5LMNJ

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5lmnJ00
1IBLJ 4OX9J 2KL8A 4X66J 4DV6J 4RJVA 4YY3J 4DR3J 4DR6J 2MTLA 3IMQJ 1HNXJ 2VQEJ 2UUBJ 4DV3J 4DV1J 4DV0J 4DV7J 5IT9U 4DR4J 4JI0J 2MEWA 4NXNJ 3J81U 1IBMJ 4LF5J 2F4VJ 4DV2J 4AQYJ 4JI1J 4JI6J 3J7AN 4KY3A 3OTOJ 4KHPJ 1J5EJ 4DR7J 5LMNJ 2KVQE 4DV4J 4B3SJ 4KYZA 4DUYJ 1HNWJ 4LF7J 2MQ8A 4JI5J 2E5LJ 4NEYA 4DV5J 2UXDJ 4K0KJ 4LF9J 4JI4J 4JI2J 4X62J 4B3MJ 1XMQJ 1XNRJ 4DR5J 2UUCJ 1FJGJ 3D3BJ 1I94J 4NXMJ 4B3RJ 4X65J 3R2CJ 4LFAJ 1N34J 1IBKJ 4JI8J 3T1YJ 4JV5J 4GKJJ 5FLXU 5AJ3J 5A2QU 4NEZA 4LF6J 4LFBJ 4JYAJ 1HR0J 4YHHJ 4B3TJ 1N32J 4LF8J 3D3CJ 5LMUJ 3R2DJ 5LM7E 3J80U 3T1HJ 4LF4J 4X64J 2VQFJ 5IWAJ 2UXCJ 1HNZJ 4JI3J 4JI7J 4PWWA 2UU9J 4V1Ak 4GKKJ 5BR8J 4HHUA 4DR2J 4DUZJ 2UUAJ 2ZM6J 1XMOJ 1XNQJ 2UXBJ 3W1YC 1N36J 3JAMU 4DR1J 2HHHJ 4LFCJ 1N33J
chains in the Genus database with same CATH superfamily
2WK4A 3J7Z5 3JB9k 4DQQA 1BLUA 2FVCA 2QZ8A 4ZITA 2GJFA 2NR0A 3EGZA 3US5A 4RJVA 4YY3J 3I56S 1FT8A 4K2XA 4DCPB 1RKIA 2FLOA 5KFMA 2B9XA 2OHDA 5AE3A 4AFFA 2IAJB 4YQWA 3GSDA 4WE1B 4LFBF 2BACA 1P6TA 4U96A 1MU2A 2PC6A 1V3RA 2AYEA 2FC8A 2FLPA 1R31A 3H90A 4U95A 4K4WA 1X5SA 2HHTA 1U0SA 3EZUA 3G82B 3TVKA 2FPHX 5L9NA 1ZM9A 4DV7J 4EBCA 1AFJA 2VHGA 2J0XA 2W4DA 3T41A 2CQGA 2FJAB 4PG4A 2YNGB 5DETA 3R7NB 5KFJA 1VMBA 4FXVA 2F8MA 4YB5A 3ZTOA 3DXSX 1URNA 2F4VJ 2XZWA 5LMNF 3UQSA 3FBEA 4QU7A 4C3LA 3OL9A 1URRA 2B4OA 4I2PB 1WKJA 3VV2B 2D41A 2VKRA 2M7SA 4MYTA 1VQPS 2Q43A 5L46A 4EZ9A 2ZZNA 3FRZA 2R3VA 2CPIA 1O0PA 1RT7A 2ZKUA 3QGHA 3PEHA 4LBIA 5G4DA 3D9BA 2OO4A 2J7WA 2XZDB 4ZDNA 2ZD1A 4ZJQA 4DUYJ 1N5YB 1B4SA 2C2KB 2NSBA 4DV5J 4ER8A 2HWTA 2UXDJ 4FN5A 3KNGA 2NYIA 2NZCA 3MMAA 3TVYA 4DFMA 4K4ZA 1IR2A 2BW7A 2HZAA 1RDRA 3D54A 2QC3A 1E6VB 4I6AA 4RBUA 4S0MA 4WCEQ 2I8EA 1UCNA 2VA3A 4BDPA 2HS0A 2IRXA 2EG2A 1FKAF 4JI3F 2LQBA 1OPIA 5J2PA 1TKXB 4O0NA 4C2MA 4IO1A 3H5YA 2FGCA 1FK9B 1VRTB 2YQ0A 3M2VB 4KGVB 2EKYA 1TL3B 3TA1A 5KFYA 3OL8A 1NU4A 2AF6A 1S9EB 3N6LA 4NXNF 2AJQA 4ES3A 3BGFA 2AQ4A 1QE1B 4AXJA 2AJ4A 3QO9A 4OX6A 4CT9A 1S1UA 2ZC3A 4G1PA 3ZZUA 2Z30B 1VCTA 1SBRA 3A8JA 3Q8UA 3D1OA 4J9KA 3C6UA 3I31A 1TL5A 2XMKA 2XHCA 4HDGA 3MUTP 1UZDA 5T14A 4AT1B 5E3AA 4MK9A 4TYBA 2CJ9A 3DHXA 4ANEA 1VR6A 2CPXA 2O1PA 1A0OB 2XMVA 5KFFA 2ZUAA 3MPUB 4U67Q 3PYDA 4OYXA 2IRUA 3ZO7A 3ZC4A 1TV6A 4U8VA 1W26A 2DITA 2JH3A 1Y5LB 4C7QA 5F9NA 4YHHJ 3EZ5A 5ETVA 2HIQA 5DZ6A 2NREA 4KH1B 1XN9A 2PI5A 4F25A 1RAAB 3M1VB 1BQMB 4TY9A 2MZRA 1S79A 3NEKA 3TVZA 3B54A 2IJNA 2I6WA 4NI2B 2FHJA 4R8UB 5A6WA 1XBWA 2C2DA 2VF3A 3DLKA 4DSEA 1U1KA 3CJKA 5IV3A 1N48A 2M3DA 1UZHA 2N3LA 2HURA 3EICA 9RUBA 4DQSA 2DXEA 2GC8A 3GP9A 3C6TA 1YBUA 2UUWA 3B4DA 4LF6F 1RJJA 1WSRA 4E0DA 1MWZA 4BBYA 1UVNA 2R4FA 4WP8A 3A4TA 3J7YU 2XI3A 4PQUA 1JLAA 2MHNA 1HNVB 4LRDA 3TAMA 4YR0A 1WNEA 3AOCA 1RT2B 3HMJG 1KVKA 2CG4A 3AD9C 4UOCA 2VG6B 2DGWA 5E7OB 1SKWA 3BSCA 4X4VA 1X0PA 3GYNA 1SVDA 3QPIA 4YHHF 3CWJA 1WEXA 2OPSB 3AJ2A 4A8OA 4DWIA 5HMXA 5ETSA 3CCJS 3QGGA 2GVZB 1VJWA 3PVXA 4Q7AA 4B3SF 1HI0P 3H7HB 1DLOB 4P72A 3G71S 3ICLA 4L75A 1JQGA 5CD4A 1T9WA 1MROA 4MIWA 4K0KF 2IVYA 4GKJF 4R5PB 4ECVA 2BOPA 4KKOB 4ZCLA 2UP1A 3S01A 2E9RX 5C25B 3DMJB 1BHNA 3Q0AA 4DV1J 1OSDA 1YJRA 2VFVA 3PCOB 1ULRA 1HW8A 3GCWP 1Q16B 2JFDA 2Z58B 5DQGA 4F67A 3T5KA 3QNWB 1U49A 2ZBIA 4V19X 3WC2A 2R7UA 4EMDA 1OJ4A 3RRKA 1FCAA 2UVRA 1Y4ZB 3ADAC 4QIFA 4C11A 3JSRA 3DLBA 3BN4A 3LP0B 1R7IA 1SKUB 5AXKA 1S10A 3OXGA 5IWAF 2CPZA 4ECWA 1N6QA 3WIUA 3FEXB 4MIBA 3VAJA 2I2YA 4FF3A 2JLEA 3FBBA 1RU2A 4LRFA 1RXOB 3G96A 4JI6J 3GFZA 3R5GA 1JLGB 1RT4B 3E01B 4MKYA 3POTA 4I2QB 2B8QA 1B70B 3JYTA 2WOMB 1ZA2B 5LMNJ 3KG1A 3F73A 3TAQA 4J9NA 4IOAQ 2C3OA 4NEYA 3CDAA 4JP8A 1JLBB 2BMBA 4QW8A 1VYAA 5IV4A 2EC2A 2RUSA 4WIIA 2LECA 2HBYB 4IH5A 4K0KJ 5E5NA 1SQEA 1TL7B 2MKSA 3NOGA 3BV8A 1JMTA 3CDUA 4FZVA 3W5ZA 1KLMB 4DPTA 1NJZA 3R7SB 2AIRB 3W61A 1XNRJ 4Q0BB 2CPDA 2JLGA 4GVBA 2BANB 4ICLB 4OHZA 2KB2A 1X4CA 1RWKB 2J76E 3QIPB 4U7UK 4Y2MA 5HROA 3K0JA 1GK8A 2B3TB 2GHVC 3SXLA 4OZ1A 4CDIA 2YNHB 3SDEB 1Q86T 2WRMA 2BE2B 3DRPB 4B08A 2F40A 5BYQA 1BMQB 2J9DE 2E7WA 1SJ3P 4L3KA 1RT5B 1HBUA 3IR5B 3C6UB 4DL7A 4LF6J 4IUFA 1U1RA 1TL4A 2AJFE 3BBFA 2OPRB 3IG1A 4M5LA 3WX8A 1X4FA 2DHGA 3NRBA 3D3CJ 3HFKA 1HHQA 3PRDA 3R5AA 1TFWA 2IDLA 2OUGA 2K3KA 3ISNC 1TKTB 2CNNB 1VHIA 3UI3A 3CCMS 3J7A1 1BQMA 2E1AA 3JTNA 1S49A 2LXIA 2OMLA 4KFBB 3CCRS 4JI5F 1CS4B 4HEA9 1UJ4A 4WFAQ 3I55S 4IQXA 5BYSA 2L9WA 3G6XA 1CJUB 2OSQA 1JJ4A 5HK4A 1LWFB 4KGZB 4KV8B 2HK2A 2MY7A 1WC3A 5IM0A 1RWUA 3D1HA 4H4KC 3DDNA 4RUBA 3CW2C 5THWA 2ZBQA 3DLGA 3OJSA 2R8GA 3LAKA 1FNOA 1SIZA 3Q8RB 2J9EA 3U02A 3BEGB 5K8MA 2V2VA 2ALYB 1C0TB 4LUBA 3TAMB 2D9OA 2MLYA 1VFJA 2ASYA 1PO6A 3VGVA 2F4VF 2GVDA 2MLXA 2B4PA 3LGNA 4RW7A 4RBTA 1K1QA 5E33A 1NDCA 3UDCA 1T3OA 3TUJC 3THPA 4KC5A 3UD3P 1W2BR 2A6MA 2KKHA 3BH7B 4HH1A 4LVNP 3CCLS 2NUUG 2CQ1A 2QV6A 4CCHA 2KL8A 2V8GA 2YWKA 2MGZB 3DYAB 3NCPA 5F0UA 1JWWA 1VQ4S 1EKRA 3NS7B 3PO4A 1GX6A 5DDPC 3PZPA 1HI1A 2CJBA 2N7CA 3OLBA 5KFOA 5CHCB 1RTHA 3TAPA 4JV1A 6AT1B 5CCMA 5A0YB 1H74A 2IAJA 2AD9A 1X4GA 4WE1A 3PFOA 4N8OA 4CWBA 4EEYA 3FKBA 3I6PA 2XY5A 1K9MT 3FEZA 3IBFB 3FZ2A 3H0PA 5I3UA 2HFVA 3CGIA 3DOKB 4OI2A 5KFVA 4F04B 3ENWA 1YLXA 2LCWA 4USUA 3ZZPA 2YVSA 3W9JA 4C97A 1FESA 4KHMA 3GQCA 4B3MF 1SJ4P 1OIAA 2MKYA 3EJMA 2DH8A 2HFOA 1A6LA 2OPPB 4CH1A 2DHXA 4A8MP 2I5JA 4IRCA 3OSPA 3MGJA 3PW0A 3FK4A 2BDPA 4DR1F 1MWQA 1SJRA 2CZ4A 2F4FA 1RT1A 1UEUA 3AY0A 5DO2A 2UU9F 4FYDA 4BC7A 5EX3A 5DQHA 2KVQE 5E3RA 1QVFR 1VS3A 3M9OB 1YRTA 3PIOQ 1N5YA 1REVB 1TK0A 1GXUA 2AJ0A 2BJ1A 2E5GA 4QYZJ 1RACB 3HDSA 4Y3CA 2M4MA 1JLBA 1M1GA 3MAAA 5AXNA 3CJ2A 2FLNA 2R7TA 5JMNA 3GV5B 1X4EA 4WK3A 3KK1A 1U2CA 2R7VA 1SPBP 2BV3A 5B7WA 1NKEA 2RKIA 4MMOA 3M32A 1FWLA 2CDRB 2COLA 2DXDA 3BPSP 2WBRA 4Q0BA 2RRAA 2JDJA 3AJ1A 4N77A 3MR2A 1TR0A 2ZKTA 2AGQA 1T03A 2FJWA 5KFEA 1JLEB 2DHAA 1IKWA 2ADBA 5I4MA 2B0GA 1N0VC 3R3TA 3I4PA 3V6JA 3VHQA 4ILLA 1WG5A 4O44B 3AAWB 3EPIA 4GC6A 1AYEA 3MCOA 4QWBA 3FCVA 2RF2A 5KOXA 5HLFA 3L7OA 1OMSA 1RT5A 1UA0A 2YH0A 3PYFA 2DCLA 4FYWB 3Q83A 2NYHA 3FJ2A 3PY8A 1CEZA 3DGVA 1QAJA 3W2VB 2OAUA 3HCXA 1U6BA 1Y10A 4Q5VA 2GIFA 1IBCB 3MECA 3NG8A 1WC5A 3OT9A 3MCNA 4AL6A 4OZ5A 2QX0A 1FEHA 3FQLA 5LMUJ 1U24A 3GE9A 4DBQA 2QFIA 1JJCB 1D8YA 3SV3A 3BO4A 3KG4A 4UUWA 4DN9A 4ZHRB 2CVEA 2VBXA 3T3FA 2QA4S 4PWDA 4WFZA 4K5RA 3RW7A 2KYXA 5IWAJ 1LW2B 3CDWA 2WVDA 3MMBA 2VG7A 1D8ZA 5F41A 1YJ7A 3PR5B 2DGSA 1HARA 1ZPVA 3KXDA 4ZJOA 1RHQB 1UW9A 2D3ZA 3P8BB 4IFVA 5CCLA 2OKQA 1F9HA 4ZPAA 2B8PA 4EO8A 3HSGA 4DV1F 2C2MB 1S1VB 2O01C 2DR6A 2RQMA 3DLGB 1DTTA 2QO3A 3ZTRA 3P3DA 4PR6A 4FYVB 5AT1B 3JTOA 2PD1A 2W9BA 4DSKA 1R0CB 4USKA 4QWCA 4OFZA 1JK9B 5LJ3Y 4TLQA 3DDKA 3QSYB 3OLAA 2BXJA 1PC5A 1KC8T 3OV7A 4DV7F 3BKUA 5IT4A 1ZAXA 2EWHA 2FHMA 2LA6A 5D4LA 3I5AA 5F8LA 2OTJS 2ZHOA 2XCAA 1EETB 2IVFB 3MFHA 4JI1F 1PCAA 4DFJA 4TVAB 1KQFB 3NCQA 4ZPCA 5KG1A 4QBUA 3GIMA 1P1TA 1OPZA 2YKPA 4EO6A 5F3ZA 4IDKB 3OQ2A 4U8YA 5KFKA 2Z8QA 3KHRA 4DV4F 1QLNA 1XIQA 1U1OA 2GX8A 1DBDA 2IYGA 2LMIA 3LF0A 2MTLA 4FPIA 1YGYA 1BWVA 1TKZB 2W8LA 4HL9A 4CLUA 4H4MA 4J9QA 1RTHB 4DV6F 3MEDB 3MMCB 1TKXA 1G1XA 2HEKA 4NMLA 5G0RA 5SUHA 3KLFB 4F8RA 3KLGB 1FK9A 1VQ6S 2GO9A 2DT9A 2RDIA 2HVHA 2O66A 1V6HA 2ZUGA 3GIIA 4FYXB 3EMTA 4M5NA 2BVZA 3TYTA 2CIMA 2QGFB 1HQUA 4LIRA 1TQLA 5HVFA 2QFJA 3RAQA 2JEJA 3QLHA 2R8IA 5HVGA 2AJ2A 4TYAA 2FY8A 2RDJA 4HH0A 3K58A 1BD6A 2V69A 2GHWA 1VISA 4Z7YA 3HKZD 2UV8G 4ZVEA 2A6OA 5KFCA 5LOQA 3TZWA 3E8OA 3DOLB 3PHEA 3EVMA 2EVZA 3CJ0A 2PDAA 4PYAA 4JI1J 1TV6B 3HLUA 4IH7A 5D4OA 5DM7Q 1S4EA 1KBRA 1RCXB 5L9XA 3N4WA 4CZCA 2WHOA 1RGVA 4LF9F 4F4KA 2X7IA 1H98A 3VR1A 4C48A 4UY85 1HBMA 3MWBA 1FDDA 2AEJA 2E5JA 4D3GA 2PA8D 1ROFA 4PABA 5FIIA 3I0SA 2R7QA 3PJ9A 2AU0A 4FF1A 3ET6A 3FSIA 1C1CB 3NNCA 3TA2A 1Y5NB 4ILMA 3M32B 3RRGA 1FXDA 3NXZA 3CJ4A 4KHRA 1R6VA 3I9V9 1T03B 4USVA 4I68A 2HMIB 1SL2A 4LF5F 4NXMJ 4M5JA 1WF2A 2Q79A 1ZAVA 1FFWB 5KG0A 1GMWD 2HNDB 3UN3A 4ZLNA 4WTOB 1NXIA 5D8HB 2M52A 5E2QA 5DGAA 3NGTA 3R6LB 2B9YA 3JSMA 2DRBA 4K59A 4P9SA 4CLYA 1BQXA 3M4XA 2W7OA 4FVCA 2HG4A 2FYXA 3GJQB 3RUBL 1KKHA 1FJCA 5HLFB 1HW9A 2APOA 2DGOA 2H65B 4FNHA 4DL0C 3RBEA 1HWJA 1X31C 4O4RA 4MJKA 1VC0A 2WVCA 1JJ2R 4GC7A 3NGUA 1NRKA 3VAIA 1S1TA 3OUYB 1KTVA 2D3O1 5KG2A 1H3DA 4N56A 3T1AA 3HJVA 4LF8J 1DQAA 4FDFA 4M8LA 2CXEA 4PWUA 2ZH4A 4A8KA 4NCAA 2V63A 2HQIA 5BYRA 2RS2A 4OMFG 1HYSA 5IOLA 3MM8B 3QIDA 3IRWP 3IWNC 2AJ1A 2VQFJ 3BN7A 2G0JA 2DRAA 1FKPA 2CNKB 4OL8A 1HNIA 4CH0S 5EWFA 5M2RA 3AA9A 2C2OB 2J9CA 2XMTA 4OQJA 2KFNA 3G82A 2FJXA 5SZTA 3BO2A 1NPPA 1RHJB 1Y0HA 3MCMA 3V6HA 1JLFA 4HI1A 3EGNA 3S7RA 1D3WA 1UA1A 2KH9A 4V1Ak 2DXFA 4NPOA 3G4SS 1N4LA 4FF2A 4QIVA 4LQ9A 4QZVB 4PKDB 5MLCV 2HVDA 1S0VA 2Y1IA 3IAM9 4ZS6A 4DUTA 5HQMA 4FKXA 3TEHB 1X8DA 4NLXA 2UUTA 2VASA 4K7QA 2CQ0A 3QWPA 4ZK7M 2UVUA 2D3OR 1QUPA 3JYTB 2ALZA 3DM2B 3HZGA 4K50A 2XYPB 3K89A 4DR1J 1OSCA 3MEGB 4DU7A 3AXKA 1G2EA 1B3TA 1RWPB 4TXSA 4M95A 4DPXA 1DTQA 1G3OA 5KFAA 3HT3A 1VQMS 3FRYA 1SKRA 1N6QB 3QRQA 2DPJA 1TAQA 3RGIA 4DV6J 1DRZA 3LAMA 2VZ9A 1NHKL 3M2RA 4DPOA 2DNLA 2W9AA 3BBBA 2XG8A 5IQ6A 1S12A 4WFXA 1CSJA 2P9GA 4AD6A 4QIEA 2ZH7A 3G8SA 1TL3A 2D7SA 2PFFB 2IC3B 1RWWB 4F50A 1LFPA 3HX9A 3PJWA 1B99A 1Q7LB 2DGQA 2RNEA 2XWXA 5CH7B 5HN0A 3DRPA 4DV0J 3QFWA 2PMZD 2YKAA 4ED0A 3VAMA 5EUHA 2K1RA 3O3LA 1V5IB 3ZNUA 2ZH6A 3W5XA 2DO0A 2G0CA 4OI4A 3QGPA 1UAWA 1WOPA 1KONA 4C8KA 4QPXA 4KIAA 4OX9F 3T6BA 3HD2A 2OEKA 1RTIA 3KWMA 3MTKA 2OJ3A 4DSLA 2WB4A 5HMYA 3CDEA 1ZBTA 1Z1ZA 3J7AN 5F3TA 2A3JA 3OTOJ 2DH9A 2A10A 4MFBA 4ERDA 3CPWR 3QSIA 4CO1A 2OD4A 1FFSB 5DQIA 1LV5A 4CM0A 2K7KA 2MJUA 1FE4A 5AXLA 4B9MA 4QCLA 4C3KA 1REVA 2ZE2B 3BYRA 1CJTA 4PG8A 4KGMA 5CYJA 5F8JA 2MQ8A 1ZM4A 2VOPA 1O5JA 1T9VA 3MM6B 2HRUA 2ACMA 1JLQB 1HNXF 1FJ7A 5CABA 3LWMA 2ZZTA 4KV8A 3TANA 1PILA 2DVIA 4LF9J 3Q2SC 4ED5A 4ED4A 3D0IE 2F1FA 4M63A 4ZP6A 3R9LA 5I42A 2YNFB 3ET6B 2V8DA 1XMQJ 1K8AT 4YS2A 1FRLA 4OZLA 4ANCA 4OX7A 4HHJA 4DV0F 3TW0A 3MUVP 4OI6A 1RHMB 3OBIA 2IIHA 4A8SA 1QAIA 3N9UC 5IQQA 4QOTA 4YR2A 3LP2A 2XY7A 1FO1A 4M5DA 1IBKJ 2DNPA 2CQBA 3GFXA 2MQPA 2DGXA 3W8GA 2CQ4A 5I3QA 4DR6F 4ZKAA 3QJPA 2EK1A 4ES2A 1UW4A 3MPVA 2Y1LB 3PW5A 2GVDB 1WWHA 1LXJA 5AXMA 1LW0B 1RT6A 2R42A 1HPZA 2ZH8A 1HWUA 2HIYA 1UFLA 2WB1D 2W2QP 4PPZA 1FRHA 1M5HA 4PXDA 2F65A 4DZ6A 1WEZA 4RWWA 2MGZA 5BJRA 2HQCA 4PG6A 2C2RA 3OPKA 3MECB 5F8GA 2DHHA 1VIOA 1QVGR 2YTCA 1YBAA 4ZVQB 3HXMA 1PJ7A 1NJXA 