2AD9A

Solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
GDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*UP*CP*UP*CP*U)-3'
publication title Structure of PTB bound to RNA: specific binding and implications for splicing regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ad9A00
3US5A 2QFJA 3TO8A 3SXLA 2RUGA 2MGZA 2K3KA 1H2VZ 1N88A 2DNQA 2MZSA 3MI7X 2AYEA 2LYVA 4FXWA 2J0SD 1WHYA 2MZQA 1KC8T 2AD9A 2JWNA 2MGZB 3THTA 1O0PA 2XNRA 4OZ0A 1VC5A 2M2BA 1U1LA 3NNCA 2DNNA 3LQVA 2XS7A 2CQ4A 2EK1A 3J7YU 3MDFA 3PIPQ 1W2BR 3ZZZA 2DGUA 1M5PC 1U1RA 1WEXA 2HVZA 2LMIA 3UE2A 2X1AA 1YHQS 2AYGA 1A9NB 2J8AA 2RNEA 3CCSS 3VAKA 2FHOB 2XNQA 3MURP 2DNOA 4U67Q 1N54B 2DO4A 2KU7A 4F02A 4TU9A 2DGTA 5JVGQ 2CPHA 1U1OA 2I38A 1Q86T 5FJ4A 3CC7S 2KRRA 2MKHA 4LMZA 2DH9A 2MQNA 1F9FA 2A3JA 2L08A 5GMKa 2MJNA 5DM6Q 2LEBA 1YIJS 1D8ZA 1QVFR 2J76E 5LXYA 1S79A 3I55S 3CMAS 4QU6A 4TLQA 3CTRA 1K9MT 1YJ9S 5HL7Q 1RK8A 3CCES 2DNHA 3B4MA 1WHVA 4UY8T 2DNMA 2RQCA 2G4BA 3TYTA 2PEHA 2DNRA 2D9OA 2KXNB 4QPTA 4IUFA 3VAHA 4WFNQ 1H6KX 2DHXA 2DH8A 2KXFA 2MXYA 2DGSA 1U1KA 2KYXA 2MSSA 1KQSR 2GO9A 1FXLA 2M4MA 2MYFA 3LPYA 3CCMS 4IO9Q 2CQDA 1JJ2R 2FC8A 3G4SS 3RW7A 2N82B 5CYJA 3PIOQ 3MD3A 1QM9A 3FEYB 2KVIA 3MD1A 2M52A 4F25A 5LSOA 3NS6A 2OSRA 2AYBA 2MZRA 3TP2A 4F26A 2F3JA 1VQLS 2JRSA 2KHCA 4TU7A 2MHNA 2MKJA 4EGLA 2CJKA 1VBZA 2CQ0A 3CC2S 1P27B 1WG1A 4LJMA 3OW2R 4UQTA 2F9DA 1WELA 1FNXH 2KG1A 1SJQA 3U1LA 4WFBQ 1VQKS 2CPIA 2WBRA 3UWTA 1U1QA 4RU2A 1WF0A 2GHPA 3S6EA 2X1GA 2K8GA 4WFAQ 2DNPA 1K73T 3IWNC 4CH0S 3SDEA 2DNZA 3VALA 2MQOA 2MQMA 4CIOA 5MLCV 2MKKA 3MUVP 1UFWA 1VQ6S 5IFMA 1UAWA 2CPYA 2M88A 2LKZA 1X4AA 3S8SA 3THPA 3CCLS 1FJCA 2RRBA 3R27A 1WI6A 2D3OR 1WF2A 2CPJA 2MMYA 1JMTA 5D78A 3SDEB 3S01A 2CQPA 1L3KA 4C7QA 1WG5A 1Q81T 3RW6A 2B0GA 1FJEB 2KRBA 2MY7A 2OJ3A 1X0FA 2N3LA 2E5HA 4FXVA 3MXHP 3P5TL 2JVRA 5LJ5Y 2XS5A 2E5GA 4YOEA 4ZKAA 1KOHA 2MQQA 3BO4A 1SJ3P 2LA6A 4ED5A 2QEXS 1B7FA 1NO8A 1WHWA 2VODA 2KI2A 3G96A 2DGWA 3K0JA 1WI8A 1DRZA 2HYIB 2KG0A 1SJFA 2XB2D 2JVOA 2X1BA 1X5PA 2CQIA 2KN4A 1YJNS 1H2UX 2CPZA 3Q2TC 5LSLA 2FY1A 2I2YA 3DLLQ 5DDPC 2M8DB 4Y00A 2SXLA 1VC0A 1BY9A 1HL6A 5GVQA 1YTYA 2RS2A 3CC4S 5GAEU 2MZ1A 1YITS 2XS2A 3CCVS 3ULHA 1U2FA 3VAIA 3L3CA 1KD1T 4V19X 3G8TA 2CQHA 2MKIA 1VQ5S 1R8PA 5EN1A 3CUNA 2YH0A 1DHMA 1M90T 4CQ1A 2DIVA 4IOCQ 3R1HA 2M70A 2DNYA 2PE8A 5CA5A 2BOPA 3D2WA 2KFYA 1WG4A 1FJ7A 2LECA 2ADBA 1PGZA 3FEXB 3CMES 2E5IA 2NZ4A 2CPXA 4M5DB 1N52B 2MQPA 2RU3A 2YKAA 1WHXA 3BO3A 3CCRS 2MKSA 2RQ4A 5GAGU 1WEZA 2MZTA 3G71S 4PRFA 2DHGA 2YWKA 4W90B 1X4GA 2LCWA 2OSQA 1M5VC 3CULA 2FPHX 2DISA 4W92B 4WF9Q 1KOOA 5JVHQ 5H1SV 2L41A 5D77A 2D9PA 5ITHA 3P49B 1FHTA 1U1PA 3MUTP 1JJ4A 2MKCA 1H2TZ 3UD4P 1UW4A 4LIRA 1WTBA 5IQQA 2N7CA 3G9CA 5HO4A 3Q2SC 2EK6A 3EX7B 2ADCA 3G8SA 5BJRA 5IM0A 2U2FA 1VQPS 3I56S 4WIIA 2CPEA 2MSTA 1X4BA 3P3DA 5DETA 1OWXA 3CD6S 1RKJA 2LEAA 1VQ7S 1FO1A 4C0OC 2CQ2A 4YB1P 5IM0B 1A7GE 2MPUA 5DDRC 3G6ES 1VQOS 2MJUA 3VAFA 1AUDA 2ERRA 1IQTA 1SJ4P 3SMZA 2CQCA 1SXLA 2MQLA 4QQBA 4PR6A 3B4DA 3EGZA 1WF1A 1Q7YT 4P6QA 3HHNB 1OPIA 3MUMP 1K8AT 1X5OA 3HI9A 2CQ1A 1UP1A 3IRWP 5DM7Q 3CCUS 5LXRA 4CH1A 3VAMA 4TU8A 2CPFA 1M5OC 2CQ3A 3EGNA 1JJHA 1P1TA 4IOAQ 2XSFA 2BZ2A 1VQMS 3VAJA 2J0QD 2CQBA 4C4WA 2MZJA 1HA1A 1VC6A 2YH1A 3J7ZT 3UD3P 1DBDA 3BEGB 1X5SA 2KM8C 2KXHA 1Q82T 2N3OA 3H2VE 2DGQA 1WEYA 1N8RT 5CXTA 2G1DA 2O3DA 3V4MA 3MOJB 2OIHA 2G0CA 1X4CA 3NNHA 1R8HA 1SJRA 1X4DA 1HD1A 1VQ8S 5DDQC 1QVGR 4ERDA 2M0GB 3UCUP 1VQNS 2RVJA 3CCJS 2LXIA 2U1AA 1D9AA 2JX2A 3UCGA 2DHAA 2NLWA 4OZ1A 3N9UC 2DNLA 2E5JA 2KM8B 2X1FA 2HGLA 1YJWS 3U1MA 1X4FA 2DIUA 2YTCA 4Z2XA 1OIAA 2HGNA 4WKRA 1PO6A 2VOOA 3BS9A 2ZJPQ 2LA4A 2DGOA 3R1LA 3P6YC 1X4HA 2KT5A 3VF0B 1VBXA 3DXBA 4J5OA 1XN9A 2M8HA 3CPWR 2DK2A 2MB0B 2DH7A 4PKDB 4Y0FA 2ZJRQ 1NJIT 1CVJA 1ZZFA 2DHSA 2RRAA 1M5KC 1URNA 2V94A 2OTJS 3ZZYA 2L9WA 4BS2A 3CXCR 1U1MA 3NS5A 2RT3A 1ZZNA 5LJ3Y 2ZJQQ 3NNAA 1FT8A 1HD0A 3VAGA 2VOPA 2FC9A 2F9JA 2DNGA 5GAHU 5GADU 2OTLS 1U6BA 3CCQS 1ZH5A 1VQ9S 3BO2A 4QU7A 2DNKA 1U6FA 1X5TA 2DITA 1U1NA 3UCZP 1VQ4S 2M9KA 4A8XA 2CQGA 1G2EA 1OO0B 2E44A 1WWHA 2RS8A 2M7SA 3JB9k 2DO0A 2CPDA 2Q79A 2DGVA 2QA4S 3H2UB 1NU4A 1YI2S 3NMRA 4YUDA 2HZCA 1X4EA 1DZ5A 3S7RA 2VONA 2MY8A 2UP1A 1M1KT 3CF5Q 1YWXA 2KH9A 1S72S 2LQ5A 2AYMA 2HGMA 2DGXA 2EVZA 2LXUA 5DDOC 2DB1A 4WCEQ 1VBYA
chains in the Genus database with same CATH superfamily
