4C98A

Thermus thermophilus cas6 (tthb231)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
268
structure length
242
Chain Sequence
b'GAASMPQAVVLELVGEKPPLYPARYAHGLFFALLSRVSPELAQKLHEAPRKPFTLAPLPGTLRLRLTTLDDGLFAPFLRALSSYRLARVLATREGHPLAGATSWEELKEAPKREKATFRFLTPTVFATSKTRYTPLPDPRLIAGSLLDKWQAHSPFPYNPKEEAALRELFELDLEVAGFRNLRFHRVQAGKGFFPGFTGEATLRLWSQSLEAQEALGRLHALAFFSGVGAKTPYGMGLAVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAS6B
publication title Evolution of Crispr RNA Recognition and Processing by Cas6 Endonucleases.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Hydrolase
total genus 55
structure length 242
sequence length 268
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10040 CRISPR_Cas6 CRISPR-associated endoribonuclease Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c98A01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c98A02
4C9DA 3QJLA 3QJJA 4C8YA 4C97A 4C8ZA 3ZFVA 4ILLA 3PKMA 4C98A 3I4HX 3QJPA 4ILMA 4ILRA 3UFCX
chains in the Genus database with same CATH superfamily
2GIFA 5KOWA 3R7NB 4X4PA 3TARA 4LF8J 3R5GA 4Q44A 3ZNJ1 5GMDA 4ETZA 3P3DA 2EKNA 1A9NB 4ES1A 2DGWA 3D3CJ 2VB6A 1GH8A 4JI3F 2ZOMA 5F8LA 4PWDB 4D3HA 4JYAF 1R0AA 3NGDA 2JVRA 5HQLA 4OV6A 5IQ6A 1QTNB 2AX0A 2CADA 3KG1A 3TZYA 2I0XA 2CPEA 2HBYB 1VC6A 4KV8A 2KVQE 4ZA1A 4UOHA 2BEFA 3BEGB 3PW5A 1RHUB 2J7KA 2DT9A 4YB1P 4ZLJA 2BJ8A 2VPXB 3X1LB 1R0AB 3DRSB 3MAQA 5DZ7A 2DNYA 3BYPA 3NS7B 1TL1A 2OPSA 3NLCA 4KV8B 1TL3A 4RO0A 3VF0B 3PEHA 2KT3A 2J8AA 5GVQA 4LIRA 3N6NA 4CCHA 1WG4A 1YITS 1Y5NB 3QSYB 2QG9B 4ZIVA 1Y7PA 2W24A 4X4NA 1IJEB 3TUPA 2HWHA 2QLXA 4P2SA 5LJ5Y 2YWHA 4CH1A 2HWTA 4G65A 1APSA 1OS5A 4ECQA 3CVKA 1TL1B 1X5TA 1RWPB 4NA3A 1GAOA 4EO6A 2P5VA 5F41A 3D0HE 2BM0A 2OJ3A 4B3MF 3CCSS 5B0FA 1N33F 5AE3A 2I9SA 4PCQA 3BS9A 3QBCA 3CCWA 4LFAJ 5IC6B 4QW9A 4C7QA 4PXEA 2GX8A 1S9EB 3NKYA 4JOUA 1VS3A 2Y1LB 1OIAA 3RW6A 2BJ3A 5DQIA 1TV6A 3KLVA 1RABB 1F3VA 2ZJPQ 4NLUA 3ITHA 1YRXA 2HHPA 1FJ7A 1NXIA 3NY0A 1WKJA 4KQZA 3HX9A 2EPIA 5CYJA 4HACA 4OX6A 4ED2A 1I94F 1U6ZA 1Q1KA 3W2WB 3R6LB 2LXFA 2VU5A 1OO0B 2AU0A 4EI2A 2E66A 2VDIA 4ED8A 2OD4A 3BO4A 3NGRA 1TK5A 2QLJB 4ED4A 4CM0A 5CH7B 3BB5A 3BH6B 1ITPA 3DLGB 1SQEA 4ZPVR 1UJ6A 2VOPA 1SH0A 1UZDA 2V8VA 3N0VA 5ETLA 4DCOB 1YJUA 1TV6B 1HHTP 2Y1RI 2IAJA 3T1YJ 1TU0B 4ZPDA 5D78A 4DX8H 4J7CA 1CG2A 1R0BG 2YKMA 5DQGA 4LF9J 2IIHA 4Q45A 3HZGA 1U09A 3VAGA 2CQ1A 1CS4A 4Q2MA 2HNDA 3H5UA 2DNQA 2B9XA 4ECXA 3MPUB 1G2EA 5DO2A 2DO0A 4U67Q 3CIZA 1WELA 2B9EA 4HLBA 3H5XA 2DGVA 2JC0A 3ZTSA 4Q8FA 4FF3A 5DDQC 5ETRA 3RB6A 4M5KA 2VG6A 1FNOA 1B0TA 2F8EX 3M1VA 4X4SA 4LR9A 4FS1A 5DLFA 3EDQB 3FNNA 2XLJA 1TK8A 4CLLA 1HHQA 3ISZA 1U1MA 1RCOB 1CPZA 1TFYA 1AXQA 4C0BA 2MQLA 3FRYA 4CO1A 4CP5A 1LNQA 2YH1A 2N4CA 5THWA 4LF1A 4BC7A 1X9WA 2MKSA 1FWPA 1TFWA 4PYAA 2HHHJ 4IYQA 1BLUA 2RMLA 1O51A 2KTQA 4DS5A 3VQTA 2VG6B 4ENOA 2C28A 1S10A 2SXLA 3UN3A 1QVGR 3IRXA 2H3EB 2MZSA 4U9RA 3DGVA 3IR6B 3KK3A 3KUGA 2ROGA 1HARA 4Q8EA 5K8OA 4UTGA 2JEJA 2V63A 3MURP 4I1TA 1SC4B 2EK1A 1M5SA 1FXRA 4P72A 4QU6A 2N4DA 2HHWA 1KN6A 3DLEA 1RCXB 5KG5A 3Q83A 1IBKJ 2VHGA 3BPSP 3DN9A 2HHQA 1SH2A 3ULHA 4ZJOA 2CQGA 3TAQA 3IRXB 1U2FA 4LSNA 1UJ5A 3KHRA 2V69A 2K2PA 3QRQA 3D0GE 3NNCA 1GX5A 4DR6F 2APOA 3AODA 2RS2A 1PGZA 4K4ZA 3I9ZA 1U1NA 2BDPA 2DHAA 1B3TA 1RT7B 5KFTA 2AQ4A 5LXYA 1Y5LB 3Q2SC 4C8ZA 3IMQJ 3NOCA 4RUAA 3CDEA 3PW7A 4RBTA 1U1RA 1U0SA 1LW2A 3CO0P 4D3GA 3LP2A 2DH8A 4F0MA 2XSJA 4OYIA 3IR7B 2B5JA 1UWBB 2PT0A 1CBKA 1S72S 8ATCB 4LSNB 3PW4A 4PG4A 4ZCLA 1Q8LA 2W7OA 2WCXA 3V6KA 1B7FA 2GAGC 3MD3A 5I3PA 4B3RF 2WVDA 4NZ6A 2GO9A 3CCVS 4DV3F 1FK9A 4KB7A 4CT8A 4MKYA 2CJXB 2XG8A 2ZJRQ 2NPIA 2H1YA 2VA2A 2HIYA 1C1CA 4P10A 1C4AA 1LW2B 3OVAA 3G8TA 3LP2B 3KJNB 3C66A 2KYXA 5HROB 3B4MA 4NYPA 4Y2CA 4OYAA 3EPIA 2K06A 3KJFB 3E3XA 1UA0A 1F5AA 1S6PB 2VG7B 1HW9A 2IDLA 1LOUA 4CO3A 1H72C 2U2FA 2VOOA 1T0TV 2UUAF 2OMLA 4HR2A 3PZPA 1SUQA 2NQPA 4B08A 4YN3B 4DCPB 4YEAA 1Q7YT 2CZ4A 2XC9A 2MQNA 1C1CB 3CJ8A 3A1YG 2Y0BB 4LR7A 3NXZA 2A0FB 1BGXT 4A46A 3OFHA 5D0HA 1DY3A 4DUZJ 1W2BR 1W25A 4PABA 1IBMJ 1NK5A 3G9CA 4OI6A 2JEIA 3DXBA 4F50A 1KHWA 2HGLA 3NCQA 1SUQB 4LBHA 1RBAA 5F9NA 3HSZA 4BCAA 3RJMB 1T9UA 1K8AT 3KUEA 2C2DA 3PX4A 4CLYA 1YJ7A 4O0IA 4ZLPA 3PCOB 2Y8WA 3MOZA 2Y1JA 4LRBA 4NI2A 3N5FA 2LU1A 2MQPA 3BGRA 1IR0A 1RP5A 2V4JA 2JWNA 3FGVA 2HQIA 1G4CA 2X1GA 2FJAB 1GK8A 4K5SA 1KBRA 2H51B 2QGFB 1EX8A 1FKOB 4ID5A 5HVFA 2X1FA 1NDCA 2Z56B 4XO0A 3PRDA 3BN7A 2LP4A 1FHTA 3DNCA 1S6QA 4OZ2A 4UW2A 4J37A 1IKYA 1TAQA 5CZXA 2ROEA 1K9MT 4K2JA 4N76A 5IWAF 5ETNA 4NI2B 1IXKA 4I6WA 3BGRB 2VA3A 5F8NA 3I5AA 1T05A 2ASDA 2YWGA 2ZNZA 3BDEA 1NCLA 1HNIB 3WBZA 2KXNB 1BMQB 1DAXA 2GMHA 2D3OR 3K58A 4MH8A 3BSAA 1OPIA 1IKYB 4ECTA 1H98A 1GX6A 3M05A 1KR4A 4JP8A 3EWGA 3SV3A 2DGQA 2RKIA 4O3QA 4DF4A 3OV7A 1K73T 3GCXP 1VOMA 1NSQA 1HQEA 4OZ5A 4DPWA 2KZMA 1T05B 1NM2A 5HMWA 1J2VA 3ET6A 3WIUA 4TNOA 1JQGA 4ZLLA 3L7OA 3Q8PB 2B7BB 4LF7F 3CJKB 3BV8A 2CYYA 4JI3J 1LXJA 1WORA 1RT3A 3TEHB 3CXCR 2YX1A 5C2CA 3H40A 2GZOA 2UVRA 4JYAJ 4AXIA 1LV5A 1UPMB 3NBPA 4O44A 2RKIB 4CTAA 3GU0A 3HO1A 2MKKA 3JSMA 1F2HA 5IT9U 5HVGA 1HQEB 4A8FA 4OYPA 3R5BA 4L72B 