4DQIA 1T3NA 2XS7A 4OYBA 1H2TZ 2WZ1A 3HK2A 1L3UA 5CYQA 3F44A 5K14B 1EQ0A 3GG0A 2BKOA 2CFXA 4KPCA 4YOEA 2GO8A 5DDOC 2FC9A 1O6XA 4F7VA 1RA7A 1HNZJ 4IRKA 4CIOA 2NXUA 3W2WA 3KG0A 3TZYA 2W4CA 3NWRA 3QFHA 3CNQP 2J8SA 3R27A 2B9WA 3SSQA 4ECYA 1YJNS 5DLGA 1IBKF 3LP0A 2JWNA 4NRUA 2KZMA 2VPXB 1JJHA 4Y2AA 1QJHA 1WJ9A 1APSA 2HRYA 3L7PA 3QJLA 1FVQA 3SCKE 2UUAJ 3K8WA 1N36F 2ZH2A 1DY3A 2B4VA 4Y0FA 4R0EA 2CUYA 2B6AB 4NCGB 2XO6A 1D1UA 1TL1A 1R0BG 3W1YC 2RMLA 3HPOA 3GV7B 4ZPVR 2IFXA 1U09A 3MPDA 3IR6B 4NA2A 4UT4A 2Y1JA 3H8YA 2VC0A 1NLKL 3K5LA 4CLLA 2BQ3A 5ITHA 2IYIA 1S6PB 1VDHA 3MPYA 3MMJA 4OX9J 1JNZB 4EZ6A 3D6HB 3Q2TC 1KLMA 2ASDA 4PUOA 3OVBA 2KG1A 3R5CA 1S97A 2NXJA 3DDIA 2DEIA 1XTZA 5LJ5Y 3MMCA 4NLQA 4BS2A 1VRUB 2J7UA 5BR8F 3HZEA 5K8NA 3KLGA 5IC6B 2UUBJ 2G2OA 3CJRA 3CVKA 2GS8A 2Z56B 3RAMA 5DM6Q 2XLKA 2R7XA 1VLYA 3DI6B 2X1GA 4RNFA 1TUGB 2MQMA 3Q86A 4CTAA 4UY8T 3A3PB 2IDEA 3QAUA 5KFRA 1QUVA 2MEWA 5D4NA 4GVLA 3BPDA 5CZVA 2HHUA 1RAGB 2XGQA 2I38A 3FSXA 2R2UA 4ZCKA 4DU8A 1GMWA 4YN3B 2ZJRQ 2YWEA 1X7VA 3FQKA 4L6V3 5A6PA 4WK1A 4B9UA 1CLFA 1KD1T 2YKMB 1K0VA 2CJQA 2FHOB 4KHPJ 3JS9A 1SUQA 1N56A 4MFBB 4MTPA 3IN5A 2OSRA 2QA4G 1UJ6A 1VQYA 4CNZA 4KYZA 1JXEA 1CJTB 4USTA 1WOOA 3NS6A 3KLEA 2VL1A 3LWLA 1CJUA 1Y7PA 4D3HA 1HFEL 2VG7B 3KUHA 2MKIA 2ROGA 3HP6A 2P2CB 2RUGA 3PW4A 1OYDA 2H5JB 4QYRA 3P6YC 1XC9A 2Y8WA 5FJ4A 1B0PA 3C15A 5HATA 5CXTA 2UUCJ 1RSCA 1T9YA 2ZWOA 4LVOP 5J2MB 4WFBQ 2WONA 4B3RJ 2ZOMA 3QT5A 2JEIA 2VONA 3PYGA 5KT4A 3V4MA 1PIEA 2FZKB 3UN2A 3QQCD 2KRRA 1D9DA 4DR3F 4M5DB 3QJJA 1HQEB 5E3QA 4ZVPB 2EFGA 2GZOA 3V81B 4PAAA 4AL5A 1LQ9A 3GPAA 4NLDA 4UOFA 4NLUA 3KLVA 2HHPA 2UUAF 4PXCA 3KMQA 5GADU 4QWAA 4OZ0A 1RAJA 3IRXA 1WKLA 4CO4A 5B0DA 1UL3A 5A2QU 5AJ3J 2A2CA 2VQEF 5JVGQ 1RTDA 3NP5A 4I6YA 3IBWA 3DLLQ 4CLTA 2QLBB 4X4QA 3OUYA 2AYBA 5KT2A 1CVJA 2E1PA 3I82A 1SV5B 3QAEA 1VI7A 1NSAA 3K5OA 2KHCA 4DHVA 4J9LA 4WKRA 3HHKA 3ONQA 4R25A 4NLGA 3NNAA 2FGOA 3M8PA 5HO4A 4CLWA 5DGBA 4L3NA 2XM3A 3N6MA 1RAEB 3B8HA 3CCTA 2PN6A 5ETQA 2M2BA 3T19A 3AD7C 1T05A 1T02A 4ECSA 4F2SA 2GHPA 4U6PA 2YWWA 2KN4A 1H7WA 3TARA 3UVJA 2EBEA 3HHLA 1P9QC 2BYCA 5HJXA 3HO1A 3LGHA 4WXWA 4X65F 1QAYA 3GJRB 1NB7A 5B0BA 3A3NB 4N7TA 4PPDA 4NASA 2XSFA 1ZZFA 1M5KC 2PMHA 1W25A 3ETMA 1XWLA 4DR2J 2OEJA 1OYEA 2QRRA 3V6DA 2EBGA 4USIA 1M5PC 2VH7A 4F3MA 3NNHA 1J2VA 3BGUA 2HK3A 4I2PA 1KS2A 1XR5A 3IC1A 2PO4A 2ILYA 2RQCA 3GZ7A 4WXOA 5C24A 3U1LA 2X1FA 1KHWA 3KUEA 3CC2S 3MXHP 1LK5A 4YFUA 1N52B 2WW8A 3CD5A 3SCJE 2QYCA 1RYRA 2DNZA 1CJVA 4HVZA 2GQCA 2V4JB 4X66J 2AZ1A 5A8WA 2HHWA 2ZBPA 3M6WA 1OS5A 4IG3B 2CVIA 4DR6J 4P71A 3DFEA 1RE1B 3AOBA 3ISND 4XO0A 4DDFA 4MK8A 3MM9B 3NGRA 2XB2D 1YVFA 3NWGA 1YJTA 3OVSA 4GKKF 3R7BB 2D1CA 2W9CA 2VOOA 5B0FA 5KFHA 3RJMB 4G65A 4EK2A 1FKOB 3FC9A 3OTCA 1E6VA 3IGNA 4DV2F 4ES1A 1ZS6A 2HAFA 3PW2A 3J81U 4IG0A 4ECZA 3ILIA 5J2PB 3NY0A 4F4YA 3CJTA 2G0IA 2GMHA 4RW4A 3U27A 3VGSA 1AA1B 3QRRA 1TVRB 3CTRA 2ACYA 1NJYA 1S9EA 1EZZB 2N4DA 2DGUA 1U0HA 2DNGA 2O67A 2QN6B 3O5TB 2DNOA 3ZNJ1 4ZCIA 4ZPDA 1IKVB 1NPRA 3TX0A 1WI6A 2YPZA 3F0NA 1SI9A 1Y3KA 2EC0A 4ECUA 2EW9A 3EYZA 5AJ3F 2EEYA 4LBPA 4Q45A 2R7WA 4R8UA 3UW1A 2IHR1 3VWSA 1JXLA 5C2CA 3NGDA 3FNNA 3ILOA 1ZOTA 4DLEA 2XSJA 2OPQB 1S0NA 4F3QA 1J5OA 3HVTA 4NYPA 2MHEA 1ZTTA 7FD1A 4QJVA 2GAHC 4DR5J 4ZPWR 4G3IA 3CJSA 1SH0A 4EBEA 2GMLA 2W9BB 3PKMA 3GR1A 2DK2A 4DS5A 2CYYA 1JLAB 4MKVA 5FDLB 1PAUB 3JTPA 3KDOA 2M88A 4C0HA 2XQCA 4DF4A 1UVIA 2G4BA 4QQBA 1S57A 1WKKA 3SBMA 3W7BA 5M2UA 2Z2YB 3J81Y 1EP4A 3PKYA 1NK5A 4BLGA 1RT6B 5CA5A 1R3NA 3QT7A 2DTJA 3FCHA 3M8QA 4LT6A 2AP6A 3CDBA 4C8NA 4TY8B 2NXNA 2UUBF 1CBKA 3ZZ0A 5KG4A 1WF0A 4XPEA 1LOUA 1WC6A 2CPYA 4CP5A 4EYIB 2C1EB 3OFGA 4OJ1A 5JJBA 1SL0A 1FDBA 4X4RA 2IRYA 1Q0NA 2BE7D 4WFYA 1RWOB 4TU8A 2XCPA 5IT0A 1NAQA 4DX7A 1NKBA 2MLZA 1TK5A 2KHDA 2CQHA 4RKUC 1VQNS 5ETKA 5EGYA 2IBKA 3SSSA 2D3UA 3DLEA 2R2TA 3RB3A 4RZRA 1D9FA 3FFIB 1RKJA 2JX2A 3L3CA 4NZ7A 1QSSA 1HQUB 2QSWA 3FZBA 3MM5A 4RW8B 4O0IA 1DAXA 3L09A 4NA3A 4DX6A 2I0XA 1S9GB 3HVAA 1HNWF 1RAIB 1VQSA 3PHTA 4RX6A 1S48A 3DC2A 4HHUA 1Q81T 1RTIB 1SJ1A 1IWAA 4LR7A 2MZSA 3THTA 1PYOB 2WBMA 3I87A 4RNMA 4ED7A 1N32F 1FDAA 2V68A 1V5VA 5CQGA 4ED8A 2V6AA 3OXLA 4ECRA 2YXLA 2LA4A 3DOMA 2GFFA 3MEEB 4P10A 4ZPBA 3MM7A 5KTQA 3CMAS 6FDRA 1BWEA 2BM1A 2HNZB 4C11B 4U7CA 1JB0C 2KJVA 1HWLA 3MM6A 1NSQA 2OFHX 3ENQA 2FHJD 3FEYB 3L7UA 3MMAB 3ZZYA 5CAAA 4I56A 3BKTA 1Q79A 4Y34A 3UCUP 3HSDA 3F56A 3G8TA 1FA0A 1HLWA 2PA3A 3OSNA 3E01A 4IH6A 3K5PA 2BJ8A 3BQ1A 1F5CA 1VQ8S 1U7LA 4X4PA 3M2VA 5D78A 2X1AA 3QGIA 1RWXB 2W25A 4M5MA 4RNOA 2JC0A 2XZTB 1S59A 2VQEJ 4X2BA 2CQ2A 1PBUA 2VFRA 1M0SA 3I96A 5F0WA 2DNNA 3C16A 3DRSB 1XK8A 4BHQA 3TWZA 2FUG9 2A18A 3JSYA 4X62F 2W7PA 3GIRA 3T9ZA 1TUWA 2XMMA 2U1AA 4NYOA 4FS2A 2XNQA 1UJ5A 3K17A 1YZ6A 1J27A 4MIAA 2HBQB 2AHOB 3NGSA 1O51A 1FEEA 2Z2LA 3BKFA 3H40A 1NHVA 3UWTA 1ZYQA 1YITS 4YEAA 3PNIA 4L74A 5KFUA 2E1CA 4B3OB 3TUZC 2RAQA 2VG5B 4XIUA 2HGNA 2XMWA 3PX4A 3K7RA 3UN5A 1HBNA 4NWBA 4ETZA 3SV4A 4IFYB 4OHXA 4B3SJ 2JOQA 3S1TA 2CKWA 2M8HA 2X51A 4IR1A 4OZJA 1HNIB 1HBUB 3KJNB 2YWHA 3ZZZA 2E5HA 3PR4A 1KNZA 1N54B 5L8RC 4C98A 3W2WB 2G13A 1K47A 4E98A 2WVBA 3AD8C 3D6FB 4DR5F 1ZZNA 3CJKB 2IA6A 2PGCA 4YB7A 1V3SA 3D67A 4JI2J 3J7ZT 4OI3A 5D0HA 4IOBA 2CDQA 3HVTB 4ZVFA 2C2EA 2IM1A 4WU3A 3R97A 3D3BJ 4K4UA 2KU7A 3H2LA 2WONB 4I7FA 1GTEA 2CQ3A 5HAOA 3BGOP 2VV5A 4HACB 4B9SA 2OI2A 3LGMA 1C0TA 1F9FA 3G86A 4MH8A 4A8WA 4EBDA 1BUXA 1L3VA 3VAHA 4LSLA 1W7WA 1RT7B 3CCUS 1R27B 1YZ7A 4N41A 4LRCA 4DL5A 4B02A 1H38A 3VCDA 4PG5A 1NPKA 1MLAA 5E0OA 1M90T 1VQLS 1HI8A 2FJBB 2GVZA 2Y1RI 5ETPA 3W63A 2C2NA 1DQ9A 1NJIT 3P5TL 5CYMB 1DLOA 5HMWA 3R6GB 2HFZA 4PUOB 1UVKA 4HT7A 3KLHB 3CT9A 4PQAA 4B3TJ 4KJIA 2ZITA 2HGMA 5KFZA 3IM9A 3CO0P 2V8HA 4ZP7A 4R5PA 4LF4J 3HHLC 1TZ0A 1NMEB 3W66A 3DMJA 3CCSS 2QA2A 3VQTA 2IC3A 2EK6A 3VALA 5JUMA 3T1HF 2CZ9A 3EE3A 2UXCJ 3OTDA 5D0RA 5HSPA 1C4CA 4DF8A 4CTAB 1S1UB 3U1NA 1N88A 2K06A 1KFSA 4DR7F 1YK9A 4LFAF 4BWMA 2JZ5A 3H20A 1UEVA 1G7CB 1GNKA 2D9PA 3BREA 1RWVB 3I5CA 4O23A 4URSA 5A0YA 5BR8J 4F4ZA 1SJFA 4GRSA 3V6DB 2AYMA 3R5BA 1U8SA 4URQU 2KDOA 3ZZRA 1S6QB 3ZZTA 4F0MA 5KG5A 5EWGA 1NKCA 5EHHA 1NJWA 1SL1A 1QSLA 3D68A 4DSJA 1VK3A 1T0TV 1RQ0A 2CPJA 4IKAA 3I32A 3RZAA 3MFIA 3L9ZA 1Q1KA 4DFPA 1X9SA 5DDRC 4O3NA 4F0KA 1JNRB 1I94F 2RU9A 2HNZA 4QIWD 1N33J 3PRBA 2C3PA 2YNIA 1CJVB 3OR1A 2DJWA 4L73A 4O3OA 4W4MA 2EFPA 2F7VA 2XMUA 5I42B 2Q66A 2DNHA 2QLWA 2YH1A 3MM9A 2KM8B 3CCZA 4MT1A 4C0BA 2HLUA 3WDOA 1RHRB 5HMZA 1P8GA 3G2XA 1IVZA 2OD6A 3MR3A 1WOSA 3UD5A 4QR0A 1PJ5A 5B09A 1S7HA 3M9NB 1FKOA 2JC1A 3QMQA 2FVSA 5EN1A 1H7XA 1SC6A 4WYWA 2HVIA 1LWCA 1VBKA 1EJ7L 4EI2A 2HZCA 1LFWA 3HFZB 3SSRA 3JQJA 5KFDA 5H9EK 4UQGA 1VBXA 1C0UA 1LXNA 2E44A 3FSYA 3O6QA 1TELA 2VB6A 4AXIA 3BYPA 3Q8PB 2BE9B 1VC6A 1UP1A 4NLRA 1IQZA 5J2NB 5KFIA 3S6EA 4CQ1A 3TI0A 4C8YA 2VC1A 4K8RA 4K2JA 3QT8A 1IKVA 1VGYA 1XERA 4DPUA 4J91A 5MAOA 2X3DA 5KFXA 1QD1A 2QLXA 4CO0A 4RBVA 5C5JA 5GAGU 1UWAA 3MPWA 4ID5A 3A8EA 3MAHA 3H4BA 3K57A 3VAGA 2CJYB 1UPPA 1KTQA 4K4VA 1NO8A 2W2MP 2LDYA 1WF1A 2BKNA 2W4PA 1FX2A 2BX6A 1Z2LA 5A76A 5IM0B 2WSFC 2ZC4A 1OY8A 1REGX 5KFBA 2V2QA 2JL9A 2H5EA 5GMDA 1AT1B 4NLYA 4ZOSA 3G6YA 4Y2IA 2N7YA 3GIJA 1S1VA 1RT3B 2NXCA 2G1DA 4P2SA 3PIPQ 3D0HE 4ZN1A 1YTYA 2A2DA 2FD2A 3CUNA 4ALZA 2DR7A 1LW2A 3O8WA 4ED3A 1N34J 2MMYA 1MN7A 1FXRA 3CEDA 2GNKA 2QMWA 5KFSA 5B08A 4RW7B 5C24B 1SC3B 4IFVB 1RB0A 3PFEA 1WD6A 3GYXB 2ZM6F 3OR2B 1P1LA 2ZVIA 2GCFA 2HFUA 3H98A 2JLFA 4CM2A 8RUCA 1CC8A 2KYZA 2AMCB 4ZLLA 4JI0J 5DS7A 4IG3A 1TL7A 1E6YA 2B5JA 3SMZA 1Q78A 1X9MA 4DQRA 4NMXA 3BR9A 4A48A 2UXDF 4O4GB 1X4DA 1KSPA 1R0AA 4JYAF 3MZIA 1GAOA 4ITSA 2AEFA 1C1BA 1XEZA 2LDIA 3N5FA 2DNQA 2HHSA 3DOKA 2RH3A 1JKHB 2E29A 1BE4A 2R9LA 4LF1A 4IOCQ 3B4MA 4PWWA 5HP1B 1LKZA 5T7LA 3OTBA 3I4HX 2UXCF 3AODA 3H5XA 4FKYA 1IBLJ 1VHFA 2J6TA 3W62A 2I5JB 3TX8A 2VBYA 4NA1A 3N0VA 2YKMA 2I9SA 2ZM6J 3THVA 1UTAA 1NK4A 1SUQB 1S6QA 2Y8YA 1G6BA 2VBZA 2DIVA 4JI2F 3CCWA 3T5JA 1TKTA 1AXQA 2EG1A 2HFSA 2V50A 3TJ8A 2MQQA 1L5UA 2UZAA 4DX5A 2V5HG 4JI6F 3Q89A 9ATCB 3CD0A 3LPYA 1XMBA 4X84A 3KLEB 2J0WA 3MAAB 1NB2A 4A4JA 5A8RA 2RU3A 1TU0B 2HQDA 3S8SA 2XI2A 3M2UB 4X64F 4WTYA 1MN9A 2H1YA 3I0SB 1F0XA 1RCOB 3KDNA 4Y6IA 2JNJA 2G1HA 2FQQB 5KT5A 3C15B 4RU9A 4J9PA 1WTBA 3IMQJ 2IM2A 3C19A 2HRTA 4GMKA 3JSBA 2POKA 3ZXWA 5K8OA 2NS1B 3M30B 2MSTA 1NZAA 3BM7A 3JAMY 2YWGA 4LJMA 3MCSA 3RB0A 2VFUA 1F2HA 2FZCB 1TMJA 3CCES 1RAFB 1NK7A 3H5UA 4C8ZA 4OZ3A 1RTJB 3IRXB 3KLIA 1D09B 1DHMA 3D66A 3BGLA 2BEFA 5A8KB 5K8PA 1EHWA 2X1BA 2CAJA 3IP0A 1FRKA 2AKWB 4BWJA 3SQOP 3W2VA 1Q5YA 2HNYB 1F5AA 4ENOA 2KZZA 2IM0A 1TTHB 2E1MC 3CSKA 2RIJA 3M8YA 3OTEA 1FXLA 3KHHA 3UFCX 2DR8A 1NK9A 2ABYA 3UPFA 4W92B 1CC7A 2LLZA 4DJBA 1T11A 4IFYA 4MYUA 3UNGC 3VGUA 5GAHI 4DV4J 2ZFHA 2GJIA 1VQOS 2KJWA 4HKQA 5IT9Y 4ECQA 2B56A 2BW2A 3LP1B 1FKPB 3J80Y 4DFKA 3IA0A 3PTWA 2C3UA 5H9EJ 3H2UB 4PEOA 1EQMA 5DZ7A 3IXQA 4DCOB 4ZVUB 2B4UA 5LSOA 2FDNA 3KK2A 3D6MB 1WC0A 1MMNA 3BDEA 1NK0A 4X4NA 1VLOA 1RYSA 3KTQA 1FD2A 4HR2A 2ZHBA 5DG7A 3GSIA 2ADCA 3VZHA 4W98A 1BQNB 2OPPA 1AB8A 4NLTA 4Y28C 3UO0A 4UOGA 2DR5A 4F02A 4CRJA 2H5IB 3M1VA 2OGUA 1N33F 2VDHA 4WIQA 2GV1A 3GONA 2D69A 2HBRB 4YY3F 4KE5A 3LANA 3H42A 1B7YB 3SI8A 3DOMB 1JLFB 2XEXA 2MZTA 4WP9A 3ILLA 4Q8EA 4LF7F 3OR2A 2UVWA 2ZOFA 1DTQB 1M5SA 1RAHB 3P45B 1R89A 2NPIA 4NEZA 4OYAA 4CLKA 1N8RT 2WVEA 1HIYA 1I1GA 3NOCA 2XC9A 2XO7A 1S0MA 2RS8A 4GO7X 1N32J 3E3XA 3KJVB 2AGOA 1ZM3A 4XK8C 4K4SA 2XMJA 3F41A 4ZVOB 4ATNA 1XQIA 3Q8QB 2LFVA 5G0RB 1F3VA 2VBWA 2CPHA 1JLEA 4ID8A 4OLPA 4EGLA 5C7PA 5GAHU 3MD1A 1NM2A 3MEGA 4Q8FA 3IWLA 1Q8KA 3EDQB 4Y65A 1GFWB 1GXLA 1S4FA 3KJQB 4UF4A 4OI1A 1NSKL 4JOUA 1FTRA 2KG0A 3KK3A 2HFNA 4C8LA 1Y9OA 1ZAWA 2XYGB 4O44A 5RUBA 4JI7J 2MPUA 5T7LB 3AHPA 1W2IA 2LVWA 3LOUA 4IG0B 1TUVA 5F8IA 4LQ3A 2JFKA 4ELUA 4I67A 2HAIA 2YKNA 3D28A 4B9TA 1D9AA 3AOAA 1TVRA 2J6SA 4NL5A 5U47A 3W5YA 2W1BA 2M8DB 1U0HB 1U2RA 1IJFB 2E5IA 4C8MA 4RPFA 5KAKA 5GAGI 1VBZA 3C14B 3PXGa 4QWEA 3D7SB 1QE1A 3VAFA 1HBNB 2ZH5A 1SQFA 1YJ9S 4PWDB 1NZ8A 1YJUA 1WDTA 4DCJB 2MB0B 3AA8A 4EYHB 4A8QA 3CJ5A 4B3RF 2ZH9A 1X0FA 2DNMA 1YSJA 1SJQA 2O3DA 2RHQB 3D6TB 3MHYA 3OFHA 4I6WA 1JLQA 2GW8A 2CG8A 1UWBB 2O5DA 1S1XA 2OPQA 5E3PA 5GAEI 2PT0A 4JUZA 3HD1A 2IJFA 4WJBA 3DXBA 4LSNB 4CLPA 1HA1A 2IA0A 2BJEA 4TN2A 4UW2A 1WG4A 2HBZB 4LBHA 1RBOB 2R8HA 3GU0A 5FDLA 5J1EB 3M30A 2CQIA 4F4XA 4ECXA 1IKXA 1CG2A 