4C98A

Thermus thermophilus cas6 (tthb231)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
268
structure length
242
Chain Sequence
GAASMPQAVVLELVGEKPPLYPARYAHGLFFALLSRVSPELAQKLHEAPRKPFTLAPLPGTLRLRLTTLDDGLFAPFLRALSSYRLARVLATREGHPLAGATSWEELKEAPKREKATFRFLTPTVFATSKTRYTPLPDPRLIAGSLLDKWQAHSPFPYNPKEEAALRELFELDLEVAGFRNLRFHRVQAGKGFFPGFTGEATLRLWSQSLEAQEALGRLHALAFFSGVGAKTPYGMGLAVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CAS6B
publication title Evolution of Crispr RNA Recognition and Processing by Cas6 Endonucleases.
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 55
structure length 242
sequence length 268
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10040 CRISPR_Cas6 CRISPR-associated endoribonuclease Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c98A01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c98A02
3ZFVA 4C8ZA 4ILLA 3PKMA 4C98A 3QJPA 4ILMA 4ILRA 3QJJA 4C9DA 4C8YA 3QJLA 3I4HX 3UFCX 4C97A
chains in the Genus database with same CATH superfamily
4M5HA 4AUKA 4Y2AA 3QNWB 4HACB 3VAMA 4KIAA 3RU0A 1M0SA 2DNOA 1X4AA 3HFZB 2CQPA 4OX7A 2Y1RI 1WHVA 2FJDB 1MU2A 4PWDB 1TELA 2BJDA 4PPZA 4DFJA 3DNCA 1F9FA 1N34J 1GMWA 3HT0A 4QIWD 2CZ9A 2EFPA 3JSRA 2E1MC 2KG1A 4A47A 2DHSA 1VBKA 4FZVA 1GFWB 2CNNB 3M8PA 2FTRA 4R8UB 3MM8B 2E5HA 3TEHB 4KKOB 3QRQA 3HJFA 4ZN1A 2VBWA 3Q23A 1JXLA 2E5IA 1WI8A 3CJKA 2UXDF 4OYZA 1HIYA 4KC5A 3E3XA 4L73A 3H0PA 3K5LA 1W2BR 2X51A 4OI6A 2HAFA 1WJ9A 1HWKA 4DCOB 4YB1P 2KM8B 1UP1A 2HNDA 2EKNA 1BY9A 1P1LA 4RW6B 5RUBA 3FZBA 1C2PA 4NOHA 1DY3A 3GSDA 4YEAA 3CJ2A 4LF6F 4DX7A 2MZQA 3TX0A 1JLQA 5EN1A 3M8YA 1L5UA 1SC6A 5KOXA 4X84A 1KHVA 3MMCB 4YUDA 3I5BA 1U2CA 3PKYA 1WF1A 3GV8B 3HULA 5C24A 2F1FA 1XMBA 5K8NA 4MKAA 2CJAA 1RXOB 4USHA 3HVAA 4JV0A 3RGIA 3WC2A 3HHLC 3EGVA 5KFHA 4BCAA 3CDBA 1FFSB 1YJ9S 2GO8A 4N8OA 1SQFA 1AFJA 5BJRA 4ZMMA 1JJ4A 1LW2A 4Z37A 3D28A 1X9SA 3MM7A 9RUBA 4JI3F 1WD6A 2AIRB 3BN4A 4EYHB 3ZTRA 3K8VA 2FJWA 5KFLA 1N5VA 1DHMA 2UVVA 3Q86A 1YTYA 1WKJA 4RW7B 3HXMA 3OSNA 4UY8T 2MQLA 1PYOB 3ZFVA 2VJUA 1FDDA 2N3LA 3MAAB 2R2SA 3UDLA 3AQPA 2PMZD 2FDNA 3KWMA 2BJ1A 2GVDA 2UXDJ 2DR8A 2IFXA 3VZHA 1IR1A 4UOHA 4NCAA 3RBZA 2V2KA 4I56A 4RL1A 3OT9A 2NSBA 1ZA1B 2I8EA 1YI2S 4C9DA 1O8BA 3ZZPA 3QAUA 4A8FA 4WP9A 2KB2A 3T9NA 1EKRA 1U4BA 2FC8A 1NH8A 2X3DA 3DXBA 4WYLA 2FJVA 2A1BA 3NGRA 4LF6J 2ZE2B 3PNIA 4DV0F 4DUTA 4MKVA 5L38A 4CLZA 5ETVA 3BKUA 3H2UB 4OLOA 4NYOA 3K0JA 1IQZA 3IG1B 2K2PA 4ZCKA 3A8KA 4PABA 2DGOA 2RDJA 1PBAA 4DQQA 3MMAA 3RAMA 1TUWA 2XEXA 1FXLA 4AFFA 2VONA 3MMJA 2R8GA 3SQGA 1RCXB 4EK2A 2L9WA 1Q8IA 3KOAA 4C48A 4K5RA 2IMOA 3E8OA 4N7TA 2P9EA 4USJC 3HD1A 3K2YA 3CCVS 4KFBB 5CD4H 2OLWA 3OR2B 1CJTB 2FLPA 2HW3A 2PA3A 3AODA 4JI3J 3AJDA 2Y1IA 2FIUA 2QZ8A 4Y0FA 4K4WA 2UV8A 2NUUG 1ZAVA 3P6YC 2QL7B 4HT7A 3GTYX 3BO4A 4PG5A 3PDNA 4PG4A 2EBEA 5HJXA 5KFFA 1UVMA 1U0HA 2VG6B 4JYAJ 2RKIB 2KKHA 4ECVA 1SKSA 5HROB 3M32B 3K8WA 2V4JA 2KU7A 3IRXB 4EBDA 5CYMA 2WB1D 3QSIA 5KFTA 2RUSA 3FKBA 3EMTA 3HSJA 4N5SA 4DV0J 4HKQA 1UTAA 5AT1B 3IGVA 3U7JA 2COLA 2VKRA 1UA0A 1S4EA 4V19X 1XC9A 1NPKA 4RW8B 1SJQA 1HBOB 2ZC3A 3MWBA 4CDIA 2DH8A 1YBUA 2XO7A 4EBCA 1X4EA 3TA0A 4IO9Q 2H5JB 2BE2A 4ECYA 1SPBP 4IQXA 2A10A 3BF4A 2R8IA 4AQYF 2DNKA 4LR7A 4LF5F 4LSNA 2LFVA 4J5OA 3UCZP 1FX2A 3QMQA 4RR5A 1ROFA 4B3RF 4J91A 5HL7Q 1RAEB 5IV3A 2M0GB 5U47A 4IFYB 1I1GA 3NCPA 1EP4B 2WBMA 3CMAS 2ZITA 2HZVA 1N36F 2CG4A 4XAKA 5KFVA 4F2SA 2N7YA 4A48A 1HI1A 1ZBTA 1MLAA 3KJNB 4MFBA 4V19J 1JNRB 3PJXA 5K14B 1DLOB 3T41A 4J9QA 4O3NA 4FXDA 3V6JA 3EICA 4EEYA 2V69A 4DZ6A 5J2PA 2F3JA 1SL0A 4L75A 1SIZA 4ED8A 1HPZB 1PCAA 3QZ7A 2LYVA 3B54A 3CXCR 3C2PA 3IR6B 3F73A 2X1GA 3MEEB 5B0AA 2OEKA 3ET6B 4B9SA 4URSA 4X4NA 4PZVA 3SCJE 3C3LA 2VPZB 4ZP8A 4M95A 3CDUA 2FVCA 3QGIA 3JB9k 5G0RB 1RT4B 2GIFA 3EZ5A 4MIAA 4YY3F 1TV6B 3AOBA 3DLGA 4AQYJ 4LF5J 4CO4A 2CPIA 1SH3A 1XJWB 4WFZA 1VR6A 3MFIA 2J0WA 1RBLA 2OFHX 2ASLA 2YNGA 5BXIA 1UFWA 1RWVB 1Q53A 5CZVA 3H2LA 4KY3A 1JLEB 4AL7A 2AD9A 1S1VB 2F65A 5E33A 4ZKAA 2WAQD 3KMQA 4I6AA 4F0KA 4DL2A 1N36J 3B4MA 3HDSA 3PO5A 5LJ3Y 1QSYA 3JAMY 4OJ3A 1IM6A 1H2TZ 1KQKA 4LF2A 1HW9A 5F8NA 2X3GA 1RWXB 2C2OB 3HKWA 2CJ9A 3PY8A 1VHIA 3GSIA 3IM8A 4M5DB 3W2VB 5A6WA 1KR4A 1DARA 4ZPBA 4R5PA 1RKJA 4F4YA 5FDLA 3X3UA 3MAHA 4TXSA 3PFOA 1UVLA 3D0HE 4M1KA 3H59A 3ENAA 1RJJA 4E2FB 4UQGA 4S0MA 5J2MB 3DRPA 4HTIA 3MEDA 3DOMB 2YWWA 2VC1A 4DSEA 1OSDA 5KFAA 5BYRA 3CJTA 5DG7A 2F4VF 4ZVTB 2VZ9A 4LR8A 1FWPA 2KVIA 1J2VA 1A7GE 2E9RX 4YY3J 1T9UA 2MZ1A 4FS2A 1F2HA 4CZCA 4DJBA 4Z2XA 2XMMA 1JWWA 1UETA 4DL4A 3BQ1A 1BQMB 4Y6IA 2GW8A 3LP0A 1APSA 5A8KA 1JJHA 3JSBA 5EWGA 3ISZA 5F9LA 4DG1A 3ZTSA 3LGNA 2QV6A 1X5TA 4QIEA 4QZVB 1HI8A 2KFYA 3CIZA 3R3TA 4ICLA 1IBCB 1VMBA 2ZH6A 1BC6A 3PHEA 1D1UA 1X5SA 3ILOA 1FHTA 4AYBD 5ETOA 3HD2A 1M1KT 5KG7A 2B6AA 3G6XA 1UZHA 2JJ4D 1IVZA 3RRKA 2HQDA 4KHMA 1FRKA 1FNXH 5KFKA 2Z4PA 2XY5A 1X60A 4OHWA 1OSCA 5C25A 3HM9A 2Z56B 4QYZJ 2YNHB 2I0XA 4LREA 4MIWA 1CSJA 2NLWA 3KFWX 3OHAA 1ELOA 1S1XB 1FNOA 2ZBCA 1GK8A 5KFDA 3E01A 5HLFB 3GWCA 2GV1A 2MKJA 5D4LA 4K4YA 2CJQA 2VV5A 2F4VJ 3M8QA 2Q6CA 4B9UA 1LWCB 3MR5A 2ILZA 3GZ7A 4LF1A 3R5DA 2R8JA 