1B0TA

D15k/k84d mutant of azotobacter vinelandii fdi
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTKCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEDKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PROTEIN (FERREDOXIN I)
publication title Crystal Structure of the D15K/K84D Mutant of Azotobacter Vinelandii Ferredoxin I
rcsb
source organism Azotobacter vinelandii
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b0tA00
1SIWB 1G6BA 4ID8A 7FD1A 1FRIA 3EXYA 1BWEA 1Y4ZB 2Z8QA 3EGWB 1JB0C 4OV1A 1GTEA 3MM9B 1FXDA 3GYXB 3IR5B 3MM9A 3MM5B 2C3MA 3MM5A 2WSCC 4XDDA 1FRKA 3MM8B 3MM7B 1FDNA 5CHCB 1DURA 1F5BA 5L8RC 6FDRA 2VPWB 1R27B 1PC4A 1DFDA 1D3WA 1FDBA 2Y0SD 1IQZA 1FD2A 2VKRA 1FRLA 2FD2A 3PNIA 5CH7B 1A6LA 5BYSA 1Y5IB 2FJDB 2C3PA 2IVFB 1Y5NB 2WSFC 5BYQA 1FRHA 1FTCA 3MMBB 2PMZD 4DHVA 1FRMA 2PDAA 3IR6B 3MMAA 3MMBA 1KEKA 1FEHA 1JNRB 3MMCB 4CI0B 1C4CA 3MMCA 1HFEL 5BYRA 1F2GA 1BD6A 3MM6B 3LW5C 1AXQA 1FF2A 1GTHA 2V4JA 1H7XA 3MM6A 1GT8A 4XK8C 4KT0C 7FDRA 1BQXA 1KQGB 1BLUA 1ROFA 2V2KA 2VPYB 1KQFB 1RGVA 1VJWA 2VPXB 2FGOA 1FDAA 1FDDA 1XERA 1WTFA 4AYBD 1B0VA 3EUNA 1FCAA 3OR2A 2C3YA 1G3OA 4L6V3 2VPZB 1B0PA 2FJBB 3MMAB 5FD1A 2C3UA 4Y28C 2FJAB 1FRJA 2XSJB 3C8YA 1DAXA 2PA8D 2XSJA 2V4JB 1GAOA 3IR7B 2FJEB 1H0HB 3OR1B 1Y5LB 2WAQD 3OR1A 4YDDB 6FD1A 4OMFG 3HKZD 2GMJA 1C4AA 4RKUC 2GMHA 3OR2B 1Q16B 5E7OB 1FERA 2C42A 1IR0A 4XDCA 1B0TA 1CLFA 1FXRA 1F5CA 2WB1D 1SJ1A 2WSEC 1FRXA 2UZAA 3MM8A 2C3OA 1H98A 3MM7A 1K0TA 1SIZA 1PC5A 1BC6A 1JNZB 1H7WA 2ZVSA 2FDNA 2O01C
chains in the Genus database with same CATH superfamily
2CFXA 3ILLA 1WF0A 2FHJD 4ZDNA 1SKUB 2NYHA 3S01A 3R5CA 1S1VB 2HNDA 2OSRA 2YVSA 1YRTA 3BREA 2GA7A 3Q8UA 3FMWA 1L5UA 2FVSA 4B3RJ 4K8RA 2AEFA 3LGMA 2HNDB 2DGWA 4HL9A 4WU2A 1LW0B 1JNRB 1N33J 4UTGA 4JI4F 1JXLA 3W1YC 3RBZA 2YWKA 1IXKA 4V19J 4DL3A 4KBIA 2OH2A 2C2OB 4USTA 3R27A 1HNXJ 1WDTA 4NA1A 3RRHA 5HVHA 1FD8A 3G71S 2HIYA 3LUYA 3POTB 2DGXA 3SV3A 5KT2A 2GIFA 2N3OA 2ZFHA 2PEHA 2OTJS 1BC6A 4DPTA 1TU0B 2B4UA 5ETQA 5KOWA 3WQPA 1LW2A 2ZKTA 1JQGA 1VRUA 3PDNA 1HYSB 2RHSB 1N5VA 5L8RC 1UPMB 2V8HA 3IAS9 3UI3A 1IVZA 3P5TL 4C0BA 1RWUA 1Y5IB 4FNIA 4CH7A 2KXFA 1QLNA 3N28A 5IT4A 4LF5F 5GAEI 4TY9A 4XK8C 1T05B 1SCJB 1VJWA 2NUHA 4B9VA 1WWHA 1FDDA 1FNXH 3A4TA 3G8TA 2F8EX 1J5OB 3D0IE 1RQ0A 2Z0GA 4FS1A 1CC8A 2QFIA 1B7FA 2R7XA 4IRDA 5HANA 1VC5A 3MR2A 1WC4A 3G6VA 1C0TA 1ELOA 2KTQA 2MPUA 2G2ZA 1MMNA 1U49A 2RAQA 1EKRA 4UUXA 4DQRA 2HWIA 4J9QA 4DFPA 1RBAA 2QA4G 4C4WA 1CSJA 3KLHB 1C0TB 2OJ3A 2BE2A 2XLJA 2KG0A 4ID5A 3RB0A 1U8SA 2XMMA 2HW3A 4OZ3A 5C7PA 2YKOA 5E3CA 2HBZB 1KQKA 2DIVA 1AYEA 4HDHA 2BE2B 2R7QA 4WYWA 3BSNA 1HNIB 5CZXA 3CF5Q 1KFDA 4ID5B 1HQEA 3DKDA 5C2GA 1T03A 2GHPA 3EGNA 1XR7A 4KRWA 2IYGA 4KJIA 3ICLA 1S5ZA 3QFWA 1ZS6A 2LQ9A 3SSSA 3OL7A 1VC0A 3FCWA 1VBZA 2AEJA 5JMNA 4ED5A 3GIKA 2G9OA 1K47A 5H9FJ 1N5YA 2D9OA 2QTWA 2H9ZA 1D8YA 5ETKA 4OMFG 4HYKA 2DNLA 2M70A 4ZP6A 1MWYA 3OV7A 5F3TA 1H74A 1F5CA 2WB1D 1KVJA 4URSA 4CDIA 3J81U 1S0NA 2YKQA 3NEKA 3OVAA 2ZH4A 2OI2A 3QT5A 2UUAJ 4USKA 2EFPA 4URGA 3IWLA 5KG4A 4FXVA 4JI1F 4DPOA 8RUCA 2UUCF 2N7CA 4X2BA 4U8VA 1Y7PA 3W5YA 3CCSS 2AV5A 1RT7A 3MMBA 3P8BB 2HVIA 5CCLA 4BC7A 5DDPC 4O0IA 4G1PA 2YTCA 2KHCA 2VPYB 3ET6A 2OPSA 3KHLA 1OWXA 1QD1A 1RT7B 1L3UA 3QGPA 4Q0BA 2U1AA 5DM6Q 2ZH8A 1TFWA 2U2FA 4C48A 1U2FA 3DLGA 3JTNA 3BSOA 2DCLA 1FI4A 3EPIA 1QAIA 3M9MB 5KFPA 4LSNB 4Q0BB 4WFYA 2JFDA 2OMOA 2D3UA 5K9FA 2FTRA 1N88A 1FRXA 2C3OA 3DLGB 4PEOA 2X7IA 5B0EA 2XG8A 3EVMA 3OTBA 1JNZB 1PBAA 3ZTSA 1O51A 3DMJA 1S10A 3D7SB 2RDDA 1S1TA 4LUBA 1S49A 5LOQA 1NBEB 5DDOC 2OUGA 5HLFA 3W9HA 1NJIT 1RA7A 2VC0A 1U1KA 3CJSA 1R43A 1HMVA 1NPKA 1RHMB 5JXSA 4I1TA 1KONA 3P4UB 5C42B 5DG7A 2E5LJ 2POKA 3DMJB 2XZDB 1S1TB 2HZCA 4LFAJ 3OTEA 1KLMA 2AYEA 2XCAA 1RWNB 4FN5A 1OQ3A 3OFHA 1S1UA 1I3OB 4YB5A 4DEZA 3IN5A 2BJ1A 4PAAA 4AL7A 3Q8VA 1WG4A 5CZVA 2VONA 4PG4A 3QT7A 1TVRB 4X65J 2I9SA 1QUPA 3AOCA 4DV2F 3BDPA 3HZEA 1NSAA 1S1UB 4LF9J 2BW7A 2RMLA 3DRYA 2IHR1 1P1LA 2P6TA 3M8WA 1JK9B 4OJHA 4J9VA 1N0UA 5AE2A 3TVYA 2AT1B 4ZA1A 4XDCA 4A8KA 1OY9A 4QWBA 3VAFA 2DGSA 2VQFJ 3SCIE 2RB7A 1D9DA 4C8OA 5CA5A 1TL4A 4EEYA 3EXYA 2XI3A 2CG4A 1BQNA 3JTPA 2IFXA 2XB2D 1PJ7A 2FC9A 1Q8IA 4DSEA 2XHCA 1BQNB 2AGOA 3GCXP 3ISND 4DUYF 4DV6J 1RT3B 2JDJA 2V4RA 3VAJA 3HJFA 3IR6B 2I6WA 5B09A 2B4OA 4U9RA 4ATNA 4NRUA 2VD3A 1WUUA 4WTYA 4X66J 3J81Y 3FEZA 1HLWA 2J7KA 2YKMB 5KFRA 1KQSR 1WSVA 1BXNA 1T9VA 2DEJA 4DU7A 1XEZA 3HVAA 2C2RA 2YXLA 3PKMA 1T9XA 1GXLA 2IY5B 5BR8J 4UZBA 1X5OA 1YJUA 4WK1A 3E2EA 3R6GB 2CPEA 2M52A 1H73A 4IKAA 2DY9A 3OXLA 2MQNA 4KB7A 1FTRA 2ZBCA 1ZTTA 2BXJA 2NPFA 1W26A 1UCNA 3IG1B 3Q24A 2R8IA 3NMAA 4I2QA 3CJTA 3KLGB 1C2PA 1B70B 4CLYA 4DV1J 2CPDA 3NAHA 4ZPDA 2M3DA 2IBOA 4ZPVR 3QYYA 3OLAA 4I2QB 3BGFA 2EEYA 4F0HA 4JI0J 5I3UA 3GZ7A 2EC0A 2YWWA 3H2LA 3B54A 3V6KA 3BKTA 3EVWA 4K4ZA 5IZHA 2LXFA 2MZQA 2LDIA 5I3UB 3VV2B 2HVHA 2YX7A 3CUNA 3GILA 5KFTA 1F2HA 1RT2A 2YKPA 3JSMA 2AHOB 1X4CA 5KFCA 4DR5F 3QMQA 3MR3A 1XN9A 4LSZB 1FVSA 3D3BJ 3RRGA 2W01A 4F0MA 3IGNA 2K06A 4K0KF 2JLEA 4F3OA 2XBPA 1V3SA 2UXCF 2M2BA 3CW2C 