2ZWPA

Crystal structure of ca3 site mutant of pro-s324a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
394
structure length
389
Chain Sequence
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDADAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Requirement of a unique Ca(2+)-binding loop for folding of Tk-subtilisin from a hyperthermophilic archaeon.
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 118
structure length 389
sequence length 394
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2zwpA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zwpA02
1SN7A 2PWAA 5B1DA 4YN3A 1KE1A 2Z57A 3VHQA 3I30X 2W2QA 1AK9A 3CNQS 1SUCA 3D9QX 2W2NA 1GTL1 1C3LA 1ZVKA 3DE4X 1TM4E 5CW1A 4K8RB 5AVJA 4CFYA 1BE8A 3EIFA 4GI3A 5FBZA 1BJRE 1Y4DE 1TM1E 3DE6X 1EA7A 1SCDA 2P4EA 1V5IA 3VV2B 4WOBA 2WV7A 2Z2YB 3DE5X 1KDVA 1MPTA 4KPGA 2IXTA 4DJ5X 4ZOQI 1CSEE 5AQEA 3SICE 3TI9A 1Y3FE 1ST2A 2DUJA 1YJAA 3QFHA 3DWEX 3I2YX 3BX1A 3DE3X 3A3NA 5FAXA 4H6VA 1XF1A 1Y3BE 2X8JB 1SBIA 1GNVA 1Y9ZA 1SUPA 1A2QA 2ST1A 3GT4A 3DVQX 5ARCA 1VSBA 1YJCA 3Q5GA 1V6CA 1AU9A 3PRKE 1AQNA 1OT5A 4WOCA 1S02A 1Y3CE 2PMWB 4C3VA 1KDZA 1BE6A 1SBTA 4OMDA 3GCWA 2Z58B 2Z57B 1BH6A 1WMEA 1DUIA 1T1GA 3ZXYA 4Z2AA 1ST3A 1Q5PA 3ZXXA 3VSBA 4AKSA 1SIOA 1SUBA 1SBCA 1ITPA 3EE6A 4NE9A 4H6WA 3TI7A 2Z2YA 3SQOP 4OV6B 4MZDA 3QTLA 2GKOA 4ZARA 3VYVA 1Y48E 1NDUA 2QTWB 5SICE 2W2MP 1C9JA 1TM5E 3SQOA 4I0WB 5ARDA 1JEAA 3OSZA 3VV2A 1THMA 4NE9C 1SUAA 2B6NA 4YN3B 1GTG1 1AH2A 2SBTA 2TECE 1HT3A 3P5BA 1GT91 3BPSP 3TECE 3DDZX 1WVMA 4HVLA 1GNSA 3VTAA 2PWBA 2W2QP 3VV3A 3I34X 2WUWE 2ID4A 2W2OA 1C9NA 1TO2E 1R64A 2W2NP 4J94A 2Z56B 1LW6E 1P7WA 1WMDA 4LVNA 1MEEA 2HD4A 1CNMA 1AV7A 2PRKA 3WQBA 1EGQA 2Z2ZA 2HPZA 2W2MA 1SELA 5JXJA 1SBNE 1TO1E 3DE1X 3F7MA 2Z58A 4C3UA 2SNIE 3A3PA 3QMPA 1Y34E 3F7OA 3F49S 1P8JA 2IY9A 1R6VA 3BGOP 3GCXP 1ZVJA 2ZWPA 4BWGA 1GA1A 3T41A 4CG0A 3AJ9A 3D43A 1S2NA 3PTLA 1YJBA 1KDYA 2X8JA 2ID8A 3WHIA 1TECE 4AKTA 2Z30B 4KB5A 1BFKA 3GCXA 4DWWA 4FONA 2WWTA 3CO0S 2SECE 5JMOA 1BFUA 2W2PP 2PYZA 4K8RA 1AF4A 1SIBE 2DP4E 3A3OB 1PEKE 4OMCA 5B1EA 1SCBA 2PMWA 4CFZA 1TM7E 2Z56A 1YU6A 1IAVA 3CNQP 1SUEA 1Y33E 5AVKA 2XRMA 3I37X 1T1EA 1OYOA 4M1ZA 3L1KA 3GCWP 2V8BA 1GA6A 1SCJA 1TMGE 4OV6A 2Z2XA 3Q40A 4NE7A 1GCIA 5I9SA 3DW3X 3DE7X 3A3NB 3LXUX 1NLUA 2DQKA 1C9MA 3H42A 3P5BP 4NMXA 3WIUA 1WSDA 4LVOA 3BPSA 3AJ8A 2G4VA 1GTJ1 1NDQA 2W2PA 1Y4AE 2E1PA 2ZWOA 4DZTA 1SPBS 1SBHA 3DE0X 4B5LA 1TK2A 3GT3A 1SVNA 3H42B 4NMXB 2XTJP 5AMXA 1PJ8A 1WMFA 3DVRX 2W2OP 3LPCA 5FFNA 1SH7A 2SICE 4JP8A 1UBNA 3DVSX 3EDYA 4H6XA 3A3OA 1Y3DE 4KG7A 2WUVA 1PFGA 2XTJA 3LPAA 5JXHA 1PTKA 5JXGA 3AFGA 3A3PB 1SIUA 3DW1X 3DE2X 1AVTA 3DYBA 2PQ2A 1V5IB 2ZRQA 1SCAA 1GA4A 1IC6A 2QTWA 2PKCA 1SUDA 1R0RE 1SCJB 5ARBA 1Y1KE 1SCNE 1TM3E 3UNXA 4HX2A 1DBIA 1T1IA 4RYDA 3LPDA 3HJRA 3BGOS 3CO0P 5K7SA 1SPBP 2Z30A 1OYVA 5JXIA 1S01A 1KE2A 1P7VA 3WIVA
chains in the Genus database with same CATH superfamily
4O4IB 1X7DA 2ZSJA 1OSCA 4C11A 3MUNA 3HQ4O 5JS7A 4JS0A 2ZXUA 1NP3A 1F4VA 4DMGA 5LYJB 1IZZA 4MHSA 5DBEX 1N5OX 1PEDA 4F2WA 1L3CA 4H7JA 3KAKA 1E1MA 4RHFA 4ARZA 2R1VA 4EBBA 3CX8A 1Z6XA 4LECA 4RESA 2B9XA 1V8DA 2JBAA 5IWAF 2BGJA 1U0SY 4DSNA 2R8HA 4J37A 5IBRA 1Q12A 1X7XA 4Z3OA 4J7XA 1U9CA 1YC5A 4IF4A 4W5TA 1U0HC 4R5HA 4G4JA 3A11A 1OOEA 3QO9A 3UNGC 2MGZA 1BMFD 1BTOA 1ATZA 1JA9A 3ZDYB 2NZ4A 2Y9HA 3UAOA 4GDFA 4FFMA 3N7AA 4IHQA 4MH8A 2BUNA 3LTNC 1M2OA 2H7CA 3RG2A 3MELA 5PNTA 2CG8A 2AJQA 3OO0A 4L72B 1Z4JA 2ZIVB 1JXLA 1GAJA 1BS2A 4YS2A 2AQKA 2NSCA 5ALDA 2P6UA 1KGDA 1EESA 1AROP 1Y42X 5ALUA 2B4UA 3UXMA 1OLSA 3WGZA 4Z2AA 3ZBPA 8ABPA 1I51B 3BMNA 3TSOA 4RNDB 1U9YA 4BMXA 4Z49A 1OI3A 5KDDA 4LJRA 1H3EA 3LMKA 2P6SA 3QT5A 2R1VB 2AXNA 2O8BA 2Z2LA 4UY8T 2UVVA 3EVAA 2W98A 4OYPA 1C2TA 4OQJA 4FS1A 3R1HA 5COBA 5K8UA 1I4DD 1W34A 5D86A 3VYVA 4LUCA 4C4SA 2E4UA 3ISTA 3GFZA 3E5HA 3SHQA 1IJKA 4HTFA 4YUDA 3WLQA 4BP8A 1EXMA 3FFXA 3DDWA 4DR2B 3PTZA 3HCBA 3NC0C 2XY7A 5BNTA 2DUWA 3F5MA 5DLDA 3KUKA 1YLXA 2BVNA 1J2RA 2JI6A 5HSGA 1UOOA 2UUBF 3KQHA 3N2GB 4DMLA 2BFCB 3IWNC 3X1JA 1H0HA 5J1PA 1YHZA 4XM1A 2NPFA 3QKIA 4ETIA 5AYVA 3NETA 1YRUA 2JCVA 1N25A 2B78A 3BTVA 2EC0A 3EK2A 2UZ0A 3MXHP 5FRDA 1UDCA 4AZ3B 2M1ZA 3F71A 4BNUA 1L7OA 3FPCA 3H2JA 2IIPA 1RHJB 4PNPA 4OHOA 4PIPA 4ZAXA 3F7MA 5CLGA 4DR2J 5BORA 3BG5A 3D81A 3QXCA 3RM3A 2XE6A 5KFWA 4ZO4A 1YZLA 1M5VC 3OXLA 5M2QA 5AVYA 4BO8A 3PACA 2LD4A 3AI3A 5H4HA 3Q8SB 5A0YB 1C1CA 1RQ0A 1PLKA 4OXNA 4LHVA 2BJ8A 3FLEA 1UTAA 1QGDA 3HN6A 3A6DA 1EKSA 2EW2A 3UBMA 4L7QA 1K8RA 3MMAA 1ZISA 1U1OA 4MR9B 2WJJA 4P38A 2AN1A 2NZXA 3OIYA 2NOAA 2BW2A 1MX5A 2KM1A 3ELWA 2RE8A 1GU0A 4BS2A 3V55A 5DXAA 1M1ZA 1ULAA 3LUCA 1RD4A 2VPZA 2ZJPQ 4MQFA 1XAHA 4DDUA 3V8VA 3PL5A 5FR2A 2HQDA 3EJ6A 3JSMB 1QNLA 4B33A 3THWA 2IGBA 3B2QA 1ORWA 4CCSA 1QQAA 5JECA 2X4GA 4F9GA 4Z3DA 2ORIA 4PVDA 2MJNA 1U9IC 2CJYB 2DLCX 2CWDA 3GJZA 4QBHA 2VAVA 4IRXA 2EFOA 2JGAA 3AJEA 5FAKA 2R44A 1ZITA 4B8WA 3JQPA 2ZR0A 2DT9A 4FU0A 2HXYA 3SPXA 4MTLA 4DCNA 4TWBA 1HEUA 2VSXA 3EDYA 3WB1A 1L5FA 4LIPD 4NCNA 4PWYA 4RK7A 1PFGA 1R5OA 3ETCA 2HA7A 4CN8A 