4TU9A

Structure of u2af65 variant with bru5g6 dna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tu9A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tu9A02
4W92B 5DDPC 3LPYA 1D9AA 2GHPA 2DH8A 2KRRA 2MJUA 4Y00A 4PR6A 1G2EA 2LXIA 2MKJA 3G8TA 1YWXA 2HVZA 1X4BA 2DH9A 2D9OA 3SDEB 4CIOA 3TO8A 1FJEB 1VC6A 2ZJPQ 2MZ1A 2KM8C 2ZJRQ 2MKCA 3I55S 2M7SA 1X5PA 3VAMA 3K0JA 3P6YC 1WF2A 3MD3A 1JJ2R 3H2UB 2M52A 1CVJA 4TU7A 2AYGA 1NJIT 1WI6A 4QU7A 1WF1A 2RUGA 3PIOQ 2OTLS 2CQ3A 2CPFA 3S7RA 1YJNS 2PE8A 1WWHA 3CCQS 3MI7X 2DNPA 4WFAQ 5LSOA 4PRFA 1K9MT 1U1KA 1WHXA 5LXYA 3VF0B 4F26A 5GAHU 2DK2A 4QQBA 1RK8A 2FC8A 4C0OC 2M70A 3TP2A 3R1LA 2MQNA 1VQNS 2DO0A 2KYXA 3IWNC 3NMRA 2M8HA 4CH1A 1B7FA 1U1OA 2MZSA 5DM6Q 1Q86T 2I38A 1U1RA 2XSFA 2MGZA 3MXHP 1D8ZA 1UFWA 1WEZA 5IFMA 5DDOC 3RW6A 3EX7B 1A9NB 2CQCA 2MPUA 1FNXH 2M88A 2DNYA 5MLCV 1SXLA 2DNRA 1H2TZ 2JRSA 3MOJB 2KI2A 1AUDA 1HD1A 4YB1P 3R27A 1FJCA 5HO4A 3P3DA 1WTBA 3J7ZT 2AYBA 4FXWA 5GAEU 2XB2D 2HGLA 4F25A 2OIHA 2M0GB 2V94A 2HYIB 2DNOA 2KHCA 1KC8T 2DGUA 1URNA 3G4SS 3D2WA 1Q7YT 1M90T 3VAHA 2OJ3A 3THPA 2F9JA 1Q81T 3EGNA 3CCVS 1OWXA 3ZZZA 5LJ3Y 2KT5A 1FO1A 2MQLA 2OSRA 3Q2SC 1H2UX 1VQ6S 3B4MA 2O3DA 4LIRA 2G1DA 2EVZA 1KD1T 2WBRA 1QM9A 1VQLS 1X5OA 3G8SA 5GMKa 3L3CA 2HGMA 2DHSA 1OPIA 3V4MA 2DGXA 2MMYA 1U6FA 3EGZA 4U67Q 2MY7A 1UW4A 1ZH5A 1WG5A 3US5A 2D3OR 2KN4A 4OZ1A 2XS7A 2VOOA 2VOPA 4UY8T 1U2FA 1UAWA 1VQPS 3MURP 2LEAA 2YWKA 3SXLA 2LECA 3FEYB 3JB9k 1Q82T 2VODA 2DHXA 1XN9A 1WHYA 2MXYA 2N3LA 3U1LA 5DDQC 2JVRA 2BZ2A 1VQ7S 1A7GE 2M9KA 3G9CA 3CCJS 2JVOA 2DNZA 4CQ1A 1S79A 1OO0B 2RQCA 2KG1A 2CQ1A 5JVGQ 1DBDA 2CQHA 2CPEA 2E5GA 2DGSA 4TLQA 4YUDA 1SJRA 1YIJS 1K8AT 1KOHA 5ITHA 2DNGA 2JWNA 1X4FA 2L9WA 1X4EA 4Y0FA 2Q79A 2MZJA 3MUMP 5IM0A 2KH9A 2YKAA 2RRBA 3UD3P 2DNNA 5LSLA 2MB0B 1YJWS 5HL7Q 4TU9A 2KM8B 2ADBA 1BY9A 1HA1A 2RS2A 4UQTA 2CQPA 3S8SA 1WELA 2MKKA 1WG1A 2KXNB 2NLWA 3P49B 5D77A 3CXCR 2LEBA 2AD9A 3VAJA 1WEXA 3VAIA 2MSTA 2VONA 3SMZA 3CULA 2MKIA 1NO8A 1N52B 1JMTA 2RQ4A 2KG0A 1VBYA 1VQ5S 1WF0A 1X5SA 2CQ2A 2DNKA 3DLLQ 3NNHA 1U1QA 5H1SV 2U1AA 1WHVA 3CC4S 5D78A 3NNCA 2DHAA 2X1GA 2KXFA 4LJMA 4C4WA 1VQ9S 1VQMS 1R8HA 3CD6S 5GVQA 2CJKA 2CQ0A 4A8XA 1X0FA 2DNHA 3MDFA 3VAGA 3P5TL 4CH0S 2CPXA 1FXLA 2DO4A 5JVHQ 5FJ4A 2MZQA 1UP1A 2J8AA 2BOPA 3BO2A 1M5PC 5CYJA 1S72S 3DXBA 2YH0A 1SJ4P 2OSQA 5GAGU 2XS2A 2XNQA 1R8PA 2U2FA 3LQVA 1VQ8S 3NS5A 3S01A 2RU3A 2N82B 2JX2A 2CPIA 2CQ4A 3UD4P 2CPZA 2RS8A 2QEXS 2DB1A 2CQIA 3BO3A 3R1HA 3CCRS 2KU7A 2MQMA 1JJ4A 4WCEQ 4WFNQ 2E5IA 2FHOB 3SDEA 3CMES 2ERRA 4QPTA 1M5KC 2MGZB 1DHMA 1KOOA 3BS9A 2MZTA 5DETA 4ZKAA 2J76E 1YJ9S 3CCUS 2DGOA 3CF5Q 2MSSA 5DM7Q 2RRAA 2QFJA 4FXVA 3CPWR 1VQKS 4P6QA 2MZRA 2G0CA 2RVJA 2CPHA 3G6ES 3VAFA 4V19X 4TU8A 2X1BA 1HD0A 3MUVP 2M8DB 2MYFA 1YITS 4RU2A 2G4BA 2RT3A 4F02A 1W2BR 2F9DA 2MKSA 1X4DA 3HI9A 3H2VE 3B4DA 2KRBA 4WIIA 2DGWA 2DGQA 3BEGB 4IOAQ 1X4CA 1SJ3P 2L41A 2ADCA 2YTCA 5LXRA 5CA5A 1SJQA 2MQPA 2A3JA 2PEHA 3FEXB 2NZ4A 4WKRA 1U1NA 2AYMA 2LYVA 3UCUP 2FY1A 2EK6A 2CPDA 1WEYA 2J0QD 2M2BA 1H6KX 1U1MA 2L08A 4LMZA 1RKJA 2E5HA 2D9PA 1ZZFA 3UE2A 3N9UC 3CUNA 3PIPQ 1IQTA 2DITA 1N88A 2M4MA 1M5VC 1X4GA 1M5OC 2LQ5A 3CCES 1L3KA 2J0SD 2QA4S 3CCLS 1U1PA 1ZZNA 2DIUA 1P27B 2CQGA 2E5JA 3U1MA 1SJFA 2CPYA 1PO6A 1N8RT 2UP1A 1YI2S 3ZZYA 2CPJA 3G71S 1OIAA 3Q2TC 2DNQA 2EK1A 3VAKA 2KVIA 1FHTA 2N3OA 5GADU 2I2YA 1NU4A 4J5OA 2XS5A 2DGVA 2K3KA 2HGNA 1PGZA 2N7CA 1N54B 5EN1A 3OW2R 1WHWA 2MY8A 2DNMA 2FC9A 1WG4A 2CQBA 1YTYA 2OTJS 3VALA 1FJ7A 2KFYA 1VC0A 2DHGA 1VBXA 1VQOS 1P1TA 1X4AA 3S6EA 2LMIA 1QVFR 2MJNA 2LCWA 2CQDA 4PKDB 2AYEA 4ED5A 4C7QA 2SXLA 1X4HA 4IO9Q 2DNLA 3CTRA 2LA4A 2K8GA 2MKHA 4WFBQ 1JJHA 3CC7S 3CMAS 3I56S 1VBZA 1KQSR 1VQ4S 5IM0B 2FPHX 4OZ0A 5BJRA 5LJ5Y 2DH7A 1K73T 4BS2A 4W90B 3ULHA 3THTA 1YHQS 2B0GA 1WI8A 3UCZP 2XNRA 2MHNA 1DRZA 2X1FA 2DISA 5DDRC 1F9FA 2X1AA 3RW7A 4M5DB 4EGLA 1FT8A 1U6BA 1DZ5A 2F3JA 3MD1A 3TYTA 2GO9A 2MQQA 2DGTA 2MQOA 3NNAA 3BO4A 2ZJQQ 4QU6A 3IRWP 2HZCA 2LKZA 4Z2XA 2RNEA 1U1LA 4WF9Q 1O0PA 2LA6A 3MUTP 3CCMS 1HL6A 4IOCQ 3G96A 3CCSS 4IUFA 5IQQA 2DIVA 4YOEA 1VC5A 1M1KT 3UCGA 4ERDA 2KXHA 2YH1A 3CC2S 5CXTA 2E44A 3J7YU 1H2VZ 2LXUA 1X5TA 3HHNB 3UWTA 1QVGR 3NS6A
chains in the Genus database with same CATH superfamily
2B8PA 3ADAC 1K47A 3ET6B 5KFRA 3M8PB 4ES2A 1R0BG 1MU2B 1T9XA 1N56A 4CIOA 4B9UA 3IFEA 1SB6A 2E29A 3MCNA 4DL3A 3VTIA 4WYLA 3I0SB 2IFXA 2KT2A 1KDNA 2D69A 1RTHB 1NJIT 2BUNA 3CJTA 2VC1A 5MAOA 1NK5A 4ECUA 4KHMA 3SCLE 4AD6A 4ETXA 3OL9A 2APOA 2AMCB 1NDKA 2YX1A 2OPPB 2MZSA 4CM0A 3H4DA 3NEKA 2MGZA 3G2XA 1Y11A 3ENQA 1Y4ZB 3D9BA 4EBEA 4X4UA 2VG6A 5BYSA 2O1PA 2QL9B 1NRKA 3AOAA 1FJCA 3BSAA 1SUQA 2EC2A 3AQPA 5E3AA 2FB0A 3ZZZA 1RT3A 5KFOA 3T6JA 1I3OB 1QSLA 3VR1A 5KFEA 2DHHA 3QLHA 3KK2A 3B4MA 3U27A 2E7XA 2FJWA 4DV7F 2V4QA 3OFGA 1VRQC 3Q83A 4NRUA 4A8KA 3UQSA 5EWEA 3TZZA 2GIFA 3ENAA 4DF4A 4FDFA 2F4VF 4F2SA 3OD2A 4KTQA 3SEOA 5A8RB 1VGYA 2RDIA 3IP0A 2R8GA 5A6WA 4NLUA 2XLIA 3I96A 4OMFG 1WHYA 3U1LA 4PCQA 1VQ7S 4X62J 5J1PA 3F56A 1KONA 5DLGA 1NDPA 4Y2KA 4DV4F 1FCAA 