1B0TA

D15k/k84d mutant of azotobacter vinelandii fdi
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTKCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEDKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN I)
publication title Crystal Structure of the D15K/K84D Mutant of Azotobacter Vinelandii Ferredoxin I
rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b0tA00
1FRJA 1Y4ZB 1JNZB 2VPYB 3MM8A 3HKZD 1F2GA 1B0VA 3PNIA 2WB1D 1SIWB 1KQFB 2FJBB 2GMJA 1B0PA 2FJAB 1D3WA 1AXQA 5FD1A 7FDRA 2PMZD 3IR6B 2VPZB 5CH7B 1BQXA 1FRMA 1JNRB 3GYXB 3MM8B 1DFDA 1C4AA 5L8RC 2WAQD 2Y0SD 1WTFA 2FJEB 3MM5A 1BD6A 5BYQA 1K0TA 1G3OA 1FDAA 2O01C 1KQGB 3MM9B 2XSJB 2C3YA 3MMCA 3IR7B 1G6BA 3LW5C 1C4CA 1F5BA 1FEHA 1GTEA 1PC5A 3MM7A 6FD1A 2WSCC 1FXRA 3MMBB 3OR1B 3MM6A 2VPWB 2PDAA 1DAXA 1H0HB 1Y5NB 2ZVSA 1FCAA 1DURA 1FRHA 3EGWB 4RKUC 4YDDB 1BC6A 4XDCA 1Q16B 2FJDB 4DHVA 2V4JA 6FDRA 1FRIA 2WSFC 4XK8C 4Y28C 1XERA 2VPXB 2C42A 2C3MA 1FRKA 1H7WA 1F5CA 2C3OA 2GMHA 3MM5B 5BYSA 4KT0C 4AYBD 1PC4A 3OR2A 5E7OB 3MMAA 1FERA 1FF2A 1BLUA 5BYRA 1GTHA 1IR0A 3EXYA 1ROFA 3MMCB 4L6V3 1KEKA 1HFEL 1VJWA 2PA8D 3MM7B 1H7XA 1R27B 1Y5IB 2C3PA 3EUNA 3MM6B 1A6LA 1FD2A 1H98A 1FRLA 2WSEC 1GT8A 1FDNA 2FDNA 1B0TA 1FDBA 4XDDA 4CI0B 2V4JB 3IR5B 2FGOA 7FD1A 2V2KA 1Y5LB 1BWEA 2Z8QA 2C3UA 1CLFA 2FD2A 1JB0C 3MM9A 2VKRA 4ID8A 1SJ1A 1IQZA 2XSJA 1FTCA 1FXDA 1FDDA 4OMFG 5CHCB 2UZAA 1FRXA 1GAOA 1SIZA 3MMBA 2IVFB 3OR2B 3C8YA 3OR1A 1RGVA 3MMAB 4OV1A
chains in the Genus database with same CATH superfamily
3NNAA 1QAIA 4YQWA 2LQ9A 1X0FA 5L9NA 3MFHA 4ECUA 3K2YA 4RNMA 4LUBA 5DDRC 1WC0A 1OQ3A 1TVRB 4DQIA 2JEIA 1ZZFA 5DM7Q 4DPOA 1O8BA 2V50A 2BRKA 3IAS9 3QWUA 1FJGJ 3J81U 4ZLNA 2BMBA 4PPZA 4Y2IA 4IG3B 2BV3A 1RTDA 3N01A 4ED2A 4DPXA 2FY8A 4RW8A 1HI0P 1BUXA 3FCHA 1W26A 2B7BB 3VV2B 2JEFA 1FJGF 3N6LA 2GHPA 3PFEA 1LW2B 3DM2A 4LF8J 4MKVA 3G87A 2FHJD 3HCXA 4DEZA 2AX0A 1VQ6S 3PO4A 3BBFA 1REVA 2IIHA 2RQKA 2N4CA 4DDFA 3BYRA 3JSMB 1XR6A 4E98A 4LF8F 3KJQB 2AEMA 1NZ8A 2ZM6J 1S48A 3NGSA 4KBIA 3W9JA 4ZN1A 4WIIA 3FBEA 3SDEB 3V6DA 4GVLA 2HQ3A 1K1QA 1HNIB 4X4PA 2L9WA 2ZM6F 1M5HA 1RKIA 4O0IA 1GXLA 2AJ0A 2F4FA 2QX0A 1CJUA 2CJBA 3HT0A 3BYPA 2D3ZA 3E3XA 2BJ1A 3M2UB 2R8HA 4DOZA 1W2IA 1VQPS 2MJNA 5D15A 2MHNA 5BYSA 2MQPA 4NXNJ 2JH3A 4EEYA 2HMIA 1Y7PA 3P5BP 5KFCA 3LWMA 4WTOB 1Y9OA 1X4DA 2YNIA 3I5BA 4XDDA 5KFPA 4ES2A 2WBMA 3I5CA 1KDNA 4NXNF 3IG1A 3PG9A 1SV5A 2EWHA 3GR1A 3IM9A 3T3FA 3L7PA 3MOJB 2UXBF 2W4DA 3O1LA 1U2RA 3W2VB 2RQCA 5IQ6A 3VVTA 3V81B 2MZJA 3G6VA 1ZPWX 1VHIA 2NLWA 5DJBA 1OSCA 1JLGB 4LFAJ 3AY0A 2QYGA 5LMUJ 1XEZA 2B43A 3BF4A 2E1CA 5K8OA 3KLHB 1S7HA 5KFBA 3ZZOA 4ED7A 5IV4A 1OPIA 1SKWA 4O4GB 4P2MA 1TP7A 2W2OP 3KLFA 4L72B 1PBAA 1OY9A 1NXIA 3M2RB 3DLEA 4U9RA 2C2DA 2VF3A 4LFAF 5LMUF 3MF5A 2XY7A 4DWIA 2W7AA 1RP5A 4C98A 4PUOB 2OIHA 4EU0A 1NNDA 4RNFA 1SUQB 3QJJA 1QJHA 2IJNA 2B56A 4CLFA 1VQYA 4DV4J 2G2YA 3GMGA 4NA3A 2LLZA 1X4GA 3OTBA 3H98A 4EUVA 3K5MA 3DXBA 2H48B 4CLTA 1VI7A 2AZ1A 3B4MA 3OXLA 2IAJA 3D68A 1BY9A 8AT1B 5IV3A 2JLFA 2LA6A 2VC1A 4DV4F 4OX7A 3KLVA 2RKIB 2UVRA 3DRYA 2M0GB 3NS6A 1VQSA 2XY6A 2XG8A 2A18A 5J2MA 2J0WA 1UVLA 1WDDA 2C2ZB 3QT5A 2WONA 2UUBJ 1P1TA 4GRSA 4MTPA 3DU5A 4LT6A 4M5LA 4O3OA 1YJRA 2IC3B 4AD6A 5F8MA 2DIVA 4YDDB 3R6LB 4P2FA 2WVEA 1X4CA 2V34A 4HL9A 4J9VA 1NHUA 3BKUA 3QLHA 3S7RA 2QMXA 2FPHX 3KMQA 3U7JA 4JI5J 2UUBF 4AYBD 8ATCB 4TY8A 1BQNB 4YB6A 2KVIA 3V4MA 5HBMB 2ABYA 5D0GA 5K14B 2CNKB 1YRXA 4WZQA 4MK9A 3OUYA 1WOOA 1WF1A 2E1RA 1JQGA 1S72S 4DMZA 1CLFA 1UKUA 4JI5F 3DYAA 4XTTA 4GVBB 2ILYA 4CH1A 4RW4B 1JLEB 2W2MP 1TL7B 1K44A 1JLCB 1N0VC 3F56A 3FMWA 2YKNB 3DOKA 2ZH7A 3PVXA 3D4JA 1WC6A 5KG1A 5GAGI 4TXSA 4WP8A 3DI6A 1G2EA 3MPDA 2A2CA 1HWKA 1NDLA 3UNYA 4NI2B 3LW5C 3B4DA 4ZA1A 3T1YJ 4K59A 2AEJA 2MQOA 4IUFA 1C1BB 1Z2ZA 1FRIA 3HSZA 1N5QA 4O3PA 4CIOA 4NZ0A 3BREA 1IKWA 1HBOA 3G6YA 3UI3A 2V94A 4Q8FA 1IUJA 1JXVA 3T1YF 3MPYA 3MM7B 2D3OR 3OTDA 4USHA 2XYHB 5D8HB 5EWGA 1EKSA 3EX7B 2ZZTA 3Q8RB 3KWMA 1GQEA 3PX4A 3R7BB 3T5JA 2J7WA 4EMDA 1QY7A 2BE9B 4X84A 3X1LB 3N5FA 3OR1A 3WX8A 1EQ0A 3CC7S 1BHNA 2Q43A 2ZUAA 1HQ2A 2NZCA 3TJ9A 1H6KX 1YGYA 1JJ4A 1UWBB 2DHSA 5ADZA 2FUG9 2BEFA 2LXIA 2F7VA 4YP3A 1F5BA 2OSQA 4DPTA 4NOHA 3MM6A 5ETQA 4C8OA 2EFPA 1HNWF 4WE1A 2UUTA 3NGTA 1GX5A 2GNKA 1UVMA 2ZNYA 2BJ3A 5IM0B 1NPRA 4I2PA 4U96A 3OHAA 2P9GA 4J9OA 2NXCA 3AJDA 5B0FA 4RW9B 3GIMA 3AD7C 2G4BA 3DOMB 1Y5LB 2COLA 4DR4J 1J2VA 4NEZA 3D66A 1KD1T 3KNGA 4RR5A 2DGQA 3MGJA 4M5MA 5A8RA 3PACA 2GMJA 5LSOA 1FVSA 3FRZA 3EDQB 4F4WA 3CCUS 2J5AA 3W65A 4DR4F 3DLHA 1F1BB 3VF0B 3KJVB 4NLUA 3QO9B 3IR7B 3AB2B 1TL3A 3NMRA 2V9KA 2DKOB 4OYOA 4FF2A 4GKKJ 3M8PA 2V4JA 3TQ1A 2C2EA 4OZNA 1RTIB 2P2CB 2W4PA 4ZIWA 2ZJQQ 2JC1A 4B9LA 2BW2A 2E44A 2W25A 2VHGA 1S1UB 5FLXY 1RT3B 2P9CA 2CZ4A 1RK8A 2MKYA 3I4PA 2UXDJ 5A76A 2AGOA 2DK2A 3N0VA 5H9FJ 4PWUA 4GKKF 4PZVA 4IQMA 1VQ7S 2LFVA 1B0TA 1RT2B 1OY8A 4ER8A 4W92B 2DRDA 2EFVA 2X1BA 1JLBB 1IBMJ 2HFNA 4JV0A 3THVA 3GWCA 4K8RA 2YKAA 4FF1A 5IC6B 1YKWA 1CJKA 3OR2B 2UXDF 1MROA 2IDLA 4CYUA 1FNMA 1WC5A 3KMSA 1J5EJ 1IBMF 5EGYA 2WAQD 1HYSB 2OD4A 