2ZWPA

Crystal structure of ca3 site mutant of pro-s324a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
394
structure length
389
Chain Sequence
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDADAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Requirement of a unique Ca(2+)-binding loop for folding of Tk-subtilisin from a hyperthermophilic archaeon.
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Hydrolase
total genus 118
structure length 389
sequence length 394
chains with identical sequence B
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2zwpA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2zwpA02
3SICE 1THMA 3CNQS 2PWAA 1XF1A 4C3VA 4CG0A 2IXTA 1R0RE 3AFGA 4I0WB 3GT4A 4ZOQI 4H6XA 3TI7A 4NE7A 2E1PA 3DE3X 1ITPA 1AV7A 1C9MA 4KB5A 3WQBA 1Y48E 5FBZA 3VTAA 3L1KA 2PRKA 3CO0P 4JP8A 3T41A 4AKSA 1Y3FE 4KG7A 3CO0S 3DVQX 3VSBA 1SUPA 2QTWA 1TMGE 5JXJA 1PTKA 1SIOA 4NMXA 1YU6A 2W2PP 3GT3A 4K8RA 1AQNA 3A3PA 1V6CA 1GNVA 3AJ9A 2TECE 4WOCA 3I30X 1SUBA 2W2MA 2PMWA 4HX2A 1SH7A 1GCIA 4MZDA 4YN3A 4OV6A 2W2QA 1DBIA 3BX1A 3H42A 1R64A 2IY9A 1C3LA 4OMCA 2QTWB 4GI3A 4CFYA 1WMFA 3DVRX 1SCNE 3OSZA 2WWTA 4NMXB 4HVLA 4K8RB 1WMEA 1Y1KE 3A3PB 2Z2ZA 1JEAA 4NE9C 2V8BA 3SQOA 3DE5X 1TK2A 2SBTA 1TM3E 5AMXA 1VSBA 1EGQA 2PMWB 1V5IA 3EDYA 4NE9A 4YN3B 1R6VA 3QTLA 4OV6B 2X8JA 3H42B 2XTJP 1KDZA 2WUVA 5JXHA 3VYVA 1SELA 3GCXA 1P8JA 1BFKA 3A3NA 1DUIA 3GCWP 2W2NP 4KPGA 1SBNE 4H6VA 3WHIA 5AVJA 1S02A 1AU9A 1V5IB 2SECE 2W2OA 5ARBA 1SPBS 1GA6A 2X8JB 2Z57A 3QMPA 3A3NB 3DE2X 2HD4A 1P7WA 2WUWE 1C9NA 1ZVKA 5FFNA 3PRKE 3P5BA 4LVNA 1SN7A 4B5LA 5I9SA 2Z2XA 1NDQA 2WV7A 1KE1A 2Z57B 1SVNA 3WIUA 3BPSA 3I2YX 1SCJA 4Z2AA 1A2QA 1GA1A 1T1GA 2G4VA 3HJRA 1GT91 1SCAA 1EA7A 1TO2E 3VV3A 5B1EA 5FAXA 1BJRE 3ZXYA 4RYDA 2DUJA 1IAVA 1UBNA 1C9JA 1TECE 4AKTA 2ID8A 1SCJB 1TM1E 1PJ8A 2XRMA 5ARDA 2ZWPA 3EE6A 2W2PA 2PKCA 1OT5A 1Y4DE 3BGOP 1KDVA 1S2NA 4C3UA 1BE6A 3BGOS 3LXUX 5K7SA 3DYBA 5JXGA 2PQ2A 3DE7X 2HPZA 1TM4E 1ST2A 1BFUA 3VV2A 1AF4A 1T1EA 4H6WA 1YJAA 1HT3A 1TM7E 1WVMA 4FONA 5JMOA 1SBHA 4OMDA 2PWBA 4WOBA 3WIVA 1S01A 3Q5GA 1T1IA 1BE8A 4DJ5X 1SPBP 3DE0X 3TI9A 1IC6A 4BWGA 3QFHA 2DQKA 3LPCA 1AK9A 2P4EA 3LPAA 3AJ8A 1MEEA 3VV2B 2XTJA 3LPDA 1MPTA 1OYVA 1SBIA 2ZRQA 3GCWA 2W2NA 3DE4X 1Y3CE 4DWWA 3UNXA 1PEKE 5AQEA 1OYOA 1Y3BE 1NLUA 3TECE 1WMDA 2W2MP 1GTL1 3DVSX 1SBTA 2W2QP 3VHQA 2B6NA 3D9QX 1Y34E 1Y33E 1AH2A 1ST3A 3D43A 1KE2A 3SQOP 4ZARA 1YJBA 5ARCA 3Q40A 1GNSA 3F49S 4LVOA 1GTJ1 3DDZX 1KDYA 1WSDA 1SBCA 2Z30A 1NDUA 3GCXP 1Y9ZA 1Y3DE 3I34X 1LW6E 3ZXXA 5JXIA 2ST1A 1YJCA 2DP4E 3DE1X 3F7OA 2ZWOA 3EIFA 1Q5PA 1TO1E 2Z58A 3DWEX 3DE6X 2Z2YA 2W2OP 1ZVJA 2SICE 3PTLA 1SCDA 2Z56A 1GA4A 2Z30B 3F7MA 4CFZA 1SUAA 1CNMA 3A3OA 5B1DA 1BH6A 4M1ZA 4DZTA 2PYZA 3I37X 1Y4AE 1SUCA 2Z58B 1P7VA 2GKOA 1CSEE 4J94A 3P5BP 5CW1A 1SCBA 5SICE 1SIUA 2Z2YB 1TM5E 2ID4A 1AVTA 1PFGA 2SNIE 2Z56B 1SUDA 3A3OB 3BPSP 1SIBE 1SUEA 3DW3X 3CNQP 3DW1X 5AVKA 1GTG1
chains in the Genus database with same CATH superfamily
1VYUA 2HQ3A 3BBLA 4A8MP 1Z6TA 2C7RA 2A9JA 2HRDA 1YCFA 4RPCA 3L7MA 3K7RA 5M7EA 4IIXA 2OKCA 1VCMA 1XALA 1CEEA 1VCOA 5E1MA 3FGVA 4G1BA 4XWOA 1OI7A 1ZBQA 1TC2A 4GZ6A 2P78A 5LUAA 3V7YA 4XA8A 2JC0A 4R6WA 2CPEA 4RY2A 3I01M 1M90T 1JLBA 4LF6B 2OTCA 2ANCA 3RRBA 4BNWA 5G1NA 1LV7A 4K3UA 4O4GB 1Z33A 3JSMB 4JYAB 1NJ6A 2WTXA 1MJGM 5THQA 3GELA 1TCAA 2XVMA 1MX9A 4BKQA 3QVUA 4Q1CA 4ZQHA 1MFPA 3HA7A 2O20A 4KY3A 4Y7CA 1LBEA 2QLMA 3PC8A 4RHXA 1EYZA 2IHBA 3NTVA 2BQUA 1Z4JA 2RD5C 3T35A 3JVEA 4OZ3A 5EMJA 4BE7B 4ZI7A 3T3PB 1T6NA 5BNWA 2CXXA 3R1LA 5HZKA 4M46A 2Q8NA 5HKKD 4BRUA 4R41A 2GIFA 2CDRB 3S8EA 3ND8A 2C7QA 4Q03A 3UAWA 4FOOA 1HFWA 1E9VA 3OHBA 1OBOA 1LQUA 3KCQA 1N32B 2LEAA 4BLPA 2CCGA 2PRZA 1CEZA 2GJ4A 4YJGA 1LH0A 4BNYA 3VDRA 2BGLA 3UBMA 2R7VA 2YY6A 2HEKA 1U9JA 4Y0NA 3A12A 3DQZA 2OHXA 2ASVA 4V2UA 1NKBA 4ZVUA 1ORWA 1CJBA 4ISBA 4Q3OA 4KX5A 1AXQA 4XH9B 1VKZA 8GPBA 4I6WA 4CIXA 3FB1A 4QVIA 1XMBA 2AMLA 5JISA 4OI4A 3I2YX 3DUWA 1BXNA 4TYWA 4OQJA 4D4IA 1DQZA 3M6WA 2XY6A 1GILA 1PS9A 5I8WA 3K35A 5B1EA 4ID9A 1U2CA 1RXCA 1OAKA 3ERCA 2VJOA 1G18A 3ESQA 1C7QA 3AVWA 1ZUNA 3E48A 4IG0A 2N75A 5LSLA 4OHYA 4RW7A 5K3EA 4PE5B 1C8VB 1E2KA 3Q7TA 1E6YB 1RT1A 1IVNA 4E3WA 4Q4CA 3KOZA 3KEMA 3V32A 1L3IA 3CMAS 1ZVVA 2VDQB 2PUJA 4UULA 1OGIA 4IH6A 1E66A 1OZFA 4BMCA 5H0IA 4O0IA 4ATNA 3UHPA 4ZVTB 2VPXB 3GH1A 2AOWA 3H90A 4YQYA 2MYUA 2DHSA 1HV8A 2JIRA 3REFA 3TLXA 3GVPA 3W3AH 4MCIA 4HN4B 3H2ZA 2DR3A 1EP4B 3N0RA 3D1OA 1OFVA 1CQMA 5IV4A 4A6EA 2CHFA 1AFJA 2VJQA 1NHUA 4ZODA 3JQ8A 4RW4B 1IULA 4EFKA 3EBLA 1L6RA 2H4JA 4U8HA 4UVGA 4G0UA 4CMEA 4OI6A 1P62B 4P2GA 4JOUA 1OH6A 2GR9A 3WAJA 3F67A 3TTVA 3T1YF 4ZU3A 3WGGA 1HWJA 4HVCA 4XDCA 2R5FA 1R0LA 2HQFA 2HGNA 4FNHA 1IZ7A 1CJTA 4IJMA 5FV4A 4BP8A 1EUDB 4C1BA 1C2YA 2HGSA 1EDEA 5AXNA 4JAVC 2XYPA 5EQDA 1WW3A 1SD5A 2C3PA 1T2AA 4LHVA 2C00A 4O3RA 1NGSA 1RC8A 1QIIA 4RUKA 3KQKA 1RAAA 3KZCA 1VJRA 1SXPA 1R4AA 5ETRA 3DONA 4UMVA 4YASA 1TKTB 3JAMA 4RLSA 3ZDZB 2Z30A 2XA2A 3USES 3B9PA 3PPWA 2F7SA 1ADFA 2VG8A 3F7OA 2CF6A 3KJXA 2FSVC 1NQUA 4A92A 3E4CA 3SQLA 3OT1A 