1LQ9A

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor strain a3(2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ACTVA-ORF6 MONOOXYGENASE
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 27
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lq9A00
3MCSA 1FVQA 1APSA 1GXUA 2LDIA 2OD6A 2QIFA 2XMMA 3I9ZA 3LO3A 3CJKA 3WDOA 1YJUA 2BYCA 3GZ7A 4A46A 2OD4A 3HDSA 1Q8LA 1JK9B 1YG0A 4DL0C 2ASYA 1YJVA 2W4PA 4DN9A 2OKQA 1FVSA 4Y2IA 1S6UA 3BB5A 2XMVA 2HLTA 1W2IA 2OFGX 1TL5A 2HQIA 1SQEA 5B0CA 1CC7A 2JDJA 2XMTA 1N5SA 2XMUA 2CRLA 4EFAC 4Q2LA 1N5TA 2W4DA 3F44A 1VQYA 4DPOA 3HHLC 2ROPA 2HLUA 5B0GA 3FRYA 1FE4A 4OJGA 1SB6A 2L3MA 1CC8A 1LQ9A 1TUVA 5B08A 2BBEA 3KG0A 2IFXA 2LQ9A 2FB0A 2FIUA 4NL5A 4QOTA 2EW9A 1OQ3A 1Q53A 3CJKB 2AP6A 2VV5A 2OMOA 2HIQA 1X7VA 1YRXA 3HX9A 3QMQA 4A4JA 2GFFA 2ACYA 4A47A 1XBWA 2PGCA 2PD1A 2XMJA 2HFNA 2FTRA 2K2PA 3LGNA 1YJRA 3BM7A 1URRA 4U9RA 4Y2KA 1AW0A 1S6OA 3KNGA 3QGPA 4HL9A 5IXUA 1Q8BA 2K7KA 2LQBA 2Q3PA 2RILA 2AJ0A 4YDXA 4OJ3A 1Y3KA 4FNHA 1OPZA 2GV1A 2KT3A 1KVIA 1FE0A 3DCAA 2OFHX 2KT2A 2ZDOA 2BJEA 4YEAA 2N4CA 5F0UA 4Q2MA 1N5QA 1QUPA 2K7JA 2QLXA 5A6WA 5B0AA 2GO8A 2K1RA 2W4CA 2K1RB 4HI2A 5T7LA 3KG1A 3BGUA 5T7LB 4A48A 2GGPA 5B0DA 4ZOSA 3BF4A 2RMLA 2ZDPA 1KQKA 3BDEA 1FESA 4Y2MA 2RU9A 3HHLD 4HH1A 3TRGA 2N4DA 1AFIA 1RJJA 2N7YA 3DXSX 5F0WA 1R6YA 2AW0A 3IWXA 3KKFA 2HFOA 2ROEA 4OIXA 2KKHA 1ULRA 3TNVA 1Y9OA 3HF5A 3MZIA 4OJ1A 2ROGA 5B0FA 5A6PA 3K7RA 4HI1A 5B0EA 3VTIA 2OAUA 3HFKA 4FNIA 1SI9A 5B09A 2FHMA 1OSDA 4F67A 1GXTA 1AFJA 3LGMA 2BUNA 1CPZA 2XMKA 3TOQA 2RSQA 1Q4RA 5B0BA 1X8DA 1VQSA 5KAKA 1TZ0A 3UDCA 3IWLA 2GCFA 2QYCA 1V3ZA 4NPOA 1K0VA 3FGVA 3BR8A 1X0PA 2G9OA 1P6TA 2LXFA 1WD6A 2GA7A 2VH7A 1IUJA 1YJTA 1MWYA 3HHLA 1Y3JA 3HHLB 4ZA1A 4OJHA 1OQ6A 2GGPB 2QLWA 3T9NA 1U7LA 2IYIA 2KYZA 1TL4A 2AJ1A 1TR0A 1FEEA 1Y0HA 2IYGA 1P8GA 1N5VA 3FMBA 1MWZA 5K9FA 1KVJA 3BN7A 1JWWA 4HH0A 1FD8A 2OP5A 2XMWA 3E8OA 2BJDA
chains in the Genus database with same CATH superfamily
3PX0A 5D6GA 4DV7J 4ECVA 3S6EA 1V5VA 1UETA 2SXLA 1WELA 4ZVEA 1NZ8A 5E3AA 5D77A 4LF9F 1SVDA 4Q7AA 1A0OB 2BDPA 4RNOA 1RWPB 4WFZA 2CAJA 2DVIA 5ETVA 2RVJA 5F41A 2F4VJ 3PJ9A 3BO4A 1JLBA 1Q16B 4V19X 3PEJA 4J9OA 3DMJA 1YBTA 2OJ3A 5CZVA 4DL7A 1FDNA 1XR5A 3L7UA 3W2WA 4NXMJ 4GRSA 2QYGA 1RAIB 3R5JB 4ID5A 1JJ4A 5K8PA 2YVSA 5DZ6A 3HLUA 4HDHA 4LQ9A 1ZOTA 3CDWA 1T94A 4DV6J 2F7VA 1HNIB 4DN0A 1SKUB 2KG0A 3E8OA 1F6TA 5KG0A 5A8WB 5BJRA 4J7CA 1U1LA 3OSPA 2ZITA 5A8KB 3O1LA 1WI6A 1BC6A 1R31A 2XMVA 2HQGA 3R5CA 1FDBA 2DEIA 5LJ5Y 3L95X 3BSAA 4CRJA 3W65A 5GAEU 1UPPA 5LOQA 3GG1A 1R0CB 1SL1A 2HQCA 2QMWA 1WHYA 2KN4A 2M0GB 3IMQJ 3KNAA 2D9PA 3LGNA 4DX6A 4U9RA 2FVQA 5HL7Q 5GMEA 4UZBA 2JZ5A 2XLIA 3MWBA 1CJTA 2UUTA 4K4TA 2BOAA 1N5YA 2P5VA 1GQEA 3X3UA 9ATCB 3EX7B 4LSLA 4LBIA 4EWTA 1J5EJ 4DV4F 3ZZUA 4B3OB 2EWHA 3L9ZA 2R8HA 2WOMB 2MLXA 2LA6A 2B5JA 3WX8A 5G0RB 5EWGA 2W9CA 3PW0A 1WF0A 3KK3A 1MN9A 4OYPA 3FGVA 3Q22A 1Y5IB 2WZ1A 2IA6A 1NM2A 4CM2A 1S9EA 4YUDA 3M8RA 2AKWB 1LFPA 2P2CB 3DU5A 4JI3J 2MPUA 3ETOA 2BKOA 4PEOA 1VQMS 5C24A 2BE2A 3EGVA 2IM0A 2HWTA 5JVHQ 1Q7YT 4NLPA 2RQ4A 3PY8A 3PDNA 2AF6A 4BDPA 2J8SA 4EFAC 2V8VA 4ES3A 2EI5A 4GC6A 2AX0A 3KLHA 1NHUA 4LF1A 4DUTA 4TU8A 2M70A 2HRUA 4M5KA 3CD0A 1L3SA 3RU0A 3FSYA 4LF2A 2IVYA 1PIEA 1BXNA 2LDYA 4RPFA 2F9DA 1M1KT 2CWKA 2BQUA 2J6TA 5AT1B 3I96A 3KG1A 2CA9A 2WB1D 3H40A 4FYDA 5BR8F 2VB6A 3GIKA 3QRQA 4DV5J 3KJVA 5ETRA 5B0EA 2J9CA 1FFGB 2PFDA 4ECXA 5IT0A 4U7UD 4F3MA 4USUA 2FUG9 1UEVA 2J9DA 4OX6A 1CULB 2CQPA 3D1OA 1U1PA 2EC0A 1JIHA 1TUWA 4PPDA 2C2RA 4FPIA 4JI6F 1K1SA 4DMZA 1RBAA 2I1RA 4ILMA 2FJDB 1RWUA 3OR1B 5J1NA 3I56S 3POTB 3GQCA 4PR6A 2D3OR 3TX0A 5IM0B 4MJKA 1IQTA 3NBPA 2Y0SD 2VJUA 4R25A 5CHCB 3PM9A 3H5UA 1JLEB 2UU9J 3CW2C 2PD1A 4CT9A 1HYSA 1AYEA 3D1HA 2RU3A 1YJRA 5J2QA 1KLMA 1UEUA 3O2IA 5IWAJ 1U45A 4LIRA 4KH0B 1U8SA 2RRBA 5KFUA 2I2YA 2DHSA 3M8ZA 1VC0A 4DLEA 2ZJPQ 3W7BA 3QSYB 1JJHA 4LRDA 2QE5A 4J37A 2UUCF 2B4VA 3HJVA 2AEMA 1RTHB 4OJ1A 1VBXA 1KR4A 1CVJA 1P1LA 3VQSA 4FZVA 1TAQA 1ZPWX 3MMBB 3BR9A 1K0VA 4Q44A 5L1JA 2HG4A 1X60A 3UVJA 1RWMB 1FEEA 1R7IA 2A6OA 4LRFA 3PRVA 5DDPC 1QVFR 3VHQA 1S49A 2DR5A 3C3LA 4WE1B 2HZCA 5I42B 4X62F 2IRXA 2W2NP 2VPWB 3C14A 4URSA 3OTDA 4HTJA 1FJGF 1O5JA 4QZVB 3CCWA 2HK2A 2Y1RI 5JJBA 2QN6B 1I94J 2VG5B 2ZNZA 1DTTB 1Q81T 1S1WA 2NSBA 3KG0A 1K8AT 1DBDA 4X66J 3KHRA 2QO3A 2VUGA 2ZBCA 2CPHA 1ZAVA 4OZ0A 1IKYB 3DLBA 4LUBA 3CO9A 3HD2A 2X7IA 3E01B 4DI6A 1FRJA 2V4QA 2L9DA 3GCXP 2QG9B 2VPYB 3ELHA 1RTDB 3HO1A 3TRGA 4IR1A 3NNCA 1D9AA 1FJCA 3CCSS 2I6WA 3EDRB 1NHVA 1PKUA 1IBLF 2ALYB 2QX0A 1WD6A 2IYIA 5GADI 3OXFA 1RKIA 4GVBA 5K9FA 4HH0A 3EPIA 3Q2SC 3M8QB 2RDJA 4FS1A 4RW6B 4OI2A 4AL6A 3H4BA 3IS9A 3NL0A 3OTOF 4OZ2A 1U2FA 2Z2LA 2MKSA 3OUYB 5A76A 1JMTA 3MM6A 3NXZA 2FLLA 2ROPA 4YR0A 3CNQP 3FSIA 4JI5J 4PWDB 1SJ3P 3D6MB 4DV1J 3RAXA 2XO7A 5T14A 2YNIB 4TYBA 1WACA 1C1BB 1IKWB 2BA9A 4AL7A 3NOCA 4V19J 1RXOB 1UAWA 4ERDA 3M30A 2AD9A 1EAYC 2N82B 1M1HA 1VQ9S 2V34A 4NLQA 1REGX 1HI1A 3KUEA 2YWKA 1UCNA 3MEGA 4NZ6A 1HI8A 2YKNA 3GJRB 2DXFA 3PRBA 5LSLA 3MI7X 