3U1MA 4J9OA 1KOOA 1N5QA 2VDIA 3LUYA 3GLJA 4OYWA 5ETLA 5LSLA 3JSMB 2NSCA 5KT6A 3DLKB 2F63A 3ILJA 3MR7A 3MR5A 3A8KA 4M1KA 3GJTB 2ZNYA 3IAS9 3NBPB 4WYLA 1RTJA 2DY1A 3GYGA 3KLIB 1R6YA 4P6QA 3VVUA 1HHSA 5A8KA 5IXUA 2VQFF 1IBMJ 2DPIA 1RI7A 4ZVRB 4A8FA 3X1LB 4K5SA 1X60A 5HROB 2QEXS 4MAKA 2E7VA 4OV6A 2RILA 3DRRB 1R8HA 1SIWB 1HQ2A 3KLHA 4QYZK 3DN9A 1R8PA 2HLTA 2OTLS 1PBAA 2PMWA 1H73A 2JSXA 3MM8A 2UVVA 1QAXA 2P8IA 2VPWB 7FDRA 3DRYA 3OHBA 2MKHA 4F26A 1U1MA 1HNWJ 1V3ZA 3MD3A 1IQTA 4DR4J 3FFIA 4PXEA 2XHWA 1AZSB 4Q2LA 4XAKA 2BKPA 1FRJA 4FF4A 2E9ZA 3CD6S 3OVAA 1IXKA 2G2YA 4FNIA 1PJ6A 5CZXA 2PIIA 2HZVA 1S9GA 2UV8A 1WSVA 3AJDA 1FRXA 3GFHA 3AXMA 4LRAA 4RWXA 1KQKA 3UE2A 4RNNA 2R2RA 1YJVA 3FCWA 4OIXA 3CMQA 1F9EB 1BQNA 1F60B 2H54B 2MYFA 1NCLA 1N0UA 2PEHA 4I1TA 3BH6B 4OHVA 2V2KA 4KKOA 3Q23A 3VAKA 3O2IA 3UNYA 3R5DA 4KT0C 1KLNA 4QIGA 3PRVA 1J5EF 4XDCA 3AT1B 4J5OA 4HI2A 1Q8IA 3RU0A 4JI7F 3ISZA 1JX4A 4PXBA 5D4PA 2JVOA 2R8JA 2HWHA 2G9OA 2V8PA 5JVHQ 3BDPA 4JV5J 2LQ8A 4LR8A 2DB1A 4RR5A 2E1RA 2W9CB 1RZMA 4P52A 2YNIB 3OR1B 4RLEA 5JXSA 1MSWD 2AZ3A 1SH3A 3G9CA 3RRHA 1Z2ZA 5B0CA 2MXYA 4Q43A 1U48A 2I1RA 1NDKA 4KGKA 5K20B 3WBZA 2M70A 1OQ3A 1TL1B 2ZOGA 1NSPA 1KVIA 1LWXA 3I0RA 2XYHB 3POTB 4I2QA 3FUYA 2GAGC 4YP3A 3BQ0A 4X64J 1C1BB 2F8HA 4NRTA 3HF5A 4ED1A 1IWGA 3HM9A 3QZ7A 5E3CA 3CC7S 2CJXB 5ETNA 1U4BA 3BBCA 2DD8S 1ITPA 2JRSA 1VRQC 1YKWA 2OMOA 4ZLJA 4JI8F 4N76A 3TQEA 3E2EA 2G2ZA 4PYDA 3QYYA 3UDEA 5KG6A 3QWUA 5I3PA 3VGTA 3M8RA 3SCLE 3A1YG 1KQGB 1VRUA 2D74B 1T9XA 2DO4A 2BRLA 1FRMA 1DQ8A 2LKZA 2Z2MA 1VRTA 3E51A 3QIPA 5LL6d 2CADA 4CLZA 1IN0A 2IMWP 3CE8A 3IGVA 4JV5F 2DKOB 3WIVA 1RUSA 3EVOA 3MTJA 4OI0A 1TFYA 1X4BA 1F2GA 4M5GA 1ZETA 2IBOA 4LMZA 1Q53A 4G1QB 3GILA 2CQCA 2BJ3A 2ZE2A 3JAMU 3H4DA 4FP9A 4OZNA 4LSZB 3FVYA 4NLOA 1ZTWA 4LFCJ 4G1IA 2E7XA 3Q8VA 4KBIA 3M2UA 1KR4A 2OLWA 3JQKA 3OFFA 5EX0A 3T5HA 3O44A 3EGWB 5KG3A 3J81j 4HT5A 4USMA 2RVJA 3M7VA 3TA0A 4RUCA 3SFGA 2B9EA 2EFOA 5IC4B 2H48B 2MKJA 4DQPA 2Y0BB 4USHA 3QATA 4M94A 1UVJA 4LSNA 4ZP8A 1RLDA 4N5SA 1BY9A 4OV1A 4F3OA 4O3RA 1WI8A 4DUYF 3BR8A 4RL1A 1K0TA 4DR2F 2P5VA 4ILRA 2Y9HA 4AL7A 1S6UA 3KJFB 4JV0A 5H9FJ 4LSLB 2C22A 3V81A 1S72S 3R8YA 4EWTA 5IT9U 4B3TF 2DBBA 2RQKA 1LWFA 2LQJA 3DM2A 1LW0A 3M8ZA 4CLFA 3CC4S 1Y11A 1T94A 2AT1B 2GIRA 1GT8A 2FTRA 2OFGX 2OPSA 4M5HA 3ZFVA 4ZCMA 1X4AA 2EXUA 4QWDA 4DI6A 2CWKA 3BB5A 3ELHA 4O3QA 4K4YA 1Q7YT 1VQ9S 1QSYA 1BXNA 4F2RA 1LNQA 3HSZA 1GXTA 2N82B 2QMUB 4KRWA 1G4CA 2H3EB 4ZIWA 1WC1A 2F9JA 3NCRA 4CI0B 3OHAA 1RT2A 4OHYA 3EWGA 1J5EJ 3W3SA 5EDWA 3V5RA 4DR7J 2YQ3A 4MKBA 3CMES 1RWMB 2GGPB 1NNDA 1XJWB 2F9DA 2Z2ZA 3MUMP 3RYLA 5C25A 4QW9A 1X4HA 2VJVA 2NZ4A 2E5LJ 1U6ZA 1V9OA 2XTJP 1T05B 5C2GA 1AZSA 1IR0A 2FIUA 1OQ6A 1JKHA 1SQGA 2YQ1A 4E8UA 5D3GB 3KOAA 3WHIA 3WZ0A 4RUHA 3HVRA 2IM3A 4ZN3A 2VFTA 2GQ2A 3O1LA 3SFUA 1SCJB 1PC4A 2ZJPQ 1FF2A 3CJ3A 2IY5B 4H4OA 5LSRA 2HPUA 2R7SA 1KOHA 2J5AA 2KVIA 4ZHRA 3MDFA 3PACA 5D0GA 4Q44A 3G6ES 2LYVA 2QL5B 4FS1A 3PX6A 5ETRA 2J8AA 2MQLA 3C3LA 2MQOA 3HKWA 3IS9A 1EIYB 2FJVA 1UFKA 4RNHA 4A8YA 4P74A 1L3KA 1WACA 3PX0A 1T95A 3HHLB 4ZVGA 1CQNA 4DUZF 5L38A 3QZ8A 3PG9A 4O3SA 2HVEA 2RJZA 4G6VB 4KO0A 5F8HA 2DGTA 2YX4A 5HJYA 2F5GA 4LFBJ 4O3PA 2FJDB 3GWCA 4RO0A 2QG9B 1DARA 2XMAA 2V0NA 1HR0J 4PQUB 1RT4A 5KFNA 1Q8BA 2KXFA 1OO0B 3MF5A 4L72B 4OYPA 3A3OB 3D2WA 1SXLA 3I0RB 2LP4A 2R7RA 1ZH5A 3UR0A 1SC1B 1EETA 1RA6A 2MDAA 1TAUA 3HHNB 1Q4RA 2RT3A 2DRDA 3A12A 2KFZA 2E66A 3DI6A 1VJQA 2HHQA 2DNKA 2ZH1A 1KN6A 4IDKA 2XNRA 1ACMB 4YUDA 2VJUA 1UVMA 1Y5IB 1FJGJ 2HQGA 4JB8B 2OH2A 2BJ9A 3C66A 1IM6A 3PDNA 1YDLA 4H4MB 8AT1B 4C8OA 3N01A 2FVPA 2YKNB 4DS4A 3PYEA 5HQLA 4YDXA 2XS5A 2H4WB 1U47A 4B17A 1S7IA 3D1QA 4DUZJ 4DV5F 4L76A 3AFGA 4Y2CA 3SDEA 4OYMA 3V4IB 3FGVA 3GCXP 1U45A 5E41A 3NGKA 3V2UC 1OY6A 5K14A 1AUSL 3EM1A 3QLHB 2JEFA 1GQEA 2J7KA 2CJAA 2EFQA 2P6SA 4KFBA 4IQMA 2QLFB 1Y3JA 2R7OA 2CJKA 2NCKL 4OYOA 3FBCA 2MY8A 2ZEJA 5KG7A 3BSOA 3ULHA 3TQ1A 2ZNZA 1NEEA 4P75A 1I3OB 5J2QA 4DSIA 1FNXH 2JVRA 2CQPA 8ATCB 3SZ2A 1RU1A 1NK6A 5C42A 1A7GE 2L41A 3K59A 4NX9A 1B0VA 2AGPA 1YJWS 2ILZA 4QR1A 5HANA 5GAEU 3OFEA 3BSNA 4R0JA 4PCQA 4DMZA 1XMQF 5L1IA 2CRLA 1RBLA 3W65A 1IUJA 1HMVB 5DRKA 1R43A 3MMBB 4C0OC 4WBFA 2KXHA 1N5TA 1C2PA 3BSAA 3TNVA 2FJEB 1WG1A 4CYUB 3GTYX 2XSJB 4XPCA 3SQGB 4CO2A 1J5OB 2MZQA 3M8QB 3P5BP 3JQMA 4LIWA 4TNOA 2ASLA 4LF5J 1WHWA 1JIHA 1KDNA 1SV5A 1S1WA 3QT6A 2V34A 4WFNQ 3IFEA 1T7PA 3A13A 1VQ7S 4J9UE 3HHEA 3UDLA 3D5MA 2WAQD 2L9DA 4KHPF 2BR0A 1KEKA 4LF7J 2RD5C 4C9DA 1FD8A 2DEJA 1AUDA 4USJC 2DISA 5LMUF 3MAQA 2C28A 1RLCL 1HL6A 3TZXA 3UVJB 3RR7A 2KT5A 3M8WA 4JI4J 1B64A 1HR0F 4USWA 1RISA 3H2VE 4WKYA 3AQOA 3CJ8A 1GX5A 4HLBA 1FFGB 1I51B 4HTIA 3KHGA 4CH7A 3QRPA 1WUUA 1I94J 1RABB 1HYSB 1GH8A 1S5ZA 2WVFA 4AYBD 2CA9A 3EVWA 3GB0A 3LH2S 3RBZA 4YDDB 3KLFA 4B9NA 1WTFA 3DLEB 1I5OB 3L95X 5FD1A 5I3UB 3IS9B 5GMKa 4PZVA 1NH8A 2RB7A 2C3YA 1ELOA 1OY9A 3HFVA 3Q8YA 3HJFA 3M6XA 1MMLA 3OL6A 1HHTP 1L3TA 1IKYB 2RHSB 4KO0B 3KFWX 1Q5VA 3NKYA 1UWBA 2H51B 3AB2B 4ZA1A 1S1XB 3WC0A 4CLSA 5HQ8A 1KVJA 4DN0A 1F3FA 4U9RA 3SCIE 3W9HA 1RHUB 3LPEA 4LF8F 1S99A 2RKIB 2GIQA 4DR4F 4BC9A 3HHDA 3J80U 3HT0A 3WQPA 3TOQA 1U1PA 3ZTQA 3ITHA 2DNYA 2GQQA 3VTIA 4NLPA 5HBMA 4DG1A 2ERRA 1KWMA 2BQUA 1U2FA 2ZD1B 1IBLF 5ETTA 5CD4H 3LA0A 5GADI 3RB4A 3LO3A 1TK8A 1R8AA 1UETA 2VU5A 3P4UB 1Z4UA 2K8GA 2WW4A 3HSJA 4Q2MA 3DGPA 2RF2B 3ZTPA 4DV3F 3PO5A 4W90B 1HD0A 5IFMA 4UQTA 1RTDB 5J1PA 3J7YI 4OYIA 2RQ4A 2A0FB 2M0GB 2V4QA 2HMIA 1GTHA 2HNDA 1XNQJ 4B3OA 5ETMA 4OJGA 2VG5A 4FXWA 2V4RA 1LWEB 2IMOA 1H0HB 2KRBA 3IO1A 4DL4A 4I4BA 2ZWPA 3M8PB 2MZJA 3TUPA 4G1QA 3ENVA 1M5VC 4C4WA 1BC6A 2XWYA 2FHKA 2ZBRA 4H4KA 5EWEA 2HHHJ 3TUIC 4OZ2A 3PJXA 3BJYA 3C8YA 4QU6A 2VFSA 4N47A 3TO8A 5L1JA 1EKSA 4F4WA 3W60A 4LF2A 4NYZA 1PSDA 1RP5A 1H2UX 2KXNB 3CO9A 5B0EA 3PW7A 1S1TB 3M9MB 2L3MA 3EXYA 2BM0A 1MG7A 1UPMB 1HWIA 3KKFA 3K5NA 5C42B 1DTTB 3HI9A 5KFGA 3DRXA 2HKEA 3VVTA 1WHXA 2XLIA 3P49B 4OJ3A 3CD7A 4RW9B 4HACA 5IZHA 1U8WA 4DV3J 3MOZA 3MURP 2PFDA 4NI2A 1YIJS 4P7TA 1UVLA 3IBCB 3B82A 2NLWA 5K9FA 2BRKA 1CULA 1FTCA 1T9UA 1XR6A 4YR3A 4EFAC 1PYSB 4IO9Q 4CYUA 2B7CB 2IVMA 2VICA 4OYZA 1YHQS 1GMUA 5KFPA 4CO3A 4DL6A 3TRGA 2CQDA 4WWSA 1N5VA 4ETXA 3G8QA 3GMGA 1DZ5A 3LALA 4IRDA 2VKZG 2V4JA 5A8WB 2ATCB 4WZQA 2FVQA 1R8CA 4DV2J 5CYMA 2XY6A 2WTFA 3C2PA 1S6OA 2YX1A 3R1LA 1YWXA 4Y00A 5IS2A 1HNVA 2Z4PA 5KFQA 3OD2A 4OLOA 2RE1A 5KFTA 3MEDA 2GGPA 1ZA1B 1U02A 2ROPA 4P2XA 1HBOB 1RK8A 3RG6A 2RSQA 3OTOF 1QTMA 2XS2A 2CPFA 3IR7B 1WHYA 2N4CA 3CIMA 4B9VA 3NL0A 2WSEC 2BQRA 2N3OA 3MM5B 4RW8A 2JHEA 2W2OP 4UZCA 2KFYA 3KNAA 2W7AA 3KUGA 2HGLA 4HYKA 4QPTA 4DXLA 3R1HA 2J6UA 3NMAA 2W2PP 4J90A 4P2FA 2NPFA 2J9DA 1FX4A 1TKZA 1U6FA 2QLJB 1RBAA 1NH7A 2HS4A 4H4OB 3ENAA 3EXCX 4YB6A 3FBFA 3KMSA 3KHLA 4JI4F 5KOWA 2V9WA 3T6JA 2FB0A 3NAHA 2BZ2A 1IM4A 5KT7A 2A1BA 4CO5A 3C14A 3DCAA 4I64A 1DJ0A 3ZZOA 2HVZA 4ZIVA 3MEEA 4JI8J 3M6UA 2ZDOA 4ZPTR 2K1RB 1F1BB 4PG7A 2R8KA 4ELVA 5FLXU 2V67A 1YQHA 5DLFA 1RHKB 1T9TA 1IKYA 2K2PA 2Q6CA 3SEOA 2B51A 5LXRA 5HVHA 4FXDA 3GV8B 4WPAA 1JLCB 4KQZA 1YX2A 1A9NB 3ETOA 1PYTA 3BZQA 4ZJLA 4CNYA 1C1CA 3DKDA 1YRUA 1JLGA 4NZ6A 4X4TA 3NLCA 1FI4A 5LM7E 4IR9A 3RR8A 2P9EA 4J37A 1U1QA 1HNZF 4Z37A 1GMVA 1M1HA 1NUEA 2LU1A 4J9VA 4C3MA 1NK8A 5HBMB 2XBPA 1Q95G 5J1EA 3UD4P 1IBMF 2IJRA 2HYIB 2XULA 2VA2A 2VPYB 4A47A 1H2VZ 4EUVA 1X5PA 3DRSA 1EP4B 1Y00A 3MEKA 3NBPA 1VOMA 5ADZA 2UU9J 2MZ1A 1P27B 3H25A 2ZHAA 3DGPB 5KFLA 4UOHA 3TZZA 4RW6A 4TY8A 2BANA 3CCVS 4RU2A 1XNQF 2L9NA 2MKKA 3UCGA 3K2YA 4UZBA 1I6JA 1ZPWX 4LRBA 5K5MA 1BGXT 5T41A 3DRRA 1R8BA 2V9KA 4DPYA 5J2NA 2BJ7A 4KR0B 2PE8A 4NE9C 4EU0A 1EX8A 2UXBJ 2H4YB 2K7JA 2YNHA 3QO9B 3M05A 1QTNB 3SIPB 5B0AA 5FLXY 2BJDA 2KM8C 2MSSA 5F9LA 1NDPA 1N36J 4KTQA 2LU2A 1SH2A 2LEAA 2LEBA 2QJ3A 2C2ZB 3AH6A 1LWCB 1M5OC 1M1KT 1VQKS 2CWXA 2GMJA 2PSZA 4ZVSB 1N5SA 3N6NA 4J9SA 3DU5A 3W9IA 5J2QB 4X4UA 2EI5A 2MQNA 3N28A 5GMEA 1LK7A 2H9ZA 2V2ZA 1CJKA 2JJ4D 1WELA 3HHLD 4FBTA 1WHVA 2DHSA 3ZTSA 1X9WA 3TR5A 3G6VA 4ED2A 3N5BA 4DL2A 1FNMA 1HNXJ 5CYQB 4F4AA 2HS3A 2QSFA 3RW6A 4ID5B 4Y2KA 4URGA 5LT5A 1EB0A 3CF5Q 1CS4A 1DURA 4DZDA 5AE2A 3IWXA 2HWIA 1LEOA 2AWZA 5KT3A 4M5KA 4UUXA 1TKDA 2X3GA 1VQ5S 4JV2A 4V19J 2MJNA 3MM7B 1AW0A 3CXCR 2EFNA 4I69A 1Q82T 5F8NA 2ATLA 1RT3A 2Y0SD 2YNGA 3DNCA 4LREA 2RRNA 5KFWA 3B78A 4RUAA 4TQRA 5J2MA 4HTJA 4AQYJ 1UFWA 2AV5A 4KY3A 1UMJA 1P9YA 1F6TA 1U25A 3D0GE 1K44A 2GA7A 3V6KA 2NQPA 3MOJB 4WP3A 3Q8SB 1VBYA 4KPYA 2YBVA 4X66F 1O8BA 2IPOB 3EGVA 4K4XA 2CNLB 3AQPA 2HW3A 1ICEB 4C6AA 4HDHA 3RBXA 4DL3A 3RB6A 2HHXA 1DFDA 1S6PA 4NXNJ 2C3MA 4TU9A 2WSCC 3TJAA 4CT8A 3T5LA 3PEJA 1FJGF 3OXFA 1FJEB 4JI0F 2QTWA 2VD3A 3M2RB 2VIHA 4Z2XA 4FPRA 4MK7A 4X62J 2DYAA 5L1KA 3PV8A 2HQ3A 4NLWA 4KAIA 4O4GA 3K5MA 2W2NP 1MROB 4DSFA 2Q1LA 2OELA 1XR7A 4QR2A 1EARA 2HHHF 2AYGA 1MMDA 3EDRB 1YRXA 3CIZA 3EZOA 5DDQC 2DCUB 4WF9Q 4A46A 2QL9B 2BUNA 3M6VA 1S9FA 2UUCF 1VC5A 2P9CA 3V4IA 3DLHA 3BQ2A 3NMRA 3IM8A 1KQSR 3A8IA 5HP1A 4LR9A 1WORA 2YX7A 5DG9A 4P7VA 1L3SA 4MKAA 1NBEB 4WU2A 1JXVA 1U1NA 2U2FA 2AX1A 5D6GA 4J9RA 2QMXA 2LXFA 3TP2A 2AW0A 3LQVA 2UXBF 2YNFA 3HVWA 4XTTA 1RT1B 2AEMA 2LQ9A 1NDLA 4FVMA 4GO5X 4BCAA 1XNRF 3R2DJ 3M8SA 3T1HJ 3ITHB 4DOZA 1TP7A 4DEZA 3Q24A 3N79A 4I7FB 4DG1B 1T8EA 2F8EX 2BOAA 3FDSA 3QBCA 5J1NA 3P96A 3TEGA 5HL7Q 1FE0A 3LP2B 1YG0A 3SYZA 2NXEA 5A8RB 2VUGA 1HMVA 3VQSA 4JI3J 4DLGA 4LF4F 1H72C 2CNOB 1PKUA 1FDNA 2M9KA 2Q6BA 3BGRA 1N34F 1SKSA 2CPEA 2SXLA 2FZGB 4RW6B 4M5IA 4P73A 4XDDA 1D0EA 3MI7X 4KH0B 3VF0B 2W24A 2Z57B 1RADB 2QIFA 4AE5A 2C42A 1YBTA 5H1SV 3C46A 3Q22A 4OHWA 2EPIA 1PGZA 2BE2A 1HQEA 3BF4A 2VG6A 2NUHA 2KT3A 1XMOF 3U7JA 1OWXA 1KRPA 1HPZB 3GFYA 4KGXB 1QDUB 3BS9A 4N8NA 2KO1A 3X3UA 3KYLA 3LP1A 2VODA 3NS5A 1EAYC 2L08A 1UEKA 2HSEB 4IYQA 5DJBA 5D3GA 1K73T 3I5BA 2PI4A 2OPRA 3EUNA 3IG1B 4ZMMA 3KK2B 1MW7A 2F3JA 1U26A 1CJKB 1KP6A 5M2PA 2WCXA 2PEBA 1PG5B 6FD1A 1CQMA 2Y3YA 4KB7A 2OP5A 2HQFA 3AB4B 4HHHA 1F5BA 4TLRA 1C4AA 2QL7B 3VZIA 7AT1B 1KHVA 3FMWA 1RAOA 3GIKA 1MU2B 2DY9A 5BXIA 2YKOA 4TKTA 3PM9A 1UKUA 4NLVA 5A2QY 1WC4A 5L1LA 3CCQS 1SB6A 3CULA 2RDDA 1B7FA 4F0HA 3JXOA 2JEGA 5DG8A 4YB1P 3UCZP 3UDVA 3OJUA 2KI2A 2FY1A 4X4OA 2EKNA 5ETOA 1E6YB 2B5JB 1NHUA 2MKCA 2YWFA 2ZJQQ 1QY7A 1RWNB 3T9NA 1S76D 1B0TA 3D4JA 1U1LA 2B6AA 4NCGA 4NZ0A 2ZDPA 3W8PA 4ANDA 3K8VA 1ZM2A 2XLJA 1R0AB 5H9FK 3GJSB 2WOMA 1HBOA 4E2FB 1SC4B 2FVRA 1AROP 1Q8LA 4P2MA 4JI5J 2HHVA 2E9TA 3KK3B 4I0WA 2OIHA 3DYAA 4WZMA 1HWKA 3UR3C 4YMEA 4KSEB 2W8KA 2ZZMA 3R5JB 4NXMF 3KJVA 4B3MJ 1HKAA 1FWPA 4ECTA 2M5YA 2L48A 3L4BC 2B43A 1WEYA 4GVBB 4ICLA 1C0UB 4F36A 4LFCF 1X5OA 2ZBCA 3HULA 3OL7A 4K4TA 2BBEA 3H5SA 1TMMA 1FWKA 2ROEA 2EFVA 3I9ZA 5HI7A 3RAXA 2DR9A 1YI2S 4X65J 2BABA 2V8VA 3GG1A 4J7CA 4NLSA 4LFAJ 3R2CJ 4OJHA 1VK8A 2DGVA 4ZP9A 1LWEA 3DLJA 1KFDA 4B9LA 2VPZB 4TQSA 1H6KX 2R2SA 3EX7B 4ZVHA 3OW2R 1GEHA 3T1YJ 4GKJJ 1AFIA 3LTOA 2LEPA 1CPZA 2YKQA 2ZH3A 4J9MA 1QM9A 1JLCA 1FRIA 3DHWC 2P6TA 2DIUA 2QYGA 4RW4B 3NAIA 2J0SD 2DNRA 3DOLA 4JBCA 5D0EA 2QA1A 4JYAJ 4U7UD 5L39A 1HD1A 4DPWA 2Z0GA 2K3IA 2BA9A 1PAEX 4OX8A 2QE5A 4AUKA 1FHTA 4H54A 2CZVC 1IJEB 1RTZA 3MR6A 1IR1A 2XGPA 3RTVA 1S0OA 1FVSA 4PRFA 2LXUA 4FYYB 3LW5C 4RW9A 3EPGA 2LQ5A 1IKXB 1WDDA 2YY3A 2RRBA 3FMBA 1HBMB 2FLLA 4UTGA 2Q3PA 3RBDA 2YPYA 4TU7A 1CULB 4NOHA 2ZVSA 2DH7A 3GR0A 3KK1B 2ASJA 2V94A 3DU6A 1MWYA 3SQGA 4ED6A 4X4SA 5D77A 4Z7CA 4GKKJ 3BGRB 2QT7A 1S77D 5D15A 3C6TB 4ZVTB 2HNYA 2E5LF 3CJQA 5AE1A 2KTQA 1FERA 2OEMA 4NCBA 2W01A 5F8MA 4DX8H 1X5TA 1K1SA 1S1WB 1IKWB 3T1YF 3H59A 1XMOJ 2B7BB 3CB4A 5LXYA 5B0GA 3B6BA 3W64A 1MNEA 5GVQA 4FBUA 3C16B 3TJ9A 3G87A 4ZLPA 3WX4A 3BO3A 4AQYF 1VIXA 2J0QD 4ELTA 4A8XA 2GJ2A 2AX0A 2KT2A 4DR3J
