2ZWPA

Crystal structure of ca3 site mutant of pro-s324a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
394
structure length
389
Chain Sequence
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDADAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Requirement of a unique Ca(2+)-binding loop for folding of Tk-subtilisin from a hyperthermophilic archaeon.
pubmed doi rcsb
source organism Thermococcus kodakaraensis
total genus 118
structure length 389
sequence length 394
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2zwpA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zwpA02
1R6VA 3DE6X 2W2MA 3Q40A 2XTJA 1SELA 4KPGA 1ST3A 4KG7A 1IAVA 2PYZA 4NE9A 4WOCA 1Y34E 1GA6A 3LPAA 1R64A 1TM4E 1TECE 3DDZX 4NE7A 2W2QP 4ZOQI 5CW1A 1AVTA 3DYBA 1XF1A 1Y3BE 1BE8A 2G4VA 2ID4A 2PWAA 3WHIA 1AK9A 1SPBP 4YN3A 3AFGA 1C9MA 3WIVA 3BPSP 1GA4A 2GKOA 4Z2AA 3GCXA 3SQOA 2PRKA 2X8JA 4KB5A 3I2YX 3A3OA 1YU6A 1TK2A 1S2NA 1EGQA 3DW1X 4YN3B 1SCAA 1A2QA 1WMEA 1EA7A 2Z2ZA 2X8JB 1Y33E 1SBCA 3A3OB 3BX1A 1ST2A 4H6XA 1SUBA 4B5LA 3D43A 1KDYA 3EIFA 2P4EA 1SCBA 1Y4DE 1AV7A 1SCNE 1P7VA 1PJ8A 5ARBA 1ZVKA 1KE1A 1Y3CE 4J94A 1MPTA 1V6CA 1WMFA 1C3LA 1V5IA 1GTL1 1Y3DE 5JXGA 3A3PB 1GA1A 4CFZA 4ZARA 3F7OA 5FFNA 2W2OA 2QTWB 3CO0S 2DP4E 4H6VA 3DW3X 5JXJA 3DVRX 3SICE 1GT91 4RYDA 1GNVA 1NLUA 3VSBA 4DWWA 2SBTA 2HPZA 1Y1KE 2TECE 2WV7A 4C3VA 2W2MP 2ZRQA 3VTAA 3PTLA 2PWBA 3VHQA 3DE7X 2XTJP 1TM5E 1TM1E 3VV3A 1SUCA 1BE6A 1SBIA 3DE0X 3OSZA 2WWTA 1Y4AE 1WVMA 3I30X 3ZXXA 3VV2A 1ITPA 3QMPA 1Y48E 2WUVA 3GT4A 4H6WA 3F7MA 3CO0P 3AJ8A 1TMGE 1AU9A 1OYVA 4FONA 3I37X 3LXUX 1SBHA 5FAXA 1SN7A 4HX2A 3LPDA 3GCXP 3VV2B 4C3UA 3SQOP 1AF4A 1S01A 5B1EA 1KE2A 3F49S 3UNXA 3ZXYA 1WSDA 2E1PA 3GCWA 3D9QX 1JEAA 3WQBA 3EE6A 4NMXB 1YJCA 4K8RA 4LVNA 2SECE 1LW6E 3A3PA 3AJ9A 4LVOA 1CSEE 5AVKA 4MZDA 2QTWA 5K7SA 1TO2E 5JMOA 2ST1A 1GTG1 1DBIA 3GCWP 5SICE 2Z57A 4I0WB 1SBTA 2DUJA 1SUDA 1VSBA 3WIUA 1Y9ZA 4K8RB 1C9NA 1BFUA 3L1KA 1UBNA 3DVQX 1SCDA 2W2PA 1KDZA 2Z2YB 1IC6A 4OMCA 3P5BA 2ZWOA 2Z57B 2W2NA 1AH2A 5AQEA 1YJBA 4M1ZA 5I9SA 3Q5GA 5ARDA 1S02A 1C9JA 1HT3A 2W2OP 3BGOS 4NE9C 3A3NA 4OMDA 2PMWB 3TI7A 2PQ2A 1YJAA 1GTJ1 1SBNE 1SUEA 2W2QA 4HVLA 3A3NB 1KDVA 4AKTA 1PFGA 1SCJA 5ARCA 3QFHA 4AKSA 3T41A 4GI3A 3BPSA 3EDYA 1ZVJA 2ZWPA 1AQNA 5AVJA 4JP8A 1SCJB 1BJRE 2PKCA 1T1EA 2IXTA 3DE5X 3CNQS 1PEKE 2V8BA 4NMXA 3DE2X 2WUWE 2Z56A 4DZTA 3VYVA 2XRMA 1SUAA 3GT3A 1TM7E 3BGOP 1P7WA 3I34X 1MEEA 1WMDA 1GNSA 1PTKA 1Y3FE 3DWEX 1P8JA 3DVSX 1GCIA 3H42A 1T1IA 2SICE 5JXIA 1DUIA 2Z56B 1SIUA 1SUPA 1TM3E 1TO1E 5B1DA 2Z2YA 1THMA 2Z58A 5AMXA 1NDUA 1SH7A 3H42B 2Z2XA 1T1GA 4CG0A 3PRKE 4CFYA 2Z30A 3DE3X 4OV6A 2B6NA 2ID8A 3DE1X 3HJRA 1SIBE 1SVNA 2PMWA 2SNIE 2Z58B 3CNQP 1OYOA 1BH6A 1SPBS 1OT5A 1R0RE 5JXHA 1Q5PA 3DE4X 4BWGA 2Z30B 4OV6B 3TECE 2HD4A 5FBZA 2W2PP 1NDQA 1SIOA 3P5BP 2DQKA 1BFKA 3QTLA 4DJ5X 2W2NP 2IY9A 1CNMA 3TI9A 3LPCA 1V5IB 4WOBA
chains in the Genus database with same CATH superfamily
3HKCA 5D5PA 2IUUA 1P2FA 2CWWA 2ZDGA 5CYQB 5H1YA 1HQDA 1UXIA 5C35A 1VMAA 4Q4AA 1TRHA 1JKJB 3THXA 4DG1A 1MWZA 4FF4A 2UXBJ 3T7DA 2PYZA 1Y34E 3U4IA 5FD8A 5CIYA 3CDWA 4FKMA 2HA5A 4B8YA 1DDIA 1TT5A 2WVFA 4CTKA 2DFPA 3L4BA 2W8KA 2AC2A 1BE8A 4F50A 1HNNA 2ZVSA 1VZ2A 1OPZA 5JO9A 4A6EA 4MQMA 2Q5JA 1KTIA 3PFHA 3I73A 4EVSA 3MFQA 3U6BA 4NCKA 1W0JD 3I23A 4P36A 3DZJA 3LYHA 3AONB 1EVYA 5JVDF 2RHSB 5TSDA 4P93A 1SCAA 5EJEA 1U7PA 5AOBA 2ZYUX 2ZEJA 4JOBA 4PO1A 3VKUA 4ILLA 4JB8B 4MQLA 3QELB 4DHEA 4TTQA 2QWXA 1EWRA 2VDIA 4KBFA 1UJBA 3VTKA 1PT9A 1A9XB 4UKDA 4GR9A 3V32A 2R1VA 4PAQA 3V4ZA 2NZ2A 3IGNA 3SQGB 1MVLA 2C28A 1SOVA 5JS1A 3M82A 1YI1A 1LJ8A 3VO8A 4QOIA 1DELA 1RI3A 4P74A 4UOFA 3RRBA 2R11A 1ZZNA 3MGCA 2CV2A 4OKSA 2DQZA 3N2LA 4Y30A 1QE1B 3TKYA 3QW4B 3IBTA 4KRFA 3TL6A 3GQBA 3GG0A 3OJOA 3H2JA 4KPFC 2BKPA 4OYMA 4DX7A 5DXFA 2W6ID 2D8AA 3MT0A 4ZI5A 1XTQA 1U0JA 3K4PA 1YACA 4P75A 1C2TA 1II0A 1UBOS 4BHTA 4IMPA 2IFTA 4IICA 3IJ5A 4KVAA 4PFQA 1JHUA 1KO4A 1KK0A 1J1UA 2O8FB 2TMKA 3NHYA 4TXSA 3UA3A 2I2YA 1MAWA 5CCDA 4C7KA 2IE0A 2AB0A 4H1VA 3WHKA 3UWOA 4EF5A 3HP6A 3W2WA 4KGMA 4OPMA 1E6MA 2F9MA 1EKRA 2GA8A 3ZJUA 3VVLA 2WFLA 1VSVA 4YLGA 3THYB 3CCWA 5G02A 4HN4B 3OOSA 1B26A 3CUUA 1EUCA 3BXOA 1ISFA 4OB7A 4BVBA 1M83A 3FNGA 3BWDD 3HCNA 3DL4A 3ONNA 4LY0A 4PNEA 1KKHA 4KQHA 3NNNA 5BR4A 3K0EA 2MSTA 2ZI7A 1UEKA 4N1AA 4DFMA 5K05A 3NMAA 3BGFA 2BKEA 1T9DA 8RUCA 1COWA 1OH5A 2X5NA 1OFIA 3L1KA 5A4AA 4Y2IA 1R0BG 1KBZA 3L8DA 4KVFA 4IHJB 4N5NA 5ITZA 2P9QA 2PVPA 3JASA 3VU1A 1OVGA 3C87A 3BWMA 3P1JA 3CD0A 4LJ8A 2QZ9A 4F9FA 1R66A 5G1PA 1BVYF 1ZUNB 4AMUA 2PO7A 5EFZA 1ZAYA 1EVZA 4MCHA 4RSGA 1A5ZA 4LZAA 3TI7A 1QVGR 1TJ4A 1MQAA 1N1MA 3J80Y 1UEUA 4ZU1X 5E1BA 5E7JA 1NUTA 4RWEA 3LUAA 1I0LA 4AXIA 4H7FA 3IR5B 1PR2A 1WZUA 1RI2A 2IRXA 3ZZNA 2NSHA 4JVOA 1CWUA 3H2IA 5JS6A 4NI2A 4F0MA 1Z07A 1YOBA 3HX9A 2MKJA 1TTQB 1Z82A 4D43A 3KK3A 5B2FA 1QJCA 1E89A 1IWBB 3CGGA 2ES4A 3GWZA 2WF5A 1LRKA 1O1YA 4I1PA 5EGYA 3MJFA 2G5TA 1UVJA 1H9BA 2H1RA 4AU1A 3T1NA 3IBSA 4IG3A 3VC3A 4EVQA 1MMDA 4MR7B 2ONCA 4UE6A 2J9FA 3WQSB 4NVRA 4RD6A 2RAUA 1SBYA 3Q7TA 