3DRXA 4YY3F 1EX8A 1HARA 3EUNA 2HAIA 4TLQA 4YUDA 4QWDA 3AODA 4CLUA 2VC0A 5HK4A 2RRBA 1OSDA 2K1RB 2HKEA 4DSJA 4F8RA 3OJUA 3TEHB 1RACB 2ZZNA 3HKZD 4XDCA 3SQGB 1U25A 1S48A 5D77A 2H51B 2AD9A 1RWWB 1FKPA 4N5SA 3DLKB 4NYZA 4M5MA 1Y5IB 4ANCA 1DQ9A 2X1GA 3V6KA 3R5DA 4R5PA 2IC3A 1W25A 2CZ9A 1LWFA 3BKFA 4B9VA 4USUA 3JTPA 4DV5F 2W7AA 3GONA 2ALYB 2CPIA 1LWCB 1S6QB 3OTEA 2EI5A 3ET6A 3M8PA 1WOOA 1MU2A 2I9SA 4WFNQ 3W9JA 3KHRA 5IWAF 4DV2F 2BQUA 5D0GA 4M5GA 2DRBA 2XMKA 3R6GB 2MZTA 1TAUA 3I0SA 2QA2A 1RTHA 3GIIA 5I42B 3HPOA 1Z4UA 4TXSA 4KT0C 4U8YA 1IBLJ 2G4BA 4F36A 4QPXA 1Y00A 3GYGA 2GJFA 3B4DA 1Q8LA 2UXBJ 1GTHA 4IOAQ 2R7UA 2VFUA 5CA5A 2YPYA 4NE9C 2LYVA 1FWLA 2OPPA 4FVMA 2CPDA 1NB7A 3VZHA 5M2UA 4C97A 3GB0A 3IBFB 2B7BB 4A8SA 4OV6A 4PXCA 2PI4A 4OHYA 2GC8A 5HMZA 2CXEA 2B4UA 2E5JA 4ID8A 2Y8YA 3DU5A 1O6XA 1FHTA 2NCKL 5AT1B 1H98A 2HNDB 1FRIA 5B0GA 3RJMB 3J7Z5 4DSKA 2KFYA 1VC0A 4CLWA 1VQOS 1I5OB 1RWKB 1YBAA 3FSXA 2LA4A 1VK8A 1GXTA 3A3NB 1VBZA 2FPHX 4OZ0A 1NK0A 4KRWA 5HJXA 1TVRB 4CRJA 1RWUA 5A8RA 3WX4A 3B54A 4M5NA 3M8RA 5KG6A 1G6BA 1PC5A 1U6BA 1PYOB 5IT9U 2DPJA 2VPXB 2HFSA 4K7QA 3QRPA 1NH7A 3QT7A 5AJ3J 4M5KA 3CCSS 2XZDB 2IDEA 2FVQA 5KFIA 1OYDA 4DZDA 1UKUA 2K1RA 1IKYB 2WHOA 1FFGB 1CPZA 4TNOA 3FCHA 2GFFA 4NLPA 2MLXA 3SQGA 1G2EA 2YKPA 5IS2A 1J27A 3DLKA 4PXDA 1B70B 2HFZA 3CGIA 3TZYA 1XC9A 3PJ9A 2A1BA 1JJ2R 3U02A 4TU7A 3BYPA 3PIOQ 1GMWD 3CCQS 4P2MA 5H9EK 1SQEA 3ZFVA 3DI6B 1RT7B 5D4OA 4NOHA 2QN6B 1LWCA 8RUCA 1S6QA 4F0HA 1DFDA 3JAMY 1TTHB 2E5LJ 3R1LA 2MQNA 2FVSA 4QOTA 3W65A 2R7VA 3RW6A 1EARA 1PAUB 5CCMA 1SQFA 2BABA 5I42A 4ILMA 1T9YA 4FBUA 5HO4A 4ZVEA 1RT1B 3LALA 1L3SA 5JXSA 2WONB 4ED4A 1DY3A 4IQMA 1QAYA 1ACMB 5A6PA 1NH8A 1Q81T 1F5BA 4J9UE 3KFWX 3TX0A 1U6ZA 2IPOB 4MKAA 3CJQA 1UZDA 2V8PA 2O3DA 2D3UA 2FDNA 4G65A 4UZBA 1KD1T 2BXJA 3L3CA 4PG7A 3ICLA 2MMYA 2GS8A 1U6FA 4ZJQA 1J2VA 3MFIA 1RCXB 3FBEA 5KFVA 3E3XA 2R7OA 4J9RA 4JYAF 3OVSA 2HNDA 2HK2A 1UFKA 2J6UA 4P72A 4X66F 2VFRA 3DU6A 1OMSA 3P96A 4DR4J 1PJ6A 1LQ9A 1P9YA 3JSBA 3PRBA 2IM2A 4NXNF 4F0KA 3ZNUA 1TVRA 3W1YC 1HA1A 3BQ2A 4HHJA 4NASA 2VIHA 4ED2A 1NO8A 3K57A 3CC4S 5F9LA 4NA2A 2XYHB 1FRXA 2VG5B 3MDFA 3N6MA 2YNHB 2DO4A 4M95A 1S72S 4ZVPB 1IKYA 2MLYA 2P6SA 3KLEB 4HDGA 2R2UA 2BRKA 2YWHA 3KKFA 3BB5A 3BPDA 3CCRS 1T7PA 3CNQP 2ERRA 4CLLA 1IR2A 4DPTA 4QW8A 4DN9A 3OFEA 3BGLA 2GIRA 3EPIA 2RRAA 3CDEA 1RYRA 1XNRJ 1U8SA 2YKNB 3JXOA 2RVJA 3T1YF 2Y1RI 5B0CA 2BJ7A 4XDDA 1LOUA 2QMWA 4PWWA 3DI6A 1KFSA 3M8ZA 1RT7A 4FYVB 4ANEA 3T1HJ 1GXLA 1DTQB 5LXRA 4JI6J 5D3GB 2E1MC 1H6KX 1AFIA 4ZVTB 2H9ZA 3RRGA 1S10A 4F3OA 2F65A 1TL1B 3CCES 4JUZA 4KV8B 4I56A 2E9ZA 1YK9A 4DG1B 1B3TA 1RT1A 3K7RA 3MF5A 1OIAA 1VFJA 2WONA 2RQMA 2BANB 1JX4A 1ROFA 1YSJA 1GXUA 1NU4A 3IAS9 1WHWA 3QO9B 4I0WA 1REGX 3RG6A 1TMJA 3TVKA 1N33J 2CQDA 2AT1B 2KL8A 4IO9Q 3CTRA 4I6YA 4DPUA 2GVZB 1YBTA 3T5KA 5LJ5Y 3PX0A 2KZZA 2HRYA 2R7RA 2HHUA 3WX8A 4LFAF 4ZVQB 4PPZA 3AB4B 1HFEL 1ITPA 5DG9A 3HFVA 3QT5A 4Y2CA 2EFVA 1NJXA 3G96A 1MMLA 5KFHA 4M5JA 1VYAA 2B56A 3IXQA 3JSMB 2E66A 5ETQA 3FEZA 1D9AA 1XMQJ 1WC3A 1Q79A 2F8MA 1M5SA 3EVWA 3LP1B 4C9DA 4NLGA 2D9OA 1IBCB 5HQ8A 2QGFB 1MROB 3GE9A 3QPIA 3PW4A 4J9QA 4ID5B 5CAAA 2F4VJ 3L7OA 2ZM6F 1NSQA 3NCPA 1WF1A 4LSNB 2VG5A 4GMKA 2YNHA 3PEHA 1Q5VA 2PE8A 2J9CA 1MNEA 2BE7D 3KLEA 3CJ5A 4CM2A 3OR2B 4YY3J 5ETNA 3LGMA 3HD1A 2ZOFA 1ZM2A 1EKRA 1B7FA 4ZVRB 5DM6Q 1NK7A 1BHNA 5DDOC 2R2TA 2DNYA 3ETOA 1SI9A 2YKNA 5FLXY 1S12A 4X4TA 1WTBA 3V5RA 2N4DA 1S5ZA 4DX6A 3OTOF 2DGUA 2H3EB 4ZPVR 4RWWA 3THPA 3T19A 3D4JA 1P9QC 4IH5A 2BQ3A 2IMWP 3Q2SC 4OL8A 2IIHA 5D3GA 1VQ6S 1FRHA 5IQ6A 1S0OA 3OR1B 3BYRA 4ZVFA 3SCJE 3G8SA 3I87A 4DV5J 4O4GB 1LW0B 1WJ9A 1TL1A 4KV8A 5KFPA 4R8UB 5DRKA 2KN4A 4DG1A 3W5XA 3DDIA 3U1NA 3KNAA 1UAWA 2WRMA 3C8YA 1N36F 2BANA 4C48A 2CNKB 3SXLA 1G3OA 3QO9A 2JVRA 3EZOA 4ELVA 1S79A 4O3RA 2LQ8A 2VUGA 2FHMA 5E0OA 3IN5A 3NGKA 3OT9A 4JI8J 5E5NA 3KK3B 2GVZA 1D09B 2PIIA 4DR7F 3MUMP 3NAHA 3G6VA 2OMOA 3ILIA 4DR3J 1BY9A 2RS2A 1RAHB 1WG1A 1VK3A 2OFGX 1S1XB 3DNCA 2Y0BB 1WDDA 3GJTB 2HPUA 2IJFA 3E8OA 3CULA 1B0TA 3THVA 4ED6A 3A3PB 5J2MB 3HHLD 4CP5A 3SZ2A 2VQFF 1ZA2B 2B9WA 1UL3A 3M6XA 5A2QY 3BH6B 3LOUA 2DNHA 3KYLA 2CPXA 5JVHQ 1UP1A 3ZTOA 3JSMA 3OXLA 3AOBA 1GMWA 1E6VB 4JI1F 2UXDJ 2CJQA 5D8HB 2ZHAA 2R2SA 2W7OA 4X4SA 3FCVA 5F0UA 1OY8A 1MROA 2W8KA 4ID5A 4I67A 1RWOB 2HVIA 1IKXB 4ECXA 1AYEA 2HWTA 2CPHA 4PABA 2RB7A 4LSNA 4LREA 2IYGA 1SCJB 1KQKA 2N4CA 4RU2A 2RT3A 1U24A 4IG0B 1HR0F 2OPRB 4Z7YA 3VGTA 1QSSA 5KFWA 3NGTA 4M94A 5A76A 4B02A 2A18A 3OL7A 1UWAA 3OR2A 3K8VA 1XR5A 2FY1A 4PG8A 5CD4A 2HEKA 4I6WA 2L08A 4IOBA 3HFZB 1NSAA 1HNIB 2DEJA 1BXNA 4O0IA 1WC4A 3AA9A 1SL1A 1IWGA 1SJFA 1N8RT 2CPYA 2GHWA 2HHQA 3R5GA 4DPYA 4MYUA 1XR6A 3PTWA 2C2ZB 1NJYA 4DX5A 2RILA 3NLCA 4JI5F 4GO7X 1ZM9A 3PJXA 3V6HA 2ZWOA 1S1UB 4WFBQ 4O4GA 1P8GA 1LW0A 1VQ4S 5GMDA 4R8UA 2DH7A 2XGPA 3HP6A 1RAOA 2ZVIA 3W7BA 3CCZA 3UCZP 2JLGA 5E41A 3OFHA 2VASA 4ZVGA 2QV6A 7FDRA 3VGUA 2J7KA 3MOZA 1QUVA 5CYMB 3R5CA 3GIJA 3BO4A 3OJSA 4BC7A 1U1LA 4JV5F 1Q4RA 4DPWA 2AGPA 3DRPB 2DCUB 3WC2A 5LT5A 4OLOA 