3DLLQ

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA-23S ribosomal RNA
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dllQ00
2O3DA 3CCJS 1U1PA 1PO6A 2M9KA 2K8GA 4TU8A 1O0PA 2MQLA 1VQPS 2AYGA 2BOPA 3CTRA 3BO4A 2KI2A 4WKRA 3TO8A 3MOJB 2MHNA 3R27A 2RT3A 1WG5A 2DO4A 4IOAQ 2OJ3A 2CPJA 2DNGA 5GAGU 1U1KA 2ZJQQ 1YWXA 4A8XA 5LXRA 2J0QD 4BS2A 5CXTA 2G1DA 2LMIA 1KOOA 3VALA 2D3OR 1RKJA 1VQLS 3PIPQ 2LA4A 2DHXA 3FEYB 3NNAA 4WFAQ 2KFYA 1URNA 2DGQA 2EK1A 3VAHA 2QEXS 3U1LA 2CQ0A 4U67Q 1Q7YT 4FXVA 2RS8A 1K9MT 2DNMA 4W92B 1WELA 2JRSA 2PE8A 1U1MA 2G0CA 2LYVA 4F26A 2CQGA 3MUTP 3CCRS 3UCZP 2CPYA 1SXLA 2WBRA 3CMAS 4C0OC 1VQ8S 2DNPA 2EK6A 2MZ1A 3D2WA 1DHMA 1P27B 5DDOC 3SDEA 1WWHA 2LEBA 1QM9A 2LCWA 2MYFA 3CC4S 3TP2A 2JWNA 1VQKS 1DRZA 2DGSA 1VQOS 5D77A 2OIHA 4CH1A 2LKZA 2AYBA 1H2VZ 3JB9k 2AYMA 3N9UC 3CCMS 3THTA 1X4EA 2KG1A 3CCLS 1IQTA 2OSQA 3H2UB 2FY1A 4ED5A 3HI9A 3CCQS 1M5KC 3R1LA 1VQ6S 3TYTA 1SJFA 5LJ3Y 3G8SA 2B0GA 2RVJA 1WI6A 2KM8C 3SDEB 3B4MA 2XNRA 2X1FA 2LA6A 2KG0A 2CPIA 4CH0S 1QVGR 4QU7A 2RS2A 2L9WA 2FHOB 3BEGB 2DNLA 1UW4A 2BZ2A 3EGNA 2DHGA 2RQCA 1M5PC 3UD3P 2ADBA 2QFJA 1X5PA 1WF1A 5ITHA 1X5TA 2DGVA 4QPTA 2E5GA 4Y0FA 3MXHP 5MLCV 2LEAA 5DM7Q 2DGTA 3VAMA 2MZJA 5CA5A 2CPDA 4WIIA 1VC6A 2RNEA 3VAKA 1FHTA 3Q2TC 4ZKAA 1WEZA 2M7SA 1PGZA 1N88A 4W90B 2MQPA 2MXYA 3NNHA 4FXWA 1WF0A 2HGMA 4TU9A 1VQ7S 1Q82T 5LSLA 2F9DA 2KU7A 4WF9Q 2N7CA 3CPWR 2HZCA 1SJRA 4YB1P 2F9JA 2RRBA 2U2FA 2E5HA 4CQ1A 2KN4A 1VBXA 2CQPA 4QQBA 2VOOA 1U6BA 3V4MA 3CF5Q 2MZTA 1Q81T 3CC7S 1W2BR 1FNXH 1VQNS 2CQ3A 5GADU 3I56S 2KXHA 4ERDA 1U1QA 2E5JA 5IFMA 1P1TA 3US5A 2GHPA 2YH1A 2MKCA 2OSRA 4UQTA 3G9CA 2DNRA 5JVGQ 3PIOQ 3P3DA 3P49B 2DHAA 2X1BA 2DNOA 3J7YU 5JVHQ 3CD6S 3ZZZA 3G4SS 1YJ9S 1VQMS 1YJWS 1WF2A 2MSSA 1UFWA 1WHYA 2AYEA 1DZ5A 2OTLS 1U1RA 2FC9A 2ZJPQ 1X0FA 4WFNQ 1N8RT 5EN1A 4F02A 3MD3A 1A9NB 2AD9A 3ZZYA 3RW7A 2LQ5A 2YTCA 3P5TL 5DDPC 2LXUA 2L41A 1ZH5A 2YH0A 2ADCA 3VF0B 5H1SV 3IWNC 1M1KT 1X5SA 2MKIA 2VOPA 3FEXB 1X4GA 1R8HA 1X4AA 4WCEQ 1UP1A 2J0SD 4CIOA 2QA4S 1OPIA 3BO3A 3EGZA 4Y00A 4PRFA 1FJ7A 2KXFA 4PKDB 2KH9A 1WEXA 5HO4A 5IQQA 5GAEU 2CQDA 5IM0A 3VAFA 2DHSA 2E5IA 3S6EA 5GMKa 4UY8T 2M52A 4Z2XA 1FJCA 2I38A 1H2UX 1M5VC 3UE2A 1NU4A 2U1AA 1U1LA 1BY9A 2KM8B 2MZQA 2DB1A 3U1MA 2CPXA 2NLWA 2EVZA 2DK2A 2JVRA 4C4WA 2D9PA 3CCVS 2MY8A 2MSTA 2X1AA 1FJEB 3RW6A 1K8AT 1DBDA 3Q2SC 1RK8A 2L08A 2VONA 2CPFA 2CQBA 3UD4P 5D78A 1FT8A 1H2TZ 2MZRA 2MKHA 2HGLA 1X4BA 1CVJA 1WI8A 1U1NA 2G4BA 1FXLA 2MJUA 4YUDA 5IM0B 2GO9A 4LMZA 5GVQA 1WEYA 2MQMA 2HYIB 3LQVA 1VQ4S 3DLLQ 1D8ZA 1Q86T 2HGNA 2XSFA 3UWTA 1SJQA 2M88A 1F9FA 2DH7A 3NS6A 3MI7X 2LECA 2PEHA 1OIAA 1AUDA 1KD1T 4QU6A 2MKJA 5GAHU 2KRBA 2KT5A 3CCES 2MPUA 2FPHX 3J7ZT 2N3OA 5BJRA 1N52B 3MUMP 4YOEA 2RUGA 1HL6A 1UAWA 3OW2R 3EX7B 2DNNA 2MJNA 2CQ1A 2DNZA 3UCUP 1A7GE 2FC8A 1OO0B 4J5OA 4OZ0A 4C7QA 5FJ4A 2LXIA 2MGZA 4TU7A 2M2BA 2UP1A 2MKKA 2DGOA 5DDRC 1X4CA 1VBZA 3DXBA 3MURP 1X5OA 2DNHA 1KC8T 1VBYA 4IUFA 2X1GA 2XB2D 2F3JA 2M8HA 2CPHA 1H6KX 2XS2A 1M90T 2V94A 1K73T 2JX2A 2KYXA 2CJKA 2MMYA 3ULHA 3S01A 2CQIA 2KHCA 3K0JA 1JMTA 2M8DB 2KVIA 4TLQA 1L3KA 2MGZB 1WTBA 1HA1A 3VAGA 2M0GB 2A3JA 2DNQA 2XNQA 4M5DB 1N54B 5DETA 1YI2S 2CPEA 4V19X 1JJ2R 4IOCQ 2K3KA 2YKAA 2DGUA 2RRAA 1QVFR 5LSOA 5DDQC 5CYJA 4RU2A 2MKSA 2OTJS 2M4MA 3CUNA 2ERRA 2CQHA 1D9AA 4WFBQ 3MUVP 2M70A 1R8PA 1WHWA 3UCGA 2MQNA 4IO9Q 2RU3A 2DNKA 4LIRA 2RQ4A 2ZJRQ 2VODA 2N3LA 1U1OA 1U6FA 1VC0A 1VQ5S 1G2EA 1YIJS 3BS9A 1YHQS 1VC5A 2MB0B 1SJ3P 1FO1A 4PR6A 1HD1A 3CCSS 2KRRA 3B4DA 2MQOA 1SJ4P 3MDFA 3CC2S 2KXNB 2DIUA 1OWXA 1HD0A 3G96A 1ZZFA 2XS5A 2SXLA 1JJHA 2MY7A 1YITS 1KQSR 3CXCR 1X4FA 2CQ4A 1WG1A 1ZZNA 1WG4A 2DISA 1X4HA 1VQ9S 2MQQA 1M5OC 3MD1A 3BO2A 1U2FA 1X4DA 4EGLA 2YWKA 3THPA 2J76E 3G71S 3IRWP 2DIVA 3LPYA 1WHXA 2D9OA 3CULA 5LXYA 2J8AA 3VAIA 1JJ4A 3S7RA 4OZ1A 3R1HA 1YTYA 3L3CA 3VAJA 3CMES 3SXLA 1YJNS 2I2YA 4LJMA 2DH9A 4F25A 3P6YC 1S72S 2CQCA 2HVZA 4P6QA 5LJ5Y 2DGXA 1WHVA 2CQ2A 2E44A 1B7FA 3NMRA 2Q79A 2DITA 2N82B 1KOHA 3NS5A 3I55S 1NJIT 5HL7Q 5DM6Q 2DO0A 3SMZA 3G6ES 2XS7A 2DH8A 2DGWA 3G8TA 2NZ4A 1S79A 3HHNB 3NNCA 2DNYA 3H2VE 3CCUS 2CPZA 1NO8A 1XN9A 2MZSA 2JVOA 3S8SA
chains in the Genus database with same CATH superfamily
4OZ5A 2NYHA 3SCIE 1SIWB 1PO6A 2HAIA 2MQLA 4ZJOA 4LFBF 3FZ2A 1WOOA 3GFZA 3MOJB 1R0BG 3M1VA 2FHJA 5KFBA 3DOLA 1FFGB 3A8JA 1FDBA 1HBOA 3U02A 2XLKA 4F4AA 1D0EA 3PW7A 2LA4A 3OPKA 4KO0A 3MM9B 2LQJA 2ZFHA 4A8QA 1UPMB 2YXLA 4M5GA 3ZC4A 3OVAA 4BWJA 1VQ8S 3KUHA 4OI4A 2KT2A 3SQOP 4DL6A 3ILOA 3EGWB 2RUSA 4E0DA 4IG0B 3N9UC 2HFZA 5KG7A 4O3OA 2BW7A 4ID5B 1IQTA 4NLSA 4LRFA 2NCKL 3I9ZA 1SJFA 4DV1F 1K0TA 2D3O1 2RKIB 4NI2B 3F44A 1GNKA 3T3FA 1KTVA 1XNRF 2EC0A 2XY7A 4KHRA 1HBMB 2HK2A 5HQLA 1JLQB 3MPVA 4OJ3A 1Q53A 2KJWA 4OX8A 3KLGA 1SJRA 1YK9A 5DQGA 3JTPA 2XO6A 1KVKA 5AXMA 3V4MA 5L1IA 2YQ1A 5JJBA 1FNXH 3TAPA 4DCOB 4OHWA 3M8ZA 1F1BB 5LT5A 5JVGQ 3UW1A 1RTJA 1QD1A 2CZVC 4JI5F 3KNGA 5HQMA 3SCKE 2ZNZA 1TL1A 1NSQA 3MD3A 2AD9A 4LFCF 2GO8A 2YWGA 4WZMA 2LXUA 1N32J 3GPAA 1T8EA 3M2VA 3H25A 1PSDA 1OPIA 