2HMIB 2XWXA 3J7A1 2OUGA 3O2IA 4O23A 1E6YA 4USVA 2K8GA 3QGGA 3PFEA 2CVIA 1B0VA 4NWBA 5E5NA 2HBZB 4DSJA 2HIYA 3HHKA 3ILLA 2R3VA 2NYHA 3LA0A 5LJ5Y 1JLGA 4B3SF 1YG0A 1SJRA 4G1IA 4TKTA 5KFIA 2QA4S 2VC0A 5HVFA 2HK2A 1CQNA 2YVSA 2NR0A 3KJVA 3R2DJ 1U45A 4LIRA 4DF8A 2KYZA 4PG8A 1TVRA 1KKHA 2XG8A 4DDFA 5A8WA 5MAOA 4RLEA 3DU6A 9ATCB 1SB6A 2BKOA 3W3SA 4X62F 4WBFA 2EVZA 3MM6A 1UJ4A 2CPEA 1N48A 4B17A 4IFVA 3I32A 3S7RA 3J7ZT 1GXUA 1NHKL 1SKWA 5D0HA 3KLVA 3D1QA 2MQPA 1S49A 1UVIA 2CFXA 3DRSB 2H54B 1ZAWA 2F8MA 4QR2A 1HA1A 2IM1A 3DI6A 2IIHA 3TZWA 3Q89A 2IC3B 1EB0A 3I55S 2FZKB 3BSAA 2MPUA 4AL6A 1W26A 3HHDA 1EKSA 2Z2LA 3P96A 4HEA9 2JL9A 2KTQA 3JQJA 2XMTA 1HQEA 3OFGA 3BBBA 1FRXA 2UU9J 1SJFA 3EVMA 2UVWA 2HBYB 1CVJA 3JAMU 3NP5A 2HWHA 1PG5B 2DH9A 4B3SJ 4CH1A 2DPIA 1S97A 3UNGC 2OD4A 2KN4A 2UUAF 3CCQS 1S79A 2PA8D 5ETSA 3D3CJ 3BYRA 1T05B 1K0VA 3VR1A 1TFYA 4EZ9A 1I5OB 4M5KA 1UJ5A 3D3BJ 4IR1A 1UMJA 2V4QA 1Y4ZB 1ZAXA 1ZPWX 2ZH7A 4DSLA 4L72B 4K4UA 5HMZA 3TVYA 2QRRA 3K5MA 1GXLA 4X62J 4Q0BB 3W5ZA 1QE1B 2FYXA 5F3ZA 1FDBA 1FJCA 1FK9B 5I4MA 4NL5A 2CAJA 3GFXA 4YB7A 3DHWC 3KLEA 4C0OC 2ZD1B 1LWFB 2J9EA 3WC0A 5KFOA 1HARA 2DNHA 1JX4A 1VQ7S 1M5SA 3Q8RB 3DOKA 3PYEA 3TRGA 2W4CA 2AZ3A 2H3EB 3TYTA 4WKRA 1HKAA 4O3SA 2MJUA 4YDDB 2RQMA 1SV5B 1NK5A 1IQTA 4DV1J 4UZBA 3BGFA 4J90A 3AT1B 5DDQC 5KT4A 4IDKB 4DR4F 3I5CA 1WC6A 5H9FK 3OTEA 1BWVA 1LQ9A 2VOOA 4TY8B 5EGYA 4RZRA 1TL3A 1XEZA 3FMBA 3PW2A 4LVNP 2N4CA 3EGNA 3BPSP 5J2NB 3KDNA 2DYAA 2QX0A 3LW5C 4RUCA 2UUAJ 2QMWA 2CJKA 2L9DA 1Z2ZA 1JLBA 1YITS 1KC8T 2K1RA 4B9VA 5KG4A 3WQPA 1AUSL 3TZXA 1ZZNA 2P5VA 1NHUA 1RT7B 2HHSA 3MEGB 4IKAA 2Q6BA 5HQ8A 2ZEJA 3HX9A 4DSFA 4NXMF 4ITSA 4FF1A 1NDKA 3V2UC 2PO4A 2AYGA 2C42A 2HHWA 2W9BB 2NREA 4NPOA 5GAEU 1DTQB 5DQHA 3HKZD 1HNIB 1BE4A 3OQ2A 1VQYA 2BM0A 1KLMB 1D3WA 5KG0A 2E7VA 1GAOA 2GQQA 1Q95G 4WU3A 1WEXA 4OYXA 1ACMB 2AX1A 1VQPS 1C1BB 4IH7A 1MSWD 2O01C 3GONA 4DR5F 1YWXA 3G8SA 3VF0B 3GV5B 3G86A 5F41A 2DO4A 4L74A 4CLYA 4DR4J 1JJCB 1NHVA 2GO9A 4OHYA 4GRSA 2IJNA 5AXKA 2DNGA 3N5FA 4GVBB 4ZVQB 3K58A 4HT5A 3NY0A 1SKUB 3G82B 1YQHA 3IAS9 4O3RA 1N0VC 4LFAF 2IVYA 2QYGA 3CUNA 3POTB 3DGPA 5C42A 1S12A 1TKZB 3G2XA 3ETOA 2B56A 3OUYB 4P2XA 2E7XA 5D0GA 3HVWA 2IRYA 3LANA 3PYDA 2MKYA 3W8PA 3OR1A 1LW0A 4DR2F 4ZPTR 2Z2MA 3IN5A 1FXRA 4NLGA 1K73T 4WP8A 1WWHA 2V8VA 1REVA 2E9TA 2DT9A 5E3RA 3V4IB 2CJBA 8AT1B 3NEKA 4MT1A 3Q83A 5B0CA 1RAHB 4LUBA 2PSZA 4NXMJ 2IVMA 2R7VA 3LUYA 1UFKA 3EZUA 4ECSA 3SEOA 3HVTA 2EFQA 3V6DB 2M52A 5KT2A 1FKPA 2IY5B 3FEXB 5DS7A 3UE2A 2V9KA 2F8HA 6FD1A 1HBMA 2IHR1 3QAEA 4LRDA 2P6TA 1XBWA 3PW0A 1P8GA 1VYAA 4C0BA 1KVJA 1X5PA 2VA2A 2WB4A 2E1PA 2DR7A 1RCOB 3CE8A 3BDPA 1S0MA 1AXQA 2YKMB 1Q8KA 1V6HA 1HYSB 1SCJB 2N82B 2RIJA 2ZWPA 4DR5J 3MCMA 4GC6A 4D3GA 3I6PA 1S1WA 3MECB 3Q22A 2AU0A 2M7SA 2CJYB 3D2WA 4LFAJ 4QW8A 3C6TA 1XK8A 2F4FA 1RT3A 2JC1A 2LA4A 4ZPAA 3IS9B 2XGQA 4WE1A 2FHJA 5L1JA 3CD6S 2ZOGA 1NDLA 5BR8J 2V0NA 2GVZA 4OZNA 2GC8A 5M2UA 2Q79A 1B0PA 3GIIA 3KLIB 3NGSA 2AKWB 2NXJA 1F5AA 2CPHA 3CC2S 4KJIA 2JEGA 1NJWA 4KO0A 2B5JB 2DXEA 3UN5A 4NE9C 2ZDOA 3BBCA 1UW9A 4YR3A 4C11A 3EWGA 3HSGA 2AP6A 3FMWA 3T19A 3OVSA 1JK9B 1TU0B 3LO3A 2W4PA 5GADI 2XHWA 2LQ8A 3KTQA 1TQLA 1Q8LA 5SUHA 1X31C 3TQEA 1AFIA 1NLKL 3JSMB 3RR7A 2FZGB 4F2RA 1OS5A 3M2RA 4CP5A 2BJ8A 4YB6A 3M9MB 5KFYA 3ISND 4A8OA 5E3PA 5B0DA 1WDDA 4DPWA 4QIFA 3NKYA 2QO3A 2XNQA 2WHOA 4IG3B 1EJ7L 4L6V3 4IO1A 4OZ1A 4C97A 3FSIA 4I2PA 4NLYA 3W5XA 3HHLD 4B9TA 4KGKA 3GR0A 1RLCL 2R2RA 2HFSA 4EZ6A 2DNPA 3J7YU 2Q66A 1FFWB 2C1EB 1T7PA 1FCAA 3IA0A 3Q24A 2NXEA 4OJ1A 2ZJPQ 5K20B 1TKXA 3FBCA 2CDRB 1TL5A 3US5A 2KT2A 2OPSA 4C3MA 2A2DA 2D3OR 4CTAB 4ERDA 2WOMA 2UVRA 1RU2A 3FEZA 2XCPA 3JTOA 4FYWB 4ELTA 2FVQA 2ZZNA 2MQMA 3ONQA 1UVNA 2XZTB 3BN7A 1ICEB 2PIIA 4NZ0A 1U26A 1M5HA 3W1YC 1R0AB 3MMBA 3IBFB 1EZZB 4JUZA 1QVFR 3MTJA 2R9LA 4FVCA 1N6QB 4K4XA 1A6LA 3GJQB 1WC5A 2GIRA 3L3CA 1MW7A 3G96A 3FCHA 2A6OA 1XN9A 4DV4F 1IKVB 3V6KA 4ZPWR 3MI7X 2LQBA 2QGFB 1M5KC 1UEUA 2DHXA 3KLFA 1VRUB 4G1PA 1Q1KA 4PXDA 3K7RA 4DPXA 4DR3J 2O67A 3I87A 4QOTA 3U1LA 1YVFA 2QMXA 2FVPA 3DYAA 3TJAA 1GH8A 1D8ZA 3NCRA 5F8MA 2HPUA 3ETMA 1EETB 2YKOA 4RUHA 3T1AA 2R7WA 3C46A 2M88A 5LSLA 1MMNA 4PWUA 1LK7A 3QATA 3LQVA 2W9CA 3C8YA 2W01A 3D7SB 5F0UA 1RTHA 2VU5A 5IM0A 5DG9A 1EARA 2XULA 5DG8A 1M90T 2JEFA 1FD2A 3N28A 4ZVUB 5B0FA 4U8YA 3ENWA 2OIHA 2J8AA 2UUWA 3M30B 3PRDA 5D8HB 4OQJA 2R4FA 1AW0A 3MD3A 3DLKA 1SL2A 1K9MT 4PUOA 3BM7A 1KHWA 2JWNA 2ATLA 4ELUA 1MMLA 2XY7A 2CPFA 2WONA 2ADCA 3M05A 2RILA 1D9DA 1RADB 1YZ6A 1CJUB 1UJ6A 2M8HA 3FBBA 3M8ZA 4DV4J 2O66A 3U27A 2Z30B 1OPZA 2DKOB 4XDCA 1U1RA 4Y2IA 2I38A 2HS3A 2V5HG 2UP1A 1AZSA 4TYBA 5IZHA 3AH6A 5KFPA 5I3UB 2LU2A 2H4WB 1S6QB 3LPYA 4I7FA 2XB2D 3A3OB 2MZTA 5DZ6A 1I94F 2PN6A 3PHTA 3EGWB 4JOUA 1TL1A 5KG5A 3QLHA 2R7QA 2LMIA 3C16B 3FQKA 3IM9A 2JDJA 3HLUA 3QIPA 3PVXA 1UWAA 4DV2F 3UDEA 2YWEA 3B6BA 4PXEA 2GQCA 1WKKA 4QYZK 5KFZA 3QRPA 1NB2A 4OI0A 3SFGA 1Q81T 1QTMA 3KK3A 2K7JA 4X4VA 4KB7A 3AFGA 4LSLA 4DX6A 3PYGA 4HACA 2HRYA 1MG7A 1QUVA 2OPRB 1IR0A 3ZZUA 3VAJA 3OTBA 5T7LB 1PO6A 2AGQA 2AGOA 4CYUA 2RHQB 3MM9B 2HVEA 3NBPB 2CQGA 4AXJA 3BYPA 4J9LA 3D68A 3HK2A 4FKYA 