2ZWPA

Crystal structure of ca3 site mutant of pro-s324a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
394
structure length
389
Chain Sequence
b'TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDADAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Requirement of a unique Ca(2+)-binding loop for folding of Tk-subtilisin from a hyperthermophilic archaeon.
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Hydrolase
total genus 118
structure length 389
sequence length 394
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2zwpA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zwpA02
4CFZA 3DE5X 4YN3B 4H6VA 2PMWB 3GT3A 1JEAA 2Z58B 2V8BA 4LVOA 2W2MA 3SICE 5B1EA 1TO1E 3H42A 1OT5A 3WQBA 1HT3A 3F49S 4K8RA 1PEKE 3LPDA 1WMFA 3DVQX 1SUEA 1GA1A 4KB5A 1BH6A 1TECE 2Z30B 4NE9A 4AKTA 4NE7A 3SQOP 1TMGE 1SBIA 3PTLA 4OV6A 1KDVA 1C3LA 3A3NA 2PRKA 1AH2A 1IAVA 3DW3X 1GTL1 1Q5PA 2Z2XA 4I0WB 1SCJB 1V6CA 1BFUA 1GNVA 1TM5E 3UNXA 3TI9A 3A3PA 1TK2A 1PTKA 1VSBA 1P7WA 2SBTA 2ZWPA 1SUBA 3A3OA 4J94A 4C3UA 3DWEX 2W2PA 4Z2AA 3EE6A 2ID8A 3L1KA 3DE3X 3DVSX 3DE2X 4YN3A 5JXJA 5JXHA 1GNSA 3DE7X 1ITPA 3BGOP 5AVKA 1V5IA 5JXGA 1TM3E 2Z2YB 3OSZA 1SUPA 2IXTA 4OMDA 2Z57B 5FBZA 2SNIE 1WMDA 5B1DA 2ST1A 3DE4X 4GI3A 2G4VA 1CSEE 1SPBS 1WMEA 2X8JB 1Y3BE 2QTWB 3LXUX 1SVNA 3CNQS 2Z30A 1P7VA 2WUWE 5K7SA 1SN7A 1KE1A 3AFGA 2XTJP 5CW1A 3P5BP 1S01A 1SCBA 1ZVKA 1SCJA 4NMXB 1MEEA 1THMA 1OYVA 3P5BA 4C3VA 1YU6A 1T1IA 1KDYA 1SIBE 2Z56A 3AJ8A 1TM1E 5JXIA 1SIUA 1Y34E 2WWTA 3EDYA 1Y1KE 3F7OA 2E1PA 2SICE 1Y33E 3DE0X 3GCWP 5ARBA 4CFYA 3WHIA 2TECE 1AK9A 3EIFA 2PWBA 2Z57A 2W2OP 1DUIA 3AJ9A 5ARCA 4ZARA 1XF1A 3SQOA 1Y3FE 4BWGA 2W2QP 2ZWOA 2PKCA 3CO0S 2PQ2A 4KG7A 1WVMA 3DYBA 2QTWA 3I2YX 1KDZA 4DJ5X 1BE6A 1Y4DE 3DW1X 2DP4E 2XRMA 5ARDA 3D43A 4LVNA 1GCIA 5AMXA 1EA7A 3VV2B 3DVRX 1SCAA 2ID4A 5FFNA 1KE2A 2PWAA 2PMWA 3VSBA 5I9SA 2Z58A 3H42B 4ZOQI 1Y3DE 3VTAA 1AQNA 1GA4A 3I34X 4K8RB 1R64A 3ZXYA 1Y9ZA 1SPBP 2SECE 2WUVA 3WIUA 2W2NP 1YJAA 1AV7A 1IC6A 3CNQP 2W2NA 3HJRA 1C9NA 1UBNA 3A3NB 3DE1X 3Q40A 1GTG1 5JMOA 3GCXP 1PJ8A 2XTJA 3TI7A 1SIOA 1Y3CE 2IY9A 2GKOA 1ST2A 1SH7A 2HD4A 5FAXA 1SBCA 3A3OB 1PFGA 1SUCA 1C9MA 3LPCA 1Y4AE 2Z2ZA 3VV3A 1SBNE 1P8JA 1R0RE 2W2MP 2HPZA 3VV2A 2ZRQA 1SUDA 1V5IB 5SICE 3ZXXA 1SCNE 3BX1A 2DQKA 4OMCA 1MPTA 1SUAA 3F7MA 3GCWA 5AVJA 3Q5GA 3I37X 3TECE 2Z2YA 3I30X 3QMPA 2B6NA 4CG0A 1BE8A 1BJRE 3T41A 3CO0P 1AF4A 4HVLA 2W2OA 1ST3A 1EGQA 1NDUA 1T1EA 4FONA 2WV7A 2X8JA 2W2QA 1NLUA 1ZVJA 4H6XA 1Y48E 1SBTA 1S2NA 1SBHA 1A2QA 4M1ZA 4JP8A 4B5LA 3VYVA 4NMXA 4WOCA 2Z56B 4WOBA 2W2PP 1AVTA 1TO2E 1WSDA 1DBIA 4HX2A 3LPAA 2P4EA 1S02A 4DWWA 3QTLA 4MZDA 1NDQA 3BGOS 1TM7E 4H6WA 1T1GA 2DUJA 1GA6A 3DE6X 1YJCA 3PRKE 1GTJ1 4NE9C 3DDZX 4DZTA 4OV6B 4RYDA 1TM4E 3QFHA 1YJBA 3GT4A 1SCDA 3BPSP 4AKSA 1GT91 1R6VA 3VHQA 1SELA 3GCXA 1C9JA 1AU9A 3BPSA 1BFKA 3A3PB 3D9QX 1OYOA 1CNMA 4KPGA 5AQEA 2PYZA 3WIVA 1LW6E
chains in the Genus database with same CATH superfamily
1V8BA 3DCYA 3F0TA 1NUPA 5DX0A 2I7XA 1GFIA 1ZX1A 1YV9A 2DVIA 3PSAA 1LFDB 1RKQA 3HD1A 3QGGA 4JV1A 2GK4A 1K86A 3HCBA 1VXRA 1TTTA 1MQAA 2EK6A 1EGAA 3L0DA 4BX0A 2WB1D 3OVAA 3G1UA 1XTZA 1LI5A 3TRHA 4RHXA 3ZGYA 1QO7A 4D4LA 2XSJA 4MHOA 1Q19A 1DRJA 4PCAA 4KE9A 3QGPA 3JD1A 2XWSA 3QZUA 5JPDA 4KE6A 1P9QC 1AB6A 1E6WA 1CE8A 2Z4RA 2XO6A 5EE1A 3S44A 1C7QA 4MX8A 1JLRA 3RUPA 2PPVA 2VBGA 3D2LA 4L9RA 1UOPA 1V71A 3DEIA 3C3LA 1WDKA 2MDAA 1XELA 3M6WA 1N48A 3JWIA 4NENA 1E3JA 4TQAA 2C31A 3QPUA 1PZHA 2QMZA 5KNCD 4H35A 1JLGB 2CVFA 4XYMA 4WKYA 3A8KA 4DL9A 3JALB 2F00A 4JDUA 2ONZA 4INAA 3D8NA 3O8CA 3AH6A 5I42B 2DJWA 4RW6B 4KP7A 4Y2GA 5DHAA 5LFAA 5EIFA 3CA8A 1M5HA 2FDNA 3QEMB 3DKIA 4OHWA 2QA4G 2HV9A 1WUTA 3FN4A 4C29A 2EWVA 2EDCA 3MGBA 5BR8F 2W00A 3H8SA 1JFSA 2PIAA 4BAZA 5BWNA 4R6XA 2IVYA 2J09A 5JD4A 4NICA 2YOHA 1J8QA 2HWKA 3LRXA 4BBPA 2J46A 1ADJA 2B1IA 7AT1A 2HMAA 1M6HA 4BVBA 5F2NA 1XFAA 2EGGA 2YQ5A 1KZHA 4UC0A 4CFYA 2IK8A 3AL3A 5FBQB 3OM9A 2H1HA 5B2ZA 1HZZA 3I04M 2QW0X 3URMA 1H9BA 3QE9Y 4GXQA 2D1SA 2G17A 3US5A 4BLGA 2FWRA 2FOXA 5FRDA 4BWGA 2EYUA 4WBSA 1IG3A 2ECOA 5JROA 3R9WA 5A1TA 2LXUA 3UH0A 1HQEB 1VHQA 2OD7A 3DDIA 1HURA 1L3KA 1G8KA 5DN9A 2RKIB 2P90A 1PILA 2LU1A 1AW0A 2OHXA 3N76A 2FPOA 2D0OB 3OZ7A 4MKAA 5ITSA 5IFMA 1WDMA 2MYUA 2R7MA 4HKQA 1V8FA 3MYYA 3QLTA 3RS0A 4RLQA 4CMGA 2X5XA 2RHJA 4L4ZA 3PX0A 5HF9A 4K88A 5DM6Q 4CLEA 4B3CA 3PCOB 4X6LA 4LNUB 5EX3A 4F3MA 3N0XA 3UHPA 1E1QD 1GQSA 1IR2A 4WGGA 1Z0ZA 3PS9A 2AOTB 3G2OA 2W2NA 3PV8A 2AW5A 3EUEA 3D6HA 2BTOA 4UQGA 3KRTA 2Q0SA 1KYIA 5B0FA 2R751 3EJWA 1NW6A 2JKZA 4UUXA 3UJBA 1H1TA 2XBPA 1G59A 2OG2A 1TVKB 1T9TA 3U6BA 2V2KA 3Q7PA 1OWOA 4TKZA 3X1ZA 5FAXA 4JI3J 3ZE2B 3SMVA 4Z99A 4DIDA 4BGIA 1EP9A 2GILA 3M8ZA 5CXUA 5H7XA 2PMDA 3ZHSA 3L8HA 1LY1A 4Q37A 1T4MA 4JGIA 1O03A 1ZH0A 2ZKUA 4HVTA 1OFVA 3HJAA 5DJBA 1IPHA 2AVNA 2NO9A 4BWMA 2W7AA 2WT8A 3ZE6A 3EZLA 4YRTA 2W2QA 1R0CB 1SKWA 3DM9B 4BN0A 2JFYA 5KYUB 3UT0A 1GZ3A 2RGDA 4KQGA 1MB4A 1Z5UA 3ZZOA 3L0PA 4ID5A 5A0YB 4GWKA 2AIRA 4NBSA 4GPEA 1A95A 3G17A 2IYSA 2YBVA 2QL6A 3SVLA 1QVZA 5E6SB 3SOPA 4X6YA 4ZVOA 