2AD9A

Solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
b'GDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*UP*CP*UP*CP*U)-3'
publication title Structure of PTB bound to RNA: specific binding and implications for splicing regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ad9A00
1L3KA 2E5HA 3CMES 3MD1A 2DGQA 2DHAA 5DDOC 4TU9A 3CCES 4TU7A 4PKDB 4A8XA 1SJ3P 5JVHQ 1FJEB 1ZZFA 2CQ2A 2CQCA 2MZQA 3IWNC 2KG1A 4WFNQ 1VC6A 2VODA 2MKKA 3SDEB 4F25A 4Y0FA 2LECA 2KM8C 1YI2S 1Q82T 1VQ8S 2E5GA 5CYJA 2DNOA 2AYBA 4C7QA 2KH9A 5GVQA 4CH0S 2MZJA 3BEGB 2U2FA 2M2BA 4YUDA 4RU2A 1RKJA 2UP1A 3MI7X 5DDRC 3DLLQ 5GAEU 2HVZA 2SXLA 2HGMA 2MSTA 2RNEA 3G8SA 3MUTP 2MY8A 2QA4S 1F9FA 3VF0B 2AYEA 5GAHU 3VALA 3EX7B 2CJKA 2DHSA 3NMRA 2MZSA 1WG4A 1X4FA 2X1GA 3CXCR 1FJ7A 2DGWA 3H2VE 3MXHP 2K3KA 2MKHA 3CCSS 2MY7A 2FHOB 1VQKS 2LA4A 2LEAA 2DGOA 2MQLA 1VQLS 5LSOA 3CF5Q 2Q79A 3VAFA 2DISA 4YOEA 2KN4A 3MDFA 2RQCA 2KRBA 3CCVS 2MKSA 1QM9A 1H2TZ 1YHQS 4EGLA 3S8SA 3S7RA 5EN1A 1R8HA 2L9WA 1JMTA 1R8PA 3BO3A 2DGSA 3D2WA 2KI2A 2MXYA 2ADCA 2J0SD 2G1DA 2LCWA 2VOOA 3SXLA 2EK1A 3MD3A 4UQTA 1KD1T 3US5A 1WF0A 2KFYA 1P1TA 4WFAQ 3L3CA 5LJ3Y 1ZZNA 3BO4A 3R27A 3SMZA 2MGZA 2CPHA 3J7YU 3VAMA 3HHNB 5LXRA 4ERDA 2DB1A 2FC8A 2EVZA 1KQSR 2AD9A 3BS9A 1X5PA 3NNHA 3G6ES 2V94A 1KOOA 2HZCA 1WWHA 2DNGA 2RUGA 3CCMS 1FT8A 1YITS 3CTRA 1WHVA 2JVRA 4CIOA 2I38A 3J7ZT 1WF1A 1S79A 4IOAQ 4ZKAA 2JRSA 5DM7Q 2KXHA 2XNRA 2RRAA 4PR6A 4YB1P 2FPHX 4IUFA 4F26A 5CA5A 2MQOA 5GAGU 4FXVA 1UW4A 3BO2A 3MURP 3VAKA 3PIOQ 3CCQS 1VQ5S 2U1AA 2CQ3A 2KHCA 1X4BA 2CPXA 3S6EA 1HD1A 3LPYA 2YKAA 1UP1A 1U1RA 1WG1A 4C4WA 2DNRA 1FNXH 3CULA 2B0GA 3OW2R 2CPZA 1XN9A 3Q2TC 2OSQA 1HD0A 2F3JA 1UFWA 2MQPA 1VQPS 2MZRA 3MUMP 2MB0B 2KYXA 2LKZA 1NU4A 1H2VZ 2CPDA 1QVFR 2RS8A 2DHGA 2MHNA 4TLQA 2YH1A 2VOPA 2CQ0A 3MUVP 4QPTA 2E5IA 2ZJPQ 2HYIB 1HA1A 2X1AA 3UCGA 1WHXA 2HGNA 2E5JA 3H2UB 2M52A 3TYTA 2CPEA 1WI8A 3VAGA 2FC9A 1A9NB 2X1BA 1WEYA 1WI6A 1SJQA 1URNA 3G4SS 2GO9A 2JWNA 4FXWA 3ZZZA 4V19X 1KOHA 4LJMA 2CQDA 1D8ZA 2CPJA 2RU3A 1DBDA 2MYFA 2DGUA 1M5PC 3UWTA 3CCUS 3P3DA 3ZZYA 1N54B 3CD6S 4W92B 1NO8A 2JX2A 5FJ4A 1NJIT 3UD4P 1PO6A 3UCZP 3JB9k 1WTBA 1KC8T 4W90B 2CQIA 3CUNA 5DDPC 1X4HA 2OSRA 2LQ5A 1U1QA 3B4MA 5JVGQ 2CPFA 4BS2A 1VQ9S 2KG0A 1WELA 3UE2A 4WF9Q 2X1FA 1K8AT 2CQGA 2DO4A 2LXIA 1O0PA 2KU7A 2MJNA 2M88A 2YTCA 2M0GB 1VQOS 1OWXA 5D78A 5DDQC 2MSSA 3RW7A 1YIJS 1YJWS 1WG5A 2OIHA 2MQNA 1M5OC 1A7GE 1SXLA 1H6KX 2DIUA 1PGZA 1DRZA 3TO8A 4C0OC 2M8HA 2J0QD 1K9MT 1WHWA 2MZ1A 3PIPQ 2LMIA 2D9OA 2L41A 4IOCQ 2CQHA 4F02A 5LXYA 1U1NA 3V4MA 2RVJA 3CCRS 1Q81T 1JJHA 2OTLS 2YH0A 2DH8A 3U1MA 1FXLA 2ZJQQ 4OZ0A 3K0JA 1SJFA 1D9AA 1X4CA 2M7SA 3CPWR 2DGXA 4WKRA 1RK8A 1W2BR 2KT5A 2JVOA 2DH9A 2NLWA 2DNHA 1ZH5A 2DNYA 5IM0B 4ED5A 2MMYA 3N9UC 2DGTA 3NS6A 1U1PA 2XNQA 2YWKA 2KRRA 1JJ2R 3G9CA 2O3DA 2D3OR 2N3LA 1X4GA 3VAJA 2CQ4A 2N82B 5ITHA 1U1OA 2DNKA 3B4DA 2MQMA 2CPIA 1AUDA 3FEYB 3S01A 4U67Q 2XS5A 2KXNB 3NNAA 2DIVA 3MOJB 2LYVA 1G2EA 3DXBA 2XB2D 2ERRA 2VONA 4TU8A 1N88A 1U1KA 1SJRA 2QEXS 2J8AA 4QQBA 5DM6Q 3P6YC 1CVJA 1UAWA 1X5SA 5DETA 4PRFA 4CQ1A 2AYMA 3ULHA 1VC0A 4CH1A 2MQQA 2DH7A 2DK2A 2HGLA 3I55S 1SJ4P 2F9DA 1HL6A 2G4BA 4UY8T 2DITA 3Q2SC 1N52B 3FEXB 5IQQA 1VBYA 5LSLA 2DNLA 2LXUA 5GADU 1X4DA 2RS2A 2EK6A 2OJ3A 1VBZA 3P49B 2PEHA 4QU6A 2MPUA 3SDEA 3EGNA 3CCJS 1OPIA 1YJ9S 4LMZA 1VQNS 3CC2S 2RT3A 3VAHA 1U6BA 1OO0B 3CC4S 2CPYA 1WF2A 2ADBA 2CQ1A 3HI9A 1IQTA 5D77A 2L08A 1FJCA 2QFJA 2WBRA 3NS5A 2I2YA 2D9PA 2MKIA 1M5KC 3THPA 5MLCV 1U1MA 5BJRA 1P27B 1U1LA 2MKCA 1S72S 2A3JA 3G8TA 2DNQA 3P5TL 2K8GA 5HO4A 2N7CA 1X4EA 4OZ1A 5H1SV 2DNMA 1N8RT 1X5OA 2MGZB 2RQ4A 2G0CA 2MZTA 3VAIA 1M5VC 4IO9Q 1VQ7S 2N3OA 2ZJRQ 3UCUP 3R1LA 1FO1A 1M1KT 1VQ4S 2FY1A 1WEXA 1OIAA 1DZ5A 1WHYA 2KM8B 2DO0A 3NNCA 2DGVA 1X5TA 1Q7YT 3G71S 2BZ2A 1YJNS 2LEBA 2MJUA 4WIIA 3UD3P 2DNNA 2MKJA 1DHMA 1YTYA 2XS7A 2J76E 1VC5A 2PE8A 2E44A 2KXFA 2GHPA 2RRBA 1U2FA 3THTA 2DHXA 1YWXA 2DNZA 4J5OA 2XSFA 4WFBQ 2AYGA 1VQ6S 4LIRA 3G96A 3IRWP 5LJ5Y 3R1HA 4Z2XA 3LQVA 3CMAS 3I56S 2KVIA 4Y00A 2M8DB 2XS2A 4QU7A 2DNPA 1VBXA 2M4MA 4P6QA 3TP2A 1X0FA 2F9JA 1VQMS 2M9KA 4WCEQ 1QVGR 3CCLS 1Q86T 5CXTA 3CC7S 1JJ4A 2LA6A 1H2UX 5GMKa 2CQPA 4M5DB 3U1LA 3EGZA 1K73T 3RW6A 1U6FA 2NZ4A 2OTJS 5HL7Q 1BY9A 1X4AA 2M70A 1B7FA 5IFMA 1M90T 5IM0A 2CQBA 2BOPA 1FHTA 1WEZA
chains in the Genus database with same CATH superfamily
