2AD9A

Solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
GDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PTB bound to RNA: specific binding and implications for splicing regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords 5'-R(*CP*UP*CP*UP*CP*U)-3'
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ad9A00
3I56S 5BJRA 3H2VE 2HYIB 3J7ZT 4FXVA 2X1FA 2DO0A 3THPA 2DGQA 2MGZB 1R8HA 1WEYA 1SJ4P 2CQHA 3S01A 3RW6A 2MHNA 1KQSR 2MQLA 3CCMS 1KOHA 1NU4A 5GADU 1OIAA 3CULA 2XS2A 3S7RA 2F9DA 2M70A 3US5A 3LPYA 1H2TZ 1HD1A 4WF9Q 4F26A 1WG4A 2DK2A 4YOEA 2RVJA 2E5HA 1CVJA 1U1RA 1VBZA 2F3JA 2LXIA 2RU3A 1SJRA 4WIIA 4YB1P 2L9WA 2MZRA 3D2WA 2KG1A 3VAJA 1X4EA 2DGVA 1P27B 2X1AA 3VAKA 2XB2D 4W90B 5GAGU 1U6BA 2DNLA 5IQQA 2ZJQQ 3G96A 2AD9A 3MUVP 1K9MT 1FJ7A 2DH8A 2YTCA 2M9KA 3S6EA 1WHYA 2DHGA 2EK6A 3EX7B 2DHXA 1WELA 2GHPA 2MZSA 2X1BA 3SDEA 1X4BA 2DGTA 3Q2SC 2CQIA 2M8HA 1X5OA 2M7SA 2GO9A 3VAIA 1WG1A 1YWXA 2KH9A 2CQ0A 2Q79A 1JJHA 3CCUS 1WF2A 5JVHQ 2MPUA 1X4CA 1VQOS 1VQKS 1U1LA 2MKSA 4YUDA 5FJ4A 1M1KT 4C4WA 2JRSA 2PE8A 5CA5A 3SDEB 2CPIA 3CCSS 1H6KX 2RUGA 4J5OA 3BEGB 1WEXA 1HL6A 4M5DB 2MQPA 2E5JA 2KM8B 2E44A 2KXFA 2CQ4A 4P6QA 2MKJA 3J7YU 2RQCA 2CPZA 2U2FA 5D77A 1YITS 1FNXH 2KRRA 4CH0S 1FT8A 2ADBA 1FO1A 1M5VC 4QPTA 1KOOA 2L08A 2MKHA 1W2BR 2E5IA 2BOPA 2MYFA 2LA4A 5LJ5Y 1U1KA 2MY7A 2VONA 2LCWA 2DNGA 5DDOC 3BO2A 1D9AA 2ADCA 4IOAQ 2CQBA 2CPHA 1OPIA 3BS9A 3CMES 2I38A 2XSFA 2MZ1A 2CQDA 2AYMA 2D9PA 3UCUP 1X5PA 1X5SA 2K8GA 2OSQA 4QU6A 3UD4P 2M4MA 3V4MA 5ITHA 2MZJA 2KU7A 3VAMA 1H2UX 3VAFA 1FXLA 3EGNA 3NS5A 2MSTA 3N9UC 2DGWA 2DGSA 1VC5A 3B4MA 2J8AA 1OO0B 4F02A 2DIUA 5DDPC 3MD1A 3CD6S 5GMKa 1SJFA 1DHMA 2KI2A 4PRFA 4QQBA 3U1MA 3PIOQ 2LEBA 1N54B 5JVGQ 2KYXA 2O3DA 2DNHA 1VQLS 2UP1A 1L3KA 1HD0A 1SJQA 2RRAA 1AUDA 1ZZNA 2DH7A 2LA6A 3R27A 4OZ1A 4Y0FA 1NJIT 1X4AA 2DNOA 2DNKA 5DETA 5GVQA 2KXNB 4C0OC 2HGLA 3HI9A 1VQ5S 1WF0A 1WWHA 2MQOA 2DGUA 3MUTP 3FEYB 2PEHA 2CQ1A 4TU8A 4ZKAA 4ED5A 2YH0A 1D8ZA 2D9OA 2G4BA 2JVOA 2NLWA 2VOPA 4IOCQ 3I55S 5LJ3Y 1VBYA 1K8AT 1PGZA 1VQ4S 2BZ2A 1IQTA 2M88A 1YJWS 2N3OA 1P1TA 1VQ9S 2U1AA 3PIPQ 1Q7YT 2LKZA 2YKAA 1NO8A 2DITA 2N3LA 2RQ4A 1JJ2R 1QM9A 2MZQA 2MZTA 3R1LA 2OIHA 3NNCA 1G2EA 2DNPA 1U2FA 1YIJS 3P3DA 3G71S 1DZ5A 3MUMP 2X1GA 1WG5A 2E5GA 2V94A 1UP1A 2DHAA 1WEZA 3MD3A 2KG0A 2ERRA 4TU7A 2VOOA 4CQ1A 1SJ3P 1VC6A 5EN1A 3TYTA 2MMYA 2DNMA 1WHWA 3SXLA 2MB0B 2CJKA 4CIOA 4EGLA 5DM7Q 3EGZA 3CCRS 4RU2A 1VQPS 2DNQA 3UE2A 2MGZA 4V19X 1URNA 2M8DB 1WF1A 2KRBA 2L41A 2LXUA 3UWTA 2FPHX 4F25A 5CYJA 1FJCA 1N52B 2RS8A 1FHTA 1R8PA 1A9NB 2KFYA 2QA4S 3UD3P 3DLLQ 4BS2A 1UFWA 4OZ0A 5IM0A 1HA1A 4IO9Q 3CCJS 2DNNA 3FEXB 2RT3A 2DNRA 2XNQA 4QU7A 2LEAA 1X4HA 2LECA 4TU9A 5IFMA 1DBDA 2KM8C 2DIVA 3CTRA 2M2BA 3UCGA 2DHSA 3CMAS 2CPFA 2EK1A 1WHXA 4LIRA 2K3KA 1H2VZ 3VAGA 3S8SA 2MQQA 1VQ8S 1X5TA 2DGXA 2J0SD 1JJ4A 2CQGA 5GAHU 3TP2A 3B4DA 1M90T 1YTYA 4Z2XA 3CC4S 2DNYA 3IWNC 3RW7A 1U1QA 4U67Q 2KN4A 3R1HA 5LSOA 3IRWP 1F9FA 3CCES 3NMRA 1VC0A 1Q82T 4IUFA 2I2YA 3CUNA 2AYEA 5HO4A 4WFBQ 5D78A 3CXCR 2J76E 2N7CA 2KT5A 2MKCA 1O0PA 3MDFA 2YH1A 4W92B 3L3CA 2LMIA 1VQ7S 2B0GA 2FC8A 1VQ6S 3THTA 2LYVA 2MKIA 3CF5Q 1KD1T 1RKJA 2D3OR 2MXYA 2F9JA 2CQCA 2AYBA 2XS7A 3SMZA 3CCQS 1UAWA 2MKKA 3MOJB 5LSLA 1YHQS 5LXYA 3MXHP 1QVGR 3LQVA 3NNHA 4LMZA 2OSRA 1YJ9S 1N88A 1QVFR 2OJ3A 1X4DA 1YJNS 3G4SS 1PO6A 2KVIA 1WTBA 3JB9k 4TLQA 4FXWA 5DDQC 2DH9A 2J0QD 2G0CA 1N8RT 4LJMA 1UW4A 1M5OC 2OTLS 3DXBA 2RNEA 5IM0B 1X0FA 2DNZA 3MURP 2WBRA 2ZJRQ 2MJNA 2QFJA 4A8XA 4UQTA 4PR6A 3OW2R 1RK8A 1WI6A 3BO3A 3CCVS 2FC9A 2JX2A 2KHCA 2M0GB 4WFNQ 4Y00A 3U1LA 1ZH5A 1U1MA 2CPYA 3NNAA 2ZJPQ 3CCLS 3G9CA 2DISA 3ULHA 2MY8A 3ZZYA 2CQ3A 2MQMA 2AYGA 1B7FA 2MSSA 2LQ5A 3G8SA 1U1PA 3P49B 1OWXA 1X4FA 2HGNA 3CPWR 2KXHA 1VQMS 2OTJS 3VALA 2VODA 2SXLA 1KC8T 3K0JA 5GAEU 2CPXA 5H1SV 3BO4A 3NS6A 4PKDB 1BY9A 3UCZP 2CQPA 2CPDA 3P6YC 1S79A 2CQ2A 1VQNS 3Q2TC 2MQNA 2HVZA 1K73T 1ZZFA 2EVZA 3VAHA 5DM6Q 1Q86T 5CXTA 4WKRA 4WCEQ 3TO8A 5LXRA 2DB1A 1YI2S 2A3JA 2JVRA 2DGOA 5MLCV 1XN9A 4UY8T 5HL7Q 1S72S 1U1OA 1SXLA 3VF0B 3CC2S 1JMTA 2CPJA 2NZ4A 2QEXS 3H2UB 1A7GE 2XNRA 3CC7S 1U1NA 2FY1A 1WI8A 2G1DA 4CH1A 3G6ES 2M52A 2DO4A 4WFAQ 3HHNB 1M5PC 1U6FA 2JWNA 5DDRC 2RS2A 1WHVA 4C7QA 2MJUA 1FJEB 3ZZZA 2FHOB 4ERDA 2YWKA 2CPEA 1VBXA 3P5TL 1Q81T 1DRZA 2RRBA 2N82B 3MI7X 1M5KC 2HGMA 1X4GA 2XS5A 2HZCA 3G8TA
chains in the Genus database with same CATH superfamily
