1RGVA

Crystal structure of the ferredoxin from thauera aromatica
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
ALYINDDCTACDACVEECPNEAITPGDPIYVIDPTKCSECVGAFDEPQCRLVCPADCIPDNPDYRETREELQEKYDRLHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ferredoxin
publication title Crystallization of 4-hydroxybenzoyl-CoA reductase and the structure of its electron donor ferredoxin.
pubmed doi rcsb
molecule tags Electron transport
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2003-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rgvA00
1F5BA 1Y5LB 2FJDB 3MMCB 4DHVA 2WSCC 3IR7B 4YDDB 3MM5B 3MMAA 1A6LA 1FDDA 1FRXA 1RGVA 1DAXA 1IR0A 1JNZB 1JNRB 1C4AA 2C42A 3MM9B 2GMHA 2O01C 1FDAA 1FD2A 3HKZD 1B0PA 1VJWA 1D3WA 4CI0B 3EUNA 1FDNA 3MMBA 2V2KA 3OR2A 4OV1A 1PC4A 1FRLA 1BC6A 1FTCA 2FJBB 3C8YA 3EGWB 4XDCA 1BQXA 1SIWB 2GMJA 2XSJB 2FJAB 4XK8C 2PA8D 1FDBA 2WAQD 1IQZA 3LW5C 7FD1A 4Y28C 1G6BA 3EXYA 3OR1B 5BYRA 2ZVSA 1FRIA 5CHCB 1BD6A 3MMAB 4XDDA 2C3MA 1FERA 1WTFA 2FJEB 1AXQA 1PC5A 2WB1D 2C3UA 2UZAA 1GT8A 1B0VA 2VPZB 5L8RC 1KQGB 2FGOA 3MMBB 3MMCA 4OMFG 3OR2B 2V4JA 1R27B 6FDRA 1H0HB 2PMZD 1KEKA 1XERA 3MM6B 1FXDA 2VPWB 1JB0C 7FDRA 1HFEL 3MM7A 1GAOA 3MM8A 1H7XA 2VKRA 1F5CA 3IR6B 3PNIA 1KQFB 5E7OB 2C3OA 4AYBD 2FDNA 5BYQA 1ROFA 4KT0C 1K0TA 1Y4ZB 1CLFA 2WSFC 2VPXB 1B0TA 1FCAA 1H98A 3GYXB 5FD1A 3MM5A 1H7WA 1SIZA 1Y5NB 1FEHA 1Y5IB 2VPYB 1BLUA 1FF2A 2V4JB 1DFDA 4L6V3 2C3PA 2IVFB 3MM9A 1FXRA 4RKUC 5BYSA 1BWEA 6FD1A 5CH7B 2Y0SD 3IR5B 1FRHA 2PDAA 1C4CA 1FRKA 3MM7B 4ID8A 2C3YA 3MM8B 1F2GA 1GTHA 1Q16B 2XSJA 2FD2A 2WSEC 1DURA 1FRJA 1FRMA 1G3OA 1GTEA 3OR1A 3MM6A 1SJ1A 2Z8QA
chains in the Genus database with same CATH superfamily
3S1TA 1TK0A 4B17A 4RBTA 4EGLA 4JV2A 2LQBA 2XG8A 2WVCA 4HHUA 4F4KA 3HFKA 3P8BB 2OPQA 2MDAA 3T1YF 2Q66A 5EUHA 2WVEA 1S1VA 2DNMA 2MYFA 3SXLA 3H0PA 5KFQA 3ZTOA 2YWFA 4L74A 4WE1B 1RTJB 2YNIA 1RKJA 1S97A 1H73A 3Q8UA 2VBYA 2VUGA 5B08A 2OPPB 3LGNA 3T5KA 3M6UA 1HNVB 4WK1A 4YUDA 2C2NA 3U1MA 4DWIA 4ZCMA 5F8JA 2DBBA 5GMKa 2GC8A 2XSFA 5CD4H 4U8VA 5D4PA 1X8DA 1JLCB 4DU8A 5I3QA 1IR2A 4ALZA 3DOKB 3U1NA 1NDCA 2YY3A 2E1RA 4DLEA 3D54A 3ZFVA 1JLFB 3GSIA 2C28A 1M5HA 6FD1A 2Z4PA 4OYXA 3FRYA 4DV5F 1FRKA 1CJTA 1YJ7A 2OTJS 1V5VA 4ZVEA 3B82A 5DM6Q 1O0PA 1OQ3A 4PYAA 9RUBA 2R4FA 4J9QA 3SDEB 1TVRB 3I32A 4KGZB 3CC7S 1DJ0A 5E3QA 1RAHB 4DN0A 1RT3A 1UEVA 1NMEB 4G1QB 4CH1A 4RR5A 1S1TA 2EC2A 3R27A 4W98A 4B9VA 1HBOA 3R5CA 2A2CA 4A4JA 4ICLB 4B3OA 2GVZB 1FK9B 3HF5A 1CVJA 4N7TA 2UUAF 3D3BJ 1KQSR 2IJNA 3ENVA 4MK9A 4MK8A 4LF9J 4RW7B 3KLHB 5KFXA 2VV5A 3PJWA 1R0AA 4NPOA 1IKVB 3CJKA 3K17A 3LO3A 5C24A 1W2BR 2R7WA 3IFEA 5ITHA 1AB8A 2NCKL 4A8KA 4UOHA 1KLMA 2CNOB 1QAXA 3DRRA 4KO0A 2KM8B 3AJ2A 4QWCA 1FKAF 2JDJA 2BJ9A 3GCXP 3FEZA 2KM8C 2LLZA 5ETOA 4DV6J 1K44A 3IRXB 1CPZA 1J27A 1JLQB 3OTCA 5H9EJ 1VISA 1AFJA 1I1GA 2Y8YA 3T5HA 5EWFA 1FRLA 3LP2A 3I5AA 2F8EX 3ZZ0A 1YKWA 2BRKA 4G1PA 3S6EA 4ZP9A 2DIUA 4ILLA 3PY8A 5KFPA 3FBBA 3K58A 2FHJA 5T41A 1N33J 4ZMMA 2WCXA 1NDPA 4ANEA 3UNYA 1Q53A 3PO5A 3RBXA 1Q79A 3IMQJ 1RADB 1REGX 4J91A 5A0YB 1IKWB 3MEEB 2RSQA 4OI1A 2HHVA 3TUPA 4J9PA 2BEFA 1QVFR 1KQFB 5GAGU 1HWJA 4UUXA 3CULA 4OI0A 2CJQA 4MKBA 2F5GA 2XO6A 3V5RA 1F6TA 3BKUA 2IY5B 4USUA 4BC9A 1VLOA 1GTHA 4HLBA 4F0KA 3KK3B 3F56A 3MMCB 2P5VA 2F9JA 3O6QA 3D0HE 1HNWF 1R0CB 2HRTA 2BZ2A 2GAHC 2HQDA 4NXMJ 5CQGA 4RW6B 2H65B 4Y6IA 3W5XA 3M1VB 2Y3YA 2B3TB 3R5AA 3RR7A 5ETPA 2HPUA 3ITHA 4I1TA 4A48A 4ZVSB 2HKEA 4X66J 1NK6A 4NXNJ 4XDDA 5K8MA 1P9QC 2F8MA 3D28A 3BPSP 3K0JA 1FFSB 1HWUA 3O1LA 5KFVA 5J2NB 1KEKA 3K5NA 3VF0B 4ES3A 1UFWA 2Y1JA 1HIYA 3LOUA 4NLUA 2Q3PA 2C2KB 3NNAA 2GHPA 3TEHB 2VQFF 3ZNUA 3JYTA 2M8HA 5J1EA 2W9CB 3KMQA 4MAKA 3CPWR 3A4TA 3FBEA 4K4VA 5K8OA 3CCJS 1ZZNA 1BQNB 5HJYA 2FLNA 1S6QA 2KTQA 3PW5A 3M9OB 3B4DA 3HK2A 1Y3KA 2HEKA 3KLIA 1WJ9A 5T14A 2E5LJ 4ATNA 2Q1LA 3R2CJ 2HMIB 5AXLA 2KYZA 3H25A 1QAIA 1U45A 2L9NA 3F44A 4USIA 3HFVA 3HJVA 2ZH4A 1RE1B 3O3LA 2IVYA 3BQ0A 1IM6A 4USKA 5A8KB 4ECQA 5BJRA 3ZO7A 1RAGB 1RAFB 1U48A 3MHYA 1ACMB 2DR5A 2VU5A 1R8CA 2HGMA 4WJBA 3N79A 3ET6B 1IR1A 4OYMA 2O67A 3BV8A 1FX4A 1NK7A 2QO3A 4IG3A 2Z2LA 3OD2A 3OTDA 3M32A 2YQ1A 4QR2A 4YHHJ 1S9EB 4PWDA 4CTAA 2HQFA 4FKYA 2PIIA 2DGVA 4F25A 4AL5A 2PEBA 4UY85 1FDBA 2VF3A 3FQKA 1UFKA 1UAWA 2QA2A 3TZZA 4KGVB 4UOGA 3PEJA 3DYAA 1QY7A 5C25A 4DQPA 2VQEF 1VRTA 4CQ1A 4DQRA 1HLWA 3I82A 4TY9A 2OUGA 4I2QA 3HULA 1PAEX 2BANB 5D4OA 1X4GA 4AD6A 2CJXB 2VFSA 2HBQB 4MT1A 2FDNA 1QLNA 3MUMP 3NCQA 2VC0A 1CLFA 1X9SA 4RUCA 5THWA 4EZ9A 2MLYA 1REVB 3GE9A 5HVHA 2VG5B 3PRVA 1K1QA 1WHVA 3FEYB 1ZYQA 3G96A 1WF0A 3TUIC 2N82B 2BJEA 3TW0A 4PZVA 4C8YA 3CF5Q 2GVDB 4KH1B 4ZCKA 3LP0B 3SEOA 1UP1A 2IVMA 3JQJA 4KGKA 2ZEJA 2VG6B 4NYZA 2W8LA 4RLEA 4DV2J 4C0HA 3OBIA 4NZ7A 1Q0NA 3QFHA 3W2WA 1JQGA 2HRUA 3BBCA 2IFXA 4HTJA 1RHUB 2QIFA 3IBCB 3TJ9A 2DR9A 1T9TA 3UR3C 1R6VA 1HQUA 3J7AN 3MI7X 5G0RB 4CCHA 3IR6B 3OFGA 1M1GA 2BE9B 4OYWA 4ERDA 2VPXB 5HLFA 4OZ3A 1RAIB 2HIYA 1BLUA 2IVFB 2QV6A 4UT4A 1YRXA 3W8PA 1CJKA 5HATA 2H5JB 4ECRA 4RNNA 2HNDB 3M2UA 5A2QU 2GIQA 2LQJA 4AQYJ 2QC3A 3I87A 1Z2LA 3NL0A 1KQKA 4DU7A 