3VGVA 5B36A 1PFWA 4Q4AA 4DQLA 3ENKA 3SV3A 1EVJA 2MKIA 3MMSA 4Q44A 5F8HA 2EBGA 2GEBA 2GPTA 4BWFB 3TX0A 4QR2A 1IBCB 1O94D 3JQCA 3JWGA 2V6BA 1YB7A 4PSKA 2IU0A 4G1BA 1PGOA 4MVJE 3PXGa 1NQ5A 5KTKA 1HG1A 4IXWA 1QRTA 3GFQA 1IYZA 4UMEA 2PZEA 3CZ4A 3VPAA 2WHEA 3JYOA 2N0SA 2WF9A 3FCHA 4A1OA 1JSCA 3ZKWA 5DNEA 4O4IA 5ILQA 2WF6A 4LF2A 3DV2A 1SMKA 5T3UA 3QKSB 5EVJA 4OZ5A 4QU7A 1V2GA 5ECGC 1U81A 1KVUA 5EG5A 4EO9A 5KNDD 5I7HA 4A8HA 5DXAA 3KFXA 2BUNA 2JFFA 4QLAA 3IBFA 1B6GA 2VDOB 2F90A 2QE7A 1OYWA 1V41E 3EFBA 1ZI9A 2UUBJ 4DWJA 5JAUA 5C7IO 1XQVA 3AJDA 3I64A 1RLJA 5C34B 2VJLA 1AF7A 2XWQA 3T7IA 4X64F 1NJ2A 2GN1A 1HA3A 3BO4A 1MENA 2QVLA 3VTFA 3PCTA 3BR9A 1FBNA 3D2BA 1WHWA 1ADYA 2YWHA 1U1DA 4ALKA 2JCBA 3TTWA 3ZVMA 4ZVQA 5K0TA 1ZRNA 4E51A 1FE4A 1NPRA 3JAMU 3H7HB 1SVSA 1FRZA 2YCLA 2QL9B 4Q7AA 1DRKA 5BURA 2D2IA 5L8RC 3Q22A 1KAOA 2UUOA 1ZA2B 4N6OA 3NAMA 1E6EA 4Q4DA 5D1HA 3V4OA 4JLBA 4ZVSA 3CH7A 4JI8J 1Z2DA 2E1RA 3TQHA 2YY6A 1UPMB 2OPQA 1P7ZA 3H1TA 4MKGA 3ZNPA 3RHSA 3RVKA 5JIBA 4B7UA 4JQYA 1FJGF 1M5SA 2B0GA 3M9OB 4RH0A 3UYKA 5CDYA 4E13A 2E7WA 2QY6A 2EFHB 2FKNA 5K0EA 1WCIB 1J0AA 3WWDA 1AM4D 5TY0A 3A13A 3N3BC 1W5FA 3WGJA 2JEYA 4OYLA 1KI6A 4Q4HB 2E44A 3CX4A 1IBMJ 3GJSA 4KXUA 3PL1A 3ZHZA 3F1KA 2GPAA 2KI5A 4I14A 4J76A 4PO1A 1NJWA 5K3AA 4X85A 3NOGA 3B7WA 4KIAA 2ASEA 2JI8A 3Q9SA 3O5AA 2CXQA 1X3SA 4F5DA 2F67A 3T9DA 4IR9A 1SAYA 2DFNA 2FZGA 5FNVF 1WZEA 4G8JA 4K4TA 3LY5A 2O5CA 3NU1A 1NBHA 1S8FA 2CNLA 4G0PA 1HUQA 4Q7EA 2HNAA 2BFBB 2PRZA 5KFVA 3COZA 5CB4F 4U1RA 3TUPA 4USHA 1AQNA 4OYWA 3EXHB 4L9SA 2VWQA 4K2JA 1UFVA 2REOA 3U0VA 1QG4A 1YB4A 2QX6A 4Y6RA 4ZEVA 4EY5A 2P6NA 2BHNA 5CMLA 1ZW6A 1ZJYA 2GB4A 3D8BA 1AXGA 1PO6A 1YBFA 5HMMA 3K9NA 5TPWB 5CLIA 2RKOA 5EESA 3HN7A 1SC4A 3VPGA 1KP3A 2QG9B 3A04A 1XJ0A 4CKYA 1M34E 3TR6A 4N5NA 4D4GA 4AF8A 5IC4A 4EKNB 4OF4A 4CMIB 4RGVA 3VJLA 4X1KB 3NBPB 2WKWA 1M5UA 2QL5A 4X3CA 4RZRA 2VFRA 4OFWA 3WMRA 1EWKA 4HK4A 4LC1A 2PKQO 1B41A 4DDUA 4ED5A 1HF3A 3GZNB 2DLDA 4Y6SA 5LJLA 1QSSA 1MIOB 2UZ1A 3ZWAA 2ODPA 1E6VA 1T2UA 1PJ7A 4H3KB 1I6WA 3T5LA 3R6DA 4Q48A 3E27A 5J2TF 3RFVA 4HACB 4XWGA 1YULA 3UN5A 5GGYA 3W5IA 1Y8RB 5AYVA 1LWOA 3G79A 2DKOB 1GGVA 4OI4A 3K4PA 3E3MA 1EAYA 3H1BA 2EBFX 1XTRA 2GBLA 4TL9A 4MO9A 2B4UA 4DREA 1BQ4A 2G40A 3I4CA 1TEVA 2GO7A 3QTLA 1M5OC 2PJUA 1G6HA 2C4KA 5I3QA 4KPEC 2A59A 5IV3A 2V4MA 1CERA 4Q21A 4RK4A 2BJEA 1MDBA 1NN1A 4TKUB 3PIRA 4F71A 4HATA 4KLNA 5JH7A 2GGPA 1SU7A 2H1WA 1CLFA 4R1UA 3S0JA 4CV3A 3N1UA 1Z13A 1E2EA 3FCEA 3FFWA 2ZPUA 4DDWA 2ZBPA 1H2EA 1G16A 2NTEA 5D1NA 2ZYDA 4IJVA 1C9DB 1M2VA 4A8KA 1IHXA 3A6HA 1SGWA 4C9BA 1JR3D 4UMVA 1RTHA 2WY2D 3VPHA 3GFTA 1JDBB 4ZAWA 5EE9A 2WIFA 3BSCA 5EGNA 2M6KA 2REQB 2XQFA 2XGMA 2ZH2A 2ZWVA 4ZQFA 5DNAA 1BHQ1 3VR3A 1I4EB 4CU5A 4FNHA 2VPXB 3DMFA 1A3CA 1L8QA 2J9RA 4U8YA 1XD2A 4BLQA 4HDMA 3VOAA 1JVBA 3H98A 1V1RB 2H2WA 2VA8A 3TFQA 2BF4A 2GJ4A 3I0RB 2PZGA 1JHPA 4R2KA 3I5YA 3ZWNA 2A5JA 4FN5A 1MMLA 2VICA 1N88A 3QEJA 4F9GA 2P75A 4RANA 1DRUA 2C2MB 2ZBDA 2IYAA 2NZUG 3HR7A 3K9FC 2P2CB 2GHTA 3W2VA 5PNTA 4KH0A 2OHJA 3PWZA 1R16A 4PLWA 3EEIA 3MGCA 4NMLA 1ITPA 1K8QA 5A8KA 1UDBA 2WU8A 3OFJA 3KE9A 4R31A 2H06A 2P3QA 4RM2A 4BJ3A 2BR3A 3D4OA 1Z26A 4W9NA 4DUGA 2HVHA 3EPRA 5A9SA 1PJCA 1VGQA 2HHVA 3ON5A 5D3KA 4LSNB 5JMWA 1KA9H 3LNCA 2C42A 3AOAA 2ZE2B 5D4OA 1JLQB 2DE0X 3IJRA 2C4VA 3K09C 4FMDB 5CW1A 3AI3A 3FBCA 4ARZB 5BV0A 4IFIA 4ALZA 1SXIA 2QP9X 3CD5A 2YHIA 1DAIA 6NULA 2UXDF 2FG5A 1SXJD 3KQTA 2KM8C 1BC6A 1T1JA 1YZ3A 4TQUS 2RC6A 2JCSA 3ME5A 2YDXA 3OSNA 1XKLA 5L3QA 2B37A 5AVWA 1YQWA 1ZA1A 3NNSA 4DAEA 4H3SA 4U3JB 1N9GA 1G4UR 3MHYA 5GV8A 1CIPA 3BXXA 3BG5A 1YR9A 3G5TA 3L93A 5AJVB 3P19A 3RFCA 4G0ZA 3W60A 4ZV7A 2H48A 2LR0A 4B6FA 3NWJA 5A3VA 2O2XA 3AU9A 3B3FA 3BMQB 4NXMJ 1FFAA 3R1LA 2NU7B 5DBHX 3JQAA 3B7PA 2A6PA 3A06A 4F04A 1PW7A 1T4CA 4NXNF 4KW7A 1SCUA 4JYPA 3D3QA 4YP1A 4C2MA 3W2TA 4LE2A 5CT9A 1VMKA 1IY8A 3PKZA 1JFTA 3B9RA 1NJ5A 4RR5A 1HHSA 1GL7A 1KEZA 2PSFA 4TS4A 2ECPA 5DDPC 3SQDA 3NL0A 3A36A 5CVTA 3H0EA 5JBQA 1LXJA 4D45A 2YJ3A 1N5IA 2W6QA 5L7YA 5IM0B 5JZOA 3A4VA 1HLWA 2HK9A 4LGMA 4JL5A 1RWOB 1FFXA 3SE0A 3PRVA 2YXBA 4FYDA 4PYLA 1BDBA 4MPRA 2B8JA 1PK7A 1FW6A 1UMBA 2RHRA 1UM8A 3LP2A 4PINA 1G6OA 1EZZA 1GAOA 3HFSA 4B3TF 4NYZA 3FCCA 1NXSA 1SUDA 1RWWB 1DKQA 1KMNA 3ZE7A 1CUEA 4KO2S 1R4MA 1KJYA 3MM6B 2I2DA 3NXSA 4BGUA 1SUAA 2HT6A 1O0CA 3I37X 3C16B 2YICA 1HI0P 1MOSA 2X9LA 3KLIB 1E3MA 4IF6A 4R54A 3B7GA 5ECDA 3D7KA 1S9EA 4JP1A 5FR1A 3BEOA 4BRUA 3R5GA 2QE7D 5JJBA 2XY4A 5KVVA 4H4CA 5CJPA 4AROA 4R5MA 2WVEA 1GRQA 2GASA 4TTRA 2JGKA 4G1VA 3JAWA 2RJ3A 4DV0J 4Y7CA 4IJKA 3QV2A 3FYUC 4G1QA 2W11A 2W2TA 4WX2B 5IAOA 3K96A 1P6XA 5AI9A 3UB3A 4B85A 3TDKA 2CSXA 1GRRA 4UPDA 5AXDA 5KFRA 2M5YA 3QRQA 3ZDAA 5CXTA 4CQJA 5CXSA 3TZHA 3CF5Q 1PJ4A 2G71A 1GMWA 1HDOA 1G5IA 2O48X 5JC8A 1AXEA 4AMGA 3AXKA 3SYTA 3OOJA 1JKIA 2H54B 4PS0A 4BBZA 3BZWA 2F1FA 5HUJA 4NVRA 4UNNA 1HEYA 2FDCA 3I0NA 3VOTA 1SJ9A 1X13A 2GWHA 1OASA 2H1VA 2FV8A 1UODA 5LQAA 1OIVA 1N77A 2CDBA 1ONNA 3MUOA 2IBKA 1XG5A 2PYZA 3I5CA 5AK0A 5JRZA 3B8HA 3EZ2A 3VU0A 3U9SA 2W6IA 3SYRA 3W5DA 1RWNB 1M8KA 1NSPA 1RU1A 