chains in the Genus database with same CATH topology
1IBLJ 4OX9J 2KL8A 4X66J 4DV6J 4RJVA 4YY3J 4DR3J 4DR6J 2MTLA 3IMQJ 1HNXJ 2VQEJ 2UUBJ 4DV3J 4DV1J 4DV0J 4DV7J 5IT9U 4DR4J 4JI0J 2MEWA 4NXNJ 3J81U 1IBMJ 4LF5J 2F4VJ 4DV2J 4AQYJ 4JI1J 4JI6J 3J7AN 4KY3A 3OTOJ 4KHPJ 1J5EJ 4DR7J 5LMNJ 2KVQE 4DV4J 4B3SJ 4KYZA 4DUYJ 1HNWJ 4LF7J 2MQ8A 4JI5J 2E5LJ 4NEYA 4DV5J 2UXDJ 4K0KJ 4LF9J 4JI4J 4JI2J 4X62J 4B3MJ 1XMQJ 1XNRJ 4DR5J 2UUCJ 1FJGJ 3D3BJ 1I94J 4NXMJ 4B3RJ 4X65J 3R2CJ 4LFAJ 1N34J 1IBKJ 4JI8J 3T1YJ 4JV5J 4GKJJ 5FLXU 5AJ3J 5A2QU 4NEZA 4LF6J 4LFBJ 4JYAJ 1HR0J 4YHHJ 4B3TJ 1N32J 4LF8J 3D3CJ 5LMUJ 3R2DJ 5LM7E 3J80U 3T1HJ 4LF4J 4X64J 2VQFJ 5IWAJ 2UXCJ 1HNZJ 4JI3J 4JI7J 4PWWA 2UU9J 4V1Ak 4GKKJ 5BR8J 4HHUA 4DR2J 4DUZJ 2UUAJ 2ZM6J 1XMOJ 1XNQJ 2UXBJ 3W1YC 1N36J 3JAMU 4DR1J 2HHHJ 4LFCJ 1N33J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL J;  4OX9 J;  2KL8 A;  4X66 J;  4DV6 J;  4RJV A;  4YY3 J;  4DR3 J;  4DR6 J;  2MTL A;  3IMQ J;  1HNX J;  2VQE J;  2UUB J;  4DV3 J;  4DV1 J;  4DV0 J;  4DV7 J;  5IT9 U;  4DR4 J;  4JI0 J;  2MEW A;  4NXN J;  3J81 U;  1IBM J;  4LF5 J;  2F4V J;  4DV2 J;  4AQY J;  4JI1 J;  4JI6 J;  3J7A N;  4KY3 A;  3OTO J;  4KHP J;  1J5E J;  4DR7 J;  5LMN J;  2KVQ E;  4DV4 J;  4B3S J;  4KYZ A;  4DUY J;  1HNW J;  4LF7 J;  2MQ8 A;  4JI5 J;  2E5L J;  4NEY A;  4DV5 J;  2UXD J;  4K0K J;  4LF9 J;  4JI4 J;  4JI2 J;  4X62 J;  4B3M J;  1XMQ J;  1XNR J;  4DR5 J;  2UUC J;  1FJG J;  3D3B J;  1I94 J;  4NXM J;  4B3R J;  4X65 J;  3R2C J;  4LFA J;  1N34 J;  1IBK J;  4JI8 J;  3T1Y J;  4JV5 J;  4GKJ J;  5FLX U;  5AJ3 J;  5A2Q U;  4NEZ A;  4LF6 J;  4LFB J;  4JYA J;  1HR0 J;  4YHH J;  4B3T J;  1N32 J;  4LF8 J;  3D3C J;  5LMU J;  3R2D J;  5LM7 E;  3J80 U;  3T1H J;  4LF4 J;  4X64 J;  2VQF J;  5IWA J;  2UXC J;  1HNZ J;  4JI3 J;  4JI7 J;  4PWW A;  2UU9 J;  4V1A k;  4GKK J;  5BR8 J;  4HHU A;  4DR2 J;  4DUZ J;  2UUA J;  2ZM6 J;  1XMO J;  1XNQ J;  2UXB J;  3W1Y C;  1N36 J;  3JAM U;  4DR1 J;  2HHH J;  4LFC J;  1N33 J; 
#chains in the Genus database with same CATH topology
 2WK4 A;  3J7Z 5;  3JB9 k;  4DQQ A;  1BLU A;  2FVC A;  2QZ8 A;  4ZIT A;  2GJF A;  2NR0 A;  3EGZ A;  3US5 A;  4RJV A;  4YY3 J;  3I56 S;  1FT8 A;  4K2X A;  4DCP B;  1RKI A;  2FLO A;  5KFM A;  2B9X A;  2OHD A;  5AE3 A;  4AFF A;  2IAJ B;  4YQW A;  3GSD A;  4WE1 B;  4LFB F;  2BAC A;  1P6T A;  4U96 A;  1MU2 A;  2PC6 A;  1V3R A;  2AYE A;  2FC8 A;  2FLP A;  1R31 A;  3H90 A;  4U95 A;  4K4W A;  1X5S A;  2HHT A;  1U0S A;  3EZU A;  3G82 B;  3TVK A;  2FPH X;  5L9N A;  1ZM9 A;  4DV7 J;  4EBC A;  1AFJ A;  2VHG A;  2J0X A;  2W4D A;  3T41 A;  2CQG A;  2FJA B;  4PG4 A;  2YNG B;  5DET A;  3R7N B;  5KFJ A;  1VMB A;  4FXV A;  2F8M A;  4YB5 A;  3ZTO A;  3DXS X;  1URN A;  2F4V J;  2XZW A;  5LMN F;  3UQS A;  3FBE A;  4QU7 A;  4C3L A;  3OL9 A;  1URR A;  2B4O A;  4I2P B;  1WKJ A;  3VV2 B;  2D41 A;  2VKR A;  2M7S A;  4MYT A;  1VQP S;  2Q43 A;  5L46 A;  4EZ9 A;  2ZZN A;  3FRZ A;  2R3V A;  2CPI A;  1O0P A;  1RT7 A;  2ZKU A;  3QGH A;  3PEH A;  4LBI A;  5G4D A;  3D9B A;  2OO4 A;  2J7W A;  2XZD B;  4ZDN A;  2ZD1 A;  4ZJQ A;  4DUY J;  1N5Y B;  1B4S A;  2C2K B;  2NSB A;  4DV5 J;  4ER8 A;  2HWT A;  2UXD J;  4FN5 A;  3KNG A;  2NYI A;  2NZC A;  3MMA A;  3TVY A;  4DFM A;  4K4Z A;  1IR2 A;  2BW7 A;  2HZA A;  1RDR A;  3D54 A;  2QC3 A;  1E6V B;  4I6A A;  4RBU A;  4S0M A;  4WCE Q;  2I8E A;  1UCN A;  2VA3 A;  4BDP A;  2HS0 A;  2IRX A;  2EG2 A;  1FKA F;  4JI3 F;  2LQB A;  1OPI A;  5J2P A;  1TKX B;  4O0N A;  4C2M A;  4IO1 A;  3H5Y A;  2FGC A;  1FK9 B;  1VRT B;  2YQ0 A;  3M2V B;  4KGV B;  2EKY A;  1TL3 B;  3TA1 A;  5KFY A;  3OL8 A;  1NU4 A;  2AF6 A;  1S9E B;  3N6L A;  4NXN F;  2AJQ A;  4ES3 A;  3BGF A;  2AQ4 A;  1QE1 B;  4AXJ A;  2AJ4 A;  3QO9 A;  4OX6 A;  4CT9 A;  1S1U A;  2ZC3 A;  4G1P A;  3ZZU A;  2Z30 B;  1VCT A;  1SBR A;  3A8J A;  3Q8U A;  3D1O A;  4J9K A;  3C6U A;  3I31 A;  1TL5 A;  2XMK A;  2XHC A;  4HDG A;  3MUT P;  1UZD A;  5T14 A;  4AT1 B;  5E3A A;  4MK9 A;  4TYB A;  2CJ9 A;  3DHX A;  4ANE A;  1VR6 A;  2CPX A;  2O1P A;  1A0O B;  2XMV A;  5KFF A;  2ZUA A;  3MPU B;  4U67 Q;  3PYD A;  4OYX A;  2IRU A;  3ZO7 A;  3ZC4 A;  1TV6 A;  4U8V A;  1W26 A;  2DIT A;  2JH3 A;  1Y5L B;  4C7Q A;  5F9N A;  4YHH J;  3EZ5 A;  5ETV A;  2HIQ A;  5DZ6 A;  2NRE A;  4KH1 B;  1XN9 A;  2PI5 A;  4F25 A;  1RAA B;  3M1V B;  1BQM B;  4TY9 A;  2MZR A;  1S79 A;  3NEK A;  3TVZ A;  3B54 A;  2IJN A;  2I6W A;  4NI2 B;  2FHJ A;  4R8U B;  5A6W A;  1XBW A;  2C2D A;  2VF3 A;  3DLK A;  4DSE A;  1U1K A;  3CJK A;  5IV3 A;  1N48 A;  2M3D A;  1UZH A;  2N3L A;  2HUR A;  3EIC A;  9RUB A;  4DQS A;  2DXE A;  2GC8 A;  3GP9 A;  3C6T A;  1YBU A;  2UUW A;  3B4D A;  4LF6 F;  1RJJ A;  1WSR A;  4E0D A;  1MWZ A;  4BBY A;  1UVN A;  2R4F A;  4WP8 A;  3A4T A;  3J7Y U;  2XI3 A;  4PQU A;  1JLA A;  2MHN A;  1HNV B;  4LRD A;  3TAM A;  4YR0 A;  1WNE A;  3AOC A;  1RT2 B;  3HMJ G;  1KVK A;  2CG4 A;  3AD9 C;  4UOC A;  2VG6 B;  2DGW A;  5E7O B;  1SKW A;  3BSC A;  4X4V A;  1X0P A;  3GYN A;  1SVD A;  3QPI A;  4YHH F;  3CWJ A;  1WEX A;  2OPS B;  3AJ2 A;  4A8O A;  4DWI A;  5HMX A;  5ETS A;  3CCJ S;  3QGG A;  2GVZ B;  1VJW A;  3PVX A;  4Q7A A;  4B3S F;  1HI0 P;  3H7H B;  1DLO B;  4P72 A;  3G71 S;  3ICL A;  4L75 A;  1JQG A;  5CD4 A;  1T9W A;  1MRO A;  4MIW A;  4K0K F;  2IVY A;  4GKJ F;  4R5P B;  4ECV A;  2BOP A;  4KKO B;  4ZCL A;  2UP1 A;  3S01 A;  2E9R X;  5C25 B;  3DMJ B;  1BHN A;  3Q0A A;  4DV1 J;  1OSD A;  1YJR A;  2VFV A;  3PCO B;  1ULR A;  1HW8 A;  3GCW P;  1Q16 B;  2JFD A;  2Z58 B;  5DQG A;  4F67 A;  3T5K A;  3QNW B;  1U49 A;  2ZBI A;  4V19 X;  3WC2 A;  2R7U A;  4EMD A;  1OJ4 A;  3RRK A;  1FCA A;  2UVR A;  1Y4Z B;  3ADA C;  4QIF A;  4C11 A;  3JSR A;  3DLB A;  3BN4 A;  3LP0 B;  1R7I A;  1SKU B;  5AXK A;  1S10 A;  3OXG A;  5IWA F;  2CPZ A;  4ECW A;  1N6Q A;  3WIU A;  3FEX B;  4MIB A;  3VAJ A;  2I2Y A;  4FF3 A;  2JLE A;  3FBB A;  1RU2 A;  4LRF A;  1RXO B;  3G96 A;  4JI6 J;  3GFZ A;  3R5G A;  1JLG B;  1RT4 B;  3E01 B;  4MKY A;  3POT A;  4I2Q B;  2B8Q A;  1B70 B;  3JYT A;  2WOM B;  1ZA2 B;  5LMN J;  3KG1 A;  3F73 A;  3TAQ A;  4J9N A;  4IOA Q;  2C3O A;  4NEY A;  3CDA A;  4JP8 A;  1JLB B;  2BMB A;  4QW8 A;  1VYA A;  5IV4 A;  2EC2 A;  2RUS A;  4WII A;  2LEC A;  2HBY B;  4IH5 A;  4K0K J;  5E5N A;  1SQE A;  1TL7 B;  2MKS A;  3NOG A;  3BV8 A;  1JMT A;  3CDU A;  4FZV A;  3W5Z A;  1KLM B;  4DPT A;  1NJZ A;  3R7S B;  2AIR B;  3W61 A;  1XNR J;  4Q0B B;  2CPD A;  2JLG A;  4GVB A;  2BAN B;  4ICL B;  4OHZ A;  2KB2 A;  1X4C A;  1RWK B;  2J76 E;  3QIP B;  4U7U K;  4Y2M A;  5HRO A;  3K0J A;  1GK8 A;  2B3T B;  2GHV C;  3SXL A;  4OZ1 A;  4CDI A;  2YNH B;  3SDE B;  1Q86 T;  2WRM A;  2BE2 B;  3DRP B;  4B08 A;  2F40 A;  5BYQ A;  1BMQ B;  2J9D E;  2E7W A;  1SJ3 P;  4L3K A;  1RT5 B;  1HBU A;  3IR5 B;  3C6U B;  4DL7 A;  4LF6 J;  4IUF A;  1U1R A;  1TL4 A;  2AJF E;  3BBF A;  2OPR B;  3IG1 A;  4M5L A;  3WX8 A;  1X4F A;  2DHG A;  3NRB A;  3D3C J;  3HFK A;  1HHQ A;  3PRD A;  3R5A A;  1TFW A;  2IDL A;  2OUG A;  2K3K A;  3ISN C;  1TKT B;  2CNN B;  1VHI A;  3UI3 A;  3CCM S;  3J7A 1;  1BQM A;  2E1A A;  3JTN A;  1S49 A;  2LXI A;  2OML A;  4KFB B;  3CCR S;  4JI5 F;  1CS4 B;  4HEA 9;  1UJ4 A;  4WFA Q;  3I55 S;  4IQX A;  5BYS A;  2L9W A;  3G6X A;  1CJU B;  2OSQ A;  1JJ4 A;  5HK4 A;  1LWF B;  4KGZ B;  4KV8 B;  2HK2 A;  2MY7 A;  1WC3 A;  5IM0 A;  1RWU A;  3D1H A;  4H4K C;  3DDN A;  4RUB A;  3CW2 C;  5THW A;  2ZBQ A;  3DLG A;  3OJS A;  2R8G A;  3LAK A;  1FNO A;  1SIZ A;  3Q8R B;  2J9E A;  3U02 A;  3BEG B;  5K8M A;  2V2V A;  2ALY B;  1C0T B;  4LUB A;  3TAM B;  2D9O A;  2MLY A;  1VFJ A;  2ASY A;  1PO6 A;  3VGV A;  2F4V F;  2GVD A;  2MLX A;  2B4P A;  3LGN A;  4RW7 A;  4RBT A;  1K1Q A;  5E33 A;  1NDC A;  3UDC A;  1T3O A;  3TUJ C;  3THP A;  4KC5 A;  3UD3 P;  1W2B R;  2A6M A;  2KKH A;  3BH7 B;  4HH1 A;  4LVN P;  3CCL S;  2NUU G;  2CQ1 A;  2QV6 A;  4CCH A;  2KL8 A;  2V8G A;  2YWK A;  2MGZ B;  3DYA B;  3NCP A;  5F0U A;  1JWW A;  1VQ4 S;  1EKR A;  3NS7 B;  3PO4 A;  1GX6 A;  5DDP C;  3PZP A;  1HI1 A;  2CJB A;  2N7C A;  3OLB A;  5KFO A;  5CHC B;  1RTH A;  3TAP A;  4JV1 A;  6AT1 B;  5CCM A;  5A0Y B;  1H74 A;  2IAJ A;  2AD9 A;  1X4G A;  4WE1 A;  3PFO A;  4N8O A;  4CWB A;  4EEY A;  3FKB A;  3I6P A;  2XY5 A;  1K9M T;  3FEZ A;  3IBF B;  3FZ2 A;  3H0P A;  5I3U A;  2HFV A;  3CGI A;  3DOK B;  4OI2 A;  5KFV A;  4F04 B;  3ENW A;  1YLX A;  2LCW A;  4USU A;  3ZZP A;  2YVS A;  3W9J A;  4C97 A;  1FES A;  4KHM A;  3GQC A;  4B3M F;  1SJ4 P;  1OIA A;  2MKY A;  3EJM A;  2DH8 A;  2HFO A;  1A6L A;  2OPP B;  4CH1 A;  2DHX A;  4A8M P;  2I5J A;  4IRC A;  3OSP A;  3MGJ A;  3PW0 A;  3FK4 A;  2BDP A;  4DR1 F;  1MWQ A;  1SJR A;  2CZ4 A;  2F4F A;  1RT1 A;  1UEU A;  3AY0 A;  5DO2 A;  2UU9 F;  4FYD A;  4BC7 A;  5EX3 A;  5DQH A;  2KVQ E;  5E3R A;  1QVF R;  1VS3 A;  3M9O B;  1YRT A;  3PIO Q;  1N5Y A;  1REV B;  1TK0 A;  1GXU A;  2AJ0 A;  2BJ1 A;  2E5G A;  4QYZ J;  1RAC B;  3HDS