3KK3A 1VC5A 5IV3A 2J6TA 2A2DA 2YH1A 2Y9HA 3CC2S 3R6LB 2VZ9A 5DGAA 5E3QA 3HSZA 4IH6A 2ZBQA 2DH8A 2DCLA 3QJJA 3DYAB 4PR6A 4EWTA 2DYAA 4EZ9A 3CJRA 2QA4G 4O3SA 1L5UA 5J2MA 3O5TB 3B8HA 4CLPA 1PSDA 2E1RA 3K0JA 5HP1B 2XY5A 4TY8B 4A8WA 1VISA 2OO4A 4JYAJ 2AHOB 1E6VA 4WXWA 2BEFA 2CVIA 1WTFA 4X66J 3ZTQA 5KFKA 3X3UA 4MFBB 1JXEA 2VQEJ 4OYOA 1D8ZA 2YNIB 4KH1B 4UZCA 4B9NA 1HQUB 3WZ0A 1IKXA 2JRSA 1YGYA 1ZTWA 5KT5A 1Y7PA 5J1NA 3R27A 1S7HA 4DUYF 3E2EA 4FXWA 2QIFA 5GAGI 3EDRB 4HHUA 2QSFA 3FGVA 4IG0A 2OPRA 1QAJA 5F8JA 1M90T 3SCKE 2YWGA 2VFSA 2VBXA 3KDNA 3CCVS 1OWXA 4B9MA 4GVBB 1OJ4A 1FWPA 5LJ3Y 4YB6A 3H40A 1TK0A 4K4UA 4ITSA 4QYZJ 1JLFB 2BACA 1JLBB 1HNIA 2UUCF 2B5JB 3V4MA 3CO0P 3KWMA 3H25A 1BWEA 5HVHA 3A8JA 2D3OR 1N4LA 1QDUB 4X64J 4Y6IA 2XS7A 2VOOA 1T3OA 1U2FA 3GP9A 1AW0A 4UT4A 3FEYB 2D41A 5KFYA 2CJAA 2HURA 2R7SA 2CQ1A 5JVGQ 5DGBA 2CPEA 3HHLB 4DQRA 4DXLA 1NMEB 4DL5A 2MHEA 3M32B 1JNZB 1S1UA 4OX8A 2CIMA 3PHTA 4EFAC 3R97A 1NK8A 1N48A 2LEBA 3VAJA 3E01B 1RT6B 3H5SA 3K89A 2ILYA 5CYMA 3CVKA 3GG0A 2OKQA 2EC0A 4RNOA 3W66A 2UUAJ 4A8YA 1ZM4A 2CJKA 2OMLA 1EZZB 3CJ4A 3D0IE 3DRPA 4OX7A 2V8VA 3DLJA 3R5BA 4ZMMA 4KIAA 4OX9J 5KG3A 1IWAA 3S01A 4X4OA 1QTMA 4LFBJ 2QYCA 3DYAA 1KLMB 3H0PA 4USMA 4WU3A 3LGHA 4C3LA 4JI3J 5KFAA 1DHMA 1NZAA 2AEMA 1FDNA 3ILJA 3ZTPA 4L74A 5HP1A 4L73A 2DRAA 1FE0A 3EMTA 4FXVA 4TY8A 3CPWR 5L1JA 4V19X 4NCGB 4TU8A 1NK4A 1HD0A 2M8DB 3KLFB 1R0AB 5J2NA 3QWPA 5KFGA 2MKSA 5I3QA 4LFAJ 2DGQA 4DPOA 2VPYB 1A6LA 3FEXB 1OPZA 3GJSB 4WKRA 4MFBA 3M1VB 1TL5A 3HHEA 5EX3A 4OJ3A 5H9FJ 2YNIA 1RKJA 2JZ5A 3I82A 1HQUA 8AT1B 1TL3B 4OX6A 1X4GA 2A10A 1CJUB 4YP3A 4GKKF 2V68A 3NG8A 4Q0BB 4HVZA 2YWEA 2UVWA 2A6MA 1FI4A 3L09A 4UOGA 4GVBA 2FVCA 1FX2A 1SH3A 3M05A 3MHYA 3PFEA 3O6QA 1JLFA 1JLBA 2AX1A 2B4OA 3BN7A 3GJQB 3Q86A 1Q95G 2B5JA 1D9FA 3PFOA 4W90B 4LF6J 2V6AA 4O3NA 3RAQA 4K8RA 2AKWB 2BJDA 1F9FA 2WCXA 5KFFA 4F3MA 5KFMA 1NJZA 2DGTA 3I9V9 3A13A 4QU6A 1LFPA 4HDHA 2BE9B 4Z2XA 4I69A 2F5GA 3HHLA 1HL6A 3CCMS 3M32A 4W4MA 3OTOJ 4BLGA 4U7UK 2FVRA 4G1IA 2R9LA 3IM8A 3NS6A 2FJVA 1PBAA 3CMQA 4AYBD 3E01A 3QSYB 1RT6A 3H5YA 3BSCA 3B78A 3TO8A 1RTDB 1FKAF 3LGNA 2VKZG 2CJBA 3KK1B 2ASDA 2MEWA 3QGHA 1WI6A 4TQRA 4QU7A 1FDBA 1N5QA 3HCXA 3DCAA 2E1AA 1RAEB 4F50A 3MI7X 3RBEA 4WFAQ 1S9GB 3AD9C 1U1KA 5BR8F 4F26A 3ITHB 4DPXA 5IT9Y 4OV1A 2FC8A 1KLMA 4OHVA 2AZ1A 1FKOB 5KOXA 2IVFB 4B3RJ 2DO0A 3NMRA 2M8HA 3GFHA 1KQGB 4LQ3A 2IA6A 2Y1LB 4EYIB 3NCRA 2ASLA 2WSEC 2FYXA 5F3ZA 3HVAA 2K7JA 4NCGA 3KLFA 1R0AA 4B3SF 5IOLA 2IM3A 1HWIA 2DNOA 3D2WA 3EJMA 4QIFA 5CCLA 2F9JA 4CH7A 4DFKA 3W61A 3FBBA 2YQ1A 2JLFA 3M1VA 3NOCA 2FVPA 5E33A 1XMBA 1BLUA 4JI1J 2JC0A 1CJUA 2H5IB 3KMQA 4O23A 2ATLA 3UR3C 1Z2ZA 4Q0BA 4D3HA 4NPOA 3DC2A 4CLSA 3L7PA 1XN9A 4P74A 1RT5B 2D74B 3EZUA 1LWXA 3OHBA 1YIJS 2X3GA 3QJLA 5B0AA 4K4XA 2DNNA 1RI7A 4TU9A 2C2OB 2ZITA 1FNMA 2CQPA 1KSPA 3T9NA 2OP5A 3GYXB 1S1TB 3PACA 5LMUF 3PNIA 4A47A 1VQ5S 5FD1A 5DG8A 3AY0A 4ENOA 3NGDA 2VB6A 3BR8A 4LJMA 5F9NA 1RUSA 1X0FA 5KOWA 3HX9A 3VAGA 4BC9A 3ILOA 4FKYA 1FTCA 2H48B 2HQGA 4ECVA 2IA0A 1U0SA 2K3IA 2CQ4A 2J8SA 3KOAA 2QEXS 2RS8A 4M5LA 5IC6B 2ZE2B 4Y2AA 3BO3A 4JV2A 2DRDA 2FHOB 2PMHA 1RTDA 1FRKA 1KOOA 3NGSA 3D6TB 4YFUA 3BS9A 1T9VA 5KT3A 4NLTA 3KK1A 3CF5Q 2MSSA 5DM7Q 4JI4F 2B9EA 3HK2A 3LUYA 4BDPA 4KE5A 4K0KJ 1HI1A 2PMWA 1HKAA 1S9GA 4YDDB 3GMGA 3M2RB 1FWKA 3BEGB 1YRUA 3ITHA 5C5JA 1FKOA 4OHXA 5KFQA 2CNNB 4YR2A 1U1MA 1HLWA 2E5HA 3N9UC 1S1WB 3Q8PB 1U26A 3CUNA 2JLEA 4ECTA 3FZBA 2VBWA 1MMDA 2VKRA 1MW7A 4BWJA 4UW2A 3C6UB 2G0JA 5KFLA 3Q2TC 3UD5A 5CYQB 3VAKA 4B3MF 2KVIA 3DRYA 1K1QA 2ZNZA 2DTJA 4LF8F 3UNYA 3HSDA 2MY8A 7FD1A 4RJVA 2BX6A 4CWBA 3M8YA 1IR0A 2YQ3A 1CG2A 2C2EA 3BV8A 1F5AA 1ZS6A 3KJQB 2Z4PA 4OYBA 2AU0A 1RZMA 2V69A 3UDCA 3LO3A 1K73T 1DARA 4ZVOB 2BRLA 2VBYA 2IRUA 4FXDA 2ZKUA 3I32A 3FC9A 2QLBB 1IKVB 5IZHA 4GKJF 4WE1B 1RT5A 3NNAA 3G86A 4N7TA 2CZVC 1C1BB 3GIRA 2EG1A 4JB8B 4RLEA 1RHJB 2NXCA 1H7WA 1PC4A 2CNOB 2LDYA 4DCJB 2XHWA 2HHHJ 2KXHA 1FJGJ 2HS3A 4OIXA 3H2LA 5D4PA 4RR5A 1QVGR 2G13A 4C8OA 3N79A 3A8IA 3FSYA 4MKVA 2MJUA 2RHQB 4NMLA 1AT1B 1SKWA 2MKJA 3TA0A 3ZZUA 1YWXA 3KG1A 1S1TA 2HVZA 4MKYA 3DMJB 4DX7A 1KFDA 4B3OB 2HRUA 5HVFA 1WC5A 2BKPA 5K5MA 1X5PA 3N01A 3GLJA 3Q8YA 2RUGA 1U7LA 2RRNA 2OTLS 1VHIA 3S7RA 2C2KB 1VRUB 4PRFA 4ZDNA 3POTB 1SBRA 2WVBA 3TUJC 1R27B 3AQOA 1V3ZA 2NSBA 2QT7A 3HLUA 2ZE2A 4ZLNA 4NLSA 1EJ7L 1AROP 1EKSA 3KHLA 5C25B 2I38A 3ZXWA 3EXYA 3PW5A 2OLWA 3TUZC 1IKWB 4Q45A 5DS7A 1FNXH 3K2YA 2KI2A 1FVSA 1YJVA 4QR1A 2ZOMA 2FZCB 3M2RA 3G4SS 1Q7YT 4ZP9A 2YNGB 4WPAA 1L3VA 2MQLA 4ZCMA 2OSRA 2BKOA 2WVFA 2ZBCA 5KFBA 4EU0A 3HM9A 2G1DA 2WBRA 1VQLS 1S1WA 2OGUA 2HGMA 4RUBA 5THWA 1SL2A 1U8WA 1EP4B 5B0FA 2AX0A 3R7SB 2W2NP 1CJVB 3C6UA 2CUYA 5AXMA 4DMZA 4LFCJ 5CYQA 4DWIA 4U6PA 2AZ3A 2MQ8A 4DR1J 1EIYB 2XULA 2CJXB 1PBUA 3OTCA 4GRSA 5RUBA 1OO0B 2KG1A 1S77D 2E5GA 1IR1A 2W7PA 4IDKB 5K8MA 4J90A 4C98A 2JWNA 4DV6J 3M8SA 4ECWA 2ZD1B 4AXJA 1DTTB 2ADBA 5KT4A 3OVAA 2EXUA 1PYTA 2O66A 1RWXB 3AD8C 1G7CB 3LP2B 1Q78A 2MSTA 3SMZA 1IKVA 3N0VA 5ETRA 3CO9A 4WE1A 3CD0A 5LL6d 4YHHJ 