4C2MA 1NXIA 2X6QA 3ZPXA 4RDHA 2LQBA 3ABZA 2F17A 2JRLA 1SL0A 1DC7A 4NKRA 2I38A 2WHPB 4ZALA 2KBEA 1V4NA 1JH9A 3SZ2A 2EJTA 2H48A 4ERDA 5FTLA 2MGZB 3GZJA 3PUJA 4RW8B 1WUHS 3I6PA 3QKRA 5E4FA 4DCUA 4NF2A 2ZBRA 4A2CA 4CLEA 3AOGA 2YWHA 1PGQA 3I4HX 1IJFA 1KY2A 4L3NA 5LA6F 1LU9A 1XTTA 1ZAWA 1OLXB 4E03A 1RWKA 2QAJA 5BR8J 4FIZA 2HIYA 2BGGA 2NN3C 4BE9A 2QRRA 2CVFA 1KI7A 4DSAA 1RBYA 4DWIA 1DIAA 4DV1J 1TP7A 2IYSA 4UUWA 2NAPA 3W5YA 5DVZA 4I81A 4CI0B 4HX9A 4RNNA 5F3DA 4IFYB 4G1VA 4MYRA 2YASA 3H9GA 3PC3A 2RGGA 1QIGA 2TECE 4X4QA 5DS7A 3Q8QB 3DB1A 5KVQA 3LP1B 1IL0A 4XIGS 4JI4B 1RHJA 2G4BA 5FDFA 4QQRA 1ENYA 4YROA 3KXIA 1STOA 2G5CA 3BO4A 4YJHA 4BIIA 1QP4A 3EDRA 1RACA 4P0TA 3V8BA 2QRNA 2IH5A 2B0JA 4IHKA 2JI7A 3ZWMA 4CQJA 1R16A 2FJEB 1U0HB 1K7YA 4ZTUB 3PXXA 1ZSVA 5DBFA 1EGMB 3DMHA 3G23A 1JIIA 3GRZA 4MZXA 3UANA 3VSAA 1Y6RA 1EGVB 2GETA 4FFWA 3ZBPA 4HVTA 1WD5A 3IOMA 3OLZA 4ETNA 3MRXA 2P2CB 2YX1A 1UMBB 2IUFA 3BBPA 3SYRA 2GM5A 1YZUA 1WJ9A 2X8JB 1S9EA 4P1ZA 4O3SA 4LGMA 3G1UA 4LSZA 1RQRA 1ZCJA 5LVAA 3OQ2A 4MYTA 3WV4A 1I2ZA 1DCMA 3LUPA 2GVZB 1B1CA 1QY7A 4O4HA 3Q98A 4NK4A 4XYEA 1JDUA 2VWQA 3AUAA 1CQJB 2YFQA 3DFIA 1W5AA 3BB4A 2INGX 3ZXSA 2GN1A 2AI2A 4LZJA 4XW2A 5JVDF 2BL4A 1GQEA 4FDVA 5KYNA 4AC9A 4OSOA 3O1LA 4QUHA 2ZOSA 2QMWA 5B0DA 2EI5A 3EUFA 1P31A 5ITWA 4F5ZA 3CF4A 4L3WA 4YCAA 2F63A 2F1KA 3GBPA 4BY9E 2L42A 3NT2A 3OL8A 5AVYA 5A3RA 2CJWB 4YAWA 3D6JA 3DFFA 2MEWA 2JF0A 5EWMB 1NJXA 2PX6A 1H23A 1R0BG 1PQ4A 3RSOA 1VJGA 3IMQJ 1A7AA 2UZ1A 4ZT7A 2PL5A 2YNIA 4L4YA 4AZVA 4R0MA 5GAHI 2UVPA 2B2NA 3OIUA 4XYLA 1UJBA 5EQJB 2UZ3A 1N33J 1N4AA 3ILJA 3BMQB 5K0CA 1XEFA 1M6HA 1VFJA 4ZOLB 5HVNA 1NL3A 2C4KA 3H1TA 2E4YA 1G1XA 5B4VA 1AGPA 4BWGA 4DR6B 2L82A 5A4AA 3HDTA 5LR6A 5H68A 1IKWA 2M6SA 3KB6A 3ND5A 1I7SB 1C30B 4XIFA 4XQ9A 4X62F 3G82A 4YRBA 3LPDA 2B1QA 2PG3A 1LVUA 1EAYA 3DHEA 1NLZA 1HW9A 4BO3A 2MLZA 3GEDA 2MKHA 3WKEA 1P19A 3BN4A 2HJHA 4X20A 1DPGA 3N2YA 1WCIA 4NRTA 3EDQB 4F92B 1A9XB 3JYQA 1ABFA 3OOHA 3T8YA 2H7XA 5JNWA 4CCSA 5HPYB 4F04A 4RIHA 3RYTC 3MW8A 3NM5A 1MMLA 2BBEA 3MCVA 1FKOB 3OR1B 3K8QA 4H4EA 5TQ2B 4B4KA 4TSRA 3ZTSA 2PXHA 5LJLA 4KITB 5ESWA 3PHIA 5IQ6A 2OBFA 1GTJ1 3EH2A 3KDOA 2RIPA 3PZBA 3QI7A 3H2GA 1ZONA 5JATA 2FQXA 5F98A 3MGJA 3T7IA 2XB6A 5IDXA 3IAM1 1FQKA 2HY7A 4FDMA 5DOZA 2PUHA 3K9QO 1L3UA 1DO0A 1WACA 1OILA 1N34B 3C98A 3DD1A 4WCFB 4UFOA 3EE3A 4OHCA 4I6EA 3FOBA 3BWXA 2PYZA 3I37X 4W5QA 4QPNA 2BGMA 1E94E 4RW0A 2Z2YB 1OSCA 2FLOA 4V02A 4JBHA 5EIXA 1GQ2A 4A6DA 2RHHA 1IKXA 1DFDA 2KM8B 2ACEA 2MSTA 2CMDA 3GUVA 3Q88A 4WNYA 5C51B 3ZZ1A 1XYYA 2FPUA 3H3FA 4YRSA 3M7VA 4K9PA 3ZY3A 1DAXA 3OHPA 2EKNA 3H7HB 4RPKA 4KO0A 4Q3NA 2HV8A 4HDAA 1TAGA 1YJ7A 2E7VA 2CQDA 2J3KA 2X2PA 4CNYA 1T03B 2ZR0A 3VBCA 2ZS8A 5E3AA 4JV5J 5CR9A 1PNRA 4EF4A 5I9IA 5E2IA 4LQDA 2C2EA 3WLPA 1NKEA 3HSKA 3VNQA 1VQ5S 3LQ4A 3ZZPA 4J0HA 2YJ4A 2B78A 4HOYA 4QYIB 2F1RA 1RRFA 4DR7F 3AHJA 2XLCA 1DJLA 4YY3F 1ZK1A 1SCNE 4HRXA 2ASYA 1MRNA 3C7DB 1U0GA 3C8DA 3TZLA 1QH1B 2V7TA 5GAGI 2V6AA 3PDIB 3H0CA 2YHSA 2PNFA 5J2PB 1VHLA 3OE4A 2NNLD 2QD2A 2IYWA 3Q1KA 4UZSA 4MR8B 1T2UA 3KHLA 2IDLA 5DG9A 4WK6A 1YKSA 3GCXA 4UTGA 2GO1A 1WF1A 4ZYZA 3WRYC 2WVFA 1SHZA 4DS4A 3T3IA 2XUJA 3S3TA 2SECE 2X0JA 1WRBA 2FEMA 1VQ8S 1GIAA 3SQWA 3HLKA 3EY4A 2IV2X 3L6EA 3IQWA 3QUCA 3GDWA 2R8OA 4EZ9A 4P3OA 1F9HA 4AULA 2ZT7A 5H3HA 4RU2A 3V4SA 4MUFA 2I6WA 2XB2D 2WWHA 2G13A 4Q1AA 2B30A 2NU9A 1LLQA 5JW6A 1TA9A 3KQYA 1TYCA 1LWFB 3R0QA 2BEWB 4CQLA 4UD6A 5K14B 1YS7A 1RLIA 4KVFA 1RJWA 3TTWA 3KNZA 3I87A 1DWQA 2NZUG 4IDAA 3DLIA 5KFJA 4BCCA 4AMZA 2D74A 1F06A 4C4SA 1I5EA 2IEDA 5DLDA 3OQMA 4LXXA 2O1EA 2RB4A 5H3LA 1VR6A 4K4XA 4ZXFA 4RUHA 4EW6A 2ZH1A 2JLAA 3RHSA 1P91A 2BBTA 1KSHA 4M8SA 1NNI1 2JFZA 5AHXA 1N36B 3THYB 3U37A 1QLJA 2NYVA 4Q1BA 1XD2A 1PEDA 1U3VA 2YPZA 3MS2A 3FA2A 1PR0A 3GD5A 3W2GA 1G2EA 2B4PA 5DO2A 1VMAA 1Z25A 2G82A 4HDKB 3VGUA 5DFAA 3IS9A 3KYCB 5ISMA 1XPOA 3L4BA 4BV3A 1U8AA 4QU8A 4KIFA 2LDYA 4MPJA 4BHTA 4G1EB 1DXYA 4OYOA 2VJNA 3RAQA 3RG2A 4BX9A 2Z8YA 1ORDA 3EMVA 1MWYA 4YEAA 4UE3S 4FYWB 4DR5F 2G0NA 1XEXB 1NLUA 4KO1S 4QOSA 1Z73A 3VISA 4BRWA 4ES1A 2YBDA 1QR6A 1U02A 4GGMX 5BSHA 4R2LA 1RI1A 2ASDA 2OD9A 1RJGA 3A4NA 3WQRA 2E2WA 4KWEA 1VRVA 1BUXA 1MJ5A 3SC6A 2OBMA 2N3LA 4W8GA 1N1GA 1MW8X 5EZSA 3HJGA 3VGTA 4PLCA 5U9CA 2Q5IA 3GUYA 1WIWA 4MWBA 1RBAA 4Y2PA 3VR0A 3TAUA 2EV9A 1UMKA 1NW9B 5NULA 2QQ5A 1LWCB 4ZP9A 3UD4P 1Z8HA 3DMJA 5FPYA 4E1VA 1ZR4A 1ECFA 5GJCA 1DCFA 2GB4A 2VR1A 1RHKA 5C3UA 3LDHA 3SYMA 4W5NA 3HU1A 3W2WA 1PU2A 4MUJA 4MR9A 5CDFA 4B80A 2I7XA 3AIKA 3A4IA 2Z04A 3BE5A 3RAMA 1P7VA 5H16A 1L3VA 5KHAA 1DUSA 1PFGA 4AX8A 4WV3A 2AEMA 4X1YB 3U4QA 3WGKA 1KI4A 1RRKA 4Q7EA 4CKEA 4HV4A 2V6BA 3ENAA 4YCBA 5IC5A 3UD5A 2IYVA 5C42A 5LA6B 5J2QA 2ZANA 5BN4A 2FPOA 4GYWA 1ZQ9A 2P68A 1CUAA 2IBMA 3FTFA 1QRAA 2EFJA 1A50B 2Z5VA 4TV9A 4Y1RA 1RI4A 5LXRA 4R0VA 1R0BA 2C9MA 4OLPA 5CVVA 4TYQA 3RWBA 3LHFA 1F3FA 4YBZA 3H1PA 3S5UA 3Q24A 5DIZA 1MROA 2GYUA 3PQDA 4I46A 1YQHA 3GPBA 2RJOA 4DMKA 3PX3A 2J6UA 2WAAA 3MCUA 1RTTA 5KEIA 5FQNA 4CKWB 2P40A 2VJBA 4DC9A 1YK9A 2GBLC 3GK3A 5HIAA 4Q3DA 3STWA 2HMIA 4V24A 1MG0A 2HWKA 2PMWA 