3G82B

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with mant-itp and mn
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
199
structure length
189
Chain Sequence
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 2',3'-(O)-(N-Methyl)anthraniloyl-inosine 5'-triphosphate is the Most Potent Adenylyl Cyclase 1 and 5 Inhibitor Known so far and Effectively Promotes Catalytic Subunit Assembly in the Absence of Forskolin
rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
molecule keywords Adenylate cyclase type 5
total genus 50
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3g82B00
4OYAA 1Y10A 4WP3A 4P2MA 1YBTA 4CLYA 1TL7B 1FX4A 4WP8A 3C16A 5IV3A 1WC5A 5D0HA 5D0EA 4OYZA 1WC6A 1CULB 4NI2A 2GVDB 1CULA 4OZ2A 3G82A 1CJUB 4P2FA 3C14B 4CLSA 4CLWA 1WC1A 4WP9A 1CJVB 2W01A 1CJTA 5IV4A 1CJUA 4OYPA 1CS4B 4NI2B 1U0HB 3C15A 2WZ1A 3UVJA 4CLPA 2GVZB 4CLKA 3MAAA 4USVA 3MR7A 4CLZA 3MAAB 1AZSB 1YK9A 4OYOA 4CLLA 5D0RA 1CJTB 3UVJB 2BW7A 3C16B 4CLUA 2QV6A 4OZ3A 1WC0A 2GVDA 1WC3A 4CM2A 1CS4A 4CLFA 4USWA 4OYMA 3C14A 4WPAA 1CJKA 1FX2A 3ET6A 3G82B 3R5GA 4OYIA 1WC4A 2GVZA 4OYWA 1CJKB 4OYXA 3ET6B 1CJVA 1YBUA 4USUA 5D15A 1TL7A 1Y11A 4USTA 3C15B 1U0HA 5D0GA 4OYBA 1AZSA 4CM0A 1AB8A 4P2XA 4CLTA
chains in the Genus database with same CATH superfamily
2K06A 3BBBA 1S9GA 1GQEA 2FZGB 2PA3A 2D7SA 4LREA 5DQIA 1NPPA 4WK1A 4ANEA 2XO6A 4N76A 4WP3A 1NZAA 5DG9A 4MKBA 3MOJB 1YJVA 2YBVA 2UXBJ 1NHVA 1N32F 1T02A 1S7HA 2K7KA 2H51B 1S1VB 4WFAQ 4KGXB 2DH7A 3HLUA 2R7WA 1RTHA 4ID5A 4OFZA 4K0KF 3MMCB 1LXJA 1NLKL 2MY7A 1RU1A 4TNOA 3F44A 2HGMA 3EPIA 4ECUA 2N7YA 1FDBA 4NLUA 2E5GA 1F2GA 1RYRA 1CULB 2JDJA 4M5DB 3CCQS 5J1EA 1MROB 1YJUA 2EXUA 4DLGA 3O5TB 2H4WB 4OZ2A 5L38A 4PCQA 4ERDA 3IG1A 4DV4J 2AF6A 3T9NA 4P2FA 1WEXA 2OI2A 4IG3A 2KHDA 2V8HA 5KFJA 4USJC 2XLIA 3TQ1A 1P27B 2L9NA 4OQJA 4LFAF 4QWBA 3UQSA 2OMOA 3BM7A 2WSCC 3L9ZA 4O3NA 3J7ZT 5KFPA 2L41A 2CUYA 3VGVA 3ZTQA 4OYPA 1MSWD 3C19A 3G6ES 4QYZK 3PKYA 3IWNC 3KJNB 1X4HA 1TKDA 4MJKA 8AT1B 2VJUA 4HDHA 3PRVA 3KWMA 2V8VA 1CC7A 1T95A 2BA9A 3ETOA 2RHQB 4J7CA 5CZVA 4EUVA 4DX6A 1UWAA 4IUFA 2FJEB 1U1NA 1YIJS 2VA3A 1X5SA 1YRXA 3NLCA 5KFNA 4B3RJ 1LWFA 3JSMB 2JFDA 4WTOB 2WVFA 3GJSB 1TUWA 2Z8QA 5IT0A 1U1PA 4Q2LA 1H74A 4TQRA 2KT2A 2Y1RI 4HHHA 4DX5A 3PHEA 4DR4F 3PG9A 4O4RA 1DAXA 2HFZA 5SZTA 1NK9A 3M6VA 2UUBJ 3MHYA 1EQMA 3D28A 2A10A 3T1HJ 4NRUA 1QDUB 3KUEA 3HHLB 3L95X 2A2DA 4H4KC 4JUZA 2UUTA 3EM1A 3TW0A 3I32A 4TQSA 2XMUA 3K57A 1U8WA 1Y4ZB 2OP5A 5HVHA 2H65B 2FJVA 3G6YA 2G1HA 4K5SA 3EXYA 4IG0A 4DV7J 4ZP8A 2EWHA 3MEDB 1FRLA 1DQAA 2ZDOA 2OGUA 4JYAJ 2YNIA 4ZCLA 2E1CA 2QTWA 4EYIB 1QAXA 2I9SA 3RB6A 1TK5A 4OX9F 4C8YA 5F8HA 5B0BA 1RI7A 2ZITA 3JXOA 1WDTA 3K58A 3CJQA 2XZWA 4G6VB 3X3UA 2HG4A 5B09A 5GADU 4F2SA 4FF1A 3UDVA 2NCKL 5DJBA 2J6UA 4KYZA 1XR6A 2OFHX 3I0SA 1B99A 5LL6d 2CWXA 1NKBA 3CEDA 3P49B 1U47A 1WG4A 1UPPA 2MQQA 1QSYA 4BC9A 2BJEA 2V34A 2HRTA 4LFCJ 2H5IB 1U8SA 2YWKA 3EUNA 5GAEI 3VQSA 4DV0F 4PPZA 2RAQA 3GYGA 4NLXA 4OZJA 4ZPTR 5ETLA 4YMEA 3CNQP 1HHSA 3DDNA 3OTDA 1CPZA 2Q43A 1RWXB 1OWXA 1VDHA 4ID5B 4RR5A 3PVXA 4C0OC 1K1SA 1SH3A 1Y5IB 5DO2A 2AGQA 5IWAF 3PRBA 4L73A 3PIPQ 1DARA 1TKTB 2ZE2A 5IXUA 3VAKA 2DR6A 3G9CA 2CQBA 1VQKS 2FHOB 5D0GA 3BR8A 2MSSA 3QSIA 4OYBA 2Y1JA 3HX9A 2MY8A 2V0NA 4OZ0A 5CHCB 3Q2SC 3MPWA 3VALA 4CLTA 4YOEA 1DTQB 1KOHA 3C3LA 3HO1A 1HIYA 3JYTB 1S0NA 2FDNA 4L72B 1RA7A 2XNQA 2VBXA 1HNZJ 2XZDB 1KHVA 2VOOA 2MZRA 1TP7A 2JWNA 3D1QA 4NLVA 1CBKA 1VC5A 4JI7F 1IM4A 2PT0A 3I6PA 4KO0A 1A7GE 3L4BC 3GMGA 2YX4A 5ETOA 3AY0A 5J2PA 1QSSA 1WTFA 5KFVA 1B64A 1VLYA 1VIXA 2EW9A 1DTQA 1N88A 2CNLB 2KH9A 2A18A 3W62A 4EBEA 3DMJB 1XNRF 3HK2A 1R0CB 3CD7A 3RW6A 2ZH7A 3N4WA 4O4GB 3ZTPA 2ZOMA 4Z7YA 5HP1B 3D67A 4F0KA 5FD1A 3OHBA 4RL1A 3DLHA 3N28A 1KC8T 3H4DA 1Q8KA 1NK7A 3KNAA 1BQXA 3JQKA 4LF4F 1FRHA 4FDFA 2RVJA 4JI6F 5IV4A 1F0XA 1SL0A 2JNJA 2FHKA 3NWRA 3ELHA 2OD6A 2AGOA 4V19J 3QFHA 2AKWB 1JLBB 1FRKA 2EFPA 1SJ1A 2HMIB 4B17A 3GPAA 4LSNA 4B08A 3M2RA 4EYHB 4X62J 1WJ9A 4ECTA 4DCJB 4U7CA 3UW1A 2NXJA 1AROP 2XMWA 4PXBA 5T7LB 5BR8F 2IM0A 2BUNA 4JBCA 4USMA 3KLVA 4ELTA 4XIUA 3GJRB 1H3DA 1IR1A 1JXLA 2RF2A 3IP0A 1REGX 2GVZB 2HAFA 2KO1A 3I9ZA 3JSBA 3IM8A 3UPFA 5IOLA 3KHGA 2ZHAA 1J5OA 4OHVA 2CJKA 2DBBA 4K4UA 4OI3A 3SCIE 1ZM2A 2R9LA 2DIVA 1IBKF 4EO8A 2DKOB 4B3TF 2JVOA 4ITSA 1RUSA 5T7LA 4CLZA 2DNQA 3OVAA 1ZM3A 5L9XA 5ETPA 5LSRA 3NEKA 3Q8SB 2ZJRQ 5H9EJ 1LNQA 4YHHF 4DL7A 2XNRA 3HHNB 1AFIA 2MQOA 2O67A 1WHWA 2CPYA 4OI2A 5DDPC 2BJ7A 4C0BA 3I4HX 1MNEA 1OYDA 2BKOA 1FRIA 1SV5A 3OLAA 1LWCB 4ECVA 4JV5F 1S48A 5DETA 5K5MA 2WHOA 1YWXA 3DYAB 2R8KA 4JI2J 3V6HA 3WHIA 4URSA 4A8XA 4LRBA 3VGTA 1OY9A 4FYVB 3TOQA 1S9FA 2VKRA 2XLJA 3LWLA 4W98A 3DGVA 3BGLA 2QA4S 2XS2A 5A6PA 1NUEA 4JI3F 2EFNA 4LF6F 2NQPA 2EI5A 1X0PA 4NLSA 5M2RA 3MURP 2CRLA 3M9OB 2JJ4D 2IAJB 1S6QA 1VBKA 2EBEA 2CPXA 4FPIA 3R5AA 2ZKTA 3CJ4A 3CXCR 4EEYA 3WIUA 2XGQA 4USHA 3CJ2A 3ITHA 2V50A 4L74A 5LSOA 1G4CA 4ECWA 1L3TA 2JC1A 2PD1A 4P2SA 1JLBA 2GVZA 1YJTA 2E5JA 2QL9B 2YNGB 3HKWA 3EDRB 3GSIA 2DHAA 5KG1A 4RW4A 3BDEA 4JV1A 3CWJA 3VZHA 1IJFB 1NSQA 1U1KA 2B4PA 4KKOA 3R9LA 4JI5F 1C1BA 3TAMB 3GIJA 3AA9A 3WZ0A 3H5UA 2ZJPQ 2GS8A 2CQIA 2RUGA 3OL8A 4QJVA 1Q8BA 2VFRA 3HHLA 4OLPA 2VPXB 2B0GA 3TA0A 5HP1A 2DITA 1B0TA 2LQ8A 2PMWA 4YS2A 3QRQA 1TELA 2W2NP 1RAIB 4DR3F 1VISA 4GVBA 2N82B 1NPKA 4QIGA 2MKCA 3NGRA 2XHWA 2AJ1A 2ZNYA 3POTB 1BWEA 5A8RA 2MB0B 2GIRA 4WCEQ 2ALYB 3LO3A 1HA1A 2CYYA 2C3YA 3R5CA 1RJJA 3NBPB 4QIVA 2DNMA 4DF8A 2CNOB 1T9WA 3QZ7A 1T9TA 2ASDA 3OTEA 2HIYA 4ZCKA 1KQGB 1EP4A 3I87A 3MMJA 4LIRA 4WP8A 5FDLB 5U47A 2MHNA 5T41A 3OL7A 1WC5A 3L7PA 2JEIA 5KOXA 4K4YA 1DTTA 3MOZA 3LP2A 4CI0B 3TJAA 3HVAA 2R2RA 3DU5A 3M7VA 4P71A 3KMSA 4DV0J 1X4CA 1Y3KA 2VPWB 3GV8B 4PQUB 3P3DA 1NO8A 2F40A 3US5A 1N5VA 2X1GA 1R27B 2G0CA 3BPDA 4TXSA 3Q24A 2VHGA 4DV6F 2HFUA 1O5JA 2MZQA 2VFUA 3K5PA 3E3XA 5J1NA 1RT2B 4CLWA 3V81B 5AXLA 2HVEA 3HI9A 3IS9A 3ICLA 4M5HA 1HNVB 2KXHA 4M5GA 1XMBA 5A2QY 3TX0A 4KQZA 2DHXA 1FE0A 5CQGA 4O3RA 4FNIA 4DR7J 3MR6A 1QY7A 1H38A 3OTCA 4C3MA 2HHVA 3C15A 2AZ1A 2VG7A 1JMTA 2ZE2B 1GMWA 2DCLA 4DPYA 1RT4B 4FF4A 2O5DA 1RWMB 3BGUA 1G1XA 9RUBA 2JEFA 2F65A 2NUUG 1M5SA 1EZZB 2WONB 4I69A 2MKSA 3PW4A 2QSFA 3QJPA 3CDWA 2D9OA 3FBFA 4GVBB 4Q8EA 1WI8A 4DL0C 1JLCB 3DLEA 3KG4A 3GCXP 4N5SA 2W4PA 2QFIA 1FJGJ 1IM6A 1WF2A 3AD7C 3B6BA 4CLKA 2W7OA 2K1RB 1BWVA 3FSYA 3IFEA 5IM0B 1DBDA 3CCRS 3RW7A 1RBLA 4DG1A 2I8EA 4J9RA 2YKNB 3C6TB 2J8AA 4FS1A 1S9EB 1QTNB 3RZAA 4J9MA 1CQMA 5EDWA 2YKPA 2HQFA 4FYDA 4IG0B 1AZSB 1GNKA 2V2KA 2OPRB 4DUZJ 4UQTA 2ZH1A 3AAWB 2OPQA 3LTOA 4HHUA 1ZAWA 1AW0A 1FE4A 2E1MC 3P6YC 2G1DA 2OD4A 2WRMA 1XIQA 1BGXT 3UE2A 3VV2B 3FFIB 2BJ1A 3H2LA 5FDLA 2YWFA 2XWYA 4CLUA 1IBMJ 3MWBA 2ROEA 1X5OA 4A8QA 1FKPB 2GQCA 1X4AA 2K3KA 2XSFA 2IY5B 2OHDA 4X2BA 3MECA 3CCTA 3RYLA 3P96A 1RU2A 3GG1A 1KDNA 2HRUA 3Q8RB 4DX7A 5EGYA 3E01B 4S0MA 3EVOA 5LJ3Y 4RNFA 4U67Q 2IIHA 2LXFA 4TY9A 1B0PA 4OIXA 5HO4A 5CYQB 3DLKA 4TU7A 4PYDA 1SC1B 2UVVA 2C3OA 2AV5A 2PO4A 3KLHA 2DIUA 3MF5A 1U2FA 3U02A 5EHHA 1IR0A 2ACYA 2CQ4A 4RW6B 2YPYA 4F3MA 4NASA 1RWOB 5HQ8A 3QLHB 4HYKA 3MCOA 1IBKJ 2HHQA 1SPBP 3VVUA 4Y34A 3ET6B 3MM9B 7FDRA 4Q5VA 2HW3A 3HD1A 5HVFA 1RLCL 1SC3B 3IRXA 4NEZA 4Y2AA 2R8JA 1JLFB 2GA7A 2L08A 4KV8B 3UWTA 3MAQA 1VC0A 4NCAA 2DEIA 1QUVA 3N01A 3S7RA 3CUNA 3PNIA 3SSQA 1HL6A 3GLJA 4U96A 2YWEA 4XPEA 5HATA 4LJMA 5C25A 4DQRA 1S4EA 3FK4A 4NX9A 1H6KX 3ZZRA 4UOGA 3N0VA 4NZ6A 2AGPA 3J81U 2IRUA 4NLQA 4Y28C 2MKKA 2I5JA 1NJXA 4DSFA 1S1VA 1TUVA 3BF4A 2VUGA 1Z4UA 1JX4A 2OJ3A 1LFPA 3S1TA 3QGIA 4ZA1A 4DS4A 3UD4P 3IR5B 2CPZA 2N3OA 1FNOA 4M95A 4GVLA 4H4KA 2AT1B 2CZ9A 2R2TA 4EI2A 5I3PA 1DZ5A 1RSCA 3C16A 2IYGA 2KKHA 5CYQA 2XMJA 5D0HA 5DM6Q 3KJVA 1DURA 4WTYA 1WORA 5IQ6A 4ED3A 2ZD1A 3F56A 1V3SA 3RRGA 2K3IA 2M52A 3ENAA 2GVDB 4F67A 4KHPJ 2AMCB 2CA9A 1ZA1B 2GO9A 5DZ7A 3W1YC 3O2IA 5DLFA 2HYIB 1VQYA 3TZYA 2MZ1A 2J7UA 1RKIA 1XBWA 4PAAA 2R8IA 4F26A 4DV7F 2R4FA 1YJWS 3LUYA 1HYSA 2OPSB 1C1CB 1CJUA 5DRKA 4ENOA 4IDKB 2R7UA 3KHLA 2CXEA 1M1HA 3J7YU 2G2OA 2VBZA 4JOUA 3F73A 1LKZA 3LWMA 3PW7A 1TAUA 2WZ1A 2OPRA 4XDCA 4RW8A 3TWZA 2GIQA 4JI0F 5KG6A 4BWMA 1U09A 3MTJA 5CYMA 3D1OA 4F3QA 4JV0A 1IKXA 2VDIA 4XO0A 4PUOA 2OSRA 1YJNS 4DZDA 1RYSA 3EGVA 3K17A 4WIQA 4DR2J 1L3VA 4DPXA 3QIPA 2FTRA 2V8GA 1Q7LB 2J7KA 3DKDA 4ZP9A 5F3ZA 1EB0A 2DNLA 3DRYA 2ZVSA 3I0RA 2YX7A 1FK9A 1U4BA 3Q83A 4MT1A 2ZM6J 1BXNA 4LBIA 4F2RA 3QQCD 2CQCA 2DCUB 1FDAA 4ETXA 5L9NA 2YQ3A 3M8RA 1PIEA 4G1QB 1BY9A 2B3TB 1U7LA 2ZOGA 2HEKA 1YK9A 1SIZA 3HSZA 3MXHP 4DS5A 1Y00A 2ZD1B 1GTEA 5D4NA 1RBOB 2GHVC 2C3MA 4PXEA 4UF4A 3K59A 4DV3F 4B9VA 5JJBA 3R2DJ 4O44B 5JXSA 4FBTA 4PYAA 3MMCA 4IH7A 3PDNA 1KOOA 3MFIA 2NXCA 2QG9B 2R3VA 4C8NA 2QV6A 4CYUA 1RADB 2CG4A 5K20B 1ZA2B 4K0KJ 2V2QA 1KVKA 4ED5A 1AUSL 1WC3A 2VL1A 2HLTA 1H2VZ 4ZIWA 5D4LA 3HHKA 4C48A 3DRSA 2IMOA 2XMMA 2ZFHA 1KRPA 4JI7J 1ZPWX 4E98A 1S76D 1T3OA 2GJFA 2E66A 1WF0A 4M8LA 3ZTSA 1N5TA 2VQEF 1F9FA 1U6FA 2LU2A 1T94A 4LR7A 1RTDA 2GHPA 4CNZA 1JLAA 1JKHB 1I94J 3SQGB 3NKYA 4LFAJ 4GC6A 2MHEA 2DNGA 1SKSA 2VODA 3A3NB 1C0UB 1DRZA 1JLCA 1HMVA 3LP1A 3D9BA 2LECA 3KOAA 3DHWC 4B3SJ 3M8QA 1HQ2A 2E5HA 3HVTA 1SH2A 1HQEA 5I3QA 2PC6A 1U0HA 4ZS6A 1YRUA 2D3UA 3EX7B 1GH8A 3IWLA 3OD2A 3OPKA 2FLOA 2CVEA 4CM0A 4H4MB 2BQUA 2J9CA 1PC4A 4F04B 2AWZA 3UCGA 3FRYA 4DR5F 5ETVA 5HLFA 4W90B 2CAJA 1Q82T 1RT4A 2J7WA 1DY3A 5HK4A 1QVGR 3BQ1A 3Q8PB 1S1TB 4Y2CA 1Q5VA 1RWVB 3Q22A 2WOMB 2E7XA 1V5VA 2H3EB 1H72C 4E8UA 2UV8G 2B5JA 2G2ZA 1M0SA 4Q2MA 4KBIA 4DX8H 3U1NA 1E6VA 2M3DA 2RRBA 3MUMP 3V4IB 3G71S 4USIA 5F8GA 2FPHX 3LALA 1LXNA 3ISND 1JLAB 1A0OB 2DRDA 3Q23A 4LFBF 2HRYA 2H54B 2L9WA 3THVA 5E41A 4ZVOB 4F50A 3KLIB 2XSJB 4CCHA 1LK7A 2GW8A 2M88A 1H0HB 3MM5B 1IQZA 3SCKE 2XBPA 3CD0A 5BYRA 1X5PA 4LF9F 2AX1A 1F5BA 4DUYF 3QWPA 1CS4B 2ZC3A 4H4OB 1G2EA 4NXMJ 1FESA 1U0HB 2I0XA 2DNYA 2IYIA 2NXUA 3DFEA 1RB0A 2V2VA 3MD1A 2UUWA 3NOGA 5FIIA 3RAMA 3QO9B 3H42A 4UUXA 4LFCF 3TA1A 4NA1A 2W9CA 1NRKA 1JB0C 2B8PA 3H90A 4LRFA 3BSOA 4WJBA 1HWUA 4XK8C 2GAHC 4ECYA 2EC0A 3A8IA 3G96A 2JLFA 3NRBA 5M2UA 1FXRA 2ADBA 3BKTA 4MH8A 3DRPB 1XNQJ 2AYEA 3TNVA 1LV5A 3P5BP 3GYXB 4Y6IA 1C1BB 1L3SA 5GADI 3M8PB 4B3OA 4NMXA 5GAHU 1WOSA 2W2PP 1IWAA 4HLBA 4NCBA 4F4XA 2CJAA 3C66A 5K8OA 1FERA 1J27A 2RILA 3DHXA 3IA0A 1WHXA 2KJVA 2W4DA 1MWYA 2VPZB 2Y1IA 1HHTP 1V3ZA 4ZLLA 3HD2A 1U24A 2QSWA 3OR1B 