1TQLA 5HANA 1N0VC 1NM2A 3AXMA 3TAMB 4DDFA 1S4FA 1I1GA 1VQ9S 1C1BA 1T02A 3K5PA 4DR6J 4C8NA 5GAGU 4RUAA 3RYLA 3LQVA 4FF2A 4Q2LA 4J9SA 3J81U 2CQIA 1VDHA 2V4JB 2HVHA 1IBLF 3DMJA 2PEBA 4OI1A 4B3OA 5KFDA 3ZZ0A 1UVNA 4ZKAA 3BGUA 1TK5A 2DJWA 3MM9B 2NR0A 3D1HA 3TX8A 2GZOA 2MYFA 1VRUA 4ZJOA 3D67A 3POTA 2R8KA 3BKUA 2HBRB 4LSLB 2PEHA 1L3TA 2NZ4A 1U1NA 5L1KA 5C25A 4K59A 2R8HA 1J5EJ 1NSPA 1IKWA 4AT1B 4ED7A 4EBCA 3ILLA 2WB1D 4MIBA 3AH6A 4LVNP 2EBEA 1XEZA 4FNHA 1ZPVA 2CQGA 1PO6A 4OYIA 2GQ2A 4QYZK 3IS9B 2N3OA 1APSA 5D4NA 5LOQA 3CD7A 2YNGA 4LBHA 3WQPA 4IFVB 1VBXA 1W2IA 1P1TA 4JBCA 1UVKA 1HI8A 4RWXA 2RF2B 1FTRA 2G9OA 2RDDA 2WOMB 2DY1A 1KTVA 1RU2A 1JJHA 3CMAS 2CFXA 1EP4A 1S1VB 1JIHA 3NS7B 4BS2A 2JJ4D 3EM1A 1CJVA 2AF6A 4KKOB 3MZIA 4F0MA 4UOHA 1MWQA 4JI7J 5KG5A 3CJ8A 2CYYA 4WP9A 3EDQB 1WDTA 2M5YA 2ZHOA 3I9ZA 1O0PA 3J7A1 4IDKA 2FD2A 2XMAA 2C3UA 1WC6A 5C42B 5KFTA 4AL5A 4ZLPA 1GH8A 4WYWA 1WC1A 4URGA 2ZD1A 1WC0A 1HIYA 4TQSA 4E0DA 2LXUA 1DTTA 1SH0A 1CEZA 1UVLA 2I0XA 1OSCA 3D3CJ 4ETZA 4DR5F 1F0XA 3F73A 2ZHBA 3HT3A 3KLIB 3TAMA 2HBQB 2IBKA 1CVJA 1XJWB 2AYGA 1QTNB 3QGPA 2E5LF 2VFVA 4USHA 1XTZA 3KLVA 3VCDA 2Y0SD 4AE5A 3OTDA 2WK4A 3FBCA 4TKTA 2KYZA 3IWLA 1FVQA 2QSWA 2Z8QA 4URSA 4OZ5A 2V4JA 2HWHA 2EW9A 1QUPA 1UEVA 1CQMA 1AZSB 1XIQA 3EX7B 2CQCA 1SH2A 2MPUA 1UPMB 4J9OA 4P10A 4N77A 4ECSA 3MM9A 1KR4A 1TL7B 4RZRA 5GAEI 3HFKA 2XI3A 1FFSB 2PO4A 3RGIA 1TELA 5H9FK 3KMSA 2YBVA 4K4YA 2FHJA 4LSLA 4NXMJ 2C2DA 1ZOTA 4JP8A 4RPFA 5KTQA 4JV1A 2VA3A 2H1YA 2EKNA 3PO4A 1N32J 3TRGA 1HQEB 2UU9J 2AJFE 3QT8A 5ETMA 2WTFA 2B6AB 1G1XA 4CLFA 2XM3A 1CJKB 2ZH4A 4U95A 4QIVA 2W4PA 1NAQA 4DSLA 4DR4F 2L9NA 3IS9A 2ZVSA 1XBWA 2YWKA 2Q6CA 4IYQA 4IFVA 1A7GE 3G9CA 2JVOA 4CQ1A 5HQLA 2RF2A 3VQSA 1DBDA 2WOMA 5HJYA 2PT0A 3P5BP 3PV8A 4J9LA 2AJ0A 4Y0FA 2KH9A 1XERA 3V6DB 2ZDOA 1S1VA 1V6HA 1ZAVA 1TL4A 2XHCA 2KM8B 3GU0A 2Z58B 4USKA 4KKOA 3WC0A 2KXNB 3G6YA 2AP6A 4DFJA 2BOAA 3MTKA 2QFIA 2FIUA 3FDSA 4P2SA 4J9PA 4LRFA 3N28A 3PEJA 2XBPA 4U7CA 4DL2A 3BBBA 1HNXJ 3ENWA 4I2PB 2NYIA 5C42A 3BO2A 3VV2B 1EQ0A 3VGVA 2W2PP 4AFFA 2IVYA 2H54B 3NS5A 4EMDA 3N4WA 4NL5A 2DR6A 2FZGB 3CMES 2VJUA 2BVZA 3IR6B 3HJVA 2RH3A 2CRLA 3KLIA 3DDNA 3T1HF 2KJWA 1SL0A 2J76E 1NHUA 1IQZA 4ANDA 3HXMA 1FD2A 3TR5A 3WIUA 3Q24A 2JEFA 1RLDA 1LWEB 2QJ3A 4QZVB 2RJZA 4GKJJ 1RLCL 4WIIA 1Q53A 3A1YG 4LRBA 1SJQA 1T95A 2RSQA 2AJ1A 4I64A 1JB0C 1QD1A 3M6UA 4J9KA 1AZSA 3D0GE 1Y10A 2GAGC 1RTZA 2DITA 2UUWA 1TL7A 2LQ5A 1U1PA 4CDIA 4ZPDA 1U0HB 1N33F 2ZH6A 2EKYA 5F3TA 1U45A 5GADU 2HNYB 2XS5A 4QW9A 4N76A 2EFGA 2EFNA 4TY9A 1YKWA 2JDJA 3OL6A 4PKDB 4CLZA 1HQEA 4KC5A 4XIUA 1CJTB 3PHEA 2B6AA 1IJEB 1MSWD 1CJKA 5DQGA 3GYNA 4H4KA 3KHHA 3K5MA 2XNRA 1P1LA 5EX0A 1Q0NA 3LAMA 1FT8A 4P75A 3H42A 5IT4A 4PYDA 3CIMA 2MQOA 4PXBA 3IRWP 3B6BA 2LQBA 1XMQF 1NDCA 2HHPA 3KDOA 4IRCA 3QIDA 1T9WA 2QRRA 3MEDB 3V6DA 2Q66A 3J7YU 4KHPJ 4V19J 1DLOB 2UXCF 1DAXA 3UWTA 1G4CA 1FXDA 3RBDA 2AQ4A 4R0EA 3CE8A 2DH9A 4ECQA 1BD6A 4RL1A 1IBMJ 5F8NA 3W60A 2ZJPQ 2MKCA 3I55S 3SSSA 3VAMA 3RR8A 2Z2YB 2DR5A 5F41A 3MD3A 3H2UB 2M52A 2ZWPA 1EAYC 4CLTA 4I2PA 3FSIA 3EGWB 1B0VA 1UETA 2B7CB 5L1IA 4I2QB 3H5UA 2NSCA 3D66A 1V9OA 4OHZA 3AFGA 3HO1A 4DX8H 4PG6A 3MXHP 4X84A 2OPSB 5IFMA 2PA8D 3TUPA 4OZJA 3JSRA 2ZDPA 2QYGA 4O44B 2AEJA 1LWEA 2HGLA 3TZXA 4BHQA 2OJ3A 4IO1A 3PW0A 3E51A 4K2XA 3LTOA 4K4SA 2PD1A 2DKOB 3C15B 4H4MB 2GJIA 4QYRA 2K2PA 5GMKa 3K59A 4M5IA 1AA1B 3KLGB 3HZEA 2FGOA 3W8GA 4P2XA 1U0HA 1E6YB 2ZZMA 1DURA 2FJXA 3PZPA 2W4CA 3MURP 4JI8F 1NJWA 1PG5B 5CQGA 5JJBA 2HNYA 4RW7B 3O1LA 3SFGA 4DR3F 4USTA 4NLXA 5HN0A 1S0VA 3NBPB 1CJTA 4JI0J 2W25A 1CS4B 4ELTA 3PYDA 2XCAA 1Y0HA 2XC9A 1NLKL 5K8PA 5HL7Q 3EXCX 1TKZB 4DZ6A 2YKQA 2OI2A 2XTJP 3BDEA 4O3OA 3RR7A 4FF4A 3DLLQ 2BJ1A 2UXDF 3NGUA 1VQMS 1FDDA 1M1GA 1FXLA 5FJ4A 2MZQA 3MEDA 3Q8UA 1DLOA 3IMQJ 2DXEA 3UVJB 5F8IA 3QFWA 2W9AA 1NPRA 2VH7A 2GAHC 3FK4A 3MGJA 2BE2B 4LF5F 4KPYA 2DR7A 4PXEA 4F4XA 2HIYA 4PQAA 1YJ9S 2V2QA 3LF0A 4USWA 3ISNC 2VD3A 3QJPA 2XYGB 2ZBPA 1JNRB 3R9LA 4IR9A 4NYOA 4I2QA 4WZMA 3IR7B 3DXSX 4XAKA 1GEHA 4IG3B 2RQKA 2BJ8A 4RX6A 4MTPA 3KNGA 3UCUP 1YRXA 2EK6A 3RUBL 2J0QD 3DGPB 2OPSA 3QFHA 1T94A 1IQTA 1N88A 4M1KA 2C2MB 2BR0A 4HLBA 2AJQA 4O44A 1DJ0A 1U02A 4DR5J 1P27B 2LDIA 1JLGB 5DQIA 3TW0A 3ZZYA 1WKLA 2IRXA 1HW8A 1KEKA 4K5RA 1PGZA 1N54B 4DU7A 1FJ7A 2GV1A 5A8WB 4WTYA 3C15A 2H65B 4H4MA 2BJEA 1R8BA 1UW9A 3N6LA 1TKDA 5F8MA 4OI6A 4DI6A 3CC7S 3I56S 3KLGA 5E2QA 1E6YA 5KFJA 4XTTA 1X9SA 3MEGB 3BQ1A 3M6VA 4LUBA 3RBXA 3HVRA 3W5YA 4RW7A 1WORA 3MR7A 3MR6A 1NK6A 2JH3A 2MQQA 5IV4A 2B4VA 4QWCA 4Y2IA 1RABB 2ZJQQ 1EETB 1Q7LB 2LA6A 3NBPA 4EI2A 3BR9A 3FJ2A 1S49A 2OD4A 4DLGA 3ZZRA 1CS4A 1M1KT 3UCGA 2I1RA 4PZVA 1MLAA 3GV8B 4ECRA 2ASYA 4JV0A 1TKZA 3A8EA 2NPIA 1YJTA 2Z57B 2OHDA 3MM6B 1HBMB 3Q8RB 4ZP8A 1VC6A 4OZ2A 1SC3B 3MPUB 5KG1A 3AA8A 4KGZB 4DJBA 3CJ2A 2VQEF 1VJQA 2G2OA 1WWHA 4OZLA 3H90A 4L76A 4UUWA 1GMUA 4O3PA 1FERA 3UVJA 3AT1B 3GJRB 2CJYB 4HHHA 4ED8A 2BE2A 5DZ6A 2FJBB 3CWJA 4OI2A 3FQLA 4PAAA 3SFUA 2VBZA 5B0DA 2R2RA 1BC6A 1SXLA 3BGRB 4LBPA 1H2TZ 1WOPA 4KYZA 1V3RA 