2PMZD 3O6QA 1ZAVA 5GAEU 1FJCA 3MTJA 4ID8A 1XTZA 5EUHA 2OELA 4NLQA 2JVRA 4KFBB 1FJEB 4UUXA 4MKVA 4YDDB 1VDHA 2HURA 2NPFA 4ZLJA 2O67A 1WEYA 5L1KA 5EHHA 1RHMB 1XNQJ 2VG5A 5T41A 5IT4A 2D41A 1NSAA 1IQZA 3ITHB 2R2SA 1OIAA 3BSNA 1S1TB 4KGVB 4PPZA 1AUSL 3ZNUA 3C6TB 4YQWA 3GR1A 2EG2A 2NXUA 2V4JA 4L76A 2VL1A 3AAWB 5E0OA 2FVCA 3MFIA 1RACB 4CLFA 2XO7A 3I4HX 5KAKA 4QR2A 3PRBA 2M8HA 1TKTB 1SL1A 2WBMA 4KH0B 5HROA 4NWBA 1PILA 3NGRA 4QYZK 4CP5A 5HJXA 2IA6A 4Y65A 3M2RA 5HLFB 2YKAA 3MAAA 1VOMA 3N6MA 4MKBA 2OTJS 2VPYB 1Z2LA 3QSYB 4KAIA 1WHWA 3HD1A 3PXGa 2J6UA 4K4WA 1TVRA 3K5OA 3JYTB 2IRUA 4KGZB 4NMXA 2OPQB 2R7VA 2VODA 1JLEA 3D0IE 2HIQA 4ZHRB 1VC5A 3BGLA 4C11B 3KHGA 2EFQA 3C2PA 2HZAA 4X4SA 3POTA 3G96A 2XS5A 2XYGB 1C0UB 2BANB 1WKJA 1ACMB 4CLKA 3PY8A 5E2QA 3GV5B 3OT9A 4XPCA 4OI2A 3DRPA 2J76E 2ZBRA 3M8QA 5KFPA 3D6MB 3LAKA 5J1EA 3CMES 4FBTA 2AZ3A 3NL0A 4DV3J 3UO0A 1NDLA 3C16B 3CGIA 4JI0J 1RHQB 1DQAA 1S6PB 4B02A 3VV2B 3UR3C 4QIGA 3HHNB 2K06A 3W60A 1VHFA 2MHEA 3GWCA 3LW5C 5K5MA 4HYKA 1CPZA 4GC6A 4FVCA 4PYDA 1YWXA 4N8OA 1AT1B 4ILRA 4LBIA 2DR8A 1VQSA 3QGGA 2DHXA 2P8IA 3LOUA 4HACB 2AF6A 4Q5VA 2MKYA 1TFWA 3VAHA 2J7KA 3HXMA 2ASJA 3J81U 4FPIA 3LO3A 4KGKA 4CNYA 1O8BA 3BBCA 1OY8A 3Q8QB 2PE8A 3AJ1A 4J9VA 1FKAF 1DURA 2MYFA 3CC4S 2V6AA 1DRZA 5A8WA 3GYGA 5D77A 1R43A 4W4MA 3RBDA 1KS2A 3CDBA 1FRHA 1N5TA 5AXNA 5C2CA 1H73A 1NB2A 2VQEF 2BQUA 2N4DA 2CA9A 2HFNA 2FHMA 3KLFA 1NKCA 3BH7B 2FVQA 2RS2A 3GYNA 3PYEA 3H5SA 3OXGA 1SBRA 4JV1A 2I9SA 3QATA 1VBKA 2L9DA 2DGTA 3SSQA 2H4YB 2RNEA 3AHPA 2BYCA 3E2EA 3QAUA 1WEZA 1PGZA 3HZGA 3M6WA 1RT2A 1S1UB 3EJMA 1QAIA 3M8SA 4FYWB 4WF9Q 2XMJA 3QIDA 4K0KF 1N6QB 4ZPDA 3FKBA 2KN4A 2XMUA 7AT1B 3H59A 4PYAA 4DXLA 3CF5Q 2F40A 5HVGA 2W9CA 2ZM6F 4RW9A 4YMEA 4K4TA 1JLAA 2G2YA 2GC8A 4UQTA 1QTMA 2FDNA 2ATLA 3CD6S 1RAHB 2QO3A 1WHYA 1FDAA 4TKTA 1CJUA 2V0NA 1XMQJ 2CG4A 2R8HA 4YY3J 3OTOF 3T9NA 4Y2IA 2IC3B 2Z57B 4QOTA 2UVWA 3BO3A 1HYSA 3T5JA 1FJ7A 2HS3A 4LVNP 4PKDB 3VAFA 4IH5A 2BR0A 3MFHA 4UY8T 2W4CA 4Z2XA 2J7WA 2RF2A 1EX8A 4HT7A 1PC4A 4F4WA 3R2CJ 1NU4A 2U1AA 2XWXA 1GFWB 4X4RA 4NCBA 3B8HA 3HFZB 3HSZA 2W9AA 3DLEA 5D78A 3DLHA 1U1NA 2PC6A 2DR6A 3PW5A 1RA7A 3I5AA 4JV2A 1F6TA 3Q0AA 4OL8A 2UVUA 2QYGA 2R7WA 3R7NB 2AQ4A 4Z7YA 4ECWA 5GAHU 1AB8A 1VK8A 3MHYA 3R7BB 2KT5A 5BJRA 5K8OA 3UCUP 4F4XA 1IBKF 2ASDA 2GMLA 3KK1A 4TU7A 2UP1A 4LF6F 2ZHBA 1CULB 3UN5A 1PBUA 2CYYA 5KFGA 1X5OA 5KFMA 3T19A 1RTHA 1RT7A 3T1YJ 4NXNF 3GG1A 4KH1B 4NLXA 1C1CA 1FWLA 2YNHA 2V34A 3MPDA 1AZSB 3BQ1A 2DNQA 3DLGA 4AXIA 1DTQB 3VQTA 2VZ9A 3O3LA 3MM6B 3FFIA 4NRUA 2CZ9A 3EE3A 3CUNA 2OD6A 2R7TA 1SL2A 3SSRA 4LR8A 4XPEA 4TLRA 1OQ3A 4ILLA 4KIAA 3FBFA 2G0JA 2RE1A 3MDFA 3CC2S 1I94J 5SZTA 3T1HJ 4KR0B 3GSDA 5IZHA 1DQ9A 2FZKB 4I4BA 5L9XA 1T3NA 1D9FA 3HVTB 2C2NA 2HVHA 2CVEA 4Q7AA 1M1GA 2EG1A 1UJ5A 3JTOA 2Y8YA 5A8WB 1UFKA 2CQ2A 1BQNA 5ETTA 1V6HA 5B0AA 3AA8A 3E01B 4KGMA 3KLVA 1ZAWA 4HDHA 4BLGA 2GZOA 5SUHA 4Q2MA 3HULA 1X9WA 1LWEA 3CJ2A 5T7LB 4MYTA 1JIHA 1F60B 2MHNA 2AT1B 2NSBA 2HQFA 5B0CA 1U09A 1VK3A 4K7QA 4EFAC 4DSFA 2GMJA 1SPBP 3GSIA 3OJSA 5G4DA 2GAHC 2V67A 2JLGA 5HJYA 3W5XA 3KLIA 3MWBA 3HJVA 2VICA 2BKNA 4HI2A 3GFHA 1NH8A 5A8KA 3GJQB 1DHMA 5KFXA 3ZXWA 3PRDA 5HAOA 4F3QA 1KBRA 2LU1A 3AXKA 5K8MA 1TUGB 2ILYA 2BE2A 2B5JA 2AYMA 2OSQA 1IKYA 4NA1A 1HR0F 1IJFB 1X31C 1NK5A 4Y2MA 5LJ3Y 2VFTA 3N6LA 1W7WA 5ETMA 3NBPB 2VFVA 3LUYA 3BEGB 4QWAA 3KWMA 2J0WA 4FF4A 4RW4B 5KFVA 3QO9A 1X5PA 4PXDA 2DGVA 2QL9B 1WKKA 2FIUA 1RU1A 4WWSA 4JI2F 4ZKAA 2KO1A 1JLGB 1QSLA 2YNFA 2RRBA 4LFAJ 3OL7A 2GVZA 3M9OB 5CHCB 4OI0A 2MZTA 5A76A 1YRXA 3VGSA 5HP1B 4Y3CA 3UD5A 2DNRA 2ZC3A 1WF2A 2DY1A 3OHBA 2N7YA 1N8RT 1GEHA 4JI4J 3IXQA 5DDPC 2ADCA 2OPPA 3VF0B 2V68A 1X5SA 3SI8A 1X4AA 4MIBA 2BMBA 4MIWA 1K47A 6AT1B 5GMKa 1HHQA 1N5YB 6FD1A 1U1LA 4J9OA 4FF3A 4IFVB 2CPXA 3GFYA 2DK2A 1WC3A 2D9PA 2MY8A 1LOUA 2ROPA 4A47A 3Q2SC 4I6AA 2VONA 2CQBA 1WD6A 2YPZA 3Q22A 3RTVA 1RU2A 3MM5B 1HPZB 2V2KA 3CDAA 2H5EA 4DL0C 1LFWA 3SFUA 3EWGA 3HHLB 2JHEA 3MEDB 4ZN1A 1SJQA 1EQ0A 4XDCA 4RR5A 3NGSA 1NK6A 3ICLA 1AW0A 4LRCA 1YJTA 2FPHX 4DSIA 3MUMP 3CD5A 1LXJA 1X8DA 1YLXA 2WK4A 4KTQA 4C7QA 4RNNA 4Q8FA 2XZTB 4L73A 1YBTA 4P2XA 1T9VA 3LALA 2IDLA 3CDEA 2F3JA 1BQNB 3IA0A 3Q23A 5L1JA 2YBVA 4ZP8A 2JX2A 2KHCA 3NP5A 3L95X 1JLCA 3TOQA 1YG0A 2UZAA 1HA1A 1TMJA 2DCUB 3W2VA 4J9UE 4R0JA 2AMCB 2UVRA 1OY9A 1HNWJ 1UVJA 4NLVA 4LSNB 3MPUB 1KLNA 4I1TA 1H7WA 1XMBA 2KKHA 3B78A 2RQ4A 3PKYA 4PG7A 3W9JA 1LW0A 4OYAA 4NMLA 4PUOA 2ALYB 1D09B 1SJ3P 1BE4A 4XO0A 2HMIA 1SJ4P 2B4PA 1YX2A 1Y4ZB 2KXNB 4B08A 4EI2A 4K8RA 1ZZFA 3W63A 3KLIB 2DISA 4ELUA 1S5ZA 4JI1F 3JSMB 4CNZA 5DRKA 5G0RA 3UQSA 3SQGB 5LXYA 1TQLA 1SVDA 5DG9A 1TKZA 5ETPA 3H5XA 1F5AA 3L7PA 3HJFA 1RT6A 1N32F 3PHEA 3GQCA 5CABA 1IKYB 4ES2A 2POKA 3QT8A 1C1BA 1Y00A 2CDQA 5F8JA 3M4XA 2Z2LA 3RG6A 1S1VB 3SV3A 1OQ6A 3TUZC 4URQU 3A3NB 2CPZA 5KT2A 2WSEC 2M9KA 1X7VA 4WBFA 3DLKA 3AOAA 3TO8A 1S48A 4I6WA 3DM2A 3TJ9A 4LT6A 4ELTA 4NZ0A 3UN2A 4RKUC 3QAEA 1XNQF 4QYZJ 4K4VA 1KOOA 3D5MA 2RHSB 1GTHA 4O3RA 4PCQA 3DOMA 2C3YA 4QIWD 1URNA 3BKFA 3EVMA 1LNQA 