1M5HA 3KXDA 4ZHRA 1K44A 5IT0A 4Y2MA 4J90A 5E7OB 3PRBA 1DLOA 5C42A 1DURA 2D9PA 3TVZA 1R43A 2NYHA 1EB0A 4KGXB 3DRRB 2HS0A 2IC3A 4PQAA 5ETVA 1LQ9A 2IRXA 3FKBA 5KT4A 4F4ZA 1RTHB 2B9YA 5KFOA 1JIHA 1VK3A 3TX8A 4ZHRB 2IFXA 3IM9A 4B02A 5K14A 2B9WA 3MWBA 4QR1A 2DYAA 3TAMA 4E0DA 3T41A 3BYRA 3QRRA 3E01B 1DLOB 2FJDB 2MTLA 2ZH2A 1TL7A 1UW4A 3IBCB 3SFGA 1H7WA 2FD2A 5J2MA 2ZDOA 1ZM9A 1PJ7A 3UD5A 1WOSA 5DETA 3MXHP 3VZHA 2HBRB 1VRQC 2ZITA 4CYUA 4W92B 2EG2A 4NYZA 1RTJB 4MT1A 4FZVA 2FB0A 2MY8A 3F0NA 4B3MJ 3HT3A 3NCRA 4ZN1A 2KDOA 1QUPA 4DQSA 1N33J 4GKKF 4CIOA 2NYIA 2QLWA 3MAAB 2C3UA 3GCWP 1B0PA 1WC3A 3K2YA 3NL0A 5J2MB 4UUWA 5EX3A 4A48A 1FVQA 4EYIB 1YK9A 3FCWA 1RAAB 2FC8A 2HVZA 3BKUA 4F67A 3PRVA 1JLCA 3QPIA 3Q8SB 2WSCC 4HT5A 4CDIA 3GIKA 1HLWA 1WHXA 1I94J 2P9CA 2WBMA 4EZ9A 2UVVA 2BABA 2ZE2B 2DCUB 2VICA 3MR5A 2ROPA 3D7SB 4L74A 3RBXA 3MCOA 3HHLC 3HZEA 1M0SA 4P2MA 2HG4A 3AQPA 4WP3A 4EFAC 3BZQA 1WF0A 1HMVB 2YQ0A 1VCTA 2X3GA 1OQ6A 3H90A 2CG8A 1JLCB 4OZ0A 2H4WB 1FWLA 5JVHQ 3EXCX 3UCUP 4Q2LA 1IM6A 4MIAA 2XMAA 2WVEA 5J1EB 1VQPS 2YBVA 4DPOA 1X5SA 5EUHA 5KT3A 2BW2A 4K0KF 3KK2B 3LPEA 3MI7X 4LMZA 2GJ2A 2HGMA 1UVKA 5FDLA 4OZ3A 1URNA 3DDIA 2WZ1A 1IQTA 4PPZA 6AT1B 1SJQA 3KKFA 3B82A 2DR5A 5AXKA 5CAAA 1X4DA 2H48B 3KHLA 5C7PA 5KG1A 3C6TB 3MM5A 1U02A 2DGOA 1NDKA 2D69A 4WP8A 2BJ9A 2LCWA 4Q0BA 2BQUA 3PYDA 3I32A 5HJYA 3G71S 3ONQA 2MMYA 5FDLB 3G6XA 2AJ4A 2ZKTA 4O3RA 4OJ3A 3PR4A 5IM0A 4P7VA 4RKUC 4WZQA 5AE2A 1QJHA 2L48A 4ZVHA 4ED6A 4CO5A 1FD2A 2U1AA 1U1LA 3Q8UA 2MGZB 1MNEA 4USTA 1RAHB 4JI2J 2QEXS 1S4EA 1NHVA 4Q0BB 5JUMA 1KTQA 4K4UA 2X1AA 3D6FB 1ZAXA 4F4WA 3C8YA 2JH3A 3ZO7A 3M6XA 4TYBA 1FEHA 4GVBA 4JV0A 1N0VC 4MIWA 3UNGC 1JLEB 1SV5B 1N34F 2PFFB 1ZM4A 2IVYA 3TR5A 3DRPA 1WG5A 3QT6A 5HBMB 2LMIA 4K4XA 2UXBF 3MECA 5DGAA 3GJRB 1HBOA 1NK8A 4NLWA 2O3DA 4K4SA 4RW6A 3MM8A 3CDAA 4ZCMA 1R3NA 4WXWA 4DR6J 1S99A 1KQSR 4QZVB 4ERDA 2ZBCA 5HATA 4EGLA 1RAIB 2BYCA 1V5VA 3WZ0A 1VK8A 2YKNA 2Z2MA 4GVBB 4DN9A 1UA1A 2FLLA 3M6VA 1UEVA 4DEZA 1JMTA 5D8HB 1S4FA 2W8LA 3DRPB 3MEGA 4LSZB 2DPJA 4FF1A 1HBOB 3L95X 1NSKL 3MM8B 3BQ2A 3OUYA 3PX0A 2I1RA 4DX6A 2UVUA 5K8MA 3TW0A 4LVOP 3GV5B 1NB2A 2V94A 4RW8A 4B3RJ 1C1BA 3JAMU 2Q6BA 1NSPA 4HH1A 3MR3A 5I3UA 5KFEA 4DV3J 5C25B 2YKNB 5MLCV 2OD6A 2ZVIA 3ENAA 5FIIA 2ZUGA 2ZZMA 4PKDB 1D0EA 1DBDA 3MEGB 3KG4A 5A0YA 2ZH6A 1E6VA 3AD9C 1KTVA 5A8WB 3M32B 2XMWA 3D1OA 1YVFA 2IBOA 2LA4A 1C1BB 4MKAA 1RXOB 1V6HA 3F73A 2MSTA 3TA2A 5EDWA 3GJTB 3P49B 1F1BB 2ZVSA 2EFGA 2YKAA 3FBEA 2MKHA 2IA6A 2Y8YA 2MKCA 1CSJA 5L46A 3HKWA 5A0YB 4FYWB 1E6VB 4NA1A 4M5IA 3RRKA 3NGSA 4DZDA 3PFOA 4F3OA 1KC8T 2BE7D 3N5BA 1N88A 3CC7S 4K4WA 1S7IA 3M7VA 1F9HA 1EQMA 3U7JA 2PDAA 3AJ1A 4AYBD 3S01A 2HKEA 3KTQA 4C11A 1VRTA 1UPPA 2V5HG 4F26A 4ZN3A 3FQLA 4F3MA 2XWXA 4R5PA 2E5LF 2YVSA 2FVCA 2VDHA 2D3O1 3VWSA 4IO9Q 2CQIA 1X4FA 1FX4A 2XYPB 5DDPC 1BC6A 3NNHA 3BH7B 2D3UA 2CJYB 4R0EA 3QGGA 2LECA 4IG3A 4M5LA 1VLYA 1Y11A 3AB4B 4IR1A 2KT2A 4Z2XA 4U95A 1VBXA 4FS2A 3NMAA 3BDPA 1N5SA 2R3VA 2EFVA 3OR1A 2XM3A 2DHXA 1TL4A 5IWAJ 4R25A 1YI2S 1NEEA 3DOKA 4TU8A 2UUBF 2CQ4A 2C42A 4DDFA 3D66A 4WYWA 3A3PB 1AT1B 1RT5A 4ZVGA 2BUNA 4NLVA 3OLBA 2OHDA 4DSEA 4DUYF 3LPYA 3RR7A 4KKOB 1R0CB 3SDEB 2DTJA 1VQ4S 4DPYA 2HQ3A 3KFWX 3AA8A 1FDDA 1N0UA 2QIFA 3EVWA 3DOKB 3TUJC 4C9DA 5DM7Q 1SL1A 1SJRA 2DISA 1WI8A 3V4IB 4FNIA 1XMBA 2ZBQA 1WTBA 2CA9A 4UZCA 4PR6A 3CJ3A 4NCGA 5I4MA 1MSWD 1RT5B 1W26A 1PYTA 4Y0FA 4LF7J 4RUHA 4DV7F 3U1LA 5IFMA 4Y34A 4QWBA 4CNZA 2CDQA 3QAEA 2EK6A 2MQ8A 2M4MA 3UN2A 2G13A 2K7KA 2PSZA 2P8IA 4B9VA 2CJ9A 3K57A 3DRYA 4TLQA 3GJSB 1EAYC 4HTIA 3V5RA 2A2CA 2XZTB 5CYQA 1SKWA 2WVCA 1Z1ZA 2GV1A 3MHYA 1RTDB 1B7YB 2HQGA 4P73A 1XQIA 2RDDA 3CD6S 2DR9A 2G4BA 4M95A 2HZAA 3US5A 3OLAA 2F1FA 1JLGA 2QL7B 3UR3C 3HHEA 2QFJA 1U4BA 2KFZA 5KG4A 3T5JA 3Q89A 3CIMA 4XPEA 3RAXA 5HVHA 2FQQB 1IKWB 1VQKS 4DSIA 2DGSA 3M2VB 3P5BP 1HL6A 3VGSA 4KGKA 2MDAA 3MOJB 3T6JA 1HQUA 2XGPA 4K4VA 4WP9A 4O0NA 1P9YA 1Y9OA 5G4DA 4EZ6A 4DFMA 2CPYA 2GMJA 2EW9A 3F56A 5A8KB 3UQSA 4HVZA 2ATLA 1MLAA 3ICLA 1JLGB 2LQ5A 1HQ2A 1RZMA 5L39A 1XERA 2OFGX 1S1XB 3G2XA 5C24A 2WRMA 4LRDA 3OL6A 4ZK7M 4B9UA 1NO8A 4GVLA 3N01A 1ZAVA 2M5YA 3DU6A 3VTIA 4ZDNA 3LP1A 4YOEA 2YQ3A 2IBKA 3TZXA 2EBGA 1T9WA 1A0OB 3FVYA 1WWHA 3HVTB 4ZPWR 1TKTA 1YBTA 3G82A 1DJ0A 2Q1LA 2FLNA 4GKKJ 2FYXA 4V19X 3HSJA 2GS8A 2BJ1A 1B70B 4G6VB 4GKJF 2R8KA 5ETMA 2OP5A 4ZVQB 3ZTQA 2QYGA 4WU2A 3I0RA 4J9KA 1HIYA 3O1LA 2WW8A 3ISND 5D6GA 2RNEA 4RR5A 1KFSA 5C24B 1JK9B 4EU0A 2R7VA 3M8ZA 2W7AA 4J9LA 5K9FA 5LSOA 2P9EA 1U49A 2BMBA 1TKTB 3MPVA 3G82B 4B3TF 1WOOA 3DLKA 1HI8A 2DHSA 1S9GA 2XMTA 4TYAA 1CJTA 5B7WA 1TVRB 2GMLA 5DG9A 1D9DA 5HANA 1Y00A 1YKWA 2CAJA 4UOCA 1X4HA 3P6YC 5KFUA 5J2QA 1V3RA 2H54B 2HSEB 2E5IA 3FDSA 4X4TA 4Z7CA 4A8YA 2YPZA 3ZTRA 4YQWA 2UXDF 3W3SA 1DTTA 4UQTA 4ZLNA 2M8DB 2MYFA 4LRAA 4FXVA 2DRAA 4DR3F 4CI0B 4B9NA 1GEHA 3R2CJ 4YB5A 3DLKB 2B4PA 3LALA 2NREA 3QZ8A 3M8SA 1S9GB 3R5DA 2PEHA 2QL5B 4DV5J 3UN5A 1RE1B 4NMLA 4K0KJ 5F3TA 4N8NA 1HPZB 1PBUA 2V8GA 2DRBA 4WPAA 1PJ5A 3QSIA 3I56S 4QYZK 3NGUA 2EKYA 4L3NA 1DTTB 4QJVA 3HFZB 3RRGA 4DXLA 3BR9A 3N6LA 3CNQP 2C2ZB 4NWBA 4L76A 3NEKA 5K8NA 2KXHA 2V0NA 