3DLLQ

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords rRNA-23S ribosomal RNA
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
total genus 8
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dllQ00
2PEHA 2LXIA 1VQ9S 1N52B 1H2TZ 2OIHA 1WF1A 4LIRA 3G9CA 3LQVA 2MQQA 1FXLA 2JX2A 4FXVA 2YKAA 1PO6A 4QPTA 3CMAS 1FO1A 1U1KA 3DLLQ 1WEZA 3CCRS 1X4GA 1WEYA 2DNGA 4YB1P 1VQMS 3CCJS 3NMRA 1XN9A 3UD4P 1VQ6S 3RW6A 2M9KA 1U1OA 2MZJA 1U6BA 1FJEB 5JVHQ 2MJUA 1NU4A 2WBRA 1YJ9S 2HGMA 2MGZB 1SJRA 1NO8A 5DM7Q 2QA4S 1WHYA 2RT3A 3H2VE 5DDQC 2I2YA 1KOHA 4PRFA 4V19X 2CPDA 2CPYA 2XS2A 5DDPC 2Q79A 1SXLA 5JVGQ 3G6ES 1YITS 3CCVS 2AYBA 2I38A 1H2VZ 2CQPA 2MKHA 3MUMP 2E5JA 3G71S 2G4BA 2OTLS 2RU3A 1N8RT 3J7YU 2PE8A 2M8HA 2MKIA 2J0SD 1L3KA 1CVJA 4W90B 2J8AA 1DHMA 3TO8A 3JB9k 2MYFA 2QEXS 2YTCA 4CH1A 2KG0A 1UP1A 1WHWA 1YIJS 2MKSA 2DNQA 4C4WA 2MZSA 2MQLA 3SDEB 2DNZA 3D2WA 3G4SS 1M5OC 2EK6A 3BO2A 1U1QA 2KG1A 1D8ZA 2KI2A 3P5TL 1VQ4S 1QM9A 3VAFA 5GADU 1IQTA 3MURP 1DZ5A 2DNYA 1HA1A 1WI6A 1Q86T 3FEYB 1HL6A 2DGOA 4EGLA 2DGUA 3THTA 1KD1T 1KOOA 1R8HA 3BEGB 5CA5A 2B0GA 2LKZA 2LMIA 2KN4A 2LYVA 3R27A 4QU7A 4LMZA 2D9PA 1YJNS 2VONA 2HZCA 2E5HA 4IUFA 2OSRA 5HL7Q 2CQHA 5GAHU 4IOAQ 3IWNC 1WHVA 2RQCA 1YTYA 1QVFR 1Q82T 2MY7A 2LA6A 2V94A 3VAHA 3P49B 2G0CA 2RNEA 1N88A 5LJ5Y 2VOPA 1X4AA 2AYGA 2DGXA 2EK1A 2MPUA 3EX7B 5GVQA 2DH9A 5D77A 3UE2A 1FHTA 2LXUA 1WELA 1D9AA 3CC2S 4CIOA 3IRWP 2KFYA 2MMYA 2YWKA 1SJQA 1VC5A 2E44A 2CQ3A 2FC9A 2X1AA 4TU7A 1WHXA 2M70A 1RKJA 3HI9A 5MLCV 2DIVA 2HVZA 1WTBA 2CPJA 2KRBA 3S01A 2DGTA 2RRBA 2M4MA 1X5OA 2F9DA 1OIAA 2K8GA 4Y00A 4Y0FA 4WFBQ 1U1MA 1SJ4P 2DNRA 3PIOQ 2GO9A 2DGWA 1DBDA 2JVOA 2CQDA 2N82B 1YJWS 3B4DA 3CC4S 1A9NB 1Q81T 3CTRA 1M5VC 2MGZA 1U2FA 3MI7X 5HO4A 1VQKS 2CQCA 1ZH5A 3THPA 3U1MA 2DHXA 1JJHA 3MOJB 2XB2D 1X5PA 2DH8A 2YH1A 4QQBA 3S7RA 3FEXB 1X4HA 2N3LA 1H2UX 2DHAA 2DNKA 2CPHA 2M0GB 2L08A 2KM8C 1R8PA 1WG4A 2ZJRQ 1YI2S 2DNLA 1K9MT 2DO4A 1WEXA 2CQ4A 1BY9A 1FNXH 4FXWA 3ZZZA 1X0FA 2CQ1A 5CYJA 4CH0S 3L3CA 2BZ2A 1VBZA 1VC0A 2DNNA 2MZTA 3LPYA 3MD3A 3VALA 3Q2SC 1DRZA 2FPHX 3Q2TC 4WF9Q 4ERDA 4PR6A 2L41A 2M52A 3ZZYA 4LJMA 1M1KT 1FJCA 1UW4A 2M2BA 1WWHA 2NLWA 4CQ1A 3G8TA 2KM8B 2RQ4A 3SDEA 1QVGR 2NZ4A 2VODA 2M8DB 1X5TA 2XSFA 2MQNA 4W92B 1U1PA 2A3JA 2MXYA 5LJ3Y 2DK2A 3BS9A 2LEAA 5D78A 3R1HA 3U1LA 3EGZA 2MZRA 2MKKA 2FC8A 2KHCA 3UCGA 1KC8T 1VQ5S 3CMES 1F9FA 2X1FA 3MUTP 1HD1A 1N54B 3NS6A 3CCES 5CXTA 1FT8A 4YOEA 5LSLA 2RVJA 4OZ0A 3S6EA 3V4MA 3N9UC 1KQSR 3CD6S 5DDOC 2MQOA 2XNQA 1RK8A 2UP1A 3NNHA 4RU2A 3MXHP 1B7FA 2DHGA 2ZJPQ 1VQ7S 2E5GA 3MDFA 3I55S 5DM6Q 3BO3A 1S72S 5BJRA 1AUDA 3RW7A 2DO0A 1WG1A 2J76E 3CC7S 2MHNA 2X1GA 4PKDB 2G1DA 2GHPA 3CCSS 4A8XA 1X4DA 4ZKAA 2EVZA 1X4CA 3MD1A 1JJ4A 5EN1A 2RRAA 2LQ5A 3CCLS 3PIPQ 2CPXA 1VBXA 3CPWR 2CPIA 5IM0B 2KXFA 1UAWA 1Q7YT 4F25A 2KT5A 2VOOA 1VQPS 3J7ZT 3S8SA 5FJ4A 2XS7A 2KRRA 2ERRA 2AYEA 2CPEA 3CF5Q 1UFWA 2KXNB 3NNCA 2DNPA 1NJIT 3OW2R 2MJNA 1HD0A 3B4MA 2M88A 3TYTA 2MY8A 2D3OR 5ITHA 2J0QD 4F26A 4IO9Q 1OPIA 2LCWA 5LXRA 1VC6A 2DNHA 1X4FA 4F02A 2JRSA 2CJKA 2CQBA 2CQ0A 4WCEQ 3G96A 3CUNA 2AYMA 5LXYA 2DH7A 3VAGA 2O3DA 3CCMS 1ZZFA 1X5SA 2MKCA 2N7CA 1WG5A 2DGSA 2ZJQQ 2DISA 2BOPA 2CQIA 1A7GE 1X4EA 4TU9A 4WFNQ 3CULA 3CXCR 4WFAQ 3NNAA 2KYXA 1YWXA 1URNA 2CPZA 2L9WA 2MZQA 2X1BA 1JJ2R 2DGVA 2U1AA 2RS8A 3G8SA 1M5KC 2SXLA 2DITA 2M7SA 1WF0A 1W2BR 4IOCQ 4TU8A 3VAJA 2OSQA 1K8AT 2OJ3A 4UY8T 2ADCA 2E5IA 4P6QA 5DDRC 3CCQS 1PGZA 1U1LA 2KU7A 2YH0A 1M5PC 2DGQA 4UQTA 3SMZA 3SXLA 2RS2A 2MKJA 2RUGA 3P3DA 3HHNB 2LA4A 1M90T 3UCZP 2KVIA 4U67Q 2LEBA 4QU6A 5GAEU 2MB0B 1VQOS 3VAKA 2AD9A 1U1RA 2CQ2A 5H1SV 2LECA 1YHQS 2F9JA 3DXBA 1VQLS 3MUVP 2XNRA 2DHSA 1G2EA 2N3OA 3VAMA 1FJ7A 4YUDA 3ULHA 1WI8A 3EGNA 5DETA 1VQ8S 5GAGU 2KXHA 3UCUP 2CPFA 2HYIB 3UWTA 2D9OA 1P1TA 3US5A 5IFMA 2DIUA 3H2UB 2MSTA 1U1NA 1U6FA 1JMTA 4C0OC 5IQQA 1WF2A 1P27B 2FHOB 3VAIA 3K0JA 3TP2A 1O0PA 4WKRA 2MQMA 2JVRA 4OZ1A 3UD3P 2ADBA 2MSSA 2QFJA 2OTJS 2JWNA 1X4BA 4M5DB 3VF0B 4Z2XA 2DNOA 2XS5A 2MZ1A 2CQGA 5GMKa 2MQPA 1SJ3P 1S79A 2HGLA 3R1LA 2FY1A 5LSOA 3CCUS 4TLQA 3BO4A 2F3JA 1OO0B 1OWXA 2K3KA 3NS5A 4J5OA 3I56S 1VBYA 1SJFA 1VQNS 2U2FA 4ED5A 1H6KX 4WIIA 4BS2A 2HGNA 2DB1A 5IM0A 1K73T 3P6YC 4C7QA 2KH9A 2DNMA 1ZZNA
chains in the Genus database with same CATH superfamily