1IKYA 2ILYA 1OO0B 3A8EA 5L38A 5KFVA 5H9EJ 4J9NA 2BQUA 1FRMA 4C2MA 2D9PA 3V4IA 1SJRA 1RWXB 2IDEA 1RAFB 4YP3A 4FP9A 2V2VA 1IKYB 4AYBD 2AJFE 4ZVQB 1S1XA 4PG7A 1EB0A 4YB1P 1YJ7A 3MPUB 3DLHA 3V4IB 1KR4A 2VDHA 3I96A 1SV5A 5EX0A 1YKWA 3C6TB 4WXOA 5DQGA 1YVFA 1C1BB 2HK2A 5I4MA 2PO4A 1S1XB 4BDPA 3MEDA 3ENQA 1XJWB 2UUTA 3ZXWA 4A48A 1QJHA 2V5HG 3TWZA 4CLTA 1SV5B 1UWBA 1YZ7A 4M5NA 1OYEA 2VFSA 2RRAA 3MEDB 4X4TA 4CZCA 2K8GA 2DHHA 3BM7A 2LVWA 2IRYA 4U95A 4TYBA 4ILRA 1UWBB 1ZPVA 2XNQA 3SDEA 3R1LA 2HNZA 3GLJA 3KLIA 5ETNA 2XO6A 3W65A 2PEBA 5KT4A 1CS4B 1N5QA 4H4OA 4DSKA 4YY3F 1HFEL 3SDEB 4DPUA 1DJ0A 2HNZB 3A12A 3N0VA 3CJ3A 1BLUA 2B51A 2B6AB 3RBDA 1B3TA 4WTOB 1FCAA 4PWWA 3H2UB 3T41A 4PXEA 4H4OB 2YQ3A 3KK2A 1R0CB 5IWAF 1N5SA 1D0EA 1NB7A 2BRLA 3KK2B 4CT9A 2XSFA 1I94F 5HMWA 2PC6A 4KGMA 1GMWA 2BKNA 1SPBP 3CJRA 3VAKA 3CMES 4WFNQ 2VDIA 1BWEA 1WELA 4DR6F 3NNCA 3US5A 4KIAA 3CCJS 5CYMA 1D1UA 1UJ4A 5ETTA 1SVDA 5J2MB 4WBFA 1IKXA 2VBXA 1X5SA 2X1BA 1R27B 4QWEA 1KDNA 4JI1J 1RHUB 3JQKA 4QWDA 3CIZA 1EHWA 2JWNA 3D1QA 2XO7A 3K5NA 1IKXB 2X1GA 5D0HA 2RIJA 1YQHA 3HFVA 3TW0A 2DHGA 2A1BA 2VOPA 9RUBA 3VQTA 1QSYA 1O0PA 2R2TA 2EKYA 3KJNB 4TLRA 2CQGA 1QVFR 1FRJA 4NPOA 1SJQA 3FRYA 2FUG9 1PIEA 1VRTB 2JC1A 3AA9A 2EVZA 1FWPA 1HBOA 2L08A 1T11A 2UUBF 3IM9A 2ZHAA 1VLYA 2QA4S 5EN1A 1UETA 2APOA 3EGZA 3MM8A 4PR6A 1VBKA 2WW4A 1FKOA 2Q1LA 3T5JA 4ZMMA 4RNMA 1O6XA 3PYFA 1HBOB 5E0OA 1DARA 5KFAA 4X84A 4PKDB 1LKZA 1IJEB 3GIJA 4HHUA 3MZIA 4X4OA 2EFOA 1KOOA 3ETOA 3MM8B 1DURA 2DITA 3L3CA 1FKOB 2Z4PA 4FF3A 4JI6F 3MMJA 1MLAA 3CVKA 4Y2MA 4DQPA 1FEHA 3GV8B 2DBBA 1IKVA 1U1LA 1WF2A 4KR0B 3O8WA 1YX2A 5GAGI 1QSSA 1PILA 2E5HA 3HP6A 3NS6A 3HHLC 2K2PA 4O4RA 1HA1A 4TU8A 1NH7A 4R8UB 1LWCB 2DHAA 4OI1A 4A4JA 3KUGA 1IKVB 2VJUA 3HSDA 1REVA 2KB2A 4HDGA 3OR1A 4EFAC 1U48A 2VUGA 2W4CA 3U1LA 3UPFA 2YKAA 2HQDA 3A8KA 4DPWA 4C97A 1REVB 3MOJB 3M32A 5KG5A 1CULA 2NUUG 3QAEA 3UO0A 2IM0A 2YNHA 3H0PA 4OYOA 4NLXA 5CHCB 2W25A 5I42A 1U7LA 4NYZA 1NNDA 2BYCA 2R7VA 3RRKA 3C6UA 4OQJA 4NCAA 2ZZTA 3BR9A 2YNHB 1GMVA 2BRKA 5BYQA 3ZTOA 2WCXA 4DG1A 5A76A 1WORA 1ZOTA 2ZBPA 1HBMB 4JI2F 4CTAA 4U67Q 3C6UB 2YWFA 1F3FA 4NLYA 1XNRF 1FDAA 1CJTA 2DPJA 1Q78A 1Z2ZA 4C3KA 3GONA 4USMA 4P7VA 3KUEA 4LF4F 4DG1B 4DF4A 2R7OA 2J0QD 1TKDA 2CQBA 4ZVTB 1M5KC 4CTAB 2W9BA 1SJ4P 4WF9Q 2J76E 2IA6A 4P72A 3EJMA 1CJTB 4A8WA 4F3QA 2BM1A 4F3MA 4G1QB 3R5JB 3CC4S 5A2QY 1H7WA 2W9BB 5HO4A 3EZ5A 2HRUA 4GKKF 3RR8A 2E5GA 4YN3B 2UU9J 1FXDA 3EMTA 4PG6A 3UWTA 3MM9A 4J9KA 1OYDA 2AIRB 2E66A 2DISA 2XZWA 3L7PA 2HHSA 2IC3A 4C6AA 1UJ6A 2HGMA 1NSQA 1SL0A 5ETVA 1Y11A 2QLBB 4W90B 3CE8A 5D0EA 1H72C 5HSPA 3LALA 4CO4A 5B7WA 5C24A 2WTFA 2W1BA 1JLEA 2IC3B 2V0NA 3TRGA 5KFEA 5ETRA 1HHTP 4L73A 3JSRA 4WJBA 3HO1A 5C24B 1B0VA 2QFJA 3AJ1A 3EUNA 3UNYA 3G6YA 3H59A 1JLEB 5D4LA 2NSBA 2C3UA 3CJ4A 4FKXA 4N7TA 4N56A 4WE1A 1DQ8A 1RISA 2HVDA 2UVVA 1F60B 1NSPA 4M5HA 3Q8QB 1P8GA 3GR0A 3UW1A 2YWGA 1X4DA 4JI8F 1Y00A 3FCVA 3RR7A 3SEOA 4KGVB 4BWMA 4WFBQ 1U0HA 5J2QA 4WE1B 3TNVA 3W7BA 1XR5A 2B8QA 3LF0A 5KFYA 2VV5A 4ZPBA 4Z37A 4QOTA 1PO6A 1RWVB 4HEA9 4Y3CA 4J9SA 4JB8B 2CNNB 4DR5J 4PABA 5F9LA 1U0HB 4DR1F 1X7VA 3THVA 2ZITA 2OHDA 3DOMA 1F5BA 1E6YA 1ZAXA 2HWTA 3RAQA 3KK1B 5B0AA 2HQFA 3C16B 3PACA 1TKTA 2UXBF 4K0KJ 5CAAA 4DHVA 2CA9A 5B08A 1YBTA 2HLTA 2LQ5A 3DOLA 3DOMB 1E6YB 3VALA 2KN4A 4IRCA 1KWMA 1KQGB 1X5PA 3AH6A 1U1QA 1YJVA 1KVKA 3H98A 3PY8A 3IGVA 3DOLB 3R5DA 1Q1KA 2DNGA 2JC0A 3TUIC 3NNHA 3HSZA 3U02A 2PA3A 2FHKA 4QQBA 3G9CA 5KT7A 1AFJA 4WZMA 3OHBA 3P5BP 2XC9A 1D9FA 4ALZA 4OZNA 4DV3F 2DCUB 3I87A 4HACA 2HRTA 4UOHA 2M0GB 3CCMS 2QL5B 3LA0A 4ZVEA 2P5VA 4F4ZA 4Q45A 1MU2B 4O3QA 3T1AA 5KT3A 4HKQA 4RBVA 1ULRA 3RZAA 4FXWA 1FJCA 3AY0A 1FK9A 1V3ZA 4HACB 2KO1A 1DLOB 5M2PA 3CC2S 4LT6A 4HI2A 2MSTA 4IFYA 4CO0A 1V9OA 1DTQB 1WD6A 2GQQA 1FK9B 2G13A 2QV6A 2IJRA 4YR3A 3OXGA 3DGPB 2BA9A 5C25A 3HULA 2EKNA 2UV8G 2GC8A 4X62F 4YY3J 2CQ1A 4QIWD 1B0PA 3E3XA 2DNQA 5T7LA 2QG9B 1WF1A 3NGSA 5C25B 3HVWA 4D3HA 1W25A 3K0JA 2OFHX 5HBMB 5JUMA 3M8PA 4OZ1A 4O3NA 2A2CA 1TKZB 2D69A 1FERA 4ZVFA 4EBDA 5IWAJ 5T7LB 3M2UB 1IBKF 3DNCA 4LF1A 3M8PB 4AD6A 2W8LA 3R5GA 3ILJA 1N32J 4GO5X 2A0FB 3QGGA 2JOQA 3RAMA 2BM0A 3CO0P 3MM5A 2YH1A 2QIFA 3AOBA 2V8GA 3R97A 3TUPA 2QMUB 4DR6J 2VPWB 4C0OC 3VVUA 5CYJA 2B5JA 3PO4A 3RG6A 3CD0A 2A2DA 2XS7A 4DU8A 2XYGB 4ZJQA 4DV7F 1Q8KA 2Q79A 1VQPS 3MEGA 2MDAA 2DNYA 2E9ZA 1HR0F 2EK1A 4L6V3 4KGXB 4NLQA 2IVMA 2FB0A 2QLJB 4DV0J 2FJAB 3I31A 3U27A 3N6NA 1QSLA 1R6YA 1YLXA 2KH9A 4X4NA 3MEGB 2BDPA 3CMQA 1SC1B 4RNOA 3LH2S 4PG8A 4YHHF 4NE9C 2OSQA 1M1HA 2M88A 5KFDA 1RWPB 3JAMU 5FLXU 3NY0A 4JV5F 3ZZPA 1FWKA 2V63A 1U1RA 2R4FA 1GFWB 1MW7A 2DXFA 3TOQA 4ZP9A 2XMWA 4QZVB 2JH3A 2ZUGA 4ZJOA 1JLGB 3BDEA 3J7YI 2R8HA 4DQIA 3D9BA 4C8LA 3I5CA 3NCPA 4XAKA 3RB4A 4OYWA 3O44A 1LNQA 1JLQA 2XWYA 3A13A 1S6QA 2HFSA 1CJKA 2DHXA 3UR3C 2CDQA 1JX4A 2V2KA 4EMDA 2HMIA 2HHUA 3DC2A 4Z7CA 3NOGA 3QQCD 1JLQB 2R2UA 3R7BB 2PE8A 1DBDA 4OYPA 2HBRB 3C8YA 2RF2A 3Q89A 3IMQJ 2VF3A 1RAAB 1Y5LB 2WAQD 1UVJA 2HMIB 2GMJA 3TYTA 3IWXA 1FKPA 1M5VC 1F0XA 1XBWA 2HHWA 5IC4B 2GZOA 2XY5A 2V9KA 4CLSA 