4C98A

Thermus thermophilus cas6 (tthb231)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
268
structure length
242
Chain Sequence
GAASMPQAVVLELVGEKPPLYPARYAHGLFFALLSRVSPELAQKLHEAPRKPFTLAPLPGTLRLRLTTLDDGLFAPFLRALSSYRLARVLATREGHPLAGATSWEELKEAPKREKATFRFLTPTVFATSKTRYTPLPDPRLIAGSLLDKWQAHSPFPYNPKEEAALRELFELDLEVAGFRNLRFHRVQAGKGFFPGFTGEATLRLWSQSLEAQEALGRLHALAFFSGVGAKTPYGMGLAVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAS6B
publication title Evolution of Crispr RNA Recognition and Processing by Cas6 Endonucleases.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Hydrolase
total genus 55
structure length 242
sequence length 268
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10040 CRISPR_Cas6 CRISPR-associated endoribonuclease Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c98A01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c98A02
4C9DA 4C97A 3I4HX 3QJJA 4ILLA 4C8ZA 3QJLA 3QJPA 4ILRA 4C8YA 3PKMA 4ILMA 4C98A 3ZFVA 3UFCX
chains in the Genus database with same CATH superfamily
4A8KA 3U1MA 1Q8IA 2HS0A 3EGVA 1HBNA 2RQKA 3NRBA 2QA2A 4FF4A 4NA1A 2VD3A 5GAGU 1HNXJ 1DQAA 1T3NA 2XS7A 1TKZB 4ES2A 3QZ7A 5H9FJ 4M5GA 2DHGA 1LW2B 1HBOB 1ZM9A 5KFYA 1BLUA 4DSLA 1WEYA 2BJ9A 2V63A 1P9YA 2ASJA 4IR1A 4DZ6A 3VGSA 3TR5A 4RKUC 2ZZTA 3DOLA 3IAS9 3ZZRA 2CJKA 4R5PA 1UKUA 1IWAA 3US5A 2LLZA 3CMQA 4DPOA 4DXLA 2DPJA 1Z2ZA 2GQ2A 2VG7B 2CQ0A 6AT1B 2F4VJ 2C3YA 2Y1JA 1D8ZA 1YGYA 2MGZB 4DMZA 3WDOA 4ECYA 4OZ1A 2KO1A 2XMAA 1T9YA 4EBCA 4RBTA 1TZ0A 1VRTA 3C6UB 1ZZNA 1C1CA 4ZS6A 4Q43A 1S1WA 3SBMA 4G1QB 2M0GB 4I64A 3KK1A 3R6LB 2K3KA 2QN6B 3CNQP 3U02A 1HWJA 2RQ4A 2MKIA 4DSFA 2KRRA 4UOCA 4RW9B 1N36F 3KK2B 3DDIA 4RBVA 5E3CA 5CHCB 4NZ7A 4YN3B 2CQBA 2DXEA 3TZWA 3ITHA 2DNMA 1WDDA 2UUCJ 2DNKA 4ETZA 4LUBA 4ID5B 3IRWP 2RD5C 5L8RC 5G0RB 2R7QA 3C15A 1KTQA 3EZ5A 2HIYA 4N76A 2A18A 3CIZA 4X62F 1QAYA 3D2WA 2IMWP 1W2BR 3PR5B 2HNYA 2WVFA 1S1VB 2APOA 1OS5A 3LALA 4URGA 1JLCB 1WKJA 3OHAA 5HVFA 5D78A 2VQEJ 3C14B 1S0MA 1TVRB 5HI7A 3BM7A 4X4TA 2HHHJ 1Z4UA 4OJ3A 3WX8A 5DQIA 1WELA 3PM9A 4U67Q 3PIOQ 1GT8A 3DCAA 4HI2A 1DLOB 2BOPA 2XQCA 3JYTB 4BWJA 2YPZA 4CO5A 1TL1B 2OGUA 1FWPA 1S6PA 1IXKA 1IBCB 5T7LB 5KG0A 4OZNA 1CLFA 4DX6A 3J7A1 3LGNA 1TUGB 4O3PA 4X4PA 3D0HE 2JRSA 1EP4A 1TKXA 2QL9B 1RK8A 4HDGA 3OL7A 3TX8A 3TX0A 3H2VE 1P27B 2JJ4D 1K1QA 1J5OA 1JLFA 1M5VC 3D54A 3G9CA 5B0DA 2V8GA 2VONA 1FKOA 2NSCA 1IR1A 4EUVA 4WTYA 3HI9A 1Z1ZA 4JI2F 1VLYA 2BBEA 2R7VA 3RBZA 4XAKA 2AJQA 5IS2A 3NNAA 1SQGA 2V50A 2LEBA 2I5JB 2GVDB 1IBKJ 3IC1A 1SJ4P 1CQMA 1WDTA 5EWEA 2HURA 4B9VA 3L7OA 2QYGA 1XNRF 2G1DA 1E6YA 3NL0A 2RQMA 2C3UA 2QX0A 4YB1P 4XPEA 2D9PA 2VL1A 3F44A 4JI1F 4LSNA 2Q43A 4CLSA 1TL7A 4CH1A 1RXOB 1FVSA 5EUHA 2MHNA 4ZJQA 5LJ3Y 4H54A 4Y2IA 2PA8D 2K06A 1UMJA 2G0JA 1VK3A 1WF2A 4FXVA 1KVIA 1R6YA 2B6AA 3LP2A 2DNYA 2CYYA 1AFJA 4J9NA 2L9DA 3B4MA 2QO3A 2G0CA 4OHXA 4ZJOA 3LWMA 1HWLA 4E2FB 2L41A 3NOGA 2MKCA 1G1XA 3MEDB 3G8TA 3QATA 4WK3A 1IBMJ 3EWGA 3H59A 1UPMB 2HQDA 3IM9A 5F8IA 1NPRA 4O3QA 1VISA 3RTVA 3KMQA 2V67A 1MU2B 1X4FA 3GCWP 4Q8FA 3GIRA 1CJUA 2ZZMA 4Y34A 3CC4S 1P1LA 2CQ4A 3DXBA 3OR1A 2XGPA 4MK9A 1VHFA 3BGOP 5KFJA 1X4CA 5KT7A 3KLHA 4RLEA 2C2MB 3O8WA 2F7VA 4DUYJ 2CQ2A 3NY0A 4ZHRB 2NYIA 3FBFA 4A8MP 2BA9A 1NDCA 2YKNB 2MKSA 3KOAA 1L3UA 1U47A 4OZ3A 3NGTA 2RNEA 3X1LB 2N82B 2NPFA 1QAJA 2HVHA 4OZLA 1TL5A 1SUQA 4MK7A 3VZHA 4OZ2A 4K8RA 1X9SA 1QTNB 2U2FA 3ENAA 3L7UA 5DJBA 1HWIA 4ZN1A 3EJMA 6FDRA 5LL6d 2D3OR 3D9BA 2Y8WA 5IV3A 2AT1B 4X4VA 5IT4A 1W26A 2JC0A 2ZUGA 2AYBA 3DLBA 3K5NA 2XHCA 3TUJC 1N34J 4OYPA 1C0TB 5KFDA 4JYAF 1DTQA 3MD3A 2RIJA 2YKPA 4K0KJ 1N6QA 1EZZB 1Y3JA 3QLHB 1HQ2A 1WC6A 1I94J 2ADBA 4EYHB 3Q24A 3MPVA 4NI2A 1L3SA 1R0CB 2V4RA 4DR6F 2IJNA 3OFGA 4OX9J 4ECVA 2XYGB 3KKFA 5KT5A 2CZ4A 3CDUA 3SEOA 1RHQB 1ZBTA 3QFHA 4PWDB 1RT1B 5EGYA 4C9DA 2JDJA 2W4DA 2Z0GA 1RHMB 2WVCA 2H4WB 3H5SA 4LF5J 2VUGA 2YWGA 4B08A 3OBIA 3BBCA 3TA1A 2O1PA 1YWXA 3BSCA 1JB0C 5F8JA 2C2DA 2EKNA 3CE8A 2HBRB 4L75A 5HAOA 2K7JA 2V4JB 2BXJA 1PIEA 3FMBA 1LFWA 2K1RB 2WBMA 2FGCA 3C16A 4GRSA 1FXRA 1RISA 4MAKA 3FBEA 3RW7A 2YX1A 4I2QA 1JMTA 3CJ5A 1WHXA 5L39A 3VAIA 3NOCA 1S1UA 4OI0A 3AD7C 3C6TA 1FVQA 2AU0A 1YKWA 3MUMP 4DSKA 2DEIA 2VKRA 4CT9A 3FVYA 1WSVA 2MJUA 2ZE2A 3MUVP 4DFPA 1D0EA 3TZXA 3EM1A 3V4MA 2QLWA 2W7PA 1QE1B 1B7YB 4HYKA 2FY1A 2EBEA 4FBUA 1KVKA 4U9RA 1JK9B 4LMZA 4ANDA 2IVMA 2FDNA 3PYDA 2V68A 1Q79A 2W1BA 2WSEC 1B7FA 1PGZA 3GCXP 2VBYA 3HT0A 3R5CA 5HMZA 3ISND 3GFZA 2YX7A 1S48A 5F8LA 5I3QA 4YDDB 5B0FA 5IQQA 2LECA 2EG1A 5DS7A 1N52B 1J27A 2E5HA 4PAAA 2M52A 1UVMA 3CJRA 1O0PA 1UEKA 1ZAXA 4NCAA 1RAFB 5HQLA 2AP6A 3CGIA 1GTEA 2UUBJ 5HVHA 1TKTA 1RE1B 3RB4A 2COLA 1BHNA 2BE2B 1T8EA 4NPOA 2RH3A 1IR0A 4ED4A 3C66A 4P73A 1SQFA 3AHPA 2KM8C 2NUHA 4NCGB 4CNYA 4KQZA 3CTRA 4N5SA 4WU3A 3KDNA 4H4MA 4CH7A 4DSIA 4EK2A 3MM5B 1GMUA 2RB7A 1ACMB 5M2PA 2DD8S 5LMNF 2CRLA 3UFCX 3K57A 1SC6A 5DLFA 3WX4A 1EARA 1RI7A 1SJQA 4HHUA 5HVGA 4NXNJ 4L6V3 4AQYF 3GG0A 2DNOA 3M8ZA 1KLMB 1WHWA 4ZA1A 3L3CA 3PRBA 4AYBD 1ZA1B 1BE4A 3HDSA 2Z58B 2AYGA 2BJEA 3MM9B 1XWLA 1GXUA 3M2VA 2VZ9A 5K20B 2Z2MA 1YITS 5A0YB 1BQMA 1WJ9A 1H7XA 1S10A 1Y9OA 