5LMNJ

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5lmnJ00
2E5LJ 4NEZA 4PWWA 4LF8J 2MTLA 3W1YC 1XNRJ 4KY3A 4B3TJ 5FLXU 4X65J 4HHUA 3IMQJ 4DV6J 4JI0J 5LMUJ 4DR3J 3OTOJ 4DV7J 4B3RJ 4DR4J 3D3BJ 5LMNJ 2UUBJ 1HNZJ 2UUCJ 2VQEJ 5BR8J 1IBMJ 4JI6J 4RJVA 4DV3J 4DR2J 4JV5J 4DV2J 1I94J 5A2QU 3D3CJ 4JI3J 4JI7J 2VQFJ 4X62J 4LFAJ 2UU9J 4LFBJ 4AQYJ 4V1Ak 4LF7J 4NXMJ 4LF4J 2KVQE 1N36J 4YHHJ 2F4VJ 1N34J 5IT9U 1XMQJ 4DR7J 4JI8J 4LF5J 4KYZA 4X66J 1XMOJ 2MEWA 4NEYA 4YY3J 4LF6J 4NXNJ 4OX9J 1N33J 4DV4J 5AJ3J 1HNXJ 4GKKJ 2KL8A 4B3MJ 3R2DJ 4DR6J 1IBKJ 3J81U 4DUYJ 4GKJJ 4DR5J 2UUAJ 4DR1J 1FJGJ 2HHHJ 4LFCJ 1HR0J 4DV5J 3J80U 1J5EJ 3T1YJ 1N32J 4JI2J 1HNWJ 3R2CJ 4B3SJ 2MQ8A 4LF9J 2ZM6J 3J7AN 4K0KJ 2UXDJ 4X64J 4JI4J 5LM7E 4DUZJ 4DV0J 4DV1J 5IWAJ 4JI5J 4KHPJ 2UXBJ 1IBLJ 4JYAJ 2UXCJ 1XNQJ 3JAMU 3T1HJ 4JI1J
chains in the Genus database with same CATH superfamily
2MPUA 2H5IB 2AYGA 3MAHA 2Z57B 1RA6A 3OJSA 2MHEA 4P6QA 1XNRJ 2JX2A 2VOPA 4DCOB 1S79A 2W8KA 2PO4A 3D3BJ 1QVGR 2BR0A 3A13A 4DPUA 2GJ2A 4DR2J 1CPZA 2X7IA 1N36F 3FQKA 1RBLA 1BQMB 3FSIA 3K57A 2YKNB 5IS2A 3S6EA 4ED2A 5HROB 4IFVB 2LECA 1ZETA 3L95X 3DLEB 2OAUA 3C14A 4DQIA 3RAMA 3EGVA 1FNXH 5DGAA 1FNOA 5HMXA 3PX4A 3HFZB 2AHOB 1T0TV 2H5JB 5FLXY 4FN5A 4NLWA 3TVYA 3RUBL 1RISA 2AJ4A 3W2VA 3AODA 4J9OA 4L76A 1FD8A 1Y0HA 3GU0A 1X5TA 3UD5A 1UJ5A 2HVZA 1RTIB 2IDEA 1SB6A 2X51A 3NKYA 2LVWA 3W9HA 2QFJA 5FDLB 3P4UB 4M5MA 3JSMA 2M88A 2EPIA 4ZITA 1VQ7S 1WORA 2DHGA 2MKSA 4RW8B 3HZGA 3TX0A 5C24A 3NOGA 4PUOB 4PXCA 3BEGB 1PYSB 3GP9A 5AE1A 4KE5A 1BXNA 2CZVC 1ZM9A 3FK4A 4KKOA 3DXBA 2HQFA 2ROPA 3QT8A 2LP4A 2HRYA 3W7BA 2VFTA 4LF6F 4LBIA 4IDKA 3RBXA 3K8VA 2CJYB 2IBKA 4GKKJ 2JL9A 1CJUA 3R9LA 3DI6B 2Y1JA 1HWIA 1J5EJ 4P7TA 3I4HX 3V4MA 2KDOA 3M05A 4C3KA 2VFUA 1NDKA 2F65A 1RHRB 3PYGA 4JBCA 3P8BB 4M5NA 4S0MA 1IR1A 3MAAB 2EFPA 5C42A 3IM9A 4ECYA 3K8WA 2DO0A 2F1FA 3U02A 2V4RA 3TNVA 5IQ6A 5I3PA 1W2BR 1FVSA 5KG7A 4YUDA 2MGZB 4R5PA 2J76E 2MZTA 1VQYA 3ILIA 1F5AA 4F4KA 2B51A 2XLKA 2EVZA 3K58A 3OTOJ 3CIZA 3QSIA 4QU7A 4U95A 3T5HA 2VOOA 1SJ4P 1OS5A 3I5CA 4X62F 3A8IA 3NMRA 4JI3J 2N7YA 2QX0A 4LFBJ 4OFZA 4NLQA 1XMOF 3PW0A 2RJZA 1YJNS 1RAFB 1SIWB 3PR4A 3I0RB 4URQU 4N41A 4ED1A 2UVRA 1HNXJ 1IQTA 4OX8A 1N32F 1PJ7A 3OVAA 2EBEA 2HIQA 3D6HB 4ED6A 1GXUA 4JI2J 2FJEB 5CXTA 2X3GA 5CABA 1LW0B 2ASLA 4HLBA 3W62A 4P2XA 2CJKA 4I67A 1AZSB 2ZHOA 3M9OB 2GQCA 3KHGA 1PGZA 3LP0A 2FJVA 2AGQA 3OSPA 5KFPA 5THWA 2VPXB 3THTA 2QMXA 3NG8A 3O6QA 1AT1B 4Y2MA 2RKIA 2NYIA 1S7HA 1I5OB 3HZEA 3LGMA 5DZ7A 3SCLE 5CCMA 1TK0A 3H2LA 5A8WB 4USTA 3TX8A 4OI3A 3TUZC 3Q8UA 1S12A 1KBRA 2D69A 4YY3F 4N56A 1SPBP 3PR5B 1RHJB 3CCQS 2ASJA 1ZBTA 2O67A 1YK9A 3HHEA 3CB4A 1FDDA 2BJ9A 5CH7B 2NUHA 3GR1A 1U0HA 3C3LA 4ED0A 4P2SA 4PYDA 4K0KJ 4OI4A 3CCSS 1UWBB 1RTHA 2MSSA 1U1RA 2AT1B 3LWMA 5K8PA 3JYTA 3VAFA 2K3KA 1XNQJ 4L6V3 5F8NA 4RW4B 1HBOA 3OUYA 1RTJA 4NI2A 2XMMA 4LSZB 4RBTA 3AQPA 3CMES 6FDRA 1UPPA 4O44B 4CIOA 2BQ3A 2W01A 2VG7B 2XSJB 1W2IA 1CJVA 2AYBA 2ZC4A 3LOUA 1IQZA 4DSKA 2MLYA 5LJ3Y 3ZTOA 2KH9A 3EMTA 1UMJA 4LFAF 3VWSA 4LF4F 3H7HB 3W5XA 3CCRS 2HHPA 4I2QB 3QGGA 2NUUG 1XJWB 1QUPA 4TU8A 1C4AA 2O01C 3LF0A 2JVRA 2J8SA 4DR5F 5HQ8A 3HHLD 8ATCB 4KHRA 3UR3C 2HZAA 3L7OA 3NGUA 3UE2A 2FD2A 5GMDA 3CW2C 4ICLB 2XG8A 4DUZJ 1U45A 5HJXA 3SQGB 4LR7A 1TKTA 4M5LA 2QG9B 1NB2A 2D3O1 3ZTQA 3M2VB 3RB0A 2OSRA 1SV5B 4ELUA 1QE1A 3PCOB 4PWDB 3CJ8A 1VMBA 1SQGA 1T3OA 5LMUF 1J27A 3NWRA 4J37A 4NLOA 3PY8A 1R27B 4KTQA 3HT3A 1P9YA 2D3ZA 3KLGA 2OTLS 2UUBJ 1JLAB 4CM2A 4DV2J 2XI3A 4NYOA 2WBRA 3W2WA 4NXMJ 4KR0B 3UDCA 3E01A 4J9UE 2V34A 2V67A 1J5OA 2GHWA 3V4IB 3QPIA 5BYQA 1RSCA 2FJXA 4ZHRB 2BDPA 3A1YG 5E5NA 1FJGJ 5E3CA 2IVFB 4DL3A 3OXFA 3ZTRA 1VIXA 1RJJA 1XBWA 5F0UA 5KFYA 2Y0BB 2YPYA 2GO9A 3TYTA 5IV3A 4NZ0A 2C2OB 1UFWA 3BBFA 1FNMA 3NAIA 3IS9B 3LP2A 2BJEA 4ZPTR 3TI0A 3G86A 2OLWA 4NA3A 2BJ7A 4HVZA 2YKOA 2H4YB 2CNNB 2QA4G 3D54A 1T9WA 1WOSA 4F3QA 4FXVA 2F3JA 1EX8A 1HQUA 3RYLA 4EO6A 4QWBA 2XMWA 4X4TA 2WK4A 3AOCA 5AXKA 4UZBA 4IOAQ 1H72C 4RW6B 3MD1A 3EVOA 2ZVSA 1XWLA 1PAEX 1RT7A 1XN9A 3VQSA 3GJTB 4B17A 1S49A 3C8YA 4K7QA 3HHLA 3D7SB 3J81U 1DHMA 1L3KA 4HEA9 1WC6A 1SQEA 3S7RA 3THPA 3DOLA 2RQMA 3DC2A 2YQ1A 4QQBA 2DH8A 3TOQA 2VFRA 3HP6A 3AD7C 4P75A 2E1RA 1K8AT 4LUBA 4FVMA 1TAQA 1CVJA 2B8PA 2DPJA 1X4DA 4ZP8A 4RPFA 5EUHA 3AQOA 3BQ1A 3IAM9 4BWJA 4Y2AA 4LF8F 1U2CA 5RUBA 3I9ZA 3CDEA 4ZVGA 1BWVA 2JFDA 1SXLA 4TY9A 4UY85 2FJWA 1PC4A 3FDSA 1WKKA 3BS9A 2HIYA 1TKDA 3PJWA 1IBMF 3DCAA 1HWLA 2CWKA 2FLPA 2DBBA 3ADAC 4FXDA 3MTKA 2XO6A 3D3CJ 2ZH6A 1HW8A 4HR2A 1YRXA 3SBMA 1UEKA 5D0GA 4DCJB 3EGWB 4IG3B 1RAAB 4USWA 2A1BA 4A48A 4IOBA 1YQHA 2BACA 1VOMA 1FDNA 4DL7A 2DHXA 1L3VA 5ETQA 1S0OA 4PR6A 1HNVA 1GX6A 2J9EA 2RF2A 1WG5A 5AE2A 2GCFA 1R8BA 4YOEA 1S9FA 4XDCA 1GMUA 2F9DA 1ZM2A 2V9WA 3UDLA 4WTYA 2ZH9A 5GAEU 2HQ3A 2YNGA 1R8CA 3DLKA 1MROB 2XZTB 1TL1A 4EYHB 2FVSA 4QBUA 4FS1A 1UPMB 3FFIB 1NPKA 4B08A 1Q7YT 1HD1A 2ROGA 3JTPA 1WACA 4ENOA 4EEYA 1VBKA 4O3SA 3QYYA 4RUHA 3DOKA 2FHMA 4MIBA 2AEJA 2CJXB 5CZXA 4Y00A 3SV4A 3AA8A 1JJHA 2C42A 3T1AA 3OQ2A 3F44A 2FLOA 3NGTA 4BBYA 4DZ6A 3AD9C 2DCLA 2X1GA 4ZP6A 1XR5A 2DR5A 3EX7B 4DV0F 1SQFA 2QZ8A 1U1LA 4WFNQ 2B4UA 1BQNA 2VKRA 2IA6A 3UPFA 4DV1J 3OL7A 2I8EA 4NA2A 4ZKAA 2AP6A 1Q1KA 2RU9A 3IG1A 3JAMU 3GG1A 2HNDB 2Z0GA 2K8GA 1M90T 7FDRA 3TJ8A 2G1HA 1SL1A 5F8JA 2Y1LB 1CULB 2O66A 2ZKTA 5F8GA 1DZ5A 1URNA 5DRKA 5IM0B 3AOAA 3EE3A 2E1PA 2DIUA 1VCTA 3AAWB 3MURP 2BM0A 5BXIA 1HL6A 4F0KA 1N33F 5KT7A 3VAMA 5D3GB 1RT2A 2H4WB 4K4XA 5HI7A 4KO0B 4P73A 3EZ5A 3CD6S 1VIOA 2V68A 2H65B 2CQ3A 1NRKA 3HVRA 1N8RT 3QO9A 5HVFA 3UR0A 4TU9A 3BF4A 4UY8T 2N3OA 1FXDA 1GXLA 4MH8A 1EETA 5C5JA 3OW2R 3H59A 2HPUA 2DGTA 1GNKA 2RDDA 1IM4A 1U1KA 2Y8YA 4GVBA 3LGNA 4K4YA 4ILLA 1SKSA 4CYUA 3QGIA 2PEHA 3THVA 4DL2A 5B7WA 4ZPBA 4X2BA 3CIMA 4JUZA 2VQFF 1OWXA 2XY6A 1RT5A 4PAAA 3G6VA 4CLFA 1SKUB 3C46A 2KVQE 5JJBA 4DR7J 4JI8J 5HBMA 1R8PA 3Q24A 1X0PA 2XYHB 3LO3A 1K1SA 1HFEL 3TJ9A 1MG7A 5HQLA 1QY7A 4MAKA 2WOMB 5HN0A 3OL8A 2DY9A 1TKXA 1JLBB 1FERA 3WHIA 2VJVA 4M5IA 5JVHQ 3LP1A 1MLAA 1S97A 2E5LF 4KGMA 4ZPAA 4CDIA 2V69A 1X7VA 4J9VA 4NL5A 2WVFA 4AXJA 3MMBB 3KFWX 3A8JA 4ILRA 1S48A 2DEIA 2F8MA 4WFXA 3PRBA 4LRFA 2Y3YA 3AB4B 5HATA 2YWWA 2FHOB 5KG5A 2J0WA 3QATA 1Q82T 4JV5J 3GYGA 5HK4A 3GZ7A 1X9WA 1NHUA 2FJDB 2XEXA 4ZCKA 1RT6A 2IRYA 2VJUA 1S1VB 3M8PB 1FRXA 1WI6A 4RX6A 3G96A 1R7IA 5AJ3J 3QT7A 4B3SF 3P45B 1F3FA 2LEAA 5D4OA 3MUMP 3C15B 4NLXA 4PQUB 4OX9F 2GC8A 1DLOA 4GRSA 4OZJA 2FLLA 3EVWA 2BX6A 4DFMA 4KPCA 1LWCB 1IBLF 3QRPA 3BYRA 2AQ4A 6FD1A 2RS2A 4X4QA 3CPWR 1KFDA 3JQKA 2JLFA 5B0EA 3DGVA 3GIIA 3IR7B 3DYAB 5IT9Y 1VQPS 1W7WA 4RNNA 1RB0A 4DV7F 2EC0A 2IJRA 1KC8T 4H4KC 4OZ1A 3PW2A 1JXEA 2MDAA 3PG9A 3I56S 4A47A 3LPYA 3HKWA 2C2KB 1UVMA 2MY8A 2XMTA 1CJKB 1ZTWA 2ADCA 2GVDA 3DRSB 4EBCA 5KOXA 5FIIA 4YDDB 2B6AA 1VQOS 2YVSA 3GLJA 3CCLS 1NJWA 4J9RA 1UWAA 2OFHX 2HHVA 3CCWA 3BO4A 2CIMA 4JV0A 5J2PB 2CQDA 4DUYF 3I5BA 2R8GA 2HMIA 4Y6IA 2EC2A 1TV6A 1IKYA 2UUAJ 3SXLA 3UN3A 4TXSA 1TKZB 1HNWJ 3PRVA 1ITPA 2U2FA 1HI0P 2KHCA 2YKPA 3BN7A 2GA7A 3V81B 3GB0A 1FWPA 2QV6A 2LEPA 4FNIA 5L38A 4CT8A 2UVWA 3SIPB 2QSFA 1S0VA 4DQQA 4CLSA 2CJAA 5HLFB 4FBUA 4LSNA 2CVEA 1F2HA 1FWKA 3MI7X 2XS2A 2MQMA 2JLGA 1JJ2R 1MWYA 2OP5A 2F4FA 5D15A 2C3OA 2W4DA 2YX4A 4FVCA 1YJVA 1KQKA 3HK2A 2QLWA 1M5KC 4KGZB 3N79A 2H5EA 2XTJP 1HWKA 2QA4S 4NCAA 3FBEA 4UF4A 5T7LB 5JMNA 4YN3B 4I68A 2DYAA 4NLYA 2OPRB 2A2CA 4OHZA 2IMOA 3K59A 3H40A 1S1UA 3B54A 1PJ5A 1Y00A 4UOHA 2F5GA 2Y8WA 3LPEA 4PWUA 1KN6A 3T9NA 2ZUGA 3FZ2A 4OHWA 4USMA 1M0SA 3I5AA 4JP8A 3CO9A 4TQSA 2R7TA 2UVVA 4A8SA 3QWUA 4KGXB 3JS9A 3GJQB 3T1HF 4X4VA 1UTAA 4DUTA 1X4AA 4ZPWR 3CEDA 3TW0A 1IR0A 3LANA 1NDLA 1REVA 2DO4A 2XYPB 3OR1A 3SCKE 4HHUA 4DR4F 4H4MB 4CQ1A 5HP1B 4JI0J 1HNZF 2ZC3A 4V19J 3BKTA 3CJSA 3ENAA 2X1FA 1NK6A 5LOQA 3G2XA 1H0HB 4B9VA 1OMSA 4ZN1A 2YXLA 1LW2A 1S6OA 3JSBA 5DZ6A 1QDUB 2R8HA 4NXNF 2J7KA 3FGVA 2E1AA 4OI6A 5D78A 1E6YB 2VHGA 3KK3A 1R89A 3FUYA 1CQMA 1NEEA 1M1HA 1VC0A 3C14B 5L9NA 3KMSA 1VBYA 3DRRA 1GH8A 3R5JB 2W9BA 1L3TA 3A3OB 4OYOA 2N7CA 3V6DA 1RAGB 4NLUA 3W2VB 2CQ0A 2L08A 2WSCC 2AJ0A 2E29A 4YP3A 2A3JA 2LQ9A 3DXSX 2XSFA 5KFNA 2XLIA 2VKZG 1SJ1A 2DH9A 2UP1A 4B3RF 2BE7D 2CA9A 5DQHA 2VQEF 1JLQB 1TU0B 2OSQA 3JTNA 2FJBB 1VQSA 1AA1B 5BYSA 2JRSA 1I94J 5A6WA 2A0FB 3HSDA 1UW4A 2N82B 5C24B 1L3SA 2KZMA 2G2OA 3UCZP 5C25A 4HH0A 2IM2A 4KH1B 2L9DA 3JSYA 1LWFA 1S9EB 2OPQA 2LQ8A 2FGCA 4IDKB 4D3HA 3X1LB 1RT3A 4WIQA 2XB2D 1TP7A 1RWKB 3I87A 4JV2A 2UXBF 4B9TA 1TVRB 4JI1F 3VTIA 4F0HA 2KN4A 4RBUA 2JEJA 4F8RA 4ERDA 1OIAA 1ZPVA 2XZDB 3PIPQ 2KRBA 4RLEA 3FSYA 2RD5C 3D0GE 3ENVA 5C42B 4WPAA 3SCIE 5KFXA 1MN7A 4FKXA 2VU5A 3HI9A 2YQ0A 5B0CA 2HRTA 1MU2A 5EN1A 4M5GA 3FCWA 4YB6A 2EG2A 3RAQA 3DLGB 1RK8A 1N34F 2E9ZA 3C6UA 3CCZA 3LGHA 4AQYJ 3K5LA 4MIWA 5KFTA 2WCXA 1TAUA 2NXJA 2VA2A 1YWXA 5DDOC 4RU9A 4OIXA 4MKVA 2CQCA 1X5OA 1Q4RA 1S4FA 5K9FA 1EZZB 1DQ9A 2IRUA 1YRTA 3QWPA 4F3MA 2IYGA 5EWEA 3PFOA 1LOUA 5KFGA 4TKTA 1E6VA 1WELA 3MPVA 1OSCA 1GEHA 1S6PA 3ETOA 4I69A 4OJ3A 3RW7A 2XQCA 2K7KA 4UOFA 2AIRB 2B9XA 4ZA1A 3RR7A 4P10A 3CSKA 3G87A 4PWWA 4DV6F 2BANB 2ILZA 5I3QA 1NJZA 1KTVA 5FLXU 2J7UA 3LP0B 2Z2LA 3W5ZA 1M5PC 1VJWA 2R8KA 3OXLA 3P96A 4C8MA 3R5AA 3IWXA 1JLEA 1SC3B 1O51A 3QJJA 1XEZA 4WFAQ 2BQUA 2RKIB 2IDLA 2ZHAA 2C1EB 1PCAA 3NS5A 4G3IA 2CQ4A 3PM9A 4C48A 5IQQA 5G0RB 3NGDA 2GIFA 5DG8A 4ANDA 5DM7Q 4JI3F 1B0VA 4GKJF 1EKSA 2VD3A 4C2MA 4DSJA 1IXKA 4ELVA 3A4TA 1IN0A 4DX6A 2HHHF 4B3MJ 2OTJS 2V8DA 4WE1B 1CQNA 4OYXA 4LBPA 4U6PA 4Y0FA 2QFIA 4QR2A 1U0HB 1QAIA 2J9DE 1X4FA 3AY0A 4JI5F 2FVCA 3G71S 2AEMA 3MCNA 1VK3A 2ZJPQ 4H54A 3CDUA 4KHPJ 3BKFA 2IY5B 3DLJA 1RAIB 1F60B 2C28A 1RTHB 1U25A 2PT0A 3PIOQ 1VLYA 2GNKA 3CCMS 2E1CA 3JYTB 2EK1A 2BQRA 1FCAA 3OUYB 1HBOB 1BD6A 4NI2B 4IO9Q 2MQQA 3UCGA 4F2RA 2V2ZA 4R8UA 4B9LA 1KTQA 4DL5A 2LDYA 1H7XA 1TL7A 4C0HA 1PILA 4F26A 4HHJA 2ZFHA 1LK7A 1CS4A 2GVZB 2WB1D 5EWFA 5IFMA 3O8WA 5GVQA 1MSWD 2AZ1A 1X5PA 2MEWA 4NCGB 3DFEA 1F9HA 3M2UA 4IYQA 3CJQA 2G0IA 2QMUB 1K47A 4K4VA 3IWLA 4HHHA 2HGMA 5J2NA 3U1NA 3NXZA 3MEGA 1OY8A 4I7FB 2FVPA 5L1IA 4C9DA 4WYWA 2YNIA 2ZH4A 4RU2A 1V3ZA 4FPIA 2QL9B 3BH6B 3MM6A 1TKTB 1YDLA 1IUJA 4CO3A 3IMQJ 5LMNF 1LWXA 2MKCA 2XHCA 4M5DA 3HO1A 4YB1P 4KB7A 3DMJA 4LRBA 1TFYA 4WZMA 1S59A 2FHKA 1CEZA 4QR1A 1I3OB 3KLGB 5KT5A 4K4SA 2R42A 4WU2A 3MOJB 2YNHA 1DQAA 3I82A 3I31A 5CYMA 1P9QC 2QA2A 3HFVA 4DV4F 2G2YA 