4H4OB 2IIHA 4OHXA 2NUHA 1FO1A 2Z57B 2ALZA 4FVCA 2DNGA 4QW8A 2ZWPA 1TL7B 3BREA 2V8GA 3H8YA 1WHYA 2ZBCA 2OMLA 4ZLPA 2UUAF 3R5DA 4M5NA 3RBXA 3ELHA 2CPDA 3RGIA 4O44A 3TUJC 2RDJA 3G6ES 4CLWA 4ZP7A 3OR2B 1K0TA 1D9DA 2NREA 4G65A 2HFNA 1MW7A 4H54A 4F4WA 2H3EB 2M8HA 4DN9A 3L9ZA 3I96A 3TO8A 2Q66A 1PJ7A 1N33F 1I3OB 2MKSA 3BH6B 1Q0NA 3EUNA 3IR7B 2HNZA 3D6MB 2M5YA 4DSKA 4Q0BB 4ZLJA 1NZAA 3CIZA 2HNDB 4F4YA 1FEEA 4IR1A 1PYOB 1QAJA 3W5ZA 1S1XB 2DXEA 2NXNA 1HA1A 4RW6B 1Q7LB 4ECVA 3U1NA 5DGAA 4ZLNA 4OV1A 3MCMA 1W2IA 2E9ZA 4MIWA 3UDLA 2C3MA 2RQCA 1FRHA 1XERA 2NSBA 4DUYJ 4QYZJ 2MTLA 3VAHA 2QTWA 3H0PA 3GIKA 4DQPA 4LF4F 3CJ0A 2MPUA 3GJRB 4J9PA 3DOLB 5F9NA 2Y3YA 5GAGI 4ANDA 1IBLJ 5IQ6A 1S7HA 4TU7A 4C8MA 5KG7A 4NA1A 4ZHRA 4X65J 3CNQP 1MLAA 1REGX 5E0OA 3AJ2A 3CCTA 4R5PA 3GONA 4HYKA 4F3MA 3B6BA 4F04B 2D1CA 2ZM6F 4NMLA 3OR1A 3C14A 1WOPA 1L3TA 2DHHA 2XSJA 1S59A 3K5LA 1JLEA 2AZ1A 2Z0GA 3H90A 1UKUA 1E6YB 4CH0S 5IT9Y 1RT5A 2OPRB 2WHOA 5F41A 1FDAA 1B3TA 3HHLC 3G8TA 4CT9A 2R4FA 3OSNA 2ZBQA 1JXVA 3HDSA 3QJPA 3RRHA 4K4SA 2VBYA 4PYDA 3E8OA 4P2FA 3KLFB 1C0TA 3KG4A 1HD1A 2O01C 3FJ2A 5CXTA 5HANA 4OL8A 4YOEA 4XK8C 1TVRA 5F8MA 1FWKA 2NYHA 4TVAB 2IDLA 3ETOA 1QDUB 3BO3A 3RW7A 3HHKA 3OSPA 3PFOA 2FB0A 3BF4A 3AT1B 2FJEB 1VBXA 4FVMA 1JLFB 2HBQB 2OI2A 4EZ9A 1T94A 4F3OA 1FDDA 1NDCA 5KFQA 4DR5J 1RT1B 1U48A 4PXBA 4PPDA 1UEKA 3K5OA 4KGMA 2RILA 4Y6IA 2LQ8A 2CQBA 5EHHA 4B3OB 3DRPA 2BOPA 2DISA 2XO7A 1G3OA 2JOQA 2QT7A 4UT4A 1F1BB 2YKQA 2RHSB 3QJJA 2QSFA 2O66A 1X8DA 4BDPA 2SXLA 2DITA 2HWIA 3W63A 4C8ZA 1NJWA 4DR6F 3Q24A 1G7CB 4UZCA 2LEBA 3CJTA 3TVZA 2NXUA 4WTYA 3K17A 4QIFA 3LAKA 2N3OA 4FF1A 3VAMA 1L3SA 1I5OB 4NOHA 4KH0B 2E7XA 2D9OA 6FD1A 4CI0B 5B0BA 4NYPA 2VFTA 3KFWX 4K8RA 2VDHA 3IS9B 3UR0A 1R8CA 1UVMA 2XS5A 1DFDA 2NYIA 4EFAC 3BO4A 1SJFA 2YWWA 2EG1A 4GKKF 4MT1A 2BANA 3BGUA 2KH9A 1JX4A 5A2QY 1UWBB 1S1UB 2R8GA 1CLFA 2NXCA 2XYHB 4ED3A 3RBEA 3CJ3A 3D3CJ 3CCRS 3T1HJ 3W1YC 4U9RA 3MTJA 1S9GA 5DM7Q 2GMHA 5D15A 2G0JA 2RT3A 4YDXA 1TK0A 1C4CA 1WDDA 4ECWA 3KLHA 1T3NA 2A10A 4ZJOA 3GZ7A 3CCVS 3IA0A 2I38A 3MUMP 2R7QA 4KAIA 1VRTB 5LM7E 1I94F 1S1WA 1RACB 1L3KA 4PWDA 2IAJB 4RW4B 4UUXA 3UD5A 1UP1A 1U0HA 2YNGA 4LSZB 3QO9A 3NGKA 2RRNA 1WTFA 3PDNA 3V81A 1VQ4S 3LANA 3T1YJ 4NXMF 1VQYA 1NKBA 4ZP6A 1HNWF 5C25B 1XMOF 4WTOB 1RHMB 3HXMA 2A6OA 4KPYA 1NXIA 2VQFF 5J1EB 3OXFA 2KN4A 5BR8F 1AA1B 5LMUJ 1PKUA 1O5JA 1EP4B 1XNRF 3DFEA 3NLCA 1N5YB 4QIEA 2R7TA 1R0AB 3H42A 2W9CB 3G6YA 4B3SJ 1C1CA 4P71A 4CIOA 3Q8RB 3IRWP 2BKPA 3K8VA 5D0HA 2G2ZA 1XMQF 2VFUA 3PYEA 2YKPA 3PJXA 2VB6A 3NL0A 2XCPA 2KRBA 4GMKA 3K89A 1VYAA 3BGOP 3AAWB 1H7WA 3OFGA 4R0JA 2CUYA 4J9KA 5A8KB 1Q5YA 4WK3A 3GWCA 5ETKA 4AUKA 4DI6A 2OD4A 4Y65A 1N48A 1IBKJ 4C0BA 3BJYA 2N3LA 4DMZA 2B4UA 2CPHA 2OELA 1X60A 1R8PA 1YI2S 1Q78A 1SKUB 1X0FA 4ZVEA 2GMJA 4KTQA 2OFGX 1QE1A 2HHWA 2XMAA 4F2SA 2H5EA 4O3QA 1SH0A 3EGVA 4CQ1A 2KM8B 1XR5A 5F3TA 2E1CA 2UXBJ 3JS9A 2DK2A 2LLZA 3R7SB 5HATA 3EVMA 3D28A 4EBEA 3R5CA 3R1HA 2V2QA 4JV5J 2AWZA 1CEZA 2VF3A 4HI1A 2AQ4A 2IA6A 1HNIA 1EX8A 5C24B 4C6AA 4OHYA 1UEVA 1KEKA 3AXKA 2ZBIA 2JHEA 4KPCA 1KR4A 3M8WA 3ZZUA 3CJKB 2GJ2A 1AFIA 1S72S 3IFEA 4DX8H 4C9DA 4LREA 2VG5B 4K4WA 2M3DA 2Y0SD 1EJ7L 3SBMA 3PIPQ 1V3ZA 2LXFA 1HQ2A 4ZPBA 4L6V3 4OIXA 4AXJA 1HR0J 4XAKA 3OTEA 4LIWA 4A48A 2WSCC 3D0IE 2D74B 2YKNA 2MY8A 4QIGA 2EFGA 4DR2J 2DNHA 4B3RJ 2ZH2A 3PVXA 3HSDA 3LGNA 2DH7A 4M5KA 1C2PA 4A4JA 2CQIA 4TU9A 1YWXA 4ER8A 2HAIA 2ZH3A 4Z7YA 3EPIA 1S76D 1GK8A 3M8QA 3I0SA 3ZTOA 1CJKA 2YKOA 1N5QA 3HPOA 3PW5A 2RS2A 4F8RA 1D0EA 2IRUA 3JSBA 5GAEU 3M6WA 3RB4A 2HIQA 3KTQA 3BH7B 1TUWA 2CQ2A 2VKRA 5H1SV 2XNRA 4DV1F 2E66A 2ZNYA 1IKXA 4LSLB 2CRLA 3EGNA 3BR8A 2YKMA 1IKVA 5L1IA 4DSJA 4O0IA 4MFBB 3V4IB 4JI8J 3HFZB 4P7VA 3C15A 4DCJB 2JSXA 4G1QB 1KLMB 4RUBA 4C0OC 4P73A 2FTRA 4ZVSB 2P9EA 3DDKA 3C16B 2QN6B 3QT7A 4FBUA 2HVIA 3AY0A 3UD3P 3KHHA 4Z2XA 2OD6A 1LWCB 2AJ1A 3OT9A 1S79A 1B0TA 1N36F 1RTZA 1HBMB 1MG7A 3IR5B 1MMDA 3PTWA 2UUCF 4FN5A 2FJVA 4DQIA 2CVEA 2J6TA 3D3BJ 2IY5B 5KFSA 4M5JA 4PQUA 2BM1A 1U26A 1RT6B 1KVJA 4NLRA 3NCRA 1RCXB 4NEYA 2FGOA 4FNHA 2N4CA 2Z2ZA 2P5VA 3CJ2A 4UZBA 5L1JA 2V63A 1VJQA 4LF5F 2EKNA 1SQGA 1BLUA 3V6DA 2BVZA 4ED8A 3ET6A 2EFQA 3PXGa 2UUWA 4RLEA 2E5JA 1WSRA 1DTTA 2RU3A 2EFOA 2GIRA 3FSXA 1SC6A 3DU5A 3G82B 3LP0B 3EMTA 2C2NA 4I68A 2DR5A 1WHWA 4C4WA 2MQLA 2EPIA 1IVZA 1HFEL 4WZMA 1TL1A 4IO1A 1GMUA 3MFHA 3VGUA 4OYOA 2IJNA 3BGLA 5F8NA 2VDIA 2QYCA 1NNDA 1EETB 1VBKA 5D0EA 2E5HA 3IWNC 3DOKB 2HW3A 2HHQA 4D3GA 3BKUA 1YLXA 3DM2A 3L7OA 3MCNA 3JTPA 1R27B 1S9EB 4A46A 4DN0A 1X4AA 2QJ3A 2AYGA 2LXUA 1ZYQA 2KT3A 5T7LA 2KFYA 1XMBA 2YQ1A 3ETMA 4NE9C 2WVCA 2CKWA 2HHSA 3ILOA 4M5IA 4PG8A 4GVBB 5F8GA 1IJFB 2EKYA 4X64F 4OHZA 3QQCD 1O51A 2F9DA 3PKYA 3HZEA 3DNCA 3MOZA 4TN2A 2DGWA 1KN6A 1KTVA 4AL6A 2F4VF 3ONQA 4ZDNA 4NWBA 3M8SA 4ELUA 3FZ2A 4DSIA 4DR3J 2JH3A 1S77D 1S6PB 3WHIA 4PCQA 3AD8C 3DXSX 1VC0A 3VALA 2Q6BA 4I6AA 3PYFA 4JI6J 4PR6A 3DLKA 1T95A 4EO6A 1TFYA 4DL0C 2HS0A 1QVGR 2DEJA 4EZ6A 3T5LA 3CJQA 4RBVA 3FSIA 1H7XA 3IO1A 5LJ3Y 2BJDA 4L74A 2AGPA 2FC8A 5DRKA 2HK3A 4I69A 4ANCA 2E5LF 4TNOA 3GQCA 3NG8A 3BPSP 5KTQA 1FERA 5RUBA 3R97A 2UVWA 4XPCA 2ZH4A 3CD6S 3SZ2A 2IM3A 1E6VA 1VQ7S 2DCLA 1Y0HA 4RR5A 2CZVC 1YZ6A 3QYYA 1JNRB 4RZRA 2J76E 3GYXB 3T1AA 4DQQA 4V19J 1NKCA 4J9VA 4A8XA 1RTDB 2UU9J 2HBRB 4B3MF 1H74A 2KT2A 3D0HE 5B0CA 2R7VA 2JC1A 2KXFA 1Q7YT 2IC3B 4RUAA 4ZP8A 3D4JA 4IR9A 2YWEA 1BQXA 3ZO7A 1V3SA 4K2JA 4EO8A 1UFWA 3FVYA 1SQFA 4F26A 1AB8A 2YY3A 4K4VA 4RJVA 1IKYA 1UETA 2AW0A 2CQ0A 2R8HA 1Y4ZB 2ILZA 3CCMS 1F60B 4QR2A 1WKKA 1GEHA 3M2RB 4F0KA 1MU2A 2YWFA 2U1AA 2VFRA 3TX8A 1V3RA 4PUOA 2GX8A 1L3UA 2JFKA 5DDRC 1HQUB 4NCAA 4FKYA 2W25A 5KFDA 2WONA 5BYRA 2RUGA 4WPAA 4DS5A 1SPBP 1HMVA 3VAKA 2BQRA 2GGPB 6AT1B 3MMCA 1RT7A 4NZ6A 2GVDB 3ULHA 1HNVA 3NOCA 1R43A 1HW8A 4C11B 2J9DE 1LXJA 