1BC6A 3C6UA 1GEHA 3DHXA 1S9FA 3M8YA 1MN9A 1RWUA 1URRA 2LYVA 2QLJB 4HEA9 1OY6A 3PRVA 2AZ1A 4OI1A 5J2QB 3F73A 4DV6J 4HKQA 1CG2A 2H5IB 2ZBQA 3QO9A 3ZC4A 3KHGA 4I7FB 4MIAA 2V2QA 3I31A 3LTOA 4P7TA 3B6BA 4C11A 4U67Q 4HH0A 1VQYA 1KDNA 3NP5A 4NLVA 4FP9A 2UZAA 2OD4A 3GIKA 1OMSA 2BJEA 3UDEA 1UWBA 4ECUA 2J9DA 1KLMB 3N6NA 2DNMA 2W4DA 3L4BC 1VDHA 3QSYB 3SFUA 2C22A 4RBVA 3IR6B 1ZETA 2MSSA 2E9TA 3M2VB 1VLOA 1F5AA 2DR8A 3R5JB 2EI5A 3A8JA 1EKRA 3EYZA 3AT1B 1T03A 3OTCA 4DL5A 3KHRA 3M6XA 4LJMA 3CDUA 2QLFB 4DV2F 1SJQA 2CIMA 1WF0A 3L9ZA 1HYSA 2K8GA 3VALA 4DR7J 4CIOA 4KHMA 3D3BJ 5HP1B 4LSNB 5L39A 3PHEA 3O44A 4K7QA 2V0NA 4KT0C 3S1TA 2G9OA 3RW6A 4OJ3A 1OQ3A 2OJ3A 4LBIA 3BQ2A 1GTHA 4OZ2A 4PG6A 4F0HA 4OX9J 1VCTA 3TAQA 1IXKA 2VKRA 4USUA 3MM8A 4QWCA 1NPPA 4IH5A 2FY1A 1B7YB 1KLNA 5DDPC 4WP8A 4K4WA 1SL1A 4GC7A 4AYBD 2ILZA 3U1NA 5GAEU 1HNXJ 4ZS6A 1VRUA 1SVDA 3W7BA 3NOCA 3TUZC 3VV2B 3RUBL 3PW0A 2IMWP 2V9KA 4J9SA 3V4IA 3H5SA 3DRRA 4PCQA 3BM7A 1RLCL 3ZTQA 1EETB 4XDDA 1WHXA 3PW2A 2V8VA 3GE9A 2GJFA 3DGVA 4ED1A 2W24A 3VGSA 1WSVA 1T11A 3E3XA 4WF9Q 1KOOA 2Z56B 5FDLA 2L41A 5D77A 4B9SA 1MWZA 2CA9A 3N6MA 4P72A 5HO4A 1VJQA 4MK8A 1NK8A 1WC4A 1MWYA 3LOUA 1VQ7S 1FO1A 4Q0BB 2B9WA 3OR1B 1TP7A 3SMZA 4DR5J 2A0FB 2ZFHA 3MUMP 1X5OA 2I5JB 3H90A 4X66F 4LF9F 2M3DA 3NOGA 5C5JA 4JV2A 2E7XA 1T0TV 2CZ4A 3RGIA 3RB3A 4I0WA 3NCRA 4YB5A 4P2FA 2F4FA 5CXTA 4Y2KA 4JI4F 2O3DA 4KGZB 2P9CA 4N76A 2G2YA 2M0GB 2M5YA 1AYEA 4AL6A 5KFUA 5BR8J 4DBQA 3VVTA 4BHQA 2ASDA 1XK8A 1MW7A 1TUGB 1ELOA 1JWWA 4Z2XA 2R7OA 4I2QB 1WKJA 5M2PA 3DC2A 4ZVQB 1J5OB 1LOUA 3BSOA 3WX8A 4B9NA 4X4OA 3FSYA 1PKUA 1LFWA 5AE2A 2XY5A 2WB1D 1Q0NA 1S4EA 3KJQB 1HI0P 3OHAA 2X3GA 2RT3A 2GX8A 4G1QA 2YX7A 5E7OB 3EZ5A 2LQ8A 2Q3PA 2VFUA 4GVLA 2OH2A 3MZIA 4CM2A 2WW4A 3CJ4A 5D4PA 3DMJA 4C8ZA 2BUNA 1VHIA 4A8XA 1SL2A 1N5VA 3BR9A 1TUVA 2CPDA 2AX0A 1T3OA 3KJFB 2Q79A 1NMEB 4I6AA 1NPKA 4QWEA 1U2RA 2EVZA 1B0TA 3OV7A 3TX0A 3CWJA 3SXLA 2UVWA 3TVKA 2BACA 3RAQA 4KR0B 2AD9A 3GONA 4JI0F 1QAJA 1GMWA 2DTJA 4F36A 1GXUA 5M2RA 2H5EA 1U6ZA 4KB7A 4EFAC 2B5JA 2XM3A 4IR1A 2LMIA 1A9NB 2AYGA 4X64F 1LWFB 3J80U 2DJWA 2KU7A 4F02A 1FWLA 1IKXB 1DURA 3NG8A 3W2WB 5ETRA 5KG7A 1G1XA 2IM0A 1YIJS 3PFEA 4DG1B 4XDCA 3PW4A 1VHFA 4CTAA 5AJ3F 4JV1A 4P71A 4C8KA 5HVGA 2CVIA 1YK9A 2OKQA 1R0CB 1LWCB 2VB6A 2QTWA 2J9CA 2VG7B 4OYWA 4NXNF 1FKAF 3AA9A 2DH8A 1KQSR 2AT1B 2AJ1A 1C0UA 5HATA 2FLLA 3MM5B 1U47A 2R4FA 1YSJA 5DGAA 4NZ0A 2AYBA 5A8WA 4HYKA 1UVLA 3UPFA 3TZYA 1RT2B 3AOCA 4DPOA 3EM1A 1EQMA 2WONA 2ZBIA 5EGYA 1QUPA 4RU2A 5A8RB 4L6V3 3NL0A 2CPYA 3BGFA 4BBYA 4PPDA 4ZPDA 2K06A 2B4UA 4K2JA 2YKQA 1TR0A 1DJ0A 4C7QA 3R5GA 4B3RJ 1V3ZA 4RW6A 2GFFA 5KFQA 4DFKA 3GMGA 1CPZA 2R7VA 3SSRA 4F0KA 4UOCA 1PC5A 2WVBA 3FUYA 1FESA 1OJ4A 1S6OA 2EFQA 2Z57B 4NYZA 1WC3A 5B0FA 1HPZA 3HDSA 5B0CA 3KNAA 5KT2A 1E6VA 2BKOA 4LF1A 2WCXA 2PT0A 4V19X 2RUSA 4URSA 2CQHA 4AFFA 2VDHA 4ZLPA 4KV8B 2WOMA 4ZK7M 1VRTA 1NDLA 5B0GA 2R7WA 4R8UB 1JLCB 1PGZA 2NPFA 4MT1A 5ETSA 4J9MA 4U7UD 1NK0A 2LCWA 5L1JA 3FVYA 3KK2B 1PBAA 1KR4A 4FYYB 3TAMB 1CS4B 5JVHQ 4ZN3A 4XO0A 1WDDA 3FC9A 3CJKB 5GAHI 2CG4A 4C8LA 1JLQB 2JC0A 1KTQA 4CLWA 3DLBA 5IQQA 4DL7A 2CUYA 1YVFA 4WIIA 2R3VA 4LR7A 2YKMA 3UR3C 1SKUB 3V6KA 2FLOA 1HNZJ 4K4UA 1VQOS 3VAFA 5T7LA 2W8KA 1TMJA 4IH6A 3ZTPA 1Q7YT 3C46A 3QGPA 2HKEA 4EBCA 3A4TA 3BKUA 1WOOA 3BGRB 1SUQB 3DHWC 1T95A 3T19A 3KDOA 5KT5A 5F8NA 1QJHA 3FQLA 5KT6A 4IKAA 2W9BA 5BR8F 3BEGB 1CJKA 3H2VE 4KHPF 3VQSA 4Q44A 4KJIA 4WXOA 3UN2A 3NNHA 4X2BA 4B08A 3TVZA 3B78A 3G87A 3TAPA 3GIIA 3DRSA 1VQNS 2VA3A 3NWRA 4TXSA 2LQBA 4RW4A 4WIQA 2DNLA 4ANEA 1FRHA 3B8HA 1HBMA 2EKYA 1NM2A 2GGPB 2EFVA 2FVSA 2HGNA 4OIXA 1NHVA 4IDKA 4OYZA 5FD1A 3VF0B 3RJMB 4AXJA 4WZMA 2IAJA 2JEJA 1HW8A 4A8FA 3UDVA 1YKWA 1TVRB 4RLEA 1XC9A 5F9LA 5BXIA 5E3QA 1R3NA 3J81U 3HVWA 1Q5VA 2FJDB 2WBMA 2GAGC 4F50A 2YNFA 3OT9A 4PQUA 2EFOA 3KFWX 2H4YB 1C4CA 3MF5A 4OMFG 1FX4A 2VFSA 3OLAA 4RNMA 2OTLS 2V4JB 1ZH5A 2DNKA 4ZA1A 3PDNA 3KLEA 1S77D 3QGIA 2G0IA 2DO0A 3EGWB 2HWIA 2NQPA 1GNKA 5A8KB 4U8YA 1LV5A 3CVKA 1GMVA 2X51A 4CO4A 1PCAA 2K3KA 4Y2AA 3PEJA 2K1RB 3QJJA 2XLKA 4LR9A 2J6UA 1JLAB 1IN0A 3QNWB 4YB7A 5J2MB 4NLDA 2OAUA 4X4RA 3I9V9 4OI2A 2DGUA 3HJFA 3FBFA 4PABA 4DR4F 2X1AA 3LP1B 2V2VA 2J8AA 3HVRA 4DQIA 1RTIA 1SL0A 1H38A 4YQWA 4JI8J 1Q86T 1LKZA 1BQNB 2AX1A 2FHJA 2HVHA 2IPOB 4OYAA 5KAKA 2HW3A 4NMXA 4C3LA 5C42B 1R0AA 4UTGA 2O1PA 3QRRA 1N0UA 2VICA 3D0IE 1U1KA 3EICA 4PWDA 5F0WA 4MMOA 4RX6A 5T41A 2CQDA 4WP3A 3CDAA 4I6WA 4PG5A 3IC1A 4DI6A 4F4KA 4JUZA 2LP4A 1CLFA 1SQGA 3AODA 4KHRA 1UPPA 2BM1A 5ETNA 2P8IA 5IXUA 4PUOB 2HVEA 3Q22A 3TW0A 1RYRA 4UZCA 2XWXA 1RT5A 5KFGA 1S1UB 2OP5A 4DSFA 3H59A 2XTJP 1JQGA 2DNZA 4CLUA 2NUUG 1NLKL 4DSEA 2CQPA 3B54A 2ALZA 3I4HX 3MR7A 2E5HA 4PZVA 1Q5YA 1QD1A 2XS5A 5D4NA 4ECZA 1SH0A 2OPRA 5KT3A 1I94F 4EMDA 3DDIA 1JIHA 3LALA 2KZZA 1YRUA 1FF2A 1HKAA 1XJWB 4FBUA 3OVSA 2VBXA 4WE1B 2MZ1A 3CCVS 1B70B 1KD1T 3MCMA 1S99A 1TV6A 4ES3A 5K14A 3D6FB 4PAAA 3LA0A 2EC2A 1RBAA 1RHMB 4CLYA 2YXLA 4Y2CA 3P5BP 3JQMA 2AJFE 2F7VA 2UUBF 4M63A 1GX5A 2RU3A 1XBWA 5HVFA 1T05B 5L38A 3H4DA 1WOSA 2HQDA 1RDRA 2CJXB 2XY6A 4Z7YA 1VS3A 5F8MA 1B64A 4JI6J 5SUHA 2W1BA 1S6QA 1CJVB 2MKCA 4NA2A 5F9NA 4L3KA 2EK6A 1QAIA 3G86A 7FDRA 4KTQA 3O8WA 3RRHA 4B3MF 4W4MA 1B0VA 3D0GE 1S9GB 1SJ4P 4ZLNA 4CM0A 2GIQA 9ATCB 2QGFB 4DL0C 3HHNB 1S4FA 3TARA 1GFWB 1U02A 2CQ1A 4DCJB 3GJQB 2JLGA 1HQEB 4ELVA 4IRKA 4K4YA 4UY85 3JYTB 2EBGA 2FJEB 4J9QA 2F63A 3DLKB 3J7YI 2HBYB 2QA4G 2RQKA 4WTOB 3M05A 2PGCA 2QLXA 2AF6A 1JX4A 1ZM3A 2Z58B 2OIHA 2XI2A 4USHA 2QJ3A 1DQ8A 4CDIA 1HLWA 2FVRA 2IIHA 2IFXA 4LVOP 4I64A 1IKVB 1I5OB 3N9UC 4Z7CA 1U4BA 3U1MA 4V19J 4LIWA 1QLNA 3HZEA 3BS9A 2DR6A 1WDTA 2Y0SD 2ZD1A 1O5JA 3QAEA 5I4MA 3K58A 4HH1A 2ZJRQ 2Q1LA 5I42B 1S1VB 4ID5A 2W2NP 2YNGB 