1LQ9A

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor strain a3(2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
molecule keywords ACTVA-ORF6 MONOOXYGENASE
total genus 27
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lq9A00
3K7RA 4NL5A 1OQ3A 4QOTA 2ZDOA 4A48A 4HI2A 4FNIA 1Y0HA 2BJEA 2K2PA 3QMQA 2HLUA 2ASYA 5K9FA 1XBWA 3IWXA 1VQSA 1RJJA 2PD1A 3TOQA 2LQBA 5B0FA 1APSA 2GO8A 1N5SA 4DN9A 2QYCA 1OSDA 1URRA 1W2IA 1GXUA 2ACYA 1Y3KA 1S6OA 1TL5A 2XMMA 1X8DA 1JWWA 3FGVA 1FESA 5T7LB 1VQYA 3KG0A 3HHLB 1FEEA 2RSQA 2W4DA 1Q53A 3KG1A 3DCAA 5B0BA 5B09A 2G9OA 2HQIA 3BN7A 2PGCA 2FHMA 1IUJA 2KT3A 1CC8A 2JDJA 1TR0A 1Y3JA 1Q8BA 2HFNA 2GGPB 2W4PA 2IYIA 2VH7A 1YJUA 1N5TA 2AJ0A 3DXSX 4Y2MA 1Q4RA 2OD6A 3VTIA 3LO3A 2GGPA 3KNGA 1YJTA 3BDEA 1YG0A 2BYCA 1X7VA 4OJ1A 3BR8A 2HLTA 3IWLA 2N4DA 2KYZA 2FTRA 1N5VA 3TNVA 3BB5A 3LGNA 3HX9A 5A6WA 3HHLD 3KKFA 3HHLA 4F67A 5T7LA 4A47A 2XMUA 4HI1A 3T9NA 1Y9OA 5F0UA 5B0DA 5KAKA 4Y2IA 1X0PA 2XMKA 4HH0A 1YJRA 4OJGA 5B0EA 1MWZA 3CJKB 2VV5A 4ZOSA 4ZA1A 5IXUA 2QLWA 3BGUA 3TRGA 4A4JA 1FE0A 4Q2LA 1SQEA 1OPZA 2RMLA 1U7LA 2KKHA 1AFIA 2AW0A 2OFGX 3WDOA 4FNHA 1N5QA 1YJVA 2IFXA 2N4CA 1FVQA 1SB6A 2N7YA 2QIFA 3HDSA 2ROGA 2BBEA 3FMBA 2XMJA 5B0AA 2IYGA 1MWYA 4OJHA 4YEAA 2L3MA 2BUNA 1LQ9A 1TUVA 2OD4A 2ZDPA 3UDCA 2GV1A 2Q3PA 1JK9B 3MZIA 4A46A 2W4CA 4U9RA 3CJKA 1ULRA 2RILA 1P8GA 2ROEA 4EFAC 2OKQA 1AFJA 2EW9A 3HHLC 1S6UA 1R6YA 2K7JA 5A6PA 1FD8A 3GZ7A 1KQKA 5B08A 2XMVA 2GFFA 1K0VA 1QUPA 1P6TA 2LQ9A 2LXFA 2OMOA 2QLXA 3BF4A 3E8OA 4Q2MA 4DPOA 1WD6A 1CC7A 2XMTA 4YDXA 2HFOA 5B0GA 1GXTA 1TL4A 2BJDA 3HF5A 4OJ3A 2OFHX 1Q8LA 1KVJA 2OAUA 5B0CA 2K1RA 2OP5A 2AJ1A 1V3ZA 2FB0A 2K7KA 3F44A 4OIXA 2KT2A 1FE4A 1KVIA 1FVSA 2K1RB 3FRYA 2FIUA 3HFKA 2XMWA 1AW0A 5F0WA 4HL9A 3QGPA 2GCFA 2ROPA 3I9ZA 3LGMA 2AP6A 2HIQA 1SI9A 1YRXA 3MCSA 4Y2KA 4HH1A 1CPZA 4DL0C 2CRLA 4NPOA 1OQ6A 2LDIA 1TZ0A 3BM7A 2RU9A 2GA7A
chains in the Genus database with same CATH superfamily
2HPUA 2YKNA 1WI8A 2WHOA 3JYTB 3OVSA 2DNYA 1R8PA 3J7AN 1HKAA 5K8OA 2ZH8A 4WTOB 2B51A 4DV7F 2KM8B 1VQSA 2QLFB 3DOLA 5K14A 1U1PA 1YZ6A 3K58A 2OH2A 5HQLA 3TAQA 5KFRA 5HMWA 4JUZA 4FXDA 4DN9A 4PAAA 1GMUA 1FCAA 2BRLA 1S1UB 1IQZA 2FJDB 5LMNF 3VAHA 1SPBP 4CQ1A 1DY3A 4O44A 3CCQS 5DG7A 4UY8T 3DLKB 1JLAB 4YMEA 2CPDA 3GJTB 2C22A 1YX2A 1S7HA 3R9LA 2YNIA 3FCWA 2BANA 4MFBB 4J9RA 1KSPA 1B7YB 2Q66A 1R8CA 3HJFA 2F8HA 4KFBA 1NSPA 2FYXA 5GAEU 2BQRA 1SC3B 1DARA 5C7PA 5FJ4A 4JI4J 1HHSA 1X4HA 2CPJA 3DXSX 3QZ8A 4OHVA 4F0KA 2FQQB 4PEOA 2DCLA 2ZD1A 1YZ7A 3MI7X 3IR6B 2ABYA 4FVMA 4I68A 4ZCMA 3MR2A 3G71S 3D0HE 4DV6F 1RABB 2Y3YA 2FGOA 3A8KA 3MTJA 1SJRA 1CS4A 1QTNB 2QTWA 3LANA 3GFYA 2DNGA 3JSMA 1N36F 2F63A 3SV3A 2E5LF 5BR8J 1SL0A 1CJKA 4TYBA 4NLTA 2CQ3A 4S0MA 5J2NA 2J7WA 1O5JA 3W66A 3CW2C 2BQ3A 1FKPA 4TXSA 2AZ3A 1IKXA 4I67A 3ZZPA 3OSPA 1TFWA 3GMGA 3NCRA 2KB2A 1KKHA 1RCXB 2A10A 3G86A 4C4WA 1IKVB 4Y00A 4LF7F 3GSDA 2IRYA 1V5VA 3D5MA 4NXNJ 2N4CA 1FVQA 1S1UA 1NHVA 2QMXA 1R3NA 2Z8QA 3O3LA 1KQFB 3WX8A 4QIWD 5CYQA 2MSTA 3T5JA 4C97A 4O3SA 1RDRA 1LWEB 3FMBA 1RWKB 3UFCX 3X1LB 4MIAA 4JV5J 4WP3A 5DLFA 3Q89A 1B7FA 1OY8A 2E7XA 4NLWA 3NS6A 4WYWA 3W2VB 3WIVA 4ECWA 4LF4J 1XNRF 2HK3A 1R0CB 1RAAB 2C1EB 1KOOA 4LBIA 3ZTPA 5IM0A 4B3TF 5IC6B 5BR8F 2HKEA 2WSEC 1FKOA 2YQ0A 2D7SA 3M30B 4LRDA 3AA9A 5F3ZA 1KONA 2FHJA 2VFSA 4KT0C 3AT1B 2ACMA 2K7JA 2V4RA 1V6HA 4PQUB 4U7UD 4HTJA 2DO0A 3JSBA 3OTOJ 4NLQA 1OPIA 2LKZA 3BF4A 3HLUA 2CWXA 4DUZF 3ZZYA 1QE1B 2XM3A 4DFJA 2D3OR 1U1RA 2DNNA 2IDEA 2C3PA 3W5YA 4DDFA 1SKRA 3GCXP 5FIIA 5J2NB 3RB4A 4W92B 4DCOB 3ZFVA 4JV0A 1RHJB 3B82A 2CPXA 3R27A 3D1OA 2ERRA 5KT6A 2K1RA 2UUCF 3L3CA 1YGYA 3RR7A 4BC9A 4NCAA 2CIMA 2YH0A 4OI4A 3IRWP 1LW2B 4MK9A 1SJQA 5KFEA 1U2CA 3EMTA 1V5IB 2HQFA 2HFUA 1SI9A 1B0PA 5FD1A 3CJSA 3U1LA 4ZN3A 5AJ3F 2D3UA 3J81U 2HBYB 3GFHA 3CDBA 3HSDA 2XEXA 1SH2A 3RBZA 5SZTA 1J5EF 3MTKA 5AXNA 2NXUA 4Z37A 1RT1B 5LJ5Y 4R8UB 3MM8B 2RRAA 3BO2A 3D1QA 3ENWA 8AT1B 4JI8J 1U02A 1LWEA 4DR1J 4RNOA 2VG5B 1APSA 4ECXA 5KFFA 2GO8A 4B9VA 1CG2A 4LBPA 4PWUA 3MURP 2R7OA 1JXEA 3QFHA 2V2QA 2CADA 1Y5IB 3BPSP 4X4NA 4RJVA 4B3SJ 4J9QA 2RQCA 2W9BB 5AJ3J 4J9MA 2GZOA 5GMEA 1TUWA 4YR0A 5ETNA 2QMUB 1IWAA 2IAJA 4O0NA 1T8EA 4LIRA 1DQ9A 1FHTA 1T9UA 3TVKA 3DCAA 3FKBA 1RBOB 2IJFA 4FVCA 5A8KA 2GX8A 2ZH7A 3RAXA 3RRGA 3EXYA 1BXNA 1FX2A 2BKOA 4MH8A 3TX0A 4X65J 2IRXA 4HEA9 1HNVB 4URSA 1VHIA 1F6TA 1YJUA 3KJQB 3M8QB 3WQPA 1R7IA 4TQSA 1SJ3P 3PW2A 2FLNA 2OELA 2UU9J 2RHQB 2XO7A 1M90T 1PJ5A 4ERDA 1KVKA 5C25A 3IAM9 3M2VA 3QWPA 4MYTA 2LQ5A 1B64A 2R7VA 4KIAA 2LU1A 3BR9A 3LGNA 5LMNJ 3KG4A 1S4EA 3HHLD 5HK4A 3DRSA 4F67A 3LP0A 2ZE2A 1RAOA 4MFBA 1QM9A 4NLSA 3OHAA 4HI1A 3KK2A 4DX6A 1NJYA 5LM7E 1JLAA 4PPDA 4ES2A 2ZM6J 2EKYA 5D15A 5HANA 4ANEA 5KFNA 2ZVSA 5CYJA 4NLYA 2V6AA 4PWWA 4ETXA 3KLVA 2B4UA 2AT1B 2VODA 4ED6A 3M30A 1R43A 1R0AA 1JNRB 4DV0F 5HP1B 3Q8VA 4U8VA 9RUBA 3KHGA 4NZ7A 2FC8A 1NPPA 2DXDA 4JI3F 4CLSA 3I0RB 2QMWA 3K5MA 3A3NB 2JX2A 5LJ3Y 1SKWA 3H4BA 2HAIA 2OEJA 2PMZD 2HZAA 1NM2A 2XTJP 1H38A 2UVUA 3CDUA 2X3DA 4NCGA 1M5VC 3OPKA 2YWKA 