5LMNJ

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5lmnJ00
4YY3J 4KYZA 5A2QU 1N36J 2UUAJ 4PWWA 4LF6J 2MQ8A 4NEYA 4V1Ak 4DR6J 4DV6J 4JI8J 4KY3A 4AQYJ 2VQEJ 4OX9J 3R2CJ 1HNXJ 4RJVA 4JI1J 1XMQJ 4LFCJ 4DR4J 2MEWA 4GKJJ 2UUBJ 2VQFJ 4B3SJ 4JI3J 5FLXU 2ZM6J 2UUCJ 5IWAJ 4LF5J 4JI5J 3J7AN 1XNQJ 2UU9J 4DV1J 1N33J 2KVQE 5IT9U 4JI0J 5LMNJ 4NXNJ 2MTLA 4YHHJ 4DV3J 4B3RJ 1XMOJ 3T1YJ 2HHHJ 4DUZJ 4LF4J 4LF7J 4DR5J 1IBKJ 4X64J 1I94J 3R2DJ 4JI6J 5LMUJ 4KHPJ 3OTOJ 1N34J 1IBLJ 5AJ3J 2UXCJ 4X62J 4HHUA 4DV7J 2KL8A 4NEZA 4B3MJ 4LFBJ 4JV5J 4DUYJ 2E5LJ 4K0KJ 1FJGJ 4DV0J 4JYAJ 1J5EJ 4GKKJ 2UXBJ 1XNRJ 4X65J 4DR7J 3W1YC 4JI2J 3D3CJ 4LF8J 2F4VJ 3JAMU 4B3TJ 4JI4J 1HNWJ 1HNZJ 3J80U 5LM7E 2UXDJ 3D3BJ 4NXMJ 1IBMJ 4X66J 3IMQJ 4DR2J 1N32J 4DV4J 1HR0J 3T1HJ 4JI7J 4DV5J 3J81U 4DR3J 4LFAJ 4LF9J 4DR1J 5BR8J 4DV2J
chains in the Genus database with same CATH superfamily
2ACMA 3DRRB 3GYXB 3SSRA 3TJ8A 3QGHA 1YKWA 1ZM2A 2AZ1A 4A8SA 1A6LA 2J9DE 2BJEA 3H5YA 2OTLS 2UUAJ 2D74B 5M2RA 3FBFA 4PXCA 1EHWA 4TU9A 4JOUA 5LXYA 4DSLA 1PSDA 4CLZA 4CH7A 4L3KA 1Z4UA 3BDEA 4E2FB 4M5MA 5LL6d 2DGQA 5JVGQ 4WXOA 5K14B 3BGRB 5KOWA 3T5LA 2EFGA 3FCVA 3GJSB 1EKRA 1LXJA 3CEDA 3I96A 2QL9B 3L7OA 4MIAA 4OMFG 1FNMA 4KHRA 2DNHA 2ZKUA 3QT8A 4P73A 4C0BA 5M2UA 1VHIA 4DL2A 2MEWA 1EKSA 2YTCA 4IO1A 2J0QD 1M5PC 4OZ5A 1FRHA 1TKTB 2B5JA 2VASA 2XC9A 1DTTA 2MHNA 1F5BA 2E7XA 2KJVA 2OLWA 4USKA 3WC0A 3P96A 2MXYA 1U8SA 2CWXA 3GSDA 3UN3A 3OJUA 3MXHP 1HD0A 2YPZA 2DEIA 3C6TA 1TKZB 2AZ3A 1RTZA 2V9WA 1HHTP 3M30B 4JI5J 3HK2A 4KGVB 3NS7B 4QU7A 4HTJA 2HGLA 3HZEA 4O3PA 2JEFA 1PBUA 1TMJA 1ZOTA 2H5IB 4ERDA 3QJLA 1FO1A 3UNYA 3QZ8A 1GQEA 4ID5B 1T9YA 3DHWC 1VOMA 5LMNJ 1RWUA 5ETOA 4F3MA 3RW7A 2A1BA 3G87A 3HM9A 3Q8QB 5AXLA 3BGOP 3GE9A 1YX2A 1MU2A 2KI2A 2VBYA 2B0GA 4IRKA 4DG1A 4DCPB 2ILYA 2OGUA 1QSLA 3A8KA 4GO5X 3LGHA 5GAEI 4LF7J 3KLIB 2XY5A 5DQIA 4LFCF 3GYGA 2RKIA 2JHEA 5F0WA 1FXLA 3EDQB 1TKXB 2CNNB 4WYLA 3Q2TC 1S0VA 2H1YA 4Y3CA 3JSRA 1KSPA 1LQ9A 3CJSA 3JTPA 1F3FA 2VPWB 3C6UB 3D7SB 4TXSA 1HWLA 3KOAA 2DR6A 4PQUB 2VC1A 2ZJPQ 4HHUA 4J9VA 3IWNC 1UVIA 1SIZA 2BANA 1TV6B 4ECVA 2YQ3A 3DDIA 2XY6A 1VBZA 4O4GB 1U7LA 2JL9A 5D0HA 3CWJA 1OY9A 1UVNA 2DNQA 5C42B 3H2UB 1FJGJ 1K9MT 4RUAA 2W9AA 4WZQA 2HIQA 3M6WA 4H4MB 5C25B 3QLHA 2LDYA 1B7YB 3UVJA 2XM3A 2DH8A 2BA9A 4CO5A 2RUSA 2DVIA 2ZZNA 2V67A 2R2UA 2P5VA 1HYSA 2DHAA 5D4NA 1R8CA 1N5YB 1YRTA 3ENAA 2LEPA 3EXYA 2NYIA 3KHRA 4DR7J 2V6AA 2ZFHA 2E44A 1N48A 4LF9F 3OSNA 2OPQB 1JLGA 1V6HA 2XO7A 1K47A 5I3UA 4U7UD 3GP9A 3CIZA 4OX8A 4GKKF 2ZHOA 3IS9A 1JMTA 2CQBA 4FYVB 4CLFA 2HQFA 3QBCA 3R5CA 3QGIA 3TEHB 1CQMA 3NAIA 3KJQB 4DPWA 4QJVA 5C24B 3TUZC 3RR8A 1HWUA 1TP7A 2DGUA 3M8WA 2B3TB 3MURP 5D3GA 2V9KA 2OTJS 3NP5A 4DR1J 1X5TA 3Q89A 1D9AA 1FTRA 1TKZA 2PA8D 2QMWA 2DXEA 4DV1F 2DPJA 2F9JA 4CLKA 2HQDA 2Z4PA 2FJVA 3D6MB 3MCMA 4H4OA 4PXBA 1RTHB 4MFBA 4I4BA 2KB2A 4USHA 4RNNA 2MQ8A 4C98A 2MGZA 4DLGA 1NLKL 4Q43A 3SCIE 3SQGA 3G6VA 3Q83A 3KHHA 2MLXA 4EO6A 4EBDA 4FBUA 4CP5A 4DV2F 1VI7A 1X7VA 1R8PA 1AW0A 3BB5A 2UUTA 1OYDA 4LSLB 1CC7A 3MM9B 2NZ4A 3MPUB 2EFOA 2KVIA 5KG0A 4ZLJA 4DMZA 1R8AA 5HQ8A 1AROP 1S1TA 3BV8A 1LW2B 4ZCLA 3OJSA 2IRXA 2OD6A 3UCGA 3FQLA 4ITSA 3OTDA 3B82A 1KQGB 4DPTA 2Z56B 1TKXA 1RAOA 4DPOA 2CJBA 3D4JA 4J9UE 2FHJD 1X4AA 2R2TA 1KS2A 1RAIB 2JH3A 2HK2A 1FK9A 2PGCA 4CLPA 4Y00A 1EAYC 2W2PP 2MLYA 1Y10A 2IM3A 4HLBA 3TA2A 1VS3A 3M8PB 4KHPF 1H74A 4I7FA 3T3FA 4X4UA 2DRAA 2XS7A 3TR5A 4HDHA 3W9HA 2AGQA 1IN0A 1ZA1B 2HKEA 2I2YA 3MD1A 3UDLA 4P7TA 1RB0A 1FFGB 1MN9A 1FRLA 2C2RA 4QCLA 1F5AA 4B3MF 3SCJE 4JP8A 4QPTA 4R8UA 1TFWA 3TOQA 4MH8A 3TVKA 3MM7B 1H72C 2DT9A 3P45B 1NDLA 4ZA1A 4QBUA 1VQPS 3N0VA 4KQZA 2XEXA 1VBYA 3MOJB 1BMQB 2G2ZA 2XMMA 5CCLA 2DRBA 1WC3A 1NO8A 1WHXA 2BABA 3DM2B 3ITHB 4FXDA 1N6QB 2WW8A 3L9ZA 1YTYA 2DGOA 3MCOA 3WZ0A 1X5OA 3QSYB 5BXIA 4XDCA 4K5SA 3J7A1 2LYVA 4C8YA 3H0PA 8RUCA 2GJIA 3C14A 2N3LA 2VA3A 3OTBA 4R0EA 4RNHA 4XAKA 4WKYA 4P2XA 1CJVA 4NRTA 4XDDA 4XPEA 1JKHB 3O8WA 2F65A 4ECQA 2XLJA 3JAMY 1C1BA 5A8KA 4DLEA 1FEEA 2WRMA 2AJ2A 3FC9A 2E5LJ 3MR7A 4OHZA 1VJWA 1LKZA 3OTEA 1QTMA 2ZC3A 3QIPB 1N36F 4NLQA 3QJJA 1VDHA 4PCQA 3CJ2A 2GQCA 2E9TA 1IR2A 3TQEA 5HQMA 1TKDA 2KT3A 4K4SA 4WKRA 1LEOA 4OZ3A 1OQ6A 3GWCA 4HEA9 1VQLS 2DY1A 1RTHA 4MFBB 4PG7A 4GC7A 4ZJLA 1UVJA 1HARA 1RHUB 3QFHA 2YNGA 2HQCA 5IQ6A 3EWGA 4F4KA 1QSSA 3V6JA 3G8SA 2WW4A 4OZ1A 5AXKA 2G4BA 2M0GB 1JXVA 1GMVA 3I9V9 4MIBA 1TL1A 3S6EA 3V6DB 3RRKA 2HAFA 3FGVA 3FZ2A 4CO4A 2W9BA 3G6XA 3BGRA 2QL5B 2HHWA 4DOZA 2BJ1A 4DPUA 3M9OB 2V8DA 3BKFA 4RW8A 1EJ7L 4DX8H 2VD3A 3KDNA 5E5NA 3VVUA 2ZH6A 3A12A 2IM0A 2RS8A 2D1CA 3LP1B 5KG4A 8ATCB 3DOLA 1SH2A 1XERA 3MR5A 2G1DA 4IO9Q 5DLFA 1FKOA 1LXNA 4OZLA 3M6XA 5IQQA 2KFYA 2PI4A 3FEZA 1HBNB 4KH0B 2FLNA 3DKDA 3UDVA 5DGBA 4I7FB 2OD4A 4BCAA 3DOKB 4F0KA 2A3JA 4LBHA 1FESA 1F1BB 4CCHA 2VL1A 3AY0A 3W65A 2VONA 3M30A 3HHEA 3JQJA 2BXJA 3ILJA 3M4XA 3CW2C 4HDGA 4K0KJ 1T95A 4L74A 4DCOB 2IRUA 3AH6A 3PJXA 2IRYA 3UDEA 4Y6IA 4Q44A 1GH8A 2B6AA 3KK2A 2AGPA 1K73T 1APSA 2PFFB 2HWIA 1SBRA 2VPYB 2XHCA 1QUPA 3OXGA 1ZETA 4Y65A 2BE2A 5FLXY 2W2QP 2ZEJA 4OYMA 2VB6A 5KFMA 5KFDA 2FUG9 1VGYA 3DRRA 1X4DA 2ZOGA 3MAAA 3PJ9A 4RBVA 3DYAA 1I3OB 2BRKA 2HMIB 4YY3F 5J2QA 1KEKA 2NPFA 5GAHU 3ISNC 4K4UA 1WORA 2WBMA 3NCRA 4OX7A 1SL0A 4EUVA 1DRZA 1JKHA 3N5FA 2BJ9A 5CD4H 3HHLC 3E01B 4ZN3A 2AYGA 4ZLLA 2X1BA 4AL5A 1REVB 4DV1J 3PJWA 1PAEX 1V9OA 2KVQE 3RB4A 4G1PA 2HGNA 3I32A 1V3SA 2C2KB 4NYZA 2G0JA 2QFJA 1G7CB 2G13A 3IGVA 4P72A 1IXKA 1YK9A 2A2CA 3O2IA 4QIWD 3MPDA 3UI3A 3MHYA 1TK5A 4N41A 3F41A 3HHLD 3OVBA 1HQEB 1WDTA 2HHHJ 5D0EA 1FEHA 3CJ4A 3HVTB 2NUUG 3GILA 4RKUC 3SDEB 2GHWA 4OZNA 3BKUA 2KZZA 4FF4A 4NLYA 4FPRA 3DOMA 4Y0FA 2Y8YA 1URRA 3EMTA 3R2DJ 4GKJF 2XCPA 1G2EA 5E3RA 3I5AA 3NGUA 1UWAA 3PYGA 1JNZB 1QM9A 1KHWA 1KFDA 2BBEA 5KFGA 2YWHA 2DH7A 1NZAA 2YKQA 3K5OA 2BV3A 1HI8A 3CO0P 1SIWB 4RWWA 3BBBA 3EPGA 3CCVS 1MW7A 3CSKA 2J8SA 2VC0A 1XN9A 5HMXA 1VQ4S 4ANEA 2BE9B 1FERA 4NLSA 4CTAB 4FF1A 2IM1A 4GVBB 4N47A 1VQOS 2QFIA 4QWAA 4DFJA 3T6BA 1B3TA 4NCAA 1A7GE 4RNMA 2JEGA 2V68A 3MMAA 5KFXA 2JZ5A 3VAJA 2VV5A 3IXQA 2M70A 2N7YA 2V63A 2R8KA 5CQGA 4KE5A 5J1EB 4OI1A 1JLQB 3GG0A 2M88A 2V2VA 2P9EA 4P71A 2VOOA 2BMBA 3AB4B 3GJRB 4ELUA 1HNZJ 1HI0P 4USIA 2YY3A 5F8HA 2RSQA 2BANB 3H25A 5JVHQ 3JYTA 2CVIA 1ZYQA 2W4DA 3M2UA 1NZ8A 5KOXA 5CA5A 3LGMA 2J0XA 4RUHA 3CD6S 4A8MP 4X4SA 2RUGA 5HJXA 5F8GA 1E6VB 1VRUA 2F8HA 2LQJA 3OD2A 4H4MA 4RW7B 2V2KA 4C7QA 2U1AA 3DGPA 3UD5A 1CC8A 1HQUB 5L1IA 4DV5J 1M5OC 1P1LA 4DS4A 4C11A 1A0OB 4ZPAA 4BS2A 2CPDA 5CHCB 4PYDA 4Z7CA 1R8HA 2VUGA 2WVCA 4ED1A 5KFTA 3BSNA 2LLZA 2ZVIA 4TNOA 3TZWA 4X4TA 1FNOA 1BQMB 1K1QA 4YMEA 5GMDA 1NHUA 2KH9A 3JQKA 2DNGA 1WEYA 2GCFA 1P9YA 5IT0A 2JX2A 5I3UB 1HNZF 5BYRA 4NEYA 1RT2A 4P6QA 4DL7A 3J7ZT 4ZPTR 5C2GA 3GB0A 2J9CA 4HKQA 2QLBB 2V4JB 4I2QB 4MKBA 3R8YA 3EPIA 3HSJA 2HHSA 2E5HA 3BEGB 2Z58B 3MF5A 3NNCA 2LMIA 3A1YG 3ADAC 1NXIA 7AT1B 1HQEA 2RDIA 3RAXA 3TI0A 1VRTB 1U0HB 4RU2A 1NHVA 4CDIA 4OV1A 1L3KA 5GVQA 3A8JA 3BPDA 5L38A 2VQFJ 1CVJA 4NLRA 1RZMA 2CDRB 2VFTA 1TUWA 2DXFA 2W01A 2KN4A 5EWGA 5K20B 1T3OA 4N7TA 2RQCA 2Z57B 2CQGA 3L3CA 3EVMA 1DURA 2WB1D 3VHQA 3J7AN 2QN6B 4F0HA 2N7CA 2DO4A 2ZDOA 3THVA 2CNOB 1G6BA 4QIGA 2FVQA 1TR0A 2O67A 3GR1A 5ETQA 4YR0A 1T05A 5A6PA 1U1RA 4DN9A 1C4CA 2MKIA 1R8BA 3T1YF 3BGFA 1YG0A 2VKZG 1NK0A 4K0KF 5KFRA 1BY9A 1OMSA 1S6PA 5EDWA 4HT7A 3NWGA 1YLXA 2W9CA 1F9EB 2LXIA 2LU2A 3M8RA 2DHSA 3D1OA 4ZMMA 2K7KA 4A8YA 1UA1A 5ETSA 4LFBF 4YN3B 4L6V3 1K44A 3PO5A 1N33F 3UR3C 3KJVB 3AOBA 5KFWA 3FSYA 4USTA 1QY7A 4JYAF 2GGPA 1CULB 3I0SA 2UV8A 3VAGA 1N34J 3B4DA 1PC5A 2ASLA 4FZVA 2XG8A 3NNAA 4FYDA 1NNDA 4K4YA 2QV6A 2UVVA 1N0VC 4FKXA 1N88A 2MY7A 5J2MA 2CDQA 2JLGA 4RW9B 3M8QA 3FRZA 3RRGA 3DGPB 4W90B 2QMXA 4F67A 1D09B 2YNHB 2B8QA 4F02A 4ZLNA 2XGQA 5L1KA 4U8YA 2X1GA 2I1RA 4F4XA 1RTDB 2P9GA 4KKOA 3EXCX 4RW6A 1YQHA 1ZM4A 2PE8A 3E2EA 3B8HA 3PFEA 4DJBA 2GFFA 3Q8YA 2Z2MA 4CLWA 5KT4A 1CJTB 3M32A 2D9PA 2C3UA 4X65J 3Q24A 2HRUA 4WXWA 1QVFR 1PKUA 4KAIA 4QR0A 3QGPA 1MG7A 4RWXA 1N34F 2AP6A 1GMWA 2ADCA 4OIXA 1XK8A 2D9OA 5GAGI 2JEJA 1N32F 5DGAA 3MR2A 1SL1A 3AJ2A 4NASA 4C0HA 2V8HA 2AYMA 1JJHA 1GT8A 2JOQA 3D9BA 3IMQJ 4MT1A 2RU3A 5DETA 1M1HA 4O3NA 1NDCA 4ATNA 3IG1A 1NRKA 4WFYA 4X4PA 4JI7J 1SH3A 2NLWA 3MM8A 3JTOA 1N0UA 5BR8J 4J9KA 1UJ6A 2KT2A 2DB1A 4ZVPB 2OH2A 2HFOA 3H98A 2BJ7A 1S0MA 1Q7YT 1S5ZA 4F4WA 1PYSB 2IHR1 3MMCA 2J7WA 4Q2LA 2RILA 2J7KA 1Q1KA 3MD3A 2FGCA 4WZMA 1U24A 4NXMF 1BHNA 2HGMA 2R8GA 4M5JA 3ZZZA 4M5DA 1LV5A 2E9ZA 1B0TA 2GMHA 2R9LA 2ZNZA 1IM6A 1KR4A 1OSCA 1DLOB 1T9TA 3K5PA 4M5HA 4DCJB 1UFWA 2IM2A 3E01A 4YFUA 4OX9J 1VQ6S 3T5KA 2ZNYA 2ASYA 2DBBA 4RJVA 3KLGB 3W2WB 4UOGA 4PABA 1WC5A 3QMQA 4YEAA 4CNYA 3PKMA 2E5GA 4WP3A 3W64A 1X9SA 2GA7A 1RSCA 3LF0A 2UUBJ 2F4FA 1X9MA 3ZTRA 3ZFVA 5KFOA 3FDSA 1KFSA 2RMLA 1QAXA 3MEGA 4CNZA 4J90A 4RBUA 1RADB 3CJ8A 2BJ3A 3AT1B 1WEXA 1NJXA 3R3TA 4JI8F 1Q16B 1FD8A 3I31A 1QD1A 2KJWA 2ZM6J 1LK7A 3BYPA 3HSGA 4ED5A 1TL7A 5CXTA 2HK3A 4ICLB 2MQNA 4C4WA 2NXJA 3R7SB 2FYXA 3GLJA 3W66A 4ZCKA 3HT3A 5L1LA 2UU9J 1F5CA 4DV0F 2I38A 4OX9F 4P7VA 4AD6A 1C0UB 4G6VB 2ASJA 1H38A 3GV5B 4DL3A 2ZH7A 2PMHA 4A8KA 2H48B 2BE2B 4B3RF 4M5LA 5F9NA 3MEDA 3IWLA 1L3UA 1GX6A 1S12A 3CDAA 2EBEA 4ID8A 3OFGA 4KBIA 3U02A 3WIUA 4YR3A 3QZ7A 1WKLA 3Q8SB 2ZBIA 4RO0A 1X4BA 2EFQA 2VG5A 1PBAA 3K7RA 5IC4B 4AYBD 4U9RA 3IBCB 1LW2A 1FJ7A 3J81Y 3WHIA 1NMEB 4OZ2A 5D0RA 2OHDA 1SV5B 2K3KA 1HMVB 4ZHRA 3HDSA 3J7Z5 1RWXB 2VQFF 3EM1A 3BH7B 2FQQB 4O3SA 1C2PA 1S9EB 1CJUB 3ET6B 4IH6A 4K2XA 3QRQA 4M63A 2UXCJ 1JIHA 1PCAA 3EYZA 3PX6A 2MHEA 2C28A 4EBCA 3PW4A 3V81A 1VQ8S 2E66A 2HZCA 2KL8A 2LA4A 2QTWA 1X8DA 3ELHA 2M5YA 2XULA 1WKKA 3LTOA 2HHVA 1OIAA 1V5IB 2DHHA 2HZAA 4DUYJ 3IBWA 4J37A 3RUBL 3KMSA 4DF4A 4WK3A 4TU8A 4WFXA 4N76A 1O51A 2I9SA 3MMCB 3N6LA 1U09A 3P4UB 4I67A 4G1IA 2UXDF 5KFJA 3K5NA 1O0PA 2X3DA 4HACA 3TO8A 3W8GA 3TANA 2XBPA 4DV7F 1FRKA 3GFZA 1BQNB 3MEEB 1W7WA 3CD7A 2X51A 3LOUA 3EX7B 5DDQC 2ZH3A 1RUSA 4KO0B 2XS2A 2F4VJ 1FFSB 1RDRA 1SB6A 1X5SA 1WOOA 2LVWA 4PG5A 5EWEA 4DFPA 4IQXA 4N8NA 1OQ3A 2BX6A 3J80U 4OHVA 1DBDA 3LUYA 3PM9A 2YKOA 2HBQB 1RT3B 3FCWA 1UEUA 3D1QA 1EB0A 2DISA 2MPUA 5K8OA 3OL6A 3UCZP 2WVFA 1UVKA 1TVRA 4NMLA 1T02A 3JQMA 2HLUA 2MQMA 2ZE2B 3FQKA 4G1QA 4DV4J 3V6KA 3NBPB 3W63A 2R2SA 3MCNA 1MROB 1TTHB 1IKVA 3R5GA 1P27B 2LQ9A 1UKUA 4KRWA 4DS5A 3AAWB 2Y1IA 1HLWA 4EO8A 3QNWB 2R8JA 4J9NA 