2C2EA 1LFPA 1N6QA 3D6TB 3BEGB 1R8PA 2RF2B 5AT1B 4RLEA 5JVHQ 3BBFA 4ZP8A 1RI7A 1NHKL 1P9YA 4P2SA 2ZM6J 1FFWB 1P1TA 1HBNA 2PFDA 1FKPB 2HQ3A 2A6MA 2YNFB 1RAEB 3DRRA 5KTQA 4P2FA 3MCOA 3HKWA 4JI5F 1GX5A 3W8PA 1O5JA 2IPOB 2AD9A 3I0RB 2FD2A 5CH7B 4G1IA 3AODA 1HBNB 3FBFA 4M94A 2B9WA 3D4JA 3DRRB 3QT6A 3CJKA 3M8RA 3V2UC 1RKIA 5DGBA 2GX8A 1WC1A 2J8SA 3GU0A 3PO5A 1R0BG 2HHTA 1LV5A 1DY3A 1TV6A 1WACA 1T0TV 4JI2J 3CJKB 3N6LA 2F5GA 2NPIA 2B4VA 1S57A 1XNRJ 2HVEA 2J7UA 3K7RA 1Z1ZA 2LLZA 3MUVP 3UN3A 3A8IA 3QJPA 5KT5A 1BGXT 3CCWA 3G8QA 3IS9A 4LVNP 1KN6A 1NDCA 2WSEC 4DR2J 1SC4B 1T8EA 3HFZB 1YRXA 4F67A 5F8IA 2E1AA 2BKOA 5K8NA 2OLWA 4GKKJ 4GMKA 1LWFA 1JLCA 1HQUA 5HQ8A 1BY9A 4DSFA 3FNNA 2I8EA 3NS7B 2EBEA 2RU9A 1CPZA 2VQEJ 5KFWA 2YQ0A 3MURP 2R3VA 1LWFB 1S7IA 5IV4A 1JLCB 3O1LA 3QRPA 4NXMF 2K3KA 3LP0A 1HI0P 4MKBA 2FPHX 4DFMA 1RTZA 3EGVA 2LEAA 4ZP7A 2G1DA 2LYVA 3FMBA 1S9GA 1K1QA 1R8CA 4FF4A 4K4XA 4F7VA 4UF4A 4K4UA 2QE5A 4IDKB 4NRTA 2DNMA 4JYAJ 3LP0B 3KHGA 1UZDA 1NKEA 1I5OB 1JLAB 5KFGA 3OTOF 4YDDB 4RKUC 3PZPA 2DGVA 4JI8J 1FXRA 3CULA 1A0OB 1MWQA 4KHPJ 3QJLA 2NCKL 2Z30B 3MR6A 2C2MB 4N8NA 3H40A 4KV8A 3P3DA 4ES2A 3SV4A 3EGWB 3KLFA 4KHMA 4OZ5A 4ZCMA 4WP9A 2FY8A 1MMDA 4Q8EA 4DSJA 3B4DA 4X4QA 4DR1J 4KV8B 5J2NA 3G82A 2WVCA 3NS5A 3SYZA 5HP1A 4L3NA 3UDLA 2CVEA 5M2UA 3KLFB 1RTJA 2F3JA 2EFQA 3MMCB 1RLCL 2UXBJ 2MZTA 2NXCA 2AGPA 2W7PA 3MDFA 2FIUA 4IO9Q 3TEGA 2RQKA 2COLA 4P2MA 3G82B 1ZH5A 5HP1B 1SQFA 2OPQA 2NXJA 5ETLA 2R8GA 1WOSA 1B7YB 4X4VA 2ZWOA 4QPXA 3UD4P 2B0GA 1YGYA 3GIIA 2GJIA 4S0MA 1KNZA 3PRDA 2VU5A 3C2PA 2MQMA 3Q23A 4FBTA 2PGCA 5HI7A 3V81A 1R0AA 3FBBA 2F9DA 1HPZB 4NZ0A 2I2YA 1PC5A 4MFBA 3C14A 1RCOB 4ID8A 2FZCB 2VJVA 2BANA 1VQ8S 5A8KA 1YG0A 1NK0A 2VL1A 2DNZA 1R0AB 4LRCA 4J90A 3SZ2A 3M30B 3T5KA 2OKQA 2DNNA 3ZFVA 2BR0A 2HHXA 3DDKA 2BANB 4O3OA 5A8KB 3EDQB 2UUWA 4DL6A 2M5YA 1TL3A 2GAHC 2GO8A 1UEUA 4NI2B 2LECA 3QRQA 3JB9k 1GT8A 1BQMB 4WIQA 1PYOB 3D28A 3CD5A 3MEEA 3MUTP 3OSNA 3HM9A 4PQUA 4F26A 4X62J 4Y65A 3UCUP 2HG4A 1WI8A 3MEEB 4TKTA 5LMNJ 1CQNA 4DV5F 2DTJA 2G2OA 5GMEA 5LT5A 2CYYA 2R7UA 2DRDA 3I56S 4HR2A 2HK3A 2RNEA 1IBKJ 4GRSA 2XMKA 2C28A 3NKYA 3IRXA 1NPRA 2E1PA 4NMLA 4FZVA 1OPIA 3LOUA 3BGUA 4ITSA 2XLIA 2QEXS 4LRBA 2MKSA 3CJ2A 3HPOA 4QW8A 4CLPA 4DS4A 2BV3A 2O67A 4OHWA 4DV7J 2VBWA 4MT1A 3PVXA 3R5AA 4C11A 1QAYA 4LFCJ 4IH7A 4D3GA 4K4VA 4NA3A 4DCPB 3PG9A 4JBCA 4OYAA 1ZA1B 1H0HB 4YR0A 1NRKA 5HMXA 4ZJLA 2QA1A 4P9SA 3R6LB 4X4SA 5E5NA 2YX1A 2KJVA 3NL0A 2R7TA 4HH0A 4I69A 4YHHJ 1IUJA 5CYQA 3K57A 2MY8A 4N5SA 2AF6A 1SQEA 7FD1A 4RZRA 4LSLA 2JEIA 2FQQB 1Y4ZB 4PYDA 5F3ZA 2QT7A 2DVIA 1UWAA 4MKVA 5CYQB 3RU0A 1Y3KA 4RUHA 2BE9B 2JHEA 2QLXA 4IH5A 2ZUAA 4N76A 4KO0B 3OQ2A 2AMCB 1EKSA 1FRHA 2JNJA 4L75A 5HMYA 1IM6A 2FVPA 1U1PA 3UN2A 2JL9A 2WRMA 3FEXB 1S72S 4DQSA 3MEKA 4ECZA 2DR6A 2A3JA 2ZDOA 4F4KA 4N77A 1C0UB 2V6AA 1BUXA 2XSJA 2H1YA 4PG5A 4F0KA 3W2WA 3M6XA 1XC9A 4IOBA 3M9OB 3G96A 4QIFA 2D3OR 3TI0A 3IXQA 4C3LA 2YPZA 4RW4A 5D0RA 3SI8A 2VBZA 3AAWB 1TUGB 2PMWA 4RNFA 1SIZA 2BJ7A 3W2WB 3H5XA 2AJ1A 1RCXB 3KKFA 4HVZA 3MAHA 2ATLA 3SMZA 1GTEA 1HW8A 2J5AA 1NDPA 2MGZA 3CPWR 4K2XA 1YWXA 2VKRA 1YIJS 3H7HB 5EWGA 3I55S 4JI5J 4B3MF 3LANA 5IT9Y 3EDRB 1E6VA 2MY7A 3KTQA 2F7VA 2MGZB 3S7RA 4OYMA 2G2YA 2AYMA 2FGOA 1RABB 1T94A 4I6AA 2FJBB 2KFZA 2YNIA 2B7CB 1E6VB 2FHMA 1CG2A 4Q5VA 5AXKA 3FVYA 2D41A 4DX6A 1XTZA 2ERRA 2HHHJ 4Y2IA 1H2TZ 5EHHA 1IN0A 1WDDA 4M63A 1VK8A 5EDWA 4NLGA 3CDEA 1RADB 4JV2A 2AEMA 4AQYF 4C3MA 4NLDA 1TP7A 2BX6A 5RUBA 1NSKL 2RHQB 5L1JA 1GH8A 1TL1B 4RWWA 1Z4UA 2VHGA 3QO9B 4RO0A 3ZZUA 1EQMA 1IBLJ 1FD2A 2XS2A 1APSA 3G87A 4Q8FA 1S9EA 1HNWF 2VB6A 2RDIA 3KNGA 4AE5A 2HFZA 3ISNC 3A1YG 2FYXA 3PW2A 1TK5A 1MN7A 3BO2A 4J91A 4A8XA 1RWMB 1B99A 4PWUA 1S9EB 1YRUA 1TUVA 1RU1A 1N34F 2E1RA 3BR8A 3EZUA 4UY8T 1XMQJ 4IG3A 3PRBA 2O5DA 3BGLA 1P9QC 2HHPA 2CJYB 1YITS 3SFUA 3SQOP 4ED0A 1T95A 2HNYB 5F8JA 3OFFA 1SBRA 2ZVSA 2QGFB 3OHAA 4G65A 3ZZRA 2BQRA 2LEPA 4OV1A 3RGIA 3DU5A 2CZVC 1UP1A 1UFLA 4L72B 2E1MC 4CLWA 1D3WA 1VQSA 2MZ1A 4FYXB 1T02A 1LQ9A 5A8WB 3TUZC 4ECWA 1ZM9A 4QWCA 4ZOSA 3DXSX 3LWMA 2DNOA 3FGVA 2WOMA 1A9NB 5HVGA 3HD2A 4RW8A 3K17A 1N36J 2R9LA 1SKWA 1ROFA 3K5OA 4P73A 2A6OA 4NLRA 2ADBA 1SKSA 3R3TA 4M5GA 3H5UA 2WOMB 2WVFA 1JJCB 2BOAA 3I5AA 3N9UC 3SBMA 2W4DA 1Q7YT 4U6PA 2RKIA 1PG5B 3M05A 1FA0A 2RRNA 5D77A 4ICLA 1QM9A 4ER8A 1S76D 4CQ1A 2NXNA 4KY3A 2GHVC 3H5YA 3CO9A 4ZITA 3K2YA 2IAJB 1S1WB 3KOAA 2RKIB 3OUYB 1NKCA 4IR1A 2O01C 4ICLB 2AGQA 4V1Ak 1FRIA 3L7OA 1S4FA 3D67A 1K73T 4BS2A 2Q43A 5A0YB 4TU7A 1WG5A 1XR6A 5K8MA 3CCQS 1R3NA 3GB0A 3MGJA 3MTJA 5F8LA 1VQOS 2FJXA 2IVFB 1QDUB 2PDAA 3Q8SB 2F63A 3V6HA 4J9UE 1JWWA 4OYZA 4AXIA 4ZVPB 5BYRA 2DH8A 3X3UA 2BEFA 4PPZA 3G4SS 1FO1A 4LR7A 3MPDA 1FNOA 4LRAA 4OX6A 3QATA 4KTQA 2AJQA 1X9MA 5HN0A 3LPEA 3GG1A 2GGPA 3OSPA 3DHWC 2VG5B 1NUEA 1HWUA 2UVWA 3W5ZA 5DG8A 2AU0A 4OX8A 1Q16B 3LO3A 3QIPB 3WX8A 1AUDA 1VC6A 3AA8A 4DN9A 4NASA 4GC7A 1X0FA 3THPA 4B9UA 1NCLA 2EC2A 4FVCA 3RYLA 4ZHRA 2E1CA 4ELVA 2YX4A 2F4VF 3IR5B 3PJ9A 2YNGA 4LF2A 4ZIWA 4NCGA 5T14A 5B0CA 3N01A 2IA0A 3D5MA 4FF1A 2LQ8A 3R2DJ 3BO4A 1EETA 