1UTAA

Solution structure of the c-terminal rnp domain from the divisome protein ftsn
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
KDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell division
molecule keywords CELL DIVISION PROTEIN FTSN
publication title Solution Structure and Domain Architecture of the Divisome Protein Ftsn
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05036 SPOR Sporulation related domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sporulation related repeat 1utaA00
1UTAA 2LFVA 1X60A
chains in the Genus database with same CATH superfamily
5GAHI 1ZAXA 5EGYA 4D3HA 5KFNA 5E0OA 3POTA 3CCES 3TI0A 1U1MA 3F0NA 3I9V9 2GS8A 1S1TB 1UW4A 3BO2A 4IO9Q 2M8HA 5C25A 2VBXA 4AUKA 2YTCA 4QOTA 4BWMA 2DRAA 2WW4A 4ZN1A 4ATNA 2YKAA 1IN0A 3C3LA 3TUJC 3JTPA 4B3SF 4PPZA 3HT0A 3OVAA 2DYAA 1ZBTA 4F3MA 4CCHA 2G1DA 3RBZA 2K1RB 4D3GA 1MWZA 3ENWA 4ILLA 5DLGA 3GQCA 1W2BR 1B7FA 1HLWA 1SJ3P 1FWPA 2W7PA 2HZCA 3SV3A 2OTLS 4HDGA 4CO2A 4NEZA 5U47A 4GKKF 1FTRA 4LFCJ 1X5TA 2CPYA 2C1EB 5B0AA 1RISA 2KG0A 4I56A 3HX9A 2KFZA 3DRPB 4V1Ak 2HSEB 1BLUA 4Q44A 4ZVHA 1AA1B 3VVUA 4NLRA 3OTOJ 4ZVUB 2XYGB 1C2PA 2R7SA 3N28A 3ZZOA 2G1HA 1UPMB 4NLGA 3UNYA 2FZGB 3H2LA 1RABB 2LXUA 1RYSA 1RT7B 5G0RA 3LPYA 3UQSA 3QSYB 4NLSA 3HKWA 3KJNB 4B3MF 3CEDA 3TP2A 1S6QB 1HYSB 1B0TA 1S57A 4DUZF 4R8UA 2KKHA 3QMQA 1A0OB 4ICLB 1NKEA 2IDEA 4OYWA 3ZZYA 3LWLA 4E2FB 4DQRA 1KC8T 1RE1B 3HFVA 3KDOA 1XNRF 2IA0A 4LQ3A 2DK2A 3H0PA 1XMQF 3BKUA 1RT6B 4DPTA 4B9VA 4B9NA 3LP0A 4KPCA 2BEFA 2LECA 2FY8A 2OEKA 2J8AA 2NXUA 1SH2A 2RD5C 3B4MA 4M5KA 4CYUB 4DV7F 4FF3A 2W9BB 4JI0F 2MYFA 1X5OA 3GSDA 5HVHA 4IO1A 4CO1A 2VBZA 3I82A 4GO7X 3NAIA 1M1GA 1CJUA 4PXCA 2Z58B 2K7KA 4IFYA 4BDPA 1TQLA 3BPSP 2LQ8A 3GCWP 3TZZA 4N8OA 1N34J 5CZVA 2E5LJ 3H59A 4WCEQ 2IYGA 2P2CB 3AJ1A 4MYUA 3DI6A 4F36A 3EPGA 2JEFA 3H4DA 3LP2B 3BKFA 3QIPB 1U0SA 4DV2J 4ZCIA 2QFIA 3Q89A 2EFQA 2IC3A 4KHPJ 2MQ8A 4CRJA 3G86A 3IAM9 1EETB 1TKTB 2X7IA 2GX8A 1FKOB 3T9ZA 2UVUA 1KOOA 2A2DA 1WKLA 1ZAVA 4XDCA 3WBZA 5GMEA 3MR3A 3WDOA 5HBMA 1WEXA 2X1GA 5KG5A 2DGQA 3MPVA 2B5JB 2RQKA 4DR3F 4NLWA 1LWFB 4RL1A 3I5AA 3BR9A 4B3SJ 4FPRA 4I7FA 1RWUA 4R0EA 1S0OA 5D77A 3JSBA 4PWDB 1DFDA 2FIUA 3T3FA 1ZH5A 3BF4A 5L1JA 5CCLA 2F8EX 2ZH5A 1UJ6A 3MTKA 4GKKJ 4EBCA 2K3KA 3OFEA 3PYGA 3H8YA 1O51A 5T7LB 3GIJA 2LCWA 2HS3A 1DLOA 1T8EA 1X4FA 4P2MA 1EZZB 4LJMA 4ZCLA 3TRGA 2WK4A 2FYXA 2VH7A 3K17A 3HHLD 1S79A 2B9XA 1YJ9S 3DGVA 2XYHB 2VL1A 4F3QA 1HBNB 2Z2MA 4JI3F 2ZE2A 2DNHA 5ETKA 3CMAS 4OYIA 1YLXA 3KJVA 2RNEA 3UN5A 4KH1B 1PG5B 3W5ZA 1SL1A 2PMZD 2BKNA 1Q81T 4A8MP 1TKZA 1VRTA 4K8RA 5KAKA 1UAWA 2V2QA 1WC3A 1F5AA 2ALZA 4DV1F 4DUZJ 2MY7A 2J7WA 1WI8A 1UA0A 5HP1A 2EWHA 5A76A 1F9EB 4JV0A 1D9DA 2O3DA 3UR3C 1FJGJ 2UVWA 1FRMA 1IBKF 4RLEA 4LT6A 2RVJA 4CIOA 2HIYA 1U1OA 3Q0AA 1FFGB 3GFZA 4Y2IA 1XNRJ 2HHUA 1FX4A 3O44A 2B6AB 4F25A 3TQ1A 4LRCA 3MDFA 1TFYA 3DOLB 2HVDA 1XMQJ 2MQQA 4WKRA 2XB2D 3N9UC 4B9SA 2EBGA 2VG7A 4K0KF 3KK2B 1A7GE 1JLEA 2A3JA 1WSVA 1YJWS 1QTMA 1JLGB 1EP4A 1JLFA 4JI0J 5LMUF 3IMQJ 4KRWA 3VQSA 2MKYA 4ECYA 5D0GA 3SQOP 4OX9J 3LUYA 4DG1B 1Q53A 2AZ1A 3VAHA 2DR7A 1EQ0A 2XLIA 2ZFHA 5E33A 2ZBCA 4X4OA 3K8WA 3PHEA 4PKDB 3QT5A 2FLPA 1CQMA 3K89A 4IR9A 1WNEA 4K4YA 3EZ5A 1Y10A 2NS1B 1OY6A 3CDWA 1PC4A 3E51A 3GE9A 2HMIB 4FXVA 2UV8A 2O1PA 1YJUA 1IR1A 4IH5A 2HW3A 2NXEA 3JAMY 4EO8A 2VFRA 3QGIA 1OJ4A 3FDSA 3VAGA 3EJMA 2MQPA 2Q6CA 2HGLA 2W7AA 4C6AA 1BXNA 1VBYA 3A8KA 2M7SA 4K59A 4MK7A 2A0FB 1N88A 1KRPA 2YY3A 1QUPA 4CH7A 3ITHA 2QLJB 4DR3J 1FRJA 2EI5A 3T9NA 1HWUA 2RHSB 5AXMA 1SQEA 4C7QA 3Q8RB 1CULB 1H6KX 4AL7A 2IAJB 2QIFA 3PRVA 1EQMA 4DCPB 3A8IA 2ZC3A 1B0PA 2JNJA 2V69A 1F0XA 2OKQA 4DU7A 1HR0J 4F67A 1S4FA 4YEAA 4KV8B 3VF0B 1NJZA 4RPFA 5DQGA 2PT0A 4ED8A 2BUNA 4QCLA 3GMGA 5B0FA 3NGKA 5HQ8A 2V2ZA 1Q82T 1IKXA 2LQ9A 1JMTA 1DTTB 2MTLA 4LR7A 4X4TA 4WP8A 3CULA 2YQ1A 2DTJA 4CLYA 2RIJA 2ZH1A 3M9OB 1VGYA 4P73A 3SDEA 3KWMA 3LP1B 1Y5NB 3Q8VA 1T02A 3QLHB 4AXIA 4JI3J 1YRTA 1XMBA 2E9TA 2YX4A 1HIYA 3H2UB 3J7A1 1LW2B 1KQGB 3HFKA 3GILA 2RDJA 5GAEU 3R5AA 1EKRA 4DV1J 2EW9A 2V4RA 4ENOA 4A8YA 4XIUA 4NYOA 4ED2A 4AFFA 3QJPA 3C46A 4OZ5A 2R8GA 2HBQB 2QC3A 1J5OA 1FE4A 2K2PA 5CABA 5J2NA 4P2XA 3I87A 2MPUA 4YN3B 2MQOA 5F3ZA 2QYCA 4USMA 1TL3A 4O3NA 2QJ3A 3MEGB 2Z30B 2RRNA 3Q24A 3DMJA 4R0JA 2CWKA 3FGVA 1I6JA 1E6YA 3CD0A 1FD8A 2DRDA 1W25A 3I0SB 5I4MA 2HVHA 1D9FA 4QIVA 1U1RA 2PIIA 5LMUJ 3J80U 2DIUA 1NLKL 3LAKA 1FEHA 2OPPA 1C4CA 3D1OA 3MHYA 2H54B 1YK9A 2IJFA 3MM9B 1TUVA 4TYBA 4F0KA 4F2RA 4OHZA 4CH1A 2OUGA 3GV5B 1PCAA 3VGVA 2J0SD 3HHKA 1HI8A 2W24A 5D0EA 2A2CA 1RT1A 1YI2S 4Z37A 4RX6A 3IS9A 4H4OA 1S1WA 2D69A 5LJ5Y 1N48A 1MMNA 2EKNA 2BYCA 2PGCA 3TARA 3HHLA 1YRUA 4ZHRB 3KLGA 4HEA9 2AHOB 5HATA 2UXDJ 4HVZA 3NMRA 1U8WA 1Q16B 2YWFA 1UKUA 3BSCA 2JL9A 2GIQA 3C6TA 4LBHA 2YBVA 3IP0A 2N3OA 3R7SB 2JJ4D 2XMAA 3HVTA 3AD9C 1L3SA 1ZS6A 4DQPA 5D3GB 4FBUA 3UFCX 1B4SA 1GMWD 3FCHA 2D3OR 5BJRA 2HFVA 2M5YA 5DS7A 2DO4A 3OBIA 3RAXA 4B3RF 2B7BB 3RRGA 2VODA 4DPWA 4FN5A 2CQDA 4HTJA 1OSDA 2JRSA 3ILLA 3BDPA 4RW6B 4BC7A 6FD1A 5K8NA 4MIAA 5KFTA 1K1QA 3V6JA 4X4VA 3M8ZA 2ABYA 3MWBA 2N82B 1LK5A 3KK3B 3V6KA 2MZTA 4JI5F 3WQPA 4TXSA 3BBFA 4CO5A 4IFVA 3C66A 4KT0C 3HCXA 5A8KB 4OZLA 3AAWB 4FXDA 4J90A 3MMAA 2CIMA 3CGIA 1FXRA 2FTRA 3KLFA 3KG1A 5F0UA 4F02A 2ZHBA 2FDNA 1H2VZ 3GZ7A 3AOCA 4ECZA 1WF0A 1T3NA 3H5XA 3HLUA 2YWEA 5IM0A 1RKJA 1FF2A 2YH1A 2MY8A 1S6PA 4NZ6A 1KOHA 3FRZA 1NK7A 1H2TZ 1Q4RA 4Y00A 5K14A 2CQGA 4NRTA 3UVJB 1C1CA 2D7SA 4TKTA 2GJFA 3I0RB 1NJIT 3ZZRA 1JB0C 4DUYF 1N36J 2X3GA 1LWEB 2FY1A 4G1IA 2WOMB 4B17A 2KJWA 3GG0A 2CDQA 1H2UX 2HK3A 1SJRA 5IV4A 3GCXP 2UVVA 4P6QA 1FVSA 3P49B 1U09A 3BGFA 4TY9A 1QSYA 3V4IB 2E7XA 3PR5B 3DLEB 4PAAA 3CW2C 3IC1A 5KFJA 3FMBA 2DJWA 4F3OA 3RRKA 2GMLA 3M05A 1X4HA 4NLOA 2ZH9A 5K8PA 3W8PA 4N77A 3OW2R 5ETSA 3H5SA 3D7SB 5HROB 3AOBA 4JB8B 2RH3A 2F65A 2DNRA 3AODA 3PZPA 1T03A 3HFZB 1K0VA 1ZPWX 2J6TA 4QWEA 2N7YA 5KFDA 2OI2A 2VB6A 4PG5A 2K8GA 3OV7A 3W2VA 4F0MA 3UD5A 1K47A 3NWRA 2DCUB 5HSPA 4Z2XA 4OJHA 1SKUB 2HGMA 3OD2A 3ZTPA 1S5ZA 2DNQA 4PR6A 3VWSA 2KB2A 3IGVA 3W2WB 4S0MA 1HWKA 5FD1A 3S01A 2D3UA 4H4MB 3CB4A 3TYTA 4FS2A 2V0NA 1HBMB 3I31A 1RAEB 1RWPB 1KN6A 5DJBA 1YTYA 6AT1B 4OI6A 3CMQA 1P6TA 3PX0A 4TU7A 4LVOP 1G2EA 5K9FA 2B4UA 5A8RA 2H9ZA 4B3RJ 1UFLA 5HVFA 1GEHA 4RJVA 3FFIB 3RB4A 4DFKA 4C3KA 1SC3B 3LQVA 2OEJA 4A8XA 4LF8F 5KOXA 4OZNA 2AJ4A 1RWVB 2LEPA 1VHFA 1FNOA 1RU1A 4DSFA 3MPWA 1Y5LB 2ZHOA 2GQ2A 4ZIWA 4PQAA 4IH6A 3POTB 1QSLA 4JI5J 1Z4UA 3MAQA 1WEZA 2E5HA 3QRRA 4RKUC 4YUDA 2U1AA 3FCVA 4YHHF 3FSXA 5KG1A 1WUUA 4DN0A 2IMWP 2XG8A 4DL0C 5C25B 2N3LA 2J8SA 3M8WA 3LWMA 1RAAB 4DZDA 2UUWA 4ETZA 4NXMF 3NCQA 2DNKA 1BQNA 1KS2A 2DD8S 1WKKA 3QRQA 2LEAA 4LIWA 2ZKUA 1ROFA 5AXLA 3AH6A 1KNZA 2XNRA 2L41A 5KFOA 1FXDA 3BGLA 3MM6A 3WHIA 2I6WA 1YBAA 3DOKA 2VG6A 3H98A 4ID8A 1S6UA 3UPFA 3HXMA 4DUYJ 3KHHA 2JEGA 3RAMA 4OV6A 5B0BA 3M8RA 1M1KT 2WBMA 1ULRA 1RHKB 3BN4A 2Y0SD 2AJQA 1CEZA 2BJDA 1H0HB 1R43A 4DX7A 2JEJA 1XBWA 4YY3F 1HWIA 2BJ8A 2XO6A 2QL9B 4DS4A 1X0PA 4X65F 3TO8A 4ZVFA 2VG5A 5G0RB 1JXLA 2UUCJ 4OI2A 2CZ9A 1N33F 1GMWA 3K0JA 1WOOA 2CJQA 4BLGA 1RAGB 2RAQA 3GLJA 1FKPA 5LJ3Y 2M8DB 4R8UB 2GVDB 2FLOA 3MMJA 2DH9A 4F4XA 2DNPA 4MIBA 2C22A 5IC4B 2L3MA 4OYBA 1L3KA 3GYXB 2QN6B 2DO0A 2RQMA 2BANA 2DGWA 1RQ0A 1RA6A 2GZOA 1V3RA 1MMDA 1RAOA 3LP0B 1SKWA 2DEJA 4TLRA 5L8RC 3J81j 3UE2A 2V8PA 3PY8A 5I3PA 2KFNA 2NSBA 2LEBA 3CC4S 4BC9A 3K5PA 2BE2A 1WHYA 2BW7A 1WACA 3R27A 3MR6A 1H98A 5M2RA 1FK9A 4ELUA 3U02A 4K4UA 4USJC 4OI0A 5B0GA 3AOAA 1CJUB 4ZVRB 4IFYB 2W1BA 3IWLA 2HNDA 2R7UA 2CPEA 1CS4A 2C3OA 5EDWA 2YWHA 3KJFB 4OHWA 3DI6B 1IUJA 2CPJA 4E0DA 2HQFA 2Z2LA 1SC4B 1RADB 3V2UC 5F8IA 1YVFA 2IC3B 2DGVA 2HYIB 1SVDA 1VC6A 1L5UA 4KR0B 4WP9A 1Q86T 4WFNQ 3W5XA 4ZPDA 5HQMA 4YHHJ 1YITS 2CJKA 1TUGB 1CC7A 2COLA 4CP5A 1KVJA 1TL4A 5KG7A 5HBMB 1LEOA 3DNCA 3ZZTA 1DHMA 3AXMA 4I7FB 1RWKB 4NXMJ 2HGNA 5ETPA 3O3LA 4RNOA 3J7ZT 3OT9A 2Y1IA 1JLCA 1XWLA 1GNKA 2ADCA 3JQMA 5C5JA 1WF1A 2I9SA 2B7CB 2A6OA 2KH9A 5CYJA 1RCOB 2H48B 4N8NA 3H90A 3CT9A 3NAHA 2MQLA 2DXEA 3MECA 3KDNA 2AF6A 2PD1A 2DXDA 1DLOB 3FQKA 4QWCA 1F60B 2ZH7A 4J9LA 1UVLA 3S7RA 2ZJRQ 3CCWA 2VPZB 1Q95G 5A8WA 3NGUA 3LAMA 4JI1F 5KT4A 5H9EK 1J27A 1R8CA 2ZE2B 5KFIA 4LF4F 4DFPA 4L3KA 2W2QP 2X3DA 3FZ2A 4F50A 4XK8C 3UDEA 4X65J 4EMDA 1VI7A 3GB0A 3DDNA 4WJBA 1K44A 1N33J 2AIRB 1TKZB 3NNAA 1VRTB 3J81U 2WVDA 3IN5A 2M52A 2MZSA 4RW4B 3M9MB 3NG8A 2C2EA 4DPXA 2NXNA 5LL6d 5HP1B 4OV1A 2ZNZA 4OX8A 1LV5A 4HDHA 1SB6A 3F73A 3TNVA 3IWNC 2ZWPA 2CQ4A 3A1YG 1UZHA 1OMSA 3EICA 2VG7B 2XHCA 2CVIA 2CJAA 3FEZA 1SC1B 4XAKA 2XYPB 1IKVA 5DO2A 2BRKA 3SQGA 1JLEB 5G4DA 1EP4B 1JLFB 2XO7A 2KRBA 2DNMA 3MURP 3CCSS 2HQ3A 4Q0BB 3OR2B 2V5HG 4CLSA 4USTA 3NCPA 4C8LA 2J9DE 1M1HA 4EYHB 3L7OA 4WWSA 1IKYA 4ER8A 1KDNA 2E44A 1VQKS 4ECTA 3PYDA 2RE1A 3MOZA 4DL7A 1L3TA 3THPA 3MR7A 4J9OA 4ECRA 3T41A 1GT8A 1VQNS 4QZVB 4ED5A 3LH2S 1Q8KA 3M6XA 4LR8A 4A8SA 3MI7X 4C8MA 4ANDA 4MTPA 1S10A 3MM7A 4MMOA 4LR9A 1QJHA 2OH2A 1RTDB 3IBFB 1U1QA 2LQBA 4KGVB 5IT4A 2E7VA 4ZP7A 2WSCC 1U6ZA 2NCKL 2FJAB 2VC1A 2HS0A 5CQGA 3K5OA 3OSPA 1SJQA 2BVZA 3BR8A 4P10A 3NS6A 4B9LA 3JSRA 2C2OB 3BGRA 1FVQA 2CDRB 4GMKA 2OD6A 2I2YA 1UTAA 3GU0A 1DRZA 4TQRA 4QWBA 5HK4A 3G8QA 1R8HA 4ALZA 3W66A 2ZBQA 5B0DA 1UZDA 2EFVA 3P5BP 1T9YA 3DOMA 4Q2LA 4OJGA 3KLIB 3OR1A 2IDLA 1FI4A 3BZQA 3WIUA 4M5HA 5D4NA 3U1LA 2UXBJ 3MM8A 2RUGA 4F04B 4M95A 1IKXB 1HL6A 3CJTA 4KYZA 3HT3A 4KHMA 1D1UA 3TA0A 1HBOA 1YRXA 2XTJP 1HW9A 4JI1J 4KFBA 1VJQA 2KN4A 3BSAA 3ZTOA 2VASA 3PYEA 1D0EA 3OLAA 2MDAA 2V2VA 4I2QA 2IJNA 1RTZA 2HBRB 5DQHA 1DARA 4DMZA 1Y7PA 3ONQA 1RA7A 2O01C 3K5MA 4F4YA 3H4BA 1OY9A 1X4BA 3J7YI 2V9KA 3GTYX 3M2UA 3NS5A 1J5OB 2P9GA 1TV6A 5KFZA 1U24A 4GC6A 5J2NB 1RTIA 3N6LA 2MZQA 3JQJA 2AGQA 1RK8A 5SUHA 4LVNP 2KRRA 2W2PP 3G87A 3QZ7A 2ZEJA 1FTCA 4LUBA 3PRDA 1L3VA 2Z2ZA 3QYYA 4A46A 2LMIA 5ETNA 3DMJB 1T95A 8AT1B 1E6YB 4F7VA 3G2XA 4KSEB 3HK2A 4J9MA 2V6AA 3W62A 5EWGA 3MPUB 1M5PC 3EE3A 