5LMNJ

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5lmnJ00
1XMQJ 4LF8J 4LF6J 5AJ3J 2UUCJ 4DR2J 4X64J 1I94J 3J81U 4JI2J 1IBMJ 4X62J 2E5LJ 2MEWA 4V1Ak 4DUYJ 5LMNJ 4K0KJ 2UUAJ 4JI6J 4DR3J 2UXCJ 2VQEJ 3R2DJ 5IT9U 4HHUA 4JI3J 4JI7J 4JI8J 1IBLJ 3J80U 2MTLA 4DR6J 3W1YC 5A2QU 4NXNJ 4B3MJ 4LF5J 1HNZJ 5LM7E 2ZM6J 1XNRJ 1J5EJ 4DV1J 2F4VJ 1XNQJ 4B3TJ 4X66J 4AQYJ 3IMQJ 4LFCJ 4KHPJ 1N36J 4LFAJ 1HNXJ 4JI0J 4RJVA 3J7AN 1HNWJ 2KVQE 4B3SJ 4LFBJ 4B3RJ 4JYAJ 4DV3J 2KL8A 4NEYA 4OX9J 4X65J 2MQ8A 3T1HJ 4YY3J 2UXBJ 4DV5J 5BR8J 4DR5J 1IBKJ 4LF4J 3D3BJ 1N33J 4KY3A 1XMOJ 1HR0J 3OTOJ 2UXDJ 4LF9J 3D3CJ 4LF7J 5IWAJ 5FLXU 4DV6J 4NXMJ 1N34J 3R2CJ 4DUZJ 2HHHJ 2UUBJ 4GKJJ 4JI4J 1N32J 5LMUJ 4DV4J 4DV7J 4KYZA 2VQFJ 3JAMU 2UU9J 4JV5J 4PWWA 4YHHJ 4DR4J 4NEZA 4DV2J 4JI1J 4DV0J 4DR1J 4GKKJ 4JI5J 4DR7J 1FJGJ 3T1YJ
chains in the Genus database with same CATH superfamily
3ETMA 3VHQA 4NA1A 1RT4B 4NRTA 1AYEA 1UL3A 2P8IA 2J6UA 2HFZA 1PSDA 2HZAA 3MPWA 1N52B 4LF6J 1VQKS 4RPFA 4WYLA 5E0OA 1JX4A 1SL1A 1I94J 1K8AT 2I2YA 3C6UB 3IXQA 3Q2SC 4RW7A 2DT9A 2CADA 3ET6B 3IR7B 5BYSA 4ER8A 1NH8A 5G0RB 4PEOA 2XY5A 5A8KA 1LW2B 3MPYA 5E3PA 4DUYJ 2CPXA 1TFWA 2E9ZA 4N8OA 1HMVB 3EM1A 3AFGA 3GFZA 3GV8B 2BQRA 1MNEA 3RB4A 3HHLA 3G6ES 2PSZA 2QMWA 3X3UA 3QJJA 3MEEB 1ZPWX 3V6DA 5H9FK 1KD1T 4ZJOA 1FDAA 4ES2A 5GADU 2MQOA 4F04B 1DTQB 3JS9A 3NKYA 1HW8A 5DM7Q 4ECZA 1VMBA 1FNOA 3V4IB 3S01A 2F40A 3KLEA 4NXNF 1C1CA 4LRFA 5DM6Q 2XLKA 2K8GA 5LMUF 2AJ4A 4DV4F 2BRKA 3CJ8A 4DR1F 5B7WA 2AMCB 4NI2A 5KFHA 4HI2A 4KIAA 4NMLA 1Z2ZA 3UI3A 1HLWA 3DLGA 2NREA 1VRTA 2MLYA 4JV5F 2ZUAA 3MMCA 4Z37A 4P75A 5KOWA 5KFAA 1NBEB 3AHPA 3Q8UA 5DQHA 2F3JA 1B64A 1SB6A 3KMQA 5K5MA 3M32B 5A8RB 3QYYA 1N34F 3TW0A 5JMNA 4TY8B 4LT6A 3HFVA 3UDCA 3CO9A 1FJEB 2C3UA 2RDDA 4DU8A 3CJ4A 1BY9A 2RQKA 4EBCA 4ED3A 2CQ2A 4MK8A 1S9EA 3KJNB 4UQTA 4QPXA 3C8YA 1P8GA 2E7VA 1IWAA 1R31A 1B70B 4B3SJ 1IUJA 3TVZA 2YKQA 4FN5A 1D8ZA 1TL1A 3GV7B 1RA6A 1D1UA 1O6XA 3BEGB 4LR8A 3CDAA 3CC4S 3W3SA 4JYAJ 4LBHA 2HW3A 1KLMB 5D3GA 4A47A 2DHXA 4O3PA 3T1HJ 3FSXA 3VAKA 1VQ7S 3SV4A 3UDEA 3NOGA 1UCNA 1XR7A 1B7FA 3D68A 4UY85 3HHLB 4PUOB 4Y2CA 3UW1A 2OPRA 1C0TB 3D1HA 3MM9A 4M5LA 5I3UB 4IOAQ 1NJZA 1KLNA 1T95A 4NZ7A 3U7JA 3DCAA 4OZ2A 1RLCL 4KGVB 1PJ7A 4LFCF 3H4DA 3QAEA 5IT9U 4ZPDA 4XK8C 3OL7A 2XCAA 1DQAA 2R8HA 2Y9HA 4OX7A 2LLZA 4OI6A 2DNZA 1Z1ZA 1R6YA 3GG0A 1GMVA 1QAXA 3UD4P 2FVSA 4M95A 2KN4A 3MM5A 2C42A 1O0PA 2M5YA 3QT7A 2B9WA 2LQ8A 4XTTA 5HANA 3NGDA 4Y65A 2RS2A 1KVIA 3NNHA 1YSJA 1RHMB 5L38A 2WONA 4DMZA 2JOQA 4PYAA 3U27A 5KFWA 4GMKA 3ICLA 4PR6A 3R5JB 1I94F 2UXDF 1HQ2A 5EDWA 4F4ZA 4NLWA 2GJIA 4HLBA 3UDLA 4NL5A 2G0IA 3M05A 4LF5F 5IV4A 3D54A 4N47A 3DOLB 3KHHA 1IBCB 3MDFA 4YP3A 1AZSA 1DARA 2WRMA 4NPOA 2WCXA 2O5DA 2YQ0A 3M6VA 3D0HE 4C7QA 4DR7J 2CKWA 4NLVA 2PFDA 4B08A 4YS2A 3T3FA 5KG0A 2CA9A 2UXCF 2W8KA 1RGVA 2JVOA 2V6AA 2W24A 3OTBA 4F4AA 5J1EB 1GXUA 2GAGC 1CJKB 3OTOF 2B8QA 1X4AA 2CJXB 2ZNZA 5J2MB 3HFKA 1Q0NA 1HQEA 2KB2A 2W01A 4YB6A 3DLBA 3DXBA 4CWBA 2HMIA 1U6FA 1UPMB 2FD2A 4LUBA 3QGGA 3Q24A 5KFTA 1UVIA 1HNVB 1PYOB 1RZMA 2R7TA 4BCAA 4MT1A 3CD5A 2DPJA 2AEMA 3L7PA 5DGAA 2J7UA 2R7RA 1UA1A 5BYRA 3LUYA 4OYWA 1N5QA 3G8SA 2LEPA 3SCJE 3DDIA 3LH2S 1Q7LB 1ZETA 2UXCJ 2ZH1A 2CNNB 3QIPA 1QVGR 2AF6A 2A2CA 4A8WA 2EFPA 2JFDA 1JLGB 3L7UA 3R3TA 1S1UA 1H3DA 4H4KC 5A6WA 3IG1B 2AGQA 1JLEA 4DR6F 3GFHA 2M8HA 2F8EX 1AB8A 2HPUA 3O3LA 3UFCX 4ELVA 4LF5J 2HLTA 4KO0B 2I38A 5GADI 1EARA 3ZTPA 4QWBA 1M90T 3EGZA 3FQKA 3M4XA 2XMWA 2H4WB 3HVWA 3BJYA 1WKLA 2MQMA 3D67A 3PYGA 5KFXA 2VF3A 4QOTA 4RW9B 4JI6F 3KHLA 1U26A 4OZ0A 3CJKB 1QAJA 2XSFA 2VG7B 2LA6A 3AD7C 4N77A 2DYAA 3VVTA 4CO0A 4ED4A 5EN1A 2VKRA 4OHWA 4ZP9A 1G6BA 2R7SA 3BF4A 4EO8A 2XQCA 4Q0BB 1LWEA 3EGVA 4WTYA 4CTAA 3ZZRA 5A8RA 2FLOA 2PC6A 3M32A 1IQTA 2QFIA 4URSA 2W9AA 4GVBA 2AZ3A 1HNWF 4DL6A 1HBNA 3MWBA 4DG1A 5EWGA 1FRHA 3TJ8A 2HHHF 3DGVA 3BKUA 2ZEJA 1F9HA 1H7XA 1NLKL 3CJ2A 1TR0A 4LRDA 5GAHI 2MZQA 2XO6A 3R5GA 5G4DA 5J2QB 2F4VF 2GX8A 2V4JA 4CNZA 5IFMA 4YR2A 5DG8A 1X9WA 1WOPA 2WB1D 2UXBJ 1T3OA 3EZOA 3ZZOA 2R8JA 2PIIA 4LF4J 3KUGA 1RKIA 3HKZD 2W4DA 4I64A 1J5EJ 1CS4B 2B6AB 3F41A 3PZPA 2KI2A 1S48A 4RUHA 2QJ3A 1DTQA 3NGTA 3NS5A 2BR0A 4E0DA 3MEDA 3A8KA 4WPAA 5CCMA 5IM0B 5KFFA 1S1UB 4YB1P 3GV5B 3BQ1A 2W7AA 1ITPA 4DX6A 3GR1A 1RADB 2RT3A 3TZZA 4BBYA 1Y0HA 3MURP 1I5OB 3MEDB 4F4XA 1I3OB 4C9DA 1R0AB 1U7LA 2GQ2A 2EVZA 4QIFA 4OYMA 3DLEA 1NSQA 5HP1B 3HLUA 1TKXA 2ZITA 5EX0A 4FS2A 4MTPA 5KAKA 3O5TB 3A13A 4HACB 5DDOC 3HVRA 2MKCA 3OT9A 1ZS6A 3DN9A 4K2JA 3VR1A 2QMUB 4TY8A 3AJ1A 3VGSA 2Y1RI 4CQ1A 2BRLA 1FDNA 2LVWA 1VIXA 5CQGA 2GAHC 3TA2A 3TP2A 4CLZA 5IT4A 2WVBA 4Q0BA 1LWEB 4NEZA 2CJAA 3NAHA 1R27B 3CMAS 1LWFB 1C4AA 1X4CA 2KO1A 3LP1B 3DRPA 3KDOA 4ZP7A 1UWAA 3T1AA 4KV8A 4P74A 4ZVOB 1B3TA 5D0GA 4CM0A 2LYVA 2FHKA 1QLNA 2CJYB 4F3MA 1IKXB 2GZOA 2AEFA 2CZ4A 4P71A 1KONA 4HT5A 4FP9A 5AE1A 1N6QB 1AXQA 1OY9A 5D3GB 1FF2A 1RAGB 5KT5A 1RHKB 2H9ZA 2P6TA 4F7VA 5AJ3J 3W8PA 4AE5A 1SL0A 4BLGA 4A8XA 2KM8B 2FC9A 4WU2A 2QLXA 1CS4A 4HTIA 4O4GB 5KTQA 5DQGA 1NDLA 4WBFA 4KHMA 1VRUB 2LQ5A 4I68A 5KFMA 3DI6B 3Q86A 5T41A 3WX8A 3OVBA 2RE1A 1QSSA 4EGLA 3LWLA 1TL3A 2XTJP 4CLTA 2YWFA 3MAQA 2PGCA 2Y3YA 3QPIA 2JX2A 3CDBA 2R7XA 4I6AA 4WP9A 2QLBB 1BGXT 4WIQA 4X4SA 3CJ3A 3OTCA 1CULB 2CPIA 4KGZB 3H20A 1JJ2R 4TU7A 1EAYC 3L09A 3BPSP 1KVKA 3C66A 2BJ1A 1FRKA 1PIEA 5ETSA 2JEGA 4C0BA 3H4BA 3MM7B 2WVEA 4IG0A 4DX5A 5KFCA 3IBFB 1WF2A 3DGPA 1FDBA 3RW7A 4J9QA 4DL4A 2VA2A 3HX9A 3MECB 3PFOA 2E1RA 4CLSA 4QWAA 5BYQA 1HWKA 1BQXA 1FX4A 1FRIA 4G65A 3SSQA 5GAHU 1RK8A 1WJ9A 3TAMB 4U7UD 2F8HA 4UUWA 3N0VA 3QQCD 3P96A 2UVUA 8RUCA 4C6AA 1J2VA 3QRPA 4KHPJ 4K4TA 3KWMA 3KLHB 2JVRA 4PQUB 2HRTA 3ILJA 4ZLLA 2Q43A 2M2BA 1IKXA 4FXVA 2BJ9A 4JI0F 1N6QA 5A2QY 2R9LA 4LVNP 1FO1A 2EK1A 2VG5B 3UN5A 5F9NA 1FA0A 2MKYA 1OQ3A 2V2ZA 3DOMB 5F41A 4UZCA 5KFQA 2YX7A 1CJUA 2AYMA 1WHVA 1JXLA 1HHSA 4X4UA 4EZ9A 7FDRA 4IFVA 1SIZA 3HHLC 2Q6BA 3C15B 3N4WA 4PABA 3ULHA 3W5ZA 1TELA 4J9RA 1L5UA 1RTHA 2BJEA 2HWIA 3EXYA 1YIJS 3DMJB 3H5YA 4QU6A 5F8MA 3ITHA 2D3UA 1EJ7L 5C24A 4DL7A 1PG5B 1N33J 2L9WA 2FIUA 2Z2MA 4NA3A 2AJFE 2VBZA 4QCLA 2NR0A 3V81B 2ILZA 2KKHA 5KT4A 3ZNUA 1H38A 3QRRA 1REVA 2RS8A 2ROPA 1N0VC 3MAHA 5F8HA 3K8WA 1S0MA 4FF1A 4DSJA 1RTIB 3D7SB 2Z57B 4HT7A 5LL6d 2CJQA 2ASLA 3QO9B 1FRXA 3GJRB 4NWBA 1RCOB 2YQ3A 2FY1A 3I5BA 5KFUA 3K59A 1S72S 1EZZB 5F3TA 1HNIB 4OI3A 3G6YA 4NYZA 2RRNA 2B5JB 2P9GA 4BC9A 4CO4A 4P52A 5CXTA 3CMES 2QL9B 4DV7F 1HBUA 3OXLA 4DPUA 2X1AA 1ZTWA 2UU9J 1S6QB 3HCXA 3QT6A 5DGBA 2C28A 1RT4A 2APOA 2V8PA 2W4CA 1RHRB 1RI7A 2VFUA 3ZTOA 4CLLA 2HZVA 2WB4A 4F2SA 3JSRA 4W98A 5EWEA 2DEJA 3PHEA 2JHEA 4MIAA 1GXTA 2LA4A 2BQUA 4BWJA 3L4BC 3VVUA 4X4QA 3T1YJ 2XYGB 1U49A 2RB7A 4H4OA 4KFBB 3I5AA 3AD8C 4Z7CA 2QO3A 2Z56B 3NCQA 3BGUA 4NASA 3FSIA 3UNYA 2N3LA 1MW7A 1FERA 2RHSB 2ZZNA 3SZ2A 3OR2A 1IBMF 1X4EA 2QT7A 4WFBQ 4PPZA 2W7PA 4EYHB 1B4SA 1HMVA 1X4FA 1VHFA 3PYFA 5CYJA 4FS1A 1SH3A 4OYAA 1SKSA 1RYSA 3GTYX 2QLJB 3CGIA 3I5CA 2R2RA 2E5LJ 2MKSA 3DMJA 4JI2J 2WVFA 2V68A 5IC4B 3M8WA 4B9VA 4OHYA 2MGZB 5HROA 5ETVA 3KJVA 5KT2A 1EQMA 1ELOA 2YPYA 5B0DA 4PWDA 2GMJA 2WK4A 3C14B 1FRMA 4RW8B 5F8JA 2MKHA 4JI6J 2UV8A 3BH7B 2OAUA 1N32F 1CJTA 2BE9B 4WE1A 2KG0A 1ZBTA 1C1BB 1Y4ZB 2COLA 2P2CB 3KG4A 3KLIA 4NLOA 1U0HB 2O67A 2KM8C 2R8IA 3PYDA 4ELUA 2HHSA 4I7FA 4P7TA 3ENQA 3DLGB 4ZMMA 5K9FA 1GNKA 5ADZA 4ZLJA 3QZ8A 4RW6B 3L95X 1UW9A 3W9JA 2H5JB 5L1KA 4P72A 1LQ9A 1R43A 3SQGB 2YNFA 3JXOA 1C1BA 1S5ZA 2EWHA 1RWWB 3KLIB 1U25A 4DF4A 1NB7A 1QVFR 4B3MJ 4K4SA 4Y6IA 3G82A 2W4PA 1PBAA 1VLYA 2R7UA 3NP5A 5HSPA 1T03A 3BB5A 4X4OA 4LF1A 2OFGX 4UZBA 3MR7A 5F0WA 3QFHA 1U2RA 3M30B 1R0BG 3P8BB 4NLYA 4ECYA 4UQGA 3HFZB 5L46A 3K5NA 3O44A 4WKYA 3W66A 2ZWOA 3V6HA 4ZK7M 3TR5A 4X4VA 2CQDA 3H42A 1G7CB 2GHVC 4OFZA 2DGXA 4OLOA 2B4UA 1R7IA 5DG9A 1RYRA 2N4DA 5AXNA 3MMBB 3OJSA 4ALZA 3B4DA 2IRXA 2D3O1 2VODA 3J7AN 3CDWA 5D4NA 1A0OB 2EC2A 1R3NA 4OHVA 3CCMS 3WHIA 3KTQA 2Z2ZA 2VONA 4U8VA 4DV3J 1WEYA 2O01C 4ILRA 2V2QA 4OZLA 2VPYB 1CVJA 4YOEA 2IAJA 5HQLA 4YB7A 2XLIA 1NK0A 4U96A 4DR5J 2B4PA 4A8KA 1IBKJ 4EEYA 3N5FA 2HAIA 3HZEA 5G0RA 3EGNA 3M2VB 1SCJB 2FVCA 1NKCA 2IAJB 2UXDJ 1FK9B 3JAMY 3AA9A 2CQCA 6FDRA 1M5OC 2F9JA 3POTB 4RW6A 1RTDA 5FDLB 2ACMA 1UETA 3FZ2A 3W5YA 4RZRA 1S97A 4USWA 2XNRA 2C2MB 2VFVA 4QWDA 2KDOA 1RISA 2V5HG 2MLZA 3BM7A 1R0CB 4UUXA 1AUDA 1A7GE 1MMDA 4AL5A 1U1KA 4MJKA 5KT3A 1YRTA 2XM3A 1A9NB 2K7JA 2FZCB 1MWZA 4DL3A 4LBPA 2HBQB 4ZCLA 5E3CA 2ASYA 3MCOA 2YH1A 1VQOS 4OYZA 2IA6A 1HARA 5RUBA 2RQMA 4QW8A 1TL7A 3HSGA 3H25A 2HFVA 3IR6B 3IGNA 4YB5A 1UVKA 4NCAA 5B0FA 4NXMF 3FEXB 3B8HA 4C11B 4DV6F 4DQPA 3I31A 1H72C 5K8PA 2E29A 1CPZA 2MXYA 4NLPA 3E01A 4O3NA 4TU8A 4IOCQ 3VCDA 2XI2A 1TKDA 4NZ6A 4JI1F 3DU6A 3GLJA 3AA8A 3BPDA 4IQXA 2UXBF 2HFNA 1ROFA 2AWZA 4AD6A 3OR1B 4GVBB 2CNLB 1EX8A 1BQNA 2OI2A 3DM2B 2UUCJ 3LP0B 4NLGA 2ZZMA 3P6YC 4DLEA 1IBMJ 4UY8T 4X62J 1YI2S 1RBAA 2ZH4A 2W7OA 4PG6A 3GU0A 5A8WA 4V1Ak 3T9NA 1RT3B 2C3YA 3CVKA 1X9SA 3QJPA 2VA3A 1WWHA 3U1NA 2PE8A 3ADAC 4X65F 2H51B 2CPEA 3DYAB 4ZVGA 2C2NA 3UR0A 1TMJA 2BKOA 2KRBA 2U1AA 3PJXA 5IT0A 4IH5A 4K0KJ 1CG2A 5I4MA 5A8WB 1V3RA 3IRXA 2Z4PA 2IC3B 4Y2MA 2GS8A 2FJXA 3NMRA 4OYIA 5IQ6A 4HHUA 1IQZA 1H2TZ 2HQIA 2OSRA 4EFAC 4ECQA 1IBLF 5U47A 3OW2R 1X8DA 2OELA 2K3IA 3V6DB 1NJWA 1N5YB 2NXNA 2YX4A 3VWSA 2FJWA 4LRAA 4L75A 4B9TA 4FF3A 1JXVA 2FB0A 2L3MA 2Y0SD 4NXNJ 1WOOA 2NSBA 4F36A 1KN6A 1NM2A 1TVRA 1Y11A 2JLFA 3D4JA 3DLEB 3W2WB 1HBMA 2N7CA 4DWIA 4J9NA 3IO1A 4CO5A 4FBUA 1F3FA 1L3TA 4B02A 4F8RA 2X1FA 2LEAA 4DV3F 2IM0A 3KKFA 3HKWA 3UVJA 2FYXA 3MOZA 3QNWB 3H90A 2OLWA 4M5JA 3M9NB 3OXFA 5HI7A 3TZYA 4DSKA 2H5IB 1FE0A 4USMA 4X2BA 1VQ9S 1AW0A 3M9MB 3MFIA 1SQFA 3DRXA 1Q8KA 2IM2A 5ETLA 2BKNA 3VQTA 1UA0A 1RAFB 3B4MA 2KHCA 1RT1B 3F44A 3BYPA 3L9ZA 4U7CA 3KG0A 2Z2YB 1F3VA 1N8RT 3ET6A 4BWMA 4NEYA 2B6AA 3PVXA 3BN4A 3RZAA 2ZD1A 3KJVB 4NLTA 3CULA 2GHWA 2B9XA 5D0EA 2ZH8A 3EICA 2DO0A 1VQ8S 1BWVA 1DBDA 1RT1A 3DOKA 3RJMB 2JNJA 3M1VA 4DHVA 5GAEU 4DV5J 1UJ4A 1MN9A 4WZQA 1ULRA 3LGHA 3QGPA 3CF5Q 2I8EA 1HWIA 2QA1A 5CD4H 3ZXWA 2KFZA 1VRUA 5KFJA 2C2RA 4KY3A 1ZM3A 3CJRA 4EYIB 5BXIA 4JUZA 2ALZA 3J80Y 1PILA 1GTEA 3P45B 1NJXA 2XMAA 1N5SA 2D9PA 4ZDNA 4H4MA 5GAEI 4LSNA 1NB2A 1DHMA 5ETMA 1T9YA 2QZ8A 2F63A 3LGMA 2DHSA 1FD2A 3LA0A 5AXKA 1KNZA 3OFGA 1MU2B 1TVRB 2MJNA 2M7SA 4HDGA 4C48A 4Q8EA 1P9YA 3D66A 1RT5B 2N82B 3HO1A 2BJ3A 2XS2A 