1FJGF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fjgF00
4B3SF 4JI3F 1CQMA 1XMOF 4LF6F 4DV7F 4B3TF 4JI8F 4LF4F 4LF8F 4JI0F 5LMNF 4DV5F 4GKKF 1LOUA 2VQFF 4LF7F 3OTOF 5AJ3F 1HR0F 1I94F 4DV2F 2UUBF 1B64A 1XMQF 4JI7F 1IBLF 4DV1F 4DR4F 4JV5F 4KHPF 4YHHF 2E5LF 2YY3A 2B7BB 4AQYF 1J5EF 1N33F 2UXBF 4K0KF 2BXJA 3T1YF 4DUYF 3R3TA 2UU9F 4DR5F 5LMUF 4DR2F 1N36F 1FKAF 4DR1F 4NXNF 4DR3F 1IJFB 4JI5F 4LFCF 1VMBA 4YY3F 2VQEF 4NXMF 2HHHF 1IBKF 1N34F 2UUCF 4X65F 1F60B 4X66F 1G1XA 4DUZF 4X62F 5IWAF 2J5AA 4OX9F 1HNZF 2UUAF 1N32F 4B3RF 4DR6F 4JI2F 1CQNA 4GKJF 1XNQF 2UXCF 2B7CB 2KJWA 4DV6F 4LF5F 4LFBF 4JI4F 4JI1F 2F4VF 4DV0F 4DV4F 1HNXF 1XNRF 1IBMF 1GH8A 2BVZA 1HNWF 4JYAF 3T1HF 2UXDF 2ZM6F 1QJHA 4LF9F 4X64F 5BR8F 3ZZPA 4DV3F 2RJZA 4DR7F 1RISA 4B3MF 1G7CB 2KJVA 4JI6F 1IJEB 4LFAF 1FJGF
chains in the Genus database with same CATH superfamily
4WIQA 3LA0A 4ICLA 3C15A 4QW9A 3OR1B 4MH8A 2HQIA 1T94A 3HHKA 3P96A 4RW8B 4ICLB 4KTQA 1FKOA 4MIWA 2R8IA 1F3FA 3W8PA 2EFVA 1SJRA 2YNGB 3Q89A 3BS9A 4JI2J 1FKOB 4EEYA 1DFDA 3RW6A 2QL9B 5IOLA 3MF5A 4QR2A 1AW0A 3PNIA 1YIJS 4I2QA 1WKJA 4BC9A 2OMLA 3MZIA 3AB4B 3W60A 2RD5C 1ZPWX 4I2QB 5D4PA 2GQCA 5HQLA 1S97A 4M5LA 1FI4A 3VCDA 1YQHA 4AL6A 2ALYB 3G86A 5L1KA 1NHKL 2IM0A 1ZA1B 3LH2S 5ETKA 1FRMA 3C46A 2OEJA 3ENWA 5E3AA 2UUCJ 3VZHA 1PJ5A 3H4DA 4ALZA 1RI7A 1HBNA 4KFBB 1GQEA 3G71S 2BE2A 2KTQA 4LRFA 2NYIA 3MCSA 1HBNB 1WTBA 1F0XA 2GVZA 3QJPA 3MM5B 5KFXA 3KHLA 2HAFA 1UPPA 4KHPF 1FESA 1S1UA 1U1LA 1FA0A 2PO4A 2UXDJ 3MMCB 3IRXA 1CJKA 3V2UC 1S1UB 2L41A 2YKNB 4OHYA 3V6KA 2W7AA 3CCSS 2XTJP 4MJKA 1CJKB 2R42A 1HD1A 1KONA 3KHGA 4M5KA 1U4BA 3MAAA 2KXHA 1CLFA 1S9EA 2W7OA 2CPEA 2K1RA 1GTEA 4DV4F 2HBYB 2WTFA 1M5SA 2XO6A 2P5VA 4ILLA 1LWFB 3DXBA 4ENOA 4Q43A 2KFNA 2PA8D 2AZ3A 1RWKB 1RGVA 2XWXA 3R1LA 2IMWP 4DX5A 5L39A 2W2OP 1RHRB 3J81j 1NK7A 1NJWA 1NUEA 2NSBA 4KHRA 3P5TL 5J1NA 4USVA 2PI4A 1Z2ZA 