2ZWPA

Crystal structure of ca3 site mutant of pro-s324a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
394
structure length
389
Chain Sequence
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDADAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Requirement of a unique Ca(2+)-binding loop for folding of Tk-subtilisin from a hyperthermophilic archaeon.
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 118
structure length 389
sequence length 394
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2zwpA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zwpA02
1C9JA 5ARBA 4OV6B 1ZVKA 1MPTA 1AU9A 1MEEA 4OV6A 3QFHA 1SVNA 2PRKA 2V8BA 1ST2A 1WSDA 1SBHA 4DZTA 1HT3A 2IY9A 1T1GA 1T1IA 2Z2XA 3TI7A 1TM5E 1S01A 3CO0P 4OMCA 3BPSA 1BE8A 4CFYA 3WIVA 1GTL1 1SUEA 1SCDA 2W2NP 4I0WB 1P7VA 2Z56B 3GCXA 1ST3A 1SH7A 1Y33E 1THMA 1GTG1 4DWWA 1TM4E 4DJ5X 5AQEA 2XRMA 1GT91 1GNSA 4NE9C 2W2NA 3VHQA 4H6XA 1Y1KE 1TO2E 3GCXP 5AVKA 4H6WA 1C9MA 2W2QA 2GKOA 2P4EA 2Z56A 1R64A 3DVRX 1NDUA 3BPSP 1P7WA 5FAXA 1GA1A 4Z2AA 3VV2B 1EA7A 3VSBA 4NMXA 3ZXYA 2Z58B 2WWTA 4HVLA 1SCJB 3EIFA 3AJ8A 1WMFA 1KE1A 2SBTA 3VTAA 2PYZA 1T1EA 4YN3A 1OYOA 3T41A 3TECE 3EE6A 3DE1X 1AVTA 3A3NA 3SICE 2Z2ZA 2PMWB 2ID8A 1IC6A 4FONA 2Z57A 2IXTA 1WMDA 1PFGA 2B6NA 1TMGE 4MZDA 1PTKA 3BX1A 3LXUX 3A3OB 1OT5A 5ARDA 1SUPA 1TECE 5ARCA 4OMDA 1V5IB 3SQOA 3A3PB 2E1PA 2W2OP 2W2MA 4WOCA 1GA6A 1XF1A 1TM3E 3VV3A 3A3PA 3P5BP 1AF4A 4ZOQI 3Q5GA 3I37X 1V5IA 5CW1A 3GCWP 1TM7E 1NDQA 4C3UA 2ST1A 1AV7A 4NE9A 2G4VA 2Z57B 4H6VA 1CNMA 2HPZA 4K8RA 3GCWA 1ITPA 1SCAA 1SPBS 3F7OA 3DE3X 4GI3A 1BFUA 1SBNE 1UBNA 2Z58A 3SQOP 1YJAA 1Y9ZA 2ZWOA 3WHIA 2QTWA 1SUBA 1WMEA 3DE4X 1TM1E 1BFKA 2DP4E 1BJRE 3GT4A 3DW1X 1Y3BE 2XTJA 4LVOA 3H42A 2X8JB 5JXJA 3DE0X 1SIOA 5AMXA 1C3LA 1A2QA 1KE2A 1P8JA 1DUIA 3UNXA 3WIUA 2ZRQA 4B5LA 4CG0A 3DE6X 3DYBA 2Z30A 1V6CA 4KG7A 2Z30B 1SUAA 4LVNA 1KDZA 1Y34E 1S02A 1AH2A 2WV7A 2HD4A 1BH6A 1EGQA 1Q5PA 3VV2A 3TI9A 3ZXXA 1SPBP 2PWBA 3D9QX 1Y4AE 3CNQP 5FBZA 1JEAA 3F49S 1C9NA 3D43A 4AKSA 1IAVA 1GTJ1 3HJRA 3LPDA 3BGOS 5I9SA 1TO1E 4K8RB 3F7MA 3DVSX 3DW3X 3BGOP 1AK9A 1S2NA 1Y48E 3LPCA 5B1DA 4YN3B 1GCIA 1YU6A 1YJCA 2TECE 5AVJA 3QTLA 1SCBA 3DWEX 1SBTA 4WOBA 3Q40A 4RYDA 2XTJP 2W2QP 1WVMA 1SCNE 5JXHA 3L1KA 3P5BA 1R0RE 3I34X 3VYVA 5JMOA 2W2PA 5JXGA 1ZVJA 3A3OA 1KDYA 3PTLA 1GNVA 1VSBA 1SELA 3DDZX 2QTWB 1KDVA 3OSZA 1Y3DE 5B1EA 3AJ9A 1SIUA 3CNQS 4KB5A 1CSEE 3WQBA 4KPGA 3DVQX 5FFNA 2PQ2A 4J94A 3A3NB 1YJBA 2SNIE 3I30X 2PMWA 1SUCA 1SIBE 2WUWE 1SN7A 1AQNA 2PKCA 2WUVA 2PWAA 4C3VA 1SUDA 2DUJA 3I2YX 4ZARA 2W2PP 5SICE 1Y3FE 2DQKA 4CFZA 1TK2A 1SBIA 3PRKE 4BWGA 4NE7A 1LW6E 1R6VA 1NLUA 3DE7X 5K7SA 1SBCA 3QMPA 3CO0S 3GT3A 1BE6A 3DE5X 1PJ8A 3DE2X 1OYVA 1PEKE 2X8JA 3H42B 4JP8A 3AFGA 2SECE 1Y3CE 5JXIA 1Y4DE 4HX2A 4M1ZA 2Z2YB 2ZWPA 3LPAA 2ID4A 1SCJA 4NMXB 3EDYA 4AKTA 2Z2YA 2SICE 1DBIA 2W2MP 2W2OA 1GA4A
chains in the Genus database with same CATH superfamily
2E4UA 2G82A 5EIWA 1VA5A 2BE9B 4W6QA 3AF3A 2XE4A 4YCDA 3N2ZB 2V6BA 1JSCA 1PWXA 2DEUA 4XEUA 2X3GA 5JC1A 1A1VA 1TQ4A 2G40A 2I6QA 2BTQA 3EUWA 5DSXA 2TMKA 5DNVA 5ETJA 3CR7A 4GNRA 1JSRA 3OVBA 1EBUA 1JR3E 2ZATA 4MQ5A 2B9YA 2C4WA 2B4TO 2XOKD 3W2FA 2R8IA 5G2OA 2XVYA 1LKZA 2O8DA 4YDRA 5DRYA 1AX9A 3C1TA 3USZA 5DGDA 5GJCA 1AKWA 2BW7A 4K9SA 4KLNA 3TI0A 3AM5A 1VZ2A 5G4LA 1GNSA 1QG2A 3VMMA 2JHFA 1Y1KE 3TOSA 1IKWA 2IP1A 1NXVA 1WWKA 3KQQA 1E2FA 3H0PA 3M4NA 1BVHA 1W4RA 1DPFA 4P2BA 1T1SA 1FMCA 1VJRA 2PJUA 3WC0A 1NWCA 3BL8A 4P86A 4DSEA 3QWBA 4YR0A 5KTRA 3K70B 2WTUA 1Z8NA 1RAAA 3TVZA 3H59A 4F3RA 2EBUA 4O1IA 4JC4A 4OJMX 2Z6AA 2JFZA 3MM6A 4I2QB 2W6MA 2WPDA 4JHLA 4EX6A 3GG2A 2PXAA 3IOYA 1N5JA 1I0IA 5IMSA 2DXIA 4WNAA 3PNMA 4QDOA 4EGFA 1UFLA 3DBLB 5JC8A 3KKFA 1Z06A 4G8JA 3MS7A 1J4AA 2BHNA 3AC0A 1RT2B 1KO8A 1DRJA 4GPAA 2GKGA 4F3MA 2F2TA 2HU2A 3ERCA 3K57A 4JUBA 2JZCA 5CR9A 2WKRA 2XQFA 4LECA 5AK4A 3BUSA 4DR5F 1YHZA 4JXJA 2HTFA 2YUIA 5E7MA 4Y6LA 3FPJA 2P2CB 6YASA 3WGNA 4DBLE 5EZYA 1XEFA 3PDNA 4KYVA 1XHLA 1H9BA 5TMEA 4YI3A 2K2PA 4BCAA 1H0RA 5KT5A 4ZLNA 4LBPA 4IHQA 1UBNA 3T9FA 4E1VA 4G5RA 4CMIB 3AU9A 3NBZC 4WZBB 3WTBA 4GMGA 4YMUA 2M8DB 2X2PA 3ZJ5A 4YUXA 2FSFA 3LKZA 1OHHD 4IUYA 4AY2A 2PD1A 1RKVA 5DFAA 1Z5OA 1Z6XA 4ZTUB 3U4DA 3SIWA 3H2IA 2NSYA 3EIQA 3HYNA 2W8BB 2ZZKA 1PT9A 4TYYA 1VLVA 2CWKA 3N79A 2PLFA 1MN6A 3ZIAD 1NBMD 3SDZA 1LPAB 3HFGA 4JVNA 3KYJB 3AJRA 3NGLA 3QENA 3UCUP 2KFZA 3QELA 4FKMA 1SQ5A 1FNSA 2JBWA 4TLEA 1SD5A 2GZSA 5K05A 5JYDA 1W0KD 3EVBA 5TE9A 2SXLA 1KP9A 3F49S 4NRUA 1DBVO 1U4SA 2IUFA 4MVYA 2NXNA 1YUMA 3HKEA 1DBPA 4R8VA 4RJTA 3OJCA 2RHSB 1J9ZA 2CPYA 1ORVA 3WB9A 3E35A 3GPBA 5KNDD 3LPCA 2R7RA 2TECE 1RWOB 3FSYA 2VG8A 1RE0A 3TEMA 3EZLA 4HDSB 4KV7A 1PO6A 4KRWA 4M9XA 4O4JA 4EYGA 1AKQA 1MB3A 2HQIA 3AIMA 5EPOA 2DHDA 3BGLA 1VQYA 4F2HA 4AP5A 4K2XA 2W00A 5E41A 4HDKB 4J03A 3K70D 1KWGA 4YDXA 1NR5A 1ULTA 3F3MA 3ZU6A 4C20A 1WPQA 5FX2A 4DQQA 3WL6A 3MOIA 2HFVA 5C34B 4QHTA 1DLOA 4B4UA 4NICA 3LGAA 4EHAA 5JDIC 1HBMA 1P1IA 1KPIA 1FNDA 2HQSA 3Q88A 4IFIA 2Q7OE 4B3MB 3EZFA 1U2PA 3GFHA 1CJVA 5K0GA 5CCBA 3UNGC 5KO2A 