1VRTB 1JLAB 2KHDA 3L4BC 3QZ8A 2RU9A 2AJ4A 3G9CA 4R8UA 3MM8A 3W9IA 2BM1A 4KKOA 3UVJB 1R27B 1QY7A 5CD4A 1G6BA 2WSFC 4DR6J 2MHEA 4NLWA 3RB4A 3RAXA 3QRRA 4RNFA 4M5JA 4HL9A 5CYJA 4X66F 1KQGB 3M9NB 4RW6A 3Q2TC 3OVBA 4K8RA 2MQ8A 3EXCX 4ECXA 3CCUS 2AEMA 4OI1A 2YKNB 4IG0A 4DV2J 3C66A 5E2QA 3MCNA 1QAJA 3LAMA 3MMCA 3J80U 3V81B 2R7XA 4CO0A 1FRHA 2RRNA 1NNDA 5IC4B 1T9YA 4WIQA 1XR6A 1VOMA 2HBQB 3CW2C 2OTJS 1RT5B 2QC3A 4AT1B 2YQ3A 1P27B 4L3NA 3RZAA 1WHYA 3TWZA 1RKIA 5CCMA 4W98A 2PFFB 2UVUA 4NYPA 1DBDA 1C0TB 3BZQA 3G6ES 4USIA 3VHQA 2AYBA 4NX9A 2G0IA 1DURA 2RS8A 3KKFA 3G4SS 2WRMA 2RF2A 2C2RA 3UN3A 2OI2A 2BW7A 2GCFA 3PRVA 1MU2B 4RW7A 2DCUB 2V6AA 2R7UA 1XERA 1YK9A 1FRLA 3OFHA 1FNMA 1R6VA 5EHHA 2OHDA 1RP5A 1K0TA 5LSOA 3MUTP 1AROP 3M8PB 4TU7A 4KYZA 2DNQA 4RU9A 3KXDA 3DCAA 3D1HA 4KGVB 1NKBA 2WTFA 4Q44A 4B9LA 2ZBPA 2X1FA 4X66J 4N76A 1X5OA 3H98A 4CLPA 3PW5A 3HO1A 2GS8A 1H6KX 4ZJOA 2DGWA 2Z8QA 4Y2CA 4NLSA 2HNDB 1RTJB 4FXWA 3W9JA 2VODA 3TUJC 4F4KA 2OPPB 3MCSA 2B4UA 4G6VB 1CULB 2MLZA 2FC9A 2J0XA 4M63A 4DPYA 5B0BA 1T02A 3FGVA 1YDLA 4TQSA 5C24B 3H5XA 3TZZA 5B7WA 3TI0A 2MLXA 3IR7B 2OJ3A 1S0NA 4U7UK 5LT5A 2Y0BB 2FVRA 2L08A 3K5NA 2R7SA 2XBPA 1R0CB 4TQRA 4DV7F 1WELA 5D3GA 4OI4A 2MKIA 2XGPA 3VVUA 4AXIA 1LW2B 1U1KA 1S1TA 1FX4A 2DGVA 3AXMA 4ENOA 1HNXF 3NCQA 3MM7B 5DM7Q 3SFUA 2H48B 2ZOFA 1VDHA 4DX5A 2EFVA 1IXKA 2Y9HA 1Z2LA 4EYIB 2CXEA 4P72A 2RUGA 1FVSA 1NH7A 2FB0A 1KOOA 3CPWR 3LH2S 2HFZA 8RUCA 1UVKA 1E6VA 3NAHA 1AA1B 5HO4A 2EEYA 1OJ4A 2RKIA 5HROA 2XMWA 2WVCA 4CWBA 3HFKA 3IRXA 4USWA 2H51B 2YKPA 5KFBA 2Y1LB 1HD0A 3CD5A 4ZA1A 2ZFHA 3TAMA 4PRFA 2LLZA 1FTCA 2DNMA 2KH9A 4X4UA 1NEEA 4IR9A 4EO8A 3THPA 4E0DA 1VGYA 2MXYA 1FXDA 4RW8A 1KRPA 4CM2A 5F8JA 4U95A 1WG4A 2CQDA 2KXHA 3SV4A 3RW7A 1XTZA 1MMDA 3QIDA 1FRMA 1S0OA 4TU8A 2LEBA 2Y3YA 3GFYA 3JQMA 3QBCA 2HHUA 4NZ6A 4NZ7A 1SC3B 4DV7J 3SQGB 1VBZA 1RLDA 3TA1A 3KK2B 2CUYA 1NB7A 3K59A 1CBKA 1HNXJ 4CH0S 4JI4F 2DNYA 3KLGA 1R31A 2WVDA 1M5OC 4DHVA 1U8SA 2C2EA 2OH2A 2EXUA 4C8KA 4FXVA 5DQIA 4LBIA 1S59A 2V8GA 1JLCB 2W4DA 4XIUA 4OYPA 1IKYB 4F4XA 3RG6A 3CCZA 5K14A 1DLOA 3L7UA 1L3UA 1FT8A 4OX9J 3AHPA 3AXKA 1KLNA 2HG4A 3GIMA 2XZWA 3OV7A 1N5YA 5HI7A 4USTA 2QN6B 5CYMB 1HPZA 2RDIA 3SIPB 3GIJA 1X4DA 4DQRA 5L1IA 4PCQA 1Q5YA 3ET6A 4JI8J 1I3OB 3DHXA 5DETA 3PRBA 3H5YA 3RB3A 1TUVA 1UPPA 4ZLNA 2UUBJ 1GTHA 3W62A 1K1QA 2MDAA 3WDOA 5KT5A 4YR0A 4HYKA 1TV6A 2BANA 4C4WA 1TKTA 3IFEA 1GNKA 3CJ4A 1H2UX 2OSRA 2NCKL 3R5AA 3N5BA 4NYZA 3EPGA 1C1CB 1YJVA 2B7BB 2E5LF 1X4CA 3W7BA 4JI4J 4URQU 1GTEA 3BB5A 3BGUA 4ED1A 1YJTA 2HNYA 4LSNB 5CCLA 1V3SA 4J9OA 4E8UA 5DJBA 2XO6A 4CLLA 3G87A 1S1VA 2BW2A 2W2QP 5E3QA 1B7YB 3OLBA 1YIJS 1HWIA 4IH5A 1QUPA 2AJ1A 4DQSA 2L48A 2ZUGA 5AE1A 3S8SA 1U6BA 1KSPA 3W5YA 4J9NA 2XSFA 2YY3A 1KN6A 4PG7A 1D0EA 1O0PA 4A8WA 1Q16B 4MFBB 2RS2A 1CQMA 2YX1A 5J2PB 2M8DB 3OTOF 4HH0A 4F67A 4JB8B 5J2MA 1FE0A 2FHKA 1BQNA 1VC0A 1RABB 1FI4A 3B82A 2BKNA 3NL0A 4RBTA 1PJ5A 4J9SA 3IR5B 5KG6A 1KOHA 3QFHA 3C15A 2HHQA 1IWGA 2CPXA 4C3KA 2BJ7A 4FBUA 1KP6A 5JJBA 2G2ZA 1B64A 2DISA 2KDOA 2LXIA 4ZVPB 4O4GA 2NSCA 4OHXA 5A8RA 3MM5B 1BQMA 4NLRA 3D6HB 3ICLA 2CVEA 4L76A 4B3MF 2E5LJ 2MKKA 3CO0P 1XMQF 5G4DA 4KPYA 1RHMB 3Q8UA 2A3JA 2LQJA 4DLGA 2PEBA 1U1QA 2J8SA 4RJVA 1HNVA 2GAGC 4NLTA 2CQCA 2Y1JA 1NM2A 4HH1A 2CZVC 3P5BP 1LXJA 1YJRA 3VGTA 1V5IB 2YNGB 2OMLA 3D5MA 2FLOA 4M5IA 4DL5A 4DL6A 1VC6A 1VIOA 4ZLLA 4Y00A 3KUGA 1EQ0A 3RB0A 1TTHB 3EZOA 2LVWA 2DCLA 1Q0NA 3C6UA 3D6FB 2RT3A 5I42A 2ZJQQ 2VH7A 1YKWA 3PCOB 2YNHA 4C8ZA 1G3OA 4OHZA 2BDPA 3MEKA 1VS3A 3OTOJ 2HVIA 4PYAA 1O51A 4WXWA 1ZETA 2JOQA 2QA4G 2X7IA 1UEKA 4CO1A 4F3QA 3BH7B 4J9RA 5GMDA 4AE5A 3EXYA 1IR2A 4QQBA 3CB4A 5KOWA 2HQ3A 2FJAB 4RNMA 4OZ2A 5C2GA 1R8AA 2VFVA 4QR0A 1O5JA 2V2ZA 2CQ4A 3FC9A 2PEHA 2HRUA 5CA5A 1YRTA 4J9KA 4NMLA 1R8CA 3TR5A 3U1MA 4WWSA 4L3KA 4B3MJ 2RB7A 5ETNA 4O44A 1XMQJ 1RSCA 3MPYA 2MY8A 2OD6A 4MTPA 4OHVA 1WACA 2V63A 3M2VB 2BE7D 4ZDNA 5C2CA 5IT0A 3H42A 5A8KB 2EWHA 4JI2F 3V6HA 1F60B 1MN7A 5IS2A 3OVAA 1WG5A 2QLBB 3SCLE 2BJEA 3UR0A 2YPYA 4X65F 4ICLB 2GFFA 1NK6A 1U09A 1DQAA 4WFAQ 1WOOA 2HVZA 2VASA 2XI3A 3TARA 2QFIA 2JEJA 2B6AB 1W7WA 2CQIA 1U6ZA 2PD1A 1RHRB 3L9ZA 3NGDA 4QWAA 3PX4A 2DNRA 3A13A 3GE9A 1H0HB 2QEXS 4X4SA 5FD1A 3BJYA 5C25B 4N47A 1RT1A 4WYWA 4QW9A 1TR0A 2XYHB 3HF5A 4ECQA 4J7CA 2FD2A 1QJHA 1B4SA 4OZ0A 2MYFA 4WPAA 1RHQB 3DU5A 3QSYB 1R8HA 3IMQJ 4HLBA 2EFOA 1GEHA 4AD6A 1R8PA 5HK4A 3D6TB 4PQUB 3PM9A 2FGOA 2C3PA 2FUG9 1EQMA 1NMEB 2C2NA 2FGCA 2MKHA 5LSRA 5JVGQ 4MAKA 3CC4S 4WTOB 4ECRA 3M8QB 2BXJA 1TZ0A 1SXLA 2HFUA 3LP1A 2B4VA 5D4OA 3T1YJ 4XO0A 2WW8A 4NRTA 1A0OB 3UDVA 3I5AA 3N4WA 1E6YB 4DR7F 4DL7A 2GJFA 4DS5A 3CCLS 2WZ1A 1KWMA 4K0KF 2VBXA 3U02A 1VCTA 4JI2J 3ISNC 3NNCA 2IM2A 5DM6Q 3VGVA 1S9FA 3CO9A 3IWXA 1JLGB 1GXTA 4X65J 3G71S 2HHTA 1RHJB 2CNLB 5K8MA 4HHJA 3S1TA 3QYYA 1WG1A 2DGXA 1P6TA 4CO3A 4F36A 3LF0A 3J81j 3P4UB 4XPCA 1U1LA 2A18A 4BLGA 3UFCX 3CDAA 2J7KA 5DO2A 1QE1A 5A8WB 1FK9A 1M1HA 2EK6A 4HI1A 1IBLF 1HBNB 5CAAA 4LMZA 4GVLA 5KFEA 2ZD1A 1NSAA 2B9XA 3MR2A 3GJSB 3N6MA 4K59A 4YS2A 4LIWA 5GAHI 4DR1F 2LQ9A 4Y28C 4C8OA 4DS4A 2EC0A 4Q5VA 4ZVOB 4CM0A 4YHHF 1EHWA 5DLGA 4E98A 