2AD9A

Solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
GDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords 5'-R(*CP*UP*CP*UP*CP*U)-3'
publication title Structure of PTB bound to RNA: specific binding and implications for splicing regulation
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ad9A00
2KG0A 4FXVA 2CQIA 2AYGA 2YTCA 2M7SA 3UD3P 1U1OA 1K8AT 1H2VZ 1QVFR 3BO3A 4Y0FA 1WHXA 2QEXS 2DHAA 1WHVA 4IO9Q 2MHNA 2JVRA 1SJQA 1ZZNA 2U2FA 1KQSR 2KXFA 3P5TL 3TYTA 2KRRA 2DO0A 1X4BA 1WEYA 2CQBA 5MLCV 4BS2A 1UFWA 3CMAS 1CVJA 5CA5A 4IUFA 1FT8A 3FEYB 2MKSA 2X1GA 2YH1A 1U1MA 3CMES 2MY7A 1KD1T 2FPHX 1VQOS 2GO9A 1JJ2R 1YJNS 1X4HA 3K0JA 1H6KX 3VAKA 1AUDA 2MKJA 2LEBA 2HZCA 2MGZB 1OPIA 5DM7Q 3CCMS 2CQ4A 1SJFA 3U1MA 1FJEB 1D9AA 1HD1A 2KRBA 2DNKA 2J76E 2M9KA 2D3OR 3NS5A 2RUGA 1M90T 2CQ0A 3H2VE 4LMZA 2DNQA 2LA4A 1Q81T 2DNMA 1JMTA 2ERRA 1QVGR 2BOPA 1VQMS 3UCGA 5DDQC 4PKDB 5IM0A 3CCES 4QQBA 5GVQA 2I2YA 2CQHA 4C7QA 1JJ4A 2DGSA 2O3DA 1HD0A 2HGLA 1M5KC 3JB9k 2DK2A 2RNEA 1YWXA 2DITA 2L41A 3SMZA 5D78A 2CPHA 1RK8A 1VQPS 2M8HA 5D77A 2FHOB 3MUVP 2LKZA 2OIHA 2M52A 3CCLS 3ULHA 1VQLS 2MY8A 3S6EA 1XN9A 5DDRC 2XS2A 2F3JA 2K3KA 3P3DA 3Q2SC 4TLQA 2CQ2A 4F25A 2Q79A 2RU3A 1WF1A 2KG1A 2MYFA 5JVGQ 2A3JA 3EGNA 4WCEQ 3CXCR 2KT5A 4P6QA 3CPWR 3PIPQ 3S8SA 3CC7S 2NZ4A 1FNXH 1JJHA 2RT3A 2DNYA 2LQ5A 1S79A 3ZZYA 1M5OC 2MSSA 4EGLA 4IOCQ 1X5PA 3CC4S 3UCUP 1S72S 3FEXB 3G6ES 1R8PA 2G4BA 2KI2A 3NNCA 3DLLQ 2CPJA 4ZKAA 3HI9A 3IWNC 1OIAA 3MXHP 2MXYA 1SJRA 1P27B 1L3KA 1SJ3P 2AYMA 5LXYA 3HHNB 1G2EA 2DB1A 3SDEA 2MB0B 2MKCA 1U6FA 4W92B 2QA4S 1YJ9S 3L3CA 3CF5Q 3G71S 2MZTA 2MQOA 1U1RA 2MJUA 1BY9A 3UE2A 2CPEA 1VC6A 1X4AA 2BZ2A 3P49B 3MURP 2ZJQQ 3G9CA 2X1FA 4WKRA 5GAHU 2HVZA 4QU6A 2E5JA 4ED5A 1H2UX 2DIUA 1Q82T 1WF0A 1W2BR 2MZSA 1ZZFA 1NO8A 1U1NA 2DNNA 2J0QD 4WFNQ 2EVZA 3US5A 1YHQS 2KYXA 1DZ5A 5LXRA 1KOHA 5DM6Q 3I56S 2KVIA 1HA1A 2M2BA 2CPDA 3MDFA 1VQ5S 4CQ1A 3MD3A 1YTYA 2KN4A 2LXUA 1FXLA 2MZJA 2DH8A 3G4SS 2G1DA 5HO4A 1HL6A 4TU8A 2DH9A 2OTJS 2OJ3A 1A7GE 2CPFA 1WG1A 4W90B 3V4MA 2LCWA 2DHSA 2KHCA 2M70A 4LIRA 4OZ1A 2DH7A 3J7YU 3BO2A 1DHMA 2I38A 2UP1A 3MUMP 1N54B 2M4MA 3LPYA 3B4DA 2B0GA 1U1QA 2ZJPQ 2X1BA 2MQPA 4WIIA 2VODA 2HYIB 3G8TA 5EN1A 3CCRS 2AD9A 1X4DA 2JWNA 5GAEU 3MUTP 3MD1A 4A8XA 2CQ1A 2LECA 2N3LA 2LXIA 2DGXA 3EGZA 2DGVA 3DXBA 2DISA 3SDEB 5ITHA 2MKKA 3VF0B 2M0GB 1VBZA 1IQTA 3MOJB 2QFJA 3G8SA 1O0PA 2XNQA 2ADCA 5BJRA 1M1KT 1VQ8S 1K73T 2CQDA 2MJNA 1Q86T 1YI2S 3VALA 4FXWA 2KXNB 3PIOQ 1F9FA 1U6BA 4WF9Q 2YH0A 2LA6A 2U1AA 1WEXA 2M88A 3CTRA 4CH0S 4C0OC 2RQ4A 5LJ3Y 2DIVA 2K8GA 3RW7A 2RS2A 1WHYA 2PEHA 2SXLA 2KU7A 1FO1A 4M5DB 1FHTA 2E5GA 2MSTA 4QU7A 2MZQA 2RVJA 2XSFA 2KFYA 2MMYA 2CJKA 5CXTA 3ZZZA 3VAHA 2L9WA 5FJ4A 2YWKA 1WG5A 2ADBA 1N52B 4RU2A 2V94A 3S7RA 2MQLA 2KM8C 2GHPA 1ZH5A 1X0FA 2CPZA 3CULA 3CC2S 3CCVS 1WTBA 3N9UC 1OWXA 1URNA 1FJCA 2CQ3A 2D9OA 2MKIA 2DGUA 2AYBA 1VBYA 2DNOA 4YUDA 5GMKa 1X5SA 1WEZA 4TU9A 3G96A 3CCJS 4F02A 3BEGB 3SXLA 4C4WA 2VOOA 5IM0B 2NLWA 1X4GA 2DHGA 1UP1A 2YKAA 2CPXA 1WWHA 2J0SD 2LYVA 4ERDA 1NJIT 1VQ4S 1U1PA 5IQQA 2X1AA 5LSOA 2DGTA 2L08A 3R1LA 3BO4A 1B7FA 1VBXA 2JRSA 2LEAA 2M8DB 1YITS 4CH1A 2XNRA 2RQCA 1QM9A 2FC8A 4WFAQ 3Q2TC 1VQ9S 4PR6A 2XS7A 2OTLS 1VC5A 1UW4A 4QPTA 1PGZA 3CCSS 1UAWA 5IFMA 1X5OA 2RRAA 1YIJS 3CD6S 2CQGA 2MQQA 2DO4A 3I55S 2DNZA 1R8HA 2DHXA 2F9DA 2KH9A 1PO6A 2N7CA 2DGOA 4U67Q 3OW2R 4V19X 1SXLA 3UD4P 4J5OA 5DETA 1WELA 2F9JA 2EK6A 5GADU 3P6YC 2N3OA 3EX7B 2DNLA 3H2UB 2KM8B 2G0CA 3D2WA 4UQTA 2CQCA 3BS9A 1VQ7S 4Z2XA 1X5TA 3S01A 3CUNA 1WG4A 3U1LA 1U2FA 3VAFA 3R1HA 3NNAA 1X4CA 5LJ5Y 2RRBA 1U1LA 1U1KA 2CPIA 1M5PC 2MPUA 5DDPC 2MQMA 2PE8A 1KC8T 3LQVA 3J7ZT 5GAGU 3MI7X 2XB2D 2HGNA 3IRWP 2AYEA 2DNPA 2WBRA 1VC0A 2CPYA 3RW6A 2DNGA 3R27A 2J8AA 2KXHA 1FJ7A 1VQNS 2RS8A 4TU7A 5CYJA 3CCQS 3VAGA 2MZRA 1KOOA 2XS5A 1VQKS 1WF2A 1D8ZA 1WI6A 2DNRA 2OSQA 2D9PA 3THPA 2MGZA 3UWTA 4Y00A 3VAJA 3NNHA 1X4FA 4PRFA 1NU4A 2N82B 1X4EA 2CQPA 3CCUS 1OO0B 1N88A 4OZ0A 2JVOA 2HGMA 5HL7Q 1Q7YT 1WI8A 2MQNA 3THTA 3NMRA 2MKHA 1RKJA 2OSRA 2E5IA 2DGWA 4LJMA 3UCZP 4YOEA 4YB1P 3NS6A 2FY1A 2FC9A 2DNHA 2VONA 2LMIA 3TP2A 2ZJRQ 3VAIA 2E44A 4CIOA 1A9NB 3TO8A 1N8RT 1K9MT 1M5VC 3B4MA 4IOAQ 5DDOC 2JX2A 4F26A 5JVHQ 5LSLA 1VQ6S 1DBDA 1DRZA 2DGQA 2VOPA 2E5HA 3VAMA 1H2TZ 4WFBQ 2MZ1A 1WHWA 1YJWS 1SJ4P 4UY8T 2EK1A 1P1TA 5H1SV
chains in the Genus database with same CATH superfamily