3IIKA 4RTQA 3T7IA 3AXSA 4PRKA 1UEJA 4CEHB 2GVNA 2ZIAA 3LUDA 4BXOB 3AFOA 1DFIA 4XX0A 2XXJA 1M0TA 2WJ6A 5FJJA 2PHZA 5FR1A 3HL0A 3LX4A 2EFGA 4ZVRB 3E81A 3HBLA 1O95A 1CUIA 2I6SA 5HE9A 3TFQA 4R3NA 1TAQA 3IQIX 3VF0B 4ECQA 1Q0LA 3C3JA 3DOCA 4JYAB 3HWRA 2V2VA 5BR8J 2W2MP 2J6SA 4DXLA 2GVZC 2QE7A 3IEKA 5E2AA 3WGVA 1T6BY 3MM4A 2FCRA 4I2QA 4QGSA 3FOAA 2XWJI 5LFAA 4OGFA 5IPFA 4FXOA 2IKSA 3FR7A 3JTEA 5CVJA 1GKUB 5AM1A 1HPLA 3UIEA 3UTDA 3HHLC 3M5CA 1CE8A 3IUNA 5TV2A 4Z9XA 3X1ZA 1IMOA 1JEEA 1UC5B 3H2KA 2QY6A 2HA7A 1Y5IA 2IBMA 1TA4A 3EXYA 3LL7A 2X2FA 2FUEA 2HFKA 1FBNA 3F6EX 2PUVA 1RLDA 4BRZA 4DPLA 3HN6A 1ORRA 4DV5B 3ZNPA 4Z3DA 5SUHA 3MMJA 3QATA 1X0XA 3O8BA 1C80A 1U8TA 4I4TF 5BYQA 5TJ9A 2ZTSA 5HF8A 2XY6A 1NC1A 2F4NA 4E14A 7FD1A 1XALA 5EMHA 2NT4A 4QPZA 3GMDA 3OJFA 6AT1A 5KDDA 3UWKA 4K5SA 4L4UA 2OSQA 4W9NA 3LGXA 4GPD1 5KT3A 1TP7A 2HGZA 3HWX1 2OD7A 3F9RA 3G8AA 3KT6A 4K8OA 1DINA 1E7SA 2J0SA 1I3LA 4EW3A 3DLGB 4O3RA 3K0AA 3GAFA 2QG9A 4C05A 5ENVA 3GI1A 3B38A 1VRWA 2G9OA 4M3NA 2C4KA 4HACB 1N4LA 1E9EA 4DN0A 4EJSA 4ENOA 5E4JA 3IB3A 1Z5GA 2B1IA 1DEHA 4YEDA 3PVZA 5H9FK 1G5PA 4E4TA 1T6ZA 1LDYA 4DU7A 3K6SA 1KRPA 3FTEA 3QVJA 3VV3A 3UWSA 1IBMJ 3VUFA 4X6YA 3NB0A 2HPUA 1OTXA 3F8TA 5CVUA 5JS7A 4ZQEA 4XWWA 3GJQA 4FYXA 3QKIA 5T5QA 2UXCF 4KQ2A 1NM5A 4A8HA 1OI3A 3MWYW 5DLFA 1H3DA 3V2GA 2M4MA 4OH7A 2QLFB 4GR9A 4JJ4A 2GQCA 3L4JA 1S12A 4LXHA 3BKTA 5CFOA 4YREA 4KIFA 4CL8A 5CAAA 2HW3A 1NVUQ 3G8TA 1NDHA 4JT9A 4CNQA 1SC1A 1BQNA 4MUYA 1ZDMA 2Y6VA 4J07A 1L6IA 5AW3A 1XTVA 2TYSB 4DL7A 1QJHA 4Z9AA 1NTRA 3GF4A 1UBMS 4EPVA 4PTZA 4C3LA 4DRXA 4LSNA 4YRGA 2DPMA 1JI0A 2H4WB 3BGDA 2LKDA 4QTUB 2DLNA 1QIIA 3FZBA 2COEA 2RG7A 1N5KA 2MJLA 4XDDA 2P6TA 3P9YA 1Y34E 1I2MA 4JI6J 2YQ3A 2QT1A 5J2QB 4A48A 1PR2A 4UASA 4QAQA 2MSTA 2EIHA 1F2HA 3G79A 5CITA 4N7JA 1DBSA 1XQYA 3HJFA 5T7BA 1U5BB 4FW8A 1ZIYA 2HIYA 2R5FA 4RENA 1ZIPA 4ZCKA 1Z5WA 1SM4A 2FJUA 1BC5A 3NJ8A 5A8KA 1YR6A 1FSGA 1UPMB 1F8XA 4F04B 2VTVA 4JBWA 2I99A 2XT9A 5I7WA 3RS4A 1QFYA 1H9AA 3W90A 2BEVA 4BWYA 3IR5A 2CJPA 1KDYA 2XYQA 4M83A 4LR9A 3E53A 1QIJA 1RE1A 3TZHA 2FQ1A 1CHDA 2OC9A 1RCTE 4O2AB 2PMBA 1M34E 3DDSA 4IIVA 3AHGA 1KH1A 4RV5A 2LU1A 5C8ZA 1L7DA 4FDAA 2ZUFA 1TEVA 4C48A 2MYNA 3JY6A 3QEMA 3RAPR 2JIZD 5F8HA 3CCVS 4CTOA 4CKCB 2H9ZA 1SA0B 3O1JC 5HDBB 3PNIA 4CLLA 1ZISA 5L39A 2X1AA 1KKLA 3T1YB 2IS1A 6ADHA 2C4NA 2F67A 2AD9A 1EPUA 1W1UA 2PKQO 3CDWA 3LFUA 4Q4HA 3PYLA 2RRAA 1EXDA 4DS4A 1WF2A 3JVUA 1URRA 1E6LA 4Q82A 1Q11A 1UQTA 3V5NA 2O14A 3CNOA 3FWZA 4UNIA 1X1CA 4H4EA 2DTEA 1G2IA 3QX8A 2GK6A 1QOPB 1QE0A 1INLA 3AU8A 4DJBA 2QOEA 4ISCA 1R9NA 4BE4A 1UEUA 5AE1A 4HWRA 4PIVA 1H2FA 3GP3A 2X3FA 2BBOA 1D07A 3OQMA 3KYIB 3RV3A 4X64B 2O1PA 2FPSA 1CS4A 3QWHA 2MLYA 2PZMA 4UDOA 2CKWA 3IPAA 3IDZA 3OZGA 3UO0A 3DFUA 3INGA 2A18A 1RP1A 4WCDA 3BYZA 4NABA 1I30A 3OZSA 3N86A 1WUTA 3HKDA 2HYIB 1BDBA 3NGTA 1FD8A 1EJBA 2AYGA 3EY4A 1OOEA 3BD6A 2ROPA 2AG6A 4H3KB 2DF8A 2QT0A 2GQQA 3OZCA 1DBWA 2P35A 4R8RA 2DVIA 3BGSA 3R5TA 1U2TA 2D5CA 5KYNA 4EECA 2DBYA 4NATA 5CT8A 2W24A 4K9LA 3D68A 3NORA 1RXWA 1LXCA 4DYVA 2HGLA 4MWZA 1Q78A 1B1CA 4N5NA 1TM4E 3OKPA 4IDQA 1EETB 3KNGA 4IQ4A 1G3RA 1P1KA 1F9EA 1PJRA 1VE6A 3WGGA 3GEMA 1T3TA 2R8YA 4AXIA 2DXEA 2YOGA 2QY9A 1Z74A 5FI5A 3LY8A 4C89A 5HQ3B 2QTAA 1EK5A 5GWXA 3UV6A 4YN3A 2C84A 3NKLA 2YCBA 1IZ9A 3FC9A 2AMYA 3ZWCA 3GEDA 2VYFA 3UKOA 3BRCA 4PRLA 1Y8CA 3PUVA 4R7TA 3G6VA 2IXTA 5ICCA 1PFGA 2AFRA 2MZ1A 3OR1A 5L9NA 4B3XA 4EG3A 4F3NA 3LU1A 2HPAA 1M5HA 1Q6YA 1YQ9A 4O44A 5FOXA 3LXUX 3RLFA 2BV3A 5ARDA 4OAOA 5HILA 4O4LA 4DSAA 4YASA 1WP4A 3L4SO 4ZHQB 2H7XA 2DBZA 1WF3A 2W2LD 4OI4A 1OAOA 2FCAA 2KG1A 1TV6A 3H05A 2LV8A 3IUJA 5IM4F 1G20A 4IX1A 4O4IF 3IBYA 4GFDA 1TW3A 1QB7A 1N75A 3TOVA 3O8QB 4NF2A 2UUWA 2CQBA 3KK2A 4TLCA 3ENZA 4TTJA 3UXMA 5EP1A 1N3IA 2K3KA 3PFWO 3FQKA 1REVA 5FWXB 3HHNB 3A9WA 1JXEA 2CUKA 4OAQA 1DCFA 1YZTA 5BWCA 4AW9A 3IUBA 3UWMA 1A9PA 1E5DA 3DO5A 1RHQB 1X6VA 4CCYA 4JVMA 2XF2A 3M5WA 4I69A 1KQFA 2YWGA 2B99A 3QEJA 1EUQA 4N3BA 3I4CA 3EGDA 4QNNA 1Q95G 2E4VA 3GRYA 3R7WA 3KB2A 3W5BA 2CQDA 1P4AA 1V5GA 3NUZA 4TLBA 1SXIA 1K98A 1BE4A 3CR8A 3HUDA 1MQ9A 3ULHA 3JQDA 4G5YA 5HCIA 2Q2WA 2FNAA 1SXJE 4DR7F 2K7KA 5ICSA 2JJQA 2CQCA 5I9BA 3QMVA 4A6PA 5EWFA 3U26A 2WIAA 4RW8A 1IVZA 4F6CA 5K8NA 3W79A 4NV3A 2R8OA 1X8DA 4JKYA 5ETPA 3JSXA 3LIPA 5I9LA 4H3SA 3FBWA 4J3FA 2Q5JA 2J6UA 3WOHA 5EHNA 4O4LF 4Z1MA 4B44A 5BYAA 2JL1A 3G2HA 1T11A 3TQFA 1U2EA 3WHPA 5EMMA 1RI2A 3K5PA 5JNUA 4X66J 4BN0A 3IOEA 3T5LA 4YALA 5L7YA 2O6HA 4N7MA 4AJ4A 5DK6A 3AF5A 4US1R 2WAQD 3EWGA 3K0CC 1GTSA 3U4QB 2Q43A 1WXEA 2VJMA 4PX5A 4D41A 3FGNA 1Z3IX 1T9WA 2HQCA 4LFCF 1XFDA 1RTJB 3FTCA 4DLTA 5EWEA 3FNGA 3JSRA 5I48A 3KJVB 2A5LA 4BMPB 1UL3A 3W1YC 1KDOA 5KEIA 2OAP1 3V1YA 1V4VA 1XQIA 1JNYA 2XKAA 2XYPB 5M2RA 4REOA 3PJ9A 3VCDA 2NZXA 4GKBA 4UHHA 1MIOA 4B3BA 1HDEA 4QFCA 5EZSA 3DWIA 4MRAA 1W96A 1ZVMA 1R6AA 5C8DA 3Q11A 2IPMA 5D6GA 4Y6PA 1Y4ZB 4NECA 3H13A 2V2ZA 3Q12A 5IC4B 1H5NA 3MCNA 4F2SA 4J2HA 1PTJA 4P92A 2VDLB 5KU7A 4ER8A 1T0JB 4XFKA 3D3WA 2C0QA 4DMUB 2IQIA 2C2MB 4ZAYA 1JVNA 1EGHA 5FAKA 5CYMA 3H5WA 3KJFA 1E5XA 1NU4A 1UWKA 