2AD9A

Solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
GDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PTB bound to RNA: specific binding and implications for splicing regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords 5'-R(*CP*UP*CP*UP*CP*U)-3'
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ad9A00
2MKIA 2MQOA 2LECA 2JRSA 5MLCV 4UY8T 1X4BA 2KXHA 2J0QD 2DH8A 1FT8A 2MKKA 3BO2A 1U2FA 2KXFA 3VAKA 3DLLQ 2KG0A 2D9OA 3THTA 2MKSA 2V94A 3MD3A 3R27A 4TU9A 1R8PA 2MZSA 1U1PA 4Z2XA 1IQTA 2DITA 1U1OA 1DHMA 3LQVA 4QQBA 2YH0A 2EK1A 3BEGB 5ITHA 3CCES 2CJKA 4PRFA 1WELA 2F3JA 1FHTA 4WIIA 5D77A 2ADCA 2DGQA 2EVZA 1M5KC 2DHSA 4W92B 2L9WA 2KU7A 2WBRA 3H2VE 4YUDA 4IO9Q 3NMRA 1UAWA 3BO4A 1M5OC 3VAGA 4TLQA 5FJ4A 1VQNS 3US5A 1YHQS 3CCQS 2MKHA 2SXLA 4U67Q 1VQOS 2YKAA 4W90B 2E5GA 1Q81T 2DGUA 2CQPA 2MQNA 1K73T 2M8DB 1YI2S 1HD0A 2DNKA 3CUNA 1N8RT 1JJ2R 1Q86T 2MPUA 1FJ7A 2AYEA 2MJNA 2AYBA 1M90T 5CYJA 3CCMS 3Q2SC 1UP1A 2N7CA 2VONA 1U6FA 1HA1A 2X1BA 3VAMA 2MQMA 1U6BA 3HI9A 3MOJB 3FEYB 2DO0A 3CCJS 2LEBA 3RW7A 2M52A 2O3DA 1RKJA 1VQ8S 2YTCA 2RUGA 1D8ZA 3G4SS 3UD3P 5CXTA 4ED5A 5IM0A 1X4AA 3P6YC 3N9UC 2HZCA 3IRWP 1OWXA 2J0SD 1SJRA 3UCUP 1KOOA 2VOOA 2CPHA 3HHNB 2KH9A 1YJWS 3G9CA 2PEHA 1SXLA 2GHPA 2XNRA 2KRBA 2KI2A 2HVZA 2KYXA 2D9PA 4PKDB 2E44A 2DIVA 4YB1P 1KC8T 2XS2A 1H6KX 1O0PA 1FNXH 4UQTA 2NZ4A 3TYTA 3UD4P 2JVOA 3G71S 2ERRA 1L3KA 3MD1A 5EN1A 5HO4A 1HL6A 4OZ0A 3SXLA 1WWHA 1VQMS 1VC0A 1ZH5A 2J8AA 2CQ4A 2LCWA 2ZJQQ 2JVRA 2N3LA 2RQ4A 2RNEA 5GAHU 2OIHA 2DNQA 3MURP 3CCLS 5LSOA 2M88A 1DRZA 2NLWA 2CQ2A 2DHXA 3TP2A 2LA6A 2AYMA 2KVIA 2F9DA 4WFBQ 4PR6A 2MB0B 4A8XA 1X4FA 3LPYA 4C0OC 2YH1A 2U1AA 2EK6A 3P49B 2K8GA 3CC2S 4CQ1A 2A3JA 4WCEQ 2N3OA 3SDEA 3P5TL 2VODA 2RT3A 2RS2A 4C7QA 3CTRA 2CQ1A 2MQLA 1K8AT 2MSTA 1FXLA 2MXYA 3CCRS 3RW6A 1X5PA 5BJRA 4WFAQ 5LSLA 3MUMP 2DNGA 2MKJA 1FO1A 2DO4A 3VF0B 1X0FA 1VBZA 4CIOA 4WF9Q 2MZJA 2DNPA 4LIRA 3V4MA 1CVJA 2CQIA 2MZTA 2XSFA 2MMYA 3NNAA 1X4CA 1DZ5A 2XB2D 2ZJRQ 3ZZYA 5GAGU 3VAFA 1M1KT 2DISA 5DM6Q 2DNNA 2MZQA 1HD1A 5HL7Q 1WHVA 1VQ4S 4F02A 2U2FA 3EX7B 2CPIA 2DGXA 1G2EA 4C4WA 2KT5A 1U1NA 3JB9k 1WHYA 2G1DA 4V19X 1WEZA 3EGNA 4TU8A 3B4MA 4F25A 2FC8A 2CQGA 4QPTA 5DDPC 1H2VZ 1K9MT 1YTYA 3MUTP 3CULA 1P1TA 1YIJS 2E5IA 3J7ZT 5DM7Q 1U1MA 2DGOA 1H2UX 1WEYA 1WG5A 2RRAA 2I2YA 3OW2R 2LXIA 3ULHA 2MGZA 2FPHX 4P6QA 2DNMA 1VQ6S 2N82B 3S6EA 2M4MA 2RVJA 2YWKA 2G4BA 1BY9A 2DK2A 2MKCA 5DDQC 2HGMA 2KXNB 1JJHA 2LYVA 5LJ5Y 2LA4A 1U1LA 3CD6S 3G8SA 1N52B 2M7SA 3NNHA 1KD1T 1W2BR 2CPJA 2CPXA 4Y0FA 1OIAA 1NU4A 3UWTA 1OO0B 3CMAS 5GMKa 2VOPA 2X1FA 1QVGR 2MZ1A 1A9NB 3UCZP 1VC6A 1X4DA 1Q82T 2OJ3A 2E5HA 2RRBA 3Q2TC 3SMZA 2DH7A 1U1QA 2HGLA 2FY1A 5LXYA 1JJ4A 2DNLA 5JVGQ 5LJ3Y 2KRRA 1WF2A 2QFJA 1ZZFA 3S7RA 3VAHA 1NO8A 2MJUA 1VQ5S 2QA4S 2RQCA 1AUDA 1M5VC 1D9AA 2DGSA 2K3KA 1UW4A 2OSRA 3TO8A 2OSQA 2GO9A 1JMTA 2RS8A 3G8TA 2M0GB 2MZRA 2D3OR 5GADU 5H1SV 1QM9A 3PIOQ 2I38A 3H2UB 3ZZZA 4RU2A 1SJFA 1WI8A 4IUFA 3PIPQ 1KQSR 1OPIA 1N88A 3G6ES 2KG1A 2F9JA 2CPYA 3UCGA 2ZJPQ 2DNZA 2MQQA 2M2BA 2DNOA 1VQPS 4TU7A 4FXVA 3CXCR 2XNQA 3BS9A 1YJ9S 2CPFA 1PGZA 3BO3A 2LXUA 3S01A 1YJNS 5GVQA 1WEXA 2M70A 2UP1A 2Q79A 2OTLS 2LKZA 2CQBA 5DETA 3P3DA 2M9KA 3UE2A 1KOHA 1ZZNA 3R1HA 3EGZA 4M5DB 3MXHP 1N54B 2CQHA 3VAIA 2MY7A 5DDOC 2E5JA 1U1RA 4QU7A 1FJEB 1SJ4P 2CQDA 3L3CA 1UFWA 1VQ9S 4IOAQ 5JVHQ 2XS7A 1S79A 3CCSS 1X4EA 3I55S 5DDRC 1WTBA 2XS5A 2DHAA 3FEXB 3S8SA 3CPWR 1PO6A 1WF0A 5IM0B 2QEXS 4BS2A 1A7GE 2DNRA 1VQ7S 2OTJS 3I56S 3K0JA 1WF1A 1X4HA 2FC9A 4WKRA 1B7FA 1R8HA 2DGWA 2MSSA 2DH9A 2BZ2A 3SDEB 5IQQA 1VQKS 1X5SA 5LXRA 2J76E 1WG1A 2CQ3A 1VBYA 2CPZA 1F9FA 2FHOB 4LJMA 1SJ3P 3CCUS 4WFNQ 5D78A 2ADBA 2LEAA 3B4DA 2CQCA 2CPEA 1X5OA 1VBXA 2M8HA 2MHNA 4Y00A 1M5PC 1SJQA 3U1MA 5GAEU 3VALA 1U1KA 2LQ5A 2JX2A 3NNCA 3NS6A 2DGVA 4OZ1A 2MQPA 2LMIA 4CH0S 1YITS 2DB1A 4CH1A 2G0CA 2BOPA 1NJIT 2AYGA 4IOCQ 4J5OA 3D2WA 1WI6A 1VQLS 3MUVP 1X5TA 1YWXA 1S72S 1WHXA 4ERDA 2DHGA 2KN4A 3CCVS 2CQ0A 2CPDA 2AD9A 1WHWA 2L41A 1X4GA 3R1LA 1Q7YT 2DNYA 2DNHA 2JWNA 1URNA 3THPA 1H2TZ 1FJCA 2DGTA 2HGNA 3CC7S 5IFMA 1WG4A 3CC4S 1P27B 2KM8B 3U1LA 1XN9A 3CMES 2L08A 4FXWA 4F26A 1QVFR 3J7YU 2B0GA 2KFYA 3NS5A 5CA5A 4QU6A 3DXBA 2MY8A 2HYIB 4LMZA 2MGZB 2KM8C 1RK8A 1DBDA 3G96A 3MDFA 1VC5A 4EGLA 4ZKAA 3IWNC 2DIUA 3CF5Q 4YOEA 2RU3A 3VAJA 2KHCA 2X1GA 2PE8A 3MI7X 2MYFA 2X1AA
chains in the Genus database with same CATH superfamily
