1RGVA

Crystal structure of the ferredoxin from thauera aromatica
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
ALYINDDCTACDACVEECPNEAITPGDPIYVIDPTKCSECVGAFDEPQCRLVCPADCIPDNPDYRETREELQEKYDRLHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of 4-hydroxybenzoyl-CoA reductase and the structure of its electron donor ferredoxin.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords ferredoxin
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2003-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rgvA00
1JB0C 1FRIA 2C3UA 2FDNA 1FCAA 5CH7B 2UZAA 1SJ1A 1FRXA 3MM7B 6FD1A 4XDCA 1BQXA 1F2GA 1B0VA 2C3OA 4CI0B 1FEHA 1BC6A 1PC5A 2C3MA 3GYXB 3MMCB 4XK8C 3IR7B 1D3WA 1CLFA 2VKRA 3MMAB 1KQFB 3MM5A 1IR0A 1Y5LB 3MM8B 1JNRB 1FXRA 2VPYB 2C42A 2V4JB 2VPWB 6FDRA 1C4AA 2WB1D 3OR1B 1DURA 1BLUA 4OMFG 3MM6B 2FJBB 3MMBA 1FF2A 3LW5C 4RKUC 1H0HB 4ID8A 1SIZA 3EGWB 2FJEB 2FGOA 1GT8A 2ZVSA 1KEKA 4OV1A 2C3PA 5L8RC 4L6V3 1FERA 1C4CA 2XSJB 1XERA 3MM5B 1FDAA 3MM8A 1H7XA 2C3YA 1KQGB 1Y5NB 1H7WA 1FRLA 1G3OA 1FDNA 1FRJA 2V2KA 1FDDA 1WTFA 1F5BA 3EXYA 3OR2A 4YDDB 2WAQD 5FD1A 2WSCC 3EUNA 5E7OB 1RGVA 4AYBD 7FDRA 1B0TA 1GTEA 2VPXB 2WSEC 1K0TA 2PA8D 2Y0SD 3MMAA 3IR6B 1FTCA 1G6BA 1FD2A 1ROFA 1A6LA 1HFEL 2FD2A 2FJDB 1Y5IB 3MM9B 2Z8QA 3OR2B 1SIWB 3MMBB 3MM6A 7FD1A 4XDDA 1Y4ZB 1VJWA 1PC4A 1FDBA 1FRKA 4KT0C 2PDAA 2IVFB 2V4JA 1F5CA 5BYSA 2GMHA 4Y28C 1JNZB 1FXDA 3HKZD 1AXQA 1B0PA 3MM7A 3OR1A 1IQZA 1BD6A 1DAXA 1FRHA 3IR5B 2VPZB 5BYRA 2O01C 1GAOA 2GMJA 3MM9A 1Q16B 1H98A 5BYQA 2PMZD 1R27B 5CHCB 1GTHA 1BWEA 4DHVA 2WSFC 3PNIA 3MMCA 2FJAB 1DFDA 1FRMA 2XSJA 3C8YA
chains in the Genus database with same CATH superfamily
5LJ3Y 4FDFA 1JB0C 2QSWA 3M8QA 3MWBA 3PM9A 4URQU 4WCEQ 3I0SB 1MMDA 3SSSA 2FVCA 1FK9A 2KTQA 3KLIB 5KOWA 1HQ2A 2W7AA 4YUDA 3HP6A 2RB7A 4ES3A 2AGQA 4IUFA 5HJXA 4XDCA 2DD8S 4F3QA 2N82B 3CJTA 2F9DA 3T5JA 1U45A 2Z4PA 1X9WA 3BS9A 3RB4A 2CQ3A 1CJKB 3FEZA 4LJMA 3C46A 5HLFB 4JI3J 1WG4A 2GGPB 2IFXA 4NXMF 4J9QA 4QU7A 1TELA 2DNYA 3FEXB 1HNIB 4FYWB 5J1PA 3RB0A 1FI4A 3BKUA 4A4JA 1OWXA 2EFGA 1LOUA 1CC8A 4X4PA 1RHQB 4IFYB 2HZVA 4NXMJ 4YDXA 3NOGA 2HQIA 2ZKTA 2E5GA 3W9HA 3K5LA 1WOOA 5D4LA 4QW8A 2AZ3A 4TU7A 4NWBA 3D4JA 3N4WA 2ZM6F 1JJ2R 4QIGA 3W63A 2XGQA 3GB0A 3HFZB 4DCPB 5F8JA 1UCNA 3AXMA 3CJ4A 4I4BA 5KFAA 3W66A 3BPSP 2D69A 3M2RA 3CJ5A 3W8PA 4I2QA 4QBUA 2E7XA 3CCRS 1XK8A 4IOCQ 1P27B 1IBKF 3MCMA 1IKXB 3C15B 1NBEB 4LMZA 4FS2A 1U1QA 2DRBA 3I9ZA 3MM5B 4C8LA 3GLJA 3T9NA 5BXIA 1HR0F 4OHYA 5A76A 1EJ7L 2V2VA 3NBPB 4F25A 2V2QA 3GQCA 5D6GA 3KJFB 2KRRA 3BSNA 5F9NA 3PW7A 1VQ9S 1XNRF 2JEIA 3CVKA 2ZWOA 3A3PB 2DNKA 4OYMA 3V4IB 2K2PA 2WSCC 3PY8A 1JLCA 4AYBD 4UW2A 1U09A 4WE1B 2WSEC 4NLUA 2D3O1 2KI2A 2DHAA 1DTQA 1RJJA 5KFMA 3TI0A 2CDQA 1RLCL 2ACMA 2WOMB 2ZFHA 3HHLC 2X3GA 1KDNA 3HDSA 3KUHA 2E5LJ 1RT4B 4IO1A 1EHWA 2D41A 4RW7A 3W1YC 2OJ3A 4FF3A 4QW9A 1P1LA 1JLGA 4IFVB 4USKA 2EC0A 1N33J 5LSOA 1DLOA 2M3DA 3C6TB 1QY7A 1YLXA 2FZKB 3I0RA 3OBIA 2CPIA 1K47A 3TVYA 4JI8J 2F63A 2K7KA 4P7VA 1HNXF 2R9LA 1WNEA 1RA7A 3IP0A 3K7RA 3RB6A 1N33F 5GAEI 2NXJA 3KTQA 4IR9A 4DV0F 3R7BB 3DOKB 1D8YA 1N5QA 1JLBA 2IA6A 4C4WA 3DDKA 3Q8PB 4DSJA 3AA8A 3EE3A 1OMSA 3I4PA 2CUYA 3WQPA 4RW6B 4C11A 1IKVB 4OZLA 3J7YI 1UW9A 3JYTB 3M2UA 4PUOB 2A6OA 3OFEA 1IKYB 1R0AB 4RU9A 3BH6B 1JNZB 3X3UA 4QWEA 4K50A 1TMJA 2R7UA 3NWRA 2J9DA 2XBPA 2VKZG 4KGXB 2JFKA 3I31A 4IOBA 1QSYA 1J2VA 4DL7A 1H38A 4KHPF 3PW2A 1VQ7S 1F9FA 2F3JA 2VL1A 4IH6A 4TN2A 2HVHA 2HVIA 2HRYA 4Y2MA 4RJVA 2CQGA 1DBDA 1HI0P 1RADB 2N3LA 2KZZA 4UQTA 3MMCA 4QWAA 2ASYA 2LEPA 3C6UA 2KKHA 4EYIB 5KT4A 1DJ0A 2LLZA 1RT2A 1L3UA 5K5MA 3M32A 5BJRA 3D0HE 1VOMA 3ITHA 2R2RA 1VI7A 1NHVA 3KK2A 4MKYA 3O3LA 3QWPA 1BQXA 1UEUA 2HHVA 3DC2A 1IXKA 2ROGA 2ALZA 4DQQA 4B9SA 1FWKA 2VIHA 1N5YA 2AJQA 4IO9Q 2HNZA 1VC6A 2MSSA 2RKIB 3HO1A 4ZVRB 2O67A 5AXLA 1SL1A 5CABA 1UPPA 3LGHA 4OL8A 4OZ0A 2XO7A 4H54A 4Z7YA 4PYAA 3QO9A 3TX0A 1J27A 4EMDA 2ROEA 2H54B 2DNPA 2EWHA 1LW2B 3TUJC 4M5IA 1BE4A 1RBLA 3NGDA 2KFYA 3TQ1A 1VBXA 4V19J 1MNEA 3K89A 4ES1A 1XMQF 1HPZB 2VPYB 3N0VA 4ZP6A 2VG5B 2PFDA 3GMGA 2FVPA 2LFVA 2RDIA 3CDBA 2BDPA 4U67Q 1WF0A 3P5BP 1WUUA 4PQAA 3M2VA 5DQHA 1RKIA 4NEZA 3JAMY 3CJ0A 3CJ8A 3EGWB 4MTPA 3ULHA 3Q8UA 5A6WA 4FP9A 2HPUA 4AXIA 2D3OR 2UP1A 2ZJPQ 1RB0A 3RBZA 1FHTA 1JX4A 4CTAB 3B4DA 1VK8A 3MUMP 4OYAA 2XMTA 4V1Ak 3M30B 2HVZA 1R8PA 3A3NB 2V8GA 4Q2LA 3MEEA 1MMLA 1VS3A 3VALA 1NJZA 1LEOA 4OI6A 4LSLA 4WXOA 5HBMA 4DV6J 1K9MT 2GMLA 2QEXS 3OL8A 4Q0BB 1BGXT 2AEJA 1Y3JA 1HWJA 3NCPA 4ZPWR 5J2PB 4RX6A 2HLTA 1LWXA 4B3OA 3ZTRA 2R3VA 5DGAA 4F4AA 2UUCF 3EVMA 4F4ZA 2DNZA 1B4SA 3EXYA 3VWSA 4YDDB 1RKJA 2KT2A 1C2PA 5CD4A 5BR8F 2ABYA 3BDPA 4P10A 3V81B 4X62F 4UF4A 1U7LA 4YS2A 1HHTP 2G9OA 2WTFA 1JJ4A 1TKZA 2P5VA 4DR3J 5KT2A 2FLPA 4FXWA 2Y0SD 4C9DA 2XEXA 4LREA 2PFFB 2QO3A 1GX6A 1C1BA 3FBFA 1JLEB 4CM0A 3HKWA 2D74B 3FCHA 1S0NA 3CC7S 1YJRA 1TFWA 4X4NA 2NYHA 2ZH3A 4H4KA 2C2DA 4BHQA 3A8EA 4O44B 1TFYA 3P3DA 5HVFA 2LYVA 3WZ0A 1UW4A 3FBBA 5DG8A 1S77D 4N8OA 1YJ9S 2PN6A 4BS2A 2IIHA 2YWFA 2OP5A 3B8HA 1S9EB 3LGMA 3NGSA 4TNOA 4ZVUB 5HMWA 5JJBA 2DEJA 1Y4ZB 