1RADB 4DV3F 1AROP 5CYQB 2V63A 2IYGA 4ZIWA 3FBCA 3GJRB 1Q0NA 2P9CA 1YLXA 5D0EA 1DLOA 2ZHOA 1TUVA 4QJVA 1UVNA 2BX6A 3UN2A 1S76D 2KVIA 2M5YA 2NUUG 3PM9A 5IFMA 2BE7D 3ZTOA 3OR2A 2ZHBA 4CLTA 1WEYA 1EETB 3A8JA 2YWWA 3H98A 3IBFB 4R5PA 5HN0A 5H9EK 1KFSA 4FF3A 4UUWA 4ES1A 2QO3A 2K06A 1CLFA 4PG5A 4LR8A 2PIIA 2YVSA 3DRSB 3FBBA 4KO0A 1YJWS 1EKRA 1P9QC 1UKUA 1CQMA 2ZKUA 3IS9A 3PHTA 1P6TA 1XMBA 3UDVA 4NYPA 4ZPBA 2C2MB 3KLGA 3GIIA 4YY3J 4A8FA 2LEAA 4V19J 1GXLA 1REVA 1SCJB 2YWHA 3DC2A 4L73A 4ILLA 1RT4B 3FK4A 3K8WA 3HHEA 3MPWA 3KLHA 1N54B 2DHHA 1PBUA 3H20A 2QV6A 4FP9A 4FZVA 4NLDA 4DWIA 1HBMB 1T0TV 2KG0A 5D0GA 1IN0A 2R3VA 4UQTA 5ETPA 1VR6A 3UDEA 4DHVA 5H1SV 5KFJA 1UEKA 4J37A 1BHNA 4IFVA 2W8KA 2ZH2A 4DUYJ 3SI8A 1Q95G 3VR1A 1S12A 1WOOA 4WE1A 2UXBF 5K20B 3MM6A 2NXNA 1CPZA 2MZJA 1JKHB 2NXEA 4DL0C 3THTA 2E7WA 2GQCA 4P9SA 1M5OC 2VKRA 4A8XA 2CJXB 2LEPA 3ILIA 1AA1B 4DPWA 4MKBA 1L3KA 2KHDA 3NBPA 3KXDA 1F3VA 2JFKA 4O44B 3HP6A 2ZOFA 2AYMA 1BMQB 2MEWA 3BO3A 2FUG9 4QU7A 1OMSA 2AKWB 2RDIA 2XYGB 3RGIA 1AW0A 1HMVB 3EXCX 4NLOA 2EVZA 1YDLA 4DX7A 5L9NA 2W2OP 1MU2B 3JTOA 1ZYQA 3UDLA 4LVOP 4MJKA 2BOPA 3TQ1A 3WC2A 4ZVOB 2XGQA 4OYOA 4E2FB 1UTAA 1J5EJ 2CJAA 1ZH5A 2RSQA 1WC4A 5BYQA 1JLBB 2IM0A 1FJGJ 5IC4B 1UPMB 4EUVA 4L72B 4K4YA 2PGCA 1XIQA 3RRKA 2BABA 1TR0A 3O5TB 3QIPB 3OTEA 1LW2A 2O1PA 4WYLA 5DLGA 2PI5A 2W4PA 4Q5VA 2J6TA 3PY8A 2DIUA 2Q79A 1Q78A 2VH7A 2I0XA 3L9ZA 1RCOB 4KGMA 1BY9A 2CFXA 5THWA 2FJXA 1S77D 2Z2LA 3BDEA 3BSAA 3OBIA 3BDPA 5CD4A 3TUPA 3OFGA 1RXOB 2F8EX 1FTRA 1HWIA 2YKAA 3BH6B 4JI6F 2GQQA 3IWLA 4CM2A 1QE1A 2Z2ZA 2K3KA 3GWCA 3AXKA 3PHEA 4HT7A 4X2BA 4DV1F 2ZH1A 3HX9A 2GS8A 5A6WA 3TP2A 4J9PA 1RB0A 3HHLA 4F3OA 1FRIA 2MY7A 3DOKB 3BEGB 3G8QA 2G1HA 3C19A 4QPXA 1Y9OA 3LGHA 5B0DA 3BGLA 4NI2A 1NDPA 4X62J 2C2KB 4PKDB 2XMKA 3J80Y 1YJRA 5CCMA 4QIEA 1MWZA 1T03B 2BM1A 1TVRB 2FGCA 1Q81T 3KHHA 3UWTA 1FFSB 5IXUA 1NJXA 4B3OB 3QRRA 4LMZA 4M63A 3NXZA 3EZUA 5E3AA 3HK2A 1NK7A 1CJTB 3W65A 4FNHA 2UVRA 2RNEA 2Y8YA 3C6TB 2IM1A 1FNOA 3GLJA 4C6AA 1DTTA 2VG6B 3H2VE 3LTOA 1FXDA 3W9IA 2CPFA 3MPUB 2XWYA 3QZ7A 2G2ZA 2M7SA 1X4FA 2WOMB 1T11A 4ZMMA 2HHUA 3NP5A 3TZZA 3CD0A 2I6WA 4OHZA 5HMZA 4OZNA 4ZLJA 2V8VA 2FLLA 3CJKA 2B8PA 3MM9B 4I6AA 2AEFA 3DLBA 1HD1A 2RILA 2X51A 3J7ZT 1EX8A 4RLEA 3C3LA 3HHLC 1R27B 3UD3P 2XZDB 1JLFA 1WF2A 4ED0A 2VONA 2IC3B 4UF4A 1WDTA 1RWMB 3PR5B 1UEUA 3A8IA 8RUCA 3JSMB 2VQFJ 4KGVB 3BO4A 1F3FA 1HNXJ 3U27A 2Y0SD 4Z2XA 3KMQA 2VPXB 1XWLA 1L5UA 2WVCA 1FNXH 4ECQA 1RHRB 1DTQA 2HFOA 4WK1A 2XNQA 2UUBJ 4F4ZA 3HF5A 5HQMA 5B0CA 3HHDA 3CMES 2NYIA 4G6VB 1UW9A 4ID5A 2R2RA 2Q6BA 3ELHA 3ZO7A 5EDWA 2B9YA 5KFBA 1DAXA 2MPUA 1RBAA 3LP1A 2JHEA 2OJ3A 1VQ9S 2ZFHA 3GP9A 3O2IA 3BGFA 4QR1A 3M2RB 5M2PA 4DPYA 4CO2A 3R2DJ 3AA8A 3R7NB 3DU5A 2GO9A 2B7BB 3MCSA 2DNRA 2DY9A 3DMJA 5DGBA 2XMAA 1HW8A 3BM7A 3CO0P 3DM2A 3JQKA 1C2PA 2B6AB 3C8YA 3ENAA 3BQ2A 1ZA1B 3NEKA 3OT9A 4NL5A 4USUA 3OUYB 1U4BA 3PO4A 4DQIA 2V68A 2IRUA 4J9UE 5IT9Y 2V9KA 5H9FK 1Y0HA 1GT8A 2VU5A 3NGUA 4OX8A 2I1RA 1GX5A 2XWXA 3M6XA 4R25A 4OHXA 4F04B 4CZCA 3D28A 1NK4A 3EZOA 2MKSA 2HBQB 3IWXA 5DDQC 1RJJA 3FSXA 1H0HB 4N77A 1N52B 5ADZA 5L38A 1I94F 4E0DA 5GAGU 1OSCA 3N9UC 2XO6A 1U45A 1VBXA 3DRPB 1TVRA 5EN1A 1HLWA 2GJ2A 4QW8A 3CXCR 3UCUP 1URRA 4GKKJ 5J2PB 1IKWA 1O51A 2NYHA 1S6OA 3H5XA 2QL7B 3D6HB 2A1BA 3TZWA 1S1TA 5DGAA 3CCRS 1LNQA 1RBLA 1OYEA 1WOPA 3CJ4A 2XI2A 3GG0A 4WFXA 5F9NA 3I56S 3HHLB 1S1VA 1XC9A 2DR8A 2YKMA 4J9VA 4X4OA 3D66A 4H4KC 1VK3A 5B0BA 1IKXB 3BN7A 2J8SA 3LP0B 3BH7B 3LP1B 4F02A 1Q82T 3CPWR 4Q8EA 2IMWP 4KHRA 2ZBIA 3I31A 1SIWB 5E3CA 4U8YA 4DL2A 1TL3A 2OPRA 1FKAF 4OQJA 4HLBA 4PG7A 1VQ8S 4DFKA 1Q4RA 2OD6A 4QCLA 1PILA 2GIFA 2IVYA 1BGXT 5EWFA 2BYCA 2AJFE 2Z30B 4QIFA 4UTGA 3UCZP 3J7Z5 2HURA 2ZD1B 2AEJA 2XC9A 3SYZA 2FTRA 3S1TA 4QQBA 1S97A 1N32J 2CPZA 1TUGB 2BZ2A 4ZJLA 2QE5A 2E5LJ 1S0OA 1G2EA 1S7IA 5HVHA 2MHNA 4TY8B 2J0QD 4GKJF 3SIPB 2BA9A 2BRKA 1PAEX 2WVBA 3RU0A 1IBKF 1FJCA 4DQPA 4KPCA 5IM0B 3KUHA 1Y5LB 2WK4A 5CH7B 2A6OA 1X0PA 2BANB 3NCPA 3PDNA 3CJKB 5KFLA 3O44A 4OYWA 3M8PA 1QAIA 1N33F 2QLWA 2YX4A 1RTHA 3ZZOA 3V4MA 1KD1T 2IMOA 3LAMA 3WZ0A 5GADU 1HNIB 3IC1A 3UQSA 3V4IA 4FYWB 3WDOA 4EBCA 1YJVA 1RT7B 1QAYA 2J9CA 2VG6A 1WEZA 1XERA 4WK3A 1YRUA 3ZZ0A 3D0IE 2E9TA 3V6DB 2CQ0A 4IFYB 2EFNA 4LF4F 3HT0A 3VF0B 4YEAA 5I3PA 4ECSA 2L3MA 2UUAF 4IQMA 4C98A 4M5JA 1S48A 1FKPB 4X4RA 3MAHA 4A8SA 4IH6A 1BLUA 3D67A 1N0UA 3FJ2A 2C3YA 4C2MA 1FO1A 4RKUC 1ZOTA 5JMNA 3NGKA 3EVMA 3Q8QB 2N3LA 3CJ0A 3POTA 1N33J 1B99A 3I5AA 5CAAA 2MKJA 4XPCA 2KI2A 5A6PA 3RR8A 1FD8A 4EZ6A 1U49A 3CMQA 3GIRA 1UJ6A 2D1CA 4C7QA 2RU3A 2LYVA 1K1QA 2OGUA 3CDEA 3CJTA 5DQGA 4DUZJ 3IGVA 2ZH5A 4V19X 5BJRA 3TZXA 4M8LA 3OSNA 5C24A 4DG1B 3KLGB 3MDFA 1NK8A 4NYOA 2OFHX 5KG0A 3CIZA 4KB7A 3PV8A 4C8OA 2FB0A 1YJNS 2QLBB 3QLHB 3K57A 3ITHB 3G6XA 4GC7A 2ZH3A 1FVSA 1JQGA 2XMWA 3W63A 5M2UA 1D0EA 4F2RA 3I9ZA 1LK5A 1FJGF 2B56A 4WFZA 1NU4A 4QWBA 1JLEA 5KT7A 4HH1A 1RAEB 2R8KA 2R8JA 3DFEA 1HQUA 1XJWB 2BW7A 4QWAA 2P9EA 4GO5X 2QEXS 1OQ3A 3AOBA 1D8ZA 2CA9A 2ZDOA 3ILJA 4NCGB 3Q23A 3SEOA 1VQPS 4JV5F 2G2OA 