4NZ0A 1S48A 1G7CB 1RBLA 2A1BA 2VUGA 2W9BA 5CZVA 4ZP8A 2HFVA 2XY6A 1BQMA 3KJQB 1GXUA 4H4MA 4NEZA 2MKYA 5IT9Y 2EWHA 3CDUA 4M1KA 1MG7A 3D4JA 1VIOA 4J9RA 2XMUA 2DNHA 2HGNA 2ACYA 1BD6A 4WTOB 2V68A 4CLSA 1FEEA 2UP1A 1HYSA 1GXLA 2B8QA 1TKXA 4O4GB 3TI0A 2OTJS 1D9AA 3Q8RB 1RLCL 1P27B 3D68A 2CVIA 3BM7A 2MZQA 2IMOA 5IXUA 4UUXA 3SMZA 2AYMA 3SSSA 1N34J 5A8RA 1MW7A 1PYSB 3EGNA 4CQ1A 4P7TA 1YIJS 2XNQA 2UXBJ 2PE8A 3DMJA 3NG8A 2EVZA 4ATNA 3GIMA 1WSVA 3CCMS 4C8MA 3THVA 1TKXB 1D9FA 1RDRA 5KT6A 4P75A 4AL5A 3D2WA 3UPFA 1WC6A 3AHPA 2FHOB 1LWCB 1YWXA 2DIUA 1W2IA 1Z2ZA 1IWAA 2A3JA 2ERRA 3BO2A 4KPYA 3L4BC 3HPOA 1H2TZ 2O01C 1FNMA 3UR0A 1Q95G 2FY8A 1TK0A 4DSKA 1GNKA 1WNEA 3DMJB 4JI6F 4X66F 3BKTA 4DX7A 1CJUB 5KG0A 2N7YA 1RWNB 1SJ3P 2XO7A 4C48A 3PO4A 4F4YA 3H8YA 1UFWA 3WX8A 1F9FA 1NRKA 3AT1B 4E2FB 1EKRA 4X4UA 2G0CA 2Q43A 2KRBA 1NK0A 4QCLA 2HMIA 1WC1A 3J81j 2DKOB 1I51B 3RB0A 2RS8A 2CIMA 4I7FA 1NPRA 2HNYA 3OFEA 1NK6A 2GFFA 4WZMA 4N8OA 3M2RA 2IM0A 3G6ES 3MPDA 1S0VA 1NKEA 2IJFA 3G8QA 4BWJA 2Q79A 3UVJA 4PRFA 2L9NA 4TLRA 3QMQA 3HHDA 4OYMA 3WHIA 4FPIA 1FTCA 4Y28C 4X4VA 4KSEB 4X64F 2ZBIA 1T9TA 4UF4A 1JXLA 4RW7A 1LK7A 4YFUA 5GADI 4I7FB 2WB1D 4RUCA 2DVIA 3V2UC 1RI7A 4NL5A 1SC3B 3C16A 2VQEF 1CQMA 1TTHB 4OZ1A 2MXYA 2V8DA 3M2RB 3Q24A 4B3OB 3CSKA 3OR2A 2OH2A 3J7AN 3UVJB 5EN1A 2HAIA 4BHQA 3RG6A 4J9PA 3IGNA 4C8OA 3OSNA 2DH7A 2FJWA 1Z2LA 4TXSA 1PAEX 2F65A 3CCTA 3M8YA 5K8PA 4NXMF 2ZZNA 3M30A 2Y1IA 4F3QA 3DOMA 2UV8A 1L3KA 3HHNB 4RW7B 3V6DB 2QA2A 2XMJA 2HHTA 2E5LJ 5T14A 1SJ1A 2GW8A 1FA0A 2KM8C 4UY8T 1T8EA 1QTMA 1U8SA 3EZ5A 4ITSA 1S76D 2CWXA 2QMUB 5B0EA 1TZ0A 4OJ1A 5KFSA 3P8BB 2HQFA 3OFGA 4RWWA 2Y0SD 2XCPA 3C2PA 4C2MA 3H42A 4ECRA 3EZOA 2CNLB 4AQYJ 5M2RA 3DU5A 3AXMA 3DHXA 3M30B 2E9ZA 3DOMB 3GFXA 3GWCA 4K2XA 3L09A 3KNGA 4I2QB 4CLUA 4NLSA 1URRA 3W5YA 3O8WA 2HRTA 1TMJA 2QSFA 2XCAA 1L3UA 2UUBJ 3LAKA 2YKQA 2DNKA 2BJDA 2E1RA 2I6WA 2ZHAA 3CD0A 3FEZA 3IG1A 5KFWA 1XN9A 1HD1A 2OTLS 2KFNA 1S1VA 3TWZA 4DFPA 2ZH3A 1Q16B 4DUYJ 3KMSA 4ZS6A 2E7XA 1VC5A 2VPZB 4NEYA 2ASYA 5B0DA 1T7PA 3MPYA 2VODA 4OYXA 2R2TA 3CMES 2G2ZA 4OI0A 1S1TA 2AYEA 2J5AA 3RYLA 3MM7B 1MWZA 1X4CA 1FVSA 1CULA 5KAKA 3IG1B 2JC1A 3M6UA 4KGZB 3UO0A 2RQMA 3FFIA 4U7UD 5KFYA 1N5TA 3CDBA 5DZ6A 4DV7J 3I0SB 1S1VB 2ZZTA 2KO1A 3SCLE 3GFHA 1X60A 2VKRA 1HBUA 3LWMA 8AT1B 2J0QD 1VQ6S 4ED7A 2VFUA 2CNNB 2E7WA 1RT4A 2FC9A 5IOLA 2KN4A 1UKUA 4QPXA 5KTQA 1CULB 3KMQA 1G6BA 3FZBA 1S12A 1D09B 2Z0GA 5LMNF 3FFIB 4C6AA 2J9DA 2V2ZA 4J5OA 1SQFA 5E3RA 2LEPA 1HBUB 3LUYA 2W2NP 2CJBA 4IDKA 4DSLA 1RT4B 4TU7A 2M9KA 2LYVA 1QM9A 4JI4F 2VFTA 3TZZA 1V5IB 1TUVA 1HI0P 3DOLA 2XY7A 2M52A 1Q82T 3POTA 3PTWA 4QIVA 1WI6A 2JVOA 2HVDA 3H7HB 4QIWD 1BE4A 1RT2A 3BO3A 2QX0A 3OPKA 2RRBA 3AFGA 1Q5VA 4RBUA 2YNFA 4QIEA 1QY7A 4ECYA 3GQCA 2B7CB 2WONB 2YNGA 2E1PA 1VDHA 2QZ8A 2Z2YB 2OGUA 3MAHA 3EXYA 4G1PA 4LF6F 3KUHA 5BYRA 5IC4B 3IWXA 4J9QA 4H4KC 1FRHA 5B0GA 3DOLB 3O6QA 3K5NA 1FE0A 1VYAA 2QRRA 4YB7A 2H4YB 3POTB 1FRMA 3FCVA 1AB8A 3AJDA 1RT2B 1F6TA 3KDOA 3BF4A 4A8KA 2DGUA 2YNFB 2L08A 2CPXA 2N3OA 2OPPA 4F0KA 4QWCA 2B6AB 4A8WA 2YNGB 2J7WA 2WSFC 3GB0A 3TOQA 1EARA 3R1HA 1R7IA 2O5DA 3BSNA 5DDRC 4CLKA 4Z7YA 4ZVRB 1U1OA 1O5JA 2GA7A 4ZVTB 5H9FJ 1HBMB 2IA0A 2QE5A 3LW5C 2LEBA 2R42A 4ILMA 1M1KT 3Q22A 4B3TJ 4IFVB 3VZIA 4CZCA 2G2YA 1U25A 2CUYA 1VQ7S 3MR2A 3TYTA 4R0JA 3HI9A 4LRCA 2J8SA 2FLOA 1LW0B 4CM2A 2PA3A 2VBXA 3K5OA 2VZ9A 3MFHA 1KQGB 4YDDB 3AAWB 3K5LA 2NZCA 2CNKB 3TO8A 3AXKA 2UXDJ 2RF2B 2DEIA 3TJ8A 1XR6A 3CT9A 3TVYA 2D9OA 3FBCA 1HWLA 1IWGA 3MTKA 4DR3J 2R4FA 4PWDA 3TZWA 4ER8A 2QV6A 4X4RA 1RACB 1NPKA 4GO5X 4EWTA 2DR6A 2J9DE 3I5CA 4YS2A 5DJBA 4ECWA 4AL6A 3QIPA 2FHJA 1B4SA 2AEMA 2ABYA 2CQPA 4K5RA 1S97A 1R27B 2G0IA 1TL5A 3DYAB 3BPDA 2BW7A 5KG6A 1R8AA 4NASA 2Q66A 1N5YB 3C15A 2MJNA 4DG1A 2HZCA 3TJAA 3OFFA 3DRSA 2FHJD 1YJWS 1IR2A 2W2QP 2XWYA 3QIPB 2FVSA 5KT5A 4KGVB 1UVLA 2OLWA 3T5LA 4MK7A 5L1JA 3IRWP 1YRUA 2FVRA 3GE9A 4PG7A 3BSOA 5GAEU 3J81Y 1FF2A 5E3PA 2MQQA 3C15B 3M8PA 4MFBB 2ZHOA 2B3TB 5CD4A 3W5XA 2HNZA 3N4WA 4DG1B 2RDJA 1JJ4A 1H2UX 2R8JA 3U1MA 2WOMB 3OXFA 2ATCB 2RHSB 1HWKA 2F9JA 4KYZA 4ED0A 2KT5A 2JL9A 3MCNA 3Q23A 1VQ5S 2CJAA 3GONA 2Z2ZA 4CH0S 2R2RA 2ZDPA 2RRAA 4JI5F 4DV2F 5D15A 1YTYA 2J76E 1HD0A 3EDRB 1X4GA 5HO4A 2WVBA 5A76A 2FHMA 3GYGA 4I69A 3M8PB 3ZZUA 5I42A 2LFVA 2HNZB 4WTYA 1S9EA 1KD1T 1TELA 3NS6A 1XTZA 1CC8A 3THTA 2DNGA 4PXCA 5HL7Q 4F2SA 1WC0A 4U6PA 3GYXB 3ZZZA 4RNFA 1VQNS 1FT8A 2BRKA 1P1TA 1KHVA 3IWLA 3W62A 4DR7F 3UDCA 3F41A 3D1QA 3W2WA 4C8KA 1U6BA 3OL8A 3JYTA 1TKDA 4W98A 1S49A 3CJSA 3PKMA 4DL0C 5I42B 3QRPA 4JI6J 5KFXA 4LF2A 3LOUA 4TY9A 2CZVC 2OEMA 4X66J 4B9LA 3DLGA 4ETXA 2RQKA 4KAIA 3U27A 4CWBA 3W65A 3GFZA 3DFEA 4DV4F 3GG1A 3LQVA 2VFVA 1JX4A 4F02A 4QU7A 1ZM3A 2MHEA 1M5OC 3JYTB 3G4SS 3GMGA 2QL9B 2LU2A 2CVEA 3AQOA 4LIWA 3M9OB 2BE2A 3H25A 4QR0A 3R27A 2AJ2A 3HHKA 4XDDA 1YGYA 2QTWA 5EWGA 4IQXA 2AGOA 2GVDA 4DPUA 4QBUA 5DQHA 3DLLQ 2ALYB 4USJC 4DL6A 1NK9A 3HD1A 2VL1A 4X64J 2P6TA 2FTRA 4H4OB 1SB6A 3RB4A 1VQMS 2BE2B 1E6YA 5CABA 4EO8A 2UUWA 1VMBA 1LEOA 4DR5F 2EFQA 2PIIA 2N3LA 2VQEJ 5HP1A 2DXEA 1VBKA 3MMBA 3PY8A 2GVDB 5RUBA 4WFAQ 1UP1A 1WEZA 1YQHA 2E1AA 