2CJQA 3ENQA 1Y3JA 3H2UB 3W66A 3FKBA 1SUQA 4LRCA 3K59A 3CJ8A 4Q8FA 4IYQA 2ACYA 2OTJS 1NDPA 5GMKa 2KZZA 1WUUA 2FJDB 5IWAF 1U7LA 4J5OA 3I56S 1H6KX 4WIIA 3MR5A 2JC0A 5F8JA 1ZZNA 1BGXT 3G6XA 5LSRA 2I5JA 3LQVA 1JJCB 4TKTA 4NL5A 2OPSA 1HBOA 1U1KA 3UVJB 3THVA 3HULA 2FVRA 2M9KA 5JVHQ 4PEOA 5HAOA 2HHTA 3NOGA 1KVIA 3H2VE 4FYWB 1Y11A 4RU9A 4YP3A 3PACA 3MAHA 5DDPC 4HEA9 3D54A 1KFSA 4B17A 1Q4RA 4PQAA 1RT4B 2IBKA 1JWWA 1RHUB 2IPOB 3GJSB 2AX0A 3B82A 3KUGA 4WFXA 1PBAA 1HYSB 3K5MA 2ZKUA 3QIPA 1N33J 2ASDA 3KLIA 4I4BA 3I5AA 3RUBL 4F4XA 4GO7X 1D8ZA 2J7WA 4QW9A 3D1QA 1SKWA 2UVRA 4O23A 2DNYA 2GMLA 3RB6A 4KV8B 3TUZC 4RNHA 1RBOB 1S0MA 3RRKA 4LMZA 3FBFA 3UQSA 4K4ZA 2FDNA 1IR1A 2H54B 2PO4A 3HFKA 2WB4A 4LF4J 3GCXP 3TQ1A 1FHTA 1N56A 1HHQA 3H20A 1D9AA 4RW9B 2QRRA 4IG0B 1SIWB 1R31A 4H4OA 5GADI 4GC7A 3DDNA 5EX0A 5FLXU 1GMWD 2VBWA 4O3RA 3N79A 5D3GB 2NPFA 4J7CA 1TL7A 2CQDA 4TQRA 2ZM6J 3CDWA 3T19A 4L3KA 5KFMA 5I3QA 1CJTB 3MOJB 4DEZA 1IBMF 4DUZF 4LF9F 3M1VB 4DV0J 1X31C 1NCLA 2DNLA 3IAS9 2HURA 2CQ1A 3QGHA 3TX0A 4C3MA 4O3NA 1NHKL 3Q2TC 5KG5A 1Q53A 2GQQA 2HFOA 2H5JB 4JI4J 3HD2A 4UOFA 4CLKA 1KQKA 4ZLLA 1WC5A 3KDOA 1N34F 4Q0BA 4LRBA 2LEAA 5D78A 2C2EA 3KOAA 2HNDA 4OV6A 5AXMA 1F9FA 1S1XA 3QGPA 1HQEB 4RW6A 3HHLB 5DJBA 2PGCA 1NSQA 3H2LA 3D66A 1VISA 5HQLA 5FIIA 1RHRB 3DRSB 1RK8A 1Z2ZA 1HWUA 1WORA 2E5GA 4TQSA 3MZIA 5KFVA 5KFAA 1V6HA 4KE5A 3MEDB 1KBRA 2CA9A 1J2VA 3DOLA 2HVHA 2W2QP 1VJWA 4LF8F 4X4PA 2AF6A 2AV5A 3R5AA 1NDLA 4N8OA 1UWAA 3CF5Q 4OI2A 3VV2B 3NNCA 3KK2B 1H72C 4NI2B 4EBCA 2IM1A 1TL5A 1A0OB 1CC8A 4XPEA 1FKPB 2DR8A 3CCZA 2DTJA 4DFMA 1T11A 1UMJA 3WC2A 1XWLA 5DZ6A 2FHJD 4E8UA 1E6YA 1S12A 1FRMA 2D3UA 3DLEB 1KNZA 2OPRA 2QLXA 3BBBA 1PGZA 2V67A 4DR6J 3CJ4A 2KU7A 3SXLA 2DBBA 4DV5F 2BACA 1S57A 3HHNB 4U67Q 3M05A 1FFWB 2LECA 2RMLA 2QC3A 4LF2A 3Q8QB 3KLFA 3DRXA 4NLSA 4ES1A 3TEHB 3OTCA 3AA9A 4JB8B 2RSQA 3NEKA 4J9MA 4DL6A 2OEKA 1AW0A 1JKHB 4ZCIA 1DLOB 3QT8A 3AD9C 3Q23A 3MPWA 3K2YA 2HGLA 3PY8A 2C2KB 3AB2B 2E1MC 2U2FA 4M5LA 5GMDA 1JLFA 3DHWC 4LIRA 2A18A 2GJIA 1U2RA 1N6QB 1RT1A 1PO6A 4X65F 3BYPA 4CDIA 4RWXA 4RUHA 4DZDA 1WEYA 1FRJA 3NMRA 1XN9A 4V1Ak 3MAAB 2BX6A 2PC6A 2OMOA 2W4DA 4CLPA 2MJUA 3NP5A 2HGMA 3U27A 1Z1ZA 3BGRB 2BQ3A 5IZHA 4B3OA 1RWWB 4PRFA 5KT2A 1WC4A 4OMFG 4X4OA 3WC0A 4JV1A 2Q79A 1SCJB 2OFHX 2OTLS 1I94J 3K7RA 1T9VA 3O1LA 2UV8A 4OYWA 3J81j 4WKYA 3JB9k 3AOCA 2QEXS 3H25A 1YIJS 3O44A 5HLFA 3JQJA 4MK7A 1QAXA 4OYXA 4WIQA 4ELTA 4IH5A 1KQFB 4I2QB 2XGPA 4NXMJ 3HJFA 3M7VA 5KFNA 2F7VA 4CTAB 2QLWA 3KG0A 2VQFJ 1WC1A 2B0GA 5D6GA 4TY8B 4HHHA 3IS9A 3FSYA 5BR8J 4C97A 1T03B 1IWGA 4WJBA 4CH7A 2EG2A 3PR4A 4X4RA 2I1RA 3ITHB 3TZXA 4M63A 1W25A 1FXDA 3R2DJ 1XNRJ 5U47A 2RNEA 4HDHA 2VOPA 5K8MA 1V9OA 4OX9J 4RW8B 5AE1A 1UWBA 4OYAA 5HN0A 2VICA 4X4TA 1S1UA 3DOMB 4UY85 2X3GA 3GG1A 2VG6B 5KFOA 4G6VB 3A8IA 2P6TA 2VPZB 2DNRA 2OAUA 4Q2LA 2B56A 4OZ5A 3T6BA 3CTRA 4KYZA 3V6KA 4X4NA 5L38A 2FYXA 3FCVA 3TNVA 5D4PA 3KK1B 4DU8A 1MNEA 4IFYB 2ZBRA 3D6TB 4JI2J 2GFFA 1VRTA 3ZZZA 3X1LB 3MD3A 4WU2A 1FVSA 2KHDA 2IAJA 4RW4A 2XZWA 3WX8A 2VBZA 2FZKB 3KKFA 4DX6A 1EQMA 1KHVA 2XZDB 1HHSA 2I8EA 4DOZA 5EGYA 4CT8A 5C25A 3QRQA 1GMVA 2W8LA 1VQ5S 2J0WA 2CWXA 2JEJA 3C2PA 3KJQB 4EYIB 2XHWA 3CCES 4HI2A 5LSLA 5J1EA 4ZITA 2X7IA 4N47A 1SC1B 4UOHA 1VK3A 1LFWA 2QIFA 1RKIA 2FVQA 2ACMA 4ZVTB 3UDEA 1FI4A 2DHGA 1EP4A 3MDFA 5E33A 4U8VA 1N5YA 3R8YA 2HFUA 2DO0A 1R0AA 3HHEA 1WG1A 4H4KC 4LFCF 1VCTA 3UDCA 2W9CA 1OQ3A 5HSPA 4ZKAA 3M2UB 3JTOA 3CCLS 4TY9A 5CCLA 4KHPJ 4F25A 3LA0A 2EBEA 3EDRB 2ZC4A 1S48A 3ISND 1FTCA 2B4OA 4L76A 2E9TA 1SBRA 4KKOB 2GNKA 2MJNA 3TYTA 5A8KA 3CDEA 5DO2A 3H4BA 2HFZA 4PZVA 1DARA 1VC6A 3W2VB 3R5BA 3W61A 4ECYA 4C3KA 2N7CA 3EVWA 1XBWA 2K2PA 5D0RA 2Z30B 3TEGA 4CO3A 2NZCA 2JLGA 3ZFVA 2ZH8A 3CE8A 4TU8A 3OBIA 1NHUA 3D6HB 1U1LA 2IVMA 3MR7A 5F8IA 3J80U 2Q3PA 3EYZA 1NSAA 1VQLS 2WSEC 1G2EA 3QGGA 3ZTSA 3EICA 3KNGA 2C28A 5DETA 4RO0A 5J2QB 3T1YF 3JTNA 3AQOA 4IDKB 3UWTA 5C24A 2GW8A 1JLAB 5BXIA 3IWLA 5IFMA 1YBTA 3TZWA 4XDCA 4FNIA 1REVB 1S0NA 1U6FA 5A6PA 2XQCA 2FHOB 3VAIA 3CJKA 1NBEB 1NUEA 3VF0B 1SJ3P 2GZOA 2VG5A 1N36J 4ALZA 1OWXA 4CO4A 4BS2A 2DB1A 3POTB 2UUCJ 4U7UK 4K4XA 4Q7AA 2LXIA 1H2TZ 2OIHA 3O5TB 4Z37A 2JX2A 2VG7B 3IXQA 2KJWA 4WFZA 1JLCB 2F40A 4QPTA 1HWLA 2DXFA 1WKJA 3MEEB 2IVYA 2MZJA 2XZTB 1VOMA 1GQEA 1GX5A 3IBWA 1YJ9S 2PIIA 3HD1A 2D41A 3MECB 1MROB 5F0WA 4LF5J 4USWA 1MWQA 1WC0A 3U02A 1QTNB 2FHKA 2WW8A 1U09A 2LQJA 3GSDA 4DF8A 1HPZB 2HQ3A 1K47A 1NH8A 3J7A1 4CO1A 3WIUA 1V5VA 5CH7B 3PV8A 1FNOA 2VJUA 2QGFB 4JI7F 2VD3A 4J9RA 2ZD1B 1SH3A 3RR7A 1F9HA 1FF2A 1M5SA 1FRXA 3N0VA 2CFXA 4LSLA 3QLHB 5GADU 3J7Z5 4MFBA 3V4IA 3HSJA 4R8UB 1SB6A 2YVSA 4JV5F 2OH2A 4G1QA 1DZ5A 4KO0B 1KLMA 2DGOA 4EGLA 2NXJA 3NXZA 3BEGB 3C16A 4QU7A 1LWCA 3KHRA 1Y00A 1ZAXA 2IJFA 4PXEA 1YBAA 3I9V9 1HBMA 3PKMA 5LJ5Y 4USUA 4ZIWA 5ETNA 2NXEA 2HHHJ 4ZPWR 2RU9A 4U95A 4J9QA 1B0VA 2WVEA 3HM9A 3U7JA 2POKA 5DGBA 1RKJA 1PAUB 4X64J 2HZVA 1RT6A 4EEYA 3KXDA 2BV3A 1DBDA 3QT6A 3MI7X 2GA7A 1N5SA 2CQCA 2MDAA 1EIYB 2XB2D 2F4VJ 2E9RX 1XR7A 4B3RF 3UNGC 3HHDA 2ZZMA 2DHAA 1N32F 