4YDDB 4IOCQ 3DXSX 2QA2A 3UPFA 3D2WA 4LFAF 3O44A 2ZOFA 1Q5YA 3ZZYA 2XMAA 2RRBA 4MAKA 2ZH4A 3TP2A 2HQ3A 2HNZA 1NSQA 1ZTWA 2F4VF 1EQMA 2UXCF 2CKWA 4X84A 3R9LA 3B78A 1WF0A 3TRGA 5HVHA 5LSLA 1S99A 3DLEB 3EJMA 3NWRA 2KG0A 2D3O1 2IA0A 1BQXA 1PILA 4UQTA 1PJ6A 1KWMA 4MK7A 2XSJA 1I1GA 1TL1B 3M6VA 4UUWA 3OLAA 5H9FJ 4B08A 4QU6A 1S1TB 2CNKB 1UFKA 1H98A 4MIWA 2DR7A 2MYFA 2B56A 4I2PA 4WWSA 4C8KA 2Q66A 1HNWF 2K1RB 3BGUA 1NB7A 4F8RA 1GAOA 1IWAA 1S1UB 2VG7B 5HVGA 3PIOQ 5HLFA 2BJDA 4Y2AA 4DUZF 3Q8PB 2NUHA 4NYPA 4KH1B 4ZOSA 4H54A 4TLRA 4FNIA 4KR0B 1F2HA 2KRBA 4OYOA 3VALA 1CJUA 1FKOB 4J9PA 4BHQA 1BLUA 1RT2B 4KPYA 1NUEA 1UWBA 4QWEA 1V5VA 3H7HB 4HVZA 4IKAA 4DQIA 4KGMA 2IJRA 2HRTA 1VBXA 3O1LA 2KFZA 1VLYA 1MMDA 3CCQS 2DIVA 2P9CA 2JFDA 3LP0B 1KQSR 4UOFA 4WTYA 2VF3A 3A8IA 2EG2A 5C7PA 1S76D 1U25A 3CC4S 3GR0A 4JI0J 3DRPB 4UY8T 2UZAA 3SBMA 2M3DA 5LMUF 3FEXB 4K2JA 1CG2A 4PXDA 3GFXA 4DR7F 1YJWS 4LRAA 2YQ1A 2WOMB 2AIRB 4ZPCA 4CZCA 4OHYA 2L9WA 2QYCA 2FZKB 1VIOA 2CQIA 3DLKA 3NGDA 1Q53A 1U6ZA 3OHAA 2BEFA 3KLHB 3TX0A 1I94F 4LF4J 4PWDB 2CPJA 2IC3A 1GMWD 1SQFA 3G71S 4N8OA 4DHVA 2OPRA 2DNZA 2LEAA 4P52A 3T6JA 1I94J 4LF4F 2GO8A 4OFZA 1NK5A 2H3EB 4JI2F 2OMOA 3I4HX 3IRXB 2LQBA 4B3TF 4KGZB 3MMJA 4F4AA 2LU1A 5HROA 1Q7LB 1RU1A 1Y11A 1SC6A 4USMA 1DQ8A 1S48A 4C48A 1NPRA 1N4LA 4LF7F 4OYIA 4NCBA 2EC0A 3L7UA 3NCQA 3KK3A 4DR1F 1IBMF 2R7TA 1NJIT 3CNQP 4DQSA 1WG5A 5J2PA 4DV0J 2IDLA 4CLLA 5D15A 3ENWA 1IM4A 2V34A 2W2OP 3PZPA 4LSNA 3KK2B 4GKKJ 3W9IA 1YGYA 4TY9A 4OL8A 4WF9Q 1WC6A 3WX4A 5MAOA 5CD4A 1XNRJ 2UXBJ 4Q2MA 2CPFA 2JLEA 2DO0A 2HBYB 1M1KT 4JI2J 4YQWA 2UXBF 4J9SA 2R7UA 4IFVA 4B3TJ 3ZO7A 2QIFA 2BQRA 4LF6F 2FTRA 5I3PA 2EI5A 2R42A 4EI2A 1RBOB 4ZVTB 2IAJA 2FJBB 3D54A 4ID5A 4F3OA 2YPYA 1MWZA 4LIRA 1S6QA 5LM7E 4RW9A 3BF4A 3KG1A 2R3VA 3F0NA 3FJ2A 4BBYA 4YS2A 1IBMJ 4F25A 1DLOA 3S8SA 1IJFB 1U2RA 1RISA 1MU2B 2ALYB 3M2VA 4WPAA 1UTAA 2XY7A 2L3MA 4KPCA 5JUMA 4ECWA 1ZZFA 2ROPA 2O5DA 3I55S 3SV4A 3HHNB 2QE5A 1RBAA 1ZAVA 5FDLA 5T14A 3M9MB 3LPYA 1D9FA 5LT5A 3HFZB 1KVIA 2CQDA 1QTNB 2GAGC 1YJVA 4DZDA 4QOTA 1GNKA 2D7SA 3QO9A 1LWEA 2KHCA 1WSRA 4R0JA 3K5MA 5D4PA 4M95A 2YWWA 3MWBA 3PFOA 3DOKA 1UW4A 2BOAA 4I6WA 2RNEA 4XIUA 3QRRA 4W98A 1WWHA 2YH0A 2M8DB 2UUCF 4LF6J 1IWGA 3D6HB 3D0GE 2XCAA 1X4CA 3DFEA 3T1AA 4KB7A 1NM2A 1S6UA 3DLBA 2GS8A 1UEVA 2XS5A 4WE1A 4O4GA 1N52B 2IJFA 5E3AA 5K9FA 3R2CJ 4ZDNA 2HHQA 1AZSA 4USWA 3D67A 2HFSA 4J7CA 6AT1B 4DR4J 1FHTA 2ZUAA 1AFJA 4O4RA 1ZA2B 2A18A 3QT7A 2R7QA 3TJAA 3UVJB 1N5TA 3V4MA 3A3NB 2ATCB 4C9DA 1FWLA 4PWDA 4JV5J 1WUUA 4KC5A 4RW4B 3PEJA 2F9DA 4ELTA 1N5YA 2M2BA 2D69A 3DU5A 3QAUA 2BKPA 4DU7A 5KFNA 2A6OA 2OIHA 2EFPA 4U6PA 3C46A 1JLFA 1FKPA 1HFEL 2LQ8A 2ZDPA 1Q82T 1WG4A 4OYBA 2UUCJ 4K59A 1HBMB 1S59A 4YOEA 4EEYA 5HROB 2GNKA 1FKAF 1OJ4A 4B9MA 1OO0B 1JLAB 2EKYA 2X7IA 3NGSA 3PW7A 2KXNB 4F2RA 4GMKA 2BUNA 4RX6A 3FSIA 3LQVA 1FI4A 3G4SS 1QUVA 5AT1B 2CQ2A 3KK3B 4OZJA 3W2WA 3TAQA 1S72S 3KUEA 3BQ1A 1KOOA 2V4QA 2QLJB 3HPOA 5F41A 3WDOA 2BQUA 3P6YC 5ETRA 3SYZA 2GAHC 3EGZA 3NLCA 5K8NA 2MZRA 5DM6Q 1EZZB 3HVTA 3VVTA 2OMLA 1HD1A 3EUNA 1T9UA 2VFSA 4CI0B 4NL5A 3K89A 1D1UA 3ILLA 2XI2A 3SDEA 1T03A 5A2QY 4WJBA 1IBKJ 1VYAA 4QIFA 4NI2A 3ETOA 1RKIA 3ZTQA 1ZZNA 1NK8A 3R97A 3H5UA 3UN5A 1Q4RA 1XWLA 2A6MA 3D68A 4ALZA 4U95A 4JI5F 3RG6A 2QZ8A 2C3OA 3A4TA 3ZXWA 1NKEA 1WD6A 2IAJB 2J8AA 4IH5A 5B0EA 1UCNA 3KG0A 4C3MA 4KO0A 1RA6A 1D8YA 1HI1A 4X62J 4NRUA 5DG7A 2MQOA 2HVIA 3HHDA 3I56S 2XTJP 3OV7A 3IRWP 2R7OA 3U7JA 2KZMA 1QJHA 5KT7A 3N9UC 2FJDB 4X62F 1R7IA 4KSEB 4O3OA 1RAEB 3SIPB 4DDFA 1VQ9S 3L09A 1FDNA 3CCTA 3OQ2A 4MJKA 3C19A 2GVZB 3P5BP 5G0RB 3T41A 3TAMA 5HVFA 5BJRA 1TL3B 1HKAA 2GX8A 1RABB 3B4MA 4K5RA 5A8WB 4CO2A 1YHQS 1U26A 1RHMB 1UZHA 3QSIA 3TUIC 4RU9A 2BE7D 4MKAA 4ZP7A 1FWPA 1NK9A 1S49A 1KKHA 5H1SV 3MOZA 5HMYA 2WK4A 3QWUA 4LF8J 3GCXP 1S9FA 1UJ5A 2YKNA 4RLEA 1TUGB 1RT4B 2VFRA 3BREA 3LWLA 1BWEA 3M2UB 3MAAB 3JS9A 2VA2A 2EK1A 3KNGA 1S97A 1JLCB 3W2VB 3DXBA 3RYLA 2KYZA 4QWBA 2RH3A 3OTOF 4F26A 2HURA 4XO0A 1PC4A 1VBKA 3LH2S 4YDXA 3PW5A 3U1LA 1RE1B 2OEMA 1U45A 2KKHA 4YB6A 4F0MA 2IJNA 1R0CB 2BM1A 4ZP8A 4F3QA 3BBFA 5HAOA 3RGIA 3WBZA 3RB6A 3MEEA 3QFWA 1H2VZ 2E5JA 3H2VE 1RT6B 1NSKL 2RKIB 2ROGA 3E51A 4LF8F 5KFUA 1RAHB 3RW6A 3TAPA 4B9VA 1EETB 1PIEA 1W26A 3EDRB 5KG2A 2W8LA 5L9XA 4FYYB 1CJKA 2I5JA 3PW2A 4WU2A 2FIUA 1X5PA 2ZBPA 4C0OC 5LJ5Y 2N82B 1FRIA 5D78A 5HL7Q 3JSBA 5DM7Q 1ZH5A 5B0AA 1TQLA 3VGSA 3OR2A 3CJKA 5GAGU 2J0WA 1SXLA 2R2RA 1UMJA 5CZXA 2GO9A 3D0IE 3M8YA 3PO4A 1V3RA 4GKJJ 2ZZTA 3B54A 5JJBA 3D0HE 2CQ0A 1CBKA 5H9EJ 3IBFB 4KFBB 2RS2A 2WOMA 3ENQA 2DNNA 4OI3A 4X4OA 2WTFA 1LNQA 3KJFB 2FVCA 4YR2A 4OYAA 1NK7A 2MKYA 2V8VA 3BKTA 1K0VA 2H4WB 4AXIA 4RUBA 4CLTA 1AB8A 4E8UA 1UFLA 1WC0A 4LJMA 4F36A 3V5RA 2HHHF 1LWXA 3TUPA 4K4VA 3HSZA 2W9BB 2VOPA 3DLLQ 1OY8A 5E2QA 4NXNJ 3HVAA 4NMXA 4A8XA 4PRFA 2L08A 2MTLA 5F3ZA 4EMDA 2HPUA 3BO2A 1F9HA 5A8WA 3DOLB 4NLTA 5AXMA 2B4OA 1SQEA 4WP9A 2NZCA 5J2PB 1NBEB 1WTFA 5D6GA 3MDFA 4J9MA 2LDIA 4B9TA 2VG6B 3AOAA 4PKDB 3KLEB 2VU5A 2F7VA 1OSDA 1IJEB 3OFHA 5ADZA 3MEGB 2C22A 3OT9A 1Z2ZA 1F6TA 3O5TB 1Q8IA 1RT4A 3I87A 4LRDA 4UUXA 2OFHX 2KG1A 4PPZA 4JI6J 1UVLA 1R43A 4KHPJ 3M2RB 4BWJA 3OL7A 2IYGA 2FZGB 4QIVA 4TVAB 4FXVA 1JXLA 1JLCA 4ILRA 3W2VA 1T9XA 2MMYA 3BN4A 4NLOA 4AL6A 3IR7B 1CQNA 1PYTA 2B6AB 3N01A 1Q8LA 2MB0B 4NEZA 1RTIB 1IR1A 2B9YA 4E98A 1IKYA 1VK3A 3JSMB 4B3MJ 1JJ2R 1YSJA 4TY8A 1T11A 3HKZD 5IFMA 1RTDA 1RT1A 2WONB 4HI1A 4KKOB 4ZS6A 1S0NA 1F0XA 3A3PB 3H5XA 4PYAA 3EGVA 4QIEA 2R7RA 3RBZA 2NXCA 3GFYA 2EWHA 4NLUA 2G2OA 4PR6A 2XWYA 1RP5A 3GIRA 3HHLA 2AEFA 4PG4A 4ZN1A 2ERRA 3HJFA 4X4VA 1VC5A 2HVHA 3QO9B 4QWCA 3DDNA 1MWQA 4L3NA 1BD6A 1SUQA 1XTZA 4L76A 4CO0A 2J9DA 1UPMB 4DV5F 3BSOA 2I8EA 1YZ6A 2HQIA 2B7CB 3POTA 4ZPWR 3DGVA 1WEZA 2PMZD 1EX8A 2OEJA 5DDPC 3ZC4A 4J9QA 2HSEB 2YX4A 5AXNA 1FE0A 3IAM9 4QYZJ 2HVDA 1U0SA 4QZVB 4GRSA 1SPBP 2IIHA 2PI5A 4LQ3A 4IG3B 2LKZA 5J1NA 1DAXA 2G9OA 1RBLA 1M5SA 1Y5IB 4I69A 3R7NB 3SXLA 3PX4A 1JQGA 2YQ0A 1XIQA 1JX4A 1N5VA 4O0IA 2BYCA 2W2MP 3BS9A 3SSSA 1X4FA 1BWVA 2EPIA 3Q22A 1TFYA 1ROFA 2VFVA 1NJWA 2CA9A 3ZTOA 5CYJA 3DOMB 3FK4A 5E3CA 3EZUA 4ILMA 3I5BA 4FYXB 3HKWA 1T94A 3PYDA 2JSXA 3R6GB 2Z2LA 4AUKA 4IFVB 1WF2A 3KUHA 3PEHA 3V4IB 2Y0SD 1KHVA 3PR5B 5J2NA 1KRPA 1H0HB 4YB7A 2CJXB 2WSEC 1HBMA 5IM0A 3K58A 2D41A 3L7PA 3NOCA 1BC6A 3HMJG 3CUNA 2CPYA 2VODA 3DI6A 1TAUA 2KDOA 3PRVA 3C15B 4P9SA 4F2SA 3N5BA 1HNVA 2MQLA 2RAQA 2CJAA 3LP2A 3QAEA 1FF2A 4J9RA 4IUFA 1ZPWX 4NCGA 3P5TL 4EYIB 5A0YA 4GVBA 1YBUA 2H51B 1O8BA 4OJHA 1YWXA 4I6AA 4TYBA 2HVEA 4OLOA 5FDLB 4M8LA 3X3UA 1X31C 1ZTTA 3MMAB 3OPKA 2BACA 1IKVB 4QR2A 3US5A 2E7WA 5IC6B 2WCXA 3QIDA 3M1VA 3G86A 4OX6A 1ZAWA 2NYHA 3C6TB 1XBWA 1FDAA 4YUDA 2BZ2A 1PO6A 3WIVA 3ONQA 2L41A 3W5YA 1DQ9A 2KFNA 2HEKA 3RZAA 4DR3F 1JK9B 1FRJA 2XMUA 3H8YA 2X1AA 3RBDA 4IR1A 1HQ2A 1RWOB 3RU0A 2R8HA 3IFEA 3FFIB 3VAKA 2B7BB 2YNGB 2AYBA 2IBKA 1C0UA 4DX6A 3DLGA 3SFUA 2XO6A 4IRDA 2E9RX 4EWTA 2FJXA 2DK2A 4OI6A 1E6YA 2V8GA 2WAQD 4WFAQ 2MQPA 3EVWA 4RBTA 3AA8A 4YB1P 2DYAA 3NGKA 1NJZA 1R89A 4LT6A 3IP0A 3HZGA 3ZNJ1 1IKXA 1CS4A 1ZBTA 2CAJA 2RVJA 2B9XA 2XMKA 2XWXA 5KFLA 3TX8A 5C2CA 1XMOJ 1CSJA 2Q6BA 4RW8B 1FCAA 2LEBA 1RHJB 1HBOB 1VR6A 1FKPB 2ABYA 2QJ3A 2AKWB 2OP5A 2Y1RI 1SUQB 2N4CA 4UZCA 4IFYA 3HO1A 3G8TA 1YJNS 1DARA 1HWJA 4O0NA 5GADI 3HJVA 1YI2S 3AA9A 2IVFB 1W2BR 1A9NB 2BRLA 3A13A 3HVWA 3X1LB 3GZ7A 4DN0A 2FGOA 3P3DA 1C0TA 1Z1ZA 1LK5A 3KMQA 2W24A 1TAQA 3DRYA 5KT2A 1S0OA 4IG3A 5E3PA 1PGZA 4LFBJ 4B17A 2YKMB 1GXTA 2Q1LA 2I0XA 3LP0A 2EFVA 3PYFA 5KFFA 1VRTA 2FLPA 1W2IA 2RB7A 4ZVHA 2NXEA 2RQMA 2HZVA 1XMOF 2DEJA 1UAWA 2UV8G 1C1CB 3SQOP 4DL0C 1AT1B 2HIYA 3VV2B 2FJEB 3QLHB 3R6LB 2V2ZA 3DLKB 4OJ1A 4GVLA 4ZVSB 4ANDA 3E3XA 4ZVUB 2EBGA 4DV3F 3W1YC 2LFVA 2OPQA 4B3OB 1B4SA 4BDPA 1VK8A 2C2ZB 1Q8BA 1XMQF 4NLVA 3DI6B 1QVGR 2CPIA 2L9NA 1AFIA 9RUBA 1HNVB 3LP2B 3IA0A 4R5PA 2UVWA 1VQ7S 3KXDA 3A3OB 4NCGB 2ZE2A 4G1QB 3CXCR 3DLHA 5HBMA 2R7WA 2HYIB 2J6SA 1UJ4A 3VAMA 2DNOA 2H4YB 4C6AA 3FNNA 2NS1B 2C42A 5RUBA 1FDBA 2C3YA 5D3GB 3P49B 2YKPA 3QJPA 1YITS 2ZM6F 5A6WA 2HFZA 5KT6A 3W8PA 4ECXA 2AQ4A 2ZWOA 1N56A 5E7OB 1U49A 3CDBA 3OR1A 2DHXA 2QRRA 1S57A 1TMMA 4KFBA 2FJAB 5ETTA 1F60B 3MGJA 2YKNB 1M5VC 2GGPB 3FBCA 1P1TA 1CULA 3I0SB 4UF4A 1F9FA 3CCUS 3OL9A 1B0VA 4C2MA 2YWFA 2W4CA 2UUWA 1N8RT 4H4OB 1U8WA 3BBCA 4JI3F 2K8GA 4QR1A 1RKJA 3AJDA 2VQEJ 2DCUB 1M5KC 1KC8T 3FRYA 2CPXA 4FF3A 5GMEA 4JI1J 1Y5NB 4ZVGA 1NK6A 1CS4B 5CCMA 4IR9A 4M5IA 2C2DA 2CQPA 1H7WA 2HBZB 1SJ1A 4CT9A 1TU0B 4HTIA 1ICEB 3R5DA 2YNIA 1HWKA 3G82B 3T19A 3IGNA 5D0GA 1M0SA 4B3SJ 1CJTA 3M32B 4DPYA 5FJ4A 2AJFE 2ILZA 3CD0A 2NSCA 2MQQA 4CRJA 3T1HF 4DV6F 1LFPA 3I0RB 2AEMA 3EGNA 3DCAA 2N4DA 2P8IA 1SVDA 4F50A 5IWAJ 1SKWA 2HAIA 5A8RB 1R0AA 5A76A 2QSFA 4KV8A 5KFHA 3C8YA 4MK9A 3CC7S 4UOHA 5CYQB 4ZVQB 4ES1A 5IWAF 5F0UA 4HHHA 2DIUA 2P6SA 3DRPA 3K2YA 3OR2B 2DKOB 3IG1B 4JI1F 3VQTA 5HQLA 4WU3A 1QAIA 5EHHA 1IKYB 2OSRA 2ROEA 3JSMA 2NXNA 5KFQA 4DR6F 1J5OB 1UETA 5ETMA 2GVDB 4XTTA 5I42B 1U02A 1BGXT 1B0PA 4ZLPA 5IS2A 2AMCB 3PW0A 4DR5J 2OPRB 2Q6CA 4B02A 4A47A 2GIQA 4DUYF 3DM2A 4B3OA 7FDRA 1FRMA 4LIWA 3VTIA 2E29A 2NSBA 1S7IA 2OSQA 2R8IA 1BQMA 2FPHX 4WCEQ 2YX7A 2XSFA 3O6QA 3RR7A 2GIFA 4ZPBA 5GMKa 1RAAB 1S1WB 4DV7J 5HATA 5HI7A 3QT6A 2GJFA 1ULRA 1KLNA 3FUYA 4QPXA 1J5OA 3TNVA 4W4MA 3OXFA 1R27B 2M9KA 3UD4P 1KOHA 2OPPB 3EVOA 1S4EA 3H42A 3QIPA 1N5QA 3CMQA 1Y0HA 3LAMA 4ZP9A 2J6TA 1TKTA 2B43A 2WSCC 4ELVA 1DJ0A 1SI9A 4BC9A 2ZJRQ 2M52A 4CM2A 2V0NA 5ETPA 1RT7B 3PR4A 4DR5F 2XZTB 9ATCB 1VQMS 1VQ5S 1JB0C 5HO4A 1LFWA 1ZS6A 3FMWA 1TL7B 4Q5VA 1NB2A 2XMJA 1R31A 2KXFA 3L4BC 2WVEA 2AT1B 3QATA 3R27A 4ICLA 5ETVA 4CO3A 4ZKAA 1UVMA 3PXGa 3W60A 3AXKA 4O23A 3ZZUA 1YJUA 2QG9B 3UNGC 3HVRA 3OBIA 4Q45A 2LQ5A 3N6NA 1GFWB 3T9NA 1S6QB 4ZIVA 1TK0A 4HHJA 5LOQA 4ZCMA 5CABA 2KRRA 3WC2A 3M05A 5B0FA 1NDPA 2UXDJ 2RE1A 3MEDB 2BW2A 1VHFA 1Z2LA 2COLA 3V6DA 2XMWA 1JLEA 2B4PA 2CZ9A 2DGXA 3G82A 3AQPA 3W5XA 5F8MA 1SJ4P 2J9EA 1RLDA 2E1AA 3ETMA 3TAMB 2JDJA 4FDFA 5L39A 1L3VA 4DSIA 3JB9k 3BN7A 4LF9J 3BSCA 1DQAA 2WSFC 1RA7A 3H40A 2YVSA 2I6WA 3HFVA 2CJ9A 2R4FA 1R0BG 2CPHA 1X9WA 2ZJQQ 1S9EA 3ET6A 2Z2YB 3VF0B 4Q8EA 2ACYA 3RB3A 4DV4F 4ER8A 4JV2A 4EK2A 2JEIA 4A8OA 1U6BA 4V19X 2KHDA 2HNYB 1FXRA 2FY8A 3PRBA 4I64A 3UCUP 1Y9OA 4K4TA 1H73A 3IN5A 4U7CA 4CO1A 2HFVA 3J81j 3ZZOA 1M90T 2AX1A 3UE2A 4AQYJ 4DSFA 4FYWB 3G2XA 2EXUA 5E41A 