3KK3B 2H5JB 1VS3A 1KBRA 4JP8A 4ANEA 3HD1A 3HVRA 3QIPB 2YWEA 1S1TA 1SKWA 2LXFA 2DR6A 3M8QA 3GSDA 1UPPA 3OVAA 4FYDA 1FX2A 2CNNB 4B17A 4C3KA 5E0OA 4W90B 2IY5B 1VMBA 3T6JA 3BPSP 1HNXF 3HHLA 5ITHA 3TJAA 1TELA 3GPAA 1RUSA 2HFUA 3HZEA 4PRFA 1XMQF 2BJ3A 1RTIB 2FJEB 4DCJB 4H4KC 4Y3CA 2YNHA 3CCWA 4FP9A 1FHTA 1JKHB 3BQ0A 5C2CA 3PW4A 2ZH8A 4K4YA 3U1NA 2WONA 1U6FA 5KG3A 4DU7A 2J6UA 1FWKA 4NYOA 3CVKA 2QGFB 4DUZF 3CF5Q 2HMIA 5I42B 2KM8B 2EK6A 3RW6A 5KT6A 4GVBB 2GNKA 2WVEA 1HBMA 1UP1A 2EG2A 3TP2A 3TI0A 2VFTA 4DV4F 3CCTA 2D9OA 4A4JA 4QWBA 2R9LA 3NS5A 1TK5A 3M1VA 2NYHA 1YBAA 1R8HA 1F5AA 2GCFA 5DZ6A 5FLXU 2HWHA 1LW0B 5KFWA 3M2UA 3FC9A 2V9KA 4DF4A 1NAQA 3ZTRA 1H38A 1IQTA 3QNWB 5GVQA 2ZC3A 2LXUA 1Y7PA 4K4XA 1C4AA 3DRSB 1DY3A 2BE9B 1JLAB 1RZMA 1L3TA 3O6QA 2HVDA 2YWWA 2MQ8A 2ZD1A 5HJYA 1FEEA 5D15A 1HHQA 2DVIA 4GKKF 4YR0A 5B0EA 1RT2A 4JI7J 1FKPB 1PILA 5J2NA 2AD9A 4Z37A 1LXJA 4MKYA 2JNJA 1XMOF 1R27B 2OPPB 2HQFA 2Q3PA 1YZ7A 1PYTA 1U8WA 2BACA 1JIHA 5L1LA 2G4BA 5IC6B 1KHVA 4EMDA 1Q78A 2LU2A 1MN7A 1WC3A 2CWKA 4YHHJ 4CRJA 2XLKA 2F9JA 3EVWA 2OAUA 3OVBA 2ZUAA 3ZTSA 3GJSB 3BN7A 4L74A 1G4CA 2CJBA 4K4ZA 4FVCA 1HI8A 2MZTA 4EGLA 5HJXA 2E29A 1K9MT 3GIMA 3H40A 5CYJA 1N56A 3UD4P 2WB1D 2BJ8A 1JLQA 2D1CA 4NOHA 3ET6A 4PXDA 3VGUA 4PR6A 2LYVA 3M2RA 3OFEA 4C8LA 2EFPA 5GAGI 3H42A 2FGOA 3OTCA 1WF1A 3UCGA 3RJMB 4DL2A 2XWYA 5HMYA 2DT9A 4ECRA 1FK9B 3WZ0A 4CH0S 3IFEA 5KT4A 4DLGA 4ATNA 1ZZFA 1NPKA 1SKSA 1TKZA 1LFPA 3D6FB 2JEFA 4LT6A 4U7CA 3FEXB 1LW2A 3L9ZA 4DV1F 3MPDA 3MCNA 1CS4A 1HBOA 3ENWA 2B9WA 4O0NA 3AFGA 1FTRA 2ZHOA 4TQRA 5KFGA 1YJ9S 1VBKA 1UFWA 3BO2A 4J9VA 4DHVA 5HQ8A 5FD1A 5KG1A 4OX6A 2FZKB 2OSRA 1AXQA 3O3LA 4CIOA 2VG7A 2HPUA 4F26A 2CUYA 4PQAA 4LFBJ 2MQLA 1U45A 1UAWA 2MGZA 4CCHA 4LREA 4YY3F 4IOAQ 4PG5A 4KSEB 2VASA 4MIAA 2CWXA 2DISA 5A6WA 1VDHA 1PAEX 3C6UA 2BUNA 3W63A 2B9XA 2E7XA 2B7CB 3DRRA 4Y28C 5HANA 5J1EB 3QT8A 3TANA 3MF5A 2LP4A 2MY8A 1K73T 3BGFA 5E33A 4N8NA 2I1RA 1K8AT 3GFXA 2W9CB 4RWXA 1NK7A 3K2YA 2HSEB 4RW9A 3KK2A 2ILYA 4M1KA 4UUXA 4FNHA 3P5BP 2ATLA 3LPYA 2L08A 4DSJA 2RS8A 4WFZA 1DTTB 3QYYA 1N88A 1HMVB 1S97A 2ACYA 4M5IA 4CLTA 4UW2A 1C0UB 2KYXA 3UPFA 4ID5A 1K0TA 2GJIA 1Y5IB 2QSWA 4J9SA 1Q82T 3MPYA 1TV6B 4IKAA 1PKUA 1PJ5A 4HHJA 2KL8A 2BMBA 2XMWA 4Y2KA 1BWEA 5B09A 1RT4A 1S4FA 5J2QB 4A46A 5EDWA 1S12A 2KT2A 2DO0A 1JWWA 1NSPA 1ZPVA 1YRXA 4K5RA 4EWTA 1RBOB 3BO4A 1S1VA 5KFNA 1F6TA 4OZJA 3O5TB 2R2TA 4F4ZA 5K14B 2VQFJ 1JLCA 3W5ZA 4DR1J 3FZBA 1RU2A 5ETSA 5JMNA 3QRQA 2X3GA 5LMUJ 2AHOB 3C14A 1SIWB 3QT7A 4QU7A 1IKXB 4LF9J 3CJ2A 2C2RA 1TVRA 1H2TZ 2D74B 4LF6J 3ZZPA 1Q8LA 3DU5A 1HNVA 3FZ2A 4KR0B 1QAIA 5MAOA 1PG5B 1G7CB 3R3TA 4NYZA 1S1XA 5C5JA 3JYTA 2E9TA 4JV1A 3GZ7A 3DM2A 1HQUB 1XIQA 5GADU 2UVRA 1U1MA 4QYZJ 1TFYA 1P6TA 4ZP9A 4DL6A 3Q83A 4DV5F 1NCLA 3I96A 1QTMA 4Q8EA 4KJIA 5KG6A 4BC7A 2HAIA 4WPAA 2WOMB 4OJGA 3IRXB 3MXHP 1KQGB 4DV3F 2BANB 2B5JB 5L9XA 3VGVA 4F3OA 3QT5A 4J5OA 1T11A 2IM1A 4EU0A 3DOMA 1SJRA 2I5JA 2GVDA 3LAKA 3CDEA 1CSJA 4Y2MA 2CQIA 3MM7B 4DV0J 4U7UK 4F4KA 1DARA 4DS4A 2E5GA 1FDAA 4DI6A 3SMZA 4MKAA 3D68A 1UA1A 2RU3A 4DR5J 4ECTA 5K5MA 4LSZB 1HPZB 3OXFA 4O3OA 3T1HJ 2CDRB 1U0HB 2XNRA 4EO6A 4ERDA 1JLEB 2Q1LA 1LQ9A 1ICEB 2X1GA 5D8HB 2VPXB 4S0MA 2Z4PA 1I5OB 3SIPB 1WKLA 4HHHA 2IJRA 3G82B 4H4OB 4YOEA 1ZETA 2GV1A 1DAXA 4UOHA 1C2PA 2EFGA 3MEDA 1N5VA 4C0HA 4Z7YA 1HIYA 4RWWA 5D4PA 3PHEA 3JSMB 2HHUA 1URNA 4RO0A 1T05A 1HQEB 4YS2A 3D0GE 5CZVA 1VQPS 3PJWA 2CFXA 2OEMA 1SJ1A 2DNLA 2P6SA 4DV7F 4X65F 2R3VA 3D3CJ 3RB6A 3RR8A 1MU2A 1TU0B 4WBFA 3GR0A 4IRCA 2JOQA 2K3IA 3ZZ0A 4FBTA 1S9EB 1XC9A 5HQMA 1QD1A 2W8LA 1ZAWA 4PZVA 1N4LA 1SQEA 3NKYA 4WYLA 2ZZNA 3CSKA 1SXLA 2IRUA 4IH6A 2P6TA 1RDRA 4QW9A 3UD5A 2KHDA 2CQ1A 4F25A 4ENOA 4ZHRA 2PFDA 3TO8A 4DCOB 2YKNA 4OLPA 2GFFA 3CWJA 3K5MA 4MFBB 2RDIA 4CLLA 3R97A 4RJVA 1M0SA 2E9ZA 5D0HA 4CO4A 4C8MA 1KEKA 2V4QA 5KFBA 3BDPA 1R3NA 4R8UB 4I1TA 1CJKB 1RYRA 3DKDA 3KLIB 4Y0FA 2AEFA 1IQZA 4I7FB 2OPQB 1UWBB 4DSEA 1UVLA 1FDNA 4IFYB 1VC5A 1J5EJ 2XSJB 4YB5A 2A1BA 4ES1A 1ZTTA 3CCUS 4KC5A 2JVRA 2M7SA 4CTAA 1TKDA 3GSIA 3QO9B 3Q2SC 5AJ3F 2FIUA 3W9HA 2G13A 2IAJB 3QLHA 4KFBA 3RU0A 1JLBB 2N7CA 4M94A 3MI7X 3OL8A 4USUA 5HK4A 1CVJA 1JJ2R 5GMEA 2ZH6A 4BDPA 3OT9A 3OTBA 4RW4B 3Q8VA 4PG6A 4X66J 3PYEA 4IDKB 4C97A 2BKOA 4A8FA 4F3QA 3MAAB 5H9EJ 2DNQA 2Z8QA 3OR2B 1QVGR 1RABB 4B9UA 3R2CJ 1B99A 1NZAA 2GO8A 4WK1A 2UU9F 2DNRA 4X4RA 1RT1A 3DNCA 2W8KA 3DOKB 3MOJB 4YMEA 2DY1A 2YWKA 2Y9HA 4TY8B 2HRYA 4AFFA 2XLJA 4MYUA 2AZ3A 3DGVA 3KHRA 3V2UC 4KIAA 1VRUB 1GMWA 3WBZA 3DRPB 2UVUA 4ZVEA 4DF8A 5E3QA 3SQGB 3B4DA 4OZ5A 2MLXA 2VJVA 4B9SA 1VQYA 2XCAA 1EKRA 3VAJA 2W4PA 2PC6A 1F5BA 3KHGA 4K59A 2OPSB 1YSJA 3FFIB 5H9FK 1VBZA 4GKJJ 2QMWA 2V8HA 3EUNA 3TW0A 4NXMF 2R7RA 3N28A 4CLWA 1IN0A 4PXEA 3HPOA 3TAMB 5DGBA 3WHIA 2HZCA 3V4IB 4QIEA 4AL7A 1FJGF 3UD3P 2X1FA 3MMBA 2ZH2A 3HKWA 2KYZA 3GWCA 2K2PA 1VQ6S 1SIZA 4W98A 4USKA 3AA9A 3D1HA 4LFCF 1QE1A 4MKVA 2BW2A 2Y0SD 1HW8A 4OMFG 1RT5B 3G6YA 1HLWA 1ZOTA 3SSSA 2MKHA 4LF7J 2KI2A 3R8YA 3TA2A 4CWBA 3NCQA 2OUGA 4RW7B 4B3RF 3SCJE 4K4WA 1RAJA 1HR0F 2CVEA 4C11B 3M05A 4ZP6A 1TFWA 4EEYA 3DDNA 2XY7A 1CULA 1KONA 1AT1B 3SYZA 4LVOP 