A;  4Y3C A;  2M4M A;  1JLB A;  1M1G A;  3MAA A;  5AXN A;  3CJ2 A;  2FLN A;  2R7T A;  5JMN A;  3GV5 B;  1X4E A;  4WK3 A;  3KK1 A;  1U2C A;  2R7V A;  1SPB P;  2BV3 A;  5B7W A;  1NKE A;  2RKI A;  4MMO A;  3M32 A;  1FWL A;  2CDR B;  2COL A;  2DXD A;  3BPS P;  2WBR A;  4Q0B A;  2RRA A;  2JDJ A;  3AJ1 A;  4N77 A;  3MR2 A;  1TR0 A;  2ZKT A;  2AGQ A;  1T03 A;  2FJW A;  5KFE A;  1JLE B;  2DHA A;  1IKW A;  2ADB A;  5I4M A;  2B0G A;  1N0V C;  3R3T A;  3I4P A;  3V6J A;  3VHQ A;  4ILL A;  1WG5 A;  4O44 B;  3AAW B;  3EPI A;  4GC6 A;  1AYE A;  3MCO A;  4QWB A;  3FCV A;  2RF2 A;  5KOX A;  5HLF A;  3L7O A;  1OMS A;  1RT5 A;  1UA0 A;  2YH0 A;  3PYF A;  2DCL A;  4FYW B;  3Q83 A;  2NYH A;  3FJ2 A;  3PY8 A;  1CEZ A;  3DGV A;  1QAJ A;  3W2V B;  2OAU A;  3HCX A;  1U6B A;  1Y10 A;  4Q5V A;  2GIF A;  1IBC B;  3MEC A;  3NG8 A;  1WC5 A;  3OT9 A;  3MCN A;  4AL6 A;  4OZ5 A;  2QX0 A;  1FEH A;  3FQL A;  5LMU J;  1U24 A;  3GE9 A;  4DBQ A;  2QFI A;  1JJC B;  1D8Y A;  3SV3 A;  3BO4 A;  3KG4 A;  4UUW A;  4DN9 A;  4ZHR B;  2CVE A;  2VBX A;  3T3F A;  2QA4 S;  4PWD A;  4WFZ A;  4K5R A;  3RW7 A;  2KYX A;  5IWA J;  1LW2 B;  3CDW A;  2WVD A;  3MMB A;  2VG7 A;  1D8Z A;  5F41 A;  1YJ7 A;  3PR5 B;  2DGS A;  1HAR A;  1ZPV A;  3KXD A;  4ZJO A;  1RHQ B;  1UW9 A;  2D3Z A;  3P8B B;  4IFV A;  5CCL A;  2OKQ A;  1F9H A;  4ZPA A;  2B8P A;  4EO8 A;  3HSG A;  4DV1 F;  2C2M B;  1S1V B;  2O01 C;  2DR6 A;  2RQM A;  3DLG B;  1DTT A;  2QO3 A;  3ZTR A;  3P3D A;  4PR6 A;  4FYV B;  5AT1 B;  3JTO A;  2PD1 A;  2W9B A;  4DSK A;  1R0C B;  4USK A;  4QWC A;  4OFZ A;  1JK9 B;  5LJ3 Y;  4TLQ A;  3DDK A;  3QSY B;  3OLA A;  2BXJ A;  1PC5 A;  1KC8 T;  3OV7 A;  4DV7 F;  3BKU A;  5IT4 A;  1ZAX A;  2EWH A;  2FHM A;  2LA6 A;  5D4L A;  3I5A A;  5F8L A;  2OTJ S;  2ZHO A;  2XCA A;  1EET B;  2IVF B;  3MFH A;  4JI1 F;  1PCA A;  4DFJ A;  4TVA B;  1KQF B;  3NCQ A;  4ZPC A;  5KG1 A;  4QBU A;  3GIM A;  1P1T A;  1OPZ A;  2YKP A;  4EO6 A;  5F3Z A;  4IDK B;  3OQ2 A;  4U8Y A;  5KFK A;  2Z8Q A;  3KHR A;  4DV4 F;  1QLN A;  1XIQ A;  1U1O A;  2GX8 A;  1DBD A;  2IYG A;  2LMI A;  3LF0 A;  2MTL A;  4FPI A;  1YGY A;  1BWV A;  1TKZ B;  2W8L A;  4HL9 A;  4CLU A;  4H4M A;  4J9Q A;  1RTH B;  4DV6 F;  3MED B;  3MMC B;  1TKX A;  1G1X A;  2HEK A;  4NML A;  5G0R A;  5SUH A;  3KLF B;  4F8R A;  3KLG B;  1FK9 A;  1VQ6 S;  2GO9 A;  2DT9 A;  2RDI A;  2HVH A;  2O66 A;  1V6H A;  2ZUG A;  3GII A;  4FYX B;  3EMT A;  4M5N A;  2BVZ A;  3TYT A;  2CIM A;  2QGF B;  1HQU A;  4LIR A;  1TQL A;  5HVF A;  2QFJ A;  3RAQ A;  2JEJ A;  3QLH A;  2R8I A;  5HVG A;  2AJ2 A;  4TYA A;  2FY8 A;  2RDJ A;  4HH0 A;  3K58 A;  1BD6 A;  2V69 A;  2GHW A;  1VIS A;  4Z7Y A;  3HKZ D;  2UV8 G;  4ZVE A;  2A6O A;  5KFC A;  5LOQ A;  3TZW A;  3E8O A;  3DOL B;  3PHE A;  3EVM A;  2EVZ A;  3CJ0 A;  2PDA A;  4PYA A;  4JI1 J;  1TV6 B;  3HLU A;  4IH7 A;  5D4O A;  5DM7 Q;  1S4E A;  1KBR A;  1RCX B;  5L9X A;  3N4W A;  4CZC A;  2WHO A;  1RGV A;  4LF9 F;  4F4K A;  2X7I A;  1H98 A;  3VR1 A;  4C48 A;  4UY8 5;  1HBM A;  3MWB A;  1FDD A;  2AEJ A;  2E5J A;  4D3G A;  2PA8 D;  1ROF A;  4PAB A;  5FII A;  3I0S A;  2R7Q A;  3PJ9 A;  2AU0 A;  4FF1 A;  3ET6 A;  3FSI A;  1C1C B;  3NNC A;  3TA2 A;  1Y5N B;  4ILM A;  3M32 B;  3RRG A;  1FXD A;  3NXZ A;  3CJ4 A;  4KHR A;  1R6V A;  3I9V 9;  1T03 B;  4USV A;  4I68 A;  2HMI B;  1SL2 A;  4LF5 F;  4NXM J;  4M5J A;  1WF2 A;  2Q79 A;  1ZAV A;  1FFW B;  5KG0 A;  1GMW D;  2HND B;  3UN3 A;  4ZLN A;  4WTO B;  1NXI A;  5D8H B;  2M52 A;  5E2Q A;  5DGA A;  3NGT A;  3R6L B;  2B9Y A;  3JSM A;  2DRB A;  4K59 A;  4P9S A;  4CLY A;  1BQX A;  3M4X A;  2W7O A;  4FVC A;  2HG4 A;  2FYX A;  3GJQ B;  3RUB L;  1KKH A;  1FJC A;  5HLF B;  1HW9 A;  2APO A;  2DGO A;  2H65 B;  4FNH A;  4DL0 C;  3RBE A;  1HWJ A;  1X31 C;  4O4R A;  4MJK A;  1VC0 A;  2WVC A;  1JJ2 R;  4GC7 A;  3NGU A;  1NRK A;  3VAI A;  1S1T A;  3OUY B;  1KTV A;  2D3O 1;  5KG2 A;  1H3D A;  4N56 A;  3T1A A;  3HJV A;  4LF8 J;  1DQA A;  4FDF A;  4M8L A;  2CXE A;  4PWU A;  2ZH4 A;  4A8K A;  4NCA A;  2V63 A;  2HQI A;  5BYR A;  2RS2 A;  4OMF G;  1HYS A;  5IOL A;  3MM8 B;  3QID A;  3IRW P;  3IWN C;  2AJ1 A;  2VQF J;  3BN7 A;  2G0J A;  2DRA A;  1FKP A;  2CNK B;  4OL8 A;  1HNI A;  4CH0 S;  5EWF A;  5M2R A;  3AA9 A;  2C2O B;  2J9C A;  2XMT A;  4OQJ A;  2KFN A;  3G82 A;  2FJX A;  5SZT A;  3BO2 A;  1NPP A;  1RHJ B;  1Y0H A;  3MCM A;  3V6H A;  1JLF A;  4HI1 A;  3EGN A;  3S7R A;  1D3W A;  1UA1 A;  2KH9 A;  4V1A k;  2DXF A;  4NPO A;  3G4S S;  1N4L A;  4FF2 A;  4QIV A;  4LQ9 A;  4QZV B;  4PKD B;  5MLC V;  2HVD A;  1S0V A;  2Y1I A;  3IAM 9;  4ZS6 A;  4DUT A;  5HQM A;  4FKX A;  3TEH B;  1X8D A;  4NLX A;  2UUT A;  2VAS A;  4K7Q A;  2CQ0 A;  3QWP A;  4ZK7 M;  2UVU A;  2D3O R;  1QUP A;  3JYT B;  2ALZ A;  3DM2 B;  3HZG A;  4K50 A;  2XYP B;  3K89 A;  4DR1 J;  1OSC A;  3MEG B;  4DU7 A;  3AXK A;  1G2E A;  1B3T A;  1RWP B;  4TXS A;  4M95 A;  4DPX A;  1DTQ A;  1G3O A;  5KFA A;  3HT3 A;  1VQM S;  3FRY A;  1SKR A;  1N6Q B;  3QRQ A;  2DPJ A;  1TAQ A;  3RGI A;  4DV6 J;  1DRZ A;  3LAM A;  2VZ9 A;  1NHK L;  3M2R A;  4DPO A;  2DNL A;  2W9A A;  3BBB A;  2XG8 A;  5IQ6 A;  1S12 A;  4WFX A;  1CSJ A;  2P9G A;  4AD6 A;  4QIE A;  2ZH7 A;  3G8S A;  1TL3 A;  2D7S A;  2PFF B;  2IC3 B;  1RWW B;  4F50 A;  1LFP A;  3HX9 A;  3PJW A;  1B99 A;  1Q7L B;  2DGQ A;  2RNE A;  2XWX A;  5CH7 B;  5HN0 A;  3DRP A;  4DV0 J;  3QFW A;  2PMZ D;  2YKA A;  4ED0 A;  3VAM A;  5EUH A;  2K1R A;  3O3L A;  1V5I B;  3ZNU A;  2ZH6 A;  3W5X A;  2DO0 A;  2G0C A;  4OI4 A;  3QGP A;  1UAW A;  1WOP A;  1KON A;  4C8K A;  4QPX A;  4KIA A;  4OX9 F;  3T6B A;  3HD2 A;  2OEK A;  1RTI A;  3KWM A;  3MTK A;  2OJ3 A;  4DSL A;  2WB4 A;  5HMY A;  3CDE A;  1ZBT A;  1Z1Z A;  3J7A N;  5F3T A;  2A3J A;  3OTO J;  2DH9 A;  2A10 A;  4MFB A;  4ERD A;  3CPW R;  3QSI A;  4CO1 A;  2OD4 A;  1FFS B;  5DQI A;  1LV5 A;  4CM0 A;  2K7K A;  2MJU A;  1FE4 A;  5AXL A;  4B9M A;  4QCL A;  4C3K A;  1REV A;  2ZE2 B;  3BYR A;  1CJT A;  4PG8 A;  4KGM A;  5CYJ A;  5F8J A;  2MQ8 A;  1ZM4 A;  2VOP A;  1O5J A;  1T9V A;  3MM6 B;  2HRU A;  2ACM A;  1JLQ B;  1HNX F;  1FJ7 A;  5CAB A;  3LWM A;  2ZZT A;  4KV8 A;  3TAN A;  1PIL A;  2DVI A;  4LF9 J;  3Q2S C;  4ED5 A;  4ED4 A;  3D0I E;  2F1F A;  4M63 A;  4ZP6 A;  3R9L A;  5I42 A;  2YNF B;  3ET6 B;  2V8D A;  1XMQ J;  1K8A T;  4YS2 A;  1FRL A;  4OZL A;  4ANC A;  4OX7 A;  4HHJ A;  4DV0 F;  3TW0 A;  3MUV P;  4OI6 A;  1RHM B;  3OBI A;  2IIH A;  4A8S A;  1QAI A;  3N9U C;  5IQQ A;  4QOT A;  4YR2 A;  3LP2 A;  2XY7 A;  1FO1 A;  4M5D A;  1IBK J;  2DNP A;  2CQB A;  3GFX A;  2MQP A;  2DGX A;  3W8G A;  2CQ4 A;  5I3Q A;  4DR6 F;  4ZKA A;  3QJP A;  2EK1 A;  4ES2 A;  1UW4 A;  3MPV A;  2Y1L B;  3PW5 A;  2GVD B;  1WWH A;  1LXJ A;  5AXM A;  1LW0 B;  1RT6 A;  2R42 A;  1HPZ A;  2ZH8 A;  1HWU A;  2HIY A;  1UFL A;  2WB1 D;  2W2Q P;  4PPZ A;  1FRH A;  1M5H A;  4PXD A;  2F65 A;  4DZ6 A;  1WEZ A;  4RWW A;  2MGZ A;  5BJR A;  2HQC A;  4PG6 A;  2C2R A;  3OPK A;  3MEC B;  5F8G A;  2DHH A;  1VIO A;  1QVG R;  2YTC A;  1YBA A;  4ZVQ B;  3HXM A;  1PJ7 A;  1NJX A;  4DQI A;  1T3N A;  2XS7 A;  4OYB A;  1H2T Z;  2WZ1 A;  3HK2 A;  1L3U A;  5CYQ A;  3F44 A;  5K14 B;  1EQ0 A;  3GG0 A;  2BKO A;  2CFX A;  4KPC A;  4YOE A;  2GO8 A;  5DDO C;  2FC9 A;  1O6X A;  4F7V A;  1RA7 A;  1HNZ J;  4IRK A;  4CIO A;  2NXU A;  3W2W A;  3KG0 A;  3TZY A;  2W4C A;  3NWR A;  3QFH A;  3CNQ P;  2J8S A;  3R27 A;  2B9W A;  3SSQ A;  4ECY A;  1YJN S;  5DLG A;  1IBK F;  3LP0 A;  2JWN A;  4NRU A;  2KZM A;  2VPX B;  1JJH A;  4Y2A A;  1QJH A;  1WJ9 A;  1APS A;  2HRY A;  3L7P A;  3QJL A;  1FVQ A;  3SCK E;  2UUA J;  3K8W A;  1N36 F;  2ZH2 A;  1DY3 A;  2B4V A;  4Y0F A;  4R0E A;  2CUY A;  2B6A B;  4NCG B;  2XO6 A;  1D1U A;  1TL1 A;  1R0B G;  3W1Y C;  2RML A;  3HPO A;  3GV7 B;  4ZPV R;  2IFX A;  1U09 A;  3MPD A;  3IR6 B;  4NA2 A;  4UT4 A;  2Y1J A;  3H8Y A;  2VC0 A;  1NLK L;  3K5L A;  4CLL A;  2BQ3 A;  5ITH A;  2IYI A;  1S6P B;  1VDH A;  3MPY A;  3MMJ A;  4OX9 J;  1JNZ B;  4EZ6 A;  3D6H B;  3Q2T C;  1KLM A;  2ASD A;  4PUO A;  3OVB A;  2KG1 A;  3R5C A;  1S97 A;  2NXJ A;  3DDI A;  2DEI A;  1XTZ A;  5LJ5 Y;  3MMC A;  4NLQ A;  4BS2 A;  1VRU B;  2J7U A;  5BR8 F;  3HZE A;  5K8N A;  3KLG A;  5IC6 B;  2UUB J;  2G2O A;  3CJR A;  3CVK A;  2GS8 A;  2Z56 B;  3RAM A;  5DM6 Q;  2XLK A;  2R7X A;  1VLY A;  3DI6 B;  2X1G A;  4RNF A;  1TUG B;  2MQM A;  3Q86 A;  4CTA A;  4UY8 T;  3A3P B;  2IDE A;  3QAU A;  5KFR A;  1QUV A;  2MEW A;  5D4N A;  4GVL A;  3BPD A;  5CZV A;  2HHU A;  1RAG B;  2XGQ A;  2I38 A;  3FSX A;  2R2U A;  4ZCK A;  4DU8 A;  1GMW A;  4YN3 B;  2ZJR Q;  2YWE A;  1X7V A;  3FQK A;  4L6V 3;  5A6P A;  4WK1 A;  4B9U A;  1CLF A;  1KD1 T;  2YKM B;  1K0V A;  2CJQ A;  2FHO B;  4KHP J;  3JS9 A;  1SUQ A;  1N56 A;  4MFB B;  4MTP A;  3IN5 A;  2OSR A;  2QA4 G;  1UJ6 A;  1VQY A;  4CNZ A;  4KYZ A;  1JXE A;  1CJT B;  4UST A;  1WOO A;  3NS6 A;  3KLE A;  2VL1 A;  3LWL A;  1CJU A;  1Y7P A;  4D3H A;  1HFE L;  2VG7 B;  3KUH A;  2MKI A;  2ROG A;  3HP6 A;  2P2C B;  2RUG A;  3PW4 A;  1OYD A;  2H5J B;  4QYR A;  3P6Y C;  1XC9 A;  2Y8W A;  5FJ4 A;  1B0P A;  3C15 A;  5HAT A;  5CXT A;  2UUC J;  1RSC A;  1T9Y A;  2ZWO A;  4LVO P;  5J2M B;  4WFB Q;  2WON A;  4B3R J;  2ZOM A;  3QT5 A;  2JEI A;  2VON A;  3PYG A;  5KT4 A;  3V4M A;  1PIE A;  2FZK B;  3UN2 A;  3QQC D;  2KRR A;  1D9D A;  4DR3 F;  4M5D B;  3QJJ A;  1HQE B;  5E3Q A;  4ZVP B;  2EFG A;  2GZO A;  3V81 B;  4PAA A;  4AL5 A;  1LQ9 A;  3GPA A;  4NLD A;  4UOF A;  4NLU A;  3KLV A;  2HHP A;  2UUA F;  4PXC A;  3KMQ A;  5GAD U;  4QWA A;  4OZ0 A;  1RAJ A;  3IRX A;  1WKL A;  4CO4 A;  5B0D A;  1UL3 A;  5A2Q U;  5AJ3 J;  2A2C A;  2VQE F;  5JVG Q;  1RTD A;  3NP5 A;  4I6Y A;  3IBW A;  3DLL Q;  4CLT A;  2QLB B;  4X4Q A;  3OUY A;  2AYB A;  5KT2 A;  1CVJ A;  2E1P A;  3I82 A;  1SV5 B;  3QAE A;  1VI7 A;  1NSA A;  3K5O A;  2KHC A;  4DHV A;  4J9L A;  4WKR A;  3HHK A;  3ONQ A;  4R25 A;  4NLG A;  3NNA A;  2FGO A;  3M8P A;  5HO4 A;  4CLW A;  5DGB A;  4L3N A;  2XM3 A;  3N6M A;  1RAE B;  3B8H A;  3CCT A;  2PN6 A;  5ETQ A;  2M2B A;  3T19 A;  3AD7 C;  1T05 A;  1T02 A;  4ECS A;  4F2S A;  2GHP A;  4U6P A;  2YWW A;  2KN4 A;  1H7W A;  3TAR A;  3UVJ A;  2EBE