4IV0A 3ZDCA 1UAAA 1Y5NA 3DHYA 3VH4A 2MQOA 1TKXA 3ETEA 3JVVA 2J31A 3VZSA 3UGTA 1AKYA 3QYPA 4B3DA 1RQ7A 1T35A 4GMFA 5KTSA 1U65A 4WK6A 3I3SR 1QHHA 4KN8A 1JSZA 4B79A 1T5SA 4S3MA 4RKWA 3WNBA 3K0AA 4FHDA 2D0PB 1JJHA 2HVIA 5CFQA 1GLVA 3TE6A 1FWPA 4OV6B 4JLWA 4O29A 2ZIGA 4Z86A 1VYUA 4DX8H 4Y2MA 4OTZA 1SZCA 1FD8A 3PHHA 1KNQA 2ID7A 2OUKA 2WJJA 2CZGA 3POTA 2I7DA 1FXWA 5YASA 2HHCA 1VQOS 3MCWA 5AI0A 2YJZA 4LFCB 3N6LA 4EY4A 1YDGA 3CEAA 3UXYA 4MP3A 3U60B 5EMKA 3MFYA 3ER9A 3RNLA 4ARCA 3TAXA 2CK3A 4D1YA 2HLNA 2ZIXB 3OPMA 1AS2A 4J91A 2AKAB 4LDZA 4A2WA 4LSWA 1I32A 4DN9A 5L38A 4XDYA 5B64A 2C59A 3IAHA 4NRDA 5E9AA 5DEIA 2I22A 1UPFA 3LOPA 1OX6A 4JI8B 1KWGA 1EFRD 1KR2A 3K2YA 1A2QA 1W1IA 1CQNA 5JRZA 4CF7A 1IN7A 2V8VA 2QLFB 1TUGB 2XQJA 2OV8A 4LI3X 1C4AA 3PNKA 1G7RA 2IZ1A 3QEMA 2PCJA 1QFXA 3TLCA 1CF4A 2RAQA 1ZM9A 4L8YA 3R41A 3R5CA 3MEGB 3NWPA 1VIXA 3HD1A 3C6YA 3HXOA 4PFKA 1MVNA 4XB1A 3AERA 1RZVA 2FVRA 3RK0A 4B3CA 5LMUB 2CVFA 4ZOEA 4ID8A 5JLAA 4FEAA 3T9FA 3GBSA 4JI0B 4FYWB 4N6GA 1DIAA 2ZQ5A 1JLLA 4AYWA 3KMQA 3PQ2A 5IFLA 2ADMA 4HGRA 1RQ2A 3ET6B 5KFAA 1N2XA 3AKEA 4MUNA 1HFWA 1BXNA 2H5JA 1ZK3A 2HAFA 1LSJA 4CLFA 1T5TA 4LV8B 3GIRA 5A5GA 5HNKA 3RARA 2AWNA 2XCSB 3BEGB 2UVDA 3MT7A 2DLDA 3JQQA 3IAM9 3HM2A 5D3MB 4XPCA 4WJBA 3CH5A 3R5AA 2YL2A 4JSRA 5IV4A 5A0YB 4PQUA 4KDFA 5BW8A 3T1HB 4QDKA 2CJPA 1A1VA 3VGUA 1W5AA 1ZHOA 1AKWA 2JFOA 1Y48E 1ZCBA 3TA1A 3C97A 5JDCC 1Y3JA 5EIHA 1ESNA 3QX9A 4XASA 3BS9A 4ZU3A 1PT7A 4FW8A 4C7QA 2NSDA 4RPKA 2FLKA 4EKYA 2IYOA 4RW8A 4D4HA 4NRTA 4GX0A 2LEBA 1TCVA 2VK8A 2JAPA 4RJJA 1N5KA 3SCZA 1W88A 2VDVE 3QT8A 1JB1A 1XRMA 3K5PA 1I1QB 3MMZA 2AJLI 2FMUA 1UBMS 2C4WA 3W5HA 2O3JA 1P9WA 3STXA 1TZCA 1XD8A 2Y6VA 1HYSB 3BIJA 1LK5A 2XVXA 1T3OA 5D7NA 1C9DB 3WB2A 4DUZB 4WY5A 2RC6A 1QAYA 5KQLA 1GNPA 3RPEA 4U7WA 4ZVTB 3KOMA 2QRQA 2IYZA 1XDZA 2GN1A 2ON6A 3ONFA 3PFGA 3ID6C 5EMJA 2ORYA 3X3HA 4DCPA 3LT2A 3BB5A 4JXJA 5JHGB 5JJKA 1DQZA 1DHRA 4MI3A 3ZD9A 3PJDA 5K99A 1RKXA 2XY7A 4RL6A 3L8YA 3D1QA 3SS9X 1G6OA 5I3UB 3DAFA 4FBLA 2HU8A 2W2QA 1N78A 3KK1B 4LNHA 2V5AA 3OO0A 5LB2A 3TKLA 3OTHA 1MB9A 4AP9A 1NPPA 2JI6A 4M9ZA 4ZQBA 3RUEA 1DO2A 3MS4A 3RV4A 2YKPA 3ZW7A 4Q3LA 2YNFA 3PHEA 4BLPA 2PEYA 4OX8A 4DVJA 4TQ9A 2WIKA 2BP7A 1HNWJ 3TOVA 1BQMA 3TGWA 1D7AA 4GGOA 2C57A 2BCEA 1F60A 3CX8A 4C5CA 2HEKA 3IQIX 1VR6A 3F9IA 3O3NB 1U0TA 4RAQA 2ZAGA 1YB5A 5JG7A 2BMFA 1NHUA 2V03A 5IC4A 3FPCA 3TSYA 1WKBA 1X1RA 2QDXA 4WN3A 3QV2A 2GBIA 5CABA 1Y1QA 1K4MA 2M32A 1V8ZA 3AOAA 2GASA 1NXTA 3TZZA 2FPKA 2Q5FA 5F35A 3R0QA 2VG7A 4P81A 4RH3A 2Z5FA 3LXMA 3X1DA 2XUDA 5MN4A 1OKKA 2H17A 5DX8A 1T8RA 5G53C 4J6EA 2PMEA 4QHYA 5A3QA 3WX0A 1ACJA 3AESB 1P44A 3GK3A 3GVCA 1Z6ZA 3ZWYA 1VKRA 5BW4A 1PV4A 4WOBA 1RWOA 3KB1A 4K0KF 2X76A 5H70A 4OX9B 4IR9A 2C4KA 1S6QA 4L8GA 4G9BA 1I5EA 3V7NA 2E4XA 4X6LA 1U4SA 2QJ3A 3B6IA 4FFDA 4C8NA 2BFCA 2FJWA 1UJ6A 4RHEA 2W2QP 4QWCA 3WICA 1W29A 7AT1B 2W0MA 4OCZA 4V0NA 2UUPA 4BKRA 4ZYWA 1E2LA 2EKYA 2V63A 4FF3A 3ONVA 3DNFA 1HA1A 2Q3LA 2XDWA 2IY5B 4XGNA 1N6PA 3CMMA 2PX6A 5DE3A 3KG4A 3RTAA 3WHLA 1MHPA 4CNQA 5KREA 1EVIA 4L27A 5D78A 5EERA 2QPOA 2ASLA 2AYBA 4FF1A 4EO8A 3Q41A 4V2IA 4YA6A 1U8SA 1SAYA 1U1RA 3WMEA 1XT6A 2O5RA 1RKUA 1OE0A 3I58A 4KQIA 5K0CA 2QJOA 1EVQA 2WIDA 3SR0A 2V0NA 4S2UA 3N01A 3JVIA 4RF4A 3GJ7A 1P1LA 1UWLA 1WC5A 2VDRB 3AB2B 3QNWA 2XLIA 1G0NA 5ENVA 1SHKA 3W2VA 1D4OA 5B6JA 3N2GA 1WNFA 1LH0A 2DFKB 4ER5A 2A0KA 2HHHJ 5T14A 3R9IA 4CCWA 2PS0A 1GKYA 1IATA 2IU0A 2D3OR 3R7LA 3OT1A 3HCBA 4LCJA 2XJ4A 4O2AA 5GGXA 4P73A 4XDGA 3JSRA 3KSZO 1D6SA 2V65A 3VUFA 5KYUA 1C29B 1UCFA 4IJMA 2GMLA 4EB0A 5KPDA 4IFVA 4GGPA 4BMDA 2KVQE 5DM0A 3PGJA 3QKIA 4X41A 4DJFC 1SV5A 3HE3A 2VQDA 4KL8S 3WWYA 3HMKA 4MQEB 4ICLA 1QHIA 4MV4A 1NRWA 2WD7B 3ETJA 3HB4X 4DNQA 2R2RA 3B82A 1JBKA 2I2XB 3OEEA 1YRLA 5LMNB 2XAAA 4W9NC 2F8TA 4O2RA 1RYMA 1YOVB 3AIMA 2HB6A 1I3KA 2UUAJ 2J3HA 3LQ2A 4LMRA 1QXSA 5FLKA 4DQLA 4P9SA 3KKOA 2DULA 1VGYA 1XE3A 1JU4A 1B0PA 2JKYA 4LBPA 3AFHA 4Y2VA 5J63A 5LOVA 5JQGB 1B73A 4PG8A 2G70A 5HRUA 1KTQA 1FUIA 3PXBA 3MQ4A 5D3KA 1FDOA 1FDDA 3DLAA 1VJWA 5KNDD 3SFVA 3JSXA 1H0RA 2FOIA 3UYKA 4CKWA 5WRFA 5F23A 4Y98A 1H8ED 1VLQA 2CY0A 4M9SA 3NT4A 4NS4A 1UEIA 5M2PA 2B25A 4L85A 3O93A 1DBDA 3W8GA 2C5BA 4LZNA 1G9TA 2WAYA 4I4BA 1U7WA 4JLSA 2RK3A 4L73A 4Q6BA 3ECCA 3FUTA 4V19J 3NBPB 1T6XA 4IDOA 2V6GA 1U0LA 4S04A 4KGXB 2C2ZB 3RSCA 4BNYA 4J9NA 2XNDA 3QMMA 3HB5X 1UFRA 4ZAXA 2Z6VA 1RBAA 5FTJA 3H90A 3GJSB 3JSAA 1FLAA 3K8YA 4FDAA 2D3ZA 4CMJA 2EFDB 3KUGA 3CUVA 4KTVE 1IHXA 1TCAA 3PEUA 3UTDA 2VAPA 2J0WA 1SKSA 4IIYA 1I6KA 4NJOA 4PXSA 1SUAA 2QRVB 3PWZA 5CVTA 3W8RA 1FEHA 2WP8J 1T1RA 4K5RA 4OBXA 4Q1CA 1JDJA 2RJ3A 4F7DA 2GVDC 3SZMA 5JD4A 4KN9S 4V02A 2F00A 1FFWB 1CQZA 1TO1E 1L7QA 4LVUA 3D1OA 4CG2A 4P08A 4DDKA 1X8DA 3GFQA 4TROA 4ANCA 1OYOA 4HFRA 4RD3A 3BMCB 4OH1A 3W8PA 2D1CA 2OELA 1KWMA 1AV6A 2RUGA 4DV4F 3MMXA 3AI3A 3RU7A 2I34A 2VNSA 5DGXA 1VM6A 2NAPA 3PDUA 2IIHA 3DDOA 2E5LB 1CNMA 4FKZA 1KQ3A 4LSLB 1P45A 4BBAA 1JJ2R 1CJTB 3VZIA 3NAZA 3D7NA 2AF3C 1W93A 3M0EA 1G21B 5KFGA 1T6BY 4OA5A 4GMGA 1RM0A 5JEEA 4LNUB 3ZU3A 3SKXA 3OVMA 4ZOQI 2JL1A 1XQ9A 3MEKA 