4CLDA 1Z4JA 3VMFA 2EFEB 4RNDB 1RJEA 1E3SA 4ZVTB 1L5FA 3D6VA 2QFIA 1RADB 1JMTA 1YSCA 3PACA 1COZA 1K5GA 1RC1A 2E29A 1NMZA 5EJFA 2E37A 2IX3A 5L6LB 2NVBA 2PBFA 2ZS9A 4ANCA 4XJXA 1GA1A 3RUDA 3N53A 3RHTA 3D3EA 4C7JA 2DXFA 2O7NA 3L7MA 4EEYA 3W5SA 2FZEA 2FPMA 1B7GO 2G09A 2XECA 3L7YA 1KDVA 2ZYAA 1W34A 2AV5A 2LV8A 4BL5A 4YJFA 2ZITA 2BC9A 5IJ9B 4QBFA 2EPIA 1RC0A 2AC4A 1HYGA 2GLXA 1U7UA 4GPBA 1JG2A 1YIDA 3NGLA 4BMDA 1J09A 4HAYA 5AW4A 1K0VA 2HQFA 1X38A 2WFLA 3KKFA 1CEQA 5A2QA 5DLQC 1JIVA 2XYVA 1VJWA 2B5JA 1F2GA 1NMQA 4M55A 4A0HA 2VONA 4PBRA 2I7VA 2GETA 4G2NA 4Q4LA 1QQ6A 1AG9A 4BNZA 2G88A 4UU1A 4QOEA 2P30A 2OCYC 2RCYA 4A0QA 2Z30A 4Q3AA 4J2TA 1RR6A 3QPIA 2PGJA 1PJQA 3TAHA 3ICCA 2CXEA 5EPUA 5BWCA 4WYLA 1FSPA 2YQ1A 2W43A 1HFKA 3DRPB 2OO5A 4QTUB 4ZPXA 1MU2B 3LF2A 4JSYA 4RVDA 1ONSA 5DDRC 4BTEA 3A31A 1ZN8A 4EW1A 1LWFA 3B48A 1N2XA 1TZ2A 4EY4A 3HO6A 3C6UA 2HBQA 1VZ2A 4UEWA 2ZBFA 1RT1B 4KH1A 5SYNA 3SC4A 1NU8A 3OH8A 1NBOA 3OFNA 3WBZA 2NS1B 2DUWA 4O4GA 5F8IA 3K57A 1M1XB 5DP1A 2RCNA 3RU9A 3CMAS 4LF7J 1NHVA 1QG6A 3GLJA 2HBZB 3EFEA 2JKYA 3LJKA 2QMXA 3IR7B 5ICSA 2E5LB 4LRCA 2YUTA 1HBUB 1XCMA 2VDQB 5K6AC 4C2AA 1S7GA 2R68A 2ZWAA 4AZ0A 4H4OB 3AR9A 2VYFA 1KH3A 4RSRA 2CKWA 4G89A 1P2FA 2HLDA 5A7HA 1XNJA 4F36A 3WXBA 1YZLA 2J5QA 3VZIA 1HNVA 4LJAA 1UJ5A 4J16A 5BUCA 4N5LA 2I7CA 4PVCA 3TP2A 4V1CI 4QDKA 1RCFA 4DMHA 2OCDA 4PABA 2DUNA 3DRXA 1QQTA 4RMHA 3KYBA 2I7DA 1H6AA 3OA2A 3WK5A 4YH1A 4TXSA 5I9NA 1WWHA 4ITRC 1X7HA 4MINA 3NOCA 3B85A 1X7WB 1JG6A 1PJAA 3ILYA 1X7ZA 4P7TA 2WSFC 2XCIA 3FKSA 4IHQA 1VRUB 5FORA 1HNZF 4NYIR 4QM7A 3S40A 3GJQB 4OFXA 3IG1A 1VBNA 1W8DA 1FW8A 1F2UA 1L4HA 4JD5A 4ZO4A 2XQCA 3RBEA 4WEQA 5DI3B 3G82A 3DUWA 2POQX 5DX1A 4AZ3B 4HOYA 3EVDA 4DV3B 3T0IA 4K3UA 1YDFA 4DEYA 1QG2A 2JZOA 4LY6A 5I8WA 4G0NA 5KAPA 3TE7A 4HVLA 2OM6A 3H7IA 3H8WA 2G1HA 2R7XA 4R0JA 1G9SA 5F8LA 3DWFA 3GRYA 3QGMA 3TAMA 2CJXB 5EN4A 4TXLA 1YKFA 2FJPA 4YPFA 1SI9A 5E7QA 3AP1A 1JH9A 1JEJA 1E3DA 5LXTA 3GLIB 1I33A 1MNEA 3BBBA 2O20A 1I1NA 4HEA9 1DUVG 3V4FA 3NATA 2DU8A 2QAGB 4GPAA 1MAUA 4R2WA 3A1YG 1A5ZA 5ILGA 1JIHA 3T0FA 4IH9A 2ZQ5A 3AHHA 3ZIAA 1MRZA 1VQ7S 4AO8A 3TD6A 1WCYA 4Y2HA 4ME6A 2NUTB 3QKWA 4KTTE 5EYPA 4RVOA 1O9GA 4QYIB 4KXLA 5DLYA 3M2RA 2R6HA 3ZW9A 2O7QA 4DUGD 1AGYA 3MR7A 2QR2A 3IP1A 2RB7A 1A04A 2FPLA 4CIDA 4DR3J 2RDIA 3AFNA 1KJ9A 5A7FA 3U7QA 4NABA 1GT6A 2C04A 3VZCA 2F64A 2JS7A 2OGTA 4WT7A 4OFBA 2YKGA 3AR6A 2HPUA 2J5RA 4UJ5A 2GN0A 2WSLA 2A1BA 1RTDB 1O94C 2B61A 3QLHA 3E7PA 1V45E 1A5AB 3ZCSA 3MUNA 3CUEF 4ZQHA 4QUHA 5CCDA 1V48A 4KLCA 1V11A 3SV4A 5DU2A 1UDWA 2YYZA 1NUSA 3WGMA 1GXSA 2UVQA 5JQGB 2O8FB 1VJDA 2HHHB 3JZIA 3VX4A 1IEXA 2BDPA 2R2UA 2GUGA 5GOTA 4AS1A 2VV5A 4Q9JA 1HEIA 1QKIA 2W70A 4NL5A 3OICA 3JYQA 2CJ9A 2PH3A 3KYDA 4FCTA 3H2SA 3O2IA 1ZP6A 3O03A 2Z83A 2ID8A 4LBZA 2OFXA 2PI4A 3A6JA 4YR0A 1HWJA 2LEAA 3E18A 3TVZA 1QHEA 1MAVA 3LF0A 3SHVA 4DSIA 3T1YJ 1R8PA 3MCNA 3DDCA 3GBVA 2OV6A 5JCPA 4JH0A 2YJ4A 4U7JA 1F4PA 2RC5A 6AT1A 2NU8B 3AIMA 3FMWA 1OFTA 1YTYA 3OJLA 4AJOA 3BAFA 1Z6GA 1NJYA 4XD2A 4U0JA 2ZIFA 3E9EA 3K58A 2J76E 1BGVA 1KO1A 4L3NA 3ASYA 3TLJA 4EQZA 2OZLB 5AT1A 3NG8A 3FPCA 2X1FA 2R8PA 4B31A 3HFVA 5GVSA 3GLUA 4YAJA 4KAJA 3GRKA 1JU9A 4I9HA 1HH4A 3WA7A 1PO7A 4LF9F 3SEOA 1XGKA 4HS4A 4JENA 3HXLA 1Y0HA 1A27A 1ZJJA 4I1PA 3TZWA 5AJ3J 3O8QA 2D5AA 3SBMA 2IP1A 1DO8A 2DPXA 2B8PA 2LEPA 2RAPA 2I6WA 3JWHA 2W25A 1RJ9B 4ZAGA 1KARA 3OIGA 1Q7CA 4G5QA 3G5LA 2WJVA 5AXMA 4MT1A 3BGVA 5L51A 4RJJA 1CTQA 1VL5A 5FUXA 5LU9A 1XDSA 2BEWB 4X65B 2V0CA 1ZBTA 3G88A 3LGSA 4NX2A 1ZD2P 3T1AA 3TW0A 4CGYA 1RWPB 3RNLA 1LWCA 8ATCA 5ICCA 3BKWA 3LSYA 1FFHA 3T7AA 1K47A 1TAHA 3SQNA 3F6EX 1NONA 4C08A 3GJ6A 3PUWA 3M82A 1GMWD 2QVGA 4LOHA 3VA7A 3WZMA 2ZBCA 5I7SA 2A1UB 1E9DA 4IX1A 2LD4A 3N39C 3GTYX 4EL0A 1EFPB 1E3EA 1I51A 3LP8A 2GEUA 3ZCVA 5AVVA 2GUWA 4FD2A 3LTNC 1H0RA 4N8DA 2QSFA 3HXMA 2IUEA 1JIIA 2I8CA 4KNYA 4A0GA 1EFRA 2D00A 3C6QA 4EBBA 4KXXA 1KI2A 3BTSA 1PNQA 3WIEA 2WOOA 1PQ4A 2AH5A 1R9MA 4C0HA 2JGAA 4NMHA 2D7SA 3NS7A 3EHEA 1UPBA 4XXHA 2Y1GA 3WBBA 2RK6A 2ZT7A 1JXAA 3CPHA 3BV8A 1M2EA 4GKAA 4GOXA 1OUMA 1Y8AA 4MDYA 1C0LA 4Z0PA 3QMPA 3D4PA 4LF5B 1WVGA 4Q1DA 5CAAA 1FP4A 2RVJA 3AVQA 4MHTA 2XB2A 2G1DA 1KONA 3UXMA 1ZIDA 1G7TA 2H07A 1XD9A 1HSZA 4KSCA 3PU6A 4TU9A 4E21A 3AVWA 4USWA 1VRTB 4C3OB 4CTKA 4EPRA 2DHHA 1W5SA 2ERXA 2PBRA 4XUEA 4WY2A 3CNLA 2Z09A 4ZOEA 2F9FA 1PIWA 3KJNA 2CYBA 2PYIA 4O2BB 2WRZA 1RXIA 2R4QA 5TS3A 3SHQA 5CVJA 3HTXA 4JBYA 5E7JA 3C43A 1J39A 1S10A 3VNAA 2Y8YA 2XXAB 2JK0A 1TYDE 5ED0A 3FPEA 3ISND 4Y1FA 3KEMA 2LCFA 3F74A 3M2UA 1LFWA 2RG7A 1ZTWA 4U00A 1ESZA 2OIHA 2QRHA 1QF6A 2WI8A 3DKKA 4OIMA 5HKOA 2J0WA 2ZT8A 4TWIA 2CDNA 2GBFA 4WFNQ 2RDJA 3D67A 3NLLA 5KFUA 4DR6F 1RT9A 4ZK7M 3J7YI 2OBLA 3SJUA 4NWIA 5A3SA 1L5OA 4B4OA 1U09A 1N1DA 1PUJA 1R0YA 5BXIA 2R6AA 4MVJM 3KT8A 3BQNB 4UUOA 5TMBA 4I1IA 3BRSA 2ZULA 5EPEA 5B1EA 1QNFA 4EQ6A 4US0R 1AQYA 4LBVA 4GBMA 3OJWA 4UFNA 4ECZA 1X7VA 2FEWB 3W34A 4B3HA 3TZQA 1CJVA 1UBRS 1ZAWA 1YONA 2HQ1A 2XCTB 4Q0BB 2ZH7A 2H85A 2X0DA 2OZEA 4FGUA 5LM3A 1QZXA 4UNIA 2O8CB 1GGJA 2RQMA 5DT2A 5ALFA 3GEIA 3MTAA 3GQBA 4GRIA 4IQ0A 