4DZ6A 2XM3A 2ACYA 1OS5A 1BLUA 1PBUA 1Y5LB 2YKMA 1EIYB 1FDNA 5BJRA 3BQ1A 3W1YC 4JOUA 2YNFB 3O1LA 4Z7CA 3R5DA 2V9KA 3H2VE 2VBZA 5KT2A 1S4EA 4FXVA 3KJVB 5ETOA 2X1FA 3HPOA 2HWTA 4PABA 4TY9A 4UOGA 4J91A 3ZZ0A 2DO0A 1NB7A 4I4BA 4C48A 3MPWA 1HWJA 3IMQJ 1R8HA 1WEYA 2MGZB 5HJYA 1SJ4P 2CQHA 2HZAA 5E5NA 5AXMA 5JXSA 1J5OA 3OPKA 4JI5F 1WKJA 1KQSR 3RBZA 4NI2A 3H25A 3OLAA 3CCMS 2V2VA 4LREA 3CJRA 3A8KA 5F0UA 3HO1A 2W25A 3CWJA 4F4WA 1N5YA 3FEZA 2W9CA 1RHMB 3S7RA 3H59A 4IH7A 4WKYA 4WF9Q 4DJBA 3BPDA 3D28A 4EBCA 2QO3A 1QJHA 4V1Ak 2CA9A 4F26A 5RUBA 1RWNB 2ZHAA 4J9NA 3V81A 2AGQA 2W2QP 3MM5B 2UUTA 3TX0A 1CVJA 2CJ9A 1IKXB 1WSVA 2FJAB 3VVTA 1JXVA 2LXIA 3KK1A 3ILJA 4ZVGA 2CJYB 4LF2A 4UT4A 4M5HA 2XO7A 1HWIA 1RAHB 4I6WA 1SB6A 1RT3B 3ZTQA 4ZLLA 2DKOB 2YBVA 1HIYA 4CO1A 2FJEB 3VV2B 5HN0A 2KG1A 3HHKA 4F8RA 5GAGU 1HNXJ 1RE1B 1CLFA 2ZFHA 3PW7A 1F2HA 4Q45A 4H4KC 3D1QA 4OYWA 2GA7A 1BQXA 3H8YA 3OFHA 3WHIA 1TP7A 3M1VB 1VDHA 4LF7J 4ZP9A 2R8IA 3MUVP 1K9MT 3BBFA 1FJ7A 2YTCA 5J2PA 3PJXA 1E6YB 2ZITA 4LIWA 2UUAF 1X9MA 4B3TJ 3DC2A 2O01C 4DPXA 4DN9A 1S1XB 2HAFA 2DGTA 1SC4B 2CNLB 3C14A 3K7RA 3BQ0A 1NJWA 4JI6J 2IDEA 1T94A 1X5OA 2QA2A 4ZHRA 3VAIA 1WG1A 1PKUA 2B4VA 2HQCA 5KFKA 3KJFB 1X60A 5KG6A 2RF2A 4DL4A 3M8QA 1KQGB 5A0YB 1WF2A 5KT3A 2NCKL 3BBBA 4NLPA 1RHJB 2RE1A 4XO0A 1DQ9A 3CGIA 3H98A 4OZLA 2D1CA 1DURA 2HRTA 3C6TA 4W4MA 5LMUJ 3QO9B 3DLKB 4DQSA 1V3ZA 3MWBA 5LT5A 1LXJA 1PAEX 3R6LB 1QTNB 3AB4B 5I42A 1F5BA 1LFWA 4LFCJ 3GB0A 3SQOP 1MROB 2AZ3A 4UQGA 1Y5IB 3OR1A 3HSJA 4DS5A 3BQ2A 4B3RJ 3M2VB 2CUYA 4F2SA 2GAGC 4OI4A 4DFMA 5AXKA 4IRDA 2ROPA 3DRRA 2I9SA 3QPIA 2IRUA 4UTGA 2MQPA 4B17A 4DV1J 1NK0A 2HHTA 1AXQA 1FDBA 1Q8KA 3KK3A 3TW0A 3TUJC 2JEGA 4C8ZA 4MMOA 4CP5A 4HH1A 2U2FA 1XMQF 1YITS 2BACA 3TUIC 2ZVSA 3PX4A 2MLXA 3OFEA 1FT8A 4CM0A 2VQFJ 5BXIA 1FO1A 3H5SA 5B7WA 3LGNA 1VOMA 5U47A 2UUAJ 1YK9A 3BSNA 2CVEA 2UXBF 5HMWA 4O4RA 1U0SA 4PG5A 5THWA 4ATNA 2E5IA 2OD6A 1R0BG 2PGCA 2VQEF 3A12A 5LJ5Y 2BOPA 2VA2A 2MY7A 1RHQB 1TL1B 1HNZF 2Z57B 2BJ1A 1U6ZA 2PA8D 2G2ZA 2BKOA 4XK8C 4Y2MA 3DFEA 3T5KA 3BO2A 2ADCA 1D9FA 3TAMA 3NGTA 4QIFA 1T03A 3SZ2A 2HHHF 3CJQA 4U8VA 1XERA 3T5HA 4DX5A 2GS8A 3OXGA 2OFGX 1B64A 3PM9A 2I38A 2XSFA 5KTQA 5IV3A 2WVCA 1RA7A 4USTA 2Q1LA 2GAHC 3GILA 1QAXA 3I4PA 4IDKB 3UD5A 2FVQA 1YRXA 2OSQA 1OYDA 1C2PA 2GV1A 2QLXA 4B3TF 2MZJA 4ZP6A 1RT7B 3BGFA 3PO4A 2KU7A 5EX0A 4LQ3A 2F4VF 2E9TA 4OHYA 1N56A 5KG0A 2MSTA 4CLSA 3J7A1 1FWPA 1Q7LB 4MTPA 4DU7A 4ED8A 2DGWA 3W2WA 4LBPA 1SH3A 4DSKA 3EUNA 4EEYA 1HPZB 1U09A 1NK6A 3PRBA 4F02A 1AB8A 2WVDA 1U8WA 4ZPWR 5HJXA 1JB0C 4DL7A 3QSIA 1JLBA 2CZVC 2FDNA 3AJ1A 4U95A 5GMKa 1Y3JA 4QOTA 3W9JA 1LXNA 2Q3PA 4RW7A 2OH2A 3QIPA 1SJFA 3RBDA 2FVPA 1DHMA 4JYAF 4PRFA 1EB0A 3POTB 1HYSA 3U1MA 4NYZA 2EC0A 4USJC 1ZYQA 2J9DE 3KKFA 4UUXA 1UL3A 2BQRA 3DU5A 2ZC3A 4ES3A 3PG9A 1E6YA 1RWOB 5KAKA 2HLUA 2QN6B 5CYMA 1CC7A 2OLWA 3ZC4A 1SJQA 3OTBA 1LK7A 2R42A 3DOLA 3MCOA 2BYCA 4CM2A 5EHHA 1ZZNA 4B3OA 4Y0FA 2V2QA 5J2NA 1NJIT 1ZTWA 2DD8S 2IBKA 3KJNB 2B9EA 3NS7B 5ETKA 3WZ0A 1FTCA 2XZDB 4YDDB 3L7UA 5A8RB 5E41A 5DG9A 1SL1A 2DRBA 4JYAJ 1HWKA 2UVUA 5DETA 1RU2A 3GCWP 1NZ8A 2OPQA 4CTAB 2UUCJ 3CD7A 2AWZA 2HNDA 1D9DA 3J81Y 5KG1A 4J9MA 3NKYA 1JWWA 1LWEA 5KFEA 2A6MA 4DV5J 1S1UA 4HI2A 2HS3A 1WF0A 4IR1A 1RISA 5C5JA 4DSEA 2PEHA 3GG1A 4OYIA 4WK1A 1WKLA 2JC1A 2YH0A 1D8ZA 2G9OA 4O0IA 2JVOA 2UVRA 3QJJA 5B0EA 3MGJA 2Q66A 4IOCQ 3JAMY 1VBYA 2WTFA 2ZZMA 1VS3A 4B9LA 3MPDA 2BZ2A 1HBUB 4P9SA 4USWA 3MR5A 1VJQA 2WONB 3F44A 3AH6A 3KG0A 1SQGA 3GFXA 3MCNA 2OEJA 2BANA 1TKTB 2LKZA 5KT6A 1NO8A 1JKHB 2DITA 2CXEA 5D4PA 3TJAA 3W2WB 4JI5J 5HAOA 3QIPB 5G4DA 4GKJF 3VGSA 1N34F 1XEZA 3JSMB 4A8FA 5F3TA 4J37A 2BEFA 3TJ9A 2DNPA 1RWPB 3AY0A 1U2FA 3AQOA 2AP6A 1HNIA 3Q24A 4LF7F 3DGPA 1H0HB 2HS0A 4F0KA 3QQCD 1X7VA 2VUGA 4RW7B 3CCUS 2RSQA 3TQEA 1FD8A 2E5GA 1PCAA 2IYIA 2V94A 1UP1A 3TZWA 2DRAA 4DL3A 4Y28C 4TU7A 1TL1A 1BGXT 2OGUA 4RW4B 3VR1A 3PJ9A 3N6LA 5IT0A 3LGHA 3KHLA 4FVCA 3WBZA 3OLBA 5L1LA 3DMJB 4AXIA 2DVIA 2VKZG 4U7CA 1IBCB 1O5JA 1URRA 4KRWA 4EGLA 4QR1A 2B8PA 4FKXA 4PG6A 3TA1A 4ANDA 3PVXA 2P5VA 3HVTA 3KOAA 1J5OB 1RP5A 2OEMA 4P10A 5IT4A 4WBFA 4ANCA 4U6PA 1AA1B 1CEZA 2ASDA 3NXZA 1TK0A 3NRBA 1S0MA 3EYZA 2M8DB 2BJ8A 4MYUA 4Q8FA 1IWGA 1AT1B 2LXUA 4GC6A 2FLPA 2JC0A 4GRSA 4NLRA 4ZVRB 3R5AA 4B3SF 1CJKB 4FF4A 1R8PA 3LH2S 3LOUA 1GH8A 3A8EA 2X3DA 2QA4S 2ZZTA 3A8JA 3QYYA 3DLLQ 1UFWA 2LQBA 4CCHA 3MAHA 4Q2LA 4QCLA 1FXRA 5K8MA 4KSEB 3UVJB 2UXCF 3KLEB 3W62A 2UU9F 2RT3A 2IVMA 2XNQA 2LEAA 1HHQA 1UZHA 3MFHA 2LECA 2R8KA 4KT0C 5G0RA 1EX8A 2IYGA 5IFMA 1G3OA 4E0DA 3CDWA 1RT6A 2V63A 3MAQA 4MKYA 1UTAA 3UCGA 5HP1B 3AB2B 5HLFA 2DCLA 2FLOA 4Y2CA 4C8NA 2CFXA 3OFFA 2RQMA 3ZTRA 1WHXA 4ED6A 2UXBJ 1DFDA 1DLOA 2BMBA 4Y65A 1A0OB 1IJEB 1TL4A 3AQPA 4HI1A 2E9ZA 3EE3A 2D3ZA 4PYAA 1X5TA 2GO8A 3FBFA 3WIVA 3ZTPA 2DGXA 3DM2A 4CNZA 3Q8PB 4ZVOB 3W2VB 1OQ6A 3EZOA 4MKBA 4RR5A 3DRSA 5DO2A 1HBNB 4NXMF 3JSMA 3CC4S 3MF5A 2E1CA 1CJVA 2HHHJ 1T9YA 2ATCB 5DGBA 3LP1B 4URSA 1TV6B 2HRYA 1U1QA 3CJ3A 4TLRA 3AFGA 4DV0J 3C6UB 3J7AN 2G1HA 2V4JA 4YHHF 2MKYA 4HDGA 2F4FA 5CQGA 3KG1A 2RF2B 3H5UA 4USMA 3KDNA 1BQNA 4X4QA 1F3VA 4ZN1A 1FXDA 3AJDA 2VU5A 4WFXA 4DV7F 3BYPA 1GNKA 3PZPA 4KFBA 5IT9Y 1NJZA 4F4KA 4P2SA 2NXEA 1CULB 1UZDA 3V6HA 4PXDA 3QRPA 1S9FA 3D68A 3BYRA 1FRXA 5C24A 4K5SA 2KT5A 2MKCA 1W26A 1LNQA 3IG1A 4ZPDA 5KFVA 4FPIA 4X4OA 1JK9B 4Q5VA 2YH1A 4UY85 3G8QA 1NPKA 3I87A 3JSBA 2FC8A 4LR7A 1SUQA 4KC5A 4YB5A 1VQ6S 2LYVA 2GIRA 2HBRB 1I94F 4NLGA 4UOCA 2B51A 3K17A 1KR4A 3FUYA 3MR7A 4PXCA 4X84A 2IY5B 3T9ZA 1N5VA 2IA0A 2D3OR 3HCXA 4DZDA 3JQMA 1WOOA 2FZCB 2AYBA 3DOMA 1NHVA 3SMZA 4YY3J 1RADB 1PJ7A 4PG4A 2OPPA 1JLBB 3DLBA 1DAXA 4ZVUB 4DSFA 4DBQA 4ICLB 1OMSA 4DCOB 3RYLA 2C2RA 2Z2LA 5LXYA 3MEEB 