4ECRA 4CLZA 4CI0B 4Y0FA 4ANDA 2F8EX 4DPOA 1UVJA 3MM8A 4KHPJ 2A6MA 2UUAJ 1LKZA 2HURA 4U8VA 2ZHBA 6FDRA 5IS2A 3RB6A 3CMES 4ED0A 2BYCA 1S9EA 5DM7Q 3G82A 1IKVB 3LALA 4MJKA 4KRWA 1HNZF 4LMZA 2ZOGA 3FUYA 2ERRA 4DR2J 3H59A 3B78A 3MEEB 4PKDB 4UOFA 1ZOTA 4C3LA 1V3SA 2ZM6J 1KEKA 4IQXA 2F5GA 2OPSB 3DRXA 4KH1B 3DYAB 2HNZB 2G13A 2LKZA 3I5AA 2HQDA 4QR2A 4RW9A 3RAXA 3ULHA 4MK9A 5B09A 4U7UK 3S6EA 5DDRC 4I2PB 4DUYF 2RKIB 2WVEA 1JJCB 3Q2SC 5E3QA 2FB0A 2R7RA 3PIPQ 2WHOA 2IVYA 2VQEF 5D4LA 3QZ8A 1RTJA 3TEHB 3JAMU 3Q0AA 3KWMA 5E5NA 4FKYA 3UCUP 2B56A 2LDIA 2HBQB 4OV1A 2BX6A 1JLFA 3NNCA 4IDKA 2KFZA 5KOWA 5HJXA 1DURA 1UZHA 3IFEA 4FYVB 2MB0B 5AXMA 3CF5Q 2UU9J 2MZTA 2Q6BA 2CPEA 2BZ2A 1FKPB 1RBOB 4HYKA 4TNOA 2YWWA 3GONA 3QRQA 1FDBA 5KFTA 5F0WA 2F4VJ 4WP8A 1GTHA 4IQMA 4HHUA 5I3UB 1RWOB 4KBIA 2RIJA 3FBBA 4NCAA 1DQ8A 1FXLA 2QC3A 4J9MA 2XZTB 1VIOA 2DH9A 2AJ4A 3OTEA 3HVTA 4CM0A 3ZZRA 5E2QA 2ASLA 3Q8YA 1DLOB 3R7BB 1RTHA 2I38A 2FJDB 2YNFA 3B4DA 2JOQA 2XQCA 3GFYA 2VODA 3L4BC 2JLGA 4CLWA 3GFZA 4RWXA 5FLXY 1W2IA 2N3LA 3H8YA 4LFAF 3R3TA 2DGVA 1OY8A 3VF0B 4M94A 3ILJA 2LQ9A 2DEIA 2IBKA 2V4RA 2MJNA 3N01A 4ZCMA 4RUAA 3OTOF 1OYDA 5HBMB 3B6BA 1RT7B 3BGRB 3MMJA 3HHLA 2PEHA 4WP3A 4M5IA 4LF8F 1N56A 1P9YA 3N6NA 3DFEA 3VCDA 2XLKA 3FGVA 3BQ2A 3RBEA 4GKJF 4DI6A 3DRSB 4DN9A 4NI2B 5DQHA 2DNOA 3BV8A 4IO1A 2GIRA 1TUWA 1HNWJ 1ZYQA 1Y4ZB 4DBQA 3BDEA 1F0XA 4ERDA 5IQQA 2VDIA 3IRXB 1NB2A 2AZ3A 4NASA 1RCOB 2YKOA 3EPGA 3IBWA 4N76A 3QBCA 2QL5B 3EJMA 2H51B 1XBWA 1VC5A 1UW4A 2HZVA 3WDOA 1UKUA 1UVLA 4JI8F 2N7CA 2FY8A 3IWXA 1RAEB 1FNOA 2ASDA 2P9CA 3CDBA 1VLYA 4M5NA 4ES3A 2BJDA 3KYLA 5ETRA 1SUQB 2EKNA 4FYWB 4H4KC 2WAQD 2MQMA 1CC8A 2PE8A 3J7ZT 5GAGU 1J27A 2DNPA 2FJXA 2UXDJ 4BBYA 1VQNS 1L3VA 2XS5A 7AT1B 2QJ3A 3M1VB 3C8YA 1B4SA 4B3OA 4RBTA 2AEFA 4X84A 4BHQA 5DQIA 1Q1KA 5IOLA 2ZJRQ 4Q0BB 2IY5B 1K9MT 5K20B 4KFBA 4UT4A 4IOAQ 2KDOA 5D3GB 2DD8S 4IH6A 1QTMA 3O2IA 3SSRA 4Q7AA 3THVA 4LRAA 2EFOA 3MM6B 2HHWA 5U47A 2AGPA 2AYGA 3RRGA 1N33J 3IM8A 3ENAA 4KYZA 3ENQA 3BGOP 1T3OA 2R7WA 2FJVA 2KXFA 1EARA 3CIMA 1TAQA 3O6QA 3CMAS 1U1MA 4ZVHA 3TUJC 1XMOF 4JI6J 2Y0SD 4OIXA 4ATNA 1HD1A 4RW7A 2RU9A 1HBOB 1NJZA 1JMTA 4DV1J 1WKLA 5KFDA 1RU1A 4PYAA 1WOSA 3V81A 3OHAA 5A6WA 1H38A 5IQ6A 3PYFA 3DOLB 2VJVA 3SIPB 3HF5A 4R5PA 1Q16B 1EQ0A 4HDHA 4DSIA 2X51A 1CS4A 3CD7A 3J81Y 4NLDA 3KLHB 2CQ2A 1T03A 4FPRA 4ECQA 2DNYA 3T9ZA 4LF9J 4MAKA 3R6GB 2K7JA 1SVDA 2VF3A 4WE1A 3DKDA 1S72S 2V69A 1K0TA 2YX1A 2Z8QA 4TYAA 2YX7A 2UZAA 4EO6A 4B9TA 2MKCA 1Q53A 3G71S 1VGYA 3RB3A 4WKRA 2CWXA 2JEFA 2HIQA 3TZXA 1NPKA 3PR4A 4NLGA 1Q82T 4YMEA 1HNVA 2DNNA 4Y2CA 4MKYA 3M32A 3H40A 2VA3A 2XY6A 2HBYB 3UR3C 1FXRA 3UN2A 3D0GE 2C3YA 4LIRA 4OZ1A 4IRDA 4C11A 1VS3A 4FS2A 1N54B 2B9YA 4BDPA 2G9OA 4K2XA 1HHQA 4WTYA 1HQUA 4Y2MA 4LSLA 2B9EA 3M8QA 4LF2A 5BXIA 3MUTP 1D1UA 3K8WA 3SI8A 1VHIA 4L72B 3I0SA 3AXMA 2QA1A 1NH8A 3K8VA 2E1RA 1IBMF 1GXUA 1K73T 3LP1A 5J2QB 3PIOQ 2LXFA 1LW0A 2V8PA 2HVIA 2R3VA 1Q79A 1ZA2B 4DR3J 2VFTA 1FHTA 2MZQA 2QLBB 2OFHX 5F8JA 1OY6A 3OL9A 3ZZOA 1T9WA 2VV5A 4LFCF 4U96A 1S57A 4TLRA 5EX0A 1FEEA 3AQPA 4MT1A 1MLAA 3BB5A 2R2RA 3NEKA 5DZ6A 3KLFB 5A8RB 4C4WA 1HI1A 3TJ8A 2QMWA 5IM0B 2P8IA 4ED4A 2WW8A 1U1PA 1PYOB 4CLKA 3CDAA 3BO4A 3DLKB 1TFYA 2D3O1 1FESA 2YWEA 2E7XA 2A10A 2XS7A 2HFNA 3I55S 3LAKA 4KKOB 1UFLA 2AIRB 1A0OB 5HVGA 3HSGA 2DGOA 4HT7A 3UD4P 2QO3A 1BQNA 4DV7F 4OHZA 1RAGB 2QG9B 1K1SA 1XTZA 2JDJA 3D2WA 4OZ3A 2CZ4A 3NAHA 3BYPA 3R9LA 3GJQB 1XNQF 5L8RC 2IAJA 3OV7A 4OLOA 4DV4F 4ID5B 5BYRA 2D7SA 1DTQB 5J2NA 2V4JA 2JSXA 4I2QB 2FHJA 3BR8A 2RS8A 4FNIA 1NHVA 1VQKS 1RABB 5KFSA 5A6PA 1RDRA 2VKZG 4RNOA 4MK8A 4YOEA 3M30A 2FY1A 3EZUA 3BGLA 3FQLA 1A9NB 3FSIA 4W98A 1N5SA 2UUCJ 1IBCB 3TX8A 2WSCC 3B4MA 2YNGA 1ULRA 2COLA 1DRZA 2C3OA 1R31A 3W5YA 1RLCL 2MZ1A 3KJQB 1WHWA 4KB7A 2FLPA 3H0PA 4ELTA 2XZWA 4I64A 4K8RA 4ZVQB 2CQIA 4C8YA 2FLNA 3UD3P 1NK7A 1QVFR 3FBFA 5AJ3F 2XZDB 4AFFA 4K4XA 3L7OA 1SJQA 1NRKA 2WB1D 4YFUA 1QDUB 1RHJB 1C1CA 1OQ3A 1PJ5A 3AA8A 2CA9A 3VAKA 2VFVA 1KQFB 3HXMA 1R8AA 1I6JA 2KRBA 1CJVA 4OZJA 1QLNA 2VPWB 4N7TA 5DDQC 2XWYA 1WD6A 1HIYA 4K4SA 4BC9A 2C22A 2VPXB 5AE3A 1RK8A 3GCWP 1SCJB 1BHNA 1IM4A 1N5YB 3AH6A 2HAIA 1E6YB 2YKNB 1IJEB 1BC6A 3MOZA 5J1NA 4USHA 4X4NA 3DMJB 4ZJQA 5AE2A 1M5OC 1T05A 1EETA 3KUEA 2VA2A 2D69A 2B8QA 1F5AA 1FRMA 4C8NA 3BBFA 1S59A 3OUYB 3QRPA 3W63A 3R7NB 3ISNC 3SCKE 4QZVB 1TL3B 2KT2A 2V4QA 1ZM3A 2J9DA 2I5JB 1JKHA 2R7UA 2FJAB 5F9NA 1UJ4A 3JSRA 4WFNQ 4NCGA 3TQEA 2KVIA 2BXJA 1LQ9A 4ECTA 2CPDA 2P9GA 3FDSA 4H4OA 3DGPB 2LXUA 2CXEA 3BH6B 3FCVA 3OTBA 2XLIA 3O3LA 1VRQC 3M2RB 1WG1A 2ZH5A 4LBPA 3BDPA 2P6TA 2NXJA 2CADA 1UFKA 1OQ6A 3QFHA 4LRBA 4O3PA 2W01A 3V5RA 2B0GA 3AJ1A 1S1UA 1GX6A 3QIPB 2JWNA 2CQ1A 1ZM4A 5F8MA 3FZBA 1JLCB 2OI2A 4QPXA 3RRHA 3IR7B 3JYTA 2QLFB 4H4MA 1VQ8S 2VJUA 1Q86T 3B54A 1YI2S 4ZPDA 4WP9A 4DUTA 3GIJA 3CTRA 4IFYB 2IM0A 2ZBRA 3RW7A 1Q95G 3MWBA 2KU7A 4Z7YA 4M5DB 1EAYC 2V9KA 5AT1B 2IBOA 2OPPA 1YBUA 4RNNA 1RTDB 2NXCA 4DV0F 2AHOB 4K4TA 2HVHA 2VDHA 4MK7A 2LFVA 4TU9A 5F8LA 3BEGB 2BQUA 4IFVA 3DLEA 1RXOB 2NSCA 1ICEB 2YKAA 3QO9A 4LFBF 1NEEA 1X60A 4G6VB 2VG7B 3VGVA 3R97A 1GXTA 4CDIA 2JLEA 1VQ9S 2R2TA 1FVQA 5F0UA 1TMJA 4A48A 2MQQA 3NCRA 4GKKF 1NJWA 1HYSB 3J81j 2OHDA 2FIUA 1MWQA 5ETSA 3RTVA 4A8QA 3CCTA 3KG4A 2XULA 3P96A 3I32A 3P8BB 4PPZA 2H5JB 1XERA 4F8RA 3C3LA 3CUNA 1U2FA 4NLRA 2NCKL 4J9KA 2OH2A 4JI1J 1MROB 4MFBB 1SJ1A 4TKTA 3OR1B 4F4AA 4Z7CA 3RW6A 3MECB 3AODA 3GZ7A 3ITHA 3L09A 1N36J 3THPA 5B0CA 3SQOP 2N82B 4IH5A 1IKVA 3R5AA 2JVOA 5HL7Q 2IM1A 4MKAA 4PXBA 2V8VA 4A8MP 2C28A 2A18A 3MEEA 3NS6A 2CG4A 1QSLA 5AXKA 3TP2A 1VJQA 2VICA 4TN2A 5DDOC 2OPSA 3FBCA 5LSLA 2H5IB 3DYAA 3TA2A 2HNZA 2DGQA 1OMSA 2WRMA 2UXCF 4RKUC 4K5RA 4LQ9A 3I5CA 3J7AN 4I2PA 2RKIA 4ZVTB 5H1SV 