1PSDA 2L08A 1WNEA 2DKOB 1U6ZA 4C48A 1BE4A 4Y2IA 3Q8VA 4M5GA 1U0SA 3G82A 3LP0A 4KGVB 4K59A 1MMNA 4BHQA 1KP6A 3AB4B 4ZCKA 1ZM4A 1Z2LA 3ZXWA 2HLTA 1SL0A 5B08A 5KFHA 4L73A 4OLOA 4ZJQA 3B54A 2WOMB 3NKYA 4F7VA 4F4AA 3HVRA 2E5LJ 4ZP9A 1RHKB 1EETA 4DPWA 3NBPB 1FEHA 7FD1A 5DDOC 4BC9A 3UW1A 2XNQA 3DOKA 3VR1A 1UA1A 2WCXA 5EDWA 1UPMB 3MXHP 3IAM9 2B43A 4MTPA 4YS2A 3I55S 2JFDA 1F0XA 4DWIA 2QFIA 1S9EA 1X4DA 4CLLA 5LMNF 1VGYA 3TQEA 5D0GA 5ETTA 4GVBA 2ZHOA 2W1BA 1PBUA 3AJ1A 4N77A 5DQHA 1TQLA 2ZH9A 3KLGB 5HMZA 3AFGA 4FPIA 1JLQB 4U6PA 5ETVA 2HEKA 4IO9Q 2LCWA 3TA2A 4DG1B 1URRA 1VI7A 4P2MA 3G96A 1S6PA 2Z56B 3HP6A 1OYDA 2ZNZA 3JQMA 3KK3B 1QUPA 2BW2A 1T8EA 4KIAA 1FCAA 1K8AT 3Q8YA 1RYSA 2ZZTA 1RJJA 4LT6A 4ZS6A 2CNOB 3VQTA 3KLEB 2AD9A 1YG0A 7FDRA 1RISA 3MPDA 1NEEA 2YXLA 2BJ7A 3QFHA 3TZZA 1Y5LB 3OL6A 1XIQA 1K1QA 3JAMU 1SC3B 4Y3CA 3QZ7A 3K0JA 4EBDA 2C3UA 3QPIA 3RZAA 4ED2A 5J2NB 1Y5NB 5BYQA 1RTHB 5KT7A 1RTDA 1AT1B 4DDFA 3SV4A 4LRAA 2HRYA 1S49A 2ZOFA 2XC9A 1HWIA 2IC3A 4DR4J 4OX8A 2J0XA 2ZHBA 2GAHC 2UV8G 3MR2A 4DFKA 3G8QA 2L48A 4K4TA 1C4AA 1TK5A 5A0YB 2F8MA 3OXGA 1L3VA 4K4UA 4OYBA 2R3VA 5KG6A 1BWEA 3A3OB 2C2ZB 1WC6A 1RWUA 1B4SA 3MTKA 3EXCX 4WP3A 2VKZG 2CPYA 2QE5A 4DV4F 2PMHA 3M2RA 3K5PA 2B7CB 2FUG9 2MKHA 1TKTB 3MPYA 3VZIA 3G71S 4DPTA 3HLUA 4ED1A 4GKJJ 1QSLA 1HQUA 1RAFB 2BJ1A 2A2CA 5F0UA 3LOUA 2YTCA 2BE2B 3W65A 4KHMA 1W26A 2GGPA 1PC5A 4HACB 2HBYB 3J7AN 1UA0A 1UEUA 2GVDA 4K5SA 4RPFA 4C11A 3IC1A 2VC1A 4DL2A 5CYMB 1HL6A 2DGUA 4B9NA 2W2NP 5CA5A 1HWJA 2VH7A 5B0EA 1Q8LA 1NPKA 4NMXA 4DV2F 1N0UA 2JEIA 1ICEB 4QCLA 5CAAA 1VHFA 2E29A 5KG4A 3GMGA 2FJWA 3CT9A 2N4DA 5KT5A 5KOXA 5KFWA 4QWDA 2YWKA 4A8QA 1TR0A 5K8OA 1QTMA 2BKNA 5J2PB 3UVJA 1LWFB 4Y00A 4WFBQ 1EQ0A 1SJ4P 2HIYA 4RBUA 1ZETA 1D09B 1VQKS 1ZH5A 1S9FA 4WP8A 1NK6A 3MGJA 2RH3A 1OMSA 3J81U 1IBMJ 4DUZJ 3QWPA 4WFYA 2EC2A 4LF9J 1M1GA 2AJFE 1TKXB 1FESA 1QLNA 4NPOA 3TA1A 1BY9A 2Y9HA 1RT4A 3VZHA 2MZTA 5KT3A 1H38A 2FVSA 2ZVSA 4I67A 1R8AA 1U2CA 1HYSA 2Z8QA 1RU2A 1WC3A 4LJMA 3TARA 3QGIA 2R9LA 2FLPA 4L75A 3C8YA 1X5TA 2EFNA 4USJC 3E2EA 3TANA 1S97A 1CPZA 3PW2A 4A8WA 2UUTA 3DI6B 1R8BA 3SFGA 5HBMB 4OYZA 2Z4PA 5CZXA 2E7VA 3M30B 5D8HB 3NS6A 2D7SA 4KV8A 4B02A 3N9UC 3W2WB 2QYGA 3A13A 2B4PA 4FF3A 2RDIA 4FYVB 1FXRA 2G13A 5C42B 5KOWA 5BJRA 2MHNA 3DRRA 3OL8A 3K8WA 3I4PA 2B7BB 2GHPA 3B78A 2AEFA 4RW9A 1XTZA 1FX2A 4IG0A 2VPWB 1CC7A 2JDJA 5DLFA 1UFLA 4LFAF 5DLGA 4LF8J 1I51B 3S8SA 1BWVA 5D3GA 2QL9B 2ZKTA 2DNPA 2F4FA 4QJVA 5K14B 2ZHAA 4HDGA 1P9QC 3VTIA 2V2ZA 5AXKA 2M88A 1TP7A 2XCAA 1CJTA 3FK4A 2QV6A 2FLOA 1Y10A 1NH7A 3OHBA 3M1VA 5L8RC 1X5SA 4USKA 2MKCA 1WG5A 3SCLE 1WKLA 2KYXA 4OX6A 3MM6B 3IMQJ 3QT5A 4P75A 3KJNB 2RS8A 1HKAA 2DXDA 1N5VA 3D7SB 2ADCA 1VQSA 2B6AB 3SMZA 3UNYA 1NDKA 3AODA 4DV5J 3UCZP 2KVIA 1VQOS 4RNOA 3SEOA 2PDAA 2RD5C 1XK8A 1HQEA 2K7JA 4DS4A 3HHLA 2YNFB 4HTJA 1X7VA 4OZ2A 4J37A 1U1NA 1VS3A 3LWMA 3DRSA 4AQYJ 1RCOB 2YX4A 1T0TV 3CJSA 3BQ1A 1X4BA 4L72B 4ES3A 3MEDA 3OFEA 3SQGB 3GIRA 5F8LA 3SFUA 2F8HA 3TRGA 2MLXA 1GAOA 4KJIA 2RIJA 1DTQB 3X3UA 2DNMA 5G4DA 3UN2A 4DL3A 4JYAJ 3C19A 3H7HB 1IN0A 2YKAA 3MWBA 3KK2A 3WQPA 2ZH5A 4NI2A 3ZZOA 1ZA1B 3G6VA 2IYIA 1T05B 5DG7A 5IV4A 4F0HA 1HWKA 1NO8A 1FKPA 3Q8SB 1TMJA 2FJBB 3KLHB 2QLFB 4DPOA 2NUUG 4URSA 2HS4A 4DV0F 1NKEA 3AXMA 1YITS 3P45B 2AYBA 1C0UA 3DLEA 1NZ8A 3TAMB 1CS4B 2JLEA 2MKIA 2FVPA 3PX4A 4YN3B 2ASJA 3AOBA 4CM2A 5J2MB 4KFBB 3HT3A 4LRFA 2QA4G 3M4XA 4JI4F 3E51A 4F3QA 2FZCB 4PG4A 3M6XA 2VBXA 2X3DA 3ZNUA 1WSVA 5JXSA 5HQ8A 3W64A 1KD1T 3A8JA 1RBLA 1H73A 5EUHA 1R8HA 1JKHA 2LMIA 2GAGC 1DLOA 3GFHA 2RUSA 3A12A 2XMVA 1JLBB 5GAHU 2XTJP 3CDUA 3DDIA 4CZCA 4FYDA 3L4BC 3SI8A 2F8EX 5ETOA 1UVKA 2EFVA 2V8DA 3CD7A 4B9UA 2G2YA 3EX7B 4E0DA 1GFWB 2EC0A 2K06A 2IM0A 4CNYA 5HP1B 3HKZD 2ZUGA 1SJQA 3BDEA 2E44A 3DCAA 3N01A 3QAEA 1WHXA 2KL8A 1Q8IA 1N6QA 4RL1A 2HQFA 3QSIA 3IG1B 2DGTA 2ZEJA 1MSWD 2K8GA 1U1MA 3MAAA 4I6WA 3E01B 4OI6A 3BGRA 1GT8A 3VVUA 2DHXA 2QG9B 2W4CA 2ZC3A 2Z2MA 2V8PA 2XM3A 2LP4A 1H2UX 2BJEA 3C66A 3DLJA 3A8KA 3M9OB 1TU0B 3KMSA 1CQNA 3NWGA 2Y1RI 2QLJB 3PCOB 5I3UB 4EMDA 3HCXA 3ZZYA 1RWVB 4ZVFA 2DEIA 1GNKA 5GMEA 3Q83A 1LQ9A 3IRXB 2A3JA 3MM7B 1S1TB 3MCOA 1F5BA 1KVKA 3G2XA 4C98A 4I2QA 3EGZA 2MZRA 2HHVA 1KC8T 1YX2A 4CTAA 2V2KA 2DYAA 2YQ0A 3W7BA 1VR6A 4TY8A 2KFNA 4ZA1A 1T03A 2MQOA 3ITHA 1VIXA 2UP1A 3NNHA 5KT6A 2BJ8A 3MM9B 2WVFA 4C8LA 1X0PA 4I56A 4LFCJ 4ZN1A 3CCSS 4RW8A 1I1GA 1EAYC 3I6PA 2HSEB 3M8ZA 2V34A 1RAOA 5L9NA 5IM0B 3QZ8A 3DOMA 1LK7A 2VG6A 1OY8A 5FJ4A 1IUJA 3DC2A 1IR0A 4OZJA 3JXOA 2XWXA 2D3OR 5ITHA 4LQ9A 4X66F 2VQEF 4F4KA 1X4FA 4LFBF 3KK1A 2R42A 4N41A 3OTBA 4IFYA 3VAGA 1R7IA 2BYCA 4ECQA 2QX0A 8RUCA 4KRWA 3Q8UA 1URNA 2L9WA 2DR9A 1J5EF 3N6MA 3SSQA 1W2BR 5FDLB 2HFVA 3OLAA 1EKSA 1PYSB 2YNIB 5HVHA 4CRJA 1HIYA 1FX4A 2F9JA 2KKHA 2DHSA 1CSJA 1FJ7A 1FTRA 3R5GA 1RBAA 2R7OA 1VQ8S 4DFPA 4DCOB 3KUHA 2KTQA 1YRXA 2ROEA 4ZPVR 4HKQA 2B51A 4QOTA 2HVEA 2JVRA 4M5DB 2DNOA 1M5HA 1KKHA 2FY1A 1OO0B 3M2UA 4OJ1A 1D3WA 4DR1J 4OX9F 5KT4A 2HGNA 2W7PA 2VA2A 3VWSA 4LBIA 5HJXA 3FFIB 3W8PA 3N28A 1FRLA 4KKOA 4FXVA 4G1PA 