4F4ZA 3LQVA 3POTA 1SH2A 5AJ3J 2O1PA 1YJ9S 3M05A 1N32J 1RT1A 3R5BA 1LWXA 3HXMA 2OJ3A 3HMJG 2H51B 1GK8A 2KVIA 3CJ0A 3DU6A 2IRXA 3G4SS 3ILOA 5HLFB 1PO6A 2OPSA 3C16A 2HHWA 3JB9k 4TLQA 3I31A 1UPMB 3KWMA 2VG7A 3D3CJ 3VWSA 1NK4A 4OLOA 5B09A 3NEKA 1T03B 5DDQC 2OP5A 4R0EA 1TU0B 3CJSA 1RWKB 1V9OA 3CW2C 3MTKA 2DTJA 3GSIA 4WU2A 3EPIA 2HHUA 1LW0A 3OQ2A 3QSYB 2YKMB 3JAMU 4K4ZA 4F36A 3M32A 3MMBA 5IM0B 4KB7A 4RNOA 3O5TB 2BBEA 3SQGA 2DY1A 2VASA 2K1RB 4IG0B 2F63A 3R2CJ 2GQCA 4HACB 4URGA 5E3AA 2QFJA 1H72C 1PBAA 2MJNA 3BF4A 1OJ4A 3N5BA 1F5AA 2BJEA 2HQ3A 3QZ8A 2FC9A 3NGRA 2A10A 2BDPA 2YY3A 3FQLA 4TYAA 2BQ3A 5CYQA 5I4MA 1XNRJ 1NDLA 1S76D 4K4YA 2XHCA 3IO1A 3QNWB 3U1LA 3TVYA 4J9VA 2JL9A 5AXLA 2XYPB 3JS9A 1EKRA 3LP0A 4LF1A 4M5IA 3CJKA 5HQMA 2CPYA 1RWMB 3NNAA 5KFIA 1G6BA 4IFVA 4RW8A 2EFNA 2NXUA 4K8RA 1R0AB 1UEKA 1TK8A 3G9CA 3KDOA 4K5RA 1OSCA 3C19A 1RKIA 2RIJA 3QBCA 4DR3J 1Y11A 3GV8B 2WB4A 1NLKL 2MSSA 1RT1B 3GIMA 3QO9A 1RHRB 2PIIA 3LP2B 3RAMA 2P6SA 4BHQA 4F50A 2HURA 3G8SA 1QTMA 3K8VA 4WYLA 2XCPA 5BYRA 1U1PA 2BANB 4WE1B 4P74A 1X4FA 4TQSA 4DPOA 3CPWR 4O3SA 1ZA2B 2VG6A 3ICLA 3KLIB 3ZZRA 3CCTA 1G4CA 4NEZA 4U7UK 3T1AA 2VJUA 2LEPA 2CPXA 2C22A 1T8EA 2HHXA 2ZBIA 4I7FB 3EGVA 4AFFA 4P7VA 1BY9A 1Q53A 2E66A 4ZPCA 5AE1A 2DT9A 2CQPA 1KLMA 1TL5A 2FTRA 1Y4ZB 4YMEA 4L72B 3J81U 4Z37A 4X4NA 4MJKA 3BKUA 1KTQA 1PYTA 1MWZA 1SV5B 4ITSA 3J7YI 2VQFF 3VAHA 3PO5A 2B3TB 4F4AA 4ZOSA 3CDEA 2E9RX 4WCEQ 3SFGA 3NOCA 5LXRA 1ZS6A 1S49A 4ZCKA 1W7WA 3GIRA 1FVSA 1U0HB 2DGOA 1I3OB 3KHHA 5HL7Q 4F67A 1M5SA 4RBVA 2VPZB 2OELA 4ILMA 2IHR1 1FD2A 1SXLA 1WC4A 2GJ2A 2VBYA 5FIIA 3PW5A 1UFLA 1L5UA 3E3XA 1JMTA 2XI2A 2XWXA 4RW9B 1LWFB 2YQ0A 3D67A 5GAEI 5ADZA 5KFFA 3H2LA 3RB0A 2NZ4A 2QEXS 3H5XA 1NM2A 3DGVA 3I5CA 4QWEA 4PXEA 4C8YA 3CC7S 1RT5A 4KV8A 4RUHA 1K0TA 4YB7A 1Q1KA 1RA6A 4FYXB 2G1DA 4LF4J 4X2BA 4OX9F 5F9NA 2DO4A 2QGFB 3LP2A 1M5PC 2H5IB 1U6FA 2QZ8A 5CYQB 2JLFA 4X65J 1WHVA 3HJFA 1HHSA 4FZVA 5ETPA 4DOZA 2CVIA 3ZZZA 1EHWA 1GX5A 1KHWA 1H38A 4NRUA 3R7BB 2YWKA 4EFAC 4ERDA 3D9BA 3DDNA 3P5TL 4ZPVR 4WFYA 4A8SA 2RRBA 3JYTB 2H3EB 2ZE2A 3OL6A 1EJ7L 2GIQA 3ZZPA 4ILRA 4J90A 4I6YA 2HAIA 3UDEA 3H42A 3M30B 4D3HA 4EYIB 1L3UA 3I56S 2MDAA 5KFNA 1TAUA 3TR5A 5D4LA 4J9PA 3ISZA 1FX4A 4N47A 2IJRA 2AIRB 3FNNA 3UN3A 1HW8A 2HPUA 4LBHA 3MR3A 3SV4A 2HYIB 2ZWOA 3M8YA 2ASJA 3DNCA 3OFGA 1E6VB 2WVBA 2JFDA 1RWWB 2YKNB 4KO0B 4OMFG 1Q95G 1JX4A 3PYDA 4URQU 2KTQA 1YDLA 4CLPA 1QLNA 2W2OP 1RWUA 3S01A 2J7UA 3CJTA 2V8DA 4G6VB 3RW6A 4M5DA 2ZH2A 2YQ3A 3I0RA 1I94J 2QT7A 4C3MA 2V2KA 4A4JA 2J9CA 2C2OB 2ZD1B 2GZOA 3S1TA 4WP9A 4XDDA 3CULA 3KUHA 5A8WA 3EWGA 4LVOP 3DLHA 3HFKA 1YZ7A 1IWAA 2DPIA 2K2PA 1HD1A 1NKCA 4DQIA 3PW0A 4QJVA 4ZVQB 1H7XA 5BR8F 3IGVA 1WG4A 2DK2A 2UV8G 4YOEA 1SC6A 1SCJB 4DF4A 3VTIA 2VFRA 3EDQB 3R3TA 5T7LB 2P9GA 4NA2A 1HBOA 4LSLA 2VKRA 4DN0A 1Q4RA 2RU3A 5M2PA 1K47A 1SJRA 4DV3J 1OSDA 2ZZNA 3V6DB 2W24A 2J0WA 1JXLA 3T1YJ 2C2MB 4YB1P 4LVNP 1CJUA 2V8VA 2Q43A 3VAJA 2RILA 1ROFA 1X4EA 2HG4A 2ZH1A 3VAKA 1UFKA 4MKVA 4FBUA 5IQQA 2ZJQQ 2H4YB 4ZS6A 1TKZA 2AD9A 3KG4A 1YBAA 2BW7A 2VFVA 1Y9OA 4DPUA 2M9KA 3S6EA 3IRXB 3KK2B 2EK6A 1CJTB 1HQEA 1ZOTA 4QZVB 1QAIA 2V34A 4IQMA 3GG0A 1YJRA 4YS2A 4QYZJ 3CB4A 2MZSA 2QTWA 1RT2B 4E2FB 4PWDB 3SDEA 4FF3A 3FSYA 3O6QA 3Q2SC 3E51A 4J9KA 3IAS9 3G86A 5A6WA 5M2UA 1JQGA 4EZ9A 2AF6A 4CTAA 3OJSA 1BQNB 3HHLA 5C24B 2GMHA 2Q79A 3C14B 3HZGA 1JJHA 1SKUB 4KHRA 4OJHA 5A8RA 4YR0A 1PG5B 1S1UB 2COLA 2OAUA 3ELHA 2MPUA 3BGOP 4UOFA 4KAIA 5JMNA 2LLZA 4PAAA 1VQOS 1RUSA 2XMVA 4DX6A 4NA1A 1H73A 3BR8A 2H54B 3LF0A 4EBDA 2XMMA 3PX0A 4BWJA 5KFOA 1JLGB 1PC5A 5GADI 5HK4A 3QRRA 4TXSA 3CCSS 2DEIA 4ZLPA 2C2DA 2QFIA 1LQ9A 2RUGA 4KO0A 4FF1A 2HK3A 1YZ6A 3X1LB 3LTOA 4JI4J 2C3MA 4ENOA 3FZ2A 4P73A 5D3GB 2WK4A 2K06A 3RRGA 5J2QA 2GVZB 2UUBJ 3R5CA 1JXEA 2E5JA 3DN9A 1GMUA 2E44A 1IKYA 2DR7A 1GT8A 2KXFA 2CQ4A 2V5HG 4NMLA 3NGSA 2W8LA 2MKJA 1N33F 1N5YB 2BKNA 2OFHX 5J1EA 1SC1B 4L3KA 4H4MB 4IFVB 4OV1A 4RW8B 1R0AA 3FFIB 3FBBA 3IGNA 4DUYF 4AL7A 4I67A 4HLBA 1IXKA 1K1SA 2NXJA 4NZ0A 1Q0NA 1VYAA 3OVAA 1M5VC 1O51A 4OX7A 4QPTA 4KGZB 3M6UA 1C0UA 4PWWA 4RLEA 1RSCA 4RW6B 3I5AA 4YHHJ 4DR1F 2R7QA 4OHVA 4AT1B 4K4UA 1VISA 5K9FA 3SSSA 2VONA 2FHMA 1JLQA 1L3SA 2IMWP 2KDOA 2V68A 1D9AA 2UZAA 4O3RA 4F0HA 1S1TA 4XAKA 3N28A 4ER8A 4CO3A 3AA9A 2RKIB 1C1CA 3MCMA 2VC1A 4NASA 1QE1A 2JEFA 2QX0A 3NBPA 3GP9A 3OTOJ 3TUPA 3BKFA 2AYMA 1AYEA 1RGVA 2NR0A 2D9PA 3KXDA 4ILLA 5KFPA 2J5AA 1X5PA 2AX1A 2XZTB 4JI2F 2UXDF 2K8GA 2ROGA 3ZO7A 1WOSA 2GVDA 3LA0A 1FCAA 1U24A 3V4MA 1OYEA 4QIVA 4QYRA 5ITHA 1RJJA 1QUPA 4DV2F 3RRHA 1Q8BA 4AQYJ 1H2UX 3VAFA 2J6UA 2JSXA 3QMQA 2NUHA 1IR1A 4RU9A 2LU2A 3N9UC 3EVOA 5J2MA 2ZH8A 5J2QB 2EFVA 3KLHB 4LFBF 4KR0B 2DGSA 3DLKA 4A8WA 1VC5A 4A46A 1NJYA 1RBAA 3G2XA 3GFYA 1HI8A 1R27B 4Q2MA 4ELUA 2ZOMA 1N36J 2DIUA 4JP8A 1GX6A 1MROA 3M6WA 1T9UA 2V67A 3MD1A 4H54A 5J1EB 3B6BA 1F0XA 4DLEA 3PCOB 2AJFE 4J9RA 2F4VJ 1NK9A 3BZQA 4NZ7A 2BE7D 3IG1B 1SPBP 3SFUA 2W7OA 3GJTB 2KI2A 4OYAA 4MK9A 1KRPA 3PIOQ 5KG3A 3ZNUA 5DQHA 3G6YA 3MMAA 3T6JA 2CRLA 1N54B 4C0HA 4X4VA 2KYXA 1UVNA 4LFBJ 3HSZA 2MTLA 