1IN5A 1PTKA 3CLUD 4O2AB 1YIAA 4NASA 1M1KT 2RVJA 4YBZA 3AU8A 3K09A 4JI8J 3DFMA 3RK1A 5EKSA 5B1SA 3ZCSA 4CRJA 4DR4B 4RS4A 1KI3A 2E9RX 2PKCA 1ENPA 2A0KA 3H75A 4I2QA 2DH5A 1TM3E 4BKRA 4BO6A 1K7YA 4MYCA 4WK6A 3ADDA 1X4FA 1OYVA 4ETMA 3ZLUA 3CCSS 3H0CA 2OTLS 3LT4A 5FO0A 5LJ3Y 3WV5A 2MYFA 3R0IA 1ZGAA 2WSEC 5DYWA 1PNVA 1M8GA 4X92A 4IF6A 4N56A 1KHVA 1AMUA 4B2PA 3OQMA 1EUDA 4BV9A 4CNBA 3QVJA 4X66B 4DBLE 1AZTA 3JSXA 5EE1A 4QIWD 4NABA 3FHLA 1XZBA 2NV6A 1ACJA 2VFAA 2YWEA 1P9WA 4UFNA 3CEMA 4YROA 2Z1MA 1GUBA 5FTWA 4E07A 3VVBA 2V4QA 3W63A 5BSKA 5B0CA 4GOLD 4PBRA 3RARA 3ASYA 2HMIB 1XCBA 1TVRA 5K8OA 3H1EA 4OK3A 2O2SA 3FPGA 2BYCA 1RYZA 4EGAA 4LYHA 4OXQA 1XFAA 1LS6A 4D3DA 4TMTA 4B3MF 3OZEA 2J3QA 4HCJA 1I1GA 4RW8B 2CXPA 4TLEA 5JJCA 1G8JA 1YJAA 1EZZA 5AK5A 1KHTA 1TQ4A 2V97A 4MV0A 3UWTA 3X1WA 4OXRA 2NSJA 3NLLA 1SZDA 3PNLA 1CY2A 4YLEA 1ZYQA 3HU2A 3KTAB 2VDWB 3N87A 3RYTC 5AXKA 2B2CA 1WC6A 2C4WA 4IDKA 2IC3A 4QIFA 1KJ9A 4FW9A 5AK6A 3UCGA 4RDXA 5ER9A 2Q99A 4IGIA 2OGZA 3NGRA 1NATA 4D80A 5I3UB 3E82A 1X14A 2YH2A 1ULBA 1UXIA 4KBGA 1T5SA 4KOEC 4RUCA 5HZGA 3L7MA 3ESYA 5M7EA 1OW3B 3L7YA 3K71B 5CLQA 3GZNB 2XDWA 2C20A 3JWPA 1XBWA 2I1RA 4KDRA 1YR6A 5HQJA 3E4CA 4CMJA 1D2GA 1KAEA 3IKMB 1VQNS 1RLUA 2Z4PA 3STUA 1J2JA 5SICE 2HK2A 2W2MP 4M21A 5H83A 3ICCA 3MS2A 1IG3A 1PR3A 5EFZA 5HBRA 3HM9A 1PSWA 4QUAA 4PXAA 4QM6A 4EO9A 1RRGA 2EW9A 3VTKA 2I0FA 1NM5A 2FYXA 4X91A 4YRFA 2W7AA 1H22A 2KQUA 3LPNA 4YV2A 1S1VB 3BHIA 4LF6B 4J94A 2NXCA 4I1IA 4Q34A 2DHHA 3EBOA 2ZD1A 2X1MA 2IBMA 3ZNNA 2JFXA 1PUIA 3LUHA 4FMCB 1WUJS 2FZCA 1XZJA 1M1UA 3RQIA 2RSQA 4AMGA 2HVZA 3S28A 4C9DA 4HG2A 3F7OA 3V4OA 5ENVA 4YMUA 2E0IA 1YKFA 3WLRA 1HBOA 3VZSA 3CLSD 2O2JA 1VDHA 4KMMA 1V96A 4NFYA 1REGX 2X1FA 5EHQA 2JVIA 2RF2B 4LOLA 2GFFA 3CH4B 1CR2A 1LNQA 2RH9B 3K6KA 3VU9B 5IFMA 3W9UA 4A8WA 2GVZB 1Z4IA 4IM7A 1RVV1 3ILOA 2WA2A 4KYVA 2ZH4A 4ZS6A 2Z8YA 2B3TA 3RU3A 4ANDA 2O4UX 3MSXA 1LVHA 4CLFA 2J9ZB 3C66A 1OSDA 4ZIRB 3MFIA 2IYLD 3NV9A 1QE3A 5HCIA 3MOIA 1YBHA 2ONJA 4WCVA 2I2WA 4UOQA 1RYSA 4QQFA 4RULA 3AY7A 1TD9A 4K0KJ 3NOQA 2B1JA 2QLMA 5JBNA 4FSHA 2OLKA 1CUYA 2CVZA 1H3DA 4JR1A 4EEZA 2IHJA 4Y0NA 2JCXA 5HJ2A 1XT6A 2I80A 3VZPA 2FQYA 1QDUB 1ORIA 1Y3IA 2RT3A 4IUFA 1QP8A 2CQ3A 2QX7A 4HXFB 4OQDA 5MDHA 1J8MF 2VYQA 3W5VA 1XZDA 1XX6A 3GI1A 4W92B 1VCTA 1GUYA 2SXLA 4KDEA 3EHEA 4LGYA 4ECQA 5LMCA 2RDIA 3JX9A 1RBMA 2PUEA 4RD1A 2HJVA 5B30A 3B3AA 2ZBIA 2NV2B 3KQSA 1N57A 3HPOA 2XQKA 3LDUA 1JMVA 5AM1A 4KEAA 1OH8A 2PO7A 3HCNA 2C3PA 3QSYA 2GSDA 2NP7A 1AKEA 2PRYA 3B85A 3EFOB 3HXOA 1HT0A 1P7ZA 2IDJA 1WC3A 3EF0A 2FQXA 2Q1XA 1WD7A 2ZZTA 1KO5A 3I5AA 5DPMA 3VJMA 3KOMA 3NEJA 2R8YA 2R6GA 4O4JA 1QANA 4ENVA 1ZUNA 3JVVA 3BB3A 4R05A 5JZMA 1N7HA 1KOLA 5FLKA 4A8JB 1P9YA 1NJWA 3UVEA 2YNMC 2ALZA 3OUUA 3OE1A 3FCYA 1QKKA 4TLLB 2COKA 3NEAA 4I6WA 3UAVA 3AW8A 3WKEA 2IUSA 1FJHA 4IDFA 3EF3A 1WUKS 1A0OA 3UN1A 2Z8QA 5C32A 4WOJA 2WIJA 1RZRD 2QD5A 3UUWA 2WLSA 1F9EA 1PT7A 1YVPA 3RR2A 3H18A 3W06A 2QK4A 1G2IA 1EE1A 1NXIA 4IKOA 5SZKB 4S35A 4DCPA 2Z4RA 3CEAA 1A9NB 4RAOA 4WVLA 4F96A 1B93A 3CRQA 3J7YU 4ONEA 3GJTB 3MTEA 3K9NA 3BD9A 3CCLS 4KHPF 5ALPA 2VYND 3ZLBA 2VDJA 3E5RA 1QJCA 1CEEA 3IMKA 1SIZA 3QNWB 5AKGA 2J7WA 2Y0CA 1HWKA 2HJHA 2WM8A 5DOVA 1GUAA 3SKVA 2W24A 1HMPA 4OAQA 4B3TJ 1FTCA 2VTEA 1PL6A 3JRXA 1EFVB 2WFLB 2QUHA 4C1NA 4G1MB 2P3QA 2Q0QA 5CR9A 3GPCA 1LBEA 1ZOOA 5C1BA 1A98A 3VR0A 1PR6A 3MPVA 4LR9A 4FNOA 4QDUA 4EEXA 1WJ9A 3N6MA 2JEOA 4FSDA 1O6FA 2CPEA 4F85A 4YR2A 2PE5A 3BO4A 1PVDA 3DAGA 4GRAA 3O4RA 1X5PA 1GGVA 1C7QA 3G87A 3E9DA 1MNQA 4Z86A 1R3DA 4KQHA 3WXBA 4CNZA 3GEDA 3Q8XB 5JU6A 1J21A 3SHWA 4JR2A 4J9NA 3LW7A 3GNSA 2SBTA 4CT0A 1K1EA 4H1VA 2Y1RI 3CH6A 4Y2HA 3O8NA 4JJ8A 5DNVA 1IH8A 3I5YA 2IP2A 5EWEA 2D1TA 5TC4A 1BQMA 5CG1A 2HZCA 5JNWA 4KR2A 2UUBJ 5EMNA 4C3LA 3FIJA 5JQGB 2PV7A 4LTDA 4HNTA 2X51A 2J3KA 1TO2E 1F5SA 2H2AA 2BANB 4DLGA 3V8QA 4LVNA 3FVYA 1X38A 3HB5X 2W2MA 1EP4A 1KAHA 4ZOLB 4E09A 3CCFA 4OU5A 4LOIA 1WORA 1YQGA 1M54A 3TSWA 1UIRA 4YRBA 1CPYA 2ZQYA 2I03A 4UPEA 2P2LA 2HXGA 1R89A 4JB8A 1XTPA 1IHXA 4MYHA 1YS1X 2RIRA 4BE4A 2QTFA 4J4HA 2DOKA 2XLJA 4L78A 3JWHA 3GP3A 1TIBA 5BOVA 3O74A 3H5WA 3DLKA 3QQ5A 1WQ1R 1XCGB 2HMAA 1XZIA 5JNSA 5IW8A 1ONBA 3BYPA 3MJHA 2E6UX 4IIEA 2CNKA 1JB0C 4MV8A 2YH0A 5JMTA 1S2IA 3LP2A 2GX8A 3H5NA 5CLFA 4RCVA 1U5BB 3SE7A 1NJIT 3PGKA 1WP4A 2I1LA 5KTPA 3MGCA 3NWRA 1XIVA 2IDZA 2XCSB 4NMMA 1Z6PA 1DIGA 5A2QY 2VDVE 2ADCA 3ELYA 3IRXA 5JZSA 2P5UA 3HZZA 5KC8A 1YJTA 4O4JB 1P33A 4K9MA 1LD3A 3VZBA 3M4ZA 3NORA 4UOZA 4XYLA 1LWCB 5U4QA 5IJ0B 4U9UA 4D9NA 3A1SA 4QW8A 2ISCA 3KHLA 5HBGA 1FLDA 2NVUA 3TO8A 2B9VA 3G82A 1T4CA 4V0RA 4FZRA 5CT8A 2W9BA 4KFRA 3KG0A 1WO8A 521PA 4HWGA 1B6TA 2NZCA 3TEFA 3GFVA 3UZUA 3KQNA 1PR9A 5EE5B 3FBCA 2HCJB 4HUJA 1BEZA 4U7FA 2J41A 3DPUA 3U09A 1Q16A 3DT9A 4XVQA 2OPBA 2A86A 4YCLA 4XX0B 2UXDB 1RADA 3AOCA 3ITHB 2C9BA 1SCAA 4NVRA 3OLBA 1TKBA 2UUAJ 3UH1A 1IHDA 1YRYE 2XW6A 1EUCB 3BQ9A 2F4VF 1KXJA 4OFXA 3S8YA 5AM2A 3T5JA 4F0MA 2EJVA 4PV7A 4ZN1A 2JPDA 3CBQA 4C14A 4B7UA 3K73O 3RSHA 1F2DA 3PC7A 4U63A 3ZNPA 2J9DE 4TXJA 4B8YA 3I1YA 3M6VA 1FRJA 1XRPA 2ZUCA 3JTMA 