1WHVA 1U47A 4EWTA 2AX1A 4KH0B 2HFNA 3T9NA 1KTQA 3DM2A 4NCGB 3KK3A 1EX8A 3GJTB 4U96A 5L1IA 2VG6A 3GPAA 2B8PA 3UQSA 1U4BA 3F41A 2MMYA 3DLBA 4JP8A 4WWSA 3KK3B 3VQSA 2VG6B 4U8YA 2BBEA 4URQU 2GMLA 1G4CA 4DV4F 1GMUA 1AROP 2HGLA 3H20A 2NZCA 1HI8A 1XQIA 2K1RA 3MOZA 3KUHA 2MHEA 2EPIA 3ZTPA 1Y3JA 1JMTA 1LW2B 3BPDA 2IJFA 1QTMA 2VZ9A 2F9JA 1VRUB 2KT5A 3T3FA 3PTWA 3HCXA 2C1EB 2K1RB 4P52A 4F2SA 3ULHA 2ASDA 5LM7E 1WTBA 2HBYB 2IMWP 1H3DA 3NBPA 2ACYA 5IV3A 4NLPA 3M1VA 1N54B 3BN4A 2HQGA 1X4HA 3MI7X 1RYSA 1X60A 3QZ8A 3GFZA 1V6HA 3CT9A 2OD4A 5FD1A 3NBPB 2FJVA 3QIDA 3M1VB 2JZ5A 1J2VA 2PA8D 2QYCA 1HIYA 3ZZYA 3ZZTA 2X3GA 1YJTA 3TVZA 2AYGA 2FZKB 6FD1A 2PFFB 1NLKL 1OJ4A 2CPIA 2KT2A 2EFVA 2ZH5A 2KHDA 2R7SA 4XPEA 2FLOA 4C7QA 1VQKS 3KHRA 2WK4A 1T9TA 4ZPCA 4OJGA 3QNWB 2KG1A 3HHEA 2RUGA 3HX9A 1S6OA 3BYPA 1VIOA 2FLPA 2MTLA 2FLLA 4X64J 4LVOP 1SC3B 4OL8A 3GV7B 1ZPWX 5KFOA 2CKWA 4ZLPA 3KG4A 1HQEB 3TO8A 1VIXA 3MMAA 4IH6A 5KFQA 4FPRA 1T3NA 5L1KA 1T03B 1BD6A 3MWBA 1PAUB 4W4MA 1UKUA 4B9TA 3QSYB 3VR1A 1TL7A 4F04B 1X31C 2DT9A 3MMAB 4RUAA 1M5HA 1N5YB 3PRVA 5F0WA 3DRPA 1C4AA 3BV8A 1WHYA 1SJ3P 4PUOA 2XLKA 2Z57B 1LOUA 3DYAA 4Z2XA 5HVFA 2K7KA 3BYRA 5JJBA 3LAKA 3DRPB 3M9NB 4PUOB 5KG0A 3DYAB 2NYIA 2ZE2A 1L3SA 3DHXA 3Q8PB 3HD1A 4MH8A 2HHVA 4LMZA 2E7VA 3DDNA 4R0JA 2ZOGA 4DR4J 3D54A 4B3SF 3MMBB 5B0BA 3HZGA 2GVZA 1KKHA 4F4AA 1BHNA 3I82A 1KOHA 4LF7F 1EP4A 2ZE2B 3K8VA 3ET6B 2OPSB 3DRXA 3R2CJ 1WKLA 3OR2A 4B9LA 4OYXA 1RTIA 4RUBA 1NJXA 1DTTA 5D6GA 1EP4B 2ASYA 3CJ5A 2XGPA 4J9MA 1CBKA 5MAOA 2Y0BB 3OTDA 3OR2B 5F9NA 1DTTB 2MZSA 3O3LA 3VWSA 2ZNZA 3GYNA 4V19X 5J1NA 1EJ7L 2PI4A 4H4MA 1K0TA 1ZETA 3KG1A 4Y2KA 3RW6A 2W4PA 1JXEA 1MN9A 3IM8A 5GMDA 4NXNJ 5HLFB 5K14A 2HLUA 2JVRA 3I6PA 1HMVB 3DLEA 3K58A 4H4MB 3MAAA 2BOPA 1AT1B 4YMEA 1LFWA 1PC4A 4WFZA 2W2MP 1AZSA 2E7XA 1KLMB 4B17A 3K5PA 5K14B 4K4YA 4QYZJ 2X1FA 3B78A 2W2NP 1Y10A 3DLEB 2DXEA 3HJVA 2AJ4A 1JLBA 2CADA 1GTHA 1AZSB 2RS2A 4K2JA 4P75A 4CO1A 1N33F 1LK7A 5GADU 2XI2A 1ZZNA 1VGYA 3PYDA 1NJYA 1RWOB 5KG7A 5IM0A 2HRYA 1RHKB 4KQZA 4E8UA 1JLBB 4RPFA 2HQCA 4RR5A 1TFYA 3DOKA 2KXNB 3FSXA 4I6WA 2MXYA 4XPCA 3DRSA 5F0UA 3ELHA 1HBUA 2CDRB 5IM0B 3T9ZA 1U0SA 1ZM2A 2LMIA 4BHQA 2N4DA 4WFXA 4I7FA 1VYAA 3DRSB 2DK2A 5H9FK 4FDFA 1HBUB 2EXUA 1HD1A 4ECRA 3UCGA 1Q53A 3DFEA 2I0XA 5DETA 4JUZA 1UVIA 2DNPA 2IBKA 4F2RA 4OI2A 1FNMA 1AW0A 5K20B 5LJ3Y 1RTDA 2GNKA 3FFIA 5DLGA 4KAIA 3MM6A 3OVSA 2LU1A 2I1RA 2W9AA 3CB4A 3CCRS 1RTDB 2CXEA 1R8AA 3D1HA 4N41A 1GAOA 2VKZG 1PCAA 5SUHA 2J9EA 5HJXA 3WC2A 3T1YF 2FLNA 4F25A 2R8KA 3MXHP 4FYDA 5KT6A 2HGNA 4TVAB 4N47A 4NCBA 2WVEA 5EWEA 4DUZF 3FC9A 2BABA 3N6MA 1TELA 2XNRA 5L9XA 4TLQA 4C9DA 2D74B 4R25A 4DPXA 3OW2R 4B3TF 4JI4J 4DQQA 2WW8A 1X5TA 2OEMA 1IBMF 2AYBA 1UVNA 4KT0C 3BPSP 4Q44A 2GAGC 2DR8A 2ZD1A 2L3MA 3A3NB 4ILLA 1S0VA 2Y1LB 1M1GA 3MPVA 4USWA 4YB7A 2BUNA 3HVTA 1WOOA 3SSRA 3TP2A 3ZNJ1 5U47A 3UNGC 2QMWA 3I0SA 3WBZA 3SXLA 1RT2B 5I3QA 3JSMB 2HURA 4DV4J 4ZVOB 2CQPA 4OHVA 5AE3A 2KRRA 3R7NB 3D3CJ 2CQ0A 2IJNA 1GX6A 3D0HE 2J6TA 2ZDPA 3I0SB 1RACB 3DXBA 2A10A 3EVOA 2VOOA 2MJNA 4H4KA 2ZJRQ 3D6MB 3DU6A 3KNAA 1NM2A 3Q8YA 1YDLA 2Q66A 2W8KA 2UUAF 4WFAQ 4LF5J 2MQ8A 4B3OA 2L48A 2V67A 3PNIA 5BYSA 2VC1A 1O8BA 4LF8F 3V4MA 4U7CA 5KFFA 3OBIA 2Z2LA 2RVJA 1X8DA 1X9WA 3FBCA 4ANDA 2ZKUA 4CT8A 2WB4A 4B3OB 4AFFA 2J9DE 4ZLJA 4I68A 2C3YA 3M4XA 4W92B 1OSCA 4CWBA 4YB6A 1QAJA 4GVBA 1JLFA 4ZPAA 4EZ6A 2CQIA 5E41A 5KG1A 1VQ5S 3NXZA 5ETPA 3SCKE 5E3QA 2OMLA 4EBCA 4DFKA 1K9MT 4ZVSB 3KMSA 3W5XA 4GVBB 1G7CB 1JLFB 4UOGA 1VOMA 1DZ5A 2QSFA 4QU7A 2J7WA 4E0DA 2Q3PA 3K8WA 4MK7A 3RUBL 2B43A 1VDHA 3O5TB 3ZTRA 2AZ1A 2V4QA 2V50A 1EAYC 3HSJA 4FPIA 1GEHA 3QWPA 2XS5A 3QRRA 5C5JA 1UPPA 3KLIB 1PGZA 2ALYB 1TKXA 2BQ3A 3Q0AA 4LBHA 2G1HA 5LSOA 1FJ7A 2MLXA 4M95A 3BS9A 5HL7Q 4LFAF 5DQIA 2W7AA 2OTLS 4CNYA 2MJUA 1TKXB 5HMZA 3PFOA 2NXUA 3KLEA 1OY8A 3TJ8A 4X65F 1F9HA 4Y6IA 2G0CA 5DS7A 2F40A 3HFKA 2H51B 3W60A 4LF9F 2BVZA 3V6JA 4Q2LA 3VVTA 2KM8B 3KLEB 2NR0A 3TJAA 3H4BA 3V5RA 2UUCJ 2VA2A 4BC9A 3J81j 2RUSA 2OIHA 5CYMB 1JB0C 3GYXB 3GIRA 1R6VA 3VAHA 1IR1A 1RT6A 5ETMA 3BKFA 2DJWA 4C8MA 2KM8C 5L1LA 2A18A 5IQQA 3AJ2A 2HS4A 3CWJA 2N7YA 9ATCB 4RBUA 3TVKA 2ABYA 1RT6B 2YPYA 4ZK7M 2B9YA 4P2XA 3R1HA 4DV6F 3R9LA 4RUCA 2LDYA 3GFXA 4F50A 2B7BB 1WTFA 4LRFA 2HIQA 4X66F 2CZ4A 3W63A 1S7HA 4MYUA 4JI7F 1YTYA 4DX8H 1U1NA 5DG9A 3M6WA 2ZJQQ 2DPIA 1RDRA 5GAHU 5A8RA 4PXCA 5H9EK 3H5SA 3KFWX 2KL8A 4F8RA 1HNVA 2DXDA 3VAIA 1B0TA 3R7SB 5BR8F 1UEVA 1H98A 3RB6A 5A8RB 1T7PA 1NPPA 4NZ6A 1P27B 2XZTB 2DGQA 1HNZF 1HHQA 4JV0A 4OI6A 1OIAA 3AOAA 2J6SA 1FE4A 4QPTA 4YDXA 1MWZA 2DR9A 3U7JA 2J9DA 4CO5A 4RW7A 3TJ9A 2XULA 4GO7X 2CJAA 4X4RA 4USHA 3V6DA 2RU3A 1LW0A 1TQLA 4TYAA 1GXUA 4DV1F 4KH1B 3BSAA 1R8BA 4DV2J 4LJMA 2CPJA 5F8HA 4NYOA 5ETSA 3KG0A 1PYTA 3NWRA 3NNAA 3PJXA 2IMOA 2P2CB 3ITHA 4RW7B 2CQCA 3V6DB 4WP8A 4USUA 1BMQB 2PD1A 1RSCA 5LXYA 4JI0F 1FFSB 2JLFA 2MQOA 3H2VE 3OR1B 3F0NA 1VLOA 4M5DA 5JVGQ 4FYWB 3ITHB 2VBYA 3POTA 4ZN1A 2GCFA 4CO3A 1MMLA 1YK9A 5DZ7A 3IAM9 1RHJB 4CLKA 2YBVA 2V8PA 1SC6A 4QR2A 4M5DB 2HAFA 3M32B 1CULB 4DSIA 5J1EA 1CJVA 1Q0NA 