1B0TA

D15k/k84d mutant of azotobacter vinelandii fdi
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTKCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEDKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN I)
publication title Crystal Structure of the D15K/K84D Mutant of Azotobacter Vinelandii Ferredoxin I
rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b0tA00
1BLUA 1GAOA 3MM5A 7FD1A 1FDAA 1FF2A 2WSEC 1DAXA 1FRHA 5CH7B 1FRXA 2C3OA 2C3MA 5BYSA 1Q16B 1BD6A 3MM7B 3MMCB 3EUNA 3MM9B 4XDDA 2FJEB 1B0VA 2GMJA 3MM6A 1FCAA 4RKUC 2FJBB 1VJWA 2WSFC 3MMBA 4KT0C 1AXQA 1A6LA 1B0PA 1GT8A 1FRJA 4CI0B 3OR2A 1KEKA 1G3OA 4ID8A 1BC6A 1IQZA 3HKZD 4L6V3 5BYQA 2C42A 3MM7A 2VPXB 2C3PA 1FEHA 2V4JB 1GTHA 3MM8B 1GTEA 2PMZD 5CHCB 1FD2A 1WTFA 4OV1A 1R27B 2VPZB 4AYBD 3IR7B 1Y5LB 1KQFB 4YDDB 3EGWB 2O01C 3OR1B 1B0TA 1RGVA 5L8RC 1FDBA 2C3YA 4Y28C 2VPYB 1FTCA 3MM8A 1SIZA 5BYRA 2FJAB 2XSJB 2Y0SD 3MMCA 3MM9A 1H7XA 7FDRA 3GYXB 1K0TA 3LW5C 1Y4ZB 1F5CA 1JB0C 1FRMA 2VKRA 2UZAA 3MMAB 3MM5B 1XERA 1F2GA 2IVFB 1H7WA 5E7OB 1PC4A 1C4CA 3C8YA 1DURA 1DFDA 1IR0A 2V4JA 4XDCA 1HFEL 3IR5B 1JNRB 5FD1A 1FRLA 1ROFA 1FERA 6FD1A 1FDNA 1H0HB 1JNZB 3MMBB 3MMAA 3IR6B 1D3WA 2PA8D 3EXYA 3OR2B 6FDRA 1F5BA 1FRIA 1FXRA 2PDAA 1FXDA 1Y5IB 3OR1A 1BQXA 3PNIA 1FRKA 2FGOA 2FD2A 1FDDA 1PC5A 1KQGB 2WAQD 2V2KA 2FDNA 2FJDB 1BWEA 2XSJA 2C3UA 1SIWB 4OMFG 1Y5NB 4DHVA 2WSCC 2WB1D 2ZVSA 1CLFA 1G6BA 2VPWB 1C4AA 2Z8QA 2GMHA 3MM6B 1SJ1A 4XK8C 1H98A
chains in the Genus database with same CATH superfamily
1S1VA 2FVCA 3THVA 1LV5A 3K89A 4BBYA 2XQCA 1WI8A 2WSFC 4K50A 2N82B 1ACMB 1GT8A 1U2FA 4OX7A 1OWXA 3SSRA 4ECYA 2XM3A 3BF4A 3HKZD 2CXEA 1S9EA 1XBWA 5IC4B 3PRDA 4GC6A 2ATCB 1S6PB 4O0IA 3LAMA 2GJIA 3OV7A 2BW7A 1TK5A 2RRAA 4DQSA 3C6TB 3QFHA 2BUNA 4DX7A 3ULHA 4OX9J 1T9VA 5AE1A 3R27A 5KFUA 1T11A 4P73A 1XMBA 5G4DA 2Z57B 4RW6B 3UO0A 3VAGA 1HD1A 4B3TJ 1SKUB 3DGPB 5D4LA 1XR6A 4I2QB 3LP0A 2M52A 3CVKA 4Y0FA 2QMUB 5KG7A 2E9TA 1VQSA 2FUG9 4R8UB 5HQMA 2XNQA 1F5AA 2CAJA 3TOQA 5B08A 1M0SA 2B4PA 1S76D 1I3OB 4GMKA 1CJTA 5HMWA 4RJVA 4ZN3A 4A8YA 3KFWX 4O4RA 3JTNA 5HROA 1VBXA 3E2EA 2KT2A 2OPSB 1VK3A 4HACA 3UD3P 4A48A 3TA0A 3OTBA 3I5BA 2L48A 3SQGB 3WHIA 3MUTP 4DV6F 1WWHA 2GGPA 2HG4A 3B54A 1ZBTA 1XMOF 3NOGA 1FD2A 1RBOB 1U1OA 5T7LA 2YKMB 3MPUB 1MSWD 3FCVA 2B6AB 3HSJA 3TZZA 1LFPA 3J7YU 3D68A 2OEMA 3SCJE 4BLGA 1U1PA 2DR9A 3H90A 5CYQB 3LW5C 4RWXA 1BHNA 4ZVTB 3TZXA 4YR0A 2G4BA 4KHPJ 2Q6CA 2IVFB 4DFJA 3QT5A 2PMWA 1RHKB 2IJRA 1C1CA 3K0JA 1U6ZA 1QTNB 2PA8D 3OR2B 1U0SA 1SCJB 2R7SA 3CDEA 4L73A 3P3DA 3GPAA 5K9FA 1EQ0A 2V8VA 1OS5A 3MOZA 5ETNA 3T1HJ 1NSPA 3QYYA 3HSDA 1ZS6A 3W66A 3US5A 3CCUS 3AHPA 3HI9A 3V6DA 3CCTA 4I56A 2QO3A 1IQTA 4IUFA 5B09A 3G6ES 2UVRA 2B9WA 3FBEA 3G2XA 2MQ8A 3IO1A 1GMVA 4Y34A 2DIUA 4A4JA 4JI1F 4ZVFA 3KLVA 2MEWA 2GAGC 3OLAA 3I4PA 3GCWP 3F0NA 2OMOA 2E1MC 3H5YA 5CHCB 3R8YA 2IVYA 3CPWR 1CJKA 3Q2TC 3OR1B 5RUBA 3K17A 1WNEA 1UP1A 4KRWA 3AY0A 3AT1B 8RUCA 1TK8A 1OSDA 1XJWB 3TAPA 2RUSA 2PN6A 2HGNA 2KXNB 3JSMB 3ZZTA 2HYIB 5A8WA 2OO4A 2RNEA 4CLZA 1RT7B 4J9PA 4CLTA 2EWHA 1MLAA 3CO9A 4DSIA 2BKOA 2MPUA 1RISA 5CCMA 4NI2B 1RK8A 5CZXA 4IR1A 2WVFA 4DEZA 4V1Ak 3JQKA 4RW4B 2YNFA 3VAHA 3M8YA 4YY3J 4EBCA 5GAGI 4DL3A 1C0TA 1M5HA 1PBUA 2IM2A 2Z2ZA 3HK2A 2DHXA 2RUGA 5IV3A 4CI0B 5ETVA 2UV8A 5HQLA 2CWKA 4WCEQ 3D4JA 2VJUA 1TV6B 2FYXA 3PW0A 3ITHB 2XMMA 1X4AA 5D0RA 1U24A 3ENQA 1L3UA 3QJJA 5L9XA 3AAWB 2QL5B 3KG1A 1UJ5A 5L1IA 1JLFA 3T1YJ 4J9KA 1UA1A 3N01A 2DKOB 1FRMA 2HLUA 2Y1JA 4QWEA 2UU9J 1Z4UA 1IR2A 1HLWA 2O3DA 2GQQA 1HFEL 5BR8J 1YJVA 3TJAA 4N76A 2O5DA 4WE1A 6FDRA 2HGLA 4JI3J 4CO2A 5F3TA 5GMDA 2KRBA 1QDUB 4HTJA 2UVUA 1MWQA 3PX6A 3IBWA 4DSJA 1Q8LA 1VBYA 1AA1B 4KC5A 3VTIA 3LGMA 3TJ8A 1B3TA 4LQ9A 2H5EA 2VD3A 2OH2A 1OPIA 4AQYF 1EQMA 1HW9A 3MEEB 3AFGA 1REVB 1IKYB 2OEJA 4UTGA 4LSNB 2X1BA 4CCHA 2KZMA 1YVFA 3FDSA 1ZOTA 2ZH1A 3QGGA 2KFZA 3IM8A 1KSPA 3I56S 1PYSB 3NY0A 3VR1A 3HHKA 1UA0A 5IT0A 4JV5J 2YVSA 5A8RB 5F8HA 4PG4A 1K0TA 1OJ4A 2XS2A 3M6XA 4WK1A 5CAAA 2J6UA 4Z2XA 1ZYQA 3DYAB 5KG5A 2NSCA 3CCMS 3V6KA 1U8SA 3C3LA 1DTTA 2B3TB 4EYHB 1Q8BA 1F5BA 3CO0P 2R7TA 2ZM6F 5CYMB 2C2EA 3ILJA 2RD5C 5JMNA 3PYEA 3TVKA 1VISA 2JLEA 4ZDNA 1QAIA 2BMBA 4DL7A 5DGBA 4ILRA 1WSVA 3C16A 4I6YA 3RJMB 1N5YA 1T03A 3Q8UA 3H7HB 1PKUA 5K14B 1UVIA 3SFGA 1PBAA 2ASLA 4PRFA 5J1PA 1HR0F 4ED0A 3ZTOA 2NYHA 1WORA 1U47A 2NXJA 4OZNA 2YH0A 5LT5A 2BABA 1FE4A 4O44A 2W9CA 4IRKA 1X0FA 3WIVA 2JFDA 3Q8QB 4RPFA 1JWWA 3Q89A 2CIMA 1FKPA 3PIOQ 2RRNA 1JLAA 3RR7A 3FEYB 3CCSS 1QTMA 1UWAA 3A3NB 2BBEA 2GX8A 2YWFA 4OJ1A 1T8EA 1H0HB 1MWYA 3M05A 1F2HA 4U8VA 4AT1B 1S6QB 4LIWA 2K1RB 1DQAA 4DUYJ 3EYZA 4U95A 4LVNP 5ETQA 3VAKA 2PA3A 2G2ZA 5D4OA 2KXHA 3L7UA 3VAJA 4DS4A 4U8YA 2MKIA 1RA6A 2OD6A 1FEEA 3PY8A 3IS9A 4ZP7A 2PGCA 3UVJB 1DTQB 2M5YA 4I7FA 5KFXA 1KLNA 3WBZA 5GAEI 4ECTA 2RF2A 3NOCA 1RU1A 1ZM3A 1MMLA 1TUWA 2P9CA 4FYVB 4P9SA 1YJUA 5CD4H 3EVOA 2HHVA 2R7UA 2V63A 1IKVB 2MZSA 4PYDA 2LKZA 3HD1A 1IUJA 4CIOA 1UVMA 3P5TL 4CTAA 1SQGA 1KOOA 3PJWA 3GZ7A 5G0RA 4PXBA 1X5OA 3HHLD 3AJDA 3UNYA 4NYPA 3IR5B 3V4IB 5JXSA 