2E5HA 4C8KA 3IAS9 1Q16B 2JEGA 3IGVA 4USHA 4ZCIA 3HT0A 2CQ2A 4YDXA 2CQCA 4LIWA 3KLVA 1HI8A 2CIMA 2MKKA 1YI2S 1NK6A 3JQJA 2AYBA 4C7QA 4O3NA 2AT1B 2ZH1A 2QA4S 4LF5J 1WDDA 1UZDA 2X1GA 1OMSA 2XLJA 1XWLA 3MPWA 1KONA 2QMUB 4IQXA 4MK8A 1RACB 2ZH2A 5KG3A 1V6HA 1VQLS 4E8UA 3MEEA 3TRGA 1GTHA 5EWEA 1R8BA 4DFPA 4JI4J 4ID5B 3KLHB 1FEEA 3HZEA 2IDLA 3BN4A 1IBLJ 1SQEA 2R7SA 3K17A 5LJ3Y 5B0FA 3I4HX 2ZM6F 3HP6A 2HQFA 5IWAJ 3G82A 1IXKA 2XI2A 4C0BA 2NXJA 1S4EA 2W25A 2RHQB 3HX9A 2OEKA 5E41A 2HHHF 2FPHX 2YQ0A 2V4QA 2I8EA 4Y2CA 4DHVA 1GK8A 1MN7A 2RQKA 3LA0A 4C4WA 1UA0A 1TFWA 1LWEA 2BJDA 2B0GA 2GMHA 3PW0A 1VQPS 2HRYA 1CPZA 1RAHB 4L76A 1R3NA 2MHNA 5C24A 1F9HA 3I6PA 2AKWB 2VFVA 3ISNC 2RILA 2JLEA 1FDNA 1NK5A 3DU6A 3SEOA 2XO7A 1TL4A 2EFOA 2HZAA 1YZ7A 1LWFB 4IH7A 4B3OB 3LOUA 3PW4A 1MMNA 4USUA 5HQMA 3RU0A 5ETVA 3RB0A 5KFUA 1WTBA 3MZIA 1U4BA 2NSBA 2WTFA 5JVGQ 1PKUA 4JI6J 3RB6A 2YKMA 2M88A 2Y1JA 1R89A 3UDVA 1Y7PA 2VC0A 1XEZA 3GTYX 5L1JA 1QLNA 4OJ1A 1TL1B 3GJRB 4CH7A 2QRRA 2ZH5A 4UZCA 4OZ0A 1SJFA 1X4CA 2HKEA 3QQCD 1RK8A 1KLMB 5F9LA 4F04B 5KG7A 3UD5A 2LQ9A 3C66A 4RW7A 2WCXA 5FDLA 3QJJA 2BKOA 2D3OR 4LFCF 3GG0A 1N34F 2HBYB 2BKPA 2IHR1 1VRTA 2BANA 1ZM3A 5CYMB 4FXDA 2BJ1A 4XK8C 5DM6Q 3L4BC 4H4KA 1DY3A 3BKTA 4C11B 3ET6A 4PRFA 3LF0A 4P52A 2WAQD 2V9WA 2XI3A 3JAMU 2G4BA 4ZCKA 3D3BJ 4JYAJ 5IQQA 4YB6A 1YKWA 3K7RA 1ACMB 2RF2A 2V67A 3Q24A 1RHQB 1OPIA 1GXTA 2AV5A 4M5LA 4GC7A 2JOQA 3A8JA 2CPYA 3A8IA 2ROEA 2B5JA 1U49A 2BACA 2HAFA 3DOMB 4I6WA 4F67A 2VG5B 2GMJA 2H48B 5K9FA 3G8TA 3TVZA 2L9DA 1KTQA 1HIYA 1TL3B 3QAEA 1IJFB 2FHJA 3UDEA 1U48A 2N3OA 4J9SA 3CDAA 1WHYA 1MW7A 2DO0A 4Z7CA 3GJQB 1YTYA 1F5BA 4N8OA 3BSNA 2WHOA 1RT6A 1YWXA 2Z2LA 2HNYA 3G96A 1IKVB 3M2RA 3PYDA 4AL6A 2ZC3A 3GYGA 1FKPB 3LQVA 5AJ3J 5DS7A 1CEZA 1QVGR 2QFIA 3I0RB 3QJPA 4MKYA 4O4RA 4USWA 1NJWA 1RSCA 1TTHB 3G8QA 2NZ4A 3E01A 1APSA 1T11A 1C1CA 1VBKA 3I4PA 2O66A 1TAQA 2Q43A 4WU3A 4ILLA 1XBWA 3RTVA 3RR8A 1ZM2A 3I5AA 4WFNQ 4F25A 2CNOB 2LECA 2DNOA 2F4FA 1L3TA 5EWFA 4D3GA 1RKJA 4NI2A 2AMCB 3HXMA 1YGYA 5GAEU 4LT6A 2FLPA 3T1YF 4WTOB 1X0PA 2PSZA 4LRBA 2COLA 1GX6A 3KK1A 1RTDB 2HFUA 4PWDA 3K5NA 3FCHA 2Y1IA 3W1YC 1ZYQA 4DG1B 5HJXA 3DLKA 4CT9A 2Q79A 3MEGB 1R8AA 4YOEA 2ZH9A 2H1YA 1FKAF 3M8PA 2O1PA 2L9WA 3GU0A 4I2QB 4I2PA 3OUYB 1HBMB 3AOBA 4KO0B 2FJVA 2V50A 4KB7A 3VAMA 3NP5A 4PEOA 2YPYA 4ZHRB 2OPQA 1LW2B 5JXSA 4OYXA 1YBUA 3LP1A 4NZ6A 5KFWA 2UU9F 4NMXA 1JLCA 2GQCA 4QW8A 2HHVA 2OPRA 2VFRA 3BREA 3GIKA 4IH6A 1U26A 4IUFA 4E98A 2JZ5A 4FXVA 1ZM4A 3MR5A 2ZBPA 1VQ5S 3JSMA 4A47A 2F7VA 1JIHA 2EBGA 1LEOA 2AX1A 2V5HG 1U8WA 3IC1A 3H4DA 4ATNA 2MQ8A 5F9NA 3BN7A 3UCGA 4DL3A 2FVPA 5J2NB 3Q8YA 5CABA 2BE7D 3VAGA 1NUEA 2J7WA 3H8YA 2X1BA 5IXUA 2K1RB 5F8HA 1RYSA 2IJRA 1DBDA 4NEYA 5IV4A 1WTFA 1S10A 4FVMA 4L73A 1B3TA 3GZ7A 4RBUA 4C8OA 1XERA 1RLCL 2V8GA 2WSEC 3BKFA 3KHLA 1KDNA 3EWGA 3GSDA 4RW8B 4DV1J 2YY3A 5DGAA 1R43A 3BM7A 5C5JA 3NGRA 5J1PA 1DLOA 1RT5B 1NK9A 2J0QD 4KGKA 3GFYA 1HHQA 4RW9B 4DL5A 2WB4A 3QRPA 1QAXA 3V4MA 1FK9B 2B4VA 3KJVA 2VPXB 4JI4F 1I6JA 3MM9A 3V6HA 1EB0A 2KFZA 1N5SA 1IKYB 2R7TA 3NS6A 1DURA 4IR1A 1IBLF 1U1PA 4FKXA 5ETQA 2MQMA 4PXBA 3QLHA 5CZXA 4FBTA 1XMQJ 3H5YA 5C42B 4R0JA 4DEZA 3BR8A 3F56A 5B08A 1L3SA 1CVJA 2QV6A 1X5SA 4OHZA 5KG6A 4WPAA 5K14A 1T9WA 3CDUA 4UY8T 3OXLA 4AXIA 1HYSB 4LFBJ 1V5IB 4DV0J 3M2VA 4KH0B 1NPPA 1V9OA 4JV1A 4N5SA 2CJAA 4F4AA 3K5OA 3HM9A 2JEFA 1F5AA 2H54B 2PMZD 4PXDA 1P6TA 3W63A 3MM7A 1P27B 4HT7A 4C48A 3MEDB 3DI6B 1PSDA 2PFFB 1U6ZA 4EYIB 3DOKA 4KRWA 3C46A 2W9BB 3TW0A 2FJEB 2CNNB 4JI7J 4LSNA 1G3OA 1JLGA 3G71S 2YNIA 4DN0A 2NSCA 2H5JB 2RQMA 1NXIA 2P6SA 4WP9A 2HHTA 1RZMA 3Q8QB 1HQEA 3ISZA 2DRAA 1MG7A 3HHLD 3CMAS 2W2NP 2VJUA 1N36F 2IYGA 1VQSA 2X3DA 2CJBA 1RHJB 2PT0A 2HQ3A 1EAYC 2LQJA 4JI1F 1BWEA 4NCAA 5I3PA 4NCBA 1H7XA 3QIDA 3DU5A 5IM0A 4HH1A 1HNVB 3RRKA 1RTZA 2DHAA 5DDOC 4TY8A 3DLEB 4PKDB 3UQSA 3PHTA 2V34A 2Z56B 1PG5B 1RISA 4HVZA 1S77D 1SKUB 4Y0FA 2EPIA 5KFLA 2C2KB 4Y28C 2I1RA 2WW8A 3IRXB 2RDDA 4XTTA 1QSYA 3TA0A 4WIQA 3QT6A 3A13A 4B3RJ 1D3WA 3W8GA 3MUTP 5F8GA 4LF9F 4AE5A 3WX8A 2C1EB 1FD2A 2YQ1A 1S0OA 3MXHP 5D0RA 1VYAA 1C0TA 1TUVA 3TZWA 1HI1A 3EICA 5KFQA 2KRBA 3O5TB 1YHQS 3S8SA 3ZFVA 2GVDB 2A6OA 2N7YA 3W2VA 1P1TA 1VOMA 3L3CA 3L7UA 2YKPA 3HHNB 3AAWB 5LXRA 1JLFB 4YR3A 1RT2B 2EBEA 4PYDA 3G6ES 1RT4B 3M8QB 1OSDA 2DNGA 1JJCB 1H98A 3AXMA 2HBRB 3MMBB 4CLPA 4ZJQA 4NYOA 5KFYA 3QGHA 4PPZA 3DLGB 1UWAA 1S49A 3FQLA 5KT4A 2CQ3A 1X4BA 3JSBA 1AFJA 5IT9Y 1IBCB 2GNKA 4F0KA 3D1QA 4QPTA 2E5IA 2UXCJ 4QR1A 3K5PA 2IVMA 4PQUA 4K5SA 1TQLA 4GO5X 1H73A 2D3UA 2B9YA 2QLJB 3CIZA 2J7UA 3Q8UA 1DFDA 1WKJA 2CPJA 2P8IA 4RBTA 4MKAA 1UTAA 4UF4A 3C16A 3BF4A 2ZH3A 1HWJA 3GIIA 4LF1A 4C9DA 2HK3A 3LO3A 4LRCA 4WKYA 4MYTA 2PI5A 1UJ6A 2QL9B 3K8VA 2DO4A 2KU7A 2Q6BA 4A8OA 1YJWS 2HLUA 4ENOA 5BR8J 1MMDA 3CNQP 1UWBA 1UZHA 5B0GA 2A2DA 5J2PA 2RB7A 4A8SA 2O5DA 4DFMA 2NLWA 2EW9A 1HNXJ 2HFOA 3TJ8A 2YKNA 1YJ7A 2YVSA 2IRUA 2DR6A 5E3AA 4PZVA 3C6TA 3H7HB 2R7VA 2YWGA 1ELOA 4ZVSB 1TR0A 5EUHA 3KJFB 4JV0A 5LMNF 2LU2A 1BXNA 3MR2A 5DETA 2LP4A 2HVEA 4RNMA 2AHOB 1U25A 1HNIA 2VZ9A 3BPSP 4CI0B 4PAAA 2BYCA 1BD6A 1VK3A 1MWQA 4DPYA 1S6QA 3FRZA 1GNKA 5HQ8A 3MEEB 1XMOF 5F8LA 2PIIA 3OR1A 1W2IA 1IQTA 2L08A 4PQAA 4USIA 4XDDA 2IRYA 1EQ0A 4XIUA 5FIIA 1S72S 1VFJA 2XCPA 5HMXA 4KV8A 4ED1A 4F3OA 2EEYA 2K2PA 2C2ZB 5A8WA 3T3FA 4ETZA 1NHUA 1NH7A 3FC9A 3G82B 2FJDB 4OZJA 1N5VA 2E1PA 2DNZA 3CEDA 4EBDA 2VG6A 3NWRA 3R1HA 1H38A 2KVIA 2M4MA 1G7CB 3AFGA 1LK5A 5CXTA 3M1VA 5C24B 1IBKF 1WNEA 1Y4ZB 1BY9A 1X4AA 4RPFA 3MAAA 4O23A 1VHFA 5CAAA 4USJC 3QNWB 1JNRB 5JVHQ 3IWNC 4QYZJ 2KG1A 4RW4A 1S6PA 2XQCA 1RWNB 3EZ5A 5KFIA 5CCLA 1UJ5A 4QIEA 4EYHB 5GVQA 3J81Y 1SH0A 2AJFE 5KG5A 3QBCA 4JI2J 1GMUA 2HS0A 1MN9A 4MTPA 4LRFA 3R5DA 1EKSA 3UVJA 3EX7B 3JQMA 