3CO9A 4OYZA 2LXUA 1TV6B 1ZM9A 2BJEA 2M88A 4RO0A 1LWFB 3D6FB 4RUBA 3NNHA 4L74A 4KC5A 2L9NA 4CO4A 2CZVC 4ZJQA 1S49A 2RQMA 2WB1D 2DGWA 4O3RA 3D1HA 5IOLA 1RU1A 4B08A 4U7UK 4NLXA 2W8LA 1M5KC 3GR1A 2KG1A 3DNCA 3BJYA 3MPDA 4OLOA 3H2UB 2MKCA 3DRYA 2LQ8A 1UFLA 3GU0A 1VK8A 1HPZA 2B3TB 4M95A 3OV7A 2DXFA 3GV7B 4ECTA 4B3RJ 4LR7A 3MM6B 2GHVC 1RHKB 2BMBA 3FUYA 5CHCB 4C3MA 2H1YA 4LUBA 4I69A 3US5A 3BKTA 8ATCB 1SJ1A 3MEGA 4XDCA 4MKVA 2CUYA 1IUJA 3MCNA 4IFVB 3C16A 3PKYA 1XR7A 2ZM6F 3CCVS 3A13A 3KUEA 2NZCA 4M5NA 5D77A 1HBMA 2UV8G 1TKDA 2DHSA 4C8KA 1FI4A 3EYZA 1IJEB 4JYAJ 3BBFA 4ECZA 4OJ1A 1YG0A 2ZJRQ 2E1PA 3MCOA 2IBKA 2ZH6A 2N82B 2NPIA 3W2WA 4ED1A 4QWEA 2HSEB 1F2HA 1JLFB 1N5VA 3IS9B 1UCNA 3TAMB 1FERA 1SL2A 2XSJB 4DX5A 2QA4G 4C8MA 2YX7A 3H7HB 4LQ3A 4K0KF 3JSRA 1WJ9A 4DX8H 4PRFA 4OX7A 2F9DA 1FDDA 1ZA2B 1WKJA 4KQZA 1AXQA 4OI6A 4ZVQB 5C2CA 1VBYA 4C8YA 1FF2A 2HNDA 1MMDA 4C8ZA 3BREA 1NB2A 3MR3A 3UN3A 4ES3A 4ZOSA 1MG7A 5CYMB 3RUBL 5LOQA 1RT3A 2W9CA 4Q2LA 1QDUB 4P72A 2E1RA 2CNKB 1N5QA 2VA2A 4RW6A 4OL8A 1PO6A 4MKAA 2BM0A 3EM1A 3HULA 4CP5A 1IBMF 2PEBA 1NJIT 5CD4H 2XHWA 4KGZB 4R8UA 1NO8A 3H25A 4K5SA 1VQMS 3EGZA 1IR2A 4P52A 2OPPA 3MEKA 4OJHA 5A76A 5E5NA 4M94A 2AD9A 2I5JA 2ZDPA 1ZAXA 2VHGA 1XMQJ 2FC9A 5LT5A 3PIPQ 4EZ9A 1ULRA 2RE1A 2A6MA 3CB4A 4F25A 3EZ5A 2J9EA 4QYRA 1BQNA 3Q8PB 1H2UX 2R2UA 5JVHQ 1BD6A 4B3MF 3FCVA 5E7OB 5K8MA 3CCMS 4GKJJ 5CQGA 5DG8A 2HHXA 5AXLA 3FBEA 5E2QA 2UXBJ 2XQCA 2HK2A 2QJ3A 3CCTA 3FFIB 2VQEJ 2GHWA 3TAPA 3NNCA 1X5OA 2DGSA 3MFIA 2XY5A 2Y1IA 2BDPA 2RKIB 3W64A 2X7IA 2ATCB 2GNKA 3C15B 4GC6A 3QJJA 1UA0A 2U1AA 1JJCB 1W7WA 4USMA 1Y00A 2HRUA 1YHQS 3UO0A 1W25A 5FDLB 2YNHB 5FLXY 5A8KB 3POTB 5KFIA 4OI2A 5DM6Q 4RUCA 4N8NA 4B3MJ 1WG1A 1LW0B 1SC6A 2WSCC 2QSWA 3PIOQ 1SXLA 3H90A 3R3TA 3RBXA 2MZRA 2FJWA 5I3QA 1U1KA 2CJ9A 2IAJB 4NPOA 2WSFC 3EDQB 2HHQA 2GVZA 4PXCA 1C0UA 1U6ZA 2BJ8A 2KU7A 3DLJA 4G1QB 4IG3A 4M5HA 5C42B 4UQGA 4DPXA 2ZZMA 3SQGB 3HHKA 3SDEA 2R7RA 4PG8A 4DV3J 2MKIA 2RUGA 2KXHA 3Q8RB 1JXVA 1RT5B 2LCWA 4PXEA 4ZVPB 3Q0AA 3KOAA 2EFOA 4CIOA 1S5ZA 2LQBA 2DRDA 3DHXA 3NLCA 4M5DA 4LFBF 2Z0GA 2JFDA 1D3WA 4JOUA 2HQ3A 3V6JA 1Y3KA 1EB0A 2AJ4A 3T1HJ 3P3DA 4LT6A 4USWA 4ICLB 2MGZB 2DT9A 1IM4A 3PW4A 1MLAA 3V81B 3DGVA 4TY8A 3BS9A 3KG0A 2D69A 4PPZA 1TAQA 1JX4A 5MLCV 3M1VB 3V6KA 3MPVA 1T9TA 4EBEA 4AL5A 1H3DA 2W1BA 3BKUA 1PJ6A 1TL1B 4TN2A 3T19A 2D3O1 2LP4A 1N8RT 1S1XA 3A3PB 2M2BA 4F0HA 1VC5A 2CVEA 2NS1B 4LR9A 1U0HB 2ZHAA 1N5TA 1UA1A 1NB7A 2PMHA 3D6TB 1R89A 3VTIA 1TL3B 2OPRB 2XS7A 4A8QA 1YJTA 3MAAA 3VGTA 1NSKL 3N4WA 4KO0B 2FZGB 1RT6B 3SCIE 4DR3F 3F41A 4CYUA 4RU9A 3H40A 2DNPA 2OTJS 1A9NB 4KV8B 3OTDA 4L6V3 3B54A 2ZBRA 1C1CB 2Y0BB 1EQ0A 2L08A 2CQBA 4DL6A 3PNIA 1H6KX 3OR2B 2PE8A 4ZS6A 1O8BA 4DQQA 1SUQA 1S1TB 1NPKA 3FC9A 1RWPB 2EFGA 3ET6A 5F0UA 3Q24A 2XNRA 2FHJD 2OI2A 5H9EJ 2UVVA 2IY5B 3M2UB 3R6GB 3DLHA 2VV5A 1TQLA 5JJBA 2E1MC 1IKYA 3A4TA 1J5OB 1Z4UA 1VRUA 2EFPA 2RH3A 3WBZA 5DDPC 2DB1A 2HNZB 3DN9A 4NLUA 2M0GB 2ZKTA 3M05A 3MEEB 3UI3A 5CA5A 3CD5A 4USJC 3PW5A 1ZAWA 1HBNB 2L9WA 3QGIA 2MZ1A 4AQYJ 4IG0B 1VQ7S 5GMDA 1X9WA 3MOJB 2QIFA 4ZVFA 1WNEA 1SB6A 3I0RA 2C2RA 2Y9HA 1KHWA 4YB5A 3JYTA 3UN5A 4AL7A 2C2OB 2YKNB 2NR0A 3DM2B 4P10A 3DDKA 4J91A 2KFZA 2HS0A 1JLQA 1LQ9A 1RK8A 1S9EA 2OD4A 4GO7X 4YUDA 3OXFA 1NHKL 2QX0A 3MZIA 5KFCA 4IRDA 3ZC4A 4KTQA 2J5AA 3GQCA 1IBLJ 2MZTA 4EFAC 2YWGA 4YDDB 2QGFB 2M4MA 2VJUA 4GRSA 3TANA 1TKZB 3L7OA 1HI8A 2B9EA 1VDHA 2F7VA 5SUHA 1S72S 1XK8A 2CJYB 3EX7B 2A0FB 2LQ9A 3U1NA 2IJNA 2MQ8A 3J80U 3G6VA 3J81Y 3MECB 4U67Q 1U48A 1DTQB 1KTQA 3R1LA 4TQRA 4XAKA 1QVGR 2RRBA 4CRJA 4Y0FA 1MMNA 1ZPVA 3EGVA 5HAOA 4C0BA 1UZDA 5E3RA 2DTJA 5KG4A 4WKYA 1U47A 1IBKJ 5LMUF 3RG6A 2DXEA 1V3RA 1RYSA 1FFWB 1FK9A 3HMJG 1I3OB 4GMKA 1FE4A 3L09A 1FEHA 3T6JA 2VA3A 4ZLPA 2ADBA 2G0JA 3TA1A 1AUSL 2CVIA 1PYTA 3MM7A 3M8WA 2HFSA 3QSIA 4AE5A 5C5JA 3DRRA 4LVNP 4OX9J 2ROPA 4J90A 4URQU 1PIEA 1HWLA 5KOWA 2KJWA 1TKXB 2W24A 3KYLA 1YRXA 4F50A 4ER8A 2HGMA 2CRLA 4GKKF 1U1MA 2LDIA 1TZ0A 2WOMA 1KS2A 2RU9A 3MMBA 4ZPCA 3G82B 2CZ4A 4QOTA 2BE9B 3PKMA 1ITPA 3U02A 4P71A 2OUGA 3CE8A 5A8RA 1O0PA 2K2PA 1P1TA 3G87A 4O4RA 2GW8A 4QR0A 2KFYA 2B5JB 4A4JA 2QZ8A 1VMBA 2YXLA 4NXMJ 3IXQA 4ITSA 2DPIA 1N5SA 4CO0A 5KFUA 3HT3A 2YNGB 1WC3A 4YB6A 2FDNA 2AMCB 1OSDA 2NXCA 2RAQA 3EVOA 4W4MA 1Q86T 3PYEA 4WIIA 4USHA 1S1WB 4PZVA 4WCEQ 4ANCA 3MWBA 3LWLA 2HG4A 2IA0A 2DJWA 1NNDA 4RU2A 5L1LA 2XYHB 4CI0B 2R7WA 3P5TL 3Q8YA 2XGPA 4IKAA 4Y2AA 4B9TA 2J6SA 1FWPA 3J7YU 4AL6A 3RBEA 5HLFA 1CULB 3HVWA 3HVTA 3VALA 4CDIA 1S99A 1TMMA 4J9KA 4G65A 3PRDA 2HS3A 3TJ9A 4Q8FA 3KJFB 2VBZA 4NOHA 1OS5A 3VZIA 2ZC4A 2DPJA 2YKOA 3ADAC 5IT0A 1D9DA 2FD2A 4FDFA 5MAOA 2JEIA 2OLWA 1X4GA 3UD5A 4C11A 1C1BB 7FDRA 2LMIA 1RWVB 4ILRA 2H4YB 1FXLA 5D4OA 2Z4PA 4OZJA 4CNZA 5DQHA 2KN4A 2MMYA 2DVIA 2I2YA 1NK5A 4AT1B 2XYPB 3CCLS 3G6YA 5BYRA 5DDOC 3M9MB 3UCGA 1WWHA 4HYKA 4U7CA 4HH0A 2EC2A 3PRBA 4CLYA 1WORA 2A3JA 1T7PA 2RDDA 4KH1B 3CJ2A 3TEGA 3TRGA 2BKPA 1WG4A 5D0RA 1DJ0A 1NKBA 5HJYA 5GVQA 2B9WA 1HBUB 1BWVA 1FJEB 3I0SB 2AGQA 1XNRJ 2MY8A 2Z56B 1E6YA 4RNNA 4TU7A 