3A3PB 1LNQA 3MFIA 4JI7J 4RNOA 1GX5A 4C8YA 4YB7A 3DCAA 4P6QA 4DN0A 5KFYA 2GIQA 4DR3J 2ZNYA 2RIJA 4ZLJA 4HT7A 1S12A 4HDHA 3D7SB 1NEEA 1FKAF 4ZITA 1XK8A 3ILIA 3GIKA 1WJ9A 1C4AA 4B3TF 3CDBA 4X4RA 1KFDA 2RDIA 3OVSA 3C15A 2OPPA 3R5CA 2D3OR 5D3GA 3OHAA 2AV5A 1VFJA 2FQQB 3DI6A 4ZVEA 5FDLB 1G3OA 3KLFB 2V0NA 4IOCQ 5BYQA 1QLNA 3EZUA 2VPXB 4BDPA 2YWHA 1IKXB 3DDNA 1VBZA 4URSA 3OT9A 2Z30B 2YKOA 1QAJA 2C1EB 3FMWA 2VDHA 5KFCA 2NXEA 2AJ2A 1WACA 4YDXA 5EWEA 3MR2A 1RWWB 3WIUA 4J9QA 3R5DA 3UR0A 1KHWA 1KN6A 5DS7A 5E7OB 1FWLA 4DI6A 2V68A 2IBOA 8AT1B 3LP1A 3PCOB 3MAQA 4A8MP 1HKAA 2AEJA 1WC6A 3WQPA 1U1KA 2I5JB 1U09A 3CC7S 2ILZA 4EGLA 1TMJA 2PIIA 4I64A 2JWNA 1JLQB 1RTZA 1CJVA 3T9ZA 5D4NA 4EU0A 1W7WA 4LQ3A 2G0IA 3GJSB 5A2QU 5D0EA 5KFFA 1FESA 1M1GA 3HHLB 2GA7A 4E8UA 1Q4RA 4ZPAA 4UT4A 3T1HF 3CCWA 3UDLA 4F4YA 1RAAB 4M5KA 3KG4A 2V4JB 1FNOA 4C98A 1D1UA 1MU2B 3PXGa 2XY7A 4KFBB 3ZZYA 1RT5B 3RYLA 1PJ7A 3M1VA 1T3OA 1SKWA 4P74A 2CDQA 2E1RA 2HQGA 4OJ3A 2P5VA 1YJNS 4OZ3A 1R3NA 2CFXA 2GS8A 4ZHRA 4ERDA 4F0KA 3QT7A 4OI6A 4Q2LA 4NEYA 3ISNC 1JNZB 3CJ8A 1N6QB 3MR7A 5GADI 4NLTA 4PPZA 3BGUA 4ZPCA 4MKVA 1GFWB 3ZZPA 1FWKA 4MIAA 2DRBA 1GMWD 2PI5A 3TNVA 1RUSA 1PAUB 4UY8T 3TAQA 1PGZA 3RB0A 4WXWA 4C11A 2QZ8A 4DX6A 1FX4A 2HHPA 1N56A 1WKJA 4ZJQA 3SFUA 3AH6A 3BQ1A 1UVKA 1TP7A 3FMBA 4TKTA 1D9AA 2QLWA 2MQOA 4EWTA 1QVGR 1X5PA 3NEKA 2P8IA 2A1BA 3UQSA 5EDWA 5J2MB 3D0GE 4IH5A 3GE9A 4YY3F 2XO6A 1URNA 3PKYA 3BJYA 1IBMJ 2AJQA 1CULA 1YSJA 3GV7B 3CJ4A 3VV2B 3OJUA 3QNWB 2LQJA 1QSLA 2CQGA 2FVSA 1ZTTA 1U1NA 3ZZ0A 2CZ4A 1SVDA 2V67A 4B3MJ 2W2MP 2ZC3A 3MEGA 1VC0A 4K4WA 2RSQA 4LF5J 2QRRA 1HBOA 4KQZA 4K59A 3KMQA 1S6PA 3QT8A 2R7WA 2NQPA 1PILA 3NXZA 3AQPA 3PYFA 5LMNJ 1GK8A 3L4BC 5A0YB 2UU9F 2G0CA 3CDUA 1RZMA 3C6TA 1B70B 4PQAA 4OMFG 2B4OA 5ETKA 4OFZA 5F8LA 3G6XA 2B7CB 1Q8IA 1VR6A 4EO8A 4JI3F 3SBMA 4USMA 4RW6A 2HVHA 2HFUA 1SJFA 3DGPA 4OLPA 4I2QA 2R8GA 3M6UA 5H9FK 4WFAQ 1ZM9A 1R8CA 3I0SA 1F0XA 4R8UA 4N77A 1CQNA 4ES2A 4X4QA 4GC7A 2OLWA 1WOOA 4Y28C 1DQ8A 1HMVB 3KHLA 3BO4A 4DL0C 3PM9A 3OUYB 2OPSA 4PR6A 3RAXA 3CCVS 4OYBA 3SQGA 3DRPB 2VQEJ 4JV5F 3QPIA 1WC5A 2AF6A 1X0PA 3EXYA 4NX9A 2C2KB 2HNYB 4URQU 3MCMA 4OZJA 2B6AA 3HLUA 1YRUA 4OJGA 2PO4A 2EEYA 3BSAA 2LDYA 1JJ2R 2EFQA 5CYQA 1LQ9A 2HVDA 4DF4A 2NXUA 2XYGB 4CRJA 4DV0J 2XGPA 1JLBB 2HKEA 1KQSR 2WHOA 1YITS 3OR2A 1KEKA 1R0CB 3OW2R 2UV8G 2YTCA 4LF6J 5HBMB 4IDKB 1IJEB 5IM0B 1ZAWA 3AQOA 3MUVP 1PCAA 2QLXA 2F63A 4KIAA 4LRFA 2IMOA 4C8OA 4G1PA 2B4VA 2A2DA 1SL2A 5KFHA 1T9YA 5KG2A 2D3ZA 4J91A 1Q95G 2XS7A 3G96A 4X4PA 2FB0A 3DLEA 1R89A 4DU8A 2KL8A 5HI7A 1QE1B 3GQCA 4ED7A 2QSWA 2JFKA 1S9GB 3H0PA 2J76E 2LQ8A 4QW9A 1JX4A 4EZ9A 4LR8A 5EX0A 2CNKB 2CVIA 3OR1A 3W2WB 4KGMA 4K4YA 4ANCA 1W2BR 4PAAA 4ZPTR 3EICA 4DN9A 3EGZA 2QG9B 4MIWA 4HL9A 1Y3JA 4F67A 2MLZA 5CH7B 3HVTA 4DUYF 3LP2B 3JSMA 2HZCA 4YFUA 1V3RA 1RT7A 3K58A 1S72S 1A6LA 4Y2AA 4MK7A 2MKJA 4NLGA 4UUWA 3GYGA 2XYPB 2XYHB 4NI2A 2MGZB 4QR2A 2QGFB 1FD8A 1XEZA 4QIWD 1Y5LB 1ZM2A 2R2SA 2IM3A 4NZ6A 4I68A 4RW4A 2AX0A 4O4GB 2DGTA 2XHCA 1UZDA 3CJ5A 1HI8A 2WK4A 3LAKA 4DPXA 3B6BA 4ILMA 3N9UC 1L3SA 1LW2B 3D67A 4ZPBA 3VGTA 1S1WB 2XI2A 4GKKJ 3K5MA 1BQNB 1TV6A 4ZVRB 1NH7A 1C2PA 4N7TA 4ZP8A 3OVBA 3MR6A 2RRBA 4O3SA 4BWMA 5MAOA 3LA0A 3GONA 4FS2A 3EZOA 1VQ5S 3BH6B 4KYZA 3G8TA 3RBZA 2FHKA 2AYGA 4FF4A 4FXDA 1HBNB 2QA4G 5DM7Q 1W25A 3A8JA 1I94J 2AJ0A 3QIDA 4DR3F 4O3OA 1VQMS 3ENVA 3RGIA 4B9NA 2FZGB 3M30B 2J6SA 1CSJA 4LR7A 4UQTA 1RHRB 4UOFA 4QW8A 2YXLA 2V8HA 3O44A 1B4SA 2EC2A 3BBFA 3D6HB 3GFHA 3C46A 5DZ7A 4CO0A 3MHYA 4EYIB 3M8ZA 4C8KA 2YQ1A 2F4VJ 3DC2A 4GRSA 4H4KC 2BQ3A 2R8IA 1VRTB 3MEEA 1C0UB 3W64A 1REVA 1IKYA 2CDRB 4V19J 3OFEA 1NKBA 1NK4A 1DARA 1K1SA 2ZBQA 2KVQE 4DOZA 4ELVA 5M2PA 1SJ3P 3VQSA 2WB1D 2FPHX 3IWLA 3LPYA 4W4MA 3CT9A 3UFCX 3MECB 3DYAA 1DAXA 4PG7A 1E6YB 3PJXA 1BD6A 4FXVA 5K8MA 2CPIA 1EJ7L 1H74A 3JB9k 1S1TB 5CYMA 1TAUA 1YX2A 1MG7A 3LOUA 5AE3A 4A47A 2VASA 2NUHA 1Q0NA 1SIZA 1V3ZA 3PEHA 3R7BB 3R3TA 4ED3A 2CQIA 4RWWA 2NPIA 1GQEA 2IMWP 5K14A 5E3AA 2CNNB 5IT9Y 4B9MA 3GSDA 2D69A 3CB4A 1JKHB 2FLLA 4KKOB 2AKWB 3C6UB 2XZDB 3DXSX 4IO1A 4NXNJ 2YX7A 5CD4A 4ZMMA 4ID5B 1SIWB 2DIVA 2Z2MA 1F60B 5DDQC 1J27A 4TY9A 2I9SA 3ILOA 1RWNB 3QATA 1FE0A 1XTZA 2KVIA 3HFVA 4J9VA 3BO2A 4O0NA 2DGVA 4U7CA 4C8NA 4JI2J 1S6QA 4ZK7M 4L6V3 2K1RA 2MQLA 3QSYB 2LDIA 5HJYA 2DO4A 4KGXB 4HR2A 4QIVA 3K5LA 2HQFA 5MLCV 4IQXA 2ZBPA 1NSAA 4Q45A 1IBLJ 3I55S 1DTQA 5GADU 3FBFA 4RW7A 1Q78A 2ASYA 3J80Y 5AJ3J 3BPDA 5B7WA 4QWDA 2P9EA 2MDAA 4Q5VA 3TANA 1RYRA 5KG0A 4PPDA 4LSLB 1IKVA 4F4KA 3MCNA 4B3MF 3PZPA 1MW7A 1UL3A 2DTJA 5JUMA 2Z4PA 4A8KA 3DLGB 2V8DA 2BJDA 4LF5F 3BR8A 5EHHA 3KJVB 4XAKA 4QIEA 4P72A 3BGLA 2H9ZA 4J37A 3T5JA 1KBRA 1N34J 1GEHA 1QD1A 2P6SA 2C3MA 3H5UA 4ZIVA 3V4IA 4C3KA 5KFPA 1GXLA 2BJ8A 3ZNJ1 1RXOB 3KLGB 1VQ4S 3KTQA 1NPKA 3IA0A 4WFBQ 2N7CA 2ROGA 3RU0A 2C2ZB 1FJ7A 1LKZA 1JLCB 2H4WB 2NREA 1NB7A 1T0TV 3BGOP 1YLXA 1RT2A 2CQ2A 4DUTA 4ENOA 1WKLA 5FDLA 4RNHA 3KLFA 2QLFB 1D09B 4M1KA 3TVZA 4CDIA 2RKIB 1TFYA 5KT4A 3MOJB 5CCLA 1YJ7A 1N5TA 1GNKA 2G2OA 2IM1A 3OTOJ 2VQEF 3DHXA 2VONA 5ETTA 4DPYA 