1SXJD 1DTQA 2YMMA 3NU1A 3N53A 2Q1LA 1I9CA 3N6NA 3PGJA 3KLHB 5IEJA 2A2DA 4UHBA 4LJSA 3VVMA 2OPSA 4YHBA 4MGYR 1TRHA 1IR1A 4WW0A 5I51A 3D7SB 3AGQA 3NUQA 4JXXA 2I5JB 2MSEB 4FBLA 4NLRA 4K9RA 3UH0A 3QJLA 1LTQA 7AT1B 2JFPA 1BU8A 2I8CA 3FFIA 2AOTB 4A4JA 4CZ2A 3G8DA 3WNQA 2UP1A 2OIHA 2HWUA 4MUGA 4X66B 1TEZA 3O73A 4G4SO 4QEKA 4EYSA 1X94A 1R00A 3B1WA 3FWKA 3CLTD 3VOAA 2E9ZA 1U7ZA 1GZSA 4F38A 3SMZA 1ES9A 4IZHA 1U9ZA 4EUFA 1PSZA 3JQPA 3NC0C 1IQ0A 3E9NA 4XM2A 1F3OA 4AYTA 4AJJA 3ZTRA 4F45A 2EFCB 2DGXA 1R6YA 2GZ1A 4Q4JB 2SKEA 1SXJC 4A92A 2FMHA 3DVRX 1HNXF 2B3TB 1U0TA 4H1TA 1M8JA 4JL6A 5TQ2B 4O0NA 4WMLA 4RJLA 2EQAA 1SCJB 2VJKA 3LA8A 1UVNA 2L82A 1B8PA 5C42A 2QLMA 3L0OA 2BUCA 4AVYA 3HABA 2O4UX 1TEXA 2FPGB 2IZ1A 3AVOA 1KI7A 1Y1TA 1ZNQO 2XNDD 3ZHVA 1D7AA 4LXGA 1UP7A 1FU8A 4Q4DA 3H84A 3PZPA 1IN5A 4DR1J 4MR9B 3QY0A 2I03A 2CE2X 2W2MA 3KQHA 1NQXA 4OUDA 1IQZA 2J45A 2BFFB 3QPAA 1J22A 5A5DA 1JJVA 2RJZA 4Y2HA 3IA0A 4NC9A 1HWYA 1KDTA 5TPZA 2OKCA 4W5QA 1E7MA 2VBYA 5IDVA 2JIBA 2XW6A 3TTSA 5L3VA 2OD9A 3NC4A 3KLEB 2V98A 2V9ZA 4WKYA 4OBEA 3PDJA 2ZJ8A 2DHRA 1EX8A 2VBCA 3N2IA 1K0FA 1JEYA 2O5CA 5D5HA 1A9OA 4LNUB 5I3ZA 4P33A 1A9RA 3OPXA 1HQYE 1NQUA 2A8YA 1US8A 3AB8A 4DCNA 5IBCA 4WK1A 2KI2A 3QBEA 4EG1A 3I9LA 1JPUA 5EKXA 3RYIA 2IDJA 5LIRA 4URFA 4RA9A 4ZI3A 4KSEB 3ZNQA 2BKXA 1CUJA 3UOGA 1F2GA 4B74A 1XK7A 5DZ7A 4I50A 3HUEA 2I33A 1TW2A 3OT1B 3K09C 1ZN8A 2ZBGA 3MEGB 3H6HA 3DT6A 1EUDB 4FLFA 3IUQA 3U61B 4OUKX 3OVSA 3QYFA 5G40A 3GX1A 3CH6A 3PO4A 2AIRB 4JHXA 4ZCMA 1VJGA 1SJ9A 3CLTC 1HH4A 4BDTA 4PYMA 4PYDA 3E6AA 3V2UC 4PZAA 3ZU2A 3QXCA 1JX4A 3PK0A 2GEJA 3E9YA 2FPPA 4AICA 2GRUA 2VJOA 3CUSA 5E8JA 2DR2A 2L9NA 3CNQS 4KB5A 1M8PA 2B8PA 1MORA 3VU9B 2XRYA 5A4IS 5AW2A 4FS8A 4Y1GA 3WWCA 2VKTA 1KY4A 3WL4A 3QOFA 3DMTC 3TXXA 3D2BA 3MD9A 3L41A 4ANFA 1W5TA 3HA2A 3PQ5A 1FFWA 3A6LA 3OH8A 1E2UA 1FXWF 3G2OA 1PDWA 2QM3A 3H8VA 4GBMA 1U09A 1M2NA 1UJ6A 2LUOA 5B64A 1KDRA 2VAPA 5CFNA 3N2YA 4RFSA 1NURA 4US0R 2WAYA 3GNSA 1MW9X 2ONKA 1JLLA 4B09A 2WU0A 3BXXA 4FSDA 4YUYA 2O2IA 5JCZA 1JQKA 1L5SA 4MVJH 4TY9A 4U02A 3ZY6A 1ZC4A 4JQSA 2D13A 3GVPA 3AVTA 3ET6A 3UW1A 3PPYA 1VYAA 4X4PA 4I19A 4V2UA 3ETCA 4JB3A 4ZI2A 4YB1P 2RK3A 1OZHA 3ZE8A 4A47A 1Y3CE 3LC1O 1KAEA 5BSKA 1JDUA 4TMTA 1XXHA 1N5RA 5HVFA 3ILXA 1SOMA 1AY0A 4KWHA 1X9IA 3STHA 1NN3A 2CDQA 2HZVA 3UJNA 4N76A 4KDEA 1SU7A 4Z8XA 4DILA 4HS4A 1S1WB 5A8WA 5IT0A 1IG0A 5LMCA 3JASB 3P5TL 5HVNA 2R7MA 3HNOA 3DMPA 4J3JA 3NHZA 4B3GA 2SCUA 2R4TA 2H16A 4JLDA 2MSSA 2QUAA 5E8RA 3V6JA 2LCQA 3LDGA 4EFMA 1X1DA 3FEXB 3P9ZA 2OUIA 4B3SJ 3FVYA 2BE7A 5K45A 3HDQA 3CNHA 2WONB 1YC5A 4EARA 3SKVA 3U7EB 3OR1B 5JD6A 1CFJA 1N36F 3RSHA 3FBTA 3C43A 4HRYA 2Z5FA 4D26A 1THMA 3TSOA 1JHXA 4E2XA 1MOZA 4Q16A 4TYBA 2H2GA 1X4BA 1TVMA 2Y1GA 4C8MA 1F4VA 2IEZA 1NDLA 3FCAA 2FUNB 4FFRA 1TO2E 4IO9Q 4RQAA 4NEYA 4P3PA 3OHPA 3TVTA 1N9GB 3R7FA 3PQ3A 3AA8A 1T5OA 4PLZA 1Q2XA 3VNVA 1L5LA 1DCTA 4EMUA 4WE3A 3TWZA 1G8KA 3ONWA 1LK7A 2X41A 4TYNA 4WFKA 4B3MJ 1UINA 4IIBA 2QDKA 2DBBA 3M6UA 5JCOA 1KLMB 1LWFB 2GVZA 5J2UB 1XQWA 4BEVA 2JGFA 4PEOA 4GBJA 2BDUA 4QDXA 1U0GA 4MEJA 4L5CA 2BQRA 5KFJA 3HHKA 1I51A 3L02A 4YY3B 1I51B 1CQWA 1IC6A 3KEOA 2BMVA 2DWQA 4BB6A 4DR6B 3T1TA 5ITZB 3CZMA 3NNSA 4R2IA 4AQ7A 1O97D 2PLNA 4HQLA 1NT2A 3LVBA 2QSFA 5THWA 2NX2A 4J4BA 4ACBA 4RK7A 4R8UB 3GCWP 3BS9A 1Z29A 3E9MA 3WMWA 1JJAA 3VPXA 1RYBA 4PX3A 4Q1DA 1IBLB 1BOFA 1W2IA 1NPKA 3UMJA 2Z1DA 1VBYA 3F7OA 1C3OB 3FVTA 1HBUA 4WGFA 1GMWD 3GJ3A 4MYDA 3I01M 1NSQA 4EJ0A 2R0QC 4PU0A 2OFPA 3B89A 1ZQ1A 4RHCA 5CBKA 1R2QA 4Q93A 1BQMA 2YJNA 2JCVA 1PU2A 4B71A 3QMQA 3LP0B 4S1VA 1EAMA 3U1NA 3RF7A 1BMTA 4LISA 3P3DA 4O8ZA 3QPIA 1MXFA 1KD1T 1RKXA 4NJEA 1W35A 2XXBA 1L4NA 3D0OA 4CLEA 4B6JA 2BFBA 2HPVA 5LOVA 2ZKIA 3ZXXA 1SPBP 4YP3A 5JD3A 5DNCA 1S3IA 2J0UA 4ZC8A 4F92B 4Q3LA 4YRJA 4QWAA 4RDIA 1DVRA 2R8XA 4FB5A 2VBZA 1NM5C 4DLVA 1GMVA 1VLZA 4UCWA 3GCGA 3CZAA 3BXGA 3RG2A 3MMBB 3UMBA 2NU9B 3BGOP 3ZWYA 4EHLA 2MZJA 1I6WA 2QP9X 3L7IA 2AOUB 1Q5YA 5FA6A 4YV7A 1T4DA 5K2MA 3CDAA 4RYDA 1D9XA 4D8YA 3AJAA 1ZGHA 1RLTA 3WLQA 4JT2A 2P3SA 5G4DA 3IAUA 4QBHA 1APSA 2NPOA 3THWB 4BC0A 4HHUA 4H4OB 2OK8A 4R8SA 1CJTC 2RGGA 2C00A 2HNZB 3MI7X 3GB0A 4O6VA 3MPWA 2JC1A 1MO5A 1LVGA 1PX0A 2D5AA 4DPMA 2LIVA 3JU3A 2KG0A 1YVFA 1YL6A 1Z33A 1NLKL 3KOMA 4C7VA 5HI7A 4IFBA 4N0QA 1EHWA 4HF7A 5HIMA 5KG7A 2FEMA 4L1KA 4L74A 3I9V9 4KBYA 3GRPA 1PR3A 3AM4A 4IXMA 4M87A 1J23A 4Y98A 3TUPA 2PFGA 5KWSA 1QM9A 4GF5A 5FOUA 1VPDA 4A5SA 3M5DA 5KVAA 1X14A 1G42A 2XD9A 3M3PA 5IAGA 3I9ZA 4M6WA 3UFXA 4RACA 3KK1B 1PEKE 2OOSA 2PFFB 4S05A 5F8NA 1HE4A 2HA4A 1M1GA 2ZUWA 2RBGA 1ZH8A 2VLBA 3DYAA 3JQ9A 3T7EA 3ROQA 2X1MA 3L0PA 5TQ0A 4HEJA 4CF4A 1FQWA 3MM5A 2BMBA 3H04A 3R8CA 1XGKA 1QVZA 5AOVA 3KLEA 3I8SA 4PGHA 3GJSB 2JZOA 3GY0A 2QQ0A 2AOUA 4IYJA 5G0UA 3U3RA 1S1TA 2YMQA 4JL5A 3VH1A 1SCIA 2O4CA 3DXFA 2XITA 1EIYB 1NOJA 4NI2B 2OEPA 5EHIA 2MSLA 5A3SA 4UAVA 2QUJA 2O0KA 3H2ZA 4YFYA 4NLVA 4RNCA 4I1IA 3CPHA 2DNOA 1R6XA 3FE2A 5IJXA 2LEAA 3GDGA 2HA0A 5M2UA 1HSZA 1TF7A 3WHKA 2JAWA 1Q1ZA 2FR8A 1N6RA 2X0FA 3DRRA 1B93A 1Q77A 5J2NA 1V47A 4I6YA 5LZ5A 2FA9A 3ABIA 1UPFA 