4OHWA 4DHVA 3IMQJ 5MAOA 3AA8A 3HSDA 4YR0A 1RTIB 2EKNA 3CCLS 3V6JA 3DDKA 3EMTA 4I0WA 4I56A 4ZDNA 2XSJA 2BZ2A 4NLPA 4QR2A 4KC5A 4LVOP 3DOKB 2WW4A 1T03A 3IO1A 2QJ3A 4NLTA 4AYBD 3A8JA 2M4MA 2GX8A 4ZCMA 1NXIA 1P1TA 2C2NA 4M1KA 3ILLA 4IO9Q 1M5OC 3CD6S 1SJ3P 5EN1A 4M5KA 2B9XA 2LQBA 3OQ2A 5KFHA 2H5JB 3DDIA 4CH0S 3CGIA 4WPAA 1SIWB 4QZVB 4HTIA 2XC9A 4G65A 3G8QA 4RW9A 5GVQA 5C42A 3DOKA 4GC7A 1LWFB 3BEGB 3TJ9A 3JSMA 3KJVB 3JS9A 4J9PA 2V6AA 2DGQA 3HT3A 1JLFA 4X4QA 1FD2A 2CNNB 2FY8A 4K4SA 2Q6BA 2GJIA 3VAHA 5E33A 3RBZA 2W9CB 1Y11A 3QIDA 3TO8A 5MLCV 5J2MA 3OFHA 5C42B 2BR0A 4ZPCA 4NXNJ 4OZNA 3CO9A 4LF1A 1HI8A 4GKKJ 3BQ2A 2HAIA 5D4PA 2CJYB 5JMNA 3LGMA 1T05A 4KH1B 5G0RB 3T6BA 3A4TA 4B3OB 3GB0A 1MN9A 3M9MB 1TUGB 5KG0A 3MFHA 3SV4A 4X4UA 1RT6A 2AP6A 1VCTA 2HHXA 4QW9A 1OY8A 5D77A 3PYDA 1RWUA 1HARA 3OSNA 1T8EA 4P2MA 4ILRA 4O3OA 1RHMB 2R7VA 1RQ0A 2C2OB 5F0UA 5FJ4A 2J76E 3ZNJ1 1TL7B 1O51A 3OJSA 4DL4A 2F3JA 2AIRB 2VB6A 4XTTA 3LGNA 4L76A 3SYZA 2DISA 4UUWA 2L3MA 2MLXA 5EX3A 2KFNA 4QYRA 2K7JA 3PX0A 1N56A 4OYZA 1VOMA 2OIHA 1D9DA 4NI2A 2MQNA 3W2VB 5E0OA 1OY6A 3HMJG 3C6UA 2QEXS 2KT3A 3V4IA 1OS5A 5DGAA 4B3SF 3UN3A 3GYNA 1GMVA 2Y3YA 3N79A 4DLEA 1CQNA 5ETSA 4CLSA 3DLGB 2QLBB 2V4JA 1GMUA 3BGRA 4I7FA 3W8GA 4C6AA 2QFJA 4GO7X 5CCMA 3R1HA 3KK2A 3HF5A 3RBEA 4DQPA 1HNWF 4DFJA 3R6LB 4C3KA 3GV5B 2W8KA 3KNGA 2ABYA 4E0DA 1FI4A 1U25A 2XMAA 2KVQE 1AYEA 1ZAVA 2IDEA 5C24B 2FD2A 3ZFVA 1FVSA 5EWEA 3GV7B 4DWIA 3QRPA 2GAGC 3DRXA 1UKUA 3D3BJ 3FCVA 4EK2A 4NXNF 4K4VA 4GKKF 2MZJA 1TL5A 3BGFA 2Q3PA 3UDLA 2W1BA 2DXEA 5F8JA 4QWEA 4JI5J 3W66A 3TEGA 5LMUJ 2MKHA 3PYEA 3VVTA 2MLYA 2YNHA 1T03B 1UVNA 1RBAA 1R31A 3MAAA 1Q86T 4JI4J 4KE5A 3ILOA 2OPPA 4PG4A 1JLEB 1FRMA 1SJQA 2HVDA 4IFVB 2BE7D 3TAMA 2WCXA 2KXNB 4PWWA 5KFYA 1T7PA 2MDAA 1FK9B 5L1JA 4WKYA 4M5NA 4EFAC 3CMES 2CQHA 4IOBA 1N34J 3NGSA 3SSRA 2CWKA 3CC7S 2J0SD 2QLWA 5LSLA 3TR5A 3NS5A 1VQPS 1PSDA 5IT4A 2NXNA 3OHAA 1FF2A 5AT1B 4LVNP 3W2WA 1JK9B 2W7AA 3R3TA 2X1AA 1HBNB 2DY9A 2VFVA 3W2VA 3KK2B 1G7CB 1S99A 4CYUB 1RTDB 2JC0A 1FA0A 1RE1B 3M30B 2VDHA 3VAJA 4M5MA 3BGOP 5KG5A 1HLWA 2E29A 3LQVA 1CVJA 2HKEA 2DGXA 2R7TA 1FJ7A 1NK5A 1AXQA 3UCZP 3OXFA 3H0PA 4B3RF 1SXLA 4DR6F 3S6EA 3NGUA 3M05A 3LH2S 1YG0A 4C7QA 6AT1B 5CD4H 4QCLA 1Z1ZA 2GC8A 2RQCA 5KFEA 3TEHB 4YR2A 1Q5YA 2DNPA 5IFMA 2HK3A 3V6DA 4RNOA 1TL7A 1TL4A 3SQOP 1HMVB 3CC4S 4UZCA 1F2HA 2DJWA 3M8PA 2XY7A 2F1FA 3ETMA 3KK1A 2QMUB 1XMQF 2FVPA 2AJQA 1HBUA 2EVZA 2ZJQQ 4CIOA 2F4VJ 1KN6A 2RJZA 3HVWA 5D6GA 1KQKA 2BJ8A 1G6BA 2HZCA 3BSCA 3PFOA 4OZLA 1ZTTA 1FJGF 4LF5F 2YNFA 3MEEB 4FN5A 3ZZZA 1HR0J 4OMFG 1FRXA 2FLNA 1S6UA 2PFFB 3DRSB 3UD3P 3OVSA 3C2PA 3SXLA 3ZZ0A 5KFGA 3K8WA 2VU5A 2HGNA 4V1Ak 2BXJA 2FGOA 3QLHA 2YX1A 4ZVGA 2HS4A 1EARA 1PYSB 3O3LA 5AXNA 3H98A 3BN4A 4RUBA 2R7OA 4H54A 4P10A 1NH8A 2OELA 3GR1A 3S8SA 4L75A 5A8WB 2KM8C 3GIMA 2NYIA 1IBCB 2V4RA 2W2QP 1NZ8A 3TX8A 2D3ZA 4Z37A 2HZVA 2HNZA 4LF6J 3IG1B 4WYLA 1HPZA 3F41A 5AXMA 2VD3A 1U1RA 1UA0A 1ZM9A 4I6YA 2IC3A 3GP9A 2UXDJ 3E51A 2BV3A 3QZ8A 2UP1A 2XS5A 2D41A 4X66F 2OPSA 2C2EA 4MKVA 2XZTB 4OV6A 5DG8A 1RT7B 4DN9A 2DRAA 4F3OA 4MKYA 2XB2D 5CAAA 5IWAJ 3RG6A 1GXLA 1MU2A 2B56A 2ROPA 2DNZA 1NB2A 3EVWA 3MCNA 2XWXA 3NGTA 1R43A 1TMMA 3GZ7A 3UNYA 5KFLA 4JV2A 5J2MB 1BQMA 3K8VA 2NPIA 3W9JA 4OJ1A 7AT1B 1UVIA 1SKUB 1OJ4A 4PWUA 4K2XA 2F8EX 2ZHOA 4L3KA 3B82A 4F02A 2Z56B 3AHPA 2YQ1A 1UTAA 1ZPVA 2FJBB 2XEXA 1AA1B 1VGYA 3N6LA 4EGLA 2MXYA 2J0XA 1R8PA 1GTHA 2GGPA 5DDQC 2HWTA 3SDEA 5KT6A 2GV1A 5ETQA 3QT7A 2YY3A 1FT8A 2V9KA 1VK3A 2BJDA 3SFUA 3ADAC 3MUVP 3DLLQ 4LF5J 2IJNA 3SIPB 1TFWA 3QT5A 2MLZA 3Q8UA 1HNIA 1CC8A 1RK8A 1S7IA 2F8MA 2D9PA 3KXDA 1X4GA 3CJKA 1DLOB 1NU4A 2IM1A 3D6FB 1S4FA 2KHCA 2OO4A 2RKIA 3AH6A 4ED2A 1PYOB 4TYBA 1WF1A 1RISA 2V9WA 1XMOJ 1SC6A 3N9UC 3NAIA 3ZZTA 3K5NA 2EFGA 4Y2MA 3D7SB 2DGTA 1X4BA 4LF7F 1U02A 1SJ4P 4U9RA 4F4WA 2C2RA 2DO0A 4JI6J 3MR5A 3R7BB 2ZH2A 3I56S 1H7WA 3NMRA 1NSPA 2QLFB 4ZIVA 4OZ3A 4BS2A 1JQGA 3KG0A 2JFKA 3LA0A 2DHSA 4RWXA 4CT8A 5DQGA 1YZ6A 3HULA 1HBNA 3FQKA 1M90T 4IYQA 1B70B 5DDRC 4Q0BB 3CVKA 4K59A 5KFOA 1TFYA 3TI0A 1SVDA 4CLFA 2F8HA 1IKYB 3V81A 1SL1A 1SKWA 1S6OA 2J6TA 5D8HB 5J2PB 4NA2A 5F3TA 1CJKA 3MDFA 1XTZA 4ZITA 1PJ6A 2B4UA 3G82B 4K5RA 4WBFA 2VG5B 5K8NA 1OQ6A 3MI7X 1KWMA 2LCWA 4NCGB 1YJRA 1B7FA 1P9QC 3CCZA 4J9OA 2AHOB 2HQDA 5J1PA 1LW0B 2OEKA 4PQAA 5L39A 3K5LA 4OX7A 2KZZA 3U1MA 1EP4B 2OPPB 3R5DA 3CJKB 2DRBA 2UUCJ 2XLKA 5B7WA 1TK8A 1U0SA 3BYPA 1T05B 2Z30B 2IM3A 2V5HG 3T19A 3M8SA 3J7AN 2IC3B 4RLEA 4B9NA 2MMYA 3FMWA 1SB6A 1LW0A 4LSLB 1NDCA 2EK6A 3BJYA 3DU6A 2IRYA 3EGZA 2MSTA 1Q0NA 4QQBA 3AD9C 4N7TA 4OZ1A 1AFJA 2QGFB 6FDRA 1BD6A 3AXMA 2HQCA 2EFQA 2HNDB 3J7YI 1NKCA 1M5PC 4IR1A 1VQNS 2CDRB 3VGUA 4CLYA 1HQEB 2HHHF 1TKZA 1FX4A 2UXCJ 1YITS 1B0VA 4UOHA 4NLOA 4ELUA 4DV3J 2GCFA 3BH6B 2QC3A 2B43A 1UFKA 3CMQA 3GILA 2HQIA 1T9YA 4OI4A 5JUMA 4ZLJA 3IGNA 1OIAA 1PJ7A 1UFWA 2Y0BB 2GNKA 3H59A 2HQGA 1V3RA 4P6QA 4DFMA 1S49A 4PPDA 3HJFA 3GIIA 2XQCA 4HACB 3FZBA 1SUQB 4UOFA 1RACB 2HBYB 2RDJA 2BVZA 4EZ9A 3SBMA 1S1WA 2FVSA 4J37A 1RT3B 3FEXB 3FBCA 2FC9A 4HR2A 2QL7B 2HIQA 5F41A 4C11B 4ER8A 4OX9J 3W60A 1YTYA 1JJ2R 1ROFA 1TK0A 4ZJLA 1GXTA 3EZOA 3NG8A 2LFVA 2O1PA 4LBHA 4ZVUB 4RNMA 3GIKA 2QA4G 3H25A 4LF7J 3HVTB 4E2FB 2J6SA 3HPOA 1D8ZA 4ED6A 3HJVA 1IKVA 4MFBA 4NYOA 4TU8A 1SUQA 4ICLB 4ZPDA 1UETA 1PAEX 1YRTA 2U1AA 4WWSA 3UFCX 5KFBA 2BM1A 4O3SA 2VKZG 3M9NB 3KYLA 3FSIA 1XN9A 3A8EA 1TKXA 4R0JA 3PJXA 4WE1A 1QAYA 4YB5A 2HK2A 5A8RB 4PG5A 3JSYA 2W2OP 4QR0A 3ITHB 1X0FA 4IOCQ 1N4LA 4HI1A 5D78A 3RUBL 2IPOB 4RBTA 2RIJA 4AL5A 3OV7A 3V6KA 2FJAB 1GX6A 4ELVA 3SCLE 3MCMA 2UV8A 3EXCX 1TAQA 4PR6A 4DL5A 2ZDPA 4USKA 5E3QA 4L3NA 1F5AA 4Q7AA 5KFIA 1T11A 2LVWA 4DV2F 1R0AA 5D3GB 3AQPA 1DFDA 3G8SA 1X9WA 3VF0B 5D0RA 4ZCIA 1R8CA 3EVMA 2CQ1A 4J9QA 2WB1D 1TV6A 3T41A 1ACMB 4ZPBA 1REVA 2H48B 4UZBA 5KT4A 1F6TA 1KP6A 4U95A 3ISNC 3C46A 4NE9C 1VQMS 1R3NA 3KLFB 3M2RB 1FKAF 2R8HA 3M30A 1K1QA 4WFZA 1MROA 2DY1A 3IM9A 1E6YB 4RUHA 4I6AA 2QE5A 3MPUB 3POTA 3BBFA 2Y0SD 3R7NB 2E7WA 1NDPA 3DI6A 3T9ZA 4O23A 1I3OB 3TVKA 2Y8WA 4MTPA 4UW2A 4O4GA 3GCWP 3T5HA 4OYMA 2DNKA 4USWA 1WOOA 1QE1A 2LMIA 3CCUS 1XNRJ 5KFFA 3H20A 1RP5A 1X5TA 4CO1A 1VQ8S 2H5EA 4J5OA 2MEWA 1QAIA 3IBFB 1PAUB 1QD1A 3CIMA 2GIFA 1XR7A 3D6TB 4FYWB 4KIAA 3SZ2A 4P9SA 4A47A 4RW7B 5IS2A 3ULHA 3U27A 2VG5A 4W92B 4N8NA 1CJVA 3KTQA 1RTJB 2HBZB 2VG6A 3MM5A 2VOPA 2BW2A 4HVZA 5CYMB 5KT7A 2V63A 2HFSA 2AEJA 2YNGA 5CD4A 2M70A 2BOPA 1RWPB 3T3FA 2ZZMA 2R2UA 2FJXA 1R89A 1S1TA 4ZVHA 3DN9A 2OTLS 3BREA 4OX6A 1VR6A 2LLZA 4NMLA 1AZSA 4YDXA 3MZIA 1KKHA 4RPFA 2E1PA 4C9DA 1RAAB 1AUDA 1FNMA 4CTAB 1GFWB 2B9WA 2WVCA 2DXFA 2PE8A 3PTWA 4R25A 5HAOA 3CCVS 2FHJA 2QA2A 1R8BA 2RRNA 3LP0A 4GO5X 5J1EB 5LXRA 2X1FA 3NNCA 3GE9A 2G2YA 2ACMA 3MR2A 4FVMA 3PFEA 5B08A 2DR8A 3QAEA 5LMNF 2P2CB 4X84A 5AXKA 1S59A 1XR5A 5IV3A 2JLGA 2N4CA 3CMAS 2ZOFA 1UZHA 2BEFA 1FD8A 4Q43A 4HHJA 1NBEB 2OLWA 4C0HA 1F3FA 4QPTA 4J90A 1S6PA 4BLGA 1APSA 2WK4A 3KHRA 4DSJA 2CKWA 2UUAF 5KTQA 4YUDA 3BKUA 3G82A 3W9IA 1HNVA 4F0MA 3DOLA 4DV5J 3D6HB 4I7FB 4LUBA 4DQIA 4JI2F 4BCAA 4A8FA 2YNIB 3W61A 2B5JB 2V94A 1Q8IA 4NZ0A 4ZVQB 4WP9A 4M5IA 1LEOA 2XCAA 4HKQA 4DPOA 1N0VC 3THPA 3BDPA 3R1LA 1YJ7A 2CPJA 4NLRA 1PILA 1W2IA 3OFGA 2BRLA 2A2CA 2AEFA 4RBVA 3QFWA 2Q66A 3QRRA 5A2QU 1NEEA 4URQU 4DPUA 2HHTA 4M63A 1U2RA 3WX8A 2GMLA 1NJIT 2VBYA 1UA1A 3G2XA 1UL3A 2IVMA 4FF3A 4OI6A 2FC8A 2GMHA 2EG1A 3MCSA 5E3CA 4TN2A 3QNWB 3UVJA 3DRRB 1W7WA 4DDFA 2ZH3A 3OVBA 2RSQA 1UJ5A 4DUTA 2KT5A 4O0IA 2F63A 1LOUA 3C6UB 4DR6J 1TU0B 5KFTA 5KT2A 1JLQB 1NPRA 4DR5J 2W4CA 2B9YA 3EE3A 4ECQA 2HHHJ 3TUJC 1YHQS 3QATA 1S79A 1B3TA 5GMKa 3O6QA 4PXCA 2DGWA 1M1GA 1Y7PA 4CTAA 4I64A 5HMXA 1KVJA 1U2CA 2M2BA 2UXBF 5L8RC 4KPYA 2VONA 1HBOA 3OR2B 2QLXA 5LMNJ 1M1KT 4HT5A 3SQGA 1JLGB 1RXOB 4ZK7M 1YDLA 1Z2ZA 2XHCA 4N47A 4C8MA 1WUUA 4ZLPA 5KOWA 1RHRB 3IS9B 3MEKA 3W5XA 4F7VA 4C8KA 4RUCA 5HL7Q 3G6VA 4KAIA 1HI0P 3UNGC 1PKUA 3D0HE 1CG2A 2DEJA 3SSSA 2VC1A 2E9ZA 1FWPA 2VG7B 1N36F 1ITPA 3EGWB 5C25B 3N6MA 5T14A 1W26A 4HT7A 3RR8A 3HT0A 1X9MA 3Q8VA 2V67A 2WBRA 3RRHA 4ZOSA 3SMZA 4CDIA 1TL1A 2QA1A 3FMBA 4ANDA 5DDOC 5F8NA 1S1UB 4X64J 1Y5NB 4NXMF 1MMLA 2K1RA 4WK3A 5IM0A 2ASLA 3W65A 5GMEA 1FX2A 1D3WA 2LA4A 3ET6A 3ISZA 1O6XA 2CPDA 2HHPA 2YWGA 4MK9A 1LWCA 2UZAA 3CJTA 4KRWA 2AJ2A 3RAQA 3TYTA 3BBCA 3HCXA 4A8WA 1NJYA 1SBRA 2V2ZA 2I2YA 4CT9A 2B4VA 3KLEA 1I5OB 3ONQA 5C2GA 4OHZA 4X66J 1NJZA 4G1PA 2LQJA 1F9HA 3D66A 3E8OA 4DFKA 1KQSR 4O0NA 3HXMA 4HH1A 1GAOA 2HNYA 3PW5A 3C15B 4J9UE 2XMKA 4DBQA 3CDAA 1ZM4A 3FSXA 1J5OB 3NCRA 3CC2S 4D3HA 1AB8A 3WX4A 1VQLS 5AJ3J 2DXDA 3BB5A 2QX0A 2KDOA 4CNYA 2V4QA 1S0OA 2POKA 4AL7A 4LF2A 1PYTA 4P73A 4AD6A 2EBGA 2HZAA 2X1BA 2B8QA 1VQ5S 2AYGA 3QAUA 3T5LA 3G4SS 1VHFA 2FJWA 1VRTB 3BV8A 4B3MJ 3FDSA 3KLFA 2M8DB 1N52B 3NGKA 5F9NA 4KT0C 4MMOA 1P9YA 1RAJA 4IQXA 1N34F 1JIHA 3TZZA 3NS6A 1WTBA 5CA5A 4P75A 3AQOA 2RHSB 3EWGA 1HWLA 4ECSA 3OT9A 3KHHA 4KTQA 3DM2A 2QT7A 3IN5A 3KK3A 3RTVA 1CULA 1HW8A 2P9GA 2RD5C 5HJYA 1PGZA 2KYZA 4DI6A 1NK0A 4JI3J 1PBUA 4K4ZA 4YB7A 4PWDB 3GFYA 2HWHA 2RDIA 3MEGB 3N6NA 3DC2A 5K9FA 3M8QB 5HMYA 4KHPF 5E3RA 1ZZFA 2NSCA 2YKMA 3E01A 5ETMA 4CQ1A 1FFGB 4JI1F 2RH3A 4YP3A 3X1LB 2MYFA 2NYHA 4OI0A 3MPVA 4JP8A 4OHYA 2HHWA 4DF4A 3RB0A 2BE2A 1S1WB 4ICLA 4LRCA 3MM6A 4J9LA 5GMDA 4KKOB 3BH7B 2ATCB 5K14A 3W9HA 4PG8A 4LF8F 1UEVA 1VI7A 2YVSA 4DEZA 3OTBA 1RAOA 3W5ZA 2AYBA 2BDPA 4KY3A 1IUJA 4Q44A 2IVYA 4WU3A 4PQUA 2CNKB 3RJMB 2MQLA 4M5JA 5LJ5Y 2FVRA 3CDEA 2ZBQA 4DJBA 1N54B 2APOA 1XERA 1FCAA 2Q6CA 3VWSA 5B0GA 3G86A 1SQEA 1Q16B 1UEUA 2GO8A 3FEZA 3DXSX 1EKRA 3NWGA 2OPQB 4NYZA 2LQ9A 4O44A 2ZH9A 3T5KA 1HR0F 2UUCF 2RF2B 1UCNA 1WEZA 3NBPA 1QLNA 1H73A 3V2UC 4DSIA 4R0EA 5J2NB 4BHQA 2QL5B 2OMLA 1XC9A 3NXZA 4IFVA 2BW7A 3J80Y 4LF9J 2CIMA 2AJ0A 4PWDA 3MPDA 4FYYB 4DUYJ 3MMAA 1X7VA 2YPZA 4GRSA 3ENWA 5HMZA 1H98A 6FD1A 1MWZA 2CZ4A 1K47A 1S77D 2UU9J 1OYEA 4ZPWR 1D1UA 2FYXA 5F9LA 5I42B 2HLUA 4Q8FA 5KG2A 2M8HA 2DYAA 1VMBA 2O01C 2HSEB 2DGOA 1RT2A 1UEKA 1UW4A 2X7IA 4OX8A 1PBAA 1Q4RA 1TL1B 3PJ9A 2IVFB 1LWEA 1OMSA 2XG8A 4WXOA 3VAFA 1FXLA 5IT9Y 2ZH6A 3D2WA 4NCGA 4CO0A 2BE9B 1RT5B 4NRTA 1JJHA 2P8IA 2QYCA 5K8PA 2ATLA 1U6BA 1SI9A 3KUHA 4NLGA 1XWLA 3J7Z5 1VIOA 1V9OA 3R27A 4ZP7A 4X4TA 1URRA 3TANA 2QMXA 4USUA 1RDRA 3BQ0A 1J5EJ 1MU2B 2BJ3A 3GWCA 2ZH8A 3H2UB 3T6JA 1U1LA 1U48A 5LMUF 1RHJB 5H9FJ 2KTQA 3O1LA 