3EXCX 8AT1B 2M7SA 1K8AT 1H2VZ 2QEXS 2DHAA 2OPQB 2NPFA 4XPEA 2E1CA 3I96A 2Q6CA 4QYZK 4ECZA 1F6TA 2IPOB 5T7LA 1WEYA 2RHQB 2GX8A 2B8PA 3MFHA 4X66F 3UDCA 3AY0A 3N0VA 1B7YB 2KT3A 1PCAA 4UOHA 4RJVA 1SC1B 2AGOA 3H2VE 1AYEA 1QE1B 1FKPA 1Q81T 2UVWA 5ETPA 5EWGA 3M8PA 5J2MB 5GVQA 2KZMA 1S1VB 3JB9k 1RP5A 4F4YA 3HFZB 3C16B 5HVFA 3PNIA 4Q2MA 1IQZA 5KAKA 4PWWA 3TAPA 1HWKA 2F4FA 1DFDA 4DPUA 2GAGC 3TA1A 1S48A 2F3JA 2HIYA 2J6SA 1S9FA 3GV5B 4ALZA 1M5SA 2OELA 1DLOA 3CPWR 4DR1J 1VRTB 5MAOA 2H54B 5E3AA 1HQEA 1T8EA 2BANB 2VASA 4ZVSB 5GAEI 3AFGA 2KFNA 3MXHP 3K2YA 2OPRA 1WC1A 5D4OA 4K4UA 1Y5IB 1NHUA 2WCXA 1X4AA 3TAMB 4F2RA 3VQTA 4ED7A 4OZ5A 4NA1A 3FCHA 2PN6A 1TAUA 3UNGC 3BGRA 1M1HA 1B0PA 1GK8A 3I87A 2EBEA 1D0EA 3MCOA 3PYDA 2KN4A 5A8WB 2HWHA 3CDWA 5KG1A 4DR5F 1KHVA 2LCWA 2JFDA 2QMUB 4A8KA 3T1YF 3J7YU 3MUMP 2L9NA 2W4CA 4TQSA 1IKXB 1RUSA 2PMWA 4OX9J 3VVUA 3VZIA 4J9SA 1YRUA 4M5MA 3CJ2A 3IRXA 2IA0A 4DUZJ 3X1LB 4LBIA 2LXIA 3VHQA 4M5GA 2VG5B 4NZ6A 3G6VA 1VBZA 3TUIC 1M1KT 1FJGF 2W4DA 2ZDOA 2XHWA 1U6BA 2YH0A 1RWWB 1APSA 2V2ZA 3RAQA 2V5HG 1F3VA 3W5XA 4QCLA 3OL6A 5SZTA 2MMYA 1JLAB 3QATA 1SUQA 3W2VB 1LWCB 4JI0F 4OL8A 1IUJA 4WYWA 1FCAA 1AA1B 3QWUA 1X5SA 2YWGA 3PJ9A 3B8HA 2ZD1B 5KFVA 2YKPA 2D1CA 3MTKA 3J81U 3A3PB 2IJNA 3FSXA 4K4VA 2B5JB 3TW0A 4DV5J 3NCQA 2RD5C 3M1VA 8RUCA 1L5UA 4FBUA 1FDAA 3M6WA 1HWIA 1YIJS 4NOHA 2FVPA 4DSFA 5D3GA 1SC6A 3NRBA 1LWXA 5G0RB 2XC9A 1ZETA 3MM6A 1AW0A 1N4LA 3BS9A 4KJIA 4H4KA 4AQYJ 4QW8A 3KUGA 2VZ9A 1G4CA 5K14A 2GAHC 3L7UA 5LJ5Y 2VUGA 3AQOA 2CPIA 1H72C 2R42A 4RBUA 1HW9A 3MPDA 2XBPA 3MI7X 1ELOA 1VC0A 5DLFA 3MEKA 2DNGA 4HH1A 5HATA 2W24A 4PEOA 4L73A 2MHEA 2GHWA 3DDIA 3K5NA 3V6DB 2HKEA 1RAAB 1OS5A 3DI6A 2B4OA 1HBOA 4F2SA 1FFWB 4ETZA 2WSEC 4QWAA 4LJMA 4PQUB 4X64J 4F0HA 4KHRA 4L75A 4CIOA 3TO8A 1V9OA 3R5DA 4MIAA 2JX2A 4F26A 4EBEA 5KFEA 4MYTA 1QAIA 2LU1A 3GCXP 4HACB 3DGVA 4WFBQ 1U24A 1PYSB 4NLVA 3KLHA 3RJMB 5L38A 4LT6A 4HVZA 3LGMA 2V68A 4YY3J 4RX6A 3RAMA 2IDEA 2JVRA 1KQSR 4XO0A 1NSKL 4NCBA 1SB6A 3D6MB 4IUFA 2MKSA 1C1BB 3MMAB 2ZUAA 5F9LA 5KFKA 1IWAA 4X4SA 2CRLA 4OHXA 1D9AA 2J7KA 1LW2B 4JI3F 1CPZA 1U0SA 2XMVA 1NH7A 3D67A 3Q8UA 2FZGB 1U6ZA 2HGLA 2V0NA 3I31A 1UTAA 1VQPS 3Q8RB 3JTPA 1D9DA 1SV5B 2FVRA 2L3MA 4RNHA 4J9NA 2HAFA 3PW2A 4OI4A 3Q8QB 2CAJA 5LMNF 1TUGB 1TUVA 1RT2B 4Y6IA 3GE9A 1NDCA 3KK3B 2NZ4A 2LQ5A 3ZZYA 3WQPA 3BKFA 4A8YA 3WZ0A 3FEXB 4I56A 1RA6A 4DV6F 4FKXA 2V50A 4LREA 4Y28C 3HHNB 1P6TA 1G2EA 1HBNB 1T9YA 2DB1A 3WIVA 2XMUA 1IKYB 2QA4S 1GMUA 2NSBA 1IBKF 3UE2A 4DWIA 4R0EA 2ZBIA 3MURP 3LP2B 1S6QB 2H4WB 2BR0A 3D9BA 4I67A 2E5JA 1H2UX 4ZIWA 5A76A 5J1EB 3US5A 4QIGA 2LLZA 2BKOA 4YR3A 2YVSA 4ECYA 1YTYA 3FSYA 4A8SA 1HL6A 5B0FA 2OTJS 3GR0A 2DR7A 1UMJA 1WSVA 1VMBA 4ZVFA 4B3TF 3QT8A 3KLFA 3UPFA 5KG7A 1O8BA 2F40A 1Q7LB 2M4MA 5A8RA 4DPXA 1FD8A 1JIHA 2OEJA 2YNHB 1X4DA 4EO8A 2W2QP 2DGXA 3QQCD 4NPOA 4RW8B 4QWEA 3JS9A 1FFSB 5E3PA 4CLUA 3GG0A 2QFJA 2V9WA 3ENVA 4RWWA 2XNQA 4X4OA 1WNEA 4DR6F 2FDNA 4M5JA 3E2EA 3CB4A 2BDPA 5L39A 2KXNB 3HFKA 4XTTA 4WF9Q 3TNVA 2IVFB 4DL2A 4JV5J 4PABA 3P45B 3KOAA 4B3RJ 4MIWA 4NZ7A 2HQCA 3ZZZA 3RU0A 5FJ4A 3LTOA 3S7RA 5DS7A 4Q44A 4QIWD 2ABYA 2CVEA 4J9UE 2GIFA 3PG9A 4ZN1A 2JNJA 1HI0P 4LSNB 1C4AA 5D0EA 1DTQA 4YR0A 2ZC3A 2GVZB 1Q8IA 4DLGA 3OFGA 3QSYB 2IMOA 2JC0A 4I2QA 1RHKB 3I9V9 3DRRB 5B08A 2E7WA 3I0RB 1T02A 4EYHB 1JQGA 2FD2A 1N0UA 2QIFA 5LSOA 4I1TA 3PW7A 4FYDA 4DS4A 1N6QB 3D66A 3BBBA 1Z2ZA 4ECVA 4P7TA 1H0HB 3I4PA 4KGMA 2OTLS 5KFXA 3CCSS 4KO0B 4ZVGA 4E0DA 2DTJA 2DRBA 3EWGA 3A8KA 1R8HA 2C42A 4OI3A 4DR7J 1TK8A 2XGQA 4PAAA 4KT0C 4LUBA 4DX8H 3MAQA 3PM9A 2GQ2A 3MMCB 2NS1B 1X8DA 4WZQA 2CUYA 4LF5J 3HO1A 4O3SA 3IA0A 4Z37A 5L1KA 3ZTSA 3JQKA 3HSZA 1JLGB 2CPYA 4ZHRB 4ZVRB 3A8JA 3TUPA 2MZRA 3ZNJ1 2BW2A 2YNIB 1REGX 1JLQB 4ZOSA 1WDTA 2EFNA 3NNHA 1ITPA 1N88A 2Q43A 2HGMA 4I6WA 4FYYB 4M5KA 3BH7B 1G1XA 1MG7A 3LH2S 1R6YA 2OMLA 4U7UD 2FC9A 2DNHA 5IT0A 5KFMA 2GS8A 3VAIA 3Q24A 3GTYX 5BR8J 3FEZA 3I9ZA 5HLFB 4DFMA 1CJKA 3VAMA 3N5BA 4Y3CA 2MLXA 1E6YA 2YKNA 2V2QA 1C2PA 4PXEA 3DMJA 2JJ4D 1LFPA 1YRTA 3HD2A 1F5BA 1HMVB 4R25A 2UV8A 4QYRA 2ZHOA 2ZH7A 1IBLF 2ROPA 3QLHB 2CJXB 3LF0A 3UI3A 4KPCA 4OI2A 4KH0B 3OUYA 3J7A1 2CQBA 5K8PA 1DJ0A 2XSJB 1JJ2R 1AUSL 4HDGA 2GIQA 3HFVA 4KV8B 1TL3A 1RBLA 3HPOA 1PC4A 2I5JA 4LSZB 1I94F 1W25A 4LF4J 3CCES 2L9DA 4QBUA 1PYTA 4HL9A 4CWBA 2O3DA 1RAHB 1M5KC 2DK2A 2B4UA 1N5QA 5D78A 2V63A 3DGPA 3VTIA 4I68A 3CCLS 2RRNA 1PIEA 4CO5A 1UEVA 3M2RA 3P3DA 3CGIA 3PZPA 8ATCB 1FI4A 3CJQA 3CC7S 2PA8D 3QPIA 3D6TB 4G3IA 3G6ES 3QIPA 5JUMA 2RJZA 2C1EB 3IWNC 3W65A 3NXZA 1DAXA 4X4PA 1JLCA 1YJ9S 4C3MA 1F1BB 5DGAA 1RAFB 1YK9A 4N8NA 3A4TA 3DRPB 3KLIB 4BLGA 4UZBA 1OSCA 4O3QA 1MMLA 3UR0A 4P7VA 4M5DA 3GYXB 3M4XA 2M2BA 2J0WA 1VQ5S 3PDNA 1LNQA 2DH8A 4OFZA 4WPAA 5HMZA 2OJ3A 1RTDA 2GGPB 3DRYA 4PUOB 3K7RA 4MYUA 1A7GE 1S1TB 3R5CA 1RT3A 2R2SA 4JI7J 1S10A 1R7IA 3DN9A 4N56A 2ZUGA 3GFXA 2B9XA 1RHMB 1ZTTA 3G8TA 1L3UA 3GV8B 1F2HA 3QT6A 1XR5A 3ICLA 1QAJA 1K47A 4DV3F 1PJ6A 1R89A 2B51A 3DLGB 4NYPA 2Q1LA 3ETMA 2BKNA 2D41A 4ICLA 5KFYA 1SQGA 1Q8LA 3CJ4A 1LV5A 4ZVPB 2QN6B 3MM9B 