1RGVA

Crystal structure of the ferredoxin from thauera aromatica
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
ALYINDDCTACDACVEECPNEAITPGDPIYVIDPTKCSECVGAFDEPQCRLVCPADCIPDNPDYRETREELQEKYDRLHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords ferredoxin
publication title Crystallization of 4-hydroxybenzoyl-CoA reductase and the structure of its electron donor ferredoxin.
pubmed doi rcsb
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2003-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rgvA00
2V2KA 2Y0SD 1DFDA 4AYBD 1G6BA 2VPYB 3MMBB 1FEHA 1FRJA 3IR5B 3MM7B 3MM6A 1Y5LB 4ID8A 2PMZD 3EXYA 2V4JA 1A6LA 1BC6A 2C3YA 1Y5IB 1FD2A 4L6V3 5BYSA 1C4AA 2UZAA 2C3PA 1HFEL 1PC5A 1R27B 3MM5B 1GTHA 3MMCA 1H7WA 2VPZB 4KT0C 1KQGB 2PA8D 1AXQA 1FTCA 4XDCA 1Y4ZB 1KEKA 2O01C 1PC4A 2C3OA 2FJDB 2WSCC 1D3WA 2FGOA 5L8RC 1GTEA 3MM6B 3MM9A 1FDAA 2V4JB 1CLFA 1VJWA 4XDDA 3HKZD 1B0PA 3OR2A 4Y28C 2XSJA 1F2GA 1RGVA 1K0TA 1FCAA 2WSEC 1BLUA 2GMHA 3MMCB 4DHVA 1FDBA 3LW5C 1FRIA 7FD1A 1G3OA 2C3MA 4XK8C 2PDAA 1FRHA 2ZVSA 3PNIA 1SIWB 1FXDA 1ROFA 2FD2A 2C42A 3MMAA 3MM9B 1FF2A 5BYRA 2GMJA 1GAOA 6FDRA 1SJ1A 1Y5NB 2FJBB 1WTFA 1GT8A 1JB0C 2VKRA 4OMFG 1BD6A 3OR2B 1DURA 1B0TA 1SIZA 1FXRA 2XSJB 1DAXA 5E7OB 1FRLA 1FRKA 1FRMA 3IR7B 1F5BA 1H0HB 2WAQD 1XERA 3OR1A 2FJAB 2FJEB 3MM8A 7FDRA 2FDNA 2VPXB 3MMAB 2Z8QA 3C8YA 1F5CA 2WSFC 3MMBA 1JNRB 1FRXA 1H7XA 3GYXB 3MM7A 6FD1A 5BYQA 1IQZA 4OV1A 1JNZB 3EUNA 3EGWB 1IR0A 1FDNA 1BWEA 1H98A 2C3UA 4RKUC 2IVFB 5FD1A 1C4CA 3IR6B 1BQXA 2VPWB 2WB1D 4YDDB 3MM5A 3OR1B 5CH7B 1Q16B 3MM8B 1FERA 1B0VA 4CI0B 5CHCB 1KQFB 1FDDA
chains in the Genus database with same CATH superfamily
4N47A 2FHJD 4RR5A 3FQLA 1U2CA 4I64A 2MHEA 2JWNA 2J7WA 1DJ0A 3QYYA 3R6LB 1HBMB 3UD5A 2CQ4A 2RILA 2CXEA 4KT0C 1UA0A 4USVA 3UQSA 2N7YA 4L3KA 2OAUA 2QTWA 2ASLA 2BDPA 2LYVA 3DM2B 5D4NA 4DSIA 2IHR1 4AD6A 3CC7S 4TN2A 3TAQA 2DHAA 4QIVA 3TZWA 3R5BA 1JXEA 3E3XA 2UVUA 1TFWA 4CO3A 1GAOA 2ZH4A 4BS2A 1T9VA 1TKTB 3NLCA 2E1AA 3H5SA 1J5EF 1YZ7A 2G1DA 3GIJA 2VA2A 4WP3A 2B51A 1JLGA 1U2FA 4MFBB 4K0KF 1JQGA 3IWNC 3M9MB 2DR7A 4OYIA 4O0NA 1R6VA 3EMTA 1U02A 3DLGA 2IM0A 5KG5A 1NKEA 2VPYB 5K8MA 2YPZA 5GADI 5LMNJ 1N36F 3TJ9A 3LO3A 4TQRA 3LGNA 5GMDA 1HQEB 3AJ2A 1S9EB 3BBCA 2HMIA 1WSVA 2HHVA 1VLOA 1QAIA 1TVRB 4IR9A 3UR3C 3RGIA 1D3WA 5L8RC 1GTEA 4RW7B 2Z58B 5I3PA 4QQBA 1TMMA 4IDKA 1CQNA 1OMSA 2RHSB 3R7SB 4C3KA 2FVQA 5KT3A 4FYXB 3RYLA 3BPSP 2CJKA 3K8VA 2AJ0A 1FXRA 4DSFA 3N5FA 2K3KA 4ED7A 1I6JA 3RRHA 3OLAA 4GC6A 1AROP 1Q8IA 2W4PA 5B0EA 1VMBA 1HNWJ 1MWQA 2DIUA 4EUVA 1MMNA 3GR0A 2DPJA 3AODA 1HBMA 1K8AT 1QAYA 2V50A 1S5ZA 1O8BA 5HBMB 5IXUA 4DN0A 1KBRA 3MFHA 2N3OA 2APOA 4DV5J 4C3LA 4ZLJA 3DM2A 2VONA 3N6NA 1FJGJ 2OD6A 5LMUJ 3TUJC 3QFWA 3JSBA 3OTOJ 3VVUA 4CLFA 4ZA1A 3RBDA 2JLFA 4Y2AA 4ECQA 2VG5B 1V5IB 5CZXA 2OJ3A 3MHYA 4MKAA 2GVZB 4KB7A 1TKTA 4OI0A 3ILOA 1XR6A 2IA0A 4FXWA 2UUTA 2PC6A 2LXUA 3NNHA 4MFBA 5RUBA 1LQ9A 3C66A 2HWIA 3HHLD 1YG0A 3CSKA 5L9XA 4LFCF 2VFUA 3K0JA 4ZVEA 5KFYA 4LF5J 4AXJA 4I0WA 1YBTA 4QW8A 1XERA 1B4SA 2VFVA 5EWGA 1T8EA 1ZTWA 4JV5F 4ANCA 3EGWB 3R7NB 1HQEA 1TL4A 1S9EA 2MGZB 3KTQA 2CQBA 2D3UA 1KFDA 2RKIB 5CHCB 1KS2A 1TVRA 5C42B 1WF0A 2BE9B 2D1CA 1WC4A 4BCAA 4RW7A 4LMZA 2BKNA 3B8HA 1Y7PA 4ILMA 2ZZTA 4DL4A 1OSDA 4N8NA 1CULB 1EJ7L 1SVDA 4OZNA 2WB4A 4MJKA 1TFYA 1LWXA 2MB0B 1Z2ZA 2O5DA 3CJ4A 4BWJA 3F41A 1U2RA 1X4HA 1NJYA 4XK8C 4OX9J 4JI8F 3SCKE 2J0SD 4NLRA 2YWFA 2IM3A 2G0CA 1GK8A 2QA4S 2XMVA 3VAMA 5HVGA 2R8GA 2J9CA 1VRUB 4ED5A 4IRDA 4NASA 2C2NA 5HMZA 5HBMA 3K89A 1WHWA 1WSRA 1ZM9A 2ADCA 5GADU 1YZ6A 1DQ9A 2BW2A 4YUDA 5SZTA 1B64A 3RAQA 2ZJPQ 3H7HB 4NYPA 3CPWR 1F60B 1ZPVA 2LKZA 1S1VB 2VG5A 3KG4A 5M2RA 3AXMA 2GVZA 3OFHA 2FB0A 2ZE2B 1BMQB 2C3PA 2VDIA 1TMJA 3M05A 1HPZB 3A1YG 3RR8A 3D6HB 4JI0J 2KM8B 3I32A 4DLGA 1VC6A 3ENVA 3PW5A 2DTJA 3OFEA 5DJBA 1QDUB 4ECXA 4KV8B 1WEXA 4DV0F 1H2UX 4CO4A 1X4BA 4ZCMA 3V6JA 3J7A1 3W64A 2WHOA 3GJQB 4KH0B 1FWKA 1WC5A 2WONB 3NGKA 2YWKA 1WEZA 1R3NA 2IRXA 3QRQA 2MGZA 3NGTA 1GEHA 2RKIA 1NK4A 2CPIA 5C42A 3H59A 3P5TL 1RT1B 5HLFB 3POTB 3OJSA 5KFQA 4CLTA 5K14B 3HXMA 3BBFA 5DG7A 4KHMA 4C7QA 3QAEA 4U7CA 1NDKA 4AL5A 1CULA 3FCVA 1BE4A 2GGPB 1MU2B 1YBAA 2E7WA 3M8SA 2FQQB 5JMNA 3MTKA 1IR1A 2PEHA 1FI4A 4H4KA 5GMKa 1A9NB 1D0EA 2KM8C 2Z2ZA 5DLGA 2VFTA 1HNVB 2IMOA 2J9DE 4DV3F 1R0BG 3MUVP 1VRUA 2Y3YA 3CCES 2AYBA 1VHIA 1P1TA 3M8ZA 3D1OA 2HWTA 1U25A 3MCSA 1N8RT 3TI0A 1WTBA 2J0QD 5JXSA 2FHKA 2BJEA 1YJ9S 3BGRB 2NXJA 1KWMA 3OTDA 2W7PA 1RWNB 3MPWA 4Y65A 1CC7A 3M4XA 4GKJJ 4DUTA 2KRBA 1S1VA 2B9WA 4LBHA 3SV3A 1H7XA 2KZMA 4USUA 1OS5A 4RKUC 2ZE2A 4DR7F 1KP6A 1NUEA 2X3DA 2VBXA 2XZTB 4USMA 1HPZA 2X1GA 1Q0NA 4C8KA 1TL5A 3S8SA 3KHHA 3SCIE 4CP5A 2JEFA 2DT9A 4KV8A 3MR5A 2RRBA 2CJYB 3B78A 5AE2A 4UW2A 3GQCA 3H20A 4JYAJ 2W24A 1RAAB 4B3SJ 3QZ7A 4EU0A 1S1XB 4QWDA 1AFIA 3H25A 4OYZA 3MR6A 1Q5YA 2WONA 3QWPA 4M94A 3G82B 1VK8A 2BR0A 2SXLA 1S12A 2XHWA 5F41A 1JJCB 3W5ZA 3W7BA 3HSDA 1ZZNA 2FVRA 5IV3A 1TUVA 1RT1A 5HLFA 1DAXA 3BM7A 3POTA 5J2MB 3BSOA 4A8KA 5K14A 1G7CB 3QSIA 2FJEB 2HBQB 2YWGA 3TZXA 3OTBA 3UN3A 2EXUA 4NE9C 