3OSPA 2NS1B 2DK2A 4F25A 3DI6B 3I56S 3KYLA 3MPDA 1DFDA 2NZCA 3C14A 1N5QA 1YJUA 3T6BA 2JSXA 2UZAA 2F5GA 4QJVA 2IBKA 4OLPA 3EX7B 5KFCA 1YHQS 4DR7J 1OQ6A 2J6UA 4K0KJ 3S01A 1TUGB 2DXDA 3BS9A 2IA0A 3MD1A 4NA3A 4M5NA 4K5SA 5IT9Y 4J9UE 1S1UA 4P7VA 1RT7A 3R97A 4RBVA 3A12A 1RWUA 2NPIA 1GMUA 4PEOA 3MEGA 2BQRA 3E2EA 2G1DA 3WIVA 2E29A 3H5SA 3ZTPA 2J9CA 4QWCA 2W9AA 4DEZA 1SH0A 1IBKF 4P9SA 4FF4A 2YWKA 1WKLA 1IBLJ 1N33F 1DTQA 1SQEA 3OLAA 1HNIA 1J5EF 5A6PA 2YNIA 1KLMA 3CCSS 3VALA 1VRQC 2DEJA 1FKOA 1M5VC 4R0EA 5IV4A 3H25A 5DGAA 3OW2R 3CD0A 4DR1J 5C5JA 2PI5A 2F40A 5EWEA 1V3ZA 1SC4B 1C1BA 5GMKa 4MKYA 2BMBA 4YHHJ 3DOKB 2IAJA 3M6UA 3R2CJ 2D7SA 4F04B 3HPOA 2YQ0A 1G4CA 4LBHA 5A2QU 2ATCB 3CJ3A 3G82A 2P8IA 4C8MA 3FDSA 1NPRA 4ZS6A 2M70A 2IYGA 3BGRB 2R2TA 3BKFA 1RTZA 1IUJA 1TL3B 2VG5B 1K1SA 2BV3A 5GADU 5L9XA 3B4DA 3CCMS 2E7WA 3KHLA 4FYVB 3OTCA 5L8RC 4BDPA 3M8WA 2AHOB 2VL1A 3N0VA 4IOBA 3P5TL 1LXNA 2CIMA 1B7FA 3RR8A 1RU1A 3W8GA 1DJ0A 1YGYA 1IBKJ 4NLOA 3B78A 4ZLJA 3ILIA 2GHWA 2A6MA 3R5BA 2RE1A 1J5EJ 3W63A 3ITHB 2AX0A 3MOZA 1HD1A 2CDQA 1QAIA 1NJYA 2DTJA 1U25A 5KFUA 4CLTA 2X1AA 1R8BA 2YNFA 1T94A 1WF2A 1F3VA 1PIEA 1RTIA 1HYSA 5JVHQ 1U1OA 1VBYA 1RWOB 2BYCA 4JV2A 3CJ5A 3MECA 4UY85 1WUUA 2DGUA 3VAIA 3FSXA 3DRRB 1KS2A 4FS1A 3GYNA 1U1NA 1QDUB 1P9QC 1D9AA 1XIQA 2XMVA 1P1TA 4BWJA 2BEFA 4EO6A 4Q45A 2XC9A 4NA1A 1EX8A 1X8DA 2I6WA 1RI7A 1FJ7A 2HQFA 3KLIA 4I6WA 3DGPB 2G9OA 4F50A 4W90B 2B5JA 1RA6A 2MZJA 3CD7A 3AY0A 1MWZA 2XMKA 3NG8A 2G2YA 3I4HX 3OR1B 4Q8FA 1LW0B 3ZZOA 1UCNA 3OFFA 3G8QA 3RYLA 2HGMA 2WSEC 1RAAB 4Y65A 3R5GA 1L3TA 4K7QA 5HMYA 3M8SA 1CJKB 1X9MA 4FPRA 3QO9B 2CQ1A 3JSMA 2DRBA 4NLPA 4G1QA 3KJQB 3PG9A 5ETKA 1OO0B 1KBRA 5T41A 3D6MB 4CT9A 3HVTB 2D3ZA 2KRRA 4QPTA 3JXOA 4X4OA 4B3RJ 3IGNA 2V4RA 4OYWA 1ZZFA 3GJTB 1H3DA 4OFZA 3UW1A 2E5GA 1QAXA 5GVQA 3CJ0A 4RNOA 2MY7A 2IDEA 4ANDA 4P75A 3PKMA 4F0MA 2ILYA 1RT6A 4WF9Q 5IT9U 4WFNQ 5GAEI 1LWXA 1S1WB 4FYDA 2IJFA 3N6LA 1HMVB 3IWNC 3I0RA 1VC5A 4WK1A 4FPIA 1RAIB 5KFGA 4KGXB 1WEZA 3C6TB 5DQGA 2GIQA 4F26A 1X4GA 3Q0AA 5GAGU 4KRWA 3RRGA 2U2FA 3QFWA 5F9NA 2XLJA 1J27A 4DBQA 4FYYB 2XLKA 2F8EX 4O0IA 2O1PA 3KG1A 2WVBA 4DU8A 2HZAA 1MWQA 3S6EA 2AJ2A 2EBGA 4ZOSA 3NLCA 5I3PA 2XS5A 4KO0B 5LOQA 2DPJA 5FIIA 1MROB 3FCWA 3NOGA 4DV6F 1LWEA 2QG9B 2VIHA 4QCLA 5C7PA 3GYXB 1TK5A 3MPWA 5CZXA 1PYTA 4IOAQ 3BH6B 3GILA 3JS9A 1Y5NB 5IWAF 2DNLA 4UUXA 1KTQA 4B9NA 1VRUA 3HHLA 4B08A 2J0SD 2VA3A 1WC1A 3M2RB 2ZH8A 3VGUA 2VFTA 4QBUA 4BHQA 3F0NA 1ZTTA 2AJQA 1TP7A 3BKTA 3T1HF 2NZ4A 4OYAA 1CJVA 1KDNA 4FKXA 2C22A 4NXNF 2R2UA 3NRBA 4ED7A 5HVHA 2LEAA 3TAPA 1WTBA 4I2PB 1K8AT 2K06A 4N77A 4DI6A 5HJYA 4JP8A 1IBMF 1H7WA 5EX3A 1H74A 3W65A 3TJ8A 1XMOF 2H65B 4B3TF 1TKXB 1HI0P 1B99A 2OPSB 1KD1T 3HMJG 2AF6A 3MOJB 1IJEB 3KNGA 5L1LA 3PIOQ 1D9FA 2EI5A 4C0HA 1HHQA 7FDRA 3B8HA 3M30A 2WOMB 4O3OA 2LECA 2AQ4A 5LL6d 3JSYA 3DLLQ 2HFNA 4DFMA 2FVSA 2G1HA 5J2QA 3O1LA 4I4BA 4DV6J 4RPFA 5KTQA 3VTIA 2LXFA 3GCXP 1T9VA 1CS4A 3MMBB 2C2KB 4DQPA 2YKAA 1QSSA 1NK4A 1D09B 2EG1A 2HWTA 1S9GA 3CCWA 4LFBF 2WSCC 2W2OP 5IWAJ 2BBEA 4H4MB 2PMWA 4USKA 2J7UA 2Z2YB 4PKDB 1X4HA 4XPEA 2FZCB 2HBRB 2ZM6F 1S6QA 3HHNB 1NU4A 1HQ2A 3T1HJ 3PZPA 3KLFB 3GB0A 4P2MA 3TOQA 4WZQA 5HP1B 4NXNJ 2JX2A 3DYAB 2MSTA 1HFEL 2NYIA 3C16A 1WTFA 2MTLA 1IBMJ 1ZM2A 4V1Ak 4ANEA 3SCKE 4IRCA 4N8NA 2DGQA 1XMOJ 4I64A 5D15A 3JYTA 4B3TJ 4LF9F 1G1XA 5FLXY 1HWUA 4NLDA 1SKRA 2RMLA 1FF2A 3VQTA 2ZH4A 1RTHB 4CQ1A 2I5JB 2AMCB 2D3O1 2YX4A 2ZH2A 3OBIA 3SCIE 4M5GA 4FYXB 3E51A 3OHBA 2RAQA 4QU6A 2VQFF 5E7OB 2XY6A 4DL0C 4ZLPA 5T7LA 1NXIA 2E44A 5B08A 2BACA 3W64A 3DLKB 2M5YA 3N6NA 3RB6A 1LK5A 4Y3CA 2OELA 4DPOA 1S9EA 2V94A 2RQ4A 3CGIA 1J5OB 4LFBJ 2Q1LA 4R0JA 2WONB 2YWHA 2B3TB 4WFBQ 1RAFB 2IMWP 2DGTA 4ED5A 3BSCA 2AZ1A 2E5JA 3OL9A 4KHPF 3SDEB 2PT0A 4WFYA 1YRUA 1FKAF 1UWBB 3KG4A 3QT5A 3LP2B 1AZSB 3GFHA 4MJKA 4XTTA 3CCTA 2ACYA 3DFEA 4P7TA 3NS7B 4JBCA 2ZH3A 3GYGA 4C2MA 2CQ0A 4ZPDA 3OFEA 1TL1B 5K9FA 1ZYQA 2IJRA 3V81A 3Q2SC 4LF9J 3QLHB 2FHMA 3OJUA 2OFGX 1N52B 3M6WA 3KHRA 3EE3A 1PYSB 2IRUA 1Q4RA 2Q3PA 1RT5A 1LOUA 3GFZA 1C0UA 4YMEA 2VOPA 5K5MA 4EFAC 2V9WA 2N4DA 2VQFJ 2DVIA 1Q79A 2V50A 2DNNA 3KK3B 2DHAA 5I3QA 1C0TA 2GAHC 3F56A 2V2VA 2P6SA 4LSLB 1S6PA 2HYIB 3AJ1A 3PTWA 2AJ0A 1Y5LB 1IKXA 2XSJA 4GMKA 4KE5A 2FY8A 2Q43A 4CYUB 5AXLA 3T5LA 4DLEA 2VFUA 3QJPA 2GHPA 3RAQA 4KTQA 2ZKTA 1NBEB 1VQOS 4HHHA 1RWMB 4I0WA 2N3OA 2KG0A 4KHPJ 2DITA 1SIWB 4Z7CA 1JKHA 4CRJA 5J1PA 2VICA 3CJSA 3FNNA 4RW4A 3FFIB 4FF2A 1F6TA 3MR7A 5H9FJ 3EDRB 4KH0B 2ZOMA 3OXLA 2OMOA 1RTJA 1T9XA 2KI2A 3M2UB 1G7CB 4MKBA 3VAHA 2OPPA 1ZH5A 4IG0B 4TNOA 3WZ0A 1CULA 2QLXA 2DRDA 2M2BA 1H38A 4GKKF 3DC2A 1SUQB 2JRSA 4ZVFA 3DLJA 4CNZA 4Z7YA 3R8YA 3J7Z5 1VQ9S 5KG3A 1IJFB 3I0SB 2J9DE 4RO0A 4XDDA 3LGHA 2GGPB 2GNKA 4OMFG 1BUXA 3DDNA 2W8KA 4DPUA 2A2CA 3MXHP 2JZ5A 3EPIA 1Q8BA 2RF2B 4CNYA 3KLHA 1F2GA 2V2QA 1H73A 3W2WB 1OYEA 3SSQA 1TL7B 2JLFA 4DPTA 2DHGA 5F3TA 1U24A 4EUVA 3N01A 3RUBL 5LXYA 3T9ZA 5FLXU 2ZHAA 1IN0A 1HLWA 4JYAF 1R6YA 1ITPA 2PMHA 4NEYA 1HHTP 2ALZA 3GMGA 4ED6A 4I2QA 1X0FA 2QSFA 2W7PA 4ECTA 3WX8A 3BO2A 2ZVSA 3NNAA 2MZRA 3DMJA 1Y3KA 5H9EJ 1IKWA 3H4DA 4RW9B 2KXNB 3TW0A 4CCHA 