3EVMA 1XEZA 2DNLA 1FX2A 5EWFA 1D09B 1VR6A 3GFXA 2LXUA 4WWSA 3H2LA 5CYQB 2DGTA 2CJ9A 2VQFJ 1F6TA 3TA1A 1RCXB 5C5JA 3OHBA 2DR8A 4QYZK 2RHQB 3MMAA 2GA7A 3N79A 4KGXB 3OD2A 2DY1A 5E41A 2V69A 2R2SA 4IRCA 4DV0J 2ILYA 4KKOA 2WW8A 2VU5A 5KG2A 4J9OA 4ZVSB 2Q66A 2D74B 3MD1A 4F4YA 4PQUA 3FNNA 3GCWP 1CQNA 4IYQA 4O23A 3JYTA 4GRSA 2UVRA 2PFFB 1UFKA 2XG8A 3I4PA 2XMUA 4FF2A 1FWLA 2J8SA 3NXZA 2FY8A 3M2RB 3PW2A 1TAUA 4WF9Q 3K89A 1PC5A 1RAHB 1WF1A 2CZVC 1ZM4A 1TQLA 2OUGA 1PBUA 2BXJA 2FDNA 5DJBA 5FIIA 5AJ3F 2QA4G 1GH8A 4I69A 5CHCB 2KRRA 2OPRB 1U1RA 1NSAA 1Q5VA 2A2DA 3E51A 4FYVB 3HK2A 4WZMA 3AJ2A 1BWEA 3Q23A 1HI0P 2HGNA 4PRFA 3FKBA 1VDHA 1Z2LA 2RF2B 4RR5A 1FESA 1HQEB 2F1FA 4L74A 4OX9F 3KHGA 2CWKA 1S1WB 3IWNC 3WIUA 1EQ0A 3K8VA 4AXIA 4BHQA 1MROA 4IFYA 3SIPB 1S49A 2EBEA 2HVDA 4XDCA 1I1GA 2OPQA 3R7SB 3S1TA 2JJ4D 3OTEA 2IMOA 3BGRA 2R7WA 3I4HX 1KWMA 3DGPB 2G9OA 3D6FB 3DYAA 3O8WA 5LT5A 1JXEA 2QLFB 3MECA 4ZJLA 4CLFA 3IN5A 4P6QA 3PV8A 3D28A 1FKPA 3NGRA 4QIVA 2MTLA 4RWWA 2CFXA 4GO7X 3KNGA 3ZC4A 1FRJA 5HJYA 5KG6A 3MEKA 4ERDA 1QAYA 1HWJA 1SKUB 2CQHA 3TZWA 1YZ6A 5K8NA 4YR0A 1FKPB 2XI3A 8AT1B 2PMHA 1W25A 1JLQA 3RTVA 4OZ5A 5HL7Q 1WC4A 4RUAA 2DISA 3MGJA 4Q43A 2E5HA 4J91A 3OPKA 3IMQJ 5B0EA 4J9KA 4V19X 2P9EA 4DL0C 1SKWA 1N36J 1JJ4A 3QJLA 3D6MB 1XN9A 1WNEA 1Q8LA 1PAEX 5DO2A 2C2ZB 4KR0B 1XERA 1RWUA 1XMOF 4KPYA 4WP8A 1VISA 1N0UA 4U8YA 5F8IA 1YVFA 3OR1A 2GCFA 5B0BA 5HQ8A 4K4ZA 3P49B 2FJEB 3LP0A 1OO0B 1X4BA 1NKEA 1RXOB 4AYBD 4LFBJ 3KFWX 1NJIT 1ZA1B 4KHRA 1HQUA 2JH3A 1G2EA 2JC1A 4DFPA 2BOAA 4Q2MA 3DKDA 4CLPA 2L41A 2PI4A 1Q53A 2EEYA 3SCKE 4PZVA 4N56A 1VC0A 4WCEQ 2QA2A 2CIMA 4M5HA 2DITA 4MFBA 2EFVA 4B3TF 3JTNA 2XCPA 1FFGB 3EDQB 1FRLA 4O3QA 2VJUA 1YRUA 2D3OR 5HROB 5H9FJ 1FEEA 2F7VA 2MGZA 5J1NA 2IRUA 5ETQA 1PO6A 2CAJA 4LF7J 4ZCIA 2R7QA 5FLXU 4KE5A 4TNOA 1T05B 4YHHF 2H54B 3LQVA 2FZGB 2QGFB 4JI5F 4L76A 1LW0A 3TZXA 3R2CJ 2NXUA 2PEBA 2KVIA 4ECTA 3CCQS 2NXEA 3CDEA 4J9UE 4NYOA 3SDEB 3FK4A 1J5EF 2UUBJ 1IVZA 4LR9A 4ETZA 2ZJQQ 3UN3A 3W2WA 2XGQA 3VZHA 1GTHA 4OV1A 3R1LA 4C8ZA 3MR6A 3THPA 3FCVA 1QY7A 2C3MA 3UDVA 3CJKA 4DX7A 2MQLA 3SFGA 2E5IA 2KJWA 3T9ZA 1L3KA 2PA3A 3ISND 1VJWA 4ZPVR 4ATNA 2AYBA 2UVWA 3W9IA 1X31C 2X3DA 5M2RA 2BOPA 2B8PA 3DHWC 5CYQA 4GKKJ 2X7IA 2DH9A 1RAJA 3A8IA 1DLOB 4B9NA 1VC6A 2QL5B 1WC0A 2NXCA 2YTCA 4ZA1A 1Y5LB 4OZ3A 4WTOB 3Q8QB 3RB6A 1X7VA 5J2QA 1SKRA 4CP5A 3MMBA 1RWNB 2OEJA 4F50A 2EXUA 5IXUA 3BKFA 3OLBA 3H40A 1OPIA 2LU2A 3C6TB 1X5OA 4B9SA 4JV2A 4OI4A 2YBVA 2DR7A 3MM6B 1YDLA 3N9UC 2D69A 2XLJA 3SSRA 3K0JA 1VK8A 1K47A 3DHXA 5HMXA 4Q8FA 3GONA 3KJFB 3QBCA 2ZH5A 2ZJPQ 3H98A 5D15A 1RTHB 2KFYA 5CYMA 2K1RA 4KB7A 2OH2A 2HFOA 1TKTB 2NUHA 2B9EA 2K2PA 4H4MB 4YN3B 2Y1JA 4ZPAA 1UVNA 2HVZA 2YNGB 5EGYA 3BSNA 4RNHA 1KQSR 1WG1A 1S10A 1S1WA 2ZH9A 1S79A 3BGOP 1VQNS 2K1RB 1S1TB 3V2UC 4DS4A 5KFBA 2A10A 2VBYA 3BGFA 2A18A 4ECRA 5ETTA 1IBLJ 4TLQA 3W1YC 3NOCA 3J7YU 4IO9Q 3TARA 3OVAA 3AY0A 1RTIA 3GG1A 2GV1A 2XMMA 1KQGB 2GIFA 3QO9A 7AT1B 3UR3C 4USVA 3EZUA 1AUSL 2BDPA 3OTDA 4NLSA 1AT1B 2HRUA 2J0WA 5F8GA 1PC4A 1QTMA 1H7WA 4DFJA 2WSEC 2PA8D 5HBMA 3MR5A 4JV0A 1XTZA 4LJMA 1UWBB 1YKWA 2E1MC 3DRPB 3NBPA 3KMSA 4B3TJ 4LFCJ 1VCTA 1SC6A 3DLKB 1H74A 4FKXA 2MZTA 4P10A 2RU9A 3G8QA 1GMWD 1NDPA 4RWXA 4Y0FA 4C98A 2EC0A 3GR0A 5B0GA 2DNHA 2Z0GA 2KT3A 2ASJA 5SUHA 1HNXF 1R89A 4B3OB 2HHTA 1UWBA 3IGVA 5DZ7A 3ILLA 4QIEA 3KUEA 1XK8A 4FDFA 2KH9A 1YJUA 3CCTA 2XO7A 3UD5A 1RWKB 5HVHA 3C6TA 3IFEA 1VQPS 1RAIB 1S6UA 1FD8A 1SJ1A 3I0RA 3MF5A 3D0GE 3TRGA 4DUZF 4DV1F 1UEKA 2KT2A 1S0OA 2XBPA 2O66A 2QA4S 1HNVA 1BQNB 3DM2A 3HPOA 1VBXA 3FUYA 1UEVA 5GMEA 1DRZA 2AJ2A 4QYRA 2DJWA 1YK9A 5CAAA 1YJNS 5GVQA 3CMQA 9ATCB 4DSIA 4C4WA 3A3OB 1FXRA 5CYMB 2DHHA 3AD9C 3HVAA 3R7NB 4C3KA 5A6PA 4DR6J 3I0RB 5A76A 2FJVA 2YNIA 3G71S 1NNDA 2EFOA 1RACB 2X3GA 4RUBA 1LW2A 5KFPA 4X62F 1KOOA 2RDIA 2CQGA 4ID8A 2I5JA 1NPRA 1P6TA 4RW8A 2V63A 5IWAJ 2G2OA 1WOSA 4M5DA 5F3ZA 1S1TA 2DNKA 3LANA 3RAMA 2YNIB 2FVPA 2DR6A 3C16B 4U95A 1NMEB 3BZQA 3I82A 1OQ6A 4FVMA 2ZH3A 1U48A 3MM7A 2VHGA 3JSYA 2R8GA 4O0NA 4P2SA 5CABA 2ZZTA 2Z8QA 3LGNA 5D6GA 3F73A 2QG9B 3BSAA 2E5JA 5KFYA 4QWCA 1S9GB 3T5KA 3D2WA 3TWZA 3FEYB 1KC8T 1JIHA 1APSA 4DSFA 1T94A 4R8UA 4ZN1A 5LMUJ 4DV4J 2KHDA 5CZVA 3CD0A 2JFKA 2F9DA 1KTVA 2VG7A 1Y5IB 3AJDA 3FRYA 4USTA 3TQEA 3DRSB 1R6VA 2FHMA 3OL9A 3PX4A 4Q2LA 2AJ1A 1MWQA 2C3OA 2UUTA 3BR9A 5FLXY 4Q45A 1ZM9A 5DDRC 1JLCB 1SC1B 5DETA 1BD6A 2MHNA 2BEFA 3DXSX 1VBYA 1AROP 4CO3A 2H48B 1S1VA 3Q83A 2OJ3A 4DR3F 3OUYB 2JDJA 1R8CA 2QEXS 4A8MP 4FBTA 4CLWA 3SCIE 4DUTA 3AXKA 3W65A 1Q82T 4G6VB 4XPCA 2C22A 1KFDA 4X64J 4TN2A 3M6UA 3BSCA 4ZJQA 2XB2D 4RL1A 2ZM6F 4W4MA 2WVCA 3MEEA 4HH0A 2MEWA 1T9VA 4HVZA 2C2OB 4OYBA 1J5OA 1RTJA 3MM8B 5D4OA 2AIRB 2Q6CA 2EK6A 1IN0A 3MD3A 2DGQA 1QE1B 2MJUA 3EWGA 1HYSB 4M5MA 2DGUA 1IM4A 1IWGA 4QR0A 1C0TA 3NAIA 1RAEB 1Y10A 2IIHA 5KG4A 3BO2A 4R0JA 4K4UA 4AL7A 1YBUA 1SQGA 2X1GA 3HXMA 4DSEA 4J9VA 2B43A 3IA0A 5KT7A 4DQSA 2OPPB 2LECA 1NK6A 1FK9A 1GMUA 4NLXA 3Q8RB 3W62A 4ZCMA 1VQ4S 2HK3A 2HG4A 1WEXA 2RQ4A 3WBZA 5HP1A 1TKTA 1WC1A 2CDRB 4OJGA 4JI3J 4XDDA 3CCSS 2FPHX 1WACA 1U09A 1TL5A 1QJHA 2HWTA 1JK9B 3HVTB 1VI7A 4HACA 4I6YA 5GMDA 4A8SA 1CULA 1XJWB 1XMQF 4M8LA 1OS5A 4HDHA 5D0HA 2BUNA 3RBEA 1E6YB 1CC8A 1RAAB 2FUG9 3A3PB 4OZNA 4ZPCA 2CJKA 2DBBA 1H2VZ 1FXDA 1SV5B 1O51A 1ACMB 1VRQC 2WAQD 3LP2B 4OX8A 3R97A 5C42A 1DURA 2HGMA 2ZBQA 2Q79A 2XSJA 3J7Z5 2Q1LA 3D0IE 3N6MA 4XO0A 3TAQA 4G3IA 3NGKA 4M5KA 2FGCA 4F67A 5H9EJ 2IVFB 2XWYA 2VFRA 2DO4A 2HSEB 1I6JA 1RDRA 4EWTA 1TFYA 4Q44A 1GX5A 1YJRA 3B6BA 3PHTA 2IJNA 3RGIA 1JNRB 3ZZYA 3GIMA 1NK7A 2A3JA 4DR4F 3DOKB 1DJ0A 1S7HA 2JSXA 5MAOA 4N8NA 1NAQA 3HJFA 3NGSA 3QFWA 3T1YF 1TU0B 2HIYA 2B7CB 2CG4A 3M8PA 3QMQA 5J2NA 4B3OA 3UNGC 3KK3B 1KQKA 2MQ8A 1U4BA 4C8MA 2K3KA 1ZAVA 5JJBA 3H2VE 2E5GA 2WSFC 1FFSB 2QE5A 5BR8J 2VC0A 1WELA 3TJ9A 3PR4A 3GB0A 3WDOA 5KFIA 4KRWA 3AOCA 1LNQA 3QGIA 4WYWA 2ZNYA 4O44B 1UZDA 1FVSA 2XMTA 1SJQA 1F1BB 4QR2A 5E5NA 1X4DA 2I1RA 4IFYB 3S6EA 3HMJG 5DDPC 3OFEA 3B54A 4LSZB 1T0TV 5CH7B 5K8MA 5LSLA 4WFAQ 1FI4A 2BANA 2YNFB 4JI8F 5FJ4A 3IBCB 4DFMA 3MAAB 4PG5A 3AXMA 1KVJA 1QTNB 4UW2A 4F4WA 1C1CB 4NX9A 1HI8A 2VJVA 4JB8B 1SL2A 4JI4J 3AQOA 1FXLA 4KBIA 4IOBA 4K2XA 3IM9A 3PXGa 3M2UB 5ETNA 2UU9F 4IR1A 1N33F 4DV7J 4AL6A 2YKMB 3CCRS 3G4SS 1JLBA 4URQU 1IR1A 4RBUA 1CC7A 4BC7A 4TY9A 4EBEA 1N4LA 3MOJB 1SVDA 4ZHRB 1MMNA 2LMIA 1Q1KA 4C3LA 3B78A 3NS7B 3MFHA 4DR4J 3KLGA 2GGPB 6AT1B 3DNCA 3M2RA 4I2QB 2HURA 4OZJA 2DHAA 5DQIA 4NLRA 4G1QB 4L3NA 3C6UA 4RW7B 2VBWA 4OQJA 4CO2A 2AX0A 3LTOA 4LVOP 4DF8A 1LFWA 2W1BA 2ZE2B 2NZCA 1V3SA 1RT3A 3HJVA 2GFFA 1LWCB 4PQAA 3AB4B 4PXBA 1NSPA 3GE9A 5ETRA 3K58A 4IFVB 4I2QA 2MPUA 4DR2J 5A0YA 1WG5A 2FVRA 3LPYA 1S1VB 2OD4A 2CJBA 4ZP8A 5C25A 1MROB 4DI6A 1WHXA 4QWEA 2IDLA 1X60A 4DV2F 4DL5A 1FWPA 4DZDA 1N48A 3R27A 1F60B 2ZBRA 5MLCV 2J9DE 4OMFG 4P73A 1RKJA 2U2FA 1U47A 2I5JB 3EXCX 3M8QB 4WFXA 3NCRA 3PEHA 3SQOP 1JB0C 1SH0A 4DU7A 2LCWA 2IYIA 3W61A 1I51B 3OLAA 4C8KA 4D3HA 1NK9A 2QYCA 4K7QA 2NPFA 3P5TL 2LKZA 2YX1A 3K5OA 4OYOA 3C14A 3W60A 4MKYA 4J37A 3TOQA 1UVMA 4A8OA 4WU3A 3HT0A 1GK8A 4LRCA 1VK3A 3CJQA 3T19A 4JI7J 5JUMA 3Q8YA 3KJQB 2G1HA 3PEJA 4I6WA 4AT1B 3QLHB 4ZN3A 3R5CA 2UV8G 4RW4A 4YY3F 1X0PA 2DIVA 1IKVA 4TKTA 3V4MA 1CEZA 1KP6A 3HHDA 1JLFA 1BE4A 2ZM6J 1U24A 2D1CA 2L08A 2FHJA 3FBCA 3I96A 2HEKA 2QN6B 4MK9A 4RNOA 4AXJA 5L1IA 1HPZB 3PFEA 4CTAB 2DRAA 3IS9A 3QT8A 4KPCA 3PX6A 2YWGA 2DNQA 3A4TA 3MI7X 2J76E 1JLFB 4LFAJ 4BS2A 3GSIA 3NY0A 1HQUB 3MMAB 3DOLA 4FYWB 2NYIA 1TV6B 1E6VB 4USIA 3W2VA 1ZZNA 1U1MA 1KLMA 4LFAF 4ZP6A 2F4FA 4WKRA 2DHGA 1SXLA 2Z30B 1KQFB 1DLOA 3FVYA 3PW0A 2G13A 2YKAA 4ID5B 2KVQE 1ZOTA 2ZOMA 4USKA 4EUVA 3GJTB 4K5SA 5J1EA 2QYGA 4N7TA 1S1XB 3J7ZT 3HHEA 1RBLA 2JL9A 5D0RA 4UOCA 3GIJA 1P1TA 3MTJA 1G3OA 4YY3J 1X0FA 1WHWA 2YWEA 3CW2C 3IR5B 1RU1A 1S6PB 3W64A 4IR9A 2G1DA 1QDUB 1VHIA 2HQ3A 4PCQA 4TU9A 2ZH2A 4F3OA 2MZJA 4NLUA 4DPYA 5KFNA 4ZIVA 5IC6B 1WC6A 1XMOJ 2IYGA 2XMKA 5L8RC 3ZNJ1 4WFYA 3GIRA 3SDEA 3OVSA 3RRHA 2DKOB 1C4CA 4YQWA 2ZDOA 4P2MA 2GW8A 1YZ7A 2YY3A 3ENAA 4MAKA 4RBTA 1B0VA 2EI5A 2M88A 4OI1A 4NI2B 1H0HB 2IVMA 2IM3A 3BGRB 4OJ3A 4DOZA 3FGVA 2DCUB 3ISNC 2K06A 1YBAA 5B0CA 3BYRA 2YKNA 1YGYA 4ZS6A 4N5SA 2YNHA 3MR2A 4LSNB 5KOXA 2EFQA 5DG7A 3M30A 2DNYA 3ZTQA 3MUVP 1N32J 2B9YA 2J0SD 2DNOA 4OX6A 4MYUA 1MU2A 5I42B 1DQ8A 3DC2A 4ED1A 1FNXH 4JV5J 1KFSA 2HAFA 1U1NA 1FJ7A 1YLXA 3R9LA 2Y8YA 1TV6A 2VPXB 1VQMS 4FYXB 4DR1J 4O4RA 2V34A 1RQ0A 2HVEA 4P2XA 3I55S 1FKOB 2CQBA 1TL1B 2KFNA 4O3RA 1IJEB 5L9XA 3PRBA 5EHHA 4J9MA 1TUWA 2MLXA 1XC9A 5BJRA 4QIWD 1ICEB 4Y3CA 2JEFA 4IH6A 2AHOB 1V5VA 2OTLS 4W92B 2G4BA 1NJYA 2KYZA 3VQSA 1S12A 1FKOA 4DEZA 1RWOB 2AZ1A 3RYLA 2HHQA 4FXWA 4JI4F 1EHWA 4R5PB 4TQRA 1GFWB 2C2KB 3C15A 3ZTRA 3G86A 1LEOA 1FVQA 2EPIA 3T5LA 2XNQA 4Y28C 2XYHB 2HMIB 2BV3A 1C0UB 2OEMA 4IKAA 3ILOA 1WTFA 3IG1A 5FDLA 2H4YB 4L3KA 4DQRA 1N54B 2KXHA 1EP4A 4ZITA 3HI9A 2AGPA 3SCLE 4F02A 4TLRA 2GVDA 3D9BA 4USHA 4RX6A 3OQ2A 1DFDA 2BA9A 2BABA 3N5BA 1BQMB 4MYTA 3I56S 3FBEA 1URRA 2AT1B 2B56A 2HS4A 3RRKA 4P9SA 1VQ5S 2EKYA 4DDFA 3G9CA 1T9XA 4M5IA 5A2QU 1LW0B 2CRLA 3MR3A 3CUNA 1YTYA 4IQMA 4CRJA 2HHPA 2LXIA 1NPPA 1NRKA 2BE7D 1WORA 2DNRA 1XNRJ 5KFLA 2ADCA 2DGSA 1VQSA 3I0SA 3CB4A 3VAGA 1AZSB 4WIIA 3ZZZA 2HS0A 3JSMA 3KG1A 3PO5A 3NNAA 2C2EA 1U2CA 1RJJA 1WC5A 3TAPA 4RNFA 5L39A 3VAIA 4ENOA 1QSLA 3ZZ0A 5D4PA 4LSLB 4XIUA 2EFGA 5DDQC 2J7KA 4UT4A 1LWCA 1KRPA 5T14A 2CNKB 2NQPA 2H1YA 3GYNA 3JSBA 4MFBB 5DLFA 4B3RJ 2GJ2A 2HHWA 1VBKA 3K5PA 3H2UB 3LWMA 4EBDA 4TXSA 4DR7F 4OL8A 4CLKA 2Y8WA 2ZC3A 1LXJA 2G2ZA 5LSOA 2RUGA 4FYDA 1QD1A 4NCGB 3TA0A 3AOBA 4J9LA 2GQCA 3V81A 2ADBA 3R7BB 3HHNB 4X4RA 2KG1A 3AQPA 1NU4A 1TZ0A 3D3BJ 4OI2A 3FEZA 4EU0A 3RB3A 1JLAB 1M0SA 2QRRA 1MN7A 3H5SA 2X1BA 2BM1A 1NEEA 1Q16B 2OMLA 1RA7A 3QIDA 3A8EA 5KFEA 4J5OA 1N5YA 1XNQF 1JLAA 2B3TB 3PW5A 2BBEA 2CVEA 2AU0A 2HFSA 4ZVFA 4KTQA 1BMQB 1RUSA 1U0HA 7FD1A 3K2YA 4CH1A 1PYSB 3CJ5A 2YWWA 3OXGA 1IKYB 2XGPA 3MMCB 2QC3A 2GMLA 3Q8VA 1T05A 4GKJF 1XR6A 4CT9A 1S6OA 3NNCA 4X4NA 3G2XA 5LXYA 1AA1B 3M8ZA 3MM5B 3HSJA 2XZTB 3MCSA 1WKKA 5D77A 1NH7A 1WD6A 2Z58B 3UCZP 5T7LA 5GAGI 3VAMA 1RT6A 3I9ZA 3PJWA 4RNMA 4HKQA 4YHHJ 4LSLA 1PJ5A 1D9AA 2FHOB 2M9KA 3TAMA 3ZFVA 3RG6A 4CO1A 5KG5A 3MTKA 2HHXA 3LAKA 3GIKA 3Q89A 5T7LB 1F9EB 3KLHA 1TKZB 4NYPA 4ZPTR 4DCPB 2G0JA 1OWXA 2J8AA 3F0NA 2JC0A 4DCOB 3C2PA 1FTCA 4U9RA 