A;  3HHL A;  1P9Q C;  2BYC A;  5HJX A;  3HO1 A;  3LGH A;  4WXW A;  4X65 F;  1QAY A;  3GJR B;  1NB7 A;  5B0B A;  3A3N B;  4N7T A;  4PPD A;  4NAS A;  2XSF A;  1ZZF A;  1M5K C;  2PMH A;  1W25 A;  3ETM A;  1XWL A;  4DR2 J;  2OEJ A;  1OYE A;  2QRR A;  3V6D A;  2EBG A;  4USI A;  1M5P C;  2VH7 A;  4F3M A;  3NNH A;  1J2V A;  3BGU A;  2HK3 A;  4I2P A;  1KS2 A;  1XR5 A;  3IC1 A;  2PO4 A;  2ILY A;  2RQC A;  3GZ7 A;  4WXO A;  5C24 A;  3U1L A;  2X1F A;  1KHW A;  3KUE A;  3CC2 S;  3MXH P;  1LK5 A;  4YFU A;  1N52 B;  2WW8 A;  3CD5 A;  3SCJ E;  2QYC A;  1RYR A;  2DNZ A;  1CJV A;  4HVZ A;  2GQC A;  2V4J B;  4X66 J;  2AZ1 A;  5A8W A;  2HHW A;  2ZBP A;  3M6W A;  1OS5 A;  4IG3 B;  2CVI A;  4DR6 J;  4P71 A;  3DFE A;  1RE1 B;  3AOB A;  3ISN D;  4XO0 A;  4DDF A;  4MK8 A;  3MM9 B;  3NGR A;  2XB2 D;  1YVF A;  3NWG A;  1YJT A;  3OVS A;  4GKK F;  3R7B B;  2D1C A;  2W9C A;  2VOO A;  5B0F A;  5KFH A;  3RJM B;  4G65 A;  4EK2 A;  1FKO B;  3FC9 A;  3OTC A;  1E6V A;  3IGN A;  4DV2 F;  4ES1 A;  1ZS6 A;  2HAF A;  3PW2 A;  3J81 U;  4IG0 A;  4ECZ A;  3ILI A;  5J2P B;  3NY0 A;  4F4Y A;  3CJT A;  2G0I A;  2GMH A;  4RW4 A;  3U27 A;  3VGS A;  1AA1 B;  3QRR A;  1TVR B;  3CTR A;  2ACY A;  1NJY A;  1S9E A;  1EZZ B;  2N4D A;  2DGU A;  1U0H A;  2DNG A;  2O67 A;  2QN6 B;  3O5T B;  2DNO A;  3ZNJ 1;  4ZCI A;  4ZPD A;  1IKV B;  1NPR A;  3TX0 A;  1WI6 A;  2YPZ A;  3F0N A;  1SI9 A;  1Y3K A;  2EC0 A;  4ECU A;  2EW9 A;  3EYZ A;  5AJ3 F;  2EEY A;  4LBP A;  4Q45 A;  2R7W A;  4R8U A;  3UW1 A;  2IHR 1;  3VWS A;  1JXL A;  5C2C A;  3NGD A;  3FNN A;  3ILO A;  1ZOT A;  4DLE A;  2XSJ A;  2OPQ B;  1S0N A;  4F3Q A;  1J5O A;  3HVT A;  4NYP A;  2MHE A;  1ZTT A;  7FD1 A;  4QJV A;  2GAH C;  4DR5 J;  4ZPW R;  4G3I A;  3CJS A;  1SH0 A;  4EBE A;  2GML A;  2W9B B;  3PKM A;  3GR1 A;  2DK2 A;  4DS5 A;  2CYY A;  1JLA B;  4MKV A;  5FDL B;  1PAU B;  3JTP A;  3KDO A;  2M88 A;  4C0H A;  2XQC A;  4DF4 A;  1UVI A;  2G4B A;  4QQB A;  1S57 A;  1WKK A;  3SBM A;  3W7B A;  5M2U A;  2Z2Y B;  3J81 Y;  1EP4 A;  3PKY A;  1NK5 A;  4BLG A;  1RT6 B;  5CA5 A;  1R3N A;  3QT7 A;  2DTJ A;  3FCH A;  3M8Q A;  4LT6 A;  2AP6 A;  3CDB A;  4C8N A;  4TY8 B;  2NXN A;  2UUB F;  1CBK A;  3ZZ0 A;  5KG4 A;  1WF0 A;  4XPE A;  1LOU A;  1WC6 A;  2CPY A;  4CP5 A;  4EYI B;  2C1E B;  3OFG A;  4OJ1 A;  5JJB A;  1SL0 A;  1FDB A;  4X4R A;  2IRY A;  1Q0N A;  2BE7 D;  4WFY A;  1RWO B;  4TU8 A;  2XCP A;  5IT0 A;  1NAQ A;  4DX7 A;  1NKB A;  2MLZ A;  1TK5 A;  2KHD A;  2CQH A;  4RKU C;  1VQN S;  5ETK A;  5EGY A;  2IBK A;  3SSS A;  2D3U A;  3DLE A;  2R2T A;  3RB3 A;  4RZR A;  1D9F A;  3FFI B;  1RKJ A;  2JX2 A;  3L3C A;  4NZ7 A;  1QSS A;  1HQU B;  2QSW A;  3FZB A;  3MM5 A;  4RW8 B;  4O0I A;  1DAX A;  3L09 A;  4NA3 A;  4DX6 A;  2I0X A;  1S9G B;  3HVA A;  1HNW F;  1RAI B;  1VQS A;  3PHT A;  4RX6 A;  1S48 A;  3DC2 A;  4HHU A;  1Q81 T;  1RTI B;  1SJ1 A;  1IWA A;  4LR7 A;  2MZS A;  3THT A;  1PYO B;  2WBM A;  3I87 A;  4RNM A;  4ED7 A;  1N32 F;  1FDA A;  2V68 A;  1V5V A;  5CQG A;  4ED8 A;  2V6A A;  3OXL A;  4ECR A;  2YXL A;  2LA4 A;  3DOM A;  2GFF A;  3MEE B;  4P10 A;  4ZPB A;  3MM7 A;  5KTQ A;  3CMA S;  6FDR A;  1BWE A;  2BM1 A;  2HNZ B;  4C11 B;  4U7C A;  1JB0 C;  2KJV A;  1HWL A;  3MM6 A;  1NSQ A;  2OFH X;  3ENQ A;  2FHJ D;  3FEY B;  3L7U A;  3MMA B;  3ZZY A;  5CAA A;  4I56 A;  3BKT A;  1Q79 A;  4Y34 A;  3UCU P;  3HSD A;  3F56 A;  3G8T A;  1FA0 A;  1HLW A;  2PA3 A;  3OSN A;  3E01 A;  4IH6 A;  3K5P A;  2BJ8 A;  3BQ1 A;  1F5C A;  1VQ8 S;  1U7L A;  4X4P A;  3M2V A;  5D78 A;  2X1A A;  3QGI A;  1RWX B;  2W25 A;  4M5M A;  4RNO A;  2JC0 A;  2XZT B;  1S59 A;  2VQE J;  4X2B A;  2CQ2 A;  1PBU A;  2VFR A;  1M0S A;  3I96 A;  5F0W A;  2DNN A;  3C16 A;  3DRS B;  1XK8 A;  4BHQ A;  3TWZ A;  2FUG 9;  2A18 A;  3JSY A;  4X62 F;  2W7P A;  3GIR A;  3T9Z A;  1TUW A;  2XMM A;  2U1A A;  4NYO A;  4FS2 A;  2XNQ A;  1UJ5 A;  3K17 A;  1YZ6 A;  1J27 A;  4MIA A;  2HBQ B;  2AHO B;  3NGS A;  1O51 A;  1FEE A;  2Z2L A;  3BKF A;  3H40 A;  1NHV A;  3UWT A;  1ZYQ A;  1YIT S;  4YEA A;  3PNI A;  4L74 A;  5KFU A;  2E1C A;  4B3O B;  3TUZ C;  2RAQ A;  2VG5 B;  4XIU A;  2HGN A;  2XMW A;  3PX4 A;  3K7R A;  3UN5 A;  1HBN A;  4NWB A;  4ETZ A;  3SV4 A;  4IFY B;  4OHX A;  4B3S J;  2JOQ A;  3S1T A;  2CKW A;  2M8H A;  2X51 A;  4IR1 A;  4OZJ A;  1HNI B;  1HBU B;  3KJN B;  2YWH A;  3ZZZ A;  2E5H A;  3PR4 A;  1KNZ A;  1N54 B;  5L8R C;  4C98 A;  3W2W B;  2G13 A;  1K47 A;  4E98 A;  2WVB A;  3AD8 C;  3D6F B;  4DR5 F;  1ZZN A;  3CJK B;  2IA6 A;  2PGC A;  4YB7 A;  1V3S A;  3D67 A;  4JI2 J;  3J7Z T;  4OI3 A;  5D0H A;  4IOB A;  2CDQ A;  3HVT B;  4ZVF A;  2C2E A;  2IM1 A;  4WU3 A;  3R97 A;  3D3B J;  4K4U A;  2KU7 A;  3H2L A;  2WON B;  4I7F A;  1GTE A;  2CQ3 A;  5HAO A;  3BGO P;  2VV5 A;  4HAC B;  4B9S A;  2OI2 A;  3LGM A;  1C0T A;  1F9F A;  3G86 A;  4MH8 A;  4A8W A;  4EBD A;  1BUX A;  1L3V A;  3VAH A;  4LSL A;  1W7W A;  1RT7 B;  3CCU S;  1R27 B;  1YZ7 A;  4N41 A;  4LRC A;  4DL5 A;  4B02 A;  1H38 A;  3VCD A;  4PG5 A;  1NPK A;  1MLA A;  5E0O A;  1M90 T;  1VQL S;  1HI8 A;  2FJB B;  2GVZ A;  2Y1R I;  5ETP A;  3W63 A;  2C2N A;  1DQ9 A;  1NJI T;  3P5T L;  5CYM B;  1DLO A;  5HMW A;  3R6G B;  2HFZ A;  4PUO B;  1UVK A;  4HT7 A;  3KLH B;  3CT9 A;  4PQA A;  4B3T J;  4KJI A;  2ZIT A;  2HGM A;  5KFZ A;  3IM9 A;  3CO0 P;  2V8H A;  4ZP7 A;  4R5P A;  4LF4 J;  3HHL C;  1TZ0 A;  1NME B;  3W66 A;  3DMJ A;  3CCS S;  2QA2 A;  3VQT A;  2IC3 A;  2EK6 A;  3VAL A;  5JUM A;  3T1H F;  2CZ9 A;  3EE3 A;  2UXC J;  3OTD A;  5D0R A;  5HSP A;  1C4C A;  4DF8 A;  4CTA B;  1S1U B;  3U1N A;  1N88 A;  2K06 A;  1KFS A;  4DR7 F;  1YK9 A;  4LFA F;  4BWM A;  2JZ5 A;  3H20 A;  1UEV A;  1G7C B;  1GNK A;  2D9P A;  3BRE A;  1RWV B;  3I5C A;  4O23 A;  4URS A;  5A0Y A;  5BR8 J;  4F4Z A;  1SJF A;  4GRS A;  3V6D B;  2AYM A;  3R5B A;  1U8S A;  4URQ U;  2KDO A;  3ZZR A;  1S6Q B;  3ZZT A;  4F0M A;  5KG5 A;  5EWG A;  1NKC A;  5EHH A;  1NJW A;  1SL1 A;  1QSL A;  3D68 A;  4DSJ A;  1VK3 A;  1T0T V;  1RQ0 A;  2CPJ A;  4IKA A;  3I32 A;  3RZA A;  3MFI A;  3L9Z A;  1Q1K A;  4DFP A;  1X9S A;  5DDR C;  4O3N A;  4F0K A;  1JNR B;  1I94 F;  2RU9 A;  2HNZ A;  4QIW D;  1N33 J;  3PRB A;  2C3P A;  2YNI A;  1CJV B;  3OR1 A;  2DJW A;  4L73 A;  4O3O A;  4W4M A;  2EFP A;  2F7V A;  2XMU A;  5I42 B;  2Q66 A;  2DNH A;  2QLW A;  2YH1 A;  3MM9 A;  2KM8 B;  3CCZ A;  4MT1 A;  4C0B A;  2HLU A;  3WDO A;  1RHR B;  5HMZ A;  1P8G A;  3G2X A;  1IVZ A;  2OD6 A;  3MR3 A;  1WOS A;  3UD5 A;  4QR0 A;  1PJ5 A;  5B09 A;  1S7H A;  3M9N B;  1FKO A;  2JC1 A;  3QMQ A;  2FVS A;  5EN1 A;  1H7X A;  1SC6 A;  4WYW A;  2HVI A;  1LWC A;  1VBK A;  1EJ7 L;  4EI2 A;  2HZC A;  1LFW A;  3HFZ B;  3SSR A;  3JQJ A;  5KFD A;  5H9E K;  4UQG A;  1VBX A;  1C0U A;  1LXN A;  2E44 A;  3FSY A;  3O6Q A;  1TEL A;  2VB6 A;  4AXI A;  3BYP A;  3Q8P B;  2BE9 B;  1VC6 A;  1UP1 A;  4NLR A;  1IQZ A;  5J2N B;  5KFI A;  3S6E A;  4CQ1 A;  3TI0 A;  4C8Y A;  2VC1 A;  4K8R A;  4K2J A;  3QT8 A;  1IKV A;  1VGY A;  1XER A;  4DPU A;  4J91 A;  5MAO A;  2X3D A;  5KFX A;  1QD1 A;  2QLX A;  4CO0 A;  4RBV A;  5C5J A;  5GAG U;  1UWA A;  3MPW A;  4ID5 A;  3A8E A;  3MAH A;  3H4B A;  3K57 A;  3VAG A;  2CJY B;  1UPP A;  1KTQ A;  4K4V A;  1NO8 A;  2W2M P;  2LDY A;  1WF1 A;  2BKN A;  2W4P A;  1FX2 A;  2BX6 A;  1Z2L A;  5A76 A;  5IM0 B;  2WSF C;  2ZC4 A;  1OY8 A;  1REG X;  5KFB A;  2V2Q A;  2JL9 A;  2H5E A;  5GMD A;  1AT1 B;  4NLY A;  4ZOS A;  3G6Y A;  4Y2I A;  2N7Y A;  3GIJ A;  1S1V A;  1RT3 B;  2NXC A;  2G1D A;  4P2S A;  3PIP Q;  3D0H E;  4ZN1 A;  1YTY A;  2A2D A;  2FD2 A;  3CUN A;  4ALZ A;  2DR7 A;  1LW2 A;  3O8W A;  4ED3 A;  1N34 J;  2MMY A;  1MN7 A;  1FXR A;  3CED A;  2GNK A;  2QMW A;  5KFS A;  5B08 A;  4RW7 B;  5C24 B;  1SC3 B;  4IFV B;  1RB0 A;  3PFE A;  1WD6 A;  3GYX B;  2ZM6 F;  3OR2 B;  1P1L A;  2ZVI A;  2GCF A;  2HFU A;  3H98 A;  2JLF A;  4CM2 A;  8RUC A;  1CC8 A;  2KYZ A;  2AMC B;  4ZLL A;  4JI0 J;  5DS7 A;  4IG3 A;  1TL7 A;  1E6Y A;  2B5J A;  3SMZ A;  1Q78 A;  1X9M A;  4DQR A;  4NMX A;  3BR9 A;  4A48 A;  2UXD F;  4O4G B;  1X4D A;  1KSP A;  1R0A A;  4JYA F;  3MZI A;  1GAO A;  4ITS A;  2AEF A;  1C1B A;  1XEZ A;  2LDI A;  3N5F A;  2DNQ A;  2HHS A;  3DOK A;  2RH3 A;  1JKH B;  2E29 A;  1BE4 A;  2R9L A;  4LF1 A;  4IOC Q;  3B4M A;  4PWW A;  5HP1 B;  1LKZ A;  5T7L A;  3OTB A;  3I4H X;  2UXC F;  3AOD A;  3H5X A;  4FKY A;  1IBL J;  1VHF A;  2J6T A;  3W62 A;  2I5J B;  3TX8 A;  2VBY A;  4NA1 A;  3N0V A;  2YKM A;  2I9S A;  2ZM6 J;  3THV A;  1UTA A;  1NK4 A;  1SUQ B;  1S6Q A;  2Y8Y A;  1G6B A;  2VBZ A;  2DIV A;  4JI2 F;  3CCW A;  3T5J A;  1TKT A;  1AXQ A;  2EG1 A;  2HFS A;  2V50 A;  3TJ8 A;  2MQQ A;  1L5U A;  2UZA A;  4DX5 A;  2V5H G;  4JI6 F;  3Q89 A;  9ATC B;  3CD0 A;  3LPY A;  1XMB A;  4X84 A;  3KLE B;  2J0W A;  3MAA B;  1NB2 A;  4A4J A;  5A8R A;  2RU3 A;  1TU0 B;  2HQD A;  3S8S A;  2XI2 A;  3M2U B;  4X64 F;  4WTY A;  1MN9 A;  2H1Y A;  3I0S B;  1F0X A;  1RCO B;  3KDN A;  4Y6I A;  2JNJ A;  2G1H A;  2FQQ B;  5KT5 A;  3C15 B;  4RU9 A;  4J9P A;  1WTB A;  3IMQ J;  2IM2 A;  3C19 A;  2HRT A;  4GMK A;  3JSB A;  2POK A;  3ZXW A;  5K8O A;  2NS1 B;  3M30 B;  2MST A;  1NZA A;  3BM7 A;  3JAM Y;  2YWG A;  4LJM A;  3MCS A;  3RB0 A;  2VFU A;  1F2H A;  2FZC B;  1TMJ A;  3CCE S;  1RAF B;  1NK7 A;  3H5U A;  4C8Z A;  4OZ3 A;  1RTJ B;  3IRX B;  3KLI A;  1D09 B;  1DHM A;  3D66 A;  3BGL A;  2BEF A;  5A8K B;  5K8P A;  1EHW A;  2X1B A;  2CAJ A;  3IP0 A;  1FRK A;  2AKW B;  4BWJ A;  3SQO P;  3W2V A;  1Q5Y A;  2HNY B;  1F5A A;  4ENO A;  2KZZ A;  2IM0 A;  1TTH B;  2E1M C;  3CSK A;  2RIJ A;  3M8Y A;  3OTE A;  1FXL A;  3KHH A;  3UFC X;  2DR8 A;  1NK9 A;  2ABY A;  3UPF A;  4W92 B;  1CC7 A;  2LLZ A;  4DJB A;  1T11 A;  4IFY A;  4MYU A;  3UNG C;  3VGU A;  5GAH I;  4DV4 J;  2ZFH A;  2GJI A;  1VQO S;  2KJW A;  4HKQ A;  5IT9 Y;  4ECQ A;  2B56 A;  2BW2 A;  3LP1 B;  1FKP B;  3J80 Y;  4DFK A;  3IA0 A;  3PTW A;  2C3U A;  5H9E J;  3H2U B;  4PEO A;  1EQM A;  5DZ7 A;  3IXQ A;  4DCO B;  4ZVU B;  2B4U A;  5LSO A;  2FDN A;  3KK2 A;  3D6M B;  1WC0 A;  1MMN A;  3BDE A;  1NK0 A;  4X4N A;  1VLO A;  1RYS A;  3KTQ A;  1FD2 A;  4HR2 A;  2ZHB A;  5DG7 A;  3GSI A;  2ADC A;  3VZH A;  4W98 