1FJGF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fjgF00
1I94F 1IBKF 4JI7F 1N36F 2B7CB 4LF5F 2YY3A 3ZZPA 2BVZA 1N34F 4DR5F 2KJWA 3R3TA 4YY3F 5BR8F 4GKKF 4JYAF 4OX9F 4JV5F 4LFCF 1XMQF 1IBMF 3T1HF 4DV5F 2RJZA 5LMNF 4LF9F 2F4VF 4X62F 4GKJF 4JI8F 1HNXF 4X64F 2E5LF 2UXCF 4DV6F 4JI6F 4LF6F 4B3SF 4DV4F 4B3TF 2ZM6F 1G1XA 5LMUF 2UUCF 1N33F 2UXDF 1IJEB 1F60B 4JI1F 4K0KF 1XNQF 2VQFF 4DR3F 5IWAF 1B64A 4DV1F 2UUAF 4YHHF 1FKAF 2UUBF 4NXMF 1HR0F 4DR4F 1LOUA 3T1YF 4DR2F 4X65F 4JI3F 4DR1F 2HHHF 1IBLF 4DUZF 1CQMA 5AJ3F 1CQNA 4DUYF 1HNWF 4KHPF 4JI5F 1J5EF 1RISA 1FJGF 4DV3F 1XMOF 4B3MF 4JI0F 4X66F 4LF7F 4AQYF 2BXJA 4JI2F 1GH8A 2UU9F 1IJFB 2B7BB 3OTOF 4DV0F 2VQEF 1HNZF 4DV7F 2J5AA 4LF4F 4DV2F 4LF8F 4B3RF 1VMBA 1XNRF 4DR6F 4LFBF 2KJVA 1G7CB 4DR7F 1N32F 4NXNF 4JI4F 4LFAF 1QJHA 2UXBF
chains in the Genus database with same CATH superfamily
5KG4A 3KNGA 3CJ2A 5F3TA 3TJ9A 1Y10A 2YNIA 4GC6A 1F3VA 1Y3KA 1OSCA 3MPUB 4NL5A 3ZTPA 6FDRA 2V8VA 3NCRA 2IDEA 5D3GA 1IR1A 3ZXWA 2MXYA 2GJFA 1WC4A 3SI8A 3HVAA 3THTA 3R5BA 3BDPA 4PEOA 1RCOB 2HQGA 1ZM3A 2AMCB 4F04B 2RRNA 3R2CJ 3NWGA 2C3UA 1HW9A 3B4DA 2ZH5A 3KDNA 4G1QA 3BYPA 4DCOB 3MOZA 3CMAS 1WACA 2HZCA 3BZQA 3X3UA 3JS9A 1K8AT 3PX0A 2JH3A 1X8DA 3TVKA 5GADI 3HPOA 1NSPA 2VBXA 1FJ7A 4P71A 4K4ZA 4DL4A 5KFGA 1KDNA 1ZA1B 4NMLA 1GH8A 3HXMA 3ADAC 5KFOA 3U1MA 2B7BB 5I3QA 2AF6A 1T94A 2ACMA 1YZ7A 5E3PA 1Z1ZA 1C1CB 4ILRA 2HLUA 1VK3A 1U1KA 1TFWA 5J2QA 1HMVB 2CPZA 2PGCA 4WZMA 5DQHA 1V5VA 4WXOA 5CYMA 2HNYB 3SV4A 3MEDA 4C8MA 3U02A 5IV4A 1DTTB 3CMQA 4LFBJ 2FY8A 5MAOA 5B0CA 1Q7LB 3LP2A 2YQ0A 5K8NA 2DHGA 2FHJA 1UZHA 3KLIA 2MKKA 3I96A 1YX2A 1T02A 4IG0B 1Q5VA 2JSXA 2WAQD 4EO8A 1B0TA 2I8EA 2GGPA 1KONA 1FO1A 2BMBA 3U7JA 2OJ3A 2M3DA 4DL0C 4F4WA 2F7VA 1RT4A 4FF4A 2VU5A 1J5EF 5LMNJ 1TK5A 4DU8A 2KM8C 4NA3A 5CXTA 4O3SA 1RBLA 2MKJA 1VC6A 4X66F 2JEIA 2LP4A 3JAMY 4LF6J 2NPFA 1RT7B 3IWLA 3I5CA 4JB8B 1FEEA 2EFPA 4RUBA 1J5EJ 1FDDA 1XR5A 4QR2A 1VQLS 4KSEB 3OUYB 3I56S 1T3OA 2MQ8A 1XQIA 4TN2A 4A8OA 5HATA 1QJHA 3BF4A 1NKBA 4DUZJ 2B5JB 1X9MA 1UFWA 2X3DA 1S1XA 3MMBB 4ZITA 2ZH3A 2L9DA 3MTKA 5KFXA 1EHWA 1CEZA 1QVFR 4I6WA 4LQ9A 3D66A 4O3RA 4HACB 4JI8F 4ELUA 1PJ7A 1F5BA 2ROEA 2FIUA 1BQMA 2NSBA 3V6HA 3IS9B 3D0HE 4K0KF 3OR1A 1M5SA 1UL3A 2B4UA 3SSRA 4DV1F 1OO0B 4WXWA 1FJEB 4KGZB 1S1UA 2KXFA 2DY1A 2GZOA 1P27B 1UVMA 2CQ2A 2VFUA 5DDPC 3QZ7A 1H38A 1NRKA 3PYDA 4WYWA 1KFSA 2KT5A 1DJ0A 2ILYA 1VQ4S 5F9LA 2RE1A 3OVSA 3QJPA 5J1EA 3HDSA 1WNEA 3SCIE 3H5YA 2YWHA 4IFYA 5IXUA 4O44B 3PACA 1GXLA 2ZE2B 5GMEA 4PG5A 5H9EJ 2J9DE 3EPGA 3M2RB 3GE9A 4UOHA 1EB0A 1RB0A 1IKXA 3I4PA 2CWXA 4J37A 3KLHB 5GAHU 2MQQA 4QU7A 4TY9A 3NEKA 2ZBIA 2AJ1A 3RRKA 3NOGA 3MECB 2PT0A 3J7Z5 3MD1A 4OLOA 4NCGB 1F1BB 2G4BA 5B0BA 2WW8A 1MSWD 5IC6B 3ICLA 3AJ2A 4Y2CA 4V19X 1BXNA 1JKHA 1X4DA 2FB0A 2HNDB 3I82A 3EICA 3HHLC 3HLUA 3UCGA 3D0GE 4NZ6A 4WTOB 4MT1A 5L1KA 3M2UB 2IAJB 2OTJS 3AD8C 5KFZA 1NK9A 2P6TA 2PEHA 3PO5A 3QAEA 2W2NP 3EVOA 2VQEF 3NBPB 4J7CA 1SC6A 1N5YA 3OTCA 2LEAA 1MMLA 1FNOA 2BJ7A 1B7YB 4IQXA 2YKNA 4R0JA 2VQEJ 3MM7A 3HF5A 4BHQA 4PG4A 4ZCLA 4PQAA 4NEZA 3LPEA 5EDWA 5C5JA 2MKIA 1M1GA 2CVEA 5HROB 5KOWA 4KKOB 1UA1A 4J9LA 4KGKA 2D69A 3HKZD 3OTOJ 4C0OC 3QSIA 2E29A 3GR0A 1HI0P 4NLGA 3H0PA 3G2XA 1UCNA 2RDDA 2J76E 3GG1A 1IM6A 1HQUA 4NA2A 5KFJA 4DR4F 4OI4A 4OYXA 2D74B 2QA1A 3ITHB 1X0FA 3F73A 1TKTA 2V63A 3TJAA 5IFMA 3AQOA 4XIUA 2LEPA 2WVCA 4M63A 4DN0A 2D3UA 1CJVB 1U2RA 2CZ4A 3LW5C 2HK3A 5J1PA 2FVSA 2BZ2A 3MTJA 3UVJA 3EVWA 2OAUA 2HVIA 1CJTA 1ZAVA 1UFLA 4DR2J 2AX1A 3CDUA 3FK4A 2EI5A 4NLPA 3K8WA 1RYRA 5D8HB 2FQQB 2J7KA 2P9CA 4HH1A 2CQ1A 4LBHA 2BW7A 3T1HF 3M1VB 1RHJB 3DI6B 2BR0A 3D6MB 1G3OA 5EX0A 3HFVA 1Q8IA 4QCLA 2YKMA 3R8YA 1U47A 2Q1LA 3T1HJ 2K3IA 1XMBA 1SL0A 1YK9A 3H2UB 1BLUA 2PEBA 3M6XA 3QGHA 1GMUA 4K5RA 2M8HA 1VLOA 2VC1A 3QWPA 4RW8B 3ELHA 4ZPBA 1WKLA 4LBPA 1U0SA 5JXSA 3M6UA 2DGTA 3K2YA 9ATCB 5F8JA 1DQ9A 5D6GA 3MPYA 1C4CA 2HWTA 4C4WA 2WSFC 1LQ9A 3OL9A 5H9EK 2LA4A 5KFMA 3TJ8A 1WEXA 4DOZA 4CLTA 3J7AN 2B7CB 2VPXB 3P96A 4MK7A 2LMIA 4H4OB 3PRVA 1VISA 3US5A 4OI3A 5DLGA 3GJQB 4NA1A 3OTEA 2L48A 4ED8A 1Y00A 4K4VA 3BN7A 2HBYB 1E6VB 3W8GA 3WBZA 1Y11A 3TZWA 5B7WA 4ZVUB 2BJ9A 4NXMF 2XLIA 1MWZA 1S5ZA 4MTPA 3KLVA 1VYAA 1VFJA 1RXOB 1TTHB 3J80Y 3LGMA 4O4RA 1RADB 1GX6A 2ZNYA 3GMGA 2KZZA 5F41A 1LEOA 1REVB 6AT1B 1CS4B 2V4QA 2Y8WA 1VQKS 1DAXA 2B51A 1BC6A 3AH6A 5AJ3J 4I56A 4DSLA 2GMJA 2D3OR 2VKZG 1YLXA 2HYIB 3ZFVA 3CJRA 4ED4A 2MEWA 2HNZB 3BPSP 2BKPA 5AE1A 4B3OA 1LW0A 1RWKB 1NK0A 4DQSA 3M30A 4LR8A 1FK9B 2VQFF 2XZTB 1LWXA 2R9LA 3OR2B 1NK4A 4CRJA 1YJWS 3C6TB 4NRTA 4P9SA 1V3RA 4FVCA 4FF3A 4DF8A 3MF5A 1FWPA 2VQFJ 2PI4A 1GMWD 3G8QA 5AXMA 1TZ0A 3SCJE 2LKZA 4M95A 4F4KA 4CYUA 1TAUA 2K8GA 4X4SA 1JNRB 4RNOA 5G0RB 2VF3A 4QWEA 2E1CA 1XNRF 4G6VB 2MLYA 2XMJA 1MG7A 1IUJA 4DR7F 2HHXA 3GFYA 2XY5A 2IA6A 1YBTA 5A8KA 2UXBF 3JTOA 3BQ2A 1XNRJ 3FMBA 1FVSA 3QAUA 3CJQA 3W66A 4ZPDA 3RRGA 2KG0A 4DR7J 4XPCA 1AFIA 3J81j 2R2SA 2EFOA 4DPUA 1KOHA 2NSCA 4FKYA 1VQYA 2UUCF 4CQ1A 2R42A 4N7TA 2KU7A 3MM9B 2B6AA 1FI4A 4DDFA 1JIHA 