1FJGF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fjgF00
1IBKF 1J5EF 4DUYF 4DR6F 4JI8F 4LF6F 2UUAF 4LF5F 5IWAF 4JV5F 1XMQF 1N36F 1QJHA 4JI6F 4X65F 2BXJA 1FJGF 4NXNF 5BR8F 1CQMA 2VQFF 4DR2F 4B3RF 4JI0F 2B7CB 1HNXF 4AQYF 2RJZA 1N32F 1I94F 4DV3F 2UXBF 1HR0F 4KHPF 4GKKF 4JI7F 4DR7F 2UXCF 5LMNF 4JI5F 4DV1F 4B3TF 1HNZF 2B7BB 3ZZPA 1FKAF 2HHHF 4LF8F 4DV6F 2UXDF 4LFBF 3T1HF 4DR4F 1IJEB 2YY3A 3OTOF 1GH8A 4LFCF 4DV0F 1XNQF 4JI3F 4X64F 2UU9F 4OX9F 4DR1F 1IBMF 1N34F 4GKJF 5LMUF 1HNWF 4B3SF 4LF9F 2BVZA 1F60B 4JYAF 1RISA 1CQNA 4JI1F 4X62F 4X66F 4DR5F 4NXMF 3R3TA 4DR3F 4LFAF 1XMOF 4DV4F 4YY3F 4LF4F 2KJWA 2UUCF 4DV2F 4DV7F 4DV5F 5AJ3F 1IJFB 2J5AA 4JI4F 2UUBF 1G7CB 2E5LF 4JI2F 1IBLF 4B3MF 2F4VF 4YHHF 2KJVA 1VMBA 1XNRF 1N33F 4K0KF 3T1YF 4LF7F 1G1XA 1LOUA 4DUZF 2VQEF 2ZM6F 1B64A
chains in the Genus database with same CATH superfamily
2UZAA 2LVWA 5D4NA 4CYUA 2VKZG 3DLKA 2XMVA 4BHQA 4UOHA 4C3KA 2OSRA 2RD5C 3Q89A 4WFBQ 5BR8F 3E01B 3LUYA 3K58A 5KFPA 4FYVB 2DBBA 2G9OA 3QT6A 1XEZA 5AE2A 1RT6A 4OX8A 3MMJA 4O0IA 4O3OA 3PRBA 4DSFA 3CCMS 5L9NA 3IN5A 4P2XA 4LFAJ 4V19J 2OAUA 1FKPB 2UUCJ 3I6PA 4I67A 3B82A 3HZGA 2IJRA 3V6DA 1HNWF 2R7WA 4JYAF 2HNDA 2PEBA 4JV1A 3RBXA 3K5NA 1NBEB 1DLOB 1XMOF 4LR7A 1DAXA 4JI8J 1JLCA 3MAAA 1S97A 4WXOA 4WE1B 3HSDA 1HD1A 3L09A 2IYIA 3DDKA 3HHKA 1VQSA 4ZIWA 3UVJB 5A8KA 2HS3A 3BGUA 2NREA 1VQ7S 1M90T 3WBZA 2BXJA 4NL5A 1EJ7L 3VQSA 4A8FA 1CJTA 3MD1A 1S0VA 3BGRB 1VIXA 3O3LA 5IT4A 1A6LA 1RWUA 2A2DA 1UKUA 1T11A 3CCES 1U49A 2LKZA 2JEJA 2PFDA 3ZNJ1 1QTMA 4KH0B 5L8RC 4RWWA 1IKWA 4LUBA 3EGNA 2W9BA 4K4TA 7FD1A 4F0KA 2AJ1A 5ETQA 1HFEL 2LQBA 3UD3P 2XI3A 1FESA 4DF8A 1RU2A 1TL5A 2B4OA 5KAKA 2ALZA 5FDLA 2QA4G 3PW5A 4F8RA 1HI0P 2YVSA 1TAQA 3LGMA 4Z2XA 4PQAA 1Y5LB 2C2ZB 1X4HA 1FA0A 1TK0A 1NU4A 5KFZA 1S0MA 1RHRB 3AODA 2KU7A 1U1PA 1DQ9A 5JJBA 1RTDB 2HHQA 1C2PA 3HLUA 1RTJA 4K4SA 3EVMA 5KFBA 3IRWP 2FYXA 5CYQB 3H5UA 4O0NA 5E41A 1T94A 3DCAA 4LBHA 1WF2A 1RWOB 1YJ9S 4L3KA 1Q79A 4AUKA 4LMZA 1YBUA 2M9KA 4FXDA 4CO5A 3KUEA 2ASLA 2AQ4A 2W4DA 1F60B 1W2BR 1FRHA 2QMXA 1SKRA 1T3NA 3K5OA 2F65A 1L3VA 3IM8A 3PXGa 2XS5A 4CM2A 5KFGA 1TELA 2OPSA 5DGBA 1RCXB 4LF6J 2VHGA 1X9WA 5L1KA 1XK8A 4NXNJ 4IRCA 2I5JB 3CD6S 5JVHQ 1LFWA 4P2MA 3J80U 4RWXA 1N33F 3TX8A 2G0CA 2RHQB 4ECRA 4DJBA 2XHWA 5JXSA 3PW0A 2PT0A 1TK8A 1N6QA 4JI5J 3QMQA 4RPFA 3EE3A 3DDIA 3HVWA 5E3PA 1CJVB 3CXCR 2W9AA 1T8EA 4ZKAA 4QBUA 4FYXB 3OR2B 4DPYA 1G2EA 2RDJA 2W9CA 3W9JA 4AXIA 3MUVP 4ID5B 1RGVA 4IOCQ 3MEGA 4IFVA 5I3QA 2PMHA 4ZITA 4GC6A 2DNGA 2N3OA 2AZ1A 2N7CA 2IC3A 9RUBA 2DNPA 4MIAA 1DQAA 5ETVA 4QIWD 4NI2B 4LF9F 2E5LJ 4J9PA 2YWWA 3R5AA 2E44A 4JV0A 2AHOB 1RKJA 3JTPA 4CLZA 5HVFA 3M8QB 2LYVA 2Z4PA 2DHHA 5F9NA 2BW7A 4EYHB 3NGDA 5HQ8A 4DR2J 2VZ9A 2B8QA 1ROFA 1U2RA 3TQ1A 2X7IA 2H51B 4TYAA 3KJVB 3PYDA 1JLAB 1S0NA 2MKKA 3KNGA 5AE1A 1F5BA 2ZWOA 1NDCA 5A6PA 5I3PA 1NJWA 1P1TA 1IKVA 1V3RA 4IKAA 1VI7A 3OLBA 3QIDA 4O23A 1KHWA 3CWJA 3I0RA 4Y6IA 2IM0A 3BO2A 4UY8T 2UUTA 1NKBA 1NK0A 3PYFA 4B9NA 3B8HA 3DLJA 1SV5B 2HVEA 1RU1A 3RW6A 1RTHA 5A0YB 3CJ3A 2WVBA 3DLHA 3M30B 1WELA 2GJFA 1YZ6A 3A8IA 4NLDA 3DGVA 2KVQE 4YN3B 4MT1A 5DZ6A 3D0HE 2JVRA 3DRSA 2WBMA 4IO1A 3THPA 2X3DA 4B17A 3SQOP 5C5JA 3UDVA 1JXEA 1RT4A 5B09A 4FP9A 3DMJA 5J2MA 5H9FJ 4NWBA 1LXJA 3BSAA 5E7OB 2V2QA 3ZTSA 1NHKL 3DM2A 4KV8A 5FD1A 3GIIA 4WF9Q 5ETRA 3UCUP 1OSCA 3Q23A 4HL9A 3W2VB 2XM3A 4QWAA 3MR5A 4C4WA 1RB0A 2HEKA 4ZVQB 1P8GA 2ROEA 1WI8A 4NLPA 1VBYA 3K8WA 1VQ6S 2B9XA 4M5DA 3B78A 3VAHA 1KOOA 1XNQF 4DQRA 5HLFB 4OX9F 2CWKA 5AJ3J 1WC5A 5CA5A 3UI3A 3BGOP 1TL7B 2PN6A 3R5JB 1PYSB 3QFHA 4IDKB 3GFHA 1UMJA 5H9FK 1BD6A 2VOOA 1WF0A 3R9LA 4KGMA 4YB6A 1NJIT 2L3MA 4FXVA 1KLNA 3LW5C 2LXUA 1VMBA 3W8PA 2D9PA 3KK2A 2YWGA 3E3XA 1LQ9A 4I6AA 1OWXA 5IT9U 3FZBA 1R27B 3NL0A 1S76D 4ECUA 3CCSS 1NSPA 1TUVA 4KGKA 2GMJA 4QIVA 4IRKA 2MLYA 4ZJQA 5KFJA 2CKWA 1PIEA 1T05A 3SV3A 1N0UA 2HWTA 3DC2A 3FUYA 4OZJA 3TZXA 4EU0A 4ANCA 2LEAA 5FJ4A 3PRVA 3QNWB 4URQU 3T5LA 3QRQA 2W1BA 3P49B 1WWHA 2CPYA 2V9KA 5B0EA 1RWMB 4QW9A 5DZ7A 3MAQA 4F0HA 1PBUA 3D6MB 1VHFA 5IC4B 2EFVA 3HSGA 1UVJA 6FD1A 1H74A 3VAMA 3KJQB 1JKHB 1FXLA 1REVB 4DOZA 2X1GA 2E9ZA 1VC6A 4X84A 4ILMA 1SH3A 1N0VC 1C0TB 3M6VA 1FWLA 2XNRA 1ZETA 2W2NP 1YJUA 2CQBA 4DEZA 4UQGA 4DBQA 1CQMA 2RRAA 4M1KA 1RWPB 2AX1A 4N56A 3IA0A 2MMYA 2QGFB 2CQ2A 4RNOA 2V4JB 5KFCA 2QA2A 4F7VA 1FDDA 1SCJB 3VVUA 2DRBA 2MQPA 5EHHA 4PG6A 5HN0A 3UW1A 4ZVUB 3X1LB 3G82A 3J7AN 2CNNB 3R6GB 4MYTA 2GS8A 3UR0A 2HQIA 1M5PC 1S7HA 4X66F 1SJ4P 3M1VB 2QYCA 2R8KA 2AJFE 1FKPA 2I6WA 1WHVA 1SJRA 1CBKA 3PEHA 4LRFA 1NCLA 2IVMA 1ZPVA 1U4BA 4BC9A 2CPEA 4DR6F 3WQPA 3QBCA 1A9NB 3MGJA 4K7QA 1IN0A 2OLWA 1S0OA 1GMVA 5E3AA 1IQTA 3I82A 2FGCA 4JI3J 1HHSA 3CDBA 2GVDB 3ENQA 3IS9B 5I42B 2BABA 3KG1A 1OYDA 3U1NA 1KRPA 2B7BB 3PIOQ 1Q81T 2GO8A 3I31A 1IJEB 3DXBA 2B9WA 3FBCA 4OYXA 1IBKJ 2BJDA 3UCZP 4NYZA 3CCQS 3MTJA 1VOMA 3BGRA 2KI2A 3WIVA 4NX9A 3KK1A 1NUEA 2A10A 2JDJA 1KTVA 2CIMA 4NLRA 3QFWA 4NLUA 1VISA 3T1YJ 1VHIA 4U95A 1UVNA 2QA1A 2DXEA 2XMAA 2OMOA 2YPYA 2KJWA 3KNAA 2PGCA 4PYAA 