4WCEQ 3CC4S 3W2WB 4DLEA 2PN6A 3E01B 4OJ1A 5HMZA 5CZVA 3RBZA 2LXIA 2NR0A 3G9CA 1NK7A 4NCBA 1IJFB 5IWAF 5L8RC 1ACMB 2DPIA 3I4PA 2R7RA 4NE9C 3KLHA 3CDWA 1B99A 5A2QY 4NA1A 3EWGA 4DQRA 4BLGA 5ETSA 4EZ9A 1KVIA 2BE9B 1AFIA 2YNFA 3ET6B 1RAHB 5KFSA 4DPXA 1AROP 1URRA 1ZM4A 2BW7A 3OVSA 4QW8A 1KNZA 2G4BA 1WOPA 3HXMA 3ZNUA 3SSSA 1QSSA 2ZBPA 3MM5A 2NREA 1ZM3A 3CWJA 3QLHB 1NUEA 1H6KX 2D9OA 3RJMB 2ZDOA 1HPZA 1J2VA 1HI8A 1VQLS 3NGRA 2QN6B 1QTNB 1KWMA 3EPIA 3DHWC 4A8MP 5K8MA 3ZZ0A 4DS4A 5ETNA 2QRRA 1HNIB 2X1AA 2COLA 4CRJA 3DOLB 2MQNA 4LQ3A 3P49B 4ZPCA 4HTJA 1RHUB 5KFZA 4C97A 2OGUA 4CTAB 4IFYB 3GJSB 3C6TB 2EG1A 2A18A 1FKPA 4WFBQ 2V63A 1V3RA 3B78A 1GX5A 4Q8EA 3CDAA 4B3TJ 2MJUA 3AFGA 3HHDA 4L74A 4OHXA 3MM9A 1RYSA 4PG6A 1RE1B 4PG5A 3TR5A 2CPXA 3VAGA 3RZAA 4QIEA 3BSOA 3MR7A 3M8QA 5KFMA 1IVZA 4B9NA 3FMWA 4PG7A 4Y34A 3OTBA 4NMLA 1IWGA 1PG5B 4YS2A 3OLBA 4O3NA 4X4UA 1MMLA 3MR5A 4AL5A 2V8VA 3GYNA 3GQCA 3NNCA 5I42A 1QAYA 5CA5A 4JYAF 1HNVB 4DG1A 1U8SA 1VRTA 4KV8B 1IKVA 2A2DA 1BGXT 3OSNA 4NLGA 5SZTA 2DJWA 4WJBA 4NYPA 3RRKA 2JEFA 3M32A 1KP6A 2B4VA 2YNGB 2ZWOA 2GZOA 3DLKB 5E0OA 4FXWA 4DV3F 4QCLA 3DM2A 4DOZA 2IJFA 5KFHA 1HWJA 1T3NA 4OI2A 2KTQA 2VFSA 1X9MA 1XK8A 7FD1A 4Q2LA 2HEKA 1XMBA 1PBAA 3CTRA 4OJGA 1N36J 1WC0A 2Z58B 4TLQA 1Q8IA 1ICEB 3DOKB 3P5TL 2IC3B 2HLTA 1X0FA 1KLMB 4B9SA 5E2QA 2XM3A 2W4PA 4RWWA 2ZOGA 3MEDB 4IUFA 2W4CA 2DRBA 3R2DJ 4ILMA 2PDAA 4NASA 1M5VC 3QAUA 1NKBA 2YH1A 1MWQA 2HK2A 3U1LA 3BGRA 3TZYA 2W7OA 1FI4A 4YQWA 2MSTA 5JVGQ 4ZIVA 2DNHA 1TUVA 1SC6A 3PNIA 2E7WA 1BQNB 2AKWB 2J6TA 4A8XA 3ILJA 2BJ1A 4ZIWA 5A6PA 3IG1B 1HHTP 5LL6d 3KG4A 4O3OA 1SL2A 2DGOA 3JQMA 1HLWA 2VPWB 4EBDA 1YJRA 3D66A 2MKJA 3J80Y 4EI2A 1BQXA 1U24A 1H2TZ 2ZUAA 4LR8A 3N6NA 4V1Ak 1M5HA 4KRWA 5DM6Q 1WG1A 1TTHB 3I0SA 3NCRA 4IFVA 2C3YA 4LF6J 4K2JA 1PAUB 1T11A 1S7IA 3TVZA 2QJ3A 4RNHA 2RRAA 1GT8A 5LXYA 1PIEA 1RHQB 3BREA 4NX9A 4ZJLA 2ZJRQ 2Y9HA 1V3SA 1U8WA 1ZYQA 1TELA 2QL5B 3DRYA 3MR2A 1REGX 2DGSA 4KGVB 3FCVA 1HMVB 2AEFA 3ZZTA 3TJAA 3KG1A 1IKWA 4XK8C 4J9PA 3GE9A 4DXLA 1FA0A 1X4BA 4GVBB 4ELTA 3QT5A 5FDLA 4CO2A 3OFEA 4OYWA 2HNZB 1RWNB 2Z2ZA 2KXNB 2B9WA 4F04B 2R7VA 2DNMA 3KLEA 4N8OA 3A3PB 3GCWP 3IBWA 4X62J 4U8YA 2I2YA 4Q0BB 1F2GA 1U6FA 2NQPA 2E7VA 3RB4A 1RT5B 4O4RA 3EZOA 1RU1A 2CJBA 1YBTA 3OR2A 4OJHA 1AB8A 3MEKA 1XMOJ 3PV8A 3KTQA 3P6YC 5HBMB 1ZAXA 3PX0A 2UXDF 3EZUA 1N32J 2YBVA 1VS3A 5F0WA 3AJDA 5D0HA 3DI6A 1GFWB 1RT4A 3KJQB 4QIGA 1WKJA 4J5OA 1TKXB 3MMJA 4N5SA 2JVOA 2CKWA 2KJVA 1KQFB 2LEBA 4K4UA 2QYGA 1LNQA 1YJUA 1NDCA 3ZO7A 3R6GB 2IYIA 2LMIA 4ZCLA 2F63A 1S99A 4NEZA 2ZZMA 1JNZB 3MAAA 3UD4P 2WVCA 2CVIA 4A46A 4WKYA 4CZCA 1LV5A 2JNJA 1P27B 3T19A 4TYAA 2NPFA 4Q44A 1P6TA 4DMZA 5CYJA 1NH8A 1U09A 4X4SA 1R8HA 2MHNA 4X4NA 2FQQB 4YHHF 4IR9A 3UVJA 3KJVB 2HQIA 1WSVA 3OPKA 3D0HE 2EBGA 2IFXA 1KKHA 3A8KA 4OYIA 1KQGB 4NWBA 2ZNZA 4USIA 4W92B 2B9EA 1RT6B 4YY3J 2JDJA 2BRKA 1OYEA 4X4PA 2VPYB 5HL7Q 2GJIA 1V5VA 1YG0A 4C8LA 2WB4A 3HLUA 2XYGB 3H5SA 4DSFA 3W5YA 3GV7B 2XGPA 1RI7A 2V9KA 2ZH5A 3WZ0A 4ID5B 2CAJA 3QFWA 4KIAA 2C2MB 4DFKA 1DLOB 4B02A 3Q23A 1NJXA 2BJDA 4Q2MA 1AZSA 1D09B 1SKWA 2MZRA 3JQJA 1TL4A 2VIHA 3UW1A 3HJVA 2D41A 4J9LA 4HKQA 4M5HA 4DSEA 4ES2A 2ZBQA 4Y2KA 3A3NB 3M2RA 2D3OR 5IT0A 1R43A 1QJHA 3ZNJ1 3EICA 1D9DA 3DKDA 1RACB 1XMQF 1F5BA 2R7UA 4LFAJ 3KWMA 3IA0A 1OQ3A 4LF4J 4MJKA 2BM1A 5A8WA 3IN5A 1RGVA 2B6AB 2FC9A 3NMAA 3POTA 3HVTB 1P8GA 3TA1A 1UVIA 4F4ZA 1IJEB 5F3ZA 1IR2A 4DR5J 4K59A 4P9SA 2HHTA 5D6GA 4WBFA 1YBAA 2GX8A 3CULA 1TV6B 4OZ5A 3K2YA 2BKPA 4B3OA 3ZZRA 3TQEA 1Y3JA 3HVWA 2ZH8A 2P6SA 3PYFA 4C0BA 1BMQB 4ECUA 1RWVB 1B64A 4WP8A 4WXOA 2XHWA 5JUMA 3UFCX 1WUUA 1ZAVA 1IM6A 3UDEA 4FS2A 4RW4A 1C1BA 3H25A 3V2UC 4ECWA 2MZJA 2FTRA 5LMUJ 4LSNB 1UZDA 2OPSB 5M2PA 4U7UK 4C4WA 1QAJA 2BV3A 4O44A 2VG7A 1H74A 5DGBA 3CD7A 3HT0A 3Q8RB 4W98A 3KKFA 3CC7S 3PO5A 4C8OA 4ZPVR 1AFJA 3SFGA 3EGNA 4K4TA 1HBNA 2RU3A 4X66F 5KTQA 2WVBA 1W25A 4DN9A 1UVNA 2YX1A 3OTDA 2MZ1A 2KYXA 4DWIA 3BH7B 1NMEB 2V2VA 2J0SD 1NZ8A 1HR0F 2KKHA 1PO6A 2RQKA 2YKMA 3BDEA 4NRTA 5EX3A 2CPZA 3ZTPA 4ECQA 4X64F 1S1UB 4L73A 2QSWA 1KR4A 2VASA 1KDNA 3DRXA 3FMBA 2BMBA 2I6WA 5KFJA 3F56A 1U0SA 4ICLA 3GILA 5G4DA 3SQGA 3CCES 2XMAA 1X31C 2KHDA 2WZ1A 4DR3F 3OHBA 3M2VA 3ITHA 4PWDA 2VZ9A 3A12A 1T9UA 4OYPA 5KFBA 3FBFA 3L3CA 1REVB 4EBEA 5KFFA 2R8IA 2DKOB 5KFUA 2NSBA 3PJ9A 3MD3A 3VV2B 1PSDA 4IRCA 1S6QB 5GAGI 1HYSB 5KFQA 2H3EB 5IT9U 2FZCB 4DPTA 5B0DA 4WF9Q 2L9NA 3D1HA 1VRUB 1LW2B 1UL3A 2YWFA 3Q2SC 4KT0C 1LK5A 4CLUA 2OEJA 1VC6A 2C2NA 3V4IA 1TUWA 3NNHA 4LRDA 2FY8A 2KT2A 1RP5A 4RL1A 2ZH7A 3NNAA 3OLAA 4NZ7A 1S1XB 3TAQA 3KHRA 1R8AA 1N6QA 2R7OA 3C16A 3ILLA 3GIKA 1IKXA 3OTEA 3Q83A 2ZBRA 4TU7A 3PW5A 3DRRB 1FKAF 4NLRA 3D67A 2HKEA 2OIHA 5D4PA 2H9ZA 3V6DB 3UN2A 4LF8J 2PFFB 4CH7A 4M63A 1D0EA 4HI1A 2BW2A 4M95A 1FD2A 4DU8A 3R6LB 3IS9A 3R7SB 4QZVB 1WHVA 1VRQC 1X4CA 2P9GA 4H4KA 1IBMJ 3VGSA 4IQXA 2CZ4A 1PYTA 1WSRA 2AJQA 2B5JA 1YSJA 5IC4B 4P2MA 4UUWA 2V8GA 2MZSA 4DL0C 3NCPA 3CJTA 1DRZA 1TR0A 1JLCB 1S9GB 8RUCA 2NZ4A 3BKUA 1YJ9S 2CQHA 3BGOP 2FDNA 2A6OA 5C25B 4QIFA 2HBZB 4PABA 5F41A 1LWFB 3DU5A 4N77A 3C66A 3T41A 2OPQB 2CPDA 5AXNA 3OL9A 3O2IA 4C8NA 2RRNA 5A76A 1RT3B 3FEZA 4WTOB 3K89A 3D6TB 3ZZZA 3SDEA 2E44A 4WK1A 3GYXB 3PRDA 1GAOA 4M5KA 3QQCD 5CQGA 1GMWD 2W2NP 5K20B 1SH2A 5A8KA 3MDFA 2W2QP 1HKAA 1WF1A 4IH5A 4DU7A 3EXYA 4LF7F 4KQZA 1FRJA 1WHYA 1AUSL 3NP5A 1S6UA 1MU2B 1SBRA 2HS0A 1YHQS 2P8IA 2WONA 2Z30B 2FGOA 2O1PA 4NOHA 2KO1A 2HVEA 5L1KA 4DR1F 2LCWA 4DV5F 4FNHA 2ZNYA 2AX0A 4C3LA 4ZVQB 1KS2A 3M4XA 3TO8A 2MMYA 4RUAA 2R7WA 1XC9A 4IH7A 2M0GB 2WW4A 3BGLA 4ANCA 2UXCF 2HS4A 4DV0J 1EQMA 1Y4ZB 2HBYB 3BR8A 4ZP7A 3TA0A 1RTDA 3ULHA 1X60A 2WW8A 4URSA 1E6VB 2APOA 2W9CB 4OZNA 1VBZA 1S6PB 4QYZJ 2EW9A 2HG4A 1EKRA 5AXLA 5LT5A 2MKIA 1CJTA 2V8HA 2B43A 4DPOA 3FFIA 4B9UA 2UUCJ 4FYDA 1RWUA 3KLFA 3DDNA 2F4VF 2L3MA 3B4MA 1C0TB 3ZZYA 1U6BA 2EFOA 3CJKB 1UETA 5M2RA 4DSIA 1ELOA 4MYTA 4K5SA 3QJLA 1DAXA 2ZH3A 2H1YA 2DGXA 3T6BA 1T05B 5D8HB 1N33J 4NLVA 4RUBA 4V19X 1NZAA 3SV3A 3CDBA 4OZ3A 3R7BB 2E5JA 3R5BA 4A8QA 1JNRB 4LVNP 4OYZA 1F3VA 2LU2A 2ZM6J 1C4CA 4DX8H 4KFBA 2Y0SD 5KFKA 1NK4A 1VQ6S 3M8RA 2VG5A 3ZC4A 1WKLA 4K4WA 1Q86T 4Q45A 3BO3A 2V94A 1M1GA 2DXFA 2GGPA 4Q8FA 3T5LA 4BC9A 1OO0B 4AL7A 3ZFVA 3IBCB 2HNDA 1GMWA 1WTFA 3ELHA 1S57A 1UEVA 1FKOA 2CFXA 1ZH5A 2R7SA 4UT4A 3KLVA 1NDPA 2HFUA 2DT9A 4MK7A 2VQFJ 1CULA 1SJ3P 1WEXA 1ZPWX 5IM0A 5A8RB 4ED4A 4YR3A 5KOWA 1TL7B 3BV8A 2N4CA 1YITS 1ZZFA 2DRAA 3EXCX 2Z8QA 3J81j 2D74B 4KO0A 4U67Q 2E5HA 4JI4F 1R0BG 2VV5A 2J7WA 2CQIA 4KJIA 3KK2B 3HD1A 1HARA 1F9EB 1U2RA 3M6VA 3KNGA 2HK3A 2YWGA 1Q78A 4WFZA 2KVIA 4QR0A 1N88A 4C98A 2E5LJ 2HGNA 2YNIB 2D1CA 1VR6A 1D8ZA 2ZBIA 4HDHA 2AU0A 4PG4A 2YWHA 2DXDA 4JI7F 5E3PA 3TA2A 3CVKA 3MM8B 1CC8A 2HWHA 5B0BA 2E9RX 3W65A 4M5DB 2HHWA 1ULRA 4ZK7M 2AW0A 2R2TA 3MMCB 5I4MA 1JLFB 1XIQA 1DFDA 3PVXA 1Q8LA 1IBKF 1M1KT 4ANEA 1K44A 2YNHB 4XO0A 3CD0A 5CYMB 1T7PA 3H2UB 4X4OA 2PSZA 3HPOA 4DF8A 1NSPA 4FKYA 2RNEA 2EFVA 1BWEA 3KHHA 4B3SJ 5J2QA 1HHQA 2PE8A 3JB9k 1HBUA 2W25A 1UVJA 2R8JA 3TVKA 4MFBA 3PW7A 4LF2A 4F50A 3Q8SB 3HDSA 1IBLJ 1U48A 3FCHA 1VK8A 3AA9A 3KLHB 3W1YC 4EGLA 2EXUA 2WSFC 5KG3A 5CD4A 1IBCB 3DOMA 3W64A 4X65J 2MXYA 3CJ0A 3IXQA 3MMBA 4P74A 1N48A 1SI9A 4DV7J 4ED5A 2XZWA 4CLWA 2YNFB 4EFAC 1OY9A 2BXJA 3NRBA 1R3NA 2DHSA 1VISA 5J2MA 5KFLA 2MQPA 3G4SS 2P5VA 2KB2A 1LWEB 3U1MA 1F5CA 3G6YA 2E9TA 5FJ4A 3GJRB 1S1VA 3M8PA 3MPWA 3HHKA 3NS6A 4DUYJ 3V6KA 4QYZK 1T9TA 2UUTA 5M2UA 2AMCB 3N0VA 3QAEA 1DY3A 5HQMA 4PQUA 3PYEA 5H9FJ 2IJNA 5KG4A 5DDQC 1VQ5S 1R31A 2CYYA 4EWTA 1U02A 2J9DA 2KG1A 1YVFA 1U4BA 3NLCA 2PMHA 3PYDA 2RDIA 4AXIA 1FKPB 3DYAA 3AXKA 2BKOA 2I9SA 1U2FA 3GFYA 2QEXS 3MCMA 2CPYA 3DNCA 1FJCA 2QC3A 1VQ8S 4JV1A 3MM9B 5DLFA 1CJKA 1Q8KA 2LQ5A 2P2CB 2N4DA 5KFOA 5A0YA 3C2PA 1KHWA 3G82A 3M8QB 5LSRA 2DNOA 4DJBA 1N0UA 2N3LA 1PC5A 3H8YA 5J2PA 1EARA 1WNEA 4OZ2A 3KUGA 2IBOA 4YR2A 2DR6A 2I5JA 4Y65A 4G1PA 2IHR1 4ECSA 4LR9A 4ID8A 4F02A 1GK8A 3GFXA 3QGPA 3GFZA 1TKZA 2JEIA 5AXMA 2PC6A 1LXJA 1RCXB 4FF1A 1B0PA 3KXDA 1TK8A 2CQGA 2CNKB 4USKA 1Q95G 2DNRA 5I42B 1JJ4A 2DNPA 3V81A 3T1HJ 3BM7A 4DG1B 1NB7A 5CYQA 4F4AA 2L9WA 1HI1A 5HLFA 1IKVB 3GSDA 3D1QA 5E7OB 1JB0C 4DR4J 3WC2A 1FHTA 4AUKA 1ZAWA 1HNZJ 2VA3A 1FFWB 4ZJQA 5A2QU 5IZHA 3H42A 3TUPA 5BJRA 1P1TA 4LBHA 3DM2B 4QWCA 4DDFA 1WHWA 1WI8A 4O0IA 1VLOA 2XC9A 4FPRA 2BOAA 3WC0A 4NXNJ 1T8EA 2MB0B 1RT1B 5L1LA 4G1IA 1K73T 5HANA 3WIVA 3I9V9 4OV6A 2KU7A 1Y11A 4USHA 6AT1B 4IH6A 2DNYA 4GC6A 3BDPA 2FYXA 4IKAA 3W61A 1EQ0A 1MWZA 3MMAA 2MY7A 3R5CA 2BOPA 1B70B 5I3UB 5CCLA 2QT7A 3T5KA 1TL3A 5E3QA 3B82A 4W4MA 2V6AA 2CQ1A 3QZ8A 4U96A 3IRXA 2B9YA 1FJ7A 5BR8F 4JI6F 4B3RJ 2VG6A 2ZE2B 3VAJA 4H4MA 4CLTA 5U47A 3BJYA 5HP1A 2VPZB 3GSIA 2VQEJ 5EWGA 2W2MP 3ICLA 3CJ3A 3NBPB 2GMLA 3MPYA 2VBWA 3FJ2A 1UP1A 2KT3A 1C1CB 3PTWA 4ECTA 3T5JA 2UV8G 1NH7A 4YEAA 4ZP9A 3TZZA 3J7YI 2MZQA 3G8QA 4C11B 2DNZA 3NCQA 1OJ4A 5K5MA 3KLIA 5E41A 4AL6A 4O3PA 5DG7A 4LSLA 1G3OA 3EM1A 3I0SB 4RW9B 1E6YA 1ZS6A 1QD1A 1WEYA 3MEEB 3Q22A 5HSPA 4QWDA 3TARA 2ZEJA 3KMQA 3PHEA 3KYLA 3BQ2A 4U8VA 3DGPA 2CDQA 4FP9A 2UXBJ 4DZDA 2Q66A 4RNMA 4JI1J 2ERRA 1TMMA 5EDWA 4KH0B 1MNEA 3QNWB 1S1TB 4USVA 1G4CA 3WDOA 2KM8B 3VAKA 1F0XA 1A6LA 2HGLA 3VAHA 1NK0A 4UZCA 1IKWB 4F67A 1H3DA 1JLQA 4LF1A 2V0NA 1SH0A 1N34J 3KLEB 1KEKA 5IC6B 4KBIA 5GMEA 2PGCA 4DR6F 5H9FK 2W2PP 4OMFG 2CZ9A 2PA3A 4PZVA 2OH2A 1S9EA 3OR2B 1OPIA 2RRBA 2BBEA 1UA0A 5LSLA 1YGYA 4XTTA 4ES1A 2ZWPA 3VF0B 1GTHA 4I1TA 2PIIA 2JJ4D 1DTTA 4USJC 1RT4B 5HMYA 4HI2A 3J7A1 5LJ5Y 4ZPDA 2WVEA 4A8KA 4DSLA 1TUGB 1TVRA 5SUHA 1Y5IB 4KY3A 3R1LA 3R27A 1VGYA 4DV6J 2XCPA 2J5AA 4DL4A 2HLUA 3IGNA 2UVUA 4WIIA 2NPIA 1NHKL 2PD1A 2V8PA 1H73A 2BABA 3DN9A 3CMAS 4KC5A 3EUNA 2NXCA 3LTOA 1H2UX 4DCPB 1HBMB 1S1WA 3HD2A 3L9ZA 4KAIA 3RGIA 3DLGA 2NYHA 4QPXA 4I2PB 2ZDPA 3AHPA 1KVJA 1VQNS 3HF5A 3UVJB 3L7PA 2LA6A 3KK1A 4LFCF 3VGTA 1ZZNA 4GKJJ 5KFEA 4HL9A 3FBBA 2HHHJ 2MYFA 3J80U 1FRHA 3R8YA 4M5JA 3RB6A 1O5JA 2NSCA 4FYXB 3CJ4A 3D9BA 5HJYA 2CPIA 2PEBA 1WOOA 4JI5J 1R0AA 2HAFA 4ECRA 1YZ7A 4UW2A 4QIVA 2LDIA 2F40A 4IG0A 2JC1A 4UUXA 2MTLA 1Y5LB 3KJNB 3UI3A 3HCXA 2NXNA 2QLFB 5ETTA 2BANA 1I1GA 4ZLNA 3UDVA 3TAMA 4AT1B 4K2XA 2M8DB 1PKUA 1N5VA 2WTFA 1L5UA 4RJVA 4CT9A 3M2RB 1S4EA 3R1HA 2J6UA 4CNYA 2UU9J 3VALA 2XMUA 3CE8A 3TZWA 5KFWA 2J6SA 3KHLA 2XWYA 3J7Z5 2OMOA 3K5PA 5F9NA 2DY1A 5G0RA 2AWZA 4PYAA 5ETLA 4LQ9A 1YJWS 