2DR5A 4LBIA 1XMQJ 2BVZA 1OPIA 1W25A 2GVDA 4NLXA 4OZ0A 5I42A 1RXOB 3ISND 3AHPA 4PG6A 2E1RA 3GU0A 2RQKA 1NCLA 3DYAB 3QYYA 3PKYA 1B99A 2CIMA 1HYSB 4DZ6A 2LCWA 1BQNA 3PYEA 4JI0F 5FLXU 1RHQB 3DRSA 2Q3PA 3N4WA 2VIHA 2AGOA 2MSSA 1HBOA 3MECA 2MSTA 2YNFA 4IRCA 2IY5B 1DZ5A 2C3PA 4FVCA 3SEOA 3UFCX 4LF5J 1Y7PA 1YJ7A 3H5SA 2VKRA 4FXWA 3ZZRA 4CH1A 3OL8A 3KLFA 4WK1A 3IS9B 1RU2A 1SL2A 1S9GB 1AYEA 4AQYF 1FVQA 2KU7A 4I68A 3C3LA 5CZVA 3NBPA 3V2UC 1KONA 3W9JA 1REVA 5I4MA 5DQHA 3T5HA 2FLLA 4ZIWA 1XC9A 3TEGA 2DNLA 5ITHA 2HVZA 2VDHA 1GXUA 3KKFA 5IM0B 1FJGF 4OHXA 1T03B 2B9WA 3DNCA 3NCPA 4ECRA 3THPA 2IFXA 2VQEF 3I82A 4TKTA 5KFVA 2FC9A 1DY3A 3N79A 3ILIA 3TUJC 1IUJA 3NY0A 5LJ3Y 4OI2A 1VQKS 2YKAA 1XQIA 4I0WA 1MMNA 5KG6A 2GQQA 3TZZA 4QW9A 4X64J 4K8RA 2UP1A 3IWXA 1BE4A 1DTQA 1ELOA 2MZJA 5M2PA 3VGTA 3NG8A 2AJ0A 2JRSA 2MLZA 3HLUA 5LMUJ 1KQFB 1WOSA 2Y9HA 2Q43A 2RT3A 1EQ0A 1E6YB 3OTCA 2CYYA 4DF8A 1GX5A 3RAMA 3AODA 2KO1A 2H5JB 3MUTP 3CJRA 5K14A 2D3OR 4DV6J 1IKXB 1YIJS 4Q0BA 1HHQA 4MKYA 5KFYA 1X4EA 4P2MA 1DFDA 2Z2ZA 4P74A 4TN2A 1ZM3A 5KFAA 4P2FA 4BC7A 4CTAA 3G6YA 4F4YA 3C66A 4WP8A 3Q0AA 2VBWA 5IV4A 1S79A 4IOBA 1JJ4A 1FK9B 1Y3KA 2VFUA 1U1OA 2B5JB 2RDDA 2K7JA 1DTTB 1S1VB 1TELA 1DHMA 4PXEA 1ZPVA 2Z30B 1UWBB 2F3JA 7FD1A 5LSOA 3GONA 2W7OA 3NL0A 1CLFA 2ZC4A 3JAMU 4MMOA 3LGNA 5JXSA 3GIJA 3TVYA 4CIOA 5BR8F 3TA1A 4FS1A 4N77A 2J5AA 2Z0GA 3GIMA 2YWKA 1NU4A 4NLPA 3UDCA 4K4WA 3MFHA 2DNPA 2GIRA 2JFKA 5HN0A 5DLGA 4DR2J 4U96A 4Y2MA 1HNXF 1JXEA 5AE2A 4EU0A 1R6YA 2EEYA 4LRBA 3TVZA 4FNHA 2Y8WA 2ADBA 2VJUA 2C2MB 3CC2S 1RT1B 2WONA 4LFAJ 4P2SA 2CUYA 2K3IA 1HQUA 2P2CB 3GCWP 1CEZA 2DCLA 4CLYA 3AD8C 2HS0A 4DG1B 4C11B 1D0EA 1ITPA 1TL4A 3NKYA 2HWTA 5D4OA 1RWKB 1H6KX 3R7BB 2MKHA 1F2GA 4LQ9A 5GAEU 2KT5A 3AOCA 1CJKB 2I5JB 3HF5A 3KLFB 3R5BA 2FLOA 4EYHB 1U4BA 3EZ5A 5EUHA 4AXJA 4F4ZA 1YBTA 1X60A 2V4JA 4I2QA 2BKOA 2W2NP 3I5CA 1WACA 4KY3A 2ATLA 1UA0A 4DR2F 1HNXJ 2DD8S 1D8ZA 2H65B 4H4KA 1T3NA 2U2FA 5FD1A 1GMUA 2DR8A 3D28A 3BM7A 5KFBA 2CZ4A 1G1XA 2JC0A 1WF1A 2AF6A 1XR6A 2VBXA 3BH6B 1G3OA 4L72B 3CDUA 1WKJA 4RZRA 4LR9A 3CCWA 3OW2R 3C16B 5LMNF 1XJWB 1B64A 4HACB 3GV7B 2C3MA 1FD2A 2XI3A 3CIMA 1MLAA 1Q95G 2WZ1A 4IG0A 2W7AA 2BM0A 4Y34A 5SZTA 4ZP6A 2NCKL 4NPOA 5J2NB 5E33A 2GW8A 1NSAA 3T5JA 1LW0A 3UN2A 3BYRA 3MUMP 3TQ1A 4Z7YA 2PSZA 4B9NA 2D3UA 2ZD1B 3OVSA 1S1WA 1RT3A 1I5OB 3M2VB 3VZHA 5DDOC 4Q0BB 1T05B 3VAIA 1Q78A 3AD7C 2MJNA 3DRXA 1KP6A 3HT0A 4HI2A 3KG4A 5G4DA 4QQBA 3R1LA 2Y1LB 1VQNS 3GG1A 2BOPA 2CQCA 1MROA 1UEKA 4Z2XA 4FF2A 1LWEB 4KGXB 4J5OA 2AV5A 4R25A 3KLEA 3MAQA 4A48A 4DUZJ 1WNEA 3BPSP 1FJCA 5EN1A 5DO2A 5ETNA 3MFIA 2ZITA 4ECUA 1P8GA 2MZQA 1SC3B 3CDWA 1P6TA 3M7VA 4UW2A 1QAJA 1PJ5A 3TZXA 3CMAS 3KJVA 2QLXA 5MLCV 1OYEA 5CYQA 1WHVA 4YP3A 1KTQA 3OTOJ 3SCLE 1J27A 1UP1A 2QLFB 4OHWA 4WE1B 3R5JB 5B08A 1IBLJ 2NREA 4ZPDA 2GQ2A 2Z8QA 5B0CA 1AZSB 3HD2A 1M1GA 3AFGA 1T9WA 1IBLF 1ZAXA 2YNHA 4ETZA 1NDKA 1R6VA 2EKNA 2YXLA 2F8MA 3QT5A 1RAJA 3CCES 1SC1B 3PDNA 3Q8UA 5KT3A 1U1QA 2PEHA 4C8LA 3MM9A 1U6FA 2VHGA 2VDIA 2XB2D 3Q8VA 2E5LF 1YZ7A 4OI4A 2CQ3A 5GAHI 3HHLB 2GMLA 3I9ZA 2OUGA 5J2QB 5B0DA 3MZIA 4KJIA 2KYXA 1JLFB 3SV3A 4ZJQA 1FA0A 1RWWB 4HT5A 1MNEA 4JB8B 1HW9A 3NAHA 1HBUA 2AJ4A 4NOHA 4OYWA 2PDAA 5BYSA 1FWKA 2QA1A 5KFIA 2FHOB 1RI7A 2CQ1A 3RRHA 2GHPA 1QE1B 1L3SA 1HNWJ 1VISA 1RTJA 1XEZA 2IA6A 1WC1A 1HNIB 3G96A 1EP4A 4M94A 3J80Y 3GIIA 3M9NB 4MK8A 1H2UX 1KVKA 4N56A 2IMWP 2RHSB 4M5NA 2DNMA 4HYKA 4ECTA 1UL3A 1RWVB 2FHJA 3BR8A 5F8IA 3MM7A 1Q79A 3S7RA 2DH9A 2MZSA 4TQSA 2R7XA 4UOCA 4URSA 2LA6A 1KLMA 4OI0A 1MSWD 2GC8A 1XNRF 4DV2J 4E0DA 2GJ2A 2HNDB 1FTCA 2CJQA 6FD1A 1OY6A 4KYZA 4YY3J 4PZVA 2X1FA 3ULHA 3HFKA 5A2QU 4J91A 3KHLA 1HA1A 1SJQA 4KT0C 3OSPA 2PT0A 2DR9A 3KNAA 5T7LB 2JNJA 4QW8A 3IR5B 4OYZA 4G65A 4DFMA 2B4VA 4DR4F 3CJQA 4EBEA 3SCKE 2B8PA 1RACB 5F8JA 4HR2A 2AD9A 3W5ZA 4ED2A 1KVJA 3J7YI 4R5PB 4AL7A 1QSYA 1JLEB 3HX9A 4WIQA 1NPPA 3D66A 1JJCB 4V19J 1HHSA 2DHGA 1PYOB 2H54B 1FXDA 4WYWA 4GC6A 1S7HA 5IT4A 2HG4A 3H4DA 5L46A 1VIXA 2V5HG 4JI6F 2CRLA 4DXLA 2IVYA 2M7SA 1VRQC 5J1EA 5HP1A 4MTPA 4DI6A 3KK1B 4NXNF 4M5GA 4ETXA 3DDKA 3FVYA 5KFPA 5DG9A 1IR0A 2F40A 4WFNQ 3SZ2A 1XNQF 3T9ZA 2LP4A 2AX0A 2XGPA 3SI8A 4USJC 3CF5Q 3DLGB 4DPXA 1XNQJ 1VFJA 5HANA 4OYXA 3Q23A 4FPIA 2QGFB 3MMBA 1LWCB 4WFZA 3FKBA 3SFGA 4CH0S 3PHTA 2DGTA 1RHKB 1RWPB 5IT9U 1E6VA 4RW7A 4RNFA 5F8LA 5KFCA 4P10A 1U47A 4W92B 3CGIA 4KTQA 2MZTA 5DG8A 4LSZB 2GHVC 2VH7A 2ZBRA 2XNQA 3RAQA 2PFDA 1N54B 1MMLA 3VGVA 5GADU 1VLOA 2ZWPA 4FN5A 1HBUB 1BXNA 4IFYB 1HMVA 4ZHRB 1NEEA 4ZVEA 2QYGA 3LANA 2ZBQA 2CVEA 4B9LA 3K8VA 2JWNA 5THWA 3AB2B 3FBBA 4URQU 1O5JA 1EETA 1S1VA 1ACMB 2WBRA 1SV5A 5DDRC 1MWYA 3CJTA 1AUSL 2MJUA 5IT9Y 3UWTA 3UR0A 1O6XA 1HR0F 1AA1B 2J76E 1TUVA 3H2LA 3D5MA 4FS2A 1RAFB 4DX7A 2DY9A 3OHBA 4NLDA 2RQ4A 2IVMA 2FD2A 2OPSB 4RL1A 3CJKB 3GV8B 2IMOA 1PJ7A 2F8EX 2A10A 3EE3A 4I56A 1C1CA 4J9LA 3GYNA 4CM0A 2LXUA 1YBAA 4DQQA 5C42A 3ICLA 4DEZA 1URNA 3M6UA 1IBKF 3U27A 1K8AT 2ZZMA 5EX3A 1H2TZ 4C8NA 4Q8FA 3RBXA 1RYRA 2RDJA 4NWBA 4Y28C 3W62A 2EG1A 3C2PA 4O44A 2G0IA 3F73A 4JI4J 3GTYX 2YWGA 4UTGA 1VJQA 5I3QA 3OLBA 3BQ2A 1SKUB 4BWMA 5B0BA 1HWIA 3CT9A 1Q5VA 3MTKA 4DL4A 1RQ0A 1WHYA 3PNIA 3Q2SC 1J2VA 4ANCA 2ZH5A 4X66J 1SKRA 3KUGA 1NAQA 4ZITA 2MKSA 3CCMS 2DGSA 5C24A 2MKJA 4I6YA 4X66F 2HHTA 3J7YU 4DR3J 4DFKA 1NKBA 3NS5A 3Q86A 2DITA 1SQGA 4JV1A 5KFEA 2WB4A 4ECZA 1WTBA 5L9NA 3KWMA 3Q8RB 4ZVFA 2PO4A 2RF2A 5J1PA 1SJ3P 2CNLB 2JLFA 4NI2B 1KQKA 4C8MA 3M2RA 1N36J 3GJTB 2XNRA 2DNYA 1RHRB 2EC2A 4HH0A 3OXLA 2DJWA 4DQPA 1LWCA 1YDLA 4MYUA 2DXDA 3CCRS 1JLBA 2QMUB 2HS4A 5J2MB 3FBEA 3M8QB 2PEBA 3KTQA 1X0FA 4QYZK 4UT4A 2G1HA 2L48A 2Y3YA 1AUDA 2DRDA 2W8KA 2ZUGA 3GIKA 1RAGB 2YNIB 3SSQA 3TZYA 1GXLA 4ECYA 3MTJA 2FHKA 2A2DA 3GFHA 2W1BA 3HP6A 1H3DA 4L75A 1VQSA 2GZOA 2ZBCA 3MI7X 3NEKA 4USVA 3S01A 4C3LA 3KDOA 2QL7B 2K1RA 1IQTA 2MZ1A 4LF1A 3B6BA 4LRFA 5HSPA 2CJYB 2YWEA 4F7VA 2EVZA 4X4RA 5AE3A 1R0AB 1YVFA 4KV8B 4DSKA 5IZHA 4EGLA 4A8QA 3I4PA 1IKWB 1RGVA 3KJNB 1C4AA 1S10A 3M8ZA 2CFXA 3FCHA 2XYGB 4IDKB 3VQSA 2PMWA 1TV6A 2V69A 2HQGA 3PRDA 3D1HA 1OS5A 2RJZA 3VAHA 2C2NA 3GJQB 3JYTB 4TQRA 3D6TB 2VJVA 3K0JA 4Q7AA 4YB5A 1U1LA 3PHEA 1B70B 3AJ1A 5C25A 1T8EA 3IC1A 5BYQA 2N3OA 4DV3J 5KG1A 3JTNA 1VRUB 2FC8A 3DHXA 2ZH8A 3T1YJ 2BJ8A 3PVXA 3K59A 3BDPA 2ZKTA 2IC3B 4NA1A 4G3IA 5CYMA 4ED7A 5DQGA 3KLHA 4ED3A 1UZDA 2X3GA 2CG8A 5D4LA 1EARA 2OI2A 3ITHA 3NS6A 3RJMB 1N6QA 2KXHA 2GV1A 1HW8A 4JUZA 4PUOA 3NMAA 1JLGB 2DNKA 5HK4A 1T9VA 3W7BA 3R1HA 2CG4A 2OJ3A 2YNFB 5E0OA 3D6FB 2XZWA 2DGWA 3MPYA 3MPVA 4C3KA 2V4RA 4CYUA 3OFFA 3C14B 1QE1A 3LAKA 2VICA 2ZD1A 2XLKA 2XQCA 1KTVA 3LA0A 5KFKA 3KLGA 1HNIA 2NXUA 3LALA 1EP4B 1NH7A 4FP9A 5A0YB 2OPPA 1ZM9A 2XHWA 2RRAA 1S9GA 2MKCA 3IM8A 4DL6A 4NA3A 1U1NA 3CCSS 1RCXB 1NHKL 2QA4G 4DSEA 1VC0A 2J0SD 4PEOA 4X4QA 2CPZA 1WI6A 1B7FA 2M4MA 1XMBA 3HI9A 4QYRA 5D77A 4XK8C 5E3QA 3HULA 4KGKA 2W4PA 1U0HA 2EW9A 2QX0A 3GSIA 2RF2B 3I6PA 2VZ9A 2DNRA 2FZCB 4ZCIA 5IV3A 4U7UK 1F3VA 1P9QC 3AD9C 4LSNB 3DMJA 2F5GA 2F63A 1SH0A 1KLMB 3TWZA 3PY8A 5K8MA 4OLPA 3CJ5A 3IO1A 1S1XB 1QLNA 2A0FB 4K7QA 2HS3A 3D3CJ 3F44A 5D8HB 3BSAA 3FFIA 3DC2A 4WTOB 3PV8A 3CJ0A 3TJ9A 3OUYA 4L73A 5AE1A 1VCTA 4EZ6A 3R5AA 1HIYA 2OAUA 2HRYA 5F9LA 5KG7A 3FEYB 1V3ZA 1SKSA 3H20A 2HBRB 4EFAC 5F3TA 2H5EA 3CVKA 4PAAA 4WIIA 4B3SF 4URGA 4B9UA 4O3RA 1N32J 2IYIA 3T1HJ 2DTJA 2O3DA 1RYSA 2VG5B 4PQAA 2CJKA 3HHKA 3G8QA 3EICA 2CPEA 4BLGA 1NPKA 4CLUA 1S6PB 2VPXB 4JI7F 3CJ3A 4D3HA 4AT1B 4MYTA 1WJ9A 5KFZA 2W9CB 4K4XA 4ED8A 4ENOA 2AHOB 5C5JA 4D3GA 4TYAA 2YBVA 4ZJOA 2O01C 4OJGA 2CQHA 5B09A 3G6ES 2VG6A 1YJTA 1IVZA 2E1PA 3M8PA 2AW0A 2F1FA 5LSRA 5KG5A 1LWFA 2EFNA 5KAKA 3V81B 4Y2KA 3BO3A 4KIAA 1FJEB 4C8ZA 1PG5B 4FKYA 3MM5B 5ETLA 4ES3A 4DR6J 1REGX 2CXEA 3TARA 3SMZA 2YKMA 3AXMA 1GEHA 3TYTA 4R8UB 1JWWA 5DZ6A 3MR6A 5H9EK 4JI4F 3FSXA 3O3LA 1Y4ZB 4CT8A 5EWFA 1T7PA 1RT5A 3MPWA 4TY8B 2Y1JA 3WQPA 1FT8A 5DJBA 4OJ3A 4JBCA 2ZH1A 3DRSB 2V8PA 3BQ0A 1XR7A 4ECSA 5H9FK 2HNDA 1WDDA 5B0GA 3GQCA 3VAFA 2AYEA 4EZ9A 2PIIA 4JI3J 5AJ3F 2O1PA 3VWSA 2KM8B 2C2EA 3KLIA 3MCSA 3CCJS 5L1JA 2HMIA 2K2PA 3CMES 2GMJA 2WHOA 3PCOB 2FVRA 3G9CA 1RLCL 4ED4A 5T7LA 1RJJA 3DLJA 4DUTA 1TZ0A 2NPIA 3CCLS 3JSYA 2CWKA 1TVRB 2C2OB 5HBMB 3IAS9 4P75A 3ZZPA 5HMWA 3H4BA 2AWZA 3BJYA 1N33J 3NOGA 2HFNA 4DU8A 2NR0A 2WVBA 2ZH2A 3V6HA 5KT5A 4YHHJ 1WI8A 4RR5A 3EZOA 1VQYA 3NNHA 4B3RJ 1KBRA 2ASDA 1KNZA 5HP1B 1U2FA 3MM8B 1Q86T 3IR6B 2XLIA 2BKNA 3CE8A 3TW0A 1WC4A 2DGVA 2POKA 1K0TA 1DTQB 1YJRA 3BGLA 3U1NA 4FBTA 2AJQA 3HD1A 5LXRA 3BO4A 3OUYB 2HNZB 2KTQA 4ZVRB 3LWMA 2HHUA 2XYHB 4NLGA 2FJWA 3V4IA 3THTA 1I6JA 4O44B 4NA2A 3ZNUA 4A4JA 4O3QA 3PG9A 5HJYA 4PWUA 1Y00A 4XPCA 2DPIA 4K50A 4M5DB 1IQZA 2XSJB 2VBZA 4ZK7M 4NX9A 4QWDA 3P8BB 3ZZTA 1CPZA 1LW0B 2E1MC 4UZBA 2UVUA 3C15A 2R7SA 1FFWB 5IOLA 3U1MA 2Q79A 2MKKA 1MN7A 2P6TA 4I2PB 2ALZA 1J5EF 1TL3A 3NRBA 1Q81T 2QA4S 2MDAA 3CB4A 3PX0A 2NQPA 1S1UA 2VG7A 3LW5C 4C97A 4KHMA 5FIIA 5G0RA 5HLFB 2GVZA 1RCOB 3MAHA 1J5EJ 2UUAF 4JYAJ 2FVPA 2JC1A 2J7UA 2FB0A 3I0RA 3E8OA 1TL5A 1FNXH 1HBNA 4ES2A 4Y2CA 2APOA 1M5HA 1OPZA 3M1VB 1Y5LB 1LOUA 2XMVA 5A8RA 1AXQA 1LWFB 5KG3A 1HR0J 3C6UA 2QEXS 1T0TV 2LXFA 4WBFA 1TK8A 3NMRA 4X2BA 4PQUA 3MM5A 3KHGA 2JVRA 3QRPA 1NSPA 3NGRA 4NE9C 1U1PA 4DBQA 2E5IA 3CULA 4LBPA 2OPSA 3H59A 4X4NA 4LRCA 3RTVA 4MKVA 2OKQA 3N6MA 1OWXA 1HPZB 2B9EA 1JLBB 3WX8A 3EGWB 3SQGB 3DU6A 4RNOA 3UO0A 3HXMA 2OO4A 4NXMJ 2FY1A 1RT5B 2CQ4A 2IBOA 2V94A 6FDRA 3QWPA 1WHWA 1WSVA 2QO3A 3K5LA 5KFSA 5KTQA 1EIYB 2MY8A 2UVRA 2HFUA 5DRKA 2ZHBA 4OV6A 1SJFA 1N5SA 1FDDA 4I1TA 4NYOA 1NKCA 1U48A 1PAUB 2G0CA 2AEJA 4S0MA 4N5SA 1X4HA 4LF2A 4ED0A 1U1MA 4OQJA 3LO3A 2XYPB 3CDEA 3FZBA 2O66A 3L95X 3AQOA 3PACA 4ZVOB 2KM8C 2ZHAA 4IQMA 4NZ0A 3IRXA 2W25A 4PWWA 3TA0A 4PPDA 5CAAA 1RT6A 1YJ9S 2BR0A 4LREA 1RK8A 2UUBF 2BW7A 2JVOA 3CO9A 1RWMB 2AU0A 2M8HA 4J9OA 4V1Ak 1KDNA 4X65F 3BZQA 3MM6B 1NH8A 1H7XA 1RTJB 2FDNA 1C0TB 2IDEA 4FVMA 4IDKA 4JI8J 4UY85 4K4ZA 1VC6A 3VZIA 4DL5A 1Q8KA 4AE5A 5SUHA 3OVAA 4LFCJ 3H90A 2FVSA 4ED6A 2PD1A 1L3TA 1R3NA 2D3ZA 3GMGA 1KN6A 3HCXA 1RT7A 2UU9F 3A8EA 3RB0A 1YRUA 4IOAQ 3C16A 4JV0A 3VR1A 4HL9A 3LPEA 1G4CA 4IH7A 3PIPQ 2B4UA 3K17A 4IG0B 4U67Q 2J6UA 5ETKA 2XZDB 5CH7B 1WOPA 5CYMB 3W3SA 1U2CA 3FMBA 3UW1A 3ZTPA 2MGZB 1KD1T 4DWIA 1S4FA 1Y3JA 1FX4A 4F04B 4TU7A 2HWHA 5DZ7A 2RU9A 1FE4A 3HSDA 3PTWA 5EX0A 4C8OA 3W61A 4A8FA 2E7VA 2IPOB 4PG8A 1I51B 4LSLA 1X0PA 4Z37A 2RHQB 2CZVC 3CD5A 5HMZA 5L8RC 2FHMA 4CQ1A 1UW9A 5IXUA 5T41A 4DQRA 1JNRB 4B9SA 4DX5A 2B51A 2K06A 3ZTSA 4LF5F 3OFEA 1GK8A 4LUBA 8AT1B 2QC3A 3ILOA 2YH1A 4DSJA 3VGUA 3ISZA 4TLQA 1SCJB 1JLQA 1RWNB 1QAYA 2ZOMA 1WELA 3KK1A 2HW3A 1IKWA 3OR1B 2HLTA 3DMJB 2HNYA 4WFBQ 3KFWX 4AFFA 3CCZA 1U1KA 3ENVA 4M5KA 3RBEA 4IYQA 3S1TA 3VCDA 1HPZA 3ZZ0A 5AJ3J 1WG1A 3GPAA 5DS7A 1FRXA 1RTIA 2SXLA 2ZH9A 5B7WA 5K8PA 3UD3P 4Y2IA 1FX2A 2OEKA 3DN9A 3MEKA 3F56A 1VMBA 3DLEA 2LECA 1NK4A 2QLWA 3MMBB 3NGTA 4LR8A 5JMNA 5EGYA 4X64F 4UQGA 4CLSA 2PC6A 4A8WA 1S6OA 1GTEA 4ILLA 3N28A 2OFGX 4GO7X 4LVOP 4RW4A 4A46A 2HHXA 4NZ6A 2HHPA 1SJRA 1Q0NA 2EK6A 2G2YA 1L5UA 4U8VA 1HL6A 3MECB 3LP1A 2L9DA 2W7PA 4LVNP 2WVDA 2XMTA 4RW6B 3QGGA 4NZ7A 4USUA 4YHHF 4PUOB 1YRXA 4RPFA 1D3WA 1SC4B 4LMZA 1FVSA 1D9DA 2R7VA 2RIJA 3POTB 4ZPVR 1XR5A 1JLAA 2YX1A 3JXOA 4CYUB 1CJVB 4H4KC 3MM6A 2BQ3A 2E1CA 2ZVSA 2QSWA 3IM9A 2OELA 4LR7A 1C1BB 5A8KB 4HH1A 5F8NA 2RD5C 3CTRA 3CPWR 1X4GA 3K8WA 1S77D 3MUVP 1K1SA 2PA3A 2JJ4D 2VPZB 3D3BJ 4CWBA 3QPIA 2RRNA 4JV5F 2AJ1A 2V2QA 3QQCD 3M8SA 3NXZA 1QDUB 2CADA 1IBCB 4M1KA 3KYLA 1BUXA 2PN6A 5U47A 4RUCA 3MR3A 3K57A 1GTHA 2Y0BB 5K5MA 4NLWA 1UPPA 2H9ZA 2QT7A 3J81U 4OYPA 3KLVA 2BDPA 3UQSA 2C1EB 1NJYA 2V50A 1S1XA 3BR9A