1S0MA 2ROGA 3SSQA 1HA1A 3OD2A 3PJ9A 4I0WA 2AGOA 2XLKA 4PR6A 2AHOB 2F5GA 2WRMA 3AOAA 4HTIA 3EPGA 3CJRA 1F5AA 2FY8A 4KAIA 3K59A 5DZ6A 3T6BA 3NCQA 3W5XA 3E2EA 4LRAA 4HT5A 1VOMA 4C8NA 2EBGA 4K4SA 1CJKB 2POKA 3DOMB 3SMZA 2WCXA 2WONB 3HXMA 4GVBA 4DUTA 3Q22A 3HKWA 2DO4A 4DFMA 1AFJA 2IHR1 3ISNC 1VI7A 1WHVA 4KR0B 5F8LA 4KBIA 4N7TA 3N01A 2GFFA 3OLAA 1UP1A 3L4BC 4N8OA 4O4GA 2OMOA 4FPIA 1RT4A 2D9PA 1NSAA 2XB2D 3N6MA 1NDKA 3LP2B 1NMEB 1XR6A 3QO9B 2VPYB 1FTCA 2OEKA 3HZGA 4RBVA 4YDXA 3THPA 1OYDA 3ZZUA 4CO5A 5DS7A 4J9SA 4IOCQ 1BQMB 2UU9F 3TR5A 3BSNA 1WTBA 2YNFA 3JQJA 5AXMA 2GMJA 5L9XA 1HQEA 1VCTA 1PYSB 3T41A 4RNMA 2R2TA 5IT4A 1CJUA 4DV2F 3FRYA 1KNZA 2FIUA 3GCWP 3HSJA 1KVIA 2VG7B 3DYAA 4FS1A 1QUVA 3MM5A 3NMRA 4Q0BB 2CDRB 4LF9J 1GFWB 4OYAA 1FD2A 3KLIA 1WKLA 3N28A 3GFZA 3MMCB 1AZSA 2JLGA 4HR2A 2WBMA 1TKTB 2Q1LA 1YBAA 1RAJA 1RI7A 2V8GA 3QGGA 1I6JA 2JOQA 3TO8A 4QYZJ 2VOPA 3GE9A 3IAS9 3AD8C 4KKOB 4DCJB 5HBMA 4P7VA 3AQOA 3S8SA 2ASYA 2AYEA 3RYLA 1RKJA 1U26A 4FXVA 3NAHA 1R8BA 1I5OB 5HP1A 4Y28C 4B9SA 2WW4A 4M5KA 2C2NA 3FEYB 5L1IA 1QY7A 1XNQJ 2QT7A 3PYDA 2DNQA 1OO0B 2ZNZA 4HDHA 4B9NA 4I2PA 4DBQA 1LWCA 3NGTA 3RAQA 1TL5A 3TA2A 4Q43A 2DCUB 1T95A 4ED2A 1WUUA 5D78A 5JVGQ 3HZEA 1FEEA 2J6UA 1ICEB 1FRLA 1KLMB 2ZNYA 4O0IA 1Q53A 2D9OA 3GYXB 1VQ5S 3EE3A 4H4OA 1FFGB 1RTIA 4JI1J 1UZHA 1MSWD 1UFWA 2CQDA 1NZ8A 4KSEB 2M3DA 4M1KA 2CNOB 4OYIA 5B7WA 4EI2A 1U1LA 2DNZA 3GB0A 4OV6A 5KFYA 1DBDA 2GGPA 5KFTA 1JLCB 2Y1LB 2RS2A 2HAFA 1X7VA 3E3XA 4O3NA 3RB0A 1FRKA 2EG1A 3NY0A 3CGIA 2A18A 2AJQA 4Y65A 4C48A 4QBUA 2OO4A 4FF4A 4OI0A 4KHMA 1ZTWA 4LF6J 3QGHA 4A47A 3NKYA 1UL3A 3CUNA 3T9NA 2A2DA 2OPQB 1VBZA 2RF2B 1JLGA 3LUYA 3QO9A 5KAKA 1U24A 2VDHA 2UXDF 3M9OB 1HQ2A 3NS5A 1W26A 1FRMA 1K73T 1S6PA 3BGRA 4RW9B 4DOZA 3QSYB 1UVIA 3BQ0A 1QAXA 2EPIA 4QWDA 3BPDA 3AOCA 3BBCA 2RMLA 4RW4B 3DI6B 4JI1F 2OFGX 1RWNB 2MQOA 1VISA 1T05A 5D4PA 4X4TA 5EX0A 1FXRA 4LFCJ 2YTCA 1NJWA 3I9V9 2MLXA 2HZCA 4NA3A 4OI1A 3C46A 4FPRA 3MM8A 4HVZA 1RT1A 4UZCA 2QSFA 4UUXA 2WZ1A 4LFAJ 3MUMP 2G1DA 2PFDA 3N0VA 1NEEA 4DR7J 3KDNA 3P4UB 2GV1A 2Q3PA 2EWHA 3QAUA 2HNYA 3I55S 2CPEA 1Q5VA 4G1PA 3LAKA 4WWSA 2ROEA 3HM9A 4M5MA 5BYSA 2LEBA 3HSGA 3AY0A 1KQKA 5J1PA 2MLZA 4IH5A 1QSYA 3DDIA 2HFZA 2AV5A 1H74A 2DEIA 2MQLA 1VLYA 3QBCA 1VQLS 2NCKL 3B4MA 4BC7A 2DHGA 3L7UA 2NREA 4IUFA 1VQ6S 2HS4A 3S01A 2E1CA 1KLNA 4WFAQ 3CC7S 1GXTA 1SKUB 5KFKA 4X4SA 4DV5F 4ED8A 1PKUA 2IVFB 2FJAB 4I7FA 2CPYA 4DLEA 2HMIB 4JV1A 1NDCA 5FDLA 4XK8C 4KPYA 4TKTA 3FSIA 1K47A 3FEXB 1PJ7A 4QYZK 2UUAJ 2RQKA 4NZ0A 4K4TA 3SZ2A 4DR4F 2VC0A 3R2CJ 4PWDB 1V3SA 1KDNA 4PQAA 5HMXA 2ZJQQ 3O6QA 5G0RB 4D3GA 1B0TA 3NWRA 4R0EA 5LL6d 3CC4S 2MKHA 2HWHA 1LFPA 4L3KA 1KLMA 3D7SB 3M6WA 3PX4A 1UVMA 2W01A 2MYFA 3K7RA 4A48A 1ZM2A 3QJPA 4IRCA 3NWGA 2ZUGA 3DGPA 1Q8IA 4XPEA 3QIDA 5KT2A 2UXCJ 1S0VA 1WSRA 2PD1A 3KK1B 1PYOB 4LSNB 1IKVA 2HQCA 2YWEA 3FZBA 1YBUA 3R1HA 2IM3A 1E6VB 2CQ2A 4K7QA 5KG3A 1ZS6A 3A3OB 1G7CB 1S9GB 4DF8A 4QU6A 1EARA 2EFVA 3CCES 1SC1B 2JEFA 2CQCA 2E66A 2CNLB 2WB4A 1N4LA 1RT2A 5E3PA 2JVOA 3B78A 3KTQA 5G4DA 1LOUA 3DRXA 4G1IA 5F8NA 3M4XA 1NBEB 4PG6A 3VWSA 4ALZA 4DU7A 1EZZB 3PYGA 4WU2A 2ZITA 4TY9A 3WHIA 1C4AA 3KK3B 1X4BA 3CCZA 1S6PB 3BGRB 3RBDA 2MSSA 2AJ2A 2OHDA 3PEHA 4NZ6A 4L76A 1UWBA 2HFNA 2JC1A 1EQMA 4ZVUB 4DUYF 2ALYB 2VG7A 3DYAB 3IG1B 3LF0A 2YQ3A 4F26A 2XY7A 2DR5A 2R7UA 3I4HX 1U1QA 4ZITA 1J27A 1BUXA 3T1YF 3ZZTA 3DKDA 4FYYB 4AD6A 5DZ7A 2N7CA 1BE4A 3KWMA 1VIOA 4X4QA 1SH0A 4UOGA 5I3UB 4F2SA 2HHHJ 3QWUA 3LP2A 2CJBA 2BJ7A 2QYGA 4Y2CA 2XMUA 1XN9A 2FJVA 7AT1B 4JI0J 1WC6A 4FYVB 5KFHA 4HHHA 4DV6J 2AQ4A 3SFGA 4I2QA 3QYYA 5F3TA 2NUHA 2CZ9A 3QATA 1RTIB 3EICA 5KFAA 3NRBA 2G13A 1K1SA 4DU8A 4H54A 3TZYA 2NXJA 2W7OA 4DR7F 4WFNQ 1HI1A 1OPZA 3DOLB 1Q16B 2P6TA 3M32A 2AW0A 5K14B 1AUDA 2SXLA 4LF1A 4ED4A 2QC3A 5KT4A 1VC0A 1WACA 1KC8T 4KHPJ 1MN9A 1WF0A 3Q8SB 3CMAS 4NRUA 3CCSS 2BEFA 2H5EA 4KGXB 1L3TA 3TUIC 3VZHA 5AE3A 1NUEA 1EKSA 2IVMA 2V4JB 4USTA 1TK8A 4LF7J 5HATA 3OL7A 3NGDA 2EK1A 5CCLA 3TI0A 3DLGA 2O66A 2OSRA 4YN3B 3KLEA 4J9LA 3EWGA 4X4PA 3OHBA 3MEDB 4F36A 4MT1A 1QSLA 3JB9k 2IJRA 3UVJA 1P8GA 4BCAA 2V4QA 3OFHA 2OKQA 1X31C 1HYSA 2AX0A 2GMLA 1Y4ZB 2YBVA 3MFHA 3RTVA 2UUBF 4KGKA 2BE2B 1UVLA 3IFEA 5B08A 5HO4A 1REGX 3D68A 3FQKA 4DV1J 1WSVA 2RD5C 4P75A 3VGSA 4DR4J 2ZUAA 1CC7A 4I1TA 3AJ2A 3ET6B 3QT7A 3QAEA 1GAOA 4BHQA 3CEDA 2Z2MA 1MW7A 1UJ5A 3AXMA 2OPSB 2BJDA 2MZSA 3PW7A 4DEZA 1X60A 1Q8LA 2FZCB 5J2QB 1RTDB 2E5GA 3PXGa 2GJFA 1V3ZA 5ETRA 3QT8A 5A0YA 4NCBA 3N5FA 3N6LA 3VGUA 4DL4A 4MKYA 5F0WA 4LF8J 4B9LA 3NS7B 4MK7A 4ZVTB 4LREA 1G1XA 1N48A 4FBTA 1Y5NB 4WZQA 3N5BA 1QTMA 2WW8A 2L41A 1U0HA 5ETQA 1F2GA 5DETA 3G8SA 3IRXA 4PCQA 2KXNB 4O4GB 3MMAB 1TL1A 3NGSA 4F3QA 1VQOS 2BACA 3T3FA 2HEKA 1HBOB 5IQQA 3NMAA 2BJ1A 1RSCA 3FCHA 5J1EA 2OMLA 2WONA 1DZ5A 1Q5YA 4J9OA 3M6UA 2HGNA 2VFRA 1XBWA 1QAJA 2C28A 1CJVB 1VRQC 4CWBA 1X4DA 3EGNA 4RWXA 1SH3A 1B3TA 4W90B 1A6LA 2DGXA 3C14B 1IBLF 5KFQA 1WG5A 4LIWA 3M32B 3MGJA 2UUTA 2E9ZA 1W2IA 1O6XA 1VS3A 2DNOA 4X64F 3OTBA 3Q2TC 4RW4A 1E6YB 1X8DA 1JWWA 1FESA 3CSKA 2DNKA 2HQGA 