2AD9A

Solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
GDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*UP*CP*UP*CP*U)-3'
publication title Structure of PTB bound to RNA: specific binding and implications for splicing regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ad9A00
1WEXA 1WG5A 4WIIA 3R1HA 4PKDB 4OZ0A 3N9UC 1WHXA 1FJ7A 3UD4P 1Q81T 2A3JA 1VQ5S 2M8DB 2MQMA 2B0GA 1AUDA 1M1KT 2DNZA 5DM6Q 2HVZA 5HO4A 1M5PC 3RW7A 1HA1A 1W2BR 1KQSR 2K8GA 5DDPC 2DIVA 2CQ2A 3P6YC 1Q82T 3CF5Q 2LECA 2FPHX 3CCRS 2E5IA 2KM8C 1XN9A 2JWNA 2MZSA 2PEHA 2DH7A 2J8AA 3MUTP 1HD1A 5JVHQ 3MOJB 3BS9A 2M88A 3EGZA 2CQCA 5DDOC 1N52B 2MY7A 5DDQC 3UCUP 2KRRA 3VAMA 2QEXS 4WCEQ 2CQ4A 2DO0A 3B4MA 2E5HA 2RRBA 4LJMA 5HL7Q 4WF9Q 2RS2A 2DGOA 2KFYA 2DNNA 1WHVA 1P1TA 4RU2A 4F02A 2RNEA 1UW4A 4Y00A 1KD1T 5IM0B 3CC2S 1DBDA 3OW2R 3CTRA 1URNA 4QU6A 3CPWR 2DGQA 2MZRA 1WTBA 2Q79A 2MYFA 2CQPA 1QM9A 4EGLA 2U1AA 3G4SS 3P49B 3HHNB 1KC8T 2I2YA 2EVZA 2M9KA 2DGWA 4IOCQ 2N82B 4CIOA 1YIJS 2DNMA 2HGMA 2XS5A 1VQ4S 3MDFA 5LJ3Y 1D8ZA 2KHCA 3J7ZT 1L3KA 3DXBA 4WFAQ 1S72S 2CPHA 5GAGU 2N3LA 2XS7A 1P27B 2CQHA 2N7CA 1SJ4P 1FNXH 1X5PA 1X5TA 2KH9A 5GVQA 1VQ6S 4QPTA 4PR6A 1YTYA 4IO9Q 3I56S 1H2TZ 1X0FA 2QA4S 2DNYA 3SDEA 2MQQA 2MQLA 4YUDA 1KOOA 3R27A 4FXVA 5D77A 3K0JA 5MLCV 2M52A 2DISA 1SXLA 2KXNB 3CCES 2KRBA 2QFJA 1X5SA 2X1BA 3NS5A 3TP2A 2F9DA 3VAJA 2MXYA 3DLLQ 1ZZNA 2M0GB 3EGNA 2DHGA 3FEXB 3UE2A 2DNKA 2HYIB 2O3DA 3U1MA 2L41A 2JVRA 1A9NB 2ZJPQ 5FJ4A 4CH1A 3Q2SC 5GAHU 2RVJA 1NJIT 1OO0B 1BY9A 1YHQS 4BS2A 2MKJA 3R1LA 2D9PA 1VC0A 3SMZA 1U1MA 2MKCA 4WKRA 4M5DB 1OWXA 1A7GE 1WG1A 5DETA 3P3DA 2CPYA 3THPA 1SJRA 1U6BA 4W90B 5EN1A 2DGUA 5IQQA 3FEYB 1WEYA 1WHYA 3CC7S 2VODA 1VQOS 3D2WA 3CCLS 2AYEA 4CQ1A 4TU9A 3CC4S 3J7YU 1U1OA 2AYMA 3UWTA 3G8SA 5JVGQ 1UAWA 1OIAA 2YWKA 3MI7X 2RRAA 1YJWS 2MJNA 3HI9A 2MHNA 5LJ5Y 2E5GA 2J0QD 4FXWA 1VQ9S 2AYBA 2MKIA 1VBXA 2YTCA 1U1RA 1VQ7S 4A8XA 3G8TA 1U1KA 3H2VE 1RKJA 3H2UB 2XB2D 2CPIA 5IFMA 5CA5A 2AD9A 5LSOA 2ADBA 1DZ5A 2MGZB 4J5OA 2M4MA 2JVOA 4YB1P 1HL6A 2WBRA 3LQVA 2CPXA 1HD0A 2MZ1A 2M7SA 3VAIA 3CCVS 3CULA 3IRWP 2E44A 5GMKa 3BO2A 3UD3P 1RK8A 2VOPA 2DNLA 1WI8A 1R8PA 2CQIA 2XS2A 4UQTA 2OIHA 4OZ1A 2DIUA 1KOHA 1IQTA 2DB1A 2VOOA 1X4HA 3MD1A 2CPFA 1U1LA 2L08A 3TO8A 3RW6A 2ERRA 3VAHA 2LMIA 3U1LA 2DH8A 2DNOA 3CCQS 2DGVA 3NNHA 2MKKA 5BJRA 2CJKA 1SJQA 1H6KX 2M70A 1WF0A 2DHSA 1N88A 2V94A 3VAGA 4W92B 1QVGR 2X1FA 1D9AA 1WF1A 2G1DA 2RUGA 2MQOA 1SJFA 1M5OC 3NNAA 5H1SV 2LXUA 1Q86T 3SXLA 3US5A 2LA4A 2MMYA 1X4BA 2G0CA 2HGNA 2J76E 1FT8A 1U1QA 2AYGA 2LCWA 1VBYA 2DH9A 4WFNQ 2LA6A 2DNGA 2MJUA 2SXLA 2CQ0A 4Z2XA 1X4FA 1YITS 1WWHA 4TU8A 1NU4A 1JJ2R 2KXFA 2MQPA 2MSSA 2X1AA 2GHPA 2LKZA 2OJ3A 4LMZA 4C0OC 3L3CA 3BO3A 2MGZA 4CH0S 1PO6A 2F3JA 1JJ4A 2L9WA 3PIPQ 2YKAA 2RQ4A 5LXYA 3ULHA 1VC6A 1R8HA 2RS8A 2KVIA 3VAKA 2LYVA 2FHOB 5CXTA 1X4GA 5IM0A 1K9MT 3ZZZA 1ZZFA 2OSQA 2ZJRQ 3UCZP 4C4WA 1WEZA 2CPEA 1X5OA 2MSTA 3NMRA 1UFWA 1X4AA 2DGTA 3BO4A 4U67Q 2DGXA 2G4BA 1WELA 2KYXA 3V4MA 1JMTA 3G9CA 1VBZA 4F25A 3S01A 4Y0FA 4TU7A 2MKSA 1ZH5A 2DNHA 1U6FA 2I38A 2F9JA 1DHMA 2MZQA 2MY8A 4UY8T 2DK2A 2KI2A 2DO4A 2MB0B 2MQNA 2XSFA 1OPIA 2XNRA 2CQ3A 2E5JA 1VQKS 5DDRC 1X4CA 2CPJA 3CXCR 1N54B 1M90T 1QVFR 3VF0B 2ADCA 2RU3A 2VONA 2DHAA 2CQBA 2K3KA 2KXHA 2HZCA 2LXIA 3THTA 4QU7A 3EX7B 1S79A 2NZ4A 3CMAS 2DNPA 1YJNS 1Q7YT 1VQ8S 1M5KC 4C7QA 4ZKAA 3MUVP 3SDEB 1FHTA 2CQ1A 5GAEU 3CMES 2NLWA 2J0SD 1FO1A 1FXLA 3UCGA 3IWNC 2BZ2A 5D78A 3JB9k 1CVJA 1G2EA 1M5VC 1WG4A 4IOAQ 3S7RA 3CCUS 2N3OA 3NS6A 2OTJS 1UP1A 1WHWA 2EK1A 3CCJS 2JRSA 1U1PA 2OSRA 1YWXA 2KG0A 1F9FA 2M8HA 1U2FA 2DITA 2KT5A 1DRZA 3MD3A 4IUFA 3CD6S 2DNQA 2RQCA 1VQPS 2CQGA 3ZZYA 4P6QA 4PRFA 2RT3A 4TLQA 1YI2S 3CUNA 3Q2TC 2OTLS 1VQLS 2HGLA 1NO8A 1WI6A 5GADU 2KU7A 1FJEB 1FJCA 2YH1A 3MURP 1VC5A 2PE8A 1K8AT 4YOEA 2D3OR 3TYTA 4V19X 3G71S 3P5TL 1PGZA 1X4DA 2KM8B 1O0PA 4LIRA 3CCSS 3I55S 2FC9A 2MZTA 5LXRA 4QQBA 4WFBQ 3BEGB 2D9OA 2LEBA 3S6EA 1X4EA 5ITHA 4ERDA 4F26A 3VAFA 3G96A 1H2UX 2DHXA 2KG1A 3G6ES 1U1NA 1WF2A 3MUMP 1N8RT 1SJ3P 2DGSA 1VQNS 1K73T 2GO9A 2MPUA 3PIOQ 3MXHP 1JJHA 2XNQA 2ZJQQ 2MZJA 2CPDA 3CCMS 2UP1A 2LQ5A 2KN4A 5CYJA 2M2BA 2EK6A 2U2FA 1YJ9S 3NNCA 2DNRA 2LEAA 1VQMS 2JX2A 2X1GA 2CQDA 2FC8A 5DM7Q 2CPZA 2BOPA 3S8SA 3B4DA 3VALA 2MKHA 2YH0A 3LPYA 1H2VZ 5LSLA 1B7FA 4ED5A 2FY1A
chains in the Genus database with same CATH superfamily