2W8KA 4ZITA 3M8RA 2J8SA 3X3UA 4PRFA 2UVRA 1RKIA 2QL7B 4Q43A 2NXJA 3RG6A 1IBCB 4FZVA 5CAAA 3GU0A 4P2FA 4RUAA 3DMJB 2YNFA 4RUBA 4K8RA 1NB7A 1BD6A 2ZHBA 2WB1D 3P6YC 2W9BB 1F3FA 3QBCA 4DV3F 7AT1B 1P27B 4MTPA 2G2YA 1R27B 3RYLA 6FDRA 3CTRA 4ZP7A 1JXEA 4ZVQB 3BGLA 3FZBA 1YHQS 5CXTA 3W8GA 1H7XA 4LQ3A 4DPUA 5GAGI 4LF7J 3CCES 3SFUA 1UVJA 2HHQA 4MYTA 3C15B 5D3GB 1FE0A 1S4EA 5HBMA 1XNRJ 2KXHA 4PXCA 2ZZMA 2O66A 2YH1A 4HEA9 2B5JA 3CD5A 2ZOFA 3LGHA 2E1MC 1XMQJ 3IG1B 2WSEC 2GNKA 4CM0A 5CYMA 4OZ2A 3AD9C 2DXDA 3HT0A 2RQCA 5IM0A 3CO0P 3NGTA 3FK4A 3DLJA 2RHSB 1VRUB 3D0GE 4ZVFA 1RYSA 2V2KA 2KT3A 2W2QP 5A8RB 2PN6A 1VDHA 2VB6A 3G87A 2WAQD 2MY8A 2AYMA 1RWMB 4KIAA 3MXHP 3PKYA 4FXWA 1L3SA 2YWEA 3M2RB 3QWUA 1EQ0A 1C2PA 2J9DA 2BDPA 3M8SA 3POTA 1GEHA 1WC3A 2QMXA 4JI7F 2HHWA 4P6QA 1WEXA 1BXNA 2DHAA 1SKSA 2F8HA 2ROGA 1HFEL 3OFHA 1JJ2R 4WFXA 1PJ7A 1F0XA 4FVMA 2RF2B 2YTCA 1TZ0A 1YX2A 4OX6A 3HFZB 1WELA 4DSLA 3MPWA 3QIPB 4HH1A 3RBDA 1ZS6A 3CJ3A 1RLCL 3AFGA 4PPZA 1WG4A 2K8GA 5ETNA 1P9YA 1RT1A 1T9UA 3Q2SC 1RUSA 1EP4B 4NLOA 3AJDA 4NA1A 2G4BA 2QYGA 4EFAC 2B51A 5GADU 2D3OR 4JI4J 2WONB 2MHNA 2J7KA 4DPYA 4Y2AA 3HD2A 3GPAA 3ENWA 4URGA 2GJIA 2LA6A 3CMES 2M3DA 3KMSA 4TNOA 2YKOA 5F8HA 2KRBA 4Z7YA 3ZTPA 2VFUA 2W7AA 1NCLA 2XCAA 4Y00A 4KFBB 2WK4A 1X4EA 2G13A 2QGFB 3RRGA 2K3IA 2OEJA 5CYJA 5B0EA 1VS3A 1FWLA 3I56S 1YBUA 2FQQB 4JI5F 3SV3A 4A8OA 4LBPA 2YPZA 5LL6d 1ZA1B 2C2RA 1MU2B 5J2PB 3P49B 4ZOSA 2B0GA 1EJ7L 3K8WA 3ADAC 4RW8B 2VH7A 4NA3A 4K4XA 2B9XA 4CH0S 3KLEB 1NRKA 2YKMA 3HSGA 2YPYA 5H9EK 1NK5A 4LRAA 4H4OB 3VGUA 1IR0A 2W4DA 5DG8A 3KJVB 3NS6A 5B0DA 2IA0A 2LU2A 2PMWA 1KHWA 2OO4A 1KOOA 1T9XA 2AMCB 3LALA 2CZ9A 1LFPA 3AY0A 2OSRA 4U7CA 3RBZA 5IWAF 1S9GA 1BY9A 3US5A 1QUVA 5F9LA 2XWYA 1N36J 3DI6B 4PXEA 1UA1A 4DZDA 4XPEA 4ED0A 1XMOJ 4OL8A 4OMFG 5CCLA 2E1PA 4IKAA 1J2VA 4N47A 2ZJPQ 1HBUA 2NR0A 1T05A 3I9ZA 1JLEB 3CB4A 1U1OA 3HP6A 3RAQA 1X5PA 1NPPA 3FMBA 5E3CA 2B4PA 1QTMA 1FXRA 1RK8A 5DG7A 2CQ2A 2LU1A 4DV4F 2ZZNA 2PDAA 3DRSA 5KFDA 4ID8A 2NUUG 4ELVA 1RT5A 1IBKJ 1TL3B 3EZOA 2DPJA 2H51B 2XS7A 2E7WA 1DQ9A 2I8EA 1SJ1A 5J2MB 5KFOA 1SH3A 1G1XA 1RWNB 4DX5A 5A8WB 4TYBA 3LWLA 5D0RA 5K8PA 4P2XA 5A2QY 2RNEA 4YB7A 5E5NA 4C3LA 3TA2A 1ZAXA 4WZMA 3TQ1A 4X4UA 2HVHA 3E2EA 3O5TB 5IFMA 3RAMA 5KG0A 2MSSA 4N76A 4QPXA 1QAJA 3QLHB 1YJ9S 4KY3A 4LF6J 3T5JA 1RWVB 5DO2A 1GFWB 4QIGA 2R9LA 2QLBB 3MDFA 4IOAQ 1PJ6A 2R7RA 3BYRA 2CPDA 1HPZB 2Z57B 4ID5A 2NXEA 4IFVA 3GYNA 4ECSA 2LXFA 3J80U 2K06A 3WHIA 2CRLA 2XMTA 1GQEA 4WXOA 3MF5A 2MQ8A 5D0GA 3W2VA 2FGCA 3H90A 3D5MA 2ZKUA 2V50A 4WFYA 3LPEA 3QT5A 3SFGA 1SC4B 4YY3F 4Y28C 5KG2A 3PW7A 4B3SF 5MAOA 3UD5A 5LJ5Y 1NK8A 4Y3CA 4U6PA 4WP9A 2W2OP 2OPQB 2E44A 2DNKA 1S7IA 2VASA 2IMOA 1PYSB 3FSIA 1ITPA 2MEWA 1OYEA 1XR7A 4M1KA 2GZOA 4Z37A 2YNIB 3PJXA 1Z2ZA 4DV1F 2Z2ZA 3RJMB 1JJ4A 2GIRA 2K1RA 2F4VF 3I0SB 3UCUP 2D3UA 8RUCA 4L75A 2ACYA 3P96A 3TAQA 3U7JA 1EKSA 5KT5A 2HAIA 3K5LA 3DN9A 4AUKA 1HA1A 2ZC4A 3DGPB 3MECA 4G3IA 4FKXA 2VA3A 3I5CA 2ASDA 2NS1B 1FFGB 1EQMA 2CPYA 4KHPJ 3WDOA 1CJTB 2DCLA 4UF4A 4LJMA 2ASLA 2DIVA 4K59A 1U1LA 2UUTA 2NZ4A 2MPUA 4L76A 3TAPA 2EFVA 1T9VA 4DUYJ 1TL1A 3S7RA 4JOUA 1UVKA 4R8UA 1EX8A 2VG7A 1KFSA 2NXNA 4QYRA 4LSNB 3BQ2A 4DR4J 2E7XA 2V4JA 2MJNA 2PMZD 1RT3B 1XERA 5LOQA 3FMWA 1KOHA 2V8DA 1S1TB 1Q8LA 1MLAA 2DGUA 2DGWA 2SXLA 1NKBA 1HBOB 3MTKA 2CYYA 3HVTB 4MH8A 1U8SA 3CDWA 4F3MA 4OI6A 3MCMA 1F3VA 2MZQA 1X4DA 3K8VA 3DDIA 3BYPA 1BWEA 2B43A 3GONA 3P5TL 5AT1B 4ZHRA 4LMZA 3QATA 5AJ3F 4Q8FA 3C6UB 2BQUA 3WIUA 2C22A 2K7KA 2EFQA 3PHEA 4ZLLA 4PWWA 1R0AB 1O6XA 2Z8QA 3OFEA 3CJKB 3IR7B 2DHHA 4ZPAA 1OY9A 2KFZA 3DRPA 3WX8A 4B3TF 2NQPA 3D3CJ 1FDDA 4OZ0A 2HFSA 1C0UA 5F8LA 2W25A 3CCZA 3E01A 1LNQA 5GADI 4MIWA 1KTQA 4G65A 1KLMB 2G2ZA 3DRRB 1S6PA 4KO0B 4WKYA 2CNKB 2GMJA 2ILYA 1U0HA 2ZOMA 1LWEB 1IBLJ 1B99A 1WSVA 3U27A 2DEJA 2HQ3A 3AXMA 2DISA 1YG0A 2AJFE 5LXYA 2V2VA 4G1IA 3LP2B 4EWTA 2BE2A 2APOA 4RPFA 2UU9F 4M63A 3BEGB 2Q43A 3MR3A 1BE4A 2RD5C 5CD4A 2EK6A 3FBFA 3CJSA 3K59A 1DFDA 1XC9A 1UA0A 3N4WA 2CPHA 1NU4A 1JJCB 4QW9A 2JSXA 4ANDA 3OTOJ 2GHWA 2ZJQQ 4URSA 4FNHA 2YQ0A 1NM2A 3C14B 4QW8A 2J5AA 3OVAA 2JZ5A 2HW3A 2YVSA 1S49A 1K9MT 3IO1A 2UV8G 5LSLA 2ZVIA 3DOKA 2Y9HA 4IG0A 2JJ4D 4NMXA 1X4CA 2ZM6F 1PSDA 2IC3A 1VQ6S 4TVAB 3HHLB 3PX6A 1Q86T 3HX9A 3NWRA 1T3OA 2D69A 4WBFA 1JX4A 1HQEA 4LIRA 4RWXA 1QSLA 3OHBA 3FUYA 3P5BP 3ITHB 1LOUA 1DBDA 3CCWA 1Q78A 4ZLNA 3V6KA 1M1KT 4LF5F 2HFZA 1FEHA 2J9EA 2OSQA 4ED8A 5D8HB 3M9NB 1GK8A 3VAJA 4QIVA 3ZZRA 2W24A 1FRHA 3MPDA 4DR5F 2E5JA 2F9DA 4GRSA 4FVCA 1FA0A 1ZM3A 3M2VB 1E6YA 3BR8A 2XBPA 3ICLA 5J1EB 3DKDA 2VOOA 2DHGA 4KPYA 1ZZFA 4X4SA 3J80Y 4YP3A 1GMWD 1B70B 1SI9A 4ILMA 2V2QA 2V68A 1MW7A 3BSOA 2R7OA 4O3PA 5KG7A 3UDLA 4WCEQ 1SUQA 2V4QA 1YZ7A 4XAKA 3MR6A 3AQPA 3NMAA 2GQQA 1Y3JA 2E5HA 1S6QB 2YWWA 3R5BA 4ZVUB 1MROA 2UUCF 2OELA 4K7QA 2ZBPA 2OAUA 3KLIB 3QWPA 3DRYA 4QYZJ 1IWGA 4UUWA 4HACB 4Q45A 4K0KJ 3QRRA 5C7PA 2H5EA 3E3XA 4ZK7M 1YBTA 5IOLA 4IRCA 1N56A 1KVJA 1FKOA 4F4AA 3RZAA 2DRBA 4TQSA 4YB6A 1FEEA 1WHXA 4L73A 3PRDA 4Y34A 4UQGA 1N32J 2ZH6A 2QE5A 4LF4F 3IRWP 2QEXS 3RB6A 3I55S 3I5BA 2KO1A 3BO4A 1VQ5S 