3R5CA 4RNHA 2DISA 3BR9A 2VFRA 2XY7A 5C25A 5L39A 2DNRA 4J9VA 4RW4B 4I2PA 3IWXA 1Y3JA 4M5DB 2V9WA 1FRKA 1HNXJ 3MAAA 5LJ3Y 2E5LJ 2LU2A 2XSJB 1VQ8S 1Q5YA 3VZHA 4BCAA 3D2WA 5HQ8A 1D0EA 1MWQA 4LIWA 2NR0A 4E98A 3DDNA 3BN4A 4IRCA 4RUAA 1Y5NB 4X4PA 2DY9A 1QM9A 1A0OB 4K7QA 5L38A 1CULB 4C8LA 2CQIA 1A7GE 1B70B 1I3OB 3MPDA 3GYGA 3H5SA 1SKRA 4PUOB 1UWBB 5HP1B 3GFXA 1N34F 3H20A 5BYSA 3PR4A 4ZCKA 1D9FA 4WKRA 4GKKF 2NXUA 4ZHRB 4PQUB 4UZBA 3RAQA 3MHYA 2L08A 2XHCA 3FKBA 1MW7A 3H7HB 4ZIVA 4GKKJ 3Q8YA 1NB2A 1RAOA 5KFDA 4A4JA 4ZVGA 1L3UA 2CQ0A 1FKPA 2AYBA 1KN6A 3W2WA 2X1AA 3FEYB 3NCQA 3N4WA 4WK1A 1TL3B 2IIHA 1VBZA 2F4VJ 3T19A 3VAMA 4B9LA 1XMOF 4CT8A 1YJTA 1RHKB 2RQKA 1EX8A 4GO5X 3DM2B 3Q0AA 1JLFB 4ITSA 3ISZA 4ZVTB 1J5OB 2DR9A 3SBMA 3R5JB 1XMOJ 5KFRA 1HQEA 4Q2LA 2JDJA 2IYIA 4LBIA 1JJ4A 2BQ3A 4HKQA 5GAEU 5F3ZA 2AJ0A 2CJKA 2H4YB 3CSKA 2J0QD 4ICLA 4B02A 3BBCA 4JI0J 3EE3A 1WF0A 4EK2A 3TX0A 3MCNA 1Q95G 2UP1A 2JJ4D 1FWKA 5I3PA 4ED1A 4IO9Q 1NDLA 5FLXY 1T3NA 5KFYA 3MXHP 1IJEB 3HM9A 1QVGR 1Z2ZA 1N32J 4KO0A 5G4DA 1RUSA 5JJBA 5E0OA 2VD3A 3JSYA 2R2UA 4A46A 3D3CJ 2G0IA 1FJCA 2G2YA 1JJCB 3PW0A 4USWA 2J9EA 4QOTA 1T05B 4J9RA 1S6QB 3EGVA 2HSEB 2YNFB 3HO1A 4U7CA 3RB0A 4KPYA 1RP5A 5IM0B 3KK1B 2C3OA 1IBCB 1SC3B 4CH1A 1B4SA 3GIKA 2CAJA 4ATNA 3I32A 3ILLA 2EWHA 3PO4A 4F3OA 3MPWA 5HAOA 2H5EA 2NCKL 3J80U 2E5HA 3ETOA 1TK8A 4LREA 4A47A 4Y2MA 1FRXA 2WTFA 5CYQA 1F2HA 1VRUA 4CLUA 2ZDOA 1Q8BA 3C14A 1FTCA 1NKCA 1ZAWA 4ZLJA 5IT9U 5CABA 3HSDA 1FFSB 2CA9A 5KT3A 4K4WA 1S0NA 2ZOGA 2RKIB 2AU0A 3EX7B 4MH8A 4EBEA 1WHVA 5T7LB 1HWKA 1G1XA 3I31A 2XLJA 1C0TA 3IP0A 2R7OA 1U26A 4LF5J 1HW8A 3QLHA 3M2VA 3FBCA 3BB5A 3UW1A 3NWRA 3GP9A 2MY7A 2NXCA 4AL6A 3TUIC 3HFZB 4EZ9A 3U1LA 4OMFG 3CD0A 4Y0FA 3I87A 1NJIT 2YWEA 2AZ1A 2VG5A 1VQOS 2BUNA 3MEGA 2ABYA 2VG7A 2KT3A 4HI2A 3BYRA 3FDSA 1U4BA 2LXUA 3CNQP 3ZO7A 4ED7A 4DLGA 2Q66A 3SQOP 2HFSA 1S6UA 3BSCA 3G6XA 3B4MA 1RTJA 3SQGB 5KFIA 1QDUB 4TY8A 1NUEA 4FVMA 2ZOMA 2GO8A 3ZZOA 3FSIA 4LF7J 1FWLA 2WSEC 5IT0A 1HNZJ 3MM5A 4HHHA 3OVAA 2OD4A 3M8PA 3G9CA 1RT6A 1Q1KA 1SQEA 1ZETA 2MQPA 2D1CA 4JP8A 2W7AA 2GV1A 2MKCA 4M5MA 1NPRA 4ZJOA 2ZHAA 2VDIA 3KKFA 5LXRA 3C6UB 2FHOB 2W25A 1CC7A 5CAAA 3SEOA 2R7VA 3R7NB 1P9YA 1UVJA 3W63A 1UETA 2HURA 4G3IA 5KG6A 2OEJA 1DBDA 2ALZA 1R8BA 2FJXA 4U67Q 3HSZA 4Y3CA 3C8YA 4ZPTR 4C0HA 1Q0NA 4DSIA 3MR2A 1OS5A 4QBUA 1S4EA 1T8EA 2LA6A 5AE3A 3KMQA 3LGNA 1WTFA 1WEYA 3ILIA 4OIXA 1SUQA 3ISND 1Y5LB 2ZM6F 4ZVSB 4U7UD 3BGRA 2NXJA 3EZOA 5LOQA 5JMNA 2DB1A 5K14A 5SZTA 5CD4H 1LW2A 2ZM6J 1GTHA 4UY85 3HX9A 1ZTWA 4FF1A 3UI3A 1JLBB 3DRPA 4KHPF 2G1DA 1L3KA 3BQ0A 4GKJJ 1XWLA 1FDAA 1D1UA 5C24A 4BWJA 4AD6A 1RAEB 2RF2A 4OV1A 3BS9A 4KHPJ 3MM6A 4KGMA 4FP9A 2G9OA 1VQ9S 1VMBA 2K1RB 2Y3YA 2VPWB 5M2RA 4CP5A 3NGTA 4U8YA 1VBKA 3OL8A 4L3KA 2MKYA 2QC3A 2ZC4A 1I94F 4HEA9 4RNNA 1T11A 1VBXA 4JI5J 3KG4A 2IM2A 4NLRA 5D4NA 3UR3C 2J6UA 5BYQA 3A3NB 1HHTP 3MR7A 1U1OA 2PSZA 2WZ1A 4HDHA 4B3RJ 5HVGA 5EHHA 1P1LA 2M70A 3MMAB 2N4DA 2RSQA 3C19A 4IFVA 1KFDA 3QIDA 1IN0A 2YWKA 4JYAJ 1D8ZA 4MMOA 1FRIA 1Q16B 4EFAC 3BGUA 3KOAA 4D3GA 2AYEA 3NGUA 3EM1A 4JI6J 3SCLE 1UW4A 2YWGA 4HI1A 2IJRA 3M05A 1UTAA 5FDLA 2LEBA 2FHMA 1IQZA 1R8AA 4BS2A 1V6HA 2DNGA 1RBOB 3DU6A 3VV2B 1FKOB 2HQIA 2F9JA 3KJVA 3DLHA 4OZJA 1XN9A 3PR5B 4C3KA 2BOPA 4LRCA 2KHCA 3GV7B 3CIZA 5GMDA 1F6TA 3D6TB 4TU7A 3PX6A 5K9FA 2PI5A 4KT0C 1TMJA 1RT5B 4GVBA 2UXCF 3H4BA 4O3OA 2POKA 1HHQA 2QE5A 1ACMB 1U0HB 4QWCA 1FT8A 5F8GA 5IS2A 2PFFB 4Y28C 5KG2A 4QW8A 5DM6Q 2CNLB 3OFGA 2XYGB 3EXCX 3T6BA 4XPEA 2YH1A 4ELVA 1TVRA 1DY3A 3PHEA 3OPKA 3RB6A 1HNWF 4LIRA 2GS8A 3QZ8A 2JEFA 2FD2A 3OT9A 3H5UA 2Y9HA 3EDRB 1HNWJ 4YFUA 3I0SB 3HD2A 4NYPA 3SYZA 4LF4F 4TNOA 5A0YA 1IKVB 1QUPA 4A8FA 3RBZA 2C42A 5ETKA 3EUNA 3AD9C 3ZTSA 4LF4J 2HBRB 4CM2A 4G1PA 1MU2A 2O1PA 2F8HA 3TANA 3Q86A 1WG5A 2AIRB 3DOLB 5DLFA 1Y5IB 4HTJA 2CQGA 3KK2A 4RW9A 4IRKA 1T95A 2XNQA 3FBBA 2B0GA 2MDAA 4OYMA 2Z58B 1RTIB 3ZZTA 2F5GA 1ZYQA 3K5OA 3HZGA 3DLKA 3CJKB 1RWVB 2HQFA 3IAS9 3IO1A 3AQPA 2BJ3A 3EXYA 2R7UA 1S57A 4IKAA 4FPRA 2RIJA 3PFEA 4RW7A 3CCSS 1VHFA 3KK3A 1QAXA 3HK2A 4LSNA 3KFWX 2C1EB 1U1PA 3HVRA 2WVEA 3NS5A 2HWHA 3PFOA 1BWEA 4KPCA 5IOLA 3DXSX 4X65J 4I64A 1R89A 3ZZZA 1U09A 1Z2LA 4L75A 4L72B 2YWWA 1YVFA 4OJ3A 2CQCA 3W61A 1H6KX 1SIWB 1NJWA 4ECXA 3D9BA 1U1NA 2CPYA 2CADA 2LDIA 2VUGA 2N4CA 3L09A 4EYIB 2CWKA 1RT1B 1RT2B 4AXIA 3PEHA 3T6JA 1OWXA 3BM7A 4WE1B 4OZNA 1RK8A 1JLGB 2W2PP 1DHMA 1SV5A 5KG1A 4B9MA 2H1YA 1U1QA 3DRSA 3VALA 2GIRA 4PCQA 1OIAA 1JXVA 3RR8A 2N82B 4RUHA 5KFNA 2J9CA 4ZN3A 4DQIA 2VFSA 2Q6BA 2DHSA 3AFGA 2P8IA 4YB7A 5EWEA 4K4SA 3PG9A 1S0MA 5LSOA 1OY6A 4KQZA 4F02A 3DMJB 2X7IA 2QLJB 3Q23A 4ECZA 1H98A 4BC9A 1JLEB 1TUGB 4LF1A 4QPXA 2DGSA 4DEZA 1UZDA 2FZGB 1EQ0A 1F0XA 2ZKUA 1YSJA 4B17A 4EGLA 2OPSB 1BQNB 4OHYA 1SH0A 2VL1A 4YY3F 2P9EA 2W9BB 1YRUA 1BMQB 4Y6IA 1U7LA 5F0WA 5KFAA 1R8PA 2V68A 1VRQC 4LF9F 3N28A 3RBEA 1TL7A 1HPZA 2GFFA 4F0HA 1G6BA 2YQ1A 4J9SA 1NPPA 3GV8B 2W9CA 1RAJA 3UCZP 3CWJA 4DX7A 4IR9A 4YHHF 2GVZB 3TZYA 3S6EA 2NUHA 1WOSA 4RX6A 2DITA 2HAIA 2CPFA 