4Q01A 1BHJA 1J07A 3Q7QA 5C25A 2G4CA 5LCXA 2A9PA 3CF5Q 4X4SA 2MGZB 3AVYA 4YCBA 1AZSC 1JQAA 4XA8A 1N8KA 4GLOA 5FA6A 2V7UA 1KJNA 2FOLA 2ZRDA 2Q43A 1Q2XA 2JLRA 3CQ9A 1MOSA 5IVDA 2D3TA 5JYBA 2DYKA 2PLNA 1DC7A 1RIFA 3SC2B 4FHDA 1GAXA 1GGHA 2R1ZA 1A9TA 1X3LA 2IFXA 4EF5A 2FG5A 5JZOA 3PHBE 1U2ZA 3DVLA 1U0RA 2ZI3A 2AG0A 2VJOA 5CEJA 4ID5B 1COWD 2VDMB 4IXTA 1ZCFA 3W65A 4W5QA 2Y2UA 3G1TA 1NUUA 1YR3A 4RXMA 3PD0A 3D1QA 4OHVA 2ZYHA 1FP7A 2XYHA 4HNGA 3IXMA 3ANYB 2QTTA 2CQ0A 3FVVA 4IVPA 2OHGA 1FFGA 1J0XO 3SCLE 3THRA 3MWDA 2UZ3A 1NB7A 1M2KA 2ODEA 2ZETA 3RYCB 4J2TA 4GF5A 4CUJA 3I2FA 4JC8A 2WMDA 3MRXA 4YDRA 2GXSA 2CV2A 4TWAA 5CB0A 1DTEA 1R43A 1OWLA 1LV7A 3AY0A 1XMOJ 1X7WA 2DKOB 3K96A 4DGQA 4K50A 4ID9A 3WGIA 1YASA 3B6KA 1AXQA 3KFLA 5JS6A 2CXRA 3MB5A 3E7XA 1CERA 2O3SA 3JPWA 1T9ZA 4H31A 2DZDA 3N5KA 2W6PA 4H59A 1FW6A 3T1HB 1TW3A 4ND6A 3DTVB 2QZPA 3A0UA 4NR0A 1QSGA 2VU5A 1TK5A 4GVBA 3PHLA 3G82B 3SQLA 3WP1B 4XPIA 1WTFA 4KQMA 4PCVA 1U1CA 4P36A 3SZ3A 1XZKA 1RPJA 1Z6ZA 2CWXA 4EQ6B 3SZLA 5DOZA 3KTOA 1C9NA 1ZGJA 4WZBA 2RMLA 3ICEA 2ROQA 1YA8A 4JI2B 4P0QB 2HNYB 2JAPA 3TEGA 2R7LA 1O9HA 3RBVA 3WJ2A 2BQUA 4YCCA 2QT7A 2HMSA 3IWLA 2ZYWX 4KUGA 4F9FA 3UMRA 3KDPA 1VLHA 2VL1A 3K8QA 3C3CA 1HDGO 1USVA 2BEWB 5D5QA 2ZSFA 2ZZMA 5F8JA 4JZKA 2QL9B 1P77A 3BWYA 5BSWA 4CF3A 1NVDA 1BDJA 2VG7B 1HDXA 4CMKA 1T8RA 3NIDB 2HHAA 1N2BA 2P3LA 2WP8J 4P7TA 1U4SA 1OH7A 2QAJA 3AI1A 3FFAA 2WVGA 1I94F 2OMEA 2CFXA 1K7SN 1KGSA 3AVTA 4F4UA 4UTNA 2HBQB 1PL7A 2O7RA 2Y9PB 4Q48A 1JDJA 2KTQA 1EWYA 2NPOA 5DW3A 1OYOA 1MB3A 2OHXA 3LBAA 4ZQCB 2VBGA 1JPNA 4NKRA 4EYEA 4S1PA 4BNKA 1ACLA 3ETOA 2FFBA 1TMGE 1S1XB 2VT2A 3GZNA 1MX3A 2UVRA 3W9HA 4F38A 3LLUA 2AU0A 3EXHC 3FKBA 4EGCB 3ZCRA 2WTAA 3AXTA 4J76A 2GNKA 4OZJA 5LJ5Y 1F8GA 2H16A 2PG3A 5AJZA 1EBBA 2Y1DA 2FPIA 1SBHA 2W6MA 3D4PA 1TQ6A 3M8QA 3AR6A 4CL8A 1QHGA 2VSNA 4TWIA 5HKLA 2RIJA 2GMJA 1DG1G 2E5LJ 2WIDA 3K70B 5C5CA 2DHEA 2ZM5A 4XCQA 4EL0A 4J0CA 2YWFA 2R66A 4GSKA 3TLXA 2VZEA 1Y9OA 3KOYA 5C4IA 3PRBA 4L3KA 3ZEAA 5IH7A 1I5OB 1J7JA 2HU8A 5EA2A 5JZBA 2J48A 3OCUA 2ADOA 1XZGA 1CUWA 1A82A 2FE4A 2R2AA 3OO1A 5CFLA 3D66A 2RJZA 3EIUA 3ODGA 2H18A 4K9QA 1Z74A 3P9KA 4PR3A 1JT9A 3NHWA 3HHEA 2G76A 5CQGA 2DEJA 5E6UA 4QPZA 3KWMA 1DZ3A 1EVZA 1YU9A 5JXIA 2UZ4A 2HIQA 1JQ5A 1HNNA 3PNOA 1QYWA 3H4IA 2PWAA 3FUUA 1ZP6A 3M4XA 5KSYA 4RBVA 1A9QA 2YDXA 2DX7A 5JAUA 4FMCF 5KYXB 2YWRA 4U3JA 3EGDA 4XVHA 4OBBA 1QUPA 1LK7A 1C1BA 4HX5A 4LFBB 3F56A 3W5ZA 3DAOA 3KKEA 1ZNQO 3LQYA 3ABOB 2HMUA 3RC7A 3UJ6A 1CNFA 2HPAA 1GNTA 5GOZA 1BE8A 3WNCA 2V7EA 2C42A 2VDWA 1H1TA 3POTA 2RGNC 2QL7A 3MZ0A 2VP9A 4MB0A 4C76A 3WGNA 3DOLB 2AR9A 2PU5A 2BFEA 1NM2A 1NXXA 4ZVHA 2AJBA 4U2FA 3VPAA 4TX1A 1NDKA 1V25A 1DQZA 4LSMA 3GGSA 3ZTRA 1R00A 1UK9A 2GBGA 2FN9A 1R9GA 1E6YA 1PF7E 4G85A 1NDPA 1Z0JA 2FVPA 2EJUA 3DMYA 3BL5A 3ZBQA 1RT1A 3BGRB 3UAGA 4BEVA 3TXAA 2PD6A 1S9DA 3HVRA 5D3KA 4GLBA 1U1FA 4JLVA 4CEJB 4UTVA 1HI0P 2KXHA 1FD2A 1N1EA 2GBCA 3GCDA 1GSIA 4Y6OA 3L4SO 2AQ8A 3R44A 1W59A 2DFKB 1NO8A 3FTDA 1OBVA 1MO4A 1ZCJA 4JROA 1D9FA 1ICEA 3C8UA 1QE0A 2A9OA 3K9QO 1AHIA 2GK4A 4I8XA 4FGJA 2YX1A 2VHWA 4LNHA 1T94A 5D87A 5LMZA 1PG2A 1LFWA 3S4YA 4MZDA 4WFIA 3TEJA 1YCDA 3VNBA 5FNVA 3NDBB 5G0SA 1JFSA 5HROA 3MHYA 3QU9A 4KSYA 3SU8A 1PJTA 1M74A 2MMYA 1N6PA 1R6UA 3DMGA 3PR3A 1DAFA 3VNUA 5L6MB 1TKZB 4GVPA 1F20A 2Z6QA 1NBMA 3NCHA 3FNGA 4OJNA 4HVLA 4EIWA 2AFHE 2VPYB 3TA2A 2ZOMA 2EGGA 4NEGA 1PAUB 1EXNA 2W2LD 4IVNA 4TT3A 3M6FA 1FNDA 2WVHA 5TF0A 5CH7B 2IOQA 5C7IO 4V38A 1KYTA 1FJGJ 1XRQA 3OQ6A 4DR6J 3VO9A 1NU6A 4ZQGA 3AUXA 4FJ2A 2HY7A 2A9KA 3EVNA 4Q24A 2C4NA 1M0TA 4UEKA 1JIVA 3IPYA 1U0HB 3B5JA 2FN8A 5A8KB 5L39A 2J3MA 1N8TA 4B80A 1B1AA 4QJ5A 1E60A 4ZN6A 5BUSA 1MC4A 3KK2B 1X70A 3EBLA 3ZVRA 3RTVA 3QZ7A 4URGA 2IWRA 1QR2A 1YL7A 1ZH5A 2DB1A 7GPBA 3U02A 1UMCB 3HVAA 3HB1A 3NM4A 2XMCA 4FIZA 1O5OA 2O2IA 4K86A 2ATXA 1SFRA 5EMHA 1FJGB 2ZJQQ 5AKJA 5F5XA 1FNBA 1M1NB 2FX3A 4IR9A 3MEGB 1SQSA 5EC8A 1XVAA 2AR0A 1C2PA 3KUXA 3ETJA 2J0SA 2V2ZA 3JYTA 2E5GA 4BNFA 3GLQA 5JS8A 3FVTA 4Y2XA 2IDKA 1LKZA 5CCLA 3J81k 2QPOA 3GE9A 1LPPA 3A4YA 3OTOB 1W30A 1C9MA 3H1PA 1RAOA 4QYRA 3ZU4A 3FG9A 5AXCA 5AXDA 5KYGA 1T6ZA 2AYGA 1RQXA 1YB7A 2BFCA 3PFHA 1VQYA 1YMVA 5I9BA 4H1TA 5DNCA 1P74A 2CF5A 4LOAA 2B8WA 1V45E 1KMMA 3Q8QB 4GX1A 1Y3DE 3AF4A 3FMGA 3H5RA 4DB4A 1NPDA 4RLFA 1R8YA 5LOQA 4XWOA 4HRXA 3CZRA 1C0TB 1NNEA 2AN5A 5ALJA 3VNAA 4M1YA 3TINA 1BKYA 4FSXA 4MUIA 2XBUA 2J7PA 2WIFA 1SC1A 1HYBA 1FFWA 3DLGA 2QB5A 2V6BA 4CIAA 1RABA 4CH7A 3U6BA 2R25B 3WIVA 5J5CA 4B9LA 1TJNA 2HWUA 5ILQA 1YRQA 2VP4A 1PR0A 1XA3A 2MB0B 1E3WA 1W7AA 2NO6A 2XYQA 3L8ZA 3IOBA 4YJHB 4MMOA 2CVFA 5L4LA 2GESA 4LJ8A 1IVNA 1QAOA 3KB1A 1PL0A 3KEQA 3UGJA 4LMZA 3HLTA 4IH9A 4X3CA 1NPRA 5RUBA 4R8UB 3UDCA 2R8IA 3V00A 3NU1A 1RWWA 3PTAA 2V4JB 3UD4P 4HGZA 2B8PA 2C2MA 3KWFA 4G25A 3PQ3A 3LWNA 5F3WB 1T9CA 1RWKB 1K6IA 4MW6A 3GXBA 1SJQA 3IVRA 1GTMA 1LQUA 4DS4A 2ZT8A 2PZAA 4C4OA 3B1XA 3GILA 4X7MA 3OP4A 2C4HA 4RXUA 2QIOA 3G0GA 5MFZA 8ADHA 1R8HA 1E9EA 1NK7A 4PFSA 2P0EA 3QRRA 1W4BA 3LHSA 3OAAA 2OSRA 4CLSA 1RYFA 3LY8A 4RZQA 3QKSB 3HWWA 3HHKA 4A2CA 5D15A 5K5MA 