3CJKB 4U7UD 2QIFA 4NLGA 1VLYA 3L95X 3GFXA 1XN9A 2GGPA 1U49A 4D3HA 1MU2A 4URGA 4WF9Q 4NLWA 2HFVA 4DR6F 3NMAA 4OYBA 4XAKA 3O5TB 1HNVA 1N33J 1OPIA 2V69A 3P96A 2XHCA 3I5AA 1ICEB 3QNWB 4MTPA 3IMQJ 2KHDA 3N28A 2DXDA 1VBYA 1NHUA 2GAHC 1RAIB 1RISA 4XO0A 3BGRA 2MMYA 1WF1A 4YR3A 1N34F 2XMKA 4EYIB 2F9DA 3ENQA 4NWBA 1XMBA 3Q2SC 2F63A 4WIQA 3RW6A 2FVSA 1JWWA 4LF1A 1WTFA 2VQFF 1JB0C 2AGOA 1HI1A 1SPBP 2GQCA 4ICLB 1S6PB 4RJVA 4MT1A 1XEZA 2Y0BB 1OWXA 3IWXA 3J80U 2Y9HA 5LJ3Y 2QJ3A 4B9NA 3BS9A 2RHQB 4M63A 2OMLA 1BXNA 4R0EA 2OEJA 1B70B 1S1XA 2IDLA 4PG5A 1A6LA 4A8QA 4JBCA 1N32F 3G82A 3L9ZA 4ILRA 1X4FA 4N7TA 4Q2LA 2D41A 1CS4B 3IG1B 4CLYA 1EKSA 4F67A 5F8LA 1YI2S 4IUFA 4O23A 2AHOB 1JLBB 1FKPB 2MQNA 3K5OA 2R2RA 4ZS6A 1MWZA 3HFVA 2R8HA 1AUSL 2H5IB 2KVIA 5J2MA 5HP1B 1PAUB 5T41A 1XMQF 1S57A 2W25A 4ETXA 3CJKA 3OSNA 3GTYX 4PWWA 2DIVA 2BMBA 2BXJA 2UVRA 3O6QA 2VG7B 2FUG9 2WVCA 3FCHA 4USKA 1F5CA 3QZ8A 2QA1A 2XWYA 4WJBA 1NPRA 4LFBF 1OPZA 4K4ZA 5HAOA 1BQXA 2J76E 2AJ1A 5D78A 3BZQA 4HH1A 4I69A 1PJ5A 5HI7A 3MCOA 1AZSB 1G6BA 2K8GA 3PX6A 3O2IA 3MI7X 1UP1A 3NY0A 4NYZA 1HW8A 8AT1B 2KYZA 4I7FB 1UMJA 3BYPA 4KGZB 3KHLA 3ISZA 5DGBA 3WIUA 2QL7B 2HFUA 4B3MJ 1RK8A 3OL8A 4NXMJ 1NZ8A 1M5KC 4JI5J 4DV1F 4KGMA 4OYOA 4LBIA 4ZJLA 4YDXA 4U6PA 1FWLA 4ICLA 4OJ3A 2PDAA 5DM6Q 3Q8SB 2MXYA 1S6PA 4CM0A 4X4SA 1SC4B 5KT4A 3U1NA 3T1HF 2DVIA 3D6TB 3VAIA 3JSRA 2FYXA 2R7VA 2HHPA 1ZTTA 2YX1A 1Z2LA 1JK9B 1B7FA 2LQJA 9RUBA 4USTA 3R1HA 1NNDA 1UWBB 1JJ4A 1S0VA 1OY8A 2F8EX 1HR0F 1JNRB 2KT5A 1TELA 2LEPA 1JNZB 4JI1F 5IWAJ 1MNEA 2R4FA 2G2OA 4FXVA 4LREA 1Z1ZA 1YDLA 1CS4A 1RA7A 3IG1A 3D54A 4AYBD 1L3KA 2V9WA 3R5JB 3OPKA 4LR7A 1ZAWA 1JLBA 2NQPA 1FKPA 4DI6A 3P6YC 2QL9B 5HP1A 2IPOB 3NS6A 2WSCC 1S99A 5HATA 4PRFA 2DEIA 2MKSA 4X4OA 3A8KA 1IKVB 1RA6A 4ZVPB 4U67Q 1WWHA 3PIPQ 4BHQA 2W7OA 1X0FA 2VG7A 3IGVA 3HI9A 4F2RA 2H54B 1SKWA 2CPDA 4DX6A 5BYRA 2FJBB 2V34A 2GW8A 2MEWA 4OX8A 1TKZB 3MPVA 1HNZF 2ASJA 1T9TA 3NMRA 4O3PA 2J7KA 2BJ3A 3MXHP 2Q3PA 1P6TA 2E1RA 1I94F 4I2QB 1W7WA 1AZSA 3FNNA 4H4OB 3K7RA 2Q66A 4I7FA 2MQQA 2YQ3A 2EI5A 2XS2A 2ZBCA 4H4MB 3I0SB 4CI0B 3GFZA 5KT7A 1VJWA 2QYGA 4C9DA 4F0MA 2OD4A 1IM4A 1VHFA 3MR3A 1D8ZA 1AXQA 2HVEA 2A2CA 3KNAA 1HD1A 3AOCA 3DLLQ 2OMOA 1EX8A 1RBOB 1V3SA 2K7JA 2BRKA 2CRLA 4ELUA 3FEZA 4WKRA 4A47A 3TQEA 3IRWP 3A13A 2E5HA 1X4CA 3PG9A 1UWBA 1RTIB 2AD9A 2Q43A 2VBZA 4NA1A 1TUWA 2ERRA 3CDBA 2FJXA 4IG3B 2RF2B 4ZVRB 4YHHJ 1WG1A 2YVSA 2NPFA 1OY6A 2I5JB 1RKIA 2F1FA 2Q1LA 2LA4A 4CCHA 1VRTB 1FT8A 4OV6A 4X64J 5KFUA 4FP9A 4OHWA 1SJQA 1F1BB 4AUKA 4L74A 3BR8A 2COLA 4M5JA 3MMBB 2M5YA 1RCXB 4HHHA 3P8BB 3M6XA 4DV6F 2XI2A 1IKVA 4A4JA 2JFDA 1N56A 2E9TA 4TYBA 2HIYA 2B3TB 2HBRB 2BX6A 1U6FA 3QGGA 1TKZA 4KHRA 4HHJA 1RWXB 2WSEC 3HVTB 3UVJB 4CRJA 4MYTA 4F4XA 4G65A 2VOOA 5A8RB 4QWCA 4TU7A 4I2QA 3G4SS 4ZPWR 2NZ4A 4H4OA 4DPYA 4WP9A 4FNIA 1K9MT 4YOEA 2E5JA 4NLXA 2B4PA 4H4MA 4JI2F 3H2LA 3I0SA 2MDAA 3SEOA 2LFVA 5ETNA 5JVGQ 1WELA 3MAAB 1RT3B 5HROB 5E0OA 3VGSA 4C8ZA 5B08A 1HD0A 3HVRA 2V8GA 2BA9A 4I1TA 3EVMA 3IR5B 4PWDB 2ZOMA 4W90B 4FF2A 3DN9A 2DO0A 2ZJQQ 2WVBA 1SJFA 3D3BJ 3T5JA 1GTHA 4RZRA 2E5LF 3R5GA 3VAFA 2QZ8A 1QM9A 2QA2A 4YB5A 1OY9A 3PKYA 1WACA 4LR8A 4K4WA 2DPIA 1MN9A 1RTIA 3GSIA 1SBRA 4WPAA 5IV4A 1YJVA 1S72S 4IG3A 1LWFB 3CMES 2DNZA 2P8IA 1TV6B 3I5BA 3EZ5A 4P7VA 2QC3A 2RF2A 2VICA 3TA0A 3W2VB 1N5YB 1S7IA 1U7LA 2HWHA 2MKCA 2I5JA 3RTVA 2VKRA 1VRTA 4J9RA 1TL1B 1N5SA 3QQCD 1DRZA 3BSAA 1VQYA 4ZVOB 1U1MA 1U1PA 1VS3A 3U02A 2UUWA 3PXGa 1WUUA 3MMBA 3GWCA 2VFSA 2V68A 1RT7B 3RAMA 3U7JA 3V2UC 2DH8A 4JI7J 2W4CA 2D3OR 4CLSA 4LRFA 1TKDA 2C2KB 4XPEA 3MFIA 2W8KA 5L1JA 2CADA 2QG9B 5KT2A 1WKJA 2BANB 2UU9F 4HKQA 2UP1A 1CJUB 2XMTA 4UT4A 3HVTA 4OLPA 3UVJA 3A3NB 2XQCA 3CTRA 3RBXA 2KJWA 1S6QB 5A8RA 1ZAVA 4DXLA 2X1BA 4YB7A 1NEEA 4WK1A 2POKA 3CDUA 3H4BA 1FO1A 3SFGA 2OPSB 4OI4A 4X4RA 2XO7A 3MOJB 1Y5NB 2IIHA 1RT6B 1PJ6A 1WF2A 4QIEA 4ES3A 3MAAA 1RT3A 5HROA 4DG1B 1WHXA 1S76D 3HHKA 2GHWA 4CLUA 1NJIT 1MWYA 2GV1A 1S49A 2K06A 3K2YA 4PWDA 5HO4A 1IQZA 1HHSA 4EZ9A 4ED2A 3N01A 3CC2S 2IY5B 3ILLA 4UF4A 2GIQA 1FFWB 1X31C 4P6QA 4WFAQ 3CJ2A 1N52B 2ZHOA 3TUIC 4HHUA 4KGVB 5CXTA 4OZJA 1AB8A 5E3QA 4DMZA 1LWFA 2VA3A 1UVMA 1TV6A 2PE8A 2KHCA 2FLLA 2J7UA 4P72A 2J9DA 3NCRA 4DQPA 4BLGA 1WC0A 1R0AB 4NLSA 1YHQS 3W2VA 2QSWA 1N5YA 5A76A 2ZNYA 3HHLB 2KRRA 3NOGA 5AXMA 3OV7A 1RWKB 3ENAA 1TL1A 3NNAA 1NMEB 3CNQP 1VQNS 2WK4A 3AB2B 1C1BB 2DD8S 4EWTA 1LW0B 4OYMA 2IJRA 3NL0A 2CPXA 1BD6A 5AXKA 1NDPA 3KK1B 1QVGR 4ZLLA 1RT7A 5KFNA 1NB2A 1RYSA 1UTAA 3IR7B 3HF5A 1XBWA 2DY9A 1IWGA 4Y3CA 2YNFB 1G4CA 1FNXH 3UD4P 1NJZA 3MURP 4B9MA 1YJ7A 1DLOB 2HBZB 1SJ4P 2BANA 3GFYA 3BPDA 1CJUA 4ZVFA 3IBCB 4OZLA 3AB4B 4IO1A 4Q5VA 3EDRB 3FZ2A 3NAIA 5GMEA 3B82A 2Y0SD 3BO4A 1J27A 3SCJE 1AT1B 1S6QA 2F4FA 2QGFB 3LF0A 4X66J 2D9OA 3HO1A 2KG0A 3VAHA 5E2QA 2OPSA 1QVFR 2EBGA 4JI3J 4CTAB 4IR1A 2E66A 2QMXA 3QJJA 3H2VE 5CAAA 1RT6A 4DF4A 4E98A 4QR1A 3K58A 4MK7A 2B8PA 4DG1A 1SQEA 3QPIA 2XCAA 4JI4J 4I68A 4DFJA 4AQYJ 4ED0A 5KG4A 6FDRA 1YWXA 3LP1B 1IXKA 3GZ7A 1VBZA 5KFAA 4KJIA 3N9UC 3VALA 2JNJA 4OJ1A 2ZDPA 3MMJA 4PUOB 5F8GA 3N0VA 2A10A 