4QR2A 2RAQA 5CYMB 3HJFA 4J37A 2C22A 3PIPQ 2HHHJ 3HXMA 2BANB 4OJ1A 1J5EF 1VHFA 3BM7A 1FX4A 2B9XA 2HBZB 2CDRB 4Y34A 3DGPA 2NREA 4RJVA 1KWMA 3F44A 1HBUB 1Q81T 1RTZA 3TO8A 3LWLA 2M4MA 4I6YA 2HHHF 4DFPA 3HFKA 3T1HJ 1TKZA 4C48A 1NB2A 2NPFA 5JVHQ 1ZTWA 3LGMA 3UE2A 3QFWA 1KFSA 5T7LA 3TR5A 4C8YA 3W8PA 3HDSA 3T1HF 3T5LA 3KFWX 1N5YA 1YQHA 1Q8IA 4ZCKA 1CG2A 2KJVA 3SQOP 2GQCA 3W66A 4KSEB 1CS4A 2R2TA 3OJUA 1D0EA 1AZSA 5L46A 2VBZA 3HVTB 2Z2YB 3M4XA 1HKAA 2W2PP 2HLUA 3LANA 5DQIA 2E66A 1LNQA 5C25A 3KLIA 3NBPB 2XHCA 2G0IA 3MAQA 5K8NA 4U7CA 3G82A 2G2ZA 2HZCA 2FQQB 3M2VB 2HNYA 3BQ2A 1PJ7A 1UEVA 1RWXB 1Z1ZA 1WUUA 3HJVA 3WC0A 1HQEB 1TK0A 2Z2LA 1T02A 2BRLA 1KEKA 2Y8WA 2DTJA 4IKAA 1KTVA 1R0CB 1XC9A 1HD0A 3KK3A 4LREA 1MW7A 5FIIA 5C5JA 2UVVA 4O4RA 5IS2A 3WZ0A 1BWEA 2XMJA 4ZPTR 1K73T 5K9FA 1X5TA 2HSEB 2DGTA 3GLJA 2CQHA 1KONA 4ED6A 3IFEA 2GO8A 3M6UA 4OZ0A 2D1CA 2ZH2A 3GJSB 4EYIB 2MQ8A 1KOHA 5DDPC 2GIRA 1SKSA 1W7WA 2XLJA 5KFEA 1VS3A 4KFBA 1S9GB 4IFVA 4M5IA 2XNQA 1X5OA 3DLGB 5D3GA 2VIHA 1BC6A 3OLAA 4ZLJA 2KYXA 2VG6B 5BR8J 3M8QB 4A8XA 4KGKA 2X7IA 3MM5B 5B0EA 5J2QB 1PC4A 1QM9A 4B3RJ 1QD1A 3JQMA 2AJ4A 1DQ9A 1NHVA 2VOPA 2BZ2A 3MUVP 3OSNA 4RWWA 1HWUA 4NLPA 3HO1A 5BR8F 3KNAA 4XAKA 1RSCA 2WVBA 1K0VA 4JI0J 4NRUA 3L4BC 3K59A 2GVZA 4DV5F 4NYZA 1O5JA 3K89A 3FUYA 3LAMA 4NLYA 3VHQA 3SDEA 1RT6B 2VB6A 1SKRA 4QR0A 1N33J 7FDRA 3G2XA 3FSXA 4Q45A 1UJ4A 3MEEB 3D6TB 2D9OA 2JFDA 3K57A 1T94A 3D2WA 2CJ9A 4CO5A 1WELA 3TVYA 2V4QA 1K0TA 3D6MB 3W1YC 3WBZA 2M88A 2N7YA 2DXDA 4U6PA 3GCXP 1PC5A 3BSNA 1S9EA 1N33F 3BO2A 1DURA 3SBMA 3DLKB 3C6TB 3SCKE 4Q2MA 3QBCA 4U7UD 1NK9A 3PM9A 1RAOA 2C3MA 1R0AB 5U47A 3CMES 1LXNA 4ZKAA 2CQ0A 2DPIA 3QPIA 1TKXB 3TEGA 5D4LA 1N5VA 4CNYA 1VJWA 2A6OA 3QT7A 4DPUA 4G1IA 1LFPA 4ETXA 3B54A 1SH0A 2DYAA 5KTQA 5F9LA 1SXLA 1S1TB 3ZZZA 3MEDB 3SMZA 2I38A 1SL1A 2J6UA 3GFZA 4OI6A 3PTWA 4IFYA 1QSYA 4GC7A 4BDPA 2QE5A 1BGXT 1YDLA 3KG1A 1RTJA 4PKDB 1L3UA 1M5KC 3ZZUA 3VQTA 4X64J 2VL1A 4RW6A 2UUAJ 1C0UA 2DNMA 2ATLA 2DVIA 4ZVUB 2OFHX 2MB0B 5HROA 4RPFA 4YHHJ 5A0YA 3GV7B 1W25A 1CC7A 1S6OA 2WSCC 4NWBA 1TTHB 1ZOTA 5KG7A 4MH8A 2RSQA 4X64F 3UR3C 2ZVSA 4URSA 1KBRA 1IXKA 4IR1A 2CVIA 2UUAF 3P3DA 3UCUP 2DXEA 5KT3A 2VODA 1L3KA 1HARA 2CPJA 4RNHA 1CULA 1G7CB 4C3LA 4DL4A 2CQ2A 2DH9A 4OQJA 4YHHF 2QGFB 4N7TA 2GGPB 3TJAA 3MCSA 4HHHA 5GAGU 3TAMA 2E5LJ 4WP9A 3U02A 2M9KA 2IM3A 4F67A 1U6BA 1Y10A 3NGDA 1UFKA 2I5JA 2Z57B 3IN5A 1JWWA 1C1CB 4DN9A 3CIZA 1YJUA 4FBUA 3DGVA 4WYWA 4I6WA 2BKNA 3TNVA 1JLAA 2RUGA 2VKRA 4G3IA 2V4RA 2RS8A 2EI5A 2DR8A 2E5LF 1S10A 1EX8A 4RUBA 1LQ9A 1S1XA 3QZ7A 1VFJA 4F2RA 4IRCA 4MK7A 4KAIA 1MMDA 4N8NA 1FDAA 3KDNA 2JLEA 2IC3A 2MLXA 3UNGC 2GC8A 1P9YA 4KGVB 2OJ3A 1T05B 2KB2A 4DJBA 2YPZA 1T9YA 2YXLA 1VRUA 2XS2A 3GE9A 3G8QA 2F9JA 5B7WA 1GFWB 3CE8A 4CLPA 2ZH4A 2YWEA 4LQ3A 3TW0A 3M8ZA 5EWEA 1M1GA 1RHRB 3JSRA 1URRA 3BV8A 3CF5Q 1MWYA 4OZJA 5HVHA 5AE1A 4DSFA 2UP1A 2NQPA 1REGX 1U47A 4GVBA 2OPQA 2XC9A 3NNCA 4C9DA 3I6PA 1VJQA 2F1FA 1FJ7A 5J2NB 2JX2A 1TELA 1SIWB 2FJBB 3OTCA 2VG5A 3TA2A 1IR1A 1HHSA 2DHGA 4LSNA 1R31A 1BD6A 1T8EA 1XN9A 1NK5A 3H4BA 1KQSR 2J0SD 2MQQA 3JB9k 3W64A 3CJKB 1DTQA 1SC6A 1VQ4S 4WF9Q 1FESA 3PJ9A 1ZAVA 1FTRA 5F3ZA 2OUGA 4G1PA 2HG4A 1YTYA 3I0RB 4ECYA 5IFMA 5HJYA 1X4BA 4LF9J 2F9DA 3TYTA 4C97A 1KTQA 1GEHA 4M5JA 5E3CA 1RI7A 4FF3A 4UZBA 2B4OA 4ELTA 1OO0B 3SZ2A 4QWDA 1H98A 3FVYA 2M52A 5IT9Y 2VG7A 4LF9F 1T9UA 1IQZA 4CO0A 2CYYA 3CT9A 4ENOA 5AE2A 1Q7YT 4N77A 3JSYA 1B0PA 1RACB 1JIHA 1VISA 4FXVA 1N5TA 1OWXA 5EWFA 2XYPB 2IRXA 3FSYA 1JXLA 2QMWA 1PJ5A 2R2RA 4PXEA 1KS2A 2BX6A 1TKDA 2MMYA 4GC6A 4FNHA 1WD6A 4QR1A 2HNDA 1RZMA 4J9PA 1VR6A 4Y2CA 3OV7A 1MMLA 1QVGR 2HVEA 3US5A 1EIYB 4OYBA 3BBBA 4XO0A 4DV1J 4IG0B 2E5HA 3F73A 4B9MA 3H42A 4K2XA 5D4PA 1Y3JA 1IR2A 1XBWA 4B3TJ 5K8MA 2YBVA 1T03B 1UFWA 3JAMY 3HHEA 2XSJA 4M5GA 3T6JA 5KFGA 1TL1A 2XO6A 2K7JA 1YRTA 2E7XA 4MKBA 1JX4A 1KLNA 4DV1F 1R43A 2WB1D 3RAMA 2BYCA 2MQLA 5KFKA 1WACA 5J1NA 1S57A 3D5MA 5I3UA 4B3TF 4KPCA 3I31A 2A6MA 2G0CA 2HNZA 3C16B 5AXMA 2GVDB 1TL4A 3HHLA 2DNPA 3D0HE 4CLUA 2YWGA 4DCOB 2ERRA 1FNOA 3P96A 4I2QA 2RS2A 3CDBA 2BQRA 1S7IA 2MQNA 4Z37A 4OHVA 4RUHA 1FO1A 5KFTA 3ISND 2EFGA 2FHOB 3J81j 2Z4PA 2CZ9A 3I9ZA 3BGFA 1HWJA 1EKRA 3CGIA 4C0HA 3VGUA 2E29A 4DX7A 1AUDA 3AD9C 2F5GA 2W24A 3DRSA 3RU0A 2RF2B 4V19X 2G9OA 2QA1A 1DY3A 3FFIB 2VV5A 3C8YA 4ZK7M 2MKKA 2DGVA 1M5PC 3AT1B 4P52A 4QZVB 2CQCA 2V69A 3TZYA 2ZDOA 2QLXA 3HSJA 3GCWP 2MHEA 3QYYA 3KLGB 4DZ6A 1RBOB 1HBMB 1Q8KA 2PEHA 2HQCA 4ZVSB 2CA9A 5ETMA 1P8GA 4Y2MA 3O6QA 4U8YA 2J8SA 5KFJA 3H20A 4ZDNA 4L74A 4ECWA 2H9ZA 3PY8A 3T6BA 3O3LA 2KU7A 4E8UA 4DR7J 2EBEA 3CCWA 2VUGA 3OQ2A 4P2SA 1H7XA 4A8FA 3FZBA 1EETA 2AT1B 4AXJA 3Q23A 2WOMA 4PQUA 3NGRA 1YSJA 4DR7F 2PT0A 1YRUA 4YEAA 2R8KA 4CLWA 3MMAB 3KK2A 3R6GB 1T9TA 3BGRA 1VIOA 3ISNC 1FE4A 4MFBB 3EGZA 3TZZA 4WCEQ 5I4MA 1RDRA 1X7VA 4BS2A 4LFBJ 1WDTA 2Y0SD 3SFGA 2HVIA 1WF0A 3GJRB 2DO0A 4DCPB 2Q66A 1S6QB 1R0BG 2X1GA 4HLBA 4Q2LA 2QLBB 2IRYA 1D9FA 4C11A 2LXFA 3QT8A 2YNGB 3PJWA 4LFBF 3CJ5A 3H90A 4PR6A 3MPUB 3Q86A 4F2SA 5E7OB 3JTOA 1SJRA 2HLTA 1NK7A 3J81Y 1X0PA 