4J9MA 5HLFB 4ED1A 4V19J 4TKTA 2AYMA 1S4EA 5DDPC 3FK4A 1K44A 4Z2XA 2CDQA 4LR9A 3M32B 3SQOP 2Z2YB 1CJTB 4UOFA 1YRTA 2QMXA 1FRXA 3A3NB 3D5MA 2R42A 3P6YC 2HBZB 3QBCA 4TU8A 2EK1A 3LO3A 4GMKA 2BE2A 4QZVB 2H54B 2ZBCA 1TMJA 5KFFA 3CCJS 2OPRB 1HNZJ 2D41A 1VFJA 2QL7B 4FKYA 1REGX 2XMUA 1QUPA 2B56A 3LW5C 3CJ3A 2E9RX 3I4PA 3KG1A 5CYMA 3AJ2A 1GXLA 2YTCA 4I2PB 3MM5A 3KLFB 2YBVA 4JI0F 2I9SA 1G2EA 1QSYA 1B70B 4PXCA 2XMTA 1RT3A 1JXVA 4OYOA 2GHPA 3IN5A 3SI8A 4I68A 4ITSA 3Q8PB 1KLMA 4G1IA 2NR0A 1H0HB 3FCWA 2ALYB 4WCEQ 3QIDA 5F3ZA 4AUKA 3H5XA 3MM9A 4DJBA 1S9GB 3N6MA 4DZDA 4OL8A 2H4YB 5A0YA 4QWEA 3N9UC 1L3VA 2AV5A 4M5HA 3BQ1A 5KG4A 2V2VA 3KK3A 1A6LA 8RUCA 5D0RA 3W2WB 1WC1A 1T02A 3OXGA 2WTFA 2DKOB 1XR7A 1ROFA 4JI8F 3UR0A 3G2XA 3N5FA 4F4XA 2VOOA 2B51A 1CC7A 5GMKa 3OVSA 4X84A 3GV7B 4IFVB 1Q7LB 4HH1A 3MM6B 3MTJA 2ZVIA 1YG0A 2X7IA 4DR2F 3BSNA 3ISZA 1N5YB 1RTIA 2FJBB 3DXSX 2POKA 3WC2A 3VZIA 2ZH1A 3GU0A 4IQMA 5E2QA 1JKHA 3WIVA 3A4TA 3PKMA 2UVWA 4ZLNA 2P9EA 2C28A 3MMJA 3IGVA 2CVIA 3PW0A 1MWQA 3MPUB 5E7OB 2ZKTA 5DZ7A 3EGZA 5KFAA 5KFMA 1TL3B 3D6MB 2YWHA 4LFBF 3BBFA 2ZJQQ 1HWUA 4NMXA 3MECA 3NLCA 1WF0A 5I42A 3UW1A 3BYRA 1D3WA 1P9QC 4GVBA 4C3LA 2J0SD 2YPYA 4K4TA 4ZVOB 1HBUB 1P8GA 5A8WB 2W2QP 4KKOB 2KN4A 5DDQC 4KT0C 3T5LA 3UVJB 3K5PA 4QIWD 4DL0C 1WNEA 1JXEA 2W25A 1S72S 2W4CA 4GO7X 1LW0A 4HL9A 4J9OA 3MR3A 4NX9A 4M5DB 3TUIC 4E0DA 1NJIT 5T14A 3LP0B 2ZH3A 3ENQA 2VOPA 2UVVA 2VV5A 3H20A 2JHEA 2E5LJ 4U6PA 3HVAA 5A76A 1SKRA 5ETTA 4HDHA 1JLAA 4DG1B 1OSDA 4WZQA 1H73A 2ZH4A 1GNKA 4LRDA 1T95A 1YZ6A 2J9CA 1G3OA 1FKPA 4JI4J 2BRLA 3BGRA 3TJ8A 2XBPA 2LXIA 3QMQA 4WIIA 5EWGA 2UXCJ 4UF4A 2QLXA 3M8YA 4ED7A 3AQOA 3J81Y 1NZ8A 3PG9A 2YNFA 3N4WA 4DEZA 2A2CA 4U96A 2MTLA 3RUBL 3OJSA 2GJ2A 4B9NA 2RHSB 4L3NA 1L5UA 3DHWC 4I56A 2XMJA 2GGPA 3JQKA 1RKIA 2VH7A 3BYPA 2C3PA 3OPKA 2V9WA 1RGVA 3UDVA 2M2BA 2YX4A 4LIRA 4DN0A 2F65A 4YP3A 4QWCA 3CCVS 4CZCA 1R8PA 2FYXA 3ISNC 2VBWA 2R7XA 2UUAF 2CQPA 3CJ0A 4FF2A 2C1EB 3BKFA 2ZHAA 3KNGA 3QPIA 1B0TA 4MT1A 4I6WA 2W7AA 2HLUA 1U1QA 2WHOA 3QJPA 1U2RA 3CJSA 3D6HB 1LEOA 3Q8UA 3R7BB 1NB2A 3UO0A 4F3MA 2DNPA 4L73A 1TUVA 2FHMA 2Z2LA 5IWAJ 3S1TA 1RA6A 3R7SB 3LP1A 5DDOC 2DK2A 2WVBA 5LSRA 1TUWA 4QIFA 3K89A 4ER8A 1URRA 5D3GA 4LQ3A 4ZVPB 1F3FA 5A6PA 4DV0F 5RUBA 1YJUA 5A8KB 2XTJP 1RT6B 1PO6A 1K1SA 3D28A 3N01A 5KFLA 2MZ1A 4J9KA 4C98A 1RWUA 5B0BA 3P49B 1H2VZ 4F4WA 4XDDA 3CJKB 2Y1LB 1XQIA 1KFSA 2H51B 2V0NA 4P72A 2EI5A 2V94A 2M5YA 2H3EB 2RDJA 4IYQA 3KLEB 1WI8A 4WP9A 1RWXB 1DQ9A 1H74A 2W9CA 5BR8J 1XJWB 2YQ0A 3BJYA 1KQKA 1WEXA 3GE9A 2FC9A 3OTEA 4MH8A 2C2ZB 4B02A 2QA1A 2LMIA 3SCKE 2V2ZA 1DTTA 1F1BB 4USTA 1HMVA 5K9FA 1QAXA 1WI6A 2MLYA 2Z2ZA 1BC6A 1C0UA 1RT7B 3GV5B 2C42A 3SDEB 2DRBA 1SH0A 1RB0A 2HQGA 2AMCB 2BW7A 1TV6A 1OQ6A 4ELTA 2MSSA 2ZJRQ 3AQPA 2CQCA 3VAMA 1NK5A 2H5IB 4R25A 5CAAA 1Q4RA 1K47A 2J6TA 2F1FA 5J2QA 1AROP 3RR7A 2JFKA 2NZCA 1MROB 2MZRA 4Y2CA 3PFOA 1NMEB 4L72B 4QIVA 1RTZA 2ZM6J 2B4UA 1CPZA 2ACMA 1RWPB 2OELA 2CQHA 3G8QA 5CCLA 4UZBA 4OYAA 3ZZUA 5GAEU 3OFHA 4NLVA 5KFZA 4OYZA 4ZLPA 4MIBA 2BYCA 3E2EA 4CM0A 3J7YU 2MKKA 2HNZA 2R8JA 4RNHA 3DYAA 4OLOA 4YB6A 3V6HA 2FVQA 5F8NA 3AXKA 4PWWA 1S6QB 4R5PB 3O2IA 1B3TA 1HKAA 9ATCB 5GADI 3MAHA 2RRNA 3VVTA 3QAUA 1YJRA 1RACB 5LT5A 4U8VA 3MDFA 4C6AA 3EXYA 1HQUA 3MD1A 3FNNA 3ILJA 3HHEA 3ZO7A 5EN1A 1OY8A 1C1CB 5CYQB 2MSTA 1S1WB 4DQPA 4M5JA 2LEPA 2IIHA 4ZPAA 2M4MA 4NLTA 4KV8A 3UDCA 3CO9A 4OHYA 1KQSR 3T5KA 2WOMA 4DR3J 3IRXA 2AX0A 3ICLA 3MMCB 3R1HA 4F0HA 1HYSA 3CPWR 5L1KA 1HFEL 4O44A 3TUPA 1DQ8A 3JSYA 2WW8A 3OSNA 1SB6A 4OI1A 2BANA 2B5JA 4B3MJ 4RW8B 1YHQS 3THVA 3NS6A 3D6TB 3BKTA 4X66F 1FA0A 4YB7A 1VQKS 2DR9A 5LXRA 3MEEB 3MM7A 2QLFB 5IFMA 2OTLS 3A12A 3R2DJ 1RBLA 1R89A 2BDPA 2AEJA 4CLZA 1HPZA 3IWLA 3IO1A 2A6OA 3UI3A 4F7VA 3L09A 3D4JA 1Y5LB 3I31A 4GVLA 4LRBA 2QE5A 2OHDA 3ILIA 1JLEA 4OI2A 3FEZA 3DRXA 4ZLJA 3W62A 3PW2A 3JSBA 1Q8KA 2O3DA 1S99A 1IBLJ 5HL7Q 2CNLB 1IKVA 3G6XA 2HRTA 1V6HA 2PI5A 1YJ7A 1LK7A 4ZPDA 3K8VA 1JNRB 4ED8A 4AT1B 2EKYA 2FZGB 1UW4A 3V6DB 4MKBA 4B3TJ 5D4NA 4TYAA 1BXNA 3LGHA 4LRFA 3SZ2A 1S79A 4DPWA 4EZ9A 3V81B 2FJVA 3K59A 3G71S 4FVMA 2B9EA 2N3LA 3PTWA 1S9EA 2RRBA 2XMKA 2W9BA 1VIXA 4JI5J 1N54B 1H7WA 1Y11A 1WTFA 1N0VC 3BQ2A 2G0IA 2HHTA 1R8AA 4NA3A 2A6MA 4AL5A 1RYSA 4LF7F 1UJ6A 1BQNB 3DLHA 4EYIB 1FKOB 5C25B 4FDFA 2IPOB 4I4BA 2DHXA 3A13A 4MFBA 2W2PP 3I9V9 4XPCA 2HHPA 3CUNA 1NXIA 1NH8A 1S57A 3W7BA 3G4SS 2QTWA 2GMLA 4BCAA 1IJEB 3MCSA 1NJZA 1F0XA 4KGMA 4X64F 3GIIA 1E6YB 1RWWB 3KLIA 5DDRC 4I7FA 2VU5A 2OPQA 2RDDA 2RSQA 2HHVA 1UWBA 2D69A 1TL7B 4B3OB 5IZHA 2NQPA 1D9AA 2XSJA 2YVSA 1KKHA 3LANA 5F0UA 1SJ3P 2GMHA 2N7YA 2XGQA 4M5NA 4TXSA 1FNMA 4ETXA 3QO9A 4USHA 3Q8SB 2P2CB 2XY5A 3IMQJ 4CO3A 3EYZA 1FFSB 2IAJA 1EQMA 3DI6B 1JLBA 1PYOB 4NL5A 1N36J 4HLBA 3E01A 2DGXA 4WTOB 2YKOA 2DBBA 5AXLA 4RX6A 4AD6A 2FVRA 3ULHA 4I67A 4IDKA 2LQJA 1M5HA 2EFVA 3MAAA 3Q23A 3AOBA 2F9DA 5ETNA 2HW3A 4ELVA 3HXMA 2J7WA 2MY7A 4C48A 2HZAA 3KFWX 1S9FA 1U02A 1FTCA 2OEKA 4PABA 1FJCA 3DOKA 4WKRA 2XEXA 1NSAA 3HX9A 3C3LA 1XTZA 4DR7F 4PUOB 1VHIA 4RW6B 1CJUB 4PWUA 1XNQF 2VPWB 4X62J 1WC0A 1AUDA 1UVKA 1FRMA 1S7HA 3OUYA 3KNAA 1VYAA 1OO0B 2FHJD 