4C3MA 4BBYA 4FVCA 4EYHB 3C16B 5FLXY 1NH7A 4G6VB 5D77A 2QRRA 2V94A 1V3RA 4YB1P 2KO1A 2DHXA 2VBYA 3KXDA 3CUNA 1QSLA 2EW9A 1Q8BA 3ADAC 1R0AA 1HI8A 1MMLA 2RDJA 3WC2A 4ATNA 8RUCA 5B0GA 3HHLA 2FLOA 5J1PA 2ZH7A 3ZTPA 1FE0A 1NPKA 4FS1A 5KFJA 1R43A 4J9QA 4LF8F 2F4VF 2UVVA 2R2UA 5F8JA 3TZYA 3N79A 1C1BA 1CQMA 1LW0A 1PG5B 2DH7A 1HI0P 2XULA 3R6GB 2H65B 1B0PA 3RU0A 2DJWA 3KK1A 5KFTA 3SZ2A 3H5XA 3IGNA 3MMCB 2UVWA 2PI5A 3BQ2A 4DLEA 5FIIA 2YNFA 3MM9B 1SKRA 3PEJA 1GMWA 1NHVA 1DLOA 2VQEJ 2V6AA 1FRLA 2GHVC 4YR0A 1EKRA 5GAHI 2CQHA 2ZZNA 2IVYA 3GR1A 2C22A 4OYXA 1RHRB 4DX5A 2ZH2A 1NK7A 2GIFA 1ZA1B 3EZOA 1UL3A 3QRRA 3ELHA 4MIAA 3L4BC 4WZQA 2Y8YA 2A3JA 4DR2J 2KXHA 4EBCA 1CPZA 3JXOA 4EI2A 4CTAA 1FEHA 4L6V3 1EIYB 4Z7CA 1D9AA 3PFOA 1XMOJ 4KAIA 1T3OA 4M5DB 1PYOB 3PW4A 2FGOA 5CZVA 1JLEB 3MM6B 3CEDA 3LP1A 4RUBA 2GJIA 2HW3A 1ZZFA 4KPYA 2DXFA 3AY0A 3C3LA 4PUOA 4R25A 3QATA 5HVFA 3AQPA 3RUBL 2WBMA 2Z0GA 2MLZA 3ZNUA 4O4RA 1REVB 1FWPA 4K8RA 3C16A 4J37A 1RACB 5EX0A 3W9HA 2QX0A 2B43A 4TU9A 3NXZA 2Z4PA 1S59A 2OEMA 4WE1B 4PYDA 3EPIA 1SXLA 3Q86A 2YKAA 3P4UB 5E33A 5A6PA 3CD6S 4QYZJ 3AHPA 4YN3B 2FC8A 5D0RA 2VIHA 1U48A 3CULA 2YY3A 1X60A 3HZEA 2PFFB 2C3YA 4ZPAA 4A48A 4X62F 3MMCA 1MROB 3QBCA 1F3FA 1X8DA 2XCPA 3DGPB 1VDHA 1UFLA 3AD8C 2FJDB 3OVAA 1L5UA 3MM9A 4RUHA 1GMVA 4DR5J 2M8DB 3CCSS 3VVTA 3NRBA 1QSYA 2I6WA 2OEKA 2RSQA 1VQMS 3FBFA 2P6TA 3IBWA 3CDWA 3UI3A 2GC8A 4NA3A 5D4PA 3HMJG 2D74B 3IP0A 2VBWA 4TY9A 3T5HA 4C6AA 1EHWA 3TOQA 3BKTA 2ZOGA 3SXLA 4FPIA 2VH7A 4RW8B 1B3TA 4M5DA 3J81Y 4DN9A 4N8OA 5LSRA 1N88A 2RUGA 2OIHA 3DGVA 1JLEA 1CSJA 3MM6A 1ELOA 1RABB 1J5EJ 1CJTB 3ILIA 3I82A 1S1TB 2F65A 4K0KJ 2FLPA 3W60A 4PQUB 4LRCA 2BBEA 1M1HA 1NZAA 3PZPA 1ITPA 2XM3A 4CZCA 4PG8A 2PIIA 3E8OA 1NSPA 1TK5A 1REVA 3CJ3A 4B02A 2LA6A 1KOOA 2YQ0A 3RB3A 4A8WA 5GAHU 1N36J 3NGSA 4RW4B 4GVLA 2B4OA 2R7SA 2UV8G 2W4DA 2KXFA 4EK2A 1DURA 3I0RB 5AJ3F 4WE1A 4ZKAA 2Z2YB 2JH3A 4P74A 4USIA 1O5JA 3V6KA 2L9DA 2H4YB 3RBZA 2HFNA 2HQGA 1FD8A 5IT4A 4ZPTR 1K44A 5G4DA 1LW2B 4EEYA 1J2VA 2X51A 3QIPB 2XLJA 3FSYA 1MROA 3AXKA 1WOPA 3DGPA 2H5EA 2ZFHA 3BR9A 1YKWA 2FZCB 8ATCB 3GMGA 1FXLA 3QT6A 5B0BA 1NHKL 2M3DA 3KDNA 5DM7Q 1FDAA 1Y11A 3G8TA 1F0XA 3ZTQA 2HHTA 5THWA 1SC6A 1CBKA 3EVOA 4F0KA 3H40A 4I56A 3Q0AA 4WP8A 2DNMA 3PW2A 2ZWOA 4OZ0A 4GO5X 1WOOA 4C11B 2RB7A 3CXCR 2HS0A 2HFOA 2AJQA 1RBAA 1RU2A 5K8OA 4RW8A 3AOAA 4CLWA 2XS5A 3AJDA 2G1HA 4DV2F 2RDIA 1U47A 3M2UB 1NK8A 4ZLNA 1VQPS 1CJTA 5J1NA 1UEVA 1S1TA 2AJ2A 2DNHA 2DGWA 4NL5A 3R97A 4LFCJ 4PQUA 2EFOA 1KQFB 1O0PA 3UO0A 1UJ5A 2DH9A 4HACB 3CCZA 5DETA 3FMBA 5CA5A 3I4PA 3H5YA 3BGOP 3M9NB 1PC4A 5L1IA 3G71S 4JV5J 3BF4A 4RW4A 1IQTA 2CQ1A 4HT7A 3J80Y 2HEKA 3I0RA 3QJLA 2R8KA 3KJQB 1YJNS 1VYAA 3CCJS 2IYIA 1JXLA 1KLNA 2ZBIA 4A8FA 2ZBRA 1LW2A 4WXOA 1URRA 2BJ7A 3THTA 3QIPA 1R8CA 1U1KA 2CJAA 4FXDA 3C19A 3GV7B 4UY8T 3A12A 3VTIA 3DC2A 1T9WA 3QRPA 3CJQA 2ROGA 3KG0A 2DCLA 1Q7LB 4JI8J 3O8WA 3TW0A 4B08A 2Z2LA 2DNRA 1WEYA 2G9OA 5SUHA 4CT8A 4UQGA 5AT1B 3LWLA 4PAAA 2XYGB 1R27B 3T3FA 1P1LA 3R9LA 4LF9F 1LEOA 2CYYA 2DGOA 3FBCA 3H4DA 4C11A 4DBQA 2MKHA 1IJFB 2BW7A 2K1RB 3C46A 1X5PA 1E6VB 2GQQA 1TP7A 4ANEA 3I31A 1KKHA 2GMJA 4QW9A 1YTYA 2C2EA 3M2UA 4J9OA 2UUBF 2XZWA 3SMZA 4A8YA 2A2DA 4A8OA 2BYCA 2DRBA 2MJNA 2W7AA 2ZM6F 2WAQD 3OXFA 2FJAB 2L48A 2PMHA 3ZFVA 4DV0J 4HI1A 2V8HA 2CDRB 4HACA 5LM7E 3J81j 3OXLA 4QIGA 4U9RA 4BC9A 2MKKA 1H38A 1V9OA 2W01A 3MUTP 4LF6F 4ZP8A 3PW0A 2R7TA 1Y5IB 1JLQB 3PHEA 3MCMA 4IO9Q 3NCQA 1D9DA 3KNGA 3W61A 4UUWA 2ZH3A 3QMQA 3LQVA 3RZAA 3W5YA 2MZTA 2BM1A 2R7WA 1U8SA 3A3PB 2LQ5A 4PQAA 2LQBA 2A6MA 1U1OA 5IQ6A 2MZJA 2DGQA 4PYAA 3NCPA 2E1PA 2P2CB 2XMWA 4OI3A 1Y10A 4RNHA 1WD6A 2BABA 5KFZA 4Q0BB 4B9VA 2JEIA 4KKOB 3C15B 4KRWA 4Y0FA 1HLWA 4DPTA 4O3QA 5F8NA 4DV3J 3DXSX 3G96A 1KHVA 2KU7A 5DS7A 4ZN1A 4ZCLA 3F0NA 4F4ZA 5FD1A 3IR6B 2HZCA 2WOMB 1PAEX 3VAKA 1DFDA 2B4VA 1OQ3A 3LAKA 4E8UA 4WFZA 2DXEA 2RE1A 1BQNB 1FFGB 2DGVA 3TUPA 3T41A 2Z30B 2P9CA 2R2SA 1VBXA 4XDCA 4ECVA 4WWSA 3BGFA 2K1RA 4DQSA 1E6VA 3QAUA 3PIOQ 2DNLA 4KYZA 4DR7J 2DR9A 2AW0A 1I51B 2J0XA 4J9VA 1K0TA 3CB4A 4A46A 1F3VA 4IRKA 2JEGA 3KLVA 2X7IA 2C42A 3W2WB 3QGPA 3T9NA 3HT0A 1FRKA 1JJ2R 4F25A 4B9LA 4N76A 2Y1RI 5BXIA 3LUYA 4WU3A 4DSLA 2XB2D 2IRYA 4U95A 1S1UB 2HURA 1FTRA 2IVMA 1JLQA 1UVJA 4MYUA 2JLGA 2QLWA 1RSCA 3I9ZA 2XY6A 2FJWA 3D68A 3QGIA 5KFBA 1NDLA 4NLOA 3VZIA 2NR0A 4DR4F 4P73A 4DPWA 2D9PA 2L9WA 2ZC4A 2QT7A 4KO0B 2ASDA 1NSAA 1UZDA 4ITSA 3PVXA 2FZKB 1T3NA 4Q0BA 4QJVA 3ILJA 4KKOA 3C15A 4DR6J 2AGPA 1F5AA 2C1EB 2B7CB 1LK5A 2Q6BA 1FF2A 4NZ7A 3NEKA 4QIWD 1IR2A 5BR8F 2BV3A 1X4AA 5ETVA 3THVA 3KJVB 3C6TB 1QTMA 2HRYA 2HAIA 2K3IA 4N5SA 3SQOP 2WOMA 3BB5A 4ZP9A 2EWHA 3A4TA 1UCNA 4O44B 1N34J 2V2VA 3P45B 1BQNA 2HLUA 2W2OP 5KFXA 3VGTA 2UUAF 3TVZA 4DCOB 2V8DA 4BC7A 2RVJA 4CO1A 4FYWB 2VQFJ 1RAJA 3Q8UA 4K7QA 3IM8A 1S48A 1I1GA 1U26A 2PT0A 1CEZA 4IG0B 4RBTA 2Z56B 4OLOA 2VL1A 3EZUA 3GU0A 4LQ3A 1VIXA 1FX4A 4PG4A 3FEYB 4RNNA 2QLJB 2L3MA 4ER8A 5B0DA 5F8MA 5F8HA 3TAMB 2ZOFA 2MPUA 3LA0A 3W2WA 4QIFA 3CT9A 1SL1A 1NJWA 3DRYA 2AYGA 1UFWA 3GPAA 4DHVA 3US5A 4WYLA 2ATLA 1N32J 2V0NA 2YX7A 