A;  1BQN B;  2OPP A;  1AB8 A;  4NLT A;  4Y28 C;  3UO0 A;  4UOG A;  2DR5 A;  4F02 A;  4CRJ A;  2H5I B;  3M1V A;  2OGU A;  1N33 F;  2VDH A;  4WIQ A;  2GV1 A;  3GON A;  2D69 A;  2HBR B;  4YY3 F;  4KE5 A;  3LAN A;  3H42 A;  1B7Y B;  3SI8 A;  3DOM B;  1JLF B;  2XEX A;  2MZT A;  4WP9 A;  3ILL A;  4Q8E A;  4LF7 F;  3OR2 A;  2UVW A;  2ZOF A;  1DTQ B;  1M5S A;  1RAH B;  3P45 B;  1R89 A;  2NPI A;  4NEZ A;  4OYA A;  4CLK A;  1N8R T;  2WVE A;  1HIY A;  1I1G A;  3NOC A;  2XC9 A;  2XO7 A;  1S0M A;  2RS8 A;  4GO7 X;  1N32 J;  3E3X A;  3KJV B;  2AGO A;  1ZM3 A;  4XK8 C;  4K4S A;  2XMJ A;  3F41 A;  4ZVO B;  4ATN A;  1XQI A;  3Q8Q B;  2LFV A;  5G0R B;  1F3V A;  2VBW A;  2CPH A;  1JLE A;  4ID8 A;  4OLP A;  4EGL A;  5C7P A;  5GAH U;  3MD1 A;  1NM2 A;  3MEG A;  4Q8F A;  3IWL A;  1Q8K A;  3EDQ B;  4Y65 A;  1GFW B;  1GXL A;  1S4F A;  3KJQ B;  4UF4 A;  4OI1 A;  1NSK L;  4JOU A;  1FTR A;  2KG0 A;  3KK3 A;  2HFN A;  4C8L A;  1Y9O A;  1ZAW A;  2XYG B;  4O44 A;  5RUB A;  4JI7 J;  2MPU A;  5T7L B;  3AHP A;  1W2I A;  2LVW A;  3LOU A;  4IG0 B;  1TUV A;  5F8I A;  4LQ3 A;  2JFK A;  4ELU A;  4I67 A;  2HAI A;  2YKN A;  3D28 A;  4B9T A;  1D9A A;  3AOA A;  1TVR A;  2J6S A;  4NL5 A;  5U47 A;  3W5Y A;  2W1B A;  2M8D B;  1U0H B;  1U2R A;  1IJF B;  2E5I A;  4C8M A;  4RPF A;  5KAK A;  5GAG I;  1VBZ A;  3C14 B;  3PXG a;  4QWE A;  3D7S B;  1QE1 A;  3VAF A;  1HBN B;  2ZH5 A;  1SQF A;  1YJ9 S;  4PWD B;  1NZ8 A;  1YJU A;  1WDT A;  4DCJ B;  2MB0 B;  3AA8 A;  4EYH B;  4A8Q A;  3CJ5 A;  4B3R F;  2ZH9 A;  1X0F A;  2DNM A;  1YSJ A;  1SJQ A;  2O3D A;  2RHQ B;  3D6T B;  3MHY A;  3OFH A;  4I6W A;  1JLQ A;  2GW8 A;  2CG8 A;  1UWB B;  2O5D A;  1S1X A;  2OPQ A;  5E3P A;  5GAE I;  2PT0 A;  4JUZ A;  3HD1 A;  2IJF A;  4WJB A;  3DXB A;  4LSN B;  4CLP A;  1HA1 A;  2IA0 A;  2BJE A;  4TN2 A;  4UW2 A;  1WG4 A;  2HBZ B;  4LBH A;  1RBO B;  2R8H A;  3GU0 A;  5FDL A;  5J1E B;  3M30 A;  2CQI A;  4F4X A;  4ECX A;  1IKX A;  1CG2 A;  3U1M A;  4J9O A;  1KOO A;  1N5Q A;  2VDI A;  3LUY A;  3GLJ A;  4OYW A;  5ETL A;  5LSL A;  3JSM B;  2NSC A;  5KT6 A;  3DLK B;  2F63 A;  3ILJ A;  3MR7 A;  3MR5 A;  3A8K A;  4M1K A;  3GJT B;  2ZNY A;  3IAS 9;  3NBP B;  4WYL A;  1RTJ A;  2DY1 A;  3GYG A;  3KLI B;  1R6Y A;  4P6Q A;  3VVU A;  1HHS A;  5A8K A;  5IXU A;  2VQF F;  1IBM J;  2DPI A;  1RI7 A;  4ZVR B;  4A8F A;  3X1L B;  4K5S A;  1X60 A;  5HRO B;  2QEX S;  4MAK A;  2E7V A;  4OV6 A;  2RIL A;  3DRR B;  1R8H A;  1SIW B;  1HQ2 A;  3KLH A;  4QYZ K;  3DN9 A;  1R8P A;  2HLT A;  2OTL S;  1PBA A;  2PMW A;  1H73 A;  2JSX A;  3MM8 A;  2UVV A;  1QAX A;  2P8I A;  2VPW B;  7FDR A;  3DRY A;  3OHB A;  2MKH A;  4F26 A;  1U1M A;  1HNW J;  1V3Z A;  3MD3 A;  1IQT A;  4DR4 J;  3FFI A;  4PXE A;  2XHW A;  1AZS B;  4Q2L A;  4XAK A;  2BKP A;  1FRJ A;  4FF4 A;  2E9Z A;  3CD6 S;  3OVA A;  1IXK A;  2G2Y A;  4FNI A;  1PJ6 A;  5CZX A;  2PII A;  2HZV A;  1S9G A;  2UV8 A;  1WSV A;  3AJD A;  1FRX A;  3GFH A;  3AXM A;  4LRA A;  4RWX A;  1KQK A;  3UE2 A;  4RNN A;  2R2R A;  1YJV A;  3FCW A;  4OIX A;  3CMQ A;  1F9E B;  1BQN A;  1F60 B;  2H54 B;  2MYF A;  1NCL A;  1N0U A;  2PEH A;  4I1T A;  3BH6 B;  4OHV A;  2V2K A;  4KKO A;  3Q23 A;  3VAK A;  3O2I A;  3UNY A;  3R5D A;  4KT0 C;  1KLN A;  4QIG A;  3PRV A;  1J5E F;  4XDC A;  3AT1 B;  4J5O A;  4HI2 A;  1Q8I A;  3RU0 A;  4JI7 F;  3ISZ A;  1JX4 A;  4PXB A;  5D4P A;  2JVO A;  2R8J A;  2HWH A;  2G9O A;  2V8P A;  5JVH Q;  3BDP A;  4JV5 J;  2LQ8 A;  4LR8 A;  2DB1 A;  4RR5 A;  2E1R A;  2W9C B;  1RZM A;  4P52 A;  2YNI B;  3OR1 B;  4RLE A;  5JXS A;  1MSW D;  2AZ3 A;  1SH3 A;  3G9C A;  3RRH A;  1Z2Z A;  5B0C A;  2MXY A;  4Q43 A;  1U48 A;  2I1R A;  1NDK A;  4KGK A;  5K20 B;  3WBZ A;  2M70 A;  1OQ3 A;  1TL1 B;  2ZOG A;  1NSP A;  1KVI A;  1LWX A;  3I0R A;  2XYH B;  3POT B;  4I2Q A;  3FUY A;  2GAG C;  4YP3 A;  3BQ0 A;  4X64 J;  1C1B B;  2F8H A;  4NRT A;  3HF5 A;  4ED1 A;  1IWG A;  3HM9 A;  3QZ7 A;  5E3C A;  3CC7 S;  2CJX B;  5ETN A;  1U4B A;  3BBC A;  2DD8 S;  1ITP A;  2JRS A;  1VRQ C;  1YKW A;  2OMO A;  4ZLJ A;  4JI8 F;  4N76 A;  3TQE A;  3E2E A;  2G2Z A;  4PYD A;  3QYY A;  3UDE A;  5KG6 A;  3QWU A;  5I3P A;  3VGT A;  3M8R A;  3SCL E;  3A1Y G;  1KQG B;  1VRU A;  2D74 B;  1T9X A;  2DO4 A;  2BRL A;  1FRM A;  1DQ8 A;  2LKZ A;  2Z2M A;  1VRT A;  3E51 A;  3QIP A;  5LL6 d;  2CAD A;  4CLZ A;  1IN0 A;  2IMW P;  3CE8 A;  3IGV A;  4JV5 F;  2DKO B;  3WIV A;  1RUS A;  3EVO A;  3MTJ A;  4OI0 A;  1TFY A;  1X4B A;  1F2G A;  4M5G A;  1ZET A;  2IBO A;  4LMZ A;  1Q53 A;  4G1Q B;  3GIL A;  2CQC A;  2BJ3 A;  2ZE2 A;  3JAM U;  3H4D A;  4FP9 A;  4OZN A;  4LSZ B;  3FVY A;  4NLO A;  1ZTW A;  4LFC J;  4G1I A;  2E7X A;  3Q8V A;  4KBI A;  3M2U A;  1KR4 A;  2OLW A;  3JQK A;  3OFF A;  5EX0 A;  3T5H A;  3O44 A;  3EGW B;  5KG3 A;  3J81 j;  4HT5 A;  4USM A;  2RVJ A;  3M7V A;  3TA0 A;  4RUC A;  3SFG A;  2B9E A;  2EFO A;  5IC4 B;  2H48 B;  2MKJ A;  4DQP A;  2Y0B B;  4USH A;  3QAT A;  4M94 A;  1UVJ A;  4LSN A;  4ZP8 A;  1RLD A;  4N5S A;  1BY9 A;  4OV1 A;  4F3O A;  4O3R A;  1WI8 A;  4DUY F;  3BR8 A;  4RL1 A;  1K0T A;  4DR2 F;  2P5V A;  4ILR A;  2Y9H A;  4AL7 A;  1S6U A;  3KJF B;  4JV0 A;  5H9F J;  4LSL B;  2C22 A;  3V81 A;  1S72 S;  3R8Y A;  4EWT A;  5IT9 U;  4B3T F;  2DBB A;  2RQK A;  1LWF A;  2LQJ A;  3DM2 A;  1LW0 A;  3M8Z A;  4CLF A;  3CC4 S;  1Y11 A;  1T94 A;  2AT1 B;  2GIR A;  1GT8 A;  2FTR A;  2OFG X;  2OPS A;  4M5H A;  3ZFV A;  4ZCM A;  1X4A A;  2EXU A;  4QWD A;  4DI6 A;  2CWK A;  3BB5 A;  3ELH A;  4O3Q A;  4K4Y A;  1Q7Y T;  1VQ9 S;  1QSY A;  1BXN A;  4F2R A;  1LNQ A;  3HSZ A;  1GXT A;  2N82 B;  2QMU B;  4KRW A;  1G4C A;  2H3E B;  4ZIW A;  1WC1 A;  2F9J A;  3NCR A;  4CI0 B;  3OHA A;  1RT2 A;  4OHY A;  3EWG A;  1J5E J;  3W3S A;  5EDW A;  3V5R A;  4DR7 J;  2YQ3 A;  4MKB A;  3CME S;  1RWM B;  2GGP B;  1NND A;  1XJW B;  2F9D A;  2Z2Z A;  3MUM P;  3RYL A;  5C25 A;  4QW9 A;  1X4H A;  2VJV A;  2NZ4 A;  2E5L J;  1U6Z A;  1V9O A;  2XTJ P;  1T05 B;  5C2G A;  1AZS A;  1IR0 A;  2FIU A;  1OQ6 A;  1JKH A;  1SQG A;  2YQ1 A;  4E8U A;  5D3G B;  3KOA A;  3WHI A;  3WZ0 A;  4RUH A;  3HVR A;  2IM3 A;  4ZN3 A;  2VFT A;  2GQ2 A;  3O1L A;  3SFU A;  1SCJ B;  1PC4 A;  2ZJP Q;  1FF2 A;  3CJ3 A;  2IY5 B;  4H4O A;  5LSR A;  2HPU A;  2R7S A;  1KOH A;  2J5A A;  2KVI A;  4ZHR A;  3MDF A;  3PAC A;  5D0G A;  4Q44 A;  3G6E S;  2LYV A;  2QL5 B;  4FS1 A;  3PX6 A;  5ETR A;  2J8A A;  2MQL A;  3C3L A;  2MQO A;  3HKW A;  3IS9 A;  1EIY B;  2FJV A;  1UFK A;  4RNH A;  4A8Y A;  4P74 A;  1L3K A;  1WAC A;  3PX0 A;  1T95 A;  3HHL B;  4ZVG A;  1CQN A;  4DUZ F;  5L38 A;  3QZ8 A;  3PG9 A;  4O3S A;  2HVE A;  2RJZ A;  4G6V B;  4KO0 A;  5F8H A;  2DGT A;  2YX4 A;  5HJY A;  2F5G A;  4LFB J;  4O3P A;  2FJD B;  3GWC A;  4RO0 A;  2QG9 B;  1DAR A;  2XMA A;  2V0N A;  1HR0 J;  4PQU B;  1RT4 A;  5KFN A;  1Q8B A;  2KXF A;  1OO0 B;  3MF5 A;  4L72 B;  4OYP A;  3A3O B;  3D2W A;  1SXL A;  3I0R B;  2LP4 A;  2R7R A;  1ZH5 A;  3UR0 A;  1SC1 B;  1EET A;  1RA6 A;  2MDA A;  1TAU A;  3HHN B;  1Q4R A;  2RT3 A;  2DRD A;  3A12 A;  2KFZ A;  2E66 A;  3DI6 A;  1VJQ A;  2HHQ A;  2DNK A;  2ZH1 A;  1KN6 A;  4IDK A;  2XNR A;  1ACM B;  4YUD A;  2VJU A;  1UVM A;  1Y5I B;  1FJG J;  2HQG A;  4JB8 B;  2OH2 A;  2BJ9 A;  3C66 A;  1IM6 A;  3PDN A;  1YDL A;  4H4M B;  8AT1 B;  4C8O A;  3N01 A;  2FVP A;  2YKN B;  4DS4 A;  3PYE A;  5HQL A;  4YDX A;  2XS5 A;  2H4W B;  1U47 A;  4B17 A;  1S7I A;  3D1Q A;  4DUZ J;  4DV5 F;  4L76 A;  3AFG A;  4Y2C A;  3SDE A;  4OYM A;  3V4I B;  3FGV A;  3GCX P;  1U45 A;  5E41 A;  3NGK A;  3V2U C;  1OY6 A;  5K14 A;  1AUS L;  3EM1 A;  3QLH B;  2JEF A;  1GQE A;  2J7K A;  2CJA A;  2EFQ A;  2P6S A;  4KFB A;  4IQM A;  2QLF B;  1Y3J A;  2R7O A;  2CJK A;  2NCK L;  4OYO A;  3FBC A;  2MY8 A;  2ZEJ A;  5KG7 A;  3BSO A;  3ULH A;  3TQ1 A;  2ZNZ A;  1NEE A;  4P75 A;  1I3O B;  5J2Q A;  4DSI A;  1FNX H;  2JVR A;  2CQP A;  8ATC B;  3SZ2 A;  1RU1 A;  1NK6 A;  5C42 A;  1A7G E;  2L41 A;  3K59 A;  4NX9 A;  1B0V A;  2AGP A;  1YJW S;  2ILZ A;  4QR1 A;  5HAN A;  5GAE U;  3OFE A;  3BSN A;  4R0J A;  4PCQ A;  4DMZ A;  1XMQ F;  5L1I A;  2CRL A;  1RBL A;  3W65 A;  1IUJ A;  1HMV B;  5DRK A;  1R43 A;  3MMB B;  4C0O C;  4WBF A;  2KXH A;  1N5T A;  1C2P A;  3BSA A;  3TNV A;  2FJE B;  1WG1 A;  4CYU B;  3GTY X;  2XSJ B;  4XPC A;  3SQG B;  4CO2 A;  1J5O B;  2MZQ A;  3M8Q B;  3P5B P;  3JQM A;  4LIW A;  4TNO A;  2ASL A;  4LF5 J;  1WHW A;  1JIH A;  1KDN A;  1SV5 A;  1S1W A;  3QT6 A;  2V34 A;  4WFN Q;  3IFE A;  1T7P A;  3A13 A;  1VQ7 S;  4J9U E;  3HHE A;  3UDL A;  3D5M A;  2WAQ D;  2L9D A;  4KHP F;  2BR0 A;  1KEK A;  4LF7 J;  2RD5 C;  4C9D A;  1FD8 A;  2DEJ A;  1AUD A;  4USJ C;  2DIS A;  5LMU F;  3MAQ A;  2C28 A;  1RLC L;  1HL6 A;  3TZX A;  3UVJ B;  3RR7 A;  2KT5 A;  3M8W A;  4JI4 J;  1B64 A;  1HR0 F;  4USW A;  1RIS A;  3H2V E;  4WKY A;  3AQO A;  3CJ8 A;  1GX5 A;  4HLB A;  1FFG B;  1I51 B;  4HTI A;  3KHG A;  4CH7 A;  3QRP A;  1WUU A;  1I94 J;  1RAB B;  1HYS B;  1GH8 A;  1S5Z A;  2WVF A;  4AYB D;  2CA9 A;  3EVW A;  3GB0 A;  3LH2 S;  3RBZ A;  4YDD B;  3KLF A;  4B9N A;  1WTF A;  3DLE B;  1I5O B;  3L95 X;  5FD1 A;  5I3U B;  3IS9 B;  5GMK a;  4PZV A;  1NH8 A;  2RB7 A;  2C3Y A;  1ELO A;  1OY9 A;  3HFV A;  3Q8Y A;  3HJF A;  3M6X A;  1MML A;  3OL6 A;  1HHT P;  1L3T A;  1IKY B;  2RHS B;  4KO0 B;  3KFW X;  1Q5V A;  3NKY A;  1UWB A;  2H51 B;  3AB2 B;  4ZA1 A;  1S1X B;  3WC0 A;  4CLS A;  5HQ8 A;  1KVJ A;  4DN0 A;  1F3F A;  4U9R A;  3SCI E;  3W9H A;  1RHU B;  3LPE A;  4LF8 F;  1S99 A;  2RKI B;  2GIQ A;  4DR4 F;  4BC9 A;  3HHD A;  3J80 U;  3HT0 A;  3WQP A;  3TOQ A;  1U1P A;  3ZTQ A;  3ITH A;  2DNY A;  2GQQ A;  3VTI A;  4NLP A;  5HBM A;  4DG1 A;  2ERR A;  1KWM A;  2BQU A;  1U2F A;  2ZD1 B;  1IBL F;  5ETT A;  5CD4 H;  3LA0 A;  5GAD I;  3RB4 A;  3LO3 A;  1TK8 A;  1R8A A;  1UET A;  2VU5 A;  3P4U B;  1Z4U A;  2K8G A;  2WW4 A;  3HSJ A;  4Q2M A;  3DGP A;  2RF2 B;  3ZTP A;  4DV3 F;  3PO5 A;  4W90 B;  1HD0 A;  5IFM A;  4UQT A;  1RTD B;  5J1P A;  3J7Y I;  4OYI A;  2RQ4 A;  2A0F B;  2M0G B;  2V4Q A;  2HMI A;  1GTH A;  2HND A;  1XNQ J;  4B3O A;  5ETM A;  4OJG A;  2VG5 A;  4FXW A;  2V4R A;  1LWE B;  2IMO A;  1H0H B;  2KRB A;  3IO1 A;  4DL4 A;  4I4B A;  