2OPPB 4ZDNA 1XR5A 4JI2F 4G1PA 2VPXB 4MK8A 1KEKA 1JXVA 1D8YA 1KBRA 3CIZA 1ZM2A 4I64A 1KTVA 2HKEA 3PKMA 5L38A 4WTOB 3J80Y 3DRRA 2LA4A 4ANCA 5C2GA 4H4OB 1S1WB 4B3OA 3AB2B 5A2QU 3W3SA 2R8KA 2E1AA 3PV8A 1OQ6A 3D28A 3N01A 1O0PA 3HHLB 2AP6A 1K1SA 3KLGB 2Q3PA 4K50A 2C28A 2W9CA 4WYWA 2E1CA 4IOAQ 3ZXWA 1GMVA 4QIFA 2I38A 4FVCA 1BHNA 2C3PA 2WBRA 4P72A 1FJ7A 3ZTQA 1VK3A 4O0NA 4ELTA 1X9MA 3V81A 2AGPA 2CAJA 2FVRA 4WYLA 5JVGQ 2UUAJ 1NNDA 1VS3A 1G7CB 4DEZA 3ZTSA 3M8QA 2WVBA 3BBCA 2H5IB 4JV1A 2C2MB 3HVTB 1VQPS 2ZH8A 5EUHA 1JJCB 4MKYA 4DV4J 1FJCA 1ELOA 3HJVA 4X4SA 3WIVA 2KO1A 3HVWA 4PZVA 3NY0A 2PMHA 4MKBA 2KU7A 3GIKA 3C8YA 3TVKA 2ZOFA 1BWVA 2DRBA 4DFJA 3CVKA 5T41A 2QZ8A 3DFEA 1MWYA 4F4WA 1X4DA 3UN2A 3GJTB 4X84A 2C3UA 5LSOA 3Q8QB 4OZ3A 1DJ0A 4ECSA 3C2PA 3C14A 4NI2A 1SJ1A 3W9IA 2ZBRA 3GONA 3PDNA 4IFVB 1HI0P 4Q7AA 3MCMA 1R8BA 3LTOA 2RT3A 3WZ0A 3O6QA 2GW8A 2HRYA 3R6LB 5KT2A 3MMAB 3UCUP 2KDOA 2YNGA 5HMZA 3KLFB 4LFAF 2HHPA 5E41A 2OMLA 4RBVA 2FQQB 2EXUA 1FEEA 2FVPA 1M5HA 3W60A 1YJTA 5L9NA 2RQ4A 3AA8A 2JH3A 1U0HA 1ZM9A 2CQ1A 2NXJA 3CJSA 5E7OB 5IM0B 2F8MA 2ZJPQ 1FDDA 4PXBA 3SCJE 5C2CA 2MLXA 1S6PB 1OPIA 3VTIA 5KG4A 1HKAA 1RCXB 4USWA 3M8SA 5BYSA 2CJYB 1C1CB 4C2MA 1FESA 3KJQB 1WG5A 4C9DA 1IQTA 3W8GA 4DV6F 1VQMS 1EX8A 1F3FA 1KFSA 3D9BA 1VK8A 4DR7F 2JSXA 4L3NA 4J5OA 2QMUB 2FVQA 1B99A 4IQMA 1UVMA 1QUVA 2ALYB 3H5UA 4B9UA 2DH8A 3VVTA 3BGUA 3CCLS 1KKHA 2VFUA 4WIIA 4PYDA 2G13A 1SJFA 2YPZA 1HNVA 2GAHC 2HEKA 1URRA 5IOLA 2O66A 3CCMS 3KYLA 1NK4A 4IKAA 2KHDA 4YP3A 5J2PA 1LFPA 3OTBA 3R1HA 4JI2J 4LRDA 1K0TA 2BBEA 4C8KA 2C2ZB 4HT5A 2HURA 4Q2MA 2MSTA 1RHUB 3RJMB 1T03B 1X4CA 1KVKA 1N5YB 3QWPA 4DL6A 4GVBA 3HSGA 3QSIA 3Q83A 3Q23A 1RLDA 3W2VB 2DPIA 5J1EA 3VGTA 4GRSA 1CG2A 4PG4A 2LP4A 2GA7A 1RWXB 1U25A 4P74A 5FIIA 2ZZTA 4K2JA 3K2YA 4DV5F 1T9TA 3CCZA 1PJ5A 4ED0A 4PRFA 1FRHA 3QO9A 1GXLA 1Q8IA 5I3QA 3MEEA 1Y3JA 3W1YC 5DRKA 1A6LA 1FRXA 4HKQA 2P9EA 3T5LA 1K9MT 3T6JA 1KQSR 4M5IA 5FJ4A 3OJSA 2V8VA 2GO8A 1SI9A 3G71S 5A8RB 1NDKA 2UP1A 1UVJA 3W63A 2A18A 4TLQA 2EFPA 2JEIA 5IQQA 3R5BA 5AJ3F 2XMKA 2VUGA 1JJ4A 2D74B 2LLZA 1T05A 4F4KA 1NXIA 5IS2A 3E8OA 1RTHA 1KFDA 2HHQA 1URNA 2AD9A 5THWA 1V3SA 4ZJLA 1OY8A 2BX6A 4FKYA 4QW9A 4C8YA 2FPHX 2Q1LA 4FYYB 2I5JA 2F9DA 4R25A 4YFUA 4I2PA 2XZDB 2CQPA 4RW9A 4LFAJ 1U2CA 2DGXA 1FT8A 1UWAA 2BJEA 2VFTA 1YSJA 3GV7B 2L48A 1QSSA 2VKZG 4PCQA 1SV5A 4PUOA 4KC5A 2PI5A 3BJYA 4BWJA 1BQNB 1I3OB 1WOSA 2OO4A 4C8ZA 1FCAA 3R5CA 3KUGA 2HFUA 1RT3A 2FLNA 1NJWA 5F9NA 1N6QA 3MM6B 4Q5VA 2QL7B 4RW8A 1JLAA 3C19A 1RT4A 1YZ6A 2LYVA 2ZOGA 3DOKB 3FSYA 3NCRA 4QU7A 4EO6A 4OLPA 3Q2SC 5L39A 4NCGA 4OZJA 4DV6J 3NGTA 4GKJF 1TL7A 1JQGA 1WDDA 2V8DA 4XPCA 2ZUGA 2BE9B 3NGSA 1RI7A 1Z1ZA 3KLVA 3NNCA 5DDRC 2K06A 1I5OB 5LSRA 1Q79A 2WHOA 1WTFA 5LMNF 2RKIA 1QVFR 1QE1A 2KL8A 4JV2A 1IR0A 4F26A 2LQJA 5KFAA 2VG5B 1R27B 3UD3P 5D15A 2NLWA 3QNWB 2KJVA 4RZRA 2IFXA 3WC0A 5H1SV 1T94A 3IBWA 4WIQA 1NM2A 1FKPB 1FFWB 2E1RA 1S6OA 4ECQA 1NDPA 4TNOA 3FRYA 4K2XA 4WP3A 2QMXA 3LW5C 4NYZA 4ANEA 4RNMA 2OJ3A 2OHDA 1NB7A 4WZQA 2XSJA 2BANB 4ED1A 1FJEB 3OTOF 1B0VA 3GYGA 3RBXA 5FLXU 2HLUA 4DQSA 3OVBA 1GX6A 1WTBA 4DV0F 4HI1A 5E5NA 4A8OA 4NCAA 3W9HA 4NLPA 1VBZA 2F4VF 2BE2B 4DV5J 5EHHA 3DGPA 1WD6A 1WG4A 3E01A 4YQWA 3O5TB 2FUG9 1P9QC 2HNDB 2PE8A 4ZPAA 3KG4A 3PO5A 3RBDA 1CS4B 4WXWA 2OTJS 3JSYA 2WONB 3G82A 1QAYA 3AA9A 2ZHAA 4DQQA 2AT1B 2MZ1A 4C0BA 5KOWA 3FBCA 1TZ0A 2YKQA 4O3PA 1ZPVA 4NEYA 3UDCA 2IY5B 3RGIA 2QMWA 1NJYA 3UW1A 3A4TA 2MGZA 4KGZB 4J9RA 1R0BG 3CIMA 3P4UB 1JJHA 1X9WA 5AJ3J 5KG3A 1U2FA 4HYKA 4O23A 4DFMA 1FHTA 1F1BB 1HARA 3SSRA 5E3AA 3G4SS 1BY9A 3DDKA 1QM9A 3SSSA 3MPDA 1F2HA 5HO4A 3G6ES 1RHMB 4EYIB 1NPKA 1VRUA 1U1NA 1HQ2A 2MKJA 3CWJA 1N34F 4ILMA 2DHSA 1S1UA 4KO0A 1N0VC 1Y00A 4P52A 4PQUB 2Q66A 4J9KA 3EGZA 1XEZA 2XMWA 2H3EB 3Q22A 2XY5A 3MEKA 3QJLA 1MW7A 1CQNA 3K57A 3MECB 3CJQA 1VDHA 4QPXA 3KHLA 3R2CJ 4J37A 2HZAA 2QE5A 2PSZA 4GKJJ 1S99A 3B4DA 2ILZA 3QFHA 1S49A 2HVEA 1KLNA 1HBUA 2DVIA 2QT7A 3P8BB 4J9NA 3T5JA 3OL9A 5LMNJ 4TQSA 5MAOA 4ZCMA 5KFEA 3CF5Q 3N5FA 3RYLA 1GXUA 4FF4A 2Y3YA 3ISZA 4RNNA 1VIOA 2VDIA 3PFOA 1S4EA 3W7BA 2WCXA 2Z4PA 2ASLA 4K4ZA 4X4RA 2LXFA 2JZ5A 1SXLA 1R6YA 3Q8UA 3DLGA 1I1GA 3Q8PB 1AZSA 1NAQA 1NHVA 3BDEA 3CE8A 4L73A 3D66A 3DU5A 4CYUA 3RZAA 1TR0A 1U6BA 1F9FA 1HPZA 3IG1A 4ZVSB 1S97A 2HQGA 3J81Y 2ZBPA 4RU9A 5I3UA 3DXBA 1T7PA 2E1PA 3MF5A 1Q8BA 2V8GA 4DV0J 1S59A 3UNGC 4JV5J 3SQGB 1FERA 5D4LA 2F4VJ 4F0HA 2VQFF 2BZ2A 3ZZZA 2V68A 5IWAJ 2ZH2A 4ES2A 3B78A 4RUHA 4LF1A 4IOCQ 4RR5A 3T5HA 3D6TB 2EC2A 3OXLA 2OD4A 3X3UA 1TUWA 3MCSA 1FJGF 4NCBA 3WX4A 1IKYB 3TEHB 2Q79A 2CRLA 3VAFA 4DQIA 3HDSA 1EETA 3BEGB 1Q78A 5J2MA 2E29A 1BE4A 1RT5B 1WKJA 4U7UK 4CT8A 1YG0A 3NRBA 3TQEA 1NBEB 3FJ2A 2CPFA 3RW7A 1D8ZA 4OL8A 3MFHA 2BMBA 2WSFC 3EDQB 2B5JA 1GH8A 3MM7B 3Q8YA 2CADA 4C8NA 3THTA 1TL1A 1LWFA 2G9OA 2OP5A 1SUQA 5HN0A 4HHUA 2H5JB 3KXDA 2R7QA 2AW0A 3KHGA 4CNZA 2RDDA 4DDFA 2L08A 4YR0A 4OX9F 1KLMA 1VCTA 3ZTRA 2R7RA 1RUSA 3DDIA 2KXFA 4R5PA 1H7XA 3BGRB 1X4EA 4NA2A 2YNIA 4E8UA 2ZVSA 2VONA 2XSFA 1HW8A 2JHEA 5GAGI 5I42A 4IH7A 5EX3A 4J7CA 1HA1A 4U9RA 5JXSA 4YR3A 2H4YB 2VPWB 3GIIA 1AFJA 2AJ2A 1X4AA 4LSNA 2R8JA 4CWBA 3DOMB 4YDDB 3HD2A 2P8IA 4EBDA 2ZZNA 2ADBA 3OR1B 2XULA 3FZBA 1IM4A 2ZUAA 4JI4J 2F7VA 2OSQA 3US5A 2BE7D 3DRSA 5ETQA 3MM8B 3OQ2A 3U1NA 3PG9A 1MG7A 2ZNYA 2YKMA 2Z8QA 1Y0HA 1HBOB 2QTWA 4RW7A 2X1BA 3NBPB 2GQCA 1DAXA 2FJWA 2OMOA 4LBPA 1BQXA 5E3PA 1NHKL 1FRLA 4IOBA 4X4PA 4K4SA 5EN1A 2W8KA 2Q43A 3R2DJ 3UWTA 3KNAA 2R2TA 2AJ1A 1V5VA 1HR0F 3LO3A 4UUXA 2CPXA 4A4JA 1YHQS 3FSIA 2H1YA 2KHCA 2IBKA 1RHQB 3G6YA 3CD5A 3O2IA 4DZ6A 3M2UB 4WTYA 1NB2A 1TV6B 1RTIB 2E5GA 2OSRA 2EFOA 5HAOA 3GWCA 2P6SA 1CVJA 4URSA 1VC0A 1S77D 5K8MA 1GFWB 4IRKA 3PACA 8ATCB 3LGNA 3PM9A 2AEFA 1HQEA 2VV5A 4DU8A 3JAMU 4NWBA 3MMCA 3SFUA 2V4QA 4KB7A 1S72S 4OMFG 1SPBP 2HFZA 2VQFJ 4OZ0A 3MZIA 3D2WA 4FYDA 2IYIA 2F4FA 2YKPA 4FDFA 5F8HA 5A0YA 2CYYA 4TY8A 3PJ9A 2IVMA 2PMWA 4USIA 3EX7B 1FWKA 3H7HB 3MM5B 3AHPA 4ZITA 2DNYA 3DRRB 1WWHA 5H9FK 2HFOA 1AXQA 2V63A 1H73A 3PW2A 3V5RA 4B3OB 1JIHA 2N4CA 3VAKA 3TUZC 1AROP 3VR1A 3CJKB 1M5OC 2P6TA 2W9CB 4AD6A 4C4WA 4MYTA 3HD1A 1C1BA 3BS9A 1CULA 1KQFB 2IAJA 3KKFA 2AYGA 4K4VA 4AL5A 5E2QA 4UOGA 4JI7J 4P71A 1KWMA 3X1LB 1GX5A 2DEIA 1DZ5A 1KONA 3V81B 3NGDA 7FDRA 2GVZB 4L74A 1S7HA 3JSMB 3M8QB 4DCJB 1C0TA 2HK2A 5DDQC 2B51A 3C15B 4M5MA 2RUSA 4OYAA 4P7TA 2RMLA 3D3BJ 3PW7A 1RBLA 3EM1A 1T9UA 1U8SA 4OYXA 1YKWA 2EK1A 2OFGX 7FD1A 1DTTA 1WC1A 3VAMA 5J1PA 4FPIA 4X4UA 1LNQA 1RAHB 2LU2A 4UY85 2UXDF 1AYEA 2JX2A 2ZM6F 4I4BA 3V6HA 4M63A 3G9CA 2GHWA 5KFKA 3K5NA 2MKCA 2RHQB 3GV8B 1NUEA 2VOOA 2A10A 3DHWC 1R8AA 2GMHA 2R7VA 2Z56B 3B82A 1I51B 1QAIA 3T1YF 3CJRA 3KLHB 3R7BB 3QAEA 4C0OC 4ECUA 3CPWR 2YNGB 4ZVGA 4NE9C 1NZAA 1ZM4A 5LOQA 4X4NA 4FKXA 4DR1F 4J9VA 2OPSA 4A8FA 2YPYA 3AFGA 3CDEA 1BWEA 4DPYA 4DSIA 5D4OA 4WFAQ 1KHVA 2VJUA 3IA0A 4ZLNA 1ZZFA 1XMOJ 3H2VE 3WX8A 2A6MA 4OX7A 3DXSX 2MB0B 3FK4A 2IVFB 4O0IA 4LRBA 3W9JA 2J5AA 3V6DA 1U1LA 2PEBA 4X62F 3DYAA 4DL3A 3I0SA 2MHNA 1VQ6S 3UD4P 3ZNUA 3Q2TC 3Q86A 4PXDA 3OPKA 4DF4A 3KUEA 1SIZA 2VFVA 2F8HA 4USKA 4C11A 1JLQA 1NK6A 4K5SA 1OIAA 2UVRA 2FVSA 1U48A 3SFGA 2FVCA 1HNVB 2YWKA 3R5DA 4LSLA 4WK1A 4ECWA 4OJ3A 4NMLA 2HNZA 4WKYA 5J2PB 4ZHRA 4PPDA 2CZ4A 2L9WA 3TJAA 1LKZA 3SZ2A 2CQ2A 1N5VA 4N56A 4UY8T 1T0TV 4KKOA 1N36F 3M7VA 4G65A 1VIXA 3GG1A 4H4KA 3C6UA 3TUIC 1JNRB 4X64F 4GVBB 5KFPA 5J1EB 2V67A 1ZZNA 1KVIA 4KH0B 4DR4F 3GR1A 2GHPA 1HHSA 2F9JA 3RTVA 4HH0A 2LKZA 2G0JA 2JFKA 2G2OA 2ZDPA 3AXKA 1B70B 5F8LA 5HMYA 2CPDA 1J5EF 4O4GA 4QU6A 5D0HA 2XLKA 1R0CB 2OGUA 3QO9B 3GSIA 3NLCA 3TAMA 4UZCA 2XGPA 2PN6A 2OFHX 4RO0A 3MEEB 1BD6A 2WVFA 3BQ0A 1RTJA 3MUTP 3RAQA 2ACMA 1NH8A 3MFIA 2QA4S 1H38A 4LF9F 1WHVA 2HFNA 1HHTP 4MFBB 1YZ7A 1S48A 5CYQA 3ENVA 1VJWA 4XTTA 4Z7YA 3J7AN 4HHHA 3VV2B 1B7YB 3EGNA 4EZ9A 1FX2A 4OZ2A 5C24A 4HACB 2CQ0A 2XNQA 1D09B 4DL4A 3NNHA 3ZFVA 2ZD1A 2JLFA 4O3SA 2ZM6J 1T05B 1VQ4S 1C4AA 2GHVC 3FEYB 2V4JA 2UUTA 5LXRA 1RTHB 3JQKA 1IKWB 3HHEA 4MJKA 5KFFA 4DF8A 1FNXH 1FDNA 3QT7A 5CZXA 1HNXF 5H9EJ 3MTJA 3T1YJ 5GVQA 2YWGA 3IWXA 4I2PB 3ICLA 3BO3A 4RW9B 3UVJA 1QAJA 4DR1J 3I0RA 4NRUA 1SV5B 2OPQA 3FKBA 3FQLA 5KFCA 1TK5A 4QYRA 2CWXA 4KGKA 2ASYA 5D0RA 2Y1RI 3M6VA 5EWFA 3IR7B 1XJWB 4DX5A 1TFWA 1Q8LA 1ZAWA 4ECVA 1N6QB 4RW8B 1SH0A 3V4IA 4RBTA 1U1KA 4M5NA 1RT4B 4ZPBA 1VC5A 3HZEA 2MJNA 4F8RA 4X62J 3GIRA 4IDKA 2W7OA 4CLPA 3H5YA 1CJTB 2C3YA 3GP9A 4NCGB 2HQIA 1IJFB 3R9LA 1TL7B 3GFXA 1NPPA 4FVMA 1PJ6A 4I6AA 3AY0A 2XS7A 4ID5A 4J9UE 2KT5A 5F0WA 2DT9A 1R0AA 1HMVA 2HQDA 1ICEB 5L1LA 4H4KC 5DGBA 4NLXA 4DR6F 5HROA 5AE2A 1QE1B 5B7WA 3MD3A 3SV4A 3T5KA 4TU9A 3PEJA 2QRRA 5KFSA 2QLXA 2AQ4A 3PYFA 5C42A 4ZS6A 3CSKA 4WE1B 1AFIA 3T6BA 3ADAC 2LU1A 2UV8G 4FYXB 2QO3A 3R1LA 4O44B 1JLBA 4WFBQ 1M5SA 2XSJB 2Z2YB 2DR5A 1QD1A 3EGVA 4X64J 1OS5A 3CUNA 4H4MA 4URQU 2R3VA 4DR4J 1HNZF 1UEKA 4QQBA 2KI2A 3CDBA 2LVWA 2SXLA 3SIPB 2CXEA 3VGSA 1GAOA 4MH8A 4ZPTR 1XNQJ 2DH7A 4YB1P 2HWTA 2I8EA 3M6WA 2UUCF 1WC6A 3D3CJ 4U6PA 3KK1A 1J5EJ 3HPOA 2FHJD 2BR0A 4N7TA 2E7WA 2E9ZA 4LF2A 5HANA 4NA1A 1M90T 1VLOA 2PEHA 3SI8A 2VZ9A 4LF9J 3NXZA 3CNQP 1VRQC 2IBOA 1GTEA 2YWWA 4PWWA 2G0CA 4IRDA 3CDAA 4DX6A 2D9PA 2CPHA 3IXQA 2GFFA 1CLFA 2I1RA 3TA2A 2MGZB 4CI0B 4Y2KA 4QIGA 5K8OA 3DKDA 3U27A 1UMJA 4X66F 3QFWA 1NSQA 4ZPVR 1YJRA 4KY3A 1T11A 3BN7A 4HR2A 3VZIA 4ZVQB 3QWUA 1Q1KA 3RRHA 3MPYA 1N8RT 9ATCB 3OFGA 5E3QA 2C2RA 2C2KB 1HNXJ 3M30A 2DR9A 4OYPA 1L3UA 5C7PA 1VRUB 1RKIA 1UJ4A 4ZVPB 1SL0A 4WPAA 2WTFA 1U26A 4Y6IA 1S1UB 3M9NB 2XY6A 3OL8A 4KO0B 4C97A 2J7UA 5F9LA 4RWWA 1TAQA 1XR7A 4DPOA 2GIFA 3M8PA 5HJYA 2W9AA 4F4ZA 3GJSB 1HQUA 2C42A 1GQEA 4G3IA 3R97A 3W61A 4K4TA 2IRXA 4RNFA 3P96A 5GADI 2HHWA 2QYGA 1ACMB 2AX0A 4M5GA 2M9KA 3PVXA 1P27B 1UVNA 3D67A 1IWGA 4QYZJ 1H74A 5ETRA 1WF2A 3NMAA 2PDAA 1HWJA 2DGOA 4WU2A 1HBUB 2ROEA 5GAHU 2GVDA 5IFMA 4OHVA 5F8GA 1FKAF 4DR6J 1F5CA 2XMMA 4JBCA 4XPEA 3JXOA 4NZ0A 2V9WA 2F63A 4Y34A 4OZ1A 4YB7A 3CD7A 3T1HF 1ZTTA 3MMBA 