1F8YA 3MAHA 1RP5A 4AY2A 3BX1A 1VJQA 1DX4A 4G2NA 2C5HA 1MF7A 1IXKA 4PBTA 2O2JA 2NUBA 5DYGA 1E5LA 4RYLA 1Y1LA 4WFZA 4U7CA 4A0RA 3KRTA 4PC1A 3L95X 1LZKA 2PGIA 3DZBA 4ZVQA 2JGKA 4WBFA 3SQGB 1WMAA 2AEJA 4CM2A 3AK4A 3KK2A 3RU3A 2DO0A 3JTEA 6AT1B 2QFJA 3AQPA 1DUIA 4JI5F 2QTVB 2QKYA 2OHOA 4LR9A 4ENTA 1PR5A 5C1DA 4FDAA 3F8TA 3S68A 1T8YA 5KFTA 3H98A 1WB5A 1DJNA 4JI6F 2J5KA 1V6SA 5EWJA 3QUTA 2J46A 1X7YA 1H8HD 1ZH6A 1U80A 4E2ZA 1Q14A 4LFCJ 1VQ4S 2HWYA 3DOLB 2AOUB 3HD2A 2P77A 4NYMQ 4D8TA 1YZQA 4YP9A 3D3WB 1NI3A 4F7WA 3VU0A 4S0ZA 3VAYA 5FFNA 1U1KA 1IRXA 4JODA 1YQQA 5AFSA 2BVNA 3BE8A 5B0EA 1U11A 4QDJA 2GBIA 2V54A 2PRIA 3LGXA 3CJ8A 1KVJA 3K9CA 3VH4A 4G97A 4KL8S 3V4VB 5TLSA 4DV3J 2E1CA 1YZHA 3VGJA 5JVDB 3MCSA 2GF9A 5T6MA 2YVSA 3TM4A 4LF9J 5JDCC 3AZQA 3TZXA 1UBFA 1WKVA 2QL7A 1HDOA 5LCXA 3V4IA 2XMKA 3N74A 1L4KA 4UVHA 1IWOA 4M5JA 4LA4A 3IAAA 3BYRA 2XLKA 4G4SP 2YXNA 2IHYA 1ZGGA 1SFRA 4YP3A 4LE0A 3AINA 1XK8A 5K0TA 4ZV4A 4AJ4A 1VLHA 1WEHA 3BGOP 1YMUA 5KYYB 3VC3A 1MO2A 4DT1A 2YS7A 4FGZA 5ECYA 4AJHA 1Q12A 1WS6A 2H65A 2WJIA 4B46A 5JS7A 3VR4D 5ICSA 3QT7A 1U5AA 1S6PA 1GZ6A 1RWXA 4UU0A 4DV2F 1FQOA 1P77A 4DF4A 4UHDA 4D57A 4DCSA 3HFVA 4WY5A 4X62B 1N77A 5D3ZA 1M2WA 3R3HA 3RBEA 4DIFA 3KK1A 1QG2A 3R5FA 3LC7O 3I83A 4M86A 4EHAA 1JLGB 2R6ZA 4M9UA 2ZVJA 4ZFNA 2BXJA 3RRGA 1NUQA 2WK4A 3IA2A 4MQEA 2CUNA 3AG6A 1A3CA 1BMDA 3JQEA 1CTQA 5B2EA 4KFBA 1GTL1 1ZD5A 3E84A 3P9PA 4BNJA 4C22A 1N92A 4IH1A 3QYYA 5I42A 1TDJA 5G4KB 4EHKA 1Q7RA 4DCPB 4IVNA 1BZYA 4WEQA 3W8DA 5LXYA 2ONZA 3MJFA 1HTTA 3ZHSA 2OGWA 1H2WA 1W9HA 3D7KA 4ZT2A 5AXBA 3OVAA 2JI4A 5LD2C 4IIHA 1LTQA 5AQ1A 3FPAA 3W5BA 3WP1B 4AYXA 2YINC 2DFTA 1LWNA 2ADCA 1W87A 1HFEL 1W8IA 1ACMA 4MYSA 6GPBA 2PSEA 5L3SA 2X2FA 1PT6A 4A4DA 2J9DA 4OXQA 3R5HA 5AKYA 5KOXA 4MH8A 2VDWB 3V6HA 1W0JD 4C4AA 2A58A 2FI1A 2FTRA 1SA0A 5KFFA 3WHKA 4R5HA 1S9GA 5ULLA 3FCYA 5JSFA 3QZ8A 4D5EA 2OM6A 3EZGA 5ALIA 3CM0A 3GFTA 2QJTA 3ZJ5A 5KT2A 1I4LD 1AUXA 3I64A 2PSZA 1X0FA 1FDSA 3M4XA 3WO0A 3W78A 2VBYA 1N2JA 1VLOA 4UBNA 3BJYA 3FSGD 3JYNA 2N46A 2HUNA 2R97A 1ZD2P 1NHGA 1NZ8A 4IUYA 2X3UA 4DFMA 3C2QA 1HPZB 1P5JA 3DV0A 4E5VA 5BYAA 4HTAA 4NEQA 3R76A 2M1XA 2ECPA 4QR2A 1CUCA 1YQ9A 2EXXA 4C87A 1TZMA 1VECA 4NL5A 1NSYA 1YRHA 3HCOA 1LI5A 4EPXA 3CVKA 1QYIA 3OZ7A 3NC4A 1QV7A 3R27A 4O3PA 2WU0A 1QS0B 3CKKA 2UZIR 3BKTA 3T5JA 3AW9A 3A32A 1TF2A 1X1CA 1XEZA 4I7FA 4X64J 1YR9A 3E6AA 3MTDA 2IXDA 5EJMA 1RRCA 3F90A 3O3CA 2MKYA 1K44A 4PQUB 4K4UA 2BDTA 2J0VA 1EK1A 3AOCA 4YY3B 4JUFA 4OQXA 3HKDA 4ZVSB 1XYVA 2BUCA 2EBHX 4PYNA 2J76E 1ZA1B 2C3OA 2NUUG 2DEJA 4K8RB 2LP4A 5I5GA 3B60A 2XUKA 2Y3YA 4Y8VA 2BOAA 1Z0SA 2J9GA 4DUYF 5CNMA 5BUSA 5LBTA 2VBGA 4CNZA 2VZ0A 2I67A 1S77D 1IBMF 3MWDA 5C18A 4OA8A 5EYPA 2KRRA 1C1BA 3PI6A 3BA1A 4IX1A 1C0KA 2C28A 4NBLA 2UU9J 4YCMA 4A36A 4ZPTR 1PJBA 1SBNE 3GLQA 5FI5A 4H6VA 2VC0A 4TYAA 1Y4ZA 1E8MA 1A88A 1RAHB 4CMIB 3MFIA 5AVQA 4GO7X 2E5GA 2PZAA 4DSIA 2QLJB 1JZTA 4UFNA 4S1VA 5FLXA 3L2OB 4ITUA 3RRKA 3CTRA 3GLHB 4K6GA 4BASA 5JAUA 3OTOF 2O8FA 4L3VA 2H00A 3OY2A 2BE7A 2OB2A 4QG3A 4DLLA 4B40A 4IF6A 4NV3A 4B5LA 4X9XA 4EARA 4OF4A 2JGJA 2P8SA 1XZHA 3L9ZA 3EG9A 3PGMA 5K6TA 3CNOA 5HCUA 3A4TA 2XW6A 1Y6FA 1ISPA 2A33A 2AMYA 2B21A 3HJRA 5CCXA 3NQ41 1PHRA 5IBRA 4Q8FA 1XV5A 4HQNA 5FAXA 1U7PA 1IN0A 3S1AB 5JS2A 2J6IA 1GCUA 2PD4A 4ZA1A 2F4VF 1JW9B 2WTMA 4TGLA 1K3UB 4YECA 5ADVA 2VTEA 4URYR 1RXIA 3V00A 4RFSA 3G17A 3CD5A 2QMZA 2AIRA 3BA6A 2PPLA 3I09A 3NHKA 2N0SA 3WE7A 4NU8X 4KMOA 1Y7PA 5IVIA 1VIYA 5CDUA 2IYGA 1RLUA 2TSYB 1BN6A 1VBZA 3T9NA 3DYBA 3F73A 3QVGA 2QRQA 2OPRB 2NTJA 3QBTA 1V11A 2H1RA 3KB1A 3CKMA 3VZQA 3L8MA 2XMVA 1HNWJ 4CYMA 2IPLA 3IR7B 3CDEA 5E2QA 3DTVA 3G2KA 1WPRA 2XT9A 2ERYA 1OBHA 1DBQA 2VDVE 1E6VA 2KXNB 4MK7A 4ES6A 2BX6A 3MT7A 1IOVA 5EY5B 1OAAA 4AS3A 1UCNA 4BVLA 3MT8A 4ZRMA 1R0AA 3LCMA 3D5EA 3VJKA 1TFWA 3EUNA 1OYVA 5JWHA 2ZUFA 1XHFA 3RVMA 3L77A 4KZKA 2Z43A 1M5RA 1F2UB 1WI8A 2WNHA 5TB5A 4C4XA 4HZUB 1SJ4P 4BJ5A 5ALQA 3MUTP 2O0LA 4UTOA 1X1QA 1SEPA 1YZFA 4TWZA 1B3TA 4EUVA 3IB6A 3H16A 3WKDA 3CHYA 4LYHA 1N4DA 2JHGA 4BGDA 1FRMA 4ERNA 4IO1A 4OKSA 3W9SA 3AY6A 4M5IA 4BP3A 2LCWA 1FXWF 3PC4A 4LMAA 2B0CA 2F9LA 2CPZA 2YRXA 2D0IA 5KFUA 4YJKA 3ZC3A 2CT8A 4XD7D 4JVSB 2CNNA 3TNYA 2WK1A 3RTGA 1LJ8A 1RWNA 1VQMS 1WC0A 3AJAA 3BFPA 3IS3A 2FN7A 2NSDA 1Z9BA 4U6SA 3Q8SB 2HL6A 2NO9A 2OWDA 3NVDA 5K1ZA 4EB0A 4F2HA 3M7IA 1M7BA 3A3YA 1ODLA 4ON9A 3DLLQ 5B1DA 3UBTA 4KI7A 1KI6B 3I6MA 2D2FA 1HOXA 2J0QD 5AP9A 2UDPA 4I2VA 1Z5UA 3DCYA 2I1WA 3HI6A 4LKRA 3H1GA 3N5BA 2DERA 1IBSA 1OUMA 5F41A 5BNIA 3Q83A 4R2WA 4Q7AA 1R0ZA 2GZ1A 2ZVDA 4D8UA 4URXR 3KR1A 3PDNA 3GSDA 4DZRA 3JPYA 2FMTA 1FJGF 4EHBA 3VH1A 2ZZNA 2ZRHA 4O4GA 2BJ1A 3WWEA 1T8TA 3JSMA 1YS6A 3KJGA 1LWOA 1HQDA 4G0WA 4JN6B 2XSZA 3M6VA 1T2FA 2GEKA 1ZIOA 3WJ1A 3AXSA 4LRBA 1Y48E 2YX7A 1DZIA 3TW8B 1EWVA 3QXJA 3HJHA 1SHTX 3VR5D 3CO0S 4B71A 1CC7A 2BZ0A 3K5OA 3UAVA 2ZTLA 2W2PP 3HBJA 2PV7A 3MOSA 5L9AA 5L4SA 3N2IA 4WKPA 5K8OA 4H1WA 4ZHQB 3JWEA 4P7KA 4TU7A 1JLCB 3QLVC 3LRXA 1R4ZA 3GG1A 2CDRA 4HVLA 1TTHB 3DL2A 1IN6A 4YAKA 4NULA 1JQBA 1NBME 2BFPA 1OBCA 5KOWA 3QZUA 2H06A 4XASA 2VL1A 1THGA 2OCBA 