3OUYB 4CH0S 3SIPB 3CCUS 1MSWD 1S1UA 5ADZA 2PD1A 3S01A 5EHHA 1T03B 1M5SA 4B9UA 2OSRA 4NXNF 2Q79A 3HVAA 3Q2TC 4P2XA 4I4BA 2IBKA 3KUEA 1QAJA 2JDJA 4WXWA 5H9EJ 1TAQA 1PBAA 2F7VA 4PXDA 1XMQJ 1NU4A 5ETQA 2CZVC 5D3GB 4Q45A 1KN6A 1H2TZ 2YPYA 4KO0A 4U96A 4LSLB 4OHZA 1ZM3A 2DEJA 5DQGA 3VHQA 2UXCF 4AL6A 2HSEB 4MAKA 2AYEA 3AFGA 1VQOS 2IFXA 2YKMB 4LFBJ 3OLBA 5EWFA 1LWCB 4DU8A 4I6YA 1RAEB 3BKFA 4JP8A 1X4GA 1FCAA 2ZUAA 4KIAA 3KJVA 3C6TA 2EVZA 3P3DA 1KSPA 4DUYF 1DTTB 4IOCQ 3TA2A 4CLPA 3VAGA 4O44A 3BN7A 4X65F 6AT1B 4QBUA 4CDIA 4LSNB 1RBLA 3HPOA 4X4PA 2WRMA 2PA3A 4DV1J 1KDNA 5EUHA 3WBZA 1Q8LA 3EICA 2QEXS 2PGCA 2ZD1B 4IG0A 4MKYA 1ZH5A 2RT3A 1VISA 3AH6A 4TU8A 3TYTA 1ZM4A 3CO9A 4EMDA 3T1HJ 2HVIA 1JKHB 4FS2A 3FBBA 2L41A 2IC3B 3TAMA 2B5JB 2HHHF 1YRTA 2EBEA 3Q8PB 4AT1B 5FLXU 1T05B 2QFJA 3D67A 2OTLS 2HVZA 1X9WA 3PJXA 1HR0J 4ZPVR 2XEXA 4NRUA 3DRRB 5BJRA 2G0JA 1U4BA 4JI1J 2RJZA 2H9ZA 5KOXA 3OUYA 1M5PC 3HULA 4Y28C 1SL0A 3GCXP 2VZ9A 4RPFA 4OYWA 4NLVA 1T03A 3AD7C 2B56A 1U1QA 3WIVA 1SIZA 3CIZA 4TQSA 4DL2A 2U2FA 1X4DA 2NREA 1PSDA 4BWMA 1GMWD 2HHXA 2JLEA 3D2WA 2N82B 2B9EA 2XMJA 5D3GA 4RW9B 3D4JA 2NXEA 3BQ1A 4LSLA 5F9LA 1DY3A 3W8GA 3A8EA 5L39A 3HHNB 4UQTA 1Q16B 2VC0A 4WFYA 1HNZJ 2YKMA 2AQ4A 2XS7A 3PJWA 1LWCA 4USJC 3SFUA 4LF7F 3HD1A 1I94J 2YBVA 3DLEB 1KEKA 5E3PA 1Z4UA 3VF0B 5DQHA 4ZITA 1DTTA 1SH3A 2V4JB 3M1VB 3MDFA 2B6AB 1N0UA 3RW7A 4WCEQ 5AXLA 4RX6A 1RADB 2CJQA 4LSNA 1FRHA 1SC3B 4DX8H 4F7VA 3BH7B 3IBFB 1NK5A 4OX6A 4QOTA 3M6WA 2ZD1A 4ZCIA 5A6WA 2CWXA 4KFBB 2XSJB 4ENOA 5IC4B 3RRGA 5B09A 3AAWB 4TNOA 2YNGB 1Y3JA 5J2QB 1JKHA 1R89A 2RS8A 1TK0A 2IC3A 3E2EA 2B5JA 1OQ6A 2FGCA 2A1BA 4Z7YA 4A8MP 2I38A 1T05A 3JSYA 2ALYB 2WB1D 3BREA 4CIOA 3LPYA 3CIMA 3DRRA 3I5CA 2QLXA 2DHSA 3KLHB 3EXYA 4QYZK 2GVDB 5HSPA 4HTJA 1Q81T 3JYTB 1FJEB 5LXYA 2NUHA 2CPEA 1RI7A 2E9ZA 4B3RF 3KK3B 1P9QC 2R7RA 3CDEA 5F0WA 3TNVA 4M5HA 4QU7A 4NLPA 4CT9A 1WKLA 4O0IA 2YKPA 4JUZA 3OTCA 2KG1A 1IBMF 4O3OA 1O51A 3CCQS 4DV6J 1RHKB 2HGLA 3I9V9 4RW9A 4IOBA 2QYCA 4CWBA 2P5VA 3G6VA 3JAMY 4OZ2A 4EZ6A 3T1YF 4W92B 2VPXB 2DR8A 3UE2A 1FRXA 3U1LA 3AD9C 2HS3A 4DSKA 1S4FA 4PEOA 5KFGA 1H98A 1N4LA 4QWEA 1TZ0A 3ETMA 3TX0A 2ZH6A 1KC8T 3DLEA 2O1PA 3GE9A 1LXJA 2ZDOA 4L75A 1BGXT 4DEZA 4F4AA 4PG6A 2HQDA 2V4JA 3M1VA 2B6AA 5LXRA 1FD2A 3CMAS 4JV0A 4JI2J 1X5TA 5KFLA 4P2FA 4RWXA 3J81U 2RQMA 1T11A 5LJ5Y 3CWJA 2UUCF 3QT8A 4KFBA 1WC1A 2XSJA 3CJRA 1NM2A 2MZSA 1F9HA 1N48A 1T9XA 2NYIA 5B0AA 5KFFA 3BJYA 3KKFA 3OW2R 4YR2A 2KTQA 2MZQA 2V5HG 2YNGA 4KHPF 1TL7B 2VKZG 4U7UK 5J2QA 1PJ7A 3HHEA 5IOLA 2ZH8A 5D15A 2EEYA 4PG7A 4RW6B 2E5LJ 2K2PA 1RXOB 4Y2CA 1PKUA 3T1AA 1GMUA 2J0WA 4M5LA 4MKVA 5BYQA 3KLHA 2AWZA 5LSOA 2GVDA 3R1LA 2IM1A 1IR0A 4NPOA 4HDHA 3JYTA 4K5SA 1N54B 5DQIA 3ZTSA 2MQMA 2ALZA 2NYHA 4G1QB 2MSSA 3IAS9 4KE5A 2R7UA 3KK3A 1Q4RA 2LXIA 4LF4F 1K1QA 1WKKA 1H7WA 3JQKA 1EQMA 1YITS 1XR7A 3MECB 4V1Ak 1KR4A 3M2VB 1HIYA 3M8WA 5E3CA 1ZPWX 4J9UE 1LV5A 2C2DA 4DV7F 3L7OA 5KG6A 1IKXB 1P27B 1UWAA 2OHDA 1E6YB 3GCWP 2UU9J 4M95A 1HBUB 5C2CA 3ETOA 3DCAA 2YWEA 4DUZF 2XZDB 2OI2A 2ZH9A 1S77D 2VD3A 3ZTOA 1L3VA 3GYNA 4S0MA 4EBDA 5KG7A 4NZ0A 3MGJA 3IRXB 4DR1F 1EZZB 4FKYA 2IBOA 2ZVIA 1S0NA 3WC0A 2CNKB 1RLCL 4F4YA 4F02A 2B0GA 1VQ5S 2CQPA 4C98A 2UXDF 3AA9A 4DPXA 5IC6B 5KG3A 3BN4A 3NWRA 4ZIWA 3V4MA 4M5GA 4NEYA 3CJSA 5E5NA 3JSMB 5KTQA 3DOKB 1BUXA 4NRTA 1TL7A 2DYAA 4Y00A 3CD5A 4RW6A 4F50A 2Q6CA 3HX9A 1ZYQA 3GJSB 4TXSA 2GAGC 1KONA 4L3NA 5CQGA 3L3CA 3T5KA 1D09B 2EC0A 2EK1A 3I4HX 3H98A 3VAJA 3M8QB 1RHQB 3D7SB 2ZKUA 4F3OA 2X1FA 5IZHA 3F44A 4YY3F 2CAJA 3LP2B 4LRAA 4PWUA 4O4GB 2IJFA 2FHOB 4G1QA 1OO0B 2XYHB 3SSRA 3ITHB 2ACMA 1X4EA 3OR1B 1OIAA 3HSGA 3W66A 1FDDA 3MECA 2KYXA 4WIIA 3M2VA 3ET6B 1Y5LB 4MK8A 3J7ZT 3OFGA 1DARA 1RWVB 1B7YB 4PXCA 1R7IA 2C2MB 1N6QB 1SL2A 1HQUB 2FLNA 1IKXA 2OLWA 2C3OA 2RH3A 1E6YA 1XNRF 3KFWX 2HQCA 1HBUA 2Y1JA 3RAXA 4K50A 2ZBQA 2AX0A 3TJAA 2UXBF 3CE8A 2BKOA 1BLUA 3HHDA 4CLZA 2C3MA 2HHWA 2JOQA 3EWGA 2NXNA 4W98A 4JI6F 2HGMA 4P52A 3ICLA 2ZH5A 2XGQA 1WC6A 3IRXA 3EGZA 1RWWB 3EX7B 1VBKA 2GX8A 1X9MA 1NBEB 2B4UA 1H0HB 3D28A 1JJHA 1HNIB 1KRPA 3WHIA 5ETLA 3D0IE 5C7PA 1XNQF 1HL6A 3UW1A 1DZ5A 3C6UB 4EGLA 4RWWA 5ETTA 1DQAA 1NPPA 1FEEA 4IH7A 4USWA 3W8PA 1UKUA 3JSMA 3DOKA 4DOZA 1WOSA 4LQ9A 2DO4A 2CKWA 2LEBA 2CJXB 1FVQA 3LPEA 2C28A 1AW0A 4V19J 3PKMA 5F8IA 5FDLB 1HWJA 2K7KA 3L7UA 4ZOSA 1MLAA 4CM2A 3BSCA 2W2MP 4UOCA 2OPRB 1YVFA 3M8QA 1RGVA 3CD0A 2CQ0A 3QO9B 2GO8A 2PN6A 3A8JA 3LP2A 2I8EA 4QCLA 4O4GA 4E2FB 7AT1B 2RIJA 3CW2C 2VB6A 3TEGA 4LF8J 3OR2B 1C2PA 2F4VJ 2R8IA 5KT6A 5D0GA 3ITHA 4EO6A 1NO8A 4F3QA 4B17A 4IRCA 3EPGA 3KWMA 2N4CA 4Y2IA 3OL6A 1PBUA 3OR1A 2FDNA 1XJWB 3ET6A 3J7YI 3PYDA 3R7BB 3IM9A 1S4EA 3MR2A 4B9SA 1B0VA 4PCQA 1N6QA 4NLTA 1HQUA 5J2NB 3NGUA 1RT4B 2DGXA 1QLNA 1RAHB 3PHTA 5MLCV 3ZZTA 2DB1A 4E0DA 2F9JA 5KT5A 4WFXA 2YKNB 1YJRA 4PXBA 3DNCA 4IH5A 5EN1A 4P9SA 1HWIA 2NXUA 1RT5B 1WHYA 1RTDB 1FNMA 4OJHA 1NB7A 1R0CB 5KFIA 2BJDA 4GVBB 3UDVA 2BZ2A 4HVZA 1LFWA 3NNCA 1HNIA 3CCRS 3ZZOA 3DRXA 2YKOA 2D3O1 2QLFB 3KJFB 3SBMA 4C97A 4OMFG 1SQGA 1HARA 1UZHA 2M9KA 2MKJA 2J8SA 4AXIA 2GMLA 3DKDA 3C6UA 5CCLA 