1OSCA 2HS3A 5E3QA 5E33A 4A48A 3GILA 3K5MA 3VV2B 1OPZA 3ENVA 3G6VA 1D0EA 3CIMA 3DI6A 4PKDB 3CCES 1QE1A 1HYSA 3JYTB 1XBWA 4CDIA 3Q8PB 1ZH5A 2VH7A 1RHQB 1MG7A 4C3MA 1IR2A 2CNOB 4EI2A 2OD6A 4LFBF 5KG7A 1RHJB 2IJRA 3MXHP 2GNKA 3OSNA 2PD1A 4I7FB 3ZZUA 4WJBA 3EPGA 2W9CA 3T1HF 4C8YA 2E1CA 2VPZB 3CSKA 5HN0A 3J81j 4HTJA 2V2KA 2IFXA 1U6BA 3CC2S 4GC6A 2YKOA 2WHOA 1BHNA 1F5CA 4H4KA 4DX8H 4OLPA 3ZO7A 4J9SA 2J6TA 2OTJS 4HYKA 1TL3B 2VL1A 1KS2A 1REVB 2LQJA 3QT5A 5D8HB 4K4YA 4HR2A 3J80U 2XEXA 1RABB 4DPXA 5B08A 4MH8A 4P7VA 4LR7A 4CH0S 1V6HA 2QL7B 2HK2A 1YJTA 2OO4A 2DXDA 4OZ1A 4ZVEA 3HSZA 2BE2A 4HHHA 1KBRA 1WKJA 2JRSA 4KT0C 5EX3A 3M8RA 1KSPA 2WZ1A 3KOAA 5EUHA 4C97A 4CI0B 1F5BA 2BQ3A 2KZZA 4NOHA 4DV1J 2C1EB 3KK1A 1AFIA 1D9DA 1L3UA 4WP3A 5KFGA 3W7BA 2B5JA 3PRDA 2OFHX 3Q0AA 3FFIA 2CPYA 2G0CA 5HJXA 3TI0A 2HYIB 2XHWA 3DOMA 2HQGA 1W2IA 4Q5VA 1HNXJ 1NZAA 1OMSA 4W90B 8ATCB 3LPEA 5H1SV 5ETPA 4LF6F 3M8SA 2H3EB 1Y00A 1ZAXA 3FFIB 3E01B 3H59A 1WSVA 1HNWJ 3V5RA 4CT8A 1VIOA 2BVZA 3OV7A 3GQCA 1XWLA 2QFJA 3PW4A 4OI0A 2KL8A 4OYPA 3RRGA 2L9NA 1XIQA 3IC1A 3CTRA 4IDKB 2ROGA 2RVJA 3GFYA 3TX8A 9RUBA 1FJCA 5K20B 5A0YB 2CQ3A 4G1IA 4O44A 5KFVA 5C7PA 1X5TA 5CZXA 5DLGA 1JQGA 2NYHA 3CCLS 1M1GA 3ZZTA 2W2QP 1U6ZA 4DPWA 4JYAF 2V4RA 4DQIA 1HW9A 2KU7A 3Q22A 1RP5A 2EG1A 6FD1A 3LO3A 3BV8A 3NWRA 2HBRB 2LQBA 1OYDA 2DR5A 1YX2A 3B82A 3OSPA 3NMAA 2B0GA 2J0XA 1T11A 1W26A 3A8JA 3ITHB 2N7YA 4ZIWA 3OBIA 4R8UB 1Z4UA 3HD2A 5K14B 2HZCA 1OY6A 2XYPB 2XZWA 3M2UA 2R3VA 2VG6A 3NRBA 3SEOA 4DXLA 2N3OA 2H5EA 1O8BA 1EKSA 2D9OA 3H7HB 2XMVA 2MY7A 1ZA2B 3N6NA 5E3RA 4B3RF 3SFUA 3MHYA 4S0MA 2ZJRQ 3BBBA 3PG9A 2HIQA 2KYXA 4RW9A 5L1LA 1VC5A 3AAWB 3I0SB 4UOFA 1U1OA 1JLCA 3FDSA 2OPSB 2HNYB 4ZVPB 4O3SA 2LP4A 2J6SA 2W2PP 1Q79A 2OP5A 3PKYA 1HNZF 4PPDA 3GSDA 2J9CA 4NMXA 1HNIA 1TAQA 3SMZA 1ZYQA 3FBBA 2SXLA 2CPZA 2EBGA 4DV2J 2MDAA 3K57A 2DY9A 1W7WA 4JI5J 3N01A 1S57A 2I9SA 3DRSA 2JZ5A 3PACA 4I0WA 2MY8A 2ZOGA 4OHZA 2QLWA 3KDNA 3BBCA 5C2CA 3MUTP 2V4JB 2HHVA 3RU0A 4DV5F 2K7KA 2CXEA 2GO8A 3I9V9 1X5PA 2ERRA 1D9FA 2X51A 3J7YI 4M94A 2ZKTA 5CA5A 1S76D 5J2NB 3CWJA 2MYFA 4FZVA 4E8UA 1SC3B 4Y2KA 1M5SA 2QTWA 4ED2A 4K59A 4B9LA 3K17A 4F25A 3MMJA 4ECUA 2DRBA 2OPPA 4ZVUB 2EKNA 1EETB 4K5RA 3DRRB 2ACYA 1MLAA 1NO8A 2ATCB 4M5DB 3LOUA 3TUPA 1P1LA 3MEGB 4B9MA 2RILA 3M2VA 1ZZFA 1RTJB 3MM8A 1HHQA 2D3ZA 3QATA 3TJAA 2VQEJ 4DR3J 1C2PA 4HI1A 1T3NA 2ATLA 2JEIA 1S0NA 1K1SA 3NLCA 4RW4B 1B0TA 1NHKL 1RAOA 1HKAA 3U1MA 1HD0A 2HQCA 4DLGA 3PX0A 1RU2A 4L73A 5GAGU 5AE3A 2RKIA 2YKPA 2RUSA 1LOUA 1UJ6A 3L7OA 3M8YA 4PXDA 1FEHA 1GXLA 4MK7A 1HPZA 3CJSA 3MPUB 4J7CA 3F56A 1T8EA 2UP1A 1BUXA 3KXDA 5KFDA 2CZ9A 4LQ3A 3IRWP 3U02A 1M5PC 1T9WA 3HP6A 4CM2A 2QMXA 4WE1B 3Q8SB 1FE4A 4LIRA 2YKNB 3EMTA 2B51A 2IVYA 4M5NA 2WONB 2MQPA 2XWXA 1RT7A 3RUBL 1BC6A 2RSQA 1NCLA 2YQ1A 2VC1A 1E6VA 3D6HB 4WFZA 2E44A 3RBZA 2V4QA 1JJHA 2DB1A 2R4FA 2BE2B 3QGHA 3FRZA 2UZAA 5HK4A 4X66J 4A4JA 4KV8B 3MUMP 4ZPWR 2VIHA 2FLLA 1Y9OA 3J7A1 1MWYA 3ZZPA 4O0IA 1S9FA 4YEAA 1GT8A 1K44A 2V67A 2AYEA 4WXOA 1X9MA 2GMHA 2LDIA 2G2YA 3A12A 5HBMB 3HDSA 4K0KF 3TUJC 1HHTP 2E9TA 1HWUA 1Q8BA 2FHJD 1KEKA 1TK8A 3TANA 1KKHA 1S6PA 3PCOB 4GO5X 3O1LA 4LREA 2QSWA 1WF0A 2ZE2A 1ZAWA 3GWCA 4OX9J 4O4GA 4DBQA 4I4BA 5HVFA 2KXFA 3EVOA 3RBDA 3LF0A 3M6WA 4IRDA 5J2PB 4ED0A 3BGLA 5KFKA 3PR5B 1VYAA 3A1YG 2YWKA 4YR3A 2E9RX 3VALA 1CJTB 3FZBA 3G6XA 3VGVA 2YNGA 1FCAA 3HULA 3SI8A 1P27B 4MKAA 3KLFA 2XC9A 4R0EA 3N6LA 2N4CA 4DV6J 3E2EA 1LV5A 3ZTSA 1HL6A 3BKTA 1O5JA 2ZHAA 4ZVTB 3OJUA 4NXMJ 1DTTB 4F4KA 3TX0A 3EJMA 2WBMA 2GVZA 2JWNA 4DV0F 1H2UX 1L3VA 4USUA 4DPOA 1TTHB 1SQEA 1JLBB 2OEKA 1S99A 2MMYA 1T03B 4ZPBA 4GKJJ 3ONQA 1J27A 1HBOB 4F0HA 4BDPA 2GQQA 4ZHRA 2DD8S 2F65A 3BDPA 1DTTA 1U02A 2EW9A 1X5SA 2RJZA 2RRBA 3ISZA 3QLHA 1ZTTA 2YWHA 1U0SA 1VQ6S 2MKJA 3R5DA 3CPWR 3DLKA 3FCWA 4FF4A 4PAAA 1UJ5A 3S8SA 1Y3KA 4B17A 5IOLA 5CD4A 4M1KA 4MKVA 1CJKA 4RU9A 4YFUA 1CBKA 4CNYA 2YVSA 3UE2A 3DDNA 1DZ5A 2VG5A 1U2FA 2L9DA 1B7YB 5I3PA 5KFRA 4EK2A 2PT0A 3OHAA 5LJ5Y 4KJIA 2FTRA 1T9TA 2HGLA 2M3DA 3W2VB 3M8PB 5E7OB 2R7VA 4QYZJ 1U1LA 1IBKF 5E3AA 4A46A 1SJ3P 2HBZB 1RT2B 4X4TA 4ANDA 2VQFF 2P9CA 2VASA 1IJFB 2Q3PA 3OFHA 4H4OB 1C0UA 3E8OA 4O3OA 4I2PB 1N88A 2JEJA 5AT1B 3IRXB 1TK5A 1NKBA 1U1PA 3D1OA 2KXNB 2IC3A 2VKZG 3WIVA 2RNEA 4XAKA 1JWWA 2AJ0A 4KC5A 2FJDB 2IRYA 4LF2A 3H8YA 4PUOA 3V4IA 2ZVSA 2AJQA 3MCMA 1JLEB 4RBVA 2R2UA 1TK0A 1JKHA 1UMJA 3C16A 2HVHA 5K14A 3HSDA 5D4LA 5KFZA 5IS2A 4KO0A 1F2GA 3CCVS 1UVJA 2AW0A 1UP1A 4I1TA 5GMKa 1VBZA 1JKHB 1K73T 2WW4A 4YDDB 1Q81T 3T6BA 3PY8A 3D5MA 1M1KT 2M52A 2FVQA 2LFVA 1WHYA 2VBXA 2LQ9A 3FQLA 1MSWD 1HR0F 3RB0A 3TUIC 4DS5A 3FMWA 2ZC4A 4RLEA 3CO0P 1IM6A 2JLEA 3BDEA 4N41A 3HVTA 3I87A 4ED8A 4FNHA 3EX7B 2BX6A 1TMMA 3DRYA 1WTBA 1UTAA 1UFLA 3G82B 1IKWA 2LXFA 3JQJA 4ECWA 2FLPA 3C3LA 1UVLA 1GQEA 2B4VA 1LKZA 2LEBA 3DLHA 1HBMB 3BQ2A 3BSOA 1RT7B 2QX0A 1PYTA 4TYBA 2QSFA 2M0GB 4M5GA 3LP2A 3H5UA 4GC7A 4CYUA 4ETXA 4RO0A 5JVHQ 3OR2B 3K7RA 4QQBA 4C8NA 5JXSA 1SIWB 4LF7F 4CIOA 2BJDA 1GAOA 2ABYA 1RWPB 3SV3A 1VGYA 3V6KA 1K9MT 1T7PA 4K50A 5C25B 2XY6A 3GJQB 2QV6A 3BO3A 3U1LA 2DK2A 3G8TA 5IQQA 4CYUB 3BR8A 4X65J 1J5OB 4ECXA 2RU3A 2MSTA 5F8NA 3CCWA 1XR5A 4JV1A 3JQKA 4EMDA 2V2VA 1OJ4A 1S4EA 1SBRA 2UUBF 2WTFA 1YG0A 2OKQA 3IWLA 4U7UK 3KK3A 1F5AA 1YJ9S 2BMBA 1VQYA 1V5IB 5LXRA 4F2RA 2XS5A 4K4VA 2A6MA 2B4OA 3AB2B 5J2PA 3D3CJ 1R0AA 2BW7A 2HNDA 4JOUA 5FD1A 2A0FB 2OSQA 2E7XA 4ES1A 4URGA 4CZCA 4LF8F 2E66A 2DIUA 2CQ4A 2WVDA 5HATA 4CCHA 1S0VA 2FGOA 2ZOFA 4USJC 3QIPB 1UEUA 4CLYA 4E98A 2MKIA 1PGZA 3KLFB 3T41A 1N36F 2ZWPA 1JLGA 3NEKA 2CPFA 4OV6A 1NPKA 4X84A 2KTQA 4F26A 4K4WA 4PG4A 2W2MP 4DQQA 3VTIA 3DU5A 2AQ4A 1QAIA 2CQ1A 3IS9B 3MAAA 2DXFA 4KKOB 3LAMA 2YXLA 4ELTA 1Y3JA 3UCGA 3JAMU 3TVYA 1YITS 2YNHB 4DPTA 4PWWA 4A8QA 2NSCA 3VGUA 2Y1LB 5L9NA 3BN7A 4UOHA 2HNZB 4PXCA 4JI1J 2DNMA 1FDDA 1Q78A 3TYTA 3QAUA 3PIPQ 2Y1IA 4KSEB 2VDIA 5M2PA 2J5AA 2P5VA 1WSRA 2KT5A 3TVKA 1XMQJ 4KHPF 1JMTA 2BZ2A 3TUZC 3EE3A 2UVVA 4IO1A 5B0AA 4R5PA 3KLGB 3FJ2A 4NZ0A 1KHVA 4PG8A 2PEHA 3RR8A 2FJAB 4Z2XA 3VAHA 2A6OA 2CPHA 2W9CB 1HIYA 2VFSA 1VLOA 1Q4RA 3M1VB 1RHUB 3US5A 3J81U 1V3ZA 4AFFA 2IDEA 3FC9A 3MM9B 1REGX 2GO9A 3M9OB 1EP4B 1QM9A 1SH2A 2VICA 5HLFA 4E2FB 3P3DA 4ANCA 2W2OP 3IM8A 2WSCC 3W9HA 5DS7A 3W5XA 4AUKA 4F0KA 2HNDB 1YJWS 3CD6S 1BQMA 2UUAJ 2MZRA 3G96A 3UN2A 3UQSA 3O6QA 4G1PA 1GX6A 2FC8A 4C8OA 5K8OA 4QBUA 2BANB 3R1HA 1RSCA 3HM9A 2RF2A 1CLFA 2BW2A 3CCZA 3CDUA 3C19A 2V8VA 4K8RA 4FPRA 2AV5A 1KHWA 1RLDA 4L6V3 5IM0A 1PKUA 5THWA 4JI8J 3NGUA 2DGVA 4X64F 1HBOA 1JLQB 4RNNA 3HF5A 1H73A 4KH1B 1LFPA 3CT9A 4FVCA 1SJRA 1Y7PA 4ICLA 4WXWA 5DRKA 3IWXA 3CXCR 2VV5A 1TP7A 4D3GA 3NBPB 4QR1A 3QSYB 3GZ7A 2UUAF 2GJFA 1U8SA 4YDXA 1WG4A 2D41A 1RTZA 2AX1A 2NPIA 3GJSB 3HHKA 4XPEA 1NHVA 4ED7A 1XNQJ 3KLVA 1K0TA 2D7SA 5I3QA 2HNZA 1GMWA 1YRXA 2EG2A 2E1AA 2HNYA 1VRTB 4RKUC 3N28A 4AQYJ 1HBUB 2V9WA 1HBNB 2RH3A 1TUVA 2WBRA 1N56A 4QU7A 2CQIA 3CJTA 1OYEA 3QSIA 4U67Q 5HMZA 2WOMB 2HRYA 3RW6A 2ZBIA 2IA0A 3PKMA 4L72B 1R8HA 3CJ0A 2J7WA 1WI8A 3CEDA 4RU2A 4LQ9A 2V0NA 1K1QA 2M8DB 2VOPA 1HFEL 2WOMA 1S9EB 4LMZA 4ZCKA 4JP8A 3PDNA 1W2BR 5A8KB 4QZVB 4TVAB 3OFFA 2M4MA 1NK5A 4IRKA 3AH6A 3D1QA 4DG1B 5IZHA 5F9LA 2VOOA 4K4XA 1DAXA 3RR7A 2VFTA 1N5TA 3MZIA 3RBXA 3MM6A 1KR4A 1Q95G 1S1XA 1S4FA 3R5BA 2BYCA 2PDAA 3GYXB 2P6SA 1S59A 2ZKUA 4PWDB 3DLJA 2HBYB 4R25A 2NLWA 4DL2A 1G4CA 2F5GA 3A3NB 1P9QC 1TKXB 4LBIA 3QWUA 1YJVA 2CDQA 1N34J 3R6LB 2LDYA 3VAJA 1NDKA 1Q8IA 2CYYA 2M70A 1XNRF 4DUZJ 1LXNA 4DR2F 3MPDA 4LF9F 1IKVB 1M5KC 1OIAA 4GVLA 2PMZD 3FSYA 3M6XA 3WZ0A 4V19J 3JTOA 2NXJA 2DGOA 4DCJB 2XY7A 5LJ3Y 4X66F 1HI1A 2DH7A 4OJ1A 2VZ9A 2CQ0A 2R2TA 2Y0BB 3JSMB 4HEA9 4Q7AA 5LMNF 2KZMA 3M7VA 1IR0A 2RIJA 1X4HA 5JVGQ 2VPWB 2HQFA 2J9EA 4YUDA 3HD1A 2A1BA 3OUYA 2MQQA 2Z2LA 2RRAA 2ZVIA 3FBFA 3PTWA 4H54A 4PG7A 1RBOB 1SUQA 4WK1A 4ID5A 4KH0B 5HQMA 1RT6B 1URNA 3MPVA 1NDCA 1GEHA 4Y2AA 2RQCA 5L1JA 1VOMA 4OIXA 5SZTA 4LF4F 2VQEF 1Q5YA 2C3PA 2ZD1B 1IXKA 5M2UA 2DEIA 3PJ9A 4IUFA 4KGKA 1H98A 2CUYA 3C46A 2AGOA 4Z7YA 4DN9A 5BR8F 2MHEA 3CCUS 1KTQA 1NZ8A 1RWMB 4EO6A 5ETKA 3AT1B 2DPIA 3H5XA 2VDHA 3HT3A 4NLQA 1WUUA 5LMNJ 2F8MA 3CE8A 1R8PA 1XQIA 3JQMA 3GCXP 1FJGF 3DLLQ 2BJ8A 2GIRA 2VD3A 3GYGA 4HHJA 1BLUA 3VZIA 1EIYB 1WEZA 2OGUA 5AE2A 4Y00A 1Q86T 1FHTA 3FCHA 3VAFA 4KAIA 3WQPA 2PI5A 3KK2A 4FYYB 1IKYA 3TEGA 3PIOQ 3DDKA 1RT5A 4QJVA 5C2GA 3KK1B 3T5JA 2IM1A 2GVDB 2HFUA 1EB0A 3SBMA 2XSJB 2IHR1 1SPBP 3BREA 5KG3A 1HNZJ 4EZ6A 3CC7S 2E7WA 4FKYA 4MKBA 4F0MA 1FFWB 4ECVA 4F3QA 2MQNA 1CSJA 1NSKL 4MMOA 1U8WA 3G87A 3GIIA 2J9DA 2ZDPA 3WC0A 4GKKF 3VGTA 1SI9A 4ICLB 4OJHA 3UWTA 5H9EK 1SJ4P 1LWFA 3LP1A 3UPFA 2W9BA 3KHRA 1TL7B 4UTGA 3Q2TC 2ASDA 2AYGA 3ELHA 3QRQA 2LU1A 3EUNA 4ZKAA 3K5LA 5IT9Y 4J90A 5HO4A 4OYXA 5HMYA 4JI0J 1ZPVA 2ZBPA 3NL0A 3UD3P 4ZOSA 2MZ1A 1CJUB 3BQ0A 4RJVA 2GGPA 3EGWB 1UFWA 3ETOA 4IDKA 1CQMA 2W9BB 4DSLA 5J2MA 4C8LA 3E3XA 2V9KA 3KNAA 3O2IA 4KFBA 2YPZA 1SJFA 2RDJA 4FPIA 1NK8A 3JTPA 4P2FA 3OL6A 2UUWA 2XMJA 5ETOA 1LWXA 2E1PA 3NCPA 4I56A 2XULA 3TNVA 5C24B 3SYZA 5HLFB 1RT2A 1T9UA 2R7OA 4DR5F 1D8YA 4AQYF 2HLUA 1FKAF 1U45A 3THVA 2DRDA 4PXEA 5CCLA 5B09A 2FZKB 2V50A 2IJFA 2ZHOA 2FLNA 2GHPA 2HHUA 2PN6A 2AD9A 2DVIA 2GVZB 2R8KA 3KUHA 4CH7A 1TL4A 2DNPA 4LF9J 2CPDA 1VFJA 3DRRA 4DN0A 4PWUA 3UO0A 3KK2B 4HL9A 2O3DA 1VQLS 3LALA 2NZ4A 4LIWA 2V8GA 2NUUG 3PYEA 4TQSA 2PMWA 3BBFA 3CCJS 4KGMA 4A8FA 2JLGA 2V8HA 2R42A 2BACA 2NS1B 2IBKA 1MMLA 3KLEB 1VS3A 1L3SA 4ED6A 4PYDA 5KFOA 3R5AA 2VB6A 5J1PA 4FXDA 3GPAA 1LK5A 3PM9A 4RUCA 1FTRA 2ZFHA 1HWLA 1ZM2A 3T6JA 4JI7F 2DGWA 2IY5B 1UAWA 1HD1A 5E2QA 1Q7YT 1G1XA 4NCBA 4B3MF 1S9GA 5IWAF 1S7IA 4NA2A 2HWHA 1M5HA 3ENWA 5C42B 2OMOA 1U1QA 1UKUA 5F8LA 1FT8A 4ES3A 3EDRB 1BXNA 3PNIA 4WFNQ 2ZH6A 3IBWA 3BH6B 1S6QA 3VF0B 2QIFA 1WDDA 1WDTA 4UF4A 1V9OA 2OHDA 1Y5NB 2UUCF 4I2PA 4LF8J 2GIQA 5LOQA 2V94A 2AP6A 3CNQP 3WX4A 1RWVB 2FJBB 5I3UA 1UPPA 4NE9C 4TYAA 3NS6A 3RAXA 3PW7A 3GMGA 2B7BB 4NCGA 5D78A 3ILIA 3M8QA 1EETA 1TKZA 1X4GA 4QPTA 4ZVQB 1T02A 4HH1A 2CWXA 4IG3B 4NLDA 3W8GA 3TO8A 2ZHBA 4B3SF 3NWGA 1SC4B 2ZH7A 4JI2F 2E5LF 2IMWP 3BS9A 5HVGA 2IPOB 1QUPA 1HA1A 4MIWA 2BJ7A 3MCNA 4LRBA 2NCKL 1RB0A 4IG3A 2ROEA 3IAS9 1AFJA 3AODA 3P5BP 4J9PA 2PO4A 3R2DJ 1R8AA 5LSRA 3PRVA 3EZ5A 2I6WA 2KJVA 3POTA 3L3CA 3WC2A 3I32A 2CVIA 3AOAA 3QWPA 1F9FA 2W25A 1RTDB 3X1LB 2HKEA 3HZGA 3MEGA 2DR9A 2IBOA 1S77D 2CPJA 3SSSA 1M5VC 1FNMA 2AEJA 2ALYB 4DUYF 4UOGA 4DFKA 4ILMA 2O1PA 3EPIA 1IKWB 1B0PA 2EFNA 2I0XA 3UVJB 4QW9A 5LM7E 3V6JA 1NUEA 1D3WA 4N76A 3W63A 4IH7A 2RKIB 2F4VJ 3SQGA 1UZHA 2BKPA 1H6KX 2RAQA 2ZBCA 1QUVA 1WC3A 2XZDB 3I6PA 1CJVB 4IG0B 4ITSA 2J0QD 2YKMA 4ECSA 4QIGA 3R6GB 3FMBA 3SXLA 5I42A 1SUQB 5AXMA 2MB0B 1E6YA 5HAOA 2AKWB 2OIHA 3D6TB 4C11A 2RD5C 1QSYA 1F0XA 1LK7A 1PCAA 1TUGB 3LW5C 3P4UB 4DZ6A 3KYLA 1PAUB 2MZSA 4WK3A 4A8YA 2CQPA 4B9UA 1YWXA 5ITHA 3IAM9 1M1HA 3J81Y 2HVIA 1KOHA 2XHCA 1N5VA 2MSSA 2FQQB 1FWKA 3RAQA 4C0OC 4C2MA 3IP0A 1UW4A 2DH8A 3DFEA 5IV3A 2CG8A 1YHQS 1A6LA 1JJCB 4YMEA 3S7RA 1XMBA 5HMWA 2DTJA 2MKKA 3PO4A 5KFSA 1NHUA 4C0HA 2V8DA 3JB9k 4NRUA 4MIBA 4I67A 4Y34A 4ZVHA 2DNGA 1HR0J 2DNNA 3HHLD 3OTOJ 1RE1B 1R8BA 1YJ7A 1WI6A 3CIZA 4JBCA 3T5HA 1EKRA 2W2NP 1NXIA 3BO4A 2L48A 1B99A 3EYZA 1NK4A 4CLUA 1DQ9A 2OPQB 4KQZA 1OSDA 2HQDA 4ZLPA 2BM0A 2RMLA 1PJ6A 4ED5A 2HHHJ 1OY8A 3OL8A 4Y2IA 1K0VA 2XS7A 2POKA 3QZ7A 4OHXA 4ANEA 2YH0A 1KDNA 1SV5A 3EVWA 1F2HA 1CJVA 5F0UA 2VG6B 4M63A 5AXLA 4ZLNA 2ZUGA 2W8LA 4JI3F 4KYZA 4X4PA 2GC8A 3UCUP 4G1QA 1DY3A 1JNZB 2DCLA 3TEHB 5KG1A 1YBTA 4DJBA 1VJQA 4U6PA 4FNIA 3GP9A 5DZ6A 2C2DA 2VUGA 3CD7A 4ZVRB 3NG8A 3TQ1A 2DXEA 3R8YA 1RWXB 2H65B 2OPSA 3H0PA 1YQHA 5KT6A 4ILLA 1FJGJ 3THTA