1SH2A 2MKIA 4IG0B 4TNOA 5F3ZA 2IC3B 2MQOA 2UVUA 2CFXA 3IAM9 3LGNA 3SCLE 3TAMB 4Q5VA 2J0QD 1FT8A 4UUWA 4JUZA 2IHR1 1YKWA 5KFKA 4P2SA 2KXFA 1TMJA 3C14B 2GCFA 4MFBA 4CLYA 3H20A 1VISA 4DS5A 4MKYA 5C24B 1JLEA 4LR9A 2OELA 2HBRB 1IM6A 1BMQB 2EFVA 4WZMA 1RT2B 2MKSA 2GFFA 4F4YA 3TJAA 3ZTPA 3MD3A 4I1TA 3SCIE 1C4AA 5CAAA 3RAMA 2UXDJ 3CD7A 2IRXA 3GR0A 4ILRA 1RT1B 2A18A 2YVSA 1F2GA 2AHOB 4I7FA 1LK5A 1O5JA 3UDVA 2HNZA 2YH0A 2R7XA 1KN6A 1SB6A 5ITHA 3K5MA 3CCES 1N48A 4EWTA 1VRUB 4LIWA 5KT4A 3UD3P 5SUHA 2FLLA 3JSBA 1EZZB 4JI8J 1WELA 2ROEA 3UNGC 2KKHA 3VHQA 4NLGA 1FHTA 2JL9A 4ECXA 1XMQJ 1VQ9S 2DXDA 3UR0A 2C2MB 2FHMA 2HAIA 4DSIA 1SL1A 3HJFA 2HBZB 4D3GA 1VK3A 2VB6A 1XQIA 1Y7PA 4H4KA 4Y2AA 3D67A 3OR2B 1PJ6A 4RR5A 4ZJQA 1S4FA 2KB2A 1CJUB 4UOFA 1FFGB 1YJTA 2O1PA 3CD0A 3CJ3A 3GJRB 3HZGA 3O3LA 1LFPA 4G1QA 1F5BA 3NL0A 5FJ4A 1YBAA 1VQNS 1S49A 1IWAA 1JXVA 1PCAA 3DYAA 2DRBA 4FXDA 1NDLA 4L74A 4CO5A 2DCLA 3DGPB 3KJVA 4LF7F 4NCBA 1PBAA 1NK9A 4OYWA 2DGUA 3M6WA 2M8DB 3PKMA 1RT1A 3FDSA 4ZIWA 1YI2S 4WFXA 2IYIA 3O44A 3UW1A 5I3UA 4LRBA 5DQHA 1ZS6A 2B56A 2QL9B 3CUNA 3KUHA 3RB6A 4DUYF 3K8VA 3OLAA 3B6BA 1RYRA 3B82A 4KSEB 2MPUA 2X3GA 4LMZA 3NLCA 2AYBA 3K89A 3MEGB 4ZKAA 3IWNC 1M90T 3CCMS 1RTIA 3VZIA 1LOUA 2RMLA 3DU5A 1U6FA 3C6TB 3P5BP 2BQUA 5D4NA 3OFGA 4KB7A 4CTAA 1CJKB 2ALYB 3CVKA 3W60A 1QAIA 1U6BA 3FEYB 2HHVA 2O66A 2X7IA 3JYTA 3V81A 2XSJA 3GSIA 4LBHA 1L3TA 2QLJB 2OEMA 3AB4B 3RRHA 1UWBA 3I6PA 1RAIB 3SSRA 1V5VA 3J80U 2AT1B 1OSCA 3WQPA 3N4WA 4YQWA 4I2PA 3J81j 4G3IA 2FIUA 5DS7A 3D1HA 3NGUA 5IM0A 1X4AA 4RWXA 3N9UC 3P6YC 2HZCA 4EYHB 3LP2A 4A48A 1HBUA 4ECWA 3KLHA 5HLFB 1N32F 4LFBJ 5L8RC 3I9V9 3E51A 2FUG9 4HTJA 5M2PA 2XM3A 1ZM9A 1WACA 4LSZB 5U47A 4U6PA 2ATLA 1DQ8A 4KY3A 1XEZA 4O4RA 1S0OA 4DDFA 3J7A1 4HDHA 2KRBA 1HHSA 3SEOA 1TL5A 2GA7A 3SQGA 1GFWB 5KG0A 2BRKA 3D9BA 4RW9B 4PKDB 3W5ZA 2D3UA 2E44A 2V5HG 3QJPA 2AU0A 2VPZB 4OHYA 2HHHF 1KC8T 1I6JA 3GMGA 2IM0A 4N56A 5G4DA 4O23A 4CWBA 1VS3A 2FYXA 1LWXA 3ZZUA 1O0PA 2Q3PA 4O3QA 1RABB 3T19A 3RG6A 3WIVA 1TK8A 1L3KA 1V5IB 2GIQA 4ZPBA 2VBXA 4OZ0A 3D68A 3VGUA 5J2MB 4OYBA 3GFYA 2BJ3A 4RBVA 1IBLF 1AT1B 2J8AA 5HBMA 4ZIVA 4WTOB 1CJUA 1J5EF 3LP1B 2HZVA 2ZJQQ 1XMBA 2JVRA 2ZZTA 4CLPA 2N3LA 2RQ4A 4P73A 1T03A 2WTFA 5HMZA 2DNQA 1FRMA 2XO7A 2WB4A 3BH6B 3HX9A 3GSDA 4ED2A 3FQLA 2HWIA 1HNXJ 4QWCA 1J2VA 2UUBJ 4CP5A 3NGRA 1RCXB 4LF1A 2XI2A 3I0RA 5HMWA 4W4MA 4C3LA 5AE2A 4LVNP 3NCPA 5L38A 5KFPA 4HVZA 2OD4A 2OD6A 3UI3A 4FF3A 1L3VA 3G86A 4X4QA 2EWHA 3BBBA 1IBKJ 2VQFJ 2BJ8A 2XBPA 3HHKA 1D8YA 3T5LA 4WFBQ 1Q95G 5A76A 2H5EA 3C16B 1OYDA 1EB0A 2NSBA 1X4FA 1FX2A 4OZ3A 4OYPA 4C0OC 1X9MA 2YH1A 2V63A 2RUSA 3DLHA 1XTZA 5KFAA 2V6AA 1Y10A 3MWBA 3TUJC 1RHMB 5CYQB 3HK2A 4L73A 4FYDA 2B43A 1KFSA 1IQZA 4K8RA 2N3OA 3AQPA 3K59A 3HSGA 1SIZA 4WYLA 1IXKA 4OJGA 1ZA2B 2VODA 4C8YA 4ZHRB 2NUHA 1B0PA 3QIPB 3W64A 4PWDA 1HQUA 4K7QA 5B09A 3NCQA 2MSTA 4RNNA 2MXYA 3ZZOA 2RHQB 3QNWB 3BQ2A 4MK8A 5BJRA 3RW6A 2LQ8A 1IKWB 3BKFA 3MUMP 4OX8A 4MKBA 2CVEA 1K0TA 5J2MA 1TL1B 1NM2A 7FDRA 1X0FA 4JI4J 2OTJS 5I3PA 1VBZA 2HK2A 5KG3A 3C66A 4LIRA 3V4MA 1S6PB 5DGBA 2WVCA 3NGTA 5FIIA 2IMWP 1CVJA 1C0UA 4CLWA 1SC4B 1T9VA 2JOQA 2XSFA 4USKA 1X4CA 2ZH7A 1T03B 1DZ5A 4K4UA 1FWKA 1UMJA 2QMUB 1R31A 2HQFA 2JFKA 2VASA 4NLQA 4E2FB 4CCHA 1O8BA 5HBMB 2XB2D 4WU2A 1HWKA 2HRYA 2O01C 3I31A 4F36A 4JI8F 3A13A 5GAGU 3J7Z5 1WJ9A 2RQMA 2DNNA 2MZQA 3DC2A 4C8NA 2ZM6J 5D0HA 1GH8A 1T95A 1Q8IA 2QSFA 3M1VA 1WHVA 2VA3A 1G7CB 1VQ4S 4FPRA 2U2FA 3JTNA 3BYRA 1NHVA 3FZBA 1C0TA 1G2EA 3I0SA 3H4BA 1NDPA 1S1XB 4FKYA 1NHKL 5CYMA 2QMWA 2VC0A 1GMWA 4CO4A 2DY1A 3K5PA 3W7BA 4C97A 4UZBA 4V19X 1Q53A 2AGOA 3CJSA 4TU8A 4WZQA 2AP6A 3M8YA 3HHLA 3N79A 3R6GB 2V4RA 4QCLA 2HLTA 3H42A 5J1EB 2Z8QA 3PYFA 3TW0A 1UWBB 3R2CJ 2GIFA 4BC9A 2IM2A 1GT8A 3QRPA 1IR2A 4IH6A 2HFNA 3KUGA 2J9DE 4DFKA 4DV5J 2JNJA 1NJZA 4C8ZA 4NLSA 1RB0A 3CULA 1TL7A 1HQ2A 3FKBA 4K2JA 1FDBA 1HBUB 5HJXA 4CYUA 2ZBCA 2J7KA 3HT3A 2DGOA 4GC7A 2WZ1A 3OTBA 3H40A 1H2UX 1WEYA 1WG5A 1WSRA 1RAEB 2IVYA 4KGXB 1MMNA 2LXIA 2OPPA 3HKZD 3WC0A 1ZA1B 1X8DA 3BGFA 1BQNB 3DRSA 3FBEA 3ULHA 2W2PP 3KK2A 4AT1B 3GV7B 3A12A 4X4VA 1WC5A 1J5OB 3HCXA 4B9TA 1I51B 4X64F 2ASLA 1YBUA 2HGMA 3EXYA 3GONA 2KXNB 1JJHA 1FXRA 3EPGA 4Q0BB 1BLUA 4P72A 3LGMA 3GPAA 2H48B 3WBZA 1IR0A 2QGFB 1JLBB 4WP3A 2JEFA 3RJMB 3M1VB 1RTIB 3MPWA 5GADI 3KJVB 1Z2LA 3MEGA 1U1LA 3GV8B 2V8VA 3K5LA 5E41A 3JAMU 1NKBA 4QR2A 3W2WA 1MLAA 1HI0P 4K4SA 4BWJA 3G8SA 3H5UA 3BB5A 2QX0A 3QT5A 1U0HB 4U95A 1H72C 3Q89A 4AXIA 3H4DA 4LFBF 2JSXA 1W2BR 4YEAA 3KK3B 1SV5B 1TK0A 4E0DA 1RQ0A 1T3NA 3UD5A 3IN5A 4RUBA 3UWTA 4UT4A 1FRXA 3CMAS 2EBEA 3MR7A 2X1FA 1QVGR 1A9NB 3C46A 1AFJA 4PUOA 3KG0A 4ED4A 1TAQA 3HVTB 3ONQA 2E5HA 4KTQA 3Q2TC 2XMKA 1U1QA 1RT4B 1KQGB 2FY1A 1VJQA 2VL1A 3IAS9 3IO1A 4M5JA 1WF2A 1VOMA 4E8UA 2QFJA 1KNZA 1S6QA 3UPFA 3QAUA 2HQCA 1TL4A 4ZHRA 3AOCA 2IDLA 1NO8A 3LF0A 1FKOA 4ZPTR 2CYYA 2QA4S 4P2XA 1R0BG 3AXMA 1GMWD 2RQCA 3H59A 5CYQA 1FDNA 2IDEA 4ZDNA 3AB2B 4FNIA 3MMAB 1UW4A 3PW4A 4LF6J 2OSQA 3UR3C 3W62A 4R8UA 2RS8A 3M4XA 3N6LA 3G8TA 3EM1A 2UVWA 3V4IA 4ZVEA 3ISZA 5KFXA 4KAIA 4J9SA 2L48A 4X62F 2AIRB 4ELVA 1VBKA 2B4PA 3L7OA 4DL0C 2N7YA 1DURA 4FZVA 3PIOQ 2I38A 3T5KA 3KTQA 3TAMA 3BREA 4M5HA 1XIQA 2HFVA 4CNZA 5F41A 3M8ZA 2RH3A 2FJVA 4WKYA 1HHQA 5LSRA 1OPIA 2ILZA 3A3OB 2PGCA 3CJRA 4DEZA 1YJUA 2KG1A 3M7VA 5KG7A 3UCGA 5DZ7A 2CZ9A 4LSNA 3TA2A 1UTAA 1H74A 1VQYA 4M5DA 3PNIA 3BZQA 1TKDA 4U8VA 2ATCB 2HVHA 2MQQA 5FDLA 4DR5J 1WD6A 3DXSX 5M2UA 2WBMA 1XNRJ 2BKNA 2DNOA 2ZVIA 3KLEB 3OL7A 4KGKA 3BSAA 4AD6A 1NK7A 4O3SA 3BS9A 3NRBA 1YJ9S 1ACMB 2CPFA 3BO3A 4KV8B 2LXUA 3J81Y 2R2SA 2DBBA 2W2MP 1YX2A 3CT9A 3HHLB 1RT7B 2XWXA 3P96A 1YG0A 4UQGA 3RUBL 4DL5A 2OTLS 2LKZA 1S0NA 2W9CA 4HKQA 2K1RB 