2GIFA 2HGMA 1VRUA 3QSIA 5A8RB 3KLHB 4C8YA 2I38A 5C42A 4QYRA 3SQGA 2VFSA 2KDOA 4TU9A 1TL4A 4B3SF 4ZVFA 1SBRA 2OPSA 3R1LA 3FFIA 2XLIA 4N7TA 2CA9A 4FF3A 3R6GB 5AT1B 3QGGA 4XTTA 1BQXA 1AB8A 4LJMA 2BABA 1SKUB 1H2UX 4L3KA 3TAMA 4ZIWA 4AL6A 4V19X 3DLEA 2GQCA 1KDNA 3V4IA 2GHVC 3ZFVA 5IOLA 2B3TB 2HFZA 1NK6A 1MSWD 3UNGC 3CMES 4NLSA 2CPZA 1SC3B 2XZDB 2GZOA 2LQBA 1NHKL 2EXUA 4NLXA 2MEWA 5J2MA 2QSFA 3EXCX 1RU1A 1FCAA 2LQ9A 5ETKA 5EX3A 3T1YF 3GTYX 2HK2A 1DTQB 3DDKA 2AKWB 2WZ1A 2ROEA 5DG8A 1RTJB 3H90A 4ANCA 3DC2A 3IA0A 1N6QB 4FS2A 4RW7A 1KQFB 4OYWA 1R31A 4Q44A 4JV5F 2JC1A 3JAMY 5AE1A 3M8WA 2JEJA 3HVWA 4JI6F 2D7SA 3QSYB 2DGQA 5AXKA 2RHQB 4WU2A 2IYIA 1XNRJ 3BKUA 4KHPJ 3GJQB 4JI1J 1U7LA 4ZVRB 1RTDB 1RLCL 3M32A 3POTB 2WSCC 1CJTA 4DPXA 2NS1B 2IDEA 2VC1A 5JVHQ 4ID8A 3T5JA 4DV6J 2EEYA 2VJUA 1RAOA 4FN5A 2KXHA 3MM8A 1QVFR 4O23A 4LF4J 1PAUB 2PDAA 5E3RA 2OPRA 3LH2S 2WRMA 2PD1A 3J7AN 1CC8A 1PBAA 2WK4A 1X0FA 2E5LF 1XR5A 4LQ9A 2IM0A 3M8SA 4QWDA 4OYXA 4KRWA 3CJ4A 4OV1A 3S6EA 1E6VB 2EFOA 2JZ5A 1MG7A 3QFWA 4I2PA 3KLFA 1B4SA 4WFXA 4QOTA 2HFOA 2W9AA 1VRQC 1RSCA 4ZP7A 3QWUA 1S1UB 3PX4A 3CDWA 4FYXB 3N79A 4YQWA 2WAQD 2LQ8A 2L9NA 3ELHA 2GMJA 2M9KA 2NXJA 2DO4A 5J1PA 1RLDA 3C19A 2R8HA 4CQ1A 3N5BA 3A3OB 4HH0A 3OJUA 5BYQA 3UDEA 1PJ6A 2PA3A 2X3DA 1NDPA 5B08A 1XN9A 2XNQA 2F40A 3FSIA 2RE1A 2E1CA 1VQ7S 4USMA 3UDLA 2XO6A 4WIQA 1FESA 1S9GA 4FF1A 5HP1B 4PCQA 1TR0A 1VJWA 3EZOA 3O44A 4ZVSB 5DG7A 3M30A 2YNGB 2OMOA 1NK4A 2J9DE 4ZVTB 3F73A 4IQXA 2LA4A 3O1LA 1LKZA 4KPYA 3NGUA 4HT7A 1R8CA 4NLGA 3LA0A 1UL3A 2OMLA 4ZVUB 4UQGA 1EJ7L 2CPXA 3HHLC 1U2CA 4PEOA 2O67A 2YH0A 1N0UA 2YQ1A 1NHVA 4ZK7M 3C2PA 4IFVA 4ECZA 1VC0A 5ADZA 4Q45A 3UQSA 5DM6Q 3MM6A 1HNWF 4ELUA 2HVZA 1QM9A 2IRYA 4EI2A 3KHHA 3TVKA 2BKNA 4W4MA 5IM0B 3PO4A 3QT6A 1NPPA 3HM9A 1U4BA 4I6YA 1UZHA 5KFTA 1VQSA 5KAKA 4DV2J 2AJ4A 2QFIA 2W7OA 4TLQA 3DLKB 2AEMA 3OTOF 1I6JA 4F4AA 3FQKA 4Q0BA 4P7TA 4H4MB 2RU9A 1VI7A 3ZZOA 4DR6J 3FDSA 2VICA 4NLWA 4OFZA 4DUTA 2HZVA 4P52A 5KFRA 4DL4A 4Z7CA 2GVZB 1XEZA 1NRKA 1QY7A 5DQHA 5AXNA 4KKOA 3PHTA 2YKAA 1RAEB 3CCQS 2JEIA 4MK8A 1UA0A 2L9WA 1M1KT 1MWZA 2B4VA 1EHWA 2RRAA 2C22A 2J76E 2NZ4A 1UCNA 3TJ9A 5F9NA 4URSA 4Q2LA 4QBUA 1FD8A 3JTPA 4USVA 1O6XA 4J9QA 1R7IA 2NXCA 2CPDA 1ZM3A 4XIUA 3RBDA 1UFKA 4WFAQ 3AOAA 2VF3A 2UP1A 3GB0A 2IVFB 4DG1A 1IWGA 4KBIA 1U1NA 4C2MA 5L46A 2LDYA 1S1TB 4NEZA 1N33F 1APSA 4KTQA 4KHMA 5H1SV 3M8QB 2F63A 1X31C 1EAYC 1X4BA 3N6LA 3I87A 3IBFB 4J7CA 3JS9A 3KTQA 5ETLA 4CLFA 3KJNB 4P74A 1OYDA 3CW2C 2MMYA 3HHLB 2IBKA 3TVYA 3I0RB 1FEHA 1RWNB 3V6JA 2WCXA 5THWA 2FLOA 2IYGA 2ROPA 4B9MA 2J7UA 3ILLA 3I9ZA 4LBPA 2VBZA 3I82A 3W5XA 3ZTQA 3BS9A 4FXWA 4IG0B 3IWXA 1Y0HA 5KTQA 2ZJPQ 1T9VA 5AE3A 2WONB 4C3MA 3K5LA 4NEYA 4F0MA 2QZ8A 4LSLB 1BD6A 1YJVA 4KGVB 2GHWA 3ZC4A 3OHBA 4CNZA 2HMIB 5HBMB 3SSQA 1YRUA 5KFKA 3GG1A 2IC3B 3BPDA 1OPIA 2VPZB 5KOXA 2UXDF 3P3DA 1N32F 1LWCB 4LFAF 1S76D 2PN6A 2CADA 1SH2A 3KG4A 4Y00A 2Y0BB 1LWEB 1UWAA 3I5AA 3UE2A 2RKIA 5KFHA 4YR2A 5E3PA 2KU7A 4BLGA 2F3JA 1SC1B 3AH6A 3RRKA 2RF2B 3X3UA 2ASYA 1VIOA 4MMOA 2IVYA 2FLLA 1D8YA 1T94A 2Y1RI 3RB3A 2DTJA 1HHSA 2X1AA 3BEGB 2ATCB 5A8KA 2UZAA 1Q95G 1S59A 4M5KA 3TZYA 1ULRA 1RT6A 7AT1B 1N5SA 4G65A 4KY3A 1NLKL 4K4VA 4C7QA 1U1PA 2VODA 2IA6A 2RT3A 4M95A 2CJ9A 3PJXA 2YNIA 4F0KA 2XY6A 4FZVA 5L1JA 3V6KA 3PRDA 4RBUA 5IC4B 3HT3A 2ZEJA 1LXNA 3PXGa 5LMNJ 3KLEA 4OI6A 3Q8QB 2WBRA 4AE5A 3J80Y 4L76A 4F50A 1EQ0A 2F4VF 4DX8H 4USIA 2DGSA 2XMVA 1REVB 3LQVA 3JQJA 4U95A 2FD2A 4WE1B 2HGLA 4NLUA 1YK9A 1QSSA 2HS3A 1UEUA 3R5DA 2B8PA 3DMJA 3W2VB 1BWVA 3QGIA 3KDOA 3DU6A 2H9ZA 2DNZA 3MR6A 1NKBA 4CLPA 3SDEA 1X9WA 1T03B 4RL1A 4OX7A 2PE8A 4P2FA 4FYWB 3UN5A 4N56A 1S49A 1CQNA 3ET6B 5BYSA 3JSRA 3VVUA 4QCLA 1CJVB 1WOOA 5F8MA 2F4FA 1HNIB 4KH0B 4P71A 2J8SA 3J7Z5 1TMMA 1U6BA 4JI5F 1MROA 1RWKB 4WFBQ 1UZDA 2J0WA 4EBEA 4C8OA 1JXLA 2HBQB 5GAEI 2UUCF 3K8WA 1QLNA 1Q5YA 2JL9A 3J7YI 1YIJS 1CG2A 2KH9A 1GAOA 2J9DA 2KTQA 1XMQJ 1CS4B 2VHGA 4UY85 1RADB 3THTA 3Q8RB 1LWFB 1T0TV 2HRUA 3W9IA 5FDLA 4I69A 4NLDA 8AT1B 2X1BA 4KH1B 3AOCA 1S6QA 2OH2A 2XZWA 1AFIA 4ZJLA 4DUZJ 1VQMS 3RB0A 4C8KA 4O3NA 1D9FA 1LNQA 4A8SA 2MZJA 2ZHBA 1X4GA 2VQEF 5DG9A 2AGPA 3BB5A 1VCTA 4LIWA 5L1IA 5CQGA 1QJHA 3MGJA 1VK8A 1M1HA 4V1Ak 3FSXA 2HHHF 5CYQA 2F5GA 1NK8A 3DRRB 4LR8A 4DV4J 4CLKA 3FRYA 4ZPCA 3HO1A 2L48A 4O0IA 4IO1A 2GIRA 3B54A 9RUBA 2IA0A 3MMCA 5DM7Q 3CCMS 1GX6A 4WXWA 4DX7A 3LF0A 2EFNA 4MTPA 2HYIB 2EPIA 2MQPA 1R6VA 3HKZD 4E98A 4PPDA 2D3ZA 3HVTB 4RW8A 4ES3A 3MHYA 3F56A 1S0OA 5IT9U 3AXMA 2O01C 2ZITA 1MN9A 3MEEA 1U1LA 4PYDA 4PYAA 1VOMA 2VG6B 1RCXB 4M63A 2M8HA 2R8KA 2JSXA 1KHWA 2OLWA 4KB7A 2KVQE 4GKKJ 3H4BA 4CT8A 2LFVA 3HLUA 1RT4B 1B64A 4UUWA 2O66A 1TTHB 2YKMB 3NXZA 2UV8G 1XMOJ 2F8MA 4P10A 2CPEA 4DDFA 1LWXA 1IBKF 3SV4A 2QV6A 3I5CA 1H6KX 2ALZA 4QIGA 4ZOSA 2YH1A 4NE9C 2Z30B 4P9SA 3A8KA 5KFQA 1KRPA 3M4XA 4MYTA 3R5GA 1WC5A 5F8GA 3AD8C 4OI3A 4TQSA 3PCOB 2FJXA 1K0VA 1MMNA 3V6DA 3H7HB 5D0EA 4G1QA 3ZZYA 1HNVB 2KHCA 1Q1KA 2QEXS 3KUGA 3VTIA 3K0JA 1S1XB 4FYVB 2QL5B 3LWLA 3V81A 1X4EA 2E1AA 1HL6A 4A8XA 3DM2B 5LJ5Y 1XR6A 2R7WA 2V69A 5GMDA 1VQ8S 1RTHB 2ZOGA 1SI9A 2JH3A 5U47A 2XMMA 4ZITA 1FRHA 