2BJ3A 3GP9A 5DDOC 4UZCA 4LF8F 5JMNA 2KRBA 5THWA 4ID5A 3MTKA 4I6YA 3UQSA 5IT4A 2KM8C 2U1AA 2AJFE 3PX6A 3L95X 2LA6A 3UN2A 1VLYA 4LVOP 4GKKJ 2BOAA 1VK8A 4UOGA 1P9YA 3IWLA 5AXNA 5A76A 2VJVA 2HRTA 3FCVA 1HBUB 4DWIA 2VQEF 6FDRA 3M6VA 2XMAA 3R7BB 3KK2A 4F8RA 5KG2A 1XQIA 3M4XA 3KUHA 4PQAA 2JFKA 1PAEX 3DM2A 2SXLA 1RUSA 2AT1B 5D3GB 3DDKA 2VDIA 2CWXA 1S1TB 4B9MA 4UTGA 1A9NB 3P49B 2BABA 4OZ3A 4PR6A 2W24A 3BEGB 7AT1B 2DIVA 1JLCA 4DZDA 1IKYA 4FP9A 4TLQA 1AT1B 4DR2J 1F5CA 3K17A 5L46A 1RHUB 1E6VB 1QSLA 5M2PA 4M8LA 4BS2A 3GQCA 4TLRA 1Y3JA 2EPIA 4F4AA 2KFZA 2R8KA 1RQ0A 1N0UA 1RBAA 2HQIA 1RT2B 3TAMB 4K2JA 2B7CB 4LF8J 2CPJA 5AE2A 5J1EB 3IC1A 1B70B 2YKQA 3SBMA 2FQQB 2IA6A 4H4OB 2ACMA 3GU0A 4Y2KA 1ZTWA 2ZC4A 1PSDA 2GQ2A 5GMEA 5M2RA 1SI9A 2XTJP 2G0JA 2DHHA 2BA9A 4OV1A 1SJ1A 2HHPA 3FK4A 2R8HA 3WBZA 3ZZZA 2VQEJ 1PBUA 2CQ3A 4ANCA 2K3KA 3CCJS 4J9PA 3TJ9A 2BR0A 3TUIC 4CLKA 2PI4A 2I2YA 1C1CA 4O3PA 1QVGR 1RE1B 4P52A 4K50A 2VKZG 1GMVA 5AJ3F 3SXLA 1DTTA 5CYQA 1TMJA 2UUCF 3HFVA 4I67A 4WZMA 4RUBA 2L3MA 1N5SA 2OGUA 1X9WA 3KLGB 1T11A 2J9DA 2FJXA 3ZC4A 3GIRA 2CPYA 4KSEB 3PJWA 8ATCB 4A8KA 3R1HA 4LRAA 2P9CA 1KNZA 3CDEA 3M9OB 2CPDA 2VFSA 3Q8VA 2CQ2A 1Q5VA 4LR9A 2BJ9A 2CWKA 5CXTA 3AD7C 4OV6A 1X0PA 4C6AA 3J80Y 4A4JA 1VQSA 3CT9A 1ZA2B 4MMOA 3A8EA 5CABA 1N5YB 3EJMA 4WTYA 4U96A 1T8EA 4KQZA 2B9YA 1TK0A 2IYIA 2H4YB 3BQ2A 2RRBA 4HR2A 1L3SA 1UL3A 3SYZA 1X4FA 5E0OA 4YQWA 3Q8SB 1HNWF 1FD8A 1BWEA 1NDPA 1UVJA 3KMSA 4LT6A 3TQ1A 2D69A 2B51A 3W61A 1LFWA 2HHHF 3HVRA 4EBEA 2HK3A 3MM5A 5DDRC 3DLEA 2BQ3A 3P8BB 4NI2A 3ILJA 4HDGA 1LFPA 3L7OA 4ZHRA 1YJWS 4UF4A 2BANB 3AD9C 3PACA 1TKTB 3DDIA 3K5OA 1FVQA 1NK9A 5AJ3J 2BKPA 5HBMA 1K47A 4KAIA 3DOLA 1FWKA 2BRKA 3H2VE 4USUA 1PGZA 2UUCJ 4NCGA 3IRWP 4B3OA 1QM9A 4KR0B 2C28A 1R7IA 1BLUA 2HNYB 3W60A 2QT7A 1RDRA 3UD3P 1OY6A 2ZDPA 3CWJA 3K89A 5ITHA 2D41A 2C3OA 2ZVIA 5B0EA 4UT4A 2MJNA 2PFDA 3HI9A 4WIIA 2HLTA 4DQIA 2RU3A 2Y8WA 2J6TA 4HVZA 4ELVA 3CEDA 1HQUA 3QT6A 4LBPA 4CI0B 2ZZTA 4WJBA 4TVAB 2KJWA 5KFNA 1XR5A 4FF3A 1UW4A 4RWXA 1OMSA 1M5PC 1DZ5A 2MQNA 3JTNA 2HNZA 4K4VA 3M1VB 3R7SB 3QJLA 2EC2A 2OPQB 1BQNB 5D4NA 5CQGA 3TUPA 1HNWJ 2RDDA 2HVDA 2CQHA 5L39A 1JLFB 3TUZC 3ZTQA 3CNQP 1NJIT 2VG7A 2RQCA 2HHHJ 3C15B 3D0GE 2DH7A 1NSPA 5LM7E 1B3TA 3MAQA 4W92B 4TY9A 2HS4A 1SBRA 3PJ9A 2D74B 1D8YA 2IBOA 4ZP9A 3NXZA 3T6JA 4M5LA 4O4GB 2VDHA 3M2VA 5A8RB 3MGJA 3JTPA 5KFJA 4A8SA 1U47A 4QIGA 2MGZA 2HQGA 4LF7F 1N8RT 1RK8A 5D6GA 4LRFA 1BQXA 1HNVB 1T0TV 3GG1A 4MYUA 1N4LA 3MUVP 2QA1A 5A0YB 1RAJA 1CG2A 1HHSA 2CADA 2HWIA 5D0EA 3DRXA 2W25A 1RTDA 2A0FB 4ES3A 2LDIA 2I1RA 4P2SA 2NUHA 2R7OA 5IQQA 4ECWA 3A8JA 2R7TA 5HMXA 3PXGa 1WNEA 5GAHU 4A46A 1TMMA 4OL8A 3C6UB 5ETPA 5HVGA 5I42B 2QTWA 3LTOA 2K3IA 2FJEB 4BC9A 4PWDA 2QLJB 3TO8A 5KAKA 3D0IE 2B43A 4WKYA 3ADAC 2DR6A 1VQ6S 3KK1B 3K5PA 3NS5A 1WORA 3HZEA 4ZVSB 2G4BA 2H1YA 3QJJA 1GX5A 4P2FA 2ZKUA 4PQUA 2XMUA 2KHCA 1N32F 4ZIWA 1UEVA 2H9ZA 1ULRA 3FRZA 3RJMB 3TAQA 2ROGA 1GMWD 2L41A 1S77D 3AA8A 2EW9A 5KT7A 5E3CA 1CC7A 1I94J 4LRCA 4TYAA 2BOPA 1MN9A 3NGKA 1JXVA 1S4FA 2D9PA 2QLFB 4USMA 4DL3A 4MYTA 1NK0A 4MH8A 5IFMA 2G13A 1VQ5S 4O44B 3FSYA 2KYXA 2UU9F 4LF7J 4AL5A 3BV8A 3I9ZA 1WDTA 6AT1B 1S7IA 4PYDA 1RB0A 3IBCB 3DLHA 4UOCA 1T03B 3OJSA 2ADBA 4ZPCA 1VFJA 1AYEA 2ASYA 2AGPA 1U6FA 4KV8B 3F41A 4IQMA 1KEKA 2RJZA 4CO2A 1V5VA 3MR6A 4C8LA 4FNHA 3BBFA 4JI0F 2Z0GA 1HBNA 1KQSR 4ZITA 2ZBIA 3BO3A 3UCUP 1RWPB 3LPEA 2JEIA 3CJRA 4TN2A 1RT1B 2F9DA 2XQCA 2L9NA 2ZBRA 4C8NA 1VK3A 3MAAA 1F1BB 2LEPA 2C3YA 5HATA 1N32J 5AE3A 5MLCV 3UPFA 4RNNA 3T3FA 3CTRA 1FWLA 2ASDA 1M1GA 4DV1F 2RH3A 1PAUB 3KDOA 2UUTA 2JFDA 3CJKB 1LV5A 4NRUA 4LQ3A 4RX6A 3M6XA 4CIOA 3LP1B 3LWLA 2XS7A 4J37A 1S6UA 1BGXT 2ZE2A 5CH7B 2KT5A 3PW4A 4OZJA 2W2MP 4IRDA 4ZVEA 1VQ8S 1XNQF 4FVMA 3CMES 4YR2A 2DD8S 1R0BG 3IG1A 4O3QA 2XNRA 2GMJA 1JLQB 3M7VA 4OX8A 1FESA 2YH1A 3PEJA 3BGLA 4FN5A 2RVJA 3DGVA 3UO0A 2OEJA 4DV5F 2POKA 1DRZA 2LU1A 3AA9A 2DEIA 4JI0J 2VBZA 4NEZA 3DXSX 2YWFA 3VAFA 3RTVA 4KFBA 4X64F 2KZMA 3OR2A 1CJTA 2HGLA 4IUFA 3QWUA 1VI7A 2GJ2A 2MKSA 2MLYA 2KVQE 1NK7A 1W25A 3VVTA 3DRYA 4F4WA 2RNEA 4P71A 4P6QA 4DSKA 2ABYA 1N56A 1NAQA 3I82A 1PJ7A 4MK7A 1V9OA 5J1NA 2FLLA 3AB2B 2OKQA 1SC1B 3ZNJ1 4WK3A 2VPYB 2HFOA 2VG6A 1BMQB 1FDAA 4NMXA 2GVDB 3M32A 3GG0A 3BGRA 2LQ5A 1FEEA 3C14B 3H40A 2HZCA 2DNZA 2MZSA 1U0SA 3D54A 2VG5A 3VZIA 2CNKB 1XNRF 5IOLA 4M5MA 1YJ7A 3SV3A 3KHGA 1XNQJ 1LEOA 2HVHA 1Q78A 1Y9OA 1DAXA 4RUAA 4C8YA 1HBOA 3I4PA 4LF4F 3TA2A 2UXBF 1PKUA 1WF0A 1S1UB 2W2PP 1RWKB 2LP4A 1UZDA 3THVA 4DSIA 2O3DA 4DV5J 1C4AA 2I9SA 1VQNS 2HGNA 3MMAB 3R6GB 3ZZTA 3RRHA 2MMYA 4OYOA 1MWYA 2HIQA 3O44A 3HJVA 3ITHA 4X64J 2RHSB 4KGMA 1FFGB 3TP2A 3ELHA 1F3FA 4XK8C 4ID8A 1VHFA 3FJ2A 4U9RA 4YB5A 3QT7A 5D0RA 2YNIB 5EX0A 1T9WA 2B8QA 1FE4A 1FKOB 4IFYA 4I69A 4DV3F 1EP4A 1OWXA 3BSOA 3DRRA 2IAJB 1URRA 2PDAA 4P74A 2YBVA 4DN0A 2QL5B 2E1CA 4J9MA 3RBDA 1U0HB 3OL6A 2J5AA 2W7OA 1XNRJ 5FJ4A 5H9EK 1NK8A 5K8OA 2V4JB 3JQKA 5BR8F 4ZJQA 2AYEA 2LXUA 2ZJRQ 4U6PA 2XS2A 1Z1ZA 1CC8A 4LF4J 2UXBJ 3MEEA 1T3NA 2VD3A 2YPZA 1LNQA 5HQMA 1U7LA 2IDLA 5JUMA 3TX8A 2M9KA 5D4PA 4A8MP 4NA2A 1CJKA 2EG2A 5G0RA 4F3OA 3NGTA 3QO9A 1RT4A 4QWDA 