1VQYA 3TUZC 4ZHRB 5IWAJ 3H5YA 1UVJA 3DGPB 2W4DA 3H5UA 5F8IA 2X1AA 2E9RX 5B09A 3GIMA 3VAFA 4TVAB 3RJMB 2RS8A 1N5YA 2AF6A 2VBYA 1XEZA 5C42A 2HHHF 1C0TA 2F40A 2R8GA 4IH7A 4P7TA 4K0KJ 2NLWA 3MM7B 1VC6A 2AJ0A 1HNZF 2B9XA 1KQSR 1A7GE 1WHWA 2ZC3A 4CM0A 2UUCJ 3IWNC 3BR8A 1Q8KA 4P2FA 2GVDA 2FPHX 2W2PP 5ETOA 4B3SF 1N0VC 2JZ5A 2GJIA 1WEXA 2KYZA 5KG6A 3FQLA 3TNVA 4OYMA 3E01B 1C1BA 4ELUA 4NMXA 1ZM3A 5T14A 2P2CB 5T7LA 3BV8A 1VQKS 4Q7AA 2JSXA 2VL1A 4N5SA 2MQMA 1I51B 2P8IA 3IR5B 2V2KA 3I5BA 4PABA 1WC0A 1S57A 1OY6A 4UOCA 1HFEL 3R97A 1SIZA 2DHAA 3HVTB 1K8AT 3UVJB 1S9GA 2K3IA 1XMQF 4A8YA 1WF1A 4DFPA 1T3NA 1FA0A 5JXSA 4AXJA 3X3UA 3HD2A 5D3GB 3P6YC 2V2ZA 3VAJA 2V69A 4RBTA 3HDSA 1X0FA 2JNJA 3QPIA 1AT1B 1ZETA 1RAFB 5ETMA 2J7KA 2YX1A 1A0OB 2G4BA 2H48B 4DR5F 1I1GA 4OYPA 1NJZA 2HVEA 2EFQA 5E3QA 3NAIA 3CJ3A 2G2YA 1HNWJ 4FN5A 4KKOA 3UDCA 1H73A 1VRTA 5KFXA 4U9RA 3V2UC 1SQGA 2HBZB 2ASLA 2XSFA 3VGVA 1RYRA 4USKA 1S0NA 2IBOA 1XQIA 4WFYA 1IXKA 4YHHJ 3HI9A 1F1BB 1PSDA 3M8YA 3MHYA 1YBTA 2CNNB 2XI3A 4MIBA 3M2UA 5LSLA 3GZ7A 2KRRA 3OFEA 1KQGB 1K0VA 2DGVA 4U96A 4ETZA 3BQ1A 4LF9F 4Q2MA 2RIJA 4CTAA 4JI7J 1YKWA 2F9JA 1WD6A 1N6QA 1C1CA 2GVDB 2V0NA 3R5CA 4K2JA 2W25A 4KYZA 4KV8A 2GC8A 4CYUB 4H4MA 2WVDA 2HBRB 1M5SA 2OAUA 1FDAA 2JC0A 2VB6A 2EC0A 4ID5B 2J0XA 1UAWA 2V9WA 1GNKA 4JI4F 2W9AA 3B4DA 5L46A 4P2MA 5H9FJ 2XS2A 1JLCA 3QGPA 4X66J 1SJFA 3F0NA 2O01C 3TQEA 2VUGA 1XMOF 4MIWA 3I82A 3QNWB 1HNZJ 4NEYA 4RUHA 4Z7CA 1SV5A 2FHOB 2J9DA 1TK5A 3HD1A 5DM7Q 1YK9A 4P2SA 2FLOA 2HVDA 1X4AA 2V5HG 4FNIA 3PTWA 4CT9A 2BQUA 1KR4A 1VIXA 2VPZB 5IWAF 2YKPA 3TOQA 1CJVA 1MROB 3AJDA 3ZZRA 1JMTA 1T94A 4ZP8A 1UJ4A 4LSNA 2JWNA 5KFDA 1I94J 3DI6A 1ZM4A 1M1GA 2AEMA 2QYCA 4HHJA 5KFVA 2ZJPQ 2D74B 2E5JA 4OZ2A 1IBMJ 2CKWA 1NK6A 1CBKA 3EPIA 2VFTA 4AFFA 5KG5A 1EHWA 2ZEJA 3MMAA 2GMHA 2IDLA 4CLZA 2GQ2A 4RWWA 1PG5B 1SVDA 2PEHA 1CJTA 1TTHB 2PSZA 4IG3B 3ZTRA 2AU0A 4I6YA 3BZQA 3RW6A 3KG1A 2HRYA 2YPYA 2OPQA 4C0OC 1PGZA 4DJBA 1M1KT 2Y8WA 4JYAF 1FDBA 3G2XA 1YJ7A 2ZOMA 2FZKB 4IDKB 2KT3A 4QZVB 1RUSA 1HWUA 5KTQA 4DCPB 5KT3A 4CLFA 1T02A 1T03A 2ZWOA 1RISA 4RW7A 3KLFA 3AH6A 1JLEB 3OVAA 3PG9A 2ZH4A 1N88A 2YNHA 3ILLA 1SJ4P 3PACA 2H5IB 3LO3A 4Z7YA 5F8GA 3K0JA 2DHXA 1RWUA 4X84A 2Y1RI 4K59A 2ZOGA 3EDRB 1RZMA 1OJ4A 2GIQA 3IM9A 3Q2SC 2KT5A 2UUWA 4RBUA 4Y3CA 4CLKA 4D3HA 3FEZA 4X64J 1N34J 2V94A 3K8VA 2UZAA 4IDKA 1EAYC 2CAJA 1RE1B 1C0TB 5BXIA 1VRTB 3PZPA 4Y2IA 2VBXA 4OMFG 5RUBA 1QD1A 4LFAF 5B0EA 1IJFB 3MEDA 4LJMA 3W8PA 3QIPA 1S6QB 3JXOA 3VAGA 4RL1A 3PX0A 1FRXA 3DLGB 1AYEA 3OXGA 4JP8A 2CQHA 2CPIA 3ISND 4I2PB 3SFUA 3SQOP 3TYTA 2E5IA 2W2MP 4J7CA 5EX3A 3W60A 4ZLNA 1ZAVA 2C2EA 4GVBB 2J76E 2JEGA 2IFXA 3MD1A 4UT4A 4BWMA 4MAKA 2H51B 3BKFA 1WELA 4EO8A 3SSRA 4OYXA 5HBMB 1GMWD 4CNYA 3R5BA 5E33A 4EGLA 3NNAA 1DQ8A 1UVKA 2DIVA 2ALZA 1SL1A 4DL3A 3V6DA 4UOHA 4LRCA 4YR2A 5GAHI 4DR1F 4DV4J 3AD9C 1K9MT 4PUOB 3ISZA 1HMVA 2MDAA 2ZVIA 4BWJA 4ZN1A 2VC1A 2W9CB 3CC2S 3M7VA 1WKKA 4DL7A 4RW9A 3V4IB 4O3QA 4YQWA 1F5CA 1S6UA 1X4CA 2MHEA 2WVFA 4JB8B 2PN6A 1HW9A 1RTHB 4ZP6A 4F4YA 1NRKA 2V8DA 1UETA 1PBAA 3CD7A 3O8WA 3CCUS 1W2BR 5F8JA 4EYIB 3ZNJ1 5U47A 2XG8A 3ZTQA 4C0HA 2XSJA 1N32F 2XCPA 1GTEA 4H4MB 3GPAA 4X65F 1FK9B 1TL4A 1VHFA 1KVJA 1IWGA 4CH1A 1BC6A 1N36J 3F44A 1UWBB 2HGLA 4EWTA 4WP9A 4URGA 1DRZA 3ILOA 1OWXA 3IA0A 3G9CA 3PJXA 1LFWA 3GR0A 3NG8A 2F65A 3A8EA 5L8RC 3TVZA 4UY85 1IBCB 1WC5A 1PCAA 3GV5B 3P49B 1HIYA 1U0SA 2BE2A 2DD8S 3W62A 3J7YI 3W9JA 1OQ6A 4EEYA 1DURA 3H59A 1JB0C 2EEYA 2OEMA 4HI2A 2KH9A 2RRNA 4FF2A 1Y7PA 3P8BB 4L3NA 3ZZZA 1S1VB 3RAMA 1TP7A 3QMQA 4DXLA 2HLUA 1EETA 3H5SA 3FZ2A 4Y34A 2WTFA 3BN4A 5J1EB 3ICLA 2V4JA 3MR5A 2VFUA 2R7XA 2CQ1A 4DV7J 1F5BA 2HWTA 5CZXA 2KZMA 3TX8A 3T1AA 1S6QA 2V34A 2QA1A 4B3TJ 5DRKA 4NEZA 2C2DA 1U25A 2ACYA 2LU2A 2ZBCA 1IVZA 2I9SA 5LXRA 4LSLA 1FT8A 2J7UA 4I6WA 4OZ3A 4TU8A 1ZZFA 5G0RA 4NLVA 3AODA 5I42A 1AZSB 1JIHA 3TEHB 3Q8UA 3TARA 2L48A 2LVWA 1GK8A 1S9FA 1VQ4S 4OYBA 2R42A 4ZPWR 4DF4A 1FWLA 2FVCA 1JJHA 2QA2A 3KJVA 2B6AA 4DR2F 1VGYA 2A2CA 2JDJA 2FY1A 1SBRA 4B9UA 4ZVHA 3JS9A 3MR6A 1IM6A 3GTYX 3SCJE 1TKXA 4UOFA 1CJUB 3I32A 2DGQA 4RW7B 1JXLA 1HQEB 1GX6A 3DRRB 2FVSA 2PFFB 2I8EA 1ACMB 3HPOA 4Q44A 4JI6J 3TAMA 2KTQA 1NZAA 2VD3A 2PMWA 1R8HA 3M2VB 3W2WB 1X5PA 2BV3A 3KKFA 2J8AA 4WTYA 3SCLE 1YIJS 2MJUA 2GHPA 5IS2A 3VQTA 3W61A 2DR6A 3MD3A 1HR0F 4RW8A 5A8WA 1H98A 1S59A 2JVRA 3KK3A 2XULA 4ELVA 4OJGA 2NZ4A 3AB2B 1RAIB 3UR0A 3QT5A 4Q45A 5KOXA 3JQMA 1T9VA 2APOA 2C3OA 4ZA1A 4PUOA 2ZBQA 1KBRA 3V5RA 5KFPA 5EHHA 4J9NA 4ICLA 2MGZA 1AFIA 1R6VA 1CVJA 4OV1A 3VAIA 3CNQP 3T1HF 1G3OA 3FMWA 2X3GA 3VQSA 2WBRA 2K8GA 3IP0A 3N6NA 2P5VA 3M8RA 2BR0A 4HDGA 1IR0A 2W9BA 4NASA 1KP6A 2DK2A 4WBFA 2EK6A 4JBCA 4NLGA 4I4BA 2Q6CA 3KK1A 2COLA 3UD4P 2QA4S 3AAWB 2HHTA 4I2QB 3RB6A 1HWKA 1WDDA 3L7PA 4RW8B 5A8WB 1NAQA 5EWEA 4ECYA 3SDEB 1IQTA 2VG5A 3RW7A 4EO6A 3FDSA 4NXNF 2ILYA 1RHMB 5D0HA 1KN6A 2EW9A 4YB7A 1NKCA 1NSQA 4RUAA 4WFBQ 3T9ZA 6FD1A 4LF8F 5D8HB 4BBYA 2NQPA 5KFZA 2R2SA 1J5OA 3PJWA 1HQUB 2QL5B 2DYAA 3H2LA 4PYDA 1HD0A 4ZVEA 5HVFA 3GFXA 3TWZA 4NI2B 