1QYCA 3DMJB 2VH5R 3U27A 5DNDA 1SHKA 5KNCA 2H31A 3ABSB 2KHCA 2VBXA 3QNUA 4KIJA 1E62A 1TLLA 5AW9A 2J6IA 2ZD1B 1TAQA 2D54A 5FO1A 5IW8A 3R5CA 4G1PA 4YY3J 3RTBA 2AT1B 3FSYA 1HZZC 2IEGA 4D74A 3G23A 4B3RB 2HLDD 4ERXA 4UAJA 1X1QA 4Y9DA 1IU9A 4OU5A 5BN5B 3WLLA 3DOIA 2FTRA 3L1IA 4OD0A 2Z6AA 4UU0A 3O38A 1VYTA 4DUYF 2AWNA 3PHIA 4PRYA 3H5RA 3QMMA 3TO8A 3KAPA 1SCBA 5DTMA 3KK0A 4XM2A 5JD6A 4KVAA 1UC9A 1BVYF 3R4VA 1SBQA 1Q3KA 1X1EA 1AN9A 5IUKC 2V7XA 3OBBA 3EWIA 1FVXA 3SDEB 2QRUA 4ASUA 1W19A 3LLSA 3PXEA 3Q9NA 2O7RA 2FDRA 2O2DA 3NZEA 4DR1J 4ECWA 5BYKA 4MR9A 1MDFA 4G5RA 2QLBA 3LUYA 2ZS8A 4JI5J 4FFSA 4QNRA 4FF4A 4WLNA 4RUKA 4REQA 1QF9A 2HNBA 3A11A 2WK1A 5FUVA 2PG3A 4WZMA 5I01A 1C3JA 4IIYA 2IXFA 5HF6A 3G9XA 4KGKA 4CT8A 3B54A 1U28A 3I8XA 4FEAA 4FCCA 1OZHA 1SKAA 3HR8A 1OJ4A 2HSZA 4BX2A 5DB4A 4IP0A 1OFHA 4LK3A 3TFWA 2DO0A 1RLCL 2QQFA 2GT1A 3ACDA 8AT1A 2YKMA 5FJJA 3OP1A 4DFPA 1IOWA 2VBCA 1SJQA 4ITSA 3D0QA 2WINI 4N0DA 3ASUA 4IWNA 2I8AA 3ZIAD 2ZJ3A 1KJNA 3R7SA 4KO8A 1BA2A 3BR8A 1POXA 4EBDA 5AVUA 3BEGB 5KUTA 5EINA 4A4JA 1E2DA 3GIDA 5EN1A 4MYSA 3AL2A 3H4IA 4H31A 4UM8B 5LDDC 5EHNA 5D0EA 1P1FA 4UQOA 2X14A 1GPAA 3Q8WA 3ISZA 1R31A 4G07A 1ZS6A 2I4MA 2F3JA 2R2SA 3KT0A 1XXHE 2WPDD 2HJGA 2IXGA 3R6GB 2VJYA 5EWEA 3NP9A 3GI1A 4OX9J 2P40A 1C4WA 2ZW9A 2OBMA 1HWLA 2ZIEA 3CRNA 5AM2A 1YFJA 3L1HA 5SICE 1A9QA 4U2DA 2UZ4A 2QL7B 2P8SA 5B1HA 2HVZA 1HC7A 2EFCB 5H81A 4TV9F 4CMBA 2H1FA 1SL0A 5AVQA 4KLAA 1N1GA 3TXXA 4MIBA 1IWPB 1GGHA 4QNMA 4ZVUA 3WP1B 5LYJF 1YTLA 2X8JA 2Q50A 3MWGA 4IEIA 4QYMA 1TAGA 2WKQA 2M7SA 4DS3A 2ENWA 3EIQA 2XD9A 4NV3A 5AE1A 5I7EA 3EEOA 5E2AA 1ZNWA 2VQEB 4IZIA 4LBPA 4WKBA 1QDLB 4UM9D 1X92A 3I6PA 4FYIA 4JLVA 1JE1A 3RJ5A 2M9KA 3PCRB 3C8HA 1AVTA 2C07A 4DZZA 3B1FA 2V58A 2QVYX 4KPYA 4Q39A 1USVA 1LA2A 4M1YA 4MVYA 2WPNA 2ZRHA 4XASA 3VCDA 2FVCA 4LMPA 4ZAYA 4KPUA 4I4TF 2PL1A 4RQUA 4OV6B 4WCDA 5KMGB 4GVLA 4DSUA 4NI2B 3UT6A 3WK8A 2P62A 5KG6A 1Q8BA 1S9GA 4B74A 4KXYA 4J9SA 3BF4A 4LF6F 2J31A 1MMNA 1WNTA 5CHYA 4X94A 4CKZA 1NU6A 4E11A 1NUTA 5DOVA 3WDSA 1YR7A 3AOCA 4J9VA 1MQ9A 3GPLA 1SK8A 2XDWA 4RJVA 4OQJA 4Q3OA 2W2MA 5KNDA 2VEDA 3BD8A 4BVHA 3QBVA 3VR2A 4Y3CA 2ZKTA 1UA1A 4JITA 3RSHA 4RGBA 1BN6A 4FR2A 1XPOA 2KT5A 1TECE 4JI7F 2IHYA 3T3NA 3BE5A 4FFDA 3OEWA 1NSAA 1GL9B 1FLVA 2LWIA 3T52A 4ZPWR 1G7RA 3A3NA 2BN4A 3BN7A 3GLRA 1XA4A 1X31C 3M05A 3F7TA 2GGSA 3MG9A 1URRA 2OMEA 4XD7A 3U3OA 4TLRA 3P4XA 4NLTA 3DTVB 2W8BB 1J2YA 2E9TA 4F6RA 3MINA 2CL5A 2KYRA 4RBNA 1UAGA 4GKKB 2R8HA 3P2IA 3KP1A 4ND2A 4BE4A 3PKIA 1Q1QA 2C97A 3AD7C 3KQPA 1FB5A 5GAJA 1BDMA 1V9OA 2JLYA 1H72C 1U0OC 3MTDA 5JPCA 4JYCA 2I78A 2I33A 3CO5A 2Y67A 5HRCA 4ECTA 1ZIYA 2XR1A 1QLNA 1AUXA 3TOCA 3Q8PB 5DG8A 3Q88A 5ILOA 2PUFA 4HN2A 3CNQS 4ND6A 3QLUA 4HO1X 2UUAB 4QDJA 2Q4EA 1JJCB 2L2QA 4ES2A 4OZ1A 2HNDA 2QI9C 1GKUB 1RHJB 3CX8A 5DTIA 5CA1B 4BNDB 1Y89A 3UHJA 5B3LA 3U44A 1O8CA 1U0JA 3RVBA 3KQNA 2ZYWX 1J00A 1MRSA 4C01A 5KPJA 1MCZA 2ROQA 4QHYA 2F9LA 1I0IA 2QK4A 1L2TA 3R9KA 4FYXB 4GKVA 4OJTA 2VP0A 5F76A 2H1OA 2PDAA 2C8VA 2N82B 5E0OA 2Z57A 1KAEA 3HP1A 3NC0C 1KEVA 4ISBA 3L0BA 2JAUA 1JQJC 3HL4A 1GNQA 3P9NA 1H98A 5A6WA 4NYPA 3QUSA 5B7QA 4IDBA 2DITA 2VVTA 3IX7A 2IIHA 4WFBQ 3PG9A 4OYOA 1RTJA 4BEBA 3V1NA 3O8LA 2FMHA 5E9WA 1XMOF 3PK0A 2QTVA 3GIJA 3GUYA 4B9SA 4EGSA 4A8TA 5AKIA 4BX9A 3EHDA 2I29A 3L7PA 4USJC 2HNKA 4B43A 4R0NA 5HROB 3VM6A 1NBME 4M0LA 1N36B 4MCJA 1YKWA 3FOAA 4ERNA 1ZO8A 4JLOA 2NNLD 3S55A 5IYZA 1WQ1R 5TEWA 2Y05A 2FQQA 4PGHA 3U09A 3MFQA 3ND8A 5H3LA 2J5AA 3U1VA 5UKDA 2JRCA 1DXOA 3M5PA 5ETNA 5ESDA 3FDFA 1SZPA 1YS7A 2V2ZA 2VLIA 4JU8A 2Y0BB 3IAS9 1EKXA 3E70C 1OIXA 1UEJA 1F8GA 1R0ZA 4C1NA 2BE9A 1EAYC 1PUIA 4QR0A 2GBLC 4NPOA 1H23A 2NADA 4MV7A 2D41A 3S2YA 1ZJ5A 1YOVB 1WEKA 2IV7A 2FU5C 4RTLA 4RVGA 4P3XA 1NRWA 2NXEA 5FH9A 4CG0A 2A9OA 2IH4A 4RJLA 1XZBA 3WC4A 4EZBA 3D5MA 3T41A 5D6GA 1EVQA 5ETQA 3C8MA 2AFIA 4J29A 1EGQA 5CCBA 2G36A 2OBNA 4KYVA 1CULA 3LDHA 1TMOA 4V2IA 4URXR 3LLUA 3LPNA 3WP0A 3S70A 3PXBA 3OW2R 5FR2A 5A2QY 4ALIA 1YZYA 3MF4A 3T5TA 1V3SA 3X44A 1SQFA 1KLNA 1QC5B 1FF2A 2V2QA 2BMDA 1VRWA 1YCGA 1ENOA 3M32B 3IN5A 4EZ6A 2HMTA 2WVHA 4I5EA 3BDAA 5K3BA 1M6YA 5EMLA 3OZBA 4HDCA 5TXGA 3GIWA 4PPDA 1M5TA 3HLKA 5E2IA 2P3SA 3UFCX 4DV2J 2DGXA 3SF0A 2FSFA 3KZKA 4FR0A 5CBPA 5JSUA 1HM5A 3THRA 3DWGA 5AP9A 4WERA 5CQGA 1X8KA 4HWOA 4FNIA 3EY4A 4U6QA 3FFIB 1NA5A 4N4AA 2XULA 4LF1A 4BP3A 4FOSA 3NNAA 1DQNA 1L7AA 3NCTA 3OU7A 1JR3A 4OHBA 4R2LA 2VG6B 1SC9A 2CQHA 4TMWA 3PYMA 1P9NA 4QVIA 4INOA 4V0KA 1UEUA 1ESCA 4FIDA 4M0FA 5HQ3B 3IHLA 5E5NA 4P92A 1Q6YA 2PV0A 1HT3A 2O8BB 2E2WA 3KNGA 1ZH5A 1ZLXA 3DZCA 4W9NC 4Z0NA 1URNA 1JLFB 4PX5A 4ASUD 3DBHA 4Y30A 1X1DA 3OLAA 1X9GA 2IYLD 4G4JA 1LDBA 3H9EO 1NP3A 2KKHA 3TLGB 4YMUA 4TVKA 2RB4A 1SBIA 1X4EA 3D31A 3FCOA 3G49A 4H7EA 4BC7A 4DMKA 3PNPA 1OS5A 1TTQB 2XUZA 1P9LA 4JV5F 2BWJA 4M5DB 3BIOA 4OP2A 2OVBA 5FL3A 4R8KA 5B1YA 2XYPB 2G67A 3VAYA 2QD5A 2ATCA 3I0SA 3Q5DA 2J3QA 4IIUA 3TLMA 1C7FA 3JRNA 1NZJA 2YZGA 3KXLA 3HY6A 5IAKA 1WBDA 5J4LA 3AQ4A 1XMQB 1CDEA 4URSA 3A4NA 1S1XB 3T4UA 1DKNA 1EVEA 2GCIA 3TJZA 1VCIA 3F47A 4HTIA 3ZHOA 1NURA 1H1LA 3HDTA 