2A0FB 1IM6A 2XSJB 2GGPB 5CZVA 1ICEB 4ZP7A 3ZNJ1 3C14B 4IG3A 3TQ1A 4ZS6A 3KLHB 4A8OA 3I4HX 4X64F 1R89A 3DGPA 2KFNA 4NLVA 1O5JA 2WSCC 1UJ5A 1C1CB 2UVVA 3FFIB 5ETKA 1JWWA 3TZWA 2MY7A 4U67Q 3JYTB 5C2GA 4OZ1A 1N34J 4H54A 1JLGA 2ZH1A 4QCLA 4UY8T 1VQPS 2DBBA 2KZMA 5A8WA 1R31A 2BZ2A 4HR2A 3NCQA 2HBZB 3JQJA 3BJYA 4OZ3A 2GMLA 3PO5A 2IYIA 4HTIA 2UUAF 3IGNA 3TJAA 2V8DA 1RGVA 3C3LA 3MEGA 4DCOB 3PW7A 1NHKL 3DOLB 2VONA 1VBYA 4OX9F 3I0RB 2JEIA 3IC1A 5ETSA 4LFBF 1B4SA 4C4WA 4N47A 1EETA 3GWCA 5D6GA 4JI3F 3ZZOA 3QIPB 4Q5VA 2J8AA 4DV3J 1MN7A 1UCNA 1RJJA 2VDHA 2HHXA 2U2FA 4LF7J 3L7UA 3MPDA 1XWLA 3KG0A 2FJAB 2QX0A 3MM6A 3QGGA 2ZC3A 2PFFB 1HBMA 3DHXA 4OYMA 3TARA 2MLZA 4QR2A 5I3UB 1XMOF 4P2FA 2C3OA 2PGCA 2GO8A 4ZPCA 1HWLA 5DETA 2QLJB 2GCFA 1C4AA 1VQKS 2DD8S 2G0CA 2XMMA 4NZ7A 5CHCB 1S59A 1OY9A 5F8GA 1W2BR 3MPWA 4F4ZA 1R0CB 3HI9A 3RRKA 3GCXP 3NGRA 2K7KA 3PYEA 1X4CA 4DFPA 4GO5X 2HLUA 3L4BC 4K50A 1HNZJ 4ES1A 1V3SA 4XPCA 3K58A 3IBCB 3BGRA 2UXCJ 4PWDB 2VHGA 1L3KA 4Z7CA 2XSJA 1WNEA 2BMBA 2DIUA 2GGPA 4Q8FA 2UP1A 2HQIA 4HEA9 1UVMA 4KY3A 3C14A 4ZITA 1K0TA 1SKRA 3KLHA 2DHGA 4LF6F 1PJ5A 2HNZB 4FBTA 3M2UB 3DLHA 3QATA 4ED5A 2BBEA 1QJHA 3CDAA 4CT8A 3PW2A 1X4HA 1VI7A 1C1CA 2CNLB 2Q6BA 3DKDA 3FFIA 4QWEA 2HMIB 5ETLA 2KFZA 3JYTA 3T6BA 1MWZA 3W8PA 2N7YA 4U7UD 4FF3A 3N5FA 3K5LA 3RRHA 2DISA 2CZ4A 4I1TA 1Y5NB 2NXEA 2X1AA 3RW7A 1CC7A 2XLKA 2E7WA 2BQRA 1LW2B 4EEYA 5AE3A 4C8KA 2LKZA 2QE5A 3KG4A 1UEKA 3PCOB 2C28A 2VICA 4USVA 4ERDA 3R7NB 4HH1A 3PKYA 4A4JA 4HACB 5DG7A 4EO6A 4LRDA 5DDPC 3WDOA 1GT8A 3H4BA 4MK7A 4LT6A 3HMJG 3RB3A 2C3PA 3DOLA 2R7QA 4ER8A 3MMCB 4IFYB 4FKXA 3I0RA 3M30B 2FUG9 2A2CA 1S9FA 3PYGA 3AJ2A 2VF3A 3B82A 2CDRB 3BSOA 4B3RF 4LF9J 3AJDA 2NXNA 3QIPA 4F3QA 3OXGA 4P52A 2OEMA 2XGQA 5LSOA 2AEFA 3CSKA 4OFZA 3EPGA 2BM0A 1XNQF 3VZIA 4CO2A 2ZH8A 2Z2ZA 1RTJB 2M70A 2IM0A 2KYXA 1REVB 4LR7A 1AXQA 4UOCA 2I5JB 4L3KA 5I3UA 2ZH3A 4QBUA 2LFVA 2V9WA 2M88A 1URRA 4I7FB 3D6MB 4KGMA 2JC1A 4DFMA 5SUHA 3NWGA 2V5HG 1HNWJ 3NL0A 3HULA 1RAGB 3SV4A 4Q7AA 2QC3A 3UPFA 1FXRA 3VAHA 5IT0A 3JS9A 2F40A 3TA2A 4F4KA 1S97A 1FO1A 4EO8A 5BYQA 1H2UX 2B51A 2BV3A 4OLPA 1MG7A 2DT9A 4LRCA 3HHKA 3OBIA 4FS1A 4ZLJA 4PWDA 4ECYA 3VVTA 2KO1A 3EZ5A 1ZH5A 4TVAB 4IQXA 1Y3KA 1HHSA 4LF5J 3DOMB 1HWUA 4A8FA 4ILLA 2LECA 3JQKA 1B64A 1TUWA 2CA9A 3ZO7A 2HNZA 3JQMA 1HBNA 4R25A 5D15A 3M2UA 2RQCA 2V2ZA 3G82B 1JLEB 3GV5B 4DL4A 3PRDA 2HMIA 1UEUA 1IN0A 5LSLA 2MB0B 3D6FB 1T0TV 1NDLA 2FLLA 3GTYX 4H4OB 3CDWA 3DFEA 3M4XA 3VAIA 5IC4B 5A0YB 4UUXA 1GMVA 2XO7A 2L3MA 3LP0B 1N5TA 3A8KA 1QLNA 1LW2A 3J81j 5KFNA 5J1EB 2QL5B 2DHAA 1BQXA 3MWBA 1SC1B 5CH7B 3AAWB 2HW3A 5C24B 4NWBA 4E2FB 5HAOA 1RE1B 3D1QA 2OSQA 3PDNA 3F44A 4HACA 2HFVA 2HQCA 4AQYJ 3UD4P 4KB7A 1VIOA 1RA7A 2LP4A 1BE4A 2KVQE 4DV1J 1UFLA 2MQMA 3MMCA 4IFYA 3VHQA 4K0KF 1AB8A 3LWMA 1JXLA 4YR0A 1X0PA 3M30A 2GNKA 2L9DA 3CCUS 1ELOA 4DL7A 2X51A 2GHVC 3VAFA 3KTQA 4Q2MA 3QBCA 3HSGA 4UTGA 1RWPB 2CWXA 4LR8A 1YX2A 4ATNA 3H2VE 1ZAWA 2KRBA 2D7SA 1Q16B 1SKSA 3DDKA 2Z30B 4ZJLA 1RTJA 4DUZF 1REVA 3C6TB 2I5JA 3D0HE 2GX8A 4RUHA 4G1QB 4UQGA 3AB2B 1M0SA 3UE2A 2YNFB 4I7FA 2M4MA 1Z2LA 3AXKA 2H5EA 4J9NA 3FKBA 2MTLA 4C8YA 5J2NB 2R4FA 4OJGA 3SI8A 1SQGA 3UI3A 2KT3A 1WG4A 4TYBA 1JKHB 2LMIA 2Q3PA 3TJ8A 1Q1KA 1Q8IA 1R8AA 2FLPA 3GPAA 2YX4A 5G4DA 1F9EB 2R8JA 3P4UB 3C66A 2PFDA 4QWAA 1YHQS 2B0GA 4FS2A 1WI8A 3DOMA 5C2CA 3H7HB 2C3YA 3GR0A 4B9LA 2MHNA 3PY8A 3F0NA 1O51A 3BBFA 3AD7C 3DRRB 1S0NA 2LLZA 2HHHF 1FJGF 2F3JA 2KB2A 4U96A 1JLCB 1UVIA 2R7TA 4MMOA 3G82A 1JLEA 4KBIA 4UF4A 5IQQA 4F4YA 2P8IA 4O3QA 1TUVA 4GC7A 3A12A 1YZ7A 4O4RA 2KDOA 3FRYA 2AJ4A 3CJSA 4H4OA 2LXIA 4X65J 1GAOA 5A0YA 3LP0A 3W9IA 1RADB 5E3RA 1PAEX 4WU2A 4ED3A 5J1EA 4RNMA 3P6YC 3SSRA 2JFDA 3QRRA 5C24A 2IHR1 3HJFA 4C3KA 2F63A 3TVZA 1U09A 2FZKB 2K06A 3CCTA 3RBZA 1RAIB 2DR8A 2NQPA 2NXJA 2C22A 1CLFA 1WSVA 5KG0A 4CH1A 1VLOA 3OLBA 3LWLA 2RKIB 4ZOSA 2UUBJ 1BGXT 4RU9A 2O67A 4KPCA 2KKHA 3MTJA 1UZHA 5MLCV 1L3UA 3V81B 5K8NA 3EICA 3MM8B 4DOZA 3BPSP 3FCWA 4LF2A 3P3DA 3MR3A 1WD6A 3P8BB 1SV5B 4Y3CA 3W63A 4ZVHA 5K20B 4G1PA 3C6TA 3H98A 4LFCF 1BQMB 4G1QA 4EBDA 3BDPA 1KHVA 2RU9A 4JOUA 2YNFA 1I94J 4DR1F 3NXZA 4DN0A 3I5AA 2H4YB 2B9XA 1WG5A 4K2JA 3R2CJ 1FDAA 2OPQB 1U2RA 2B9YA 1F1BB 4QIGA 3UW1A 1XMOJ 3FQKA 4DV6F 2QO3A 3JB9k 4RNHA 4NMXA 1JKHA 3DHWC 5U47A 3GCWP 2ZC4A 3OQ2A 1JJCB 4LF4F 1AFJA 1SJRA 4NLWA 4DV0J 2ROGA 4C8ZA 1X4EA 1VMBA 3UD3P 3UR0A 3UN2A 4YHHF 4DQIA 2HS0A 3IA0A 4WTOB 1TFWA 2DEIA 4FYXB 2Z2MA 2FLOA 1EHWA 2NLWA 4ED1A 3P49B 3DM2B 3SIPB 4DR6F 3DRRA 5G0RB 1HYSB 1JLCA 4B3TJ 1U1QA 2UV8G 1WHVA 4X4QA 4WP3A 2FTRA 1S9EB 2KXFA 4TYAA 1B99A 2CQ0A 4A8XA 2HG4A 3CJ3A 3TWZA 3P5TL 3K5NA 3OSPA 2BJ9A 3KJNB 3KUGA 4C8MA 3TAPA 2OD6A 5FDLB 2PI5A 3V6JA 3RZAA 5LMNJ 3T1AA 1HBUB 2ZNYA 2UUTA 4NA1A 3LANA 2FGCA 1SIZA 2LEPA 2MZRA 3T5LA 1M5HA 3MUVP 2V0NA 1YITS 4A46A 2RE1A 4KAIA 1J5EF 4JI2J 2XY6A 1TU0B 2DGWA 2RIJA 1T8EA 2ZKTA 2L41A 7AT1B 1T05B 2AYMA 5B09A 2RKIA 3ENVA 1FK9B 2M2BA 4OI4A 2ACMA 1M1HA 3V81A 3S1TA 3MM8A 1W26A 1VCTA 2W4DA 1NZ8A 4OYPA 2AGQA 3TANA 4QIEA 2AWZA 3H20A 4LVOP 2CPJA 2XI2A 3G71S 3PVXA 1SV5A 3L9ZA 5GAHI 3Q89A 4ZIWA 1GNKA 4X4VA 5F0WA 1RHRB 4NX9A 2DGVA 5L38A 4OYXA 2DNMA 3W64A 3QMQA 2DVIA 5HMYA 3I31A 5JMNA 1BQMA 4CO4A 3D1OA 2ZH5A 1X60A 2B43A 4JI7F 4QJVA 1D0EA 4AXIA 4WWSA 2GIQA 4PPDA 5C7PA 1X31C 3Q8VA 1XNQJ 1IBKF 4FNIA 2V4RA 3THTA 2ROPA 2J0XA 2OPQA 2Y1JA 2E1CA 1WACA 4DL0C 1DRZA 3FMWA 3NY0A 4DSFA 2J9DA 2H4WB 2XMJA 4YDXA 4H4KC 2WSFC 3D6HB 3SQOP 2RAQA 2LQ9A 4ZPBA 3UFCX 1PILA 2J0WA 4B9TA 4IOCQ 2IJRA 4IUFA 2XMUA 4Q44A 3RTVA 2VL1A 3BGFA 2E44A 1CSJA 1UJ6A 2NS1B 1X5TA 2GHPA 2KRRA 5HI7A 2HFOA 3HT0A 1N6QB 1FX4A 2P6TA 3DM2A 1NPKA 3N5BA 2NUHA 3MFHA 2W01A 4RUCA 5G0RA 3SDEB 2VJVA 2HLTA 1HYSA 5L8RC 2KM8C 2V63A 2ZJRQ 3EVMA 2M7SA 1S9EA 3G6XA 4FP9A 1TKTB 1HHQA 2VPWB 2YWFA 2F8EX 2JSXA 4C6AA 3T3FA 1R3NA 5ADZA 4Y34A 2E9RX 1WHXA 2XO6A 5FDLA 4C0OC 1NBEB 2YPZA 4EUVA 1HBUA 1KNZA 4ZK7M 2JOQA 4DQPA 1WEZA 5KFSA 5LM7E 2XQCA 1VOMA 4NXMF 1AUDA 1CBKA 3MM5B 1F2HA 2B8QA 3J7ZT 4ILRA 1N32F 1J5OB 4F25A 2M0GB 2Y1IA 2UU9F 3CJ0A 1KC8T 3CDUA 4Y2MA 1F6TA 5KG4A 2DR9A 1CC8A 1T05A 3BM7A 1S76D 4K4ZA 1GX5A 4PWUA 5L39A 3V4IB 4J7CA 3GFZA 1FK9A 4N8OA 4DUTA 1N5SA 1QM9A 2C2NA 4KGVB 1X5OA 2V34A 1PIEA 3PXGa 3W3SA 2HAFA 3OTBA 2HRTA 1WUUA 4ELUA 1LNQA 4MIAA 2OAUA 2O5DA 4DR2F 2LEAA 4DV7J 2IAJB 1F60B 1H74A 2DHXA 4QIWD 2PMZD 2MXYA 1LFWA 3MEKA 2PDAA 3SV3A 3IBWA 2CWKA 2CQHA 1D9DA 3EYZA 2FQQB 4YN3B 4CI0B 4L75A 2W1BA 2ZH7A 4LR9A 2MZJA 3ISND 2A6OA 1NKCA 1TR0A 4DUZJ 1HMVB 4DV4J 2Z0GA 1HNXF 4RO0A 5KAKA 4RW8B 3CXCR 3OHAA 4DBQA 1GK8A 4IH7A 1WF0A 2DNKA 3TNVA 1IXKA 1KQFB 1TAQA 2RDJA 2W9BB 3D28A 2QA1A 2BOPA 1SJ4P 2L48A 1KS2A 1DTQA 2WVEA 4ZVSB 1D1UA 1T9TA 2DB1A 1N6QA 2QG9B 2JEJA 3SDEA 3BSNA 4A8MP 1H0HB 3OUYB 6FDRA 2R7WA 4J37A 1TKTA 3J80U 3G6ES 4DL6A 2ROEA 3QAEA 2UVUA 1OQ3A 2PC6A 1NEEA 1TKXB 2F9DA 5IWAJ 2B4PA 4DV2J 4FYWB 3ONQA 2OEKA 4RBVA 4LQ9A 4URQU 3UN5A 2A3JA 4HKQA 1R8CA 1WEYA 2V9KA 4Y65A 1SC4B 2V8GA 1ZZFA 1Q8BA 3PIPQ 1VQYA 2EEYA 3TI0A 4WXOA 1UPPA 3M7VA 1GQEA 1RAJA 2ZBIA 3MM5A 8ATCB 5EWGA 3NRBA 1J5OA 3Q0AA 1H73A 2HWIA 3UN3A 2P9EA 4L72B 3R2DJ 1IVZA 3SCIE 1NXIA 1RYSA 1RB0A 5F8LA 3S6EA 2VG7B 3V4IA 1QVFR 4F2RA 3W9HA 1BWVA 1FE4A 5KFXA 2CKWA 1RHUB 1NHVA 1T11A 1PCAA 2YX7A 1JK9B 4LIWA 2OELA 4QWBA 3HD2A 5EDWA 4WFYA 1JLAB 3R8YA 4B08A 2ZH2A 4F7VA 2CVEA 5AXLA 3LP1A 4NLQA 2JNJA 5SZTA 5CZXA 2IAJA 4RBUA 3QYYA 2XWYA 4CYUB 3MD1A 2JL9A 2GMHA 4KHPF 2GO9A 3HZGA 5J2PB 2W8LA 4PEOA 3D5MA 2QL7B 2ALZA 4YOEA 4IR1A 3H8YA 4XO0A 3IR5B 1IBMF 5CXTA 2VDIA 3QSIA 4MJKA 1NSKL 1LK5A 2I6WA 1HMVA 4W92B 3BN4A 3LPYA 4KFBB 4MK9A 4TLRA 4RW8A 3I5CA 4I6AA 5L1LA 1X4BA 4WBFA 4J9MA 3HVWA 4E8UA 3BQ0A 1H7XA 4ZA1A 4F67A 1WF2A 2W9BA 2IDLA 3CD5A 4NLOA 5E7OB 5I3PA 4ZCIA 3O44A 4OI3A 4O0NA 2GA7A 4B9SA 4NEZA 1YRTA 1FA0A 2OEJA 1K44A 3KUHA 2HIQA 3K5OA 4LF4J 5KG7A 3IWNC 3CCWA 1U1OA 3IM9A 3WIVA 3OR1A 3OUYA 2DNRA 4RNFA 3MOJB 3BKTA 4RBTA 4FYYB 2X3DA 2XB2D 1TKXA 2OIHA 4YB7A 1RHQB 1FEEA 2V94A 1ZM3A 2EG2A 2EFPA 1NK9A 2WB4A 4PQUB 2ZFHA 2WVDA 2WBMA 1SPBP 2CADA 3QZ8A 2VA2A 4CTAB 1XR7A 2J7UA 2QLXA 2GVDB 2F1FA 3CIZA 2DHSA 1RTIB 1LEOA 3N6NA 3DOKB 4NA3A 3US5A 1S1XA 3QNWB 5HLFB 4JI0F 1UA1A 3RB6A 1RXOB 2VG7A 1LKZA 4X4NA 2DNZA 1F3FA 4CNZA 2HQFA 3GV7B 2DNGA 2Q79A 1RSCA 3RAXA 2UVRA 1JLAA 1R7IA 3S8SA 2BJ3A 4DEZA 5K8OA 1SVDA 3MAHA 3V2UC 4CYUA 4NXNJ 5B08A 1N52B 5J2PA 4EYHB 3NNCA 4RKUC 4RW6B 2JEGA 1X9WA 4PUOB 1R8HA 5K14B 4WFXA 4CCHA 1HPZB 4KO0B 4MIWA 2XLJA 3HVTB 3HDSA 2EBGA 4NI2B 2LU1A 2XS2A 2XNQA 2QLFB 1UWBB 3D68A 5KT7A 4HT5A 4NLYA 4FF1A 4NLRA 4HL9A 2G2ZA 2CPZA 1R6YA 4KFBA 5IXUA 4Z37A 4NEYA 2E5IA 4QPTA 4KJIA 1QY7A 2Q1LA 3D3BJ 1IBKJ 3EVOA 4M8LA 4USIA 1UJ4A 3TAQA 2HHSA 3WHIA 1YDLA 4TN2A 4M5HA 2AW0A 5EWFA 1IM4A 3MM7B 2DXDA 1X7VA 5DZ7A 1F5CA 3MPYA 3OPKA 2R7XA 1EQMA 3R3TA 5JUMA 3T1YJ 2ZUGA 2EFOA 2XMTA 4W98A 4DLEA 2V2VA 2HQ3A 1WKJA 2X7IA 3KJVB 4C3MA 2NUUG 4S0MA 4ZCLA 4CZCA 1FF2A 3U1MA 2MKYA 1S57A 5AXKA 2YVSA 3FZ2A 4I4BA 1ZAXA 3PYFA 5HMWA 4R0JA 1HHTP 4PQUA 2W9CB 4X4RA 3OW2R 3VALA 2IVMA 1X9MA 3T5HA 3GZ7A 4NCBA 4P71A 2LCWA 4CTAA 2C3MA 3SSQA 4C7QA 2GVDA 5F8HA 4ZCKA 3DN9A 1RTIA 5IM0B 3RAMA 3DOKA 1Y9OA 5HLFA 4L3NA 4ZPAA 3NWRA 3M8QB 5DDRC 1UVJA 1N0UA 1SIWB 2CAJA 3F41A 4EGLA 2IBOA 4OHWA 3PX6A 3HF5A 1GTEA 3TYTA 2KTQA 1VS3A 2YKMB 5KT6A 1PYSB 2HZCA 4C8LA 1B0PA 1S6OA 2YWWA 5J2QB 5M2RA 1SC6A 2QZ8A 2J9EA 4A48A 1VQSA 1K0VA 5BXIA 2KJVA 4USJC 2V50A 2Q43A 3QAUA 2LVWA 3G8TA 1VJWA 5D0RA 2HHTA 1FJEB 4YB5A 2HBYB 5HQMA 4YS2A 4RW6A 4PUOA 2HHWA 1CULB 5K14A 1HPZA 4KO0A 3TVYA 2CPFA 4DR2J 3HVTA 2DNPA 1IUJA 4NI2A 4J91A 4OJ1A 1K9MT 3T5JA 1UWBA 3IO1A 5LXYA 3FNNA 5GAHU 1CQNA 3K17A 4CNYA 1RK8A 1HWKA 2ZM6J 4CO3A 4WK3A 1RT2B 2P2CB 2EFQA 1KVKA 1U1RA 4Q43A 1UFWA 3MMAB 1A9NB 4DF8A 4PG5A 1NPPA 1WKKA 2ASJA 2E9TA 3FRZA 1HD1A 1HBOB 4K4WA 1AUSL 3MM7A 4WJBA 2PSZA 1NKBA 4FPRA 3TEGA 2CDQA 2KHCA 3W2VB 2OUGA 4WK1A 1Y3JA 4MAKA 5E3CA 3PX4A 3A4TA 1N34F 4LRAA 2HFUA 4HH0A 3KJVA 4P73A 2HZVA 4CT9A 2QMXA 1OYEA 2IRYA 5B0BA 1YJ7A 4LSZB 3EGZA 2BM1A 4LBIA 2VOPA 5HROB 2POKA 2P5VA 2GW8A 1RAAB 2W9CA 1HQ2A 3CB4A 3DLBA 2J7WA 1PKUA 4PYAA 2RD5C 2DGSA 1N36J 