1HR0F 3BV8A 1GFWB 3T1YF 1QAYA 4TVAB 3J7YI 4TYBA 3D6FB 3FZ2A 1L3SA 3RGIA 2R8HA 1D3WA 3GFHA 2KB2A 1PC4A 1HR0J 1FHTA 4Z7YA 3DHWC 3T1YJ 2N7CA 2KN4A 5I42B 3G6VA 3UDEA 3FFIB 1AFJA 1CLFA 4JUZA 2AGPA 2CPDA 2FHJD 2Y1IA 2HIQA 3B54A 4C3MA 2JFDA 2V4RA 2R2RA 2NZCA 1NHVA 4DR6F 1B99A 3HZEA 5HJXA 2XYHB 3L95X 2G2OA 2OPQB 4JI7F 3PVXA 1VQPS 3MR5A 2RVJA 4EYHB 4DR6J 1HYSB 3LAMA 3CCMS 4DXLA 2I9SA 2F1FA 5E3RA 2CYYA 3GV5B 1Q78A 2ZD1B 4OI0A 2Y0BB 3Q89A 5GAGU 1R3NA 1VDHA 1NDKA 4M8LA 1OQ6A 1TL5A 3RJMB 4ZP9A 2C2RA 1N5VA 4CTAB 3KDOA 4ZJQA 2XCPA 4Z7CA 4WFZA 2A18A 1VRTA 3NG8A 3NMAA 3G82A 1VS3A 5T41A 1O51A 3PCOB 2FJBB 4ENOA 3MR3A 1YKWA 1NAQA 1TKDA 4P72A 1N48A 2KL8A 3L7PA 1WHYA 2XBPA 2XMUA 2AYGA 3DLBA 2XS2A 2KI2A 5DGAA 4C0BA 2UVRA 3C2PA 5HMYA 3UN3A 4X2BA 2DH8A 4NYZA 2LFVA 2ZH4A 2BE9B 4ES2A 5ETPA 1WG1A 1YQHA 1CJUB 2RH3A 1S9EB 4CIOA 2RNEA 4B3MJ 1S12A 2HFVA 2BE2B 3L9ZA 3ENVA 4KV8A 4IG3B 5LMUF 3GSIA 1WC3A 3M32B 2B56A 1SC4B 1XNQF 4EBCA 2ZFHA 1U02A 1KLMA 4OYZA 4UY8T 2DRAA 1TV6B 5LMUJ 3I0RA 3BSNA 5KTQA 1XNQJ 4ZVEA 2RB7A 3T5HA 4J9OA 2IMWP 4WFXA 5I4MA 4FNIA 5J2MA 4YEAA 1X5TA 3OSNA 3QQCD 1YJRA 2AJ2A 2OHDA 2UXDJ 5KFWA 1N54B 1K73T 4DV0F 2RUGA 4DV7F 3CXCR 4F50A 1FRHA 1F2GA 3GTYX 4NLUA 1C0UA 4NLQA 3K7RA 4DV0J 4LT6A 4CNYA 2M7SA 3MM8A 3DKDA 3Q83A 3MCOA 1EIYB 3BDEA 4GO7X 3KG0A 1N8RT 3G8TA 2FJDB 4LSLA 4EZ6A 2RRAA 2YNIB 1SCJB 3FBFA 3MMCA 2LCWA 4P73A 2HHWA 2MYFA 2C3PA 4KB7A 5D3GB 3OXLA 3PY8A 2ROPA 1XIQA 4NLTA 3S8SA 1QY7A 1RU2A 4QR1A 2RT3A 1RLDA 4F4AA 3GIJA 1FA0A 2O3DA 3SCKE 3UO0A 4J9UE 1K9MT 2OP5A 3LP1A 4KH1B 2V67A 4G1QB 3VAKA 1JJ2R 5HI7A 1Q82T 1SVDA 4USMA 3A8EA 1RHRB 2GJIA 3LUYA 5KFSA 3RB4A 2KDOA 1GT8A 4CLZA 2VONA 4GC7A 1W2BR 3FRZA 4QQBA 2EFQA 2HRTA 4NI2A 3NOCA 1RHUB 4LJMA 3TA0A 2DRDA 3IWNC 3A13A 2V2KA 3G4SS 4DR5F 5EGYA 1GK8A 1KP6A 4NLSA 4U6PA 4YR3A 4FN5A 3M7VA 3KLEA 1SKUB 2HQ3A 5KFFA 1NSQA 3ULHA 4FNHA 3W5XA 3TX8A 5J2QB 1T9YA 5KT6A 1WC0A 1N33F 3N6NA 3K5LA 3GYNA 2J6TA 3J7A1 2HVZA 3MI7X 3GG0A 4O4GA 4CH0S 1AW0A 3PJ9A 2AEFA 2DGUA 1LOUA 2YKQA 1YIJS 5B09A 4L76A 3LP2B 4KE5A 3KLIB 3IMQJ 1HWJA 4IH7A 3K5MA 3QNWB 1V3ZA 2GGPB 1JMTA 2Z0GA 4E8UA 3JSMA 5ITHA 1KEKA 1RT4B 2DNQA 2SXLA 1AA1B 1X4GA 3OW2R 4M5KA 4ZP8A 4K4UA 5K8PA 4RW6A 4OYIA 2J8SA 4OYWA 4MYTA 4KJIA 2AKWB 3F56A 4RBUA 4LFAF 2XO7A 2XMMA 1AYEA 3UCUP 5E33A 3W9HA 3PM9A 4PPDA 2M4MA 2MQOA 4C8YA 1GX5A 4USIA 4DX5A 5CZXA 1N0UA 4DG1A 4F2RA 5JVGQ 3CEDA 4U8VA 1IVZA 3EZ5A 1S4FA 1BY9A 3TR5A 1HNVA 5KG5A 3TA1A 4X4NA 5A8WA 1U1MA 2M9KA 2X51A 3MFIA 4Q0BA 2Z30B 4U9RA 1ZM4A 2AX0A 4QPTA 2DGOA 1BQMB 5A6WA 3MAQA 1H72C 2NLWA 3CW2C 3OR1B 4IDKA 4J90A 2C2NA 2QT7A 4IOBA 3PJXA 4USJC 4OL8A 1IBMJ 3D68A 4DZ6A 1N4LA 1S1UB 4CLWA 3TZZA 4MAKA 4CNZA 4ECYA 3IG1A 4ES1A 4AUKA 3TEGA 1VIXA 3E8OA 2IDLA 4XK8C 3BKUA 3BKFA 4P2XA 1YTYA 2HFOA 2C2MB 2KJVA 4F25A 1TQLA 4F2SA 3IM8A 5J1EB 4IFYB 4FXVA 2ZOFA 2HMIA 2GAGC 5KG7A 2KJWA 4WKYA 2BDPA 3R27A 1H7WA 2XEXA 2WW4A 1PGZA 5KT5A 3M4XA 1U2FA 5L8RC 3H2VE 2Z2YB 3CDWA 3DLEA 1IKXB 5AXKA 2W7OA 1SBRA 3JTNA 2RDIA 5M2PA 3QJJA 4JV0A 2VBYA 1ITPA 2V69A 3WC0A 3CCRS 2JNJA 5L9XA 1NBEB 2EK6A 2GIFA 5AT1B 1JKHB 2XZWA 4OX9J 1O0PA 1HBMA 1ZZFA 1HBUB 2BANA 2CPXA 3R5DA 2M2BA 4O3QA 2HLTA 3R7BB 2LECA 3JQKA 4I1TA 4R8UA 1I51B 1UVKA 1RWMB 3KHHA 5ETQA 3TRGA 4JI4F 4I0WA 3N5FA 3D7SB 4KHRA 3QSYB 2RU3A 1NHKL 3MCSA 5SUHA 2YNGA 1HLWA 2NREA 4QJVA 4QWAA 1N5YB 2CPIA 4MFBA 2XMTA 1EETA 2DBBA 3OFEA 2YKNB 2NYHA 3QBCA 1UP1A 3M8QA 3MM7B 3N01A 2VKRA 3Q8VA 1X4CA 2ZHBA 3ZTQA 1OY9A 4YP3A 4CT9A 6FD1A 2G0CA 4ZVFA 3D1QA 1KBRA 1JXLA 4CH7A 2E1RA 1BWVA 3EPIA 1VBYA 2L41A 4A8KA 4ID8A 3CJ8A 2WHOA 2XULA 2J8AA 4DR1F 1BGXT 2RS8A 3MD3A 1HQUB 1AB8A 4DSEA 1PYSB 1FJGF 1SPBP 4ECTA 4F3QA 2LU1A 5KFHA 3LAKA 1IKWA 2VOPA 1ZM2A 2EC0A 1TKTB 4CZCA 2F8MA 3ISNC 5GAHI 1VK8A 2J5AA 1FJGJ 7FDRA 2XNRA 4USKA 4N76A 3KTQA 2E66A 2QYCA 1ROFA 3T41A 3UVJB 3L7OA 4KAIA 1CJTB 3RB3A 8AT1B 2E1PA 4O3NA 1XEZA 2D3ZA 1VJWA 4JV5F 4OI1A 2YNHA 1U24A 2GC8A 2BKNA 1K1SA 3CC4S 3S7RA 1PIEA 2FZCB 2DHHA 1S99A 3GCWP 1X4AA 2GIQA 4PKDB 4YB6A 4JV5J 2HGLA 5HL7Q 1FXRA 4CCHA 1CSJA 3BBBA 2BM0A 4M5HA 1DARA 2V94A 1GQEA 2ZVSA 2YKMB 2KFYA 2EVZA 3TA2A 4UOFA 1K0TA 1GXTA 2HHVA 2ZH1A 1WOPA 5KFVA 4N8NA 4ED3A 2R7SA 4DS4A 2D9OA 2Q3PA 4L6V3 4WFNQ 4J9PA 1Y4ZB 2MKHA 4XDDA 3I5BA 4ED2A 2W7PA 3D54A 2UU9F 4GRSA 4I6AA 3WHIA 3R5AA 3PV8A 1Z4UA 1U48A 3LALA 1FCAA 3AHPA 4QIGA 3NCPA 3V4IA 1Q86T 3NNCA 5LJ5Y 5D4PA 2JL9A 2UU9J 1RCXB 2VBZA 3G71S 2APOA 5ETLA 2DHAA 1H2UX 2KVQE 4O23A 1UPMB 4F7VA 1SJQA 3KYLA 3I9ZA 3R1LA 1D9DA 1S9GA 2FLOA 1DLOA 2OFGX 5KT7A 3AODA 4DX8H 5KFPA 2FJEB 1I5OB 4PG7A 2GHPA 1PCAA 3NGDA 1WDDA 3TWZA 1Q79A 4AYBD 3BH7B 2V2QA 4M5IA 2FVPA 2GCFA 2RU9A 2DHXA 1M5VC 4C8KA 2EFGA 2AHOB 2DT9A 1FX2A 3R7SB 3O6QA 2QSFA 3OJUA 2N7YA 1DRZA 2RILA 3MR6A 2B4VA 4PWWA 5A8RA 3IGNA 2MGZA 3OHAA 1Q81T 2OEMA 2QA4G 3C66A 4OX6A 4DR3J 3C15A 4YB1P 2DGXA 4LFBF 2MQMA 3GZ7A 4IH5A 3OTDA 5J2PA 2CG4A 4LRAA 4OX8A 4EUVA 4ZMMA 2EFVA 3FCHA 4QW9A 2ZH9A 3AT1B 2MMYA 3MUVP 2DO0A 1RSCA 3KUGA 5LMNF 3QATA 4FYYB 4JI2J 5EWFA 1VGYA 4LF6F 3S01A 4Q2MA 3PIOQ 2XZDB 3TQEA 