4O3RA 2NXUA 3OLAA 2W8LA 3AQOA 1Q81T 2LDYA 3LW5C 2J5AA 3FK4A 1JKHA 3HX9A 2W9BB 1AUDA 3KWMA 4ETZA 4N8OA 3D68A 1W2BR 1Q78A 4HH0A 4OMFG 1F6TA 4JP8A 1TMMA 2O66A 5D3GA 2HVHA 1IR2A 4M5KA 2ACMA 2J0XA 2RJZA 3M05A 1BE4A 2O67A 2ZH1A 3MFIA 5AE3A 4LRCA 1RTHA 3PNIA 3AA8A 5A8KB 2QE5A 4XIUA 1GFWB 1ZBTA 2C2ZB 3IR6B 4YR0A 5LM7E 5IT4A 1XERA 4DV0J 4RUAA 3JXOA 4HHJA 3FNNA 3ENQA 4HACB 4EMDA 4JI5F 3TWZA 1H98A 1U47A 5JMNA 2E1PA 5A8RB 4U7UD 3EDQB 4URGA 5KFUA 2XO6A 2ZHOA 2QLXA 2XMJA 3BGRB 3I56S 2HHPA 2HQGA 4EU0A 3W8PA 1KLMA 2YX7A 5D0RA 5KFBA 1EKRA 2VU5A 2NYHA 2B9XA 1FFGB 2BABA 1K44A 5L1LA 4LBHA 3U1MA 2HURA 3J7Z5 1A9NB 2ZJPQ 2Q66A 2VB6A 3IA0A 2VZ9A 2ZBRA 2A1BA 4P7VA 4A8KA 2YX1A 2RQKA 2NS1B 1WG1A 1CG2A 1KQGB 1U6BA 1SJRA 2NXCA 2OEKA 4WU3A 4DR6F 4OZ3A 3LPEA 4X4QA 2AEMA 4JYAJ 5DO2A 4B3RJ 3PW7A 4AL6A 2FUG9 4XPEA 1KONA 3QJLA 3KLHB 4NLSA 3LA0A 3JTNA 4XTTA 1FTRA 4ZPCA 5A2QY 3A8JA 2XGQA 1UWBB 2QMWA 1VR6A 4J5OA 4KT0C 4DSEA 2JVOA 3OXFA 2HKEA 1YBUA 3IRWP 5GMKa 4K4XA 1XQIA 5E2QA 3FBFA 4IRDA 5F8JA 4JI0F 1UZHA 3CCQS 2C22A 5KFSA 1SJQA 3C6TA 2RRNA 1ULRA 2X1FA 2C3YA 1X31C 1FX4A 1FT8A 1RT3B 2C3MA 2FVCA 1YITS 4QCLA 1R27B 1SI9A 5EHHA 3RRHA 2X1AA 4X2BA 3FC9A 3K5MA 5IT0A 2FLPA 4F0HA 2BJ8A 4GKKJ 1IKWA 1F5CA 3H5YA 5KOXA 4CLUA 4ZK7M 3MM8A 3NMAA 3H40A 3AD9C 2R2SA 4UF4A 1UW9A 3CJKA 4I69A 1VRQC 1QSSA 2HQIA 2QSFA 3FQLA 2EFQA 2R7OA 3IR7B 3D7SB 3DU5A 1QDUB 2X51A 3NLCA 2J9CA 3CCWA 2XNRA 4ZVEA 4MKAA 4DI6A 1MROB 3W1YC 3EWGA 3NEKA 4Y34A 3CD0A 2CXEA 2VBWA 3B6BA 3CJQA 2DNPA 5L9NA 4PG6A 1UVLA 4ECYA 2BKPA 4P9SA 2YNFB 2IRYA 4NL5A 2ZHAA 2BQUA 3R97A 1A0OB 4JV0A 1RB0A 2HWIA 1CC7A 4USVA 2OPPB 5J2PA 4DL5A 5ETLA 1G1XA 2R8IA 5I3PA 1HBUA 2LU2A 3GPAA 2AP6A 2UVRA 1PG5B 4U6PA 1BWEA 5DQHA 4DV2F 2OTLS 1VQLS 3LANA 1SL0A 1FJGF 1WNEA 2ATCB 5KT6A 1YRTA 1RT5A 1S77D 3BDPA 4YOEA 1F3VA 2GVZB 4KHPJ 4F4KA 2IVFB 2UUAJ 3P5TL 3LP0B 1R6VA 2DR9A 4N41A 3CCSS 3GYGA 1ITPA 2OO4A 2JDJA 2QT7A 4K4ZA 4KRWA 1N6QB 4WZMA 2FLNA 4ZA1A 4IFVB 3WIUA 3LOUA 4O4RA 2KZZA 3MZIA 8ATCB 4XPCA 4ZP7A 2IJNA 2GIFA 3GFXA 3W9JA 3A1YG 2FVPA 2ZDPA 5D0HA 4C8OA 1RTJB 5J2MB 4DR1J 1RHRB 2QLWA 4PWDA 3PCOB 2K8GA 2CQ2A 2B5JA 4MK7A 3LH2S 1FKPB 2YY3A 1XN9A 2G2YA 2Z2ZA 3TQEA 1HNWJ 2IBKA 2FDNA 4BDPA 3OLBA 5THWA 5DDOC 3UCUP 1HBOA 1RT2A 1B0PA 5D4OA 4Q44A 1IBMJ 1Q1KA 5T7LB 3SCJE 2XMUA 3ET6A 3LP1A 4GMKA 3K17A 2MYFA 3QFHA 1LFPA 3G4SS 1RYRA 3HKWA 2M9KA 2GGPB 3KDNA 2R3VA 1Q5VA 1GMVA 1L3KA 1AYEA 3IS9A 4F7VA 2PMZD 3FCHA 4ITSA 3MM5A 1FNOA 4U7UK 3JSBA 1IKYA 5BYRA 4V1Ak 1S6OA 1FK9B 4DV5J 4NWBA 1UFKA 4OZJA 1B4SA 2RVJA 1NJIT 5AXMA 1BY9A 3R1LA 4WKRA 2V9WA 3VQSA 1R3NA 2AMCB 3BGUA 4DS4A 4K0KF 2GV1A 1VQOS 4ZVOB 2OPSA 4ZPTR 1SVDA 1JLQA 2RH3A 3OV7A 4FXWA 3GIRA 3QZ8A 1SQGA 4CLKA 3DOLB 4YQWA 4JI8F 2R42A 4EI2A 2W2OP 3V2UC 2E44A 2XC9A 1KLNA 2FVQA 2ASYA 2ZBPA 1KHWA 1FNMA 3LAMA 2VQEJ 1NKBA 1PJ5A 4HT7A 5AE1A 3GFHA 5HATA 3MAQA 2E1MC 1YZ6A 3DRXA 2UU9J 2KT3A 2DH9A 3CEDA 3Q0AA 5CABA 1NSQA 3MFHA 2GHPA 1RBOB 3HHLD 1I3OB 1LFWA 1T05A 2OJ3A 2G2OA 3B82A 1PO6A 5IV3A 2F8HA 2JL9A 1JLCA 3C14A 3ULHA 4PCQA 5JJBA 3F73A 1FI4A 1X4GA 2OP5A 2BA9A 4A8YA 4LR8A 1ZZFA 2CPEA 2D3ZA 1FA0A 5KOWA 4KO0B 2XLKA 2DGTA 5F8NA 3KLGB 3KK2B 1JMTA 3G9CA 2F5GA 5U47A 3C6UA 4O44B 2DK2A 2PFDA 2MQNA 3GILA 3DOMA 4LSNA 4DN0A 1CC8A 1DAXA 1VQKS 4PXDA 1IBCB 3JTOA 3GMGA 1Y5LB 1SL1A 3OUYA 2CQBA 2HZCA 1P9YA 3R5DA 4L72B 2CNLB 2HAIA 4G1QA 1M5KC 4LSZB 3A13A 3E3XA 4IQXA 1YVFA 4KKOB 1NK5A 1RI7A 4AYBD 4NCAA 2LDIA 2OFGX 1R7IA 2EFNA 2C2OB 4DPYA 3GG0A 4JOUA 3QT8A 4C6AA 4P71A 3D9BA 3AB4B 2CQGA 3MEEB 2RT3A 1YI2S 3Q2TC 2ZH6A 3TZYA 4DSKA 2J6UA 3HD2A 1NPRA 1RXOB 3RRKA 4J9LA 5EWGA 2D3OR 1EP4A 2GMJA 1TZ0A 2XZWA 4LIRA 3K7RA 3D66A 4I2QB 4NZ7A 2GAHC 1N4LA 2HFUA 1ZOTA 3EJMA 2B9WA 1VK3A 3TA0A 4PQUB 2Q6BA 2DCUB 1OPZA 1Q53A 3OVBA 4DR2J 4ZCKA 4WE1A 4NEYA 2EK6A 2G0IA 3NGKA 4P73A 3ISNC 1WEXA 4OHZA 5K8MA 2QYCA 4OYBA 4AFFA 3UDVA 1T3OA 3Q24A 1YG0A 3MAAA 3KOAA 1Z2ZA 2I0XA 4YHHJ 1TKXB 2HVZA 3RW7A 1W2IA 4I4BA 3FBEA 3M1VA 2BUNA 3TZXA 1V5VA 4G65A 4ED4A 3E01B 4BC7A 5H9EJ 1SUQB 2ZD1A 4ZN1A 2IVYA 2DO0A 3N4WA 3MCNA 5HL7Q 4WF9Q 4X4UA 1R6YA 5B0BA 4F02A 3SZ2A 1DBDA 5D0GA 5HLFA 4DX8H 2CNKB 1PSDA 3JSMA 4Q0BA 2U1AA 4N7TA 2IPOB 4K5RA 1CJVB 3T6JA 3QATA 3MMAA 2H9ZA 1NDLA 3NGDA 2FJDB 1U45A 2BEFA 3CJRA 4PG7A 5HVHA 1UEKA 2CQHA 3R5GA 4GVBA 4UOFA 1Q8BA 1VQ6S 1URRA 1YBAA 2PN6A 1D3WA 1YKWA 5DGAA 2HHXA 2DNYA 4DL7A 1JXLA 4NLTA 1KOOA 4C8NA 3EDRB 2XMWA 5SZTA 4QR2A 3BF4A 2X1BA 1CQMA 1FVSA 3UE2A 4QWEA 1NB2A 3BGFA 1TL1A 4LF5F 1UPPA 4O0IA 4ANEA 2OEMA 3FEZA 2VFTA 3VTIA 3KK3A 5B08A 2VG6A 2HK2A 1TELA 3ZZTA 1SKRA 3DU6A 1U09A 3T5HA 5FDLB 4TU9A 4ED8A 2PGCA 2VPXB 3KLIB 4L3NA 1I94J 2OPRA 3PYFA 4G3IA 2E5GA 3ADAC 4X4SA 4L6V3 3PZPA 2PDAA 2W7AA 4KTQA 1FRKA 3X3UA 3H2UB 4NCGA 1S4FA 5IFMA 2JLGA 3DLEB 3RRGA 3C19A 1HL6A 1QAYA 3BPDA 2M7SA 1RLDA 1V9OA 5C2CA 4IG3B 1XMOF 4UQTA 2B9EA 2AW0A 4WFZA 4NLYA 2I5JB 1S48A 2UV8A 2PA3A 2H4WB 2UVUA 4NXNJ 2MKKA 2M70A 3AJ2A 3BM7A 2G1DA 2DRAA 1SB6A 3QLHB 2IRUA 3ILOA 2GVDB 3RBDA 1HBMA 4LF9J 3MMBB 1SC6A 4TU8A 2GMLA 4TY9A 3DGPB 3BO3A 1IM4A 1UJ6A 3BBBA 1JJ4A 5F3ZA 1U2CA 4IH5A 1NH8A 2JEFA 5M2PA 2IMWP 4QPXA 1BQMB 4R0EA 3W7BA 2BJDA 3NMRA 4EEYA 3PX0A 1NMEB 3AA9A 1B3TA 1LXNA 4MKBA 4FNIA 4J90A 2G4BA 1XMBA 2POKA 4LSLA 3DLJA 3WDOA 4IFYB 4Y2AA 4KPYA 1RACB 3TI0A 4DFJA 5T14A 3HSZA 3KNAA 4PWUA 3WX4A 2R8KA 2LXIA 3HZEA 2HAFA 3M9OB 4N47A 1SJ1A 4TXSA 2YQ3A 1T02A 1D9FA 5A6PA 2R2UA 1MNEA 3A3OB 1TK8A 3P8BB 1GXUA 2VG7B 1DTTA 3KMSA 3DKDA 2P9GA 5B7WA 3D6HB 4ZJLA 4K2JA 1RAIB 4LF1A 2ZNYA 3HFKA 2OSRA 4URQU 2CJXB 2HMIB 4PPDA 1VYAA 4M1KA 2XLIA 1AFJA 2ZH4A 1WI6A 4IOBA 3G87A 2C2DA 5C42B 1REVA 3N6NA 3BQ2A 3FJ2A 1BQXA 2NPIA 4WXOA 3G86A 4V19X 3PTWA 1RISA 4OV1A 4GC6A 4WFYA 3OHAA 2IC3B 3GIMA 2KJVA 4U7CA 4OZ5A 5LXRA 1HQEA 1BC6A 3R8YA 2DYAA 