3NAIA 1HYSA 4J9QA 2K8GA 2QLJB 3BBCA 2SXLA 4ECXA 1SL0A 1C4CA 4TVAB 3CDEA 3GR1A 5ETVA 2GHPA 3ELHA 1WTBA 4ZK7M 4WJBA 2QT7A 2CQ3A 4OI1A 1N32F 4YB6A 2D9OA 4D3GA 2DVIA 4NLYA 1MROA 1NDPA 1RWKB 3NBPA 2R7SA 2LU2A 1W26A 3MECA 4I4BA 1F5CA 2V2KA 4DZDA 5ADZA 4U7CA 1NZAA 5C7PA 1QTNB 3DDKA 4JI2F 2J9CA 3T1HJ 1RTZA 2W7PA 3NWRA 2Z0GA 4JYAF 3TJ9A 1B7FA 2OD4A 4ZVOB 1J5EF 2M8DB 1ZPVA 1Q5VA 1RTIB 4KGKA 2NZCA 1ZAVA 3DLBA 3D0IE 3F41A 4UUXA 2RRAA 1Y9OA 2HK3A 2E66A 4NE9C 3AB2B 2E1PA 4ZJLA 3GFHA 4U67Q 3OW2R 3MPUB 3QFWA 4DSKA 2NYIA 3AJDA 2E1AA 2F8MA 2EFQA 3A8EA 2CQCA 2OEMA 3DOMB 1WG4A 4NXMJ 1CULB 2GQQA 2W7OA 1S99A 2OPQA 2KZZA 4C6AA 5C2CA 4C0HA 1KN6A 2XB2D 2E5LF 4TXSA 1RYRA 4JI4J 2OSQA 1QJHA 1RT5B 1UEKA 1KHWA 2J9EA 1QE1A 1Q7YT 1CG2A 4NL5A 4O4RA 5J2MA 2RE1A 5C42B 3CJSA 2DT9A 4D3HA 1S1VA 2P9EA 1R0AB 3FK4A 4WFXA 3C16A 4PG8A 1M5VC 4PG5A 4EEYA 4NXNJ 1RA7A 3SCIE 4UF4A 1SQEA 4KTQA 2HWIA 2JEGA 3D6FB 4AYBD 3KMSA 2NPIA 5D4PA 3MZIA 5IWAF 2QX0A 4FYXB 1U1OA 4KHPF 2UUAF 3BO3A 3W8GA 4DQRA 1VRTA 1WHVA 2X3GA 2W2MP 3L7PA 2WOMB 4P2FA 4WFZA 2BANA 2FVCA 4FXDA 1T11A 1JWWA 5F3TA 3RBXA 1FT8A 1YJRA 4JUZA 1X7VA 2K3IA 3U1MA 2DNKA 3LP0B 2PMZD 4DR2F 3IO1A 2RUGA 3HDSA 3CJ3A 2CQ0A 1S12A 4AXJA 2DNMA 1U09A 2K7KA 3T5KA 2ZM6F 2BOPA 4QQBA 5HMWA 3IWLA 1VIXA 2W9AA 2L41A 3Q86A 4B9UA 2ZBQA 5A8WA 3WHIA 4F0KA 2OMOA 4CO2A 3QAUA 5H9FJ 4F25A 3FQKA 2ZOFA 1WF1A 3PKYA 5J1PA 1D8YA 4HI2A 2KT5A 3NGRA 3BYRA 3GG1A 2JEIA 3OBIA 2MSSA 4DFPA 1IKXA 3M2UB 3CC4S 2LEPA 3D1OA 4ZKAA 3NGSA 2UU9F 3CVKA 2VG5A 1F9HA 3NGUA 1V3RA 5D0HA 1LXJA 5KFWA 1B99A 1BY9A 1VC6A 3C46A 2BMBA 2HHHJ 5DLGA 3MHYA 3M9MB 3D3CJ 1CBKA 1B3TA 3CD0A 5EHHA 3GYGA 1WF0A 2WSFC 4C8LA 2A1BA 1NO8A 3CJ5A 5KG6A 4DHVA 2VQFJ 5DM6Q 4N47A 1JLEB 1L3TA 4P2SA 1JLAA 1ZAXA 3MD3A 4ECUA 2FUG9 4QR0A 2IDLA 7FDRA 3N6MA 3W2VA 1HFEL 4YS2A 1LWCA 2G0JA 4CH7A 1U0HB 4WYLA 1MMDA 3KDOA 3ZFVA 2JEJA 2XEXA 1YJVA 3V2UC 2ZD1A 2PFDA 2VBYA 3HM9A 4Q5VA 4OYWA 4F4ZA 1NSPA 4ENOA 4W4MA 5J2PB 2W1BA 2B5JA 1PSDA 1R3NA 2ASYA 2B4VA 4X4VA 3T3FA 3CO9A 3K58A 1QSSA 2B7CB 3E3XA 1KR4A 4B17A 3R2DJ 2OLWA 4AL7A 1EB0A 2PI5A 5G0RA 1Z1ZA 1MNEA 1CEZA 4ANEA 2GQCA 2XSFA 1J2VA 2KJVA 1WTFA 4WU3A 5KT4A 2E9TA 4IR9A 4HT5A 4DN0A 2V94A 2J5AA 2MQLA 1X0FA 2CPZA 2OO4A 2IC3B 1TV6A 4XK8C 4RL1A 1URNA 3F44A 4E98A 4EU0A 4A47A 1DARA 3T5LA 4U8YA 2HFSA 1WEZA 1HNWF 1KQKA 1NZ8A 1S6OA 4M5LA 4OYPA 1KSPA 2W25A 2FJWA 5G4DA 3V6DA 4OJHA 4MH8A 3WIUA 5ETNA 2BQ3A 4C9DA 1X0PA 1QM9A 4PQUA 3U02A 3KLEA 5L1IA 4Q43A 4FVMA 3M8SA 1AB8A 5IFMA 1X5OA 5L1LA 4O0NA 3VGUA 3IGVA 1PO6A 2VL1A 5M2RA 3PR5B 1SXLA 4OI6A 5B7WA 3TWZA 2YWFA 3OL8A 3EX7B 4UQTA 5KG4A 4Z2XA 3PEJA 3V6KA 2R8IA 4ELVA 3C14B 3NNAA 3GIKA 2Z4PA 2FJEB 1M5PC 5IT9U 1QUPA 3IBFB 2UXDF 1RWMB 2HGNA 2WBRA 1PJ7A 2ROEA 3TVKA 2RH3A 4CO1A 4USWA 4OQJA 2UVUA 3UWTA 3HZGA 1LW2A 1WI8A 1LWFA 2R8KA 5KFBA 4DFKA 1UVKA 4ZLLA 1JNRB 4C98A 2AX0A 3GILA 2VONA 2ACYA 4F4KA 1RHRB 4BC7A 2ZH1A 1YRXA 3SQGB 1AFJA 1IN0A 1SV5A 2QA4G 3MM5A 2VOPA 1UPPA 2IMWP 5FIIA 3X3UA 4J91A 1N33F 2MDAA 4YDDB 4FXVA 1RQ0A 1RT2A 3KK3A 1Q78A 2XO6A 3EGWB 2MHNA 1UZDA 3VZHA 4HLBA 1JXLA 2DO0A 4JI6F 5MLCV 1ZM9A 4BS2A 3N4WA 1MN9A 1HNXJ 1S4EA 3MPYA 2KKHA 1MWZA 1FWKA 1X4HA 5CZXA 3LW5C 1IKYA 3EM1A 3EVMA 4DV1F 3V6JA 4ZP8A 3NS5A 3LP2A 3HCXA 4I69A 2XTJP 1AROP 1S6QA 4RUCA 3KJVB 1OJ4A 5T14A 2I2YA 2QL9B 4GMKA 5J1EA 3A3NB 2CYYA 2DITA 3SMZA 1S1XB 4DQIA 2M8HA 3M05A 1GEHA 3N28A 3IMQJ 1A6LA 1VQLS 5HROB 5CYMB 2QLWA 4AD6A 1HWUA 3O1LA 3HLUA 1H3DA 3OXLA 4DR4J 4LF9F 2A3JA 2BRKA 2C2EA 2GC8A 1EJ7L 4DU7A 5EWFA 3FFIA 1TVRB 1OIAA 4OHYA 4NA3A 2AYMA 2HNYB 3CO0P 1IR2A 4FZVA 4RW8A 2DR5A 2HWTA 3PKMA 4DQSA 3K17A 1RSCA 4DV2J 1AZSB 4OYMA 3IM9A 3MR2A 3DCAA 1W2BR 2HZAA 4FVCA 1YLXA 4O23A 3DM2B 4B9NA 2AJ0A 3I56S 2AWZA 1HA1A 2VC1A 3DU6A 2HK2A 4CQ1A 3VWSA 3GSIA 1VK8A 2R7TA 3KNGA 3T9NA 3W61A 3MAAB 2LVWA 4LR8A 3BO2A 3AHPA 1DHMA 1JXEA 2GVZA 4NYOA 4DMZA 4CP5A 4LR9A 3HHEA 1NCLA 3DRRA 4P9SA 1IM6A 3I0RA 3KMQA 2ZNZA 1QAYA 4JV1A 5EN1A 1Y3KA 2C2RA 5GAEU 4ID8A 4CNYA 3A3OB 3TZYA 1N6QA 3PW4A 3EGZA 2DISA 3PJWA 4DX7A 3QGGA 3GPAA 3VQSA 3FRZA 2CQDA 4DR3F 4KO0A 4RUHA 2LA6A 1N0VC 4C0OC 1RYSA 2RQ4A 2PDAA 5A8KA 1XIQA 2CVIA 2E5GA 3SEOA 1YKWA 1EP4B 3OHBA 4X62J 3PW5A 2YQ0A 3CJRA 5C25B 3NGKA 2GMHA 3OSPA 2MKIA 3KJNB 4YUDA 2BRLA 2H4YB 4DPWA 4PYDA 3EMTA 4ILRA 2NLWA 2DHGA 3ZTRA 2LP4A 2ALYB 4CRJA 3V81B 3AAWB 3ILIA 4GC7A 1IXKA 1JLQA 2DGTA 1UW9A 4L74A 1VBXA 1TKXB 2W9CB 3C66A 3SFGA 2VIHA 4B3MJ 4QOTA 4WFAQ 2AZ1A 3GQCA 1FE0A 4O4GB 3NKYA 2IM2A 5HLFA 3A13A 1U4BA 1TELA 2XO7A 4DQPA 1FKOA 3CCWA 4ED2A 4F3QA 2AT1B 1U45A 2BOAA 2ZH8A 2C3MA 3SSSA 1T9TA 1F2GA 1X4CA 2F65A 1RHUB 1HMVA 5LMUJ 5DDPC 3NGDA 3CE8A 2R7VA 3TJAA 2AP6A 1RT1A 2HRYA 1KP6A 5JJBA 2XCAA 2VBXA 2V6AA 3E8OA 2KJWA 3LWMA 2YQ1A 1Y0HA 1IR0A 3PW0A 2XSJA 1YGYA 1HBMB 4KV8A 4Y00A 5CABA 1X4FA 2CQPA 4YN3B 1VYAA 4ZIVA 1UJ5A 2KTQA 4URSA 1UWBA 4CYUB 1QY7A 1GQEA 4FF4A 4OYXA 3CNQP 1JLBB 4YQWA 4EFAC 4K7QA 2ZZMA 1CC7A 3MFIA 1NK4A 1HQUB 1H2TZ 5CHCB 1CJTB 2EK1A 4P2MA 2KVQE 1T3NA 3QJLA 3PVXA 3D7SB 1WHXA 2GV1A 1IJFB 1VQSA 2RMLA 2DCUB 4CLTA 5KG5A 4RO0A 4LF6F 3RZAA 3K57A 1LW0B 3MCSA 