5CYMB 3LAMA 3OQ2A 2VH7A 2MQMA 2HVIA 3CDWA 1R8PA 1PC4A 2GQQA 1Y5IB 4MJKA 4J9NA 4NXMJ 3MEKA 3ENQA 4JI7F 1BQNA 3PIOQ 3Q8VA 4U8VA 3T5KA 1G3OA 1E6YB 1WDDA 1U48A 2X3DA 1F60B 3MCMA 1X7VA 1MROA 3JB9k 1S5ZA 4A8XA 3SCKE 4Y65A 2CKWA 3PR5B 5HP1B 4PG5A 3MMBB 5D3GB 2C2NA 2J9EA 5FD1A 1FFWB 1VRUA 4EEYA 2FLPA 1VJQA 4RNNA 5GADU 1XNQF 2BVZA 5F8IA 1YDLA 2NXNA 3R8YA 2AZ1A 4FNHA 4KRWA 4HTJA 2GJIA 4JI2F 1O0PA 1BQNB 2G0JA 3MM9A 2C2KB 2R7QA 1QVFR 2F3JA 3GSIA 4PAAA 1MROB 1Y3JA 3M9MB 4JI8F 2CWKA 1RT7A 5A6PA 4B9SA 4TQSA 3C19A 1WTFA 1ZPVA 2B4VA 5E0OA 5KFFA 2RIJA 1VRUB 4AXJA 1KVIA 1P9QC 1ZA2B 1F5BA 2RJZA 1D8ZA 1WF2A 3PACA 3KJVA 1UWBA 3MR7A 3B6BA 3MM9B 1EKSA 3SSRA 3ZZPA 3BREA 3SFUA 4UQGA 4IOCQ 1T95A 4C8NA 2XZWA 5AXLA 3IBWA 2DCLA 3UWTA 3SSQA 3JTOA 1LWFA 3HP6A 1P1LA 3ZTOA 1JLFA 1UETA 4LF5F 4QYZJ 1YJNS 2DXDA 2UUCF 1U26A 1CJVB 1Q8KA 2Z57B 4BLGA 1IVZA 3EGVA 4X84A 3TA1A 3OTDA 1KVJA 5HROA 3KJVB 1UTAA 1KFDA 1FJGF 2C2EA 1TR0A 3DI6A 1S6PA 2VG7A 4OHVA 1UL3A 2Y3YA 3ZTPA 5CCMA 5KG3A 5CQGA 5KG7A 2F4VF 1LWFB 3UD4P 2OPRB 4BWMA 3J7Z5 4DL5A 1JLFB 3TJ9A 3D1HA 2XI3A 1XR5A 1GFWB 1H2VZ 5LMNJ 3I5BA 3PHEA 4URSA 2W4DA 2RT3A 3OTEA 3B4DA 4DUTA 3S6EA 4I6AA 4IRDA 4DMZA 1TUWA 2ZD1A 1RKIA 1ZH5A 1MN7A 3GIJA 3DI6B 2GIRA 4JI4J 3J80Y 3QIDA 5K20B 2K3KA 2OUGA 3IM8A 1REGX 1CQNA 3H4DA 2MKJA 1KOHA 2I5JA 4MAKA 2BACA 2H65B 2DK2A 4C0HA 5HMXA 2B4UA 3QLHB 1RHKB 3MEDB 3SXLA 1XMOF 3PVXA 2XS2A 3EYZA 5LOQA 3CMQA 3ENVA 3CW2C 4DR1F 3MCSA 2YNIA 4N5SA 1JLQA 4NLXA 3MMCA 3A8JA 4NYOA 3AA9A 2K1RB 3VALA 2K3IA 4DX5A 2ZD1B 2E7VA 1FDBA 2M8HA 3QJPA 3W8GA 4LF6J 4OX8A 3G86A 2NSCA 5HLFA 1LKZA 5DLGA 1AZSB 2VG5A 2P2CB 2I5JB 3FJ2A 1FKOA 1L3VA 1PILA 4I4BA 3I55S 2R7TA 3PV8A 3HCXA 4F7VA 4MK9A 3J7YU 4DU7A 2XNRA 5FLXU 3WIVA 2G1DA 3PJ9A 5KFJA 1OY9A 5KFPA 4PPDA 1Q8BA 2YNIB 2LEAA 1JLQB 4H54A 3MMCB 1ZTTA 3FSYA 2E29A 1R6VA 1AFJA 4A47A 3C14B 1XMQJ 1EP4B 3OXGA 1GT8A 1MWYA 1VHFA 1RHQB 5HLFB 1K1SA 2VG5B 4OJHA 2HAFA 1AFIA 1HNIA 4PG8A 1VBZA 3CPWR 1QUVA 2AYBA 3OD2A 4ZJLA 3BGOP 2D7SA 1UVJA 4CLFA 1FXLA 2MY7A 2OKQA 1C0TA 5L1KA 2GQCA 3KLIB 3SCIE 3H5YA 4I2PA 3PYEA 3RBDA 1ZS6A 4NRTA 1OSCA 3LGNA 2HQCA 4USIA 1TKZA 2J6SA 4DL7A 4WIIA 5DGBA 2DNPA 4C0OC 1QAYA 4O3OA 2XI2A 1U24A 2CQDA 3CJKA 1RWXB 3UE2A 2YX7A 3T1HF 3S1TA 1KLNA 4DBQA 1F5CA 3PYFA 2N82B 3MMJA 2YH0A 4WBFA 3BBCA 3QGHA 4TY8A 4NZ7A 1C0TB 4I2PB 1QAXA 3B8HA 2L9WA 2LQJA 1NKCA 3ZXWA 1I5OB 3A8KA 3M4XA 1TKZB 4KO0B 5U47A 1X5PA 5J2PB 1MWQA 2MSSA 3K8VA 4TN2A 4ECSA 2RUSA 2AP6A 4GC6A 4OZLA 4OX9F 2R2UA 2CPZA 3HHLD 1CEZA 2HWIA 4DR4F 4RPFA 3HHLB 4DU8A 3DXSX 3H20A 2NR0A 1H74A 1VIXA 2JFDA 3TUZC 1XWLA 5GAGI 3D0IE 2VC0A 2CFXA 4TY8B 2BM1A 4OZNA 1RWKB 1SXLA 4IFYA 3DRRA 4N56A 4KJIA 3MFIA 1YZ6A 2FUG9 1RJJA 1REVB 1TUGB 4W4MA 5KFZA 3GR1A 1YZ7A 1JXEA 4DJBA 1RTHA 1I6JA 3K5MA 1VR6A 3CCZA 1S1WB 3W1YC 3ZZTA 2LQ8A 3X3UA 2XQCA 1MU2A 2COLA 4DPTA 1OPZA 1R8BA 2ZC3A 3QO9B 3NAIA 4PUOB 3E01A 3KK1A 3R6GB 1RA7A 4ZVUB 2OI2A 4FYXB 1IKXA 5DRKA 1YSJA 3CO9A 2RVJA 2HS3A 2XGQA 4IFYB 2IM2A 2HHSA 5D0EA 1RTJA 3W9IA 4JI5J 2MJUA 4DV2J 4USKA 5AJ3F 3RUBL 5EX0A 4OI1A 5HMYA 4AL7A 4WF9Q 1Y4ZB 1SVDA 2ZOFA 2ASLA 1WKLA 1MU2B 4NLDA 1JKHA 3SIPB 3RAQA 3OL9A 3MAAA 2NLWA 4USUA 4JB8B 1N8RT 1Z4UA 2PMZD 1T3OA 3KK1B 2BJ7A 2Q6CA 3V6HA 4DQQA 1A7GE 1IKXB 2RB7A 4LBPA 4DV1J 4ZPAA 4B9TA 4FYDA 3L9ZA 4OLPA 3CWJA 2C3PA 4C3MA 3O3LA 2DPIA 3CJ2A 1GTEA 4F8RA 4QIGA 3S7RA 3RBEA 2HFUA 4DR7J 4IO1A 2KHCA 5HJXA 2DGXA 3HD2A 2DRDA 4ANDA 3RZAA 3D6TB 1KVKA 4U8YA 3KWMA 5H9EK 3M9NB 2ZE2A 4DOZA 1JKHB 4FF4A 3ILIA 3JTPA 3HVWA 1Q53A 4YR3A 2C3OA 2ZH1A 1X4EA 2ZC4A 1VGYA 2BANB 3BGLA 1HMVA 3HJVA 1NK7A 3SEOA 4I6YA 1KRPA 2RH3A 4ZJQA 2E1MC 1N6QB 1KLMB 4DV4J 3TQ1A 3MGJA 2E1CA 4JI0F 4M94A 2AT1B 5J1EA 4ELTA 4PWUA 1HNXF 4N77A 4NCAA 2R7XA 3BSCA 2V9WA 3KK2A 2XZDB 1C2PA 3PM9A 1AA1B 5BYQA 3CD5A 3D6MB 5ETOA 3HF5A 4F4KA 2GHVC 1KS2A 5L1LA 1X9MA 3NS5A 3DDNA 1S7HA 3MMAA 3FBBA 2KKHA 4NOHA 4DI6A 1MMLA 1JJHA 1ZOTA 1S1UA 2EFOA 2XYGB 1X4BA 4A4JA 3GLJA 2DD8S 4E8UA 3C6TA 5DG7A 4NLGA 4A8OA 4DV5F 2A6MA 2YWKA 2LQBA 3FMBA 3ETOA 2YWFA 3VHQA 3UW1A 1EIYB 2RILA 4DR5J 1AYEA 1UAWA 2BZ2A 1IN0A 4LBIA 4X65F 4G3IA 3SV4A 3GV7B 1WUUA 3MMAB 2LKZA 2HW3A 1RWMB 3I4HX 2ZH9A 3CULA 1I3OB 4KTQA 3CF5Q 4DV0F 1S1UB 2KJWA 4EBCA 2MGZA 4F0HA 4RNHA 3FMWA 2WHOA 4JI7J 2W2MP 1ZAWA 4UOFA 1KEKA 3RW7A 4ZKAA 1DRZA 5IV3A 2QLBB 1HW8A 5HQMA 5MAOA 1Q4RA 2K7JA 1SJ4P 2CQBA 4C4WA 3A8IA 2BOAA 1GMWA 1JLEA 1SV5A 4QIFA 5J1NA 1HR0F 1ZETA 1FTRA 4WXOA 1XNQJ 3R5CA 3IR5B 3E51A 3BKFA 1AUDA 3Q2TC 5F9LA 1U1QA 5HBMA 3VQSA 3VV2B 4X4OA 3KNAA 1S0NA 1FKAF 2JLGA 2IJRA 1D8YA 3TRGA 4JI8J 5J2NA 3Q86A 4FP9A 1FWKA 1X5OA 1OMSA 2GJFA 1Q81T 3PYGA 2FGCA 1GMWD 2BR0A 2OPSB 4NLTA 4KH0B 2MB0B 2XB2D 2CPIA 5B08A 1TL3B 1ZTWA 1NZAA 4LVNP 4KIAA 4DQRA 2VIHA 2A10A 2ZH8A 2VPWB 1S9FA 1JNZB 3N9UC 1S77D 4EBDA 2KJVA 2JJ4D 2E9TA 1NPPA 4BBYA 4CT9A 2PMHA 2RAQA 4HI2A 5J2NB 3LP0A 1HHSA 4HL9A 4HT7A 2L41A 5HAOA 1NUEA 4LF5J 5C25A 4ZCIA 4DZ6A 4O3PA 5B0CA 3DLJA 4QOTA 2UUCJ 3QFWA 2J9CA 1IBLJ 1WHVA 1EJ7L 5LJ3Y 2Y9HA 2IMWP 4RX6A 1Q86T 3H59A 2OMOA 4AE5A 2GNKA 2HBZB 2WB4A 4HHUA 2FJBB 2DITA 1M1GA 1FJGJ 2IRUA 3ETMA 5A8WA 2NUUG 3M32A 4KHRA 4UT4A 3JSRA 4WKRA 5C2GA 4OX7A 