2RKIA 4CDIA 4I6YA 3KLFA 1YLXA 2RE1A 1UWAA 3F0NA 1VRTA 1C2PA 5LMNJ 3CIZA 2V9KA 3OTOF 3GONA 2W24A 4ATNA 2QMUB 2QL9B 1IXKA 4DUZJ 4DEZA 1TAUA 1S7IA 4ILRA 4M5JA 3M8PA 2BOPA 3EPGA 4B3MJ 3LPYA 4KB7A 3TQ1A 2FJXA 5JXSA 2ZVSA 1WHXA 1VLYA 1VQ5S 3VGUA 2XI2A 4OHYA 2HNDB 4OFZA 2HPUA 4FYWB 5C24A 3TVZA 2JWNA 3KHHA 3M4XA 4IO1A 4CNZA 4WYWA 2UXDF 3IAM9 2HS0A 1RJJA 4LF2A 1PJ6A 2CVIA 3VAMA 2KDOA 4Y00A 4OJ3A 1VRUA 2G2ZA 4YP3A 3PW5A 3O3LA 2Q79A 1GTEA 1XBWA 2DGWA 1ZTWA 1YIJS 4OZ2A 2HHVA 3AHPA 1TL3A 1PIEA 2F8MA 3FUYA 4BLGA 2IBOA 2OELA 1FNXH 1X5TA 1BQNB 1L3VA 2C2RA 2BM0A 4YB7A 1LNQA 2UVWA 2AX0A 1HIYA 2MQQA 3C16A 2DISA 2KXNB 4Z37A 3FSYA 4MYTA 2XY6A 1ZM4A 1AROP 4ECVA 2L41A 3G6XA 4RX6A 3UVJB 4RUCA 2IDEA 3BPSP 2Q1LA 3Q23A 3IG1A 1F5BA 3P45B 1VIXA 1W7WA 2E9TA 7FD1A 3H7HB 4ED6A 4P10A 4DL4A 1APSA 4PXCA 3THPA 2ZM6F 3M30B 2WRMA 1XR7A 2E9RX 3V6HA 4DWIA 5JVGQ 1YX2A 4NLGA 2Y8YA 5LJ5Y 2YTCA 2FHKA 2PC6A 9ATCB 1HW8A 4DS5A 4J9VA 4O3NA 3SBMA 1YRXA 3LWMA 4LFAJ 4QW8A 2YXLA 3GP9A 4RW9A 2HLUA 3H5UA 2WK4A 2WHOA 4URSA 2XYGB 3OR1B 4NZ6A 5KFRA 3IBFB 4I2PA 4DCJB 4R0JA 2YNIB 4DXLA 4FZVA 4DV1J 4HTJA 4L76A 2EC0A 1OYEA 1JLBA 5F0WA 3MM9B 1NHVA 2DR6A 2G0CA 2HGNA 4M5HA 5LL6d 1RT1A 3CD5A 1FFWB 3DDIA 2W9CB 1S9EB 3HSDA 2LQBA 3DLKB 3EXYA 4YEAA 3PIPQ 5LXYA 2Y1RI 1KEKA 1R8HA 4QYZK 3DYAB 4AE5A 5IM0A 4GKJJ 1M1GA 3LGNA 2FLLA 4J9MA 4R8UA 4NLWA 2W8KA 1FKOA 4CYUA 4RW8A 2RF2A 4IDKA 5HSPA 3PG9A 3Q8YA 2AGQA 1LEOA 2BE9B 4W4MA 4UZBA 3NP5A 3MPYA 1KVKA 3HMJG 4DR3J 2IM1A 3N01A 1YJRA 4OHVA 3CMAS 5KFKA 5ETOA 1WC0A 4USTA 2Q3PA 4R25A 4X66F 3A4TA 1KSPA 1B99A 4A47A 5J2NA 1KFDA 2ALZA 4F36A 5L8RC 2HSEB 4MK9A 2BKOA 2Y9HA 4X4OA 1YQHA 4IUFA 3MTJA 2IMOA 1XNQF 3A8EA 1FD8A 4J9PA 2V50A 3P4UB 1T9UA 5C25B 1Z2LA 2PE8A 2D41A 2E66A 4QIFA 3TANA 3ISZA 4NI2B 4QQBA 2ASLA 4F26A 1FVQA 2W1BA 4HLBA 2WVBA 2KG1A 3KG0A 5HMZA 5AJ3F 5J1EA 2IYIA 2E9ZA 4PEOA 2MQ8A 2FZGB 3IXQA 4GC7A 1S6PB 3I5BA 4MH8A 3Q86A 3FBBA 3DOKB 1CEZA 4KGZB 1KN6A 2JX2A 3J7AN 3A3PB 4AQYJ 5F9LA 3D0GE 4O3SA 5LSLA 3KFWX 3FZ2A 2LXFA 4Q2MA 1TK0A 3NG8A 2IHR1 3ZTSA 3ZZRA 4JI7F 2XCPA 3K5PA 2VC1A 1KBRA 2BV3A 4LRFA 2VJVA 1HW9A 1T9VA 2KM8C 5F8IA 5HI7A 2XZTB 5CYMB 2BE2B 3H8YA 2CQCA 2MY7A 5DDQC 3MM6A 3RJMB 2DR5A 2GQQA 3RB0A 4MT1A 2ACYA 3PHTA 1BHNA 5DG7A 5F3TA 4JI3F 3BZQA 3F56A 2DGQA 4LF8J 2R7SA 3ILIA 5J1NA 4EGLA 1MU2A 1U0HB 5C2GA 1NKCA 3IWLA 3O5TB 4PXBA 4DPOA 2V4RA 3RB6A 1T7PA 5EGYA 2EPIA 2OLWA 3J7ZT 4C11B 4DR4F 4WP8A 2A6OA 3C66A 2KH9A 5HROA 5GVQA 4LBIA 4JI4F 1U26A 3K5NA 1X0FA 2MQLA 3DCAA 3K0JA 3R7SB 1E6YA 1FXRA 4MAKA 4OX6A 3IM9A 3M8RA 4ICLB 4B9LA 1NHUA 2DNKA 3VVUA 1ZAVA 5LMUJ 2HRUA 3CMQA 1N5SA 1TL7B 4LFBF 4M5GA 4ID5A 1N5YB 1S0MA 3P3DA 4W90B 1WEYA 1HMVB 1TVRB 4DPUA 2GW8A 2C28A 2HZAA 1RUSA 2YVSA 3AD8C 1C0TB 2MJNA 3FDSA 2J0QD 1FRHA 5I3QA 4DR5J 4DQSA 4LF4F 1OJ4A 1HI0P 4B3TJ 2KO1A 3T1YJ 1HD0A 2W4DA 2FD2A 3PW4A 1WI8A 4OZ1A 2RD5C 2VPWB 3SSSA 3M8ZA 1HBNB 3PRBA 1BUXA 2WOMA 2WZ1A 1CS4B 1TKDA 1WTFA 4QR0A 1E6VB 5CCMA 1HNVB 4JBCA 1Q5YA 2XQCA 4W92B 3AODA 1N33J 2W9BA 1D9AA 2LXUA 5HBMB 4E0DA 1ZAWA 3KLEB 4CP5A 5F41A 5FLXY 5CD4A 4Q5VA 1IJFB 2VG5B 2KXFA 2MQPA 3SQOP 3ZZOA 1UJ4A 4I1TA 2HK3A 3PVXA 1QUVA 2MGZA 1HNIB 5K20B 2HEKA 2F3JA 3OR2B 4CLWA 5A8KA 2RDJA 3R9LA 2XY7A 2H54B 1S9FA 2QLFB 5KFVA 3IP0A 2ASJA 2OSQA 1TV6B 4KIAA 3RBEA 4DL2A 2HRTA 4KBIA 3PJXA 5CD4H 2KYXA 1XR5A 4HACA 3AB2B 1RADB 4A46A 2MKSA 3EM1A 2F9JA 3R2DJ 2DO4A 3O6QA 4G1PA 4HL9A 1VOMA 5B09A 1XR6A 3BGRA 2FJEB 4PUOB 1O6XA 2MKYA 4FYYB 3TX8A 3W66A 3FSIA 1RWMB 4ZKAA 1RE1B 5K14B 4DV0F 3W61A 4F4XA 3PFOA 2DRBA 3PRVA 1ZM2A 5CYQA 3DRSB 1M5VC 1KTQA 3CJ4A 3JQKA 4H4KC 3NWGA 3S7RA 1D8YA 2UZAA 4DV4J 4Y2MA 3AD7C 2E7WA 4PYAA 5KFMA 4P6QA 4TLQA 3EZOA 3R6GB 3TRGA 1FJEB 1NPPA 3KLHA 4DQIA 1FJCA 4DFMA 3IN5A 2QYGA 4HHHA 1U49A 3PO4A 5L1JA 2C2MB 3ILJA 4DFPA 1X4DA 5D3GB 3SFGA 5HQLA 1NBEB 1LWCA 2P2CB 3I55S 3OFEA 2MZTA 2D9OA 4C48A 1WF2A 1VHIA 2HHQA 3PYDA 3PJWA 4PG8A 4B3RF 2I9SA 1U4BA 3NNCA 5H9FJ 4WWSA 2ZH8A 2X1GA 5DM7Q 4IQMA 4CLFA 2JSXA 2HZVA 3VALA 2HFSA 2FZCB 4F3QA 3N9UC 1FJ7A 2W9AA 3ZZPA 1RZMA 1RT3A 2P6TA 3EVOA 4EFAC 3QO9B 1SH2A 2CDQA 1TR0A 2DIVA 5KFDA 2FPHX 3M2VA 2K06A 4ZPAA 3MEDA 1I5OB 3JS9A 4WU2A 4DX6A 1NJWA 1IBKJ 2KRRA 2UUTA 4PG5A 3R7BB 4LF6J 3BDEA 3MM7B 1TKTA 4S0MA 1SCJB 4NLUA 3G8QA 1XNRJ 4OL8A 1S72S 1MROA 1PC4A 1R0AB 1RWOB 5E3AA 2RUSA 4GKKF 1FDBA 1AFIA 2CYYA 4IO9Q 5I3UB 4R5PA 4J37A 2BE7D 4OI4A 3QAUA 2YNFA 7FDRA 1Y11A 2HS4A 1XWLA 5MLCV 2UXCF 5KTQA 3TP2A 3J80Y 3FEXB 3M2RA 2O3DA 1FDDA 4WXWA 2XYHB 4DUYJ 1RWVB 1NKEA 2CG8A 4ECSA 4DJBA 3SMZA 4AXJA 2HNZA 5CAAA 3KLVA 1SKWA 4J9UE 2R2TA 4WJBA 3G6YA 4CQ1A 1XJWB 4AUKA 5GAHI 3MI7X 2GVZA 5GMDA 1K1QA 1VQ9S 3LP0A 1UVJA 1IKVA 2WB1D 2BBEA 3KG4A 3KJFB 2WVFA 2XB2D 2AZ3A 3DHXA 3IFEA 2W4CA 3MOZA 1F2GA 1R8CA 3IAS9 1TTHB 1LWFA 1WC6A 1IKWB 4LT6A 2ZKUA 2HLTA 3EVWA 5L1KA 2VOOA 3BSOA 2D69A 3CJKB 2ATLA 4M5DA 2HHWA 5G4DA 1PKUA 2DGVA 3LGHA 4NLVA 2CJKA 4I64A 4KHPF 2UUAF 3HXMA 3ETOA 1RTJA 3CB4A 2FLOA 3JQMA 3SFUA 2RILA 1Y10A 2JEGA 1S5ZA 1OSDA 1FKPA 4UOCA 1PAEX 2R7VA 3UO0A 2CQ0A 2VDHA 5BXIA 1R0CB 1KWMA 1H0HB 4H4MA 4N5SA 1PYSB 4GO7X 