3ORSA 4BWVA 5JDIA 1IBKJ 1SXJA 3JYTA 3MMCB 4F0JA 4RA9A 2PKQP 3QT7A 4RBUA 1KDYA 1K1SA 5CEJA 4C5BA 4Y2XA 2C82A 1ZOIA 1H93A 1IQPA 2I7TA 2BKXA 1KVQA 2OHVA 5AICA 2MTLA 5LNK1 2ZH9A 4DLBA 4OH7A 3RRNA 3CJ5A 3RVNA 2GXQA 4P73A 3R44A 4MQ6A 5JC1A 3G6VA 4WW0A 2ZRLA 2KTQA 1B4SA 1FKOB 3PNSA 1HTBA 3M4YA 1T9HA 4MLCA 1LVGA 2IUYA 4KAAA 1BLUA 5L45A 3BH6A 1W1UA 2QN7A 4K4UA 2XNHA 2AG5A 2RGYA 4CMHA 3K53A 3WYCA 2OG1A 2G8LA 1C9YA 3FBGA 5GWXA 1V5VA 1NK7A 5E1BA 2E1MC 4IH5A 1TYCA 2G9VA 3BRCA 4E32A 4QGBA 1K3UB 1QONA 1QB7A 2HZCA 4HLDA 3NMUF 3DM2B 4QBUA 3GUCA 3Q2IA 2XI4A 4TXJA 1HQDA 3NBZC 2PBZA 4ZU6X 4DPWA 5KFQA 2FAXA 4YIHA 1I13A 2Q7OE 3I12A 3TIXB 2WWWA 5EZYB 4RE6A 3MJDA 3JQQA 4MV8A 3DULA 3GW8A 4V0NA 1HT2E 4FDVA 4X20A 2WVJA 3ETJA 2HLHA 5D3GB 3UMMA 4BMXA 1T9XA 3EPGA 1NNUA 3D54D 1YVRA 1SIOA 3GMGA 3PA8A 4UOCA 2V9WA 1FP1D 3SQGB 2BYTA 2B4YA 3QX7A 2PC6A 2PXAA 4NX9A 2FWNA 5K9FA 2WJGA 1AO0A 4PV7A 1QPGA 3BOSA 4OHCA 4PLZA 1A9NB 3DHEA 1RE0A 4FM9A 4NZPA 3LQFA 1JLGA 3FSXA 1NMSA 3P6YC 3DZGA 3JALA 2NUUG 2NVOA 1P7YA 1PX0A 2BOPA 4Y28C 4DVJA 4D5GA 2AJDA 3I4LA 3VR2D 1RPAA 3KOYA 1E79D 5HFNA 2VJNA 3BF7A 3F5QA 4WPGA 1HK7A 2J0VA 1RM3A 2FFAA 2CQ0A 3HGQA 3RAQA 1MAAA 4ND5A 1Q50A 3ZJ4A 2XW6A 4K81B 1DINA 1CX9B 5EWMA 4DNQA 4XGKA 3L6RA 4BS2A 4M8NE 4MP3A 3QYFA 2RDMA 4XD7D 1U1CA 1BU5A 1JQEA 2XUIA 3UICA 2AYGA 3IILA 4ZCKA 4AYXA 1CLEA 1YMVA 2D1CA 2FVPA 3VISA 4IQXA 4ZKEA 3AHGA 3LGHA 2XQJA 4MYTA 2P9BA 4CI0B 4LYFA 3L9WA 3JTEA 2NACA 4LXTA 4HF7A 2C8LA 1V6HA 4CM8A 1J56A 3ZTSA 1TL4A 2I9KA 5AK5A 4WK6A 3EBLA 1M76A 4QD3A 1KK0A 4C4SA 1DV2A 4LYAA 3WGGA 1KPIA 4CKCA 1W46A 1Q95A 2DWPA 3BWDD 4AUNA 4RPIA 4D9CA 3OQVA 4Q5IA 1K5HA 5TLSA 3O9MA 4W98A 3CEJA 4NJMB 1JHAA 4M6WB 4CE6A 4P5DA 1VJCA 2HQRA 1KIFA 1W6RA 1T29A 1IUPA 2L41A 1SUQA 4CTAB 1AN0A 3G96A 1Q0ZA 1U63A 3E1GA 2CNOB 2WM9B 1R5JA 2XIJA 4A5SA 2GJAA 3TSZA 1K88A 2F3QA 1WR8A 1RHQB 3C6KA 1SKRA 4HH3C 3ZQUA 3F4KA 3BGLA 2VHYA 3SXPA 4W6ZA 4Y98A 3E3LA 1W35A 2QTBA 4AFFA 3JD2A 2OO5C 2XT6A 1TDJA 1WTCA 1JWLA 1FXRA 4DSTA 3BMCB 3V81A 1UEIA 1YJNS 2WE7A 3EGDB 1M10A 2BQ3A 3MECB 4FJ2A 1J5OB 1RWQA 4TTVA 1QE5A 2IQIA 3WJ2A 2F43A 4BIMA 3TRGA 3RYFB 1WMDA 4RW7A 1RT4B 1XRJA 2WLSA 3Q3VA 4TOIA 2XS7A 1PHPA 2PLRA 5JCXA 8OHMA 2REBA 4MQ5A 1VE3A 1RXWA 3K9BA 3LZ6A 2MQ8A 3JQ8B 4IR7A 3EN0A 3SE7A 2HQBA 1QIJA 1KI3A 3T15A 4FEEA 4Y0AA 1EP3B 4G1MB 4ZIVA 1A5TA 2FK7A 1B3RA 4GMGA 4BU1A 1CRPA 5ETSA 5JNWA 1Z0FA 4LFCF 1H74A 2PZKA 3JATA 4S1PA 5K0GA 4J16C 1T8EA 5FPHA 2MYTA 1FJCA 3ASVA 4KBYA 3Q8KA 4GPZA 5HFJA 1OFGA 4PRZA 3MBOA 2BOVA 2YVLA 1IBCA 1KI8A 1T0IA 3RC3A 2AGOA 2B92A 1OAAA 4Z9FA 2PL9A 4URHA 3OPYI 5KKCA 2YX7A 4HNGA 1BE6A 1SL1A 3QKTA 2LZ0A 3RW6A 1EG2A 2PJZA 2J6HA 1LX7A 3FKQA 1VA5A 3PIDA 3ZGOA 2A9RA 3NVKI 2IPMA 2RILA 5EKSA 3G82C 3OLYA 4D3ZA 3H1GA 3QKSA 7ADHA 3IPXA 5JT1A 4YYEA 2VYVA 4P3PA 5AUPB 3OO0A 2H4WB 1MROB 5AIAA 2Q0XA 2VSNA 3Q3GE 3Q11A 1X7YA 4RACA 3N5KA 4J0KA 3KPYA 3CV3A 5COQA 1IIRA 1E4YA 4YPVA 2GQCA 2D13A 2YN4A 5JI2E 1KFEB 2GZHA 3I2KA 4CZCA 2FWMX 4ZRDA 2ACKA 3H2JA 5CYQB 2P9GA 3B6ZA 4C05A 4D5EA 5FTKA 1DG9A 2XX3A 3E3XA 4KJIA 3QITA 1MWZA 3GLHE 5K8MA 1W48A 3HBMA 2ZH6A 2GO1A 2I1VB 1DCMA 4L27A 2JFXA 2HRYA 2IPLA 2R1ZA 1JLSA 4LTNA 3EDMA 1H2YA 3R9IA 4RJIA 4KYIB 1L7RA 1BMQB 4JZYA 2AX4A 3UPFA 4LRXA 2Q9UA 1ZA2A 4R81A 3LLCA 5FLXU 4QGHA 1U0RA 4QC2A 4C48A 4X4TA 3G8BA 4U4AA 4J4BA 3WMEA 3Q24A 1BQMB 1IHYA 3DB2A 3HADA 3EF1A 3D6MB 1IJEA 1QFXA 4YASA 1EUCB 3N87A 2PMFA 4DOMA 2ZJ2A 3M5DA 2U2FA 3OLZA 3MFYA 4E4YA 2BJ8A 3HJNA 4NYMQ 1KVJA 3K94A 4ER3A 2MEWA 2C4NA 1XTQA 1BKDR 1TYZA 1NK4A 4FF1A 2UXCJ 2F6RA 4KOEC 1ANKA 4XR9A 2H92A 5J2NB 1D09B 4ND3A 4N8SA 4JSTA 2ZRIA 1I36A 2FYTA 5BMOA 2LYVA 4CLKA 4XYBA 1RABB 2WZCA 5H16A 2V7QA 2CXSA 5IM5A 5DG7A 2YY5A 3QOYA 4LXGA 5AI8A 1JA1A 3FKJA 2PD1A 5DZ6A 4BN5A 4FVMA 2JRLA 4JMLA 2P2GA 1HDIA 1NO8A 1E1YA 2DULA 3N2KB 4LQ3A 4E98A 4OQ4A 2VODA 4EKEA 4ICLB 1I14A 3F1LA 3GRCA 1D2AA 3AR5A 4DILA 4F60A 2AFHA 1N33B 1P2SA 4WBNF 3HHKA 2HR1A 1VBMA 3PHEA 5ALDA 3BSAA 4GRDA 3IAUA 4EJ0A 4P2GA 4C78A 4X64B 2G07A 4ADSG 4PLFA 5I4MA 2B20A 1WPQA 3S27A 4ZALA 1JAHA 2WMOB 1JEAA 3IVCA 4MMZB 3PDIB 4LPSA 1Q78A 1WD6A 5LQMA 1CJBA 3PQEA 2QLJA 3RC9A 5GMEA 1JG1A 3WYAA 4P35A 1VPWA 5IT9A 3QU4A 3EXHA 2P9TA 3R24A 3E15A 1C4KA 4DFDA 1UH5A 3CW8X 5H9EJ 1M2OB 4RA6B 2ZPAA 3PM9A 5DQIA 2WVDA 3FNQA 4LJ4A 1TVRA 4KQKA 2XY5A 2AQIA 3WLEA 2O67A 2V7WA 1CS4B 1AGXA 3UNGC 1P0CA 4ARCA 1DBDA 1PL6A 3EVMA 4EUSA 3FZNA 4JJ4A 2B8EA 5L8VA 3H3FA 3OESA 5BRAA 5KX5A 4L4SA 1JJ2R 4OLPA 1C1BB 4AD6A 2M4MA 4XPZA 2M2IA 3OJSA 4FKMA 4ARAA 2SXLA 1U65A 3P2MA 2C1XA 4QIEA 4X4QA 4O59O 1T3HA 3DGVA 3AHCA 1D6MA 1WB6A 4N47A 4CM7A 3TQEA 3NBPA 3IIKA 1FE8A 1EM8A 1QCCA 3HKBA 4EDFA 5JXGA 3MA0A 1JQKA 1GQFA 4ZGGA 2UUCJ 4YJ3B 3GZNA 1ZUIA 4A82A 3RLFA 2OK7A 2H4YA 4X1YB 3E8MA 1MIOA 3PE3A 3FNHA 1W94A 4P1ZA 3PV0A 1RI1A 1DQPA 4MIWA 3IIJA 4HACA 3PJFA 2ZDPA 4AZTA 3Q3JB 3GFXA 3WI7A 3OZAA 4XPEA 2OGSA 3WY9A 1XAHA 4S1WA 1C0EA 4G1EB 5JXIA 3IBTA 2ZJFA 4QYWA 3JTOA 1TOAA 3LC1O 5DZSA 4NC9A 2Q1XA 5CCEA 3OL6A 1JT2A 3EXIA 2WB2A 3PIOQ 1VL0A 3I42A 1J8MF 1RXUA 2ZYTX 2DFLA 3OUYB 2Z98A 2JD1A 4B5KA 1VE9A 4JWTA 2PLNA 2DSNA 