3QWPA 3O6QA 1KP6A 3CPWR 2AT1B 1F2HA 1EQ0A 3C16A 1JXVA 3FCWA 3DNCA 3MMCB 4LVNP 3GB0A 4CH1A 2D1CA 2M7SA 4DS5A 3HSJA 4LF8J 2F7VA 2UXDJ 4X65F 3WX8A 2JFDA 4ED6A 4AFFA 2CJAA 2MQNA 1UA0A 1SJFA 4JI0F 1IR1A 5C25B 2C22A 1YZ7A 3Q2SC 2C28A 5J1PA 4MKYA 3ITHB 2DNHA 3DU5A 2KZMA 1DQ8A 1DZ5A 4YR2A 1RWVB 4QWDA 3DDNA 4M8LA 5HVHA 5HP1B 1RTDA 1GEHA 1S7IA 2BKOA 5H9EJ 4QIFA 5F8MA 2BV3A 4CH7A 2IDEA 3HP6A 3AA8A 4B02A 5DGAA 3S01A 4E8UA 1R8HA 4IH7A 2WVEA 5AXMA 3V5RA 4DLEA 1FX4A 1B0VA 1HYSB 4Y3CA 4A8YA 2LQJA 4DL0C 4NLXA 2MEWA 3LP1B 1N5VA 2HAIA 4H4KC 3NGTA 4X4RA 1YITS 1D09B 5KFNA 4O4RA 1HIYA 4FPRA 3HKWA 3MURP 2AF6A 5GAGU 4I1TA 3MOZA 2CRLA 3NNAA 4MAKA 5F0UA 3CUNA 3EDQB 4PKDB 4KHMA 4JV5F 1EZZB 1XTZA 2DJWA 2CDQA 2GCFA 3HDSA 3IC1A 4ZPVR 1B0TA 1RTIB 3Q0AA 3A3PB 3SCJE 4FVCA 1N52B 3NS5A 5KFKA 1NSKL 4NYPA 4LJMA 1X5SA 3AOBA 2DO0A 1K9MT 1CJVA 4MKBA 4ZJOA 2E5GA 1RDRA 2F9DA 2J8AA 2WSFC 3OR2A 3N6MA 4UOCA 3E2EA 2JWNA 5KT6A 3LP2B 3JTNA 2HZCA 1NAQA 2A6MA 4ID5A 1MMDA 2H3EB 2J8SA 2PE8A 5HL7Q 4M5JA 1SQGA 4Y2IA 3NOCA 4ED8A 4OI3A 2L41A 2RS8A 2ZKUA 1MG7A 2OP5A 4NI2A 1M1HA 1V3ZA 4DLGA 4M5KA 1PSDA 1UW4A 2RE1A 5BYQA 4LR8A 2ZC3A 1MN9A 5E5NA 2OJ3A 1FJGF 3QIPB 3QT8A 3TRGA 4NASA 4YDXA 1QAXA 5IXUA 3VAFA 4FPIA 2R7UA 1TUWA 3LAMA 3KJVA 3M8YA 9ATCB 1JLAA 2VF3A 4LRBA 4XIUA 2MPUA 3RW7A 1Y00A 2HHTA 2E1CA 2XO7A 3LANA 3W8GA 2ZNYA 2WTFA 4NMXA 4DL4A 2FVQA 3KHLA 1N36J 3DOLB 3GFYA 1I51B 1KWMA 2HNYB 1RADB 1TAUA 5B0DA 1UPPA 1HQEB 4QWCA 2W4PA 2OKQA 2AD9A 3K89A 1SV5A 3CD5A 2VV5A 1U0SA 2F8EX 5A0YA 1S77D 3PFOA 4I56A 3CCUS 1H3DA 1VQLS 2VKRA 1WC1A 3M30A 4L6V3 4GKKJ 1NDPA 4DV1J 4MTPA 2IPOB 2HHHJ 4DN9A 2E1AA 4KY3A 3NEKA 2KO1A 3U27A 4PG5A 4TXSA 2YQ1A 1NK6A 1BUXA 1T9WA 5DG8A 3M2RB 2ZDOA 3MWBA 4N5SA 2XMJA 5DO2A 1S48A 4HACA 2UU9F 1PJ7A 3MR2A 5HMYA 4P7TA 1R6VA 4FXWA 1C4AA 8ATCB 2OPPB 3W2VA 3DGPB 1YJVA 3BQ0A 3VGTA 3GG0A 3TANA 4NLGA 2XEXA 3CIMA 4KT0C 2R7RA 2WOMB 1WF1A 4NCGB 2VUGA 3EICA 2C1EB 1W25A 4YY3F 5F8JA 3KTQA 5HLFA 1UTAA 3SZ2A 3QGGA 3MEDB 3FKBA 2DR9A 1RK8A 2R2UA 1JJ2R 4ANDA 5HO4A 4F4WA 3OL7A 1MMNA 3DLBA 3MR7A 4OV1A 4IDKA 2CJ9A 2ERRA 4USIA 4CO4A 2YNFB 2NCKL 2C2OB 3C6UB 4LRDA 4DR7J 3AHPA 1GNKA 1FRJA 4FKYA 3MTKA 4PWDB 3Q8UA 4U8YA 2Z30B 4L72B 5C24B 3KMQA 3QZ7A 2ZBIA 3CJ4A 3KDOA 4J9OA 2DH7A 4C2MA 3AD7C 1VQOS 5IQ6A 4A8OA 5T41A 4HYKA 3MFIA 3Q83A 2R4FA 4O4GB 3BYRA 3KLHB 1M5OC 2EW9A 2WVFA 1UFWA 2HYIB 1T95A 3TVZA 4DR3F 2D7SA 3BS9A 1AA1B 4J90A 3C6TA 1OY6A 4DV5F 4F2SA 4JOUA 5CYMA 1KQSR 4OYZA 2QMWA 4GRSA 5HJYA 5GAHI 1VK8A 3T1AA 3BYPA 3RAXA 4EYIB 4DV0J 2ZH8A 5CHCB 2AGOA 3KOAA 2W4CA 2CDRB 2O1PA 2V4RA 1EETB 3A3NB 1BY9A 1QTNB 1HMVB 4FF2A 5CXTA 2DHGA 1JKHA 4TVAB 1JJ4A 1REVA 4ITSA 5ETTA 2BW2A 3CIZA 3ET6A 4B3SJ 4JI7F 2VFUA 1C0TA 2RDIA 4CLYA 5D77A 4C8LA 2XCPA 4X62J 3ZZYA 2AKWB 2VU5A 4Q5VA 1NK9A 1HBNA 4ZCKA 4F4ZA 2HHSA 3KMSA 5GMDA 2ZUAA 2V4JA 3RJMB 4B3MJ 1BE4A 4WFAQ 2ZHBA 2RQCA 1QE1B 4URSA 5DLGA 1F9EB 4P10A 3HHDA 2KH9A 3T3FA 1Q8LA 4OLOA 1ZTTA 1BGXT 1H0HB 2IRXA 1NM2A 4KGVB 5BR8J 1H2VZ 3FCVA 4J5OA 2XG8A 1UWBB 2QJ3A 2F4VF 1MLAA 3H2VE 1V5IB 2CPZA 1LNQA 1FKOB 3M1VA 2XI2A 4EBDA 4A8MP 2GHWA 4CO2A 3SSSA 3OQ2A 3MECB 2LEPA 2CZ4A 2V9WA 4ES3A 2UP1A 2ASYA 1KQKA 1FX2A 3UO0A 1C1CB 4OYMA 3HFKA 1CG2A 1U6BA 4LSLB 2KTQA 5AE3A 2HKEA 4K2XA 1U1LA 1YI2S 2OGUA 1N8RT 3PRDA 4JYAJ 1IWGA 3FK4A 3OXFA 5KFQA 1LW2B 1SXLA 3DLGB 1XMOJ 2XMWA 1TKXB 1FWKA 1R43A 2VD3A 3U1LA 5DDPC 1CVJA 2GVDA 3IS9A 3EJMA 2J6UA 1UVMA 3UFCX 1ZAXA 1GMWD 4KBIA 2V8GA 4HTIA 4PXCA 4YS2A 2QLXA 3CCZA 4OHXA 1IR0A 3A1YG 4DV2F 5LSLA 4LREA 1IJFB 2J5AA 2M2BA 3JSRA 5B7WA 4USTA 2DNKA 3IAM9 3FQLA 2BJ9A 2HZAA 3CD0A 1CJUB 3MEKA 1HI8A 3RR8A 2XULA 2WVCA 3EZUA 3D66A 3O2IA 4QOTA 3PV8A 5KFSA 1ZA1B 3CDAA 4OZ3A 4QQBA 4A8WA 1RKIA 3OTBA 4KPCA 4P7VA 2HRTA 4U7UD 2DY1A 4C8NA 2GQQA 3GZ7A 4KYZA 3RZAA 5J2NB 3FFIB 1S9GA 3CF5Q 5A8WB 3H5SA 3IGVA 4PWUA 3D7SB 3MUTP 2MSSA 3NCPA 2RHSB 1MNEA 2G0JA 1EIYB 4JI1F 2ZH9A 2A2CA 5HP1A 4RW8A 3H59A 1GXUA 2Q66A 3PJXA 3NWGA 4J9UE 1U1MA 2WVDA 1HWIA 2B51A 1BC6A 3W65A 3PM9A 4K0KF 1QUPA 2ZD1B 3V6HA 4AL5A 3TEGA 1NZ8A 4TY9A 2FHMA 1S72S 5DDQC 1IBCB 4ED2A 3TZWA 3LP1A 3TVKA 4MK8A 4YDDB 1YJRA 1D1UA 2ZZMA 2RS2A 3OTDA 3BN7A 4OIXA 1WEXA 2B7CB 4QWBA 3HULA 1I94F 1LWFB 1JLFA 1XERA 2YNGA 2QTWA 3CW2C 3N28A 5HJXA 2RH3A 3MAHA 3EWGA 2V2KA 5ETMA 1K8AT 4OJ1A 1QSSA 3VGVA 2P8IA 2MQ8A 3THVA 4B9MA 1RTIA 4ICLA 2NS1B 2XLJA 2HHWA 1T9XA 1FERA 3G6ES 1WG5A 2M8HA 1IM6A 4W90B 1BLUA 1N33J 2CJKA 1RT5B 4A47A 3V6JA 2ZOMA 2RKIB 3IR6B 1X5OA 3EM1A 3MPWA 4U96A 1KLMB 3HFVA 5EWFA 2G0IA 1GQEA 2FJXA 4HKQA 1AZSB 2NPIA 2IAJA 1QLNA 3FBEA 3H8YA 3AFGA 3E51A 4C7QA 4N47A 1M5SA 4ZOSA 3PJ9A 4RW9A 4Q43A 1MWZA 4NZ0A 2BDPA 3BKUA 5LXRA 4EO8A 4AE5A 2AMCB 1OQ6A 2VL1A 3S6EA 4EGLA 4F4YA 4LF9J 5CYJA 5LJ3Y 4DG1A 1SJ3P 3T1HF 2LCWA 4C11B 3KHHA 1U47A 5ETSA 3KLGB 3QIPA 2RU3A 4UUWA 2E1RA 1DURA 2QSFA 3LALA 5HMWA 2XWXA 3VWSA 1UZHA 4RUHA 3CC7S 4KTQA 2J0XA 3N0VA 1VDHA 4DX8H 2ABYA 5GMKa 4X4SA 3M05A 4HDHA 4S0MA 4I64A 1DY3A 5KFUA 4K8RA 2HFVA 1U02A 1HHTP 2F1FA 5T7LA 1SH0A 3DOLA 4JP8A 1YIJS 4WFNQ 5ETKA 2HNYA 4WK3A 