5CHCB 1V9OA 1PYTA 4E98A 4F4AA 5CA5A 2ZZMA 4ELVA 2ROGA 3TX8A 3DLGB 1HI1A 5KT6A 1K73T 4FF2A 1AZSB 3GJRB 1ITPA 2BW2A 4TYAA 2FLLA 2Y1LB 5DETA 3IO1A 3RG6A 4LF5J 2ZVIA 4O3QA 1HPZB 3IG1B 1FRKA 3G96A 3MR5A 2UUBJ 1S0NA 2FHOB 4QBUA 4YDXA 5I3UB 3HJFA 1HNZJ 4ZJQA 3L7UA 1LXJA 2KXHA 3GFYA 1J2VA 3F56A 1VOMA 2CQCA 1U2RA 4B9MA 1BC6A 1DQ8A 2LQ5A 2YNFA 3FBFA 4NA3A 2RU3A 1RAFB 1GTHA 2LFVA 2V34A 1PSDA 2QLWA 1B3TA 1VYAA 2P9CA 2J0WA 1EB0A 2W4PA 3J7Z5 1PAEX 4WK3A 5KFWA 4CLZA 4WZMA 5HVGA 5J2MB 1EKSA 3S8SA 1V3ZA 3P6YC 3HF5A 1RT2A 1OPZA 1IXKA 2R42A 3OXFA 4LIRA 4DPUA 1D3WA 4U8VA 1CJKA 4X66J 1TL1B 4UUWA 5IT9U 3JYTA 1SUQB 1U02A 1PAUB 1S9GA 3S1TA 1NRKA 2RB7A 1RWMB 3IAS9 5LM7E 3NS7B 2YXLA 3ENQA 3CJ4A 1KLMB 2BM0A 5AE1A 3ZC4A 1ZM3A 4MKAA 1YJNS 4R5PB 1OSCA 4NXNF 2VBWA 2YNIB 4Y2CA 3LGMA 2GIRA 3AB4B 3GJQB 5I42B 2B56A 4CLLA 3PEHA 2Y1JA 2BKOA 1YJVA 4CLTA 4DSEA 4UQGA 5B0CA 2FJDB 4CO4A 4LSNB 3EVMA 2E5JA 4NLYA 3G8SA 3N4WA 4HHJA 2ATLA 2JFDA 2YNHA 5GAGU 2RDIA 1RAIB 4G1QA 2DHXA 3TR5A 4XDDA 1CSJA 1M0SA 3OFHA 3FUYA 2IHR1 3QGGA 3DRSB 4QR2A 4OHYA 1TMMA 1IM6A 1NDCA 4PG8A 4B3MJ 2Y8YA 2FHJA 2YKMB 5KG0A 1PBUA 3QQCD 4KE5A 4LBIA 4RW7B 3L3CA 1E6VA 1YX2A 4RW4A 4LMZA 3DLKA 4EU0A 1M5KC 2EFGA 1Y3KA 2KYZA 1HWLA 1SKRA 3C16A 2G2ZA 4YMEA 3T1HJ 2CKWA 2KFYA 4LSZB 4CLUA 3EYZA 1X5PA 5E3RA 4ZJOA 2IM1A 5L1KA 3A3PB 4CM2A 5KT3A 2W2NP 3F44A 1PYSB 2DKOB 1X31C 2AZ3A 2UXBF 4UQTA 1AUDA 4DV7J 1FFSB 2KT2A 4KHRA 4NYPA 2ROPA 1U49A 4ED4A 2KZMA 3I55S 2KYXA 5FDLA 4Q0BA 2FZCB 2X1AA 3OR2A 4CLWA 4ZPCA 5CXTA 4IQXA 5CCMA 3KLEA 2NSCA 1HQEB 5HLFA 2QL5B 3RB6A 1NH7A 5DQIA 3KJVB 3LOUA 3MMCB 2BOPA 3EXYA 4KGMA 2DR6A 2UZAA 2YH0A 1X5SA 1YWXA 1CJVA 4MAKA 3K59A 3I96A 4DS5A 2EC0A 2XS2A 5A0YB 4O3OA 1IQZA 1SH3A 4TY8B 1RLCL 3K5LA 3CCUS 5DLFA 3BGOP 3EXCX 4USHA 5K20B 1RTDA 5KFYA 3UI3A 1FE0A 2RF2A 3CTRA 3OUYA 1UWBA 1N54B 1VQ9S 3BV8A 3OJUA 3RB0A 1G1XA 2R8IA 2MXYA 1V5IB 2OLWA 4AL6A 3KMSA 1HNIA 1WJ9A 2V94A 2OELA 2DITA 4ZP6A 2J9CA 2HRTA 5DM7Q 3LGHA 5HMWA 5DDOC 3GFHA 1XN9A 1C1BB 3H25A 2B3TB 4U96A 1CC8A 3E3XA 2FGOA 1ZA2B 1LWCA 4CTAA 2XCPA 3KLIA 4NXNJ 2IM0A 1C0TB 2FD2A 3R7NB 4CDIA 3D5MA 3VAIA 4O4RA 3JB9k 1TK0A 3KFWX 3AD8C 6FDRA 2PO4A 3HMJG 3OXGA 1REVA 3BBBA 4B3TF 1U1PA 3DM2A 3PW5A 3ILOA 4HI2A 2IIHA 1ZOTA 5B0EA 4PXEA 3L7PA 5DGAA 4M5LA 2IM3A 4HTIA 3PX4A 3I32A 2H51B 4FNIA 2HHHF 2B9YA 4M5DA 1C0UA 1VQLS 3M32A 3MCNA 4J9QA 2NR0A 5A6WA 1RAJA 4UZBA 2IRUA 1Q0NA 2UUAF 3N79A 5K5MA 3ITHB 3HULA 1RHRB 4EFAC 1BMQB 4DV4F 4C3LA 3CXCR 2OPSB 4CT9A 1IBKJ 1O5JA 3T19A 1TTHB 2OIHA 2MKHA 2XEXA 2DXFA 5BR8F 2KVQE 2R8HA 2W4CA 4P7VA 3HM9A 5JMNA 2CNLB 5KFHA 4Y65A 4K0KJ 2B43A 2MMYA 2YQ0A 4J9SA 1NDLA 4ZLLA 4URGA 2B0GA 3MD1A 3V6DB 3DYAB 4B02A 1RJJA 4ZLPA 1LW0A 1YBUA 4A8WA 4ILRA 1SJ4P 3VAJA 3K7RA 3H20A 5L46A 3KNGA 4ZMMA 2R2SA 4UT4A 5D8HB 3SDEB 3VGUA 3M2RA 3CJ3A 4C11B 1JLQB 2HHTA 5A6PA 2YX7A 2JWNA 1IR2A 4L6V3 1TAUA 1UETA 4I6WA 1U7LA 2R7XA 2XY7A 4LSLB 3N0VA 2HNZB 5KFXA 2FJVA 1NK8A 2DNZA 5JUMA 3KG0A 1WHXA 3N5BA 2BV3A 4A47A 2J9EA 4K4XA 1FDAA 3PTWA 5ETLA 3IRWP 4KKOB 2AKWB 4W92B 5KTQA 1WC4A 1GXTA 2JC1A 3C6UB 3TJ9A 4DL5A 1TL3B 1S1VA 2FGCA 1NU4A 3LA0A 2DHHA 4Q43A 2IA6A 4DN9A 2KG1A 1D9AA 2FJEB 1S7IA 2WRMA 1EARA 5F3TA 3ETMA 2KT3A 1CPZA 2XWXA 4O4GB 3R6GB 1KTQA 4CLKA 1RU2A 1F5BA 2RU9A 1BGXT 3TAMB 4Y2AA 1T3OA 2VPYB 5L1IA 2AEJA 1RTJB 4I6YA 2WSEC 1TKDA 2JC0A 2VC0A 5GMDA 2K3IA 3TZYA 5J2QA 2MLZA 3HVRA 2H4WB 2EG2A 3V4MA 4FS1A 4BBYA 2VJVA 5F8NA 2MSSA 3HVAA 2R2UA 3DLJA 1UCNA 1X8DA 1RT1B 1JKHA 5CYQB 3IS9B 1WC5A 4B3TJ 4RUAA 1FA0A 2Q6BA 4I68A 3E2EA 2XI2A 5DG7A 1X4GA 5C24B 3CJ8A 4DSJA 2F1FA 1OO0B 4I67A 3LF0A 1JX4A 2ZD1B 3U7JA 2HHHJ 2DHAA 2XM3A 3SMZA 2V4JB 1DURA 2XI3A 3SYZA 3OL6A 2GGPA 3C6TB 3BSNA 2O5DA 2CFXA 4UTGA 4DLEA 1RWWB 1U6FA 4IG0A 4MKVA 1S9EA 3I4HX 4AT1B 5IQ6A 5DG8A 1PKUA 5B08A 1I94F 4V19J 4ED6A 3D0GE 3FNNA 4LFBF 5IXUA 2OPQB 3M1VA 8RUCA 2EKYA 3D6FB 1MLAA 5BR8J 2ERRA 2NPIA 1N5SA 2E66A 4ES1A 2VD3A 3ZZUA 4FYWB 1N5QA 1Z2ZA 3T1AA 2APOA 3KTQA 1Y4ZB 5GMKa 1MMLA 3P5TL 1QDUB 2IPOB 3D6MB 1OWXA 4NASA 3BM7A 1SBRA 2GJ2A 4IDKB 1LOUA 1RWNB 4DBQA 3HHLC 1FXLA 2AJ0A 3ET6A 4NLDA 4NLTA 4ID5B 2OPRA 5JJBA 1G3OA 3TVZA 1R0AB 1HMVB 2EG1A 2YVSA 2PFFB 3EGWB 3MAAA 2HAFA 2K7JA 4DV3F 2RQCA 4KGXB 2L9NA 3D1HA 2R7WA 2MHEA 3A12A 5HJXA 4C98A 5ETMA 1N5YA 1NEEA 4NPOA 5B09A 1WG1A 2CPZA 2F40A 3EMTA 5C42B 3AQOA 3DCAA 2IVYA 1NSPA 5DG9A 1BQMA 1B64A 5K14B 2GQQA 1W2IA 3HSJA 5KG2A 2FHMA 2WVCA 1MU2A 1VISA 2W4DA 3MAHA 1JLBB 2QSWA 3CJ2A 1Y5IB 3BH7B 3TOQA 1W26A 2VOPA 2J6UA 2VFSA 3TX0A 2XGQA 2GO9A 4RUCA 2C2NA 3PXGa 2RS8A 2CA9A 4HH1A 1SC6A 2DNNA 1VQ5S 3I4PA 2M0GB 2KTQA 1R8PA 4P9SA 3PFEA 3NP5A 3IR5B 4YB5A 5J1NA 2VICA 2DIVA 3KK1B 5KFVA 2JLGA 4O3RA 3MXHP 1S1XA 2YKNA 1VQ7S 4DSKA 1EHWA 5F8MA 4EZ6A 3BYRA 1T9WA 5KFRA 3IR6B 5F8JA 5L9XA 1IWAA 2CVEA 3CD6S 4ERDA 2XZTB 1WEYA 2DR8A 5DM6Q 2MKIA 1DQ9A 4AE5A 1JJ2R 3TEGA 4DHVA 2ZWOA 4AXJA 4ES3A 3OLBA 3ILJA 4YOEA 2Y8WA 4ITSA 4QIEA 3HKZD 1S12A 3EDRB 4L76A 2ZH3A 2B4OA 2HNYA 4CLFA 4A48A 1S9FA 4ZVTB 4DXLA 3SCLE 3UCGA 1XR6A 1TVRA 2LA6A 4ECXA 3D1QA 3M30B 5E3CA 3OHAA 1S76D 2J7KA 4Z7CA 1WORA 5KFLA 3NEKA 4Q45A 1P9YA 1I94J 3RW6A 1Y11A 4C3MA 4LFBJ 2XZWA 4WBFA 5CD4H 2NREA 1MROA 4HL9A 3M8PB 4FF1A 2VIHA 4K5RA 2WB4A 3QJJA 4RWXA 1HQUB 3ISND 2VBYA 2AYBA 2MEWA 4WFXA 3A13A 3HP6A 3BQ2A 1WDTA 3LPEA 2EEYA 4EEYA 2QEXS 4UOFA 4Y3CA 4IRCA 2CPIA 4CM0A 4CO0A 3CO9A 1O8BA 4TVAB 1TK8A 4RUBA 1RYRA 2GV1A 1X0FA 2B9EA 4NX9A 2JLEA 2WZ1A 2CG4A 3RUBL 4WFZA 4LRAA 4OLOA 5GADU 3AQPA 2O67A 1Q5YA 4ZCKA 1UVKA 1RDRA 2GAGC 2ZH6A 1HD1A 4FP9A 4K4WA 1LFWA 4IUFA 2CQHA 2LDYA 1WOPA 3NWGA 4PG6A 4DV3J 2H5EA 2E1MC 1P1TA 2FJBB 1TKXA 3MMBB 4QWAA 2XLJA 3ZZ0A 3TUPA 3I6PA 2D3ZA 2MZJA 3NGRA 1YDLA 4DX8H 3L09A 3VHQA 2VG6B 1XIQA 1U4BA 2MQNA 2PI4A 1Q5VA 5H9FJ 2W2MP 3H40A 1HFEL 3S6EA 4C8OA 2RSQA 1IVZA 1WELA 3KUHA 3R5GA 4ZLJA 4OQJA 5AXKA 5HMXA 2V8HA 3HO1A 2KM8C 2HBYB 3WC2A 4DWIA 4CQ1A 4OFZA 3R8YA 5LT5A 1RP5A 3BO4A 3UDVA 1TL5A 3MEDA 2DNOA 4M1KA 2WONA 1DTQA 1G6BA 2NYIA 3D4JA 3GPAA 5LSLA 1O6XA 2AX1A 3TZWA 2NZ4A 5T14A 2J76E 4QWDA 2YNFB 2WW8A 1NKCA 4I0WA 3IRXA 2ZBIA 4USUA 1XERA 1OYEA 1PO6A 3MUMP 2JVOA 4LF8J 4JUZA 3M2VA 2DY1A 3BYPA 4OX6A 1PIEA 5KFGA 4IG3A 3GIMA 1HNWF 2MQMA 2QA2A 5DZ6A 1MN9A 4AYBD 2QLBB 1IBMF 1PC5A 2BOAA 1RT2B 4UF4A 3HHDA 2DCLA 1HHQA 4OHXA 4JV5F 1CJKB 3QATA 2M3DA 3IM8A 4USVA 1R7IA 3JYTB 5CYMA 2DGTA 5KFBA 1OYDA 1FK9B 3NOCA 3BH6B 3R5JB 3M8YA 1S9GB 2FHKA 3CJ0A 2LXIA 5IWAF 4GO5X 3IM9A 4PQUA 2DNLA 5DDPC 1NO8A 5DZ7A 4NL5A 1S0MA 3RU0A 3GYNA 3NL0A 2ACYA 5IT9Y 2OAUA 2GNKA 1S1TA 5KFQA 4PABA 5D78A 3D0IE 2R7TA 1QY7A 2R7OA 2VF3A 1OQ3A 2HWIA 2AYEA 2XHWA 2YNHB 5SZTA 4YY3J 4G1QB 2MZRA 2MKKA 2AMCB 1XC9A 3TAPA 1LQ9A 4Y0FA 2K1RA 1KHWA 3D6HB 1F9HA 2VA3A 1YJ7A 3FBEA 1IBLF 1KSPA 3NOGA 1AT1B 5KT7A 2CJXB 3CDUA 1E6VB 4DJBA 2J6SA 2Y9HA 4NLUA 2HVIA 1UPPA 1EIYB 1X9SA 4XO0A 3DLKB 1CBKA 3SSQA 4C48A 1VBKA 2XBPA 1R31A 2BJ3A 3A8JA 2D41A 4EUVA 2RRAA 1GMUA 2F3JA 3C16B 1NK9A 1KP6A 2G2YA 3CMES 4P2FA 1JLCB 3DRPA 3ENAA 2CNOB 2EK6A 3EZUA 4KIAA 5KFUA 4OI4A 2R9LA 1YBTA 3PHTA 3SEOA 2NUHA 3BB5A 3QPIA 3PR4A 1X60A 1LXNA 4EWTA 3UO0A 4JI4F 3PJWA 2HG4A 1RT7A 1ZA1B 4DR2F 1A9NB 3N6MA 4NLVA 2AEMA 3DRYA 4YB6A 2POKA 2GCFA 3EVWA 4FXWA 1UFKA 1S6QA 1HYSA 4WF9Q 5FDLB 5A8WB 3PIPQ 3HSZA 2CQ3A 2ASJA 5ETTA 4P2SA 3UDLA 1U45A 3JTNA 3KLEB 2HBZB 4ICLA 2E5IA 4J91A 5HLFB 4NLQA 1NK5A 2YKOA 1VBXA 1RSCA 1KD1T 4L75A 2NUUG 4W4MA 1SQGA 2C3MA 4UOHA 1RT5A 2NPFA 3OSNA 1TELA 1RT6A 4JP8A 3NKYA 4OYOA 4RBUA 1CJVB 2RS2A 4ZOSA 2GC8A 2BJ7A 2HVZA 2BXJA 4ZIVA 1SIWB 4Y2MA 4LF6F 2QA1A 2W9BA 3QT8A 3MR2A 1HNWJ 2ZC4A 2RF2B 1S0VA 2IM2A 3JS9A 3OUYB 2HS4A 1UWBB 2V50A 4UW2A 3O1LA 4L72B 2WAQD 3I9ZA 1IBMJ 4PG7A 2AWZA 3ETOA 2J0XA 3D68A 1N0UA 1HNIB 3CCQS 1DQAA 1KR4A 3UCZP 1IKVB 3LALA 4MIWA 4CO3A 4PYAA 4M94A 2DISA 1PYOB 2QA4G 3L95X 3LP2A 3SBMA 3QIPA 2DPJA 4FZVA 2HIQA 3ZNJ1 2IRYA 3B6BA 1LWCB 2RILA 4CTAB 3ZO7A 5HL7Q 4ZP8A 1UFWA 4QIWD 1TKTA 1FKOA 2MKSA 1UEVA 2CJ9A 1NCLA 3B8HA 1NHUA 2BABA 4WXOA 2HWHA 2VA2A 5CH7B 1REVB 1YGYA 3PJXA 3DM2B 3FVYA 1TMJA 4JOUA 3RR8A 1APSA 2H65B 3RR7A 2AU0A 1WI6A 4Q8EA 3NBPA 1NSKL 3G6VA 4B9TA 4KTQA 2P5VA 3CO0P 2DBBA 3MUVP 2A1BA 4CH0S 2BQUA 4LF4J 3PIOQ 4ZN3A 3H42A 4PWDA 4M5DB 3THVA 1C0UB 1XQIA 1N32F 4JI7F 3U1MA 3M32B 4RU2A 4U95A 1IBLJ 1FDBA 1FRIA 4DLGA 3B54A 3TA1A 2CNKB 1VQOS 1KQKA 3OHBA 2X1FA 2XS5A 5T7LA 1R6VA 2ZITA 2F5GA 1H7WA 2AGOA 2CZVC 3DC2A 3GR0A 4IR1A 5ETVA 4EI2A 1ZTWA 4QYZK 4TU8A 3BKTA 3QBCA 1XK8A 2CUYA 1HBNA 2N4DA 2D3O1 1H3DA 2FC8A 2PA3A 5ETOA 2ZDOA 2BJ1A 4DR5F 1RZMA 3TJ8A 2WVEA 3EVOA 4UOCA 1Q7YT 4DR2J 3OL7A 1LW0B 1QVGR 4H54A 1U47A 2QSFA 3ISNC 2ILYA 2G4BA 4KFBB 3QZ8A 2NQPA 3SXLA 3M2RB 5ADZA 5KG6A 3MM5A 1YIJS 3D0HE 4I2QB 2B6AA 1NKBA 4OJ1A 4X4QA 3DOLA 2U2FA 4NMXA 1XMOF 3A3NB 1VQ8S 1VLYA 4YS2A 2BM1A 2KXNB 2FB0A 3CJKA 2J0QD 3KK2A 3DLLQ 1VQSA 4LRFA 4LF6J 1JLGA 3CCJS 3VALA 4FNHA 1IJEB 2CNNB 4ZP9A 2DGSA 2GJIA 3RBEA 2M2BA 3EWGA 3PCOB 4KAIA 2RRBA 3EUNA 4DG1A 3QRPA 1S1VB 5IT0A 5F41A 2CQIA 3J7YU 4MT1A 3TVYA 4TN2A 1WHWA 2GVZA 2BQRA 5AXNA 3JSMA 5D4PA 1N56A 3CC2S 1LWXA 3DLHA 1MNEA 3CCVS 3C15A 4AQYF 2KZZA 4KQZA 2HMIA 3PO4A 3FBBA 3IFEA 2R4FA 4ZK7M 1T9VA 4JYAF 4W98A 3TW0A 4DI6A 4A8QA 4ZVOB 2DNGA 2B8QA 3CC7S 3I56S 1PILA 2JOQA 5KT5A 5J2QB 3VCDA 4M5JA 3OTCA 3P3DA 3OVSA 1MWQA 2XMVA 4CZCA 1JKHB 3PW4A 2KVIA 1SCJB 2HHVA 3FC9A 5AT1B 3PX6A 5EX0A 4YR2A 3L4BC 3A8EA 2BJ9A 3KLHA 4P75A 3KOAA 3HZGA 5M2UA 4LF7F 3W65A 1DY3A 2V2KA 4LREA 3ZZPA 4BS2A 1N4LA 1N32J 5CD4A 1ZYQA 4KJIA 5A2QY 3W64A 3L9ZA 2GGPB 4OYMA 4KPYA 4QPTA 2XCAA 3TANA 2E9RX 2EPIA 3SCIE 4IG0B 4KV8A 4X2BA 1S9EB 4N76A 2DY9A 3M1VB 1H72C 2JVRA 3QGPA 1ZETA 4U67Q 3CJ5A 3K8VA 1VQYA 2M70A 3LP1A 5GAEI 1FO1A 2W8LA 2BDPA 3QLHA 4N5SA 1T9XA 4DR5J 1TP7A 2XMTA 3W5YA 4QR1A 3C14B 1VHIA 1N5TA 1NMEB 2UXCF 4NI2B 1LW2A 4Y28C 1AB8A 1VR6A 5HQLA 4K7QA 1R3NA 2XC9A 2B8PA 4DSLA 3ET6B 2EFNA 4IYQA 4NOHA 3OTDA 4OYZA 3QIDA 2OPRB 1UVIA 1JWWA 3PW0A 5IZHA 1QTNB 2CQBA 4FYVB 3HSDA 4JI8F 3MAAB 1PJ7A 2VU5A 5HI7A 4BCAA 4B08A 1N52B 