2GC8A 2HEKA 3TA1A 3CXCR 3ITHA 3FRZA 3FBEA 1RT7B 1UJ4A 2H3EB 5EWFA 1Y4ZB 1B4SA 2FC9A 2UV8G 4B9TA 3N0VA 4X4QA 3CCQS 3OJUA 3BO2A 3DYAA 2YWEA 3Q24A 3NGTA 3BYPA 4NLSA 2Y9HA 2V34A 4MYTA 2MY8A 1JKHA 2G2ZA 3UVJA 1HHSA 4HVZA 2ZUGA 2FJXA 1BWEA 1RAOA 3NAIA 2OPPA 2XGQA 3MI7X 2HHQA 1WHYA 2MZQA 1XIQA 4YR2A 3R7SB 3CDWA 3Q0AA 3N5FA 1WD6A 3IRXA 3LQVA 2P6TA 1N48A 1H0HB 4DQPA 2BA9A 4RUCA 1K47A 3M1VA 5L9NA 2FHOB 1F6TA 4F8RA 2OFGX 2XG8A 3T6JA 1U1OA 3CC7S 2OEKA 5GMKa 1LW2A 4E0DA 2MJNA 4UOGA 1TL7A 4DF4A 1NZ8A 1XMQJ 3KUGA 1CEZA 1OSCA 1SI9A 4ED4A 1KHVA 3WIVA 4O3QA 3IAS9 4WFNQ 2C3YA 4URQU 2M4MA 4DFPA 5D0HA 5D3GB 4M5IA 5CYJA 3MD1A 2RF2B 4WK3A 3T9ZA 5ETVA 3TP2A 2E1AA 1D09B 3HZGA 3K5LA 2ZH4A 3J7Z5 2HS4A 4EO8A 3OW2R 4LFBF 4OX8A 3U1LA 3HHLB 4J9LA 1KSPA 3IWNC 1RQ0A 2R8JA 4USVA 1NK7A 1VQ6S 4MKAA 3G82A 2GVZB 1J2VA 3R27A 3M9OB 1VGYA 1S7IA 2OMLA 4DPXA 1SKWA 3SCLE 4KE5A 2BM0A 3DLGB 4U95A 1TTHB 3N28A 4URGA 2P6SA 4DU7A 1HW9A 1EIYB 3LUYA 1VK3A 2LA6A 1RISA 3K57A 2D74B 5IWAF 5KFLA 1FRXA 1DRZA 2KG0A 3EXCX 3GR0A 3Q2TC 1YZ6A 2ACMA 2GVDB 4NCAA 1UVMA 2XMKA 1ZM2A 5HROB 2UUTA 2E5LJ 2YWWA 4DSLA 1KLMA 4DMZA 4OL8A 3I0RB 1LW0A 5KFFA 1MN7A 5IT0A 3HT0A 4FVCA 2PSZA 1AFIA 3T1AA 4IO1A 5CA5A 1GQEA 3D2WA 4LREA 3EDRB 3OR2A 3D6HB 4UOHA 2YKAA 2HIQA 5HQ8A 1RT3A 3W5YA 2HLTA 3DDKA 1M5SA 4IG3B 3ENVA 1F1BB 3LP0B 3OL9A 3GYXB 3JQJA 3NMAA 1T9UA 2D9PA 3IBCB 2DHHA 2BQUA 2N7CA 4DR6F 2XSJB 3LAKA 3GJRB 3AOBA 5EDWA 2VBYA 1RKJA 1JXEA 3BBCA 2HNYB 1FI4A 4RW7B 3T5HA 2MPUA 1X60A 1G7CB 2MJUA 5E41A 2BJ8A 3LGNA 2HVDA 5E3PA 2WB4A 4QQBA 3TOQA 4TQRA 4G1PA 4WWSA 4H54A 3JTNA 2CPFA 2KHDA 3V5RA 1HMVB 4C4WA 4XAKA 2YH1A 2UU9J 4AD6A 4KRWA 2KXHA 4RNNA 3AJ1A 1NBEB 2R8GA 1ZM9A 1TU0B 1F0XA 3UNYA 4ED0A 3MOJB 1N5TA 5LL6d 2BRLA 4A8SA 5GAEI 3G6YA 3ETOA 4XPCA 1CULB 3M2UB 3PJXA 4B17A 4O3PA 1RWMB 4DZDA 1D9AA 7AT1B 5ADZA 1HBOA 4AT1B 1Z2ZA 1OIAA 4NOHA 4K4SA 2J0WA 1XMOF 2ZJPQ 1Y5IB 2VUGA 3ENWA 1U8SA 1S59A 3VQTA 3DXBA 1SPBP 1SQFA 2K7JA 3ZTOA 5D15A 1KNZA 3AXKA 3D6MB 1GT8A 5MAOA 2AJ0A 2FLPA 2Y1LB 3OFFA 1IJEB 4Q0BA 3OFGA 4CH7A 1FT8A 3VAGA 1A0OB 3OR1A 4NWBA 3DXSX 5CAAA 3JAMU 1U6FA 3SQGB 1OO0B 1I3OB 4YP3A 4H4MB 5EX0A 3M8ZA 2G1HA 4OX6A 2W7PA 3JS9A 2KH9A 1UW9A 3M9NB 2I6WA 1UVIA 1HI1A 4FXWA 1S5ZA 3Q8YA 1R43A 5KFXA 1U1LA 3M8SA 4NA1A 4AE5A 2KT3A 1S12A 2XCAA 1F9EB 5LSRA 3EVWA 3PO4A 3WC0A 3A1YG 4I2QA 5IT9U 3KWMA 3D66A 2YQ0A 3K5PA 2PN6A 2YPYA 2KL8A 4ZCKA 1IBMJ 1PAEX 2CVEA 3G6VA 2V4RA 1HHQA 4IH7A 2EFGA 3MECB 4DV3F 3NGKA 4DUZF 2HK3A 4QPTA 2Y3YA 3L7PA 4QR2A 4ICLB 3QQCD 2JEFA 3T1YF 4IO9Q 3AQPA 1MROB 1MU2A 1JJ2R 3T5LA 3OL7A 5E2QA 3GV8B 1S97A 2MZRA 4B9VA 2NCKL 4F4WA 4B9MA 3ONQA 5HQMA 1S49A 3CE8A 4DV4F 3BN4A 3HF5A 4NCGB 3T3FA 2ZWOA 2DNPA 3SDEA 3R2CJ 4QYZJ 2YWHA 4NX9A 3DOMB 3KNGA 4J9KA 2RRBA 2XHWA 5HQLA 4B9UA 3HP6A 1Q81T 4DV0J 4FN5A 2ZE2A 1RCOB 3UDCA 3W65A 2L48A 2MY7A 5LOQA 2E5LF 5K8OA 3BJYA 4YOEA 1FEEA 2MDAA 3FJ2A 5JMNA 1NJYA 1D1UA 4QYRA 4NI2B 3NGDA 4TY8A 2KN4A 1OY9A 4DR2F 2VASA 3UO0A 1CJUB 1EJ7L 4DG1A 1RTDA 1FWPA 4Q5VA 1WTFA 4G1IA 4ELUA 3CC4S 4J90A 4LF4J 3CJSA 1V3RA 3PFOA 2BV3A 2UXCJ 2FHKA 5B0BA 4DL6A 5EN1A 1YJUA 5D4LA 2B43A 3QFHA 2LQJA 4M5GA 4YDDB 4CLZA 1G4CA 2DNYA 2PE8A 4QW8A 2KKHA 1F3VA 3BQ1A 2WSCC 2HNDB 4J91A 3PZPA 1S9EB 2RH3A 1S1WB 4KIAA 4DUYJ 1GTEA 2GW8A 1RT2A 1M5VC 3MEEA 1JJ4A 4OI3A 2UV8A 4I68A 4F04B 2K2PA 3FDSA 3P3DA 4CWBA 2JL9A 1D9FA 3PTWA 2LEAA 1HWUA 2A1BA 4YB1P 2GIFA 1A7GE 3MM9B 3AOAA 1IQTA 2F8EX 3OL8A 1WORA 1NK6A 3CCUS 3WHIA 3OTDA 5KFNA 3CIZA 1E6YB 2FLNA 2AIRB 2MZJA 3UD3P 3FRYA 4DL2A 4JV5F 2BJ9A 3QLHA 3PR4A 3QT8A 5KFHA 3D6TB 1QDUB 4IRCA 3BGOP 4F3QA 1HNWJ 4Q2LA 1HNVB 4I2PB 3R7NB 4FF1A 3FSIA 4EO6A 3P96A 5C2CA 2YTCA 4WKRA 2FY8A 4F2RA 2RDDA 2VOOA 3KK2A 2YX4A 3DM2B 3MEGB 2C2OB 1RT1B 3C16A 3MPYA 3TAMA 4J5OA 1K1SA 3T6BA 3CJKA 4K4XA 2AWZA 1HWKA 1EP4B 1JLQA 4A8QA 3BBBA 3U27A 1M5KC 1PJ6A 3FEZA 1U45A 3N79A 4HT7A 5KFZA 2R8HA 2OPQB 3NS5A 5K8PA 4YFUA 4EWTA 4NLYA 1O6XA 1N32J 1JLGB 1AZSB 5GAHU 3OSNA 3W63A 4MFBA 2VC1A 3V81B 1U1NA 3UCZP 1HNIA 2E44A 1NB7A 5LT5A 1T9YA 3DKDA 3LW5C 3HULA 4F0MA 1ZA1B 4RUBA 5KFAA 3POTB 3W9HA 3LWLA 1C2PA 1KRPA 4NE9C 1Y0HA 4FNIA 1F5CA 5DZ7A 1KTVA 2XNRA 2V67A 1ULRA 2QT7A 1IWAA 3CD5A 2NUHA 3MDFA 5C2GA 1RT4A 2W2OP 4OJ1A 4OI4A 1VFJA 3R2DJ 4OYIA 2HVZA 2BABA 4EEYA 3MCNA 3MURP 4V1Ak 1FD8A 1IQZA 5D6GA 1HQUA 3NLCA 4OZJA 2MKHA 2DH9A 3KLHB 2WSFC 3L7UA 4ZIWA 1S79A 1P9YA 2G0JA 1LK5A 1TVRA 1Y5NB 3W2VA 1RK8A 4H4KC 4WK1A 3E8OA 3MR2A 2ZHOA 2YX1A 2RQCA 2DR9A 2G4BA 4A8KA 1H6KX 4DV1J 2YKOA 1T9TA 2FC8A 1NJWA 3G4SS 2N82B 2HURA 3C3LA 3CO9A 1TELA 5L8RC 1F3FA 5B0DA 4MK7A 5A8KA 3AJ2A 4OV1A 2BDPA 4DV7J 3P4UB 3KLGB 2KJVA 2A10A 2RE1A 2F9DA 1WELA 2KG1A 2R7QA 1YBUA 2GJ2A 1RTJA 3HKWA 2XEXA 3T5KA 1OPZA 5MLCV 3D1QA 3MTKA 1UAWA 3R5DA 1JLAA 4O44B 2Z2ZA 3THPA 2YKNB 3AXMA 2BYCA 2FUG9 4QIGA 3NS7B 2HHTA 1WF2A 2MMYA 5CQGA 3GSDA 4QZVB 3LGMA 1KVKA 3FSXA 4B3SF 2JVRA 3PJWA 1TKXB 4LF4F 3LP2B 4AUKA 3MAAB 4YB6A 1FK9B 2DGWA 4I56A 2CWKA 3QJPA 5H9FK 4TLRA 1BQNA 1I1GA 4X4SA 2VFRA 4LF5J 2OPSB 4ETZA 4N5SA 1YTYA 1N36F 3EPIA 2P9GA 5C24B 3ZZPA 5KG5A 1UFLA 2DYAA 4ZVGA 4AL5A 