4ZMMA 2DEJA 4DZDA 3MCNA 2F4VJ 5HQ8A 2CJKA 2WRMA 2B6AB 1BQMB 2JZ5A 4MIAA 2KHDA 2FD2A 4X4RA 3OFEA 2W9CB 5L39A 2PFDA 2B9EA 1KRPA 4DL6A 5G0RA 3LP1A 2RIJA 4DX8H 2BQUA 1PCAA 4ZVEA 4OV1A 4NLGA 3ZO7A 5KFRA 4G1QA 2F4VF 2KTQA 4ZPVR 4W98A 2KZMA 2QL5B 3ENVA 2EW9A 4ZVPB 5AXKA 1WWHA 1APSA 5B0BA 1VIXA 4EYHB 4DPWA 4IOAQ 3R7SB 2OTLS 4R0JA 4NZ7A 4RKUC 4ERDA 1ITPA 4B9UA 1E6YB 4XK8C 2VBYA 2J7UA 1OMSA 2E1PA 2UVWA 2GMHA 3WIVA 1S4FA 3CDEA 2DISA 2Y3YA 1WOSA 3LA0A 2YX7A 2Y8YA 1X9MA 4OYXA 1VQOS 2VFVA 1H2UX 1UETA 4H4OA 2R8IA 1LWCB 1FJEB 1VBKA 3CDWA 3VCDA 3U1LA 4PG5A 4NCGB 4F0KA 5H9EJ 3Q0AA 4Y65A 1M0SA 3O8WA 4N56A 3M30A 2OO4A 2QIFA 2O67A 2NSCA 4IOCQ 1D3WA 2FVSA 1VGYA 2XZTB 4Q7AA 2IPOB 3BGLA 2UUWA 1DBDA 1WTFA 1K8AT 3SQGA 4KHPJ 2OPPB 3DHXA 2HHSA 1U48A 4Q0BB 2FZGB 4K4XA 2HQFA 2WVCA 2QLJB 3P5TL 1YJVA 2LP4A 3W3SA 2V63A 2AJFE 4AQYJ 4OI2A 4UOGA 4E2FB 4KHPF 2DGOA 3HFVA 9RUBA 2OKQA 4LMZA 2QV6A 2ZWOA 2ZBCA 3DLBA 3D7SB 2BUNA 2IM1A 1M5OC 5KOWA 2HHQA 5KFLA 5LJ3Y 2BKPA 3D1HA 4PG7A 1RTHB 1T9VA 1FRLA 2OPRB 3W62A 4AQYF 1N5SA 3KK1A 3R2DJ 4LVNP 4GO7X 3CJRA 1WI8A 5J2PA 2C3UA 2J6SA 2AJ1A 3RB6A 2A2DA 4QCLA 2QLFB 1FRJA 3O2IA 1MG7A 1F2GA 3PNIA 2CIMA 4QOTA 2ZNZA 3KUEA 2PMZD 2HZAA 4R8UA 5ETLA 4Z7YA 3H2VE 4ICLA 4DF8A 2ZE2A 4CZCA 3GV8B 3I56S 4ALZA 3L9ZA 5D4OA 3T5HA 5AJ3J 4AFFA 4C8LA 1UJ5A 4QU7A 4LBPA 2N3OA 2V8DA 3RB3A 4J9SA 4EBCA 3ISZA 4DUTA 4ECSA 4LF5J 1IN0A 2XNRA 3DOLB 1UW4A 4K5RA 3KG4A 4J7CA 3OTEA 4EGLA 3MR3A 1H74A 2DGXA 4BBYA 5AJ3F 3CCLS 2HQGA 4UY85 4ELVA 3AJ2A 2OELA 2BE2B 4LF5F 3UCZP 4URGA 2FY1A 2FJWA 4BC9A 3HHLD 2OTJS 5L1JA 1U0HA 4F0HA 2APOA 4JB8B 3EM1A 4RUAA 3W2WA 3FCWA 5F8IA 2DEIA 4LSLB 4JI3J 1RLCL 1J5OA 3M6WA 4C4WA 2VDHA 2ZHOA 2XS5A 2D7SA 1AXQA 1FNXH 1YIJS 5DRKA 2I8EA 3G6XA 1OSDA 2KJWA 3G71S 1U6FA 3QATA 2AWZA 1U45A 4JI3F 4TNOA 3G9CA 3NCRA 3MMCA 2DCUB 4O44B 3M8WA 4FXWA 4USTA 3MTKA 2HS4A 5J1EA 4RUCA 2ADBA 4YB7A 6FDRA 4AL6A 3M1VB 1RADB 3QJPA 1IKYA 2GQ2A 1S1WA 3FC9A 3A8IA 1YWXA 1GTHA 2XMKA 3R5JB 1GNKA 1HPZA 1YBUA 1RWPB 3BR8A 2UUCJ 5CYQB 4WFZA 3MUMP 5A2QU 3EYZA 2RD5C 3M9NB 4ED5A 1I1GA 2D3O1 1LKZA 1RHQB 4DFMA 5E3PA 1ZYQA 2UUCF 1DRZA 1NBEB 3NLCA 4NLXA 1NSAA 2VDIA 5LXRA 3BGOP 4YDXA 2J9EA 3DRRB 2B8PA 2HRYA 3HHLC 1KQGB 3NKYA 3MMBB 5IC4B 2D3UA 4I7FB 2OD6A 3KXDA 4DX6A 4X4QA 3AOAA 2IJRA 5BXIA 2XCPA 4EK2A 4HTIA 3TZWA 3QWPA 1VBZA 2LEAA 3CCSS 2J9CA 4RW7A 2N4DA 3R1HA 3KHHA 1HD1A 1HFEL 4BHQA 4DQSA 3MDFA 1X60A 4Q8EA 3R5DA 2FDNA 2QSFA 2HHUA 1ZM3A 3AOBA 4QWAA 3CCES 4FKXA 4HH0A 2MYFA 2CPHA 6AT1B 2HPUA 3LGNA 1F5AA 2XGQA 3KHGA 5J1PA 2RHSB 2F8EX 3PJXA 3S6EA 4FYVB 1YJ9S 1LW0B 5E5NA 1D9AA 4USIA 4DS5A 1UEKA 2HHVA 3SI8A 4U8VA 3HLUA 4HDHA 1U26A 3UVJB 2ZH6A 8RUCA 2RQMA 1TZ0A 1NSQA 2GFFA 2OMOA 1N54B 1QVFR 1EP4A 2VBWA 3GZ7A 1RCOB 2IM0A 4IQXA 2B5JA 1C0TB 2CXEA 4QW9A 3J7Z5 2GMLA 5CA5A 3TP2A 2W9BA 2BABA 1GX6A 4TKTA 1FKOB 2PA8D 1CBKA 2YNFB 4U95A 2R2SA 2YQ3A 2NZ4A 4DR1J 5KG2A 2F40A 3GV5B 2RU9A 4OYIA 5DQHA 3C6UB 2JEGA 3MAAA 1NRKA 2R7RA 2CQPA 3R5BA 4ZPBA 5HP1A 3UFCX 3CJ3A 3ETOA 4A8YA 3VZHA 2MZQA 1VLOA 3I0SA 1NB7A 2QN6B 4C6AA 2A0FB 2WW8A 1TR0A 2I0XA 4KO0A 1Q78A 1FFSB 3JAMU 4CH7A 4M5DA 2IM2A 4J91A 2XMTA 1DJ0A 5CXTA 1V5IB 4NLWA 1FXRA 2HIYA 2LU1A 3MXHP 2VA2A 4F4KA 3BB5A 4B08A 1VC6A 3CCTA 4CTAA 2ZOGA 3KLEB 3OLBA 1EQMA 4FYYB 2V8HA 3PKYA 5E3QA 1UZHA 1K1SA 4DV3F 1B7YB 3A3OB 3BN4A 3MAHA 2HK2A 1HQUB 2H5EA 2CKWA 3J7A1 1S6PA 1IKXB 1E6VA 1FD2A 4YB5A 3N79A 1S1VA 2W7OA 1RA7A 3EZUA 3TQEA 3MD3A 3LTOA 4Y6IA 4J9QA 3BR9A 2HEKA 1X31C 2PO4A 3C14A 2DNGA 2YKMB 2V5HG 4LIRA 3CJ0A 3HK2A 4ECZA 3Q8VA 1D09B 2HFUA 1URNA 3EWGA 5L9XA 4MKAA 2JL9A 4ZHRB 1JLQB 3D54A 2OGUA 3R2CJ 3GFHA 4OJGA 3IRWP 4GMKA 1Y5NB 3SXLA 4K4SA 4P74A 4TU7A 2CQBA 1RT1A 4B9SA 1HL6A 4NEYA 4F4ZA 5HJXA 4QIGA 3LP0A 2CPEA 2ZD1A 1WI6A 2R7SA 2M5YA 4NXMJ 3LGHA 1OY6A 4A4JA 3SSQA 4ZLPA 2OPSB 2JFKA 3EGVA 3T41A 5LL6d 2XMAA 2DNNA 4ZP6A 2R8JA 4RL1A 5HSPA 2H4WB 5C42B 3QIPA 5HQLA 4NXMF 2OLWA 1VC0A 2M8HA 3AD8C 1PYTA 4N47A 2FLPA 4QBUA 4RBUA 3SV4A 4C8KA 5JMNA 1D9DA 2RDDA 1I5OB 4KGXB 3G8TA 4MYUA 4LBIA 3RB0A 3EPGA 1RT5A 1EB0A 1ZBTA 2V68A 4PQAA 4X62J 1FK9A 4I1TA 2IYIA 3PYGA 3A3PB 3RUBL 3OD2A 2BACA 4C8MA 3EGWB 3IGVA 4CM0A 1FFGB 3D3CJ 3P4UB 2XI2A 5SUHA 4QWCA 3HP6A 4X62F 3UWTA 1RAGB 1IBLJ 4P75A 2PC6A 1HBNA 4RU9A 4PWDB 1FWPA 4J9NA 4EWTA 1PIEA 3Q8QB 3QJLA 3TZXA 1A6LA 5C24A 1N34J 1XJWB 3U1NA 4ZPAA 2EFOA 2LEBA 2CPIA 3TANA 1RT7B 2CZVC 3HHNB 4PRFA 4ECVA 5GMKa 2YNHB 1IBLF 1WF2A 2BXJA 3QGIA 2L48A 3GB0A 1SC1B 1N34F 4OYAA 3BEGB 2IJFA 3I4HX 1PG5B 3V6KA 2XULA 2UXCJ 4DUZJ 1B64A 4KHRA 3W63A 2XHWA 4K4TA 4B3OA 1G4CA 1SJ4P 3K5LA 4XPCA 3EE3A 2O5DA 3ZNJ1 3KOAA 2JWNA 3KHLA 4MIWA 2JDJA 3MEGA 2MGZB 2YH0A 1OYDA 1U1MA 2UXCF 4S0MA 4DUZF 1RE1B 4DG1A 4F3QA 4B9VA 4Z2XA 4YFUA 2MKHA 3AXMA 2RHQB 3C15A 3V6HA 3EPIA 5KFDA 5DGBA 3CCMS 1IR0A 1V3SA 5E0OA 1JJHA 5C7PA 4UQTA 3HPOA 5A8WB 2QG9B 4GO5X 3HMJG 1FKPB 3HVAA 2KRBA 7FD1A 3KJNB 3D1QA 1SJ1A 4ZVFA 1WKLA 1TV6B 3E01A 4CLYA 2MZ1A 2ZFHA 4CT9A 1N6QA 1VK8A 1FFWB 3UD4P 3H2UB 4N41A 4JI1J 2N7CA 3C2PA 5DGAA 1Q8LA 5KT5A 5I42A 1YI2S 2VPZB 2FHKA 3R3TA 1N52B 2WHOA 3S1TA 3LPEA 3DRPB 4BWJA 