2HFZA 4LFCJ 3EDQB 3A12A 4LBPA 4M63A 3SDEB 3H40A 1PJ5A 3UW1A 4U6PA 5CQGA 1UKUA 1S4EA 2I5JA 1K1QA 2BYCA 3G8QA 2E9RX 2R42A 2BOAA 1JLQA 5HN0A 2OELA 3EZ5A 2C2MB 3J81j 4HVZA 3EXCX 2C3YA 1FTCA 3TEHB 4LF6F 3VGSA 3UCZP 3HHLA 3W61A 4B9VA 5DQGA 2ADBA 1HNXJ 4HKQA 4LR9A 4X4UA 1ICEB 2V4JA 2F4FA 4OV6A 3BZQA 1FDNA 4DFKA 1MU2A 3CMES 5ETOA 4KFBA 4DLGA 2D7SA 4IH7A 3I0RB 4K5RA 3PR5B 1G1XA 2VFVA 4OYMA 3MAAA 4FNHA 5KT7A 4ETZA 1UZHA 1WKKA 5F0UA 3IXQA 2M0GB 4F4ZA 4JI0J 3PKMA 2NXCA 2ZD1A 1FRXA 2QLBB 4J9NA 1IBKJ 1N6QA 3HT0A 4RO0A 5H9FJ 3AXMA 3G6YA 2ASDA 4CH1A 1IM4A 4DPWA 3MM8B 2RQ4A 1NB2A 5KFNA 1ZZNA 2AD9A 3BBCA 1GX6A 2FJVA 2GVDB 3KK3B 4B08A 2DNKA 2N7YA 3QJLA 2JL9A 1LXJA 4WJBA 2E1PA 4KHRA 3W3SA 2JVRA 2CJ9A 2O66A 4F26A 2VC0A 5HVHA 4OHVA 1XQIA 4B3OA 4ZVSB 1WELA 1X4GA 2RAQA 4G65A 2M4MA 3UDCA 3TZWA 3KHHA 1N32J 1FRIA 3OQ2A 4QYZK 1FHTA 4DV7J 4LFAJ 3CIMA 3TP2A 3MI7X 3ETMA 3IGNA 2YNGB 4LMZA 2JLFA 4GKKF 3B4MA 2Y0SD 4Y00A 2YWEA 3Q2SC 1X4BA 3CD7A 4DX5A 3WZ0A 1V9OA 1R8PA 3FVYA 4DR4J 3D6FB 1KR4A 2MSTA 1CC7A 4Q7AA 2IA0A 2L41A 1KOHA 1X5SA 4Q0BB 5A0YA 5CZVA 3Q8RB 2J8SA 2YPYA 2WVCA 1HNIA 2EI5A 1I94F 3PX4A 3K2YA 1T02A 2IDLA 3R7SB 4JP8A 1N8RT 2DNNA 3KJNB 2GV1A 4FYYB 2I0XA 1Q82T 4B9LA 4I6AA 2Y1RI 2R8KA 4N5SA 2YPZA 3K8VA 3SV3A 1MROB 2W9AA 2G0JA 2IC3B 1NDPA 2QL9B 1F9FA 1BUXA 4IG3B 2V8PA 5IZHA 2DNRA 1O0PA 3Q23A 1GMWA 2FY8A 5EN1A 2MZ1A 4ICLB 2K3IA 3KG0A 1RTHB 1AYEA 1WG5A 2FGOA 3D3BJ 2RB7A 1HMVA 3NMRA 2VU5A 4JB8B 2AHOB 1YJRA 2QA4S 2VC1A 3OUYA 3MEKA 2R2TA 3MZIA 2ZOGA 3MD1A 5IT9U 2BE2B 1MWZA 4LSZB 3DRPA 5EUHA 2W7OA 4DS5A 1Q16B 1XR5A 1REGX 4C0HA 4QPTA 4OI3A 4FN5A 9ATCB 1NUEA 4DL2A 2YQ3A 4K7QA 2ZH7A 1HWIA 2AP6A 2KDOA 4OYPA 2NPFA 4RUAA 2LEPA 1VQPS 2OFGX 1JLBA 3LALA 1YGYA 3H20A 4NLVA 3HT3A 4ZVQB 4P10A 5HLFA 2ZBRA 3AJ2A 2Y8WA 1YKWA 4U9RA 5HBMA 2VG5A 4IDKA 5IM0A 1WEYA 4IKAA 1SL0A 1NJWA 4RU9A 3AD8C 4FS1A 2HZAA 2E5HA 1HHQA 2FLNA 4YB6A 2ZZMA 1UVNA 2FDNA 3T3FA 2RMLA 2D74B 3NAHA 1S59A 3J80U 3UPFA 1QE1A 1S9GA 1EP4B 4NXNF 3I87A 3DFEA 2FJBB 4KT0C 1P9QC 3GFZA 4CNYA 1U4BA 3CCQS 4NXMJ 1RAHB 2DXEA 1FT8A 2M7SA 3W9JA 2FVRA 3ZTPA 3VCDA 1D9DA 1ZPVA 4TNOA 4OV1A 3SV4A 4CLKA 1NDLA 2JX2A 3UDVA 2ADCA 3SSQA 4FDFA 3G4SS 1F6TA 3AOBA 4JI2F 5BYRA 4X84A 1QSSA 3LP2A 3D54A 1YBTA 1VHFA 1SV5B 3KLEB 3N5FA 2MYFA 1DURA 2MGZA 3VVUA 1IBLF 1T94A 3MMAA 3OVAA 3EWGA 4MJKA 3R5JB 1JLEB 2ALYB 3N6MA 4O4GA 5AJ3F 3MAHA 1YJTA 4LJMA 1OQ3A 3NS6A 2IPOB 3KK2A 3RZAA 1P9YA 4QYRA 1AZSB 3ZZZA 1XWLA 1LW2A 4L3NA 1FFGB 1S1WA 4BS2A 2OTLS 4PWDB 1BQNA 4YP3A 3N6LA 3UDEA 5DDPC 3CUNA 4DUZJ 3MEDA 4IRCA 3N4WA 4K4SA 4YB5A 1KVIA 1HBNA 2KHCA 1UETA 2AW0A 4WP3A 3FRYA 3OL7A 1RWUA 1WDDA 3T6JA 1TKXB 5J1NA 3B4DA 4TYBA 3M2RB 1SQFA 4ZP9A 2XLIA 3M30A 1JB0C 2EW9A 2NR0A 3DHWC 1B64A 4MKBA 2H5JB 4UOCA 1YIJS 4XDCA 4JYAF 4FF1A 4PG8A 3JSBA 4N41A 4CT9A 1J5EJ 1RAOA 4ZLLA 3ONQA 2HNZB 2P6TA 2GJ2A 2AQ4A 3QWUA 5C7PA 4KJIA 3TX8A 3P45B 4C8MA 1VRTA 1C0UA 4IFYB 3TUPA 4DLEA 3AODA 2FZKB 2APOA 2W1BA 2MQQA 2RU9A 3OTOF 2XULA 2W25A 2ZJPQ 4Z7YA 3HMJG 5GVQA 2LFVA 3HZEA 3FSXA 2C42A 2MQNA 4ZCIA 2IFXA 1S0MA 1IBCB 4DSEA 2LQ5A 3FCWA 3W7BA 3NGDA 4LF8F 3PRVA 1KRPA 4M5HA 1R0AB 2L9WA 2QX0A 1E6YA 3D1QA 1RTDB 1SH0A 2DNZA 3U02A 4WIQA 1UMJA 1S1TA 3W1YC 1X9WA 1TL1B 4ZLNA 1S0OA 5FD1A 1FXLA 3RB3A 1NJIT 2V5HG 2IM0A 4X4SA 3QGHA 1HNXF 1OYEA 2UUTA 1JIHA 4CM0A 2VFTA 2NUUG 4LF2A 3RUBL 4GVBB 5E0OA 1VRQC 2LP4A 4C3MA 1ZAVA 2YNHB 2YKAA 5IWAJ 1AT1B 3MPVA 1O5JA 3BR9A 3X1LB 3A13A 1NNDA 3NBPB 1IM6A 2ZJQQ 4KKOA 1VC5A 5D8HB 3C6UA 4C9DA 2B56A 3SQOP 4ED8A 3TARA 4ID5A 2VG7B 2LECA 5E3CA 1IBKF 2J5AA 5A76A 1SJQA 2YKNB 5CABA 2CPYA 1G2EA 1NZ8A 1OQ6A 4YS2A 4KB7A 3Q24A 2MB0B 1R7IA 4ELTA 3NLCA 1ZTWA 2L3MA 3TWZA 1B99A 1RJJA 3L95X 2DGXA 1FRLA 4IH6A 2DNYA 2QFIA 2HRUA 4NCGB 5F9LA 2V2VA 2ZE2B 4AL6A 2GC8A 1QY7A 3UE2A 1XN9A 2EK1A 4CZCA 2KH9A 2VPWB 3R6GB 4YEAA 1GAOA 1N32F 2HZVA 4ZN1A 4DV7F 4LFAF 1D0EA 2ZWOA 4DU7A 4LF1A 1NRKA 2MKHA 2NXNA 3VHQA 2EXUA 5IOLA 1SB6A 1JXLA 1URRA 4DCPB 2MSSA 2IYGA 5HATA 3WX4A 1Y3KA 3DLGA 1U8WA 2HBQB 1M1KT 2ZM6J 4DR4F 3P4UB 2CQDA 4NYZA 3CMAS 3NGSA 5CA5A 5J2QB 2HPUA 3KJVA 3J7AN 5T14A 2HGMA 4NEZA 3PYGA 1NU4A 2A3JA 1APSA 1TR0A 4KO0B 2UVVA 1X60A 4IR9A 5KT2A 2CZVC 3KLGA 4WFNQ 1UCNA 1TVRB 3DLKB 2HBRB 1X4EA 1JLCA 1U48A 3KKFA 1S1XA 5F8NA 2DJWA 1YDLA 5B0DA 1SJ1A 3NCRA 1HYSB 4B9SA 2ZHOA 2RKIA 4ZP6A 4EUVA 3WX8A 2KRRA 3BPSP 4LRAA 4RX6A 4NLOA 5DQHA 2RS8A 2W8LA 4LVOP 1RT6B 2GJFA 2O67A 4L3KA 2HFVA 3AA9A 2YKQA 1I51B 1SBRA 2CG8A 2ZH8A 1R27B 5LL6d 4L76A 3P8BB 4ZCMA 5ADZA 2IRYA 4Y3CA 1VLOA 4EBDA 2NS1B 1XC9A 3ET6B 5IFMA 3SDEA 3S8SA 3GYXB 2QYGA 1Y4ZB 1ZA2B 1NBEB 5BXIA 2K2PA 2Z56B 2XSFA 1C4CA 4EBEA 1UPPA 4TLRA 1IVZA 4QYZJ 2W24A 2DISA 4DR5J 2JH3A 2MMYA 1TL4A 3F44A 3OLBA 1HNWJ 4J5OA 1LWXA 1P1LA 1UTAA 3GTYX 3LWMA 2QJ3A 2GMHA 3AJ1A 2NSBA 3LGNA 3K57A 1RP5A 3CXCR 4IRDA 3CJQA 2R7XA 2ZBIA 1UFLA 3D3CJ 2J7KA 4FNIA 1HARA 5E41A 2GVZB 3DOKB 2EVZA 3H4BA 2HQCA 2RDDA 3AB2B 3I0RA 3MM7A 1HBMB 3SYZA 1OPZA 2CNOB 3VGVA 3IMQJ 2JEGA 4RNNA 1VBKA 4ZOSA 1U25A 4NXMF 2WONB 2HS0A 2KYXA 3BS9A 4UF4A 4DCOB 1U26A 3PW7A 4HH0A 3ZO7A 1N54B 3S01A 3PYDA 5I3QA 