4M9SA 2FK8A 3GJYA 3UTDA 1KIMA 2EOAA 3RIEA 4OJ1A 1DTWA 3U16A 2AQ8A 5DRYA 4RDXA 4TKUA 1GK8A 4G8CA 2O5RA 1JHQA 1ZG3A 2QPAA 1Z12A 2BKNA 2QRKA 3LIIA 3GDHA 1IUNA 4YAUA 1ZHOA 2VF8A 5H68A 3CLKA 5A03A 5JANA 1Z73A 5A4FS 1KZYC 1TMMA 3P0JA 3EOZA 3G0DA 4W82A 3HKWA 3TG8A 4PPFA 4D3XA 1MNAA 4WCFA 4MRSA 3RSOA 4FNGA 1LB1B 2WEKA 2C9MA 1AT1B 1RK8A 1EHCA 4H4MB 1OX4B 4V0RA 3BO3A 2EW2A 3OX1A 1SUWA 5F7JA 4QQFA 3S5UA 4J9MA 3C3AA 3ANLA 3CT9A 1T3GA 4R25A 1ECJA 4BVLA 1V1RA 3U1MA 2W6MA 3OZSA 2X4DA 4L76A 2GAJA 3H5OA 2YPZA 2SHKA 3I9OA 1PW5A 1W52X 4NA1A 1M83A 2VJUA 4U2GA 4FPRA 4F46A 3E5HA 4F45A 4WPAA 3RAGA 2WSIA 1BWVA 2C2MA 2VBYA 1T02A 3C6BA 1F3VA 5TQ2A 2P2CA 1A1VA 3LTEA 4OYXA 3T5HA 1CJKA 5AVJA 2VJKA 1DLOA 4HHEA 4HLQB 3SYMA 5K0BA 1UPCA 4TUYF 4XDCA 4W9MC 3UMJA 4JI4F 3Q7IA 1CDZA 2O9JA 2Z3VA 4ALMA 3HZGA 3FPJA 1KI7A 4K40A 4X3OA 4YC7A 2V74B 2P77A 4HNRA 5CD9A 5F8MA 2AX3A 1H05A 3LXRA 4J0GA 4PHHA 1ZAYA 2C1EB 4GS5A 2AG0A 5BYBA 4UBMA 4AF7A 1R6YA 3PHCA 3NKYA 4XIUA 4UTRA 1Y3AA 1KDPA 2D5IA 1CJVC 4R0EA 2GLTA 4L3WA 3PWTA 2JFNA 4U3JA 3IS3A 3QX3A 3S8EA 5AW3A 3AV0B 3LC0A 3PUKA 4YMTA 4R40A 2CEKA 4AKSA 4UFOA 3PC7A 3T7JA 1HHQA 4IV8A 3PFCA 4CLFA 2I2FA 3N2LA 3BMQA 4Q01A 3LCMA 2JLRA 4JBWA 3HKCB 2WD7A 1PYTA 2XKJE 4MWBA 1KYWA 3PB3A 2RRBA 4BP8A 1H94A 2XUAA 2JF0A 1G2EA 4H6VA 3U5TA 1JFRA 3AEQB 2B2CA 1SOVA 4ARVA 1UJCA 4D0SA 2V94A 4RDHA 2QTGA 2DMRA 3DGEC 4LF4B 2COUA 1PJ5A 2P4QA 4O0MA 1VLMA 2NQTA 3VUFA 4QG3A 5DS7A 5FD1A 2J08A 4QATA 3QNWB 1C80A 1QUVA 2Q9CA 3BZQA 3ZWKA 5EJ4A 1NNDA 4EZEA 3OY7A 4GSLA 2J9GA 1CVJA 1EXWA 5SZIA 3RJ9A 5IM0A 4I9UA 3MJFA 3JQEA 2WJIA 3GMSA 1NKEA 1MC1A 5HO4A 1PAEX 2BBOA 1UJ6A 3AEKB 1UKBA 1MG5A 3EPKA 3PI7A 2YBEA 3KXKA 1QH0A 1U8FO 3ZCRA 1D4ZA 1Y42X 4QUJA 2OJ3A 3EQZA 1JX4A 2XWPA 2DWUA 3SP1A 5A5EA 2UXDB 1D1UA 1V1JA 6ADHA 4RD0A 4WLEA 4OZ3A 3UQZA 3P9KA 4YUAA 2Q9BA 4KGXA 2GEDA 4O8ZA 4BDTA 3CJ0A 3E01A 4Z8XA 4YP7A 1VC5A 2ONYA 2VYVD 1XNQF 4TT3D 5KHAA 2RHLA 3A6GA 3PFFA 5LZ9A 2FR1A 4DSZA 3WSWA 2I4OA 5IX8A 2WSBA 3F8TA 2LQBA 3OOEA 1U28C 3JYPA 4CL2A 2WVGA 3PR1A 1HBJA 4RBTA 2GAGC 4QW9A 4KRYA 1X5TA 2YFHA 1PVOA 4JROA 4NMXB 4RS3A 1G3QA 1GEHA 4JQSA 2ZUWA 3WLKX 4O23A 5IF3A 1WVIA 5B0EA 1DXYA 3R20A 2BCJQ 2AXNA 5LM7E 4CNQA 4OXNA 1CP2A 2CXPA 2BZ0A 1S9DA 4RVCA 3TNVA 1SY7A 3MUMP 3HFJA 2AR7A 3TVTA 3ELWA 4NOKA 1TUVA 1AIPA 4MGKR 3B5JA 2NO5A 1JZSA 1ZDMA 2PQ2A 3R3JA 3ZDEA 3VU9A 1K7CA 3LQ4A 1AC5A 3FHJA 1HQUB 1XOIA 3QIPB 1ZMXA 1LPAB 3CVWA 2B8WA 2H9YA 4G3IA 1B73A 1ZCAA 1KE2A 1T9ZA 3I2GA 3T5DA 4AJIA 1TJ5A 1E6KA 2EFDB 3EICA 1XTKA 3LUPA 3PJ9A 1HRDA 1E1CA 1DBPA 2CLKB 2RUSA 1FD2A 4B3SB 4KNWA 2HHQA 4WE1B 2V7QD 5HXAA 3BQMB 1OBFO 3F8SA 4IM7A 1IQTA 5D2CA 2O59A 3KD2A 4YMIA 4WFAQ 5EGSA 4HUTA 3RSSA 3FOCA 3R6LA 1L1QA 5B0CA 1T25A 4MYRA 3NGKA 2XQIA 1Z8HA 3WKDA 3LYLA 2J9XB 5E9QA 4OZ2A 4YIKA 2VA2A 4HWRA 3TW8B 2H8KA 4HBGA 5T64A 5BYAA 5DLDA 4P5PA 2WPDA 3SVTA 4GHWA 2IP4A 4EKDA 3Q89A 2ZG6A 1RTZA 4DR7F 1Z08A 2NN3C 3THXB 1PVVA 1V5IB 4XQCA 3MTIA 3T7TA 2GCEA 3VU3A 2Q2OA 1WP4A 1GCUA 1RYZA 1WZNA 2JFZA 3JQRA 1IZ0A 1GUFA 1YQUA 4GQIA 1K2VN 1GLNA 2TRSB 1P4GA 1BO6A 2ISCA 1C3OB 1XERA 3HVHA 1JLHA 1V95A 1DWPA 4CNYA 4I81A 4JI6F 1X60A 1P1KA 1ZH2A 1LUAA 3HE3A 4YRRA 3FOZA 1PAUA 4HWSA 4OJNA 1XQIA 5C1IA 1RAGA 1JTVA 4NCHA 1ABFA 3ZHCA 4POAA 5CH5A 4MCIA 3VYVA 2F4VJ 3FMVA 4DLYA 3QBCA 5JLAA 3PRDA 3WLRA 2KXHA 2PQMA 3CQ9A 1CUZA 2LEBA 4DUZB 1TTPB 1YA4A 2GJFA 4LZZA 5FBRB 1FVOA 2HLUA 3F97A 4FE4A 1M1YE 3T94A 3Q2SC 5E3RA 1MLAA 2X5JO 1JEYB 1GTJ1 4CM4B 4MV6A 4WP3A 1GFWA 1YRUA 3F9IA 1YZFA 4JXZA 3H8JA 1NZ8A 3H5IA 3PD1A 3A58B 5EC8A 3NI2A 2VO1A 4LQCA 2AZ1A 2CHQA 3EY9A 3OMLA 4YV1A 3QYPA 1UZHA 4F4FA 4E0BA 2IIVA 2HBZA 2C95A 4QOSA 3TR0A 3FPBA 3PLRA 1RYDA 5JZBA 5T7BA 4AURA 4FQ8A 2Y4NA 3RO7A 1NF8A 4DC9A 3DCAA 3DXXA 1U7WA 5FQOA 3EVBA 2ZDGA 5EHIA 5K14A 1RBQA 1NK5A 1JZQA 3VPFA 4QSHA 1EWTA 1Z6YA 3HB1A 3U1BA 3QLUC 1R0XA 2FPKA 3QRPA 2BANB 4O1MA 4JFRA 4YJHB 2ZBRA 3GA5A 3W8DA 4OA5A 3FWPA 1EWVA 3V8QA 3O47A 3ECSA 3H18A 4FX2A 1L4YA 1ZWLA 4EM6A 4JNKA 1T5BA 2WBRA 4EMTA 1QTRA 2P11A 2AD1A 4X92A 4MV9A 1VFPA 4UW9A 4C0BA 5CCXA 3WQHA 4KHPJ 5I3ZA 4I6WA 1KFSA 1FMCA 3K0AB 4HBZA 1ECLA 1BN7A 4GSYA 2FWPA 4FOPA 4EO6A 3RQIA 1CQPA 5DI3A 3R5FA 3SC2A 3C3WA 1FYFA 4LDRA 4AZ3A 3SXUB 3RT1A 1IZ8A 3ZTWA 4UCQA 3PNVA 3CVKA 2Q5FA 5G1PA 1S7CA 4W5JA 4ILKA 4NLLA 3EG9B 4M63A 4ZK2A 1E2FA 1C4OA 4PCLA 3UD3P 4ZC8A 4YUDA 1FP2A 1O7JA 4D3DA 3PKYA 3ETEA 3B6BA 3R5AA 3AHIA 1T6BY 3FWHA 2XUHA 4PSUA 2ZR0A 2GVDA 3I05A 1MNQA 3NJ8A 1VB3A 3DZ8A 1ZVKA 3OKPA 4F93B 4CW7A 2AD5A 1QDUA 3RVSA 1SKBA 3LCVB 3V1MA 3PI6A 5A05A 4LF8J 2QAGA 5DCUA 1CJSA 1SOUA 4WYWA 2CWXA 3L7UA 1YMUA 2ZI6A 3IHWA 2ORYA 2DGOA 1T3OA 1GAXA 1AFIA 1ZGCA 2ASLA 1NXXA 4TTAA 1V35A 1DFIA 3G89A 5E8RA 2C3MA 2YRXA 1DELA 1SJ3P 2PZLA 3OWOA 2QUBA 4HRAA 4DG9A 2YNHB 2KH9A 3AB2B 1L3TA 1G21E 4HDQB 3JQDA 3SZGA 3HLTA 3K0FA 1VPEA 4UJ3A 4YT5A 2ZU0C 3GEEA 1T5DX 1NPYA 1Q16A 3WYGA 4AY3A 2WA2A 1E2PA 4EOGA 1GNLA 3VV2B 1MOZA 4MS4A 3P20A 3MT0A 3QVUA 3C3CA 1REQB 4MMYB 2W4QA 5MN4A 2BEKA 1XMXA 2PN1A 3KU1A 2Y3YA 1YUNA 3MTKA 4V0OA 4RZHA 1JG3A 1RTDA 3NIWA 3FRZA 4C7VA 5JBNA 3BGUA 2AMLA 1SXQA 4JR0A 1AV6A 