4RNOA 1PIEA 3EWGA 3BQ0A 1UEKA 2FYXA 3CJ2A 3M6WA 1B99A 5K9FA 4LFCF 1L3SA 1U24A 2RQ4A 4ED3A 4W90B 4OI0A 1RAEB 2XC9A 3W62A 4WFZA 4PUOA 2AJQA 1DARA 5IT4A 3UD4P 2QYCA 1S1UA 4JI5J 4LF6F 2O66A 4ZP9A 1DTQB 2CG8A 3EX7B 3W3SA 4CLKA 3BGUA 1OSDA 2RIJA 2BE2B 2XCPA 2HHSA 1XMBA 2CYYA 1R8BA 2C42A 3MM6A 4MTPA 1VIXA 4R5PB 4ECVA 3B4DA 2IMOA 2HHHF 1OPIA 2GS8A 4ZVEA 3CB4A 4N7TA 4O4GB 5C7PA 4CH1A 3HX9A 5HVHA 2V50A 2BJDA 1M5OC 1RWOB 5AE1A 3A8EA 1QAYA 3PYEA 2EWHA 5HBMB 2BZ2A 2AU0A 2LVWA 2PFFB 2N7YA 5B7WA 1Q4RA 5D8HB 4H4OB 2V9WA 2QL5B 2W7AA 2ZH3A 2DCLA 3K17A 2XMJA 4JYAF 3X3UA 2J7KA 1HD1A 2B4OA 3MMCB 2E1CA 2W01A 1H3DA 3CCJS 4NPOA 2JX2A 2ZVSA 1T7PA 1XNRJ 1T05A 1X4FA 3EGVA 3A8KA 3PACA 4M94A 3NGRA 1NB2A 1FE4A 2ZC4A 2CDQA 4J37A 3CJ5A 1UVKA 1NDKA 1D8YA 4C3KA 4FYVB 1CJVA 2VPWB 5KG2A 5KG4A 3HPOA 2IJFA 4J9PA 3IWXA 3I0SB 3LWMA 1N0VC 2IC3B 3T41A 2V8PA 4FYWB 3FCVA 3HHDA 5KFJA 1S9GA 2QSWA 3GZ7A 3KK3B 1TK8A 2M9KA 4DL4A 3CJRA 1RGVA 1HQEA 4LSLB 4IFYA 3S7RA 1YBTA 3JYTA 3RZAA 3L7OA 3CCZA 3DLKA 2MGZA 4ZITA 2UXDJ 1N88A 1RT6B 1S1XB 1UVNA 3L09A 2UXBJ 3PW7A 2XZDB 1RTHB 2JWNA 2IM1A 1Q7LB 4ZPBA 2ZH8A 4X65F 1G3OA 1JXVA 1Q95G 2ZEJA 1RU2A 3J7YU 5L1IA 5SZTA 1CC8A 1U1RA 3D3CJ 2RNEA 2XNQA 4ED8A 2DO4A 2GZOA 2H5JB 4JI1J 1YRTA 5A2QY 1SC6A 1PBUA 5KG0A 3Q89A 3KOAA 4C11B 2R7SA 5CYMA 1K9MT 3QIDA 3BH6B 5I42A 2YNIA 2ZOFA 2YNGA 3MR5A 2AZ3A 4HHJA 4A8OA 3RAXA 1YJTA 1QY7A 2Q43A 3OQ2A 1UWBB 2HQIA 3ENAA 1RT7A 4IUFA 3W5XA 4ZCIA 1B0PA 4DV7F 2KXFA 4P2XA 2GQ2A 1XNQJ 5KFPA 5JXSA 3QIPB 3HHLC 2KZMA 3GQCA 2YWGA 1NCLA 4F25A 5LSOA 3QMQA 1KP6A 1NJXA 5C25A 1VLYA 4NLGA 3VVUA 2AJ2A 4LRAA 2PMWA 2AJ4A 3RRGA 2VPYB 1OS5A 3JXOA 4A47A 2GHPA 3H7HB 1T03B 4CH0S 2B9XA 9RUBA 2FZKB 3GFXA 3E01A 2CPJA 1JMTA 3RTVA 1L3KA 1N5YB 3MPWA 1FVQA 8RUCA 2PI4A 1GX6A 1L3TA 3K7RA 4FF3A 1X0FA 2YBVA 1HR0J 3GV7B 5B0AA 1ICEB 1RHKB 2E5GA 2KDOA 4PXEA 1IJFB 4EU0A 2NXEA 2NXUA 1SJ3P 2GNKA 1FVSA 1X5PA 4USKA 3PKYA 2VKZG 2J5AA 4RO0A 4RW9B 4TNOA 2DRBA 2PI5A 1FDBA 2GO8A 2GQQA 2VJVA 3G8TA 3GWCA 2YVSA 1EKSA 2V8HA 1VRUB 4M5LA 2LECA 3KUHA 1EB0A 1UZHA 3CMES 2NZ4A 3KG0A 4GKKF 1ACMB 3V4IB 1PJ7A 3PG9A 3UFCX 3G71S 4NLRA 3WBZA 3VHQA 2XYGB 4NZ7A 1REGX 5CYQA 5FLXY 4LIRA 1Y5LB 5FDLB 2U2FA 4KGKA 2FJBB 3ICLA 3BKTA 2GVZA 2EPIA 4ZOSA 1KFDA 2KO1A 5H9EK 3DLGA 2QN6B 3VR1A 2ZKUA 2CQCA 3EGZA 3OVBA 2GAHC 3BDEA 1KQKA 1RXOB 5LXRA 3ZFVA 3QT5A 3WQPA 2GVDA 3M8WA 4Y2MA 2VJUA 3MGJA 2NSBA 2FGCA 4EYHB 1X5SA 1XNRF 3EVMA 4CYUB 4F2SA 2VQEF 4FZVA 4FS2A 3OBIA 3DOLA 2RJZA 4ECTA 5B09A 2OUGA 3HKZD 1RWXB 2ZH5A 1XR7A 2CNOB 4OZ1A 3A8IA 5A6PA 4UQGA 3T1HF 2ZDPA 4J9VA 5E33A 1QSSA 1NK4A 2UUCF 1KONA 2DK2A 2HFUA 2MQ8A 2RHQB 2P9EA 1ZZFA 4U7CA 3CJ8A 2QLBB 4WFXA 2CFXA 1SH3A 5KFIA 4DCOB 1BQMA 4QOTA 4RW7A 2BVZA 1HD0A 3KLIA 2HNZA 3G2XA 1RU1A 2FDNA 5GMEA 4G1QB 2JLEA 1X5TA 1DLOB 1VQ4S 2UXDF 1XR5A 2NPIA 4Y6IA 2DR7A 1SKRA 2UXBF 3DMJB 3JSRA 1R7IA 3D28A 2ZKTA 3H8YA 1ZA2B 3MOZA 2AYMA 3MCSA 4WCEQ 3BV8A 2IVYA 1TKTA 2OELA 3D0HE 5CCLA 2RILA 4ES1A 2YY3A 4OHXA 1C1CA 2IVFB 2AYEA 2J0SD 4CO1A 3C2PA 3IMQJ 1OY8A 2PA3A 3AA8A 2AEMA 3C15A 1P8GA 4D3HA 2VHGA 1N33F 1U0SA 4USMA 1CULA 3M2UA 4IYQA 2VQFJ 4IOBA 2YWFA 3CCSS 1TFYA 3R97A 2DNOA 1T9VA 3VGUA 4HTJA 2WVEA 5JVGQ 1HBUA 2WVFA 2BW7A 2ZH6A 4WFYA 1YDLA 2A3JA 2RHSB 5E0OA 1D8ZA 4X62J 4EUVA 1XNQF 1RWNB 2QV6A 5J1PA 2DNHA 3B4MA 2EKNA 5HAOA 4PWUA 4C97A 2DNRA 5A0YB 2D9OA 3EZUA 2HFNA 2HG4A 1CC7A 3VAHA 4JI3F 2UVVA 3TZXA 2DGSA 2GO9A 4K4TA 3T5JA 4FF2A 3SQGA 2KFNA 2B8QA 3OTOJ 4KFBB 3C14A 1ZAXA 4LRDA 2E1RA 4JI2J 1C0UB 4H4MA 4DV5J 1WC1A 2B56A 2GQCA 2CQ0A 5B0EA 4CNYA 4ECWA 5A8WB 2VL1A 1C4AA 2ZITA 3Q8VA 1K73T 4R0EA 2MQOA 2HHWA 3MUVP 1UFWA 4NYPA 2ABYA 5D78A 4KYZA 1NDCA 1F2HA 1IBLJ 2KRBA 3RRKA 1RADB 5F41A 3PHTA 1V5IB 4ZKAA 3DRYA 1B7FA 2FVCA 4PYDA 4ZLJA 2EG2A 2I8EA 4RZRA 1IBKF 1D3WA 4OYOA 4YS2A 1NSPA 2AEJA 2DXFA 1HPZB 1X8DA 1E6VB 4WPAA 1SQEA 2YH0A 4ICLA 1UMJA 1W7WA 1S1TB 3NEKA 3FFIB 1UFKA 3TZWA 2WOMB 3ISNC 3OL6A 2D3UA 3HM9A 4M5DB 4DN0A 1YRXA 5KOWA 1OQ6A 2FB0A 4L72B 4LRCA 2HSEB 1HARA 4XTTA 1FFWB 1YJVA 4ZHRA 4Z37A 5DQGA 4CI0B 1QTMA 1FHTA 1U1PA 2QG9B 1Z1ZA 2ZNZA 1FJGF 4DR3J 2IHR1 3Q2SC 3GIRA 3ET6B 3DOMA 5IM0A 1J5EJ 2WVDA 2X3DA 2RDIA 3C6TB 3G6ES 4DEZA 4K4VA 2YKMB 4S0MA 2WTFA 4DV6F 1PSDA 4FNHA 3KYLA 3ENQA 1N4LA 3HI9A 4NI2A 5T7LB 4ZVRB 2CKWA 8ATCB 1D9DA 1I51B 4A8MP 2HBRB 3EJMA 1XR6A 3Q8RB 1PYSB 1V5VA 2VG6A 1UL3A 1DBDA 3FZ2A 4MIBA 2HQFA 4OZ5A 1YX2A 3DI6A 2W9BB 1WEYA 3JSBA 2HK2A 3VWSA 3N01A 4ZDNA 2BJ7A 3I5AA 1QVGR 1CJKB 4ERDA 5IC6B 1YGYA 5HI7A 1S6PA 3JTPA 4AQYJ 1S9EA 1S1WA 4HLBA 2DIUA 1AXQA 3DRSB 5U47A 1JLEA 1YJRA 2JDJA 3TX8A 4RW4B 1MLAA 3Q83A 1EHWA 3CPWR 4DX6A 3Q8PB 2DH7A 3KMQA 1NJIT 1IR0A 4IDKB 4OJGA 3HVTB 5KFVA 2IAJB 4GC6A 2ZZNA 2DEIA 2ZC3A 4F4YA 3AH6A 2C2DA 4UF4A 3SQOP 4YR0A 4DR7F 2B3TB 5KT4A 5EWGA 3JSMA 4NLPA 2YPZA 1TK0A 2YNFB 3KTQA 2IDEA 2D3ZA 1X9WA 4QJVA 4XPEA 2R8KA 4YDXA 1X4EA 4ENOA 2UP1A 2UUAJ 1M1KT 2A2DA 3KLEB 1PYOB 1U0HA 2CJQA 4OX9F 1E6YA 1FKOA 1DY3A 3IS9B 2NXCA 3NGUA 4QPXA 3CJ0A 1NHKL 1O0PA 2Q6CA 4USWA 1M5HA 2ZM6J 3ILOA 1HNXF 4I1TA 2ILYA 3I87A 2W7OA 4ANCA 3HSZA 2KT2A 4X62F 