2ZUDA 2P7IA 3UMJA 2CBGA 4BB6A 3HT0A 2DY9A 4ODIA 3GT0A 3M6WA 2IRWA 3AUKA 4XIGS 4HHJA 2J45A 2PUFA 1KSFX 2VJPA 1Y5MA 1FSFA 4ENUA 1GTHA 3JXEA 1QFZA 3ODPA 3GJQB 1NR7A 4HZUB 2XRFA 4KNVA 3MOSA 3C7AA 4GKJB 1Q16B 5HKKA 5G4LA 1UEIA 2O2ZA 3OJFA 4Q4JB 5DNUA 2ZTVA 4C43A 1RJDA 4RBUA 2ILZA 2PWPA 2G77B 3FNBA 1BMQA 2HPVA 2KW5A 4Q1AA 1UBHS 2DNMA 4E5VA 1MAVA 1FKPB 4F50A 1NT4A 1MHTA 3OFFA 1FXWA 4M88A 3G86A 1D9ZA 3ILLA 3RLIA 4XARA 2DFPA 4ANEA 4CBVA 2IYXA 2WSSA 1B76A 3RE1A 5FBKA 3JSYA 4UNRA 4MQBA 1GXSA 4KNYA 1EARA 2B5JB 2H2FA 4ZT4A 1LTKA 2QNIA 4ES6A 3ETGA 2WBMA 4N7BA 3EA4A 4QODA 4UU1A 3ZVLA 2Y1LB 3PRDA 4AP6A 4DR3F 3PHEA 1OBCA 3UF0A 2OPRA 3AWIA 4M55A 4RGQA 1MQAA 5GAHI 2WWIA 3OD2A 3NONA 2CL6X 4EHDA 3O91A 2I7CA 5AW0A 3C48A 3VKHA 1SEPA 3JSBA 5KT5A 1LZLA 2C92A 4O2BA 4EWLA 4JOSA 3H8WA 2E9SA 1UH5A 2MMGA 5LNK1 2GVDC 1KRWA 1XJWB 4F2PA 3TL6A 2UVUA 1YVDA 1TTTA 2WU0A 2PDAA 2FFQA 4L95C 3HMJG 3V5NA 2GSWA 1T4GA 2HF9A 3HHLC 4MLZA 4II3A 3RLFA 1IBMF 2XXAA 3QG5A 3U40A 5JH7F 3EG5A 4O3RA 4ZVPA 2MLZA 5JYDA 1JZSA 1F17A 1L4FA 1XMXA 3NGMA 1B0ZA 5D4LA 3SNKA 3KK1A 5D0EA 2WJ4A 3DBRA 1AD2A 1TQLA 1UKBA 2YL2A 1Y5RA 2GLUA 3VKWA 5D6GA 3KLEA 2HRDA 2IJNA 5BMVF 3IEKA 3B8HA 1Z3IX 4JEHA 3OW2R 4KDCA 4X4OA 3K8VA 2PIIA 1NJSA 1TKXA 3JAMA 2IP1A 3E9YA 4QQ8A 4OCZA 2XCIA 1GSHA 2ZK7A 2PMDA 1OJ7A 1E9DA 2BWJA 2MCFA 4RAQA 4B6RA 5ITZA 2AYXA 4YIKA 3L4JA 4WF9Q 4XM0A 1PW7A 1KYQA 3FE2A 3SY8A 5FFNA 3WQPA 3E3NA 3HSDA 3MCVA 2ZNYA 3GLFA 4RKWA 5IT9A 4IFTA 1AKQA 1TJ5A 3FZBA 2BMDA 3V46A 2HHXA 5B08A 4EYIB 2CZ9A 1HARA 3C97A 2XQGA 3T1HF 4NI2A 4RHUA 3NHYA 3DKDA 2CFSA 3OFKA 2A94A 4P2XA 1DC4A 1W73A 1VHFA 1GL3A 1KORA 2GGSA 2N47A 1VJTA 3WLPA 2QTZA 1ORRA 1Q11A 2ZI9A 1Y80A 2QGZA 3RVOA 3N0TA 2I78A 4NWIA 4MDFA 3JWJA 2DHCA 2PX2A 2NG1A 5E9JA 3I0RB 1Z0DA 2QGNA 5LJLA 2C07A 1IKYA 3GJRB 5K4AA 3SF0A 3MFYA 3FCOA 3N07A 4ZLLA 2Y3YA 5DBGA 3CPJB 1SUCA 1Q8LA 4CGZA 1GTL1 1C0IA 2G3YA 1U7PA 4AMVA 3G85A 4XSVA 2X1HA 3GJ7A 5C3UA 2AW5A 5TPWB 2G9QA 2BDTA 3TM5A 3IUQA 3DE6X 4D8WA 4J0DA 5BR8B 3ELDA 1A5TA 4FEEA 3CTRA 1X4EA 5IZCC 3JQAA 4RLHA 4Q05A 3LSTA 4RLQA 5U4XA 3DE5X 1HRKA 2IPLA 5ES4B 3QELA 4M1QA 3ZBTA 1EVQA 1QB7A 3G4SS 2D2IA 3QJGA 3UB2A 4PLZA 4RPHA 3LUBA 4EPTA 5SYAA 5KG6A 3LE8A 4S05A 3DZIA 4HN4B 2CHUA 3QI7A 1UVLA 4IXMA 4M1OA 1WU7A 5E9QA 2C82A 1BHO1 4FFOA 3HP6A 2NUAB 4DADA 1ZHFA 4BDTA 3EFOA 5CXUA 2ZKLA 2O3DA 1WCWA 1TJ3A 2PSDA 4ZI7A 4O4IA 3SC6A 3QKSA 2CXQA 5BN5B 3KL2A 3W1YC 5EPEA 1HEYA 2DNQA 4PC6A 3MCAA 4FYXA 1Z8FA 4EB6A 4QIHA 1H72C 3UCUP 4ZLJA 1SCKA 3T9FA 4LTMA 2ZJ1A 1SBCA 1CRZA 1WDWB 1JX4A 2B7CA 4L73A 1BWQA 4DILA 2AZXA 4CTOA 1J0BA 3LDGA 4B7CA 1USIA 1HYGA 1J2UA 1KQFA 4EEYA 5AI6A 3PRJA 4G6ZA 1LW0A 3AM1A 3IAM1 1D6SA 5CXXA 2NZUG 4LY9A 1YS7A 3T1OA 1DOAA 3GRKA 1RRPA 3QO9B 3OEHD 4UOGA 3TKLA 4BQRA 4FT2A 3QLEA 2PS9A 3GA0A 4YUXA 1C7ZA 3TECE 5ALYA 1T5OA 4A0FA 4ECXA 4L51A 3BPDA 5ALSA 4USHA 1QOQB 5ENZA 1H3FA 4IGEA 3M6UA 3RBZA 5ETSA 5E8JA 2J7KA 2VDLB 1E9VA 4CM6A 1SXLA 2KG1A 1VBYA 3AVQA 2B35A 5BW5A 3MQ2A 4B3OA 3B53X 2WYOA 3ESBA 2R6HA 2FTRA 2FHMA 1QO7A 5AJUA 2NUTB 4IDEA 5DYTA 1IM8A 2XKAA 2YS6A 4TYMA 1HTWA 2AYMA 4Q15A 1MJGM 1NFQA 2W58A 4D6PA 4FNIA 4CM7A 1YIOA 2FDCA 1X4BA 3E2MA 3D8RA 1NF3A 3H9JA 4N8EA 4V0QA 5JSZA 5AVTA 1Q7RA 2PKEA 1GU1A 5FPPA 1NNDA 3C1TA 1DQ8A 2X3GA 4PYKA 3J81U 5CD4H 1E7SA 2VKQA 4GKBA 2XVYA 1KQPA 3AHHA 4WK0B 2O0HA 1GPUA 4ENTA 3COYA 2BZ2A 4J16A 3HD2A 2ZU6A 1WRBA 4RKYA 3Q3VA 4HRAA 1ZU4A 3DDKA 4BKUA 5BNZA 4II7A 2QIPA 1ZOLA 1YU6A 5E1BA 3OT9A 2PKWA 4LF4J 1CHDA 4ZOCA 1Q22A 4KI7A 5BSUA 4ILKA 5HZKA 2RD5C 4AL6A 1P6QA 3KQVA 2H8KA 1NLFA 5I9SA 3VSEA 2VAMA 3A4LA 4LZPA 3I4CA 1Q92A 2R85A 1NQWA 4W5OA 2C8LA 3JS9A 3O83A 2NLWA 5DHRA 3DS8A 3ZWPA 2PD4A 1D4AA 1ZONA 4Q2LA 3U4QB 2MSCB 2H17A 2XY5A 4BKPA 4NMXB 5A6WA 3PEYA 3TTYA 1Y00A 3DHVA 4FI3F 2HRCA 1RAEB 4GYJA 3W7BA 4DUGA 4QG3A 1JEQA 4AF8A 1MB9A 4NAVA 1JKJA 1ULSA 2NVWA 3MILA 2YNFA 4X8OA 1RTHB 1S7GA 1IEWA 1VYHA 4F1JA 2EFPA 3U0VA 2I3ZA 1NJ6A 3CVJA 5KQPA 5A2QU 4RGVA 4RC9A 5ETLA 3DYBA 4PN3A 2QW8A 3QH4A 1AG9A 1XELA 4GH5A 3NTLA 1PLJA 3TZWA 4JJAA 3ZX4A 5A4DA 3FCWA 1Q0NA 1OQ3A 1LF0A 4WY5A 3PXCX 2JI4A 2A2ZA 3Q8UA 3C2QA 3FPHA 3DMDA 4ASUD 4L22A 1KZ9A 1CQXA 5F78A 1KE2A 5KOHB 1Y5NA 4BJ1A 4DVJA 1RHMA 3KVOA 1FXWF 5F5NA 2OO7A 2OM2A 4HN2A 1VJDA 2BA9A 5TQ0A 4BIIA 4QASA 4OI1A 4Q12A 3WWZA 2HK3A 3LWZA 4AW9A 4YJFA 4HDRA 4Q3CA 3WGYA 1QGOA 2V0NA 2IDEA 3V7NA 1PZEA 5KNCD 2J0EA 4PX9A 3ECSA 4CFYA 1HBMB 2OXFA 2IHTA 5JAOA 3MT9A 4KAXA 4AXBA 4GUDA 2CHGA 2IU4A 1V1MA 4REQA 1O9BA 4C7JA 1HD1A 5HQTA 1ZO8A 1FRLA 1HQEA 4AECA 3FN4A 4UUMA 3CW2A 2VDRB 4PQUA 1WNEA 1VCMA 4Q1VA 5CZXA 1L8OA 4EHHA 4TY8A 3E5MA 3I55S 4MAFA 4NOJA 1ZH0A 4NJEB 5A05A 5EPOA 5K0TA 2JCYA 1DHRA 4BNNA 1JIUA 3D5MA 2LDBA 3PUJA 2P6NA 2LDXA 4GKKF 5LKRA 3PPWA 4WOCA 1PO7A 1KZ4A 4HLCA 1T4MA 4UC0A 4MIKA 4GOMD 1XK6A 3UY4A 1DFIA 2JFKA 2X19A 3BFJA 4K4VA 5TV2A 3T12A 4M1WA 1D2MA 1DUIA 4RACA 1SVKA 3CCWA 1B70B 1XD2B 3THXB 1I7DA 3H3JA 4MPJA 3H19A 1FS5A 3CWCA 4XQGA 4WYLA 1JLGA 2NT4A 1HO3A 4B73A 3DMFA 1XEXB 4JBXA 4PQGA 4YAJA 3LT2A 4JVMA 5FWXB 2QLLA 1RMTA 2FHJA 2R62A 3VC2A 4JT8A 4AN0A 1SHZA 3DLKB 1CF4A 4HD8A 