2KL8A 3T1YF 4D3GA 4XPCA 3M8WA 1H98A 1QUVA 3POTB 1FXRA 1GXTA 1NBEB 3H4DA 4OZLA 5KFVA 1WTBA 1U1NA 4WE1A 1FK9A 2BA9A 3FSXA 3BQ0A 4ZCIA 2CNLB 4HDGA 1WC3A 4YR0A 4H4OA 1RAJA 4B3OB 3I55S 3SSQA 3LAMA 3RW6A 4ZN3A 2IPOB 1YX2A 3UD3P 4TNOA 4F7VA 4ECZA 2KXHA 1SIZA 4AD6A 3PKYA 1N56A 5E3RA 1HIYA 5LMNJ 4ED3A 3IBFB 1C1BB 3OT9A 5KG6A 4CH1A 2K1RA 2GQ2A 3M1VA 3MCOA 1B7YB 1NK8A 5B08A 5J1PA 2O3DA 2FJAB 4CO5A 5KFAA 3BR9A 4PEOA 3VVUA 2E7XA 3B8HA 3RRGA 1AXQA 1KQSR 1N4LA 3H98A 1VQMS 4MT1A 1HBNB 1RKIA 2GVZA 2HHQA 2B4PA 1VQ9S 4DV4J 2PA8D 2YWEA 3N9UC 3VVTA 2NCKL 3TWZA 4LF9F 2QYCA 5B0FA 1KOOA 2AX1A 4NCGA 1UEUA 1T03A 1JXLA 2DNQA 4CO0A 2ADBA 2HWIA 3ISND 1RUSA 3BSAA 2YKMB 3BSNA 4G65A 1RABB 2YPZA 2W2OP 2HBRB 2R2SA 1R6VA 5IWAJ 3UO0A 4J90A 3VQTA 1HQEA 4DX5A 4I7FA 1XNRF 3K17A 3JSMB 4F2SA 4LJMA 4DBQA 3W63A 4PG8A 3MUVP 3W9JA 3HSJA 1QAXA 1NAQA 1U1MA 2EK6A 1VI7A 3L7UA 4KKOB 4DR2F 2KRRA 3L4BC 1APSA 1F1BB 3ITHB 2FC8A 2RHSB 4NLSA 1I6JA 3FZBA 3MF5A 1KONA 2HVHA 4FDFA 1FO1A 2ZJQQ 4ECVA 1JLGA 5GAGU 2P9CA 1JKHA 1JX4A 1SH3A 1CJUB 4CLYA 1Y3KA 5L1JA 4QWAA 4F25A 3GTYX 2FZGB 3MR6A 3W3SA 1WWHA 2AD9A 2QMWA 1LEOA 1GQEA 2RVJA 4CI0B 1KHVA 2C22A 3M6XA 2LXUA 4OX6A 1NU4A 4MMOA 3M30A 2BE2A 2VONA 3OFHA 4O3QA 1N6QB 2DTJA 3LA0A 4R5PB 3C16B 1WHXA 3IO1A 1IKXB 1P1LA 4RNFA 2DVIA 2Q43A 2QGFB 2C3MA 3J7ZT 4Z2XA 2LFVA 3Q0AA 4U9RA 3ET6A 1RWOB 1T94A 3IC1A 2P9EA 4MKBA 3MECA 3JXOA 1Y7PA 3DU6A 1NSKL 4HACA 2F9JA 1OQ6A 3SZ2A 2B5JB 3NOCA 2JLEA 4ZVHA 4GKKF 4X84A 1SKRA 1NM2A 4Q7AA 2XI2A 3FRYA 2IM1A 1J5EF 2G0JA 1UVKA 5KFIA 3QLHA 1FVQA 1Q16B 5B09A 4MTPA 2R7QA 5DG9A 1RWXB 4OZ0A 1RYRA 4A8WA 3ISZA 1WEZA 1EP4A 2ASYA 1UKUA 1HNIA 5KFDA 3OTCA 4PXDA 4JYAJ 3Q86A 2Y1IA 2WHOA 4RW7A 2GMHA 5K14A 4CTAA 1NSQA 4IFYA 3C6TA 4WFYA 4C7QA 2U1AA 4F4YA 3OTOF 2KM8C 2NXUA 3NEKA 5ETMA 2OELA 2KT5A 5J1EA 3SDEB 2DXEA 3FKBA 3FQLA 2EKYA 8AT1B 3Q8QB 1KVKA 1N52B 4LFBF 3NGSA 2GMJA 4DV3J 2ZD1A 1RLCL 1RWMB 1K1QA 2VFVA 3D5MA 4CM0A 5A8KB 5IT4A 3W66A 2DCUB 5F3TA 1DTQA 1ZOTA 1HNXF 3N6MA 2BZ2A 9ATCB 4BCAA 4WYLA 3M8SA 2DHHA 2WONB 2CPEA 2YKQA 3O3LA 4JI2F 4P71A 1PBUA 3QZ7A 4UTGA 3M9NB 2V5HG 1KSPA 4G1QA 5GMKa 3IGVA 5CD4H 1PYOB 2PMWA 2Q6CA 2C2RA 3IR5B 1FFGB 2XNRA 1LXNA 1FEHA 3BBCA 5L46A 1RTJB 4I6AA 1EHWA 1M5SA 3MPUB 2E5GA 2ATCB 2MKYA 2RDJA 4PXEA 1DQ8A 4PPZA 3G8TA 1RXOB 2QIFA 4GVLA 2RH3A 4KV8A 2EWHA 1CJVB 1RTDB 3CCVS 4L3KA 4DX7A 1SJQA 2KJWA 4FYYB 1YTYA 2XMVA 2X1BA 3VHQA 2NS1B 3Q8PB 1WJ9A 2HQDA 2Z56B 5HO4A 2VC0A 1DARA 5EGYA 1CJTB 4WU3A 1FRLA 4CLPA 4FF4A 1NO8A 2J8AA 4YB5A 3HHNB 1NLKL 5FD1A 3KLFB 4L72B 4FYWB 2KZZA 1DBDA 4LF5J 4F36A 2FY1A 2HFVA 2YQ3A 4OLPA 5E33A 2IC3A 2ZOMA 1A0OB 1KLMA 3OV7A 1YJ7A 1NJYA 2M8HA 4K0KF 3MEDA 5GADI 3MM7A 1H2VZ 3QGHA 4MK9A 4NLPA 4GC7A 3HKZD 2ACMA 4QOTA 3O5TB 1QE1B 1XNQF 3E3XA 1JJCB 4RZRA 2AYEA 5F8LA 2Q6BA 4KFBB 1LFPA 3MAQA 2EFNA 9RUBA 5F8HA 2CRLA 2VG5B 2GW8A 3U27A 4J91A 5GAHI 3Q8YA 2UV8A 3UQSA 2AJFE 2BVZA 2ZITA 2DRDA 2CJQA 4NMXA 4DI6A 3D4JA 3MFHA 3PEHA 2QO3A 1B3TA 4MYUA 4EK2A 4O4GA 2GGPB 2XMKA 4FF2A 4ZVFA 2XULA 3UN5A 4ED7A 1D8YA 1FE4A 1KLNA 3AT1B 1J5OB 1FKOB 2OPPA 2IAJA 3P5BP 2VF3A 2UUCF 1NJIT 2M2BA 2QTWA 3IWNC 2MKHA 3MCSA 4ZVSB 3H5YA 3JSRA 2V2KA 1XR7A 5HMWA 1Q0NA 3M8YA 4JB8B 3V6HA 1Z2ZA 2OD4A 1N54B 4A8OA 2VDHA 1R0CB 2YKAA 4MKYA 4M1KA 4DUZF 2UXDJ 2E1MC 1VHIA 2BJ3A 1N5YA 1S72S 4ES3A 3IFEA 4DFJA 1VBXA 3GV5B 2ZM6F 2HAIA 3LP2B 3M6UA 3MHYA 4MIAA 1Q5VA 3CNQP 5D77A 2V4JA 1HMVA 2UUBF 2CWXA 2C2DA 2P6TA 1S76D 3BN4A 1HQUB 2AF6A 2XO7A 2MKKA 4TY8A 4DV2F 2OKQA 2JSXA 4I64A 3WIUA 2QLXA 4ECXA 4NXMF 2JFKA 4YFUA 2HNZA 3CF5Q 1HD0A 4AYBD 1SC4B 2AYMA 1RT7B 4YHHJ 5F8IA 2FVRA 2LU1A 3BSCA 4P52A 3DRPA 4ZVPB 4Q0BA 3HHLB 2M52A 3OL6A 4C3MA 3TEGA 4ZOSA 1FJGF 2HZVA 2DGVA 3TQ1A 3TEHB 1SUQA 1V5IB 3N28A 2Y1RI 1K0VA 3PKMA 3R5DA 1U7LA 2QLJB 2GV1A 2G0CA 5J2QB 1RBAA 3FEXB 2B7CB 1MMDA 2Q1LA 1FDBA 5EX0A 3K0JA 4Z37A 1HBUB 3TZXA 1HW9A 2K3IA 4MFBB 4U7CA 3TUIC 1TL5A 3QMQA 5L9XA 4OHYA 2D7SA 2KXFA 1C0UA 3RRHA 4XDDA 4P2FA 3DOMB 3RG6A 4J9MA 2OHDA 3D6MB 3SSRA 2QLBB 4CH0S 4PXBA 3DLLQ 2XY5A 1XERA 4USUA 3SQOP 4LIRA 2HRUA 1XMQJ 4WWSA 4ZVRB 1T95A 3KJVA 2GAHC 3N5FA 4BHQA 1N0VC 5J2MB 4XPEA 4C8YA 2KFZA 1FWLA 4NZ6A 4C6AA 2HFOA 4PRFA 3U7JA 2RF2B 5DJBA 1SVDA 2MQ8A 2HNYA 2ACYA 1S5ZA 4IR1A 1G6BA 4DF4A 1S0MA 2BYCA 3M7VA 3GIMA 4C8KA 4OYAA 4R0JA 2J9CA 1TL1B 1R6YA 4ID5A 1FRIA 3T3FA 3B4DA 5F9LA 4YMEA 2RUGA 3H4BA 1VQ4S 1RWWB 5L39A 3IP0A 2ALZA 2FZKB 1YI2S 5KFRA 1O0PA 4X65F 1TZ0A 4EMDA 3KDOA 4J9NA 2EEYA 2LXFA 2ALYB 2B0GA 4L75A 3K5OA 1UJ6A 2DITA 2Z2YB 1X9SA 2GFFA 4R0EA 5AT1B 2M3DA 5F8MA 4X66J 3SFUA 5A0YB 2LYVA 3QIPA 3G82B 3HVTA 1O8BA 1HR0J 4YB7A 3LALA 5DQIA 3HULA 2DGUA 3J7AN 4X64J 1FFSB 2I5JB 4Q43A 3AB2B 3DLHA 1RWPB 3MGJA 4E8UA 1WC4A 4J9KA 1XTZA 1BY9A 3GMGA 1JMTA 4NRUA 3ZTSA 2GS8A 1UZHA 3MFIA 2VB6A 4DR3J 1YIJS 4EU0A 4RBVA 2JHEA 3IM8A 3VAIA 5CYQB 1BQMA 3HM9A 3H0PA 2YKNA 2PI4A 4DQPA 1N5SA 5HROA 2OPSA 2RSQA 1RCOB 3OVBA 5ETVA 2R4FA 3DLEA 2C2ZB 1G7CB 2FIUA 1RT2B 2CADA 4UOCA 2I0XA 3HMJG 2R2UA 2AJ1A 4JOUA 4CLLA 2HW3A 3UCUP 3QO9B 3ENWA 4DHVA 1S10A 3CCJS 2HYIB 4ZJOA 3N6LA 1EETB 3PACA 3LQVA 1G1XA 1Z4UA 2QA1A 3EDQB 1RTIA 4DV1F 1LFWA 2JC0A 1Y10A 4OI0A 4DLGA 4QPTA 3M6WA 2L41A 1SJRA 3PJXA 4ITSA 4PCQA 2GHPA 4EYIB 4Z7YA 1L3UA 2YTCA 2K06A 2WVDA 4CYUB 4RW8A 1XR6A 3MR3A 3MMAB 4PUOA 1K9MT 4CP5A 1UCNA 1NKEA 2A6MA 3LWLA 1FT8A 3QJPA 2W24A 1TL3B 3BYPA 2E66A 4ED8A 2DGWA 4PKDB 3FVYA 2W7AA 3IRXB 1AYEA 3D0IE 3DDIA 1QM9A 5KAKA 1CSJA 2VH7A 1YZ6A 2VG6B 2DNKA 2JWNA 2Z2MA 2CPHA 1V9OA 1Q8BA 4DN0A 1S6QA 3A8EA 1HYSA 2QL7B 4QIWD 3GONA 3J7YU 2JH3A 2M4MA 2HQCA 3HX9A 5ETKA 3ZXWA 1VRUA 3LP1B 5KT6A 5T41A 3RR8A 2R3VA 2O5DA 1B4SA 3KLIB 4CWBA 1JXVA 4LSLB 1ZA1B 1WC1A 1YRUA 2HHSA 1N5TA 1S1XA 1FF2A 3K7RA 3TP2A 1VDHA 2MGZA 2ZHBA 1Q5YA 2GQQA 1YLXA 4QW9A 3S8SA 4I4BA 4XIUA 3VGVA 3DGPB 4MK8A 5HAOA 4DPWA 4ER8A 2HZCA 3PHTA 4OLOA 1FX4A 3HFKA 2OUGA 3D2WA 2RT3A 3PEJA 3VCDA 3OXGA 1Y5NB 4Y28C 3I0RA 1BHNA 3BB5A 2FHJD 4DR7F 3AOBA 4JI8F 3PX6A 2DNNA 4LT6A 4LF7J 5DDRC 2LQJA 3HSZA 4B9MA 3BGUA 1RLDA 3SYZA 2RE1A 1JLCA 2MLZA 1JK9B 1S9GA 2VC1A 5KG1A 1LW0A 2VUGA 4DR1J 2ABYA 4DV5J 3BZQA 1D3WA 2OEMA 4O23A 2SXLA 2M5YA 1CC7A 3GFHA 2OI2A 1KRPA 2B3TB 1SL0A 1UVLA 4E0DA 4HH1A 2IMWP 2DNLA 2DD8S 3DHXA 2UXCJ 4ALZA 2Q3PA 1A9NB 1DTTB 1CLFA 2UZAA 1T9YA 3N5BA 3CGIA 2GVDB 5DDPC 4JV5F 4ZVEA 2PFDA 5KT3A 3EDRB 2AZ3A 5DO2A 2IIHA 4N8NA 3UNGC 1OY6A 2XLJA 1RKJA 2F4VJ 5DETA 1RADB 2WBMA 3HHLC 4M94A 2HMIB 5AJ3F 4CLZA 4N7TA 1WD6A 3D1OA 3QRQA 3MZIA 1IKYB 4HT5A 1X8DA 1S1WB 3LUYA 3MXHP 4WXWA 2MLXA 4KGKA 4N76A 2C2EA 2UUWA 1UWBA 3KK1B 2HQGA 1HQ2A 3M8ZA 4A8FA 3QFHA 5DLGA 3GWCA 1KD1T 4DL6A 1EB0A 4OQJA 3Q2TC 4ATNA 3FC9A 4LRAA 3K5MA 1VC5A 3AD8C 2XSJA 4UQGA 4CCHA 4ZDNA 3T9ZA 1RHKB 1G2EA 1R0AB 2W9CA 1V6HA 3GV8B 3UWTA 2G9OA 3C19A 2ZOFA 1D9AA 2HFZA 4E98A 4IG0B 3PFEA 2ZZTA 1NHVA 1EAYC 4I6WA 3CJ2A 4I2QA 2VODA 2ZH1A 1K0TA 3J81Y 2HFSA 2V4QA 3LH2S 2B7BB 5DQGA 1IWAA 2B4OA 2XS7A 2FHJA 3TAMB 1FRMA 4HT7A 2F7VA 3NAHA 2H48B 2GJFA 3S01A 3E2EA 3TANA 3QSYB 4Z7CA 1C0TA 3CJKA 4NEYA 2UUAF 1Z1ZA 1HNWF 2F8EX 1T05A 1EJ7L 2K7JA 3MWBA 1H7WA 2OEKA 4DFPA 4HYKA 1OYDA 4JI4J 1SV5A 3KJFB 1QVFR 1UFLA 3S1TA 5IXUA 1FK9B 4PPDA 3OR1B 3N4WA 3WBZA 2RIJA 2B56A 3HSGA 1AUDA 4EZ6A 5MLCV 4H4OB 1FTRA 5EHHA 3F73A 3QT6A 2YH0A 1JLAA 2DIVA 4W90B 1UA1A 3EYZA 4RUCA 2FPHX 2CG8A 3NWGA 2ILYA 4WP9A 3E51A 5C2CA 1KOHA 3VZHA 1RDRA 4YDXA 2AJ2A 3OFFA 4JI7J 3RAXA 2FUG9 1NPPA 1T9XA 4RR5A 2K1RB 3M1VB 2LKZA 4ZHRA 3KK3B 4L3NA 2Z4PA 4QYRA 4URGA 5KT4A 2UU9F 2AGPA 1EIYB 3JTOA 5A8RA 3MPDA 1IBKJ 2EFQA 2W9BB 4IOCQ 4FBTA 2L48A 5KFCA 4UQTA 5DS7A 1X4EA 2DHAA 1OPZA 1T03B 4K8RA 3I96A 1DJ0A 3F41A 1Q79A 4TLRA 4FYVB 2HURA 1U6ZA 3KK2A 5B0GA 1WG4A 3P3DA 3BBBA 5D4NA 3CCUS 2G2ZA 4M8LA 3WQPA 1F9FA 3AJ2A 1CG2A 3EVMA 3PZPA 4JI0F 1B0TA 1HQEB 1LQ9A 4ZVOB 1QTMA 1RHMB 2GO8A 2XWXA 3R3TA 1X4GA 4LREA 3PDNA 4BDPA 3V5RA 2LQBA 4RW6A 2RMLA 1NK9A 3HVAA 3KG0A 3R97A 3I32A 2WSEC 3D28A 3EJMA 2I38A 3SI8A 3MM8A 5KT2A 2HSEB 2Q79A 3DDKA 2EI5A 2ZBCA 3ENQA 1D1UA 3OHAA 4IQMA 4F0MA 5ETOA 5AE3A 3CJRA 2VDIA 3MMCA 3F0NA 1JLGB 5B0AA 3CJ5A 4WKRA 3JAMY 1JLFA 1JKHB 2XMJA 2XY7A 1Z2LA 1RAOA 3GR0A 2W8LA 5C2GA 3NY0A 3BPSP 5LXRA 3SEOA 1N5QA 1GTEA 7AT1B 2OD6A 2FB0A 4ZVTB 2BEFA 2JZ5A 5IV4A 3Q8VA 1FXLA 2OMLA 3VZIA 2WAQD 1FX2A 1TFWA 2NZCA 4GMKA 3V6JA 3BO2A 1U1PA 2RQCA 1JWWA 4FZVA 2ATLA 3M30B 2BE2B 3NS7B 3IRWP 1WF0A 2M7SA 3H5UA 3PXGa 3GCXP 1I94F 2ASDA 3C6UB 3VR1A 2RS8A 5JXSA 1VJQA 2BRLA 4DEZA 4IG3A 3RB3A 1GMVA 4BC7A 4ZLPA 5ETRA 4A8YA 4QU6A 1WC5A 4F4WA 3MECB 4ZVUB 2OFGX 2VBZA 4KYZA 2CG4A 4IRDA 4HACB 1LWEA 1WDTA 2GIQA 3GG0A 2VICA 2EKNA 3KDNA 2H54B 3W8GA 1NCLA 2HHXA 3RBEA 4OHVA 4F3OA 3UNYA 2HBQB 1VFJA 1UFKA 1Q53A 4Y2IA 3MOZA 1RTZA 3MTJA 4Y3CA 1MROA 1U47A 2DB1A 5GAEI 4ETXA 4LMZA 5ADZA 2VBXA 4I6YA 4O0NA 2MQLA 2KI2A 1EP4B 3W9IA 4R25A 4RO0A 1JLEB 4RW7B 3ZZUA 2CQBA 2DR8A 5K14B 3R5GA 1RQ0A 1VYAA 2G13A 2CPFA 5J1NA 2HFNA 2RB7A 5J1EB 4AQYF 2BJ8A 3K5NA 1WF2A 2WRMA 4OYBA 5HVGA 1RA7A 2BUNA 2ZD1B 3G6ES 1F6TA 3H90A 4KPYA 1TMJA 3DLBA 1DTQB 2CDRB 3IAS9 3HJFA 2VBYA 2ZZNA 3NGKA 2XBPA 2ZVIA 2C3UA 4C8ZA 4OYMA 5ETPA 4G1QB 2IM0A 1SJFA 5HVHA 2GAGC 2J0QD 3GIJA 1FESA 3CT9A 2RQ4A 4EUVA 5D0EA 2NXEA 1WDDA 3OD2A 3GPAA 1FJEB 2HVIA 2VL1A 2V50A 1B7FA 4DS5A 2IRXA 4KSEB 4CNZA 3BPDA 1X5SA 2POKA 3G6XA 4R8UB 1YBUA 4Y2CA 2IVYA 2M70A 3QRRA 4J9SA 1T02A 5KG0A 5BR8J 4EO8A 4JI6J 2HVDA 2W1BA 1DURA 1CS4B 1T9VA 5D3GA 2HHUA 2ROEA 2JEGA 3CC2S 1FEEA 1S77D 4NLDA 2C3PA 3WX8A 4WZQA 2R7XA 3M2UB 5E3AA 4B3MF 1M5OC 2PMZD 3LW5C 4MKAA 3AJ1A 3SCJE 3VGUA 2J0XA 2CPJA 4RNOA 5J2NB 4OL8A 2W7PA 2R9LA 3AXMA 1ZTTA 3ONQA 5MAOA 3MEGB 1RT1A 2E5IA 1UJ4A 1QLNA 3LAKA 4U7UD 5GADU 3OFGA 4KHPF 2KYZA 3Q89A 1MW7A 3FEYB 3KNAA 3MM7B 1SCJB 3MM6B 5K8OA 4AE5A 2IVMA 2EFGA 4WK3A 1NKCA 2CJ9A 5I3UA 3WX4A 5GAHU 3TUJC 4Q5VA 2YY3A 5ITHA 3DMJB 4BWMA 3ZZPA 2G1DA 2X3DA 3I6PA 3B6BA 5H9EJ 1BUXA 2ZE2A 2LA4A 3NL0A 2ZH2A 4F4XA 1A7GE 4O4GB 1FTCA 4QJVA 1KFSA 3QBCA 2IA0A 2OO4A 3NBPA 2WOMA 2DK2A 2H51B 3PO4A 4NPOA 3RTVA 4OX9J 2OPPB 1JLBA 1C1CA 2IAJB 4XAKA 4DR6J 4X4RA 2ZKUA 2KFNA 4K5RA 4C11A 2DNGA 4LF5F 4ZS6A 1RU2A 4IO1A 2D3UA 2XCAA 4GO7X 3H5XA 1U26A 4RW9A 3TRGA 4C0OC 3MEEA 1U1QA 1YJTA 2CNOB 1SC1B 5KG2A 2DH7A 1N5YB 2DR7A 3FNNA 3FRZA 4QWEA 1H38A 3BGFA 3CMQA 2PI5A 2CUYA 1S1TA 2GIRA 2V4JB 4TVAB 1JQGA 4J7CA 3US5A 1TK5A 2AV5A 4CO4A 4NYZA 5BYRA 2B8QA 4I0WA 4O3RA 2A10A 3MM5B 2W9AA 5T14A 2JOQA 2HWTA 5CAAA 4TY8B 1BLUA 3AH6A 2XNQA 4BS2A 1HA1A 4I56A 1UW9A 1S0NA 1HPZB 4N47A 4KHMA 4ETZA 4RKUC 3H20A 1JIHA 3C15A 4E2FB 3KOAA 3DRPB 4ZCMA 1BE4A 3E8OA 1LWCA 2RHQB 1FRKA 4LFCJ 3CUNA 1OSDA 3KUHA 3ZZOA 5D0RA 2CQ2A 4P72A 3R2CJ 1ZA2B 1NNDA 1Q81T 3PW4A 2YWKA 4ZLJA 4IRKA 3D68A 3O44A 4DQSA 1HWUA 4LVOP 1SUQB 1YKWA 2F8HA 1AW0A 3X3UA 4FF3A 2V2QA 3OBIA 2M9KA 4LRCA 5K8NA 1NXIA 1BC6A 1RAEB 3QIDA 4TQRA 4CLKA 4G6VB 1FDAA 2DGQA 3DRSA 3O1LA 5CHCB 1XQIA 4K50A 4A4JA 2YX7A 3L09A 4AFFA 3EGZA 2DISA 3EPGA 1C0UB 2I1RA 3W60A 1ROFA 5D4LA 3RBDA 3SMZA 4UOGA 3ILOA 2FLNA 1X4HA 1VQKS 4TN2A 2QE5A 1HBMA 2MQOA 1U1OA 2DR9A 3GIRA 4I2PA 1RBOB 2D9PA 3T1YJ 4HTIA 3R7NB 1VRTB 4NLTA 4K4ZA 4DPYA 3ETMA 4OV1A 2HNYB 3TAPA 5H1SV 1D9FA 4B3TF 2RUSA 1HHSA 1O6XA 1Y9OA 2K2PA 4GO5X 3M32B 3CXCR 1FE0A 3OJUA 4PQAA 5LSOA 1I51B 2BKNA 2IM3A 2NLWA 1RZMA 1Q7LB 5T7LA 3MUTP 2HS3A 2RILA 2OJ3A 4J9QA 3CO0P 3CD5A 1W26A 3KUEA 1NPRA 2OPRA 4CO1A 2R2RA 3FBCA 1NSAA 3W8PA 1U49A 4TYBA 1TQLA 2LLZA 3D6FB 4LIWA 1LKZA 2GHVC 1QSLA 1PJ6A 2XGQA 3BGRB 2CXEA 3IR6B 4P7VA 2AGOA 1CBKA 5C7PA 2KG0A 3G8SA 4ZLLA 2RAQA 1MN9A 2FVQA 4LF9J 2KFYA 1UAWA 3QIPB 4RWXA 2MJNA 3M9MB 3H2VE 4WP3A 3T6JA 3RU0A 5LM7E 4OX7A 3ISNC 3N01A 3CCTA 4ZMMA 5IOLA 2CQPA 2XS5A 2DEJA 1VHFA 1NK5A 1C2PA 4OI1A 1MMNA 1QSYA 5H9EK