2ZJ0A 3GN2A 1JLAB 4PABA 4PCLA 3ESAA 1KBOA 1GVNB 5CYMB 3KQVA 4M1YA 4QT4A 1CB0A 3C3PA 2TMKA 4JI5B 2Z2JA 2HHHB 4H0NA 2KB2A 2HW8A 4PIVA 4QX6A 3D6FB 3RBVA 2AR7A 1M5KC 1FE8A 1FX1A 3UGKA 1DIOB 5BOVA 4HO1X 1IKYB 4GI7A 1ZOOA 2VOOA 4G6ZA 2ZSHA 2X0DA 3KC2A 4GMGA 2P2LA 4MB6A 3ER6A 2HJWA 5DF1A 4JLKA 3OWXA 1YDGA 1OBFO 5CDHA 3HU5A 4KUGA 4Z1OA 3LNCA 3IYLW 4AX4A 4QNMA 2XUAA 3U4AA 5A5DA 3HO6A 2OZKA 4ZOAA 3BH7B 4JI8B 2CK3D 2A0WA 3EGIA 2B82A 1N8RT 1ZIXA 4IYJA 2NVUB 3TLGB 4Y6GB 5LQKA 3E8SA 4MEJA 1E6YA 1F8FA 3RVSA 4OQMA 1TO2E 1G3QA 1EUQA 2IUTA 2Q8PA 5AUPB 1GNQA 1V37A 2X1MA 5CT5A 2VRCA 5DBHX 4AJ9A 1IE3A 1C9JA 5L40A 4ZVTA 2VPXA 1WSVA 2BGRA 1OU0A 3G0IA 4EG3A 2KYZA 3M2RB 1ZITA 2AJLI 4MP6A 1FJ2A 3FAKA 1EP4A 5JEEA 3OZCA 4CO5A 3SEQA 2AQKA 5BV0A 2IEYA 4RW4A 2J6CA 2X3YA 3MR7A 4DSTA 3U7RA 2H11A 1TKXB 1VBXA 1ZXXA 3OECA 2XO7A 4U4AA 5GONB 3PYDA 2ONKA 4BZWA 1YGYA 4ZCSA 4BNHA 1VHIA 3OLQA 2V8GA 2B98A 1U8TA 3R3SA 4NQRA 4BNLA 4QC2A 1Q78A 1ZXLA 2CFRA 2JS7A 2VYQA 2O8CB 2H9ZA 4OB7A 4JR0A 3E4DA 1HMYA 4GZ5A 3WGMA 1UANA 2AQ8A 1A9PA 3IPLA 1CWUA 2FFQA 4X7PA 3FR8A 4PS1A 4QNRA 5FYQA 2WOMB 1EUDA 4KLZA 1IDOA 3NP7A 4OHZA 4YR2A 1DO8A 1JJAA 4RPFA 5A0TA 2ILZA 2KHDA 3TKLA 2ZRQA 1VMKA 4B44A 1Y8ZA 4MLCA 1OZ0A 4R2HA 4KQGA 1Z2ZA 1WZ2A 1QNLA 2CD7A 1RAFB 4LRAA 3H4BA 2B1IA 2WJ4A 1BU5A 5J5CA 2DNRA 4ECWA 1Z08A 2FEPA 1TKTA 2R7SA 2XKAA 5GADI 3MJTA 5EQFA 3NV7A 1PJ2A 3CCFA 5H81A 3D6TB 1FPMA 4DWOA 4OOEA 1EKSA 2XNSA 4XQGA 1I5OB 2GM9A 5GJWC 1BMFA 2CC2A 1O4VA 3RNLA 4C29A 1T43A 2O2YA 1EWTA 4ZT3A 5BSRA 1KY5A 2OPHA 1GGNA 4DN0A 3I0SB 3BS9A 4JQOA 3RTBA 4K0KF 3EVCA 2UUWA 3H25A 4RF4A 2XYHB 3O2QB 2YUIA 1AURA 3JQ7B 3OU2A 2X0IA 3NYRA 2WHPA 2Y1RI 2BGKA 3CDWA 1W581 2JHFA 1O51A 3EZUA 2RRBA 2MGZA 3KR9A 4LMBA 3TVZA 2ZYDA 1YV9A 4KR2A 2ZWVA 3D54D 4ARBA 2O48X 4XGIA 4BWFB 2J3QA 3AGQA 4TN2A 3QAEA 1ZOIA 4ENVA 4RW8A 2R2UA 1S99A 3GGJA 4MUBA 1PCXA 3R4CA 3AB7A 3PXDA 4Q3EA 4J9UE 5E7MA 1GR1A 1JB0C 2ZM6F 3AERB 3NX4A 3GN1A 1TK8A 1WG4A 1OLXA 5KNCD 1HURA 3DJYA 3BB5A 1WU7A 4P5PA 2IEGA 1VIAA 4MWOA 1V3RA 2ZB4A 3QGMA 2JDJA 4C4PA 3T1VA 4EGAA 1WXQA 1FTYA 4M89A 3EOAI 1JL3A 1NA5A 3HYCA 4IFYA 2DM6A 3CWQA 4IJUA 3OFEA 2ZSUA 4BRZA 4E1AA 1RQPA 4XWGA 4XFJA 2GQ0A 2Z3WA 1K88A 3LP1A 2PIDA 3IQZA 1K8QA 3IBSA 1UIMA 3TRDA 2V0GA 1RQGA 1IR0A 4TLLB 4CG1A 4MWSA 1GZDA 4EG0A 3F3KA 1OI2A 2NYRA 5EKXA 2H7VA 3IVXA 1RAGB 1FVQA 4FHZA 1U0HA 2IOQA 1AKRA 4EZBA 4XI9A 4D41A 2P8IA 3AM3A 3I9FA 3FYTA 2CJFA 4NEYA 3BK1A 1G66A 2AN5A 2J4FA 4ALNA 3DLJA 2UXBB 2BI4A 3QEBZ 1QHHB 2P2CA 2ZB3A 1FZQA 1UMBA 3CUKA 1EP9A 2HQGA 1XVLA 2X8JA 3MD3A 1VSVA 4PYKA 5F7ZA 2MMCA 4JGIA 4EPWA 4EM6A 2GVZA 1JR3E 3Q8KA 4EBDA 3DP7A 1CQJA 4C7QA 2BFEB 4D5GA 4MGIR 2R7TA 4I8IA 2FDNA 2VKTA 4LHSA 1NVWQ 1SO8A 4Q16A 4PPGA 4X3OA 3OTOB 2FY1A 3CEMA 4YJDA 1E1QD 1W26A 1KEVA 2JEJA 5TPWB 2UYQA 4IWNA 4RS4A 5FORA 4NZ9A 1GUFA 2JH3A 2Q50A 1MZPA 2GD6A 2W6PA 3CZ4A 1BTOA 3TZWA 2F1IA 5T6BA 3C6ZA 2I4TA 5JSUA 2CJWA 4H0CA 3VR6D 1S49A 4E98A 4NLLA 3UIEA 1I1OA 5EWMA 4RY0A 4RW9B 1KZ9A 2CEAA 1J25A 1SJ1A 2YWGA 1T6ZA 4EF5A 2AR9A 1MHTA 3IN5A 1PP4A 5AKGA 4K2JA 2GERA 1SCJB 1WXHA 1E2HA 5IM4A 1M73E 3HZZA 3CGGA 3BMQA 3BGVA 2OD7A 3I6BA 4ZOLA 3H9QA 3HVRA 3BOSA 4IXNA 5IUJC 5JZSA 1ZI6A 2YYZA 3P9CA 2COKA 1JIUA 1QJ4A 4KOEC 1J22A 1PW7A 4KBIA 1P61B 3OE7D 4KXNA 2D54A 1C30A 2IM3A 4GXRA 2P6MA 3PNVA 3FHTA 2Q99A 4OYLA 3RIXA 3D0RA 2HX1A 1LXJA 4YJ2F 2P4QA 1T1IA 3U7GA 1FJEB 1OU4A 3AP3A 4MVJM 1EXNA 2XTAA 3KHKA 2PK3A 1JEOA 1ZBTA 4GPEA 1P2SA 2QTGA 3U16A 3A9WA 1Z2PX 3HVTB 3EDQA 1A9XA 1NASA 2MZQA 1FEZA 1PG2A 1I6JA 2VBXA 1IBLF 4GPTA 3H4IA 3TO8A 4AG6A 4DFDA 4R71A 3BK2A 1FKOA 2IZOA 5EXDA 4QM6A 4DM7A 1RWQA 3PPVA 1XCPA 3OR1A 4H08A 5TQ2A 3C46A 4Y2IA 4PYRA 1V9SA 2B8EA 3ZE2B 5FLKA 4RL1A 2XS2A 2E55A 1UKVY 1P81A 2VQ3A 1W0CA 3LQ1A 1QAMA 3SJZA 2V8DA 1UBMS 4C0LA 5K3SA 4U3JB 4U7TB 1H5QA 3O3MB 3AZOA 4FD2A 1WABA 4NZYA 2IDEA 4WCFA 4PO3X 2P9JA 4QRHA 1FDVA 4ARAA 3D8TA 1GGKA 1OJLA 3QRQA 4DUGA 2AFRA 5CHCB 4QBTA 4YUAA 1CBUA 2QY6A 4ARVA 5A9RA 2C4NA 2O06A 5I4CA 2Z2YA 3JU3A 3U6BA 4NENB 4TT3A 1FXLA 3N9IA 1H1LB 4I9FA 5CT6A 2VQSA 4QPCA 2VFSA 2ZOGA 1XZKA 3BRWA 4UBLA 4WZBB 1TUWA 5TMEA 2F3SA 1HEYA 3ICEA 1E2DA 2V97A 5BSEA 1L8QA 3NHWA 4EO9A 2V3VA 1SCKA 3NHJA 5LNK6 2CLEB 2WICA 2CMFA 2E5LJ 4US0R 1UM8A 4KVGA 1YZTA 1O94A 3PJFA 5J1PA 2VSXA 5ALHA 4HAUA 1T03A 1NH8A 3SMZA 1Z36A 1FJGB 4TROA 2IXTA 1NQTA 2IIPA 1ONSA 4R1SA 3RZAA 2NMVA 1T4GA 1MAHA 3LYHA 1NRXA 3GX1A 2MKKA 4KPYA 1V3SA 3NT4A 4QYIA 5A4DA 3LHSA 3G49A 4AB1A 4AZ3B 1PTKA 1QZZA 3EDCA 3ZI7A 4LWPA 2GUGA 1UPFA 1QH1A 3PDIA 3AHGA 4R1LA 5J2PA 1YL5A 1F3LA 1YBHA 3TF5A 4JVLA 2FSHA 4MR8A 1CR0A 2ZI6A 5HATA 3FHJA 3X3HA 4B3BA 4LQ4A 2J32A 3VR2D 5BW6B 2XNKA 4RHUA 3A3PB 3LBAA 3F78A 3GFPA 5AW7A 1JTEA 4O8CA 2RG1A 5AK6A 2BEUB 2GNKA 1GQYA 3QGIA 4IDCA 3OJ0A 4PYMA 1SUQB 1DAHA 1E3TA 4QREA 2R84A 4YRFA 2O6HA 2CLHB 1G3OA 1S8FA 1KQ3A 3NEAA 3IODA 1YFZA 1RYEA 5KU7A 2C2YA 2I71A 2ACKA 1Z4MA 3L49A 3SZLA 1WBDA 2JPDA 1DQ8A 1FXRA 4E15A 1PDWA 1JR2A 3KP1A 1CETA 5DBGA 1HQ2A 1DKQA 3T7CA 1ZGZA 1RDRA 1JXLA 3FC9A 4YREA 1LWFA 5KTSA 1NNLA 1J07A 2BEWA 2P79A 1LNSA 2IAJB 5K14A 4JJEA 2O01C 1N9ZA 3SIWA 