2L9DA 3TAQA 3VZHA 1RXOB 2FZKB 3PRBA 1U0HB 4ZVEA 3F41A 3DLBA 3TWZA 3UN3A 3BREA 2YX1A 2QV6A 3FCWA 2G0IA 3MEGA 2QGFB 2VHGA 3JTOA 1BQMB 4JI6F 1MSWD 1UL3A 4ETXA 1RGVA 3EZOA 3EPIA 3RB3A 3G6XA 4Q8FA 1MU2B 3M6UA 1PGZA 4DCOB 2UU9F 2W25A 5RUBA 2MJUA 3MM9A 3I5BA 2BRLA 2PA8D 1BUXA 1DBDA 1FD2A 2Z0GA 2VQEF 1M5VC 3G8TA 2J9DA 3N6NA 1AW0A 1RB0A 4G6VB 4NZ7A 4LQ9A 4MFBA 1W7WA 4OI3A 3HI9A 4AQYJ 4ZKAA 2B9WA 1F6TA 1FWLA 3D54A 3O8WA 1VFJA 1S1XB 2YKNB 1RBOB 4V19X 1Z2LA 4JYAJ 1Q7LB 4PWUA 2NZCA 3KHRA 2JDJA 5M2PA 2C2DA 4HACA 3OTEA 1XTZA 2CG8A 4KBIA 1JK9B 2IMOA 4OI1A 2OEMA 3AJ2A 2ZKTA 2KM8B 3MOJB 4QR0A 1IKWA 2QLFB 2NXCA 2FJXA 1PBAA 4RNHA 3VQTA 1JNZB 4ZPWR 1EJ7L 2QX0A 3HHNB 4U7UD 1EAYC 1RWOB 2BKPA 4EK2A 2DHGA 3ELHA 4LF7J 1XNQF 3BQ1A 2DB1A 5D3GA 3Q8SB 4MK9A 1HD0A 2HNYB 2W2OP 4EBEA 1UW9A 1RHJB 2BA9A 5ITHA 1UA1A 1TVRB 4HT7A 9RUBA 3DU6A 1NK0A 3M4XA 7AT1B 4RW6A 1SQFA 4U7CA 2Z57B 2AV5A 3KK3A 1F3VA 2HAIA 3QAUA 4U8YA 3AT1B 1NZ8A 2RJZA 3SCKE 5EWEA 1CJTA 1MROB 4N41A 3ULHA 4OIXA 5A8KA 5IV3A 4FBTA 2M4MA 4DR7J 4W90B 1P1LA 3DRXA 2I0XA 2YQ3A 3ILIA 2XWYA 1RBAA 2B4VA 3OFFA 4A8KA 1TU0B 1Y9OA 2UXCJ 1QAXA 2AYMA 2R2RA 5BYQA 2VDHA 4J9PA 2LDIA 2D9OA 3IBCB 2BQ3A 3FMWA 1YQHA 2I5JB 1G4CA 3BSOA 3CCTA 4WE1A 4M8LA 3P45B 4DOZA 1FNMA 4QJVA 4LFCF 4GVLA 2X51A 2NYHA 4JI8J 4WFYA 4PUOB 1UJ5A 1LWEA 2ASDA 4DL2A 2HPUA 2XQCA 1NPRA 2WOMA 4O44A 3AJDA 1TKXB 5LXYA 1RT3B 2ATCB 1UP1A 3BPDA 5JVHQ 2ZOMA 4CNYA 2HHSA 1JLAB 3PNIA 2N7CA 4JI6J 2ZJQQ 3DLEA 2AJFE 3A3OB 2FC9A 2GMJA 2EVZA 3PKYA 3CCRS 2UU9J 2XMUA 4C0HA 5KFMA 1JXEA 2HZVA 2VQEJ 3MGJA 4QW8A 3FEXB 4N47A 2RKIB 3MEDB 1V6HA 1DTQB 3LANA 5MLCV 1WC0A 4F2SA 2HHXA 4I69A 5D6GA 1WSRA 1MN7A 1REGX 2BACA 3IRXB 1QLNA 4GC7A 3TZXA 2ZH4A 1SKSA 5IC6B 3K58A 4PEOA 2PC6A 3M2VB 2QG9B 2D1CA 5BYRA 4I1TA 1RACB 3QT6A 2QFJA 1LK7A 1VMBA 4IG3B 3DHXA 4LF5F 3W2WA 1IBCB 1R89A 5BXIA 2Y0BB 2HFSA 1P8GA 2HQCA 2UUBF 2WB1D 2M88A 5AE3A 4HLBA 4WU3A 2EBEA 1HBMA 4BHQA 1GK8A 5CAAA 1X7VA 2B4PA 2PFDA 1F2GA 2E5LF 4EGLA 2XMJA 5CYMB 1SL2A 2VKRA 3DGPB 2CJBA 2IJRA 1K8AT 5FLXY 1NJXA 3KMQA 4ED3A 4ED7A 2MLYA 3DN9A 3I5CA 3E01B 3MCOA 3FFIA 3UR0A 2HRUA 3R3TA 4DUTA 2HLTA 1NSAA 1AUSL 4DV2F 3IGNA 3QGHA 2W01A 4ZA1A 1UEUA 4KHPF 3AD7C 2DGUA 3G82B
chains in the Genus database with same CATH topology
1UTAA 2LFVA 1X60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTA A;  2LFV A;  1X60 A; 
#chains in the Genus database with same CATH topology
 5GAH I;  1ZAX A;  5EGY A;  4D3H A;  5KFN A;  5E0O A;  3POT A;  3CCE S;  3TI0 A;  1U1M A;  3F0N A;  3I9V 9;  2GS8 A;  1S1T B;  1UW4 A;  3BO2 A;  4IO9 Q;  2M8H A;  5C25 A;  2VBX A;  4AUK A;  2YTC A;  4QOT A;  4BWM A;  2DRA A;  2WW4 A;  4ZN1 A;  4ATN A;  2YKA A;  1IN0 A;  3C3L A;  3TUJ C;  3JTP A;  4B3S F;  4PPZ A;  3HT0 A;  3OVA A;  2DYA A;  1ZBT A;  4F3M A;  4CCH A;  2G1D A;  3RBZ A;  2K1R B;  4D3G A;  1MWZ A;  3ENW A;  4ILL A;  5DLG A;  3GQC A;  1W2B R;  1B7F A;  1HLW A;  1SJ3 P;  1FWP A;  2W7P A;  2HZC A;  3SV3 A;  2OTL S;  4HDG A;  4CO2 A;  4NEZ A;  5U47 A;  4GKK F;  1FTR A;  4LFC J;  1X5T A;  2CPY A;  2C1E B;  5B0A A;  1RIS A;  2KG0 A;  4I56 A;  3HX9 A;  2KFZ A;  3DRP B;  4V1A k;  2HSE B;  1BLU A;  4Q44 A;  4ZVH A;  1AA1 B;  3VVU A;  4NLR A;  3OTO J;  4ZVU B;  2XYG B;  1C2P A;  2R7S A;  3N28 A;  3ZZO A;  2G1H A;  1UPM B;  4NLG A;  3UNY A;  2FZG B;  3H2L A;  1RAB B;  2LXU A;  1RYS A;  1RT7 B;  5G0R A;  3LPY A;  3UQS A;  3QSY B;  4NLS A;  3HKW A;  3KJN B;  4B3M F;  3CED A;  3TP2 A;  1S6Q B;  1HYS B;  1B0T A;  1S57 A;  4DUZ F;  4R8U A;  2KKH A;  3QMQ A;  1A0O B;  4ICL B;  1NKE A;  2IDE A;  4OYW A;  3ZZY A;  3LWL A;  4E2F B;  4DQR A;  1KC8 T;  1RE1 B;  3HFV A;  3KDO A;  1XNR F;  2IA0 A;  4LQ3 A;  2DK2 A;  3H0P A;  1XMQ F;  3BKU A;  1RT6 B;  4DPT A;  4B9V A;  4B9N A;  3LP0 A;  4KPC A;  2BEF A;  2LEC A;  2FY8 A;  2OEK A;  2J8A A;  2NXU A;  1SH2 A;  2RD5 C;  3B4M A;  4M5K A;  4CYU B;  4DV7 F;  4FF3 A;  2W9B B;  4JI0 F;  2MYF A;  1X5O A;  3GSD A;  5HVH A;  4IO1 A;  4CO1 A;  2VBZ A;  3I82 A;  4GO7 X;  3NAI A;  1M1G A;  1CJU A;  4PXC A;  2Z58 B;  2K7K A;  4IFY A;  4BDP A;  1TQL A;  3BPS P;  2LQ8 A;  3GCW P;  3TZZ A;  4N8O A;  1N34 J;  5CZV A;  2E5L J;  3H59 A;  4WCE Q;  2IYG A;  2P2C B;  3AJ1 A;  4MYU A;  3DI6 A;  4F36 A;  3EPG A;  2JEF A;  3H4D A;  3LP2 B;  3BKF A;  3QIP B;  1U0S A;  4DV2 J;  4ZCI A;  2QFI A;  3Q89 A;  2EFQ A;  2IC3 A;  4KHP J;  2MQ8 A;  4CRJ A;  3G86 A;  3IAM 9;  1EET B;  1TKT B;  2X7I A;  2GX8 A;  1FKO B;  3T9Z A;  2UVU A;  1KOO A;  2A2D A;  1WKL A;  1ZAV A;  4XDC A;  3WBZ A;  5GME A;  3MR3 A;  3WDO A;  5HBM A;  1WEX A;  2X1G A;  5KG5 A;  2DGQ A;  3MPV A;  2B5J B;  2RQK A;  4DR3 F;  4NLW A;  1LWF B;  4RL1 A;  3I5A A;  3BR9 A;  4B3S J;  4FPR A;  4I7F A;  1RWU A;  4R0E A;  1S0O A;  5D77 A;  3JSB A;  4PWD B;  1DFD A;  2FIU A;  3T3F A;  1ZH5 A;  3BF4 A;  5L1J A;  5CCL A;  2F8E X;  2ZH5 A;  1UJ6 A;  3MTK A;  4GKK J;  4EBC A;  2K3K A;  3OFE A;  3PYG A;  3H8Y A;  1O51 A;  5T7L B;  3GIJ A;  2LCW A;  2HS3 A;  1DLO A;  1T8E A;  1X4F A;  4P2M A;  1EZZ B;  4LJM A;  4ZCL A;  3TRG A;  2WK4 A;  2FYX A;  2VH7 A;  3K17 A;  3HHL D;  1S79 A;  2B9X A;  1YJ9 S;  3DGV A;  2XYH B;  2VL1 A;  4F3Q A;  1HBN B;  2Z2M A;  4JI3 F;  2ZE2 A;  2DNH A;  5ETK A;  3CMA S;  4OYI A;  1YLX A;  3KJV A;  2RNE A;  3UN5 A;  4KH1 B;  1PG5 B;  3W5Z A;  1SL1 A;  2PMZ D;  2BKN A;  1Q81 T;  4A8M P;  1TKZ A;  1VRT A;  4K8R A;  5KAK A;  1UAW A;  2V2Q A;  1WC3 A;  1F5A A;  2ALZ A;  4DV1 F;  4DUZ J;  2MY7 A;  2J7W A;  1WI8 A;  1UA0 A;  5HP1 A;  2EWH A;  5A76 A;  1F9E B;  4JV0 A;  1D9D A;  2O3D A;  3UR3 C;  1FJG J;  2UVW A;  1FRM A;  1IBK F;  4RLE A;  4LT6 A;  2RVJ A;  4CIO A;  2HIY A;  1U1O A;  3Q0A A;  1FFG B;  3GFZ A;  4Y2I A;  1XNR J;  2HHU A;  1FX4 A;  3O44 A;  2B6A B;  4F25 A;  3TQ1 A;  4LRC A;  3MDF A;  1TFY A;  3DOL B;  2HVD A;  1XMQ J;  2MQQ A;  4WKR A;  2XB2 D;  3N9U C;  4B9S A;  2EBG A;  2VG7 A;  4K0K F;  3KK2 B;  1A7G E;  1JLE A;  2A3J A;  1WSV A;  1YJW S;  1QTM A;  1JLG B;  1EP4 A;  1JLF A;  4JI0 J;  5LMU F;  3IMQ J;  4KRW A;  3VQS A;  2MKY A;  4ECY A;  5D0G A;  3SQO P;  4OX9 J;  3LUY A;  4DG1 B;  1Q53 A;  2AZ1 A;  3VAH A;  2DR7 A;  1EQ0 A;  2XLI A;  2ZFH A;  5E33 A;  2ZBC A;  4X4O A;  3K8W A;  3PHE A;  4PKD B;  3QT5 A;  2FLP A;  1CQM A;  3K89 A;  4IR9 A;  1WNE A;  4K4Y A;  3EZ5 A;  1Y10 A;  2NS1 B;  1OY6 A;  3CDW A;  1PC4 A;  3E51 A;  3GE9 A;  2HMI B;  4FXV A;  2UV8 A;  2O1P A;  1YJU A;  1IR1 A;  4IH5 A;  2HW3 A;  2NXE A;  3JAM Y;  4EO8 A;  2VFR A;  3QGI A;  1OJ4 A;  3FDS A;  3VAG A;  3EJM A;  2MQP A;  2Q6C A;  2HGL A;  2W7A A;  4C6A A;  1BXN A;  1VBY A;  3A8K A;  2M7S A;  4K59 A;  4MK7 A;  2A0F B;  1N88 A;  1KRP A;  2YY3 A;  1QUP A;  4CH7 A;  3ITH A;  2QLJ B;  4DR3 J;  1FRJ A;  2EI5 A;  3T9N A;  1HWU A;  2RHS B;  5AXM A;  1SQE A;  4C7Q A;  3Q8R B;  1CUL B;  1H6K X;  4AL7 A;  2IAJ B;  2QIF A;  3PRV A;  1EQM A;  4DCP B;  3A8I A;  2ZC3 A;  1B0P A;  2JNJ A;  2V69 A;  1F0X A;  2OKQ A;  4DU7 A;  1HR0 J;  4F67 A;  1S4F A;  4YEA A;  4KV8 B;  3VF0 B;  1NJZ A;  4RPF A;  5DQG A;  2PT0 A;  4ED8 A;  2BUN A;  4QCL A;  3GMG A;  5B0F A;  3NGK A;  5HQ8 A;  2V2Z A;  1Q82 T;  1IKX A;  2LQ9 A;  1JMT A;  1DTT B;  2MTL A;  4LR7 A;  4X4T A;  4WP8 A;  3CUL A;  2YQ1 A;  2DTJ A;  4CLY A;  2RIJ A;  2ZH1 A;  3M9O B;  1VGY A;  4P73 A;  3SDE A;  3KWM A;  3LP1 B;  1Y5N B;  3Q8V A;  1T02 A;  3QLH B;  4AXI A;  4JI3 J;  1YRT A;  1XMB A;  2E9T A;  2YX4 A;  1HIY A;  3H2U B;  3J7A 1;  1LW2 B;  1KQG B;  3HFK A;  3GIL A;  2RDJ A;  5GAE U;  3R5A A;  1EKR A;  4DV1 J;  2EW9 A;  2V4R A;  4ENO A;  4A8Y A;  4XIU A;  4NYO A;  4ED2 A;  4AFF A;  3QJP A;  3C46 A;  4OZ5 A;  2R8G A;  2HBQ B;  2QC3 A;  1J5O A;  1FE4 A;  2K2P A;  5CAB A;  5J2N A;  4P2X A;  3I87 A;  2MPU A;  4YN3 B;  2MQO A;  5F3Z A;  2QYC A;  4USM A;  1TL3 A;  4O3N A;  2QJ3 A;  3MEG B;  2Z30 B;  2RRN A;  3Q24 A;  3DMJ A;  4R0J A;  2CWK A;  3FGV A;  1I6J A;  1E6Y A;  3CD0 A;  1FD8 A;  2DRD A;  1W25 A;  3I0S B;  5I4M A;  2HVH A;  1D9F A;  4QIV A;  1U1R A;  2PII A;  5LMU J;  3J80 U;  2DIU A;  1NLK L;  3LAK A;  1FEH A;  2OPP A;  1C4C A;  3D1O A;  3MHY A;  2H54 B;  1YK9 A;  2IJF A;  3MM9 B;  1TUV A;  4TYB A;  4F0K A;  4F2R A;  4OHZ A;  4CH1 A;  2OUG A;  3GV5 B;  1PCA A;  3VGV A;  2J0S D;  3HHK A;  1HI8 A;  2W24 A;  5D0E A;  2A2C A;  1RT1 A;  1YI2 S;  4Z37 A;  4RX6 A;  3IS9 A;  4H4O A;  1S1W A;  2D69 A;  5LJ5 Y;  1N48 A;  1MMN A;  2EKN A;  2BYC A;  2PGC A;  3TAR A;  3HHL A;  1YRU A;  4ZHR B;  3KLG A;  4HEA 9;  2AHO B;  5HAT A;  2UXD J;  4HVZ A;  3NMR A;  1U8W A;  1Q16 B;  2YWF A;  1UKU A;  3BSC A;  2JL9 A;  2GIQ A;  3C6T A;  4LBH A;  2YBV A;  3IP0 A;  2N3O A;  3R7S B;  2JJ4 D;  2XMA A;  3HVT A;  3AD9 C;  1L3S A;  1ZS6 A;  4DQP A;  5D3G B;  4FBU A;  3UFC X;  1B4S A;  1GMW D;  3FCH A;  2D3O R;  5BJR A;  2HFV A;  2M5Y A;  5DS7 A;  2DO4 A;  3OBI A;  3RAX A;  4B3R F;  2B7B B;  3RRG A;  2VOD A;  4DPW A;  4FN5 A;  2CQD A;  4HTJ A;  1OSD A;  2JRS A;  3ILL A;  3BDP A;  4RW6 B;  4BC7 A;  6FD1 A;  5K8N A;  4MIA A;  5KFT A;  1K1Q A;  3V6J A;  4X4V A;  3M8Z A;  2ABY A;  3MWB A;  2N82 B;  1LK5 A;  3KK3 B;  3V6K A;  2MZT A;  4JI5 F;  3WQP A;  4TXS A;  3BBF A;  4CO5 A;  4IFV A;  3C66 A;  4KT0 C;  3HCX A;  5A8K B;  4OZL A;  3AAW B;  4FXD A;  4J90 A;  3MMA A;  2CIM A;  3CGI A;  1FXR A;  2FTR A;  3KLF A;  3KG1 A;  5F0U A;  4F02 A;  2ZHB A;  2FDN A;  1H2V Z;  3GZ7 A;  3AOC A;  4ECZ A;  1WF0 A;  1T3N A;  3H5X A;  3HLU A;  2YWE A;  5IM0 A;  1RKJ A;  1FF2 A;  2YH1 A;  2MY8 A;  1S6P A;  4NZ6 A;  1KOH A;  3FRZ A;  1NK7 A;  1H2T Z;  1Q4R A;  4Y00 A;  5K14 A;  2CQG A;  4NRT A;  3UVJ B;  1C1C A;  2D7S A;  4TKT A;  2GJF A;  3I0R B;  1NJI T;  3ZZR A;  1JB0 C;  4DUY F;  1N36 J;  2X3G A;  1LWE B;  2FY1 A;  4G1I A;  2WOM B;  4B17 A;  2KJW A;  3GG0 A;  2CDQ A;  1H2U X;  2HK3 A;  1SJR A;  5IV4 A;  3GCX P;  