1X9SA 1FHTA 2AJ4A 3VZIA 4ZHRA 3CTRA 1RT5A 1UP1A 2ZH4A 2JEJA 3OLBA 4C4WA 4ZJOA 4WFXA 3TQEA 2XI2A 2JLEA 4P74A 4TYAA 4DCOB 2YKNA 4A8YA 4YHHJ 3R8YA 3CCMS 4CO2A 3TUPA 4JYAF 4OYAA 4QIEA 2HQ3A 3SEOA 2LP4A 4M94A 5FLXU 3NOCA 1KVIA 3DI6B 1D0EA 2VV5A 3L09A 2OAUA 4DSEA 2RNEA 4KGZB 4A48A 4U7UD 1KEKA 1H2TZ 2PEHA 2XGPA 4C8OA 3AODA 2FGCA 2RKIB 2VBWA 4FKYA 2IFXA 4Z7CA 4I2QB 3IC1A 4KHRA 1NH7A 4KO0B 3MEEA 1FO1A 1DHMA 1C0UA 1AT1B 1LW2B 1S1UA 4NLWA 4IKAA 4F4AA 4R5PA 1URNA 3FUYA 2KM8B 3JAMY 2K8GA 4BBYA 4U6PA 3PV8A 2Y9HA 1P8GA 1VLOA 3M2UA 3PXGa 3UD5A 4CO5A 9ATCB 2BKNA 2CZVC 1EJ7L 4RW9B 2XY6A 5KFUA 1UJ4A 3W64A 1BMQB 1C1CA 1R8AA 1RHQB 2JRSA 3RRKA 4FS2A 5KG7A 3C14B 2PA8D 2Q79A 3CCJS 4P7TA 2AQ4A 1WC1A 1VBXA 1QTMA 1ZOTA 2UVWA 1HD0A 1WG5A 2PDAA 1FFSB 3HZGA 3BN7A 2RB7A 3F0NA 5KFWA 2AW0A 2DD8S 3M4XA 3VQTA 1S10A 1J5EF 2CJQA 2HS0A 3BO4A 2KG0A 1GMWD 4J9SA 2GFFA 2ERRA 2OSQA 3MGJA 4QBUA 4H4OA 4RU2A 2OTJS 2HWIA 2AYMA 1C2PA 3GTYX 2W9BA 3OXLA 1W2BR 2UVRA 1KONA 2U2FA 2B6AB 4XPCA 4EZ6A 1IXKA 4F25A 2CADA 3FJ2A 1A9NB 1B7YB 4U8VA 1YJ9S 2G4BA 3RR7A 2FZKB 2PN6A 1Q81T 2GJ2A 2G13A 2OUGA 4IRDA 4G3IA 5KT5A 5L1KA 2H1YA 3A1YG 4KGKA 2HPUA 2YXLA 4ES2A 2YNFB 3J81j 3HHEA 2K2PA 1Y9OA 4AE5A 5CYJA 1P6TA 1N33J 1VJQA 1RKJA 3I31A 3OFEA 3QGHA 3THTA 3ZNUA 3I9V9 3OW2R 2R8GA 5HANA 3PO5A 2XMVA 1TZ0A 1JNZB 1RAHB 2MTLA 1HBOB 2WVBA 3MMBA 1O0PA 3JQJA 1BHNA 1FKOA 1OO0B 1DJ0A 1IN0A 2NUHA 2KI2A 3LPYA 5B0AA 3PEHA 4RW4B 2A6MA 1VYAA 1V6HA 4I2QA 2GQQA 2F9DA 1WACA 3LAMA 1Q8LA 2CJ9A 4RNHA 4YQWA 2W7PA 1ICEB 2XY5A 1S97A 2MZSA 3TJ8A 1DQ8A 1KLMB 1WC0A 2GVDA 1G3OA 2DGSA 2DT9A 2EK1A 4RW6A 3M2VB 4CM2A 4MIWA 5LXYA 4OZ5A 3KK1B 4DV6J 1N6QB 3A3PB 2EG2A 1C4AA 1FTCA 3I5CA 3NCQA 2QLJB 4ID8A 1HYSB 4YR3A 3DOMA 3H5YA 2MPUA 4DR7F 1H7XA 2F9JA 3FFIA 3JSRA 2AZ3A 2WB4A 3SFGA 5C24A 3D3CJ 2BANB 4DV1J 3KUGA 3LP1B 4AXJA 1TR0A 3D4JA 5C7PA 1WC4A 4K4XA 2GHWA 4OYWA 4Y2IA 2RE1A 2UUAJ 1UVLA 2B51A 3W8PA 1REVB 2W9BB 5E5NA 4FXWA 1WG1A 2NR0A 1IKYA 4WFBQ 2HGLA 2HS3A 3C6TA 1FVQA 5C5JA 4TY8B 3JB9k 5J2QB 1RLDA 2QRRA 3PO4A 3I4PA 4FF2A 1U1MA 3VAMA 2EPIA 4B9TA 1HFEL 4ETZA 2AEMA 1QAJA 2B7BB 2ZWPA 3FNNA 2WTFA 2P5VA 1TKTA 1RA6A 1UFLA 3NY0A 4RX6A 1UZDA 5A8KB 2MJUA 1TMJA 3AJ2A 3EGNA 5DQHA 2ASJA 4DUZF 4R8UA 3H40A 1XMOF 2JEGA 1KLNA 1TKXB 4CH7A 3DCAA 3LGHA 2E5LJ 3U7JA 1UMJA 4RW7A 2O3DA 2R7SA 3HSJA 3FCHA 1U1QA 5LM7E 3H4BA 2EC2A 3VR1A 3CW2C 4DV2J 4MK7A 3AD8C 3K89A 4WKRA 1IVZA 4ED7A 4IRKA 5HROB 3AFGA 2CPFA 2ZZTA 3DOMB 8RUCA 1OSDA 1JLGA 3DNCA 4CZCA 3ZZPA 2Y1LB 2RQKA 4IFYB 2XYPB 4OV1A 2ASYA 1RCXB 2YKAA 3DLEB 3I5BA 3M2VA 5HSPA 1HNXJ 2Z0GA 1BQNB 3BPSP 2BMBA 1L3KA 4YY3F 4NA3A 1HHQA 3KLGB 1I51B 4ECRA 4HDGA 5HBMB 3QBCA 1D8YA 3IBCB 1TTHB 2CPHA 1XMQJ 1KBRA 2NS1B 2WAQD 5HI7A 4C3LA 5KG4A 3PR5B 3MUTP 3CJ5A 3PR4A 1ZYQA 5C2CA 1K9MT 3W2WB 3JYTA 2YKMB 2ZBIA 5GAGU 3IWXA 1RWWB 4AL6A 4CP5A 2EKYA 2Q1LA 3LW5C 4F4KA 5E2QA 1LK5A 1Q53A 3OTOJ 1X31C 3KFWX 1Y3JA 3G6XA 5I42A 2D3OR 3IGVA 3MM6B 3PJWA 2IAJA 4JB8B 4BDPA 1F1BB 2YWHA 2ZEJA 3WC0A 4YN3B 3J80U 2X3GA 3DLBA 4UOCA 3RB3A 1FWKA 2FJDB 2QZ8A 3BKFA 3D54A 3ZXWA 2RU3A 1NK6A 4USVA 3PACA 2KYXA 1X8DA 2HNYB 1OSCA 2WSEC 3FKBA 4KR0B 3KLHB 3QSYB 3RAXA 1VRUB 2RS2A 2SXLA 1IKVB 2IMWP 1IBLJ 3MAAB 2MKIA 5EX0A 5L1IA 3PX6A 2E1RA 2J0WA 4UY8T 1LFWA 4YDDB 3QT8A 3OR1A 3M1VB 4CLLA 2DH8A 4IFYA 5CCLA 2BANA 3FRZA 5B0FA 1Q7YT 3WC2A 2BM0A 2BKPA 3MR3A 4J9NA 3LPEA 1CSJA 4QWCA 3B4DA 2GZOA 3K7RA 1S9GB 1WD6A 4RUAA 3C16B 2C2MB 3AOBA 1NSAA 5AE3A 1RTZA 2COLA 4PG6A 3SI8A 3DGPA 3ENVA 2GQ2A 3PM9A 4DPWA 3AJ1A 1VQ9S 5BXIA 3H7HB 2W2MP 1R0AB 1VS3A 4KB7A 2W8LA 2RS8A 1HD1A 4KJIA 4Y2KA 5CZXA 5D4OA 3HM9A 2VA2A 3CSKA 3I0SB 3QPIA 1UPMB 2D1CA 4I1TA 4C8LA 2NZ4A 4QU6A 3EJMA 2DPJA 4MKAA 1N36J 3IR7B 4ZPVR 4C2MA 5G4DA 2CPIA 1IKWA 1UWBB 2OEJA 1BLUA 4QOTA 4ZKAA 2JHEA 3QYYA 1HWJA 4JI0J 3ZTRA 1RT1A 2NPFA 4QWAA 2GGPB 4LR9A 2VJVA 1RZMA 2A0FB 3R97A 3WBZA 4ECXA 1HPZB 2J0QD 2CQPA 2IM2A 3MEGA 1V5IB 4AXIA 2P6SA 2MQ8A 4PEOA 2KB2A 2PI4A 1ZH5A 2DGVA 3MM9A 1KFSA 3JTPA 1KQFB 3V5RA 3P45B 4A4JA 1NM2A 1X4EA 2XMTA 3ZZYA 2WW8A 3M1VA 3NGDA 2DH9A 1YZ7A 3BZQA 4QWDA 1QUPA 2PMHA 2C1EB 2IJFA 1NAQA 2P6TA 3NS7B 4I4BA 2V69A 3DRRA 3BO2A 4X65J 1N5YB 3T1AA 1TV6B 4DR4J 3CJRA 2ZBRA 3MMBB 3WQPA 4F36A 1MG7A 3PEJA 3HHDA 1MWQA 4J9VA 1Y10A 1EETB 2N3LA 2UUBF 2XCPA 4F4YA 1RWKB 3EICA 1EIYB 1Y0HA 1UVMA 3T1HF 4IH6A 4I2PB 2AJFE 3KKFA 4OL8A 3TZXA 4I6WA 1YBTA 3UDCA 1LW2A 3PYFA 3M8WA 4DL2A 3A3OB 5A0YB 3PZPA 1SCJB 3P4UB 4UY85 1M5KC 4ED4A 2C3UA 4C98A 2IBKA 1NJWA 5EWFA 5D0EA 3PCOB 3K5MA 1XQIA 2YKQA 1HWIA 1KS2A 1PG5B 4DV1F 3KDOA 1UVKA 3R6GB 2W9AA 3CCWA 3FBBA 2H9ZA 1EETA 1WKJA 3ZO7A 3TVYA 4DU7A 2WSFC 1R8HA 1N48A 4PKDB 5B0EA 2ALZA 5E3AA 2RDDA 4OI1A 3B8HA 5LOQA 2CQ0A 2X51A 3H8YA 3Q8QB 1LWXA 1I6JA 2HVZA 1CJTA 5HQMA 3BSAA 2DTJA 5FLXY 1NK8A 1Q78A 2F4FA 3AJDA 3DRPA 1SH0A 4M5DA 4W4MA 1JLQA 1T9VA 2PMZD 4DOZA 4ES3A 2DNOA 7FD1A 5I3UB 2VQFJ 1RT3A 4I68A 2JZ5A 3V4MA 1FKPA 1ULRA 2LXIA 3TP2A 3TA2A 2IA0A 2JOQA 3DMJA 1N0UA 3FBEA 2FHMA 3KLIA 4DXLA 4DPTA 1Z2LA 3I55S 3GFHA 5CXTA 3RB4A 2FUG9 2E5LF 2NREA 2R7QA 3CIZA 1MMDA 5HQLA 3HFVA 2J5AA 2ZHBA 5HJXA 1HQUB 1R6YA 3A12A 4LSZB 2LEAA 2DNNA 5KFRA 4X65F 4GKJJ 2RQ4A 3PY8A 5HN0A 4A8MP 1WELA 1VQ6S 2XYGB 2YH0A 4X4NA 1B4SA 4MYUA 2PSZA 3MM8B 1NK4A 3FQLA 4D3GA 2F7VA 5HLFB 3MM7A 5DLGA 5IT9U 3R7SB 4DG1B 2J9DA 3N5FA 2ZZNA 2LDYA 4FP9A 4YEAA 1CLFA 3PW0A 5THWA 4K4TA 2DR9A 2HMIA 4OYOA 3QGGA 1FWLA 2PI5A 2PIIA 1VQ7S 2C22A 1S6PB 3S01A 4ZN3A 2F4VF 3D68A 4LT6A 3JAMU 2D3O1 4B3MF 4RNNA 1WI6A 1KFDA 1WEYA 3R5JB 4WFNQ 3OUYB 3D5MA 1FJEB 3GFXA 3OXGA 2DGUA 4IQMA 1Y5LB 2FHJD 2C28A 5LT5A 4KFBB 2HFNA 2YWWA 4ZVPB 1JWWA 3D6MB 2DVIA 1VC6A 3OR2A 5EWGA 4F0HA 2YTCA 5BYQA 3O8WA 3CB4A 2CVIA 1WKKA 4QIFA 4CWBA 3M32A 4NWBA 3JQMA 3NAHA 2HNZB 3Q89A 3A13A 2KZMA 3DLGA 3OUYA 1WWHA 2VH7A 4FKXA 4X4SA 2CQGA 4F4ZA 4FPRA 4MYTA 2NZCA 2QIFA 4TKTA 2FVQA 2FLPA 4LMZA 1HBMB 5KFDA 4QU7A 3LP0B 3PX4A 4EMDA 4QPXA 1CJKB 2XI3A 1IJEB 1C0TB 1F9EB 4LRDA 2RQMA 4ZP6A 5BYSA 4RKUC 2ZM6F 1NB7A 2J9EA 2V4JB 4JI1J 1HNWJ 2R2SA 2H4YB 3ZZOA 4NPOA 3BYRA 4DMZA 5HMWA 5F8LA 1XNQF 2E44A 4KGMA 2L48A 1RTJA 2VG6B 1QVFR 2EFVA 4LF8J 3CCES 4K50A 1HBMA 2EEYA 3B78A 3HFZB 5AE2A 4A8SA 4WF9Q 5I4MA 3CJ8A 4TY8A 4R8UB 1RABB 4IDKA 5EUHA 5H9EK 3UN2A 1VQ4S 2W24A 2DB1A 2DO4A 3GU0A 2MZTA 3JTOA 3DOLB 5ETRA 2IBOA 3MEDA 1NHKL 1R6VA 4HEA9 1W25A 3TVZA 2IHR1 4LIWA 3W3SA 1YLXA 2MQPA 4RZRA 3HP6A 3OJUA 1SKRA 2BOAA 4B3TJ 3KJQB 4EU0A 5GAEU 2IJRA 3KK3B 3C8YA 1M5VC 2AX0A 4DSKA 2I5JB 3ZZUA 1X4DA 2D74B 3UI3A 1RCOB 4QIWD 1RTIA 4N41A 4JV5J 2VASA 4OJ3A 5BJRA 5KFXA 1IQTA 2IRXA 3I0RB 5A0YA 1S57A 5DZ6A 1KNZA 2E9TA 1WC6A 1RAEB 5KFAA 5KG3A 4AFFA 1UJ6A 1SV5B 3IAM9 3TUIC 1WSRA 3HVRA 1PCAA 1KD1T 4X64F 1VRTA 4N8OA 4G1QA 1VQSA 1ZS6A 2J8SA 4WZMA 2KU7A 4K7QA 1CJUB 1YGYA 4ZVEA 4KV8A 4ZN1A 2C2KB 2CPEA 3T5JA 2UU9F 3P5TL 2ZC4A 3QJJA 1SQFA 1CJVB 2Z57B 2G0JA 1RAFB 4DCPB 3O44A 1IBMF 2LKZA 4RW8B 1BQMB 4NI2B 1WHYA 4ALZA 1M5HA 1RHKB 4DQSA 4FZVA 2CQ3A 2RT3A 3TZWA 5A76A 3VTIA 5K8MA 1FEHA 3T1YF 1IKXB 4UT4A 3DGPB 3HHLD 3RGIA 1U1OA 3BS9A 2E1AA 1S12A 3MPYA 4F8RA 1UAWA 2HURA 4ZLNA 4YB6A 1R7IA 4DU8A 4LR8A 1FTRA 3AOCA 2F5GA 5RUBA 4P7VA 1WSVA 2M5YA 4AT1B 4KH0B 4NEYA 4Z2XA 3AOAA 4BC7A 2BBEA 3QT6A 3ENQA 4RO0A 5ITHA 2UVUA 4DR1J 1EHWA 5H1SV 1K73T 3QJLA 1YVFA 1YBAA 4C97A 4Y00A 5ETKA 1RTHB 4QR1A 3BR9A 3EYZA 4X4PA 1EX8A 3K5OA 3KMQA 2XTJP 1GT8A 2CG8A 2LDIA 2FLLA 2LEBA 3B4MA 1RWNB 3CJ3A 4B9SA 4ILMA 2ZVIA 4DV5F 1NMEB 2B6AA 5IC6B 2Z2LA 4MK8A 1ZAXA 2KFYA 2NLWA 4OHXA 4NYPA 3EPGA 3NNAA 2NXEA 4IG3B 4TLQA 4XAKA 3G8TA 2IDLA 3CCSS 3MAHA 2HNDA 2KJWA 5L1LA 1FNXH 3GR0A 1D9FA 4DL3A 4Q0BA 2ZNZA 2QN6B 5SUHA 4UQGA 1CS4A 3VAIA 3CF5Q 4I67A 4X4VA 3HZEA 4TLRA 4ANCA 4GMKA 3JTNA 5HVGA 3WIVA 1FXDA 2ZKUA 3AB4B 1FDNA 1RHUB 3QO9A 3UR3C 4ED8A 4ATNA 2KVIA 3VCDA 1YKWA 3M2UB 1BQNA 2MGZA 1HBUB 4DZ6A 3CD5A 4X62F 3R5GA 4QW8A 4OYIA 2LYVA 4A8OA 4ZMMA 1X4FA 4GKJF 2XO7A 2DNRA 2CQ2A 2HFOA 3HSGA 5BR8J 5AE1A 1K8AT 1JKHA 4Y0FA 1CEZA 2VZ9A 4K4WA 4A46A 2HFVA 2KXFA 3KLEB 2XM3A 4IO1A 3M6WA 4MAKA 4RBUA 2BX6A 1HI1A 2ZH5A 3H5XA 3D1HA 3PW2A 3AB2B 4X4RA 2UXDF 2HHUA 3RBXA 2A3JA 1GXUA 1RAGB 2DHGA 2W25A 4P2XA 5H9FK 3M6UA 4OLOA 4P72A 1S9EA 1S0VA 2HBQB 3QGPA 5JVHQ 2KL8A 3OTOF 3OBIA 2MJNA 2R7XA 1D09B 1SJFA 3UN5A 1T9UA 4ZJQA 3CDUA 1LQ9A 4JI8J 1Q1KA 2R42A 1N33F 1JJCB 4LBPA 2VIHA 4EBDA 2BQRA 4A8KA 3N5BA 1F60B 2FVCA 2JVRA 3EZUA 4YB1P 3RBDA 3QWUA 2A1BA 3CDBA 4OJHA 2C42A 3I96A 3M32B 2ROGA 2WOMA 5K14B 4LQ3A 4LQ9A 5KFSA 3L7OA 2VF3A 2BABA 2LXUA 1QJHA 1T9XA 2M9KA 2BACA 2ZBCA 5KFKA 3Q86A 2HVHA 2M0GB 2FZCB 1VFJA 2O66A 3KG1A 5KFQA 4O3PA 1N6QA 1JJ4A 3NNHA 4ZVSB 1WNEA 4KHMA 3TUZC 1R0BG 4N56A 3GQCA 1UVJA 4LSLA 3M6XA 5M2PA 3BO3A 1GX5A 2MKYA 2WONA 3W63A 3CULA 1OPIA 5A8WA 2ILYA 5GAHI 1PO6A 1XK8A 1OPZA 5F8MA 2CJXB 4WU2A 2PFDA 4WXWA 4U7UK 1FJCA 3HFKA 5DS7A 4DQQA 3K0JA 1C4CA 3CJ0A 4K2JA 3TAPA 3A8KA 3EDQB 5AJ3F 1IWGA 4L6V3 4PABA 4Y3CA 5KFZA 8ATCB 3E2EA 2P9CA 4PUOB 1Q79A 1FFWB 2ILZA 1DLOA 4TU9A 4IR9A 4FBUA 3VHQA 3NL0A 4WZQA 5G0RA 2FQQB 2RUSA 2C2ZB 2D69A 4PG7A 4ED0A 1WDDA 2ADCA 3ZC4A 4CO3A 1I94F 4DR3J 4ILLA 2VICA 1FEEA 4YFUA 1BE4A 3G87A 2G0IA 1T0TV 3FVYA 4PRFA 3LANA 1P1LA 4B02A 2ZWOA 5HBMA 1U45A 2HVIA 2QO3A 2I38A 3HHLC 2WBMA 3MR7A 4JI8F 2OKQA 4B9MA 5E7OB 2DNHA 1ZZNA 2ZUAA 1YSJA 4M5LA 2RU9A 1NNDA 2BQ3A 4B9UA 4PZVA 5B0CA 2MGZB 3IRWP 2A6OA 3CJSA 1VRQC 1IR2A 1SQGA 3DM2B 4XDDA 1CJTB 2JL9A 2WVEA 1S1XB 1SC4B 2Z2MA 4ZPAA 1SL2A 4LF4J 4WFYA 5DM7Q 2JX2A 3DXBA 4RWWA 1X60A 3R5BA 2G9OA 3SCJE 5J2NA 2DK2A 2VC0A 3NP5A 4FXDA 2CFXA 2UXCF 3FGVA 1HKAA 4X4OA 4FVCA 5CABA 3HDSA 4QYZJ 1DQ9A 1VBZA 2B7CB 4HH0A 4WIIA 3I82A 2V68A 1VHIA 3FCWA 4MIBA 5DG7A 1IKWB 1UWBA 1TL3B 1E6VB 1U6ZA 2PGCA 2VFSA 3M8ZA 3TRGA 1HNXF 1T3NA 3IRXB 3C14A 5DGBA 5ETNA 2Z58B 2DPIA 4Q45A 2OH2A 1XEZA 1S6QB 2V8PA 5B0DA 3CE8A 4EWTA 4ES1A 4V19X 1PC5A 3D0GE 3GJTB 3GSDA 2N4DA 3KJFB 3Q8YA 1VJWA 3OL6A 2DR7A 5D3GA 1K0VA 3NMAA 2KRRA 4JI4F 4DR1F 4LFBJ 4J9KA 1OQ3A 3WDOA 1YBUA 4C8ZA 4DV4F 4MFBB 2YH1A 4AUKA 1ZTWA 3V6DB 1JLEA 3L3CA 5I3UA 3GG0A 3J7A1 1TVRA 2V8DA 2E5IA 4H4MA 4WE1B 1JNRB 3CT9A 5F0WA 1Q95G 2VQFF 4ZHRB 1FDDA 2I1RA 4TVAB 1N5QA 2XYHB 3IBWA 1QE1B 5KFCA 1VK8A 1KSPA 4HI2A 3PYGA 3B54A 3Q2TC 1VRUA 5IQQA 5HROA 3GFZA 3CO0P 1QM9A 3DYAA 1NSKL 3Q0AA 3VAGA 3NCPA 2L9DA 3D0IE 5JVGQ 3M8YA 4DSLA 3UR0A 1QSLA 2CQDA 4FXVA 1L5UA 1TVRB 1EAYC 3LOUA 4NOHA 4NZ7A 5IC4B 2YQ0A 1IBLF 2LQ5A 3I5AA 