2C2NA 3MCOA 5B0FA 2RDIA 4QIGA 2MKHA 4RW4B 4C48A 4CDIA 2VDIA 2CVIA 4N41A 3H59A 3ADAC 6AT1B 2HHQA 4F0HA 1RT5A 2HWHA 1UP1A 3PIPQ 2RUSA 2IYGA 2ZH3A 3HD1A 1CJKA 4K5SA 2NREA 4PQUA 1G2EA 3IM8A 1NDPA 1NKCA 1KFDA 2HQIA 5CH7B 5AXNA 2CFXA 3I5CA 3HT0A 2Z2ZA 3LP1A 1HPZB 3EJMA 4DXLA 1LQ9A 2FIUA 2EW9A 1E6YA 2F8EX 4Y2AA 3D0GE 2BQ3A 2A2DA 2ERRA 2GO9A 2CPDA 3QRPA 2RKIA 5KT5A 2BJ3A 5AE2A 1P9QC 2YH0A 4M5GA 5IQ6A 3PKMA 4DSEA 2XHWA 3ZTOA 3HVWA 3QT7A 2MZ1A 2YWWA 1X4HA 1PCAA 4DV2J 2LYVA 1S48A 4CLTA 2C2DA 3HFKA 1RACB 1MROB 3MDFA 3ZC4A 2UUAJ 1LWCA 2AHOB 1YJNS 2VC0A 3HHKA 3RAQA 1UWBB 4BHQA 4WFNQ 5EHHA 4IG3A 4P71A 1U6BA 1JJ2R 1X4EA 1Y5NB 3AAWB 4DN9A 1VCTA 1KHVA 2VOPA 1RAEB 2M3DA 3KK1B 3HHEA 1MMNA 4J91A 1RT1B 2ZM6J 1YJ9S 2HLUA 1NJXA 3WIVA 4C0BA 3LP0A 1TFYA 4ZHRA 2GW8A 1S1UA 4USWA 2CJYB 1ZETA 5A6WA 4DQPA 1T3NA 1D1UA 3KUGA 2DISA 4X4PA 3CMES 2RMLA 2ZNYA 1LXNA 1NK7A 2AYMA 4ZP6A 3RBXA 2MKKA 1JLBB 2DY9A 1PJ6A 5A8RB 1N33F 1TK5A 4XO0A 4CT8A 3KDOA 1QAIA 3ILOA 4IYQA 3M6XA 2B9YA 1IJFB 2DHGA 1NK9A 2RQKA 2QIFA 3UR0A 3JXOA 3KG4A 2ZKTA 1L3UA 2G0CA 4MIAA 2JRSA 5FD1A 4ID5B 1GNKA 2W4PA 1JLAB 4WP3A 4EBCA 5KFDA 5DG8A 3OV7A 3EUNA 5E0OA 2JDJA 2M52A 3PO5A 2M5YA 2XQCA 3BJYA 2C42A 2VBXA 2NXEA 2ZH8A 3IM9A 4C8ZA 4J9PA 4DR6J 2OMOA 1Y11A 1U25A 3W60A 1N34F 1FEHA 2J7WA 2CQDA 4LF7F 1LWEB 1SC6A 3GR0A 3DLJA 2KH9A 4IDKB 3OVSA 4A8YA 2OEMA 2I9SA 3Q8PB 1VMBA 3KLIA 1BWEA 3FSXA 1GH8A 1MW7A 3PW2A 2CJ9A 1T05A 4R0JA 1SC4B 4B9UA 3DRPB 4CLKA 2XZDB 4ZKAA 3PTWA 4DG1B 5KAKA 3TZZA 1FKPB 3RR7A 2BMBA 1Q5VA 4LSLB 4RW7B 3I5AA 5IT9Y 1NJYA 3BSOA 1RB0A 1U1RA 2DCUB 2HNZB 2BM0A 3F41A 2R7XA 4ZVOB 1FWPA 5DGBA 2B5JB 5CA5A 1DZ5A 2W9CB 4H4OA 2G1HA 3MEKA 3Q8SB 1Q8LA 3HM9A 5KG6A 3FEXB 4HT7A 5EWFA 2DHXA 1S9EB 4O4RA 2ZOMA 1S57A 5C42A 2A18A 2GMHA 3FUYA 5C24B 2BE2B 3T3FA 4NLXA 2FC9A 3HX9A 3MXHP 4H4KC 5F8NA 1O6XA 4Y2KA 4YS2A 3H8YA 1AW0A 4URGA 2ZOGA 2H54B 5E7OB 2HGLA 4CH7A 1MWQA 4LVOP 2QA4G 1VHFA 1DJ0A 4YY3F 1SCJB 2DY1A 3MPVA 3FQKA 5E3RA 4B3RF 3K5OA 1GXTA 1U02A 4NLUA 1X8DA 5EDWA 2DNPA 3KHHA 2QLWA 2XZTB 3N5FA 5FIIA 2OHDA 3B82A 1TL4A 4EK2A 3CULA 3PCOB 1RT3A 2IHR1 3CMAS 5D0EA 4ED5A 4C3LA 3N28A 4KFBA 1D9DA 2YPYA 4J9RA 3PJXA 3HDSA 4M5MA 1CEZA 3N6MA 3S01A 2HURA 3ENQA 3DLGA 3NLCA 4G1PA 1DLOB 2IBKA 4RUCA 3F44A 2YWGA 1RP5A 3D7SB 1SV5B 4KB7A 1QD1A 1BHNA 4O3PA 4AE5A 2D7SA 2UXBF 2BEFA 1PG5B 2FLOA 2H5EA 3J81Y 4W92B 3RBEA 1RTZA 3ETMA 4WTOB 1KOOA 1LFWA 2FLPA 5J1PA 5CD4A 3MF5A 2PE8A 3ZZRA 4S0MA 5BYQA 2HNYB 1PSDA 2F65A 4D3GA 1YTYA 2X1BA 4OYAA 4ZVHA 1HQUA 1HYSB 1S9GA 5J2QB 2VASA 3FVYA 5E41A 2CNKB 2QC3A 2HQDA 5LXRA 3MR7A 2NPFA 3H0PA 1RADB 1T8EA 1WG4A 2CPFA 4ITSA 1S0NA 4FXDA 4ZLNA 4MAKA 4F26A 1SH3A 3OJUA 4OX8A 2L9WA 4C11B 3UVJB 3DLKA 1TL5A 2O1PA 4YB6A 2W9BB 1X5TA 2CNOB 3UCUP 1VC5A 4CLWA 2MQOA 4YR2A 2KVIA 3MPYA 4IRKA 3S7RA 1TKZA 2E5LJ 4AT1B 2ZUAA 2EBEA 4RLEA 2KI2A 3GV5B 3CCJS 1S1WB 3DHWC 2K1RA 2MZJA 5I3UA 3BF4A 2WVFA 3THPA 4ZPBA 1FJ7A 1SQFA 2ROGA 5L8RC 1KS2A 4RUHA 2BUNA 5I4MA 2JLFA 2BQRA 2CQ4A 4J9MA 4ELTA 2JLGA 1SQGA 4RWWA 4DUZF 1MU2A 3V4IB 2Q79A 4NEYA 3CJKA 1EKSA 2IM2A 2ZC4A 1UVKA 3ZTQA 1OYDA 2V6AA 1U1KA 4MH8A 4JUZA 4UY8T 4ZCMA 2XEXA 1F2GA 4QWCA 2GVZA 2BJ9A 3FRYA 3VZHA 5HROB 2G2OA 3M2RA 1R0AA 3CF5Q 5HJYA 2B4PA 3IS9B 1NH8A 2EFPA 2FTRA 4QWBA 4IRDA 3OJSA 4K4SA 3TA0A 2NCKL 2VFTA 2NS1B 1HMVA 4FYYB 3MMAA 1OIAA 2RRNA 2I5JA 5KFCA 4DZDA 3KDNA 1NPPA 3W9JA 4ZOSA 2IM1A 3V6KA 1XC9A 1CJUA 5SZTA 2BXJA 4PPZA 4WFXA 3RZAA 2KKHA 4B3TJ 2V2ZA 3PKYA 1SJQA 5A6PA 2HHXA 3CXCR 5DZ7A 4P10A 4WJBA 2CNNB 4WKRA 4ANEA 2YKNB 1NKEA 1LNQA 3BN7A 4QW8A 5IS2A 4AD6A 2DGVA 4RW8B 5CYMA 1XK8A 4X65F 3G86A 1M0SA 1XMOJ 2AJFE 4B3MJ 1HFEL 3NCPA 4ZPTR 3V6DA 1TKXA 3NGSA 4PYAA 2GHVC 2ZJRQ 1CJKB 2W2MP 4PQUB 3G6VA 3CCQS 4TLQA 4F50A 4C4WA 3Q8UA 5CQGA 3UN2A 1IM4A 3DM2A 2CJKA 1NZAA 2CQBA 3LP1B 3D6FB 4DR1J 5C2GA 1HWIA 4X4TA 4DV3J 3CCES 4DV7F 1YZ6A 2WRMA 3HHLD 2L08A 3CSKA 4XAKA 1RTJA 2U2FA 4WU2A 4JYAF 3PX6A 2RDDA 1VQ6S 4P72A 5HLFA 3AHPA 4NRTA 1WOSA 3E51A 2M7SA 1U49A 2M2BA 1M5KC 2PDAA 1P8GA 4ZS6A 2F4VF 1M1GA 3D68A 6FDRA 2MKJA 2VDHA 3I9ZA 5HP1B 1LWCB 3DRRA 2P8IA 1RQ0A 2E66A 3W63A 1EETB 1TP7A 5B0CA 5KTQA 2XMTA 3C8YA 2XY5A 3HHLC 4NXMF 3RB3A 3BQ1A 4IG3B 2DNKA 4FKYA 4NYPA 4A4JA 2D69A 3ET6A 2IC3A 1N52B 3VWSA 3MHYA 4DV6F 4UF4A 4N5SA 2UP1A 3EGNA 4CO2A 2YH1A 5L1IA 4A48A 3M1VA 3N79A 4ZHRB 1S1UB 5KFEA 1X5OA 4FYXB 4DSLA 3NNHA 3LOUA 1XQIA 1FXDA 1S72S 3HPOA 4QWEA 5KFPA 1V5IB 1HR0J 4OFZA 5L38A 1YLXA 2XM3A 1RAAB 2CJQA 3W64A 1Y0HA 2EBGA 3ILJA 5ETLA 2AT1B 3J7YU 4Q5VA 1R8BA 3LGHA 3GLJA 4DZ6A 1NB7A 1PC5A 2GS8A 3DOLB 5H9FK 3W2VB 2R7WA 2BANA 2OPRA 4N56A 2FVSA 4MIBA 4HVZA 4K7QA 4Y2IA 4XTTA 4P7VA 1S79A 3M8PA 1O0PA 1J5EF 1W26A 1M90T 1DFDA 3VGSA 3N9UC 2Y0BB 3TZXA 3SDEA 1YJ7A 3HK2A 2HIQA 2AEFA 3GV8B 3R97A 4JI0J 4EZ9A 3UD3P 3MPUB 2ZKUA 5BXIA 2HSEB 2FJWA 1ZYQA 1FWKA 4JI3F 3FCVA 4M5JA 2WVDA 4DL4A 1WF2A 2ZOFA 3SYZA 2KVQE 3G2XA 5H9EJ 3LAMA 2PEHA 4EYHB 1FNMA 2JHEA 3TZWA 2C2MB 3P5BP 2GC8A 3NGTA 4DR3J 3J7Z5 1JNRB 3FZBA 3WC0A 2K3IA 5IC4B 4USVA 4Y2CA 3B4MA 3KLIB 1X0FA 1N5VA 4X4RA 5HMXA 1JJCB 3O5TB 5FDLA 4IQMA 