1IBMF 1U2FA 2DIUA 1WG5A 3UCZP 2O5DA 4A8YA 4DV1J 1BQNA 2MPUA 5G0RA 4IOBA 1X7VA 5C25A 4ED0A 3KJFB 2RS2A 3TA0A 3HSGA 4R0JA 3L7PA 2FVPA 4TNOA 1NHUA 1T7PA 2R8IA 4CO2A 3L4BC 2VC0A 3MCMA 3DOMB 1YVFA 2DH8A 3UNYA 2DIVA 4ED2A 3J81U 4YFUA 3KLGB 4KHPF 2BX6A 4YY3J 5CH7B 4DUYF 4X4NA 2FJWA 2KB2A 2ABYA 3EVMA 3TUZC 4B3OA 1RBAA 4Q7AA 1SL2A 3M6VA 5EHHA 4A8QA 1OQ3A 1NUEA 3T9ZA 4KGKA 2VBXA 3RAQA 2VFUA 2DNNA 4DV6F 2V6AA 1DJ0A 3RBXA 3ZNJ1 5FJ4A 5C24B 4WP3A 2CPJA 1DLOA 3K58A 4LF4F 4PG8A 2VA2A 2HHXA 2XWXA 4HACB 1JQGA 5L9NA 2G9OA 3DI6A 1ZPWX 1TL1A 3CCES 1WOPA 3W1YC 4ZVHA 3W5YA 5A2QY 2DITA 1ITPA 3I56S 5T7LA 1IKWB 2ADCA 1NSQA 1U6ZA 3BR9A 1JJCB 4EO8A 5ETOA 2EBGA 1N34F 1FXDA 3K5OA 1T05B 2QLBB 3A3PB 2AJ0A 2R4FA 3AD9C 3ETMA 4PG7A 2LDIA 3I4HX 4K0KF 3T3FA 3ZXWA 1U1OA 1IKYB 2XULA 2NREA 4J9PA 4PUOA 4RW6A 2FC8A 1I94F 1RHRB 3TYTA 1R0AB 2HAFA 2NXUA 1NDKA 2QT7A 1PJ7A 3G8SA 5KFXA 2IRXA 4OX9F 3A1YG 3BF4A 2VIHA 4B9LA 2ROGA 1HI0P 4ZCKA 5JXSA 5A8RA 2D3UA 2E1PA 3BR8A 1M5PC 2A0FB 1VLOA 4ICLB 4O3RA 2MQOA 3OW2R 3CEDA 1GXTA 2PEBA 4LF5F 1VQ4S 1SV5B 5B0AA 2IFXA 3TOQA 2KKHA 3IBWA 5J1NA 3B8HA 1F9FA 4QQBA 2CNKB 5I3UB 2NCKL 3T9NA 5KFCA 3CT9A 2V2QA 3EDQB 3HJVA 3PW5A 5HATA 4CLYA 5IQ6A 3PW7A 2XS5A 1I1GA 2ZBIA 2CZVC 1WC4A 2DCLA 5ETVA 1KD1T 2XSFA 2MJNA 1YDLA 4DV5J 4CTAB 2RJZA 3W3SA 2GO9A 5LSOA 3DGPB 4KO0B 2CJYB 2NLWA 2HFVA 1RTJA 4ZCLA 5JJBA 1Y4ZB 1Y5NB 1HD0A 1M90T 2XYHB 4DV3J 3QGHA 4DV2F 2GAGC 4KFBB 3ZNUA 3N0VA 2KG0A 3IM8A 1FJEB 2HBYB 3LOUA 2JFDA 3SFUA 1F2GA 3SSRA 4OV6A 2CKWA 4DU8A 1P1TA 1DURA 3D0IE 1X8DA 3NMAA 1T9UA 4ZVGA 3H5YA 1HARA 1X4AA 4O3SA 5CCMA 1RTDA 3POTA 3FJ2A 2W01A 3D7SB 4ECSA 5AE2A 2M88A 4DQRA 3VQSA 5HROB 4ZCIA 3HHLD 1RHKB 3KWMA 2OKQA 4P2SA 3NBPB 4KE5A 3CULA 5J2PB 4FPRA 2AQ4A 2JEGA 5KT2A 2MZSA 1Y00A 4CP5A 2DNGA 4HT5A 4RU9A 2MKJA 1VJQA 7FDRA 2UUBF 4IG3B 3GQCA 1E6VA 4BHQA 1EX8A 3PX0A 2QMUB 3M7VA 3KUHA 1RA7A 4OI4A 2HWTA 3V5RA 3BZQA 2B0GA 1C0TA 3CDBA 1I3OB 3E51A 1W2IA 4FPIA 4DV7J 2FUG9 4DOZA 4X65J 3PRVA 3VWSA 2ZC4A 2PEHA 4F67A 4QR2A 2R8GA 2ZKUA 4WJBA 1VQNS 4USJC 4QPXA 2H1YA 1X0PA 5E3AA 4WYWA 2QJ3A 2Y8YA 3MMBB 1F2HA 2YY3A 2KXNB 2V8DA 3HFKA 4PWDA 5HP1A 2DB1A 2QRRA 2KZMA 2R7OA 2FVCA 3QJLA 3KMSA 3VQTA 3KXDA 2YNGA 4ILLA 2IBOA 3PDNA 3W66A 4NXNF 3BSAA 4NRTA 2KJVA 4GC7A 4ALZA 2FTRA 3M8PB 3KUEA 2KT5A 3G96A 1CULB 1EIYB 1OWXA 4CM2A 4J9RA 3PR4A 2ZDOA 4O4RA 1YI2S 3D67A 1HA1A 1N48A 4N41A 1FO1A 1NO8A 1Y3KA 2V4JA 4DLEA 1YLXA 1G6BA 2K1RA 2SXLA 2KT3A 2XI2A 3PZPA 3H2UB 4X4SA 2HVEA 1NBEB 3ENVA 3RG6A 2FB0A 1VGYA 2QYCA 2HK3A 4IH5A 5IM0A 2JX2A 4DL5A 2GW8A 3VAFA 3MR7A 2D3O1 1RP5A 5AJ3J 3I0SB 2FQQB 6FD1A 1B0VA 3DLKA 4PXBA 3AY0A 4LF8J 3GYGA 3MEKA 3ETOA 5CYMB 5DQGA 1RHJB 2F8EX 4HVZA 3MUTP 5KFPA 2CZ9A 2I2YA 3GILA 2ZVSA 2GVZA 4OHVA 1D9DA 3RRGA 2DH9A 4OIXA 1A0OB 1KVJA 4CDIA 1S7IA 4KPCA 2UU9J 1C1BB 3AODA 1RT3B 3CDAA 4DX5A 2DGWA 1WG4A 4WFYA 2AWZA 5JUMA 2UUWA 2HWIA 1OIAA 1FFGB 4ZCMA 2RAQA 3P8BB 3DLJA 5HN0A 5FIIA 2HHQA 2BQUA 2GC8A 3PJ9A 2VG5B 2WVDA 2EW9A 3IG1B 3ADAC 3JXOA 2BKPA 3N6NA 4B9TA 2CJQA 3FBCA 4DR4J 4R0EA 2MYFA 1W25A 3W61A 4QWAA 3S01A 3AB4B 2R2UA 1GEHA 1M1GA 4X4QA 4ZP8A 1DBDA 1UVIA 3P45B 1YBUA 3R5BA 3MR2A 3QZ8A 4NXMJ 1YX2A 3IR5B 5CA5A 2DGVA 3HJFA 2DEJA 3M9OB 1MW7A 1D09B 2HLTA 3KJVB 1KN6A 1FJGJ 1KSPA 4NCGA 1AZSB 3I0RA 3DLGB 3T5HA 1DHMA 4K7QA 1NH7A 3EMTA 3PO5A 4UZCA 2DCUB 4NZ0A 4OZ0A 3NWRA 1SL1A 5DGAA 4IG0A 4LFCJ 4JI7F 1U48A 2DPIA 3EE3A 1Z2LA 5LXYA 2DHHA 1KOHA 2QA4S 3FRZA 4PPZA 4LSLA 4B3RJ 2VFVA 2ZNYA 1HR0J 1X5TA 3T41A 3NWGA 2C2KB 3MECB 5HBMA 1FI4A 1U49A 2GJFA 2ZBQA 4YHHF 1MMDA 3U7JA 4D3HA 2IC3A 1X5PA 1KTVA 4J91A 1JLGB 4DCPB 4J37A 2BOAA 1WTBA 1LWCA 5KT3A 2XM3A 5DETA 2QLJB 2OEJA 3BV8A 4NRUA 1U24A 1WSRA 3HHKA 4ED5A 3MR5A 2DGTA 5D6GA 2Z56B 1LWEA 4ECUA 3SFGA 1W7WA 3E3XA 4J90A 2AF6A 2ZBRA 1PC4A 4PQUB 4UTGA 3DN9A 2Q79A 3QIPA 2K8GA 3CB4A 1O5JA 1EB0A 2LQ5A 2RF2A 3NGKA 2DNHA 1FNOA 2DGOA 1S6OA 1SPBP 4A8OA 1ZA2B 2R7TA 2JLFA 2G2ZA 4IOCQ 4Q2MA 4XK8C 4M5LA 1SC4B 3CMAS 3UCUP 2BQ3A 3VCDA 3TWZA 1T9XA 5K8MA 3A8EA 3HHNB 2XO7A 3UWTA 2MZQA 3PY8A 4BC9A 2G2YA 2E1MC 1F9EB 2AGOA 5B7WA 4JI0J 3ZZZA 3BGRB 1WHYA 3MWBA 2B9YA 4JOUA 2PFFB 4RNOA 2NXEA 1F3VA 4CI0B 3G6VA 4EZ6A 4ZPWR 2N4CA 1PYSB 2YNFB 3IS9B 3JTOA 2IMOA 4N77A 4BS2A 3OXLA 1NK9A 4JV0A 1REVA 2Q6BA 1Y10A 4RNMA 4WE1A 4UQTA 4WXOA 2GS8A 1T3OA 3JAMU 1DZ5A 2LKZA 2VB6A 2ILZA 4MJKA 5M2RA 2J6SA 2MLZA 1GQEA 3TNVA 2MQQA 3VR1A 3W2VA 2GGPB 3U1LA 4WKYA 4J9LA 1PSDA 3IWNC 1O51A 1RQ0A 2ZH5A 2B43A 3BH7B 2GIQA 2H65B 1T03A 3CJ8A 3NNCA 1RHUB 2EWHA 4HTIA 2CQDA 4Q5VA 1UJ5A 1HW9A 2ZFHA 4RNNA 4IRKA 1CJVA 1HNIA 2PT0A 3S8SA 4JI8J 1Q81T 5F8HA 5IV4A 3WIUA 1JX4A 1V3SA 1FJ7A 5HO4A 2KG1A 3GV8B 1RWOB 1FD2A 3OQ2A 2ZH9A 3DRSA 5D4LA 2OD4A 1EKSA 1RAIB 1UTAA 5B0GA 3CJQA 4WF9Q 1Q53A 2HQ3A 4DR2J 3HP6A 4YR3A 1EETB 3PX6A 2BE7D 2NSBA 3BDEA 3LP1B 1LWFA 4GC6A 2F8HA 1WORA 4UOGA 1KFDA 3PYFA 2OPPA 1H72C 5D3GB 3KG0A 2U1AA 4P7VA 2VQFF 4DR1F 1S0NA 1N8RT 1YBTA 2AW0A 5LMUF 2PGCA 1AA1B 2VKZG 1U0SA 4LF9F 1I51B 3HFZB 1MMLA 2LU1A 3EGNA 4LF6F 5CD4H 2DR7A 1S0VA 2CIMA 4H4KA 2KJWA 3P5TL 1Q7YT 3GYXB 3QAEA 4EBDA 4ED6A 1F5CA 1FRIA 4OJHA 4IUFA 4F02A 1FXLA 2CAJA 3M9MB 4HTJA 3QRRA 4A8WA 8ATCB 