4WCEQ 2ZZMA 4B3OB 3M8RA 3MDFA 1LW0B 4DQQA 2HS3A 4ZLPA 1SJ4P 4ZA1A 4TQRA 4X84A 3OTBA 3M30B 4I2QA 4DUZF 3B6BA 3AJ1A 2IM1A 2OEKA 2QFJA 1AUDA 1T9VA 3H2LA 3L3CA 2HGNA 3A12A 2BXJA 3GYXB 4QU6A 5RUBA 2DXFA 4Q8EA 4CYUB 2GQCA 4ILMA 1PYTA 1NB7A 2UUBJ 2P5VA 2DPJA 3KNAA 4FPIA 3Q8SB 2V5HG 3DLGA 2BM1A 1SIZA 2E7VA 5A8KB 2CQHA 4J9QA 1G2EA 5HBMB 2JZ5A 4UW2A 2JFKA 1OMSA 2F4FA 3R2DJ 2DR8A 1XBWA 4F4XA 1KVIA 1F60B 2MLXA 1H74A 4DFJA 4WFBQ 1XTZA 3TUPA 1RDRA 1XK8A 2YX1A 3I55S 4HDGA 3NKYA 1UJ6A 5M2UA 1FEHA 2B6AB 1CJKA 1YHQS 3TYTA 4WP9A 3BH6B 4PWDA 3DRRA 2RHQB 4WU2A 4FZVA 1AT1B 5C25B 1FVQA 4KBIA 4A8WA 4OZ3A 3GIMA 3H5XA 4I2PB 1KTVA 2G13A 2FC9A 3MAAB 3QIPA 3NY0A 3L7UA 1N5SA 1EJ7L 3S1TA 3PDNA 1FE0A 4NX9A 2IJNA 4Y2KA 3CCES 2GMHA 2RRBA 3CJSA 2XC9A 2CJAA 5J2NA 2UVWA 4I7FA 2AGQA 1B7FA 3OXGA 3Q8QB 3ZTRA 3KJFB 3FEXB 2FVQA 2QG9B 1QSLA 2DO4A 3RYLA 1C1BA 1IKYA 2BKOA 2Q6CA 4I6YA 5E2QA 2E9TA 4ZCMA 2FY1A 1QTMA 2R7TA 3FSYA 3TO8A 1GEHA 1DQAA 5LM7E 3MFHA 4IUFA 2HFZA 5HK4A 4C2MA 2KT2A 2AEJA 2X1GA 1PAUB 4YDXA 5KOXA 5LXYA 3D5MA 3NLCA 1FKPB 2DH7A 2YQ3A 3W2WB 2B9XA 3Q24A 4HLBA 2IJFA 2A1BA 2AYMA 3FEZA 4N56A 2I1RA 4FBTA 1CVJA 1LKZA 3OTOF 4KR0B 1U2CA 3FC9A 1ICEB 2ERRA 2CJQA 3IBFB 5EUHA 2NZ4A 2H51B 4AL5A 4I68A 1RTDA 2GQQA 3CCZA 4OI2A 1HQEB 1FERA 1HNIA 5DRKA 4DCPB 4QWBA 2QL5B 1ELOA 2Y1JA 2ASLA 2H3EB 4ECUA 1N0VC 2CNNB 3POTA 5L46A 3EZUA 4KTQA 1LWFA 1PKUA 4UUXA 2EC2A 2I6WA 3R97A 1G4CA 2LQ9A 3RZAA 1EQMA 4ICLB 1RT3A 4OV6A 2ZUGA 4ZCIA 4JI1F 1RAHB 4HL9A 4DQRA 3DGPA 3DYAA 3IA0A 1FKAF 2UV8G 2W2QP 4JV1A 1VI7A 4JI1J 3HSJA 3A8IA 4DR2F 4KO0B 3OBIA 1IBLF 5E3AA 4ZJLA 3CJ0A 3LP0A 1MROA 3QO9A 2EK1A 2CXEA 3K8VA 2DEJA 1W25A 4MYUA 1IBLJ 5THWA 3VHQA 3JQMA 2PMWA 2IY5B 5HO4A 4Q5VA 4NXNF 1FTRA 1R0AA 1LXNA 3HVTA 4DPOA 4XO0A 3N0VA 4NXNJ 2QA2A 1ZOTA 2B3TB 2E7WA 1KVJA 1R31A 2FUG9 4C97A 5CYQB 1VRUB 4X62F 3C14B 2V9KA 1U25A 5IZHA 5D0EA 1RKIA 4KHMA 4P10A 2AT1B 2VG6A 4X62J 2ZVIA 4P2MA 1U1RA 3BBFA 3AXMA 2FPHX 5ETMA 1O6XA 2ZKTA 1C0TB 3OLBA 3VGVA 4URQU 2RQMA 5HQMA 4OHVA 5HLFA 3QLHB 3M2VB 5F8HA 3H90A 3BGLA 4B9UA 3MEEA 5GAEI 1P8GA 2CJBA 4B3TJ 2C2OB 3ZTOA 2CNOB 2FVCA 3QGIA 4WK3A 2VV5A 5BXIA 5CYJA 1WC5A 3OL6A 3RRHA 2IRUA 3ZZYA 5DM7Q 2KTQA 1RHQB 2VG5B 4DPXA 3TAQA 3MEGB 4NLDA 2VG7B 1FD2A 5CCMA 4F4YA 1OJ4A 1FFWB 2XO6A 1WSVA 3SZ2A 1RI7A 4Y2AA 2K7KA 3HHKA 1NJZA 2DNPA 2YWFA 4DX6A 1ZTTA 3IBCB 1RTJB 2JX2A 4TY8B 2IVFB 2IMOA 1NK8A 1BD6A 4B9NA 2DH9A 1XR6A 5KFLA 1ZZNA 4DL3A 5E7OB 2LQBA 4RLEA 3P49B 5CHCB 3MM5B 3BEGB 3M8PB 1RT6B 2DIVA 2IBKA 1VLYA 4O0IA 4ZIWA 4PPZA 5IT9Y 1F5AA 5AJ3F 3PKMA 4OLPA 2PDAA 2P9GA 5D0GA 1HWUA 1TP7A 3OLAA 1RQ0A 8RUCA 3MPVA 3WIUA 3G8SA 3GLJA 3BREA 3LQVA 1TL4A 2CQPA 4MIWA 4RU9A 2COLA 4MJKA 5H9FJ 2E9RX 3BPDA 1KTQA 1KQFB 3KLGA 4ECSA 2YY3A 3UDCA 5B0FA 2DXEA 3KXDA 4USVA 2CJYB 1OPIA 4KGVB 2QMUB 3TI0A 4NCAA 3H25A 3O5TB 3SFGA 1X9WA 3ET6A 3D28A 2PE8A 3W8PA 1SUQB 3VAFA 5IWAF 3T5LA 4F67A 1NJYA 3BGRB 1WSRA 4K8RA 5IQQA 2DNHA 2Z8QA 2HG4A 4JI3F 1HD1A 1C4AA 1RABB 4U7UK 5K14B 5IWAJ 1LW2B 1FNMA 3VGSA 3CCUS 4NPOA 4JI3J 2ZH6A 4ECQA 1FNXH 3DRPB 3HHDA 3CCQS 4QIFA 3ZNJ1 2QO3A 1X4FA 1PAEX 5C24B 2RDJA 1NXIA 2FLNA 2JWNA 3E2EA 2B9WA 1GAOA 3AY0A 2RF2B 5CQGA 5D4OA 2C3MA 3MM6B 4MKAA 2KXNB 1S48A 4C8NA 1S6PA 1K44A 3TEHB 7AT1B 1QE1A 4OZ1A 4W92B 1DQ8A 2Y1LB 3GJRB 4G65A 3P5TL 1RE1B 2L3MA 1CC8A 2R8KA 1HNXF 2V34A 2E5LF 3TZXA 2Q79A 4H4MA 2HS0A 2OPRA 3BO2A 1KHWA 4LR7A 2CQ3A 1K0VA 3DHXA 3IRXA 2QL7B 4KIAA 4YR0A 2HEKA 2X3GA 2QMXA 4FYVB 2DNZA 1YBUA 4PXDA 5E5NA 1UW9A 2A10A 5B0AA 4IFVB 4KH0B 3SDEA 3C16A 1KQKA 2C28A 1RAGB 1PO6A 4DV4J 3RW7A 2ROGA 5GMKa 2V0NA 4CO2A 2QYGA 4HH0A 4LRFA 1UVIA 2UZAA 1WI8A 3CDAA 4ID5A 4DZDA 2IRXA 3V2UC 5FDLB 4PR6A 2VFTA 1WI6A 3QFWA 4NLVA 4I4BA 2BJ1A 1RJJA 2B9EA 3W9IA 3KJVB 1RAIB 4ZPAA 3UD5A 1WC6A 1SH2A 1UEVA 1TAQA 2F4VF 1M1HA 3SMZA 1LK7A 2XWXA 1UVLA 3KLFA 3TNVA 2QRRA 5DJBA 4DPWA 2QFIA 2XB2D 3LO3A 1JWWA 4IG3A 4GVBB 4OX7A 2UUAF 1H7XA 1TK0A 3WDOA 1HBOA 1KSPA 2W01A 1N56A 5IV3A 3QRRA 4X4TA 4ETZA 2UUAJ 2KRBA 3U1NA 4CLYA 2E1AA 4P2SA 3IGVA 1TVRB 1M90T 2L9NA 4JI0F 3CCVS 4F0KA 3MAHA 1TL1A 4UZCA 2RHSB 2K2PA 3G6YA 3M8SA 5H9FK 2ALYB 2LYVA 1N32F 1RWOB 1JLQA 2W8KA 3J7ZT 3IRWP 5D77A 5A0YB 1TR0A 4DUYJ 2OLWA 3QT7A 3THPA 2FJWA 4NCBA 4HYKA 3LH2S 2OSRA 1M0SA 2HFUA 4NWBA 4FYXB 2DRBA 2B8QA 3NMRA 1URRA 1MU2B 1X7VA 4X64F 5A76A 9RUBA 1T9WA 3HFKA 3Q8RB 2OTLS 2VA2A 3KK2B 4ZP6A 4RW9B 4EWTA 4X64J 2XY6A 1E6YA 4YR2A 1LWEA 5LL6d 1X9SA 1S1TA 3HHLA 2QN6B 4W4MA 1WJ9A 4EBDA 1GTEA 1UJ5A 1YRTA 2ZJRQ 5L1IA 1RLCL 2R2TA 1HD0A 3DLKB 2ZBCA 4RJVA 1RKJA 2B4OA 7FD1A 3JYTA 2BRLA 3LA0A 2DGWA 5DS7A 4E0DA 4LF8F 2XSFA 4RW7B 2VA3A 2XG8A 2ADCA 3KK3B 1I1GA 2DGVA 4LSNB 4O0NA 2XMAA 4LF5F 2V4JA 4LF8J 3W3SA 1TKXA 1WKJA 4DFMA 5B0GA 2JEGA 2R7WA 3O1LA 2DEIA 1RTHA 2KYXA 4CO5A 2GJ2A 5IT4A 3HT0A 3QJLA 2NXNA 2DPIA 3K5NA 4WJBA 3V6JA 3CVKA 4B3SF 2VDHA 4AXJA 3FRYA 1NU4A 3TQ1A 2J9DA 1Y7PA 4IOAQ 2I5JA 3Q8PB 1U6BA 2BBEA 4OJ1A 4B3SJ 2E1MC 1SV5B 3FMWA 3THVA 1FRMA 1JLCA 4RBTA 3DRSB 3M9NB 1JB0C 3M9OB 4PYAA 5D15A 2JLEA 2WOMB 4LF7F 1ZS6A 3IN5A 3Q2SC 3HVWA 3SXLA 