3S7RA 1FE4A 1FJGF 2WW8A 3CJKB 1XWLA 3IS9B 2VQFJ 1FE0A 1PJ6A 2DNGA 2KVIA 3CDWA 3E51A 3M8PA 3QAEA 5D0GA 3OLAA 4LVNP 1VDHA 5LMUF 2RSQA 1URRA 1RABB 4ZN3A 1S10A 2A3JA 1YJ7A 2GIRA 3VGSA 3WHIA 2BBEA 2LQBA 3AJDA 3LWLA 3K57A 1ZZNA 2J6SA 2GQCA 4C0HA 3UR0A 4NCAA 1Q81T 1X9SA 4HACA 3QT5A 2HNYB 3D6FB 1V3RA 1IQZA 5DM6Q 4X4OA 3PYGA 4A8WA 2OFGX 5BYRA 4ZJQA 1X0PA 3QIDA 1LXNA 2KM8B 4ECVA 1T3NA 1QAXA 2V6AA 3FQLA 4ED4A 3LP0A 4F0HA 1M90T 1HHSA 3UCZP 4DHVA 4WXWA 3MAQA 1GNKA 4ZIWA 3CJ3A 4X65F 2DR8A 3AODA 3HHNB 4DR3F 9ATCB 3RW6A 4OZ1A 1DFDA 2BJ9A 4Y65A 2XI2A 3GJQB 3RZAA 2W9AA 1N34J 2V50A 1YRTA 3PJWA 2R7XA 2CJYB 1SB6A 1U24A 2YNGB 3EDQB 5CH7B 2UZAA 3NMRA 2KT3A 2BOAA 2CKWA 1KONA 3UN5A 2ADBA 3ZZ0A 2QFIA 3IFEA 1VC0A 3EGZA 1R89A 4FPRA 2DR9A 4QYZJ 2HFSA 3QLHA 2NPIA 3T41A 2A6MA 4DL4A 2QGFB 4NLTA 1NK9A 1ZM2A 2W4CA 3GJRB 1KWMA 5ETTA 4R8UA 1X4EA 2MHEA 2W1BA 2HURA 2VB6A 4A47A 4DN0A 3KLFB 3EPGA 3OVSA 1NDPA 2QRRA 2DNNA 3MAHA 2YNFA 4B3OB 4X64F 2YX7A 2VQFF 1ACMB 1HMVB 1CJTA 1VK3A 2HEKA 4L74A 3HSZA 3THPA 1HBOB 3H8YA 4EO6A 1NH8A 5L38A 4OHVA 1YBAA 5ETPA 1LW0A 1HBNA 1HYSA 1X0FA 4I6AA 5T14A 4URSA 3PXGa 4ZITA 1RYSA 2OPQA 4CCHA 1F5AA 5F0WA 4QWDA 3DGPB 4TLQA 3C19A 2QMUB 1SQEA 1H0HB 2C2ZB 3IRXB 1SH2A 4URGA 1UA1A 1R7IA 1O5JA 5G4DA 1J5OB 3GYGA 1CJVA 1RWPB 2GQQA 2VC1A 1KVJA 1WTBA 5C24B 4FVMA 3KG4A 4M5MA 5KFEA 2JJ4D 1FVSA 2E5HA 3AXKA 3MTJA 2F8EX 1RWMB 1TL3B 4PAAA 4ZCLA 2VHGA 1RP5A 4J9PA 4O23A 4PKDB 2AEFA 2ZH7A 4AL7A 2CQDA 3MURP 2W8LA 1ZA2B 1T03A 4C8OA 2FVRA 3JTPA 2W9BA 2DVIA 1VYAA 1GMUA 3QMQA 4WJBA 1ZM3A 1AA1B 2YKQA 3EVOA 2DNRA 3GV5B 4GKKJ 2WAQD 1HNVB 1G1XA 3CMAS 3JSBA 3R1LA 2PMHA 3FUYA 1UVJA 3PJ9A 2MXYA 3DGVA 4DPWA 3PR5B 3CMES 2B6AA 4ILLA 1IM6A 4PABA 3VTIA 4JI4F 1S1VA 1L3VA 1TL7A 5D3GA 2RUSA 4B9LA 3K5MA 1Q95G 3MMAA 3MZIA 3MXHP 1S12A 3DXBA 1A6LA 3W2WA 5M2UA 2MQMA 1SKWA 3JTOA 5AXMA 4TKTA 4TQSA 3R2CJ 4IG3A 4Z2XA 2FYXA 3ZTQA 1YBTA 1O0PA 3LP1B 2MZSA 1JLFA 3E01B 2G0IA 3HD1A 4FNHA 3SSRA 4X66F 3CCSS 1HARA 3DRPB 3OV7A 3DDNA 3THVA 2MTLA 2IAJB 4DV4J 1X4CA 3AOCA 4DX8H 2C2MB 4RNOA 5L1KA 4B3SF 4LF8F 2WBRA 3AA9A 4PWUA 4RW4A 1S9FA 3WC2A 2IJFA 4F8RA 1VIOA 2H48B 2Q6CA 4A8QA 2ASDA 4NLQA 4X2BA 5LSRA 2PDAA 4Z7CA 1YX2A 3RBXA 5KFJA 2CQPA 3UDEA 4MYTA 4MT1A 4MKBA 3I82A 2IM3A 2OUGA 1RZMA 3IR5B 2MJNA 1RUSA 4DU7A 1H2TZ 3I56S 1H98A 3ZZYA 2PMZD 3FMBA 2OAUA 3UQSA 2GX8A 2HGLA 3BQ0A 2UVWA 1HNWF 4DWIA 1VHFA 1E6YA 2BM0A 3EZUA 4QCLA 2DO0A 3PNIA 4IYQA 1FJCA 2KFZA 2FJAB 1SC4B 3J7YU 1HNIA 3KYLA 3TVZA 1VQMS 2NQPA 1N0VC 2ZEJA 2M2BA 3DU6A 2L9WA 4ZIVA 1RT3A 1ZETA 2C3UA 2MQ8A 2FDNA 3M8WA 3M9MB 2HFZA 3CT9A 5CYMA 1FFGB 3D3CJ 1IBLF 4DUYJ 4G6VB 4PXCA 4CLLA 3MM7B 5KFIA 3MPVA 4CYUA 3D54A 3NGRA 1KD1T 1F2GA 5KFUA 2V5HG 1UETA 1B99A 2KB2A 1I51B 4C6AA 4CT8A 5L1LA 3GWCA 1AB8A 1M5PC 2P2CB 2UVVA 4JI8F 1LWFA 4LF6F 3ETMA 1WF2A 4CNYA 2WVCA 3N6NA 1Q8IA 2HLUA 2F8MA 1N36F 1IKXA 2DGWA 2CJXB 3DLEA 2GHWA 1QUVA 2F7VA 5LOQA 5LSLA 2FHJD 4DR2J 1V6HA 3R5AA 3MM5A 2ADCA 3VAGA 2AEMA 4Y00A 2EFNA 1FXRA 5J2QB 1LQ9A 1TUGB 4ZDNA 3W7BA 2E7VA 2OEJA 2AJ4A 2HS3A 2BVZA 2JL9A 2WB1D 4UZCA 3TRGA 1RTJA 3ZC4A 2ZH2A 5L1JA 3CSKA 1N56A 1OY8A 1BLUA 1AROP 4XAKA 4KSEB 2QX0A 1Q5VA 2WCXA 3CE8A 3GONA 3IA0A 3JSYA 5KFRA 4X4QA 2AHOB 1ZYQA 2YKNA 5AE1A 3ENVA 3IG1B 2F4FA 1LK5A 1T9WA 4J9VA 4DPTA 2XULA 1XNRJ 3IBWA 2IRXA 4L6V3 4NA2A 3C14B 2FY1A 3ZZZA 4DZ6A 3QZ8A 1Q78A 2XSJB 1DTQB 3IGNA 5J1EA 2OMOA 3G6VA 3UD3P 2RJZA 4DI6A 2R2TA 1L5UA 3MFHA 1N5VA 1CJUA 3NAIA 3UWTA 4OYOA 4DFJA 1RT4A 1UEKA 2FLNA 1CSJA 1RWWB 2DK2A 2VASA 2EI5A 2LVWA 1JLGB 2NXCA 1NHUA 3M1VB 3ENWA 3QIPB 1VBKA 1DLOB 1FDNA 1JXVA 2R4FA 1RK8A 4U7UK 2EG2A 1UTAA 2QYCA 1KN6A 1SV5A 4XPCA 3VZIA 5KG2A 4YB6A 2CG8A 1HKAA 2IDEA 1PG5B 2OPPB 4FVCA 1NSQA 3K58A 4JV5J 2HRUA 1QLNA 4U6PA 2FLLA 1B0TA 3BJYA 5IT0A 2CJ9A 2HFNA 1GX5A 2OELA 3FZBA 1AZSA 3N9UC 2R8HA 1NJWA 1IKVA 3TQEA 5G0RA 1N5SA 2NXEA 2I38A 1CQMA 1P6TA 2OEMA 2XZWA 3POTA 3VHQA 2ZBIA 2WONB 1SL0A 5DJBA 3Q2TC 1TAQA 2K1RA 4DV5F 2FJDB 4CH0S 2IBOA 1S6QB 2VBWA 4QQBA 5AXKA 3NS6A 2UUBF 5B0EA 1WACA 4QR1A 3WX8A 3KUGA 1F6TA 1Q4RA 2PT0A 3HHDA 3HVRA 4M1KA 1C0TB 1TVRB 2L48A 3OXLA 1UZDA 3QBCA 4HHHA 1WSVA 4HDGA 2VBXA 4RPFA 4WFNQ 3KOAA 2OTJS 3E8OA 5KT3A 2XLKA 1NDKA 4MFBA 4X4SA 2HQCA 4JB8B 1KS2A 4OYIA 3QGHA 2KYXA 3LTOA 5EHHA 4DL6A 1NDCA 5LM7E 2PI5A 1SPBP 5DGBA 2E5JA 3CD7A 3TW0A 1PAEX 4I69A 2LQ9A 4ECSA 3BM7A 4P2FA 5K20B 2GVDA 2QL5B 3DM2A 2CRLA 2O01C 4WK1A 2UVRA 2VODA 1RWOB 1N5YB 2E5IA 1ZAXA 3MECA 4GO5X 3FKBA 1RTHA 4Y2CA 2W8KA 4C8KA 4L72B 3BQ1A 2V67A 4MIAA 3CGIA 1P8GA 3M6WA 3PACA 2EFQA 3PFEA 3BGRB 2IMWP 2GA7A 4LF1A 2OD6A 2RE1A 1L3SA 2VF3A 4QPXA 1TL5A 3J7AN 1LW2A 5IXUA 1YJTA 1SVDA 1T0TV 2EFOA 4MAKA 4UOHA 4QR0A 2LA6A 5DDOC 3KJVA 2FB0A 1GXLA 4USHA 2XS7A 4YHHJ 4A8YA 3CIZA 1WG1A 3UVJA 2DKOB 4FZVA 5I4MA 2HS4A 2EXUA 3M2VB 4A8FA 4DSKA 2MZTA 2NSBA 4N8NA 4O4GB 2MY7A 2M5YA 5KG0A 1K8AT 2R8GA 3QPIA 1FEHA 4FN5A 1RTIB 2VA3A 2LEAA 1R8HA 3Q22A 4DV3J 2YBVA 1NU4A 3MCNA 4B08A 4CH1A 2D3UA 2GC8A 2O1PA 3CDUA 4DOZA 3PEHA 5C25A 5E3AA 3MEEB 2YWGA 3CUNA 1U1NA 5FDLA 3LAMA 2JLFA 1HQUA 2WHOA 1EQ0A 2E66A 4LBIA 3ICLA 3KFWX 3SSQA 3PV8A 2W9CA 2ZHBA 