3KHRA 3D68A 1YDLA 3I0SA 2YKMB 3D9BA 5B0CA 2EI5A 3GWCA 4DR4F 4J9OA 4M5HA 4ZVFA 3MDFA 2OI2A 2RQCA 1QTMA 4DV0F 5A8KA 3CCVS 1WC5A 3AOAA 3ZTPA 4M5KA 4PYAA 4QWCA 3D6MB 3DRYA 3W65A 3OXFA 3F0NA 1HBOA 1RWXB 2GHVC 3T5LA 3AB2B 4RW7B 3GMGA 2G1HA 2AGPA 5FDLB 1KQSR 2FLOA 3HSZA 3HCXA 4DR5F 2CXEA 2GA7A 2IMWP 1FT8A 2WSFC 2XSJA 4HI2A 4BWJA 2FVCA 2BANB 5LT5A 2XNRA 3NOGA 4OHXA 2GIRA 3L9ZA 4EUVA 3VVTA 3ET6B 3HKZD 4NLDA 3VAKA 2ZC4A 3M9OB 5KG4A 1IR0A 5D4LA 4EK2A 2RJZA 3LPYA 1Q5VA 1UFLA 2R7UA 4FP9A 1Z1ZA 2ZZNA 2RF2B 3FSYA 2IJNA 1QVFR 2OD4A 4ECZA 2VOPA 2ZH4A 1RJJA 5D0EA 1JX4A 1Y5LB 3NWGA 2B5JB 2E5JA 1HKAA 1KVKA 4JI8J 1HARA 2FC9A 3NGDA 4UT4A 4S0MA 4CLLA 5J1EA 2VKZG 3G86A 3BSOA 3QGGA 4ZLLA 1XNRJ 1B4SA 1Y3KA 4B3MJ 4LVOP 2WOMA 3MCNA 3OHAA 2HS3A 4CO1A 3OJUA 4IRDA 2Z2MA 3GLJA 3UCZP 1GMWD 5A2QU 3CO0P 2HMIA 3CUNA 3KNAA 1SIZA 3GP9A 3LGHA 2RMLA 2YX1A 3CWJA 2W9CA 1K8AT 1RT6B 2HNYB 3M2RB 1F0XA 3RW7A 3K2YA 3W61A 2FDNA 2W8KA 2E1AA 3IO1A 1TU0B 2VF3A 4ZVRB 4OHVA 4DOZA 4QYZK 3GSIA 1RHMB 4X84A 1NLKL 4U6PA 3V81A 4JI5J 2ZJQQ 2XWXA 5AXKA 3ILJA 4X66J 5A8RB 2P9GA 2E1MC 3DHXA 1RCXB 3PVXA 5EX3A 4ECSA 2AZ1A 1C1CB 5HN0A 2ZEJA 5T14A 4AFFA 1HPZA 1JJ2R 1NBEB 2N3LA 5E0OA 2Q3PA 4EO8A 4DV2J 2CPIA 3P45B 5KFBA 4HHHA 5DG7A 2JEJA 4EBCA 4LBIA 3PY8A 3D0HE 4CM0A 2R4FA 4NI2B 2IVFB 2M5YA 3D54A 1CC7A 3Q2SC 3HHLC 2VC1A 2H4WB 3KK1B 4MFBA 3SV4A 4GKKJ 3QRRA 2OJ3A 1RAAB 2LDIA 4MJKA 4WXOA 3DLKB 4A4JA 4NYPA 3D1HA 4ZVPB 5M2PA 1HW8A 3M8PB 2F4VJ 2QC3A 2I2YA 2ZWPA 1U1MA 3HKWA 4OI2A 2DT9A 3QZ8A 2G0CA 1FVSA 1RBOB 2ZJRQ 2OPQB 5JMNA 2AEFA 5HANA 3TEGA 1NDLA 3IS9A 3WDOA 1YQHA 1JLCB 1B99A 1X5TA 4OHYA 1CJVA 4IH5A 2FGCA 2OPRB 1QY7A 2XS7A 5BYQA 4ZLPA 1IM6A 1AXQA 1D9FA 4MH8A 1MROA 1UA1A 1S1VA 4IG0A 2WVBA 1OPZA 4OYBA 2XYGB 3JSMB 3P8BB 4YR0A 3JTNA 1HI0P 4J7CA 4O3QA 2F9JA 2ZVSA 2DR8A 5BR8F 1PYOB 3ZC4A 2UUBF 2HHQA 4GKJF 3KK3A 3B78A 5HL7Q 2IPOB 2AJ0A 2PEBA 4I64A 1OJ4A 1EETA 4L6V3 1EKRA 2EFVA 3FK4A 4KHPJ 2UV8A 2R2RA 3HSGA 3IMQJ 3TUJC 4PUOA 2VODA 3D0IE 1J5OA 4ILMA 5CYJA 2N4CA 4ZVHA 4LRDA 1U24A 4UTGA 2CJYB 3MI7X 2HPUA 3GE9A 2MSTA 3DC2A 4CLKA 4UY85 3NRBA 4KTQA 3WIUA 1UETA 2Y0BB 2DGWA 3H2VE 2WZ1A 1VQKS 2RRNA 2XZDB 3R7BB 3GYXB 4AUKA 4DPWA 1DLOB 1U2RA 4DR3J 1RHUB 1NHVA 2BJEA 2X3GA 3KLGA 4OYMA 2BQ3A 3L09A 3SV3A 3KJVB 1JMTA 5I3QA 2ZH7A 4UZBA 3KKFA 2Y3YA 1HQUA 3M4XA 3ZXWA 3MM9B 2R7RA 1KD1T 5F8JA 2KFYA 4CLFA 5DO2A 4HKQA 1U02A 2XG8A 1R31A 4WP8A 4HI1A 2CJ9A 4I67A 2OPSA 3QLHB 2IM1A 4Y65A 3IR5B 4I68A 1GQEA 5DM7Q 4B3SJ 2ROPA 2RRAA 1IN0A 3OFFA 5HAOA 5L1IA 1IKWA 3GQCA 5K14B 2UXBJ 4KGXB 3FGVA 5DLGA 1FNXH 3M2VB 3NLCA 1UFWA 1WACA 4TLQA 4F4WA 4FF3A 5DJBA 1Q8BA 3PNIA 5HK4A 2FZKB 4WWSA 2UXDF 2F5GA 3UNYA 3OR2A 4K4WA 2LU1A 3MM7B 5DG8A 3IG1B 3SIPB 3VQTA 3SQGA 4K0KJ 4JI3J 4DUTA 4IOBA 2B8PA 1JLAA 2UVWA 4DV3J 3DOKB 3IP0A 5EDWA 1RQ0A 4DR6J 1HNWJ 4LSNB 1RUSA 2UV8G 1JLGB 1PAUB 2DR5A 2YNIB 1U1QA 2YNHA 3SSSA 5CYQA 3BQ2A 4JI2F 4LR8A 2KL8A 4DCPB 3OT9A 3MFIA 2VQFJ 2LXFA 2O67A 1OY9A 1HQEB 1NAQA 4C98A 1VCTA 1OY6A 1TMMA 3HULA 1RI7A 3CCRS 2BXJA 3BPDA 5KFSA 4ED6A 5C25A 4ZPTR 4KKOA 5IM0B 2MMYA 3D7SB 1LKZA 2RHSB 2B9EA 1DJ0A 2KRRA 2JEIA 3CDWA 3OQ2A 4LQ3A 4O3OA 4KHMA 3EVWA 4O3SA 2FB0A 3BGOP 2ZOGA 4NX9A 5HSPA 1U1KA 5KAKA 2OUGA 4CQ1A 8RUCA 2XCAA 2DH7A 3GILA 4U7UD 3GJTB 2MLYA 3FJ2A 2OH2A 3FEXB 5D15A 4HYKA 1IWAA 1C0TB 2HQIA 3WC2A 3HK2A 2XM3A 2Y8YA 4FS2A 2DVIA 4XPCA 2QFJA 4DZ6A 5B0AA 1GXUA 3W2VB 2HNDA 4JI8F 5KTQA 4IG3A 2L48A 4URSA 1X5OA 1QAYA 3KOAA 3GONA 1BHNA 2B7BB 4ZP7A 5E3RA 1ZTTA 1RHRB 4B3MF 3RB4A 2R7QA 4ZPCA 4Y2MA 1ZAXA 1RU1A 1U2FA 4J5OA 2JC1A 3X3UA 2QGFB 3Q0AA 2MDAA 3H2LA 1I3OB 3T9NA 3PYGA 4RX6A 4OLOA 4J9PA 4DXLA 2GGPB 1R6YA 3DHWC 2H3EB 3KWMA 3RRGA 4NWBA 3PX4A 4FNIA 3CGIA 2FVRA 4PQUB 4JI5F 2B43A 4X66F 1LQ9A 2DGQA 4FKYA 3TEHB 3LP2A 1SJ3P 5JJBA 1DTQA 2ALZA 3QGIA 1NJYA 3M6XA 3SDEB 1Q82T 2E5GA 2X7IA 3C16B 3V2UC 2DBBA 1C1BA 4DV2F 4HT5A 2JDJA 1TKDA 4O0NA 2HVZA 2RNEA 1SKSA 1W7WA 4WFYA 4I0WA 4ZPVR 2BDPA 4ICLA 2MY7A 2FHOB 4C8MA 3I87A 1JLEA 1REGX 2MQLA 1VR6A 1TK0A 3Q83A 2BE9B 1UWBB 1R8CA 2VV5A 2YWHA 1H2TZ 1S9EA 2Z2ZA 5LMUF 3HPOA 3DRXA 2V4JA 1WC4A 3CW2C 3M8RA 1NK8A 3SXLA 3MD3A 3AOCA 3EYZA 2CWKA 3EZOA 1SH2A 3OD2A 2AJQA 2YKNB 2MGZA 2CPHA 5AE2A 4ERDA 2FC8A 1DAXA 5KOWA 3HHLA 3C6TB 4ELUA 1KOOA 1QDUB 3CJ4A 2RUGA 3PCOB 4ANCA 1FWKA 3CJKA 2I38A 3H0PA 2R3VA 4K7QA 3H4BA 3TA2A 4HTJA 3U1NA 3KLFA 3R97A 4ECWA 1HNIB 3GR1A 2N4DA 4F2RA 3K57A 1JXVA 1D09B 1WG1A 1RTJA 2NXCA 3W2WA 3OW2R 4EZ6A 1ZAVA 1S6QB 2KDOA 2F3JA 3EXCX 3LWLA 2D3O1 1LXJA 2F65A 4DL2A 2UUAF 3H5XA 3OR1B 3W9JA 6FDRA 1FRKA 1SBRA 2APOA 3LALA 1NJZA 3GYNA 4G3IA 3CB4A 2GVZA 1N5YA 4KV8B 3ZZZA 1J5EJ 1D8ZA 3KMQA 5A8WB 3V6KA 1TKZA 3N28A 3KYLA 2JL9A 3UD4P 4RO0A 3HJVA 1QUPA 5IS2A 3IBCB 5DQHA 2LQ5A 3RBXA 2CPFA 3A4TA 4PPDA 1VQ9S 1GXLA 3HT3A 3DFEA 1I51B 3TQEA 3MPVA 2NR0A 1FF2A 2LXIA 4WFZA 2HNZA 3AA8A 2VG6B 1VQOS 5DDQC 2HLTA 3J80U 1H6KX 4U7UK 5A6PA 3QZ7A 2EWHA 1Q8IA 2CQHA 3PXGa 2VQEF 1JJHA 2V4RA 2NCKL 4PG7A 3U1MA 2MLXA 3VCDA 3LAMA 3M1VB 4M1KA 2HSEB 4WKRA 2KT5A 3H5UA 1N0VC 3AT1B 1QAJA 1U0HB 3PJ9A 2XNQA 4LF7F 2KO1A 2NREA 4FYWB 