2ZWP A;  3M8P B;  2MZJ A;  3TUP A;  4G1Q A;  3ENV A;  1M5V C;  4C4W A;  1BC6 A;  2XWY A;  2FHK A;  2ZBR A;  4H4K A;  5EWE A;  2HHH J;  3TUI C;  4OZ2 A;  3PJX A;  3BJY A;  3C8Y A;  4QU6 A;  2VFS A;  4N47 A;  3TO8 A;  5L1J A;  1EKS A;  4F4W A;  3W60 A;  4LF2 A;  4NYZ A;  1PSD A;  1RP5 A;  1H2U X;  2KXN B;  3CO9 A;  5B0E A;  3PW7 A;  1S1T B;  3M9M B;  2L3M A;  3EXY A;  2BM0 A;  1MG7 A;  1UPM B;  1HWI A;  3KKF A;  3K5N A;  5C42 B;  1DTT B;  3HI9 A;  5KFG A;  3DRX A;  2HKE A;  3VVT A;  1WHX A;  2XLI A;  3P49 B;  4OJ3 A;  3CD7 A;  4RW9 B;  4HAC A;  5IZH A;  1U8W A;  4DV3 J;  3MOZ A;  3MUR P;  2PFD A;  4NI2 A;  1YIJ S;  4P7T A;  1UVL A;  3IBC B;  3B82 A;  2NLW A;  5K9F A;  2BRK A;  1CUL A;  1FTC A;  1T9U A;  1XR6 A;  4YR3 A;  4EFA C;  1PYS B;  4IO9 Q;  4CYU A;  2B7C B;  2IVM A;  2VIC A;  4OYZ A;  1YHQ S;  1GMU A;  5KFP A;  4CO3 A;  4DL6 A;  3TRG A;  2CQD A;  4WWS A;  1N5V A;  4ETX A;  3G8Q A;  3GMG A;  1DZ5 A;  3LAL A;  4IRD A;  2VKZ G;  2V4J A;  5A8W B;  2ATC B;  4WZQ A;  2FVQ A;  1R8C A;  4DV2 J;  5CYM A;  2XY6 A;  2WTF A;  3C2P A;  1S6O A;  2YX1 A;  3R1L A;  1YWX A;  4Y00 A;  5IS2 A;  1HNV A;  2Z4P A;  5KFQ A;  3OD2 A;  4OLO A;  2RE1 A;  5KFT A;  3MED A;  2GGP A;  1ZA1 B;  1U02 A;  2ROP A;  4P2X A;  1HBO B;  1RK8 A;  3RG6 A;  2RSQ A;  3OTO F;  1QTM A;  2XS2 A;  2CPF A;  3IR7 B;  1WHY A;  2N4C A;  3CIM A;  4B9V A;  3NL0 A;  2WSE C;  2BQR A;  2N3O A;  3MM5 B;  4RW8 A;  2JHE A;  2W2O P;  4UZC A;  2KFY A;  3KNA A;  2W7A A;  3KUG A;  2HGL A;  4HYK A;  4QPT A;  4DXL A;  3R1H A;  2J6U A;  3NMA A;  2W2P P;  4J90 A;  4P2F A;  2NPF A;  2J9D A;  1FX4 A;  1TKZ A;  1U6F A;  2QLJ B;  1RBA A;  1NH7 A;  2HS4 A;  4H4O B;  3ENA A;  3EXC X;  4YB6 A;  3FBF A;  3KMS A;  3KHL A;  4JI4 F;  5KOW A;  2V9W A;  3T6J A;  2FB0 A;  3NAH A;  2BZ2 A;  1IM4 A;  5KT7 A;  2A1B A;  4CO5 A;  3C14 A;  3DCA A;  4I64 A;  1DJ0 A;  3ZZO A;  2HVZ A;  4ZIV A;  3MEE A;  4JI8 J;  3M6U A;  2ZDO A;  4ZPT R;  2K1R B;  1F1B B;  4PG7 A;  2R8K A;  4ELV A;  5FLX U;  2V67 A;  1YQH A;  5DLF A;  1RHK B;  1T9T A;  1IKY A;  2K2P A;  2Q6C A;  3SEO A;  2B51 A;  5LXR A;  5HVH A;  4FXD A;  3GV8 B;  4WPA A;  1JLC B;  4KQZ A;  1YX2 A;  1A9N B;  3ETO A;  1PYT A;  3BZQ A;  4ZJL A;  4CNY A;  1C1C A;  3DKD A;  1YRU A;  1JLG A;  4NZ6 A;  4X4T A;  3NLC A;  1FI4 A;  5LM7 E;  4IR9 A;  3RR8 A;  2P9E A;  4J37 A;  1U1Q A;  1HNZ F;  4Z37 A;  1GMV A;  1M1H A;  1NUE A;  2LU1 A;  4J9V A;  4C3M A;  1NK8 A;  5HBM B;  2XBP A;  1Q95 G;  5J1E A;  3UD4 P;  1IBM F;  2IJR A;  2HYI B;  2XUL A;  2VA2 A;  2VPY B;  4A47 A;  1H2V Z;  4EUV A;  1X5P A;  3DRS A;  1EP4 B;  1Y00 A;  3MEK A;  3NBP A;  1VOM A;  5ADZ A;  2UU9 J;  2MZ1 A;  1P27 B;  3H25 A;  2ZHA A;  3DGP B;  5KFL A;  4UOH A;  3TZZ A;  4RW6 A;  4TY8 A;  2BAN A;  3CCV S;  4RU2 A;  1XNQ F;  2L9N A;  2MKK A;  3UCG A;  3K2Y A;  4UZB A;  1I6J A;  1ZPW X;  4LRB A;  5K5M A;  1BGX T;  5T41 A;  3DRR A;  1R8B A;  2V9K A;  4DPY A;  5J2N A;  2BJ7 A;  4KR0 B;  2PE8 A;  4NE9 C;  4EU0 A;  1EX8 A;  2UXB J;  2H4Y B;  2K7J A;  2YNH A;  3QO9 B;  3M05 A;  1QTN B;  3SIP B;  5B0A A;  5FLX Y;  2BJD A;  2KM8 C;  2MSS A;  5F9L A;  1NDP A;  1N36 J;  4KTQ A;  2LU2 A;  1SH2 A;  2LEA A;  2LEB A;  2QJ3 A;  2C2Z B;  3AH6 A;  1LWC B;  1M5O C;  1M1K T;  1VQK S;  2CWX A;  2GMJ A;  2PSZ A;  4ZVS B;  1N5S A;  3N6N A;  4J9S A;  3DU5 A;  3W9I A;  5J2Q B;  4X4U A;  2EI5 A;  2MQN A;  3N28 A;  5GME A;  1LK7 A;  2H9Z A;  2V2Z A;  1CJK A;  2JJ4 D;  1WEL A;  3HHL D;  4FBT A;  1WHV A;  2DHS A;  3ZTS A;  1X9W A;  3TR5 A;  3G6V A;  4ED2 A;  3N5B A;  4DL2 A;  1FNM A;  1HNX J;  5CYQ B;  4F4A A;  2HS3 A;  2QSF A;  3RW6 A;  4ID5 B;  4Y2K A;  4URG A;  5LT5 A;  1EB0 A;  3CF5 Q;  1CS4 A;  1DUR A;  4DZD A;  5AE2 A;  3IWX A;  2HWI A;  1LEO A;  2AWZ A;  5KT3 A;  4M5K A;  4UUX A;  1TKD A;  2X3G A;  1VQ5 S;  4JV2 A;  4V19 J;  2MJN A;  3MM7 B;  1AW0 A;  3CXC R;  2EFN A;  4I69 A;  1Q82 T;  5F8N A;  2ATL A;  1RT3 A;  2Y0S D;  2YNG A;  3DNC A;  4LRE A;  2RRN A;  5KFW A;  3B78 A;  4RUA A;  4TQR A;  5J2M A;  4HTJ A;  4AQY J;  1UFW A;  2AV5 A;  4KY3 A;  1UMJ A;  1P9Y A;  1F6T A;  1U25 A;  3D0G E;  1K44 A;  2GA7 A;  3V6K A;  2NQP A;  3MOJ B;  4WP3 A;  3Q8S B;  1VBY A;  4KPY A;  2YBV A;  4X66 F;  1O8B A;  2IPO B;  3EGV A;  4K4X A;  2CNL B;  3AQP A;  2HW3 A;  1ICE B;  4C6A A;  4HDH A;  3RBX A;  4DL3 A;  3RB6 A;  2HHX A;  1DFD A;  1S6P A;  4NXN J;  2C3M A;  4TU9 A;  2WSC C;  3TJA A;  4CT8 A;  3T5L A;  3PEJ A;  1FJG F;  3OXF A;  1FJE B;  4JI0 F;  2QTW A;  2VD3 A;  3M2R B;  2VIH A;  4Z2X A;  4FPR A;  4MK7 A;  4X62 J;  2DYA A;  5L1K A;  3PV8 A;  2HQ3 A;  4NLW A;  4KAI A;  4O4G A;  3K5M A;  2W2N P;  1MRO B;  4DSF A;  2Q1L A;  2OEL A;  1XR7 A;  4QR2 A;  1EAR A;  2HHH F;  2AYG A;  1MMD A;  3EDR B;  1YRX A;  3CIZ A;  3EZO A;  5DDQ C;  2DCU B;  4WF9 Q;  4A46 A;  2QL9 B;  2BUN A;  3M6V A;  1S9F A;  2UUC F;  1VC5 A;  2P9C A;  3V4I A;  3DLH A;  3BQ2 A;  3NMR A;  3IM8 A;  1KQS R;  3A8I A;  5HP1 A;  4LR9 A;  1WOR A;  2YX7 A;  5DG9 A;  4P7V A;  1L3S A;  4MKA A;  1NBE B;  4WU2 A;  1JXV A;  1U1N A;  2U2F A;  2AX1 A;  5D6G A;  4J9R A;  2QMX A;  2LXF A;  3TP2 A;  2AW0 A;  3LQV A;  2UXB F;  2YNF A;  3HVW A;  4XTT A;  1RT1 B;  2AEM A;  2LQ9 A;  1NDL A;  4FVM A;  4GO5 X;  4BCA A;  1XNR F;  3R2D J;  3M8S A;  3T1H J;  3ITH B;  4DOZ A;  1TP7 A;  4DEZ A;  3Q24 A;  3N79 A;  4I7F B;  4DG1 B;  1T8E A;  2F8E X;  2BOA A;  3FDS A;  3QBC A;  5J1N A;  3P96 A;  3TEG A;  5HL7 Q;  1FE0 A;  3LP2 B;  1YG0 A;  3SYZ A;  2NXE A;  5A8R B;  2VUG A;  1HMV A;  3VQS A;  4JI3 J;  4DLG A;  4LF4 F;  1H72 C;  2CNO B;  1PKU A;  1FDN A;  2M9K A;  2Q6B A;  3BGR A;  1N34 F;  1SKS A;  2CPE A;  2SXL A;  2FZG B;  4RW6 B;  4M5I A;  4P73 A;  4XDD A;  1D0E A;  3MI7 X;  4KH0 B;  3VF0 B;  2W24 A;  2Z57 B;  1RAD B;  2QIF A;  4AE5 A;  2C42 A;  1YBT A;  5H1S V;  3C46 A;  3Q22 A;  4OHW A;  2EPI A;  1PGZ A;  2BE2 A;  1HQE A;  3BF4 A;  2VG6 A;  2NUH A;  2KT3 A;  1XMO F;  3U7J A;  1OWX A;  1KRP A;  1HPZ B;  3GFY A;  4KGX B;  1QDU B;  3BS9 A;  4N8N A;  2KO1 A;  3X3U A;  3KYL A;  3LP1 A;  2VOD A;  3NS5 A;  1EAY C;  2L08 A;  1UEK A;  2HSE B;  4IYQ A;  5DJB A;  5D3G A;  1K73 T;  3I5B A;  2PI4 A;  2OPR A;  3EUN A;  3IG1 B;  4ZMM A;  3KK2 B;  1MW7 A;  2F3J A;  1U26 A;  1CJK B;  1KP6 A;  5M2P A;  2WCX A;  2PEB A;  1PG5 B;  6FD1 A;  1CQM A;  2Y3Y A;  4KB7 A;  2OP5 A;  2HQF A;  3AB4 B;  4HHH A;  1F5B A;  4TLR A;  1C4A A;  2QL7 B;  3VZI A;  7AT1 B;  1KHV A;  3FMW A;  1RAO A;  3GIK A;  1MU2 B;  2DY9 A;  5BXI A;  2YKO A;  4TKT A;  3PM9 A;  1UKU A;  4NLV A;  5A2Q Y;  1WC4 A;  5L1L A;  3CCQ S;  1SB6 A;  3CUL A;  2RDD A;  1B7F A;  4F0H A;  3JXO A;  2JEG A;  5DG8 A;  4YB1 P;  3UCZ P;  3UDV A;  3OJU A;  2KI2 A;  2FY1 A;  4X4O A;  2EKN A;  5ETO A;  1E6Y B;  2B5J B;  1NHU A;  2MKC A;  2YWF A;  2ZJQ Q;  1QY7 A;  1RWN B;  3T9N A;  1S76 D;  1B0T A;  3D4J A;  1U1L A;  2B6A A;  4NCG A;  4NZ0 A;  2ZDP A;  3W8P A;  4AND A;  3K8V A;  1ZM2 A;  2XLJ A;  1R0A B;  5H9F K;  3GJS B;  2WOM A;  1HBO A;  4E2F B;  1SC4 B;  2FVR A;  1ARO P;  1Q8L A;  4P2M A;  4JI5 J;  2HHV A;  2E9T A;  3KK3 B;  4I0W A;  2OIH A;  3DYA A;  4WZM A;  1HWK A;  3UR3 C;  4YME A;  4KSE B;  2W8K A;  2ZZM A;  3R5J B;  4NXM F;  3KJV A;  4B3M J;  1HKA A;  1FWP A;  4ECT A;  2M5Y A;  2L48 A;  3L4B C;  2B43 A;  1WEY A;  4GVB B;  4ICL A;  1C0U B;  4F36 A;  4LFC F;  1X5O A;  2ZBC A;  3HUL A;  3OL7 A;  4K4T A;  2BBE A;  3H5S A;  1TMM A;  1FWK A;  2ROE A;  2EFV A;  3I9Z A;  5HI7 A;  3RAX A;  2DR9 A;  1YI2 S;  4X65 J;  2BAB A;  2V8V A;  3GG1 A;  4J7C A;  4NLS A;  4LFA J;  3R2C J;  4OJH A;  1VK8 A;  2DGV A;  4ZP9 A;  1LWE A;  3DLJ A;  1KFD A;  4B9L A;  2VPZ B;  4TQS A;  1H6K X;  2R2S A;  3EX7 B;  4ZVH A;  3OW2 R;  1GEH A;  3T1Y J;  4GKJ J;  1AFI A;  3LTO A;  2LEP A;  1CPZ A;  2YKQ A;  2ZH3 A;  4J9M A;  1QM9 A;  1JLC A;  1FRI A;  3DHW C;  2P6T A;  2DIU A;  2QYG A;  4RW4 B;  3NAI A;  2J0S D;  2DNR A;  3DOL A;  4JBC A;  5D0E A;  2QA1 A;  4JYA J;  4U7U D;  5L39 A;  1HD1 A;  4DPW A;  2Z0G A;  2K3I A;  2BA9 A;  1PAE X;  4OX8 A;  2QE5 A;  4AUK A;  1FHT A;  4H54 A;  2CZV C;  1IJE B;  1RTZ A;  3MR6 A;  1IR1 A;  2XGP A;  3RTV A;  1S0O A;  1FVS A;  4PRF A;  2LXU A;  4FYY B;  3LW5 C;  4RW9 A;  3EPG A;  2LQ5 A;  1IKX B;  1WDD A;  2YY3 A;  2RRB A;  3FMB A;  1HBM B;  2FLL A;  4UTG A;  2Q3P A;  3RBD A;  2YPY A;  4TU7 A;  1CUL B;  4NOH A;  2ZVS A;  2DH7 A;  3GR0 A;  3KK1 B;  2ASJ A;  2V94 A;  3DU6 A;  1MWY A;  3SQG A;  4ED6 A;  4X4S A;  5D77 A;  4Z7C A;  4GKK J;  3BGR B;  2QT7 A;  1S77 D;  5D15 A;  3C6T B;  4ZVT B;  2HNY A;  2E5L F;  3CJQ A;  5AE1 A;  2KTQ A;  1FER A;  2OEM A;  4NCB A;  2W01 A;  5F8M A;  4DX8 H;  1X5T A;  1K1S A;  1S1W B;  1IKW B;  3T1Y F;  3H59 A;  1XMO J;  2B7B B;  3CB4 A;  5LXY A;  5B0G A;  3B6B A;  3W64 A;  1MNE A;  5GVQ A;  4FBU A;  3C16 B;  3TJ9 A;  3G87 A;  4ZLP A;  3WX4 A;  3BO3 A;  4AQY F;  1VIX A;  2J0Q D;  4ELT A;  4A8X A;  2GJ2 A;  2AX0 A;  2KT2 A;  4DR3 J; 
#chains in the Genus database with same CATH homology
 1IBL J;  4OX9 J;  2KL8 A;  4X66 J;  4DV6 J;  4RJV A;  4YY3 J;  4DR3 J;  4DR6 J;  2MTL A;  3IMQ J;  1HNX J;  2VQE J;  2UUB J;  4DV3 J;  4DV1 J;  4DV0 J;  4DV7 J;  5IT9 U;  4DR4 J;  4JI0 J;  2MEW A;  4NXN J;  3J81 U;  1IBM J;  4LF5 J;  2F4V J;  4DV2 J;  4AQY J;  4JI1 J;  4JI6 J;  3J7A N;  4KY3 A;  3OTO J;  4KHP J;  1J5E J;  4DR7 J;  5LMN J;  2KVQ E;  4DV4 J;  4B3S J;  4KYZ A;  4DUY J;  1HNW J;  4LF7 J;  2MQ8 A;  4JI5 J;  2E5L J;  4NEY A;  4DV5 J;  2UXD J;  4K0K J;  4LF9 J;  4JI4 J;  4JI2 J;  4X62 J;  4B3M J;  1XMQ J;  1XNR J;  4DR5 J;  2UUC J;  1FJG J;  3D3B J;  1I94 J;  4NXM J;  4B3R J;  4X65 J;  3R2C J;  4LFA J;  1N34 J;  1IBK J;  4JI8 J;  3T1Y J;  4JV5 J;  4GKJ J;  5FLX U;  5AJ3 J;  5A2Q U;  4NEZ A;  4LF6 J;  4LFB J;  4JYA J;  1HR0 J;  4YHH J;  4B3T J;  1N32 J;  4LF8 J;  3D3C J;  5LMU J;  3R2D J;  5LM7 E;  3J80 U;  3T1H J;  4LF4 J;  4X64 J;  2VQF J;  5IWA J;  2UXC J;  1HNZ J;  4JI3 J;  4JI7 J;  4PWW A;  2UU9 J;  4V1A k;  4GKK J;  5BR8 J;  4HHU A;  4DR2 J;  4DUZ J;  2UUA J;  2ZM6 J;  1XMO J;  1XNQ J;  2UXB J;  3W1Y C;  1N36 J;  3JAM U;  4DR1 J;  2HHH J;  4LFC J;  1N33 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...