1D9FA 3UDCA 5ETMA 3HDSA 4O3SA 4M8LA 3IWLA 1Q7YT 2J8AA 3OFFA 3SDEB 2KFYA 2DNGA 3OD2A 3B4MA 4ECRA 2LXFA 3NGRA 2EG2A 2OPPB 4FPRA 5FDLA 3KOAA 2LMIA 4FKXA 5IT9Y 1S1WB 2PMZD 2E5GA 3CJ5A 2OPRA 5DRKA 4KTQA 5KFRA 2DNNA 2XLKA 3QO9A 2AKWB 3JQJA 2XG8A 2YNHB 1SKSA 4TLQA 1A0OB 3D6FB 4PPDA 1OSCA 3OR2A 1G3OA 3DLKB 2DRDA 2P9EA 3OXGA 1VCTA 2KN4A 4Q2MA 2JHEA 4X62J 3HZGA 2LVWA 4HI2A 2OUGA 3LANA 5C25B 3W9IA 1UPPA 1S9GB 1C1CB 1IBLF 5J2NA 1RT4A 2I2YA 3D1HA 1TK8A 2HNDB 2CPHA 2CG8A 1L3SA 2YKNA 3MM8B 3DLBA 1MN7A 2E5IA 4EBEA 3MZIA 1GQEA 2KI2A 5HQLA 2CNLB 3NP5A 2HHQA 1RT5A 1RTDA 1T9YA 3V4IB 1HNXF 2H48B 2KB2A 4GKKF 3G6YA 2ZJRQ 4GVBA 4U8YA 1HBOB 4F04B 2VJUA 1S0OA 1X5OA 2RD5C 1KLMB 4NCBA 2PMWA 1XK8A 4WFBQ 1UA1A 4ID5B 4M1KA 5K8NA 3CVKA 4EFAC 1T02A 1LXNA 1F9FA 1K1SA 3GV5B 4UOGA 3SDEA 5B7WA 5D8HB 1EETB 3J7YU 1HWLA 4DL6A 4I6WA 4HT5A 2GCFA 1M5VC 2F40A 4HEA9 4ZP7A 2OPPA 4DZDA 1FESA 4J9LA 2HRUA 1S1WA 2DHHA 1YRXA 1RHUB 1RUSA 1FDNA 3IA0A 2IMWP 4NA2A 2O3DA 1NXIA 4OIXA 4FF1A 5A2QU 2QO3A 3B54A 3K17A 3SV4A 5H9EK 1IWAA 2ATCB 3DHXA 3UFCX 2YNHA 5AJ3J 3W9JA 1SV5B 4DX7A 2FY1A 2GFFA 1IJEB 2V67A 1PC5A 3OJUA 4P71A 3VZHA 4J5OA 5E41A 4RO0A 1D1UA 1R31A 3DLKA 3M30B 1SJ3P 4CNZA 2O66A 2LQ9A 2BKPA 5C24B 3Q8RB 3KG1A 5KFMA 2BQRA 1U6BA 3PYGA 5J2PB 1F2GA 1M5OC 5C25A 2CZ4A 1QSSA 2AEMA 2J5AA 2QLBB 2ADBA 2WZ1A 5FJ4A 1S9GA 1C1CA 5GAEI 2CWKA 1N5TA 2HG4A 2EG1A 4K2JA 5H9FJ 4B3TF 3J7AN 1J5OB 5F3TA 5HMXA 4CH1A 3GLJA 1HQ2A 3JTNA 3DLJA 2NS1B 3MR7A 2HNDA 2MLXA 3MM8A 1GNKA 4EO8A 1VK3A 2CPJA 3R3TA 2NZCA 3V4IA 3PJ9A 2MY7A 3K8WA 3BO2A 3OT9A 2OFGX 5D4LA 2ILYA 1HBOA 2ROEA 3GONA 2AZ3A 4DR3F 3GP9A 3W1YC 2VODA 1KLMA 5A8KB 1WI8A 2EC2A 3BEGB 1HBNB 1NK0A 4FF4A 3L09A 1Y0HA 4RL1A 5KFSA 1SB6A 1H3DA 4DV2J 4ID5A 2LDIA 1KQGB 5HMYA 3DRPB 2DNKA 4OYAA 2C2OB 1LK7A 2OSQA 9ATCB 2F5GA 3ZZRA 1T9UA 1VQLS 1PYSB 2QFIA 4KQZA 3CJ0A 4UTGA 2AEFA 1EETA 2HQIA 1S9FA 4ED3A 1GXTA 3LW5C 3LGHA 4F0HA 1Q53A 4J90A 1H2VZ 5KFKA 4DDFA 1HHQA 4TKTA 3M8PB 1EARA 5L46A 2R42A 3Q8QB 4OHXA 3OHAA 2W9AA 4AFFA 5EWEA 4DV4F 1YBUA 4F2SA 4ERDA 3A3OB 2V2QA 4F8RA 3WX8A 1NKBA 4P10A 5DZ7A 4ZN3A 3UNYA 5DO2A 1RWOB 4H4KC 1VQSA 3CCMS 4ZJOA 3MTJA 2Z8QA 2OTJS 1SV5A 1XQIA 1IBKF 1X7VA 1M1GA 2D69A 2CPYA 4C8LA 1BWVA 1CG2A 3KLEB 1PCAA 3M30A 3Q8VA 3RR7A 5C24A 3H2UB 2RU9A 3Q83A 4DSEA 1F9EB 5J2PA 1U6ZA 4YS2A 4XTTA 2G13A 2KH9A 1FX2A 1PYTA 3AOBA 4L73A 2AEJA 4IQMA 2EKNA 1MMDA 2OH2A 2XNQA 5HVHA 4CO2A 1J5OA 2CVEA 4KR0B 3MEGB 3TAPA 1U1RA 2FVPA 2W2PP 5LL6d 2JVRA 4Q43A 1WI6A 3G2XA 4MIBA 4LF9J 3GJTB 2CA9A 1N5VA 1GXUA 3FSIA 5IM0B 4P7TA 3PRDA 1NH8A 3FJ2A 2IA6A 3LALA 4NCGB 1DHMA 4N41A 2WVEA 5A8KA 1SCJB 3H0PA 5DLFA 3QT7A 1HBNA 1BWEA 4CO0A 2IVFB 3N4WA 1UEUA 1IBCB 4J9SA 2RMLA 2RRAA 1HWKA 4ECTA 1JLAB 3DXBA 3DRPA 3GSDA 2UUBJ 4P75A 4PR6A 3MEDB 2ZM6J 1RU1A 3M32B 3ULHA 4IH6A 3PV8A 2RAQA 3RRKA 2M88A 2NCKL 2V63A 3HJVA 2R9LA 3DDIA 5ITHA 3M8PA 2EFQA 2DHGA 1S79A 5GAEU 1H74A 3SQGB 2RQ4A 3TP2A 4PKDB 1V5VA 4UOHA 1S97A 4Q44A 4LF6J 4R5PB 1UJ4A 3QJPA 2CDQA 2ZEJA 2DNOA 1MG7A 2XNRA 2BQUA 4XPCA 3HSJA 1UVLA 2NPIA 5AE1A 3ZZZA 1VRQC 1Q86T 4ELVA 3OQ2A 2BE7D 4C4WA 5D6GA 3KLEA 3WX4A 3OSPA 2H1YA 2CQCA 2WTFA 1HYSB 5F0UA 3G8SA 3JAMU 2BEFA 2ZWPA 4NX9A 1K73T 4C0OC 3RB6A 4RNOA 1FVSA 3GV8B 4O3RA 5BYSA 3HSZA 2LDYA 3ZZ0A 1FTCA 3BGLA 3MEGA 3K59A 1VQ6S 4RU2A 2AX1A 2CJBA 3CD7A 3ENWA 1TAUA 2ROPA 4LFAF 1DTQB 5IM0A 2YTCA 2ZVSA 2CQGA 2HFZA 4DL7A 4NCGA 3TR5A 1GXLA 4QZVB 3L7PA 1SQFA 4B3OB 3G6ES 2AU0A 3TARA 3ISNC 2V4RA 1JLAA 1LWEB 3R2CJ 3HCXA 1YJUA 3C8YA 5MAOA 1WNEA 4NLDA 3MEDA 2YWWA 4MKBA 3LAMA 2AGQA 3M32A 3EUNA 3LWMA 3BKUA 3FK4A 5GVQA 2WVFA 2I9SA 1PIEA 4L76A 2CUYA 2CPFA 3SQGA 3VQTA 3I6PA 1VQ9S 5ETRA 1C4AA 1U0HB 2R2TA 3I55S 4W4MA 4R5PA 4CNYA 2XSFA 1UW4A 4A8SA 1D8YA 3CDAA 2V9KA 4GO7X 1PO6A 5C2GA 7FD1A 1F6TA 2JZ5A 3QFHA 1FXDA 2V2ZA 3OVBA 4X4TA 3FFIB 4DR4J 2HBYB 3EXCX 1GFWB 1ZA2B 2VU5A 3I56S 5LMNF 1XR5A 1HYSA 4Y2KA 1IN0A 4ES2A 1HWUA 2RQKA 1VGYA 1S6UA 3IO1A 2WCXA 3KLIB 3MD3A 2E29A 2EFPA 1R8BA 4USHA 3MPUB 1BY9A 1X0PA 3VV2B 1CJVB 3K5LA 4YDDB 3FC9A 1URNA 4NOHA 4Q7AA 3MUMP 5BR8J 1TR0A 1FJ7A 4ZJQA 3BDEA 1A7GE 3G87A 3UCGA 1R8HA 1XTZA 2VV5A 4ALZA 4ZPDA 3G9CA 1M90T 2JFKA 5E3AA 3DU6A 1DTQA 2DNYA 2JC0A 1VFJA 2KXNB 3O44A 5L9NA 1RWPB 1UVKA 2UUAJ 4LRDA 3BV8A 4OJGA 4NLQA 4KC5A 1NK9A 2AT1B 4Y2MA 1HNWF 3JQMA 3M6VA 3TQ1A 4B3OA 3AJ1A 3MD1A 1LWEA 1I5OB 4HR2A 3OHBA 3NBPB 4KGXB 4ECSA 4OX7A 3KMQA 4DV5F 4DFMA 3RB0A 4YEAA 2HS4A 1FJGF 5LMUF 5G0RB 1RB0A 1IUJA 3IN5A 1YLXA 5KFOA 3OTOF 3FVYA 2RUSA 2ZKTA 4X4NA 3A8IA 3EYZA 2OP5A 2WSFC 3GIMA 5KG2A 4PABA 2XYPB 3ZTRA 1U0HA 5JUMA 3IFEA 2C2RA 1FERA 2MKIA 3N6LA 4N56A 2MTLA 4ED8A 3Q23A 4C2MA 5KFPA 5LSLA 4LF5F 4NXNJ 4DPOA 5IFMA 4FVMA 2EFNA 3FFIA 2VOPA 1U24A 3KK2B 3D0HE 4A8XA 2PEBA 4HLBA 2VF3A 3GYGA 2XMUA 2VC1A 1IVZA 3JS9A 3KLIA 2H51B 1HW9A 2LU2A 2UXCJ 3LH2S 2AYMA 1SUQB 2HRTA 3GB0A 5GAGI 1ZBTA 3D0GE 2P6SA 3KYLA 3PW7A 1CJVA 3GIKA 5ETOA 2KVQE 2DR5A 2WBRA 4DWIA 1FE4A 4RUAA 2MLYA 1X9SA 1M0SA 3UN2A 3UWTA 1MW7A 4PPZA 4ECYA 4DQIA 2FPHX 3KHRA 1EQ0A 1T7PA 1Y9OA 4DUYJ 2GA7A 5KFDA 5HJXA 4YB6A 2KKHA 4X65J 2X1AA 4OX9F 4CH7A 1RDRA 5EX3A 1RKJA 2QN6B 