3QJPA 2GO8A 2PMWA 2V8DA 2ZKTA 4G1IA 1ZAXA 2FHOB 2XHCA 2CAJA 1K9MT 3GR0A 1SQEA 5J2PB 1SC4B 4DPTA 4DR1F 4IKAA 4ECWA 3N79A 4OYMA 2PI5A 4C2MA 2F65A 5B0FA 4ZN3A 1U6FA 2I38A 1IKXB 5KFXA 1TMJA 3HHLC 1HNWF 2I8EA 4J9RA 5IZHA 5DDRC 5BR8J 1DY3A 2F4VJ 6AT1B 1RT5B 1U24A 4OYIA 3VF0B 1HLWA 3DLGA 1S79A 2NZ4A 3DM2B 1Y3JA 1IBMF 1NDPA 2GIQA 2NZCA 1C4AA 1JLGA 2LQJA 2J0SD 3CCZA 3D3BJ 4OX8A 4C8ZA 4OHWA 5D78A 2GX8A 3HHKA 4NMLA 3CJSA 3NS6A 1WHWA 1YZ7A 1ACMB 4JI6J 2YKNB 2FTRA 2Y3YA 4DU8A 2BJ7A 1FE4A 5A0YA 1FDNA 5IQ6A 4HDGA 3DOLA 3OSNA 4PWDB 1DQ9A 1OSCA 3TYTA 2B5JB 3IC1A 3DRRA 3K57A 2Z57B 3G6ES 3OTCA 5GADI 4N76A 4Q45A 3FBCA 1VDHA 3V6KA 1QE1B 5L39A 3TW0A 4I6AA 3NRBA 2LQ5A 4PAAA 3L7UA 2M2BA 3VZHA 3ET6B 2VA3A 3GZ7A 3BR9A 2KZMA 2ZNZA 3MR7A 1FF2A 3EUNA 2W25A 1SL2A 1K47A 3R5AA 4TY8B 3OD2A 3HM9A 2B0GA 2J9DA 2VFRA 4IG0A 1UTAA 2AIRB 1M5PC 3QAEA 2F40A 1Q82T 4DPWA 4RR5A 1S1UB 5AE2A 1HD1A 2OPQA 3T9NA 3TUIC 1X60A 4X4PA 2VF3A 1V3SA 2VQEF 1Q8KA 2OUGA 3CWJA 2FZKB 3BJYA 5EX0A 1WHVA 3MGJA 5D8HB 3IGVA 2VC0A 3KLGA 3KK2A 1URNA 5KFJA 1SKSA 2UU9F 2WONB 4DSFA 4K59A 4P2SA 1WTBA 4YFUA 3HHNB 3QIDA 1P6TA 5LJ3Y 5F9NA 2OPSB 2B4UA 3IBCB 2XS7A 2E29A 4DL3A 2YNGA 2N7CA 1JLQB 1S0NA 1QSLA 5KAKA 4NLPA 4BBYA 4QWCA 3I5AA 2OD6A 2HIQA 4D3GA 4CLLA 2DRDA 4PZVA 4KKOA 2QFJA 5G0RB 3D6FB 2DHGA 1LOUA 1U48A 4DR7J 3J81j 3H2LA 3OT9A 3DMJB 3ZZUA 1W26A 2RB7A 4Y6IA 1Q0NA 4IRCA 3TR5A 5DETA 2CPYA 4FPRA 1C1CB 2EFPA 1VI7A 2LFVA 3TVKA 1V3RA 2KFZA 3V6JA 1FEEA 2BQ3A 4MJKA 3SYZA 4F67A 3R5CA 1UAWA 1OIAA 3UD5A 2VPZB 5DLFA 4OYWA 1T3NA 2QO3A 4B3SJ 4I2QA 3SQGB 4TQRA 4CM0A 3TUZC 5KG2A 4KE5A 4EK2A 2BANA 1WD6A 1Q79A 2WBRA 2HW3A 2BJEA 4MYUA 2JLEA 1N5QA 4ZITA 4K50A 2BXJA 3EXCX 3RW6A 3B54A 1YGYA 1XMQJ 2DH8A 1S0VA 4DMZA 3KNGA 1KTVA 2I6WA 2Y0BB 4O4GB 1OS5A 1ZETA 1WOPA 4YY3J 1N88A 3JYTB 3EMTA 3OL6A 2VHGA 3HO1A 3W9HA 2LA4A 1TKXA 3UDEA 1X4BA 1VJWA 5C7PA 1HHTP 3OUYB 1X4FA 2RSQA 1DLOA 4DR2F 1S4EA 1QTMA 5K5MA 5GAGI 3E01A 3L3CA 1SUQA 4NLRA 4DG1B 3D1QA 2FJWA 2OFHX 3QQCD 2HBYB 3VAKA 2NXJA 3ZZZA 2DXDA 4C4WA 3FCVA 1X5OA 2MSTA 4ZP6A 1UFWA 2DXEA 1CJVA 4YHHF 1S10A 4ZPVR 2YKOA 4TU7A 1EB0A 3WQPA 3VGTA 2VFUA 1RBLA 1VQSA 5KFOA 3PEJA 3MPWA 1DFDA 4AD6A 1VGYA 1RWUA 2ZHBA 3KUHA 1MMLA 1EP4B 3ETMA 3EX7B 4JI1J 3F44A 2CZ9A 3SDEB 1IJEB 4OYZA 1FO1A 3CJ0A 4KFBA 1N56A 1FCAA 5KG4A 3IWNC 4OX7A 3ICLA 3TEGA 3L7OA 4HHUA 1KP6A 1WC5A 3BKTA 1FDAA 4WE1B 5L9XA 3PDNA 4XO0A 4KV8A 1QLNA 2XO7A 4Y2CA 1HR0J 4OYOA 2OMOA 2KT5A 3H20A 1DRZA 2EWHA 2K7KA 4USUA 3NKYA 4P52A 4WKYA 4ECXA 2Q43A 4CO3A 3POTB 1T95A 2BR0A 1IBLJ 4DBQA 4B9TA 3ITHA 4B02A 2FVSA 3DLEA 3L4BC 3JQJA 3CJ2A 2HIYA 1PGZA 4L73A 1IVZA 2ZVIA 2NPFA 3M1VB 1ZTTA 2KKHA 3SIPB 1X4EA 5HQ8A 3G96A 4A8SA 2B7CB 3MUMP 1JJCB 1SJ3P 1N34J 2K7JA 4QW9A 2I5JA 3KJNB 2MPUA 1JJHA 4OYXA 4WBFA 2LVWA 1I94F 3IRXA 2DPIA 2RDIA 2Z2MA 5HLFB 2YWHA 2LEAA 1S1VA 4LUBA 3B4DA 4ED5A 4UOGA 4K4VA 3QLHA 3MMAB 3J81U 3J7A1 1Y5NB 1Y7PA 4OZ0A 2ZH9A 3BQ1A 3UD4P 1CJKA 3MEKA 1RBAA 1GMUA 3MMBA 2HVEA 2CNOB 1XK8A 3HULA 1H7WA 4DPXA 1WC3A 2C42A 3DGPA 3EGZA 1XIQA 2UV8G 4NXNF 1SPBP 1GAOA 3ZFVA 2JEJA 1GXLA 2QEXS 1NJYA 1BQMA 3OFFA 5SUHA 2E5HA 1QAIA 1TL1B 1YRUA 4K2XA 4QWBA 2DNNA 4RU2A 2AEJA 1NK0A 4KY3A 3KK3B 4FF1A 1R43A 4LF9F 2Y1IA 1RHMB 4FYXB 4ELTA 1L5UA 3NBPB 3W2WA 4EBCA 2B6AA 4X4VA 2VDIA 2CPHA 1LWEB 5GAGU 2N3LA 2OPRB 1X9WA 2B8QA 5LT5A 1YTYA 1WACA 1S76D 2V5HG 4J9OA 2XMTA 2VG7A 4ZVUB 4RO0A 1NZAA 4ZVSB 3EGNA 5F8GA 2CNNB 2JVRA 3W8GA 2PO4A 2CJYB 2GNKA 2B4VA 5A76A 3OVAA 4RNMA 3HHEA 4F4AA 2QZ8A 3RG6A 2HMIA 3VHQA 1OWXA 2MDAA 3PYEA 1PCAA 3TEHB 2C2EA 3QSYB 2VKZG 1T9XA 3FEYB 3B78A 2B43A 2IJRA 3U1NA 1PBAA 3J7YU 5C42A 2AYMA 2VH7A 3G8SA 1K0TA 3FRYA 2ZUGA 2YWKA 2AJFE 1N36J 3HVAA 3T1HJ 4LRAA 4HI1A 2IC3A 1SV5B 2DY9A 1HFEL 2RHQB 2PD1A 2M4MA 2RU9A 1RAAB 5CZVA 1RTIB 1U8WA 3CULA 5J2QB 3BO2A 2VOPA 2Z4PA 2XULA 3TAQA 4RW4A 2DB1A 2OI2A 2VASA 2NUHA 2L08A 1JNZB 4K4TA 4MKYA 4ES1A 4FBTA 1U7LA 3ZTPA 2BW7A 1EJ7L 1WSRA 2MQOA 3NNAA 4UQGA 5H1SV 3T19A 2HNDA 1RT4B 2AU0A 5FD1A 4CT8A 1AW0A 2J76E 4GO5X 4DHVA 1B7YB 3MPDA 5D4PA 3GIJA 4NRUA 1UVNA 4FN5A 5LMNF 1UPMB 4FS2A 3AT1B 4DUZF 4FKXA 1WDTA 3GG1A 4RKUC 4CI0B 4DZ6A 2ZOGA 4B3MF 3CD7A 3D6MB 2QX0A 2N4CA 3HVWA 4XDDA 1L3SA 5KFCA 3CNQP 3U27A 3CIMA 1AUSL 2FGOA 1VBZA 2DNHA 2V68A 3CJ8A 1B70B 2QLBB 2MZQA 4U95A 2V2ZA 1JX4A 1ZM3A 1BQNA 3KUEA 5KFLA 1WORA 1RWKB 4MIAA 2ROEA 2ADCA 5EUHA 4RWXA 3GQCA 8RUCA 1H72C 2NLWA 2RKIB 1Q8IA 3GV7B 3UVJA 4QYRA 2GS8A 3KUGA 2BM1A 1WG4A 2JH3A 3W3SA 1VRTB 2E1RA 1RKIA 4U8VA 2EK1A 3CCJS 2UXBF 3OPKA 4NLQA 4NXMJ 4TYBA 1TUWA 3TUPA 2DNQA 2B9YA 1JWWA 3RBXA 3W64A 4HDHA 3C46A 2WSEC 2XEXA 1SC1B 4F8RA 4Y28C 3HK2A 2JLFA 4F04B 2IA6A 4MIWA 3PW0A 4FBUA 4CLYA 1UCNA 2OKQA 4M94A 3KXDA 2CKWA 1JQGA 3VCDA 1RWXB 1S97A 2JJ4D 2IM3A 3PY8A 1N5TA 1CJUA 5BYSA 4LRDA 3GJTB 2JZ5A 3T6BA 2ZJQQ 3BYPA 1L3TA 3BR8A 1VRUB 3J81Y 3T3FA 3C3LA 4DQRA 5KFPA 3EYZA 4RJVA 4RW6B 2QA4G 2QN6B 4O3QA 3UQSA 4LFAF 4KHRA 3MM9A 3GIIA 1P1LA 3M6WA 2MQMA 3I32A 3JAMU 2KJWA 2DNZA 2YNHB 1VISA 1KQSR 2W9CA 2EBEA 3QFWA 3C16B 1FXDA 3DLKA 3MUTP 4LQ3A 4N77A 4YDDB 2CWKA 1FRIA 4DV1F 1F60B 