3JSYA 4C0HA 4DR1F 1XMOF 2QN6B 4MAKA 2F40A 2E7VA 1NB2A 2ZKTA 4LVOP 1D3WA 5T7LA 2ZOGA 4CT8A 2YNGA 1AA1B 4C8OA 3CB4A 1OQ3A 1SJ4P 2GGPA 3ENAA 3AD9C 4TXSA 3PHEA 1NJXA 4IRDA 1KSPA 1URRA 3BM7A 3IXQA 3WX4A 4Q8FA 2V8HA 3CCSS 1RXOB 1TTHB 1X4EA 4ECTA 2BACA 4ZS6A 2XS7A 2FDNA 4K50A 2G2OA 1FCAA 3FEXB 3S8SA 3BR8A 1PO6A 2QJ3A 1REGX 4IG3B 4FVMA 4R0JA 4RNFA 5ETRA 1VQ7S 2J6SA 4BS2A 1XERA 3DRRB 4DG1B 3K0JA 3MR3A 1EKSA 4QWDA 2LP4A 3JTOA 2CKWA 3RR7A 3DLKA 4AE5A 4J9NA 4HHJA 4KGMA 2YWWA 5D4LA 1RWNB 1U2CA 4DX5A 5IV4A 1S5ZA 1BHNA 2FJWA 4DR6J 1B7FA 2C22A 2BW2A 1IKVA 1U02A 2KVQE 5HANA 2VBYA 1PC5A 3B78A 1CJKA 3FZ2A 2DH9A 1D0EA 2HIYA 5HP1A 1TUVA 3C6UA 3SDEB 4FBUA 5IQQA 2UUAJ 2CJQA 4F4AA 3HHDA 3HZEA 2H9ZA 1QTMA 2EG1A 1TKXA 5HVGA 3OQ2A 2ZHBA 4C8KA 3OVBA 3MM9A 4USWA 5HROA 4NLTA 1VFJA 1U7LA 1VGYA 2V8GA 2VG7B 2VFUA 3GR1A 3JTPA 2NPIA 3MMJA 3CCUS 1SJ3P 2ZUGA 1P8GA 1ZPVA 4ED1A 4DOZA 1PYOB 5KFWA 3OFEA 3SV4A 2OPSA 4NLDA 4P75A 2KFZA 3NMAA 5G0RB 2CPEA 2HWHA 2WOMA 1VBXA 2AJ1A 2M8HA 4NA1A 2XLJA 3VGSA 3U1MA 1F9EB 4PCQA 4RNHA 2GHWA 2Y8YA 2JX2A 4OI0A 3NNCA 2UUAF 1RLDA 3T41A 3IC1A 4FF2A 2MYFA 1FKOB 1T8EA 1OS5A 2DT9A 3LWLA 2HBYB 2YWGA 4QPXA 3HVRA 4C6AA 4KHMA 4OZ1A 4K0KJ 1SVDA 1EP4B 2DB1A 4CH1A 2ROGA 1VLOA 4OHZA 2DRDA 2UU9J 3QYYA 2BMBA 4DHVA 4J9PA 5IQ6A 1WI6A 3QQCD 3D2WA 1U45A 2IVFB 2EFPA 2AKWB 1YWXA 1IKXA 4OL8A 1TK5A 1S72S 2GIRA 2QO3A 3KLGA 5L1KA 3NBPA 1WHXA 1HNIA 4LRAA 3CJ0A 4HHUA 2CPDA 3MTJA 2AD9A 1LXNA 2E29A 2HHHJ 3WZ0A 5EHHA 1PJ7A 4NLXA 1DTQB 3G6XA 2DNHA 1TV6A 1HBOA 3MMCB 1NK6A 4PG6A 5JXSA 1H2TZ 4FVCA 2DGTA 3BSCA 2XLKA 1FDAA 1HIYA 4DSFA 1JLEB 4JB8B 4Y2CA 2WRMA 2P6SA 1PBUA 3PEJA 2KHDA 2Y1LB 4CDIA 3R9LA 2YNHA 3DDKA 4LQ9A 4P74A 2V4QA 4IH7A 1W25A 4URQU 2R7UA 2AJQA 4JYAJ 2H54B 1HPZB 1QVFR 1NK8A 2B0GA 2YNHB 1R89A 1MMDA 4UW2A 2X51A 4HT7A 4ZVPB 2GNKA 3M8QB 2R8GA 2H5IB 2V50A 2WVEA 5CA5A 1NEEA 4DS4A 2AGPA 4A8WA 1SC3B 2F8EX 4EK2A 1OMSA 2KM8C 3QGHA 2ZH4A 2OPPB 1DBDA 2KYZA 3QLHA 1VC5A 2Z2YB 3C3LA 1T05B 4EGLA 1XR6A 3DLGA 2F4FA 1R6YA 2XYGB 3ZTOA 2OPRA 3LALA 3M32A 1TL7B 3OTDA 4HDGA 2FHKA 3JSMB 1DTTB 4ER8A 3HD2A 4DF8A 3WC2A 2RRNA 1X9WA 1RAFB 4FS1A 1UVLA 3R3TA 2FGOA 5A8WB 1L3UA 3W2VB 5J1EA 2X1AA 4K4XA 1K47A 2JEJA 3CWJA 2DKOB 2LECA 4UY8T 4F50A 2YX7A 5MLCV 4DR7J 2N4CA 1X4BA 4YY3J 1X31C 1HBNB 1ZM2A 2E1RA 3BO2A 1U09A 4DUZJ 5KT6A 3R5BA 4DL6A 2Y1RI 2EG2A 1EHWA 3G82A 3OSNA 3VAKA 1U47A 4YR0A 2JLGA 1YGYA 4EBEA 2XO6A 3RBXA 3DLLQ 2B6AA 3FQKA 1CC8A 1GXTA 5DLGA 2RD5C 4DPWA 2WOMB 4A46A 3R27A 4NXMJ 2M3DA 4H54A 1FVSA 3VVTA 2CXEA 2V2ZA 2MZSA 1B4SA 1U24A 4M8LA 4Z2XA 2D69A 5K8MA 1U1PA 1U1OA 2OH2A 4JI4F 1RU2A 3D0GE 4QQBA 3T1YF 3PJ9A 2VG7A 2EK1A 3BEGB 2ACMA 5A6WA 4ANCA 1TKXB 3D6MB 3MECA 1JLCA 4OX9F 5IC6B 3VGTA 4Q2LA 2I5JB 2L9WA 3L09A 4P7VA 2WBRA 1DQAA 2MQ8A 5KT5A 4DJBA 4DN9A 4YUDA 4ED3A 4NXMF 3NMRA 2Z30B 5RUBA 4ZITA 4KQZA 3BO4A 1RA6A 1Q78A 2CWKA 1CJVB 2VG5B 3MPDA 3U27A 3VAGA 1U0SA 2C2NA 2EPIA 3DGVA 4KKOB 3EMTA 4ZA1A 5ETKA 2AW0A 1RT2A 4DBQA 4JI3J 2AWZA 4KBIA 3US5A 1YHQS 2XC9A 3CCQS 1XC9A 4HHHA 2YKQA 4O4GB 2FLPA 3IFEA 1F5CA 4U67Q 1VQOS 4W90B 1VRQC 4DSJA 1S0MA 1CEZA 2E5GA 2GO8A 2NUUG 5C5JA 1Y0HA 2GS8A 3H90A 1Q81T 1C1BB 3TX0A 4ENOA 3K8WA 3LAMA 3TZWA 2IBKA 4CO0A 4KHPJ 2IJFA 2OFGX 5H9EJ 1N36J 1IM4A 4EO6A 3HMJG 4IR9A 5L9XA 1JQGA 4YN3B 1KBRA 2HNDA 4LF8J 4OI4A 4ZVHA 4DV3F 2ABYA 2VDHA 1HQEA 3GQCA 1YQHA 3F0NA 4QYRA 4G65A 2AYEA 4UOCA 4PYAA 1ZAVA 1JLQB 5C7PA 2ASYA 5CYJA 5T7LB 2GVZA 1U48A 2VONA 3FSYA 1R27B 2GV1A 4C8LA 1HA1A 2OPQB 2XMJA 3VAMA 1F3VA 2MQMA 1KRPA 2AJFE 2XEXA 3MOJB 2DO0A 3CCJS 2LEBA 4PPZA 3RW7A 4ES1A 2M52A 4XK8C 1RKJA 3CDBA 2LXFA 1B3TA 5KFZA 1NK0A 4WBFA 1HWLA 1IBCB 1U2RA 3LP1A 2F1FA 4MYTA 4MYUA 4DV0F 4LFCF 3BQ0A 4ELTA 2FVSA 2C3YA 3SIPB 5KFDA 4ED5A 5L1IA 4DL3A 4JI2F 3ILIA 4HH0A 4NZ7A 3EVOA 4DV3J 1Q79A 3D1OA 5D4PA 1OWXA 1OY9A 2J0SD 2VH7A 1RT3B 2J7UA 3AFGA 1SJRA 1JXEA 3OXGA 5MAOA 3EZ5A 1S9GA 3DLGB 2L9NA 3MPUB 5DG7A 1PAEX 3CJTA 4DCOB 2CPHA 3HHNB 2KZZA 3V2UC 3ZTSA 1MSWD 2YWFA 3QLHB 2EC0A 3UQSA 1YJWS 2NYHA 4ZPVR 2PEHA 1SXLA 2GHPA 2VJVA 4DPYA 1B7YB 2XZWA 5F8JA 1JK9B 1LXJA 1EQ0A 3HHLD 4CRJA 3NCRA 2Y9HA 4H4KC 3PM9A 1OJ4A 3Q0AA 2BW7A 2H5JB 2K7JA 1RJJA 5EWFA 2PN6A 3OSPA 2CG4A 4DXLA 2H4WB 5EGYA 2W25A 2XS2A 4FYXB 4ZP8A 3JQMA 2BQRA 4EFAC 2D3ZA 2CNKB 3DNCA 3RZAA 4R8UB 4DPTA 6FD1A 3D0IE 5C42B 3HLUA 3H5YA 3C2PA 5EUHA 3G71S 3EYZA 3M2RA 3U1NA 1HL6A 1WC6A 4CZCA 1WWHA 2XCPA 4OMFG 1VC0A 4RW4A 4DR3F 2AF6A 2WW4A 4PXBA 4DL7A 4GMKA 1TV6B 3CDWA 2HQDA 2KFNA 2VQFF 3BGRB 1I94J 2IFXA 1SPBP 1YSJA 1M5SA 2WVBA 3KKFA 4A8MP 4WIQA 4Y2IA 5AJ3J 4JI6J 3BR9A 4ANEA 2ZZNA 3CCLS 1LEOA 5BXIA 5LSOA 5ETNA 1EKRA 1YJVA 1E6VA 4DFMA 1MG7A 3OTEA 4F3OA 4OX7A 5E3PA 4K5RA 5IT9Y 3EJMA 2FB0A 1RSCA 3H8YA 1JLGB 1TMMA 2CQ2A 2WCXA 1DLOB 3N28A 4R25A 1CBKA 4MIAA 4MIBA 4CI0B 2QA1A 3TP2A 2VFRA 3ZZRA 4TY8B 5AT1B 4DU7A 3F41A 4IR1A 4MIWA 1TKZB 1TKTA 3MHYA 4ECUA 1TR0A 2RILA 2YKMB 4KO0B 3RB3A 1NHUA 1EETA 3MAHA 2YKMA 2F8HA 4KO0A 1HR0J 1LV5A 3IR6B 2HHUA 2R7QA 3TA1A 4A8XA 3LPYA 4DQIA 3DOLB 4HLBA 2EEYA 2EK6A 4ITSA 3I5BA 4KFBB 2JDJA 4KYZA 3FUYA 1FKAF 1O51A 4OJ3A 1SKWA 4DL2A 