2BEFA 4DL3A 3H98A 3LPEA 1P1LA 2YH1A 1PAEX 1AUDA 2H1YA 2HZCA 2CQ4A 4ZP9A 3TARA 3QGPA 5GAHI 4WTOB 1T94A 3KLIA 1VQYA 3G86A 1VQMS 3UCGA 1BE4A 2WTFA 2JL9A 3OQ2A 4K59A 3UVJB 2GVDB 4WK3A 3ONQA 1M0SA 2Z30B 4QW9A 2Z56B 2ZZNA 4J9VA 2XM3A 2J9DE 4USMA 3OXFA 2F1FA 2RILA 3OVBA 5H9EJ 2M52A 1WC0A 2HQGA 2AJ2A 2IJFA 4K2JA 1XN9A 4LBHA 1HARA 2AEMA 1DQ9A 3QGHA 2GGPA 3EE3A 4PUOA 2CFXA 2FGCA 1S1TA 1RB0A 3EGNA 4WCEQ 4ER8A 1LK5A 2BE7D 1UETA 4CTAA 1SPBP 1BXNA 1Z2LA 1V5IB 1P9QC 5KTQA 1Q0NA 1R8PA 2KI2A 5IC4B 3ZO7A 1MMNA 1S97A 3DLGA 1EHWA 1P27B 3NOGA 4EI2A 4DL4A 2C3PA 3PO5A 2IM3A 2XHCA 3HHLD 4R0JA 4C8MA 1U1RA 1RWVB 1L3SA 3MAHA 1JB0C 2IFXA 1ZZFA 1TK5A 1UWAA 2HMIB 2AGQA 4AUKA 1LK7A 4H54A 4OYZA 1VOMA 2V4JB 3KG1A 5K8NA 2HHUA 1IBLJ 1TL1B 3TUZC 4RNFA 5KT2A 3D5MA 4TU8A 2CKWA 5IXUA 3W7BA 4W90B 4X65J 4KHMA 2KHCA 3M8WA 4DU8A 1QUVA 1S77D 1GMWA 2RUSA 1RT4B 2GA7A 1S7HA 2MQPA 1TKTA 4ZLPA 2APOA 4G65A 2AD9A 2DRAA 3N5FA 4NLUA 2W9BB 2B43A 2M5YA 1U2RA 4NLTA 3BSCA 1RTIA 2ADCA 5BJRA 3VALA 4U9RA 3J7YI 1ZA1B 1VRUA 1WUUA 3TZWA 1Y00A 1WEXA 2CDQA 2W8KA 1WHYA 1TQLA 2MSTA 2KHDA 4E2FB 4M5HA 4DEZA 2CJKA 1FKAF 3VAHA 4J9OA 3DOMA 2UUBJ 4B3SJ 1CULA 1MWYA 3Q8VA 3H5XA 3QIDA 4GRSA 3M6UA 4S0MA 1AXQA 2RDJA 1HR0J 3RGIA 1OSDA 1JXVA 2XYHB 3WC2A 1WWHA 1RI7A 4C2MA 3PCOB 1F60B 4QR1A 1RT5A 1DTTB 2B4PA 2JRSA 3GJSB 5C42A 3BN7A 3U1NA 3R2CJ 1UAWA 2DY9A 2HS3A 3CD6S 3GIRA 4YP3A 4RW6B 4NLSA 3KLGB 4EK2A 1YJ7A 4Y65A 4EWTA 1WELA 1SH2A 1VHFA 2IJRA 4TY9A 3H2UB 3UFCX 4KR0B 1SQFA 4F36A 1UEUA 1KC8T 4L6V3 4HI1A 2IVMA 3KHLA 2DXEA 1N36F 1Y3JA 2KXHA 1TU0B 2ZKUA 3D0HE 2DNRA 4NCGB 3PYGA 1X9MA 2W8LA 2CJQA 2P2CB 1HKAA 4PRFA 1NU4A 1X4EA 3LP0A 4CNZA 3PRDA 5FDLB 3HP6A 1RKIA 4K0KJ 5D0RA 3Q89A 2E5IA 2F63A 2O66A 3UNYA 2Y1LB 3NP5A 3RG6A 3EXYA 1P8GA 3Q8PB 3EICA 3W62A 5DRKA 4PG7A 2POKA 5BYQA 3H4BA 1R27B 4ZCIA 2C2ZB 4DZ6A 3AOAA 4R8UB 1YJWS 2KG0A 3MM7A 2QGFB 2QV6A 3AOCA 5HP1B 2XMWA 4FP9A 2R4FA 2FHKA 2Z58B 1NK9A 3C2PA 3TVYA 2ZVIA 4DCPB 4RUBA 1X4BA 1H73A 4UUWA 5A2QU 4ZPVR 1NAQA 3R5BA 2FPHX 1VQOS 1YJNS 5I42A 4KE5A 2MGZB 1OPIA 3UN5A 1G6BA 3HHKA 1KTVA 2DNQA 3RB4A 2OPPB 3MR5A 5A0YA 1U25A 4DG1B 1FF2A 2YQ3A 2HFVA 4HTJA 4ZCLA 4HKQA 2NQPA 2H9ZA 4LF7J 3ZTQA 1YWXA 1JLEA 2Y8WA 4GVLA 1RWPB 1CSJA 3UO0A 3OXGA 2BM1A 3OFHA 2HLUA 2BA9A 2DY1A 4RU9A 4DR1F 4FDFA 4G1IA 2I6WA 4NWBA 4P74A 2HLTA 4P6QA 3FC9A 2C2DA 2PIIA 3IS9A 2HFOA 5CH7B 5DZ7A 2ZC4A 5J2PA 3F0NA 1FFGB 1S9GA 3NGTA 3L3CA 4YR2A 1Q8BA 4K4WA 3MPWA 4ZDNA 1N34J 3V4IB 2I8EA 4ZLJA 5IWAJ 4AXIA 3R7SB 1RAIB 3RR7A 4YHHJ 4ELUA 1X9SA 1DZ5A 3EZ5A 3R5GA 2Y1JA 2PA3A 2ALZA 3ITHB 2EWHA 1YBTA 2UXBJ 2AJFE 2IC3A 4PWDA 3QJJA 4IG3A 1WKJA 2HHQA 4FN5A 4OX9F 4WZMA 2ZFHA 2DXFA 2BE9B 4DX5A 4UQGA 2WZ1A 2C2MB 4NRTA 3MEDA 2ZJPQ 4DUZF 1XNRJ 3O5TB 2HRTA 1S0VA 4URGA 3LGNA 2BJ3A 2F8HA 4ZPBA 4DL5A 2BJ9A 4YDXA 2W7AA 1NK5A 1GMWD 2NXEA 5ITHA 2AJQA 2YKMB 3MOJB 2ILZA 5CYQB 4LVNP 5LL6d 1O0PA 3ENWA 3HX9A 9ATCB 2BM0A 1WORA 3QT5A 5I3PA 1F9FA 2ZHAA 4FNHA 1W7WA 5LJ3Y 1FO1A 2GW8A 4QU7A 4M8LA 2KFYA 2DYAA 5T7LB 5IT4A 2D3ZA 1WC3A 2FHJD 3C14A 2VFSA 1FJCA 1HBUB 4JI5J 1RBAA 3HKWA 1NLKL 3AA9A 3E01B 3M2VB 3QYYA 2B6AB 4HHJA 2H3EB 3M8PB 1FTCA 1MU2B 3IR5B 4DV5F 2J0SD 1OYEA 3IP0A 2X1AA 2HHTA 4PCQA 2Y1RI 4ETXA 3D3BJ 5C24B 4NLWA 2I9SA 1XR6A 2XNRA 2HHVA 5KFJA 3JTOA 3H25A 4PR6A 4Q8FA 1R8BA 2ZH9A 2N4CA 4TYBA 3SQGA 4J7CA 4N8OA 2KH9A 1HQEB 4HH0A 1M5HA 4J5OA 4CT8A 2EK6A 4L3KA 4AQYF 2DNLA 1UVIA 2JZ5A 2J8SA 4X4RA 3EYZA 1D3WA 4NMXA 4G1QB 2K1RB 2OPRB 5B0GA 5EUHA 2HRUA 3RB0A 3UN3A 5I3UA 3CJKB 3MPVA 5CD4A 2CZ9A 3POTB 1Y11A 2HVDA 5E33A 2IRXA 1XMQJ 1WI6A 1M1GA 3VAJA 2DRDA 4UOCA 1YJUA 5IV3A 1RT6B 4X64F 1HW8A 1JNZB 1DY3A 1FTRA 3B82A 2ZE2B 3A1YG 2JLFA 1FDNA 3KJVA 1YZ6A 3UCZP 1HHTP 1Y5NB 2EI5A 5IC6B 1T0TV 3EDRB 5ETMA 1LXNA 3RBZA 1S1XA 5JVHQ 1NJXA 3GJRB 2YPYA 2Y9HA 2QYCA 5HROA 5CYMA 3SFUA 5E41A 2OD6A 4YY3F 4UY8T 3QZ7A 3M7VA 5HBMA 1RT7A 3W60A 1NK8A 5M2PA 4F67A 1SIWB 1YJTA 4O44B 1LEOA 4PQAA 1TVRA 3DNCA 2HNYA 2X1GA 3KXDA 1KD1T 3DRSA 4NLPA 3CCMS 1VLOA 4NI2A 2D3OR 1C0TB 3DLJA 1AZSA 4ECSA 2H48B 4PXDA 1K44A 1NPPA 5K9FA 1HNZJ 4BCAA 1RHQB 1IR1A 2CQHA 3FNNA 2DGSA 3OFFA 1HD0A 4O3RA 2RNEA 4NZ0A 3DM2A 3I6PA 3RYLA 2CPHA 3EZOA 1YDLA 1OPZA 2B3TB 4EYIB 2K3KA 4NLXA 1Y10A 3MAAA 3OFEA 4M63A 3UDVA 2KG1A 2MYFA 3DHWC 1HQ2A 3W66A 4DUYJ 1I1GA 3BR9A 1FNXH 1JJHA 2V2VA 3SBMA 2BVZA 3ZZTA 4JB8B 1OY9A 3GP9A 3PV8A 4RW4B 2VQEJ 3D1QA 2G4BA 3HI9A 4CLSA 1I5OB 3MR6A 2DBBA 1CQNA 1PAUB 5LOQA 5KG0A 4DL6A 1YX2A 2MQ8A 4JP8A 3I5BA 5K14B 5I4MA 2MZSA 3RR8A 1IVZA 4IH7A 1KS2A 1WC5A 1EP4A 1O51A 3MDFA 3LWLA 1QD1A 1XQIA 2MZJA 1B70B 3H2LA 4WK1A 5C25A 4OJ3A 1NBEB 1BQMB 3BPDA 4J9LA 2OUGA 4OHWA 2GNKA 3V4MA 3NL0A 4Q0BA 1U02A 3DI6B 1TMMA 2Z2MA 2M70A 1NKEA 4L3NA 3DC2A 3K5LA 4DCJB 4KGVB 4V1Ak 1RAJA 4NLQA 4X2BA 1BWVA 2C3UA 1WKKA 2EPIA 4ZA1A 1NUEA 3SDEB 2G0IA 1TKXA 2W9CA 2M0GB 4CO4A 3NG8A 1U47A 4LFAJ 1U26A 2IHR1 4JV5F 4O4GA 1HNIB 1YVFA 4B3RF 3OTOJ 4WBFA 4EBCA 4ZVUB 4C48A 3I4HX 2WW4A 1SC4B 4RLEA 4RU2A 1RWUA 4QWCA 4PZVA 4LF8J 3V6HA 3N9UC 5FD1A 1F3FA 4GKJJ 2HPUA 3M6XA 7FD1A 1N5VA 4P71A 3CCJS 3OR2B 1FNMA 3DOLA 3SXLA 1VFJA 