2IC3A 4F4ZA 2YX4A 2M8DB 2QLXA 3M9MB 2CQBA 1HNZF 2FJAB 4GMKA 3J81Y 4ECVA 1VQNS 3CCTA 2DD8S 4IYQA 1NHUA 4LVNP 3GCXP 5LT5A 5C42A 1HFEL 5ETRA 4RPFA 3RW6A 4ZP7A 2NYIA 1LWCA 4X66J 3Q8UA 1ZM9A 1S1VA 2YTCA 4AL7A 2MPUA 3PRDA 3LTOA 4NRUA 2ZBQA 1Q4RA 1ZPVA 3HJVA 4TLQA 1TL7B 1HPZB 5F8LA 4J9MA 2W9CB 2KKHA 4A48A 4CLLA 2IYGA 1YDLA 1TFYA 2PMZD 4I67A 4NASA 2BQRA 2R3VA 2QTWA 2OGUA 5HSPA 4JI8J 3UWTA 2W2MP 2W1BA 3OL7A 4MIAA 4BDPA 4C11A 3TAMA 4Z2XA 2W2OP 4K0KJ 2ZUAA 1JXEA 3V5RA 4DV1J 4KFBA 3TAPA 1TKZA 2WVFA 1VQ6S 2JC0A 1VCTA 2W4CA 2H5JB 1L3TA 1ZH5A 2BVZA 2R8GA 3BJYA 2J6SA 1Y0HA 2AJFE 3R1HA 3PKYA 1F9EB 4LFCF 1XMQF 4YDDB 1V3SA 3HI9A 1AXQA 2CZ9A 1NCLA 2CVIA 4GKJF 4M5JA 1YJ7A 2UVVA 2V8PA 1WEZA 4P2FA 5DG9A 4LFCJ 1XMQJ 1KR4A 2ZWPA 4UQGA 2GNKA 3FNNA 1OSDA 2RD5C 2QV6A 3CCWA 4DL5A 2AWZA 2BQUA 2EFNA 4Z37A 2MHNA 3SV3A 4JI5F 3LWMA 3HD1A 2JHEA 4RNFA 4ES3A 2HVHA 2E9ZA 1VRTB 4Q43A 4IH6A 1HBUA 4LR9A 1IR2A 2LQJA 1KLNA 3G82B 4ER8A 1N6QA 1V9OA 4B3RF 2V2VA 2Z2MA 3V81A 2R7QA 2QEXS 1UKUA 2PA8D 1FD8A 1P9QC 1ZAXA 3DOMA 3GSDA 4J9NA 2WB1D 1HBNA 4X4QA 1TUVA 2KZMA 4MKBA 1RU1A 1MWYA 3M8ZA 4JYAF 4AT1B 2Z57B 1WD6A 2QIFA 4DWIA 2B8PA 4ED0A 1W7WA 1YWXA 4K59A 1S9FA 3CC2S 2QJ3A 1O5JA 4JI6F 3ENQA 4KYZA 1S1WA 4WPAA 4LVOP 1PBUA 2YVSA 2YH0A 3V6DA 5I3UA 4KV8B 3FGVA 1B0PA 2PC6A 2CQDA 5KT2A 1T03A 1NK6A 1KLMB 2B43A 1EP4A 3I0RB 2HWIA 3WX4A 3A4TA 1UVNA 1OQ3A 2GVDA 4R25A 2LQ8A 2H48B 5J2MB 4DSKA 2M5YA 3QT5A 1NH7A 3GQCA 3W2VA 3OV7A 5GADU 1DTQA 4DR4J 1S59A 4WP8A 1JLAA 2P2CB 4RL1A 2WONA 3ZZPA 4TU9A 4F3MA 3VWSA 5K20B 3I5AA 5AXNA 3E01A 5HMWA 1VQ7S 5GAGI 1C0UB 1T9XA 3O2IA 1NZAA 2QGFB 3MM8B 3Q22A 1HKAA 3MCMA 3FSXA 1Q8KA 2V6AA 2IBOA 2R7RA 4LSLB 4R5PA 3RAXA 2OPPA 1BUXA 3D0IE 3WZ0A 3MMCB 2DR6A 2K3KA 3CJ4A 3HHNB 4WFYA 3Q2TC 3CCJS 4P74A 2MTLA 1NJXA 3OFFA 2GHVC 4OZ0A 2F65A 4M5GA 5JVHQ 4UF4A 3KJQB 2XGPA 3ENAA 3GJSB 2DNOA 4AFFA 3B8HA 2XCAA 1IWAA 2ADBA 3DOKA 2VFVA 4QZVB 3LP1B 1D8YA 2CPHA 3PYGA 1F3FA 1HARA 3VZIA 1ZA2B 3M6WA 1KC8T 2B4PA 2FC8A 5IQ6A 1VQMS 2CIMA 1J2VA 5C7PA 3FUYA 4PG8A 4DMZA 1RGVA 4NI2B 2AJ4A 3PJWA 4ELTA 2KHDA 3J81U 4RBVA 1QAIA 1NNDA 2CQ4A 3W5ZA 4DV5F 4LRBA 3UE2A 3TVZA 4CLPA 3IFEA 3NS7B 3JAMU 2RQCA 2W24A 3KLEB 2ZBPA 1NSAA 3TUJC 3KHLA 1YBAA 4K2XA 4DV5J 4IR1A 2YPYA 1APSA 2XI3A 2MZJA 3R5GA 2HBQB 4UT4A 4Q45A 2C2DA 4X65F 1BQXA 3DRXA 2HGMA 2AJQA 4O4GB 4DBQA 1NK5A 2H4WB 2OSQA 3ILJA 3BO4A 1S6OA 1U6ZA 1XR7A 1M5KC 5EWGA 1WHWA 2W4DA 5DQGA 1C1CA 1OY8A 4KC5A 2CG8A 2HVEA 4CWBA 4NEYA 3MOJB 2ZJPQ 3D1OA 3QMQA 4RNMA 3JSMB 4NXMJ 4A8XA 2G0JA 1YITS 5DDQC 2Z2LA 1AZSB 1HMVA 3V6KA 1N36F 4RW6B 3RAMA 5A2QY 1RA7A 2HRUA 5KFQA 2WSCC 2ZBRA 1VOMA 2HNYA 2OKQA 1MN7A 3H4DA 1S49A 1NH8A 1DTTA 1N36J 5KFBA 2GW8A 3CE8A 4L3NA 1SH3A 3T5JA 5F0UA 2CUYA 4DG1B 1T0TV 2OUGA 2ASYA 1JNZB 2MKSA 2OFHX 4IG0A 1WHXA 3MMJA 1MMDA 5DO2A 1HNVB 2A2CA 3PW4A 5DDOC 3HCXA 3ONQA 5A8WB 3IR5B 3PTWA 1R8HA 1HQ2A 4YMEA 3FCVA 4QYRA 4Q0BB 1RT7A 4WZQA 2V2ZA 1H0HB 4ZLLA 2YKAA 2MB0B 2VHGA 2A3JA 3WC2A 4IDKB 1VQSA 4BWMA 3OUYA 4QIEA 4F26A 2FGCA 1Q7YT 1SJ1A 2JLFA 1S79A 2RS2A 4L73A 2B5JA 4EU0A 3IG1B 2MSSA 1M5PC 5B08A 1S97A 1X4EA 3MMBA 1RACB 4RU2A 4DFPA 4B9SA 3ETMA 3GFZA 2W9AA 4HACA 4P75A 3FZBA 2XM3A 3P4UB 2XMKA 1GNKA 3W62A 3OVBA 3IS9A 2E5IA 3EGWB 3UQSA 2F40A 2ASJA 2HMIB 3LANA 1U8SA 5HBMA 4Y34A 4BLGA 1M5HA 3DLEB 2CJXB 5CD4A 4ZVRB 2UXBJ 3CGIA 4NLYA 5D4LA 1FXDA 2AQ4A 2KYZA 4YQWA 3MZIA 1VC0A 3N79A 3QYYA 1KOOA 2WVBA 1R0CB 3T9NA 4DV3F 4Q44A 4O44A 3NGKA 2ZZNA 2UUCJ 2ZE2A 1HBMB 4OYBA 4ZVHA 2Z4PA 2O01C 2HHTA 5K8MA 4ZPWR 4DV3J 2BANB 3M2RA 4WF9Q 5BJRA 4DCJB 4P7TA 3KLHA 3KG1A 2X1FA 2MSTA 2HHUA 1QSYA 3BR8A 3P6YC 2U2FA 2P6SA 1AUSL 4R8UB 3CF5Q 4A8QA 2E7XA 3MECA 2XMVA 4NCGA 2YNGB 2FLLA 4ZK7M 4MFBB 1WUUA 3DU5A 5E41A 1EETB 2HNDA 2O5DA 2IHR1 3M8QB 2QZ8A 2BJEA 4NLXA 1R0BG 2CKWA 3UNGC 2ZJQQ 2QLWA 3IM9A 3K17A 2Z56B 3M2UA 2IAJA 3D4JA 1R27B 2IA0A 1T9TA 1N34J 2FJVA 2EW9A 3QPIA 2PA3A 2ZH2A 1LV5A 1WWHA 3AOBA 5D0RA 1UMJA 3AA8A 1QUVA 3NS6A 4DL2A 3CJ3A 1U8WA 4DUTA 1R8CA 3K58A 1F9FA 4B3MF 3NBPA 3HJFA 1PG5B 4FS1A 2D3O1 3CUNA 1KWMA 3AXKA 1IKWB 2YPZA 1RAAB 1YGYA 5HROA 2MZSA 4KKOA 5KT4A 3BO3A 2G2ZA 5IC4B 5ETNA 4M5LA 3FBEA 2RJZA 5KFCA 5EX3A 4DI6A 1ZPWX 3JXOA 4J91A 2YNHB 2UXDF 2JC1A 2BYCA 3UDLA 1GXUA 3BSAA 1NKEA 4DPTA 4QIVA 1B64A 1N88A 3ITHA 4K4XA 4CO0A 2R8JA 4LRDA 1ZBTA 5HQLA 3AA9A 4TXSA 1FRJA 4OHXA 4WBFA 2H9ZA 1TELA 1WF1A 3N9UC 2HVDA 1KVKA 3W64A 1CJVA 1RISA 4ERDA 3EDQB 3VGUA 5LSLA 3MUTP 2UV8A 2J7UA 2A6OA 3R6GB 2Z2ZA 5F8IA 2LDYA 4F0MA 1V5IB 1VHIA 3OD2A 1EARA 3M1VA 3AOAA 5A6PA 3V4IB 3DI6A 4OJHA 4LQ3A 4NLOA 2HHQA 3JTPA 5U47A 2AGOA 5EN1A 1WKKA 3B78A 1PSDA 4C8ZA 1UPPA 3AD7C 3PYEA 1HL6A 3OSPA 2BRKA 1S9GB 5ETOA 5A2QU 1DLOB 4W98A 4CI0B 5T14A 2WRMA 4PXCA 2O67A 1SI9A 2UUTA 4ZPVR 4N41A 1QD1A 2VB6A 4RW8A 2MLZA 3BGFA 3U27A 2M52A 3HMJG 3FQLA 2RQ4A 2C22A 3CCLS 2I0XA 4A8MP 3E3XA 3CTRA 1KS2A 4N5SA 3GIIA 3W5YA 2EBGA 2A6MA 5A8RB 3MWBA 4QIWD 2MGZB 3IR7B 1RWWB 1URNA 1W2IA 4H4OA 3BGOP 3NRBA 3C15B 3FJ2A 2IFXA 4FXDA 3RU0A 2HBZB 1ULRA 2FLPA 3T5KA 4OYAA 3K89A 4C9DA 4TQSA 5J2PB 5CYMB 