1H69A 2QS9A 1VKZA 3VR2D 3J81U 1R64A 2LQ9A 3E7DA 4D44A 3IAM9 4G41A 1ECPA 2RNEA 4FD3A 2PBFA 5AKGA 1KZ9A 1E2JA 5EA2A 2DY9A 4OB6A 2J5XA 1UMCB 1E8MA 3KU1A 3Q8SB 1XDSA 1JFRA 4HN2A 3C16B 2RHOA 4CDRA 1N7HA 2VF7A 2NVBA 4X62F 3L7UA 4W6ZA 1WWHA 4J49A 2R751 1PZXA 2NLWA 5EJEA 2YZKA 4MJXA 5T14A 2UV8G 4Z0HO 1ECJA 1Z9BA 2G7ZA 1NHWA 2IXDA 2YUTA 3ZFVA 4KXMA 4UM5A 2ZE2A 1OGJA 3KR9A 3CIZA 2BGRA 4R8UA 3AR8A 4MYRA 5ENZA 3ZQ6A 4LOHA 2WMYA 5AVWA 3ZVRA 3Q9UA 2BGNA 2DR3A 4ZOBA 1GDHA 2O3TA 4E98A 1N2BA 5EGNA 1A4IA 1QTQA 4CEJB 3VZPA 4P4LA 4RR5A 2AOTA 1TL7B 3UYKA 2YL2A 2XBPA 3HO6A 5DT9A 1B2RA 3O4IA 3C24A 2JCGA 4AM8A 3HSGA 3QOYA 3NDPA 2I2FA 1DEKA 3O26A 3GFBA 4QWDA 4TRNA 2BJ9A 3PI7A 3OQ6A 5E9WA 3THPA 2VDQB 3TANA 1ARZA 1VE5A 4BV3A 3NAMA 1E4OA 2EYUA 4P5PA 1F8YA 1UAAA 1ETUA 2R5WA 2V3CC 5KTMA 2HRZA 1AT1A 2CJFA 4GWKA 3QLVC 5AT1B 4GVLA 4MPPA 4V02A 3HSJA 5AJTA 1JLFA 5FHRA 1HMVB 4WTOA 2RGWA 4LRXA 3EVZA 4DV7J 4NLSA 2NNLD 1RYSA 2RKIA 3R77A 2PTHA 4MUXA 5FJIA 3VVBA 2QUIA 1CS4B 2G1KA 4F4AA 1C4OA 4PZUA 5DCUA 1SVDA 1Y8RB 3PHEA 3A8KA 3VQSA 3KK3A 1RAHA 3FVQA 4AKSA 3SBEA 3LVQE 1UM9B 5ALJA 3AIIA 3KR2A 5HUJA 3LWBA 1BJTA 4BASA 4DV3F 1G4HA 4PF1A 1YWXA 2AUTA 1GJRA 4BGDA 4OJGA 4O4RA 3UHOA 3TRDA 3DZCA 3AL0C 1P9LA 2R85A 3WWZA 1QM5A 1SBTA 1M5RA 3U80A 3TZLA 3TGLA 3JASA 3LBAA 3EIWA 4C06A 3OA0A 3PUYA 3BB1A 4N03A 3DI6A 1N1EA 2ZTHA 3OHMA 1RTIA 1MQ8B 2IDEA 1CP3A 1XMVA 4FQ8A 3WISA 2E55A 2WLSA 2UXBJ 2XYPA 2ZZNA 3PZBA 1F0NA 2I22A 3EG9B 3ZVLA 4PG6A 1JLHA 1G8AA 2ZPTX 3W0LB 3DLAA 4FT4A 4KMOA 4UTGA 1UFWA 2ZDPA 3WK5A 4ZDKA 3B6JA 4IV0A 2XQCA 2C88A 1KO4A 2NU6B 4RS4A 3T7SA 2CHVA 3CIFA 3LC7O 1U0EA 4X65F 4Y2CA 5BJRA 3EXEA 2FN8A 4MDHA 4ID8A 2C4HA 4LX0A 1BA3A 3HH8A 2PZEA 4ZAXA 4PZZA 2GGPB 3PFEA 4QDJA 3ZHXA 4U7CA 1SU8A 3GWCA 5CB4B 1NEEA 3INYA 3BWDD 3N05A 2GEDA 4ZMMA 1KYXA 4DEYA 1BGXT 2R1TB 2QLXA 3PEFA 3PVCA 4UUQA 4Q9JA 4K40A 2I6UA 4INJA 1V41E 3WBKA 3CS3A 4LRQA 3K0CA 3TW0A 2YWCA 3RJ9A 4Y6GB 1H4VB 2F8LA 2GAIA 4DWJA 4WXYB 1OX4A 2DGSA 2CD7A 3EGEA 2JEZA 1NFFA 2FHSA 4GVBB 1R9MA 3V5RA 4GIBA 2HHUA 3BXFA 4DADA 4OV6B 3C4VA 5AXAA 2H4WA 4NZ9A 2EBGA 1DC4A 3DDIA 3CTPA 4RVFA 1M66A 1ZOOA 1KC3A 3D8HA 4FDMA 3K89A 1JLCB 1V25A 4NX9A 5KMGA 1DUVG 2BHLA 2VK2A 2OOKA 4KKVA 2KWIA 3ZI4A 4X62B 4NU8X 3TWOA 1X1SA 2HEKA 4IMRA 3KJXA 3MECA 2A0UA 3HLUA 2VF2A 2QAGB 2YJ4A 4WJLA 2YWBA 4QUBA 1E3DA 5CA5A 4L0QA 4ARZA 3LCRA 3V4RA 3MWFA 3EC1A 1HI0P 1SO8A 4H6XA 3PYFA 2RGNA 4FYWB 1UJ5A 2BI8A 4A16A 4KH1B 3RC2A 4MDEA 1PS9A 3RAMA 2E5HA 2UUBB 4HLUA 1IKYB 3HLYA 2XDAA 2DPIA 2GZOA 2NZVG 4F84A 5C3UA 4QYIB 3RH0A 2Q0QA 2FN3A 4HYYA 3FMGA 3VISA 4DUGD 2V8OA 3D2LA 2G1PA 3TA0A 3MWEA 1VSTA 1S6YA 2EBFX 4BVEA 1OYOA 5DTMA 3FQLA 2HEIA 1RTDA 4WBFA 2DGQA 1NH8A 1BHQ1 1ONSA 4ZZ2A 2OMLA 1FA9A 3FOZA 5E3RA 2B8WA 4JJ7A 5F33A 2F9LA 3PXGa 2O8DB 4K28A 5JVDA 5IUJC 2ZE6A 3IT2A 3VYUB 1EESA 4IHJB 3DLGA 2GMHA 3ZTWA 2O54A 4XYMA 5IAEA 3NG8A 1Z37A 1FTNA 4DCJB 4UVHA 3ESYA 4MINA 4R05A 3DEZA 1IDOA 4IDFA 2XMWA 4ANEA 4KXQA 3BN7A 3FN4A 2Q9UA 1T7PA 2RHGB 4DJFC 4CEHA 2IBSA 1SXJA 1GDTA 1HPZB 3KKEA 3KOWA 1AHHA 3JPWA 3Q6IA 2O8BA 1KQGB 2D69A 1IBSA 2AZDA 3K0BA 3K35A 4BJ3A 2A92A 1NJIT 1GPLA 1FZTA 2ZETA 1IXZA 3W78A 4F2RA 1OFUA 4RL4A 1CE8B 3P2MA 5J4HA 4WLUA 3QQPA 2J30A 1GPUA 2Z30A 5WRFA 1VL6A 3HSYA 1C2TA 3RRXA 5I01A 4AJ9A 4ERNA 1RQNA 3OQ1A 5D8HB 1RSCA 1P8AA 3MINA 3TYXA 1V7QA 4E3WA 5C25A 3WA6A 3OQJA 3F6RA 3OWOA 4JBIA 1C2YA 1PD1A 4O0IA 4IKAA 1FX1A 3CNQP 3FMFA 4NMHA 2HHHJ 3FJ1A 3ND7A 3K7EA 4TXSA 2AJTA 3GFGA 2Z2LA 4I4CA 4RSHA 2O6LA 4ES2A 2FPKA 5DLDA 1FQKA 4ES1A 1ODLA 3EB9A 1XE3A 2BABA 3G82B 2OPRA 3JARB 3AQ4A 1UK6A 4TV8B 4BVFA 1U2CA 2CQ0A 4DMLA 2KXFA 1TK5A 2EGGA 3LQQA 1P75A 2YZ7A 5ALZA 3BXPA 3MPVA 3OLWA 1DTTA 4QYZK 2FUG1 2BANB 2J9FB 3NHPA 3HE3A 3OZFA 2IAJA 2D41A 3OSZA 2V03A 3OEWA 1KH2A 1OU0A 4J0GA 4G84A 1RUSA 3EMKA 1IVSA 2H65B 1T9GS 5CA0F 3DVAB 2IVFA 4F4IA 3D5EA 3ECCA 5DWDA 2FWPA 4R1MA 3MSXA 4CG2A 4JJ8A 2WQ7A 4R71A 1MHTA 1ZZEA 1SEPA 1KWKA 2XNJA 4USVA 1U8EA 1WXXA 1MHPA 4I4TB 3KU4A 1KZ6A 1YJRA 2A9QA 1RS0A 1NVVR 4NCHA 2WU8A 5JNLA 4TY8A 4QVKA 3HX9A 1RMTA 1XDZA 2OD6A 4UQTA 1MENA 5AM2A 3NJRA 2ZBRA 1Q7EA 2XHZA 4LXQA 3VBCA 1T13A 2OCIA 3ZHOA 1XTJA 2L42A 1JLBA 1C9KA 4M46A 4W1PA 2ZC3A 2ID4A 3LKVA 1T34A 3G6XA 2BKVA 2N3OA 2I7VA 1FDAA 4XYLA 2IH4A 3M8WA 3P20A 3QSYB 1LXJA 4OJNA 2HMSA 3D1HA 5CB8A 2FN7A 5EX0A 3GFYA 3U7GA 3P2IA 1NKCA 1F14A 1SC1B 1E61A 5B6IA 2E5FA 3LS2A 3PV8A 4JY7A 1MB9A 5HR5A 1PL7A 4LHVA 1RQRA 1T8SA 1ZU4A 3K0EA 1S01A 4PC3A 1VGYA 3KQLA 2D2VA 4HI0E 1G6HA 4IGKA 5I7AA 2R68A 4ZYZA 4IIHA 2XCLA 2VA3A 3R9LA 2X86A 3AETA 1K6JA 2X8BA 4ZHRB 4M95A 2GM9A 2M9MA 1GXUA 3DLPX 4KXUA 2EHJA 4DR1F 5AHXA 2Y1RI 1VXOA 1POWA 2CMKA 4CKYA 1WUUA 2VPIA 1MWQA 4NFLA 4WT7A 4MWDA 2VQ3A 2HA3A 1X7DA 4CLRA 4CTMA 2BKPA 2Z58B 1HE8B 2ZRPA 3PDUA 1JVBA 2ZR0A 2L9DA 2OQVA 4GOOD 3FDIA 2GFFA 3QIDA 2IDMA 1RT2A 5BPHA 1CUGA 4BDSA 3ZDEA 1LJUA 1FDWA 1P6UA 3CJ5A 1AKVA 2MWMA 3JATA 2HHLA 3RHZA 1RPAA 2E44A 3BK1A 1VDMA 3MM6B 4DBQA 4C88A 1HDCA 5BV8A 3O93A 4IG0A 4CM4B 3D4BA 1AQLA 5HZKA 1LV5A 4AKGA 1WACA 1FYXA 1A82A 2PGCA 1IXYA 1PD0A 4AIIA 2XZLA 3C7AA 2KI5A 4LGYA 5FBWB 