3UPFA 2WRMA 1UEUA 2JC1A 3HZGA 3MMAA 3U02A 3TYTA 4ZN3A 3VALA 2HFVA 3EGZA 4JI2J 3EUNA 5EX3A 3CE8A 4IG3B 3DLEA 1FJEB 3FZ2A 3CD7A 1IBLF 3M32B 3BQ1A 1WORA 1OPZA 4CTAB 2M2BA 4Q44A 4DFKA 3KK3A 4BWMA 5E2QA 3SI8A 5EHHA 4GVBA 1SQEA 2HVDA 1NH7A 3MMCA 4JI3J 2YXLA 2FVCA 2YBVA 4ZIWA 1FJGJ 2MZTA 3MM7A 3HHDA 3T1HJ 1T3NA 4NRUA 1L3UA 2XS5A 2PT0A 4NASA 1U26A 4K50A 3EPGA 5A6PA 4CZCA 5C25B 2CQCA 4QU7A 3JTNA 3F0NA 4NEYA 1VRTB 5LMNJ 1PBUA 2V69A 5CA5A 2EFOA 2X51A 3KHGA 3BPDA 1Y7PA 3N28A 4PABA 3HT3A 1U1PA 3GMGA 3OTOF 5M2UA 3H2UB 3E51A 2JC0A 4NZ0A 2AU0A 4FBTA 4YOEA 3A8IA 1F1BB 2RMLA 5DDOC 3RW7A 1IKYB 1C1BA 1LXJA 2LDYA 1FO1A 1L3KA 1NSAA 3PIPQ 2RS8A 2W9CA 2QT7A 4FYDA 1HW8A 1AUSL 5D4NA 3F73A 1YWXA 1U2RA 2M5YA 3MCSA 2ZVSA 3FCHA 5T7LA 1FT8A 2HHUA 3DHXA 4LSZB 1BQNA 2NREA 1GH8A 2DXEA 4M5LA 3R1HA 1RI7A 2LA4A 1URRA 5K8NA 2P2CB 1DTQA 1TELA 3NP5A 1VOMA 4PQUA 2XULA 3MAQA 1FI4A 2HMIA 1H98A 1NH8A 4GO5X 2FZKB 1D9DA 2UXCF 1LWCB 1SH0A 2WOMA 1U1NA 2Y0SD 3LAKA 5KFMA 1FXLA 2CDRB 4C9DA 5HLFB 4USJC 4B02A 1FJCA 1V3SA 4KPCA 1R0BG 1RLDA 1FDNA 4F3QA 1CJKB 1SQFA 1SKUB 4LFAF 3Q23A 3M2UB 4WYWA 1S72S 1TR0A 2DGXA 2I6WA 1ULRA 1Q8IA 4FYXB 4DR3J 1O5JA 4ILRA 1BHNA 2EFGA 3EGVA 1SL0A 2CPZA 2VPZB 4DV0J 1DQAA 1AW0A 4IR9A 2EC0A 2R7TA 2MLXA 2E9RX 8ATCB 4KE5A 2KJVA 4KC5A 4DS5A 2YNFB 3EDRB 2GA7A 3FKBA 3GZ7A 3KK1A 2H3EB 2JLFA 1J5OA 4LFBF 3MPUB 1XN9A 2A6MA 4CNZA 4NL5A 4CYUB 2J6UA 4DCPB 3JTOA 5KFSA 4ZCLA 4EO6A 5ADZA 2LEPA 2ADCA 2UVUA 1JJHA 1TL7A 1G2EA 3ILIA 3WC0A 3UCGA 2R7VA 3AAWB 3GV5B 5JVHQ 4JI2F 4RW9A 1O8BA 2B5JB 5F41A 3CDEA 1IQZA 5CYMB 4QZVB 5HMZA 5IM0B 2I1RA 1WF1A 1U8WA 3KDOA 1DQ8A 3GP9A 5B09A 2C3UA 3JB9k 1RISA 2XNRA 1NO8A 4DBQA 4JI3F 4LF8F 3RUBL 3AQOA 3CCRS 2YKQA 3QZ8A 2BQRA 2N7CA 4ECYA 5HROB 2XMMA 3CCUS 1YIJS 2H9ZA 1ZM9A 3LP0A 4JI6J 1TAQA 3TO8A 1Q7YT 2VG6A 3W3SA 5LMNF 2VPYB 3KKFA 2JEJA 1VQ7S 1F2HA 4DR7F 5M2RA 4O3QA 3IS9A 5L1KA 5KT6A 2CPFA 5DLFA 1NJIT 3M6WA 1N5VA 1GXTA 3LWMA 1OWXA 2MB0B 3MTJA 1W25A 2DHXA 2MKHA 1EIYB 2Z58B 5G0RA 5I4MA 2CJBA 1CS4A 1EHWA 2FJVA 3T6BA 3KJFB 3HKWA 1RT1B 4QR1A 3OJUA 3DDKA 1ZTTA 3MCNA 2BOAA 3T3FA 2QLFB 4RL1A 2Y8WA 5DLGA 3HMJG 3MR2A 2HNDA 1KDNA 1GNKA 4DPOA 2DH8A 2QSWA 2MQNA 4QWDA 2VBWA 1VMBA 2H5IB 3CJ0A 2P8IA 2GO8A 5DZ7A 5HQMA 2ZHOA 4FF2A 1FKPA 3FCWA 4NCBA 4XO0A 4ZPDA 1SC6A 4B9NA 1IWAA 4RKUC 3UN5A 4M5DA 1RT7A 3PFEA 2PC6A 3X1LB 2HWHA 5FDLA 2UVWA 2V2ZA 1ICEB 2MJUA 1RT6A 3C66A 1J5EJ 3NNCA 4FBUA 1H2TZ 4PQAA 5IT4A 4P72A 4X4QA 2DO0A 3R2DJ 4GVLA 3H5UA 5AE3A 4DCOB 4EYIB 3C15A 2QLJB 3HHLD 3OL9A 1IQTA 4B08A 3EDQB 4C8ZA 2VDIA 2LQ8A 2HQGA 5CHCB 4E2FB 4BDPA 3WZ0A 4DR3F 2X1BA 3EM1A 3PHTA 1B7FA 5L1JA 4PXBA 3OL8A 3AODA 4OJ1A 3T1AA 3MR7A 4EBCA 2A18A 3NXZA 2XZDB 4Q7AA 2E5GA 1S9GB 1N52B 1V9OA 2RS2A 4DL2A 4A47A 2OJ3A 4IUFA 2BVZA 3P4UB 2OHDA 4AE5A 4FN5A 2HHXA 3PVXA 2YNGA 1TAUA 3BS9A 3V6DB 1WG5A 3N5FA 4B9MA 4OIXA 1EKRA 3AHPA 4QQBA 4M5IA 3M2RA 3QIDA 5BYSA 1WC4A 4WFBQ 2RUSA 3MR5A 1T05B 2EWHA 1WNEA 3AH6A 2F7VA 3IBFB 5AE2A 3BO3A 1OIAA 4WP8A 4AL7A 1RBLA 3NKYA 2DEIA 4J9UE 2N3OA 1EARA 3DRSB 3QIPA 4CNYA 5JUMA 2FB0A 4C98A 4EO8A 1HNIA 2QRRA 4O0NA 4TY8A 4O3SA 1CSJA 3H42A 4ANCA 3BSNA 2DJWA 3ZC4A 3KG4A 3BGRA 5DGAA 4FP9A 4RUHA 4E98A 5B0BA 4JI6F 3S01A 2CQHA 1GMWA 1S12A 3PR4A 2ASYA 5KG1A 1HHQA 2HK3A 4A8WA 4L6V3 3MFIA 4QU6A 3A13A 4CLSA 4OX7A 3SZ2A 4ES2A 4NLWA 2DNPA 2MKSA 3T1YJ 1S1UA 4YB5A 2V8PA 3W9JA 3SCKE 5KFYA 2XMAA 2PEHA 2R42A 5KFTA 2W2NP 2IDLA 1FTRA 1WHYA 2QSFA 3K5PA 5DS7A 3SV4A 1U7LA 4LUBA 4RZRA 1FTCA 1NZAA 4L72B 1S77D 2J76E 4LIWA 2D9PA 4K2JA 2DO4A 3DC2A 2A0FB 2DNLA 2UUBF 4KTQA 4X4OA 2FLOA 4RW8A 3W2VB 5GAHU 1TV6A 1T95A 2MXYA 3KFWX 4QYZK 5D78A 4DX7A 4ELTA 4H4OA 4NLSA 4ZIVA 3SMZA 3CGIA 4TU7A 3I0RB 3G8TA 2V9KA 4PXDA 1U1KA 2V4RA 3R7BB 4BC7A 4DV5J 2XI2A 4KV8A 2AX1A 1APSA 1DLOB 1LWXA 2GCFA 2RQKA 3CJ4A 2CZVC 4QCLA 3QT7A 4UZCA 1LWFA 3NOGA 3NAHA 2WZ1A 3JAMU 2OH2A 5BR8F 3NCRA 3GIRA 4RBVA 4GKJF 1N5YA 2YKNA 2A3JA 2W4CA 2B7BB 3KUHA 2CAJA 5K20B 2OLWA 2K1RB 2EG2A 3THTA 4TKTA 2XHWA 4B3RF 1ZM2A 4CI0B 2FVPA 4YS2A 3KOAA 9ATCB 2H1YA 2UUAJ 2O3DA 2JEGA 1E6VB 4CT8A 2W2MP 4KR0B 3MECB 3LPYA 3OL7A 4H4MA 2N4CA 1WEZA 3K5MA 2AEFA 1KTVA 1VQOS 1XEZA 3SSSA 3PM9A 2YKPA 3DLKA 5L46A 3TZWA 2DGSA 2E5IA 1R6YA 3L95X 3NY0A 1VJQA 3HSDA 3CJ8A 4EUVA 3CSKA 3N9UC 4OX9F 3EE3A 3BGUA 4GO7X 5IC4B 2B4OA 4LFCF 2KRRA 4R8UB 2V34A 2VG7B 5F8MA 1RAAB 4EEYA 3IWXA 1Y5NB 2V4JB 1FWPA 3AOAA 3I9V9 4UOCA 1TK8A 2IIHA 2CPXA 3BGOP 5F0WA 5C2CA 4B9TA 3T6JA 4O4GA 4IH7A 1Q4RA 4OI2A 3OV7A 2CQGA 4EZ6A 2MQLA 4B9UA 1M0SA 4Q8EA 4J9MA 1HPZA 2ILZA 3T9NA 3KHHA 3OR2A 3VR1A 4QR0A 3Q8VA 2ZC3A 5M2PA 3EGWB 3BGFA 4OHYA 1AROP 5GVQA 2HS0A 4KJIA 2GX8A 3DRPB 2R7UA 1C0UB 4DSEA 3TNVA 1CC8A 3Q2TC 4YR0A 1S6PB 3MCOA 3OTEA 3JSMA 1U0HB 1OY6A 5KG6A 4LR8A 5EGYA 4YDXA 2IA6A 4CH7A 4AYBD 2W01A 2LKZA 1G7CB 5SZTA 4USVA 2Y1RI 3UWTA 1HBNB 3ETMA 3DU6A 3UD4P 3MM9A 2BE2B 1HNWJ 2WHOA 1MSWD 3ISND 4ED6A 2W4PA 4RNMA 1U25A 1UJ6A 1P1LA 2K2PA 1F5AA 3GCWP 2YKAA 2N4DA 2VBXA 4HHJA 5MLCV 1RGVA 1HNZJ 4IDKA 3UN2A 3NEKA 1XNQF 3TJ8A 2KH9A 4LSLB 1HHSA 2BKOA 1CULA 2R8GA 3TP2A 3EZUA 3I0SA 1EETB 1A9NB 1RT4A 4N56A 4P2SA 3BBBA 1WSRA 