2EFPA 2CQ4A 1HNVA 4I2PA 5KFYA 4RNFA 3ZZZA 4USTA 3UE2A 3VAKA 3DM2A 1AUSL 4NLXA 1RT1A 2B6AA 2QL7B 2ZOGA 2KYZA 1QTNB 1QVFR 2C2NA 4DFMA 3CTRA 1YJ9S 5I3UB 2ZWPA 1RWKB 1KN6A 1GK8A 1WC6A 5CABA 4B3OB 2R2TA 2OPQA 4JI2F 5A76A 2PEHA 4ZP7A 4DSJA 2H48B 3J80Y 3E51A 2HBQB 1R0AB 3DFEA 1JLGA 1FXLA 2DXEA 3DCAA 3RW7A 1UWAA 3CSKA 3PV8A 2O67A 4O3RA 4PWDB 4BDPA 3MMAA 4OHYA 2FJVA 5ETPA 5T14A 3VTIA 2F65A 3POTA 4DR5F 2Z2MA 1RAJA 2BQ3A 5HSPA 3UWTA 1NNDA 2CJ9A 4DX8H 2MKKA 1RT5B 5E3CA 1UKUA 4KH1B 2B0GA 4ELTA 4DU8A 3MXHP 2Z0GA 2OHDA 5LMNJ 1H7XA 3W61A 3BDPA 2W9CA 2WVCA 2PDAA 2MQQA 4QBUA 4NLOA 2CNKB 3K0JA 2XULA 2R7TA 3AD9C 2JZ5A 3BH7B 5DZ6A 1U09A 4RUHA 4P2SA 1IM4A 2H1YA 1IKYA 4N56A 1TKZA 2M8DB 2F40A 1IBCB 3I96A 2V8DA 2X7IA 4FPIA 1R8PA 2YNHA 1WJ9A 2C3PA 2VDIA 1RUSA 5K5MA 4IOCQ 4ETXA 2M70A 3F44A 1FJ7A 3FCWA 1TV6B 2NREA 1KQGB 5K14B 2CADA 1M1HA 1DQ9A 2Z30B 3UI3A 1NUEA 5GAGU 3W9JA 4CCHA 4TN2A 1X4GA 1J5EF 3MEDB 4GMKA 4CT8A 3KLGA 1EZZB 2AV5A 8AT1B 2HHUA 2FZGB 5H1SV 3H40A 4DS4A 4M5NA 3IAM9 1BGXT 3M30B 3VZIA 3DRPA 5KTQA 1S6QB 2XMMA 2DBBA 4ZVHA 2YKNA 3IGNA 3ZZ0A 4P73A 2V6AA 4ZCLA 3LO3A 2V5HG 3DDNA 1FNOA 3QAUA 3GPAA 1ZOTA 1TKXA 1HI8A 2FTRA 2JEIA 3LP2A 3MAAA 4PR6A 3QRPA 4DV2J 5HK4A 1DTTA 1FK9A 3IRWP 2W2MP 3BGLA 2HFSA 3EGNA 3VZHA 3BYRA 3IXQA 3MHYA 4BWJA 3D1HA 2QLWA 1TFWA 3T9NA 3QT6A 1JLBB 2RKIB 1N8RT 5CD4A 5KFRA 4YMEA 4M5HA 3SSSA 3SEOA 1RABB 1Q53A 5ETKA 4F3OA 2V2KA 3CJ3A 2C2KB 1HWJA 2RVJA 1JB0C 2Y1IA 1IKWB 4UT4A 2DHAA 2WSEC 2BW2A 1YJWS 2GIRA 2XLIA 1RBLA 4Y34A 3MM7B 2CRLA 3P6YC 3KXDA 4L75A 1X4HA 3FKBA 4KKOA 2M8HA 2MHEA 1RCXB 3GP9A 3DLJA 4OZNA 2QMXA 2J0XA 2ZD1B 2OTJS 2JC1A 3ZZUA 4BS2A 1UEUA 2F1FA 2R2RA 2BE2A 4RNHA 3NRBA 4ID5B 2QA2A 5HANA 1XEZA 2E7WA 5KG6A 3IN5A 4K2XA 5M2UA 4ED6A 4B3RF 3KLVA 4X4NA 3H2UB 5AXKA 3TEHB 2EBEA 3J81Y 3DLEA 1RTZA 4PG4A 1R8CA 3UN3A 2PFDA 3IP0A 2H9ZA 3UVJB 3R9LA 1LWEB 3PRDA 2FIUA 4X4PA 5HLFA 3BPDA 2EC0A 3MMCA 3PR5B 4ZVFA 3HD2A 1Z2LA 4X66J 4LF9J 3IRXB 5DQIA 1R0BG 3AQOA 1N54B 1RA7A 3F56A 3CCTA 2W2PP 3HXMA 4QWDA 4ZLLA 4R25A 3M1VB 4NLUA 1L3VA 5DM6Q 2J76E 3I55S 4NLQA 4JI4J 1WUUA 3PX0A 4ALZA 4ZVSB 4OHZA 2RQMA 3M32B 2BQRA 4N47A 4FXDA 2UVRA 4LBHA 2IC3A 5EHHA 1SJ1A 1RWVB 2KYXA 5IQ6A 1RHUB 1V9OA 1P9QC 5KFMA 2MLXA 3LH2S 1QM9A 3DGPB 3FGVA 3IWLA 4X84A 1HNZF 4OYXA 2KHCA 4LSLA 2MHNA 4F4AA 5IS2A 2ROPA 1VBZA 3AD7C 1P27B 4FVMA 1Q8BA 1UJ5A 3DOKA 1IR1A 2HHPA 1FKPB 4J9OA 2WHOA 5LMNF 1S1XA 1T02A 1X4AA 3CD0A 1RTHA 1FNMA 3CCLS 3I82A 1FJCA 1TL1B 4HACB 2D3OR 4OZ3A 2CDRB 2Q6BA 1U8WA 3CDEA 1REVB 2XO7A 4ZCMA 4C98A 3PYFA 4TYAA 3G82B 4PXDA 3M8PB 4X4TA 1LEOA 3KG4A 3W60A 4K8RA 1FFGB 4F4ZA 2XI3A 3NBPB 4QIFA 4ZVOB 1KOHA 4ED5A 4ECYA 1WHWA 4DN9A 2XB2D 1IVZA 4KPYA 4QIEA 1YJNS 2CPZA 3MMJA 3H5XA 1CJTA 5GVQA 1PG5B 4JI0J 2CJBA 3H0PA 1RWPB 5EX3A 4Y3CA 3UR0A 3HSGA 3PEHA 4X64J 1WC5A 3TJAA 3AJDA 2G2OA 3BPSP 1LW0B 2ZHBA 3QIPA 5BYSA 4EI2A 1WNEA 5IV3A 2MKSA 2G13A 1WEZA 5AJ3J 1N6QA 2DHGA 1RAIB 3OR2B 4RW8B 5IV4A 1RT3B 3SV4A 3DLHA 2D69A 1H2TZ 4NXNJ 1RP5A 1HBNB 4D3GA 1NKEA 3LF0A 2V8GA 2BOAA 2VG5A 3A3NB 4I4BA 5I3QA 2I9SA 4FF4A 3SIPB 3Q23A 1N5YA 2CQ2A 4C3MA 4ZPVR 4C9DA 1IWGA 2IJRA 3N6LA 4GO7X 2VPZB 2CZ9A 1M1GA 3DU6A 1DFDA 4Q2MA 2ZVIA 5DG8A 2HMIA 5DM7Q 5J1EB 4Q43A 4JI7J 5KFTA 2J0QD 4RW9A 2R2UA 3M8QB 4JI8F 3GIJA 2XMVA 4DQRA 3D1OA 1AROP 5DGBA 3W64A 4FPRA 2XQCA 1JK9B 1VQ8S 3CMQA 5F3TA 1VI7A 4DDFA 2LXIA 1SIZA 3K89A 1XTZA 3G8QA 5G0RB 4RU9A 5J2NA 4CT9A 4GVBB 3RU0A 2RRNA 1QE1B 1PO6A 1HBOB 1SBRA 3C66A 2B9YA 3KK1B 3SYZA 2B9EA 2QSFA 4HT5A 1ZTTA 3OUYA 2HRYA 3NY0A 4RKUC 3C8YA 4IFVB 3KG1A 4UUXA 1NPRA 3GJTB 5ETQA 4YHHJ 1FXRA 2P5VA 4TVAB 4E8UA 4WP9A 2EEYA 3SV3A 4KGVB 1H72C 4G3IA 4DL3A 4B02A 3MMBA 1ROFA 4P74A 2NXJA 3ZZOA 2M7SA 1UETA 2GA7A 4DQQA 2DGVA 1NU4A 1YI2S 2NYIA 3QPIA 3US5A 3TO8A 5J2QA 1BWVA 5I3PA 1C1BB 4CYUA 2P2CB 2JOQA 5HJYA 4I7FA 1GXTA 3IG1B 2HS3A 3J7A1 2F4VJ 2J9DE 2DVIA 2L9DA 4ITSA 2QO3A 1BLUA 1CQMA 4FS1A 4IG0B 2OEMA 2RAQA 2VA2A 5D4OA 1ZAVA 2PD1A 2DGTA 1UTAA 3VGTA 4CO3A 4CLFA 5FJ4A 2KRRA 3GG0A 2ZH9A 4CLSA 4ILLA 4KHPJ 3CMAS 3AY0A 4FDFA 1UA0A 2GJIA 2PIIA 4NXMJ 4JI6F 1FD2A 3ZZRA 2KXNB 3M2VA 4M5KA 3D68A 2BXJA 2AGOA 2LU1A 4YEAA 1X7VA 2C1EB 1IR2A 1DLOA 2M52A 1W2IA 3EUNA 5DLGA 4F26A 1MU2B 1KVIA 4EGLA 3IA0A 2JLFA 1OYDA 3BKFA 5HP1A 4LSNA 3S6EA 3OHBA 4MJKA 1FTRA 5ETMA 1JLFB 4RUAA 3SDEB 1LXJA 2GMLA 4WJBA 4RWWA 3P5TL 1Y10A 2XGPA 1SC3B 3MPVA 2ZBCA 2ZE2B 1QSLA 2QEXS 2KI2A 3G96A 1RHRB 3HHLD 1SJFA 3U7JA 2BKNA 5HJXA 1H2UX 4CRJA 1RLDA 5LM7E 1SV5B 3R5AA 2RS2A 1YITS 4TY8B 1F5BA 1U2CA 4OYBA 5A0YA 1RTDB 2HVIA 4DR4J 2PMZD 4DSKA 1EETA 2DIVA 3DNCA 1ZTWA 5L9XA 3HCXA 3FMWA 4KFBA 1T3NA 1RJJA 2VZ9A 1I6JA 5KOXA 4RL1A 2NZCA 2ZUAA 1FCAA 2H51B 2FPHX 4ED2A 4KAIA 2E1MC 3H2LA 1F2GA 3EXYA 1K1QA 4ID8A 2QMWA 1T94A 2B4VA 2ROGA 5GADI 4RBUA 2Y0BB 4BCAA 2BBEA 1AT1B 2EXUA 4ER8A 3MEEB 3PCOB 1FDDA 3OFHA 3NCPA 1YJ7A 4XK8C 3CD6S 2ASJA 3A13A 3OSPA 3I5CA 3N4WA 2ZBRA 4JI7F 4HI1A 4B3TJ 2K7KA 2I5JA 5CHCB 4NEZA 4M95A 3QWUA 1IUJA 3QZ7A 3TA0A 2K3IA 2NYHA 5K20B 4O3SA 2Y8YA 1P1TA 3PVXA 4IOAQ 3QFWA 2CZVC 3UW1A 2R7RA 4C8YA 3RB6A 2BANB 1X0PA 3IFEA 3KDNA 