chains in the Genus database with same CATH topology
4YY3J 4KYZA 5A2QU 1N36J 2UUAJ 4PWWA 4LF6J 2MQ8A 4NEYA 4V1Ak 4DR6J 4DV6J 4JI8J 4KY3A 4AQYJ 2VQEJ 4OX9J 3R2CJ 1HNXJ 4RJVA 4JI1J 1XMQJ 4LFCJ 4DR4J 2MEWA 4GKJJ 2UUBJ 2VQFJ 4B3SJ 4JI3J 5FLXU 2ZM6J 2UUCJ 5IWAJ 4LF5J 4JI5J 3J7AN 1XNQJ 2UU9J 4DV1J 1N33J 2KVQE 5IT9U 4JI0J 5LMNJ 4NXNJ 2MTLA 4YHHJ 4DV3J 4B3RJ 1XMOJ 3T1YJ 2HHHJ 4DUZJ 4LF4J 4LF7J 4DR5J 1IBKJ 4X64J 1I94J 3R2DJ 4JI6J 5LMUJ 4KHPJ 3OTOJ 1N34J 1IBLJ 5AJ3J 2UXCJ 4X62J 4HHUA 4DV7J 2KL8A 4NEZA 4B3MJ 4LFBJ 4JV5J 4DUYJ 2E5LJ 4K0KJ 1FJGJ 4DV0J 4JYAJ 1J5EJ 4GKKJ 2UXBJ 1XNRJ 4X65J 4DR7J 3W1YC 4JI2J 3D3CJ 4LF8J 2F4VJ 3JAMU 4B3TJ 4JI4J 1HNWJ 1HNZJ 3J80U 5LM7E 2UXDJ 3D3BJ 4NXMJ 1IBMJ 4X66J 3IMQJ 4DR2J 1N32J 4DV4J 1HR0J 3T1HJ 4JI7J 4DV5J 3J81U 4DR3J 4LFAJ 4LF9J 4DR1J 5BR8J 4DV2J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 J;  4KYZ A;  5A2Q U;  1N36 J;  2UUA J;  4PWW A;  4LF6 J;  2MQ8 A;  4NEY A;  4V1A k;  4DR6 J;  4DV6 J;  4JI8 J;  4KY3 A;  4AQY J;  2VQE J;  4OX9 J;  3R2C J;  1HNX J;  4RJV A;  4JI1 J;  1XMQ J;  4LFC J;  4DR4 J;  2MEW A;  4GKJ J;  2UUB J;  2VQF J;  4B3S J;  4JI3 J;  5FLX U;  2ZM6 J;  2UUC J;  5IWA J;  4LF5 J;  4JI5 J;  3J7A N;  1XNQ J;  2UU9 J;  4DV1 J;  1N33 J;  2KVQ E;  5IT9 U;  4JI0 J;  5LMN J;  4NXN J;  2MTL A;  4YHH J;  4DV3 J;  4B3R J;  1XMO J;  3T1Y J;  2HHH J;  4DUZ J;  4LF4 J;  4LF7 J;  4DR5 J;  1IBK J;  4X64 J;  1I94 J;  3R2D J;  4JI6 J;  5LMU J;  4KHP J;  3OTO J;  1N34 J;  1IBL J;  5AJ3 J;  2UXC J;  4X62 J;  4HHU A;  4DV7 J;  2KL8 A;  4NEZ A;  4B3M J;  4LFB J;  4JV5 J;  4DUY J;  2E5L J;  4K0K J;  1FJG J;  4DV0 J;  4JYA J;  1J5E J;  4GKK J;  2UXB J;  1XNR J;  4X65 J;  4DR7 J;  3W1Y C;  4JI2 J;  3D3C J;  4LF8 J;  2F4V J;  3JAM U;  4B3T J;  4JI4 J;  1HNW J;  1HNZ J;  3J80 U;  5LM7 E;  2UXD J;  3D3B J;  4NXM J;  1IBM J;  4X66 J;  3IMQ J;  4DR2 J;  1N32 J;  4DV4 J;  1HR0 J;  3T1H J;  4JI7 J;  4DV5 J;  3J81 U;  4DR3 J;  4LFA J;  4LF9 J;  4DR1 J;  5BR8 J;  4DV2 J; 
#chains in the Genus database with same CATH topology
 2ACM A;  3DRR B;  3GYX B;  3SSR A;  3TJ8 A;  3QGH A;  1YKW A;  1ZM2 A;  2AZ1 A;  4A8S A;  1A6L A;  2J9D E;  2BJE A;  3H5Y A;  2OTL S;  2UUA J;  2D74 B;  5M2R A;  3FBF A;  4PXC A;  1EHW A;  4TU9 A;  4JOU A;  5LXY A;  4DSL A;  1PSD A;  4CLZ A;  4CH7 A;  4L3K A;  1Z4U A;  3BDE A;  4E2F B;  4M5M A;  5LL6 d;  2DGQ A;  5JVG Q;  4WXO A;  5K14 B;  3BGR B;  5KOW A;  3T5L A;  2EFG A;  3FCV A;  3GJS B;  1EKR A;  1LXJ A;  3CED A;  3I96 A;  2QL9 B;  3L7O A;  4MIA A;  4OMF G;  1FNM A;  4KHR A;  2DNH A;  2ZKU A;  3QT8 A;  4P73 A;  4C0B A;  5M2U A;  1VHI A;  4DL2 A;  2MEW A;  1EKS A;  2YTC A;  4IO1 A;  2J0Q D;  1M5P C;  4OZ5 A;  1FRH A;  1TKT B;  2B5J A;  2VAS A;  2XC9 A;  1DTT A;  2MHN A;  1F5B A;  2E7X A;  2KJV A;  2OLW A;  4USK A;  3WC0 A;  3P96 A;  2MXY A;  1U8S A;  2CWX A;  3GSD A;  3UN3 A;  3OJU A;  3MXH P;  1HD0 A;  2YPZ A;  2DEI A;  3C6T A;  1TKZ B;  2AZ3 A;  1RTZ A;  2V9W A;  1HHT P;  3M30 B;  4JI5 J;  3HK2 A;  4KGV B;  3NS7 B;  4QU7 A;  4HTJ A;  2HGL A;  3HZE A;  4O3P A;  2JEF A;  1PBU A;  1TMJ A;  1ZOT A;  2H5I B;  4ERD A;  3QJL A;  1FO1 A;  3UNY A;  3QZ8 A;  1GQE A;  4ID5 B;  1T9Y A;  3DHW C;  1VOM A;  5LMN J;  1RWU A;  5ETO A;  4F3M A;  3RW7 A;  2A1B A;  3G87 A;  3HM9 A;  3Q8Q B;  5AXL A;  3BGO P;  3GE9 A;  1YX2 A;  1MU2 A;  2KI2 A;  2VBY A;  2B0G A;  4IRK A;  4DG1 A;  4DCP B;  2ILY A;  2OGU A;  1QSL A;  3A8K A;  4GO5 X;  3LGH A;  5GAE I;  4LF7 J;  3KLI B;  2XY5 A;  5DQI A;  4LFC F;  3GYG A;  2RKI A;  2JHE A;  5F0W A;  1FXL A;  3EDQ B;  1TKX B;  2CNN B;  4WYL A;  3Q2T C;  1S0V A;  2H1Y A;  4Y3C A;  3JSR A;  1KSP A;  1LQ9 A;  3CJS A;  3JTP A;  1F3F A;  2VPW B;  3C6U B;  3D7S B;  4TXS A;  1HWL A;  3KOA A;  2DR6 A;  4PQU B;  2VC1 A;  2ZJP Q;  4HHU A;  4J9V A;  3IWN C;  1UVI A;  1SIZ A;  2BAN A;  1TV6 B;  4ECV A;  2YQ3 A;  3DDI A;  2XY6 A;  1VBZ A;  4O4G B;  1U7L A;  2JL9 A;  5D0H A;  3CWJ A;  1OY9 A;  1UVN A;  2DNQ A;  5C42 B;  3H2U B;  1FJG J;  1K9M T;  4RUA A;  2W9A A;  4WZQ A;  2HIQ A;  3M6W A;  4H4M B;  5C25 B;  3QLH A;  2LDY A;  1B7Y B;  3UVJ A;  2XM3 A;  2DH8 A;  2BA9 A;  4CO5 A;  2RUS A;  2DVI A;  2ZZN A;  2V67 A;  2R2U A;  2P5V A;  1HYS A;  2DHA A;  5D4N A;  1R8C A;  1N5Y B;  1YRT A;  3ENA A;  2LEP A;  3EXY A;  2NYI A;  3KHR A;  4DR7 J;  2V6A A;  2ZFH A;  2E44 A;  1N48 A;  4LF9 F;  3OSN A;  2OPQ B;  1JLG A;  1V6H A;  2XO7 A;  1K47 A;  5I3U A;  4U7U D;  3GP9 A;  3CIZ A;  4OX8 A;  4GKK F;  2ZHO A;  3IS9 A;  1JMT A;  2CQB A;  4FYV B;  4CLF A;  2HQF A;  3QBC A;  3R5C A;  3QGI A;  3TEH B;  1CQM A;  3NAI A;  3KJQ B;  4DPW A;  4QJV A;  5C24 B;  3TUZ C;  3RR8 A;  1HWU A;  1TP7 A;  2DGU A;  3M8W A;  2B3T B;  3MUR P;  5D3G A;  2V9K A;  2OTJ S;  3NP5 A;  4DR1 J;  1X5T A;  3Q89 A;  1D9A A;  1FTR A;  1TKZ A;  2PA8 D;  2QMW A;  2DXE A;  4DV1 F;  2DPJ A;  2F9J A;  4CLK A;  2HQD A;  2Z4P A;  2FJV A;  3D6M B;  3MCM A;  4H4O A;  4PXB A;  1RTH B;  4MFB A;  4I4B A;  2KB2 A;  4USH A;  4RNN A;  2MQ8 A;  4C98 A;  2MGZ A;  4DLG A;  1NLK L;  4Q43 A;  3SCI E;  3SQG A;  3G6V A;  3Q83 A;  3KHH A;  2MLX A;  4EO6 A;  4EBD A;  4FBU A;  4CP5 A;  4DV2 F;  1VI7 A;  1X7V A;  1R8P A;  1AW0 A;  3BB5 A;  2UUT A;  1OYD A;  4LSL B;  1CC7 A;  3MM9 B;  2NZ4 A;  3MPU B;  2EFO A;  2KVI A;  5KG0 A;  4ZLJ A;  4DMZ A;  1R8A A;  5HQ8 A;  1ARO P;  1S1T A;  3BV8 A;  1LW2 B;  4ZCL A;  3OJS A;  2IRX A;  2OD6 A;  3UCG A;  3FQL A;  4ITS A;  3OTD A;  3B82 A;  1KQG B;  4DPT A;  2Z56 B;  1TKX A;  1RAO A;  4DPO A;  2CJB A;  3D4J A;  4J9U E;  2FHJ D;  1X4A A;  2R2T A;  1KS2 A;  1RAI B;  2JH3 A;  2HK2 A;  1FK9 A;  2PGC A;  4CLP A;  4Y00 A;  1EAY C;  2W2P P;  2MLY A;  1Y10 A;  2IM3 A;  4HLB A;  3TA2 A;  1VS3 A;  3M8P B;  4KHP F;  1H74 A;  4I7F A;  3T3F A;  4X4U A;  2DRA A;  2XS7 A;  3TR5 A;  4HDH A;  3W9H A;  2AGQ A;  1IN0 A;  1ZA1 B;  2HKE A;  2I2Y A;  3MD1 A;  3UDL A;  4P7T A;  1RB0 A;  1FFG B;  1MN9 A;  1FRL A;  2C2R A;  4QCL A;  1F5A A;  4B3M F;  3SCJ E;  4JP8 A;  4QPT A;  4R8U A;  1TFW A;  3TOQ A;  4MH8 A;  3TVK A;  3MM7 B;  1H72 C;  2DT9 A;  3P45 B;  1NDL A;  4ZA1 A;  4QBU A;  1VQP S;  3N0V A;  4KQZ A;  2XEX A;  1VBY A;  3MOJ B;  1BMQ B;  2G2Z A;  2XMM A;  5CCL A;  2DRB A;  1WC3 A;  1NO8 A;  1WHX A;  2BAB A;  3DM2 B;  3ITH B;  4FXD A;  1N6Q B;  2WW8 A;  3L9Z A;  1YTY A;  2DGO A;  3MCO A;  3WZ0 A;  1X5O A;  3QSY B;  5BXI A;  4XDC A;  4K5S A;  3J7A 1;  2LYV A;  4C8Y A;  3H0P A;  8RUC A;  2GJI A;  3C14 A;  2N3L A;  2VA3 A;  3OTB A;  4R0E A;  4RNH A;  4XAK A;  4WKY A;  4P2X A;  1CJV A;  4NRT A;  4XDD A;  4XPE A;  1JKH B;  3O8W A;  2F65 A;  4ECQ A;  2XLJ A;  3JAM Y;  1C1B A;  5A8K A;  4DLE A;  1FEE A;  2WRM A;  2AJ2 A;  3FC9 A;  2E5L J;  3MR7 A;  4OHZ A;  1VJW A;  1LKZ A;  3OTE A;  1QTM A;  2ZC3 A;  3QIP B;  1N36 F;  4NLQ A;  3QJJ A;  1VDH A;  4PCQ A;  3CJ2 A;  2GQC A;  2E9T A;  1IR2 A;  3TQE A;  5HQM A;  1TKD A;  2KT3 A;  4K4S A;  4WKR A;  1LEO A;  4OZ3 A;  1OQ6 A;  3GWC A;  4HEA 9;  1VQL S;  2DY1 A;  1RTH A;  4MFB B;  4PG7 A;  4GC7 A;  4ZJL A;  1UVJ A;  1HAR A;  1RHU B;  3QFH A;  2YNG A;  2HQC A;  5IQ6 A;  3EWG A;  4F4K A;  1QSS A;  3V6J A;  3G8S A;  2WW4 A;  4OZ1 A;  5AXK A;  2G4B A;  2M0G B;  1JXV A;  1GMV A;  3I9V 9;  4MIB A;  1TL1 A;  3S6E A;  3V6D B;  3RRK A;  2HAF A;  3FGV A;  3FZ2 A;  4CO4 A;  2W9B A;  3G6X A;  3BGR A;  2QL5 B;  2HHW A;  4DOZ A;  2BJ1 A;  4DPU A;  3M9O B;  2V8D A;  3BKF A;  4RW8 A;  1EJ7 L;  4DX8 H;  2VD3 A;  3KDN A;  5E5N A;  3VVU A;  2ZH6 A;  3A12 A;  2IM0 A;  2RS8 A;  2D1C A;  3LP1 B;  5KG4 A;  8ATC B;  3DOL A;  1SH2 A;  1XER A;  3MR5 A;  2G1D A;  4IO9 Q;  5DLF A;  1FKO A;  1LXN A;  4OZL A;  3M6X A;  5IQQ A;  2KFY A;  2PI4 A;  3FEZ A;  1HBN B;  4KH0 B;  2FLN A;  3DKD A;  3UDV A;  5DGB A;  4I7F B;  2OD4 A;  4BCA A;  3DOK B;  4F0K A;  2A3J A;  4LBH A;  1FES A;  1F1B B;  4CCH A;  2VL1 A;  3AY0 A;  3W65 A;  2VON A;  3M30 A;  3HHE A;  3JQJ A;  2BXJ A;  3ILJ A;  3M4X A;  3CW2 C;  4HDG A;  4K0K J;  1T95 A;  4L74 A;  4DCO B;  2IRU A;  3AH6 A;  3PJX A;  2IRY A;  3UDE A;  4Y6I A;  4Q44 A;  1GH8 A;  2B6A A;  3KK2 A;  2AGP A;  1K73 T;  1APS A;  2PFF B;  2HWI A;  1SBR A;  2VPY B;  2XHC A;  1QUP A;  3OXG A;  1ZET A;  4Y65 A;  2BE2 A;  5FLX Y;  2W2Q P;  2ZEJ A;  4OYM A;  2VB6 A;  5KFM A;  5KFD A;  2FUG 9;  1VGY A;  3DRR A;  1X4D A;  2ZOG A;  3MAA A;  3PJ9 A;  4RBV A;  3DYA A;  1I3O B;  2BRK A;  2HMI B;  4YY3 F;  5J2Q A;  1KEK A;  2NPF A;  5GAH U;  3ISN C;  4K4U A;  1WOR A;  2WBM A;  3NCR A;  4OX7 A;  1SL0 A;  4EUV A;  1DRZ A;  1JKH A;  3N5F A;  2BJ9 A;  5CD4 H;  3HHL C;  3E01 B;  4ZN3 A;  2AYG A;  4ZLL A;  2X1B A;  4AL5 A;  1REV B;  4DV1 J;  3PJW A;  1PAE X;  1V9O A;  2KVQ E;  3RB4 A;  4G1P A;  2HGN A;  3I32 A;  1V3S A;  2C2K B;  4NYZ A;  2G0J A;  2QFJ A;  1G7C B;  2G13 A;  3IGV A;  4P72 A;  1IXK A;  1YK9 A;  2A2C A;  3O2I A;  4QIW D;  3MPD A;  3UI3 A;  3MHY A;  1TK5 A;  4N41 A;  3F41 A;  3HHL D;  3OVB A;  1HQE B;  1WDT A;  2HHH