4EUVA 3PW2A 1RKJA 2D1CA 2F4VJ 4LFBF 1HBNA 3LP0B 4ZPCA 5KFAA 3OVBA 5EGYA 4XAKA 3ITHB 1JWWA 4WFXA 5LL6d 3H2VE 4HACB 1JB0C 4NXNF 2HVHA 2CXEA 4NLQA 4C3LA 1N4LA 4OZJA 4DL4A 2C2OB 2XEXA 4DL3A 2W25A 5ITHA 2GCFA 3MZIA 4IKAA 3W60A 4ANCA 3NGKA 4NLRA 1ROFA 1RGVA 4USVA 1SBRA 3CCUS 1HBNB 2R7WA 5H1SV 2JEGA 3EX7B 1N36F 5AE1A 3MF5A 2IAJB 1XMOJ 2PI4A 2C1EB 4WK3A 2AMCB 4YY3F 2FY1A 4IH6A 2DHHA 1W7WA 9RUBA 4DR1J 2AIRB 4OIXA 1R31A 2YKMB 4N47A 2EC2A 5HMZA 4JV1A 1CS4B 4LQ3A 3D54A 2HNDB 1V9OA 4JUZA 1F3FA 1PYOB 2CZ9A 2HRYA 4NRUA 2JEFA 2VBWA 4LF4F 5ETKA 1RTIA 2PO4A 2W9AA 3NCPA 3HKZD 1X0PA 1DQ8A 2PMWA 1VLOA 5ETSA 5D4LA 3M1VB 4DR2F 4ECUA 3J7A1 3GJQB 1RYRA 1TMMA 2POKA 5E41A 3K8WA 3OTOJ 5A6WA 1ZA1B 4IRKA 2D41A 4RWXA 3MUMP 1X4AA 1RTIB 2BBEA 2B8PA 3PG9A 5KFRA 2BKNA 3EVOA 3CCQS 3SYZA 3I9V9 3HT0A 1WACA 4FBTA 1CJKA 1O6XA 4M5HA 1BUXA 3KG0A 4NPOA 2ZEJA 4AQYF 5B0AA 5CA5A 3H5SA 3QWPA 4RNMA 4KKOA 3V4MA 3SDEA 5B0BA 5BYSA 3HJFA 3BN4A 3KK3B 4DCJB 2J0SD 1UW9A 3H98A 2KH9A 2MHNA 1K47A 2C2RA 3DLBA 5GAHI 2FDNA 3V4IA 2XULA 3WC2A 2ZKUA 4NE9C 1HKAA 2OELA 4JV5F 1YX2A 2IPOB 2W9CA 4IRCA 4OLOA 2ZBRA 3DLEB 4OI4A 1QD1A 1CJKB 4PXDA 2NUHA 5HK4A 3T1HJ 3C46A 2YX4A 4GC7A 1PC5A 4EYHB 1HNWF 1VHIA 1SIZA 3QYYA 3EZUA 2B51A 3M2UA 1NJXA 3HM9A 4PEOA 1RTDA 4RBVA 4I0WA 2W9CB 2OSQA 3KHHA 1YJRA 4CLZA 4OX9J 3PXGa 2BV3A 1SL2A 1ICEB 1XBWA 2UXCF 4UOGA 3I6PA 4HI1A 4HKQA 4DR4J 3D28A 2HK3A 4FF2A 3A3NB 2CPFA 5LT5A 3OJUA 4ANEA 2AHOB 3OJSA 2XSJB 3MM6A 4DF8A 2XS7A 1U6FA 2GIQA 2B5JB 2LQ9A 3FSXA 5JJBA 3M2UB 3Q8YA 1IQZA 2DNRA 4MK8A 1IKWA 2C22A 4USWA 3M2VA 1RA6A 2F40A 4RU9A 2PGCA 2KZZA 3J81U 1FK9B 3UDLA 3JSYA 2JLFA 3TA0A 3ILOA 5A8KA 5HI7A 4MYUA 3KOAA 1L3SA 4CO0A 2XLKA 4UY85 3KYLA 3G6YA 3MM6B 3EICA 1UZHA 2QLFB 3VGVA 3EPGA 1S1XA 2VD3A 4LRFA 3DHWC 1UCNA 3TEGA 3CGIA 1N32F 3NAHA 1NB7A 4OHXA 2YKOA 2W7PA 3IP0A 1VC0A 3QGIA 1WDTA 4KY3A 1VQSA 1KQFB 2UUTA 2HFZA 3HVTA 5AJ3J 2VPYB 2EC0A 2GVZA 2EFPA 3VGUA 4DS4A 5GAGU 5IQQA 1T11A 3HSGA 1KDNA 4K4TA 2HHUA 1GQEA 2WTFA 4BS2A 4QWAA 1RT6A 3DC2A 2BQRA 3NP5A 4RW4A 1JXVA 4KBIA 2V50A 3IBFB 2PC6A 1OJ4A 4TVAB 5ETTA 4ILRA 4NX9A 4EMDA 1M5KC 3FZ2A 1VFJA 3CCRS 5DS7A 4QQBA 2GVZB 1R89A 4URQU 1YHQS 2H5JB 3QATA 2CPHA 2DHGA 1S0OA 4MTPA 5FLXY 3QJLA 3GFYA 5L9NA 1TVRA 1YBUA 3UD3P 3T6BA 4DQPA 5KG2A 1RT6B 4NLYA 1D1UA 4DPXA 1CVJA 2M88A 4RW4B 1NBEB 4QR2A 3GILA 2MZTA 1U45A 2V4JB 3VCDA 3W66A 3VAKA 5M2UA 4K8RA 2MEWA 4NMXA 4WYLA 3LA0A 4JI0J 3AY0A 4ID5B 3BQ0A 4LR8A 1DZ5A 4F4XA 2DY9A 1XNRF 1S6QB 5J1PA 1HNXJ 1BWEA 2NCKL 1YJ9S 2R7OA 1NKBA 4OHYA 2JHEA 2XMMA 1N48A 5FJ4A 2YWEA 1HPZA 3BQ1A 5K5MA 2V67A 1VI7A 2CJKA 3T1AA 5AT1B 2V2VA 2Z4PA 1XK8A 4USMA 4C8YA 1NZ8A 3WQPA 1ZM2A 3C6UA 1H73A 1H6KX 2MPUA 5E2QA 3CJQA 3VVUA 2MLZA 4K59A 4WCEQ 2ZH7A 3TAPA 1LXNA 3CJRA 4MIBA 2AX1A 4O3NA 2K8GA 1OY8A 5GAEI 2XMKA 1IBCB 1EZZB 3UCGA 1FRLA 1O8BA 4HYKA 4TQRA 2B56A 2V8PA 3ELHA 3GIRA 1PKUA 4JI1F 4Q5VA 2NXCA 1L3TA 4X65J 3C6UB 4TKTA 4Q7AA 1N52B 5T41A 3FBFA 2HPUA 1UMJA 4L75A 5BR8F 1Q0NA 3ET6B 3HLUA 4JBCA 4DV0J 4N41A 2OEJA 1NLKL 3MUTP 1J5OA 4AFFA 2GGPA 2HLUA 3PJXA 3VAFA 2CG4A 3AOCA 1RT3B 1J27A 1H0HB 1SKUB 3F44A 4O4GA 2EXUA 1WSRA 2HHVA 3NBPB 4O44B 1GMUA 3SQGA 2MLXA 3HK2A 4CTAB 2AWZA 3H2LA 1FD8A 4CO4A 4Y2IA 3JSMB 3I96A 3OXLA 2DXFA 3BR8A 2ZHBA 3UFCX 5L8RC 2O66A 4MKBA 5I3QA 1HR0J 1IR1A 3N79A 4KGMA 4WIQA 1J5OB 2HIQA 2GGPB 4DL2A 2D74B 1Y10A 3QT5A 3OW2R 4KFBA 5E33A 2GO8A 3AH6A 2RSQA 3KHGA 5C42B 1PG5B 5KFDA 4G1QA 4FXDA 4PZVA 3Q8QB 4ILLA 3SQGB 5L38A 7FD1A 1P8GA 2JZ5A 4WFNQ 1C4CA 4HHJA 1LWCA 1ELOA 1FFSB 2FGOA 2PA8D 2IC3B 3OL7A 4K4YA 2AF6A 3VAHA 4OI2A 1RAJA 4HDHA 1ZBTA 4ED3A 1PSDA 2M3DA 1K0TA 3ILJA 4IUFA 2DR8A 5K14B 3IC1A 2NXEA 3A8EA 1YG0A 3EUNA 3TAMB 3LANA 4RU2A 4KFBB 3THPA 2KM8B 5D0RA 2XLIA 4ZITA 1FJEB 2QJ3A 1CJUA 1TL7B 4G1QB 2O67A 3KDNA 3IAM9 1U2CA 4AUKA 4CYUB 2AZ3A 2IHR1 1P6TA 2JDJA 2VQFF 2NZ4A 3LH2S 1J5EF 1RADB 2M7SA 2DY1A 4YR2A 1XC9A 3P96A 4K7QA 2UZAA 2DR7A 3NRBA 1FRJA 5A2QY 4ELUA 4ZP9A 2YQ1A 1Q78A 3M8RA 2F8MA 4R8UA 1XIQA 2VKZG 2YWWA 3N28A 3W7BA 4Y6IA 4I67A 2HZVA 2G9OA 4LFBJ 1FRKA 3WDOA 1OYDA 2KYZA 3M6WA 1WD6A 4DSFA 2DNMA 5E3QA 3FQKA 1Y3KA 2G2OA 4DFKA 4TU9A 4NXNJ 3EMTA 4HDGA 2ILYA 3QQCD 4LUBA 3FEXB 1YLXA 1PO6A 3OT9A 2I2YA 3V6JA 1DARA 1OWXA 4R8UB 3J80U 2CQ2A 1DQ9A 1SC6A 4B3OA 4L3KA 3RTVA 1B64A 5KFLA 3T9NA 2A18A 1PCAA 4QPTA 4OYOA 5CXTA 1N36J 2KI2A 3CD7A 4YY3J 2V6AA 1L5UA 4J9SA 1R8CA 1SJFA 3J7ZT 1FFGB 3K5PA 5KFNA 2PD1A 3V6DA 4ID8A 1GMVA 2XMVA 3ZFVA 1XJWB 4M5JA 1K1QA 2G1HA 3BBBA 3EM1A 3R1LA 4LF4J 2FVPA 2CDRB 3W2VA 1QE1A 4WFBQ 4F04B 4P52A 2YPYA 4BDPA 4FVCA 4IOBA 4PYDA 1DFDA 1TP7A 3JQMA 3CCJS 4DR2J 4U7UK 2KL8A 3GTYX 3PDNA 3IFEA 1WEXA 5H9EJ 4IR9A 1OSDA 2J6TA 1S57A 4I2QA 3MM5B 3KLHA 4H4KA 2QA4G 1G1XA 2E5JA 4ES3A 2PFDA 2YNHA 2NSBA 3NGTA 2LXIA 1SC1B 1Q8IA 4IH5A 4KE5A 3W2VB 2DNZA 5IM0B 1QE1B 4ZVOB 3P5TL 4I56A 3K7RA 1HI1A 3TNVA 4RL1A 3P4UB 2AEJA 2BRLA 2HRUA 1RB0A 1U2RA 3WC0A 3KLHB 4IG0A 5F0WA 4DWIA 2Z8QA 3S8SA 5IV4A 2BKOA 2QA1A 3R9LA 1NHUA 2YNHB 3M8QA 3MM7A 4B17A 2UV8G 2QSWA 3QWUA 4JV5J 5EHHA 1RBOB 2QO3A 3R7SB 3PO5A 2QMXA 3I0SA 3PIPQ 2RU9A 3PJWA 3HMJG 3P45B 4V1Ak 3A13A 1QAIA 1HNWJ 4CH7A 3JQJA 2IDEA 3GYNA 2RQ4A 