3NS5A 1K0VA 3FBBA 2V8GA 2CADA 4PQUB 2BVZA 1LWFB 4QR0A 3MFHA 3DDIA 4F25A 5C42A 5FLXU 3DRXA 4QZVB 4Z37A 3VAMA 2GVDA 1S1VB 3KLHB 4XO0A 1LK7A 1VMBA 2K7JA 2CJKA 4D3GA 3I31A 4HT5A 2EG2A 1L5UA 4FF3A 2BDPA 2WSEC 1TFWA 3MPYA 2E66A 4M5JA 3POTB 5C5JA 4NLYA 4RUBA 3QJPA 3GJQB 2ZDPA 4HYKA 4P2SA 3IM9A 3TA1A 3CJSA 2R8JA 4JOUA 2YNGA 3JTPA 2HAIA 4NLPA 4WF9Q 3T1AA 3MURP 2IY5B 1HI1A 4LBIA 5EWGA 4OL8A 1HHTP 1FDBA 3OL9A 2Y1IA 2DEJA 2QEXS 4HH1A 3EDRB 4DUZF 1HQEB 2OJ3A 3DLLQ 4NCAA 1CS4B 1F5CA 2XO7A 1R43A 4K0KF 2BEFA 3NP5A 4Q0BA 5IQ6A 9RUBA 2P2CB 4ZS6A 3KNGA 2K06A 2N4DA 6FD1A 1SJ4P 1EIYB 4Y65A 3OL6A 1TL3B 3BSNA 3F73A 1SH2A 2M2BA 1RTIB 2AX1A 4DR2J 1MROA 2IC3A 1NHUA 4KH0B 3EM1A 1TUVA 1J5EF 4IG3A 1HBUB 3G87A 2H48B 1BE4A 1NKEA 2GMJA 1LXNA 5DZ6A 4RL1A 4F7VA 3TO8A 4P7VA 2PE8A 4ICLA 5KFBA 5T7LB 1LK5A 1RTHA 3QLHB 3OTDA 2HK3A 3KWMA 1UPMB 1VCTA 3W5ZA 5IT4A 4N47A 4ED1A 3ZZOA 4USIA 5K8OA 4MTPA 2R9LA 1M5VC 4PUOB 4OYOA 1LOUA 2FLPA 5J1EB 2DNPA 3AOAA 2ERRA 3CCLS 2CNLB 1UJ6A 4HHUA 2J9DE 3SCIE 1KVKA 1JXVA 4DDFA 3THPA 1RHMB 2E7VA 1RKJA 3DDKA 4DCJB 2PDAA 5L1JA 1HPZB 4PKDB 4C0BA 2V2KA 2J0WA 2AIRB 1N0UA 3HJFA 2UXBJ 3ZTQA 4NMLA 1CC8A 3CEDA 1RT4A 2HVEA 2LLZA 2XZTB 1DLOB 3D0IE 4NOHA 5IWAF 3N6NA 1IQZA 3ZNUA 5C2CA 2HQIA 2MHNA 2BJ1A 1I6JA 4TU7A 1RB0A 2O01C 1RA7A 3UD4P 2ZNZA 5K8NA 3IN5A 2PC6A 1GXUA 5HO4A 1ZAXA 4P2MA 3KDOA 1AB8A 1EP4A 5DRKA 1N4LA 2IHR1 5A8WB 1U49A 3W60A 1H2TZ 1PO6A 1RTJB 3J7Z5 4G3IA 3H25A 2CG4A 2VFSA 2AYBA 2UP1A 3D28A 2B5JA 2MZQA 5AE2A 3NL0A 2CQ4A 2ZVIA 2E7WA 5E5NA 2HNDB 3NMAA 2YNFB 1VK8A 3BKTA 1RT1B 2HK2A 1BWEA 2UXCJ 4DPOA 3RR8A 1ITPA 4USWA 2IA6A 4KPCA 2JLGA 1KDNA 3KLEA 2WB4A 4USHA 4KHMA 2Z2YB 4RU2A 4KR0B 1DY3A 3DXBA 1SQEA 2J7UA 1JLEA 3W65A 4WZQA 1AUSL 3T5KA 1M5KC 5H9EJ 1TUGB 2MKYA 1AZSA 4UOGA 2R7VA 1VQNS 4WU2A 5KAKA 1ZM4A 4PWDA 2LCWA 4RNFA 3CJ2A 2DH7A 1GXTA 3OD2A 3OSPA 4OYWA 4DG1B 3UI3A 3TX0A 3MPWA 3SCKE 5IQQA 2KJVA 4NE9C 5JJBA 3KHRA 3DGVA 1Y10A 4DFPA 4IFVB 3HO1A 1RCXB 4Q44A 1TKXA 3M8WA 4EK2A 3J7YI 5KFSA 2V9WA 3M2RA 1H72C 4IOAQ 4NWBA 5KFGA 2FJXA 3CMQA 2OKQA 4TU9A 4F50A 1WHWA 4NASA 3MM6A 2B8PA 3S6EA 3RBDA 2HNZA 3FUYA 3BH7B 5HMXA 2JOQA 3OSNA 3SEOA 2VB6A 2GHWA 4IO9Q 1R8BA 3W5YA 5E2QA 4EI2A 2YQ0A 2IRXA 1T3NA 4IFYA 4OZLA 3CJTA 1FWPA 4WFXA 3G82B 1V5VA 3TZYA 4D3HA 1WF2A 3UN3A 4CO4A 4DR7F 2E5LJ 1RDRA 1WC3A 2R8HA 1P27B 4AD6A 1NDCA 3TUIC 3ISND 4AL5A 2OPRB 2CJBA 1NDKA 4KGZB 4YHHJ 2IDEA 4OHWA 4JI4J 1S9FA 4OZ1A 4E98A 5ETMA 2DY9A 2MQMA 2Z0GA 1KWMA 1R0AA 1B7FA 1OSCA 2OSQA 4QPXA 1R31A 4NLWA 2Z8QA 4RBUA 4I67A 4ED5A 4DR5F 3CSKA 3QWPA 5K5MA 1HNWF 1TL1A 5BYSA 5FIIA 3IWXA 3CC2S 1VRUB 3QBCA 4WKRA 2F40A 4TVAB 2GO8A 2LA6A 6AT1B 4OHXA 2LQ9A 1Q5VA 1ZZFA 2E5IA 1RBLA 1JJHA 1GTHA 4GVBA 4LIRA 4J9MA 4O44B 3GU0A 5C2GA 2Q43A 3UD5A 2YNHA 2AYMA 4NRUA 3IG1B 3P5BP 2K8GA 4HDGA 2F65A 2HHXA 5L46A 4F4AA 4XPEA 5B0GA 3M2UA 3NBPA 1RWXB 3QO9B 1Y00A 1O6XA 4ECUA 2XY6A 4USKA 2DT9A 2DGWA 5DJBA 5HANA 2VHGA 3K5PA 2FVQA 1S5ZA 3LPEA 2A2CA 4WKYA 2G9OA 5J2PB 2F7VA 2XNRA 4IG0B 2HHHJ 4U96A 3D0HE 2XHWA 5KFVA 3TEGA 4J9RA 3W9IA 4ECZA 3KJQB 3L9ZA 3IS9B 1U1MA 3M8RA 2L9NA 3M32B 2VA2A 1OO0B 3HVWA 5GMKa 4DQQA 3Q8VA 3CF5Q 3RW6A 5M2RA 1HWJA 4ECXA 3MMCB 3MWBA 4Y2KA 4RKUC 2WW8A 4DL6A 1B0PA 1Y11A 5D4PA 1NSKL 3D66A 4OI4A 2IIHA 4NCGA 1Q53A 2ZE2A 2HS3A 3LH2S 4DJBA 3A4TA 5THWA 3G86A 3DRSB 5EX3A 2DPJA 4YDDB 2BE9B 1SJRA 2LQBA 3T41A 2YX4A 4PXCA 3BQ0A 4V19X 3HVAA 1YG0A 2I6WA 4F8RA 1UVJA 4HI1A 1NSQA 3MTJA 3BEGB 4USTA 2X3DA 2AGOA 3MDFA 2VIHA 1FERA 4WYLA 2AYEA 3OJSA 3D6TB 5J2QA 5KT6A 5D0HA 4A8WA 1LWCB 2P9GA 2CPJA 4R5PA 1HD0A 1FRKA 2E5JA 1VGYA 4OYXA 1EZZB 5LSOA 4KO0A 1VJQA 1QVFR 3GFXA 3HDSA 3TUJC 2G2YA 3VAIA 3SMZA 3DI6B 1NH8A 4NCBA 3BV8A 1N36J 2XG8A 2WVDA 5HJXA 4C48A 1Z1ZA 4AXIA 2FJEB 4UQGA 1TVRA 3NCPA 3DLKA 4XIUA 5M2UA 4DR2F 4C4WA 4FP9A 4WYWA 3PW2A 2ZITA 1TQLA 5F8IA 1WHYA 2E44A 1KFSA 2J0XA 1OY9A 2AJ1A 2DY1A 2CPXA 4AFFA 4QCLA 1HYSA 2RH3A 4RW9A 2MTLA 1CJUB 3SSSA 3AXKA 2YNIB 3N28A 2FHJD 2DITA 3DU6A 3IBCB 3GV5B 4ANDA 2RU3A 4JI5J 1RT6A 2LU1A 3CD5A 1FFSB 3I9ZA 5D0GA 4ZCKA 2Z2LA 3Q8PB 2CWXA 2M8HA 2GCFA 4TQRA 2DHAA 4DX8H 1UFWA 4ITSA 2DRAA 3W63A 1UEKA 4CH0S 3HFZB 4NL5A 3ET6A 1MMDA 3B82A 2OIHA 3U27A 4CNZA 1JLGB 4DR1J 2Z58B 4P2FA 3HULA 2IBKA 2CVEA 4DV2F 3T5HA 2DYAA 3CE8A 1UEVA 4ZPWR 2EKNA 4WFYA 3R1LA 3FEXB 4NYOA 2MJUA 2POKA 3RRHA 2MKSA 2UXBF 4QU6A 1RBAA 3HP6A 3QT6A 4WP9A 2IRUA 3M1VB 3W8GA 1LWEB 2BJ7A 2DHSA 2V4RA 4QU7A 2CPFA 1WTFA 4M5IA 2WZ1A 4LF7F 2XMJA 1CBKA 3WC0A 5I4MA 4NLSA 1RADB 4Y6IA 5ITHA 2AJFE 2VF3A 5GAGU 4DR6J 1WEXA 1H38A 2GVZA 2U2FA 3DOKA 2M70A 4FXWA 3OL8A 2NZCA 2CQCA 1VHIA 1HBMA 3WC2A 3MMBB 3S1TA 1S97A 3JAMY 4CLUA 4OI1A 3OXLA 5F9NA 2HMIB 2JEFA 1K9MT 4OJHA 3CCJS 2Q79A 1R6YA 2ZKUA 2RHSB 4PG6A 2X3GA 3IWNC 4DBQA 5GAHI 4KV8B 1E6VB 4IYQA 4PQUA 1RWMB 1LWFA 2UXCF 3I9V9 3GCXP 4DL4A 1YJWS 2HWHA 1CULB 2QLJB 1H3DA 4N8NA 3KLHA 2H5IB 1RACB 1S99A 2LVWA 2QV6A 4AYBD 3G6VA 1KNZA 1RHUB 1VQOS 1LW0B 3MEGB 1HL6A 2DNMA 2XWYA 5IS2A 3DLHA 4OX8A 2YKMA 3MCOA 1HBOB 4USUA 1T05B 2AT1B 3POTA 1EAYC 1PSDA 5DGAA 4W92B 1D3WA 3E51A 3IAS9 1WI6A 3NKYA 2VOOA 4A8OA 5KFRA 