2JFDA 1XR7A 4I7FB 4F4YA 5AXLA 3LQVA 3AB2B 3QJJA 4O3OA 3MAHA 2EVZA 3B6BA 3VQTA 4DV5F 2C3PA 3RJMB 3KJNB 2DK2A 4C8KA 4JI6J 2E5IA 4R8UB 1S6QA 1EB0A 3K89A 1G1XA 2R7OA 1HI0P 2L9NA 1YHQS 4EEYA 4OLOA 1D8ZA 4FXWA 2MLYA 5D3GA 1QVGR 1TK8A 3V2UC 4XK8C 5C42B 1IBMJ 3SXLA 2MY8A 5ADZA 2O01C 2GGPA 2JSXA 4R0EA 3TR5A 3ONQA 4CZCA 3N6LA 2VF3A 2ZUGA 3FFIA 2OTJS 4C6AA 2X3GA 4TXSA 4A8XA 1RAOA 2EC2A 1IUJA 2PC6A 1SC3B 4HDGA 2UU9F 5DDOC 4FP9A 1YJWS 4UW2A 3M2UB 4K4YA 1T0TV 2DGOA 3I55S 5IWAF 3LO3A 2NUHA 3IAM9 4TNOA 4YQWA 1AUSL 4P74A 5LSRA 2XLJA 1WDTA 1RT3B 1RHKB 3CUNA 3JS9A 5KT7A 3LA0A 2V63A 4CLFA 3N0VA 3ZTSA 5KFWA 1XBWA 5HVFA 2XMJA 1VBZA 4EUVA 3DLGB 3G8SA 3CCUS 4M94A 2K3KA 1BQNB 5KFVA 1SL2A 2QLXA 5I3QA 4WIQA 3GJSB 1JLGB 2O66A 3GONA 3MUTP 4DFMA 1FT8A 4NA2A 3QLHA 2J7UA 3C6UA 4A8FA 2KL8A 2NXJA 1I94F 2HVHA 4JB8B 2YXLA 3W8PA 2MDAA 3TW0A 2H48B 2J9DE 1U26A 4X66F 2ZH9A 4RKUC 1S9GB 2AJ4A 2XMWA 1CLFA 5HATA 1VQNS 1ZZFA 3T6JA 1YJUA 3W1YC 3JSMA 2V2KA 4OI6A 1I6JA 3D3BJ 4L74A 2DH8A 5CZXA 3R5AA 3MM5A 2V8HA 1LW0A 3TQ1A 4BBYA 4PZVA 5D0GA 4DWIA 5KT6A 3CJ2A 1JQGA 4PXBA 4DL2A 3W5XA 3VF0B 5KG2A 3A12A 2D41A 3R2DJ 2C3MA 1HHTP 4O44A 5H9EK 4I69A 5ETMA 1RAJA 4M5DA 2RHSB 4TY8B 1N5QA 1RT6A 4XPEA 1LW2A 2QL7B 2VJVA 3V6JA 4IH7A 3K0JA 2FZGB 4LBPA 3NG8A 2HVZA 2YWHA 2XSJA 3MOJB 3THTA 3TOQA 1I51B 2YBVA 2ZE2A 3H4DA 4OI1A 1K73T 4JI5F 1TL3B 2JVOA 4DV1F 2KYZA 5FLXY 1X9WA 3QIPA 2DGXA 2LVWA 5MAOA 4RWXA 1UVMA 1EKRA 5FJ4A 3KLGB 3TANA 3GCWP 2MB0B 4IR9A 3DRXA 1W7WA 4KV8A 4IH5A 1X5PA 1T11A 2HZAA 3OR2A 4TU7A 5DLGA 1HQ2A 1VS3A 4IG0A 5KFNA 2DKOB 1Q53A 3CJKB 1D0EA 2G2YA 4RO0A 5J2NA 2FYXA 3LANA 4IH6A 4YB1P 5HQMA 3H5YA 3P49B 2JEFA 1FRMA 3D3CJ 1VQLS 2O3DA 4YN3B 5F0UA 3W8GA 4JI1J 4Q0BB 2OO4A 4OZLA 5L39A 1C0UB 1URNA 2B0GA 2E5GA 1GAOA 2YQ1A 2D9OA 3PW5A 3CCVS 2IM3A 3MMAB 1TVRA 3DYAB 2WHOA 2WONA 1V3ZA 3H20A 4AXJA 1Z1ZA 4EMDA 3R5DA 4DL3A 1OQ6A 3CPWR 1P9YA 2OPSA 3QATA 3EVMA 2OPQA 4KGZB 2Q43A 3HZEA 2V0NA 2D3ZA 5E5NA 4FYVB 3ZZTA 2P9EA 2IJRA 4M5LA 4C8OA 1HNZJ 3IA0A 1IR2A 1JKHA 3ENAA 3EZUA 4ED7A 1X4CA 5KFBA 3BB5A 4KIAA 3HVTA 3MFHA 4DV2F 1LXJA 1RGVA 1XMQJ 1FF2A 4NI2A 1LWFA 3D5MA 5GADU 1WKLA 3AB4B 4I1TA 2CZVC 2UUAF 3CDBA 1ZAWA 4RBVA 3K57A 4DUYJ 1KNZA 3JSRA 1RU2A 4YMEA 3MECB 2HFVA 4RW9A 1T03B 2FHJA 4IFVB 4Q2MA 2E44A 4DV0J 1UFKA 4I56A 2F40A 1NK0A 5C25A 4Q8EA 1VGYA 1CJVA 3VTIA 2ZVSA 3SMZA 4WFAQ 2ZM6F 4B3SJ 1RISA 1X0PA 2YNGA 1WSVA 3AT1B 2ZH4A 5CD4H 2CPXA 2KXFA 3HFZB 3ULHA 3JAMY 1O51A 3BBCA 1RTJB 2GIQA 2DIUA 2HHTA 3QIDA 3MTJA 4RR5A 3WQPA 1WJ9A 1FHTA 4PG7A 1HQEA 1RLCL 3KTQA 1R3NA 4Q2LA 4ZLLA 1S0VA 3G4SS 1NK6A 4LVNP 1IQZA 2AEJA 3D0IE 5A2QU 2CG4A 1KC8T 4O4GA 4QR1A 1VRUB 1CQMA 1UL3A 3PIOQ 2Y8WA 4KE5A 4U8VA 3MM8A 1K0TA 3D9BA 1YI2S 1RTIB 1VRTA 2ZD1A 1U2CA 1SJFA 2AYBA 1EP4B 3VAJA 1S4EA 4X4OA 3DXSX 3L09A 4OYBA 3ET6B 4Y28C 2DHHA 4JV5J 5KFSA 3LP2B 1Q1KA 3IP0A 5CCMA 2UUBJ 1YRTA 1RYSA 3VAIA 3RYLA 5K20B 1P27B 2F8HA 4RUBA 3CEDA 4ZA1A 4DR6F 3M1VB 1DQ9A 1KVJA 3CCTA 5F3ZA 1FD8A 5DJBA 3P6YC 1U0HB 1EX8A 3WDOA 5CYJA 2Y1JA 2OGUA 1FFSB 4WZQA 1YG0A 3ITHB 2FJVA 1FRLA 3GJTB 1ZM2A 3GMGA 4Y0FA 2VA3A 2GX8A 4GMKA 5HJXA 3B8HA 2RUGA 2NPIA 1RAHB 2ATCB 4PAAA 1U1NA 4OZNA 4ZP9A 2J9EA 4OHZA 1I3OB 3D2WA 2VQEF 5GVQA 3FBCA 1BQMA 1YIJS 3TX8A 4ETZA 1Q78A 2V8PA 3M9OB 1UJ4A 4ENOA 4P2SA 2RHQB 3UCGA 1XMBA 3EMTA 4WP9A 1Q5YA 3BGLA 2XZWA 3DOMA 2MQMA 3KJQB 4K59A 3R6LB 3K7RA 2YTCA 1ACMB 2DJWA 1H98A 1TZ0A 5ETSA 2IY5B 2R4FA 4J9LA 3FQLA 1OY8A 4C8NA 2JEIA 4A8QA 2HHUA 1H2VZ 3RBZA 1UEKA 2OEJA 2BV3A 1C0TA 4CO1A 2OD6A 4WXOA 1RDRA 3IG1A 1HNWJ 5GAEI 3LW5C 2OKQA 4DL5A 4KO0B 4IO9Q 3OD2A 2N3OA 4BCAA 4ICLA 1S1TB 1N8RT 4DX7A 5K8MA 2DRDA 4V1Ak 3RB0A 1REVB 4YOEA 1QM9A 2ZBIA 3SFUA 4O0IA 4Y00A 3MEEA 2RILA 3WZ0A 3IXQA 4I67A 2XS5A 4USIA 4L73A 5F8JA 2W25A 1A6LA 2GO8A 2V9KA 4DPXA 1S6QB 4KR0B 1Y00A 4NE9C 2N7YA 2Q66A 2IBOA 2HZVA 1DAXA 1IKVA 4MIWA 2OIHA 2LXUA 1GMWA 2QYCA 3IC1A 1WF1A 2AZ3A 3GR1A 3PZPA 3HHLB 2RS8A 2GGPB 3QGHA 2MJUA 5U47A 2HNDA 3D66A 1D09B 3AXMA 1S99A 3B78A 1FKAF 2R8KA 3G71S 3QO9B 2XCPA 1U09A 1LV5A 1H7WA 4N77A 3U1LA 1HD1A 3OTBA 2PI4A 2CNLB 2CQ0A 4G1QB 1X9MA 1SB6A 3DKDA 2G2ZA 3IRXA 3OSNA 5HBMB 3CDEA 3Q8QB 2ZFHA 2MXYA 4WXWA 1Y3KA 2NXCA 3FNNA 5HQLA 3K8VA 4KH1B 2V9WA 5D0HA 4MTPA 1N54B 3HSZA 5JXSA 2JEJA 3HT3A 2VKRA 2QA1A 2R8JA 4ED1A 3SSSA 3DC2A 1OO0B 1TL7A 2XWYA 3HZGA 3WHIA 3B54A 3W9IA 1NK4A 1MWYA 4QU7A 1X4AA 1A9NB 4ED6A 2E5LF 3Q86A 1ZH5A 4RZRA 1ZM4A 2XMMA 4A46A 2R9LA 2QV6A 1DARA 2MQPA 2XCAA 4PABA 1HBOB 3NS7B 2RNEA 1NJZA 3GYNA 2XHCA 3SIPB 4CH1A 3GILA 2F4FA 4NL5A 1YKWA 2ZH2A 2CQ1A 2UVWA 4QWAA 1T7PA 4R5PB 4PG4A 4ZP7A 4HACA 1R43A 3MM5B 1TV6A 4ATNA 3C19A 3D6TB 2KJVA 1FRXA 4LF5J 3OVBA 4ZN1A 2RF2B 3CCRS 4F4ZA 1WNEA 2Q1LA 2CUYA 4CTAA 2NR0A 1FJEB 3VAMA 1CS4B 2HAFA 2XY7A 2HFOA 1UFLA 1FXRA 2QL9B 1VYAA 4U96A 3KYLA 1LK5A 1CPZA 3BZQA 5K5MA 5ETPA 4M5DB 1RT6B 3M05A 4AL5A 7FD1A 5JVGQ 3OHAA 4F3QA 1DY3A 3UE2A 2EFGA 4LFBJ 4UT4A 1FKOA 3ZFVA 2PMZD 4JV0A 3VGVA 5D0RA 2XSJB 5F3TA 2LFVA 2BVZA 3OPKA 2V4JA 3GZ7A 4A8OA 2HBYB 4JV2A 1S5ZA 2ZE2B 4PUOA 3QIPB 2VL1A 3DDKA 4JI2J 1N5SA 2YNHA 1V3SA 2VA2A 2QLFB 3IFEA 2LLZA 4ANCA 4B3TF 3CIZA 2HHWA 4GO7X 1CC8A 1F3FA 4DR7J 2KG1A 2KRBA 3KLEB 4RNHA 1EIYB 1RBOB 3N6NA 4P73A 1D3WA 4CI0B 3MURP 2QA2A 2YQ3A 3V6HA 2VQFJ 1Q95G 3TUZC 1AROP 2MSSA 3VCDA 3NOGA 2ABYA 2EK6A 1R8AA 1IM6A 1TL1A 3M2VB 4KGVB 4EYIB 8RUCA 3MM9A 4ECUA 4P9SA 5F8LA 3Q0AA 2RT3A 1XMOF 3IN5A 4B3MF 1Q82T 3F56A 4DFKA 2GCFA 5CXTA 2KHDA 3BKFA 3UWTA 3MAQA 5L1KA 1RCXB 1RUSA 3PYDA 4Y34A 4JYAJ 2WVCA 3BO3A 3IBWA 3TAMA 4O3RA 3FC9A 3OXGA 2E9ZA 4O3QA 1QE1A 4MKVA 1HHQA 4DR1F 3QYYA 1H73A 3US5A 2OPSB 3V81A 4DV3F 1HBNB 4HTIA 3MD3A 4X2BA 3VAGA 3A3PB 3NY0A 3ISND 3M6WA 6FD1A 3GWCA 1JXLA 3GG0A 1JKHB 1VQ4S 3UO0A 3MTKA 2CWXA 3NKYA 1SUQA 3T1AA 3N5BA 4F2SA 2IDEA 1LWFB 4FXVA 4EI2A 2KHCA 1TK0A 2C2ZB 4AYBD 4ZLJA 1K44A 2MKIA 5IZHA 2BR0A 1M5HA 4U7UK 3G96A 3NCRA 4NLRA 1S1XA 2DR9A 1AFJA 1VQSA 2V4RA 3TJAA 2G9OA 3IWNC 4JBCA 2GVDA 3ISNC 1VFJA 4WPAA 3QZ7A 1WC1A 3CB4A 5F8IA 2C3OA 5A0YA 2KM8C 2DNOA 1XEZA 4KJIA 3H2UB 2D1CA 3QAUA 3A8JA 3MM7A 1Q0NA 3D54A 4KBIA 1XTZA 4ZCKA 2CRLA 3SV4A 3EGWB 2MJNA 2RIJA 2DEJA 2E9TA 1RKJA 1UZHA 3MD1A 4K4XA 2IAJA 3DFEA 3AD7C 4I4BA 3BH7B 3ZZ0A 1JLQB 2GMLA 1HR0F 1C4CA 2EEYA 3OLAA 1KSPA 4TLRA 2XGQA 2XMAA 1FDDA 5E2QA 3CC4S 4LFCJ 4E98A 3DGPB 2BRKA 2BJ1A 4U67Q 2FGCA 2MY7A 3NS6A 1SC1B 1VK3A 1F1BB 3FBBA 2OTLS 3MM8B 1RI7A 1OYEA 4TU9A 5BYRA 3MMCA 1U7LA 4H4MA 4A8WA 4BC9A 2HHPA 3C16A 1F3VA 4IFYA 2FLNA 1YITS 4JI0F 4RNNA 2AQ4A 1S77D 3PACA 2B7CB 3PJWA 3EE3A 3QT8A 4IOBA 3OXLA 2MTLA 3SCLE 4NZ7A 5HMYA 1RAFB 1VBYA 3FK4A 1TKTA 2QSWA 3HKZD 3SCKE 1NSPA 4DEZA 2X1AA 4CNYA 3EZ5A 1NNDA 3TVKA 1NPRA 4G65A 4DR3F 3G9CA 5IV3A 2ZZNA 1S6OA 3TYTA 3GP9A 1R8PA 4P52A 1UTAA 3T1YJ 1G6BA 4OX9J 2Z58B 2C2EA 4HR2A 1FTCA 1FESA 1JLCA 1HBMA 3K17A 1S1VB 1S0OA 4NZ0A 3C6TA 4KTQA 1BQMB 4LIWA 5EN1A 2X3DA 1OSDA 4DPUA 1VI7A 2QFIA 2V94A 4UOFA 3H98A 4K4ZA 3OHBA 4U7CA 1KONA 2OH2A 3DOMB 2IA0A 3MR6A 5KFKA 2R3VA 2GHWA 2E1MC 1KBRA 3WX4A 3J7AN 3R6GB 2ZC3A 2V67A 1GTEA 4DFJA 1IBMF 3BREA 1LEOA 3HCXA 3V5RA 1T9VA 3JYTA 5CCLA 2CDQA 3RB6A 2CVEA 3I32A 2XMUA 2ATLA 3U02A 1VQYA 4MFBB 4OX7A 4EGLA 1C0TB 1XNQJ 1XIQA 3OTCA 1RBLA 5AJ3J 2F3JA 1UZDA 3A13A 1F0XA 4ES1A 4F2RA 4E0DA 3OFFA 3R7SB 5T7LB 2ASJA 3MUMP 3QT5A 4F36A 2AU0A 4DX8H 2GJIA 2H5IB 3CJQA 3MEEB 1N0VC 4WYWA 4HHUA 4NX9A 2UUWA 3IGNA 4PXDA 4QPTA 4OI0A 1M5PC 2DR7A 3TQEA 3AD8C 1HNIA 3LPYA 1BGXT 2B56A 3LWLA 4FF3A 1IKVB 4BWMA 3GPAA 3CCZA 3T19A 1TFWA 4NEZA 5A8KA 2GQ2A 2DRBA 3M8YA 3CMQA 1RCOB 3I4HX 2CADA 2V69A 3GIIA 4NMXA 4YB5A 2XLKA 2R7SA 4Z7YA 3PYEA 4OJGA 5B08A 1HD0A 1WOPA 3BKUA 4ZVPB 1B4SA 5AE3A 5KFGA 1U2RA 3BGRB 4Y65A 3NGUA 4DLGA 1YWXA 2RB7A 3BEGB 4X64J 4UUXA 3BQ0A 2HFUA 1KHWA 4DQRA 4Q43A 3UDVA 3BGUA 3OTEA 2DYAA 4FVMA 1VQKS 1ZTWA 1MN7A 1S59A 4B3OA 3AQOA 3RB4A 2WOMA 5IFMA 1N36J 3IAS9 1GT8A 4TN2A 4KHRA 4GKKJ 3SCJE 3PXGa 2FGOA 2B6AA 2FHKA 5F8MA 5KFMA 1GX6A 3FCHA 2QEXS 4WP8A 2LXIA 1ELOA 4OHYA 4I2PB 1GXUA 1CBKA 4OV6A 1V9OA 2IDLA 2IRUA 2NUUG 1IKXA 4LR8A 2PT0A 1H74A 2EPIA 3JSYA 3HULA 3TA1A 1PBUA 1UPMB 2W4DA 3UR3C 3R5GA 5IQQA 4LF6J 1FK9A 5HO4A 1G7CB 2AZ1A 3BBFA 2XGPA 5KOWA 4EBDA 4DCPB 2BKPA 1T9YA 1RT2A 1G4CA 4OHVA 1C1CB 1PYOB 3DCAA 3T5KA 2A6MA 1CSJA 1AB8A 2NYIA 1UFWA 2CQHA 1X4BA 2JFKA 3MZIA 4MK9A 2R2RA 3HSJA 4P7TA 1SKRA 2XMKA 2CQIA 1PGZA 1Q8IA 3W62A 2VH7A 3IGVA 3NMAA 4CTAB 2RQMA 2V2QA 2DH7A 3O3LA 5K14B 3UCZP 4ILLA 1HNXJ 3GIRA 4LRCA 3CGIA 4KQZA 1QAYA 4L75A 4DU8A 4JI1F 5J2PB 1UW9A 3CD5A 4M8LA 3OR1A 4P75A 5L1LA 2H3EB 2E1PA 4DSJA 3K5PA 1RK8A 3EPGA 2E7XA 4QOTA 2V4JB 1JLEA 3NWGA 1OPIA 4L3NA 2GFFA 2PGCA 2ZBRA 2P6TA 2VFSA 1VQPS 4HL9A 1RT4B 3OL7A 2J0QD 2YNHB 2KZZA 2KT3A 4USTA 1S76D 4DSFA 1NPKA 1HNZF 2IPOB 4K5RA 5HVHA 4NLVA 4LR9A 4OZ3A 2HGMA 1N6QB 1RWVB 1ZM3A 2EK1A 1K47A 1DTQB 3D28A 1XMQF 2XBPA 2E29A 3QAEA 5HAOA 4IRCA 2FZKB 4ECSA 1TL1B 4DR2J 2J5AA 3Q83A 4OYMA 3MM9B 2A2CA 5HI7A 4DUYF 4WE1A 2M8HA 2YX4A 2E7VA 5I42A 4MMOA 4C8MA 2XWXA 1B0VA 2HRYA 1R27B 2FC8A 3FKBA 4DV0F 1QLNA 2FPHX 2HAIA 3KHLA 4DPWA 5KT4A 2VG5A 1PAUB 4B9LA 2JOQA 3TAMB 2CPJA 4JI7J 2XNRA 1DTTA 3JQMA 2FD2A 2IFXA 4UZCA 1KDNA 1L5UA 3TJ8A 4B3SF 2IMWP 3UDEA 3A8KA 4Q45A 2MZSA 1H2TZ 3AOAA 1IKYA 1F60B 4OZJA 1Q8KA 1IN0A 8AT1B 3HSGA 1SL0A 5KOXA 2KYXA 5DDRC 4B9MA 4F4KA 3DMJB 1RTDA 4LFAJ 4QU6A 1BLUA 2D3O1 4OYWA 3W2WB 2XI2A 1B7YB 3M9MB 3ZXWA 1SUQB 2CZ9A 3P8BB 2PMHA 2F63A 2C3YA 3PR4A 4CLUA 4LRBA 1VC6A 3G6YA 1UA1A 1S1XB 4WK1A 1K1QA 4QR0A 2OI2A 2JC1A 5GMKa 4N8OA 3G8TA 1JK9B 2RRAA 2F5GA 2GVDB 3OUYA 2BM1A 2COLA 1UVJA 1N5TA 5A0YB 4ZPCA 1NK5A 1NBEB 4NLTA 4JV5F 2AX1A 2YNIA 1RHMB 2UUBF 2MQLA 4G3IA 4LT6A 4K4UA 2J7KA 3IO1A 3MM7B 2D3UA 3GSDA 3W9HA 4XDDA 3ZNUA 1CJTB 1KQFB 1FCAA 1N5YB 2DNLA 2VQEJ 2DT9A 2IAJB 3BYPA 3W3SA 4WZMA 5CABA 4Y2MA 2Y8YA 4Y6IA 4NA1A 1KTVA 3G6XA 4J9UE 1Y10A 4RW4A 3KK3B 4A8SA 2HW3A 3LUYA 1GTHA 1DQAA 2GA7A 4JP8A 1BWVA 1NU4A 3RTVA 4ES2A 4ZVQB 3BN4A 4ZPWR 4ZVFA 3FEYB 4B02A 1CG2A 2KTQA 2ZWPA 1EARA 5LXYA 3HHDA 2MQNA 3C16B 2BJ7A 1HPZA 3KLHB 2HYIB 3NS5A 1NAQA 4KAIA 3ICLA 1X7VA 3I31A 2HHVA 4MKBA 1HWLA 3ENWA 1TKTB 2O67A 3MMJA 3IR6B 2VD3A 3AXKA 3PEHA 3QFHA 1HNWF 1AFIA 1IR1A 1BD6A 3KJVB 1YX2A 3KMSA 2A1BA 