2PFDA 3X1LB 4NOHA 3MEDB 2FGOA 3PNIA 5KFTA 2VH7A 1E6VA 2FZKB 2PO4A 3UD4P 2VPZB 2PD1A 1HIYA 2OH2A 3RTVA 4K4TA 1WG4A 2MZQA 3I6PA 1X5PA 3PW7A 3HSGA 2F3JA 5DQIA 4PWUA 1REVA 1CS4A 3P3DA 1TMMA 4I2QB 3KMSA 2Y1RI 3VAGA 2C3YA 1EKRA 3PHTA 4ZVOB 3ZC4A 4F36A 3R6LB 4TKTA 4Y65A 2HK2A 3LOUA 1S1XB 2R8IA 4WYLA 5L1LA 2CNKB 2HNZA 3QGPA 4UUWA 4HR2A 4WIIA 4LSZB 2WB4A 1IBMF 1NO8A 4QWDA 2CFXA 3QFHA 3TOQA 1FK9A 2DXDA 3DLGB 4C3LA 1D09B 3GPAA 3OR2A 2KFZA 3RBDA 1NPKA 4I69A 2NQPA 3C6TA 3HP6A 1SXLA 3KJNB 3A8KA 2DNYA 1XERA 4YB5A 1K47A 4NZ0A 4FYWB 1FDBA 2WVDA 3DN9A 3KWMA 3G6ES 4NMXA 2BA9A 1YRXA 3FVYA 1H73A 3MEKA 1LFPA 5G0RA 2W8LA 5LSRA 2GO9A 1CJKB 3H8YA 3C3LA 2W4PA 4X4OA 4PWDB 3DRRB 3D6HB 2NXEA 4PG6A 2MZRA 1N5QA 2WBRA 1SKWA 2JEJA 3CO0P 5E3CA 3QIPB 3O8WA 3KUEA 1SC1B 2CDRB 4A8SA 2IM3A 5BR8F 2VIHA 4OX9F 1VQ5S 2XHWA 4V1Ak 4JOUA 4MK8A 5H1SV 4V19J 3D67A 5J2NB 3MM9A 4I7FB 5BR8J 2EXUA 4ZVQB 1CBKA 3NAIA 2VZ9A 2DCUB 4NZ7A 4FKXA 1NDCA 1P6TA 1I94J 1C1BB 4WFAQ 1IKYB 4RW4A 3UN5A 2RAQA 4M5DA 2E44A 2XSJA 2HZAA 5ADZA 3TVYA 3VTIA 1HA1A 1LNQA 1CULA 5HMXA 1F9HA 5HVFA 2CPEA 5HANA 4MK9A 1Q8LA 5FLXU 1WOOA 4NE9C 3G86A 2PMHA 2L9WA 4PUOA 3OJSA 1UWBA 2YX7A 3IBWA 5HP1A 4ECWA 1S77D 2EKYA 1XJWB 3CT9A 4ZHRA 4PQUA 4YN3B 2ZEJA 5AE2A 2BJDA 4EI2A 2H5IB 3RUBL 1X5SA 4N8OA 2HS4A 4ANDA 1IQTA 1I6JA 4DSFA 2VBWA 2WBMA 2AD9A 1M1KT 3L4BC 3CMES 5KG3A 1RTDB 2ZDPA 1YJNS 3CDEA 3ILOA 5KFEA 1HNIB 3POTB 1RHMB 1LWFB 3GB0A 2I38A 1WC1A 5CH7B 3AB2B 3E51A 3F0NA 2N3LA 2CRLA 1RT3B 1TL3A 5K5MA 1YI2S 4Q7AA 1DZ5A 3HHEA 1P1TA 3CD5A 3DGPB 2NPIA 3DYAB 1Y9OA 2YKOA 4F8RA 4CDIA 3DDKA 3DM2A 5KG0A 2GA7A 1H2TZ 1X0PA 4FDFA 1JLFA 5KFKA 2O66A 2UXCJ 4UOCA 1W26A 1J5OA 4ZS6A 3EVMA 4M94A 2B9YA 1EAYC 2OI2A 2C2ZB 1HWIA 3LP0B 1FXLA 1MROB 4RR5A 3QO9B 2CDQA 2ZHOA 2HZVA 3GU0A 5C2GA 4CM0A 4C6AA 4M5NA 2ACYA 3EYZA 1CPZA 3NAHA 1VJQA 1UFKA 2WCXA 2DVIA 2UVUA 2UUWA 2D9PA 4A8YA 1LK5A 1R0AB 1FRLA 4USTA 3HVTB 5DG7A 3D3BJ 4EO6A 3PW5A 5HMZA 4KY3A 2VICA 4U95A 1SJ3P 1O8BA 4S0MA 3PXGa 1T05A 1S6QA 2YNFA 5IM0A 3KK1A 4RO0A 3W7BA 2VG6B 2M0GB 4YOEA 1WTBA 2XYPB 1RZMA 5ETTA 4DU7A 1NSKL 1UJ4A 1KQGB 2KO1A 1BHNA 3GILA 2AW0A 4L74A 5HLFB 2VASA 2JOQA 1H2VZ 1PYOB 5AXLA 4URSA 4DV2F 3MEEB 4IO1A 2H54B 4OZLA 1SB6A 2IRYA 2MJNA 4UOGA 3RG6A 2OD6A 3H59A 4DLEA 2E5GA 4DV2J 2RKIA 1S7HA 2HQDA 3UR0A 1IR0A 5T7LA 3WIVA 2BV3A 1A6LA 1JX4A 4TLRA 3QGGA 1SJFA 1GMWA 2HRYA 2K06A 1NK7A 3P8BB 8ATCB 1X4BA 4ILLA 1UWAA 4PXEA 1RWNB 3EMTA 1PC5A 3P5BP 4W90B 4DR3F 4DJBA 2GHWA 2J0SD 2XMWA 1SL2A 3VVTA 4XAKA 3A3PB 1REGX 1FFGB 4HHUA 4WU3A 3AB4B 5DETA 3LWLA 3ZZUA 2QLBB 5E3QA 5CCLA 2A0FB 2XLKA 3BSOA 1S10A 4QYZJ 4JI2F 4HT7A 2WOMA 1U6FA 4C7QA 3AAWB 4FS2A 3UD3P 3SQGA 3TARA 3IR6B 2D41A 4ZOSA 1LFWA 3HHLD 3N5BA 4GVLA 3QRPA 4N47A 3P45B 5L1JA 4PRFA 4K5SA 4KGXB 3R3TA 1SJRA 2HFNA 3DDIA 2ZITA 1U49A 4WTYA 2BABA 3T3FA 3KLGB 3K59A 4B08A 4WWSA 2HAFA 3VCDA 3H40A 1SQFA 4DL7A 4DS5A 1RWUA 3JB9k 4B9TA 3K5PA 3C6UA 3CD6S 3ET6B 3NGSA 3PYFA 4PXBA 3HT3A 2UUBF 2DNKA 5ETVA 4P7VA 4YY3J 3JSBA 4K2JA 1YJUA 2HHHF 3JSRA 4USHA 1KHVA 2EEYA 2DKOB 2JVOA 2AP6A 1FDNA 4ETXA 4ANEA 4LF9J 5HVHA 1MNEA 2HHHJ 3H98A 3SSSA 3NNHA 1F5CA 3FQKA 2DR7A 4OJGA 4LUBA 4RWWA 2IM0A 4YHHJ 4K4YA 4RWXA 4DF4A 4Y2IA 1DURA 3G96A 1TU0B 3LPYA 4FBUA 4CO3A 2E5JA 2U1AA 3KUHA 2LLZA 5B0DA 3GWCA 3PZPA 2CPJA 3K0JA 4CLKA 2XS7A 4PYDA 1FESA 3VQTA 1WORA 2BOAA 2H65B 1S6PB 4HHJA 3CO9A 2RMLA 1QE1B 2F9DA 1UEKA 2CJ9A 4ZDNA 4ZKAA 3CULA 4OHWA 2ZH7A 3UN2A 4DN9A 5L9NA 2C2KB 4H4MB 1JLBA 4JI7J 2OPRB 5J1NA 4HTIA 4X4RA 3O3LA 3IRXB 2KFNA 1AROP 5DZ6A 3BQ1A 4ED6A 3NXZA 2HW3A 1CQMA 1RTZA 3D1HA 2VOOA 2ZNZA 4MIBA 2QL9B 1RBAA 2K1RA 4AQYF 3ZZRA 2I2YA 3SDEB 2V8GA 3C16B 2KM8B 1NEEA 4ZPCA 2JVRA 4AQYJ 4Y00A 4DL6A 2KG1A 3PEJA 2KH9A 4PAAA 1C2PA 1KQSR 2FDNA 1RWXB 4Q8FA 2FHKA 4ID5B 3VF0B 1M5OC 1QLNA 1YJ9S 1VIOA 3EJMA 2QX0A 3WQPA 3MMAA 4MKYA 3WX8A 3G87A 3K57A 3OXFA 3DCAA 1NM2A 3M8WA 1YJVA 3KLFB 2EG1A 2DR5A 3GJTB 1H3DA 2Q43A 5FD1A 3QT8A 4ECRA 2BACA 2K7JA 1S0VA 1S72S 3UFCX 1L3VA 1GMVA 1HBOB 4WP3A 2LXFA 1WF2A 4QYZK 2AZ3A 4HVZA 1BE4A 2LQ5A 2CZVC 1FKOA 2QLFB 1HHSA 1D9AA 4RZRA 3MUMP 2MHEA 3QWUA 4IRDA 3AJDA 1TL1B 3OQ2A 3DXBA 2AV5A 3UDVA 2JLGA 1CG2A 1X5OA 3N6MA 1RT5A 1JJHA 2OMOA 1UAWA 3PX4A 1JLQB 2OELA 1U0HA 3DGVA 1KKHA 3JQJA 3QRQA 4X4VA 2ZWOA 4OYPA 2DNMA 2ZC3A 4DV7J 3W65A 1N52B 1SQGA 3DLLQ 5FJ4A 4B9VA 2KRRA 3F44A 1QAJA 2MQNA 1MMNA 4ZVPB 4OHZA 3PRBA 5CZVA 4M1KA 4PABA 2DK2A 2YBVA 2BE7D 4OZ5A 2MZ1A 4WIQA 1OYDA 5GVQA 3NNAA 1E6YB 4U96A 4AE5A 1LWEB 4DSJA 3I0SA 1S1TB 3HHLB 2R7XA 1IKVA 1B3TA 2Y0SD 1X4HA 3CD7A 1NLKL 3MURP 2M88A 3JYTB 3CJ5A 3DOLA 5HN0A 4XTTA 1WELA 1KRPA 3LF0A 4UQTA 2MZTA 2VODA 3IAM9 2BJ8A 2XI2A 4N77A 3CPWR 1UA0A 3GONA 2KVIA 2IPOB 2ILZA 2V4JB 1TKXB 4CO4A 4D3HA 5F8MA 1SL1A 4OFZA 2J0XA 1B0VA 1RTIA 1XC9A 2F63A 1RTHB 2VJUA 1PBAA 4B3TF 3OHBA 4YS2A 2XGQA 3CJKA 4IOCQ 2BX6A 2F8EX 2MJUA 4DR5J 1IM4A 2I5JB 3T9ZA 3F41A 1Q53A 1RYSA 3M8YA 5K8OA 2XQCA 4YUDA 4H4KA 1JLCB 3TUZC 2GAHC 1KD1T 1N33J 4DHVA 1QSSA 3ZNUA 3DNCA 1S0OA 3EGZA 3I9V9 3FCWA 1EZZB 1NDPA 2ATLA 3J7YU 4JV2A 1MLAA 2ZZTA 