4KH1B 3EGVA 2J9EA 3ZZPA 3DHWC 4WU2A 4M5KA 3RJMB 4ILLA 4IFVB 4OI6A 2OELA 3F73A 4K4UA 4JV2A 3NBPA 4ETZA 3CC4S 2M52A 2JEJA 3T19A 1DQ8A 4F3MA 3E51A 1NSQA 4QWAA 3AT1B 4WTYA 1FHTA 3PACA 5J1EB 5G0RA 2J6TA 4URQU 2HHHJ 4M5NA 2BM0A 1GT8A 3PO5A 4QU6A 3MAQA 3UDEA 2HK2A 1R8PA 3ZO7A 1KVJA 1JIHA 4MH8A 4NMXA 4JI0F 6FD1A 4HL9A 3EJMA 2W9CB 2F3JA 2H3EB 3RG6A 4C48A 2GS8A 2HHUA 4TVAB 4G1IA 2ZH1A 4IFYB 3NWGA 2VG6B 3M6UA 4TYAA 5DG9A 1VOMA 4JB8B 1ZOTA 4DZ6A 1VQ7S 3HK2A 2XO6A 3FKBA 3KK2A 3GG1A 2I1RA 4OZ5A 1RLDA 3MM5B 2E1CA 1FKOB 3EDQB 3FDSA 4LIRA 3GFHA 3BH6B 3HT3A 3UCZP 4I6AA 1SC1B 2QL5B 3IXQA 1SUQA 3R27A 2FHMA 1V6HA 2DKOB 4RBVA 3Q24A 4LF7J 5U47A 1O6XA 5DGAA 1GX6A 4JV1A 1UVIA 4OQJA 2CNOB 3SSQA 5DG8A 4N77A 1VQ4S 3MMAB 3H5UA 3CO0P 3S1TA 3X1LB 4KGKA 4WZMA 3FUYA 2IJNA 3R5AA 2M70A 5KFVA 4X84A 2XLIA 4IFVA 1KNZA 5HANA 2PO4A 4ZK7M 1QJHA 2V8PA 5LT5A 1NKCA 3VGUA 1QUVA 1S10A 5J1EA 4K2XA 1RTHB 2R7QA 3PFEA 5IT9U 3W63A 4GKJF 4UOFA 4URSA 1BHNA 2XGPA 5IQQA 5GAGU 3NAHA 4X4VA 1FRIA 2YXLA 4Q8EA 1UPMB 4J9MA 4DL0C 3FMWA 1SJ1A 3DYAB 3ZZYA 3Q89A 3DMJB 4K4VA 3NGDA 4Y34A 5E7OB 2W9CA 1LFPA 4OFZA 2ACYA 4UY85 3IS9B 3VQSA 1RZMA 3FRYA 4IFYA 3FEXB 3UNGC 4B3RJ 1Q79A 4P2SA 2R7OA 2VG6A 3MPDA 2DY1A 3MEKA 4JYAF 3K57A 2KT3A 4B3SF 3TRGA 2RNEA 1HA1A 1SJRA 2BE2B 3UD3P 5E3RA 4OYPA 3BSNA 1IBMJ 2KT2A 2VPWB 2XY5A 2E44A 3MM5A 4C8OA 4ZCKA 4WKYA 1BQMB 2FIUA 1FKOA 4J9KA 4C8MA 2ZHBA 1FNOA 1I3OB 1BC6A 3MF5A 1LKZA 2UZAA 2CJ9A 3RB4A 3IC1A 2JC1A 3T1YJ 3AA8A 2OFHX 1QAXA 5IT0A 5CCMA 2MQPA 3HP6A 2HGNA 2BQ3A 1AFJA 3PYFA 1QD1A 1OYDA 1WC3A 3P49B 1RAGB 4LF2A 3DI6B 1RP5A 5HN0A 3D6MB 4ANDA 3MMAA 1U45A 2G2ZA 2B8QA 2GJ2A 5I3UB 3KLGB 4OHVA 5CABA 4DS4A 2DNQA 2MHNA 2ZZMA 1N33F 5K5MA 4LBPA 4FYVB 2UUCJ 1NSKL 4WK3A 2H4WB 5AXNA 2FHJA 4KHPJ 2QV6A 1NRKA 4ZVSB 1RTHA 1B0TA 1RJJA 3TVYA 4HYKA 4X4QA 1RHMB 1KOHA 3KLFB 1VQKS 1RAFB 3U1MA 4ECUA 2G0IA 3DOLB 2HVHA 1VJQA 4RLEA 2Y1LB 2E7VA 1CLFA 3DYAA 2M7SA 3EGNA 3DMJA 1YSJA 1Q78A 1TKXB 4DFPA 3IS9A 3CCVS 4DL5A 3M7VA 3W62A 2EPIA 2OGUA 5AE3A 4LF4J 2BUNA 1EP4B 4DU7A 2MJUA 4OZ1A 2BE2A 5T14A 4OZ3A 4HH0A 2C2ZB 3DDNA 5H9FK 3T9ZA 1BQMA 3TANA 5CYQB 3FCWA 3OL7A 3V6DB 3I96A 2L08A 4D3GA 5CD4H 2DNPA 3VGVA 1UAWA 4L72B 3CJ8A 4DV7J 4CLKA 2ILZA 3V5RA 3P5BP 1RTJB 5CH7B 1JMTA 3PR4A 3X3UA 2ASYA 4Y6IA 5D4OA 2CVIA 1U1LA 4DUZJ 4AE5A 1FJCA 4Z37A 2I0XA 4IKAA 4ED6A 3UCUP 1U09A 2VPZB 3DI6A 5DDPC 2O01C 4DR1J 1TQLA 3WDOA 2N4DA 5K20B 3PYEA 3BO3A 4KY3A 1RWUA 5I3UA 4DF8A 3KLGA 2GO9A 2VDHA 1GH8A 4K5RA 3BBBA 3PNIA 2UXDJ 3TX8A 2F8MA 5D0EA 3HHLC 1R8AA 3ZC4A 4ZVQB 4IYQA 4LUBA 4C0BA 1QTNB 3KUGA 3CCLS 4R8UB 4B3MF 3IAM9 4NXMF 2C3UA 3EVWA 4JI5F 3KLFA 3V6HA 4FN5A 3DU5A 2GHPA 2KJVA 1KD1T 4P2MA 3DOLA 3MCNA 1FRJA 5DDRC 2M2BA 2HZAA 4R0JA 2VHGA 2ZHAA 1ULRA 4YY3J 5EGYA 1TKXA 2FTRA 5KG1A 1M5HA 2CQDA 3UR0A 2BOPA 2AF6A 4J91A 4Z2XA 4AL7A 1RAOA 3NKYA 4OL8A 1EP4A 2XMMA 1UEKA 3DDKA 5LOQA 3FSXA 4CLLA 5IWAF 4GRSA 5A2QY 4ZVGA 3S7RA 1YJTA 3ZZUA 1NLKL 3KJNB 5C5JA 4HTIA 4RUCA 3N6MA 5CYQA 1ACMB 3V6DA 2QSFA 1T94A 4I2PB 4TLRA 1UETA 1WG5A 3O1LA 3T6JA 4NEZA 1PGZA 1RTJA 1AYEA 1XNRJ 1S7HA 3N5BA 2LECA 1SI9A 2UXBJ 1W25A 2CQ2A 2LP4A 3G8QA 3PO4A 3NG8A 1RQ0A 3Q8YA 4JI6J 2R8JA 2BJ8A 5D0HA 3ONQA 1SKUB 1NDCA 4TY8B 4ZLPA 2AJ4A 5M2UA 4DSJA 2M4MA 4LSZB 3SSSA 1AUDA 3TWZA 3W3SA 1H6KX 5K8PA 1XC9A 1HFEL 3H90A 5HJYA 3KUHA 4WFNQ 1CVJA 2HFSA 3H42A 1RYRA 3WZ0A 4ZPBA 2HYIB 1YK9A 1XNQJ 2MQOA 3TVKA 2PFDA 2EFVA 3FGVA 4FYDA 1EAYC 4YMEA 1HKAA 1WDTA 1CJKB 2DK2A 4F26A 3GILA 3HKWA 1X5SA 2P9GA 4R8UA 1TU0B 4QR2A 1WG4A 4DL3A 1VIOA 3K5MA 2CIMA 1JXVA 5KFCA 1F5BA 2MZRA 4ZDNA 3HD2A 1TTHB 4V19X 4DQRA 2NLWA 2NXCA 3TO8A 2NSCA 1F2HA 1YQHA 1RWMB 4C0HA 1FA0A 3DFEA 2AZ1A 4MIWA 2A6OA 1JX4A 3CGIA 2CFXA 2VUGA 1QUPA 2XWXA 5EDWA 2IYGA 4FBUA 3HVWA 3OTEA 1W2BR 3SYZA 3KDOA 1N0VC 3E01B 2WW4A 2XC9A 4M5MA 2CQIA 2EFGA 5CD4A 3M8YA 2PA8D 4C8YA 1FK9B 4YHHF 3C14B 3GG0A 3PRBA 2W2QP 4I2PA 4DPUA 2IRUA 2U1AA 3M8RA 5I3QA 2M8HA 2IM2A 4WBFA 1VQ8S 4X64F 2N7CA 1C0TB 2OKQA 1B99A 5F9NA 3T5LA 3D66A 1Y00A 3K5NA 2CNNB 2HNZB 3BGUA 2YX4A 4RBUA 3M9OB 3B6BA 1FKAF 4B9TA 4TY8A 2HLTA 4RNFA 3SCLE 3LTOA 3QGHA 2W8LA 3C2PA 3D9BA 3T6BA 2HK3A 4YP3A 4LVOP 1C4CA 4OHYA 2RRNA 1SH0A 4O3NA 2L9NA 1OJ4A 4ECWA 3D5MA 3R5DA 2XY7A 2JVOA 4FBTA 4QYRA 4ID8A 4QR0A 3D1QA 3OVSA 5CYMB 4X2BA 5JJBA 2XI3A 1IM6A 3CJTA 3UDLA 2JX2A 1UFKA 1CJKA 2B9XA 3PY8A 4LJMA 5KFHA 2FVCA 5T7LB 3UPFA 5CYJA 1L3TA 1W26A 2DRAA 1FFSB 3FBEA 2LU1A 5A0YB 3JTPA 3CF5Q 2W2NP 2J6UA 2IDEA 1KQKA 1NK6A 4FZVA 2EKYA 3G6XA 3DRSB 2CG4A 3QT5A 1TUGB 1K0VA 2GNKA 5ETKA 3MPYA 3ISND 4DS5A 2HZVA 3KHGA 1JLCB 2DR6A 1W2IA 4IOAQ 3PX4A 1NJXA 1WHVA 4DJBA 2RDDA 1WDDA 3VR1A 3HM9A 2YH0A 4J7CA 3E01A 2ZC3A 2YNIB 1L3UA 5JVHQ 4IQXA 3NS7B 1FK9A 2KFZA 3PTWA 4CYUB 2D3ZA 1EB0A 3G86A 1TL3B 3C14A 3PCOB 2MSTA 3I87A 2RU3A 3HLUA 2ABYA 4ZPCA 1IBLJ 4ZMMA 1Q1KA 2ZBPA 3GJRB 1C0TA 1XIQA 1VI7A 3GIRA 3H8YA 1LNQA 2HAFA 4NLYA 4ZP6A 1G1XA 2E9RX 3V81B 4LVNP 5DDOC 2HNZA 4J9NA 2MKYA 4Q8FA 1HNXJ 3U27A 1ROFA 2LQ8A 1KHWA 3TJ8A 4JI7F 4GKKJ 2XMAA 1H73A 1P8GA 1RTZA 2W1BA 4F4KA 1GX5A 1REGX 2AMCB 2MZ1A 3NOCA 4FNHA 1VR6A 2B9YA 2G4BA 2VJVA 1P9YA 3OBIA 