3CJ5A 1MROA 3CJTA 3K5NA 4WBFA 3BR8A 1UWBA 3DDNA 2GZOA 3CJRA 2CPEA 4KRWA 1JLCB 1QAXA 3C6TB 2OEKA 3GFZA 5EUHA 4F04B 3A1YG 5K8NA 3HP6A 2ASYA 3NAIA 4HT5A 2DH9A 3TI0A 2YY3A 4Q8FA 2GIRA 2DXEA 4DBQA 1F9EB 2OFGX 4OV1A 3KK1A 4TQRA 4UUWA 3EVWA 1ZAXA 2RD5C 3NBPB 1WKJA 5ITHA 8ATCB 1HW8A 2YKQA 3GFXA 3E3XA 1QY7A 3JYTB 3C2PA 1ITPA 3QQCD 1KLMB 2DGTA 4C9DA 2GV1A 3TO8A 2OFHX 4ZVSB 2MHNA 2KM8B 3IBCB 5L9NA 2W7PA 4PYDA 4ZPDA 2V5HG 2R7VA 5J1EA 1TMJA 4HLBA 5C5JA 4DHVA 1SH2A 3L4BC 1SI9A 4ZMMA 5B09A 5A8RA 2YX1A 4WWSA 1TTHB 2I8EA 4P2XA 3ZO7A 1GMVA 3I6PA 2C2OB 2Z30B 2Z4PA 2UV8A 5HK4A 2R2SA 4QYZK 1F2HA 2CYYA 4ZPVR 1WOOA 2ILYA 5DM6Q 1N48A 1YGYA 3FDSA 3C14B 3KK2A 2E1RA 2CDRB 1L3TA 2DNYA 1JLAA 4U8YA 3M7VA 4F4WA 2VIHA 4G6VB 1GXLA 4QR2A 2QLBB 2YWEA 1QSYA 4DQQA 3AQPA 1N0UA 5KFYA 5JUMA 3AOCA 1Y5LB 2XY6A 3MAAA 2HBRB 3RRHA 1YQHA 3CJSA 2K2PA 1LWEA 1SBRA 3NGRA 1XJWB 4FNHA 4IDKA 4I68A 3UNYA 4N76A 1KEKA 4ECYA 4ZPAA 4HH1A 4LRAA 1U6FA 1RWWB 1J5OA 2MZTA 4W90B 1RU1A 3Q8RB 3DRPA 1UVNA 3CCMS 1F5BA 4DG1A 1FKPA 1VBKA 3L7OA 2R7RA 3BH6B 4RW7A 4ZK7M 2W7OA 1KD1T 5MLCV 1S10A 1FERA 4GVBB 5H9FJ 1DRZA 3SSRA 4I2QA 2HNZA 2GMJA 1YVFA 1RABB 4C98A 1H72C 5HANA 4LF5F 4CYUA 4LBHA 2B6AB 3V4MA 2OSRA 2HLTA 1HIYA 3MCMA 2AJQA 1HLWA 3MM6B 4C3KA 2AYGA 5B0GA 1RA7A 2ZH1A 4JI4J 1ZTTA 1IKXB 3VAHA 4KT0C 3I9V9 3M30B 1B0PA 1ROFA 2YWFA 4K4WA 3K2YA 4ETXA 3I0RA 4LFBF 3R9LA 4ANDA 2N4CA 1FK9B 4Z37A 3MEGB 4FF2A 4KGKA 2V2VA 2ZDPA 3SZ2A 1WDDA 2P6SA 1RT2B 1NDKA 2PA8D 4GKJJ 2C28A 3VGTA 4WIIA 4JI2F 4IO1A 1NCLA 2DGSA 2RAQA 4KHPJ 4NPOA 1IXKA 1WI8A 3O8WA 4DR7F 3UD4P 1RT5B 1KFSA 1HNVA 3R1LA 3BSNA 3FJ2A 4OL8A 2QTWA 2BJDA 1FVQA 2VQFF 3MR5A 5EX0A 1NSQA 4NASA 4ECWA 1IBKJ 3CC7S 2GJ2A 2EG1A 3CJ4A 3G8QA 3Q2TC 4K8RA 1NSAA 1DLOA 2OLWA 2J76E 4FS2A 1RAGB 2FQQB 4FF1A 1SV5A 2W2PP 2OUGA 5D4OA 3TVYA 3M9NB 4RBTA 1E6YB 1I5OB 2BE7D 3H2VE 1ZA2B 1URRA 4NYZA 3KLFA 2RKIB 2HHSA 2JX2A 2GHPA 5E3QA 4YEAA 2HNYA 2IJFA 2MGZA 5B0AA 4EO8A 2BJ8A 1YSJA 4FVCA 1NEEA 2K06A 4QCLA 5LM7E 4BLGA 4LREA 1IWAA 1WC6A 2A3JA 2CXEA 3H7HB 1F9FA 3I5BA 4YHHJ 3BPDA 3T41A 4X4VA 1WEXA 1WG5A 2OSQA 3GU0A 4EU0A 2UXCJ 3N4WA 2E5HA 2H4YB 1MWZA 3EWGA 2E9RX 4ILRA 4URQU 2FHOB 2BYCA 2XS7A 2XS2A 4LMZA 1NDCA 4C11A 1UKUA 2VU5A 4ED2A 1NJWA 2W9BA 1H7XA 2EXUA 1PAEX 1SJ1A 1VLOA 3LP0B 1UVIA 2WSEC 4N47A 2W8LA 2HK3A 2YKMA 2DXDA 4CNZA 4LF4J 3TEGA 1NJIT 1ZBTA 2W4CA 2JH3A 4HI2A 4DL6A 3R7NB 4X4NA 5DO2A 2XC9A 2HVEA 3HF5A 2D74B 5RUBA 2R8GA 2FHMA 1A7GE 4L76A 2DITA 4DR4J 4MYUA 2OPPA 2VKZG 5H1SV 3GYGA 5ETNA 4QWDA 2KU7A 4USHA 2B9EA 5KFXA 2VICA 3CCLS 2AIRB 2HS3A 4I6AA 3V4IA 3EVOA 4F0KA 1FDAA 3D67A 4KSEB 4NXNJ 4CO4A 4LFCF 4YR3A 1OSCA 2BABA 2RS2A 4NCAA 4ZCLA 2WBRA 2VC1A 1VIOA 2VOOA 5HROA 3QZ8A 4IOAQ 3BV8A 3AFGA 2EKNA 2V8DA 2NYHA 4CO5A 2HWIA 2GNKA 1UW4A 4DR5J 2K7KA 3VZIA 5D78A 1N56A 4WKYA 1JB0C 1H0HB 3DHXA 5HN0A 4AUKA 2J0WA 3KUHA 2RE1A 3I4PA 1RJJA 3OL8A 2W2OP 3OVAA 2ROEA 1T05B 2DTJA 3FBEA 1KQGB 3HHNB 2KT5A 4KYZA 1Q4RA 4UOGA 1TU0B 1YJTA 3DLEA 1SPBP 2JNJA 2CQCA 3UNGC 4GC7A 4CQ1A 2VHGA 4RW8A 4DPTA 3G82A 3T1YF 4H4OB 3U1NA 4OX9F 3P96A 1VHIA 4DL0C 2PSZA 3C46A 4OLPA 1BUXA 4ZVGA 4PG6A 3DN9A 3GTYX 3RAMA 3A3NB 1U1MA 1DQ8A 4NLDA 2ZHBA 2BBEA 2WCXA 2B4OA 3NGDA 4DQSA 2DCLA 3THVA 4YFUA 5L46A 2HS4A 3F0NA 2E5JA 5IXUA 2VG7A 4USJC 1B70B 3IRWP 2ASDA 2NZ4A 4ZIVA 2LQ8A 4DSKA 4D3HA 4LSZB 1OWXA 5KT3A 4WCEQ 2AYEA 4KPYA 4O3NA 4RBUA 2C3UA 4OMFG 1QSLA 4HEA9 4EBEA 1P6TA 3MEDA 2VFRA 4RX6A 3S1TA 4OQJA 1XNQF 5IT9U 3Q24A 5ETTA 2HRTA 1XNRJ 5AJ3F 2J0SD 3ILLA 1GEHA 4KFBB 4MKYA 2QL5B 5HP1A 1UVLA 4C8YA 3BDPA 1EETA 2R8IA 3DOKA 4O0NA 4QPXA 1ZPVA 2KXHA 3VVUA 4QYRA 2FHJD 4OI4A 3SFGA 2L41A 1ZA1B 2OMLA 1S97A 1HBUA 1AZSA 1FE0A 3PFEA 4CO3A 4HHHA 1CQNA 4LF8J 4DJBA 1HQUB 4H54A 3TP2A 2CQ2A 1KTQA 4RL1A 3QGIA 3GE9A 1SIWB 5IOLA 4F67A 5DDQC 4X4SA 4JOUA 1MG7A 3J7A1 4ER8A 1SKWA 3CJ3A 1PJ7A 5J1EB 1J2VA 3IBFB 3DOLA 3W2VA 4O3SA 5DQHA 2Y1IA 3CT9A 4X64F 3K5LA 2VZ9A 3EXCX 4EZ6A 3DLKB 2L48A 1JLFA 3RUBL 4ZDNA 1MMLA 2HPUA 4M63A 5GAHI 4M1KA 1N36F 3KK2B 1TKZB 4GKKF 3J81U 3H2LA 3DLHA 3IR5B 3KLVA 1RWOB 2LA4A 2Q6BA 3LH2S 3PFOA 1M5OC 2XTJP 2B9XA 2KT2A 3A3OB 2DPJA 1YK9A 2OELA 2K1RB 2R7UA 5I3UB 3MAAB 1LK7A 3UQSA 3TNVA 2WSCC 4LSNA 3T5HA 4ECQA 1QTNB 4FN5A 5HMWA 3EXYA 4NLWA 5M2RA 4YP3A 4LF6F 3S8SA 2BE9B 4KPCA 4J90A 1Q7LB 1J5OB 2H4WB 2XSFA 1MU2B 4M5HA 3MUVP 2AGPA 2MHEA 4I7FA 2CPZA 3QSIA 4NLSA 2LP4A 4X4QA 1RHJB 5LMUJ 1T9WA 4I2QB 3AH6A 5CYQA 2GVZB 2NQPA 1KQSR 3JSBA 5GAGI 5D4PA 3M2RB 1R0AB 4R8UA 4CYUB 1S4FA 2YNFA 1S7IA 4HYKA 2LEAA 2LQBA 1SKSA 4QIVA 4K0KJ 3EYZA 1HMVB 4USKA 2I5JB 4F0MA 3GFYA 2QMXA 1HNXF 1C2PA 1L3KA 3L7PA 2MMYA 1CJUB 1WC4A 2ALZA 2LU1A 4DU7A 1SJRA 2JL9A 1J27A 1S12A 1YZ7A 1I1GA 3I0RB 1R8HA 3OFEA 4DOZA 1F9HA 2DIVA 1FNXH 4ZVRB 1TR0A 3KHGA 3J81j 3M2UA 1FWLA 5IC6B 1SJ4P 4RU2A 3RGIA 2NXNA 3NAHA 2ZH6A 5CYMB 2W8KA 2ZHOA 2LMIA 2B8PA 2YKPA 3EM1A 2R7QA 2UXDJ 5KG5A 1OMSA 1HNVB 3V6DB 4F7VA 4JI8J 2E7WA 1FA0A 1TKXB 3D0HE 3PYGA 3OLBA 5BYSA 3PHTA 3QJLA 3ZTPA 1TKDA 3DI6A 4DS4A 2BW2A 1S6PA 3RW6A 4WU3A 1VQ8S 4DR2F 4YDXA 1BQNA 3DM2B 4FDFA 1TUGB 3MPDA 1B7FA 4C97A 