5KFYA 1T3NA 2UP1A 1NHUA 3NGKA 1L3KA 1AUDA 1SKRA 2EKNA 5C2CA 3O44A 5D8HB 3F56A 4LR9A 2ZKTA 1F5CA 4FF2A 3DRXA 2V8PA 2V4JB 4Q44A 4CH7A 3W2VA 1T0TV 1VBKA 1VK8A 2FQQB 2GCFA 3PDNA 4MIWA 1NSQA 3FC9A 1C4CA 2POKA 3OHBA 3OUYA 2WVFA 4Q43A 1N32F 2DNOA 2NYIA 2IC3B 3BGRB 2DNKA 1JIHA 1NEEA 1VRQC 5GVQA 4RUCA 2WOMB 4JV1A 4LF9F 3W5YA 3PFOA 2NPIA 3PKMA 1C1BA 4ZP8A 2XMTA 2ZNZA 1DTTA 4FYWB 1CULA 1FFWB 1WWHA 3MUTP 4NRTA 2LU1A 3QGHA 2FVRA 3FEYB 4ZKAA 2J7KA 2D9OA 3GJSB 5DQIA 2AGOA 1K8AT 2F65A 1T05B 1PGZA 1TUVA 3D66A 4BLGA 4LF5F 4PQAA 3GJQB 1IQTA 4QR0A 1BE4A 2W9CB 1YJWS 1P1TA 5B0AA 2QLBB 3I32A 3UDVA 3R9LA 3ZTOA 3T5JA 2GVDB 1L3VA 1U25A 2IJNA 2H5JB 2N3LA 2RQ4A 1X9SA 5FLXY 3W9HA 4IDKA 1QM9A 2MZQA 4HT5A 2OIHA 3NNCA 3ENWA 3V6DA 1RTHA 4JI1F 4CLUA 2LXFA 3ZZTA 5EDWA 1YIJS 3J81j 1DZ5A 2YPYA 1GAOA 1IM4A 5T7LA 1LK5A 4UF4A 2H9ZA 1UA0A 2O67A 2I1RA 4A8MP 3C3LA 3M8RA 1S0NA 2ERRA 1RAAB 3PXGa 3KMSA 4NYOA 4LF4F 2R9LA 4DR5F 2HBYB 3W3SA 2NQPA 1RI7A 2DBBA 3TQ1A 3KNGA 1VC6A 4FYDA 3ITHB 3TYTA 2IM2A 1S1TB 2MMYA 1S48A 3HFVA 4X66J 3ZXWA 2XQCA 1U49A 3MEDB 2WSEC 1KFSA 2HMIB 2I5JA 2B6AB 4J9UE 1R8CA 3CDBA 2Z30B 4ECWA 3CCRS 2OUGA 3MEEA 1MW7A 3UE2A 4Q8EA 1KFDA 3GMGA 4WXWA 4L75A 2C3YA 1TQLA 2QG9B 4OX6A 1X0PA 1NKEA 2CDQA 3DI6A 2W1BA 2AJ0A 2FPHX 1TKXA 2PMWA 2ZM6J 3U27A 4DR5J 1N52B 2RS8A 3LPEA 3GIIA 1FJCA 1REVA 3T1YF 4I1TA 2KFYA 3D0GE 2K1RA 4IG0A 3W5XA 2ZVIA 5IM0A 5M2RA 2V4QA 5HI7A 2R8GA 2YWGA 3DHXA 4IO9Q 4M94A 1B4SA 4C9DA 3HK2A 1LW0B 4GVBB 1T05A 3OR2A 1AFJA 4DL2A 3EZUA 2FUG9 4JI0F 4OHZA 2DNRA 4QU7A 8AT1B 6AT1B 4P52A 4KHMA 2LFVA 1MWYA 4TU9A 3GIJA 3R7NB 1AZSB 4JI1J 4ANEA 3RB6A 1DBDA 4KHPF 2ILZA 2CJBA 5HSPA 2M2BA 3FGVA 2FJBB 1QUVA 3QLHA 5IXUA 2Z2ZA 4DV4F 2EFQA 2YX1A 2E1AA 1IJFB 2AEMA 2EI5A 3H7HB 3CMAS 3PHTA 5KFMA 1XMOJ 3SCIE 1N5SA 4LRDA 3EVMA 3S8SA 2CZ9A 4TNOA 3GQCA 4X64F 4LFAF 2BE2A 2ZDOA 3V4IA 3P4UB 1DQAA 3RR7A 1JJ4A 2IBOA 3TI0A 2WSFC 2J0SD 5F8MA 1J2VA 1FERA 2W7PA 4LT6A 4HHUA 5E3CA 1CJTA 1HQEB 2JZ5A 3J7Z5 2VBWA 1YTYA 2DNYA 3FBCA 4OI0A 2F5GA 2LQ8A 5DRKA 1Y10A 3TEHB 1JKHA 2WW4A 3RW7A 1Y3KA 3PNIA 2C2EA 4M5NA 4UUWA 2V6AA 1HBNA 1UVKA 3CNQP 2QA4G 1ZBTA 2B8QA 3BM7A 3M2UB 4ECXA 4B3MJ 2R7TA 1P9QC 4DR6F 1L3TA 3D1OA 4LF9J 1PAUB 4C8MA 2YVSA 4LRCA 4I7FA 5ETQA 1C1BB 3MFIA 1Q82T 3R97A 4XTTA 4MKAA 4GO5X 1N48A 4AXJA 5B08A 3RB4A 1XK8A 3EGWB 3LWLA 4WFBQ 4RNNA 2FLLA 3RUBL 1MU2A 4DPWA 4I68A 2KZMA 3CJ4A 2Z0GA 3PJWA 1FDAA 2N7CA 4KBIA 1SIZA 4PZVA 3RJMB 1O0PA 3MDFA 2K7JA 4W92B 4X64J 1PSDA 2BV3A 2B0GA 1XIQA 4RZRA 3M9NB 1NCLA 1FRHA 1TAQA 3RG6A 3GWCA 5DZ7A 4IG3A 3CJ2A 2X7IA 4DQQA 4KJIA 2ACMA 3H4BA 1RKJA 2MXYA 1C4AA 2F9JA 5AE3A 5KG7A 2G0IA 3M9MB 3CCQS 1YGYA 4FPRA 3GFZA 3GCXP 3HZEA 1F1BB 2OMOA 2QIFA 1R6YA 1ZM3A 3KLGA 3SI8A 3MM8B 5LSLA 1QSYA 2UU9J 1TK5A 1RT6B 1Z1ZA 1S6PB 1IBKF 3NNHA 2OSRA 4C3LA 4AQYF 3MM5A 2DPJA 4RBUA 4HHJA 4FS1A 4CLTA 4HYKA 1S9EA 5I3UB 1SC3B 1T9XA 1ZM9A 4I6AA 3QLHB 2IPOB 3TEGA 2UXDJ 1YG0A 3BH7B 4USIA 3N01A 3I4HX 5T41A 4DV3F 4S0MA 2AW0A 2YWFA 2CWKA 2GGPB 5CD4H 2DH9A 3V81B 2ZH9A 4IYQA 3DLGA 1K44A 2VBXA 4DL0C 1NAQA 3H4DA 1N8RT 4K4TA 2EG1A 2GHVC 4CI0B 4HTIA 5CD4A 1M5OC 2H4WB 3IBCB 4E8UA 1UVIA 2RNEA 1RZMA 4ED3A 2Y0SD 1C1CB 4X62F 1VJWA 1SKSA 1X0FA 2JDJA 2HNYA 2DCUB 1WC6A 1HFEL 2C2NA 2NXCA 2XULA 1TZ0A 1NH7A 2WBRA 4I2PB 4KQZA 4UZCA 5EUHA 3NG8A 3VQSA 1B99A 2J8SA 3T1HF 4OL8A 1YRUA 4UQTA 3MMCA 1V6HA 3N6MA 1RK8A 3VGVA 1FEHA 1WI6A 4DR6J 2JX2A 1OQ3A 2KHCA 2YKNA 4QWAA 4C8KA 5C7PA 4L76A 4DS4A 1BC6A 2WAQD 4TKTA 4IFYA 4Y00A 4R8UB 1F2GA 1WD6A 4LF8F 4TY8A 2C2KB 2DR6A 4IG3B 3CCLS 2YNIA 3QWPA 2JJ4D 4IKAA 4JV2A 4CRJA 8RUCA 2DISA 5H9EJ 4DWIA 4ZVPB 4EZ6A 3IR7B 2MY8A 2CQ3A 2KKHA 2FGOA 2QSWA 3M8QB 3T5LA 1NDKA 2QV6A 1HQUB 4EK2A 5MAOA 2VG5B 4O0NA 5F41A 3OD2A 3HVRA 1J5EJ 2RHQB 3BKTA 2LQ5A 3PHEA 4DV4J 1NPPA 5ETNA 2FZGB 3BH6B 3P49B 2RRNA 3T3FA 1OWXA 4N5SA 3TNVA 2HGNA 3MM8A 2KXHA 1VQMS 3KMQA 1PJ5A 1UJ6A 3AD7C 2IDLA 4K4WA 3AOCA 3UW1A 4ED0A 3K0JA 1N36F 5IT9U 5EX3A 5H1SV 3BO4A 2XWYA 2ZUGA 2OHDA 3AT1B 4PKDB 4ZJLA 3UCZP 4U7UD 2WONA 3DOKA 3MOZA 1N0UA 2CQ2A 4JI6F 3W61A 2Y9HA 2HRUA 1K73T 2VPWB 2XY6A 3Q2TC 3DM2B 3IM9A 3NLCA 3UNYA 1HLWA 1ZM2A 4OZ2A 2QMWA 2EVZA 3LANA 3TA0A 5HBMB 2CNOB 3VHQA 4XIUA 1Q86T 1CJVB 2A2DA 2GX8A 2BX6A 4ECZA 3I82A 5ETTA 4DL5A 5CXTA 2J6TA 4F2RA 1IQZA 3KLIA 1RTIA 4RO0A 1NSPA 1VRTA 2DB1A 5D4OA 1YI2S 2I6WA 4DR4F 4NXNF 2A3JA 3KUGA 2AQ4A 4NZ6A 6FDRA 5K8OA 2Y8WA 1UETA 1DQ8A 5HROA 1F3FA 3TWZA 3T41A 3TOQA 2F8EX 3HVWA 3IRXA 2R2UA 1U1OA 1S1WB 1NJXA 1N6QA 1I6JA 2P6TA 2RDJA 2GHWA 4FNIA 1FK9A 4FKYA 5K20B 4PWDA 2HQFA 3H2UB 5CAAA 1EKSA 1N5TA 3MR6A 3CO9A 1HNZJ 1WORA 4CH1A 2M52A 2R7XA 3HULA 3DLJA 4WFAQ 3HHNB 3FJ2A 1KONA 3HDSA 4WZMA 3O2IA 3MEGB 4FP9A 2JWNA 2CJAA 4OYMA 2RS2A 2QL5B 1S5ZA 2ROEA 4O3PA 5D0GA 4C7QA 1U8SA 2D3O1 3N4WA 1BQMB 4KH0B 2LQ9A 2NZCA 1VBXA 1HPZA 1Q81T 3M4XA 4C0BA 3PYEA 4DCJB 4ZPBA 2N82B 3KLHA 1M5KC 2AHOB 1EZZB 4FBTA 5KT4A 4ECRA 2GNKA 3WX4A 3G8TA 4M1KA 2YXLA 3QJPA 1W2IA 3CT9A 2IJFA 2KFZA 3PRDA 5A76A 2V4RA 4ECSA 1NZAA 2VZ9A 2AEJA 1SIWB 2YNGB 3D4JA 1T3OA 4CLFA 2WVEA 4JI0J 2QJ3A 3ONQA 3GV5B 4UW2A 5IS2A 2DRDA 