1N5SA 3OFEA 1NDPA 3D67A 3OD2A 3V4MA 3GB0A 5G4DA 2B7BB 1XMQF 1S1TA 3QLHB 1N56A 3FFIA 4FYDA 4YY3J 1I94J 4JB8B 3LPEA 1J5OA 4M5DA 4NLWA 3M2RB 2X1FA 2HGLA 5EWEA 4PG7A 1BQXA 1U25A 3PO5A 1Q16B 3RB0A 4YHHF 2KT5A 2COLA 2LEPA 3MAQA 2O01C 1UVJA 1CVJA 1URNA 3C16B 1X9MA 2ZBPA 3ET6A 2IY5B 2J8SA 1VQSA 2UUBJ 2ZJQQ 3C6TA 1TL3B 4DPUA 4U7UK 2DNGA 3NAHA 1U6BA 3VGVA 1NK5A 2RS8A 2XMUA 4MFBB 4EZ9A 1S72S 2F4VF 2HQGA 4HI2A 1HNIB 2LXUA 3FBBA 1VBYA 2ROEA 1RWWB 1ZPVA 1RYSA 3CW2C 2RUGA 1L5UA 3Q8QB 6FD1A 4Q8EA 4B3MJ 3JAMY 4CZCA 2IRYA 1LWFA 4IQMA 2AKWB 3HSDA 1VISA 3KLFB 1IKXA 1YHQS 3W2WA 2DY1A 1ZPWX 5H9FJ 2GV1A 4NXMF 1V6HA 4TU9A 1RT4B 4OV6A 3MR3A 2RB7A 4M8LA 2L08A 1LWCA 1MSWD 4QU6A 1NH7A 4ZVUB 1HQUB 2VG7A 5HL7Q 3AD8C 3HVTA 5KG1A 1O8BA 1FDNA 4ECXA 3TYTA 3W2VB 5IOLA 3QZ8A 3CJTA 2XMTA 3MM5A 1LQ9A 5IT9Y 2EFNA 3ILLA 3O5TB 3FQKA 4DCPB 2H54B 1OYEA 4USJC 1IM6A 4HDHA 1UZDA 1GMUA 5A8RA 5A6WA 3RBXA 2AQ4A 4UQTA 1K44A 3IS9A 5DO2A 4W98A 3K8VA 2LU2A 1PJ5A 1FE0A 3HMJG 5IFMA 4ZJQA 1NSKL 1RTJB 2VU5A 2UU9F 2ZH7A 3KJVB 2CNLB 4J9NA 1PC4A 1NO8A 4C8OA 1K0TA 4C48A 2YQ1A 2GCFA 1RAFB 4WU3A 2XZWA 1UEVA 1VC0A 5I3UA 5ETLA 1Q8LA 4KV8A 1AA1B 2PMHA 4ZJLA 2DRAA 4B3OA 4OHVA 4G6VB 4L73A 4R8UA 1VQ5S 3CUNA 4PEOA 1JLCA 1DHMA 3WIUA 3NKYA 1UJ6A 4P9SA 3QRQA 4I69A 4P10A 3KKFA 3MCOA 3GIMA 4O23A 3ISZA 1NSAA 2QL9B 4WZQA 1CS4A 3V6DB 3I5BA 2MZTA 4LBPA 2YWKA 4Q7AA 3H5YA 3IGVA 4W92B 3AHPA 4MYUA 3R5CA 4ZN1A 4B3TF 1X9SA 4GKJJ 5BJRA 2YKPA 1LXNA 2EW9A 1SCJB 1U7LA 1TAQA 4GRSA 1RBOB 4DS5A 2RMLA 1T9XA 5DDRC 2XLJA 5HMZA 3W1YC 1B3TA 3EDQB 3TRGA 3BGRA 1SUQA 3IM9A 2N4CA 3MR6A 2LLZA 4OJHA 2OGUA 4LFBJ 1HWLA 4P6QA 1SH2A 3MM6B 2IBOA 2IDLA 2R7XA 3IR7B 4IR9A 1G6BA 1RACB 3ISND 2CQ3A 5GMDA 1NXIA 1KEKA 4QR0A 1Q1KA 3VAJA 2WAQD 4YY3F 3BREA 1H98A 2HWTA 3TANA 2JNJA 3P45B 3TUPA 1IBMF 4NRUA 2ZDOA 2DGQA 3QWPA 1X4CA 2WK4A 3W8PA 4N8NA 3GFHA 1FEHA 1SJRA 4LUBA 1HIYA 3QT7A 1TK5A 1TMMA 1ZYQA 5IWAJ 2W4CA 3JTOA 3UCUP 2GGPA 2FHMA 2XYPB 3HLUA 2MTLA 2U1AA 1CBKA 3KUEA 3A12A 2AGPA 2XHCA 3CD7A 4BC9A 3MEDA 5IZHA 2BJ1A 3R1LA 2B7CB 4JV0A 4LF7J 2MB0B 3W5ZA 3PY8A 2YQ3A 2MKYA 4PKDB 3M30A 5GAGI 5F8JA 5L1KA 2WZ1A 3QSIA 2L9WA 1H73A 2BKPA 2V4JA 1N5QA 3FMBA 4OQJA 4R0JA 1SC4B 3HK2A 1KWMA 3SSQA 4ZPCA 4DPYA 1EAYC 1RHJB 5DRKA 2CQGA 1G2EA 4NZ6A 3QBCA 3JB9k 4DV0F 4YUDA 4OYMA 1DZ5A 4DR6J 2VBZA 4C0HA 2K1RA 2ACYA 3V6JA 4G65A 1KFSA 3PNIA 3FZBA 1LNQA 4IFYB 5J2MA 1TUWA 1JLBA 5D0RA 2MZSA 2RKIA 1KC8T 5K8MA 4ES2A 4OFZA 4DF8A 2MGZB 1VBKA 2J9EA 1VC5A 3NNCA 3LP1A 4QCLA 2R7UA 2ZOMA 2UXCF 1IKWA 1M5PC 3ZZTA 2CAJA 1WEXA 4DHVA 1FERA 5CZXA 3MM7A 3BB5A 5KFWA 2ASLA 5C42A 5HMYA 1VOMA 2B51A 2C3UA 2MLZA 4DOZA 3EPGA 4DUYF 3CCES 1WHVA 2R9LA 4UY8T 3H98A 5CYMB 2XWYA 3EZOA 4HHHA 2YNIB 4QIWD 2HIYA 2MXYA 4H4KA 1DAXA 4ZVTB 4DPWA 1XMOJ 4NYOA 1TL4A 2MYFA 1AFJA 3PX4A 1APSA 1FA0A 1AB8A 4OZLA 1JJCB 5KFKA 1KS2A 1FXDA 1M0SA 2CJKA 1Y3JA 4WKYA 5KFBA 3M9MB 3TZZA 5FIIA 3RBZA 2CJAA 1KVJA 4Y2IA 3UDLA 4ZPTR 5C25B 4WFBQ 1VQKS 4C8MA 3TQEA 5J2PB 2A18A 2HPUA 2ATCB 3AB2B 2DY9A 4DSIA 3S8SA 5H9EJ 1LWEA 3VCDA 1NK9A 1RB0A 2AGQA 4X4VA 2NXNA 4KO0B 1DQAA 2HFVA 3E01B 4K5RA 2F5GA 3Q86A 2V69A 1C0TB 2VODA 4NASA 1HNWF 5AT1B 1WI8A 2AW0A 3HO1A 4WE1A 2X1BA 4BLGA 4DX7A 2HWHA 2SXLA 4KPCA 1F60B 2F8HA 2B8PA 1S0OA 2KJWA 3VAIA 4N8OA 3M32A 3BZQA 2R8IA 4U9RA 4CQ1A 3R1HA 4O3OA 4F4XA 4UZBA 2ADBA 1WOPA 3AB4B 3DGPA 1N52B 2MQPA 4GKJF 1Q8IA 1RAAB 1N32F 4PWWA 3LAMA 3IBWA 4Q45A 3O2IA 5THWA 3M7VA 3GTYX 4DV3J 2KB2A 4DUZJ 1XWLA 1FKPA 2Z2YB 3EE3A 1WTBA 4J9UE 4J7CA 5F8IA 3T1YJ 3I56S 2H65B 3J7AN 2MSTA 5CYQB 1TL1A 4HACA 1KKHA 1SC1B 1R89A 1REVA 4HR2A 4DR1J 4L3NA 2DKOB 3M8PA 4TQSA 4B9LA 2MQLA 3NBPA 4DV4J 1Q8KA 5F3ZA 2HRUA 1FFSB 1FTCA 4RR5A 3VAMA 1N34J 4TU8A 4KC5A 4WU2A 3C6UB 3G6XA 3ZNUA 3J7ZT 3HFZB 2WW8A 3R3TA 3GG1A 2N3OA 3K2YA 1X31C 5DLFA 3R6LB 1MG7A 1JNZB 4JBCA 4ANDA 4O4RA 2G0CA 3MWBA 1IKVA 4USIA 4LF7F 4DLGA 3HSJA 3D5MA 3QO9B 1BUXA 2OFHX 4J9RA 4DR2J 5KFDA 3DOLB 3UCGA 2APOA 1FRKA 4DV1F 2KM8B 1KBRA 4K50A 3I6PA 2HHVA 3SFGA 3PRBA 2DGOA 4RW8A 1S1VA 3NGSA 3HHEA 1XN9A 5HMXA 2ZHAA 4Y0FA 1HBNA 3CO0P 1SIWB 2I1RA 6AT1B 3Q8SB 3H4BA 1QSYA 4ZVPB 2V4QA 1ZZNA 4OHWA 1P1LA 2F9JA 2C28A 2JHEA 3O3LA 2XMWA 1BQMB 1NJZA 1UCNA 3OXGA 2DR5A 3QGHA 3KLIB 2HNZB 1S0VA 3BF4A 3ADAC 5J1EA 3GJSB 3CF5Q 2LQ5A 2DGXA 2MLYA 2IYIA 3M8QA 3GSIA 1H2VZ 1HYSB 2DNQA 4QWBA 1TKTB 4LF5F 4PQAA 1C1CB 4OZ0A 2DNNA 3OTEA 2XS7A 3D9BA 2RDJA 2EK1A 2JH3A 3JSYA 3A3OB 1W2BR 1T8EA 1UA1A 1GXLA 2OEJA 3K5OA 5G0RA 3C15B 4GVBA 3LGHA 1QE1A 3CDBA 4LMZA 3MM8B 4JV5J 3KK1A 2MQNA 1F9FA 2R2SA 1ZM4A 4ATNA 5LXYA 4TLQA 1HBUB 4U6PA 3W9IA 5JUMA 1A6LA 4E2FB 4C6AA 2UUWA 1RZMA 3ELHA 4IFVA 1YBAA 3A3PB 4M5JA 1WC0A 4FYXB 2J6TA 4ED7A 5D3GA 2FGOA 4MK9A 4JI5F 2DHXA 2RF2A 4ZJOA 2Z8QA 4A48A 3DRRB 3AFGA 1U26A 3PIOQ 3MD3A 5RUBA 2KVIA 3RAMA 4Y28C 2OSRA 2DRDA 2HBZB 1VQLS 4LSZB 2BEFA 1HWIA 3HHLA 4TU7A 2DPIA 2XMAA 2A6MA 3C14B 3HFVA 5AE3A 3GFYA 2BR0A 1NEEA 2CPIA 2OI2A 2WBRA 1F9HA 2DD8S 1MWQA 1C1BA 3PX6A 2ZNYA 2M88A 2LKZA 4CP5A 4KQZA 3IG1A 4EK2A 1FRMA 2QRRA 1D0EA 1FJEB 4L76A 2N3LA 4FXVA 4IG0A 5LJ5Y 2FZCB 4UW2A 3BO4A 2CJYB 5HROA 