1IUJA 1Q1KA 3A8JA 2LFVA 2RILA 2RQ4A 1QD1A 1VC6A 2FHKA 1ZAVA 2VQFJ 2HNZA 4IG0B 2V8VA 3DGPA 1FNXH 2R8IA 1VRQC 3IXQA 1VC0A 1RCXB 1X4FA 3ZXWA 2IC3B 2YWHA 3W5ZA 2DTJA 2MQPA 1Y5IB 1FF2A 3CVKA 1VLYA 3TA1A 4CDIA 2J6TA 4O3RA 2AZ1A 1HQEB 1SH2A 1L5UA 3PTWA 4PPDA 1X9MA 2ZBCA 4MIBA 4LSNA 4F4WA 2BA9A 2ZH3A 4X84A 3TVYA 1MWQA 4XIUA 4DI6A 4X64F 3V4IA 4UTGA 1Q7LB 3PV8A 2XQCA 3HVTA 1CJUA 4DLGA 5KT7A 3LW5C 1VQLS 1KVIA 2J8AA 1NJWA 2Q6BA 2HHHF 1E6YB 3C6UA 4C8KA 5ETMA 5KTQA 3MUTP 1L3TA 3EXCX 5J1NA 1ZETA 1RTHA 2XMUA 3GSDA 4DJBA 2CWXA 1RQ0A 2Y1IA 1SUQB 3BKFA 3MM6B 2WBRA 4DR6F 5D0EA 4GKKF 3IM9A 4YR3A 4OZJA 1LWEA 1U2FA 3NGUA 4HH0A 1S1XB 1MROB 3TR5A 2MZJA 1SVDA 3FSXA 1BGXT 4DSKA 3DHWC 4LRFA 1ZOTA 2IRXA 1NB2A 2J7WA 5LMUJ 4NOHA 2CQ1A 1FKOB 2YWGA 3HDSA 2L41A 4NEZA 4F2RA 2C2EA 4BHQA 5HN0A 2VQEJ 5E3AA 2VD3A 1SBRA 1WEYA 3BBFA 2FZGB 3MMAB 5GAHI 1RWXB 3PXGa 3KG0A 2CPEA 3KLFA 3C14A 2XLJA 2R2TA 4DG1A 1S79A 3DLEB 3I4HX 3H5YA 3MOJB 4CLFA 5KT3A 2RRAA 2BQ3A 3DU5A 3Q8RB 2DY1A 3SSQA 4GVBB 5B0CA 3W62A 3DLBA 5FD1A 3ILLA 3HI9A 4A8YA 3HHLA 5EN1A 4JI1F 3K57A 2BW7A 1AUDA 1F9FA 4ED5A 1OSCA 2DH9A 3MM7B 2VDHA 4DX8H 3G71S 2RU9A 1UVLA 4RJVA 1GTEA 5DG9A 2FY1A 1H3DA 3UI3A 1HNZF 4NI2A 3R7SB 4QIEA 3FGVA 4M5KA 2YQ3A 4I67A 2DNGA 3GG1A 2P9CA 3VGVA 3ENQA 5BYRA 1Q81T 1TUGB 2CNLB 4N8OA 1YBAA 2OEMA 3PFOA 1I5OB 2HZCA 2RT3A 1C1BB 3M2VA 5L8RC 1CQMA 2HG4A 2FGOA 4CLYA 2M9KA 4WKRA 3R6GB 3MUVP 3BDPA 4OX8A 2RQMA 3PW4A 1RJJA 4NLXA 2H48B 5T7LB 3LGMA 2BABA 1GXUA 4CO4A 2R7QA 4BCAA 1NPKA 2WSFC 4PAAA 3FJ2A 1U6ZA 4IOBA 1DTQB 3D4JA 2OKQA 1HR0F 4PQUB 4ENOA 1VQMS 1Q16B 1HNXF 1KONA 4F4YA 4Y2CA 4HACA 5HQLA 4DXLA 3JQKA 5L9XA 1V3ZA 1YDLA 2ROEA 3NBPA 3FNNA 5AXMA 4ED2A 4WF9Q 4LVNP 3SQGA 2WOMB 2AQ4A 3OFFA 4C8OA 4RX6A 3VQTA 1VBYA 2KFYA 4JB8B 2QFJA 4DV3J 4X4TA 3SCIE 2ASJA 1WI8A 3LA0A 3KK2A 4UY8T 4AXIA 4J9LA 1LK7A 3DXBA 4HT7A 2NZCA 2QL5B 5HMWA 3P3DA 2CQDA 3BJYA 4ZN1A 1LK5A 2ZH2A 3PYDA 2KT2A 3HD1A 4KB7A 1RTDA 4RU2A 3KNGA 1U49A 2ABYA 3BB5A 1N88A 1YRTA 3JSRA 2G1HA 3UDVA 2XI3A 5IV3A 5D77A 3IAM9 2IAJA 2C3OA 3D6FB 3QRPA 2MKCA 3NLCA 3HO1A 1W7WA 5ETQA 1N5QA 4J9VA 5IXUA 3TVKA 2GMLA 2P9GA 4IQMA 1PO6A 1OYDA 2BRLA 3UW1A 3NWGA 5LMUF 1YJRA 1XBWA 3KK1B 3TX8A 1MWZA 4O23A 6AT1B 1G3OA 1NNDA 1J5OB 3BH7B 2WSCC 4YDDB 2FUG9 3W64A 1KNZA 3EYZA 5C2GA 1KR4A 4HYKA 1UMJA 3MD1A 1KSPA 1AYEA 2AZ3A 4P10A 3RB0A 4AXJA 4X65F 2HRYA 2ZDPA 4TQRA 4JI7J 2R2RA 2AW0A 3S8SA 3OVBA 3HHKA 2AYBA 3ONQA 1TL7B 4KH0B 3DM2A 2MQQA 5I3PA 2MKIA 2ATLA 4QWAA 4I69A 3QFWA 3TARA 5KFGA 4RW9B 1K8AT 5C42B 3M9MB 3GILA 4GMKA 4U7UD 4P71A 5DDRC 4F4XA 4ED3A 2HGNA 1IKYA 3BF4A 5HP1A 3R5JB 3A1YG 1KLNA 2K7JA 4ZPWR 1UZHA 4ZVPB 3IGVA 2HBRB 3PNIA 4DV7J 2FHOB 2ZH7A 2J0XA 1S59A 2AHOB 2CQ0A 4WK3A 1S0NA 5KT2A 1IXKA 3CD0A 2RU3A 4ED1A 4F3OA 4ED4A 4DN9A 1AT1B 3KYLA 3CCSS 4NCGA 4PCQA 4C3MA 2U2FA 1KWMA 4I7FA 1WKLA 2QG9B 3SIPB 4JI8F 3JS9A 2L9WA 3DOMB 5IQ6A 4L3KA 2RJZA 1XTZA 2RDDA 2J9CA 1VBZA 4LF1A 2LDIA 3L4BC 2IDEA 3IS9B 4C3KA 4PG4A 4EMDA 2Y1LB 2GIFA 1LWCA 5LJ3Y 2BW2A 3UDEA 5IT9U 1CEZA 3NOCA 2LEAA 4JI5J 4MIAA 1MG7A 4PG8A 1JKHB 1HWLA 1CS4B 1YRUA 2B9YA 4FF4A 3Q0AA 1D0EA 4V1Ak 2KG0A 3RW6A 2UXBF 1VHIA 4DR1J 2E9ZA 2BYCA 2VPWB 1MMNA 3MFHA 1N5SA 1UTAA 3RTVA 1BQMB 2P9EA 3F41A 1R31A 3OXGA 3H20A 3LANA 2IM2A 2FC9A 4G6VB 4X2BA 4EK2A 1KBRA 2O1PA 3GFYA 4LR7A 2RIJA 2F3JA 1H74A 2J7UA 2OI2A 1UETA 3W5YA 2NSBA 3T5LA 3GTYX 1OS5A 1YLXA 4HTIA 2QYCA 3QMQA 2KZZA 1FKPB 2COLA 5IWAJ 3CW2C 4RNFA 1RAEB 3IBWA 3ILJA 1OQ6A 2J9DE 2CJAA 3MAHA 4M5DB 4K4WA 1SV5A 1RT7B 1S7HA 2CIMA 1S4FA 4CYUA 2FJAB 2O5DA 5FDLB 4CP5A 2QA4G 3R1LA 3IP0A 3GYGA 2DNRA 1RT6B 2YNHB 1D9AA 3RU0A 3GIMA 3NS5A 2G0IA 4OZNA 2JRSA 1QSSA 3D7SB 2H4YB 2ZBRA 5IC6B 4J5OA 1TFWA 5IT0A 3C16A 3G82A 4IQXA 3AD8C 4OZ1A 4OJGA 4DV4J 4E8UA 5EDWA 2ZBQA 1SXLA 1K0TA 4OHZA 4TU9A 3Q8SB 4FDFA 1I6JA 3PYEA 5B0GA 1CBKA 2VIHA 2V63A 3GJQB 1BMQB 2HFNA 4F8RA 4YB1P 2ROPA 3A3PB 5H9FJ 5HROA 1SPBP 3BM7A 2POKA 3K7RA 1RSCA 2YNGB 2OTLS 2RDIA 1LXNA 3ZNJ1 5LT5A 3PR5B 1YJTA 1IM4A 1VBXA 1XK8A 4P2MA 1FDAA 1RCOB 1TK5A 3MMBA 1WC1A 5A76A 2F65A 2AKWB 2FVQA 3RGIA 1R8AA 1FESA 1Q5VA 2G9OA 2PSZA 2OGUA 2KYXA 1FERA 3ISZA 2FJEB 4I0WA 4WFAQ 5CZVA 1VQNS 1NBEB 2HLTA 2XMVA 1VHFA 3TJAA 4DR2F 2QJ3A 2XC9A 4F0MA 3OSNA 4PKDB 4DPTA 1XIQA 5JVGQ 1HNIB 3R6LB 3O8WA 4DV7F 4OHXA 4TY8B 3PKMA 4WYLA 4JV5F 1XR5A 4NLRA 2JOQA 3BGRB 2HWIA 5GMDA 5ETTA 5HSPA 1VQPS 1UW4A 2WW4A 1VQ8S 1KHVA 2UV8A 5B0AA 5ETRA 2XYGB 3M6XA 4H4KA 4J9NA 3QZ7A 3MEDA 3AA8A 1S9FA 4ZA1A 4TU8A 4YN3B 3G6XA 1TKDA 1TKZA 4YY3J 2ZD1A 3CJ2A 1UVNA 4B3SJ 2V8HA 4Q2MA 4CLWA 3TX0A 5H1SV 4DUZF 4DQQA 4LBIA 3DXSX 3FQLA 1S1UB 2HHTA 2QMWA 1XR6A 5I42A 1K73T 2IHR1 4NE9C 3VVUA 4CIOA 4ECXA 3CEDA 4DV1J 1KP6A 4HL9A 4DR1F 4K5SA 2F4VJ 3MGJA 2P6TA 3PDNA 2KDOA 2WVDA 1F5CA 5BYQA 2G0JA 1TV6B 4HR2A 2KN4A 3HJFA 2DXFA 4KBIA 5KOWA 3FDSA 3R7NB 4RW4A 3TANA 2HS3A 2HSEB 3GB0A 4OLOA 4JI0F 3M8QA 2C3YA 5F8NA 3FRZA 1FRMA 4KV8B 3ZZTA 1JMTA 1S0OA 1HMVA 1Y5LB 4YR2A 2RKIB 1T8EA 4K5RA 3KWMA 2OIHA 1LWFB 3C6TB 2DGTA 3V6DA 2HVIA 4P7TA 1N5YB 4F26A 2YKNB 3WIVA 2PA8D 1RA7A 5HANA 1H72C 2AV5A 1NUEA 1UW9A 3PO4A 4NLQA 4D3HA 2HVEA 4ETZA 2X3DA 