3MECB 1B99A 5IZHA 5C5JA 4IG0B 4RW6B 2MZ1A 2UU9F 3AJ2A 5JVGQ 1FI4A 3M8QB 2GHWA 3OHAA 4WE1A 1BWVA 4DV6F 1EQ0A 3NNAA 3JS9A 4WK1A 5H9FK 2B4OA 1R8HA 3RAMA 5LM7E 4M5DA 2UXCJ 1KKHA 1QSSA 4XDCA 4LFCF 2E5HA 2DBBA 3SBMA 5LSLA 5GAHU 2LDIA 2XSFA 1YBAA 4RNOA 1FNXH 1X31C 5F0UA 1HNVA 3GP9A 4PQUA 4FXWA 2IVFB 3OUYB 2XS5A 4Y00A 3V81A 2UUAJ 3PEJA 4U7CA 1F9EB 4RW8B 4WE1B 2CRLA 2ZJQQ 3PKYA 5I3UB 3H0PA 2WVFA 4M5DB 3W64A 1T9YA 4FN5A 5D0GA 5AXMA 1JJ2R 2FPHX 1RAOA 2HQDA 4HHHA 4Z37A 2WBRA 3T19A 3QZ7A 3W8PA 1WKKA 2WONA 5E5NA 3J7YI 1NAQA 5LXRA 2MKIA 2IJNA 5CCLA 2J6UA 1HNVB 4CRJA 4OYWA 2ASJA 2BJEA 4ZP6A 1N32J 2GHPA 4PQUB 2Q3PA 1VISA 4FYVB 3A12A 1KOOA 4KR0B 3NOGA 1Q7LB 2Z2LA 3V81B 4XPCA 2FJVA 5D4OA 3L3CA 1KONA 3GIIA 3IWNC 1ZZFA 3HFVA 2UVWA 2V4RA 3MR6A 1M5PC 3WX4A 4DSJA 2KG1A 2KU7A 4JV2A 3PW0A 4FYYB 1FDAA 2VV5A 1VJWA 3FUYA 4WFYA 2B6AA 4S0MA 3GG0A 2MZRA 9ATCB 1RK8A 1DTQA 3JTNA 4X2BA 2IYGA 5IT4A 2OIHA 1SL0A 4NLPA 2HYIB 3CCLS 1WF1A 4PG6A 1HBMA 1HWIA 3TANA 4OFZA 5KFMA 3D9BA 1T02A 4IFVA 1JLBA 4QYRA 3HXMA 7AT1B 4C8LA 4C11B 4YP3A 1VRTB 2H5IB 2IY5B 4XK8C 1WHWA 3LGHA 2QMWA 1RAGB 2XHCA 1UVIA 3OVSA 1NH8A 6FD1A 4X62F 4OL8A 4RUBA 1LW0A 3CC4S 5EWFA 4R5PB 2KB2A 1XMQF 2RRNA 1U47A 2LDYA 3D5MA 3MTJA 1ACMB 2V4QA 1DTQB 3DRXA 1NU4A 2RF2A 1WOPA 4RJVA 2R8GA 2XY5A 3VAMA 1NMEB 3CMAS 2YXLA 2PEBA 4IG3B 2YTCA 4W90B 5KT2A 1JLBB 1LWEA 2CPDA 3OSPA 1XNRJ 1T3NA 5F3ZA 1NNDA 1S6UA 4N7TA 1F2GA 3OR1B 1KQKA 2I8EA 1QLNA 2EFNA 4ED5A 1D3WA 3DYAA 2KG0A 4PXBA 1RHMB 5KFCA 1N5YA 5BJRA 4DLEA 2ADCA 2C3MA 2EBEA 1RT1A 2YKPA 1M1HA 2KXFA 1LWEB 5KFQA 3QT8A 1FRXA 2R7UA 4C3KA 4A8QA 1VQOS 3CC2S 2ADBA 4DN0A 2XO6A 3ILLA 2AV5A 3LO3A 4JI1J 5KFBA 3D67A 4BC9A 1NJYA 2C3YA 1FO1A 5SZTA 3AOAA 2XYHB 5BR8J 3K59A 3HVRA 4EK2A 2HLTA 3I82A 4NCGB 3PHTA 1WJ9A 2CQ0A 3O2IA 4MFBA 1RT1B 1EHWA 1I1GA 4ZPBA 2HK2A 2PI5A 4A8MP 3JXOA 3MUVP 2BQ3A 2WOMA 4ZMMA 1OYEA 5E3CA 4MKVA 4J9MA 2ZWOA 4DQIA 4KPCA 1RHJB 2IYIA 3U02A 5KOXA 1HWUA 4NLOA 2FZKB 4URGA 5CYQB 4YHHF 3QAUA 2DNNA 2FZCB 3W9JA 3W5ZA 2BKPA 4RLEA 3ZZOA 1LWXA 4P2FA 3IAS9 1NJZA 4YR0A 5D4PA 1H7XA 3TP2A 4LQ9A 2W01A 2ZH5A 4P2XA 2ACMA 2L9DA 2P6SA 5LMUF 3SI8A 3D3BJ 5AXNA 3E8OA 2Z58B 3C3LA 2DIVA 2N7CA 4J9VA 1RWWB 3AD8C 1X8DA 2X7IA 1MMDA 2RD5C 3EVMA 3CUNA 2PN6A 2NPFA 3OTCA 2L3MA 3G96A 3OHBA 1YJVA 1ZPWX 2AD9A 2NS1B 3DM2A 4J9UE 4DHVA 2DNLA 1UWAA 1U0HA 2YY3A 2HEKA 1HQUB 3RB3A 3B54A 2XTJP 1Q5YA 4QW8A 1CC7A 4ECZA 1KWMA 2H5EA 4KHPF 3SQOP 5IS2A 1NJWA 2WW4A 2KHDA 4DV1F 1U7LA 4Y3CA 1QAJA 3ZZRA 4KHMA 4ALZA 2CQ3A 1HNZF 2WK4A 5ETPA 2Z30B 4Y2AA 2F4FA 3KLEA 3VGTA 2MQOA 1AW0A 6FDRA 1BXNA 4F2RA 3LP1B 2VQFJ 1AROP 3DM2B 1J5EJ 4HEA9 4OYZA 2R8HA 2W2OP 1U0HB 2GC8A 1ZZNA 3W63A 4FKYA 3GZ7A 3CJTA 2ZM6F 3R5AA 1UVMA 2ZBPA 1Q79A 3GR0A 4DLGA 1RU2A 2F9DA 1N5QA 4YUDA 3K89A 2QT7A 1C0UA 2EG1A 2CJQA 3OTBA 3I0RB 2ZUAA 4LSLA 2DB1A 3R5JB 2JLEA 3KLEB 1PAUB 3PFEA 3SZ2A 4B3SF 2CNOB 4AT1B 1RUSA 1V3SA 5KT7A 4A8SA 3R3TA 2R7RA 2H9ZA 2BE9B 1N5VA 1BHNA 3B78A 4H4OA 1U1PA 1CJTB 1FXDA 5F8HA 2A2DA 3W61A 4ZVFA 2LVWA 1NH7A 3ZZYA 4C97A 1PIEA 1C0UB 3CB4A 4FVMA 5J2QB 3D6HB 1NDLA 3FCHA 3EGWB 1SI9A 4LSLB 3T9ZA 1SKRA 2NXUA 2HFOA 4LF8F 3BGUA 2DJWA 4GRSA 4WJBA 5CYMA 1IKVA 3O44A 2JX2A 4ZOSA 2LXUA 1FCAA 1HFEL 2F5GA 2F8HA 3BJYA 4KT0C 3L7UA 2E5GA 4GO7X 4DFJA 4P71A 1GTHA 1HA1A 1XR7A 3MDFA 2W2PP 3H2UB 2XBPA 3I31A 3HULA 5F8JA 1RWOB 4CLTA 2DEJA 7FDRA 2HVEA 1VQ9S 3DLHA 5D3GA 4J9OA 2W4CA 3DKDA 2ZH4A 4CLWA 1IKVB 2FVQA 3PNIA 3AD7C 3UDVA 1A6LA 4ZCKA 5M2PA 3EJMA 2VFSA 4OMFG 2F63A 2BX6A 1S79A 2IM1A 2BA9A 4QWDA 4OYBA 4XIUA 2NXJA 2VC1A 1UEKA 2JOQA 1VQ8S 2W9BB 4G1IA 3QJJA 2AJQA 1RWVB 5HSPA 1BQMB 2VONA 4KC5A 4H4MB 1CLFA 1X0FA 1IJFB 4B9MA 3TUIC 3FC9A 4ES2A 2RHQB 1H38A 3IS9A 3PX6A 3ISNC 2OSRA 1RHRB 2OAUA 3R2DJ 2M2BA 4PWWA 1FERA 2RUGA 4M5NA 2ALZA 3I87A 3FEYB 1F0XA 4ELVA 4M5GA 1Y0HA 4M63A 4MMOA 3EE3A 1LFWA 3TX0A 5G0RA 1HYSB 1RAEB 2D3ZA 1FE4A 2FJXA 1XEZA 2X51A 2WSEC 3O5TB 3VAIA 3JQKA 4AD6A 1RU1A 3VR1A 2BOPA 5KFKA 1GXTA 3DCAA 1CJVA 3IS9B 5A8RB 4WFZA 5D4NA 2ZNYA 2V2QA 4L73A 1VQLS 3MPWA 4LFAF 1RWUA 1QSYA 3QGPA 2HS4A 4M5MA 1T03A 2P9GA 5G0RB 4Q43A 4FDFA 3HSDA 5KFIA 3CE8A 2UU9J 2WAQD 3VVTA 4WKYA 1WHYA 2OPRA 2QC3A 3R7BB 3SCJE 2JRSA 4DV6J 2OO4A 4FBUA 2MLYA 1V3ZA 3GSDA 1IBLF 1PBAA 4E98A 2M0GB 3BGFA 4P9SA 1UJ4A 3ZZ0A 2W8KA 4YDXA 4LFCJ 3M8WA 1BQXA 1T03B 2IVMA 3NWGA 3RR8A 1UEUA 2GAHC 1OY6A 8RUCA 2QYCA 2X1BA 1WEYA 3QLHA 1FKPA 3T1YF 3MEDA 2AGQA 2VASA 3ZNUA 1X9SA 1EETA 1FX2A 1JLAA 3K0JA 2AGPA 2HFSA 4LF9F 3UI3A 2HMIB 2B43A 1VBYA 1NK4A 4KH1B 2RE1A 3U1NA 2V9KA 2K1RA 4I64A 4WWSA 3KLGA 1RQ0A 2F7VA 2FHKA 2HNYB 2ZFHA 1S6OA 1PJ6A 2C2MB 1AZSA 2AW0A 3ADAC 1UVNA 1FKPB 3CTRA 2ZOGA 3A3OB 1LFPA 2XHWA 1EETB 1JLAB 1WG1A 4OHZA 1YRTA 4CO2A 2HBQB 3HDSA 2W1BA 3G87A 1AUSL 2AYGA 3KLGB 3C14A 4CNYA 1LK5A 1EP4A 2QFIA 2ILZA 1N56A 4OV1A 4O23A 3C16B 2QA4S 2J0WA 1SQGA 1DQAA 1WC5A 2DO4A 1IUJA 1TQLA 3AOBA 4ED1A 3OR2B 2HHHF 2BXJA 5GMEA 2AJ1A 4IQMA 2J0XA 4L6V3 1S59A 3T5HA 4Y2KA 2ZWPA 1RYSA 5L9XA 3GV8B 2AJ0A 1T9VA 5KFVA 3KLIA 1SPBP 3OTOF 4X62J 2DGTA 2R2SA 2VBZA 3JSBA 2OFHX 2A6OA 1T94A 5EWEA 5CHCB 3Q0AA 3RRHA 2VJVA 2I38A 4ICLA 4ECVA 4O3SA 1JJCB 1MN9A 4FKXA 1IBKF 3QT7A 