4CH7A 3RB3A 1RTJA 4DR3J 3CJQA 5E0OA 1JJ4A 2OPSA 1D9FA 4K50A 5LSRA 2OIHA 2J9DE 2OP5A 3I87A 2XCAA 3KJVB 4J5OA 1X5TA 3QT6A 2KT2A 3SXLA 3GIKA 2H4WB 3K5NA 3S6EA 4DV4F 2K1RB 3HVRA 2LECA 2VKZG 2HWIA 3ETOA 2XLJA 1TKZA 2RUSA 3MAAB 3M6VA 2CG4A 3H4DA 5LSOA 9ATCB 2DNHA 4ENOA 4Y6IA 3Q83A 4DZ6A 3QFWA 4I64A 3DHWC 5HROB 1VJWA 3R5JB 4P2XA 2R7TA 2YPZA 2YQ1A 4USVA 2HNYB 3PX6A 2GAHC 2MLYA 4FS2A 2ZZNA 5EUHA 1FKOB 2FHKA 3EGWB 3LPEA 4ANDA 1MROA 4U95A 1XNQF 2E44A 3LPYA 3OW2R 5HI7A 2YNGA 5KG7A 3DRPA 4ZPAA 3LOUA 4ID8A 1RHQB 4ED5A 4K4UA 4F4AA 5K5MA 1FRJA 1CSJA 4HHUA 3HKZD 1Q1KA 2RDJA 3MEEA 4NLRA 2VJVA 2DITA 3UR3C 4M5DB 4CLUA 2HNZA 2W2QP 3ENVA 3R5AA 1CEZA 4LFBJ 3MMCA 3R6LB 4NA1A 1RT7A 5KFOA 1SV5B 2LLZA 3FGVA 1YTYA 4JI3J 2ADCA 3C2PA 2B4PA 4WJBA 2LFVA 3MMBB 3HHNB 5KFMA 3E01A 4JI0F 3G6ES 3SQGA 2KJVA 4B17A 5EWGA 2E7VA 5KFSA 2E1AA 4QIVA 5DG9A 4I7FB 3GILA 1CC8A 2KO1A 2HMIA 1JLGB 2HHWA 1GH8A 2ZWPA 2H3EB 2IYIA 3D54A 4OI3A 1LK7A 2H5JB 4Y2MA 3IO1A 4U6PA 2VQEF 2Z57B 3KNGA 5LXYA 4JV2A 2XBPA 3PFOA 4EMDA 5F8HA 1YJ9S 2CYYA 1KWMA 2G0IA 2V8PA 3W9HA 4G3IA 4O3PA 2RB7A 4F4XA 1VYAA 1D9AA 2E5HA 1YVFA 3BB5A 1RKIA 1NH8A 4GVLA 4ZHRA 4RR5A 4F4KA 2HYIB 4OHYA 5E41A 2KDOA 3C15A 2DGTA 2QN6B 4K8RA 4QR2A 4ZVGA 2C2ZB 2EG2A 2DISA 1H2TZ 1REVB 3MUTP 4DL5A 5IQ6A 4H4OB 1DFDA 2CQIA 4YY3F 2D3ZA 3VCDA 2AIRB 3C14A 1VBKA 5D6GA 2DH9A 1F9HA 1H2VZ 1VLOA 1WHYA 3BGUA 4LF2A 4F8RA 3IGNA 3MM9A 1E6VA 3UE2A 2JEJA 1VJQA 1LWCB 4YHHF 1X4EA 2DRBA 3PFEA 1L3SA 3HVAA 4BDPA 3AHPA 4WPAA 4N56A 3T5LA 1T9WA 2IM2A 1HBOA 4RX6A 4YP3A 1ZPWX 2KM8C 2JH3A 2KYXA 3I4PA 3GYGA 5HJXA 4A8WA 3W1YC 4M5LA 5HROA 3NL0A 3FRZA 4N47A 5ETVA 1L3VA 1LWFA 2DH8A 1TV6A 1GTHA 5K8NA 3O1LA 5K8PA 3G96A 1K0TA 4K5RA 3QJLA 4H4KA 1B70B 3KDOA 4TLQA 3HO1A 2MQNA 3PEJA 1IKYB 2RHSB 3MR7A 4EK2A 1IR1A 2HW3A 3ZTSA 3V6HA 1RT3B 4LF5F 4ECVA 3ENQA 1R0AB 3MMJA 3AFGA 5ETTA 3TUJC 3GIJA 2JRSA 4OZ0A 4UZBA 3D3BJ 2XMVA 3VV2B 1LKZA 3FVYA 3OFFA 1XMOJ 3THVA 3MXHP 5HSPA 2RQ4A 1RTJB 2XMTA 4OFZA 2V67A 2XS5A 2W2NP 1U09A 1LXNA 3QLHA 4OJ3A 2RKIA 4USIA 3H42A 5DJBA 3R7SB 1ZTTA 1WOSA 5KFGA 2HVHA 2IIHA 1GEHA 1TL7A 2HRTA 2X1FA 2HHVA 5D4LA 3I5CA 1CULA 5C25B 4JI2J 2KL8A 2F3JA 1RGVA 3M8ZA 3VAKA 1D8YA 2MB0B 2UVWA 3KLEB 4Y2KA 1ELOA 2NSBA 2M8DB 3MUVP 4WZMA 2J0WA 3F56A 3K5PA 3PRVA 1F0XA 4KRWA 4XDDA 5GAGI 1S1WA 4ZPTR 2GA7A 3K2YA 3MEGB 1T9YA 3M9NB 4IO1A 4DV0J 4DPUA 2B43A 1QLNA 5L1JA 4DSKA 5K9FA 1MMLA 3HFZB 1HNWF 2EXUA 1H7WA 5F41A 4DSEA 4YS2A 5IT9U 1KOHA 4CLLA 4EYHB 4HKQA 4O23A 1T05B 1P1LA 4DN0A 4WF9Q 3JTPA 1FDNA 3KLIB 1WTFA 2DGOA 5CYMA 4DMZA 2HVIA 1YSJA 1FWKA 1HBUA 4ZPVR 1RWXB 3LW5C 4ZP9A 2PI4A 3Q86A 3T5KA 3N79A 3IRXB 3MM5B 2BXJA 4FYXB 4MK8A 4P6QA 4CH0S 3TA0A 3QRQA 1X9MA 4G1QA 1S79A 1X5SA 1RHUB 4DR6F 2RF2A 3BGOP 2XLIA 4NX9A 2JL9A 1LV5A 5CXTA 1M5HA 2MKYA 3UW1A 3OLBA 1N56A 3KHLA 4P74A 3CVKA 3D6MB 1RA6A 2UV8A 4TYAA 1UW4A 4B02A 1RTDA 2VIHA 1NCLA 2DRAA 3IG1A 1HHTP 2V8HA 3RZAA 4CTAB 2ZBPA 2PT0A 1P9YA 4W98A 4OX9F 5KT5A 2AWZA 2DNMA 2F8MA 2HLTA 2VPWB 4ZVSB 1HR0J 4ZCKA 1DHMA 1UWAA 5GAHU 4NYZA 4XTTA 5I4MA 4PXDA 3GYNA 3GJQB 4K2XA 4BLGA 5I42B 1GMVA 1F60B 2QRRA 3FFIA 5HL7Q 2VQFF 2FVPA 1VFJA 4X4UA 4LSLB 5HVGA 3IM8A 4AXIA 5HLFB 1YITS 1T3OA 4ZPDA 4LRFA 2AYGA 1F9FA 4OZLA 3IBWA 4XO0A 4DSLA 3FBFA 3PR4A 1FE0A 3R5DA 4F7VA 3BBBA 3OJUA 1U7LA 3HSZA 2R9LA 4KH0B 1URNA 3CT9A 3NOGA 4DR2J 2HVZA 4ED3A 5J2PA 3DXBA 1TELA 1SKSA 3VHQA 3K5LA 1NLKL 2WAQD 5D3GA 2BOAA 3RRHA 5D4NA 2MQQA 4FYDA 5AE1A 1SC4B 2P9GA 2QFJA 3BSOA 3W2VA 5B0AA 4ED7A 5A2QU 4CO1A 1TKTA 1MU2A 3R8YA 5HQ8A 1VRUB 4LQ9A 4MTPA 4F3MA 4PWDA 5A8RB 3PVXA 5CABA 4YFUA 4LSZB 2F4VF 1C4CA 3MF5A 4Q0BA 1KFDA 4DQSA 4P73A 1R31A 3W3SA 5ETLA 4C11B 5I3UA 1QUPA 3OXLA 3KK2B 2VICA 4CT8A 3K17A 4ZP7A 5J1NA 4KJIA 3U7JA 4LF6F 3J81j 2VF3A 5DO2A 3ZNUA 1DQAA 6AT1B 3W5ZA 2N3OA 2CWKA 5B0GA 4PG4A 2BVZA 1GQEA 1P27B 1Q7LB 4CO3A 4DG1A 5C24B 3UPFA 4ZCLA 1N5YB 4K4VA 2ATLA 2Z58B 1LEOA 1S1XB 2Z2YB 4OIXA 3W8GA 2MQPA 5J2MB 2DR9A 1HL6A 3P45B 2YWFA 3FNNA 4IR9A 5AT1B 4E98A 1UEVA 3EUNA 3GJSB 2GCFA 3CDAA 2LA6A 2VASA 2CPHA 2PA8D 2VFVA 2HFVA 4ZDNA 3SV4A 1U1OA 4N41A 1RLDA 1TFYA 2IC3A 2KHCA 3V81A 4N76A 1RT2B 4C9DA 1TU0B 3DDNA 5A2QY 2ZH9A 4A8KA 2DR7A 2F4VJ 2RVJA 4CLPA 2I38A 4AQYF 2YNIB 2KRBA 3SCKE 2R8IA 5ETSA 3B8HA 4I56A 3PW0A 2YKMB 4IFYA 2B5JA 1EIYB 2HHSA 2M70A 1Z2ZA 2YY3A 4LBHA 1Q79A 1T9XA 3CULA 2XZWA 5ETKA 3VAMA 4DS4A 1RU2A 2H65B 3EJMA 4NMLA 5IZHA 5F9LA 4M5IA 3I0SA 1IKWB 3MAQA 1HNIA 1NKEA 1DTTB 1Q7YT 3C6TA 3M8SA 1YWXA 3GV8B 3W7BA 4IG0A 2JJ4D 1C0UB 2L9DA 1M0SA 3D3CJ 3P96A 2XMMA 3CCWA 4NXMF 4TLRA 3G8TA 1NPRA 1VQNS 2R7SA 3DU6A 1YRTA 3J7A1 1CQNA 2FVQA 2B7CB 5FLXU 4IO9Q 1AB8A 1UFKA 3OUYA 3ETMA 3I96A 1K44A 2B4VA 2DEJA 2FHMA 1L3UA 4NLPA 2IA6A 5J2QA 4YOEA 1ZBTA 1Y3JA 2C3MA 4QPTA 5F8MA 2BJ3A 4RZRA 3UNYA 2GGPB 4CCHA 2W7AA 3ZXWA 5KG2A 2DKOB 3AD7C 3KLFB 4BS2A 7FD1A 1RWWB 2LQJA 3IR7B 3H0PA 3ITHA 3F73A 2C3UA 1RT6A 4C3LA 4ZK7M 1OIAA 2HHPA 2YH1A 1RAHB 2N4DA 2OSQA 4FKXA 3OVBA 1HHQA 1NK0A 3LWMA 2ILZA 4DPTA 4X4VA 2QG9B 4AUKA 4NRTA 5M2RA 3OL8A 2QLJB 2HIYA 3PO5A 4LF5J 1BQXA 1BQNB 3MPYA 2CQ4A 4HACB 4EU0A 