chains in the Genus database with same CATH topology
1XMQJ 4LF8J 4LF6J 5AJ3J 2UUCJ 4DR2J 4X64J 1I94J 3J81U 4JI2J 1IBMJ 4X62J 2E5LJ 2MEWA 4V1Ak 4DUYJ 5LMNJ 4K0KJ 2UUAJ 4JI6J 4DR3J 2UXCJ 2VQEJ 3R2DJ 5IT9U 4HHUA 4JI3J 4JI7J 4JI8J 1IBLJ 3J80U 2MTLA 4DR6J 3W1YC 5A2QU 4NXNJ 4B3MJ 4LF5J 1HNZJ 5LM7E 2ZM6J 1XNRJ 1J5EJ 4DV1J 2F4VJ 1XNQJ 4B3TJ 4X66J 4AQYJ 3IMQJ 4LFCJ 4KHPJ 1N36J 4LFAJ 1HNXJ 4JI0J 4RJVA 3J7AN 1HNWJ 2KVQE 4B3SJ 4LFBJ 4B3RJ 4JYAJ 4DV3J 2KL8A 4NEYA 4OX9J 4X65J 2MQ8A 3T1HJ 4YY3J 2UXBJ 4DV5J 5BR8J 4DR5J 1IBKJ 4LF4J 3D3BJ 1N33J 4KY3A 1XMOJ 1HR0J 3OTOJ 2UXDJ 4LF9J 3D3CJ 4LF7J 5IWAJ 5FLXU 4DV6J 4NXMJ 1N34J 3R2CJ 4DUZJ 2HHHJ 2UUBJ 4GKJJ 4JI4J 1N32J 5LMUJ 4DV4J 4DV7J 4KYZA 2VQFJ 3JAMU 2UU9J 4JV5J 4PWWA 4YHHJ 4DR4J 4NEZA 4DV2J 4JI1J 4DV0J 4DR1J 4GKKJ 4JI5J 4DR7J 1FJGJ 3T1YJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ J;  4LF8 J;  4LF6 J;  5AJ3 J;  2UUC J;  4DR2 J;  4X64 J;  1I94 J;  3J81 U;  4JI2 J;  1IBM J;  4X62 J;  2E5L J;  2MEW A;  4V1A k;  4DUY J;  5LMN J;  4K0K J;  2UUA J;  4JI6 J;  4DR3 J;  2UXC J;  2VQE J;  3R2D J;  5IT9 U;  4HHU A;  4JI3 J;  4JI7 J;  4JI8 J;  1IBL J;  3J80 U;  2MTL A;  4DR6 J;  3W1Y C;  5A2Q U;  4NXN J;  4B3M J;  4LF5 J;  1HNZ J;  5LM7 E;  2ZM6 J;  1XNR J;  1J5E J;  4DV1 J;  2F4V J;  1XNQ J;  4B3T J;  4X66 J;  4AQY J;  3IMQ J;  4LFC J;  4KHP J;  1N36 J;  4LFA J;  1HNX J;  4JI0 J;  4RJV A;  3J7A N;  1HNW J;  2KVQ E;  4B3S J;  4LFB J;  4B3R J;  4JYA J;  4DV3 J;  2KL8 A;  4NEY A;  4OX9 J;  4X65 J;  2MQ8 A;  3T1H J;  4YY3 J;  2UXB J;  4DV5 J;  5BR8 J;  4DR5 J;  1IBK J;  4LF4 J;  3D3B J;  1N33 J;  4KY3 A;  1XMO J;  1HR0 J;  3OTO J;  2UXD J;  4LF9 J;  3D3C J;  4LF7 J;  5IWA J;  5FLX U;  4DV6 J;  4NXM J;  1N34 J;  3R2C J;  4DUZ J;  2HHH J;  2UUB J;  4GKJ J;  4JI4 J;  1N32 J;  5LMU J;  4DV4 J;  4DV7 J;  4KYZ A;  2VQF J;  3JAM U;  2UU9 J;  4JV5 J;  4PWW A;  4YHH J;  4DR4 J;  4NEZ A;  4DV2 J;  4JI1 J;  4DV0 J;  4DR1 J;  4GKK J;  4JI5 J;  4DR7 J;  1FJG J;  3T1Y J; 
#chains in the Genus database with same CATH topology
 3ETM A;  3VHQ A;  4NA1 A;  1RT4 B;  4NRT A;  1AYE A;  1UL3 A;  2P8I A;  2J6U A;  2HFZ A;  1PSD A;  2HZA A;  3MPW A;  1N52 B;  4LF6 J;  1VQK S;  4RPF A;  4WYL A;  5E0O A;  1JX4 A;  1SL1 A;  1I94 J;  1K8A T;  2I2Y A;  3C6U B;  3IXQ A;  3Q2S C;  4RW7 A;  2DT9 A;  2CAD A;  3ET6 B;  3IR7 B;  5BYS A;  4ER8 A;  1NH8 A;  5G0R B;  4PEO A;  2XY5 A;  5A8K A;  1LW2 B;  3MPY A;  5E3P A;  4DUY J;  2CPX A;  1TFW A;  2E9Z A;  4N8O A;  1HMV B;  3EM1 A;  3AFG A;  3GFZ A;  3GV8 B;  2BQR A;  1MNE A;  3RB4 A;  3HHL A;  3G6E S;  2PSZ A;  2QMW A;  3X3U A;  3QJJ A;  3MEE B;  1ZPW X;  3V6D A;  5H9F K;  1KD1 T;  4ZJO A;  1FDA A;  4ES2 A;  5GAD U;  2MQO A;  4F04 B;  1DTQ B;  3JS9 A;  3NKY A;  1HW8 A;  5DM7 Q;  4ECZ A;  1VMB A;  1FNO A;  3V4I B;  3S01 A;  2F40 A;  3KLE A;  4NXN F;  1C1C A;  4LRF A;  5DM6 Q;  2XLK A;  2K8G A;  5LMU F;  2AJ4 A;  4DV4 F;  2BRK A;  3CJ8 A;  4DR1 F;  5B7W A;  2AMC B;  4NI2 A;  5KFH A;  4HI2 A;  4KIA A;  4NML A;  1Z2Z A;  3UI3 A;  1HLW A;  3DLG A;  2NRE A;  1VRT A;  2MLY A;  4JV5 F;  2ZUA A;  3MMC A;  4Z37 A;  4P75 A;  5KOW A;  5KFA A;  1NBE B;  3AHP A;  3Q8U A;  5DQH A;  2F3J A;  1B64 A;  1SB6 A;  3KMQ A;  5K5M A;  3M32 B;  5A8R B;  3QYY A;  1N34 F;  3TW0 A;  5JMN A;  4TY8 B;  4LT6 A;  3HFV A;  3UDC A;  3CO9 A;  1FJE B;  2C3U A;  2RDD A;  4DU8 A;  3CJ4 A;  1BY9 A;  2RQK A;  4EBC A;  4ED3 A;  2CQ2 A;  4MK8 A;  1S9E A;  3KJN B;  4UQT A;  4QPX A;  3C8Y A;  1P8G A;  2E7V A;  1IWA A;  1R31 A;  1B70 B;  4B3S J;  1IUJ A;  3TVZ A;  2YKQ A;  4FN5 A;  1D8Z A;  1TL1 A;  3GV7 B;  1RA6 A;  1D1U A;  1O6X A;  3BEG B;  4LR8 A;  3CDA A;  3CC4 S;  3W3S A;  4JYA J;  4LBH A;  2HW3 A;  1KLM B;  5D3G A;  4A47 A;  2DHX A;  4O3P A;  3T1H J;  3FSX A;  3VAK A;  1VQ7 S;  3SV4 A;  3UDE A;  3NOG A;  1UCN A;  1XR7 A;  1B7F A;  3D68 A;  4UY8 5;  3HHL B;  4PUO B;  4Y2C A;  3UW1 A;  2OPR A;  1C0T B;  3D1H A;  3MM9 A;  4M5L A;  5I3U B;  4IOA Q;  1NJZ A;  1KLN A;  1T95 A;  4NZ7 A;  3U7J A;  3DCA A;  4OZ2 A;  1RLC L;  4KGV B;  1PJ7 A;  4LFC F;  3H4D A;  3QAE A;  5IT9 U;  4ZPD A;  4XK8 C;  3OL7 A;  2XCA A;  1DQA A;  2R8H A;  2Y9H A;  4OX7 A;  2LLZ A;  4OI6 A;  2DNZ A;  1Z1Z A;  1R6Y A;  3GG0 A;  1GMV A;  1QAX A;  3UD4 P;  2FVS A;  4M95 A;  2KN4 A;  3MM5 A;  2C42 A;  1O0P A;  2M5Y A;  3QT7 A;  2B9W A;  2LQ8 A;  4XTT A;  5HAN A;  3NGD A;  4Y65 A;  2RS2 A;  1KVI A;  3NNH A;  1YSJ A;  1RHM B;  5L38 A;  2WON A;  4DMZ A;  2JOQ A;  4PYA A;  3U27 A;  5KFW A;  4GMK A;  3ICL A;  4PR6 A;  3R5J B;  1I94 F;  2UXD F;  1HQ2 A;  5EDW A;  4F4Z A;  4NLW A;  2GJI A;  4HLB A;  3UDL A;  4NL5 A;  2G0I A;  3M05 A;  4LF5 F;  5IV4 A;  3D54 A;  4N47 A;  3DOL B;  3KHH A;  1IBC B;  3MDF A;  4YP3 A;  1AZS A;  1DAR A;  2WRM A;  4NPO A;  2WCX A;  2O5D A;  2YQ0 A;  3M6V A;  3D0H E;  4C7Q A;  4DR7 J;  2CKW A;  4NLV A;  2PFD A;  4B08 A;  4YS2 A;  3T3F A;  5KG0 A;  2CA9 A;  2UXC F;  2W8K A;  1RGV A;  2JVO A;  2V6A A;  2W24 A;  3OTB A;  4F4A A;  5J1E B;  1GXU A;  2GAG C;  1CJK B;  3OTO F;  2B8Q A;  1X4A A;  2CJX B;  2ZNZ A;  5J2M B;  3HFK A;  1Q0N A;  1HQE A;  2KB2 A;  2W01 A;  4YB6 A;  3DLB A;  3DXB A;  4CWB A;  2HMI A;  1U6F A;  1UPM B;  2FD2 A;  4LUB A;  3QGG A;  3Q24 A;  5KFT A;  1UVI A;  1HNV B;  1PYO B;  1RZM A;  2R7T A;  4BCA A;  4MT1 A;  3CD5 A;  2DPJ A;  2AEM A;  3L7P A;  5DGA A;  2J7U A;  2R7R A;  1UA1 A;  5BYR A;  3LUY A;  4OYW A;  1N5Q A;  3G8S A;  2LEP A;  3SCJ E;  3DDI A;  3LH2 S;  1Q7L B;  1ZET A;  2UXC J;  2ZH1 A;  2CNN B;  3QIP A;  1QVG R;  2AF6 A;  2A2C A;  4A8W A;  2EFP A;  2JFD A;  1JLG B;  3L7U A;  3R3T A;  1S1U A;  1H3D A;  4H4K C;  5A6W A;  3IG1 B;  2AGQ A;  1JLE A;  4DR6 F;  3GFH A;  2M8H A;  2F8E X;  1AB8 A;  2HPU A;  3O3L A;  3UFC X;  4ELV A;  4LF5 J;  2HLT A;  4KO0 B;  2I38 A;  5GAD I;  1EAR A;  3ZTP A;  4QWB A;  1M90 T;  3EGZ A;  3FQK A;  3M4X A;  2XMW A;  2H4W B;  3HVW A;  3BJY A;  1WKL A;  2MQM A;  3D67 A;  3PYG A;  5KFX A;  2VF3 A;  4QOT A;  4RW9 B;  4JI6 F;  3KHL A;  1U26 A;  4OZ0 A;  3CJK B;  1QAJ A;  2XSF A;  2VG7 B;  2LA6 A;  3AD7 C;  4N77 A;  2DYA A;  3VVT A;  4CO0 A;  4ED4 A;  5EN1 A;  2VKR A;  4OHW A;  4ZP9 A;  1G6B A;  2R7S A;  3BF4 A;  4EO8 A;  2XQC A;  4Q0B B;  1LWE A;  3EGV A;  4WTY A;  4CTA A;  3ZZR A;  5A8R A;  2FLO A;  2PC6 A;  3M32 A;  1IQT A;  2QFI A;  4URS A;  2W9A A;  4GVB A;  2AZ3 A;  1HNW F;  4DL6 A;  1HBN A;  3MWB A;  4DG1 A;  5EWG A;  1FRH A;  3TJ8 A;  2HHH F;  3DGV A;  3BKU A;  2ZEJ A;  1F9H A;  1H7X A;  1NLK L;  3CJ2 A;  1TR0 A;  4LRD A;  5GAH I;  2MZQ A;  2XO6 A;  3R5G A;  5G4D A;  5J2Q B;  2F4V F;  2GX8 A;  2V4J A;  4CNZ A;  5IFM A;  4YR2 A;  5DG8 A;  1X9W A;  1WOP A;  2WB1 D;  2UXB J;  1T3O A;  3EZO A;  3ZZO A;  2R8J A;  2PII A;  4LF4 J;  3KUG A;  1RKI A;  3HKZ D;  2W4D A;  4I64 A;  1J5E J;  1CS4 B;  2B6A B;  3F41 A;  3PZP A;  2KI2 A;  1S48 A;  4RUH A;  2QJ3 A;  1DTQ A;  3NGT A;  3NS5 A;  2BR0 A;  4E0D A;  3MED A;  3A8K A;  4WPA A;  5CCM A;  5IM0 B;  5KFF A;  1S1U B;  4YB1 P;  3GV5 B;  3BQ1 A;  2W7A A;  1ITP A;  4DX6 A;  3GR1 A;  1RAD B;  2RT3 A;  3TZZ A;  4BBY A;  1Y0H A;  3MUR P;  1I5O B;  3MED B;  4F4X A;  1I3O B;  4C9D A;  1R0A B;  1U7L A;  2GQ2 A;  2EVZ A;  4QIF A;  4OYM A;  3DLE A;  1NSQ A;  5HP1 B;  3HLU A;  1TKX A;  2ZIT A;  5EX0 A;  4FS2 A;  4MTP A;  5KAK A;  3O5T B;  3A13 A;  4HAC B;  5DDO C;  3HVR A;  2MKC A;  3OT9 A;  1ZS6 A;  3DN9 A;  4K2J A;  3VR1 A;  2QMU B;  4TY8 A;  3AJ1 A;  3VGS A;  2Y1R I;  4CQ1 A;  2BRL A;  1FDN A;  2LVW A;  1VIX A;  5CQG A;  2GAH C;  3TA2 A;  3TP2 A;  4CLZ A;  5IT4 A;  2WVB A;  4Q0B A;  1LWE B;  4NEZ A;  2CJA A;  3NAH A;  1R27 B;  3CMA S;  1LWF B;  1C4A A;  1X4C A;  2KO1 A;  3LP1 B;  3DRP A;  3KDO A;  4ZP7 A;  1UWA A;  3T1A A;  4KV8 A;  4P74 A;  4ZVO B;  1B3T A;  5D0G A;  4CM0 A;  2LYV A;  2FHK A;  1QLN A;  2CJY B;  4F3M A;  1IKX B;  2GZO A;  2AEF A;  2CZ4 A;  4P71 A;  1KON A;  4HT5 A;  4FP9 A;  5AE1 A;  1N6Q B;  1AXQ A;  1OY9 A;  5D3G B;  1FF2 A;  1RAG B;  5KT5 A;  1RHK B;  2H9Z A;  2P6T A;  4F7V A;  5AJ3 J;  3W8P A;  4AE5 A;  1SL0 A;  4BLG A;  4A8X A;  2KM8 B;  2FC9 A;  4WU2 A;  2QLX A;  1CS4 A;  4HTI A;  4O4G B;  5KTQ A;  5DQG A;  1NDL A;  4WBF A;  4KHM A;  1VRU B;  2LQ5 A;  4I68 A;  5KFM A;  3DI6 B;  3Q86 A;  5T41 A;  3WX8 A;  3OVB A;  2RE1 A;  1QSS A;  4EGL A;  3LWL A;  1TL3 A;  2XTJ P;  4CLT A;  2YWF A;  3MAQ A;  2PGC A;  2Y3Y A;  3QPI A;  2JX2 A;  3CDB A;  2R7X A;  4I6A A;  4WP9 A;  2QLB B;  1BGX T;  4WIQ A;  4X4S A;  3CJ3 A;  3OTC A;  1CUL B;  2CPI A;  4KGZ B;  3H20 A;  1JJ2 R;  4TU7 A;  1EAY C;  3L09 A;  3BPS P;  1KVK A;  3C66 A;  2BJ1 A;  1FRK A;  1PIE A;  5ETS A;  2JEG A;  4C0B A;  3H4B A;  3MM7 B;  2WVE A;  4IG0 A;  4DX5 A;  5KFC A;  3IBF B;  1WF2 A;  3DGP A;  1FDB A;  3RW7 A;  4J9Q A;  4DL4 A;  2VA2 A;  3HX9 A;  3MEC B;  3PFO A;  2E1R A;  4CLS A;  4QWA A;  5BYQ A;  1HWK A;  1BQX A;  1FX4 A;  1FRI A;  4G65 A;  3SSQ A;  5GAH U;  1RK8 A;  1WJ9 A;  3TAM