2HNYB 3DLEB 2XEXA 4KGKA 2B4PA 4H4OA 5GMDA 1YLXA 4ICLA 4WJBA 2Y1JA 2LP4A 2Y8YA 3AD8C 4IRKA 2R7WA 3CCJS 4F4YA 3DDIA 4PQUA 4QW8A 1HBMB 2MHNA 4YR3A 3K58A 1B70B 2MQLA 3DI6B 4PUOA 5GADU 5KFAA 3D1HA 3NBPB 1IBLJ 1KQKA 2HWIA 1OIAA 4L3NA 4DPTA 3TZZA 1UVLA 4DF8A 2YKQA 2XS2A 2F9DA 2W4CA 2M70A 2RQKA 3M30A 4IOBA 4PYDA 1H2TZ 2F8HA 4Q7AA 5KFGA 2XGPA 5AJ3F 1LWCB 3MPVA 1ZPVA 2QLWA 4NE9C 4K7QA 2R2TA 2FYXA 4OFZA 1U1RA 3WQPA 1VBZA 3T19A 1R7IA 5SZTA 4RWXA 3LALA 2UUWA 5KOWA 3PFEA 3HM9A 3QFHA 4CZCA 3TVKA 3GSDA 1GXTA 4QWBA 2KZZA 3JQJA 1ZETA 3P8BB 2L9WA 2PT0A 3NCQA 1S6PA 2MZRA 4NLSA 1BQMA 3WC0A 5DLGA 2DGVA 1KS2A 4ETZA 3Q8SB 2IM0A 1DJ0A 1RAFB 4YDXA 2X1AA 2XSJA 4RUBA 1U6BA 2C2ZB 2C3UA 4HT7A 2AJQA 1O8BA 2DNLA 3CIMA 3AJ2A 1Y00A 3MEGA 2AEFA 3G96A 4DR2F 1VI7A 1ZAVA 2RDDA 2WRMA 5FD1A 4P7TA 4HH0A 4ZITA 3PYGA 3CCWA 1XMOF 1TKTA 1U26A 4B9NA 2QYGA 3JSRA 2DHGA 3D0HE 3U1NA 4DX7A 2ASYA 3EX7B 3GTYX 1R31A 3GZ7A 1WELA 2GHPA 2YX7A 5KFBA 3L7OA 2X1BA 3GIKA 4B9MA 4M95A 1VCTA 4TVAB 2ZDPA 4X4UA 2OD4A 2Q6BA 2VFUA 1RTIB 2M8HA 3PIPQ 4LSZB 3KYLA 2M7SA 1DTQB 2YKOA 3C2PA 1YWXA 2GQQA 1ZAXA 4DQPA 4PQUB 1FJGJ 3OHAA 5C42B 1YBTA 2AJ1A 2ZWPA 1UEUA 3QAEA 4ZMMA 2O5DA 2A2CA 1U1LA 3EPGA 2MKSA 2H65B 5BYQA 1SV5A 1M1KT 4C4WA 3IAM9 2PE8A 3RGIA 3SDEB 2CPIA 5CA5A 4ECUA 1I51B 1S0OA 1KBRA 1H98A 1CC8A 1FX2A 1S57A 3KUEA 4QR2A 2ALZA 2JLGA 2WW8A 2PDAA 5FDLA 2HFZA 4FYVB 1MLAA 3UDLA 4G1IA 1WC5A 4F04B 3EMTA 4CLZA 2KYZA 1Q16B 1TKXB 4NLVA 4M5DB 3RBEA 4ZIWA 4MAKA 4B9UA 3VGUA 4O23A 2DEJA 4ZVEA 1RT4A 4P6QA 2DHHA 1IN0A 1JLFB 2XSJB 1UA1A 1SQFA 1N34J 1T7PA 3FZBA 1Q5YA 4G1PA 2CPZA 4BC9A 5A8KB 2KT2A 3IFEA 2PC6A 3KJVA 4LSNB 2XI3A 5T14A 1ZTTA 3RAXA 3N6NA 1FNXH 4Y2AA 4CH0S 4JI4F 1WDDA 1R8BA 4USVA 3TRGA 1UPPA 3KLEA 5L1KA 2ADBA 2VH7A 2GC8A 3Q86A 3UVJA 1KOOA 1GMWD 4NWBA 2YWHA 4RNHA 4WTYA 4DUZF 2MKHA 1HBOB 4LSLB 1W2BR 5G0RB 1GTEA 3VQTA 4OJ3A 5KFWA 2XBPA 3VVUA 3BSCA 3OVBA 2LCWA 2DNGA 1G7CB 1UMJA 2HFUA 2CYYA 3ZFVA 4BC7A 3DLGB 4A48A 5DDOC 4X4PA 4IOAQ 2ZBQA 1HMVB 4CLYA 3ITHA 2HVEA 1X8DA 4KGXB 4OLPA 1JLAB 1OPIA 4OYPA 4WU3A 2W9BB 4QWDA 4J9OA 2ZH5A 4EUVA 1S99A 3CMES 1NSKL 2CQDA 4BCAA 2XMAA 4MIBA 3SCLE 3C15B 5IWAJ 3THVA 4OYXA 1WUUA 5D0RA 4EO8A 2IIHA 3IM8A 5L46A 3UR0A 4NPOA 5L1JA 3UD4P 2X51A 3MPUB 1HW9A 1NMEB 4DMZA 5D6GA 4JUZA 4ETXA 3GLJA 4AYBD 3VAMA 4ZVHA 4B08A 2CJQA 3G82B 1C0UB 2Y0BB 3D7SB 1HARA 3EGNA 1Y5NB 3NS5A 4GMKA 3LAMA 3V5RA 4DI6A 5KFCA 1QSSA 5ETMA 5FLXU 2C1EB 3FBEA 4DV1F 4OHXA 5FDLB 2J8AA 2ZOFA 1OO0B 3MM6B 5DDPC 2VOOA 2ATLA 3IR6B 1Q8LA 1FK9B 5EGYA 4NLUA 4F7VA 4JI7J 4JI8J 1AFIA 2QMXA 3MAAA 3HHLD 2KHDA 1FKPA 3N79A 1V5VA 3IN5A 3I5BA 2EBGA 1Q78A 2CNKB 1VLYA 3JXOA 3LGMA 2H5EA 3KJQB 1D3WA 2HWHA 1I5OB 2QL9B 3QFWA 1HBUA 2V2ZA 3MECB 3K89A 4KFBB 2HKEA 2D3UA 2IAJB 2O3DA 4FDFA 1VQLS 3CD5A 1EP4A 1MG7A 1LWFA 3FRZA 3TZYA 1CS4A 4A8QA 1HD0A 1RAEB 4C97A 3PX6A 2RRAA 2AT1B 3GYGA 1ZAWA 4NCAA 5D3GA 1J27A 2DH7A 2HBZB 2YPZA 5F8IA 3C66A 4OJGA 3FRYA 4NEYA 5HATA 2JLEA 1FNMA 3PW4A 4R5PA 4DG1B 2ZNYA 2ZH7A 1HI0P 3EZ5A 4H4KA 4RJVA 5LMNJ 3QT8A 3TJ8A 4C0OC 4LR8A 4ID8A 5HQ8A 3HP6A 3HI9A 1MSWD 2EEYA 4I2QB 3OUYB 2XY7A 2VF3A 4ELTA 4USKA 1GTHA 2OKQA 2DGUA 3I9ZA 2MQOA 1TUGB 4CLLA 2B9YA 3OBIA 2CQ1A 1IKXA 3HSDA 1TELA 3HX9A 3IWXA 4ED5A 2G4BA 1TL3B 2VV5A 2VA3A 5HBMA 4RPFA 2VOPA 4HL9A 4C3KA 8ATCB 3I55S 2IM3A 2HVHA 2RJZA 4I0WA 4NLXA 5HVFA 1VK3A 1BMQB 1S1XA 1PILA 3FSIA 1FFSB 1FKOB 1F60B 2M88A 3SV3A 2K7KA 3LAKA 1S1VA 1B0VA 2N7YA 2RMLA 3UPFA 5J2PB 4EBEA 1Q7YT 4NXMJ 1G1XA 2ZBCA 1JJ2R 2E7WA 1S6UA 5J2MB 4C2MA 4EWTA 2MZTA 3G82A 5I3PA 3AAWB 1M1GA 2EBEA 1G2EA 3LUYA 2HS4A 3P3DA 3G71S 4ALZA 4ID5B 3NGDA 3MUMP 3E01B 3H40A 1FF2A 4KKOA 2EW9A 3Q89A 3EM1A 4HDHA 2XLKA 4F3OA 1KTVA 1ELOA 1NPRA 3IS9B 3M8WA 4KH1B 5KFRA 3UNGC 4CQ1A 2QE5A 5EN1A 3PKYA 1R0CB 1OY8A 4WK3A 4CT9A 4JI7F 1NNDA 1Q8IA 3RB3A 1WHWA 3SXLA 2MB0B 4WFZA 2CJKA 4JV5F 2OPRA 4PXBA 3HLUA 2D41A 2GJIA 1C0TA 1VHIA 2M5YA 3NWGA 2WHOA 3RRKA 3TANA 2GGPA 4CO4A 3MR2A 3KHRA 4USHA 1GQEA 3EGZA 4RU2A 2DNQA 2G0JA 1URNA 4EMDA 1TMJA 4ELVA 2L41A 1HNXF 2R7UA 1CG2A 1S9EB 5I3UA 3ET6B 1ITPA 4BBYA 3EXCX 1RWXB 5D15A 3ENAA 4LRFA 1QDUB 4DUTA 4PWUA 4F25A 3HHEA 4IQXA 4KTQA 4ZLNA 1A9NB 5GAHI 1FHTA 1HNIB 1UEVA 3W60A 4GC7A 3UD3P 4BS2A 3DMJA 2PO4A 2RKIA 4WPAA 3OTOF 3DKDA 2R3VA 7FD1A 3QGGA 4QIWD 2MEWA 1FVQA 9ATCB 4DPYA 1SJ1A 1SQEA 2DNNA 1YKWA 3SEOA 1JLQB 5EWEA 3X3UA 2JHEA 5L8RC 5E2QA 4NXNJ 2QLJB 1NHKL 3TVZA 4NLQA 1XTZA 1FKOA 2BW2A 2HVDA 3D3BJ 5LSRA 2KM8C 3PW2A 4K0KJ 5F8JA 2HHVA 3P96A 4RW9A 2CPFA 3P5BP 1D0EA 3QZ7A 2EK1A 2F8MA 3HHLB 4LIRA 1LEOA 3EJMA 2K3KA 1RAIB 4WWSA 3VAGA 4DR3F 1KEKA 1XJWB 2XMKA 1RAOA 6FD1A 1KLNA 4ID5A 1VQ8S 1R8AA 1S1VB 1NSAA 4AE5A 3U7JA 1FEEA 1U2CA 1A6LA 1Z4UA 1S7HA 2CIMA 2L9NA 2Z2MA 1D8YA 2QSFA 3TP2A 2R7SA 1M90T 3KLVA 4OX8A 2VD3A 4Z2XA 3A3NB 3IA0A 3VZIA 2KN4A 1RCOB 3AOAA 4QW9A 3R1HA 4KGMA 4QPXA 5L1IA 3SYZA 3UN5A 1LW2A 2BQUA 1U48A 3LWMA 4Z7YA 2CJXB 2UXCJ 2V8HA 3NCPA 4GVLA 3MMAB 3IRWP 2VHGA 4YR2A 5HVHA 3J80Y 3FCWA 3V6JA 3T1HJ 3NMRA 5C42A 3W66A 3GR0A 2XZWA 4I2QA 4PCQA 4FYYB 4M5JA 4IUFA 1UVMA 2CNNB 3ENQA 2I2YA 2AYEA 1JLCA 1FDDA 3D0IE 