1EB8A 3VOBA 3PJEA 3KYDA 1RJ9A 4EDHA 3HY3A 3OLBA 2HNZA 1M8GA 2A5FA 5BNZA 3T4XA 1R43A 3OZDA 3V6DA 2H5IB 4JCOA 1ZFNA 2YPZA 4QEKA 5MFPA 3FN4A 3KQWA 1SZJG 2J0SD 2WBRA 2QAGA 4TUYB 5EGNA 1XZAA 2QFJA 2WJHA 2JHGA 5LDGA 1P6XA 4ZV9A 4A6XA 1Z38A 4B2LA 2Q8QA 2W4QA 1SKQA 3GLRA 2YQ3A 3PI7A 3SIPA 5KJ6A 5G0TA 2HFUA 5KFJA 1JEYA 1HE3A 1A9TA 3UAXA 4D79A 4WFIA 2HU5A 2FU5C 3LT0A 5AOCA 4BJ6A 2WHOA 1URRA 5KSPA 5ENDA 4E94A 2PZEA 1NP7A 4FXVA 1E6UA 4Y1GA 4V1CA 2WAQD 3G86A 5CH7B 1SCIA 1SKRA 2PSDA 1GT91 4MTCA 3A8KA 3II6X 3U81A 2UVUA 3I6BA 1E3MA 3VGSA 1Y6JA 3PQFA 3W5ZA 2ZU6A 4UNIA 5JSFA 1QHYA 1IBMJ 4XVCA 5DYTA 4WFAQ 5HP4A 3MELA 3OPNA 4JVSB 2R4TA 1KWKA 3VHQA 2E4YA 3WLAA 3K9QO 3GV5B 3H65A 4ZJPA 2DBVO 4MR8B 2Z83A 2HRDA 3FRZA 4HDMA 3C6TA 3R0VA 2PNFA 1XRJA 3Q8YA 1H22A 2ONKA 3LA0A 1U8TA 4QJ3A 4YMHA 4ZXFA 4C11A 3JS9A 4AMZA 4GMKA 1JFVA 4F91B 5AJWA 3BA1A 3GYGA 3I42A 4B6PA 1M34B 4BFXA 3NDIA 1YR3A 4O1HA 3EXHC 4PFSA 2C2MA 1IJFA 3UH0A 3CNEA 1R4NA 4FYXB 3RAEC 4AF8A 3DPSA 4DPKA 3UJ3X 1NK9A 4LF6B 4KZKA 4MKXA 3A6FA 2WBLC 5HMXA 2XCQA 1QVVA 3LDUA 4B3FX 4ZPXA 1Z6XA 5MGBA 3GZ4A 1CNFA 5DEOA 3B38A 5AUOB 2BEUB 4FR0A 3SI7A 2RQKA 2Z57A 1Z6GA 2OVBA 3VKVA 2L9NA 4K2AA 5GOZA 3DVLA 2BBSA 1AE1A 3KIPA 3NUQA 2XB2D 1EFVA 4IMJB 4DR5J 4JFRA 5TX7A 1IIRA 5DHSA 3D3EA 3EWGA 2HRUA 5TQ2A 4JEIA 1FFXB 1TVRA 3BZQA 2JKZA 3FLBA 4QO7A 4ERNA 4ESEA 3ZY3A 3GYNA 4PAAA 5K3OA 5MAOA 1IDN1 1E9CA 4BV2A 1XLTA 2P2DA 3CCLS 5L53A 4BN5A 4HTFA 5J4VA 3F5QA 1L4KA 2XYGB 4L9RA 2HA6A 2I29A 3PSHA 4IH9A 4DRYA 1R8SA 3H59A 3UQYS 1V8FA 3NWRA 4YJGA 1VSQA 1I1NA 4E7OA 4FYYB 4LDRA 3EXCX 5BORA 2A2ZA 3KUXA 2IXTA 3ZQJA 4WV3A 1CPZA 1VMKA 4EPTA 1JP7A 5F7ZA 1J5OB 1HE5A 3N86A 3EJWA 1KEPA 4HLUC 2CN1A 1ZRHA 5C32A 3S2FA 3IEPA 3TNVA 1GNSA 4MJ7A 5HSPA 1FQKA 4RUCA 1N5OX 2VP4A 5L1IA 1GCIA 4CYMA 2AJFE 1XN1A 2VIIA 4NA3A 1ZL2A 2ZOSA 3JALB 4O6VA 5HBGA 4XTTA 3BDPA 3WQRA 3C3PA 4E33A 1VG0B 4D0RA 2FSUA 1CY1A 1ZBTA 3TNJA 1J06A 4CLDA 1FS6A 2J9YB 3QOXA 3GGSA 2RI6A 2P6UA 5F8GA 4REMA 3HO1A 2HNDB 2EJBA 4MKZA 4ZOSA 3CLRC 2R65A 2I6GA 3M2UA 4CT8A 2OCLA 3CIZA 1KXZA 1TKRA 2PKQP 4JJZA 3TVTA 4LWOA 4C43A 4C0OC 4EG8A 4HQKA 1AA9A 1QZ3A 2EZ4A 1DIRA 2O8EB 5IMBA 4ENVA 1HQKA 2KH9A 3PTAA 3TW4A 2VHJA 5CIWA 3OIGA 3VPBA 4DMCA 2YH1A 3W3AD 2IPNA 1RTIB 2BE2A 4PCLA 1S79A 2AJCA 5KT5A 1V48A 2VCHA 1I9GA 1FXUA 2AU0A 2CZ4A 2IA6A 4K9NA 2JVJA 3TQ1A 2N4DA 1U1NA 3EZ7A 3QMVA 4FCVA 3CZCA 1OHHA 3MPDA 2CQDA 3KFLA 3WRVA 3E5NA 2F64A 1V96A 2FDNA 4EJ6A 1WC3A 1QPBA 5L7YA 5HLFA 3V4IB 4LHEA 2DZDA 1K9SA 3FD8A 3ZIAD 1Y3AA 3BSNA 1WDDA 3EDCA 3S55A 2DIUA 2JJ1A 4G5FA 1FKOA 1A7AA 4QW9A 1NU8A 3LQ1A 3PICA 5LM7E 3QLEA 3CW2C 5I47A 3V4FA 1OPIA 1RQGA 4AY5A 2XULA 4L2IB 1SUBA 2ZNZA 1E3IA 1UDWA 2QQ0A 5IYZA 4NXMB 2WLTA 4F06A 4EYKA 1LZKA 3FPKA 2EDAA 1SCNE 4DWJA 1E7MA 5DTRA 2ISSD 4BVLA 2HNAA 2G1DA 1Q8KA 4R1TA 4J9KA 3EFOB 4C30A 3R9LA 4FNHA 4ND8B 1P31A 3WG9A 5B0CA 2AN3A 1E6VA 2XJ9A 5F2OA 3K9NA 2DP4E 4MI9A 3WAJA 1E0AA 4O4LA 4AY6A 2VQFB 2FJXA 2VASA 4ZP7A 3V7FA 2XHCA 2ZQZA 4B76A 4PYQA 2XDAA 2J6IA 1K8YB 3GJZA 3EZLA 3LK6A 4PLGA 1RP1A 1KL7A 3R76A 4P0TA 2MZJA 4IMIB 2O7SA 2CUTA 3ZCPA 2XZTA 1IVZA 3WRYC 1V2GA 4GUDA 3T7JA 3UD3P 4AYBD 1UMCB 1UBGA 3AX6A 2M5YA 1TU0B 2Q3CA 4OO3A 1GEEA 2CJYB 3IFEA 2R7UA 4KE6A 4OUKX 4BO8A 3W2FA 3VVUA 1D9XA 1BN7A 2O0LA 5JZOA 1QF6A 3HM9A 1HNZB 4C3UA 2JHEA 5HUHA 4Y2KA 3GIKA 3A8TA 2VZEA 1J09A 1UM9B 3EVMA 4NASA 3RVDA 5KKCA 2AFIA 4F36A 2HSEB 2J3MA 3OPVA 5HFAA 4ZGGA 3DU6A 2I3AA 5AVKA 3DO5A 1LF5A 3RUCA 4MV9A 1WKJA 2KRRA 5DZ6A 2H31A 2QE5A 4ARSA 5LIRA 1KZ6A 2WHPA 4F1JA 3KJHA 4PR3A 4WZMA 1NA5A 4CN9A 3OPXA 2AVNA 2NU9B 5EHXA 2V8OA 4X24A 2ZWOA 5TMPA 2VDNB 3B2EA 2JCXA 1RQPA 4F2WA 3WLOA 1G5TA 3EX7C 3IIKA 5TPWA 3BGSA 1EVKA 3PV0A 1F3VA 1NJIT 4GL2A 2YZ7A 3UDEA 2DYAA 4O25A 4E08A 3EDQB 3A3NA 1G6HA 1IHYA 2R1TA 1AKVA 5C1IA 4AZ3A 3PUVA 1O7JA 4BZQA 3IOMA 5EIOA 3I62A 2Y1RI 3E2MA 1LQ9A 2CL6X 4PCVA 3FKSD 1JBQA 2EXXA 1YJ8A 2PMKA 1VHJA 1KDVA 5AKZA 1WV0A 2X9GA 4LTMA 5NLLA 1U9CA 2AOUB 1H2XA 9LDTA 3DJFA 5BYKA 3H5AA 4LF7F 2MGZA 3UZUA 2ZWPA 2QRUA 5BV8A 2QRZA 3US5A 1RI1A 5IHPA 1R0CB 3IR7B 1RXYA 3LDAA 2Z56A 3O73A 3Q4GA 1WNTA 1KH1A 4FWTA 3ZQ6A 1J8DA 1TIPA 4ED4A 4FWIB 2AX1A 1ZP6A 4FOPA 1HD1A 3ZGYA 4IILA 1WBBA 1OV4A 3IAFA 3THOA 1FNXH 4YMVA 1IHDA 1YFKA 2ZKUA 4DCUA 4J3NA 4DN6A 2O6HA 4B3GA 2Y1CA 2PKWA 4KKVA 1OTXA 1QCDA 1X87A 1UWAA 1ULZA 4IYJA 3DDWA 4DG8A 3NT5A 3F96A 4GX2A 2OP5A 5FOWA 3EXFB 4BATA 4YPFA 2FZCB 2NPOA 2VD3A 3C1OA 2QT9A 4JMLA 4COOA 3KQNA 4OXYA 3PWSA 1BMQA 1RM3A 5K14A 2XB4A 2BOPA 2GILA 1EA5A 1XWFA 3TUPA 4QXPA 3X1JA 2W71A 2HA7A 4MWDA 4CKBA 4L0QA 1Z0IA 3VR2D 3I0RB 3G8BA 2IPMA 2YQ0A 4JVLA 1KHWA 5HILA 2XTJA 3CZRA 3NP7A 2BJ1A 1GNKA 3QBJA 4D92A 4TY8B 2CFTA 1Y00A 4J1NA 1YHZA 1DKNA 3HKBB 1ZITA 5D3GB 3B1WA 3DTVA 3OP1A 3RJMB 3NG1A 4IUCS 3OQIA 1HSZA 1Z15A 2W37A 4OZLA 4TLMB 3OMLA 2O23A 2F7VA 4HB3A 1B41A 1ZGGA 3ZWCA 1K5HA 4FYDA 3PT5A 1ICEB 4NL5A 1FJCA 4HHEA 4Y67A 4QYWA 2H9IA 1CSJA 2C5HA 3D8SA 4TWBA 4M0CA 3RRFA 4DDWA 2C31A 5JSUA 4YN3B 4TTSA 4FYVB 2ZI3A 3W1EA 5EJ9A 3TMYA 3QQ5A 4XSHA 4USUA 3WK7A 2AHOB 3C39A 2UVPB 3IA0A 4IFIA 3AVWA 5LU8A 1TMMA 4RJVA 3DC2A 4EB6A 