3L7UA 3MECB 4O3QA 2R7RA 1NDLA 4RJVA 3ILIA 1N8RT 1F3VA 4NLYA 1EQ0A 2B4OA 1FKOB 4Y65A 5GAGI 1BUXA 3OL9A 1MMNA 1JXEA 2GMJA 4NL5A 3PIOQ 1BC6A 3IXQA 3GIRA 1C0TA 1ELOA 3MD3A 1NHUA 2C3PA 4LRAA 1VBYA 1VQOS 3RU0A 2JSXA 1WOPA 2Z4PA 2BYCA 3LF0A 4HTJA 2AU0A 5E3PA 1L3UA 4AQYJ 2VFTA 1I1GA 4NLDA 5KAKA 1N5YA 2Y8YA 4KFBA 5ADZA 1TL3A 1YX2A 4ZVRB 3DLKB 3P8BB 3CPWR 2QYGA 2W01A 2ZBPA 4IOAQ 3FC9A 1TQLA 2VQEJ 1A6LA 3KDNA 1WKLA 3PRDA 1H2UX 4EO6A 4EBCA 2C2DA 1FRJA 2RMLA 2FY1A 2HHSA 4P52A 1U49A 3H5SA 3MMAB 2DHHA 1KR4A 5L46A 1KTVA 1WHVA 2MQMA 5F8IA 2JH3A 2KN4A 2X3DA 1S1XA 4HACA 4J91A 4DN0A 5IZHA 1K44A 2HBRB 2M7SA 2OEMA 2ZUGA 4LSNB 4FNHA 4WYWA 4CLPA 5A8KA 1GEHA 3OSPA 1RT1B 3ILJA 4OJGA 1EKSA 1KTQA 2XS7A 4UTGA 4C11A 3HKZD 1D9AA 2KFZA 5ETTA 3FEYB 2Z2YB 3QMQA 1K0TA 2NSBA 2OFGX 1UW9A 2FIUA 1F5CA 3MM7B 4MIAA 4ZVFA 3VGSA 3UCUP 3IAS9 3UDEA 2N7CA 3TAQA 3R2CJ 1GK8A 1KHWA 5CH7B 1MW7A 2WVDA 2XULA 1YQHA 2I6WA 3UO0A 5A6WA 4I2PA 2EFOA 3PHTA 1ZBTA 4R5PB 2KG1A 3LP2B 4DL6A 4KPCA 3PKMA 3W7BA 2J9DE 1PJ5A 2LU1A 3UVJB 3AT1B 2FB0A 1RGVA 1RT6B 3ZTOA 1TKZB 5KFMA 3TARA 1N32J 4N77A 3W5YA 4PXDA 1HW9A 2PEBA 1MN7A 1XJWB 1RT7A 2VPYB 1HQUA 3SV3A 4AQYF 4YY3J 2AD9A 1S72S 3DLJA 4K8RA 2B9EA 1HNZF 1YI2S 4CRJA 4U8YA 1LWEB 1KLMA 1O8BA 3EZ5A 4BWJA 1U26A 2IA6A 2LA6A 4ZVTB 3J81Y 4CO4A 3KLGA 1ZETA 4CH1A 2RRAA 4RU9A 3K2YA 3IR6B 1SJRA 2YNHB 1HWKA 2QMWA 2E7VA 1NCLA 3LAKA 3GONA 3OFFA 4KGVB 4KSEB 3H2VE 4URGA 3GJQB 1E6YA 4G1IA 4FYXB 4IH5A 3QIPB 1S0MA 1J2VA 3SDEB 4OYXA 2LEPA 1NDKA 1DTTB 1JXVA 4B9LA 3BGRB 4IRCA 4DR2F 5D15A 3U1LA 1NKEA 2Z2ZA 1HNIB 4USTA 2CDQA 1S5ZA 4HL9A 4DFPA 2BE2B 3MTKA 1N5SA 1MLAA 2DR5A 2E9RX 2BRKA 2YKOA 3AXKA 3BSNA 5J2QA 3FZ2A 3T1YJ 2BJ9A 2CJBA 2MKJA 5KT3A 2P9EA 4ED1A 3MM8A 2KRBA 4ECZA
chains in the Genus database with same CATH topology
4OYAA 1Y10A 4WP3A 4P2MA 1YBTA 4CLYA 1TL7B 1FX4A 4WP8A 3C16A 5IV3A 1WC5A 5D0HA 5D0EA 4OYZA 1WC6A 1CULB 4NI2A 2GVDB 1CULA 4OZ2A 3G82A 1CJUB 4P2FA 3C14B 4CLSA 4CLWA 1WC1A 4WP9A 1CJVB 2W01A 1CJTA 5IV4A 1CJUA 4OYPA 1CS4B 4NI2B 1U0HB 3C15A 2WZ1A 3UVJA 4CLPA 2GVZB 4CLKA 3MAAA 4USVA 3MR7A 4CLZA 3MAAB 1AZSB 1YK9A 4OYOA 4CLLA 5D0RA 1CJTB 3UVJB 2BW7A 3C16B 4CLUA 2QV6A 4OZ3A 1WC0A 2GVDA 1WC3A 4CM2A 1CS4A 4CLFA 4USWA 4OYMA 3C14A 4WPAA 1CJKA 1FX2A 3ET6A 3G82B 3R5GA 4OYIA 1WC4A 2GVZA 4OYWA 1CJKB 4OYXA 3ET6B 1CJVA 1YBUA 4USUA 5D15A 1TL7A 1Y11A 4USTA 3C15B 1U0HA 5D0GA 4OYBA 1AZSA 4CM0A 1AB8A 4P2XA 4CLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYA A;  1Y10 A;  4WP3 A;  4P2M A;  1YBT A;  4CLY A;  1TL7 B;  1FX4 A;  4WP8 A;  3C16 A;  5IV3 A;  1WC5 A;  5D0H A;  5D0E A;  4OYZ A;  1WC6 A;  1CUL B;  4NI2 A;  2GVD B;  1CUL A;  4OZ2 A;  3G82 A;  1CJU B;  4P2F A;  3C14 B;  4CLS A;  4CLW A;  1WC1 A;  4WP9 A;  1CJV B;  2W01 A;  1CJT A;  5IV4 A;  1CJU A;  4OYP A;  1CS4 B;  4NI2 B;  1U0H B;  3C15 A;  2WZ1 A;  3UVJ A;  4CLP A;  2GVZ B;  4CLK A;  3MAA A;  4USV A;  3MR7 A;  4CLZ A;  3MAA B;  1AZS B;  1YK9 A;  4OYO A;  4CLL A;  5D0R A;  1CJT B;  3UVJ B;  2BW7 A;  3C16 B;  4CLU A;  2QV6 A;  4OZ3 A;  1WC0 A;  2GVD A;  1WC3 A;  4CM2 A;  1CS4 A;  4CLF A;  4USW A;  4OYM A;  3C14 A;  4WPA A;  1CJK A;  1FX2 A;  3ET6 A;  3G82 B;  3R5G A;  4OYI A;  1WC4 A;  2GVZ A;  4OYW A;  1CJK B;  4OYX A;  3ET6 B;  1CJV A;  1YBU A;  4USU A;  5D15 A;  1TL7 A;  1Y11 A;  4UST A;  3C15 B;  1U0H A;  5D0G A;  4OYB A;  1AZS A;  4CM0 A;  1AB8 A;  4P2X A;  4CLT A; 
#chains in the Genus database with same CATH topology
 2K06 A;  3BBB A;  1S9G A;  1GQE A;  2FZG B;  2PA3 A;  2D7S A;  4LRE A;  5DQI A;  1NPP A;  4WK1 A;  4ANE A;  2XO6 A;  4N76 A;  4WP3 A;  1NZA A;  5DG9 A;  4MKB A;  3MOJ B;  1YJV A;  2YBV A;  2UXB J;  1NHV A;  1N32 F;  1T02 A;  1S7H A;  2K7K A;  2H51 B;  1S1V B;  4WFA Q;  4KGX B;  2DH7 A;  3HLU A;  2R7W A;  1RTH A;  4ID5 A;  4OFZ A;  4K0K F;  3MMC B;  1LXJ A;  1NLK L;  2MY7 A;  1RU1 A;  4TNO A;  3F44 A;  2HGM A;  3EPI A;  4ECU A;  2N7Y A;  1FDB A;  4NLU A;  2E5G A;  1F2G A;  1RYR A;  1CUL B;  2JDJ A;  4M5D B;  3CCQ S;  5J1E A;  1MRO B;  1YJU A;  2EXU A;  4DLG A;  3O5T B;  2H4W B;  4OZ2 A;  5L38 A;  4PCQ A;  4ERD A;  3IG1 A;  4DV4 J;  2AF6 A;  3T9N A;  4P2F A;  1WEX A;  2OI2 A;  4IG3 A;  2KHD A;  2V8H A;  5KFJ A;  4USJ C;  2XLI A;  3TQ1 A;  1P27 B;  2L9N A;  4OQJ A;  4LFA F;  4QWB A;  3UQS A;  2OMO A;  3BM7 A;  2WSC C;  3L9Z A;  4O3N A;  3J7Z T;  5KFP A;  2L41 A;  2CUY A;  3VGV A;  3ZTQ A;  4OYP A;  1MSW D;  3C19 A;  3G6E S;  4QYZ K;  3PKY A;  3IWN C;  3KJN B;  1X4H A;  1TKD A;  4MJK A;  8AT1 B;  2VJU A;  4HDH A;  3PRV A;  3KWM A;  2V8V A;  1CC7 A;  1T95 A;  2BA9 A;  3ETO A;  2RHQ B;  4J7C A;  5CZV A;  4EUV A;  4DX6 A;  1UWA A;  4IUF A;  2FJE B;  1U1N A;  1YIJ S;  2VA3 A;  1X5S A;  1YRX A;  3NLC A;  5KFN A;  4B3R J;  1LWF A;  3JSM B;  2JFD A;  4WTO B;  2WVF A;  3GJS B;  1TUW A;  2Z8Q A;  5IT0 A;  1U1P A;  4Q2L A;  1H74 A;  4TQR A;  2KT2 A;  2Y1R I;  4HHH A;  4DX5 A;  3PHE A;  4DR4 F;  3PG9 A;  4O4R A;  1DAX A;  2HFZ A;  5SZT A;  1NK9 A;  3M6V A;  2UUB J;  3MHY A;  1EQM A;  3D28 A;  2A10 A;  3T1H J;  4NRU A;  1QDU B;  3KUE A;  3HHL B;  3L95 X;  2A2D A;  4H4K C;  4JUZ A;  2UUT A;  3EM1 A;  3TW0 A;  3I32 A;  4TQS A;  2XMU A;  3K57 A;  1U8W A;  1Y4Z B;  2OP5 A;  5HVH A;  2H65 B;  2FJV A;  3G6Y A;  2G1H A;  4K5S A;  3EXY A;  4IG0 A;  4DV7 J;  4ZP8 A;  2EWH A;  3MED B;  1FRL A;  1DQA A;  2ZDO A;  2OGU A;  4JYA J;  2YNI A;  4ZCL A;  2E1C A;  2QTW A;  4EYI B;  1QAX A;  2I9S A;  3RB6 A;  1TK5 A;  4OX9 F;  4C8Y A;  5F8H A;  5B0B A;  1RI7 A;  2ZIT A;  3JXO A;  1WDT A;  3K58 A;  3CJQ A;  2XZW A;  4G6V B;  3X3U A;  2HG4 A;  5B09 A;  5GAD U;  4F2S A;  4FF1 A;  3UDV A;  2NCK L;  5DJB A;  2J6U A;  4KYZ A;  1XR6 A;  2OFH X;  3I0S A;  1B99 A;  5LL6 d;  2CWX A;  1NKB A;  3CED A;  3P49 B;  1U47 A;  1WG4 A;  1UPP A;  2MQQ A;  1QSY A;  4BC9 A;  2BJE A;  2V34 A;  2HRT A;  4LFC J;  2H5I B;  1U8S A;  2YWK A;  3EUN A;  5GAE I;  3VQS A;  4DV0 F;  4PPZ A;  2RAQ A;  3GYG A;  4NLX A;  4OZJ A;  4ZPT R;  5ETL A;  4YME A;  3CNQ P;  1HHS A;  3DDN A;  3OTD A;  1CPZ A;  2Q43 A;  1RWX B;  1OWX A;  1VDH A;  4ID5 B;  4RR5 A;  3PVX A;  4C0O C;  1K1S A;  1SH3 A;  1Y5I B;  5DO2 A;  2AGQ A;  5IWA F;  3PRB A;  4L73 A;  3PIP Q;  1DAR A;  1TKT B;  2ZE2 A;  5IXU A;  3VAK A;  2DR6 A;  3G9C A;  2CQB A;  1VQK S;  2FHO B;  5D0G A;  3BR8 A;  2MSS A;  3QSI A;  4OYB A;  2Y1J A;  3HX9 A;  2MY8 A;  2V0N A;  4OZ0 A;  5CHC B;  3Q2S C;  3MPW A;  3VAL A;  4CLT A;  4YOE A;  1DTQ B;  1KOH A;  3C3L A;  3HO1 A;  1HIY A;  3JYT B;  1S0N A;  2FDN A;  4L72 B;  1RA7 A;  2XNQ A;  2VBX A;  1HNZ J;  2XZD B;  1KHV A;  2VOO A;  2MZR A;  1TP7 A;  2JWN A;  3D1Q A;  4NLV A;  1CBK A;  1VC5 A;  4JI7 F;  1IM4 A;  2PT0 A;  3I6P A;  4KO0 A;  1A7G E;  3L4B C;  3GMG A;  2YX4 A;  5ETO A;  3AY0 A;  5J2P A;  1QSS A;  1WTF A;  5KFV A;  1B64 A;  1VLY A;  1VIX A;  2EW9 A;  1DTQ A;  1N88 A;  2CNL B;  2KH9 A;  2A18 A;  3W62 A;  4EBE A;  3DMJ B;  1XNR F;  3HK2 A;  1R0C B;  3CD7 A;  3RW6 A;  2ZH7 A;  3N4W A;  4O4G B;  3ZTP A;  2ZOM A;  4Z7Y A;  5HP1 B;  3D67 A;  4F0K A;  5FD1 A;  3OHB A;  4RL1 A;  3DLH A;  3N28 A;  1KC8 T;  3H4D A;  1Q8K A;  1NK7 A;  3KNA A;  1BQX A;  3JQK A;  4LF4 F;  1FRH A;  4FDF A;  2RVJ A;  4JI6 F;  5IV4 A;  1F0X A;  1SL0 A;  2JNJ A;  2FHK A;  3NWR A;  3ELH A;  2OD6 A;  2AGO A;  4V19 J;  3QFH A;  2AKW B;  1JLB B;  1FRK A;  2EFP A;  1SJ1 A;  2HMI B;  4B17 A;  3GPA A;  4LSN A;  4B08 A;  3M2R A;  4EYH B;  4X62 J;  1WJ9 A;  4ECT A;  4DCJ B;  4U7C A;  3UW1 A;  2NXJ A;  1ARO P;  2XMW A;  4PXB A;  5T7L B;  5BR8 F;  2IM0 A;  2BUN A;  4JBC A;  4USM A;  3KLV A;  4ELT A;  4XIU A;  3GJR B;  1H3D A;  1IR1 A;  1JXL A;  2RF2 A;  3IP0 A;  1REG X;  2GVZ B;  2HAF A;  2KO1 A;  3I9Z A;  3JSB A;  3IM8 A;  3UPF A;  5IOL A;  3KHG A;  2ZHA A;  1J5O A;  4OHV A;  2CJK A;  2DBB A;  4K4U A;  4OI3 A;  3SCI E;  1ZM2 A;  2R9L A;  2DIV A;  1IBK F;  4EO8 A;  2DKO B;  4B3T F;  2JVO A;  4ITS A;  1RUS A;  5T7L A;  4CLZ A;  2DNQ A;  3OVA A;  1ZM3 A;  5L9X A;  5ETP A;  5LSR A;  3NEK A;  3Q8S B;  2ZJR Q;  5H9E J;  1LNQ A;  4YHH F;  4DL7 A;  2XNR A;  3HHN B;  1AFI A;  2MQO A;  2O67 A;  1WHW A;  2CPY A;  4OI2 A;  5DDP C;  2BJ7 A;  4C0B A;  3I4H X;  1MNE A;  1OYD A;  2BKO A;  1FRI A;  1SV5 A;  3OLA A;  1LWC B;  4ECV A;  4JV5 F;  1S48 A;  5DET A;  5K5M A;  2WHO A;  1YWX A;  3DYA B;  2R8K A;  4JI2 J;  3V6H A;  3WHI A;  4URS A;  4A8X A;  4LRB A;  3VGT A;  1OY9 A;  4FYV B;  3TOQ A;  1S9F A;  2VKR A;  2XLJ A;  3LWL A;  4W98 A;  3DGV A;  3BGL A;  2QA4 S;  2XS2 A;  5A6P A;  1NUE A;  4JI3 F;  2EFN A;  4LF6 F;  2NQP A;  2EI5 A;  1X0P A;  4NLS A;  5M2R A;  3MUR P;  2CRL A;  3M9O B;  2JJ4 D;  2IAJ B;  1S6Q A;  1VBK A;  2EBE A;  2CPX A;  4FPI A;  3R5A A;  2ZKT A;  3CJ4 A;  3CXC R;  4EEY A;  3WIU A;  2XGQ A;  4USH A;  3CJ2 A;  3ITH A;  2V50 A;  4L74 A;  5LSO A;  1G4C A;  4ECW A;  1L3T A;  2JC1 A;  2PD1 A;  4P2S A;  1JLB A;  2GVZ A;  1YJT A;  2E5J A;  2QL9 B;  2YNG B;  3HKW A;  3EDR B;  3GSI A;  2DHA A;  5KG1 A;  4RW4 A;  3BDE A;  4JV1 A;  3CWJ A;  3VZH A;  1IJF B;  1NSQ A;  1U1K A;  2B4P A;  4KKO A;  3R9L A;  4JI5 F;  1C1B A;  3TAM B;  3GIJ A;  3AA9 A;  3WZ0 A;  3H5U A;  2ZJP Q;  2GS8 A;  2CQI A;  2RUG A;  3OL8 A;  4QJV A;  1Q8B A;  2VFR A;  3HHL A;  4OLP A;  2VPX B;  2B0G A;  3TA0 A;  5HP1 A;  2DIT A;  1B0T A;  2LQ8 A;  2PMW A;  4YS2 A;  3QRQ A;  1TEL A;  2W2N P;  1RAI B;  4DR3 F;  1VIS A;  4GVB A;  2N82 B;  1NPK A;  4QIG A;  2MKC A;  3NGR A;  2XHW A;  2AJ1 A;  2ZNY A;  3POT B;  1BWE A;  5A8R A;  2MB0 B;  2GIR A;  4WCE Q;  2ALY B;  3LO3 A;  1HA1 A;  2CYY A;  2C3Y A;  3R5C A;  1RJJ A;  3NBP B;  4QIV A;  2DNM A;  4DF8 A;  2CNO B;  1T9W A;  3QZ7 A;  1T9T A;  2ASD A;  3OTE A;  2HIY A;  4ZCK A;  1KQG B;  1EP4 A;  3I87 A;  3MMJ A;  4LIR A;  4WP8 A;  5FDL B;  5U47 A;  2MHN A;  5T41 A;  3OL7 A;  1WC5 A;  3L7P A;  2JEI A;  5KOX A;  4K4Y A;  1DTT A;  3MOZ A;  3LP2 A;  4CI0 B;  3TJA A;  3HVA A;  2R2R A;  3DU5 A;  3M7V A;  4P71 A;  3KMS A;  4DV0 J;  1X4C A;  1Y3K A;  2VPW B;  3GV8 B;  4PQU B;  3P3D A;  1NO8 A;  2F40 A;  3US5 A;  1N5V A;  2X1G A;  1R27 B;  2G0C A;  3BPD A;  4TXS A;  3Q24 A;  2VHG A;  4DV6 F;  2HFU A;  1O5J A;  2MZQ A;  2VFU A;  3K5P A;  3E3X A;  5J1N A;  1RT2 B;  4CLW A;  3V81 