1WELA 2HVIA 4HTJA 2CQGA 3I0SB 1HNIA 2CPYA 3PDNA 1N5SA 4NASA 2MZ1A 3SDEA 3QMQA 1FA0A 4PXBA 2AWZA 2FJEB 4LUBA 1TKXA 3D54A 4F8RA 3ISZA 4DL2A 1X4EA 2QMXA 3H2UB 4FDFA 3GIMA 4PXCA 2WSFC 4DR5J 4DJBA 3TYTA 4PABA 3BN4A 3CEDA 3VGUA 3CJQA 3JAMY 3RGIA 4ZP7A 4N41A 7FD1A 1QVGR 3KLHA 1IKVB 4DZ6A 3G87A 8AT1B 4X66J 2OUGA 4A48A 3PJWA 1HQEA 4FYDA 5MLCV 3QZ7A 3M6XA 4LRDA 1VQYA 4DV5J 3PYFA 1G1XA 2YNIB 4ZCIA 1N88A 1SH3A 3AODA 3MM7A 4MK8A 2FLPA 1K1SA 3IM9A 4EU0A 4ED7A 1NH7A 3GILA 3C8YA 1IR0A 2CQ3A 2CJBA 2E5JA 2RRNA 3AT1B 5B08A 3OLBA 1GX6A 4DV3F 2VF3A 1X0FA 4WFNQ 4BHQA 4LF2A 4J90A 3P5TL 1U48A 2E29A 3MCOA 1N4LA 3PJ9A 3IWNC 2LU2A 4WCEQ 4A4JA 4YP3A 3THVA 3BBBA 3RAMA 5CD4H 4DZDA 3M8PA 3LGHA 4QWBA 1SH0A 3I6PA 1E6YA 4LF4J 1P9QC 3PYDA 1WJ9A 2GHWA 2NREA 4KRWA 4C8LA 4DEZA 3W7BA 1RK8A 4OYXA 4ZCKA 2CIMA 4WTYA 4PUOB 3T41A 3LQVA 3M30B 1D8ZA 4O0NA 4B3TJ 3NAIA 3OR2B 4IFYA 5CYQB 4WJBA 1RTZA 4EMDA 3KDNA 1AUDA 3FBCA 2XSJA 4IKAA 1N34J 2W4PA 4K5RA 4PWUA 2DNNA 3IGNA 1UZHA 3OXLA 3V4IB 1OO0B 2VBYA 2EW9A 2MDAA 5BYRA 4M5DA 2NQPA 4Q0BB 1E6VB 3RB3A 5A8RB 2ZH2A 4I56A 4LREA 1ZETA 1HBUA 3LA0A 2Z30B 4WU2A 1FKPA 3IP0A 2KVIA 4ZCMA 4X4OA 3ZTRA 3MR6A 2XLIA 3DRSB 1XK8A 3LP2B 3HX9A 1N54B 1S57A 4C8MA 2HFVA 1HQUB 2LDIA 4DX8H 5CYJA 4ZVGA 1ZM2A 3BDPA 4DF8A 3PO4A 3W1YC 3Q89A 2UV8G 2BABA 3DGPA 3FMWA 1UEKA 1A0OB 5K8NA 4QYRA 4HL9A 4FVMA 4PR6A 1Q4RA 4DCJB 4CLLA 5DO2A 2XTJP 1LW2A 4XDDA 5KFHA 3NOCA 1JJHA 4B3OB 4JP8A 1XMOJ 4OI1A 2CQ4A 2HHUA 5L39A 1MWZA 1VCTA 2DEIA 3TZWA 1R89A 3P5BP 4EGLA 1N56A 1S9EB 1DQ8A 3CULA 4UY85 2ZWOA 3IS9B 2H65B 2DRAA 3GCXP 4P74A 5F41A 2ZOMA 2EC2A 1XMQF 2B3TB 3EZ5A 1NEEA 1WC1A 2E44A 2ZITA 2V50A 4ED1A 4YY3F 4DFKA 2DGWA 4B9NA 1WOSA 1UPPA 4L74A 1FRIA 1LEOA 1OS5A 2UXCJ 2Q1LA 4KC5A 4CO0A 1MW7A 3NNCA 1KWMA 3L4BC 3FVYA 4MFBA 4O44B 1U45A 7FDRA 1VRTB 3QJJA 5HBMB 4NE9C 1O0PA 1G4CA 2WZ1A 4TN2A 3K58A 3ISND 2W2QP 5KT4A 1KVIA 2FLOA 2NUUG 1FK9A 1HHSA 2KFNA 2LP4A 5KG5A 1KSPA 1UMJA 1DTTA 5H9EK 1JLBA 2EBEA 1VQLS 5J2PA 1XC9A 3TWZA 4A8OA 3OL9A 3GR0A 4M5NA 1NMEB 3L7UA 2WB1D 1TKDA 1FDDA 3G6XA 3AB4B 3MM8A 1RWWB 4X4UA 1HMVB 1S6UA 1ZM3A 3RUBL 5DDOC 2G2ZA 2LEBA 2Z4PA 4DPOA 1FFWB 2XC9A 1NK9A 3A12A 1HW8A 3N0VA 2LKZA 1MG7A 3T1YF 4F50A 4KGXB 4DUTA 4ECUA 3MMBB 3OUYA 1JWWA 1DAXA 3TZYA 4WYWA 1UJ4A 5IQ6A 1M5KC 5KG4A 4DV4F 2B0GA 2L9NA 3FDSA 4LF7F 5KFCA 2X1FA 1U49A 2KG0A 4B9LA 1TL7B 4WZQA 2CAJA 4I2PA 5J2MB 1TL3B 2ZD1B 2Y9HA 4K4YA 3BB5A 1Y5LB 3GCWP 5D0RA 2F8EX 3O8WA 1HARA 5C42B 3VAKA 5GAGI 1VRUA 4EYHB 1F0XA 1HW9A 1VQ7S 3T1HF 4YB1P 2OEMA 3N6NA 1MWYA 4TY9A 5KFFA 4IFYB 1VBXA 2CQPA 3KG4A 3A8IA 3HHDA 2KDOA 3I31A 2K3IA 5F9LA 3LH2S 3R3TA 1KQKA 2GHPA 1NPPA 5J1NA 4ZA1A 1R31A 2AYEA 3DMJA 2H9ZA 2IFXA 3V6DA 3SEOA 4EZ6A 2AGQA 3ZZYA 2LQ5A 3OQ2A 2XY5A 4HR2A 2VOPA 1HWLA 2NS1B 1EQMA 2HHHJ 3PX4A 4G65A 2KXFA 5GMEA 1WEXA 2CQDA 1LWFA 4CM0A 4DSJA 2I38A 1W26A 1X0PA 2WVEA 3EMTA 4O4GA 5HMYA 3C15A 4EWTA 2MSTA 4WFYA 1C0TA 4C2MA 1YBAA 1P6TA 3HF5A 2R7UA 2HGLA 3E51A 5IM0B 3KK3A 5GVQA 2HYIB 4KV8A 2J9DE 1S7IA 3H7HB 2VU5A 2YNGA 4NZ6A 3I87A 1XR6A 1RTIA 4ZVFA 3TVZA 1UZDA 1SB6A 1IUJA 2N3OA 3K8VA 1GT8A 3H40A 3BR8A 2ZEJA 3QT6A 1A7GE 4QR1A 4I7FB 3J7YI 5FDLB 3X3UA 2L48A 4LF9J 2FGCA 3MURP 3M32A 5B7WA 4WFZA 4RUHA 4Y2KA 5IWAJ 3MAQA 1EJ7L 1T3OA 2O66A 2VPXB 1K73T 2IYGA 3S01A 3K0JA 5ETRA 3Q8YA 5D6GA 1SUQB 1SKRA 2MGZB 3M6UA 1RT4A 2AEMA 4U6PA 4EYIB 4DPYA 1JJ2R 4IOCQ 3HMJG 4C8ZA 4K2JA 4RU2A 1XQIA 5DQIA 2JH3A 4WXOA 4NRTA 1R8PA 1N5QA 3UCGA 5T14A 4IO9Q 4B9UA 2JEJA 3NRBA 3PJXA 4F67A 1CLFA 2QZ8A 2VKZG 2DPJA 4OHYA 1JLBB 4LFAF 1ZTWA 4RWWA 2MY7A 2CXEA 3B82A 1NHKL 1X4HA 2BX6A 2R4FA 3TAMA 2MQQA 1PJ7A 3D67A 3W2WA 3CNQP 2VJVA 3TNVA 1T11A 3SXLA 3H8YA 1ZBTA 3P6YC 4JI4F 2DR9A 5JXSA 3CJ3A 3K5MA 2QSFA 4ZPCA 1YJUA 3VGTA 4EEYA 2DNYA 1F2GA 1NO8A 3DHWC 3C3LA 5D3GA 1B0PA 2IVFB 3K59A 2B51A 3S8SA 3HVRA 1S1XA 1NLKL 3Q8RB 2CWXA 5C25B 4K4UA 3BO4A 4WKRA 2W25A 1OJ4A 3DU6A 4NEYA 3OTDA 4Q8EA 2XQCA 4KSEB 3K5NA 2G9OA 4WP3A 1HNVB 2CWKA 4Y28C 4DR3J 1SIZA 1L3SA 3C6UB 4N77A 4FYYB 2GMHA 3VALA 1UL3A 2FTRA 3PIPQ 1NPKA 3LTOA 2KFYA 1XWLA 2QEXS 2CQ0A 2JFDA 2Z8QA 3UDCA 5EX3A 4FXVA 2GIRA 2RS8A 2Q6BA 4CLWA 4JI7J 4DQSA 2KTQA 4F26A 1TAUA 2CJQA 1UVIA 5AJ3J 4R5PA 3TP2A 3SCJE 2JWNA 3NLCA 3QNWB 2JSXA 1PBAA 4K4SA 3OFHA 4C9DA 2VIHA 1P8GA 2HS4A 4TY8A 4H4KC 1TV6B 1VQ6S 1J27A 3CWJA 4USTA 3IR6B 3B4MA 4YHHJ 1EHWA 1BGXT 3RRKA 4CI0B 4M5LA 3KG0A 1NPRA 1RWXB 2NXEA 1T05B 4JUZA 4HH1A 4C3LA 2RILA 1X5TA 1MSWD 2B43A 4Q43A 1BHNA 3MTKA 5DZ7A 3H2LA 2YWEA 3A3PB 4DR7F 4DR4J 1KLMB 3I4PA 4K4XA 2XGQA 2OKQA 3C14B 3CW2C 3RB4A 1CBKA 2CJYB 3T6BA 4CYUA 4CLYA 4O3PA 3ENWA 2FQQB 4WPAA 2KYZA 2IBKA 4DPTA 2AEJA 3CMQA 3BYPA 4MAKA 5LL6d 2E1AA 2F5GA 3PIOQ 2W2MP 2DHAA 4O3QA 5L1LA 1YJ9S 2PDAA 4UT4A 1VQMS 3CT9A 3L09A 4TQRA 5EN1A 4F02A 4M5JA 3ELHA 4IDKB 2ZWPA 2YH0A 4TYAA 4X65F 1TU0B 4JYAJ 4DR1J 2C3UA 2GJIA 1U26A 3FEXB 1RT4B 2VFSA 3M8WA 1GK8A 2QLWA 4PG6A 5KG3A 3CCVS 2V9WA 4NCGA 3L7OA 2YKMB 5E7OB 5BYQA 3QSIA 2V9KA 2NXJA 3ZO7A 2MKHA 5J2QB 1CVJA 2GA7A 1DLOB 1WDTA 5ETKA 2CRLA 3F56A 3BREA 2NPIA 3SIPB 3IO1A 2DH7A 4R25A 