3MMAB 2V34A 4OI6A 2Y1IA 4JI6F 5KG6A 5HMZA 1VR6A 4KR0B 1V5VA 3G71S 4UQTA 3KG0A 2DD8S 1O0PA 3G87A 1W7WA 2VA3A 3M8WA 2HFOA 5LMNF 4PXBA 1UFLA 2VICA 1NK4A 2VC1A 4M94A 1RBLA 4DPOA 3I5BA 4FVMA 2MZQA 1HWKA 2HRYA 5KOXA 3HSZA 2QLJB 3OFFA 2IRUA 2W8KA 1UEVA 4DZDA 2NPFA 4R8UA 3H7HB 3OL8A 3M2RA 2J9DE 4V1Ak 1R3NA 1K47A 3UN2A 2HHXA 3MHYA 2MQQA 2OPPA 4ZCMA 3AB4B 5DDRC 1XNRF 1FDNA 2G2ZA 3V6DB 2NXUA 4ECYA 1LOUA 2WOMA 4DUZF 2B9EA 4NCGA 3QGIA 4CQ1A 4U7UK 2V69A 2R8IA 5IWAF 3H5XA 4Y2KA 3MEDA 4N7TA 2DVIA 2L9WA 1JLCB 4OX9J 1OIAA 1ITPA 3T5JA 3N5FA 1GX5A 2JC1A 3F41A 3UNGC 3ZZRA 2YNFA 4ZN1A 4IR1A 2UXCF 4DCPB 3C6UA 3IO1A 2NUUG 2BX6A 5A8KB 4Q8EA 2VBWA 2XMTA 4PWDA 2JVOA 2BA9A 2YX4A 5C24A 2GA7A 3SDEA 4DR1F 3FEYB 1WC4A 5CH7B 1S6UA 1UVLA 1SL0A 1VJQA 4CLSA 3OD2A 2W8LA 3TJ8A 4OYPA 1GX6A 3N4WA 2MY8A 1E6YA 1N88A 1XBWA 1URNA 1R8PA 4WU2A 2ILYA 4TNOA 2EXUA 3ZZOA 2IM2A 4OHWA 2W2OP 1NK7A 1N5YA 3HHLD 4O4GA 3B54A 3OUYB 1WSVA 2VASA 4M5LA 2R7OA 3KLHA 1IKWB 2E9TA 5LSOA 2XTJP 3IWLA 3L3CA 2YKMA 4ZHRB 4WKYA 4CLTA 2COLA 1WTFA 1TFWA 1HARA 4EBCA 3NXZA 3M2VB 4NLWA 4PAAA 1X4DA 2R42A 3HVAA 2LA6A 5FIIA 4WPAA 3I9V9 1VYAA 4V19X 4DQIA 3BBFA 3T41A 3NG8A 2X1AA 1HW8A 5C7PA 2XS7A 1RHKB 4XDCA 1GK8A 3NNCA 4YQWA 5IQQA 2Z57B 2DISA 1EETA 1HMVA 1YHQS 3EYZA 2U1AA 2P5VA 4PG4A 2AYGA 2O01C 3R5GA 3VAGA 3NNHA 1OYEA 2M70A 3PR4A 5I3UA 3TO8A 3CULA 1FNOA 1FNMA 1VC5A 2WAQD 4W92B 3S1TA 4NLYA 2DT9A 2RRBA 5LL6d 2HFNA 1RYRA 4USJC 4ZVTB 1AT1B 2PSZA 1BXNA 2ZJQQ 1X9MA 1QE1A 4LIWA 5CD4A 4ZS6A 2HBYB 1WSRA 1JLQB 2UVVA 1UAWA 1RAHB 2GHVC 3HVTB 3LO3A 3TARA 1UWBA 1NMEB 4ED0A 4KHPF 1FKOA 5B0CA 3UN5A 3EPGA 2NSCA 3BKTA 2A18A 4RUAA 4LFBF 4X66J 3MECA 2XYGB 2KRRA 1IBMF 1C1CA 3Q8RB 1KFDA 2LDYA 2HLUA 2V4QA 2OD6A 2R8GA 3OSPA 1RAFB 2MZRA 5CQGA 2F40A 1QY7A 1SC6A 4MK9A 2DGVA 4DR6J 1B3TA 4CTAB 2OFHX 1TKXA 2C3YA 3MEGB 4IG0B 2PA8D 5L1LA 3HD1A 1VQ8S 4IOAQ 2DNRA 1MMLA 5GAEU 4HHHA 2F8MA 3QGHA 1HWLA 4UW2A 2AEFA 1VRTA 2HQGA 1NKEA 1F1BB 2IMOA 2ATLA 5H1SV 1SH2A 1P6TA 3AOAA 4EO6A 2BQUA 1J5EF 3IBCB 4ED4A 3MM8B 1TTHB 3D28A 2VFSA 4ZCIA 1RAEB 2DITA 3KLEB 4G1IA 1CJUA 2DNZA 2KXNB 4WP3A 2LQ9A 3H2UB 2KT5A 3Q8YA 1DJ0A 1U0HB 4YHHJ 4P2SA 1WHWA 2Z56B 3UWTA 3KHRA 3C3LA 2J9DA 4TLRA 1FFSB 1RWNB 1JLBB 1OY8A 2CJYB 2C3PA 5EWGA 1X5PA 2CQPA 2HBRB 2HHUA 2DPJA 3NLCA 4NA3A 4X4VA 4DPUA 4WIQA 2FPHX 2EFNA 1S5ZA 3BGFA 1REGX 4Y34A 3DOKB 5A8WA 3T19A 2CPHA 4X65J 1YDLA 1IKXA 4ZVRB 2XO6A 5KFVA 4JI0J 3VAJA 2FY8A 2CG8A 4PXEA 3E8OA 4YB5A 3MPYA 4C3MA 4DL6A 4NPOA 1FE0A 3AJ1A 3ILOA 2MLXA 2B5JA 3FCHA 2XSFA 4E98A 2CUYA 3K0JA 1NLKL 1OS5A 2JH3A 2ZOFA 2B56A 2Z2LA 1B4SA 3MCMA 3M6UA 1RT4B 1FKAF 3KJFB 1GTHA 4DV6F 4YFUA 1FTCA 2ZWPA 1RA6A 2ZH4A 1R0BG 1JLGA 1L3TA 2DTJA 2WK4A 2EWHA 2A0FB 2VG7B 3VALA 1DHMA 2RQMA 5J2PA 2XY5A 2DGTA 3ZZ0A 2EFOA 4FDFA 4JV5J 4C8KA 1RTZA 2DEIA 2E7WA 4NLVA 1WG4A 1ZZNA 1R0AB 2L48A 1JIHA 1RT5A 2ZHAA 1R0CB 4JUZA 2RKIA 4X4NA 2F9JA 3MXHP 1EAYC 4WJBA 4OI4A 2OMLA 2LQ8A 1CULA 3HD2A 1HR0F 2EFPA 2UUBJ 2AWZA 5KT3A 2GMLA 2YKOA 4P52A 2DIUA 5D0HA 4USHA 3PKYA 2VG5A 1F5AA 5D0GA 3BB5A 4F26A 3I4PA 3ENWA 3P5TL 1VLYA 3F56A 1YSJA 1YJNS 3JQKA 1CLFA 4TY8B 1NK5A 3N5BA 5B0GA 4USKA 4ZLPA 4C11A 3QYYA 3TWZA 2N4CA 4TYBA 3KLGA 1FNXH 3GFZA 2A3JA 1FJGJ 4HR2A 3H25A 2AW0A 5CCMA 4USWA 4FYDA 4ZA1A 2ZBQA 4YR3A 3SEOA 4ZLNA 2CNKB 2MZSA 4RO0A 1ZM4A 2DGWA 3KUHA 2YH0A 3ZTRA 2OUGA 2ZUGA 1GMUA 3LF0A 1HBOB 3IG1A 5CCLA 3TAPA 1NH7A 5E3QA 1LWEB 3GLJA 3M2UB 3SCIE 2OEKA 3N6LA 1BWVA 1J2VA 1JX4A 4NZ6A 4B3TF 1XIQA 1SL2A 1V3SA 1VGYA 2OEJA 2J7KA 3L7UA 4DFPA 4LFCF 2FC8A 2DGOA 4K5SA 1XN9A 3V4IB 1C0UA 3CGIA 5KFFA 3W9IA 3AAWB 3F73A 5A6WA 3HHLC 2R7VA 3U1MA 3TUIC 1CS4B 2B4VA 3B6BA 4EZ6A 3I0SA 4F25A 2HSEB 3EX7B 4C0HA 1IBLF 1KTQA 4ERDA 3G6XA 1OJ4A 3G82B 3I5AA 5HI7A 3QRPA 4KSEB 3HJFA 5IT0A 3GIMA 4OZNA 1Z2LA 3OTEA 4OZ1A 4KFBA 3MM9B 3FJ2A 1N56A 3QPIA 4RNNA 3BSOA 1IQZA 4X4PA 4TU8A 2GJIA 5L1IA 2EPIA 2AYEA 5D15A 5KG7A 4ZPAA 4UUXA 2YTCA 5HROB 4QPXA 5DG9A 2VJUA 1URRA 4M5IA 3W3SA 4YY3J 2ADBA 4OYBA 3GV5B 4XPEA 2CQDA 3NGKA 1VS3A 2GX8A 4A48A 2UV8A 4P72A 1EB0A 2XHCA 2ZFHA 3D3BJ 3K5LA 1SUQB 1JQGA 4B08A 3Q2TC 3D1OA 3R3TA 3QRRA 2VFRA 3TUJC 2BMBA 2Z8QA 1IKYB 3QGPA 2W7PA 2AYMA 2IRYA 2QT7A 2PIIA 1T02A 3D67A 3BDEA 2ZVIA 4H4OA 3PFEA 4MH8A 5BYSA 4LF7F 1QM9A 1Y10A 2D3UA 2DY9A 2Y0BB 3KK1B 3M8PB 4O3SA 1VQ9S 1L5UA 1VRUB 2H48B 5KG3A 3G8TA 1NDLA 1D9FA 3LA0A 3OUYA 2NZCA 2KDOA 1UA1A 2ALYB 2R8JA 3EGVA 1Y7PA 4KHRA 1W2IA 3SMZA 3GMGA 4I2PB 2CQCA 3C16B 1RAJA 4ZHRA 1YX2A 2HGMA 3WZ0A 3RBDA 2G2OA 2LU1A 3M2VA 4N76A 4DR3J 1PGZA 1S9EB 4LRAA 2AJ4A 1WKKA 2NUHA 3PNIA 3RAQA 5F8HA 3MFHA 4DV5J 2E7XA 2Y1RI 4LF5J 2CYYA 1TL4A 2DIVA 3X3UA 3GPAA 3K5PA 2MB0B 3GILA 1PYOB 2VH7A 2D9OA 4IQMA 4B3OB 1RHJB 2ZH3A 4CLLA 3KFWX 1X4GA 3PW4A 1GXTA 4X2BA 3SBMA 1LW0B 1U1OA 2FIUA 3EVWA 5HQMA 3QWUA 4JI7J 3TX0A 1G4CA 4M5NA 2Y1LB 1XMQF 1KONA 1I6JA 1TMJA 1YQHA 1F5CA 1U1KA 2N3LA 2FB0A 4ECSA 3GIJA 3FSYA 4WYWA 3MR6A 4AYBD 4LSZB 2XZDB 1HPZB 1KVKA 3OHBA 1M5KC 2J9CA 1JLQA 2RNEA 3PYGA 2FJEB 2YPZA 2XMMA 5IM0B 5G4DA 1Y5NB 3QLHB 3KK3B 2DNYA 3OTOF 3HVTA 2YQ3A 2VODA 