1KQGB 1HQEA 3RTVA 1S1UB 4C97A 3DRYA 2MLXA 2ZH9A 1CS4A 8ATCB 3GIIA 2VKZG 7FD1A 2YH1A 1SC3B 2EFGA 1LFWA 4OYZA 3H59A 1SPBP 3L09A 4X65J 2DH9A 2I38A 2KN4A 3DNCA 3I0SB 4NLUA 3M9OB 3BN7A 1TL3A 4HTIA 3QRPA 1N33J 2JC1A 2PEHA 1RTIA 1F3FA 4M95A 3PDNA 2N3OA 2UXDJ 2CQHA 2B51A 4O23A 1T9UA 1AFJA 1KLMB 1HBUA 1VI7A 1WHXA 5B0BA 3R97A 4LT6A 2HFNA 1F1BB 4ZIWA 1UW4A 5LXYA 4K4UA 5AT1B 3QLHA 1PC4A 2W8KA 4F3QA 2VICA 1NK7A 2I1RA 2ZKTA 3O2IA 1FI4A 2E5LF 4PUOA 1HWUA 3HFKA 4RLEA 4DV1J 2X1FA 2W7AA 4PZVA 4YMEA 5J1EA 1QSYA 2C3UA 2BANB 4UZBA 1S6UA 4YHHF 2XWXA 2HVZA 2HAFA 2J9DA 4JI4F 2RT3A 5EWFA 1UWBB 1FRHA 2CPZA 1B0VA 2BOPA 1VOMA 2HBYB 3K7RA 2F1FA 4YR2A 2ALZA 2H65B 2N4CA 3G9CA 1HPZA 3VZHA 2E7XA 4K4TA 1S7HA 1GTEA 1IWAA 1WOPA 3OTCA 2GHPA 4QIFA 3DLEB 1UVLA 5ETPA 4ES3A 2VPYB 4WK3A 1T7PA 1SXLA 3ITHA 2KM8B 2CPHA 1TMMA 1DLOA 3BSCA 5JVHQ 2VL1A 5GAEU 2Y0BB 1WHVA 1TAQA 3R5AA 4FZVA 1A9NB 3ADAC 3O1LA 4CLPA 1M5SA 4OI0A 1FDDA 1PC5A 2BKPA 5A2QY 2QMWA 2ZWPA 3HVTB 3VVTA 4NLXA 1FRJA 1WDTA 2HHHF 1RTJA 4X4NA 1Y9OA 2WVBA 4C8ZA 1RLCL 4B9UA 3M7VA 1U1QA 4BCAA 1IJFB 1YI2S 2LXFA 2HNDA 3X3UA 1HW8A 4ZJLA 2XEXA 1RT1A 2DBBA 4I69A 1JQGA 3NGKA 2VPZB 2E9ZA 1KONA 3R5BA 4LSNA 2XLJA 1KQKA 2WBMA 4NLRA 3HPOA 5DG7A 1KHVA 2FC8A 4MYUA 3FSIA 3I4HX 4F0MA 3PFEA 4NZ0A 2W9BB 4YB1P 1TKTB 3EMTA 4CYUB 5A8RA 1U6FA 2FHMA 3RBXA 3RB4A 2VQFJ 4HEA9 1WOSA 1JJCB 2CZ9A 4XTTA 2KM8C 4OZ0A 4FYDA 3ILLA 1V6HA 3RW7A 3M8PB 1G6BA 1BWVA 4LREA 3W2VB 4DG1A 4JV0A 1Z2ZA 3QFWA 2RJZA 4W98A 1MMNA 3H5XA 5KFEA 3CDWA 2YWGA 3NGUA 4ATNA 3NAIA 2Y3YA 4LF4J 4PYAA 4B3RF 4IFVA 1SKRA 4OIXA 1N36F 3D6MB 4EO6A 2UVWA 2A6MA 5KFJA 5L8RC 2QSFA 2KG0A 1AFIA 2JHEA 1RT3B 1YBAA 3W62A 2DCLA 2GAHC 4B9TA 3MM5B 2OI2A 3HM9A 2G1HA 4O3PA 3FBCA 2BR0A 1U1LA 2OTJS 4R0JA 3OFHA 1NJZA 4ECRA 4OLOA 2ZH2A 3MCSA 4I0WA 4X4TA 1NPRA 3PEJA 3QIPB 3EGNA 2VV5A 2FD2A 3NGTA 2YKPA 3LUYA 3DKDA 4WFZA 3G82A 4UY85 2FTRA 4JI5F 5ETLA 1DQ9A 5LSLA 1ZH5A 1TKZB 4XK8C 3HD2A 2R7OA 2GQ2A 1SC1B 4RW8B 4A8FA 2OPRA 3BQ2A 2XLKA 4NPOA 1D8YA 4FF2A 3JAMU 2OP5A 2WTFA 2RDJA 4DR1F 3UVJA 2VBWA 2O1PA 2LYVA 1FJGF 4ZA1A 2CQ1A 4A8SA 3EGWB 1TL7B 3NWRA 3M8SA 2Y9HA 1J5OB 2HQDA 3QAUA 2VBYA 2KFNA 2OFHX 3P96A 1VRUA 2AGPA 1L3VA 2HFOA 2UZAA 3CCRS 1F2GA 4DSKA 5A6PA 3W9HA 3CDAA 2MKCA 2JSXA 1RAEB 2JNJA 3A1YG 3V4MA 1ZETA 5I3UB 4OHYA 1KS2A 2H1YA 1F3VA 2OHDA 4DR6F 3U1LA 3IG1A 1RWVB 3BDPA 2BRKA 1S48A 1K8AT 3QMQA 3KK1B 4RUCA 2DGSA 4FKXA 1T9WA 3QO9A 1FJEB 4B3SJ 3PW5A 5KFOA 4USVA 2ACMA 3V81B 3HX9A 1IXKA 2COLA 5J2PA 4JYAJ 4IG0A 5AXKA 4FYWB 2I8EA 4U7UK 2UUBJ 1B7YB 4ZLPA 3CJRA 3M9NB 2HHUA 1D9FA 1RHQB 1L3TA 3BM7A 2BW2A 3M32A 2MY7A 4RW7B 2GO9A 1IKXA 1RGVA 2R4FA 2C2RA 2B8QA 1X4CA 4M5DB 2AJ4A 3MMCA 2D1CA 5DDRC 5C25B 4F02A 4GKJJ 2HRYA 3I5CA 3CW2C 3CGIA 4NA2A 4ZPDA 1YHQS 2FJWA 4B02A 2DXDA 3C2PA 3GP9A 3DRSA 4MIBA 3HSGA 2DGQA 3AB4B 5GAHU 4LF8J 2HWIA 2QYCA 3D9BA 2GIRA 3NNHA 1Y5NB 1P8GA 2ACYA 3QSIA 3PACA 4OX9F 3TYTA 3JS9A 5E3PA 1EHWA 1LEOA 2YX1A 5EGYA 1SC6A 2J9CA 4ALZA 4KE5A 5LM7E 2CQ0A 1S6OA 1LWCA 4M5GA 2EC0A 4QIGA 2F8EX 2F9DA 3LGHA 4X65F 1F9HA 1RT2B 4PG5A 4URGA 3GR0A 4P75A 4C3LA 1NO8A 2AEFA 2HIYA 1YRTA 1TU0B 4LF9J 1YZ6A 3PR4A 2FJAB 2RVJA 3GILA 1DZ5A 5HMYA 2X1AA 1N33F 1RT5A 2BJ3A 5AXLA 4C0OC 1N5VA 3B78A 2UXDF 4FPIA 3TUZC 2VOPA 3DM2B 1HQUB 2W2PP 2HS4A 1CG2A 3OHBA 1JK9B 4J7CA 4G1QB 2MZRA 1WEZA 3DN9A 3ISZA 2VG6B 5HK4A 3E8OA 3DLBA 2EFPA 4DF8A 2FZCB 1M90T 3Q83A 1CJUA 4A8XA 2YNIA 3ZTSA 4L72B 1H98A 5E3QA 2RS2A 3JQMA 1VQYA 4DV1F 5HAOA 5DLFA 4M8LA 1BQMB 4KHPF 4DV3J 2ZUAA 3PFOA 2JVOA 3CCES 2MZJA 4H4OB 1SUQB 2V2ZA 2W4PA 1S79A 3DMJB 4DV4J 2OSRA 2J0SD 2CYYA 5HMZA 2KHDA 5DLGA 1JLGA 2Q1LA 5J2MA 1B0TA 3JYTB 4MAKA 1ZPWX 2ZH4A 4TXSA 3ICLA 3ZXWA 4W90B 3QZ8A 4DSFA 2MXYA 3QRRA 3SI8A 2NCKL 4PXEA 1I1GA 3ZTRA 3EPGA 3HHNB 1G7CB 3VALA 3RRKA 2DH8A 1LWEA 2E1AA 1S49A 3MAAB 2E1CA 2XZWA 5ETRA 3KHGA 5B0EA 3E01B 1NHKL 7AT1B 1EETB 4DL5A 2HHQA 2ZD1B 4QOTA 1H73A 4FBTA 3GG0A 3V6HA 2W4CA 1IR1A 5K8PA 1PYTA 2A18A 1JMTA 3SXLA 2A6OA 2R2UA 2XI3A 3MMBA 1V5IB 3PHEA 2YWWA 1NK0A 4ID8A 1U1RA 3TRGA 5A6WA 2HMIA 4NRTA 1CQMA 5KG4A 4AL7A 3W8PA 4X62J 4FKYA 1WF0A 5HSPA 2L9DA 2FHJA 2OAUA 5LXRA 1AROP 5H1SV 4MK8A 4B3OB 4KV8A 1E6VA 4O3NA 4PCQA 1D8ZA 3FCHA 1BGXT 3HHLC 1XNQJ 4CO3A 2R3VA 3EGVA 2KI2A 1DBDA 3MMJA 1G4CA 4BC7A 2ZHAA 4X4OA 2PFFB 1UAWA 2ABYA 2MQPA 1RWOB 3C19A 1LW0A 5F8MA 2EPIA 3KOAA 2KTQA 1Q7LB 2KT5A 2OEKA 4ZCLA 2HNYA 1Q79A 3TVYA 2VQFF 1T05A 3PJ9A 3J7A1 3MXHP 3QZ7A 3CIZA 2H4YB 3T1YF 2XTJP 1RAFB 1NK6A 2ZOMA 1HNIB 3I5AA 4NLDA 4N56A 2LEBA 2JDJA 1YWXA 4MMOA 5BR8F 3M8QB 4HHHA 5KFKA 1S1UA 4NLQA 3BYPA 2VDIA 4GO5X 1X31C 2DPIA 4EMDA 1HA1A 5DO2A 4LF4F 3EVMA 5KG3A 1FK9B 2XSJB 3KLIB 4Z7CA 1Z2LA 3T19A 5E33A 1W2IA 3C8YA 1WD6A 1IR0A 1YTYA 4K4VA 3T9NA 3L7OA 4WP8A 4F4XA 3MTKA 2PD1A 1VIOA 3R1HA 2ZH6A 1DJ0A 3M6WA 4F0HA 3C66A 3AD9C 1KLMA 3IRWP 2BQUA 4ANEA 2QMXA 1S77D 3GB0A 2X7IA 3HVRA 5U47A 1OYDA 2EBGA 3W2WA 3HKWA 2GW8A 2CUYA 3C14B 1FO1A 1EKRA 1IKWB 3FZ2A 4DXLA 3ETOA 2XMKA 2KO1A 4E0DA 4OHZA 3IFEA 2BANA 3CTRA 4H4KA 3H2VE 1Q7YT 4CWBA 5HLFB 3TW0A 2JRSA 1FVSA 1UWBA 2CJAA 3HF5A 2DVIA 3S7RA 2J0QD 2VG5B 