3PR4A 2ZKUA 3PACA 1B70B 1FKPA 1YZ7A 2E7WA 4IKAA 1JLBA 2GMLA 3UNYA 4ETZA 2V9WA 4ZVTB 2H1YA 2QLFB 3FBCA 4KH1B 3CMQA 2AJ0A 4ZOSA 2BRLA 1REVA 2R2RA 4LQ3A 2HAFA 3CO0P 1UEVA 2HK3A 2CQ1A 5LOQA 1WNEA 2MQLA 3IS9B 1C2PA 2FTRA 5BYQA 1FXLA 2M5YA 3MTKA 4DFPA 5B0AA 4JI7J 3FGVA 1MWQA 3LPEA 3OR1B 4HT5A 2C28A 2UVRA 1NJYA 1KTQA 3VF0B 3DLBA 4OZJA 3SCKE 4U9RA 1UVIA 2R7VA 1S4EA 4WF9Q 1Q8KA 3I4PA 1LWCA 2MZJA 5IT9U 2BJ9A 5C42A 3FNNA 2Q43A 2E5LJ 4I7FB 2WAQD 2CQIA 3D0HE 1EAYC 1TUWA 3R8YA 2CG8A 3VV2B 4DWIA 3MAQA 1KLMB 5KFMA 1B0TA 3DM2B 2BR0A 1T0TV 3M2VA 4KPYA 5B0DA 1M1KT 2J6UA 2WSFC 4DX8H 3FSXA 2VG6B 4FYYB 5KFUA 4CLSA 3WIUA 1S9EA 3DKDA 4USMA 1WOSA 4K4ZA 4DCPB 7FD1A 2BE7D 3W61A 4XDCA 1K73T 2ZH9A 1HBMB 2DGXA 3KNAA 3SCJE 2QIFA 3SFUA 4TQSA 4L76A 4C4WA 3A8EA 1FRKA 4NLPA 3M6VA 5GAGI 1BWVA 2G1DA 1Q4RA 2GGPB 1WEZA 2QMXA 2IC3A 3EGNA 5IS2A 3ZNUA 4K5SA 5ETQA 4F25A 1R8BA 4HI2A 4USJC 3TA0A 2FC8A 2RF2B 5ETOA 2VFVA 4HR2A 4QPTA 5DDPC 3W3SA 4FKXA 4ETXA 2NYIA 3RTVA 3W9JA 3Q86A 4X64J 1V6HA 5ETSA 1YTYA 1IWGA 1TU0B 1WORA 3AY0A 4ED8A 2DPIA 1QLNA 4X4NA 4LSLA 1OPZA 1JJCB 1YIJS 1UWAA 3J7ZT 3CW2C 2J7WA 2VPWB 5A0YA 4Z7CA 3W65A 1NXIA 2XMMA 1GX6A 1RT5A 1S99A 2ZBIA 3EZOA 3MM6A 2RRAA 2LFVA 3MOZA 3QZ7A 6FDRA 3JQJA 3OUYB 2LQBA 1BD6A 1QDUB 2WONB 2QL5B 3IG1B 1F5AA 1SJ1A 3GTYX 3KNGA 4KV8A 4P6QA 5KG4A 4ED0A 3S6EA 4FNHA 2M4MA 4AUKA 2OMLA 2HHQA 1R6VA 5FLXY 2YKNB 4EZ9A 1BY9A 2DK2A 4J9KA 5DDQC 4E98A 4RUAA 4NRTA 3MEEB 4F8RA 3E3XA 1TP7A 3UN2A 1Q1KA 2OPQA 5LJ5Y 4IQXA 3VGVA 3ELHA 1U6ZA 4UOGA 1GMVA 4WXWA 2OAUA 3KJQB 3RRGA 4WP9A 1N56A 4OI6A 1UZDA 2FJEB 4OLPA 3UO0A 3OHBA 4G6VB 3PW2A 2OLWA 1RWWB 3WX8A 1N0VC 3EUNA 3KWMA 4DV7F 4JI1F 3DDNA 4KKOA 2KZMA 1XJWB 3NNHA 3AODA 1HNVB 5AXLA 1KQKA 2PEBA 5DO2A 2GC8A 3M8PB 4ZJLA 2B9EA 1A0OB 2CPJA 4GO5X 6AT1B 2GHVC 3T1AA 4CLUA 4J9QA 2Y1JA 1DARA 1OO0B 3AXKA 5K20B 5GMKa 2WB1D 2ZZMA 4WK3A 3IR7B 2MZ1A 2WSEC 4IDKA 2JLEA 3O8WA 4OZLA 4OI3A 2MEWA 2DPJA 3F56A 3CJ5A 1X4DA 3CCTA 1JLCB 1Q82T 1I3OB 2W7OA 1BWEA 5I3QA 2VZ9A 4A8YA 2HGLA 4NLWA 4YP3A 1Y3KA 2G13A 3MZIA 1WKLA 2LDIA 5LJ3Y 5JVGQ 3TQ1A 4JI0J 2E9RX 2V8DA 4IFVB 3RR8A 3DMJB 3SZ2A 2BDPA 2RU9A 2PO4A 2DVIA 3R6LB 4G1IA 3VAHA 4PQUA 2J0XA 3ZZPA 5F3TA 2HBQB 3DLKB 2J9CA 3U02A 3T3FA 2BOAA 2KJWA 2VKRA 4Y6IA 1AUDA 2FLNA 1N6QB 1HMVB 4ZVUB 4ZMMA 1YJ7A 2PT0A 2BX6A 2RIJA 2OMOA 1U8WA 2IRYA 5B7WA 4H4OB 3BN4A 4EI2A 4Q8EA 3AJ1A 1JLAA 4NMXA 4NA3A 3GLJA 3FMWA 2MZRA 2D3OR 2RB7A 2BJDA 2PDAA 3ZZZA 4RU2A 1SJFA 1QE1B 1UJ6A 2KJVA 2XMUA 2COLA 5D0EA 4ZCKA 4C0BA 1KQSR 2BJEA 4HEA9 4A8KA 1CJTB 4Z7YA 1RWXB 4YB7A 2ZHAA 4ZVGA 3ZXWA 3M6XA 3NXZA 2RDIA 3HVAA 4WU3A 3M9MB 1T3OA 2QL7B 1S6UA 4DV1J 4B3RJ 3MEKA 2DNZA 5A8RA 2JFDA 2PMZD 3ADAC 4YR3A 1VQPS 4XTTA 5KT3A 3MMBB 1NH8A 1WOPA 2P8IA 1IKYB 2FHJD 4CO1A 5IT0A 3CXCR 3SI8A 3MFIA 1PGZA 2FVRA 1SI9A 4AFFA 2LVWA 4IO1A 2OO4A 4PABA 5GVQA 1U25A 1AFIA 3LAKA 2M70A 1UFKA 1NDKA 4I56A 3Q23A 3JSMA 5DETA 3P3DA 2M9KA 1KWMA 3HVWA 4URGA 2UXCF 4WXOA 3R1HA 1FEHA 3AAWB 1WKKA 4M5DB 4QBUA 1HBMA 1N54B 2W2OP 4JI6F 2W8KA 3M30B 2F5GA 2E5JA 3C6TA 4B9SA 2FZCB 4X65F 2FJAB 1TELA 5B0FA 4DX7A 1AROP 4V19J 1XWLA 1RHJB 1Y5IB 4ZN3A 4BC7A 4J37A 5D3GB 1HNZJ 2CQDA 1V3SA 5CYMB 4QIEA 5L1JA 2QE5A 1ZM3A 1U8SA 2RKIB 2V68A 1SKRA 2OUGA 3GIRA 1RWPB 1UL3A 4ZN1A 2CDRB 3NG8A 1CG2A 1LWCB 2XS5A 5HMXA 3TEGA 3IM9A 1WF0A 4RUCA 2FQQB 2J9DA 2HRTA 2QLBB 1UEKA 2XHCA 1NZ8A 5KFCA 2PFDA 2V0NA 2EFNA 4G1QB 3HF5A 5D6GA 1LWFA 5EWEA 3I56S 1PAUB 4DR4F 4WWSA 1T9UA 2FC9A 3GE9A 3TVKA 1TL3A 1F9HA 3R7NB 4WKRA 3Q22A 1S7HA 2MSSA 3K57A 4ALZA 3UDCA 1HHTP 1CQMA 1LW2B 3OL8A 1HNIB 3IWXA 1IN0A 3PW0A 3I87A 1ZETA 3CNQP 2BZ2A 3W63A 2J5AA 1FRHA 1IKXB 2BJ1A 4DUYJ 2L9DA 5KFQA 3A1YG 5HK4A 3ZTRA 1IKWA 5LXRA 2CJAA 2OEJA 5LMNF 1UA0A 1VBYA 4NCAA 2NQPA 2R7WA 1H98A 2HNDB 3QWUA 1NKEA 1SBRA 5ADZA 5G0RA 4NXNF 3J81U 2VBZA 1QTNB 3HKWA 1YRXA 1TUGB 2IJNA 4NRUA 4ECRA 2Q1LA 2DJWA 4WFNQ 1ZBTA 2ADBA 4JI3F 4AL6A 1JLAB 3B4DA 4UTGA 1OSDA 1X5OA 4BWMA 4RNOA 2YWEA 2MHNA 2VHGA 1M5PC 5H9FK 3RRKA 1FX4A 3NAIA 1HMVA 4PQAA 1JLGA 3CIMA 5J1NA 5C24A 1FRJA 1RHKB 3W5YA 4DV2J 1NAQA 4ZVSB 2DEJA 2HQ3A 2CVIA 1KONA 1NKCA 3CE8A 4JP8A 1YRTA 4ZVRB 3C16A 4JI2J 3NS6A 3JAMY 1RWMB 3ET6A 5E33A 1K1SA 3DMJA 2R7RA 2YQ3A 4N76A 5DQIA 4HI1A 5J2QB 2J0WA 3KMQA 3KXDA 1GK8A 2CJYB 2B9WA 2GQCA 3LGHA 3VQTA 4IOCQ 2YXLA 2K7KA 3RYLA 2ZNYA 4I64A 3DRRA 1N5SA 4DG1A 1MNEA 1X5TA 4W98A 3KLFA 3MUVP 1VQLS 4H4MA 4XIUA 4NLOA 4DPXA 4YS2A 3GG1A 5AE1A 2LU2A 1GXLA 1RTZA 2CAJA 4OZ5A 4IOBA 2DR7A 2DHGA 4A8QA 3PRDA 4F7VA 3NAHA 2KO1A 4DV0J 5E3RA 2L41A 5A8KA 5DQGA 4X65J 4AQYF 3R1LA 4EZ6A 4F4WA 2JWNA 2LEPA 4QIWD 1URNA 3THPA 2Y0BB 1FJCA 5IFMA 3TZZA 2HHTA 1RI7A 1UJ4A 3T9ZA 3L7PA 4ZCMA 5AE3A 3CC4S 2E9ZA 1HWJA 2QTWA 3U1LA 1FK9B 1XN9A 3H25A 4WFZA 4F26A 4U96A 1RKIA 3J7YU 2ZH2A 2PMHA 3R5JB 1FK9A 3LP0A 2YKNA 5K14B 5K8PA 4LF9F 2UUBF 2R7SA 1RBOB 2C3UA 3ZZTA 3QRQA 3DXBA 4O3RA 2R2TA 3G8QA 2DR9A 3NS7B 2E9TA 4NZ6A 1WDTA 5J2NB 3D66A 4V1Ak 1RISA 5HQLA 1QSSA 2W4DA 1H38A 3PRBA 3G96A 5C25A 3KLIA 3TWZA 3EVWA 3VWSA 1ZYQA 1N33J 4M5IA 5E0OA 5F8HA 3CF5Q 3H2LA 3A8IA 3GFXA 4LF5F 5HLFA 4F2SA 2NS1B 