J;  5D0E A;  1FEH A;  3CJ4 A;  3HVT B;  2NUU G;  3GIL A;  4RKU C;  3SDE B;  2GHW A;  4OZN A;  3BKU A;  2KZZ A;  4FF4 A;  4NLY A;  4FPR A;  3DOM A;  4Y0F A;  2Y8Y A;  1URR A;  3EMT A;  3R2D J;  4GKJ F;  2XCP A;  1G2E A;  5E3R A;  3I5A A;  3NGU A;  1UWA A;  3PYG A;  1JNZ B;  1QM9 A;  1KHW A;  1KFD A;  2BBE A;  5KFG A;  2YWH A;  2DH7 A;  1NZA A;  2YKQ A;  3K5O A;  2BV3 A;  1HI8 A;  3CO0 P;  1SIW B;  4RWW A;  3BBB A;  3EPG A;  3CCV S;  1MW7 A;  3CSK A;  2J8S A;  2VC0 A;  1XN9 A;  5HMX A;  1VQ4 S;  4ANE A;  2BE9 B;  1FER A;  4NLS A;  4CTA B;  4FF1 A;  2IM1 A;  4GVB B;  4N47 A;  1VQO S;  2QFI A;  4QWA A;  4DFJ A;  3T6B A;  1B3T A;  4NCA A;  1A7G E;  4RNM A;  2JEG A;  2V68 A;  3MMA A;  5KFX A;  2JZ5 A;  3VAJ A;  2VV5 A;  3IXQ A;  2M70 A;  2N7Y A;  2V63 A;  2R8K A;  5CQG A;  4KE5 A;  5J1E B;  4OI1 A;  1JLQ B;  3GG0 A;  2M88 A;  2V2V A;  2P9E A;  4P71 A;  2VOO A;  2BMB A;  3AB4 B;  3GJR B;  4ELU A;  1HNZ J;  1HI0 P;  4USI A;  2YY3 A;  5F8H A;  2RSQ A;  2BAN B;  3H25 A;  5JVH Q;  3JYT A;  2CVI A;  1ZYQ A;  2W4D A;  3M2U A;  1NZ8 A;  5KOX A;  5CA5 A;  3LGM A;  2J0X A;  4RUH A;  3CD6 S;  4A8M P;  4X4S A;  2RUG A;  5HJX A;  5F8G A;  1E6V B;  1VRU A;  2F8H A;  2LQJ A;  3OD2 A;  4H4M A;  4RW7 B;  2V2K A;  4C7Q A;  2U1A A;  3DGP A;  3UD5 A;  1CC8 A;  1HQU B;  5L1I A;  4DV5 J;  1M5O C;  1P1L A;  4DS4 A;  4C11 A;  1A0O B;  4ZPA A;  4BS2 A;  2CPD A;  5CHC B;  4PYD A;  4Z7C A;  1R8H A;  2VUG A;  2WVC A;  4ED1 A;  5KFT A;  3BSN A;  2LLZ A;  2ZVI A;  4TNO A;  3TZW A;  4X4T A;  1FNO A;  1BQM B;  1K1Q A;  4YME A;  5GMD A;  1NHU A;  2KH9 A;  3JQK A;  2DNG A;  1WEY A;  2GCF A;  1P9Y A;  5IT0 A;  2JX2 A;  5I3U B;  1HNZ F;  5BYR A;  4NEY A;  1RT2 A;  4P6Q A;  4DL7 A;  3J7Z T;  4ZPT R;  5C2G A;  3GB0 A;  2J9C A;  4HKQ A;  2QLB B;  2V4J B;  4I2Q B;  4MKB A;  3R8Y A;  3EPI A;  3HSJ A;  2HHS A;  2E5H A;  3BEG B;  2Z58 B;  3MF5 A;  3NNC A;  2LMI A;  3A1Y G;  3ADA C;  1NXI A;  7AT1 B;  1HQE A;  2RDI A;  3RAX A;  3TI0 A;  1VRT B;  1U0H B;  4RU2 A;  1NHV A;  4CDI A;  4OV1 A;  1L3K A;  5GVQ A;  3A8J A;  3BPD A;  5L38 A;  2VQF J;  1CVJ A;  4NLR A;  1RZM A;  2CDR B;  2VFT A;  1TUW A;  2DXF A;  2W01 A;  2KN4 A;  5EWG A;  5K20 B;  1T3O A;  4N7T A;  2RQC A;  2Z57 B;  2CQG A;  3L3C A;  3EVM A;  1DUR A;  2WB1 D;  3VHQ A;  3J7A N;  2QN6 B;  4F0H A;  2N7C A;  2DO4 A;  2ZDO A;  3THV A;  2CNO B;  1G6B A;  4QIG A;  2FVQ A;  1TR0 A;  2O67 A;  3GR1 A;  5ETQ A;  4YR0 A;  1T05 A;  5A6P A;  1U1R A;  4DN9 A;  1C4C A;  2MKI A;  1R8B A;  3T1Y F;  3BGF A;  1YG0 A;  2VKZ G;  1NK0 A;  4K0K F;  5KFR A;  1BY9 A;  1OMS A;  1S6P A;  5EDW A;  4HT7 A;  3NWG A;  1YLX A;  2W9C A;  1F9E B;  2LXI A;  2LU2 A;  3M8R A;  2DHS A;  3D1O A;  4ZMM A;  2K7K A;  4A8Y A;  1UA1 A;  5ETS A;  4LFB F;  4YN3 B;  4L6V 3;  1K44 A;  3PO5 A;  1N33 F;  3UR3 C;  3KJV B;  3AOB A;  5KFW A;  3FSY A;  4UST A;  1QY7 A;  4JYA F;  2GGP A;  1CUL B;  3I0S A;  2UV8 A;  3VAG A;  1N34 J;  3B4D A;  1PC5 A;  2ASL A;  4FZV A;  2XG8 A;  3NNA A;  4FYD A;  1NND A;  4K4Y A;  2QV6 A;  2UVV A;  1N0V C;  4FKX A;  1N88 A;  2MY7 A;  5J2M A;  2CDQ A;  2JLG A;  4RW9 B;  3M8Q A;  3FRZ A;  3RRG A;  3DGP B;  4W90 B;  2QMX A;  4F67 A;  1D09 B;  2YNH B;  2B8Q A;  4F02 A;  4ZLN A;  2XGQ A;  5L1K A;  4U8Y A;  2X1G A;  2I1R A;  4F4X A;  1RTD B;  2P9G A;  4KKO A;  3EXC X;  4RW6 A;  1YQH A;  1ZM4 A;  2PE8 A;  3E2E A;  3B8H A;  3PFE A;  4DJB A;  2GFF A;  3Q8Y A;  2Z2M A;  4CLW A;  5KT4 A;  1CJT B;  3M32 A;  2D9P A;  2C3U A;  4X65 J;  3Q24 A;  2HRU A;  4WXW A;  1QVF R;  1PKU A;  4KAI A;  4QR0 A;  3QGP A;  1MG7 A;  4RWX A;  1N34 F;  2AP6 A;  1GMW A;  2ADC A;  4OIX A;  1XK8 A;  2D9O A;  5GAG I;  2JEJ A;  1N32 F;  5DGA A;  3MR2 A;  1SL1 A;  3AJ2 A;  4NAS A;  4C0H A;  2V8H A;  2AYM A;  1JJH A;  1GT8 A;  2JOQ A;  3D9B A;  3IMQ J;  4MT1 A;  2RU3 A;  5DET A;  1M1H A;  4O3N A;  1NDC A;  4ATN A;  3IG1 A;  1NRK A;  4WFY A;  4X4P A;  4JI7 J;  1SH3 A;  2NLW A;  3MM8 A;  3JTO A;  1N0U A;  5BR8 J;  4J9K A;  1UJ6 A;  2KT2 A;  2DB1 A;  4ZVP B;  2OH2 A;  2HFO A;  3H98 A;  2BJ7 A;  1S0M A;  1Q7Y T;  1S5Z A;  4F4W A;  1PYS B;  2IHR 1;  3MMC A;  2J7W A;  4Q2L A;  2RIL A;  2J7K A;  1Q1K A;  3MD3 A;  2FGC A;  4WZM A;  1U24 A;  4NXM F;  1BHN A;  2HGM A;  2R8G A;  4M5J A;  3ZZZ A;  4M5D A;  1LV5 A;  2E9Z A;  1B0T A;  2GMH A;  2R9L A;  2ZNZ A;  1IM6 A;  1KR4 A;  1OSC A;  1DLO B;  1T9T A;  3K5P A;  4M5H A;  4DCJ B;  1UFW A;  2IM2 A;  3E01 A;  4YFU A;  4OX9 J;  1VQ6 S;  3T5K A;  2ZNY A;  2ASY A;  2DBB A;  4RJV A;  3KLG B;  3W2W B;  4UOG A;  4PAB A;  1WC5 A;  3QMQ A;  4YEA A;  4CNY A;  3PKM A;  2E5G A;  4WP3 A;  3W64 A;  1X9S A;  2GA7 A;  1RSC A;  3LF0 A;  2UUB J;  2F4F A;  1X9M A;  3ZTR A;  3ZFV A;  5KFO A;  3FDS A;  1KFS A;  2RML A;  1QAX A;  3MEG A;  4CNZ A;  4J90 A;  4RBU A;  1RAD B;  3CJ8 A;  2BJ3 A;  3AT1 B;  1WEX A;  1NJX A;  3R3T A;  4JI8 F;  1Q16 B;  1FD8 A;  3I31 A;  1QD1 A;  2KJW A;  2ZM6 J;  1LK7 A;  3BYP A;  3HSG A;  4ED5 A;  1TL7 A;  5CXT A;  2HK3 A;  4ICL B;  2MQN A;  4C4W A;  2NXJ A;  3R7S B;  2FYX A;  3GLJ A;  3W66 A;  4ZCK A;  3HT3 A;  5L1L A;  2UU9 J;  1F5C A;  4DV0 F;  2I38 A;  4OX9 F;  4P7V A;  4AD6 A;  1C0U B;  4G6V B;  2ASJ A;  1H38 A;  3GV5 B;  4DL3 A;  2ZH7 A;  2PMH A;  4A8K A;  2H48 B;  2BE2 B;  4B3R F;  4M5L A;  5F9N A;  3MED A;  3IWL A;  1L3U A;  1GX6 A;  1S12 A;  3CDA A;  2EBE A;  4ID8 A;  3OFG A;  4KBI A;  3U02 A;  3WIU A;  4YR3 A;  3QZ7 A;  1WKL A;  3Q8S B;  2ZBI A;  4RO0 A;  1X4B A;  2EFQ A;  2VG5 A;  1PBA A;  3K7R A;  5IC4 B;  4AYB D;  4U9R A;  3IBC B;  1LW2 A;  1FJ7 A;  3J81 Y;  3WHI A;  1NME B;  4OZ2 A;  5D0R A;  2OHD A;  1SV5 B;  2K3K A;  1HMV B;  4ZHR A;  3HDS A;  3J7Z 5;  1RWX B;  2VQF F;  3EM1 A;  3BH7 B;  2FQQ B;  4O3S A;  1C2P A;  1S9E B;  1CJU B;  3ET6 B;  4IH6 A;  4K2X A;  3QRQ A;  4M63 A;  2UXC J;  1JIH A;  1PCA A;  3EYZ A;  3PX6 A;  2MHE A;  2C28 A;  4EBC A;  3PW4 A;  3V81 A;  1VQ8 S;  2E66 A;  2HZC A;  2KL8 A;  2LA4 A;  2QTW A;  1X8D A;  3ELH A;  2M5Y A;  2XUL A;  1WKK A;  3LTO A;  2HHV A;  1OIA A;  1V5I B;  2DHH A;  2HZA A;  4DUY J;  3IBW A;  4J37 A;  3RUB L;  3KMS A;  4DF4 A;  4WK3 A;  4TU8 A;  4WFX A;  4N76 A;  1O51 A;  2I9S A;  3MMC B;  3N6L A;  1U09 A;  3P4U B;  4I67 A;  4G1I A;  2UXD F;  5KFJ A;  3K5N A;  1O0P A;  2X3D A;  4HAC A;  3TO8 A;  3W8G A;  3TAN A;  2XBP A;  4DV7 F;  1FRK A;  3GFZ A;  1BQN B;  3MEE B;  1W7W A;  3CD7 A;  2X51 A;  3LOU A;  3EX7 B;  5DDQ C;  2ZH3 A;  1RUS A;  4KO0 B;  2XS2 A;  2F4V J;  1FFS B;  1RDR A;  1SB6 A;  1X5S A;  1WOO A;  2LVW A;  4PG5 A;  5EWE A;  4DFP A;  4IQX A;  4N8N A;  1OQ3 A;  2BX6 A;  3J80 U;  4OHV A;  1DBD A;  3LUY A;  3PM9 A;  2YKO A;  2HBQ B;  1RT3 B;  3FCW A;  1UEU A;  3D1Q A;  1EB0 A;  2DIS A;  2MPU A;  5K8O A;  3OL6 A;  3UCZ P;  2WVF A;  1UVK A;  1TVR A;  4NML A;  1T02 A;  3JQM A;  2HLU A;  2MQM A;  2ZE2 B;  3FQK A;  4G1Q A;  4DV4 J;  3V6K A;  3NBP B;  3W63 A;  2R2S A;  3MCN A;  1MRO B;  1TTH B;  1IKV A;  3R5G A;  1P27 B;  2LQ9 A;  1UKU A;  4KRW A;  4DS5 A;  3AAW B;  2Y1I A;  1HLW A;  4EO8 A;  3QNW B;  2R8J A;  4J9N A;  4YDD B;  4IOC Q;  3DXS X;  2QA2 A;  3UPF A;  3D2W A;  4LFA F;  3O44 A;  2ZOF A;  1Q5Y A;  3ZZY A;  2XMA A;  2RRB A;  4MAK A;  2ZH4 A;  3TP2 A;  2HQ3 A;  2HNZ A;  1NSQ A;  1ZTW A;  2F4V F;  1EQM A;  2UXC F;  2CKW A;  4X84 A;  3R9L A;  3B78 A;  1WF0 A;  3TRG A;  5HVH A;  5LSL A;  1S99 A;  3DLE B;  3EJM A;  3NWR A;  2KG0 A;  2D3O 1;  2IA0 A;  1BQX A;  1PIL A;  4UQT A;  1PJ6 A;  1KWM A;  4MK7 A;  2XSJ A;  1I1G A;  1TL1 B;  3M6V A;  4UUW A;  3OLA A;  5H9F J;  4B08 A;  4QU6 A;  1S1T B;  2CNK B;  1UFK A;  1H98 A;  4MIW A;  2DR7 A;  2MYF A;  2B56 A;  4I2P A;  4WWS A;  4C8K A;  2Q66 A;  1HNW F;  2K1R B;  3BGU A;  1NB7 A;  4F8R A;  1GAO A;  1IWA A;  1S1U B;  2VG7 B;  5HVG A;  3PIO Q;  5HLF A;  2BJD A;  4Y2A A;  4DUZ F;  3Q8P B;  2NUH A;  4NYP A;  4KH1 B;  4ZOS A;  4H54 A;  4TLR A;  4FNI A;  4KR0 B;  1F2H A;  2KRB A;  4OYO A;  3VAL A;  1CJU A;  1FKO B;  4J9P A;  4BHQ A;  1BLU A;  1RT2 B;  4KPY A;  1NUE A;  1UWB A;  4QWE A;  1V5V A;  3H7H B;  4HVZ A;  4IKA A;  4DQI A;  4KGM A;  2IJR A;  2HRT A;  1VBX A;  3O1L A;  2KFZ A;  1VLY A;  1MMD A;  3CCQ S;  2DIV A;  2P9C A;  2JFD A;  3LP0 B;  1KQS R;  4UOF A;  4WTY A;  2VF3 A;  3A8I A;  2EG2 A;  5C7P A;  1S76 D;  1U25 A;  3CC4 S;  3GR0 A;  4JI0 J;  3DRP B;  4UY8 T;  2UZA A;  3SBM A;  2M3D A;  5LMU F;  3FEX B;  4K2J A;  1CG2 A;  4PXD A;  3GFX A;  4DR7 F;  1YJW S;  4LRA A;  2YQ1 A;  2WOM B;  2AIR B;  4ZPC A;  4CZC A;  4OHY A;  2L9W A;  2QYC A;  2FZK B;  1VIO A;  2CQI A;  3DLK A;  3NGD A;  1Q53 A;  1U6Z A;  3OHA A;  2BEF A;  3KLH B;  3TX0 A;  1I94 F;  4LF4 J;  4PWD B;  2CPJ A;  2IC3 A;  1GMW D;  1SQF A;  3G71 S;  4N8O A;  4DHV A;  2OPR A;  2DNZ A;  2LEA A;  4P52 A;  3T6J A;  1I94 J;  4LF4 F;  2GO8 A;  4OFZ A;  1NK5 A;  2H3E B;  4JI2 F;  2OMO A;  3I4H X;  3IRX B;  2LQB A;  4B3T F;  4KGZ B;  3MMJ A;  4F4A A;  2LU1 A;  5HRO A;  1Q7L B;  1RU1 A;  1Y11 A;  1SC6 A;  4USM A;  1DQ8 A;  1S48 A;  4C48 A;  1NPR A;  1N4L A;  4LF7 F;  4OYI A;  4NCB A;  2EC0 A;  3L7U A;  3NCQ A;  3KK3 A;  4DR1 F;  1IBM F;  2R7T A;  1NJI T;  3CNQ P;  4DQS A;  1WG5 A;  5J2P A;  4DV0 J;  2IDL A;  4CLL A;  5D15 A;  3ENW A;  1IM4 A;  2V34 A;  2W2O P;  3PZP A;  4LSN A;  3KK2 B;  4GKK J;  3W9I A;  1YGY A;  4TY9 A;  4OL8 A;  4WF9 Q;  1WC6 A;  3WX4 A;  5MAO A;  5CD4 A;  1XNR J;  2UXB J;  4Q2M A;  2CPF A;  2JLE A;  2DO0 A;  2HBY B;  1M1K T;  4JI2 J;  4YQW A;  2UXB F;  4J9S A;  2R7U A;  4IFV A;  4B3T J;  3ZO7 A;  2QIF A;  2BQR A;  4LF6 F;  2FTR A;  5I3P A;  2EI5 A;  2R42 A;  4EI2 A;  1RBO B;  4ZVT B;  2IAJ A;  2FJB B;  3D54 A;  4ID5 A;  4F3O A;  2YPY A;  1MWZ A;  4LIR A;  1S6Q A;  5LM7 E;  4RW9 A;  3BF4 A;  3KG1 A;  2R3V A;  3F0N A;  3FJ2 A;  4BBY A;  4YS2 A;  1IBM J;  4F25 A;  1DLO A;  3S8S A;  1IJF B;  1U2R A;  1RIS A;  1MU2 B;  2ALY B;  3M2V A;  4WPA A;  1UTA A;  2XY7 A;  2L3M A;  4KPC A;  5JUM A;  4ECW A;  1ZZF A;  2ROP A;  2O5D A;  3I55 S;  3SV4 A;  3HHN B;  2QE5 A;  1RBA A;  1ZAV A;  5FDL A;  5T14 A;  3M9M B;  3LPY A;  1D9F A;  5LT5 A;  3HFZ B;  1KVI A;  2CQD A;  1QTN B;  2GAG C;  1YJV A;  4DZD A;  4QOT A;  1GNK A;  2D7S A;  3QO9 A;  1LWE A;  2KHC