5B09A 2E9RX 2AHOB 2ZJRQ 4ZP8A 1LWEB 2ZEJA 3SFUA 1R6YA 1TKTB 2AJ2A 1CQMA 2IVMA 2GX8A 3UN2A 2KKHA 5E2QA 4J9MA 4JI1F 2B0GA 3WIUA 2RDJA 1RAIB 4NLVA 3H0PA 4JV2A 2UXBJ 2YKOA 4I0WA 2R9LA 5JVGQ 4PXDA 1ZS6A 2H5JB 4ED0A 3L3CA 2KH9A 4M1KA 2YWFA 1YBAA 1BMQB 1U4BA 2VONA 2E9ZA 2NCKL 1RTDB 4LRBA 2CJQA 3ZTOA 4RW8B 5FDLB 2ZH5A 1SQFA 5M2RA 4LBHA 4CI0B 2XGPA 1R8HA 3OL9A 4CO2A 2EFQA 4R0EA 4KE5A 2HGMA 1RWVB 5D0RA 1R89A 3DM2B 3OT9A 3ITHA 1DTTA 3UD3P 3TA0A 3IS9A 1B0VA 1WNEA 4DL7A 1S6UA 3MECA 3IRXA 2H54B 5K5MA 1REVB 1S0OA 3ILLA 1HLWA 3G8SA 2E9TA 3AFGA 3N6MA 2QA4G 4QW8A 1VC5A 1KVIA 2Y1JA 1HNXJ 1FCAA 1PYOB 1HWIA 3IMQJ 4Y28C 3AQPA 4PG4A 3CJQA 3V6DB 4PWWA 4OYWA 4KPYA 4EO8A 2G2OA 2QSWA 1LK7A 2QL7B 2IFXA 1R8CA 1N88A 1N56A 1HNXF 4HKQA 3W60A 2BJ7A 4CLSA 3EUNA 1ZM9A 3GIRA 4K50A 4LSLA 2HURA 3Q2SC 2Z2ZA 1CJUB 2GA7A 4LF6J 4NCBA 2HHPA 3PV8A 3UR0A 1LWFA 3MUTP 2GJFA 2RDIA 2HMIB 3G86A 4MT1A 1NPKA 2YNIB 1NAQA 4F3OA 5F8LA 4MKYA 4C0OC 2VKZG 3ZZ0A 2H1YA 4LF6F 1U7LA 4H4MA 1EZZB 4ED4A 3V6JA 1PJ6A 1M90T 3IG1B 3H5YA 1SV5B 4I6AA 3SV3A 3G4SS 1EHWA 2DNYA 5D0EA 3LP2A 3BZQA 1CEZA 3M1VA 1N36F 3FBBA 4QPTA 4RBVA 1IKVA 3H7HB 1MWQA 4K4YA 4JI8J 3K8WA 3MMJA 5KG6A 3B6BA 1U8WA 4TU9A 3E2EA 4Y00A 1U2CA 1QE1A 2C2NA 2W2NP 1WHYA 4C2MA 2KT3A 3RRHA 3UDVA 4H54A 4FDFA 4JI8F 2E7VA 3D9BA 1FE0A 3DMJA 3RAQA 1Q82T 3MM9A 2ROPA 3KLFB 4OMFG 3WX4A 2YWWA 3DLEB 4ITSA 3AOCA 3IAM9 1RGVA 4NRTA 2DBBA 1Z2LA 5IOLA 3HKZD 2ACYA 2MZTA 3CMAS 4LSZB 1NJXA 3MM8B 2CQIA 3VGSA 5D6GA 3JTNA 4B3SJ 3FDSA 4CO3A 1JK9B 2IAJB 3Q89A 2V2ZA 2JHEA 4TVAB 3L95X 5KG5A 5HMWA 2PFFB 5F8GA 2ATCB 5GMEA 4PPDA 3QGGA 2R7TA 1D8ZA 1RB0A 2BOAA 1I94J 5HQMA 3M9MB 3T1AA 1ELOA 4JV5J 5L1KA 5J2MB 4B3SF 3FEXB 3J7YI 1BLUA 2CNLB 4EZ6A 2WONB 4M5NA 2FVCA 3ZTRA 1HNZJ 2CQGA 4NA2A 1I94F 2QLWA 1LOUA 4UT4A 4B3MJ 1HNWJ 3QZ8A 3JYTA 1RCXB 1KR4A 4JV5F 1ULRA 1YJTA 5CD4H 3QLHB 1M1HA 5HLFA 5GVQA 4NYOA 2EG2A 4WKYA 1SIZA 3K58A 4V1Ak 5LMNJ 4RNNA 1NU4A 2QC3A 4TY8B 3M9OB 3EMTA 3SEOA 3W8GA 1HNZF 5F0UA 4OJHA 1Z4UA 3HI9A 5KFWA 2PMWA 4I67A 4B3MF 5HAOA 3OUYB 4DL2A 2LQ5A 2MY7A 1YHQS 3QNWB 3A8JA 2K1RA 4M8LA 2OEKA 3ENQA 1HHTP 2L41A 3DYAB 3EZ5A 1EAYC 5LMNF 1SQEA 1DARA 2XLKA 1HNVA 1HI8A 2EC0A 3KDOA 2ZOMA 2HFVA 4ID5A 3VR1A 3U27A 2ZITA 3MR7A 2ZKTA 1N48A 4IRDA 3V4IA 4WK1A 3DOKB 4GKJJ 2Z58B 3SCIE 3GG1A 1CSJA 1FRKA 3RBDA 4ANDA 2LA4A 1MMNA 3DI6B 3N9UC 3CULA 1R3NA 1O51A 2P6TA 1ROFA 3KHRA 3BDPA 4PEOA 2V8PA 2KXHA 5F9NA 4GKJF 1FDBA 2NUHA 2DR5A 3T9NA 1JLFA 2DHXA 1H72C 1MN7A 1IKWB 2ZH8A 1HBOB 4F50A 1WKJA 1RT4A 3MURP 2JNJA 4ZS6A 1P27B 2XLIA 4ECTA 4Y2AA 3MR2A 5BYQA 5KFOA 2QA4S 4MK8A 2C3YA 4KQZA 4QU6A 3HZGA 2IMWP 1MLAA 3OR1B 1AW0A 2H4YB 1FT8A 2D74B 3K5OA 1CJVA 3W5YA 4DL5A 3F0NA 1UPMB 2HW3A 3R5CA 3MR5A 4M94A 1HQUA 1JJCB 5CQGA 2SXLA 4W4MA 1CQNA 1XWLA 1U1KA 3ULHA 3IGNA 4Y3CA 2MKIA 3BS9A 4NLQA 1Y5IB 2B51A 2FLNA 3MM6B 1UMJA 4DFKA 2DNKA 4WE1B 4ZPWR 3RBEA 2Z0GA 4IH7A 1YJNS 3UDLA 4ZP7A 3M7VA 4ANEA 1Q95G 1OS5A 2UZAA 3IWXA 4RLEA 1U1RA 2ZDPA 4I2PB 3FKBA 4DLEA 4FYDA 4NLSA 3OFGA 2EXUA 1CJTA 1SQGA 5KT7A 2GJ2A 2O3DA 1DLOA 2VC0A 3PFOA 4LQ9A 1WEXA 3THTA 3A8EA 1FHTA 3M05A 3CTRA 3JQKA 4N76A 1FEHA 1MU2A 3Q8SB 5A8RB 2HGLA 2HHXA 1Q16B 4J9LA 1SPBP 2RJZA 2D41A 4HI2A 1UJ6A 5H1SV 3T9ZA 5A8KA 4AL7A 4F26A 1ZZNA 3M32A 2VQFJ 2X1AA 3AJ1A 2PI5A 2CRLA 1TL3B 1WOPA 4UUWA 3LUYA 1Y11A 2W2QP 3D6FB 3D6HB 5AXNA 1T9WA 3POTA 1UWAA 3M8PB 2ZWPA 2V4JB 5DG9A 1AUSL 1S0MA 1RWOB 3W5ZA 2QFIA 1RUSA 2HWIA 4P72A 2VQFF 3H4DA 3DKDA 4R5PA 2BJDA 3ET6A 2CWXA 2M70A 2ZH3A 5KAKA 4WIQA 2K06A 1DQAA 4DR3J 4LRCA 1JKHA 3A8KA 1N0UA 4YR2A 3J80Y 1SCJB 1HMVA 5MLCV 4K5SA 4OHZA 2XMMA 4KKOA 3DDNA 3WDOA 3O44A 2WBRA 1RWWB 1VRTA 2AQ4A 4ZOSA 4WU2A 1GTEA 1CJKB 2DHHA 4KV8A 4DR3F 1H0HB 1MROB 5EX0A 4CYUB 3GIIA 2J7KA 3HSDA 4ZPDA 1RAAB 4USWA 1ICEB 3ZZRA 2KM8C 3NGKA 2QT7A 2R7XA 3JS9A 3CD7A 1RKJA 3PIOQ 1IVZA 4IDKA 2UV8A 4M5HA 5B0DA 3CCVS 4JV1A 2GAHC 4TYAA 3M8RA 1S12A 1TVRA 3K0JA 5LSLA 3DGPB 3VAKA 3HD2A 3PX0A 1WG1A 4IOBA 2ILZA 1RWMB 4CQ1A 1KOOA 4PXBA 3UQSA 3R8YA 4IG3A 4QYRA 3THPA 2MDAA 1TKZB 1KSPA 4WZMA 2XEXA 2AX1A 2I6WA 3C19A 3H2LA 5CH7B 2CQ4A 3CDAA 5KFHA 2DR9A 2H3EB 1MSWD 1DHMA 1VOMA 3IBCB 3NL0A 1LW2A 5T7LB 2VFSA 4UUXA 2Y1RI 2V8GA 4DV5J 3QMQA 1Q5YA 3CD6S 1MN9A 2VBXA 6FD1A 4EI2A 4L73A 1N5YB 1XNQF 4KTQA 3PW4A 5E41A 2QL9B 2B9YA 1CS4B 4ZN3A 1AZSB 1AA1B 3M6XA 5A6PA 3JSMA 4WFAQ 4FS2A 2JEJA 3LQVA 5C25B 4ED3A 3KLIB 1V5VA 3QRQA 3G82B 2IYGA 4DU7A 4NLOA 5BJRA 4PYAA 3MHYA 5DETA 2HNYB 3DRXA 1GH8A 2DH8A 2ZBPA 2JVOA 1HNIA 2UV8G 1FXDA 2RU3A 5CHCB 4ED8A 3HZEA 5DDQC 3MPWA 4OL8A 2RVJA 3PW5A 1QSSA 3CD5A 5ETVA 5JJBA 1ZAWA 4FF4A 3IC1A 3KK3B 3CMQA 2DIUA 1NHKL 2AKWB 5CYJA 2EBGA 3M2UA 2LKZA 3RBXA 3X3UA 2ZBIA 1WTBA 2KFNA 1S79A 4UF4A 2CPZA 4ZCMA 4FS1A 1PAUB 4FYWB 5ETPA 3MD1A 3ZXWA 4XDCA 1WSVA 2CPFA 3RW7A 5E3AA 3PRVA 2R7UA 5KFNA 1NKEA 2I9SA 5KG4A 5DO2A 4KFBB 1VLYA 4L6V3 4IFVB 1U0SA 5FDLA 1KC8T 1S59A 5D3GB 4LR7A 1LWXA 2HAIA 2PI4A 1RISA 3W2VA 2DT9A 1VQNS 4ES3A 4L76A 3V81A 2FHMA 3RZAA 2MZRA 3OW2R 1JLGA 4Q5VA 3HULA 2YY3A 3IWNC 5F8NA 1AFJA 5I3PA 2MEWA 2J76E 3KLHA 2W7PA 1F6TA 2X51A 1NO8A 5L38A 1NEEA 4DSKA 