1L3VA 1YJTA 4RW4B 1S6PB 7AT1B 3C8YA 4NLUA 4ALZA 2ZH6A 2GAHC 1FRIA 1GX5A 1M1GA 4TU8A 2NS1B 3FVYA 1Q7LB 4UUWA 1UAWA 2DKOB 1KQGB 2FD2A 3UVJB 3KK2B 2E29A 1Q78A 3QO9A 2E1CA 3MHYA 2NXUA 1VBYA 4K4YA 2JC0A 4ED0A 4K4VA 3GCWP 3LGMA 4ES2A 3RBZA 3ZTRA 2HW3A 1WF2A 3AA9A 5A8KB 1D0EA 2XULA 5JUMA 3M8YA 2F1FA 3FBBA 4JV2A 1GH8A 2PDAA 5F3ZA 1UVNA 2P2CB 3DOLA 1U1LA 4Q8EA 2FVSA 4NL5A 1HBOB 2W01A 4A8FA 3NL0A 1Y10A 2J9EA 4NXMJ 4DQPA 1M1KT 4JI3F 4YFUA 1R7IA 2JFKA 2R8JA 3FZ2A 2BVZA 3NNCA 2DGVA 5MAOA 3J7YI 1PIEA 2LEBA 3QT8A 2AP6A 5IQ6A 2PFDA 5U47A 2KZMA 3N6LA 4KY3A 2Z30B 2ZNYA 2NYHA 2DHXA 1KVJA 1HBUA 1S9GA 2QMXA 3AODA 5LJ5Y 2PMWA 3FEZA 2Y9HA 3ZTQA 2M8DB 2HIQA 2VQFF 1X9WA 3FSIA 1XK8A 3HSJA 3M9NB 3BYRA 5E2QA 4TYBA 3JYTA 3B8HA 2W2OP 2AJ1A 1URRA 2VU5A 5HVGA 2ZBCA 4G65A 1S5ZA 3TAPA 5J1EB 2W4DA 2AEMA 3EPIA 4U96A 5T41A 2RD5C 3W62A 1VQ8S 3VV2B 2WOMB 4FYDA 4DV5J 4Q2LA 2BBEA 4OLPA 1QE1A 1N4LA 2HMIB 1NDCA 2F8MA 3IFEA 2DY9A 1WC1A 2W9CB 2R8KA 3HHEA 3CXCR 4NLPA 1D1UA 1XR6A 1BMQB 1WJ9A 4DR7J 2DGOA 3AQOA 2VA3A 3RGIA 5K8MA 4WTYA 1T95A 3CF5Q 2KN4A 3VZIA 4IR9A 1VRUA 1ZPVA 1C4CA 1YBTA 4USKA 8ATCB 1T8EA 1FVQA 4EI2A 3V81B 5EN1A 4ZK7M 1T9YA 2ADCA 3DGPA 2ILYA 2MEWA 1YRXA 4JOUA 2EK1A 1TVRA 2PA8D 5THWA 4UQTA 2H5IB 1HPZB 2EVZA 1PC4A 4TY9A 3PACA 1WWHA 3HVTA 3HDSA 1AZSA 2CDRB 4OZNA 1TZ0A 3KUGA 1EARA 3H90A 1UW4A 3TJ9A 1S1TA 4YB5A 1BUXA 3BGLA 2U1AA 3S6EA 4B9UA 1U09A 1WSRA 4RJVA 3M05A 4MFBB 2DNRA 4G1QA 2RUSA 1HD0A 2E5LJ 3N01A 2ZUAA 3CD0A 1FJGJ 2X1AA 3BBBA 3ZZPA 4OHWA 3DLBA 3O44A 1KHVA 3R8YA 1RTHA 4PXEA 4E2FB 4I69A 1Y5IB 3GR0A 4FXWA 3DRSA 1BLUA 5D4OA 5HI7A 2E66A 4NLRA 1EX8A 1FTCA 1SL0A 1N54B 1YBAA 3MEKA 2A18A 1PYSB 4Q0BA 3IBWA 4NZ0A 4QWEA 3IGNA 2I5JA 2AW0A 3ZZ0A 1CJVB 1E6YA 2C3PA 1X8DA 4P75A 2WB1D 2FJBB 3UN3A 2P9EA 3EZUA 4L75A 4L3NA 5D78A 1MROB 4WK3A 1S1VB 4IG0B 2IMOA 3D1OA 4N7TA 3NGKA 2VIHA 1Q8KA 4C0OC 2XY7A 2V2KA 1K9MT 4QPXA 3J7AN 4YHHJ 2B9WA 3PDNA 3GFZA 2JVOA 4C0HA 2QSWA 5H9EJ 5HROA 5E3CA 1EETB 3GPAA 1G6BA 4B3TJ 3IM9A 2DNKA 3B4DA 4LFAJ 8AT1B 2BQUA 1WOPA 3DMJA 3NGUA 2Q6CA 3ZNJ1 4PUOB 4A8WA 3KG4A 2DIVA 1WC6A 2LVWA 4QIWD 2VONA 3T9ZA 3RRHA 4DF4A 2BJ9A 2HFZA 1XNQF 2J8AA 1FDDA 3FRYA 1FERA 3OLBA 2EC2A 3U7JA 1AT1B 4C8NA 4KR0B 1F1BB 4WZMA 1S59A 2QL7B 4NLQA 1N52B 2ASDA 4J37A 3DN9A 3GIJA 1E6VA 2VL1A 4HACB 3K5LA 5K8OA 3J7A1 4USVA 1NKBA 2QZ8A 5G0RA 2UUCF 1YZ6A 3VAHA 1U6BA 3MMAB 2CQ1A 3PHEA 3KLGB 2MKIA 2C2DA 1NB2A 5BJRA 1F60B 1PCAA 3T6JA 4NE9C 2MKCA 5H9FJ 1HBNA 1HQUB 5F3TA 2D41A 4QIGA 3RBEA 3AD7C 4X4TA 4OYOA 2PN6A 2FHJD 4USMA 1U8SA 5HMWA 3BH7B 1J5EF 1VI7A 4B17A 1OIAA 2OPSB 2KYZA 3ETOA 5BXIA 4Y2IA 1S0NA 2MKJA 2AGOA 4HLBA 5LL6d 2E44A 2KXFA 3ICLA 4KGZB 3BYPA 5D6GA 3CJ8A 4B9TA 1BC6A 2LEPA 3THVA 5GAGI 3NCQA 1VQMS 4WCEQ 2XHCA 1RWUA 2Z0GA 3PEJA 2GQ2A 1FXRA 1KRPA 4OI4A 4JV5F 1C0UB 4PWWA 1U6FA 3FDSA 4IFYA 2BOAA 1FHTA 3OR2B 1W25A 4FNHA 3R7NB 2C2MB 9RUBA 1SC1B 3SQGB 2IM0A 1JLAB 2ATLA 2VB6A 4ED8A 2QMWA 1GT8A 4TKTA 2UP1A 1VLOA 2J0WA 1FKOA 1RU2A 2YNHB 3VF0B 4GVLA 4A46A 5IC4B 4YB7A 2K3KA 3TZYA 1LWFA 5H9EK 4C3MA 2B7CB 3I32A 4ELTA 1RADB 3NBPA 4FF1A 2GMLA 3I82A 3ETMA 4EGLA 3JTOA 4ECUA 3LUYA 4XPEA 3WBZA 3HFZB 5C25B 1BQNA 2FJAB 2G2OA 1QSSA 2J6TA 4WFAQ 1N5TA 3UN2A 4GVBA 1CJKA 4ECRA 1I94J 1M5HA 1S4FA 2HZCA 3GV5B 4F8RA 1B64A 4Y3CA 1UJ4A 3R7SB 4ZKAA 1UCNA 1KS2A 1ITPA 4PR6A 3EPGA 3LTOA 4ANEA 3ENAA 1KLMA 4P2SA 4LBHA 2WVDA 4A8YA 4URQU 3VVUA 3O8WA 3UR3C 1RT1A 3CULA 2BM1A 2E1RA 2KYXA 2LKZA 1NU4A 4KFBA 2ZJPQ 3FQKA 5GADI 3TYTA 3T1HJ 5I42A 4OYAA 2QYCA 4UOFA 4FZVA 5KFPA 2HNDB 3SCJE 3MPDA 4IG3B 2OFGX 3HO1A 3UWTA 1M1HA 2EG1A 3HD1A 4DFJA 3JB9k 2VH7A 2CQIA 1NPKA 2ACMA 2DYAA 2HRUA 5HBMB 1X4HA 3AJ1A 4MT1A 4DV5F 5C2GA 1JKHB 1RE1B 1D8YA 3NXZA 1WELA 3FBCA 2QG9B 1JB0C 1NK4A 3RYLA 4J9VA 4QWBA 1FI4A 1Y3JA 2ILZA 2YXLA 1PGZA 5DGBA 1LNQA 2M8HA 3DNCA 2HWIA 4LBPA 4DR7F 1Q81T 4EBEA 2J0XA 1JXLA 1NH8A 3CPWR 3W9IA 3JTPA 2PGCA 2QYGA 1SCJB 4M94A 4WFXA 5KFGA 3KHHA 1ZH5A 4QWDA 2Z4PA 3P96A 3KXDA 1K1QA 4IDKA 3DYAA 1RWVB 2O3DA 1D9DA 1DTQB 3QSYB 2Q66A 1LOUA 2DY1A 1TL7B 1HR0J 5KFMA 1K1SA 3KUEA 3DXBA 4LF6F 1C1BB 5KFHA 4DUYF 3ILIA 4QQBA 4IRKA 4CCHA 2RDIA 3CDBA 3R5GA 1S99A 4NXNJ 5DQGA 3OVAA 2MQQA 1HL6A 3E2EA 2HG4A 2Z58B 1QD1A 4WXWA 2OEJA 4ICLB 2DNLA 2ZBRA 4NLGA 1JLEB 5EGYA 4QU6A 1RWKB 1RA7A 2ZE2A 5T7LA 3CCJS 3CC4S 4Q2MA 1S9EB 2KJWA 3VGVA 2ASLA 1RAEB 2V4JB 3RZAA 1MLAA 1FJGF 1H74A 3U27A 2N7CA 4JI0J 1FDBA 3GIRA 1Q79A 2MGZB 4IO9Q 1REVA 2VICA 2W24A 2IRXA 2DXFA 4GRSA 4R0EA 5HMYA 5HMZA 1AROP 1WC0A 2Z2YB 1Q8LA 3CJKB 4Y2KA 2CG8A 1DHMA 1VC5A 2ALYB 4ZVGA 1O5JA 2AYGA 2G9OA 1VQ6S 4X4PA 1S48A 3KLFB 1OS5A 2PO4A 2HVHA 1FTRA 4WU2A 4DSFA 3OTDA 1KQFB 1HWLA 3I56S 1FE4A 2XS2A 4Q7AA 2M3DA 2ABYA 1RTJB 2XWYA 3ONQA 4X64F 2XMUA 2H4YB 1M90T 4R25A 3QFWA 2J6UA 3L7PA 3OLAA 1S1XA 3MD1A 1ZPWX 3ZTSA 3M6VA 3H42A 2GVZB 4OZLA 3MM5A 4Y34A 2J9DA 4B3TF 3WZ0A 5HLFA 5DQIA 1TKZB 2ZH8A 4LFAF 1NSAA 1N48A 2QLBB 4K4SA 3CJ5A 2SXLA 3G8SA 1F9FA 4C6AA 2DHSA 1T9VA 4QR0A 3T1AA 2HNZB 2ZM6J 2EFNA 4EMDA 4DMZA 3CCSS 2B4UA 2LA4A 1C2PA 3H5SA 1IVZA 3MECB 2FLNA 1KBRA 3W3SA 1YRTA 1IR1A 4CLYA 1T3OA 2YWEA 