4B5LA 1OQ6A 3IBCB 2EJCA 1PUIA 4TWAA 3FC9A 4BMSA 3CN9A 3EGZA 2B43A 1USWA 2COEA 4WSOA 3KXLA 3L4SO 3GO4A 3CW9A 4JV5B 2H7YA 5CTAA 3WZMA 5IH7A 1TM2A 3ECAA 4US0R 4I5EA 4KCGA 3MCSA 1BW9B 3QHPA 1TQHA 3RT1A 4X1OA 3RDPA 1Y8ZA 5FR1A 1Q5YA 2QIOA 4Y2RA 3M2VA 2YHUA 3CPSA 1HPLA 5DOVA 4Q37A 4DY6A 4IAOA 5F1OA 3IKTA 3DR5A 3WP1B 3W0LB 1UBRS 3MM7B 2HJSA 2XTJP 1ESCA 3OLWA 4C0AC 1VS3A 3FMGA 2L82A 1O96A 4P6VF 3SM9A 4QTUB 3CKLA 1NJWA 3MQFA 4ZK6A 2LXUA 4DIMA 3NKVA 4LRCA 1E69A 3B1VA 2H5EA 2D3O1 1UP4A 4AXXA 3ZHYA 1RAIA 3QRQA 1R0XA 5LDHA 3HDVA 3BGDA 2C5LA 1FYWA 4HV4A 2VOEA 3I09A 2LEAA 5F2NA 2LVWA 1E77A 3I96A 3O94A 3P52A 3D67A 4WRRA 3NR2A 3KSBC 3TQHA 1UQUA 3F78A 5B1EA 2IUFA 5CLJA 2BGMA 3L6DA 1CTQA 3BE6A 4IH4A 5EKTA 3ZY6A 4X7RA 3O8WA 2HYIB 2HW8A 3P0RA 3ETHA 5GONA 4ANFA 6LDHA 5G4KA 5ICMA 2REQB 5HFNA 3QI7A 1I51B 4FX5A 1QS0A 4K6OA 3M2PA 1S0OA 2RJZA 4M1QA 2PUGA 2WIGA 3BYPA 5DX1A 2QSWA 2BGRA 2EIXA 4E2FA 4Y8VA 4DXDA 1UFVA 2YOFA 3S1AB 2VYFA 1XA0A 3QWFA 1ORWA 4CW7A 4JJ4A 3P0IA 4A48A 2ZJ3A 4HEA6 2BKVA 1XDSA 2X7JA 3H19A 4U4AA 3FBEA 3E70C 4RV9A 5EE9A 2FJAB 3A1TA 4N77A 1N6LA 1X5PA 1RYNA 5J2UF 2NZCA 3SHOA 3T7SA 4N5MA 1GYQA 2JGMA 3LP1A 3F8SA 2G2ZA 5COQA 3D6TB 2YN4A 3JU3A 2O2YA 5FNVA 1SQEA 1U4BA 3GD7A 2CJ9A 1TTTA 5E6SA 4YQYA 3ZGNA 5BOSA 2QYSA 2QN6B 1A8HA 4RH0A 4DR6J 5IXJA 3LKDA 5KG4A 5CDHA 3PGA1 3ND5A 3GNLA 1QLNA 1Z5PA 4G1VA 3CXRA 3OAAD 3D0IE 3PC7A 5ED0A 5EZYA 3AD7C 2AMYA 1YRUA 1DLOA 4OK6A 4G4SP 4KU4A 5FRDA 4XVHA 2HI0A 3TTYA 3U9LA 1SU8A 5A6SA 1WDLA 2A6MA 2DUMA 4DDVA 4QIEA 5I48A 3NNAA 1NJ5A 1Z8HA 4OU5A 2G06A 2AOVA 4EG1A 5B30A 5BR7A 4ZYZA 5A0FA 4XB2A 2KB2A 2EW1A 3T35A 1V95A 3JZDA 5DLEA 2JOQA 5K8LA 3WLSA 4C0WA 4L3WA 3VSEA 4JVNA 3KLGB 4I55F 4HH1A 1CULC 2QGNA 1L7DA 3HJRA 1EJ0A 4QOSA 2ZYWX 1BQEA 3AVYA 4OXRA 4H17A 2D06A 2XWXA 2F1IA 4II3A 2XUAA 2VFVA 1UK6A 1WG4A 3DOKB 2ZREA 5DNWA 2CBZA 3PEEA 3W78A 4YP6A 2ZE5A 4MGEA 1PYTA 2EZ8A 8AT1B 2HBYB 3MDFA 3DLIA 2H8GA 4YXWD 5J2TF 5JWHA 2CLEB 4IRKA 5FTMA 5I9NA 2J6TA 3TINA 3AUFA 5L45A 1IY1A 2VDWB 2ECKA 2O9JA 4TXMA 1NDKA 2DCMA 2CNWA 3NS7B 5IEBA 1O87A 4LZPA 1JLAA 2AN9A 2PH5A 4ZOAA 4BJHB 3ZHVA 1QGAA 1K6EA 1YFLA 4ENPA 1C8VB 5FHQA 2J0EA 2GSDA 2EKBA 1GRCA 4B32A 3OOYA 5JHHB 3GFBA 1NBMD 3NWBA 2VDHA 2E4UA 4YMIA 3M5DA 2I4IA 4NOKA 1ID1A 5K20A 2Q8NA 1GG8A 4B08A 4O2BB 2Y0BA 5EX0A 4ASUA 2LXNA 4MUBA 1P7CA 3U1LA 2DRBA 3T19A 3ZE1B 1C1YA 2Q43A 3DBLA 5DW0A 3OTBA 4WXMA 4J0KA 3I0NA 5DWDA 1YJXA 3C5WP 5HKKA 2EFNA 4EMTA 4BX2A 2CWXA 1IQRA 3RVPA 1GMWA 2F59A 2PUFA 4IG4A 1IEVA 5BRNA 2BM1A 2CPJA 1UKUA 1GX6A 2B9VA 1FX4A 3GFGA 1MF7A 1ZVKA 4UU8A 3JYHA 3OZEA 4I1VA 4A73A 3IESA 4RO0A 1ZAXA 4Y1FA 1DTTB 4ZC8A 2FEWB 2H4FA 4LXTA 5CCLA 1I4OA 3OL7A 2KS6A 4CL0A 3OR1A 4Q4DA 1E2DA 3LPLA 4AICA 2VHZA 1WHSA 4AG5A 3DVRX 5HMLA 2ORIA 3G5MA 1OX4B 2IFXA 5J1EB 3QG5A 5KT7A 1CVLA 3RYFA 5E2BA 5BP7A 1BRMA 3EMTA 4BRWA 4LK2A 1JJ4A 1UFQA 3TVYA 1PJLA 2RKOA 5E2QA 1GMUA 3DRSB 2C78A 4X2BA 3V1MA 4KQJA 5AKKA 3S2GA 2H9ZA 2ZRFA 4CCSA 4YB1P 2D8MA 2COUA 3IAS1 3JQ7A 2XYPB 5GJCA 3SE0A 1RQ0A 3PJWA 1I4TD 2J30A 3UG7A 4OBBA 2VG6B 1UZNA 2V1XA 3GT4A 3N74A 3HUUA 4ZWNA 1VBFA 4FONA 3R5JB 4Y2SA 5E6RB 4YY3J 2FTKE 5TQVA 1II8A 3DRYA 1E3QA 3E18A 1XXHA 2HCRA 3IT3A 2RAVA 5KMGB 1T2NA 4DQVA 4D9KA 5BT9A 2ZH7A 5EJ2A 3F49S 3ZBTA 4DSFA 1N4LA 3NAGA 3H40A 2JC3A 4GE3A 4GMDA 5K3AA 3BBFA 3K5WA 1V4NA 3DZKA 4ITVA 1V7QA 4OJNA 5C42B 2W83A 3C5EA 3I01M 5LYJB 4JI4B 3REQA 1LXCA 4PYMA 1AT1B 4CO3A 1M2NA 2QUHA 1A71A 4CLOA 3DFEA 1AZSA 4G89A 5KTTA 3HWWA 1JT9A 4XAQA 1DJQA 1NGSA 5LL6P 3DVQX 5EXDA 4JKIA 3WL4A 2B2CA 2ODNA 1FUKA 1JHOA 2ILTA 4BDSA 2Q41A 4JJAA 3Q3JB 1CBKA 3ELUA 4O8ZA 4CE6A 4CODB 1L4EA 2WHQA 3AK4A 1RTHB 1TCBA 3HVUA 4LTDA 4GKKF 3DLEB 2VJPA 2C3UA 2R6HA 2QRJA 4OHCA 4LT6A 3N87A 2C8VA 3PNOA 1PR6A 5IXUA 1V7PC 2R4QA 2IYNA 1XKQA 3DFKA 3B5IA 3OLQA 3R7BA 3HN2A 3WZ2A 2OFHX 3DYVA 4WZ6A 1DBRA 5C8DA 5A3RA 2K4MA 2OD6A 4JQOA 4OQXA 3CR7A 5HVHA 4NJMB 5FLEX 1VSUA 1HO3A 3I1YA 2B56A 2POQX 1FJGB 1JU3A 4HTAA 4PLWA 3DOOA 4H59A 2GH1A 3HCEA 1MEEA 5EP2A 2V74B 4RDIA 3CE6A 5EINA 3UV7A 2QLBA 2PR2A 4R1OA 4RW9B 1IQTA 2Q3DA 2CHUA 4RZIA 2PE8A 3EFEA 4L4YA 3EPRA 1IHOA 3OTGA 1TGYA 5H3LA 3WO0A 5A06A 4NZ6A 4JV2A 3C6BA 1V16A 2QL7B 4EIWA 2QL5A 3BBBA 3H2YA 5EWFA 4GOLD 4ZCRA 3CB2A 2CVOA 1ZL0A 3BSAA 2GESA 4ADSG 5LP1A 4CWAA 1WZ2A 1P4AA 3BB4A 2BHNA 1RFGE 3RNOA 2Y66A 1HNIA 4X4TA 2J9EA 2ACVA 4ZLPA 2AX0A 2XBMA 3VZDA 4HXYA 4KH0A 5E8JA 3RW7A 4X62F 3UAWA 1KYWA 1S9FA 3UQZA 4KJZA 1BE0A 2OKQA 2H1VA 1TKZB 4GKAA 2Q2VA 3K0CA 3WGUA 2JLUA 4ZHQA 1UBCA 1YRXA 3M6IA 3KAKA 4AG3A 1VTKA 4F6RB 3ZI4A 1RCUA 2H1IA 2F90A 3H99A 2HA3A 5KVSA 2PKXA 3IGVA 1UBTS 5FT9A 3DKPA 4Z8XA 4ZPVR 3PE6A 2J5AA 2LIPA 3AM5A 1JFFA 1NJZA 3GJRB 3RJ5A 2W9CB 1Z4LA 4IIEA 4O44B 4YHHJ 4H3SA 2BRUC 4IDAA 5A5EA 1TL1B 4J9VA 2OP0A 3DLCA 3NGSA 3OC0A 1ODSA 1K0FA 3W9BA 1WUUA 3G0HA 3WK6A 4B09A 4EHFA 4GR5A 2PIDA 5CTJA 4L4ZA 4HAZA 4TMZA 3F3KA 4QYZK 2WSMA 2H00A 4P9NA 1BCRB 2EU8A 2WABA 3F1KA 1K89A 2QI9C 5I4MA 4LRTB 1L3VA 5AVSA 4EM6A 1FFEA 4UBKA 3A3PB 1QRDA 4N7JA 4WKCA 1HQCA 4CFZA 3QG1A 3RS3A 2WKQA 3AQIA 3GDWA 4DWIA 3I31A 3MUOA 3WYDA 3DW3X 3T9ZA 5JXJA 4LMPA 