2HHVA 2VC0A 4ZPBA 3TA1A 2BJ3A 5KG0A 2F4VJ 1RQ0A 3G9CA 1FXRA 3FMBA 3T5KA 2CZ9A 2QLBB 5ADZA 4DV4F 3RU0A 2CNLB 2ZBPA 4OYIA 4JI2F 3ILLA 3JS9A 3K17A 5HQLA 3M32B 1PC5A 3D54A 3H0PA 3Q8SB 2D3OR 2GO9A 1NEEA 1V9OA 2JSXA 3BEGB 5D78A 4CTAA 4EI2A 3G8QA 2NYHA 4IG0A 1RBOB 3MD3A 3G96A 1LWXA 3A8EA 3A8KA 2PC6A 1YJWS 4M63A 1S1VB 5MAOA 2GGPB 4QWEA 1RACB 3P6YC 1UEKA 2EK6A 2AEMA 5IV3A 4KAIA 5KG1A 3GE9A 3LGNA 2KKHA 2KRBA 4NRTA 4ZP8A 3MM8A 4MFBB 1RWXB 1FJCA 4ZVSB 1RUSA 1YBAA 4DV2J 4DHVA 2N4DA 5L46A 2NYIA 3KLEA 2ATCB 1IWAA 1U0HA 2MQOA 2Q3PA 1TL1B 4Q2MA 3OHAA 2KFZA 3W5XA 1JLBA 1MWQA 2MHNA 5GADU 1UP1A 3TI0A 2RF2A 1O51A 2B9YA 4J9MA 1FFGB 4F2RA 3K8VA 1IBKF 5DQHA 3SQGB 3ADAC 3DOKA 5K8MA 3KLVA 2XWYA 2JHEA 2FHJA 3GSIA 1X8DA 3GV8B 1NB2A 2JZ5A 4WCEQ 4ZPTR 2GQ2A 2J0QD 3A13A 4DFJA 4JI1J 4O3NA 2EEYA 2GVZB 3UQSA 4CWBA 3ENAA 2CJQA 4M5HA 3NAIA 5LMUF 3HMJG 3GR0A 4H4MB 1FRIA 1FJEB 3OVBA 2G1HA 1LWCB 3AA9A 5HAOA 4HTJA 2GMHA 4HH0A 2Q6BA 1VQKS 4K0KJ 4NEYA 5AXKA 2X1BA 1H2UX 1F2GA 1K1QA 2HFZA 2IIHA 2C3MA 5L39A 1RT3B 3EGWB 1PCAA 4KRWA 4OZLA 3SCKE 2YKAA 4NLSA 3J81Y 1P9YA 4HACB 3PYEA 1I94J 1BQXA 5M2PA 2VG7A 4OMFG 2GHPA 2ZM6F 4Z7CA 3LAKA 3OJUA 1FRMA 1D3WA 4TLQA 2WONB 1JJCB 2AJ2A 4NLQA 3TR5A 2B4PA 2HWHA 3D1HA 1AW0A 1R0AA 1UJ5A 4GC7A 3GJTB 5KT2A 1LEOA 3G4SS 3NP5A 1NJZA 1QD1A 4MMOA 3BDPA 2EK1A 1WACA 1ACMB 2BJ8A 2HQCA 3OFHA 2MKSA 3P5BP 4BWJA 5B0BA 4ZDNA 1QUVA 1Y3JA 3PZPA 3NY0A 1KD1T 2I2YA 4PPDA 4IFYB 3AB2B 2NSBA 2GFFA 2R9LA 2FJWA 3D3CJ 5G0RA 4CLWA 4OHVA 1JNRB 2IJNA 2XQCA 4P73A 2MZTA 4TY8A 2DXDA 1FHTA 2YWEA 3SCLE 5D4LA 1RLCL 2EC2A 3CJKB 3W61A 1PO6A 4K4YA 4Q0BB 3T5HA 4J9RA 3T1HJ 2ZC4A 1VBXA 2R7QA 3GSDA 2AGQA 2VFTA 1CEZA 5EX3A 3C6TB 4K5RA 4IH5A 4Z37A 1NRKA 5CYMB 3BSNA 1SB6A 1Q8KA 2I0XA 2GC8A 2Z2MA 2HFUA 2Y0SD 3CJ5A 3QZ8A 1NO8A 4PYDA 3IWXA 4DPWA 4LF2A 4IH6A 1HBOA 3GYNA 4FKXA 3UR3C 5KFAA 2KM8B 1LWEA 3M2UA 4G65A 2MYFA 1KEKA 3LPEA 4JBCA 1A7GE 4LQ9A 7FDRA 2CVEA 4RBTA 3ET6B 3LOUA 1MSWD 3ZZUA 2DNLA 2ILZA 2QIFA 1FXDA 3S7RA 3IGNA 2BJ7A 3MM7A 1NHVA 3TNVA 4JI6J 3EVOA 3V4IA 4N41A 4ELTA 4WU3A 3TEHB 2UV8G 3BM7A 5DETA 1QDUB 3DHXA 1HBNB 2KJVA 4F4AA 2DKOB 1U45A 4ETZA 1CS4A 3UPFA 2AGPA 3VQTA 4CRJA 1VLOA 4OYOA 4WTOB 2VONA 3EPIA 4Y0FA 5DM7Q 3K7RA 2QFIA 3Q8VA 3DU6A 5D0EA 3HX9A 1N36F 1XJWB 3SSQA 1BHNA 1ZA2B 5LJ5Y 2Q43A 2RJZA 2C2RA 2J0WA 4OZ0A 2VBXA 4Q44A 3T9NA 2YKPA 1FRLA 2R2SA 2RUSA 1N5TA 1LKZA 3L7PA 4OYAA 1RA7A 4X4OA 2QX0A 2PA3A 3W1YC 3MM9A 3GIKA 3GP9A 4ELVA 1YRXA 4P75A 1APSA 1FEHA 1JK9B 4ZP6A 1GFWB 4J7CA 2RILA 3OLAA 1ULRA 1KQGB 3PO4A 1XNRJ 3AXKA 2ZVSA 4KGZB 5HROA 3HCXA 3NWRA 2IY5B 4DUZJ 1S6QB 4USMA 3BPSP 2HWIA 4DSJA 1Y9OA 2R2RA 5JUMA 5IWAJ 4WXWA 1HQ2A 3VZIA 3KLFB 3CCVS 4O3RA 1U8SA 3R1LA 1ELOA 1SUQA 2RQKA 1FVQA 4Y2MA 4D3GA 2KB2A 5K14B 3G86A 1IKYA 2CQ3A 2C2EA 2UXCJ 3NAHA 2E29A 4PXDA 3SI8A 4L74A 3UNYA 4BDPA 2IA0A 2HVIA 3AQPA 5DJBA 5IFMA 3C66A 4DR1J 1T3OA 2OEMA 5GAEI 2R7XA 4J9SA 2BQRA 4A8QA 3M8PA 2DEJA 1VRUA 1YGYA 4A4JA 2LXIA 3NRBA 4MK7A 2CPIA 3WIUA 5LT5A 1EP4A 3B4MA 4I2PA 4IG3B 3I4HX 1UL3A 3R7NB 2E5JA 3FDSA 2O5DA 2XGQA 5SZTA 3AOCA 3MPUB 1RXOB 3IXQA 3RB0A 2JFKA 4DXLA 1S9EA 3CB4A 4DV7F 3QT7A 1PJ6A 2Y9HA 4JI4F 1AYEA 1HBUB 2XS2A 3MM6A 1S9GB 3CVKA 2YX7A 2BKPA 2W2MP 1RYSA 3QO9B 4LRCA 4B3OA 1OPZA 2ZEJA 2XSJA 5HSPA 4K4WA 2H65B 2MTLA 1JMTA 4FNHA 5DS7A 4F50A 2RDDA 4RW8B 1Z1ZA 2HLTA 3J81j 1LW0A 2OIHA 3RBEA 5LM7E 3MF5A 1MU2A 3OV7A 4HI2A 1S1UA 3MEEB 4DV0F 5KFIA 1H73A 1HA1A 1K73T 1GT8A 1H98A 4OLPA 3UD4P 2SXLA 4C9DA 2MXYA 3RB4A 1HPZA 2KM8C 1S10A 1K44A 1JLFB 2DGUA 2YNGB 2EKNA 1N5SA 3DOMB 4C8YA 5IM0A 1UJ4A 4KJIA 4LVOP 2FY1A 3QLHA 2H1YA 3KK3A 1Z4UA 3D2WA 4MJKA 1Y4ZB 1X0PA 2CXEA 2RT3A 3R5BA 4P74A 2BRKA 1X31C 3P8BB 5B0FA 3CJQA 3NBPA 4F3MA 1LV5A 4ICLB 2VQEF 2BQ3A 4DS4A 1T0TV 4GO5X 4KHPJ 1B7YB 4MIWA 3V4MA 1KN6A 3CDEA 2F5GA 1YBTA 4LFBJ 2K7JA 1TKTB 3QJLA 3OTCA 3CEDA 4DR5J 4AQYF 2LQ5A 4CP5A 3M32A 5F8IA 2KXHA 1IXKA 2K3IA 1LK7A 5IS2A 1QAJA 1OO0B 2IAJB 4CCHA 4I2QA 2M8DB 3BQ2A 3BBCA 1MROA 4RW9B 1S1VA 4CI0B 2GGPA 3JQJA 4ECQA 2Y8WA 2JEGA 4ZVOB 3D5MA 6AT1B 4E2FB 3M6WA 5K9FA 4AT1B 3PO5A 4ILRA 2U2FA 5C2GA 3BBBA 1J5EJ 1EARA 4MFBA 1UFKA 2DR6A 2CQ0A 4DG1B 5HATA 3CD7A 4HDGA 2JLGA 5B0AA 3FNNA 3UN3A 4KO0B 4EWTA 3VAIA 3RB3A 3GCWP 1NNDA 2DHAA 1TL1A 2WBRA 2MKIA 4ES1A 2HS0A 2V8DA 3S8SA 3ETMA 5FLXY 2V8HA 3ZZTA 1UVKA 1LFPA 3TZZA 4OZ2A 3HT3A 4HEA9 2DB1A 3R5CA 4L76A 4CT9A 1H6KX 2GJ2A 3SQGA 5T7LB 4ZP7A 1L3SA 4ZK7M 5B08A 2CQGA 3W60A 1T9VA 2CJXB 3CO0P 2ADCA 3CJTA 4CT8A 3FEZA 3US5A 5J1EB 3HHNB 3HF5A 2HFSA 3C2PA 1FEEA 2DNMA 3MDFA 5C42B 5GAHU 4DPTA 2GVZA 1ZZFA 1AFJA 4ETXA 4IO9Q 2I9SA 4H4MA 1KOHA 3DFEA 3W62A 3PKMA 1LWCA 3PX0A 3DYAB 1SL1A 2WB4A 2FTRA 1T03B 4WYLA 2JLEA 3LPYA 4R8UB 1RT3A 4DV6J 1Q0NA 5BJRA 1KHVA 3H4BA 1FI4A 4FF4A 2ZH6A 1X9SA 4YOEA 2MZ1A 4G6VB 2K06A 2IBOA 5E0OA 3KXDA 2C42A 3FQKA 5KG2A 2C3UA 5KFYA 4GO7X 2DRAA 4OZ5A 3OR1B 1BMQB 3CMES 1M5HA 2X1FA 3BR9A 4IR9A 4YUDA 3IM9A 4WFYA 2HAFA 2WONA 1KQFB 2AU0A 1NPKA 1PBAA 2H54B 4NZ7A 1FO1A 1HBMB 2AJQA 4RNMA 2G13A 1P27B 2V5HG 2MDAA 3K5MA 4NXMF 4G1QB 4IUFA 4BBYA 4N8OA 