1WC4A 4OQJA 5F8GA 3OBIA 2V2KA 3IN5A 2AJFE 2RU3A 3HFKA 2MZJA 2AEFA 4OI3A 5F8MA 3W9HA 1SKSA 4P6QA 2E9RX 3RGIA 2J7UA 5GMKa 1OQ3A 3CJ0A 1NSAA 4I68A 1JNRB 2EEYA 3QNWB 4ZIWA 1S0MA 5HN0A 2VF3A 1RLDA 2O1PA 3AB2B 4KO0A 1R6YA 5J2PA 3DGPA 4NCBA 1RTZA 4ICLB 4RW9A 3LGMA 4M8LA 5DDOC 3IA0A 1FJCA 3HHLA 2KFYA 2JNJA 1UFKA 2HURA 1ULRA 3EGZA 2CQHA 4IH7A 1NDPA 4P74A 2M70A 3IXQA 2B0GA 5CD4H 3RU0A 3LF0A 2QN6B 3MEEA 2GQ2A 2VFRA 1QDUB 2KVIA 4J91A 1VQYA 1N54B 1REVA 2R8IA 1S1TB 2E44A 5HQ8A 3MD1A 1RAFB 2OPQA 3JAMY 3DGPB 4OJGA 3R97A 4RZRA 4RW9B 1S1WA 1U1KA 2OEKA 1H3DA 3CCES 4USHA 3LWLA 1UFLA 3UNYA 3QO9A 4PUOA 3IGVA 3A4TA 3RBZA 3N6MA 1K0VA 2DH9A 4GMKA 2KRRA 5ADZA 1FESA 4QWEA 1U8WA 2V34A 1QSLA 3GPAA 3G6VA 4LT6A 4ZVEA 3MEEB 2IM3A 2V8HA 1MMNA 4NA2A 3KLFA 3L7PA 4YHHJ 1SCJB 4UZBA 2OPQB 1YJTA 4FPRA 5T7LA 3I4PA 1IM4A 1SH3A 3TVKA 2LA6A 1NHKL 3NMRA 4YMEA 2EI5A 2AKWB 4WU3A 1KSPA 1ZYQA 2CQCA 3FSIA 4O4RA 3UDEA 5LMUJ 4F25A 3E2EA 1SIWB 4ZVPB 1RSCA 4IDKB 4DUZF 2LLZA 1IBMF 1B0VA 3ZC4A 2JSXA 5LSRA 4F4AA 5SUHA 3KLFB 4U96A 3NWRA 2R7SA 5E3AA 2W4PA 1RISA 2CPJA 3LTOA 5T7LB 2FIUA 4K50A 4XTTA 3K17A 4KHPJ 4OHWA 3CJ4A 3DDKA 5B09A 1M90T 4GKJJ 2HFNA 4F36A 2JFKA 3T3FA 2BANA 3FRZA 5DM6Q 2HHXA 5ETQA 1HNZJ 3QFHA 1T9XA 2VBYA 4LREA 3TQEA 1N6QA 1KLMA 1TAUA 2FZGB 1BY9A 2RDIA 3FK4A 4HH0A 1FDNA 3G8SA 5L1IA 3H4BA 3CEDA 2FJEB 5A2QU 1KNZA 2ZM6J 5D77A 4IOAQ 5BXIA 5KFHA 2OPPB 1M5VC 4EBEA 1HWJA 3VAJA 3HVAA 3UCZP 4ZP7A 4MYTA 4LJMA 4B3SJ 4ZPTR 2RQCA 1FRIA 3CJ5A 3ENWA 2IRYA 5JXSA 4CLPA 5KFGA 5JMNA 4ZVSB 3BBFA 1KP6A 3IO1A 4V19J 1DHMA 4X4QA 4YB6A 2VJUA 2R9LA 1NJIT 4C98A 2DNOA 5DG8A
chains in the Genus database with same CATH topology
2EK6A 1LWFB 2M4MA 5KOWA 3UD4P 2OPRB 2G13A 4BWMA 3J7Z5 1PO6A 4X4PA 4DL5A 1JLFB 3TARA 2K7KA 2PSZA 3D1HA 4Q44A 2XI3A 4B9VA 1XR5A 4ETZA 2CJ9A 2I2YA 3V6JA 3P3DA 1DARA 1OWXA 3K57A 1H2VZ 1A9NB 3I5BA 3DRYA 3PHEA 4TLQA 4R8UB 4ES1A 4URSA 2DGWA 2W4DA 2RT3A 3OTEA 2VB6A 2CQ2A 1DQ9A 1SC6A 1GH8A 4B3OA 4JI3F 2ZOMA 5F8LA 4PWDB 4HTIA 3V5RA 2A2CA 3B4DA 3RTVA 1B64A 5CYQA 3S6EA 4D3HA 5KFLA 4I6AA 4IRDA 3T9NA 1SKWA 2A18A 4JYAF 4QPTA 4DMZA 1Z1ZA 5CXTA 1R0AA 2GV1A 3NGDA 2ZD1A 3MHYA 1RKIA 1RTDB 2JVRA 2KI2A 3CD7A 1ZH5A 3GIJA 3DI6B 5IQ6A 1L5UA 2GIRA 2AX0A 3CD6S 3J80Y 4J9SA 2DR9A 3QIDA 3KG1A 2K3KA 1R8CA 1SJFA 2I0XA 1CQNA 2CPEA 3H4DA 3J7ZT 2G4BA 2MKJA 3K5PA 4M95A 1KOHA 5KFNA 2I5JA 2PD1A 4MAKA 3V6DA 2BACA 4ID8A 1VC6A 2DK2A 4KV8A 4C0HA 3US5A 5HMXA 3OLAA 2F1FA 2B4UA 2XMVA 1JLGA 3QLHB 4ZA1A 3MEDB 3SXLA 3ZFVA 3UR3C 1XMOF 3PVXA 2XS2A 3HHEA 3EYZA 2QFJA 1U4BA 2KFZA 5KG4A 1K1QA 3T5JA 3BEGB 3CIMA 4XPEA 3PW5A 2J7KA 2DT9A 3ENVA 3R1LA 4DR1F 3RAXA 2FVPA 3MCSA 2YNIA 1IKWB 3W2VA 4YB1P 1VQKS 4DSIA 2DGSA 4N5SA 3M2VB 1JLQA 1HL6A 4NLXA 1QE1A 4KGKA 3MMCA 2MDAA 3MOJB 2VPXB 4WFBQ 4NYOA 3AA9A 2K1RB 3T6JA 3VALA 3X1LB 1R0AB 1HQUA 2K3IA 3DRSB 2ZD1B 2XGPA 4K4VA 1FDBA 2M8HA 3QJPA 3MAQA 4BDPA 4FVCA 1Y9OA 4IOBA 5G4DA 4EZ6A 1TP7A 4OX8A 1DFDA 3G86A 3CCJS 4DFMA 2CPYA 2GMJA 2EW9A 3F56A 2DNYA 4U7UK 5A8KB 2NSCA 5HLFA 1TL1A 3PDNA 3UQSA 3IFEA 1LKZA 4HVZA 1WEXA 2OPSA 2ATLA 5DLGA 5H9EJ 4IR9A 1OSDA 2VG5A 2J6TA 3NLCA 2I5JB 3FJ2A 4I2QA 3MM5B 1FKOA 3KLHA 4KV8B 3ICLA 1L3VA 1PILA 4I4BA 3I55S 2R7TA 4H4KA 1JLGB 2LQ5A 5L39A 3PV8A 2QA4G 1TL3A 1XERA 4MK9A 1G1XA 3VF0B 2E5JA 2OFGX 1S1XB 4ES3A 3PEHA 3J7YU 2KT3A 2XNRA 2J8AA 2YNHA 5GVQA 4LIRA 2WRMA 5C24A 3N6NA 2NSBA 4CCHA 3OL6A 4ZK7M 1WG4A 1NO8A 2G1DA 4B9UA 3N01A 1ZAVA 2LXIA 2M5YA 5KFPA 5KFJA 1YITS 4PPDA 3DU6A 1Q8IA 1Q8BA 1Y5NB 2YNIB 4IH5A 4KE5A 3W2VB 3VTIA 4ZDNA 3LP1A 2LEAA 4YOEA 2YQ3A 2DNZA 1JLQB 5IM0B 1Y7PA 1QE1B 2IBKA 4H54A 2EBGA 3MMCB 2W24A 1ZTTA 3FSYA 4X4NA 2E29A 1IJEB 3FVYA 1WWHA 3HVTB 4ZPWR 1TKTA 3P5TL 4A47A 1AFJA 1DJ0A 4I56A 3K7RA 2HWHA 1HI1A 2QLXA 2Q1LA 3TNVA 4P2SA 2FLNA 5LJ5Y 1EP4B 2YWHA 3OXGA 4CH1A 1GT8A 4V19X 2HWTA 1APSA 2BRLA 1MWYA 1VHFA 1OS5A 4ECQA 3CVKA 5HLFB 1TL1B 1K1SA 1X5TA 2HRUA 4G6VB 2VG5B 4OJHA 4GKJF 1U2RA 4NA3A 2R8KA 1HNIA 1GAOA 3WC0A 4EO6A 3KLHB 2P5VA 1AFIA 5F41A 3D0HE 4IG0A 5F0WA 2BM0A 2OJ3A 4DWIA 2OP5A 4PG8A 1VBZA 2Z8QA 3S8SA 4B3MF 3CCSS 5B0FA 4WU2A 3I0RA 2QA1A 4J9KA 1N33F 3CPWR 3O1LA 2WW8A 3ISND 5D6GA 1QUVA 5AE3A 2I9SA 2RNEA 1NHUA 2YNHB 4PCQA 1KFSA 3BS9A 5C24B 2AYBA 1JK9B 3M8QA 3CCWA 3MM7A 2D7SA 4QW9A 1UVJA 4B17A 4EU0A 2R7VA 4C7QA 2UV8G 2QSWA 3QWUA 1FXLA 4PXEA 2GX8A 2MY7A 5EHHA 2OKQA 1C0TA 2QO3A 5L1KA 2GQCA 2W7AA 3KLIB 4J9LA 1S9EB 5K9FA 3SCIE 3NKYA 5LSOA 4I2PA 3H5YA 2P9EA 1U49A 3RBDA 4JOUA 1VS3A 1TKTB 3PO5A 2QMXA 3I0SA 3MPVA 1OIAA 3PIPQ 2RU9A 3PJWA 3HMJG 4B3TF 4NRTA 1OSCA 3DLKA 1HI8A 3LGNA 3RW6A 5DQIA 2DHSA 4USIA 1QAIA 1S9GA 2XMTA 4TYAA 1TKZA 1TV6A 4CH7A 5B7WA 3KLVA 4DL7A 2J6SA 4WIIA 3GYNA 1TVRB 5DGBA 2ZJPQ 2DNPA 4NLUA 3ITHA 2RQ4A 4C0OC 3MECB 1YRXA 1QAYA 2GMLA 2HHPA 1FJ7A 4O3OA 5DG9A 1D9DA 5IZHA 2XI2A 1U24A 1Y00A 4KQZA 4UOCA 5C5JA 3HX9A 1X4HA 2EPIA 3P6YC 5KFUA 2CQDA 4IG0B 4RW6B 4OX6A 3CJKA 5CYJA 4ED2A 1I94F 1U6ZA 1Q1KA 3W2WB 2LXFA 3UE2A 2MZ1A 5J2QA 1V3RA 1OO0B 2AU0A 3AJ2A 2YX7A 3T1HF 2UU9F 2E5IA 5JVGQ 3FDSA 2E66A 4X4TA 3S1TA 4ED8A 2OD4A 4A8YA 1KLNA 4DBQA 1F5CA 3BO4A 3M8QB 2N82B 2GHWA 3OHAA 4WE1A 1TK5A 2UXDF 3MMJA 2YH0A 4YQWA 4DV6F 