2RD5C 2C2RA 3WZ0A 1Y3KA 2CQIA 2OO4A 4WYWA 3KHLA 3FBCA 3R5BA 3I0RA 4N77A 3H20A 3GCWP 4CNZA 1HL6A 3ZTRA 3ETMA 2XS2A 1Y00A 2ASYA 2BMBA 4P52A 3ULHA 3D7SB 3IR5B 2FJWA 1MMDA 1RKIA 2FVPA 4DWIA 2MEWA 4KY3A 3K5MA 4ZP6A 4IG3A 3LP0A 2C3OA 3BO3A 5F0UA 4M1KA 3H25A 4OI6A 4PRFA 2XBPA 3BBFA 3CULA 3HFKA 5D0GA 2DISA 2XSJA 4P75A 2GMHA 3HT3A 4DR1F 1S0MA 2HAIA 3HD1A 3MUTP 2Y8WA 7FD1A 1WSRA 2NR0A 3B82A 3GR1A 1RAGB 2HNYA 4ZHRB 4KH0B 2VIHA 1TQLA 1R31A 4JOUA 5DETA 2KFZA 1JLFA 4ECQA 1OWXA 4DPTA 4LQ9A 2QFIA 1N34F 3MAHA 2HRTA 3WC2A 4OX7A 1UPMB 5IM0B 2IBKA 2QZ8A 3QYYA 1FWKA 1AUDA 3OTBA 2ERRA 3GLJA 3RG6A 1K8AT 2IVMA 2Y1JA 1HMVA 1UP1A 1XQIA 3GFZA 4Q8FA 2RU9A 3ZTSA 3FCHA 4QR1A 4ILMA 2XSFA 1MMNA 1SV5A 2CQBA 4GO5X 1VC6A 1HA1A 2HZVA 5LMUJ 4NA3A 3TEGA 4JI1F 1JNRB 2VH7A 4EBDA 4B3SJ 1EQ0A 2VG6B 2FQQB 1R8HA 4K5SA 2LXFA 1MNEA 3PXGa 3DI6B 3MPUB 2ZZMA 4LVNP 5F8HA 2V2ZA 2B5JB 4DUTA 2NLWA 1LWXA 1H7WA 1GH8A 1NZAA 5KFOA 4LFAJ 1HQ2A 2VPXB 3SCJE 4MKYA 3W66A 3OVAA 1VR6A 4K59A 1N36J 1S6UA 4HTIA 1S6PB 1VBXA 3H42A 4MH8A 2I0XA 1JLEB 3OXFA 2ZZTA 1WKKA 3TR5A 4CTAB 4NMLA 2V94A 1BXNA 3THVA 3H5UA 1S48A 5ETOA 3HVAA 4QWAA 5LJ3Y 4LFCJ 2VOPA 2LDYA 1RSCA 5GADU 3EVOA 1VQ9S 4QU7A 4NLTA 2ZH1A 5E5NA 4P7VA 4RBTA 1S7HA 2XYHB 2IRUA 2C2MB 1Y9OA 3JSMB 1Q79A 4LF6J 4OLPA 2HZCA 3TA2A 1YZ7A 2DT9A 1HR0F 4DFJA 3GV5B 3PYDA 4RWXA 4ECRA 3IM8A 2QFJA 2WONB 4N41A 3I9ZA 2BANA 1R27B 1U0HB 2J7WA 3K8WA 1FKOB 1V3SA 1PYTA 2FD2A 2KVQE 3THTA 3SZ2A 2HHHJ 2JEGA 4Y65A 1HHTP 4RW6B 3PIPQ 2R42A 2OD6A 6FDRA 3X1LB 3M2RA 2W2QP 1U48A 4HHUA 2IRXA 2CPHA 3O1LA 5AXNA 3RYLA 3MECA 2D3O1 3QGGA 2HQCA 4C8NA 4JYAJ 2B6AB 2J7UA 4TY9A 2OLWA 3TUIC 1MROA 4FKXA 2IYGA 3C19A 1TL3A 4KGXB 1GMWD 3CGIA 1VRTB 3TWZA 2HHXA 4NCBA 2POKA 1T9WA 2D1CA 1BMQB 1RHQB 3TI0A 2F3JA 3RB4A 4HL9A 5KFEA 4NCGA 2WRMA 4EZ6A 4IRDA 2H4WB 1NRKA 2DEJA 1NSQA 4U96A 1QAXA 3MMAB 3N5BA 3MFHA 1U1QA 2X1GA 4WFAQ 2MQMA 4K4ZA 2LFVA 2BE7D 4ILRA 3KMSA 4YN3B 5F8LA 1WG5A 4AXIA 2W8LA 3LANA 3KLFA 1FRIA 3UN5A 1CJUA 2GHWA 5KFSA 4XIUA 2QMUB 1H74A 2HYIB 2JVOA 1Q78A 2W9CB 3TJ9A 3SBMA 3WDOA 4RJVA 4Y00A 5KT7A 4X65J 1LK7A 1IKYB 3L3CA 1TKZB 2AHOB 4MKBA 4IQXA 4E98A 1JXLA 4A46A 1BHNA 4K0KJ 2HAFA 1NKBA 3Q8UA 2HNDA 1WG4A 3TNVA 2QX0A 2YNHB 1NHUA 3FEXB 4TKTA 5DJBA 1RA6A 1VMBA 3F0NA 3DU5A 4C0BA 1XERA 1W25A 5JJBA 4O0IA 3CCRS 3R8YA 1HBMB 1SKSA 2HFOA 3OJSA 1FDAA 1PILA 2AMCB 4NEYA 5ITHA 1VRQC 2NS1B 1BE4A 1UW4A 2DPJA 2F8MA 1SB6A 3PJ9A 4WTYA 4P2MA 4A8WA 3OLBA 2ADCA 3G8SA 2CPEA 3R6GB 1X4BA 3MM9A 4QYZK 4L74A 4BWMA 3DRPB 4PQUB 3E2EA 5DS7A 3PKMA 1KHWA 3KJVA 1YG0A 2VC0A 1ZAWA 2Y1RI 1BD6A 3RR7A 2DXDA 5LMUF 3HHKA 4NRTA 4MAKA 5K8NA 3W8GA 1HFEL 3CEDA 3RR8A 2VQFF 3ZXWA 4MIWA 2A6OA 1DTTB 2QIFA 3MTJA 1ZBTA 2IJNA 5AXLA 4EBEA 1ITPA 3UQSA 3FK4A 4PXCA 2IM3A 1Q82T 4LFAF 2QE5A 2E9ZA 2G1DA 2HQ3A 2HFZA 2CXEA 2GMJA 1FX2A 4ZMMA 4I6YA 2HLUA 2FJAB 3RBDA 3MEGA 2VV5A 2E9RX 1S76D 3V6DA 1RTIB 2PC6A 1EP4A 2LA4A 5KFCA 3EMTA 1YQHA 5CD4H 3OTOF 3DN9A 3P8BB 4LR8A 2C3MA 2RRAA 4DV5F 5BYQA 4M5MA 4KKOB 1AZSA 1U1MA 2FVQA 1Z4UA 4KGMA 3V81A 3FNNA 4GKKJ 3TQ1A 4DZ6A 4WBFA 1NKCA 1S57A 3ILIA 5J1NA 1VIOA 4A4JA 4I67A 2DITA 4PYAA 1S10A 3RBEA 5L46A 4CLLA 1FRJA 2C2EA 1IBLF 1L3UA 3D4JA 4HDGA 4O0NA 1P6TA 1VYAA 1Y7PA 4WXWA 3WX4A 2XO6A 4DQSA 2HGMA 3AAWB 5DDOC 1TL5A 5BYRA 4NL5A 2B4PA 3M6UA 2VFVA 3ILJA 4LF8J 1RI7A 2JSXA 3DLEB 5A2QU 2NSCA 5KG3A 3CT9A 3J81j 2M2BA 2Z2LA 4PPZA 3BSNA 4WYLA 3TUJC 5HLFB 3IO1A 3SCKE 3KLHA 2OPRB 5AXMA 4JP8A 2I38A 4FKYA 1WKLA 1U49A 2LEBA 3K5NA 1AW0A 2VQEJ 2V68A 4ECSA 3OPKA 1Y11A 5EUHA 1VK8A 3TJ8A 1PAUB 1LFPA 1TAUA 3I32A 1NAQA 2QA1A 4DR3F 3V2UC 3T1HJ 2EG1A 1O51A 3LPYA 2PEBA 3CCMS 3KHHA 2JFKA 5HMWA 2UUCJ 3FEYB 2Z4PA 3NS6A 1S0NA 5CCMA 2JRSA 4ZIVA 2W25A 2W4PA 2MKJA 2A2CA 2O5DA 2FHJD 3CC2S 1WG1A 4LRFA 1FNXH 2LQ9A 4C2MA 3PW5A 4O44A 2L3MA 1EX8A 1TZ0A 5DQHA 3ZO7A 5DG7A 4KSEB 1J27A 2OMOA 3DOKB 2XZTB 1R6VA 3IBFB 3BSCA 2HS0A 3GYNA 2QC3A 1WI6A 4ZP8A 2IM2A 4PG8A 3S01A 4YR3A 1R6YA 4OLOA 4CLPA 3BN7A 4KBIA 2D41A 4EYIB 1W26A 2OPSA 1GAOA 4O3NA 4K0KF 5LSLA 1YLXA 2I2YA 3DLLQ 1EARA 4AQYF 3MEKA 3SCIE 2VD3A 2D7SA 2AEFA 1R8AA 5ETTA 1BY9A 3TVYA 5C24A 2HZAA 4LF2A 1N33J 4RPFA 1U2FA 2IA0A 4F67A 4F3MA 2MKIA 1CJTB 4UOFA 3SI8A 2J6SA 1M90T 4OYPA 3MFIA 5FLXU 2BOPA 1NH8A 2KFYA 4CLTA 1MMLA 3ZNJ1 2E5IA 3KJNB 2CPXA 3JQKA 2BJ3A 3M8RA 3I4PA 3U02A 2V63A 1TKDA 3CNQP 3QJLA 2OSQA 2GHVC 3R7BB 1DTQA 4ZPAA 3MPDA 2E66A 2C2ZB 4QW9A 2PA8D 4DJBA 2W9AA 3NWGA 3P49B 5CZVA 1N6QB 3GU0A 2UVUA 1FRLA 4JI3J 5J2PA 3G9CA 3M4XA 2UUAF 5E3RA 2CNNB 1VQPS 4FBTA 3ITHB 1CSJA 4R5PA 1KQFB 4MKVA 5HN0A 2KTQA 3M6VA 3K59A 2QYGA 4C0OC 2VG5B 4KO0A 2LDIA 4PXBA 2BX6A 1VJWA 2E7VA 2Q66A 3D54A 4O4GA 1SXLA 3DYAB 3QATA 1WF1A 4LT6A 2N4DA 2ZM6F 1C0TA 5HBMA 3GILA 1RE1B 4UUWA 3UNGC 2VF3A 2PO4A 5D0EA 2VFTA 3BR8A 4DX5A 1JJHA 4X4UA 4H4OA 1WACA 1JKHB 3CJQA 4CO0A 1VQMS 2HMIB 2ZH2A 3UD5A 3L95X 3PYGA 3NCQA 2L9NA 4CO2A 2E1PA 2KM8C 1K0VA 2OPPB 2ATLA 2BE9B 1QUVA 4DLEA 1X4DA 2ALYB 2CWXA 5DDQC 3V6HA 2JJ4D 2DCUB 2AP6A 3BSAA 3NXZA 4A8YA 1IBKJ 3O6QA 3CIMA 2E5JA 1ZS6A 5CH7B 2IA6A 4QIVA 5J2NB 5IC4B 4DXLA 2XY7A 3HJVA 3DRXA 1LW2B 3F41A 1TL7B 3I0SA 3OXLA 4LRBA 4F7VA 2DHSA 5DG9A 2E29A 3ZZYA 4CO5A 3CCWA 3KK3A 3OUYB 4AL7A 3NNAA 3PM9A 4U8VA 4BC7A 2VBWA 5F8GA 4LF8F 5L1LA 1WWHA 3GCXP 2JFDA 4LQ3A 1FJGJ 2QA4S 2BRKA 4TYBA 2RSQA 3NMRA 2VONA 3GYGA 3MMBB 5E3AA 1CQNA 1RAHB 1YWXA 1RT6A 2DB1A 5B08A 4ZPWR