1RJJA 3HVTA 4CYUB 3RAXA 3TVZA 1MWYA 1FT8A 4RUBA 2B8QA 2HGNA 5F41A 1FK9A 1V5VA 2AJFE 3MMAB 1B0PA 2VG6A 3CD0A 1UEVA 4OHWA 4TY9A 3MEGB 1V3ZA 1UFLA 2HQCA 4DFJA 3FUYA 3TQ1A 4O4GB 2MXYA 3I6PA 2BRKA 2EC2A 2A2DA 4LRAA 5ETRA 4ZVQB 2YKMA 2HG4A 1Q0NA 3B78A 3W8GA 5GAHU 1AYEA 2E44A 3EICA 1OY9A 1BMQB 3IGNA 2P9CA 3OL9A 3J81j 2PMHA 3RYLA 1NKCA 4DR5F 4NCBA 2BM1A 3AAWB 1KR4A 2HQIA 4CO1A 5E41A 3T1HF 2HNZB 3DYAB 2B7BB 2DY9A 3BREA 3Q0AA 3PVXA 4KHRA 2HIQA 1U8SA 3SCLE 5J1EA 3P96A 3W65A 3BGUA 4WFNQ 2E66A 3FBBA 4M8LA 4JI3J 1LK5A 1YQHA 3Q8YA 4RNFA 1M5KC 4TN2A 1FF2A 2FLPA 4LBHA 3HCXA 3CCRS 3NEKA 2UUAJ 3VHQA 1XK8A 1RTHA 3TAPA 4DQSA 4TU7A 1OSCA 3OFFA 2HNDB 2B4OA 4NA2A 3FEYB 4KV8B 4QW8A 2DR8A 3K7RA 1CEZA 3W60A 1NDLA 1HYSB 4GO5X 2KVIA 4O44B 2BJDA 5F3TA 2VA3A 2DH7A 4C8NA 2OFGX 3A8IA 4Y2AA 2DR5A 1UW9A 1GMWD 1F9HA 1YJTA 1J2VA 2AJ2A 1Q8BA 1SVDA 3M6XA 3HZGA 1HBNB 2IM2A 3QQCD 5HMWA 5I3PA 3L95X 3MPWA 1BUXA 2ERRA 2HHWA 1MLAA 3LPEA 2EC0A 3H25A 5CABA 4KGXB 1NJXA 3VAGA 3G87A 5K14A 2Q6CA 3A8JA 1X5OA 4RZRA 3KLGA 1WEZA 3BN4A 3F0NA 1IKXA 3GJRB 3H0PA 2R2RA 4ZLLA 3DOLB 4OJ1A 1M5SA 4K5SA 1WD6A 4ZDNA 5C24A 4FS1A 3GYNA 3QWPA 1RCOB 2DHSA 4F4YA 3SCIE 2C2NA 3HMJG 3TQEA 2W2NP 2WW4A 4OYBA 2ASLA 3MOZA 5HMXA 1IKVB 4HACA 4ZPTR 1UJ4A 3PKYA 5K8PA 2AYEA 4F36A 5AXMA 2CPIA 2VDHA 2IDLA 2JWNA 5ETQA 1QDUB 1IKWA 1VRTB 1UVNA 1J5EF 2EVZA 4OHZA 4ECXA 4QJVA 3RZAA 2DXDA 3KK1B 1V5IB 2ZWOA 5G4DA 2OJ3A 1X9MA 3B82A 3PFEA 3NG8A 3R5JB 1D1UA 4Y65A 3G86A 1IKYA 4NLQA 2XS2A 3FKBA 2XI3A 2NXNA 4P2MA 1R0AA 3H2LA 2W9BB 2OD6A 2CXEA 2K7KA 3ITHB 4YUDA 3HHDA 3IAM9 2UXBJ 4FXDA 1JJ4A 2J8AA 2W24A 2GX8A 1NKEA 4YEAA 3CD7A 2W2MP 3OL6A 1FDDA 2CPHA 4IR9A 4ICLA 1RAAB 2DJWA 3JB9k 5EX0A 1KP6A 3C15B 2E5JA 3WQPA 3C46A 3HFVA 1GTHA 1GFWB 4TYBA 5DO2A 3CC7S 1U25A 1SV5A 4NLOA 1U0HA 4QPTA 1HD1A 1RAGB 4ZPVR 4HKQA 4EFAC 1OJ4A 1BGXT 2V2KA 3VGTA 2R7SA 4BWMA 2FJAB 2XC9A 3FCVA 5BYRA 2J9EA 4TVAB 3TAQA 5I3UA 2H5EA 2G2OA 2HNYB 4RUAA 3CJTA 1SH3A 5IXUA 4ECQA 2AZ1A 3D1OA 3G82A 4OYMA 5MLCV 4H4OA 2I8EA 1QSLA 3J80U 4ZMMA 2XB2D 2DYAA 4NWBA 2IHR1 1LV5A 4GKJF 4IH7A 3C8YA 2MQNA 3OTDA 4XO0A 3JSMA 4HR2A 1TAQA 5CXTA 3DGPA 3ZZTA 1HQEA 4KO0A 2MKYA 3I55S 1VQOS 3TEGA 3ZTPA 4F04B 1YJNS 5CD4A 4DN9A 3E01B 1S6PB 3G6ES 1KWMA 2M8DB 4LF8F 2YXLA 3VALA 3H5UA 4HI1A 3H4DA 2GA7A 3R9LA 3CD5A 1EP4B 1TKXB 2N4DA 2HFNA 4X4OA 2HVIA 1U26A 4A48A 1J5OB 1JLFB 2CQ3A 3W64A 1FWLA 2CJAA 1FNXH 2XHWA 4AXJA 1NB7A 2JVOA 3IBCB 3VV2B 1YTYA 3HSJA 4X4UA 3GLJA 1JJHA 3FQLA 2QG9B 4K4SA 5HROA 3OV7A 5L38A 3OUYB 2HEKA 3GIKA 4CO0A 3HK2A 4JBCA 2CNOB 4R8UA 2L3MA 3BSOA 1CJKA 3KYLA 5K8NA 3NBPA 1Q5VA 2I6WA 2J0QD 5C42B 5J2PA 3NGDA 3FSYA 4DR4F 4LSNB 3LTOA 3RBEA 2DHAA 4OYIA 3BBBA 4IFYA 1FE0A 4IG3A 4NMLA 5KG2A 4F2SA 3RAMA 1M5OC 3T1AA 4CLUA 4G3IA 1GH8A 1TP7A 2FHOB 4JB8B 2CJXB 4G6VB 4I6AA 2KZZA 3CIMA 1A9NB 1FX4A 3DLEB 1FKAF 4TLRA 1NJYA 4D3GA 2B6AB 3LP2B 2RILA 1HNZF 3TEHB 1Q86T 4YDXA 1AW0A 2MDAA 2AX1A 3CXCR 2ZDPA 2RUGA 5HSPA 1UVJA 4FKXA 1FFWB 2UUTA 5KFEA 3UR3C 4RW4A 5J2MB 3MURP 2KFZA 2H48B 1N5QA 1FDBA 3OR2A 4J9UE 4HEA9 3TZZA 1C4CA 3SXLA 3CC2S 3WC0A 2Y3YA 4KYZA 2OIHA 4MIWA 2V8PA 1KS2A 1KOOA 3M8RA 3D66A 3W9JA 4USWA 3TARA 1IM6A 2OI2A 4TY8A 4C4WA 3M8PA 3OR1B 3NS7B 4NYPA 1OMSA 2CPFA 2OSQA 4RPFA 1ZM4A 1KNZA 2NUUG 4N8OA 2KRBA 1GK8A 1NK0A 2HFSA 4X64J 3DRPA 3IR7B 4LVNP 2M3DA 3FMWA 2FHKA 5CZXA 3J7ZT 5FLXY 1NJWA 3IR6B 3CD6S 1IR2A 2V5HG 1O8BA 2FVSA 2PO4A 1SUQB 3AJDA 4LRCA 3MM8B 3AJ1A 4OQJA 2OFHX 3D1QA 3I0SA 2JLEA 4UY8T 3HF5A 1TAUA 2YQ3A 2LCWA 3LGMA 1RKJA 1ZH5A 3AB2B 1N5TA 2E1RA 2BQRA 2FPHX 1GX5A 2AGQA 3R7NB 2N3OA 1XBWA 2PMWA 2BM0A 2FJDB 2ZOFA 3NAIA 1F60B 3DRYA 4DQQA 1X5SA 5I4MA 3W8PA 2OTJS 3Q22A 3KHLA 2RUSA 4FNIA 3GP9A 3D3BJ 2BR0A 1C1BA 1RT5A 1RWMB 2YWFA 4QR1A 2PIIA 2RMLA 4ZN3A 4DR7J 3VAKA 2X51A 1DRZA 4JI2J 2C2OB 1XNQJ 4NI2B 3EVOA 4C11A 1PC5A 4DPYA 2IM3A 4DL7A 3S7RA 2BZ2A 4K4UA 3HD2A 2VG5A 5HLFA 3IG1A 2KXFA 3PYGA 1OY6A 3UN3A 4LF1A 1PCAA 4A47A 3LAMA 3M30B 1WOSA 1DFDA 4B3SJ 5DRKA 4DPUA 2C3OA 2MB0B 2ASDA 5IT9Y 2LA6A 5KFSA 3JQMA 3NAHA 5KFOA 3DLLQ 4JUZA 4ZKAA 2B4PA 4K2XA 3HULA 2QFJA 1GMVA 4U7UD 3KJVA 2QC3A 5C2GA 3M6WA 2A10A 2C3MA 1VC6A 2XCPA 1AZSA 2UV8A 3VAHA 5DLGA 3DLGA 3NGSA 3PACA 3C16B 4F2RA 1WHVA 3GFYA 2RVJA 4URQU 2PI4A 1NSKL 5KOWA 2V34A 3K17A 2BJ1A 3OLBA 5A2QU 5E5NA 4I2QB 2DGUA 3EPGA 4FYYB 3T1YJ 4JI4F 3CCZA 4P75A 4KAIA 5M2UA 1VQLS 3C6TB 4QR0A 2G1HA 2UXCF 4KGZB 3MTKA 4K50A 2MHEA 3R27A 1X4HA 3FGVA 1IVZA 1V3RA 1VBYA 3F41A 4W92B 4JV5J 4Q0BB 1VQ9S 2Y1IA 1TK0A 4IO9Q 2ZE2B 4G1PA 2DRDA 1VR6A 1H98A 4M5MA 4WWSA 3NCPA 4JI6J 2J0XA 1JLGA 4LF2A 2ZNZA 5D0GA 4P6QA 1ZS6A 4QYZK 3M9NB 5D77A 2Q66A 3MAQA 1ELOA 1TK8A 2ZH7A 1WWHA 5LM7E 3DFEA 4C0BA 3T19A 4PQUA 3EDRB 3W2WA 3Q2TC 4ED3A 3GIJA 4RUHA 4NASA 4DS5A 1AUSL 1VQ5S 2AIRB 3ZTOA 2ZOMA 1VBXA 4ILMA 5KG7A 3H8YA 2GQQA 4Y6IA 2LEAA 3QJJA 1XMBA 1T9WA 2FHJA 2A3JA 3NGRA 2I0XA 1TKTB 2VPYB 2CG4A 5LSLA 1OPZA 3OSPA 1N5YA 3FCHA 3NP5A 4XDCA 3CCSS 5IWAF 3GMGA 3GR1A 3MFIA 2NPIA 2OO4A 2WSFC 4JYAJ 1R8BA 4JV2A 1X4DA 4DPTA 3PEHA 3GFHA 3QRPA 5JVGQ 3IS9A 1ZTWA 1XERA 5T41A 1TL3A 2GAHC 3MFHA 1KLNA 1IJFB 1MNEA 5KG5A 1NM2A 2XZTB 2CPYA 3MCOA 2VDIA 2W2OP 1HBUA 1HWKA 