2UVV A;  4P6Q A;  1FVS A;  3P49 B;  1U09 A;  3BGF A;  4TY9 A;  1QSY A;  3V4I B;  2E7X A;  3PR5 B;  3DLE B;  4PAA A;  3CW2 C;  3IC1 A;  5KFJ A;  3FMB A;  2DJW A;  4F3O A;  3RRK A;  2GML A;  3M05 A;  1X4H A;  4NLO A;  2ZH9 A;  5K8P A;  3W8P A;  4N77 A;  3OW2 R;  5ETS A;  3H5S A;  3D7S B;  5HRO B;  3AOB A;  4JB8 B;  2RH3 A;  2F65 A;  2DNR A;  3AOD A;  3PZP A;  1T03 A;  3HFZ B;  1K0V A;  1ZPW X;  2J6T A;  4QWE A;  2N7Y A;  5KFD A;  2OI2 A;  2VB6 A;  4PG5 A;  2K8G A;  3OV7 A;  3W2V A;  4F0M A;  3UD5 A;  1K47 A;  3NWR A;  2DCU B;  5HSP A;  4Z2X A;  4OJH A;  1SKU B;  2HGM A;  3OD2 A;  3ZTP A;  1S5Z A;  2DNQ A;  4PR6 A;  3VWS A;  2KB2 A;  3IGV A;  3W2W B;  4S0M A;  1HWK A;  5FD1 A;  3S01 A;  2D3U A;  4H4M B;  3CB4 A;  3TYT A;  4FS2 A;  2V0N A;  1HBM B;  3I31 A;  1RAE B;  1RWP B;  1KN6 A;  5DJB A;  1YTY A;  6AT1 B;  4OI6 A;  3CMQ A;  1P6T A;  3PX0 A;  4TU7 A;  4LVO P;  1G2E A;  5K9F A;  2B4U A;  5A8R A;  2H9Z A;  4B3R J;  1UFL A;  5HVF A;  1GEH A;  4RJV A;  3FFI B;  3RB4 A;  4DFK A;  4C3K A;  1SC3 B;  3LQV A;  2OEJ A;  4A8X A;  4LF8 F;  5KOX A;  4OZN A;  2AJ4 A;  1RWV B;  2LEP A;  1VHF A;  1FNO A;  1RU1 A;  4DSF A;  3MPW A;  1Y5L B;  2ZHO A;  2GQ2 A;  4ZIW A;  4PQA A;  4IH6 A;  3POT B;  1QSL A;  4JI5 J;  1Z4U A;  3MAQ A;  1WEZ A;  2E5H A;  3QRR A;  4RKU C;  4YUD A;  2U1A A;  3FCV A;  4YHH F;  3FSX A;  5KG1 A;  1WUU A;  4DN0 A;  2IMW P;  2XG8 A;  4DL0 C;  5C25 B;  2N3L A;  2J8S A;  3M8W A;  3LWM A;  1RAA B;  4DZD A;  2UUW A;  4ETZ A;  4NXM F;  3NCQ A;  2DNK A;  1BQN A;  1KS2 A;  2DD8 S;  1WKK A;  3QRQ A;  2LEA A;  4LIW A;  2ZKU A;  1ROF A;  5AXL A;  3AH6 A;  1KNZ A;  2XNR A;  2L41 A;  5KFO A;  1FXD A;  3BGL A;  3MM6 A;  3WHI A;  2I6W A;  1YBA A;  3DOK A;  2VG6 A;  3H98 A;  4ID8 A;  1S6U A;  3UPF A;  3HXM A;  4DUY J;  3KHH A;  2JEG A;  3RAM A;  4OV6 A;  5B0B A;  3M8R A;  1M1K T;  2WBM A;  1ULR A;  1RHK B;  3BN4 A;  2Y0S D;  2AJQ A;  1CEZ A;  2BJD A;  1H0H B;  1R43 A;  4DX7 A;  2JEJ A;  1XBW A;  4YY3 F;  1HWI A;  2BJ8 A;  2XO6 A;  2QL9 B;  4DS4 A;  1X0P A;  4X65 F;  3TO8 A;  4ZVF A;  2VG5 A;  5G0R B;  1JXL A;  2UUC J;  4OI2 A;  2CZ9 A;  1N33 F;  1GMW A;  3K0J A;  1WOO A;  2CJQ A;  4BLG A;  1RAG B;  2RAQ A;  3GLJ A;  1FKP A;  5LJ3 Y;  2M8D B;  4R8U B;  2GVD B;  2FLO A;  3MMJ A;  2DH9 A;  4F4X A;  2DNP A;  4MIB A;  2C22 A;  5IC4 B;  2L3M A;  4OYB A;  1L3K A;  3GYX B;  2QN6 B;  2DO0 A;  2RQM A;  2BAN A;  2DGW A;  1RQ0 A;  1RA6 A;  2GZO A;  1V3R A;  1MMD A;  1RAO A;  3LP0 B;  1SKW A;  2DEJ A;  4TLR A;  5L8R C;  3J81 j;  3UE2 A;  2V8P A;  3PY8 A;  5I3P A;  2KFN A;  2NSB A;  2LEB A;  3CC4 S;  4BC9 A;  3K5P A;  2BE2 A;  1WHY A;  2BW7 A;  1WAC A;  3R27 A;  3MR6 A;  1H98 A;  5M2R A;  1FK9 A;  4ELU A;  3U02 A;  4K4U A;  4USJ C;  4OI0 A;  5B0G A;  3AOA A;  1CJU B;  4ZVR B;  4IFY B;  2W1B A;  3IWL A;  2HND A;  2R7U A;  2CPE A;  1CS4 A;  2C3O A;  5EDW A;  2YWH A;  3KJF B;  4OHW A;  3DI6 B;  1IUJ A;  2CPJ A;  4E0D A;  2HQF A;  2Z2L A;  1SC4 B;  1RAD B;  3V2U C;  5F8I A;  1YVF A;  2IC3 B;  2DGV A;  2HYI B;  1SVD A;  1VC6 A;  1L5U A;  4KR0 B;  4WP9 A;  1Q86 T;  4WFN Q;  3W5X A;  4ZPD A;  5HQM A;  4YHH J;  1YIT S;  2CJK A;  1TUG B;  1CC7 A;  2COL A;  4CP5 A;  1KVJ A;  1TL4 A;  5KG7 A;  5HBM B;  1LEO A;  3DNC A;  3ZZT A;  1DHM A;  3AXM A;  4I7F B;  1RWK B;  4NXM J;  2HGN A;  5ETP A;  3O3L A;  4RNO A;  3J7Z T;  3OT9 A;  2Y1I A;  1JLC A;  1XWL A;  1GNK A;  2ADC A;  3JQM A;  5C5J A;  1WF1 A;  2I9S A;  2B7C B;  2A6O A;  2KH9 A;  5CYJ A;  1RCO B;  2H48 B;  4N8N A;  3H90 A;  3CT9 A;  3NAH A;  2MQL A;  2DXE A;  3MEC A;  3KDN A;  2AF6 A;  2PD1 A;  2DXD A;  1DLO B;  3FQK A;  4QWC A;  1F60 B;  2ZH7 A;  4J9L A;  1UVL A;  3S7R A;  2ZJR Q;  3CCW A;  2VPZ B;  1Q95 G;  5A8W A;  3NGU A;  3LAM A;  4JI1 F;  5KT4 A;  5H9E K;  1J27 A;  1R8C A;  2ZE2 B;  5KFI A;  4LF4 F;  4DFP A;  4L3K A;  2W2Q P;  2X3D A;  3FZ2 A;  4F50 A;  4XK8 C;  3UDE A;  4X65 J;  4EMD A;  1VI7 A;  3GB0 A;  3DDN A;  4WJB A;  1K44 A;  1N33 J;  2AIR B;  1TKZ B;  3NNA A;  1VRT B;  3J81 U;  2WVD A;  3IN5 A;  2M52 A;  2MZS A;  4RW4 B;  3M9M B;  3NG8 A;  2C2E A;  4DPX A;  2NXN A;  5LL6 d;  5HP1 B;  4OV1 A;  2ZNZ A;  4OX8 A;  1LV5 A;  4HDH A;  1SB6 A;  3F73 A;  3TNV A;  3IWN C;  2ZWP A;  2CQ4 A;  3A1Y G;  1UZH A;  1OMS A;  3EIC A;  2VG7 B;  2XHC A;  2CVI A;  2CJA A;  3FEZ A;  1SC1 B;  4XAK A;  2XYP B;  1IKV A;  5DO2 A;  2BRK A;  3SQG A;  1JLE B;  5G4D A;  1EP4 B;  1JLF B;  2XO7 A;  2KRB A;  2DNM A;  3MUR P;  3CCS S;  2HQ3 A;  4Q0B B;  3OR2 B;  2V5H G;  4CLS A;  4UST A;  3NCP A;  4C8L A;  2J9D E;  1M1H A;  4EYH B;  3L7O A;  4WWS A;  1IKY A;  4ER8 A;  1KDN A;  2E44 A;  1VQK S;  4ECT A;  3PYD A;  2RE1 A;  3MOZ A;  4DL7 A;  1L3T A;  3THP A;  3MR7 A;  4J9O A;  4ECR A;  3T41 A;  1GT8 A;  1VQN S;  4QZV B;  4ED5 A;  3LH2 S;  1Q8K A;  3M6X A;  4LR8 A;  4A8S A;  3MI7 X;  4C8M A;  4AND A;  4MTP A;  1S10 A;  3MM7 A;  4MMO A;  4LR9 A;  1QJH A;  2OH2 A;  1RTD B;  3IBF B;  1U1Q A;  2LQB A;  4KGV B;  5IT4 A;  2E7V A;  4ZP7 A;  2WSC C;  1U6Z A;  2NCK L;  2FJA B;  2VC1 A;  2HS0 A;  5CQG A;  3K5O A;  3OSP A;  1SJQ A;  2BVZ A;  3BR8 A;  4P10 A;  3NS6 A;  4B9L A;  3JSR A;  2C2O B;  3BGR A;  1FVQ A;  2CDR B;  4GMK A;  2OD6 A;  2I2Y A;  1UTA A;  3GU0 A;  1DRZ A;  4TQR A;  4QWB A;  5HK4 A;  3G8Q A;  1R8H A;  4ALZ A;  3W66 A;  2ZBQ A;  5B0D A;  1UZD A;  2EFV A;  3P5B P;  1T9Y A;  3DOM A;  4Q2L A;  4OJG A;  3KLI B;  3OR1 A;  2IDL A;  1FI4 A;  3BZQ A;  3WIU A;  4M5H A;  5D4N A;  3U1L A;  2UXB J;  3MM8 A;  2RUG A;  4F04 B;  4M95 A;  1IKX B;  1HL6 A;  3CJT A;  4KYZ A;  3HT3 A;  4KHM A;  1D1U A;  3TA0 A;  1HBO A;  1YRX A;  2XTJ P;  1HW9 A;  4JI1 J;  4KFB A;  1VJQ A;  2KN4 A;  3BSA A;  3ZTO A;  2VAS A;  3PYE A;  1D0E A;  3OLA A;  2MDA A;  2V2V A;  4I2Q A;  2IJN A;  1RTZ A;  2HBR B;  5DQH A;  1DAR A;  4DMZ A;  1Y7P A;  3ONQ A;  1RA7 A;  2O01 C;  3K5M A;  4F4Y A;  3H4B A;  1OY9 A;  1X4B A;  3J7Y I;  2V9K A;  3GTY X;  3M2U A;  3NS5 A;  1J5O B;  2P9G A;  1TV6 A;  5KFZ A;  1U24 A;  4GC6 A;  5J2N B;  1RTI A;  3N6L A;  2MZQ A;  3JQJ A;  2AGQ A;  1RK8 A;  5SUH A;  4LVN P;  2KRR A;  2W2P P;  3G87 A;  3QZ7 A;  2ZEJ A;  1FTC A;  4LUB A;  3PRD A;  1L3V A;  2Z2Z A;  3QYY A;  4A46 A;  2LMI A;  5ETN A;  3DMJ B;  1T95 A;  8AT1 B;  1E6Y B;  4F7V A;  3G2X A;  4KSE B;  3HK2 A;  4J9M A;  2V6A A;  3W62 A;  5EWG A;  3MPU B;  1M5P C;  3EE3 A;  2OPP B;  4ZDN A;  1XR5 A;  4JI2 F;  4G1P A;  2VPX B;  4MK8 A;  1KEK A;  1JXV A;  1D8Y A;  1KBR A;  3CIZ A;  1ZM2 A;  4I64 A;  1KTV A;  2HKE A;  3PKM A;  5L38 A;  4WTO B;  3J80 Y;  3DRR A;  2LA4 A;  4ANC A;  5C2G A;  4H4O B;  1S1W B;  4B3O A;  3AB2 B;  5A2Q U;  3W3S A;  2R8K A;  2E1A A;  3PV8 A;  1OQ6 A;  3D28 A;  3N01 A;  1O0P A;  3HHL B;  2AP6 A;  1K1S A;  3KLG B;  2Q3P A;  4K50 A;  2C28 A;  2W9C A;  4WYW A;  2E1C A;  4IOA Q;  3ZXW A;  1GMV A;  4QIF A;  2I38 A;  4FVC A;  1BHN A;  2C3P A;  2WBR A;  4P72 A;  1FJ7 A;  3ZTQ A;  1VK3 A;  4O0N A;  4ELT A;  1X9M A;  3V81 A;  2AGP A;  2CAJ A;  2FVR A;  4WYL A;  5JVG Q;  2UUA J;  1NND A;  1VS3 A;  1G7C B;  4DEZ A;  3ZTS A;  3M8Q A;  2WVB A;  3BBC A;  2H5I B;  4JV1 A;  2C2M B;  3HVT B;  1VQP S;  2ZH8 A;  5EUH A;  1JJC B;  4MKY A;  4DV4 J;  1FJC A;  1ELO A;  3HJV A;  4X4S A;  3WIV A;  2KO1 A;  3HVW A;  4PZV A;  3NY0 A;  2PMH A;  4MKB A;  2KU7 A;  3GIK A;  3C8Y A;  3TVK A;  2ZOF A;  1BWV A;  2DRB A;  4DFJ A;  3CVK A;  5T41 A;  2QZ8 A;  3DFE A;  1MWY A;  4F4W A;  1X4D A;  3UN2 A;  3GJT B;  4X84 A;  2C3U A;  5LSO A;  3Q8Q B;  4OZ3 A;  1DJ0 A;  4ECS A;  3C2P A;  3C14 A;  4NI2 A;  1SJ1 A;  3W9I A;  2ZBR A;  3GON A;  3PDN A;  4IFV B;  1HI0 P;  4Q7A A;  3MCM A;  1R8B A;  3LTO A;  2RT3 A;  3WZ0 A;  3O6Q A;  2GW8 A;  2HRY A;  3R6L B;  5KT2 A;  3MMA B;  3UCU P;  2KDO A;  2YNG A;  5HMZ A;  3KLF B;  4LFA F;  2HHP A;  5E41 A;  2OML A;  4RBV A;  2FQQ B;  2EXU A;  1FEE A;  2FVP A;  1M5H A;  3W60 A;  1YJT A;  5L9N A;  2RQ4 A;  3AA8 A;  2JH3 A;  1U0H A;  1ZM9 A;  2CQ1 A;  2NXJ A;  3CJS A;  5E7O B;  5IM0 B;  2F8M A;  2ZJP Q;  1FDD A;  4PXB A;  3SCJ E;  5C2C A;  2MLX A;  1S6P B;  1OPI A;  3VTI A;  5KG4 A;  1HKA A;  1RCX B;  4USW A;  3M8S A;  5BYS A;  2CJY B;  1C1C B;  4C2M A;  1FES A;  3KJQ B;  1WG5 A;  4C9D A;  1IQT A;  3W8G A;  4DV6 F;  1VQM S;  1EX8 A;  1F3F A;  1KFS A;  3D9B A;  1VK8 A;  4DR7 F;  2JSX A;  4L3N A;  4J5O A;  2QMU B;  2FVQ A;  1B99 A;  4IQM A;  1UVM A;  1QUV A;  2ALY B;  3H5U A;  4B9U A;  2DH8 A;  3VVT A;  3BGU A;  3CCL S;  1KKH A;  2VFU A;  4WII A;  4PYD A;  2G13 A;  1SJF A;  2YPZ A;  1HNV A;  2GAH C;  2HEK A;  1URR A;  5IOL A;  2O66 A;  3CCM S;  3KYL A;  1NK4 A;  4IKA A;  2KHD A;  4YP3 A;  5J2P A;  1LFP A;  3OTB A;  3R1H A;  4JI2 J;  4LRD A;  1K0T A;  2BBE A;  4C8K A;  2C2Z B;  4HT5 A;  2HUR A;  4Q2M A;  2MST A;  1RHU B;  3RJM B;  1T03 B;  1X4C A;  1KVK A;  1N5Y B;  3QWP A;  4DL6 A;  4GVB A;  3HSG A;  3QSI A;  3Q83 A;  3Q23 A;  1RLD A;  3W2V B;  2DPI A;  5J1E A;  3VGT A;  4GRS A;  1CG2 A;  4PG4 A;  2LP4 A;  2GA7 A;  1RWX B;  1U25 A;  4P74 A;  5FII A;  2ZZT A;  4K2J A;  3K2Y A;  4DV5 F;  1T9T A;  3CCZ A;  1PJ5 A;  4ED0 A;  4PRF A;  1FRH A;  3QO9 A;  1GXL A;  1Q8I A;  5I3Q A;  3MEE A;  1Y3J A;  3W1Y C;  5DRK A;  1A6L A;  1FRX A;  4HKQ A;  2P9E A;  3T5L A;  1K9M T;  3T6J A;  1KQS R;  4M5I A;  5FJ4 A;  3OJS A;  2V8V A;  2GO8 A;  1SI9 A;  3G71 S;  5A8R B;  1NDK A;  2UP1 A;  1UVJ A;  3W63 A;  2A18 A;  4TLQ A;  2EFP A;  2JEI A;  5IQQ A;  3R5B A;  5AJ3 F;  2XMK A;  2VUG A;  1JJ4 A;  2D74 B;  2LLZ A;  1T05 A;  4F4K A;  1NXI A;  5IS2 A;  3E8O A;  1RTH A;  1KFD A;  2HHQ A;  1URN A;  2AD9 A;  5THW A;  1V3S A;  4ZJL A;  1OY8 A;  2BX6 A;  4FKY A;  4QW9 A;  4C8Y A;  2FPH X;  2Q1L A;  4FYY B;  2I5J A;  2F9D A;  4R25 A;  4YFU A;  4I2P A;  2XZD B;  2CQP A;  4RW9 A;  4LFA J;  1U2C A;  2DGX A;  1FT8 