1MC1A 1S1TB 4FI3F 4MA0A 1OBOA 1EFKA 1R8PA 2H7YA 5DCLA 2EGHA 4OQNA 1V37A 3PYGA 2QN6B 1SPBS 4OHBA 3DHVA 4WFYA 3EARA 3JSMA 2NYVA 1FVOA 5HG0A 1TQHA 3NXSA 4DVJA 3D1VA 2G0JA 2PKRA 1WMEA 2JJYA 3GEPA 2ZVSA 5JFGA 1EZ4A 4CV3A 3R8YA 2B37A 4D98A 1C1CA 4A2WA 4D0LB 2FP3A 2D0PB 1XCGB 3M9MB 3BR9A 3DEJA 2ZSEA 1PKEA 4C8LA 4HVTA 4E5SA 2GF2A 2BE9A 5TMDA 4YJKA 3JQ8B 2VQEF 3AGPA 3LCUA 4MJLA 2VPTA 3STVA 2ZPAA 2R00A 3ZJUA 4ETZA 2QA2A 2Q3DA 1PVOA 3UWOA 2WKWA 3JSYA 3O91A 4WZAE 2IZ0A 1VRTB 4EQZA 2CL5A 2VG7A 3ISZA 3E9DA 4ZPBA 3Q72A 3EX7B 4QPXA 4DIDA 5LQUA 4RSGA 3AM3A 3HSDA 2GT1A 4OFZA 2PR2A 1H73A 2C3MA 2R9VA 4J76A 2PT5A 3AOEC 3L7KA 4CEIB 1WOYA 4DG5A 4INZA 4RQUA 5GONF 3KL2A 3RUAA 2ZG6A 5BNZA 1R0RE 5T4EA 3IMCA 1GITA 4LBWA 1AUXA 3E7FA 2WOOA 4TSFD 4GOMD 5JSFA 1QY7A 4HL9A 5L46A 5F2KA 4TV9F 2ZNZA 1M6HA 1SELA 4TKVA 3AG6A 4K4XA 4BNNA 4IFEA 5LWHA 1G7SA 1LNZA 3DWFA 1DAEA 1KOFA 1YDFA 1R6UA 2NG1A 1KYZA 2F1HA 2HQBA 3WBJA 2Q1UA 1NUAA 1HFKA 3JQAB 4TRJA 1I7NA 1TMOA 2DEIA 5LUAA 4ZCRA 3UDVA 1RJDA 4UUMA 2GKSA 4RK1A 3POTA 3L7PA 3NNNA 3IS3A 2VNIA 2CVFA 3P9QA 2AK3A 2ZYDA 5FLEX 1ENYA 3V4PB 1CZLA 4QZVB 1OY9A 5D78A 1CWUA 4TV8A 2RD2A 1W1WA 1RQGA 1F4PA 3OR2B 4KFUA 1IZ0A 2J59A 5FA5A 4M86A 1EVLA 1A7GE 1SKBA 2BM8A 3FPFA 1MOPA 1UZAA 3SSOA 2YS6A 4FPRA 3H1FA 3BIWA 3MTEA 3VNSA 2IA5A 2D8AA 1Y4DE 3T5DA 4O0LA 3PGKA 3MLAA 2F9MA 2CBZA 4TS1A 1I4EB 4JGBA 2HEGA 2GUGA 3AHHA 4ZC1A 2UUOA 3I5XA 4GO7X 2JD0A 1CEQA 2ILTA 2CNWD 3LP6A 3ZC4A 2JA1A 4D6YA 3IYLW 3IVMA 4CYMA 3O5AA 1E2LA 5GMDA 1E3WA 2HFUA 2O2GA 2QGFA 4E46A 2P1RA 3G0HA 4U8HA 4NULA 3BV8A 2NTEA 4FGZA 4B80A 3PFFA 1LI4A 2JRLA 2HBYB 1DTTB 3VVTA 1A7UA 2Q29A 4JI7F 1IQRA 3TVKA 4NZZA 1N77A 1X9HA 4ZZIA 4R0JA 2KJQA 2W2LA 1U6ZA 3M8QB 3K96A 4KXLA 2JFXA 3RIXA 3HJGA 3VH4A 4F3KA 5M29A 1N0UA 2W9CB 3QEAZ 4CN9A 3Q85A 4L50A 4L8FA 2HHHF 2DUNA 4JI5J 1HNXB 2ZSKA 1RZRD 3D7LA 3RFCA 2Q07A 2NUAB 4C2MA 3OLAA 4I3HA 5BOVA 4XCQA 3HYSA 3FHCB 4A2CA 2GZHA 3M9LA 2H2WA 5EUCA 2RE1A 1V45E 2VHEA 4A8MP 4W63A 3HJUA 5HTKA 3R27A 3DQZA 2ZCVA 4YEAA 3AI2A 3E61A 4U8YA 3GFTA 5AM5A 4LXYA 4ZPCA 3CCES 1RC8A 2J0XA 5JE8A 2DLCX 3CVXA 4BLTA 1YNSA 2Q99A 4H60A 1Z0UA 1OMSA 2R97A 1QUVA 2VAWA 5FBVB 3KLPX 3L77A 2F48A 4NKRA 3D1LA 1HFEL 2AGVA 4G1EB 4PR3A 4WOCA 2W4CA 1USUA 4BAUA 2PD4A 4RIIA 1LBHA 4B40A 4NG4A 3OX3A 1GZ5A 3DO8A 2FRDC 1ZSYA 2W7PA 4ECSA 5KAMA 4JODA 4GMFA 1HDGO 1Q19A 1SC3A 1UTAA 1NDCA 4OQFA 2QWXA 4DPYA 1BHJA 5KS2A 4YCMA 5A6WA 2P0YA 1KPGA 1R4AA 2C2ZB 3FRYA 1DIRA 1CUFA 1ZVQA 3QE3A 5CH7B 4QM6A 1DDIA 4ZP1A 2IYEA 4ZQHA 4LE0A 1PT5A 2V0GA 5B4TA 1TUBB 1MV8A 3EWAA 3OTWA 1J0BA 1LSSA 4UW9A 4N40A 2ZUDA 3DAGA 4UHKA 1FCAA 4NBWA 5T4FA 3ZV6A 1YRXA 1QO9A 4BX9A 1TCAA 2I87A 1QHIA 4QXPA 2PX4A 2W58A 3T0GA 4B8ZA 1S2OA 5M34A 5E9AA 3C15B 1RM0A 3DYBA 5ECYA 3CSUA 3ETLA 4O2BF 4A0FA 5CZVA 3ETMA 1Z47A 4P7KA 3IXQA 5DI9A 1KDZA 1CY0A 1M6VA 4K0KB 5KX5A 3P6YC 3D8TA 1CW2B 2JJ1D 2YVKA 1DAIA 2YH1A 1CQNA 3C87A 5AIBA 4X85A 3PRBA 3GVHA 2JC3A 2OCAA 2H0RA 3UHJA 2JLGA 1R4NA 1KVTA 1U24A 3UWDA 2ARKA 5IZCC 3B70A 3QXXA 4FCVA 1KL7A 1XN9A 4DN9A 3D3CJ 2C3OA 3CRZA 1T29A 1JDVA 5JQGB 1MXHA 1NPYA 5B1YA 3VR5D 4TV8F 3ZBQA 2OAEA 3FWHA 3DWEX 3AFNA 2P67A 3QNMA 2QW0X 4CRJA 1CY8A 4OX8A 4XAQA 1WQ1R 1EFPB 5CH5A 3DC2A 3RYTC 3LQFA 3W5XA 3BQ1A 1YZ6A 3EFEA 3CF2A 4DQRA 2AIRA 4DSFA 3H0EA 5G3YA 1VI7A 3QSYA 1N32F 3NTLA 1HYBA 4AQYB 3Q5EA 5GV8A 4WRRA 4KQ1A 4DR5B 1ULRA 2H0AA 2RJOA 1T05A 5I6DA 2QJTA 4QC2A 5DEIA 3SQGA 2CLSA 2M2IA 3CE9A 4J43A 4NXMF 1EBFA 4KQEA 3RZAA 3J80A 2IYAA 2XD4A 2C9MA 1XVUA 2IPAB 4M21A 3EXIA 3CXRA 2I7CA 3KG4A 5FI3A 3ZY3A 4QIFA 3A7DA 4MTLA 5MAOA 4ED9A 1X5OA 2ORVA 2WP8J 5C31A 4XE5A 4Y0AA 2XVZA 4QDZA 1XWIA 5FCDA 4PSDA 3SEOA 5I7EA 3ABZA 4OSOA 3DFIA 1ABFA 4LBIA 4K4SA 4LMAA 1DURA 4XW2A 1M1YA 2EW8A 1W2WB 1RIIA 4P6VF 3IQFA 2A9VA 3QZ7A 1EI9A 2OQ2A 4U00A 3AXMA 2WIDA 1NY5A 1JPJA 4JV2A 1VPLA 2IH2A 2VJPA 3H5IA 5HEKA 3DB1A 4RD2A 1B6RA 3EVFA 2ACWA 4KR9A 4CKBB 4F9TA 3GWZA 2C4MA 3MJHA 4Z9YA 1KAHA 1MG5A 2KO1A 4J9OA 1K5PA 3UJBA 3T1AA 2A5GA 2ZWVA 7MHTA 3LL4A 1E99A 1Q3KA 3PR4A 2DVMA 4NCKA 1XA4A 1EU1A 4A7PA 1GILA 1JLGA 3MIZA 3OOYA 2G1UA 3H1AA 3R5SA 2VBWA 1CJCA 4AP9A 1E5VA 1M72A 2Y0BA 1N2SA 2IS6A 3INNA 4MZXA 4ETWA 2ZBCA 3C8MA 5DN6D 4FNMA 4NXMB 1JSXA 4K2HA 4M9QA 4O4IB 1FWPA 1AXRA 2VK4A 3K9GA 1JJHA 1C8BA 3N3BC 5FRDA 1B8UA 4V2IA 3DOMB 4YRZA 2QVXX 4NL5A 3C3XA 1DELA 1RAEA 2F3SA 1RAHB 2FPHX 4JLWA 4NMXA 2ZAYA 4XUGB 1TVKA 3E1GA 4NLTA 1J25A 2AN5A 2MLXA 3W6UA 1O6GA 1I2AA 2RF2B 5CCMA 4HDAA 1ZPDA 5LMUB 1BKYA 3OQNA 5LJIA 1MLAA 5CBPA 5F1KA 1VE9A 1K7EB 3FTDA 2HJHA 3M1YA 1WMDA 3C16A 2N9UA 3NP7A 2B6NA 1FL9A 2CBXA 3TBKA 5CFPA 3MJTA 5KNDA 2VRNA 4IUFA 3HXKA 3BORA 4BC7A 4EL5A 5BORA 1KQGA 2C8VA 4G0WA 4DCSA 3G89A 3A3PA 3OZ7A 2HVHA 2FP4B 2OT3B 1NHKL 2NV2B 3F0TA 3UEOA 5TQJA 2JIQA 5ICEA 3YASA 3HJCA 4AQYJ 1SVSA 5KFWA 2MGZB 2GN6A 4YRAA 2CMDA 3WSTA 2AZMA 2HU7A 4DJEC 1Q5VA 1R5BA 3CRW1 3MGJA 4D0RA 4K2AA 3PWTA 3BK7A 4X60A 2C42A 4J4TA 4UOHA 3VUEA 4QWBA 2R2SA 3CRMA 4IHJA 4URGA 3G0BA 3VSDA 1HL3A 1RT6B 4C3KA 1Z2EA 2FTKE 3D7RA 1L3VA 3OQIA 3W3ZB 3GHYA 1G2OA 5LMNJ 3PNPA 5IWCA 4IUBS 4KZPA 1JXVA 3RCBA 4E88A 2AD1A 3OWHA 