2ZDPA 4TN2A 1YJ7A 3J7YU 4DX6A 4NCBA 3ELHA 3T6BA 3IFEA 1FRKA 3O1LA 2W7OA 1RLDA 4RW4A 3SDEB 4NA1A 2GIFA 2YQ0A 4DQPA 4W98A 1HR0J 4IFYA 2CPXA 3BO4A 1E6YB 3PG9A 4QR2A 2DR8A 3GWCA 1VFJA 1YLXA 2VFVA 5ITHA 2K3KA 3A4TA 2YNHA 3I87A 1OY9A 4CO0A 4OX6A 4FYYB 4EUVA 4OI2A 5IV4A 1N5YB 5DQGA 1Q5VA 1R8BA 1F3FA 4YP3A 3SSRA 4FNIA 2FLOA 1XQIA 4JB8B 3CJKA 2ZZTA 2YWKA 2P6TA 4DCJB 5KT4A 4PCQA 1T9YA 4I6WA 4Q0BA 1HD0A 2YKMB 1KKHA 5LOQA 4LR9A 2WSEC 3LQVA 3RB6A 5DLFA 1XR5A 3GONA 3GV7B 4NLOA 1U7LA 2GQCA 4OQJA 2E5IA 1AUDA 3CNQP 2E1PA 5D4OA 2XBPA 2QC3A 1C1BB 1S79A 3BF4A 2O67A 1J5OA 4OI1A 4H4KA 2KG1A 3BO3A 3FGVA 2EI5A 3CSKA 2M52A 2V6AA 1H38A 3HJVA 1Q53A 2WSCC 2V8VA 4Y65A 3NOGA 4B3TJ 5AT1B 3O8WA 2KT3A 4QZVB 5I3UB 2WCXA 2WW4A 5C2CA 3CCJS 4Q7AA 2GIRA 2XLIA 4LFCJ 2AJ0A 4KKOA 1ZS6A 1VQYA 2DXFA 1X4EA 4QR1A 2MGZB 1Q7LB 8AT1B 2B3TB 3PW2A 2B6AB 4DR4F 2B8PA 2FVCA 4DFMA 4QU6A 2MZJA 1U2FA 5J1NA 4I4BA 1M5VC 4X64F 2DNNA 3OFEA 1WOSA 5K8NA 1P1LA 4GVLA 1P9QC 1GTEA 1RZMA 4DSKA 1IBLJ 2YKNB 3LGHA 2AYBA 2GIQA 3MOJB 2UVRA 3GG1A 1X7VA 1Y5IB 3L7OA 3L95X 4PG7A 3R5DA 3V6KA 4EK2A 1FTRA 4WBFA 3OJSA 4ED5A 4ZJLA 1TVRB 2VA2A 4UZCA 2C2MB 1HNWJ 2GAGC 4OFZA 1S6QA 3NGRA 4DUYF 2BE9B 1YKWA 3DLEB 3NKYA 3SYZA 2YWFA 2CVIA 3QSYB 1UPMB 1KC8T 1M1KT 3KLFA 4WKRA 1NPRA 5D4PA 3DN9A 3LWMA 1SVDA 4K4VA 4EZ9A 1VRTB 1J27A 1RAAB 3NGSA 3BREA 3Q86A 5K14A 3TVYA 3FSXA 4LBPA 3G2XA 3BH7B 5KFTA 5HANA 2CAJA 5A2QY 1X4CA 1EX8A 3H20A 3RG6A 3POTA 1K1SA 4TQSA 4E0DA 1U25A 2Y1JA 2L08A 4PQUB 4QJVA 4LF7J 3IBFB 1SC3B 4ZPDA 2CQIA 4IRDA 5KT7A 2Z0GA 1L3KA 4YB7A 2FZKB 1Q1KA 3NMRA 1XR7A 4PEOA 2AV5A 2FLPA 1HNVB 2OD4A 4IG3A 4QW8A 2IVFB 4U6PA 2QYGA 1S1TB 3NS7B 2ROGA 1U24A 4FBUA 5KFRA 4F04B 3JSMB 5U47A 2D69A 4ZN3A 1I3OB 1W26A 3CJ0A 4ZLLA 3IBWA 5EGYA 1HBUA 3RUBL 4P9SA 5M2UA 2RIJA 1SC1B 5GADI 4R5PB 1IKXB 4DI6A 3QO9A 2OI2A 1RWWB 3AD8C 5D6GA 4P6QA 4DU7A 1RABB 1Q16B 4C98A 2MKJA 4ECXA 4ZVPB 4RNHA 5KTQA 3C8YA 2ZJRQ 3RTVA 4ER8A 4F0MA 1ZAWA 1C4CA 3FBBA 2B5JB 3FSIA 4PR6A 4A8KA 1FJ7A 2HIQA 5EWEA 1JXLA 2M0GB 4K50A 3GIRA 2MQMA 4DPXA 3MEEA 2VOPA 1XMQJ 2ZKTA 1H2TZ 2JRSA 2WHOA 4Q45A 4WIIA 1FVSA 3LP0B 2J0SD 2E9RX 2BOAA 3SFGA 1JLGB 2ZE2B 3RYLA 1G1XA 4DQSA 1HLWA 1QSLA 3AXMA 4OHYA 2J7UA 1S4EA 1NPPA 3DOMA 2APOA 3D0IE 4CM0A 4UY85 5F0WA 5ETOA 4KIAA 1WEYA 3PX6A 4C8OA 1WC6A 3LTOA 5J2PB 1FWPA 3OTOJ 4ATNA 2UXBF 1WEZA 4USUA 2V8PA 2XYHB 4RL1A 2E66A 4ECWA 1S1XB 4ANEA 4RKUC 1TKTA 2ZH2A 4DV4J 5E3CA 3LH2S 4P2FA 3CCWA 3BR8A 4LBIA 2H4YB 4JI2J 3M8SA 2L9NA 2BE2B 2NLWA 4ZMMA 1CULB 1JJHA 3ZC4A 2RB7A 5KFLA 4HT5A 1NZAA 3E01A 4LF4F 3TA0A 4DL5A 3QJJA 1OMSA 2VG5B 4RX6A 1FD8A 2OPRB 2QSWA 2BZ2A 3UDCA 3TW0A 1FRXA 2XC9A 2N7YA 2IBKA 2W01A 3CMAS 2HURA 3D6FB 3WHIA 3BQ1A 4JV2A 1Q7YT 2DO4A 2VQFF 2QL7B 3UCGA 2M3DA 3Q24A 1UEUA 1HNXF 2FC9A 2Q1LA 4KO0A 2ZZNA 2HNZB 2ZBCA 1DTQB 1DLOA 3EUNA 1HNZF 3D6HB 2HIYA 4DU8A 2VBYA 1SI9A 3CMQA 4WE1A 3R6LB 3R2DJ 3ZTOA 1RHUB 2ZJPQ 3UVJA 1RSCA 3JAMY 1Q4RA 1TFYA 2DCLA 1VJWA 3PIPQ 1MN7A 3IG1B 1UZDA 4QYRA 4RU9A 4O3PA 5CD4H 1KVIA 2ASDA 2MJUA 4IQXA 1H72C 3DRYA 2L9DA 4PABA 2JC0A 4NCAA 4Z7YA 5D3GB 2IM1A 1VQ4S 5J1EA 1ZPWX 1YJTA 4YHHF 3MI7X 3KHGA 2JJ4D 1C0UB 1SQEA 3MPDA 5E2QA 4ED1A 5C42A 1WNEA 2UUAF 4L73A 5KFOA 1L3UA 4RJVA 1U1NA 3I0SB 1D9DA 3A8JA 1CC7A 3DRXA 2XZTB 2W24A 2MLZA 5LMUJ 2OH2A 3DYAA 3MCNA 3OBIA 1S99A 3UD5A 1T03A 4EBEA 4ED3A 2B4UA 1O5JA 4YR0A 1F6TA 2G2YA 4FF1A 1TZ0A 4PUOB 3TUZC 1Q78A 2CZVC 4RUBA 1WKJA 1N34F 4UZBA 4QIGA 4KFBB 1PJ5A 3SFUA 2DPIA 3A12A 2IHR1 3OR1A 3D1QA 4Y28C 1VCTA 2LA4A 1IUJA 1RT7B 2ZM6J 2H9ZA 5D8HB 2MKHA 3CDWA 2V50A 2YWHA 3FZ2A 4URGA 2NR0A 5EN1A 4PG8A 4LF1A 4J9KA 3JQMA 5CYQA 1MW7A 3W9HA 4J9QA 1HBMA 2AZ3A 2FJBB 3EGZA 1XNQJ 3HKZD 1S6PB 3WX4A 1KBRA 2CFXA 2DGQA 4G1QA 4PPZA 4B3RF 5KOWA 4TU7A 3IRXB 1KDNA 2DNOA 4QPTA 4Y00A 1RCOB 4ZVFA 4H4OB 4U67Q 2FVRA 2HVZA 4WP9A 5HVGA 2OHDA 1WI6A 2I5JA 1YRTA 2GAHC 5H9EK 3I9ZA 3TYTA 1SKSA 2XMKA 2E1MC 1B70B 2VB6A 2ZBRA 5THWA 5SUHA 3FC9A 2BRLA 2NZ4A 4ECVA 3QAEA 4QCLA 3R97A 2B43A 3V2UC 3GTYX 2VBZA 4QIEA 1HHQA 1I5OB 1RJJA 4LIRA 2LLZA 2UUBF 2HHPA 1CSJA 1KNZA 1TMMA 4ZVHA 2D74B 4K59A 2FDNA 2RAQA 3VR1A 3KDNA 3H98A 1RT2B 2I38A 4J9VA 1C1BA 2Y3YA 2FD2A 2OPQB 2PEHA 1EHWA 3ISND 2P6SA 4ZP9A 4BS2A 1Y3KA 1PG5B 3JSBA 2XGPA 1N32F 1IVZA 5BXIA 4DV3F 1Z2ZA 3N9UC 3DHWC 4BC7A 4UTGA 3EXYA 3M8QA 2KL8A 2MQLA 3MCOA 1FDAA 1Q8IA 3V81B 2GNKA 3MMBB 1JNZB 1PAEX 2ACMA 2I8EA 4OX7A 1ZBTA 2BM1A 4GKJF 3CTRA 3DLLQ 2HPUA 3MM5B 2FZGB 2MGZA 2IM3A 2FLLA 1O6XA 4AL6A 3THTA 1F3VA 4I7FB 2BE7D 4QYZJ 2B6AA 2QMUB 1SJQA 2HGLA 2MSTA 4KGXB 2YKNA 1Q8BA 3WC2A 4DN0A 3OXGA 5GAGI 3HO1A 3DKDA 2FGOA 3J81U 3TJ9A 2PDAA 3TQEA 4M95A 5CZVA 4P71A 1TVRA 2HBZB 3CJSA 2DNQA 2JEFA 2V67A 4FN5A 1XR6A 2QG9B 3KJNB 2VPWB 1NJYA 2M88A 4X4QA 1D9AA 2GZOA 5KT5A 3RGIA 4QYZK 3DLEA 2KHCA 4BCAA 4MKVA 4J91A 3HM9A 2CQHA 3J7A1 4W4MA 1NXIA 2D41A 3J80Y 1AXQA 4DDFA 3VCDA 4F4KA 3FEXB 2KZZA 3FRYA 4OV6A 2EFQA 4RW6B 4F3OA 1FCAA 4X4UA 1DBDA 1U2CA 2DR7A 4LFAF 2JOQA 1QVGR 1BQMB 2UUCF 4ZVEA 1QSYA 1ICEB 2K1RB 1VC0A 2C3OA 2UUWA 3GYXB 4OL8A 2OTLS 1IM4A 2YBVA 2RMLA 