4PXCA 1U24A 1X4GA 3GSIA 3IGVA 1VQMS 2DY9A 3VHQA 4B08A 4G3IA 4E98A 1X9SA 1G4CA 3W2VA 2RKIB 2WK4A 2I2YA 2W9AA 1QUVA 9RUBA 4DXLA 4V19X 4M5HA 1KDNA 1BXNA 4JI2F 1JXLA 4MK8A 3MR6A 4OZNA 2XO6A 2R8KA 2PE8A 4K0KF 2XMTA 4F2RA 2RJZA 3LALA 2LDYA 5AT1B 4DPUA 2UUBF 1NSKL 2VIHA 4JI7J 3SDEB 4PABA 5L1KA 2EFPA 3BO2A 5KFUA 4IRKA 2KI2A 2Z2YB 2OGUA 5J2QA 2DY1A 4OFZA 4IDKA 3N5FA 1JLAA 3L09A 2F5GA 1FNMA 1REVA 2A6MA 2XG8A 2LYVA 4JI0J 4LVNP 1RWPB 4B9SA 2VONA 3J7YI 4IUFA 5KAKA 1QVFR 4FS2A 2V94A 3P49B 3TW0A 2Z2LA 2DH9A 4OQJA 3ZTQA 3POTA 4O4GB 3M6VA 1N0VC 2FC9A 4KHPF 4UOGA 1ITPA 2IM2A 3MEGB 2VG7A 4PAAA 1LXNA 1VHIA 4M94A 1WTBA 1JLCA 3NGRA 3LP1B 3BQ2A 3MEEA 3T5KA 2QLBB 1YJWS 4ZK7M 4K50A 2JEGA 2QA2A 4KGXB 4QPXA 1HW9A 3MECA 1MROA 3D6FB 4USTA 5KG1A 4CM0A 3R9LA 4W98A 3EWGA 3NGUA 1N32J 2R7WA 2CQ4A 4GVLA 5LT5A 1SKSA 1HPZA 2BZ2A 2H48B 3QATA 1DRZA 1QJHA 2ZZNA 4X84A 2M2BA 2YWHA 1IXKA 2ZD1A 2A2DA 5HMXA 5E7OB 1U1PA 1LWEB 3QBCA 3JYTB 3QLHA 4LRDA 4Q5VA 2XMJA 2CJAA 3UCGA 5T41A 3RR8A 1AXQA 4R8UA 4KO0A 4IH6A 3FZBA 1FT8A 4DU7A 1TMMA 3GB0A 3GCWP 3N4WA 4KBIA 1G6BA 4DQRA 3PYDA 1B7YB 4RU2A 4DV7F 1AUDA 3P8BB 4UOCA 3R6GB 3A1YG 4CNZA 4LR8A 5LMNJ 4O3SA 3V2UC 4DL4A 3CCWA 4M5MA 5KG0A 2QMUB 2ZH1A 4OZLA 3LP2B 3HSGA 3FGVA 5L39A 4WYLA 3BSAA 2HWHA 4NZ0A 2WBMA 3H40A 5ETQA 5A2QU 1TV6B 4F02A 2R8IA 2EXUA 8ATCB 3KWMA 2W2MP 1A7GE 3PX6A 4QWCA 3NNAA 3GFZA 2X1BA 1IJEB 2M7SA 4DCPB 2IMWP 4UY8T 3CCQS 3UPFA 4ID5B 1NJYA 1RTIB 3ISNC 3CSKA 5C7PA 1NMEB 1UFKA 5CYQB 4ETZA 2WOMA 1TK8A 1AUSL 5GAGU 3JSMB 2CNLB 4ZJLA 2DIUA 3NBPA 1RAJA 3FCWA 4M95A 4C8YA 4RX6A 4P7TA 2ADBA 2MSSA 4A47A 2CZ4A 2YQ3A 5LSOA 2C3OA 2W8KA 3NMAA 1PJ6A 1B70B 3NGTA 4IFVB 2HHHF 1VQ9S 1WF1A 2JZ5A 5EWGA 5DS7A 4EWTA 4RUCA 1JIHA 3I5CA 1NPPA 3KLGA 1JLQA 3OXLA 1N5TA 2WBRA 2ZFHA 2MGZB 4DG1A 2QA4S 2Y0BB 5SUHA 3UN3A 2LDIA 1TZ0A 4NZ7A 1X9WA 2G9OA 3C3LA 2XY6A 3ZZPA 5J1PA 3CVKA 4DV4J 3D0GE 3KK3A 1YVFA 1H2VZ 1NPRA 3CJ5A 2V4JB 2K1RB 3W3SA 1CBKA 1YZ7A 2XWYA 3GTYX 2WTFA 1MN9A 3KLEA 2CWKA 5CCMA 5KFCA 1JK9B 4DSEA 1OSCA 2MEWA 3QSYB 2CJXB 2XGQA 5F9LA 4O3PA 3HKWA 4ZOSA 2R7UA 3ILIA 1RYRA 2FJAB 5DZ7A 2F1FA 5M2RA 4RWWA 3THTA 3RAMA 1S0OA 3FQLA 2EW9A 3EZ5A 4AFFA 2BRLA 4ILLA 2W4PA 1KTQA 2HZCA 5J2NA 4DV2J 1VLOA 1WHVA 1RTHA 4YHHJ 1Q82T 2BM0A 4GRSA 3DKDA 2G0CA 3MMJA 4I64A 5GAEI 4JI3F 2R2SA 2DGXA 3N6LA 3VQSA 3L7PA 3OUYB 3GV5B 5KFRA 4UUWA 3L7UA 4BWMA 3K57A 3ZZTA 2DIVA 2EEYA 3S01A 5A0YA 4NXNF 1LFPA 3PIOQ 3C6TB 2JVOA 3CC4S 3BB5A 3B4DA 3M8YA 1M5VC 1S0VA 1UJ5A 4DF4A 2HMIB 3C46A 2LFVA 3LGMA 1X5PA 3B8HA 2BR0A 1TL4A 3CD0A 4DHVA 4DV3F 2HRTA 4ZMMA 1CG2A 1TKTA 5THWA 4PWWA 5AJ3J 1XC9A 2FPHX 2RE1A 1RGVA 2BE2A 4K5RA 2DJWA 3ZNJ1 5B0AA 2WB1D 3RAXA 1RT2B 2PEBA 4HACA 4DX7A 3MCSA 1U4BA 5A8WB 3M9MB 2COLA 5B0GA 3DLGB 2QMXA 2ABYA 5CYMA 3M8RA 2CNKB 3DGVA 4OI1A 4R0EA 2RVJA 4KSEB 3S6EA 3LO3A 1FFGB 3RAQA 1KQSR 1KONA 4OI3A 3HSZA 4PYAA 1Q5VA 4WP9A 3H4DA 1UW9A 1JLGB 4N8NA 2UXDF 1XQIA 5E5NA 3DN9A 4J9OA 4RKUC 2AJ4A 3TJ8A 3NCPA 4PKDB 4F67A 3BSNA 2G1DA 3M2VB 1XNQJ 2H65B 3MD1A 2VU5A 4TYAA 2CPXA 3M8PB 4B9LA 3PYGA 2O67A 4LFAJ 1RHQB 2KT5A 4P2SA 3J7ZT 3F41A 5L46A 4DR4F 4YQWA 5J2PA 3LTOA 1LWFA 2AYEA 2ILYA 2IRXA 2ZDOA 3PNIA 2LU2A 4LR7A 2YWGA 2OHDA 1OSDA 1RI7A 2OPQB 4FYXB 1OPIA 4YB7A 3ENAA 3SCKE 2JRSA 2LU1A 1FDNA 2HHXA 1IQZA 4USMA 4CLZA 2B8PA 2QZ8A 1TKXA 5IOLA 2ZJQQ 2O5DA 2BDPA 2UVUA 2DGVA 4DQSA 3G8SA 3IGNA 2FGCA 1NHVA 1LW2B 1UPPA 1X9MA 4GKJF 1BUXA 4X62J 4CYUB 3CWJA 4KGZB 4NCBA 4ZPTR 2R7SA 3O3LA 3W60A 3DI6A 1WD6A 1FK9B 2IRYA 5HBMA 3C6UB 3M6UA 2GIQA 5K8NA 4HHJA 5G0RB 3M30A 4O0NA 1LNQA 2CG4A 3W2WA 1A6LA 2AT1B 1Y5IB 4NLXA 2AIRB 3UDVA 2IDEA 4HTIA 5C42A 1TUVA 3H5XA 2CQGA 4A8YA 4BCAA 4E2FB 2V69A 5KFFA 1FVQA 1KS2A 1NK8A 4TLQA 4U8YA 3SYZA 3PFEA 3OVBA 2VFVA 1VQNS 4UF4A 4YFUA 4TLRA 4U96A 4C7QA 3CDBA 1FRIA 5F8HA 3EZOA 4J9UE 3WZ0A 1UJ6A 1R6VA 1LWXA 5K14A 1VQ6S 4WU3A 3RW6A 5AXLA 3RBZA 1U1OA 1Q8BA 4KH1B 3NGSA 4UQGA 3EM1A 4JI1F 5KFPA 1BHNA 5CABA 4W4MA 3BKFA 1HARA 4KB7A 4YMEA 1FDBA 3MM6A 4BC7A 5JVGQ 3BQ0A 2DD8S 1BMQB 3OR2A 4K4YA 5A8RB 3J7YU 1XEZA 1DURA 3MMBB 2J8AA 1F5AA 2B6AA 2WVDA 3TVYA 3KMQA 2XHCA 5HLFB 4A8KA 5EWFA 2J9CA 4FF4A 2C2DA 1QM9A 3VAFA 1RDRA 2VHGA 4QBUA 2YNFA 4FZVA 5D4LA 2E1AA 2PMZD 3KYLA 4FBTA 2LKZA 3QAUA 5IT4A 4FS1A 2NSCA 1TL3B 2DCUB 3SQGA 2LA6A 2KZMA 2I0XA 1IWAA 3T3FA 1ZOTA 3KG1A 2AJ2A 5H9EK 1DTQA 2HQCA 1GTEA 1VRUB 1U8WA 1U47A 3T41A 2J8SA 2YPZA 2P6SA 2O1PA 4LBHA 5KFJA 1QD1A 2RRBA 1HNZF 1T05A 2XYGB 4AYBD 2BBEA 3FMWA 3THPA 3GLJA 3OJSA 2FZGB 2V9WA 2QA1A 2MKYA 1BQNB 3P5BP 2M0GB 4KY3A 2OEMA 2W01A 2X51A 1IKWB 2HLUA 2B8QA 2RQMA 4F4ZA 1HLWA 3FBBA 3TAMA 1CS4A 3GU0A 1WEXA 4FXWA 5KFBA 5E41A 4NLWA 2V8VA 2V0NA 3PHEA 4WF9Q 1NK4A 4S0MA 5J2MA 4KFBA 1YBUA 4DZ6A 5HMYA 1DJ0A 1UVJA 1Q1KA 4P10A 3OVSA 2IA0A 1RA6A 1ZM9A 2HK2A 1Y3KA 2IHR1 3NAIA 4FKXA 3U1LA 4GO5X 4Y2CA 3BM7A 4C3LA 4LSNB 1OJ4A 1PAEX 2W24A 2CDRB 4DR7F 3GV7B 1Q16B 2KFZA 2YX7A 3I0RB 3DMJB 3IBCB 1SH2A 4I7FB 5HK4A 1HBNB 1JLBA 5I42B 1RE1B 4U7CA 2ZOGA 4O4RA 4ZVPB 4AQYF 3QRPA 4NEZA 3QRRA 2XI3A 1YJVA 1FD2A 4LUBA 1P1LA 4Q45A 4CP5A 5MAOA 2LVWA 1NAQA 5CD4A 