chains in the Genus database with same CATH topology
3M9NB 4OX9F 1E6YA 3PNIA 1FKOA 3FZBA 1BC6A 3C6UA 1S9FA 3DHXA 4IFYB 3IS9B 5J2MA 1JLBA 1UVIA 2MZSA 1RWUA 1HI1A 1URRA 4QPXA 2LYVA 4FXWA 2RKIA 1KC8T 5K8MA 4HEA9 4ES2A 1R43A 3CJ0A 4OFZA 2MGZB 4DF8A 1O0PA 2Q6CA 2J9EA 4OI1A 5KFXA 1VC5A 5J2QB 3M8SA 3F73A 1U1LA 3LP1A 3NNCA 4QCLA 1M5HA 4NA1A 4HKQA 2R7UA 1CG2A 4AE5A 1HNXF 4I1TA 2ILYA 3I87A 2W7OA 2KT3A 2KT2A 3QO9A 2EFPA 2CQ4A 2ZOMA 1HNVA 3ZC4A 4X62F 2XCAA 3KHGA 2UXCF 4I2PA 4I7FB 5KFYA 4RNFA 1IKWA 3ZZZA 1M5PC 3ZZTA 5LSRA 1WEXA 3UE2A 4MIAA 4DHVA 3VAKA 1FERA 3I31A 4P7TA 3PO4A 5CZXA 3WC0A 4C11A 3VWSA 3A1YG 4I2QA 4U67Q 3MM7A 4HH0A 3BB5A 3KWMA 5KFWA 3DM2A 1VQYA 4NLXA 3K5PA 2PN6A 3NP5A 1RT1A 2B6AA 2ASLA 5C42A 4NLVA 4ZCKA 2ZOGA 4FP9A 2KYZA 2UZAA 2OD4A 5HMYA 1QVFR 3GIKA 2CVEA 3G6VA 2BJEA 4DFMA 3CTRA 1VOMA 2B51A 2C3UA 2V4RA 1YJ9S 1UWBA 4DOZA 5I3UB 4ECUA 3EPGA 4DUYF 2J9DA 1KN6A 3CCES 1KLMB 1WHVA 2R9LA 4UY8T 3N6NA 2DNMA 4IH7A 2EFGA 4B3OB 2W4DA 3MECB 2R2TA 2OPQA 4JI2F 4DV3F 3NGKA 2PEHA 3H98A 2XWYA 5CYMB 4ZP7A 4DUZF 4DSJA 4QPTA 3J80Y 3SFUA 2C22A 3E51A 2YNIB 3L7PA 4QR2A 4QIWD 4ICLB 1R0AB 3DFEA 4RBVA 2MXYA 1JLGA 3IR6B 4H4KA 1ZETA 1DAXA 2MSSA 1FXLA 2JEFA 2E9TA 4NYOA 1TL4A 2MYFA 4IO9Q 3T1YF 1AFJA 3AQPA 3PX4A 3M2VB 1APSA 1MROB 1MU2A 1JJ2R 3T5LA 3DCAA 3RW7A 1FA0A 3CSKA 3PV8A 2O67A 4O3RA 3OL7A 5E2QA 1F5AA 3GV8B 4PWDB 2DR8A 1S97A 4BDPA 4OZLA 2MZRA 4B9VA 2EI5A 4F4WA 3EYZA 3MMAA 5KFKA 4B9MA 4OHYA 1KS2A 3ONQA 5T14A 2FJVA 1FXDA 1M0SA 2CJKA 1Y3JA 1T03A 4WKYA 3VTIA 3OTCA 5KFBA 1S49A 3CE8A 3POTA 3M9MB 3M6XA 4LJMA 3KHRA 5FIIA 4DV4F 4DR5F 2CJAA 3CDUA 1KVJA 2Z2MA 4Y2IA 2F4VF 3UDLA 4ZPTR 4DV2F 1RAJA 1SJQA 5C25B 2BQ3A 3BN4A 4WFBQ 1VQKS 3HF5A 4C8MA 4NCGB 3UWTA 2CIMA 1NNDA 1WF0A 3T3FA 1HYSA 2K8GA 5J2PB 2DNPA 2CJ9A 2A18A 2HPUA 3SDEA 4DX8H 3VALA 4CIOA 3AB2B 2MKKA 4KHMA 4QYZJ 2YWHA 4NX9A 3KNGA 4J9KA 5HP1B 3S8SA 4DSIA 5H9EJ 1LWEA 1RT5B 4LSNB 3VCDA 5L39A 1NK9A 2RRBA 3PHEA 3O44A 5E3CA 2XHWA 1UKUA 2AGQA 2V0NA 4X4VA 4KT0C 3S1TA 2G9OA 3HP6A 4B9UA 1Q81T 3RW6A 2B0GA 4FN5A 2ZE2A 4KO0B 1DQAA 4ELTA 3E01B 4K5RA 3UDCA 2L48A 2MY7A 4OJ3A 1OQ3A 2OJ3A 2E5LF 5K8OA 3MXHP 3BQ2A 2Z0GA 1GTHA 1H7XA 3BJYA 3BDPA 2W9CA 4YOEA 1FEEA 2PDAA 4PG6A 2MDAA 3TAQA 3FJ2A 2MQQA 4QBUA 4NLOA 1NJYA 1D1UA 1C0TB 2VODA 1IXKA 4QYRA 3K0JA 1HNWF 1WI8A 3NGDA 2XULA 2AW0A 2R7TA 3HO1A 2VKRA 4WE1A 2JZ5A 3MM8A 4QWCA 2X1BA 4TY8A 2KN4A 1U09A 4DR2F 4RUHA 4P2SA 2VASA 1IM4A 1IKYA 4IH5A 2FY1A 1KLNA 4DG1A 5DDPC 4N56A 1TKZA 1RTDA 2M8DB 2F40A 2HWHA 4Q5VA 2SXLA 4K4WA 1WTFA 1F60B 1SL1A 4G1IA 4GC7A 4AYBD 4ELUA 2F8HA 3I96A 2ILZA 3U1NA 3CC4S 5GAEU 4ZS6A 1V3RA 3PFOA 1VRUA 2BV3A 2V8DA 1S0OA 2KJWA 3VAIA 2FHKA 5B0BA 4DL6A 4N8OA 5EN1A 1R8PA 1YJUA 3M32A 2YNHA 5D4LA 3W7BA 3BZQA 3TUZC 2B43A 2C3PA 2IMWP 3PW0A 2LQJA 2R8IA 2V9KA 4YDDB 4U9RA 4CQ1A 5K5MA 4IOCQ 3R1HA 4ETXA 2M70A 2DNYA 4O3OA 2PE8A 4J9SA 3F44A 3V4IA 4F4XA 1FJ7A 2ADBA 3H5SA 4QW8A 1TV6B 2NREA 1KQGB 3DRRA 4PCQA 2KKHA 3BM7A 5K14B 3AB4B 3BQ1A 2WSCC 3DGPA 1N52B 2MQPA 1EETB 4XDDA 4GKJF 2HNDB 1DQ9A 1WHXA 3PW2A 3PZPA 3UI3A 1S9EB 2RH3A 2V8VA 3GE9A 1Q8IA 5GAGU 1S1WB 1N32F 4CCHA 3LAMA 3IBWA 4ED1A 4TN2A 4KIAA 4Q45A 3O2IA 5THWA 2W24A 1GTEA 1X4GA 1J5EF 2GW8A 1RT2A 3MEDB 1M5VC 4GMKA 4CT8A 3KLGA 3E3XA 2AV5A 2KB2A 1KOOA 4WF9Q 2HHUA 5H1SV 3H40A 5FDLA 3MEEA 2L41A 5D77A 4DS4A 1XWLA 3IAM9 1JJ4A 4B9SA 1FKPA 1MWZA 1BGXT 4OI3A 3N6MA 2UV8A 3M30B 3VZIA 1WTBA 4I68A 5F8IA 3DRPA 5HO4A 5KTQA 1S6QB 2XMMA 4MK8A 2K2PA 3FDSA 2DBBA 1NK8A 3I56S 4ZVHA 2YKNA 2MSTA 5CYQB 3IGNA 3P3DA 1MWYA 1TL1A 2JL9A 3LOUA 1D9FA 3ZZ0A 2LEAA 1VQ7S 1FO1A 1HWUA 2A1BA 1R89A 4Q0BB 1REVA 4ZCLA 4YB1P 3LO3A 2V5HG 3DDNA 1A7GE 4L3NA 1FNOA 2B9WA 3QAUA 3OR1B 1TP7A 3M8PA 3MM9B 4TQSA 1IQTA 3SMZA 1ZOTA 1TKXA 4B9LA 1HI8A 2FTRA 2MQLA 2JEIA 3LP2A 3NBPA 2F8EX 4PR6A 3OL8A 2ZFHA 1DTTA 1NK6A 1FK9A 3MUMP 1X5OA 2I5JB 5F3ZA 2HRUA 3IRWP 1FTCA 3BGLA 3CCUS 3VAMA 4TU8A 4X66F 3OTDA 3EGNA 4KC5A 3VZHA 4LF9F 2M3DA 3IXQA 5C5JA 3MHYA 4BWJA 5KFNA 3CIZA 1E6YB 2QLWA 3D1HA 4JV2A 4WU2A 1TFWA 2E7XA 3C6UB 2CZ4A 3T9NA 2FLNA 3G6XA 2MZJA 3RB3A 4I0WA 3NCRA 3J7ZT 3UD3P 2WW8A 4YB5A 3FRYA 1JLBB 3R3TA 4DL2A 3GG1A 4JV5F 3QLHA 2N3OA 3PR4A 3K2YA 5DLFA 2RKIB 1JNZB 5KFHA 1N8RT 4JBCA 5CXTA 4Y2KA 5KFRA 4JI4F 4YMEA 2O3DA 3SSSA 2P9CA 4O4RA 3SEOA 2G0CA 4N76A 3MWBA 1IKVA 1Q53A 4USIA 4IRCA 4LF7F 4F3OA 4DLGA 2V2KA 3CJ3A 4F3QA 2M0GB 3D5MA 3QO9B 2RVJA 1HWJA 1HNVB 2M5YA 4Q2LA 1JB0C 2OFHX 4AL6A 4I2PB 2Y1IA 5KFUA 4J9RA 1IKWB 4DBQA 5KFDA 3DOLB 4FF1A 3UCGA 2APOA 2DHAA 3FSIA 4BHQA 2ASDA 2WSEC 1FRKA 1XK8A 4EO6A 4DV1F 3P96A 2KM8B 4K50A 1MW7A 3I6PA 2BW2A 2HHVA 1YJWS 1ELOA 1JWWA 4Z2XA 2GIRA 2YTCA 2R7OA 3SFGA 2XLIA 4I2QB 3PRBA 4Y34A 4WKRA 3MM7B 5M2PA 4F2RA 2VOOA 3DC2A 2CRLA 2YX4A 3KK2A 3DM2B 1J5OB 1LOUA 2DGOA 3P6YC 3MEGB 4RW8A 3BSOA 1X4HA 1S1VA