3BR9A 3MR7A 2DGSA 2KI2A 2J0SD 5KFJA 4J9KA 4LF5F 3HJFA 1SC6A 3KDOA 1ZS6A 4BWMA 3J7YU 3SI8A 3ZZTA 3KNGA 3KMSA 2AD9A 3BS9A 4DCOB 3NNHA 2IDEA 5EWGA 5KFKA 4CIOA 2OGUA 4OMFG 4YB1P 1SL1A 4DX7A 3H98A 1FE0A 4DF8A 2GQQA 2CZ4A 2DJWA 3WC0A 1K47A 3QO9B 4LRAA 1T9UA 3AB4B 1FD8A 1NB7A 2OSQA 1HMVA 5F0WA 3F73A 4CDIA 5IWAF 4MYUA 3I9ZA 4M5DA 5C42A 3BSCA 1YK9A 1HA1A 2VBWA 3LAKA 3DKDA 4KSEB 4EWTA 4ES1A 3TX8A 1WI8A 2Y0SD 3DOLB 3M8SA 1SJQA 3TUPA 1RT3A 4BDPA 2GO9A 3EVMA 2FZGB 3LWMA 1WKLA 1CJTA 1Q1KA 3PJXA 2QT7A 4W90B 3M9MB 4Q44A 2DPJA 3KDNA 1TK8A 3RBDA 4B9MA 1SV5A 1T7PA 4N47A 4WYWA 4J91A 1IBMJ 2VPZB 1RT7A 2UVRA 1EHWA 2KG0A 3K89A 3OTEA 1SC3B 2G2YA 2QLXA 2D74B 5KOXA 4ZLNA 1HBUB 2MJNA 3D28A 1S9GB 2QA2A 4RNFA 4LFCJ 4AL5A 1SXLA 4A8KA 2FYXA 1N34J 1T9XA 5D0GA 1DRZA 1KFSA 1Q53A 2YWFA 5J1NA 4L72B 3PIPQ 2D9OA 5LXYA 4B02A 2W8LA 4ECQA 3V4IA 3JYTB 3BBCA 4IKAA 4Q43A 4TVAB 2DH9A 2XEXA 2QL5B 1OQ3A 1DTTA 3MM6B 3VTIA 3HVAA 4HR2A 1SL2A 3DDIA 3R2CJ 4JI6F 1NKEA 3C14B 3N79A 4WJBA 4OI3A 4LSZB 4ED3A 1X4GA 5CD4A 3VAJA 1KN6A 2AJ4A 3OL8A 3DLJA 1I94F 1MWZA 2XS5A 4OZ3A 3QMQA 2E9RX 2XB2D 3MGJA 4RWWA 3N0VA 1KNZA 4DV6J 1QE1B 3GIMA 3BH6B 2HWHA 3GB0A 2HQCA 4KQZA 4LSLA 7FDRA 4DU7A 2LDYA 1WD6A 2KHDA 5LM7E 1N6QB 1P9YA 4YS2A 3Q8SB 1H7WA 2XMWA 4P7TA 3C3LA 4DWIA 3OSPA 2HVIA 3I96A 1PBUA 1V3RA 4NPOA 3IRXA 1VRUB 2IA6A 1FJCA 1FX2A 3N5FA 3D3CJ 1K44A 5B0BA 3DGPB 3N6NA 4ZVUB 2E9ZA 1RWOB 1TVRB 3P5TL 5HO4A 2AF6A 5AT1B 4ZVTB 1SB6A 3OL9A 1OQ6A 1XTZA 4J9QA 1TELA 4P2MA 2D69A 1VGYA 1M5VC 3OHBA 4JYAF 4CNYA 1FFSB 4ZIVA 4DU8A 1FO1A 4GMKA 3H59A 2ZFHA 2YBVA 1ROFA 3CO9A 3HVTB 2DR7A 1AZSB 4NRTA 2GHPA 1KQKA 3MTKA 4WFBQ 4ECTA 1UVKA 1S1TB 1CQMA 2RKIA 1CJUA 2ZWOA 1S12A 4Y00A 3RG6A 2ZITA 4DS5A 1JLFA 1RT2A 5L46A 1X0FA 3HVRA 4G1QB 5IOLA 3M8QA 4AXJA 4OX6A 5GMDA 5AE1A 1H2UX 3T5KA 3NEKA 3BKUA 1SQGA 3T1YJ 2OTJS 1Y0HA 4UW2A 1Z2LA 1B7FA 4CO0A 2W4CA 3OXGA 3UW1A 2V8PA 3OSNA 2AU0A 1RTHB 2CUYA 3DRSB 5AJ3F 2IAJB 2FQQB 3H20A 1AUSL 4K4UA 1SUQA 2KH9A 1QAIA 4CH0S 3DRRA 4R8UA 4Q0BB 1RDRA 2EXUA 4OQJA 5DDRC 3DLLQ 2I5JB 1L5UA 2YWWA 1E6YB 3EUNA 2VD3A 2AYEA 2MZSA 3SCLE 2CDQA 3VR1A 4NCGA 5E3QA 1X31C 5KFEA 5KFZA 2R7XA 4UOHA 2UU9J 3TARA 2A6MA 1X9MA 2XY6A 6FD1A 1A6LA 2C2OB 4ZVEA 4WZQA 3L95X 1EIYB 1EP4A 1RWMB 3D2WA 3BQ0A 1UKUA 1S9FA 5B09A 4DCJB 2OP5A 2VOOA 1AYEA 4B08A 1WF0A 1UPMB 2YNFA 3HZGA 4HH0A 3OTBA 5HROB 3PO4A 3QWPA 1PILA 2DCLA 4FYYB 3SSRA 4JI0F 1Z4UA 2NYIA 2JNJA 4K2JA 1YITS 2C42A 4HHUA 4ZP6A 1WF1A 4N56A 3IR6B 4N8NA 4KT0C 3TAMA 4F26A 4ZN1A 1IKXA 5GAGU 2IC3A 2VKRA 4ED2A 2KHCA 4QJVA 4ZCLA 3OFGA 1RA6A 2G0IA 2HK2A 4OFZA 3B54A 5I3UA 1E6VB 4WK1A 6AT1B 2MZRA 5DZ6A 2QO3A 5G0RB 2GJIA 2FJXA 1P9QC 1RXOB 2IFXA 2DTJA 1Q95G 2FHMA 1HBNB 4KC5A 2HEKA 2UUWA 4LJMA 2CQDA 2RU3A 1FRHA 1NSQA 5K20B 4DSJA 1U7LA 3CD6S 3UN5A 4G6VB 2B9XA 2B51A 4LF8J 3PO5A 4BS2A 3M7VA 1F5CA 3PZPA 4WF9Q 3ZZUA 2W7AA 2H65B 5K8PA 1P1LA 1WG5A 2OIHA 1A7GE 1GFWB 1R0BG 5CQGA 4RNHA 1SVDA 3IXQA 4IOCQ 2L41A 4FS1A 4F02A 1NM2A 3CJRA 1HQ2A 4LVNP 4O3PA 4NA3A 2FLLA 2DGXA 2FY8A 1T03A 3QIPA 4HDHA 3W5ZA 4P9SA 4CM2A 5ETOA 2ZOFA 4OZ2A 1SKWA 1HNZJ 4IFYB 4DV1F 2YNGA 1H3DA 1T9TA 4DSIA 5B7WA 1LWEB 4ZCMA 1CBKA 2BR0A 3PV8A 1IM4A 3MOJB 2DPIA 1VIXA 3PX6A 2CA9A 5KFRA 1FKOB 1VLYA 3JXOA 2AYMA 4F3MA 2G2ZA 4FPRA 3I55S 2F9DA 4K59A 2DITA 1TL5A 5IC6B 1K0VA 1XMBA 3KUHA 5SZTA 2CVIA 5GADU 1X4DA 4DX5A 2DXDA 2BM0A 3P49B 2PEHA 1CSJA 4C3LA 3NBPB 4N77A 4H4MA 4O44A 2B56A 1XMQF 4KGMA 4QW9A 2G0JA 3HI9A 1HW9A 1SKRA 2BKNA 2D9PA 4KPCA 3TWZA 1WSVA 3LW5C 4KH1B 1BQNB 3GJSB 4P74A 3Q8PB 4ELVA 1N36J 4GVBB 1CJKB 4DPXA 1VQ7S 4LFBF 2ZD1A 3TVKA 4QWAA 1G1XA 2FY1A 4ED4A 2V8HA 2KM8B 2PA3A 1Q7YT 2BZ2A 4JI1J 2DNNA 4CLUA 4X4QA 2AGQA 2RRBA 2QA1A 3QFHA 3F44A 1IBMF 4ECYA 1PJ5A 4LR7A 4RR5A 2V8VA 4QU7A 1RT1B 3KG0A 2RDJA 1VRTB 1Q86T 4WBFA 2LA6A 2AIRB 4JI7F 4KFBB 4C2MA 1MWYA 3RW6A 4CLSA 4LF9J 2BOPA 3NOCA 3BDPA 5I42B 1KTVA 1VS3A 5KG1A 1PC5A 1X7VA 2ASYA 3MM8A 4UOGA 3IA0A 1U2CA 3IN5A 3AD8C 2V0NA 4URGA 4OI0A 3T19A 4RU2A 1ZAWA 4M5GA 3MR6A 5KFFA 3R5AA 4MMOA 1KHWA 5IT9U 4DV6F 4M5IA 3C2PA 3DDKA 1PJ7A 5AXMA 5DG9A 5M2RA 4P2XA 5K5MA 4NA2A 4DL4A 2FJWA 5DLFA 1G4CA 1R8PA 2V69A 2OPPA 2G1DA 1JLQA 4B3RF 5KFAA 3D67A 3US5A 3W5YA 3OFHA 1AB8A 4ZN3A 1CC8A 3BO4A 1ZZNA 1LWCA 2GIQA 4IDKB 1H0HB 3DYAB 2EFPA 4K4XA 1X5PA 5G4DA 5CZVA 5HQLA 1N56A 3QWUA 2LLZA 2W7PA 4QIFA 2KXHA 3SSQA 2HBZB 3E01B 4LF2A 5A8RA 2OD6A 3IBFB 2MQOA 2ZKUA 5KFOA 1N5QA 4DPTA 2HHUA 3H40A 1S97A 2VFTA 1S76D 3W7BA 3NMAA 3Q2TC 2ZE2B 5T7LB 4DN9A 4IFVA 2YH1A 1HLWA 4DFKA 3GG1A 4WE1A 3R2DJ 1WHXA 2GJFA 2EFQA 1NCLA 2NUUG 2NXNA 3I5CA 2HQGA 1UVMA 4DI6A 4PWDB 3QATA 2P5VA 2DCUB 1O8BA 3QGPA 3ZTOA 2QLWA 1M5PC 2VBYA 2R8GA 1REVB 3EM1A 4YY3J 2MLZA 3BGUA 5ETMA 2BA9A 3T6BA 3RAXA 4Q8FA 1UVJA 3B6BA 2FUG9 4OX9J 1YX2A 4I2PB 2UXCF 3AXKA 4FYXB 5AXLA 3ZZOA 3RAMA 5FD1A 3IAM9 2F8HA 1T94A 1FRMA 3M32A 3R9LA 4AD6A 2ZOMA 2F8EX 3SQOP 2BJ7A 3LP1B 4AT1B 3TO8A 1FFGB 1FFWB 1WHWA 2BMBA 2RVJA 4CYUA 5LMNJ 2DH8A 1RYRA 3NKYA 2BE2A 4RNOA 2DNHA 2K7JA 2V2VA 5IZHA 1CULA 2J9DE 2A2CA 1S1XB 4TLRA 1YSJA 4NA1A 2CVEA 3NAIA 3P4UB 3ENQA 2XLKA 5ITHA 3MM5B 