5EN1A 5HP1A 2G0IA 1OYEA 1VQPS 1Q79A 3IG1A 4JYAF 2XMWA 1LW0B 1RWOB 4Y28C 3E01A 4NRTA 1NJIT 3FMBA 1HBUB 1F3FA 2XLKA 3Q89A 4WXWA 4X66J 2VQEJ 1S4FA 4F0MA 1PG5B 4LFBJ 4I0WA 2GIFA 1F3VA 1YQHA 3KJFB 5LXYA 4FXDA 2LQ9A 1TKZB 2CYYA 1S6QB 4ICLB 3CULA 3OTOF 3ILJA 2CPZA 3SV3A 3DLHA 1OS5A 1J5EJ 3WIVA 1ZPVA 2XI2A 4ZVOB 1PJ5A 1YJTA 5I3UA 2FY8A 2R7XA 1KFDA 2DGQA 3PM9A 3GIIA 3QWUA 5HROB 4DL7A 3IRXA 3V5RA 4ECZA 2V8HA 1RT3B 2PFFB 4AL7A 3MM7A 2VJVA 4Q2MA 1S1TA 1UZHA 3W9HA 2GO8A 4DSLA 3UCUP 4OHVA 4NYOA 3E3XA 4MYUA 4OYPA 1FD8A 2A1BA 4F50A 2BKOA 2AGOA 4DLGA 4G1IA 1TFWA 3MM9A 2JWNA 4WYWA 4B9TA 1LEOA 2VV5A 2CAJA 1APSA 3CCUS 1CULB 1UJ4A 2AKWB 1VBYA 2DRAA 4ED5A 2BE7D 4I2PB 5IM0A 1K73T 4XTTA 3BBFA 4JI5F 1SV5B 1RTJB 4LR9A 4NYZA 4H4KA 4OI4A 4O3OA 2HHPA 4HLBA 3KHGA 4MKYA 5E3PA 3ENVA 3LH2S 4MKAA 1U6BA 1RABB 3QJLA 2ZOMA 3HMJG 3IBFB 1NK9A 3VGTA 1CJVB 2FD2A 2Y1IA 2WW4A 3NY0A 3V6JA 3CB4A 4YDDB 3GJQB 2HBZB 5FDLA 2V68A 1CVJA 4K0KJ 4OJHA 2YNIA 1SVDA 2YBVA 2KG0A 4MKBA 2UUBJ 2DNZA 3DHXA 3D2WA 3PW7A 3NWRA 2XYPB 4TXSA 4J91A 1MWZA 4OLPA 1TKDA 5I4MA 3HFVA 3ZZRA 1IQTA 2V5HG 4F36A 1Q86T 1KOOA 2PA8D 3OHAA 1O6XA 3R27A 4YY3F 3PW0A 2D9PA 4NLPA 2DVIA 3D67A 2KJVA 4M5DA 1RAIB 3JSRA 4HVZA 5J1NA 4DUTA 1RAGB 2B9EA 1FKOB 1AROP 2DRBA 3CGIA 2EK1A 5GVQA 5E3RA 2KDOA 2WAQD 3CC2S 4GC6A 1GX6A 4CLTA 2IBOA 2HRUA 3KDNA 1TAQA 3FFIA 2CQ3A 3LW5C 2M70A 5MLCV 2HVZA 2MQ8A 4OJ3A 2PA3A 3HVTB 2WZ1A 3WX4A 2M4MA 1OIAA 3MFIA 4Y0FA 1HHTP 3EGWB 2N82B 1D8YA 1A9NB 1U2FA 3UI3A 4KT0C 2RKIA 1RZMA 2LQBA 3KJVB 1JJHA 2GJFA 1I6JA 2DH8A 4URQU 3CIMA 3S7RA 1T9UA 2DPIA 1UZDA 4ECRA 2V2VA 3UR3C 5B0DA 2J6UA 1K9MT 3HJVA 1Q8KA 5CYJA 1SQEA 5CD4H 5EX3A 1FJCA 1UW4A 3W62A 3SDEA 4OI0A 3MM8B 1B0PA 1ZS6A 4AL5A 2XSFA 3MHYA 3GE9A 3PEJA 5ETPA 3MMAB 1AZSB 2BJ9A 3GFYA 4PG5A 5B7WA 2OLWA 5K8PA 4OZ0A 1NK5A 3RYLA 1PYTA 1EB0A 1R6YA 3K58A 3A4TA 1YRTA 2FHMA 4FPRA 2IMOA 5FLXY 5DM6Q 4DV7J 5E2QA 2MLZA 4ES2A 2CJYB 4O4GA 1JJ4A 4NLUA 4DR1F 3CPWR 4ID8A 3H5SA 4DV6F 3MEGA 2UXCJ 4X2BA 1GXLA 3LP1A 1C1BB 2KRRA 2ERRA 3K5NA 2FJXA 1B64A 2ZBPA 4Y2KA 3PZPA 1KSPA 3BSOA 4CO0A 1KWMA 2XMKA 1YDLA 2G1HA 4QWAA 5I3PA 2O3DA 4IQXA 4ZVRB 4OX7A 4CLFA 2ZE2B 1RQ0A 4LF7F 2VL1A 2J9EA 2QSWA 1ROFA 1YJ7A 5B09A 1JB0C 3R7NB 3IM8A 3VAJA 4QZVB 4RW7B 5IXUA 2MKJA 2Z58B 4IG3B 2GVZB 1EHWA 5F3ZA 2ATLA 2K3IA 3TUIC 1AYEA 2RHQB 5K9FA 1LWEA 3JYTA 4DLEA 4LF6J 3QMQA 4YUDA 1RWXB 2W9BB 2CG8A 2CPFA 3DGPB 1WDTA 1PCAA 5BYSA 2KYZA 2HNYB 4QR1A 2R2UA 4JI0F 2C1EB 2I9SA 3CMQA 4NCGB 5IC4B 4IKAA 4WKRA 4OZ1A 1IM6A 1TTHB 5D4NA 2Y8YA 1FWLA 2C3YA 4NLQA 2APOA 2F3JA 2K3KA 2FIUA 3AJDA 1RWNB 4NA2A 2HZAA 1IBCB 1Z4UA 4H4MB 2J9DA 2PEHA 1CJUB 1FE4A 3BPDA 3G9CA 2MQQA 4X4QA 4C8OA 4ED7A 1XR6A 3R2CJ 2B5JB 2FQQB 3LP2A 1BD6A 4ZCMA 3UD4P 2BQUA 1FJEB 2AX1A 1NU4A 1TV6A 3AA8A 2OPPB 3FCHA 2ZH6A 5HQMA 1NM2A 1VDHA 4WBFA 2XS2A 3MM5B 1L5UA 2HHUA 5AE3A 1K1SA 4FF2A 4JUZA 5LL6d 3ZC4A 1P6TA 1V5IB 3ISZA 3GG0A 1UVNA 4WWSA 3PRDA 4IH7A 3PO4A 1DHMA 4ID5A 1RTIA 2BABA 3FBEA 1K0VA 5K20B 2YNHB 1GXUA 5CYQA 3M32B 2OO4A 5DQGA 2PI4A 3ADAC 1QSSA 3DYAB 4QR0A 1VK8A 1T7PA 3JSMA 3PRVA 4OYIA 5ETLA 2AEMA 4AD6A 4ENOA 3WDOA 3MURP 3H59A 3N6NA 5ADZA 4WE1B 3O2IA 1F9EB 3VGVA 4USIA 2OSRA 2CQHA 1FJGF 3F0NA 1ELOA 2BMBA 3GIMA 4CCHA 2V6AA 4UW2A 4EU0A 4JI3J 1RU1A 3OFHA 4HT5A 5D77A 3UE2A 4DBQA 4IFVA 5KG2A 3KLVA 2MMYA 3PR5B 4AXIA 4P74A 3HHLD 2JLFA 2CPJA 4QIWD 2NCKL 1JNZB 2XY5A 4NXNJ 1WOSA 1NLKL 2MGZA 3EJMA 3TZYA 2UUAJ 3AHPA 2YH1A 4QQBA 2DPJA 5HMWA 4USVA 1HNXF 2PMWA 5DG8A 4DV3J 2J7UA 4A8SA 1BQMB 1DY3A 4MIBA 2DO4A 2CADA 2V4JA 2K1RA 4ELVA 2HQDA 5JMNA 2Q6CA 4C8KA 2Y8WA 3AOAA 2M52A 1M1KT 3PHTA 2JNJA 1Y7PA 5H9FK 2J6SA 2RF2B 2W7OA 4Y2MA 2MXYA 3N5BA 2NS1B 4BBYA 2D3ZA 1TUGB 1QY7A 2X1FA 3MAQA 3ENWA 1NK0A 1PC4A 4QIVA 3PW4A 4KQZA 1B7FA 3OFFA 1TAUA 3I31A 1T9XA 2UXDJ 3OVAA 3DRRB 5JUMA 4RNMA 4MKVA 1S1VB 1NSPA 1YK9A 1TELA 2EVZA 3OUYA 1X4CA 4ECXA 1OQ6A 4DJBA 4CO5A 1D9FA 5KG3A 5HI7A 1O8BA 1J5OB 3FRYA 2WRMA 4EK2A 1PIEA 1F2HA 3SQOP 3C6TA 2KXNB 1HD0A 2HMIA 3B4MA 4A8MP 5LXRA 3DLBA 2QO3A 1MN7A 2YPYA 3EZUA 1U49A 2AYMA 3LAMA 1SC4B 2ZITA 4JV2A 4O44B 4LQ3A 2UZAA 4B3TF 1WF0A 2OSQA 2XY7A 4P6QA 1M5PC 2YH0A 2HKEA 5JJBA 1RT2A 2LA4A 3RB3A 3IN5A 1M90T 1IM4A 1U1RA 2VC0A 3KNAA 4OZ3A 5A8WA 2BW7A 2HNZB 3M9NB 3SIPB 3DLGA 1S6UA 3TVKA 3HVWA 3BZQA 2ROPA 2E7WA 4N56A 2HQIA 2ROGA 4NASA 3OL7A 4C2MA 3BYRA 3TWZA 2BJ3A 1JLGA 1J27A 3GYNA 5E3QA 2GQ2A 1S10A 3R1LA 1FA0A 3Q86A 5KFGA 4YHHF 3M2VA 4DFJA 3EE3A 3DU6A 3M8PA 3I32A 3RJMB 1SI9A 1RHJB 4A8OA 3BN4A 2DR6A 3A8EA 3DRYA 1HI1A 1KHWA 3T9NA 3CD5A 4ZN3A 1FXLA 4ZHRB 1RLDA 2C2OB 2AP6A 2C22A 3GR0A 1S4EA 2F65A 3S1TA 2ZDPA 1FRKA 4R5PB 2OPQA 4TYBA 3OR1B 5CQGA 4M8LA 2D3O1 4JI1J 3C14B 5T14A 3J80Y 1RA7A 2FLNA 2XSJB 1EZZB 1RAAB 1C0UB 4R25A 1JLEB 2BUNA 3CO0P 4QYZK 1LW2A 2J0SD 3GYGA 2CDQA 5AJ3F 2MYFA 1RT5B 4MYTA 1Q95G 4CYUA 4JV0A 3OJUA 1P8GA 2DR7A 3G4SS 1FK9A 1M5OC 3C6UA 4N7TA 1VIOA 4X4SA 3MEKA 1HI0P 1UVLA 5G0RA 3QFWA 1YSJA 3W5YA 2RQKA 1C0TB 4ECSA 1D1UA 1TVRB 3D1OA 5HJYA 2H9ZA 3FRZA 1ZTTA 1T02A 4YEAA 3OLBA 4DPYA 4NRUA 4KC5A 4DUYF 1LK5A 1N88A 3G86A 1OY9A 3W8GA 