1C0TB 4FZVA 4N41A 4KSEB 1U47A 3QWUA 3I4PA 1LK7A 2G0IA 1XK8A 5IM0A 5M2PA 2UZAA 1YLXA 2BA9A 4IRDA 1RBOB 2XYPB 2EWHA 2MKKA 4NRTA 2COLA 3M9OB 3M8QA 5DLFA 1WEXA 3TA1A 3JTOA 4DV3F 2W2QP 2G2YA 1FFWB 1OY6A 2MKIA 1TP7A 1JMTA 1OQ6A 4DR7J 1RKIA 4DS4A 4LF7F 5H1SV 2YKMA 4DSIA 4DSEA 4N56A 3CD6S 4GC6A 3D7SB 3VGSA 4NCAA 5J2QA 1KWMA 4ES3A 5KG2A 3QT6A 3JSYA 1M5PC 5CYJA 1R8PA 1VQ8S 1H3DA 2RU3A 2VQFJ 3Q22A 4V1Ak 1TFYA 2FY8A 5EUHA 2KU7A 3OL8A 4K5SA 4OYWA 2Y8WA 1M5KC 3QRQA 1XQIA 2R42A 2B3TB 2J5AA 1TL3A 3LA0A 1GFWB 2IY5B 2HVEA 4P6QA 1CULA 2YKOA 4ZLLA 3GFXA 4RW9B 3BZQA 1HNZF 3QZ7A 3AOCA 5ETVA 3BF4A 3R7BB 3L95X 2WZ1A 5T41A 4ZPTR 1C0UB 1YVFA 4ZVUB 1ZTTA 1RT2A 1U2CA 2V8HA 3DRSB 3C2PA 3GSDA 1ULRA 3TQEA 2PN6A 2VV5A 3EE3A 3MMAA 2BKNA 1HR0J 4RW4B 3O2IA 3IAM9 2IJNA 5T7LB 3KUEA 4CO1A 2QA4S 1HBOA 3CCLS 1YJUA 4U8VA 1X8DA 1YI2S 4OZNA 5GADI 3CDBA 3KJFB 3UO0A 1LXJA 4AL7A 2DNQA 2EK1A 3NOGA 3W2VA 4M63A 1HW9A 1VR6A 3T41A 3NKYA 3WBZA 2ILZA 2HK3A 3O8WA 2OTJS 3GILA 2CJ9A 1QSYA 3Q8SB 2DY9A 2SXLA 4NLDA 2V67A 2DNLA 1A0OB 2W2MP 1VRTB 3R5JB 4E98A 2ZEJA 3EGVA 3ZTRA 1FD8A 1RP5A 4JI5J 2XZWA 3ULHA 1Q8KA 5CABA 4A8QA 5HROA 2ZH9A 2X1FA 2ZOGA 5T14A 1P6TA 2D1CA 3UDLA 2XY7A 3VQTA 1YJRA 3KHGA 3K8WA 3PM9A 1RISA 1I6JA 3JAMU 2YXLA 2OFHX 4UY85 2P9CA 4CLYA 4NZ6A 3W62A 3GR1A 3OLAA 2Z56B 1C0TA 4MT1A 4C0BA 2HS4A 4RNNA 2DIVA 3J7YI 3PR4A 2WVCA 2F4FA 3PG9A 1T03B 4K4VA 1H2VZ 2JHEA 3HHNB 1S0MA 4J9VA 5HATA 4ALZA 4Y00A 4ZPWR 4JV5J 4LF9F 1U48A 2XMWA 2FJEB 5L46A 5HMXA 2WAQD 5KT2A 3I5BA 4P9SA 1T3NA 1BMQB 2NPFA 3NP5A 1KHWA 4EZ6A 1UMJA 1FRJA 1NNDA 2FHJD 1V5IB 1EB0A 3SYZA 5A8KB 4DS5A 2AIRB 1S4EA 1NUEA 1KTQA 2DK2A 4QQBA 3AHPA 3M8WA 3M2VB 3TP2A 1VQNS 1O8BA 1Q86T 1HNWF 2XSFA 1R6VA 3HSJA 1ZYQA 6FD1A 1ZPWX 4YR3A 3M6WA 2E7VA 2D3O1 4RW9A 1TZ0A 4UOFA 1RWMB 3GG1A 4FPIA 2HVDA 4LF1A 2HYIB 2J9DE 1MMNA 1URNA 1YBUA 2Z2LA 1FRLA 1HNVB 4C11B 3LAKA 3EGNA 1FRMA 3H5XA 1C0UA 2KT5A 3P45B 1KP6A 4DUYJ 5AE2A 3DRSA 5DO2A 1ZETA 2V2KA 4XK8C 4RW4A 3FUYA 1JLQB 2AGOA 4K4TA 2DGXA 5T7LA 2EPIA 5B7WA 2C42A 2ZBRA 3KXDA 2FLNA 2UUCJ 2E1PA 4FVCA 4OJHA 1Q82T 4YEAA 2P9GA 2VODA 4EK2A 2F8HA 2N3LA 5ETOA 1F9HA 5KFUA 3CCJS 3PKMA 5CD4H 3IGVA 1S99A 3OVBA 1KOHA 5FIIA 1B7YB 3FMBA 1VRTA 2L9WA 3MEEB 4KQZA 1D8YA 3PJWA 1UA0A 1YJWS 3GFYA 4PG4A 4UQTA 2LXFA 1WELA 2FHKA 5D4LA 1S6UA 2KG0A 2CQ2A 1KBRA 2U1AA 3UDVA 3H59A 4AQYF 4D3GA 3DGVA 2AV5A 3MMBB 3SBMA 2YQ0A 4DV1F 4L6V3 1VLYA 4DQQA 4P7TA 2ZUAA 3IG1B 1T03A 3LPEA 3TUIC 4ZP6A 3DXBA 2BW7A 1Y5LB 3MCMA 3CEDA 4F04B 6AT1B 4FN5A 2IM1A 2HQDA 4DHVA 4ZHRB 2D3ZA 5H9EJ 3MCSA 4CO5A 5K9FA 1NB2A 2QFJA 4X62F 2XZTB 2X1BA 2GQQA 3G8QA 3G87A 5GMEA 3ZTSA 5A8KA 4HYKA 2R3VA 4KGXB 3QGIA 1S7IA 3CJKB 3MCOA 3M2VA 1RDRA 3HHLC 3ETMA 4WP8A 5DJBA 2RUSA 3DLEB 1ZA1B 4IKAA 2D9PA 1M5OC 1SJ1A 1TMMA 2ZZTA 2W2OP 3W2WB 1I51B 2KHDA 1VHFA 3U7JA 1N5VA 2I2YA 1KRPA 1HNVA 4C11A 1YZ6A 3TJ9A 2K3KA 1W7WA 2HGNA 5EN1A 1YTYA 2CQBA 9RUBA 3EWGA 4Y28C 3I6PA 1X4AA 2XG8A 4GKKJ 2MJNA 3M9NB 3J7AN 2AYEA 3J80Y 4WIQA 4BBYA 4BWMA 2K8GA 5HBMB 3MECB 1KLNA 1JLQA 1VBKA 3CT9A 1QAIA 2RMLA 1U49A 4AUKA 3JTNA 3BREA 1KN6A 4C0HA 3O3LA 4M5DB 5ETPA 5I4MA 4CO0A 1TUGB 4OQJA 1RHKB 3C19A 2UXBF 1JQGA 2F7VA 2BYCA 4YMEA 2MDAA 2RNEA 4WF9Q 4DU8A 2CG4A 4X65F 2NREA 5L9XA 3A3OB 4OI0A 3MEEA 3MAQA 3ISZA 4N8NA 3VVUA 3CW2C 5FLXU 4BCAA 1R43A 2R8IA 5BYRA 3NMAA 1RT4B 2AJ2A 2DPIA 3UNGC 2XWXA 4Q8EA 2CG8A 4HI1A 5KFCA 2MZ1A 2G1HA 1SKUB 4ICLB 1T9UA 3MMBA 4FYDA 2CQ3A 3IG1A 4HI2A 1YJNS 4G6VB 2UUBF 4OYZA 1OS5A 2DXFA 1KKHA 5LSRA 2GMJA 9ATCB 1H38A 3VF0B 4ECZA 2QLWA 3BGOP 2GQCA 1S6PB 4ZHRA 1C4CA 2PA3A 1Q5YA 2XCPA 1D3WA 4DQSA 2OH2A 3ZC4A 5BR8J 4U9RA 3PR5B 1JXVA 1N5YB 4F4WA 4YB1P 3C46A 2AYBA 2LU2A 5GAEU 1V5VA 3FBFA 5AJ3F 5HSPA 3OV7A 2YY3A 1RBAA 1I94F 3QQCD 1NCLA 5EHHA 3GSIA 3CJKA 3DLGB 3GIKA 3MAAB 3C16B 2WW8A 2HSEB 4AL6A 3HHDA 4B3SJ 1H72C 1RWVB 3DLEA 3RU0A 4LIRA 1TV6B 2EVZA 4IRKA 4F4AA 5ETTA 1HWJA 3IRXB 4YQWA 1OPIA 5DQHA 3FVYA 5A2QU 3PRVA 1UW4A 4ZN3A 3W2WA 1KVJA 5B0EA 2W24A 1LXNA 3LP2A 4DV0F 2NXUA 1NKEA 1FNOA 1RBLA 3OFFA 1BQNB 2QMUB 4MYTA 3ZZPA 2BW2A 5DDQC 2LQJA 2M9KA 3T9ZA 2HFNA 1IJFB 3NAIA 3UDEA 5D0EA 1ZBTA 5HVGA 1C2PA 1FESA 1K8AT 2IMOA 4GVLA 5ITHA 1QE1B 2Y3YA 3LH2S 5HBMA 3MECA 1X4FA 4B3TF 2YKAA 3X1LB 3BBCA 5E3PA 3MR2A 4G3IA 1BUXA 1U4BA 3J81Y 3RB0A 3W5ZA 4M5DA 1F3VA 3ELHA 2RQ4A 4NYPA 4P7VA 1X5SA 3NNHA 4KGKA 4NZ0A 5D78A 3TOQA 1HBNB 1WSRA 5GVQA 2GJ2A 1WOSA 5LMNF 4CH0S 2VU5A 3GQCA 5LMUJ 3OXFA 2YH0A 3RB4A 5EGYA 2N82B 2JX2A 3MR5A 3R5AA 4XPEA 2J6SA 4MK8A 4I68A 1RT4A 5AE1A 3R1HA 1JJ4A 4WZQA 2VPZB 3LW5C 4WCEQ 4ED0A 4ZIVA 2MGZB 4JI2F 2HZAA 2XMVA 4ICLA 2DGOA 1Z1ZA 2VG6B 2C1EB 3MMJA 4WFZA 1KVIA 4F02A 1SUQB 1RAFB 1X4DA 1YG0A 4MH8A 3OSNA 5KFZA 2C2RA 4X4PA 1SJ3P 3BH7B 3M9MB 1PJ7A 2ADCA 2YTCA 3VWSA 1RT3B 4JI4J 2MQPA 3MPVA 3QLHB 1S6PA 1LV5A 3KK2B 2ATCB 1RQ0A 2ABYA 4KH0B 4LMZA 1RWNB 1HI0P 4KR0B 1M5VC 1K1SA 4MKBA 4WKYA 1FEHA 2J0SD 3D54A 1N5YA 1GX6A 1ZZNA 2XEXA 1MN9A 1RHMB 4DCPB 2HHVA 2WW4A 4B17A 2JFKA 4CLKA 4J5OA 2N7CA 2M3DA 1VIXA 2FC9A 1UTAA 3DLGA 3MAAA 1F2GA 3C16A 2FJDB 4QR0A 5D0HA 1TV6A 2BDPA 4B3MJ 4X2BA 4HT7A 5AXNA 4ZN1A 2MKHA 3IWXA 3IRXA 1RA6A 4LF8J 2QTWA 3Q8QB 1KQSR 4OYAA 2O01C 5BJRA 1XNRF 4KHRA 4HTJA 3HKWA 3GIMA 1TK8A 1BQNA 4C2MA 1DZ5A 1QAXA 2UV8A 1FKPB 1DQ8A 1MWYA 2RHSB 3Q23A 5L9NA 1DQAA 3MUTP 2H5JB 2NZCA 4R5PB 4JI6F 2ACYA 2I8EA 1QE1A 3AJ1A 1RU1A 1RCOB 2IC3B 1LWFB 1YQHA 2VFTA 3ZZTA 2NYHA