1XMOJ 4J9LA 5HLFB 4RUBA 1JWWA 1WOSA 3O2IA 3P6YC 3FZBA 3N5BA 2O01C 2R8HA 2R2TA 3MMCA 4RU9A 4TNOA 1VK8A 1B0VA 4DBQA 3T5JA 1TP7A 4F4KA 1HNXF 3W64A 5IT0A 4I7FA 3HF5A 3IWXA 1FRXA 1TKXA 3Q23A 2EK6A 1VMBA 5GAHI 1N33J 3TX0A 1UW9A 1YJ9S 4F36A 5LOQA 1OO0B 1BQXA 4HDGA 2ADBA 4ANDA 3BGFA 2WBRA 3T5HA 2ZHBA 2A0FB 2B3TB 2NZCA 2JLFA 2R9LA 5HVHA 3OPKA 3J81U 5H1SV 5EX0A 3VAIA 1WC3A 2XLIA 2GHWA 4EO6A 3M8ZA 2UVUA 1IBKJ 4WIIA 2DXEA 3D4JA 3POTA 2XC9A 4LF8F 4LIRA 5L1LA 4LF4J 1KEKA 1X9SA 4H54A 2IYIA 4Z2XA 5M2UA 1TUGB 2DNPA 2AWZA 4TQRA 4OJ3A 1KSPA 1MSWD 1HMVB 1YJVA 3CC7S 1O6XA 3M2UA 3LP0A 4M5DB 4RBVA 3BV8A 3A3NB 1KLNA 1NDPA 2GX8A 2Q1LA 1UMJA 4ZJOA 5KT7A 2HZVA 2OLWA 4BC9A 3CCES 4MIWA 4TU7A 4A8XA 1RT3B 1HNZF 4C8YA 2PI4A 4MK7A 5A0YA 4DR4J 2V63A 2J7KA 3FBEA 3ZNUA 1CJTB 2IM3A 3R3TA 3WX4A 3O3LA 1S7HA 3PYFA 4FPIA 2XMMA 2NQPA 1SV5B 3KFWX 3U02A 4KAIA 3M6UA 1RT7B 4ETXA 4ER8A 1GAOA 4USTA 3IG1A 1FJ7A 5KG2A 7FD1A 4P72A 3FFIA 4DR5J 1J27A 3TANA 3PYEA 4ZPDA 4Y6IA 2XYHB 4CO3A 2HS4A 3V4IB 3GCXP 3ELHA 2MXYA 1RTIA 2LCWA 3GV7B 2WVFA 1DTTB 2AQ4A 3SMZA 4U8YA 3PW5A 4P7VA 1T02A 1FWPA 1N0UA 4OI1A 5CD4H 3CCMS 4NLXA 3PFOA 2JVRA 3IM8A 1BQMA 4P10A 1DQAA 1HFEL 3OTOJ 1KKHA 2D3ZA 4FVCA 3EDQB 2BRLA 2YX4A 4K4ZA 4TY8B 4LSLB 5ETNA 1NSKL 3TZXA 2CPXA 4Q45A 1DARA 2C3YA 2KJVA 2HURA 4GC6A 1FRJA 3QT5A 1HWKA 4I1TA 5BYRA 2K06A 3GV8B 1NK7A 2CPDA 1RB0A 2CQ0A 2OMOA 1K0TA 3VGUA 1F2HA 1SJ1A 2CPEA 2F40A 3HLUA 1WEYA 1SQFA 2RH3A 5KFCA 2W2MP 2DGUA 2CFXA 2GCFA 2IVYA 3BBFA 4F7VA 1NO8A 2HFNA 2NXEA 3MF5A 2KZZA 4BLGA 2B8QA 1UEKA 1NKCA 1QTNB 3UE2A 4F4ZA 4FBUA 2X1FA 1NHKL 1Q4RA 2M0GB 1IUJA 3S1TA 2RKIB 2UZAA 1CJUB 2RIJA 1XNRF 1R0CB 2XMAA 3AJDA 1ZA1B 1U0SA 1EQMA 2Y8WA 4DR1J 4JP8A 3TNVA 2LMIA 4M5NA 1U1NA 1RWPB 4YDDB 1FXLA 3KLEA 3V6DA 3W60A 1U47A 4NZ7A 2QX0A 3R5CA 5GMEA 4FYVB 2VA2A 1OSCA 1B70B 1RHKB 3N9UC 2DGTA 3A12A 3G9CA 4ECVA 2WONA 2B6AA 3R6GB 2CQ4A 2N82B 3CMQA 2P6TA 4U8VA 2E7XA 3S01A 4U67Q 2E7WA 2VJVA 3NNAA 1S6OA 2GGPA 1SUQB 3CJTA 4EZ9A 3PW2A 2XHWA 1N88A 3DRRB 4R8UB 4DSEA 5J2QA 1CG2A 1UVIA 5SUHA 4ECXA 5HVFA 4AL7A 4CO4A 3HFVA 1T05A 1TV6A 3OV7A 4OV6A 3LPEA 4MK9A 5KG0A 4M5MA 3EJMA 5A2QY 4F4YA 1NZ8A 4NCGB 1MNEA 4HL9A 3SCKE 3O6QA 2LXUA 2RS2A 4F0HA 3SDEA 1LWXA 3Q8RB 4CWBA 5KT3A 3EGNA 4ZJLA 4LMZA 1VQNS 1FNMA 5FLXY 1S6UA 4FN5A 5ETSA 4YP3A 4OJGA 1EP4B 3BDEA 4YN3B 3PR4A 2BQRA 2DNQA 4OZ1A 2YNFB 2XGQA 1NJXA 3GFXA 4EU0A 1VQYA 2JJ4D 5D4PA 3UCUP 4GKKF 3R1LA 1FRLA 2UUBJ 5L38A 2KB2A 3P5BP 3HMJG 2JHEA 4D3HA 2C2EA 3M30A 5CHCB 2IBKA 2ZKTA 4GKJJ 3PM9A 2V2ZA 5J2PB 4ZPAA 3RAQA 4YY3F 5ETPA 1TKTA 2F4VF 2OFHX 1NK0A 3TAMB 4OYZA 4OX9F 1IKXB 3TA1A 4H4OA 1ZM9A 2IC3B 2HFVA 3NGSA 4C8LA 4ES3A 5J2MA 3ZO7A 3TP2A 3HFKA 5I3UB 4V19J 1IJEB 4K2XA 3AY0A 4KGVB 3C15A 3U1LA 1ULRA 3RB3A 2PMHA 2XMTA 2UUTA 4NASA 2M70A 5IFMA 1NMEB 2GFFA 3QT7A 4RUAA 3RJMB 2ZHOA 2ROGA 2RE1A 4IYQA 1L3KA 1Y00A 2F63A 4RL1A 5L9NA 4KE5A 1VC6A 3UDCA 3VGTA 1TAUA 3MAQA 1VIOA 2MZJA 1NNDA 4MIBA 3QYYA 2VPWB 2W9AA 1CS4A 3CJSA 3VALA 4ZS6A 3NMRA 4RLEA 4HHJA 4DL6A 4KBIA 2MKHA 1RAIB 3I5BA 3AQPA 4KHPF 2WRMA 3I31A 1Q5YA 1Q0NA 3AJ2A 2BX6A 1YJRA 4N76A 2BJ3A 1UVLA 3MCSA 5KT2A 1QM9A 1N33F 1H72C 3S7RA 1DQ8A 3HHDA 1AA1B 1IQZA 1T03B 3QIPB 2E9TA 4PG8A 2I6WA 1YLXA 2B4OA 2EG2A 4J9RA 2R8IA 3I9V9 3G2XA 2YNGB 2HHSA 5AE3A 3LANA 4ZP8A 3WHIA 2WBMA 4BCAA 4DR3F 3SFUA 4ZLJA 1J2VA 4A48A 4DPOA 2UXDJ 4CTAA 3MPUB 3TI0A 1LFWA 5CA5A 4J9NA 2J6SA 3MAAB 3UFCX 1EZZB 2XMVA 3VHQA 3MURP 3DM2A 1U0HA 3PKMA 1HD1A 4P71A 3K5MA 4LF4F 1KP6A 4QIVA 1RKIA 1HWUA 4O44B 4H4MB 2HIYA 3MUVP 3MFHA 2L9NA 5B0EA 4F4XA 2J8SA 4B3SF 1R6VA 4AQYJ 3N6MA 2BJ8A 3I0SB 3QRQA 2OAUA 3UR0A 3KK2A 4O4GA 2UXBF 2QN6B 4J90A 9ATCB 1KOHA 2QIFA 1S1WA 1FX4A 3ITHA 2ZD1B 2JX2A 4OYWA 4X4VA 2POKA 4GO7X 1ZETA 2R2SA 2OSRA 1X60A 3C6UA 2FGOA 3E8OA 5HJYA 4QBUA 1YRUA 4KPYA 3KG1A 2HBQB 1ZTWA 2YTCA 4X4RA 3ENVA 1SC4B 4K0KF 1BE4A 4EEYA 4KIAA 4ZPWR 4DV3F 4MKBA 4DPUA 4R5PA 2ZBQA 2XSJB 3KLIA 4DR6F 3CSKA 3F41A 2OTLS 2YH0A 5HP1A 1HNWF 2M7SA 3UNGC 5KT5A 1W2BR 4J9MA 2V6AA 5E3PA 3TJAA 3D6TB 3DLHA 2ACYA 3MTJA 2JLGA 5E5NA 4FF2A 4TQSA 2DRDA 3CCWA 5A76A 3FMWA 3MM8B 1NRKA 4ITSA 4I6AA 5K8NA 3FEYB 2DEJA 3V6JA 1OYEA 2LYVA 2PD1A 2VHGA 1SJRA 1PJ6A 3A1YG 4K8RA 2J5AA 1LW0A 3OBIA 1SJ4P 3OTOF 2CYYA 3EGVA 5LSLA 3TZZA 4X4NA 3Q86A 4CRJA 2RT3A 3NCRA 1F6TA 3DRPA 4UUXA 4B9VA 4B9LA 5ETLA 3D5MA 1GMVA 2GS8A 2OPPB 4UQGA 1LFPA 4RW6A 1JLQB 3EDRB 3OFEA 4FDFA 4J9UE 1AFIA 2CZVC 2DD8S 3PTWA 3RUBL 4Q5VA 5DZ7A 4DSLA 4ILRA 1FA0A 1LWCB 2K7KA 1UL3A 4DUZJ 5FLXU 4G1PA 1VQ4S 2QE5A 4MIAA 2JFDA 5C7PA 4M8LA 3A3PB 4ZVQB 1M5SA 4WP3A 2MJUA 3WQPA 3FMBA 4F3QA 5ETTA 3THTA 2XSFA 1S1UA 1DQ9A 3BSAA 1JLBA 3BZQA 4QZVB 3PG9A 1XJWB 1M0SA 4RWXA 3M8WA 4ZIWA 2M9KA 4W98A 1JJ4A 4DR1F 2NPFA 4IFVB 3EGZA 3FNNA 3O1LA 4WE1B 3SCIE 4NLTA 1Y11A 2CQBA 2FZCB 2BABA 5L39A 4TU9A 2OMLA 5D3GA 3AHPA 3N4WA 1FJEB 1IWGA 2MZQA 3MMJA 4DL0C 4NOHA 4EFAC 4KHRA 5LMUJ 1R0AA 5ETRA 4CLWA 1RBLA 3IWLA 1BWVA 1RWWB 3CVKA 5EHHA 1VISA 3KHGA 3A8KA 3D6FB 5GAHU 5KT6A 1WDTA 1L3UA 1X4FA 2ATCB 3KJNB 3M32B 4DZDA 1ZA2B 1I5OB 1NSPA 3VGSA 4NLWA 4DLEA 4K50A 1UFKA 3IS9B 2RAQA 