1RT7A 2DNHA 4B9TA 2VG6A 3VAFA 1GMWD 2WW4A 1JLGA 3R27A 3JTOA 1VJQA 1Y9OA 1WWHA 3KLFB 3UN3A 3OW2R 2K8GA 4FKXA 4JV1A 4ED8A 5B0BA 2EG2A 2ZZTA 2FJAB 4JI7F 5HLFB 2MGZB 3AODA 1X4GA 4YDDB 5F8HA 4AQYJ 4RUAA 1NUEA 1GMUA 1FX2A 4WF9Q 2O5DA 4ELVA 2DBBA 2HQFA 1F5AA 3F73A 3X1LB 2PMWA 2WBMA 3DRRB 4MT1A 1S6UA 3OT9A 2WAQD 5G4DA 1FTRA 5KFHA 4OZ1A 4LFAF 3A8IA 3W5YA 2XYGB 5DQGA 1ICEB 2EFQA 4X84A 3R1HA 3QMQA 4MK7A 4EO6A 2IVMA 4IKAA 3RR8A 2HFNA 1HKAA 3BM7A 2IC3B 2KO1A 3M6UA 3U1MA 3JQJA 4TY8A 2J8AA 1G3OA 1VLYA 5F9NA 2V50A 1WC5A 3NWRA 4I6WA 1T9TA 1R6YA 1ULRA 9RUBA 3SI8A 2GQCA 1RHUB 2YKMB 2XG8A 3PRDA 1TL3A 5AXKA 4C7QA 5C7PA 1RWXB 1RZMA 4UOHA 1AT1B 4CCHA 4H4KA 1RSCA 2RH3A 2G1DA 1NB2A 4ELUA 2BANB 3MR2A 1N32J 3KLGA 3R3TA 2OPRB 3GIJA 3NGKA 2P9CA 3AOBA 2OPPB 1FVSA 2PFFB 1MLAA 2ADCA 1DHMA 1KWMA 1UJ5A 2HHHJ 3TVZA 1X31C 3C15A 3M8PB 4DFPA 1R8CA 5HQ8A 3SDEB 2VV5A 3FBFA 3R7BB 5ETKA 1YDLA 3A4TA 5LJ3Y 1KVKA 1BE4A 3TJ9A 2VPZB 1B64A 2CJXB 3T1HJ 2KZMA 2CIMA 1BQXA 2Z0GA 1WC3A 4IQXA 3ZNJ1 1FRIA 2EFVA 4Q0BA 5M2UA 2FVPA 1QUVA 1C0UA 3NNAA 1HWKA 4WK3A 2YQ0A 5J2MA 1MMDA 2FJBB 3QJPA 2DHAA 4CP5A 3DYAA 1MNEA 2JC0A 1B99A 3GIMA 2JWNA 4GO5X 5ETQA 3JTNA 3WIUA 5DETA 3CJ8A 3BSCA 1D9FA 1QJHA 1QTMA 5FDLB 3KMQA 3TA2A 4W98A 2APOA 5LMNF 4NCGA 1EJ7L 3BS9A 2FZCB 2ILZA 1KLNA 2W1BA 2M8DB 3DLEB 2WTFA 1UA0A 2FVCA 3FMWA 3LTOA 3GYXB 1SQEA 4ZVTB 5ETOA 4WYLA 4P6QA 5A2QY 3G82B 4PWUA 2N3LA 3GV7B 2R2TA 5D15A 3MECA 5D3GB 1T03A 3ENVA 4IFVA 5K8OA 2BX6A 4K2JA 4F25A 4N8NA 3ZZYA 2Z57B 1WEZA 3ISZA 3DXBA 4LF9J 3BPSP 2LQ5A 3FFIB 2CPYA 2VG7B 3SBMA 1TMMA 2RSQA 3I82A 4CLLA 2KFYA 2AJ2A 2FJXA 4L6V3 4OJHA 2M9KA 2W01A 4F3OA 3KFWX 2MEWA 4C0OC 4F4AA 3QGGA 1KP6A 2I38A 1ZS6A 5DG7A 3I0SA 2DNZA 3KOAA 2PIIA 3MGJA 4OYZA 3MEDB 1GX5A 4CLSA 5KFJA 2ZH5A 1SIZA 3EDQB 2B43A 5KT2A 4LR7A 2ZVIA 4MYTA 3RW7A 3HMJG 2C22A 1V3RA 1VRUA 3DOKB 3H25A 1U24A 4KHMA 1Q8BA 3CC2S 3BQ2A 3PV8A 2JVRA 1FFWB 1RTIA 2ZDOA 4B9SA 3MCNA 3VVTA 2QT7A 1EP4A 1FX4A 2KXNB 5DM7Q 2DR6A 3RRKA 3QLHB 5HMZA 3P3DA 1HBUB 4RU9A 1AZSB 3C6UB 2HMIA 3LP2A 3LGMA 3UI3A 3W5ZA 1FD2A 1IJEB 1QAJA 3DNCA 5F8GA 1U0HA 3I87A 2N7CA 1RYRA 4J9SA 4DCJB 4NYOA 3DRSA 2HFZA 1QSSA 3JSMB 3IR7B 3ITHA 3JQKA 4DV4J 2R7TA 3HKWA 3P5TL 4ID8A 3TZYA 1LW0B 3CD6S 2LEBA 1T95A 1W2BR 1T9UA 4DPOA 1BY9A 1NH7A 1R89A 3R2CJ 4ZCIA 3RG6A 4FBUA 1X9SA 3VV2B 4O44B 3EZOA 1UJ6A 4OJ3A 1JLFB 3AJ2A 3QWUA 2DNGA 4U95A 3B4DA 5IT4A 1LW2B 4CLZA 1HWUA 2LEPA 1HARA 3H42A 3DRYA 4QIWD 5KG7A 1PBAA 2MZQA 2MKCA 1EQMA 4NCBA 3IWLA 2X1FA 1Y3JA 3DLLQ 2WW8A 2AJ1A 2W24A 4C3MA 4JI4F 3AA9A 4LSNB 4BC7A 3TAQA 2Y3YA 4F02A 3LF0A 5BR8J 7FDRA 2VBWA 4XIUA 4KO0A 4KV8B 2HVIA 1H6KX 1F5CA 3AJ1A 3OR2B 1S1TA 4HHJA 1REVA 2DNMA 2RJZA 4GKJF 4IG0B 3ZZPA 3VR1A 1XN9A 2DGUA 2AP6A 2RQCA 2HBQB 2EKYA 4KHPF 1NKBA 5J2NB 1X5SA 5DG9A 2GAGC 1D8YA 2Z2YB 4BWJA 1V6HA 3KXDA 5CYQB 2AGOA 1WUUA 5EX3A 1LKZA 1KQKA 1IBKF 2YNFB 4AFFA 3JB9k 4NOHA 1TVRB 2WONB 2KRRA 3AA8A 1R0BG 4B9NA 3HHLA 3H5SA 4BS2A 4FBTA 4CM0A 2HFSA 5FLXU 1RA6A 2OPQB 4PG8A 1U6ZA 5D8HB 5D4LA 3SQOP 3QO9A 2PEBA 1VQ5S 4ZJOA 2QSFA 2UUCJ 1RWKB 3FRZA 1YJVA 1WSRA 2KFZA 3GJQB 4IUFA 3HVTB 3QPIA 5DQIA 4QJVA 3OFGA 2IJNA 4G1QA 2CJBA 4NI2B 5D4NA 1YBUA 4K4VA 3PNIA 4YHHF 2ASLA 2VBYA 5HBMA 3ZTRA 3KJFB 1U1OA 2IRYA 2G0JA 1E6VA 4X62J 3M4XA 2UXCF 4RW9B 1FJGJ 5LL6d 3WBZA 3AJDA 2XO6A 2B51A 3VAKA 3DI6B 5B0DA 2R2UA 1W25A 4TYAA 4ED3A 5KG4A 5C25B 4NLGA 2FY1A 1RLDA 1S6PB 2XI3A 1OY6A 1CJVB 1OS5A 4Z2XA 2OAUA 4FNIA 1EZZB 3UN5A 4ECRA 4ECTA 1JNZB 1RT7B 2VG6B 4ALZA 1U0SA 3PYFA 2YNGB 3PG9A 4O23A 4QIFA 4ZJLA 1PILA 2A10A 3VGUA 2JEGA 3CD7A 4ZJQA 3K8WA 4ZIWA 1LWXA 3OBIA 4AXIA 2HQ3A 4QBUA 3BBBA 4LF4F 1NHKL 3PHEA 3JTPA 1TAUA 1HQEB 2LQJA 3MPWA 3KWMA 1HBOA 4UOCA 1IBLJ 3NP5A 3CVKA 2DPIA 1WTFA 2G0IA 2GIFA 1RE1B 3HFVA 5EWEA 4DR4F 4A47A 4R5PA 1NDLA 4O4GB 4OHXA 2QJ3A 3QGPA 4J9KA 2AJ0A 5LT5A 3PVXA 3PX4A 2HKEA 4XPCA 2RF2A 4A8MP 3OTOJ 5KFQA 1VRTB 3K58A 5I3PA 2ZD1B 3PW7A 1QDUB 3BO2A 4NXNF 1CS4A 2Z8QA 3KKFA 4OIXA 4YB7A 3LAKA 4M95A 3GB0A 5F9LA 4PXEA 3DU6A 1WORA 1SH0A 5GMDA 1BMQB 4Z7CA 1HHSA 2F8MA 3T5JA 2F1FA 1JWWA 3JAMU 2F9JA 3SQGA 4DR5F 1H3DA 3MCSA 1APSA 1H38A 4ED0A 2CQGA 2FJEB 5E33A 3CJ0A 4OZ5A 2UVVA 2W2QP 5KG1A 4DCOB 5E3PA 2ZEJA 1U8WA 4ZLPA 1X4DA 1FNOA 1XERA 4NRUA 3T6BA 3KLEA 1T9XA 2KFNA 3ZZOA 3T5LA 4P2FA 4PG5A 1VOMA 4KKOA 2V68A 1HWJA 3H5XA 3J80U 3C15B 4NA3A 4CH0S 1Q79A 3M32A 1QUPA 2QFJA 1B0TA 4PXCA 3M2VA 4X4UA 2V8GA 4FYWB 2RU9A 3N01A 5M2PA 1R6VA 3QT6A 3UFCX 4PKDB 2FDNA 4CO0A 4LQ3A 3ILIA 3OL9A 1IWGA 3HVAA 2G4BA 3BKTA 2U1AA 4M5IA 2PN6A 2LU2A 4U6PA 2ZHAA 3FMBA 5J2MB 2J6SA 2DRAA 3P4UB 1T02A 3W61A 2LDIA 2DGWA 1LOUA 1KKHA 1VK8A 3IG1B 3A8EA 1KN6A 1HBNA 1W2IA 4TVAB 3LPEA 3K59A 3TUJC 2NLWA 4ICLB 4RJVA 3HJFA 1P1TA 2L3MA 2QGFB 2MLZA 4NCGB 3TUPA 1GK8A 1YRXA 3TAPA 2XULA 2AGQA 4ED4A 1WTBA 2CZ4A 5KFZA 3PR5B 2Q3PA 2W7AA 3D6HB 4ZP8A 2H5JB 1XNRF 3QFWA 1YBAA 5KFOA 3DDIA 2R42A 1VQOS 3MR3A 3QRRA 1FRHA 1NO8A 4L72B 4CWBA 4OI3A 2N4DA 5F0WA 2HGNA 2AW0A 2B7BB 5A8WA 2GAHC 4I0WA 4TY9A 1VISA 2X51A 1VDHA 3O44A 2LXFA 5KG3A 2MQ8A 2CKWA 1FXLA 2QZ8A 2HNDB 3R8YA 1OJ4A 1NRKA 