2QXTA 4QWCA 3J7AC 2WG2A 4I6JA 3TA0A 3DYAB 4TS3A 3CZAA 1NR5A 4U8VA 4H17A 3AOBA 3GLGB 1NRIA 2E5LB 1HQEB 3QWUA 3VV2A 2CW5A 1E6VB 1DGQA 3WYCA 1NGSA 4LR7A 3WAKA 2QA1A 1N6LA 4G97A 2K7JA 1X9SA 2I2XB 2O1XA 1EEXB 1CJMA 1TVKA 4R69A 3MTJA 1BIFA 4JI0B 3IURA 5DASA 2XMVA 2RAUA 3CNHA 2HSEB 1DJQA 4GKVA 1BJTA 1F3LA 2PJUA 1NZFA 3BD7A 1KHHA 4KQKA 1E3MA 5HKOA 1YCGA 1AOXA 1A77A 4KHRA 4IMPA 4V0OA 2GO7A 2PZJA 4WUVA 1UFQA 2XUPA 5DO9A 1IATA 1SU6A 2Z58A 3DKPA 3Q11A 1ULHA 3L2OB 4WTOA 4JBCA 4E5SA 2QX6A 4AQYB 4JB0A 4AK9A 1JXVA 1S3GA 5LMUJ 4L4SA 2WD9A 3JQ7A 6ADHA 1CY1A 2WTNA 3R4CA 5LBIA 3VKVA 2IM3A 3NGDA 1DAIA 2KFZA 2VT7A 1K7EB 3VYTB 1U8TA 3DDUA 4Q0BB 2V58A 1RAIB 1V11A 1CG6A 4QDJA 1AHPA 1SHKA 4L9AA 3C6UB 2KXNB 3B6EA 3ABQB 2DWOA 5T5QA 1CQMA 1N5QA 1LRKA 4WBNB 1BU5A 1IKXB 3U17A 2Q6CA 3DMHA 4PRLA 2VSYA 4CO0A 4KXFB 2HZAA 3ZV4A 3OIGA 4GO7X 5IYZF 1VPEA 4H3HB 1AS2A 5LMUB 5FDLA 3GJQA 1T6YA 1P73A 4LW8A 5L7WA 5IM0B 5E9AA 3OIUA 4NOLA 5DTIA 4KE6A 2GI4A 1IRIA 4G3XA 1NZ8A 3KQPA 3NBQA 4RZRA 3PC8C 2R68A 4QDKA 4WL0A 1W5BA 4XIJA 1QVZA 3IXLA 5KTRA 2VK8A 2FF5A 1SUSA 2YVUA 5AKZA 1G5FA 2B61A 4MQUA 2XMTA 3HRKA 3K0AB 3PU6A 2PQ6A 4B2IA 3PQ7A 1JJBA 2YQ5A 3KKNA 3H9UA 1D6NA 3GT3A 4F2HA 1OBFO 4C2BA 2A1TR 4M1TA 3A8KA 2VDKB 3CDBA 1YVUA 1U2EA 4MQMA 4AUKA 1YZ3A 2VFSA 2WT4A 5CVCA 4PYAA 1HL6A 3BH7B 2GILA 2DETA 2FPGB 5B09A 2GD6A 2ZJOA 1U6IA 1SC6A 4N4AA 3JD0A 2E18A 2RHHA 4I67A 2QTBA 2UVDA 2GM9A 3CGGA 5E95A 3A1TA 2BZ0A 2AOXA 3HO8A 2WSFC 3MFHA 1GR1A 3AJDA 4AB1A 4FXWA 3PQDA 3WDKA 5JVGQ 4YFUA 4UBNA 2FFHA 4DR3B 4IJ6A 4KXNA 4PZAA 1MIOA 1DXYA 4EJMA 3HZHA 3P4YA 4MW5A 3C3LA 4AKGA 1R27A 1RWPA 1KQNA 3DZJA 1BQEA 4KXXA 1GPYA 2I3AA 9LDTA 2VT3A 3H2LA 4TROA 2NXEA 2G25A 3WLJA 1X0VA 3R5CA 5A1JA 1T9UA 1CT9A 3IS3A 821PA 1NYRA 2PE8A 1U1LA 3TSZA 1IQ0A 4JI6B 2HLDD 5K8VA 1B3TA 4QICA 2NWQA 1F14A 2DEIA 1FFWB 3QY9A 1GPJA 3FYHA 1NMXA 3UCEA 2DGXA 3LFTA 1KZYC 1T9XA 3P0JA 3D6NB 3HZOA 1I4WA 2XO7A 3G8SA 8GPBA 3RBEA 3RAJA 3QOXA 1O94C 1N0IA 2D00A 4EYGA 5DG8A 4G0XA 3KJXA 3G6KA 3R9KA 1HYEA 1U0JA 1Y3FE 1TUBB 2DUJA 3QLHA 4MUKA 2ADMA 3CZ5A 1VL8A 2NV0A 4IZ6A 4U8HA 2Q6KA 2R48A 2ARKA 3S8SA 3HA3A 3AUUA 1SKAA 1ZU5A 4O1IA 2X0EA 4E5YA 1A5AB 4RQAA 3EZUA 1NN0A 3SKYA 4M5DA 3TJAA 1GADO 3PFFA 5THXA 4U5XA 4JXXA 4LYDA 1RGVA 1XHEA 5A5VA 1YJUA 3NBKA 3G9XA 1K73T 3IN5A 4C98A 3C15A 1NRKA 1EFLA 4QOGA 7YASA 1WUHS 1HBJA 2GA8A 1MMLA 3CNOA 4RVGA 4BY9E 1T1GA 2EJTA 5F8IA 1N5VA 1D2HA 4F5ZA 2Q21A 4MVWA 1AQUA 4FNMA 1U2GC 3CKYA 2VBWA 1JTFA 4KQZA 1AGPA 3EFEA 4OTZA 4F8EA 2IYGA 3HO1A 5AVZA 1Y3JA 2ZH1A 5TLSA 1Q1GA 2EG5A 4PTZA 1TMKA 4ACAA 2QVZX 2AX0A 1P4RA 4I55A 2OP1A 3WZ0A 4C4XA 1M2HA 2BEVA 2BE2A 3K9FC 2VDQB 5ALHA 1RWMB 2FN3A 1H94A 1SOWA 4TTPA 4NLGA 1GTG1 3R7BA 4PGHA 4K2XA 3C98A 3SBOA 2BKXA 4DMHA 4NRDA 4KQGA 3V6MA 1YZUA 1LVUA 1XDSA 4LEIA 1DP4A 2FTKE 1V6SA 2ZIZA 1OFVA 2LA4A 5THKA 1KOHA 1DX6A 3I0SB 1QC5A 4OI2A 1N78A 2RGNA 4ZEMA 3S70A 2UU9B 2MQNA 3LRXA 1PYSB 2A58A 5BSRA 2UVQA 1UW9A 3SCJE 4OQQA 3OFEA 5B57C 5AESA 3QIDA 1AV7A 3DV0A 1ECBA 3T7EA 3N28A 4PW0A 1MU2A 3NXSA 1IZ9A 4Q19A 4ZAZA 4ER3A 4K4XA 2J3JA 4NAUA 1PK7A 5FUYA 3CIOA 4KH0B 1S2GA 3DXSX 4N8SA 2AJ8A 1HW9A 5DQGA 4DYDA 2ZB7A 5FUVA 1RP5A 4JLAA 3ROGA 1VFJA 4XSHA 2WJ3A 1JG3A 4M0FA 3EXHA 4OXIA 4FONA 4L9SA 1SH2A 3FJ1A 3KZVA 3KAQA 2NS1B 1JT2A 1FO1A 3BMQB 5HL7Q 4DX7A 1DCFA 2FI1A 1UAYA 2O5RA 4MK9A 2VFTA 1PGOA 4Z1OA 3IBCB 1D04A 2QJOA 3L93A 1RZUA 4C07A 2CADA 4RNCA 5KWIA 2OESA 5CA0A 5JRJA 1KI8A 3M4JA 4XI9A 4BFXA 1K89A 4JI4B 1Q0HA 2INGX 1WD6A 5I3QA 1ES9A 2P2GA 3A70A 3ORYA 4YUYA 3IQZA 4Q9AA 3CX7A 1KNQA 4GKKB 2P9CA 1N3LA 2ZBGA 5JUMA 4LXQA 4DCGA 4P4SB 3RIXA 2YJ6A 1WG5A 4B08A 5ENDA 1YTLA 3DMJB 2Z1DA 2DR8A 4NBWA 1MWZA 4PXSA 4S12A 1SVNA 4DLUA 3H42B 4PX2A 1CU1A 2CLDX 3EBPA 2Q0SA 5I4CA 4LQCA 5EX0A 2JIPA 1MVOA 5FLEX 4C97A 3M33A 2QUIA 2WWGA 4WP3A 1EKXA 3S2GA 1VRWA 3H8YA 5IUJC 1XNRF 4UTXA 2MHEA 1DO0A 3AM4A 1NULA 1TZKA 4YJGA 5DLEA 2NVBA 5J2NA 3GHHA 4HEA6 4IKPA 3N01A 3SSQA 1FWLA 4QRIA 4HWPA 4D9IA 1SV5B 2DF8A 4ML3A 3P0FA 1X0PA 1FU4A 2Y0DA 3KLMX 5DTMA 3NS5A 5C0OE 3NHKA 3GZ4A 1IBRA 3L46A 1VG0B 1S8OA 4FXPA 1DRJA 1HI8A 1JI0A 3KPYA 1H7WA 1WETA 1NVFA 1CS4C 3SG0A 1KI6B 3FDIA 4CO2A 1C0EA 5H9FJ 4ETXA 1XEXA 3H2HA 3HMQA 3E51A 1O97C 3W9BA 4EO8A 2HS0A 2YMLA 4R1MA 3BRCA 1GUFA 4CTKA 3BRSA 3UK0A 2BIFA 2H1WA 2WT8A 1I3NA 1KMNA 4RHCA 4NCXA 1NW3A 2CHEA 3NHMA 2JIQA 4BE7B 1Z0IA 5IARA 4ITUA 5FA8A 4KGKA 3B1WA 4GXQA 3B9PA 4FKYA 2AOVA 2W43A 4UEOA 5BUQA 1FDSA 3E61A 3UJNA 1P27B 2MKJA 1KPIA 2NADA 4LF4B 1N7GA 3RYLA 5F51A 3K1ZA 1SKQA 3EXEB 1P2FA 1LSJA 1WBJB 4HLUA 1J20A 4B3RB 3ZH2A 2DPLA 2F17A 3BULA 1NSFA 3EEYA 1QP0A 4B7ZA 4U67Q 4LBWA 3UDVA 3WK9A 1KLMB 1NLZA 2P8IA 1CR6A 4IJMA 2PZLA 1GH8A 1N6NA 3IUYA 2OUKA 3MJCA 5HMLA 3H4BA 1IDN1 2WW8A 2N4DA 2LYVA 1RTJB 4Y7CA 3KQQA 1OIAA 2DHGA 4E2ZA 5KSPA 5J5AA 3PDUA 3IAS6 1SIOA 1KBRA 2OEPA 5C8VA 2JIBA 1X1DA 2IV2X 4M54A 4FJ1A 5B4TA 4M7OA 2JGDA 1RAIA 1V11B 3B4DA 4YDDB 5DJ5A 3TTVA 3P45B 3JSMA 1WXWA 2VRCD 2UVWA 1VDZA 4OB7A 4P7VA 2X0IA 2WWWA 4UXJA 3IUEA 3FDFA 2FQQB 4R01A 4U02A 4CP5A 2ZULA 1N6OA 1FP4B 4HATA 1JU4A 1NXPA 4CF6A 3IUMA 4Z9XA 2UYQA 1T9AA 1UAGA 