2I0XA 5CCMA 2R8JA 1HYSB 1NXIA 3N5FA 3B54A 5D78A 1RAGB 2IMOA 2BE2B 2J76E 3F0NA 5GAGI 4LF8J 1FJGF 2EWHA 2QLFB 3A3OB 3EICA 3NCRA 4PPDA 2KJVA 3IBFB 3L3CA 2BVZA 1RLDA 2Q6CA 2W8KA 1AROP 2LMIA 3TA2A 5F8LA 2UVVA 4I64A 1VIXA 3THTA 1H7WA 2MKIA 3F73A 5BYSA 3Q0AA 4RL1A 4C6AA 3CF5Q 4B3OB 1KD1T 2Z4PA 2FB0A 5F8NA 4YQWA 1IKVB 2H48B 2ZHOA 4P2XA 5KG5A 1S59A 3H20A 2CQCA 3OR2B 3OL8A 2XS7A 2XTJP 4ES2A 1BUXA 3QT6A 1YX2A 3C46A 1UAWA 3ZTSA 3MOJB 1RAJA 5K8NA 4KPCA 4DDFA 1F9EB 2ZD1A 3M32B 3Q8VA 4MK7A 1YHQS 2HQDA 1KKHA 1F9HA 5E33A 1N0VC 1QVGR 4WTOB 3JTNA 1S97A 1N88A 1ZPWX 3HVTB 1QVFR 2XS5A 3BV8A 1RTDA 4Y6IA 1LWCA 4MYTA 2LVWA 1K1QA 3AXMA 4OHWA 4DSIA 5E0OA 4X4RA 1WTBA 5JJBA 4C98A 2APOA 2CWXA 2ZUAA 4FXWA 3V2UC 2HQIA 3HHLC 2ZHBA 3MM9B 1C0TB 2KB2A 5D0HA 5KFLA 3MURP 4J9LA 3OL9A 4QYZK 4PG8A 2YNGA 5F8GA 4O3NA 4YB6A 4G65A 1UW4A 2MQ8A 1S6QA 4A8OA 3P45B 1TTHB 1FA0A 3PACA 3V6KA 1WNEA 3QT7A 4ZK7M 1KNZA 3GJRB 1UWAA 3KLGB 4P72A 2B4OA 3MTJA 2HFNA 5ETSA 3RU0A 1YJ7A 2MHEA 2NPFA 4TQRA 2R7VA 2A18A 1HHTP 2AJ2A 4ZJQA 5K14B 3IXQA 4NX9A 3D54A 3OW2R 4X4TA 2V50A 4CO0A 1U47A 4V19J 2RDIA 2VPXB 4PPZA 4R0JA 3CVKA 4RW4A 4P2MA 1YJUA 3UN2A 4WFNQ 3SCKE 1T9TA 2JOQA 2Z58B 3KNAA 4JI3F 3A13A 3O3LA 3QAUA 2ZJPQ 1CPZA 2VG7B 4B9VA 5H9FJ 1RTJB 2DR9A 2ZBPA 4D3GA 4FS2A 4F3MA 3C8YA 3H0PA 1XMBA 4WXOA 4DR7F 1EARA 2JEJA 3OXFA 5LOQA 4OX9J 3HF5A 1RTDB 3OL7A 4ZPAA 3RR8A 1HI1A 1YRTA 3E01A 4Y34A 5KFXA 2LDIA 3B82A 2FY8A 4G1QB 3UI3A 3KFWX 1T9VA 3VALA 5ETLA 2VODA 1VIOA 2SXLA 5L38A 5GAEU 4RBTA 1CQNA 3OTCA 2XMUA 5B0BA 4R5PB 1WSRA 4CLKA 4O4GA 2CPDA 2PN6A 3WIUA 3OR1B 2L48A 2MQNA 1MMLA 1SH0A 3CO0P 1ZZFA 4IO1A 2B4UA 4R25A 4A8KA 2AJ4A 1JLEB 2GIFA 9RUBA 2PEBA 2DYAA 4YFUA 1VLOA 5DM6Q 3JTOA 4LF5J 1DTQA 2GMJA 3FCHA 2HZVA 1ZA1B 3BN4A 1NH8A 2A0FB 2L9DA 2IVFB 3TO8A 2ZH4A 2PI5A 5DJBA 1F6TA 3KK1B 4F4XA 3V4IB 1HQ2A 3R5JB 5MLCV 4UY8T 2KFNA 2D69A 1PJ6A 2CADA 2V0NA 4N56A 1NK8A 3Q8RB 3BSAA 3A4TA 5CYMB 4ED2A 2BUNA 3B78A 2CPJA 4OYZA 5LMNF 3DRSB 4OYOA 1RTJA 3R7SB 1A7GE 2XNRA 3DOKB 3C6UA 2FHKA 4ZCLA 1U1NA 2FY1A 2WZ1A 2JFKA 2HSEB 5K14A 3G6ES 1B7YB 3PYFA 4P75A 3L4BC 2W7AA 2VJVA 2BKPA 3PTWA 3QGIA 5DDRC 5A2QU 2P2CB 5CCLA 2MJUA 1ZM4A 1JJCB 3HHDA 1DY3A 2RUSA 2OI2A 4L74A 3UR3C 5F8HA 1APSA 2J9EA 2CPEA 1KP6A 3ISNC 2DR5A 1U02A 3FCVA 1M5HA 1DRZA 4OZ3A 5K5MA 1P9YA 1HQUA 3PY8A 1LKZA 4M5MA 5KFHA 1WTFA 2M3DA 2XCAA 1QSLA 1J5EF 4RNMA 4NMXA 4X4SA 3SBMA 3I0SB 2F7VA 4Y2KA 3TARA 2AGPA 2AV5A 4JI8F 1MN7A 1FRLA 3BB5A 1XC9A 2CDRB 2QL7B 3AA8A 2PA3A 4B02A 3Q8UA 4MFBA 1ULRA 4N8OA 3CIZA 3J7ZT 2EXUA 1H3DA 3GPAA 2AX0A 3ET6A 5I3QA 4OI3A 2HHQA 4DV5F 2P9CA 4ED1A 3THPA 2DGQA 4UOHA 3CJ8A 2ABYA 5IC6B 2IA6A 3CD0A 2UVWA 1MN9A 2GQ2A 2VB6A 4I56A 4DEZA 1VRUA 4NLDA 2B5JA 3Q8QB 1LV5A 2HHPA 4M5LA 5B0DA 1KOHA 5KG4A 4AD6A 3K57A 1NU4A 4CYUB 2R4FA 2XMJA 3HVAA 2CKWA 1HNVB 4JI2J 4LBIA 4DV0F 4MK8A 2OPPB 1I1GA 3B8HA 2I8EA 4MH8A 5KFQA 3C16B 3US5A 3LPYA 3A8IA 1TFWA 3QT5A 4ZVSB 4F0MA 1T11A 5IQ6A 4C8LA 1EQ0A 1MWQA 4KYZA 1T02A 2XGQA 2KG0A 1S1WA 3PR4A 1Y0HA 1KVJA 1OY6A 2AZ1A 2E5HA 2RVJA 2XG8A 1RDRA 4NLOA 5CH7B 4K50A 2F3JA 3T9NA 4DV7J 2G2OA 2KT3A 3FSXA 1UWBA 2VDIA 3DXSX 2VIHA 4RX6A 3W64A 1S9GB 1IBMF 2VFTA 4WIIA 1N4LA 1SBRA 1YQHA 2HNDB 2AU0A 5SUHA 1BXNA 1RYRA 1N6QB 3OXLA 3BDPA 4BWMA 4B3MF 1JNRB 2IC3A 3BGRA 5AT1B 3D2WA 1KSPA 1P27B 2XB2D 1X31C 2HNZA 2YX4A 1V3RA 2HLTA 2ZEJA 3M6VA 3OTEA 1WACA 2KVQE 4N76A 2QC3A 1FRMA 2BM1A 1XWLA 2X3GA 2ALYB 2KJWA 5AE2A 4K59A 2DH8A 2BRLA 4N41A 5ETRA 1WHYA 3C6TB 2UUBF 3VZHA 3MECA 4ED4A 2DHXA 1AW0A 5GMEA 1LW2B 1S77D 5F3ZA 1REGX 5I42B 1X4BA 2CQIA 4QIEA 2XC9A 4DFPA 3BJYA 2GO9A 2DJWA 2FHJD 2VG5A 2Y3YA 1QD1A 2KH9A 4KHPJ 4P71A 1FWLA 2CQ0A 2A6OA 3R6GB 2J6SA 2MLZA 4CLWA 5JVHQ 3D6MB 4GO7X 3FK4A 3I96A 4X62J 1XR6A 3NY0A 1X4CA 2HFSA 1VQKS 3OV7A 1NRKA 2GMLA 1U2RA 3MM7A 2Y1RI 4YUDA 2FVCA 5FJ4A 3FMWA 4A8YA 2D74B 3JQKA 2JRSA 4FVMA 3MZIA 4IH6A 2RHSB 1SI9A 3Q8YA 1UW9A 3N0VA 4PEOA 4HHHA 1H6KX 4J5OA 1KWMA 3TZXA 2ZH3A 3BEGB 4CWBA 1WEXA 3M7VA 4B3SJ 3WC2A 4CYUA 3HKWA 3W8GA 5HQLA 5CZXA 3M8PA 1HL6A 1HBMA 1VQSA 3MPYA 2HHSA 3PV8A 1NK7A 4E98A 2KM8B 2EFPA 1HR0J 2EPIA 1JNZB 4DU8A 2HW3A 3QGPA 4NLTA 2HNZB 4UZBA 4NCGB 1UWBB 1CBKA 3J7YU 2IRYA 2XY5A 1R3NA 1UCNA 4LF6F 5L39A 1P1LA 2RQCA 2YKPA 3ETOA 4JV5J 3F41A 5D77A 2HIYA 2J7WA 3TX8A 1YBUA 1FI4A 2KRRA 3FDSA 4NA3A 1RHKB 4U8YA 3SSRA 1X9WA 4C8OA 2PFDA 2CZ4A 2L08A 4NYPA 4U9RA 1GXLA 2LA4A 2MYFA 2P9EA 4ZN3A 4DL6A 3I9V9 1U1KA 3K5OA 3NOGA 4TY8B 1RBOB 3IS9A 5DG7A 2YNFA 1PYSB 4A47A 2RB7A 4NI2B 2XLIA 4DX8H 4GVBA 4ECQA 1CSJA 3FKBA 2CQBA 4DFKA 2V69A 2CPHA 3BS9A 5JUMA 1D09B 2N4DA 2ZC4A 1RT4B 4K4SA 2MZ1A 5KFTA 1MMDA 2ZE2B 1TVRA 3CE8A 3FMBA 3ILIA 4ZP7A 3UCUP 2BXJA 1GFWB 1X5SA 5A8KA 5KFDA 1NKBA 4G3IA 3WX8A 4QU6A 2M4MA 4XPEA 1R89A 5AXNA 5F0WA 3CJ5A 2XO6A 3G6XA 1P8GA 4K0KF 1FXLA 1BD6A 1FTRA 1WC0A 5LM7E 1HMVA 3NGUA 4OQJA 4K4XA 2HVIA 3L95X 2QMUB 4DV6F 3M8PB 2G13A 4K2XA 4N7TA 5KOXA 1EETB 1RQ0A 1SL0A 1XNQJ 4LQ9A 2HIQA 2B56A 3GV7B 2MLYA 5DG8A 3B4MA 3HSGA 1NDCA 5HROB 3DGPB 5KT5A 2OPSB 3OSNA 1DTTB 2BRKA 3KLFB 1MU2B 1IKWA 1VQYA 3PEJA 5C25A 3QJLA 3MMJA 1SVDA 2J0XA 3CD6S 