2MQQA 3VALA 2Y9HA 4L3KA 2ZJQQ 1HW9A 3CE8A 1YRUA 5JMNA 2NXUA 2WVEA 4J9QA 4LF8F 3C66A 2HS0A 4NLYA 5AXMA 1N33J 2FVRA 4J5OA 2LQ9A 1HL6A 4RNMA 1OQ3A 4KC5A 3IRXB 1ZZNA 3I0SB 2Z56B 4DF8A 2CJAA 2J6UA 2W9AA 1JLQA 4PRFA 1PJ5A 1RHQB 2DNQA 2PI5A 3UD5A 2NSCA 4FPRA 2AV5A 5G0RA 2X1GA 4F4XA 3NCQA 3DGPA 4UQGA 2BOPA 4J9VA 4E2FB 1PO6A 3J80Y 4RNFA 4C2MA 1NSKL 1TL7B 1U48A 2DR8A 3HVRA 1N34J 3HSDA 2B4UA 1Z2LA 4LF7J 2Q6CA 2ZWOA 1H2UX 2GJFA 1PYTA 3Q89A 3LWMA 1ZM9A 4Y3CA 2HMIB 4UY85 2B8QA 2B3TB 4WFBQ 5DGAA 2CQ3A 3SCIE 1WKKA 4G1IA 2XYHB 1TQLA 1XR6A 3PO4A 4CLYA 4IOCQ 2VFVA 2H9ZA 3EICA 2XYPB 2IVFB 3HI9A 2KJWA 3NRBA 4C0HA 2FB0A 3DRSB 3W66A 1N4LA 2H65B 3D4JA 4QQBA 2VPXB 3KNGA 4HACB 3E2EA 1TV6B 4OHWA 7AT1B 3H90A 1OPZA 2AWZA 4FF4A 1KOHA 1RHRB 5KFRA 2MYFA 2Z2MA 3BDEA 4N7TA 3T9ZA 3IWXA 1S1VA 2NZCA 4I64A 3J7ZT 1CULA 2ACMA 4K2XA 5LMUF 1RWNB 2DO4A 3QWPA 5KFIA 1SXLA 1WHWA 4WTYA 2ZBQA 2VODA 3POTA 3GFHA 3P45B 3U27A 5IM0A 1FKOB 2OP5A 4K0KF 4KY3A 1X4FA 4YY3J 4PWWA 1WC0A 3CTRA 2HEKA 5AE1A 5B7WA 5EGYA 4PUOB 4K50A 4OYIA 2WSFC 2KB2A 4B3RJ 1MSWD 4B17A 4MFBA 2QMUB 3L3CA 5L9XA 3TEHB 1TUVA 2ZBPA 3FZ2A 1K9MT 2YKAA 1Y4ZB 2GQQA 5IV4A 1WG1A 5HSPA 1RTHA 5DS7A 1IBCB 2CPIA 2XNQA 1EHWA 4A8KA 4C8LA 2PA3A 2I0XA 1OY9A 4MKAA 3CDAA 4F8RA 2BW7A 3BGOP 3MMBA 2DD8S 1FO1A 3CDUA 5T7LA 1S7HA 3Q8YA 1L3VA 2MKYA 4WFYA 4DDFA 2E1CA 1JXVA 3TUIC 1KRPA 3R5BA 2UXDF 5GAHU 1Q86T 4DSIA 2UXBJ 3U7JA 1S0MA 3BGFA 2C1EB 2UVUA 3PW4A 4JI8F 1PYSB 2QLJB 3CO0P 4DPYA 4LJMA 1VJWA 3SSQA 4ZN3A 4DQIA 1Z4UA 1VRQC 1WEYA 3RBDA 4MK8A 2PO4A 2DB1A 2J0XA 2LKZA 2OD4A 3CIMA 1QE1B 3LALA 2VFUA 2DNNA 3V81B 4I6YA 2YX7A 2FY8A 3AY0A 1CC7A 1DURA 3O6QA 4DX5A 1VQ7S 1C4AA 2E1AA 3E01A 2BZ2A 2DNRA 2M88A 4PCQA 1B3TA 1U4BA 3BGRA 3Q23A 3NEKA 3QNWB 2UVRA 1HA1A 4NMLA 2BKNA 4OYXA 4AQYF 3D1QA 1TELA 1NLKL 1JXEA 1IVZA 1U47A 3TWZA 4DS5A 4J9NA 4P2MA 2QA4S 5GAGU 1E6VB 2WB4A 3ZZZA 3UW1A 3M8QA 4RW6A 1M5VC 2XB2D 4E8UA 1AA1B 2ZH7A 1XWLA 4QYZJ 4B9VA 3T9NA 3SV3A 2CG8A 2POKA 1VIXA 2UZAA 4DF4A 3WC2A 2DO0A 2WK4A 1FRKA 1Y7PA 4I2PA 1AXQA 4CLPA 1NK8A 5C2CA 4PWDA 1AUDA 2H51B 5KFFA 1PC4A 3DGVA 5LSOA 2BRLA 2WVBA 1C1BA 1IKWA 5KFLA 2IIHA 3NMRA 2LECA 5KFAA 2VBZA 3M6VA 1FE4A 5THWA 4KGXB 1N88A 4ZITA 3FEZA 3G87A 4UQTA 2HBZB 5DRKA 4DUZJ 2ACYA 1C1CA 4OYOA 3AD9C 2KDOA 4CIOA 3M8SA 1KVIA 2H1YA 1UMJA 2G13A 2BJEA 4NLOA 2K7JA 1N32F 4GVLA 2JJ4D 1U1QA 5SUHA 1NXIA 3OFHA 1GFWB 2IMOA 2HHHF 4HI1A 1WHXA 2ADBA 1IR0A 2HVDA 1Z2ZA 1UWAA 2MSTA 2P9GA 2ZZMA 5DLFA 4XDCA 2EFOA 3MMCB 3OQ2A 1O8BA 3G6ES 4H4MB 2UV8G 1WHVA 4IFYB 2DGQA 4USMA 1EQ0A 3CWJA 3SEOA 4TKTA 3Q8VA 1S9FA 5K14A 3BYRA 4QW9A 3T1HF 3OL6A 3K5MA 2A0FB 1T3OA 5J2PA 2B9WA 2AMCB 4QIEA 5LMNJ 1FI4A 2MZRA 3SQGB 2QRRA 5E3CA 2M4MA 1M5SA 1RT4A 2LCWA 3UPFA 2EFNA 4PQAA 4ECZA 4X65J 2VONA 1JX4A 4TQSA 1NMEB 3J7YI 3M8WA 2YPZA 3TARA 3RRGA 5HVGA 3QBCA 3UDLA 2YKOA 4ZVUB 4HKQA 1HBMB 5T41A 1N6QA 4KKOB 4KGMA 2BACA 1DTQA 3HXMA 5CAAA 3MFIA 2C2KB 3UDCA 4M5NA 3FCWA 2Y1LB 3M32B 1VR6A 3EGZA 3GSIA 2HIYA 4NWBA 3MOZA 4B08A 1RT1A 5KFTA 4UTGA 2JLEA 4W4MA
chains in the Genus database with same CATH topology
3F73A 1GXUA 3X1LB 3PX0A 1V9OA 5D6GA 2WBMA 4ECVA 1XR7A 3DRRB 4I7FB 4F4YA 3S6EA 2IRUA 1UETA 2NUUG 3LQVA 2SXLA 5AXLA 1IKXA 2PT0A 3AB2B 1S6UA 2EPIA 2WAQD 1WELA 5G4DA 3QJJA 3JSYA 4O3OA 3TA1A 4ZVEA 1FTRA 5KFHA 4OZ1A 3MAHA 4LFAF 2EVZA 2W4DA 5E3AA 5D77A 5IQQA 3UR3C 3VQTA 3CMES 4LF9F 4DV5F 2C3PA 5DQGA 2DK2A 4C8KA 4Q7AA 1FK9A 2BDPA 5HO4A 4RNOA 2E5IA 1G7CB 4WFZA 4R8UB 2EFQA 1S6QA 4X84A 3R1HA 2XGPA 2DVIA 3QMQA 2RVJA 4MK7A 5F41A 4EO6A 5KOWA 4EBDA 2IVMA 4IKAA 3RR8A 2HFNA 1G1XA 3BO4A 2R7OA 1HI0P 2L9NA 1YHQS 1RT2A 3BM7A 2IC3B 2KO1A 4EEYA 4OHVA 4OLOA 1D8ZA 4FXWA 1C1CB 3M6UA 5D3GA 1QVGR 1JLBA 1TK8A 3V2UC 1Q16B 4XK8C 3U1MA 5C42B 3SXLA 3DCAA 3T5KA 2MY8A 4V19X 4TY8A 1CSJA 2J8AA 1G3OA 1VLYA 5ADZA 2O01C 2NYIA 5F9NA 3PEJA 2GGPA 2JSXA 1UFWA 4J9OA 3DMJA 4R0EA 3TR5A 2OJ3A 5CZVA 4DL7A 3ONQA 4I6WA 1FDNA 1R6YA 1XR5A 4CZCA 2CQHA 3W2WA 1X4BA 2JFKA 1ULRA 3MZIA 3N6LA 4MK9A 2R2RA 2ZUGA 3FFIA 2OTJS 4P7TA 3SI8A 1SKRA 2X3GA 2GQCA 2YKMB 4TXSA 2XMKA 4A8XA 2XG8A 3PRDA 2CQIA 1PGZA 4ID5A 1JJ4A 5K8PA 2YVSA 1Q8IA 1TL3A 1IUJA 2VH7A 5AXKA 4C7QA 3IGVA 2PC6A 4CTAB 3HLUA 4HDHA 3NMAA 2RQMA 4LQ9A 1ZOTA 4HDGA 3CDWA 2UU9F 1T94A 2F7VA 5DDOC 4CCHA 1HNIB 4FP9A 4DN0A 1YJWS 4UW2A 2DH7A 3M2UB 2KG0A 4K4YA 4H4KA 3E8OA 2DGOA 5KG0A 3O3LA 2RH3A 2G1DA 5A8WB 5BJRA 1U1LA 3I55S 4ELUA 2BANB 5K14B 5IWAF 3MR2A 3OSPA 3KLGA 2ZITA 3LO3A 3R3TA 2OPRB 3UCZP 4ILLA 2NUHA 5A8KB 3GIJA 3NGKA 3O1LA 3IAM9 2P9CA 3CGIA 1WI6A 2OPPB 4KQZA 1QAYA 4TNOA 1BC6A 1R31A 1FVSA 4YQWA 2PFFB 4JI1F 5J2PB 2ADCA 1DHMA 3CD5A 2XMVA 3OR1A 4M8LA 1UJ5A 3R5CA 1FDBA 5LSRA 5L1LA 3TVZA 5LJ5Y 3L95X 2XLJA 3BSAA 4DSJA 1RT3B 3M8PB 5GAEU 4DFPA 3K5PA 1RK8A 1R8CA 3CUNA 3GG1A 3EPGA 1SL1A 5HQ8A 2E7XA 5KT7A 4QOTA 2QMWA 3SDEB 2V4JB 1JLEA 3N0VA 2VV5A 1WHYA 3NWGA 2KN4A 2M0GB 5KFWA 1OPIA 4L3NA 2GFFA 3KNAA 2D9PA 1XBWA 2PGCA 2XMJA 2P6TA 2VFSA 5LJ3Y 1VBZA 4EUVA 3DLGB 3LGNA 4U9RA 1VQPS 4HL9A 2FVQA 5HL7Q 2VPZB 3G8SA 3CCUS 4M94A 1RT4B 2JZ5A 3OL7A 2XLIA 3MWBA 2YNHB 2J0QD 1B64A 