5JVDA 2IXBA 1Y5LB 1ONSA 3EMVA 3MGKA 1QHXA 2NXWA 5EJ5A 4LFBJ 1F5CA 1SQSA 3GRVA 3NUGA 3HDYA 4FGKA 5AI9A 5ADWA 2WFAA 2HNYB 2IITA 4JYZA 1I7DA 1N36J 2X4LA 5AHOA 1G9XA 4H0FA 2RSLA 1DBWA 4QE3A 3FK4A 4TN2A 1TX4B 4OAOA 3HMJG 5DRYA 5G0RB 2IYSA 2ANBA 3OR2A 5DTQA 2MYFA 3U4MA 3DMFA 1LKZA 3PYDA 1BQXA 4L8LA 4ZQEA 3UDLA 4OQEA 5BMVF 4ZO4A 3D3QA 1QFYA 4ICIA 2ZUTA 2AKEA 2NNWB 2O2HA 5FUMA 2HMSA 1E3TA 1W85B 2VHXA 4UXHA 3OFSA 2VYQA 3DOEA 4NLLA 1MNQA 3LUHA 1XMQJ 4C0SA 4D8VA 2UUOA 2VHEA 2AZTA 5JMOA 1KTVA 5SYAA 4I0WB 5JANA 3TPFA 1E1KA 3J7Z5 3A4YA 1A9PA 4X8OA 3CC8A 3TFQA 2QBYA 1X7HA 3K05A 4J0EA 4D9IA 2QL6A 1XK6A 4G5RA 4GI2A 5IHXA 1U1FA 4ZTBA 1F0XA 2F9JA 3WRXA 2QP3A 2YRFA 3OT5A 4U0KA 1NJSA 1JXLA 2XODA 4E0BA 2CJAA 1ACLA 4OMDA 5A2GA 4KXLA 2PQ2A 5AKYA 2PBRA 4KMMA 5DO9A 4OJHA 4NBUA 3DV0B 2V2VA 5HIAA 1XMBA 2Q3EA 5FUBA 2JLXA 3L07A 2H65A 5IUKC 4PN3A 5ELXA 5I9BA 5LQUA 5AVJA 1C5KA 4A8JB 4PZEA 1CUUA 2J0UA 4UHJA 4CEHB 1UEVA 4NYZA 4ID3A 1PQ4A 2OSRA 4UVGA 4I4LA 1WMDA 5IK2A 3QRWA 5RUBA 4EPYA 1P4SA 3H6HA 1IBLJ 2Q1WA 3TL2A 2WSSA 2JLWA 5IABA 2KN4A 3GILA 3Q12A 1T2DA 2XF8A 1KHVA 2P3QA 4N7RA 2X40A 3D5MA 2ASVA 2GW8A 1VBYA 5CDFA 3C3DA 2FSSA 1Q20A 5EMHA 3A9VA 4XWKA 1SUFA 5JROA 5AJZA 3C8HA 2EJUA 3MWFA 1X31C 3OBBA 3T9BA 1GCAA 4WK4B 2V3VA 4Y6OA 1R6DA 5MN6A 5B0FA 5AVXA 4URQU 1GDTA 3R6LA 3S27A 1WMBA 2ZJBA 3D6MA 4ECRA 2ZH6A 2XUIA 3HNPA 4OQ4A 5L6LB 1CC7A 3W5BA 3L7MA 4LQ9A 1CUIA 4AB1A 4RD0A 3FFTA 4ATNA 1JEDA 1T15A 3Q40A 2GI4A 1T03A 4UJ5A 2AVDA 1XR5A 1EDOA 1ZA1A 3PEYA 5HGJA 1CJCA 3MFHA 2XGOA 2DH8A 3JWGA 3KHUA 4AK9A 3IP9A 4HAWA 2PNJA 4BQEA 1ONPA 3SX4A 2A4MA 1Y3BE 1X1TA 2PGNA 3PRYA 5IJ9B 4ECVA 4EHLA 4PPGA 3T0GA 3PHLA 1QMGA 1KFCB 2QSZA 2OH2A 4LF9F 2FSIA 3ELYA 1N5JA 4HSGA 1E2KA 2P7IA 2UU9B 2V7TA 2CLOB 1NKTA 3G7NA 4KSCA 4V03A 1T36A 3K4HA 1RCFA 2QX4A 3DRRA 5L3SA 4R2IA 2ZP1A 3KEOA 1JI0A 2ZH2A 2FKAA 2KWIA 3NP5A 3BMQA 5BSEA 1WG5A 1JA1A 2R6CA 2A1BA 3FR8A 3RLIA 5BN4A 3CWCA 2WWYA 4DNPA 1SCBA 4CM8A 4B4VA 3SF8A 1E2IA 2GEUA 3SCKE 2FJUA 3S6EA 2D00A 4YJHB 3GL9A 5M29A 1QC5A 3UJAA 5A76A 1NN3A 5TPZA 3E9CA 3GUVA 3ASYA 4MAMA 1XWIA 3K7EA 3T52A 5CD1A 3AR9A 3KLFB 4BVKA 5FWYA 2ZT6A 2Q9AA 3ZBUA 2ASDA 1ESEA 1PR9A 2NUAA 4YR0A 4RF5A 4FXDA 2HSDA 1RLCL 4LJRA 1BXRB 4NIMA 1H23A 1F5AA 3M70A 1VI6A 5C8YB 2DGQA 4GYKA 4REOA 1P1CA 3TZYA 1YQTA 4GECA 3FSEA 3DE7X 1FU4A 4J0HA 4Q9KA 1L4NA 3PC3A 1C4OA 1SXJD 3V48A 4RVCA 2WU8A 2X5KO 1H8HA 2YWEA 1V2HE 3QLTA 4E2YA 3N0VA 4C14A 4KV8A 2HF9A 2WZDA 2I80A 2GRUA 2YX4A 2OBBA 2XWBF 2J67A 4KGKA 3PJ9A 3OTEA 1KNXA 4X65F 1T6NA 4BEJA 3PX4A 5EE1A 3SHFA 4Q4HB 3SSRA 5L3QB 3IUNA 4MIYA 4R1LA 3RVBA 5ALNA 5DTJA 4AULA 3J7YI 2KJQA 3NETA 2HQFA 5BO5A 2KFNA 4XR4A 1G8JA 3CC4S 3VR6D 1GCGA 3PDCA 4IDPA 3UVJB 3WIUA 3GR0A 3VKWA 3U1TA 2BFBB 3RS8A 1E32A 1ROFA 2XPCA 2PO5A 3V2IA 2R7VA 3UJ6A 3AF6A 2KG0A 3IAM1 5DNCA 4F4KA 1Y7PA 4BJ3A 4M5KA 4IFYB 4LDNA 4NEHB 3LP0B 1OJ7A 3K32A 2GFHA 4ROTA 1EH5A 3A4VA 2BUNA 1UXOA 2ZETA 4RA9A 2WKPA 1SK9A 1KMIY 2V3CC 1NKEA 4G97A 4W8GA 2C8KA 2ZR8A 4E13A 4QUEA 1BKYA 4J1TC 1XNGA 1TPZA 1DKPA 2IJGX 2SKEA 4HAOA 3ESQA 1NT2A 4L50A 4HHJA 1B3BA 2WV9A 2XUKA 2R2UA 1WJ9A 4MDYA 1S76D 3DQPA 3P0HA 1ADGA 2CKWA 1CZRA 5CZXA 3Q87B 4R25A 1RC1A 5LZ8A 1NSAA 1U7XA 1Z73A 2NU6B 5FX2A 4TSKA 2F17A 3O4VA 4PZPA 4HQOA 2FMTA 3ZZZA 1YS2X 3KZVA 1EP3B 3A2MA 2HXYA 4OAPA 3QVGB 1Z2CA 1LDGA 3D7MA 4BKMA 3FR7A 4RENA 2MSKA 3F4BA 2DH7A 3K0FB 2GCPA 5DBHX 1I5OA 1YC2A 4TWRA 2ZZMA 4YREA 5HVNA 5IBQA 4C0JA 1ZXXA 2ZIWB 2KU7A 5IDYA 1G4UR 1HBOA 2FUEA 3Q8QB 1VP9A 1FDVA 2HBRB 3QP9A 2B34A 3FTNA 3L1UA 4X3CA 3OU7A 1X1BA 3VHLB 3PUKA 4YASA 3UICA 3KUCA 3X44A 3J7A1 3W9UA 4CEJA 2BKLA 1T8UA 2K7KA 1C14A 2DVMA 5BVGB 4B33A 2X7XA 4DV7B 2ZSEA 1W25A 3HHLB 1FFGB 4O0MA 3FEZA 3DUFA 5AWFC 2DBYA 1TL7B 2YQZA 3BTOA 2J4FA 1N33J 4YQFA 3AVVA 1SJRA 3H5UA 4DV1B 4C6AA 4K6MA 1GQOA 2Y27A 4TXJA 5A05A 2DGOA 1VJGA 3UOGA 4BP3A 2UUCB 2W6ZA 4OYYA 4YFUA 3ZJ5A 3THRA 4C0HA 4ZAZA 1VOTA 2VKTA 3ORFA 3C7AA 3MB8A 4MICA 3JAWA 3L0PA 2FSVC 5F73A 5HJ7A 1Q6YA 1RA7A 3MWEB 1VRUB 2Q6BA 2G1JA 1KIAA 3G68A 1DS6A 2ZPUA 4EZ9A 4QUKA 5F9HA 4EPVA 2VP5A 1IWOA 4LOKA 3MPYA 1X7VA 4JI6B 1VQ5S 3AHGA 4PHHA 3H9EO 1CS0A 5I9IA 4X00A 1B70B 3HCDA 7FDRA 2C94A 2V6FA 4Q16A 2VUIB 3TOCA 4F4UA 5JALA 3RR2A 1AOXA 1L7MA 4X64B 3Q89A 3OICA 2R00A 1NSYA 5EY5B 1K0UA 4J9LA 3RB4A 4C98A 4MOWA 3BXEA 3PRBA 1V9CA 3H8YA 2PFSA 3ZTRA 1GTVA 4J94A 5DSZA 1KEUA 1V6CA 4YDQA 2IS2A 2FPWA 4CLRA 3TIFA 1EBUA 4ZVOA 3D5TA 4XIGS 4NDNE 4UARA 3WAKA 2B30A 3HVHA 4ZARA 3F7OA 3WBBA 1AKQA 3IQWA 3EPPA 3A14A 4CETA 2VZ9A 2CMKA 3B12A 1RA6A 4AD8A 1JNZB 2H7XA 4Y9TA 2ORVA 2VPIA 5D3QA 2VWQA 5TB5A 4CM4B 5EQDA 5A4IS 3OVBA 4DNFA 2I67A 1Y1KE 4XFDA 2GLXA 1VI2A 4Q15A 4BCBA 4JX9A 1XL1A 3EG5A 4LCEA 1RW4A 1ZGBA 3VTAA 4WVLA 1TZBA 4O2LA 4OXQA 3KELA 4B3TB 2VJMA 2C4MA 5I7AA 1GPAA 3MW8A 3VH1A 2QYOA 4MAAA 1NK6A 2YY3A 3MSCA 3ZXXA 2Z3VA 2PGOA 3JTNA 4MWBA 4KGVB 3U3XA 3Q85A 1MW7A 3GLUA 4BBPA 3X1WA 4B7CA 1R18A 1VBMA 3MEDA 3IT0A 4RKRA 2FR0A 4R9NA 3SYRA 3N2KA 3FB4A 2HDHA 1KKMA 4RD4A 2Q45A 2W2KA 3WKEA 2P4HX 2E1PA 3O44A 1YJCA 5BN5A 2SECE 4FE3A 1USGA 2RAPA 3PD1A 1YQEA 3C4QA 5L8RC 4YMTA 1JXEA 