1JK9B 3I0SA 2R9LA 1NH7A 2CRLA 2AEFA 2VKRA 4USKA 3OJSA 5DZ6A 2W2PP 3UDCA 1HNZJ 2ZH2A 2YPZA 4USMA 4ZPWR 2CA9A 2ZDOA 2EVZA 4G6VB 2R7XA 1BWVA 3U02A 4LREA 1RAFB 2PT0A 4RBVA 2J8SA 3C15A 2LEPA 2EFVA 2J6TA 4N56A 2GIRA 4GKJF 4P2MA 3HKZD 2V69A 2HHUA 4WK3A 3CJTA 4B3OB 4USJC 2M52A 1RTDB 1B0TA 3EZUA 3GR1A 5E41A 2ZWPA 3T1AA 2IA0A 4CH1A 3Q2SC 4TN2A 1S9GB 5KFGA 4I2PB 1VC0A 2MKCA 1NDCA 7AT1B 1WOOA 1MWZA 2DD8S 3M32A 1MLAA 1NNDA 1WHYA 1MWQA 2AYEA 1JLBB 3GV8B 5C25A 2GAGC 1NCLA 2XSJB 2RRAA 1YJWS 3I9V9 1XC9A 1HWJA 1VQ7S 3AOCA 1HPZB 2H3EB 4NMXA 3OL9A 1Q4RA 5LSOA 5DG8A 2COLA 4F2RA 1UVIA 1MN7A 1TAQA 2MZ1A 2YWGA 3MECB 3OHBA 2DPJA 1KNZA 3UN5A 3DOKA 2E7XA 1QJHA 2R7UA 2KT2A 4DQPA 2AKWB 4DSJA 3VAHA 2XM3A 3QBCA 4F0KA 2DNOA 5HMXA 3C2PA 4X64J 3Q8PB 4OHXA 4CYUB 4RW8B 3UNGC 2RF2B 3VAGA 4IDKB 2B51A 1SJFA 3I87A 3IM8A 4WP9A 3HJFA 4CO1A 1H38A 3V4IA 4BWMA 2LCWA 5ETQA 4QIGA 1D1UA 3MEGA 2BE2A 4CTAB 2OAUA 4AQYF 2QRRA 2H5JB 3QIPA 1VC6A 2RS8A 2KVIA 5J2NB 3SV4A 2DVIA 1R31A 4EO8A 3M9NB 1H73A 3B8HA 1WKJA 5I4MA 6FDRA 1X4AA 2FB0A 1U0HA 1VHFA 2Y0SD 4U67Q 1WSVA 3FQKA 3V4MA 1R0BG 1ZH5A 2MY8A 3UW1A 1IN0A 2MB0B 3NL0A 3NCQA 3M8QB 3FMWA 3BV8A 3KJVB 4JV2A 2V4JB 3NGUA 2VONA 2B7BB 3THTA 4BCAA 1RU1A 2XMKA 1AB8A 3OXGA 4X62J 4C7QA 2HFZA 4ED0A 4ICLA 1N32J 4LF8F 4JI7J 2CQ1A 3A3NB 1HARA 1ROFA 4ZP8A 4O23A 2OHDA 4UY85 4OX9J 3O8WA 3D1HA 1CJTB 3E8OA 1IR0A 1HHSA 1N5YA 4LF7J 1RGVA 5A6WA 2E7VA 1V6HA 4HH1A 2JRSA 3FFIB 1YWXA 2J7WA 1HMVA 4X65J 1TVRA 3GCWP 1NHKL 4ED7A 3W5ZA 3CD6S 1NSKL 1UETA 2RQCA 3HFVA 4PRFA 3D0HE 3CUNA 2Z30B 4F3MA 4C3MA 1OY9A 2AWZA 2XMAA 2DKOB 2FIUA 3PR4A 4KC5A 2YH1A 3K5OA 5LMUF 3W2VB 2K2PA 4NPOA 3ZTRA 2KM8B 3RR7A 4KSEB 2FC9A 3CJ5A 2YQ0A 4ES2A 3FMBA 2HNYB 1SBRA 4MK8A 1D9DA 1U1NA 4JI4J 4K4UA 5HK4A 4P7TA 2K1RB 1VQNS 3OXLA 1K73T 3PIOQ 1N0UA 3DRPA 1JLEB 2LLZA 1CS4A 1ZA2B 4ELUA 1E6VA 5KT4A 1HNVA 3PRDA 1SC3B 1MU2B 1PYTA 3JAMY 2GFFA 3BSCA 4LFBJ 2MEWA 3T1YF 1CQNA 3NOGA 2AGPA 5BYQA 2VG5A 1IWAA 2GCFA 3QGHA 4P74A 5DM6Q 2ZE2A 4ZVFA 4DCOB 2HHHJ 1R8AA 2DH7A 2Z2LA 1SH0A 2M88A 2F7VA 3OQ2A 4WCEQ 4RWWA 1HWLA 2RRBA 1TV6A 4EZ9A 1N33F 1NK4A 4LF4J 4KQZA 1KD1T 3CC2S 3SCLE 2HVIA 5KFYA 3OW2R 5HAOA 1Y0HA 1QM9A 3P96A 1U0SA 3RB4A 2P9EA 3O44A 2HQFA 1C1BA 4PXEA 4PUOA 1JIHA 1AA1B 1DQAA 1EKSA 5MAOA 3N5FA 1ELOA 1NDKA 4Q8EA 3Q8SB 3BREA 5K14A 3D0IE 4A8OA 3CGIA 3I0RB 4XDCA 3NS5A 2M0GB 2AZ1A 1FD2A 3PX6A 3M2UB 4CLSA 1S59A 8AT1B 1SQFA 3V81B 2LQ9A 1YHQS 5H9FK 3DDKA 2WOMB 3K2YA 5IQQA 3D2WA 4QWDA 1X8DA 4DV6J 2P6SA 1NUEA 3GE9A 1MWYA 3EGWB 3PM9A 1FE0A 2MHNA 3VVTA 4CZCA 3VV2B 1VBXA 4NLDA 2PSZA 4ZIWA 1TU0B 4WYLA 3QT6A 4Z7YA 2VICA 1FWKA 1OY8A 2X3GA 4AL7A 3BKUA 3D67A 2MGZB 1AZSB 4DV4F 3GSIA 3VAIA 3BYRA 3UD3P 3IO1A 3V5RA 2CQIA 2OIHA 3MWBA 4RLEA 3BBFA 4RU9A 1S1XA 3MD1A 3LALA 1TFWA 3TO8A 2KVQE 2ERRA 4F3OA 2JNJA 4U9RA 2H48B 2XY5A 4K5SA 1EQMA 1KR4A 4OZLA 3HVTA 2EXUA 1WF1A 5M2RA 3QO9A 4I56A 4F2SA 1T94A 1Q86T 4RW7B 1YJVA 4ILMA 2MMYA 1UVMA 4A8MP 2DNGA 4FYVB 5AT1B 1WWHA 4I7FA 1HNXJ 4Z7CA 4ILLA 2IVMA 2LKZA 4YN3B 2QV6A 2V63A 3PHEA 5AXKA 4H4OB 2VV5A 2CIMA 5CYQB 3BN7A 2AX1A 3MM7A 2BJ3A 3QNWB 2H1YA 2ZJRQ 4JV5F 3UI3A 1WEZA 2CZVC 2D3O1 1X7VA 5HMWA 1P9QC 2G13A 3QRRA 4ZLJA 1R0AA 2CJAA 4ER8A 1GX6A 1RU2A 3HT0A 2P8IA 4QWAA 4CT9A 1NSPA 3KK1A 3MMJA 3RR8A 3UR0A 4ZIVA 2CPJA 1IBKF 5I3UA 2UUCF 1F5AA 2V34A 4LF6F 1Q7YT 2VJUA 1LWCB 2GMHA 2YKQA 1QD1A 5GAEU 2CUYA 2ZBCA 1LWXA 5HVGA 1RA6A 1XNRF 5EX3A 2IFXA 5A8WB 5I42B 3M9MB 2N3OA 3TX0A 1Y00A 2MLXA 4CH7A 1RAJA 1VQPS 4LR7A 2BW2A 3GFZA 1WJ9A 5HP1B 4NEZA 1J5EJ 4LBPA 4NA2A 3WC2A 4OI3A 5KG1A 2NYIA 4DUYF 1W25A 2FHJA 3D1OA 3GJQB 4Y65A 3M2VB 2BYCA 4WFBQ 1CSJA 4ERDA 3MEDB 3SI8A 2CJBA 2G1HA 2DGSA 2DEJA 1TKZA 5RUBA 2YWEA 2A6MA 2UXCJ 2MTLA 5C5JA 1KVJA 3QT5A 1TKTB 1VS3A 5DS7A 4CWBA 1S57A 1UA0A 2MKHA 3NGRA 3NY0A 4MMOA 1H2VZ 3TA2A 2H5IB 4QJVA 4ES3A 3R1HA 3QYYA 2NQPA 1YBTA 1QY7A 5LOQA 4MTPA 2BQRA 4MFBA 2CDRB 1F3FA 4R5PB 2FGCA 3C8YA 3KHRA 5HJXA 4IR1A 2DEIA 3DRYA 1TL4A 3HT3A 2VUGA 5LSRA 3RTVA 1MMNA 3M2RB 4K4WA 4A8FA 1ICEB 1S1WB 2AGOA 4M63A 3ZNJ1 1YSJA 2ILYA 2IY5B 3GSDA 1RWWB 4NZ0A 3CPWR 2MZRA 2HNZB 1DTQB 1IKXA 1QAXA 3D3CJ 3GLJA 3K58A 2NSBA 2ZC3A 1LW2B 3GCXP 4B17A 3NCRA 5AXNA 4KGVB 3MR5A 5IWAJ 1LKZA 2ABYA 1VQ4S 2V6AA 1NM2A 1P27B 3NGTA 1X5PA 3A8KA 1M1HA 1JLFB 3DM2A 4PWWA 1DJ0A 4DL0C 1IKVB 4C8YA 1O5JA 1HI8A 2BRLA 3T5KA 1SXLA 5KFNA 3A12A 2GZOA 4WZQA 3VAJA 3DLLQ 2HYIB 3UFCX 1LWFB 2CJQA 1I6JA 3HCXA 3WIVA 3QGPA 4KGKA 4NYOA 2E5LJ 2YKNA 5BR8F 2F4VF 1U1MA 3V6DB 2UUBJ 4M5DB 1A7GE 1JNRB 2Q6CA 2GJIA 3BN4A 1RT6B 3G82B 4M5LA 4FYDA 3JTPA 3PKYA 1XTZA 1RP5A 2R4FA 3UWTA 3EGVA 1RT7B 2HBQB 3FRZA 1VMBA 5K9FA 3E2EA 1J5OB 2CPIA 4H4MB 1Z4UA 2VD3A 3Q8VA 4JI6F 3PW2A 1YK9A 1QE1A 3CCVS 2KL8A 2A2CA 1RK8A 3NOCA 5KFEA 2DNLA 1OY6A 2DY1A 3K5LA 1KOHA 1REGX 2GJ2A 1CLFA 2IYGA 2V8VA 5B0GA 3LF0A 2DR8A 5BJRA 3KYLA 4TY8A 2F1FA 4JI2J 1MW7A 2ASDA 2V94A 1T03B 4LQ9A 4FPIA 4Q2LA 3HHLB 1EETB 3OBIA 3PV8A 1JLAB 1U1QA 2AYGA 1VBYA 2LA6A 2BX6A 3L7PA 2IAJA 1S1UA 3DLGB 1NU4A 2IM0A 3Q8QB 4QIWD 5KT2A 4OZNA 3MTKA 4CO0A 1RSCA 1HYSA 3DXSX 4CH0S 1JLGB 2YKMB 2DBBA 4B08A 1WOSA 