chains in the Genus database with same CATH topology
2E5LJ 4NEZA 4PWWA 4LF8J 2MTLA 3W1YC 1XNRJ 4KY3A 4B3TJ 5FLXU 4X65J 4HHUA 3IMQJ 4DV6J 4JI0J 5LMUJ 4DR3J 3OTOJ 4DV7J 4B3RJ 4DR4J 3D3BJ 5LMNJ 2UUBJ 1HNZJ 2UUCJ 2VQEJ 5BR8J 1IBMJ 4JI6J 4RJVA 4DV3J 4DR2J 4JV5J 4DV2J 1I94J 5A2QU 3D3CJ 4JI3J 4JI7J 2VQFJ 4X62J 4LFAJ 2UU9J 4LFBJ 4AQYJ 4V1Ak 4LF7J 4NXMJ 4LF4J 2KVQE 1N36J 4YHHJ 2F4VJ 1N34J 5IT9U 1XMQJ 4DR7J 4JI8J 4LF5J 4KYZA 4X66J 1XMOJ 2MEWA 4NEYA 4YY3J 4LF6J 4NXNJ 4OX9J 1N33J 4DV4J 5AJ3J 1HNXJ 4GKKJ 2KL8A 4B3MJ 3R2DJ 4DR6J 1IBKJ 3J81U 4DUYJ 4GKJJ 4DR5J 2UUAJ 4DR1J 1FJGJ 2HHHJ 4LFCJ 1HR0J 4DV5J 3J80U 1J5EJ 3T1YJ 1N32J 4JI2J 1HNWJ 3R2CJ 4B3SJ 2MQ8A 4LF9J 2ZM6J 3J7AN 4K0KJ 2UXDJ 4X64J 4JI4J 5LM7E 4DUZJ 4DV0J 4DV1J 5IWAJ 4JI5J 4KHPJ 2UXBJ 1IBLJ 4JYAJ 2UXCJ 1XNQJ 3JAMU 3T1HJ 4JI1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L J;  4NEZ A;  4PWW A;  4LF8 J;  2MTL A;  3W1Y C;  1XNR J;  4KY3 A;  4B3T J;  5FLX U;  4X65 J;  4HHU A;  3IMQ J;  4DV6 J;  4JI0 J;  5LMU J;  4DR3 J;  3OTO J;  4DV7 J;  4B3R J;  4DR4 J;  3D3B J;  5LMN J;  2UUB J;  1HNZ J;  2UUC J;  2VQE J;  5BR8 J;  1IBM J;  4JI6 J;  4RJV A;  4DV3 J;  4DR2 J;  4JV5 J;  4DV2 J;  1I94 J;  5A2Q U;  3D3C J;  4JI3 J;  4JI7 J;  2VQF J;  4X62 J;  4LFA J;  2UU9 J;  4LFB J;  4AQY J;  4V1A k;  4LF7 J;  4NXM J;  4LF4 J;  2KVQ E;  1N36 J;  4YHH J;  2F4V J;  1N34 J;  5IT9 U;  1XMQ J;  4DR7 J;  4JI8 J;  4LF5 J;  4KYZ A;  4X66 J;  1XMO J;  2MEW A;  4NEY A;  4YY3 J;  4LF6 J;  4NXN J;  4OX9 J;  1N33 J;  4DV4 J;  5AJ3 J;  1HNX J;  4GKK J;  2KL8 A;  4B3M J;  3R2D J;  4DR6 J;  1IBK J;  3J81 U;  4DUY J;  4GKJ J;  4DR5 J;  2UUA J;  4DR1 J;  1FJG J;  2HHH J;  4LFC J;  1HR0 J;  4DV5 J;  3J80 U;  1J5E J;  3T1Y J;  1N32 J;  4JI2 J;  1HNW J;  3R2C J;  4B3S J;  2MQ8 A;  4LF9 J;  2ZM6 J;  3J7A N;  4K0K J;  2UXD J;  4X64 J;  4JI4 J;  5LM7 E;  4DUZ J;  4DV0 J;  4DV1 J;  5IWA J;  4JI5 J;  4KHP J;  2UXB J;  1IBL J;  4JYA J;  2UXC J;  1XNQ J;  3JAM U;  3T1H J;  4JI1 J; 
#chains in the Genus database with same CATH topology
 2MPU A;  2H5I B;  2AYG A;  3MAH A;  2Z57 B;  1RA6 A;  3OJS A;  2MHE A;  4P6Q A;  1XNR J;  2JX2 A;  2VOP A;  4DCO B;  1S79 A;  2W8K A;  2PO4 A;  3D3B J;  1QVG R;  2BR0 A;  3A13 A;  4DPU A;  2GJ2 A;  4DR2 J;  1CPZ A;  2X7I A;  1N36 F;  3FQK A;  1RBL A;  1BQM B;  3FSI A;  3K57 A;  2YKN B;  5IS2 A;  3S6E A;  4ED2 A;  5HRO B;  4IFV B;  2LEC A;  1ZET A;  3L95 X;  3DLE B;  2OAU A;  3C14 A;  4DQI A;  3RAM A;  3EGV A;  1FNX H;  5DGA A;  1FNO A;  5HMX A;  3PX4 A;  3HFZ B;  2AHO B;  1T0T V;  2H5J B;  5FLX Y;  4FN5 A;  4NLW A;  3TVY A;  3RUB L;  1RIS A;  2AJ4 A;  3W2V A;  3AOD A;  4J9O A;  4L76 A;  1FD8 A;  1Y0H A;  3GU0 A;  1X5T A;  3UD5 A;  1UJ5 A;  2HVZ A;  1RTI B;  2IDE A;  1SB6 A;  2X51 A;  3NKY A;  2LVW A;  3W9H A;  2QFJ A;  5FDL B;  3P4U B;  4M5M A;  3JSM A;  2M88 A;  2EPI A;  4ZIT A;  1VQ7 S;  1WOR A;  2DHG A;  2MKS A;  4RW8 B;  3HZG A;  3TX0 A;  5C24 A;  3NOG A;  4PUO B;  4PXC A;  3BEG B;  1PYS B;  3GP9 A;  5AE1 A;  4KE5 A;  1BXN A;  2CZV C;  1ZM9 A;  3FK4 A;  4KKO A;  3DXB A;  2HQF A;  2ROP A;  3QT8 A;  2LP4 A;  2HRY A;  3W7B A;  2VFT A;  4LF6 F;  4LBI A;  4IDK A;  3RBX A;  3K8V A;  2CJY B;  2IBK A;  4GKK J;  2JL9 A;  1CJU A;  3R9L A;  3DI6 B;  2Y1J A;  1HWI A;  1J5E J;  4P7T A;  3I4H X;  3V4M A;  2KDO A;  3M05 A;  4C3K A;  2VFU A;  1NDK A;  2F65 A;  1RHR B;  3PYG A;  4JBC A;  3P8B B;  4M5N A;  4S0M A;  1IR1 A;  3MAA B;  2EFP A;  5C42 A;  3IM9 A;  4ECY A;  3K8W A;  2DO0 A;  2F1F A;  3U02 A;  2V4R A;  3TNV A;  5IQ6 A;  5I3P A;  1W2B R;  1FVS A;  5KG7 A;  4YUD A;  2MGZ B;  4R5P A;  2J76 E;  2MZT A;  1VQY A;  3ILI A;  1F5A A;  4F4K A;  2B51 A;  2XLK A;  2EVZ A;  3K58 A;  3OTO J;  3CIZ A;  3QSI A;  4QU7 A;  4U95 A;  3T5H A;  2VOO A;  1SJ4 P;  1OS5 A;  3I5C A;  4X62 F;  3A8I A;  3NMR A;  4JI3 J;  2N7Y A;  2QX0 A;  4LFB J;  4OFZ A;  4NLQ A;  1XMO F;  3PW0 A;  2RJZ A;  1YJN S;  1RAF B;  1SIW B;  3PR4 A;  3I0R B;  4URQ U;  4N41 A;  4ED1 A;  2UVR A;  1HNX J;  1IQT A;  4OX8 A;  1N32 F;  1PJ7 A;  3OVA A;  2EBE A;  2HIQ A;  3D6H B;  4ED6 A;  1GXU A;  4JI2 J;  2FJE B;  5CXT A;  2X3G A;  5CAB A;  1LW0 B;  2ASL A;  4HLB A;  3W62 A;  4P2X A;  2CJK A;  4I67 A;  1AZS B;  2ZHO A;  3M9O B;  2GQC A;  3KHG A;  1PGZ A;  3LP0 A;  2FJV A;  2AGQ A;  3OSP A;  5KFP A;  5THW A;  2VPX B;  3THT A;  2QMX A;  3NG8 A;  3O6Q A;  1AT1 B;  4Y2M A;  2RKI A;  2NYI A;  1S7H A;  1I5O B;  3HZE A;  3LGM A;  5DZ7 A;  3SCL E;  5CCM A;  1TK0 A;  3H2L A;  5A8W B;  4UST A;  3TX8 A;  4OI3 A;  3TUZ C;  3Q8U A;  1S12 A;  1KBR A;  2D69 A;  4YY3 F;  4N56 A;  1SPB P;  3PR5 B;  1RHJ B;  3CCQ S;  2ASJ A;  1ZBT A;  2O67 A;  1YK9 A;  3HHE A;  3CB4 A;  1FDD A;  2BJ9 A;  5CH7 B;  2NUH A;  3GR1 A;  1U0H A;  3C3L A;  4ED0 A;  4P2S A;  4PYD A;  4K0K J;  4OI4 A;  3CCS S;  1UWB B;  1RTH A;  2MSS A;  1U1R A;  2AT1 B;  3LWM A;  5K8P A;  3JYT A;  3VAF A;  2K3K A;  1XNQ J;  4L6V 3;  5F8N A;  4RW4 B;  1HBO A;  3OUY A;  1RTJ A;  4NI2 A;  2XMM A;  4LSZ B;  4RBT A;  3AQP A;  3CME S;  6FDR A;  1UPP A;  4O44 B;  4CIO A;  2BQ3 A;  2W01 A;  2VG7 B;  2XSJ B;  1W2I A;  1CJV A;  2AYB A;  2ZC4 A;  3LOU A;  1IQZ A;  4DSK A;  2MLY A;  5LJ3 Y;  3ZTO A;  2KH9 A;  3EMT A;  1UMJ A;  4LFA F;  3VWS A;  4LF4 F;  3H7H B;  3W5X A;  3CCR S;  2HHP A;  4I2Q B;  3QGG A;  2NUU G;  1XJW B;  1QUP A;  4TU8 A;  1C4A A;  2O01 C;  3LF0 A;  2JVR A;  2J8S A;  4DR5 F;  5HQ8 A;  3HHL D;  8ATC B;  4KHR A;  3UR3 C;  2HZA A;  3L7O A;  3NGU A;  3UE2 A;  2FD2 A;  5GMD A;  3CW2 C;  4ICL B;  2XG8 A;  4DUZ J;  1U45 A;  5HJX A;  3SQG B;  4LR7 A;  1TKT A;  4M5L A;  2QG9 B;  1NB2 A;  2D3O 1;  3ZTQ A;  3M2V B;  3RB0 A;  2OSR A;  1SV5 B;  4ELU A;  1QE1 A;  3PCO B;  4PWD B;  3CJ8 A;  1VMB A;  1SQG A;  1T3O A;  5LMU F;  1J27 A;  3NWR A;  4J37 A;  4NLO A;  3PY8 A;  1R27 B;  4KTQ A;  3HT3 A;  1P9Y A;  2D3Z A;  3KLG A;  2OTL S;  2UUB J;  1JLA B;  4CM2 A;  4DV2 J;  2XI3 A;  4NYO A;  2WBR A;  3W2W A;  4NXM J;  4KR0 B;  3UDC A;  3E01 A;  4J9U E;  2V34 A;  2V67 A;  1J5O A;  2GHW A;  3V4I B;  3QPI A;  5BYQ A;  1RSC A;  2FJX A;  4ZHR B;  2BDP A;  3A1Y G;  5E5N A;  1FJG J;  5E3C A;  2IVF B;  4DL3 A;  3OXF A;  3ZTR A;  1VIX A;  1RJJ A;  1XBW A;  5F0U A;  5KFY A;  2Y0B B;  2YPY A;  2GO9 A;  3TYT A;  5IV3 A;  4NZ0 A;  2C2O B;  1UFW A;  3BBF A;  1FNM A;  3NAI A;  3IS9 B;  3LP2 A;  2BJE A;  4ZPT R;  3TI0 A;  3G86 A;  2OLW A;  4NA3 A;  2BJ7 A;  4HVZ A;  2YKO A;  2H4Y B;  2CNN B;  2QA4 G;  3D54 A;  1T9W A;  1WOS A;  4F3Q A;  4FXV A;  2F3J A;  1EX8 A;  1HQU A;  3RYL A;  4EO6 A;  4QWB A;  2XMW A;  4X4T A;  2WK4 A;  3AOC A;  5AXK A;  4UZB A;  4IOA Q;  1H72 C;  4RW6 B;  3MD1 A;  3EVO A;  2ZVS A;  1XWL A;  1PAE X;  1RT7 A;  1XN9 A;  3VQS A;  3GJT B;  4B17 A;  1S49 A;  3C8Y A;  4K7Q A;  3HHL A;  3D7S B;  3J81 U;  1DHM A;  1L3K A;  4HEA 9;  1WC6 A;  1SQE A;  3S7R A;  3THP A;  3DOL A;  2RQM A;  3DC2 A;  2YQ1 A;  4QQB A;  2DH8 A;  3TOQ A;  2VFR A;  3HP6 A;  3AD7 C;  4P75 A;  2E1R A;  1K8A T;  4LUB A;  4FVM A;  1TAQ A;  1CVJ A;  2B8P A;  2DPJ A;  1X4D A;  4ZP8 A;  4RPF A;  5EUH A;  3AQO A;  3BQ1 A;  3IAM 9;  4BWJ A;  4Y2A A;  4LF8 F;  1U2C A;  5RUB A;  3I9Z A;  3CDE A;  4ZVG A;  1BWV A;  2JFD A;  1SXL A;  4TY9 A;  4UY8 5;  2FJW A;  1PC4 A;  3FDS A;  1WKK A;  3BS9 A;  2HIY A;  1TKD A;  3PJW A;  1IBM F;  3DCA A;  1HWL A;  2CWK A;  2FLP A;  2DBB A;  3ADA C;  4FXD A;  3MTK A;  2XO6 A;  3D3C J;  2ZH6 A;  1HW8 A;  4HR2 A;  1YRX A;  3SBM A;  1UEK A;  5D0G A;  4DCJ B;  3EGW B;  4IG3 B;  1RAA B;  4USW A;  2A1B A;  4A48 A;  4IOB A;  1YQH A;  2BAC A;  1VOM A;  1FDN A;  4DL7 A;  2DHX A;  1L3V A;  5ETQ A;  1S0O A;  4PR6 A;  1HNV A;  1GX6 A;  2J9E A;  2RF2 A;  1WG5 A;  5AE2 A;  2GCF A;  1R8B A;  4YOE A;  1S9F A;  4XDC A;  1GMU A;  2F9D A;  1ZM2 A;  2V9W A;  3UDL A;  4WTY A;  2ZH9 A;  5GAE U;  2HQ3 A;  2YNG A;  1R8C A;  3DLK A;  1MRO B;  2XZT B;  1TL1 A;  4EYH B;  2FVS A;  4QBU A;  4FS1 A;  1UPM B;  3FFI B;  1NPK A;  4B08 A;  1Q7Y T;  1HD1 A;  2ROG A;  3JTP A;  1WAC A;  4ENO A;  4EEY A;  1VBK A;  4O3S A;  3QYY A;  4RUH A;  3DOK A;  2FHM A;  4MIB A;  2AEJ A;  2CJX B;  5CZX A;  4Y00 A;  3SV4 A;  3AA8 A;  1JJH A;  2C42 A;  3T1A A;  3OQ2 A;  3F44 A;  2FLO A;  3NGT A;  4BBY A;  4DZ6 A;  3AD9 C;  2DCL A;  2X1G A;  4ZP6 A;  1XR5 A;  2DR5 A;  3EX7 B;  4DV0 F;  1SQF A;  2QZ8 A;  1U1L A;  4WFN Q;  2B4U A;  1BQN A;  2VKR A;  2IA6 A;  3UPF A;  4DV1 J;  3OL7 A;  2I8E A;  4NA2 A;  4ZKA A;  2AP6 A;  1Q1K A;  2RU9 A;  3IG1 A;  3JAM U;  3GG1 A;  2HND B;  2Z0G A;  2K8G A;  1M90 T;  7FDR A;  3TJ8 A;  2G1H A;  1SL1 A;  5F8J A;  2Y1L B;  1CUL B;  2O66 A;  2ZKT A;  5F8G A;  1DZ5 A;  1URN A;  5DRK A;  5IM0 B;  3AOA A;  3EE3 A;  2E1P A;  2DIU A;  1VCT A;  3AAW B;  3MUR P;  2BM0 A;  5BXI A;  1HL6 A;  4F0K A;  1N33 F;  5KT7 A;  3VAM A;  5D3G B;  1RT2 A;  2H4W B;  4K4X A;  5HI7 A;  4KO0 B;  4P73 A;  3EZ5 A;  3CD6 S;  1VIO A;  2V68 A;  2H65 B;  2CQ3 A;  1NRK A;  3HVR A;  1N8R