1KD1T 2A1BA 3JAMU 2I8EA 4QW8A 3F0NA 3J80Y 2P6SA 4RW8A 1OMSA 2NXNA 3NGUA 1N33J 5C24A 2FGOA 1XBWA 4NL5A 4TXSA 2UUAJ 2G1HA 4J5OA 2C2OB 1RT5A 4AL5A 9ATCB 2QSWA 5CZVA 3HD2A 2R2RA 3OV7A 3DOKB 3E3XA 1C4CA 1PG5B 3IG1B 2BKPA 2OD4A 2UV8A 3NXZA 4KPCA 5M2RA 3OR1B 3FSIA 3Q8VA 2ZZMA 4LIWA 4G1QA 4HLBA 3QRRA 2V4RA 3WDOA 1ZM4A 4GKJJ 1CJKA 4RBTA 1YI2S 3IRXA 2YPYA 3MMAA 4X66F 2HNDA 1S76D 3TR5A 4YB6A 5MAOA 1FXRA 1S6QB 1WSVA 2K2PA 1WC5A 4FPRA 4WP8A 2HG4A 1RKIA 4DFPA 4FYXB 1AA1B 1NDPA 2DNKA 1S9FA 2VPZB 1O6XA 4V1Ak 2QLBB 1MLAA 3MECA 3B4DA 2ZH8A 1R0AA 3M2UB 4R0EA 1X4FA 4ATNA 2IMOA 3MD1A 5HQ8A 1X4DA 4OX6A 3N4WA 1IKXA 3W66A 4DUYJ 1JJ4A 3R1HA 1YTYA 3H4DA 3DN9A 4N56A 1YDLA 2CJ9A 5DG8A 3QIPB 1N5VA 3I0RA 2CQCA 3G82B 4QR0A 1KDNA 5I3PA 4HKQA 3P8BB 3FSXA 2JC1A 3R5AA 2NZ4A 5ETOA 4CTAB 4KKOA 4UZBA 3C46A 4ED6A 1XN9A 5D15A 2R7SA 2UUBJ 1U1PA 2YQ0A 4B9MA 1YJRA 2V5HG 3CSKA 1RYRA 3MM9A 2AYGA 1MWQA 4DQPA 1YRUA 2DO4A 3QLHB 4ZK7M 3UDLA 2WONB 2ZVIA 4BS2A 4B3TF 2GCFA 1QE1B 2HQ3A 3QZ8A 3A1YG 2HBYB 3NNAA 5RUBA 4J9KA 1J5EJ 3FBBA 2W2PP 4U67Q 1N34F 4NXMF 2HQIA 2VC1A 2I5JB 4ID5A 1LFPA 3BPSP 3MZIA 3EDRB 2EK6A 1WC0A 3BSOA 4X4QA 5K14B 2RKIA 1RAFB 2OIHA 4JOUA 1BUXA 2GGPB 4NI2A 4RUAA 1RSCA 4OJ1A 3LAMA 2L3MA 3TX8A 3TI0A 1HHTP 4ED8A 4HHJA 2DVIA 1NJWA 2WCXA 4QU7A 1JLQA 3BPDA 1LK5A 2I0XA 2HFUA 3CIZA 2BZ2A 1LWCB 3KK2B 1S9GB 4QJVA 3HHLC 4NCGB 3KDOA 1BWVA 1RTDA 3IMQJ 3ZZ0A 4WIIA 4CLZA 5IS2A 2E7WA 1JXEA 1VISA 1SC4B 2EFPA 2HGMA 3CPWR 4OHZA 5D4OA 1XMOF 4F4YA 3H98A 1F9EB 3FGVA 2V8GA 2AW0A 1Q95G 3CJ8A 3AJDA 2YH1A 3IGVA 2O5DA 5FLXY 2Y1LB 5L38A 2X1BA 4EBEA 5E3QA 2QE5A 1YJWS 4ECYA 3FQKA 2OTLS 3AQOA 2ZJPQ 1Z2ZA 3FCWA 2Y1IA 1NCLA 2LVWA 4KFBA 1O51A 2UXCF 2QG9B 3N01A 2UUWA 4U95A 2E1PA 3AQPA 5HATA 2M52A 4RUCA 4RNFA 1RWVB 4HI1A 2C3MA 4AQYJ 2GFFA 3UE2A 1VHIA 4FXDA 4ZMMA 2EKYA 1MMNA 2PMHA 3ITHA 4RNOA 1FWKA 1CS4B 2QLXA 1S1TA 1S97A 3EM1A 2ACMA 2XMWA 3C6TA 5B0EA 1ZM9A 4ZVEA 4CWBA 4LMZA 2XMMA 3W61A 4JB8B 3IFEA 2VG6B 4CO2A 1JXLA 3UWTA 3CJKB 2BRLA 3NCRA 1R0AB 1T9XA 1KFSA 4QU6A 5K20B 2B8QA 4MK9A 1LXNA 3KHLA 3P96A 2ZBCA 3J7ZT 1EB0A 1TKTA 2ZC4A 4IRCA 3M7VA 5I3UB 4W98A 4XIUA 2FC8A 4M5HA 4U7CA 3Q24A 1V5IB 2MLXA 2MKKA 3T5LA 2R7QA 2H4WB 1AROP 3G8QA 3TAQA 3SFGA 2J0XA 4J9SA 4CCHA 5HLFA 2QMWA 2B9YA 5C7PA 2XB2D 3TUJC 3JQJA 4ELVA 4OZNA 4P9SA 2K7JA 3JYTA 3JSRA 4KKOB 5HMZA 1L3UA 2OPQA 3P45B 4ZHRA 2CPEA 2K3KA 2RMLA 2DGUA 4DUZJ 4C11A 5DDQC 2C2EA 2LQ8A 5F3TA 1C0UA 5KFYA 2BANA 2KB2A 4USJC 1B0TA 3BZQA 3UNYA 1QDUB 3BBFA 1RAOA 2FVSA 2IYIA 4ZVSB 1HD1A 2KVQE 3W8GA 2PIIA 3QGHA 3NY0A 2QTWA 3PVXA 3PM9A 4OYIA 3C16A 1MU2B 1S6PA 1D9DA 2WVBA 1M5OC 1JLFB 4ZLLA 1UVKA 1BLUA 1YRTA 1CJVB 1K1QA 1UW9A 1IBCB 1WHXA 2IAJB 3R7SB 3ZTSA 4R8UB 2HVZA 3LGNA 2R3VA 3DI6B 2HHSA 2Q79A 2N82B 1D3WA 1MROB 1P1LA 3CD0A 5DM6Q 2HHWA 2DH8A 2HHHF 4P73A 4S0MA 3UNGC 2OFGX 4P2SA 3MR5A 2VV5A 1VS3A 2R42A 1F9HA 1NSKL 4ECQA 3GMGA 4HACA 2QA4G 2DHHA 1RTDB 5E3RA 3AD7C 3R27A 1B99A 2CPJA 3OL8A 1NUEA 2OAUA 2I6WA 3QGPA 3T5KA 2HQGA 1RQ0A 1UEUA 1F3VA 4DSEA 3CCRS 5CAAA 2JEIA 1HI8A 1SXLA 2OPRB 2D74B 1NKEA 3PCOB 2E66A 4LF9F 2KZZA 2DGSA 1VQOS 5IWAF 1RWMB 4FZVA 3QRQA 2LQ9A 2FY1A 1WUUA 4ZP9A 1V3SA 4DX7A 2DD8S 3R1LA 2FB0A 1RA6A 4GVBA 2VBZA 5KG6A 1YJVA 4CH0S 1HI1A 1KTQA 2L9WA 3KHRA 1NK7A 1S1UA 5F3ZA 1RP5A 3EGNA 4Q2LA 3TANA 1N6QA 3UD3P 4WFXA 2GJ2A 4U7UK 4QPTA 1QY7A 5DM7Q 3EVOA 2FLLA 4P2MA 3BGRB 2HNYB 3TA2A 1U25A 4PQUB 1BQMB 3D6HB 3MEEB 4W90B 1J5OB 4FXWA 1I3OB 3L9ZA 2Q43A 3ZZPA 2F9JA 1FDNA 3OD2A 4U8YA 3FRZA 3R5JB 2BVZA 3HKZD 5I3QA 1VQNS 1VIOA 5HANA 5IFMA 1AXQA 3S1TA 3WIVA 1IVZA 1CC7A 2IC3A 1QSSA 2LXFA 3LANA 1GAOA 4K2XA 2AJ2A 3ZZZA 4X62J 4H4KA 2BBEA 1RZMA 1U1RA 2AJ4A 5J1PA 2R8IA 4I2QB 4YDXA 2YTCA 4OYBA 4X4VA 1NB7A 2GQ2A 3UVJB 3OJUA 3PNIA 2MKIA 4CIOA 2AKWB 3EZOA 2N4CA 3CCTA 1AYEA 2OPSB 3NGDA 1U0HB 1U2RA 4AYBD 4IG3B 3DDNA 4AUKA 2KM8B 3KTQA 4RZRA 2V2VA 2EVZA 3RW6A 4J9MA 2L08A 3ZFVA 3D0GE 4DR3F 1SL0A 2QLJB 2P9CA 2YKNB 3CJ5A 3MOZA 5DS7A 4M94A 1CULA 3W5YA 2UXDF 4CDIA 2QIFA 2PEHA 4JI7F 5KT5A 2KRBA 5F8HA 4PPDA 3IM8A 5GADI 3HCXA 3EX7B 5KG1A 2PA3A 2LQBA 3CJ4A 1TR0A 5FJ4A 1FVSA 1AZSA 1CQMA 2HQCA 1VBZA 4CZCA 3DXBA 4Y2CA 1QAJA 3W5ZA 2GVDB 4DHVA 1DTQA 3PHTA 2DNHA 2ZH3A 2ZBQA 3MM6A 1TK5A 5BYSA 1R0CB 3OXFA 4IRKA 1I51B 2KYXA 3QQCD 4YHHF 4C3MA 3D1HA 3FCHA 4J37A 4I67A 4O3NA 4OV1A 3H5YA 3CJRA 3BN7A 3ET6B 1APSA 2DR5A 4V19X 5KT6A 1Q1KA 2C28A 3GU0A 4ED0A 3Q86A 4WIQA 3UN3A 2D69A 1U0SA 2Y0SD 2ROGA 1EETB 1B7YB 2BJ1A 4F36A 3DRRB 4DR4F 2N3LA 2F4VJ 2XM3A 2BXJA 3HVTA 2P6TA 4M5MA 2IJNA 5CH7B 2HIYA 4DR6F 2XMKA 2SXLA 2ALZA 1WG4A 2DY9A 1TUVA 3E01A 3KJVB 2XULA 3IRWP 3RYLA 2D9OA 1RT1B 2J8AA 4I64A 2OH2A 1GXTA 1UVNA 2V4QA 3VAJA 1RYSA 2R7XA 1YJNS 1G3OA 3RR7A 3HLUA 5LJ5Y 1S10A 1NDKA 2O01C 1JB0C 4DR2J 2XCAA 3EYZA 4GKKJ 3BF4A 5T7LA 5B0DA 4JYAF 2ZKTA 4DR1F 2DO0A 1RADB 3C66A 4GVBB 3ETOA 4OZ3A 5CCLA 2K7KA 3CE8A 5EGYA 4NPOA 3Q8PB 2ZE2B 2H51B 3J81j 3KUGA 2JVOA 3D6TB 5KFEA 1NRKA 2HVEA 4ETZA 3DHXA 4F0MA 2W8LA 4BCAA 3ENAA 1RWNB 2VQEJ 1ICEB 5B09A 4YFUA 3JTNA 4LQ9A 4DS4A 2GX8A 4EZ9A 2GAGC 1FEEA 2ZH7A 5KFJA 