4O3SA 1HYSA 2W24A 3PXGa 5I42B 4DMZA 4DUYJ 3LWLA 3NCRA 1V3RA 5IOLA 3OLBA 2CNOB 3MCSA 3E51A 2MQLA 3W64A 4QR0A 5J1EB 1CJVB 3GR1A 3IA0A 4HTJA 1SQGA 1NK6A 4EUVA 1KBRA 4L76A 2ATCB 4CI0B 3B6BA 5LXRA 4OZ0A 3W9IA 2V4JA 3CNQP 2EBGA 3FCHA 1RT5A 3BF4A 3QAUA 1T05A 4DCJB 2J6UA 1U26A 1YBUA 2DKOB 2D1CA 1XERA 3QJJA 2H54B 1VBYA 4A8OA 2MB0B 2MKJA 2XQCA 3M7VA 5L46A 1J5OA 2J8AA 1RAJA 5D3GA 3ZC4A 2V4JB 5AXMA 2JVOA 1RT5B 1WNEA 2YQ1A 4YQWA 1TR0A 4OLOA 3LPYA 4ZPWR 3P96A 3M8YA 3RJMB 2QJ3A 3KHHA 2X3DA 2NLWA 4DR7F 5D3GB 3T1YJ 3ZNUA 1YZ6A 4K5SA 2KFNA 5DZ6A 2CIMA 5I3PA 4A8YA 1RBOB 5KFSA 2MLYA 3KLHA 1EARA 1J27A 1TZ0A 3MM9B 2CQ2A 3LP2A 2M4MA 2LP4A 1LK5A 3PEJA 2H3EB 4DUZJ 1YSJA 4DL4A 2GV1A 1S4EA 2NS1B 1NO8A 5D15A 2V8DA 3AD8C 2PI5A 5GVQA 4NLTA 1HNIA 2Z2MA 1NK9A 2Q6CA 3LP2B 4B3TJ 2ZHBA 1UAWA 2UVRA 3OFEA 2DR7A 5F41A 4CO2A 5J1PA 3WX4A 2B4PA 2ACMA 1IBMJ 1NH8A 1YI2S 3TANA 5ETOA 2VPZB 4I4BA 4DI6A 3MPYA 2N4CA 4DR3F 3G6ES 4DL5A 5E33A 3NLCA 2QRRA 1RUSA 5J2QB 1X0PA 3A8JA 3TAMA 4OZ2A 3W66A 1GQEA 1VQ7S 1G1XA 4QIVA 2Z56B 3N79A 2F65A 5BJRA 3ZO7A 4C8ZA 1XMBA 2GQCA 4CP5A 2ZOMA 3NMRA 2UXCJ 2E7WA 3TZWA 2ZH3A 1NEEA 2QLWA 1FDNA 3TAMB 3VGSA 4UT4A 4ED8A 2Y0SD 1TKTB 4AUKA 1HARA 3I32A 4TQSA 4EYHB 3T5HA 3MHYA 4LF8J 1AXQA 4CLLA 2CUYA 4DDFA 1UTAA 4WKYA 4OYIA 4P6QA 4OI3A 4RNNA 2FJWA 3MTKA 4HHHA 3JSYA 3EM1A 2GJ2A 2WONA 4MTPA 4B9MA 2E44A 1MROA 4LSNA 1HQ2A 1PBUA 4X4UA 1IR2A 2KFYA 3LGHA 3P45B 1SIWB 3W62A 2WONB 4UW2A 4DLGA 4F4XA 1MROB 3HHNB 3TZZA 1VK3A 2QX0A 4QW9A 2IRXA 5DGAA 4P10A 2GJFA 4WCEQ 3QGIA 1LEOA 3LGNA 5M2RA 1UEKA 4BLGA 5C42A 4IFYB 4WPAA 1I1GA 4ECSA 2KYZA 5L39A 4RJVA 3MUMP 5CD4H 4KE5A 2ZH1A 2E9TA 1U2CA 2Z2YB 3HSGA 3TEHB 1SJFA 3LW5C 2I38A 5G4DA 1JKHA 1M5PC 4IRKA 3UVJA 2KVIA 1F6TA 1F5AA 4LREA 1NB2A 5LMUF 1Y9OA 1TVRA 1W2IA 4CH1A 4EO8A 3Q22A 1RAOA 5D78A 4USVA 3D66A 3PYEA 3K59A 1UFWA 3VF0B 3TA1A 1JKHB 1NXIA 4UQTA 1SKRA 1OMSA 1IBCB 1W2BR 3UVJB 1I94J 1TAQA 2ADCA 1F9FA 3IO1A 2MKCA 3EXCX 4USJC 2CWKA 3AJDA 1FX4A 4B02A 2EG1A 2ASLA 4AL6A 3BN7A 1CVJA 2IRUA 3U1NA 1FEEA 4I0WA 3OTCA 2KI2A 4ED1A 1DHMA 1UMJA 3MM5B 2JX2A 4O44A 1R31A 3DLJA 1ZA2B 4FYYB 4BWJA 3ZZZA 5D4PA 2B5JB 3OVBA 5LSLA 5IS2A 2RQMA 3FEYB 4MYTA 5C2CA 1QUVA 4PWDA 5E2QA 3OL6A 5AJ3F 1RT3A 4O44B 1VQYA 4OX9F 3MECA 1R8HA 4RU9A 1P6TA 4C0HA 1RGVA 5A6PA 2YKMA 1NHVA 2FVCA 3O2IA 1RXOB 4PWDB 2CJQA 4I6YA 2UUBJ 3MECB 2H5IB 4J5OA 4NLVA 2HBQB 5K8OA 4M5KA 1X4EA 4PCQA 3MF5A 3L7UA 4JI7J 2E29A 2ZBQA 2CNKB 3T5LA 4ED6A 5IC6B 4UQGA 2GIRA 4DS5A 1N56A 5KFKA 3M8SA 1S99A 3DLLQ 2MQPA 1U45A 3U1MA 1UZHA 3L9ZA 4ANEA 4K7QA 4O3PA 1JJHA 1YJRA 2HWHA 3BKUA 4A8MP 3OJUA 3IG1A 1HNZJ 3PM9A 4JI6J 1YJNS 1KSPA 4C8KA 4TY8A 2UU9F 3C46A 1IQZA 2SXLA 4NZ7A 3KLGA 4UZCA 3JXOA 4RW6A 2CPHA 1K44A 2CZ9A 3QLHA 3Q8RB 1RHRB 5K8PA 1S6QB 1CJKB 1LWEA 2JFKA 2CVIA 4NL5A 1F2GA 3HT3A 3WIUA 4TY8B 2XWXA 3GQCA 4ILMA 1HD0A 2ZZNA 2W2PP 4RW6B 2VFUA 1RHQB 4PXDA 1VQ4S 3QLHB 5EWFA 1LWEB 3FKBA 5DDRC 4ERDA 4R5PA 4RU2A 4ELTA 2ZBRA 4ECVA 2DEIA 4A46A 4CCHA 4QU6A 4YS2A 3C15A 3BGOP 4MMOA 1N6QB 3C19A 3ISZA 1SJ1A 4R5PB 3DI6A 1GMWD 5EUHA 3OT9A 2UXDF 2I5JA 4IOCQ 2RDJA 3UD3P 3BO3A 3C15B 3PR4A 3BZQA 1U1OA 4L74A 1UW4A 2CPYA 3DI6B 1U1MA 1YBAA 2I5JB 3D6FB 1WEYA 4IO1A 4IG0A 4CYUA 5MLCV 2B3TB 3IRWP 3TUJC 3RTVA 4OV6A 1VQNS 1KEKA 3P49B 3FK4A 2GIQA 1WJ9A 3NCQA 1H6KX 3KMQA 2NQPA 4IG0B 4KYZA 4C8NA 4CYUB 4LF4J 1KLNA 1TV6B 4TQRA 3KJFB 1G3OA 1JIHA 3TZXA 1D8ZA 4FYVB 4I64A 3UN5A 2BJDA 2UV8A 2AKWB 4WKRA 3W2VA 3B8HA 2MZRA 3T19A 2FJEB 2P9CA 1TMJA 2HFVA 4CIOA 2KZMA 3C6TA 1Q7LB 2CJXB 2C2ZB 1C1BA 2M8HA 1R7IA 2C2NA 3GV5B 3IS9B 2ZWPA 2H4YB 1RAIB 2DB1A 2H48B 3MAQA 3OL8A 3LP1A 3W2VB 5ADZA 4ZS6A 1S79A 4DR7J 3JQMA 3EWGA 2VIHA 3NP5A 2QC3A 2AP6A 3JAMY 2KYXA 1LWXA 5FLXY 2DGUA 3LP1B 1HQUB 3OFGA 2L9WA 2OEKA 2LXIA 3GE9A 1HKAA 3KWMA 1TUWA 4NOHA 5B0GA 1IWGA 3VTIA 1LXJA 2Z58B 2BACA 3MCMA 1CS4A 3Q2SC 4B08A 2RE1A 1KP6A 1CJUA 2V68A 3WIVA 2JEFA 3NGKA 4DX7A 2B6AA 2MKYA 2ZH7A 2RRBA 1S9GB 4FKYA 4DFJA 4H54A 4LIWA 4OLPA 1CJUB 1TMMA 4CNZA 3Q86A 2FGCA 3KDOA 2BKPA 2Y1RI 4DR3J 2VASA 1GXTA 4L3KA 3AXMA 4KPCA 3LQVA 3OJSA 1FT8A 4DF8A 2ZC3A 1RZMA 2DO0A 1G6BA 1J5EF 3AQOA 4TXSA 4ECTA 2OAUA 4A8QA 1VHFA 1C1CA 4MKYA 5J2MA 2CWXA 2ZH6A 1N32F 2R7RA 4QYRA 1U02A 5J2NB 4Q2MA 2R2SA 3AB2B 4HHJA 4M5IA 1F3VA 1RTJB 1C1CB 3TA0A 1RJJA 2IM1A 5D0GA 2R8JA 2L9DA 3ENWA 3CCLS 1OY6A 1SUQA 1IQTA 2ZZMA 2OPQB 1KVIA 5H1SV 2O66A 3NG8A 3AD9C 1Y0HA 4U7UD 1WOPA 2MSSA 2XTJP 4ANCA 3HF5A 3EPGA 4DV3J 3AT1B 4WU3A 4ETZA 1SUQB 3CDWA 1VRTA 2BMBA 5A2QU 2EFNA 3SSQA 4DV0F 3V81B 2VODA 1HWKA 2P6SA 3MM7A 3H42A 4YR2A 2ALZA 1Q79A 4MFBB 3C14B 2VFRA 4LR8A 4WZQA 4C8YA 1S12A 3D2WA 1PJ5A 3K5LA 3AB4B 3UDCA 3I4PA 3PR5B 4ZN3A 3MR7A 3MM7B 3TQ1A 4ELUA 3ZZ0A 2GW8A 3HHLA 4OHXA 4A47A 1A6LA 3NWGA 3WHIA 7AT1B 2D3O1 2DR5A 3GCWP 1OS5A 1TL3B 1UA1A 2PSZA 3CMAS 1TK0A 1WEXA 1RWWB 3HHLB 1XNQF 4GVLA 3BBCA 5BXIA 2BJ9A 4PQUB 1SH0A 3VHQA 1B4SA 4J7CA 1NAQA 4NYPA 2V2QA 1RBLA 4R8UA 4CH0S 5GAEU 1LWCA 5LMUJ 2IVYA 5KFLA 4K4WA 4IYQA 1SXLA 3RBEA 3BJYA 3KDNA 1IKWA 1Q86T 1EIYB 2CG8A 4ZLNA 2CJBA 2ASJA 2VA3A 4DL0C 2B9EA 1WHXA 4KHRA 2JRSA 3W8GA 1IKWB 1WSRA 