1X4BA 3MUMP 4QU7A 1U8WA 3MCOA 2XWYA 4WP3A 2ZNZA 4Q43A 1HWJA 3DLBA 2BE2B 1TFWA 4ZVRB 2BRLA 4TU9A 3TANA 1TL4A 3SQOP 2B0GA 3RBEA 1PC5A 3EUNA 2B4OA 1HL6A 3QGHA 2FJBB 1JLEA 2R7RA 2NPFA 2DB1A 2YNFB 4DV3J 4PPDA 3MPVA 7FD1A 3GCWP 3FZ2A 1RTIB 5T14A 2GX8A 1RAGB 4W4MA 2H5IB 1HMVA 5ADZA 4LFCF 4PAAA 1DQ9A 4QYRA 1U48A 2F7VA 4ZCMA 2Z57B 4M5DA 3W2VA 2AEJA 5K8PA 2XCAA 1YSJA 3EDQB 1S7HA 2P9GA 2M4MA 3AOCA 3FVYA 3OTDA 1EIYB 3RW6A 1VIXA 1VJQA 4BWMA 2OEMA 1SQGA 3DOMA 3VV2B 1MROA 1JQGA 3PO4A 2OP5A 1I51B 1VISA 1VQLS 1LKZA 3HZGA 4QWEA 1JMTA 3D1OA 3AB4B 1R3NA 2CKWA 4GKJF 2EKYA 3AD8C 2PE8A 5E3AA 2ZH1A 1RACB 1YRXA 4GO5X 2AYMA 1Y00A 4PXCA 4G1QB 3P45B 3DLGB 2DR9A 3UDCA 2BE9B 1CEZA 3AOAA 1T3OA 1WSVA 5B09A 2PC6A 4RWWA 4HDHA 4ZP6A 1XR7A 3MPUB 4DR3F 3NMAA 3CJQA 2RQKA 1JIHA 3A4TA 3A3NB 3BGOP 1C4CA 2EK1A 4WU2A 2C3MA 3HSZA 4YOEA 3ZO7A 2Y0SD 5KT3A 4LFCJ 2CQBA 2W8LA 1Q82T 3Q8PB 1RT6B 1CPZA 2O5DA 2QE5A 3I0RB 1FTRA 1F0XA 3MF5A 2VUGA 2GMLA 3KUEA 1S1XA 1Y7PA 1H7XA 4R5PB 2DY9A 5FDLB 5HLFA 3M8RA 3THTA 3D67A 5D77A 2V8DA 2CZ4A 4ECUA 3CCRS 2B9EA 4OI2A 3DRPB 2QYCA 4QPXA 3L09A 1LWCA 2LDYA 3MEDB 4OIXA 4OYIA 4F0HA 3MZIA 1JB0C 1KTVA 2HMIA 2EFNA 4GKJJ 4MK8A 1ZS6A 1LWEB 3ZZ0A 4H4MA 2E1RA 3VQSA 2G0CA 2HEKA 3LGMA 1PJ6A 5L9NA 1KFDA 3H4BA 2JVRA 4RNHA 3KNAA 1HNZF 4KT0C 3J7AN 2AV5A 4CLSA 2YXLA 3LP0B 3HHLB 5A2QY 5HP1A 4GO7X 1WC4A 5DLFA 5F8IA 4DG1B 1L3VA 4YFUA 4OZLA 1SJ4P 2NQPA 2YH0A 4ALZA 3V4MA 2V67A 4ETZA 2JNJA 1CJVB 4ZIVA 1KVKA 3ULHA 2DGSA 2EFGA 3I96A 2AWZA 1HR0F 1NRKA 4JI7F 2Z2ZA 3OL7A 1FJGF 1ZOTA 1ZM3A 2QA2A 3O6QA 2WCXA 2MB0B 1VQ4S 3CIMA 2WBRA 4EMDA 2IRXA 2I5JA 2J0QD 3TVKA 4A8XA 3L7PA 1TAQA 4YN3B 1F5BA 1F9EB 1RBOB 3NS6A 5DZ7A 4DX8H 3C19A 2ASJA 5F8LA 3DRSA 3W9HA 3LOUA 1NSKL 3A3PB 5F0WA 2IM3A 4DOZA 3VGSA 3SMZA 1VLOA 1I6JA 3E01B 1WOSA 5KFSA 2IC3A 2ZZMA 4MK9A 4NCBA 1S72S 3UR3C 5GAGI 4FBTA 1B0TA 5J2QB 3NWRA 1J5OA 2HKEA 2C2DA 4UQTA 3CMQA 2E9ZA 2XM3A 1CS4B 1RA7A 3BDEA 4WFXA 5EWFA 3EM1A 4NLVA 5HSPA 1NKEA 1PILA 1U49A 1S9GB 2XHCA 3FBEA 2AW0A 3BPDA 3W66A 1XWLA 2GZOA 4R25A 3D9BA 1HNZJ 4JI5F 2BVZA 3SDEA 4UW2A 2KZZA 2WW4A 1WEYA 2ZNYA 1UWBA 1Y10A 3LP2A 2MHNA 1KONA 3HT3A 4DR6F 3U1NA 1T05A 2GMHA 1Y0HA 4DUYF 2CNOB 2C3UA 2XLIA 5LMNF 2CYYA 2NXCA 2HHVA 4X2BA 4ZN3A 3KG0A 5LMUF 1FEHA 2KFNA 3R5CA 3R7NB 1HR0J 4F7VA 4JI7J 5HANA 1FJGJ 1YJNS 3OPKA 3PEHA 3KJVB 4U67Q 5LXRA 4Q0BA 1OIAA 1TVRB 1UA1A 3LWMA 3MHYA 1FRJA 3UWTA 3JYTB 1GQEA 1ZM9A 1LWFA 1NDCA 3GPAA 4CO5A 2W1BA 4KBIA 2MSSA 2KXFA 3MM6B 1U2RA 2OTLS 4IFVB 1PC4A 1UFLA 1N88A 2Y8YA 1SV5A 2J6SA 2JH3A 5F8HA 2VPWB 2YWGA 1EAYC 1HWLA 3J81Y 3CULA 4QWBA 4IDKA 2ZBQA 4ER8A 4IOCQ 3CCES 4TY8A 1S9EB 4ED2A 5IXUA 3H20A 4CLUA 1BHNA 1S99A 1R43A 3PIPQ 1Y11A 4J9VA 1S0VA 3TEGA 1WHXA 5J2NA 4JI5J 2W2NP 1U02A 5KFQA 3MFHA 1HQEB 4X4TA 3OXGA 5SZTA 4JI6F 4OJHA 5ETTA 3FFIA 4DUYJ 1YBTA 3G6YA 5LMNJ 3CVKA 4N56A 5LMUJ 4PWWA 4PG6A 3AJ2A 3R9LA 5BYQA 4RU2A 1KVIA 1K44A 5HAOA 3M2UA 2D9OA 3UD5A 4WXOA 1UKUA 2PGCA 2YTCA 1Q86T 4HHUA 1ZPVA 3A1YG 4NASA 4U8VA 4H4KC 1S6OA 2W9BA 2KJVA 2JHEA 5HMWA 3SSRA 3GV7B 1BD6A 1SUQA 3IXQA 4C98A 4Q2LA 1C0UB 3I0SA 3UCGA 2DO0A 4Y34A 3IO1A 4A8YA 3KLEB 2GGPA 2JLGA 1GT8A 1VJWA 4ZCIA 1H72C 5KFWA 1S6PB 2D1CA 2XYGB 1X7VA 1IKXB 3TNVA 2Z58B 3TVZA 4GVBA 2XSJB 1SL1A 1BXNA 3MDFA 1SVDA 4ILLA 3POTA 3W2WA 4EWTA 1RZMA 2LCWA 1RWWB 1TKZA 1TL7A 4C3LA 4YP3A 1T9TA 3BR8A 3OUYA 3FRYA 4C7QA 4DUZF 4KPCA 4JI6J 2UXCF 4K4SA 3EGZA 1H98A 5L1KA 4ILRA 4DN9A 2H5EA 1S5ZA 1KQFB 4PXBA 5ETRA 2OSQA 2E66A 1JKHB 3EVWA 1V3RA 2V8PA 3G6VA 3V4IA 1JLBB 4RW4B 3OXFA 4IRKA 2K1RB 5IQ6A 2VHGA 4RW9A 5BYSA 2ERRA 3AAWB 2CJXB 2RD5C 4KGZB 4ES2A 5KFXA 2RSQA 1WOPA 1UAWA 2NXUA 2WVEA 3NOCA 3ZZYA 2ROPA 1N33J 1WC3A 5ETMA 3V6DA 2E1AA 2QMUB 3FEYB 3VAKA 1NSQA 1Q7LB 1G2EA 3O8WA 4EGLA 1HBUA 4ED0A 3RBXA 1FO1A 5E41A 3UNYA 2DJWA 3PR5B 2YKMA 2KO1A 2HS0A 4ZJLA 2VF3A 1S57A 3ENVA 2WK4A 1QTNB 2DBBA 3H8YA 4ES1A 3CDWA 3EYZA 1RWNB 1HW8A 1FA0A 2DIUA 4ILMA 1YX2A 1JXEA 1URNA 3SSSA 2QLWA 3IS9A 3FUYA 4U7UD 3WX4A 4DUZJ 3T5JA 3N79A 1YBAA 2VBYA 4CT8A 4JV1A 1TAUA 2OAUA 4UOFA 3KLHB 2UXCJ 1RISA 3H5UA 1IM4A 2XMJA 3PW7A 4EI2A 3ZTOA 4Q8EA 5C42B 3KJFB 3CSKA 3GR1A 2CA9A 5HN0A 4ZP7A 3O5TB 2FHJD 2ZHOA 4IYQA 3IP0A 4WCEQ 1SH2A 2QIFA 4OX9F 1O6XA 1MNEA 1RT2A 1REVB 4I2QB 4JV5F 5J1EA 4G65A 4DXLA 1TK8A 3QGPA 1Z4UA 4OYBA 3SI8A 3DMJB 4H4OA 1IKWB 2LKZA 4H54A 1FDNA 2MKCA 2C2MB 4HTJA 4LRBA 2HLUA 3J81U 1L3KA 2DRAA 4ID5B 2HFVA 1NCLA 4JI8F 3EVOA 1NKCA 4URGA 2ZHBA 2JVOA 2UUBF 1T95A 2J7WA 1JNZB 1FKPB 1HBMB 4IG3A 4Y2MA 4LJMA 4ED4A 3QPIA 4ECZA 4CLFA 3VWSA 3PYFA 4KHRA 3QT8A 4K2XA 1Y5IB 3ZXWA 3R27A 5KFRA 1N5TA 3BREA 5H1SV 2FPHX 2HSEB 3NGUA 3T5HA 1TKDA 2ZWOA 3HSDA 4Q2MA 3I9V9 1OYDA 4NLQA 2XZDB 2CG8A 4ATNA 3VAGA 3DM2B 1Q7YT 4DCPB 5KT6A 4I1TA 4B02A 1NO8A 2VFRA 4CTAA 4BBYA 2QSWA 3KHHA 2BQUA 1RT3B 3OL8A 2MEWA 5DDPC 4WE1B 4DFPA 4ZCLA 3HHEA 2QL9B 2ZH9A 5KG1A 4ZK7M 2GVZB 4CH7A 3FQLA 4ZPVR 2J76E 1QD1A 4QIVA 1R0AA 1REGX 2GA7A 3HP6A 1N6QA 3NMRA 1WC0A 4JV5J 4P73A 1U1PA 3IAM9 1WI6A 2F9JA 3R6LB 4C11B 2AEFA 3UD4P 3MURP 2K7KA 3BQ0A 4M94A 1IKVA 2BUNA 4X4PA 4LQ9A 2B4PA 4I68A 2B8PA 1VBXA 2JC0A 1OY9A 2VB6A 4OJGA 1U2FA 2V8HA 4F4ZA 1NZAA 4NLUA 1WHWA 