1KBZA 2O52A 3MEQA 3MJDA 1D1PA 4RVFA 5SYMA 2DHQA 1XJWB 4DC1A 3WYDA 4OTZA 5DASA 2XQGA 4H3KB 3B89A 4BX8A 2IXFA 4DDUA 2A18A 2XQVA 2D5BA 2M4MA 4H4MB 3H9UA 1HI8A 3THYA 3MUEA 1LFAA 3ZWWA 2PTHA 4CV0A 2ZIEA 2CDQA 3RIGA 2Q2VA 2XE6A 4MLDA 5GP1A 3NDBB 4LDJA 1VGQA 1L2TA 2C29D 1SL2A 4HDKA 1ZH2A 3KYCA 1U4BA 1L5QA 1E0DA 4ZVOB 1NK5A 4OI0A 1C7IA 1DX6A 4AMVA 3HK2A 4EUFA 2DNKA 3JWGA 2UUAF 4QIGA 1WHTB 4OGKA 3ME5A 4JP2A 2CFSA 3HEAA 1KZGB 5EJ2A 3OOWA 4EA7A 2IEZA 1KD1T 2A7QA 3NGXA 4LPSA 1CQPA 3BJIC 4FYWA 1TCCA 1IJEB 4Z2XA 1XEXA 1K0UA 2XDQB 3ELDA 1S2GA 1GEEA 4C4RA 4NFSA 5CD1A 2ZI9A 3A6PC 3JCZA 3LGAA 1RD4A 4Y34A 2Q4OA 5GAEI 1UKCA 3TR5A 2PX2A 4DMMA 2E0IA 3TQQA 5B37A 4RCVA 3NW9A 5JSQA 1XNJA 1B14A 1JWLA 3GHHA 3AUJB 4A48A 4ZVVA 2AC2A 4E46A 2WHQA 2WSMA 4NXMJ 4TU8A 2FW8A 5I47A 2V4QA 4W9NC 3R7SB 2HCBA 5CA1F 4LDRA 2JAQA 1PJ6A 3HADA 2HCTA 1M75A 2QF7A 1KYQA 2HJGA 2D8AA 1H66A 4KYVA 3KOXA 2D3UA 3IOBA 1ODJA 3UWPA 4IXTA 4CLHA 1LWCA 1B0AA 1GFIA 1EB8A 1NN1A 3VTKA 1M6VB 2JFYA 4DTIA 2QIFA 2KT2A 4G1MB 5ITHA 1IPHA 1CG2A 4NATA 4FT2A 4K0KB 3JAMU 1DBSA 4L22A 5SUHA 3PUZA 3LLVA 5KYUB 2G72A 3FVTA 2I91A 4ECYA 3HB1A 1MEOA 3AHFA 4WVLA 5JH7B 2J07A 1QOZA 5EL0A 2ZRPA 3L0OA 1YOVB 3TVKA 1WUYA 2C8JA 2PMHA 4CLXA 1GAOA 4X1YA 2NV0A 4JUZA 4OJYA 3Q23A 5EEHA 2DR7A 3WBBA 5LA6A 1F7UA 4K9LA 3M8RA 2ZJZA 3ELBA 3JQBA 1ND5A 1TTTA 3QELB 2YKGA 3O8BA 4O2LA 2NO7A 3OQIB 2WLTA 4PG5A 1VISA 5B1YA 3SXPA 2D6FA 2OO4A 1FTQA 2MKIA 1PFUA 5CEJA 3G2IA 1DELA 4F26A 2RH3A 4D9CA 5HEKA 3SFGA 2OZEA 2CQ1A 2RGUA 2O2ZA 2GT1A 2LD4A 4ER6A 2IXGA 5JAQA 3GUCA 1PL8A 4CKWA 3PYFA 1Q21A 4N5DA 4Q4JB 3MSXA 2P3SA 4RU1A 3DEIA 4H7IA 2O0KA 3TLAA 1IATA 1VGVA 2WHOA 4MJKA 3DO8A 2PGNA 4NDAA 1MGOA 2NQTA 1BQXA 2OH2A 3NGDA 4PUOB 1VJ1A 3HJCA 4KAXA 2J3HA 2GDZA 2E48A 2ZR8A 4B79A 3A6EA 2M2BA 4CMAA 1LQTA 4AJEA 9ABPA 2XYVA 2FF5A 1TZCA 3SQGA 3DPUA 1LVGA 1R64A 4F0MA 2JB9A 4F6RB 5LMNJ 2A0UA 6AT1A 1L8OA 2QTVA 2NW6A 4RU9A 1JILA 1P18A 2QX0A 2EJCA 2ZJFA 3PDCA 3EXHB 1YVPA 1X1SA 3UN2A 1L7XA 2JEFA 3DJFA 2F4FA 1KHVA 2GNOA 5HRCA 3H18A 3C15B 1AW0A 2R9VA 3DOLA 1YITS 2AOUA 3WJ7A 3ZWQA 5A02A 2VQ6A 1TQ8A 4ALKA 5I4KA 3DSRA 4GR4A 4P4TA 1V8BA 2RMLA 3D3WA 2A78A 2WAQD 3LBHA 3AF2A 2QG4A 4KK4A 2OI2A 2MQMA 4FBTA 1G3MA 1T0IA 1A5TA 2C2KB 3JQPA 3WIBA 4AVYA 3BYZA 5JVDA 4B2LA 3KL4A 4L74A 5CMLA 1I3KA 3TZKA 5EXTA 5KNBA 5EG5A 3FLMA 2R3SA 4NLGA 3FKQA 1KO5A 3N2EA 1KOLA 2LKDA 2YIJA 4BCBA 2PKQO 4QPDA 4WE1B 1HE2A 5F9MA 1JEQB 4Z8YA 2BYTA 2AC4A 3QYAA 1HNIB 3U62A 5LP6C 3MZ0A 5BORA 4TUYF 1VL8A 1XVUA 1LNQA 5KYTA 4IICA 1XLTA 2A2CA 4KMRA 5A71A 2DGTA 2UVWA 4PIMA 3NTRA 2OV2A 5IF9A 3RW7A 1S97A 5TPZA 2JFQA 1D3AA 5KYYA 2EU8A 3B82A 4G4GA 2D0PB 4J0GA 3ELYA 3K0CA 5AKHA 4PRZA 2EARA 5HKLA 4AD6A 1GGFA 3MK31 1MSWD 4NI2B 2EG9A 1ZZNA 3O31A 1PWZA 3MCTA 1XNQF 4QE3A 5F33A 3ENNA 2Z4PA 3HXKA 1VHTA 3UJHA 3ZW9A 2R751 3KQOA 1Z38A 4O5AA 4ZA2A 2B0GA 1UUFA 4JYCA 2HEGA 1DKMA 5DNCA 1HDYA 2GEDA 2XAAA 4YJ2B 4LVCA 2IA0A 2GO8A 1TU3A 1BWRA 2DXFA 1JLGA 4OMDA 1SVMA 1DP4A 1WNEA 3JQ6A 2PC6A 4IRXA 2O59A 4D0GA 4G3XA 1NURA 1F5BA 1DOHA 3GJXC 4DPYA 2WJVA 3IVMA 1GXLA 4OXIA 3JQQA 3CEDA 3WNQA 3VV2B 5G4KA 1HHSA 4DCPA 2OCLA 4AKIA 4G89A 5M3BA 4Y2JA 2ZPAA 2C03A 3GCWA 1K3TA 3W6PA 4A1FA 4H31A 3CX3A 4RH0A 3PIOQ 4JP1A 4A46A 1JFRA 4DTCA 2GEVA 1ZM9A 2RBEA 5CLLA 1DG1G 3NTXA 3CINA 3MR5A 2O1XA 1UFRA 3QVSA 4KYIB 3I0MA 5J58A 4TLBA 4W5HA 4JJFA 2QV6A 1MWQA 5K4AA 3G0BA 2RAQA 4ONEA 2VDWA 2L19A 3IGNA 2EX4A 2OGTA 1UEKA 3PEEA 3OWHA 4HYQA 2YJZA 4ED3A 4L76A 5DYYA 3I76A 4LXTA 2IRXA 2VPZB 2F3PA 3LXXA 4KRFA 2FUG9 3WRWA 2OCPA 1Z0DA 4KC5A 5H4HA 2B56A 4P6VF 4D44A 2KLHA 5IXJA 1I8TA 4ESHA 4ZU1X 1R3DA 2N7CA 3T1HJ 4BNTA 1TM2A 1OFUX 1P1KA 2MJUA 1VJTA 4GOKA 2OORA 4ED4A 3UUEA 1TVEA 3PTLA 3EOBI 4UOEA 3FLEA 2W93A 3C7KA 4KIGA 4XUEA 2JFOA 5K3DA 3KPUA 2G1PA 5A4JA 3BL5A 4TLEA 2AYEA 3BQ1A 5AVZA 3H59A 3E51A 1FRNA 3KVNA 2PWZA 5IAKA 4R7GA 3THPA 1HPZA 1YVDA 3GH3A 4LXGA 2MQPA 2Q5FA 2C4MA 1NW7A 4G1FA 2I4OA 4I19A 2H0AA 2G83A 2PJRA 1DDOA 3A3KA 3G8BA 2ZU0C 3A3OB 2V7VA 1Z5PA 1K5PA 3MWBA 4IFBA 3AVYA 1SKQA 4AQYJ 3ZKWB 1NOKA 1QS0A 5AVXA 3HFGA 3UCXA 1NQXA 1U2DA 2FKNA 2DNGA 2PMKA 2FPXA 3U1NA 4S2UA 5ALDA 1R88A 1O0BA 3ABSB 4Z86A 3K92A 5EN1A 2G9UA 1N8NA 4J9RA 5EJ6A 3QEJA 3PIDA 4BQNA 4UUMA 3UHOA 4TQRA 1JHUA 5IANA 3C1OA 2KSQA 2BW7A 3TIIA 2JDIA 4PQUA 4CMJA 4OJTA 4WBXC 3NYIA 1L7RA 1MV8A 3DTNA 4HH3C 1ANKA 3OPXA 4ZVSA 3NR2A 3BTOA 4ZJLA 2XWBF 2RI0A 5KSWB 1NOIA 5KREA 1ZA1A 5FT9A 2QE7D 3L7PA 4K8RA 1VL0A 4NEGA 3U39A 1RMQA 1J0XO 4FVTA 2CXUA 5JD3A 1C41A 1NXTA 3KJQB 1WC6A 1GK8A 721PA 2WJWA 3ZS9A 4MRPA 1DBIA 2XNHA 3J7A1 4BV9A 2H92A 3GMIA 5CFZA 3D28A 5LSAA 3ONVA 3EVDA 5DG7A 2A3JA 1GTMA 2H1HA 5B5SA 3A2MA 2J8AA 1RAHA 2JLUA 2QTCA 5K0LA 3T7JA 3GLGE 4IH7A 3K70C 2IYTA 2KI5A 2JCVA 2XLBA 3OAAA 3PQ8A 3RGIA 2QLJA 3C70A 1BFKA 4CV2A 1FA0A 3GLHA 8ABPA 2GH1A 3D2BA 4FGUA 5FV7A 5JY1A 4EL0A 3EMKA 4TL6A 3FB4A 2O2XA 5A6SB 2J3EA 3LP2B 4Q9IA 5EUHA 4RBTA 2PM8A 2IM1A 1SC9A 1VL6A 3DL7A 2ZRFA 4AQDA 3FPJA 2MLXA 2J31A 5C7LO 1AQ6A 2SKCA 1A9RA 5KMGB 4KH0B 2PLNA 2A6OA 4WLOA 4Z4CA 3ZDAA 5BSUA 3QTBA 3WGJA 4A8JB 4QTZA 2Z9BA 3HHKA 1UPBA 1XT6A 2RIRA 3I9JA 