2P9EA 1GNSA 1YZHA 4I64A 2CNDA 2OZKA 2ZSKA 3FBBA 1JIHA 2H1FA 1IN6A 1WHYA 3W5IA 4R8UA 4KJIA 4LHEA 3HKBB 1OWMA 3PE4A 3O3MB 4NYJQ 2ZAYA 3B13B 3KG1A 1J90A 3DYAA 1RBYA 4P54A 4FBMA 1QTRA 1RJWA 1UJMA 3GEPA 2AIRB 1I1OA 2BFAA 1LLQA 3D7LA 1LDBA 2QYSA 3Q0TA 1Z26A 3SN6A 2FWPA 5IVPA 4ETZA 4Z0HO 1OIXA 1H66A 2JI9A 4GS5A 5SZHB 3R8XA 2GMHA 1RS0A 2HQOA 1G19A 3O9ZA 3ZJVA 2D1YA 3PTWA 3SMQA 4MW0A 2PLRA 2XHWA 4DXHA 1R8SA 2NUAA 4O3MA 1WZCA 1RZRA 5FHRA 3SJZA 4ZJOA 4GNKA 4EK9A 4BLTA 3LP1B 3WG9A 3LOQA 4TU9A 4AJ1A 4YAOA 3TZ6A 1OAOA 4J7AA 1P18A 4XOUA 2K6GA 2GHQA 1WNFA 1F2TA 3QBCA 4E13A 2WWRA 1QV9A 3OWHA 2XZDB 5DHTA 1JIKA 5C42A 3DBVO 4O2BF 4EHAA 2EZ9A 2OV4A 4CDGA 1RWXB 2L18A 2RAPA 2ZRLA 3ETEA 1IY9A 1HRDA 2QN9A 2B7BB 2W01A 1VBZA 4TTAA 2VBCA 3KLNA 4FDVA 2A9RA 1UK7A 3HKBA 1HYSA 4EBEA 1TNDA 4ZMMA 1KOFA 2Q1WA 5IN4A 2EFYA 2PGNA 1RI5A 1XROA 3UJ9A 4JY7A 3RVPA 3BREA 4WFYA 4L15A 2O23A 2O3UA 1HBNB 4G0YA 1BKDR 4N5LA 4N41A 4JI1B 1IM6A 1IY8A 3BFVA 4ZOLA 5DDPC 4TXMA 4IHKA 3TZQA 4WW0A 1U4OA 4FYWA 1PG5A 3E9CA 4YCSA 2ETVA 1RYYA 1N6IA 1RACB 3WLSA 3PCXA 2Q79A 2MKSA 2WUEA 5SY6A 3NKVA 4N18A 2WU8A 1L8LA 5KOHA 2P4SA 5AVRA 4G0UA 5D0HA 3C6TA 2COEA 4S2UA 2QZSA 2W2XA 5DETA 1JHQA 3PRYA 3Q1LA 4OI0A 1BMFA 4PC2A 1IQUA 4JV5F 1YUMA 3HXMA 2VUSA 2FV8A 3ND7A 2BE7A 1NKBA 4N0PA 4JI1J 1Y63A 2OKGA 3GLHA 1UOEA 2AJ0A 2PMHA 4N7JA 4AFFA 1ZGBA 1S99A 1R7RA 4OHYA 3HA2A 3P71T 4TS4A 4R5PA 2GJFA 1WACA 1NW7A 5BQXA 3GZTB 4WZMA 1ZN8A 3V4RA 3AHCA 4I1TA 2EGHA 3WBKA 1F6WA 4KBYA 2VJLA 4UT4A 2D4AA 2XNKA 3TNLA 2U1AA 2TMDA 1E79A 4WCEQ 1Q7LB 1LOUA 2XA9A 2LQ9A 4MWCA 2CLSA 3UK7A 2EC5A 2BMJA 1CS0A 2E48A 3AQOA 2H1SA 4B81A 4A8JA 3Q8LA 1X5TA 4ES3A 5FEMA 5FUWA 4MKRA 4Y1GA 1UCFA 2EL7A 3NRBA 1ESCA 1TKAA 5DBHX 4FDMA 1FVQA 3EDQA 3GOHA 4MPRA 4EB0A 3Q8MA 3N8HA 1MMFB 3FKSD 4YYZA 2P78A 1XJ5A 3AOEC 1FVHA 2D0OB 5EWGA 4CCHA 1VGQA 4E8UA 3DHXA 3E1KA 3LYHA 3F98A 4CMGA 5IM4A 2YKMB 1OT3A 4LOJA 4A0SA 4Q47A 4CG1A 2HB6A 2ECFA 1UBSB 2V0GA 5KT6A 1M2WA 3ZZOA 4V0KA 4BECA 1PZHA 2IXGA 4OHBA 2O2CA 4CKEA 1D6JA 1MOZA 2GJ8A 1PYOA 3PC8A 3CC8A 5CITA 1QM5A 4HHEA 2I2FA 1W9MA 1NKSA 4PC7A 1NFFA 1FUUA 5CT9A 4QE3A 3ZE7A 3NOGA 1LPSA 3S2SA 1TCVA 4RA6A 1HORA 2WWHA 5G53C 2GQ2A 2QUZA 3GPIA 1YRWA 3MUOA 1TZMA 5FIUA 2G04A 3M8WA 5K9FA 2WI8A 1XZHA 4UREA 3OX1A 2HGZA 3RBDA 3GLIA 1XWFA 3WHLA 3M05A 4YRCA 2UXBJ 1NK0A 4D8TA 2MR5A 4EZIA 2V7VA 4NYIQ 3DDZX 3H11A 3O47A 5H02A 2ODAA 2RK4A 2J3LA 4YJHA 3NBPB 1HHQA 3HH8A 1GHTA 3SXUA 5CYGA 3VR2A 1P2GA 4JI6F 1UZNA 4KQCA 3TGPA 4DR1F 3P9NA 3WB9A 1XR3A 2LCIA 4KRYA 2QRVB 2OBNA 4F91B 5KPDA 3V4SA 1YZ7A 3D6JA 1Q44A 4P34A 3AT1B 4DG5A 3H0KA 3LKDA 3RUEA 3JXOA 2G83A 3DNPA 4GFDA 4BRUA 3RVLA 3I2GA 1EM8B 1GLVA 4GDMA 1WOOA 1AQIA 4PGFA 3AEQB 3PXUA 1KDRA 4URHA 5LR6A 5I5EA 3AA8A 3X1MA 2XV1A 4YMGA 4DM3A 5FPKA 4D74A 3H9CA 1XRMA 2M6KA 2R4QA 2AJCA 2VTDA 1W0JD 1G38A 3SEAA 2F4NA 5DDRC 5I9LA 1KWKA 4GPZA 3OTOJ 1MB4A 1I5OA 1ZC3A 4EA7A 4G4SP 5GVSA 3ZU6A 5TEWA 1D1SA 4AY4A 4MB2A 3IELA 1SXJA 1KMHA 5DTJA 4QU7A 1COWA 4HO1X 5LDHA 5EMMA 3VISA 1U28A 3DMNA 2G1JA 3QT8A 2GEBA 4B3CA 4IW3B 5KWEA 3DZGA 3EXAA 1CZRA 3QVTA 2V7QA 1YZKA 3K0FA 2AYZA 2N46A 1NQXA 5B53A 3N74A 3DKRA 2JLQA 4JBYA 1MOPA 5AOAA 1E1CA 1ONOA 1ZH4A 1B3RA 3PK0A 1S79A 1U2FA 3CTMA 5AHWA 3A3NB 3EMDA 1EETA 1KFDA 2B3TB 5CA5A 1TMOA 3V8RA 1B8OA 1PVOA 3P5BP 3LSYA 4WJBA 4U7UD 1CJCA 1Y4AE 4Z9YA 1YDLA 4MW7A 4W8HA 4LCJA 3DI6A 4S3MA 4TLMB 1VJ5A 1P1FA 3IB6A 2R0QC 2IXDA 4FC6A 4QELA 1KH2A 1C0UB 5HRUA 3ASUA 5A5DA 3KFXA 3OLAA 2BFEB 2IE8A 2I29A 1HZZA 3O1JC 4OAPA 3EUEA 4RMNA 1SWWA 3DGFC 2H29A 4L0MA 5JXGA 1PT9A 4MR7A 3SI8A 2GO1A 1BW9B 5L38A 1FVXA 4L3WA 2OMLA 4R9SA 2MZTA 5JCXA 4JI4F 3OZIA 2EK6A 2Q4BA 1IOWA 1O95A 2DO0A 2D9OA 3EVWA 3HYCA 4B3SF 5JNVA 1OAKA 3CGIA 2MQOA 4QGFA 1UL3A 2QUAA 4FN5A 2GVZC 4G1VA 3W5CA 4KWCA 2C2NA 1JL3A 1M34B 5J4VA 4U9RA 1VE9A 3R7SB 3RRJA 3M32B 3RU0A 2CCGA 1QVWA 4F4FA 2EG1A 1MRSA 2N75A 3C6ZA 2OEKA 3PNVA 2VQFF 2PMKA 3ZIAD 1KR5A 2ZUAA 1QHXA 3UJDA 1ZHOA 1S0OA 1WEZA 2KFYA 2YW9A 4KZPA 2L48A 3CHYA 1Z5NA 1JLAB 1GRQA 2RMKA 2E44A 3DKVA 4OKSA 1BJRE 2JSXA 2QN8A 4XCVA 2DUUA 4WY2A 3VBEA 3S81A 3NQ41 4CMEA 3DP9A 4X85A 1UVKA 3N05A 4MQ5A 1OXTA 4EEKA 2Q6TA 2JLWA 5FPTA 1VC2A 1HDOA 2I87A 2RSLA 4TQGA 5AI9A 3F6SA 1G9TA 5ULLA 3GR1A 3QFHA 4OHWA 3QKRA 1V8OA 3C6MA 3VAAA 2JH9A 4W99A 3W6ZA 1I4LD 4WYWA 1XUOA 5CMLA 1ECLA 4IG0B 2YJ5A 5C5IA 3OLXA 1GSOA 4S0XA 1NJ5A 3I2IA 3JD2A 3DFEA 2NX2A 1GQYA 2TMYA 3RKUA 1WW3A 3C4QA 3WIOA 1WG1A 4UU7A 2C1ZA 1TU4A 1FX0A 1NXTA 1Y3CE 4QAJA 4G09A 3LZ6A 3BGRA 4FKBA 5TQ2B 1Z1ZA 3C14A 2G70A 4AO8A 2LKCA 3TUPA 1T9YA 1CZUA 4UZCA 2KI5A 4C48A 2Q5OA 1M7GA 3A13A 3E53A 4Q7EA 2EEYA 3D6TB 2VHEA 1SGWA 5ICMA 1ZJ5A 3F7NA 1WQ3A 4JYMA 1G2OA 2I4NA 3RWBA 4HN9A 3O84A 2RI6A 1A69A 5C3MA 1M5KC 3RH0A 2QL7B 1MDBA 4IVQA 4UUQA 3HUTA 4W7HA 4XAQA 1PUXA 1QGUA 4JEIA 3MEEA 1P91A 3C8YA 3C1UA 4NTZA 4YR3A 4PQFA 5C24B 4TV8F 3IQIX 5ES3A 1RE1B 3PPIA 1A72A 5F98A 1HBNA 4NLLA 2O7NA 1E2LA 4JI3B 1EP1B 1NBHA 3PXBA 5H82A 4QXOA 2VN8A 4PWZA 5DP1A 2HAEA 4XASA 4JKIA 3DN9A 3O8BA 1K8AT 3ILJA 4KGXB 1YH3A 1RYDA 2PAAA 4EW6A 4QQNA 3BE6A 5IF9A 3VV3A 2OSVA 4M7RA 4RZ3A 4TSFD 