3HFVA 2GQ2A 4WJBA 4ED6A 4HACA 2GQQA 4Q2MA 4I2PB 4ZPAA 1UETA 3MI7X 2ASDA 4EMDA 3GYGA 1VJWA 4LF9J 4TLRA 5D15A 2JRSA 5KG5A 2DHHA 4J7CA 2XQCA 2XCAA 3V81B 2KXHA 5F8NA 1H7XA 2DH8A 1J27A 4RUHA 1NJWA 4FF4A 4B9UA 1U2FA 1UCNA 4N8OA 1QUVA 2BABA 1HPZA 2FZGB 1MU2A 4RW6A 3BDEA 3T1YJ 4LSNB 1N33F 2GMHA 4CO2A 1RLCL 4DSKA 4TVAB 2R8KA 5KG1A 3F44A 4S0MA 2V94A 3I5AA 1HI8A 3LWMA 2F7VA 4DU8A 2NZCA 2C3MA 4FYVB 4TU9A 4TYBA 3ISND 1S10A 1KKHA 2WK4A 2XMWA 4O0NA 3PX4A 1X9SA 1VK8A 3IM8A 3BDPA 1R8PA 1TQLA 3LW5C 2DITA 2XG8A 1S1VB 3B54A 2CNLB 3NP5A 1S6QB 3DU6A 5D4OA 5E5NA 2XY5A 4LF6F 1QY7A 2JHEA 3KLGB 3ETMA 3PV8A 2I5JA 4KE5A 3KFWX 3O1LA 4I68A 4ZPWR 2NXEA 4I2QB 4X4SA 4WE1A 2B4VA 2B9XA 3RBDA 5IXUA 1FRIA 3MECB 5GMDA 2UXBJ 2QT7A 3D3BJ 3QFHA 2DGQA 2EVZA 5D77A 2DHSA 2UUWA 2ADCA 1RYSA 2IM1A 2KU7A 3OPKA 4W92B 4F0HA 2Q66A 2ZWOA 1UVKA 1Y5LB 4N8NA 3QATA 3EPIA 3MCOA 3FCWA 4K4TA 2H3EB 3H2VE 1JB0C 4NLUA 2R8HA 1IBMJ 4ELUA 1SV5A 4QJVA 1ICEB 2ZNZA 4ZCLA 1EJ7L 1UAWA 5E3AA 1S7IA 1RDRA 4F3QA 3E8OA 3IRXA 3HVTA 3G6VA 3C8YA 2B7BB 4TLQA 3I4HX 1V9OA 1RADB 5CZXA 3DDIA 4GC6A 5A6PA 5KFHA 2PMWA 1MWYA 3J7AN 4Y65A 2SXLA 1N34J 1CQNA 1XR7A 2LDYA 2YKAA 3HULA 1FNMA 3Q8YA 3EDRB 2ROPA 4DV5F 3M2UB 2CQPA 1APSA 1IBKF 4U7UD 3GILA 3SSQA 1FA0A 3CIZA 1K0VA 4ZJOA 2A2CA 2DNKA 2XMAA 1Z2ZA 2PIIA 2YQ1A 5D3GA 4ECZA 3CO9A 4C9DA 2DCUB 1ZAWA 3MGJA 2BKPA 2IAJA 1JJ2R 1Q86T 1FERA 1B0VA 2MJNA 3KK2B 3CD5A 2AZ1A 1NMEB 1KQFB 2D74B 1ITPA 1SUQA 3Q2SC 3RU0A 4IFYA 2EC2A 2N7CA 1U26A 4DZDA 2PFFB 2X1BA 3NY0A 2LU1A 3AOBA 2CZVC 4DQQA 1DTTA 3HI9A 2MB0B 3TVYA 2HHSA 4CLZA 4QZVB 2O3DA 1P9YA 1FEEA 2Z2ZA 1UKUA 5E3CA 2LQ9A 4FN5A 3OT9A 5IZHA 1VQ8S 1R7IA 1U4BA 2GMJA 4LR7A 4LBPA 1D8ZA 3OXFA 4PWUA 3KLVA 3GJSB 2VICA 5DGAA 3MEDA 1JX4A 4P2FA 3DLEA 4CM0A 1RHUB 4IG3A 4XPEA 3MMBA 3KHGA 2ZH6A 2XSJB 2D3O1 1CS4B 4PG5A 4KT0C 3MM8A 3AH6A 3K7RA 3HJVA 3N01A 2XZDB 3AA9A 1CULB 5IOLA 3CGIA 4P10A 4DV4J 3N6NA 2GJIA 2NXCA 4QYZJ 3HXMA 3I96A 3G9CA 1KHVA 2CDQA 4I69A 3M05A 1Z4UA 2HVEA 4DPUA 2HVZA 4K2XA 2KYXA 3TAQA 5F9LA 5LMNJ 4J9RA 1OQ6A 4ID8A 2YKPA 4N41A 4GVLA 1OY8A 5I3UB 3G6YA 1RWKB 3BSOA 5FLXU 4Y3CA 2A0FB 4USTA 2W9CB 4A8FA 2RJZA 3TYTA 2MDAA 4ECSA 4Y28C 4Q45A 1HKAA 5IWAF 3QJJA 5HO4A 3UN5A 2GVDB 3SXLA 1VQMS 2NXJA 5DG9A 4LRFA 4NMLA 2IBOA 2BYCA 4FPIA 5ETPA 3NWRA 2FJBB 2B7CB 3FEZA 1SQGA 2H51B 4HTIA 2RNEA 3TANA 4HH1A 2HRUA 4OLOA 5GAHU 3M6UA 2OIHA 1HQUB 4DR7F 2CJBA 3BGUA 3D28A 3QSYB 3H5XA 1IVZA 2IYGA 2IMOA 2RHSB 1XR5A 4UZCA 1HNZF 3FCVA 3SYZA 1CC7A 2Z4PA 1DRZA 2GJFA 2NLWA 3K58A 4DCJB 3MCMA 1T9TA 4B9MA 2NR0A 3FC9A 2DHXA 2GAGC 4IDKB 2IRUA 4F0MA 3TJ9A 3PG9A 9RUBA 1N34F 4U7UK 4B9VA 2LA6A 2H4YB 2VD3A 3ETOA 1HFEL 3OVSA 2KVIA 2E1AA 4CNYA 1AB8A 4PWDB 1YJRA 3IBFB 1S1VA 2IJRA 4N7TA 5C2GA 4XPCA 4OV1A 2V4JB 1Q5VA 1JLFB 2G1HA 4OHVA 1WC4A 1F60B 4RW7A 4C3KA 4CLLA 1N36F 1XNRF 3PFOA 2FVCA 4P71A 3RAQA 2K8GA 2D1CA 4LRCA 2CUYA 1HARA 2JEGA 1RHQB 4CQ1A 3P4UB 1ULRA 5F8GA 4WCEQ 2HWTA 4ZP9A 2FVQA 4MFBB 1PILA 2VG5A 4L6V3 1D1UA 2X3DA 5ETTA 1IR1A 2FLOA 1JLFA 3A3NB 3P5TL 3SDEA 1PYSB 2RT3A 3FBFA 4RW6B 4TN2A 3BSNA 2VA2A 4C7QA 1S12A 3CTRA 1H7WA 2W01A 3FMBA 5KFLA 1K8AT 3CCRS 3D6TB 4OJHA 1X5PA 3TVZA 3PYEA 3EWGA 2QA2A 4UOHA 2MKJA 8ATCB 3OUYA 2IA6A 2WW8A 1R8AA 3I0RB 3E2EA 3MM6B 3L7UA 4CIOA 3HPOA 1RWOB 3N6MA 1SKSA 2W9AA 1FDDA 3HSDA 1WC1A 4ED7A 2MMYA 3SBMA 3UDLA 5B0CA 3NNAA 1TL3B 9ATCB 2HURA 4MT1A 1HW8A 4OX9J 3ISNC 2J8SA 1LWFB 5T41A 3ZZYA 1LQ9A 4RW9A 2P2CB 5A2QY 2W7PA 5DRKA 3VAFA 1P6TA 1KTVA 1FE4A 1RWUA 2DISA 4ICLB 1TAUA 4NLYA 2XGQA 1KVIA 4R0EA 1HD1A 5HL7Q 4OIXA 1NSQA 2OFHX 2UUCJ 5F8MA 1M5HA 1GX5A 2R4FA 2YX1A 3TX8A 3AQOA 2CPIA 2F63A 2HFSA 4IH5A 5B0GA 1MWZA 1GTHA 2JC1A 2HVDA 3N5BA 1ZPWX 1TVRB 2P6TA 4OYMA 1HBNA 4YY3F 2RDJA 3GU0A 3JB9k 1S9EB 2A6OA 5BR8J 1CS4A 3BH7B 5K8OA 2XLIA 4DV6F 4NYZA 2VG6A 2NREA 2EFQA 3B4MA 2HS0A 2K3IA 3Q8UA 1ZTWA 3DM2A 2EKYA 2FD2A 2CQGA 5THWA 4C3MA 2ACYA 3M9NB 2KT3A 3QMQA 3ITHB 4CLKA 1LW0A 2W1BA 3KLEA 1PG5B 3ZZ0A 2HVIA 3T9NA 3MCSA 5FDLB 5JMNA 5I42A 2E5IA 5DM7Q 5D8HB 1LW0B 1G4CA 4DQSA 3ITHA 1NPKA 2HHWA 2I2YA 4QWBA 1FWLA 3DLEB 3OW2R 1RT6A 2EI5A 3EVMA 3K2YA 3KLFB 2BQ3A 1S77D 4B3OA 3QIDA 1XBWA 1H73A 2DNMA 4CO3A 4JOUA 5KFSA 5KTQA 3Q8PB 2R2UA 4A8OA 4UF4A 3M8QA 1RWVB 3EGWB 1UW9A 3ET6B 1BE4A 1S1XA 1ZOTA 3IBCB 4ZVQB 3GIJA 4CTAB 2LYVA 2AEMA 1NPRA 3ICLA 4OX6A 5D0RA 5J2PB 1I5OB 1SUQB 2UU9F 4PG4A 1KVJA 3SV3A 3CD6S 3MMAA 2I1RA 2W2NP 1AW0A 2HFZA 2IAJB 1QE1A 3BV8A 3KHHA 2V9KA 4L3NA 4ECYA 1RZMA 1N4LA 2IY5B 5HI7A 1RAOA 2BJ7A 4Y2KA 3QSIA 4A4JA 3V6DA 5K5MA 2CPXA 3OHAA 1C0UB 1I94F 1NU4A 5L46A 2R8JA 3R97A 2I0XA 2YQ0A 3DGPA 2CJ9A 2BVZA 2C3PA 3NBPB 4M1KA 5BYRA 5KFFA 3UCZP 1DLOA 2JZ5A 1VC6A 1AZSA 1UZHA 4PZVA 3IA0A 4QIGA 3TOQA 2OEKA 1AZSB 4K4VA 3IRXB 4B3MJ 2DH7A 1E6YB 1E6VB 2DTJA 1NK4A 4LFAJ 5LXYA 4KGVB 4Z37A 1JJ4A 4DUZF 2KRRA 3UFCX 4X4UA 3OTOJ 2R8IA 4ES3A 4QR1A 1S48A 3Q24A 4IFVA 3PJXA 4NYPA 2AJ4A 1S1TB 4PYDA 3KK3A 1XK8A 1VQ5S 1DY3A 2D41A 1CSJA 1U0HA 2UXDF 4USUA 2W8LA 2ZM6F 2G0IA 4RO0A 3W2WB 1FFWB 3PX0A 4JV5J 4NE9C 2K3KA 1Y9OA 2OSRA 1J5EJ 3M2RB 5HQMA 3T6BA 3TO8A 2Q6BA 2GW8A 4PXEA 1RHRB 2Z56B 3KJNB 