5H9EJ 4Q0BA 1LWCB 2BJDA 5KFHA 2KXFA 2RQMA 2HFOA 1KVIA 2B56A 2BE2A 3GPAA 3R5JB 2CJKA 2DXDA 1UFKA 4RKUC 5THWA 4TYBA 3VGVA 5KT5A 2OLWA 4LFBJ 5EUHA 4BWJA 2NZCA 3V81A 4OJ3A 3IM9A 2F5GA 4CO2A 1X7VA 3KLGB 4QOTA 3HMJG 1NUEA 2ROPA 4HI1A 1H3DA 4ZLPA 5IT9Y 1XJWB 4K7QA 3DCAA 3L3CA 1E6VA 5C2GA 3BZQA 1B70B 1NPPA 2XMMA 5E0OA 2Y1IA 2IBKA 1H7XA 2Z58B 2YWWA 1NK5A 2I8EA 5DZ6A 4K5SA 1FO1A 2JLEA 1XC9A 4B9UA 3BN4A 4DQIA 3VQSA 4KKOB 1FRLA 4OX8A 3T6BA 1S5ZA 2G0JA 2ZWPA 4ZCKA 5IZHA 1HWKA 5J2MB 2BXJA 1VQ4S 4NXNJ 2N3OA 2J9CA 2L9DA 4USWA 3OL6A 2VA2A 4RBUA 2CQ0A 3DHWC 4JI0F 1MROA 1EIYB 3CJKA 1YK9A 1JLAA 1TKTA 4FXDA 1FKOA 1BWVA 4RW9B 4HL9A 1EAYC 4GO7X 4UUWA 4HR2A 2QG9B 1YGYA 4CWBA 2MQQA 3IR6B 1UKUA 1V9OA 3A13A 4M5KA 1TV6B 2HBZB 4JI0J 4BDPA 4UY8T 1UL3A 1HFEL 3P6YC 4M95A 3RBEA 2HNYA 5HQMA 5B0AA 1JKHA 5B08A 5FLXY 4BC9A 4C8ZA 3B78A 3H59A 3Q83A 2QIFA 5C2CA 4YY3J 3OR2B 3CCZA 1GXTA 3ILJA 5GMDA 1MWZA 2BE7D 4KO0B 1R31A 1RAIB 1VJWA 4HTJA 1N0UA 4DMZA 2YQ3A 1YSJA 4FXVA 2I5JB 4HT7A 1TK0A 1BQNA 1S49A 1S9GA 1OYEA 4HH1A 4DBQA 1HA1A 4LF9F 1T9TA 1W2IA 2MSTA 4YN3B 5F3ZA 2A10A 2FHMA 2DGQA 2CPDA 3QFHA 4WWSA 1B0PA 4ZPAA 4UUXA 2YQ1A 4RR5A 3FRZA 2B4VA 2ATLA 3N6MA 4N41A 4UQGA 4NCGB 1T95A 3VV2B 1FNMA 1VJQA 2VFRA 3QJJA 2HIQA 1SUQB 2ZVIA 3C8YA 4DQRA 2HGNA 3DYAB 3HXMA 5CYJA 1Y10A 1WKKA 2OKQA 2XCAA 4A8SA 4ICLA 4DUTA 2HMIB 2I9SA 4J9NA 1HBOA 5D15A 2MY8A 3NRBA 1DY3A 1OJ4A 2OPRA 3DRRA 3KLGA 2CXEA 4XTTA 4IG0B 1XBWA 2VICA 4NLSA 5ETNA 3CNQP 4GRSA 1FKPA 5F9LA 1VISA 5KFBA 3IRXA 1LFWA 3DLBA 2J6UA 2OMLA 4DF8A 1IN0A 4LRDA 4NYPA 1RAEB 2K3IA 1OY9A 4ITSA 1RBOB 2PE8A 3N28A 4DV4F 3OLBA 2OTLS 4ATNA 2HBYB 2CNNB 3CB4A 3C16B 3D3BJ 3DRSA 1NB2A 4O0NA 4PPDA 3NP5A 1D8ZA 1F2HA 1TL3A 3CULA 2W4DA 3MAAB 4ED0A 2UXBJ 1RXOB 4NEYA 3VZHA 1KNZA 4O3NA 4FPIA 3BSCA 4LSNB 2DJWA 6FDRA 2AJ1A 2NXUA 3D1HA 3HCXA 2W9BB 4F4XA 4TY9A 5HAOA 4CNZA 2J9DE 5HP1B 2R7QA 2LU2A 3MMBA 5IM0B 4AQYJ 2QA4S 1X4DA 2MLYA 4JYAJ 2ZVSA 1SBRA 1F0XA 1FVQA 4OI2A 3KK1A 5KFWA 5CYQB 1RACB 4KTQA 2B6AB 4P71A 4P2XA 1VRUB 5GAGU 5GAHU 1CPZA 3W5XA 1RT5B 4OLPA 1T8EA 1PYSB 4M5NA 4DPUA 4M94A 3L4BC 1IBLJ 3L09A 4XO0A 4DSEA 3DLGB 3CEDA 3IBFB 4C0OC 2OEKA 3PCOB 4GVBA 3I5AA 1SI9A 3W2WB 2W2NP 4TYAA 3OL7A 3D5MA 4ZJOA 4BWMA 2ZITA 3BSOA 3OFHA 2HHWA 4RWWA 5EDWA 1BHNA 3E01A 2AKWB 1MMNA 4YQWA 1BQMB 2M70A 4DPXA 1SJFA 3V6DB 2AP6A 1RWNB 4DS4A 1NK4A 4DV7F 4G1PA 2ZOGA 1TK5A 2E1MC 2PC6A 5DG9A 3LP2B 5E3CA 4Q44A 4DQSA 1RT1B 2OPSA 3V6JA 1IBMF 4I6WA 3TEGA 2FTRA 2VONA 1BXNA 3SBMA 3ISNC 1U49A 1EX8A 2APOA 1G6BA 2H3EB 3X1LB 4DZDA 5A0YB 4IRDA 2X1BA 3ILIA 3OT9A 1IBMJ 1FFWB 1FX4A 1ZM9A 3OXGA 4ELTA 2ZDPA 1I3OB 2MKIA 1NMEB 2ZH6A 1N32J 2QLXA 1XQIA 3CWJA 4HVZA 1TMMA 4ZVSB 3HLUA 3JB9k 2I1RA 2FLOA 2AYEA 2CNKB 5GAHI 2QL7B 1TUWA 1RHMB 5KG6A 4MYUA 3HFKA 2XMAA 1RT3B 2DNHA 2V34A 4ETZA 2B8QA 4CLUA 4EZ9A 2HWHA 2V4JA 1R8AA 3E3XA 1UAWA 4NLWA 3CO0P 5CYMB 2CPFA 1HQEA 2ZD1B 3O6QA 2MQOA 5D8HB 1T9YA 2V8PA 2MGZA 2R7WA 3MM7A 4GMKA 3L95X 2E44A 2ZKUA 3W5ZA 4C3KA 5C42A 2VPZB 1HNXJ 5BYQA 2FVSA 4J9LA 4OZ2A 3A12A 2NR0A 2CQ2A 2IJRA 4F67A 1M5SA 1Z4UA 4X62J 4I7FA 3Q8RB 5JMNA 3KK3B 1ZPWX 4WFXA 2FJXA 2KHDA 1EKSA 1MG7A 3ET6B 3KDOA 4F3MA 4XPEA 3LWMA 2BQUA 3TANA 3PDNA 5ETLA 2BW7A 5D4PA 2DHSA 3KLEA 4KAIA 1VBZA 3DLEB 3G71S 4ED8A 4K4ZA 1CULB 4WFBQ 4LR7A 4EBCA 1RBAA 2P9CA 2AT1B 3DXSX 3KLHA 2G1HA 5J2QA 4OHXA 2DIUA 1LK7A 3G96A 3S01A 1RI7A 1VQ5S 3CC2S 1VRTA 4DL3A 1UFLA 1YI2S 1T05A 5A2QY 2XS2A 4IH7A 2HW3A 2ALYB 4RNHA 3T5HA 2DB1A 5MLCV 4EFAC 3KNAA 3AB4B 2YPZA 5CQGA 2D7SA 4ECTA 1JLQA 1FEEA 3R5BA 2CPZA 4O3OA 5DZ7A 4HI2A 2UV8A 4X4VA 2YTCA 2BUNA 4WPAA 3RRGA 2JRSA 2JNJA 3KHGA 4U7UD 4F26A 3TJ9A 1KQFB 4AE5A 1PJ5A 3QFWA 4WKYA 4DF4A 4UOFA 1VMBA 1X4HA 2UV8G 4FYXB 4C7QA 3PW0A 1QAIA 3PKMA 2HYIB 5A6PA 3AD9C 3I32A 3W64A 5KFPA 1A7GE 4OQJA 1WD6A 1YKWA 4WYLA 3U02A 2CAJA 4P9SA 2P9EA 3VVUA 5CA5A 3TUZC 4DV3F 4ERDA 5FJ4A 1SV5B 3BO4A 4M5GA 4QIWD 5DG7A 2BEFA 4G3IA 2BE9B 1WORA 2M88A 3EXCX 5KFKA 1S48A 4R25A 4DR7J 2YKMB 3KNGA 4NMXA 2EFPA 1PAUB 2RAQA 3T3FA 1UJ4A 2YWKA 3GZ7A 1R8BA 4Y3CA 4OHZA 1H72C 1S1WB 4ECQA 1U25A 4DV0J 2HHQA 1HD0A 2KVQE 3GJSB 3T19A 4CM2A 5G0RB 4YR0A 1FDAA 1AT1B 1UPMB 3I0SA 2JOQA 4NASA 5D4OA 5IOLA 2WZ1A 1GMWD 3POTB 3PRVA 3SDEB 2GFFA 3KLIA 4LBPA 2IM2A 1VQ6S 2K1RB 2QA4G 1U0SA 3H2UB 2OGUA 3C3LA 3DRXA 4YR2A 3BYRA 2V68A 2VDHA 4FBUA 2JEGA 2MKSA 2GIQA 4O3PA 2NUHA 3MPDA 1V3ZA 3UDLA 2EEYA 2AX1A 3VAHA 4X4UA 3BBCA 2GGPA 2GS8A 4U9RA 4CO3A 4EU0A 4MFBB 3G4SS 5H9EK 3L9ZA 3N79A 1S76D 1QE1A 1D9DA 3WC0A 5IT4A 5GVQA 4Q8FA 4Q45A 5AXNA 4ILMA 2DITA 2O5DA 5F8HA 1S1XB 4DG1A 2MQPA 2BW2A 4DLGA 3K2YA 2H1YA 3FJ2A 3JSRA 2CFXA 1NRKA 5JXSA 3CDEA 5HANA 4KH1B 3DM2B 4YP3A 4RL1A 2ZE2A 4DR7F 3NGKA 3G6YA 3V5RA 1NKEA 1RTHB 3D6HB 2MYFA 4LF4J 3S1TA 3B6BA 2QN6B 3ZNJ1 3PIOQ 3IXQA 5DLGA 2PD1A 1TKXB 2LDIA 2V9KA 3VAKA 3QSIA 3THTA 5AT1B 1CG2A 2PO4A 3M2RB 3QYYA 1IBKJ 2F8HA 2KRBA 4X66J 2ZZMA 3GFXA 2D9PA 4Y28C 2LEBA 4OX9J 2QSFA 1SJ4P 1QSLA 1AXQA 2RRNA 4M5JA 4CH7A 1WC5A 4C3LA 2BM1A 2PEBA 3EMTA 2YNHB 3KJNB 1LXJA 2EFVA 4CLWA 1R0CB 2VV5A 4KYZA 5K8OA 1PILA 3GG0A 1S72S 1APSA 2W25A 4Z37A 3CMQA 4YFUA 1DARA 5KOXA 1R8CA 