1NPPA 2IVMA 4DWIA 1VQ7S 5C24B 2VKRA 1OIAA 3JXOA 2NYIA 3FJ2A 1H7WA 4J9UE 1BXNA 1KD1T 5B0FA 2QN6B 3I82A 2WBRA 4MK9A 4CLSA 5KFAA 4QBUA 5J2NB 2UUAJ 2AWZA 5IV4A 2PSZA 5IXUA 1XMQJ 4KBIA 4RUHA 3DRRB 3OTEA 3WDOA 1VYAA 1RHJB 3R6LB 3LTOA 3PRBA 1P6TA 3GJRB 3MUMP 4K0KJ 1YRXA 2EKYA 3F56A 3TI0A 2XMUA 4KGVB 2N3LA 3AOCA 2RILA 1FA0A 2VFUA 2EBEA 4QWBA 2HWTA 2CJYB 3UNGC 2OGUA 1EARA 4E2FB 1QAYA 4B3SF 2F8HA 2KT3A 4H4MB 4MKAA 1HNZJ 3IAM9 3E3XA 5CYJA 1U0HB 4C2MA 1SC4B 1RAJA 2UUBF 3Q8SB 2ZFHA 1H7XA 1HQ2A 3TR5A 4UOHA 3MMAB 4XPCA 3FQLA 5KFMA 2RQMA 3RAQA 3KDNA 4YUDA 4QQBA 4LRDA 3GSIA 1FKOB 4BHQA 3DOLB 2ZZNA 1Y5IB 3EPIA 3KK2B 4PWUA 4EZ6A 4GKJF 5KFWA 4HI2A 4LUBA 3KJFB 2W9BA 3BB5A 4K2JA 3GWCA 2BXJA 1TKTA 2BQRA 2VA3A 1Y7PA 1KKHA 4AE5A 1FF2A 3SCLE 4CYUA 4U67Q 2FIUA 3MEDB 4ER8A 2MHEA 1X9SA 5H9EK 4FPRA 4K2XA 3FSYA 3MECA 3HSZA 4JI7F 1YBUA 4DPUA 4ETXA 3IRXB 1U02A 2FHOB 2XGQA 2DR8A 1K47A 3M8PA 3DOMB 4KAIA 4Y2IA 4FBUA 3CJ3A 2AEMA 3W2VA 4WZMA 2G13A 2CQPA 1SI9A 3NNAA 4JI8J 3GIJA 1A0OB 4ECWA 1PIEA 4MT1A 5A8KB 7FDRA 5HVGA 3KMSA 3PHTA 3Q0AA 1ZA1B 4ILLA 4G6VB 2AU0A 1UJ4A 2DNLA 1XR7A 1BY9A 3ZZRA 4LF9F 2CPDA 4AXJA 1VQLS 4CLYA 4M94A 3PW4A 2DNQA 1JKHA 2B0GA 4Q43A 3OPKA 4K5SA 2ZOFA 1RT3A 1ELOA 2BJ9A 4C7QA 2H3EB 4GO7X 4FVCA 2DNOA 2DRDA 2RQCA 2JEJA 3MM5A 4DZ6A 1N5QA 5L38A 4DQIA 2A0FB 2FVPA 2WOMB 4OYIA 2HW3A 1Y0HA 4CP5A 4DZDA 1RWKB 2E29A 3VZIA 2CQBA 2HBZB 4KH1B 2A10A 3BBBA 3N5BA 1NZAA 4TY8B 2XCAA 4TYAA 3QIPA 1GH8A 1EKSA 1X5TA 4I1TA 5B0AA 1Q86T 1O51A 3CJ0A 3RAMA 4ZJOA 3H2UB 2YBVA 1KQFB 1EX8A 1TKZA 5HP1B 2C28A 1VQ6S 4DV3F 4QWCA 2BM0A 4RW8A 3TQEA 1K73T 4DV4F 3LWLA 4NZ7A 3GV8B 1L3KA 1T9TA 5LMUJ 2XMVA 2W7PA 2F9JA 2XY5A 4P2XA 3IR6B 2QA2A 2XCPA 1QM9A 1TL7A 4WTOB 1S7IA 1TZ0A 2EK6A 1OMSA 1J5OA 4MFBB 4I2PB 1NLKL 4LSLA 3M6VA 2Q6BA 2C2OB 1J2VA 1XIQA 3K59A 4TLQA 3UN2A 3DLJA 2PEBA 3EJMA 1RCOB 5DDOC 4C6AA 3ZFVA 2D9PA 4DMZA 1VS3A 3EUNA 4UW2A 5I3UA 2BACA 4JI6J 1DRZA 5KOXA 1TKDA 3BO3A 2NLWA 3OXGA 2C3PA 1FEHA 3NWGA 1U45A 2QT7A 3MR5A 1P1TA 2F8MA 3KK1A 3JSYA 5AXNA 4I6WA 1YZ7A 1SKSA 1PG5B 2BX6A 3V81A 5DM6Q 2PI4A 2OPQB 3MF5A 5AXMA 4X62F 2XMWA 2ZHBA 2W4DA 3TAMB 4P71A 2UUWA 1F9EB 3THTA 1ROFA 3BKFA 4ECSA 3H98A 5I42B 1FXRA 2ZEJA 4F2SA 1JJ4A 4ED4A 2PMHA 3PNIA 5F41A 1AW0A 3Q86A 2MY8A 1IBMF 1IWGA 3EVWA 4M5DA 1XNQF 1CLFA 5C25A 3BDEA 4DR7J 1BMQB 2ILYA 4DPTA 3B8HA 4CLLA 2B7BB 2CKWA 4USJC 3BREA 5KFZA 3HZGA 2VFRA 5KFLA 4XDDA 5L39A 3GFYA 1C1BB 3BGFA 5LOQA 3NRBA 3KUEA 3O8WA 5E3RA 4K8RA 1NK5A 5LMNF 2HHSA 5DG8A 1HNVB 3GR1A 3FNNA 3RG6A 2AMCB 3M2VB 2WVEA 5D6GA 3FFIB 2LA4A 4WWSA 2J9EA 2DNHA 3BGRB 4CO5A 3UR3C 1RWPB 2OUGA 3CJKB 3GLJA 1S1XB 2PT0A 3R5GA 4TU8A 2ZJRQ 1IN0A 3FC9A 2CQ3A 4I4BA 1FXDA 3A8IA 4LFBJ 5F8GA 1KC8T 2WAQD 2ZDOA 3F41A 1HIYA 3GMGA 1K44A 1S57A 3T5LA 2GHVC 4O3QA 5KG6A 2VBZA 2V6AA 5HVFA 3N79A 2IYIA 2JEIA 1NAQA 3DM2A 1HQUA 3MM9B 5LJ3Y 2BJEA 4G1QA 3I96A 2FY1A 1RSCA 2VG6A 5IC6B 4DQPA 2GMLA 1U2CA 3KNAA 1FX2A 4A8QA 2DB1A 2CRLA 2KKHA 4WBFA 3MM8A 3CCZA 3R2DJ 2IAJB 2DR6A 1M5PC 2FC9A 2BE7D 1BQMA 1N88A 4DQRA 1WC1A 4DV0F 3KK3A 2PFDA 3SZ2A 1XERA 4WXOA 4ED2A 3A3OB 4P52A 4H4OA 4X64J 1SUQA 3DMJA 3J81Y 1RI7A 3A8EA 5F3ZA 3U7JA 4FYXB 2LEAA 3JYTA 1S9EB 1N52B 1GMUA 4M5NA 3PG9A 3HJVA 1W26A 2KYZA 3Q8YA 1WUUA 1HWKA 3QQCD 1QUPA 2L08A 2HEKA 2UUAF 2DR7A 2SXLA 2ATLA 4F3MA 5I3PA 5SUHA 4H54A 2BA9A 2M3DA 3MM7B 1XMQF 3RBEA 1NMEB 5BJRA 5KTQA 1VJWA 1MNEA 3PVXA 1N5SA 3E01A 5KFDA 3JTOA 1X4HA 1EETA 1A7GE 2QTWA 1R6VA 1VIXA 3IC1A 4RBTA 2J8AA 3PO5A 3LP0B 4KTQA 3G8SA 2DXFA 3LO3A 1M5OC 3Q22A 1Q81T 4PXDA 4CH7A 1CVJA 1HNZF 2NZ4A 1MN7A 3MGJA 5KFQA 5C42B 1CJTB 2MKKA 3BYRA 2D3UA 2DO0A 5HROB 3QAEA 1XNRJ 2KJWA 3H4DA 4HACB 4QJVA 4JV1A 2YY3A 2HRTA 4J9LA 2GGPB 1X7VA 1NK9A 3H42A 2QE5A 2V69A 3NCQA 5DG9A 1UEUA 4AUKA 4CM2A 2LXUA 3P6YC 1U7LA 2I2YA 3L3CA 3FKBA 2BE2A 5CXTA 1BC6A 1H2UX 1NJYA 2DEIA 2JJ4D 2VUGA 4X66J 2ZBCA 1C1CB 4ZKAA 4DV5J 4J9OA 4X4VA 3BKUA 2HLTA 3IR7B 4RZRA 4ZPVR 3VQTA 1QAXA 1Q5YA 2K7KA 3K5NA 4DV2J 2M88A 3V6DB 2BKNA 2GIFA 1KTVA 4HHJA 2LXIA 3MR3A 4L74A 2GNKA 2ASJA 3M8QA 4JI8F 3V5RA 1T9XA 3A8KA 1VQKS 2EFOA 4YQWA 2R7RA 3O6QA 4LF7J 1FK9A 2XSJA 2GZOA 3KLIA 4NA1A 4KSEB 1CJKB 2F4VF 2OD4A 2F5GA 1I5OB 4EEYA 2UUCJ 2KG1A 3KUGA 1N0VC 4TN2A 3GJTB 1WTBA 3FRZA 3V2UC 1SL1A 3QRQA 1R0BG 3D2WA 4ZVOB 1S10A 2PMZD 2V34A 3VGUA 1OY6A 2EFVA 3C14A 4WPAA 4YR3A 4G1IA 3PV8A 2KZZA 3AA8A 1IKWA 5F0WA 5FJ4A 3LANA 4IQMA 4N8OA 1C0TB 1SV5A 3LF0A 2B9XA 4KPYA 2M9KA 4QR1A 1QUVA 2DCUB 2F3JA 5LMUF 2XBPA 1FVQA 4L75A 5KT5A 1UW9A 1RT4B 5GMEA 2VZ9A 4Q8FA 3TA2A 1HI0P 3M4XA 3UN5A 4M5LA 1NK8A 4TQSA 2ZH5A 3KUHA 3OBIA 5C24A 1BLUA 1V3SA 4J90A 1FJCA 4F04B 2BRLA 1Q8KA 2C3OA 1JLFB 4LRBA 2GFFA 3CD0A 3RRGA 2CJQA 3UCGA 5J2NA 3LQVA 3H8YA 1WC4A 2KB2A 2V4QA 1NM2A 4ECQA 1NXIA 4PWWA 1YK9A 3DRRA 5DQIA 2EFNA 4DSLA 3TQ1A 4WE1B 2J7WA 2HSEB 4YN3B 4JI6F 4OQJA 3UCUP 1VC6A 4BWJA 3QGIA 3DU5A 4ZVHA 4NA3A 2RQKA 2IJFA 2DD8S 5D77A 4JBCA 4R25A 2B5JB 4YOEA 1EB0A 2W01A 2LU2A 5L1KA 4ED6A 2Y8YA 4OX6A 1DFDA 1FTRA 4ELUA 5B0CA 4H4MA 2R7QA 2ZH3A 2FGCA 1RU2A 5JVGQ 2B9YA 4ECVA 1TL5A 4RBVA 3GIMA 1S4FA 1X9MA 3CD6S 2HURA 4EFAC 