2N7CA 1NJXA 4DCJB 2YQ1A 1FJEB 4O0NA 3GJRB 4OZ5A 4P10A 3V5RA 1EETA 2RRAA 3FBFA 4RBUA 2HHXA 5KFMA 4NLXA 2ZUAA 3AQOA 3GLJA 3O3LA 4O4RA 4F3MA 1RHKB 3PV8A 1S76D 3BSNA 3UI3A 5EUHA 4JI1F 3ENQA 3SZ2A 2QFJA 1DTTB 5ETLA 5CYQB 2HAIA 4ED3A 1RGVA 4IH6A 2F63A 4OX6A 3LAKA 2JLEA 2YX7A 2BZ2A 4DU7A 3R5JB 2HQCA 5DGBA 3X1LB 3NNHA 4N41A 2ROEA 2IVFB 4EU0A 5EDWA 4FNIA 4X4QA 3G8TA 1SJ3P 4QR1A 3PR4A 4U7CA 3ZZRA 3VCDA 2FLNA 5HQLA 5ETQA 1YLXA 1AB8A 1CJUA 2CPZA 2MQOA 1VQMS 2DY1A 3M1VA 1RYSA 2OPQA 3K57A 3NWGA 4FDFA 2C2ZB 2M3DA 3F44A 3Q8QB 4A8QA 1JLFA 4G3IA 1CLFA 3D66A 3I31A 3IBWA 5I3UA 2WVFA 4F02A 4CLWA 2FHOB 3WHIA 1NZ8A 1W2IA 1F9HA 1OPIA 2R42A 3N9UC 1R89A 3LALA 1OQ3A 4H4KA 3CJ8A 4UUWA 2V68A 3PX0A 2XI2A 3DLEB 4NI2B 2KT3A 1OY8A 4YDXA 3OD2A 4DMZA 4ZHRB 2DXFA 5AXMA 2VPXB 1NUEA 2BX6A 5HBMB 4MIBA 3DOLB 1IWAA 4JI1J 4NCGB 1NJZA 5A0YA 4B3OB 4ZVHA 2CRLA 4GC7A 2W9CB 4HI2A 5D78A 2ZH5A 2G2OA 3NAIA 3R1LA 3CF5Q 5IM0B 2KL8A 2FY1A 2V34A 2IM0A 5CHCB 3CC7S 2OPRA 4X4RA 1S48A 3J7YI 1NPPA 4OYMA 1KFSA 1JJ2R 1FERA 3MM9A 1GX6A 1HQUB 3Q8YA 3NBPA 3H90A 5IC6B 4PUOB 2IPOB 5DRKA 3KK1A 2B9WA 1VRTA 4DFKA 4DF4A 5JXSA 1JLAA 3QWPA 1RYRA 2QJ3A 3QQCD 4D3HA 4ETXA 1ZM4A 1AUDA 1FRIA 3TZYA 2OO4A 3D4JA 1N34F 1QAYA 3UVJA 1S10A 2DR5A 1H2VZ 2XYPB 4BC7A 1U1MA 2HNZB 1VQKS 3P3DA 2ZM6J 4LSZB 4K4ZA 2W7AA 4ZVGA 4OI3A 5B0GA 2VG7B 3DKDA 2D3UA 1YZ7A 2MQQA 1N54B 1DQ8A 5F8GA 2HURA 1QLNA 4I7FB 3WIUA 2P2CB 2GHVC 3T1YF 4RKUC 2YKNA 1WSRA 1UPMB 1T03A 4K4TA 3DN9A 2X1BA 2MGZB 2NXNA 1RAOA 3BR9A 3ZNUA 3QIPB 3MR3A 3HCXA 2GJIA 4Q7AA 3H7HB 4KV8A 2ALYB 2APOA 3A8IA 4KH1B 3GIKA 2UV8G 1RTDB 3T5KA
chains in the Genus database with same CATH topology
3AB2B 1YVFA 2OKQA 2QMXA 3OR1B 4Q8FA 1LW0B 4WK3A 2VPYB 3ZZOA 2FVPA 2HFOA 2VG6A 3DYAA 3OFFA 3G8QA 1GH8A 1D8ZA 4AUKA 4Y2AA 3RYLA 3NCRA 1FDAA 5F8MA 2HPUA 3VAMA 2HGMA 2WSEC 3M32A 4KIAA 3GG0A 3BGRA 4Y65A 1L3TA 3RU0A 1M0SA 1EETB 2DNOA 5HMYA 3M8SA 2LQ5A 1FEEA 1X4AA 3H40A 2YKOA 2HZCA 1X9MA 2DNZA 4FPRA 2CQPA 2MZSA 3QO9B 4RUHA 3D54A 3T1AA 2CQ1A 3JSMA 2R7WA 3C46A 2DRBA 2VG5A 4NLPA 4OX7A 3VZIA 2M88A 2Y1RI 5LSLA 4G1QA 1XNRF 1WHVA 2FJDB 1MU2A 1MMNA 4PWDB 4PWUA 1LK7A 2BJDA 4PPZA 1OO0B 3LQVA 5T41A 2W9CA 3C8YA 4DFJA 3SV3A 3DNCA 3KHGA 1F9FA 4CT9A 4QIWD 5F0UA 2HVHA 2EFPA 1Q78A 1RTHA 3HVTB 5IM0A 2D3ZA 2KRRA 1Y9OA 5DG9A 1DAXA 4QPTA 3JSRA 2XULA 5DG8A 4RUAA 1M90T 2JEFA 1FD2A 1HBOA 2E1MC 2KG1A 4C8YA 4A47A 3I4PA 4X4OA 2DHSA 4LF4F 3IGNA 3N28A 4FZVA 3TA2A 2V4RA 2UXBF 3M8PA 1ZZFA 5B0FA 2FTRA 3ENWA 4R8UB 1H3DA 3MM8B 1WF0A 4OFZA 2E5HA 3UW1A 2OIHA 2E5GA 2J8AA 4KKOB 3HJFA 1QAXA 1S1UB 2UUWA 3M30B 3PRDA 2VBWA 3Q23A 1JXLA 5GVQA 2E5IA 3CJ0A 4RNOA 4DSIA 3THVA 5D8HB 2O3DA 4OQJA 1WI8A 2R4FA 1AW0A 1C4AA 3CJKA 2UXDF 2MY7A 2I9SA 4KC5A 3MD3A 3DLKA 1SL2A 1K9MT 3PKMA 1VQNS 3E3XA 4PUOA 2ILYA 3K5LA 1RT6A 2HGNA 3MMAB 1W2BR 4WF9Q 2X51A 4OI6A 3ZZTA 3BM7A 1KHWA 3RRHA 2MMYA 4WFNQ 2JWNA 2ATLA 5GAEI 1S1WB 1MWYA 2HIQA 3O44A 1HWKA 3ITHA 4ELUA 4FYDA 2IJFA 4YB1P 2KM8B 1MMLA 1HMVB 1UP1A 2HNDA 3I0RA 3N6LA 4KGMA 2XY7A 1VC5A 2CPFA 3IWNC 1BY9A 1P1LA 4RW6B 4WK1A 3TP2A 2WONA 3FZBA 2ADCA 3M05A 4XK8C 1C2PA 4NOHA 2RILA 5KFGA 3GSDA 1D9DA 4ID8A 1WEZA 1VHFA 3C6TB 4YEAA 1UJ6A 5DQGA 2GIQA 4F26A 1X4GA 2M8HA 3FJ2A 3CJ2A 3Q0AA 5GAGU 4LF6F 2MZQA 4U9RA 2O66A 4YB5A 3U27A 1JLQA 4KRWA 5EN1A 3RRGA 2U2FA 2YNIB 1L5UA 1SC6A 1OPZA 5EX0A 5KOXA 5F9NA 2XLJA 4X84A 4XDCA 1KHVA 3MMCB 4YUDA 1U1RA 1FE4A 3I5BA 1FKOB 4Y2IA 4DBQA 2I38A 3PKYA 2HS3A 1WF1A 2XLKA 2F8EX 4O0IA 3GV8B 2V5HG 2UP1A 4TYBA 2O1PA 4IFYA 5IZHA 3AH6A 5KFPA 4I69A 2F1FA 1XMBA 3KG1A 5C24A 5K8NA 5I3UB 4DV3F 4MKAA 2CJAA 4USHA 1EP4A 1OWXA 2LU2A 2EBGA 3HVAA 4ZOSA 4JV0A 3S6EA 3NLCA 3DRRA 5I3PA 3BSOA 3HHLC 4KO0B 3WC2A 1S6QB 2XS5A 2IAJB 3LPYA 4I7FA 1URRA 2XB2D 2PDAA 2DPJA 5FIIA 1MROB 2MZTA 5KFHA 4BCAA 3CDBA 1YJ9S 1I94F 2GO8A 2PN6A 4N8OA 4DN0A 4DV6F 1AFJA 1LWEA 3EGWB 2E1CA 4J9MA 5BJRA 3RBDA 4QCLA 4ZMMA 1JJ4A 4JOUA 1TL1A 1LW2A 3OL6A 4Z37A 3D28A 5KG5A 3QLHA 2J5AA 2R7QA 3GYXB 2W7OA 2LMIA 1X9SA 3FQKA 1TK5A 5FJ4A 3MPWA 5CZXA 1NK8A 4IOAQ 2JDJA 5K8OA 3HLUA 3MM7A 3QIPA 2V4JB 3PVXA 3GILA 4DV2F 1Y5NB 4JI3F 5IWAF 1WD6A 3BN4A 2DNLA 2YWEA 5BR8F 4UUXA 4EYHB 2AYEA 2LXUA 3K8VA 4PXEA 2FJWA 2ZJRQ 2GQCA 5KFLA 1KTQA 4U6PA 1Z1ZA 4C2MA 1N5VA 1CC8A 1VRUA 4B9NA 2XS2A 3HHLA 5KFZA 4B08A 1DHMA 2UVVA 2J0SD 2VA3A 3M2RB 1YTYA 2ZH8A 4RW7B 4OI0A 3SFGA 3MEEA 1T3NA 3HXMA 3OSNA 2VFTA 4UY8T 4QBUA 2MQLA 2VD3A 4BHQA 1Q81T 1QTMA 3KK3A 1ZTTA 3ZFVA 2AJQA 1FDDA 1TP7A 2N3LA 2K7JA 2R2SA 3T1HF 1U7LA 3UDLA 4X4VA 2NZ4A 3AQPA 4KB7A 4LSLA 5JUMA 3TX8A 2HRYA 2PMZD 2FDNA 3KWMA 2DR8A 2C22A 2IFXA 2M9KA 5D4PA 1QUVA 4A8MP 3VZHA 4NA2A 4NXNF 2R2UA 3NRBA 4ED7A 2EG2A 5G0RA 4NCAA 2OPRB 1IR0A 3ZZUA 4F3OA 2LEAA 2V2KA 3VAJA 4I56A 3TAPA 3QO9A 1WTBA 1RT4A 4I2PB 1K8AT 3OTBA 4QWDA 5T7LB 4N77A 1X4BA 1PO6A 2AGQA 2AGOA 2NSBA 3MUMP 4QU7A 2I8EA 2XWYA 3MM9B 1YI2S 1O8BA 3ZZPA 1IBMF 4C9DA 2ZNZA 4Q43A 3NBPB 2CQGA 1H7WA 3QAUA 1HWJA 5EX3A 4A8FA 4AXJA 2KB2A 3T9NA 4J9LA 3DLBA 1U4BA 2FC8A 2BE2B 1TFWA 1NH8A 3DXBA 4WYLA 2FJVA 3HK2A 2BRLA 2A1BA 1XMOF 1VRTB 1JLAB 4TU9A 2KHDA 3TANA 3QZ8A 4B3TF 2ZE2B 1TKXB 1HI0P 3PNIA 1TL4A 2RU9A 2B0GA 4DV0F 2AJ4A 