4ZN3A 1S6UA 5HMYA 5KFZA 9RUBA 1HBMA 2HBRB 3GMGA 4ZPAA 4OJ1A 2OP5A 3CIZA 5JXSA 5KG2A 2XMAA 4CYUA 2CIMA 1TKZB 3GIMA 2PO4A 2D74B 1JLBA 4J90A 4B9SA 3FJ2A 5E3RA 4DR7F 4YEAA 2GFFA 3QAEA 3W9HA 2FVSA 5ETQA 2FGOA 3BZQA 2EFGA 4JI8J 4ANCA 3P6YC 1S0MA 1VBKA 2G0CA 1CJTA 1FE4A 4LF5F 5DG9A 4K50A 3U1LA 3JSMB 3W5ZA 5CQGA 1NDKA 1SBRA 2BQRA 3JQMA 2HNDB 3OPKA 1VDHA 1GX5A 1Q4RA 1NK0A 3HD1A 2LDYA 1WF2A 3KDNA 5HN0A 4A8OA 3BGFA 4DL7A 1IKWB 5LM7E 3BKUA 5BR8F 1TKDA 3UVJA 2GVDA 2DPIA 1UA0A 2QA2A 2VPZB 4OV6A 2Q66A 2XI3A 3BSNA 5L9XA 2BJ8A 3R6LB 2HHSA 4M1KA 1NKBA 4B9MA 2ZVSA 3OLAA 3NY0A 3T19A 5J2QA 4CT9A 4ITSA 4OYAA 4WIQA 4IO9Q 5DG8A 1RCXB 4AL6A 3P5TL 5IT9Y 3HJFA 1FD2A 3M9NB 1T95A 3E51A 1TP7A 1Q5YA 2GJFA 3ETOA 3G87A 1KLNA 5DQGA 2RSQA 1E6VB 1FJEB 1FX2A 1XMOJ 2VC0A 3OTCA 4LF4F 2BW7A 1QVGR 4USUA 3W2WB 5IM0A 1H74A 4C7QA 3TOQA 2HMIA 3DLKA 1NJYA 3DHXA 1TL1A 4FF3A 4ZVEA 2MY8A 3C6TB 4CZCA 2BABA 2NUHA 4G1PA 2CJ9A 3ZNUA 3MGJA 3CCZA 4KKOA 3NCPA 1S79A 1D9FA 3PX6A 1RT4A 4GVBB 2N7YA 1GNKA 6FD1A 3TANA 1KVJA 3T1AA 3EVWA 4A8FA 1X31C 2CPJA 2MXYA 2W9BA 1YG0A 3BGUA 4UOGA 1GAOA 1KDNA 2MLZA 4W92B 4XPCA 2AJ1A 1MW7A 4ID5A 3SYZA 2RF2B 2GO8A 3ZZPA 5F8GA 2DR9A 2BUNA 3MMBB 3MR3A 2HBZB 2EBGA 2HQFA 4NRUA 3M9OB 1HLWA 2DIUA 2H5EA 3LAMA 5LXRA 4Y2AA 4C8ZA 1R0BG 1EX8A 2AU0A 4LF6J 2G1DA 5HO4A 5DO2A 3HK2A 3CT9A 3N6LA 2DR8A 4JI7F 2YY3A 2DHSA 3PACA 2UP1A 2BE2B 3FZ2A 3CCRS 1LWEB 3GB0A 1R6VA 4CCHA 1DTTA 4I7FB 4ZS6A 3A8IA 3G6YA 1CJKB 3DXBA 3AD7C 1SKRA 5KOXA 3F73A 3OJUA 3K5PA 2HG4A 1IBMJ 4RW6A 2R7OA 3R5JB 3PTWA 1HPZB 1V5VA 2QLXA 3KLGA 5KFGA 4DPTA 5HANA 5GADI 2ZWOA 2Y1IA 2HS0A 2RVJA 1KQGB 4I6AA 2A2CA 1FK9B 1EZZB 1ZH5A 3CC2S 4ZLNA 2VPYB 1YSJA 2MTLA 3PRVA 4LFCJ 1VBYA 4EMDA 3MR7A 5D15A 3MEGB 2VFRA 1N5YA 3T1HF 2QFIA 2VD3A 3AXKA 1UPMB 2Z57B 1AFIA 1N5TA 5FDLA 3OSNA 3PEHA 1TFWA 1RGVA 3Q2TC 4CLLA 2QE5A 1SL1A 3ADAC 4QPTA 1PGZA 4KGXB 5ETOA 2E1MC 2FLOA 3VV2B 1TL4A 3QRRA 3KK1B 4DF4A 2CG8A 1J5OB 5K5MA 4NXMF 4R8UA 4DV7J 3VAFA 3BN4A 4E8UA 1U1LA 5HP1A 1WOPA 1SC3B 1HI8A 2A2DA 2FQQB 3LQVA 2E9RX 1ZBTA 1XNQJ 5EGYA 2C2OB 4A8WA 4DV4J 4JI4F 3PX0A 3CEDA 5H9FK 1CJUB 1RJJA 2QRRA 1KOOA 5AXNA 1NK6A 1IWGA 4ZP6A 4ZMMA 4X4QA 2MGZA 1G7CB 5KFIA 3ZZUA 1NKCA 3H5YA 5B0EA 3W64A 3SSQA 2DR6A 1RKJA 4KPYA 2C2NA 5K8OA 4DG1A 5HQ8A 2LMIA 4NXNF 1FVSA 1RT3B 5KFAA 3HULA 1S6PB 1VQ6S 4P52A 2OKQA 1NSAA 3C19A 3MTJA 1EIYB 4DS5A 4KGZB 3ZZ0A 2FVQA 4WKYA 3PFEA 4IFYA 2G1HA 5AJ3J 4ICLB 3HVWA 5KFRA 3TYTA 3IG1B 4FBTA 3HT0A 2EC2A 3AJ2A 2QMXA 4KC5A 1FERA 2QZ8A 3ET6B 1GXLA 1H6KX 2JHEA 2GJIA 2MKJA 3PX4A 3JSYA 1SJFA 2M9KA 3C15B 4O3OA 1U48A 5T41A 4FPIA 3V4IA 2WB4A 4DL0C 3NBPB 1PKUA 2VG7A 1R43A 1KFSA 2Z2YB 4NLOA 1K1QA 4B9VA 2XGPA 1WDDA 5KFFA 5CD4H 2ZBCA 2XY5A 2NXNA 4F7VA 2RHSB 4YB5A 4L76A 5JVGQ 1C0UB 4ED6A 5D0GA 3TQ1A 5AE1A 2J7UA 1FWPA 2R7QA 2YBVA 4IOCQ 5FLXU 2H65B 3U7JA 3R8YA 3P4UB 4K4YA 3CMQA 3W8PA 2HHHF 1YZ7A 2YKMA 1MSWD 3L95X 5CYQA 4MFBA 3WX8A 2K06A 1SL2A 2WONB 3G9CA 4MIBA 2MEWA 3OR1A 5GAHU 2OGUA 2O1PA 4QU6A 2ZH3A 2VQFF 4KAIA 3KK2B 1NMEB 2EVZA 1H7XA 1HHSA 3LGHA 2UV8G 1JK9B 2RDIA 4P72A 3ZTPA 4IG0B 3G4SS 2PD1A 4DLEA 2AQ4A 1HBUA 1K0VA 2ZITA 3E01A 3M2VA 2RB7A 2B6AA 5EX3A 3LPYA 3QWPA 3CW2C 2X1BA 1MU2A 4OHVA 3DOKB 2Y8YA 5B0AA 5B0DA 4LF1A 4A4JA 2XLJA 4IOBA 5C24A 2R8GA 4F4WA 1IQTA 4LVOP 3RRKA 3IAM9 3T41A 2VB6A 3CDUA 4K5SA 1G3OA 5HI7A 2U1AA 5HK4A 4QJVA 1NSQA 4OLPA 2CDRB 2RQKA 3BKTA 5BYSA 2RS2A 3NMAA 2FYXA 2CJYB 5K8MA 2R7XA 2IIHA 2ATCB 2HFUA 1URRA 2L9WA 2O67A 2YWKA 2I1RA 3CJTA 4G1QA 4NYZA 2K1RA 5LT5A 1RACB 1OWXA 2DGUA 5GAGI 3PJXA 2IYGA 3J80Y 2J0XA 4DV0J 1ROFA 2P5VA 3CJKA 4F02A 5B0BA 1RWNB 4XIUA 3POTA 2E29A 2LYVA 3DLHA 1NJIT 4EBDA 4B08A 3K89A 3LO3A 4ZP7A 4LFBJ 1RT6A 2QYGA 2E7VA 5E7OB 2ZE2A 2RQCA 4DCOB 4ZPWR 5AXLA 1NPRA 2ATLA 3QSIA 3AD8C 1RISA 2X3DA 4P75A 1ZM2A 2DHXA 1U8SA 4FF2A 3TAQA 4GKKJ 1FRKA 2F9JA 1WC4A 5L9NA 4ED3A 4DFJA 4Q8EA 4DSEA 1NM2A 1VQ7S 2A0FB 3IGNA 3TAMA 3D54A 2CWKA 4TY8B 1ZS6A 3LANA 2M3DA 3ZXWA 2WVDA 5D4NA 1PBUA 4O44A 1BD6A 1H98A 1TL7B 4PG4A 4C8KA 4WXWA 2FZCB 2HQ3A 2J8AA 2FHMA 1LFWA 2MKYA 3O8WA 2KL8A 3PFOA 3T6JA 3CCUS 1PC5A 2ZDPA 4FF1A 1BUXA 1C0TA 2AMCB 4OYOA 2MQNA 4ES2A 2MKHA 2OSRA 2Z2LA 2QL7B 3CSKA 1ACMB 2E44A 3Q22A 1N8RT 1JX4A 1KWMA 3FBEA 2DCLA 1SKWA 5IV4A 5KFQA 5D8HB 3C6UB 1UVNA 4LIWA 1RWXB 1S0OA 3GWCA 2F7VA 3VGSA 5LSRA 2VHGA 2UXCJ 1REVB 3ISND 1KBRA 2E9ZA 2F4VF 2DXDA 4OX6A 3OTDA 4CLYA 1NB7A 2AW0A 3S1TA 2R8JA 4V19J 1ZZNA 1XK8A 5KFHA 3BQ0A 4RW4A 4IRCA 1HNXF 1RADB 1UFWA 1CVJA 1D09B 2GMLA 4ILMA 5KFLA 4CLFA 4NX9A 3K0JA 2LEBA 4X66J 4O0IA 3LUYA 5KT6A 2YWHA 1XWLA 3BJYA 1TV6B 4QWDA 4WFYA 1JJ4A 3H90A 1S0NA 1I51B 1S1WB 1XMBA 2ILYA 3WBZA 4ZITA 5KT3A 2FHOB 1SIZA 2FTRA 4RZRA 3T5JA 2OIHA 3NS7B 2B7BB 4DR4F 2XS2A 2VG6B 3W9IA 1BQMA 1KLMB 3D6HB 4TLQA 2FJBB 2AF6A 1O6XA 3H20A 2EG1A 4OZNA 1TTHB 3S8SA 3BF4A 5E3CA 3MM8B 3KLEB 2QSWA 1FA0A 2WVCA 3WC0A 3OD2A 3CJ0A 2ZEJA 5HAOA 2FZKB 5SUHA 5M2UA 1ZPWX 3BSAA 1TR0A 3TRGA 1V3ZA 5A2QY 2ZH6A 3SDEA 3GJTB 2OFGX 1S9EB 5ETKA 4DV2F 2DJWA 2MQOA 3G82B 5KFNA 2XCPA 2JC1A 4WU2A 2LQJA 4Q45A 2X1FA 1FRHA 4PPDA 2O01C 1T7PA 2HVZA 1HNIA 