2K3KA 1BQNB 2KT3A 2KZZA 2KZMA 2CIMA 1BQXA 2Z0GA 5KFVA 2UUTA 4IQXA 4K4TA 1SL2A 1FRIA 2EFVA 1N5YA 2P5VA 1GQEA 2QLXA 4Q0BA 5M2UA 3X3UA 5I3QA 1S76D 3EX7B 4DSFA 4LSLA 2FVPA 1HNZF 1QUVA 1C0UA 3NNAA 1JLGB 1HWKA 2O66A 4K5RA 4WK3A 4EWTA 3MUTP 4DFMA 1FT8A 4NA2A 4NLVA 5J2MA 4DV4F 3QLHA 1MMDA 2HGMA 2FJBB 3ZZUA 1N6QB 4B3OB 2EWHA 1ZM3A 2EK1A 2J7UA 3QJPA 3C6UA 2R8HA 4A8FA 2WOMB 2DHAA 1DTQB 2LA6A 1I94F 2B5JA 2HVHA 5G0RB 5EWGA 3DYAA 2W9CA 1MNEA 3D28A 3PW0A 1WF0A 3KK3A 1XMQF 2XBPA 2E29A 3QAEA 2MDAA 3FGVA 2JC0A 3TW0A 3Q22A 1Y5IB 2IA6A 4IRCA 2J9DE 4ECSA 1TL1B 1U26A 1S9EA 4YUDA 4X66F 2J5AA 2ZH9A 4RKUC 3M8RA 3GIMA 2JWNA 3MM9B 2A2CA 4GO5X 3JTNA 5HI7A 5DETA 1LFPA 1S9GB 3BSCA 3DU5A 1D9FA 2AJ4A 2XMWA 2MPUA 3ETOA 1CLFA 4DUYF 1QJHA 1VQMS 5C24A 1VQNS 1QTMA 4WE1A 2M8HA 2BE2A 1ZZFA 2YX4A 5FDLB 3TA2A 3T6JA 4MMOA 2APOA 5I42A 3KMQA 2IM0A 2HWTA 4C8MA 5JVHQ 4NCGA 5LMNF 1YJUA 3BS9A 2XWXA 3JSMA 1Q7YT 4NLPA 2V2KA 2RQ4A 4OI6A 2ILZA 1I6JA 1B0VA 1KLNA 2HRYA 2DH8A 2M8DB 3PY8A 1R27B 2FC8A 3DLEB 3PDNA 3R5AA 5CZXA 2WTFA 2AF6A 2FVCA 3MM5A 4DV0F 3FMWA 1UA0A 2FPHX 2V8HA 1QLNA 3GYXB 2HAIA 3KHLA 4BDPA 1SQEA 1LW0A 3TQ1A 5KT4A 4BBYA 4EFAC 2VG5A 2V8VA 4ES3A 2EI5A 4B9LA 2JOQA 4GC6A 4DWIA 2AX0A 3TAMB 5KT6A 2CPJA 2XNRA 3KLHA 1DTTA 1NHUA 3CJ2A 4PXBA 2FD2A 4WYLA 4TU8A 2IFXA 4DL2A 2M70A 4P6QA 5A2QY 2HRUA 3CD0A 4PWUA 3VF0B 1L3SA 3RU0A 3FSYA 5KG2A 1L5UA 2N3LA 4B3SF 2IMWP 3GV7B 4Q45A 2IVYA 2MZSA 1H2TZ 2D41A 2LDYA 2C3MA 2R2TA 1HHTP 1IKYA 1F60B 4OZJA 2F9DA 4O44A 1M1KT 1IN0A 4I69A 3MECA 5D3GB 1T03A 3ENVA 2BQUA 2J6TA 4IFVA 1SL0A 5KOXA 2KYXA 1RAJA 4M5DA 5K8OA 4TY8B 1N5QA 3I96A 5DDRC 1RT6A 4F25A 4XPEA 4B9MA 1LW2A 3KG1A 4N8NA 2WB1D 4F4KA 3V6JA 3ZZYA 3H40A 3DMJB 1RTDA 4FYDA 1WEZA 5BR8F 2VB6A 3ISZA 4IH7A 4QU6A 3GIKA 1BLUA 3DXBA 3K0JA 3W2WB 3KJVA 2XI2A 3M9MB 3NG8A 2HVZA 2YWHA 2LQ5A 2XSJA 5B0EA 1SUQB 3FFIB 3MOJB 3THTA 2J9CA 2CPYA 2PMHA 2VG7B 3TOQA 2RSQA 3I82A 2C3YA 3PR4A 3H4DA 2ZE2A 5IT0A 4ECXA 4OI1A 2KFYA 1K73T 4JI5F 2FJXA 4L6V3 1TL3B 2JVOA 4OJHA 4DV1F 4F3MA 2KYZA 2M9KA 5FLXY 1X9WA 3QIPA 2DGXA 4F3OA 2FUG9 3KFWX 1UEVA 4C0OC 1VC6A 2LVWA 2J9DA 4OX6A 5MAOA 4RWXA 3G6YA 3QGGA 2I38A 1UA1A 1S1XB 4WK1A 1K1QA 4QR0A 2CQPA 2JC1A 3D1OA 1UVMA 5DG7A 5FJ4A 5GMKa 3I0SA 3KLGB 3TANA 1U1PA 2EC0A 4N8OA 3G8TA 1JIHA 2DNZA 3KOAA 2MB0B 2PIIA 4PPDA 4IR9A 1JK9B 2C2RA 2RRAA 3DRXA 3MGJA 4JI6F 1K1SA 3MEDB 4KV8A 2I1RA 4IH5A 1GX5A 2FJDB 4DMZA 5KFJA 1RWUA 3OUYA 2BM1A 1SIZA 2ZH5A 4ILMA 2COLA 3OR1B 5J1NA 2B43A 3I56S 3POTB 3GQCA 1X5PA 4PR6A 2D3OR 1UVJA 3OR2A 1N5TA 5KT2A 5IM0B 4MJKA 5A0YB 1IQTA 4TU7A 4ZPCA 1NK5A 5DLGA 3NBPA 2Y0SD 1VS3A 4R25A 4IG0A 4NLTA 4MYTA 5KFNA 4JV5F 5CHCB 2AX1A 2YNIA 3RW7A 1Q53A 3PM9A 3CJKB 1D0EA 3H5UA 1JLEB 3HMJG 2C22A 1V3RA 2UUBF 2MQLA 4G3IA 4LT6A 5J2NA 2PD1A 4CT9A 1HYSA 4K4UA 3D1HA 1VRUA 2J7KA 2RU3A 1YJRA 3DOKB 3IO1A 3LANA 2D3UA 3MM7B 3H25A 5J2QA 1KLMA 1U24A 1UEUA 4IH6A 4KHMA 1Q8BA 3O2IA 4YB1P 3CC2S 3BQ2A 3GSDA 4XDDA 1U45A 3PV8A 2JVRA 3H5YA 4LIRA 1U8SA 2RRBA 5KFUA 3P49B 2I2YA 2DHSA 2JEFA 1FRMA 1RTIA 1KQFB 1FCAA 2ZDOA 1VQLS 2O3DA 1VC0A 5F0UA 1N5YB 4B9SA 4DLEA 2DNLA 4Q0BB 2DT9A 2QT7A 2ZJPQ 2IAJB 2OO4A 3W7BA 1EP4A 4OZLA 1JJHA 2QE5A 5L39A 1C0UB 4J37A 2UUCF 3W3SA 1URNA 4WZMA 2KXNB 4Y2MA 5DM7Q 2B4VA 2B0GA 3RRKA 4Y6IA 3QLHB 2E5GA 4NA1A 1RTHB 1GAOA 1KTVA 4OJ1A 1VBXA 2D9OA 3G6XA 1KR4A 5HMZA 3P3DA 1HBUB 4RU9A 3PW5A 1CVJA 3C6UB 1P1LA 2HMIA 3VQSA 4RW4A 4FZVA 3LP2A 3CCVS 1TAQA 2IM3A 3MMAB 1TVRA 3LGMA 1ZPWX 3DYAB 2WHOA 3MMBB 3KK3B 3BR9A 4A8SA 2WONA 2HW3A 1V3ZA 3H20A 4AXJA 1K0VA 3LUYA 3UI3A 1Z1ZA 1GTHA 4Q44A 1DQAA 2GA7A 5L1JA 3R5DA 4DL3A 1OQ6A 3CPWR 1NU4A 2HG4A 2OPSA 1FD2A 2OPQA 1FEEA 1R7IA 4ES2A 3RTVA 2Q43A 3HZEA 5DDPC 1QVFR 1IJEB 1S49A 1QAJA 2DR5A 3C3LA 3BN4A 4ZPWR 2V0NA 3DNCA 4ZVFA 2D3ZA 3FEYB 5E5NA 5F8GA 4WE1B 4B02A 2HZCA 3ZZTA 2P9EA 5I42B 2IRXA 4X62F 3I87A 2N7CA 1RYRA 4C8OA 4J9SA 1CG2A 2VPWB 4NYOA 4URSA 3OTDA 4HTJA 3DRSA 3IA0A 2KTQA 2HFZA 1QSSA 3JSMB 1JKHA 3IR7B 1O5JA 3EZUA 3ITHA 4QZVB 1FJGF 4ED7A 2R7TA 1X4CA 5KFBA 3CCWA 3BB5A 3HKWA 3P5TL 5LXYA 3HHDA 4KIAA 4ID8A 3HVTA 2MQNA 2Y1RI 5JJBA 3MFHA 1LW0B 3CD6S 4DV2F 2LEBA 1LXJA 1RGVA 2VG5B 1T95A 1FF2A 1W2BR 4DPOA 1HPZA 1LWFA 2ZNZA 3D5MA 1BY9A 3KLHB 1DTTB 1NH7A 1Q81T 5GADU 1S1WA 2NSBA 3KG0A 1K8AT 2HYIB 3AB4B 1DBDA 3NS5A 4I1TA 2CZVC 1NAQA 4KAIA 2UUAF 1R89A 3ICLA 3KHRA 1X7VA 3CDBA 1ZAWA 2QO3A 4RBVA 3I31A 2VUGA 2ZBCA 2HHVA 4MKBA 2CPHA 3K57A 4ZCIA 4FBUA 1KNZA 3JSRA 1ZAVA 4OZ0A 4YMEA 1X9SA 1HWLA 1IKYB 4O44B 3DLBA 4LUBA 1UJ6A 4OJ3A 3MECB 1JLFB 3AJ2A 3CO9A 4RW9A 3QWUA 2DNGA 1T03B 2FHJA 3ENWA 1TKTB 2O67A 3MMJA 3E01B 4IFVB 3B4DA 1FRJA 3IR6B 2VD3A 4Q2MA 2E44A 2V4QA 5IT4A 2L9DA 3PEHA 4I56A 1LW2B 2F40A 1NK0A 5C25A 2VPYB 1HWUA 4Q8EA 1RTDB 3HO1A 2LEPA 1HNWF 3TRGA 1HARA 4IR1A 1BD6A 1AFIA 1VGYA 3NNCA 1D9AA 1FJCA 3DRYA 3KJVB 3CCSS 3KMSA 2A1BA 4QIWD 3CJ5A 5KG7A 3VTIA 1MROA 2MZQA 2ZVSA 3SMZA 4WFAQ 1NHVA 2MKCA 2ZM6F 1IBLF 4NCBA 1RISA 3IWLA 3K5NA 3BR8A 2X1FA 1X0PA 1WD6A 1UWBA 3DDNA 1Y3JA 2YNGA 3DLLQ 2IYIA 5GADI 3OXFA 2WW8A 2AJ1A 1RKIA 2CPEA 2W24A 2ZH4A 4KRWA 1JLCB 5K9FA