B;  4U7U D;  2F8H A;  4UUW A;  3N0V A;  3QQC D;  3P96 A;  2UVU A;  8RUC A;  4C6A A;  1J2V A;  3QRP A;  4KHP J;  4K4T A;  3KWM A;  3KLH B;  2JVR A;  4PQU B;  2HRT A;  3ILJ A;  4ZLL A;  2Q43 A;  2M2B A;  1IKX A;  4FXV A;  2BJ9 A;  4JI0 F;  1N6Q A;  5A2Q Y;  2R9L A;  4LVN P;  1FO1 A;  2EK1 A;  2VG5 B;  3UN5 A;  5F9N A;  1FA0 A;  2MKY A;  1OQ3 A;  2V2Z A;  3DOM B;  5F41 A;  4UZC A;  5KFQ A;  2YX7 A;  1CJU A;  2AYM A;  1WHV A;  1JXL A;  1HHS A;  4X4U A;  4EZ9 A;  7FDR A;  4IFV A;  1SIZ A;  3HHL C;  2Q6B A;  3C15 B;  3N4W A;  4PAB A;  3ULH A;  3W5Z A;  1TEL A;  4J9R A;  1L5U A;  1RTH A;  2BJE A;  2HWI A;  3EXY A;  1YIJ S;  3DMJ B;  3H5Y A;  4QU6 A;  5F8M A;  3ITH A;  2D3U A;  1EJ7 L;  5C24 A;  4DL7 A;  1PG5 B;  1N33 J;  2L9W A;  2FIU A;  2Z2M A;  4NA3 A;  2AJF E;  2VBZ A;  4QCL A;  2NR0 A;  3V81 B;  2ILZ A;  2KKH A;  5KT4 A;  3ZNU A;  1H38 A;  3QRR A;  1REV A;  2RS8 A;  2ROP A;  1N0V C;  3MAH A;  5F8H A;  3K8W A;  1S0M A;  4FF1 A;  4DSJ A;  1RTI B;  3D7S B;  2Z57 B;  4HT7 A;  5LL6 d;  2CJQ A;  2ASL A;  3QO9 B;  1FRX A;  3GJR B;  4NWB A;  1RCO B;  2YQ3 A;  2FY1 A;  3I5B A;  5KFU A;  3K59 A;  1S72 S;  1EZZ B;  5F3T A;  1HNI B;  4OI3 A;  3G6Y A;  4NYZ A;  2RRN A;  2B5J B;  2P9G A;  4BC9 A;  4CO4 A;  4P52 A;  5CXT A;  3CME S;  2QL9 B;  4DV7 F;  1HBU A;  3OXL A;  4DPU A;  2X1A A;  1ZTW A;  2UU9 J;  1S6Q B;  3HCX A;  3QT6 A;  5DGB A;  2C28 A;  1RT4 A;  2APO A;  2V8P A;  2W4C A;  1RHR B;  1RI7 A;  2VFU A;  3ZTO A;  4CLL A;  2HZV A;  2WB4 A;  4F2S A;  3JSR A;  4W98 A;  5EWE A;  2DEJ A;  3PHE A;  2JHE A;  4MIA A;  1GXT A;  2LA4 A;  2BQU A;  4BWJ A;  3L4B C;  3VVU A;  4X4Q A;  3T1Y J;  2XYG B;  1U49 A;  2RB7 A;  4H4O A;  4KFB B;  3I5A A;  3AD8 C;  4Z7C A;  2QO3 A;  2Z56 B;  3NCQ A;  3BGU A;  4NAS A;  3FSI A;  3UNY A;  2N3L A;  1MW7 A;  1FER A;  2RHS B;  2ZZN A;  3SZ2 A;  3OR2 A;  1IBM F;  1X4E A;  2QT7 A;  4WFB Q;  4PPZ A;  2W7P A;  4EYH B;  1B4S A;  1HMV A;  1X4F A;  1VHF A;  3PYF A;  5CYJ A;  4FS1 A;  1SH3 A;  4OYA A;  1SKS A;  1RYS A;  3GTY X;  2QLJ B;  3CGI A;  3I5C A;  2R2R A;  2E5L J;  2MKS A;  3DMJ A;  4JI2 J;  2WVF A;  2V68 A;  5IC4 B;  3M8W A;  4B9V A;  4OHY A;  2MGZ B;  5HRO A;  5ETV A;  3KJV A;  5KT2 A;  1EQM A;  1ELO A;  2YPY A;  5B0D A;  4PWD A;  2GMJ A;  2WK4 A;  3C14 B;  1FRM A;  4RW8 B;  5F8J A;  2MKH A;  4JI6 J;  2UV8 A;  3BH7 B;  2OAU A;  1N32 F;  1CJT A;  2BE9 B;  4WE1 A;  2KG0 A;  1ZBT A;  1C1B B;  1Y4Z B;  2COL A;  2P2C B;  3KG4 A;  3KLI A;  4NLO A;  1U0H B;  2O67 A;  2KM8 C;  2R8I A;  3PYD A;  4ELU A;  2HHS A;  4I7F A;  4P7T A;  3ENQ A;  3DLG B;  4ZMM A;  5K9F A;  1GNK A;  5ADZ A;  4ZLJ A;  3QZ8 A;  4RW6 B;  3L95 X;  1UW9 A;  3W9J A;  2H5J B;  5L1K A;  4P72 A;  1LQ9 A;  1R43 A;  3SQG B;  2YNF A;  3JXO A;  1C1B A;  1S5Z A;  2EWH A;  1RWW B;  3KLI B;  1U25 A;  4DF4 A;  1NB7 A;  1QVF R;  4B3M J;  4K4S A;  4Y6I A;  3G82 A;  2W4P A;  1PBA A;  1VLY A;  2R7U A;  3NP5 A;  5HSP A;  1T03 A;  3BB5 A;  4X4O A;  4LF1 A;  2OFG X;  4UZB A;  3MR7 A;  5F0W A;  3QFH A;  1U2R A;  3M30 B;  1R0B G;  3P8B B;  4NLY A;  4ECY A;  4UQG A;  3HFZ B;  5L46 A;  3K5N A;  3O44 A;  4WKY A;  3W66 A;  2ZWO A;  3V6H A;  4ZK7 M;  3TR5 A;  4X4V A;  2CQD A;  3H42 A;  1G7C B;  2GHV C;  4OFZ A;  2DGX A;  4OLO A;  2B4U A;  1R7I A;  5DG9 A;  1RYR A;  2N4D A;  5AXN A;  3MMB B;  3OJS A;  4ALZ A;  3B4D A;  2IRX A;  2D3O 1;  2VOD A;  3J7A N;  3CDW A;  5D4N A;  1A0O B;  2EC2 A;  1R3N A;  4OHV A;  3CCM S;  3WHI A;  3KTQ A;  2Z2Z A;  2VON A;  4U8V A;  4DV3 J;  1WEY A;  2O01 C;  4ILR A;  2V2Q A;  4OZL A;  2VPY B;  1CVJ A;  4YOE A;  2IAJ A;  5HQL A;  4YB7 A;  2XLI A;  1NK0 A;  4U96 A;  4DR5 J;  2B4P A;  4A8K A;  1IBK J;  4EEY A;  3N5F A;  2HAI A;  3HZE A;  5G0R A;  3EGN A;  3M2V B;  1SCJ B;  2FVC A;  1NKC A;  2IAJ B;  2UXD J;  1FK9 B;  3JAM Y;  3AA9 A;  2CQC A;  6FDR A;  1M5O C;  2F9J A;  3POT B;  4RW6 A;  1RTD A;  5FDL B;  2ACM A;  1UET A;  3FZ2 A;  3W5Y A;  4RZR A;  1S97 A;  4USW A;  2XNR A;  2C2M B;  2VFV A;  4QWD A;  2KDO A;  1RIS A;  2V5H G;  2MLZ A;  3BM7 A;  1R0C B;  4UUX A;  1AUD A;  1A7G E;  1MMD A;  4AL5 A;  1U1K A;  4MJK A;  5KT3 A;  1YRT A;  2XM3 A;  1A9N B;  2K7J A;  2FZC B;  1MWZ A;  4DL3 A;  4LBP A;  2HBQ B;  4ZCL A;  5E3C A;  2ASY A;  3MCO A;  2YH1 A;  1VQO S;  4OYZ A;  2IA6 A;  1HAR A;  5RUB A;  2RQM A;  4QW8 A;  1TL7 A;  3HSG A;  3H25 A;  2HFV A;  3IR6 B;  3IGN A;  4YB5 A;  1UVK A;  4NCA A;  5B0F A;  4NXM F;  3FEX B;  3B8H A;  4C11 B;  4DV6 F;  4DQP A;  3I31 A;  1H72 C;  5K8P A;  2E29 A;  1CPZ A;  2MXY A;  4NLP A;  3E01 A;  4O3N A;  4TU8 A;  4IOC Q;  3VCD A;  2XI2 A;  1TKD A;  4NZ6 A;  4JI1 F;  3DU6 A;  3GLJ A;  3AA8 A;  3BPD A;  4IQX A;  2UXB F;  2HFN A;  1ROF A;  2AWZ A;  4AD6 A;  3OR1 B;  4GVB B;  2CNL B;  1EX8 A;  1BQN A;  2OI2 A;  3DM2 B;  2UUC J;  3LP0 B;  4NLG A;  2ZZM A;  3P6Y C;  4DLE A;  1IBM J;  4UY8 T;  4X62 J;  1YI2 S;  1RBA A;  2ZH4 A;  2W7O A;  4PG6 A;  3GU0 A;  5A8W A;  4V1A k;  3T9N A;  1RT3 B;  2C3Y A;  3CVK A;  1X9S A;  3QJP A;  2VA3 A;  1WWH A;  3U1N A;  2PE8 A;  3ADA C;  4X65 F;  2H51 B;  2CPE A;  3DYA B;  4ZVG A;  2C2N A;  3UR0 A;  1TMJ A;  2BKO A;  2KRB A;  2U1A A;  3PJX A;  5IT0 A;  4IH5 A;  4K0K J;  1CG2 A;  5I4M A;  5A8W B;  1V3R A;  3IRX A;  2Z4P A;  2IC3 B;  4Y2M A;  2GS8 A;  2FJX A;  3NMR A;  4OYI A;  5IQ6 A;  4HHU A;  1IQZ A;  1H2T Z;  2HQI A;  2OSR A;  4EFA C;  4ECQ A;  1IBL F;  5U47 A;  3OW2 R;  1X8D A;  2OEL A;  2K3I A;  3V6D B;  1NJW A;  1N5Y B;  2NXN A;  2YX4 A;  3VWS A;  2FJW A;  4LRA A;  4L75 A;  4B9T A;  4FF3 A;  1JXV A;  2FB0 A;  2L3M A;  2Y0S D;  4NXN J;  1WOO A;  2NSB A;  4F36 A;  1KN6 A;  1NM2 A;  1TVR A;  1Y11 A;  2JLF A;  3D4J A;  3DLE B;  3W2W B;  1HBM A;  2N7C A;  4DWI A;  4J9N A;  3IO1 A;  4CO5 A;  4FBU A;  1F3F A;  1L3T A;  4B02 A;  4F8R A;  2X1F A;  2LEA A;  4DV3 F;  2IM0 A;  3KKF A;  3HKW A;  3UVJ A;  2FYX A;  3MOZ A;  3QNW B;  3H90 A;  2OLW A;  4M5J A;  3M9N B;  3OXF A;  5HI7 A;  3TZY A;  4DSK A;  2H5I B;  1FE0 A;  4USM A;  4X2B A;  1VQ9 S;  1AW0 A;  3M9M B;  3MFI A;  1SQF A;  3DRX A;  1Q8K A;  2IM2 A;  5ETL A;  2BKN A;  3VQT A;  1UA0 A;  1RAF B;  3B4M A;  2KHC A;  1RT1 B;  3F44 A;  3BYP A;  3L9Z A;  4U7C A;  3KG0 A;  2Z2Y B;  1F3V A;  1N8R T;  3ET6 A;  4BWM A;  4NEY A;  2B6A A;  3PVX A;  3BN4 A;  3RZA A;  2ZD1 A;  3KJV B;  4NLT A;  3CUL A;  2GHW A;  2B9X A;  5D0E A;  2ZH8 A;  3EIC A;  2DO0 A;  1VQ8 S;  1BWV A;  1DBD A;  1RT1 A;  3DOK A;  3RJM B;  2JNJ A;  3M1V A;  4DHV A;  5GAE U;  4DV5 J;  1UJ4 A;  1MN9 A;  4WZQ A;  1ULR A;  3LGH A;  3QGP A;  3CF5 Q;  2I8E A;  1HWI A;  2QA1 A;  5CD4 H;  3ZXW A;  2KFZ A;  1VRU A;  5KFJ A;  2C2R A;  4KY3 A;  1ZM3 A;  3CJR A;  4EYI B;  5BXI A;  4JUZ A;  2ALZ A;  3J80 Y;  1PIL A;  1GTE A;  3P45 B;  1NJX A;  2XMA A;  1N5S A;  2D9P A;  4ZDN A;  4H4M A;  5GAE I;  4LSN A;  1NB2 A;  1DHM A;  5ETM A;  1T9Y A;  2QZ8 A;  2F63 A;  3LGM A;  2DHS A;  1FD2 A;  3LA0 A;  5AXK A;  1KNZ A;  3OFG A;  1MU2 B;  1TVR B;  2MJN A;  2M7S A;  4HDG A;  4C48 A;  4Q8E A;  1P9Y A;  3D66 A;  1RT5 B;  2N82 B;  3HO1 A;  2BJ3 A;  2XS2 A;  3EVM A;  1XEZ A;  2DNL A;  1FX2 A;  5EWF A;  1D09 B;  1VR6 A;  3GFX A;  2LXU A;  4WWS A;  3H2L A;  5CYQ B;  2DGT A;  2CJ9 A;  2VQF J;  1F6T A;  3TA1 A;  1RCX B;  5C5J A;  3OHB A;  2DR8 A;  4QYZ K;  2RHQ B;  3MMA A;  2GA7 A;  3N79 A;  4KGX B;  3OD2 A;  2DY1 A;  5E41 A;  2V69 A;  2R2S A;  4IRC A;  4DV0 J;  2ILY A;  4KKO A;  2WW8 A;  2VU5 A;  5KG2 A;  4J9O A;  4ZVS B;  2Q66 A;  2D74 B;  3MD1 A;  4F4Y A;  4PQU A;  3FNN A;  3GCW P;  1CQN A;  4IYQ A;  4O23 A;  3JYT A;  4GRS A;  2UVR A;  2PFF B;  1UFK A;  2XG8 A;  3I4P A;  2XMU A;  4FF2 A;  1FWL A;  2J8S A;  3NXZ A;  2FY8 A;  3M2R B;  3PW2 A;  1TAU A;  4WF9 Q;  3K89 A;  1PC5 A;  1RAH B;  1WF1 A;  2CZV C;  1ZM4 A;  1TQL A;  2OUG A;  1PBU A;  2BXJ A;  2FDN A;  5DJB A;  5FII A;  5AJ3 F;  2QA4 G;  1GH8 A;  4I69 A;  5CHC B;  2KRR A;  2OPR B;  1U1R A;  1NSA A;  1Q5V A;  2A2D A;  3E51 A;  4FYV B;  3HK2 A;  4WZM A;  3AJ2 A;  1BWE A;  3Q23 A;  1HI0 P;  2HGN A;  4PRF A;  3FKB A;  1VDH A;  1Z2L A;  2RF2 B;  4RR5 A;  1FES A;  1HQE B;  2F1F A;  4L74 A;  4OX9 F;  3KHG A;  2CWK A;  1S1W B;  3IWN C;  3WIU A;  1EQ0 A;  3K8V A;  4AXI A;  4BHQ A;  1MRO A;  4IFY A;  3SIP B;  1S49 A;  2EBE A;  2HVD A;  4XDC A;  1I1G A;  2OPQ A;  3R7S B;  3S1T A;  2JJ4 D;  3OTE A;  2IMO A;  3BGR A;  2R7W A;  3I4H X;  1KWM A;  3DGP B;  2G9O A;  3D6F B;  3DYA A;  3O8W A;  5LT5 A;  1JXE A;  2QLF B;  3MEC A;  4ZJL A;  4CLF A;  3IN5 A;  4P6Q A;  3PV8 A;  3D28 A;  1FKP A;  3NGR A;  4QIV A;  2MTL A;  4RWW A;  2CFX A;  4GO7 X;  3KNG A;  3ZC4 A;  1FRJ A;  5HJY A;  5KG6 A;  3MEK A;  4ERD A;  1QAY A;  1HWJ A;  1SKU B;  2CQH A;  3TZW A;  1YZ6 A;  5K8N A;  4YR0 A;  1FKP B;  2XI3 A;  8AT1 B;  2PMH A;  1W25 A;  1JLQ A;  3RTV A;  4OZ5 A;  5HL7 Q;  1WC4 A;  4RUA A;  2DIS A;  3MGJ A;  4Q43 A;  2E5H A;  4J91 A;  3OPK A;  3IMQ J;  5B0E A;  4J9K A;  4V19 X;  2P9E A;  4DL0 C;  1SKW A;  1N36 J;  1JJ4 A;  3QJL A;  3D6M B;  1XN9 A;  1WNE A;  1Q8L A;  1PAE X;  5DO2 A;  2C2Z B;  4KR0 B;  1XER A;  1RWU A;  1XMO F;  4KPY A;  4WP8 A;  1VIS A;  1N0U A;  4U8Y A;  5F8I A;  1YVF A;  3OR1 A;  2GCF A;  5B0B A;  5HQ8 A;  4K4Z A;  3P49 B;  2FJE B;  3LP0 A;  1OO0 B;  1X4B A;  1NKE A;  1RXO B;  4AYB D;  4LFB J;  3KFW X;  1NJI T;  1ZA1 B;  4KHR A;  1HQU A;  2JH3 A;  1G2E A;  2JC1 A;  4DFP A;  2BOA A;  4Q2M A;  3DKD A;  4CLP A;  2L41 A;  2PI4 A;  1Q53 A;  2EEY A;  3SCK E;  4PZV A;  4N56 A;  1VC0 A;  4WCE Q;  2QA2 A;  2CIM A;  4M5H A;  2DIT A;  4MFB A;  2EFV A;  4B3T F;  3JTN A;  2XCP A;  1FFG B;  3EDQ B;  1FRL A;  4O3Q A;  2VJU A;  1YRU A;  2D3O R;  5HRO B;  5H9F J;  1FEE A;  2F7V A;  2MGZ A;  5J1N A;  2IRU A;  5ETQ A;  1PO6 A;  2CAJ A;  4LF7 J;  4ZCI A;  2R7Q A;  5FLX U;  4KE5 A;  4TNO A;  1T05 B;  4YHH F;  2H54 B;  3LQV A;  2FZG B;  2QGF B;  4JI5 F;  4L76 A;  1LW0 A;  3TZX A;  3R2C J;  2NXU A;  2PEB A;  2KVI A;  4ECT A;  3CCQ S;  2NXE A;  3CDE A;  4J9U E;  4NYO A;  3SDE B;  3FK4 A;  1J5E F;  2UUB J;  1IVZ A;  4LR9 A;  4ETZ A;  2ZJQ Q;  3UN3 A;  3W2W A;  2XGQ A;  3VZH A;  1GTH A;  4OV1 A;  3R1L A;  4C8Z A;  3MR6 A;  3THP A;  3FCV A;  1QY7 A;  2C3M A;  3UDV A;  3CJK A;  4DX7 A;  