5LSOA 3NAHA 2DISA 4OYIA 4ZITA 1F2GA 4CYUB 2BW2A 1R8HA 3QPIA 4E0DA 2C22A 2BE2B 4ZP9A 2YKOA 2IIHA 1CULB 1Y9OA 3FCWA 5F8MA 2GAGC 3EE3A 1VJQA 2D7SA 4OJHA 5RUBA 3CTRA 4K5RA 2UUAJ 2K3IA 3KK3B 3J7ZT 1RABB 1S79A 3ILLA 4IOAQ 3CD5A 1F3FA 3BGRA 2P9CA 3ADAC 1KWMA 3MMCB 2VG7A 3QSIA 2VUGA 4U95A 4NEZA 1MU2A 4X65J 3PIOQ 4ZMMA 5ADZA 4X2BA 1VDHA 4PWUA 4RNNA 4I7FB 1UP1A 1J5OB 2W2QP 1SIWB 1YG0A 1TKXB 1XQIA 2MB0B 4XAKA 2DHGA 4XO0A 4X62J 5KFVA 2UVVA 2HAIA 1TFYA 2M52A 1A9NB 2IJFA 3UO0A 4I6YA 1URNA 3Q89A 2JWNA 4V19X 1B7YB 2MYFA 2WSCC 2CAJA 4HACA 2HWTA 2VQEJ 2V9KA 5FJ4A 4RKUC 1NJIT 1GMWA 5B0DA 3R6LB 1KC8T 1RAJA 1I1GA 2GW8A 3MMAA 1JQGA 1PYTA 1R27B 3G87A 3POTB 1N32J 1T3NA 5CH7B 4C3KA 2Z8QA 2CQGA 4NLOA 4M95A 4LF7J 1OWXA 1PAEX 3W9HA 1YIJS 2IY5B 4OX8A 3HHKA 2MQNA 1M5OC 2DIUA 1QUVA 1RP5A 4ID5A 3KLHA 1QSLA 3M2UB 1NZAA 3LP0B 4M63A 3CCTA 1IKWB 2XMKA 1P8GA 4NRUA 3D66A 3LH2S 4ED5A 1GEHA 3PKYA 5CCMA 2ASJA 2E7VA 4U9RA 2XMJA 2AX0A 5A0YB 2DR9A 1AUDA 2KXNB 2ZDPA 1G2EA 1SI9A 2CKWA 3B82A 3FCVA 3R5BA 1A0OB 1C0UA 2VFUA 2ZBIA 1VC0A 5KFXA 4OL8A 1EJ7L 2FIUA 2HGLA 2FVQA 5ETKA 2VPYB 3JQKA 1S57A 3E51A 1MMLA 1O51A 3TUIC 3V5RA 3AH6A 1SH3A 4NMLA 3FFIB 3WIVA 3HSDA 4HTIA 4F0MA 3CC2S 3NY0A 3J80Y 5D77A 2IA0A 5L9XA 5CYQB 3DGVA 3FKBA 3JSYA 2XZTB 1RTIB 4AQYF 3CCZA 1HHSA 2R7WA 2H51B 4B3OA 1N8RT 1NEEA 2RQ4A 1WUUA 5IT4A 4JB8B 1JNZB 1YJNS 5I4MA 1BQMB 4ID8A 4ZOSA 5E33A 3W5XA 4KKOB 4Y2AA 2X51A 2HFSA 4BBYA 4DSKA 1UPPA 1TL1A 1XIQA 1FXDA 4NXMF 2A1BA 2VBZA 3OVBA 2CG4A 4CO5A 3BJYA 2XBPA 3TAQA 3CJ3A 1WORA 2IBOA 3CMES 5F8IA 5H9FK 3MR3A 3PRBA 2EC0A 3SBMA 2QTWA 1ZZFA 1HHTP 3BEGB 4OI6A 5CYMA 2M2BA 4YUDA 4PG5A 4CT8A 4C11A 2C3UA 5F8NA 2BEFA 4U7CA 1GTEA 2CJKA 3PRVA 2CWXA 4OX7A 4YR2A 4DJBA 1RBAA 4F2SA 2GC8A 3VAFA 3M6WA 1RCOB 4A8QA 2V8DA 4OIXA 3DOMA 4DV4J 2VG5A 5HBMA 3KLEB 3BO3A 3V6DB 1JKHA 2G13A 1F9EB 2QA4G 2XTJP 2KT3A 3G6VA 1TL3A 2DB1A 3H25A 4I4BA 4CZCA 2ZZTA 2WONB 2CRLA 2B6AB 2V94A 3OJSA 3TUZC 3HVWA 3W8PA 1LXNA 4DUZF 3JSRA 2C3OA 3JS9A 4DQIA 5L1KA 2VDHA 1JXEA 4QOTA 5J2QB 2HQDA 3VZHA 1IKVA 3BO2A 1Y5NB 1T05B 1TV6B 4X4UA 1FKPA 3LP2B 5LSRA 1U1RA 1RAGB 1VRQC 3K58A 3I0RA 3X1LB 3PEHA 1TL7A 1H2VZ 4IQMA 1C4AA 2RS8A 3EGWB 4PCQA 5D8HB 4PG4A 4ZPBA 1HWIA 5HATA 2VFSA 3H2UB 2CADA 3UPFA 1B0TA 1T0TV 1WI6A 2PC6A 5IV3A 3K59A 3G4SS 2HHXA 1VHIA 2FTRA 2QJ3A 1QJHA 5KFTA 3P3DA 3CCUS 3ZZYA 2XGPA 2E5LF 2I9SA 3ENWA 2GO8A 3M30B 4DR2J 3LGNA 3K8WA 4X4SA 4M5JA 2DEIA 4DV7J 1TKTB 2OELA 4Z37A 1AW0A 1O0PA 4H4OB 4A8MP 1RTDA 1FCAA 1V3SA 3PJWA 3HHLB 4QYRA 4DG1A 4DDFA 5J2MB 2GJ2A 3MEGA 3OL6A 1Z2ZA 3CD7A 1XNQJ 5AXNA 3K0JA 4YQWA 5C2CA 4P73A 4I2QA 2BRKA 4C97A 3OUYA 1HBMA 2CZ9A 3ISND 3C15B 3FUYA 4KO0A 1U45A 1KFDA 1WKKA 2V2QA 3HD2A 2CJXB 4ZHRA 1TUWA 1LW2A 2YWKA 3L7OA 3W2WB 4CNZA 4LREA 2UUCJ 4YHHF 4ZVOB 4F50A 2NUHA 5E7OB 1F3VA 3TVYA 1ZBTA 2YX7A 1UEUA 1CS4B 3VQSA 4CH1A 4ED7A 1N5YB 2DK2A 2RSQA 2C2RA 3CT9A 4RZRA 1YJUA 4CLTA 2MHEA 4ZA1A 4X65F 5GAEI 2ZNZA 3ZZRA 3RR7A 2YPZA 2MPUA 2VDIA 3FBFA 5F41A 5J2NA 3NS5A 2BW7A 4OV1A 1M5KC 3THPA 4X62F 4FF4A 2K1RA 5BYSA 4L3KA 4P2FA 3TOQA 2K8GA 2EKYA 3CJ0A 3GFHA 4Z7YA 3J81j 4RUHA 3MOZA 1B0PA 2H9ZA 3SYZA 3OL7A 4MKVA 2GIFA 3CDEA 4XDCA 3MECA 4I56A 1FESA 2HHHJ 3KJQB 3CJQA 4JV5J 3UD3P 2HHWA 4CTAB 2PE8A 4TXSA 4RW8A 3TR5A 3IRWP 4V1Ak 4MAKA 1N32F 3DM2B 4O3RA 2R42A 1RT5A 4RW9A 4P6QA 5D4NA 2QSFA 1RGVA 1FK9A 4KYZA 2CQPA 2BUNA 2YQ3A 4PABA 2AJ2A 4CO2A 2ZZMA 1WEZA 1IKYA 4IO1A 4NLSA 1PBAA 4DQQA 4DS4A 3NS7B 4O4GB 2EKNA 2AZ3A 2KKHA 2NPIA 3TQ1A 1V5VA 2C28A 1XR7A 2KM8C 1S1WB 4QCLA 3ITHB 3UI3A 2U2FA 5DRKA 2HGMA 2MY8A 1XC9A 3C6UB 2OO4A 1WG4A 3BB5A 3MCMA 1LK7A 1HYSA 3ILOA 4O0IA 3T41A 1V3ZA 3DCAA 2LEAA 3Q8VA 1XR5A 2DHHA 1KVIA 4R5PB 2KFNA 3OVSA 3PR5B 3KLIB 4H4KC 4DQSA 2MKSA 5HP1B 3AD9C 2EFGA 3MEDA 2KT2A 4NLVA 3DI6A 1YVFA 1CLFA 1CQNA 1WOOA 2IM2A 4PG6A 2HHPA 3R27A 3Q22A 2L3MA 3MCOA 3VWSA 4B9SA 2W9BA 4KJIA 2XY5A 4JUZA 3A8EA 3R5JB 3UDLA 1S0VA 4LUBA 4AYBD 1S7IA 3SFGA 3MPYA 1WHVA 1JK9B 4DX8H 2VASA 2JRSA 3IR7B 4NYZA 1UEVA 3C19A 2JH3A 3NGTA 2ZUGA 4BC7A 4CLZA 1LW0B 1IR2A 3MM6A 3CCQS 3C14A 2OKQA 3EXYA 2Y1LB 1TMJA 2YKAA 2KTQA 2C3MA 3PFEA 1KR4A 2XO6A 2CPZA 1XN9A 2V68A 2MQPA 3EVOA 2DRBA 3D0GE 3MUMP 2HYIB 4DLGA 3D6HB 4RUCA 3DRPB 1ICEB 3EMTA 2HGNA 2JSXA 2FHKA 3G6XA 1HNVA 4L74A 3DLEA 2LQBA 4RW6B 3FSXA 2D1CA 2Y1RI 4LQ9A 2XYPB 1N6QA 3SZ2A 5F0UA 1LV5A 2YKQA 4W92B 2OHDA 1PO6A 4OZ5A 2HVDA 5DDPC 4WYLA 1FEHA 1VJWA 3B4MA 4TYAA 4G1IA 3T1HF 2MKYA 5KFDA 1S0MA 2WK4A 4DX6A 4BHQA 5L8RC 2MSSA 2HRTA 3G6YA 5KFNA 1S1UB 3DDNA 1JLBB 2I0XA 2AEJA 3PRDA 2LQ8A 4B9NA 3CE8A 3CJ2A 2MZ1A 3KTQA 2B4PA 4LF6J 3NG8A 4DUYJ 3QJLA 1W26A 2GVDA 3MWBA 4UOCA 4IRCA 1D9AA 2W1BA 3DXSX 4DL7A 3QAUA 1NDKA 4OYPA 4JBCA 4DV4F 2DNYA 5A6WA 2OEMA 2RU9A 2ZDOA 4TN2A 4CP5A 2CNKB 4X4OA 1TK5A 5D3GB 1U1OA 1RT4A 2W4PA 3J7Z5 3JAMY 4HEA9 2KVQE 3NCPA 3MMBA 2MTLA 1RAOA 2BV3A 2WVCA 1FWLA 2ERRA 2QEXS 3DLGA 2W2PP 1R0AB 4PXCA 3OTCA 1BGXT 3ULHA 2LFVA 2XZWA 4C8ZA 3BQ1A 2GZOA 2WVEA 1ZOTA 1RAFB 1RLDA 4ZDNA 4YMEA 2IAJA 3MAHA 2A10A 1VBZA 2R2UA 1OYDA 3PW7A 1HR0F 1FDAA 1FNOA 4YEAA 2H5EA 2ZVIA 5MLCV 5D0HA 4NXNF 2A3JA 1X4EA 2DNMA 2ZHAA 4LR9A 2MZTA 3A3OB 1WEXA 4QR2A 1DZ5A 4X64J 2CNLB 4W4MA 3CIMA 1SPBP 2J76E 4DR2F 4DQRA 4K4TA 3BGRB 3PX0A 2VG7B 4N41A 4DV7F 4NLYA 2WW4A 2W7OA 2J9CA 1MU2B 2Z57B 2C2NA 1NPRA 3W66A 3DMJB 2GV1A 2CJQA 1VBXA 2QLFB 2R7OA 3CCLS 5GMKa 2VBXA 3E3XA 1K73T 1OY8A