chains in the Genus database with same CATH topology
1LK5A 1TKZA 1HMVA 4W92B 2FJVA 3LPYA 3A8EA 4AYBD 2NPIA 4KFBB 1YJTA 4MK9A 4TLRA 3MM6B 4RW8A 5KFRA 3M8PB 3I5CA 4ES2A 1MU2B 4I6AA 5L1LA 3E01A 1X4BA 1RT6A 1HBMB 4CIOA 1N56A 4J9MA 3H5YA 4B9UA 3BSCA 3IFEA 3Q8RB 1SB6A 3B78A 2E29A 3TO8A 4ZP8A 1RTDB 1FKAF 4DL3A 1VC6A 3HVWA 4E8UA 3VTIA 4WYLA 3LGNA 3I0SB 2VKZG 3BQ0A 1H7XA 2CJBA 2IFXA 4ZA1A 4F67A 3KK1B 2ASDA 1WF2A 2KT2A 3QGHA 2W9BA 3CD5A 1RTHB 4NLOA 1NJIT 1WI6A 5E7OB 5I3PA 1FDBA 4TQRA 4QU7A 5KG1A 3AA8A 2BUNA 4ZCIA 4DJBA 1N5QA 3CJ2A 2VC1A 2VQEF 3DCAA 3O44A 2E1AA 4OI3A 1WWHA 4OZLA 4F50A 4UUWA 3MI7X 3RBEA 5MAOA 4WFAQ 1NK5A 1S9GB 4O3PA 2GA7A 4B9SA 1FERA 4ECUA 1U1KA 4KHMA 3SCLE 5BR8F 1YRTA 4F26A 1FA0A 3ITHB 4ETXA 5IT9Y 4OV1A 3OL9A 2FC8A 2HIQA 1KLMA 4OHVA 2APOA 4ED8A 2BE2A 2FJBB 1FKOB 5KOXA 3CWJA 2IVFB 3K5OA 2DO0A 4OI2A 5KG7A 3IWNC 3NMRA 2M8HA 3GFHA 3FQLA 2YX1A 3CCWA 2OPPB 1U1OA 1KQGB 2MZSA 4LQ3A 2IA6A 3H4DA 2MGZA 3OR1A 3SFUA 4EYIB 2VBZA 3ENQA 1Y4ZB 3NCRA 2ASLA 5B0DA 3OUYA 2R2RA 1BC6A 2WSEC 1SXLA 3BGRB 4EBEA 2DNRA 1H2TZ 4RNFA 4X4UA 2VG6A 5F3ZA 3MOJB 5BYSA 2O1PA 3HVAA 2K7JA 1V3RA 4RBTA 1NRKA 4NCGA 2XSJB 3KLFA 1R0AA 1FJCA 3BSAA 2GGPB 5CZVA 4B3SF 2XB2D 1SUQA 2IM3A 1TKXA 2OIHA 1HWIA 4YB7A 1FEEA 4ZP7A 2V94A 1ZM3A 2DNOA 2EG2A 2EFPA 1NK9A 3D2WA 3AQPA 2WB4A 4QIFA 5CCLA 4PQUB 2F9JA 2ZFHA 5E3AA 4CH7A 4DFKA 2FB0A 3ZZZA 1RT3A 4IG3A 5KFOA 2WBMA 3T6JA 3TQ1A 1QSLA 3VR1A 5KFEA 4ZS6A 3QZ8A 3KLHB 2JLFA 3QLHA 4A8OA 3KK2A 3I4HX 4X64F 2VA2A 4CTAB 3M1VA 1R89A 3B4MA 3U27A 2E7XA 2FVPA 3DGPA 5E33A 1XR7A 2J7UA 1XMBA 2QLXA 2FJWA 4DV7F 2F1FA 2V4QA 1BLUA 3CIZA 2KFNA 3OFGA 4NRUA 4A8KA 4NLVA 1O5JA 2DHSA 3UQSA 5EWEA 2WSCC 1UJ5A 1C1CB 2UVVA 1RTIB 3FFIB 2JC0A 3N6NA 4DF4A 1JWWA 4U67Q 2MY7A 3DOKB 3JYTB 4NA3A 3US5A 2F4VF 3KMQA 4OZ1A 4F2SA 4H54A 4KTQA 1JLGA 4O23A 1S1XA 2ATLA 3UR3C 1Z2ZA 2ZH1A 4QCLA 5HLFB 4UY8T 4D3HA 3SEOA 4Q0BA 1VQPS 4NPOA 3DC2A 5A8RB 2DBBA 4JI0F 1VGYA 2RDIA 1UA1A 2R8GA 5A6WA 2KZMA 3L7PA 4NLUA 2XLIA 3I96A 3RB6A 4OMFG 1XN9A 1WHYA 3U1LA 5A8WA 1R31A 4PCQA 1RT5B 2BZ2A 1VQ7S 5J1PA 2VG7A 2D74B 3F56A 1LKZA 1KONA 5DLGA 2DNZA 4X4NA 4Y2KA 4DV4F 4CNZA 1FCAA 3DRXA 4YY3F 3EUNA 1HARA 3EZUA 3GV7B 3OHBA 2HAIA 3NCQA 4TLQA 4YUDA 1YIJS 2DNGA 4QWDA 2X3GA 2Q79A 3QJLA 2VC0A 5B0AA 4K4XA 2RRBA 3BJYA 1OSDA 2DNNA 1RI7A 2K1RB 3RAXA 4F8RA 4DSJA 2UVRA 4TU9A 2GMLA 3OJUA 3PO5A 2ZITA 1FNMA 1JLAA 2IYIA 4HTIA 1R7IA 2UUAF 2CQPA 1KSPA 3IGNA 3S8SA 3T9NA 3HKZD 4XDCA 2ZZNA 2V8DA 1RGVA 3C3LA 3MEGA 3SQGB 3PW7A 2OP5A 1U25A 1S48A 3GYXB 4DEZA 5D77A 3DOLB 5K8OA 3MAHA 2AD9A 1S1TB 3PACA 3V2UC 2VONA 5LMUF 5B08A 3PNIA 1N52B 1FKPA 4A47A 3DLKB 4N5SA 1VBYA 1VQ5S 4NYZA 5FD1A 4OX9F 3I0RB 1Y5IB 5DG8A 3IC1A 2JEIA 3AY0A 5J2PA 3NGDA 4EYHB 3NNCA 4RKUC 1DQ9A 4LFBF 4RW6B 2JEGA 1X9WA 2VB6A 2X1GA 3BR8A 4C4WA 4LJMA 4N47A 1EETA 3GWCA 4PUOB 1R8HA 3V6KA 3R5DA 4R5PA 5K14B 5F9NA 5D6GA 4WFXA 4CCHA 1X0FA 4JI3F 1HPZB 3ZZOA 4KO0B 4MIWA 3HX9A 5KOWA 3VAGA 3QIPB 2XLJA 4BC9A 2IC3A 1W25A 4Q5VA 2J8AA 3HVTB 1LWFA 4B9VA 3HDSA 1RJJA 2EBGA 3JTPA 2HHXA 2LU1A 2XS2A 2XNQA 1FTCA 1UWBB 4DV5F 2U2FA 5KT7A 4HT5A 2W7AA 4NLYA 4FF1A 4ECVA 2IA0A 2CPIA 1LWCB 2CQ4A 2K3IA 1S6QB 4HL9A 4NLRA 3KOAA 2CPZA 2RS8A 2QEXS 1R6YA 4KFBA 3OTEA 1XWLA 2ZE2B 4Y2AA 3KG0A 2EI5A 2FJAB 3BO3A 3MM6A 5IXUA 3QGGA 4JV2A 3M8PA 4Z37A 1MU2A 2I9SA 2E5IA 2FHOB 2ZC3A 4WFNQ 2PFFB 1HBMA 3DHXA 3TARA 2PMHA 3KHRA 4QPTA 5IWAF 1RTDA 1FRKA 4DV2F 2BQUA 4QR2A 2DRBA 5I3UB 1XMOF 1KOOA 2XMKA 4YFUA 4KJIA 3BS9A 2C3OA 2PGCA 1QY7A 2GO8A 4ZPCA 2MZTA 1HWLA 5DETA 1TAUA 3I0SA 2GCFA 2Q1LA 5KT3A 4NLTA 1C4AA 3KK1A 3CF5Q 2MSSA 5DM7Q 2QA2A 4M8LA 1VQKS 1RTHA 2DD8S 4USIA 3GIIA 2G0CA 4JI4F 1UJ4A 2XMMA 4NZ7A 3TAQA 2HHSA 5I42B 3HPOA 1Z4UA 3HK2A 4TXSA 5CHCB 3LUYA 4BDPA 4KE5A 4KT0C 5F8GA 4TN2A 2G4BA 1W2BR 2AW0A 5EWFA 1IM4A 1HI1A 3MPWA 4QPXA 3MM7B 4F4ZA 1Y00A 1S9GA 4YDDB 3GMGA 3HI9A 3RRKA 3B4DA 2K7KA 1Q8LA 3M2RB 1X7VA 1GTHA 3BEGB 4IOAQ 1YRUA 1X4CA 1F5CA 3ITHA 2R7UA 3MPYA 3OPKA 4DFPA 2VFUA 5C5JA 5CA5A 2R7XA 3R3TA 5JUMA 1FKOA 2ZUGA 2EFOA 4GO5X 2LYVA 2HLUA 2XMTA 4OHXA 2OPPA 5KFQA 4FVMA 2CPDA 1NB7A 4DLEA 3VZHA 4K50A 2HQ3A 5M2UA 4C97A 4YR2A 3GB0A 3KJVB 1U1MA 4ES1A 2B7BB 4C3MA 1V3SA 4XPCA 2NUUG 3K58A 4A8SA 2E5HA 3N9UC 4ZCLA 4PXCA 1S1WB 4CZCA 3Q8PB 1U26A 3CUNA 3BGRA 2PI4A 4PWDB 2JLEA 1FF2A 4OHYA 4ECTA 3FZBA 2VBWA 1MMDA 1L3KA 2GC8A 5HMZA 2XSJA 2VKRA 1WNEA 1MW7A 4BWJA 4UW2A 2DIUA 2B4UA 2GGPA 2E5JA 3U1MA 4Q8FA 3C6UB 5AXKA 2UP1A 5KFLA 2HQIA 4ID8A 2YVSA 3FZ2A 4HEA9 4I4BA 1ZAXA 1UVMA 3DU5A 3Q2TC 5CYQB 3VAKA 4B3MF 2KVIA 3DRYA 1K1QA 5HMWA 1FHTA 4R0JA 2ZNZA 2DTJA 1HHTP 4PQUA 1H98A 2HNDB 1FRIA 4LF8F 1K0TA 5B0GA 1SKRA 2W9CB 4X4RA 2MY8A 3OW2R 7FD1A 3J7Z5 4DSKA 3VALA 3KLHA 2IVMA 2KFYA 1VC0A 2DHGA 4LF6F