4A91A 4BWMA 4RPLA 5HW0A 3CCZA 4F5ZA 2D1TA 4EU0A 4CXMA 4Z2XA 3NBQA 1J33A 3C5VA 3CUWA 3H2LA 3AO0B 1UETA 3OQPA 1TVEA 3FOWA 3W2WB 2H6EA 4ECVA 1IBLF 1M7HA 2DTDA 3WX8A 4B9LA 5EXTA 5J47A 1E1RD 5EHHA 3ASZA 5FWYA 1I2BA 3AP2A 1Z1ZA 3TZEA 5TJHA 2O8NA 5AJYA 1SJRA 1MA0A 3LX5A 1SL2A 4Y2YA 1CJUB 1KJQA 5HQTA 3ET6B 3IDOA 1Y0HA 4YT8A 5C53B 2RKWA 4BMXA 3OIVA 4Y2JA 1YSJA 2NXWA 3OD5A 4PWDA 3L0ZA 4LIPD 3EGWA 4OGGA 2B43A 2Z4RA 3D6NB 3WYCA 4XUEA 3LCMA 3FDXA 5FUVA 4TQSA 1U0JA 2I6TA 4YRCA 1WDKA 1FDIA 2DT8A 2CCKA 4FF3A 4RKEA 5JNWA 5CLFA 4HTIA 3T35A 1E1CA 1QHYA 4D4LA 2X9VA 1Q57A 4N9QA 2P7HA 3MPUA 1PZNA 1HNZB 1OPRA 4RDXA 4RS3A 1RSZA 4HUQB 4AG5A 2FN9A 3IKLA 4IOBA 1A50B 5GAEI 2CVQA 2QMEA 2VJYA 4C6TA 1NUQA 4ZHRA 1DP4A 4NZ7A 1H2RS 1KHHA 2XJ9A 10MHA 4B3RB 3THWA 4EY3A 1KDPA 1TKRA 3LYHA 2QT7A 2G2YA 4EB0A 3OJLA 3AR4A 1CETA 3LHFA 3ETDA 1R6VA 1TU0A 4QRIA 1F2UA 4LRUA 1JWLA 4L28A 3BKFA 2MEWA 3TJAA 1D1SA 3PC2A 3R6WA 4QKQA 1QZTA 2MZSA 1ZESA 2B4AA 1XKTA 1Z8HA 4QXMA 4J16A 3LYUA 4M1KA 4M36A 2NMVA 2HLDD 3OSPA 2J5QA 3WBZA 2HDWA 3RAFC 1QAXA 3CUKA 4O23A 4YUZA 5LVAA 3JAMA 3A37A 5IBRA 3C0KA 1Z0DA 2LDYA 4GOND 1VHDA 2M0GB 4Z1MD 4ICIA 5L8VA 3B2QA 4ZI7F 2ZIGA 5B30A 3FD8A 2WYWA 2Q27A 3SJ7A 1PDVA 3ZD8A 3EAGA 4OGWA 5FWXA 1DFHA 3LF2A 1NKVA 1HNNA 4AULA 3ID6C 1XD2A 1GRVA 2BFEB 3KV1A 4BZXA 4OYXA 5C1BA 4TT3A 2YR0A 1O77A 121PA 5IAKA 3QFHA 1P9YA 2PRYA 2QVGA 5B3AA 4PM4A 2C59A 1L3KA 2ACEA 2GIFA 1ODCA 4WBSA 4AL6A 1NMXA 2E1CA 3LW7A 1GMUA 2FOLA 1GQSA 2ZHBA 1I6LA 5TY0A 2ZJ7A 1LX7A 3VKHA 2X13A 3E1SA 3RGIA 1HQUA 4OJ1A 3Q5DA 4X4QA 1VIXA 4LIWA 1GTL1 1HMPA 3KE9A 2NYIA 3FCSB 4AFFA 1S9FA 1NPTO 4IOLA 3VHQA 3ED1A 2EC2A 3KZOA 3EN0A 4NASA 3UFCX 5GIOE 3GCXP 2DULA 4XVHA 3KK3B 1C9MA 4GWLA 1XRMA 2G3YA 3NG1A 6REQB 2OG1A 4E30A 1EK0A 1A7AA 4PCQA 1M2VA 4R8MA 1W94A 3RJZA 1YJQA 5EHZA 1P3DA 4P36A 1AVTA 2ATCA 4JV5B 1P5JA 1N6PA 2YC4C 1QE3A 1S76D 2MT9A 4HGPA 3W2HA 2OB1A 1RDRA 3LRTA 3IPCA 4E2YA 2EATA 2OAQ1 2GOYA 5DBEX 3LT4A 1CSJA 1SQFA 2WDZA 1LDBA 3H2UB 3GLHB 3DOHA 2PRJA 3BZWA 5BXYA 4PYKA 2YC2C 4I6GA 2PV0A 2P9FA 1XRLA 5GINE 5DN6A 3HVAA 2FN4A 4NE9A 1C3OA 3ZTPA 1Z13A 1JJ2R 1Q1BA 5EXPA 4LMRA 1R6TA 1WX1A 5HMWA 4NOHA 4GC5A 4M0MA 2AFIE 1SL1A 4UM9B 4CEJA 1SCAA 1QK3A 4HDMB 4A8JB 4L78A 4C7QA 1UR5A 4YFVA 5HMLA 2WJWA 2HQOA 3C41J 3QJ5A 1TADA 2ZJ1A 2W42A 1RWXA 5LQMA 3DE4X 4Q1VA 2XCSB 2PSHA 3JALB 4QXOA 3TTVA 1T9GR 3CH4B 4ZQCB 2VYNA 2OPQB 3L5KA 1IONA 4URUR 3EISA 1QRDA 1P2FA 1EFRD 1PQPA 3DJFA 3HACA 3IUMA 3M6AA 3ZTYA 2P9ZA 3FTFA 4C8KA 4KR0B 4BNGA 1YMVA 1FUYB 3N0WA 2GQ0A 2OECA 2ODQA 3MXHP 3KHTA 3EPKA 4NOKA 2OCBA 3B5EA 2IWHA 1DKRA 4CO2A 2ZROA 4JZYA 5KYKA 2PXHA 3T4EA 2OM2A 4UTVA 4EBFA 5KG2A 2IYTA 3MJDA 1GNQA 5KNCH 1XEWY 4EI7A 4RKFA 2EKQA 2RGDA 2OZLA 1P1TA 1SVKA 4K46A 4H3HB 2WUEA 3SYTA 1E5TA 3UA3A 2JI8A 4I14A 4PC2A 5AOAA 2OLJA 1IM2A 3KAPA 4WVLA 3S29A 4OP2A 5A0FA 4J7UA 5IP5A 4Q3CA 4WIIA 5IMBA 3KS9A 1XAHA 4UFPA 4C0JA 2ZJ3A 3CJ3A 2WB4A 4KDRA 1XZNA 3SYRA 4WXMA 2D2IA 4OYOA 1YI1A 4FOSA 8MHTA 3EODA 4R84A 1XMIA 4XWGA 2V5UA 4YV2A 3DKDA 1NVBA 2OXRA 4FYHA 4G25A 3IUSA 4OYZA 1G6Q1 5HMZA 2WSYB 1SKSA 2RHBA 3L7MA 1O3YA 4U63A 4U9RA 4IWNA 2W7TA 3ILJA 1HNWJ 3TX2A 4YMSA 3K9QO 4ROTA 3M9NB 1Y3HA 1EFHA 1VIMA 1QOZA 2PKWA 4DLLA 2QD1A 5B6JA 1X19A 3R76A 4ZVHA 2CK3D 2IYRA 3L5OA 3TRJA 2AYMA 3GIDA 3TUJC 4A36A 2C54A 3M6VA 1JEQA 5DSZA 3BRQA 2BOVA 1S9GB 3MS4A 4JYCA 1QCDA 4W7SA 3NWPA 1QFZA 5AK0A 2JGMA 2IYVA 4ZVPA 2HWXA 4RGBA 3LPMA 3BAFA 4MLPA 3J81j 1UUFA 2Y8YA 3VR4H 4XWKA 5D7BA 2A1UA 4FP9A 1DTSA 4UEJA 3ZDBA 1EQMA 1H2EA 1C7EA 1VJDA 1C1DB 2P6PA 4KXNA 1WF0A 1TTQB 1DBIA 4XIYA 3G9TA 5I5GA 4RABA 5JQGA 1XZBA 4C6TB 3RQIA 3QVGB 3HPRA 4F0HA 4MUNA 4BYMA 1T5BA 2GLTA 4TMWA 1TYDE 1DV2A 1Y9AA 5JPIA 5DLGA 2HNZA 4LNAA 1N36B 1OIAA 1LDMA 5C24A 4R7ZA 2RH8A 1JL3A 3HA3A 5K0CA 1ZK2A 4QQRA 2H9IA 4CCYB 3TFOA 4DWIA 3FMOB 4JV5F 2XUDA 5K6TA 3DRSB 5EWMA 2YRFA 1X9WA 5K3EA 4IS2A 1HEYA 5JJKA 3WNVA 1IB0A 2BFBB 5GMOA 3BILA 4WZBE 2AQHA 2R1ZA 2RH9B 1JI3A 2IY5B 5K14B 1CZRA 5LC1A 1AGPA 1FRJA 2UZ1A 3GQBB 3BTVA 3OEHA 4JWKA 1XB2A 2ETVA 4F4DA 2LCIA 4H7KA 4CWAA 1S48A 1QIEA 4KXWA 1OV6A 1S9HA 4KLRA 3DKIA 2VC2B 3IH5A 2AD5A 2NPFA 2RJNA 3QE9Y 4MGEA 1WCIB 1XK6A 4WN3A 2AP6A 1PG5A 5IOLA 7REQB 4EHKA 4DR6J 3R1IA 4GVXA 2PX6A 2A84A 4OYIA 1YCFA 1BQMB 2J6IA 4I5FA 2D1RA 2E7WA 2FLKA 1UM9A 1WG8A 2EDCA 5G02A 1JEYB 5T3UA 4DR2F 2G1AA 1DKLA 1YKWA 2FGCA 3PC7A 4HAOA 4KFBA 2J7WA 3AWDA 3S5UA 3BH7A 5E3IA 3Q8QB 1TXGA 4BDPA 3BPDA 1QUFA 4DCVA 2KL8A 3CUUA 3CPJB 5T6BA 2A0WA 3L79A 2AI3A 4KH0A 1G3IA 4X8MA 2VJLA 3RUFA 3H0KA 1EVQA 1F6BA 5LXTF 2H4ZA 4YMIA 1WW2A 5T67A 1T5IA 5HMXA 4O2BB 3MM8B 2DEJA 3SC2B 3DFMA 3RBAA 1OBVA 1G7CA 1ILEA 2APOA 1I01A 2OV2A 1TZCA 2GBLC 3A0UA 2NO1A 2C58A 5ITWA 2KH9A 1GPAA 3T54A 1KI2A 3LWZA 1O51A 4R81A 1GL9B 4KR7A 1WZ2A 1RAGB 1A9XA 4R51A 3MUTP 3O4GA 5KCMA 2EQBA 2P7IA 3NHWA 4LGVA 1OWPA 2MJUA 2OLWA 5C42B 1IJKA 1J70A 4YJ3F 4BVAA 4QYMA 1EBBA 1DJLA 5D7NA 2OPQA 5DBIA 2C4VA 2XQIA 4CM1A 5DBHX 2XMBA 3ZZMA 3CZCA 4LOLA 3RM3A 4XIFA 2X9QA 4MARA 2D5IA 1DARA 2V74B 3KKPA 1O5JA 4A8FA 3EEOA 4RLSA 4JX9A 1TUWA 1ODJA 1IHPA 5JR3A 2JGNA 2FPMA 5B1DA 4LRCA 