A;  1UWA A;  2BJE A;  2VFT A;  1YSJ A;  3GV7 B;  2L48 A;  1QSS A;  2VKZ G;  4PCQ A;  1SV5 A;  4PUO A;  4KC5 A;  2PI5 A;  3BJY A;  4BWJ A;  1BQN B;  1I3O B;  1WOS A;  2OO4 A;  4C8Z A;  1FCA A;  3R5C A;  3KUG A;  2HFU A;  1RT3 A;  2FLN A;  1NJW A;  5F9N A;  1N6Q A;  3MM6 B;  4Q5V A;  2QL7 B;  4RW8 A;  1JLA A;  3C19 A;  1RT4 A;  1YZ6 A;  2LYV A;  2ZOG A;  3DOK B;  3FSY A;  3NCR A;  4QU7 A;  4EO6 A;  4OLP A;  3Q2S C;  5L39 A;  4NCG A;  4OZJ A;  4DV6 J;  3NGT A;  4GKJ F;  1TL7 A;  1JQG A;  1WDD A;  2V8D A;  4XPC A;  2ZUG A;  2BE9 B;  3NGS A;  1RI7 A;  1Z1Z A;  3KLV A;  3NNC A;  5DDR C;  2K06 A;  1I5O B;  5LSR A;  1Q79 A;  2WHO A;  1WTF A;  5LMN F;  2RKI A;  1QVF R;  1QE1 A;  2KL8 A;  4JV2 A;  1IR0 A;  4F26 A;  2LQJ A;  5KFA A;  2VG5 B;  1R27 B;  3UD3 P;  5D15 A;  2NLW A;  3QNW B;  2KJV A;  4RZR A;  2IFX A;  3WC0 A;  5H1S V;  1T94 A;  3IBW A;  4WIQ A;  1NM2 A;  1FKP B;  1FFW B;  2E1R A;  1S6O A;  4ECQ A;  1NDP A;  4TNO A;  3FRY A;  4K2X A;  4WP3 A;  2QMX A;  3LW5 C;  4NYZ A;  4ANE A;  4RNM A;  2OJ3 A;  2OHD A;  1NB7 A;  4WZQ A;  2XSJ A;  2BAN B;  4ED1 A;  1FJE B;  3OTO F;  1B0V A;  3GYG A;  3RBX A;  5FLX U;  2HLU A;  4DQS A;  3OVB A;  1GX6 A;  1WTB A;  4DV0 F;  4HI1 A;  5E5N A;  4A8O A;  4NCA A;  3W9H A;  4NLP A;  1VBZ A;  2F4V F;  2BE2 B;  4DV5 J;  5EHH A;  3DGP A;  1WD6 A;  1WG4 A;  3E01 A;  4YQW A;  3O5T B;  2FUG 9;  1P9Q C;  2HND B;  2PE8 A;  4ZPA A;  3KG4 A;  3PO5 A;  3RBD A;  1CS4 B;  4WXW A;  2OTJ S;  3JSY A;  2WON B;  3G82 A;  1QAY A;  3AA9 A;  2ZHA A;  4DQQ A;  2AT1 B;  2MZ1 A;  4C0B A;  5KOW A;  3FBC A;  1TZ0 A;  2YKQ A;  4O3P A;  1ZPV A;  4NEY A;  3UDC A;  2IY5 B;  3RGI A;  2QMW A;  1NJY A;  3UW1 A;  3A4T A;  2MGZ A;  4KGZ B;  4J9R A;  1R0B G;  3CIM A;  3P4U B;  1JJH A;  1X9W A;  5AJ3 J;  5KG3 A;  1U2F A;  4HYK A;  4O23 A;  4DFM A;  1FHT A;  1F1B B;  1HAR A;  3SSR A;  5E3A A;  3G4S S;  1BY9 A;  3DDK A;  1QM9 A;  3SSS A;  3MPD A;  1F2H A;  5HO4 A;  3G6E S;  1RHM B;  4EYI B;  1NPK A;  1VRU A;  1U1N A;  1HQ2 A;  2MKJ A;  3CWJ A;  1N34 F;  4ILM A;  2DHS A;  1S1U A;  4KO0 A;  1N0V C;  1Y00 A;  4P52 A;  4PQU B;  2Q66 A;  4J9K A;  3EGZ A;  1XEZ A;  2XMW A;  2H3E B;  3Q22 A;  2XY5 A;  3MEK A;  3QJL A;  1MW7 A;  1CQN A;  3K57 A;  3MEC B;  3CJQ A;  1VDH A;  4QPX A;  3KHL A;  3R2C J;  4J37 A;  2HZA A;  2QE5 A;  2PSZ A;  4GKJ J;  1S99 A;  3B4D A;  2ILZ A;  3QFH A;  1S49 A;  2HVE A;  1KLN A;  1HBU A;  2DVI A;  2QT7 A;  3P8B B;  4J9N A;  3T5J A;  3OL9 A;  5LMN J;  4TQS A;  5MAO A;  4ZCM A;  5KFE A;  3CF5 Q;  3N5F A;  3RYL A;  1GXU A;  4FF4 A;  2Y3Y A;  3ISZ A;  4RNN A;  1VIO A;  2VDI A;  3PFO A;  1S4E A;  3W7B A;  2WCX A;  2Z4P A;  2ASL A;  4K4Z A;  4X4R A;  2LXF A;  2JZ5 A;  1SXL A;  1R6Y A;  3Q8U A;  3DLG A;  1I1G A;  3Q8P B;  1AZS A;  1NAQ A;  1NHV A;  3BDE A;  3CE8 A;  4L73 A;  3D66 A;  3DU5 A;  4CYU A;  3RZA A;  1TR0 A;  1U6B A;  1F9F A;  1HPZ A;  3IG1 A;  4ZVS B;  1S97 A;  2HQG A;  3J81 Y;  2ZBP A;  4RU9 A;  5I3U A;  3DXB A;  1T7P A;  2E1P A;  3MF5 A;  1Q8B A;  2V8G A;  4DV0 J;  1S59 A;  3UNG C;  4JV5 J;  3SQG B;  1FER A;  5D4L A;  2F4V J;  4F0H A;  2VQF F;  2BZ2 A;  3ZZZ A;  2V68 A;  5IWA J;  2ZH2 A;  4ES2 A;  3B78 A;  4RUH A;  4LF1 A;  4IOC Q;  4RR5 A;  3T5H A;  3D6T B;  2EC2 A;  3OXL A;  2OD4 A;  3X3U A;  1TUW A;  3MCS A;  1FJG F;  4NCB A;  3WX4 A;  1IKY B;  3TEH B;  2Q79 A;  2CRL A;  3VAF A;  4DQI A;  3HDS A;  1EET A;  3BEG B;  1Q78 A;  5J2M A;  2E29 A;  1BE4 A;  1RT5 B;  1WKJ A;  4U7U K;  4CT8 A;  1YG0 A;  3NRB A;  3TQE A;  1NBE B;  3FJ2 A;  2CPF A;  3RW7 A;  1D8Z A;  4OL8 A;  3MFH A;  2BMB A;  2WSF C;  3EDQ B;  2B5J A;  1GH8 A;  3MM7 B;  3Q8Y A;  2CAD A;  4C8N A;  3THT A;  1TL1 A;  1LWF A;  2G9O A;  2OP5 A;  1SUQ A;  5HN0 A;  4HHU A;  2H5J B;  3KXD A;  2R7Q A;  2AW0 A;  3KHG A;  4CNZ A;  2RDD A;  4DDF A;  2L08 A;  4YR0 A;  4OX9 F;  1KLM A;  1VCT A;  3ZTR A;  2R7R A;  1RUS A;  3DDI A;  2KXF A;  4R5P A;  1H7X A;  3BGR B;  1X4E A;  4NA2 A;  2YNI A;  4E8U A;  2ZVS A;  2VON A;  2XSF A;  1HW8 A;  2JHE A;  5GAG I;  5I42 A;  4IH7 A;  5EX3 A;  4J7C A;  1HA1 A;  4U9R A;  5JXS A;  4YR3 A;  2H4Y B;  2VPW B;  3GII A;  1AFJ A;  2AJ2 A;  1X4A A;  4LSN A;  2R8J A;  4CWB A;  3DOM B;  4YDD B;  3HD2 A;  2P8I A;  4EBD A;  2ZZN A;  2ADB A;  3OR1 B;  2XUL A;  3FZB A;  1IM4 A;  2ZUA A;  4JI4 J;  2F7V A;  2OSQ A;  3US5 A;  2BE7 D;  3DRS A;  5ETQ A;  3MM8 B;  3OQ2 A;  3U1N A;  3PG9 A;  1MG7 A;  2ZNY A;  2YKM A;  2Z8Q A;  1Y0H A;  1HBO B;  2QTW A;  4RW7 A;  2X1B A;  3NBP B;  2GQC A;  1DAX A;  2FJW A;  2OMO A;  4LBP A;  1BQX A;  5E3P A;  1NHK L;  1FRL A;  4IOB A;  4X4P A;  4K4S A;  5EN1 A;  2W8K A;  2Q43 A;  3R2D J;  3UWT A;  3KNA A;  2R2T A;  2AJ1 A;  1V5V A;  1HR0 F;  3LO3 A;  4UUX A;  2CPX A;  4A4J A;  1YHQ S;  3FSI A;  2H1Y A;  2KHC A;  2IBK A;  1RHQ B;  3G6Y A;  3CD5 A;  3O2I A;  4DZ6 A;  3M2U B;  4WTY A;  1NB2 A;  1TV6 B;  1RTI B;  2E5G A;  2OSR A;  2EFO A;  5HAO A;  3GWC A;  2P6S A;  1CVJ A;  4URS A;  1VC0 A;  1S77 D;  5K8M A;  1GFW B;  4IRK A;  3PAC A;  8ATC B;  3LGN A;  3PM9 A;  2AEF A;  1HQE A;  2VV5 A;  4DU8 A;  3JAM U;  4NWB A;  3MMC A;  3SFU A;  2V4Q A;  4KB7 A;  1S72 S;  4OMF G;  1SPB P;  2HFZ A;  2VQF J;  4OZ0 A;  3MZI A;  3D2W A;  4FYD A;  2IYI A;  2F4F A;  2YKP A;  4FDF A;  5F8H A;  5A0Y A;  2CYY A;  4TY8 A;  3PJ9 A;  2IVM A;  2PMW A;  4USI A;  3EX7 B;  1FWK A;  3H7H B;  3MM5 B;  3AHP A;  4ZIT A;  2DNY A;  3DRR B;  1WWH A;  5H9F K;  2HFO A;  1AXQ A;  2V63 A;  1H73 A;  3PW2 A;  3V5R A;  4B3O B;  1JIH A;  2N4C A;  3VAK A;  3TUZ C;  1ARO P;  3VR1 A;  3CJK B;  1M5O C;  2P6T A;  2W9C B;  4AD6 A;  4C4W A;  4MYT A;  3HD1 A;  1C1B A;  3BS9 A;  1CUL A;  1KQF B;  2IAJ A;  3KKF A;  2AYG A;  4K4V A;  4AL5 A;  5E2Q A;  4UOG A;  4JI7 J;  4P71 A;  1KWM A;  3X1L B;  1GX5 A;  2DEI A;  1DZ5 A;  1KON A;  3V81 B;  3NGD A;  7FDR A;  2GVZ B;  4L74 A;  1S7H A;  3JSM B;  3M8Q B;  4DCJ B;  1C0T A;  2HK2 A;  5DDQ C;  2B51 A;  3C15 B;  4M5M A;  2RUS A;  4OYA A;  4P7T A;  2RML A;  3D3B J;  3PW7 A;  1RBL A;  3EM1 A;  1T9U A;  1U8S A;  4OYX A;  1YKW A;  2EK1 A;  2OFG X;  7FD1 A;  1DTT A;  1WC1 A;  3VAM A;  5J1P A;  4FPI A;  4X4U A;  1LNQ A;  1RAH B;  2LU2 A;  4UY8 5;  2UXD F;  1AYE A;  2JX2 A;  2ZM6 F;  4I4B A;  3V6H A;  4M63 A;  3G9C A;  2GHW A;  5KFK A;  3K5N A;  2MKC A;  2RHQ B;  3GV8 B;  1NUE A;  2VOO A;  2A10 A;  3DHW C;  1R8A A;  2GMH A;  2R7V A;  2Z56 B;  3B82 A;  1I51 B;  1QAI A;  3T1Y F;  3CJR A;  3KLH B;  3R7B B;  3QAE A;  4C0O C;  4ECU A;  3CPW R;  2YNG B;  4ZVG A;  4NE9 C;  1NZA A;  1ZM4 A;  5LOQ A;  4X4N A;  4FKX A;  4DR1 F;  4J9V A;  2OPS A;  4A8F A;  2YPY A;  3AFG A;  3CDE A;  1BWE A;  4DPY A;  4DSI A;  5D4O A;  4WFA Q;  1KHV A;  2VJU A;  3IA0 A;  4ZLN A;  1ZZF A;  1XMO J;  3H2V E;  3WX8 A;  2A6M A;  4OX7 A;  3DXS X;  2MB0 B;  3FK4 A;  2IVF B;  4O0I A;  4LRB A;  3W9J A;  2J5A A;  3V6D A;  1U1L A;  2PEB A;  4X62 F;  3DYA A;  4DL3 A;  3I0S A;  2MHN A;  1VQ6 S;  3UD4 P;  3ZNU A;  3Q2T C;  3Q86 A;  4PXD A;  3OPK A;  4DF4 A;  3KUE A;  1SIZ A;  2VFV A;  2F8H A;  4USK A;  4C11 A;  1JLQ A;  1NK6 A;  4K5S A;  1OIA A;  2UVR A;  2FVS A;  1U48 A;  3SFG A;  2FVC A;  1HNV B;  2YWK A;  3R5D A;  4LSL A;  4WK1 A;  4ECW A;  4OJ3 A;  4NML A;  2HNZ A;  4WKY A;  5J2P B;  4ZHR A;  4PPD A;  2CZ4 A;  2L9W A;  3TJA A;  1LKZ A;  3SZ2 A;  2CQ2 A;  1N5V A;  4N56 A;  4UY8 T;  1T0T V;  4KKO A;  1N36 F;  3M7V A;  4G65 A;  1VIX A;  3GG1 A;  4H4K A;  3C6U A;  3TUI C;  1JNR B;  4X64 F;  4GVB B;  5KFP A;  5J1E B;  2V67 A;  1ZZN A;  1KVI A;  4KH0 B;  4DR4 F;  3GR1 A;  2GHP A;  1HHS A;  2F9J A;  3RTV A;  4HH0 A;  2LKZ A;  2G0J A;  2JFK A;  2G2O A;  2ZDP A;  3AXK A;  1B70 B;  5F8L A;  5HMY A;  2CPD A;  1J5E F;  4O4G A;  4QU6 A;  5D0H A;  2XLK A;  1R0C B;  2OGU A;  3QO9 B;  3GSI A;  3NLC A;  3TAM A;  4UZC A;  2XGP A;  2PN6 A;  2OFH X;  4RO0 A;  3MEE B;  1BD6 A;  2WVF A;  3BQ0 A;  1RTJ A;  3MUT P;  3RAQ A;  2ACM A;  1NH8 A;  3MFI A;  2QA4 S;  1H38 A;  4LF9 F;  1WHV A;  2HFN A;  1HHT P;  4MFB B;  1YZ7 A;  1S48 A;  5CYQ A;  3ENV A;  1VJW A;  4XTT A;  4Z7Y A;  3J7A N;  4HHH A;  3VV2 B;  1B7Y B;  3EGN A;  4EZ9 A;  1FX2 A;  4OZ2 A;  5C24 A;  4HAC B;  2CQ0 A;  2XNQ A;  1D09 B;  4DL4 A;  3NNH A;  3ZFV A;  2ZD1 A;  2JLF A;  4O3S A;  2ZM6 J;  1T05 B;  1VQ4 S;  1C4A A;  2GHV C;  3FEY B;  2V4J A;  2UUT A;  5LXR A;  1RTH B;  3JQK A;  1IKW B;  3HHE A;  4MJK A;  5KFF A;  4DF8 A;  1FNX H;  1FDN A;  3QT7 A;  5CZX A;  1HNX F;  5H9E J;  3MTJ A;  3T1Y J;  5GVQ A;  2YWG A;  3IWX A;  4I2P B;  3ICL A;  3BO3 A;  4RW9 B;  3UVJ A;  1QAJ A;  4DR1 J;  3I0R A;  4NRU A;  1SV5 B;  2OPQ A;  3FKB A;  3FQL A;  5KFC A;  1TK5 A;  4QYR A;  2CWX A;  4KGK A;  2ASY A;  5D0R A;  2Y1R I;  3M6V A;  5EWF A;  3IR7 B;  1XJW B;  4DX5 A;  1TFW A;  1Q8L A;  1ZAW A;  4ECV A;  1N6Q B;  4RW8 B;  1SH0 A;  3V4I A;  4RBT A;  1U1K A;  4M5N A;  1RT4 B;  4ZPB A;  1VC5 A;  3HZE A;  2MJN A;  4F8R A;  4X62 J;  3GIR A;  4IDK A;  2W7O A;  4CLP A;  3H5Y A;  1CJT B;  2C3Y A;  3GP9 A;  4NCG B;  2HQI A;  1IJF B;  3R9L A;  1TL7 B;  3GFX A;  1NPP A;  4FVM A;  1PJ6 A;  4I6A A;  3AY0 A;  2XS7 A;  4ID5 A;  4J9U E;  2KT5 A;  5F0W A;  2DT9 A;  1R0A A;  1HMV A;  2HQD A;  1ICE B;  5L1L A;  4H4K C;  5DGB A;  4NLX A;  4DR6 F;  5HRO A;  5AE2 A;  1QE1 B;  5B7W A;  3MD3 A;  3SV4 A;  3T5K A;  4TU9 A;  3PEJ A;  2QRR A;  5KFS A;  2QLX A;  2AQ4 A;  3PYF A;  5C42 A;  4ZS6 A;  3CSK A;  4WE1 B;  1AFI A;  3T6B A;  3ADA C;  2LU1 A;  2UV8 G;  4FYX B;  2QO3 A;  3R1L A;  4O44 B;  1JLB A;  4WFB Q;  1M5S A;  2XSJ B;  2Z2Y B;  2DR5 A;  1QD1 A;  3EGV A;  4X64 J;  1OS5 A;  3CUN A;  4H4M A;  4URQ U;  2R3V A;  4DR4 J;  1HNZ F;  1UEK A;  4QQB A;  2KI2 A;  3CDB A;  2LVW A;  2SXL A;  3SIP B;  2CXE A;  3VGS A;  1GAO A;  4MH8 A;  4ZPT R;  1XNQ J;  2DH7 A;  4YB1 P;  2HWT A;  2I8E