1KKHA 4IYQA 4O4GA 2DHAA 2NS1B 3BO3A 3M2RA 4AL5A 2M2BA 1MNEA 1VYAA 2GVZB 2ASJA 1AB8A 5EHHA 2VD3A 2WCXA 4PUOA 1FXLA 4A48A 2KYZA 4LF7J 2RE1A 1SUQA 1DQ8A 3ADAC 3Q83A 4EBEA 1L5UA 1P6TA 4I64A 3NWRA 2BKOA 2HIQA 5T41A 3TUJC 3IWLA 4HEA9 2RNEA 3TEHB 4HACB 4ZJOA 3HSGA 2P6SA 4LF7F 4QIWD 3BQ0A 2RKIA 1S9EB 1L3TA 4FYXB 4O3SA 3P8BB 1VCTA 4CNZA 2X3DA 2QJ3A 4OI4A 4HVZA 1X4FA 1XMOJ 2CAJA 3DXSX 3VGTA 2ZH9A 2KT2A 2OP5A 4JBCA 2A3JA 4OLOA 7AT1B 2GV1A 1Q53A 3W7BA 1VK3A 1XMBA 1U09A 3J7YU 1V3RA 4K4ZA 1PBUA 1RHJB 2VFUA 4X4VA 3OHBA 5AT1B 3ZZYA 1XMOF 2EC2A 4RBTA 4D3GA 5KFUA 4UOHA 3FBFA 3CCZA 5A2QY 4YS2A 4USVA 2O01C 4CLLA 1RHUB 4DL0C 1TMJA 1BQNA 2HAFA 1U2FA 3VWSA 5HBMA 4IFYB 5K14A 3CWJA 1DZ5A 4TLQA 1RTJB 3CVKA 4TQRA 1ZA1B 3CO9A 3DHWC 4RW6B 1C0UB 2DCLA 4MIBA 2XSFA 1B70B 4WU3A 3GIKA 1Q0NA 4HR2A 3GP9A 4RW4A 2J8AA 1JLEA 5HROB 1TL7A 3QRRA 5A0YB 1JLCA 3E8OA 2YQ0A 1VQKS 4WPAA 2YKNA 1S0VA 2FGCA 4ZVQB 2C2MB 3HD1A 3VGVA 5F8HA 3DN9A 4C7QA 3MEKA 3Q2TC 1XMQJ 4I68A 1CULB 1U1QA 4NI2A 1D8YA 3ZZPA 4UY8T 1RAHB 1RHKB 4NLTA 3TAMB 3BSCA 4OHXA 3MM8A 2XI3A 3RR7A 3NOCA 1C1BA 2I5JB 4P10A 2RRBA 4FPIA 1XMQF 3UCGA 2HVZA 1UP1A 4F02A 5IT4A 3H40A 1LFWA 4IO1A 1JLAB 3VAFA 3MM7A 1S1XB 4NCAA 1TFWA 1B3TA 2ZVIA 4K4UA 3W9IA 3I9V9 1S99A 4NPOA 4DHVA 3BSOA 4X4TA 1R7IA 3FNNA 4ECRA 3OVAA 4OZLA 4LVOP 5SZTA 2B4PA 1IM4A 4IO9Q 2GAGC 5H9FK 1RLDA 2O66A 2DD8S 2EPIA 2WVFA 2E5JA 5DS7A 1PILA 1FDNA 3L09A 2IA6A 1VRUB 1UWBA 5CD4A 4C3MA 2FC8A 3PZPA 2MZSA 2Q6BA 1YVFA 4OJ3A 2XY5A 1SI9A 1T11A 3TI0A 4ZCLA 3C46A 4K0KJ 1HW8A 4TQSA 4V19J 2FLLA 3OXGA 4F4AA 5IM0A 4N8OA 2AP6A 2JLGA 2K2PA 4KH1B 1WHVA 2OPQB 2YQ1A 1UVNA 2VH7A 1K47A 4OX6A 4AT1B 4LFCJ 2AYGA 2IA0A 2VQEJ 2F65A 1AFIA 5EDWA 3QT6A 4K0KF 4OI3A 4RW9A 4OI0A 3BH6B 4UTGA 1QDUB 2VG5B 4F4YA 2HBRB 3DOMA 4MAKA 4LSNB 4LFCF 2VQEF 3QFHA 1OPZA 1DTQB 1WJ9A 3CSKA 1PO6A 3FCVA 1X4HA 3ILOA 1YG0A 3EXCX 5L1IA 2IHR1 1ZAXA 3HVWA 4CLZA 4W90B 3TA1A 4YR3A 1RAJA 2G1HA 3KJVA 3QO9A 5DLGA 1QTMA 1T7PA 4FP9A 5DG8A 5FD1A 1HR0J 4WKRA 1RTIA 2W9AA 4RX6A 2VG7B 3Q8PB 4B17A 3SCLE 1PSDA 1S1UA 3R9LA 1RT3A 1I6JA 5RUBA 4CCHA 1RBAA 2D9PA 2WW4A 3IP0A 4CH0S 2EVZA 3UDCA 1TU0B 3KTQA 1HR0F 2Z30B 3DU6A 1RT2A 3LAKA 2WSFC 1JLBA 2ALYB 3BSAA 1WORA 5HL7Q 3OR2A 1F9HA 4YN3B 3MTJA 4ZJQA 2KRRA 2YVSA 3TX8A 4Y2KA 2WSEC 1RBLA 3OVSA 9ATCB 1NH8A 4FZVA 2V2VA 1A0OB 2XQCA 2IRUA 1NK0A 2FGOA 1HYSA 2HBYB 2HNDB 4P9SA 5CYMA 4A46A 2OEMA 4UQGA 4O3RA 3NWGA 1U02A 3J7ZT 4HT5A 2Y9HA 2LDIA 3I82A 4OFZA 2BANA 3KUGA 1VQ5S 2VPYB 4C3KA 3IO1A 3FZ2A 4XPEA 5AE3A 1ZM4A 4F04B 1IM6A 1BQXA 1HBUA 1XNRJ 3M8YA 3QRPA 5GADI 3ENAA 3H5XA 1KHWA 1NKCA 2VZ9A 1H2VZ 2XSJB 4ZVGA 3C3LA 1PYSB 1TL1B 5KFSA 2AV5A 1FRHA 1T3NA 1XNRF 5I3UB 2R8GA 3P6YC 3L7OA 1ZA2B 1F3FA 4EBDA 2F8MA 2HNZB 1UA0A 4B9NA 4F8RA 2YX4A 3HHLB 1RA6A 1VMBA 5DQGA 5MAOA 1FKAF 2FJXA 2NXJA 5KT6A 4I2QB 3AH6A 5KFAA 2L08A 1HHQA 3HVTA 3PKMA 3TVZA 1NK6A 2V2KA 3ENWA 2XZDB 4M63A 3ETMA 4FXDA 3NBPA 2ZJPQ 3D1OA 1NJYA 2IVFB 4X4UA 1Y4ZB 3JTPA 4J9KA 3M2VA 4ETZA 5C2GA 3NRBA 1UVKA 2GCFA 1JNRB 2CG8A 5GAHI 2NR0A 4OX8A 1RQ0A 3DRSB 4CDIA 1VRQC 4ANCA 4YB1P 1HQEA 2BQ3A 4JP8A 2C2RA 3PX6A 2OAUA 5HN0A 3PRDA 1P9QC 3J80U 3MZIA 3RB4A 4B9TA 1FA0A 2QFJA 2MSSA 1WSRA 2WVDA 1M5VC 3GU0A 2W8LA 2ZKUA 2J9DE 5THWA 1NZAA 2PSZA 1FX2A 1O0PA 2P8IA 4JI2J 3DDKA 5KFMA 3OL6A 3VQSA 2K7KA 2A10A 2PE8A 1R8PA 4HHJA 5KFZA 1EARA 1S9FA 1Y00A 3LALA 2C2OB 4L3NA 4OZ5A 1JB0C 1V6HA 3VAHA 4DLGA 1S9GA 4QYZK 4NLDA 1FRXA 1GAOA 5LT5A 3DLGA 2YWKA 4JI2F 4X2BA 1I51B 4FVMA 3SCJE 2VG6A 1S49A 3IBFB 1RWKB 3M8QA 1DFDA 2F3JA 1O6XA 1EETB 5CAAA 5F0WA 3MM5A 5J2QA 2WOMB 4PQUB 3MI7X 2M8DB 1SL0A 5LXYA 2CJXB 3A4TA 1XTZA 3KK2B 2PN6A 4EO6A 3BGRB 1BE4A 4WXOA 5DDOC 4DUYJ 1U24A 1BXNA 1Q4RA 1K9MT 3UDEA 3ELHA 1S0NA 4KYZA 1RT6A 3ZZTA 1NM2A 2HS3A 4DUYF 3MEEA 4C11B 3UW1A 3BKFA 5ETNA 3R1LA 2MJUA 4XIUA 2JRSA 3NOGA 3HF5A 3RW6A 4LR9A 4QIFA 1T95A 4P71A 2MLYA 2G1DA 1CPZA 4NE9C 1NLKL 3RBZA 3TARA 2HGNA 4USJC 2DRAA 2CNOB 1JNZB 3DLKA 3C6TA 4F7VA 1WG4A 1OIAA 5HI7A 4Y0FA 1ACMB 1QAJA 4QWBA 2D69A 1R0AA 2E5IA 1BWVA 4ZCIA 4HTJA 2W01A 3ZTPA 1TKXA 3NNHA 2Q79A 2E1AA 3B78A 2AGQA 5G0RB 3LP1B 5F8JA 2MKJA 1TAUA 4G1QB 2XMVA 1S77D 4TYBA 2OFGX 2KDOA 4YMEA 4IH6A 4G65A 1S1TA 3HX9A 3MEDA 2KFZA 5K8PA 2KN4A 3R5GA 2MLZA 2FTRA 4ZPCA 1FERA 1SC4B 1KP6A 3I5AA 4QQBA 4A47A 1I3OB 3CCJS 2JJ4D 4O0NA 5KFFA 4YUDA 2GHVC 3QGPA 2AYBA 2H65B 1IJEB 3I87A 2CPYA 1PGZA 3AXKA 1GMWA 2OHDA 4FVCA 1GMVA 4H4OB 1UL3A 1TQLA 1F2HA 2BJ9A 1WEYA 4B3RF 2GGPA 4PCQA 4I4BA 1C4CA 1NCLA 2F63A 3M30B 4RNOA 4JI0F 4HHUA 1Q79A 1C1CA 5M2UA 1PKUA 1AYEA 2VA3A 1XERA 1QAYA 4HACA 2LYVA 2ALZA 3BKTA 2C3OA 3SQGB 5DLFA 3CC4S 4K4VA 3QQCD 3ILJA 1CVJA 4DSJA 2XO7A 2ASYA 3TAPA 4OHYA 1J27A 2LQJA 3FMBA 1TK8A 4ECQA 3D3BJ 3GONA 3A1YG 3TX0A 3OL8A 3R27A 4PYDA 3HFZB 3S8SA 1T05A 2YH1A 2VU5A 2RRAA 4X4SA 1IBCB 2FJAB 4Q43A 2BM1A 3PXGa 3K8VA 1L3VA 1UPPA 1S97A 4K7QA 2B4UA 3KK1B 1SVDA 3PEJA 2W8KA 1HWLA 2OI2A 1A9NB 5J2PB 1B4SA 2P5VA 3BH7B 4B02A 2QMUB 4QYZJ 2CDQA 2B3TB 5IT0A 5E33A 3HHKA 3CCQS 3LF0A 4WFBQ 3CB4A 1CC8A 1NDPA 4R8UB 5F41A 1GXTA 3TAQA 2JC0A 2AD9A 4ICLB 2ZE2B 3H5SA 3WC2A 4WXWA 