5KFUA 3I5BA 4RUCA 1TQLA 5A8WA 1QUVA 3HSZA 4DL3A 1L3KA 1WACA 3EX7B 3LUYA 1HHTP 3UVJA 4P2XA 4JI3F 2FZCB 1ZM2A 5BR8F 2ZBPA 1H3DA 2DRAA 1FERA 3E8OA 1SL0A 2EFQA 4M5DA 1IM4A 2PSZA 2DXFA 3OD2A 3LP0A 4WZMA 3M2VB 2YKQA 3NNHA 3MZIA 3NMRA 1BQMB 4NLYA 1U09A 4RR5A 1HNWJ 1Q16B 1U1KA 2P9GA 5ETMA 5IT0A 2J7KA 2BEFA 1R43A 3AA8A 2ZWPA 2RKIB 1SCJB 1EETA 1ZAVA 2J5AA 2XYPB 2LVWA 1UETA 2KFYA 3PEJA 4LR7A 3GONA 2OP5A 3RGIA 1S5ZA 4F8RA 4ZIVA 2CG8A 2FLNA 4C8ZA 1WG1A 2ZM6F 1JNZB 3OTOJ 5ETPA 1NU4A 2WB4A 1R0BG 3BGLA 2PMZD 4DBQA 5BJRA 5F9LA 3R5AA 4AXIA 1FRLA 1LOUA 1NNDA 2YNIB 3SV3A 2YNHB 1S77D 2CQGA 4NLPA 3Q89A 5SUHA 4I0WA 1KC8T 3EZUA 4BBYA 4PG4A 2E7WA 2XG8A 2HS4A 2E5IA 3H98A 3QGPA 3GJTB 2KFNA 1FE4A 2E7VA 2QIFA 3EGWB 1OYEA 4DQIA 3IXQA 2JLGA 1S6UA 3CCLS 5EWFA 1WUUA 4CYUA 1X60A 7FD1A 3OLAA 5K8OA 3I32A 3DMJB 5B0CA 1SJFA 1HBMB 3CO0P 5KFVA 2RQCA 3KLVA 3B6BA 4QU6A 3NCRA 3HSDA 4OX8A 3MMAA 5D4OA 1FRJA 1T9TA 1BY9A 5H9EK 1NEEA 3MEGA 1PBUA 4C0OC 3M1VB 1WKKA 3ILOA 3PIPQ 4DR3F 1IUJA 1FRKA 5GAHI 4O4GA 2V8VA 1N33J 3BH6B 1RWVB 2AJ1A 5KFIA 2P5VA 4NLRA 3M2UB 4B3MF 2BV3A 4UT4A 4ILRA 2BJ7A 1A7GE 4N47A 5C7PA 4ECWA 3TRGA 1YJWS 3KJQB 2UXBF 3T6BA 2HKEA 3IP0A 5F0WA 1ZYQA 3ONQA 5BXIA 3M6UA 2BVZA 2ZD1B 3Q86A 2QA4G 1CBKA 2R7UA 2FY8A 1U1RA 3BO3A 1RT2B 5J2NB 4NZ6A 5FDLB 3DHXA 3PV8A 4DFKA 3AT1B 3CJKA 4ZPBA 4PKDB 3PNIA 3JTNA 4DWIA 3U27A 4U8YA 4AQYJ 1IBLF 2C2EA 3P4UB 4E8UA 3RRHA 2R2SA 4WP8A 4DFMA 1HI1A 4IRDA 1V9OA 2M70A 2Z57B 2UXDJ 5LOQA 1N32J 4LFAJ 2MQMA 2IJFA 3EPIA 4B3TF 2HNDA 1RAHB 4LBIA 2P8IA 3UN2A 1RT7A 3THPA 2HHSA 5SZTA 3VF0B 4X2BA 1JLQB 2VFRA 4K2JA 4RU2A 3M2RB
chains in the Genus database with same CATH topology
2EFOA 4A8KA 3U1MA 4IOCQ 3PJWA 2CFXA 1Q8IA 1SJ1A 2JZ5A 2DNLA 2P6SA 4Q2MA 4DV7F 4X65F 2HS0A 4XK8C 4I2PA 3KLFA 1HBNA 3CMAS 4WFXA 4QOTA 3RB6A 3RR8A 3UCUP 2BQ3A 1MU2A 2HFOA 2RQKA 3VCDA 2W9AA 4ZP7A 3NRBA 2QA2A 3GR0A 4IRCA 3QWUA 1S1UB 3PX4A 5K8MA 4FF4A 2JOQA 2K3IA 3CDWA 3N79A 3ZZ0A 4YQWA 2WAQD 4FBTA 3A8EA 4NA1A 2L9NA 1S9EB 2VD3A 2XO7A 2GMJA 3UWTA 3HHNB 2MZQA 5GAGU 2M9KA 1XC9A 2DO4A 1DQAA 5J1PA 1T3NA 2XS7A 3PY8A 4BC9A 2W8LA 1ZAWA 1TKZB 2E1MC 2R8HA 2AGOA 4ES2A 4CQ1A 3ZZZA 5B7WA 3QZ7A 3BGRB 3N5BA 5H9FJ 1N4LA 1SQEA 1WHYA 3MWBA 2B9YA 3NKYA 4HH0A 2DHGA 4WYLA 5BYQA 3OJUA 1LW2B 2ZZNA 4JOUA 3CSKA 1SXLA 1HBOB 2PA3A 1ZM9A 2IRUA 5KFYA 4IH6A 1BLUA 2P6TA 4DSLA 2PFFB 1RDRA 4RNOA 1WEYA 4QW9A 4CI0B 2KHDA 2CQ1A 3G6VA 4EZ6A 5B08A 4ZPWR 1XN9A 2N4CA 2XNQA 2ASJA 4IR1A 4F25A 2YNFB 3IS9B 3JTOA 2IMOA 3TR5A 2F40A 3FSIA 4RKUC 4N77A 4BS2A 2RE1A 2E1CA 4ZHRA 1VQ7S 3DOLA 3IAS9 3OXLA 3TO8A 1NK9A 2YKNA 3ZZRA 3UDLA 4JV0A 1REVA 4OLPA 2CJKA 2GFFA 2Q6BA 3CWJA 1UKUA 4R5PA 3US5A 3K5MA 1FESA 1S9GA 2LLZA 4RNMA 4WE1A 4MFBB 4UQTA 2RDIA 4FF1A 4WXOA 4DPOA 2DPJA 1T3OA 1Z2ZA 1M0SA 2GQ2A 2E9ZA 2VG7B 2CQ0A 5HP1B 1DZ5A 4PCQA 2LKZA 1TR0A 4CO4A 4C8MA 2VB6A 2ILZA 4MJKA 5M2RA 1KEKA 2J6SA 1VJWA 1GQEA 2C3YA 3O44A 2V4QA 5DG7A 2Y1JA 3M30A 3TNVA 1D8ZA 5KFBA 1YGYA 2MGZB 4DMZA 2YNGB 2MQQA 3VR1A 3W2VA 2OMOA 3WDOA 1NK4A 2GGPB 3BDPA 1R3NA 3U1LA 4ECYA 4R8UB 2J9DE 4WKYA 3F73A 4I1TA 4J9LA 1RYRA 4IQXA 4OZ1A 2LA4A 1PSDA 3IWNC 1O51A 1RQ0A 2KO1A 3O1LA 1LKZA 2ZH5A 4KPYA 4HT7A 2B43A 4EBCA 2GIQA 1TZ0A 1VRTA 4RBTA 3KLIB 3C6UB 1R8CA 4Y0FA 1ZZNA 4NLGA 1C1CA 4ZS6A 4Q43A 1T03A 1S1WA 1IQZA 1UL3A 2OMLA 4I7FB 4UQGA 2OPQB 4G1QB 2CPXA 2EWHA 3HHLC 2CQDA 2M0GB 4HTIA 3NNCA 4Q5VA 1UWBB 4I64A 1UJ5A 4DSEA 1UVLA 1HW9A 2ZFHA 1FDNA 3KK1A 2O67A 4RNNA 4IRKA 2K3KA 4IFYB 1VC5A 2YH0A 1N0UA 2XSJB 4YB5A 1HNIA 1NHVA 2PT0A 4ZK7M 3S8SA 3C2PA 2A1BA 3U02A 4ES1A 1Q81T 5F8HA 1HWJA 4IFVA 4ECZA 1VC0A 5ADZA 2RQ4A 4Q45A 3CCUS 1ZTTA 2MKIA 3UQSA 4KC5A 2JVRA 5DM6Q 3MM6A 2M7SA 4DSFA 1JX4A 4CTAA 2KRRA 1HNWF 4UOCA 1V3SA 1TKDA 4ELUA 2HVZA 1FJ7A 3QO9B 4RW9B 5HO4A 1N36F 3KK2B 2KG1A 4RBVA 3GV8B 3Q2SC 5E3CA 1QM9A 1FD2A 2IRYA 3KHHA 5AJ3F 3OQ2A 2FIUA 5CHCB 3TVKA 4NZ7A 2ZH9A 3DRSA 5D4LA 2CQBA 2OD4A 2G13A 2IAJB 3QLHA 5B0GA 4KFBA 3RU0A 5IM0B 4WF9Q 3ITHA 1JLBB 2DNMA 2N7CA 3PO4A 1Q53A 3HM9A 2HQ3A 4M94A 3HP6A 3MI7X 3OL8A 1U4BA 4YR3A 2DNKA 1CVJA 4I6YA 1JJ2R 1EETB 3PX6A 4ETZA 5KFTA 1VQSA 4LUBA 2ZH6A 4BDPA 4ID5B 5KAKA 3OTBA 2AJ4A 2NSBA 3BDEA 4PG6A 3LP1B 4RW4B 1LWFA 2W7OA 3IRWP 2RD5C 4TLQA 3DLKB 4IDKB 5L8RC 3OTOF 4C97A 4GC6A 1I6JA 5G0RB 4A8FA 2R7QA 4F3QA 5H9EJ 2DNQA 2F8HA 2Z8QA 3FQKA 3OR2B 1QVGR 1KFDA 4Q0BA 1KTQA 4P7TA 3EZ5A 4H4MB 2RU9A 4B9UA 1VI7A 2OPPA 3ZZOA 5D3GB 4N76A 1NZAA 2GO8A 3FDSA 4WK1A 2UU9F 2DNRA 4NLWA 4X4RA 2A18A 1RT1A 3KG0A 3CIZA 4OFZA 4X62F 3DNCA 2U1AA 2W8KA 1QAYA 5KFRA 3DOKB 4P7VA 4DL4A 3D2WA 2VQFF 3MOJB 2IMWP 4YMEA 1W2BR 4DR1F 1XEZA 3PR5B 1NRKA 1QY7A 3M2RB 1S0NA 5DQHA 1N8RT 5AXNA 2YWKA 2AW0A 5LMUF 4KKOA 2YKAA 2HNYA 4TY8B 1S1VB 2APOA 1OS5A 2HRYA 2PGCA 3CCQS 4AFFA 2VKZG 3LALA 4URGA 4LF9F 2JEIA 4MK8A 1JLCB 3OHAA 1MMLA 2XLJA 4MYUA 2LU1A 3KHRA 3V2UC 4KIAA 1UA0A 3EGNA 5D78A 4LF6F 2L9WA 5CD4H 1M1KT 2DR7A 1VRUB 1S0VA 1MWZA 2CIMA 4H4KA 3WBZA 1S0MA 2KJWA 3DRPB 2B4VA 3P5TL 1Q7YT 2UVUA 1TVRB 5HI7A 3BM7A 3GYXB 4X4TA 2RRAA 3QAEA 2C22A 2J76E 4ZVEA 4DF8A 2NZ4A 1Z4UA 5E3QA 3SQGB 5F9NA 3B4DA 4OZ5A 4URSA 4Q2LA 4OJ3A 4QBUA 4EBDA 1F5CA 4ED6A 5DQIA 4B9SA 1WELA 3PM9A 