1CPZA 2M0GB 4I6WA 3KG4A 2JJ4D 2Z2LA 1QUPA 2O5DA 2I9SA 2V8PA 2BE9B 3DFEA 3M9OB 5E2QA 5H1SV 1QM9A 4KRWA 4LREA 4WK1A 4GO7X 4EO8A 1WI8A 3DOKA 3MF5A 5CABA 4IUFA 1M1HA 3PIPQ 3GWCA 1FVQA 2Y0SD 3LUYA 5EX0A 3K5OA 1CJVA 4QR0A 3G6ES 4C2MA 1C1CA 2F9JA 2XMVA 3BGOP 3VTIA 4X4OA 3C14A 3TUIC 3THVA 2EXUA 2YWHA 3BGLA 3DLJA 4OZ2A 2ZJPQ 4RW8B 5DG8A 5I42B 4BDPA 2M2BA 2NXNA 3L4BC 3QT7A 4F67A 2C42A 1NUEA 2KT2A 2DR6A 2XNQA 3RBEA 1JWWA 3PY8A 1WDDA 1RU1A 3OL9A 3GIMA 3E01A 2G0JA 2YNFB 4F3MA 3EGVA 3W9IA 1YJNS 1D9FA 4ZCIA 3QGPA 3GV5B 1IKYA 1GQEA 1WEXA 2GVDA 3OFHA 2Q79A 3WDOA 4KH0B 1XNQJ 3T6JA 4KIAA 4KR0B 3UE2A 5A8RB 1KOHA 1RUSA 1TVRA 2DY9A 4RKUC 5HAOA 2HMIB 3EGZA 1FJGF 4B08A 5LM7E 3MXHP 2CQHA 5C25B 3VAIA 3ENVA 1BUXA 1VIOA 5DDOC 2VQEF 2PA3A 4B3TF 3X1LB 4QU7A 1UPMB 5HSPA 3QZ8A 4QW8A 1FJEB 3D4JA 4Y34A 1HWIA 5AXNA 4NCGA 3PFEA 5EX3A 3ZFVA 4XO0A 1RTDB 4ZVOB 3LP0B 2XULA 5K14A 2BM0A 3W8PA 4IOAQ 3FJ2A 3RB4A 1BXNA 3I55S 3BQ1A 5HMYA 1CULA 3HHLC 4M5NA 2KDOA 5CD4A 2ZD1B 4JYAF 1QAYA 2V2KA 2DHAA 3I82A 4M63A 2I6WA 2DR8A 4LFCJ 1UVNA 5IM0B 1TL1A 2DYAA 1A7GE 2DNRA 3GZ7A 4GVBB 2W9BA 2QEXS 1LK7A 4F4XA 1N6QA 3FVYA 3W66A 3D6HB 3UVJB 1A6LA 5KT2A 5B0EA 2VQEJ 2FVPA 4M95A 1WF1A 1EQMA 1H3DA 1X4HA 2ALZA 4ZLLA 3IR5B 1D9DA 4NXNJ 1TFWA 2DGWA 3KDOA 2QFIA 4LF4J 2NXUA 4PEOA 2DRAA 2BEFA 2HLUA 3QRRA 4NLRA 1NH7A 1PC4A 2JEIA 3BBCA 4DV6J 1C1CB 2J76E 3BKUA 1SH3A 4OI2A 1S1WA 2FHOB 1IJEB 4BHQA 5J2QA 2C2OB 2B4OA 5B0BA 1G1XA 4OJ1A 2DD8S 2ZDOA 1DQ9A 2BE2B 4X62J 1ZTTA 4WPAA 4U8YA 4ECVA 4JI7F 2FY8A 1RACB 3N5FA 4DLGA 2V4JA 3PZPA 1ZH5A 3M8PA 4M5GA 5CH7B 3R7SB 1HNVA 2CQCA 4LUBA 4OI1A 4FBTA 3GYNA 3QWPA 3KHRA 2APOA 2ZEJA 3AJ2A 1QSYA 4I6AA 1WC0A 1U1KA 2LQ5A 1EARA 2W4CA 3DOLA 2B8QA 1OYEA 4YFUA 2HS4A 4R5PA 3D7SB 3HFZB 4X84A 2L3MA 2HNYB 1KR4A 2C2KB 3OBIA 1EETB 1SC1B 3MEEA 1T9WA 2UV8A 4NPOA 3OVAA 1Q0NA 2GJ2A 1LW2A 2MHEA 4OHXA 4QW9A 1HNWJ 3PYGA 3QBCA 1RTHB 3QGGA 2LMIA 4KHRA 2MQPA 1F3FA 5F0UA 4K4YA 4IRKA 1LFWA 4TY8A 3PR5B 3GFZA 4TYAA 3M8SA 3QO9B 4M5KA 1E6YA 2AYGA 4PAAA 2R7TA 3KDNA 3C15B 3W2VA 4L75A 1VRUA 4BLGA 4ID5B 1LWEB 4YR2A 4AL7A 2VV5A 1VQSA 3D5MA 5DLFA 2UVVA 5C2CA 1NK5A 2MLZA 2KN4A 3TUPA 2C2DA 5BYSA 5KAKA 2HW3A 3IMQJ 3DHXA 1FFSB 5DJBA 5E3QA 4O3OA 1T9YA 2K2PA 3FK4A 3SQGB 1PIEA 1S57A 2HGNA 2JC0A 3CCZA 4B3MF 3HSZA 5HJYA 1R3NA 1WG4A 3MM5A 4CLTA 1P27B 3PKYA 2KM8B 1QAXA 5AXMA 4KGZB 1IBLJ 3LH2S 3CDUA 2QYCA 5GAHI 3CMES 2PSZA 2L08A 3OD2A 2R9LA 3IP0A 3VVUA 4CM2A 2J9EA 3KK1A 2KL8A 1JNRB 2KFYA 3NS5A 1Q7LB 3MM8B 4KHPF 3LA0A 3LP2B 4X4RA 1X60A 4QU6A 4NLVA 1PJ5A 4IG0A 3TZXA 2MY8A 3GJQB 4YDXA 1W2IA 5KG2A 2VIHA 1WTFA 2HS3A 4B3RF 3L95X 1BGXT 1YZ6A 4FS2A 4B3OB 1S59A 3H98A 3M30A 1RBAA 1X7VA 5LMUF 2ZH3A 2IPOB 1TZ0A 2MLYA 2VC1A 2VKZG 4U7CA 2RU3A 2I8EA 1B64A 1QD1A 3MPVA 4NI2A 2RDDA 3VAJA 5K8NA 4GKJF 2XZTB 3MAAA 3O6QA 3FRYA 4ID5A 3KLIB 1F1BB 3PJWA 3VZHA 1Z1ZA 4MK9A 2PE8A 4K4WA 2H65B 5JJBA 1HI1A 4JV0A 5HVFA 2ZWPA 3ENWA 4ZLJA 1UVJA 3L9ZA 4B17A 2ZHOA 3EICA 2ZOMA 3DRYA 2EW9A 2FGCA 3ENQA 1R8CA 4DI6A 4B3SJ 2CIMA 4LFAF 2MKKA 3PDNA 1REVB 2C2ZB 2E1CA 2ZBQA 3I0SB 4DR5F 3V6HA 2HFUA 3M2UA 2G2ZA 4J9UE 4NL5A 3KOAA 5CQGA 3D1QA 5L1LA 4ANDA 4H4OA 4DR2F 2RSQA 5KFVA 2KG0A 2D9OA 4ECQA 1HYSA 3PRVA 2YPZA 3NOGA 4NOHA 4LBIA 2AEFA 2Z58B 5HATA 3THTA 3VR1A 1KEKA 5H9EK 4JV5F 3ZNJ1 1S9FA 3D54A 2ZE2A 1PYTA 1HWUA 3W5XA 4CT9A 3S1TA 5A8KB 4N77A 3ZO7A 3OR2A 2YKOA 3ILOA 4XAKA 3JQKA 2YY3A 1TKTB 3R5GA 5KFBA 1IQTA 1DHMA 1RAAB 1RBLA 3LQVA 1JKHA 4P9SA 5GMEA 1R43A 4X4PA 3DOMA 2A10A 3AT1B 2E66A 2CJKA 1S1WB 1RTJA 3HSJA 1KLNA 4PRFA 3W1YC 4OV6A 5KOWA 2J6TA 2F3JA 2VPXB 4WE1B 4WIIA 2KTQA 2B8PA 3BBFA 4LF7J 1M5KC 4NZ0A 4DR3J 3OFFA 3CDEA 3A4TA 3IBWA 5KFGA 2NSCA 3PW5A 3DRPB 3MR5A 3BYPA 4LF8F 1HW9A 1M0SA 4CLFA 5AXKA 3QIPA 1VHFA 4IO9Q 4USHA 5AJ3F 2POKA 3T1HF 3BGRA 3LOUA 3CJQA 1M5OC 1BQMA 5ETMA 4TQRA 5IT4A 2F4VJ 4RW4B 3W8GA 2ILYA 3NGKA 4PPDA 2MKHA 2RE1A 4C11A 2WSCC 1XMQF 2DXEA 2VUGA 1N5TA 2FJXA 3QT6A 2MQNA 4RW7B 4X66F 1UVMA 1HD0A 2PI4A 2Z57B 4A8SA 1SIWB 2JH3A 1VCTA 4Y2MA 1N8RT 2UXCJ 2C2RA 2HHPA 1AUSL 1FJ7A 3T1HJ 3PEHA 2MGZA 1UP1A 1FTRA 3H0PA 3JXOA 4N5SA 4QIVA 4QYZK 2VBWA 4FP9A 1EX8A 4HACB 4QWAA 1AXQA 1RA7A 5KOXA 4WFYA 4RU9A 3PCOB 2BM1A 4YDDB 1NZAA 4FYWB 1KP6A 4OQJA 4PXCA 4DUTA 1Y4ZB 5F8IA 3OV7A 1FTCA 3V6KA 1FE0A 2YTCA 2RUGA 2YNFA 3E01B 4C48A 3G4SS 4AQYJ 1V3RA 5CXTA 5A8WA 2Y3YA 4LT6A 2MKYA 2AX0A 5A0YB 3IRWP 2V2QA 4OYIA 3P45B 1DJ0A 4AYBD 5F0WA 3UCUP 1VRTB 1KOOA 4DR6F 4RW8A 3KG1A 2VOOA 4DR4J 4DR2J 3RAXA 1Q5YA 2E7XA 2KH9A 1V3ZA 4P52A 2GVZB 3OLBA 2ZDPA 2R3VA 2XNRA 5A2QU 4F4KA 2A1BA 2KI2A 4X4TA 2QG9B 2D9PA 3M2VB 4RZRA 3NOCA 3FRZA 1KLMA 2DIVA 2OHDA 4YB1P 4J9OA 1Y11A 1H6KX 2FJDB 4USVA 1KHWA 4DX6A 4UQTA 3V4IB 1FNXH 1T7PA 2NZ4A 3UD4P 2ZC3A 2JVOA 1O6XA 3MD1A 2ERRA 5EN1A 2QLWA 1FXDA 3QFWA 1YDLA 4H4MB 4DMZA 4ZP6A 3MEDB 4EYIB 1K44A 1KDNA 1LNQA 3AHPA 3C19A 4O0IA 3MMCA 2CQ4A 2AEJA 2LCWA 4BCAA 1AYEA 1BQMB 1Y5NB 3R5DA 1FRLA 4USIA 4JBCA 3SFGA 3IS9A 5J1PA 3IWLA 3JYTB 1YVFA 5CD4H 2VDIA 2F65A 3MURP 1QSLA 2Y8WA 1VIXA 1SC6A 2G2YA 3QJLA 4K0KF 4JI5J 3OTCA 3U7JA 3CEDA 1RT4A 4NEZA 4ZLPA 4DZ6A 2M88A 2MTLA 