1S9FA 1G6BA 2HRUA 3A3OB 1UVIA 4PQUA 1B64A 1VQMS 5F3ZA 2ZOGA 2CQ4A 4JI8F 3AJ2A 1NH8A 1WOOA 2IMWP 4B9SA 4XK8C 1OPIA 3W7BA 1TL7A 4PZVA 3HXMA 4YB1P 3D68A 3M8ZA 2DHSA 1VBKA 2VG6B 4DL3A 1KVJA 1HNVA 3W5ZA 3H42A 2P9GA 3DXSX 1GAOA 5EUHA 3HHLB 2ZITA 1S1TA 1VRQC 2K8GA 4Y2AA 2RF2B 2BANB 3JSMA 3MCSA 1S1WB 1TL3B 1X4FA 3QAUA 3ILIA 2HZVA 1TV6B 1S59A 4DZ6A 4DV7J 2KT2A 3EMTA 4YMEA 4JI4J 2CQ1A 1DARA 1HQUB 3ZZZA 4O3QA 3DRRB 4AD6A 4R5PA 1ZH5A 3ETOA 1XMBA 4TU9A 3HPOA 1RISA 4G3IA 3M4XA 1U1RA 4KQZA 1VQNS 3ZTPA 2CPJA 2NXCA 2OFGX 3EZOA 2AX0A 2YKQA 3T9ZA 4DFKA 4RBUA 1TKZB 3W2WB 4YEAA 2HVHA 3C14B 4LF5F 1IR2A 1TR0A 4NOHA 1ZM3A 1RT1B 4ZPCA 2BKNA 3LP0A 3ILJA 5K20B 2AP6A 4KC5A 2ZE2A 4ECTA 1M1GA 5IOLA 4C48A 1NSQA 1BWEA 2YX1A 1FFWB 3PHEA 5GVQA 4XPCA 3R2CJ 1WORA 1RE1B 3ICLA 3W66A 3KLIB 3VHQA 2DR5A 5J2QB 3PJWA 5A8RB 3I5CA 3NS6A 4DSIA 1WG1A 2HQFA 3W64A 2FHOB 2VQEJ 1S1XA 3SV4A 1KSPA 1NDKA 4O44B 2O3DA 3C46A 1BQNB 3HFZB 1WOPA 3B4DA 2HW3A 1A0OB 4RU2A 3OPKA 2VJVA 1SIWB 3TUPA 2HG4A 1R89A 2KN4A 4AQYJ 1YWXA 4XTTA 3G8SA 3D9BA 2BE2A 4C0BA 3Q8PB 4DF4A 2LP4A 2CNOB 4LF6F 1K0TA 2QLFB 3LWLA 4CLPA 1ZM9A 4H54A 4NXNF 1HKAA 2I1RA 4Q2LA 2DGXA 2N82B 2OPRA 4QR0A 2ZHOA 2QA4S 5G0RB 3J7YI 2PFFB 2J6SA 1TUGB 4DCOB 2EBEA 5K8PA 4KE5A 4JI5F 2CPFA 4HH1A 2P9EA 4WZMA 2BBEA 2CJBA 1WD6A 5DG7A 3VGUA 3ZFVA 1GMWA 2DH8A 4HT7A 3RRGA 3CJ8A 2PI5A 4MIBA 5K8OA 2CG4A 2BEFA 2HNZA 4C0OC 2BYCA 1DTQA 1QVFR 2V2ZA 1K0VA 1FT8A 4WK1A 2WB1D 5IT9Y 2V68A 3H5YA 3CJRA 4I68A 5I42A 1D8ZA 2E5LF 3HHEA 2P9CA 1MWYA 5F9LA 4OI0A 2GW8A 2PO4A 5E33A 3OW2R 3M9NB 2MJNA 2E5HA 3G6VA 4DR2F 5D3GA 2EFGA 3CCTA 3IAS9 2JEIA 2ROPA 2QV6A 1UJ6A 2KYZA 3PACA 2HVDA 3QQCD 3MM7B 2WZ1A 3N6NA 3P3DA 4CO3A 2BR0A 1NB7A 2R7SA 3FVYA 1U48A 2IA6A 2R7TA 4B9TA 2X3GA 1LXNA 1UW9A 3I32A 2FJDB 4J37A 1HL6A 4U9RA 4GMKA 3CT9A 4CIOA 1Q82T 3MMCA 4I6YA 2QE5A 3D6TB 1B7FA 2XB2D 3DRPB 3KYLA 3R8YA 3NCQA 1VK3A 4NMLA 3OL6A 3ULHA 4DUTA 1N54B 3ONQA 4WP8A 2HS4A 4PUOA 4FF3A 5C25A 3L4BC 1WHXA 4RLEA 4RW7B 4BWMA 4KPYA 2DCUB 1GXLA 4UOFA 4WFZA 3OSNA 1TU0B 3W63A 3ITHA 4F02A 2D3O1 3ISNC 2UU9J 4CLUA 3Q8QB 3M9OB 3R27A 4DWIA 1X4AA 1RT7A 1AUSL 4CO1A 3VTIA 4J9NA 2JL9A 4GVBB 5DDOC 1T9TA 4L75A 4LSNB 1KR4A 4D3HA 3BJYA 1YVFA 1VIOA 2MKYA 2RRNA 1Q86T 1KS2A 5EX0A 3AQOA 1S6PA 1HYSA 2NXNA 3PHTA 1RWKB 3DI6B 4RUCA 4C97A 3ZZPA 2KHDA 3BZQA 2QLWA 4F4XA 5HBMB 4NXMJ 2YY3A 1TP7A 3GYGA 1E6VB 1FDBA 2YNIB 2IDLA 3H2LA 3IRXA 3IWNC 3JYTB 3RR7A 3RBZA 2QN6B 1FK9B 5GMEA 4B9LA 4M5MA 1R8AA 4L3NA 2IYGA 4OJ3A 4EEYA 5AJ3F 3SXLA 1KFSA 1NK8A 3TZYA 1CC8A 1ZAVA 2KYXA 1Y0HA 4N8NA 4NRUA 2WW8A 3C15B 4XO0A 1G3OA 1F9FA 1DFDA 1R7IA 3HVRA 1ZYQA 2LDIA 4I69A 2ZNZA 1EP4B 1F0XA 1S57A 1VQ5S 2A1BA 1TKDA 2A6OA 2OO4A 3R7SB 3LP2A 3W5YA 4XAKA 4RNFA 2QO3A 3BH6B 4OYWA 2XY6A 2D3ZA 3K57A 1R8CA 2J7WA 1Y11A 3MM6B 8RUCA 4DQQA 1WC3A 3D0GE 1WDDA 4WWSA 1RT2A 4OHZA 4NYOA 1CJKB 3VVTA 2POKA 4FZVA 1DRZA 2OPQA 2G1DA 1YRUA 2XSJB 5FLXU 5AXLA 2P2CB 4J9LA 1NKCA 4USVA 3D4JA 2ASJA 2HMIB 4NA2A 2FVPA 2BVZA 2FJAB 3EZ5A 2EG1A 3N01A 1HNIB 4ZPWR 1HWJA 3AY0A 1CQNA 3PTWA 3V81A 2HGNA 2J9EA 1DTTB 2FQQB 2E7VA 4IOBA 3MMBA 1S12A 1MU2B 3GCXP 2BJ1A 4CNYA 2C2NA 2BOPA 1S1UB 3MM5A 5L1JA 2Z2YB 2RSQA 5F8NA 4CDIA 3TJAA 7AT1B 2ZH7A 2Z58B 3F0NA 4I7FA 1U1QA 3R1HA 3RAMA 2V94A 3CDUA 4FYWB 4DR4J 3M6XA 4X64J 4HHUA 4C8ZA 4HHJA 2F3JA 1AB8A 1PAUB 1JB0C 3T6JA 1HQEA 1SQFA 2FLNA 4KH1B 1JLEB 2ZH5A 3NBPB 1OQ3A 1S49A 3AT1B 1GH8A 3MPVA 1SIZA 2QRRA 5DRKA 5MLCV 5BYRA 1SC4B 3TAMB 1Q95G 1PC4A 4DL2A 3TAQA 4KB7A 2BACA 3BSCA 1RAOA 3BV8A 3ZO7A 3IR7B 1XC9A 2OTJS 1RHMB 3OL9A 2BJEA 4CYUB 3P45B 1UCNA 4DUYJ 3DLKB 3H90A 4UOGA 3CC2S 6FDRA 2CPDA 1G7CB 4I2QB 5CAAA 3M9MB 2XYPB 4C8MA 1MROB 4RW6A 5RUBA 1RT6B 3KUGA 1BQMA 1RAIB 4DX7A 1QJHA 1QAIA 2K1RA 2XMUA 3DGPA 2AIRB 3JB9k 2EC0A 2MKCA 1RAGB 4TQRA 5JVGQ 2HNDB 3RRKA 2KFYA 1YK9A 3JTOA 4ZCLA 5L9XA 2RVJA 2J6TA 3TP2A 2J76E 3MAAB 4JI3F 4ILLA 5M2RA 3SIPB 2VG6A 1CPZA 3P96A 4WTYA 4MYUA 4XDDA 2DYAA 1PKUA 2PI4A 2MY7A 2R3VA 3HHLA 3O5TB 4ID8A 3F44A 3ZNUA 1NJXA 3C19A 3PY8A 2FZCB 2W7AA 2BANA 4ZIVA 5JMNA 2OSQA 4UF4A 1S1WA 1TL3A 3GU0A 5LXYA 3I56S 4HI1A 1M0SA 2WRMA 1XWLA 1H7XA 1TV6A 2H5EA 1X5TA 1R6YA 1CJTB 2V2VA 4B9VA 1HQUA 3VGSA 3DRRA 4R0EA 3T1YF 4F36A 1RHQB 2HK3A 2CWXA 4CLFA 3ZTQA 2XY7A 3CO9A 2EKYA 2CA9A 3VZHA 1WTBA 2O66A 1TKZA 1B99A 3W2WA 2W9BB 4K2JA 1JWWA 3CC4S 2KG0A 3EXCX 1RI7A 2FHJD 1LK5A 4LF8F 5IC6B 2UXDF 3C14A 4R25A 2C2KB 2R2TA 3KKFA 5FDLB 3AJDA 5KG5A 4ZLJA 1RT1A 5IZHA 4C6AA 3QATA 1WDTA 1N48A 2FVSA 3N79A 4TKTA 2IVYA 1VBZA 4EMDA 2UVUA 4FS1A 1B0PA 3GJQB 1U26A 2R8HA 5A76A 2IFXA 3TOQA 1RP5A 3K59A 1SJ1A 3KLIA 3JXOA 5KFEA 5J2QA 2KVIA 3BKFA 2RUGA 5A8RA 2K2PA 1X0FA 2PMWA 1RTJB 3M7VA 2UXBJ 1TK5A 4G1PA 2PD1A 3GR1A 1VQPS 1D8YA 4O44A 3M8RA 3J7ZT 1BQNA 3VAKA 3IR5B 2IJFA 4RZRA 2BM0A 1SKUB 4ED7A 4RR5A 2QEXS 4LT6A 1ZOTA 3PDNA 1WKLA 4RW4B 2H4WB 3I55S 2HK2A 2Y8YA 1X60A 3AH6A 2OPSB 5L38A 4LF4J 2LU2A 3GFXA 4I0WA 2FHKA 2KXFA 2YNHB 5HMXA 3KG4A 3OVSA 3RRHA 5KFDA 2HQDA 2ACYA 3PCOB 2EBGA 4DR5F 3TA2A 3PEJA 4EFAC 5T14A 1Q5YA 1N6QB 5KFMA 2F4FA 5A2QU 3GJRB 1V6HA 