A;  1WSR A;  4R0J A;  3K5M A;  5D4P A;  4M95 A;  2YWW A;  3MWB A;  3PFO A;  3DOK A;  1UW4 A;  2BOA A;  4I6W A;  2RNE A;  4XIU A;  3QRR A;  4W98 A;  1WWH A;  2YH0 A;  2M8D B;  2UUC F;  4LF6 J;  1IWG A;  3D6H B;  3D0G E;  2XCA A;  1X4C A;  3DFE A;  3T1A A;  4KB7 A;  1NM2 A;  1S6U A;  3DLB A;  2GS8 A;  1UEV A;  2XS5 A;  4WE1 A;  4O4G A;  1N52 B;  2IJF A;  5E3A A;  5K9F A;  3R2C J;  4ZDN A;  2HHQ A;  1AZS A;  4USW A;  3D67 A;  2HFS A;  4J7C A;  6AT1 B;  4DR4 J;  1FHT A;  2ZUA A;  1AFJ A;  4O4R A;  1ZA2 B;  2A18 A;  3QT7 A;  2R7Q A;  3TJA A;  3UVJ B;  1N5T A;  3V4M A;  3A3N B;  2ATC B;  4C9D A;  1FWL A;  4PWD A;  4JV5 J;  1WUU A;  4KC5 A;  4RW4 B;  3PEJ A;  2F9D A;  4ELT A;  1N5Y A;  2M2B A;  2D69 A;  3DU5 A;  3QAU A;  2BKP A;  4DU7 A;  5KFN A;  2A6O A;  2OIH A;  2EFP A;  4U6P A;  3C46 A;  1JLF A;  1FKP A;  1HFE L;  2LQ8 A;  2ZDP A;  1Q82 T;  1WG4 A;  4OYB A;  2UUC J;  4K59 A;  1HBM B;  1S59 A;  4YOE A;  4EEY A;  5HRO B;  2GNK A;  1FKA F;  1OJ4 A;  4B9M A;  1OO0 B;  1JLA B;  2EKY A;  2X7I A;  3NGS A;  3PW7 A;  2KXN B;  4F2R A;  4GMK A;  2BUN A;  4RX6 A;  3FSI A;  3LQV A;  1FI4 A;  3G4S S;  1QUV A;  5AT1 B;  2CQ2 A;  3KK3 B;  4OZJ A;  3W2W A;  3TAQ A;  1S72 S;  3KUE A;  3BQ1 A;  1KOO A;  2V4Q A;  2QLJ B;  3HPO A;  5F41 A;  3WDO A;  2BQU A;  3P6Y C;  5ETR A;  3SYZ A;  2GAH C;  3EGZ A;  3NLC A;  5K8N A;  2MZR A;  5DM6 Q;  1EZZ B;  3HVT A;  3VVT A;  2OML A;  1HD1 A;  3EUN A;  1T9U A;  2VFS A;  4CI0 B;  4NL5 A;  3K89 A;  1D1U A;  3ILL A;  2XI2 A;  3SDE A;  1T03 A;  5A2Q Y;  4WJB A;  1IBK J;  1VYA A;  4QIF A;  4NI2 A;  3ETO A;  1RKI A;  3ZTQ A;  1ZZN A;  1NK8 A;  3R97 A;  3H5U A;  3UN5 A;  1Q4R A;  1XWL A;  2A6M A;  3D68 A;  4ALZ A;  4U95 A;  4JI5 F;  3RG6 A;  2QZ8 A;  2C3O A;  3A4T A;  3ZXW A;  1NKE A;  1WD6 A;  2IAJ B;  2J8A A;  4IH5 A;  5B0E A;  1UCN A;  3KG0 A;  4C3M A;  4KO0 A;  1RA6 A;  1D8Y A;  1HI1 A;  4X62 J;  4NRU A;  5DG7 A;  2MQO A;  2HVI A;  3HHD A;  3I56 S;  2XTJ P;  3OV7 A;  3IRW P;  2R7O A;  3U7J A;  2KZM A;  1QJH A;  5KT7 A;  3N9U C;  2FJD B;  4X62 F;  1R7I A;  4KSE B;  4O3O A;  1RAE B;  3SIP B;  4DDF A;  1VQ9 S;  3L09 A;  1FDN A;  3CCT A;  3OQ2 A;  4MJK A;  3C19 A;  2GVZ B;  3P5B P;  5G0R B;  3T41 A;  3TAM A;  5HVF A;  5BJR A;  1TL3 B;  1HKA A;  2GX8 A;  1RAB B;  3B4M A;  4K5R A;  5A8W B;  4CO2 A;  1YHQ S;  1U26 A;  1RHM B;  1UZH A;  3QSI A;  3TUI C;  4RU9 A;  2BE7 D;  4MKA A;  4ZP7 A;  1FWP A;  1NK9 A;  1S49 A;  1KKH A;  5H1S V;  3MOZ A;  5HMY A;  2WK4 A;  3QWU A;  4LF8 J;  3GCX P;  1S9F A;  1UJ5 A;  2YKN A;  4RLE A;  1TUG B;  1RT4 B;  2VFR A;  3BRE A;  3LWL A;  1BWE A;  3M2U B;  3MAA B;  3JS9 A;  2VA2 A;  2EK1 A;  3KNG A;  1S97 A;  1JLC B;  3W2V B;  3DXB A;  3RYL A;  2KYZ A;  4QWB A;  2RH3 A;  3OTO F;  4F26 A;  2HUR A;  4XO0 A;  1PC4 A;  1VBK A;  3LH2 S;  4YDX A;  3PW5 A;  3U1L A;  1RE1 B;  2OEM A;  1U45 A;  2KKH A;  4YB6 A;  4F0M A;  2IJN A;  1R0C B;  2BM1 A;  4ZP8 A;  4F3Q A;  3BBF A;  5HAO A;  3RGI A;  3WBZ A;  3RB6 A;  3MEE A;  3QFW A;  1H2V Z;  2E5J A;  3H2V E;  1RT6 B;  1NSK L;  2RKI B;  2ROG A;  3E51 A;  4LF8 F;  5KFU A;  1RAH B;  3RW6 A;  3TAP A;  4B9V A;  1EET B;  1PIE A;  1W26 A;  3EDR B;  5KG2 A;  2W8L A;  5L9X A;  4FYY B;  1CJK A;  2I5J A;  3PW2 A;  4WU2 A;  2FIU A;  1X5P A;  2ZBP A;  4C0O C;  5LJ5 Y;  2N82 B;  1FRI A;  5D78 A;  5HL7 Q;  3JSB A;  5DM7 Q;  1ZH5 A;  5B0A A;  1TQL A;  3VGS A;  3OR2 A;  3CJK A;  5GAG U;  2J0W A;  1SXL A;  2R2R A;  1UMJ A;  5CZX A;  2GO9 A;  3D0I E;  3M8Y A;  3PO4 A;  1V3R A;  4GKJ J;  2ZZT A;  3B54 A;  5JJB A;  3D0H E;  2CQ0 A;  1CBK A;  5H9E J;  3IBF B;  4KFB B;  2RS2 A;  2WOM A;  3ENQ A;  2DNN A;  4OI3 A;  4X4O A;  2WTF A;  1LNQ A;  3KJF B;  2FVC A;  4YR2 A;  4OYA A;  1NK7 A;  2MKY A;  2V8V A;  3BKT A;  1K0V A;  2H4W B;  4AXI A;  4RUB A;  4CLT A;  1AB8 A;  4E8U A;  1UFL A;  1WC0 A;  4LJM A;  4F36 A;  3V5R A;  2HHH F;  1LWX A;  3TUP A;  4K4V A;  3HSZ A;  2W9B B;  2VOP A;  3DLL Q;  1OY8 A;  5E2Q A;  4NXN J;  3HVA A;  4NMX A;  4A8X A;  4PRF A;  2L08 A;  2MTL A;  5F3Z A;  4EMD A;  2HPU A;  3BO2 A;  1F9H A;  5A8W A;  3DOL B;  4NLT A;  5AXM A;  2B4O A;  1SQE A;  4WP9 A;  2NZC A;  5J2P B;  1NBE B;  1WTF A;  5D6G A;  3MDF A;  4J9M A;  2LDI A;  4B9T A;  2VG6 B;  3AOA A;  4PKD B;  3KLE B;  2VU5 A;  2F7V A;  1OSD A;  1IJE B;  3OFH A;  5ADZ A;  3MEG B;  2C22 A;  3OT9 A;  1Z2Z A;  1F6T A;  3O5T B;  1Q8I A;  1RT4 A;  3I87 A;  4LRD A;  4UUX A;  2OFH X;  2KG1 A;  4PPZ A;  4JI6 J;  1UVL A;  1R43 A;  4KHP J;  3M2R B;  4BWJ A;  3OL7 A;  2IYG A;  2FZG B;  4QIV A;  4TVA B;  4FXV A;  1JXL A;  1JLC A;  4ILR A;  3W2V A;  1T9X A;  2MMY A;  3BN4 A;  4NLO A;  4AL6 A;  3IR7 B;  1CQN A;  1PYT A;  2B6A B;  3N01 A;  1Q8L A;  2MB0 B;  4NEZ A;  1RTI B;  1IR1 A;  2B9Y A;  4E98 A;  1IKY A;  1VK3 A;  3JSM B;  4B3M J;  1JJ2 R;  1YSJ A;  4TY8 A;  1T11 A;  3HKZ D;  5IFM A;  1RTD A;  1RT1 A;  2WON B;  4HI1 A;  4KKO B;  4ZS6 A;  1S0N A;  1F0X A;  3A3P B;  3H5X A;  4PYA A;  3EGV A;  4QIE A;  2R7R A;  3RBZ A;  2NXC A;  3GFY A;  2EWH A;  4NLU A;  2G2O A;  4PR6 A;  2XWY A;  1RP5 A;  3GIR A;  3HHL A;  2AEF A;  4PG4 A;  4ZN1 A;  2ERR A;  3HJF A;  4X4V A;  1VC5 A;  2HVH A;  3QO9 B;  4QWC A;  3DDN A;  1MWQ A;  4L3N A;  1BD6 A;  1SUQ A;  1XTZ A;  4L76 A;  4CO0 A;  2J9D A;  1UPM B;  4DV5 F;  3BSO A;  2I8E A;  1YZ6 A;  2HQI A;  2B7C B;  3POT A;  4ZPW R;  3DGV A;  1WEZ A;  2PMZ D;  1EX8 A;  2OEJ A;  5DDP C;  3ZC4 A;  4J9Q A;  2HSE B;  2YX4 A;  5AXN A;  1FE0 A;  3IAM 9;  4QYZ J;  2HVD A;  1U0S A;  4QZV B;  4GRS A;  1SPB P;  2IIH A;  2PI5 A;  4LQ3 A;  4IG3 B;  2LKZ A;  5J1N A;  1DAX A;  2G9O A;  1RBL A;  1M5S A;  1Y5I B;  4I69 A;  3R7N B;  3SXL A;  3PX4 A;  1JQG A;  2YQ0 A;  1XIQ A;  1JX4 A;  1N5V A;  4O0I A;  2BYC A;  2W2M P;  3BS9 A;  3SSS A;  1X4F A;  1BWV A;  2EPI A;  3Q22 A;  1TFY A;  1ROF A;  2VFV A;  1NJW A;  2CA9 A;  3ZTO A;  5CYJ A;  3DOM B;  3FK4 A;  5E3C A;  3EZU A;  4ILM A;  3I5B A;  4FYX B;  3HKW A;  1T94 A;  3PYD A;  2JSX A;  3R6G B;  2Z2L A;  4AUK A;  4IFV B;  1WF2 A;  3KUH A;  3PEH A;  3V4I B;  2Y0S D;  1KHV A;  3PR5 B;  5J2N A;  1KRP A;  1H0H B;  4YB7 A;  2CJX B;  2WSE C;  1HBM A;  5IM0 A;  3K58 A;  2D41 A;  3L7P A;  3NOC A;  1BC6 A;  3HMJ G;  3CUN A;  2CPY A;  2VOD A;  3DI6 A;  1TAU A;  2KDO A;  3PRV A;  3C15 B;  4P9S A;  4F2S A;  3N5B A;  1HNV A;  2MQL A;  2RAQ A;  2CJA A;  3LP2 A;  3QAE A;  1FF2 A;  4J9R A;  4IUF A;  1ZPW X;  4NCG A;  3P5T L;  4EYI B;  5A0Y A;  4GVB A;  1YBU A;  2H51 B;  1O8B A;  4OJH A;  1YWX A;  4I6A A;  4TYB A;  2HVE A;  4OLO A;  5FDL B;  4M8L A;  3X3U A;  1X31 C;  1ZTT A;  3MMA B;  3OPK A;  2BAC A;  1IKV B;  4QR2 A;  3US5 A;  2E7W A;  5IC6 B;  2WCX A;  3QID A;  3M1V A;  3G86 A;  4OX6 A;  1ZAW A;  2NYH A;  3C6T B;  1XBW A;  1FDA A;  4YUD A;  2BZ2 A;  1PO6 A;  3WIV A;  3ONQ A;  2L41 A;  3W5Y A;  1DQ9 A;  2KFN A;  2HEK A;  3RZA A;  4DR3 F;  1JK9 B;  1FRJ A;  2XMU A;  3H8Y A;  2X1A A;  3RBD A;  4IR1 A;  1HQ2 A;  1RWO B;  3RU0 A;  2R8H A;  3IFE A;  3FFI B;  3VAK A;  2B7B B;  2YNG B;  2AYB A;  2IBK A;  1C0U A;  4DX6 A;  3DLG A;  3SFU A;  2XO6 A;  4IRD A;  2E9R X;  4EWT A;  2FJX A;  2DK2 A;  4OI6 A;  1E6Y A;  2V8G A;  2WAQ D;  4WFA Q;  2MQP A;  3EVW A;  4RBT A;  3AA8 A;  4YB1 P;  2DYA A;  3NGK A;  1NJZ A;  1R89 A;  4LT6 A;  3IP0 A;  3HZG A;  3ZNJ 1;  1IKX A;  1CS4 A;  1ZBT A;  2CAJ A;  2RVJ A;  2B9X A;  2XMK A;  2XWX A;  5KFL A;  3TX8 A;  5C2C A;  1XMO J;  1CSJ A;  2Q6B A;  4RW8 B;  1FCA A;  2LEB A;  1RHJ B;  1HBO B;  1VR6 A;  1FKP B;  2ABY A;  2QJ3 A;  2AKW B;  2OP5 A;  2Y1R I;  1SUQ B;  2N4C A;  4UZC A;  4IFY A;  3HO1 A;  3G8T A;  1YJN S;  1DAR A;  1HWJ A;  4O0N A;  5GAD I;  3HJV A;  1YI2 S;  3AA9 A;  2IVF B;  1W2B R;  1A9N B;  2BRL A;  3A13 A;  3HVW A;  3X1L B;  3GZ7 A;  4DN0 A;  2FGO A;  3P3D A;  1C0T A;  1Z1Z A;  1LK5 A;  3KMQ A;  2W24 A;  1TAQ A;  3DRY A;  5KT2 A;  1S0O A;  4IG3 A;  5E3P A;  1PGZ A;  4LFB J;  4B17 A;  2YKM B;  1GXT A;  2Q1L A;  2I0X A;  3LP0 A;  2EFV A;  3PYF A;  5KFF A;  1VRT A;  2FLP A;  1W2I A;  2RB7 A;  4ZVH A;  2NXE A;  2RQM A;  2HZV A;  1XMO F;  2DEJ A;  1UAW A;  2UV8 G;  1C1C B;  3SQO P;  4DL0 C;  1AT1 B;  2HIY A;  3VV2 B;  2FJE B;  3QLH B;  3R6L B;  2V2Z A;  3DLK B;  4OJ1 A;  4GVL A;  4ZVS B;  4AND A;  3E3X A;  4ZVU B;  2EBG A;  4DV3 F;  3W1Y C;  2LFV A;  2OPQ A;  4B3O B;  1B4S A;  4BDP A;  1VK8 A;  2C2Z B;  1Q8B A;  1XMQ F;  4NLV A;  3DI6 B;  1QVG R;  2CPI A;  2L9N A;  1AFI A;  9RUB A;  1HNV B;  3LP2 B;  3IA0 A;  4R5P A;  2UVW A;  1VQ7 S;  3KXD A;  3A3O B;  4NCG B;  2ZE2 A;  4G1Q B;  3CXC R;  3DLH A;  5HBM A;  2R7W A;  2HYI B;  2J6S A;  1UJ4 A;  3VAM A;  2DNO A;  2H4Y B;  4C6A A;  3FNN A;  2NS1 B;  2C42 A;  5RUB A;  1FDB A;  2C3Y A;  5D3G B;  3P49 B;  2YKP A;  3QJP A;  1YIT S;  2ZM6 F;  5A6W A;  2HFZ A;  5KT6 A;  3W8P A;  4ECX A;  2AQ4 A;  2ZWO A;  1N56 A;  5E7O B;  1U49 A;  3CDB A;  3OR1 A;  2DHX A;  2QRR A;  1S57 A;  1TMM A;  4KFB A;  2FJA B;  5ETT A;  1F60 B;  3MGJ A;  2YKN B;  1M5V C;  2GGP B;  3FBC A;  1P1T A;  1CUL A;  3I0S B;  4UF4 A;  1F9F A;  3CCU S;  3OL9 A;  1B0V A;  4C2M A;  2YWF A;  2W4C A;  2UUW A;  1N8R T;  4H4O B;  1U8W A;  3BBC A;  4JI3 F;  2K8G A;  4QR1 A;  1RKJ A;  3AJD A;  2VQE J;  2DCU B;  1M5K C;  1KC8 T;  3FRY A;  2CPX A;  4FF3 A;  5GME A;  4JI1 J;  1Y5N B;  4ZVG A;  1NK6 A;  1CS4 B;  5CCM A;  4IR9 A;  4M5I A;  2C2D A;  2CQP A;  1H7W A;  2HBZ B;  1SJ1 A;  4CT9 A;  1TU0 B;  4HTI A;  1ICE B;  3R5D A;  2YNI A;  1HWK A;  3G82 B;  3T19 A;  3IGN A;  5D0G A;  1M0S A;  4B3S J;  1CJT A;  3M32 B;  4DPY A;  5FJ4 A;  2AJF E;  2ILZ A;  3CD0 A;  2NSC A;  2MQQ A;  4CRJ A;  3T1H F;  4DV6 F;  1LFP A;  3I0R B;  2AEM A;  3EGN A;  3DCA A;  2N4D A;  2P8I A;  1SVD A;  4F50 A;  5IWA J;  1SKW A;  2HAI A;  5A8R B;  1R0A A;  5A76 A;  2QSF A;  4KV8 A;  5KFH A;  3C8Y A;  4MK9 A;  3CC7 S;  4UOH A;  5CYQ B;  4ZVQ B;  4ES1 A;  5IWA F;  5F0U A;  4HHH A;  2DIU A;  2P6S A;  3DRP A;  3K2Y A;  3OR2 B;  2DKO B;  3IG1 B;  4JI1 F;  3VQT A;  5HQL A;  4WU3 A;  1QAI A;  5EHH A;  1IKY B;  2OSR A;  2ROE A;  3JSM A;  2NXN A;  5KFQ A;  4DR6 F;  1J5O B;  1UET A;  5ETM A;  2GVD B;  4XTT A;  5I42 B;  1U02 A;  1BGX T;  1B0P A;  4ZLP A;  5IS2 A;  2AMC B;  3PW0 A;  