1TK8A 1YVFA 3FEZA 4DG1B 4NLTA 2PMWA 3O5TB 1ZYQA 2CDRB 2IRYA 1FEHA 2GQCA 3NWRA 4DPUA 1K9MT 1N33F 4EBCA 2LYVA 4B17A 2UUAF 1H7XA 4DLGA 3AXMA 5KFLA 2EXUA 1UWBB 3R6LB 3VGVA 3KLEB 2FJAB 5EX0A 2DJWA 3UDEA 3NBPA 4CLTA 2HKEA 3CCMS 4FNHA 1Q16B 3HZEA 4Q45A 3HI9A 3CCQS 4RW4A 1YZ7A 4F2RA 2ZM6J 4F2SA 2FHKA 5AXKA 2RVJA 4ECXA 1XEZA 4F0HA 4GKJF 3M9MB 1CG2A 5F8LA 4LQ3A 4DN0A 4OJGA 4K4ZA 3D66A 2XBPA 4OYPA 1JLGA 2HBRB 3TQ1A 4ZVPB 2C2RA 2C3PA 3JSYA 1WF1A 2X3GA 2HPUA 2WOMB 2LEAA 1YZ6A 1ZTTA 2QX0A 2ZOFA 2Y1RI 1PJ6A 1SQEA 2VG7B 3DRXA 4IQMA 4B3RJ 2MQ8A 5HP1A 1GQEA 2R7OA 1GTEA 2F9DA 2N7CA 5KT7A 2U2FA 2E5HA 1NDCA 1R7IA 4ES3A 4ECSA 1NAQA 1VGYA 2BDPA 1YSJA 2BKOA 4DUYF 3UDVA 1RGVA 3CCWA 5EWFA 4ZLNA 3AFGA 2UU9J 2LDYA 3KFWX 1N5YA 1DY3A 3IBWA 1RXOB 4IFVA 3OTEA 1TK0A 4LF8F 2XMTA 1LWXA 2CZ4A 2ZKUA 5I42B 1OPZA 3EGZA 1QSYA 4MTPA 4FS2A 4LF6J 3MM5A 1HPZA 2DHSA 1XJWB 4DX6A 2W7PA 3HHLA 1BD6A 3MEDA 1WOPA 4CH7A 4KB7A 2XWYA 3PRVA 5DQHA 1RAJA 2IVMA 4ANCA 3G6VA 4JI6F 1KQGB 3BV8A 4OQJA 1J5EF 1Q78A 4LSLB 3C19A 2EWHA 4IH6A 3QBCA 4IRDA 5KFAA 2ZVSA 1GXLA 2DRDA 4YEAA 2JL9A 2IM3A 3M8YA 1X4CA 1HIYA 3FJ2A 2QFIA 5F8MA 4LSNA 5F0WA 2JEGA 4ZIWA 2ACYA 1H6KX 5EDWA 2HHTA 2AIRB 1GX5A 4TLQA 1L3KA 2HNZA 5IC6B 4OX7A 2ASYA 3V81B 1PJ5A 3CJTA 5IT0A 2MKSA 1R8CA 4NLDA 2XI2A 4RW7B 3MUVP 2VC0A 5FLXU 2RU3A 2ZJRQ 4X64F 3JSMA 3CDUA 1G2EA 1YHQS 1R8BA 3SQGA 5IV3A 3FC9A 4ICLB 1Q5VA 5L8RC 2F7VA 4GVLA 4E2FB 3D68A 1OWXA 3DDIA 1VQ9S 4V19J 2C22A 2CADA 1S1WB 1CJTB 2NXCA 1ZPWX 3VAIA 1H3DA 4NCAA 2CFXA 4ZP6A 5ETQA 1S1VA 4L3NA 4RNMA 3TUIC 4ZLPA 2DH9A 4LSZB 1B7FA 4MK7A 2QT7A 2QA2A 5HL7Q 2XI3A 4LF1A 2OO4A 1LKZA 2Q3PA 1KEKA 1Q7LB 5E33A 3H2VE 4KPYA 5FIIA 1M5SA 1XR7A 3D3CJ 4IO1A 4DL4A 2PI5A 3J7Z5 9RUBA 1HR0J 1IBLJ 3M8RA 4LRBA 5ETNA 2F4FA 3WC2A 2UXBF 2RT3A 1U1KA 3I0SA 4A8XA 3QJPA 3GJSB 4K50A 4X2BA 1U47A 4WE1A 3W64A 3LGMA 4QW9A 4W92B 4F7VA 2JRSA 3WX4A 4NEZA 4H4OB 3VHQA 4EUVA 2LCWA 2D3UA 4N47A 2A2CA 3PR4A 4FP9A 1WORA 4CH1A 2VDIA 3H5UA 1IKVA 3UPFA 3DLBA 4B9TA 4Z7CA 1TFYA 3G8SA 4C8NA 3ZZTA 4FF2A 3HT0A 3FCVA 5HMWA 3MEGB 4F3OA 2YNIA 5IXUA 1JNRB 1T03B 1FXDA 1UW4A 3VVUA 3A8KA 1I5OB 3GP9A 4OHXA 5ADZA 4Y0FA 2CPDA 1Y3JA 4TNOA 4WK3A 5J2NB 5C5JA 2AHOB 2MQPA 2MXYA 2BOAA 1NM2A 4DU8A 1T7PA 2C3OA 2VFUA 4UOHA 4ZJQA 4XK8C 2J9CA 2E5LJ 8ATCB 2VOOA 3DGVA 1FKOB 2FJDB 2J8SA 1W2BR 4DQIA 4PQAA 3D4JA 3T1AA 4ERDA 2OSRA 2VDHA 3JSBA 2QGFB 5HVFA 2B9EA 1SQFA 3DXSX 2DXFA 1KHWA 3R5GA 1RWPB 1A9NB 1B64A 4H4MB 1SJ1A 3TVKA 4O4RA 2EI5A 1R8HA 3CO9A 4PRFA 2HNZB 2BJ9A 3S6EA 1Y10A 3TZZA 2GQQA 4FF1A 3MEKA 3M30A 2HRYA 4DS5A 3PO5A 2MZQA 2HHPA 2JC0A 3OR2A 5CYQA 2LLZA 2PI4A 4DQRA 4RW6B 3CB4A 2EBGA 2CPFA 1S49A 3UD4P 2B7BB 2JFKA 2MJUA 1RT3B 2MQMA 3AH6A 4ENOA 5KFSA 3V4IA 4LR7A 1IN0A 4Q0BA 2MKJA 1E6VA 3BH6B 1HBNB 5A8RA 3LP0B 2YX7A 3ONQA 2R8JA 2FJVA 4LR9A 3DRSA 3PFOA 3LP2A 1Q5YA 2HFOA 1REVB 1DJ0A 5I4MA 1KC8T 1HQUA 1JKHB 3QFWA 2JOQA 3Q83A 4ANDA 4JI1J 3AOBA 3D1QA 2W2OP 2MMYA 1T9YA 1O5JA 4HVZA 4DPWA 5L46A 5A0YA 2M8DB 1SKSA 1HWKA 3PTWA 2WW4A 4KHMA 1C2PA 1QVFR 4DCPB 4GO5X 4MKYA 3WX8A 3I96A 4B3OA 2OEKA 1VJQA 3WIUA 1TTHB 4ZPBA 1KVJA 1S9EA 3W9IA 3BGOP 2MTLA 1FO1A 4DSKA 3IS9A 2HBQB 4QCLA 1Z1ZA 4HTIA 4WE1B 1RB0A 4ED4A 4ER8A 3PKMA 3DFEA 5K8PA 1DFDA 1U2FA 3DYAB 1RHKB 2DIVA 3LPYA 5B0FA 2J6TA 3KJQB 4OZ1A 3IBFB 3MMCB 4X62F 1PKUA 2P9EA 5DJBA 4HDGA 5L9NA 1EP4B 3EDQB 4O44A 1S77D 4JV0A 3T6JA 3MF5A 5KFZA 2QYCA 1G6BA 2VH7A 3MR7A 1V9OA 1Y0HA 1ITPA 1VRTA 3I55S 3BM7A 5HBMA 1NJIT 3R5CA 1RWKB 1M5HA 1YJ7A 1IKWB 1AFJA 1NBEB 3HP6A 1OSDA 2Z2ZA 3D7SB 3A3OB 1PCAA 4WK1A 5CA5A 2IDEA 1EIYB 3IR5B 3JS9A 2P5VA 3HSJA 3CTRA 2KI2A 1SV5B 5LOQA 1U02A 4WTOB 1U24A 4KYZA 3K5LA 1WG5A 1HMVA 5GAGU 4NLUA 2Z2YB 5LXRA 5CXTA 2HAFA 4J9LA 3GB0A 2Z0GA 4DL3A 2D3OR 2YX1A 4ZVUB 4WFAQ 4MIAA 1H72C 5KOWA 5KFWA 4JI0F 3X1LB 3MMBA 3M1VB 1ZA2B 3DOLB 2YKOA 1NK0A 3RRHA 1FVQA 1HBOB 1SC1B 1ZOTA 3CD7A 4KO0B 2DEJA 4NLOA 1TL7A 3K5PA 2AYBA 4C6AA 3R97A 5J2MA 3GTYX 1TL3A 3CCLS 2J9EA 2ZD1A 2AX0A 2F65A 2XEXA 5KTQA 4ZS6A 2XCPA 3PW2A 5C42A 1RISA 4KBIA 2HHXA 4RO0A 2AP6A 3PEJA 2IJFA 4BBYA 4RL1A 1UKUA 3BSCA 2DNLA 3DRYA 2HRUA 1S6OA 2P2CB 3FBEA 1QJHA 5B0GA 3FZBA 4NA2A 4BWMA 2DXDA 2F4VF 3FNNA 3TW0A 4NOHA 1MN9A 1HNZJ 4E8UA 4CQ1A 3T9ZA 1KN6A 3VCDA 3ZZOA 3ILJA 4O23A 2VKRA 4F0KA 5CQGA 4Z37A 1Q81T 2IM0A 1IBMJ 2W7OA 3R8YA 4LBHA 3KLGB 3J7YU 3QWUA 3KJNB 3RB6A 4DR2F 1VI7A 3DCAA 4GKKF 5K9FA 3RW7A 2XZWA 3AB2B 4GMKA 1RHUB 1RAEB 4DF4A 4USIA 5D4PA 4DQQA 2HLUA 4USUA 5A0YB 2FY8A 1RTJB 3HO1A 1NXIA 3NCQA 5IM0A 1TL1B 1H2UX 4Y6IA 2EFOA 1NHUA 5KFOA 2IIHA 3PX0A 2AEFA 3M2VB 3VTIA 2Z56B 1DBDA 2HLTA 2C2ZB 1V3RA 5CCMA 1H2TZ 1FXLA 2GO9A 4A8SA 3R5BA 4FS1A 3ZTOA 3K7RA 1JJCB 4NZ7A 4I7FA 4DV0J 5FDLA 1KRPA 2ZH1A 2GJFA 3VZIA 3HSGA 4X4TA 2PEBA 3FK4A 2MPUA 2RUGA 1HL6A 2NSCA 4GC7A 4OI6A 1SUQA 3Q8UA 2LXIA 2H54B 2MGZA 3AOCA 2VG5B 4HH0A 1BXNA 3LPEA 4DV6J 4I68A 3OSPA 2OI2A 3IWLA 2CPHA 2IPOB 1SI9A 3ZNJ1 2CJKA 3N5BA 2CQIA 1HLWA 4H54A 4OYOA 4U9RA 2ZZTA 4ZITA 2DPIA 4ZPVR 2EPIA 1WTBA 2V4JB 4KQZA 2J6SA 4JBCA 3BGFA 5GAEI 4X4PA 2B8PA 3NS7B 4QZVB 2C42A 4N8NA 2COLA 1UWAA 