4ED5A 5L1JA 4ILLA 4OX8A 5HQLA 2NUUG 3PHEA 2KYXA 3L9ZA 3NWGA 2KO1A 4KQZA 4OZLA 1FRXA 4QYZJ 1BLUA 4RW9B 2Z2ZA 3BREA 2GJ2A 2HEKA 4A46A 3DXSX 2CPFA 4DR5J 2DH7A 1LWFB 1KFDA 2I0XA 4M95A 2YX4A 3OR2A 4N5SA 4LR7A 1RTJB 4U95A 3T1YJ 2W4PA 4HACA 1HWJA 2BJ1A 3Q8SB 3SCLE 2PI4A 3UDEA 2V8HA 1GFWB 4TQRA 1JLFB 4IDKB 2LECA 2AX1A 1RU2A 3VGTA 3MM5B 1TKZA 4N77A 4EUVA 1BMQB 3GLJA 1NNDA 2ZZTA 3T6BA 3IBCB 2XWXA 1FJGJ 2VU5A 4NEYA 3HJVA 1UCNA 1C1BA 3MMAA 3PYEA 2DIVA 2ZNYA 4X62F 2UVVA 5DGBA 3HHLC 5CXTA 3FVYA 3JQJA 4O3NA 3JSMA 3CCVS 2HQIA 3HVTB 3JTNA 5EDWA 3M8YA 1B0TA 2EXUA 3KG0A 4JI0J 2CZVC 3MCNA 1RTHB 2HNDA 2UUTA 2RAQA 2YNFB 5KT5A 1X4GA 3IXQA 3CJ8A 4KY3A 5HSPA 2D3UA 5KG3A 3GSDA 4OJGA 1IKWA 2NREA 4XDCA 4B3MF 4QIEA 3BSOA 2R2UA 1VJWA 2FC8A 1KKHA 2RDDA 4I6YA 4ZPCA 3IR6B 1VCTA 2AV5A 2DO4A 4QIVA 5DJBA 3SV3A 2CJAA 2DNZA 2QTWA 2F9DA 4GO7X 3SCJE 1HBNA 3N79A 1I3OB 2XMMA 3HHLB 5HJYA 2C2KB 2EKYA 3FFIB 3JAMY 3HMJG 2N3OA 3H5SA 1X9WA 5ETTA 4U6PA 2GMJA 3KTQA 2PC6A 5LMUF 1X5TA 3S01A 3R1HA 5EWEA 3UD5A 2W2OP 2IYIA 1U1KA 2W2PP 2HSEB 3G6XA 5H9EK 3H42A 3MCMA 3IRWP 2WBMA 3CCQS 3HKZD 3UQSA 4RR5A 1D8ZA 4DSJA 2D9PA 1E6VA 1OO0B 2CNLB 4MTPA 1DQAA 3NMRA 5CAAA 2YKQA 4PXCA 3PO4A 3W2WA 3GV7B 3H4DA 4IKAA 2V8GA 3TVZA 4IR1A 3EVOA 3A12A 2YNHA 5JMNA 1R0CB 2UVRA 3AT1B 3ILOA 3C6TA 4RPFA 4DPYA 2NXUA 1T9UA 1KVKA 4P10A 5L46A 1PILA 4GVBA 2U2FA 3W9JA 3SV4A 2AEJA 3HVRA 4CO0A 4JV2A 2HVEA 2J6UA 5CA5A 2MY7A 4CM2A 5HMXA 2GO9A 5A8KB 2JH3A 2PFFB 4JOUA 2ZWPA 4IYQA 2J76E 2RF2A 4LSNA 4C8OA 4ZCKA 2LA4A 4DOZA 3IN5A 4B3OB 3MMBA 5CCMA 4JI3J 4ZJOA 1UA1A 2O5DA 3TA0A 3AB4B 4ZPTR 4KFBB 1FRIA 4FS1A 5D77A 3MUVP 4UW2A 4XDDA 4KSEB 4EZ6A 4PG6A 2DKOB 3UW1A 2XMJA 3CXCR 1RAOA 2WK4A 1HWLA 3HVAA 5LMNJ 2BBEA 1BGXT 2BE2A 2BV3A 1X5PA 2HHXA 2VH7A 1XEZA 4I0WA 1LWEA 3GYNA 3FCWA 4MMOA 2QSFA 1SJ3P 2R9LA 4I7FA 1S7IA 4J9PA 2IRYA 4DV6J 3MMCA 1U6FA 3AD9C 2KB2A 1FKOB 4RW7B 3F56A 3HSJA 4GC6A 1JLGA 3OVSA 2UUWA 4ZHRA 2XG8A 1NDLA 1IBKJ 2K2PA 1HPZA 2J0QD 2BKPA 2YNIA 3W1YC 1RT1B 1MN7A 3OT9A 3HT3A 1FK9A 4F3OA 1FEHA 4R5PB 3PY8A 4OMFG 2ZBPA 5IZHA 3GIIA 3BQ1A 5KFUA 4X65F 1T9XA 3PXGa 1CS4B 4KIAA 3EGVA 1Y7PA 3VVTA 1T03B 3MEGA 1UWBB 2J7WA 1SKUB 3Q83A 4B3TJ 4WIIA 3FMWA 4WE1B 1UL3A 4P73A 1WC6A 4A8XA 1U7LA 1Q8KA 1N48A 1UJ6A 2Y0BB 4ED1A 4QIFA 3G8SA 3QLHA 3QT7A 3ILLA 3NOCA 2A6OA 2V34A 1EKSA 3K5OA 1U2CA 1YQHA 4DR6J 2M88A 2EFPA 4CH0S 1XC9A 4OX7A 4C3KA 1HNVB 3KK1A 3ISZA 3IC1A 2ZKTA 1J5OA 2UUBF 3M32B 1FWLA 4B3SF 4N41A 1VISA 4RNMA 1WG5A 2ADBA 1N52B 4LRCA 1S5ZA 4PWUA 3CULA 2Y3YA 2UUCF 3H5UA 1HR0F 2AYBA 5GMKa 3OJSA 3KHGA 4C11B 2G2ZA 2BJ7A 1UVMA 1CJUA 1R8CA 4NA2A 4F04B 2WVBA 5HQMA 1WACA 4LSLB 3K5MA 3M8QB 2HW3A 2XMTA 2L08A 2L48A 3QJPA 3WX4A 2LEAA 4WXOA 4WWSA 1YITS 2BJEA 3I0SB 3P5BP 2IRUA 4YB7A 3D1HA 3LP1B 2CQGA 4AE5A 3KNAA 4OYIA 5E0OA 4CTAB 1S6PA 3NLCA 3AOBA 1AT1B 5ETLA 5C2GA 3EDQB 3HSDA 3Q23A 2EW9A 2PEBA 3TI0A 3DRPA 1EQMA 2RRBA 5D6GA 1F9EB 2JFKA 3IG1A 5THWA 3R27A 5GMDA 1B64A 4DXLA 4LRDA 4TU7A 5RUBA 1GMVA 3ET6A 3IAS9 4K0KF 1FRLA 2CJBA 1WJ9A 4LRFA 4OZ0A 3C15A 3TZZA 2RQMA 3G8QA 3THTA 3GU0A 4DDFA 2NR0A 3DDNA 3UDLA 4F3MA 3M8ZA 1CQMA 2VFUA 5F8NA 4Y34A 4F50A 3M6VA 3QMQA 2E5HA 1H7WA 1BQNB 1TKTB 3LOUA 5F41A 1SJ4P 2NYHA 4F0MA 2GZOA 2YTCA 1C0UA 3HZEA 4X4TA 1S4FA 2EC0A 3MM9A 1VR6A 4HEA9 4LQ3A 2IAJB 4C0BA 4K4ZA 3EUNA 2KYZA 4GO5X 5J2NB 2KRRA 1TK0A 2J6TA 3DU5A 2BACA 1VRUB 5CCLA 3QGIA 4UY85 3FEYB 3ZC4A 5HVHA 3J80U 1KRPA 2ZOMA 5CZVA 1M90T 2WONA 3U27A 4CLPA 2XYPB 1SH0A 3K59A 3M30B 4LF7F 3FMBA 1WOOA 3KK2A 1I94J 4HR2A 1NXIA 2Q3PA 3QNWB 2FLLA 2YNGB 1V6HA 3RBDA 1SH3A 1BQXA 4AL5A 1FX4A 4IG0A 1KTQA 1Z4UA 2HHPA 2YPZA 1FXDA 3D68A 2Q79A 2ZH2A 2RU3A 3J7Z5 2ACMA 4USIA 2RT3A 2VKRA 5F3ZA 1PG5B 5F8HA 2X7IA 3TEGA 4EGLA 2R8HA 3DOKA 4NMLA 1C1CB 5F8IA 2GCFA 3DLLQ 1XJWB 2AKWB 1SJRA 1L3KA 2DHHA 5LXYA 4ES1A 1N34F 2MJUA 3H7HB 2V8DA 3P49B 1CJVB 4JV0A 2ZJQQ 1VI7A 1FDDA 1B0VA 4YHHF 2YXLA 2PSZA 4USKA 4USJC 1U1NA 3D28A 2XYGB 1YHQS 3BM7A 1KVIA 1KOHA 4BWMA 4RBVA 2UXBF 4X4UA 3JXOA 1S49A 4OYBA 2CNKB 4NEZA 2CNNB 2XY7A 5C5JA 2G2YA 5KT7A 2N4DA 1R0AA 2CNOB 1XNRF 1RLDA 1EETB 1T05B 4UZCA 3JSBA 3KUHA 1U1QA 2ASJA 4J37A 2HYIB 4Y2IA 3D4JA 4IRKA 3MD1A 1EKRA 3OLBA 3CD5A 2PGCA 4Q2LA 4JI1F 3BPSP 4DV3J 3LA0A 2MKKA 1FRJA 2WOMA 2XMKA 2EEYA 3EPIA 3PRBA 2EG2A 1JKHB 4FXWA 3MM7B 4OZ2A 1NHKL 4JBCA 2PMHA 2W2NP 2HFZA 3KJFB 1RE1B 1GH8A 2MLYA 1QSYA 4EZ9A 4H4OB 3I82A 4UTGA 3W3SA 4JI5F 2OAUA 2KM8C 3PHTA 2B9WA 2OEKA 4TY8A 5I42B 5KFOA 4QWBA 4USVA 5KFCA 1QAXA 4DQQA 4XAKA 1TL7A 1N32J 4MKBA 3G96A 2DEJA 5A0YB 2WVFA 2VOOA 2ROGA 1U8WA 1UP1A 2CPXA 1VQ4S 4HHHA 1S1UB 2LQ8A 4C97A 4ECWA 3R1LA 6AT1B 4B9LA 1S76D 1VK3A 4JI2J 1GTEA 3M8RA 5DG7A 1PBAA 3SZ2A 4CH1A 1ZAWA 4JYAJ 1J5EJ 2ZH4A 3JYTB 4H4MB 3M2UA 1GT8A 3KKFA 4P2XA 3T5HA 4F4XA 3ZTOA 2IA6A 3FRYA 3VR1A 4DF8A 2LQBA 3C6UA 5GMEA 5I3QA 4ED8A 3IS9B 2PT0A 4V19X 3KHHA 1Y5LB 4AT1B 3RUBL 5DETA 5GADU 2KM8B 3CWJA 4J9RA 4DSLA 1REVA 2VBWA 1S9GB 2MPUA 2HS4A 4CO3A 4DJBA 3OVAA 1XR7A 4DX6A 1WSRA 2AYEA 3KHRA 1LOUA 1XMQF 4IFVB 3DLEB 3G2XA 3HHDA 2EFVA 1FJ7A 1T9VA 2E5LJ 2G2OA 5CYJA 3VAGA 4MKVA 1BWEA 2GHVC 5KFPA 3QO9B 3MF5A 1O5JA 4USTA 1KNZA 3FKBA 2XI2A 4BWJA 1U0HA 2DPJA 4URQU 3TR5A 1SI9A 1CLFA 3KFWX 3TX0A 4OI0A 2DGWA 4YB1P 4PWDB 4B02A 1TZ0A 3KLVA 3O44A 2V67A 4IG3B 2P6SA 1SKSA 3OL7A 1S1WA 1TL5A 1RZMA 1ZTWA 1DBDA 2VBZA 3MEDB 1KONA 4Y2KA 2VG6A 4HTIA 1YBAA 1P1TA 1KLMA 1U49A