2R2UA 1FVQA 4BC7A 1YITS 5HATA 5J2NA 4RWXA 2JVRA 2C3PA 1V9OA 3UPFA 1M1KT 4IR9A 3GJQB 1NPPA 1IJFB 2OMLA 3T19A 3QAEA 1ZPVA 4N5SA 3CJKA 2BVZA 2ZOFA 2ZC4A 1R8AA 1ZTTA 3BPDA 3WHIA 1H73A 3NP5A 3ZNUA 3I0RA 2VASA 2FVRA 3PO5A 2MY8A 1U0HB 1RAEB 1SC3B 4LF1A 4F0MA 4ZLLA 4LF2A 1UAWA 3W2WB 2BW7A 3HHDA 3NCQA 1J5OB 1WEZA 4HH1A 5I3QA 4CO1A 4WTYA 3RRGA 4ZVHA 3TRGA 2PA3A 4X66J 1RHMB 2XB2D 1LK5A 4RZRA 1YZ6A 2YX1A 1EJ7L 1X5SA 1NMEB 4DI6A 4HT7A 3MMCB 4QJVA 4NMLA 4IRKA 1NSKL 2OEJA 3CC2S 4KGZB 3DCAA 5J1EB 1RU2A 1YJ7A 4X66F 1TAQA 3NY0A 1UVIA 1IKYB 2AJQA 3EVWA 5IWAJ 1S1WB 4NMXA 1FJCA 3QSIA 5ITHA 5EN1A 3EGNA 4PG6A 1SL2A 3A3NB 4DXLA 2XBPA 1HPZB 2RMLA 1W2BR 3EZOA 2DNHA 2IVYA 1FWLA 1SJFA 2DY9A 1T3OA 3H59A 1UVJA 5IWAF 3CUNA 3M8SA 4KY3A 1WC1A 2HWTA 2IMOA 2HVHA 3I32A 1NKBA 2FC9A 3CJSA 1T9XA 3M6VA 2PDAA 5KG0A 2XWXA 4IG0A 2B7CB 3OFFA 1VQLS 1OJ4A 2DH7A 1T03A 1LEOA 2LECA 2C42A 4RU2A 3NMAA 1TUWA 2LMIA 3IXQA 5GADU 4DSIA 2DITA 2YWHA 4EZ9A 2DNZA 2DXFA 2GW8A 2LCWA 2DNRA 3UD5A 3OBIA 1YBTA 3GSDA 2DGWA 2HFSA 5B0GA 4FKYA 3GG0A 1RABB 2CFXA 4DR2J 3IR5B 3AQOA 1Y3KA 2HYIB 3FRYA 4WK3A 3ICLA 3C16A 4P7VA 2GVDA 2ZHAA 3CJ4A 2HQIA 4DV3J 5GMDA 4RW7B 4DV0J 3AB4B 1WC4A 4JI6J 4I69A 1VQ8S 1UZDA 4WFYA 4JI4J 5EX3A 3BBCA 2AYMA 1P1LA 3PHTA 3IR6B 3CPWR 5T14A 2R7OA 1UTAA 4DR2F 4ELUA 3CJTA 3DNCA 3GYGA 4DV0F 1KQKA 2RRNA 3GFYA 2FLOA 4JI6F 3OXFA 2AGPA 4JI4F 3NS7B 2RF2A 4DV2J 3FEYB 2DNQA 5DG7A 3FFIA 1TK5A 3LPYA 2PD1A 5GAHU 3MFIA 2HKEA 2CG4A 3VVUA 2YTCA 2R4FA 3PR5B 2M7SA 4TLRA 3BGUA 3JXOA 3K17A 1Q86T 3TJ8A 2NYIA 4X4NA 4OHWA 2DNLA 2XCAA 4DV2F 1EP4B 3KLGA 3OSPA 5L1LA 1GMUA 2HS0A 5DZ7A 2BOPA 2MXYA 2KFYA 2B5JB 1HBMA 2HBQB 3GFXA 2AMCB 4IH5A 2R42A 2W9BB 1U6ZA 4X65J 5C2CA 4P2XA 3SIPB 2ASDA 3GIJA 1U8SA 3PEHA 3G6ES 3KYLA 4DFJA 3F41A 3DFEA 4NL5A 2DRBA 4DR6J 1HI1A 3MAAB 5KT2A 5HMYA 2GIQA 1TMMA 4X65F 2J6TA 5HP1B 1DAXA 1VDHA 3L7UA 1AROP 1KN6A 4USKA 5D4NA 1GMWD 2UU9J 2VFRA 3I0SB 1TUGB 5CZVA 4O3QA 3OPKA 1X9SA 2WB4A 1NJWA 2KO1A 2QZ8A 5KFQA 2V9WA 4KO0B 4UOFA 4QPXA 1RWUA 3BO4A 4DR6F 4KT0C 4M5DB 2VFTA 3MCMA 3MMAA 3EXYA 4KIAA 1N4LA 4MFBA 1FD8A 2B9WA 2U1AA 2CADA 2UU9F 2XZWA 2JSXA 5AXLA 4DSLA 4CTAB 3UO0A 4HDGA 5H9EK 1X4EA 1S6QA 2AEFA 3Q22A 3NAHA 2QRRA 2CQ3A 4P6QA 3N6NA 2E1MC 3VAMA 3N4WA 3TOQA 1HW9A 2LXUA 2YNGA 5HVFA 1S6PB 3T5KA 1E6VB 1S1VB 4OI1A 2IDEA 5FLXU 3RR8A 4WBFA 1KLMB 4CT8A 4E0DA 2KG1A 2DPJA 3C14B 4BCAA 3CXCR 3AA9A 3BQ1A 1S5ZA 2X1FA 4DL3A 1SBRA 3NXZA 3HVRA 4DQQA 4LIWA 1C2PA 1Q8BA 3ZFVA 1NSPA 2B6AA 4OZ2A 2FJVA 1QSLA 1BQMA 3HKWA 2AU0A 4M95A 2W9CA 2EKNA 3UN5A 3DC2A 4DN0A 2QO3A 4LF4J 3IM8A 3WQPA 1M5SA 4JI7J 5LM7E 5HMXA 3P49B 1NJZA 1S76D 2K3KA 2I2YA 2W1BA 1TUVA 2F8HA 2BJ8A 3TVKA 3LOUA 2M3DA 2HFZA 1RT1B 2POKA 4UZCA 4DBQA 2OSRA 3OVBA 4DR5J 1FDDA 3Q24A 4LF4F 3LP0B 4LR8A 4JI7F 2EFNA 1FEEA 2ZD1B 4NA1A 3ZC4A 4ZVTB 3R5AA 3HT3A 1E6YA 4LRFA 3I55S 3PDNA 1Q5VA 4CRJA 2ACMA 3JSBA 3MCOA 4DR5F 5LJ5Y 2XMUA 4KC5A 3QIPB 4YY3J 1NK8A 2P9EA 1WHWA 2GIFA 2MKCA 2H5IB 1VQMS 2FVQA 4C8ZA 2CUYA 1LWCA 4NZ6A 5G4DA 1SJQA 2FJDB 5HK4A 4ZVOB 4OYMA 5KT4A 2VPXB 3RAXA 2HRTA 3A12A 4NCGA 4YY3F 3C66A 4DPYA 2R3VA 1RT5B 2XYGB 3B8HA 1R8BA 1FK9B 4DV7J 2WTFA 2NYHA 3K7RA 1F0XA 3FEZA 4LRAA 3NG8A 4H4KA 2AZ3A 3JQJA 2RH3A 3RRKA 2OPPA 1H3DA 2RT3A 1LXJA 5F3TA 2KG0A 1FTCA 4Q0BA 1IQTA 4O23A 4KGMA 4DV7F 1OQ6A 3IBWA 5GAEI 2VJVA 1B99A 3MWBA 4DU8A 4JOUA 2HZVA 1HBNB 5B0AA 5HANA 3KJFB 2H51B 4CP5A 3U1MA 2NSBA 5C24B 4F4XA 1U1OA 4FNIA 2FJEB 2BR0A 1KHVA 4JYAJ 2BM0A 5KFYA 3EJMA 2W4CA 4USUA 4DQPA 2RQ4A 3TUPA 2JOQA 2IBKA 3V5RA 2J9DA 1RTHA 3EVOA 4A8KA 3RJMB 4QIVA 3NAIA 3PW2A 2OPRA 4U67Q 4NX9A 2IY5B 4OLPA 3RG6A 5HMZA 4JYAF 4WP3A 2BA9A 4B3OB 1YX2A 4WFNQ 1JJ2R 2KI2A 5BYRA 3DLLQ 1QUVA 4MYTA 2FIUA 3GILA 3N28A 3MEGB 1FWKA 5ETTA 4FN5A 2QTWA 3RYLA 3QGHA 4DG1B 4WJBA 4P73A 5CZXA 4U7UK 3C15B 4PG8A 5HO4A 4QWEA 4OX9J 2XMWA 4FPRA 1KQFB 5KFVA 3DOLA 5HVGA 2NXEA 4Q44A 1FI4A 1TFYA 4G6VB 3QSYB 3SSSA 1U25A 4UOCA 4QIEA 3E01B 2GJIA 4NYPA 4OZ1A 4OX9F 1UW9A 2BE2A 1SKUB 1N6QB 2QEXS 3R7NB 5LSRA 5ETSA 4EFAC 3SSRA 2CJYB 1U1PA 5JXSA 5I42B 2ZBRA 3G96A 3P45B 4TU8A 2ZH1A 1Y0HA 3VZIA 1F5CA 2DGUA 1U1LA 1FF2A 3H5UA 5CCMA 2V67A 1WC3A 3CJ8A 3R97A 3PHEA 3GYNA 2DO4A 1VBXA 1NJIT 1N36J 1SB6A 2Z2MA 5KFIA 4KHMA 4LJMA 2KM8B 4O44A 1ZM2A 4C0BA 3BPSP 4X4OA 5IZHA 3GR0A 4K2JA 2CPXA 1N32J 1YK9A 2DGSA 2OH2A 2DJWA 2HRUA 1U49A 3FK4A 1HIYA 1SJ3P 2AF6A 1R6VA 1RWNB 2CPDA 1F60B 4F3MA 3GQCA 4D3HA 4A8MP 1QTNB 1SH2A 1G6BA 2WK4A 1N32F 3MOZA 3ITHB 5DZ6A 1DTTB 2DY1A 5CYQA 3IS9B 1WG5A 1PAEX 2ZHBA 3FGVA 3GSIA 3MECB 3IRXB 2NXNA 2PEBA 4A8OA 1NDKA 3VAGA 1YZ7A 4KB7A 3GJTB 2HVDA 4ZP9A 4P7TA 3PCOB 1RU1A 1LV5A 3OJSA 3VAIA 3CD0A 2ROGA 2B4VA 3AAWB 4ZIVA 3DDIA 3KKFA 1GT8A 4ATNA 3DRRA 4J9RA 4UW2A 2DNOA 3MMBA 5FJ4A 4LRDA 4I7FA 2LQ8A 2RILA 4OV6A 1NUEA 2AIRB 3EDRB 3CEDA 4L3KA 1F3VA 2V0NA 4BLGA 1FRMA 1N8RT 1C4AA 2PGCA 1WKKA 2AYEA 2PIIA 4BWMA 1QAXA 2C1EB 2MQMA 4DV6J 2RUSA 2KXNB 2AW0A 2CWKA 2VICA 1LWFB 2C2KB 2ZUGA 1MWZA 3K5NA 1RYRA 4KRWA 2IBOA 5EUHA 4CLKA 3FJ2A 2HFOA 1IBKJ 4F36A 5CCLA 3D0GE 4DV6F 4H4MB 4DS4A 2BDPA 3MR6A 3CO0P 5LOQA 4KR0B 1LW0A 3LP2B 2Q1LA 