3LANA 3OR1A 3AD8C 2YNIA 4RPFA 2HZAA 2V2VA 1CJTA 4PUOB 2A2DA 4RNMA 2AV5A 3DN9A 4I6YA 3OTOF 2AGQA 3BF4A 1JNZB 1LKZA 2AYMA 2GZOA 3DOMB 4UUXA 4X66J 1EP4A 2F9DA 5LMUJ 2QV6A 4LF5J 3POTB 4OYAA 3X3UA 5D0GA 4PR6A 3MM7A 1NPPA 8RUCA 3K17A 5L39A 2HNYA 2BV3A 2V67A 3K5NA 3POTA 4C8MA 3TRGA 4IQMA 1KVKA 4RBUA 5LL6d 1C4CA 2U1AA 2PI5A 3P49B 2QRRA 3CC2S 4J9MA 2ZH5A 5ETLA 3PO5A 5KFJA 2B6AB 2DXFA 4C98A 4LF4F 4LRDA 2A3JA 1YRUA 5J2PA 2GX8A 4JI1J 3GJTB 3Q8VA 2OP5A 1NRKA 2C3OA 5FD1A 2RS2A 1TKZA 3HHEA 3J7YI 3CJ2A 3MR6A 4DLEA 4EU0A 1T11A 4FDFA 2QYGA 1XMOJ 2CJXB 1R0AA 2YBVA 5I4MA 1HR0F 3A8KA 3AA8A 3NWGA 4L72B 4DFJA 4WFAQ 2YNIB 5LSLA 2DNGA 2B9YA 4I2QA 1RT6B 1FO1A 2DO4A 2BA9A 3C6UB 4B3TJ 3MAAB 2VF3A 2DNPA 2EFGA 5KFYA 3ZC4A 2MLXA 4F2RA 2OPRB 3GCXP 2MZTA 3M32B 1D09B 4YB6A 3ILLA 2RKIA 4JV2A 1WUUA 5IV3A 4G1PA 1QJHA 2B3TB 3Q83A 1WOOA 3UVJA 2ZJRQ 2DR5A 2WHOA 1GAOA 3DCAA 3AOAA 4Q7AA 3I5CA 3FBBA 2N4DA 3CJ4A 3KJFB 4GVBA 5KT7A 2W9BB 5DM6Q 4DQRA 3NGSA 1KFDA 1FJGJ 2EFOA 1MROA 1P1LA 1RAJA 3DI6A 4F02A 3R5CA 3VQSA 4LR8A 4B9NA 3EX7B 4B3SF 3HDSA 5F8LA 2B5JB 3GB0A 3TJ8A 5F9NA 2KT5A 2LLZA 3I32A 2UV8G 3T5HA 1U1NA 1WHYA 4GKKF 2XI3A 4JV1A 4AXJA 2E5LF 2HSEB 3R2DJ 1SH0A 2FHJA 2B4UA 4DQPA 2Q6CA 2YNGB 2VFSA 3HFKA 4I4BA 2HPUA 1HBOB 3VCDA 2QSWA 2XY6A 1H2VZ 3OJUA 4DF4A 2RAQA 4RBTA 5LT5A 4YHHJ 1K9MT 1S1UA 3GCWP 1NSKL 2G9OA 3HT0A 2V34A 1S9GB 5SZTA 1QAJA 2UUCF 3MUTP 1P1TA 3MFHA 1N5YB 4DSLA 2D7SA 2RQKA 2ZC4A 3Q8QB 1U1MA 4D3HA 2OI2A 1GTEA 2FZKB 3D6FB 4PG7A 3DHWC 4I67A 3H5SA 4ILLA 3C15A 5J2NA 4X2BA 3P8BB 2FPHX 1NB7A 4GKKJ 1I1GA 4ZP7A 5KFRA 3QO9A 1VQ6S 3OJSA 2Z0GA 1HQEB 3HP6A 4ZPCA 2N82B 3SQOP 2R7OA 3OL6A 2Y1IA 1Q8LA 2RVJA 3TEHB 2YWKA 3PO4A 1RTHA 2G4BA 3KYLA 2MKCA 3GIKA 2UXBF 2CZ4A 5KFIA 2B5JA 3HM9A 1CLFA 4JI0F 3PHTA 1YLXA 4R5PB 3FFIB 2LA4A 1MROB 3DI6B 4M5LA 4A47A 5T14A 2HQGA 4K59A 3CSKA 4URSA 3TZYA 1HNWF 3PXGa 2BANB 2F4VF 3RBZA 3LTOA 3DOKB 1N52B 1MN9A 2M7SA 2UUTA 2AQ4A 1KD1T 2W2QP 4WTYA 2NCKL 2OPSB 3NEKA 2PC6A 2PA8D 4PQUB 1C1BA 4ES2A 2QLXA 4RJVA 4Y0FA 4B02A 1SL0A 1OIAA 1T94A 3TARA 5KFTA 1UEUA 2VOPA 3F73A 1B99A 4PXDA 4N47A 4UY85 2C1EB 4KJIA 4NEYA 4NX9A 4M5MA 2AX1A 4MH8A 2RRBA 4MTPA 3AD7C 4YMEA 3SMZA 5HVHA 2OJ3A 3AJDA 1BC6A 4F4ZA 1R0AB 1FNOA 1M1GA 1S1TA 2DNLA 3PTWA 5EWGA 3CJ8A 4OYOA 1VR6A 1N0UA 1ZZFA 3JSRA 1NLKL 3GG0A 2E1MC 1GXUA 3S7RA 4F04B 5IWAJ 1P9QC 4DV7J 3O5TB 2ZITA 4WYWA 3BPDA 1WC3A 2MJUA 1JXLA 1Y3JA 2EBGA 2HIQA 2ZE2B 1H0HB 2O67A 1RGVA 4P7TA 2HFOA 1M5VC 1FESA 1RTJB 2DGSA 1D9AA 1YK9A 2BANA 2OGUA 4J9VA 1RCOB 1VMBA 2CNNB 4MKVA 4F0KA 5CCMA 1MMLA 1JKHB 2DEIA 2GO9A 1JMTA 5CHCB 1S0VA 1FWPA 2VFTA 3CDAA 3NKYA 5KFOA 3V6DB 2YPYA 3RB0A 2QC3A 5GADU 3CJKA 4JI5F 3G87A 3H2UB 3D3CJ 3GP9A 1N32J 4NCGB 1RTDA 2CRLA 3EXCX 3BKTA 3UN3A 3Q8RB 1N88A 2P9GA 2PD1A 2NPFA 1NNDA 4ZK7M 2CPYA 4OFZA 1WSVA 2W4PA 3G82B 2R42A 1RT5B 4CH7A 3EE3A 4IYQA 5M2RA 1SKUB 2CA9A 4LSLB 2HG4A 1W26A 4L3KA 3KLHB 1FD2A 1VLYA 4O3NA 4TU7A 1T05A 1T02A 1S1UB 2XYHB 4FXVA 4ZVFA 4RLEA 3ZTQA 4DN0A 4BBYA 1GNKA 1RT7A 3OXLA 4MJKA 4PWWA 3M8RA 1BQNA 3DRSB 1R0CB 3S01A 4DL4A 4MKAA 1HYSB 2VU5A 2IA0A 1W7WA 4J91A 1NCLA 2ZVSA 3W9HA 3J80Y 3TI0A 3MCNA 4EUVA 2XWYA 2UP1A 4CYUB 2CQBA 4NI2B 1ZM4A 4PG8A 1PKUA 3TUZC 1ZZNA 4XDDA 3QAEA 4KPCA 1NSAA 3EZUA 7AT1B 1G6BA 3A8JA 4O44B 5KG6A 4QWEA 3FCHA 2MY7A 3TR5A 3PYDA 3KHLA 5GAEI 4IFYB 1U1RA 3SSSA 4DV1F 1SCJB 2CADA 2IVMA 4OYZA 4WP8A 4YB5A 3QPIA 4OYXA 3V5RA 4NASA 1RE1B 1X0PA 3R5AA 5L9NA 1SQEA 3CCWA 5BR8F 3H7HB 2ASJA 2QZ8A 1UPPA 3LO3A 4MK7A 3L3CA 2P5VA 4IRCA 4AL5A 5K9FA 1DTQA 1UFWA 5H9FJ 1WKJA 3KK1B 2V69A 4O44A 5JVHQ 1S79A 3A3PB 3ILJA 4OZNA 2QA4G 2LQJA 4QIFA 1UA1A 4B9LA 1ELOA 4OHWA 1RT3A 5DDRC 5EDWA 1FD8A 3MM5B 1WTBA 1ZAXA 4RL1A 3DYAB 3CPWR 3HD1A 1RP5A 1NBEB 2Z2MA 2ZBPA 2E1PA 5ETVA 3DRXA 2BBEA 1IUJA 2VPYB 4P2MA 3BN7A 1Q8BA 1R8HA 1FF2A 1S6PA 3KMSA 4DV4F 1L5UA 2UZAA 1N5VA 2YX4A 4MMOA 5HN0A 1LWEA 2HKEA 3WHIA 1HNXF 3MR2A 4ILMA 4DV2F 1VQKS 1UJ5A 2F8MA 1FKPB 1SL2A 1IJFB 1UFLA 1X5SA 1N5QA 1YBTA 2IIHA 1WG1A 2CQ3A 4M94A 2CPZA 1F9FA 4KFBA 4TY9A 4LJMA 3EDQB 4RWWA 3GFHA 2HNZB 5E7OB 4YHHF 1F6TA 5KFEA 3TNVA 2WVFA 2XY7A 3CJKB 1F0XA 3GIIA 3KUEA 3MM7B 3B8HA 1G3OA 4Q44A 5D78A 1NSPA 2LEAA 2ZBRA 3PW7A 2GAHC 1GMUA 4I0WA 4KC5A 2XGPA 2VJUA 4Y00A 4C11B 1SJQA 4O4GA 3RGIA 2XHWA 2P9EA 5GAEU 3Q8SB 3VALA 3JS9A 1RAHB 1KS2A 2C2EA 3HO1A 4J9LA 5HP1B 2DGVA 1MU2B 4NA2A 4Q0BA 4LF2A 3PVXA 4NYOA 3QT8A 1JIHA 2BE2A 1IKVB 3PX6A 4CH0S 1F2HA 1YITS 3DRPA 1PSDA 2CWXA 1J5OA 1S76D 1DFDA 2G0CA 3MM9B 5HROB 2BXJA 2WVDA 5CCLA 2BOPA 4Q43A 1ROFA 2ZOFA 2W7AA 4J5OA 1NJIT 1BQXA 1GEHA 4DPOA 1Y00A 1T9XA 3R7BB 3FSIA 3O2IA 3QGIA 3T5JA 2A6MA 2ZD1A 4ERDA 4ZLNA 3CCVS 2CQ0A 5B08A 2CNOB 1WHWA 1DAXA 1MN7A 3I9ZA 3TAPA 2ZUAA 1X4GA 2HEKA 1Q7YT 3BPSP 3BJYA 2W24A 2B51A 2DNYA 1IBMF 1FI4A 5HQ8A 4FF1A 1SQFA 4EBCA 4HYKA 3CC7S 1VHIA 1VDHA 1HLWA 3IGVA 3IGNA 2EKNA 3M8WA 1RAGB 3FFIA 1L3SA 2ZH1A 5CZVA 2P9CA 1EIYB 4FXWA 1C0TB 8AT1B 2HHXA 2K1RA 4GRSA 1VRTA 4ZPDA 5KFNA 1S97A 4DSEA 4HL9A 2XTJP 3NGDA 4GKJJ 4TKTA 5IC4B 5DZ6A 4ICLA 3GYXB 1NDCA 2IM3A 1MW7A 4QOTA 2XYPB 5JUMA 2HYIB 2WONA 2OKQA 3IG1A 4NWBA 1K1QA 3TQEA 1S6OA 3UDEA 1RK8A 2MGZB 4EEYA 2XMTA 3MDFA 4RX6A 3G2XA 1U49A 1Q16B 2ZH8A 4YOEA 2DIUA 2BUNA 2HMIA 1N5YA 1XNQF 1VYAA 1TFYA 2BKOA 2KHCA 2AJ2A 2AZ3A 2HQIA 2X1GA 3N0VA 2JLFA 4ATNA 4DR1J 4EBDA 2K06A 3V6JA 4O3PA 3MPYA 2ZFHA 2AMCB 1OY6A 2RF2A 1VI7A 1JLQA 4J90A