4DR5 J;  2OPR B;  2Q6C A;  4B02 A;  4A47 A;  2GIQ A;  4DUY F;  3DM2 A;  4B3O A;  7FDR A;  1FRM A;  4LIW A;  3VTI A;  2E29 A;  2NSB A;  1S7I A;  2OSQ A;  2R8I A;  1BQM A;  2FPH X;  4WCE Q;  2YX7 A;  2XSF A;  3O6Q A;  3RR7 A;  2GIF A;  4ZPB A;  5GMK a;  1RAA B;  1S1W B;  4DV7 J;  5HAT A;  5HI7 A;  3QT6 A;  2GJF A;  1ULR A;  1KLN A;  3FUY A;  4QPX A;  1J5O A;  3TNV A;  4W4M A;  3OXF A;  1R27 B;  2M9K A;  3UD4 P;  1KOH A;  2OPP B;  3EVO A;  1S4E A;  3H42 A;  3QIP A;  1N5Q A;  3CMQ A;  1Y0H A;  3LAM A;  4ZP9 A;  2J6T A;  1TKT A;  2B43 A;  2WSC C;  4ELV A;  1DJ0 A;  1SI9 A;  4BC9 A;  2ZJR Q;  2M52 A;  4CM2 A;  2V0N A;  5ETP A;  1RT7 B;  3PR4 A;  4DR5 F;  2XZT B;  9ATC B;  1VQM S;  1VQ5 S;  1JB0 C;  5HO4 A;  1LFW A;  1ZS6 A;  3FMW A;  1TL7 B;  4Q5V A;  1NB2 A;  2XMJ A;  1R31 A;  2KXF A;  3L4B C;  2WVE A;  2AT1 B;  3QAT A;  3R27 A;  4ICL A;  5ETV A;  4CO3 A;  4ZKA A;  1UVM A;  3PXG a;  3W60 A;  3AXK A;  4O23 A;  3ZZU A;  1YJU A;  2QG9 B;  3UNG C;  3HVR A;  3OBI A;  4Q45 A;  2LQ5 A;  3N6N A;  1GFW B;  3T9N A;  1S6Q B;  4ZIV A;  1TK0 A;  4HHJ A;  5LOQ A;  4ZCM A;  5CAB A;  2KRR A;  3WC2 A;  3M05 A;  5B0F A;  1NDP A;  2UXD J;  2RE1 A;  3MED B;  2BW2 A;  1VHF A;  1Z2L A;  2COL A;  3V6D A;  2XMW A;  1JLE A;  2B4P A;  2CZ9 A;  2DGX A;  3G82 A;  3AQP A;  3W5X A;  5F8M A;  1SJ4 P;  2J9E A;  1RLD A;  2E1A A;  3ETM A;  3TAM B;  2JDJ A;  4FDF A;  5L39 A;  1L3V A;  4DSI A;  3JB9 k;  3BN7 A;  4LF9 J;  3BSC A;  1DQA A;  2WSF C;  1RA7 A;  3H40 A;  2YVS A;  2I6W A;  3HFV A;  2CJ9 A;  2R4F A;  1R0B G;  2CPH A;  1X9W A;  2ZJQ Q;  1S9E A;  3ET6 A;  2Z2Y B;  3VF0 B;  4Q8E A;  2ACY A;  3RB3 A;  4DV4 F;  4ER8 A;  4JV2 A;  4EK2 A;  2JEI A;  4A8O A;  1U6B A;  4V19 X;  2KHD A;  2HNY B;  1FXR A;  2FY8 A;  3PRB A;  4I64 A;  3UCU P;  1Y9O A;  4K4T A;  1H73 A;  3IN5 A;  4U7C A;  4CO1 A;  2HFV A;  3J81 j;  3ZZO A;  1M90 T;  2AX1 A;  3UE2 A;  4AQY J;  4DSF A;  4FYW B;  3G2X A;  2EXU A;  5E41 A;  2DR5 A;  4LBI A;  1XMQ J;  2BVZ A;  1OPI A;  1W25 A;  2GVD A;  4NLX A;  4OZ0 A;  5I42 A;  1RXO B;  3ISN D;  3AHP A;  4PG6 A;  2E1R A;  3GU0 A;  2RQK A;  1NCL A;  3DYA B;  3QYY A;  3PKY A;  1B99 A;  2CIM A;  1HYS B;  4DZ6 A;  2LCW A;  1BQN A;  3PYE A;  4JI0 F;  5FLX U;  1RHQ B;  3DRS A;  2Q3P A;  3N4W A;  2VIH A;  2AGO A;  2MSS A;  1HBO A;  3MEC A;  2MST A;  2YNF A;  4IRC A;  2IY5 B;  1DZ5 A;  2C3P A;  4FVC A;  3SEO A;  3UFC X;  4LF5 J;  1Y7P A;  1YJ7 A;  3H5S A;  2VKR A;  4FXW A;  3ZZR A;  4CH1 A;  3OL8 A;  3KLF A;  4WK1 A;  3IS9 B;  1RU2 A;  1SL2 A;  1S9G B;  1AYE A;  4AQY F;  1FVQ A;  2KU7 A;  4I68 A;  3C3L A;  5CZV A;  3NBP A;  3V2U C;  1KON A;  3W9J A;  1REV A;  5I4M A;  5DQH A;  3T5H A;  2FLL A;  4ZIW A;  1XC9 A;  3TEG A;  2DNL A;  5ITH A;  2HVZ A;  2VDH A;  1GXU A;  3KKF A;  5IM0 B;  1FJG F;  4OHX A;  1T03 B;  2B9W A;  3DNC A;  3NCP A;  4ECR A;  3THP A;  2IFX A;  2VQE F;  3I82 A;  4TKT A;  5KFV A;  2FC9 A;  1DY3 A;  3N79 A;  3ILI A;  3TUJ C;  1IUJ A;  3NY0 A;  5LJ3 Y;  4OI2 A;  1VQK S;  2YKA A;  1XQI A;  4I0W A;  1MMN A;  5KG6 A;  2GQQ A;  3TZZ A;  4QW9 A;  4X64 J;  4K8R A;  2UP1 A;  3IWX A;  1BE4 A;  1DTQ A;  1ELO A;  2MZJ A;  5M2P A;  3VGT A;  3NG8 A;  2AJ0 A;  2JRS A;  2MLZ A;  3HLU A;  5LMU J;  1KQF B;  1WOS A;  2Y9H A;  2Q43 A;  2RT3 A;  1EQ0 A;  1E6Y B;  3OTC A;  2CYY A;  4DF8 A;  1GX5 A;  3RAM A;  3AOD A;  2KO1 A;  2H5J B;  3MUT P;  3CJR A;  5K14 A;  2D3O R;  4DV6 J;  1IKX B;  1YIJ S;  4Q0B A;  1HHQ A;  4MKY A;  5KFY A;  1X4E A;  4P2M A;  1DFD A;  2Z2Z A;  4P74 A;  4TN2 A;  1ZM3 A;  5KFA A;  4P2F A;  4BC7 A;  4CTA A;  3G6Y A;  4F4Y A;  3C66 A;  4WP8 A;  3Q0A A;  2VBW A;  5IV4 A;  1S79 A;  4IOB A;  1JJ4 A;  1FK9 B;  1Y3K A;  2VFU A;  1U1O A;  2B5J B;  2RDD A;  2K7J A;  1DTT B;  1S1V B;  1TEL A;  1DHM A;  4PXE A;  1ZPV A;  2Z30 B;  1UWB B;  2F3J A;  7FD1 A;  5LSO A;  3GON A;  2W7O A;  3NL0 A;  1CLF A;  2ZC4 A;  3JAM U;  4MMO A;  3LGN A;  5JXS A;  3GIJ A;  3TVY A;  4CIO A;  5BR8 F;  3TA1 A;  4FS1 A;  4N77 A;  2J5A A;  2Z0G A;  3GIM A;  2YWK A;  1NU4 A;  4NLP A;  3UDC A;  4K4W A;  3MFH A;  2DNP A;  2GIR A;  2JFK A;  5HN0 A;  5DLG A;  4DR2 J;  4U96 A;  4Y2M A;  1HNX F;  1JXE A;  5AE2 A;  4EU0 A;  1R6Y A;  2EEY A;  4LRB A;  3TVZ A;  4FNH A;  2Y8W A;  2ADB A;  2VJU A;  2C2M B;  3CC2 S;  1RT1 B;  2WON A;  4LFA J;  4P2S A;  2CUY A;  2K3I A;  1HQU A;  2P2C B;  3GCW P;  1CEZ A;  2DCL A;  4CLY A;  3AD8 C;  2HS0 A;  4DG1 B;  4C11 B;  1D0E A;  1ITP A;  1TL4 A;  3NKY A;  2HWT A;  5D4O A;  1RWK B;  1H6K X;  3R7B B;  2MKH A;  1F2G A;  4LQ9 A;  5GAE U;  2KT5 A;  3AOC A;  1CJK B;  2I5J B;  3HF5 A;  3KLF B;  3R5B A;  2FLO A;  4EYH B;  1U4B A;  3EZ5 A;  5EUH A;  4AXJ A;  4F4Z A;  1YBT A;  1X60 A;  2V4J A;  4I2Q A;  2BKO A;  2W2N P;  3I5C A;  1WAC A;  4KY3 A;  2ATL A;  1UA0 A;  4DR2 F;  1HNX J;  2DD8 S;  1D8Z A;  2H65 B;  4H4K A;  1T3N A;  2U2F A;  5FD1 A;  1GMU A;  2DR8 A;  3D28 A;  3BM7 A;  5KFB A;  2CZ4 A;  1G1X A;  2JC0 A;  1WF1 A;  2AF6 A;  1XR6 A;  2VBX A;  3BH6 B;  1G3O A;  4L72 B;  3CDU A;  1WKJ A;  4RZR A;  4LR9 A;  3CCW A;  3OW2 R;  3C16 B;  5LMN F;  1XJW B;  1B64 A;  4HAC B;  3GV7 B;  2C3M A;  1FD2 A;  2XI3 A;  3CIM A;  1MLA A;  1Q95 G;  2WZ1 A;  4IG0 A;  2W7A A;  2BM0 A;  4Y34 A;  5SZT A;  4ZP6 A;  2NCK L;  4NPO A;  5J2N B;  5E33 A;  2GW8 A;  1NSA A;  3T5J A;  1LW0 A;  3UN2 A;  3BYR A;  3MUM P;  3TQ1 A;  4Z7Y A;  2PSZ A;  4B9N A;  2D3U A;  2ZD1 B;  3OVS A;  1S1W A;  1RT3 A;  1I5O B;  3M2V B;  3VZH A;  5DDO C;  4Q0B B;  1T05 B;  3VAI A;  1Q78 A;  3AD7 C;  2MJN A;  3DRX A;  1KP6 A;  3HT0 A;  4HI2 A;  3KG4 A;  5G4D A;  4QQB A;  3R1L A;  2Y1L B;  1VQN S;  3GG1 A;  2BOP A;  2CQC A;  1MRO A;  1UEK A;  4Z2X A;  4FF2 A;  1LWE B;  4KGX B;  4J5O A;  2AV5 A;  4R25 A;  3KLE A;  3MAQ A;  4A48 A;  4DUZ J;  1WNE A;  3BPS P;  1FJC A;  5EN1 A;  5DO2 A;  5ETN A;  3MFI A;  2ZIT A;  4ECU A;  1P8G A;  2MZQ A;  1SC3 B;  3CDW A;  1P6T A;  3M7V A;  4UW2 A;  1QAJ A;  1PJ5 A;  3TZX A;  3CMA S;  3KJV A;  2QLX A;  5MLC V;  1OYE A;  5CYQ A;  1WHV A;  4YP3 A;  1KTQ A;  3OTO J;  3SCL E;  1J27 A;  1UP1 A;  2QLF B;  4OHW A;  4WE1 B;  3R5J B;  5B08 A;  1IBL J;  2NRE A;  4ZPD A;  2GQ2 A;  2Z8Q A;  5B0C A;  1AZS B;  3HD2 A;  1M1G A;  3AFG A;  1T9W A;  1IBL F;  1ZAX A;  2YNH A;  4ETZ A;  1NDK A;  1R6V A;  2EKN A;  2YXL A;  2F8M A;  3QT5 A;  1RAJ A;  3CCE S;  1SC1 B;  3PDN A;  3Q8U A;  5KT3 A;  1U1Q A;  2PEH A;  4C8L A;  3MM9 A;  1U6F A;  2VHG A;  2VDI A;  2XB2 D;  3Q8V A;  2E5L F;  1YZ7 A;  4OI4 A;  2CQ3 A;  5GAH I;  3HHL B;  2GML A;  3I9Z A;  2OUG A;  5J2Q B;  5B0D A;  3MZI A;  4KJI A;  2KYX A;  1JLF B;  3SV3 A;  4ZJQ A;  1FA0 A;  1RWW B;  4HT5 A;  1MNE A;  4JB8 B;  1HW9 A;  3NAH A;  1HBU A;  2AJ4 A;  4NOH A;  4OYW A;  2PDA A;  5BYS A;  1FWK A;  2QA1 A;  5KFI A;  2FHO B;  1RI7 A;  2CQ1 A;  3RRH A;  2GHP A;  1QE1 B;  1L3S A;  1HNW J;  1VIS A;  1RTJ A;  1XEZ A;  2IA6 A;  1WC1 A;  1HNI B;  3G96 A;  1EP4 A;  4M94 A;  3J80 Y;  3GII A;  3M9N B;  4MK8 A;  1H2U X;  1KVK A;  4N56 A;  2IMW P;  2RHS B;  4M5N A;  2DNM A;  4HYK A;  4ECT A;  1UL3 A;  1RWV B;  2FHJ A;  3BR8 A;  5F8I A;  3MM7 A;  1Q79 A;  3S7R A;  2DH9 A;  2MZS A;  4TQS A;  2R7X A;  4UOC A;  4URS A;  2LA6 A;  1KLM A;  4OI0 A;  1MSW D;  2GC8 A;  1XNR F;  4DV2 J;  4E0D A;  2GJ2 A;  2HND B;  1FTC A;  2CJQ A;  6FD1 A;  1OY6 A;  4KYZ A;  4YY3 J;  4PZV A;  2X1F A;  3ULH A;  3HFK A;  5A2Q U;  4J91 A;  3KHL A;  1HA1 A;  1SJQ A;  4KT0 C;  3OSP A;  2PT0 A;  2DR9 A;  3KNA A;  5T7L B;  2JNJ A;  4QW8 A;  3IR5 B;  4OYZ A;  4G65 A;  4DFM A;  2B4V A;  4DR4 F;  3CJQ A;  4EBE A;  3SCK E;  2B8P A;  1RAC B;  5F8J A;  4HR2 A;  2AD9 A;  3W5Z A;  4ED2 A;  1KVJ A;  3J7Y I;  4R5P B;  4AL7 A;  1QSY A;  1JLE B;  3HX9 A;  4WIQ A;  1NPP A;  3D66 A;  1JJC B;  4V19 J;  1HHS A;  2DHG A;  1PYO B;  2H54 B;  1FXD A;  4WYW A;  4GC6 A;  1S7H A;  5IT4 A;  2HG4 A;  3H4D A;  5L46 A;  1VIX A;  2V5H G;  4JI6 F;  2CRL A;  4DXL A;  2IVY A;  2M7S A;  1VRQ C;  5J1E A;  5HP1 A;  4MTP A;  4DI6 A;  3KK1 B;  4NXN F;  4M5G A;  4ETX A;  3DDK A;  3FVY A;  5KFP A;  5DG9 A;  1IR0 A;  2F40 A;  4WFN Q;  3SZ2 A;  1XNQ F;  3T9Z A;  2LP4 A;  2AX0 A;  2XGP A;  3SI8 A;  4USJ C;  3CF5 Q;  3DLG B;  4DPX A;  1XNQ J;  1VFJ A;  5HAN A;  4OYX A;  3Q23 A;  4FPI A;  2QGF B;  3MMB A;  1LWC B;  4WFZ A;  3FKB A;  3SFG A;  4CH0 S;  3PHT A;  2DGT A;  1RHK B;  1RWP B;  5IT9 U;  1E6V A;  4RW7 A;  4RNF A;  5F8L A;  5KFC A;  4P10 A;  1U47 A;  4W92 B;  3CGI A;  4KTQ A;  2MZT A;  5DG8 A;  4LSZ B;  2GHV C;  2VH7 A;  2ZBR A;  2XNQ A;  3RAQ A;  2PFD A;  1N54 B;  1MML A;  3VGV A;  5GAD U;  1VLO A;  2ZWP A;  4FN5 A;  1HBU B;  1BXN A;  4IFY B;  1HMV A;  4ZHR B;  1NEE A;  4ZVE A;  2QYG A;  3LAN A;  2ZBQ A;  2CVE A;  4B9L A;  3K8V A;  2JWN A;  5THW A;  3AB2 B;  3FBB A;  4URQ U;  1O5J A;  1EET A;  1S1V A;  1ACM B;  2WBR A;  1SV5 A;  5DDR C;  1MWY A;  3CJT A;  1AUS L;  2MJU A;  5IT9 Y;  3UWT A;  3UR0 A;  1O6X A;  1HR0 F;  1AA1 B;  2J76 E;  1TUV A;  3H2L A;  3D5M A;  4FS2 A;  1RAF B;  4DX7 A;  2DY9 A;  3OHB A;  4NLD A;  2RQ4 A;  2IVM A;  2FD2 A;  2OPS B;  4RL1 A;  3CJK B;  3GV8 B;  2IMO A;  1PJ7 A;  2F8E X;  2A10 A;  3EE3 A;  4I56 A;  1C1C A;  4J9L A;  3GYN A;  4CM0 A;  2LXU A;  1YBA A;  4DQQ A;  5C42 A;  3ICL A;  4DEZ A;  1URN A;  3M6U A;  1IBK F;  3U27 A;  1K8A T;  2ZZM A;  5EX3 A;  1H2T Z;  4C8N A;  4Q8F A;  3RBX A;  1RYR A;  2RDJ A;  4NWB A;  4Y28 C;  3W62 A;  2EG1 A;  3C2P A;  4O44 A;  2G0I A;  3F73 A;  4JI4 J;  3GTY X;  2YWG A;  4UTG A;  1VJQ A;  5I3Q A;  3OLB A;  3BQ2 A;  1SKU B;  4BWM A;  5B0B A;  1HWI A;  3CT9 A;  1Q5V A;  3MTK A;  4DL4 A;  1RQ0 A;  1WHY A;  3PNI A;  3Q2S C;  1J2V A;  4ANC A;  2ZH5 A;  4X66 J;  1SKR A;  3KUG A;  1NAQ A;  4ZIT A;  2MKS A;  3CCM S;  2DGS A;  5C24 A;  2MKJ A;  4I6Y A;  4X66 F;  2HHT A;  3J7Y U;  4DR3 J;  4DFK A;  1NKB A;  3NS5 A;  3Q86 A;  2DIT A;  1SQG A;  4JV1 A;  5KFE A;  2WB4 A;  4ECZ A;  1WTB A;  5L9N A;  3KWM A;  3Q8R B;  4ZVF A;  2PO4 A;  2RF2 A;  5J1P A;  1SJ3 P;  2CNL B;  2JLF A;  4NI2 B;  1KQK A;  4C8M A;  3M2R A;  1N36 J;  3GJT B;  2XNR A;  2DNY A;  1RHR B;  2EC2 A;  4HH0 A;  3OXL A;  2DJW A;  4DQP A;  1LWC A;  1YDL A;  4MYU A;  2DXD A;  3CCR S;  1JLB A;  2QMU B;  