B;  5AXL A;  2HVE A;  3HI9 A;  3IS9 A;  3ICL A;  4M5H A;  1HNV B;  2KXH A;  4M5G A;  1XMB A;  5A2Q Y;  3TX0 A;  4KQZ A;  2DHX A;  1FE0 A;  5CQG A;  4O3R A;  4FNI A;  4DR7 J;  3MR6 A;  1QY7 A;  1H38 A;  3OTC A;  4C3M A;  2HHV A;  3C15 A;  2AZ1 A;  2VG7 A;  1JMT A;  2ZE2 B;  1GMW A;  2DCL A;  4DPY A;  1RT4 B;  4FF4 A;  2O5D A;  1RWM B;  3BGU A;  1G1X A;  9RUB A;  2JEF A;  2F65 A;  2NUU G;  1M5S A;  1EZZ B;  2WON B;  4I69 A;  2MKS A;  3PW4 A;  2QSF A;  3QJP A;  3CDW A;  2D9O A;  3FBF A;  4GVB B;  4Q8E A;  1WI8 A;  4DL0 C;  1JLC B;  3DLE A;  3KG4 A;  3GCX P;  4N5S A;  2W4P A;  2QFI A;  1FJG J;  1IM6 A;  1WF2 A;  3AD7 C;  3B6B A;  4CLK A;  2W7O A;  2K1R B;  1BWV A;  3FSY A;  3IFE A;  5IM0 B;  1DBD A;  3CCR S;  3RW7 A;  1RBL A;  4DG1 A;  2I8E A;  4J9R A;  2YKN B;  3C6T B;  2J8A A;  4FS1 A;  1S9E B;  1QTN B;  3RZA A;  4J9M A;  1CQM A;  5EDW A;  2YKP A;  2HQF A;  4FYD A;  4IG0 B;  1AZS B;  1GNK A;  2V2K A;  2OPR B;  4DUZ J;  4UQT A;  2ZH1 A;  3AAW B;  2OPQ A;  3LTO A;  4HHU A;  1ZAW A;  1AW0 A;  1FE4 A;  2E1M C;  3P6Y C;  2G1D A;  2OD4 A;  2WRM A;  1XIQ A;  1BGX T;  3UE2 A;  3VV2 B;  3FFI B;  2BJ1 A;  3H2L A;  5FDL A;  2YWF A;  2XWY A;  4CLU A;  1IBM J;  3MWB A;  2ROE A;  1X5O A;  4A8Q A;  1FKP B;  2GQC A;  1X4A A;  2K3K A;  2XSF A;  2IY5 B;  2OHD A;  4X2B A;  3MEC A;  3CCT A;  3RYL A;  3P96 A;  1RU2 A;  3GG1 A;  1KDN A;  2HRU A;  3Q8R B;  4DX7 A;  5EGY A;  3E01 B;  4S0M A;  3EVO A;  5LJ3 Y;  4RNF A;  4U67 Q;  2IIH A;  2LXF A;  4TY9 A;  1B0P A;  4OIX A;  5HO4 A;  5CYQ B;  3DLK A;  4TU7 A;  4PYD A;  1SC1 B;  2UVV A;  2C3O A;  2AV5 A;  2PO4 A;  3KLH A;  2DIU A;  3MF5 A;  1U2F A;  3U02 A;  5EHH A;  1IR0 A;  2ACY A;  2CQ4 A;  4RW6 B;  2YPY A;  4F3M A;  4NAS A;  1RWO B;  5HQ8 A;  3QLH B;  4HYK A;  3MCO A;  1IBK J;  2HHQ A;  1SPB P;  3VVU A;  4Y34 A;  3ET6 B;  3MM9 B;  7FDR A;  4Q5V A;  2HW3 A;  3HD1 A;  5HVF A;  1RLC L;  1SC3 B;  3IRX A;  4NEZ A;  4Y2A A;  2R8J A;  1JLF B;  2GA7 A;  2L08 A;  4KV8 B;  3UWT A;  3MAQ A;  1VC0 A;  4NCA A;  2DEI A;  1QUV A;  3N01 A;  3S7R A;  3CUN A;  3PNI A;  3SSQ A;  1HL6 A;  3GLJ A;  4U96 A;  2YWE A;  4XPE A;  5HAT A;  4LJM A;  5C25 A;  4DQR A;  1S4E A;  3FK4 A;  4NX9 A;  1H6K X;  3ZZR A;  4UOG A;  3N0V A;  4NZ6 A;  2AGP A;  3J81 U;  2IRU A;  4NLQ A;  4Y28 C;  2MKK A;  2I5J A;  1NJX A;  4DSF A;  1S1V A;  1TUV A;  3BF4 A;  2VUG A;  1Z4U A;  1JX4 A;  2OJ3 A;  1LFP A;  3S1T A;  3QGI A;  4ZA1 A;  4DS4 A;  3UD4 P;  3IR5 B;  2CPZ A;  2N3O A;  1FNO A;  4M95 A;  4GVL A;  4H4K A;  2AT1 B;  2CZ9 A;  2R2T A;  4EI2 A;  5I3P A;  1DZ5 A;  1RSC A;  3C16 A;  2IYG A;  2KKH A;  5CYQ A;  2XMJ A;  5D0H A;  5DM6 Q;  3KJV A;  1DUR A;  4WTY A;  1WOR A;  5IQ6 A;  4ED3 A;  2ZD1 A;  3F56 A;  1V3S A;  3RRG A;  2K3I A;  2M52 A;  3ENA A;  2GVD B;  4F67 A;  4KHP J;  2AMC B;  2CA9 A;  1ZA1 B;  2GO9 A;  5DZ7 A;  3W1Y C;  3O2I A;  5DLF A;  2HYI B;  1VQY A;  3TZY A;  2MZ1 A;  2J7U A;  1RKI A;  1XBW A;  4PAA A;  2R8I A;  4F26 A;  4DV7 F;  2R4F A;  1YJW S;  3LUY A;  1HYS A;  2OPS B;  1C1C B;  1CJU A;  5DRK A;  4ENO A;  4IDK B;  2R7U A;  3KHL A;  2CXE A;  1M1H A;  3J7Y U;  2G2O A;  2VBZ A;  4JOU A;  3F73 A;  1LKZ A;  3LWM A;  3PW7 A;  1TAU A;  2WZ1 A;  2OPR A;  4XDC A;  4RW8 A;  3TWZ A;  2GIQ A;  4JI0 F;  5KG6 A;  4BWM A;  1U09 A;  3MTJ A;  5CYM A;  3D1O A;  4F3Q A;  4JV0 A;  1IKX A;  2VDI A;  4XO0 A;  4PUO A;  2OSR A;  1YJN S;  4DZD A;  1RYS A;  3EGV A;  3K17 A;  4WIQ A;  4DR2 J;  1L3V A;  4DPX A;  3QIP A;  2FTR A;  2V8G A;  1Q7L B;  2J7K A;  3DKD A;  4ZP9 A;  5F3Z A;  1EB0 A;  2DNL A;  3DRY A;  2ZVS A;  3I0R A;  2YX7 A;  1FK9 A;  1U4B A;  3Q83 A;  4MT1 A;  2ZM6 J;  1BXN A;  4LBI A;  4F2R A;  3QQC D;  2CQC A;  2DCU B;  1FDA A;  4ETX A;  5L9N A;  2YQ3 A;  3M8R A;  1PIE A;  4G1Q B;  1BY9 A;  2B3T B;  1U7L A;  2ZOG A;  2HEK A;  1YK9 A;  1SIZ A;  3HSZ A;  3MXH P;  4DS5 A;  1Y00 A;  2ZD1 B;  1GTE A;  5D4N A;  1RBO B;  2GHV C;  2C3M A;  4PXE A;  4UF4 A;  3K59 A;  4DV3 F;  4B9V A;  5JJB A;  3R2D J;  4O44 B;  5JXS A;  4FBT A;  4PYA A;  3MMC A;  4IH7 A;  3PDN A;  1KOO A;  3MFI A;  2NXC A;  2QG9 B;  2R3V A;  4C8N A;  2QV6 A;  4CYU A;  1RAD B;  2CG4 A;  5K20 B;  1ZA2 B;  4K0K J;  2V2Q A;  1KVK A;  4ED5 A;  1AUS L;  1WC3 A;  2VL1 A;  2HLT A;  1H2V Z;  4ZIW A;  5D4L A;  3HHK A;  4C48 A;  3DRS A;  2IMO A;  2XMM A;  2ZFH A;  1KRP A;  4JI7 J;  1ZPW X;  4E98 A;  1S76 D;  1T3O A;  2GJF A;  2E66 A;  1WF0 A;  4M8L A;  3ZTS A;  1N5T A;  2VQE F;  1F9F A;  1U6F A;  2LU2 A;  1T94 A;  4LR7 A;  1RTD A;  2GHP A;  4CNZ A;  1JLA A;  1JKH B;  1I94 J;  3SQG B;  3NKY A;  4LFA J;  4GC6 A;  2MHE A;  2DNG A;  1SKS A;  2VOD A;  3A3N B;  1C0U B;  1DRZ A;  1JLC A;  1HMV A;  3LP1 A;  3D9B A;  2LEC A;  3KOA A;  3DHW C;  4B3S J;  3M8Q A;  1HQ2 A;  2E5H A;  3HVT A;  1SH2 A;  1HQE A;  5I3Q A;  2PC6 A;  1U0H A;  4ZS6 A;  1YRU A;  2D3U A;  3EX7 B;  1GH8 A;  3IWL A;  3OD2 A;  3OPK A;  2FLO A;  2CVE A;  4CM0 A;  4H4M B;  2BQU A;  2J9C A;  1PC4 A;  4F04 B;  2AWZ A;  3UCG A;  3FRY A;  4DR5 F;  5ETV A;  5HLF A;  4W90 B;  2CAJ A;  1Q82 T;  1RT4 A;  2J7W A;  1DY3 A;  5HK4 A;  1QVG R;  3BQ1 A;  3Q8P B;  1S1T B;  4Y2C A;  1Q5V A;  1RWV B;  3Q22 A;  2WOM B;  2E7X A;  1V5V A;  2H3E B;  1H72 C;  4E8U A;  2UV8 G;  2B5J A;  2G2Z A;  1M0S A;  4Q2M A;  4KBI A;  4DX8 H;  3U1N A;  1E6V A;  2M3D A;  2RRB A;  3MUM P;  3V4I B;  3G71 S;  4USI A;  5F8G A;  2FPH X;  3LAL A;  1LXN A;  3ISN D;  1JLA B;  1A0O B;  2DRD A;  3Q23 A;  4LFB F;  2HRY A;  2H54 B;  2L9W A;  3THV A;  5E41 A;  4ZVO B;  4F50 A;  3KLI B;  2XSJ B;  4CCH A;  1LK7 A;  2GW8 A;  2M88 A;  1H0H B;  3MM5 B;  1IQZ A;  3SCK E;  2XBP A;  3CD0 A;  5BYR A;  1X5P A;  4LF9 F;  2AX1 A;  1F5B A;  4DUY F;  3QWP A;  1CS4 B;  2ZC3 A;  4H4O B;  1G2E A;  4NXM J;  1FES A;  1U0H B;  2I0X A;  2DNY A;  2IYI A;  2NXU A;  3DFE A;  1RB0 A;  2V2V A;  3MD1 A;  2UUW A;  3NOG A;  5FII A;  3RAM A;  3QO9 B;  3H42 A;  4UUX A;  4LFC F;  3TA1 A;  4NA1 A;  2W9C A;  1NRK A;  1JB0 C;  2B8P A;  3H90 A;  4LRF A;  3BSO A;  4WJB A;  1HWU A;  4XK8 C;  2GAH C;  4ECY A;  2EC0 A;  3A8I A;  3G96 A;  2JLF A;  3NRB A;  5M2U A;  1FXR A;  2ADB A;  3BKT A;  4MH8 A;  3DRP B;  1XNQ J;  2AYE A;  3TNV A;  1LV5 A;  3P5B P;  3GYX B;  4Y6I A;  1C1B B;  1L3S A;  5GAD I;  3M8P B;  4B3O A;  4NMX A;  5GAH U;  1WOS A;  2W2P P;  1IWA A;  4HLB A;  4NCB A;  4F4X A;  2CJA A;  3C66 A;  5K8O A;  1FER A;  1J27 A;  2RIL A;  3DHX A;  3IA0 A;  1WHX A;  2KJV A;  2W4D A;  1MWY A;  2VPZ B;  2Y1I A;  1HHT P;  1V3Z A;  4ZLL A;  3HD2 A;  1U24 A;  2QSW A;  3OR1 B;  4OHW A;  4DHV A;  3IMQ J;  5MAO A;  3AA8 A;  3HSD A;  4YR0 A;  1RTI B;  2EKN A;  3CCL S;  3V6J A;  3DDK A;  3EMT A;  4I0W A;  4I56 A;  4ZDN A;  2XSJ A;  2BZ2 A;  4NLP A;  4QR2 A;  4KC5 A;  4LVO P;  3DOK B;  2WW4 A;  1T03 A;  3IO1 A;  2QJ3 A;  4NLT A;  4AYB D;  3A8J A;  2M4M A;  2GX8 A;  4ZCM A;  1NXI A;  1P1T A;  2C2N A;  4M1K A;  3ILL A;  4IO9 Q;  1M5O C;  3CD6 S;  1SJ3 P;  5EN1 A;  4M5K A;  2B9X A;  2LQB A;  3OQ2 A;  5KFH A;  2H5J B;  3DDI A;  4CH0 S;  3CGI A;  4WPA A;  1SIW B;  4QZV B;  4HTI A;  2XC9 A;  4G65 A;  3G8Q A;  4RW9 A;  5GVQ A;  5C42 A;  3DOK A;  4GC7 A;  1LWF B;  3BEG B;  3TJ9 A;  3JSM A;  3KJV B;  3JS9 A;  4J9P A;  2V6A A;  2DGQ A;  3HT3 A;  1JLF A;  4X4Q A;  1FD2 A;  2CNN B;  2FY8 A;  4K4S A;  2Q6B A;  2GJI A;  3VAH A;  5E33 A;  3RBZ A;  2W9C B;  1Y11 A;  3QID A;  3TO8 A;  5MLC V;  5J2M A;  3OFH A;  5C42 B;  2BR0 A;  4ZPC A;  4NXN J;  4OZN A;  3CO9 A;  4LF1 A;  1HI8 A;  4GKK J;  3BQ2 A;  2HAI A;  5D4P A;  2CJY B;  5JMN A;  3LGM A;  1T05 A;  4KH1 B;  5G0R B;  3T6B A;  3A4T A;  4B3O B;  3GB0 A;  1MN9 A;  3M9M B;  1TUG B;  5KG0 A;  3MFH A;  3SV4 A;  4X4U A;  1RT6 A;  2AP6 A;  1VCT A;  2HHX A;  4QW9 A;  1OY8 A;  5D77 A;  3PYD A;  1RWU A;  1HAR A;  3OSN A;  1T8E A;  4P2M A;  4ILR A;  4O3O A;  1RHM B;  2R7V A;  1RQ0 A;  2C2O B;  5F0U A;  5FJ4 A;  2J76 E;  3ZNJ 1;  1TL7 B;  1O51 A;  3OJS A;  4DL4 A;  2F3J A;  2AIR B;  2VB6 A;  4XTT A;  3LGN A;  4L76 A;  3SYZ A;  2DIS A;  4UUW A;  2L3M A;  2MLX A;  5EX3 A;  2KFN A;  4QYR A;  2K7J A;  3PX0 A;  1N56 A;  4OYZ A;  1VOM A;  2OIH A;  1D9D A;  4NI2 A;  2MQN A;  3W2V B;  5E0O A;  1OY6 A;  3HMJ G;  3C6U A;  2QEX S;  2KT3 A;  3V4I A;  1OS5 A;  5DGA A;  4B3S F;  3UN3 A;  3GYN A;  1GMV A;  2Y3Y A;  3N79 A;  4DLE A;  1CQN A;  5ETS A;  4CLS A;  3DLG B;  2QLB B;  2V4J A;  1GMU A;  3BGR A;  4I7F A;  3W8G A;  4C6A A;  2QFJ A;  4GO7 X;  5CCM A;  3R1H A;  3KK2 A;  3HF5 A;  3RBE A;  4DQP A;  1HNW F;  4DFJ A;  3R6L B;  4C3K A;  3GV5 B;  2W8K A;  3KNG A;  2ABY A;  4E0D A;  1FI4 A;  1U25 A;  2XMA A;  2KVQ E;  1AYE A;  1ZAV A;  2IDE A;  5C24 B;  2FD2 A;  3ZFV A;  1FVS A;  5EWE A;  3GV7 B;  4DWI A;  3QRP A;  2GAG C;  3DRX A;  1UKU A;  3D3B J;  3FCV A;  4EK2 A;  4NXN F;  4K4V A;  4GKK F;  2MZJ A;  1TL5 A;  3BGF A;  2Q3P A;  3UDL A;  2W1B A;  2DXE A;  5F8J A;  4QWE A;  4JI5 J;  3W66 A;  3TEG A;  5LMU J;  2MKH A;  3PYE A;  3VVT A;  2MLY A;  2YNH A;  1T03 B;  1UVN A;  1RBA A;  1R31 A;  3MAA A;  1Q86 T;  4JI4 J;  4KE5 A;  3ILO A;  2OPP A;  4PG4 A;  1JLE B;  1FRM A;  1SJQ A;  2HVD A;  4IFV B;  2BE7 D;  3TAM A;  2WCX A;  2KXN B;  4PWW A;  5KFY A;  1T7P A;  2MDA A;  1FK9 B;  5L1J A;  4WKY A;  4M5N A;  4EFA C;  3CME S;  2CQH A;  4IOB A;  1N34 J;  3NGS A;  3SSR A;  2CWK A;  3CC7 S;  2J0S D;  2QLW A;  5LSL A;  3TR5 A;  3NS5 A;  1VQP S;  1PSD A;  5IT4 A;  2NXN A;  3OHA A;  1FF2 A;  5AT1 B;  4LVN P;  3W2W A;  1JK9 B;  2W7A A;  3R3T A;  2X1A A;  1HBN B;  2DY9 A;  2VFV A;  3W2V A;  3KK2 B;  1G7C B;  1S99 A;  4CYU B;  1RTD B;  2JC0 A;  1FA0 A;  1RE1 B;  3M30 B;  2VDH A;  3VAJ A;  4M5M A;  3BGO P;  5KG5 A;  1HLW A;  2E29 A;  3LQV A;  1CVJ A;  2HKE A;  2DGX A;  2R7T A;  1FJ7 A;  1NK5 A;  1AXQ A;  3UCZ P;  3OXF A;  3H0P A;  4B3R F;  1SXL A;  4DR6 F;  3S6E A;  3NGU A;  3M05 A;  3LH2 S;  1YG0 A;  4C7Q A;  6AT1 B;  5CD4 H;  4QCL A;  1Z1Z A;  2GC8 A;  2RQC A;  5KFE A;  3TEH B;  4YR2 A;  1Q5Y A;  2DNP A;  5IFM A;  2HK3 A;  3V6D A;  4RNO A;  1TL7 A;  1TL4 A;  3SQO P;  1HMV B;  3CC4 S;  4UZC A;  1F2H A;  2DJW A;  3M8P A;  2XY7 A;  2F1F A;  3ETM A;  3KK1 A;  2QMU B;  1XMQ F;  2FVP A;  2AJQ A;  1HBU A;  2EVZ A;  2ZJQ Q;  4CIO A;  2F4V J;  1KN6 A;  2RJZ A;  3HVW A;  5D6G A;  1KQK A;  2BJ8 A;  1G6B A;  2HZC A;  3BSC A;  3PFO A;  4OZL A;  1ZTT A;  1FJG F;  4LF5 F;  2YNF A;  3MEE B;  4FN5 A;  3ZZZ A;  1HR0 J;  4OMF G;  1FRX A;  2FLN A;  1S6U A;  2PFF B;  3DRS B;  3UD3 P;  3OVS A;  3C2P A;  3SXL A;  3ZZ0 A;  5KFG A;  3K8W A;  2VU5 A;  2HGN A;  4V1A k;  2BXJ A;  2FGO A;  3QLH A;  2YX1 A;  4ZVG A;  2HS4 A;  1EAR A;  1PYS B;  3O3L A;  5AXN A;  3H98 A;  3BN4 A;  4RUB A;  2R7O A;  4H54 A;  4P10 A;  1NH8 A;  2OEL A;  3GR1 A;  3S8S A;  4L75 A;  5A8W B;  2KM8 C;  3GIM A;  2NYI A;  1IBC B;  2V4R A;  2W2Q P;  1NZ8 A;  3TX8 A;  2D3Z A;  4Z37 A;  2HZV A;  2HNZ A;  4LF6 J;  3IG1 B;  4WYL A;  1HPZ A;  3F41 A;  5AXM A;  2VD3 A;  1U1R A;  1UA0 A;  1ZM9 A;  4I6Y A;  2IC3 A;  3GP9 A;  2UXD J;  3E51 A;  2BV3 A;  3QZ8 A;  2UP1 A;  2XS5 A;  2D41 A;  4X66 F;  2OPS A;  2C2E A;  4MKV A;  2XZT B;  4OV6 A;  5DG8 A;  1RT7 B;  4DN9 A;  2DRA A;  4F3O A;  4MKY A;  2XB2 D;  5CAA A;  5IWA J;  3RG6 A;  1GXL A;  1MU2 A;  2B56 A;  2ROP A;  2DNZ A;  1NB2 A;  3EVW A;  3MCN A;  2XWX A;  3NGT A;  1R43 A;  1TMM A;  3GZ7 A;  3UNY A;  5KFL A;  4JV2 A;  5J2M B;  1BQM A;  3K8V A;  2NPI A;  3W9J A;  4OJ1 A;  7AT1 B;  1UVI A;  1SKU B;  1OJ4 A;  4PWU A;  4K2X A;  2F8E X;  2ZHO A;  4L3K A;  3B82 A;  4F02 A;  2Z56 B;  3AHP A;  2YQ1 A;  1UTA A;  1ZPV A;  2FJB B;  2XEX A;  1AA1 B;  1VGY A;  3N6L A;  4EGL A;  2MXY A;  2J0X A;  1R8P A;  1GTH A;  2GGP A;  5DDQ C;  2HWT A;  3SDE A;  5KT6 A;  2GV1 A;  5ETQ A;  3QT7 A;  2YY3 A;  1FT8 A;  2V9K A;  1VK3 A;  2BJD A;  3SFU A;  3ADA C;  3MUV P;  3DLL Q;  4LF5 J;  2IJN A;  3SIP B;  1TFW A;  3QT5 A;  2MLZ A;  3Q8U A;  1HNI A;  1CC8 A;  1RK8 A;  1S7I A;  2F8M A;  2D9P A;  3KXD A;  1X4G A;  3CJK A;  1DLO B;  1NU4 A;  2IM1 A;  3D6F B;  1S4F A;  2KHC A;  2OO4 A;  2RKI A;  3AH6 A;  4ED2 A;  1PYO B;  4TYB A;  1WF1 A;  1RIS A;  2V9W A;  1XMO J;  1SC6 A;  3N9U C;  3NAI A;  3ZZT A;  3K5N A;  2EFG A;  4Y2M A;  3D7S B;  2DGT A;  1X4B A;  4LF7 F;  1U02 A;  1SJ4 P;  4U9R A;  4F4W A;  2C2R A;  2DO0 A;  4JI6 J;  3MR5 A;  3R7B B;  2ZH2 A;  3I56 S;  1H7W A;  3NMR A;  1NSP A;  2QLF B;  4ZIV A;  4OZ3 A;  4BS2 A;  1JQG A;  3KG0 A;  2JFK A;  3LA0 A;  2DHS A;  4RWX A;  4CT8 A;  5DQG A;  1YZ6 A;  3HUL A;  1HBN A;  3FQK A;  1M90 T;  4IYQ A;  1B70 B;  5DDR C;  4Q0B B;  3CVK A;  4K59 A;  5KFO A;  1TFY A;  3TI0 A;  1SVD A;  4CLF A;  2F8H A;  1IKY B;  3V81 A;  1SL1 A;  1SKW A;  1S6O A;  2J6T A;  5D8H B;  5J2P B;  4NA2 A;  5F3T A;  1CJK A;  3MDF A;  1XTZ A;  4ZIT A;  1PJ6 A;  2B4U A;  3G82 B;  4K5R A;  4WBF A;  2VG5 B;  5K8N A;  1OQ6 A;  3MI7 X;  1KWM A;  2LCW A;  4NCG B;  1YJR A;  1B7F A;  1P9Q C;  3CCZ A;  4J9O A;  2AHO B;  2HQD A;  5J1P A;  1LW0 B;  2OEK A;  4PQA A;  5L39 A;  3K5L A;  4OX7 A;  2KZZ A;  3U1M A;  1EP4 B;  2OPP B;  3R5D A;  3CJK B;  2DRB A;  2UUC J;  2XLK A;  5B7W A;  1TK8 A;  1U0S A;  3BYP A;  1T05 B;  2Z30 B;  2IM3 A;  2V5H G;  3T19 A;  3M8S A;  3J7A N;  2IC3 B;  4RLE A;  4B9N A;  2MMY A;  3FMW A;  1SB6 A;  1LW0 A;  4LSL B;  1NDC A;  2EK6 A;  3BJY A;  3DU6 A;  2IRY A;  3EGZ A;  2MST A;  1Q0N A;  4QQB A;  3AD9 C;  4N7T A;  4OZ1 A;  1AFJ A;  2QGF B;  6FDR A;  1BD6 A;  3AXM A;  2HQC A;  2EFQ A;  2HND B;  3J7Y I;  1NKC A;  1M5P C;  4IR1 A;  1VQN S;  2CDR B;  3VGU A;  4CLY A;  1HQE B;  2HHH F;  1TKZ A;  1FX4 A;  2UXC J;  1YIT S;  1B0V A;  4UOH A;  4NLO A;  4ELU A;  4DV3 J;  2GCF A;  3BH6 B;  2QC3 A;  2B43 A;  1UFK A;  3CMQ A;  3GIL A;  2HQI A;  1T9Y A;  4OI4 A;  5JUM A;  4ZLJ A;  3IGN A;  1OIA A;  1PJ7 A;  1UFW A;  2Y0B B;  2GNK A;  3H59 A;  2HQG A;  1V3R A;  4P6Q A;  4DFM A;  1S49 A;  4PPD A;  3HJF A;  3GII A;  2XQC A;  4HAC B;  3FZB A;  1SUQ B;  4UOF A;  1RAC B;  2HBY B;  2RDJ A;  2BVZ A;  4EZ9 A;  3SBM A;  1S1W A;  2FVS A;  4J37 A;  1RT3 B;  3FEX B;  3FBC A;  2FC9 A;  4HR2 A;  2QL7 B;  2HIQ A;  5F41 A;  4C11 B;  4ER8 A;  4OX9 J;  3W60 A;  1YTY A;  1JJ2 R;  1ROF A;  1TK0 A;  4ZJL A;  1GXT A;  3EZO A;  3NG8 A;  2LFV A;  2O1P A;  4LBH A;  4ZVU B;  4RNM A;  3GIK A;  2QA4 G;  3H25 A;  4LF7 J;  3HVT B;  4E2F B;  2J6S A;  3HPO A;  1D8Z A;  4ED6 A;  3HJV A;  1IKV A;  4MFB A;  4NYO A;  4TU8 A;  1SUQ A;  4ICL B;  4ZPD A;  1UET A;  1PAE X;  1YRT A;  2U1A A;  4WWS A;  3UFC X;  5KFB A;  2BM1 A;  4O3S A;  2VKZ G;  3M9N B;  3KYL A;  3FSI A;  1XN9 A;  3A8E A;  1TKX A;  4R0J A;  3PJX A;  4WE1 A;  1QAY A;  4YB5 A;  2HK2 A;  5A8R B;  4PG5 A;  3JSY A;  2W2O P;  4QR0 A;  3ITH B;  1X0F A;  4IOC Q;  1N4L A;  4HI1 A;  5D78 A;  3RUB L;  2IPO B;  4RBT A;  2RIJ A;  4AL5 A;  3OV7 A;  3V6K A;  2FJA B;  1GX6 A;  4ELV A;  3SCL E;  3MCM A;  2UV8 A;  3EXC X;  1TAQ A;  4PR6 A;  4DL5 A;  2ZDP A;  4USK A;  5E3Q A;  4L3N A;  1F5A A;  4Q7A A;  5KFI A;  1T11 A;  2LVW A;  4DV2 F;  1R0A A;  5D3G B;  3AQP A;  1DFD A;  3G8S A;  1X9W A;  3VF0 B;  5D0R A;  4ZCI A;  1R8C A;  3EVM A;  2CQ1 A;  4J9Q A;  2WB1 D;  1TV6 A;  3T41 A;  1ACM B;  4ZPB A;  1REV A;  2H48 B;  4UZB A;  5KT4 A;  1F6T A;  1KP6 A;  4U95 A;  3ISN C;  3C46 A;  4NE9 C;  1VQM S;  1R3N A;  3KLF B;  3M2R B;  1FKA F;  2R8H A;  3M30 A;  1K1Q A;  4WFZ A;  1MRO A;  2DY1 A;  3IM9 A;  1E6Y B;  4RUH A;  4I6A A;  2QE5 A;  3MPU B;  3POT A;  3BBF A;  2Y0S D;  3R7N B;  2E7W A;  1NDP A;  3DI6 A;  3T9Z A;  4O23 A;  1I3O B;  3TVK A;  2Y8W A;  4MTP A;  4UW2 A;  4O4G A;  3GCW P;  3T5H A;  4OYM A;  2DNK A;  4USW A;  1WOO A;  1QE1 A;  2LMI A;  3CCU S;  1XNR J;  5KFF A;  3H20 A;  1RP5 A;  1X5T A;  4CO1 A;  1VQ8 S;  2H5E A;  4J5O A;  2MEW A;  1QAI A;  3IBF B;  1PAU B;  1QD1 A;  3CIM A;  2GIF A;  1XR7 A;  3D6T B;  4FYW B;  4KIA A;  3SZ2 A;  4P9S A;  4A47 A;  4RW7 B;  5IS2 A;  3ULH A;  3U27 A;  2VG5 A;  4W92 B;  4N8N A;  1CJV A;  3KTQ A;  1RTJ B;  2HBZ B;  2VG6 A;  3MM5 A;  2VOP A;  2BW2 A;  4HVZ A;  5CYM B;  5KT7 A;  2V63 A;  2HFS A;  2AEJ A;  2YNG A;  5CD4 A;  2M70 A;  2BOP A;  1RWP B;  3T3F A;  2ZZM A;  2R2U A;  2FJX A;  1R89 A;  1S1T A;  4ZVH A;  3DN9 A;  2OTL S;  3BRE A;  4OX6 A;  1VR6 A;  2LLZ A;  4NML A;  1AZS A;  4YDX A;  3MZI A;  1KKH A;  4RPF A;  2E1P A;  4C9D A;  1RAA B;  1AUD A;  1FNM A;  4CTA B;  1GFW B;  2B9W A;  2WVC A;  2DXF A;  2PE8 A;  3PTW A;  4R25 A;  5HAO A;  3CCV S;  2FHJ A;  2QA2 A;  1R8B A;  2RRN A;  3LP0 A;  4GO5 X;  5J1E B;  5LXR A;  2X1F A;  3NNC A;  3GE9 A;  2G2Y A;  2ACM A;  3MR2 A;  4FVM A;  3PFE A;  5B08 A;  2DR8 A;  3QAE A;  5LMN F;  2P2C B;  4X84 A;  5AXK A;  1S59 A;  1XR5 A;  5IV3 A;  2JLG A;  2N4C A;  3CMA S;  2ZOF A;  1UZH A;  2BEF A;  1FD8 A;  4Q43 A;  4HHJ A;  1NBE B;  2OLW A;  4C0H A;  1F3F A;  4QPT A;  4J90 A;  1S6P A;  4BLG A;  1APS A;  2WK4 A;  3KHR A;  4DSJ A;  2CKW A;  2UUA F;  5KTQ A;  4YUD A;  3BKU A;  3G82 A;  3W9I A;  1HNV A;  4F0M A;  3DOL A;  4DV5 J;  3D6H B;  4I7F B;  4LUB A;  4DQI A;  4JI2 F;  4BCA A;  4A8F A;  2YNI B;  3W61 A;  2B5J B;  2V94 A;  1Q8I A;  4NZ0 A;  4ZVQ B;  4WP9 A;  4M5I A;  1LEO A;  2XCA A;  4HKQ A;  4DPO A;  1N0V C;  3THP A;  3BDP A;  3R1L A;  1YJ7 A;  2CPJ A;  4NLR A;  1PIL A;  1W2I A;  3OFG A;  2BRL A;  2A2C A;  2AEF A;  4RBV A;  3QFW A;  2Q66 A;  3QRR A;  5A2Q U;  1NEE A;  4URQ U;  4DPU A;  2HHT A;  4M63 A;  1U2R A;  3WX8 A;  2GML A;  1NJI T;  2VBY A;  1UA1 A;  3G2X A;  1UL3 A;  2IVM A;  4FF3 A;  4OI6 A;  2FC8 A;  2GMH A;  2EG1 A;  3MCS A;  5E3C A;  4TN2 A;  3QNW B;  3UVJ A;  3DRR B;  1W7W A;  4DDF A;  2ZH3 A;  3OVB A;  2RSQ A;  1UJ5 A;  4DUT A;  2KT5 A;  4O0I A;  2F63 A;  1LOU A;  3C6U B;  4DR6 J;  1TU0 B;  5KFT A;  5KT2 A;  1JLQ B;  1NPR A;  4DR5 J;  2W4C A;  2B9Y A;  3EE3 A;  4ECQ A;  2HHH J;  3TUJ C;  1YHQ S;  3QAT A;  1S79 A;  1B3T A;  5GMK a;  3O6Q A;  4PXC A;  2DGW A;  1M1G A;  1Y7P A;  4CTA A;  4I64 A;  5HMX A;  1KVJ A;  1U2C A;  2M2B A;  2UXB F;  5L8R C;  4KPY A;  2VON A;  1HBO A;  3OR2 B;  2QLX A;  5LMN J;  1M1K T;  4HT5 A;  3SQG A;  1JLG B;  1RXO B;  4ZK7 M;  1YDL A;  1Z2Z A;  2XHC A;  4N47 A;  4C8M A;  1WUU A;  4ZLP A;  5KOW A;  1RHR B;  3IS9 B;  3MEK A;  3W5X A;  4F7V A;  4C8K A;  4RUC A;  5HL7 Q;  3G6V A;  4KAI A;  1HI0 P;  3UNG C;  1PKU A;  3D0H E;  1CG2 A;  2DEJ A;  3SSS A;  2VC1 A;  2E9Z A;  1FWP A;  2VG7 B;  1N36 F;  1ITP A;  3EGW B;  5C25 B;  3N6M A;  5T14 A;  1W26 A;  4HT7 A;  3RR8 A;  3HT0 A;  1X9M A;  3Q8V A;  2V67 A;  2WBR A;  3RRH A;  4ZOS A;  3SMZ A;  4CDI A;  1TL1 A;  2QA1 A;  3FMB A;  4AND A;  5DDO C;  5F8N A;  1S1U B;  4X64 J;  1Y5N B;  4NXM F;  1MML A;  2K1R A;  4WK3 A;  5IM0 A;  2ASL A;  3W65 A;  5GME A;  1FX2 A;  1D3W A;  2LA4 A;  3ET6 A;  3ISZ A;  1O6X A;  2CPD A;  2HHP A;  2YWG A;  4MK9 A;  1LWC A;  2UZA A;  3CJT A;  4KRW A;  2AJ2 A;  3RAQ A;  3TYT A;  3BBC A;  3HCX A;  4A8W A;  1NJY A;  1SBR A;  2V2Z A;  2I2Y A;  4CT9 A;  2B4V A;  3KLE A;  1I5O B;  3ONQ A;  5C2G A;  4OHZ A;  4X66 J;  1NJZ A;  4G1P A;  2LQJ A;  1F9H A;  3D66 A;  3E8O A;  4DFK A;  1KQS R;  4O0N A;  3HXM A;  4HH1 A;  1GAO A;  2HNY A;  3PW5 A;  3C15 B;  4J9U E;  2XMK A;  4DBQ A;  3CDA A;  1ZM4 A;  3FSX A;  1J5O B;  3NCR A;  3CC2 S;  4D3H A;  1AB8 A;  3WX4 A;  1VQL S;  5AJ3 J;  2DXD A;  3BB5 A;  2QX0 A;  2KDO A;  4CNY A;  2V4Q A;  1S0O A;  2POK A;  4AL7 A;  4LF2 A;  1PYT A;  4P73 A;  4AD6 A;  2EBG A;  2HZA A;  2X1B A;  2B8Q A;  1VQ5 S;  2AYG A;  3QAU A;  3T5L A;  3G4S S;  1VHF A;  2FJW A;  1VRT B;  3BV8 A;  4B3M J;  3FDS A;  3KLF A;  2M8D B;  1N52 B;  3NGK A;  5F9N A;  4KT0 C;  4MMO A;  1P9Y A;  1RAJ A;  4IQX A;  1N34 F;  1JIH A;  3TZZ A;  3NS6 A;  1WTB A;  5CA5 A;  4P75 A;  3AQO A;  2RHS B;  3EWG A;  1HWL A;  4ECS A;  3OT9 A;  3KHH A;  4KTQ A;  3DM2 A;  2QT7 A;  3IN5 A;  3KK3 A;  3RTV A;  1CUL A;  1HW8 A;  2P9G A;  2RD5 C;  5HJY A;  1PGZ A;  2KYZ A;  4DI6 A;  1NK0 A;  4JI3 J;  1PBU A;  4K4Z A;  4YB7 A;  4PWD B;  3GFY A;  2HWH A;  2RDI A;  3MEG B;  3N6N A;  3DC2 A;  5K9F A;  3M8Q B;  5HMY A;  4KHP F;  5E3R A;  1ZZF A;  2NSC A;  2YKM A;  3E01 A;  5ETM A;  4CQ1 A;  1FFG B;  4JI1 F;  2RH3 A;  4YP3 A;  3X1L B;  2MYF A;  2NYH A;  4OI0 A;  3MPV A;  4JP8 A;  4OHY A;  2HHW A;  4DF4 A;  3RB0 A;  2BE2 A;  1S1W B;  4ICL A;  4LRC A;  3MM6 A;  4J9L A;  5GMD A;  4KKO B;  3BH7 B;  2ATC B;  5K14 A;  3W9H A;  4PG8 A;  4LF8 F;  1UEV A;  1VI7 A;  2YVS A;  4DEZ A;  3OTB A;  