4MK7A 1N56A 4QDOA 3M4JA 3KHHA 2Q2OA 2V4JB 1JAHA 3ZUPA 2PWPA 2OPPB 1YC5A 1RT4B 1NMZA 1KFJB 1HI0P 2Q66A 4UTVA 4LY3A 1X15A 2OLKA 1EG2A 1F9EA 4DXHA 1AH2A 4R5MA 1FNCA 2PUJA 3EBPA 1YJBA 4C8KA 2FWRA 4JCCA 1Q82T 1DOZA 4QSMA 2ZRIA 3O8QB 4Q5IA 2Q2NA 1UOQA 1IBCA 5D6OA 2BANA 4ZP9A 3I1FA 1QNFA 3ROZA 4MJXA 1MROB 1NATA 1C1CB 5FO0A 4FINA 1X0VA 4HDCA 1JR2A 3LK7A 3PWKA 3UUEA 1Y7LA 4Z1MD 1IZ8A 1ODTC 2ZG6A 4JQZA 4XM2A 1FKPA 4DUTA 1UVNA 1RWPA 3TUIC 4DSUA 3AF1A 1X1AA 3C3EA 5KTRA 3AGQA 4DREA 1W4ZA 3PT9A 1ZYQA 4X45A 4X71A 4OATA 4B2IA 2QMUB 3NC4A 2PZ8A 4MVCA 3K70B 1PFWA 2J8AA 1ES9A 1Z7BA 2HL6A 1CUDA 3KB8A 3F9CA 5AI8A 1YB6A 5J40A 2POCA 3DV9A 3VYVA 5DJBA 4GGMX 1JKHB 3U7EB 4LYEA 1LDBA 5C25B 4HK4A 4BCCA 4A92A 3B52X 1XWWA 2Q29A 1FK8A 4TQGA 1PWHA 1NW6A 1FYFA 3TCXB 2N3OA 4KAIA 1HMPA 3PNQA 3I05A 3OIWA 4PONA 1CEYA 2QMQA 3RYHA 1WOOA 3ZO7A 1Q1BA 4DV6J 3SHWA 1PQYA 1PQPA 4WT7A 1UL3A 4HT3B 4DKJA 3EXIB 4DR1B 1Q0LA 4RJLA 3NYRA 4PN7A 3P9PA 2HHWA 4W5WA 1QYCA 3KLBA 4A82A 1OT5A 1IK4A 2O1PA 1FJEB 3ZDFA 1TVKA 1O95C 2QB5A 1DWUA 2FV8A 1KBRA 3CH7A 4U6QA 2M2BA 3IYLW 3HVTA 2P75A 3F3MA 4BFYA 4OYLA 1F1BA 3FPSA 1H6DA 2G5CA 4KG7A 5BPHA 1KO1A 3JVDA 1U0HC 1CXZA 2P9ZA 5ALPA 4N18A 4WASA 1XVLA 3OSUA 3GWCA 4ALJA 4JP1A 2QLNA 4NLTA 4ZIWA 2WU0A 1OGYA 1JX6A 1SL2A 1X7YB 1R4AA 3AOEC 4GMXA 4OHMA 2OLWA 4N3CA 4KAAA 3NAHA 3SQLA 2PUEA 2WU1A 4MVJI 3FVYA 3GEBA 2B4OA 2UXCF 5KQPA 3IC5A 1OH8A 5KT3A 1PG5B 3UY4A 1QDEA 5BY2A 4ZEVA 3WL3A 4FFSA 2ZJQQ 4X7MA 3LCCA 3HFRA 2EQBA 4IOKA 1PI3A 4ZVLA 2E5FA 4OHPA 5CFNA 3RSSA 5DHFA 3T6JA 1PKXA 2GVZB 1OLUA 3A6PC 2W2TA 4HVTA 1C3LA 3MUEA 3MR6A 2RGBA 3D02A 4K2HA 3KG2A 1IK6A 5KQMA 2DM6A 4DEYA 1X5OA 2ECFA 5IAKA 4KH1B 4U7HA 3JQAB 1EI9A 3B1JA 5DGAA 3GFOA 1HHSA 2LA6A 1TFRA 1LPBB 3OEWA 2ZROA 1DFIA 3FBWA 1EJ2A 2EPIA 4Q3CA 3WDOA 3U40A 2F7SA 3BFJA 1BS2A 4WBSA 3M8QA 1S2IA 5IC6A 2J6BA 2OUIA 1PTJC 1Q4RA 3P8BB 4JR1A 1AGXA 5E4JA 4WCFC 4OHRA 2Y9PB 1CFZA 3D3WB 2RS8A 2XMKA 2C4NA 2ZVJA 1U04A 4BQOA 2CNNA 5GZ3A 2N3ZA 2HQCA 4RWZA 3T3HA 1ZUWA 3ABRB 5AJ3F 2QQGA 1R8JA 3W5XA 2IHZA 3M6WA 3I6QA 1J70A 3CSKA 4KYZA 3KDPA 1QYDA 1D9ZA 3V34A 3L3CA 1GGHA 3ZLUA 3UD5A 3KEQA 1ITZA 4ZAGA 4F4CA 3E3NA 2NUHA 3S99A 1M6VB 2FZEA 5B58C 3QUSA 2C97A 2VPQA 3JAMY 1WSDA 3LQRA 4GNKA 3SBEA 4KE5A 3M4XA 1JAYA 3IMGA 4QBKA 1FVQA 1VE6A 3HPQA 4RBVA 3W3ZB 4AUEA 2YZMA 1D2EA 1KJZA 3NBQA 2GNAA 8ATCB 1FPQA 4PFJA 1P7YA 3STYA 3V5RA 4JVMA 5AH0A 1MJGM 5LZ9A 2VAMA 3HEMA 1PO7A 3GVXA 3SXPA 4A8MP 7FD1A 3IDOA 4GSYA 1PIWA 4WI1A 2OBXA 4FXOA 3WWCA 3RHTA 4ZANA 3HDGA 3NS5A 4JYAJ 5B2EA 3QPWA 4I1UA 3GZTB 2J6HA 1KOGA 3L5KA 1EZZA 4WXWA 4JGBA 2G1KA 5AI6A 3V1KA 3ZJVA 5AFSA 3ZI7A 2F1JA 2OTLS 3MUVP 2R6AA 3OKFA 1ZPDA 2BE7A 2AXPA 3VI4B 3L4BC 1G4HA 3H84A 4B9NA 3TJ9A 4QWAA 3ITHB 1VE7A 1N2CB 3P71T 1QIIA 1ZSVA 1SCJA 5LA6B 4PWYA 5EJGA 2RJOA 3KSAC 4GI3A 1HDZA 1RHQA 1NUEA 2GZAA 3C66A 3CF6R 4K46A 1TUBA 1QE0A 3KV1A 2WHRA 4OYAA 4JENA 3ZLJA 2Y9MB 2Z8ZA 1VDMA 3LVRE 1XU7A 1R50A 4GC6A 2PXXA 3UGKA 3KVNA 2FWBA 2QYHA 3JD2A 1KC8T 4F4ZA 4RGQA 3V4LA 4IF6A 1V3ZA 3P4UA 4KSYA 4ZHRA 4QBTA 1O57A 3H42A 1RXUA 4IQXA 4MKFA 1UINA 1G66A 4P0QB 1NXIA 3NH9A 1ENYA 3AB3A 2HWXA 2VT6A 1RK8A 3V6KA 1MX1A 5ENZA 1YD7A 1IZ0A 5KYXB 2XXJA 1M33A 3QE2A 4J0FA 2OR3A 3BH0A 4HDNA 4OL8A 4AUKA 1L3TA 2MQ8A 3LL4A 5KT2A 1DADA 1CQXA 2Y68A 1LEOA 2XVMA 5CA5A 2F5GA 1VLYA 2Y99A 2I55A 1FTQA 4PS0A 2EARA 5B1HA 3QPAA 5L39A 1WB5A 1LPPA 1PJ2A 3MM6A 4KO0B 6ABPA 2B6AA 1D3WA 4QFCA 1L5GB 1EAYA 3WIBA 1KHTA 1W35A 4WK2B 3OQMA 1O51A 1R64A 2RHCA 4QCLA 4PSDA 1VE9A 4A1OA 5KOWA 1Z29A 4IXMA 3NQ41 2W8BA 3Q23A 3GMTA 3BH7B 2A33A 1RJFA 4KQKA 1HNXB 1S10A 2PUHA 2OAQ1 1ILWA 2B8QA 3JQ8A 3V7UA 2RE1A 2R97A 1HKUA 4JBHA 4H7DA 3MD0A 4AAYA 3B1KA 1JIVA 7REQA 4GIBA 2PU5A 2PL9A 4RTSA 3VZRA 4JP2A 3O8BA 1SU6A 5AHKA 3WLIA 3O7WA 1P5RA 1PZHA 2JGDB 2OCXA 3C3YA 3QVTA 3R9WA 3RUAA 2RRBA 4MCIA 3MJRA 3GLGA 1FJ2A 1B93A 2XNRA 2PSEA 3T3DA 4ZI7B 2RARA 3AG5A 4DANA 3H11B 1PJBA 4FDLA 3MM9A 2PMCA 1FA0A 4LYHA 5DM4A 1KI7A 1TEHA 1WO8A 1NCLA 2KM8C 2ZYAA 1M7GA 3ELBA 4Z3OA 1FWKA 4X20B 4WZBE 2DFVA 4YWHA 3RAPR 1RT6B 5I9TA 3TIIA 4HDKA 1IR1A 5IAAA 2QD4A 2V9PA 5IKXA 2VOPA 3K6RA 1Q8IA 4JLDA 4ANEA 3CLSC 3O6VA 2IYUA 1J27A 3KFWX 2VDUE 5HDBB 3PTLA 3UMCA 4FYMA 2F3TA 4FZRA 4NFSA 4DRXA 3P9YA 2OFWA 2V2QA 4U7FA 4ZOLB 2ZDPA 5DQHA 4X92A 1MBZA 4KHPF 3HCWA 4IDCA 4LF4J 3UJPA 1J2YA 2QMOA 4PIPA 2PT5A 4DR3J 3HBAA 1YBTA 3R3VA 5GM2A 2XCTB 1HDCA 3JPWA 5ECWA 1DFDA 3D7SB 4H54A 4HACB 3K5IA 2WBMA 4ED6A 3FE2A 3IKVA 3EGDB 4RPIA 3Q8SB 4X4VA 5I51A 2VG5A 3HL0A 3H1AA 4MTPA 3QWUA 4U9UA 3H6KA 5L46A 2EFQA 3C8UA 5LXTB 5E2IA 1EKXA 2FSGA 2A9PA 3WQBA 4KMOA 1XJCA 1GR1A 4LHWA 1N57A 4A8OA 4OZ3A 3LRPA 3NKLA 4U6SA 4C22A 3VGPA 1RU2A 4DT1A 3WLEA 1C1XB 1B00A 4EHNA 3GFFA 1AKUA 2ZRDA 2QVYX 2D74A 1IJEB 2HT6A 1NTRA 1Z88A 2HEIA 3GLIE 3HXQA 3HRHA 2O5EA 2AYEA 1UWBA 5HFJA 1O4VA 3O47A 4PC6A 1F20A 2ATEA 4PQFA 3MM5A 1X2BA 4HDHA 1Z06A 3Q5GA 1NKSA 3BF4A 1S2GA 3DXXA 2CNKA 2WYUA 3K6SA 1E2MA 2PLFA 2VQEF 1VCIA 3FHTA 5KKNB 4KLZA 1LDNA 1JDTA 4DQPA 3KPUA 4U39A 4K4XA 3JYQA 1L8OA 1W9HA 1OFHA 1PBNA 2CCGA 3FCOA 1SUEA 2OAUA 1A5TA 3FHOA 1U2SA 2IEBA 3CRVA 4J90A 