4GKKJ 5C5JA 3T5HA 2CNNB 1S6OA 1XNQF 3MF5A 1IBLF 4OHWA 2VZ9A 4DPXA 3TAQA 2N7YA 3MR3A 3OL9A 3TJAA 2HPUA 1F6TA 3MPVA 4PG6A 4WXOA 4N5SA 5M2UA 1HNZJ 3JSYA 4FP9A 1Q81T 4ANEA 3U1MA 3OPKA 1T3OA 5AE2A 3TR5A 4PXDA 3G87A 3DRPB 3FDSA 4ED6A 1NRKA 3ICLA 4D3HA 1WG4A 2P9GA 5A8RA 3MMBA 3HT0A 3O6QA 3LPYA 5H9EJ 2VUGA 5KFXA 2MHEA 1RAEB 4ZVGA 2L9NA 1ULRA 2IFXA 1OY6A 3GR1A 3R5JB 2OEJA 1MWYA 2GC8A 3NAHA 2GCFA 4X62F 1T9TA 2VODA 3NCQA 4RNFA 4OYMA 1HNWJ 1XMOJ 1VRQC 2F63A 2MKKA 2KHCA 1VLYA 4RNNA 1N54B 5KFEA 2I6WA 3VVTA 3FQKA 5DG9A 2AU0A 4DR7J 3TAPA 1DAXA 2G2OA 2PI5A 1ZTWA 3SCIE 4KHRA 1TL3A 2ASLA 4KGKA 2H4WB 2QL7B 5DQIA 2DRDA 3TJ9A 4LVOP 3I87A 2XMUA 7AT1B 2EWHA 1XMQJ 1VRUA 2LQ5A 2CPIA 2BANB 3F44A 2VA3A 3HX9A 1LOUA 4ECTA 4DR5F 2HFSA 2XLIA 2QL5B 5KFZA 3L95X 3WBZA 4DX5A 1GXTA 3HK2A 1BQNA 1S9GB 2CJKA 2GHVC 4WCEQ 4YB6A 1H0HB 2W2OP 1AFJA 1IKWA 3D5MA 5KFTA 4WFAQ 1UL3A 3OTOJ 2YX1A 4M1KA 1JJ2R 1M5KC 3W9IA 1S5ZA 2XBPA 4IOCQ 4IOBA 1S1WB 4PWDB 3I9ZA 1RSCA 2Q43A 5LOQA 4ED4A 1U0HB 2YNGB 2W7AA 3SSSA 3QO9B 1T9YA 4QU6A 3H98A 3PG9A 3MUVP 3VGSA 3V81B 5E3AA 2IYGA 5KFIA 3FC9A 4LSNA 1WI8A 3OV7A 1SKRA 5AXNA 2ZWOA 1GMWA 3I0RA 1P1TA 3US5A 2VFSA 3DMJA 4EYHB 3TI0A 4I7FA 2VASA 2XMMA 3LF0A 1HBNA 5I42A 2AJQA 4WZQA 1P27B 1GH8A 3FUYA 1O0PA 2MQMA 2HVDA 3EPGA 2J5AA 2MZ1A 5D4OA 2MQPA 1IR2A 3BN7A 3ZZ0A 1B99A 2C2MB 2K7KA 2C42A 3JQKA 1C1CB 4ZVHA 4JI5J 1N52B 5B0FA 4Q43A 3D9BA 1WJ9A 4LF1A 4J90A 2ZVIA 1LW0A 1KRPA 1FKAF 1HBUA 1WEZA 3T1HF 4YB1P 4LBPA 3A3NB 4ZPCA 4I1TA 1XJWB 1SJRA 2UVVA 2RDDA 5C2GA 1WOOA 4Y34A 3QIDA 5DDQC 1F5CA 1TKZA 1S6QA 1M1HA 4ICLA 4HH0A 1YJRA 1H98A 1ZM3A 3I82A 2CQPA 4I6YA 3EXYA 4HR2A 2G4BA 2C2RA 4Q8EA 2IVFB 5A76A 1DQ9A 2CJBA 5IT0A 4W90B 3RRGA 4P2XA 4IRCA 1QE1B 5HROA 4CH1A 1YGYA 4ZVUB 2EI5A 5SZTA 3RG6A 1RT3A 2MZSA 3JAMY 5E3CA 1N4LA 4DV1J 2FLLA 3RBDA 1U1QA 3CW2C 3P5TL 3IWXA 3Q22A 4CLSA 4NX9A 2H1YA 3RB0A 1WI6A 4N76A 1HNIB 2J7KA 2W2PP 2HQGA 4AE5A 5LMUF 3HF5A 3D68A 4YY3J 1YJNS 4XIUA 3BV8A 3VCDA 4HL9A 4CLYA 2HG4A 2PSZA 3Q8PB 4FDFA 5IV3A 3RU0A 1CULA 4MAKA 3O8WA 1U45A 4L3NA 2FHJA 4B3SF 4I2PA 4CWBA 1WELA 4HHUA 2XLJA 1QSYA 1SV5A 2LEPA 1RTJA 1VC5A 4ZPDA 2X1AA 2P2CB 2AMCB 2MLYA 3GPAA 4EI2A 1UTAA 2QMWA 2H4YB 2GO9A 3LPEA 5HO4A 1NK7A 3AD7C 3T6JA 2YKNB 3BR9A 3NS7B 3FBCA 1K44A 1R0CB 1IBKF 2V4RA 3FEXB 4AT1B 1X4HA 1CJVA 4Y2AA 3PEHA 4A8FA 2KM8C 4NLVA 2R2TA 4NLTA 1FNXH 4YR2A 2H5IB 3QNWB 3Q2SC 4IRDA 3M8QB 3F56A 3I0SB 3EVOA 1CJKB 2V9KA 1WWHA 1CQMA 2RQ4A 5HVGA 2NZ4A 2M8DB 2JEFA 1QAYA 2UXBF 3UFCX 5M2PA 4ETXA 5CHCB 3P96A 5KFYA 3CMES 1IKXB 2OUGA 2PD1A 2YKMB 1IKVB 3MUTP 5KFLA 3CO9A 2R8JA 3C15B 4FYYB 4J9NA 3AH6A 3PJ9A 3A3PB 2KB2A 1LKZA 1FKOA 1U25A 3CC7S 1SJ1A 1M0SA 3Q0AA 2WSFC 2RRAA 4RBTA 2V4QA 4ZVQB 5A6WA 2XULA 2VOOA 3J81Y 4DV6J 3P4UB 3MPUB 4K2XA 3BKTA 1W7WA 1VMBA 3HVTA 2Y1JA 2XS7A 2BRKA 1HR0F 2CPEA 4PQUB 2V50A 3FEZA 3OW2R 1GTHA 5GAHI 1ACMB 4IQMA 5FD1A 1KQGB 2P8IA 1G1XA 4NLOA 2J0QD 3KJVA 3SCJE 4DR2F 4ATNA 4QWEA 5EWEA 4QYRA 1ZZFA 2KVQE 2DGSA 4J9LA 1X4EA 1S99A 3CXCR 3V6DB 4LF7J 3ET6B 3W9JA 4DSFA 2XEXA 1DTTB 2IJRA 4P9SA 3H5YA 2B4VA 2AHOB 1SL1A 4UQTA 1EARA 1RB0A 2PN6A 2KO1A 3MM8A 4J9SA 1RLCL 1RXOB 5HVFA 5K5MA 4XO0A 4P72A 3DXBA 1R89A 1ZBTA 1AZSA 2CZ9A 3MMAA 2GV1A 1TL1B 3IR6B 3OD2A 1FFSB 1NB2A 3ZTPA 4JI8F 5IT9U 3GILA 1JMTA 1WF2A 1RADB 3TP2A 3GFXA 3LGHA 3NRBA 3DM2B 3IM9A 1ZA2B 4B3MJ 1RWMB 3TA0A 3NS5A 3LWLA 4NLDA 3ILLA 5ETMA 5T7LB 1S7IA 1P9YA 3OQ2A 3R3TA 1C1BA 4MH8A 2HAFA 3W5XA 4ECUA 2VPYB 4C0HA 4HT7A 3GV8B 3CMAS 2DT9A 3PX0A 3DLLQ 3CCJS 1HI8A 2JL9A 4KR0B 1RAHB 3KUEA 1KOHA 1T9WA 2NPIA 2ZE2A 1YJUA 1SXLA 2HS3A 5IC6B 1NJXA 4U7UD 4YR3A 4YB5A 2NR0A 4DL5A 5ETSA 1N8RT 3RTVA 3BSCA 3CDAA 4RW7A 4BWJA 4IG3A 4MJKA 1YKWA 2GVZA 3DLKB 2AZ3A 5ETRA 2P9CA 2DNQA 1U8SA 1JQGA 4UTGA 8AT1B 2AEJA 2EK6A 4MIAA 2KG1A 2FVCA 5KFKA 2W9BA 2RB7A 6FDRA 3DGPA 2Q1LA 2CJ9A 3IP0A 1DQAA 1U02A 1ZM2A 1RP5A 3FEYB 2HNYA 1FE0A 5L1LA 3HZGA 4NCGA 9ATCB 3F73A 2ZUAA 2GQCA 5HL7Q 4IOAQ 1E6VB 1FJGJ 1YTYA 1F2GA 2MY7A 4ILRA 2B3TB 5IS2A 5IWAJ 3I5BA 4USHA 1ZPWX 1DQ8A 3AQPA 1RWKB 1UCNA 2HWTA 4H4MA 1ZAVA 1NJZA 2OP5A 1CJUA 2ASYA 3T5JA 1MMLA 3HI9A 2CVIA 2UXCF 1NB7A 3R6LB 2B5JA 1X5OA 2C3PA 3HO1A 4ITSA 2BOAA 2OPPA 5C2CA 2E1PA 2NQPA 2ATCB 4NA3A 1IKYB 4MMOA 4DR3F 4JOUA 4ZCLA 1HNXJ 2DNKA 3MM5A 4EUVA 2ZJRQ 1UVIA 3FNNA 4XDDA 3L3CA 1MU2B 1VBZA 2DNNA 4C8NA 3V6HA 4PPZA 3GIJA 4JI6F 4PUOB 1FWPA 4ERDA 2L41A 2YNHA 3D1HA 3TUPA 2NLWA 3M32A 3BDPA 2AGQA 2WONB 2Y1LB 1HMVB 4W92B 2MQNA 2B9YA 2R7RA 3BS9A 3KHLA 3DYAA 3MMCB 1RT7B 4LF6F 1HNVB 3SSRA 4ZIVA 4WE1A 4YR0A 1R3NA 5L9XA 1LV5A 1KLNA 4B9VA 1EKRA 3V4MA 2R2RA 4HH1A 1PILA 1SUQB 2A0FB 4BLGA 2ZJPQ 2PT0A 1H3DA 3OTDA 1OPZA 2X1GA 2UU9F 2D69A 3PO5A 4CLUA 4X4VA 5H9FJ 4ED0A 1UAWA 4Z7CA 4OJGA 2E1RA 3ZTRA 2PFDA 1YRUA 2I5JB 4PWUA 4K7QA 2OPSB 3GJTB 1HBOB 5CZVA 1JXEA 2VPXB 3H5UA 2EBGA 2WVBA 4QWBA 2GHWA 1R0BG 3CUNA 4NLGA 1BQMA 1VFJA 1SL2A 2CIMA 4WFNQ 2B9WA 4MK9A 2L9DA 4WK1A 4Q44A 3PJWA 2MZQA 3UO0A 3T9ZA 2AJ0A 4JBCA 4CO2A 4B3TJ 3HVAA 2BEFA 4NLYA 2OJ3A 3BBCA 2E5IA 4URGA 2BE9B 4JP8A 3P3DA 2RF2A 4B9MA 2BXJA 1WACA 1N34J 1Y9OA 4X4UA 3QIPB 2MB0B 3KLIB 1YHQS 2B9XA 3UN5A 1BC6A 4PG7A 2JJ4D 3EDQB 2ALYB 2L3MA 3R7BB 2KXHA 2BA9A 2HYIB 3GP9A 1QAIA 2GS8A 4ZPAA 2H51B 3CJRA 2MSTA 1ZAWA 2RAQA 3NGDA 5IQQA 2ZH7A 3BGFA 4P52A 2QFJA 4ILMA 3CEDA 3I4HX 2OKQA 1S1VA 1SIZA 3PRBA 2CXEA 3TOQA 1RUSA 3P6YC 3LUYA 1J5OA