1RAO A;  3W5Z A;  2AYB A;  2BDP A;  4KY3 A;  1IUJ A;  4Q44 A;  2IVY A;  4WU3 A;  4PQU A;  2CNK B;  3RJM B;  2MQL A;  4M5J A;  5LJ5 Y;  2FVR A;  3CDE A;  2ZBQ A;  4DJB A;  1N54 B;  2APO A;  1XER A;  1FCA A;  2Q6C A;  3VWS A;  5B0G A;  3G86 A;  1SQE A;  1Q16 B;  1UEU A;  2GO8 A;  3FEZ A;  3DXS X;  1EKR A;  3NWG A;  2OPQ B;  4NYZ A;  2LQ9 A;  4O44 A;  2ZH9 A;  3T5K A;  1HR0 F;  2UUC F;  2RF2 B;  1UCN A;  1WEZ A;  3NBP A;  1QLN A;  1H73 A;  3V2U C;  4DSI A;  4R0E A;  5J2N B;  4BHQ A;  2QL5 B;  2OML A;  1XC9 A;  3NXZ A;  4IFV A;  2BW7 A;  3J80 Y;  4LF9 J;  2CIM A;  2AJ0 A;  4PWD A;  3MPD A;  4FYY B;  4DUY J;  3MMA A;  1X7V A;  2YPZ A;  4GRS A;  3ENW A;  5HMZ A;  1H98 A;  6FD1 A;  1MWZ A;  2CZ4 A;  1K47 A;  1S77 D;  2UU9 J;  1OYE A;  4ZPW R;  1D1U A;  2FYX A;  5F9L A;  5I42 B;  2HLU A;  4Q8F A;  5KG2 A;  2M8H A;  2DYA A;  1VMB A;  2O01 C;  2HSE B;  2DGO A;  1RT2 A;  1UEK A;  1UW4 A;  2X7I A;  4OX8 A;  1PBA A;  1Q4R A;  1TL1 B;  3PJ9 A;  2IVF B;  1LWE A;  1OMS A;  2XG8 A;  4WXO A;  3VAF A;  1FXL A;  5IT9 Y;  2ZH6 A;  3D2W A;  4NCG A;  4CO0 A;  2BE9 B;  1RT5 B;  4NRT A;  1JJH A;  2P8I A;  2QYC A;  5K8P A;  2ATL A;  1U6B A;  1SI9 A;  3KUH A;  4NLG A;  1XWL A;  3J7Z 5;  1VIO A;  1V9O A;  3R27 A;  4ZP7 A;  4X4T A;  1URR A;  3TAN A;  2QMX A;  4USU A;  1RDR A;  3BQ0 A;  1J5E J;  1MU2 B;  2BJ3 A;  3GWC A;  2ZH8 A;  3H2U B;  3T6J A;  1U1L A;  1U48 A;  5LMU F;  1RHJ B;  5H9F J;  2KTQ A;  3O1L A;  1X9S A;  1FHT A;  2AJ4 A;  3VZI A;  4ZHR A;  3CTR A;  1RT5 A;  1UP1 A;  2ZH4 A;  2JEJ A;  3OLB A;  4C4W A;  4ZJO A;  4WFX A;  3TQE A;  2XI2 A;  2JLE A;  4P74 A;  4TYA A;  4DCO B;  2YKN A;  4A8Y A;  4YHH J;  3R8Y A;  3CCM S;  4CO2 A;  3TUP A;  4JYA F;  4OYA A;  4QIE A;  2HQ3 A;  3SEO A;  2LP4 A;  4M94 A;  5FLX U;  3NOC A;  1KVI A;  3DI6 B;  1D0E A;  2VV5 A;  3L09 A;  2OAU A;  4DSE A;  2RNE A;  4KGZ B;  4A48 A;  4U7U D;  1KEK A;  1H2T Z;  2PEH A;  2XGP A;  4C8O A;  3AOD A;  2FGC A;  2RKI B;  2VBW A;  4FKY A;  2IFX A;  4Z7C A;  4I2Q B;  3IC1 A;  4KHR A;  1NH7 A;  4KO0 B;  3MEE A;  1FO1 A;  1DHM A;  1C0U A;  1AT1 B;  1LW2 B;  1S1U A;  4NLW A;  4IKA A;  4F4A A;  4R5P A;  1URN A;  3FUY A;  2KM8 B;  3JAM Y;  2K8G A;  4BBY A;  4U6P A;  3PV8 A;  2Y9H A;  1P8G A;  1VLO A;  3M2U A;  3PXG a;  3UD5 A;  4CO5 A;  9ATC B;  2BKN A;  2CZV C;  1EJ7 L;  4RW9 B;  2XY6 A;  5KFU A;  1UJ4 A;  3W64 A;  1BMQ B;  1C1C A;  1R8A A;  1RHQ B;  2JRS A;  3RRK A;  4FS2 A;  5KG7 A;  3C14 B;  2PA8 D;  2Q79 A;  3CCJ S;  4P7T A;  2AQ4 A;  1WC1 A;  1VBX A;  1QTM A;  1ZOT A;  2UVW A;  1HD0 A;  1WG5 A;  2PDA A;  1FFS B;  3HZG A;  3BN7 A;  2RB7 A;  3F0N A;  5KFW A;  2AW0 A;  2DD8 S;  3M4X A;  3VQT A;  1S10 A;  1J5E F;  2CJQ A;  2HS0 A;  3BO4 A;  2KG0 A;  1GMW D;  4J9S A;  2GFF A;  2ERR A;  2OSQ A;  3MGJ A;  4QBU A;  4H4O A;  4RU2 A;  2OTJ S;  2HWI A;  2AYM A;  1C2P A;  3GTY X;  2W9B A;  3OXL A;  1W2B R;  2UVR A;  1KON A;  2U2F A;  2B6A B;  4XPC A;  4EZ6 A;  1IXK A;  4F25 A;  2CAD A;  3FJ2 A;  1A9N B;  1B7Y B;  4U8V A;  1YJ9 S;  2G4B A;  3RR7 A;  2FZK B;  2PN6 A;  1Q81 T;  2GJ2 A;  2G13 A;  2OUG A;  4IRD A;  4G3I A;  5KT5 A;  5L1K A;  2H1Y A;  3A1Y G;  4KGK A;  2HPU A;  2YXL A;  4ES2 A;  2YNF B;  3J81 j;  3HHE A;  2K2P A;  1Y9O A;  4AE5 A;  5CYJ A;  1P6T A;  1N33 J;  1VJQ A;  1RKJ A;  3I31 A;  3OFE A;  3QGH A;  3THT A;  3ZNU A;  3I9V 9;  3OW2 R;  2R8G A;  5HAN A;  3PO5 A;  2XMV A;  1TZ0 A;  1JNZ B;  1RAH B;  2MTL A;  1HBO B;  2WVB A;  3MMB A;  1O0P A;  3JQJ A;  1BHN A;  1FKO A;  1OO0 B;  1DJ0 A;  1IN0 A;  2NUH A;  2KI2 A;  3LPY A;  5B0A A;  3PEH A;  4RW4 B;  2A6M A;  1VYA A;  1V6H A;  4I2Q A;  2GQQ A;  2F9D A;  1WAC A;  3LAM A;  1Q8L A;  2CJ9 A;  4RNH A;  4YQW A;  2W7P A;  1ICE B;  2XY5 A;  1S97 A;  2MZS A;  3TJ8 A;  1DQ8 A;  1KLM B;  1WC0 A;  2GVD A;  1G3O A;  2DGS A;  2DT9 A;  2EK1 A;  4RW6 A;  3M2V B;  4CM2 A;  4MIW A;  5LXY A;  4OZ5 A;  3KK1 B;  4DV6 J;  1N6Q B;  3A3P B;  2EG2 A;  1C4A A;  1FTC A;  3I5C A;  3NCQ A;  2QLJ B;  4ID8 A;  1HYS B;  4YR3 A;  3DOM A;  3H5Y A;  2MPU A;  4DR7 F;  1H7X A;  2F9J A;  3FFI A;  3JSR A;  2AZ3 A;  2WB4 A;  3SFG A;  5C24 A;  3D3C J;  2BAN B;  4DV1 J;  3KUG A;  3LP1 B;  4AXJ A;  1TR0 A;  3D4J A;  5C7P A;  1WC4 A;  4K4X A;  2GHW A;  4OYW A;  4Y2I A;  2RE1 A;  2UUA J;  1UVL A;  2B51 A;  3W8P A;  1REV B;  2W9B B;  5E5N A;  4FXW A;  1WG1 A;  2NR0 A;  1IKY A;  4WFB Q;  2HGL A;  2HS3 A;  3C6T A;  1FVQ A;  5C5J A;  4TY8 B;  3JB9 k;  5J2Q B;  1RLD A;  2QRR A;  3PO4 A;  3I4P A;  4FF2 A;  1U1M A;  3VAM A;  2EPI A;  4B9T A;  1HFE L;  4ETZ A;  2AEM A;  1QAJ A;  2B7B B;  2ZWP A;  3FNN A;  2WTF A;  2P5V A;  1TKT A;  1RA6 A;  1UFL A;  3NY0 A;  4RX6 A;  1UZD A;  5A8K B;  2MJU A;  1TMJ A;  3AJ2 A;  3EGN A;  5DQH A;  2ASJ A;  4DUZ F;  4R8U A;  3H40 A;  1XMO F;  2JEG A;  1KLN A;  1TKX B;  4CH7 A;  3DCA A;  3LGH A;  2E5L J;  3U7J A;  1UMJ A;  4RW7 A;  2O3D A;  2R7S A;  3HSJ A;  3FCH A;  1U1Q A;  5LM7 E;  3H4B A;  2EC2 A;  3VR1 A;  3CW2 C;  4DV2 J;  4MK7 A;  3AD8 C;  3K89 A;  4WKR A;  1IVZ A;  4ED7 A;  4IRK A;  5HRO B;  3AFG A;  2CPF A;  2ZZT A;  3DOM B;  8RUC A;  1OSD A;  1JLG A;  3DNC A;  4CZC A;  3ZZP A;  2Y1L B;  2RQK A;  4IFY B;  2XYP B;  4OV1 A;  2ASY A;  1RCX B;  2YKA A;  3DLE B;  3I5B A;  3M2V A;  5HSP A;  1HNX J;  2Z0G A;  1BQN B;  3BPS P;  2BMB A;  1L3K A;  4YY3 F;  4NA3 A;  1HHQ A;  3KLG B;  1I51 B;  4ECR A;  4HDG A;  5HBM B;  3QBC A;  1D8Y A;  3IBC B;  1TTH B;  2CPH A;  1XMQ J;  1KBR A;  2NS1 B;  2WAQ D;  5HI7 A;  4C3L A;  5KG4 A;  3PR5 B;  3MUT P;  3CJ5 A;  3PR4 A;  1ZYQ A;  5C2C A;  1K9M T;  3W2W B;  3JYT A;  2YKM B;  2ZBI A;  5GAG U;  3IWX A;  1RWW B;  4AL6 A;  4CP5 A;  2EKY A;  2Q1L A;  3LW5 C;  4F4K A;  5E2Q A;  1LK5 A;  1Q53 A;  3OTO J;  1X31 C;  3KFW X;  1Y3J A;  3G6X A;  5I42 A;  2D3O R;  3IGV A;  3MM6 B;  3PJW A;  2IAJ A;  4JB8 B;  4BDP A;  1F1B B;  2YWH A;  2ZEJ A;  3WC0 A;  4YN3 B;  3J80 U;  2X3G A;  3DLB A;  4UOC A;  3RB3 A;  1FWK A;  2FJD B;  2QZ8 A;  3BKF A;  3D54 A;  3ZXW A;  2RU3 A;  1NK6 A;  4USV A;  3PAC A;  2KYX A;  1X8D A;  2HNY B;  1OSC A;  2WSE C;  3FKB A;  4KR0 B;  3KLH B;  3QSY B;  3RAX A;  1VRU B;  2RS2 A;  2SXL A;  1IKV B;  2IMW P;  1IBL J;  3MAA B;  2MKI A;  5EX0 A;  5L1I A;  3PX6 A;  2E1R A;  2J0W A;  4UY8 T;  1LFW A;  4YDD B;  3QT8 A;  3OR1 A;  3M1V B;  4CLL A;  2DH8 A;  4IFY A;  5CCL A;  2BAN A;  3FRZ A;  5B0F A;  1Q7Y T;  3WC2 A;  2BM0 A;  2BKP A;  3MR3 A;  4J9N A;  3LPE A;  1CSJ A;  4QWC A;  3B4D A;  2GZO A;  3K7R A;  1S9G B;  1WD6 A;  4RUA A;  3C16 B;  2C2M B;  3AOB A;  1NSA A;  5AE3 A;  1RTZ A;  2COL A;  4PG6 A;  3SI8 A;  3DGP A;  3ENV A;  2GQ2 A;  3PM9 A;  4DPW A;  3AJ1 A;  1VQ9 S;  5BXI A;  3H7H B;  2W2M P;  1R0A B;  1VS3 A;  4KB7 A;  2W8L A;  2RS8 A;  1HD1 A;  4KJI A;  4Y2K A;  5CZX A;  5D4O A;  3HM9 A;  2VA2 A;  3CSK A;  3I0S B;  3QPI A;  1UPM B;  2D1C A;  4I1T A;  4C8L A;  2NZ4 A;  4QU6 A;  3EJM A;  2DPJ A;  4MKA A;  1N36 J;  3IR7 B;  4ZPV R;  4C2M A;  5G4D A;  2CPI A;  1IKW A;  1UWB B;  2OEJ A;  1BLU A;  4QOT A;  4ZKA A;  2JHE A;  3QYY A;  1HWJ A;  4JI0 J;  3ZTR A;  1RT1 A;  2NPF A;  4QWA A;  2GGP B;  4LR9 A;  2VJV A;  1RZM A;  2A0F B;  3R97 A;  3WBZ A;  4ECX A;  1HPZ B;  2J0Q D;  2CQP A;  2IM2 A;  3MEG A;  1V5I B;  4AXI A;  2P6S A;  2MQ8 A;  4PEO A;  2KB2 A;  2PI4 A;  1ZH5 A;  2DGV A;  3MM9 A;  1KFS A;  3JTP A;  1KQF B;  3V5R A;  3P45 B;  4A4J A;  1NM2 A;  1X4E A;  2XMT A;  3ZZY A;  2WW8 A;  3M1V A;  3NGD A;  2DH9 A;  1YZ7 A;  3BZQ A;  4QWD A;  1QUP A;  2PMH A;  2C1E B;  2IJF A;  1NAQ A;  2P6T A;  3NS7 B;  4I4B A;  2V69 A;  3DRR A;  3BO2 A;  4X65 J;  1N5Y B;  3T1A A;  1TV6 B;  4DR4 J;  3CJR A;  2ZBR A;  3MMB B;  3WQP A;  4F36 A;  1MG7 A;  3PEJ A;  3HHD A;  1MWQ A;  4J9V A;  1Y10 A;  1EET B;  2N3L A;  2UUB F;  2XCP A;  4F4Y A;  1RWK B;  3EIC A;  1EIY B;  1Y0H A;  1UVM A;  3T1H F;  4IH6 A;  4I2P B;  2AJF E;  3KKF A;  4OL8 A;  3TZX A;  4I6W A;  1YBT A;  3UDC A;  1LW2 A;  3PYF A;  3M8W A;  4DL2 A;  3A3O B;  5A0Y B;  3PZP A;  1SCJ B;  3P4U B;  4UY8 5;  1M5K C;  4ED4 A;  2C3U A;  4C98 A;  2IBK A;  1NJW A;  5EWF A;  5D0E A;  3PCO B;  3K5M A;  1XQI A;  2YKQ A;  1HWI A;  1KS2 A;  1PG5 B;  4DV1 F;  3KDO A;  1UVK A;  3R6G B;  2W9A A;  3CCW A;  3FBB A;  2H9Z A;  1EET A;  1WKJ A;  3ZO7 A;  3TVY A;  4DU7 A;  2WSF C;  1R8H A;  1N48 A;  4PKD B;  5B0E A;  2ALZ A;  5E3A A;  2RDD A;  4OI1 A;  3B8H A;  5LOQ A;  2CQ0 A;  2X51 A;  3H8Y A;  3Q8Q B;  1LWX A;  1I6J A;  2HVZ A;  1CJT A;  5HQM A;  3BSA A;  2DTJ A;  5FLX Y;  1NK8 A;  1Q78 A;  2F4F A;  3AJD A;  3DRP A;  1SH0 A;  4M5D A;  4W4M A;  1JLQ A;  1T9V A;  2PMZ D;  4DOZ A;  4ES3 A;  2DNO A;  7FD1 A;  5I3U B;  2VQF J;  1RT3 A;  4I68 A;  2JZ5 A;  3V4M A;  1FKP A;  1ULR A;  2LXI A;  3TP2 A;  3TA2 A;  2IA0 A;  2JOQ A;  3DMJ A;  1N0U A;  3FBE A;  2FHM A;  3KLI A;  4DXL A;  4DPT A;  1Z2L A;  3I55 S;  3GFH A;  5CXT A;  3RB4 A;  2FUG 9;  2E5L F;  2NRE A;  2R7Q A;  3CIZ A;  1MMD A;  5HQL A;  3HFV A;  2J5A A;  2ZHB A;  5HJX A;  1HQU B;  1R6Y A;  3A12 A;  4LSZ B;  2LEA A;  2DNN A;  5KFR A;  4X65 F;  4GKJ J;  2RQ4 A;  3PY8 A;  5HN0 A;  4A8M P;  1WEL A;  1VQ6 S;  2XYG B;  2YH0 A;  4X4N A;  1B4S A;  4MYU A;  2PSZ A;  3MM8 B;  1NK4 A;  3FQL A;  4D3G A;  2F7V A;  5HLF B;  3MM7 A;  5DLG A;  5IT9 U;  3R7S B;  4DG1 B;  2J9D A;  3N5F A;  2ZZN A;  2LDY A;  4FP9 A;  4YEA A;  1CLF A;  3PW0 A;  5THW A;  4K4T A;  2DR9 A;  2HMI A;  4OYO A;  3QGG A;  1FWL A;  2PI5 A;  2PII A;  1VQ7 S;  2C22 A;  1S6P B;  3S01 A;  4ZN3 A;  2F4V F;  3D68 A;  4LT6 A;  3JAM U;  2D3O 1;  4B3M F;  4RNN A;  1WI6 A;  1KFD A;  1WEY A;  3R5J B;  4WFN Q;  3OUY B;  3D5M A;  1FJE B;  3GFX A;  3OXG A;  2DGU A;  4IQM A;  1Y5L B;  2FHJ D;  2C28 A;  5LT5 A;  4KFB B;  2HFN A;  2YWW A;  4ZVP B;  1JWW A;  3D6M B;  2DVI A;  1VC6 A;  3OR2 A;  5EWG A;  4F0H A;  2YTC A;  5BYQ A;  3O8W A;  3CB4 A;  2CVI A;  1WKK A;  4QIF A;  4CWB A;  3M32 A;  4NWB A;  3JQM A;  3NAH A;  2HNZ B;  3Q89 A;  3A13 A;  2KZM A;  3DLG A;  3OUY A;  1WWH A;  2VH7 A;  4FKX A;  4X4S A;  2CQG A;  4F4Z A;  4FPR A;  4MYT A;  2NZC A;  2QIF A;  4TKT A;  2FVQ A;  2FLP A;  4LMZ A;  1HBM B;  5KFD A;  4QU7 A;  3LP0 B;  3PX4 A;  4EMD A;  4QPX A;  1CJK B;  2XI3 