3EX7B 1REVB 2G2OA 2M9KA 1CS4B 1JLCB 5J2NA 1K1QA 4N56A 2J8AA 3G82A 2CQBA 1TL4A 2B9YA 2ILZA 4C48A 2GJ2A 2DNOA 2B4UA 1GQEA 1LWCA 1DRZA 2AF6A 3MR7A 1GXUA 2XHCA 4RW7B 2DHXA 1PYTA 4IFVA 1HHQA 4DCOB 5HL7Q 3HZEA 3SIPB 4CLYA 2JFDA 3T9ZA 4CLPA 4K4UA 4U8YA 1VLOA 4M5DB 2GIFA 3TO8A 3EDRB 3T1HJ 3NNCA 3ZZTA 4OZ5A 1CLFA 4NZ0A 4OV6A 1UWBB 2W2QP 1RISA 5K8PA 3JYTA 4DSIA 3DOMA 3HHLB 1R0AA 2CADA 2Y0BB 5KG1A 3NXZA 2M0GB 4PG5A 2RILA 2FVQA 4LF2A 1N36J 2OSRA 3R97A 1EQMA 5EX0A 1S0OA 4UY85 4OMFG 3MM6B 3O5TB 3D67A 4P6QA 4N5SA 4ED7A 1QAYA 2UU9J 4DR5F 2EKYA 2UUAF 4X64J 2FJEB 4JUZA 5B0BA 4WTOB 3MPUB 1Q7YT 3NMAA 1R0BG 2A2CA 1NZAA 2E9TA 3OTOJ 2C3PA 4WZMA 4HHJA 1N48A 4ELVA 2E9RX 4F02A 2J7KA 2DRDA 3GFZA 2LP4A 3KHHA 1TKTB 4LIRA 2Y1RI 3P96A 3C6UB 4OI4A 3UDCA 2UU9F 2UUAJ 3CJSA 4DUYF 4B9VA 1DZ5A 3R2DJ 3MM8A 2BX6A 1RT2B 1D9FA 2V8HA 4Q5VA 1TV6A 2DGOA 3PW5A 3TP2A 3MD3A 2IC3B 5KG5A 1JKHB 3DLHA 3SXLA 2M8HA 2ZBCA 1RT6A 1VFJA 1WEYA 1WKJA 2Z2ZA 3DLJA 1W2BR 1KFSA 4AD6A 3OR2A 2MKYA 1RHJB 3BR9A 2HNZB 3ISZA 3UCUP 2XMWA 1YHQS 3GR0A 3MF5A 5KAKA 4JI7F 4YOEA 4K4SA 1U1MA 2RHQB 3CD0A 5ETVA 1B3TA 4N76A 1XN9A 2RU9A 3HD2A 1BQNB 2RDJA 3NNHA 2PA8D 3QO9B 4PWDA 1RWVB 2MDAA 1O51A 2DGUA 2WK4A 4P2SA 4I56A 2CQCA 4NRTA 3TNVA 2GHVC 1FTCA 1S59A 2FD2A 3KUEA 1OYDA 4J90A 3W65A 3TX8A 2VG5A 1UP1A 3TOQA 4CT9A 3M6XA 3QWUA 4JYAF 3QRPA 1T9VA 2HVEA 2MB0B 2KT5A 3TA0A 4WU2A 2E9ZA 3AJ2A 4U8VA 3KHLA 1ZBTA 2YWHA 5KG3A 4JP8A 1SUQA 2AW0A 1PC4A 3OD2A 2MHNA 2X51A 4PG4A 4D3HA 2H5JB 1IR1A 1R3NA 1KFDA 1AUSL 2DO4A 3DYAA 4I0WA 4EZ6A 3I4HX 2AIRB 1C0UB 5ADZA 4FYDA 2I0XA 4N77A 4UZBA 2DNQA 3U1MA 2KN4A 2HNDA 2RDDA 2W01A 1RE1B 3O44A 3PTWA 1WDTA 4LSLB 4P74A 5K8MA 4PRFA 1EP4B 2JH3A 3DN9A 1QAJA 3KJQB 1UVIA 1KRPA 2AJ2A 2YPYA 1Q16B 4WU3A 3M4XA 2W24A 2BJ8A 1ZZFA 2Z0GA 1ICEB 2Y3YA 2R7VA 1NNDA 4RUHA 2ZBRA 1ZOTA 2BKPA 3DRYA 4F4YA 1RTDB 2IVYA 3UW1A 2XQCA 4JV0A 3TJAA 3J81j 4F50A 2Q66A 4RUAA 2L3MA 2DIVA 2VD3A 2XI3A 1TL1B 4C98A 5LT5A 2AWZA 3T1YF 2ILYA 4KFBA 5ETKA 4ELUA 3V4MA 3IRWP 4O0IA 4QYZK 1K1SA 1JK9B 4ZS6A 4ZVEA 4LRAA 3UNGC 2U1AA 1RAAB 2BACA 1C1BB 1U4BA 1R43A 4LSNA 1F60B 1QVGR 2UUBJ 2BQRA 2W2PP 3MCOA 3BV8A 2RUGA 5HP1A 2IMOA 4CLTA 2GVZA 2F40A 2VZ9A 3QT7A 4WBFA 5E3QA 4ANCA 4DCJB 2ZOMA 3CTRA 3J81U 2XLJA 4QIVA 1CBKA 3KK1B 1SJ3P 1TR0A 1K44A 2XSFA 4KGMA 3KMQA 1WC6A 2K7JA 2RD5C 4J9RA 2ZUAA 5I42A 2Z2MA 3GYXB 4XK8C 1QDUB 4KGVB 2ZH4A 2VKRA 3AD8C 4B3TF 4MIWA 1IR0A 4ID5A 4O4RA 2AYMA 3EYZA 5HJYA 5ETOA 4C0BA 4H4KC 2XMKA 3TVKA 2XY6A 1W7WA 5ETQA 2QLFB 2WVFA 3H98A 3ONQA 1WOSA 2K06A 3HVTB 1LNQA 5EWFA 1LKZA 1YWXA 4AFFA 3LQVA 5HO4A 3JTNA 1UMJA 3I5BA 1RU2A 4DV2F 3K8VA 1M1HA 3MR5A 2JC0A 1N6QA 2EK1A 3IAM9 5F8NA 1SIZA 2XNQA 4DX6A 4V19X 3ZZUA 4IDKB 2DGXA 8RUCA 3HVWA 4LF4F 3T1YJ 1UVNA 1HI1A 1RT7B 2VFTA 2MZQA 3BGLA 1RHUB 1VQPS 3DI6A 3AT1B 2JWNA 3LO3A 1HBUA 2V0NA 4ZPVR 3SCIE 4ZHRB 3HHEA 3GCWP 1AYEA 1LWEB 2V8VA 3P4UB 2RHSB 3LGNA 4FKXA 4NLXA 3SFGA 1I5OB 2GHPA 3EWGA 2L9NA 1Q53A 3I5CA 3AOAA 4RBVA 3W5YA 2JVRA 3CJRA 5KFXA 9RUBA 2EW9A 2RVJA 1FDDA 2XZDB 4ECYA 2DCLA 1T3OA 3HJVA 4KQZA 3OJUA 1ITPA 2CIMA 2U2FA 2HAFA 1F9HA 2NUUG 3QLHB 3IBCB 2HKEA 5FD1A 5T41A 5ITHA 1S1TA 3OJSA 3EUNA 2CJBA 2FUG9 1RGVA 2GNKA 1QM9A 2XZTB 5E7OB 4CO0A 2Y8YA 2OSQA 5B0CA 3KLFA 4MIBA 2XNRA 1KHVA 1X4GA 4Q8EA 1FXLA 2F9JA 3G8QA 2R8JA 1X60A 5LMNF 1IKWA 3MPYA 1M1KT 4O3QA 3FFIB 1JJHA 2COLA 2HFUA 4HT5A 2HHUA 2MGZB 1LW0B 3FK4A 3BQ2A 1B7FA 2XHWA 2QMWA 4M5LA 2D3ZA 3NOCA 5SUHA 4A8OA 3RB3A 2XWXA 4RU2A 2FJVA 4OI0A 3H2VE 4PEOA 4ZP9A 1KOHA 1SJRA 3IGVA 4PG8A 4HHUA 5DETA 4RNNA 3CCQS 1DTTB 4W98A 4FNIA 3GYNA 3HSJA 1UVLA 2J0SD 3J7A1 2YQ0A 2VDIA 2SXLA 3AOBA 1YITS 3TA1A 4LFAJ 5CZVA 3FSXA 4LFCF 4B3RJ 3QT8A 3ZZOA 1CULA 2BRLA 3V6HA 4B3MF 4ZP7A 3T1HF 1AFIA 1U8SA 2R2UA 1HNWJ 3OTEA 3QGGA 4ZVOB 1YRXA 3DKDA 3JXOA 5CCLA 1FXDA 2XMJA 3HKZD 1J5EF 3OR1A 2ZZTA 2H9ZA 1DAXA 1GMWA 4CLKA 7FD1A 4EEYA 2ZJRQ 2H4YB 2KDOA 4P7TA 2BJ7A 1R27B 2VQEJ 1H74A 5CHCB 4K4YA 2BR0A 2M52A 2ACYA 2WB4A 1F1BB 4YB7A 3TAMB 3MFIA 3Q23A 1Z2LA 4ZN1A 4RWXA 1CEZA 3OUYB 1IR2A 1WHVA 2VG6A 2GJFA 2I2YA 4LF7F 4L75A 5CXTA 2HQDA 3EGNA 3PEJA 3QSYB 5FIIA 2UVUA 3D7SB 4B17A 2VQEF 4A8KA 2JC1A 5D3GB 2DRAA 2CZ9A 4H4OA 4NOHA 3TARA 1S1UA 2FPHX 3LUYA 1BMQB 2QA2A 3A3OB 4USTA 4W4MA 5E3RA 4JI6J 2KZMA 4WZQA 1LFPA 2ZC3A 5KFFA 4KB7A 3CJ2A 3ZXWA 2C28A 1P9YA 1RCXB 3HFVA 1BY9A 4OHWA 2CQHA 1ZA1B 5LL6d 5H9FJ 2DT9A 2XG8A 3SQGA 3F41A 3ILOA 4CLSA 1OPIA 1TZ0A 1N5TA 1EETA 3LP1A 4I67A 5A8KB 2C2RA 1OS5A 1WC1A 1U02A 1S97A 3NCRA 3OTDA 1BC6A 2IVMA 3UE2A 2WVEA 1S1WA 4ZVGA 1MSWD 1SXLA 3DMJB 2HQGA 3HJFA 3H5UA 3PYEA 2D9OA 2NREA 2WW4A 4P75A 2RH3A 2RRBA 1WC3A 1O8BA 3J80Y 2WVBA 3G9CA 1YZ6A 1WJ9A 5C5JA 2ZBQA 2HHSA 4OJGA 3CCWA 3VR1A 2HWIA 2VG7A 3AFGA 5GADI 5M2PA 4J37A 1VBYA 4TY8A 1E6YB 2HK3A 5I3QA 3DNCA 4KE5A 1NEEA 2QLJB 3AAWB 3R1HA 1YJWS 4ED5A 4WP9A 1QE1B 3D66A 3MR6A 2ZH8A 4U96A 2V4QA 4FKYA 3RW7A 2XGPA 4DUZJ 2LQ5A 1VQKS 3QGIA 2AJ0A 2CNLB 4JV2A 1WC4A 2H5IB 1RSCA 2DNMA 4G1QA 2E7WA 2LDYA 4E2FB 3PO4A 3RRHA 4C3MA 4WYWA 4HKQA 4LFBF 3UD4P 3KXDA 3UN2A 1MW7A 1NM2A 3IMQJ 3HHLD 1NAQA 3W3SA 4AXJA 4PZVA 4CYUB 2BRKA 2XWYA 3D9BA 3HHKA 