chains in the Genus database with same CATH topology
2PEHA 3DHWC 4H4OB 1FE4A 3FFIB 4LIRA 2A18A 2GJIA 3G9CA 3N28A 2MQQA 1FRLA 4X4QA 1U2RA 4C8OA 4KKOA 4FXVA 1N6QB 4OHXA 2NUHA 1XR6A 4ED7A 1RT1A 4G1PA 1PO6A 4X65F 2B5JB 3LP2A 4RWXA 1FO1A 4RUHA 2ALZA 4FVCA 4PXCA 1BD6A 1U24A 1WEYA 1FRJA 1X4GA 2DNGA 3IGVA 4QW8A 4B08A 4ZCMA 1XN9A 3UD4P 3NMRA 4G3IA 2PC6A 2OMOA 2W4DA 4E98A 2BQUA 2MJUA 1FJEB 3NP5A 2AX1A 1NU4A 3BREA 2V8GA 2HGMA 1X9SA 3U27A 1Z1ZA 1TV6A 3H8YA 3BGRB 3W2VA 2RKIB 1WHYA 2WK4A 3AA8A 2BQ3A 5IZHA 2ZBCA 2OPPB 4B3OA 2I2YA 2OMLA 4ZLPA 3FCHA 2UUAF 2W9AA 2ZH6A 4PRFA 3R5DA 1QUVA 5KT2A 4X4OA 4OMFG 4V19X 2CPDA 4O44A 3WC0A 4JV1A 2XS2A 3TUJC 2Q79A 3MM5B 1L5UA 2RDJA 2HHUA 3G6ES 5AE3A 1K1SA 4FF2A 4JI2F 4JUZA 1JXLA 5LL6d 4ZP7A 3OR2B 4MK8A 1K0TA 1D9DA 2NREA 2OFHX 3ZC4A 1P6TA 2HFNA 3ISZA 3GG0A 3MR6A 4OZNA 1MW7A 4H54A 2OTLS 2R8KA 4F4WA 2PE8A 1UVNA 2M8HA 4DN9A 4K0KF 3K7RA 3PRDA 3O1LA 2XMTA 4IH7A 3PO4A 1DHMA 4ID5A 3I96A 4F2RA 1RTIA 2BABA 3TO8A 2UV8A 2RJZA 3LALA 2LDYA 4WKYA 3JB9k 2QEXS 2Q66A 1K0VA 3H25A 2YNHB 2UUBF 1GXUA 1N33F 1YIJS 2MKSA 3O44A 5HLFA 4MK7A 5CYQA 1QAXA 3M32B 2OO4A 3SDEB 3EUNA 5L1KA 4ELTA 3IR7B 2HNZA 4IH5A 2EFPA 5DQGA 3BO2A 2PI4A 5KFUA 4IRKA 2KI2A 1QSSA 2M5YA 4DSKA 4Q0BB 1KQFB 5J2QA 3DYAB 4QR0A 1VK8A 4OFZA 4IDKA 1NZAA 4I2QB 2XGPA 1T7PA 3HJFA 3CIZA 3JSMA 2HNDB 4F4YA 1FEEA 4IR1A 3N5FA 1JLAA 1QAJA 3L09A 1S1XB 5KFNA 2F7VA 1FNMA 4CTAB 3MURP 3WDOA 3H59A 3N6NA 1HA1A 5ADZA 1REVA 4RW6B 1Q7LB 2QLWA 4ECVA 3KG0A 4WE1B 3O2IA 3U1NA 2B0GA 2XG8A 5D6GA 4TY8B 2LYVA 5DGAA 3IS9A 4OV1A 3FSYA 4LVNP 4C97A 1W2IA 1T03B 2E9ZA 4USIA 4WJBA 4CH7A 2EG2A 3PR4A 3J7YI 4B9SA 4MIWA 2I1RA 2OSRA 2CQHA 3UDLA 4X4RA 3ITHB 4IUFA 2C3MA 1FJGF 5KAKA 2RQCA 1FRHA 1QVFR 1XERA 1ELOA 2NSBA 4M63A 3GIMA 4FS2A 1W25A 4QYZJ 1FXDA 2V94A 3VAHA 3P49B 4CCHA 5U47A 3GIKA 2RNEA 4HDHA 4UW2A 4DQPA 4LF4F 2VOPA 3TW0A 5K8MA 4EU0A 1V9OA 2Z2LA 3CJ0A 2MPUA 3OFHA 4HT5A 2DH9A 5D77A 4J9PA 3UE2A 3DOLB 4OQJA 5F9NA 4RW8B 4DBQA 3POTA 4O4GB 4IFVA 5KG2A 3M6VA 3KLVA 5AE1A 1UWBA 1N0VC 5GAGI 2MMYA 5HN0A 5IQ6A 4X4TA 2FC9A 4KHPF 1S1UA 1S7HA 4TU7A 3PR5B 4C8MA 5KG7A 2IM2A 4NA1A 3MEGB 4AXIA 2VG7A 2X3GA 4UY85 3GG1A 1LXNA 2VG6B 4G6VB 4ZHRA 5KFOA 4M94A 1WTBA 3HHLD 1JLCA 2CPJA 2JLFA 3LP1B 3BQ2A 4QIWD 3MEEA 3T5KA 5E0OA 2P6TA 3AJ2A 1JNZB 2VPZB 3CCTA 2DNRA 4R5PA 2OAUA 4Q2LA 2B56A 2XY5A 1YJWS 4HYKA 4OZ5A 3T6BA 4F3MA 3CTRA 4ZK7M 2MGZA 2D1CA 2ZM6F 2JEGA 4NMLA 4K50A 2QA2A 3V6KA 3OR1A 4QPXA 4X4NA 5L38A 1HW9A 3MECA 1MROA 3TNVA 3AHPA 2YH1A 4QQBA 5KG1A 2DPJA 5HMWA 5D4PA 3KK1B 1HNXF 1L3TA 5DG8A 1MNEA 2XSJA 4A8SA 2J7UA 4IFYB 2GFFA 1BQMB 3K5LA 1JLEA 2Z0GA 4MIBA 2R7WA 2DO4A 1VRTA 1UKUA 2CQ4A 3ZZZA 5LT5A 3X1LB 1E6YB 2V4JA 1SKSA 4CH0S 5IT9Y 2K1RA 1HPZA 2BZ2A 4ELVA 3MD3A 4WU2A 1FVSA 1DRZA 2Q6CA 1QJHA 4C8KA 2KHDA 2IAJA 1RT5A 2XZWA 4RW4A 2OPRB 2WHOA 2M52A 2ZZNA 5F41A 1FDAA 2VBZA 1M1KT 3KKFA 4X84A 1KHVA 2M2BA 1IXKA 2YWHA 1Y7PA 1HHSA 3HHLC 2ZD1A 2J6SA 3G8TA 2RF2B 2A2DA 5HMXA 4CT9A 2W7OA 2R4FA 2I8EA 5E7OB 3OSNA 4Y2MA 3HDSA 1U1PA 4DOZA 2MXYA 3QJPA 1LWEB 3N5BA 3JYTB 2NS1B 4BBYA 3RRHA 3QLHA 2D3ZA 4K4SA 4Q5VA 2VBYA 2XMJA 5EGYA 2CJAA 3E8OA 4CT8A 5C25A 3UCGA 5T41A 3RR8A 1AXQA 4R8UA 2W8LA 1VQ5S 1QY7A 2J0WA 2JEJA 3C2PA 2X1FA 3KLFB 4EYIB 4KO0A 2XHWA 3MAQA 1C0TA 3KG4A 1HD1A 4IH6A 2O01C 3ENWA 3FJ2A 3FZBA 4HI2A 3CCES 5CXTA 1FT8A 4OL8A 5LSLA 4YOEA 4XK8C 1TVRA 5J1EA 1NK0A 3GB0A 4N47A 5F8MA 1VK3A 1LFWA 2QIFA 1RKIA 2FVQA 3N4WA 1PC4A 4KBIA 4QIVA 1G6BA 4DQRA 3PW4A 4RU2A 4KQZA 1B7FA 2DHGA 1EP4A 3OFFA 1TAUA 3MDFA 3I31A 5E33A 4DV7F 3ETOA 3BO3A 3OVAA 1N5YA 3DRRB 5JUMA 1AUDA 3RW7A 3HHKA 2DO0A 3OSPA 1R0AA 3HHEA 1WG1A 4H4KC 4RNMA 4LFCF 4UOCA 3PFOA 3UDCA 2W9CA 1OQ3A 1S1VB 2FB0A 3A1YG 3BF4A 2EVZA 4ZKAA 3OUYA 4CNZA 1X4CA 3M2UB 3JTOA 4ECXA 1OQ6A 4DJBA 2FJEB 4CO5A 3CCLS 4TY9A 5CCLA 1VBXA 1D9FA 5KG3A 4FVMA 4O3SA 5HI7A 1JLFB 3V2UC 4F25A 1O8BA 2EBEA 1J5OB 2ZC4A 1S48A 3FRYA 2WRMA 3ISND 4EZ9A 1FTCA 1T94A 2B4OA 2E9TA 4DL4A 3CCWA 4F3OA 1FDDA 1SBRA 5KFQA 5KG0A 4KKOB 1RT1B 2GNKA 3C6TA 2KXNB 2ZH1A 4OZLA 1U48A 3LP2B 3FGVA 4PXBA 4PPDA 2MJNA 1HD0A 5L39A 4WYLA 2HMIA 3B4MA 3BSAA 2HWHA 3TYTA 5A8KA 3K5OA 3CDEA 2WBMA 4KGMA 4NZ0A 5DO2A 3H4BA 4A8MP 2HFZA 3H40A 2RILA 5LXRA 3DLBA 4Y6IA 1DARA 1VC6A 2QO3A 1TV6B 4F02A 3W2VB 2CQBA 2R8IA 3EZUA 1U49A 5EHHA 4B3OB 3R5BA 3DRPA 2AYMA 3KWMA 4ECYA 4C3KA 3LAMA 2N7CA 2ZITA 2DISA 2XO7A 1G3OA 2JOQA 2QT7A 1A7GE 2BOPA 3PX6A 4JV2A 2YKQA 1XBWA 4QWCA 2K2PA 4O44B 4LQ3A 3NNAA 2UZAA 3QJJA 2QSFA 2O66A 1X8DA 3GFZA 2X1BA 4CO3A 2JLGA 3ZFVA 2ZH8A 4BDPA 1IJEB 4B3TF 2SXLA 2DITA 2M7SA 1WF0A 2HWIA 3CE8A 4TU8A 2IMWP 2OSQA 3OBIA 2XY7A 1NJWA 4UY8T 4DR6F 4C8ZA 3Q24A 4P6QA 3CCQS 1NHUA 3UPFA 4ID5B 1NJYA 1RTIB 1G7CB 2IVMA 2YH0A 3ISNC 1U1LA 1M5PC 5JJBA 5F8IA 1RT2A 2LA4A 3CSKA 3RB3A 3IN5A 2Q3PA 1M90T