3Q89A 4DL6A 3AJ1A 4FF4A 2WONA 1RTZA 4DSIA 3PO5A 5IT9U 4RNOA 1KHVA 2BRKA 1Q95G 1KFSA 1K1SA 4OV6A 1O51A 1OPIA 2KTQA 5A0YB 1BD6A 1IQZA 1M90T 2NCKL 2X3DA 3OSPA 5EWEA 3DRRB 1IWGA 2VFVA 5G0RA 2EG1A 1NK8A 2G0JA 3DMJA 4M5MA 4DOZA 2BZ2A 3AH6A 1SKUB 3JB9k 3NGSA 2YPYA 1VQYA 3CSKA 4ZS6A 3WX8A 1TFYA 3ZTQA 1C1CA 4ZJQA 2KG0A 4V19J 3NWRA 2DITA 1RCOB 1FX2A 3AFGA 3CT9A 1R89A 4BC9A 4DX7A 2PFFB 2CFXA 2KU7A 1EHWA 1FERA 3TAMB 3MURP 4DR7F 3MCOA 4IG0B 1S6QA 3SQGA 1TL5A 4D3HA 1T11A 2ROPA 1NLKL 1UA1A 4F4WA 1C0UA 2QC3A 2OPQB 1UKUA 1HI1A 3IWXA 2K3IA 3HF5A 4Y3CA 4LRBA 2KN4A 3T5JA 2B4PA 4O4GA 1VQMS 3MMCB 4TKTA 2CQDA 2BOAA 3S8SA 4DZDA 4B3SF 3JYTA 4ZVQB 2YH0A 1WG5A 4WIIA 3IGNA 1DQ8A 2PA8D 4ZVHA 2YQ1A 5DG9A 2YNGB 2D1CA 2WW4A 1HQUA 5ADZA 5HO4A 2MLYA 2CWXA 5DDPC 3P6YC 3CCRS 2E5IA 4DG1A 4ED3A 3PR5B 1XMQF 4FDFA 4DV7F 1F9HA 2JOQA 4FKYA 4IH6A 4ED1A 1P8GA 4YY3F 4LJMA 3TA1A 2RS2A 3TNVA 4DV3J 3VGSA 1BXNA 3N6MA 1FKAF 1CULB 1RWNB 1J2VA 4ZHRB 1Q7LB 2VQFJ 1NJZA 3P49B 3I5CA 1N48A 1KC8T 2I2YA 3AY0A 4P2FA 3T9ZA 5L46A 3CCTA 1MN9A 3H4DA 4OYAA 1MMDA 1S1TB 4CLTA 5KT5A 5E3RA 3KHGA 4PR6A 5ETRA 4BWJA 4OYPA 3LP2B 3HFZB 3SDEA 5IXUA 3KG1A 4YUDA 1NK6A 1EQ0A 1B0VA 5D77A 4LFCF 3CW2C 2BANB 4B9NA 2W4PA 5FJ4A 4C8MA 3FVYA 4FF3A 3ENAA 3CDBA 2D9PA 4TLRA 3M6VA 4RUHA 3GFYA 2HFNA 3FZBA 3T5LA 1AXQA 2AJ4A 3UPFA 2ZBQA 2OGUA 4JI1F 3POTA 3TZWA 3I31A 3Q22A 2Z56B 3CC4S 1U1OA 5T41A 1MSWD 5KFZA 1UFLA 5A8RA 3VWSA 5DQGA 3DI6B 4ZLNA 3VQTA 1U1RA 3NAIA 4DUTA 1HWUA 1DLOB 4I6WA 4PQAA 3GYXB 4KH0B 1HR0F 1KVIA 1DZ5A 4QIVA 4E8UA 1RAEB 5KG6A 1N5VA 2XS2A 4Q8FA 1LW0B 2FJAB 3RAXA 1AT1B 2F63A 4WK1A 1ZPWX 1G7CB 1U1LA 2HQDA 1IBLF 2DTJA 3DGVA 1VCTA 3NNHA 3CVKA 1TK5A 4AXIA 1WF0A 4EZ6A 2HBRB 3JSYA 2R2RA 1QVGR 3GWCA 4AT1B 2L9NA 1N34F 4EYHB 1JKHB 4WPAA 4DU7A 4X4NA 2WAQD 2WVCA 4IRKA 1UEUA 3SCIE 4EYIB 4AL5A 4ID8A 4JI5J 3D5MA 1OMSA 1UWBA 4KFBB 2YKAA 1UVKA 3FSXA 1F2HA 4XAKA 3PFEA 3IBWA 5IT9Y 2Y1JA 3GYNA 3OL8A 1RTHB 2N4DA 5DGBA 4JYAF 2XHWA 3NBPA 4TNOA 4KV8B 2DGXA 5KFQA 1DURA 1NAQA 1TP7A 1LWEA 2N7YA 2WCXA 5KFIA 4DLEA 3CXCR 1V5IB 3ITHB 1PBUA 4DR6J 1FHTA 1KLMB 1VJQA 3DLBA 2ZBIA 1TUVA 4CLPA 5DZ7A 2J7KA 3H0PA 2AHOB 4RPFA 2OTJS 3IRXB 4RBTA 3SSQA 2XG8A 5D15A 1S1VB 2VA2A 2M8HA 3IR5B 5D4LA 4ZVGA 2KFNA 3LGMA 1WC4A 1CJKB 2VL1A 1FTCA 5IC4B 1ZA1B 2RIJA 2L3MA 1SV5A 4JI0J 5HN0A 1BLUA 2AJ0A 3R7NB 2WVDA 1WC1A 1FFSB 1RTIA 3S6EA 2V2QA 1H2UX 5J2QA 3MAHA 1D0EA 3NAHA 2QA1A 1RDRA 3MXHP 2OPPA 3HD1A 2AQ4A 3ILLA 2HVDA 1N36F 1SIZA 2XI3A 1GK8A 5GMEA 3T1HF 2B8PA 1GQEA 2CPZA 4P72A 1H74A 3W2WB 4PYDA 2JFDA 2B6AB 1RT4A 5KFHA 5E3QA 3W5XA 4TYAA 5B0CA 3C6TB 2M8DB 1HWIA 1GMWA 3D28A 1JB0C 2AJQA 4HT5A 3RUBL 2O01C 2PEHA 2YWWA 4FS1A 2JEIA 3MOJB 3BS9A 1JXEA 4RL1A 1N52B 4F4YA 2ALYB 1N6QA 3DC2A 2KFYA 4IFVA 3HLUA 2D3UA 4CM2A 4YMEA 2ZH7A 3WC0A 3CTRA 3MM8B 2XLJA 1S7HA 3MPVA 1WKLA 2V2KA 2BKNA 3H90A 3KTQA 4IOCQ 2N82B 2HGMA 4CO2A 4QBUA 3GJSB 3MDFA 3BQ0A 1D8ZA 2KHCA 4RNNA 3QZ7A 4ECUA 3I9ZA 3R5JB 5F8MA 5J2MA 2H65B 3WHIA 4RBUA 1GNKA 2MLZA 2A0FB 5CZXA 4ZLPA 3SSRA 3EE3A 4DV2J 4E2FB 1FJGJ 5KG5A 1X5SA 1Y9OA 3ENWA 2W2MP 5F8LA 5F8HA 2EG2A 1T9TA 2ZUAA 4RW4B 4BS2A 3ELHA 5T7LA 4CNYA 4EO6A 2GGPA 1HBUB 3CC7S 1BMQB 1M5HA 3CCLS 4EWTA 4F50A 3DN9A 5E3PA 1NXIA 2ZH5A 3KHLA 3OJUA 3HI9A 5KFFA 1HKAA 1H7XA 1Y4ZB 3MHYA 4ETXA 4ZMMA 4A8XA 2A10A 3RB3A 2DT9A 3R5BA 4DLGA 3H2VE 3H59A 2XCAA 2HBZB 2RMLA 4NXMF 4K4SA 1FK9A 2D7SA 1NPKA 2OMLA 5L38A 1RA7A 4ZCLA 4KYZA 4I0WA 2ILZA 2IJFA 2CPFA 2FHJD 5E5NA 2J7UA 4RW6A 2PMHA 2NREA 2VIHA 1YJUA 2DHSA 4C8KA 3HSGA 3D54A 1M0SA 3I82A 1T9YA 2RUGA 2UXBJ 1Y5IB 2YNHA 3SXLA 2VFSA 4ZLLA 4ECRA 2C3OA 2MJUA 2AV5A 4Z2XA 3WZ0A 1JJ2R 2NR0A 2ZFHA 4DV5F 2KYZA 4UT4A 2FYXA 3AJDA 2RQMA 1ZYQA 3PKMA 3BH7B 4C0OC 1J27A 1KS2A 4ZDNA 2RQ4A 1EAYC 4OIXA 1RAOA 2H5EA 4IYQA 1HBOB 4NX9A 1RT2B 2GHWA 1PJ7A 2R7QA 4L75A 4K7QA 1WELA 2HHTA 3LP1B 4Y0FA 3W65A 4X4RA 1KKHA 4UY8T 2KI2A 3BB5A 2XSFA 2L9DA 2CQ3A 2E5JA 5K8NA 1U6ZA 1GEHA 1QUPA 3M8SA 4NLXA 3MR6A 2XBPA 2BACA 4KGMA 4ZCIA 3IS9B 2DHAA 4B3OA 1NJXA 1RTDA 3N28A 2R8GA 4K0KJ 1VBKA 3MM5B 5IOLA 1HNZF 4K8RA 4FVCA 5B0DA 3CMES 3QMQA 1IKYB 5E33A 5KG7A 2HFOA 1CJUB 1EARA 1S9GA 3BSNA 4RUBA 1S49A 2ZITA 1K0VA 5KFTA 3BKFA 5D4NA 4LIWA 2HG4A 2ZEJA 4ZVTB 1LV5A 4KO0A 4JI8J 4Q7AA 1S0OA 2C2NA 2IIHA 1H3DA 2B56A 3VZIA 5JUMA 1PC5A 4B9MA 4O44A 4HKQA 1DARA 2XSJA 2HGLA 4ANDA 5ETKA 2VBZA 2F4FA 3OTDA 3H98A 1HPZA 3N0VA 3MCSA 3DHWC 3W5YA 5FLXU 2QL5B 1LQ9A 1HHQA 1U25A 5ETTA 3SEOA 1IR1A 3I6PA 3H4BA 4HYKA 2PEBA 2DHXA 4LVNP 3MECA 3CDWA 3I0SB 1GX5A 2QGFB 2RAQA 4E98A 2Z8QA 5CYJA 3PYGA 1SH3A 4Q43A 4DSLA 1YJ9S 2W01A 1FWPA 4FP9A 1N0VC 2FC8A 2JC1A 4OLPA 4ALZA 3MEEA 4PKDB 5HJYA 2FJBB 2M5YA 3QGIA 3C15B 2RHSB 1M1KT 2DR7A 2RDDA 2R7TA 2G9OA 4U96A 4CTAA 3S1TA 5KG0A 2MZSA 4N8NA 2M3DA 6FD1A 2OEJA 3CDUA 4X64F 1SIWB 3OFGA 3LAKA 2AT1B 1T05B 1WDDA 3N6LA 4H54A 2CADA 3QRPA 4PQUA 4HTIA 2V0NA 1JLCB 3C14B 1P1TA 5H9EK 3BBCA 2RNEA 2QJ3A 1UW4A 1C4CA 2W7PA 2WB4A 2ZWOA 4DN9A 4UOHA 3HSJA 3KJQB 3M32B 5F0UA 4CIOA 3M8QA 1X9MA 3KJVA 3JSRA 2V8HA 3C6UB 1NRKA 2V4JA 3UR3C 2O1PA 3DOMB 4LSNB 5HMYA 3TUJC 2MHEA 4PABA 5CCLA 2QA4S 2GJFA 3N5BA 2KRBA 4G1QB 4USHA 1CJTA 1RQ0A 4KR0B 9RUBA 1ZZNA 4HEA9 1U2RA 4F4ZA 3FFIA 5HQMA 2L48A 4EBDA 3ONQA 1FRXA 4TVAB 4M95A 1UZDA 3CDAA 3W60A 3QPIA 2JC0A 4U8YA 2KB2A 2VODA 2AF6A 4X62F 1FRLA 1A6LA 1N32F 4DCPB 3DFEA 1O8BA 2OH2A 3W2VA 3PJ9A 3MCMA 4OX9F 1ZPVA 3V4IB 3EZ5A 2V8GA 4NOHA 2QA2A 3MEGB 4LF7F 5CA5A 5ETMA 2HNYA 3OTBA 2QMXA 4NCBA 4M5IA 4Y2IA 1NEEA 2ADBA 4X65F 3J7YI 3Q8RB 2K1RA 5E7OB 5K8OA 4J91A 3QIPB 4MIBA 1NB7A 2CPXA 1JLEA 2C1EB 4W98A 5DLGA 1R8PA 1UJ5A 1GTHA 1X4HA 2P5VA 3L09A 3PACA 3G2XA 2A2DA 1EZZB 3U1LA 3RU0A 1X0PA 4WTOB 5FDLA 2EBGA 3PX4A 1T9WA 1M5OC 5K8PA 3KLIA 3BGOP 4CO5A 3MAAB 2SXLA 3QJJA 1B64A 5EWFA 2C2KB 1MG7A 3W62A 2MSSA 2LQ8A 2XYPB 4QR1A 3LWLA 5ETPA 2V4QA 3L9ZA 2CG4A 2XGPA 4IG3A 2FVRA 2CZ4A 2ZD1B 3J80U 3TJ8A 2DHHA 4BHQA 4P2XA 4OLOA 2HHHF 4FXDA 2EFOA 3K8VA 3S01A 3CDEA 3JSMB 1FEHA 4Q0BB 2UUWA 2WSFC 4NA3A 4C98A 5CQGA 4LF5J 4KH1B 3PXGa 3U7JA 4ECZA 3QSIA 2GVDA 4HVZA 2QIFA 2R8HA 1QVFR 1VFJA 4GVBB 4HR2A 4QZVB 4ENOA 2R7RA 2W2QP 1WKKA 3I0RA 2QLJB 1VQ8S 3GB0A 1R8BA 1T0TV 3M2UA 3AOBA 1F1BB 4B9VA 3V81A 3TARA 1KDNA 2WVEA 3DRPB 1L3UA 4J7CA 4ELVA 5E3CA 1U1PA 3I4HX 2VG6B 4M5NA 4IFYA 3ZC4A 3H42A 1XMOJ 2HQCA 1NO8A 2YKPA 2VBYA 3TJ9A 2GQ2A 1VC5A 3ISND 2ZE2B 4DF8A 4IR9A 2D74B 1RLCL 3FKBA 4IH7A 1AZSA 1LK7A 4OJHA 4UTGA 3BEGB 4NCGB 4RNFA 2ZZTA 5ITHA 4DX5A 2WTFA 3DNCA 4PG4A 3LTOA 4DV6F 4OJGA 2MZJA 2CPDA 1NK7A 3AAWB 3TAPA 3HPOA 2ZOMA 5HANA 2V2VA 4RNHA 4RW7A 2HWTA 3IMQJ 1C1BB 2A3JA 1GH8A 2FQQB 2FJVA 3TVYA 5CHCB 3OL7A 4XK8C 1PILA 2C3PA 5B0AA 4L74A 1OQ6A 2F8EX 1HBMB 3CO0P 5EDWA 3H5XA 4H4OA 3BH6B 2HWHA 2IDLA 5ETSA 4H4KA 1LXJA 2CQ4A 2J9DE 4ECQA 3EPIA 5B0EA 3AXKA 4QU6A 2DXFA 2NXEA 5IC6B 2GHVC 3FGVA 1HNXF 2DNMA 4LSLB 2OD4A 4YDXA 1NK9A 4LR9A 4ZVRB 5IS2A 3VGVA 2ZOFA 1H2TZ 4CRJA 3R6LB 3A8IA 1G6BA 3R27A 3M8WA 3BSAA 4ED2A 2MXYA 5A8WA 5I42A 1G4CA 1G3OA 3PEHA 1BGXT 1DTTB 2NSCA 2WSCC 1OO0B 2MKJA 1YDLA 1S1XB 1UEVA 4JUZA 1EIYB 4B9SA 3D4JA 5EN1A 2DGUA 5HP1A 2LU1A 2GA7A 4JV5J 3HVTB 1FESA 3TZZA 2QL7B 2Y8WA 3I96A 2O5DA 3AXMA 3OTOJ 4WIQA 4QIEA 4OI1A 4C8LA 4C3KA 3HZGA 2CVEA 2MKIA 3K89A 3L95X 1REVB 3G8TA 4I7FB 1RKJA 3W63A 2AD9A 1D09B 3MR2A 4YB1P 4DFKA 1RYSA 2UUCJ 1CBKA 1HQEB 3LQVA 1Y3KA 1V3ZA 3KLFB 1EX8A 3CJ3A 2DIUA 1J5EF 1Q8LA 2XWYA 2LMIA 2UXDJ 2LP4A 3M30A 3O1LA 1H6KX 3KMQA 3M8PB 3RBZA 4J9KA 5D6GA 3QWUA 1PYOB 3KK1B 3THVA 2EW9A 2XMMA 2EEYA 2YBVA 3RYLA 4X84A 4P75A 5C24B 4LMZA 3NXZA 2V8PA 1S1WA 4OQJA 4CCHA 5CXTA 1GMWD 3OFHA 1TQLA 3OR1A 3EICA 3H25A 3Q8UA 4A48A 1DTQA 3UCZP 3Q83A 5IV4A 1IUJA 4OJ1A 2AJ2A 2YNIA 4NE9C 1LW2A 3QGGA 1RABB 2XMVA 3M8YA 4USWA 5M2UA 1DHMA 2VBXA 3HP6A 4C3LA 1JLFA 2DCLA 2EI5A 2WBMA 1TL3B 2QFIA 1X4CA 2R7WA 1N54B 1NSAA 3GIKA 1I1GA 2ZM6J 2KXHA 5D0EA 4KHMA 2A18A 3CO9A 3M6XA 1QAJA 2BDPA 3MUVP 4A4JA 3MF5A 1S9EA 3DYAA 3EVMA 3R2CJ 1TKZB 5IWAF 1CVJA 2GQCA 1G2EA 4IOAQ 3V6DA 3CCUS 2H51B 1RT6A 3G82A 2BJ9A 3IG1B 1F9FA 1U2FA 5KFAA 3NS7B 5AXLA 3T41A 5ETNA 3ZZYA 5FIIA 1F9EB 2I1RA 3RAQA 1KQFB 1RT7A 1VIOA 2AJ1A 2H4YB 3ENVA 3MPUB 4X4TA 5DRKA 4J9NA 4MFBB 1K8AT 3ZZ0A 1J5OA 4ANCA 4ECTA 2EKYA 3E51A 2E5LF 4NLOA 4L3KA 5ETVA 2UUBF 3RGIA 4J9QA 4TQSA 2LEBA 3HVRA 3VAFA 4JV1A 2XZDB 4RW9B 3TJAA 1S99A 2GO9A 2E1CA 3CCMS 2UP1A 4PPZA 2U2FA 4WTYA 2DNRA 4J9SA 1XEZA 3H5SA 4ZP9A 1T03A 1CPZA 3P5BP 3HHLA 3GJRB 4KJIA 1EETA 4DR3F 2B4OA 1RAGB 1JLAA 2ZZMA 1PAUB 4USIA 5HVFA 3OVSA 1JXVA 2X7IA 3UNYA 4FVMA 2E1AA 2QSWA 1HA1A 4YB5A 2W7OA 4YR2A 2Z58B 4EBEA 4QOTA 3CF5Q 1QTNB 5DJBA 2LECA 1WUUA 3M6UA 1RT1B 2J8AA 4NI2A 5JVHQ 2YKMA 4O3PA 4DDFA 4B9UA 4OI2A 2EC2A 4JI2F 3B4MA 3I4PA 2DGOA 1IM6A 2XWXA 4DQQA 2BJ1A 1S6PA 5IM0B 3F41A 1FRJA 2VPYB 3AQPA 4X66J 3K8WA 2CQPA 3G6VA 3KDOA 2HRYA 4R8UB 2XS5A 3K59A 4ZCMA 1FKOB 3DXBA 4WFAQ 1RHKB 1SJ4P 3CE8A 2BMBA 3QWPA 3ZNUA 4QPTA 4YB6A 3GV5B 1X9SA 4MKVA 2ROGA 5L1IA 3HDSA 1XNQJ 1VLOA 4FXVA 3CCES 5CYMA 2ZC4A 3D6TB 2F9DA 4QYZJ 1ZM9A 1M5SA 2FY8A 3RZAA 4A8QA 4GRSA 3OTEA 5GAHU 1QSYA 3GTYX 1RWPB 4ZVPB 3VR1A 4UUXA 4I68A 5J1PA 1RHQB 5KT3A 2J6SA 5AJ3J 4A8WA 1UL3A 4ZPDA 4YR3A 2B3TB 1LK5A 3MR3A 1KRPA 3DDNA 4C11A 4EUVA 3SCKE 3TAMA 2KHDA 3GU0A 2W2NP 1ZS6A 2AYBA 4FNHA 2IAJB 3AOAA 1U1KA 4YS2A 1HYSB 2ZH3A 3FCWA 4C97A 3UDLA 4UZCA 1FRMA 5A2QU 1YJ7A 4ZJOA 2HFVA 2BVZA 4WFXA 5J1EB 3MMCA 1IQTA 1TL7A 2GC8A 2QTWA 1T8EA 4CLZA 2EKNA 3QT7A 2Z2YB 4C9DA 4NASA 1RAHB 4ZPBA 4DF4A 4WP3A 2Z0GA 4JB8B 3US5A 2P9CA 5KT7A 4JI3J 2JFKA 1C0TA 3HJVA 4WFNQ 3SV3A 4KPCA 1S12A 3KKFA 2EFGA 4NA1A 4DR4J 1F0XA 2C3UA 2J9EA 1I51B 4OI6A 2XTJP 4C0BA 2L9WA 4Y2KA 2PIIA 2LYVA 3MM6B 1CULA 4ZHRA 1HBNA 4FF2A 3BO4A 3ZXWA 5KG3A 3BGLA 4O3OA 4F25A 1S6UA 3QRQA 4UW2A 3R3TA 3RAMA 4DR5F 1S1TA 5HBMA 2HHSA 1OYDA 1U8SA 3KLEA 2NUUG 3LP2A 1S6QB 4B3TF 2RU3A 1GT8A 2K3KA 4QU7A 4DV3F 5HROB 2PI4A 3ZTOA 3W9IA 1YJNS 1C0UB 3WBZA 3LO3A 5KFWA 4UUWA 1Q16B 2JHEA 4OI0A 4CO4A 1HNIA 1YJTA 2VQFF 1HQ2A 3LUYA 3NCPA 1FXLA 3UCGA 1GXTA 3OR2A 2NXNA 1E6YB 1RHUB 4F0MA 5DQIA 3UN2A 1U02A 1KQKA 4K4YA 3ZO7A 1OQ3A 2UVVA 4DV7J 1UP1A 3TOQA 4KGXB 3HHDA 2DJWA 2J0WA 5GAEI 3MD3A 4ID5B 3O2IA 4NRTA 2ZZNA 1Z1ZA 1UMJA 4NYZA 3UN3A 2FHMA 2IRXA 3DI6A 1HWKA 2APOA 4GVLA 4LVOP 5GADU 1HQUB 4ZOSA 2HQ3A 1VK8A 1NZ8A 3M7VA 3G71S 2HS3A 3X1LB 1O0PA 2IM2A 1RHJB 2V67A 4NYPA 3DLHA 4M8LA 5E0OA 1N8RT 1LW0A 3DRSA 2CJ9A 2XNQA 5CH7B 4LFCJ 2Y1LB 4I67A 4KAIA 1TUGB 4RZRA 2YWFA 1RCXB 2YX4A 4O0NA 2R8JA 4HI2A 1FWLA 2QG9B 2WW8A 1B7FA 4C0HA 2FY1A