4ZLLA 3OJSA 1HNVA 3QQCD 1JLQB 4PQUA 3GG1A 3CF5Q 4ZIVA 4DSIA 4DSJA 4ECRA 4ZJOA 4C8LA 2B4OA 3PYFA 3HJVA 2UP1A 2YKQA 3C6UA 5EGYA 1U8WA 2NPFA 1SQEA 1V9OA 4EBDA 5GAEI 2KKHA 4JI5F 2X1GA 3GONA 3R5GA 1MN7A 2F1FA 1Z1ZA 4DR5J 4ECUA 1HBNA 2XHCA 1TAUA 2FVRA 3T5HA 4RW6B 2BBEA 3KHRA 2M8HA 1F9EB 2CG8A 3LH2S 3G4SS 2M9KA 2XMJA 3A12A 1M5PC 3D4JA 2BUNA 2LDYA 3PCOB 3JAMY 1RT5A 2D41A 3NGRA 2GAGC 3K5OA 3R7BB 4NA2A 2KXFA 1JK9B 3U1MA 2EI5A 2W4CA 3IN5A 5T41A 2MKKA 3BYPA 1RQ0A 1U1NA 3DMJB 1X9SA 4O3OA 4K4XA 1NHUA 1EP4A 2EKNA 3M8PB 2CXEA 2GVZB 2VDIA 5DQIA 4IOAQ 1FJ7A 4TU9A 1G6BA 4NWBA 1JKHA 4MYUA 3CD6S 1SQFA 5C2GA 2ASJA 4IR1A 2J0SD 4DQRA 1LW0A 1LXJA 2LXFA 4ELTA 2BJ9A 4DPOA 3AB4B 5LMUJ 3KMSA 4ILMA 1N6QB 4OLPA 1HWJA 1WC1A 2O5DA 2MJNA 2RT3A 4KE5A 4JI8F 1KEKA 1FX4A 2NSCA 4KY3A 3DOKA 3JTNA 4E8UA 1ZZNA 3CTRA 1NH7A 1RA7A 2Y1JA 3CCJS 2K7KA 3CIMA 4ZCIA 3KLHB 5J2MA 2M52A 3M1VA 4X66F 1N34F 1RAGB 3C16B 1BWEA 2AZ1A 2HQDA 3LGMA 4DLGA 4YR3A 3E51A 2R8HA 1Z2LA 1RWOB 2FJBB 2U2FA 1HPZB 2V50A 5IV3A 2VOOA 4LFCF 3DLKA 3OQ2A 3KJNB 1S9EB 1M1HA 1U2RA 3I6PA 2MZQA 1S4FA 3P5BP 4WXOA 2DY1A 1D1UA 3WX4A 4FKYA 1PAUB 1RACB 2H9ZA 2LXIA 2BW2A 2I5JB 3LALA 2B8QA 1DLOB 3S7RA 3DLLQ 4B9MA 1NXIA 1UPPA 2OPPB 2JLEA 5B0FA 2MXYA 5HMYA 4ZKAA 4LRBA 1H7XA 1B4SA 4X62F 1TK0A 5ITHA 4A8MP 3NOCA 1MNEA 2B0GA 2AX1A 3BSCA 2IPOB 5KFWA 1GXUA 4FF1A 5KG1A 4DSFA 4B3OA 1G4CA 2PA3A 4IYQA 3VVUA 5AE2A 2XY6A 2OTLS 4JI5J 1D09B 5GADI 4FBUA 3UNGC 4JI2F 5T7LB 3FSYA 3B6BA 1WHXA 4QWCA 2DNLA 1SUQB 3WC0A 4OX6A 5L1KA 2FLPA 4IRKA 3OL9A 2H54B 2HNDB 3NBPB 2G9OA 2HQIA 3D0GE 5CZVA 5IV4A 4OZ1A 2V2VA 2VBWA 3TJAA 4DV5J 2BKNA 3TJ8A 2KVQE 3M2RA 1Q8BA 3KFWX 3L95X 2YNFB 4M5GA 4WIQA 3H8YA 1ROFA 1BQMA 2X1BA 4V1Ak 1TMJA 4WE1B 3T1YJ 4JI7F 3D2WA 1HNXF 1EJ7L 3CDWA 1R8AA 1GMWA 1PC5A 1CS4B 4B3RF 2UXDJ 3OL6A 2F4FA 4DV2J 4RNFA 3LA0A 4IQXA 1RP5A 3DLEB 1YQHA 4WKRA 1HARA 4F0MA 2DH7A 1KHVA 4DS5A 3TVYA 3OTOF 4ATNA 4MMOA 4RPFA 1JLBA 1U6BA 2E29A 1Y11A 3HCXA 1U6FA 5JUMA 3DOMA 2KFNA 1U2FA 4KFBB 1Y10A 3OR1B 2PC6A 2CDQA 3IBCB 2FJEB 2PO4A 1KTVA 2LA4A 1FRHA 1EP4B 4PXBA 2N7YA 2R4FA 1JNZB 2ZZTA 4R0JA 1RTZA 2P6SA 3EVWA 4QIGA 2HZVA 2UXCF 3QRPA 5AXKA 1LWXA 3G82A 4KHPF 1PC4A 2QFIA 1OY9A 1XTZA 1R0BG 1MWYA 4WU3A 1KRPA 2CJKA 1WI6A 2R7QA 2W7PA 4K4ZA 3OTCA 2CQGA 3CWJA 3MOZA 4NE9C 4A46A 4C3KA 1XR5A 5DDRC 1QJHA 2O3DA 1HI0P 3VVTA 1U8SA 4UW2A 2XZTB 4F4WA 1QSSA 4L75A 3BYRA 2AYBA 2KZZA 3ULHA 3OR1A 5GMKa 4TNOA 2QL9B 2RJZA 5A0YB 3KUGA 1R6YA 3KNAA 1FNMA 3C6UB 3AJ1A 2MTLA 3ONQA 4K4WA 3CJ8A 3TW0A 2GIRA 3C66A 1RLCL 3LQVA 2QLXA 3E8OA 4OZ5A 2CJQA 2DGUA 1H72C 2G0CA 2PDAA 4DI6A 1J2VA 3K89A 4HACA 3SSSA 3DLEA 3MECA 3GSIA 1JJ2R 3CJ5A 4DZDA 4IOBA 2Q43A 2ZE2B 2WVEA 2EBEA 1NK9A 4WXWA 2AJ1A 2VZ9A 1TL7B 4OHWA 3IMQJ 4A8OA 4CLWA 4YB1P 1MWQA 1HYSB 1UMJA 3WIUA 3HFKA 5L39A 3A1YG 6FDRA 4HL9A 2CQPA 4QW9A 4PYAA 1YI2S 1B0VA 2AP6A 2HIQA 2O67A 3D9BA 3JSYA 3M8QA 4RNHA 3AQPA 4AYBD 1S10A 1NDLA 4FXWA 3SBMA 4R5PB 4XIUA 2AGPA 3JAMU 2C42A 3HFVA 2JLFA 2ASDA 4ZVRB 4WP8A 1QVFR 4DR6J 2DBBA 3MCMA
chains in the Genus database with same CATH topology
2HPUA 2YKNA 1WI8A 2WHOA 3JYTB 3OVSA 2DNYA 1R8PA 5K8OA 2ZH8A 2B51A 4DV7F 2KM8B 1VQSA 2OH2A 3DOLA 5K14A 1U1PA 3K58A 3TAQA 5KFRA 5HMWA 4JUZA 4FXDA 4DN9A 1FCAA 2BRLA 1S1UB 1IQZA 2FJDB 5LMNF 3VAHA 4CQ1A 4O44A 3CCQS 5DG7A 4UY8T 3DLKB 1JLAB 4YMEA 2CPDA 2C22A 1S7HA 2YNIA 2BANA 4MFBB 4J9RA 1KSPA 2Q66A 1R8CA 3HJFA 2F8HA 4KFBA 5GAEU 2BQRA 1DARA 5FJ4A 1HHSA 1X4HA 2CPJA 3DXSX 3QZ8A 4OHVA 4K4XA 2DCLA 2ZD1A 4I68A 3MI7X 3IR6B 2ABYA 4FVMA 4ZCMA 3MR2A 3G71S 4DV6F 3D0HE 2FGOA 3MTJA 1SJRA 3LANA 3GFYA 2DNGA 3JSMA 1N36F 3SV3A 2E5LF 1SL0A 4TYBA 5J2NA 4NLTA 2CQ3A 2J7WA 1O5JA 2BQ3A 1FKPA 4TXSA 1IKXA 4I67A 3ZZPA 3OSPA 1TFWA 3GMGA 3NCRA 2KB2A 2A10A 3G86A 4C4WA 1IKVB 4Y00A 4LF7F 3GSDA 2IRYA 3D5MA 2N4CA 1FVQA 1S1UA 1NHVA 2QMXA 1R3NA 2Z8QA 3O3LA 1KQFB 3OSNA 4QIWD 5CYQA 2MSTA 3T5JA 4C97A 4O3SA 1RDRA 1LWEB 3FMBA 3UFCX 1B7FA 3X1LB 4MIAA 5DLFA 2E7XA 3W2VB 4NLWA 3NS6A 4WYWA 1XNRF 4ECWA 5IM0A 1KOOA 4B3TF 5BR8F 2WSEC 1FKOA 2D7SA 3M30B 5F3ZA 3AA9A 1KONA 2FHJA 2VFSA 4KT0C 2K7JA 2V4RA 1V6HA 4PQUB 4HTJA 2DO0A 3JSBA 4NLQA 1OPIA 2LKZA 3BF4A 3HLUA 4DUZF 3ZZYA 1QE1B 4DFJA 2D3OR 1U1RA 2DNNA 2C3PA 4DDFA 1SKRA 3RB4A 5FIIA 5J2NB 4W92B 3ZFVA 4JV0A 3B82A 2CPXA 3R27A 3D1OA 2ERRA 5KT6A 2K1RA 2UUCF 3L3CA 1YGYA 3RR7A 4BC9A 4NCAA 2CIMA 2YH0A 4OI4A 3IRWP 1LW2B 4MK9A 1SJQA 5KFEA 1SI9A 1B0PA 5FD1A 3U1LA 5AJ3F 2D3UA 3GFHA 3CDBA 2XEXA 1SH2A 1J5EF 5SZTA 3MTKA 5AXNA 2NXUA 4Z37A 1RT1B 5LJ5Y 4R8UB 3MM8B 2RRAA 3BO2A 3D1QA 3ENWA 1LWEA 4RNOA 2VG5B 1APSA 4ECXA 5KFFA 2GO8A 4B9VA 1CG2A 3MURP 4PWUA 2R7OA 1JXEA 1Y5IB 4X4NA 4J9QA 2RQCA 2W9BB 4J9MA 4YR0A 2IAJA 1T8EA 4LIRA 1DQ9A 1FHTA 3TVKA 3DCAA 2IJFA 4FVCA 5A8KA 2GX8A 2ZH7A 3RAXA 3RRGA 3EXYA 4MH8A 2IRXA 4HEA9 1HNVB 4URSA 1YJUA 4TQSA 3M8QB 2FLNA 1R7IA 1SJ3P 3PW2A 2XO7A 1M90T 4ERDA 5C25A 3IAM9 3M2VA 3QWPA 4MYTA 2LQ5A 1B64A 2R7VA 4KIAA 2LU1A 3BR9A 3LGNA 3KG4A 3HHLD 3DRSA 4F67A 3LP0A 2ZE2A 4MFBA 4NLSA 1QM9A 3OHAA 1NJYA 4HI1A 3KK2A 1JLAA 4PPDA 4ES2A 2EKYA 5KFNA 2ZVSA 5CYJA 