3HP1A 2OHDA 5ICCA 5A4AA 1MEEA 2H48B 1FP1D 2WVBA 4FPIA 2D74B 2HPZA 5A1TA 2V9WA 3HJUA 4CIYA 2X3FA 4KMOA 3T8YA 2Q5FA 1Q78A 1ZRHA 1RHUA 4RW7A 4FLMA 4CM0A 4B76A 2FW0A 3F9RA 3J7ZT 2L82A 3ADBA 2IY9A 2LU1A 1X7GA 2AB0A 2O5CA 2BKLA 4JI3J 5ED4A 4KZKA 5IMSA 4C7OB 3LPYA 1PV1A 5K6AC 4BVEA 5ETRA 2BW0A 1NH8A 2Q8QA 2W48A 2RJNA 5KNBD 3LPEA 1E7MA 2HA6A 1NG9A 2HREA 1UPUA 3IR5B 3HY3A 4OHUA 4DWWA 4RO0A 4Y2MA 2GB4A 3LFUA 1HNWB 2ZYTX 2G7ZA 1QU2A 2EC2A 2YHIB 4ZOSA 3V2IA 2XNJA 2KZMA 2X8WA 4Z7CA 5JAQA 3F3SA 1QCDA 1SCBA 2UXCB 3V1UA 4MPDA 2OFOA 4BC7A 2QMUA 3FZEA 4OH1A 2JIZD 4NU0A 4CQLA 3IP0A 1QRRA 2FMFA 4Q43A 3C3PA 3E8XA 1DRWA 1D8YA 2HG4A 3ET5A 3TX8A 4AZ0A 4CT4B 1RISA 2GDZA 4RTOA 1RA7A 1J33A 3RNOA 3RJMB 3NPAA 3V81A 1YJWS 1M34E 1WW8A 3A2NA 2ASDA 3H2BA 1DKLA 2QQ5A 2H5JB 4S1VA 4HDRB 4ILMA 3C16A 3W2WB 1ZMTA 2O8NA 2BJVA 4Q16A 1GRCA 3G5MA 4LBIA 3CE6A 3WKAA 1SPBS 2GTIA 1BXRB 4ZRNA 1L3VA 2QT0A 4C0OC 3OKFA 3A4TA 3L3BA 4BLQA 3DVSX 1U2SA 4Z7JA 4F67A 2W0MA 4ECTA 3CD0A 3F8WA 2G36A 2BP7A 1QAJA 2JAQA 5CB4B 5BSHA 4LYJA 1DRZA 4AL5A 5HJ7A 3FD8A 1KI2A 2ODQA 3MJSA 3TP2A 2I0XA 2OV2A 5IEJA 4MDHA 1EJ2A 2PJZA 3P45A 2A5LA 5ILGA 1SUDA 4ZAWA 1U63A 3H1FA 1U3FA 2OAP1 4G8DA 2EARA 1PO6A 1O95C 2E55A 3T5PA 2QZ8A 3SX2A 1TLTA 4DPLA 4I4BA 1EG7A 4CCWA 2YWWA 5C80A 4MWDA 4CKEB 4AZSA 1DBPA 3ZGVA 1U2CA 4C87A 1ICEB 4BRZA 3EAQA 5T14A 4N6NA 3ZDEA 4OM8A 4M49A 5FO1A 3GIWA 1RA6A 1U7UA 3H8SA 4E5DA 2XDQB 1V35A 3JASA 4D02A 2IGTA 3I2JA 1DTWA 3FYSA 2DHQA 1B99A 5AWFC 1WCIB 4J2HA 1FNCA 2QEQA 4WGFA 4JODA 1I2ZA 4H27A 1Y4DE 5IWCA 1Z5ZA 2FFAA 2FGCA 4BMCA 1Y5IA 4ZKDA 2AXQA 3VA7A 2MSSA 3EVEA 4L75A 4CM3A 1WXQA 2JCSA 4UQLA 2D1CA 1D03A 3L82B 3ZJYA 2BM8A 2IOFK 4RF4A 2EWVA 4DJ5X 1MN9A 4EX7A 5CGQB 1C0PA 4ZO6A 4MR7B 3U3RA 2YYZA 4ZJUA 4CV2A 3A27A 1ISPA 3M30B 4JLNA 2YKOA 5A8WB 2NVUB 3R7WB 5JCJA 4IRKA 2GCIA 5T4HA 3PJDA 3BMOB 4DJBA 1HWLA 4FF4A 4J43A 3DH0A 2FVXA 3OR2B 2J6BA 1JG2A 3KLFB 5GJWC 4DMCA 2CFCA 2HJGA 4EYSA 4KIAA 4PANA 1Z56C 1RC8A 3K5NA 1CS4B 5D6NA 2RONA 4WXRA 3VUFA 4WADA 2KLBA 2D3WA 2R86A 3TLEA 3LI2A 5ITVA 4F84A 2Z2YA 3EQ2A 3HVTB 2FJPA 1FDNA 3B6MA 3H5VA 1PBTA 2BUCA 1W7WA 5JG7A 3TUIC 2C95A 4QG7A 2F1JA 4NC9A 2KZZA 4LJLA 2FVYA 5TJHA 2RQMA 2XB2D 1NHGA 2REQA 4XB2A 3INGA 1G5RA 3F1LA 1H4QA 5FOQA 2D0DA 3KQLA 3TARA 3QRPA 5AHXA 2DGOA 4I7EA 2A35A 2RIPA 3DVAB 4WNAA 5CH3A 5EWMA 1Q1BA 5FLXU 2WZDA 2PK3A 4P71A 2JGEA 4LYAA 1S1VA 2VF3A 4ZIWA 4AS2A 3D0OA 5DJBA 4GC9A 2W6JA 1M76A 3O8OB 1MC1A 1EP4B 4DDMA 2A4KA 1S9FA 4N82A 4AMZA 3PITA 4B3SB 3A1YG 4ZU3A 1QMPA 3TW4A 1PHPA 1IBLB 3VGTA 4NDNE 2QTHA 5JSKA 5F73A 2B8JA 3FOZA 1GILA 3ZD7A 5GWXA 4LVUA 4GMKA 1HW8A 1T4BA 3CVYA 4HYQA 3NTOA 3Q7PA 4J9LA 2CXHA 4QYWA 1HLFA 2ZKTA 1SBQA 4EW2A 4GLFA 2VV5A 3HPRA 1RPNA 1PE0A 1PI3A 3NG1A 4W8GA 2V0CA 1N75A 1ZS9A 3L6UA 3HM2A 1ZVJA 2NO5A 3BH6A 1LCIA 1PYDA 1F1JA 3A7EA 1BS1A 2O8EB 1XL1A 1IFXA 3PW5A 1QIEA 5KG1A 1J2EA 2PY6A 5AW9A 3BBFA 2VT6A 2FZGB 3D1HA 4RWWA 2HAIA 5JISA 1QHYA 2DTEA 1J2TA 4R84A 4Q21A 3SV3A 2Z0GA 2QM7A 1TZCA 3RHZA 3GB9A 3UW1A 2GX6A 1VJ1A 2JGNA 4GVXA 1E1NA 1Q1KA 3HRIA 2XGOA 4AMUA 1TF2A 3WMWA 2PEYA 2REOA 2GZ2A 3PEWA 4TQUS 3TJMA 3IUSA 3FWHA 3E8SA 3V2GA 5BSEA 2CXXA 4LRDA 5B6JA 4UM8B 4BUZA 3LQRA 2B56A 4M9CA 5KOYA 1E69A 1EJ6A 1D9AA 3CNLA 4B31A 2C04A 5CDFE 3T1NA 1RKJA 2FHPA 4ZVNA 3O94A 1ZEJA 1QJ4A 3P8BB 1AUDA 4DEZA 1ZJYA 1UM8A 1OYDA 1QHHA 4OKIA 3FVWA 3F73A 4P3YA 1TKZA 2ACEA 4C0QC 5KFIA 3MD9A 4Q4AB 1CIPA 2AE1A 1CJUC 2YXNA 2IYIA 5FD8A 4V0ME 3CRMA 1KFCB 3QA9A 1P39A 3WLIA 1P0QA 4ESHA 1RAGA 1HPZA 1GXUA 1N9ZA 2IJGX 3UJBA 3PX2A 2W2KA 2HFUA 2WKRA 4OL9A 2CC2A 3UJAA 3EXHB 1PKUA 1BXGA 3Q87B 4KQXA 1FYFA 1CUJA 2CEAA 3GLRA 3DHEA 4RK0A 1G291 5F2EA 1ZNWA 4JL6A 4XDGA 2O06A 4Q3KA 5KVAA 2C3OA 1F6BA 4BNJA 3IDOA 3AB2B 5CLHA 1TFUA 1J49A 1SM4A 1UADA 1OZ0A 1FX0B 3V8NA 1ZBQA 2BFBA 1JB1A 1SN7A 3TRIA 2GD2A 2YFKA 1VHJA 3ZLTA 4FR5A 2I34A 1HMYA 4JQYA 3KPUA 1XOIA 1V6AA 5DYYA 1IPFA 4Z9BA 1YC2A 2VH7A 3EDRB 4MRAA 1G3OA 4ZYXA 1NMSA 3AYXB 3ICVA 3CZ4A 4WLUA 3HHLD 2RS2A 1UEXC 1T03B 4LYEA 1C81A 1Z7EA 3RJ5A 2G2ZA 2PD1A 1I36A 3BK2A 1HNXF 4MVXA 4EPWA 1ZETA 3AMVA 3OOEA 4KLRA 4N40A 5TPWA 1VL6A 4BAUA 3CR7A 3EC7A 4R81A 1A4IA 3HF5A 5B1IA 5E3JA 3OHPA 2D4HA 3DRXA 3R97A 1YTYA 5G40A 1TI7A 1ML4A 3NCPA 4KKXB 5CPFA 3I0SA 1QC5B 3VR3A 2HF8A 4Z7YA 1AS3A 4JI4J 2AFHB 1C0KA 2X6QA 2WFLA 2GEDA 4PYLA 2YHBA 4KFTA 10MHA 4ZCRA 1HDIA 3OCWA 1NW5A 1NI5A 3T5TA 3CJ0A 1MB2A 3RABA 2IUUA 1A7KA 2HRUA 2OQIA 1RWNB 3E01A 3K16A 4CU2A 4LYGA 3KZNA 1M8JA 2QFJA 4CYUA 3W79A 1CUDA 1W85A 2XVXA 4AKSA 1IAQA 4P7GA 3P7MA 4GGOA 4MAMA 4DDTA 1QQBA 5KUTA 1EVKA 2DR0A 3D4IA 4KC5A 5LU9A 1WHSB 3EASA 1YRLA 4MVJG 4YS6A 1VRUB 2WFMA 3GFHA 1VQ5S 2QSZA 3W2EA 2AEMA 4CO3A 2HCTA 2O5EA 3M8SA 5K3BA 1S9HA 4NXMJ 3DXFA 4QYIA 1VJRA 1L4UA 2RCNA 3B1VA 5HMXA 4LRWA 2A30A 1C9EA 1XEWX 1WSVA 3DPSA 5FBHA 1ZIOA 4EUKA 2OV8A 5GAJA 3T7AA 4K7QA 4JVLA 2P40A 3A9RA 5GM2A 1WSRA 3W7AA 1TX4B 2CDBA 4TMYA 5C8ZA 3S44A 1GPKA 5GAHU 4RNOA 4IGKA 3U9LA 1BA3A 1K44A 1N0UA 4IOMA 3T7IA 3W05A 2YMMA 1HG0A 1XJ0A 3EW7A 2IBSA 2P65A 2B8QA 4GBJA 3OEED 1JRLA 2GS8A 2ILVA 4RM3A 2EV9A 3SSMA 5KFVA 4LT6A 1XR5A 2QRVA 