2R8KA 1RAJA 1C1CB 3J81j 5KFLA 3FVYA 5IT9Y 3QJLA 4W92B 1VC5A 2XGPA 4PG7A 5KFWA 4B3MF 2ACMA 5AJ3J 1HI0P 4DCJB 3VAKA 3CMQA 3DLLQ 3BH6B 4H4MB 2DB1A 1X0PA 3DLKB 5KFCA 4B3TJ 1JLBA 3UNGC 1YITS 2WW8A 2IYGA 2D7SA 3W63A 4LR9A 3RRKA 1X4AA 1WG1A 5DQHA 4PEOA 4MJKA 3OR1A 4DUTA 1RU2A 4FYWB 3CCTA 3D0IE 3B54A 1P6TA 2HQIA 1VBKA 4CM2A 2CJKA 1X4BA 1D8YA 2MLZA 4O4GB 4C2MA 4JUZA 4CRJA 4KGXB 2UU9J 4O3OA 1N34F 2QA1A 1ZTWA 3OR2B 3H59A 5DETA 4HT5A 4UQTA 4ZP6A 4WXWA 1N0VC 4USHA 4A8MP 3CIZA 3JXOA 2KXNB 3KLGA 1TP7A 2ZNZA 3VAFA 3L3CA 3ZZUA 1MN9A 1TKTA 4TLRA 1S99A 2FVRA 5J1PA 1PIEA 1SJRA 3JSMB 4CT9A 3GWCA 2L08A 3CCVS 2ZZTA 3MOZA 2DNZA 2MGZA 3HLUA 4WP3A 1NJYA 3IAS9 1LW0A 2CG4A 3I0RA 3ILOA 4DHVA 2QZ8A 2I38A 1JXLA 2ZM6J 3QPIA 2BKPA 4NLYA 2I0XA 3MM9B 2BR0A 1DLOA 3VAHA 3MWBA 3J7A1 2QLWA 1D09B 2BOPA 2CQIA 1NEEA 1VQKS 3A8EA 2ZKTA 1WWHA 4JBCA 3CC4S 1TL5A 5KT4A 4ECZA 4IDKB 1PC5A 3GIIA 2YX1A 1NSQA 3TWZA 2VJVA 4LF5J 2KI2A 5HMXA 1CULB 4PR6A 3H2LA 1IVZA 4M8LA 3R8YA 3L7PA 4WIIA 1RT4B 3G9CA 4CO1A 3A12A 4C6AA 5E7OB 2EI5A 1T94A 4DR5J 3H4BA 1FCAA 4ZVTB 2JLGA 1E6VA 2CADA 3I4PA 2LECA 2C2MB 2HNZB 2XMWA 3VHQA 2UXDF 2Z56B 3VZIA 3D1QA 3KXDA 2ZH5A 2Z2YB 2V5HG 4PWUA 5E3RA 1MWYA 1FVSA 4NYPA 1X5OA 4CLZA 4J9OA 1JNZB 4IH5A 3DLGB 4CO3A 4MKVA 3CMAS 1Y0HA 1HBMA 4FXDA 3MEGB 2VJUA 2OD6A 2UUCJ 3JQMA 3VGSA 2HHSA 3OQ2A 2RUGA 2LP4A 3UFCX 1LW2A 3V4IB 5LM7E 2D74B 4F4ZA 4MFBA 5JMNA 1CJUB 3AT1B 5B7WA 1ELOA 4ZDNA 3GFHA 3EMTA 3C19A 2X7IA 1WDDA 2C2OB 3MM8A 3JSYA 4RNHA 1K1SA 1I94J 4LF4J 5F8IA 1XWLA 4E0DA 4JP8A 5F8GA 1SL2A 2PD1A 3NNHA 2B6AB 1RTHB 2FVSA 1XJWB 1I51B 2RE1A 2C3PA 3NGRA 3R97A 1KN6A 2RHQB 4X4VA 5DM7Q 2A1BA 4WPAA 3QAUA 1WKJA 2EG1A 1RABB 2MQOA 1RBAA 3RAXA 3BREA 1UPMB 1IJEB 5LSRA 2AWZA 2M52A 3EZ5A 1LFWA 1C4AA 1ZAWA 1V5IB 4M5HA 2ZE2A 3OLAA 4J7CA 2HLUA 1HBNA 4YFUA 1QAYA 1AZSB 3OVSA 3GG0A 2DNOA 5IQQA 2I5JA 5RUBA 2NXUA 2DY9A 4NX9A 4RWWA 3Q8QB 2UVVA 5HQ8A 2C2ZB 3OT9A 1SJQA 1T03A 5GAEI 1PAUB 3ZZZA 3OXLA 4I6AA 4LSLA 4USWA 1H2UX 1Y00A 1RWWB 4W4MA 1S1WA 2VHGA 3IGNA 1PKUA 1EETA 4Y2IA 4BLGA 3KLFB 4OHWA 1P8GA 1FHTA 5C5JA 4DG1B 2DH7A 4LF9F 1TKXA 5JXSA 1C0TA 2E29A 2XB2D 2AF6A 2A10A 2GGPA 2B9WA 3D68A 3GLJA 4N8NA 3FFIB 3NS7B 1RTIB 3QO9B 1Q8BA 4OYZA 3P45B 5HAOA 4PUOA 2EBEA 3HHLC 4DV6F 2XHCA 4K4TA 2ZNYA 4NA2A 4YEAA 1M1HA 5DDQC 1CJVB 4NI2B 3SCLE 4MK7A 2RVJA 3VWSA 4DZ6A 1B0VA 3OUYB 3LAMA 3LP1B 2CUYA 3VCDA 1ZBTA 4RNOA 2B9EA 3TUJC 2UXCJ 2DYAA 1N33F 2ATCB 1VFJA 3H98A 4DL5A 4U8YA 1IJFB 4MKAA 4OJHA 4LF2A 1R3NA 1T9YA 3R5GA 1F60B 4DS4A 3D2WA 3MD3A 1YQHA 4I2PB 4U9RA 2PI5A 2IYIA 3SQOP 4M5GA 1YZ6A 2J0SD 4P74A 5H9FK 2ZUGA 1T02A 1DURA 4ZVHA 4LFAJ 3MM6A 5DDPC 2EBGA 2ZITA 2EKNA 3OJSA 3J7YU 1HYSA 1B0PA 2W2PP 2MSTA 1S1XA 2VFTA 3C8YA 2VONA 2CG8A 4ECTA 3FCVA 2IJRA 3PCOB 4CWBA 4NLDA 4NXMF 1NJZA 3NBPB 4BBYA 2Z30B 3CCMS 3L9ZA 3SQGB 1CC7A 2R3VA 4LFBJ 2RRBA 2JEIA 4Y2MA 2VZ9A 4X66F 4P7VA 4NXNF 3KK2B 2MZRA 1I94F 2W7PA 1HD1A 3OL6A 3GYXB 1RTDB 1NSKL 4MMOA 1PG5B 5L38A 2GS8A 4DPXA 5K14A 4I56A 1YJVA 1B3TA 1TU0B 3V6HA 2EXUA 4GC7A 1WD6A 4BWJA 1NZ8A 1YSJA 2GW8A 4TYAA 1WOPA 2IAJB 1RT2A 4O3NA 4OFZA 2GQ2A 2DKOB 3H5XA 4N5SA 1N6QB 3UDCA 2M4MA 4R5PB 1RWKB 5KFUA 3TVZA 1H2VZ 3ZZOA 3IC1A 2NYHA 3EWGA 3LF0A 5CABA 3R9LA 4LF8J 3TRGA 3M05A 5L9NA 4OI3A 3EXYA 1FVQA 1GXLA 2JVOA 3HXMA 3NRBA 4NMLA 2CVIA 1V3RA 3A3OB 1GT8A 1YTYA 2J6SA 3MAAB 3BN7A 1U24A 4NYOA 2E5LF 3GJTB 1NDLA 1HWIA 1Y11A 2BKNA 4H54A 2IPOB 4DR7J 5L39A 3DM2B 2W1BA 2JLEA 1F9EB 1PJ5A 3VZHA 2LYVA 4QBUA 4X62J 5K5MA 2A2DA 3W61A 4A8XA 4KYZA 5HP1B 1SJFA 4I6YA 2ZH9A 4WWSA 2E7VA 3VV2B 3ETOA 1IKXA 3RRHA 3FEXB 2QX0A 2MZSA 2PE8A 3T41A 2GV1A 1N0UA 3J7ZT 2ALZA 1X4HA 4QIFA 3UVJA 4RU9A 2I9SA 2DGQA 4ECVA 1KKHA 4NCGB 2OPRB 5D6GA 4WIQA 4I7FB 2CWKA 2E66A 3DCAA 4YHHF 1G6BA 3TZXA 2LVWA 4Y2KA 2ZJRQ 3G6VA 2FLLA 3HM9A 3QQCD 3D6HB 1PYOB 2XNQA 3EVWA 3G6ES 4C0BA 5KFAA 3C3LA 4I64A 3D1HA 4PG5A 1EZZB 2AGPA 4I68A 5F0UA 1JB0C 3PW0A 4N77A 4DDFA 4M5JA 4UZBA 1OY8A 3CWJA 2ZWOA 4K4YA 4IRDA 4EBEA 3CIMA 5KOXA 2XY6A 2F63A 4OYIA 1AFIA 1D9FA 4FXVA 2XSJA 4DL7A 3NG8A 1KD1T 2XWXA 1N54B 4HHHA 3BSCA 2OD4A 2B4VA 1RYRA 1UL3A 3TAMB 3DDNA 2HK2A 4C11A 2JFDA 2CQBA 5E33A 1QUPA 2IM3A 1ZH5A 7FD1A 1TUWA 4TLQA 4C7QA 1T7PA 2YX7A 1RWUA 3M8PA 3LH2S 3NGDA 5B0FA 2XZTB 1RTZA 3QJJA 4K4UA 5ETLA 2ALYB 1UKUA 3KTQA 1SV5B 4U96A 4C8NA 1M90T 3AJ1A 1KVKA 2L3MA 1FXDA 4IH6A 3QGPA 2OMOA 4DV2F 4J37A 3DLHA 5KFJA 1QE1B 3IWNC 2LXIA 1RXOB 4JV0A 2JX2A 1QTNB 1OO0B 2KVQE 1H7WA 2P6SA 1PBAA 5HO4A 4OZLA 2XYHB 2XCPA 2XLKA 3ISNC 3C16B 5C42A 3G82B 2DPIA 3PRBA 1WHWA 1UFLA 3QT6A 2EFPA 3BR9A 5LXRA 3EGNA 3Q8YA 3VAMA 4B9LA 2GFFA 3MPYA 1WKKA 1X9WA 1GMUA 2BUNA 1BQXA 3TEGA 5KAKA 2DD8S 1HWKA 2IRUA 4DSFA 5KFNA 4AQYF 2YX4A 5J2QA 4QWBA 1FD8A 2VODA 3V4MA 1Q95G 4OHVA 2AJ1A 1WTFA 2IRYA 3KHLA 3THVA 4C97A 3ZTQA 1FJ7A 3DOLB 3MMBB 3O44A 4U67Q 3DOMA 5KFEA 4KRWA 1N4LA 4O44B 2DNYA 3L7OA 1RA6A 2OFHX 2KT5A 2RH3A 3UE2A 8AT1B 3LQVA 3QJPA 3ZZPA 2R8HA 5EWGA 4IOCQ 2MHEA 4LRCA 3MM5A 3Q24A 2JVRA 2YH0A 1OJ4A 4X62F 2R2SA 4IFYA 1WC0A 3UO0A 3HHEA 1JKHA 1XMBA 5KFBA 2R8JA 4AFFA 4C4WA 4F0HA 4LF7F 2IM0A 2ZH8A 1R8PA 2FD2A 4C8MA 3K89A 1UWBA 1HQ2A 