3IRXB 4FNHA 2RILA 4XDDA 4MK8A 2ZM6F 2ROPA 4Q7AA 3P6YC 2BJ8A 3NRBA 1QY7A 1VR6A 2K3IA 3CJ8A 1RLDA 3GJRB 1GK8A 2WSFC 2FVRA 1HR0J 4QJVA 4ZCIA 1WC3A 1KRPA 3PIOQ 5AJ3J 3GSDA 1HBMA 1NZ8A 4OX9J 4C11B 4M5MA 2YWHA 4K4TA 1KHWA 4F4WA 4OJ1A 2W9CA 2JEGA 4EU0A 4WYLA 2AJ0A 3MFIA 2FZGB 3BQ2A 2GS8A 3UE2A 4M8LA 4O23A 5DO2A 3DDIA 3I4HX 5FDLA 2GMHA 4JV5J 2W9CB 1RB0A 3PX6A 2GFFA 3QT8A 1TL5A 4G1QA 4LQ9A 1UA0A 4ECUA 2K7JA 3CJQA 4LSLB 4OYBA 5FDLB 5KG6A 4DL7A 4BBYA 2WBRA 4OFZA 4DR2F 5DJBA 3NGDA 4A8SA 2ZJPQ 4RX6A 2C22A 4DLEA 1Q5VA 2YY3A 3QBCA 4DZDA 2OEJA 4G6VB 3S1TA 2HS0A 2NREA 1FRLA 3NGTA 3BSCA 1L3KA 5GADI 3KLVA 3E01A 3AQPA 3RW7A 3AHPA 4A8FA 5T41A 2VQEF 4OZLA 3D68A 3VZIA 3E01B 4PQAA 3L09A 2G0IA 4DX5A 1S6PA 4U7UK 5KFIA 2XSJB 3CDBA 1KTVA 1K1SA 3A3OB 3CCES 2KZZA 2KJWA 3D6HB 3GFYA 2QMXA 2LA4A 5KFUA 1VQ6S 5AE1A 8AT1B 4JYAF 4M5JA 4RW4B 1S6PB 2XMJA 3CJ0A 2V34A 3ENVA 1UJ5A 3W3SA 3WC0A 3PYGA 4RW9A 4DJBA 3M8ZA 4OZJA 2UXDJ 4KHPF 4HT5A 2YKNA 3SIPB 2ZHOA 3HVRA 2D7SA 4IR9A 2QN6B 2KKHA 3KK1A 4RW9B 4UUWA 2HHQA 3C16A 2H5JB 3CDUA 1VCTA 2HQIA 3I9ZA 1URNA 2YKNB 3C66A 1XMOF 4TNOA 3VAMA 2LQJA 3GIMA 5KFBA 2N82B 5J2PA 3CD6S 3EE3A 3S8SA 1KFSA 4X4PA 1M5OC 1QTNB 1S6UA 3FSYA 4Z7YA 3O6QA 3FBEA 1HHSA 4OJ3A 3HHKA 3HHDA 2YNIB 3MD3A 4JOUA 1HI1A 5J2PB 2DGOA 4J9RA 2JJ4D 4DBQA 5IFMA 4OHZA 3OPKA 4QBUA 4ZPTR 1D9AA 2UP1A 5E3PA 3TARA 2JLGA 4RBTA 1KS2A 1MU2A 4QWAA 4M5LA 4LRDA 2OELA 2M8DB 5D4NA 2F8MA 4LIRA 4PZVA 3IBFB 1SI9A 4KKOA 1M90T 2R2RA 1FRKA 4NLOA 1UW9A 1U09A 2ZVIA 1DLOA 4NLUA 2F4FA 3J7ZT 2HEKA 1ITPA 4NXMJ 1FWLA 1RP5A 2OPRA 3GYGA 1DTQA 4KKOB 3L95X 1WC5A 3DGPA 4W98A 1KQFB 3F44A 1U2RA 1ZTWA 2OPRB 4CM2A 4QR1A 3OTOJ 1VRQC 1SH2A 2HZVA 4IG3B 1TTHB 1ZBTA 2EFGA 3CCTA 3WDOA 4LBPA 4FVMA 2J0SD 3M2RA 4J9PA 3QFHA 5HBMA 1DRZA 3BH6B 4HI1A 3T1HF 3IWNC 4PXBA 2O3DA 1TKZA 2C42A 4OIXA 2Y1IA 3GG0A 3M2UA 2WVDA 2HZAA 4LR9A 4EYIB 5LMNF 2AW0A 3M2RB 3HXMA 3B4MA 1DQ9A 2ROGA 5AXNA 4KC5A 3PHEA 4Y2AA 4YEAA 1J5EJ 2L9NA 1AB8A 4CM0A 1WC0A 1FHTA 3VGVA 5CABA 4WP3A 4PYAA 3BGRA 4DZ6A 3Q2TC 2E5JA 3Q83A 2BJ3A 4EBEA 4RW8B 1BQXA 2LA6A 3NGRA 3PKYA 4IQMA 2RJZA 3BGRB 3CCZA 1QVGR 4KFBA 2VFVA 3UR0A 3S6EA 3H8YA 2CNLB 3KJVA 1R89A 1AFIA 4LFCF 4DSLA 3RBXA 2HKEA 4K50A 2WZ1A 4WK3A 4KFBB 6AT1B 5D4OA 5CQGA 4NX9A 2JSXA 1AA1B 2V94A 1PKUA 3HI9A 1PAEX 2CQHA 1X4FA 3TQEA 5L9NA 3KJVB 3N5FA 3C3LA 2VG7A 2MZJA 3SCLE 5CCMA 1PSDA 1Q4RA 3EX7B 2AQ4A 2WSCC 2OFGX 4Y34A 1JLGA 2CPZA 2VG7B 3DCAA 2P9GA 2KDOA 1MSWD 2M9KA 4MIWA 5IT0A 1TK8A 1NKBA 2C3PA 1VFJA 1FJEB 4BCAA 4RNHA 2KRBA 1C4CA 5AXLA 2BJEA 2RQCA 5HQMA 3T6BA 1UL3A 1XK8A 3ZTQA 2V2ZA 2PMHA 2HAIA 1XNQJ 3CD7A 3MPWA 5HAOA 4KSEB 2GGPB 2NZ4A 3RB3A 4DV5J 5KOXA 5DLFA 3AD7C 1Q8BA 1XIQA 2DH9A 3IBWA 1AUSL 4DXLA 3PIPQ 4ENOA 4IQXA 2RS8A 3KXDA 4QIGA 4ES1A 2DNRA 2FHOB 2CJ9A 1N8RT 2QLFB 4ZHRB 2VFTA 2XGQA 1NK5A 3DGVA 2ILZA 4MK9A 4PPDA 3NGUA 4LFBF 1VI7A 3H90A 2YNGB 3FRZA 2YNFA 4EK2A 3ENAA 5B0FA 2ZBIA 1EETB 3F73A 1KD1T 3I0RA 3OL9A 2IDLA 4M1KA 3PX4A 1CQMA 4K59A 5E3RA 1RT1A 3DM2B 3PEHA 1SL1A 1RA6A 5KFJA 3F56A 1U25A 5GAHI 2XHWA 2LKZA 1IM4A 2KT3A 3R8YA 1U6BA 3VCDA 1WG1A 1RT1B 2NSCA 1VS3A 1M5SA 1A7GE 5K5MA 4DUTA 2LFVA 1DAXA 2X1AA 2XEXA 3HT0A 1U6ZA 4YUDA 2F8HA 1KHVA 3PW4A 4F02A 2AWZA 2MKKA 4GKJF 4CLFA 5G0RA 1FJGF 2HHHF 3J7AN 2DIUA 4B9NA 4KGKA 3HMJG 1VMBA 5HQLA 2ZH9A 1NJWA 2DNHA 2LQBA 4NMXA 5G0RB 1ACMB 2HYIB 1UVKA 1T3OA 4FS2A 2DRBA 1NK7A 2ZNYA 3BQ0A 3LTOA 1JJ4A 2PMZD 4ECXA 2J0WA 4RWXA 2XM3A 1MNEA 1IBLF 3GMGA 1SH3A 1H7XA 2M7SA 2MKHA 3A3PB 3HHLD 3KYLA 1X4GA 3CDAA 2VPXB 2FC8A 3N4WA 3UDVA 2RD5C 3T6JA 2CJKA 1CEZA 1X9SA 4Y0FA 3UDEA 2H4WB 4GC6A 1S48A 3VGUA 4FBUA 3CC7S 1ZAWA 3IR7B 4RL1A 2J0XA 4IDKA 5DDQC 1QE1A 1JLAA 2BW2A 1FX2A 2FHJA 1XMQF 5E7OB 3ZZOA 1V5VA 3QPIA 2W2OP 3FQKA 1Q8LA 3PFEA 1NU4A 4MIAA 1QE1B 3HLUA 4LF6F 1HWLA 2IM3A 4MIBA 2EK6A 2C3MA 4UOFA 2H5EA 2QZ8A 3PV8A 2HSEB 1K0VA 3NOCA 3MD1A 2NXEA 4B3MJ 1NDLA 3SCJE 1VBXA 1RWKB 4ZLLA 5CXTA 3H4DA 4JI3F 4HH1A 2CQDA 2GVDA 1VISA 1Y5NB 1L3VA 2QYGA 4QCLA 2KXHA 3MMCA 2CQ4A 1Z2LA 1XMOJ 3OXFA 4EZ9A 3VGTA 2WBMA 2HVZA 3VZHA 1TL7B 4ZCKA 4OHYA 2GVDB 2PN6A 1N36F 5F8GA 5HJYA 1W7WA 2E5IA 3JSBA 2LU2A 5GAGU 1D09B 2HFOA 3PJWA 2V9WA 4KGZB 4F36A 4AQYJ 2CAJA 4XTTA 5CD4A 3BBBA 4NA2A 1RKJA 4JV1A 3TX0A 1HPZA 1CC7A 1WHWA 1FXLA 1FFGB 1WEZA 2B56A 1M1KT 1UVMA 2RQ4A 4XIUA 1HNWJ 3QWUA 1B64A 3TA2A 3CXCR 4AL5A 4EGLA 4IFVA 5HROA 1DQAA 3PCOB 1FDBA 3M30A 5IQ6A 1EQ0A 1ZZFA 2RT3A 3LAMA 2DY1A 5D8HB 2GVZB 1FKAF 4CLZA 2FVQA 4IFVB 5HROB 1U6FA 4NI2A 1N34J 4IOAQ 4C98A 1BQMA 3CGIA 2OD6A 2QL7B 1WKKA 2MYFA 1RTIB 5FIIA 2G0JA 1X4BA 4MJKA 3G86A 4FXDA 3GJQB 3NAIA 1RE1B 3FZBA 1I6JA 2C2KB 5SZTA 2DYAA 3TAPA 4E98A 4USIA 2XMUA 2QSWA 3T1HJ 4ZVRB 4DOZA 3JS9A 4CRJA 4DWIA 2H65B 4KPYA 4XO0A 4QIEA 3J80U 1WKJA 5DM7Q 1HW9A 5KG2A 4NLWA 3G6XA 5IT9U 2XMAA 4ED3A 4E2FB 1N4LA 3HDSA 3MAAB 4B3RF 1N5TA 3CTRA 3I9V9 3ILIA 1ZAVA 3CIMA 2G4BA 1DFDA 2O1PA 4DPYA 2KVQE 2Y1JA 1NHUA 1V5IB 3N5BA 4P71A 1RT4A 3SFGA 1VQMS 1Q5YA 4EI2A 3IP0A 3J7A1 1RAGB 2Y8YA 2FY1A 2MKIA 1BE4A 5ITHA 2LXUA 4OI0A 1FVQA 1RT4B 1I51B 1H2UX 1N0VC 4UOCA 1HNXF 3PW5A 4Y28C 3QSIA 3ADAC 2JEJA 4J37A 3PW7A 