2HS4 A;  5J2M B;  3FBE A;  3M8Q B;  2PEB A;  3KTQ A;  1X0F A;  4QYZ K;  4UT4 A;  2G1H A;  2L48 A;  2Y3Y A;  1AUD A;  2DRD A;  2W8K A;  2ZUG A;  3GIK A;  1RAG B;  2YNI B;  3SSQ A;  3TZY A;  1GXL A;  4ECY A;  3MTJ A;  2FHK A;  2A2D A;  3GFH A;  2W1B A;  3HP6 A;  1H3D A;  4L75 A;  1VQS A;  2GZO A;  2ZBC A;  3MI7 X;  3NEK A;  4USV A;  3S01 A;  4C3L A;  3KDO A;  2QL7 B;  2K1R A;  1IQT A;  2MZ1 A;  4LF1 A;  3B6B A;  4LRF A;  5HSP A;  2CJY B;  2YWE A;  4F7V A;  2EVZ A;  4X4R A;  5AE3 A;  1R0A B;  1YVF A;  4KV8 B;  4DSK A;  5IZH A;  4EGL A;  4A8Q A;  3I4P A;  1IKW B;  1RGV A;  3KJN B;  1C4A A;  1S10 A;  3M8Z A;  2CFX A;  3FCH A;  2XYG B;  4IDK B;  3VQS A;  2PMW A;  1TV6 A;  2V69 A;  2HQG A;  3PRD A;  3D1H A;  1OS5 A;  2RJZ A;  3VAH A;  2C2N A;  3GJQ B;  3JYT B;  4TQR A;  3D6T B;  2VJV A;  3K0J A;  4Q7A A;  4YB5 A;  1U1L A;  3PHE A;  1B70 B;  3AJ1 A;  5C25 A;  1T8E A;  3IC1 A;  5BYQ A;  2N3O A;  4DV3 J;  5KG1 A;  3JTN A;  1VRU B;  2FC8 A;  3DHX A;  2ZH8 A;  3T1Y J;  2BJ8 A;  3PVX A;  3K59 A;  3BDP A;  2ZKT A;  2IC3 B;  4NA1 A;  4G3I A;  5CYM A;  4ED7 A;  5DQG A;  3KLH A;  4ED3 A;  1UZD A;  2X3G A;  2CG8 A;  5D4L A;  1EAR A;  2OI2 A;  3ITH A;  3NS6 A;  3RJM B;  1N6Q A;  2KXH A;  2GV1 A;  1HW8 A;  4JUZ A;  4PUO A;  3NMA A;  1JLG B;  2DNK A;  5HK4 A;  1T9V A;  3W7B A;  3R1H A;  2CG4 A;  2OJ3 A;  2YNF B;  5E0O A;  3D6F B;  2XZW A;  2DGW A;  3MPY A;  3MPV A;  4C3K A;  2V4R A;  4CYU A;  3OFF A;  3C14 B;  1QE1 A;  3LAK A;  2VIC A;  2ZD1 A;  2XLK A;  2XQC A;  1KTV A;  3LA0 A;  5KFK A;  3KLG A;  1HNI A;  2NXU A;  3LAL A;  1EP4 B;  1NH7 A;  4FP9 A;  5A0Y B;  2OPP A;  1ZM9 A;  2XHW A;  2RRA A;  1S9G A;  2MKC A;  3IM8 A;  4DL6 A;  4NA3 A;  1U1N A;  3CCS S;  1RCX B;  1NHK L;  2QA4 G;  4DSE A;  1VC0 A;  2J0S D;  4PEO A;  4X4Q A;  2CPZ A;  1WI6 A;  1B7F A;  2M4M A;  1XMB A;  3HI9 A;  4QYR A;  5D77 A;  4XK8 C;  5E3Q A;  3HUL A;  4KGK A;  2W4P A;  1U0H A;  2EW9 A;  2QX0 A;  3GSI A;  2RF2 B;  3I6P A;  2VZ9 A;  2DNR A;  2FZC B;  4ZCI A;  5IV3 A;  4U7U K;  1F3V A;  1P9Q C;  3AD9 C;  4LSN B;  3DMJ A;  2F5G A;  2F63 A;  1SH0 A;  1KLM B;  3TWZ A;  3PY8 A;  5K8M A;  4OLP A;  3CJ5 A;  3IO1 A;  1S1X B;  1QLN A;  2A0F B;  4K7Q A;  2HS3 A;  3D3C J;  3F44 A;  5D8H B;  3BSA A;  3FFI A;  3DC2 A;  4WTO B;  3PV8 A;  3CJ0 A;  3TJ9 A;  3OUY A;  4L73 A;  5AE1 A;  1VCT A;  4EZ6 A;  3R5A A;  1HIY A;  2OAU A;  2HRY A;  5F9L A;  5KG7 A;  3FEY B;  1V3Z A;  1SKS A;  3H20 A;  2HBR B;  4EFA C;  5F3T A;  2H5E A;  3CVK A;  4PAA A;  4WII A;  4B3S F;  4URG A;  4B9U A;  4O3R A;  1N32 J;  2IYI A;  3T1H J;  2DTJ A;  2O3D A;  1RYS A;  2VG5 B;  4PQA A;  2CJK A;  3HHK A;  3G8Q A;  3EIC A;  2CPE A;  4BLG A;  1NPK A;  4CLU A;  1S6P B;  2VPX B;  4JI7 F;  3CJ3 A;  4D3H A;  4AT1 B;  4MYT A;  1WJ9 A;  5KFZ A;  2W9C B;  4K4X A;  4ED8 A;  4ENO A;  2AHO B;  5C5J A;  4D3G A;  4TYA A;  2YBV A;  4ZJO A;  2O01 C;  4OJG A;  2CQH A;  5B09 A;  3G6E S;  2VG6 A;  1YJT A;  1IVZ A;  2E1P A;  3M8P A;  2AW0 A;  2F1F A;  5LSR A;  5KG5 A;  1LWF A;  2EFN A;  5KAK A;  3V81 B;  4Y2K A;  3BO3 A;  4KIA A;  1FJE B;  4C8Z A;  1PG5 B;  4FKY A;  3MM5 B;  5ETL A;  4ES3 A;  4DR6 J;  1REG X;  2CXE A;  3TAR A;  3SMZ A;  2YKM A;  3AXM A;  1GEH A;  3TYT A;  4R8U B;  1JWW A;  5DZ6 A;  3MR6 A;  5H9E K;  4JI4 F;  3FSX A;  3O3L A;  1Y4Z B;  4CT8 A;  5EWF A;  1T7P A;  1RT5 A;  3MPW A;  4TY8 B;  2Y1J A;  3WQP A;  1FT8 A;  5DJB A;  4OJ3 A;  4JBC A;  2ZH1 A;  3DRS B;  2V8P A;  3BQ0 A;  1XR7 A;  4ECS A;  5H9F K;  2HND A;  1WDD A;  5B0G A;  3GQC A;  3VAF A;  2AYE A;  4EZ9 A;  2PII A;  4JI3 J;  5AJ3 F;  2O1P A;  3VWS A;  2KM8 B;  2C2E A;  3KLI A;  3MCS A;  3CCJ S;  5L1J A;  2HMI A;  2K2P A;  3CME S;  2GMJ A;  2WHO A;  3PCO B;  2FVR A;  3G9C A;  1RLC L;  4ED4 A;  5T7L A;  1RJJ A;  3DLJ A;  4DUT A;  1TZ0 A;  2NPI A;  3CCL S;  3JSY A;  2CWK A;  1TVR B;  2C2O B;  5HBM B;  3IAS 9;  4P75 A;  3ZZP A;  5HMW A;  3H4B A;  2AWZ A;  3BJY A;  1N33 J;  3NOG A;  2HFN A;  4DU8 A;  2NR0 A;  2WVB A;  2ZH2 A;  3V6H A;  5KT5 A;  4YHH J;  1WI8 A;  4RR5 A;  3EZO A;  1VQY A;  3NNH A;  4B3R J;  1KBR A;  2ASD A;  1KNZ A;  5HP1 B;  1U2F A;  3MM8 B;  1Q86 T;  3IR6 B;  2XLI A;  2BKN A;  3CE8 A;  3TW0 A;  1WC4 A;  2DGV A;  2POK A;  1K0T A;  1DTQ B;  1YJR A;  3BGL A;  3U1N A;  4FBT A;  2AJQ A;  3HD1 A;  5LXR A;  3BO4 A;  3OUY B;  2HNZ B;  2KTQ A;  4ZVR B;  3LWM A;  2HHU A;  2XYH B;  4NLG A;  2FJW A;  3V4I A;  3THT A;  1I6J A;  4O44 B;  4NA2 A;  3ZNU A;  4A4J A;  4O3Q A;  3PG9 A;  5HJY A;  4PWU A;  1Y00 A;  4XPC A;  2DPI A;  4K50 A;  4M5D B;  1IQZ A;  2XSJ B;  2VBZ A;  4ZK7 M;  4NX9 A;  4QWD A;  3P8B B;  3ZZT A;  1CPZ A;  1LW0 B;  2E1M C;  4UZB A;  2UVU A;  3C15 A;  2R7S A;  1FFW B;  5IOL A;  3U1M A;  2Q79 A;  2MKK A;  1MN7 A;  2P6T A;  4I2P B;  2ALZ A;  1J5E F;  1TL3 A;  3NRB A;  1Q81 T;  2QA4 S;  2MDA A;  3CB4 A;  3PX0 A;  2NQP A;  1S1U A;  2VG7 A;  3LW5 C;  4C97 A;  4KHM A;  5FII A;  5G0R A;  5HLF B;  2GVZ A;  1RCO B;  3MAH A;  1J5E J;  2UUA F;  4JYA J;  2FVP A;  2JC1 A;  2J7U A;  2FB0 A;  3I0R A;  3E8O A;  1TL5 A;  1FNX H;  1HBN A;  4ES2 A;  4Y2C A;  2APO A;  1M5H A;  1OPZ A;  3M1V B;  1Y5L B;  1LOU A;  2XMV A;  5A8R A;  1AXQ A;  1LWF B;  5KG3 A;  1HR0 J;  3C6U A;  2QEX S;  1T0T V;  2LXF A;  4WBF A;  1TK8 A;  3NMR A;  4X2B A;  4PQU A;  3MM5 A;  3KHG A;  2JVR A;  3QRP A;  1NSP A;  3NGR A;  4NE9 C;  1U1P A;  4DBQ A;  2E5I A;  3CUL A;  4LBP A;  2OPS A;  3H59 A;  4X4N A;  4LRC A;  3RTV A;  4MKV A;  2OKQ A;  3N6M A;  1OWX A;  1HPZ B;  2B9E A;  1JLB B;  3WX8 A;  3EGW B;  3SQG B;  3DU6 A;  4RNO A;  3UO0 A;  3HXM A;  2OO4 A;  4NXM J;  2FY1 A;  1RT5 B;  2CQ4 A;  2IBO A;  2V94 A;  6FDR A;  3QWP A;  1WHW A;  1WSV A;  2QO3 A;  3K5L A;  5KFS A;  5KTQ A;  1EIY B;  2MY8 A;  2UVR A;  2HFU A;  5DRK A;  2ZHB A;  4OV6 A;  1SJF A;  1N5S A;  1FDD A;  4I1T A;  4NYO A;  1NKC A;  1U48 A;  1PAU B;  2G0C A;  2AEJ A;  4S0M A;  4N5S A;  1X4H A;  4LF2 A;  4ED0 A;  1U1M A;  4OQJ A;  3LO3 A;  2XYP B;  3CDE A;  3FZB A;  2O66 A;  3L95 X;  3AQO A;  3PAC A;  4ZVO B;  2KM8 C;  2ZHA A;  4IQM A;  4NZ0 A;  3IRX A;  2W25 A;  4PWW A;  3TA0 A;  4PPD A;  5CAA A;  1RT6 A;  1YJ9 S;  2BR0 A;  4LRE A;  1RK8 A;  2UUB F;  2BW7 A;  2JVO A;  3CO9 A;  1RWM B;  2AU0 A;  2M8H A;  4J9O A;  4V1A k;  1KDN A;  4X65 F;  3BZQ A;  3MM6 B;  1NH8 A;  1H7X A;  1RTJ B;  2FDN A;  1C0T B;  2IDE A;  4FVM A;  4IDK A;  4JI8 J;  4UY8 5;  4K4Z A;  1VC6 A;  3VZI A;  4DL5 A;  1Q8K A;  4AE5 A;  5SUH A;  3OVA A;  4LFC J;  3H90 A;  2FVS A;  4ED6 A;  2PD1 A;  1L3T A;  1R3N A;  2D3Z A;  3GMG A;  1KN6 A;  3HCX A;  1RT7 A;  2UU9 F;  3A8E A;  3RB0 A;  1YRU A;  4IOA Q;  3C16 A;  4JV0 A;  3VR1 A;  4HL9 A;  3LPE A;  1G4C A;  4IH7 A;  3PIP Q;  2B4U A;  3K17 A;  4IG0 B;  4U67 Q;  2J6U A;  5ETK A;  2XZD B;  5CH7 B;  1WOP A;  5CYM B;  3W3S A;  1U2C A;  3FMB A;  3UW1 A;  3ZTP A;  2MGZ B;  1KD1 T;  4DWI A;  1S4F A;  1Y3J A;  1FX4 A;  4F04 B;  4TU7 A;  2HWH A;  5DZ7 A;  2RU9 A;  1FE4 A;  3HSD A;  3PTW A;  5EX0 A;  4C8O A;  3W61 A;  4A8F A;  2E7V A;  2IPO B;  4PG8 A;  1I51 B;  4LSL A;  1X0P A;  4Z37 A;  2RHQ B;  2CZV C;  3CD5 A;  5HMZ A;  5L8R C;  2FHM A;  4CQ1 A;  1UW9 A;  5IXU A;  5T41 A;  4DQR A;  1JNR B;  4B9S A;  4DX5 A;  2B51 A;  2K06 A;  3ZTS A;  4LF5 F;  3OFE A;  1GK8 A;  4LUB A;  8AT1 B;  2QC3 A;  3ILO A;  2YH1 A;  4DSJ A;  3VGU A;  3ISZ A;  4TLQ A;  1SCJ B;  1JLQ A;  1RWN B;  1QAY A;  2ZOM A;  1WEL A;  3KK1 A;  2HW3 A;  1IKW A;  3OR1 B;  2HLT A;  3DMJ B;  2HNY A;  4WFB Q;  3KFW X;  4AFF A;  3CCZ A;  1U1K A;  3ENV A;  4M5K A;  3RBE A;  4IYQ A;  3S1T A;  3VCD A;  1HPZ A;  3ZZ0 A;  5AJ3 J;  1WG1 A;  3GPA A;  5DS7 A;  1FRX A;  1RTI A;  2SXL A;  2ZH9 A;  5B7W A;  5K8P A;  3UD3 P;  4Y2I A;  1FX2 A;  2OEK A;  3DN9 A;  3MEK A;  3F56 A;  1VMB A;  3DLE A;  2LEC A;  1NK4 A;  2QLW A;  3MMB B;  3NGT A;  4LR8 A;  5JMN A;  5EGY A;  4X64 F;  4UQG A;  4CLS A;  2PC6 A;  4A8W A;  1S6O A;  1GTE A;  4ILL A;  3N28 A;  2OFG X;  4GO7 X;  4LVO P;  4RW4 A;  4A46 A;  2HHX A;  4NZ6 A;  2HHP A;  1SJR A;  1Q0N A;  2EK6 A;  2G2Y A;  1L5U A;  4U8V A;  1HL6 A;  3MEC B;  3LP1 A;  2L9D A;  2W7P A;  4LVN P;  2WVD A;  2XMT A;  4RW6 B;  3QGG A;  4NZ7 A;  4USU A;  4YHH F;  4PUO B;  1YRX A;  4RPF A;  1D3W A;  1SC4 B;  4LMZ A;  1FVS A;  1D9D A;  2R7V A;  2RIJ A;  3POT B;  4ZPV R;  1XR5 A;  1JLA A;  2YX1 A;  3JXO A;  4CYU B;  1CJV B;  4H4K C;  3MM6 A;  2BQ3 A;  2E1C A;  2ZVS A;  2QSW A;  3IM9 A;  2OEL A;  4LR7 A;  1C1B B;  5A8K B;  4HH1 A;  5F8N A;  2RD5 C;  3CTR A;  3CPW R;  1X4G A;  3K8W A;  1S77 D;  3MUV P;  1K1S A;  2PA3 A;  2JJ4 D;  2VPZ B;  3D3B J;  4CWB A;  3QPI A;  2RRN A;  4JV5 F;  2AJ1 A;  2V2Q A;  3QQC D;  3M8S A;  3NXZ A;  1QDU B;  2CAD A;  1IBC B;  4M1K A;  3KYL A;  1BUX A;  2PN6 A;  5U47 A;  4RUC A;  3MR3 A;  3K57 A;  1GTH A;  2Y0B B;  5K5M A;  4NLW A;  1UPP A;  2H9Z A;  2QT7 A;  3J81 U;  4OYP A;  3KLV A;  2BDP A;  3UQS A;  2C1E B;  1NJY A;  2V50 A;  1S1X A;  3BR9 A; 
#chains in the Genus database with same CATH homology
 4YY3 J;  4KYZ A;  5A2Q U;  1N36 J;  2UUA J;  4PWW A;  4LF6 J;  2MQ8 A;  4NEY A;  4V1A k;  4DR6 J;  4DV6 J;  4JI8 J;  4KY3 A;  4AQY J;  2VQE J;  4OX9 J;  3R2C J;  1HNX J;  4RJV A;  4JI1 J;  1XMQ J;  4LFC J;  4DR4 J;  2MEW A;  4GKJ J;  2UUB J;  2VQF J;  4B3S J;  4JI3 J;  5FLX U;  2ZM6 J;  2UUC J;  5IWA J;  4LF5 J;  4JI5 J;  3J7A N;  1XNQ J;  2UU9 J;  4DV1 J;  1N33 J;  2KVQ E;  5IT9 U;  4JI0 J;  5LMN J;  4NXN J;  2MTL A;  4YHH J;  4DV3 J;  4B3R J;  1XMO J;  3T1Y J;  2HHH J;  4DUZ J;  4LF4 J;  4LF7 J;  4DR5 J;  1IBK J;  4X64 J;  1I94 J;  3R2D J;  4JI6 J;  5LMU J;  4KHP J;  3OTO J;  1N34 J;  1IBL J;  5AJ3 J;  2UXC J;  4X62 J;  4HHU A;  4DV7 J;  2KL8 A;  4NEZ A;  4B3M J;  4LFB J;  4JV5 J;  4DUY J;  2E5L J;  4K0K J;  1FJG J;  4DV0 J;  4JYA J;  1J5E J;  4GKK J;  2UXB J;  1XNR J;  4X65 J;  4DR7 J;  3W1Y C;  4JI2 J;  3D3C J;  4LF8 J;  2F4V J;  3JAM U;  4B3T J;  4JI4 J;  1HNW J;  1HNZ J;  3J80 U;  5LM7 E;  2UXD J;  3D3B J;  4NXM J;  1IBM J;  4X66 J;  3IMQ J;  4DR2 J;  1N32 J;  4DV4 J;  1HR0 J;  3T1H J;  4JI7 J;  4DV5 J;  3J81 U;  4DR3 J;  4LFA J;  4LF9 J;  4DR1 J;  5BR8 J;  4DV2 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...