2RB7A 1M5KC 1XNRF 5CYQA 1JWWA 1FRXA 2UUBJ 3J7YI 1BQMA 1M5SA 2OPSB 4FPIA 1XMQF 3T19A 1IN0A 3ELHA 3ZTSA 4WFNQ 1H38A 3MEDB 4H4KC 3M30A 3CJTA 2R7SA 1TKZB 4KHMA 4LBHA 1VR6A 5L1LA 3NMRA 3EX7B 2ZD1B 2KHCA 2QMUB 3FBCA 2LCWA 4CO5A 4DL3A 2ZWPA 4U7UK 2NLWA 1RHMB 2F40A 3MPVA 1SKWA 2HZVA 4KSEB 2ADBA 1FFWB 3I96A 1KRPA 1KFDA 5I42B 5BR8J 2V67A 2E1AA 4GKJJ 4HI2A 2QA4S 1NKCA 4EBDA 3DGVA 1GX5A 3D1OA 3PIOQ 4USMA 2YNHA 4V19J 3CO9A 1RZMA 4B3RJ 5LSOA 2NUHA 4F50A 2B56A 3KHRA 1TUVA 1DTTA 1JLAB 4ED7A 4N41A 1S48A 5HMYA 4KKOB 4RW4B 2O01C 5ETKA 3GV7B 2MKJA 4Q0BA 2ZUAA 2ERRA 3M8QB 3OW2R 3IM8A 4P52A 2VOPA 1HMVB 4P73A 3QAEA 2CVEA 3VQSA 4JI4F 4KQZA 1YGYA 4OX9J 1JLGA 1YJUA 2D3ZA 4LFCJ 1QDUB 2XMKA 1KQGB 4XPCA 2GQCA 3EVOA 3VVTA 2R2UA 1U6FA 2FZCB 2DR6A 2FJWA 2EKYA 4DOZA 3BO2A 2OMLA 5CZXA 2KU7A 2JHEA 2Z0GA 1K47A 1S1VB 3W7BA 1R8BA 4DL4A 1LQ9A 3KUEA 1B64A 3V81A 3GJSB 3N6NA 2IBOA 4OJ3A 2VC1A 1WF2A 1YJNS 1LKZA 4ES1A 2NYIA 4ZPTR 2AYEA 5IS2A 4V19X 2HFUA 1JLBB 1VJWA 1UEKA 1TMJA 3OTBA 3CUNA 3W9IA 5JJBA 2HNYA 3OR1B 1M5PC 2IMWP 1WOSA 1RHJB 3G86A 4F04B 5I3UA 4XTTA 1W2IA 2H54B 4F36A 1X7VA 2UZAA 4DSIA 3VAIA 1B7YB 1JXVA 3H2VE 2KXFA 1Y9OA 1X0FA 2G2OA 2DR7A 1N36F 2FJXA 4YQWA 5D0HA 3U1LA 1XMOF 1UCNA 3IWLA 3KJQB 2JFKA 3VGTA 4DQIA 5DRKA 3N5BA 4EYHB 2DNNA 3GV8B 2XS2A 1DHMA 3H7HB 1XNQJ 3KLGB 5EWEA 1U1MA 5D4LA 4B3OB 1NK9A 1TKTB 3IN5A 2GHVC 2AEMA 2QLXA 2BXJA 3GFXA 2L48A 1EAYC 4FNIA 2AJQA 1IBKF 3OXFA 1HD0A 2MGZB 3BN4A 2DNQA 1LW0B 5C24B 4ZLJA 4EI2A 3JSBA 1N8RT 3GR1A 2D41A 2BACA 2RKIA 5KFKA 2LQ5A 2BJ3A 1SJ3P 3C6TA 3SBMA 2VICA 1HHTP 2DVIA 1RP5A 1A7GE 4LF6F 5E41A 1Q82T 1SJ4P 1B0TA 1NHKL 3CC2S 1UVMA 2MY7A 4Q5VA 1VK8A 1ZA2B 4X4NA 2ZH1A 4X64J 1NHVA 4EU0A 1C1CA 2KVIA 2V9WA 3H5SA 4WU3A 2AIRB 5L1IA 2X1AA 4TN2A 4LREA 2LXUA 4ETXA 4WE1A 2HHHJ 1RTJA 1DAXA 4L3NA 4UOFA 1RDRA 3DNCA 3QYYA 3GFZA 4TXSA 4ZPVR 4OV1A 2OPPA 4RO0A 1HNVA 4M5NA 4DL0C 2HYIB 5E0OA 2DK2A 1TMMA 4I6WA 1S10A 2CKWA 4OV6A 3KLVA 4OLPA 1WC5A 4DR6J 1JLCA 5GMEA 1MMLA 4OYOA 2CPJA 4YMEA 4M95A 4GKKJ 3AB4B 4ZPCA 5K9FA 1HBMB 3CT9A 1JLFA 4ZCIA 2XZWA 4C8LA 4NCAA 3K2YA 4WFZA 2PMHA 1RBOB 2VKRA 3B78A 1LW2B 1RWOB 5DQGA 2B4UA 4MFBB 2PFFB 2ZFHA 3SDEA 2BMBA 1TVRA 1VK3A 4ECUA 2OP5A 1MMDA 3NAIA 1HKAA 3O2IA 2AJ2A 2CA9A 3MM8B 1F2GA 4DPWA 1UZDA 3BDEA 1WTBA 4OI4A 4G1QA 4ZVRB 2BJ7A 2DITA 2QN6B 1VI7A 3M8ZA 4LRDA 4U95A 1U1QA 1RHRB 3W60A 2M7SA 4QJVA 4ICLA 3GIJA 2GVZA 3N0VA 1D3WA 1VGYA 1FK9A 1HW9A 3EICA 3N01A 4ZVOB 2HBYB 4LQ9A 3JYTB 2HHPA 4Q2LA 1R8HA 4RW7A 2HS4A 3KLHA 4ZS6A 4ZJLA 1IKVA 4KHPF 2EPIA 4GC6A 2ZE2B 2BBEA 2M0GB 2PI4A 2XO7A 2CJ9A 4DUYF 2MKKA 4JI1J 1X60A 2I5JB 3WX4A 5KFFA 4DR4F 3IRXA 2X3GA 2B8QA 1UWAA 1PCAA 4R25A 3D6MB 1JLQA 3G4SS 3RR8A 3CD6S 1TQLA 1T03B 1W26A 2VFVA 4DFPA 2KFNA 2DNHA 2DRDA 3WQPA 4Z7CA 4BS2A 4P9SA 5HL7Q 3M8WA 3H8YA 2XY7A 2AX0A 1S1WB 4DEZA 3CCLS 2HGLA 2DRAA 3AD7C 3AXKA 1VIXA 1SCJB 3WC2A 4QIWD 1NK4A 4F2SA 5EX0A 1TKXB 5A0YA 5KG3A 1DARA 1C0TB 2FJBB 1IKWA 1LV5A 3CJRA 3MEEA 2CXEA 3L09A 2N3LA 2GGPB 2PGCA 2XMJA 1QSYA 5F3ZA 2C3MA 3OSPA 3K5OA 3ZTRA 2V0NA 1OMSA 4PUOB 4HKQA 4URQU 3CJQA 2FC8A 3JTPA 1RAOA 3DLGA 3VTIA 3PJ9A 2Q79A 3RB4A 4A46A 5HI7A 1GAOA 4PWDB 1HR0J 5BXIA 3MEGA 4CO0A 2LEBA 1EB0A 4ITSA 1HNXJ 2Y0BB 3TQEA 4RW6A 2FPHX 1RHKB 2K3KA 2JEFA 1H6KX 4F02A 4IR1A 2AD9A 1C4CA 3M1VA 1JK9B 1VYAA 4UW2A 4KHRA 2F1FA 3DYAB 4X4PA 2FJDB 2HBZB 1R43A 3PYFA 3ULHA 4NLGA 1CG2A 4K4SA 2ZDOA 4I2QB 2YWKA 1NPRA 1DY3A 1UJ4A 2PO4A 2X1FA 2B6AA 2MTLA 5J2NA 1WOOA 2DCUB 3UCZP 4OZ5A 1AA1B 1Z4UA 2VBZA 5AXKA 1HYSB 3R5DA 2KB2A 4HI1A 4JV1A 1VQYA 2M8DB 2AT1B 5HK4A 3RBEA 3E8OA 2UUWA 1YVFA 4A8QA 3G2XA 1ZPVA 3TOQA 1AZSA 4AT1B 4IYQA 1FNMA 3JAMY 2ZHAA 4HDGA 4HVZA 2F4FA 4X65J 2D3O1 3QRQA 1HARA 3W2WB 3Q83A 4CLPA 2W7OA 1FNOA 2OEKA 2Q6CA 4WTOB 5K14B 2JWNA 3M8YA 4OQJA 2MKYA 1HQUB 1U2CA 4K4ZA 1D8ZA 3THPA 1BC6A 3T9ZA 5A8KA 4NLTA 5ETSA 2CJYB 3OLBA 1RT2B 3PYGA 1NHUA 1TFYA 3M4XA 2AYGA 4DL6A 3J7Z5 2KZMA 2XTJP 2HFOA 2ZOGA 1U1RA 3ZZYA 4O4RA 4P75A 4ZP8A 4NLPA 4ECWA 1HI8A 3ET6A 3FFIA 4Z2XA 4JYAJ 1RTIA 3QO9A 3HCXA 3PEHA 3TA0A 4CLUA 2BX6A 4O0IA 4DSJA 2KJWA 1S9EA 3L7UA 3KNAA 4JI8J 1CJVA 1U6BA 4K0KF 3HSZA 3LTOA 2C1EB 4LRBA 2QTWA 3OUYA 3IR5B 1I3OB 1T0TV 4QPTA 2NPIA 2FLPA 3N6MA 2QL9B 5D15A 3LP1A 1SKRA 1KC8T 2BJ1A 1N32F 4OYBA 1U0SA 2V6AA 3A3NB 4PG6A 5FLXU 5KFZA 2I2YA 2EW9A 4I2PA 2UXBJ 2FIUA 1UVIA 2BANA 1IKXB 1VCTA 5HBMB 4J9KA 2UP1A 3HSJA 4J90A 3GIKA 5FIIA 2CFXA 3KUGA 2Z2MA 3AB2B 1MNEA 2WVBA 3UVJB 3H4DA 3DFEA 1GX6A 1H0HB 1RACB 1REVA 1PILA 3CJ5A 2VG5A 2WBMA 3B6BA 3KG1A 3PX4A 1SQGA 1S0VA 1ROFA 2AEJA 1DZ5A 3Q86A 2FHMA 4ZVGA 3MMJA 4LT6A 2FTRA 1RB0A 1FJGF 1M5VC 3H40A 1HL6A 1U02A 4CLTA 2GVDA 3T1HF 2CZ4A 1CQNA 1VQSA 4K2XA 1OPIA 1IBMJ 1FRJA 1FE4A 1P1TA 1D1UA 2LQ9A 3POTB 4PYDA 4RBUA 5G4DA 3BSAA 1WACA 2CQ4A 4WU2A 5KG5A 5DGBA 4XDCA 2XSJB 3Q22A 2VKZG 1U09A 2W9AA 2HWTA 1FRIA 4X4RA 1YK9A 2C2DA 2EFNA 4QOTA 4C11B 3BZQA 4OYPA 1JIHA 2MQMA 4ZPBA 1YJWS 2RRNA 1S0MA 1N6QA 1MN7A 4DMZA 5IZHA 4R5PA 3QGGA 3A8KA 2BM1A 1NSPA 3PW2A 1X31C 3M8PB 2WB4A 2BM0A 3PACA 3W1YC 2FHJD 1L3VA 2IJFA 1NXIA 2NPFA 1NLKL 2R7XA 4A8SA 1QM9A 3GR0A 3SSRA 1T9WA 2MZ1A 3MAAA 1S6UA 