1FRIA 1VQYA 1FD8A 3JTPA 4OJHA 2XCAA 3VAJA 4J9QA 2W4PA 1R7IA 4U67Q 3PIOQ 4IUFA 4F02A 2PC6A 1F5BA 1GT8A 2CPDA 3DCAA 3KHGA 1ZM3A 3M9MB 1FXLA 4K59A 2OPSB 1YSJA 3FFIB 4HI2A 1DLOB 4HTJA 4XIUA 4A8WA 1VBZA 3RBDA 1RJJA 3HVTA 4WFAQ 2BOPA 2QMWA 3RAXA 2UP1A 3GB0A 2V8HA 2IVFB 3JYTB 4BWJA 3EUNA 3TW0A 4CO5A 4NXMF 2R7RA 3TVZA 1MWYA 1TL1B 1FT8A 4DG1A 3N28A 1IN0A 1S6PA 4PXEA 4KBIA 1U1NA 3HPOA 4C2MA 1IXKA 3TAMB 2HGNA 5F41A 1FK9A 5DGBA 2AJFE 2LDYA 5T7LB 5KG0A 1S1TB 3MMAB 1B0PA 2VG6A 4OZNA 1N33F 1APSA 3CD0A 4KTQA 1UEVA 1CLFA 4KHMA 4OHWA 2HZCA 3MEGB 4TY9A 5H1SV 1V3ZA 3M8QB 3V4IB 3LGNA 1UFLA 3J7A1 4QIEA 4O3PA 1X4BA 3N6LA 4X4PA 3D0HE 2JRSA 3I87A 4AL7A 1EP4A 1TKXA 1FJGF 4DFJA 1RK8A 4HDGA 3UD3P 4O4GB 3TQ1A 3KTQA 3OL7A 2X1FA 3TX8A 2MXYA 3H2VE 3I6PA 2BRKA 1P27B 2A2DA 2JJ4D 1K1QA 3MMBA 1J5OA 2ZH2A 1JLFA 1M5VC 3D54A 3HKWA 2KYZA 3G9CA 3GWCA 2K2PA 5B0DA 2MMYA 2V8GA 3HHLB 2IBKA 1VQ6S 1SIZA 2HG4A 2YKMA 3TVYA 3I0RB 3AA9A 2VONA 3B78A 1FEHA 3D1HA 1FKOA 2WCXA 3V6JA 1QE1A 2NSCA 4LFCF 2BW2A 5THWA 4EUVA 2Y0SD 4WTYA 5GAHU 2FLOA 2IYGA 1HW8A 4OMFG 2E44A 1RT5B 3HI9A 3G6YA 1ZOTA 2ROPA 1Z1ZA 3SSSA 4B9MA 4JI2F 2J7UA 2MKHA 3I9ZA 2KI2A 1VLYA 2VBZA 2BBEA 3TA2A 3I82A 2R7VA 3NCQA 3BS9A 4XAKA 4FXWA 3IGNA 4IG0B 3IWXA 2P9CA 2AJQA 1Y0HA 3OL9A 4RW7B 5IS2A 3NNAA 4B3RF 3SCJE 4K4WA 2LEBA 2I5JB 2PMHA 3RYLA 1NKCA 5KTQA 2ZJPQ 1RAJA 3IC1A 1SJ4P 4DR5F 1HR0F 5AE3A 2WONB 4C3MA 3K5LA 4NCBA 1CQMA 2BM1A 2CVEA 5EWEA 3AAWB 1KR4A 2HQIA 4CO1A 4C11B 4B9VA 2QZ8A 3L7OA 4LSLB 3M05A 4ZP6A 1TFWA 4EEYA 3DDNA 1XNRF 2G1DA 1E6YA 3NL0A 1BD6A 5E41A 3T1HF 1YJVA 2RQMA 2HNZB 2XY7A 2C3UA 3DYAB 4XPEA 4YB1P 2B7BB 2GHWA 1KONA 2D9PA 2VL1A 3BREA 3F44A 3ZC4A 3OHBA 3Q0AA 4JI1F 4LSNA 3SYZA 4KHRA 2Q43A 4LVOP 4J9MA 2HIQA 3PVXA 4CNZA 5HLFB 1U8SA 2HMIB 5HBMB 4ED1A 4V19J 3SCLE 5J1EA 4TKTA 2AYMA 4CH1A 3P96A 3SSQA 1YRUA 5DDPC 5KFKA 1FVSA 3BGUA 4WFNQ 2E66A 5EUHA 3GG1A 2IC3B 1OPIA 2MHNA 4M8LA 2VPZB 5KOXA 1LK5A 4Z2XA 1YQHA 5LJ3Y 2CDQA 4H54A 3M32B 2PA8D 3P3DA 4Y2IA 2UXDF 4RNFA 1N32F 1LWCB 1YRTA 4LFAF 2QMXA 1UMJA 1S76D 2PN6A 1VK3A 1FRXA 1WF2A 1M5KC 3D5MA 4TN2A 1FF2A 1SH2A 4FXVA 2FLPA 1KVIA 1R6YA 3P6YC 3KG4A 4Y00A 3CCRS 4TU8A 2B6AA 3LP2A 2EK1A 1XK8A 1RTHA 1LWEB 3TAPA 2DNYA 3LO3A 4GMKA 2CYYA 1AFJA 2BE2A 4J9NA 4DQSA 2L9DA 4QZVB 3B4MA 2QO3A 4TU7A 1OSCA 2ZBCA 3I5AA 3UE2A 2G0CA 2RKIA 4OHXA 5KFHA 4YR2A 3OFFA 2HNDB 3LWMA 5KFFA 3CCJS 2B4OA 4NA2A 1HWLA 2OPRB 3FEYB 4KV8B 2L41A 2D41A 1VFJA 5E3PA 2KU7A 2MKCA 2F3JA 2XMUA 3AH6A 4QW8A 1QUPA 3K7RA 2DR8A 3RRKA 2RF2B 3X3UA 1G1XA 2B56A 1CEZA 3MEDB 3G8TA 3LW5C 2ASYA 3CJ3A 2E9RX 4WK3A 1VIOA 4MMOA 1HYSB 2IVYA 4GO5X 2KVIA 4O44B 2FLLA 2BJDA 5F3TA 2VA3A 2DH7A 4C8NA 3I4PA 1D8YA 2OFGX 3H59A 4Y2AA 2DR5A 1T94A 3KG1A 5CYMA 5F8IA 1YJTA 1J2VA 2Y1RI 3RB3A 1Q8BA 3AJ2A 2DTJA 4O3QA 1HHSA 3M6XA 2X1AA 1GXLA 3RTVA 2YTCA 3BEGB 3HZGA 3KMQA 4I2PB 3MM5A 3KLFB 1HBNB 5A8KA 2UZAA 1MU2B 2IM2A 4JI0F 1ULRA 1RT6A 1X4FA 2I9SA 5HMWA 1N5SA 1G2EA 5I3PA 3L95X 4Q8FA 3MPWA 2ERRA 1QSYA 2HHWA 4K4VA 4PXCA 2ZZMA 4C7QA 2EC0A 2XMTA 3H25A 4Y34A 1U1PA 2VODA 3CC4S 1P1LA 2IA6A 1RT3A 2RT3A 2CJ9A 2CQ4A 3PJXA 3DXBA 1NJXA 4M95A 3VAGA 3OR1A 2YNIA 5K14A 2XY6A 4FZVA 2Q6CA 5L1JA 3V6KA 3KLGA 1X5OA 4RZRA 3PRDA 4RBUA 2XGPA 3HT3A 4MK9A 1LXNA 1VHFA 3PXGa 2GHPA 3IN5A 3SI8A 4I68A 4ITSA 5KFJA 1X4CA 3Q8PB 5KT7A 1WEZA 3BN4A 3KLHA 3KLEA 1KLMA 1IKXA 4RLEA 4OI6A 3Q8QB 3O8WA 4G1IA 2NR0A 1H0HB 2WBRA 4AE5A 2F7VA 3J80Y 4F50A 2CQ2A 2R2RA 2F4VF 4DX8H 4WCEQ 4ZHRB 2NYIA 4A8MP 4USIA 2BA9A 3DOLB 2DGSA 3QIDA 4OJ1A 1M5SA 4K5SA 5F3ZA 2XMVA 2YKNB 1WD6A 4ZDNA 4AUKA 5C24A 1REVB 3H5XA 3MM9A 3LQVA 2MKSA 4FS1A 3GYNA 4DJBA 1S9GB 2FD2A 3N6MA 4WE1B 1L3UA 3KOAA 3QWPA 2DHSA 1U47A 4OL8A 2HGLA 4F4YA 4NLUA 3SCIE 3HMJG 2RNEA 3X1LB 1QSSA 5A0YA 2NPFA 2HS3A 2N82B 1QAJA 4QWEA 1UEUA 3MOZA 3R5DA 5HMXA 2ASLA 2HVHA 1IKVB 3N9UC 1L3VA 4ZPTR 4OZLA 1TL5A 1SUQA 1UJ4A 4MK7A 2AV5A 3BQ1A 3DMJA 3VZHA 3PKYA 3W2VB 1X9SA 5K8PA 2AYEA 2U2FA 5KG4A 3KK3A 5AXMA 2CPIA 1A6LA 3W2WB 3QGIA 5DJBA 1HWIA 3DU6A 1T02A 2H9ZA 3OXGA 2JWNA 6FDRA 2DNZA 3MR6A 5LL6d 2D3OR 1IKWA 1VRTB 1UVNA 1NKBA 2WTFA 3SDEA 1J5EF 1XR7A 1X9WA 1T03B 1ROFA 2EVZA 4JI8F 4OX7A 3UR0A 2PE8A 4OHZA 4X4VA 4N56A 4ECXA 1S49A 4QJVA 1CQNA 3N5FA 5IT4A 5BYSA 4F4XA 3RZAA 2VOOA 3JSRA 2ZUGA 2JC0A 3KK1B 2B51A 1CC7A 5GMKa 2AYBA 3OVSA 5G4DA 4QCLA 2OJ3A 5F8MA 1X9MA 3DLBA 4X84A 1HNIB 3B82A 3PFEA 3K5NA 3NG8A 1D1UA 3GV7B 4Y65A 3G86A 3TUJC 3J7Z5 4IFVB 1Q7LB 1U6BA 4JI5F 1MROA 4HH1A 3MM6B 3MTJA 1C0TB 1IKYA 5KFDA 4WFBQ 4JYAF 2J0WA 4NLQA 1DTQA 4EBEA 1YG0A 4C8OA 2XS2A 1JXLA 5GAEI 4DR2F 3MD3A 2XI3A 3BSNA 3ISZA 2UUCF 1R0AA 1N5YB 2RIJA 1RTIA 2FJBB 2YKPA 3DXSX 3K8WA 1QLNA 3H2LA 2W9BB 2OD6A 2POKA 3WC2A 1N6QA 1Y3JA 2JL9A 3VZIA 4IQMA 1CG2A 5E2QA 3J7YI 2K7KA 1JKHA 3QLHB 2KH9A 2ZH1A 3ITHB 4YUDA 1GAOA 3PKMA 2UVWA 2J9DA 3HHDA 2KTQA 3IAM9 4FXDA 1JJ4A 2ADBA 2J8AA 2W24A 2GX8A 2P9EA 1NKEA 4EYHB 4UY85 4YEAA 3Q24A 3MPVA 3CD7A 2C28A 3THTA 3MMJA 3IGVA 2CVIA 3OL6A 3PW0A 1L3SA 1FDDA 3Q8RB 1LWFB 2CPHA 5E7OB 2V4RA 4DR6F 2IJNA 2ZKTA 4IR9A 3OFGA 2HRUA 3EGZA 4ICLA 5FDLA 5KFAA 4I69A 2DJWA 4NLDA 4ECVA 3JB9k 5KFMA 1TL3B 5EX0A 2X1BA 3KKFA 2YWHA 2E5JA 4LFBF 3C46A 2ZJQQ