5L38A 3G9CA 3RBEA 1PC5A 3EUNA 2OPSB 2B4OA 1KD1T 3HMJG 2AF6A 3MOJB 1IJEB 4R8UA 3MM8A 1HL6A 3KNGA 5L1LA 2BM1A 3PIOQ 1D9FA 2EI5A 4KKOA 4C0HA 7FDRA 1R27B 3B8HA 3H2UB 2WOMB 3M30A 3QGHA 4NYOA 2FJBB 4OLOA 1JLEA 3K0JA 4O3OA 1QY7A 2R7RA 1IQZA 2NPFA 3IG1B 2DB1A 2YNFB 2K2PA 1G6BA 4ZCKA 2WSFC 2DGOA 4PPDA 2LECA 2MHEA 3MPVA 2RDJA 4NLWA 7FD1A 4DQQA 2AQ4A 5LL6d 3FZ2A 1RTIB 3MMAA 3RAMA 5T14A 3RB4A 3JSYA 3DLLQ 2HFNA 2GX8A 3RAXA 2XEXA 1FXLA 4DFMA 4AFFA 2FVSA 2VONA 3MMJA 5J2QA 3O1LA 4I4BA 4RNFA 1HMVA 5KTQA 2R8GA 5ADZA 3SQGA 3VTIA 4HL9A 2LXFA 5CYJA 1KQGB 4X66F 3M9NB 4RW6A 2L9WA 1Q8IA 3KOAA 4LFCF 3Q2TC 4K5RA 2IMOA 3OVBA 3MMBB 3E8OA 1DQ9A 4QYRA 2P9EA 4DQPA 4USJC 2YKAA 1U48A 1QSSA 3K2YA 2EG1A 2F7VA 4ZCMA 3CCVS 1NK4A 3EXCX 4M5DA 4ECXA 4KFBB 2HWTA 5CD4H 3W2VA 3CCUS 5K8PA 4OI1A 2XCAA 1S9GA 1YSJA 2YKNB 2OLWA 3CCWA 4IG0A 1S7HA 3OR2B 3C66A 2FLPA 4LFBF 2HW3A 2WSCC 2PA3A 2P9GA 2M4MA 5E2QA 2BBEA 4H4MB 1QAJA 3LAMA 2J7UA 3MMCA 2Y1IA 3FVYA 2FIUA 3OTDA 2QZ8A 3V81B 4PKDB 2R7XA 3RW6A 4CO0A 1FRHA 2RRNA 1NNDA 1X4HA 4Y0FA 1VIXA 4XPEA 1XR6A 4BWMA 1VOMA 4K4WA 2ZM6F 2UV8A 2NUUG 1ZAVA 1S6QA 3HHNB 1NU4A 2OTJS 1RT5B 3DOMA 3P6YC 1MROA 4HT7A 3PZPA 3KLFB 2YQ3A 1P27B 2OP5A 3GB0A 4L3NA 3PO4A 3RZAA 3TOQA 3BO4A 4WZQA 5HP1B 4PG5A 1VQLS 1WHYA 1RKIA 1LKZA 3PDNA 3HZGA 5CCMA 4QWEA 4PG4A 2EBEA 1JMTA 2PFFB 3D1OA 2JX2A 5KFFA 2UVUA 1UVMA 4NYPA 2VG6B 3DYAB 1DBDA 2MSTA 1HFEL 1C0TB 3BZQA 3AB4B 1R3NA 3G6ES 4USIA 2RKIB 2CKWA 2NYIA 2KKHA 4ECVA 1WTFA 4GKJF 2EKYA 1SKSA 1ZM2A 5HROB 3M32B 2PE8A 2AYBA 3K8WA 4NX9A 2V4JA 5E3AA 2KU7A 2ZH1A 3IRXB 1DURA 4EBDA 5CYMA 2WB1D 2RS8A 3SCKE 4IRCA 5KFTA 4N8NA 2DGQA 3KKFA 4I64A 1YRXA 3G4SS 2WRMA 2RF2A 4GO5X 3JYTA 2AYMA 4LF9F 2C2RA 1G1XA 1Y00A 4PXCA 4G1QB 4N5SA 5FLXY 2GCFA 1MU2B 1HWUA 3DLGB 2DR9A 4NLDA 4RW7A 1SKRA 2DCUB 2RMLA 2R7UA 4HKQA 1FF2A 3UDCA 3VQTA 1XERA 2ZH4A 1CEZA 1FRLA 3IGVA 1T3OA 3OFHA 3U7JA 1RTHB 2COLA 4CQ1A 2I5JB 2VKRA 1UA0A 1FNMA 4V19X 1XC9A 2YX4A 5B09A 2PC6A 4RW8B 1SJQA 2ZH2A 4RWWA 4HDHA 4ZP6A 1XR7A 3OBIA 1HBOB 3SCIE 5EHHA 1RP5A 4DR3F 3NMAA 1K0TA 2ZC3A 2RQKA 3E51A 5LSOA 1JIHA 3MUTP 3OHBA 1AROP 3MWBA 3M8PB 4TU7A 2DNQA 4QU6A 4RU9A 2VQFF 2DH8A 3DCAA 3D1HA 5E7OB 2XY6A 1NKBA 4DL0C 4ZLPA 1C4CA 5T7LA 4Q44A 2WTFA 4B9LA 2E44A 2EK1A 4WU2A 2XO7A 4EBCA 2X1FA 2C3MA 4YOEA 5B08A 2Y0SD 5KT3A 4N76A 2BACA 1X4EA 1X5OA 2CQBA 3DLKB 2W8LA 1Q82T 2M5YA 3H98A 3TA0A 3Q8PB 3N6NA 1RT6B 4IO9Q 1LK5A 3PW5A 4Y3CA 3RB6A 2BE2A 1CPZA 3HO1A 2O5DA 4ECYA 2QE5A 4DPOA 1H6KX 1S9EA 4IQXA 2DGWA 2Z8QA 2V94A 4Y2CA 4NLSA 2RQ4A 2A10A 3CGIA 3BF4A 2HNDB 3I0RB 2R8IA 4AQYF 1J5OB 1FTRA 2DNKA 1F0XA 4LF5F 2Q1LA 4LSNA 4R0JA 3MF5A 2WONB 1RTJB 2VUGA 4J5OA 2YWHA 4FXWA 3UCZP 2GMLA 2VODA 2B3TB 4WFBQ 3TUJC 2IMWP 1S1XA 2DGTA 4F4KA 3QMQA 1Y7PA 4ED5A 1H7XA 1ROFA 2OPPB 3BSCA 2B4UA 3MCSA 2E5JA 4R5PB 4G6VB 4B3RF 5FDLB 5HLFA 3OL9A 3M8RA 3THTA 2FC9A 5HL7Q 4KHPF 3SDEB 2PT0A 2J0XA 4WFYA 1YRUA 5D77A 4M63A 5B0BA 1FKAF 1T02A 3FGVA 2V8DA 1UWBB 3KG4A 2CZ4A 2M0GB 5U47A 3LP2B 4ECUA 4TQSA 4IFYB 3GFHA 3CCRS 5C24B 4MJKA 3H5XA 4OI2A 5B7WA 1I1GA 3CCTA 3NCPA 3DRPB 2QYCA 4QPXA 3L09A 1EP4B 2WBMA 3TI0A 1LWCA 3CMAS 2ZITA 2LDYA 3MEDB 3IR7B 4OIXA 2OJ3A 2ACYA 3DFEA 3MZIA 4U7UK 4P7TA 5LT5A 1S0NA 1N36F 1JB0C 2CG4A 1KTVA 2HMIA 4XAKA 4JBCA 2FVRA 5KFVA 4F2SA 2EFNA 2L08A 4MK8A 3K5NA 2N7YA 2R7SA 4A48A 2XBPA 4TQRA 4DV7F 2ZH3A 1LWEB 1HI1A 1WELA 1ZBTA 3ZZ0A 4V19J 4H4MA 4MFBA 2E1RA 1JNRB 3PJXA 5K14B 1DLOB 2CQ0A 4ZPDA 4O3NA 3VQSA 3OFEA 4OI4A 2MKIA 2XGPA 4EEYA 4FXDA 1TL1B 2G0CA 1LW2B 5K9FA 4AXIA 5J2PA 1ZYQA 1U1KA 1S1TA 3Q2SC 3LGMA 3V81A 3QLHB 2DGVA 2FHMA 3OJUA 5L9NA 1KFDA 2OFGX 2F3JA 1N52B 3M6WA 3KHRA 1HNXF 2IRUA 3NCQA 3MM7B 5DM7Q 3SFUA 3H4BA 1SL0A 2ZOFA 1SIZA 2JVRA 1Q4RA 2Q3PA 4ED8A 4RNHA 1HPZB 1RT5A 1LOUA 3KNAA 1HNZF 4KT0C 3GFZA 2EFVA 1C0UA 1IXKA 3QZ7A 4YMEA 2VOPA 5K5MA 2LYVA 2AV5A 4EFAC 1Z2LA 3CXCR 4EYIB 3C2PA 2RUGA 3LP0B 1FVSA 3HHLB 5A2QY 1NH7A 2FB0A 3IR6B 3F73A 1KOOA 5HP1A 3CPWR 2V9WA 4GO7X 2X1GA 3MEEB 5B0AA 5DLFA 3LH2S 4DG1B 2HFZA 5F8IA 1L3VA 2N4DA 4B9SA 2DVIA 1Q79A 4YFUA 1UVKA 1E6VA 2DNNA 3NAHA 4OZLA 4URSA 2YH0A 3KK3B 1SJ4P 2DHAA 4ALZA 2NQPA 5I3QA 4X4NA 5HO4A 1C0TA 3V4MA 3F56A 4ETZA 2P6SA 4LSLB 2RKIA 1S6PA 2HYIB 3SCJE 3AJ1A 3C3LA 2VPZB 4ZP8A 4M95A 5HROA 3CDUA 2XMWA 3ULHA 2AJ0A 2DGSA 3HFKA 2FVCA 3QGIA 3JB9k 2EFGA 3IRXA 1Y5LB 5G0RB 1IKXA 2YKPA 3I96A 2XSJA 5KFBA 2AWZA 1RT4B 1HD0A 3CD5A 4ZA1A 3EZ5A 1HR0F 1NRKA 4MIAA 2ZFHA 4GMKA 4JI7F 4KE5A 4YY3F 2Q43A 3OL7A 1FJGF 1TV6B 3TAMA 1ZOTA 5AXLA 3DLGA 3T5LA 1ZM3A 4DLEA 2QA2A 4PRFA 2LLZA 2VFUA 2CPIA 4CO4A 3QJPA 1FTCA 2GHPA 3O6QA 2WCXA 2MB0B 3RAQA 4KTQA 2ZKTA 1VQ4S 3CIMA 1SH3A 2DNMA 2KH9A 4WFZA 4X4UA 2WBRA 1VQOS 2IRXA 3MFIA 1NEEA 4IR9A 2I5JA 2J0WA 4EO8A 2J0QD 2OFHX 3THPA 3TVKA 4E0DA 1VGYA 2MXYA 1FXDA 4A8XA 4I0WA 3L7PA 2N3OA 4RW8A 1TAQA 1KRPA 2ASLA 5F8JA 2KG0A 1WG4A 2YNGA 1F5BA 2CQDA 1UFWA 2KXHA 3NS6A 1Q53A 5CZVA 4DX8H 2ASJA 3SV4A 3RW7A 2DITA 3H2LA 1XTZA 1SIWB 5F8LA 1MMDA 1JKHA 3QIDA 3DRSA 1JLEB 3LOUA 4AL7A 1FRMA 1S0OA 4TU8A 5J1PA 2AD9A 5F0WA 1S1VB 2IM3A 4DOZA 2LEBA 3SMZA 5E33A 4ZKAA 2WAQD 3FNNA 3GFYA 3E01B 1I6JA 4RW4A 3KMQA 4I6AA 5KFSA 3FFIB 4DL2A 3B4MA 2IC3