2FD2A 2UV8A 1NB2A 1Q79A 1S6OA 1IBMJ 4Q0BA 2PI4A 4QQBA 2W2MP 3HD1A 4NCGA 4ES1A 5KG2A 3EXYA 2H1YA 2LEBA 1BHNA 1WDTA 4FNHA 4KE5A 4HVZA 5JVGQ 2Y1IA 3CSKA 1CQMA 4N8NA 2DNHA 1XNQF 2A1BA 2V8GA 4M5KA 2PMZD 4YP3A 2FIUA 5E3QA 2ZH6A 1TFYA 4DR4J 4BDPA 2E1PA 1T9WA 2JEIA 2HFOA 2LA6A 3R27A 1FKAF 2IAJA 4OZ1A 2NREA 4B9TA 4CO5A 1Z2LA 1D1UA 3BBCA 1M1HA 1X4AA 5A0YA 2Z8QA 2R8HA 1AUSL 4DUZJ 3W5ZA 3TAQA 2B43A 4OIXA 2KXNB 2R7RA 4ZHRB 4J9QA 2BR0A 2HGLA 2CG8A 2GW8A 2Z56B 3EVWA 2QRRA 3DYAA 4DG1A 3UO0A 5CABA 2YNHB 5HP1A 1VQ5S 4TN2A 1GMVA 3CMQA 4WE1A 3G6VA 4MIAA 4TU8A 3M2UA 2LDYA 3M2RA 1IR0A 3IP0A 3UDCA 1DARA 4CNYA 2CAJA 1V5IB 4ZJOA 3QWUA 3SCJE 2NLWA 3KK2A 2DR8A 4O44B 1IVZA 5LJ3Y 2E7VA 4C11B 5DS7A 1M0SA 2ASLA 1IBLF 2Z2YB 1VQ4S 4DSLA 2L3MA 1IUJA 1ACMB 2BJ9A 4KGVB 1KLMB 2N4CA 1RBLA 3DDKA 5E3PA 2N3OA 2U1AA 2PSZA 1VQ9S 1GXUA 3HKZD 2E5LF 2XYGB 5H9EK 2YKAA 2FVSA 2J9DA 4WYWA 3RZAA 1Y7PA 3OTDA 3ADAC 3C15A 4Y2IA 4LF6J 3R1LA 4Y3CA 4K4VA 1B0TA 1RWVB 3W7BA 1KVIA 1EAYC 3M8ZA 3MMCB 2ILYA 2NYHA 3MM6A 4DCPB 3K5NA 2X1GA 3AHPA 3K5LA 4DFJA 1YJTA 4PUOB 4WZQA 5B0FA 2KL8A 1WC3A 1S4FA 1RYSA 1IM6A 1WG5A 3MAAB 4OJ1A 4YY3F 4DR1J 1KDNA 5C2GA 2DHAA 1WEZA 1OY9A 1S9GA 3HD2A 3MD3A 2BJ3A 3LW5C 1QE1B 4HTJA 3UQSA 3SQGB 3KLFA 5HMXA 1B0PA 1XQIA 1XR7A 2BA9A 4RUAA 5KT7A 4DUYJ 3I0SA 2E1RA 2YNIB 3KHGA 3J80U 1LOUA 4KY3A 1RT7A 1WC1A 2DNMA 2XHWA 3PRVA 4CIOA 3CJKB 3ILLA 5DM7Q 2D7SA 3L09A 1YSJA 4KIAA 4AUKA 4LSNA 2DXDA 2HQGA 2EKYA 4EYHB 2GJFA 1NBEB 1UVJA 4I69A 3OJUA 3W63A 4W98A 4B9SA 1VQPS 3MHYA 4LFAJ 2MGZA 2FJVA 2BM0A 3LO3A 1JLFA 1NDPA 4V19X 2HBQB 1WF1A 2KRBA 4DXLA 1IKYB 5KFZA 1VHFA 4LRBA 4ED7A 1S6QB 2EFGA 2OEKA 3DOMB 3UWTA 3DRRB 3A1YG 5CYJA 2VDHA 3O8WA 2NSCA 3A3PB 4H4MA 4O3OA 1GEHA 4M63A 1H74A 4WP8A 3MM9A 4K2JA 2C28A 1FE4A 4OZ0A 2W9BA 3Q22A 1Z2ZA 1HA1A 1W25A 1GMWA 1YVFA 3DRPB 5LMUF 1O6XA 3MEDA 4CDIA 3FEXB 2E1MC 3VCDA 1QY7A 4O44A 1XMQJ 3IR5B 1TL3A 1X4HA 2IFXA 3FFIA 2NUUG 2R7OA 2DY9A 1RABB 1R6VA 1UJ5A 4J7CA 1TL7B 4HR2A 1S12A 2DIVA 3CTRA 3ZNJ1 4ZA1A 1TR0A 2R2SA 2DHSA 2VQEJ 4C11A 5J1PA 2B9WA 2W2NP 2CG4A 3AODA 3OT9A 3Q23A 4M8LA 3JYTA 4ECYA 3FVYA 4HKQA 1H2VZ 2VL1A 3E8OA 4RKUC 3AOBA 3BDEA 3BREA 4ZDNA 3IWLA 2MQQA 2RH3A 4FXDA 4JB8B 2KO1A 4OZ5A 1U0HA 2NS1B 3W65A 4EU0A 3GONA 2CQGA 1RB0A 1VRTB 2AMCB 2W4PA 3B4DA 5GAHU 5J2NB 3BSOA 1IBKJ 3MCSA 3CEDA 2WOMA 3NWRA 3GYXB 5D4NA 2NSBA 4X66F 5DGAA 3IWNC 4HEA9 4FN5A 2F40A 4U67Q 3ETMA 4PG7A 1RLCL 3WDOA 4X65F 1TKDA 2BOAA 3M6XA 1ZH5A 1HWUA 1IR2A 4ZVTB 2OO4A 2ZOGA 2QA1A 4G1QA 5LSOA 1F9FA 2RU9A 2YWEA 1BWVA 4NL5A 5HMZA 5KFJA 1LWEB 5KFSA 3CCES 1VC0A 3M9OB 2HFVA 3DHWC 1WKKA 4DV2J 1KVKA 1EP4B 2GFFA 3CUNA 5HO4A 1U7LA 4MT1A 3OVSA 1XBWA 1JLEA 3D6TB 1YJVA 4L6V3 3PR5B 1VMBA 3I6PA 2IM1A 3CXCR 3DCAA 1S10A 4OI2A 1XR5A 1JLCB 2PMHA 1N33J 1RTZA 4P2FA 2W9AA 4RNFA 3K5MA 1PC4A 3K8WA 3VGTA 1TMMA 4CO2A 5A2QY 1KHVA 1CS4B 4RWWA 1VQ7S 5IZHA 3CCZA 2JH3A 3G87A 1U4BA 2FJWA 1K0VA 4OZJA 1TL7A 3K5PA 2VG6B 5DQGA 4WP3A 4XPCA 3D6HB 1KQFB 3ZZUA 3K59A 4EO6A 3IBWA 1CJUB 2B5JB 1TKZB 1MNEA 4I2PA 5E7OB 4QWCA 3MXHP 2PD1A 2MKKA 1ICEB 2OMLA 1SJ3P 2LQJA 2WCXA 3NP5A 1HNVA 3R2DJ 2XLJA 4WIQA 1FWKA 2ZBRA 4OI6A 4LMZA 3CDUA 4Q0BB 1FE0A 4LRAA 2B9XA 2B6AA 2I5JB 4USUA 1OPZA 2G2YA 2E29A 1FKPB 1X4DA 2F1FA 4OI1A 5KFUA 3TAMB 4J9SA 1YJNS 2V9WA 1IKWB 2Y1LB 4QIGA 5C25B 1SL2A 2VPYB 4N77A 3SIPB 2O66A 4F3QA 4B3RF 1T95A 2FZKB 3ISND 3FQKA 4M5GA 2J0QD 3LP0B 5DZ6A 1REVB 2G0CA 4ZLJA 4LFCF 2ZJRQ 4IFYB 1FESA 4R8UA 3CDAA 4LJMA 2XMWA 3W8PA 1R43A 3W9IA 1B3TA 2OTLS 4HACA 3AXKA 3T6BA 1RU1A 4DR2J 4ECVA 3DXBA 5A8WB 3JSYA 1XNRF 3ENVA 2PFFB 2B7BB 3HJVA 1S0VA 2DNZA 1RTHB 2QYCA 3L9ZA 3KTQA 1KN6A 3GE9A 2UUCF 1CJKA 1VRUB 7FDRA 4KKOB 1TVRB 4MFBB 4NOHA 2OPRB 2YWWA 5CZVA 4A8XA 2W4DA 3M2VA 4PR6A 3E2EA 4DV6J 3BO3A 1RT5B 4KV8B 2R2RA 3CCVS 2W2PP 1RCXB 4DR7J 2NXNA 3DLEA 2M0GB 3GYNA 4RW6A 1PIEA 2BE9B 2HMIA 2WB1D 2GVZA 2RD5C 4GKKJ 4OYBA 2HK2A 2HEKA 1U1MA 1FRJA 2RAQA 1NK5A 2C42A 1HR0F 4TYBA 3RTVA 4AL5A 1RACB 1UJ4A 3ULHA 4NLYA 5HANA 1FRIA 1QAYA 3H90A 3ZZYA 1SKWA 2MQMA 2AYGA 2WSCC 3NMAA 5IWAF 3R5GA 3KK3B 3TAPA 3SSQA 1B7FA 4YN3B 3MM7B 1UKUA 3D5MA 5J1NA 3EDRB 3MEKA 7AT1B 5DLFA 3R8YA 3L7PA 1VGYA 1TUWA 2P8IA 1RT2A 1VFJA 3HFZB 3JTPA 3NAHA 4O3QA 1HNWJ 2OTJS 4DLGA 2C3PA 5L9XA 1KC8T 2DXEA 3OSPA 4GKKF 2BJDA 3BPSP 2EFOA 2OPQB 4QBUA 4U96A 3NS6A 4OV6A 1TV6A 1VR6A 1IKVA 2FGCA 3AD9C 5K8PA 4IH5A 3DRYA 3HT0A 3IC1A 2W01A 3M1VA 2XYHB 3P6YC 1S79A 2IVYA 2C3OA 1EQMA 3GR1A 2HVZA 4CT8A 4ZCIA 4AL6A 1VQNS 3QATA 1SUQB 4ECTA 3DOLB 4JBCA 3UFCX 3DYAB 4NCBA 1RHUB 1JLGA 4IR9A 2WBMA 2ZKUA 3HT3A 2FHJA 4ZVFA 5ETVA 5EWFA 3GFHA 5IOLA 4WKRA 3M2RB 5H9FK 2BJ7A 3BR9A 2FLNA 1HKAA 2K3IA 2E7XA 2JVRA 2YNHA 4NLWA 1U45A 5BR8J 1XN9A 3Q83A 3QIDA 1LFPA 1AZSA 4GKJJ 4L73A 4LUBA 2B7CB 4O4GB 1P6TA 2FJDB 4ZIVA 1S72S 1DLOB 1MMNA 3VF0B 4DSJA 3TUZC 5EWGA 3CC2S 3BGLA 4XDCA 3BN7A 1HNWF 4ZCMA 5LL6d 1Q5VA 3DRPA 3U02A 3M8SA 5CHCB 1HWLA 1RXOB 4YEAA 2VICA 4KPYA 5F9LA 4OZNA 1WI8A 2AKWB 2VC0A 4JV0A 3D6FB 2BABA 3GU0A 3LP1A 4IRCA 4ZPTR 3ZZOA 1RT3A 1N5QA 5IC4B 1FFGB 1S7IA 5IV4A 3QRQA 5B0GA 5HVGA 4DHVA 5L9NA 1WJ9A 5A6PA 3H5YA 3K2YA 1V3SA 1BWEA 1FJEB 3RBXA 4JI3J 1QAJA 4H4OB 4W90B 1WOPA 1JLAA 2EG2A 2FHOB 2FJXA 1E6VA 4EI2A 3RAQA 3I0RB 3PEHA 3NL0A 1PYOB 2JNJA 1FRKA 2VFSA 3NAIA 3MI7X 1EETA 2EC2A 2E5LJ 2DXFA 1FNOA 4DQRA 2YQ1A 5B0CA 2HGMA 3BGUA 1X4GA 5D0EA 5E3RA 5HMYA 2HZCA 2ZM6F 1NUEA 3MMBB