1PYTA 2HIQA 4C0OC 1VQ9S 1F5BA 3DMJA 2U1AA 2MMYA 2PFDA 1NK0A 1RU1A 2GJ2A 3KDNA 1G4CA 2W9BA 3W9HA 1TL4A 1UPPA 3KJNB 4IO1A 4IRKA 2H4WB 4XK8C 3J81U 5HVFA 1R89A 3MEKA 4DR2J 4WZQA 2V94A 3CDUA 4NRTA 4F67A 1URNA 2B8PA 3UR0A 1PGZA 2KL8A 2G1DA 4JV5J 5D3GA 4D3GA 2FYXA 5U47A 1M5OC 2XY5A 2E1CA 4FS2A 4JYAF 1QVGR 2YKMB 4DFMA 4QWEA 3GQCA 3Q8PB 5J2QB 4DF4A 2HVZA 3IG1A 1T11A 3NCPA 1SC3B 1WI6A 2OPRA 2WTFA 4DV0F 1X5TA 2XEXA 4J9SA 2NSCA 2AGOA 2AP6A 3DRXA 1VRUA 5IV4A 2DT9A 3HZEA 2AJ4A 4KGMA 5A8RA 2M88A 3CDAA 3B8HA 3MZIA 1SB6A 3NGSA 4DUZJ 3QGHA 3OPKA 1F9HA 2CDQA 2RAQA 2M70A 3V2UC 3MM5B 4OYAA 1A6LA 1HBUB 4IFYB 5KG4A 2BJDA 4C48A 4IO9Q 1TTHB 1ZPWX 3I6PA 3CDBA 5DJBA 1UWBB 5HJXA 3SYZA 3M6VA 1V6HA 5CYQB 1NDKA 3QSIA 1S5ZA 1AXQA 3HVRA 2HURA 2RF2A 4Y0FA 3MURP 2NXCA 4KAIA 4Y65A 1RT5B 3AOBA 3HPOA 3TAMA 2GO9A 1HI1A 3M30B 3VAGA 4WTYA 3QNWB 3WBZA 3SCJE 2KG1A 4JI0J 3UD3P 5DQIA 3B4MA 1EP4A 2DGOA 4R0EA 4M94A 5AE1A 1BWVA 4FS1A 2CNNB 3C2PA 4MKYA 4ZJOA 2IBKA 1OSDA 3QGIA 2XYPB 4FYVB 3EVMA 2WONA 2AJ0A 5KFRA 4DQSA 3V6JA 1IBMF 3LUYA 5SUHA 2XM3A 1WC6A 2D1CA 1X5SA 1A0OB 1QE1A 2A6OA 2VA2A 4DX6A 4NLVA 3AA9A 4KFBA 3FC9A 3G8SA 1PC4A 2L9DA 4W90B 4ZKAA 2J0WA 5F9NA 4USTA 3D9BA 3M7VA 2RDJA 1DTTB 4ID5B 2J0QD 2JL9A 4CLLA 1S57A 4IFVB 1R7IA 4FYYB 2EVZA 1NAQA 4B3MJ 3UQSA 5FLXY 1KS2A 4CO2A 3NGKA 5CCMA 1MU2A 5J2PA 4Q0BB 3EJMA 1S6OA 2AGQA 2PA3A 2E9TA 1Z1ZA 1NJXA 1YI2S 1O51A 7FDRA 1Q8KA 1DRZA 3D6TB 3KLEA 1WDTA 1JLGB 3HHNB 1LEOA 1SIZA 5KFIA 1BUXA 3KJVA 3CXCR 2HZAA 2EK1A 2LMIA 3CCQS 2DR8A 3DOLA 3QT8A 3C46A 3HVWA 5FJ4A 5ETVA 3W65A 4O44A 2GJFA 1GMVA 1RHQB 1N48A 3UN3A 4CLKA 1K0VA 3DI6A 2CPIA 2GMHA 1FD2A 1ZM4A 4NWBA 4NZ6A 3V81B 5E3PA 1N34J 1SIWB 3BKTA 4I4BA 4FPRA 1U4BA 4J9RA 2VL1A 1J5EF 3R3TA 3N6LA 5F3TA 1JLEA 2HAFA 2X1GA 3IA0A 1VQ4S 1SL1A 1XQIA 3D66A 1FWKA 3PZPA 2G0CA 2DHSA 5DZ6A 1B4SA 2OPSA 2HNYB 1Y10A 5I3UB 1SC1B 2HQCA 1TL3A 5KFHA 2WVFA 3D67A 4KT0C 1Y4ZB 3PG9A 4DFJA 4A8FA 5J2MA 4FF3A 4LVOP 3G8QA 5A8WA 3G6YA 2IM1A 4ER8A 2EEYA 1N5TA 2JH3A 3HVAA 3TUZC 2KKHA 3I31A 2CQ3A 1TL1B 4B9SA 2VFRA 4DF8A 4ZLPA 1FX2A 3GJRB 2BJ8A 2D9OA 2ZBIA 1JNRB 2CQPA 2C42A 3QLHA 3TI0A 3HKZD 4HDHA 1QJHA 1U47A 4ZJQA 4S0MA 3CNQP 3FSYA 3OHAA 1UJ5A 5HVGA 1VIOA 2N7YA 5GAEU 1S76D 5AXNA 4ZHRB 3ENAA 3J81Y 1RWPB 1JLAA 2OFGX 1Q5YA 2B7CB 4KKOA 2GAGC 2JNJA 2XGQA 5A6WA 2UXDJ 2QFIA 3RB3A 2BV3A 4M5MA 3E01B 2V8GA 4ELUA 1NKEA 3PX0A 2BE7D 3W66A 3QSYB 4AL6A 4R0JA 2FY8A 3TZYA 3EPIA 3AOCA 4MYUA 5CH7B 4FF1A 2KHDA 1WUUA 4F7VA 2XLIA 3Q89A
chains in the Genus database with same CATH topology
1NNDA 3S1TA 1M5KC 1XNRF 1TK0A 1E6YA 1J5OB 3BR8A 4B17A 2XBPA 2WSCC 3ICLA 4YDDB 5J1EB 2FUG9 5CYQA 1KNZA 3EYZA 2VOOA 2DHGA 1KR4A 4KPYA 1FRXA 1ZZFA 3J7YI 4RBTA 1JWWA 4X4SA 4HYKA 4EGLA 3J80Y 1BQMA 4YP3A 1UMJA 2LQBA 3MD1A 1KSPA 4JV2A 1SI9A 2XG8A 1M5SA 2OPSB 4ILMA 3RB0A 4AXJA 4F4KA 1XMQF 4X65F 3T19A 1IN0A 3HFKA 1MW7A 3BSOA 2OPQA 2MDAA 2R7OA 3T1YF 4O3PA 2Q66A 5KG7A 2HRYA 2ZDPA 5EUHA 3UDLA 4WFNQ 4TQRA 1S1VA 2DNMA 2R2RA 4WCEQ 1H38A 3MEDB 1SUQA 2AW0A 3S8SA 3OVBA 3HHKA 2V4QA 2AYBA 2MYFA 3SXLA 4H4KC 3M30A 3ONQA 4XAKA 5KFQA 3MR6A 3DM2A 2YWFA 2MQQA 2R7SA 1TKZB 5I3PA 3AQPA 4KHMA 3NMAA 2GQQA 1Y3JA 2E5HA 2MKIA 5L1LA 3NMRA 1S6QB 3EX7B 4WE1B 2ZD1B 2ATLA 1RTJB 2KHCA 2YNIA 1RKJA 1S97A 4QWAA 4I69A 2LCWA 3R5BA 3TARA 4CO5A 5KFGA 4RW9B 4DL3A 1K8AT 5C42B 2VBYA 4U7UK 3M9MB 2NLWA 3GILA 1MROA 2F40A 2VUGA 2UUCF 5B08A 4GMKA 2OPPB 3MPVA 3LGNA 3T5KA 3M6UA 1SKWA 1HNVB 4WK1A 4YUDA 5DDRC 4F4XA 2OAUA 3KLIB 3U1MA 3QWPA 4DWIA 4KSEB 3DRYA 4ED3A 2ADBA 4ZCMA 4QYZJ 5F8JA 2DBBA 2HGNA 4UUWA 5GMKa 1IKYA 3BF4A 5HP1A 4Q45A 2GC8A 3I96A 3A1YG 1KLNA 2XSFA 1KRPA 5CD4H 2H5EA 3E3XA 1KFDA 2K7JA 4ZPWR 4ZK7M 5I42B 4IRCA 3IGVA 5D4PA 2E1AA 1N56A 3PNIA 1X8DA 4HI2A 2FHOB 2ZH7A 2J0XA 1JLCB 5I3QA 2QA4S 1KVJA 1FKOA 1NKCA 4EBDA 4ALZA 3DOKB 3RZAA 1GX5A 3U1NA 3D1OA 2DRBA 4TQSA 2YY3A 2E1RA 4YB6A 3PIOQ 2CQ0A 3D54A 4WK3A 1FEEA 2YNHA 3ZFVA 4DLEA 1JLFB 1WHXA 5KT2A 1S0NA 3PRDA 4V19J 4Y34A 3CO9A 1IXKA 2C28A 1M5HA 4UQGA 3CD0A 2RU3A 6FD1A 4ED1A 2Z4PA 4F3OA 5LSOA 4DN9A 3KYLA 3FRYA 2ZH6A 4DV5F 2NUHA 2QE5A 3CCSS 1FRKA 4LF4F 4NCGA 3IRWP 2QEXS 4PCQA 4F50A 2B56A 4C3MA 2U2FA 3RB6A 2OTJS 3I55S 3I5BA 2KO1A 4ZVEA 4I7FA 3BO4A 3B82A 5DM6Q 3KHRA 1O0PA 1OQ3A 1TUVA 1VQ5S 3UPFA 2WRMA 1UEUA 1DTTA 2JC1A 2R4FA 4JI8F 4J9QA 1JLAB 3HZGA 3SDEB 4ED7A 2L9WA 3MMAA 4N41A 3U02A 3TYTA 3VALA 1TVRB 5IQ6A 1S48A 3I32A 5HMYA 2RJZA 1XTZA 4KKOB 3CC7S 3EGZA 4RW4B 2O01C 3GV7B 2J9CA 2MKJA 1VBZA 2LDIA 1DJ0A 3IS9B 3EUNA 4Q0BA 5E3QA 4C3KA 5EX3A 2ERRA 4PG4A 3CE8A 3M8QB 4DN0A 3OW2R 4IG3B 3DLEA 1FJEB 1RT3A 1LWCA 3FZ2A 1UEVA 4G1QB 4CH1A 3CD7A 1S1TA 1IBLF 5LJ3Y 3M32B 2VOPA 3R27A 2BW2A 1HMVB 3BQ1A 1CEZA 3QAEA 4B9VA 1HBOA 1OPZA 2CVEA 3R5CA 3VQSA 2LEAA 4CTAB 2M2BA 4MIAA 4PG8A 4Q44A 4JI4F 2A2CA 4KQZA 4A4JA 4ICLB 4DFKA 1YGYA 4B3OA 3KK3A 4BWMA 5E2QA 1JKHB 1JLGA 1YJUA 5EHHA 2D3ZA 1HWLA 3SI8A 1SQEA 2XMKA 1KQGB 1NH7A 1FK9B 4XPCA 1YRUA 3MMCA 2B9YA 3HF5A 2GQCA 4FF4A 3Q0AA 1CVJA 2UUAF 1D0EA 2KG0A 3RW6A 2UXBF 2R2UA 2FVCA 1KQSR 1U6FA 2E9ZA 2IJNA 2BYCA 3ENVA 4MK9A 2VPWB 1MMNA 4MK8A 3MFHA 2MZTA 4RW7B 1N5SA 3MM7A 