1F3VA 2FC8A 3CC4S 3DLLQ 2F1FA 5IQ6A 1I94F 2DEIA 3DLKA 2QL9B 1X4BA 1LWFB 3J81Y 3UO0A 2IRUA 1VC5A 1HWLA 3LALA 2VPXB 2KL8A 4PXDA 4U95A 1KP6A 1WI6A 2MKKA 2H51B 3LPEA 4KHRA 3CDAA 4OIXA 3SZ2A 3Q8SB 2EBGA 3M8YA 3RAMA 1NXIA 3MTKA 4DS5A 4ECRA 4NLGA 2VJVA 2OI2A 1FFSB 5LXYA 4PPZA 2X1GA 3H4BA 2XY7A 4NCBA 4JBCA 2BA9A 3GU0A 5DS7A 5HLFA 4JI2J 1QTNB 2LXIA 3MEGB 1T02A 3HK2A 2B8PA 4FYVB 3LH2S 1MU2A 1AFJA 4R0EA 1ZTTA 1HNZJ 2O3DA 3PJXA 4OYPA 2DH8A 1IVZA 1KVKA 3VAMA 1OQ6A 3PRBA 5KG4A 3IG1A 4DSLA 2MMYA 4F4KA 1P9QC 2PSZA 5A2QU 3UPFA 2LKZA 4DV6F 4EI2A 3C14A 3QRRA 2WRMA 3I87A 2IVFB 4ER8A 1WHWA 4ED2A 2MLZA 4NL5A 5ETRA 1F5CA 3C2PA 3O1LA 4QJVA 1CJUB 3ILLA 1S6OA 2A1BA 3CCMS 3HSGA 4J9MA 3RAQA 1PJ7A 4USMA 2FGCA 5IFMA 4DLEA 1SKRA 1WEZA 4Y2AA 2POKA 2VU5A 3HX9A 3M1VA 1TKDA 3PFOA 4N47A 3SCJE 3RR8A 4LFCJ 1NK8A 2GQ2A 1S4EA 4DPOA 2WSFC 1N4LA 2B5JB 2VFSA 1WHXA 2FC9A 3P8BB 1U6FA 5KFQA 4X4RA 1HW9A 4CO4A 3GIKA 1PGZA 2KFNA 1VR6A 3KKFA 1KR4A 3A8JA 3AJ1A 3LAKA 4OLOA 4F0MA 1UA0A 2BOPA 2RT3A 1B64A 1XMOF 1UWBA 3GILA 4ZLLA 3IWXA 4DX5A 2QTWA 3TJ8A 4DR4F 4L73A 3KMSA 1N34F 4RW8A 4DR6J 4RNMA 1JJCB 3MI7X 2C3OA 4DPYA 3SI8A 4CI0B 2B9WA 1Q8LA 1IBCB 2C22A 4HDHA 3RJMB 4WE1A 1C0TA 1TVRA 2HHHJ 4RNFA 2C3MA 2OO4A 3V2UC 3MEDA 4MMOA 5HSPA 3SYZA 4LF5F 4C8YA 2QC3A 3R7NB 5LXRA 4DFMA 2MJUA 2Y1LB 3BYPA 4TU8A 2HAIA 1RAOA 1Y5LB 4JI4J 3MM8B 2UXCF 2UXDF 3G87A 2DR6A 1Z2ZA 1S6PB 1HWIA 8ATCB 4ZLJA 5L1IA 3F44A 1QSSA 3PHTA 2XTJP 3I0RB 1Y9OA 1MN9A 2QMXA 1RT6B 1NK7A 1DURA 2V2ZA 2J0QD 1RU1A 2FJBB 4L3NA 2MKCA 1MLAA 1PYOB 3FQKA 3MECB 5DDPC 2HSEB 1WC0A 3M6UA 2QLWA 3DHXA 4OV1A 1JLBB 3WX4A 1Q8KA 1DHMA 1HR0J 4FF1A 4LIWA 4A8XA 3W61A 3WBZA 3S6EA 3GE9A 4RW6A 4DU8A 2MQLA 4PUOA 4PWDB 2C2NA 3M2UB 4MK9A 3PX0A 2YVSA 4PQUA 3JQJA 1GMVA 3IM8A 1UVMA 1ULRA 5E2QA 1H2VZ 3BGUA 1RAFB 3R6LB 2GV1A 3L7UA 2FIUA 3R5GA 4F7VA 5HQLA 1NO8A 3H7HB 3KJVB 1FRJA 3KG1A 4DDFA 3D28A 2XB2D 3I96A 5IT9U 1BUXA 2CQIA 3TZWA 2LU1A 4EUVA 2MZRA 2BMBA 1SKSA 4K4TA 4BLGA 3BSAA 3P45B 5K14A 4DV1F 2IM1A 4KHPJ 3QQCD 4I64A 4NZ6A 4AT1B 4AUKA 1V5VA 4MH8A 2VC0A 4Q7AA 4DL2A 1SJQA 2DH7A 5JUMA 3LF0A 5J2NB 1IM4A 3GR1A 3ITHB 1C0UA 3UI3A 2DXEA 4WP8A 1R6VA 2OD4A 5U47A 4CO1A 4J9KA 3MOJB 3JSMB 1CC7A 1SKUB 4OZJA 5FDLB 5KT6A 2JEFA 1V3SA 3ENQA 4RUCA 2W9CB 2L08A 3PX4A 3IN5A 5L9NA 1W25A 2Z8QA 4M5HA 3LOUA 5KFOA 4FS1A 2H65B 3D2WA 1QJHA 4ZPBA 2G2ZA 4ES2A 2CG4A 4NYOA 5L46A 2AX0A 3V6KA 1A9NB 5HK4A 5D0RA 3H20A 2P9GA 4NLRA 5E5NA 4RUBA 3MEKA 2JX2A 4S0MA 1TL1A 1VQOS 2XMVA 3FGVA 5EWGA 1HPZA 4KPYA 4KFBB 1YVFA 2GW8A 4K4WA 2YNIA 4NLOA 3PKYA 4ZVQB 4FF4A 2A2DA 3FDSA 1Q79A 2DHGA 3WIVA 1MWQA 1W26A 4P73A 4DL5A 1YBUA 4H4MB 1LV5A 3LANA 3RRKA 4LT6A 3F73A 1GAOA 3UDVA 4KKOA 4KH0B 4LF9J 5FLXU 3G6XA 1VCTA 2GVZB 2QLBB 3DU5A 4LR9A 2IPOB 3PIPQ 2VBYA 5J2MA 2EPIA 2VH7A 2ZH1A 1EZZB 4DR1J 3Q86A 4RO0A 1FX2A 5I42B 2BABA 4MJKA 1FJ7A 1FRMA 2AD9A 1TUVA 2J8SA 3PVXA 2B0GA 3ZTPA 4Y2KA 1KQKA 2P6SA 3ADAC 1FRIA 1YJVA 5L39A 2Y9HA 1JLAB 2LQ8A 1X8DA 4F04B 5LMNJ 1HBMA 4P52A 4KIAA 3RUBL 2R8IA 2V94A 3FEYB 4RW9A 2W7PA 1TK8A 2DGTA 1QTMA 3KG0A 3HVTA 3PW4A 3MR3A 2LCWA 2A0FB 4LVOP 4ZPCA 4X65J 4ED3A 1VQLS 4E98A 1UWAA 3PYFA 1SH3A 2DHHA 3ISND 4JI1J 4R5PB 5B7WA 2HQFA 2V8DA 4USVA 3VF0B 1M1GA 3JAMU 1RT7A 1B7YB 4KO0A 3ZTSA 4B3MJ 2IY5B 4NPOA 1EARA 5B0DA 3AD7C 3DI6B 1PIEA 4ZP8A 3M05A 4KRWA 2FHJA 3H5SA 1HBUB 2VUGA 3NS7B 2AYGA 1GFWB 2N4DA 5GMEA 3WIUA 4K4XA 4ZHRA 3GIMA 2EKNA 2KM8C 2VPWB 1C1CA 3T5KA 5B0FA 4PCQA 3HT3A 1U1RA 1Q86T 4M8LA 2E1PA 1Q1KA 1XTZA 1P1TA 1S9EA 1I6JA 3MD1A 2RRAA 3NG8A 3SMZA 2FGOA 3NEKA 5KFLA 4HEA9 3A8KA 3IS9A 4NCGA 3W60A 3BGOP 2VFVA 2HHXA 1JMTA 3U1LA 2DXFA 1RHKB 4PYDA 3DOLA 1IKWB 3KWMA 4A48A 4ECXA 1U2CA 2QA1A 2HS0A 4YB1P 2HMIA 2LXFA 4ICLB 3T5LA 2RU3A 4JI5J 4DV7J 5CCMA 4JI7J 1XR6A 1H7WA 3KHRA 4LQ3A 2FHOB 3F56A 3RYLA 3TZXA 1SL2A 2F4VF 1RWUA 4IKAA 4LRBA 3U1NA 5HVGA 4DX7A 5DDRC 4YR3A 4IG0A 5KT7A 3LP0B 4DUZF 2LMIA 1WTFA 2E1CA 4JI1F 1PKUA 4LSZB 4QWBA 3TA2A 3UR3C 1DQAA 1FKPB 2DNLA 1DTTA 3R27A 2GO9A 2AZ1A 3ELHA 2XO6A 4ED6A 3VAFA 4WFZA 1XMQJ 1NHKL 1TU0B 3Q24A 1N32F 2B7CB 3T1AA 2YNGA 5CD4H 1MN7A 1ELOA 3NLCA 1XEZA 2EBEA 1YJUA 3BEGB 3C16A 3DRSB 2H4WB 2R7RA 3QJLA 5IWAJ 2KJVA 2AGPA 1FD2A 1ROFA 3MAAA 4K8RA 3SEOA 2JVOA 2DGSA 4BC7A 1XR7A 2HFVA 3JQKA 3WDOA 3OSPA 4AQYF 3C66A 4PXBA 4Q43A 1XNQF 4QIFA 5B0GA 1SQGA 2JHEA 3OPKA 2X3DA 3A1YG 4OFZA 1SIWB 4ZKAA 2R42A 1RWKB 3MMBB 5IM0A 2O66A 2N7CA 2V69A 2IJNA 4R0JA 5IC4B 1KSPA 2XLIA 3F0NA 1ZS6A 4CZCA 4O3RA 2VG6B 1FDBA 1HMVA 3KDNA 5CYQA 2HQ3A 1CJTB 1FRKA 2Z2YB 5IS2A 2CQ1A 3BF4A 4KV8B 2C2OB 4CO5A 5AJ3F 4ECZA 4IR1A 1U26A 3BR8A 3H40A 1KKHA 1Y00A 3TUPA 2DCUB 1HNZF 4F2RA 5BYSA 4DFKA 1FWLA 4DJBA 1S1UB 2OPQB 2UUCJ 3FC9A 3QGPA 2IDLA 2Z57B 3B4MA 3P5TL 2GMJA 4LF8J 3W2VB 4FYYB 3FMWA 1EETB 1J5OA 1IJEB 1KTVA 1CJVB 2PI4A 1R6YA 4LRFA 2PEHA 2C2EA 4F36A 1AUDA 2B3TB 3D1QA 4J91A 1OPZA 2J7UA 1UVKA 3OFGA 1S7IA 3G8SA 4IRKA 4DQPA 3CCTA 1RT1A 2OPSB 2NPFA 1RLDA 2ZHAA 3CF5Q 5AE2A 3HSDA 1WOPA 2P6TA 2P8IA 3DMJA 3JQMA 4ECWA 3M8SA 3BBBA 4KBIA 4G65A 3B82A 1NH7A 3SV3A 2VJUA 1D9AA 3HPOA 1ZAWA 3H2LA 1FRXA 5KFGA 2G1DA 2CNOB 6FD1A 1RCOB 4YMEA 5A0YA 