4J43A 4KXMA 3MTEA 2J45A 3IM9A 3T1YB 3BWEA 3S1AA 3Q6MA 4B8ZA 2X9NA 3F8SA 1BRMA 1WE2A 3IXLA 5KFMA 3RB0A 1G20B 3T9AA 1WV1A 5AK5A 1YWGO 4USIA 1X42A 3KUEA 1FP6A 4FC7A 2BMAA 2VHXA 5FULA 2CVPA 3BXOA 4XVRA 3A8KA 1TF7A 4I5FA 1FTCA 2OPRA 2ZSIA 1QGAA 1KIMA 1XFAA 1VRWA 1X92A 4JP3A 4BBZA 3IR7A 5A62A 4FF4A 1FUKA 4HXEB 4YUYA 4B7CA 4PAGA 1CLFA 3A4LA 2OGSA 3OP4A 3TBHA 2DTXA 5DM1A 3ZWPA 1BFDA 2LGJA 2BD0A 3O0DA 1SKYE 4ZRNA 1N6KA 1I30A 4EJSB 3RTEA 3AVXA 1SVUA 5HFJA 3TJZA 2ZH5A 1SXHA 4PO9A 3W4JA 3IM8A 2DQKA 1C1CB 1F2UA 1KDOA 2QJ3A 4ZI2A 5G0RB 4YBRA 1URPA 4RSRA 5I9TA 2X7JA 4HZUA 4ZZ2A 1RMTA 1NM5C 4FSHA 3CLHA 1A7JA 4F1JA 3I5YA 4BNNA 4E51A 3WC2A 4ENOA 1D3WA 2VPPA 5FI0B 2AW5A 2HRBA 3C66A 4BZZA 2NREA 4HDQB 2W2LD 3R9IA 3O38A 2QFIA 4FJ1A 2IYAA 1ECBA 4UZBA 2QT1A 3KTDA 1AA6A 1Y33E 1RZ3A 1VKHA 1HIYA 3AR5A 4QTYA 4F11A 2Y8YA 1B8OA 1YUMA 2HRQA 2CCKA 3DNPA 3IUBA 3DEYX 2VUTA 2V6IA 3PRBA 1EP3B 4HAIA 3SX4A 2CADA 3LT0A 1JE1A 5JASA 5JZVA 5D3GB 4QDTA 2AZDA 1KI6A 4LFBJ 1IEWA 3UMCA 8ADHA 3I8XA 2FZ5A 1AKTA 3PIIA 1HG1A 1EK5A 4RD2A 1F60B 4XGRA 4F4XA 1F8UA 3ZHZA 5B0BA 2E7XA 4WEOA 3NONA 3PA8A 4B82A 2WAXA 2FLVA 2ODAA 2HDWA 2RIJA 3PR3A 3WB9A 4HNTA 2BFMA 2ZYRA 2G7MC 1FF2A 4UHEA 2RQMA 4B81A 3MCOA 1S12A 1XA4A 5F1PA 3Q8PB 2YNMA 4YYEA 1DLOB 5AK0A 4PXYA 1U0JA 3IUPA 1R18A 3U3ZA 1EX1A 1JU4A 3B8EA 5A3JA 1D1UA 5L7YA 3M3PA 5DGTA 2KXHA 4D9GA 3TW8A 5I9LA 1DB3A 3G88A 2RAVA 3OLYA 1ULZA 3GNLA 2WB2A 3EVZA 3VRHA 5C37A 1CDEA 5D8DA 2R7OA 4C76A 2E3JA 2K4MA 4P9SA 5TS3A 1L3CA 4ZHQA 1JHQA 2PH1A 1RYFA 1YFKA 1JLCA 1X8LA 2Z9CA 1TTHA 4JIGA 3PKZA 2ZVQX 4J0JA 1CUYA 5DNAA 5C24B 1UZMA 1JLAA 1J9GA 4J2HA 1XFDA 4UAGA 2JCBA 5CYMA 2ORYA 1YVRA 4Q4LA 3SFTA 1GGMA 4LRFA 3PM9A 4MV6A 1XR5A 1T9TA 3VVCA 1W5BA 2ADFA 4AY5A 1UAWA 3U56A 3P27A 1SB8A 3DFUA 1YTLA 3TUZC 4K4TA 3D6FA 2F3QA 1Z4OA 1SU8A 1TK2A 1X70A 5THXA 5DSZA 5CDFE 1Z2NX 4EK2A 1IKYA 1ULSA 3AF1A 1PTJC 1YBVA 3JX9A 4JJGA 3T7EA 4RXUA 1KFJB 4LVNP 3T9ZA 4FT4A 3D1HA 2JKZA 3GFRA 2R7MA 1L4MA 2RGYA 4LDNA 2VYNA 2IBTA 3ENVA 3CCTA 2BISA 1SAYA 3DLKB 3II6X 4QYSA 4HQ6A 2Q6VA 1AROP 4HYTA 4QTTB 3BH7A 1WETA 4HAWA 2IPOB 1KP6A 4V19J 5DGCA 2NVUA 3OZSA 2O3JA 3TLGA 2X3FA 4U00A 4MGZR 4GQAA 4H4KA 1O96B 2WAOA 5AJ3J 1UWCA 2X1HA 1CKEA 2IYFA 1NUUA 3P5SA 2DUWA 3IP6A 2AYMA 3TNJA 4DXLA 4ZAFA 4RVUA 1ONPA 1NK0A 4BUZA 2AWZA 3U3KA 1SKWA 4C05A 2QTNA 1E98A 4HH0A 3QH4A 4TUYB 4O33A 3M2RA 2F3UA 3VKVA 2ZBEA 1UZDA 3ACDA 1M5PC 3GGGA 3BRCA 1WF2A 4A5OA 1XJ0A 4DLBA 4IHJF 1JNXX 1YJXA 1LBTA 4DLWA 1TKXA 1PEAA 1GMUA 1G6BA 3DEKA 4Y2HA 5GONA 2J4DA 3ZZRA 2D7SA 1JG1A 3EVEA 1XNQB 1Y80A 4OGWA 3ZLJA 4ZQGA 4BLTA 1PGNA 4ND6A 4IUBS 2XWYA 3U4MA 2O8CA 1SH0A 5ALLA 3PPIA 4Z0HO 3SCZA 1MX1A 1RTDB 3EICA 3EAFA 3NIBA 3HY3A 4UPDA 4M7WA 5KJCA 2WOMA 5FUBA 3QVMA 4KDEA 1TL1B 4Y2QA 2JVJA 3ZX5A 1Q20A 4KV7A 1N0VC 1S01A 4QEDA 2W6JA 4I6YA 1RP7A 4INZA 2J9FB 1RAFA 2HCJB 3IQEA 1H6CA 2IT1A 5IXSA 3HZHA 4MUEA 3UJ7A 1IK6A 2CMKA 1BAPA 1ZICA 5BV1A 4QRIA 5HOEA 3WGIA 1Q5VA 4NOKA 4P7VA 2QY9A 2V7PA 2YKNB 1WF3A 3DHYA 2HA4A 2HHSA 5AJUA 2P2ZA 5G2OA 1I5OA 3DDUA 1XEWY 3SBEA 3FNBA 4WDRA 1YQEA 1XVVA 1DCTA 3QQPA 4YRQA 3E9CA 4RFLA 1U8YA 4H35A 2PEHA 2JFPA 3PFGA 3HVIA 3I0SA 2QR3A 1T9HA 2WUGA 4NDNE 4QO7A 2XYHA 5T3UA 3JQ7A 3ETDA 2H54B 2DWUA 1EKRA 4DQSA 5AT1B 1CJVC 3ZQKA 1ATZA 4L7VA 3ABOB 1BSVA 5ECWA 1Q57A 4UREA 3ER8A 4GHWA 5DNWA 4OXRA 2Q49A 2Z8XA 1I2CA 1SIZA 3PGXA 4DR7B 3B1KA 5K51A 4Q19A 1I4DD 4M9RA 3C16B 3UATA 1IKVB 5JSHA 4ZREA 1W5TA 3AERA 1DAPA 2YXDA 5T4BA 3AUKA 3RAEC 3DCIA 3RKRA 2WSSA 3P4UB 4YRMA 3QU9A 3DQPA 4LOLA 2WAYA 4XRGA 3ECAA 1S6QB 1Z62A 3G2NA 2EKBA 4ZEVA 1YQGA 1SK9A 5T3YA 4OBWA 3NCHA 4DDWA 2D0OB 5I7AA 3FPLA 3JD3A 1CRZA 4FMPA 3SEFA 1JN0A 1RYMA 3OM0A 4IHQA 1D0EA 1JQ5A 4JUBA 3D02A 3N0VA 3ET4A 1SOUA 3H65A 1CV2A 1PIWA 4J9QA 2H17A 5KAMA 2W4PA 4IRKA 2IEBA 4D1YA 3AEZA 3I5UA 5AVKA 1VM6A 3QEMB 4P81A 3W2IA 5CLFA 3IILA 2QYOA 4KSCA 9LDBA 5DK4A 5I5EA 3W6UA 4P0QB 2M5YA 3ML1A 2ZXEA 2CQGA 4RX1A 1RAGA 4KE7A 5A03A 1SB9A 4HF7A 1ADYA 1UC9A 3U1MA 3D3BJ 1LW0B 2IMOA 3IDSA 4G24A 1ICIA 5D0EA 4XCXA 4J0KA 1EVLA 2AF4C 3B4DA 4K6MA 5ALRA 1QHHA 2GX8A 1XPUA 3T5LA 4YH1A 5KHOC 2YY3A 3IHLA 1IM4A 1DNPA 2C07A 3CMQA 4PZCA 2EOAA 1J8QA 2B8QA 4OMCA 5PNTA 3PDHA 1H42A 4RZSA 2ON6A 3IEUA 1KEKA 3TJMA 1XMJA 3O03A 3IKTA 4JT4A 2ZJ2A 2XQCA 1A2BA 3X1JA 2V8BA 1QM5A 1TM3E 2BFEA 4ZPVR 3OCYA 4RNMA 3K73O 5A8RB 4WLVA 4HEHA 2B7CB 3VH2A 3W4KA 3OOSA 2DNNA 3K1ZA 3W5ZA 2ICAA 2ID9A 4IG4A 4DV5J 2IDKA 3LCCA 1EIZA 4F2RA 1AT1A 5DEOA 4K46A 4J9OA 1KI1A 5TPWA 3UXHA 4LI3X 4IH5A 1NDHA 4QWCA 1V5IB 1Y9DA 4JC0A 1GMWD 3W61A 1GA6A 2HLHA 1HOTA 3H2KA 2A3NA 2YQ5A 4BB9A 3E27A 3O8QB 1SPXA 2I65A 4QU5A 2DQYA 4IR9A 3TR6A 5IYZF 2J09A 3G5UA 5FLXU 4C7KA 4RW9A 3E7XA 1H7XA 4XVHA 4DR5B 1SN7A 3O9MA 5ANRB 2OFXA 1QBKC 4G0MA 4TTJA 1TRKA 5G0WA 2HREA 4QYXA 3UG6A 5AXLA 1P9YA 1RI3A 3VYUB 1SCJA 2ZE5A 2VJMB 1E2EA 1BQ3A 1H72C 3ZDFA 1D0VA 1E60A 5K4HA 2DNHA 1HYSB 2BLLA 2DT5A 2ZIFA 3VV3A 3DOEA 3PQ7A 1Y3JA 3ISZA 4LY0A 1WOPA 2ROPA 3HHLD 1FWLA 1UP1A 3Q6NA 2ZFHA 1GZUA 4ALZA 2I8LA 2QAGC 4GPZA 4TMFA 1R8CA 4CM1A 5ARDA 4NASA 1C9YA 1AZLA 1XDUA 1RZRA 3LP0B 1PRYA 4KXWA 3HF5A 1UADA 