2MQL A;  3SFG A;  2E5I A;  2KJW A;  3T9Z A;  1L3K A;  2PA3 A;  3ISN D;  1VJW A;  4ZPV R;  4ATN A;  2AYB A;  2UVW A;  3W9I A;  1X31 C;  2X3D A;  5M2R A;  2BOP A;  2B8P A;  3DHW C;  5CYQ A;  4GKK J;  2X7I A;  2DH9 A;  1RAJ A;  3A8I A;  1DLO B;  4B9N A;  1VC6 A;  2QL5 B;  1WC0 A;  2NXC A;  2YTC A;  4ZA1 A;  1Y5L B;  4OZ3 A;  4WTO B;  3Q8Q B;  3RB6 A;  1X7V A;  5J2Q A;  1SKR A;  4CP5 A;  3MMB A;  1RWN B;  2OEJ A;  4F50 A;  2EXU A;  5IXU A;  3BKF A;  3OLB A;  3H40 A;  1OPI A;  2LU2 A;  3C6T B;  1X5O A;  4B9S A;  4JV2 A;  4OI4 A;  2YBV A;  2DR7 A;  3MM6 B;  1YDL A;  3N9U C;  2D69 A;  2XLJ A;  3SSR A;  3K0J A;  1VK8 A;  1K47 A;  3DHX A;  5HMX A;  4Q8F A;  3GON A;  3KJF B;  3QBC A;  2ZH5 A;  2ZJP Q;  3H98 A;  5D15 A;  1RTH B;  2KFY A;  5CYM A;  2K1R A;  4KB7 A;  2OH2 A;  2HFO A;  1TKT B;  2NUH A;  2B9E A;  2K2P A;  4H4M B;  4YN3 B;  2Y1J A;  4ZPA A;  1UVN A;  2HVZ A;  2YNG B;  5EGY A;  3BSN A;  4RNH A;  1KQS R;  1WG1 A;  1S10 A;  1S1W A;  2ZH9 A;  1S79 A;  3BGO P;  1VQN S;  2K1R B;  1S1T B;  3V2U C;  4DS4 A;  5KFB A;  2A10 A;  2VBY A;  3BGF A;  2A18 A;  4ECR A;  5ETT A;  1IBL J;  4TLQ A;  3W1Y C;  3NOC A;  3J7Y U;  4IO9 Q;  3TAR A;  3OVA A;  3AY0 A;  1RTI A;  3GG1 A;  2GV1 A;  2XMM A;  1KQG B;  2GIF A;  3QO9 A;  7AT1 B;  3UR3 C;  4USV A;  3EZU A;  1AUS L;  2BDP A;  3OTD A;  4NLS A;  1AT1 B;  2HRU A;  2J0W A;  5F8G A;  1PC4 A;  1QTM A;  1H7W A;  4DFJ A;  2WSE C;  2PA8 D;  5HBM A;  3MR5 A;  4JV0 A;  1XTZ A;  4LJM A;  1UWB B;  1YKW A;  2E1M C;  3DRP B;  3NBP A;  3KMS A;  4B3T J;  4LFC J;  1VCT A;  1SC6 A;  3DLK B;  1H74 A;  4FKX A;  2MZT A;  4P10 A;  2RU9 A;  3G8Q A;  1GMW D;  1NDP A;  4RWX A;  4Y0F A;  4C98 A;  2EC0 A;  3GR0 A;  5B0G A;  2DNH A;  2Z0G A;  2KT3 A;  2ASJ A;  5SUH A;  1HNX F;  1R89 A;  4B3O B;  2HHT A;  1UWB A;  3IGV A;  5DZ7 A;  3ILL A;  4QIE A;  3KUE A;  1XK8 A;  4FDF A;  2KH9 A;  1YJU A;  3CCT A;  2XO7 A;  3UD5 A;  1RWK B;  5HVH A;  3C6T A;  3IFE A;  1VQP S;  1RAI B;  1S6U A;  1FD8 A;  1SJ1 A;  3I0R A;  3MF5 A;  3D0G E;  3TRG A;  4DUZ F;  4DV1 F;  1UEK A;  2KT2 A;  1S0O A;  2XBP A;  2O66 A;  2QA4 S;  1HNV A;  1BQN B;  3DM2 A;  3HPO A;  1VBX A;  3FUY A;  1UEV A;  5GME A;  1DRZ A;  2AJ2 A;  4QYR A;  2DJW A;  1YK9 A;  5CAA A;  1YJN S;  5GVQ A;  3CMQ A;  9ATC B;  4DSI A;  4C4W A;  3A3O B;  1FXR A;  5CYM B;  2DHH A;  3AD9 C;  3HVA A;  3R7N B;  4C3K A;  5A6P A;  4DR6 J;  3I0R B;  5A76 A;  2FJV A;  2YNI A;  3G71 S;  1NND A;  2EFO A;  1RAC B;  2X3G A;  4RUB A;  1LW2 A;  5KFP A;  4X62 F;  1KOO A;  2RDI A;  2CQG A;  4ID8 A;  2I5J A;  1NPR A;  1P6T A;  4RW8 A;  2V63 A;  5IWA J;  2G2O A;  1WOS A;  4M5D A;  5F3Z A;  1S1T A;  2DNK A;  3LAN A;  3RAM A;  2YNI B;  2FVP A;  2DR6 A;  3C16 B;  4U95 A;  1NME B;  3BZQ A;  3I82 A;  1OQ6 A;  4FVM A;  2ZH3 A;  1U48 A;  3MM7 A;  2VHG A;  3JSY A;  2R8G A;  4O0N A;  4P2S A;  5CAB A;  2ZZT A;  2Z8Q A;  3LGN A;  5D6G A;  3F73 A;  2QG9 B;  3BSA A;  2E5J A;  5KFY A;  4QWC A;  1S9G B;  3T5K A;  3D2W A;  3TWZ A;  3FEY B;  1KC8 T;  1JIH A;  1APS A;  4DSF A;  1T94 A;  4R8U A;  4ZN1 A;  5LMU J;  4DV4 J;  2KHD A;  5CZV A;  3CD0 A;  2JFK A;  2F9D A;  1KTV A;  2VG7 A;  1Y5I B;  3AJD A;  3FRY A;  4UST A;  3TQE A;  3DRS B;  1R6V A;  2FHM A;  3OL9 A;  3PX4 A;  4Q2L A;  2AJ1 A;  1MWQ A;  2C3O A;  2UUT A;  3BR9 A;  5FLX Y;  4Q45 A;  1ZM9 A;  5DDR C;  1JLC B;  1SC1 B;  5DET A;  1BD6 A;  2MHN A;  2BEF A;  3DXS X;  1VBY A;  1ARO P;  4CO3 A;  2H48 B;  1S1V A;  3Q83 A;  2OJ3 A;  4DR3 F;  3OUY B;  2JDJ A;  1R8C A;  2QEX S;  4A8M P;  4FBT A;  4CLW A;  3SCI E;  4DUT A;  3AXK A;  3W65 A;  1Q82 T;  4G6V B;  4XPC A;  2C22 A;  1KFD A;  4X64 J;  4TN2 A;  3M6U A;  3BSC A;  4ZJQ A;  2XB2 D;  4RL1 A;  2ZM6 F;  4W4M A;  2WVC A;  3MEE A;  4HH0 A;  2MEW A;  1T9V A;  4HVZ A;  2C2O B;  4OYB A;  1J5O A;  1RTJ A;  3MM8 B;  5D4O A;  2AIR B;  2Q6C A;  2EK6 A;  1IN0 A;  3MD3 A;  2DGQ A;  1QE1 B;  2MJU A;  3EWG A;  1HYS B;  4M5M A;  2DGU A;  1IM4 A;  1IWG A;  4QR0 A;  1C0T A;  3NAI A;  1RAE B;  1Y10 A;  2IIH A;  5KG4 A;  3BO2 A;  4R0J A;  4K4U A;  4AL7 A;  1YBU A;  1SQG A;  2X1G A;  3HXM A;  4DSE A;  4J9V A;  2B43 A;  3IA0 A;  5KT7 A;  4DQS A;  2OPP B;  2LEC A;  1NK6 A;  1FK9 A;  1GMU A;  4NLX A;  3Q8R B;  3W62 A;  4ZCM A;  1VQ4 S;  2HK3 A;  2HG4 A;  1WEX A;  2RQ4 A;  3WBZ A;  5HP1 A;  1TKT A;  1WC1 A;  2CDR B;  4OJG A;  4JI3 J;  4XDD A;  3CCS S;  2FPH X;  1WAC A;  1U09 A;  1TL5 A;  1QJH A;  2HWT A;  1JK9 B;  3HVT B;  1VI7 A;  4HAC A;  4I6Y A;  5GMD A;  4A8S A;  1CUL A;  1XJW B;  1XMQ F;  4M8L A;  1OS5 A;  4HDH A;  5D0H A;  2BUN A;  3RBE A;  1E6Y B;  1CC8 A;  1RAA B;  2FUG 9;  3A3P B;  4OZN A;  4ZPC A;  2CJK A;  2DBB A;  1H2V Z;  1FXD A;  1SV5 B;  1O51 A;  1ACM B;  1VRQ C;  2WAQ D;  3LP2 B;  4OX8 A;  3R97 A;  5C42 A;  1DUR A;  2HGM A;  2ZBQ A;  2Q79 A;  2XSJ A;  3J7Z 5;  2Q1L A;  3D0I E;  3N6M A;  4XO0 A;  3TAQ A;  4G3I A;  3NGK A;  4M5K A;  2FGC A;  4F67 A;  5H9E J;  2IVF B;  2XWY A;  2VFR A;  2DO4 A;  2HSE B;  1I6J A;  1RDR A;  4EWT A;  1TFY A;  4Q44 A;  1GX5 A;  1YJR A;  3B6B A;  3PHT A;  2IJN A;  3RGI A;  1JNR B;  3ZZY A;  3GIM A;  1NK7 A;  2A3J A;  4DR4 F;  3DOK B;  1DJ0 A;  1S7H A;  2JSX A;  5MAO A;  4N8N A;  1NAQ A;  3HJF A;  3NGS A;  3QFW A;  3T1Y F;  1TU0 B;  2HIY A;  2B7C B;  2CG4 A;  3M8P A;  3QMQ A;  5J2N A;  4B3O A;  3UNG C;  3KK3 B;  1KQK A;  2MQ8 A;  1U4B A;  4C8M A;  2K3K A;  1ZAV A;  5JJB A;  3H2V E;  2E5G A;  2WSF C;  1FFS B;  2QE5 A;  5BR8 J;  2VC0 A;  1WEL A;  3TJ9 A;  3PR4 A;  3GB0 A;  3WDO A;  5KFI A;  4KRW A;  3AOC A;  1LNQ A;  3QGI A;  4WYW A;  2ZNY A;  4O44 B;  1UZD A;  1FVS A;  2XMT A;  1SJQ A;  1F1B B;  4QR2 A;  5E5N A;  1X4D A;  2I1R A;  4IFY B;  3S6E A;  3HMJ G;  5DDP C;  3OFE A;  3B54 A;  4LSZ B;  1T0T V;  5CH7 B;  5K8M A;  5LSL A;  4WFA Q;  1FI4 A;  2BAN A;  2YNF B;  4JI8 F;  5FJ4 A;  3IBC B;  4DFM A;  3MAA B;  4PG5 A;  3AXM A;  1KVJ A;  1QTN B;  4UW2 A;  4F4W A;  1C1C B;  4NX9 A;  1HI8 A;  2VJV A;  4JB8 B;  1SL2 A;  4JI4 J;  3AQO A;  1FXL A;  4KBI A;  4IOB A;  4K2X A;  3IM9 A;  3PXG a;  3M2U B;  5ETN A;  2UU9 F;  4IR1 A;  1N33 F;  4DV7 J;  4AL6 A;  2YKM B;  3CCR S;  3G4S S;  1JLB A;  4URQ U;  1IR1 A;  4RBU A;  1CC7 A;  4BC7 A;  4TY9 A;  4EBE A;  1N4L A;  3MOJ B;  1SVD A;  4ZHR B;  1MMN A;  2LMI A;  1Q1K A;  4C3L A;  3B78 A;  3NS7 B;  3MFH A;  4DR4 J;  3KLG A;  2GGP B;  6AT1 B;  3DNC A;  3M2R A;  4I2Q B;  2HUR A;  4OZJ A;  2DHA A;  5DQI A;  4NLR A;  4G1Q B;  4L3N A;  3C6U A;  4RW7 B;  2VBW A;  4OQJ A;  4CO2 A;  2AX0 A;  3LTO A;  4LVO P;  4DF8 A;  1LFW A;  2W1B A;  2ZE2 B;  2NZC A;  1V3S A;  1RT3 A;  3HJV A;  2GFF A;  1LWC B;  4PQA A;  3AB4 B;  4PXB A;  1NSP A;  3GE9 A;  5ETR A;  3K58 A;  4IFV B;  4I2Q A;  2MPU A;  4DR2 J;  5A0Y A;  1WG5 A;  2FVR A;  3LPY A;  1S1V B;  2OD4 A;  2CJB A;  4ZP8 A;  5C25 A;  1MRO B;  4DI6 A;  1WHX A;  4QWE A;  2IDL A;  1X60 A;  4DV2 F;  4DL5 A;  1FWP A;  4DZD A;  1N48 A;  3R27 A;  1F60 B;  2ZBR A;  5MLC V;  2J9D E;  4OMF G;  4P73 A;  1RKJ A;  2U2F A;  1U47 A;  2I5J B;  3EXC X;  3M8Q B;  4WFX A;  3NCR A;  3PEH A;  3SQO P;  1JB0 C;  1SH0 A;  4DU7 A;  2LCW A;  2IYI A;  3W61 A;  1I51 B;  3OLA A;  4C8K A;  4D3H A;  1NK9 A;  2QYC A;  4K7Q A;  2NPF A;  3P5T L;  2LKZ A;  2YX1 A;  3K5O A;  4OYO A;  3C14 A;  3W60 A;  4MKY A;  4J37 A;  3TOQ A;  1UVM A;  4A8O A;  4WU3 A;  3HT0 A;  1GK8 A;  4LRC A;  1VK3 A;  3CJQ A;  3T19 A;  4JI7 J;  5JUM A;  3Q8Y A;  3KJQ B;  2G1H A;  3PEJ A;  4I6W A;  4AT1 B;  3QLH B;  4ZN3 A;  3R5C A;  2UV8 G;  4RW4 A;  4YY3 F;  1X0P A;  2DIV A;  1IKV A;  4TKT A;  3V4M A;  1CEZ A;  1KP6 A;  3HHD A;  1JLF A;  1BE4 A;  2ZM6 J;  1U24 A;  2D1C A;  2L08 A;  2FHJ A;  3FBC A;  3I96 A;  2HEK A;  2QN6 B;  4MK9 A;  4RNO A;  4AXJ A;  5L1I A;  1HPZ B;  3PFE A;  4CTA B;  2DRA A;  3IS9 A;  3QT8 A;  4KPC A;  3PX6 A;  2YWG A;  2DNQ A;  3A4T A;  3MI7 X;  2J76 E;  1JLF B;  4LFA J;  4BS2 A;  3GSI A;  3NY0 A;  1HQU B;  3MMA B;  3DOL A;  4FYW B;  2NYI A;  1TV6 B;  1E6V B;  4USI A;  3W2V A;  1ZZN A;  1U1M A;  1KLM A;  4LFA F;  4ZP6 A;  2F4F A;  4WKR A;  2DHG A;  1SXL A;  2Z30 B;  1KQF B;  1DLO A;  3FVY A;  3PW0 A;  2G13 A;  2YKA A;  4ID5 B;  2KVQ E;  1ZOT A;  2ZOM A;  4USK A;  4EUV A;  3GJT B;  4K5S A;  5J1E A;  2QYG A;  4N7T A;  1S1X B;  3J7Z T;  3HHE A;  1RBL A;  2JL9 A;  5D0R A;  4UOC A;  3GIJ A;  1P1T A;  3MTJ A;  1G3O A;  4YY3 J;  1X0F A;  1WHW A;  2YWE A;  3CW2 C;  3IR5 B;  1RU1 A;  1S6P B;  3W64 A;  4IR9 A;  2G1D A;  1QDU B;  1VHI A;  2HQ3 A;  4PCQ A;  4TU9 A;  2ZH2 A;  4F3O A;  2MZJ A;  4NLU A;  4DPY A;  5KFN A;  4ZIV A;  5IC6 B;  1WC6 A;  1XMO J;  2IYG A;  2XMK A;  5L8R C;  3ZNJ 1;  4WFY A;  3GIR A;  3SDE A;  3OVS A;  3RRH A;  2DKO B;  1C4C A;  4YQW A;  2ZDO A;  4P2M A;  2GW8 A;  1YZ7 A;  2YY3 A;  3ENA A;  4MAK A;  4RBT A;  1B0V A;  2EI5 A;  2M88 A;  4OI1 A;  4NI2 B;  1H0H B;  2IVM A;  2IM3 A;  3BGR B;  4OJ3 A;  4DOZ A;  3FGV A;  2DCU B;  3ISN C;  2K06 A;  1YBA A;  5B0C A;  3BYR A;  2YKN A;  1YGY A;  4ZS6 A;  4N5S A;  2YNH A;  3MR2 A;  4LSN B;  5KOX A;  2EFQ A;  5DG7 A;  3M30 A;  2DNY A;  3ZTQ A;  3MUV P;  1N32 J;  2B9Y A;  2J0S D;  2DNO A;  4OX6 A;  4MYU A;  1MU2 A;  5I42 B;  1DQ8 A;  3DC2 A;  4ED1 A;  1FNX H;  4JV5 J;  1KFS A;  2HAF A;  1U1N A;  1FJ7 A;  1YLX A;  3R9L A;  2Y8Y A;  1TV6 A;  2VPX B;  1VQM S;  4FYX B;  4DR1 J;  4O4R A;  2V34 A;  1RQ0 A;  2HVE A;  4P2X A;  3I55 S;  1FKO B;  2CQB A;  1TL1 B;  2KFN A;  4O3R A;  1IJE B;  5L9X A;  3PRB A;  5EHH A;  4J9M A;  1TUW A;  2MLX A;  1XC9 A;  5BJR A;  4QIW D;  1ICE B;  4Y3C A;  2JEF A;  4IH6 A;  2AHO B;  1V5V A;  2OTL S;  4W92 B;  2G4B A;  1NJY A;  2KYZ A;  3VQS A;  1S12 A;  1FKO A;  4DEZ A;  1RWO B;  2AZ1 A;  3RYL A;  2HHQ A;  4FXW A;  4JI4 F;  1EHW A;  4R5P B;  4TQR A;  1GFW B;  2C2K B;  3C15 A;  3ZTR A;  3G86 A;  1LEO A;  1FVQ A;  2EPI A;  3T5L A;  2XNQ A;  4Y28 C;  2XYH B;  2HMI B;  2BV3 A;  1C0U B;  2OEM A;  4IKA A;  3ILO A;  1WTF A;  3IG1 A;  5FDL A;  2H4Y B;  4L3K A;  4DQR A;  1N54 B;  2KXH A;  1EP4 A;  4ZIT A;  3HI9 A;  2AGP A;  3SCL E;  4F02 A;  4TLR A;  2GVD A;  3D9B A;  4USH A;  4RX6 A;  3OQ2 A;  1DFD A;  2BA9 A;  2BAB A;  3N5B A;  1BQM B;  4MYT A;  3I56 S;  3FBE A;  1URR A;  2AT1 B;  2B56 A;  