3PW7A 1G1XA 3OTOJ 4MJKA 1IKVB 4OIXA 2BBEA 1XQIA 1IBKF 4KH0B 3DLJA 3ZTSA 5K20B 2C28A 4RO0A 2Q3PA 3N5BA 3TUZC 2Z56B 3UVJA 4YOEA 3FBCA 4AUKA 1RXOB 4OYPA 3EVMA 1RYSA 4I56A 4CM2A 3OTOF 1QE1B 1TL5A 3GTYX 2XM3A 2LEPA 2CJAA 1C0TA 4MMOA 3FQLA 2MPUA 3DMJB 3MM9B 2FHJA 3LO3A 1XK8A 1F9EB 4URQU 1FKOA 2YNFA 3RTVA 1UA1A 4CWBA 3ONQA 2FZCB 2J0QD 5B08A 4PABA 3VALA 2L9DA 3C6UA 4K4WA 3OFHA 3PRBA 3GPAA 4M5KA 3CCRS 4A8QA 3BDEA 4WWSA 2EK6A 3BN7A 5JUMA 3I96A 1UFLA 4ZJLA 2XS7A 4ZITA 2KHCA 4AXIA 3Q8UA 1WHXA 4FBTA 2Z8QA 3KUHA 5DM6Q 3FSIA 2GZOA 4OZ3A 3PR4A 2KVQE 5D77A 4A8WA 2CNNB 3RGIA 4OYZA 3KLEA 1S4EA 3FQKA 3NS5A 1A7GE 4ES1A 1SH3A 3JYTB 2NPIA 4YR0A 5HLFB 3CDUA 2ZBQA 3TWZA 2L9NA 1X4AA 2BJEA 3IA0A 1IKXA 3NEKA 5IT9U 2FB0A 2MKSA 2ADCA 1VBYA 4KJIA 2ZC3A 2O1PA 3E51A 2EEYA 2K1RB 3D28A 2YKMA 3BJYA 2EK1A 1KNZA 2QYCA 3VAJA 2MSTA 2VOOA 4ZVRB 1HNVB 4JUZA 2YPYA 4ID5B 3VTIA 3PYDA 1B7FA 4A8SA 3V4IB 2QA2A 1QUPA 1T0TV 4ZHRA 3UN3A 1JLQA 4R25A 3J7AN 5CABA 2DR6A 1KFDA 4J5OA 3O5TB 2Y1LB 2ASLA 3W9HA 3NGUA 3AA8A 3D67A 2DR7A 1H2TZ 4DCJB 2FYXA 3A13A 4TN2A 1JLFB 1G3OA 1H38A 2HWHA 5ETOA 4DR1F 2X3GA 2R7WA 2OPSA 2VPWB 1RT4B 4NASA 3HM9A 5KOXA 4ED1A 4PXCA 3W5XA 5C42A 1NDCA 3CIMA 1ZH5A 2KZZA 1RAFB 5KFXA 4ECXA 3ZTQA 4ILLA 2RB7A 4H4KC 2Y0BB 2MTLA 2G0JA 2B8QA 3CNQP 1R27B 4J9UE 4DQRA 4WFXA 3MPVA 1CJVB 3PYEA 2N3LA 3PW0A 5D0HA 4ID8A 4PAAA 3Q8YA 1OYEA 1GK8A 2YKQA 2HQDA 1RJJA 5D78A 4O3NA 2KXFA 3QAUA 2ZZNA 2GS8A 2YKPA 1D1UA 3NCPA 2LU2A 2XWYA 1KLMA 5L8RC 1UEUA 2LVWA 5A6WA 2FVPA 4Z7CA 2CQDA 3K5PA 2V2QA 2G13A 3LH2S 3S01A 4PWDA 1IWAA 5GAEU 1JXEA 2V8VA 2WZ1A 2R7QA 1X5PA 2CQ1A 5KG3A 2HHWA 1CJTB 2L3MA 1RT7A 2ZZMA 1XIQA 3KG0A 2EKYA 1DLOB 2YNHA 2UVUA 1F9FA 4DSEA 3CJ2A 1ZETA 1XR7A 5ETRA 2E7WA 2ROEA 1X8DA 2N82B 1MU2B 4WYLA 1KVJA 1XNQJ 4HI1A 2HK3A 4USMA 2VJUA 2GQQA 3OL7A 5A8KB 2J0XA 3M32B 3B82A 2LQBA 2KL8A 2MGZA 1UCNA 1X9WA 1AT1B 4CO4A 1JMTA 2KT5A 5B0CA 1Q1KA 2Q6CA 3POTB 4NLRA 3GYXB 2A1BA 4F25A 5IXUA 4DF4A 3SYZA 3ILIA 4DX5A 4AE5A 2BE7D 2U2FA 3AHPA 2I1RA 4ILRA 4R5PB 1L3SA 3ET6B 2GO9A 5A8WA 2LDYA 2CVEA 2DB1A 2FZKB 1JKHB 4C8NA 3AODA 4ILMA 1FKPA 1HMVB 1YJWS 1IWGA 3TUIC 3W61A 1Q7LB 3H25A 2PMHA 4KKOB 4L75A 1H7WA 1TV6A 1V3ZA 3D0IE 1HA1A 1YLXA 2V6AA 2EG1A 3QIDA 4TY9A 1VRTB 2XTJP 3PYFA 2Y1IA 1U1NA 4J90A 2R7VA 1VQ9S 5IQQA 3EICA 3V2UC 4KV8B 5E3RA 2E5GA 5M2PA 3DRPA 1NK4A 3H8YA 1LWEA 2NXUA 1GXUA 1KVKA 1XR5A 2HHTA 5ETKA 1TKTA 2K8GA 2GHWA 1NH7A 4HYKA 2K3IA 3CW2C 2NUUG 4IDKB 1QLNA
chains in the Genus database with same CATH topology
3NNAA 3SEOA 4ZK7M 1QAIA 3S8SA 4YQWA 2MKKA 2LQ9A 1X0FA 1T05A 5F0UA 1HNZF 4OJHA 5L9NA 2YH1A 2DGVA 3MFHA 1Z4UA 4ECUA 2RRAA 3HI9A 4X4SA 4Q43A 2FJAB 1M5PC 2BM1A 3PXGa 3K2YA 5KFWA 4RNMA 4LUBA 4QZVB 2CQCA 5DDRC 4I67A 4B3MF 1OQ3A 2QLXA 2ZDOA 3K8VA 1TVRB 1L3VA 3OUYB 4DL2A 2LQ5A 2MY7A 1YHQS 1S97A 2K1RA 4DQIA 2MHEA 2JEIA 1ZZFA 3QYYA 2B4UA 4M8LA 3KK1B 2W8KA 3PEJA 3KLGB 3ENQA 5DM7Q 1HWLA 1A9NB 4DPOA 1O8BA 5J2PB 2P5VA 1HHTP 4B02A 2BRKA 3IAS9 2L41A 3DYAB 3EZ5A 3QWUA 1HBMB 5LMNF 1SQEA 4QYZJ 1DARA 2PEHA 2XLKA 4PPZA 2CDQA 4JV5F 2B3TB 1HNVA 5IT0A 4Y2IA 1HI8A 2EC0A 4IG3B 1P8GA 5E33A 2BV3A 2ZOMA 1RTDA 3N01A 4ID5A 4Y2MA 3O6QA 4ED2A 3HHKA 3VR1A 4RW8A 3CCQS 3U27A 2ZITA 1HI0P 2ZKTA 1N48A 3FCHA 4IRDA 3V4IA 4WK1A 3DOKB 3LF0A 4WFBQ 3CB4A 1CC8A 3SCIE 5KFJA 3H20A 4ZDNA 2B7BB 4R8UB 3GG1A 1GXTA 5F41A 3TAQA 4ECWA 2JC0A 1CSJA 2H9ZA 3PY8A 1FRKA 3T6BA 3RBDA 2AD9A 4ICLB 2ZE2B 3H5SA 2JEFA 2LA4A 1FJGF 1MMNA 3WC2A 4WXWA 3O3LA 3DI6B 3N6LA 3N9UC 2GHPA 2KU7A 3PFEA 2R2UA 1FVQA 1LW2B 4BC7A 3DM2A 4E8UA 3CULA 1R3NA 2EBEA 1YITS 3CCWA 2VUGA 1O51A 2P6TA 3OQ2A 1ROFA 5J2NA 4P2SA 3KHRA 3BDPA 4RWXA 2JVRA 2FHJD 1H7XA 2C3PA 4DEZA 1V9OA 2KXHA 3UPFA 1M1KT 4A8FA 2AX0A 5F9NA 1VQ6S 4GKJF 4IR9A 3PO4A 1REVA 1FDBA 2NUHA 3FZBA 1EETA 2DR5A 3T9NA 1IJFB 1JLFA 2RQKA 2OMLA 2DHXA 4AXJA 3Q23A 2WOMA 3T19A 4PQUA 2N4CA 4DDFA 3JSMB 3QAEA 1ZPVA 1XR6A 1YSJA 4N5SA 4E98A 4DR7F 4LF8F 2PT0A 1YRUA 1IKWB 4YEAA 2BVZA 1HBOB 2ZOFA 3CJKA 2ZH8A 2ZC4A 1R8AA 4F50A 2R8KA 3MMAB 3KK2A 1ZTTA 3BGRA 1RT4A 3MURP 1VIOA 3ISNC 1FE4A 4MFBB 3EGZA 1S48A 3NP5A 4KBIA 4ZS6A 3I0RA 2VASA 4WCEQ 2FVRA 4WIIA 5I4MA 1RDRA 1X7VA 3PO5A 3SDEB 2MY8A 1P27B 2XLIA 4ECTA 3V6DA 4Y2AA 4BS2A 3MR2A 2Y0SD 3SFGA 2HVIA 2HQ3A 1UAWA 5BYQA 1WF0A 5KFOA 2QA4S 3W2WB 1K1QA 1HNIB 2DO0A 4MK8A 2C3YA 4KQZA 3HHDA 1S6QB 3NCQA 2Q66A 4QU6A 3HZGA 2IMWP 1J5OB 2X1GA 4HLBA 4X4PA 4Q2LA 2L9WA 2IRYA 2ZM6F 3OR1B 1AW0A 1WEZA 1D9FA 1FT8A 4HH1A 4C11A 5I3QA 2LXFA 1M5HA 4CO1A 2D74B 2YNGB 4WTYA 3K5OA 1RKIA 4O0IA 1GXLA 3RRGA 2AJ0A 3PJWA 4DL5A 4LFBF 3CJ5A 4ZVHA 3TRGA 2CJBA 2PA3A 2HW3A 4PR6A 3R5CA 3MR5A 4M94A 2D3ZA 1HQUA 2XB2D 1LK5A 4RZRA 3E3XA 3M2UB 2R8HA 2YX1A 4DOZA 1W2IA 1VQPS 2MJNA 5CQGA 2MHNA 5BYSA 2MQPA 1X5SA 2SXLA 4F2SA 5E7OB 3JTOA 1CQNA 1SJRA 2HLTA 2JH3A 1NK7A 1XWLA 3J81Y 4B3OB 4HT7A 3MMCB 1X0PA 4QJVA 4ZMMA 1U1KA 4NMLA 3ULHA 4IRKA 3IGNA 4Y3CA 2MKIA 3CC2S 4EEYA 3BS9A 2HMIA 4NLQA 1Y5IB 1Y7PA 2B51A 2FLNA 3MM6B 5KFCA 1UMJA 3LWMA 5HQ8A 4DFKA 1Y9OA 1X4DA 3DCAA 5J1EB 2CJKA 2YNIA 3I5BA 2DNKA 4WE1B 4XDDA 5KFPA 2WRMA 4X66F 2B6AB 4ZPWR 4ES2A 2WBMA 