2K3KA 1JXEA 5L9NA 1SH3A 1U0HA 3EE3A 2KU7A 2MJNA 1S0VA 3IP0A 4DHVA 2DR5A 4UZCA 3HCXA 3HHDA 4DV6J 2DK2A 1XMOJ 2WW4A 1OY8A 4OZ5A 3HXMA 1FCAA 1DHMA 1O8BA 1FKOA 3DOLA 1FFWB 5HQ8A 1H6KX 2ROEA 2IJNA 2HQ3A 2H51B 1DTTB 5KFIA 2QA1A 3ZZUA 2J6TA 2C2NA 4O3RA 5KG1A 2RHQB 3PO4A 4K4XA 1N34F 1X4FA 2JZ5A 1WF1A 2OMLA 4P7TA 3BSOA 5FLXY 1MN9A 2DGOA 1RTDA 2HHWA 3C16B 1JNRB 3IRXA 4UUXA 4OYAA 1N5YB 1T03B 1QJHA 1M1HA 2WCXA 4CT8A 5LJ5Y 3DOMA 4J9SA 1BQXA 3VF0B 4MYTA 1HHSA 4QWAA 3GYNA 3PX0A 4JI1J 1TTHB 5A8KA 3MM6B 1CEZA 2HVIA 2EG1A 2W9CB 4LFBF 4B17A 1NHVA 3J81U 2E5GA 1FKPB 1YQHA 1JLAB 2BV3A 2MZTA 3VAFA 3U1NA 1H2VZ 3BN4A 3ENWA 4JUZA 4FVMA 3IBFB 1WG4A 1KTQA 1KP6A 2QIFA 2VH7A 4R0EA 3I6PA 2RE1A 3O3LA 5F8JA 3ELHA 4PABA 2WOMA 3IGVA 2Q3PA 4M5MA 4LFCF 2VG7A 4Q8EA 2D9OA 3KXDA 2G1DA 4X2BA 2YKNA 1HWLA 3OFFA 5KOWA 4TY8A 4HLBA 1VDHA 3O5TB 1RE1B 1X8DA 3HHEA 2B43A 2KFYA 4I7FB 5ETSA 4JV2A 2GQCA 2XMAA 2RF2B 3SIPB 2ZUGA 1WC0A 3JSRA 1WG1A 5HP1A 2HHTA 1Q1KA 2B4UA 4CLWA 4RNMA 4X64F 4Q2MA 1RAGB 3M9MB 4LBHA 4ZVPB 4CLFA 4BC9A 2H54B 3MD3A 3VWSA 2LMIA 2CPEA 4ZVGA 3UWTA 2VBXA 4CTAB 3GIRA 4OI2A 5G0RB 2XMTA 4KY3A 1TELA 4F2RA 2DGUA 1AXQA 3OXFA 4Y2CA 1PAEX 3OFGA 4DFMA 1N48A 3U1MA 3QGPA 4MFBA 4I2PA 3T6BA 3NNCA 4Y2MA 2M8DB 2XB2D 1VLYA 3CULA 3NG8A 2YWKA 2R2RA 2XS5A 1RLDA 3M2UB 2HFSA 3ENAA 1TK0A 3FZBA 3H5SA 4JI0F 2DHGA 2MLYA 2CA9A 3C15B 5DETA 2OPPB 1PYOB 1CPZA 5D15A 3H2LA 3J7ZT 4A46A 5D3GB 1U6BA 1R8AA 4B3RJ 3D5MA 4CO1A 2HIQA 2B9EA 2X1GA 2QFJA 2D3O1 4AQYJ 5K20B 3PTWA 3CC4S 1RAIB 2OPQA 1XNRF 3TAMA 1FDAA 4F36A 2Q66A 4ZVUB 3D1OA 4F3OA 3I32A 1VQ8S 1WSRA 2C2DA 3NGRA 5I42A 3W5XA 1S0NA 4KGKA 3P49B 2BZ2A 1R8HA 2DHHA 4C8LA 3NS7B 3LP1B 2KXFA 3R7NB 3FK4A 1RABB 4CQ1A 1KVJA 2V50A 4U7UD 3JQJA 4MKYA 3TJ9A 5HL7Q 1RQ0A 4X66F 1CJVB 1NJXA 3ZC4A 5T41A 1U2RA 4DV5F 2VODA 2DNGA 1C1BA 1RKIA 2BM1A 4WIIA 1FNXH 3GG1A 4R5PB 3G71S 1HNVA 3L7PA 1T95A 1RYSA 3K8WA 4IOBA 3D1HA 1FJGJ 4RR5A 2AZ3A 3M2VA 2ZZTA 1X4DA 2FJDB 5KT3A 3FFIA 2ZVSA 1YJ9S 3KYLA 5SZTA 3BGRA 1FNMA 1HR0J 3CJKA 3AD7C 2U1AA 3V6JA 4NMXA 2WRMA 2QC3A 4WTYA 2V9KA 3FQKA 4ZHRB 4F4WA 2AZ1A 2VJVA 2W2QP 2V2QA 4RW9B 2UUCF 2ZC4A 3CNQP 2D41A 4LRCA 3MPDA 2W2NP 1NKCA 4ES1A 4MH8A 2Y1LB 3MM9A 1ULRA 2QL7B 2AGQA 2W2OP 4C11B 2XC9A 5D78A 2V94A 5L1LA 2WONA 2FLOA 4OZ2A 2CJXB 4PEOA 4S0MA 3N0VA 1AUDA 5KFTA 3EX7B 3R2CJ 4K4ZA 1NCLA 1VQ9S 2C22A 2ROPA 3FGVA 2X51A 3K5OA 2IAJA 3PIPQ 3FEZA 3R9LA 4WU3A 1UFKA 3RB6A 3CWJA 2WSCC 1PJ6A 4GVLA 2JC0A 5LSRA
chains in the Genus database with same CATH topology
2GW8A 4QIEA 3BGLA 1S1VA 2H9ZA 4NWBA 4J37A 3T5JA 5KFGA 2FJXA 2FVCA 3THVA 1LV5A 2OKQA 2P6SA 4TU9A 2C3MA 3H5UA 4F50A 1WHWA 3V4IA 4BBYA 1FO1A 3MM6A 4C3KA 1WI8A 1IKWB 2WSFC 3FZ2A 2N82B 4K50A 5KFPA 1GT8A 1U2FA 4OX7A 1GXLA 1OWXA 3S6EA 3ETOA 3SSRA 4ECYA 3RBDA 2XMKA 2HNZA 3BF4A 3HKZD 5HMXA 1S9EA 1XBWA 3PRDA 2JOQA 3OSNA 4GC6A 3KLGB 1VQ4S 3KTQA 3IA0A 3SEOA 4WFBQ 2VB6A 2N7CA 2KO1A 1S6PB 2ROGA 4E0DA 3RU0A 2GHWA 4O0IA 4OHZA 3IFEA 3LAMA 2BANA 3CTRA 4H4KA 1FJ7A 4IO9Q 3H2VE 1Q7YT 1R8BA 1LKZA 5E2QA 2GJIA 2IRXA 1T3NA 5HLFB 1JLCB 3OV7A 1TK5A 2NREA 4IFYA 4OZLA 3TW0A 2RRAA 2JRSA 4DQSA 1FVSA 4WFXA 1NB7A 1UWBA 2CJAA 3C6TB 3HF5A 3S7RA 2DVIA 2J0QD 2BUNA 2VG5B 4D3HA 1WF2A 4CO4A 3ULHA 4DR7F 1RDRA 1RT2A 2CQ2A 5AE1A 2IVMA 2R8HA 3R27A 5KFUA 1P27B 4DWIA 1VQ7S 5C24B 2VKRA 5FDLA 1OIAA 1AFIA 2NYIA 4RNHA 1XMBA 3KLFA 3FJ2A 5G4DA 1H7WA 1KD1T 5B0FA 4M1KA 3TUIC 3TVZA 4RW6B 2RKIB 3ISND 1TFYA 4AL5A 5KT4A 2OPRB 2CJBA 3I82A 3VAGA 2WBRA 4MK9A 1HD1A 3MOJB 5KFAA 5CCLA 4OHWA 4QBUA 5D4LA 5J2NB 1XR6A 1S9FA 4I2QB 3LP0A 4OZ1A 4E98A 2AWZA 2MQMA 1N5TA 1GNKA 2PSZA 2Z0GA 5IXUA 2M52A 3CVKA 4KBIA 4Y0FA 4RUHA 2IM1A 1R0AA 1B7FA 1OSCA 5KG7A 2VQEF 3DHXA 2E9TA 3DRRB 3OTEA 3WDOA 2OSQA 2VONA 4QPXA 1R31A 1VQSA 2FUG9 4NLWA 4R8UB 2XNQA 2HFZA 1F5AA 2Z8QA 4RBUA 3TOQA 5B08A 4I67A 1M0SA 4ED5A 2B4PA 4DR5F 1S76D 3CSKA 4GMKA 5HMWA 3QWPA 5K5MA 3PRBA 4A8YA 1HNWF 3KFWX 1P6TA 3MUMP 4O4RA 1TL1A 3JTNA 4M63A 5BYSA 1YRXA 3SDEB 5FIIA 5HROA 3IWXA 3CC2S 1VRUB 2EKYA 1VBXA 4WKRA 3E2EA 2KT2A 3H40A 3F56A 3TI0A 2XMUA 2F40A 2N3LA 2OPSB 3UW1A 1VK3A 3UD3P 4U6PA 2GO8A 4A48A 2LA6A 3TA0A 2RILA 3OTBA 1FA0A 5CQGA 2VFUA 4OHXA 3I5BA 2EBEA 2L48A 2LQ9A 3SQGB 1UKUA 4QWBA 3MUTP 1ZZFA 1WWHA 2HWTA 2E5IA 1K1QA 2BYCA 2I5JA 1JJHA 3UNGC 4DV6F 1GTHA 2GGPA 2HG4A 1ZBTA 1QAYA 3G8QA 4LIRA 1XMOF 4J9MA 4O44B 4B3SF 2E9RX 2F8HA 2KT3A 4H4MB 4MKAA 1FD2A 2Q43A 1JLQA 5HN0A 1U1OA 3EZ5A 5T7LA 2YNHA 2YKMB 1MSWD 4HVZA 2B6AB 2AYMA 3IAM9 4NRUA 3EXCX 3IG1B 1LFPA 2C3YA 3E3XA 5CYJA 1FTCA 3J7YU 2K8GA 4LF6F 4C2MA 4HDGA 3UCZP 3HHLA 3SCJE 1RAJA 2UUBF 1U1PA 2HHXA 3Q8SB 4B9VA 2ZFHA 2DR9A 5CYQB 1H7XA 3LW5C 4RWXA 5DQGA 4YR0A 4XPEA 5B0GA 3M2UA 3TR5A 2ADBA 3NBPA 2G4BA 4HKQA 3QO9B 1Y00A 3MMAB 4XPCA 4ECUA 2XY6A 2Q6CA 2DT9A 2IVFB 4DFJA 4X4UA 2DGWA 3FQLA 5DJBA 5KFMA 2V4JA 2RQMA 3RAQA 3K5PA 4YUDA 2FVQA 3BZQA 1C1CA 2A2CA 4QQBA 1FDNA 3K0JA 4DFKA 1U6ZA 4WKYA 2G9OA 5J2PB 2F7VA 1FKOB 1MU2A 2PA8D 2XNRA 4BHQA 3CMES 3OR2B 4IG0B 3DOLB 2ZZNA 4KFBA 4DLGA 2R7SA 2D7SA 3CDEA 1Y5IB 3P3DA 3EPIA 3D0HE 3KK2B 4PWUA 4EZ6A 4IH7A 3I0RB 2XHWA 4K5RA 5K9FA 