A;  1IJE B;  1C0T B;  1F9E B;  4LRD A;  2RQM A;  4ZP6 A;  5BYS A;  4RKU C;  2ZM6 F;  1NB7 A;  2J9E A;  2V4J B;  4JI1 J;  1HNW J;  2R2S A;  2H4Y B;  3ZZO A;  4NPO A;  3BYR A;  4DMZ A;  5HMW A;  5F8L A;  1XNQ F;  2E44 A;  4KGM A;  2L48 A;  1RTJ A;  2VG6 B;  1QVF R;  2EFV A;  4LF8 J;  3CCE S;  4K50 A;  1HBM A;  2EEY A;  3B78 A;  3HFZ B;  5AE2 A;  4A8S A;  4WF9 Q;  5I4M A;  3CJ8 A;  4TY8 A;  4R8U B;  1RAB B;  4IDK A;  5EUH A;  5H9E K;  3UN2 A;  1VQ4 S;  2W24 A;  2DB1 A;  2DO4 A;  3GU0 A;  2MZT A;  3JTO A;  3DOL B;  5ETR A;  2IBO A;  3MED A;  1NHK L;  1R6V A;  4HEA 9;  1W25 A;  3TVZ A;  2IHR 1;  4LIW A;  3W3S A;  1YLX A;  2MQP A;  4RZR A;  3HP6 A;  3OJU A;  1SKR A;  2BOA A;  4B3T J;  3KJQ B;  4EU0 A;  5GAE U;  2IJR A;  3KK3 B;  3C8Y A;  1M5V C;  2AX0 A;  4DSK A;  2I5J B;  3ZZU A;  1X4D A;  2D74 B;  3UI3 A;  1RCO B;  4QIW D;  1RTI A;  4N41 A;  4JV5 J;  2VAS A;  4OJ3 A;  5BJR A;  5KFX A;  1IQT A;  2IRX A;  3I0R B;  5A0Y A;  1S57 A;  5DZ6 A;  1KNZ A;  2E9T A;  1WC6 A;  1RAE B;  5KFA A;  5KG3 A;  4AFF A;  1UJ6 A;  1SV5 B;  3IAM 9;  3TUI C;  1WSR A;  3HVR A;  1PCA A;  1KD1 T;  4X64 F;  1VRT A;  4N8O A;  4G1Q A;  1VQS A;  1ZS6 A;  2J8S A;  4WZM A;  2KU7 A;  4K7Q A;  1CJU B;  1YGY A;  4ZVE A;  4KV8 A;  4ZN1 A;  2C2K B;  2CPE A;  3T5J A;  2UU9 F;  3P5T L;  2ZC4 A;  3QJJ A;  1SQF A;  1CJV B;  2Z57 B;  2G0J A;  1RAF B;  4DCP B;  3O44 A;  1IBM F;  2LKZ A;  4RW8 B;  1BQM B;  4NI2 B;  1WHY A;  4ALZ A;  1M5H A;  1RHK B;  4DQS A;  4FZV A;  2CQ3 A;  2RT3 A;  3TZW A;  5A76 A;  3VTI A;  5K8M A;  1FEH A;  3T1Y F;  1IKX B;  4UT4 A;  3DGP B;  3HHL D;  3RGI A;  1U1O A;  3BS9 A;  2E1A A;  1S12 A;  3MPY A;  4F8R A;  1UAW A;  2HUR A;  4ZLN A;  4YB6 A;  1R7I A;  4DU8 A;  4LR8 A;  1FTR A;  3AOC A;  2F5G A;  5RUB A;  4P7V A;  1WSV A;  2M5Y A;  4AT1 B;  4KH0 B;  4NEY A;  4Z2X A;  3AOA A;  4BC7 A;  2BBE A;  3QT6 A;  3ENQ A;  4RO0 A;  5ITH A;  2UVU A;  4DR1 J;  1EHW A;  5H1S V;  1K73 T;  3QJL A;  1YVF A;  1YBA A;  4C97 A;  4Y00 A;  5ETK A;  1RTH B;  4QR1 A;  3BR9 A;  3EYZ A;  4X4P A;  1EX8 A;  3K5O A;  3KMQ A;  2XTJ P;  1GT8 A;  2CG8 A;  2LDI A;  2FLL A;  2LEB A;  3B4M A;  1RWN B;  3CJ3 A;  4B9S A;  4ILM A;  2ZVI A;  4DV5 F;  1NME B;  2B6A A;  5IC6 B;  2Z2L A;  4MK8 A;  1ZAX A;  2KFY A;  2NLW A;  4OHX A;  4NYP A;  3EPG A;  3NNA A;  2NXE A;  4IG3 B;  4TLQ A;  4XAK A;  3G8T A;  2IDL A;  3CCS S;  3MAH A;  2HND A;  2KJW A;  5L1L A;  1FNX H;  3GR0 A;  1D9F A;  4DL3 A;  4Q0B A;  2ZNZ A;  2QN6 B;  5SUH A;  4UQG A;  1CS4 A;  3VAI A;  3CF5 Q;  4I67 A;  4X4V A;  3HZE A;  4TLR A;  4ANC A;  4GMK A;  3JTN A;  5HVG A;  3WIV A;  1FXD A;  2ZKU A;  3AB4 B;  1FDN A;  1RHU B;  3QO9 A;  3UR3 C;  4ED8 A;  4ATN A;  2KVI A;  3VCD A;  1YKW A;  3M2U B;  1BQN A;  2MGZ A;  1HBU B;  4DZ6 A;  3CD5 A;  4X62 F;  3R5G A;  4QW8 A;  4OYI A;  2LYV A;  4A8O A;  4ZMM A;  1X4F A;  4GKJ F;  2XO7 A;  2DNR A;  2CQ2 A;  2HFO A;  3HSG A;  5BR8 J;  5AE1 A;  1K8A T;  1JKH A;  4Y0F A;  1CEZ A;  2VZ9 A;  4K4W A;  4A46 A;  2HFV A;  2KXF A;  3KLE B;  2XM3 A;  4IO1 A;  3M6W A;  4MAK A;  4RBU A;  2BX6 A;  1HI1 A;  2ZH5 A;  3H5X A;  3D1H A;  3PW2 A;  3AB2 B;  4X4R A;  2UXD F;  2HHU A;  3RBX A;  2A3J A;  1GXU A;  1RAG B;  2DHG A;  2W25 A;  4P2X A;  5H9F K;  3M6U A;  4OLO A;  4P72 A;  1S9E A;  1S0V A;  2HBQ B;  3QGP A;  5JVH Q;  2KL8 A;  3OTO F;  3OBI A;  2MJN A;  2R7X A;  1D09 B;  1SJF A;  3UN5 A;  1T9U A;  4ZJQ A;  3CDU A;  1LQ9 A;  4JI8 J;  1Q1K A;  2R42 A;  1N33 F;  1JJC B;  4LBP A;  2VIH A;  4EBD A;  2BQR A;  4A8K A;  3N5B A;  1F60 B;  2FVC A;  2JVR A;  3EZU A;  4YB1 P;  3RBD A;  3QWU A;  2A1B A;  3CDB A;  4OJH A;  2C42 A;  3I96 A;  3M32 B;  2ROG A;  2WOM A;  5K14 B;  4LQ3 A;  4LQ9 A;  5KFS A;  3L7O A;  2VF3 A;  2BAB A;  2LXU A;  1QJH A;  1T9X A;  2M9K A;  2BAC A;  2ZBC A;  5KFK A;  3Q86 A;  2HVH A;  2M0G B;  2FZC B;  1VFJ A;  2O66 A;  3KG1 A;  5KFQ A;  4O3P A;  1N6Q A;  1JJ4 A;  3NNH A;  4ZVS B;  1WNE A;  4KHM A;  3TUZ C;  1R0B G;  4N56 A;  3GQC A;  1UVJ A;  4LSL A;  3M6X A;  5M2P A;  3BO3 A;  1GX5 A;  2MKY A;  2WON A;  3W63 A;  3CUL A;  1OPI A;  5A8W A;  2ILY A;  5GAH I;  1PO6 A;  1XK8 A;  1OPZ A;  5F8M A;  2CJX B;  4WU2 A;  2PFD A;  4WXW A;  4U7U K;  1FJC A;  3HFK A;  5DS7 A;  4DQQ A;  3K0J A;  1C4C A;  3CJ0 A;  4K2J A;  3TAP A;  3A8K A;  3EDQ B;  5AJ3 F;  1IWG A;  4L6V 3;  4PAB A;  4Y3C A;  5KFZ A;  8ATC B;  3E2E A;  2P9C A;  4PUO B;  1Q79 A;  1FFW B;  2ILZ A;  1DLO A;  4TU9 A;  4IR9 A;  4FBU A;  3VHQ A;  3NL0 A;  4WZQ A;  5G0R A;  2FQQ B;  2RUS A;  2C2Z B;  2D69 A;  4PG7 A;  4ED0 A;  1WDD A;  2ADC A;  3ZC4 A;  4CO3 A;  1I94 F;  4DR3 J;  4ILL A;  2VIC A;  1FEE A;  4YFU A;  1BE4 A;  3G87 A;  2G0I A;  1T0T V;  3FVY A;  4PRF A;  3LAN A;  1P1L A;  4B02 A;  2ZWO A;  5HBM A;  1U45 A;  2HVI A;  2QO3 A;  2I38 A;  3HHL C;  2WBM A;  3MR7 A;  4JI8 F;  2OKQ A;  4B9M A;  5E7O B;  2DNH A;  1ZZN A;  2ZUA A;  1YSJ A;  4M5L A;  2RU9 A;  1NND A;  2BQ3 A;  4B9U A;  4PZV A;  5B0C A;  2MGZ B;  3IRW P;  2A6O A;  3CJS A;  1VRQ C;  1IR2 A;  1SQG A;  3DM2 B;  4XDD A;  1CJT B;  2JL9 A;  2WVE A;  1S1X B;  1SC4 B;  2Z2M A;  4ZPA A;  1SL2 A;  4LF4 J;  4WFY A;  5DM7 Q;  2JX2 A;  3DXB A;  4RWW A;  1X60 A;  3R5B A;  2G9O A;  3SCJ E;  5J2N A;  2DK2 A;  2VC0 A;  3NP5 A;  4FXD A;  2CFX A;  2UXC F;  3FGV A;  1HKA A;  4X4O A;  4FVC A;  5CAB A;  3HDS A;  4QYZ J;  1DQ9 A;  1VBZ A;  2B7C B;  4HH0 A;  4WII A;  3I82 A;  2V68 A;  1VHI A;  3FCW A;  4MIB A;  5DG7 A;  1IKW B;  1UWB A;  1TL3 B;  1E6V B;  1U6Z A;  2PGC A;  2VFS A;  3M8Z A;  3TRG A;  1HNX F;  1T3N A;  3IRX B;  3C14 A;  5DGB A;  5ETN A;  2Z58 B;  2DPI A;  4Q45 A;  2OH2 A;  1XEZ A;  1S6Q B;  2V8P A;  5B0D A;  3CE8 A;  4EWT A;  4ES1 A;  4V19 X;  1PC5 A;  3D0G E;  3GJT B;  3GSD A;  2N4D A;  3KJF B;  3Q8Y A;  1VJW A;  3OL6 A;  2DR7 A;  5D3G A;  1K0V A;  3NMA A;  2KRR A;  4JI4 F;  4DR1 F;  4LFB J;  4J9K A;  1OQ3 A;  3WDO A;  1YBU A;  4C8Z A;  4DV4 F;  4MFB B;  2YH1 A;  4AUK A;  1ZTW A;  3V6D B;  1JLE A;  3L3C A;  5I3U A;  3GG0 A;  3J7A 1;  1TVR A;  2V8D A;  2E5I A;  4H4M A;  4WE1 B;  1JNR B;  3CT9 A;  5F0W A;  1Q95 G;  2VQF F;  4ZHR B;  1FDD A;  2I1R A;  4TVA B;  1N5Q A;  2XYH B;  3IBW A;  1QE1 B;  5KFC A;  1VK8 A;  1KSP A;  4HI2 A;  3PYG A;  3B54 A;  3Q2T C;  1VRU A;  5IQQ A;  5HRO A;  3GFZ A;  3CO0 P;  1QM9 A;  3DYA A;  1NSK L;  3Q0A A;  3VAG A;  3NCP A;  2L9D A;  3D0I E;  5JVG Q;  3M8Y A;  4DSL A;  3UR0 A;  1QSL A;  2CQD A;  4FXV A;  1L5U A;  1TVR B;  1EAY C;  3LOU A;  4NOH A;  4NZ7 A;  5IC4 B;  2YQ0 A;  1IBL F;  2LQ5 A;  3I5A A;  3L7U A;  3MEC B;  4O3Q A;  2R7R A;  1NDL A;  4RJV A;  3ILI A;  1N8R T;  1F3V A;  4NLY A;  1EQ0 A;  2B4O A;  1FKO B;  4Y65 A;  5GAG I;  1BUX A;  3OL9 A;  1MMN A;  1JXE A;  2GMJ A;  4NL5 A;  3PIO Q;  1BC6 A;  3IXQ A;  3GIR A;  1C0T A;  1ELO A;  3MD3 A;  1NHU A;  2C3P A;  4LRA A;  1VBY A;  1VQO S;  3RU0 A;  2JSX A;  1WOP A;  2Z4P A;  2BYC A;  3LF0 A;  4HTJ A;  2AU0 A;  5E3P A;  1L3U A;  4AQY J;  2VFT A;  1I1G A;  4NLD A;  5KAK A;  1N5Y A;  2Y8Y A;  4KFB A;  5ADZ A;  1TL3 A;  1YX2 A;  4ZVR B;  3DLK B;  3P8B B;  3CPW R;  2QYG A;  2W01 A;  2ZBP A;  4IOA Q;  3FC9 A;  1TQL A;  2VQE J;  1A6L A;  3KDN A;  1WKL A;  3PRD A;  1H2U X;  4EO6 A;  4EBC A;  2C2D A;  1FRJ A;  2RML A;  2FY1 A;  2HHS A;  4P52 A;  1U49 A;  3H5S A;  3MMA B;  2DHH A;  1KR4 A;  5L46 A;  1KTV A;  1WHV A;  2MQM A;  5F8I A;  2JH3 A;  2KN4 A;  2X3D A;  1S1X A;  4HAC A;  4J91 A;  4DN0 A;  5IZH A;  1K44 A;  2HBR B;  2M7S A;  2OEM A;  2ZUG A;  4LSN B;  4FNH A;  4WYW A;  4CLP A;  5A8K A;  1GEH A;  3OSP A;  1RT1 B;  3ILJ A;  4OJG A;  1EKS A;  1KTQ A;  2XS7 A;  4UTG A;  4C11 A;  3HKZ D;  1D9A A;  2KFZ A;  5ETT A;  3FEY B;  2Z2Y B;  3QMQ A;  1K0T A;  2NSB A;  2OFG X;  1UW9 A;  2FIU A;  1F5C A;  3MM7 B;  4MIA A;  4ZVF A;  3VGS A;  3UCU P;  3IAS 9;  3UDE A;  2N7C A;  3TAQ A;  3R2C J;  1GK8 A;  1KHW A;  5CH7 B;  1MW7 A;  2WVD A;  2XUL A;  1YQH A;  2I6W A;  3UO0 A;  5A6W A;  4I2P A;  2EFO A;  3PHT A;  1ZBT A;  4R5P B;  2KG1 A;  3LP2 B;  4DL6 A;  4KPC A;  3PKM A;  3W7B A;  2J9D E;  1PJ5 A;  2LU1 A;  3UVJ B;  3AT1 B;  2FB0 A;  1RGV A;  1RT6 B;  3ZTO A;  1TKZ B;  5KFM A;  3TAR A;  1N32 J;  4N77 A;  3W5Y A;  4PXD A;  1HW9 A;  2PEB A;  1MN7 A;  1XJW B;  1RT7 A;  2VPY B;  1HQU A;  3SV3 A;  4AQY F;  4YY3 J;  2AD9 A;  1S72 S;  3DLJ A;  4K8R A;  2B9E A;  1HNZ F;  1YI2 S;  4CRJ A;  4U8Y A;  1LWE B;  1KLM A;  1O8B A;  3EZ5 A;  4BWJ A;  1U26 A;  2IA6 A;  2LA6 A;  4ZVT B;  3J81 Y;  4CO4 A;  3KLG A;  1ZET A;  4CH1 A;  2RRA A;  4RU9 A;  3K2Y A;  3IR6 B;  1SJR A;  2YNH B;  1HWK A;  2QMW A;  2E7V A;  1NCL A;  3LAK A;  3GON A;  3OFF A;  4KGV B;  4KSE B;  3H2V E;  4URG A;  3GJQ B;  1E6Y A;  4G1I A;  4FYX B;  4IH5 A;  3QIP B;  1S0M A;  1J2V A;  3SDE B;  4OYX A;  2LEP A;  1NDK A;  1DTT B;  1JXV A;  4B9L A;  3BGR B;  4IRC A;  4DR2 F;  5D15 A;  3U1L A;  1NKE A;  2Z2Z A;  1HNI B;  4UST A;  2CDQ A;  1S5Z A;  4HL9 A;  4DFP A;  2BE2 B;  3MTK A;  1N5S A;  1MLA A;  2DR5 A;  2E9R X;  2BRK A;  2YKO A;  3AXK A;  3BSN A;  5J2Q A;  3FZ2 A;  3T1Y J;  2BJ9 A;  2CJB A;  2MKJ A;  5KT3 A;  2P9E A;  4ED1 A;  3MM8 A;  2KRB A;  4ECZ A; 
#chains in the Genus database with same CATH homology
 4OYA A;  1Y10 A;  4WP3 A;  4P2M A;  1YBT A;  4CLY A;  1TL7 B;  1FX4 A;  4WP8 A;  3C16 A;  5IV3 A;  1WC5 A;  5D0H A;  5D0E A;  4OYZ A;  1WC6 A;  1CUL B;  4NI2 A;  2GVD B;  1CUL A;  4OZ2 A;  3G82 A;  1CJU B;  4P2F A;  3C14 B;  4CLS A;  4CLW A;  1WC1 A;  4WP9 A;  1CJV B;  2W01 A;  1CJT A;  5IV4 A;  1CJU A;  4OYP A;  1CS4 B;  4NI2 B;  1U0H B;  3C15 A;  2WZ1 A;  3UVJ A;  4CLP A;  2GVZ B;  4CLK A;  3MAA A;  4USV A;  3MR7 A;  4CLZ A;  3MAA B;  1AZS B;  1YK9 A;  4OYO A;  4CLL A;  5D0R A;  1CJT B;  3UVJ B;  2BW7 A;  3C16 B;  4CLU A;  2QV6 A;  4OZ3 A;  1WC0 A;  2GVD A;  1WC3 A;  4CM2 A;  1CS4 A;  4CLF A;  4USW A;  4OYM A;  3C14 A;  4WPA A;  1CJK A;  1FX2 A;  3ET6 A;  3G82 B;  3R5G A;  4OYI A;  1WC4 A;  2GVZ A;  4OYW A;  1CJK B;  4OYX A;  3ET6 B;  1CJV A;  1YBU A;  4USU A;  5D15 A;  1TL7 A;  1Y11 A;  4UST A;  3C15 B;  1U0H A;  5D0G A;  4OYB A;  1AZS A;  4CM0 A;  1AB8 A;  4P2X A;  4CLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...