1DFHA 3ROFA 2XGMA 5BN1A 3OFGA 3R41A 2QHXA 5GV8A 4AKTA 2GJSA 3TF5A 4X6YA 4L3OA 1H65A 2WICA 4NEHB 2IHZA 2A5YB 3BEGB 3HVHA 1MR3F 3TAQA 2VKTA 2HQ3A 4JLDA 2WOMB 3DLCA 4KFBA 2Q0HA 1RHMB 2XBLA 2VQFB 1H23A 1N48A 2OLEA 2UYCA 4YB8A 3LFHA 3Q9SA 4LFAF 1W88B 2HC9A 1UEVA 4TTSA 3WMGA 3DMJA 2C7PA 4WD3A 1DCMA 1F8XA 3H11B 3ZK8A 1ZAKA 1D8TA 2DH8A 4OJ1A 3HKEA 2MQ8A 2CPXA 3AVUA 2WUGA 3ZWNA 1X1RA 2C9OA 4UHBA 4DF8A 4DXDA 1EJ0A 1DXOA 4YRSA 2FXIA 1FCAA 2YQ0A 1KA9H 3QU2A 1R8AA 4IFVB 3TG2A 4JLWA 5ETOA 2ZAOA 5K3DA 5KHAA 2V4RA 2CZQA 2VHVA 5E2BA 3B1FA 1V26A 3HHPA 1GKUB 3IOEA 2Q3LA 5FWNA 1C7IA 4IIFA 5K3CA 5L1IA 3QLJA 5AJXA 4UTOA 1EUCA 1TJYA 3AFNA 4DSIA 4IOAQ 4DQXA 3GRAA 3KYCB 2PSSA 2QJFA 1GXLA 2CFTA 1QIFA 3WJ1A 2VXBA 1S8AA 4AAYA 1P0CA 1JWBB 4RYDA 4N0QA 3SIPB 3SC3A 4H7IA 5HS4A 1EGMB 3B6BA 3ENWA 4M89A 2NSBA 2ZFUA 4FM9A 2NMVA 1JLFA 4EF6A 4NLUA 4WPGA 2OXRA 2WDPA 2XI4A 4AJNA 4G36A 4DX6A 2ABYA 1CS0B 2BYTA 3D9QX 4I2PA 1YDHA 4COOA 1M1XB 2CF6A 3PDHA 1QWSA 1XNQF 4RETA 2E4AA 4ER5A 3UCFA 4Y30A 3AM5A 3EA0A 4BJHB 1T24A 2ZOFA 2ONCA 4FMDF 3FPLA 5KJCA 5B58C 4L5CA 1JLRA 2A14A 2BCJQ 1CF2O 3PUXA 4XEUA 1CJTA 1ESMA 2MIIA 4N65A 1KH3A 3AESB 3X1ZA 1HNVB 1A27A 3SYRA 2WV9A 5G0VA 4UTZA 2G63A 4Q3LA 5DV9A 1AFIA 5CNKA 4ERNA 1E59A 1E5VA 4KE7A 3RUCA 1UZAA 2XHZA 5DBOA 3T5BA 1HKHA 3G7UA 5E7QA 2UUCF 2FU5C 5CYOA 3K0KA 4X45A 4URYR 1S4FA 4X1IB 4IRDA 3ZHRA 1UMCA 5BQ3A 2GWRA 2VHTA 1TKRA 4OZ2A 3PW0A 3K2BA 1FUEA 2G5TA 1JI3A 1W75A 2BQ3A 3CEHA 4N8NA 4DCMA 1V37A 3IVXA 4GBED 3NNHA 1BXRA 4O0LA 4G9BA 2N82B 4BFYA 4YPVA 5I51A 4FF2A 1NUPA 3R7WA 2X2PA 4L6IA 1XNHA 4KIUA 1A95A 1JIJA 1PN3A 1QUVA 2A9FA 4X8LA 4RADA 2ODBA 3OZDA 1LLCA 4D82A 1SUQB 3DRYA 1QOPB 1NP7A 3U62A 4OYIA 3SCKE 3MGKA 1HNWF 3D6UA 1Y7PA 1TKDA 1Y0HA 1G0NA 1DY3A 2EVWX 3AD7C 4HJXA 2H1RA 2VJNA 3K6SB 3OL9A 1MXFA 4X64J 1EJ7L 5LZ7A 5T57A 4XB1A 3OOWA 2K2QB 2PYIA 1AF7A 1OBOA 2PX0A 1I2MA 1KR4A 2IE0A 4D4MA 4DV0F 3FBWA 3UHOA 2O52A 1JNXX 1SQ0A 4DU7A 4PHFA 5EERA 4DHVA 1VMDA 3AEKA 3PQ8A 1RHUB 1YSCA 4M9XA 2PRZA 4WLVA 1MABB 3C39A 3HYTA 1Y81A 4K28A 1Q53A 2GHIA 2YJZA 2A7XA 3I73A 1T8UA 5AR1A 3RTBA 4MCAA 4FZVA 4QATA 4F04A 2REBA 1BA2A 2BRUA 3GVHA 2YUTA 5CXSA 4DRYA 3OIFA 3W8DA 5TE9A 3OPYI 4YCMA 3CRW1 1XCLA 3UO8B 1YUBA 4MFBA 3RU9A 4C8YA 2QG9B 3OQJA 2WAAA 3UWPA 2YNHA 4WKRA 3KEFA 2X86A 1NJGA 1BXGB 1ACMB 3R6WA 1FJEB 4M1MA 2YHSA 2FWMX 4XWYA 3QHQA 2MKHA 2G80A 1SQFA 2PV0A 4KWTA 1NAQA 3DLJA 2NCKL 3ZQUA 1UK6A 3JQFC 3COJA 5BRJA 2BDPA 5KSWB 1C7JA 1TKTA 1SG6A 2WHPB 2HEKA 1VCIA 4ZU6X 3GRUA 4LRXA 3VM6A 3OJOA 1O57A 1U80A 4J8PA 5B3AA 4Q2MA 1WKJA 1TUEA 4F06A 1E3LA 4EPRA 2QRKA 5HTOA 2PUHA 1ABFA 2MPUA 2QMEA 4PZUA 2CQBA 3CNQP 1VG9B 2IZ0A 3PD1A 5JY1A 1Y1TA 4KFSA 2AKWB 1TUVA 1ZPVA 4DLAA 5JMNA 4EFKA 2GK7A 3RHTA 2OCPA 4KE9A 1TV6B 1WTCA 5CJJA 1QR6A 5F33A 2BX6A 1DKMA 5TXGA 1TYAE 3MD3A 2RGUA 3S2ZA 1CEXA 1LRLA 1Z5PA 3OF2A 3IALA 3I9V6 2FWBA 5DI9A 2HVIA 5J2MA 2D3OR 3I9MA 4FNAA 1YJNS 3H98A 1V71A 3O82A 2QQFA 3EYZA 4NBNA 3QYFA 5KFPA 1ZKMA 4JI0F 2VZLA 4BVJA 1YIDA 2A5DA 1PR1A 4HDQB 4KN6A 1IM5A 1JFTA 2IY8A 4EGFA 3AQIA 3KYBA 4ZODA 1D4ZA 4PONA 1G17A 3E0QA 4UAUA 3CD7A 2IS6A 3FOEC 3MTQA 2BEFA 1XD2A 3THXA 1PR2A 4Y8VA 1PJBA 3GGJA 1XDGA 2FHKA 2K8GA 4G0WA 3FJOA 3AHEA 4BUJA 4CEJA 3EZNA 4A2PA 5EIEA 1XZLA 2O07A 2VC0A 2VIHA 1ZRNA 3LXRA 3UB4A 3GD7A 3CIMA 3OQBA 4DV6B 1CW2B 3P94A 3RFVA 2YWBA 4MRRA 3PNPA 3W6UA 4BO0A 2ZBEA 4PLWA 2H1HA 3DU6A 2G0JA 3RIHA 3W9JA 4P81A 1QH1A 3S40A 5DM4A 3LCVB 2HT1A 2OMOA 1E79D 3AO0B 3IBTA 1EIWA 4EZEA 5BV2P 4Q3AA 2QN7A 2K1RA 2VLIA 1RXYA 1I3LA 3BDEA 4PBSA 1YB5A 2EJWA 2Y0BA 4YQZA 4GEGA 3ADPA 3IQHX 3A8IA 4YJ3B 2G5PA 4LZAA 4MS4A 3BC1A 2AHOA 4OGGA 1TL7B 1SJRA 4UU8A 1N92A 3NTXA 5AXNA 2R2GA 3VDQA 4PZDA 3D0KA 4Y9RA 2QDXA 3NCRA 3HCAA 1TMMA 2QVGA 2Z0MA 4YMIA 4XVCA 4XCXA 3RIGA 1GAWA 3EGXA 2J5KA 3GIDA 2RHQB 4B46A 3CH7A 2WHYA 2OLJA 1U24A 5JNTA 3VH4A 2VHYA 3TKAA 1NBWB 3A2LA 3RF6A 4V2UA 3HSYA 1PYOB 1O94D 4X62B 2CBZA 2F8TA 1H85A 4KYUA 3T99A 2BKNA 3GC6A 3QYYA 5A5EA 1Q15A 3L0CA 1WC5A 3MRTA 1FNNA 4G26A 4G37A 3IBCA 5D6OA 5FHQA 4LBYA 3FRYA 3OEYA 3PNKA 4F0JA 2VJVA 2OV3A 2FEAA 2HNYA 2WJPA 3DOMB 4ZGWA 2D5AA 1MB0A 2VH1A 1E2IA 3QBTA 2R7TA 2AGVA 4L5JA 4C5CA 2QV0A 1JYEA 4ND8A 1K0TA 2JNJA 3I82A 3R40A 4J9SA 4PHHA 4UHEA 4GPD1 1UBEA 4B4VA 2ZVPX 2ZE7A 1C30B 3PG5A 1AN0A 4NBVA 3FFTA 3EUWA 2HGSA 5AVVA 4NH4A 4O3OA 4Z99A 2G08A 4PEOA 3TX0A 4ZJPA 5K8IA 1MAAA 2QUKA 2DFLA 4Y3CA 2RHCA 1NCLA 3EJWA 3KHKA 4TN2A 4OQEA 3ZOZA 5KNBH 1RCFA 1YK9A 1S4EA 1JFFB 1AK2A 1U1QA 1BN6A 4DKJA 2VF8A 1OI4A 4X4PA 2O1WA 5I7FA 3IV6A 3BWXA 1CF9A 3HU1A 4W1PA 3B1KA 1X8DA 1Q77A 1YR9A 1FFCA 4DCSA 2QM8A 3OCZA 4K6HA 4C7KA 3EEQA 2XGPA 2K4MA 2VDIA 2P1ZA 2C9CA 2CCJA 4IG3B 2R11A 2EX4A 4MRVA 1Z33A 4ZQFA 3UMGA 1E5QA 1VOMA 3BGOP 4ZEXA 3UQYS 3GT7A 1EZZB 4YJDA 3UN3A 2RH8A 2CNOA 2HJRA 4FLEA 2JFUA 5KYTA 3SJUA 4AG6A 4E7OA 5EHGA 4DKXA 4OLBA 1O03A 1SIBE 3VR3D 1XMOF 2G0AA 2WHRA 3D4OA 1UMJA 3WGGA 1VHDA 4XD7D 2Y0BB 1UVNA 5IT9Y 2CJQA 1H2AS 2XEDA 5K99A 1RAHA 3M70A 3RANA 2IZ5A 4BTVA 4ZDJA 4LHZA 3VI3B 1MTOA 1W85B 4H0FA 1RM5A 2ACYA 1W48A 4BQFA 1WF0A 2TRSB 1F5CA 4YNBA 3FGOA 2Q6LA 2H92A 1BOOA