4R5MA 3TM4A 3U9TA 2CJQA 3EYZA 3VNAA 2H3EA 5C8VA 3KTQA 1X13A 5IK2A 3B9RA 3ROXA 3CXUA 3OQBA 2Q4TA 3M30A 1A2KC 2GI4A 3PEJA 3FNIA 5I7RA 4LR8A 5BPFA 5KNBH 4EAAA 4EHJA 4LYAA 2WUDA 2Q6CA 1Y1LA 4M63A 5KJ1A 1RJWA 2QTHA 2VDOB 2FR1A 2RHLA 1QMPA 3KQUA 4CGZA 3O3OB 1OXXK 3BKXA 4RD3A 3AERA 2LQJA 1XZMA 3PACA 1ZN2A 3HPQA 2ADMA 4PEVA 4EKDA 1B41A 3UCEA 1UEKA 4QYTA 4NA1A 1PJLA 1EE9A 3EPLA 4MRMB 1IQTA 4E8UA 4KVGA 5LBIA 2LTAA 4NE7A 3FZQA 4MFBB 4WWHA 5DT2A 4DIUA 3I05A 4G0YA 16PKA 3P9XA 3Q7PA 4EZIA 3LV8A 3O0TA 4F04A 4Z99A 2GESA 3J81k 1OYEA 4LYHA 4B6RA 2XI3A 1ZD3A 2FDNA 1OLUA 2FMFA 1WXWA 4DQIA 4EFLA 4XCVA 2CFCA 3JAKA 3SYKA 2PS9A 2CADA 3GLVA 3M32B 3IP6A 4D4KA 1D6SA 1HRKA 1I94B 4TZ0A 1ZSVA 4IFYB 4G0QA 5J2QA 1GAXA 1V6HA 4V3BA 1UPCA 3BIXA 5HSGA 2YY7A 3SBMA 3UAVA 4RIEA 2ZWAA 3EDRB 4ECYA 4IQ8A 1Z07A 2ZJFA 2O5VA 1RT4B 5CT4A 1R0CB 2ZH6A 1P4HA 5EIFA 2CL7X 3AR9A 2XLBA 2QXYA 1B6TA 5KVVA 2REQB 3DDKA 3AVYA 1KVUA 4QYRA 2KMLA 3A8TA 3SX0A 2I7DA 1R9GA 1S3GA 2W6JA 1WF1A 2GO9A 3A7EA 3I87A 3NAGA 4FIZA 4R1NA 1XTUA 2VZ0A 4PX9A 2HM7A 2WBLC 3HM9A 4F02A 5ALRA 5CVTA 4HNAA 3L1VA 3X1JA 1T2FA 4DRXB 1YJNS 1S7CA 1HNZJ 3L01A 1AQJA 1E3TA 1V8OA 1WEYA 4KHRA 1ZJZA 2ZVIA 3ETJA 4LRTB 1FXRA 1QOQB 3W5AA 3WVNA 4Y7CA 3P0FA 3QQ5A 5IUNC 3ZZNA 2R8BA 2WUGA 3MM7B 1VDHA 4RMNA 3BMOA 1T95A 3VR4A 3EXHB 3HFZB 2VP2A 3HGQA 3AJ8A 3PI6A 2CQ1A 3U1LA 4TSRA 2HRUA 1MV5A 4KO3S 3PFBA 3TQEA 4ALLA 5F64A 1GN9A 4G6VB 1OAKA 2IVZA 1CY1A 1ISFA 5L1KA 2QUKA 2L41A 3I83A 2A5FA 2AMVA 1KJZA 4UVIA 1QCZA 1S7GA 4ZXFA 3M9WA 2V6IA 1I94J 2IYUA 3L43A 2VS1A 2AC7A 2JVJA 5EVJA 3A6EA 3TLJA 4EAQA 5DYGA 5IJZA 4LV5B 3K8OE 4OK3A 4LF1A 1LWNA 3M2UA 5EIBD 3K09A 4TTRA 3N7TA 3GLJA 5B2EA 5IASA 5C5JA 1EG7A 4EA9A 4M0LA 4NYJQ 1VCIA 2HJRA 1M83A 4PYNA 1SIZA 1QR6A 3MSCA 3OP1A 2FUG9 3K0AB 1DKQA 1SC4A 5D1NA 3TIGA 1H1LB 3HXMA 421PA 9ATCA 1K68A 3VALA 4ZMRA 2BHRA 4UY8T 2KM8C 1V1MB 2B0GA 2ZH4A 1BFKA 3AD8C 3WL8A 2BGGA 4KQFA 1HEIA 3DKPA 1JA9A 1TIBA 2XSJA 4F0KA 5JZBA 3NXKA 3C6MA 3G88A 4K6HA 5DK4A 4D9IA 4G09A 1RI7A 4X94A 4OIMA 2JAHA 1WC3A 2Q4DA 1ATIA 5AJWA 1NPDA 3NANA 3UMFA 2XI4A 5ERGB 1H8HA 2QMZA 1SZDA 2RJ3A 4QBGB 4E5DA 1A4XA 1BH6A 3B36A 5I4MA 1DXQA 3OPVA 3BYPA 4D82A 2DYKA 3ZKAA 2LRHA 2IF0A 1CRLA 4YXWD 2QO3A 3EEQA 2PMEA 3A4IA 2AZXA 4CM2A 4N8SA 1XRQA 3PNLA 4X8HA 3M89A 1IVNA 1PCAA 3D6FB 4YYEA 4K26A 4IOKA 5F7ZA 5J1EB 4MICA 2VZ8A 1PBUA 3TEHB 1I1NA 2YZMA 2AOXA 1FK8A 2Y0BB 3F7TA 4BKOA 1ZK1A 1GOTA 2A3NA 3ZCUA 3FMBA 4IIYA 1KTVA 3IEVA 1ZK3A 2JKYA 3VPBA 3Q40A 5H4HA 3LP8A 3CQ9A 2QQGA 3H8YA 4MO2A 3X1KA 1WZUA 2FMIA 1YS6A 4ZJOA 1UJ4A 1SVOA 3QUCA 1HWUA 2ZANA 4C0AC 4EMTA 4CO0A 5KYWA 3PEYA 1U2GC 1Z18A 4WECA 5G53C 4RAQA 2V7QA 1Z5VA 3WBBA 1NONA 3M8YA 5JIBA 3T5JA 3BSYA 4F5WA 3CWCA 2W9CA 5JH7A 5FORA 3CSSA 1K08A 3B3GA 4AKIA 2PKCA 3TKLA 4X1KB 1ZMBA 1NT4A 4U7UK 4EG8A 4PAQA 2J0VA 1ZM4A 3MZIA 2P0EA 5HS4A 1T36A 3NV7A 4EYKA 3MVEA 3QPVA 4OYYA 4HT7A 1NFQA 4AAYA 4OLBA 1AHNA 1OZ0A 1I3NA 1KFDA 3ODGA 3AVQA 3ZNOA 1OX6A 2J67A 3S70A 2Z4TA 2PX3A 4BP1A 1TFYA 1YZFA 3OCCA 2Q3HA 4XWOA 4PY2A 4ZMSA 2VDRB 3PXGA 1NX6A 1WMSA 4UFOA 1S9EB 1S57A 2DH9A 1ZS6A 2C7VA 2A9RA 3L7JA 3A9RA 1FF2A 5FTNA 3R6GB 4C5BA 5JMPA 4C8YA 4OKSA 5CXQA 4KGVB 3GJ5A 1T3GA 2QSJA 3ICPA 1K92A 2CUTA 3R6GA 1EQAA 4D4IA 4RLEA 3IO3A 3P45B 1J1UA 1ICIA 3JQAD 5L4SA 4KRFA 3CUYA 3ZK9A 1OXVA 1TPZA 1Z3CA 1Q22A 4XOUA 1H23A 2REBA 1M1YB 3L40A 1Z7GA 4OXNA 4O1MA 4OJHA 2HNDA 4JJIA 2WJJA 3UD4P 2Q1SA 1KARA 2HL6A 5DIFA 4EQ6B 1J8DA 3FLEA 3CSKA 2PZKA 2EI5A 3VKGA 2IMWP 1NHUA 2BW2A 4MV3A 1TAHA 1RABA 4QO7A 5KG6A 2W2NA 3UMVA 1L5WA 3OZVA 5BN5A 2X4GA 1AKMA 1HKHA 4ZQBA 1P4RA 1ZA2B 2HIMA 3LZ6A 1P8GA 2F4FA 5EHXA 2A5YB 4MR8B 4F4CA 1RYMA 2C1ZA 2H11A 3KKLA 1SKRA 3GK3A 4YRBA 1NM2A 1ESNA 1D2AA 1ORIA 2V7PA 5DX0A 2W8ZA 3MOSA 3C6BA 1G1MA 1I7DA 2JATA 2VOOA 5ALMA 4FFLA 4PHFA 4WY2A 2OPHA 3V6KA 1JP7A 4XGIA 5KZMB 4N1AA 3K4HA 4RVCA 2HXSA 3F78A 3ZD9A 3VAMA 2J3IA 3ZNUA 4D7AA 3LHIA 3ZS8A 3NWJA 1VK3A 5HS6A 4DZRA 1O94A 4Y9UA 4LXXA 1CEXA 1HDYA 4G9EA 3G4SS 1V5EA 3QU4A 3O2QB 4ALKA 3OWXA 4RVNA 4C3UA 1DHMA 2CNLA 1SV5A 3JSMB 3VR4D 1N34F 3KQKA 3SX2A 5E3HA 4ZZ3A 2JWNA 3CDEA 1W30A 3OIWA 1QC5B 1RJ9A 4LE1A 4L7VA 1P80A 1FDBA 2BGTA 4RH3A 4WBNA 5DX8A 3U7QB 3WLKX 1AGYA 1E1DA 2ICAA 2BR0A 5DHFA 3STUA 1Y1PA 3S3TA 3OLBA 1KDNA 2AYEA 3F97A 4Q7LA 1V7ZA 4O44B 1CIVA 1VE1A 3P4XA 1EM8B 5CG2A 5U47A 2CYCA 1P5HA 2GK4A 2X8LA 1WBBA 3GLIB 1N8TA 1ACMB 1CJTA 1R8SA 1LSJA 5ALFA 1B26A 1I2ZA 5EMLA 3AEXA 4TWIA 1NZFA 1FDSA 5B53A 2I4LA 4DQPA 5CABA 3TW8B 4Q9HA 1ZOTA 4OPMA 4BVLA 2XZWA 4JI6B 1UANA 2JFWA 4U7PB 2X9NA 5KSOA 3BBPA 2ORYA 3NEJA 4H4MB 2B7CB 3BWVA 5E1DA 5IX8A 1MU0A 3G8BA 2VYCA 3MUMP 1H2UX 3RVJA 2OXEA 4Z51A 3WTCA 4X90A 1UBTS 1FOEB 1EWRA 2EFHB 3DVSX 1GDDA 1H8HD 4HGNA 4PBRA 2RUSA 4JVSB 3F73A 3OZTA 5JAHA 4BEJA 1IVYA 4B85A 3WQHA 1M0SA 4BY9E 3OUYA 1DAGA 4OX9J 2O2ZA 4HBZA 1PC5A 1KIFA 3EVCA 4ZO8A 4FFMA 4UPEA 1D2RA 1G2EA 2DRIA 4IY1A 2ILVA 2YZGA 3O4RA 4H35A 5E7OB 1VL2A 5JAPA 3G7NA 2CUNA 3DGFC 3L4EA 1J0EA 4X92A 3H9CA 3IP8A 3TUZC 4R1QA 3P0EA 3ZDYB 3P26A 3NFRA 2J5RA 4RF3A 1W581 4EO9A 3T5PA 1Z0AA 3NTXA 3A2KA 3PHBE 1OKKA 5SZIA 4KLZA 1PJSA 