3W3SA 3NNAA 3QGHA 1DTTA 4TY8A 4UQTA 4WK1A 4NZ7A 2M8DB 2MYFA 1C0TB 2B4OA 1R8HA 3RAMA 4FXVA 4I2PB 5CH7B 2DRAA 3BB5A 4M5DA 4DR3F 1QAXA 4CI0B 3B8HA 4B9NA 2L9WA 1QSSA 3DLGB 4XDCA 1SQEA 4ZPVR 1UJ6A 2LQJA 2VOPA 1SH0A 4YB5A 1NKCA 3DLKB 4LFCF 2E5HA 2DBBA 2B4PA 2V8VA 3N0VA 3LALA 2NREA 3QZ8A 3M8SA 1S9GB 3R5DA 2PEHA 5LSLA 1YJUA 5GAHU 3M4XA 2LDIA 1TKZB 1TV6B 4KO0B 1HHTP 5U47A 2XSFA 1X5PA 2Y1RI 4NMLA 5F3TA 2IAJA 1YBAA 5J2PB 4RNOA 2MSSA 3K8VA 4TN2A 4ECSA 1FNXH 4N8NA 2AP6A 1HPZB 4GC6A 4OZLA 4OX9F 2R2UA 4ZPDA 2CPZA 5F0UA 1HNVA 3HHLD 5D78A 1CEZA 2HWIA 4DX8H 4PQUA 4DR4F 4FXWA 2V8GA 2IVFB 3HHLB 2DRBA 1CG2A 2YKMA 5DQGA 3OUYB 2XS5A 3DXSX 3H20A 4Q45A 4Y00A 3V81A 3HZGA 3PEJA 2NR0A 4U7CA 1U09A 1VIXA 2JFDA 3TUZC 3VAGA 3I56S 4RW8B 1XWLA 2CQ1A 2EKYA 4Q2MA 4WE1B 2CRLA 5GAGI 2HNDA 3D0IE 3H5UA 4L3NA 2ZJQQ 2DNQA 1DTTB 2CFXA 2VC0A 4TY8B 4QJVA 2B9XA 3PKYA 5I3UB 4ECXA 1G2EA 2BM1A 4OZNA 5DO2A 3RRGA 2DO0A 4M5DB 1SXLA 3BR9A 4IFYA 3N6LA 4FN5A 4U67Q 3CIZA 5AXMA 3DRRA 1WELA 4NWBA 4HLBA 3H5XA 1JJ2R 2FPHX 4N56A 2DGVA 2JC0A 4KJIA 4Z37A 3MFIA 5K8NA 2WBRA 3T19A 2FUG9 1RJJA 3QZ7A 2KXHA 1REVB 2V0NA 4NZ0A 1S48A 5KFZA 1G7CB 3GR1A 2WONA 2A1BA 5E5NA 1JXEA 2VUGA 3J7YI 4DJBA 1RTHA 2W9BA 5DDQC 4Q8FA 1I6JA 4FF3A 1NAQA 3K5MA 3RB6A 5LXRA 2VG6A 2MKIA 1FNOA 2IJNA 3CCZA 5CZVA 1B0TA 1S1WB 2F8EX 4ZP8A 3ZZTA 3M1VA 5CCLA 2J6UA 3X3UA 4X4SA 4FS1A 1HNVB 5DLFA 2ASJA 2BJEA 3FNNA 1MU2A 4ZP6A 2XLJA 2XY6A 1TK8A 1BQMA 2COLA 2GHPA 4PQUB 1OPZA 2Q3PA 1R8BA 1GXUA 2ZC3A 4H4MA 3QO9B 3NAIA 1KOOA 4KR0B 4PUOB 1Q7LB 2Z2LA 3V81B 4XPCA 3E01A 2FJVA 3KK1A 5IT9Y 2EWHA 3ISZA 5D4OA 3L3CA 1RA7A 3CDUA 1KONA 1U1MA 1IKXA 4M1KA 5DRKA 3GIIA 1YSJA 3IWNC 1CPZA 1TFYA 1VIOA 4J9RA 3CO9A 2XMUA 1ZZFA 2DNHA 2HGNA 2UVWA 2V4RA 2ACYA 1BD6A 1AXQA 2RVJA 2HS3A 3MR6A 2XGQA 4C0BA 1M5PC 2MQLA 3FRYA 4IFYB 3WX4A 4DSJA 2KG1A 4CO1A 2IM2A 2YH1A 2KU7A 2HHSA 2N4CA 5THWA 4BC7A 4JV2A 3PW0A 1FEEA 1RTJA 2UP1A 1X9WA 1FDAA 2VV5A 2MKSA 1HYSA 1TFWA 1VJWA 1GXLA 4WFYA 2MJUA 1TKXA 2B6AA 3GG0A 4IYQA 4O4GB 5AJ3F 3TI0A 1BLUA 2RMLA 5EX0A 2MZRA 2OTJS 1O51A 2KTQA 4OI1A 1D9AA 4DS5A 3Q8RB 5HMYA 3VQTA 2VG6B 4AL7A 4WF9Q 1Y4ZB 2ASLA 2ZOFA 1MU2B 1RK8A 1DTQA 2C28A 1S10A 4NLDA 1JKHA 3JTNA 3RAQA 3OL9A 1P27B 4X2BA 2SXLA 2NLWA 2IYGA 1N8RT 5IT4A 2CVIA 1QVGR 1Z4UA 3BM7A 2OIHA 1SL0A 2MZQA 1T3OA 2IMOA 3IRXA 4NLPA 2PMZD 2HYIB 5IXUA 2MZSA 3KK1B 3CCLS 1WF1A 4U9RA 2Q6CA 4PG6A 1HBMA 3IR6B 1HWIA 3KK3A 4DQQA 3V6HA 4UUXA 1A7GE 1IKXB 2RB7A 2AYMA 2ROGA 3SMZA 3SSSA 5A8RA 4OFZA 3TANA 1HARA 5KFMA 4Q8EA 5K8OA 4ZPAA 1T02A 1MW7A 4B9TA 4IFVA 4FYDA 2JEJA 4OLPA 3EGNA 1JLBA 3CWJA 4QYRA 2C3PA 3MURP 3HXMA 4CQ1A 4P7TA 1YIJS 4C3MA 3O3LA 4C8LA 2XNQA 4C11B 1VRTB 4YP3A 4I1TA 2DPIA 3CJ2A 4XK8C 1GTEA 1WHWA 2EK1A 1M5SA 4F8RA 2QMWA 2PE8A 3DMJA 3NG8A 2EVZA 4ATNA 4QIGA 3S7RA 1FXRA 3RBEA 1UVIA 3GIMA 4IO1A 3OVSA 4QU6A 2N4DA 2HHWA 1NH8A 6FD1A 4X62F 3CCMS 4C8MA 3THVA 1TKXB 4OL8A 1LW0A 2KHCA 1KN6A 3CC4S 3DLEA 2DGXA 5EWFA 4R5PB 1D9FA 1RDRA 2KB2A 5KG5A 5KT6A 3RZAA 1XMQF 3D2WA 4AL5A 2RRNA 1U47A 2LDYA 3UPFA 3DN9A 3D5MA 2HHQA 3KWMA 3MTJA 2V4QA 1SH2A 3AHPA 3ULHA 3M9NB 2ZE2A 1DTQB 2FHOB 4DOZA 1JKHB 1LWCB 3DRXA 1NU4A 2RF2A 4FF4A 1YWXA 3JTPA 2CQGA 3HVWA 3TAQA 3IRXB 2DIUA 2R8GA 1U2FA 1Q53A 2XY5A 1W2IA 4YR3A 1Z2ZA 4LSNA 3VAMA 3CMAS 1UJ5A 2C3OA 3KHRA 2A3JA 2ERRA 3BO2A 4KPYA 2ZH1A 3HPOA 2K2PA 1H2TZ 1X4EA 2O01C 1FNMA 2ZC4A 3D0GE 4IG3B 3UR0A 1GX5A 1VGYA 2YTCA 3NNCA 2BANB 4DR6F 2APOA 3BGLA 1HMVA 2RS2A 5KT2A 1PGZA 4W90B 1JLBB 1LWEA 2CPDA 3OSPA 4K4ZA 3I9ZA 1NK7A 1U1NA 1TK0A 2BDPA 3SEOA 4I6YA 2DHAA 1T3NA 4DSKA 5F3ZA 1GNKA 1NNDA 1RT7B 5KFTA 1KRPA 1WNEA 2RH3A 2AQ4A 2E1MC 1N6QB 1S6UA 3DMJB 1KLMB 5LXYA 4JI6F 3TQ1A 1F2GA 1Y5LB 3MGJA 3Q2SC 2E1CA 4C8ZA 3OR1B 1KQKA 4JI0F 4M94A 4X66F 2I8EA 4RUAA 3CDEA 1QLNA 3PW7A 4RBTA 2EFNA 1U1RA 1LW2A 4D3GA 5J1EA 5KG0A 4ELTA 3LP2A 4ED5A 2N7YA 2DH8A 1D3WA 1SJ3P 2XO7A 4PWUA 1HNXF 2XSJA 3DYAA 3PO4A 4F4YA 3H8YA 4N77A 4NCAA 2KG0A 4PXBA 1UFWA 3IR7B 2R7XA 2B5JA 3BSCA 1UWBB 2PT0A 2V9WA 3KK2A 1F9FA 1NRKA 1S72S 4LSNB 5KFCA 3PW4A 1N5YA 4PG4A 5BJRA 4ZCLA 1C2PA 4DLEA 2ADCA 2C3MA 2EBEA 3PM9A 4X4UA 1RT1A 2G0CA 2Q43A 2YKPA 3CD5A 5BYQA 1Q8LA 2KRBA 1NK0A 2W7OA 2WCXA 3V6KA 2HMIA 4QCLA 1B7FA 2KXFA 1LWEB 3HF5A 4F4KA 3MD3A 5I3PA 5KFQA 2GHVC 4B3RF 1KS2A 3RB0A 1FRXA 2CIMA 2RS8A 4NZ6A 5L1LA 2R7UA 1X9MA 3NS5A 4I7FA 3DDNA 4C3KA 1S7HA 2GO9A 3MMAA 4A8QA 3CCVS 2HNYA 4DV3F 1FK9A 1VQOS 3CC2S 2KKHA 4KB7A 4NOHA 4CT8A 4DN0A 2ADBA 3OFEA 4MKYA 2XG8A 1MMLA 1JJHA 1ZOTA 1NK6A 2ZJRQ 1S1UA 2EFOA 2GFFA 2NPIA 1X4BA 2AV5A 3LO3A 4WZMA 4A4JA 5KFBA 2VA2A 1C1CA 4BC9A 1NJYA 4N8OA 1C4AA 1LW2B 2C3YA 3M2RA 2DD8S 3OVAA 2IM0A 4E8UA 3G6ES 3C6TA 5DG7A 4NLGA 1S0VA 4A8OA 3LP2B 3G8TA 1FO1A 3C66A 5SZTA 1NKEA 2IJFA 3G8QA 4DV5F 4BWJA 2Q79A 2YWKA 2LQBA 3FMBA 4PRFA 2KYXA 5HROB 3B4MA 4NYPA 3ETOA 2YWFA 4Y2CA 2L9NA 4TLRA 3QMQA 3HHDA 3EPIA 3K59A 3E3XA 3UW1A 1UA0A 3HVRA 2HLTA 1F5AA 2RILA 1S6PB 3I82A 4NCGB 2VG7B 1FTCA 2CQ0A 3O2IA 1HW9A 4Y28C 4MFBA 1LOUA 1RT1B 4X4VA 4KSEB 1I1GA 4CO3A 2U2FA 4X64F 2VOOA 4ZPBA 2ZBIA 1UAWA 2BZ2A 1IN0A 2UUAF 4X65F 2OMLA 2PI5A 1JXLA 4G3IA 4A8MP 3PZPA 3SV4A 1SUQA 4RW7A 3GV7B 1LK7A 4YFUA 4B08A 2NQPA<