3ZNJ1 1ZETA 2OPQB 5IS2A 3S6EA 4FF3A 4RU9A 1APSA 2DGSA 1VC0A 4QPTA 5CYMA 2V4QA 2MQ8A 4KSEB 5K9FA 2MQLA 1T95A 2O67A 2KZZA 5KFEA 2QA4G 5HK4A 4QWBA 5T7LA 1H72C 4MMOA 1K47A 3MOZA 2CQ3A 5A0YA 4UUXA 3RBEA 1C0UB 5B0CA 2VFRA 4K4TA 1RHJB 2YKQA 2DGUA 3W65A 2MY8A 4ES1A 3DRSA 3HKZD 4BDPA 2LCWA 4OI1A 3UN5A 1QY7A 3JB9k 3O3LA 1JLCA 2DITA 2FY8A 4NI2B 4ZIVA 2GQ2A 1ZM2A 1OYEA 1S0MA 1RT2B 3QWUA 2DISA 5ETPA 1JLFB 5DDQC 4K4YA 3KMSA 4GMKA 2LLZA 2YNIA 4WYWA 5ETSA 4HDGA 1RE1B 2JL9A 4FYYB 1SH2A 4G3IA 3QSYB 4CYUA 5KG0A 1TL3A 4LT6A 2Y1IA 4NLUA 2J6SA 2GIRA 4CO5A 3PRVA 2W9BB 2MYFA 3BDPA 1DBDA 2G2YA 1KFSA 4U8VA 3M2RB 4B3TJ 3FRZA 4H54A 2AV5A 4X4UA 3V81A 3BYRA 1Y4ZB 4ZHRB 4ZVHA 1HHTP 2A18A 2YWHA 3HJFA 2H5JB 2ZNZA 2PI4A 2HNYB 3MEEB 2DCUB 5F3ZA 2IAJB 2RS2A 2XBPA 4DR3J 2E7XA 2GMHA 2FZGB 2ZUGA 1CC8A 2FD2A 2OPQA 2Z57B 4LR9A 2F8HA 2V8VA 2QE5A 4MK9A 4XIUA 1YJWS 3OL9A 2DBBA 2WVDA 4X66F 2RQCA 3GIIA 3PDNA 3TZZA 2Y8WA 1IKYB 2CZ9A 3SI8A 1ZS6A 4M5IA 3DLHA 5I4MA 4JI3F 4C8NA 5KAKA 2AJFE 2A0FB 4QPXA 2BACA 3QLHB 1C0UA 1KQSR 1Y3KA 5I42B 2KFNA 4DV4J 3ZXWA 4JI4F 1PILA 1Q95G 5HQMA 4DQQA 4AQYF 1XWLA 1VC5A 1QE1B 1M1KT 1KTVA 4NI2A 2AP6A 4ED4A 1RT2A 2LEAA 3R8YA 1Q8KA 1IBKJ 4ZVUB 2PSZA 1WJ9A 1JLFA 2BJ1A 2CPZA 3LGMA 2GZOA 3W5XA 1LOUA 2HQ3A 1U0SA 3HFZB 1Q5VA 2QMWA 1N5QA 3K5PA 2JSXA 1S6OA 2HHSA 1SIWB 1U8WA 3JTOA 5A8WB 4RNMA 2HVDA 4KPCA 2FC9A 1IKWB 5KFWA 4NCAA 1KTQA 1ZAXA 3FZBA 2WW8A 4WTOB 1HMVB 1FRMA 1WORA 2W9BA 2HPUA 3THPA 3EM1A 3D3CJ 3BQ0A 4LIWA 2KDOA 7FDRA 1AA1B 3M2RA 4OI2A 3TA1A 4LRBA 2HQFA 4OV1A 3MAHA 3B4DA 2Z2MA 4ELTA 2YQ1A 2BRLA 4ZVTB 3DOMB 3EE3A 1R6YA 4PZVA 2V2KA 4ZHRA 4PXEA 3LOUA 1NCLA 2EK6A 5HMWA 3MM7B 2UV8A 2HNYA 3MEEA 2IAJA 4YFUA 2VQEF 5B0FA 5L1KA 2XTJP 3LP0B 1UW9A 5L1LA 4YQWA 4DFKA 1T0TV 1KVKA 1V3ZA 3QIDA 3VWSA 4K4SA 2JRSA 4F36A 3TUZC 1FDBA 2HKEA 5DZ6A 2KL8A 4GC7A 2NSBA 2E1MC 1IKYA 3FQKA 4DR2F 4NMLA 2NUUG 3VCDA 4NZ6A 4FDFA 4ECZA 3PM9A 5KOWA 3QLHA 3MWBA 5I42A 1YGYA 4I67A 2M0GB 2BJ9A 1XMOF 4NYOA 1YX2A 4UZBA 2AIRB 3PR5B 4DCPB 4K4XA 3R5CA 2DGTA 3CCWA 3F56A 1QE1A 1JLGB 4UZCA 3CMQA 2FJVA 3WQPA 3TEHB 5L38A 3J7Z5 2YH1A 1YIJS 2R3VA 2VASA 3NS5A 2OO4A 3R2DJ 1KVIA 4KBIA 5H1SV 1U1NA 2GJFA 1G2EA 4JOUA 2R7XA 4CQ1A 2BVZA 3DLGB 5HQ8A 1YRUA 3Q22A 4ED1A 3CCTA 3HFKA 5A8WA 3AQOA 1IKWA 4XDDA 2X3GA 2HIQA 5HL7Q 1HMVA 2HMIB 3PX0A 2N3LA 2BOAA 1NAQA 4DCJB 4F4WA 1RCOB 3PEHA 4IDKB 1UJ6A 1UVNA 2D7SA 2JJ4D 3DOMA 4J9PA 2B7BB 4LFAJ 3MM7A 3GYXB 4G1PA 4K59A 1Q82T 2QMUB 4DR5F 2ZITA 3LP0A 5M2PA
chains in the Genus database with same CATH topology
2Y0SD 4N47A 3BO4A 3GE9A 1LXJA 2X1AA 2FHJD 2ZDOA 4OX9F 3SCJE 4CH7A 1BGXT 1RDRA 5EX3A 1S6QA 3FQLA 4DEZA 1RKJA 4PG6A 2V4JA 3M1VA 4I64A 2B6AA 2J9EA 2MHEA 2JWNA 3LF0A 5LXRA 2J7WA 1DJ0A 1FD2A 3ZZPA 3QYYA 3DHWC 2D9OA 3CMAS 4WU2A 3HO1A 4JV0A 1X5TA 1HBMB 2KG0A 2CQ4A 2RILA 4ILLA 5KFLA 4KT0C 1UA0A 3UQSA 4RWXA 3VAHA 5E2QA 2RQMA 4IFVB 2OPSA 1QVFR 2N7YA 2EBGA 4OI6A 2OAUA 5LJ5Y 4CTAB 3F73A 4IR1A 4K4UA 2E66A 4JV2A 2QMXA 3QJJA 2ASLA 2BDPA 3NBPA 3CWJA 2LYVA 4ETZA 3CC4S 2M52A 3H2VE 3DM2B 3T19A 2JEJA 5D4NA 2UUCF 1RT6A 4DF4A 4E98A 1DQ8A 4QR1A 4F3MA 4DSIA 2IHR1 3E51A 4KFBA 3K58A 3CC7S 2XSJA 4QWAA 2MZSA 4MK7A 4TN2A 4WTYA 3TAQA 1FHTA 2DHAA 4QIVA 1SQEA 3PACA 4DG1A 2NYIA 1N48A 3R5BA 5B0AA 5J1EB 1JXEA 3E3XA 2UVUA 3QPIA 5KFFA 3KKFA 3BJYA 4YR2A 3OW2R 1TFWA 2KTQA 5G0RA 2XCAA 2MZQA 2J6TA 4URQU 2V5HG 2YNGA 4KHPF 2VKZG 4U7UK 4I68A 4DFJA 5J2QA 2BM0A 3HHEA 4ED0A 5KG4A 4CO3A 1GAOA 6FDRA 2ZH4A 4BS2A 1YWXA 2ZH8A 4PG7A 1GT8A 3LP1B 1IXKA 4RW6B 1TKTB 3PO5A 3NLCA 2E1AA 4QU6A 3GZ7A 1VBZA 5KFAA 3MAQA 2K2PA 3H5SA 1J5EF 4KJIA 2G1DA 1R8PA 3N9UC 3GIJA 2VA2A 2B51A 3VALA 1JLGA 1U2FA 4OJ1A 4Y2CA 4MFBB 2ZDPA 3MMJA 4PUOB 1KVJA 4K0KF 3T1AA 5F8GA 3N0VA 2J0WA 1JIHA 4MH8A 4JI0F 2A10A 4C3MA 4BBYA 6FD1A 4HL9A 5BYQA 3KLHA 2AWZA 4FVCA 5LSOA 4EYHB 3R1LA 2W9CB 2IM1A 3IWNC 1IR0A 4NPOA 2F3JA 4HDHA 3M9MB 5FLXY 3JYTA 1NH7A 4G6VB 2ZH6A 5D77A 2DR7A 2QRRA 2HHUA 4G1IA 2V94A 1V3RA 2ZH1A 4YB1P 2KO1A 2DHXA 4IFYB 4K5SA 3NWGA 1N54B 2VBYA 5DQIA 3CUNA 1QSLA 2EW9A 1Q8BA 1R0AA 1HI8A 2VG6B 1MMLA 2RDJA 3DLGA 3WC2A 3M6UA 4ATNA 2IM0A 2MQMA 2ALZA 5KG5A 4TYAA 5DG9A 1NKEA 2VPYB 1VOMA 4G1QB 5B0GA 5K8MA 5GADI 1ZOTA 2MSSA 3IAS9 4KE5A 1VQ7S 2R7UA 3HK2A 3HHLA 1N36F 3KK3A 2FLOA 5J1PA 2ZH7A 3LO3A 4TQRA 1FE0A 1Q4RA 2LXIA 4LF4F 3KK2A 3GG1A 3LGNA 4FS1A 5KFJA 1K1QA 2I1RA 1HQEB 1R43A 4OZ5A 4J9QA 3MM5B 4LF8F 3AJ2A 1S9EB 2F4VF 1H7WA 2HMIA 1YITS 2HHVA 2E1CA 1XR7A 2R2UA 2UVVA 5F8JA 3MECB 1TVRB 3N79A 1FKOB 1C1BA 1QAIA 4IR9A 3FDSA 3UR3C 1CQMA 1LW0A 4LIRA 1KR4A 3M2VB 1D3WA 2DH7A 3GFHA 1HI0P 5L8RC 3HT3A 1GTEA 4RW7B 2XULA 5I3PA 4QQBA 3UCZP 4I6AA 5E3CA 1ZPWX 4IDKA 1B0PA 3RU0A 1CQNA 3IXQA 1LV5A 1SUQA 2DJWA 3KK1A 3R27A 5KFTA 3SZ2A 3H5XA 3IGNA 3MMCB 4C3KA 2UVWA 2FHMA 2C2DA 2PI5A 4DV7F 1V6HA 3L7OA 5KG6A 2FVQA 1IKXB 3BQ2A 4DLEA 1P27B 5FIIA 2YNFA 3MM9B 5KT3A 1SKRA 1E6YB 4RBVA 3PEJA 4M95A 3Q24A 3RYLA 2CJKA 1HBUB 1NHVA 5U47A 1DLOA 5DGAA 3ETOA 3K8VA 1GX6A 4JV1A 2AJ0A 1FXRA 1UVIA 4OQJA 3DCAA 1FRLA 2GHVC 2YWEA 4DSFA 3N5FA 4DUZF 2K3KA 4ED7A 4YR0A 1I6JA 3RRHA 5GAHI 2CQHA 2ZZNA 3SSQA 5DG8A 2ZH9A 3OLAA 