1S57A 3G2XA 5L9XA 6AT1B 1FNXH 4K5RA 5E41A 1B0VA 1NJXA 2MQNA 3M6VA 2DR7A 1XIQA 4WFAQ 1KLMA 4NMLA 2AQ4A 1SC1B 2HZAA 4FBTA 2XMUA 4NXNF 3N5FA 2ASJA 2AJFE 5A8RB 1NJYA 5KFSA 1TL7B 1WEXA 2YH0A 3IR7B 4GVLA 1U1OA 5GADU 4ZVPB 5SZTA 3MMAB 4B9MA 3OW2R 2KXNB 3SCLE 2AU0A 3FNNA 1NSKL 2QJ3A 4D3GA 5H1SV 1HLWA 1JNRB 3EGVA 1FTRA 4G1QB 4EBEA 2AYBA 1U0HA 2BV3A 2C42A 2HK2A 2DISA 2NCKL 2V4JB 4IG3B 4LRCA 3FSIA 1ZAVA 3CCJS 3EZ5A 1HQEB 2ZD1A 3QRQA 1U6ZA 3QT6A 1QUPA 5A8WB 4ZLNA 5C42B 1M5HA 3AY0A 3DRPA 2EC2A 1U47A 1FF2A 2UXDJ 2IAJA 4ZVTB 2JDJA 1D1UA 3HT0A 3G6ES 3DLKB 1VQSA 1UFWA 3W62A 3GFYA 3RGIA 5IV4A 3PX6A 3ET6A 1FERA 1VIXA 2H5EA 2HHTA 2MZ1A 5T7LA 4GKKF 1VRQC 5E33A 4EGLA 2C3YA 2IYGA 1WDDA 4KY3A 1NLKL 2CWXA 3UCGA 4CLFA 3GCXP 3TZZA 3KLHB 3K59A 2E29A 5HATA 2DPIA 1G3OA 3FRYA 4ENOA 4IQXA 4OX9F 4HYKA 3OTOF 3MEGA 2GAGC 3HULA 2V63A 1F5BA 1MU2B 4HTIA 2RF2A 2I6WA 1U6BA 2KXHA 3L7OA 2E1AA 4ANDA 4ZK7M 4K0KF 3EJMA 4UOCA 4TXSA 2J5AA 1XR5A 1K0TA 1GTEA 1VGYA 2Z30B 4L3KA 1JQGA 5LJ5Y 5DM7Q 2VOPA 4GKJF 3MMJA 4CRJA 3PYDA 2UUTA 3MUVP 4DV1J 3PZPA 5F41A 2NZ4A 2ZNYA 4XIUA 1I94J 1S4FA 4NI2A 3I6PA 3TAPA 5HMYA 1NKCA 4W92B 5IC6B 1Y7PA 1Y5IB 2BANA 2B51A 3GIIA 1N52B 4QZVB 1PBUA 3H25A 1WG5A 2DPJA 3PG9A 2E5LF 2L41A 1PBAA 2B5JA 2J0XA 2LQJA 3R9LA 1Q82T 2QYGA 2DTJA 2YKMA 1AW0A 2GZOA 2HZCA 2IA0A 2BZ2A 3EZOA 1N54B 3GP9A 1FESA 2B9EA 2W4PA 3D6TB 1K73T 2XM3A 1GK8A 1KBRA 2GMHA 4LR8A 4HLBA 2EK6A 5DRKA 1V5IB 5F8LA 5I3PA 1X9MA 1RTJB 1D0EA 2MPUA 3SDEA 1BD6A 1RYRA 3H4DA 3R5DA 2ZHOA 3MGJA 4K59A 4RW8B 3MM9A 5I3UB 1OY6A 3D68A 4X4TA 1VLYA 1XNQJ 2VOOA 3GV8B 2YKNB 1GTHA 2PIIA 4A8MP 1Q0NA 4I2PA 3CW2C 4DR5J 4K0KJ 3MEDB 2XSJA 5J1EB 5KG7A 4ED1A 3PRDA 4NZ7A 3QZ7A 2Z2LA 3GSIA 1TQLA 4KHMA 2R7SA 3SQOP 2EVZA 2HHHF 2C2KB 5H9FK 3W9IA 1RAHB 3VAJA 3M8RA 1S6PA 3QIPA 2FJWA 2HIYA 2KU7A 3PR4A 1S1XA 4DG1B 4E0DA 2ATCB 3JS9A 3N6LA 1X5TA 4USUA 4TVAB 2DR5A 3M9NB 4RLEA 2OPPA 5KFVA 3NL0A 3GV7B 2BQ3A 1WELA 2HBQB 2ZE2B 2CQ4A 3BPDA 2AMCB 2YXLA 1GEHA 1VQYA 3H42A 3ENAA 5B09A 1XMOJ 1NB7A 2V9WA 2R7TA 1AZSB 1TKXA 2MZJA 1OIAA 3M8QB 1H6KX 1I1GA 2MEWA 4CQ1A 1FK9B 4WP3A 5D0EA 4OX6A 3Q8YA 2WONA 4PQUB 4ZA1A 1XMBA 1RQ0A 3RAXA 1S0MA 1HI8A 2JZ5A 1S6QA 4JI3F 4GC7A 2J7WA 3OVAA 4EO8A 3P49B 2YH1A 4W90B 5HQ8A 4OYXA 1SH0A 1CJKA 5F0UA 3TZYA 1F3FA 3LW5C 4YEAA 5C7PA 2YNHA 2MKJA 1K0VA 5KFDA 1UJ6A 5K14B 2BYCA 5IQQA 4LF7J 1NJIT 2G4BA 4B9NA 5IV3A 1S0VA 3OTBA 2CVIA 1L3KA 1REVA 2DY1A 2JSXA 4A46A 1TP7A 1CS4A 2CA9A 1OSDA 3D0GE 3CO9A 1WKLA 3OTCA 5ETMA 4E8UA 4IFYA 3BO2A 3G82B 4Q2MA 2HRTA 1FNOA 4DEZA 3JSMA 2GVDB 4JV5F 1KQSR 2B9XA 1ZTWA 2RS8A 2K3KA 2CWKA 3H90A 4C8MA 3ZZRA 1A0OB 4QYRA 3CCLS 2RS2A 1IJFB 1PCAA 2ZJQQ 3DFEA 3MUTP 2V2KA 4CP5A 2RQKA 2WVDA 5GAEU 4MKAA 4HH0A 3BGRA 4NA3A 5IWAF 1UEVA 1YDLA 7FDRA 2BJ3A 4I2QB 4ANEA 5DDQC 4DSFA 2D1CA 1NKBA 3HF5A 1Y0HA 3NY0A 1VHIA 3T6JA 4QIEA 3AHPA 3C15A 4M5DA 4DR4J 2JEJA 2CPYA 3BO3A 4B3SJ 1RHRB 3LPYA 2YNIB 5KFTA 5GAGI 4RZRA 1NCLA 3K5PA 3RG6A 2R8KA 1NSAA 3UVJB 3OHAA 4YHHF 3Q0AA 4ETXA 3NBPA 1YJNS 4H4MA 3R8YA 2X1FA 3DOMB 3HHLA 4O4GA 3PO5A 1M5KC 4I68A 5ETSA 4DXLA 2EG1A 2W7OA 4OI1A 3ZO7A 3K5NA 2OIHA 1RTIA 3NGTA 3U7JA 2KHCA 2HWTA 3MM6A 3QATA 2R7OA 3CCVS 3J7ZT 1DQ8A 2LECA 3V4IA 1TAUA 4DV5J 1NSPA 1S6UA 2QE5A 2N7YA 2KG0A 5DO2A 5C25B 4WK3A 3E2EA 3Q89A 4PWWA 1NDLA 1KLNA 1HQUB 2Q1LA 4PG7A 1JIHA 2IYIA 2WOMA 1HBMB 5KFCA 4IOAQ 2YX4A 2WBMA 4I6YA 2RQCA 4EYHB 3K8WA 1H2UX 2J0WA 2BE2B 2HHPA 5HI7A 5K8NA 2R2SA 1SCJB 3AQPA 2RQ4A 3K5OA 3C6TA 2IC3A 3US5A 5LMUJ 4LBHA 4DFPA 3D6MB 2B7BB 3AQOA 2MLXA 2BKNA 4QU6A 2OHDA 3OL9A 5F3TA 4R5PA 1BWEA 2X1AA 1QVFR 2IHR1 4M63A 1WF1A 1X5OA 3FBEA 4IQMA 1YRUA 3DOKA 5EX3A 1E6VB 1T94A 2XYPB 3QAUA 3I55S 1J5EJ 2QV6A 4OI3A 5KFYA 4C2MA 3D0IE 4C11B 4JI6F 4UOGA 2KYZA 4LUBA 4NYZA 2CZVC 2M4MA 4P72A 1FCAA 3O2IA 1IKYA 3ZFVA 3EM1A 5KFNA 1SJ1A 3NKYA 1C1CB 1Z1ZA 1FA0A 4NLDA 4C97A 4DR2F 4LF5J 1X5SA 2BJ1A 2Y8WA 2UXBF 3H5YA 2G2YA 4G1IA 3G86A 1RDRA 3BREA 1MROB 1UJ5A 3B54A 3IWNC 4PXEA 5AE3A 3G8TA 2PA3A 2FQQB 2VFUA 2W2OP 3BBFA 4QR2A 4ZOSA 3Q2SC 3MMCB 1FKOB 1D3WA 1SC3B 5HROB 2DGVA 3MDFA 4NRUA 1M5VC 3A8IA 3J7Z5 3GIJA 4GKJJ 2PMWA 2ZH5A 1Y11A 3M32B 3DOLB 3TR5A 4USJC 4AL6A 1EB0A 3FCWA 4PG6A 2ZBPA 4ZCMA 2CZ4A 2J9EA 3KK2B 2YX1A 1C4AA 2AV5A 1N8RT 2NSCA 1OSCA 2HNDB 7AT1B 2V4RA 3HVAA 4KGZB 5JVHQ 4TQRA 1EP4A 1FT8A 3Q8VA 1FKAF 1UZHA 1HWUA 2FHKA 3K17A 2RKIA 2GJIA 4ID8A 3BDEA 3GIRA 1GT8A 3ETOA 2F4VJ 2ZC4A 2I5JA 3R6GB 3NS5A 4ZPDA 5DQGA 2VBZA 1S9GB 2CVEA 3R5CA 5L8RC 4MK8A 4MKVA 4O3SA 1RTDA 4B3RF 3UNYA 3W9JA 1M0SA 2W2MP 4AL5A 1YZ7A 2J6TA 1SC6A 2QZ8A 3ZZPA 1JXEA 2M8DB 5D77A 4F4WA 4ZCIA 4NA1A 1KQGB 2GO8A 4CDIA 1Y5NB 2CPHA 1WSRA 1HIYA 2M7SA 4NLVA 1REGX 2G0CA 4CLZA 3OSNA 4K4VA 4WTYA 2QFJA 1G4CA 5KFZA 3EICA 2N4CA 3FVYA 3U27A 3ZNUA 5MAOA 3H0PA 1M5OC 2YY3A 2NXNA 3PHEA 3VVTA 3NWGA 4JI2F 1U1LA 4CTAA 4I1TA 4J7CA 4DR1F 5HROA 4JI5F 5JVGQ 3M30A 2YKAA 1YQHA 4KV8A 2J76E 1RTZA 4IRCA 1IQTA 5HMXA 1Y3KA 3CJQA 4YY3F 3N5BA 2OPRB 3DRRB 3EVWA 3N01A 5HBMB 5F8MA 4LF6J 4ID5B 4Y6IA 2ZM6J 1U1PA 5DLFA 4Y2IA 1NPRA 5J2PA 2FY8A 3UD5A 2IM0A 3IWLA 4WIIA 2AGOA 4LFAF 4KC5A 3W2VA 4UT4A 1KTQA 1KHWA 2XYHB 1FD8A 