chains in the Genus database with same CATH topology
2ACYA 1OS5A 1BLUA 1Y5LB 2YKMA 1FDNA 5BJRA 3BQ1A 4JOUA 2YNFB 3O1LA 5KT2A 3R5DA 2V9KA 3H2VE 2VBZA 4FXVA 3KJVB 2X1FA 3HPOA 2HWTA 4TY9A 1NB7A 3ZZ0A 2DO0A 4I4BA 1S0VA 3MPWA 1HWJA 2MGZB 1R8HA 1WEYA 1SJ4P 4JI5F 2CQHA 5E5NA 5AXMA 5JXSA 1J5OA 3OPKA 1KQSR 3CCMS 3H25A 3OLAA 5F0UA 3HO1A 2W25A 3CWJA 4F4WA 1N5YA 3FEZA 2W9CA 3S7RA 3H59A 4IH7A 4WKYA 4WF9Q 4DJBA 3D28A 4EBCA 2QO3A 1QJHA 2ZHAA 4F26A 4J9NA 2AGQA 3V81A 3MM5B 2UUTA 1CVJA 2CJ9A 1IKXB 2FJAB 2LXIA 3KK1A 4ZVGA 2XO7A 1HWIA 4I6WA 1SB6A 1RT3B 4CO1A 2FJEB 5HN0A 2KG1A 3HHKA 4F8RA 5GAGU 1CLFA 2ZFHA 3PW7A 4Q45A 4H4KC 3D1QA 2GA7A 1BQXA 3H8YA 3OFHA 1TP7A 3M1VB 4ZP9A 2R8IA 3MUVP 1K9MT 1FJ7A 2YTCA 5J2PA 3PJXA 1E6YB 2ZITA 4LIWA 2UUAF 1X9MA 3DC2A 2O01C 4DN9A 1S1XB 2DGTA 3K7RA 3BQ0A 1NJWA 1T94A 1X5OA 2QA2A 4ZHRA 3VAIA 1WG1A 2B4VA 5KFKA 5KG6A 2RF2A 4DL4A 3M8QA 1KQGB 5A0YB 1WF2A 5KT3A 4NLPA 2RE1A 4XO0A 1DQ9A 3CGIA 3H98A 4OZLA 2D1CA 1DURA 3C6TA 4DQSA 3QO9B 3DLKB 1V3ZA 3MWBA 5LT5A 1LXJA 3AB4B 5I42A 1F5BA 1LFWA 3GB0A 1MROB 4UQGA 1Y5IB 3OR1A 4DS5A 3BQ2A 3M2VB 4OI4A 4DFMA 5AXKA 4IRDA 2ROPA 3DRRA 2I9SA 3QPIA 2IRUA 2MQPA 1NK0A 4B17A 2HHTA 1AXQA 1FDBA 3KK3A 3TW0A 3TUJC 2JEGA 4C8ZA 4MMOA 4HH1A 2U2FA 1XMQF 1YITS 2BACA 3TUIC 2ZVSA 3PX4A 3OFEA 1FT8A 1FO1A 3H5SA 5B7WA 3LGNA 1VOMA 5U47A 2UXBF 3BSNA 2CVEA 5HMWA 4O4RA 4PG5A 5THWA 4ATNA 2E5IA 2OD6A 2PGCA 2VQEF 2BOPA 5LJ5Y 2VA2A 1UVJA 2MY7A 1TL1B 4Y2MA 2PA8D 1U6ZA 4XK8C 1D9FA 3T5KA 3DFEA 3BO2A 2ADCA 3TAMA 4QIFA 1T03A 3SZ2A 2HHHF 1XERA 3T5HA 3OXGA 2OFGX 1B64A 3PM9A 2I38A 2XSFA 5KTQA 1RA7A 2Q1LA 3GILA 1QAXA 3I4PA 4IDKB 2FVQA 1YRXA 2OSQA 1C2PA 2GV1A 2QLXA 4B3TF 2MZJA 4ZP6A 1RT7B 3BGFA 3PO4A 2KU7A 5EX0A 4LQ3A 2F4VF 4OHYA 1N56A 5KG0A 2MSTA 3J7A1 1Q7LB 4MTPA 4ED8A 2DGWA 3W2WA 1SH3A 4DSKA 3EUNA 4EEYA 1HPZB 1U09A 1NK6A 3PRBA 4F02A 4ZPWR 1JB0C 4DL7A 1JLBA 2CZVC 2FDNA 3AJ1A 5GMKa 1HYSA 1Y3JA 4QOTA 4WZQA 1LXNA 2Q3PA 4RW7A 2OH2A 3QIPA 1SJFA 3RBDA 2FVPA 1DHMA 4JYAF 4PRFA 3POTB 3U1MA 4NYZA 2EC0A 4USJC 1ZYQA 2J9DE 3KKFA 4UUXA 1UL3A 2BQRA 3DU5A 2ZC3A 4ES3A 1E6YA 5KAKA 2HLUA 5CYMA 1CC7A 2OLWA 3ZC4A 1SJQA 3OTBA 1LK7A 3DOLA 2BYCA 1ZZNA 5EHHA 4B3OA 4Y0FA 5J2NA 1NJIT 1ZTWA 2DD8S 2IBKA 4YDDB 3WZ0A 1FTCA 5A8RB 5E41A 5DG9A 2DRBA 1SL1A 1HWKA 2UVUA 5DETA 2OPQA 4CTAB 3CD7A 2AWZA 2HNDA 1D9DA 3J81Y 5KG1A 4J9MA 3NKYA 1JWWA 1LWEA 5KFEA 1S1UA 4HI2A 2HS3A 1WF0A 4IR1A 1RISA 5C5JA 4DSEA 2PEHA 3GG1A 4WK1A 2JC1A 2YH0A 1D8ZA 2G9OA 4O0IA 2JVOA 3QJJA 5B0EA 3MGJA 2Q66A 4IOCQ 3JAMY 1VBYA 2WTFA 2ZZMA 1VS3A 4B9LA 1HBUB 2BZ2A 3MR5A 2WONB 3F44A 3AH6A 3KG0A 5KT6A 3GFXA 3PIPQ 2BANA 1TKTB 2LKZA 1NO8A 1JKHB 2DITA 5D4PA 3W2WB 2KFNA 3QIPB 5G4DA 4GKJF 1N34F 1XEZA 3JSMB 4A8FA 5F3TA 4J37A 2DNPA 3AY0A 1U2FA 3AQOA 2AP6A 1HNIA 3Q24A 4LF7F 3DGPA 1H0HB 2HS0A 1X7VA 2VUGA 4RW7B 2RSQA 2DRAA 1FD8A 2E5GA 2V94A 2IYIA 1UP1A 4DL3A 4Y28C 4TU7A 1TL1A 1BGXT 3VR1A 4RW4B 3N6LA 5IT0A 3KHLA 5L1LA 4FVCA 3WBZA 3OLBA 3DMJB 4AXIA 2DVIA 2VKZG 4U7CA 1O5JA 1URRA 4KRWA 4EGLA 4QR1A 4PG6A 3TA1A 3PVXA 2P5VA 3HVTA 3KOAA 1J5OB 1RP5A 5IT4A 4U6PA 1CEZA 2ASDA 1TK0A 2M8DB 3NRBA 1S0MA 3EYZA 4MYUA 4Q8FA 4GC6A 2LXUA 2FLPA 2JC0A 4NLRA 4FF4A 4B3SF 3R5AA 1R8PA 3LH2S 3LOUA 1GH8A 3A8EA 2QA4S 3QYYA 3DLLQ 1UFWA 2LQBA 4CCHA 3MAHA 4Q2LA 4QCLA 1FXRA 5K8MA 4KSEB 2UXCF 3KLEB 2UU9F 2RT3A 2XNQA 2IVMA 2LEAA 3MFHA 2LECA 2R8KA 4KT0C 5G0RA 2IYGA 5IFMA 1G3OA 4E0DA 3CDWA 1RT6A 3MAQA 4MKYA 3UCGA 5HP1B 3AB2B 5HLFA 2DCLA 2FLOA 4Y2CA 4C8NA 2CFXA 3OFFA 2RQMA 4ED6A 1WHXA 1DFDA 1DLOA 4Y65A 1IJEB 1TL4A 3AQPA 4HI1A 2E9ZA 2D3ZA 1X5TA 2GO8A 4CNZA 2DGXA 3DM2A 3Q8PB 3W2VB 1OQ6A 4MKBA 4NXMF 3DRSA 5DO2A 1HBNB 3JSMA 3CC4S 3MF5A 2E1CA 5DGBA 3LP1B 4URSA 1TV6B 2HRYA 1U1QA 3CJ3A 4TLRA 3C6UB 2V4JA 4YHHF 4HDGA 5CQGA 3KG1A 2RF2B 3H5UA 4X4QA 1BQNA 1FXDA 4WFXA 4DV7F 3PZPA 1GNKA 5IT9Y 4KFBA 1NJZA 4F4KA 4P2SA 3V6HA 4PXDA 1S9FA 1FRXA 5C24A 4K5SA 2KT5A 2MKCA 5KFVA 3IG1A 4ZPDA 4X4OA 4Q5VA 2YH1A 2R8JA 1JK9B 4UY85 3G8QA 3I87A 3JSBA 2FC8A 1SUQA 4KC5A 4YB5A 1VQ6S 2LYVA 2GIRA 1I94F 4NLGA 4UOCA 2B51A 1KR4A 4X84A 4PXCA 3T9ZA 1N5VA 2IA0A 2D3OR 2AYBA 3DOMA 1NHVA 3SMZA 4PG4A 2OPPA 1JLBB 3DLBA 1DAXA 4DSFA 4DBQA 4ICLB 3RYLA 2C2RA 2Z2LA 5LXYA 3MEEB 4F4ZA 3LQVA 3POTA 1SH2A 2O1PA 1YJ9S 3M05A 1RT1A 3R5BA 3HXMA 2OJ3A 3HMJG 3G4SS 1PO6A 2KVIA 3CJ0A 3DU6A 2IRXA 5HLFB 2HHWA 2OPSA 3JB9k 4TLQA 3I31A 3KWMA 3VWSA 2VG7A 1NK4A 4OLOA 5B09A 1T03B 5DDQC 2OP5A 4R0EA 1V9OA 3MTKA 2DTJA 3EPIA 4WU2A 2HHUA 1LW0A 3OQ2A 2YKMB 4K4ZA 3M32A 3MMBA 5IM0B 4KB7A 4RNOA 3O5TB 2BBEA 3SQGA 2VASA 2K1RB 4IG0B 2GQCA 4URGA 5E3AA 2QFJA 2MJNA 3BF4A 3N5BA 1F5AA 2BJEA 2HQ3A 3QZ8A 2FC9A 2BDPA 2A10A 2YY3A 3FQLA 4TYAA 2BQ3A 5CYQA 5I4MA 1S76D 4K4YA 3IO1A 3U1LA 3TVYA 2JL9A 5AXLA 3CJKA 3LP0A 4DL6A 1ZH5A 2CPYA 3NNAA 5KFIA 1G6BA 4IFVA 4RW8A 2EFNA