4TU8A 3RBXA 1FF2A 3HKWA 1YG0A 1QTNB 1G7CB 2IC3B 3T1AA 3LGHA 3GIRA 5KFUA 2GMLA 1S76D 1RT1A 1RT2A 1AZSA 4WE1A 2A2DA 2XTJP 1JLGA 5C42B 1YZ6A 1IXKA 1U1LA 2YXLA 4DQPA 2GQ2A 2FTRA 2EPIA 2EBEA 2QA4S 4J9KA 3PIPQ 1LWCB 3KHGA 2DCLA 4BC7A 4O3PA 3N6LA 1PJ6A 1S1VB 1EKSA 1R7IA 3DC2A 3DLJA 4LFAJ 2DIUA 1VR6A 4ZLNA 1T7PA 3O44A 3IXQA 5DG8A 2WK4A 3DFEA 2EKNA 4OI6A 4R0EA 4BBYA 3DMJA 3VAHA 4QR0A 1JLEA 4OZ2A 4P6QA 2R4FA 1FE4A 1NMEB 5F9NA 3UPFA 5FIIA 3ZZ0A 1X60A 4OYOA 2XS5A 4LMZA 4C98A 2OPSA 3KHRA 4URGA 1WDTA 1BQNA 1X31C 4C11B 3TAMB 2W9BA 2G1HA 4H54A 2D7SA 5C2CA 1T9UA 1IBKF 2LXIA 4XDCA 5MLCV 1J27A 4ZN1A 4LF2A 2OO4A 3ENWA 4KFBB 1OPZA 4EEYA 1TKZB 1NZ8A 1KNZA 2ATCB 5DZ7A 2KXHA 2HPUA 1IBKJ 3BKTA 2MY8A 4DV6F 3PW2A 2GVZA 1A9NB 2DJWA 1RAFB 4C48A 4K50A 3B82A 3TP2A 2DNLA 4MKVA 2FYXA 4DV6J 3R9LA 2RUSA 2V50A 2V8HA 4JBCA 1R6VA 3H42A 1CQNA 5I42A 2PIIA 4CLFA 1U45A 4FF2A 3W60A 1TUWA 2AEMA 3FFIA 3CC7S 4ED5A 1OYEA 4USUA 2BW2A 2J7WA 2DGQA 2OPQA 2VJVA 4DFKA 4OQJA 4X4UA 2IVYA 5F8NA 1HYSA 1R6YA 3C46A 3CIMA 1N6QB 3V81B 3CB4A 3GR1A 1RA6A 2HIYA 2FVRA 4C8OA 1FX4A 2ZD1A 1S7IA 3DOMB 2MQLA 3VAJA 1HBNB 3UNYA 3A1YG 3TW0A 2IVMA 1VC5A 3OFHA 2NS1B 5BYRA 4DV4F 3VVUA 1DFDA 2QMWA 1IWGA 4CTAA 2VPYB 4JI4J 3W1YC 3MGJA 4CLSA 3SSQA 2BEFA 2Y8YA 2QSWA 5KAKA 1S1WB 3EWGA 4NLWA 4ALZA 3V6DB 3W9JA 5I3UB 4DPYA 4HT5A 1UEUA 4E2FB 1JQGA 2HQCA 2HHPA 3DRYA 4FXWA 2DYAA 2JRSA 1HI1A 1T03B 3AOCA 1PILA 2ZH8A 2GX8A 4EMDA 2HKEA 1K1QA 1LXJA 4PZVA 1EP4B 1R43A 3SFUA 3VAIA 4KRWA 1HWLA 3NP5A 2GVDB 5D78A 2V8DA 1CJUA 4H4KC 1S9EA 3CDBA 2X1BA 1HI8A 4DR1J 2PN6A 3EGNA 5D0HA 3VQSA 3W2VB 2EG2A 1MN9A 2BE2A 3I4HX 3NGRA 2N3OA 1SKSA 4FYDA 4TYAA 4RKUC 1DTQB 1N5TA 4J5OA 1JLAB 3M32A 2VC0A 2WONB 3CJTA 4UTGA 3E01B 3QT6A 3M6VA 2XWYA 3VR1A 3NL0A 3HULA 5JUMA 1TV6A 1PJ5A 3RR7A 2ASDA 2NUUG 4RUCA 3V4MA 1JK9B 4NYOA 3VGTA 2DNNA 5DGBA 2OIHA 3A3OB 3SIPB 2J0WA 4G1IA 4R5PB 5CA5A 5B0EA 5DDRC 2OPPB 2DTJA 1L5UA 4DUYF 2LVWA 4P52A 3A8JA 2YKPA 1RWPB 3IC1A 4ANCA 4IQMA 2HHSA 2OMLA 1IJFB 5HJYA 4CO1A 2C2EA 3DOKB 5ETSA
chains in the Genus database with same CATH topology
5KG4A 3KNGA 3CJ2A 5F3TA 1R0AA 2YNIA 4G1PA 1LXNA 4GC6A 3M1VA 1MU2A 1Y3KA 3HVTA 2O1PA 1OSCA 5A6PA 3DI6A 3V4IB 2F8HA 3TANA 4OJHA 4LQ3A 4NL5A 4NLOA 4DPOA 4XO0A 3N0VA 2HHQA 6FDRA 2V8VA 2QA2A 1ZOTA 1WG5A 2B3TB 3DOLB 3JTPA 5U47A 2AGOA 5EN1A 5DLFA 1Y5IB 2E7WA 1KVJA 3B78A 1R31A 1PSDA 2FUG9 3NCRA 4HTJA 2CQGA 5CYQB 4C97A 1VRUB 4C8ZA 4X62F 5D3GA 2V9KA 3KK2A 2MXYA 4RW9A 4IRKA 1HL6A 3SI8A 1T95A 3OSPA 2BRKA 2XNQA 1S9GB 3HVAA 1U25A 5IZHA 3THTA 1RKIA 4KHMA 1DLOB 2B0GA 4CI0B 3R5BA 5T14A 3BDPA 2MDAA 2VG6A 2WRMA 4PXCA 2O67A 1SI9A 1ZM3A 2RRNA 1U1RA 2UUTA 4ZPVR 4N41A 1RTIB 3NWGA 2FPHX 2C3UA 2ZKTA 3ZZTA 1HW9A 1C0TB 2VB6A 3B4DA 2ZH5A 1ZYQA 3K5OA 3HZGA 4RW8A 3DLKA 3CJKB 4G1QA 3OLBA 3BGFA 3IAS9 3IO1A 4URQU 3AQPA 2RQMA 3MOZA 3U27A 3EXYA 2M52A 3CMAS 2R7UA 3HMJG 1WACA 2HZCA 3FQLA 2RQ4A 3BZQA 4OHVA 4IKAA 3X3UA 5HLFA 4FPRA 1K8AT 2RIJA 3PX0A 3QLHB 3M2VB 2JH3A 5F8HA 1X8DA 3TVKA 5GADI 3HPOA 2C22A 3CCLS 2VBXA 3BGLA 3PFEA 4B9UA 1FJ7A 3MEEA 4RW7A 5GAEI 2I0XA 1P8GA 4K4ZA 4A8MP 2CJBA 3CCSS 3E3XA 1VHFA 3KK3A 5KFGA 2FVCA 3CTRA 4NMLA 3QGIA 4DL4A 1KS2A 1QAXA 4N5SA 3HXMA 4LSNA 3HK2A 1GH8A 4WK3A 2VV5A 3KFWX 3U1MA 5KFOA 5CYJA 2B7BB 5I3QA 3GIIA 2AF6A 3OL6A 3RRHA 1U1PA 2EBGA 2IRUA 3ZZYA 3HVRA 3NS5A 1T94A 5DM7Q 2KTQA 5A8RB 2HWHA 3PFOA 3MWBA 4QIWD 2VG5B 2MGZB 3IR7B 3TAQA 3MEGB 4NLDA 5E3PA 1BWEA 1URNA 1Z1ZA 1C1CB 1FD2A 2VG7B 3DXSX 4I64A 5CCMA 1R89A 1W2IA 4F4YA 4H4OA 3ZZZA 1U09A 1Z2LA 4ILRA 3NRBA 3FJ2A 2HLUA 1VK3A 2IFXA 4L72B 1U1KA 4OJ3A 1YVFA 3RU0A 2CQCA 1TFWA 4FXDA 3SZ2A 1H6KX 1RI7A 1SIWB 4Y2AA 5J2QA 1ULRA 2K7KA 2FLPA 3T5KA 1NJWA 3HHKA 1NJZA 2DNPA 4C9DA 4ECXA 4TQSA 2YWFA 5J2PB 5CYMB 1U1NA 2CPYA 1ZTTA 3X1LB 2VUGA 1RTJB 2LDIA 1HMVB 4NOHA 2CPZA 2JX2A 2N4CA 2PGCA 3MEDB 4TY8B 4WZMA 3L09A 5DQHA 2FGOA 4EYIB 3PNIA 1RT1B 1RT2B 5KFTA 2VH7A 4WXOA 4AXIA 1E6VA 5CYMA 3PEHA 2IVFB 2IMOA 3T6JA 1NK8A 1OWXA 2HNYB 3BM7A 4WE1B 1BD6A 4OZNA 4B9NA 3SV4A 1RK8A 3MEDA 4C8MA 2DH9A 2PO4A 3U02A 1JLGB 1XR6A 1DTTB 5KFLA 1DHMA 1SV5A 3UD4P 1ZZNA 4DL3A 5KG1A 5E7OB 4B9MA 2LQBA 2VPZB 2PD1A 5MAOA 4RLEA 5B0CA 1U1QA 1Q7LB 3P49B 3DRSA 3LP2A 5CHCB 5K8NA 2DHGA 2FHJA 3MM5B 3VALA 3RTVA 2OH2A 3BEGB 2GIRA 3KLIA 2MKKA 4PCQA 3I96A 3M8PB 1RT6B 1OIAA 2DIVA 4K4TA 2IBKA 3RR8A 2N82B 1VLYA 4O0IA 1T02A 4IG0B 4RUHA 1WG4A 5KFNA 2JSXA 2WAQD 4PPZA 1B0TA 4EO8A 2J9CA 2I8EA 2GGPA 2MZQA 4DQIA 5IT9Y 3I6PA 1KONA 1F5AA 2VFSA 5AJ3F 1FO1A 1X5PA 3PW7A 3U7JA 2OJ3A 2M3DA 2Q6BA 4DL0C 4F4WA 2F7VA 1RT4A 4FF4A 3PKMA 2DHSA 4OLPA 2F3JA 1J5EF 4YB7A 2PDAA 5DQIA 5EWEA 2KM8C 1TK5A 2P9GA 4PWUA 4K4SA 4NA3A 5CXTA 1REVA 4O3SA 1HWUA 2MKJA 3P3DA 1VC6A 4X66F 1TP7A 2JEIA 1S0MA 4I2QB 3JAMY 2NPFA 5LSOA 1RT7B 3IWLA 3I5CA 3OLAA 1RQ0A 4KQZA 3KMSA 1FEEA 3MPVA 4F02A 3DMJB 2Y1RI 2EFPA 3VAGA 2C3YA 3G8SA 3Q23A 3BREA 3LQVA 4ECZA 1FDDA 1XR5A 1TL4A 2CQPA 4MIWA 4QR2A 1H98A 4BC9A 1JLEB 1VQLS 4KSEB 4QPXA 4RU9A 3OUYB 2COLA 3I56S 1T3OA 2DGSA 4DEZA 3ZC4A 4MJKA 1F0XA 4TN2A 5H9FJ 4A8OA 2ZKUA 2E9RX 