T;  3QO9 A;  5HVF A;  3UR0 A;  4TU9 A;  3BF4 A;  4UY8 T;  2N3O A;  1FXD A;  1GXL A;  4MH8 A;  1EET A;  5C5J A;  3OW2 R;  3H59 A;  2HPU A;  2DGT A;  1GNK A;  2RDD A;  1IM4 A;  1U1K A;  2Y8Y A;  4GVB A;  3LGN A;  4K4Y A;  4ILL A;  1SKS A;  4CYU A;  3QGI A;  2PEH A;  3THV A;  4DL2 A;  5B7W A;  4ZPB A;  4X2B A;  3CIM A;  4JUZ A;  2VQF F;  1OWX A;  2XY6 A;  1RT5 A;  4PAA A;  3G6V A;  4CLF A;  1SKU B;  3C46 A;  2KVQ E;  5JJB A;  4DR7 J;  4JI8 J;  5HBM A;  1R8P A;  3Q24 A;  1X0P A;  2XYH B;  3LO3 A;  1K1S A;  1HFE L;  3TJ9 A;  1MG7 A;  5HQL A;  1QY7 A;  4MAK A;  2WOM B;  5HN0 A;  3OL8 A;  2DY9 A;  1TKX A;  1JLB B;  1FER A;  3WHI A;  2VJV A;  4M5I A;  5JVH Q;  3LP1 A;  1MLA A;  1S97 A;  2E5L F;  4KGM A;  4ZPA A;  4CDI A;  2V69 A;  1X7V A;  4J9V A;  4NL5 A;  2WVF A;  4AXJ A;  3MMB B;  3KFW X;  3A8J A;  4ILR A;  1S48 A;  2DEI A;  2F8M A;  4WFX A;  3PRB A;  4LRF A;  2Y3Y A;  3AB4 B;  5HAT A;  2YWW A;  2FHO B;  5KG5 A;  2J0W A;  3QAT A;  1Q82 T;  4JV5 J;  3GYG A;  5HK4 A;  3GZ7 A;  1X9W A;  1NHU A;  2FJD B;  2XEX A;  4ZCK A;  1RT6 A;  2IRY A;  2VJU A;  1S1V B;  3M8P B;  1FRX A;  1WI6 A;  4RX6 A;  3G96 A;  1R7I A;  5AJ3 J;  3QT7 A;  4B3S F;  3P45 B;  1F3F A;  2LEA A;  5D4O A;  3MUM P;  3C15 B;  4NLX A;  4PQU B;  4OX9 F;  2GC8 A;  1DLO A;  4GRS A;  4OZJ A;  2FLL A;  3EVW A;  2BX6 A;  4DFM A;  4KPC A;  1LWC B;  1IBL F;  3QRP A;  3BYR A;  2AQ4 A;  6FD1 A;  2RS2 A;  4X4Q A;  3CPW R;  1KFD A;  3JQK A;  2JLF A;  5B0E A;  3DGV A;  3GII A;  3IR7 B;  3DYA B;  5IT9 Y;  1VQP S;  1W7W A;  4RNN A;  1RB0 A;  4DV7 F;  2EC0 A;  2IJR A;  1KC8 T;  4H4K C;  4OZ1 A;  3PW2 A;  1JXE A;  2MDA A;  3PG9 A;  3I56 S;  4A47 A;  3LPY A;  3HKW A;  2C2K B;  1UVM A;  2MY8 A;  2XMT A;  1CJK B;  1ZTW A;  2ADC A;  2GVD A;  3DRS B;  4EBC A;  5KOX A;  5FII A;  4YDD B;  2B6A A;  1VQO S;  2YVS A;  3GLJ A;  3CCL S;  1NJW A;  4J9R A;  1UWA A;  2OFH X;  2HHV A;  3CCW A;  3BO4 A;  2CIM A;  4JV0 A;  5J2P B;  2CQD A;  4DUY F;  3I5B A;  2R8G A;  2HMI A;  4Y6I A;  2EC2 A;  1TV6 A;  1IKY A;  2UUA J;  3SXL A;  3UN3 A;  4TXS A;  1TKZ B;  1HNW J;  3PRV A;  1ITP A;  2U2F A;  1HI0 P;  2KHC A;  2YKP A;  3BN7 A;  2GA7 A;  3V81 B;  3GB0 A;  1FWP A;  2QV6 A;  2LEP A;  4FNI A;  5L38 A;  4CT8 A;  2UVW A;  3SIP B;  2QSF A;  1S0V A;  4DQQ A;  4CLS A;  2CJA A;  5HLF B;  4FBU A;  4LSN A;  2CVE A;  1F2H A;  1FWK A;  3MI7 X;  2XS2 A;  2MQM A;  2JLG A;  1JJ2 R;  1MWY A;  2OP5 A;  2F4F A;  5D15 A;  2C3O A;  2W4D A;  2YX4 A;  4FVC A;  1YJV A;  1KQK A;  3HK2 A;  2QLW A;  1M5K C;  4KGZ B;  3N79 A;  2H5E A;  2XTJ P;  1HWK A;  2QA4 S;  4NCA A;  3FBE A;  4UF4 A;  5T7L B;  5JMN A;  4YN3 B;  4I68 A;  2DYA A;  4NLY A;  2OPR B;  2A2C A;  4OHZ A;  2IMO A;  3K59 A;  3H40 A;  1S1U A;  3B54 A;  1PJ5 A;  1Y00 A;  4UOH A;  2F5G A;  2Y8W A;  3LPE A;  4PWU A;  1KN6 A;  3T9N A;  2ZUG A;  3FZ2 A;  4OHW A;  4USM A;  1M0S A;  3I5A A;  4JP8 A;  3CO9 A;  4TQS A;  2R7T A;  2UVV A;  4A8S A;  3QWU A;  4KGX B;  3JS9 A;  3GJQ B;  3T1H F;  4X4V A;  1UTA A;  4DUT A;  1X4A A;  4ZPW R;  3CED A;  3TW0 A;  1IR0 A;  3LAN A;  1NDL A;  1REV A;  2DO4 A;  2XYP B;  3OR1 A;  3SCK E;  4HHU A;  4DR4 F;  4H4M B;  4CQ1 A;  5HP1 B;  4JI0 J;  1HNZ F;  2ZC3 A;  4V19 J;  3BKT A;  3CJS A;  3ENA A;  2X1F A;  1NK6 A;  5LOQ A;  3G2X A;  1H0H B;  4B9V A;  1OMS A;  4ZN1 A;  2YXL A;  1LW2 A;  1S6O A;  3JSB A;  5DZ6 A;  1QDU B;  2R8H A;  4NXN F;  2J7K A;  3FGV A;  2E1A A;  4OI6 A;  5D78 A;  1E6Y B;  2VHG A;  3KK3 A;  1R89 A;  3FUY A;  1CQM A;  1NEE A;  1M1H A;  1VC0 A;  3C14 B;  5L9N A;  3KMS A;  1VBY A;  3DRR A;  1GH8 A;  3R5J B;  2W9B A;  1L3T A;  3A3O B;  4OYO A;  2N7C A;  3V6D A;  1RAG B;  4NLU A;  3W2V B;  2CQ0 A;  2L08 A;  2WSC C;  2AJ0 A;  2E29 A;  4YP3 A;  2A3J A;  2LQ9 A;  3DXS X;  2XSF A;  5KFN A;  2XLI A;  2VKZ G;  1SJ1 A;  2DH9 A;  2UP1 A;  4B3R F;  2BE7 D;  2CA9 A;  5DQH A;  2VQE F;  1JLQ B;  1TU0 B;  2OSQ A;  3JTN A;  2FJB B;  1VQS A;  1AA1 B;  5BYS A;  2JRS A;  1I94 J;  5A6W A;  2A0F B;  3HSD A;  1UW4 A;  2N82 B;  5C24 B;  1L3S A;  2KZM A;  2G2O A;  3UCZ P;  5C25 A;  4HH0 A;  2IM2 A;  4KH1 B;  2L9D A;  3JSY A;  1LWF A;  1S9E B;  2OPQ A;  2LQ8 A;  2FGC A;  4IDK B;  4D3H A;  3X1L B;  1RT3 A;  4WIQ A;  2XB2 D;  1TP7 A;  1RWK B;  3I87 A;  4JV2 A;  2UXB F;  4B9T A;  1TVR B;  4JI1 F;  3VTI A;  4F0H A;  2KN4 A;  4RBU A;  2JEJ A;  4F8R A;  4ERD A;  1OIA A;  1ZPV A;  2XZD B;  3PIP Q;  2KRB A;  4RLE A;  3FSY A;  2RD5 C;  3D0G E;  3ENV A;  5C42 B;  4WPA A;  3SCI E;  5KFX A;  1MN7 A;  4FKX A;  2VU5 A;  3HI9 A;  2YQ0 A;  5B0C A;  2HRT A;  1MU2 A;  5EN1 A;  4M5G A;  3FCW A;  4YB6 A;  2EG2 A;  3RAQ A;  3DLG B;  1RK8 A;  1N34 F;  2E9Z A;  3C6U A;  3CCZ A;  3LGH A;  4AQY J;  3K5L A;  4MIW A;  5KFT A;  2WCX A;  1TAU A;  2NXJ A;  2VA2 A;  1YWX A;  5DDO C;  4RU9 A;  4OIX A;  4MKV A;  2CQC A;  1X5O A;  1Q4R A;  1S4F A;  5K9F A;  1EZZ B;  1DQ9 A;  2IRU A;  1YRT A;  3QWP A;  4F3M A;  2IYG A;  5EWE A;  3PFO A;  1LOU A;  5KFG A;  4TKT A;  1E6V A;  1WEL A;  3MPV A;  1OSC A;  1GEH A;  1S6P A;  3ETO A;  4I69 A;  4OJ3 A;  3RW7 A;  2XQC A;  2K7K A;  4UOF A;  2AIR B;  2B9X A;  4ZA1 A;  3RR7 A;  4P10 A;  3CSK A;  3G87 A;  4PWW A;  4DV6 F;  2BAN B;  2ILZ A;  5I3Q A;  1NJZ A;  1KTV A;  5FLX U;  2J7U A;  3LP0 B;  2Z2L A;  3W5Z A;  1M5P C;  1VJW A;  2R8K A;  3OXL A;  3P96 A;  4C8M A;  3R5A A;  3IWX A;  1JLE A;  1SC3 B;  1O51 A;  3QJJ A;  1XEZ A;  4WFA Q;  2BQU A;  2RKI B;  2IDL A;  2ZHA A;  2C1E B;  1PCA A;  3NS5 A;  4G3I A;  2CQ4 A;  3PM9 A;  4C48 A;  5IQQ A;  5G0R B;  3NGD A;  2GIF A;  5DG8 A;  4AND A;  5DM7 Q;  4JI3 F;  1B0V A;  4GKJ F;  1EKS A;  2VD3 A;  4C2M A;  4DSJ A;  1IXK A;  4ELV A;  3A4T A;  1IN0 A;  4DX6 A;  2HHH F;  4B3M J;  2OTJ S;  2V8D A;  4WE1 B;  1CQN A;  4OYX A;  4LBP A;  4U6P A;  4Y0F A;  2QFI A;  4QR2 A;  1U0H B;  1QAI A;  2J9D E;  1X4F A;  3AY0 A;  4JI5 F;  2FVC A;  3G71 S;  2AEM A;  3MCN A;  1VK3 A;  2ZJP Q;  4H54 A;  3CDU A;  4KHP J;  3BKF A;  2IY5 B;  3DLJ A;  1RAI B;  1F60 B;  2C28 A;  1RTH B;  1U25 A;  2PT0 A;  3PIO Q;  1VLY A;  2GNK A;  3CCM S;  2E1C A;  3JYT B;  2EK1 A;  2BQR A;  1FCA A;  3OUY B;  1HBO B;  1BD6 A;  4NI2 B;  4IO9 Q;  2MQQ A;  3UCG A;  4F2R A;  2V2Z A;  4R8U A;  4B9L A;  1KTQ A;  4DL5 A;  2LDY A;  1H7X A;  1TL7 A;  4C0H A;  1PIL A;  4F26 A;  4HHJ A;  2ZFH A;  1LK7 A;  1CS4 A;  2GVZ B;  2WB1 D;  5EWF A;  5IFM A;  3O8W A;  5GVQ A;  1MSW D;  2AZ1 A;  1X5P A;  2MEW A;  4NCG B;  3DFE A;  1F9H A;  3M2U A;  4IYQ A;  3CJQ A;  2G0I A;  2QMU B;  1K47 A;  4K4V A;  3IWL A;  4HHH A;  2HGM A;  5J2N A;  3U1N A;  3NXZ A;  3MEG A;  1OY8 A;  4I7F B;  2FVP A;  5L1I A;  4C9D A;  4WYW A;  2YNI A;  2ZH4 A;  4RU2 A;  1V3Z A;  4FPI A;  2QL9 B;  3BH6 B;  3MM6 A;  1TKT B;  1YDL A;  1IUJ A;  4CO3 A;  3IMQ J;  5LMN F;  1LWX A;  2MKC A;  2XHC A;  4M5D A;  3HO1 A;  4YB1 P;  4KB7 A;  3DMJ A;  4LRB A;  1TFY A;  4WZM A;  1S59 A;  2FHK A;  1CEZ A;  4QR1 A;  1I3O B;  3KLG B;  5KT5 A;  4K4S A;  2R42 A;  4WU2 A;  3MOJ B;  2YNH A;  1DQA A;  3I82 A;  3I31 A;  5CYM A;  1P9Q C;  2QA2 A;  3HFV A;  4DV4 F;  2G2Y A;  4WCE Q;  3CC4 S;  3W2W B;  4DLE A;  2PN6 A;  3E01 B;  4OJ1 A;  5HMZ A;  5CZV A;  3RBZ A;  2LXI A;  2NR0 A;  3G9C A;  1NK7 A;  4NCB A;  1IJF B;  5IWA F;  5L8R C;  1ACM B;  2DPI A;  3I4P A;  2R7R A;  4NE9 C;  3KLH A;  3CDW A;  1B99 A;  5A2Q Y;  4NA1 A;  3EWG A;  4DQR A;  4BLG A;  5ETS A;  4EZ9 A;  1KVI A;  2BE9 B;  1AFI A;  2YNF A;  3ET6 B;  1RAH B;  5KFS A;  4DPX A;  1ARO P;  1URR A;  1ZM4 A;  2BW7 A;  3OVS A;  4QW8 A;  1KNZ A;  2G4B A;  1WOP A;  3HXM A;  3ZNU A;  3SSS A;  1QSS A;  2ZBP A;  3MM5 A;  2NRE A;  1ZM3 A;  3CWJ A;  3QLH B;  1NUE A;  1H6K X;  2D9O A;  3RJM B;  2ZDO A;  1HPZ A;  1J2V A;  1HI8 A;  1VQL S;  3NGR A;  2QN6 B;  1QTN B;  1KWM A;  3EPI A;  3DHW C;  4A8M P;  5K8M A;  3ZZ0 A;  4DS4 A;  5ETN A;  2QRR A;  1HNI B;  2X1A A;  2COL A;  4CRJ A;  3DOL B;  2MQN A;  4LQ3 A;  3P49 B;  4ZPC A;  4HTJ A;  1RHU B;  5KFZ A;  4C97 A;  2OGU A;  4CTA B;  4IFY B;  3GJS B;  3C6T B;  2EG1 A;  2A18 A;  1FKP A;  4WFB Q;  2V63 A;  1V3R A;  3B78 A;  1GX5 A;  4Q8E A;  3CDA A;  4B3T J;  2MJU A;  3AFG A;  3HHD A;  4L74 A;  4OHX A;  3MM9 A;  1RYS A;  4PG6 A;  1RE1 B;  4PG5 A;  3TR5 A;  2CPX A;  3VAG A;  3RZA A;  4QIE A;  3BSO A;  3MR7 A;  3M8Q A;  5KFM A;  1IVZ A;  4B9N A;  3FMW A;  4PG7 A;  4Y34 A;  3OTB A;  4NML A;  1IWG A;  1PG5 B;  4YS2 A;  3OLB A;  4O3N A;  4X4U A;  1MML A;  3MR5 A;  4AL5 A;  2V8V A;  3GYN A;  3GQC A;  3NNC A;  5I42 A;  1QAY A;  5CA5 A;  4JYA F;  1HNV B;  4DG1 A;  1U8S A;  1VRT A;  4KV8 B;  1IKV A;  2A2D A;  1BGX T;  3OSN A;  4NLG A;  5SZT A;  2DJW A;  4WJB A;  4NYP A;  3RRK A;  2JEF A;  3M32 A;  1KP6 A;  2B4V A;  2YNG B;  2ZWO A;  2GZO A;  3DLK B;  5E0O A;  4FXW A;  4DV3 F;  4QCL A;  3DM2 A;  4DOZ A;  2IJF A;  5KFH A;  1HWJ A;  1T3N A;  4OI2 A;  2KTQ A;  2VFS A;  1X9M A;  1XK8 A;  7FD1 A;  4Q2L A;  2HEK A;  1XMB A;  1PBA A;  3CTR A;  4OJG A;  1N36 J;  1WC0 A;  2Z58 B;  4TLQ A;  1Q8I A;  1ICE B;  3DOK B;  3P5T L;  2IC3 B;  2HLT A;  1X0F A;  1KLM B;  4B9S A;  5E2Q A;  2XM3 A;  2W4P A;  4RWW A;  2ZOG A;  3MED B;  4IUF A;  2W4C A;  2DRB A;  3R2D J;  4ILM A;  2PDA A;  4NAS A;  1M5V C;  3QAU A;  1NKB A;  2YH1 A;  1MWQ A;  2HK2 A;  3U1L A;  3BGR A;  3TZY A;  2W7O A;  1FI4 A;  4YQW A;  2MST A;  5JVG Q;  4ZIV A;  2DNH A;  1TUV A;  1SC6 A;  3PNI A;  2E7W A;  1BQN B;  2AKW B;  2J6T A;  4A8X A;  3ILJ A;  2BJ1 A;  4ZIW A;  5A6P A;  3IG1 B;  1HHT P;  5LL6 d;  3KG4 A;  4O3O A;  1SL2 A;  2DGO A;  3JQM A;  1HLW A;  2VPW B;  4EBD A;  1YJR A;  3D66 A;  2MKJ A;  3J80 Y;  4EI2 A;  1BQX A;  1U24 A;  1H2T Z;  2ZUA A;  4LR8 A;  3N6N A;  4V1A k;  1M5H A;  4KRW A;  5DM6 Q;  1WG1 A;  1TTH B;  3I0S A;  3NCR A;  4IFV A;  2C3Y A;  4LF6 J;  4K2J A;  1PAU B;  1T11 A;  1S7I A;  3TVZ A;  2QJ3 A;  4RNH A;  2RRA A;  1GT8 A;  5LXY A;  1PIE A;  1RHQ B;  3BRE A;  4NX9 A;  4ZJL A;  2ZJR Q;  2Y9H A;  1V3S A;  1U8W A;  1ZYQ A;  1TEL A;  2QL5 B;  3DRY A;  3MR2 A;  1REG X;  2DGS A;  4KGV B;  3FCV A;  1HMV B;  2AEF A;  3ZZT A;  3TJA A;  3KG1 A;  1IKW A;  4XK8 C;  4J9P A;  3GE9 A;  4DXL A;  1FA0 A;  1X4B A;  4GVB B;  4ELT A;  3QT5 A;  5FDL A;  4CO2 A;  3OFE A;  4OYW A;  2HNZ B;  1RWN B;  2Z2Z A;  2KXN B;  2B9W A;  4F04 B;  2R7V A;  2DNM A;  3KLE A;  4N8O A;  3A3P B;  3GCW P;  3IBW A;  4X62 J;  4U8Y A;  2I2Y A;  4Q0B B;  1F2G A;  1U6F A;  2NQP A;  2E7V A;  3RB4 A;  1RT5 B;  4O4R A;  3EZO A;  1RU1 A;  2CJB A;  1YBT A;  3OR2 A;  4OJH A;  1AB8 A;  3MEK A;  1XMO J;  3PV8 A;  3KTQ A;  3P6Y C;  5HBM B;  1ZAX A;  3PX0 A;  2UXD F;  3EZU A;  1N32 J;  2YBV A;  1VS3 A;  5F0W A;  3AJD A;  5D0H A;  3DI6 A;  1GFW B;  1RT4 A;  3KJQ B;  4QIG A;  1WKJ A;  4J5O A;  1TKX B;  3MMJ A;  4N5S A;  2JVO A;  2CKW A;  2KJV A;  1KQF B;  2LEB A;  4K4U A;  2QYG A;  1LNQ A;  1YJU A;  1NDC A;  3ZO7 A;  3R6G B;  2IYI A;  2LMI A;  4ZCL A;  2F63 A;  1S99 A;  4NEZ A;  2ZZM A;  1JNZ B;  3MAA A;  3UD4 P;  2WVC A;  2CVI A;  4A46 A;  4WKY A;  4CZC A;  1LV5 A;  2JNJ A;  1P27 B;  3T19 A;  4TYA A;  2NPF A;  4Q44 A;  1P6T A;  4DMZ A;  5CYJ A;  1NH8 A;  1U09 A;  4X4S A;  1R8H A;  2MHN A;  4X4N A;  2FQQ B;  4YHH F;  4IR9 A;  3UVJ A;  3KJV B;  2HQI A;  1WSV A;  3OPK A;  3D0H E;  2EBG A;  2IFX A;  1KKH A;  3A8K A;  4OYI A;  1KQG B;  4NWB A;  2ZNZ A;  4USI A;  4W92 B;  2B9E A;  1RT6 B;  4YY3 J;  2JDJ A;  2BRK A;  1OYE A;  4X4P A;  2VPY B;  5HL7 Q;  2GJI A;  1V5V A;  1YG0 A;  4C8L A;  2WB4 A;  3HLU A;  2XYG B;  3H5S A;  4DSF A;  3W5Y A;  3GV7 B;  2XGP A;  1RI7 A;  2V9K A;  2ZH5 A;  3WZ0 A;  4ID5 B;  2CAJ A;  3QFW A;  4KIA A;  2C2M B;  4DFK A;  1DLO B;  4B02 A;  3Q23 A;  1NJX A;  2BJD A;  4Q2M A;  1AZS A;  1D09 B;  1SKW A;  2MZR A;  3JQJ A;  1TL4 A;  2VIH A;  3UW1 A;  3HJV A;  2D41 A;  4J9L A;  4HKQ A;  4M5H A;  4DSE A;  4ES2 A;  2ZBQ A;  4Y2K A;  3A3N B;  3M2R A;  2D3O R;  5IT0 A;  1R43 A;  1QJH A;  3ZNJ 1;  3EIC A;  1D9D A;  3DKD A;  1RAC B;  1XMQ F;  1F5B A;  2R7U A;  4LFA J;  3KWM A;  3IA0 A;  1OQ3 A;  4LF4 J;  4MJK A;  2BM1 A;  5A8W A;  3IN5 A;  1RGV A;  2B6A B;  2FC9 A;  3NMA A;  3POT A;  3HVT B;  1P8G A;  3TA1 A;  1UVI A;  4F4Z A;  1IJE B;  5F3Z A;  1IR2 A;  4DR5 J;  4K59 A;  4P9S A;  2HHT A;  5D6G A;  4WBF A;  1YBA A;  2GX8 A;  3CUL A;  1TV6 B;  4OZ5 A;  3K2Y A;  2BKP A;  4B3O A;  3ZZR A;  3TQE A;  1Y3J A;  3HVW A;  2ZH8 A;  2P6S A;  3PYF A;  4C0B A;  1BMQ B;  4ECU A;  1RWV B;  1B64 A;  4WP8 A;  4WXO A;  2XHW A;  5JUM A;  3UFC X;  1WUU A;  1ZAV A;  1IM6 A;  3UDE A;  4FS2 A;  4RW4 A;  1C1B A;  3H25 A;  3V2U C;  4ECW A;  2MZJ A;  2FTR A;  5LMU J;  4LSN B;  1UZD A;  2OPS B;  5M2P A;  4U7U K;  4C4W A;  1QAJ A;  2BV3 A;  4O44 A;  2VG7 A;  1H74 A;  5DGB A;  3CD7 A;  3HT0 A;  3Q8R B;  4W98 A;  3KKF A;  3CC7 S;  3PO5 A;  4C8O A;  4ZPV R;  1AFJ A;  3SFG A;  3EGN A;  4K4T A;  1HBN A;  2RU3 A;  4X66 F;  5KTQ A;  2WVB A;  1W25 A;  4DN9 A;  1UVN A;  2YX1 A;  3OTD A;  2MZ1 A;  2KYX A;  4DWI A;  3BH7 B;  1NME B;  2V2V A;  2J0S D;  1NZ8 A;  1HR0 F;  2KKH A;  1PO6 A;  2RQK A;  2YKM A;  3BDE A;  4NRT A;  5EX3 A;  2CPZ A;  3ZTP A;  4ECQ A;  4X64 F;  1S1U B;  4L73 A;  2QSW A;  1KR4 A;  2VAS A;  1KDN A;  3DRX A;  3FMB A;  2BMB A;  2I6W A;  5KFJ A;  3F56 A;  1U0S A;  4ICL A;  3GIL A;  5G4D A;  3SQG A;  3CCE S;  2XMA A;  1X31 C;  2KHD A;  2WZ1 A;  4DR3 F;  3OHB A;  3M2V A;  3ITH A;  4PWD A;  2VZ9 A;  3A12 A;  1T9U A;  4OYP A;  5KFB A;  3FBF A;  3L3C A;  1REV B;  4EBE A;  5KFF A;  2R8I A;  2DKO B;  5KFU A;  2NSB A;  3PJ9 A;  3MD3 A;  3VV2 B;  1PSD A;  4IRC A;  1S6Q B;  5GAG I;  1HYS B;  5KFQ A;  2H3E B;  5IT9 U;  2FZC B;  4DPT A;  5B0D A;  4WF9 Q;  2L9N A;  3D1H A;  1VRU B;  1LW2 B;  1UL3 A;  2YWF A;  3Q2S C;  4KT0 C;  1LK5 A;  4CLU A;  2OEJ A;  1VC6 A;  2C2N A;  3V4I A;  1TUW A;  3NNH A;  4LRD A;  2FY8 A;  2KT2 A;  1RP5 A;  4RL1 A;  2ZH7 A;  3NNA A;  3OLA A;  4NZ7 A;  1S1X B;  3TAQ A;  3KHR A;  1R8A A;  1N6Q A;  2R7O A;  3C16 A;  3ILL A;  3GIK A;  1IKX A;  3OTE A;  3Q83 A;  2ZBR A;  4TU7 A;  3PW5 A;  3DRR B;  1FKA F;  4NLR A;  3D67 A;  2HKE A;  2OIH A;  5D4P A;  2H9Z A;  3V6D B;  3UN2 A;  4LF8 J;  2PFF B;  4CH7 A;  4M63 A;  1D0E A;  4HI1 A;  2BW2 A;  4M95 A;  1FD2 A;  4DU8 A;  3R6L B;  3IS9 A;  3R7S B;  4QZV B;  1WHV A;  1VRQ C;  1X4C A;  2P9G A;  4H4K A;  1IBM J;  3VGS A;  4IQX A;  2CZ4 A;  1PYT A;  1WSR A;  2AJQ A;  2B5J A;  1YSJ A;  5IC4 B;  4P2M A;  4UUW A;  2V8G A;  2MZS A;  4DL0 C;  3NCP A;  3CJT A;  1DRZ A;  1TR0 A;  1JLC B;  1S9G B;  8RUC A;  2NZ4 A;  3BKU A;  1YJ9 S;  2CQH A;  3BGO P;  2FDN A;  2A6O A;  5C25 B;  4QIF A;  2HBZ B;  4PAB A;  5F41 A;  1LWF B;  3DU5 A;  4N77 A;  3C66 A;  3T41 A;  2OPQ B;  2CPD A;  5AXN A;  3OL9 A;  3O2I A;  4C8N A;  2RRN A;  5A76 A;  1RT3 B;  3FEZ A;  4WTO B;  3K89 A;  3D6T B;  3ZZZ A;  3SDE A;  2E44 A;  4WK1 A;  3GYX B;  3PRD A;  1GAO A;  4M5K A;  3QQC D;  5CQG A;  1GMW D;  2W2N P;  5K20 B;  1SH2 A;  5A8K A;  3MDF A;  2W2Q P;  1HKA A;  1WF1 A;  4IH5 A;  4DU7 A;  3EXY A;  4LF7 F;  4KQZ A;  1FRJ A;  1WHY A;  1AUS L;  3NP5 A;  1S6U A;  1MU2 B;  1SBR A;  2HS0 A;  1YHQ S;  2P8I A;  2WON A;  2Z30 B;  2FGO A;  2O1P A;  4NOH A;  2KO1 A;  2HVE A;  5L1K A;  4DR1 F;  2LCW A;  4DV5 F;  4FNH A;  2ZNY A;  2AX0 A;  4C3L A;  4ZVQ B;  1KS2 A;  3M4X A;  3TO8 A;  2MMY A;  4RUA A;  2R7W A;  1XC9 A;  4IH7 A;  2M0G B;  2WW4 A;  3BGL A;  4ANC A;  2UXC F;  2HS4 A;  4DV0 J;  1EQM A;  1Y4Z B;  2HBY B;  3BR8 A;  4ZP7 A;  3TA0 A;  1RTD A;  3ULH A;  1X60 A;  2WW8 A;  4URS A;  1E6V B;  2APO A;  2W9C B;  4OZN A;  1VBZ A;  1S6P B;  4QYZ J;  2EW9 A;  2HG4 A;  1EKR A;  5AXL A;  5LT5 A;  2MKI A;  1CJT A;  2V8H A;  2B43 A;  4DPO A;  3FFI A;  4B9U A;  2UUC J;  4FYD A;  1RWU A;  3KLF A;  3DDN A;  2F4V F;  2L3M A;  3B4M A;  1C0T B;  3ZZY A;  1U6B A;  2EFO A;  3CJK B;  1UET A;  5M2R A;  4DSI A;  1ELO A;  4MYT A;  4K5S A;  3QJL A;  1DAX A;  2ZH3 A;  2H1Y A;  2DGX A;  3T6B A;  1T05 B;  5D8H B;  1N33 J;  4NLV A;  4RUB A;  4V19 X;  1NZA A;  3SV3 A;  3CDB A;  4OZ3 A;  3R7B B;  2E5J A;  3R5B A;  4A8Q A;  1JNR B;  4LVN P;  4OYZ A;  1F3V A;  2LU2 A;  2ZM6 J;  1C4C A;  4DX8 H;  4KFB A;  2Y0S D;  5KFK A;  1NK4 A;  1VQ6 S;  3M8R A;  2VG5 A;  3ZC4 A;  1WKL A;  4K4W A;  1Q86 T;  4Q45 A;  3BO3 A;  2V94 A;  1M1G A;  2DXF A;  2GGP A;  4Q8F A;  3T5L A;  4BC9 A;  1OO0 B;  4AL7 A;  3ZFV A;  3IBC B;  2HND A;  1GMW A;  1WTF A;  3ELH A;  1S57 A;  1UEV A;  1FKO A;  2CFX A;  1ZH5 A;  2R7S A;  4UT4 A;  3KLV A;  1NDP A;  2HFU A;  2DT9 A;  4MK7 A;  2VQF J;  1CUL A;  1SJ3 P;  1WEX A;  1ZPW X;  5IM0 A;  5A8R B;  4ED4 A;  4YR3 A;  5KOW A;  1TL7 B;  3BV8 A;  2N4C A;  1YIT S;  1ZZF A;  2DRA A;  3EXC X;  2Z8Q A;  3J81 j;  2D74 B;  4KO0 A;  4U67 Q;  2E5H A;  4JI4 F;  1R0B G;  2VV5 A;  2J7W A;  2CQI A;  4KJI A;  3KK2 B;  3HD1 A;  1HAR A;  1F9E B;  1U2R A;  3M6V A;  3KNG A;  2HK3 A;  2YWG A;  1Q78 A;  4WFZ A;  2KVI A;  4QR0 A;  1N88 A;  4C98 A;  2E5L J;  2HGN A;  2YNI B;  2D1C A;  1VR6 A;  1D8Z A;  2ZBI A;  4HDH A;  2AU0 A;  4PG4 A;  2YWH A;  2DXD A;  4JI7 F;  5E3P A;  3TA2 A;  3CVK A;  3MM8 B;  1CC8 A;  2HWH A;  5B0B A;  2E9R X;  3W65 A;  4M5D B;  2HHW A;  1ULR A;  4ZK7 M;  2AW0 A;  2R2T A;  3MMC B;  5I4M A;  1JLF B;  1XIQ A;  1DFD A;  3PVX A;  1Q8L A;  1IBK F;  1M1K T;  4ANE A;  1K44 A;  2YNH B;  4XO0 A;  3CD0 A;  5CYM B;  1T7P A;  3H2U B;  4X4O A;  2PSZ A;  3HPO A;  4DF8 A;  1NSP A;  4FKY A;  2RNE A;  2EFV A;  1BWE A;  3KHH A;  4B3S J;  5J2Q A;  1HHQ A;  2PE8 A;  3JB9 k;  1HBU A;  2W25 A;  1UVJ A;  2R8J A;  3TVK A;  4MFB A;  3PW7 A;  4LF2 A;  4F50 A;  3Q8S B;  3HDS A;  1IBL J;  1U48 A;  3FCH A;  1VK8 A;  3AA9 A;  3KLH B;  3W1Y C;  4EGL A;  2EXU A;  2WSF C;  5KG3 A;  5CD4 A;  1IBC B;  3DOM A;  3W64 A;  4X65 J;  2MXY A;  3CJ0 A;  3IXQ A;  3MMB A;  4P74 A;  1N48 A;  1SI9 A;  4DV7 J;  4ED5 A;  2XZW A;  4CLW A;  2YNF B;  4EFA C;  1OY9 A;  2BXJ A;  3NRB A;  1R3N A;  2DHS A;  1VIS A;  5J2M A;  5KFL A;  2MQP A;  3G4S S;  2P5V A;  2KB2 A;  1LWE B;  3U1M A;  1F5C A;  3G6Y A;  2E9T A;  5FJ4 A;  3GJR B;  1S1V A;  3M8P A;  3MPW A;  3HHK A;  3NS6 A;  4DUY J;  3V6K A;  4QYZ K;  1T9T A;  2UUT A;  5M2U A;  2AMC B;  3N0V A;  3QAE A;  1DY3 A;  5HQM A;  4PQU A;  3PYE A;  5H9F J;  2IJN A;  5KG4 A;  5DDQ C;  1VQ5 S;  1R31 A;  2CYY A;  4EWT A;  1U02 A;  2J9D A;  2KG1 A;  1YVF A;  1U4B A;  3NLC A;  2PMH A;  3PYD A;  2RDI A;  4AXI A;  1FKP B;  3DYA A;  3AXK A;  2BKO A;  2I9S A;  1U2F A;  3GFY A;  2QEX S;  3MCM A;  2CPY A;  3DNC A;  1FJC A;  2QC3 A;  1VQ8 S;  4JV1 A;  3MM9 B;  5DLF A;  1CJK A;  1Q8K A;  2LQ5 A;  2P2C B;  2N4D A;  5KFO A;  5A0Y A;  3C2P A;  1KHW A;  3G82 A;  3M8Q B;  5LSR A;  2DNO A;  4DJB A;  1N0U A;  2N3L A;  1PC5 A;  3H8Y A;  5J2P A;  1EAR A;  1WNE A;  4OZ2 A;  3KUG A;  2IBO A;  4YR2 A;  2DR6 A;  2I5J A;  4Y65 A;  4G1P A;  2IHR 1;  4ECS A;  4LR9 A;  4ID8 A;  4F02 A;  1GK8 A;  3GFX A;  3QGP A;  3GFZ A;  1TKZ A;  2JEI A;  5AXM A;  2PC6 A;  1LXJ A;  1RCX B;  4FF1 A;  1B0P A;  3KXD A;  1TK8 A;  2CQG A;  2CNK B;  4USK A;  1Q95 G;  2DNR A;  5I42 B;  1JJ4 A;  2DNP A;  3V81 A;  3T1H J;  3BM7 A;  4DG1 B;  1NB7 A;  5CYQ A;  4F4A A;  2L9W A;  1HI1 A;  5HLF A;  1IKV B;  3GSD A;  3D1Q A;  5E7O B;  1JB0 C;  4DR4 J;  3WC2 A;  1FHT A;  4AUK A;  1ZAW A;  1HNZ J;  2VA3 A;  1FFW B;  4ZJQ A;  5A2Q U;  5IZH A;  3H42 A;  3TUP A;  5BJR A;  1P1T A;  4LBH A;  3DM2 B;  4QWC A;  4DDF A;  1WHW A;  1WI8 A;  4O0I A;  1VLO A;  2XC9 A;  4FPR A;  2BOA A;  3WC0 A;  4NXN J;  1T8E A;  2MB0 B;  1RT1 B;  5L1L A;  4G1I A;  1K73 T;  5HAN A;  3WIV A;  3I9V 9;  4OV6 A;  2KU7 A;  1Y11 A;  4USH A;  6AT1 B;  4IH6 A;  2DNY A;  4GC6 A;  3BDP A;  2FYX A;  4IKA A;  3W61 A;  1EQ0 A;  1MWZ A;  3MMA A;  2MY7 A;  3R5C A;  2BOP A;  1B70 B;  5I3U B;  5CCL A;  2QT7 A;  3T5K A;  1TL3 A;  5E3Q A;  3B82 A;  4W4M A;  2V6A A;  2CQ1 A;  3QZ8 A;  4U96 A;  3IRX A;  2B9Y A;  1FJ7 A;  5BR8 F;  4JI6 F;  4B3R J;  2VG6 A;  2ZE2 B;  3VAJ A;  4H4M A;  4CLT A;  5U47 A;  3BJY A;  5HP1 A;  2VPZ B;  3GSI A;  2VQE J;  5EWG A;  2W2M P;  3ICL A;  3CJ3 A;  3NBP B;  2GML A;  3MPY A;  2VBW A;  3FJ2 A;  1UP1 A;  2KT3 A;  1C1C B;  3PTW A;  4ECT A;  3T5J A;  2UV8 G;  1NH7 A;  4YEA A;  4ZP9 A;  3TZZ A;  3J7Y I;  2MZQ A;  3G8Q A;  4C11 B;  2DNZ A;  3NCQ A;  1OJ4 A;  5K5M A;  3KLI A;  5E41 A;  4AL6 A;  4O3P A;  5DG7 A;  4LSL A;  1G3O A;  3EM1 A;  3I0S B;  4RW9 B;  1E6Y A;  1ZS6 A;  1QD1 A;  1WEY A;  3MEE B;  3Q22 A;  5HSP A;  4QWD A;  3TAR A;  2ZEJ A;  3KMQ A;  3PHE A;  3KYL A;  3BQ2 A;  4U8V A;  3DGP A;  2CDQ A;  4FP9 A;  2UXB J;  4DZD A;  2Q66 A;  4RNM A;  4JI1 J;  2ERR A;  1TMM A;  5EDW A;  4KH0 B;  1MNE A;  3QNW B;  1S1T B;  4USV A;  1G4C A;  3WDO A;  2KM8 B;  3VAK A;  1F0X A;  1A6L A;  2HGL A;  3VAH A;  1NK0 A;  4UZC A;  1IKW B;  4F67 A;  1H3D A;  1JLQ A;  4LF1 A;  2V0N A;  1SH0 A;  1N34 J;  3KLE B;  1KEK A;  5IC6 B;  4KBI A;  5GME A;  2PGC A;  4DR6 F;  5H9F K;  2W2P P;  4OMF G;  2CZ9 A;  2PA3 A;  4PZV A;  2OH2 A;  1S9E A;  3OR2 B;  1OPI A;  2RRB A;  2BBE A;  1UA0 A;  5LSL A;  1YGY A;  4XTT A;  4ES1 A;  2ZWP A;  3VF0 B;  1GTH A;  4I1T A;  2PII A;  2JJ4 D;  1DTT A;  4USJ C;  1RT4 B;  5HMY A;  4HI2 A;  3J7A 1;  5LJ5 Y;  4ZPD A;  2WVE A;  4A8K A;  4DSL A;  1TUG B;  1TVR A;  5SUH A;  1Y5I B;  4KY3 A;  3R1L A;  3R27 A;  1VGY A;  4DV6 J;  2XCP A;  2J5A A;  4DL4 A;  2HLU A;  3IGN A;  2UVU A;  4WII A;  2NPI A;  1NHK L;  2PD1 A;  2V8P A;  1H73 A;  2BAB A;  3DN9 A;  3CMA S;  4KC5 A;  3EUN A;  2NXC A;  3LTO A;  1H2U X;  4DCP B;  1HBM B;  1S1W A;  3HD2 A;  3L9Z A;  4KAI A;  3RGI A;  3DLG A;  2NYH A;  4QPX A;  4I2P B;  2ZDP A;  3AHP A;  1KVJ A;  1VQN S;  3HF5 A;  3UVJ B;  3L7P A;  2LA6 A;  3KK1 A;  4LFC F;  3VGT A;  1ZZN A;  4GKJ J;  5KFE A;  4HL9 A;  3FBB A;  2HHH J;  2MYF A;  3J80 U;  1FRH A;  3R8Y A;  4M5J A;  3RB6 A;  1O5J A;  2NSC A;  4FYX B;  3CJ4 A;  3D9B A;  5HJY A;  2CPI A;  2PEB A;  1WOO A;  4JI5 J;  1R0A A;  2HAF A;  4ECR A;  1YZ7 A;  4UW2 A;  4QIV A;  2LDI A;  2F40 A;  4IG0 A;  2JC1 A;  4UUX A;  2MTL A;  1Y5L B;  3KJN B;  3UI3 A;  3HCX A;  2NXN A;  2QLF B;  5ETT A;  2BAN A;  1I1G A;  4ZLN A;  3UDV A;  3TAM A;  4AT1 B;  4K2X A;  2M8D B;  1PKU A;  1N5V A;  2WTF A;  1L5U A;  4RJV A;  4CT9 A;  3M2R B;  1S4E A;  3R1H A;  2J6U A;  4CNY A;  2UU9 J;  3VAL A;  2XMU A;  3CE8 A;  3TZW A;  5KFW A;  2J6S A;  3KHL A;  2XWY A;  3J7Z 5;  2OMO A;  3K5P A;  5F9N A;  2DY1 A;  5G0R A;  2AWZ A;  4PYA A;  5ETL A;  4LQ9 A;  1YJW S;  2KL8 A;  3T1Y F;  4D3G A;  4XPC A;  3M8W A;  1H98 A;  1QUV A;  3POT B;  1FXR A;  1GXT A;  1NBE B;  3H4D A;  4OZL A;  5KFV A;  1WTB A;  1U1N A;  4WE1 A;  1FK9 A;  2BA9 A;  3FSX A;  3BQ0 A;  4ZCI A;  2CNL B;  4HDG A;  1WC3 A;  4YR0 A;  4H4O A;  1RAJ A;  4B3O B;  3I55 S;  3SSQ A;  3LAM A;  3RW6 A;  4ZN3 A;  2IPO B;  1YX2 A;  3UD3 P;  4TNO A;  4F7V A;  4ECZ A;  2KXH A;  1SIZ A;  4AD6 A;  3PKY A;  1N56 A;  5E3R A;  1HIY A;  5LMN J;  4ED3 A;  3IBF B;  1C1B B;  3OT9 A;  5KG6 A;  4CH1 A;  2K1R A;  2GQ2 A;  3M1V A;  3MCO A;  1B7Y B;  1NK8 A;  5B08 A;  5J1P A;  2O3D A;  2FJA B;  4CO5 A;  5KFA A;  3BR9 A;  4PEO A;  3VVU A;  2E7X A;  3B8H A;  3RRG A;  1AXQ A;  1KQS R;  1N4L A;  3H98 A;  1VQM S;  4MT1 A;  1HBN B;  1RKI A;  2GVZ A;  2HHQ A;  2B4P A;  1VQ9 S;  4DV4 J;  2PA8 D;  2YWE A;  3N9U C;  3VVT A;  2NCK L;  3TWZ A;  4LF9 F;  2QYC A;  5B0F A;  1KOO A;  2AX1 A;  4NCG A;  1UEU A;  1T03 A;  1JXL A;  2DNQ A;  4CO0 A;  2ADB A;  2HWI A;  3ISN D;  1RUS A;  3BSA A;  2YKM B;  3BSN A;  4G65 A;  1RAB B;  2YPZ A;  2W2O P;  2HBR B;  2R2S A;  1R6V A;  5IWA J;  3UO0 A;  4J90 A;  3VQT A;  1HQE A;  4DX5 A;  4I7F A;  1XNR F;  3K17 A;  3JSM B;  4F2S A;  4LJM A;  4DBQ A;  3W63 A;  4PG8 A;  3MUV P;  3W9J A;  3HSJ A;  1QAX A;  1NAQ A;  1U1M A;  2EK6 A;  1VI7 A;  3L7U A;  4KKO B;  4DR2 F;  2KRR A;  3L4B C;  1APS A;  1F1B B;  3ITH B;  2FC8 A;  2RHS B;  4NLS A;  1I6J A;  3FZB A;  3MF5 A;  1KON A;  2HVH A;  4FDF A;  1FO1 A;  2ZJQ Q;  4ECV A;  1JLG A;  5GAG U;  2P9C A;  1JKH A;  1JX4 A;  1SH3 A;  1CJU B;  4CLY A;  1Y3K A;  5L1J A;  4QWA A;  4F25 A;  3GTY X;  2FZG B;  3MR6 A;  3W3S A;  1WWH A;  2AD9 A;  2QMW A;  1LEO A;  1GQE A;  2RVJ A;  4CI0 B;  1KHV A;  2C22 A;  3M6X A;  2LXU A;  4OX6 A;  1NU4 A;  4MMO A;  3M30 A;  2BE2 A;  2VON A;  3OFH A;  4O3Q A;  1N6Q B;  2DTJ A;  3LA0 A;  4R5P B;  3C16 B;  1WHX A;  3IO1 A;  1IKX B;  1P1L A;  4RNF A;  2DVI A;  2Q43 A;  2QGF B;  2C3M A;  3J7Z T;  4Z2X A;  2LFV A;  3Q0A A;  4U9R A;  3ET6 A;  1RWO B;  1T94 A;  3IC1 A;  2P9E A;  4MKB A;  3MEC A;  3JXO A;  1Y7P A;  3DU6 A;  1NSK L;  4HAC A;  2F9J A;  1OQ6 A;  3SZ2 A;  2B5J B;  3NOC A;  2JLE A;  4ZVH A;  4GKK F;  4X84 A;  1SKR A;  1NM2 A;  4Q7A A;  2XI2 A;  3FRY A;  2IM1 A;  1J5E F;  2G0J A;  1UVK A;  5KFI A;  3QLH A;  1FVQ A;  1Q16 B;  5B09 A;  4MTP A;  2R7Q A;  5DG9 A;  1RWX B;  4OZ0 A;  1RYR A;  4A8W A;  3ISZ A;  1WEZ A;  1EP4 A;  2ASY A;  1UKU A;  1HNI A;  5KFD A;  3OTC A;  4PXD A;  4JYA J;  3Q86 A;  2Y1I A;  2WHO A;  4RW7 A;  2GMH A;  5K14 A;  4CTA A;  1NSQ A;  4IFY A;  3C6T A;  4WFY A;  4C7Q A;  2U1A A;  4F4Y A;  3OTO F;  2KM8 C;  2NXU A;  3NEK A;  5ETM A;  2OEL A;  2KT5 A;  5J1E A;  3SDE B;  2DXE A;  3FKB A;  3FQL A;  2EKY A;  8AT1 B;  3Q8Q B;  1KVK A;  1N52 B;  4LFB F;  3NGS A;  2GMJ A;  4DV3 J;  2ZD1 A;  1RLC L;  1RWM B;  1K1Q A;  2VFV A;  3D5M A;  4CM0 A;  5A8K B;  5IT4 A;  3W66 A;  2DCU B;  5F3T A;  1DTQ A;  1ZOT A;  1HNX F;  3N6M A;  2BZ2 A;  9ATC B;  4BCA A;  4WYL A;  3M8S A;  2DHH A;  2WON B;  2CPE A;  2YKQ A;  3O3L A;  4JI2 F;  4P71 A;  1PBU A;  3QZ7 A;  4UTG A;  3M9N B;  2V5H G;  1KSP A;  4G1Q A;  5GMK a;  3IGV A;  5CD4 H;  1PYO B;  2PMW A;  2Q6C A;  2C2R A;  3IR5 B;  1FFG B;  2XNR A;  1LXN A;  1FEH A;  3BBC A;  5L46 A;  1RTJ B;  4I6A A;  1EHW A;  1M5S A;  3MPU B;  2E5G A;  2ATC B;  2MKY A;  2RDJ A;  4PXE A;  1DQ8 A;  4PPZ A;  3G8T A;  1RXO B;  2QIF A;  4GVL A;  2RH3 A;  4KV8 A;  2EWH A;  1CJV B;  1RTD B;  3CCV S;  4L3K A;  4DX7 A;  1SJQ A;  2KJW A;  4FYY B;  1YTY A;  2XMV A;  2X1B A;  3VHQ A;  2NS1 B;  3Q8P B;  1WJ9 A;  2HQD A;  2Z56 B;  5HO4 A;  2VC0 A;  1DAR A;  5EGY A;  1CJT B;  4WU3 A;  1FRL A;  4CLP A;  4FF4 A;  1NO8 A;  2J8A A;  4YB5 A;  3HHN B;  1NLK L;  5FD1 A;  3KLF B;  4L72 B;  4FYW B;  2KZZ A;  1DBD A;  4LF5 J;  4F36 A;  2FY1 A;  2HFV A;  2YQ3 A;  4OLP A;  5E33 A;  2IC3 A;  2ZOM A;  1A0O B;  1KLM A;  3OV7 A;  1YJ7 A;  1NJY A;  2M8H A;  4K0K F;  3MED A;  5GAD I;  3MM7 A;  1H2V Z;  3QGH A;  4MK9 A;  4NLP A;  4GC7 A;  3HKZ D;  2ACM A;  4QOT A;  3O5T B;  1QE1 B;  1XNQ F;  3E3X A;  1JJC B;  4RZR A;  2AYE A;  5F8L A;  2Q6B A;  4KFB B;  1LFP A;  3MAQ A;  2EFN A;  9RUB A;  5F8H A;  2CRL A;  2VG5 B;  2GW8 A;  3U27 A;  4J91 A;  5GAH I;  3Q8Y A;  2UV8 A;  3UQS A;  2AJF E;  2BVZ A;  2ZIT A;  2DRD A;  2CJQ A;  4NMX A;  4DI6 A;  3D4J A;  3MFH A;  3PEH A;  2QO3 A;  1B3T A;  4MYU A;  4EK2 A;  4O4G A;  2GGP B;  2XMK A;  4FF2 A;  4ZVF A;  2XUL A;  3UN5 A;  4ED7 A;  1D8Y A;  1FE4 A;  1KLN A;  3AT1 B;  1J5O B;  1FKO B;  2OPP A;  2IAJ A;  3P5B P;  2VF3 A;  2UUC F;  1NJI T;  2M2B A;  2QTW A;  3IWN C;  2MKH A;  3MCS A;  4ZVS B;  3H5Y A;  3JSR A;  2V2K A;  1XR7 A;  5HMW A;  1Q0N A;  3M8Y A;  4JB8 B;  3V6H A;  1Z2Z A;  2OD4 A;  1N54 B;  4A8O A;  2VDH A;  1R0C B;  2YKA A;  4MKY A;  4M1K A;  4DUZ F;  2UXD J;  2E1M C;  1VHI A;  2BJ3 A;  1N5Y A;  1S72 S;  4ES3 A;  3IFE A;  4DFJ A;  1VBX A;  3GV5 B;  2ZM6 F;  2HAI A;  3LP2 B;  3M6U A;  3MHY A;  4MIA A;  1Q5V A;  3CNQ P;  5D77 A;  2V4J A;  1HMV A;  2UUB F;  2CWX A;  2C2D A;  2P6T A;  1S76 D;  3BN4 A;  1HQU B;  2AF6 A;  2XO7 A;  2MKK A;  4TY8 A;  4DV2 F;  2OKQ A;  2JSX A;  4I64 A;  3WIU A;  2QLX A;  4ECX A;  4NXM F;  2JFK A;  4YFU A;  2HNZ A;  3CF5 Q;  1HD0 A;  4AYB D;  1SC4 B;  2AYM A;  1RT7 B;  4YHH J;  5F8I A;  2FVR A;  2LU1 A;  3BSC A;  4P52 A;  3DRP A;  4ZVP B;  4Q0B A;  3HHL B;  2M52 A;  3OL6 A;  4C3M A;  3TEG A;  4ZOS A;  1FJG F;  2HZV A;  2DGV A;  3TQ1 A;  3TEH B;  1SUQ A;  1V5I B;  3N28 A;  2Y1R I;  1K0V A;  3PKM A;  3R5D A;  1U7L A;  2QLJ B;  2GV1 A;  2G0C A;  5J2Q B;  1RBA A;  3FEX B;  2B7C B;  1MMD A;  2Q1L A;  1FDB A;  5EX0 A;  3K0J A;  4Z37 A;  1HBU B;  3TZX A;  1HW9 A;  2K3I A;  4MFB B;  4U7C A;  3TUI C;  1TL5 A;  3QMQ A;  5L9X A;  4OHY A;  2D7S A;  2KXF A;  1C0U A;  3RRH A;  4XDD A;  4P2F A;  3DOM B;  3RG6 A;  4J9M A;  2OHD A;  3D6M B;  3SSR A;  2QLB B;  4CH0 S;  4PXB A;  3DLL Q;  2XY5 A;  1XER A;  4USU A;  3SQO P;  4LIR A;  2HRU A;  1XMQ J;  4WWS A;  4ZVR B;  1T95 A;  3KJV A;  2GAH C;  3N5F A;  4BHQ A;  1N0V C;  5J2M B;  4XPE A;  4C8Y A;  2KFZ A;  1FWL A;  4NZ6 A;  4C6A A;  2HFO A;  4PRF A;  3U7J A;  2RF2 B;  5DJB A;  1SVD A;  2MQ8 A;  2HNY A;  2ACY A;  1S5Z A;  4IR1 A;  1G6B A;  4DF4 A;  1S0M A;  2BYC A;  3M7V A;  3GIM A;  4C8K A;  4OYA A;  4R0J A;  2J9C A;  1TL1 B;  1R6Y A;  4ID5 A;  1FRI A;  3T3F A;  3B4D A;  5F9L A;  4YME A;  2RUG A;  3H4B A;  1VQ4 S;  1RWW B;  5L39 A;  3IP0 A;  2ALZ A;  2FZK B;  1YI2 S;  5KFR A;  1O0P A;  4X65 F;  1TZ0 A;  4EMD A;  3KDO A;  4J9N A;  2EEY A;  2LXF A;  2ALY B;  2B0G A;  4L75 A;  3K5O A;  1UJ6 A;  2DIT A;  2Z2Y B;  1X9S A;  2GFF A;  4R0E A;  5AT1 B;  2M3D A;  5F8M A;  4X66 J;  3SFU A;  5A0Y B;  2LYV A;  3QIP A;  3G82 B;  3HVT A;  1O8B A;  1HR0 J;  4YB7 A;  3LAL A;  5DQI A;  3HUL A;  2DGU A;  3J7A N;  4X64 J;  1FFS B;  2I5J B;  4Q43 A;  3AB2 B;  3DLH A;  1RWP B;  3MGJ A;  4E8U A;  1WC4 A;  4J9K A;  1XTZ A;  1BY9 A;  3GMG A;  1JMT A;  4NRU A;  3ZTS A;  2GS8 A;  1UZH A;  3MFI A;  2VB6 A;  4DR3 J;  1YIJ S;  4EU0 A;  4RBV A;  2JHE A;  3IM8 A;  3VAI A;  5CYQ B;  1BQM A;  3HM9 A;  3H0P A;  2YKN A;  2PI4 A;  4DQP A;  1N5S A;  5HRO A;  2OPS A;  2RSQ A;  1RCO B;  3OVB A;  5ETV A;  2R4F A;  3DLE A;  2C2Z B;  1G7C B;  2FIU A;  1RT2 B;  2CAD A;  4UOC A;  2I0X A;  3HMJ G;  2R2U A;  2AJ1 A;  4JOU A;  4CLL A;  2HW3 A;  3UCU P;  3QO9 B;  3ENW A;  4DHV A;  1S10 A;  3CCJ S;  2HYI B;  4ZJO A;  3N6L A;  1EET B;  3PAC A;  3LQV A;  1G1X A;  1Z4U A;  2QA1 A;  3EDQ B;  1RTI A;  4DV1 F;  1LFW A;  2JC0 A;  1Y10 A;  4OI0 A;  4DLG A;  4QPT A;  3M6W A;  2L41 A;  1SJR A;  3PJX A;  4ITS A;  4PCQ A;  2GHP A;  4EYI B;  4Z7Y A;  1L3U A;  2YTC A;  2K06 A;  2WVD A;  4CYU B;  4RW8 A;  1XR6 A;  3MR3 A;  3MMA B;  4PUO A;  1K9M T;  4CP5 A;  1UCN A;  1NKE A;  2A6M A;  3LWL A;  1FT8 A;  3QJP A;  2W24 A;  1TL3 B;  3BYP A;  2E66 A;  4ED8 A;  2DGW A;  4PKD B;  3FVY A;  2W7A A;  3IRX B;  1AYE A;  3D0I E;  3DDI A;  1QM9 A;  5KAK A;  1CSJ A;  2VH7 A;  1YZ6 A;  2VG6 B;  2DNK A;  2JWN A;  2Z2M A;  2CPH A;  1V9O A;  1Q8B A;  4DN0 A;  1S6Q A;  3A8E A;  1HYS A;  2QL7 B;  4QIW D;  3GON A;  3J7Y U;  2JH3 A;  2M4M A;  2HQC A;  3HX9 A;  5ETK A;  3ZXW