2M70A 1IM4A 5HROB 4B3RF 1YIJS 2CJAA 4ANEA 3M2RB 3CCSS 3MAAB 1ZA1B 3BYRA 1K0VA 4ZPWR 4L6V3 3UFCX 1MMDA 2JJ4D 3CXCR 1BWEA 1TVRB 3FUYA 1HNXJ 3ZZRA 4QWEA 1JLEB 2XLJA 2PSZA 4DL5A 2VFRA 2R2TA 2UU9F 1QAYA 1REGX 3NOGA 3POTB 1S72S 1WHVA 3NMRA 1RE1B 1N36J 3MMJA 2X51A 2CNKB 5C25A 2JLEA 4C0BA 1RUSA 3DRPB 3U7JA 3M8QB 1NHVA 3ETMA 4EO8A 2G2OA 5J1EB 4YS2A 3PW4A 1FD2A 1HNVA 3EUNA 1CC8A 1S12A 3C6UA 3DKDA 2IBOA 1B4SA 3JXOA 2R7RA 2K8GA 2ATCB 1X9MA 1I94F 1WSRA 4DV7J 2ZOGA 5IV4A 1NK8A 4CT8A 4DV4J 2RDIA 1BQXA 1WTFA 4LF7J 5LMUJ 2OJ3A 3DDKA 2ZDPA 2DNGA 4Y2AA 4NLGA 3GLJA 1HI0P 2BM0A 4ZDNA 3IAM9 1RAGB 3U1LA 2HS0A 1YKWA 3QJLA 1JX4A 3HVAA 4ALZA 2B4UA 4USMA 1TV6A 4MT1A 2JDJA 2ZHOA 3MCSA 3UCZP 3G6YA 3CMAS 3A8EA 3D2WA 3TARA 1WWHA 2OMLA 3D28A 2A6MA 5D4NA 2BJDA 4Y34A 1T05A 1FF2A 4ED5A 4PG4A 2B6AA 2KM8C 2ZH9A 2KT3A 3D0HE 1FRJA 2D3ZA 5F8GA 2Q6CA 2QN6B 1LK7A 1KLMA 2FHOB 3C14A 1RABB 4ZVTB 3GIKA 5JMNA 1M5PC 2ROEA 4UZCA 4DN9A 3PW0A 2A10A 2ABYA 2YWFA 3KLFB 3TA1A 2AZ1A 3Q2TC 2M7SA 4RJVA 3MR3A 4TU9A 5LSLA 4F04B 2BW2A 3PG9A 1L3TA 3QT5A 3LF0A 4IDKA 1PYOB 2IJRA 4J91A 2KJVA 3A13A 1P1TA 3US5A 3RAXA 1RT2B 2XYPB 3P49B 2DNOA 5JVHQ 2DXEA 4ILMA 4U8VA 3OFGA 4CT9A 2W9CB 1L3VA 3ADAC 4RW9B 1S0NA 1SKWA 3MPYA 4USWA 4F4ZA 1JLAB 1VJWA 1X4GA 2YKMA 5KFDA 4Y00A 5J2QA 2KH9A 3ILLA 1DLOA 5HO4A 1XR5A 1CJUB 1TAQA 4YB5A 3RU0A 4J7CA 1IBLF 3DC2A 1OY6A 3QGIA 4OMFG 2OMOA 1T0TV 2D7SA 4WU3A 2BJEA 3BQ2A 1HYSB 5ETLA 4EK2A 2VA3A 3KHHA 2RF2B 3IWXA 4USVA 2E1CA 4ECRA 3LP1A 3DOKA 5E3CA 4PG5A 2H1YA 3IG1A 1FWPA 3DLEB 3OR1A 4YOEA 4EBDA 3TJ8A 1RWUA 3OW2R 1TUWA 4WP9A 2B9WA 2HK3A 2B7CB 1PYSB 5KFKA 1EKSA 5D0GA 2VASA 1VBYA 2HHQA 2ZUGA 1S6QA 4HHHA 3ULHA 2WAQD 1RHRB 1JNZB 3IR7B 3KK1B 3I82A 3VAGA 4PG8A 2A18A 2EFNA 1CQNA 2A3JA 3RBXA 3RBEA 2E7XA 1IXKA 1RT7B 1RTHB 3F73A 3AJ2A 3RAQA 2HWHA 2M4MA 2ERRA 1C1CB 5EWEA 2MQNA 1R3NA 4P72A 3M2UA 3QT7A 2YNHB 3R5DA 2BV3A 4DFJA 3HM9A 3NWGA 3DLGB 1T95A 4IH7A 3I5BA 3FRYA 5LMNJ 3FFIB 4JI3J 4OZ2A 1GMVA 1S99A 5KFNA 2E5LF 3QIPA 3CVKA 4ZVHA 1HD0A 3G82A 2DCLA 5AXLA 4B3MJ 5GAHI 3BGUA 3V2UC 1LV5A 3HVWA 4DBQA 2OP5A 2YWKA 3BR9A 3HPOA 2G13A 4DU7A 5C2GA 1FX2A 5BR8J 2M3DA 2YY3A 4CTAA 3S7RA 2QL7B 3WC0A 1HNWF 4LJMA 1TL4A 4MKAA 3EPIA 2WVDA 2WVCA 4TYBA 3EZUA 4LBPA 3NS5A 2H5IB 4OZJA 2XS7A 3G8TA 2B6AB 1I1GA 4MJKA 4DFMA 3EVWA 3QLHA 2PA8D 2WONA 2B4OA 4KE5A 1URRA 3CCJS 1QE1A 3M05A 3GIJA 3BSAA 2QLFB 3AD9C 2AJ1A 1H38A 2I5JA 3LWMA 3PX6A 2V8DA 2FLNA 5E3AA 4USKA 3BKTA 3PV8A 2V8PA 2ZJQQ 4AL6A 2MLYA 1LWEB 2OHDA 3TJAA 2G1DA 1F3FA 1KKHA 4ZPAA 4M1KA 3EPGA 4JI8J 5K14A 1FRLA 2YWWA 2EK1A 2HRTA 2AV5A 4UTGA 4OHVA 3PFEA 5AE3A 2PFFB 3JQKA 4HEA9 2GGPA 4KHPJ 3PR5B 2DNMA 1BC6A 1FNMA 3RR8A 2GIFA 2WBRA 4AD6A 2BQ3A 4C0OC 4DR7J 1NJXA 2DNPA 2HEKA 2PGCA 2FJXA 2DRBA 2XY6A 3N28A 2VBXA 3OBIA 2ASLA 4C48A 3N79A 2QL5B 4DV2J 2R9LA 3TA0A 4DI6A 1H2VZ 3E8OA 4PXEA 2KG1A 1LWCA 2HHVA 3KK2A 3GV7B 1S9GA 1DARA 5A8KB 2B9XA 3MPWA 2YKQA 3I9V9 1H74A 2CPIA 3NGTA 2BE2B 2B5JB 1W2IA 2ZH4A 2DHGA 5E41A 1KNZA 1WNEA 1HQ2A 5ITHA 4X65J 3MXHP 1FTCA 4NYPA 4QWDA 1FHTA 3K2YA 5KFTA 1WF0A 4ZVOB 3QPIA 2IRXA 3HFVA 3LP1B 3QO9B 2FJBB 4P71A 1VRQC 2EKNA 3RZAA 2YVSA 4ZN3A 4DR5F 4G1IA 1U1QA 3FQLA 4ITSA 2MLZA 2CUYA 2PO4A 2YNFB 4HHUA 2MSSA 4I0WA 1DZ5A 1UVLA 2GVZB 4ECTA 3IC1A 3HSDA 5DGAA 3BQ0A 4RNHA 2JZ5A 2JEFA 2V8HA 1CS4A 3GFXA 3B54A 3AA9A 3MAHA 4DV5F 2RJZA 1UJ6A 5IQQA 2E5IA 5DZ6A 1QTNB 3HDSA 2VG6A 2C1EB 1BY9A 3B6BA 2ZH6A 2WSCC 3CJKA 3GIRA 2OPPB 3GV8B 4L3KA 4ECVA 1HWJA 4F3MA 1Q79A 5KOXA 2HZVA 4DWIA 1FT8A 2EEYA 2OEJA 5I3UA 1NZAA 2HGNA 4ZJLA 2M88A 1N0UA 4P7TA 1KP6A 1RHJB 4ETXA 4J9RA 3W3SA 3W9HA 4PWWA 1SKUB 1N52B 2YWHA 3NEKA 1UAWA 2OGUA 2AJ0A 3OVSA 2CQ1A 2C2KB 1ZAXA 2EFGA 5A2QY 5F0UA 4RX6A 2W8KA 2RQKA 1RBLA 1KHVA 5BXIA 1S59A 5CD4A 1TP7A 2X1GA 4LF4F 4NYZA 2GS8A 2XS2A 3NMAA 3H90A 2RB7A 2FUG9 1Q8KA 3FMBA 3PEHA 2FD2A 2FZGB 1UCNA 1AFIA 4X84A 4B3SJ 3CJSA 2W4DA 3MGJA 2RRAA 1W25A 2NZCA 3GYXB 1SC6A 4NYOA 4FKYA 1JLCB 1RAIB 1MU2A 5IT9Y 4A8YA 4YR2A 3W2VB 1JLFA 2RIJA 4M5KA 1VC0A 2Y3YA 1CJVA 3BS9A 2AGPA 2HWTA 3LWLA 5HSPA 2B4VA 2MQOA 1UVMA 1HNZF 2IAJA 3J7A1 5ETSA 4LF5J 4OYWA 2BA9A 2RQMA 4R8UA 2ZHAA 3DI6A 5H9FK 1WG1A 1ZZNA 1MROA 1LW0B 2W1BA 1IBMF 3G71S 2V8VA 2E9ZA 4ZCLA 1V5VA 1PC5A 5M2UA 2E9TA 3AD8C 2HMIB 3TX0A 1Q8BA 1JQGA 3BDEA 4C8KA 3W62A 4P6QA 1B0VA 3V6KA 2IMWP 4NXMJ 3CIMA 2Z58B 4C97A 3ISNC 1IWGA 3G6ES 5G0RB 2WTFA 1EZZB 1UFLA 4UW2A 1T02A 1A6LA 3D1OA 2XMVA 4JV5J 1TKZB 2E1MC 1NSPA 2WRMA 3OHAA 3NKYA 3CJ0A 1RT6B 2BQRA 3QFHA 5KFQA 4OI3A 4P2FA 1C1BB 3TQEA 4CM2A 1NZ8A 4A8WA 2OPRA 2LMIA 4RU9A 4DV0F 1RKJA 3FEYB 5H9EJ 3DLKB 3KOAA 2P9GA 4USHA 1I6JA 2MEWA 4XTTA 1Q7YT 4WKYA 2APOA 3DM2B 2W24A 4M63A 3KYLA 4I6YA 2G0CA 2DYAA 4NLRA 1P27B 2UUCJ 2ZZNA 2VQFJ 1S0OA 3DOMB 3CCZA 2X3DA 3RJMB 3JB9k 4DV6F 1R6VA 1FE0A 3EICA 4AT1B 2IHR1 3ENVA 4KY3A 3PZPA 1HNIB 3OTCA 2AJFE 1HKAA 3SDEB 2IVYA 4YN3B 3M6VA 2XNRA 3BGRA 2HNYA 2LA6A 4CO4A 1TKXB 4PQUA 1BQMA 2IA0A 3MEEA 4ZPTR 1J5OA 4J9PA 4AL7A 2HQDA 1WACA 4OLOA 3QYYA 2RQCA 2Y8WA 2QFJA 1U2CA 2YX4A 4DPXA 1S4EA 2MZJA 2QC3A 5KG2A 4P10A 1VC6A 2M5YA 