2EW9A 3GJ3A 1GQQA 1RAOA 1CULC 5TNXA 4J7CA 1OTXA 3OTBA 3MURP 4Y18A 3WNDA 4DV1J 3EE3A 5E4TA 3WKCA 4A8PA 2XUQA 2HIYA 1YQ9A 2DWCA 1WA5A 3D6FB 2MR5A 2PPLA 2FN8A 1T9VA 4EY7A 2F63A 1QAXA 2ZC4A 2BVZA 3UT5B 3OF3A 1YRBA 3VV3A 1N7HA 3Q8SB 1V4VA 1N9KA 3QA9A 2QSJA 2BJ3A 4FCVA 2OWEA 2F8HA 3EVNA 1LZKA 2XMQA 3L41A 2ZOGA 3QJ5A 1WABA 5CD4H 1ADFA 2HGZA 3EZUA 1FDTA 4GM4A 4S05A 3S1AB 3D5QA 1BXGB 1E32A 2UP1A 1YAJA 3HXTA 5EHGA 2WNHA 4WJZA 1WDWB 1KC3A 5HLFA 5MF6A 2YUIA 2NU8A 2N9UA 4JB3A 5DM2A 4J9UE 5IKXA 2HNZA 3AJ2A 4TZKA 2GA9A 1N3IA 4JYBA 1DC3A 4RDIA 4M5HA 1XEWY 1U3UA 3ADCA 4C4XA 1U6ZA 5A5FA 2NUPB 5MDHA 2DXIA 5HIJA 4DBLE 2OZLA 4WOCA 1P33A 2JVKA 1IM6A 4S1OA 1XVLA 3WICA 5A8RA 4QOTA 1PYDA 3CF6R 3GLTA 1SBRA 3NHFA 4B2YA 4CDIA 2XS2A 1NDQA 4JCCA 4KV8B 4EFKA 4KGMA 1JAIA 3MGAA 4P7VA 3HN6A 2OQ2A 2VL7A 4IXMA 4QX6A 1RJ9A 1YJBA 2V69A 4WWHA 1QWSA 4ZVRA 1CQIB 1JKFA 4PXCA 3OLXA 1W93A 1N78A 2Z8QA 3QVGB 3ELUA 2FRXA 3A3PB 1K0TA 3QW4B 3KG4A 1HYEA 3CUKA 2HZAA 4CQ1A 4R6WA 3UWMA 1CB0A 2FB0A 4Q1BA 5CH3A 3N2GA 2QG6A 4OLAA 1VYUA 3IEXA 4G81A 4DA7A 3V6DB 4DCPB 3CY6A 4ZLNA 4W4MA 4QIGA 5BSHA 4AY4A 4FIZA 3CR8A 4YCNA 3ECCA 4ML3A 4PZ0A 1BH6A 2MQPA 2WTFA 1G38A 2WU4A 3HSSA 2QT9A 5ALIA 3BWXA 5EP3A 4EK9A 2CGEA 5JDIC 2LQ5A 1SHZA 1SXJC 4B08A 4OK6A 3L5KA 2G9RA 2K7JA 4KT0C 2PQ6A 4YAFA 2UYOA 1LBTA 5J2PB 1DQ9A 1EIZA 1Q2XA 3JPYA 3VH2A 4QYXA 1NW8A 5JXJA 1KSPA 4PZPA 3Q0AA 7MHTA 2IFXA 5JFOA 4DL3A 2W6NA 3BGDA 4AG6A 4PRLA 1N2ZA 2Y9HA 4ESVA 5IJZA 3IBYA 4LF9B 2VZ0A 1WULS 2NXWA 1DJOA 3LXUX 1XL1A 4MH8A 1E9EA 4M5JA 1EFTA 2RARA 3HSZA 3ROEA 5I7UA 2YZ2A 4QQKA 1PRYA 3T06B 1EJBA 3DLEB 5FBLB 4G85A 4HQNA 5K6RA 2BKPA 3KLFB 1N34F 2PUBA 1IONA 5IXYA 5KFZA 1FYWA 5KINB 2DT9A 1ZITA 4JV2A 2QT0A 2IJRA 4ZU3A 4LOAA 1VRTA 5D5PA 4D46A 4QDXA 4Y9TA 2X8BA 3ESBA 2OV4A 4EW3A 5J1EA 1EK1A 1S8OA 4AB1A 4L07A 2H4FA 3SCJE 3C7CB 2DNNA 1B74A 3FA2A 3JYNA 1YL7A 1YK0A 1MB2A 1TZMA 1VHWA 1ZOTA 2BGNA 4FGLA 1GPYA 3U56A 3SYZA 4RADA 1P0FA 4KDCA 5K09A 4BO2A 3KPJA 3CISA 4EY8A 3U4GA 2RGXA 2V1UA 2DR5A 10MHA 2B9WA 5KT4A 1RSZA 1Z06A 1IBLF 4ZJQA 2RE8A 3T5CA 1J22A 1DHTA 4RHYA 4ZAVA 3K31A 5AVYA 3ITNA 2B7LA 1YUBA 1PZMA 1XRSB 3MIZA 1NULA 2CK3A 4K4ZA 1NI3A 5IFKA 4EA8A 4O3SA 3ITHB 1GAJA 2ZOMA 4X2BA 5FPSA 5COAA 3A27A 4ZLPA 3K6SA 5BW6B 3MW8A 4EX7A 4C6AA 3IR6B 2WUVA 4CLUA 3HP6A 5KTTA 4E3ZA 3MLEA 3AHJA 1Z6ZA 2BE2B 4Q0BA 1UXOA 1DBWA 1N2IA 2NLWA 1P1JA 3RYTC 1VYVA 2JIQA 3QSIA 3BXEA 3D54A 1W87A 4UBKA 3O4IA 3PJWA 3C6XA 4ZJLA 1HO3A 1W4ZA 5IT9Y 5DCLA 3UCEA 5B3AA 4DG5A 3VR4H 2CQDA 4P32A 2C5LA 5FUWA 3MM5B 1HX7A 1T0JB 1TPYA 2Y93A 4RY2A 4ZT7A 4ETNA 2CQPA 4KODA 4M1TA 1SVMA 2QX9A 1BYIA 3MGKA 3UF0A 1P4AA 2R6FA 3DOLA 4PLGA 3T3PB 3LUJA 3E9RA 3WADA 2GFQA 4WFZA 1U3GA 4X93A 3T0GA 3KU4A 1C8BA 4EEKA 4HL9A 1E79A 4O0IA 1OAOA 3QWFA 4W5HA 2RAUA 5DTRA 3EDCA 1TP7A 3ADAC 2WAMA 4A8WA 3ZLBA 1PNVA 4JL8A 1W59A 2WCXA 4JQCA 3QJGA 1Y4ZA 4HGPA 3CXUA 3EDRA 3RHZA 1N2CB 1A2QA 3PLAE 3ZV6A 1Q7TA 2ZJZA 3QQCD 1M2KA 5H80A 3U3KA 1R0BA 1BD4A 2V7GA 2WJWA 3E51A 2H1YA 1D4AA 4QOJA 4DR6B 4JZKA 4FS8A 4TL8A 4A9AA 1IM2A 2X0KA 2EJVA 5IH3A 2QVXX 3NOQA 1GZ7A 1TM7E 2OBBA 1K92A 5D4LA 3EZ9A 2ZYRA 2B34A 4KRWA 3GJTB 4RC9A 1RHRA 4QVKA 5HKKD 2YX1A 5C8DA 3LL7A 3E2MA 2EWHA 3OJCA 5LL6P 3PR4A 2J8SA 1FFBA 1CHDA 2LECA 1CNMA 1TJ3A 4AG3A 1XDZA 3F4LA 3MGGA 2XMMA 4PQAA 1XL0A 3SZMA 3C3PA 1KDRA 2Y8WA 1QVAA 4RS4A 2CJYA 3W6UA 3CEDA 5AHRA 1RQNA 2HQGA 4OYIA 4YDRA 2IS2A 2OFPA 5IWAF 3PUYA 4RBVA 4ETWA 3Q3HA 2KFYA 4EI7A 4X54A 3IQXA 5EHQA 1HNXF 1SKSA 4LOLA 2KT2A 1L7BA 2C5GA 4GBED 2BFNA 2EZTA 4ZOCA 1N57A 1TF5A 3CR3C 3NWRA 5BSFA 1YZQA 2K3IA 4O08A 4DR5B 1JHZA 5LMUF 2XTNA 2BUCA 1NLYA 1I1GA 1PP4A 3QAUA 3UEOA 4Q9KA 2NVUA 5E38A 4KXNA 1YDHA 5BR7A 2GBCA 4JIGA 3HJCA 4E88A 1C14A 5GIOE 3GLFE 3KZVA 4I0WB 2VUHB 5DP2A 4QT4A 4ZS6A 1UR5A 4LSZB 1NTRA 2KM1A 2XDQA 1EB8A 2ZYHA 1UM9B 5K3DA 4M89A 3GV8B 1SRRA 3MZIA 2MZ1A 3E7WA 3W9IA 2KI2A 4LW8A 3R6GA 2GEJA 4G0MA 1QFYA 1P75A 2A9PA 3CLUD 5CW2A 4Y2SA 4MYCA 5CM2Z 4DLUA 3MTEA 1TU3A 7REQB 3REFA 1OLSB 4U02A 1ZUWA 1YACA 4OQXA 2R8KA 4RFLA 2BRKA 3UN1A 1DC6A 2GSWA 3GJZA 1Z37A 3GYGA 2VJMA 1W4LA 5C52B 1T91A 4US1R 5FPYA 2UUTA 2W7OA 1CS0A 1C1YA 4UDXX 3P5BP 5T7LB 2YTZA 2LGJA 1E7WA 4D81A 4ZOLB 5BUQA 5DULA 5JBIA 1RP7A 2KPOA 2CUTA 4BMYA 5KKNB 3AINA 1SIUA 2XQGA 2H59A 1B7FA 3GLSA 4ZEXA 2I87A 3KCNA 1NC1A 1E9VA 4NEZA 1IRXA 2OFWA 3IDZA 3SVZA 4N18A 4RTKA 2YNMD 1HDXA 1G7CA 5KMGA 1HDZA 3AF5A 1FDSA 1UJBA 1ZNYA 4W63A 3FOBA 2I65A 3JSXA 3L6BA 2AD9A 2FKAA 3OJOA 3KLBA 1O77A 2F40A 1P9OA 5G0WA 1DMSA 1JL3A 4A15A 2I6GA 4HDRB 5IUJC 2ILTA 4OX8A 1QZZA 4E6EA 3UOGA 2OLJA 4DRXA 3AB7A 3QEOA 1U2GA 1EWRA 3CM0A 2HBYA 7FD1A 3PF9A 3OT5A 4FC7A 5PGMA 2CXNA 2O07A 3DQPA 3H4VA 1OQAA 2KJQA 5HZKA 3NIDB 4D6YA 1GCAA 4C1BA 2ECFA 1IJFB 4PUOB 1QIIA 1JFVA 2VF5X 4W1SA 3ZD7A 1Z17A 3P49B 3GB9A 4P84A 5JVDB 3TVDA 3QU2A 1KR5A 3STHA 5LOVA 1ZUNA 3CRRA 2HJHA 4LRDA 3H5AA 1JU4A 3T3GA 4OLBA 3LH5A 4JI2F 4C11B 2RQKA 5B6IA 3ZUPA 3I96A 2DAPA 3D6UA 2D7JA 4Y00A 4EG5A 1GRVA 4V0LA 4XI9A 2W8BA 3CIMA 4JOBA 1HE1C 2J6SA 3L4SO 2DFPA 2XZWA 4MR8A 4CG3A 3LQKA 4KBGA 1J33A 4OBXA 3OUUA 4WBXC 4XVQA 4J6FA 3KFWX 