4OYZA 1X4FA 4FF2A 1URNA 1N6QB 1T9XA 3UN3A 1MWYA 3S8SA 4UTGA 4JOUA 3CIMA 4IDKA 3AH6A 1TKZB 2DY9A 2NS1B 4TLRA 4B3TJ 4KT0C 4OJHA 4EBDA 2DBBA 1HD1A 3W8GA 4WIQA 1JLEA 1ZH5A 4BBYA 4DL0C 3EPIA 2A18A 1NK6A 2ZH9A 2B4OA 1HW8A 2IRYA 2NYIA 1LWEA 2F65A 4O44A 3NCQA 3TWZA 4F0KA 1FJGJ 2LXUA 4KPCA 3RR7A 5F8IA 3BN7A 3I9V9 5EWEA 4KJIA 2CJQA 3DDIA 3GFHA 1KLMB 1VRUA 3MCSA 1RT5A 4N7TA 4CIOA 2HGMA 2FZCB 2Q3PA 5A8RA 5RUBA 1H73A 1S1TB 4J9SA 1D09B 2CYYA 3LA0A 3M8PB 2ERRA 3R3TA 3DLGA 4MK7A 4GVBB 3FCVA 3OVBA 4K2XA 3UFCX 2YKPA 3SV4A 1U0HB 1HL6A 4OYWA 2XCPA 4J9OA 3M9OB 2HBRB 1YIJS 3FFIA 4HACB 3VCDA 1VQNS 1X31C 4J9UE 3IAS9 5J1NA 5A8WA 1BQMA 1KOOA 2Q6BA 3V6DA 3GSDA 4ZVFA 1VQ8S 1G7CB 4OZNA 1X4AA 5E3PA 3VQTA 4JV1A 3LP2A 2GCFA 4X84A 2E1RA 3HI9A 2BJEA 3BGFA 5EGYA 3CD6S 1PC5A 3VGUA 2B43A 4WF9Q 4ALZA 3M8ZA 1IWGA 2PGCA 2B4PA 2KJWA 1T11A 1U1KA 2LA4A 1WWHA 1RAJA 1Q5YA 1PSDA 2CPJA 5T7LB 4ZVHA 1KC8T 4TU9A 3HZGA 1Q7LB 2Q79A 5D0HA 5HN0A 2XS5A 2Q43A 1FJEB 2XYGB 4LQ9A 2ASLA 1GH8A 3R7SB 4OZ3A 1TTHB 1X5PA 3OR1B 2DH9A 2X7IA 4WFYA 3H5XA 3RU0A 5GMKa 3ZTOA 3Q8QB 3OFFA 4NX9A 2RF2B 4ILRA 4EWTA 3CD5A 1F9EB 4R8UB 1KEKA 2DYAA 2JLGA 1L3TA 2OFHX 1WI8A 1RWXB 3SFUA 2Z56B 4KGKA 3CCES 5DQIA 3TAMA 2YNFB 4OYBA 2K8GA 1OO0B 3SCKE 1C4CA 5KTQA 2ZUGA 3OUYA 1NK0A 1CVJA 4C8NA 2RMLA 1XERA 2CJAA 3VGTA 3RTVA 4B02A 4QWCA 5AJ3J 1HBNB 1HYSB 1OQ3A 5BR8J 3BB5A 1PO6A 1U48A 2CDRB 2GAHC 4H4OB 4NI2B 4ZPTR 2XY5A 1U2FA 3RBDA 5EN1A 2NLWA 4F3OA 2FZGB 1RAGB 4Y34A 5D78A 3MPWA 2BANB 1ZM4A 3BH7B 1FWPA 2RIJA 3DGPA 4I7FB 3J80U 3KK3A 1G2EA 4K2JA 4OJ1A 2ZDOA 3IC1A 3GTYX 3D1OA 2Y1JA 2QT7A 3SQGB 3VAIA 3MOZA 4L76A 1NPKA 3FBCA 5A8KA 5CZXA 3KLEB 3MR2A 3FZ2A 3BKTA 4IH5A 3HM9A 2ZZNA 2ZOFA 1S99A 1U2RA 3NAHA 4KR0B 3OHBA 4EK2A 5C24A 2XC9A 2RNEA 3QNWB 2KH9A 5CAAA 5D4NA 3CPWR 1N88A 1WHYA 3CXCR 1YTYA 4YB5A 1CQNA 3QJPA 3GJTB 5K9FA 1DQ9A 1ZPVA 1JXLA 1JWWA 1T05B 1VRTB 5HMZA 1T03B 4WKRA 4P2MA 2KG1A 1T7PA 3M7VA 3O8WA 3GG1A 2G13A 2HVDA 2CPEA 3OQ2A 5I3UA 1U8WA 2YKOA 2YWEA 3MM9B 1IUJA 3A4TA 4QPTA 3AB2B 1Q8BA 4F2SA 2BKOA 3NGUA 3OXFA 1HNVA 2C1EB 4DR6F 4B9TA 1JLQB 4NLPA 1O6XA 4XDDA 5M2RA 4I2PB 4NLYA 2VG7B 1EKRA 2KO1A 4BCAA 4TY8B 3CCUS 1SQFA 1S1VB 3TUIC 1YG0A 2UXCJ 4U7CA 3BKFA 8AT1B 1S79A 2CPXA 4USIA 1IWAA 4ZMMA 3NNAA 3K0JA 4RBTA 4NE9C 2HG4A 4ZJLA 1FRHA 3IO1A 1T9UA 3FSYA 5F8GA 4Y0FA 4ECUA 5HVHA 1NZ8A 3MHYA 3TAQA 1JLFB 1RA6A 3TEHB 1QD1A 2MKHA 4GC6A 3L7PA 4DN9A 4DV2J 2ZNZA 2OH2A 4J5OA 3TYTA 4PR6A 1S7HA 2UUWA 4OX7A 4RW4B 3KLVA
chains in the Genus database with same CATH topology
5LJ3Y 1JB0C 2QSWA 3M8QA 3MWBA 3PM9A 4URQU 4WCEQ 3I0SB 1MMDA 3SSSA 2FVCA 1FK9A 2KTQA 3KLIB 5KOWA 2W7AA 4YUDA 3HP6A 2RB7A 4ES3A 2AGQA 4IUFA 2N82B 4XDCA 2DD8S 4F3QA 3T5JA 1U45A 2F9DA 1X9WA 2Z4PA 3BS9A 3RB4A 2CQ3A 3FEZA 4LJMA 3C46A 5HLFB 1WG4A 2GGPB 2IFXA 4NXMF 4J9QA 4QU7A 2DNYA 3FEXB 1HNIB 5J1PA 3RB0A 4A4JA 1OWXA 2EFGA 1LOUA 1CC8A 4X4PA 4IFYB 4YDXA 2HQIA 2ZKTA 2E5GA 3K5LA 5D4LA 4QW8A 4TU7A 4NWBA 3N4WA 2ZM6F 1JJ2R 4QIGA 2XGQA 3GB0A 5F8JA 3CJ4A 4I4BA 5KFAA 3M2RA 3CJ5A 4QBUA 4I2QA 3CCRS 2E7XA 4IOCQ 1XK8A 1P27B 1IBKF 1IKXB 4LMZA 4FS2A 1U1QA 2DRBA 3I9ZA 3MM5B 4C8LA 3T9NA 1HR0F 4OHYA 3NBPB 4F25A 3GQCA 5D6GA 2KRRA 3BSNA 5F9NA 1VQ9S 1XNRF 2JEIA 3CVKA 2DNKA 3V4IB 2K2PA 2WSCC 3PY8A 1JLCA 4AYBD 4UW2A 1U09A 4WE1B 2WSEC 4NLUA 2KI2A 2DHAA 1DTQA 1RJJA 5KFMA 3TI0A 2CDQA 2WOMB 3HHLC 2ZFHA 2X3GA 3HDSA 1RT4B 4IO1A 2D41A 4RW7A 2OJ3A 4FF3A 4QW9A 1P1LA 1JLGA 4IFVB 2EC0A 5LSOA 1DLOA 2M3DA 3C6TB 1QY7A 3I0RA 3TVYA 3OBIA 2CPIA 2K7KA 4P7VA 1HNXF 2R9LA 1WNEA 1RA7A 3K7RA 3RB6A 1N33F 5GAEI 4IR9A 3KTQA 4C4WA 4DV0F 1D8YA 3DOKB 1N5QA 1JLBA 2IA6A 3DDKA 3Q8PB 4DSJA 3AA8A 3I4PA 4C11A 4RW6B 3J7YI 1IKVB 4OZLA 4PUOB 3JYTB 3M2UA 1R0AB 3OFEA 1IKYB 4RU9A 4QWEA 1JNZB 3X3UA 4K50A 2J9DA 2XBPA 2VKZG 1QSYA 2JFKA 3I31A 4IOBA 1J2VA 4DL7A 1H38A 4KHPF 3PW2A 1VQ7S 1F9FA 2F3JA 2VL1A 4IH6A 4TN2A 2HVHA 2HVIA 2HRYA 4Y2MA 2CQGA 1DBDA 1HI0P 2KZZA 2N3LA 4UQTA 3MMCA 4QWAA 2ASYA 2LEPA 3C6UA 2KKHA 4EYIB 5KT4A 1DJ0A 2LLZA 1RT2A 1L3UA 3M32A 5BJRA 3D0HE 1VOMA 3ITHA 2R2RA 1VI7A 1NHVA 3KK2A 4MKYA 3O3LA 3QWPA 1BQXA 1UEUA 2HHVA 3DC2A 1IXKA 2ROGA 2ALZA 4DQQA 4B9SA 2AJQA 1N5YA 4IO9Q 2HNZA 1VC6A 2MSSA 2RKIB 3HO1A 2O67A 5AXLA 1SL1A 4OZ0A 2XO7A 4H54A 3QO9A 2ROEA 2DNPA 2EWHA 1LW2B 3TUJC 3TQ1A 3NGDA 2KFYA 1VBXA 4V19J 1MNEA 4ES1A 1XMQF 1HPZB 2VPYB 3N0VA 4ZP6A 2VG5B 2FVPA 3GMGA 2RDIA 3CDBA 2BDPA 4U67Q 1WF0A 4PQAA 3M2VA 5DQHA 1RKIA 3JAMY 3CJ0A 3EGWB 4MTPA 3ULHA 5A6WA 4FP9A 2HPUA 4AXIA 2D3OR 2UP1A 2ZJPQ 1FHTA 1JX4A 4CTAB 3B4DA 1VK8A 3MUMP 2XMTA 3M30B 2HVZA 1R8PA 2V8GA 4Q2LA 3MEEA 1MMLA 1VS3A 3VALA 1NJZA 2QEXS 4OI6A 4LSLA 4WXOA 5HBMA 1K9MT 2GMLA 3OL8A 4Q0BB 1BGXT 3NCPA 1Y3JA 1HWJA 4ZPWR 5J2PB 4RX6A 2HLTA 4B3OA 5DGAA 2UUCF 4F4ZA 2DNZA 3EXYA 4YDDB 3VWSA 1RKJA 2KT2A 1C2PA 5BR8F 2ABYA 3BDPA 3V81B 4X62F 1U7LA 1HHTP 2G9OA 2WTFA 1JJ4A 1TKZA 2P5VA 2FLPA 5KT2A 4FXWA 2Y0SD 4C9DA 2XEXA 2PFFB 2QO3A 1GX6A 1C1BA 1JLEB 3HKWA 2D74B 3FCHA 1S0NA 3CC7S 1YJRA 1TFWA 4X4NA 2ZH3A 2C2DA 4H4KA 4BHQA 3A8EA 4O44B 1TFYA 3P3DA 3WZ0A 2LYVA 5DG8A 1UW4A 1S77D 4N8OA 1YJ9S 2PN6A 4BS2A 3B8HA 2YWFA 