chains in the Genus database with same CATH topology
4HVZA 1T3NA 3LGMA 3QJLA 4ECRA 3PVXA 4CI0B 3ZZ0A 4Y0FA 1WHXA 2GV1A 4RX6A 1IJFB 4WKYA 2FVQA 3PFEA 1VQSA 2RMLA 2F8EX 3RAMA 2DCUB 4DPOA 1UVJA 3MM8A 4IFYA 2JVRA 1LKZA 1NB7A 4ICLB 4XO0A 1KQSR 3HVWA 5KG5A 4NCBA 5KFRA 4LF6F 3TYTA 3IG1B 1SB6A 3RZAA 3K57A 1LW0B 2ZHBA 3MCSA 4FBTA 6FDRA 4DL3A 3H98A 5IS2A 1P1LA 4IUFA 3AJ2A 2QMXA 2MKSA 2YH1A 3RB6A 3CMES 4ED0A 1C1BB 3MMAB 1FERA 4KC5A 2QZ8A 5F9LA 1GXLA 1H6KX 1AUDA 2JHEA 2GJIA 2BYCA 2MKJA 3PX4A 2HZCA 1S9EA 5KFKA 5DM7Q 3JSYA 4X4SA 2CQ4A 2CRLA 1SJFA 4OHXA 4ZP9A 3TARA 1IKVB 1D9AA 2J7KA 3QGPA 1LW2B 2M9KA 3LALA 4O3OA 4JI3F 1CPZA 1U48A 4MJKA 4KRWA 5T41A 1HNZF 5GAHI 4LMZA 2ZOGA 1T94A 2XMVA 2ERRA 1NH7A 3KLIA 1VQYA 3G86A 1VQMS 3V4IA 3UCGA 3H59A 3B78A 3MEEB 2WTFA 2WB4A 4PKDB 2JL9A 1U6ZA 3OQ2A 1ZOTA 4K59A 4C3LA 1V3SA 1KEKA 4IQXA 4WK3A 2HGLA 2V0NA 3I31A 4DL0C 3NBPB 3ONQA 1M0SA 2VG7A 4QW9A 1R43A 1KFSA 2ZZNA 1VQPS 2OPSB 4NLOA 3JTPA 3Q8RB 1K1QA 1D9DA 3DRXA 1SV5B 2J9DE 2FVRA 2L3MA 4B9VA 3DYAB 2XGPA 3OXFA 2F1FA 2RILA 2HNZB 2G13A 2LKZA 3I5AA 4RNHA 5KFFA 5H9EJ 3OVBA 2M52A 5CD4H 2ZBCA 4QR2A 4RW9A 2XY5A 3ULHA 3RAXA 4MK9A 4J9NA 5B09A 2IJFA 4U7UK 3S6EA 3PW2A 1XN9A 5DDRC 4OI4A 1HARA 1DQ9A 3Q8QB 4I2PB 3QGHA 2GGPA 4DUYF 4PUOA 2RKIB 3Q2SC 4YB5A 2CFXA 2FGCA 5E3QA 5LMNF 2FB0A 1S1TA 5JVGQ 1C0UB 2R7RA 3EGNA 4WCEQ 1TUVA 1RT2B 4Y6IA 3PIPQ 2WHOA 1LK5A 3GE9A 3KK3B 4ED6A 2NZ4A 2IVYA 3TQ1A 2LQ5A 2VQEF 5D4LA 3ZZYA 3QZ8A 1UETA 4CTAA 5AE1A 1RTJA 1Z2LA 2J7UA 3Q0AA 4A8YA 3KWMA 5E5NA 2R7QA 4IOCQ 3WZ0A 3UCUP 1P9QC 2B56A 2LDIA 3U7JA 3FEXB 5KTQA 4I56A 4OV1A 1R8PA 1RA6A 4DV6F 2KI2A 1JLFA 4K4YA 3NNCA 4IDKA 2KFZA 1MMNA 5KOWA 1S97A 3DLGA 4Y28C 1P27B 3HHNB 1DURA 1P6TA 1G2EA 1HBNB 2DB1A 3IFEA 4DL4A 2XMUA 2C3PA 3PO5A 2MB0B 2IM3A 2HHHF 1IKYB 3HHLD 2QA4S 2YKMA 4R0JA 5AXMA 4C8MA 3L95X 5CYQA 3CF5Q 1MSWD 2MZTA 1U1RA 2NSBA 4MFBA 2Q6BA 3UE2A 1IBKF 4DWIA 2CPEA 2BZ2A 1SL2A 4R0EA 2WONB 2ZBIA 3MURP 3LP2B 1L3SA 1FKPB 4MIBA 3G9CA 4HYKA 3OR1A 5GAHU 1S6QB 3MAHA 2BR0A 1JB0C 4TNOA 2IFXA 2O1PA 4I67A 4QU6A 2E5JA 2ZH3A 1H2UX 1FDBA 5KFTA 2VQFF 4KAIA 5F0WA 3KK2B 1ZZFA 5J1EB 1TK5A 2EVZA 3US5A 4QIGA 1GTHA 2HMIB 2LLZA 4IQMA 4AUKA 1LK7A 4H54A 2AGQA 1H7XA 1HHSA 1VOMA 5I3UB 2UV8G 4YR3A 2YVSA 2V4JB 3KG1A 5K8NA 2HHUA 4ECYA 1JK9B 2RDIA 1TL1B 1YTYA 4KBIA 2RIJA 3TUZC 4NCAA 1DQ8A 4RNFA 3FSYA 4IG0B 4A8SA 1FXLA 5KT2A 4J9MA 3G4SS 3D5MA 4TU8A 1HL6A 2CKWA 2PD1A 4DLEA 1VIOA 2DH9A 5B0FA 2AQ4A 2AJ4A 2OTJS 1HBUA 3OTEA 3HVTA 3GR0A 2DR7A 5IXUA 3W7BA 3ZZRA 4W90B 1UMJA 1K0VA 4KHMA 2KHCA 5E2QA 1VMBA 2ZITA 3E01A 2ASLA 1DLOB 3M2VA 2RB7A 4ZVFA 1RTHA 2I38A 1QUVA 2B6AA 4B3TF 3KLFA 1S77D 3UPFA 5KG7A 1O8BA 2F40A 2FJDB 5EX3A 1Q7LB 2M4MA 2YNFA 5A8RA 1RT4B 2GA7A 3B4DA 1S7HA 3LPYA 3QWPA 1FD8A 2JOQA 1JIHA 3GFYA 2X1BA 2MQPA 1TKTA 1MU2A 4OHVA 4ZLPA 2APOA 3DOKB 2VODA 2AD9A 2YNHB 2JLGA 1X4DA 3GFZA 5B0AA 4RWXA 5FLXY 2DRAA 1W2IA 3N5FA 4EO8A 4NLUA 2N3LA 5B0DA 3H8YA 2W9BB 2B43A 2M5YA 2DGXA 1U2RA 4A4JA 2XLJA 4IOBA 4LFAF 5C24A 4NPOA 3R3TA 4NLTA 4RW8B 4QWEA 2DGVA 3BSCA 5E3PA 3VF0B 2R8GA 4F4WA 4M94A 1IQTA 3GG0A 1RTIA 2LQ9A 2QFJA 2V9WA 3ENVA 4RWWA 4LVOP 2XNQA 4X4OA 1WNEA 2ADCA 2IBKA 4DR6F 5BJRA 2FDNA 3E2EA 3RRKA 3IAM9 3CB4A 2V4RA 2BDPA 2MJNA 3N01A 4ZCMA 4RUAA 3OTOF 5L39A 3VALA 4U9RA 2KXNB 3HFKA 3J7YI 2VB6A 3CDUA 1VRUA 4WF9Q 4K5SA 3TNVA 1G3OA 5HBMB 5HI7A 1Y00A 2U1AA 4QJVA 1WEXA 2CDQA 2IVFB 4DL2A 1RT7B 3BGRB 4OLPA 3MMJA 2RQKA 5BYSA 2RS2A 2W8KA 3HHLA 3NMAA 1WHYA 2PEHA 3KOAA 1TQLA 5K8MA 2R7XA 2MSTA 2KHDA 4MIWA 4DEZA 4LF8F 4NZ7A 1URRA 1N56A 2CJKA 3N6NA 3DFEA 3VCDA 1FKAF 3ZZZA 3VAHA 2L9WA 2O67A 3FGVA 3RU0A 3BQ2A 4J9OA 5FJ4A 3RBEA 2YWKA 3DOMA 4GKJF 2I1RA 3S7RA 3DRSB 4DN9A 5DS7A 4G1QA 4Q44A 4QIWD 4NYZA 2K1RA 2ABYA 2CVEA 5LT5A 1MWYA 1OWXA 3H5XA 3QIDA 3M6UA 5DQHA 2DGUA 5GAGI 2DNOA 1AXQA 1HI0P 3PJXA 2IYGA 3J80Y 2RDJA 4LSNB 1C4AA 2J0XA 1DTQA 4IO1A 1ROFA 4YR0A 2P5VA 2ZC3A 4DLGA 1Q8IA 3CJKA 1OSDA 4F02A 3OFGA 2GIRA 5B0BA 2IMOA 2JC0A 4I2QA 4XIUA 1ZYQA 3POTA 1Y4ZB 2E29A 3I9V9 3DRRB 4DBQA 2E7WA 3I0RB 1T02A 5B08A 3BDEA 3WC2A 1F0XA 4EYHB 1WWHA 2FD2A 1N0UA 2LYVA 3DLHA 1NJIT 4ERDA 2QIFA 4EBDA 4B08A 1RI7A 5IQQA 3IRXB 4C2MA 5LSOA 4I1TA 3LO3A 1F60B 4QR1A 3PW7A 4ZP7A 1RT5A 4FYDA 1DTTB 2B4PA 4DS4A 1N6QB 1RT6A 2JRSA 2YKOA 3EPGA 3IBWA 4N76A 1Z2ZA 5E7OB 2ZE2A 2RQCA 4ECVA 4ZPWR 5AXLA 4P7TA 5C42A 1XBWA 3BN7A 2ATLA 1H0HB 3U1NA 3I4PA 4KGMA 2OTLS 5KFXA 1VC5A 1UW4A 3CCSS 1UAWA 3WDOA 2HS3A 3CD6S 4KO0B 1RISA 4ZVGA 1UKUA 4E0DA 1UVLA 2DTJA 4YP3A 4JI8F 4RW6B 1ZM2A 2DRBA 4NLSA 1R8HA 2DHXA 3KLGB 1U8SA 2C42A 2N7CA 4FF2A 4OI3A 3TAQA 1TK8A 3IWXA 4Y65A 4EWTA 1WELA 1SH2A 1FRKA 1VHFA 2F9JA 2XGQA 1FNOA 4KT0C 4TY9A 4LUBA 3H2UB 2P9CA 4DX8H 5L9NA 3UFCX 3CDBA 3MAQA 4ED3A 1VLYA 4DFJA 4Q8EA 3PM9A 4DSEA 4ES3A 2BJDA 1VQ7S 4KR0B 3IGNA 3TAMA 3D54A