2BGIA 3VZSA 4JK3A 4LX8A 2RDDA 1UP4A 1X4GA 3VZRA 4OI1A 2DQKA 2YNGA 2X6QA 1QLHA 4JUDX 1IG3A 1ZNYA 3TXYA 4AMYA 2O7QA 3HDGA 2E82A 4E11A 3BULA 1Z2NX 4PTYA 4ZI7B 1W0KA 5G0VA 2GX6A 1CPZA 3TBHA 1XOIA 4KK3A 3IPXA 3TNLA 3AI1A 1LFDB 3IG1A 4Z7YA 4ODIA 2R1VA 3GELA 3FZYA 4GZ6A 5IDYA 1VQOS 2JIDA 4FLEA 2ZBQA 3ZBTA 3AXTA 5F7XA 4M0UA 2QL7A 2J87A 3HR4A 3HP7A 4EW2A 2WFLB 1OLXA 3UDEA 4JYAJ 3MTKA 3C14B 3OFEA 2A5JA 2BT4A 3AWIA 2ACVA 1GPNA 4C8NA 3DMYA 1J8MF 2EJBA 1IXRC 5MGNA 2X51A 2ANBA 2ZI6A 2QGFB 4ZD6A 3KO8A 2F43B 4EHFA 3HA5A 3S99A 2XRZA 1N2CB 4QNRA 3AHDA 4DV4J 3B1ZA 1GV1A 1KFJB 4DSIA 4ZPTR 2PRKA 3WL7A 1MOQA 3GBSA 1FFXA 3D6MA 1UPUA 3HZRA 4Z5XA 2CXTA 4CIVA 2DH5A 5EERA 3DOIA 3QFSA 1NXQA 4D9MA 3FLBA 3DHEA 5TDHA 3EJ6A 3AFMA 2OHFA 3IEUA 3MAAA 4TTIA 4FLMA 2QPTA 2W6CX 4HHJA 3OSNA 5EGYA 2N82B 4CRWB 2XYRA 1JKXA 1AXQA 5JXSA 4G86A 4JSTA 3H87A 5HJXA 3IN5A 4I3FA 3T9EA 2LPMA 3RWOA 2ETXA 5J5CA 4DMFA 1GAEO 4OJTA 3RBEA 5A1JA 1Z16A 1XJWA 2DG2A 2FY8A 5GGXA 1ZH6A 2R96A 2QP4A 4QYWA 1K4KA 2J09A 4OYLA 1YS2X 3FYUC 2N42A 4J2OA 2JIPA 2VKZG 1KN6A 4X7PA 1SUFA 4KHPF 3SR3A 4Z4GA 3KUHA 3ZJ4A 1EAYA 4CM0A 1NPRA 3WLTA 3R7LA 3S6JA 4A4DA 3LYLA 1EG2A 2GQ2A 2GUWA 3EBOA 2C1EA 3THYA 4FONA 5DM2A 5KOIA 4GH5A 2IIBA 4EKIA 1PWZA 2JLZA 4DLUA 3FTQA 3RSFA 2XT0A 4U5QA 3PGLA 3I1IA 3JD0A 3V8EA 2IOHA 1HBOB 2BDPA 4EH1A 2AFHE 1JLQB 4EGCB 1PJAA 4X1YB 1WG4A 1FRMA 2H17A 2ZBPA 1I1QB 1BA2A 1QYXA 5DGAA 1H38A 1U1PA 1E79A 1VBKA 4IUCS 3NHKA 3HFKA 1KR2A 2PUBA 3EXFB 1GPMA 5J2TA 3CF6R 4LVCA 3EFBA 3RBZA 2DIVA 1G21E 2BIFA 4JLJA 1LC0A 3L9XA 1IH8A 1HW9A 3GP9A 3FVVA 4Y9RA 1YRTA 4DA9A 4OU5A 5AOCA 2I0FA 4USWA 1ONOA 2VDVE 2XM3A 4BO0A 1PILA 3AF1A 5HA5A 4KR3A 1NVGA 3DFEA 2AS0A 4TPKA 1FX4A 2B7CA 1T4GA 1K8XB 5AUPB 5CLJA 2OMEA 1H2TZ 3C7CB 2Q2QA 4JCCA 5HE8A 4G63A 1RPZA 3C5HA 5F3ZA 1BOOA 4S1PA 1DKNA 3A3KA 4JUCA 5DI3B 3KK2B 4LVNA 3PC8A 5HNKA 3GJ6A 3SEZA 2WJ4A 2JB9A 1BMDA 3KJNB 1IUOA 4M5HA 1RHUA 4WZ6A 1MMLA 5SZTA 1F9FA 3ENNA 4OTZA 4BBZA 1YJVA 5HIAA 1P0MA 4C5AA 1KYYA 4L08A 4KNVA 4QYSA 4J9MA 2NV0A 5M5BA 4EW1A 4DUZB 4DJDC 1J56A 3ENWA 3IR6A 4X4NA 3HLKA 3EGXB 1YBUA 3UT6A 3REQB 1IIRA 1T6NA 2BR4A 3OE7A 2GFHA 1H6KX 1WC6A 2HF9A 4FD2A 4L8LA 2QAGA 3UUFA 1Y5RA 2H8KA 1IUKA 2EU8A 4M22A 3V6DA 3FUYA 1F6WA 4D99A 3DTVA 1HTBA 1BVUA 4EB6A 5KMGB 1D8YA 3UZUA 3KX2A 5A0VA 5DIZA 3Q87B 4CLOA 1MT0A 1O96B 5BWNA 2R7QA 1DZ3A 2XB9A 3DCAA 5FFNA 2HLTA 4N39A 4D2IA 4QSHA 2IZ6A 3R4VA 5KFPA 4P72A 4LPSA 3MJ4A 2Q3BA 3KOUA 5B09A 4PYOA 2BKLA 5SICE 1GTVA 1UBFA 4HH0A 3MXOA 3CZ4A 4NYPA 1ZLYA 1SKYE 4DR2B 2G70A 2OGTA 3M6LA 4XWYA 2UZ1B 1FDVA 4JGGA 2RHDA 1KP6A 4B73A 2XDYA 2GAHC 2V9CA 3GBPA 4QVGA 2HZCA 2O2JA 3QFWA 2JPDA 2WZDA 1VI6A 3BIOA 3OJXA 1RCUA 4NENA 3HUFA 3RWBA 3QW2A 1ISHA 2RHRA 2AKAB 4PYLA 1Z4MA 1PYOA 4M1TA 4KHPJ 1ZHHA 1I6KA 2BMAA 1UODA 3E3AA 4OBWA 5DNUA 2CQ4A 1U0RA 3ICVA 4X84A 1LQ9A 3R7NA 2A9FA 3EVAA 1KFCB 2QMOA 1AO3A 2ZM5A 3E8SA 4CLXA 2PUCA 4L9RA 3I09A 1ID1A 1MMFB 3KLOA 2X3YA 4RUKA 4HQOA 5KTOA 5EXXA 5IFMA 2WIBA 3FR8A 3UE2A 2ZP1A 1G8PA 2IODA 5BSTA 4GEKA 3VTKA 2FGOA 4QDTA 2BDEA 1R8JA 3OZXA 5FYDA 1GO2A 2D7SA 1BE8A 4K9OA 3AR3A 2B7BB 4E6PA 4NJEB 1QUPA 4PE5B 1FLAA 4ZLPA 1WW8A 3QELB 1FC0A 1BD3A 3O2NA 1C50A 1KHTA 3TL2A 1RT4A 3CW9A 4X5OA 4HLQB 1R5JA 3JQMA 2VZLA 4PXBA 3N6RA 4Y3UA 4ND7A 3W4JA 1EEHA 4YRLA 1RBLA 2HQ3A 1CJKB 4X64J 4WK2B 5CVVA 1SZCA 5GJWC 3VZCA 1WOMA 3GLGE 5K8OA 3K0HA 4ELVA 4WXWA 2WK1A 4HR7A 3E5HA 5IVIA 1N6KA 2WF8A 1MQAA 2R5NA 4JELA 3KZNA 5BT8A 5FNVA 5IVKA 1UC8A 5IKPA 3IELA 3KFWX 5DN9A 1DU4A 3EZGA 4AY6A 2XUHA 3LUGA 5K3DA 4LKRA 3SEFA 1Y9DA 5FBKA 2OEJA 3IEMA 2GTHA 3OM9A 2NVOA 2Y6UA 1NUEA 1LSOA 2HJ9A 5J1PA 4IYRA 1FK9B 3EICA 3C3MA 1VMKA 1C5KA 1R0SA 4LHYA 1SJ1A 3W2VA 4IQXA 1FFBA 1NP7A 3HCXA 4OCZA 2I4RA 2QZ8A 2P27A 1Z7YA 3GZ4A 2XQKA 3MT0A 1IATA 4H6VA 4YP7A 2OPRB 5CNMA 1EHIA 1UVJA 3VGTA 4XDZA 1HNZF 3HRIA 5B0DA 4Y0VA 2C7QA 2G9RA 2E49A 4UE2A 3VOTA 4X4RA 1QX3A 1TFRA 2VP9A 3IGFA 2MSWA 4E15A 4FDTA 4YB7A 3FTNA 2E1AA 4YJFB 4I9UA 5TF4A 1PV1A 4HYEA 2F90A 4O2BA 1IEQA 5FJ4A 2WF9A 1CYEA 4CMJA 4GKJB 2XSZD 1YHQS 4K50A 3NLLA 2WVFA 3WHLA 2R7VA 3EW7A 3ZXUB 2EEPA 1GSOA 1TR0A 3DBLA 1G3OA 4KK4A 1E1MA 2QYTA 3CFYA 3CCJS 1YZYA 2IEGA 4FVMA 4NXNF 1Q0NA 3SIXA 3SVTA 4LOIA 1XYGA 2XKJE 3WK4A 3OXFA 2V45A 2VH2A 3DSRA 3R20A 3JALA 2H3HA 5E3AA 2YFHA 3OEED 2IXFA 1NUTA 3LTOA 3W8DA 5EZYF 2NXEA 3LQVA 1EQ2A 3UKDA 1FTRA 2DB3A 4JI2J 4A23A 3ISTA 3F96A 1MPXA 4AO7A 3LGNA 1RZVA 1C0UB 1X8KA 3AFHA 1DWQA 1YQTA 3UCFA 2Z9DA 4G5HA 4QIGA 4MVJD 4Y0NA 1QIMA 2O1WA 4ES3A 2VHJA 2FU5C 3GMIA 4ZODA 5JAZA 2OH2A 3VR3A 1Y48E 1OBHA 3K5IA 5CDSA 4ZTBA 1GPH1 4GC7A 2JH3A 1VPVA 3THOA 1ZD4A 3VR5H 5CHYA 3E3NA 3P9IA 3MECB 2XSZA 1UT8A 3Q7EA 4OI3A 2H59A 4RJVA 4ED4A 2BFWA 4JI7B 2CZGA 1TMKA 3PFGA 5JNSA 3MILA 3MPOA 1RYHA 3HT3A 4H4MA 1DJQA 3PX0A 4HWPA 3BHJA 1SC4B 1BKSB 3CCWA 2O57A 2WSMA 2AG5A 2YRXA 5HM8A 2LXUA 2V4ZA 2BZ1A 4C43A 3EZ5A 1F2TB 1II8B 1M1XB 4MH0R 3ZZ1A 1VQ4S 5J4YA 3QNWB 3K53A 1M74A 4FS1A 1B2LA 3RVLA 1N8RT 5H70A 5GOTA 1M76A 4CZCA 2JJ1A 1D9AA 5FT9A 2ZSHA 1RRVA 1U6IA 4TKZA 1IHDA 3G5AA 1VIVA 3FPGA 4GP9A 3PE3A 2MOKA 2O07A 3MN1A 4EG5A 4BWGA 4AT1B