1YSJA 4B17A 1QJHA 3BF4A 1NKBA 4TKTA 4Y65A 1KTQA 3LOUA 1S1XB 1KQFB 2R8IA 4EGLA 4WYLA 5L1LA 3KLGA 4ECSA 2YY3A 2OPSB 1BQNB 4OHYA 1SH0A 2B5JB 3UDCA 1X9MA 2VL1A 5B0FA 4YY3F 2HNZA 2P9EA 1UFWA 3QGPA 2W9BB 1S1XA 1YRUA 4Y6IA 1U7LA 3MMBB 4UUWA 5F0WA 2ZH3A 2L9DA 3MTKA 4WIIA 5KFXA 2WB4A 1OPIA 1IBMF 1CEZA 1QVFR 5KFAA 4I6WA 1R8PA 4LQ9A 1NO8A 4QWDA 4LF9F 2CFXA 3N28A 3RBEA 4O3RA 1HPZA 2GFFA 4JI8F 3TOQA 4ELUA 1FK9A 3DLGB 1G6BA 4C3LA 1F5BA 3TI0A 4NCAA 3H25A 4J9SA 3O5TB 3SFGA 1X9WA 3OR2A 2KFZA 2ROEA 3RBDA 2FIUA 4I69A 3D28A 1BQMA 3GV8B 2NSBA 3V6HA 2PE8A 2W9CA 3IS9B 2NQPA 3D0HE 4K0KF 3C6TA 3HP6A 1RAJA 3OR1A 1M5SA 1SXLA 3UCZP 1UL3A 2DNYA 1XERA 2B4UA 1SUQB 3CWJA 3VAFA 4YB5A 3SSRA 4IR9A 5IWAF 4DV1F 3T5LA 4YHHF 1OO0B 4F67A 4WXWA 3S6EA 1NJYA 2NUHA 4NZ0A 1FJEB 1FDBA 4RX6A 1S1UA 2DITA 2HAIA 2CPFA 3DN9A 3BGRB 1HR0F 5IQQA 3KWMA 2DNHA 2Z8QA 2HG4A 3T1YF 4JI3F 3G6ES 1HD1A 1QAYA 1C4AA 3J7YI 4TYBA 2KXFA 4U7UK 3FZ2A 1P27B 1L3SA 5K14B 2BA9A 1UVMA 2CQ2A 2R8HA 2VFUA 1D3WA 5DDPC 1LW2B 3GFHA 1FNMA 1YRXA 3QZ7A 1NRKA 1H38A 3FVYA 3MEKA 1LFPA 2KB2A 5G0RA 1PC4A 2W8LA 3CCUS 4NPOA 1FHTA 3DHWC 2ZH6A 4WYWA 1KFSA 2KT5A 5LSRA 2GO9A 2N7CA 1DJ0A 2KN4A 3H8YA 2ILYA 3C3LA 5I42B 3G6VA 1VQ4S 2W4PA 4ECQA 1FNXH 5F9LA 3DRPB 3HHDA 3CCQS 2RE1A 4X4OA 3OVSA 4PWDB 3FFIB 3DRRB 1AFJA 3QJPA 4JUZA 1CLFA 5J1EA 4QIFA 2AGPA 4PG6A 2QO3A 3HDSA 2CPDA 2FHJD 2Y1IA 2HIQA 1X4FA 2MZRA 1WNEA 3SCIE 4C3MA 2YWHA 4IFYA 2JFDA 4O44B 5IXUA 2V4RA 3H5YA 2R2RA 5C24B 1N5QA 2RDJA 2FLNA 2JWNA 3E2EA 1NHVA 1GXLA 2B9WA 3PACA 1GAOA 4DR6F 2ZE2B 4PG5A 5H9EJ 2J9DE 3AY0A 2RF2B 5CQGA 3HZEA 2WBRA 1SKWA 5D4OA 2C3MA 2JEJA 3L95X 3MM6B 5E3CA 3QIPB 3EPGA 2OPQB 4JI7F 3PVXA 3M2RB 3MR5A 3GE9A 3O8WA 4MKAA 1VQPS 2RVJA 4A8SA 2KXNB 1S48A 4PUOA 4C8NA 1S6PA 1IKXA 2IM3A 3I4PA 4EYHB 4J37A 5BR8F 3KLHB 5GAHU 1HYSB 1QE1A 3LAMA 3CCMS 4OZ1A 4W92B 1DQ8A 2MQQA 4OX9F 1VQ5S 4QU7A 4TY9A 2I9SA 2XHWA 2ZBIA 2AJ1A 2F1FA 3P5TL 4JOUA 4MK8A 3RRKA 5H1SV 4V19J 2L3MA 1CC8A 3MECB 2R8KA 1HNXF 5J2NB 3MM9A 5E3RA 2PT0A 2E5LF 2CYYA 4I7FB 2Q79A 4H4MA 2HS0A 3J7Z5 3GV5B 3MD1A 4OLOA 1Q78A 2ZD1B 2OPRA 3BO2A 4NCGB 1KHWA 3NAIA 2CQ3A 2G4BA 1K0VA 5B0BA 2WW8A 2VZ9A 3DHXA 1MSWD 3ICLA 3IRXA 4KIAA 3AJ2A 4OI0A 4Y2CA 4YR0A 2DCUB 4NZ7A 4V19X 1JKHA 1X4DA 2FB0A 5GAGU 1R3NA 1P6TA 2X3GA 2QMXA 2HNDB 3I82A 1C1BB 4WFAQ 4M8LA 1OQ6A 1IKYB 4RW4A 1TL5A 3HHLC 4ZP9A 2C2RA 1N5VA 4M5DA 3HLUA 4CTAB 2DNZA 3UCGA 2E44A 2XSJA 3D0GE 4NZ6A 4PXDA 2XCPA 5ADZA 5E5NA 5L1KA 4WFZA 2A18A 3M2UB 1VRTA 2IAJB 2A10A 2OTJS 3NG8A 5B0AA 4IFVB 5KFZA 1NK9A 2P6TA 3NMAA 1VS3A 3TVYA 5T41A 2PEHA 3SDEA 1O51A 1KQKA 2C28A 2FJBB 3VTIA 3MR3A 3PO5A 1PO6A 1HA1A 3RW7A 2ROGA 1NAQA 5GMKa 3QAEA 2V0NA 5HMXA 4CO2A 1TKDA 2CPEA 4MK9A 1N48A 4HH0A 1Q8LA 2VQEF 3L7PA 1WHYA 3G86A 2PMHA 2L9WA 3NBPB 2XBPA 2UZAA 2XMUA 1WI8A 1UVIA 1SC6A 1N5YA 3CDAA 3OTCA 3OJSA 1UWBA 2LEAA 2AYGA 1MMLA 1FNOA 2YX7A 3IBWA 5HP1A 3DLBA 4ECWA 1S77D 2XS2A 2EKYA 2KI2A 5DGAA 4C0BA 4IQXA 3CT9A 4ID5A 2UVRA 3C2PA 5HMYA 2YKNA 4ZHRA 4R0JA 2DH8A 4NYZA 4PQUA 4X2BA 2IRXA 3V2UC 2ZH4A 5FDLB 5AE2A 2BJDA 3MM7A 4PR6A 3HF5A 2VFTA 4ES2A 1X5SA 4N8OA 1WI6A 2HS4A 4BHQA 1WG1A 1IQTA 4PG4A 4NLVA 4I4BA 1I6JA 4ZCLA 1YQHA 4DSFA 2VBWA 1RJJA 2RH3A 2WBMA 1S9EB 4PQAA 2AD9A 3KJVB 4CIOA 1M1KT 4ZPAA 2RNEA 5EDWA 5C5JA 5KG3A 3CMES 2MKIA 2ZDPA 1RTDB 2CVEA 1YJNS 3CDEA 1SH2A 5HROB 1UEVA 1TAQA 2BE2B 5KOWA 5KFEA 4KKOB 3SMZA 2F4VF 1HNIB 1UA1A 1LK7A 4J9LA 2XWXA 3ENVA 4KV8A 1UVLA 4KGKA 3HKZD 3KLFA 4C0OC 2E29A 3TNVA 2QRRA 3GR0A 4IG3B 1HI0P 3POTB 5LMUF 1LWFB 3GB0A 3M32B 5DJBA 4NLGA 2I38A 2B56A 1XNQF 5CH7B 2XB2D 3LO3A 2J76E 3GG1A 4EBCA 1JWWA 2ZFHA 4IG3A 1HQUA 4OX7A 3AB2B 3E51A 2N3LA 2UUAF 1KLMA 2CRLA 1RT3B 1TL3A 4NA2A 5K5MA 4UY8T 1H7XA 1YI2S 2DRAA 5KFJA 1TV6B 3I0RA 3BSNA 4Q7AA 1DZ5A 3HHEA 1P1TA 5KTQA 3WDOA 1TK0A 4DR4F 4OI4A 3CD5A 1HBOA 1KSPA 1N56A 2D74B 4ZVEA 2RB7A 2NPIA 3T5HA 2QA1A 4J9OA 3DYAB 1Y9OA 2IMWP 4X4TA 3ITHB 4ETZA 2YKOA 4WFXA 5I4MA 2KRBA 3U1NA 4FNIA 1X0FA 3F73A 4F8RA 1TKTA 3DDKA 3DM2A 5KG0A 2GA7A 5IFMA 1H2TZ 1X0PA 5J2MA 2E1AA 4YEAA 1X5TA 1JLFA 4P2SA 5KFKA 3OSNA 3IGVA 2O66A 1TVRB 4UOCA 1M90T 2L9NA 1J5OA 1YJRA 3AQOA 4JI0F 4XIUA 2LEPA 4ZS6A 4M94A 4M63A 2B9YA 5KFWA 3CCVS 4DN0A 2D3UA 1N54B 3MAHA 1TL1A 1U2RA 2CZ4A 3LW5C 1HWIA 5J1PA 1K73T 3LP0B 1FXLA 4DV0F 1MROB 2RUGA 2FVSA 4DV7F 3QO9B 2BZ2A 3MTJA 2CDQA 2ZHOA 2K2PA 3CXCR 3G6YA 2OAUA 3M8SA 2HVIA 4F50A 1FRHA 1ZAVA 1UFLA 2LYVA 1N32F 1F2GA 1JLQA 4NLUA 1C0UA 4NLQA 2W8KA 3J7ZT 3K7RA 3IRWP 2AX1A 3CDUA 4LT6A 5D77A 2ACYA 4CNYA 5A0YB 1TR0A 3EYZA 2M7SA 2OLWA 3MM8A 1CPZA 3NAHA 3THPA 2EI5A 2FJWA 4NLPA 3K8WA 1RYRA 2WCXA 5D8HB 4NCBA 4HYKA 3BDEA 3LH2S 2DVIA 2UVUA 4GO7X 3KG0A 2OSRA 2J7KA 2P9CA 1N8RT 2UUWA 1M0SA 3G8TA 2FJDB 4HH1A 4NWBA 2CQ1A 2D9PA 4A8YA 4LSLA 1LK5A 2RRAA 2YNIB 1FRLA 1R0AB 3T1HF 4EZ6A 2DRBA 3NMRA 1URRA 3M1VB 1MU2B 3HVTB 1X7VA 5DG7A 3DI6B 2BR0A 4EO6A 4X64F 3PW5A 1G3OA 3MMCA 2LCWA 5HMZA 5EX0A 1Q8IA 2HHWA 2MYFA 4QCLA 2C3PA 2YKMA 4KB7A 1SJ3P 1O8BA 3HFKA 1U47A 2Q1LA 3PXGa 3Q8RB 2OTLS 2K3IA 5D3GB 2VA2A 1XMBA 1T05A 1SL0A 3OXLA 3H2UB