1FDWA 4DSNA 1JWLA 4BX8A 1H4QA 3UCEA 4YAJA 3UV6A 2XMAA 3AH8A 3SC6A 3KZCA 5F9LA 1UA1A 2CVPA 2YMQA 2Z4SA 5B5SA 2O5DA 3GJ3A 1QONA 4FC7A 1WE2A 3BKWA 1E3WB 2VYNA 3NIWA 4U67Q 1MVOA 1W4RA 3OJEA 3BGIA 4J0CA 2DPYA 2BEVA 1IN6A 2B7LA 2V2KA 3KT6A 2NN3C 1OTYA 3CSDA 1DCMA 2YY5A 3ACDA 3VAYA 4PVDA 3CWJA 3WC2A 3P49B 2YY7A 2VP2A 3ZNJ1 2ZS7A 4HDQB 1PC5A 3HI6A 2C8LA 5EPOA 5HA5A 4YCAA 4ECSA 1NDUA 3PFFA 1T1GA 2FZ4A 1PEAA 3I4CA 6GPBA 3AJDA 1S72S 2YVUA 4X63A 2AYYA 4OJQA 2CMHA 3IPLA 4RTKA 4PX2A 2JZ5A 5BQ3A 1A69A 4M49A 2VPXB 1WBDA 3ADCA 2GQ2A 2QRHA 2XMVA 4R3WA 2AF6A 4U9RA 1O6GA 4WTOB 3JQPA 2YWRA 3PNYA 4E1VA 4Y0VA 4FZVA 1G5FA 1Q7RA 1IUJA 2O2ZA 4TTAA 2WWHA 1FFSB 2DSTA 2LQ5A 1V6HA 1U3TA 1SVKA 1V5IB 4PTZA 3KEGA 1OWNA 3GE9A 1ENPA 3E8OA 2HZCA 4L6V3 2ZBIA 3CVOA 2Y4NA 5K45A 3GRYA 4QJBA 4EYHB 4PWDB 1HWKA 1JXVA 4RDCA 1P1HA 1N9GB 4UZBA 1F2HA 2E6KA 1QM9A 3PXAA 1ZQ1A 4YXFA 2D1FA 5KNCH 4DR4J 4M1EA 4HTJA 2ZIAA 2DK2A 1A4IA 5BV0A 1XQ1A 2K2PA 3JWJA 3MN1A 3KXPA 3VJMA 5A7HA 5CDYA 6AT1A 1REVA 2XY4A 3E3AA 4TS3A 1PF7E 4NXNB 4C4AA 2VC1A 3ZE9A 4O4GA 1GZHB 1HMVA 2RH5A 2BDEA 3GD5A 3KV3O 4MS3B 3ESYA 5ETSA 3BWEA 1BMTA 4BMOB 2Q4BA 2QORA 3ISND 1G8GA 4X8MA 4U9IS 4MYDA 2VXBA 1JJCB 4UDXX 1QG4A 2ZC4A 4PICA 1CV2A 4Q1VA 4P92A 1GFWB 1FP1D 4LSNA 4BLVA 3KPJA 1CIPA 4G0QA 3EWSA 5SYNA 5AE1A 3FRHA 2IP4A 4B71A 3AV0B 1AQYA 2G6TA 3P2KA 1VRCA 4AX4A 3ZZTA 5K6RA 1WOMA 3AC0A 4N56A 4GXQA 4IJWA 5JXGA 4DCOB 4B1FA 3WAGA 1C4XA 1XDBA 3QV1A 3OQVA 4LMBA 1Z16A 5CNKA 2VTVA 4AP5A 3R0ZA 5KWSA 4LQ3A 3AIOA 2VK1A 2EBGA 4NLWA 1JJAA 2I6XA 3COPA 3G85A 4YAWA 1D6NA 5FOTA 1NP6A 2M4MA 3FNHA 3OTOJ 2B4PA 1F2TB 3KOXA 1XTUA 3JZAA 3CJ8A 1R6BX 1FEEA 2ZRQA 4EK2A 3GRPA 2O4CA 5I9MA 1A7KA 3G0CA 1DTQA 4MI6A 3EPLA 5HRCA 3TSWA 4S0ZA 3GC6A 3QEBZ 3PFKA 2JJ2A 3SBDA 1RKBA 2Y1KA 1GXLA 2WTNA 2BEFA 1H65A 3CEJA 3CFYA 2VSQA 3PIOQ 1ZH0A 4BUZA 3FDSA 3H5WA 5IFKA 3NYIA 3JTOA 4TT3D 1F6DA 2VPZB 2XMWA 1FSSA 3K2IA 3ZH9B 2WMYA 3PRJA 3CKMA 3EODA 4LX8A 4LG1A 3VR5D 4OLHA 3MMCB 3TH5A 3EF3A 2IEIA 4KIFA 4GQAA 4ECEA 5T7LB 3SMZA 1YAHA 1U9JA 3GFPA 5K0LA 1GP2A 2HM7A 3PYXA 3M33A 1K6MA 1H7XA 1UPMB 2RGCA 4BVFA 1SKUB 2HBQB 3FDZA 2ATXA 2FZ5A 5FJ4A 2RBKA 3UCZP 4N0QA 4TQRA 1U6ZA 4DV3J 4X66J 3CGIA 1RADB 3ZGOA 5EQJB 3HXTA 1BDHA 3QSYB 1HSOA 5DLGA 2CQBA 3DZIA 3O91A 3H5VA 1IQZA 2WVEA 4WQMA 4HADA 2XIQA 4WH0A 4C04A 3MCUA 1QGUB 4LQDA 2VQSA 1KSGA 4ND3A 3DCNA 5DSTA 3R0XA 3GYBA 3RBZA 1NBEA 2FP4A 4NCHA 2AT1A 1NDHA 3K9WA 4ECXA 3JQGA 4TV8F 5AR1A 3QKTA 1ESZA 1FRHA 2YNGB 5I01A 5DHQA 3RFCA 4HWRA 4DB2A 1YIOA 4QYTA 1OLSB 2V7BA 3Q83A 4C4PA 4HD8A 3OX4A 4BJ1A 2L08A 3OBIA 5SY9A 1PGJA 3WLFA 4DQDA 1SKAA 2VL7A 3TGPA 1H3NA 4RCYA 4H60A 2IF0A 1YQQA 3F74A 3RSFA 4A8PA 3GJ8A 1RPAA 3NGLA 4PX3A 3D8HA 1F8YA 1DCKA 2G63A 1NYTA 3KKKA 3L0DA 1SHJA 2DERA 1NV9A 1TM7E 1K1EA 3COJA 1TK3A 2AIRA 3M8PA 4AN4A 4KXFB 3WBFA 4I9UA 2OFGX 1Z17A 5ADZA 5J2UA 2QTMA 1CJKB 1J23A 2K2QB 1L5ZA 4AZVA 4YK7A 4I56A 1X7WB 3F5DA 4BKPA 3KDOA 4X84A 3LQ4A 3OWHA 5J2NA 4MARA 3EEQA 1SQ0A 4K7QA 3N7TA 2A1TR 2BFEB 1E2BA 2UXDB 1N2HA 2G1PA 4QNRA 1UJ4A 5F8HA 5LSRA 4L95C 2X5OA 5B53A 1PGPA 4A5OA 1XAIA 2WE8A 1YK9A 2DJIA 5JAHA 2XY5A 2FJ0A 5BSMA 1JB9A 4Q18A 2OAGA 4IJQA 1O5OA 1XPJA 2V7QA 1ZMRA 2OLEA 2OPSA 4H18A 5IBRA 2DGVA 3F6PA 2IH2A 4XRGA 1OY8A 5FBVB 4PF1A 2BSXA 2PCLA 3HXPA 2W2LD 1OI2A 4QPJC 4ID5B 5D4OA 1E7QA 2C98A 4JBYA 4I55A 3F7NA 3PI6A 2MZRA 3TG2A 2XOXA 3V2UA 2WOOA 3SN6A 1KDRA 4LK3A 1OSDA 4ZICA 3T94A 1WTFA 2JVIA 2YNHA 1FDBA 2OO7A 3K8VA 3D6UA 1QSSA 2MEWA 3RU0A 3SQOA 4XLTA 1QO9A 1BE1A 3QUCA 1U0OC 4OJYA 1MRSA 4K0RA 3OQNA 4XWWA 4LWPA 3KLIB 2QE6A 5J2TA 2BBOA 4F56A 5TQJA 4BX9A 3QHQA 3FTCA 2IK8A 3HP7A 3M1VA 3GGOA 1EFKA 1SULA 2BGTA 4H4CA 1JW9B 4NE2A 3DMJB 4S05A 3T7EA 3H5SA 3UD4P 1JLCB 4MS1A 1GZSA 4EELA 4HR2A 4JEHA 3WWZA 1YSCA 3DQQA 4TOIA 3LA6A 3MILA 4AQ7A 2XB6A 4PXYA 4I8XA 2WAXA 1U0BB 2CQGA 4ZVRB 2ERXA 3PR2B 4TS4A 3IERA 2RIPA 3EDMA 4LREA 1Y7TA 1TDJA 2J9ZB 4B2PA 3W5JA 2JIMA 1EJBA 1L8XA 3UMMA 3BHIA 1EU1A 1NXPA 1SIWA 2QJTA 4IH6A 2IYXA 3FDFA 2QXUA 4D3DA 2GUGA 5IOLA 2M2IA 1U48A 1YQDA 4OHZA 3W06A 1JX4A 3M6LA 4Z4QA 5DYNA 4U7UD 4DSOA 4WZAE 4BTVA 5SY6A 3THVA 2N3LA 5HRAA 2HWWA 1ZG3A 2PBZA 1RAEB 5DG9A 3VAIA 4O4JB 3QJPA 3HG7A 1FE8A 1CERA 3I0SA 3O82A 5CGZA 1TRKA 1RABA 3R9KA 2HDWA 2QE7A 4NENB 3D2WA 5AW3A 3Q5EA 2IHJA 1PZNA 3HDQA 5DASA 2BEKA 2PI5A 1ITPA 3TIVA 2N47A 3ANLA 4AJIA 3ZOZA 3TA2A 1ZUHA 5KOHB 3CVKA 9ABPA 1K0VA 2Y0DA 2HGNA 2I2WA 3SQOP 4ZCSA 2IYRA 3ZVKA 1AF7A 5BYRA 2W9BB 2R2AA 5JPIA 4Z6KA 3L6EA 4MUXA 1VLOA 2ZPAA 1HY3A 3IE2A 2N4CA 4O1MA 5JTTA 1ISRA 3N6MA 3GVPA 5LSAA 5B58T 4P5DA 4TTJA 3WGNA 4ZJLA 4IO1A 1ZHHA 1IUNA 4G8CA 1H2WA 3GPLA 1SCUB 1NPYA 2EVZA 2MTBA 2BFAA 4F2RA 4DR2F 5DIFA 3ROGA 1HT3A 5T3UA 4QGAA 4MFBB 2FF7A 1SQ6A 4L22A 3DHNA 4BFCA 4DPUA 4PRFA 5HJXA 4L6CA 4D98A 4YV0A 3G9QA 1C7EA 1N4DA 3FCUB 1NNEA 4CIYA 2XUOA 4BO0A 3ZGLA 3MRSA 4QNMA 1IE3A 1TQ2A 3HPRA 3K6JA 2X14A 3RQSA 1FBTA 1M1YB 4MULA 2QTVA 4F3KA 1E1NA 4J9RA 3WBKA 3P45B 1TMKA 2QAGC 1T1EA 1YZ6A 1JYFA 1U3GA 2YIDA 4RW7B 4UOEA 3IV6A 3I34X 5LNK6 2Q5EA 3CD7A 1QR6A 1GXTA 3PVXA 4WKNA 3WL8A 2HHHB 1DB3A 4JC8A 1QMPA 2ZRGA 2QG6A 