5HIIA 4F3MA 3TARA 4EDHA 1RRVA 3CYFA 3GLJA 4UU1A 5KTMA 2ZAOA 1TQDA 1AM4D 3W63A 3RC2A 3KBBA 3HVTA 5ADZA 3HR8A 2HA7A 3SLGA 4GMKA 3CD7A 2P11A 4AG5A 2R66A 4HDMB 4LOAA 3UMBA 2AUTA 3KQUA 1X5OA 5JZ9A 1ATIA 1U81A 4WLNA 1X9IA 3D6AA 1ZKMA 3RAGA 2BR0A 5CEEA 2VNSA 3P96A 4Y3CA 4C48A 4YP1A 4A8SA 1MH9A 2W2NA 4G85A 3AHCA 1HL6A 2P91A 4H7FA 4U3JA 5AKEA 5AW3A 1FPQA 3FRYA 2GLXA 3F44A 2CPJA 4NPAA 1QCZA 3H5WA 2FUG1 1NVFA 2FUEA 4Y6QA 1WQ1R 2VPQA 4YMSA 2XHZA 2RCYA 1L5KA 4JR1A 2K7KA 5JV5A 3OZIA 4GBMA 3L8FA 1D2CA 2IYQA 1OXVA 1WKCA 2BBOA 1C3VA 1CJMA 4H60A 2G08A 3LBYA 3OVBA 1HNZJ 2VKRA 4JWKA 4R1PA 5H8WA 1S0NA 2DGQA 3F49S 1LK5A 4AT1B 1YJRA 4NENA 2J6SA 4FFPA 1MB4A 4HNGA 1H1LA 3H5TA 2NTYC 2ONYA 3U7FB 3SP1A 2FSUA 2FFRA 4E5KA 4WZBA 2I8AA 1S4QA 3CCZA 4M0MA 3RASA 1WHVA 1G21E 4CEJB 5L9XA 2M8DB 2A84A 1NLMA 4ED2A 1CDDA 3QIDA 2HSGA 1DHMA 5KOIA 3QT6A 1E9CA 4UD2A 2EJVA 3VQTA 3NRCA 4DZ6A 4BJ1A 2ZC3A 5ADUS 2FHKA 1UZHA 4DFPA 4DQVA 1Y4SA 5BXYA 2ILVA 3EWGA 3MXHP 1BJKA 2IY5B 2ID4A 4INAA 3TKYA 3AM1A 3GUHA 4JI6B 4ZTBA 5B7NA 2FFAA 3AR4A 2GK7A 3OM8A 3NALA 5ALPA 3FI9A 4OX9Y 2ZSKA 1P8AA 4FYPA 4RUCA 4AZ3A 1U45A 3KO8A 4QU6A 3AJRA 2CFXA 1ND6A 4OYXA 1BA2A 3L4SO 2E7WA 3TAQA 5F8MA 3VPCA 3BXEA 4S1NA 1OH5A 3C3YA 5EJ8A 3JSAA 2HMVA 2C04A 1U2EA 5MFPA 3ZE8A 3DXXA 2GFFA 1X9SA 3A3PA 1R9MA 1Y7TA 1W75A 3R3VA 2M32A 4LIRA 1J09A 1GRQA 2BEUA 4TL8A 3ILIA 1KMNA 2MSNA 5DP2A 1SUQA 2D1TA 4BLRA 3H8WA 3OMWA 3ASYA 2AFHB 3V1LA 5ENZA 2V4ZA 1YVUA 3T54A 4CFYA 3FNGA 4DQ0A 1M1NB 3UHAA 2XKKA 3LO8A 4WP9A 3GIJA 1L8XA 3FF4A 3VO9A 2R00A 5J43A 1MG7A 5I7VA 3ZWAA 2ZYAA 1B74A 5GMKa 3UA4A 1IR1A 1R7RA 4CF5A 5IKEA 1IWPB 1MR3F 4RQBA 2Q6BA 5KSPA 3RUHA 2ENUA 1FTGA 1A7GE 2IAJA 3BE6A 3R4VA 3I3SR 3I6QA 2DO4A 3FMGA 4BDPA 3VA7A 2J87A 3CUYA 1HE3A 3HDJA 5ITZB 5LFAA 2GM3A 1NV8A 3G8TA 4DV2B 1I01A 1RAJA 2CV1A 2V7XA 5JU6A 4NJMB 4NYOA 2J3JA 2MQOA 1NE2A 4J9MA 3WZ0A 5AW0A 4Q6WA 3PE3A 1Y5NB 2HB6A 4OQDA 1XJWA 3IRXB 4MP8A 5AR1A 2F9JA 2QTHA 4YXFA 4HQRA 2W8BB 2EBEA 4NEHB 2Z4SA 2ZVIA 3EWNA 3PXEA 2HBQB 5AUQA 3C8MA 5I9SA 4H4MA 4TY8B 3ABRB 5F3RA 4ZANA 3ZDYB 1N6NA 3EGDB 4BO6A 2GVDB 4U9RA 1SVNA 4J0IA 3O26A 4ZDWA 4MQUA 1ISHA 3BDVA 5F5XA 1U09A 3FCCA 1NIJA 4XTRA 4C01A 4BCAA 1G8JA 1GKKA 3RS5A 3MSCA 5JQGF 4YXWA 4KKVA 5DM4A 4ZVOA 2HK7A 1NBMD 4ZCMA 1BJRE 4N0DA 2WF8A 2AH5A 2OXEA 1PJ3A 2HBYB 4BX2A 3FDJA 2YNHB 1WHTA 3LG2A 2FW7A 2JI9A 3UB2A 4R8VA 5TQ0B 3ZTRA 3HABA 1U8UA 4RXMA 5H1YA 3CVJA 3LYLA 5FFMA 4WESB 1LLFA 3FSYA 1IN8A 4S24A 4YT2A 1IJEA 2CZ4A 5FD8A 1TJYA 4C3UA 2XDQA 2WM3A 1Y6GA 2EL9A 4JMLA 1DQNA 3B7GA 4MGEA 5IFKA 4KDFA 4BKUA 2V7EA 4RY8A 3PFWO 2GHRA 2HPZA 3KFXA 4FF1A 4C0SA 5ESDA 4IDFA 5DZSA 2DG2A 3V4FA 1SRRA 3L8GA 3CX8A 4C0BA 3W1WA 1BNCA 4MQ4A 3R3ZA 2B4OA 1Z6GA 2H2FA 3DE0X 1IEVA 5G0UA 3CA8A 4LJAA 2V5VA 3LS2A 2UXDJ 2GAHC 3GONA 1X39A 3THXB 1YZ3A 4NFHA 1C0IA 3PW5A 3D0KA 1X5TA 1HBMB 4KACA 3W34A 1T6XA 4TZ0A 3R7SA 1E0AA 1JWBB 3RYIB 1ZVQA 2Y93A 2Y6VA 3RSSA 4EITA 2QTAA 1O54A 3EARA 2XUDA 1HDIA 4I14A 4CLTA 4YRKA 1R7IA 1SBQA 1OA1A 4AJOA 5IF3A 4R05A 1M6VA 1LBIA 3DVSX 4GX1A 3W62A 2UVRA 1UA1A 3L01A 3H11B 1HKUA 3UAYA 3DBLB 4EF6A 1KAEA 5B0GA 5EZYF 5DGIA 1U2FA 4IILA 3SFVA 5ECDA 2E18A 2KHZA 4MB2A 5LJIA 5KYUA 4D6XA 4NLRA 2X8BA 1ZUWA 3B2NA 5JH7A 3GAZA 4M21A 4F3NA 3T3OA 1RT9A 1YOVA 3P9RA 4EJMA 1LTKA 2G4LA 3AFMA 1WSDA 1NDCA 3PFEA 1BRTA 4X00A 1BXRB 4P53A 1SQSA 3I5BA 3H2BA 4DL2A 2MMGA 4IDNA 1U8FO 5EP1A 1SXJE 5J2UF 3HM9A 1DEAA 4OQPA 3QELA 2HEIA 3OQIA 4M5NA 2VRNA 4ZAZA 3TIVA 3MM8B 2HVDA 3FBEA 2FJVA 2AE1A 4DMFA 3ZW8A 3ETGA 4DUYB 3MOIA 3MQ4A 1ZJZA 1JA9A 1F1BB 4GDFA 4Q9DA 1IBMB 3QJJA 2F1OA 3OH8A 1FMFA 1U99A 1DFHA 2WSFC 3S1SA 1X4BA 4RADA 2VBCA 3DMTA 3MT0A 3W8PA 3WGYA 4WA7A 4GO1A 3RIYA 5FUQA 3IO3A 1YRBA 4HWSA 4C7MA 1QRSA 1K7XB 1JDNA 3JAMY 2JANA 2CUTA 3GLSA 4Q4JA 3HFJA 3HFSA 2GSDA 2O1SA 1DKNA 3Q8LA 2XMWA 2OD2A 3UAZA 2K2QB 2NADA 4PUOA 4KX3A 1P7CA 3LBFA 4RJ2A 3SCIE 4U1RA 5ETJA 5DN6D 3O4IA 3AW8A 1LDMA 3H17A 4BQSA 4GSKA 4U7GA 3C5CA 2OBLA 3PJDA 1AQLA 5JR3A 3AFIA 4FFLA 2IQIA 2PMCA 2FVYA 2OPBA 4MUNA 4NE2A 1PLLA 1H7WA 1ESCA 3RARA 1XZEA 1OXMA 4F6RA 3OCVA 5JY6A 2WSIA 4BIMA 4H4OB 5CFLA 3EXHA 1ZL2A 3I56S 5F4ZA 2LDIA 2DH8A 1V7CA 3OEHA 2VAMA 5CG1A 4LZNA 4HX2A 4R81A 3D1JA 4K5RA 3C15A 2F4VB 4EB6B 4RPLA 1USVA 5CDYA 5JARA 1O95C 1D2RA 3U27A 5T5QA 4N6NA 3CUVA 1WF0A 4USVA 4EABA 4LSMA 1FF9A 1U9ZA 4UCQA 3B6KA 4TQGA 4IDHA 3U0VA 2C2KA 1SMKA 3DDKA 2I2AA 1Q15A 2XZPA 1UH5A 1BC5A 4RF3A 5LOQA 3FIJA 3QYPA 1QK4A 1YR3A 4LWOA 1IBKJ 3IE0A 2F90A 3BGLA 3A36A 4N47A 3DKIA 4LYFA 3HGTA 4LTMA 4PYQA 4HLBA 5DNVA 4OYIA 1QIDA 4WE1A 1KIAA 1JEQA 2LR0A 1HNIA 4AXJA 1OVGA 2OUGA 1ZVKA 3CNHA 2WTUA 1B00A 3VDNB 3LAMA 3CCMS 1NI5A 2JFFA 3D8RA 1M2OB 3SDSA 2CDBA 4IR7A 4IJKA 1K73T 1GG2A 1L5WA 3ZV7A 5HJXA 1HR0J 3CW2A 4B6FA 3B38A 3EFEA 2JI8A 4DA4A 1MMNA 4NI2A 5IT5A 2ZGVA 1N9KA 3K8VA 3MEDB 4DILA 3IURA 3ZG6A 4RMIA 4B5KA 5KC8A 4NJOA 2A4MA 3U02A 1X1BA 1OE0A 2QN1A 2C8VA 5HBGA 4DEZA 5I7FA 3LX4A 5HA5A 1X2BA 2PS9A 3D8UA 4KNVA 2QO3A 5F64A 4YJ2A 1L4FA 1SXJC 2NV2B 5E0OA 1JR3D 3V8EA 4G1PA 1CZNA 4MPPA 1EDDA 4RDXA 3K3PA 1KHTA 2VHEA 3W1YC 1D5CA 5HIKA 4CM9D 4BMOB 2MTLA 5DW0A 1IWBB 