1YHQS 3Q8XB 4UHFA 4OHYA 2W2VA 4N5DA 5TGTA 3HCRA 1TF2A 1MP0A 2Q45A 2H0RA 1WHTB 3W9UA 2R66A 3PDWA 3U5ZB 4NLYA 3UMCA 4MA0A 3HZEA 1RGVA 2GDZA 4KR3A 2J3JA 4IMRA 4NYOA 2CLOB 3RM3A 2E82A 2NSJA 3QQPA 5BWMA 4JI0F 3JQGA 1G20A 1PNOA 3C4VA 2VFSA 4OG2A 5EQJB 3TRDA 2FZCB 3MLAA 1EX1A 4KYTA 4Y2YA 2GXAA 3EXHC 4PC3A 4MZDA 4X60A 1B6RA 3MCUA 3LFHA 4B33A 5IBRA 1T3ZA 1Z6PA 2ZQZA 3GFSA 2OB2A 1ODKA 1UFOA 3K9QO 3ZHQA 1FEHA 3L8MA 4NP6A 1Z16A 1L1FA 1F5NA 2ZVIA 3QU7A 1SC3B 5JYDA 3L77A 4YB7A 2QMUB 3ZZPA 1GT91 4GSKA 1O9HA 4IYQA 4OQDA 4A47A 2JRSA 5FV7A 1RDFA 2QQ5A 4CFZA 4JJEA 5EFZA 5BP7A 1I94B 2NV0A 4GE0A 2AYZA 3U61B 4DB2A 1ZKMA 3IRXA 3LYUA 3WBFA 2FFQA 3EEFA 2LUOA 2F8LA 3U7FB 2GM3A 4F4UA 5HROA 2AEFA 5ALMA 4MW6A 3RGGA 3AY3A 4PYDA 1NI5A 2NU6A 3VAFA 3KEGA 1FA0A 1ARZA 3M9LA 3QLJA 4NNPA 3GEGA 2DNMA 4FXDA 3KLEA 5LMCA 1TMGE 4V19J 2MHCA 2RHHA 3AERB 1PG2A 1Z4MA 3DDOA 4NLDA 2P69A 3H11B 2PX5A 2OBYA 1PR1A 5CURA 4XDHA 1E7MA 3LO3A 1VECA 3ICVA 4KMRA 1U4BA 2Y0BA 4CT9A 2O0JA 1RMQA 2R0QC 1S79A 1KZ9A 1ECPA 3HCDA 5J4YA 3RIGA 4BRSA 4MA5A 2WJ6A 4UM5A 1XHFA 2TMYA 5EWLB 3K9WA 2KN4A 2VYQA 4LDAA 3U4CA 3K4HA 2VJOA 1TRHA 2CK3D 2DIUA 2DVMA 4HNQA 4OMDA 1KQOA 2XODA 3B3AA 2PMCA 1J0BA 4YRGA 2ISQA 2YZKA 1LW0B 2PMHA 1P27B 2J3DA 1IH8A 2XMPA 2BJWA 4H4EA 4NBTA 3HUTA 2PR2A 4AS3A 3B38A 1KQFB 2YY3A 1ZXBA 2G72A 4QUAA 5HMYA 1EAMA 5HCNA 4EA9A 2OAEA 5CDHA 2DHSA 3CU5A 3SZLA 3CCCA 1EFAA 5IDQA 4WCFC 3NIGB 3ETOA 1ATZA 1QC5A 1YJWS 3IO1A 4JI1B 1RJGA 4AKHA 2DFKB 2XO7A 1T1SA 1PLLA 4E2ZA 1KC8T 1WZ2A 1NSFA 1SQSA 1WHVA 1DJNA 1ZRMA 2F9DA 3G2PA 1IULA 2Y8EA 3IGFA 1SBZA 5DBGA 3TM5A 1OBVA 5I42A 4BZZA 1Y81A 5KG0A 4RW6A 2Z8YM 3GA7A 2JBAB 1WC1A 1GXTA 1HPLA 3VNUA 2F4NA 4TROA 4UEQA 3QEMA 1E18A 3DEYX 4MYHA 3B6JA 4DV5J 3C14B 4H9GA 1OXMA 3N6VA 2WHYA 1E6UA 3BXZA 5F33A 1JGTA 1NIJA 2VF2A 1FRQA 4XFDA 1CJKC 1FQJA 2R7RA 2IM0A 3I4HX 4B7AA 2O8BA 5CEEA 5GADU 1FNXH 2QA2A 4IINA 1F8UA 1KOGA 1AK1A 2ZM6F 2OHIA 2IYVA 1NG9A 4PC1A 3UR0A 4I56A 3TLGA 3BHMA 4W7IA 3EXG1 3P4UB 4F8RA 4USMA 4QFDA 5TX7A 1HQEA 5LR6A 3V80A 2XT0A 3PY8A 2DNQA 3L82B 5SY6A 2JC1A 5EPOA 5FEMA 2RKIA 1P77A 5TIIA 1QCYA 1GTRA 2VDJA 2AYYA 4JR2A 4WFKA 1NAIA 2DUUA 1KVRA 3ISNC 3QJLA 1YCFA 2XOEA 1TEHA 4R0MA 2OPPB 1FDUA 1CQMA 4HFRA 3IAHA 1EVLA 3ENNA 3K8WA 3CB4A 3FTQA 1ST3A 4LNUA 1JXQA 4BQQA 4DV6J 2HTFA 1Y7PA 1G9TA 5J2UF 4TLMB 5DYTA 2BTEA 4II3A 3NJRA 1IL0A 3STXA 2AOTA 1S1XA 1RQLA 5HS4A 1QK5A 1ICEB 3BTOA 4V3BA 3CLTD 1R27B 2B5WA 1FMLA 3I2HA 1A7UA 4MW2A 4JBGA 1TVKA 2VH2A 2RGNA 1V16B 4DPYA 3QMQA 1Y9OA 1RD4A 4FYJA 3R0JA 4B3GA 3LDGA 5BR8B 1R7IA 3WMWA 2VQDA 1P3DA 4YXWA 4FYPA 3IRWP 4QO7A 1ZK4A 3HK2A 2HA2A 2Y1IA 3OC0A 5DIZA 4KWCA 2YOFA 2J67A 1XCOA 3B12A 1U1RA 5HPYB 4G5GA 5E6UB 2UZ3A 2PUWA 4EELA 3DOKB 1FKOA 2Q8NA 4V39A 1UT6A 1VC6A 3E8XA 3X2EA 3V8MA 1B8OA 1OBCA 4FQ5A 4OYBA 5LSLA 4Y65A 1R0CA 1Y3JA 3JD4A 3DR3A 3OCJA 2SCUB 3F73A 5KYUA 2XBLA 2IZOA 4AKIA 2GD1O 2Q49A 1Z62A 4CEHB 5LA6F 5CEFA 4XTRA 3E5RA 5A0YA 1TT5B 4BV8A 2HH9A 4JV5B 3NP5A 4Y1GA 1ZAKA 4GX0A 5E6SA 3M9MB 1X4CA 3ZHBA 3V4VB 4ZI5A 4R83A 3SJCA 2HL6A 3ESQA 1XBWA 3KR0A 2LIVA 5FF9A 4FS2A 2HJWA 1QMGA 4P3NA 1YJ7A 5D3GA 1KLMB 3OEHA 2MQOA 2PAFA 1B42A 1X39A 4CPDA 1GTHA 4YMGA 5JNTA 121PA 3RWMB 5CITA 1UC4B 1QB8A 3SM9A 3FUYA 3KSDO 2HV8A 5CT6A 3KT3A 1NJ6A 3TUIC 3NFYA 4YP6A 4FNAA 2A4MA 4M8IA 5CYJA 4NJEB 4CH7A 5JVGQ 3TAUA 4ECSA 2R2TA 4RHTA 3UK2A 4H59A 2IYYA 3S4YA 3KHRA 1PUXA 4TT3A 2X2FA 4MVJP 3FRHA 3P2OA 2Q4DA 5A4MS 3NB0A 5HX7A 1DIHA 4PAOA 4G0UA 3R3SA 5IHXA 4TPKA 3UCXA 3MM9B 2OP0A 4D82A 4LXYA 3ER6A 3BL6A 4NZZA 1XN1A 2EF0A 1I6LA 1FIUA 2WUFA 1KSFX 3OT9A 1DAMA 2I4NA 4FBGA 2JJYA 3NIBA 5BSEA 3KB6A 3CKYA 3HUEA 1RJWA 4DCOB 2AK3A 2RHMA 1NBIA 1YD7A 3IHKA 4PIVA 4R7GA 2QL9A 3DTVD 3RUIA 2WTAA 1V9SA 2QLWA 3UN3A 5D85A 2QTTA 5SY9A 2FZWA 2ZJOA 2Y0DA 1T36B 4GMXA 2ODBA 3R0ZA 3GD5A 4URZR 2NTJA 2WYIA 1DUIA 1PFUA 2GO8A 3C48A 1IXSB 3EMDA 2ZVJA 2RQCA 3RVJA 4B6GA 2X1BA 2CFOA 1U3CA 3M4ZA 2HRTA 1RU3A 1X80B 1W2IA 4MVJG 4WJKB 4LZWA 4UTGA 2AJ0A 3LE8A 1FTNA 4OI1A 2C5BA 3VDMA 2QTFA 4D3SA 1H0KA 1WCIA 1DTSA 3PRHA 4NJMA 1WXXA 4CLHA 2O50A 2V7VA 1E5LA 4K8RB 4WECA 4F21A 4DA8A 1YQQA 1N32J 4Q4HA 4F26A 4CTAA 1AURA 3GSDA 1BNCA 1AV7A 1D6JA 2RH8A 2ZTHA 2Z0MA 1ZZFA 4A8MP 3GELA 3QVLA 1Z2NX 2IY7A 3CCUS 2DTJA 3DMRA 2QDXA 4EJSB 5LQNA 1RQRA 1P5FA 4YP9A 2EKDA 1L4LA 5LNK6 3DXYA 2PGDA 5DMXA 2YN0A 4L72B 4UEKA 1WLSA 2OP5A 3C8YA 5HM6A 3BMCA 1ML3A 2BFBA 4LR9A 4LEIA 3MECA 1J5OA 1XQYA 2X0RA 4YP3A 1JJ7A 1JMVA 5KYTA 1IWBB 3FF1A 3FZGA 3HCAA 2A35A 1RT4A 5KIAA 4MH0R 2JFDA 2B1QA 3BBFA 2ZU6A 2HKEA 2Q6TA 1PG0A 3PEYA 4ENSA 5LU8A 1DNPA 1V9LA 3JQ8A 2CL6X 3OPMA 2PSHA 5TPWA 1SZDA 3P2KA 2QG9A 1M1UA 1ZVVA 1FJGB 2GARA 1R12A 2YVAA 3TE6A 3IWLA 2DKNA 4W7SA 1U2CA 4CMIA 4LIWA 1H2FA 2FW0A 4F3OA 4X1KA 3ANSA 3U1TA 3ZIDA 4PR6A 1F9FA 5LQKA 2H5EA 2ILVA 3QBEA 4FNOA 2I66A 3T4XA 1NYRA 2XDAA 4KBIA 4FCWA 1S0UA 3K7EA 5AM1A 4BFUA 3K5WA 2B69A 1E2JA 3RUFA 4WNYA 2D2FA 1KOHA 1UDAA 2AG6A 2Q3BA 3TAPA 2NYUA 5FUQA 2QKYA 2LLZA 1MO6A 3QVJA 3EXEB 2DR8A 3BA1A 5TS2A 3PQ6A 1YIAA 3MQ4A 2FYXA 3I01M 1HR0F 2YL2A 3QZ8A 1S6OA 1Y8RA 3CZRA 2PL3A 2DKOA 4R84A 2GBGA 1U3VA 3LCCA