4NLYA 4ETXA 3KLVA 2B4UA 2VODA 4ED6A 3M30A 1R43A 1R0AA 1JNRB 4DV0F 5HP1B 3KHGA 1TK0A 4JI3F 4NZ7A 2FC8A 3I0RB 2QMWA 3K5MA 2JX2A 5LJ3Y 1SKWA 3H4BA 2HAIA 2PMZD 1H38A 2UVUA 3CDUA 4NCGA 3OPKA 2YWKA 4DV3F 1AROP 5CYQB 2IYGA 2P9CA 1UVNA 1DLOA 2ZHOA 1TUVA 4QJVA 1S76D 2KVIA 2M5YA 2NUUG 3PM9A 5IFMA 2ZHBA 3OR2A 1WEYA 1EETB 4R5PA 1KFSA 3H98A 5HN0A 4FF3A 4UUWA 4ES1A 2QO3A 1CLFA 4PG5A 2PIIA 2YVSA 3DRSB 4KO0A 1YJWS 2ZKUA 1P9QC 1UKUA 1CQMA 3IS9A 1P6TA 1XMBA 4A8FA 4NYPA 4ZPBA 3GIIA 3KLGA 4V19J 2LEAA 1GXLA 1REVA 2YWHA 3DC2A 4ILLA 1RT4B 3K8WA 3HHEA 3MPWA 3KLHA 1N54B 3H20A 2QV6A 4FP9A 4FZVA 4NLDA 4DWIA 1HBMB 2KG0A 1IN0A 4UQTA 4DHVA 5H1SV 3DLHA 5KFJA 2W8KA 4J37A 2ZH2A 4IFVA 3SI8A 3VR1A 4WE1A 2UXBF 3MM6A 1CPZA 2MZJA 1JKHB 4DL0C 3THTA 2E7WA 2GQCA 1M5OC 2VKRA 4A8XA 2LEPA 4MKBA 1L3KA 2KHDA 3NBPA 4O44B 2JFKA 3HP6A 2ZOFA 2AYMA 3BO3A 2FUG9 4QU7A 2RDIA 1AW0A 1HMVB 3EXCX 4NLOA 2EVZA 5L9NA 1MU2B 3JTOA 1ZYQA 3UDLA 4LVOP 4MJKA 2BOPA 3TQ1A 3WC2A 2XGQA 2CJAA 1ZH5A 2RSQA 5BYQA 1JLBB 2IM0A 4EUVA 4L72B 4K4YA 2PGCA 3RRKA 2BABA 1TR0A 3O5TB 3QIPB 3OTEA 1LW2A 2O1PA 4WYLA 5DLGA 2PI5A 2W4PA 4Q5VA 2J6TA 3PY8A 2DIUA 2Q79A 1Q78A 2VH7A 2I0XA 4KGMA 1S77D 1BY9A 2CFXA 5THWA 2FJXA 2Z2LA 3BSAA 3BDEA 3OBIA 3BDPA 3OFGA 4JI6F 2F8EX 1FTRA 1HWIA 2YKAA 2GQQA 3IWLA 1QE1A 2K3KA 3GWCA 3PHEA 4HT7A 4X2BA 4DV1F 2ZH1A 3HX9A 5A6WA 3TP2A 4J9PA 3HHLA 4F3OA 1FRIA 2MY7A 3DOKB 3BEGB 3G8QA 4QPXA 1Y9OA 5B0DA 3BGLA 4PKDB 2XMKA 3J80Y 1YJRA 5CCMA 4QIEA 1MWZA 1T03B 2BM1A 1TVRB 2FGCA 1Q81T 3KHHA 3UWTA 5IXUA 1NJXA 4B3OB 4LMZA 4M63A 3EZUA 5E3AA 3HK2A 1NK7A 4FNHA 2UVRA 2RNEA 3C6TB 2IM1A 1FNOA 1DTTA 2VG6B 3H2VE 1FXDA 2CPFA 2XWYA 3QZ7A 2M7SA 2WOMB 1X4FA 4ZMMA 2HHUA 3NP5A 3CD0A 4OHZA 5HMZA 4OZNA 2FLLA 2V8VA 3CJKA 3MM9B 4I6AA 3DLBA 1HD1A 2RILA 2X51A 3J7ZT 4RLEA 3C3LA 3HHLC 1R27B 3UD3P 2VONA 1JLFA 1WF2A 4ED0A 2IC3B 3PR5B 3BO4A 1UEUA 3JSMB 4DFKA 3U27A 2Y0SD 4Z2XA 3KMQA 2VPXB 1XWLA 1L5UA 1FNXH 4ECQA 1DTQA 2HFOA 4WK1A 2XNQA 4F4ZA 3HF5A 5B0CA 3HHDA 3CMES 2NYIA 4G6VB 4ID5A 2R2RA 2Q6BA 5EDWA 2B9YA 5KFBA 1DAXA 2MPUA 3LP1A 2JHEA 2OJ3A 1VQ9S 2ZFHA 4QR1A 3O2IA 3BGFA 5M2PA 3M2RB 4CO2A 3AA8A 3DU5A 2GO9A 2B7BB 3MCSA 2DNRA 3DMJA 5DGBA 1HW8A 3BM7A 3DM2A 1C2PA 2B6AB 3C8YA 3BQ2A 1QLNA 4NL5A 3OUYB 1U4BA 3PO4A 4DQIA 2IRUA 5IT9Y 2V9KA 1Y0HA 1GT8A 4OX8A 4TQRA 1JJ4A 2I1RA 1GX5A 2XWXA 3M6XA 4R25A 4OHXA 4CZCA 1NK4A 3D28A 4B3SF 2MB0B 2MKSA 3IWXA 5DDQC 1RJJA 3FSXA 1H0HB 4N77A 1N52B 5ADZA 5L38A 1I94F 4E0DA 5GAGU 1OSCA 3N9UC 1U45A 1VBXA 3DRPB 1TVRA 5EN1A 3UCUP 2GJ2A 4QW8A 3CXCR 1URRA 5J2PB 1IKWA 1O51A 3H5XA 1S6OA 5DGAA 2A1BA 1S1TA 3CCRS 3CJ4A 4WFXA 3PX6A 1NKBA 2XI2A 3GG0A 5F9NA 1XC9A 3I56S 3HHLB 1S1VA 1WNEA 2DR8A 2YKMA 4X4OA 4H4KC 5B0BA 1VK3A 1IKXB 3BN7A 3LP0B 4F02A 3LP1B 1Q82T 3CPWR 4Q8EA 2IMWP 4KHRA 2ZBIA 3I31A 1SIWB 5E3CA 4DL2A 1FKAF 1TL3A 2OPRA 4OQJA 4HLBA 4PG7A 1VQ8S 1Q4RA 2OD6A 4QCLA 1PILA 2IVYA 1BGXT 5EWFA 2BYCA 2AJFE 4QIFA 3UCZP 3J7Z5 2ZD1B 2XC9A 3SYZA 2FTRA 3S1TA 4QQBA 1S97A 2CPZA 2BZ2A 1G2EA 2QE5A 1S0OA 2MHNA 4TY8B 2J0QD 4GKJF 2BA9A 2BRKA 3RU0A 1IBKF 1FJCA 4DQPA 5IM0B 1Y5LB 2WK4A 5CH7B 1X0PA 2BANB 3NCPA 3PDNA 3CJKB 5KFLA 3O44A 3M8PA 1QAIA 1N33F 2QLWA 2YX4A 1RTHA 3ZZOA 3V4MA 1KD1T 2IMOA 3LAMA 3WZ0A 5GADU 1HNIB 3IC1A 3UQSA 3V4IA 3WDOA 4EBCA 1YJVA 1RT7B 1QAYA 2J9CA 2VG6A 1WEZA 1XERA 4WK3A 1YRUA 3ZZ0A 3D0IE 2E9TA 3V6DB 2CQ0A 4IFYB 2EFNA 4LF4F 3VF0B 4YEAA 5I3PA 4ECSA 2L3MA 2UUAF 4IQMA 4C98A 1S48A 1FKPB 4X4RA 3MAHA 4IH6A 1BLUA 1N0UA 3FJ2A 2C3YA 4C2MA 1FO1A 4RKUC 1ZOTA 3NGKA 3Q8QB 2N3LA 3CJ0A 3POTA 3I5AA 2MKJA 4EZ6A 2KI2A 5A6PA 3RR8A 1FD8A 1U49A 1UJ6A 2D1CA 4C7QA 2RU3A 2LYVA 1K1QA 4V19X 3CDEA 5DQGA 3IGVA 2ZH5A 5BJRA 4M8LA 5C24A 4DG1B 3KLGB 3MDFA 1NK8A 4NYOA 2OFHX 5KG0A 3CIZA 4KB7A 3PV8A 4C8OA 2FB0A 1YJNS 3QLHB 3K57A 3ITHB 3G6XA 4GC7A 2ZH3A 1FVSA 2XMWA 5M2UA 1D0EA 4F2RA 3I9ZA 1LK5A 1FJGF 2B56A 4WFZA 1NU4A 4QWBA 1JLEA 5KT7A 4HH1A 2R8KA 2R8JA 3DFEA 1HQUA 4QWAA 2P9EA 4GO5X 2QEXS 1OQ3A 1D8ZA 2ZDOA 4NCGB 3Q23A 3SEOA 1VQPS 4JV5F 3CO9A 2LXUA 1TV6B 1ZM9A 2BJEA 2M88A 1LWFB 3NNHA 4KC5A 2L9NA 4CO4A 2CZVC 1S49A 2RQMA 2WB1D 2DGWA 4O3RA 3D1HA 4B08A 4U7UK 4NLXA 2W8LA 1M5KC 3GR1A 2KG1A 3DNCA 3BJYA 4OLOA 3H2UB 2MKCA 3DRYA 1UFLA 1VK8A 1HPZA 2B3TB 4M95A 3OV7A 4ECTA 4A8SA 3MM6B 2GHVC 5CHCB 3GV7B 4C3MA 4LUBA 4XPCA 4I69A 3US5A 1SJ1A 3MEGA 4XDCA 1IUJA 4IFVB 3PKYA 1XR7A 2ZM6F 3CCVS 5D77A 1HBMA 2UV8G 1TKDA 2DHSA 4C8KA 3EYZA 1IJEB 4ECZA 4OJ1A 1YG0A 2IBKA 2ZH6A 2N82B 2NPIA 3W2WA 4ED1A 4QWEA 1JLFB 1N5VA 3IS9B 3TAMB 1FERA 1SL2A 2XSJB 2QA4G 4C8MA 2YX7A 4LQ3A 4K0KF 3JSRA 4DX8H 4PRFA 4OX7A 2F9DA 1FDDA 4KQZA 4OI6A 1VBYA 1AXQA 4C8ZA 4C8YA 1FF2A 2HNDA 1MMDA 3BREA 3MR3A 4ES3A 4ZOSA 5CYMB 1RT3A 2W9CA 4Q2LA 2E1RA 1N5QA 2VA2A 4RW6A 4OL8A 1PO6A 4MKAA 2BM0A 1IBMF 1NJIT 5CD4H 2XHWA 3H25A 4R8UA 1NO8A 4K5SA 1VQMS 3EGZA 2OPPA 3MEKA 4OJHA 4M94A 5E5NA 2AD9A 2I5JA 2ZDPA 1ZAXA 2FC9A 5LT5A 3PIPQ 4EZ9A 1ULRA 2RE1A 3EZ5A 3CB4A 4F25A 2J9EA 4QYRA 1BQNA 3Q8PB 1H2UX 2R2UA 5JVHQ 1BD6A 4B3MF 5E7OB 5K8MA 3CCMS 5CQGA 5DG8A 2HHXA 5AXLA 5E2QA 3CCTA 3FFIB 2GHWA 3TAPA 3NNCA