1TAQA 3RBEA 1BQMB 2Z0GA 4IH7A 3I5CA 1YJNS 1UVIA 2JZ5A 1IKYB 4MIAA 3UDLA 2KHDA 2FD2A 2AJQA 4ZP7A 4NXNF 3IG1A 4X4RA 1S1WB 3OFEA 2W9CB 5L39A 1OS5A 1FJCA 1SV5A 2EWHA 3GR1A 2UZAA 3IWXA 1KRPA 4RLEA 5ITHA 3T3FA 3L7PA 4DL6A 1U1RA 2ZDPA 4I2PB 3MOJB 5EN1A 3EGNA 4PG6A 5G0RA 1SL2A 3LP1A 2RIJA 4DX8H 2BQUA 4ZVEA 4OV1A 4NLGA 2XBPA 5KFRA 4G1QA 1HPZB 2UXBF 2RMLA 4DLEA 4FYDA 2F4VF 2W4DA 4NLSA 2KTQA 4ZPVR 3OFGA 3O1LA 1W2BR 2KZMA 2DNHA 1U2RA 2IVYA 3ENVA 2EW9A 3W2VB 2RQCA 5IQ6A 1SJFA 1T3OA 3H59A 5AXKA 1UVJA 5KT7A 2GJ2A 5IWAF 1WWHA 1DLOA 2O3DA 3CUNA 3V81B 3M8SA 5B0BA 1APSA 2VC0A 3PFOA 2HWTA 4LQ9A 1VIXA 4EYHB 1WEXA 3THTA 2IMOA 2HVHA 2MZJA 3A8EA 3G6VA 1ZPWX 2NLWA 3I32A 1FHTA 1NKBA 2FC9A 5DJBA 3M05A 3CTRA 4N76A 1OSCA 4IOAQ 1FEHA 1JLGB 3AY0A 3M6VA 1XEZA 1MU2A 2B43A 3BF4A 2E1CA 2PDAA 5KG0A 2XWXA 4IG0A 3Q8SB 2OTLS 5K8OA 3KLHB 1S7HA 2B7CB 4R0JA 4NZ7A 3OFFA 1VQLS 5KFBA 5A8RB 4RKUC 2HGLA 4ERDA 3ZZOA 4B9UA 2HHXA 1E6YB 1Q16B 4ED7A 4J9LA 4XK8C 1OPIA 2VBYA 1SKWA 4O4GB 2DH7A 2J7UA 1T03A 2RJZA 2D41A 4HI2A 1UJ6A 5H1SV 1TP7A 2LECA 2C42A 4RU2A 2UVWA 3T9ZA 5A8KA 3KLFA 4AL7A 4L72B 4F26A 2GMHA 3NMAA 1ZZNA 3M2RB 2LMIA 3DLEA 4U9RA 3M32A 2C2DA 2X1AA 1S4FA 3CDEA 2DISA 4LFAF 3IXQA 5GADU 3AJ1A 2PI5A 2YX7A 5LMUF 3MF5A 2XY7A 4DWIA 4DSIA 2W7AA 1RP5A 4C98A 2DITA 1X9MA 4PUOB 2YWHA 2CRLA 1VQOS 2OIHA 4EZ9A 4EU0A 2DNZA 1NNDA 2VFVA 1TL3B 4RNFA 2GW8A 1SUQB 2LCWA 4UUWA 2DNRA 1H2UX 1UETA 3LUYA 4H4OA 1QJHA 2R8IA 3QJJA 2IJNA 2B56A 3OBIA 5AXNA 3POTA 1VQYA 3GSDA 1LWCB 2DGWA 5B0GA 1FJEB 3GG0A 3CDWA 3GMGA 2CFXA 2V4JB 3M8PB 4NA3A 5DG9A 1S0MA 2LLZA 1X4GA 3IR5B 3AQOA 3OTBA 1Y3KA 2HYIB 3FRYA 4WK3A 3VCDA 3H98A 2HWIA 4EUVA 3ICLA 3K5MA 3U1LA 3DXBA 2VQFF 4PG5A 3H4DA 4NCGB 5H9EJ 4P7VA 3Q0AA 1VI7A 4Y65A 1M0SA 3B4MA 3OXLA 2IAJA 3CJ4A 2ZHAA 1BY9A 2HQIA 4R5PA 3O8WA 4RW7B 4N56A 2BJDA 3M30A 3AB4B 2M70A 2ZH3A 5KAKA 2JLFA 2OO4A 2QIFA 2LA6A 1DQAA 4I69A 2VC1A 2O67A 1JKHA 1VQ8S 4DV4F 2NSCA 4OX7A 4WFYA 3KLVA 2RKIB 5EX3A 1N0UA 1D3WA 4YR2A 4IOCQ 3J80Y 2UVRA 3DRYA 2AYMA 1P1LA 1HMVA 5MLCV 3IR6B 3CPWR 4K5SA 1VGYA 2R7OA 5T14A 2FVSA 2M0GB 4OHZA 4DR2F 3NS6A 1VQSA 4ELUA 2XMMA 4Q7AA 2XY6A 4KKOA 3BGLA 2UUWA 1DBDA 1WTFA 2XG8A 3DDNA 2A18A 3SQGA 3WDOA 1K8AT 5J2MA 3O44A 2OPPB 2WBRA 2J0WA 1UVLA 3DHXA 1VRTA 2HHSA 3DNCA 2AQ4A 1U48A 2WONA 4ZOSA 4Q0BB 4WU2A 4DV0F 4K4XA 1P1TA 4MTPA 1GTEA 1KQKA 2RRNA 3GFYA 2FLOA 4JI6F 3DU5A 4LT6A 4KV8A 1YJRA 4O3OA 4DR3F 3OXFA 3P5TL 2IC3B 2AGPA 5F8MA 4JI4F 1H0HB 1MROB 5EX0A 2DIVA 3GIIA 2J7KA 4YDDB 4ZPDA 1YJVA 3W3SA 2AJFE 1X4CA 4HL9A 4OI2A 1NHUA 3ZZRA 2RF2A 2KM8C 3FEYB 3NGKA 4KHPF 2DNQA 3QLHA 2DGOA 5DG7A 2OKQA 3FFIA 3S7RA 2QMXA 4LMZA 2QV6A 2FPHX 2QT7A 1TK5A 2R7XA 3KMQA 3CD7A 2ZBCA 3LPYA 3U7JA 2PD1A 5GAHU 1RKJA 3PIOQ 3DLBA 2UUBF 3MFIA 4AYBD 2BUNA 2IM1A 1M5OC 4IDKA 4TY8A 2CG4A 5KOWA 1BQNB 2YTCA 2UV8A 4YB6A 2HHQA 2KVIA 2R4FA 3V4MA 5HBMB 2M7SA 5KFLA 3PR5B 4TLRA 5LJ3Y 2ABYA 3BGUA 5B0DA 4PG7A 3D1HA 3CCVS 5K14B 4JV1A 1RTHB 1Q86T 4TYAA 3M8RA 1YRXA 1FRLA 4WZQA 4MK9A 1TVRA 2NYIA 3OUYA 2OPRB 4AQYF 4X4NA 4OHWA 2DNLA 3K0JA 1N5SA 1WF1A 5LSLA 2XCAA 1EP4B 2E1RA 4DV2F 3KK1A 3VAKA 3KLGA 1S72S 4LVNP 3OSPA 4GO7X 4DMZA 5L1LA 3PX0A 1WI8A 1WG1A 2HS0A 2C3UA 4IOBA 1UKUA 5J2PA 1CLFA 2ILZA 4CQ1A 2BOPA 2J6SA 2MXYA 1KOOA 2KFYA 3DYAA 4JI5F 4PXBA 2B5JB 1HBMA 2ILYA 3GFXA 2AJ1A 4CH1A 3RB6A 2A2DA 4RW4B 1JLEB 4QCLA 3UQSA 4IH5A 4IG3A 4QYRA 3THPA 1FRJA 2W9BB 1U6ZA 1JLCB 1N0VC 3F56A 2MDAA 1TKZB 3O2IA 1KSPA 4WZMA 1F2GA 3FMWA 3PNIA 2CIMA 2XEXA 2YKNB 2AX1A 2ZNZA 4QOTA 3DOKA 2ZH7A 3PVXA 2PMZD 3H2LA 4R8UA 2ASDA 3GIJA 5CH7B 2CQ4A 1U8SA 3PEHA 3G6ES 3CDAA 5KFHA 2DR9A 3KYLA 1MSWD 3H2VE 4ICLA 5KG1A 4DF8A 4DFJA 2ZE2A 5GAGI 4CZCA 4TXSA 1DHMA 1VOMA 3F41A 3GV8B 3I56S 3DFEA 3DI6A 4NL5A 3NL0A 1LW2A 5T7LB 2VFSA 4ALZA 2DRBA 1G2EA 2A2CA 5D4OA 3T5HA 1HWKA 4UUXA 1HI1A 2V8GA 2Y1RI 4AFFA 5KT2A 3LW5C 3QMQA 4C8LA 1UJ5A 3B4DA 3CD6S 5HMYA 2GIQA 2VBXA 4QU7A 4ZA1A 6FD1A 4X65F 2N3OA 1N5YB 2V8DA 3RB3A 2J6TA 4J9SA 5HP1B 1XNQF 4EBCA 1DAXA 3ISZA 4KTQA 3PW4A 1AROP 1KN6A 5E41A 4ECSA 5D4NA 4K59A 1IN0A 2MQOA 2XNRA 4IUFA 2B9YA 1C1BB 3DOLB 1UW4A 1Z2ZA 2VFRA 3I0SB 4K5RA 5CZVA 1FRIA 3OPKA 4O3QA 1N5QA 1X9SA 2WB4A 3KG4A 1NJWA 2KO1A 2QZ8A 5KFQA 4O3PA 4CIOA 3OTEA 4EGLA 3MR3A 3M6XA 5A6PA 2DGXA 3JSMA 4WFAQ 2V9WA 4KO0B 4FS2A 4NZ0A 4BBYA 4QPXA 1RWUA 3BREA 1IKWA 5AJ3F 3BO4A 1HBOA 3CCLS 4DR6F 4KT0C 4UY85 3G6YA 2JEJA 3UI3A 4M5DB 2V94A 2VFTA 3MMAA 3LQVA 4ELVA 5C25B 4ED3A 4Q8FA 1IUJA 3KLIB 3EXYA 4KIAA 1N4LA 4MFBA 1FD8A 2B9WA 3AJ2A 2U1AA 3T1YF 3MPYA 3MM7B 2IYGA 2D3OR 2BE2B 3OTDA 3UCZP 4USHA 4NLOA 4URGA 4LF5F 5BJRA 2FY1A 5D8HB 2UU9F 2FJWA 4BC9A 3HHLD 2XZWA 3MHYA 2JSXA 2OTJS 5AXLA 5L1JA 4DSLA 5EWGA 3EX7B 2APOA 4CTAB 3Q8RB 3KWMA 5DETA 2HNYB 4HDGA 1GQEA 3DRXA 1GH8A 2DH8A 4RUAA 2JVOA 3PX4A 3W2WA 1X4EA 3T5JA 1HNIA 5F8IA 2J7WA 2UV8G 1FXDA 4LSLB 2RU3A 1QY7A 1S6QA 5CHCB 4ED8A 1J5OA 3M6WA 4X84A 3HZEA 3Q22A 3NAHA 4C4WA 2QRRA 5DDQC 3MPWA 2CQ3A 3N5FA 3OR1A 3X1LB 4OL8A 4P6QA 3N6NA 2E1MC 2RVJA 3VAMA 2ZHOA 3N4WA 3TOQA 2XS5A 1HW9A 3PW5A 1QSSA 3CD5A 2LXUA 2YNGA 5JJBA 2D7SA 1S6PB 3CC7S 3T5KA 1AXQA 1ZAWA