2OP5A 3LGMA 1S9EB 4TNOA 5HMWA 5JJBA 1Y4ZB 3S7RA 1FE4A 1FJGF 2WW8A 3CJKB 1XWLA 3IS9B 1FE0A 2DNGA 2KVIA 3CDWA 3E51A 3M8PA 3QAEA 3OLAA 2R8HA 5LMUF 4LVNP 2RSQA 1URRA 1S10A 2A3JA 1ZZNA 2GIRA 3LWLA 2BBEA 2LQBA 3K57A 2J6SA 2GQCA 4C0HA 3UR0A 1Q81T 1X9SA 4X4OA 2HNYB 5DM6Q 1V3RA 1IQZA 1W2BR 4A8WA 2OFGX 5BYRA 1X0PA 3QIDA 1LXNA 2KM8B 4ECVA 1T3NA 1QAXA 1A9NB 3FQLA 3LP0A 1HHSA 3UCZP 4DHVA 4WXWA 3MAQA 1GNKA 2DR8A 3CJ3A 4X65F 3HHNB 4DR3F 3RW6A 4OZ1A 1DFDA 4Y65A 2XI2A 2W9AA 3RZAA 1YRTA 3PJWA 2R7XA 1SB6A 1U24A 2YNGB 5CH7B 2UZAA 3NMRA 2KT3A 2CKWA 1KONA 2ADBA 1VC0A 3ZZ0A 3IFEA 3EGZA 1R89A 4FPRA 2DR9A 4QYZJ 3QLHA 2NPIA 4DL4A 1NK9A 4NLTA 1ZM2A 2W4CA 4R8UA 3PX6A 1X4EA 2MHEA 4A47A 2VB6A 4DN0A 3KLFB 3EPGA 3OVSA 2QRRA 3MAHA 2DNNA 2YNFA 4B3OB 4X64F 2YX7A 2VQFF 1HMVB 1VK3A 3THPA 4EO6A 5L38A 4EBEA 1HBOB 3H8YA 1NH8A 4OHVA 1YBAA 1LW0A 1HBNA 1HYSA 1X0FA 4I6AA 5T14A 4URSA 3PXGa 1RYSA 4CCHA 2OPQA 1F5AA 5F0WA 4QWDA 4TLQA 1SQEA 1H0HB 3IRXB 1SH2A 4URGA 1UA1A 1R7IA 1O5JA 5G4DA 1J5OB 2GQQA 2VC1A 1KVJA 1WTBA 5C24B 4FVMA 3KG4A 5KFEA 2JJ4D 1FVSA 2E5HA 3MTJA 4ZCLA 2F8EX 1TL3B 4J9PA 1RP5A 4O23A 4PKDB 2ZH7A 4AL7A 2CQDA 3MURP 2W8LA 1T03A 4C8OA 2FVRA 3JTPA 2W9BA 2DVIA 3QMQA 4WJBA 1ZM3A 2YKQA 2DNRA 3GV5B 2WAQD 1HNVB 1G1XA 3CMAS 3JSBA 3R1LA 2PMHA 1UVJA 2MXYA 3CMES 3PR5B 2B6AA 3VTIA 4JI4F 1S1VA 1L3VA 5D3GA 4B9LA 3K5MA 3MMAA 3MZIA 3MXHP 3DXBA 1A6LA 3W2WA 5M2UA 2MQMA 1SKWA 3JTOA 5AXMA 4TKTA 4TQSA 4IG3A 4Z2XA 3LP1B 1O0PA 2MZSA 1JLFA 3E01B 4FNHA 4X66F 3SSRA 3CCSS 1HARA 3DRPB 3OV7A 3DDNA 3THVA 2IAJB 4B3SF 1X4CA 4DX8H 4RNOA 5L1KA 4LF8F 2WBRA 3AA9A 4PWUA 4RW4A 1S9FA 3WC2A 2IJFA 4F8RA 1VIOA 2Q6CA 2ASDA 4A8QA 4NLQA 4X2BA 5LSRA 2PDAA 5KFJA 2CQPA 4MYTA 4MKBA 3I82A 2IM3A 3IR5B 2MJNA 1H2TZ 3I56S 1H98A 3ZZYA 2PMZD 3FMBA 2OAUA 3UQSA 2GX8A 2HGLA 3BQ0A 2UVWA 1HNWF 4DWIA 1VHFA 1E6YA 2BM0A 3EZUA 4QCLA 2DO0A 3PNIA 4IYQA 1FJCA 2KFZA 2FJAB 3J7YU 1HNIA 3KYLA 3TVZA 1VQMS 2NQPA 1N0VC 3DU6A 2M2BA 2L9WA 1RT3A 1ZETA 2C3UA 2FDNA 3M9MB 2HFZA 3CT9A 5CYMA 1IBLF 4G6VB 4PXCA 3MM7B 5KFIA 3MPVA 3D54A 1KD1T 1F2GA 5KFUA 2V5HG 1UETA 2KB2A 4CT8A 1M5PC 5L1LA 3GWCA 2UVVA 4JI8F 1LWFA 1WF2A 4CNYA 3N6NA 1Q8IA 2HLUA 2F8MA 1N36F 1IKXA 2DGWA 3DLEA 1QUVA 2F7VA 2GHWA 5LSLA 2FHJD 1V6HA 3R5AA 3MM5A 2ADCA 3VAGA 4Y00A 2EFNA 1FXRA 5J2QB 1LQ9A 4ZDNA 3W7BA 2AJ4A 2HS3A 2BVZA 2JL9A 2WB1D 2ZH2A 3TRGA 1RTJA 3ZC4A 5L1JA 1N56A 3CSKA 1BLUA 1AROP 4XAKA 4KSEB 3IA0A 2WCXA 3CE8A 3JSYA 5KFRA 4X4QA 1ZYQA 2YKNA 5AE1A 3ENVA 3IG1B 1M90T 1LK5A 2XULA 3IBWA 2IRXA 4L6V3 4NA2A 2FY1A 3ZZZA 3QZ8A 1Q78A 2XSJB 1DTQB 3IGNA 5J1EA 2OMOA 3G6VA 3UD3P 2RJZA 2R2TA 1L5UA 3MFHA 1N5VA 3NAIA 3UWTA 4DFJA 1RT4A 2FLNA 2VASA 1CSJA 2DK2A 5K5MA 2EI5A 2LVWA 1JLGB 3QIPB 1NHUA 3M1VB 3ENWA 4I1TA 2R4FA 1DLOB 1FDNA 1KN6A 1RK8A 2EG2A 2QYCA 1SV5A 4XPCA 3VZIA 5KG2A 4YB6A 2OPPB 4FVCA 3K58A 2HRUA 1QLNA 4U6PA 2FLLA 1B0TA 3BJYA 5IT0A 2CJ9A 2HFNA 1GX5A 3FZBA 3N9UC 1NJWA 1IKVA 5G0RA 1N5SA 2I38A 1CQMA 1P6TA 3POTA 2XZWA 1SL0A 2ZBIA 2WONB 5DJBA 3Q2TC 1TAQA 2K1RA 4DV5F 2FJDB 4CH0S 2IBOA 1S6QB 2VBWA 4QQBA 5AXKA 3NS6A 2UUBF 5B0EA 1WACA 4QR1A 3HVRA 1Q4RA 2PT0A 3HHDA 4M1KA 1C0TB 1TVRB 2L48A 3OXLA 4HDGA 4WFNQ 4WZMA 2OTJS 2VBXA 3KOAA 3E8OA 5KT3A 2XLKA 4X4SA 4MFBA 1KS2A 3QGHA 2KYXA 5EHHA 4DL6A 2PI5A 5DGBA 2E5JA 3CD7A 3TW0A 4I69A 2LQ9A 4ECSA 3BM7A 3DM2A 2CRLA 2O01C 4WK1A 2UVRA 2VODA 1N5YB 2E5IA 1ZAXA 3MECA 4GO5X 4Y2CA 1RTHA 2W8KA 4C8KA 4L72B 3BQ1A 4MIAA 3CGIA 1P8GA 3M6WA 3PACA 2EFQA 3PFEA 3BGRB 2IMWP 2GA7A 2OD6A 2RE1A 1L3SA 4QPXA 1TL5A 1LW2A 5IXUA 1YJTA 2EFOA 4MAKA 4QR0A 2LA6A 5DDOC 3KJVA 2FB0A 1GXLA 4USHA 2XS7A 4A8YA 3CIZA 1WG1A 4FZVA 5I4MA 2HS4A 3M2VB 4A8FA 4DSKA 2MZTA 2NSBA 4N8NA 4O4GB 2MY7A 2M5YA 5KG0A 1K8AT 2R8GA 3QPIA 1FEHA 4FN5A 1RTIB 2VA3A 2LEAA 1R8HA 3Q22A 4B08A 1NU4A 4CH1A 2XY7A 2AGOA 2D3UA 2GC8A 2O1PA 3CDUA 4DOZA 3PEHA 5C25A 5E3AA 3MEEB 2YWGA 3CUNA 1U1NA 5FDLA 3LAMA 2JLFA 1HQUA 2WHOA 2E66A 3PV8A 3ICLA 3KFWX 3SSQA 5H9EJ 2W9CA 2ZHBA 4Q0BA 1LWCB 2BJDA 5KFHA 2KXFA 2RQMA 2HFOA 1KVIA 2B56A 2BE2A 2CJKA 4RKUC 5THWA 4TYBA 5KT5A 2OLWA 5EUHA 4BWJA 3V81A 4OJ3A 4CO2A 1X7VA 4QOTA 3HMJG 2ROPA 4ZLPA 4HI1A 1H3DA 5IT9Y 3DCAA 3L3CA 1E6VA 3BZQA 5E0OA 2Y1IA 2XMMA 2IBKA 1H7XA 1NK5A 4B9UA 2I8EA 4K5SA 1FO1A 2JLEA 1XC9A 4DQIA 3BN4A 3VQSA 4KKOB 1FRLA 4OX8A 3T6BA 4ZCKA 5IZHA 1HWKA 5J2MB 2BXJA 1VQ4S 2N3OA 2J9CA 2L9DA 3OL6A 2VA2A 4RBUA 2CQ0A 3DHWC 4JI0F 1MROA 3CJKA 1JLAA 1TKTA 4FXDA 1FKOA 4RW9B 4HL9A 2MQQA 4GO7X 4UUWA 1D1UA 1YGYA 3IR6B 1UKUA 1V9OA 1TV6B 4UY8T 4BDPA 3P6YC 1UL3A 1HFEL 4M95A 3RBEA 2HNYA 5B0AA 1JKHA 5B08A 5FLXY 4BC9A 4C8ZA 3B78A 3H59A 2QIFA 3OR2B 3CCZA 1GXTA 1MWZA 3PW7A 4KO0B 1R31A 1VJWA 4DMZA 4HTJA 1N0UA 2YQ3A 1YSJA 4FXVA 2I5JB 4HT7A 1TK0A 1BQNA 1S49A 1S9GA 4HH1A 4DBQA 1HA1A 4LF9F 1W2IA 2MSTA 5F3ZA 2A10A 2FHMA 2DGQA 2CPDA 1B0PA 4ZPAA 4UUXA 3FRZA 2B4VA 2ATLA 3N6MA 4N41A 4UQGA 4NCGB 1T95A 1FNMA 2VFRA 3QJJA 2HIQA 1SUQB 3C8YA 2HGNA 3DYAB 3HXMA 5CYJA 2XCAA 2OKQA 4A8SA 2HMIB 4ICLA 2I9SA 4J9NA 1HBOA 2MY8A 3NRBA 2OPRA 3DRRA 3KLGA 4IG0B 1XBWA 4NLSA 1FKPA 5F9LA 5KFBA 3IRXA 1LFWA 3DLBA 2J6UA 2OMLA 4DF8A 1IN0A 4NYPA 4DV4F 2K3IA