3DOKB 1L3TA 2BZ2A 2V69A 4J9OA 4FF2A 1QAXA 2XMTA 4OX7A 5KG3A 4ED2A 2FDNA 4J9LA 4I7FB 3UCZP 3CSKA 4I56A 5KFZA 3IC1A 3SQGA 3CEDA 2EI5A 3TAQA 3GFHA 4O4GA 3W61A 1KC8T 4YFUA 2DGTA 4O3RA 3QZ7A 1IJFB 3ILOA 2AZ3A 2HFUA 4KO0A 3K5MA 3QGHA 3SQGB 3G2XA 4DN0A 5LL6d 2ZEJA 2EW9A 8ATCB 2CPXA 3FFIB 3FZ2A 1OQ6A 5KAKA 5DRKA 1N52B 3MM6B 4O4GB 1FF2A 7FDRA 4ZVGA 2C2DA 4CLUA 3E8OA 4R0EA 2KU7A 3D1OA 2V8VA 1C0UA 4DL2A 5LJ5Y 3GP9A 3KJQB 2B9XA 1YJ9S 2OPPA 1FESA 3EYZA 2XY7A 2IIHA 5HK4A 4NWBA 3AXKA 1K8AT 5GMKa 3HK2A 1IR0A 2WHOA 3CCUS 2F4VJ 1RYRA 2OPPB 2GO9A 2GHWA 4NEZA 5EGYA 2Z8QA 1TAUA 4G3IA 4Y00A 4EO6A 3TR5A 3M6UA 3R5BA 3TX8A 2DO4A 2CQ3A 4LFBJ 2EG2A 6FDRA 1RTHA 3M6VA 2DH7A 1JJ2R 2HPUA 1UFKA 2FJDB 4X64F 1S9FA 2IM2A 1H38A 5F8NA 1YJWS 4MKAA 3JYTA 4P7TA 1RTHB 3DLKA 2W7OA 4TN2A 1HWIA 3GJSB 3J80Y 4ED7A 1OSDA 1ICEB 1S77D 2ZD1B 4PRFA 3L4BC 2MEWA 3JYTB 1OPZA 3GSIA 3DLKB 3HVTB 2R42A 4QYZK 4ECYA 2MHNA 1NK8A 2WVBA 1Q82T 3UD5A 1U8WA 2IYIA 3K89A 2ZC4A 4IUFA 4GKJJ 4LQ3A 2UVUA 3MFHA 3FDSA 1N48A 1FJGJ 2OP5A 1NDKA 3ONQA 5HATA 1RU2A 4MAKA 4WIIA 3JTOA 4K4SA 1T9YA 1TL1A 3QO9A 3TZYA 1NJZA 1ZM3A 2AX0A 2P9EA 2QA2A 1S0MA 3BQ1A 4F4YA 5FJ4A 1RAHB 4I2PA 1SL2A 2F1FA 3JQJA 4TU9A 4HTIA 3PHTA 3OD2A 4H4KC 4ED4A 3CCVS 4DR4F 2DNKA 3W9JA 4P74A 1M0SA 2J9CA 4YOEA 1X4AA 5THWA 4I2PB 3AFGA 2Z2ZA 3FQLA 1HWJA 1BWVA 3FUYA 3GWCA 3I5BA 1T9WA 3M8QA 2YH0A 3J7Z5 2DRAA 3DN9A 1VHIA 5KFMA 2EWHA 3HKZD 3BH7B 4DCOB 5KFHA 1VQLS 1ZM4A 4UY85 5B0DA 1F1BB 2HNYA 1CLFA 1PYSB 2XY6A 3M8QB 2VICA 4Q43A 3MCNA 1REGX 1Q81T 1XWLA 2ZOFA 2D3ZA 4ZCLA 3X1LB 4AT1B 3EICA 3UFCX 1YHQS 4LF6J 3GTYX 4ZKAA 2E5LF 4ETXA 1U24A 2PIIA 4NXNF 2GQ2A 2L41A 1Q95G 1S59A 5A8WA 3PW0A 4O0NA 1FTCA 5DQHA 2QO3A 1H2VZ 4JI3J 4Y2CA 3J7YU 2N3LA 2LCWA 4AXJA 4K5RA 1RK8A 5LSRA 5KFNA 1G2EA 3IFEA 2RH3A 1NMEB 5EX3A 2CRLA 2VH7A 2DD8S 1WI6A 4LBIA 3B82A 2Y9HA 2XYPB 2R7WA 4I67A 2PT0A 2DHSA 2VQFF 4ZIVA 4NLSA 2IAJA 2ROEA 2XMVA 2UZAA 5A6WA 1S1WA 4HLBA 1WC6A 2ZH2A 3OUYA 3RAXA 3M2VA 5KFXA 1FE0A 3ETMA 2X51A 3IBCB 2BE7D 1T9UA 4ZVUB 3MR5A 5A0YA 1HL6A 3H25A 1EZZB 3FSIA 4B3SJ 3WZ0A 2P8IA 3THTA 2LEBA 5F8MA 3BB5A 3D0GE 1UVLA 3M2VB 4LF7J 2AJ2A 2Q6BA 3G8SA 5E3AA 2Y3YA 1URRA 1S97A 2YWEA 1NZAA 1S0OA 1VJQA 4ECQA 1ZYQA 1MG7A 4ZVHA 2Y8WA 4OI4A 2HS3A 1F9EB 2RSQA 2E9RX 3FJ2A 1GNKA 1IWAA 2W2QP 4ES3A 2QL9B 1SB6A 2XYHB 2CPFA 2VG5A 3EZOA 4NEYA 1VQ9S 4WXWA 1LXNA 4B9SA 3VAGA 2MQQA 1NK4A 2OGUA 4HT7A 2OO4A 1HNVB 1S1VA 2MLZA 3QIPA 2XCPA 3PX0A 5IXUA 1PJ6A 4N8OA 1JXVA
chains in the Genus database with same CATH topology
4WFXA 4DL0C 2CFXA 4I7FA 1WHXA 4KHRA 1U1RA 1WF0A 2FHJD 2JRSA 4ZDNA 2R4FA 3S01A 1MW7A 3R5CA 1S1VB 1IKWB 3TOQA 3DRSB 2DK2A 2HNDA 3IRXB 4FNHA 2OSRA 4ZP9A 2XMWA 2RILA 4QZVB 2YVSA 1YRTA 3BREA 4XDDA 1HBUB 2JH3A 4MK8A 1HD1A 2ZUGA 4ECRA 2GA7A 1JLGB 3UCGA 2ZM6F 2ROPA 3BDEA 3J7YI 2R8HA 4DQIA 3FMWA 1Q53A 4C8LA 3DFEA 4Q7AA 2I0XA 5DETA 3P6YC 3I5CA 1L5UA 4JUZA 3NRBA 1UVIA 3NCPA 4XAKA 2FVSA 3RB4A 1QY7A 2K3IA 2DNPA 2IBKA 4F2RA 4OI2A 1FNMA 1AW0A 3LGMA 2HNDB 2DGWA 2WSFC 4HL9A 2FVRA 4WU2A 5LJ3Y 3O44A 1RTDA 1JLQA 2XWYA 4QJVA 1LW0B 4ZCIA 1JNRB 2GNKA 1S6QA 1KRPA 3FFIA 4JI4F 2DHXA 5DLGA 3UR3C 4KAIA 3PIOQ 3MM6A 2CDQA 1JXLA 3OVSA 3GSDA 1JX4A 1HBMA 2V2KA 4C11B 2HMIA 2LU1A 2YWHA 2YWKA 4K4TA 1IXKA 2HHUA 2I1RA 1KHWA 3DC2A 4F4WA 4V19J 4OJ1A 2W9CA 2W9AA 2JEGA 3CB4A 3CCRS 4DL3A 1JLQB 2R2UA 1RTDB 2PE8A 4EU0A 1DBDA 1R8AA 4WYLA 2AJ0A 4KBIA 3MFIA 3C8YA 2OH2A 3D1HA 2RF2A 3BQ2A 4N41A 1GAOA 2VKZG 3R27A 3UE2A 5SUHA 4M8LA 1Y5LB 4O23A 4NA1A 2J9EA 5DO2A 2WAQD 3RRHA 1UVJA 2HMIB 2GMJA 1FD8A 3I4HX 5FDLA 3TYTA 2GMHA 3WC2A 3T1YF 3IWXA 3G71S 1FKPA 2W9CB 3LUYA 1M5VC 1F0XA 1XBWA 3POTB 2FLNA 2DGXA 2HHWA 4F25A 3SV3A 2R8KA 3MXHP 5KT2A 3PX6A 4FYDA 2XY5A 2V9KA 2N3OA 2C2EA 1LFPA 1N6QA 2GFFA 5KT6A 2HGNA 2ZFHA 3BEGB 2PEHA 2OTJS 1R8PA 1TL5A 2RF2B 4G1QA 4N47A 4LQ9A 1UA0A 4NCBA 4RLEA 4ECUA 1BC6A 5JVHQ 4ZP8A 1RI7A 2B4UA 4P2SA 2K7JA 4LSLB 5FDLB 1P1TA 1HBNA 5KOWA 1LW2A 1FKPB 5KG6A 4DL7A 2HQ3A 4BBYA 5EWEA 4DUZF 2WBRA 2ZKTA 4OFZA 4DR2F 1VRUA 2YNFB 5DJBA 3NGDA 2BABA 3PDNA 4A8SA 3DRRA 1HYSB 2ZJPQ 5KTQA 4RX6A 2C22A 4DLEA 3N6MA 2XNRA 2YY3A 4JI5F 3HKWA 1N5VA 5L8RC 1GX5A 4G6VB 5L9XA 3S1TA 1O5JA 2V8HA 4TLQA 2AD9A 1URNA 3IAS9 2HS0A 3UI3A 4C9DA 2NREA 1FRLA 3I0RB 2D74B 3P5TL 4R25A 4C0BA 2FD2A 5CH7B 4G1IA 3OW2R 1RWUA 1Y5IB 4FNIA 4CH7A 1HBNB 4B3TF 4M94A 2KXFA 3BSCA 4DQQA 1L3KA 2B9WA 5GADI 2WW8A 3KLVA 1QLNA 3E01A 3AQPA 3RW7A 3N28A 3AHPA 3DRRB 5IT4A 3CJKA 4A8FA 4LF5F 1X5TA 5GAEI 3M8RA 3V2UC 1RKIA 1IBMF 5T41A 2AYBA 4TY9A 2VQEF 4XK8C 1UVNA 4KT0C 1T05B 5DGBA 2GX8A 4Q44A 1VJWA 4OZLA 2NUHA 3PO5A 4B9VA 1WWHA 2HHTA 1FDDA 3VZIA 1LV5A 1TV6A 1WACA 1FNXH 3G8TA 2DR8A 3E01B 2ZD1A 2L3MA 4PQAA 3CJKB 2F8EX 3N6LA 1J5OB 3L09A 2NPIA 3D0IE 2B4VA 1RQ0A 2Z0GA 1S6PA 4U7UK 4FS1A 4ILLA 5KFIA 1S0VA 1CC8A 2J7UA 2XSJB 3K7RA 3MPVA 1B7FA 3CDBA 2R7XA 1KTVA 4IRDA 4YB7A 2BUNA 1K1SA 3HVTA 1Z1ZA 3CCES 2KZZA 1VC5A 3MR2A 2KJWA 3GFYA 3SSRA 3TP2A 2QMXA 3G6VA 1C0TA 1ELOA 2LLZA 2KTQA 5U47A 2MPUA 3MUVP 2LA4A 5KFUA 1MMNA 3UNGC 2QMWA 3I0SA 3WBZA 1VQ6S 5AE1A 1U49A 3SXLA 5KT5A 1BGXT 1RT2B 3CCWA 3G8QA 