1S77D 4GC6A 1AROP 2IVYA 2VD3A 3GR1A 4N77A 1Q8IA 2C22A 1L3VA 1VQ4S 2W4PA 3MMAB 3H5UA 3GYNA 2ZH2A 5B0EA 1VMBA 1NK7A 4EBDA 5KG7A 4NZ0A 3MGJA 3IRXB 3S1TA 4DR1F 3X1LB 4KGKA 2DIUA 4EUVA 1UL3A 1MMNA 2IBOA 3GR0A 4WZMA 2DPJA 4MIAA 1HBMA 1K8AT 1QAYA 2IJNA 1S0NA 4WZQA 3R5AA 3WC0A 2A3JA 1O8BA 2M70A 5HBMB 5IXUA 5KFVA 4X84A 4DN0A 2KXHA 2XLIA 4IFVA 3MFHA 2N3OA 4EBCA 1CPZA 2APOA 4F4YA 4F02A 1KNZA 4CTAA 1FEHA 2B0GA 1VQ5S 2CQPA 4C3LA 4C98A 2UXDF 3AA9A 3DM2A 2PO4A 3N6NA 4ZK7M 2VONA 1QJHA 2OD6A 4L6V3 3TUJC 3JSBA 5LT5A 5KG3A 3BN4A 1NKCA 3V4MA 1D9AA 1QUVA 1S10A 3PFOA 5J1EA 4ZA1A 4KAIA 4K2XA 1T3OA 4M5DB 5E5NA 1RTHB 5KTQA 3JSMB 3RBDA 2JLFA 4Y2AA 3DOKB 3PW4A 2R7QA 4ECQA 2VG5B 4NRTA 2FGOA 5CZVA 3PFEA 1JLEB 3MM6B 5CZXA 2OJ3A 3CEDA 3MHYA 4MKAA 4Y00A 4GKJF 4KB7A 3CD5A 3LP1A 4RW6A 4F50A 1TKTA 2Q6CA 4URSA 4OI0A 2XGPA 2GJIA 1XR6A 2IA0A 3HX9A 2HW3A 1ZYQA 4FXWA 2UUTA 2PC6A 1ZZFA 5IQQA 3NAHA 5GAGU 2LXUA 4X4VA 4KPYA 1FRIA 4TXSA 3AY0A 3NNHA 1KONA 4L3NA 4Q8EA 5CQGA 4MFBA 3C3LA 3L3CA 1LQ9A 3C66A 2HWIA 3HHLD 4R25A 3T5KA 4PUOA 1YG0A 2EC0A 3CSKA 4J9MA 5L9XA 4DL0C 4LFCF 2VFUA 3AQPA 3FMWA 2EK1A 1SJ1A 3I4HX 3K0JA 3DYAB 3ZZYA 4ZVEA 2WBMA 2Z0GA 5KFYA 3H98A 4O4RA 3VAJA 3DMJB 4K4VA 1REVB 3M8QB 3NGDA 4Y34A 4AXJA 4I0WA 5E7OB 2W9CA 1LFPA 4OFZA 2ACYA 2ZKUA 4F3OA 2X1FA 4UY85 3IS9B 5IZHA 3VQSA 4QW8A 3FRYA 1XERA 4J37A 4IFYA 3FEXB 5EX0A 3UNGC 1Q79A 4P2SA 2VFVA 3F44A 2R7OA 4YY3F 2VG6A 3LP2B 3MEKA 4JYAF 4PWUA 4O4GB 3K57A 2IJFA 5EWGA 2KT3A 1T8EA 2FHOB 4G1QA 1OO0B 1ZTWA 4B3SF 2B43A 3TRGA 2RNEA 4TU9A 4JV5F 3SSRA 1HA1A 1SJRA 2Z4PA 2BE2B 3EGWB 4WE1B 3UD3P 3ITHB 3EPIA 5E3RA 1SXLA 3BSNA 2KT2A 2VPWB 1HQEA 2XY5A 1TL4A 2E44A 3MM5A 1X4EA 2YKAA 1S9EA 3OR1B 2MGZB 1OIAA 3KTQA 2CQBA 4C8OA 4ZCKA 4WKYA 2D3UA 1KFDA 2RKIB 1BQMB 2FIUA 5CHCB 1KS2A 1FDDA 1TVRA 3MECA 1FKOA 5E33A 5A6PA 4J9KA 3CD6S 5C42B 4QYZJ 2KYXA 3AHPA 1WF0A 2FC8A 4WIIA 2D1CA 4C8MA 3M2VA 2ZHBA 1U48A 4BCAA 3CULA 4RW7A 4LMZA 1Y5LB 2YY3A 4MK8A 1FNOA 3J7ZT 3OFGA 3HZEA 1BC6A 1DARA 2C3YA 3MF5A 2PFFB 1LKZA 4ZPAA 2UZAA 3B8HA 4PXCA 2CJ9A 3RB4A 3IC1A 2JC1A 4A48A 4X62F 1Y7PA 4ILMA 1R7IA 3MMCA 1MROB 3AA8A 4DL4A 2OFHX 1OSDA 1N6QB 1X8DA 1SL2A 1QAXA 4N8NA 2XCPA 1HQUB 5IT0A 5CCMA 2FLNA 1IKXA 1UFLA 2OLWA 2C3OA 2FJDB 2MQPA 3HP6A 2RH3A 3OVAA 2HGNA 1L5UA 3MM9A 1E6YA 1XNRF 3KFWX 4RUHA 1HBUA 4OZNA 2Y1JA 2WB4A 3RAXA 4MJKA 3CCSS 2M8DB 1TFYA 4K50A 2BQ3A 2AX0A 2UXBF 1AFJA 3NRBA 1QSYA 3CE8A 2MB0B 1Z2ZA 2O5DA 1BLUA 3CJ4A 3HHDA 4BWJA 3F41A 3P49B 1U2RA 1X4HA 1NJYA 2C3MA 4XK8C 3DI6B 2HHWA 1RP5A 2JOQA 2RSQA 4JI8F 5HN0A 1VQMS 3SCKE 2J0SD 2P6TA 4NLRA 2YWFA 2IM3A 2G0CA 3IBWA 4JI6F 2HGMA 2QA4S 2XMVA 3CDWA 3UI3A 3ICLA 3MMAA 1U45A 2GC8A 4NA3A 3VAMA 2GJ2A 2ZH5A 2XGQA 2R8GA 3IRXA 3EGZA 2J9CA 1VRUB 3EX7B 4ED5A 5I3UB 5D4PA 3HMJG 3KLGB 4OHVA 2GX8A 1X9MA 4DS4A 2B4UA 2DNQA 4IRDA 2D74B 1H0HB 2VBWA 2MHNA 2ZZMA 4TY9A 1N33F 3D28A 1JJHA 5K5MA 1HNIB 1KRPA 5HMZA 5HBMA 3T5HA 1WHWA 4WK3A 3TOQA 1ZM9A 3D0IE 2ADCA 5AXNA 5GADU 1XNQF 1HL6A 2FHJA 3UW1A 2ZOGA 1DZ5A 3C6UB 1DQ9A 3SXLA 2BW2A 2VH7A 4RW8B 4EGLA 4YUDA 4RWWA 5SZTA 1B64A 2QV6A 1NRKA 1DQAA 3RAQA 2ZJPQ 1FEEA 4IH7A 4NYPA 4M5DA 1UKUA 1RTHA 1B0TA 3J81Y 3JSMA 4DN9A 1RJJA 3CPWR 1F60B 4N8OA 3DOKA 1ZPVA 4DOZA 2LKZA 5LSRA 1N88A 2RUGA 2OIHA 1S1VB 2VG5A 3TVYA 4LQ9A 1JLEA 2DO4A 1CSJA 3KG4A 3MM6A 2CKWA 5M2RA 4HYKA 1ELOA 2LEBA 3OFHA 4X4QA 2FB0A 2ZE2B 3I82A 2C3PA 1FVQA 1KOHA 3KLFB 1S1TB 1VQKS 2C28A 3U1MA 2FLPA 1AW0A 4PQUB 4V19J 3M05A 1HPZB 2BBEA 3A1YG 3RR8A 3PKMA 5F8IA 5FDLB 1HWJA 2KM8B 4ECUA 3I32A 4DLGA 1VC6A 1NZAA 3DOLB 3ENVA 2K7KA 2HVHA 4RLEA 3PW5A 2DTJA 3OFEA 3PZPA 5DJBA 4ZOSA 1CLFA 4ECXA 3DYAA 3BSCA 4KV8B 1WEXA 4CZCA 4PG8A 4UOCA 2M7SA 2PIIA 3E8OA 2OPRB 1YVFA 3EGNA 3DMJA 1TK5A 1REVA 1YSJA 3CJ3A 3M8QA 4B02A 1RGVA 4DV0F 1H2UX 3CD0A 4CO4A 1X4BA 1Q78A 2CQ0A 2LA6A 4ZCMA 1TKXB 1KOOA 4DFPA 3IS9A 3QO9B 3CCVS 3V6JA 3RB3A 2GO8A 4DL5A 3J7A1 4A8WA 2PN6A 5GAHU 2WHOA 3LP2A 2EPIA 4RW4B 2I8EA 4QCLA 5AE3A 4O4GA 2B4OA 2R7SA 2RIJA 2WONB 2UV8G 2VB6A 2W4DA 3NGKA 2BUNA 2KXFA 2YWKA 1EP4B 1WEZA 3OR2B 1C2PA 1DURA 3I0RB 2MJUA 2R8IA 5AJ3F 4OZ1A 5KT6A 2BE2A 4WE1A 5T14A 1R3NA 3ITHA 4EO6A 4ZKAA 1NO8A 4F3QA 4B17A 4IRCA 2IRXA 4HH0A 3DDNA 2N4CA 3KWMA 2JH3A 4Y2IA 3OL6A 3EPGA 4USIA 3T9ZA 3OR1A 2MGZA 1O5JA 2RKIA 1NK4A 1BQMA 3TANA 2FDNA 2CPIA 3V6KA 5CYQB 3OL7A 5C42A 2L9DA 3H59A 3V6DB 3I96A 3P5TL 2L08A 4D3GA 5CD4H 2DNPA 2HFNA 1RT1B 3J7YI 5HLFB 1FD8A 5IT4A 3POTB 1UAWA 4L72B 4ZPTR 3OJSA 3MR2A 5G4DA 1LW2B 5KFQA 2ILZA 4B9SA 4EEYA 3V5RA 5K14B 3HXMA 1RTJB 1J2VA 2X51A 3QIPB 2XLJA 3FSYA 5CH7B 1MROA 1B0VA 4PCQA 5DG7A 1N6QA 4NLTA 1JMTA 3DGPA 1HQUA 4KHMA 3QAEA 5J2NB 4C7QA 4U7CA 3PR4A 2H5EA 3X3UA 4AL5A 1RT4B 2DGXA 2ASYA 4Y6IA 5D4OA 1QLNA 2ZFHA 3BR9A 2CVIA 1U1LA 4AE5A 5MLCV 2GGPB 1FJCA 4Z37A 1MU2B 3ZZTA 2DB1A 1YBAA 2E7WA 3M8SA 3GMGA 2I0XA 4IKAA 2F9JA 3MTKA 4ED6A 5KT5A 4E0DA 1FXLA 2PEHA 3UCUP 1U09A 2YKNB 2VPZB 4WFXA 4H4KA 1YJRA 4PXBA 3DI6A 3DNCA 5B0BA 5DDPC 2O01C 4IH5A 5GMKa 5EN1A 1A9NB 1D0EA 2M3DA 2KM8C 5DLGA 1HWIA 2NXUA 2VFTA 1RT5B 1TQLA 1WHYA 1RTDB 5DM7Q 3WDOA 1FDAA 1FNMA 2N4DA 1HNVB 3G8TA 2IMOA 1F0XA 2J9DE