chains in the Genus database with same CATH topology
1SH2A 2MKIA 4IG0B 4TNOA 5F3ZA 2IC3B 2MQOA 2UVUA 2CFXA 3IAM9 3LGNA 3SCLE 3TAMB 4Q5VA 2J0QD 1FT8A 4UUWA 4JUZA 2IHR1 5KFKA 4P2SA 2KXFA 2GCFA 4MFBA 3H20A 4DS5A 4MKYA 5C24B 1JLEA 2EFVA 4WZMA 1RT2B 2MKSA 2GFFA 4F4YA 3MD3A 4I1TA 3SCIE 1C4AA 3RAMA 3CD7A 2IRXA 3GR0A 4ILRA 1RT1B 2A18A 2YVSA 1F2GA 4I7FA 1LK5A 1O5JA 2R7XA 2HNZA 2YH0A 1KN6A 1SB6A 5ITHA 3K5MA 3CCES 1N48A 4EWTA 1VRUB 4LIWA 5KT4A 2FLLA 5SUHA 3JSBA 1WELA 2ROEA 3UNGC 2KKHA 4NLGA 1FHTA 2JL9A 4ECXA 3UR0A 2FHMA 2HAIA 4DSIA 1SL1A 3HJFA 4D3GA 1VK3A 2VB6A 1Y7PA 4H4KA 4Y2AA 3OR2B 1S4FA 2KB2A 1YJTA 2O1PA 3CD0A 3O3LA 3CJ3A 3HZGA 4G1QA 3VTIA 1LFPA 1F5BA 3NL0A 5FJ4A 1YBAA 1VQNS 1S49A 2DRBA 3DYAA 4FXDA 4CO5A 3KJVA 4LF7F 2DCLA 4NCBA 1NK9A 2DGUA 3M6WA 2M8DB 3PKMA 1RT1A 3FDSA 1YI2S 4WFXA 2IYIA 3O44A 3UW1A 5I3UA 5DQHA 2B56A 3CUNA 3RB6A 4DUYF 3K8VA 3OLAA 1RYRA 3B82A 4KSEB 2MPUA 2X3GA 3NLCA 2AYBA 3MEGB 1M90T 3CCMS 1RTIA 3VZIA 1LOUA 2RMLA 3DU5A 1U6FA 3C6TB 2BQUA 5D4NA 3OFGA 4KB7A 4CTAA 3CVKA 1QAIA 1U6BA 3FEYB 2HHVA 2O66A 3JYTA 3V81A 2XSJA 1L3TA 3AB4B 3RRHA 1UWBA 3I6PA 3SSRA 3UD3P 4G3IA 1OSCA 3N4WA 4YQWA 4I2PA 2FIUA 5DS7A 3D1HA 5IM0A 1X4AA 4RWXA 3N9UC 3P6YC 2HZCA 4EYHB 3LP2A 4A48A 1HBUA 4ECWA 3KLHA 5HLFB 1N32F 5L8RC 3I9V9 3E51A 2FUG9 4HTJA 5M2PA 1ZM9A 1WACA 5U47A 4U6PA 2ATLA 1DQ8A 4O4RA 1XEZA 1S0OA 4DDFA 3J7A1 4HDHA 2KRBA 1HHSA 3SEOA 1TL5A 2GA7A 3SQGA 5KG0A 2BRKA 4RW9B 4PKDB 3QJPA 2D3UA 2E44A 2V5HG 2AU0A 2VPZB 4OHYA 2HHHF 1KC8T 1I6JA 3GMGA 2IM0A 4N56A 5G4DA 4O23A 1VS3A 3ZZUA 1O0PA 2Q3PA 4O3QA 3T19A 1TK8A 1L3KA 2GIQA 4ZPBA 2VBXA 4OZ0A 5J2MB 3GFYA 4RBVA 1IBLF 2J8AA 5HBMA 1J5EF 3LP1B 2ZJQQ 1XMBA 2JVRA 2N3LA 2RQ4A 1T03A 2WTFA 5HMZA 2DNQA 1FRMA 2XO7A 2WB4A 3HX9A 3GSDA 4ED2A 3FQLA 2HWIA 4QWCA 1J2VA 2XI2A 3I0RA 5HMWA 4C3LA 5AE2A 4LVNP 3NCPA 5L38A 5KFPA 4HVZA 2OD4A 2OD6A 3UI3A 4FF3A 1L3VA 3G86A 4X4QA 2EWHA 2XBPA 3HHKA 1D8YA 4WFBQ 2H5EA 2NSBA 1X4FA 1X9MA 4C0OC 2YH1A 3DLHA 1XTZA 5KFAA 3MWBA 3TUJC 5CYQB 3HK2A 4FYDA 2B43A 1KFSA 1IQZA 2N3OA 3AQPA 3K59A 4WYLA 1SIZA 1IXKA 4OJGA 2VODA 4C8YA 4ZHRB 2NUHA 1B0PA 3QIPB 4PWDA 1HQUA 5B09A 3NCQA 2MSTA 4RNNA 2MXYA 3ZZOA 3BQ2A 3RW6A 4MK8A 5BJRA 1IKWB 3MUMP 4OX8A 4MKBA 2CVEA 1K0TA 5J2MA 1TL1B 7FDRA 1X0FA 5I3PA 1VBZA 5KG3A 3C66A 4LIRA 3V4MA 1S6PB 5DGBA 5FIIA 2IMWP 1CVJA 1C0UA 2JOQA 2XSFA 2ZH7A 1X4CA 1T03B 1DZ5A 4K4UA 1UMJA 4CCHA 1R31A 2JFKA 2VASA 4NLQA 1O8BA 5HBMB 2XB2D 4WU2A 1HWKA 2HRYA 2O01C 3I31A 4JI8F 5GAGU 3J7Z5 2RQMA 2DNNA 2MZQA 3DC2A 4C8NA 1GH8A 1T95A 1Q8IA 2QSFA 3M1VA 1WHVA 2VA3A 1G7CB 1VQ4S 4FPRA 2U2FA 3JTNA 1NHVA 3FZBA 1C0TA 1G2EA 3I0SA 3H4BA 1S1XB 5CYMA 2QMWA 2VC0A 4CO4A 3K5PA 4C97A 3W7BA 4V19X 1Q53A 2AGOA 4TU8A 4WZQA 2AP6A 3N79A 3HHLA 4QCLA 2V4RA 2HLTA 5J1EB 2Z8QA 3TW0A 1UWBB 4BC9A 2IM2A 1GT8A 4IH6A 2HFNA 4DFKA 2J9DE 1NJZA 4C8ZA 4NLSA 3CULA 1FDBA 1HBUB 3HT3A 2ZBCA 2J7KA 4GC7A 2DGOA 3OTBA 3H40A 1H2UX 1WEYA 1WG5A 2IVYA 1MMNA 2LXIA 2OPPA 3HKZD 3WC0A 1X8DA 3BGFA 1BQNB 3DRSA 3ULHA 3GV7B 3KK2A 4X4VA 1J5OB 4B9TA 4X64F 2ASLA 2HGMA 3EXYA 2KXNB 3EPGA 1JJHA 1FXRA 4Q0BB 1BLUA 3LGMA 3WBZA 1IR0A 1JLBB 2JEFA 3M1VB 1RTIB 3MPWA 5GADI 3KJVB 1Z2LA 3MEGA 1U1LA 3GV8B 2V8VA 3K5LA 5E41A 1NKBA 4QR2A 3W2WA 1HI0P 4K4SA 4BWJA 3G8SA 3H5UA 3BB5A 4AXIA 3H4DA 4LFBF 2JSXA 1W2BR 4YEAA 3KK3B 1SV5B 1TK0A 4E0DA 1RQ0A 1T3NA 3IN5A 3UWTA 1FRXA 3CMAS 2EBEA 2X1FA 1QVGR 1A9NB 3C46A 1AFJA 4PUOA 3KG0A 1TAQA 3HVTB 3ONQA 2E5HA 4KTQA 3Q2TC 2XMKA 1U1QA 1RT4B 1KQGB 2FY1A 2VL1A 3IAS9 3IO1A 1WF2A 1VOMA 4E8UA 2QFJA 1KNZA 1S6QA 3UPFA 3QAUA 1TL4A 4ZHRA 1NO8A 3LF0A 1FKOA 4ZPTR 2CYYA 2QA4S 2RQCA 3H59A 5CYQA 1FDNA 4ZDNA 3AB2B 4FNIA 3MMAB 1UW4A 3PW4A 2OSQA 3UR3C 4R8UA 2RS8A 3M4XA 3N6LA 3G8TA 2UVWA 3V4IA 4ZVEA 3ISZA 5KFXA 4KAIA 4J9SA 2L48A 4X62F 4ELVA 3L7OA 2B4PA 4DL0C 2N7YA 1DURA 4FZVA 3PIOQ 2I38A 3T5KA 3KTQA 3TAMA 3BREA 4CNZA 5F41A 2RH3A 2FJVA 4WKYA 5LSRA 1OPIA 2ILZA 2PGCA 4DEZA 1YJUA 2KG1A 5KG7A 3UCGA 4LSNA 3TA2A 1VQYA 4M5DA 3PNIA 3BZQA 1TKDA 2HVHA 2MQQA 5FDLA 1WD6A 3DXSX 5M2UA 2WBMA 2DNOA 3KLEB 3OL7A 4KGKA 3BSAA 1NK7A 4O3SA 3BS9A 3NRBA 1YJ9S 2CPFA 3BO3A 4KV8B 2LXUA 3J81Y 2R2SA 2DBBA 3CT9A 3HHLB 1RT7B 2XWXA 3P96A 1YG0A 4UQGA 4DL5A 2OTLS 2LKZA 1S0NA 2W9CA 2K1RB 3JSYA 4C0HA 4DR1F 1XMOF 4MAKA 2F40A 2ZKTA 4LVOP 1D3WA 5T7LA 2ZOGA 4CT8A 2YNGA 4C8OA 3CB4A 1OQ3A 1SJ4P 2GGPA 4TXSA 3PHEA 1NJXA 4IRDA 1KSPA 1URRA 3BM7A 3IXQA 3WX4A 4Q8FA 2V8HA 3CCSS 4ECTA 2XS7A 1X4EA 2BACA 4ZS6A 2FDNA 4K50A 1FCAA 3FEXB 3S8SA 3BR8A 1PO6A 4IG3B 4R0JA 2J6SA 4FVMA 1VQ7S 4RNFA 4BS2A 4HKQA 1XERA 3DRRB 4DG1B 3K0JA 3MR3A 4QWDA 3JTOA 2CKWA 3RR7A 3DLKA 4AE5A 4J9NA 4HHJA 4KGMA 5D4LA 1B7FA 2FJWA 2C22A 2BW2A 1IKVA 2VBYA 3B78A 1PC5A 3FZ2A 2DH9A 1D0EA 4FBUA 5HP1A 1TUVA 3C6UA 3SDEB 5IQQA 2CJQA 3HHDA 3HZEA 2H9ZA 1QTMA 2EG1A 1TKXA 3OQ2A