3HHDA 3KLHB 5KFXA 2FJWA 2VV5A 3RTVA 1T3NA 4NRUA 2EKYA 3PJWA 1L3UA 1BQMB 2P9EA 3F41A 1R31A 2PT0A 4DOZA 1R0AA 2XS5A 3OXGA 4NPOA 3BO2A 3H20A 3LANA 1U26A 1IKVB 4K50A 3EPGA 2IM2A 3CJKA 5A6PA 2FC9A 2OMLA 3LO3A 4CZCA 5C25B 5CZXA 5C24A 1W2BR 2CQCA 2KU7A 4G6VB 2JHEA 2R7WA 2Z0GA 4QU7A 3IFEA 3JTNA 4X2BA 1VRTB 1S1VB 5ITHA 3W7BA 1R8BA 2O1PA 3GFYA 4DL4A 5CA5A 1LQ9A 2EFOA 2X51A 3KHGA 4A8KA 1Y7PA 1KLMA 2RIJA 2F3JA 2J7UA 1B64A 3N28A 1QAXA 1UETA 3DRRA 3V81A 4KO0A 2KM8B 3GMGA 3AJ2A 3OTOF 3HT3A 5M2UA 1U1PA 3H2UB 3N6NA 4QWCA 3E51A 2IBOA 2NSBA 3T5LA 1FKAF 1OS5A 2JDJA 2JC0A 4OJ3A 4NZ0A 2VC1A 3FEZA 4HTIA 2KM8C 1WF2A 2QYCA 3QMQA 2LLZA 1YJNS 2AU0A 2KZZA 1FKPB 1LKZA 4ES1A 3IRXB 4FBTA 2NYIA 4ZPTR 4YOEA 1CPZA 2AYEA 2COLA 5IS2A 2RMLA 1JLQB 4RNFA 3OTCA 5DDOC 4V19X 3IBWA 5H9EJ 1OQ6A 3RW7A 2LDYA 1IKYB 1C1BA 2J9DE 1LXJA 2CJAA 1JLBB 1FO1A 1L3KA 1AFJA 1VJWA 1I1GA 3MAHA 3T5HA 5EWFA 4M5DB 4K4WA 1SV5A 1FRLA 1RT7B 3PIPQ 2RS8A 1S7HA 3LP2A 3I5AA 2W9CA 2QT7A 2CIMA 2F8EX 3OTBA 3ZZ0A 4FYDA 1S4FA 3CUNA 2FJAB 2BRKA 2O5DA 4G1PA 3S6EA 4ZP9A 5FDLB 2QA4G 3R1LA 1HW8A 2DIUA 4ILLA 5JJBA 2HNYA 3OR1B 5D4NA 1M5PC 3PY8A 5KFPA 3F73A 1YWXA 2IMWP 1U2RA 2DNRA 2M5YA 3G86A 3MCSA 5I3UA 1RT6B 2ZVSA 3FCHA 5T7LA 3K58A 2FHJA 5T41A 4ZMMA 2YNHB 1FT8A 1D9AA 2HHUA 1W2IA 3DHXA 2WCXA 3RU0A 3GIMA 1X7VA 3NS5A 4OZNA 1BQNA 2NREA 2UZAA 2JRSA 1Q53A 4DSIA 3VAIA 1GH8A 1QSSA 3PO5A 1Q79A 3H2VE 3R1HA 1RI7A 5A0YB 2KXFA 1IKWB 2LA4A 1URRA 5K8NA 1Y9OA 1X0FA 1DTQA 4J5OA 2DR7A 1TFWA 3MEEB 3NP5A 1VOMA 2RSQA 4OI1A 5IT0A 4PQUA 1N36F 4IQXA 2HHVA 2FJXA 4YQWA 4OZ1A 2XULA 4J9PA 4OJGA 3U1LA 1QVFR 4E8UA 5EDWA 1KQFB 1XMOF 5GAGU 3MAQA 1HWJA 4UUXA 1SXLA 3IWLA 1K0TA 2HMIA 4OHZA 1H98A 1NH8A 3CULA 4TU9A 2JFKA 4GO5X 4DQIA 4OI0A 5DRKA 3Q8SB 1D9DA 2CJQA 3N5BA 2UXCF 1LWCB 4MKBA 4EYHB 1I6JA 1SH0A 2DNNA 5B0GA 2WOMA 1U1NA 3GV8B 2XS2A 1DHMA 2Y0SD 3V5RA 3LAKA 2HFNA 4F8RA 4BC9A 4YB1P 3KLGB 2ROPA 1GTHA 5KFMA 5EWEA 4HLBA 1U1MA 5D4LA 5H9FJ 5HROA 4B3OB 1FXLA 3KK3B 3BM7A 1NK9A 1TKTB 2POKA 3K7RA 3IN5A 4C9DA 2YNGB 5HLFB 2OTLS 2GHVC 3F56A 2RDIA 3MMCB 2P5VA 1LXNA 2F9JA 3O6QA 2QLXA 4USJC 2BXJA 3D0HE 4B02A 1FJCA 5LT5A 1HNWF 3PR5B 1YJTA 1V3SA 1IM4A 1VBXA 1XK8A 2BZ2A 3GFXA 2L48A 1FDAA 5CQGA 1TK5A 4FNIA 4RW6B 2AJQA 1FDNA 3MMBA 4Y6IA 4F3QA 1IBKF 3OXFA 3M1VB 4LFAF 1HD0A 3Q23A 2MGZB 2FVQA 3M2UB 2B3TB 4WYWA 3R5AA 1S72S 1TR0A 3BN4A 2DGXA 1R8AA 1FESA 2DNQA 3RR7A 1LW0B 2HPUA 3ITHA 2G9OA 4I1TA 4A48A 2PSZA 5C24B 1ULRA 1Q8IA 3JSBA 1NK6A 4XDDA 2KYXA 1N8RT 5K8MA 1FERA 1P9QC 3GR1A 3ISZA 2D41A 2FJEB 4I0WA 1O5JA 4ILRA 2F8MA 2BACA 3D28A 4WFAQ 2EFGA 1SL0A 5CZVA 2CPZA 2VPZB 1VQNS 2HLTA 2XMVA 1DQAA 3K0JA 1VHFA 1AW0A 2RKIA 4DR2F 1HWUA 5KFKA 4IR9A 2XC9A 2LQ5A 1SJ3P 3O1LA 2EC0A 5KFVA 5J2NB 2R7TA 1KEKA 3OSNA 2E9RX 3C6TA 4PKDB 3K5NA 3VF0B 4KE5A 1UFWA 4ES3A 2KJVA 4KC5A 5JVGQ 2Y1JA 4DS5A 1HNIB 1HHTP 2DVIA 2YNFB 1RP5A 3O8WA 4DV7F 3LOUA 2GA7A 4OHXA 4TY8B 1A7GE 4NLUA 4LF6F 3GZ7A 4WYLA 3KK1A 3PKMA 2Q3PA 5E41A 4JV5F 1XR5A 4NLRA 3NNAA 2GHPA 2JOQA 2VQFF 1Q82T 2JLFA 3JYTA 1SJ4P 2M8HA 1J5OA 1B0TA 3BGRB 4LFBF 3CC2S 2HWIA 1XN9A 5J1EA 1UVMA 1VQPS 1UW4A 2W9CB 2MY7A 4CNZA 4Q5VA 4MAKA 1VK8A 4NL5A 1VQ8S 3KMQA 2J6UA 3CPWR 4X4NA 1KHVA 2ZH1A 2UV8A 5B0AA 4K4VA 5K8OA 3JTOA 1NHVA 4EU0A 1C1CA 2KVIA 5KFSA 2V9WA 3M6XA 4H4KA 4J9NA 3H5SA 4WU3A 3CCJS 1ZZNA 4ZCLA 4EO6A 5ADZA 2LEPA 3MEDA 3QZ7A 5L1IA 3AA8A 2ADCA 1S9FA 4ZA1A 2UVUA 1BQNB 2X1AA 1JJHA 4TU8A 3G6XA 1TKDA 1TKZA 1G2EA 4TN2A 2FLNA 3WC0A 2LXUA 3UCGA 4ETXA 1S6QA 2KTQA 4WE1A 3PW5A 2ZD1A 3CJ2A 2R7VA 1RTJA 3M9OB 1UVNA 3B4DA 1DAXA 4L3NA 2V8HA 4Q2MA 3HK2A 1RDRA 3AAWB 3GV5B 5JVHQ 4JI2F 3DNCA 3QYYA 1Y3KA 3GFZA 4RW9A 5H1SV 1O8BA 4TXSA 4ZPVR 4OV1A 2OPPA 4DUZF 2B5JB 4DQQA 5F41A 1HNVA 3KLIA 3DXSX 4DL0C 2HYIB 3CDEA 3FQLA 5E0OA 2DK2A 5T14A 4ATNA 1IQZA 1S1UB 2Q1LA 2HHTA 4I6WA 2HMIB 1S10A 5AXLA 2KYZA 2QMWA 3H25A 2CKWA 5CYMB 1QAIA 1U45A 2L9NA 1XR6A 4QZVB 5HMZA 3KLVA 5I42A 3F44A 1K73T 4OLPA 5IM0B 2I1RA 2IHR1 1WF1A 4USIA 1DQ8A 1JLCA 5B09A 1MMLA 2CPJA 2C3UA 4YMEA 3O3LA 2ZH4A 4M95A 3AB4B 4CIOA 3JB9k 4ECXA 2IVYA 3CEDA 1RISA 4ZPCA 2XNRA 1NO8A 4DBQA 5K9FA 3BQ0A 4JI3F 1HBMB 4LF8F 3AQOA 3CCRS 3CT9A 1JLFA 2YKQA 2XZWA 4ZCIA 3QZ8A 5A8KB 4ECQA 2BQRA 2N7CA 4HL9A 4DR1F 4K5SA 4ECYA 5HROB 5BJRA 3MGJA 2XMMA 4C8LA 2P6TA 3PDNA 4NCAA 3K2YA 4WFZA 3CCUS 1YIJS 2KDOA 2H9ZA 1U48A 2PMHA 1ZM9A 2VKRA 3LP0A 1F5CA 3MHYA 1TAQA 3B78A 5BYQA 1LW2B 1TV6B 3TO8A 1Q7YT 5DQGA 2KN4A 2B4UA 3HJFA 4MFBB 2PFFB 2VG6A 3W3SA 2ZFHA 3SDEA 5LMNF 2DR5A 2VPYB 3KKFA 4KBIA 1R8CA 2JEJA 2HGMA 5KOWA 1TVRA 4WJBA 1VK3A 1VQ7S 4ECUA 3N79A 3FDSA 4DR7F 4RW4A 3TANA 5M2RA 2OP5A 1MMDA 2HS3A 4O3QA 3NAIA 2O67A 3IS9A 5L1KA 3O2IA 5KT6A 3GB0A 4OLOA 4JI0F 2CPFA 5DLFA 1NK7A 3M8QA 2C3YA 2QO3A 3MM8B 4IG3A 1NJIT 3FRZA 2Z2LA 5F8NA 3M6WA 1N5VA 1F2GA 3BDEA 1WTBA 4OI4A 4G1QA 1GXTA 3LWMA 3OTDA 1FRMA 1OWXA 4KV8B 3M32A 2MB0B 3ZZTA 3MTJA 1W25A 1JMTA 4QR2A 2DHXA 1HMVA 2DITA 2MKHA 1S0OA 1Y5LB 4YR2A 1S9EB 1VI7A 2RKIB 1T8EA 4PWDA 4CTAA 1U1QA 5G0RA 4K5RA 3KWMA 2M7SA 4QJVA 4ICLA 2OIHA 1LWFB 3GIJA 3C6TB 5I4MA 2CJBA 2DGTA 3N0VA 1D3WA 1VGYA 2PIIA 3V6DA 2DGVA 1FK9A 2FJVA 2HVIA