4OV6A 2E7VA 3KLHB 1RJJA 5CZXA 1S0MA 3SSSA 3NGKA 2WW8A 1SC3B 1HQEB 5EWGA 3OFFA 1HNXF 1NNDA 2ZBPA 1U6BA 3HHLD 4I2QA 2E1RA 3M9NB 5GADU 1B70B 3I56S 3NCPA 2K1RA 3UVJA 5E5NA 4DX5A 3HFKA 5DGBA 4DMZA 4P52A 3NG8A 3MM7B 1Y11A 1ELOA 2VUGA 1Q0NA 3OTBA 3G4SS 1VYAA 4OX9J 2IM2A 3TEGA 2OPSA 1N36F 1U0HA 4LVOP 4IG3A 3T5HA 4PAAA 4KT0C 2YQ3A 1FRXA 1M1KT 4ES1A 2J0SD 2QA4S 5THWA 2YKNA 2F1FA 5FD1A 1FJGJ 4O0IA 1IJEB 2B56A 4DV7F 2DB1A 4DOZA 4Q44A 1CSJA 3SZ2A 4LFBJ 5LMUF 2KZMA 1U8WA 1QUVA 2MZRA 5KT3A 1YGYA 5DLFA 3M8PB 2VJUA 1E6YB 2XSFA 1F9FA 2YKPA 2XG8A 2GVDA 2RSQA 3F41A 2NUHA 4ZIVA 2VHGA 4K5SA 2XMAA 2X7IA 3GE9A 2Z2MA 4U96A 5LM7E 1GMWD 1Q8IA 2GV1A 3GJTB 1F5CA 3D6FB 1SCJB 2DGOA 3HT3A 3ET6A 3NAHA 1UEVA 4HT5A 2XSJB 1UA0A 5D8HB 5M2PA 2F8MA 2V94A 1UETA 3OFEA 6FDRA 1EETA 3PYGA 3KMQA 3CO0P 3I5CA 4CRJA 4DV1J 3SCLE 1KR4A 3DRRA 5E3PA 3RB0A 4QIVA 2UUTA 2F63A 4M5DB 2WVFA 3BKUA 3KJFB 4QIEA 2PN6A 1HBUB 1CEZA 1XNRJ 2GW8A 1FKPB 2NYIA 4OJHA 4IR9A 2E9RX 3DLJA 4LIRA 2DBBA 3DU5A 2UVVA 2D1CA 4BC9A 3KJVA 2I1RA 1RCXB 3VVTA 1RT1A 4C0HA 2RAQA 3K89A 2OLWA 1Z4UA 4XAKA 2HVDA 2DIUA 5KFUA 1YITS 3DGPB 3UI3A 1KQFB 3O1LA 4WXWA 4C8OA 3N5FA 1LW2B 2ZE2A 4JI5J 3WZ0A 2CKWA 4F25A 5B0BA 2PT0A 3KUEA 2DITA 4LFCJ 4ECZA 5D4LA 1GH8A 4TQSA 1RAAB 1RWOB 4FN5A 2MZSA 1FFSB 1VLOA 2DTJA 3W65A 4DG1A 5CYMA 4C98A 1FI4A 1HWIA 4TU8A 4CLPA 3EGVA 3ZTPA 3WBZA 1VQPS 3KNAA 2ZUAA 4RBUA 1TZ0A 2CNOB 1FTRA 2FYXA 4IOAQ 4YR3A 4MFBB 1NJZA 2J0QD 3VWSA 2A2DA 1UWBA 2FZCB 1ULRA 3KLEA 3SYZA 1PYTA 2CNNB 3HHEA 1R8AA 2ZH5A 3H4BA 5D0HA 5AE1A 2ZNYA 5D0EA 4YB7A 1FK9B 3MUTP 4RWXA 2K1RB 1DTTB 3BJYA 2IY5B 1FESA 5J2PB 1MN7A 2RU9A 1LQ9A 1YBUA 3K17A 2R2UA 1TMMA 3MM8B 4DDFA 3VR1A 1G7CB 2HW3A 3PACA 1S0VA 2VPWB 4B9VA 4M8LA 1RDRA 2W2NP 2WOMA 2G0IA 1RBOB 1WI6A 2FHJD 4UOCA 2BACA 2VG7A 3H20A 3OUYB 1OSCA 3VQSA 2PFDA 1H0HB 1VFJA 2E5GA 3KXDA 4MYUA 1UTAA 3Q8SB 4G3IA 4PZVA 5LMNF 1SQGA 4I2PB 5AJ3F 3NNHA 4JI3F 4URSA 4CO5A 2R8KA 4UQGA 2XZDB 2HZCA 4A8FA 5A6WA 4B3MF 2GHVC 3W8PA 1VRUB 2KXHA 5BR8F 2BE9B 2MKCA 4CLUA 5I42A 3G9CA 3P3DA 2CG8A 3H0PA 4MH8A 2UXDJ 2FC9A 4GRSA 1HFEL 2DT9A 3GONA 2ZBIA 5H1SV 1QLNA 1GXUA 1D8YA 5HN0A 3DMJB 3FSYA 3V6DB 2Q66A 4FKXA 1M5VC 3SBMA 1VIXA 3U1MA 4LSLA 2NLWA 1VR6A 3OLAA 3SV4A 2V2QA 4IYQA 3R6GB 2Y1JA 1Y9OA 4I69A 1WI8A 2G4BA 2CJXB 1LWFB 1FRKA 4A8KA 4M5IA 4JI8F 1BMQB 1OYEA 3DLLQ 5ETVA 1Q86T 4O4GB 3OVBA 3ZTQA 3C15B 3NS6A 3TVYA 3TEHB 4G6VB 4QPXA 4F4KA 4KHPF 2W01A 1Y3KA 1C0TB 4CO3A 4U7UD 3CCES 5KFIA 1T9TA 3KK3B 2PD1A 4BDPA 4B9SA 3WQPA 2MJNA 2FVPA 2DNZA 4KV8B 4OZ0A 4DV2F 1RLDA 2M2BA 2YNGB 5IOLA 5DDRC 3V81A 2C2DA 4DR6J 1RTIB 2KHDA 5U47A 3J80U 5HMXA 1HWUA 1M90T 1IWAA 4RW7A 3R9LA 1PAEX 1TELA 3J81Y 4UOGA 2R8GA 1QAXA 1T9WA 1EARA 1PAUB 3M32B 2RDDA 3GG0A 4ICLA 5A6PA 4A8MP 4OZLA 2JNJA 5LSOA 3V6JA 3D3BJ 5CYMB 2XGPA 3GIIA 3G86A 2BRKA 4OFZA 4WFBQ 1MMLA 2Y0BB 1FERA 2GIQA 1U1OA 1U6FA 1RCOB 4TVAB 1VQ5S 1RI7A 2MB0B 1S1WA 1CJTA 2BE7D 4FYVB 2KRRA 1X60A 3U27A 1R27B 2BUNA 4K0KJ 4WYLA 4IOBA 1KQSR 4RLEA 4J9QA 2A0FB 3KG1A 1ZPVA 5HK4A 1T9UA 3THPA 2LEPA 3D9BA 3VZHA 2GNKA 5HVHA 3L3CA 1IR1A 3U1NA 1U4BA 5AT1B 2DGXA 1Y7PA 3TAMB 4QBUA 1FD8A 2VD3A 4G1PA 3OTOJ 1S79A 1FCAA 2KL8A 4UF4A 3W2WB 3HK2A 4CO1A 1U7LA 2O3DA 1S7HA 5F8NA 3IBCB 3EXYA 5DG7A 4E98A 1Y5NB 1KONA 3R2DJ 2BOPA 3AY0A 3ZZUA 2O1PA 1K44A 3HHKA 1XERA 5A2QU 1D1UA 1J2VA 3KKFA 5D3GB 4H4OA 1OYDA 3I32A 1S1XB 1Y5IB 5KG0A 3GZ7A 2DKOB 2DGQA 4ZVQB 2CNLB 2ZDOA 5HI7A 3MR2A 4OLPA 4PWDA 4QWCA 5LSRA 4ED2A 3P4UB 1U1MA 4J9NA 1TL5A 1ROFA 4FBUA 2NR0A 2XYHB 2H48B 1QM9A 3GJRB 2BEFA 2W9BA 4IR1A 1IBKJ 1VQKS 1NKBA 1V3ZA 3MEGA 2QMUB 5IT9U 2UUBF 1T03A 3THTA 4NLYA 5H9FJ 4NXNJ 2C2MB 2HBZB 4N7TA 2H3EB 4R5PB 1N0VC 4B3SF 4EO6A 2W7AA 3HKWA 5J2NA 2FJWA 2WB4A 1FRMA 2H5JB 1P9YA 5IC4B 4NA3A 2F8HA 4TY8B 2ADBA 2IM1A 4LF8J 4OYMA 2AX1A 2V63A 4NX9A 3VAMA 1FKOA 4YR0A 1ZS6A 4L72B 2J5AA 3RRGA 3EXCX 3ENQA 4L75A 1Q82T 4LF5F 2KU7A 2RDJA 4RPFA 1FX4A 5KFRA 4QQBA 1WKLA 1EAYC 1VLYA 4FNIA 2QJ3A 2QV6A 4H4MA 2RD5C 2BM1A 3CC7S 4NLWA 4N76A 1NJYA 4A46A 2XHWA 1YQHA 3CDWA 2ILZA 3A4TA 4CYUB 4JI6J 1UFWA 4IG0A 1VMBA 1U8SA 4ED3A 4DL7A 2RHQB 1IR2A 2HFSA 1ZH5A 2L41A 4RUBA 4OYZA 1GMWA 4JV5F 1UP1A 4RW6A 2V2ZA 3DNCA 3V5RA 3J7AN 1M0SA 1PIEA 1RT3A 5JUMA 1F2HA 2HSEB 3G2XA 4PEOA 4D3GA 4C4WA 1HBMA 2LFVA 3IAS9 2X1AA 1K8AT 1QUPA 3MCNA 1HBNA 3V6HA 4P7VA 2VA2A 1X4BA 3LP0A 4YUDA 4IQXA 2V69A 1JK9B 2BJ8A 1VQ4S 3JQMA 2AGOA 1FE4A 2XHCA 2A6OA 1WDDA 4P75A 4ZVRB 3MI7X 2LECA 2HWIA 1REVA 4KJIA 1U6ZA 2JLFA 1RLCL 4C8YA 1JKHA 4X64J 4AXJA 3ILIA 3IN5A 2UUCF 2VQFF 1C4AA 3TUPA 1KFDA 3O44A 4QIFA 1Q8LA 4X4NA 4AQYF 2CVIA 1UA1A 2KFZA 4IUFA 4BC7A 4RW8B 4LRAA 4AE5A 3H42A 5C24B 1WC4A 1XIQA 1JMTA 3O2IA 1SH2A 1RT5B 4UOFA 1R6YA 2M0GB 3MCMA 2XNQA 5DETA 5F8IA 4O3SA 4GO7X 2EFVA 2J7UA 2CQHA 1D9AA 4DLEA 3QWPA 1S4FA 4C3KA 4G1QB 2AU0A 2AJQA 4AFFA 3DYAA 4D3HA 1M1HA 1CJKB 4JI2J 3IRXB 3MMAB 2HNDB 1MNEA 3MMCA 1F5BA 5AE2A 1X9SA 1EP4A 2OFHX 1GMUA 4URGA 1T94A 3TRGA 5DLGA 4MMOA 1NK4A 4NLPA 1WC6A 3QRPA 4PWDB 3K57A 3TZXA 3K8WA 4M95A 2UXBJ 3BO2A 2FVRA 1JXVA 4UUWA 1H98A 4OIXA 4CLSA 1IKWA 3MECB 2BJ7A 1EKRA 4DSLA 4OX9F 2W9BB 2I2YA 3KMSA 1N48A 1FNOA 3OL6A 2RH3A 4DUZF 1IM6A 4RBVA 4K59A 3WHIA 1KOHA 2QRRA 4ZOSA 5F9NA 2J9DA 3UR0A 4N5SA 3SMZA 2BJ3A 3OSNA 1IKXB 2QA1A 2VB6A 2VBWA 1RBAA 1B3TA 1SV5A 2WHOA 2DR7A 3CCUS 1L5UA 5GMDA 3RBZA 3I0RB 1FJGF 8RUCA