2G1UA 1ML3A 4KC0A 4ITVA 3OZWA 3PNOA 1NU4A 2PUVA 3VV2A 4ITSA 1EFTA 4G65A 4YHHF 4KAFA 4G8DA 3KUKA 3G2LA 5M2RA 3HKCB 5K0JA 2W25A 3GJRB 2QA2A 1FX4A 1NVMB 4MMYB 3EXG1 2HU7A 3HHNB 1YKGA 2OIHA 4YPVA 3RIMA 4UXHA 3R8CA 2BFDB 3B20A 4G23A 2BDUA 3FRHA 3E7WA 4L78A 1RWPB 1QE5A 3DLGB 3EUWA 2FCRA 1R00A 1N3YA 2CLDX 5KU1A 4DCCA 3ECCA 5JMWA 4FZ5A 4U7UD 3VSCA 4TVKA 2I6GA 3D9QX 3UFBA 4K05A 1C50A 2JLXA 1C4KA 2VPZA 2FK7A 1JFLA 4C43A 1JIQA 1NCLA 1E6UA 3SQOP 2X22A 3WAKA 3BBCA 2NZ4A 3W0LB 2V5UA 2W4CA 3I0ZA 4JMPA 1OVMA 3T3DA 5E33A 2WPDD 2GPTA 1DRUA 2F9DA 2FK8A 3P45B 3OTEA 2AYGA 5KQGA 4R0JA 3I1IA 5AIAA 4WK0B 1UKAA 1TZKA 3ZY5A 4NCXA 4YC7A 2QYTA 4IDOA 3HJFA 4TKZA 2KYRA 5CTAA 4ZJQA 1NNUA 1CY2A 1FUUA 5BQ5A 5H82A 1HY3A 1NMEB 1RCOB 1Y89A 3PGJA 4DDVA 4FHCA 3H6KA 3F7MA 2N3OA 3FSIA 3A3OA 3NHBA 2K2PA 4N5LA 1BH6A 2XA1A 3SIPB 4F0HA 2JFHA 3ZKWA 3IQDB 3R8YA 1PL7A 5A2QA 3FZNA 5F7XA 4UQGA 3DDOA 2WVGA 3G85A 3UJCA 4KV9A 3B70A 3JQFC 2WFAA 5FUVA 4MKZA 2ZVPX 3AP2A 3F98A 1SK8A 5K8VA 1QMPA 1GNKA 2ZT6A 4PTZA 1W9MA 4OXKA 4N8EA 2QIOA 3T5MA 4ZAWA 1W36C 3VQSA 3RS9A 1BS9A 4ZQIA 2XF2A 3GT4A 4KSEB 4A26A 3BHJA 3BDEA 2HNBA 3SMVA 3EW7A 3KJQA 1OLUB 1IK4A 1EQ0A 3TFQA 5F3ZA 2YTZA 3V2HA 3H1EA 4D3SA 2I9KA 1W88B 1WC5A 2AP6A 5CM8B 5BXIA 2XDYA 3HVWA 2A2ZA 4PNHA 2IIVA 3LT5A 1SB6A 4UCXA 1DLJA 4DV7J 4N48A 3NBFA 2V6JA 5FWAA 2VTBB 4GNRA 1M2GA 1F48A 1C3LA 3KL2A 4OK6A 2A35A 2AW3A 2NUPB 4V0OA 1XNRF 1KY4A 4EKGA 2VRBA 1FUYB 3V6MA 5A6SA 1JDSA 3S44A 3LP2A 1LDYA 5D3QA 4Y67A 5I7OA 3GPLA 1ZAKA 1XZLA 4R0EA 3P49B 5D78A 1Y3IA 3R0IA 4BX3A 5A5FA 4L9AA 4ZJUA 1ZTWA 1QIJA 3Q10A 5KMGA 1JYEA 5FPTA 4KH0A 3O2NA 3L6OO 1YA4A 1YMQA 5A2QU 4FB5A 1O97C 2QN9A 4A8JA 3ISVA 4G67A 4OZ1A 3EVGA 4KFTA 3TAMB 1NR1A 3DXSX 1QGUB 1UKEA 3K1YA 1KQPA 4OATA 5SZKB 2CE7A 1F0NA 4ZVHA 4MCAA 2AZ4A 3OSUA 3HZGA 4D4LA 2Z4RA 3NP5A 1G20A 4CLKA 4C2AA 3L3CA 1G64A 2D5IA 3P5BA 6ABPA 3TLYA 1MLAA 3R0ZA 1E2BA 3ZXIA 3TRKA 5CK4A 3H5UA 2Z1DA 4KR9A 3VSDA 4JP5A 1TEVA 3D8NA 3SKXA 4CH7A 3WQSB 1X14A 3A9RA 4ZQCB 1Y7HA 4WCEQ 4MIWA 1YR1A 3QPCA 1H85A 1Q81T 1DINA 5JQGB 2FR0A 3BDPA 2XQFA 3RLIA 2CNWD 3MWLA 1X80B 2B8WA 4QPZA 2BPOA 3BS4A 4E0DA 4LQCA 3MN1A 3QWUA 3O8LA 2P1ZA 4CLRB 1TR0A 1IPEA 3TSAA 2AUNA 1CEQA 3T5HA 2KX7A 4ZHRB 3HNRA 1SC3B 3LECA 4NYJR 4PQFA 4KNYA 5IH7A 2CYBA 1U2SA 3CZAA 3DC2A 3HO1A 1XZMA 5J1TB 4EJSA 1N5LA 2Q1UA 2ZWPA 4I4TF 2P75A 3RROA 2X2EA 4ZWNA 2VTVA 3MAQA 4NZ0A 1K3FA 1C1CA 3EFBA 2HSDA 2OAQ1 5G0RA 5F8HA 3WDMA 3I72A 1B6RA 1QH0A 2YVKA 3MD0A 1OYDA 4KRXA 4JUCA 3GOQA 2PMBA 2DNOA 3M9XA 1QE1B 2ZM6B 2WB4A 1R8XA 3BIXA 2Q43A 2YY7A 3HB7A 3NIWA 2IV7A 3EZ6A 4GNKA 1TTQB 2QM3A 2C7PA 2HIAA 3DF9A 4NXNF 2P69A 3T1TA 4Y6SA 4DCOB 4Y2AA 2G17A 2YZ7A 4R2XA 4ABTA 1YOBA 1U94A 2GYWA 2PKWA 4LFAF 4Q18A 3EJ6A 3QHQA 1F3VA 1HFKA 1MKYA 4IIEA 1ODIA 5EZYB 2AJFE 2HFVA 1N9GB 3I58A 4BGIA 5D3GA 4WNIA 1RLDA 1L1EA 2O0JA 2G2ZA 4XJSA 4LBWA 2CJYB 2P4UA 4PQEA 3OFND 3DMPA 1F60A 7ABPA 4C07A 4DLKA 2B9XA 3COZA 4TOIA 3D81A 4ACAA 3T0IA 3NH9A 4L50A 5E7IA 3H4DA 4D9KA 2IVMA 1QDEA 1WC3A 4EYGA 3ORHA 4KLAA 4AKEA 3OQNA 1S96A 3PC8C 3NFYA 2DFDA 1I6LA 3NGTA 3O82A 1XN9A 1H69A 5C34B 2JI6A 4DDMA 1DLOA 3TX0A 4PNEA 4M83A 5JQWA 3WLJA 1YJWS 1NDLA 3ONQA 2KM8C 1SCDA 2XYGB 1XHLA 5JUWA 1J0CA 1Q6YA 1PG0A 2HXGA 2P1DA 1PDOA 2RB5A 1DHRA 4WMLA 4M1ZA 4B7ZA 3GDOA 5JSZB 4GUAA 1ZH8A 4S0MA 1W19A 4FNMA 5D86A 1EFRD 1HDCA 2XZOA 2BZGA 2B35A 3FWYA 1PD1A 4S35A 3CNLA 1RKVA 4L57A 2X1FA 2ZZKA 1N5JA 3PR5B 2NACA 3DF7A 3MF4A 2VF5X 5ESRA 5G53C 1DQ9A 2NQ8A 3NCPA 3ZU6A 1C0PA 2I99A 3M0EA 1C9MA 3LQFA 2WI8A 4I9GA 5C24A 5DWQA 5EWFA 1OBVA 1S7GA 1BXZA 2D3O1 1WL8A 2FETA 1HLGA 2IE0A 4UM9D 5LQSA 1ZIYA 1OF1A 3C5EA 1EFAA 1SJ9A 2XY4A 5BURA 2FDCA 1TZJA 1VMBA 1O1YA 1ABBA 3D67A 5DMHA 1M72A 3HBNA 3VR5H 1JMYA 3ZZMA 3GRCA 4IZHA 3EMDA 3L6BA 2BE2B 2CQCA 4DNFA 1GTHA 4WAUA 1NB7A 3MPWA 2OY0A 2JD0A 4QUDA 1TCUA 3DLKA 1O8BA 2DRDA 1WUTA 3I2IA 3KLBA 3NKLA 4LI0A 3NOVA 2AJ0A 2D1SA 2IPOA 2OP0A 3HJVA 4EG8A 3QUAA 2DECA 2CXSA 4ZPAA 1O96A 2BKNA 4YR7A 2JGRA 1VLLA 4DU7A 2CDNA 2YQZA 3PR1A 3RB4A 4CMEC 2H1WA 3FHLA 1S8AA 2MKCA 4XK8C 5A4MS 4GW3A 2V34A 2EJUA 1IBLB 3R77A 2RT3A 4TUYA 4J7XA 1WV0A 1ZUD1 2E4XA 2GS8A 4LJ4A 2EGHA 4D25A 1WOSA 3BUSA 2PJDA 3EXFB 5DPMA 1TK3A 3S8YA 4OX8A 3R75A 2NU8B 1CJTC 3WMXA 1RBLA 3EPKA 1X6VA 4HQOA 421PA 1G19A 3D4PA 2XMTA 4QWAA 1KVKA 3L0DA 3AGPA 3ZI0A 2GRAA 4DABA 4OI1A 4O0NA 4QOEA 1SCQA 3TN7A 3A27A 3MM5B 4XFDA 4WKYA 2FMIA 2ID8A 1RTDA 4MR7B 3CSDA 1XKLA 4MDEA 1E2IA 3J7YI 2E5HA 5JHHB 4QBUA 2IPMA 1TL1A 3A1EA 1UIRA 3ABQB 1GG8A 3KX2A 2PZ8A 2P0YA 3GGDA 4YRIA 2J9FA 2V65A 4GBED 1RWMB 2WSLA 1R37A 4LRDA 5FA6A 3SHQA 3FWNA 1T2NA 3E5NA 3H87A 1ST2A 2WYIA 3UC9A 1XKTA 1KH1A 2GESA 4ZDIA 3FWPA 2YKNA 1YU9A 2OLEA 1ZYQA 3OWOA 1UDRA 3W8GA 4M1SA 1J5XA 4ZIWA 3N28A 3LRPA 2OFGX 4UY8T 4MV5A 1QOQB 4FCCA 3GU0A 2O4CA 5K6AA 3VAMA 2ZDHA 2UXCJ 2V59A 2PH3A 2QLFB 2H54A 3KVVA 4L8GA 3LA6A 3ON5A 5AT1A 2XCQA 3PEYA 3UWOA 4GVLA 2ZU6A 2BJEA 1N75A 1FIUA 5E0KB 3IKMB 5SYAA 2W22A 4D82A 4LBIA 4RULA 4E8UA 1E77A 1K8XB 3VZCA 3C16A 1IKVA 5BWOA 3VF0B 5FA5A 3WHPA 1QDUB 4RABA 3NUZA 1C4CA 4IRCA 1FRVA 2PCJA 3P4UA 3F6BX 1QGZA 3E15A 3K70D