4GKJF 5KFVA 3PR5B 1G1XA 2V8VA 2VFVA 1OS5A 4J9RA 3MOZA 4ECZA 5KFWA 3IS9B 1U1MA 4FNHA 4HI2A 3M8RA 3QYYA 4LUBA 5KT7A 2L9NA 4ETZA 3US5A 3CCUS 3AHPA 3HI9A 3M32B 2VA2A 1OO0B 5F0UA 3BB5A 2W9BA 3V6DA 3IXQA 3CCTA 3HVWA 4I56A 2QO3A 3GWCA 1IQTA 2BXJA 1TKTA 2BQRA 5GMKa 2M0GB 4F4ZA 4IUFA 4DQQA 5B09A 2VA3A 3G6ES 3PKMA 1Y7PA 4AE5A 1FF2A 3SCLE 3CF5Q 2UVRA 3RW6A 2B9WA 4U67Q 2ZD1A 5M2RA 1FRXA 1HWJA 2FIUA 3MEDB 4J9NA 2MHEA 3IO1A 3MMCB 4Y34A 4ECXA 3MWBA 4Y2KA 1X9SA 4RKUC 2DIUA 4A4JA 2WW8A 4DL6A 1N6QA 5H9FJ 4FPRA 4K2XA 4ZVFA 1B0PA 5D4PA 3KLVA 3FSYA 4JI1F 3MECA 3OLAA 4OI4A 3G6YA 4JI7F 3I4PA 4NCGA 2ASDA 4CH1A 1Q53A 4ETXA 2ZE2A 1IM4A 2HS3A 2OMOA 3LH2S 3IRXB 2E1MC 2FHOB 2XGQA 4DJBA 3H5YA 2DR8A 3MM8B 5CHCB 2RQ4A 5THWA 3G86A 3DRSB 5EX3A 3M8PA 2DPJA 4YDDB 2IVYA 3CPWR 5KFNA 3Q2TC 4KAIA 3OR1B 4Y2IA 1SJRA 4FBUA 1ZZNA 2AD9A 3CJ3A 1GX6A 2LQBA 3W2VA 2YX4A 4PXCA 2FJVA 4WZMA 2G13A 1WNEA 1SI9A 2CQPA 3KK3B 4B08A 3BQ0A 4V19X 3HVAA 3NNAA 2DNKA 1UP1A 2N7YA 4KRWA 3QJLA 3GIJA 2JL9A 1LXJA 3AY0A 4WJBA 1TK8A 4ECWA 4KHRA 7FDRA 5A8KB 1YG0A 3W3SA 2JVRA 2CJ9A 4F8RA 1UVJA 3KMSA 3Q0AA 2O66A 4F26A 1OSDA 4HI1A 2VC0A 3TAPA 4ILLA 4OHVA 4G6VB 2AU0A 1UJ4A 4B3OA 2PN6A 3MTJA 2HGNA 3BEGB 1WELA 2DNLA 3ZZTA 2KXNB 3JSMB 2HYIB 2AGOA 1XR7A 5A8WA 1X4GA 1BY9A 3MDFA 3ZZRA 1FERA 4WYLA 2AYEA 4LF9F 2OO4A 3OJSA 2RNEA 2M4MA 3UDCA 1RT7B 2CPDA 4AXJA 3KHHA 4J9PA 1VQLS 5J2QA 5KT6A 1FRIA 1LWCB 2EWHA 2P9GA 3OQ2A 3CO9A 4A8WA 3PW4A 4DSIA 4M94A 1FHTA 2CPJA 2DNQA 1JKHA 2B0GA 4R5PA 1HD0A 4Q43A 1FRKA 2E5JA 2MPUA 1RISA 1VGYA 3OPKA 4K5SA 5CCMA 2ZOFA 3CIMA 1RT3A 3TP2A 1RK8A 3MI7X 3IGNA 5CZXA 2YNGB 1ELOA 4LMZA 2JLFA 4GKKF 4IR1A 5LSOA 4KO0A 3B4MA 4C7QA 1QVFR 3GFXA 3HDSA 4GO7X 4DEZA 3TUJC 2Y0SD 4Y00A 4FVCA 2YWEA 2DNOA 1X4BA 3CD7A 3Q2SC 2RQCA 2JEJA 4RW4B 3VAIA 3MM5A 3SMZA 3WZ0A 1V9OA 1R8PA 2YNFA 1N5QA 3FVYA 3DI6B 5L38A 3VAHA 4DQIA 1NH8A 4EBCA 4NCBA 2FVPA 5GAGI 4DL3A 2WOMB 1C0TA 2XG8A 2HW3A 1M5HA 1Y0HA 1KR4A 2MSTA 1Z1ZA 1CC7A 4Q7AA 2IM2A 4AXIA 2IA0A 3HK2A 2DHXA 2FJEB 4UQGA 2E29A 1TVRA 3VZIA 3NCPA 2L41A 2CQBA 2RUGA 3DLKA 4XIUA 1KOHA 5M2UA 2A10A 3N5BA 1NZAA 4CI0B 4DR2F 4C4WA 4TY8B 1X5SA 4Q0BB 2UV8A 5A0YA 5CZVA 3Q8RB 2XCAA 4TYAA 3QIPA 4FP9A 4WYWA 1GH8A 1X5TA 3PW2A 2ZITA 1TQLA 4I1TA 5F8IA 4WCEQ 1HNIA 2EI5A 5B0AA 1Q86T 1I94F 3PX4A 1O51A 1TV6B 1WHYA 2E44A 1T02A 3K2YA 1KFSA 3CJ0A 3ITHB 2XMMA 3RAMA 3PW0A 2J0XA 1X4AA 2AJ1A 3H2UB 1U24A 1N8RT 1KQFB 3ENQA 1L3UA 1TKZA 5HP1B 2CPXA 2DNNA 3AAWB 5L9XA 2GV1A 4AFFA 2C28A 3QJJA 4QCLA 1VQ6S 4DV3F 3KG1A 1HYSA 2RH3A 4RW9A 4QWCA 2BM0A 1UJ5A 2I0XA 1Q82T 4B9LA 4RW8A 5L1IA 4I6AA 3SSSA 2Y1RI 2R8KA 4N5SA 1JLFA 2YNIB 1K73T 3K8VA 3N28A 3SV3A 4DV4F 1MROB 2W9AA 4J9KA 2FHJD 2IC3B 3LWLA 1UA1A 3N01A 2DITA 3DU6A 4NZ7A 1L3KA 3GV5B 1FRMA 3GV8B 2HLUA 2Y1JA 4QWEA 1Z4UA 1F9FA 4IG3B 2RU3A 2XMVA 2O3DA 2GQQA 1RT6A 2LU1A 3CD5A 2W7PA 1HFEL 5IZHA 2F9JA 2XY5A 2DNRA 1O0PA 3Q23A 3I9ZA 4ZCKA 2Z2LA 3Q8PB 2M8HA 1YJVA 3IR6B 2QA2A 2GCFA 2XCPA 1QM9A 4N76A 4TQRA 2O5DA 4WE1A 2DHAA 2MZ1A 5EN1A 6FDRA 2HGLA 4ICLB 2K3IA 4CO2A 5F3TA 3KG0A 1RTHB 1TZ0A 2EK6A 2KRBA 1J5OA 1WG5A 2FGOA 4DX8H 1UFWA 4ITSA 2DRAA 4MFBB 2RB7A 1HMVA 4I2PB 4CH0S 4HTJA 4NL5A 1MMDA 3B82A 3NMRA 2OIHA 4LSLA 3U27A 4CNZA 3M6VA 2UVUA 1JLGB 1YJRA 2Q6BA 2QA4S 2VC1A 3OUYA 1J2VA 3PX6A 3MEKA 2R2TA 3IBWA 3K59A 4DSJA 3MZIA 4TLQA 2IBKA 3DLJA 1Q8LA 2CVEA 4DV2F 2ZOGA 1VBYA 3T5HA 4KC5A 5DDOC 3MD1A 3VTIA 2BE2B 3CE8A 3LGMA 1MWZA 1UEVA 3DRPA 3ZFVA 2D9PA 4ZPWR 5EUHA 4DMZA 4WFYA 2W7OA 4DS5A 3R1LA 1VS3A 4LQ9A 1Q16B 2H5EA 1XR5A 2VD3A 3EUNA 3FEXB 4NYOA 4UW2A 5I3UA 2OH2A 4C0HA 4QPTA 1OPIA 2BACA 2MJUA 4OI3A 4AQYF 2POKA 3RRHA 4FN5A 1HW9A 2MKSA 1DRZA 3MEEB 2UXBF 5KOXA 4QU6A 1TKDA 3HP6A 1REVB 3BO3A 2NLWA 1IKYB 3OXGA 2C3PA 1FEHA 4LSNB 2IRUA 2X1BA 2YQ3A 4DL2A 4CCHA 3M1VB 2KZMA 1YVFA 3FDSA 1LWEB 1ZOTA 3NWGA 2DHSA 2V4RA 1U45A 4QU7A 2CPFA 2QT7A 3QGGA 2ZH1A 1WTFA 3MR5A 2KFZA 2ZH7A 1P1TA 2F8MA 3KK1A 3JSYA 1HWIA 1KSPA 4LF7F 2AP6A 2KDOA 3I56S 2NPFA 5AXNA 4I6WA 2XMJA 3VR1A 3HHKA 4RUAA 1UA0A 5IT0A 3WC0A 5I4MA 2LEPA 2YVSA 1SKSA 1VQPS 2OFGX 1JLBA 3LALA 1YGYA 4NLSA 5A8RB 4BDPA 4Y6IA 3H20A 4NLVA 5ITHA 3V81A 3HT3A 5DM6Q 5F8HA 4PG4A 2AJFE 2PI4A 1K0TA 2OPQB 5GAGU 5HLFA 2XS2A 3M6XA 4WK1A 1WEXA 3MF5A 5AXMA 1H38A 4X62F 3AJ2A 2U2FA 2XMWA 3DOKA 4U9RA 2ZHBA 2M70A 2J6UA 2W4DA 4Z2XA 4FXWA 3TAMB 1ZYQA 5HBMA 2VG5A 4IDKA 3OL8A 3DYAB 2CQCA 5KG5A 2UUWA 5IM0A 3THTA 2NSCA 1WEYA 4IKAA 1SL0A 1ROFA 3CCMS 1HBMA 3V6KA 3WC2A 1NJWA 1U8SA 3C3LA 3MMBB 4RU9A 1DTTA 3S1TA 1S97A 4ECSA 2B3TB 4EYHB 1Q8BA 3JAMY 3H98A 1F5BA 5I42B 4FS1A 1FXRA 2VOPA 4F2SA 1JJ4A 2R7TA 4OI1A 2E5HA 3OXLA 5F9NA 2PMHA 2ZM6F 3PNIA 5CYMB 2FLNA 5F41A 1AW0A 4YB6A 2HMIB 2MY8A 1IBMF 2JEFA 1K9MT 2ZZMA 1UVNA 2FDNA 4OJHA 2C2EA 3T3FA 4M5DA 3CCJS 2RMLA 2D74B 2Q79A 1R6YA 2ZKUA 1XNQF 3NAHA 2RD5C 1CLFA 5C25A 4PG6A 3TVKA 3BDEA 2JLEA 2X3GA 4ZDNA 1QAIA 3IWNC 2ILYA 4DL7A 3UPFA 1QE1A 3B8HA 5DGBA 2B7BB 2CKWA 4USJC 4DBQA 3BREA 4ILRA 5KFZA 5GAHI 3HZGA 2VFRA 1S9GA 1EP4B 4I6YA 4NXNF 5KFLA 4KV8B 4XDDA 1E6VB 5L39A 3GFYA 4IYQA 3I87A 3DFEA 4PQUA 2FJBB 1N5YA 4KT0C 1T03A 1LWFA 2UXCF