A;  3M6W A;  2UUC F;  1WC6 A;  3D3C J;  4U6P A;  3KK1 A;  1J5E J;  3HPO A;  2FHJ D;  2BR0 A;  4N7T A;  2E7W A;  2E9Z A;  4LF2 A;  5HAN A;  4NA1 A;  1M90 T;  1VLO A;  2PEH A;  3SI8 A;  2VZ9 A;  4LF9 J;  3NXZ A;  3CNQ P;  1VRQ C;  2IBO A;  1GTE A;  2YWW A;  4PWW A;  2G0C A;  4IRD A;  3CDA A;  4DX6 A;  2D9P A;  2CPH A;  3IXQ A;  2GFF A;  1CLF A;  2I1R A;  3TA2 A;  2MGZ B;  4CI0 B;  4Y2K A;  4QIG A;  5K8O A;  3DKD A;  3U27 A;  1UMJ A;  4X66 F;  3QFW A;  1NSQ A;  4ZPV R;  1YJR A;  4KY3 A;  1T11 A;  3BN7 A;  4HR2 A;  3VZI A;  4ZVQ B;  3QWU A;  1Q1K A;  3RRH A;  3MPY A;  1N8R T;  9ATC B;  3OFG A;  5E3Q A;  2C2R A;  2C2K B;  1HNX J;  3M30 A;  2DR9 A;  4OYP A;  1L3U A;  5C7P A;  1VRU B;  1RKI A;  1UJ4 A;  4ZVP B;  1SL0 A;  4WPA A;  2WTF A;  1U26 A;  4Y6I A;  1S1U B;  3M9N B;  2XY6 A;  3OL8 A;  4KO0 B;  4C97 A;  2J7U A;  5F9L A;  4RWW A;  1TAQ A;  1XR7 A;  4DPO A;  2GIF A;  3M8P A;  5HJY A;  2W9A A;  4F4Z A;  3GJS B;  1HQU A;  2C42 A;  1GQE A;  4G3I A;  3R97 A;  3W61 A;  4K4T A;  2IRX A;  4RNF A;  3P96 A;  5GAD I;  2HHW A;  2QYG A;  1ACM B;  2AX0 A;  4M5G A;  2M9K A;  3PVX A;  1P27 B;  1UVN A;  3D67 A;  1IWG A;  4QYZ J;  1H74 A;  5ETR A;  1WF2 A;  3NMA A;  2PDA A;  1HWJ A;  2DGO A;  4WU2 A;  1HBU B;  2ROE A;  5GAH U;  2GVD A;  5IFM A;  4OHV A;  5F8G A;  1FKA F;  4DR6 J;  1F5C A;  2XMM A;  4JBC A;  4XPE A;  3JXO A;  4NZ0 A;  2V9W A;  2F63 A;  4Y34 A;  4OZ1 A;  4YB7 A;  3CD7 A;  3T1H F;  1ZTT A;  3MMB A;  5CHC B;  1V9O A;  1PYT A;  4E98 A;  4F4A A;  5CA5 A;  2ZZM A;  4ELV A;  2ROG A;  3TX8 A;  3DLG B;  1HI1 A;  5KT6 A;  1K73 T;  4FF2 A;  1AZS B;  3GJR B;  1ITP A;  2BW2 A;  4TYA A;  2FLL A;  2Y1L B;  5DET A;  3IO1 A;  3RG6 A;  4LF5 J;  2ZVI A;  4O3Q A;  1HPZ B;  3IG1 B;  1FRK A;  3G96 A;  3MR5 A;  2UUB J;  1S0N A;  2FHO B;  4QBU A;  4YDX A;  5I3U B;  3HJF A;  1HNZ J;  4ZJQ A;  3L7U A;  1LXJ A;  2KXH A;  3GFY A;  1J2V A;  3F56 A;  1VOM A;  2CQC A;  1U2R A;  4B9M A;  1BC6 A;  1DQ8 A;  2LQ5 A;  2YNF A;  3FBF A;  4NA3 A;  2RU3 A;  1RAF B;  1GTH A;  2LFV A;  2V34 A;  1PSD A;  2QLW A;  1B3T A;  1VYA A;  2P9C A;  2J0W A;  1EB0 A;  2W4P A;  3J7Z 5;  1PAE X;  4WK3 A;  5KFW A;  4CLZ A;  4WZM A;  5HVG A;  5J2M B;  1EKS A;  3S8S A;  1V3Z A;  3P6Y C;  3HF5 A;  1RT2 A;  1OPZ A;  1IXK A;  2R42 A;  3OXF A;  4LIR A;  4DPU A;  1D3W A;  4U8V A;  1CJK A;  4X66 J;  1TL1 B;  4UUW A;  5IT9 U;  3JYT A;  1SUQ B;  1U02 A;  1PAU B;  1S9G A;  3S1T A;  1NRK A;  2RB7 A;  1RWM B;  3IAS 9;  5LM7 E;  3NS7 B;  2YXL A;  3ENQ A;  3CJ4 A;  1KLM B;  2BM0 A;  5AE1 A;  3ZC4 A;  1ZM3 A;  4MKA A;  1YJN S;  4R5P B;  1OSC A;  4NXN F;  2VBW A;  2YNI B;  4Y2C A;  3LGM A;  2GIR A;  3AB4 B;  3GJQ B;  5I42 B;  2B56 A;  4CLL A;  3PEH A;  2Y1J A;  2BKO A;  1YJV A;  4CLT A;  4DSE A;  4UQG A;  5B0C A;  2FJD B;  4CO4 A;  4LSN B;  3EVM A;  2E5J A;  4NLY A;  3G8S A;  3N4W A;  4HHJ A;  2ATL A;  2JFD A;  2YNH A;  5GAG U;  2RDI A;  1RAI B;  4G1Q A;  2DHX A;  3TR5 A;  4XDD A;  1CSJ A;  1M0S A;  3OFH A;  3FUY A;  2IHR 1;  3QGG A;  3DRS B;  4QR2 A;  4OHY A;  1TMM A;  1IM6 A;  1NDC A;  4PG8 A;  4B3M J;  2Y8Y A;  2FHJ A;  2YKM B;  5KG0 A;  1PBU A;  3QQC D;  4KE5 A;  4LBI A;  4RW7 B;  3L3C A;  1E6V A;  1YX2 A;  4RW4 A;  4LMZ A;  3DLK A;  4EU0 A;  1M5K C;  2EFG A;  1Y3K A;  2KYZ A;  1HWL A;  1SKR A;  3C16 A;  2G2Z A;  4YME A;  3T1H J;  2CKW A;  2KFY A;  4LSZ B;  4CLU A;  3EYZ A;  1X5P A;  5E3R A;  4ZJO A;  2IM1 A;  5L1K A;  3A3P B;  4CM2 A;  5KT3 A;  2W2N P;  3F44 A;  1PYS B;  2DKO B;  1X31 C;  2AZ3 A;  2UXB F;  4UQT A;  1AUD A;  4DV7 J;  1FFS B;  2KT2 A;  4KHR A;  4NYP A;  2ROP A;  1U49 A;  4ED4 A;  2KZM A;  3I55 S;  2KYX A;  5FDL A;  4Q0B A;  2FZC B;  2X1A A;  3OR2 A;  4CLW A;  4ZPC A;  5CXT A;  4IQX A;  5CCM A;  3KLE A;  2NSC A;  1HQE B;  5HLF A;  2QL5 B;  3RB6 A;  1NH7 A;  5DQI A;  3KJV B;  3LOU A;  3MMC B;  2BOP A;  3EXY A;  4KGM A;  2DR6 A;  2UZA A;  2YH0 A;  1X5S A;  1YWX A;  1CJV A;  4MAK A;  3K59 A;  3I96 A;  4DS5 A;  2EC0 A;  2XS2 A;  5A0Y B;  4O3O A;  1IQZ A;  1SH3 A;  4TY8 B;  1RLC L;  3K5L A;  3CCU S;  5DLF A;  3BGO P;  3EXC X;  4USH A;  5K20 B;  1RTD A;  5KFY A;  3UI3 A;  1FE0 A;  2RF2 A;  3CTR A;  3OUY A;  1UWB A;  1N54 B;  1VQ9 S;  3BV8 A;  3OJU A;  3RB0 A;  1G1X A;  2R8I A;  2MXY A;  1V5I B;  2OLW A;  4AL6 A;  3KMS A;  1HNI A;  1WJ9 A;  2V94 A;  2OEL A;  2DIT A;  4ZP6 A;  2J9C A;  2HRT A;  5DM7 Q;  3LGH A;  5HMW A;  5DDO C;  3GFH A;  1XN9 A;  1C1B B;  3H25 A;  2B3T B;  4U96 A;  1CC8 A;  3E3X A;  2FGO A;  1ZA2 B;  1LWC A;  4CTA A;  2XCP A;  3KLI A;  4NXN J;  2IM0 A;  1C0T B;  2FD2 A;  3R7N B;  4CDI A;  3D5M A;  3VAI A;  4O4R A;  3JB9 k;  1TK0 A;  3KFW X;  3AD8 C;  6FDR A;  2PO4 A;  3HMJ G;  3OXG A;  1REV A;  3BBB A;  4B3T F;  1U1P A;  3DM2 A;  3PW5 A;  3ILO A;  4HI2 A;  2IIH A;  1ZOT A;  5B0E A;  4PXE A;  3L7P A;  5DGA A;  4M5L A;  2IM3 A;  4HTI A;  3PX4 A;  3I32 A;  2H51 B;  4FNI A;  2HHH F;  2B9Y A;  4M5D A;  1C0U A;  1VQL S;  3M32 A;  3MCN A;  4J9Q A;  2NR0 A;  5A6W A;  1RAJ A;  4UZB A;  2IRU A;  1Q0N A;  2UUA F;  3N79 A;  5K5M A;  3ITH B;  3HUL A;  1RHR B;  4EFA C;  1BMQ B;  4DV4 F;  4C3L A;  3CXC R;  2OPS B;  4CT9 A;  1IBK J;  1O5J A;  3T19 A;  1TTH B;  2OIH A;  2MKH A;  2XEX A;  2DXF A;  5BR8 F;  2KVQ E;  2R8H A;  2W4C A;  4P7V A;  3HM9 A;  5JMN A;  2CNL B;  5KFH A;  4Y65 A;  4K0K J;  2B43 A;  2MMY A;  2YQ0 A;  4J9S A;  1NDL A;  4ZLL A;  4URG A;  2B0G A;  3MD1 A;  3V6D B;  3DYA B;  4B02 A;  1RJJ A;  4ZLP A;  1LW0 A;  1YBU A;  4A8W A;  4ILR A;  1SJ4 P;  3VAJ A;  3K7R A;  3H20 A;  5L46 A;  3KNG A;  4ZMM A;  2R2S A;  4UT4 A;  5D8H B;  3SDE B;  3VGU A;  3M2R A;  3CJ3 A;  4C11 B;  1JLQ B;  2HHT A;  5A6P A;  2YX7 A;  2JWN A;  1IR2 A;  4L6V 3;  1TAU A;  1UET A;  4I6W A;  1U7L A;  2R7X A;  2XY7 A;  4LSL B;  3N0V A;  2HNZ B;  5KFX A;  2FJV A;  1NK8 A;  2DNZ A;  5JUM A;  3KG0 A;  1WHX A;  3N5B A;  2BV3 A;  4A47 A;  2J9E A;  4K4X A;  1FDA A;  3PTW A;  5ETL A;  3IRW P;  4KKO B;  2AKW B;  4W92 B;  5KTQ A;  1WC4 A;  1GXT A;  2JC1 A;  3C6U B;  3TJ9 A;  4DL5 A;  1TL3 B;  1S1V A;  2FGC A;  1NU4 A;  3LA0 A;  2DHH A;  4Q43 A;  2IA6 A;  4DN9 A;  2KG1 A;  1D9A A;  2FJE B;  1S7I A;  2WRM A;  1EAR A;  5F3T A;  3ETM A;  2KT3 A;  1CPZ A;  2XWX A;  4O4G B;  3R6G B;  1KTQ A;  4CLK A;  1RU2 A;  1F5B A;  2RU9 A;  1BGX T;  3TAM B;  4Y2A A;  1T3O A;  2VPY B;  5L1I A;  2AEJ A;  1RTJ B;  4I6Y A;  2WSE C;  1TKD A;  2JC0 A;  2VC0 A;  5GMD A;  2K3I A;  3TZY A;  5J2Q A;  2MLZ A;  3HVR A;  2H4W B;  2EG2 A;  3V4M A;  4FS1 A;  4BBY A;  2VJV A;  5F8N A;  2MSS A;  3HVA A;  2R2U A;  3DLJ A;  1UCN A;  1X8D A;  1RT1 B;  1JKH A;  5CYQ B;  3IS9 B;  1WC5 A;  4B3T J;  4RUA A;  1FA0 A;  2Q6B A;  4I68 A;  3E2E A;  2XI2 A;  5DG7 A;  1X4G A;  5C24 B;  3CJ8 A;  4DSJ A;  2F1F A;  1OO0 B;  4I67 A;  3LF0 A;  1JX4 A;  2ZD1 B;  3U7J A;  2HHH J;  2DHA A;  2XM3 A;  3SMZ A;  2V4J B;  1DUR A;  2XI3 A;  3SYZ A;  3OL6 A;  2GGP A;  3C6T B;  3BSN A;  2O5D A;  2CFX A;  4UTG A;  4DLE A;  1RWW B;  1U6F A;  4IG0 A;  4MKV A;  1S9E A;  3I4H X;  4AT1 B;  5IQ6 A;  5DG8 A;  1PKU A;  5B08 A;  1I94 F;  4V19 J;  4ED6 A;  3D0G E;  3FNN A;  4LFB F;  5IXU A;  2OPQ B;  3M1V A;  8RUC A;  2EKY A;  3D6F B;  1MLA A;  5BR8 J;  2ERR A;  2NPI A;  1N5S A;  2E66 A;  4ES1 A;  2VD3 A;  3ZZU A;  4FYW B;  1N5Q A;  1Z2Z A;  3T1A A;  2APO A;  3KTQ A;  1Y4Z B;  5GMK a;  1MML A;  3P5T L;  1QDU B;  2IPO B;  3D6M B;  1OWX A;  4NAS A;  3BM7 A;  1SBR A;  2GJ2 A;  4IDK B;  1LOU A;  1RWN B;  4DBQ A;  3HHL C;  1FXL A;  2AJ0 A;  3ET6 A;  4NLD A;  4NLT A;  4ID5 B;  2OPR A;  5JJB A;  1G3O A;  3TVZ A;  1R0A B;  1HMV B;  2EG1 A;  2YVS A;  2PFF B;  3EGW B;  3MAA A;  2HAF A;  2K7J A;  4DV3 F;  2RQC A;  4KGX B;  2L9N A;  3D1H A;  2R7W A;  2MHE A;  3A12 A;  5HJX A;  4C98 A;  5ETM A;  1N5Y A;  1NEE A;  4NPO A;  5B09 A;  1WG1 A;  2CPZ A;  2F40 A;  3EMT A;  5C42 B;  3AQO A;  3DCA A;  2IVY A;  1NSP A;  5DG9 A;  1BQM A;  1B64 A;  5K14 B;  2GQQ A;  1W2I A;  3HSJ A;  5KG2 A;  2FHM A;  2WVC A;  1MU2 A;  1VIS A;  2W4D A;  3MAH A;  1JLB B;  2QSW A;  3CJ2 A;  1Y5I B;  3BH7 B;  3TOQ A;  1W26 A;  2VOP A;  2J6U A;  2VFS A;  3TX0 A;  2XGQ A;  2GO9 A;  4RUC A;  2C2N A;  3PXG a;  2RS8 A;  2CA9 A;  4HH1 A;  1SC6 A;  2DNN A;  1VQ5 S;  3I4P A;  2M0G B;  2KTQ A;  1R8P A;  4P9S A;  3PFE A;  3NP5 A;  3IR5 B;  4YB5 A;  5J1N A;  2VIC A;  2DIV A;  3KK1 B;  5KFV A;  2JLG A;  4O3R A;  3MXH P;  1S1X A;  2YKN A;  1VQ7 S;  4DSK A;  1EHW A;  5F8M A;  4EZ6 A;  3BYR A;  1T9W A;  5KFR A;  3IR6 B;  5F8J A;  5L9X A;  1IWA A;  2CVE A;  3CD6 S;  4ERD A;  2XZT B;  1WEY A;  2DR8 A;  5DM6 Q;  2MKI A;  1DQ9 A;  4AE5 A;  1JJ2 R;  3TEG A;  4DHV A;  2ZWO A;  4AXJ A;  4ES3 A;  3OLB A;  3ILJ A;  4YOE A;  2Y8W A;  4ITS A;  4QIE A;  3HKZ D;  1S12 A;  3EDR B;  4L76 A;  2ZH3 A;  2B4O A;  2HNY A;  4CLF A;  4A48 A;  1S9F A;  4ZVT B;  4DXL A;  3SCL E;  3UCG A;  1XR6 A;  1TVR A;  2LA6 A;  4ECX A;  3D1Q A;  3M30 B;  5E3C A;  3OHA A;  1S76 D;  2J7K A;  4Z7C A;  1WOR A;  5KFL A;  3NEK A;  4Q45 A;  1P9Y A;  1I94 J;  3RW6 A;  1Y11 A;  4C3M A;  4LFB J;  2XZW A;  4WBF A;  5CD4 H;  2NRE A;  1MRO A;  4HL9 A;  3M8P B;  4FF1 A;  2VIH A;  4K5R A;  2WB4 A;  3QJJ A;  4RWX A;  1HQU B;  3ISN D;  2VBY A;  2AYB A;  2MEW A;  4WFX A;  3A13 A;  3HP6 A;  3BQ2 A;  1WDT A;  3LPE A;  2EEY A;  4EEY A;  2QEX S;  4UOF A;  4Y3C A;  4IRC A;  2CPI A;  4CM0 A;  4CO0 A;  3CO9 A;  1O8B A;  4TVA B;  1TK8 A;  4RUB A;  1RYR A;  2GV1 A;  1X0F A;  2B9E A;  4NX9 A;  2JLE A;  2WZ1 A;  2CG4 A;  3RUB L;  4WFZ A;  4LRA A;  4OLO A;  5GAD U;  3AQP A;  2O67 A;  1Q5Y A;  4ZCK A;  1UVK A;  1RDR A;  2GAG C;  2ZH6 A;  1HD1 A;  4FP9 A;  4K4W A;  1LFW A;  4IUF A;  2CQH A;  2LDY A;  1WOP A;  3NWG A;  4PG6 A;  4DV3 J;  2H5E A;  2E1M C;  1P1T A;  2FJB B;  1TKX A;  3MMB B;  4QWA A;  2XLJ A;  3ZZ0 