2B0GA 2HQ3A 4LSLA 2VQFJ 1HNXJ 5F8LA 1R31A 3WC0A 3IP0A 3U7JA 3EDRB 2VIHA 2W9CB 1LW2A 2RQ4A 3DLGA 1H7WA 4PRFA 5ETPA 1HNZJ 4IFVB 2AEJA 1HWUA 1U8WA 3ISZA 2G4BA 2IC3B 2W2PP 3FRZA 1EQMA 2Q6CA 1J5OB 2OELA 3NMAA 4CZCA 1YG0A 4QU7A 4HLBA 3HK2A 1I1GA 2VDHA 5F3TA 2JNJA 2LXFA 2LFVA 4F67A 5KFXA 2LECA 4B9UA 1QAYA 2CADA 1EKSA 5K5MA 3QSIA 3QJPA 2X51A 5ETLA 5KG4A 3PVXA 4U7CA 1T9UA 4WFXA 4KKOB 3FBFA 2EG2A 1SPBP 2K7KA 1U6FA 2UUAJ 4M5GA 4AXJA 5LMNJ 3K2YA 4CLKA 1WC0A 2V63A 3DRPA 4LQ3A 3CE8A 4Y2CA 1IKVB 3MR3A 5J2NA 1S4FA 3FFIA 1FF2A 2W2QP 5DQIA 2MHEA 2W25A 5D0RA 4RW7A 3I0RB 4F3QA 2BUNA 4R0JA 1N34J 1RTHB 1PILA 3UDEA 4NE9C 1N5QA 1S6OA 4GKKF 3MZIA 2DK2A 1ZM2A 4X4TA 4DV1F 4AL7A 4GVBA 2HHHF 3HZEA 5CABA 1SBRA 3OT9A 3J7Z5 2VPYB 4LSNA 1AFIA 3CCLS 4RBVA 3MUMP 3DRSB 2FJVA 4DSLA 5CZXA 2ZD1A 2VPXB 3H4DA 2VDIA 3VF0B 3DI6A 2JLFA 2Q79A 3L9ZA 3NGUA 3OXLA 1YTYA 4IYQA 3DMJB 3OFGA 5J2MB 4UT4A 2M4MA 5HBMA 4OJGA 2HBQB 1E6VA 1LWFA 5DM6Q 1F9HA 2YNIA 4DSEA 2DHXA 3WDOA 3DM2B 4KV8B 3JYTA 4ES2A 3PW7A 3Q22A 2XZWA 4B3RJ 3HT0A 4A8SA 1FK9A 3POTB 2H5JB 5HK4A 3FMWA 5F8GA 1PYTA 3KWMA 4OJHA 2PMZD 3QT5A 4K4UA 5EDWA 1HW9A 4M5DB 3JSYA 2DH9A 3NCRA 4K4XA 1N4LA 2V0NA 4K4ZA 1EKRA 5KFWA 4C3LA 2C2DA 3C15A 1HI1A 2F63A 4ENOA 2LEBA 2XLKA 4DR7F 2RU9A 3ZXWA 1X4BA 1KLMA 1O8BA 2XCAA 3BN4A 5F41A 3CJ2A 4A8XA 4DMZA 4NLTA 1U6ZA 1AZSA 2EVZA 1FD2A 3HI9A 4FS2A 2GV1A 2ZH1A 4ELUA 3KK2B 5E3RA 1CJKA 4A46A 3P4UB 5AXNA 5I4MA 1AROP 4BLGA 2VPZB 2M5YA 5ETNA 2NQPA 3R7BB 4N77A 3CCRS 3JAMU 2HMIA 5KFHA 1D0EA 4FBTA 4Q8FA 1TQLA 1T05B 4MKAA 1N32J 1HNIA 4DV3J 3VV2B 1DTTA 4NEZA 2QZ8A 2F8HA 1NSAA 4HVZA 1ZTWA 1T7PA 3ENVA 1RBAA 1WUUA 4GKJJ 3GQCA 3GJSB 4ALZA 2Z2ZA 2UVWA 3UE2A 2QL5B 4ECZA 1UWAA 2H5IB 4CNZA 2LMIA 2XNQA 2KFNA 3PX4A 2JX2A 1SKWA 4B3SF 2QL9B 3MMAA 3I96A 5LSRA 4CH0S 4DX5A 1UETA 1JLEA 3UDLA 3H40A 4DL7A 4X62F 3G6YA 3PR5B 4U8VA 1WJ9A 3BPDA 2DRDA 2FUG9 4PWWA 1NHUA 4ZVGA 2DGSA 1OSDA 1U09A 2YXLA 3TAMA 2YH1A 1FE4A 4B3MF 4WZQA 3OVAA 3AD9C 2NXJA 2QFJA 2NXEA 3U02A 1IBMJ 3O44A 3IMQJ 1WHYA 3BGLA
chains in the Genus database with same CATH topology
2UZAA 1HI8A 2LVWA 3RR8A 2XULA 5D4NA 1RT2B 2I38A 3EZUA 3LAKA 3OJUA 2VKZG 1C1BA 2FD2A 3DLKA 1FRMA 3O2IA 2XMVA 4BHQA 2OPQB 4QOTA 2PEHA 4C3KA 1D3WA 2OSRA 2RD5C 4TLQA 3ISND 2WONB 5BR8F 4WFBQ 2P6SA 3PV8A 4ZP9A 5KFSA 3E01B 4NLQA 3TR5A 3CDAA 2B4PA 4BS2A 1Y3KA 3JSBA 2HWHA 3D1HA 4QQBA 2XGPA 4A8WA 3LUYA 3K58A 5KFPA 1RKIA 1AW0A 1R0AA 1N32F 3OTBA 4DV3F 1Z2ZA 2DBBA 1UJ5A 3N9UC 3DHWC 4BC7A 4GC7A 3EXYA 2G9OA 3M8QA 4P7VA 5KT2A 1XEZA 5AE2A 2MQLA 1FDAA 1Q8IA 1RT6A 3MMJA 4OX8A 4O0IA 4O3OA 3PRBA 3V81B 2GNKA 4DSFA 4C8NA 3CCMS 3G4SS 5L9NA 2GQQA 3GZ7A 3IN5A 3MMBB 3NP5A 1NJZA 1JNZB 2I8EA 3RZAA 4V19J 2OAUA 5J2NB 1FKPB 3FFIB 4OX7A 4MMOA 3BDPA 1S9GA 2EK1A 3CF5Q 5A8WB 3H5SA 3IGVA 4PWUA 1ZBTA 2BM1A 3I6PA 4GKJF 3CTRA 1WACA 4I67A 3B82A 3HZGA 3MUTP 3V6DA 2MSSA 3NCPA 1HNWF 3OFHA 3DLLQ 2MKSA 2R7WA 2HPUA 3MM5B 2MGZA 4BWJA 5B0BA 4JYAF 2HNDA 1QUVA 2IM3A 4ZDNA 2FLLA 1Y3JA 1MNEA 4JV1A 4AL6A 3PZPA 4JI1F 3THTA 3K5NA 1KD1T 2ZH9A 4I7FB 2I2YA 4QYZJ 4PPDA 4IFYB 2B6AA 3AB2B 2NSBA 1DLOB 1XMOF 2GFFA 2A2CA 5HP1A 1DAXA 4RW8A 1JLCA 2R9LA 2FJWA 5G0RA 4OHVA 1JNRB 2IJNA 1S97A 3H59A 1GXUA 2Q66A 3PJXA 3NWGA 4WXOA 4WE1B 1U1MA 3QJLA 1HD1A 2MZTA 1SJQA 3L09A 2IYIA 4TY8A 1HWIA 2B51A 2HGLA 1BC6A 3DDKA 3HHKA 2MSTA 3PM9A 2YKNA 4K0KF 1VQSA 1Q8BA 1QUPA 1FHTA 2ZD1B 3V6HA 4AL5A 5A8KA 2HS3A 2YWEA 3BGUA 3SCLE 3WC2A 5D4LA 4DN0A 2NREA 3OXGA 4TY9A 2FHMA 1S72S 5DDQC 3CJKB 1VQ7S 4ED2A 1M90T 1PO6A 3WBZA 4K4YA 4Q0BB 3T5HA 3LP1A 3TVKA 5GAGI 4MK8A 2BXJA 1YJRA 4NL5A 4YDDB 4J9RA 1D1UA 2ZC4A 2ZZMA 3HO1A 1VBXA 2R7QA 3OTDA 2RS2A 3VQSA 4A8FA 3GSDA 2AGQA 2VFTA 3BN7A 4OIXA 3MD1A 1S0VA 1CEZA 1WEXA 2B7CB 5EX3A 2FGOA 3C6TB 4QWBA 4K5RA 4IH5A 3BGRB 1I94F 1LWFB 1VIXA 2PDAA 1JLFA 1NRKA 5CYMB 5CZVA 3O3LA 1SB6A 4Z37A 1TVRA 5IT4A 1A6LA 3BSNA 1XERA 1RWUA 2A2DA 2GC8A 2I0XA 1UKUA 2YNGA 2Z2MA 2DNQA 3CCES 2JEFA 2Y0SD 3N28A 1U49A 2LKZA 2RH3A 2JEJA 3MAHA 4FN5A 3CJ5A 1XR6A 3QZ8A 1NO8A 1QTMA 5L8RC 2VPWB 1NJYA 2M88A 4X4QA 1D9AA 5KT5A 3IWXA 3DLEA 2KHCA 4BCAA 2V2KA 1K8AT 3HM9A 4IH6A 4OJ1A 1HBOA 3GYNA 1QSSA 2CQHA 4RWWA 1IKWA 3UR3C 3J7A1 5KFAA 3THVA 4B9MA 2KM8B 1LWEA 1RTIA 4LUBA 3EGNA 4ICLA 2NS1B 2XLJA 3M2UA 2HHWA 1FERA 2W9BA 4K4TA 2D41A 3J80Y 1AXQA 4DDFA 3VCDA 1WG5A 7FD1A 3G6ES 4F4KA 2AJ1A 3FEXB 2M8HA 2KZZA 3FRYA 1HFEL 2LQBA 2MYFA 4W90B 2EFQA 1KEKA 1BLUA 4RW6B 4F3OA 4JBCA 1A7GE 4LQ9A 1FCAA 7FDRA 2CJKA 2CVEA 1RT5B 2XI3A 4RBTA 3UD3P 4X4UA 1DBDA 4A47A 3V6JA 1FESA 2DR7A 4LFAF 2ZOMA 2JOQA 3LOUA 2RKIB 1QVGR 3IR6B 3ZZUA 1MSWD 1X5OA 1BQMB 4DF8A 1TL5A 2B4OA 5KAKA 2DNLA 2ILZA 2QIFA 2ALZA 1FXDA 5FDLA 2UUCF 3MPWA 4ZVEA 2QA4G 3S7RA 1KLMB 3PW5A 3IGNA 1QSYA 3MM7A 1NHVA 3TNVA 4F8RA 2K1RB 5EWFA 1VC0A 1HI0P 2YVSA 2C3OA 1TAQA 2UUWA 3LGMA 3GYXB 4Z2XA 3V4IA 4OL8A 2OTLS 4N41A 4ELTA 4PQAA 4WU3A 1GQEA 1IM4A 2FJXA 2UV8G 3BM7A 5DETA 4HKQA 3DHXA 2RMLA 1HBNB 1Y5LB 2KJVA 1S9FA 1X4HA 1U45A 1G6BA 2HRUA 2NPIA 4ETZA 2IAJA 1UVIA 1QLNA 4PQUA 3UPFA 3H8YA 2AGPA 1FA0A 1VQMS 3VQTA 5F3ZA 