chains in the Genus database with same CATH topology
4O3QA 4O3RA 2B6AB 1RT4A 5KFHA 3UQSA 2NXUA 4KHRA 3MM9A 5E3QA 3OLAA 3AQOA 2W8LA 1Q81T 2LDYA 3FZ2A 4TYAA 2LXFA 5B0CA 3GIIA 4Q2MA 1P1LA 3C6TB 3LW5C 2M8DB 2J5AA 3M6WA 2MQMA 1TK0A 1JKHA 3HX9A 1HWIA 3NG8A 2W9BB 3I32A 1AUDA 2IHR1 4JI7F 3ZZRA 2KJWA 3D28A 2DNZA 3KWMA 2YNHB 4ETZA 1JB0C 2XCPA 3K5PA 4N8OA 2AJQA 1W2BR 1Q78A 4HH0A 4HT5A 4OMFG 1KQSR 2VC1A 2BV3A 1HW9A 2O66A 2KM8C 5F8IA 2EBEA 2W9CA 5D3GA 2O01C 2PEHA 1FXDA 3DLKA 4FS1A 2JEIA 3MUTP 4LQ3A 2HVHA 4N77A 5HI7A 4YDDB 2J0XA 3MOJB 3BS9A 2RJZA 3M05A 5CYMB 2BE2B 3H8YA 1JXEA 2CQCA 1FRIA 1N52B 2MY7A 5DDQC 2O67A 4DV1F 4F4YA 3MM6A 2ZH1A 3MFIA 1F60B 1N6QA 1JK9B 3I0SA 5AE3A 2R9LA 1NH7A 2CRLA 1RTHA 3PNIA 3AA8A 2DR5A 2VKRA 2GQQA 3DC2A 5A8KB 2QE5A 2KFYA 4IFVA 3OJSA 3RB0A 3HLUA 2ACYA 2D3UA 4XIUA 5DG7A 3UDCA 1ZBTA 5F3TA 4YMEA 2ZH7A 3IR6B 4JI3F 3WC0A 3CTRA 3BZQA 3MM8B 3F56A 2XLJA 2DGQA 4YR0A 2R7SA 1S7HA 3MPVA 2ZH2A 5J1NA 4ZPWR 5IT4A 2V2KA 1XERA 2ZDOA 4EGLA 4RUAA 3KTQA 1MU2A 2EVZA 4G6VB 4IOCQ 1NKCA 2N82B 2R7XA 3IWLA 4HHJA 2HGMA 3O5TB 3U02A 4PXBA 4DPOA 2V4RA 4CO2A 4QBUA 3FNNA 3RB6A 1T7PA 3ENQA 3MDFA 5EGYA 3BQ0A 2PT0A 1D8ZA 2EPIA 2KHCA 2OLWA 3J7ZT 4C11B 4RNNA 3QZ7A 4JI5F 4DR4F 4RBVA 1U47A 1H98A 4ECUA 3I9ZA 5A8RB 4URGA 3C66A 5KFUA 5J2MA 5F8MA 2LEPA 2EFVA 4RBUA 2KH9A 5HROA 5GVQA 2J6TA 4N56A 1GNKA 2ZHOA 2GIRA 2QLXA 2XMJA 3BGRB 4JI4F 4GKJF 1U26A 3I56S 2HHPA 3HKZD 5CZXA 3K5NA 1X0FA 4EU0A 4ZLPA 2MQLA 1KLMA 3DCAA 2HHUA 2YX7A 4WK3A 3SSRA 5KFBA 4B3OB 4USJC 3K0JA 2M52A 1RTDB 1E6YA 2B9XA 1FXRA 4MAKA 4OX6A 5KG5A 3M8RA 1X5SA 1Y9OA 2BABA 3ENWA 4ICLB 1B0TA 5L1LA 3EZUA 3GR1A 4B9LA 1NHUA 2DNKA 3U1MA 5E41A 3J7Z5 3T1AA 5F8LA 1A9NB 1ZAVA 2ZJPQ 2HRUA 5F8HA 2IA0A 4CH1A 3Q2SC 4TN2A 2Q66A 1S9GB 2EG2A 2VB6A 3IA0A 4RW4B 1N5SA 2VZ9A 4BS2A 5KFGA 2A1BA 4I2PB 4P7VA 5T7LA 1VC0A 4CNYA 4A8KA 2YX1A 4LFBF 2RQKA 2MKCA 4ID5A 2NS1B 1N5YB 1S0MA 1WG1A 1CG2A 1KQGB 3P3DA 1U6BA 1SJRA 4W90B 1MWZA 4EO6A 2DD8S 3M32A 2GGPA 4WU3A 1NNDA 1HBUB 1HMVB 1WEYA 1WHYA 4DR6F 3CC7S 1TVRB 2GW8A 1M5HA 3CCLS 4EWTA 2AYEA 4X4QA 2C28A 1JLBB 5DO2A 3GV8B 5C25A 4F50A 3DN9A 5E3PA 3PW7A 2ZH5A 4AL6A 2XSJB 2RRAA 3KHLA 2YVSA 3OJUA 1C0TB 2FUG9 2MJNA 3I9V9 1YJWS 3FDSA 3HI9A 4XPEA 5KFFA 2J0QD 1XC9A 1HWJA 1KONA 1H7XA 1FRHA 1Y4ZB 3QJLA 3MHYA 4ETXA 4ZMMA 3KLHB 4NLSA 1VQ7S 4A8XA 1HPZB 3JTNA 2A10A 3RB3A 2DT9A 3R5BA 4DLGA 5I3QA 1FTRA 3H2VE 3H59A 2XCAA 4ZPCA 4DQSA 5A2QY 3OL9A 2RMLA 1Q4RA 5LSOA 5DG8A 4NXMF 4LF4F 4K4SA 2COLA 2XGQA 1FK9A 1UWBB 2D7SA 2QMWA 4J5OA 4KT0C 4DSEA 2JVOA 1HI0P 4F2RA 1UVIA 2KO1A 3OXFA 2OMLA 5L38A 1TAQA 1HD0A 2W4DA 2MZ1A 2YWGA 3IRWP 5GMKa 2FD2A 1RA7A 3MECB 4ZCLA 3OHBA 3PW4A 2DPJA 1KNZA 3DOKA 4K4XA 1WI8A 2E7XA 1QJHA 4OZ1A 2RD5C 2R7UA 2KT2A 4I0WA 4DQPA 2ILZA 2IJFA 2VPWB 5E2QA 3SSSA 2CPFA 2FHJD 5E5NA 4DSJA 1HBNB 2J7UA 3VAHA 4IRDA 3PRBA 4RW6A 5F8JA 4JI0F 2PMHA 2DNOA 2WOMA 5HMXA 3CCQS 1TKDA 3C2PA 1WTFA 3Q8PB 2C22A 5KFSA 2NREA 1SJQA 4QR0A 4OHXA 1E6VB 5CCMA 4RW8B 1YJUA 1HNVB 2DHSA 2RF2B 4JBCA 3UNGC 4C8KA 3C6TA 3VAGA 4IDKB 4W92B 2RRNA 1ULRA 3D54A 1M0SA 3I82A 1D9AA 2B51A 2RUGA 2W9BA 2C3YA 1SJFA 2X1FA 3I87A 2LXUA 5HBMB 1Y5IB 2YNHA 3SXLA 2VFSA 4E0DA 1ZAWA 3HJFA 4CO1A 3KLEB 1H38A 4ECRA 3V4IA 4BWMA 1FT8A 1RT3B 5F41A 2LCWA 2C3MA 5FLXY 2C3OA 2MJUA 2AV5A 4Z2XA 2FVCA 4QIGA 1YITS 4Q5VA 1IJFB 2VG5B 4QCLA 1R27B 3WZ0A 1JJ2R 2KXFA 2MQPA 2ZFHA 1SI9A 1D1UA 2NR0A 4DV5F 3MEGA 2BE2A 2KYZA 5EHHA 3ZZOA 1UJ4A 2X1AA 3RRHA 1ZYQA 4I1TA 2RQMA 4CTAB 3PKMA 4X2BA 3K5MA 4C0OC 3PVXA 5IT0A 1QUVA 2MGZA 1HNIB 2OAUA 2FLPA 2F3JA 1KS2A 4AQYF 2QRRA 4ZDNA 3QIPA 2RQ4A 3OR2B 5A8KA 2RDJA 1VC6A 2RS8A 2XY7A 4OIXA 1IKWA 2KVIA 1S9FA 5J2NB 1F5CA 3H5YA 5KOXA 3SV4A 2DVIA 1R31A 5KFVA 2H5EA 4EO8A 4ZK7M 3B8HA 4IYQA 3M9NB 2ASJA 1HBOB 3MM8A 4NX9A 3NMAA 2OSQA 3H40A 1RT2B 2GHWA 1TV6B 2R2SA 4KIAA 2R7QA 5I4MA 3RBEA 4DL2A 4KBIA 3CJKA 6FDRA 1X4AA 2FB0A 1VHFA 4I69A 2Y0SD 3PJXA 5CD4H 4U67Q 1WELA 1QSSA 2HHTA 2HQIA 2KYXA 1XR5A 2QSFA 3FQKA 3V4MA 3LP1B 3AB2B 3FQLA 4A46A 4Y0FA 2EFQA 2R7OA 2MKSA 1ZH5A 4X4RA 3IR7B 2F9JA 3DU5A 2MY8A 4UY8T 3UW1A 2KI2A 1IN0A 2X51A 2DO4A 3NLCA 2MB0B 3NL0A 3NCQA 3BB5A 2XSFA 2J9CA 3O6QA 3M8QB 4G1PA 3CCWA 3FMWA 2XNRA 4ZVEA 2L9DA 4HL9A 3KJVB 2CQ3A 4JV2A 2E5JA 1VOMA 5B09A 5K8NA 4MKAA 1XR6A 1U6ZA 1MROB 3BGRA 1QUPA 3M8SA 4NLXA 3MR6A 2XBPA 2FJEB 4Y34A 2BACA 2V4JB 4KGMA 4ZCIA 3IS9B 4PUOB 3CD0A 2VONA 2VBWA 2B7BB 2DHAA 3THTA 4BCAA 4B3OA 1NJXA 2XMKA 1RTDA 3N28A 2DNPA 5L9NA 3OXGA 4PG6A 1UVLA 2R8GA 4ECYA 3MM5B 3TX8A 3FSIA 4C7QA 2HFZA 4ED0A 4ICLA 4ZKAA 1HNZF 4FVCA 4LF8F 2CQ1A 1HARA 2YNFB 5B0DA 1ROFA 3CMES 2IRYA 4NL5A 4ZP8A 2ZHAA 3QMQA 5K14B 1IKYB 4DV0F 2BQUA 4JV0A 5E33A 4O23A 4F4XA 5KG7A 2HFOA 4UY85 3PFOA 2HWIA 2DRBA 3O8WA 1S9GA 1ZM2A 3D1HA 1CC7A 5CYQA 3BSNA 3E8OA 3DRSB 1M5VC 1KTQA 1IR0A 1S49A 2ZITA