2HS4 A;  3RRK A;  4P9S A;  1VQ5 S;  2EKY A;  4DDF A;  3G9C A;  1T9X A;  4M5I A;  5A2Q U;  1LW0 B;  2CRL A;  3MR3 A;  3CUN A;  1YTY A;  4IQM A;  4CRJ A;  2HHP A;  2LXI A;  1NPP A;  1NRK A;  2BE7 D;  1WOR A;  2DNR A;  1XNR J;  5KFL A;  2ADC A;  2DGS A;  1VQS A;  3I0S A;  3CB4 A;  3VAG A;  1AZS B;  4WII A;  3ZZZ A;  2HS0 A;  3JSM A;  3KG1 A;  3PO5 A;  3NNA A;  2C2E A;  1U2C A;  1RJJ A;  1WC5 A;  3TAP A;  4RNF A;  5L39 A;  3VAI A;  4ENO A;  1QSL A;  3ZZ0 A;  5D4P A;  4LSL B;  4XIU A;  2EFG A;  5DDQ C;  2J7K A;  4UT4 A;  1LWC A;  1KRP A;  5T14 A;  2CNK B;  2NQP A;  2H1Y A;  3GYN A;  3JSB A;  4MFB B;  5DLF A;  4B3R J;  2GJ2 A;  2HHW A;  1VBK A;  3K5P A;  3H2U B;  3LWM A;  4EBD A;  4TXS A;  4DR7 F;  4OL8 A;  4CLK A;  2Y8W A;  2ZC3 A;  1LXJ A;  2G2Z A;  5LSO A;  2RUG A;  4FYD A;  1QD1 A;  4NCG B;  3TA0 A;  3AOB A;  4J9L A;  2GQC A;  3V81 A;  2ADB A;  3R7B B;  3HHN B;  4X4R A;  2KG1 A;  3AQP A;  1NU4 A;  1TZ0 A;  3D3B J;  4OI2 A;  3FEZ A;  4EU0 A;  3RB3 A;  1JLA B;  1M0S A;  2QRR A;  1MN7 A;  3H5S A;  2X1B A;  2BM1 A;  1NEE A;  1Q16 B;  2OML A;  1RA7 A;  3QID A;  3A8E A;  5KFE A;  4J5O A;  1N5Y A;  1XNQ F;  1JLA A;  2B3T B;  3PW5 A;  2BBE A;  2CVE A;  2AU0 A;  2HFS A;  4ZVF A;  4KTQ A;  1BMQ B;  1RUS A;  1U0H A;  7FD1 A;  3K2Y A;  4CH1 A;  1PYS B;  3CJ5 A;  2YWW A;  3OXG A;  1IKY B;  2XGP A;  3MMC B;  2QC3 A;  2GML A;  3Q8V A;  1T05 A;  4GKJ F;  1XR6 A;  4CT9 A;  1S6O A;  3NNC A;  4X4N A;  3G2X A;  5LXY A;  1AA1 B;  3M8Z A;  3MM5 B;  3HSJ A;  2XZT B;  3MCS A;  1WKK A;  5D77 A;  1NH7 A;  1WD6 A;  2Z58 B;  3UCZ P;  5T7L A;  5GAG I;  3VAM A;  1RT6 A;  3I9Z A;  3PJW A;  4RNM A;  4HKQ A;  4YHH J;  4LSL A;  1PJ5 A;  1D9A A;  2FHO B;  2M9K A;  3TAM A;  3ZFV A;  3RG6 A;  4CO1 A;  5KG5 A;  3MTK A;  2HHX A;  3LAK A;  3GIK A;  3Q89 A;  5T7L B;  1F9E B;  3KLH A;  1TKZ B;  4NYP A;  4ZPT R;  4DCP B;  2G0J A;  1OWX A;  2J8A A;  3F0N A;  2JC0 A;  4DCO B;  3C2P A;  1FTC A;  4U9R A;  1OSC A;  2HS3 A;  5E3Q A;  5E33 A;  4A48 A;  3GIL A;  3K5M A;  3VV2 B;  1OPZ A;  3ENV A;  3G6V A;  1D0E A;  3CIM A;  3DI6 A;  4PKD B;  3CCE S;  1QE1 A;  1HYS A;  3JYT B;  1XBW A;  4CDI A;  3Q8P B;  1ZH5 A;  2VH7 A;  1RHQ B;  1MG7 A;  4C3M A;  1IR2 A;  2CNO B;  4EI2 A;  2OD6 A;  4LFB F;  5KG7 A;  1RHJ B;  2IJR A;  3MXH P;  2GNK A;  3OSN A;  2PD1 A;  4I7F B;  3ZZU A;  4WJB A;  3EPG A;  2W9C A;  3T1H F;  4C8Y A;  2E1C A;  2VPZ B;  3CSK A;  5HN0 A;  3J81 j;  4HTJ A;  2V2K A;  2IFX A;  1U6B A;  3CC2 S;  4GC6 A;  2YKO A;  2WHO A;  1BHN A;  1F5C A;  4H4K A;  4DX8 H;  4OLP A;  3ZO7 A;  4J9S A;  2J6T A;  2OTJ S;  4HYK A;  1TL3 B;  2VL1 A;  1KS2 A;  1REV B;  2LQJ A;  3QT5 A;  5D8H B;  4K4Y A;  4HR2 A;  3J80 U;  2XEX A;  1RAB B;  4DPX A;  5B08 A;  4MH8 A;  4P7V A;  4LR7 A;  4CH0 S;  1V6H A;  2QL7 B;  2HK2 A;  1YJT A;  2OO4 A;  2DXD A;  4OZ1 A;  4ZVE A;  3HSZ A;  2BE2 A;  4HHH A;  1KBR A;  1WKJ A;  2JRS A;  4KT0 C;  5EX3 A;  3M8R A;  1KSP A;  2WZ1 A;  3KOA A;  5EUH A;  4C97 A;  4CI0 B;  1F5B A;  2BQ3 A;  2KZZ A;  4NOH A;  4DV1 J;  2C1E B;  3KK1 A;  1AFI A;  1D9D A;  1L3U A;  4WP3 A;  5KFG A;  3W7B A;  2B5J A;  3PRD A;  2OFH X;  3Q0A A;  3FFI A;  2CPY A;  2G0C A;  5HJX A;  3TI0 A;  2HYI B;  2XHW A;  3DOM A;  2HQG A;  1W2I A;  4Q5V A;  1HNX J;  1NZA A;  1OMS A;  4W90 B;  8ATC B;  3LPE A;  5H1S V;  5ETP A;  4LF6 F;  3M8S A;  2H3E B;  1Y00 A;  1ZAX A;  3FFI B;  3E01 B;  3H59 A;  1WSV A;  1HNW J;  3V5R A;  4CT8 A;  1VIO A;  2BVZ A;  3OV7 A;  3GQC A;  1XWL A;  2QFJ A;  3PW4 A;  4OI0 A;  2KL8 A;  4OYP A;  3RRG A;  2L9N A;  1XIQ A;  3IC1 A;  3CTR A;  4IDK B;  2ROG A;  2RVJ A;  3GFY A;  3TX8 A;  9RUB A;  1FJC A;  5K20 B;  5A0Y B;  2CQ3 A;  4G1I A;  4O44 A;  5KFV A;  5C7P A;  1X5T A;  5CZX A;  5DLG A;  1JQG A;  2NYH A;  3CCL S;  1M1G A;  3ZZT A;  2W2Q P;  1U6Z A;  4DPW A;  4JYA F;  2V4R A;  4DQI A;  1HW9 A;  2KU7 A;  3Q22 A;  1RP5 A;  2EG1 A;  6FD1 A;  3LO3 A;  3BV8 A;  3NWR A;  2HBR B;  2LQB A;  1OYD A;  2DR5 A;  1YX2 A;  3B82 A;  3OSP A;  3NMA A;  2B0G A;  2J0X A;  1T11 A;  1W26 A;  3A8J A;  3ITH B;  2N7Y A;  4ZIW A;  3OBI A;  4R8U B;  1Z4U A;  3HD2 A;  5K14 B;  2HZC A;  1OY6 A;  2XYP B;  2XZW A;  3M2U A;  2R3V A;  2VG6 A;  3NRB A;  3SEO A;  4DXL A;  2N3O A;  2H5E A;  1O8B A;  1EKS A;  2D9O A;  3H7H B;  2XMV A;  2MY7 A;  1ZA2 B;  3N6N A;  5E3R A;  4B3R F;  3SFU A;  3MHY A;  4S0M A;  2ZJR Q;  3BBB A;  3PG9 A;  2HIQ A;  2KYX A;  4RW9 A;  5L1L A;  1VC5 A;  3AAW B;  3I0S B;  4UOF A;  1U1O A;  1JLC A;  3FDS A;  2OPS B;  2HNY B;  4ZVP B;  4O3S A;  2LP4 A;  2J6S A;  2W2P P;  1Q79 A;  2OP5 A;  3PKY A;  1HNZ F;  4PPD A;  3GSD A;  2J9C A;  4NMX A;  1HNI A;  1TAQ A;  3SMZ A;  1ZYQ A;  3FBB A;  2SXL A;  2CPZ A;  2EBG A;  4DV2 J;  2MDA A;  3K57 A;  2DY9 A;  1W7W A;  4JI5 J;  3N01 A;  1S57 A;  2I9S A;  3DRS A;  2JZ5 A;  3PAC A;  4I0W A;  2MY8 A;  2ZOG A;  4OHZ A;  2QLW A;  3KDN A;  3BBC A;  5C2C A;  3MUT P;  2V4J B;  2HHV A;  3RU0 A;  4DV5 F;  2K7K A;  2CXE A;  2GO8 A;  3I9V 9;  1X5P A;  2ERR A;  1D9F A;  2X51 A;  3J7Y I;  4M94 A;  2ZKT A;  5CA5 A;  1S76 D;  5J2N B;  3CWJ A;  2MYF A;  4FZV A;  4E8U A;  1SC3 B;  4Y2K A;  1M5S A;  2QTW A;  4ED2 A;  4K59 A;  4B9L A;  3K17 A;  4F25 A;  3MMJ A;  4ECU A;  2DRB A;  2OPP A;  4ZVU B;  2EKN A;  1EET B;  4K5R A;  3DRR B;  2ACY A;  1MLA A;  1NO8 A;  2ATC B;  4M5D B;  3LOU A;  3TUP A;  1P1L A;  3MEG B;  4B9M A;  2RIL A;  3M2V A;  1ZZF A;  1RTJ B;  3MM8 A;  1HHQ A;  2D3Z A;  3QAT A;  3TJA A;  2VQE J;  4DR3 J;  1C2P A;  4HI1 A;  1T3N A;  2ATL A;  2JEI A;  1S0N A;  1K1S A;  3NLC A;  4RW4 B;  1B0T A;  1NHK L;  1RAO A;  1HKA A;  3U1M A;  1HD0 A;  2HQC A;  4DLG A;  3PX0 A;  1RU2 A;  4L73 A;  5GAG U;  5AE3 A;  2RKI A;  2YKP A;  2RUS A;  1LOU A;  1UJ6 A;  3L7O A;  3M8Y A;  4PXD A;  1FEH A;  1GXL A;  4MK7 A;  1HPZ A;  3CJS A;  3MPU B;  4J7C A;  3F56 A;  1T8E A;  2UP1 A;  1BUX A;  3KXD A;  5KFD A;  2CZ9 A;  4LQ3 A;  3IRW P;  3U02 A;  1M5P C;  1T9W A;  3HP6 A;  4CM2 A;  2QMX A;  4WE1 B;  3Q8S B;  1FE4 A;  4LIR A;  2YKN B;  3EMT A;  2B51 A;  2IVY A;  4M5N A;  2WON B;  2MQP A;  2XWX A;  1RT7 A;  3RUB L;  1BC6 A;  2RSQ A;  1NCL A;  2YQ1 A;  2VC1 A;  1E6V A;  3D6H B;  4WFZ A;  2E44 A;  3RBZ A;  2V4Q A;  1JJH A;  2DB1 A;  2R4F A;  2BE2 B;  3QGH A;  3FRZ A;  2UZA A;  5HK4 A;  4X66 J;  4A4J A;  4KV8 B;  3MUM P;  4ZPW R;  2VIH A;  2FLL A;  1Y9O A;  3J7A 1;  1MWY A;  3ZZP A;  4O0I A;  1S9F A;  4YEA A;  1GT8 A;  1K44 A;  2V67 A;  2AYE A;  4WXO A;  1X9M A;  2GMH A;  2LDI A;  2G2Y A;  3A12 A;  5HBM B;  3HDS A;  4K0K F;  3TUJ C;  1HHT P;  2E9T A;  1HWU A;  1Q8B A;  2FHJ D;  1KEK A;  1TK8 A;  3TAN A;  1KKH A;  1S6P A;  3PCO B;  4GO5 X;  3O1L A;  4LRE A;  2QSW A;  1WF0 A;  2ZE2 A;  1ZAW A;  3GWC A;  4OX9 J;  4O4G A;  4DBQ A;  4I4B A;  5HVF A;  2KXF A;  3EVO A;  3RBD A;  3LF0 A;  3M6W A;  4IRD A;  5J2P B;  4ED0 A;  3BGL A;  5KFK A;  3PR5 B;  1VYA A;  3A1Y G;  2YWK A;  4YR3 A;  2E9R X;  3VAL A;  1CJT B;  3FZB A;  3G6X A;  3VGV A;  2YNG A;  1FCA A;  3HUL A;  3SI8 A;  1P27 B;  4MKA A;  3KLF A;  2XC9 A;  4R0E A;  3N6L A;  2N4C A;  4DV6 J;  3E2E A;  1LV5 A;  3ZTS A;  1HL6 A;  3BKT A;  1O5J A;  2ZHA A;  4ZVT B;  3OJU A;  4NXM J;  1DTT B;  4F4K A;  3TX0 A;  3EJM A;  2WBM A;  2GVZ A;  2JWN A;  4DV0 F;  1H2U X;  1L3V A;  4USU A;  4DPO A;  1TTH B;  1SQE A;  1JLB B;  2OEK A;  1S99 A;  2MMY A;  1T03 B;  4ZPB A;  4GKJ J;  3ONQ A;  1J27 A;  1HBO B;  4F0H A;  4BDP A;  2GQQ A;  4ZHR A;  2DD8 S;  2F65 A;  3BDP A;  1DTT A;  1U02 A;  2EW9 A;  1X5S A;  2RJZ A;  2RRB A;  3ISZ A;  3QLH A;  1ZTT A;  2YWH A;  1U0S A;  1VQ6 S;  2MKJ A;  3R5D A;  3CPW R;  3DLK A;  3FCW A;  4FF4 A;  4PAA A;  1UJ5 A;  3S8S A;  1Y3K A;  4B17 A;  5IOL A;  5CD4 A;  4M1K A;  4MKV A;  1CJK A;  4RU9 A;  4YFU A;  1CBK A;  4CNY A;  2YVS A;  3UE2 A;  3DDN A;  1DZ5 A;  2VG5 A;  1U2F A;  2L9D A;  1B7Y B;  5I3P A;  5KFR A;  4EK2 A;  2PT0 A;  3OHA A;  5LJ5 Y;  4KJI A;  2FTR A;  1T9T A;  2HGL A;  2M3D A;  3W2V B;  3M8P B;  5E7O B;  2R7V A;  4QYZ J;  1U1L A;  1IBK F;  5E3A A;  4A46 A;  1SJ3 P;  2HBZ B;  1RT2 B;  4X4T A;  4AND A;  2VQF F;  2P9C A;  2VAS A;  1IJF B;  2Q3P A;  3OFH A;  4H4O B;  1C0U A;  3E8O A;  4O3O A;  4I2P B;  1N88 A;  2JEJ A;  5AT1 B;  3IRX B;  1TK5 A;  1NKB A;  1U1P A;  3D1O A;  2KXN B;  2IC3 A;  2VKZ G;  3WIV A;  2RNE A;  4XAK A;  1JWW A;  2AJ0 A;  4KC5 A;  2FJD B;  2IRY A;  4LF2 A;  3H8Y A;  4PUO A;  3V4I A;  2ZVS A;  2AJQ A;  3MCM A;  1JLE B;  4RBV A;  2R2U A;  1TK0 A;  1JKH A;  1UMJ A;  3C16 A;  2HVH A;  5K14 A;  3HSD A;  5D4L A;  5KFZ A;  5IS2 A;  4KO0 A;  1F2G A;  3CCV S;  1UVJ A;  2AW0 A;  1UP1 A;  4I1T A;  5GMK a;  1VBZ A;  1JKH B;  1K73 T;  2WW4 A;  4YDD B;  1Q81 T;  3T6B A;  3PY8 A;  3D5M A;  1M1K T;  2M52 A;  2FVQ A;  2LFV A;  1WHY A;  2VBX A;  2LQ9 A;  3FQL A;  1MSW D;  1HR0 F;  3RB0 A;  3TUI C;  4DS5 A;  3FMW A;  2ZC4 A;  4RLE A;  3CO0 P;  1IM6 A;  2JLE A;  3BDE A;  4N41 A;  3HVT A;  3I87 A;  4ED8 A;  4FNH A;  3EX7 B;  2BX6 A;  1TMM A;  3DRY A;  1WTB A;  1UTA A;  1UFL A;  3G82 B;  1IKW A;  2LXF A;  3JQJ A;  4ECW A;  2FLP A;  3C3L A;  1UVL A;  1GQE A;  2B4V A;  1LKZ A;  2LEB A;  3DLH A;  1HBM B;  3BQ2 A;  3BSO A;  1RT7 B;  2QX0 A;  1PYT A;  4TYB A;  2QSF A;  2M0G B;  4M5G A;  3LP2 A;  3H5U A;  4GC7 A;  4CYU A;  4ETX A;  4RO0 A;  5JVH Q;  3OR2 B;  3K7R A;  4QQB A;  4C8N A;  5JXS A;  1SIW B;  4LF7 F;  4CIO A;  2BJD A;  1GAO A;  2ABY A;  1RWP B;  3SV3 A;  1VGY A;  3V6K A;  1K9M T;  1T7P A;  4K50 A;  5C25 B;  2XY6 A;  3GJQ B;  2QV6 A;  3BO3 A;  3U1L A;  2DK2 A;  3G8T A;  5IQQ A;  4CYU B;  3BR8 A;  4X65 J;  1J5O B;  4ECX A;  2RU3 A;  2MST A;  5F8N A;  3CCW A;  1XR5 A;  4JV1 A;  3JQK A;  4EMD A;  2V2V A;  1OJ4 A;  1S4E A;  1SBR A;  2UUB F;  2WTF A;  1YG0 A;  2OKQ A;  3IWL A;  4U7U K;  3KK3 A;  1F5A A;  1YJ9 S;  2BMB A;  1VQY A;  1V5I B;  5LXR A;  4F2R A;  2XS5 A;  4K4V A;  2A6M A;  2B4O A;  3AB2 B;  5J2P A;  3D3C J;  1R0A A;  2BW7 A;  2HND A;  4JOU A;  5FD1 A;  2A0F B;  2OSQ A;  2E7X A;  4ES1 A;  4URG A;  4CZC A;  4LF8 F;  2E66 A;  2DIU A;  2CQ4 A;  2WVD A;  5HAT A;  4CCH A;  1S0V A;  2FGO A;  2ZOF A;  4USJ C;  3QIP B;  1UEU A;  4CLY A;  4E98 A;  2MKI A;  1PGZ A;  3KLF B;  3T41 A;  1N36 F;  2ZWP A;  