1B64A 2VONA 2ZOGA 3EPIA 2CQ4A 4Y0FA 1NU4A 3E51A 3K7RA 4JI8F 3AJ2A 5DM7Q 4C7QA 1TK0A 4N47A 3DU6A 1NH8A 5KFZA 3HX9A 1S0MA 1M5SA 4ZOSA 1N36F 2KU7A 1U1PA 2IMWP 4B9SA 4RW9A 3SSQA 4XK8C 1DQ9A 1OPIA 3W7BA 1MWZA 4Q43A 4NZ0A 5JJBA 1RTDB 3HXMA 5LJ5Y 2HHQA 2BDPA 4YB1P 5LXRA 4EO8A 2Q43A 1C2PA 2RJZA 2DHSA 2C2RA 2VG6B 4AE5A 3HLUA 2J0WA 4DL3A 1KVJA 1HNVA 4OZ0A 1OQ6A 2VBXA 2VL1A 4Q44A 3T9NA 1RTJA 4K4SA 2P9GA 3DXSX 5KFBA 3IRWP 2YKPA 3S6EA 4EGLA 4F4YA 1GAOA 5EUHA 3HHLB 5CYQB 1FRLA 1S1TA 2ZITA 2R2SA 3H5UA 5CYJA 2K8GA 5LJ3Y 4Y2AA 1N5TA 5E41A 2RF2B 1LKZA 3L7PA 1T94A 3DCAA 1RA7A 2BANB 4X4OA 4DG1A 3JSMA 1WF2A 3MCSA 1S1WB 1TL3B 1SJ3P 1X4FA 3T1HF 1YJ9S 2LCWA 4C11B 3KHHA 3QAUA 2PA3A 1U47A 1Q79A 4AUKA 4LMZA 3MM9A 3KLGB 3QIPA 2RU3A 3GIKA 4UUWA 1TV6B 2E1RA 2M9KA 3MEKA 4ELVA 1YRXA 4FXDA 1DURA 2QSFA 1FEHA 4CO5A 1APSA 2KT2A 3LALA 5HMWA 1JK9B 4YMEA 2CQ1A 1DARA 2XWXA 1HQUB 4ZP6A 4O3QA 3DRRB 3ZZZA 4R5PA 2ASLA 3ETOA 1ZH5A 3VWSA 2AQ4A 2W4DA 1XMBA 2RILA 3OLAA 4TU9A 1F60B 4RUHA 1W2BR 3CC7S 3HPOA 4KTQA 1RISA 1FRHA 1ULRA 1KQGB 2J0XA 2QMXA 3PO4A 3N0VA 1SKRA 4G3IA 2ZVSA 1T3NA 3K5OA 5HROA 3M4XA 4DX8H 2ABYA 5GMKa 1S6QB 1L3VA 4X4SA 1U1RA 3M05A 3PXGa 4KQZA 2XS5A 5KFGA 2OPSA 2HWIA 4HDHA 5DGBA 4DSJA 1VQNS 1Y9OA 2R2RA 2CPJA 4I64A 1X9WA 5JUMA 5KFUA 2OFGX 5L1KA 4WXWA 1XK8A 3VZIA 4IRCA 2I5JB 3CD6S 2AX0A 3KLFB 5JVHQ 2YKQA 1LFWA 3T9ZA 3CCVS 4DFKA 4O3RA 1U8SA 3R1LA 1HHTP 2F1FA 4RBUA 4RWXA 1N33F 3TX8A 5T7LA 1TKZB 1ELOA 1SH0A 3DOLA 3W2WB 2G0CA 1SUQA 4YEAA 1YIJS 4WFNQ 2HNYA 4WK3A 4ECRA 4DJBA 3MMAB 2XHWA 5JXSA 2RQKA 3PW0A 1FVQA 2PT0A 4Y2MA 2HVHA 4D3GA 1TK8A 2KB2A 5K14B 3G86A 1N6QA 1IKYA 2CQ3A 4OI6A 2Y1IA 2C2EA 3QMQA 3NAHA 4LF5F 2E29A 4PXDA 3SI8A 3HVWA 4JI6F 5KG6A 5E3PA 5HMZA 1TR0A 3CXCR 4NOHA 1ZM3A 4KR0B 2W9AA 1T8EA 4ZKAA 4QBUA 4BDPA 2IA0A 2HVIA 3G71S 3AQPA 5DJBA 1RT1B 4UQTA 3KG0A 2DD8S 3OR2B 4ZPCA 3C66A 5IFMA 3LP0A 1O0PA 1T3OA 2VA3A 1G2EA 2AP6A 4KC5A 2ZE2A 2HFOA 4ECTA 2RDJA 5GAEI 2W9CA 2R7XA 4J9SA 2BQRA 4A8QA 3M8PA 4AXIA 5LMNF 1BWEA 3MUVP 4ID5B 1RGVA 4PXBA 2YX1A 1UFLA 4IOCQ 3MEGA 1VRUA 1NK4A 3PHEA 5GVQA 4XPCA 4IFVA 1YGYA 2VC1A 4A4JA 5I3QA 4DPOA 4M94A 2PMHA 3I5BA 4FVMA 4GC6A 2DNGA 2N3OA 2N7CA 2IC3A 2LXIA 2MZQA 2DNPA 1HWKA 3ICLA 2HRYA 3NRBA 4MIAA 5KOXA 4MK7A 1DQAA 2CPIA 3KLIB 3OFFA 4QIWD 5J2QB 2DR5A 2IRUA 5LT5A 1EP4A 4LF9F 3B4MA 3PJWA 5A8RB 3I5CA 4I2PA 3NS6A 4J9PA 2W8KA 4DSIA 4IG3B 1WG1A 3I4HX 1UEVA 1UL3A 3R5AA 2E5JA 3FDSA 2O5DA 2XGQA 2NPFA 5SZTA 2E44A 4JV0A 4R8UA 1RKJA 3JTPA 3OL8A 2FHOB 3M8QB 2LYVA 3IXQA 3RB0A 2Z4PA 1S1XA 3M2RA 3SV4A 1KSPA 2JFKA 2J9DE 4O44B 5F9NA 1R3NA 1S9EA 2O3DA 3CB4A 2HHXA 3C46A 1BQNB 4DV7F 3MHYA 3B4DA 2HW3A 4EYHB 4RU2A 2MQQA 3NGDA 5HQ8A 4JI4F 3OPKA 1SIWB 2HG4A 2OPPA 1HBUB 4ZCMA 2XS2A 3MM6A 2VZ9A 1S9GB 1R89A 2KN4A 3CVKA 3AB4B 1YWXA 5DDRC 1XNRF 1FDNA 2YX7A 3G8SA 2BE2A 3V6DB 2NXUA 4C0BA 1ROFA 1U2RA 4ECYA 3TQ1A 1LOUA 1RYSA 2WOMA 3QO9B 4DUZF 3Q8PB 4DF4A 4NCGA 3QGIA 4TYAA 3KJVB 4B3OA 1OPZA 2XSJA 4CQ1A 1JLAB 4LF6F 1K0TA 1S0NA 4U7UK 2R8IA 3LWLA 5IWAF 1ZM9A 2MKKA 4K4WA 3H5XA 4H54A 4NXNF 1JMTA 4Y2KA 3KNGA 3MEDA 2I1RA 4FNHA 5DS7A 4F50A 4Q2LA 2DGXA 5AE1A 2N82B 2OPRA 4QR0A 2DVIA 2L9WA 2ZHOA 4RW8B 1JLCB 1Z1ZA 2HLTA 1F5BA 2QA4S 5G0RB 1OIAA 3J7YI 2PFFB 5A6PA 2J6SA 5I3PA 1LW0A 3T5JA 3N5FA 2OIHA 1GX5A 2JC1A 3RBEA 3F41A 2EBEA 5K8PA 1NJWA 3UNGC 3MF5A 4KE5A 1P1TA 2YNFA 3ZZRA 1IKVA 4IR1A 1MU2A 2UXCF 4JI5F 2CPFA 4HH1A 3C6UA 1V3RA 2P9EA 3IO1A 4IKAA 2NUUG 1VI7A 3OLBA 4WZMA 2BBEA 3QIDA 3OV7A 4O23A 4HI2A 5A8KB 1KHWA 2CJBA 4Q8EA 2VBWA 3CWJA 2XMTA 4PWDA 2JVOA 1WD6A 5DG7A 2BA9A 1S1UA 2YX4A 3I0RA 4Y6IA 2IM0A 5C24A 2GA7A 3MEEB 2UUTA 3BO2A 1NKBA 1NK0A 3ZFVA 4DV0F 4B9NA 4UY8T 2DH8A 4HT7A 5KFIA 3SDEA 3B8HA 3DLJA 3FEYB 4DR1F 1HA1A 3RRGA 2PI5A 1SV5B 1K73T 4MIBA 1GT8A 1H98A 4OLPA 5K8OA 5CH7B 2SXLA 3UD4P 3RW6A 1RTHA 1S6UA 2MXYA 5A0YB 4C9DA 2CG4A 1UVLA 3RB4A 1SL0A 3CJ3A 2HNZA 4C0OC 2BYCA 1DTQA 1QVFR 3DLHA 1HPZA 2KM8C 2W8LA 1S10A 1K0VA 1JLFB 2DGUA 1FT8A 1GX6A 2MY8A 1E6YA 1N88A 1XBWA 3N4WA 1URNA 1R8PA 3M30B 4WU2A 2YNGB 1WELA 4WK1A 1N5SA 2ILYA 4TNOA 4C8YA 5IM0A 2WB1D 1UJ4A 4NLDA 4KJIA 4LVOP 3ZZOA 5IT9Y 2IM2A 2FY1A 3QLHA 4OHWA 3KK3A 1Z4UA 3D2WA 3D0HE 4MJKA 2JVRA 1NK7A 1N5YA 3DRSA 3HHLD 1Y4ZB 3H5YA 4O4GA 2WBMA 1X0PA 3OUYB 4I68A 2VASA 5I42A 1D8ZA 2E5LF 2RT3A 4IO1A 3HHEA 3R5BA 2P9CA 1MWYA 5F9LA 4OI0A 3THPA 4B17A 2R7OA 3KLHA 5C5JA 2BRKA 2GW8A 1JXEA 1RT4A 2PO4A 5B0FA 1IKWB 3NBPA 5E33A 4F3MA 1LV5A 5B09A 2E9TA 5LSOA 4ICLB 2VQEF 2BQ3A 4FP9A 4DS4A 3IWLA 4GO5X 3L3CA 2YKMA 3DMJA 4ZHRB 4WKYA 4MIWA 5J2MA 2COLA 5H9FJ 4NWBA 1WTFA 1LXJA 3BSAA 3V4MA 1TFWA 5E7OB 1HARA 3OW2R 4EBCA 3M2VB 1KN6A 4NLWA 3CDEA 1X4DA 3M9NB 2K7JA 2MJNA 1TKTB 2E5HA 3G6VA 3DM2A 3HVAA 2LA6A 3OTCA 4KV8A 5FD1A 3CEDA 2EFGA 4DR2F 5D3GA 5FIIA 3CCTA 3GIIA 3IAS9 4WF9Q 4AQYF 2ROPA 2QV6A 3I9V9 1UJ6A 2KYZA 3PACA 1OSCA 2LQ5A 3UCUP 3Q23A 4V19X 4HL9A 4DQIA 3MM7B 3W2VB 3M32A 5F8IA 3N6NA 3NG8A 3P3DA 4CO3A 2X1AA 1HW8A 2BR0A 4QWAA 2KXHA 1NB7A 3MR5A 4C4WA 2XS7A 4XDCA 2R7SA 1IXKA 3NNCA 1P8GA 3FVYA 4YQWA 1U48A 5IQQA 2K3IA 1LK7A