A;  1VRU A;  3LP1 B;  5KT6 A;  5T41 A;  3RR8 A;  2R3V A;  2O5D A;  1B4S A;  3KLI B;  4CWB A;  1JXV A;  4LSL B;  1ZA1 B;  1WC1 A;  1YRU A;  2HHS A;  1N5T A;  1S1X A;  1FF2 A;  3K7R A;  3TP2 A;  1VDH A;  2MGZ A;  2ZHB A;  1Q5Y A;  2GQQ A;  1YLX A;  4QW9 A;  3S8S A;  4I4B A;  4XIU A;  3VGV A;  3DGP B;  4MK8 A;  5HAO A;  4DPW A;  4ER8 A;  2HZC A;  3PHT A;  4OLO A;  1FX4 A;  3HFK A;  2OUG A;  3D2W A;  2RT3 A;  3PEJ A;  3VCD A;  3OXG A;  1Y5N B;  4Y28 C;  3I0R A;  1BHN A;  3BB5 A;  2FHJ D;  4DR7 F;  3AOB A;  4JI8 F;  3PX6 A;  2DNN A;  4LT6 A;  4LF7 J;  5DDR C;  2LQJ A;  3HSZ A;  4B9M A;  3BGU A;  1RLD A;  3SYZ A;  2RE1 A;  1JLC A;  2MLZ A;  1JK9 B;  1S9G A;  2VC1 A;  5KG1 A;  1LW0 A;  2VUG A;  4DR1 J;  2ABY A;  4DV5 J;  3BZQ A;  1D3W A;  2OEM A;  4O23 A;  2SXL A;  2M5Y A;  1CC7 A;  3GFH A;  2OI2 A;  1KRP A;  2B3T B;  1SL0 A;  1UVL A;  4E0D A;  4HH1 A;  2IMW P;  2DNL A;  2DD8 S;  3DHX A;  2UXC J;  4ALZ A;  2Q3P A;  1A9N B;  1DTT B;  1CLF A;  2UZA A;  1T9Y A;  3N5B A;  3CGI A;  2GVD B;  5DDP C;  4JV5 F;  4ZVE A;  2PFD A;  5KT3 A;  3EDR B;  2AZ3 A;  5DO2 A;  2IIH A;  4N8N A;  3UNG C;  1OY6 A;  2XLJ A;  1RKJ A;  2F4V J;  5DET A;  1RAD B;  2WBM A;  3HHL C;  4M94 A;  2HMI B;  5AJ3 F;  4CLZ A;  4N7T A;  1WD6 A;  3D1O A;  3QRQ A;  3MZI A;  1IKY B;  4HT5 A;  1X8D A;  1S1W B;  3LUY A;  3MXH P;  4WXW A;  2MLX A;  4KGK A;  4N76 A;  2C2E A;  2UUW A;  1UWB A;  3KK1 B;  2HQG A;  1HQ2 A;  3M8Z A;  4A8F A;  3QFH A;  5DLG A;  3GWC A;  1KD1 T;  4DL6 A;  1EB0 A;  4OQJ A;  3Q2T C;  4ATN A;  3FC9 A;  4LRA A;  3K5M A;  1VC5 A;  3AD8 C;  2XSJ A;  4UQG A;  4CCH A;  4ZDN A;  3T9Z A;  1RHK B;  1G2E A;  1R0A B;  2W9C A;  1V6H A;  3GV8 B;  3UWT A;  2G9O A;  3C19 A;  2ZOF A;  1D9A A;  2HFZ A;  4E98 A;  4IG0 B;  3PFE A;  2ZZT A;  1NHV A;  1EAY C;  4I6W A;  3CJ2 A;  4I2Q A;  2VOD A;  2ZH1 A;  1K0T A;  3J81 Y;  2HFS A;  2V4Q A;  3LH2 S;  2B7B B;  5DQG A;  1IWA A;  2B4O A;  2XS7 A;  2FHJ A;  3TAM B;  1FRM A;  4HT7 A;  2F7V A;  3NAH A;  2H48 B;  2GJF A;  3S01 A;  3E2E A;  3TAN A;  3QSY B;  4Z7C A;  1C0T A;  3CJK A;  4NEY A;  2UUA F;  1Z1Z A;  1HNW F;  2F8E X;  1T05 A;  1EJ7 L;  2K7J A;  3MWB A;  1H7W A;  2OEK A;  4DFP A;  4HYK A;  1OYD A;  4JI4 J;  1SV5 A;  3KJF B;  1QVF R;  1UFL A;  3S1T A;  5IXU A;  1FK9 B;  4PPD A;  3OR1 B;  3N4W A;  3WBZ A;  2RIJ A;  2B56 A;  3HSG A;  1AUD A;  4EZ6 A;  5MLC V;  4H4O B;  1FTR A;  5EHH A;  3F73 A;  3QT6 A;  2YH0 A;  1JLA A;  2DIV A;  4W90 B;  1UA1 A;  3EYZ A;  4RUC A;  2FPH X;  2CG8 A;  3NWG A;  2ILY A;  4WP9 A;  3E51 A;  5C2C A;  1KOH A;  3VZH A;  1RDR A;  4YDX A;  2AJ2 A;  3OFF A;  4JI7 J;  3RAX A;  2FUG 9;  1NPP A;  1T9X A;  4RR5 A;  2K1R B;  3M1V B;  2LKZ A;  4ZHR A;  3KK3 B;  4L3N A;  2Z4P A;  4QYR A;  4URG A;  5KT4 A;  2UU9 F;  2AGP A;  1EIY B;  3JTO A;  5A8R A;  3MPD A;  1IBK J;  2EFQ A;  2W9B B;  4IOC Q;  4FBT A;  2L48 A;  5KFC A;  4UQT A;  5DS7 A;  1X4E A;  2DHA A;  1OPZ A;  1T03 B;  4K8R A;  3I96 A;  1DJ0 A;  3F41 A;  1Q79 A;  4TLR A;  4FYV B;  2HUR A;  1U6Z A;  3KK2 A;  5B0G A;  1WG4 A;  3P3D A;  3BBB A;  5D4N A;  3CCU S;  2G2Z A;  4M8L A;  3WQP A;  1F9F A;  3AJ2 A;  1CG2 A;  3EVM A;  3PZP A;  4JI0 F;  1B0T A;  1HQE B;  1LQ9 A;  4ZVO B;  1QTM A;  1RHM B;  2GO8 A;  2XWX A;  3R3T A;  1X4G A;  4LRE A;  3PDN A;  4BDP A;  3V5R A;  2LQB A;  4RW6 A;  2RML A;  1NK9 A;  3HVA A;  3KG0 A;  3R97 A;  3I32 A;  2WSE C;  3D28 A;  3EJM A;  2I38 A;  3SI8 A;  3MM8 A;  5KT2 A;  2HSE B;  2Q79 A;  3DDK A;  2EI5 A;  2ZBC A;  3ENQ A;  1D1U A;  3OHA A;  4IQM A;  4F0M A;  5ETO A;  5AE3 A;  3CJR A;  2VDI A;  3MMC A;  3F0N A;  1JLG B;  5B0A A;  3CJ5 A;  4WKR A;  3JAM Y;  1JLF A;  1JKH B;  2XMJ A;  2XY7 A;  1Z2L A;  1RAO A;  3GR0 A;  2W8L A;  5C2G A;  3NY0 A;  3BPS P;  5LXR A;  3SEO A;  1N5Q A;  1GTE A;  7AT1 B;  2OD6 A;  2FB0 A;  4ZVT B;  2BEF A;  2JZ5 A;  5IV4 A;  3Q8V A;  1FXL A;  2OML A;  3VZI A;  2WAQ D;  1FX2 A;  1TFW A;  2NZC A;  4GMK A;  3V6J A;  3BO2 A;  1U1P A;  2RQC A;  1JWW A;  4FZV A;  2ATL A;  3M30 B;  2BE2 B;  3NS7 B;  3IRW P;  1WF0 A;  2M7S A;  3H5U A;  3PXG a;  3GCX P;  1I94 F;  2ASD A;  3C6U B;  3VR1 A;  2RS8 A;  5JXS A;  1VJQ A;  2BRL A;  4DEZ A;  4IG3 A;  3RB3 A;  1GMV A;  4BC7 A;  4ZLP A;  5ETR A;  4A8Y A;  4QU6 A;  1WC5 A;  4F4W A;  3MEC B;  4ZVU B;  2OFG X;  2VBZ A;  4KYZ A;  2CG4 A;  4IRD A;  4HAC B;  1LWE A;  1WDT A;  2GIQ A;  3GG0 A;  2VIC A;  2EKN A;  3KDN A;  2H54 B;  3W8G A;  1NCL A;  2HHX A;  3RBE A;  4OHV A;  4F3O A;  3UNY A;  2HBQ B;  1VFJ A;  1UFK A;  1Q53 A;  4Y2I A;  3MOZ A;  1RTZ A;  3MTJ A;  4Y3C A;  1MRO A;  1U47 A;  2DB1 A;  5GAE I;  4ETX A;  4LMZ A;  5ADZ A;  2VBX A;  4I6Y A;  4O0N A;  2MQL A;  2KI2 A;  1EP4 B;  3W9I A;  4R25 A;  4RO0 A;  1JLE B;  4RW7 B;  3ZZU A;  2CQB A;  2DR8 A;  5K14 B;  3R5G A;  1RQ0 A;  1VYA A;  2G13 A;  2CPF A;  5J1N A;  2HFN A;  2RB7 A;  5J1E B;  4AQY F;  2BJ8 A;  3K5N A;  1WF2 A;  2WRM A;  4OYB A;  5HVG A;  1RA7 A;  2BUN A;  2ZD1 B;  3G6E S;  1F6T A;  3H90 A;  4KPY A;  1TMJ A;  3DLB A;  1DTQ B;  2CDR B;  3IAS 9;  3HJF A;  2VBY A;  2ZZN A;  3NGK A;  2XBP A;  2ZVI A;  2C3U A;  4C8Z A;  4OYM A;  5ETP A;  4G1Q B;  2IM0 A;  1SJF A;  5HVH A;  2GAG C;  2J0Q D;  3GIJ A;  1FES A;  3CT9 A;  2RQ4 A;  4EUV A;  5D0E A;  2NXE A;  1WDD A;  3OD2 A;  3GPA A;  1FJE B;  2HVI A;  2VL1 A;  2V50 A;  1B7F A;  4DS5 A;  2IRX A;  4KSE B;  4CNZ A;  3BPD A;  1X5S A;  2POK A;  3G6X A;  4R8U B;  1YBU A;  4Y2C A;  2IVY A;  2M70 A;  3QRR A;  4J9S A;  1T02 A;  5KG0 A;  5BR8 J;  4EO8 A;  4JI6 J;  2HVD A;  2W1B A;  1DUR A;  1CS4 B;  1T9V A;  5D3G A;  2HHU A;  2ROE A;  2JEG A;  3CC2 S;  1FEE A;  1S77 D;  4NLD A;  2C3P A;  3WX8 A;  4WZQ A;  2R7X A;  3M2U B;  5E3A A;  4B3M F;  1M5O C;  2PMZ D;  3LW5 C;  4MKA A;  3AJ1 A;  3SCJ E;  3VGU A;  2J0X A;  2CPJ A;  4RNO A;  5J2N B;  4OL8 A;  2W7P A;  2R9L A;  3AXM A;  1ZTT A;  3ONQ A;  5MAO A;  3MEG B;  1RT1 A;  2E5I A;  1UJ4 A;  1QLN A;  3LAK A;  4U7U D;  5GAD U;  3OFG A;  4KHP F;  2KYZ A;  3Q89 A;  1MW7 A;  3FEY B;  3KNA A;  3MM7 B;  1SCJ B;  3MM6 B;  5K8O A;  4AE5 A;  2IVM A;  2EFG A;  4WK3 A;  1NKC A;  2CJ9 A;  5I3U A;  3WX4 A;  5GAH U;  3TUJ C;  4Q5V A;  2YY3 A;  5ITH A;  3DMJ B;  4BWM A;  3ZZP A;  2G1D A;  2X3D A;  3I6P A;  3B6B A;  5H9E J;  1BUX A;  2ZE2 A;  2LA4 A;  3NL0 A;  2ZH2 A;  4F4X A;  1A7G E;  4O4G B;  1FTC A;  4QJV A;  1KFS A;  3QBC A;  2IA0 A;  2OO4 A;  3NBP A;  2WOM A;  2DK2 A;  2H51 B;  3PO4 A;  4NPO A;  3RTV A;  4OX9 J;  2OPP B;  1JLB A;  1C1C A;  2IAJ B;  4XAK A;  4DR6 J;  4X4R A;  2ZKU A;  2KFN A;  4K5R A;  4C11 A;  2DNG A;  4LF5 F;  4ZS6 A;  1RU2 A;  4IO1 A;  2D3U A;  2XCA A;  4GO7 X;  3H5X A;  1U26 A;  4RW9 A;  3TRG A;  4C0O C;  3MEE A;  1U1Q A;  1YJT A;  2CNO B;  1SC1 B;  5KG2 A;  2DH7 A;  1N5Y B;  2DR7 A;  3FNN A;  3FRZ A;  4QWE A;  1H38 A;  3BGF A;  3CMQ A;  2PI5 A;  2CUY A;  1S1T A;  2GIR A;  2V4J B;  4TVA B;  1JQG A;  4J7C A;  3US5 A;  1TK5 A;  2AV5 A;  4CO4 A;  4NYZ A;  5BYR A;  2B8Q A;  4I0W A;  4O3R A;  2A10 A;  3MM5 B;  2W9A A;  5T14 A;  2JOQ A;  2HWT A;  5CAA A;  4TY8 B;  1BLU A;  3AH6 A;  2XNQ A;  4BS2 A;  1HA1 A;  4I56 A;  1UW9 A;  1S0N A;  1HPZ B;  4N47 A;  4KHM A;  4ETZ A;  4RKU C;  3H20 A;  1JIH A;  3C15 A;  4E2F B;  3KOA A;  3DRP B;  4ZCM A;  1BE4 A;  3E8O A;  1LWC A;  2RHQ B;  1FRK A;  4LFC J;  3CUN A;  1OSD A;  3KUH A;  3ZZO A;  5D0R A;  2CQ2 A;  4P72 A;  3R2C J;  1ZA2 B;  1NND A;  1Q81 T;  3PW4 A;  2YWK A;  4ZLJ A;  4IRK A;  3D68 A;  3O44 A;  4DQS A;  1HWU A;  4LVO P;  1SUQ B;  1YKW A;  2F8H A;  1AW0 A;  3X3U A;  4FF3 A;  2V2Q A;  3OBI A;  2M9K A;  4LRC A;  5K8N A;  1NXI A;  1BC6 A;  1RAE B;  3QID A;  4TQR A;  4CLK A;  4G6V B;  1FDA A;  2DGQ A;  3DRS A;  3O1L A;  5CHC B;  1XQI A;  4K50 A;  4A4J A;  2YX7 A;  3L09 A;  4AFF A;  3EGZ A;  2DIS A;  3EPG A;  1C0U B;  2I1R A;  3W60 A;  1ROF A;  5D4L A;  3RBD A;  3SMZ A;  4UOG A;  3ILO A;  2FLN A;  1X4H A;  1VQK S;  4TN2 A;  2QE5 A;  1HBM A;  2MQO A;  1U1O A;  2DR9 A;  3GIR A;  4I2P A;  1RBO B;  2D9P A;  3T1Y J;  4HTI A;  3R7N B;  1VRT B;  4NLT A;  4K4Z A;  4DPY A;  3ETM A;  4OV1 A;  2HNY B;  3TAP A;  5H1S V;  1D9F A;  4B3T F;  2RUS A;  1HHS A;  1O6X A;  1Y9O A;  2K2P A;  4GO5 X;  3M32 B;  3CXC R;  1FE0 A;  3OJU A;  4PQA A;  5LSO A;  1I51 B;  2BKN A;  2IM3 A;  2NLW A;  1RZM A;  1Q7L B;  5T7L A;  3MUT P;  2HS3 A;  2RIL A;  2OJ3 A;  4J9Q A;  3CO0 P;  3CD5 A;  1W26 A;  3KUE A;  1NPR A;  2OPR A;  4CO1 A;  2R2R A;  3FBC A;  1NSA A;  3W8P A;  1U49 A;  4TYB A;  1TQL A;  2LLZ A;  3D6F B;  4LIW A;  1LKZ A;  2GHV C;  1QSL A;  1PJ6 A;  2XGQ A;  3BGR B;  2CXE A;  3IR6 B;  4P7V A;  2AGO A;  1CBK A;  5C7P A;  2KG0 A;  3G8S A;  4ZLL A;  2RAQ A;  1MN9 A;  2FVQ A;  4LF9 J;  2KFY A;  1UAW A;  3QIP B;  4RWX A;  2MJN A;  3M9M B;  3H2V E;  4WP3 A;  3T6J A;  3RU0 A;  5LM7 E;  4OX7 A;  3ISN C;  3N01 A;  3CCT A;  4ZMM A;  5IOL A;  2CQP A;  2XS5 A;  2DEJ A;  1VHF A;  1NK5 A;  1C2P A;  4OI1 A;  1MMN A;  1QSY A;  5H9E K; 
#chains in the Genus database with same CATH homology
 2E5L J;  4NEZ A;  4PWW A;  4LF8 J;  2MTL A;  3W1Y C;  1XNR J;  4KY3 A;  4B3T J;  5FLX U;  4X65 J;  4HHU A;  3IMQ J;  4DV6 J;  4JI0 J;  5LMU J;  4DR3 J;  3OTO J;  4DV7 J;  4B3R J;  4DR4 J;  3D3B J;  5LMN J;  2UUB J;  1HNZ J;  2UUC J;  2VQE J;  5BR8 J;  1IBM J;  4JI6 J;  4RJV A;  4DV3 J;  4DR2 J;  4JV5 J;  4DV2 J;  1I94 J;  5A2Q U;  3D3C J;  4JI3 J;  4JI7 J;  2VQF J;  4X62 J;  4LFA J;  2UU9 J;  4LFB J;  4AQY J;  4V1A k;  4LF7 J;  4NXM J;  4LF4 J;  2KVQ E;  1N36 J;  4YHH J;  2F4V J;  1N34 J;  5IT9 U;  1XMQ J;  4DR7 J;  4JI8 J;  4LF5 J;  4KYZ A;  4X66 J;  1XMO J;  2MEW A;  4NEY A;  4YY3 J;  4LF6 J;  4NXN J;  4OX9 J;  1N33 J;  4DV4 J;  5AJ3 J;  1HNX J;  4GKK J;  2KL8 A;  4B3M J;  3R2D J;  4DR6 J;  1IBK J;  3J81 U;  4DUY J;  4GKJ J;  4DR5 J;  2UUA J;  4DR1 J;  1FJG J;  2HHH J;  4LFC J;  1HR0 J;  4DV5 J;  3J80 U;  1J5E J;  3T1Y J;  1N32 J;  4JI2 J;  1HNW J;  3R2C J;  4B3S J;  2MQ8 A;  4LF9 J;  2ZM6 J;  3J7A N;  4K0K J;  2UXD J;  4X64 J;  4JI4 J;  5LM7 E;  4DUZ J;  4DV0 J;  4DV1 J;  5IWA J;  4JI5 J;  4KHP J;  2UXB J;  1IBL J;  4JYA J;  2UXC J;  1XNQ J;  3JAM U;  3T1H J;  4JI1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...