1JLG A;  3NEK A;  2CPF A;  4OV6 A;  1NPK A;  4X84 A;  2KTQ A;  4F26 A;  4K4W A;  4PG4 A;  2W2M P;  4DQQ A;  3VTI A;  3DU5 A;  2AQ4 A;  1QAI A;  2CQ1 A;  3IS9 B;  3MAA A;  2DXF A;  4KKO B;  3LAM A;  2YXL A;  4ELT A;  1Y3J A;  3UCG A;  3JAM U;  3TVY A;  1YIT S;  2YNH B;  4DPT A;  4PWW A;  4A8Q A;  2NSC A;  3VGU A;  2Y1L B;  5L9N A;  3BN7 A;  4UOH A;  2HNZ B;  4PXC A;  4JI1 J;  2DNM A;  1FDD A;  1Q78 A;  3TYT A;  3QAU A;  3PIP Q;  2Y1I A;  4KSE B;  2VDI A;  5M2P A;  2J5A A;  2P5V A;  1WSR A;  2KT5 A;  3TVK A;  1XMQ J;  4KHP F;  1JMT A;  2BZ2 A;  3TUZ C;  3EE3 A;  2UVV A;  4IO1 A;  5B0A A;  4R5P A;  3KLG B;  3FJ2 A;  4NZ0 A;  1KHV A;  4PG8 A;  2PEH A;  3RR8 A;  2FJA B;  4Z2X A;  3VAH A;  2A6O A;  2CPH A;  2W9C B;  1HIY A;  2VFS A;  1VLO A;  1Q4R A;  3M1V B;  1RHU B;  3US5 A;  3J81 U;  1V3Z A;  4AFF A;  2IDE A;  3FC9 A;  3MM9 B;  1REG X;  2GO9 A;  3M9O B;  1EP4 B;  1QM9 A;  1SH2 A;  2VIC A;  5HLF A;  4E2F B;  3P3D A;  4ANC A;  2W2O P;  3IM8 A;  2WSC C;  3W9H A;  5DS7 A;  3W5X A;  4AUK A;  4F0K A;  2HND B;  1YJW S;  3CD6 S;  1BQM A;  2UUA J;  2MZR A;  3G96 A;  3UN2 A;  3UQS A;  3O6Q A;  4G1P A;  1GX6 A;  2FC8 A;  4C8O A;  5K8O A;  4QBU A;  2BAN B;  3R1H A;  1RSC A;  3HM9 A;  2RF2 A;  1CLF A;  2BW2 A;  3CCZ A;  3CDU A;  3C19 A;  2V8V A;  4K8R A;  4FPR A;  2AV5 A;  1KHW A;  1RLD A;  4L6V 3;  5IM0 A;  1PKU A;  5THW A;  4JI8 J;  3NGU A;  2DGV A;  4X64 F;  1HBO A;  1JLQ B;  4RNN A;  3HF5 A;  1H73 A;  4KH1 B;  1LFP A;  3CT9 A;  4FVC A;  1SJR A;  1Y7P A;  4ICL A;  4WXW A;  5DRK A;  3IWX A;  3CXC R;  2VV5 A;  1TP7 A;  4D3G A;  3NBP B;  4QR1 A;  3QSY B;  3GZ7 A;  2UUA F;  2GJF A;  1U8S A;  4YDX A;  1WG4 A;  2D41 A;  1RTZ A;  2AX1 A;  2NPI A;  3GJS B;  3HHK A;  4XPE A;  1NHV A;  4ED7 A;  1XNQ J;  3KLV A;  1K0T A;  2D7S A;  5I3Q A;  2HNZ A;  1GMW A;  1YRX A;  2EG2 A;  2E1A A;  2HNY A;  1VRT B;  4RKU C;  3N28 A;  4AQY J;  1HBU B;  2V9W A;  1HBN B;  2RH3 A;  1TUV A;  2WBR A;  1N56 A;  4QU7 A;  2CQI A;  3CJT A;  1OYE A;  3QSI A;  4U67 Q;  5HMZ A;  2WOM B;  2HRY A;  3RW6 A;  2ZBI A;  2IA0 A;  3PKM A;  4L72 B;  1R8H A;  3CJ0 A;  2J7W A;  1WI8 A;  3CED A;  4RU2 A;  4LQ9 A;  2V0N A;  1K1Q A;  2M8D B;  2VOP A;  1HFE L;  2WOM A;  1S9E B;  4LMZ A;  4ZCK A;  4JP8 A;  3PDN A;  1W2B R;  5A8K B;  4QZV B;  4TVA B;  3OFF A;  2M4M A;  1NK5 A;  4IRK A;  3AH6 A;  3D1Q A;  4DG1 B;  5IZH A;  5F9L A;  2VOO A;  4K4X A;  1DAX A;  3RR7 A;  2VFT A;  1N5T A;  3MZI A;  3RBX A;  3MM6 A;  1KR4 A;  1Q95 G;  1S1X A;  1S4F A;  3R5B A;  2BYC A;  2PDA A;  3GYX B;  2P6S A;  1S59 A;  2ZKU A;  4PWD B;  3DLJ A;  2HBY B;  4R25 A;  2NLW A;  4DL2 A;  1G4C A;  2F5G A;  3A3N B;  1P9Q C;  1TKX B;  4LBI A;  3QWU A;  1YJV A;  2CDQ A;  1N34 J;  3R6L B;  2LDY A;  3VAJ A;  1NDK A;  1Q8I A;  2CYY A;  2M70 A;  1XNR F;  4DUZ J;  1LXN A;  4DR2 F;  3MPD A;  4LF9 F;  1IKV B;  1M5K C;  1OIA A;  4GVL A;  2PMZ D;  3FSY A;  3M6X A;  3WZ0 A;  4V19 J;  3JTO A;  2NXJ A;  2DGO A;  4DCJ B;  2XY7 A;  5LJ3 Y;  4X66 F;  1HI1 A;  2DH7 A;  4OJ1 A;  2VZ9 A;  2CQ0 A;  2R2T A;  2Y0B B;  3JSM B;  4HEA 9;  4Q7A A;  5LMN F;  2KZM A;  3M7V A;  1IR0 A;  2RIJ A;  1X4H A;  5JVG Q;  2VPW B;  2HQF A;  2J9E A;  4YUD A;  3HD1 A;  2A1B A;  3OUY A;  2MQQ A;  2Z2L A;  2RRA A;  2ZVI A;  3FBF A;  3PTW A;  4H54 A;  4PG7 A;  1RBO B;  1SUQ A;  4WK1 A;  4ID5 A;  4KH0 B;  5HQM A;  1RT6 B;  1URN A;  3MPV A;  1NDC A;  1GEH A;  4Y2A A;  2RQC A;  5L1J A;  1VOM A;  4OIX A;  5SZT A;  4LF4 F;  2VQE F;  1Q5Y A;  2C3P A;  2ZD1 B;  1IXK A;  5M2U A;  2DEI A;  3PJ9 A;  4IUF A;  4KGK A;  1H98 A;  2CUY A;  3C46 A;  2AGO A;  4Z7Y A;  4DN9 A;  5BR8 F;  2MHE A;  3CCU S;  1KTQ A;  1NZ8 A;  1RWM B;  4EO6 A;  5ETK A;  3AT1 B;  2DPI A;  3H5X A;  2VDH A;  3HT3 A;  4NLQ A;  1WUU A;  5LMN J;  2F8M A;  3CE8 A;  1R8P A;  1XQI A;  3JQM A;  3GCX P;  1FJG F;  3DLL Q;  2BJ8 A;  2GIR A;  2VD3 A;  3GYG A;  4HHJ A;  1BLU A;  3VZI A;  1EIY B;  1WEZ A;  2OGU A;  5AE2 A;  4Y00 A;  1Q86 T;  1FHT A;  3FCH A;  3VAF A;  4KAI A;  3WQP A;  2PI5 A;  3KK2 A;  4FYY B;  1IKY A;  3TEG A;  3PIO Q;  3DDK A;  1RT5 A;  4QJV A;  5C2G A;  3KK1 B;  3T5J A;  2IM1 A;  2GVD B;  2HFU A;  1EB0 A;  3SBM A;  2XSJ B;  2IHR 1;  1SPB P;  3BRE A;  5KG3 A;  1HNZ J;  4EZ6 A;  3CC7 S;  2E7W A;  4FKY A;  4MKB A;  4F0M A;  1FFW B;  4ECV A;  4F3Q A;  2MQN A;  1CSJ A;  1NSK L;  4MMO A;  1U8W A;  3G87 A;  3GII A;  2J9D A;  2ZDP A;  3WC0 A;  4GKK F;  3VGT A;  1SI9 A;  4ICL B;  4OJH A;  3UWT A;  5H9E K;  1SJ4 P;  1LWF A;  3LP1 A;  3UPF A;  2W9B A;  3KHR A;  1TL7 B;  4UTG A;  3Q2T C;  2ASD A;  2AYG A;  3ELH A;  3QRQ A;  2LU1 A;  3EUN A;  4ZKA A;  3K5L A;  5IT9 Y;  4J90 A;  5HO4 A;  4OYX A;  5HMY A;  4JI0 J;  1ZPV A;  2ZBP A;  3NL0 A;  3UD3 P;  4ZOS A;  2MZ1 A;  1CJU B;  3BQ0 A;  4RJV A;  2GGP A;  3EGW B;  1UFW A;  3ETO A;  4IDK A;  1CQM A;  2W9B B;  4DSL A;  5J2M A;  4C8L A;  3E3X A;  2V9K A;  3KNA A;  3O2I A;  4KFB A;  2YPZ A;  1SJF A;  2RDJ A;  4FPI A;  1NK8 A;  3JTP A;  4P2F A;  3OL6 A;  2UUW A;  2XMJ A;  5ETO A;  1LWX A;  2E1P A;  3NCP A;  4I56 A;  2XUL A;  3TNV A;  5C24 B;  3SYZ A;  5HLF B;  1RT2 A;  1T9U A;  2R7O A;  4DR5 F;  1D8Y A;  4AQY F;  2HLU A;  1FKA F;  1U45 A;  3THV A;  2DRD A;  4PXE A;  5CCL A;  5B09 A;  2FZK B;  2V50 A;  2IJF A;  2ZHO A;  2FLN A;  2GHP A;  2HHU A;  2PN6 A;  2AD9 A;  2DVI A;  2GVZ B;  2R8K A;  3KUH A;  4CH7 A;  1TL4 A;  2DNP A;  4LF9 J;  2CPD A;  1VFJ A;  3DRR A;  4DN0 A;  4PWU A;  3UO0 A;  3KK2 B;  4HL9 A;  2O3D A;  1VQL S;  3LAL A;  2NZ4 A;  4LIW A;  2V8G A;  2NUU G;  3PYE A;  4TQS A;  2PMW A;  3BBF A;  3CCJ S;  4KGM A;  4A8F A;  2JLG A;  2V8H A;  2R42 A;  2BAC A;  2NS1 B;  2IBK A;  1MML A;  3KLE B;  1VS3 A;  1L3S A;  4ED6 A;  4PYD A;  5KFO A;  3R5A A;  2VB6 A;  5J1P A;  4FXD A;  3GPA A;  1LK5 A;  3PM9 A;  4RUC A;  1FTR A;  2ZFH A;  1HWL A;  1ZM2 A;  3T6J A;  4JI7 F;  2DGW A;  2IY5 B;  1UAW A;  1HD1 A;  5E2Q A;  1Q7Y T;  1G1X A;  4NCB A;  4B3M F;  1S9G A;  5IWA F;  1S7I A;  4NA2 A;  2HWH A;  1M5H A;  3ENW A;  5C42 B;  2OMO A;  1U1Q A;  1UKU A;  5F8L A;  1FT8 A;  4ES3 A;  3EDR B;  1BXN A;  3PNI A;  4WFN Q;  2ZH6 A;  3IBW A;  3BH6 B;  1S6Q A;  3VF0 B;  2QIF A;  1WDD A;  1WDT A;  4UF4 A;  1V9O A;  2OHD A;  1Y5N B;  2UUC F;  4I2P A;  4LF8 J;  2GIQ A;  5LOQ A;  2V94 A;  2AP6 A;  3CNQ P;  3WX4 A;  1RWV B;  2FJB B;  5I3U A;  1UPP A;  4NE9 C;  4TYA A;  3NS6 A;  3RAX A;  3PW7 A;  3GMG A;  2B7B B;  4NCG A;  5D78 A;  3ILI A;  3M8Q A;  1EET A;  1TKZ A;  1X4G A;  4QPT A;  4ZVQ B;  1T02 A;  4HH1 A;  2CWX A;  4IG3 B;  4NLD A;  3W8G A;  3TO8 A;  2ZHB A;  4B3S F;  3NWG A;  1SC4 B;  2ZH7 A;  4JI2 F;  2E5L F;  2IMW P;  3BS9 A;  5HVG A;  2IPO B;  1QUP A;  1HA1 A;  4MIW A;  2BJ7 A;  3MCN A;  4LRB A;  2NCK L;  1RB0 A;  4IG3 A;  2ROE A;  3IAS 9;  1AFJ A;  3AOD A;  3P5B P;  4J9P A;  2PO4 A;  3R2D J;  1R8A A;  5LSR A;  3PRV A;  3EZ5 A;  2I6W A;  2KJV A;  3POT A;  3L3C A;  3WC2 A;  3I32 A;  2CVI A;  3AOA A;  3QWP A;  1F9F A;  2W25 A;  1RTD B;  3X1L B;  2HKE A;  3HZG A;  3MEG A;  2DR9 A;  2IBO A;  1S77 D;  2CPJ A;  3SSS A;  1M5V C;  1FNM A;  2AEJ A;  2ALY B;  4DUY F;  4UOG A;  4DFK A;  4ILM A;  2O1P A;  3EPI A;  1IKW B;  1B0P A;  2EFN A;  2I0X A;  3UVJ B;  4QW9 A;  5LM7 E;  3V6J A;  1NUE A;  1D3W A;  4N76 A;  3W63 A;  4IH7 A;  2RKI B;  2F4V J;  3SQG A;  1UZH A;  2BKP A;  1H6K X;  2RAQ A;  2ZBC A;  1QUV A;  1WC3 A;  2XZD B;  3I6P A;  1CJV B;  4IG0 B;  4ITS A;  2J0Q D;  2YKM A;  4ECS A;  4QIG A;  3R6G B;  3FMB A;  3SXL A;  5I42 A;  1SUQ B;  5AXM A;  2MB0 B;  1E6Y A;  5HAO A;  2AKW B;  2OIH A;  3D6T B;  4C11 A;  2RD5 C;  1QSY A;  1F0X A;  1LK7 A;  1PCA A;  1TUG B;  3LW5 C;  3P4U B;  4DZ6 A;  3KYL A;  1PAU B;  2MZS A;  4WK3 A;  4A8Y A;  2CQP A;  4B9U A;  1YWX A;  5ITH A;  3IAM 9;  1M1H A;  3J81 Y;  2HVI A;  1KOH A;  2XHC A;  1N5V A;  2MSS A;  2FQQ B;  1FWK A;  3RAQ A;  4C0O C;  4C2M A;  3IP0 A;  1UW4 A;  2DH8 A;  3DFE A;  5IV3 A;  2CG8 A;  1YHQ S;  1A6L A;  1JJC B;  4YME A;  3S7R A;  1XMB A;  5HMW A;  2DTJ A;  2MKK A;  3PO4 A;  5KFS A;  1NHU A;  4C0H A;  2V8D A;  3JB9 k;  4NRU A;  4MIB A;  4I67 A;  4Y34 A;  4ZVH A;  2DNG A;  1HR0 J;  2DNN A;  3HHL D;  3OTO J;  1RE1 B;  1R8B A;  1YJ7 A;  1WI6 A;  3CIZ A;  4JBC A;  3T5H A;  1EKR A;  2W2N P;  1NXI A;  3BO4 A;  2L48 A;  1B99 A;  3EYZ A;  1NK4 A;  4CLU A;  1DQ9 A;  2OPQ B;  4KQZ A;  1OSD A;  2HQD A;  4ZLP A;  2BM0 A;  2RML A;  1PJ6 A;  4ED5 A;  2HHH J;  1OY8 A;  3OL8 A;  4Y2I A;  1K0V A;  2XS7 A;  2POK A;  3QZ7 A;  4OHX A;  4ANE A;  2YH0 A;  1KDN A;  1SV5 A;  3EVW A;  1F2H A;  1CJV A;  5F0U A;  2VG6 B;  4M63 A;  5AXL A;  4ZLN A;  2ZUG A;  2W8L A;  4JI3 F;  4KYZ A;  4X4P A;  2GC8 A;  3UCU P;  4G1Q A;  1DY3 A;  1JNZ B;  2DCL A;  3TEH B;  5KG1 A;  1YBT A;  4DJB A;  1VJQ A;  4U6P A;  4FNI A;  3GP9 A;  5DZ6 A;  2C2D A;  2VUG A;  3CD7 A;  4ZVR B;  3NG8 A;  3TQ1 A;  2DXE A;  3R8Y A;  1RWX B;  2H65 B;  2OPS A;  3H0P A;  1YQH A;  5KT6 A;  4ILL A;  1FJG J;  3THT A; 
#chains in the Genus database with same CATH homology
 1XMQ J;  4LF8 J;  4LF6 J;  5AJ3 J;  2UUC J;  4DR2 J;  4X64 J;  1I94 J;  3J81 U;  4JI2 J;  1IBM J;  4X62 J;  2E5L J;  2MEW A;  4V1A k;  4DUY J;  5LMN J;  4K0K J;  2UUA J;  4JI6 J;  4DR3 J;  2UXC J;  2VQE J;  3R2D J;  5IT9 U;  4HHU A;  4JI3 J;  4JI7 J;  4JI8 J;  1IBL J;  3J80 U;  2MTL A;  4DR6 J;  3W1Y C;  5A2Q U;  4NXN J;  4B3M J;  4LF5 J;  1HNZ J;  5LM7 E;  2ZM6 J;  1XNR J;  1J5E J;  4DV1 J;  2F4V J;  1XNQ J;  4B3T J;  4X66 J;  4AQY J;  3IMQ J;  4LFC J;  4KHP J;  1N36 J;  4LFA J;  1HNX J;  4JI0 J;  4RJV A;  3J7A N;  1HNW J;  2KVQ E;  4B3S J;  4LFB J;  4B3R J;  4JYA J;  4DV3 J;  2KL8 A;  4NEY A;  4OX9 J;  4X65 J;  2MQ8 A;  3T1H J;  4YY3 J;  2UXB J;  4DV5 J;  5BR8 J;  4DR5 J;  1IBK J;  4LF4 J;  3D3B J;  1N33 J;  4KY3 A;  1XMO J;  1HR0 J;  3OTO J;  2UXD J;  4LF9 J;  3D3C J;  4LF7 J;  5IWA J;  5FLX U;  4DV6 J;  4NXM J;  1N34 J;  3R2C J;  4DUZ J;  2HHH J;  2UUB J;  4GKJ J;  4JI4 J;  1N32 J;  5LMU J;  4DV4 J;  4DV7 J;  4KYZ A;  2VQF J;  3JAM U;  2UU9 J;  4JV5 J;  4PWW A;  4YHH J;  4DR4 J;  4NEZ A;  4DV2 J;  4JI1 J;  4DV0 J;  4DR1 J;  4GKK J;  4JI5 J;  4DR7 J;  1FJG J;  3T1Y J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...