3V81A 4TTTS 2UYHA 5E1DA 4OGLA 1HBUA 3BRQA 2MMGA 3S29A 3NHKA 5FI3A 1G59A 4EYIB 1MOZA 2XHWA 1I2MA 2Z30A 4UNNA 4NY1A 2NUTB 3LLMA 1ZGJA 1OH7A 3X1XA 5FLYA 2X1BA 2R7RA 3EEOA 3MR5A 2C03A 2G88A 4XVQA 4YB6A 3ORHA 3RTCA 3S2ZA 4FN5A 2QM3A 2Q1YA 1A0OA 3AEQA 3DE6X 2F3JA 2QW0X 2QTFA 4P4TA 721PA 3K9GA 1W46A 4AXJA 3PACA 5E4FA 5B37A 4Q02A 1KI6B 3D9BA 1SG6A 2JIQA 5I42A 3ROMA 3JW8A 2ET6A 1GARA 3O5TB 4N49A 4A23A 3RR7A 1L4FA 2YIMA 4AD6A 4LYAA 1G1XA 2K1RB 4BNFA 3BQ0A 1RPNA 3FDXA 1U9IA 2O8BB 1QVFR 1K5GA 3ELDA 1AN0A 3A0RB 4WIQA 3B6BA 3W63A 4M83A 4F3TA 1YASA 4UM7A 2JEJA 3EPGA 2G5PA 2I4RA 5EUHA 4PEVA 2G0NA 1QNLA 2FHKA 2IYWA 4HQRA 3W1WA 1ST2A 4F04A 2KPOA 1H2ZA 2Y1JA 3PEHA 4MRMB 1KH2A 4ITSA 2AI2A 2LE0A 5JH7F 2AFHB 1DJOA 1B99A 4H7JA 3OIDA 3LUGA 2ZUGA 2HRZA 3BILA 5EWJB 1FMJA 2OV2A 3ISJA 5I6DA 1H2HA 4GQBA 3RSZA 3ETCA 4DX6A 3CS3A 1S6PA 2A1UA 3FF4A 3AR6A 1XLTC 5ILOA 3U19A 3H5IA 3I9MA 4M89A 3RC8A 1AQUA 5I8PA 1DAFA 3IEIA 4EQ6A 4F38A 4YYZA 1DWQA 4BRZA 1M7BA 5EWGA 4R8MA 1D0VA 1EXNA 2KZMA 4CI0B 4OHXA 1Z35A 1RWNB 3CJQA 3TWOA 4NNJA 1JDPA 3IJEB 5ALEA 2BQUA 1NB2A 4YRQA 3TAHA 2NWQA 4B6QA 3QAUA 2XMGA 1SUCA 3GEGA 2JFUA 4Z3KA 1MWYA 4E5YA 2HR1A 2J32A 2W4IA 1T1JA 3TAMA 4IHKA 4B9VA 4HJRA 1YIJS 1HEUA 1JIUA 1SA0B 4I1SA 1RHJA 2C9CA 2BKAA 2CNLA 3H7AA 4HNAB 3VNAA 3C6UB 3IDAA 4JOUA 4DF4A 4R6XA 2H7VA 2RVJA 1JG6A 2FOLA 4P32A 1R8AA 4BB0A 1IZ9A 3LG2A 2HK3A 3ASVA 2ZRNA 4BO9A 2WJIA 2FMKA 4Y2PA 5CCMA 1B8OA 5KAKA 3H1PA 3WBJA 1DHMA 1HPZB 1SXPA 2WINI 1SVUA 1XDGA 1QK5A 3QIDA 3DOJA 1IHPA 2M98A 4J16A 1AKMA 1XZEA 5KO2A 3U3DA 3K73O 1E1CB 5AJHA 4XDCA 3OL8A 2R9LA 3RFFA 4C07A 5IPFA 4GP9A 4LZJA 1IBKB 1XWLA 1ZJ4A 3KQQA 1DFGA 3BO3A 4R01A 4BNJA 4UD2A 3Q3HA 5E5NA 4HB4A 2V7WA 4IG0A 3LGHA 4AROA 1CE8B 2ZZNA 3R44A 4G5HA 4HDSA 3WV4A 4C6TA 1FNSA 1T8EA 2VK4A 3AHJA 4JDPA 5BMVA 1Q2XA 4D9MA 1SOWA 2XMPA 5IBPA 5E7OB 1YZLA 4LHVA 1W5BA 4Q1FA 5FWDA 3MD1A 4F21A 1S49A 4Q82A 3FJOA 4OKIA 3B20A 2HNKA 3T7IA 1PS9A 3QQPA 2CA9A 2UZAA 1MKYA 1FVXA 2GM4A 3FSYA 1KQGA 3UWSA 2M1ZA 2UVVA 3FBTA 3DPIA 4I2QB 4F2GA 1V7CA 1G8AA 1FDUA 2YR0A 3E0QA 1CW2B 1J5PA 2V8BA 1JIIA 4IV5A 1U28A 2XZOA 3IIIA 3DE2X 3KYJB 4ES2A 4JJFA 5EJIA 1VKJA 2W7AA 4R5PB 3RYTC 2Q07A 5CYOA 1UP6A 1MO2A 4LPKA 1YHYA 4RQAA 2X1GA 1UK7A 2WB4A 2I8AA 1G20E 2C2DA 4OHKA 4Y2XA 3R3HA 1R4MB 1GNLA 1V8DA 1LPMA 3KM0A 1MFPA 3T38A 1IBMB 4OIXA 3O5AA 3PUIA 4YRPA 3DZFA 4MWOA 3D4PA 3DMYA 1SWVA 1DRUA 1SJ4P 2QU8A 2DFNA 3NIDB 3O7MA 3LAWA 2FLLA 1J0EA 4AN1A 1QIKA 1ECFA 1JPJA 3OEHA 2VB6A 1VE3A 2PZLA 1K0TA 2A1TS 1EP4B 2K87A 4HAXA 2DGUA 2HV9A 5AJUA 2AR0A 5JJBA 1GVHA 1R0LA 5KG5A 4JFAA 2I0XA 3EVEA 4S1TA 2OFOA 3ILJA 3ONEA 3L8GA 4JI5J 3BCHA 1ULRA 3HU5A 4ZVGA 1HR0F 3SJBA 4F72A 5CDTA 4JQYA 2D13A 1NK5A 1EEXB 4FFWA 2XQFA 4MKGA 3PCOB 1M0TA 3J81A 5FTKA 4IWXA 4LRQA 2B4TO 2O1WA 4JBWA 3M49A 4RELA 4Y6GB 3D3KA 4D0NA 2UZ4A 3VISA 5AXNA 4R0EA 2BFWA 1L5KA 4O33A 2BMJA 1WPGA 3D6AA 1GPH1 4OK5A 3V6MA 2FFAA 4XIJA 4CKEA 2ZWMA 3TW8A 1U1DA 4KWHA 5A2QY 1RXVA 3SKVA 2FK8A 1KZ4A 1NXSA 1UDAA 2XLJA 1C7RA 4R51A 4K81B 2PZKA 3KLOA 4R54A 1D8ZA 4DA7A 4ZVPB 2YHSA 3GAAA 4Z1OA 3K16A 3O2SB 4NLSA 1Y11A 2NUPA 5B0EA 3VPFA 4NYMQ 2Y1GA 4CF4A 1EIZA 5FUXA 1EK1A 4B02A 2NO0A 1H1DA 2WNIA 3PKIA 2FDXA 4QBIA 3Q10A 2WQZA 2IH4A 3ZHOA 1H42A 1AV7A 5K8UA 3W05A 5LPNA 2VSYA 2ANCA 4QA9A 4QQ8A 1XP5A 5A8WB 1K7EB 3W2EA 2PUCA 2HIGA 4RADA 3TSZA 5GADI 1PL0A 4C4OA 1G98A 4RULA 3IULA 2ZRBA 3BB3A 3TVKA 4Q8EA 4HDAA 1LLUA 1QQTA 1XJWA 4HLNA 2BGWA 5BSFA 2J5KA 4KR3A 1T2UA 3NBUA 3PL1A 1MB0A 4UC0A 3UJ7A 3EGOA 4KAFA 3H5YA 2JH3A 2CLMB 3N4WA 1NNUA 2OCDA 4QYIB 3AJRA 3DU5A 2Q4DA 2TECE 1A8PA 4AL4A 3PXCX 5HHTA 4KAJA 1QZXA 3OOHA 4AY3A 2VTBB 4G23A 1EHWA 3ILLA 5ETRA 4K9SA 1ADCA 1QG6A 2L42A 4NESA 1H6BA 1M2OA 4KOAA 1OBHA 3I30X 1F12A 1ZWKA 5FUQA 1VKHA 4FMBB 1QRSA 4QYRA 1QIDA 2IODA 2VLIA 4HWKA 3OHBA 5IDXA 5L7TA 1JG4A 5EFOA 2JDID 1N34J 4JITA 3EUNA 5FEUA 2XZDA 3F3YA 5ALFA 2ZE6A 3D6HA 2HCBA 3DM2A 2GEVA 2DTDA 1X9IA 3HR4A 3FCSB 5IM0B 5DI3B 5BVHB 1G8FA 3G9UA 3PX6A 3GRAA 2GWHA 1FNNA 4QZVB 2N7CA 3BKUA 4K6KA 4FVTA 4XRRA 3OM1A 5H9EK 3RUDA 1IOLA 2QLLA 1WEZA 4GOXA 1UBNA 2UKDA 4WAUA 5J2MA 1RM4A 2HLHA 3M30B 2O6LA 3JQEA 4OZ1A 3NBXX 5MDHA 1VLHA 1EHCA 4ZPDA 1R9JA 4WCVA 5C7LO 2I6FA 2DG2A 4D9CA 2WOMA 1T9ZA 3IIMA 1L5HA 1Y6FA 1M66A 4I99A 3U6KA 1XNQJ 3DXBA 1GYRA 2X0RA 4OHBA 4MA0A 2JATA 1IXKA 2D1RA 1NVVQ 4DADA 3VWSA 4PG7A 3T41A 4X6XA 2QO3A 3MPUA 2F62A 4V0MA 5CAEA 3N07A 4AQYF 2DLCX 5AKEA 2VRCA 3BQ1A 1DV2A 3GJXC 4DCJA 4Q3DA 2BOAA 3DE5X 3IHKA 3HHNB 3QRPA 1B2RA 3F4KA 3SYKA 4I50B 3NGRA 1JDBB 4DUYJ 2IC3A 3TAUA 3HFVA 3HCRA 3J7YU 4EUFA 5JPCA 2VYVA 4G1UC 1LBQA 4UOCA 1R5BA 4ZQGA 3DBHA 5JAPA 1F51E 3CLVA 3D8RA 3AUSA 1OLOA 1L8AA 2WJ6A 2QUZA 3TO5A 2FN9A 4IXWA 3PWTA 2H54B 1WUYA 2K7JA 1WPQA 3R8CA 1E1RD 3ICWA 2BGIA 4EHDA 3CT9A 1B0ZA 1R6YA 2RDDA 1KQNA 4HQ6A 4CLZA 4YLEA 4B6RA 1QZUA 2XS7A 2FZGA 1FRZA 4D8XA 3VOAA 1EX6A 4MDEA 4B3MB 3O4FA 1HORA 2ZE7A 5D8HB 3CA8A 1VSTA 2F4NA 5B3AA 3U39A 1ZXLA 3MWYW 1V5GA 3QXGA 4KR6A 4GH5A 4HEHA 3R5SA 4BRUA 1A9RA 1U1MA 1U02A 5TLSA 1M0EA 2JLQA 3W79A 2ZJRQ 3ONWA 2H92A 2Q3BA 5EE3A 2H0AA 3DGVA 4XPIA 2CNOB 3NC0C 4NE7