5I3QA 3QJPA 4JYAF 3JSMB 4RW4B 3IS9A 1S6PB 4UUXA 4LVNP 1KN6A 2WSEC 2XMJA 3CJ0A 4DQRA 2HWIA 2CQPA 4J9QA 4DFPA 1T8EA 2QA4G 3ENVA 4OHVA 4C4WA 1UJ5A 2KRRA 5AE3A 3W3SA 2CQ0A 2IJNA 1YRXA 3WC0A 4F67A 4RW9A 1GX6A 4DJBA 1CSJA 3D0HE 3KLHB 5F8IA 1C0TB 2J6TA 4OZJA 2BE2A 2OJ3A 2ZDPA 2XLJA 3I0SB 4KHPF 2E1AA 2KG0A 4HT5A 2YKNA 3DXBA 4ID5A 5K8NA 2ZHOA 2A10A 2OLWA 3RB0A 3HVRA 2VOOA 1U8SA 2MJNA 2XMMA 4H4KA 4GMKA 2HW3A 2ZJRQ 1LWFA 2D7SA 3DU6A 3KNAA 1JLCA 1HQUA 5HQ8A 2Q66A 1BY9A 2W8KA 2YKOA 4DSFA 5E3CA 2UUAF 4IR9A 1KQKA 4WFAQ 2DIVA 3FNNA 4B3OA 2KKHA 2L48A 3KK1A 2I8EA 4RW9B 4UUWA 2HHQA 4HDHA 3PNIA 2EBEA 2RU9A 5BYSA 2VC1A 2BE2B 3CDUA 1CPZA 2R7QA 4WYWA 3BSNA 1HNIB 5CZXA 1O8BA 2HQIA 1KFDA 3I9ZA 3CF5Q 4LF8F 2YKNB 4ID5B 5KFWA 3V4MA 3C66A 4U7CA 1HQEA 1XMOF 5KFFA 4TNOA 3MURP 3VAMA 3OBIA 2LQJA 2Z2LA 3GIMA 2RVJA 5KFBA 1LWFB 1X8DA 1X9WA 2N82B 5J2PA 1JLCB 3O1LA 4NXMF 1T03A 2ZKUA 4CT8A 3CD6S 2WB4A 2K3KA 3LP0A 3S8SA 1HI0P 4MKBA 2FPHX 2GHPA 4AFFA 3EGNA 4DFMA 1KFSA 4X4PA 4B3OB 1M5OC 1XR7A 4KRWA 1S6UA 2J9DE 2LEAA 3FSYA 2IYGA 4KJIA 3O6QA 4ZP7A 1HHSA 3ICLA 2C3YA 2G1DA 4I68A 2LYVA 3M4XA 4W92B 4OJ3A 1OSCA 3HHKA 2LQ9A 3HHDA 3SSSA 3FMBA 2YNIB 3OL7A 3MD3A 1S9GA 4JOUA 1VC0A 4YB6A 1HI1A 1QAJA 1K1QA 1R8CA 4FF4A 1JLFA 4K4XA 1VBZA 5J2PB 4ED5A 4ZPAA 4K4UA 3GIKA 2DGOA 4J9RA 2G9OA 2JJ4D 4DBQA 4EZ6A 2QE5A 2CQIA 5H9FJ 4IDKB 4NRTA 2DNMA 5E41A 3LP0B 5KG1A 1N5YA 1VQ5S 2D9OA 2H9ZA 3KHGA 5IFMA 1NKEA 1D8YA 4OHZA 1JLAB 5KFGA 3OTOF 3SCKE 4YDDB 5E3QA 2OMLA 4OMFG 3OPKA 4RKUC 4HYKA 4EBCA 2DNLA 2M70A 4ZP6A 4QBUA 4ZPTR 4DFKA 1K9MT 1D9AA 3PZPA 2UP1A 1MWYA 3OV7A 3KMSA 2DGVA 5F3TA 5E3PA 3TARA 1FXRA 3CULA 1F5CA 1G7CB 1JLFB 2WB1D 1KVJA 4URSA 1VOMA 3QJLA 3MR6A 2QSFA 1DZ5A 4QU7A 2J7WA 2JLGA 1S0NA 2YKQA 2ZH4A 3OVAA 4E0DA 2Q3PA 4RBTA 4N8NA 1KS2A 1MU2A 4QWAA 3H40A 4KV8A 3P3DA 2M8DB 4ES2A 3SV4A 3K8WA 5D4NA 4MK7A 3EGWB 2EFPA 2F8MA 4LIRA 2B43A 4URGA 3IWLA 3O5TB 1SI9A 5KG4A 4KKOA 1M90T 4FXVA 4JI1F 3KLFA 4DPOA 2R2RA 1FRKA 4KHMA 2V4QA 2UUCF 2N7CA 4NLOA 4OZ5A 1U09A 4ZCMA 4X2BA 1MMDA 3QWPA 4Q8EA 2XS5A 1Y7PA 4DSJA 3B4DA 3CCSS 1DLOA 4NLUA 5C5JA 4X4QA 3KLIB 1PGZA 3J7ZT 2AV5A 4KV8B 5J2NA 3NS5A 3SYZA 5HP1A 1TKXA 1RP5A 2OPRA 1RT7A 2BQ3A 4L3NA 3UDLA 2CVEA 3Q0AA 1DTQA 5M2UA 4KKOB 3L95X 5LSOA 3MMBA 3KLFB 1RTJA 2HVIA 2F3JA 1FJ7A 2EFQA 3MMCB 5CCLA 4BC7A 5DDPC 4O0IA 4M95A 2MZTA 3BS9A 3DGPA 5HL7Q 2AGPA 5DQIA 4LFAF 4G1PA 2W7AA 2KHCA 2YTCA 2W7PA 3MDFA 2FIUA 4IO9Q 2RQKA 2COLA 2VPYB 1KQFB 2OPSA 3F44A 2OTLS 4CNYA 2MJUA 1U2RA 1ZH5A 3KHLA 1OWXA 1TKXB 5HMZA 2OPRB 5HP1B 3PFOA 1ZTWA 1RT7B 1L3UA 2OPQA 3QGPA 4Q0BA 2R8GA 2NXUA 2U1AA 4QR1A 5DM6Q 2ZH8A 1TFWA 1SH2A 2U2FA 4IG3B 3KLEA 1U2FA 4X4VA 1ZBTA 2EFGA 3DLGA 4QPXA 3UD4P 3CCTA 2B0GA 3WDOA 3JTNA 1YGYA 3GIIA 3BSOA 2DCLA 2GJIA 4FVMA 3M2RA 4X65F 4Y6IA 3EPIA 4J9PA 2J0SD 2G0CA 1QAIA 1KNZA 3PRDA 5DS7A 2F40A 3M9MB 5HBMA 1DRZA 3HFKA 3C2PA 2MQMA 4HI1A 4LSNB 5KFPA 3Q23A 3T1HF 2BVZA 4LF9F 3V6JA 3IWNC 4PXBA 4Q2LA 4FBTA 4Q0BB 2PGCA 4WFYA 2O3DA 1TKZA 2C42A 2JFDA 2OMOA 4OIXA 2Y1IA 2D3UA 5K9FA 5HI7A 3V81A 2FTRA 2KM8B 1R0AA 3KLEB 2NR0A 3GG0A 1N88A 2F9DA 1FRXA 3M2UA 2C3OA 3DLGB 5B0EA 1HPZB 4NZ0A 3H4BA 4EYIB 2XG8A 2I2YA 1PC5A 5LMNF 3OTBA 1JNZB 4MFBA 2AW0A 3M2RB 1O51A 3V5RA 3HXMA 4ID8A 3B4MA 3DMJA 1S10A 2VA2A 4BC9A 1DQ9A 2ROGA 5AXNA 1S1TA 4KC5A 4LUBA 1S49A 2BANA 2OIHA 1VQ8S 5CYMB 1JB0C 5A8KA 5DDOC 3GYXB 5HLFA 1YG0A 3PHEA 4Y2AA 4YEAA 3VAHA 1NK0A 1NJIT 1RA7A 2VC0A 2VL1A 1U1KA 2DNZA 1R0AB 1RT6A 1R43A 2L9NA 1HMVA 5JXSA 2DJWA 3SZ2A 3M30B 4I1TA 4C8MA 2KM8C 1KONA 5L1LA 3T5KA 1FHTA 2A18A 5C42B 2OKQA 2DNNA 3ZFVA 5IQQA 5DG7A 2BR0A 2POKA 3DMJB 1S1TB 2HZCA 3DDKA 3BGRA 2HHXA 3AJ2A 3OTEA 2BANB 4O3OA 5A8KB 1KLMA 2HS4A 3CWJA 2AYEA 2XCAA 2E5JA 2N7YA 3Q2TC 4RBUA 2UUWA 4DL6A 2M5YA 1TL3A 4FN5A 3TVKA 1OQ3A 2ABYA 1RT6B 3OFHA 4EBEA 1S1UA 2GO8A 4YB5A 1UEUA 2LECA 4RW8B 4ZK7M 2B9YA 3JB9k 1GT8A 4DEZA 1BQMB 1BQXA 2LA6A 3IN5A 3R1HA 4AL7A 4DV6F 3PKYA 1WG4A 5CZVA 2LDYA 3GFXA 4RUCA 2VONA 4PG4A 3D28A 4IQMA 4F50A 2RJZA 3BGRB 2B7BB 1WTFA 3CCZA 1QVGR 2HIQA 3CD5A 3MEEA 1TVRB 4KFBA 3MUTP 4X66F 3OSNA 2CZ4A 3HM9A 1S7HA 2I9SA 4PQUA 1QUPA 4MYUA 4F26A 4DV2F 4JI7F 1YTYA 4DX8H 2VFVA 3HZEA 3BDPA 3UR0A 1U1NA 3S6EA 1S1UB 5DG9A 3M6WA 2RMLA 3DRYA 3H8YA 4Y65A 2ZJQQ 3KJVA 1R89A 2DPIA 1AFIA 1RDRA 2IHR1 1P1LA 4DSLA 4LFCF 5GAHU 5A8RA 4PXCA 3UCUP 4K50A 3H5SA 3KFWX 2P6TA 2HG4A 4F8RA 1WI8A 4WK3A 3MEEB 4TKTA 1JK9B 4KFBB 4OJHA 1CQNA 1N0UA 5D4OA 5CQGA 5AE2A 1HNVA 4NX9A 2JSXA 3VAIA 3TVYA 2V94A 3HI9A 4ZA1A 4DV5F 4XDCA 2CQHA 1B0TA 1X4FA 4A8KA 2DTJA 5BR8F 1UEVA 4QWBA 3VAFA 2DGSA 1H98A 5L9NA 3KJVB 3RB6A 3SCIE 3N5FA 3C3LA 5LT5A 2RB7A 2VG7A 1D9DA 2CYYA 2MZJA 5A8RB 1T7PA 5CA5A 4C8OA 1TL4A 2R7UA 4NZ6A 1P27B 3I56S 3SCLE 4EEYA 2DGQA 5CCMA 3EXYA 2XI3A 2RNEA 2CG4A 1BQNA 1HNZF 3JTPA 2IFXA 2XMKA 4JV0A 4OI6A 2XB2D 2C28A 1PSDA 1OIAA 1Q4RA 3NKYA 3IRXA 3EX7B 2AQ4A 2WSCC 2J6SA 2OFGX 4Y34A 2FC9A 1FE4A 4NMLA 1Q8IA 4QPTA 1JLGA 4DSEA 4FZVA 1OPIA 4YDXA 2CPZA 1MWZA 3LOUA 3BGUA 2VG7B 2DR9A 3DCAA 2P9GA 4ITSA 3U7JA 2XLIA 2QEXS 2J9DA 2MKSA 2KDOA 1MSWD 2M9KA 3CJ2A 4CO5A 1BQNB 4MIWA 5IT0A 1TK8A 2AGOA