A;  3TUP A;  3I6P A;  2D3Z A;  2MZJ A;  3NGR A;  1YDL A;  4DX8 H;  3L09 A;  3VHQ A;  2VG6 B;  1XIQ A;  1U4B A;  2MQN A;  2PI4 A;  1Q5V A;  5H9F J;  2W2M P;  3H40 A;  1HFE L;  3S6E A;  4C8O A;  2RSQ A;  1IVZ A;  1WEL A;  3KUH A;  3R5G A;  4ZLJ A;  4OQJ A;  5AXK A;  5HMX A;  2V8H A;  3HO1 A;  2KM8 C;  2HBY B;  3WC2 A;  4DWI A;  4CQ1 A;  4OFZ A;  3R8Y A;  5LT5 A;  1RP5 A;  3BO4 A;  3UDV A;  1TL5 A;  3MED A;  2DNO A;  4M1K A;  2WON A;  1DTQ A;  1G6B A;  2NYI A;  3D4J A;  3GPA A;  5LSL A;  1O6X A;  2AX1 A;  3TZW A;  2NZ4 A;  5T14 A;  2J76 E;  4QWD A;  2YNF B;  2WW8 A;  1NKC A;  4I0W A;  3IRX A;  2ZBI A;  4USU A;  1XER A;  1OYE A;  1PO6 A;  3MUM P;  2JVO A;  4LF8 J;  4JUZ A;  3M2V A;  2DY1 A;  3BYP A;  4OX6 A;  1PIE A;  5KFG A;  4IG3 A;  3GIM A;  1HNW F;  2MQM A;  2QA2 A;  5DZ6 A;  1MN9 A;  4AYB D;  2QLB B;  1IBM F;  1PC5 A;  2BOA A;  1RT2 B;  4UF4 A;  3HHD A;  2DCL A;  1HHQ A;  4OHX A;  4JV5 F;  1CJK B;  3QAT A;  2M3D A;  3IM8 A;  4USV A;  1R7I A;  3JYT B;  5CYM A;  2DGT A;  5KFB A;  1OYD A;  1FK9 B;  3NOC A;  3BH6 B;  3R5J B;  3M8Y A;  1S9G B;  2FHK A;  3CJ0 A;  2LXI A;  5IWA F;  4GO5 X;  3IM9 A;  4PQU A;  2DNL A;  5DDP C;  1NO8 A;  5DZ7 A;  4NL5 A;  1S0M A;  3RU0 A;  3GYN A;  3NL0 A;  2ACY A;  5IT9 Y;  2OAU A;  2GNK A;  1S1T A;  5KFQ A;  4PAB A;  5D78 A;  3D0I E;  2R7T A;  1QY7 A;  2R7O A;  2VF3 A;  1OQ3 A;  2HWI A;  2AYE A;  2XHW A;  2YNH B;  5SZT A;  4YY3 J;  4G1Q B;  2MZR A;  2MKK A;  2AMC B;  1XC9 A;  3TAP A;  1LQ9 A;  4Y0F A;  2K1R A;  1KHW A;  3D6H B;  1F9H A;  2VA3 A;  1YJ7 A;  3FBE A;  1IBL F;  1KSP A;  3NOG A;  1AT1 B;  5KT7 A;  2CJX B;  3CDU A;  1E6V B;  4DJB A;  2J6S A;  2Y9H A;  4NLU A;  2HVI A;  1UPP A;  1EIY B;  1X9S A;  4XO0 A;  3DLK B;  1CBK A;  3SSQ A;  4C48 A;  1VBK A;  2XBP A;  1R31 A;  2BJ3 A;  3A8J A;  2D41 A;  4EUV A;  2RRA A;  1GMU A;  2F3J A;  3C16 B;  1NK9 A;  1KP6 A;  2G2Y A;  3CME S;  4P2F A;  1JLC B;  3DRP A;  3ENA A;  2CNO B;  2EK6 A;  3EZU A;  4KIA A;  5KFU A;  4OI4 A;  2R9L A;  1YBT A;  3PHT A;  3SEO A;  2NUH A;  3BB5 A;  3QPI A;  3PR4 A;  1X60 A;  1LXN A;  4EWT A;  3UO0 A;  4JI4 F;  3PJW A;  2HG4 A;  1RT7 A;  1ZA1 B;  4DR2 F;  1A9N B;  3N6M A;  4NLV A;  2AEM A;  3DRY A;  4YB6 A;  2POK A;  2GCF A;  3EVW A;  4FXW A;  1UFK A;  1S6Q A;  1HYS A;  4WF9 Q;  5FDL B;  5A8W B;  3PIP Q;  3HSZ A;  2CQ3 A;  2ASJ A;  5ETT A;  4P2S A;  3UDL A;  1U45 A;  3JTN A;  3KLE B;  2HBZ B;  4ICL A;  2E5I A;  4J91 A;  5HLF B;  4NLQ A;  1NK5 A;  2YKO A;  1VBX A;  1RSC A;  1KD1 T;  4L75 A;  2NUU G;  4W4M A;  1SQG A;  2C3M A;  4UOH A;  1RT5 A;  2NPF A;  3OSN A;  1TEL A;  1RT6 A;  4JP8 A;  3NKY A;  4OYO A;  4RBU A;  1CJV B;  2RS2 A;  4ZOS A;  2GC8 A;  2BJ7 A;  2HVZ A;  2BXJ A;  4ZIV A;  1SIW B;  4Y2M A;  4LF6 F;  2QA1 A;  2W9B A;  3QT8 A;  3MR2 A;  1HNW J;  2ZC4 A;  2RF2 B;  1S0V A;  2IM2 A;  3JS9 A;  3OUY B;  2HS4 A;  1UWB B;  2V50 A;  4UW2 A;  3O1L A;  4L72 B;  2WAQ D;  3I9Z A;  1IBM J;  4PG7 A;  2AWZ A;  3ETO A;  2J0X A;  3D68 A;  1N0U A;  1HNI B;  3CCQ S;  1DQA A;  1KR4 A;  3UCZ P;  1IKV B;  3LAL A;  4MIW A;  4CO3 A;  4PYA A;  4M94 A;  2DIS A;  1PYO B;  2QA4 G;  3L95 X;  3LP2 A;  3SBM A;  3QIP A;  2DPJ A;  4FZV A;  2HIQ A;  3ZNJ 1;  2IRY A;  3B6B A;  1LWC B;  2RIL A;  4CTA B;  3ZO7 A;  5HL7 Q;  4ZP8 A;  1UFW A;  4QIW D;  1TKT A;  1FKO A;  2MKS A;  1UEV A;  2CJ9 A;  1NCL A;  3B8H A;  1NHU A;  2BAB A;  4WXO A;  2HWH A;  2VA2 A;  5CH7 B;  1REV B;  1YGY A;  3PJX A;  3DM2 B;  3FVY A;  1TMJ A;  4JOU A;  3RR8 A;  1APS A;  2H65 B;  3RR7 A;  2AU0 A;  1WI6 A;  4Q8E A;  3NBP A;  1NSK L;  3G6V A;  4B9T A;  4KTQ A;  2P5V A;  3CO0 P;  2DBB A;  3MUV P;  2A1B A;  4CH0 S;  2BQU A;  4LF4 J;  3PIO Q;  4ZN3 A;  3H42 A;  4PWD A;  4M5D B;  3THV A;  1C0U B;  1XQI A;  1N32 F;  4JI7 F;  3U1M A;  3M32 B;  4RU2 A;  4U95 A;  1IBL J;  1FDB A;  1FRI A;  4DLG A;  3B54 A;  3TA1 A;  2CNK B;  1VQO S;  1KQK A;  3OHB A;  2X1F A;  2XS5 A;  5T7L A;  1R6V A;  2ZIT A;  2F5G A;  1H7W A;  2AGO A;  2CZV C;  3DC2 A;  3GR0 A;  4IR1 A;  5ETV A;  4EI2 A;  1ZTW A;  4QYZ K;  4TU8 A;  3BKT A;  3QBC A;  1XK8 A;  2CUY A;  1HBN A;  2N4D A;  2D3O 1;  1H3D A;  2FC8 A;  2PA3 A;  5ETO A;  2ZDO A;  2BJ1 A;  4DR5 F;  1RZM A;  3TJ8 A;  2WVE A;  3EVO A;  4UOC A;  1Q7Y T;  4DR2 J;  3OL7 A;  1LW0 B;  1QVG R;  4H54 A;  1U47 A;  2QSF A;  3ISN C;  2ILY A;  2G4B A;  4KFB B;  3QZ8 A;  2NQP A;  3SXL A;  3M2R B;  5ADZ A;  5KG6 A;  3MM5 A;  1YIJ S;  3D0H E;  4I2Q B;  2B6A A;  1NKB A;  4OJ1 A;  4X4Q A;  3DOL A;  2U2F A;  4NMX A;  1XMO F;  3A3N B;  1VQ8 S;  1VLY A;  4YS2 A;  2BM1 A;  2KXN B;  2FB0 A;  3CJK A;  2J0Q D;  3KK2 A;  3DLL Q;  1VQS A;  4LRF A;  4LF6 J;  1JLG A;  3CCJ S;  3VAL A;  4FNH A;  1IJE B;  2CNN B;  4ZP9 A;  2DGS A;  2GJI A;  3RBE A;  2M2B A;  3EWG A;  3PCO B;  4KAI A;  2RRB A;  3EUN A;  4DG1 A;  3QRP A;  1S1V B;  5IT0 A;  5F41 A;  2CQI A;  3J7Y U;  4MT1 A;  3TVY A;  4TN2 A;  1WHW A;  2GVZ A;  2BQR A;  5AXN A;  3JSM A;  5D4P A;  1N56 A;  3CC2 S;  1LWX A;  3DLH A;  1MNE A;  3CCV S;  3C15 A;  4AQY F;  2KZZ A;  4KQZ A;  2HMI A;  3PO4 A;  3FBB A;  3IFE A;  2R4F A;  4ZK7 M;  1T9V A;  4JYA F;  4W98 A;  3TW0 A;  4DI6 A;  4A8Q A;  4ZVO B;  2DNG A;  2B8Q A;  3CC7 S;  3I56 S;  1PIL A;  2JOQ A;  5KT5 A;  5J2Q B;  3VCD A;  4M5J A;  3OTC A;  3P3D A;  3OVS A;  1MWQ A;  2XMV A;  4CZC A;  1JKH B;  3PW4 A;  2KVI A;  1SCJ B;  2HHV A;  3FC9 A;  5AT1 B;  3PX6 A;  5EX0 A;  4YR2 A;  3L4B C;  3A8E A;  2BJ9 A;  3KLH A;  4P75 A;  3KOA A;  3HZG A;  5M2U A;  4LF7 F;  3W65 A;  1DY3 A;  2V2K A;  4LRE A;  3ZZP A;  4BS2 A;  1N4L A;  1N32 J;  5CD4 A;  1ZYQ A;  4KJI A;  5A2Q Y;  3W64 A;  3L9Z A;  2GGP B;  4OYM A;  4KPY A;  4QPT A;  2XCA A;  3TAN A;  2E9R X;  2EPI A;  3SCI E;  4IG0 B;  4KV8 A;  4X2B A;  1S9E B;  4N76 A;  2DY9 A;  3M1V B;  1H72 C;  2JVR A;  3QGP A;  1ZET A;  4U67 Q;  3CJ5 A;  3K8V A;  1VQY A;  2M70 A;  3LP1 A;  5GAE I;  1FO1 A;  2W8L A;  2BDP A;  3QLH A;  4N5S A;  1T9X A;  4DR5 J;  1TP7 A;  2XMT A;  3W5Y A;  4QR1 A;  3C14 B;  1VHI A;  1N5T A;  1NME B;  2UXC F;  4NI2 B;  1LW2 A;  4Y28 C;  1AB8 A;  1VR6 A;  5HQL A;  4K7Q A;  1R3N A;  2XC9 A;  2B8P A;  4DSL A;  3ET6 B;  2EFN A;  4IYQ A;  4NOH A;  3OTD A;  4OYZ A;  3QID A;  2OPR B;  1UVI A;  1JWW A;  3PW0 A;  5IZH A;  1QTN B;  2CQB A;  4FYV B;  3HSD A;  4JI8 F;  3MAA B;  1PJ7 A;  2VU5 A;  5HI7 A;  4BCA A;  4B08 A;  1N52 B;  2L9D A;  3TAQ A;  3VZH A;  1RXO B;  2FZK B;  3PRB A;  1U0H B;  4ZVE A;  3F41 A;  3DLB A;  3TWZ A;  3UN3 A;  3BRE A;  2YX1 A;  2QV6 A;  3FCW A;  2G0I A;  3MEG A;  2QGF B;  2VHG A;  3JTO A;  1BQM B;  4JI6 F;  1MSW D;  1UL3 A;  4ETX A;  1RGV A;  3EZO A;  3EPI A;  3RB3 A;  3G6X A;  4Q8F A;  1MU2 B;  3M6U A;  1PGZ A;  4DCO B;  2UU9 F;  2W25 A;  5RUB A;  2MJU A;  3MM9 A;  3I5B A;  2BRL A;  2PA8 D;  1BUX A;  1DBD A;  1FD2 A;  2Z0G A;  2VQE F;  1M5V C;  3G8T A;  2J9D A;  3N6N A;  1AW0 A;  1RB0 A;  4G6V B;  4NZ7 A;  4LQ9 A;  4MFB A;  1W7W A;  4OI3 A;  3HI9 A;  4AQY J;  4ZKA A;  2B9W A;  1F6T A;  1FWL A;  3D54 A;  3O8W A;  1VFJ A;  1S1X B;  2YKN B;  1RBO B;  4V19 X;  1Z2L A;  4JYA J;  1Q7L B;  4PWU A;  2NZC A;  3KHR A;  2JDJ A;  5M2P A;  2C2D A;  4HAC A;  3OTE A;  1XTZ A;  2CG8 A;  4KBI A;  1JK9 B;  2IMO A;  4OI1 A;  2OEM A;  3AJ2 A;  2ZKT A;  2KM8 B;  3MOJ B;  4QR0 A;  1IKW A;  2QLF B;  2NXC A;  2FJX A;  1PBA A;  4RNH A;  3VQT A;  1JNZ B;  4ZPW R;  1EJ7 L;  2QX0 A;  3HHN B;  4U7U D;  1EAY C;  1RWO B;  2BKP A;  4EK2 A;  2DHG A;  3ELH A;  4LF7 J;  1XNQ F;  3BQ1 A;  2DB1 A;  5D3G A;  3Q8S B;  4MK9 A;  1HD0 A;  2HNY B;  2W2O P;  4EBE A;  1UW9 A;  1RHJ B;  2BA9 A;  5ITH A;  1UA1 A;  1TVR B;  4HT7 A;  9RUB A;  3DU6 A;  1NK0 A;  3M4X A;  7AT1 B;  4RW6 A;  1SQF A;  4U7C A;  2Z57 B;  2AV5 A;  3KK3 A;  1F3V A;  2HAI A;  3QAU A;  4U8Y A;  3AT1 B;  1NZ8 A;  2RJZ A;  3SCK E;  5EWE A;  1CJT A;  1MRO B;  4N41 A;  3ULH A;  4OIX A;  5A8K A;  5IV3 A;  4FBT A;  2M4M A;  4DR7 J;  4W90 B;  1P1L A;  3DRX A;  2I0X A;  2YQ3 A;  3ILI A;  2XWY A;  1RBA A;  2B4V A;  3OFF A;  4A8K A;  1TU0 B;  1Y9O A;  2UXC J;  1QAX A;  2AYM A;  2R2R A;  5BYQ A;  2VDH A;  4J9P A;  2LDI A;  2D9O A;  3IBC B;  2BQ3 A;  3FMW A;  1YQH A;  2I5J B;  1G4C A;  3BSO A;  3CCT A;  4WE1 A;  4M8L A;  3P45 B;  4DOZ A;  1FNM A;  4QJV A;  4LFC F;  4GVL A;  2X51 A;  2NYH A;  4JI8 J;  4WFY A;  4PUO B;  1UJ5 A;  1LWE A;  2ASD A;  4DL2 A;  2HPU A;  2XQC A;  1NPR A;  2WOM A;  4O44 A;  3AJD A;  1TKX B;  5LXY A;  1RT3 B;  2ATC B;  1UP1 A;  3BPD A;  5JVH Q;  2ZOM A;  4CNY A;  2HHS A;  1JLA B;  3PNI A;  2N7C A;  4JI6 J;  2ZJQ Q;  3DLE A;  2AJF E;  3A3O B;  2FC9 A;  2GMJ A;  2EVZ A;  3PKY A;  3CCR S;  2UU9 J;  2XMU A;  4C0H A;  5KFM A;  1JXE A;  2HZV A;  2VQE J;  3MGJ A;  4QW8 A;  3FEX B;  4N47 A;  2RKI B;  3MED B;  1V6H A;  1DTQ B;  3LAN A;  5MLC V;  1WC0 A;  4F2S A;  2HHX A;  4I69 A;  5D6G A;  1WSR A;  1MN7 A;  1REG X;  2BAC A;  3IRX B;  1QLN A;  4GC7 A;  3TZX A;  2ZH4 A;  1SKS A;  5IC6 B;  3K58 A;  4PEO A;  2PC6 A;  3M2V B;  2QG9 B;  2D1C A;  5BYR A;  4I1T A;  1RAC B;  3QT6 A;  2QFJ A;  1LK7 A;  1VMB A;  4IG3 B;  3DHX A;  4LF5 F;  3W2W A;  1IBC B;  1R89 A;  5BXI A;  2Y0B B;  2HFS A;  1P8G A;  2HQC A;  2UUB F;  2WB1 D;  2M88 A;  5AE3 A;  4HLB A;  4WU3 A;  2EBE A;  1HBM A;  4BHQ A;  1GK8 A;  5CAA A;  1X7V A;  2B4P A;  2PFD A;  1F2G A;  2E5L F;  4EGL A;  2XMJ A;  5CYM B;  1SL2 A;  2VKR A;  3DGP B;  2CJB A;  2IJR A;  1K8A T;  5FLX Y;  1NJX A;  3KMQ A;  4ED3 A;  4ED7 A;  2MLY A;  3DN9 A;  3I5C A;  3E01 B;  3MCO A;  3FFI A;  3UR0 A;  2HRU A;  3R3T A;  4DUT A;  2HLT A;  1NSA A;  1AUS L;  4DV2 F;  3IGN A;  3QGH A;  2W01 A;  4ZA1 A;  1UEU A;  4KHP F;  3AD7 C;  2DGU A;  3G82 B; 
#chains in the Genus database with same CATH homology
 1UTA A;  2LFV A;  1X60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...