chains in the Genus database with same CATH topology
4OZ5A 1NRKA 4ETZA 3CCJS 1QE1A 7FDRA 1VRTB 3DHXA 3M05A 3GIJA 3SCIE 3QJJA 1SIWB 3BSAA 5HBMB 2W8LA 1PO6A 1O0PA 4BCAA 2HAIA 2MQLA 4LFBF 4TN2A 2AJ1A 3FZ2A 3K58A 3GFZA 3ISND 5KT4A 1H38A 5B09A 3MOJB 1KVIA 4YFUA 3JTNA 2I5JA 3M1VA 3LWMA 3PX6A 2V8DA 2FHJA 5KFBA 3DOLA 2FLNA 4LQ9A 5E3AA 4DS4A 2FLOA 2NUUG 2GX8A 4EZ9A 1FK9A 1FDBA 3PV8A 2ZJQQ 1FEEA 1HHSA 4AL6A 2KFNA 1HBOA 2ZH7A 5KFJA 1TK8A 1YVFA 1LWEB 5KG5A 1KSPA 3U02A 2XLKA 2G1DA 1UMJA 3FEZA 1DTTA 4ZPAA 4DG1B 4M1KA 4NLTA 3EPGA 1D0EA 1JLBA 2EBEA 3PW7A 1VQLS 5J2PA 1XC9A 5K14A 2LA4A 3OPKA 3O5TB 4KO0A 1FRLA 2LQJA 3MM9B 1ZYQA 2EK1A 4A8OA 3OL9A 2AV5A 3GR0A 2IRYA 4OHVA 3PFEA 1FEHA 5AE3A 2GQCA 2ZFHA 2PFFB 4HEA9 2GGPA 2WB1D 4A8QA 1TKDA 1FDDA 3PR5B 2DNMA 3G6XA 1K9MT 1N33F 3AB4B 1BC6A 1FNMA 3MM8A 4EBCA 3RR8A 4X4UA 3ZC4A 1HMVB 2LYVA 1S6UA 3OVAA 4B17A 2WBRA 1ZM3A 4BWJA 2BQ3A 4C0OC 2UUAF 1VQ8S 1NJXA 2DNPA 2PGCA 1H7XA 2FJXA 4OI4A 4DLGA 5KFLA 3N28A 5DDOC 2XY6A 2DRBA 2KT2A 1UWBB 2LEBA 2VBXA 4DL6A 3OBIA 2Z4PA 4DPOA 2ASLA 3EGWB 3KLEB 2XC9A 3N79A 1NK9A 2FJAB 5EX0A 2R9LA 2DJWA 1HW8A 3N0VA 3TA0A 3NBPA 4E0DA 2LKZA 4IG0B 1H2VZ 3T1YF 3N9UC 2HFZA 3E8OA 5KG7A 4PXEA 4F50A 3CCMS 4ECUA 4O3OA 3MMBB 4FNHA 2KG1A 4ID5B 3OUYA 1Q16B 1IQTA 1LWCA 3HZEA 3KK2A 4Q45A 1DAXA 2HHVA 1JWWA 4NLSA 3HI9A 4WYWA 3GV7B 3CCQS 4RW4A 1UJ4A 5IQ6A 1S9GA 1M5KC 4F2RA 1DARA 4F2SA 5A8KB 3I9ZA 2FHKA 1SJFA 5KG4A 2B9XA 3MPWA 5AXKA 2YKQA 2B0GA 4DV4F 2RVJA 4DV1F 1K0TA 4ECXA 3I9V9 1XEZA 2L9NA 3FDSA 4LF7F 5KFCA 2X1FA 1U49A 2KG0A 4B9LA 4GKJF 2CPIA 2RKIB 3M9MB 4WZQA 1CG2A 2BE2B 5F8LA 4LQ3A 2B5JB 4DN0A 4I2PA 4OJGA 5J2MB 4K4ZA 1W2IA 3F44A 1GNKA 3T3FA 1KTVA 1TL3B 2XBPA 1JLGA 2ZD1B 1XNRF 2EC0A 3TQ1A 2ZH4A 2XY7A 2DHGA 5E41A 1KNZA 1WNEA 2C2RA 2C3PA 4K4YA 3BB5A 4KHRA 3JSYA 1WF1A 5ITHA 1HBMB 1Y5LB 2X3GA 2HPUA 2WOMB 3MXHP 2LEAA 1FTCA 1ZTTA 2ZOFA 4NYPA 4QWDA 2F8EX 3O8WA 1HARA 2Y1RI 2VG7B 1SQEA 5C42B 3VAKA 1FHTA 3K2YA 5KFTA 3DRXA 4IQMA 5GAGI 1VRUA 1JLQB 3MPVA 5HP1A 4EYHB 1F0XA 1GQEA 1WF0A 1HW9A 1Q53A 4OJ3A 1VQ7S 2R7OA 1GTEA 2KJWA 2F9DA 4OX8A 2N7CA 3KLGA 3QPIA 2IRXA 1SJRA 4YB1P 3T1HF 3N6NA 1MWYA 3LP1B 5KT7A 2U2FA 3QO9B 2FJBB 2E5HA 4TY9A 5KFFA 4IFYB 5DQGA 3JTPA 1VBXA 2CQPA 3KG4A 3RZAA 5AXMA 2YVSA 1R7IA 3HHDA 3V4MA 5L1IA 2KDOA 3I31A 2K3IA 4ES3A 5JJBA 4ECSA 1FNXH 1NAQA 5F9LA 1VGYA 4DR5F 4G1IA 2BDPA 3LH2S 1YSJA 3TAPA 4DUYF 1U1QA 3R3TA 4OHWA 3FQLA 4ITSA 1KQKA 2GHPA 1RGVA 3CCWA 5J1NA 5LT5A 5JVGQ 3UW1A 1RTJA 5EWFA 2CZVC 2PO4A 4ZA1A 4JI5F 3KNGA 1R31A 2YNFB 3SCKE 2MSSA 2ZNZA 4I0WA 2AYEA 2LDYA 1DZ5A 1UVLA 1TL1A 3KFWX 1N5YA 3DMJA 2H9ZA 2IFXA 3IBWA 3V6DA 3SEOA 4ECTA 4EZ6A 3MD3A 2AD9A 2AGQA 3ZZYA 4LFCF 2GO8A 2LQ5A 2YWGA 4WZMA 2LXUA 3IC1A 4IFVA 5DGAA 3BQ0A 3OTEA 3OQ2A 1T8EA 4RNHA 1TK0A 4LF8F 3M2VA 3H25A 2XY5A 1PSDA 2VOPA 2XMTA 2JZ5A 2JEFA 2CZ4A 2V8HA 1HWLA 2ZKUA 5I42B 2NS1B 3GFXA 1OPZA 1OPIA 2PMZD 1QSYA 3O6QA 1ZAVA 3AA9A 3MAHA 4MTPA 3EGZA 4FS2A 4DV5F 3PX4A 2KXFA 3MM5A 2RJZA 1WEXA 1HPZA 1UJ6A 5IQQA 2CQDA 5GAEU 1LWFA 2DHSA 2E5IA 1FJCA 4DSJA 3MTJA 2I38A 1X0PA 3HDSA 2W7PA 2VG6A 4ID8A 1XTZA 3HHLA 1BD6A 1BY9A 3MEDA 2ZH6A 4O4GA 5EUHA 5HMYA 4NLQA 4CH7A 4KB7A 2WSCC 3CJKA 2OPPB 2JVRA 4KFBB 4EWTA 3GV8B 2XWYA 2MSTA 1FJEB 4UUXA 5DQHA 4ECVA 1RAJA 1HWJA 2IVMA 4F3MA 4WFYA 1C0TA 1Q79A 1YBAA 1P6TA 4YDDB 3HF5A 4C2MA 5KOXA 4DWIA 2R7UA 1FT8A 2HGLA 3E51A 2NPFA 5IM0B 3KK3A 3G6VA 2O67A 1WEYA 5GVQA 5L1KA 5I3UA 2HYIB 5EHHA 4KV8A 2J9DE 4JI6F 1KQGB 1NZAA 2HGNA 4OQJA 1J5EF 1Q78A 2YNGA 4NZ6A 2M88A 2VG5A 5T41A 5IT4A 4LSLB 2D41A 1N0UA 4P7TA 3I87A 4ETXA 1IQZA 3ITHB 4J9RA 2R2SA 1OIAA 1XR6A 2EWHA 3W3SA 1RTIA 3BSNA 1S1TB 4PPZA 4ZVFA 3TVZA 4IH6A 3C6TB 4YQWA 4IRDA 1SB6A 1IUJA 2N3OA 1N52B 5KFAA 2ZVSA 3K8VA 2YWHA 1GT8A 1GXLA 1UAWA 3GR1A 2EG2A 2AJ0A 3OVSA 3H40A 2CQ1A 3BR8A 1A7GE 1ZAXA 2NXUA 4QR1A 4YEAA 2V4JA 4I7FB 2JL9A 2EFGA 2IM3A 2VL1A 5FDLB 5A2QY 5F0UA 3AAWB 4RX6A 3X3UA 2W8KA 1X4CA 2L48A 2RQKA 5E0OA 2FGCA 3FJ2A 3M32A 1KHVA 3MURP 2FVCA 5B7WA 4WFZA 3MFIA 4RUHA 4Y2KA 1TP7A 2XO7A 3I4HX 3MAQA 5KAKA 2X1GA 4LSNA 5F8MA 5F0WA 4LF4F 2JEGA 4NYZA 4QR2A 2ACYA 3PRBA 2M8HA 1H6KX 1T3OA 2XS2A 1TKTB 2O66A 5EDWA 2VPXB 3NMAA 1K73T 2HHTA 2IYGA 1SL1A 2WBMA 3S01A 2RB7A 3K0JA 2FUG9 5D6GA 1SUQB 1GX5A 4TLQA 1L3KA 5HROA 3FMBA 3PEHA 1SKRA 2HNZA 2MGZB 2FD2A 4NWBA 3M6UA 1RT4A 1PILA 4U6PA 4EYIB 1AFIA 4X84A 4OX7A 2ASYA 3V81B 2IA6A 2W4DA 4Y65A 1JJ2R 3MGJA 3M2RA 4IOCQ 5HLFB 2YKAA 3HMJG 2RRAA 1W25A 1VOMA 3N6MA 5IT0A 4C8ZA 3GYXB 4MKBA 2MKSA 1SC6A 4RU2A 2OTJS 4NYOA 2VPYB 1R8CA 1Z2LA 4NLDA 2XI2A 5DQIA 2JH3A 4KAIA 4RW7B 4WXOA 3MUVP 4NRTA 1R8PA 1WHWA 2VC0A 1N5QA 3PXGa 3UCGA 2J6UA 4K4WA 5T14A 1JLCB 4IO9Q 2RU3A 4B9UA 1TVRA 3K5OA 3JYTB 1MU2A 2IRUA 5IT9Y 4A8YA 2ZJRQ 2JEJA 2OPQB 4YR2A 3NRBA 3W2VB 2VODA 2R7VA 1JLFA 4X64F 1JLEA