chains in the Genus database with same CATH topology
1L3KA 2E5HA 1Y00A 4C8KA 1EETA 3IAS9 1Q16B 3MD1A 2JEGA 1ZPWX 3IGVA 3M6VA 4L6V3 4USHA 4ZCIA 4OZLA 2EFVA 5L9NA 2CQ2A 2UV8A 2R2RA 4YDXA 2CQCA 4LIWA 4KE5A 3KLVA 3MM5A 3TUJC 1HI8A 2CIMA 4PUOA 1VC6A 3UDCA 2VODA 3D0IE 2MKKA 1J5OA 4Y34A 1YI2S 4ILMA 2J9DA 5CYJA 2N4CA 4ZVHA 1NK6A 4B3TF 3WZ0A 5HLFA 5DQIA 1TAUA 2AYBA 4C7QA 1TKZB 2ZH8A 4LFAF 3MAQA 1VIOA 2MZJA 4O3NA 1NNDA 4MIBA 1N48A 2ZH1A 1U24A 3QYYA 4K4SA 2VPWB 2W9AA 3MI7X 2HPUA 3CJ5A 3GE9A 2SXLA 2MSTA 3DC2A 3G8SA 4UY85 2QA4S 1F9FA 3VALA 3NRBA 4ZS6A 4KTQA 1UETA 2DHSA 3NMRA 4RLEA 4QR0A 4HHJA 4DL6A 2X1GA 3T1AA 2DGWA 2HNZB 3H2VE 4KBIA 2EFNA 2MKHA 4DMZA 2XLJA 3CCSS 1XWLA 3MPWA 2B4UA 1KONA 1VQKS 2RRNA 2LA4A 4IQXA 4MK8A 1C2PA 3AQPA 3I5BA 4KHPF 2ZH2A 2WRMA 3I31A 3GYXB 5KG3A 3H5SA 1V6HA 4AUKA 1VQLS 4E8UA 1DLOB 1U2RA 3MEEA 3AJ2A 3MECB 1NHVA 3TRGA 1GTHA 1YJRA 2FLNA 5EWEA 3W3SA 1R8BA 2BJEA 4N76A 1YRTA 2X3GA 4DFPA 1UVLA 3MCSA 5KT2A 1QM9A 3KLGA 1N33F 2BQ3A 3S7RA 4ID5B 3L09A 3KLHB 1FEEA 3SV3A 3KJVB 1T3OA 1JMTA 1DQ8A 3HZEA 2YWEA 3BR9A 3HHDA 2DGSA 2KI2A 3BN4A 5I3QA 2ZH7A 2J0SD 1IQZA 5KFJA 1T03B 4J9KA 3QIPB 3KKFA 1HQUA 3M4XA 2E9TA 4PG8A 1SQEA 3MM9B 2R7RA 1KD1T 4LF5F 3HJFA 1SC6A 5F8JA 2KFYA 2R7SA 5DO2A 4HKQA 5LJ3Y 4BWMA 5B0FA 2B4OA 3J7YU 2EG2A 2XG8A 3I4HX 4J9RA 3SI8A 2R8IA 3I9V9 3ZZTA 2ZM6F 1R31A 3KNGA 3KMSA 3HP6A 2YNGB 2HHSA 5AE3A 3LANA 4HI1A 2AD9A 2CJ9A 4ZP8A 3BS9A 4I67A 3NNHA 5EWGA 2OPSA 2WBMA 3QLHB 2IM1A 4BCAA 4DR3F 4Y65A 1IXKA 3SFUA 5KFKA 3IR5B 2XI2A 4C0BA 4CIOA 4OMFG 1J2VA 4I68A 1GQEA 4A48A 5DM7Q 2W25A 4DPOA 2ROPA 2RRAA 3HX9A 4CTAA 5E41A 2HHHF 1IN0A 4YB1P 3TI0A 3OFFA 2FPHX 1LFWA 5CA5A 5L1IA 4J9NA 2J6SA 1IKWA 1SL1A 3UFCX 3GQCA 2XMVA 2V4QA 2I8EA 4Y2CA 4DHVA 3H98A 1FE0A 5K14B 3MURP 4DF8A 2GQQA 2CZ4A 3DM2A 2DJWA 3WC0A 3PKMA 2RQKA 1HD1A 3K5MA 3QO9B 4LF4F 3FGVA 5DLGA 4C4WA 1UA0A 1TFWA 1LWEA 1FNXH 3AB4B 2BJDA 2B0GA 1FD8A 1NB7A 2GMHA 2OSQA 3PW0A 3M2VB 1HMVA 3NLCA 1UFWA 5F0WA 1VQPS 2HRYA 3F73A 4QIVA 1CPZA 1RKIA 4MYUA 5IWAF 1WACA 1HWUA 3I9ZA 4M5DA 1R3NA 5C42A 4O44B 4H4MB 2MHNA 4TLQA 3BSCA 3MUVP 5C24A 3MFHA 4F4WA 2L9NA 5B0EA 4FF3A 1HA1A 2VBWA 3I6PA 3LAKA 5DJBA 4F4XA 1Q8BA 4KSEB 3PNIA 4ES1A 2VFVA 4EWTA 4B3SF 3ISNC 2UXDF 2RILA 3TX8A 2JLEA 1WI8A 3OR2A 2LU1A 4K4WA 2Y0SD 3N6MA 1FDNA 3MM7B 1NK5A 3DU6A 3SEOA 5DG8A 3DOLB 3I0SB 1TL4A 3IG1B 1SJQA 2XO7A 3M8SA 2EFOA 2OAUA 3UR0A 1RT3A 3SQGA 3VQTA 4O4GA 3KK2A 2GO9A 1LWFB 4BDPA 2UXBF 4IH7A 1KOHA 2QIFA 4B3OB 4IOBA 1ZTWA 1JLAA 2UVWA 3LOUA 3DOKB 5EDWA 1S1WA 1RQ0A 3ITHA 3LWMA 1MMNA 2ZD1B 3PW4A 2JX2A 3RU0A 1Q1KA 3PJXA 3RB0A 5KFUA 1WTBA 2QT7A 4W90B 4X4VA 3M9MB 4Q44A 2DPJA 4LSNB 2UV8G 3MZIA 1JLGB 2POKA 4GO7X 3RBDA 1ZETA 1TK8A 4B9MA 2DR5A 2R2SA 1U4BA 1SV5A 2YNIB 2OSRA 1U1QA 1T7PA 4N47A 2NSBA 4WYWA 2WTFA 5JVGQ 2YNHA 2VPZB 1RT7A 2FGOA 3C6UA 3E8OA 5CYQA 3SSSA 2KG0A 2UVRA 3BQ2A 4JI2F 4QBUA 3OTEA 1YRUA 3RB6A 3MFIA 4KPYA 2QLXA 2D74B 3KG1A 5KOXA 1HBUB 2MJNA 2YKMA 1S9GB 2M88A 2LXFA 2O67A 2YTCA 3D28A 2QA2A 2Y1JA 4X4RA 1R89A 4RNFA 1Y7PA 3ENVA 2VC0A 4K0KF 1HQEB 1NAQA 4AL5A 1XEZA 4EEYA 1SXLA 4A8KA 5L1JA 1QLNA 4OJ1A 1DRZA 4KIAA 1TL1B 4ZPWR 4DV3F 4C98A 4MKBA 4CH7A 4R5PA 1KFSA 1Q53A 2YWFA 5J1NA 4L72B 3PIPQ 2D9OA 1RI7A 2QRRA 2XSJB 3KLIA 5LXYA 4DR6F 3CCRS 4B02A 3CSKA 3F41A 2ZH5A 2OTLS 2YH0A 5HP1A 2W8LA 4ECQA 4OZ0A 3V4IA 2BXJA 1SJFA 3JYTB 1X4CA 5KFSA 1HNWF 2M7SA 3UNGC 5KT5A 1RK8A 1W2BR 1KLMB 4IKAA 4Q43A 4J9MA 4ED6A 5F9LA 2DH9A 5C25A 5E3PA 2XEXA 1OQ3A 3DLHA 1DTTA 4ZPTR 3MM6B 3VTIA 5KG7A 2ACYA 4KKOA 3HVAA 5IM0B 3MTJA 1SL2A 2MMYA 2JLGA 1LKZA 4JI6F 5E5NA 2LQ9A 1NKEA 4FF2A 4TQSA 3C66A 3N79A 4RW7A 3CCWA 2WCXA 4WJBA 1DJ0A 5FDLA 3QJJA 4OI3A 2KRRA 4ED3A 2D3OR 3FMWA 4LFCF 3MM8B 1X4GA 3VAJA 1NRKA 3GG0A 1KN6A 2JEIA 4ITSA 1N34F 4I6AA 2AJ4A 3CDWA 5K8NA 3OQ2A 4LQ3A 4O3OA 3OL8A 3FEYB 3DLJA 4KHMA 2IHR1 1I94F 1MWZA 3V6JA 2XS5A 4O3SA 2PD1A 1VRTA 2LYVA 3QMQA 2FB0A 2E9RX 2XB2D 2BANA 2ZOGA 3MGJA 4NX9A 4RWWA 3N0VA 1ZM3A 1SJRA 5KAKA 1U1KA 5CYMB 4FXDA 4XK8C 5DM6Q 4H4KA 1KNZA 3A1YG 1QE1B 2J5AA 3GIMA 4C11B 4PRFA 4CQ1A 2HWHA 3GB0A 1LW0A 2XCAA 4KQZA 3OBIA 4LSLA 3LF0A 7FDRA 2DH7A 1SJ4P 3GILA 3OTOF 2WAQD 2CYYA 2V9WA 2LDYA 2XI3A 2G4BA 1WD6A 2KHDA 4ZCKA 3FJ2A 1N6QB 2OH2A 3FEXB 3Q8SB 5IQQA 4YB6A 5LSLA 1H7WA 2XMWA 3K7RA 4P7TA 3C3LA 2RF2A 4HYKA 4DWIA 3Q24A 3OSPA 4X4NA 1C0TB 2HQIA 2HVIA 3I96A 3WC2A 3HK2A 1OPIA 1V3RA 4NPOA 1GXTA 2AV5A 2RT3A 3IRXA 3NCRA 4FS2A 4GC7A 2JOQA 2CPYA 1VRUB 3DRPA 4UUXA 2DVIA 2ROEA 2B5JA 4XPCA 2IA6A 4B9VA 1U49A 2HVHA 1FJCA 4B9LA 2QFJA 2BACA 3N5FA 3D5MA 4I6WA 4F67A 5B0AA 2VG5B 5B0BA 2GMJA 2OPPB 4UQGA 1GXUA 3N6NA 5K9FA 1LFPA 4RW6A 1JLQB 2E9ZA 3G8TA 1TVRB 3W2VB 3TVZA 3P5TL 2L9DA 5HO4A 2AF6A 1KTQA 2HNDA 4JI8F 3OFEA 5KTQA 1SB6A 4IG3A 3OL9A 2CZVC 1OQ6A 1XTZA 2DD8S 1AFIA 2L48A 4J9QA 4URSA 1X5OA