1S4EA 1S9GB 4FPIA 3BDEA 2ZOMA 3VV2B 4OZ5A 7FDRA 2VG5A 1NK4A 2YWGA 4QWAA 1PC5A 1XTZA 4NLPA 4Y2KA 2E1MC 2E1AA 1KP6A 3K5MA 1FERA 1VLOA 2B5JA 1Q7YT 4CLKA 1FK9A 2E29A 5DGBA 3HXMA 4OYPA 3X3UA 2C2OB 5GMEA 2B5JB 3C3LA 2JOQA 2DNZA 2DJWA 5IV3A 4DI6A 4J9SA 2DNLA 1XR5A 3KNGA 1RLCL 2YWEA 1PCAA 3TUZC 3GP9A 5F8JA 4NA3A 2XMKA 1R7IA 4JI5J 5L46A 1HBMA 1XMOF 3HHNB 1XWLA 2FZGB 4MKBA 2KG1A 1JX4A 2W4PA 5HMWA 2DY9A 3CMQA 4KY3A 1Q8IA 2DEJA 2CKWA 1N5YA 2BDPA 3EICA 3MOZA 3IO1A 1WI8A 5A8KA 2CNNB 1W26A 4F02A 5BR8J 5HP1B 1BQNA 1X9SA 4B3MJ 2OAUA 3ILJA 1FKAF 3Q8VA 3GYNA 5CAAA 3W2VA 5CZXA 3CC4S 1R8CA 2XY7A 1HL6A 2B6AB 3KUHA 1NDPA 2X3GA 2ERRA 2XY6A 3PYGA 2W4DA 2BW7A 3MCMA 2K7KA 4LF5F 4NA2A 1FRKA 3CJ3A 5CA5A 3UDVA 4C6AA 2BUNA 1YWXA 1TK5A 2LECA 4OV1A 4NCGA 8RUCA 3LUYA 3TR5A 2O5DA 1UVJA 2EG2A 2ZNZA 2QL5B 5K5MA 3UVJA 4NCGB 3PZPA 2HURA 2AW0A 1RT4B 3CIMA 3CCVS 2DGSA 5D3GB 1I3OB 4GVLA 5DJBA 5KFGA 5CZVA 3OTOF 2KM8B 2K3KA 2HK2A 4JI4J 4FF4A 5A8RB 1IKXA 1ULRA 3MTJA 5ETRA 2XMTA 3KJQB 4RU2A 5FDLB 2E1RA 2WOMB 4LRAA 4ZK7M 1IKXB 1C0TB 3V81B 1V6HA 1CPZA 4N8OA 2F4FA 5LSRA 4DL6A 4ZIVA 3RB0A 1S1TB 1J5OA 3K5LA 2FTRA 2VKRA 2C22A 1TV6A 1T9UA 4X62F 3R5GA 3EJMA 2HNDB 1TMJA 4W4MA 2JFDA 1X5PA 1U47A 1TV6B 2IYIA 3VR1A 2YKMB 2F4VF 1R8PA 3OFHA 2VBWA 3GSIA 3LGHA 2C2MB 3MEDA 4N76A 1YJWS 4WF9Q 4ZN1A 4CM0A 5GMKa 1MN7A 2WZ1A 1FFGB 3MEDB 2V63A 3L7UA 3M7VA 5F8LA 4ZPCA 3R5BA 3FMWA 4CP5A 4PG8A 3AQPA 2O1PA 3H7HB 3PEJA 3JTNA 2DNRA 1K9MT 2NXEA 3UO0A 3THVA 1T3NA 3CJTA 4F4XA 5KFNA 3A12A 2WB4A 2ZVSA 3MAQA 2B4VA 2IYGA 1ACMB 4ZKAA 4DFMA 4WIIA 2UVWA 4OHVA 4DUZJ 1GX6A 4V19J 4B3OA 4FYVB 3G8SA 3E01A 1V3ZA 1F2GA 4A8WA 2AIRB 4GVBA 4CLZA 2DHAA 2HQDA 4C4WA 2WSFC 1KHVA 1GT8A 3E01B 4NMLA 4KV8A 1VQOS 4OJ3A 4RW6A 3ZZRA 3OFEA 3L09A 2R4FA 4JI7J 4J7CA 2C28A 4FF2A 4QR1A 2ZDPA 3ET6A 1SKSA 4O3PA 1BLUA 3DOKA 4K0KJ 2WB1D 4RBUA 3ET6B 3A8JA 3AOBA 3F56A 2XNQA 3T5KA 1I94J 5B0DA 4B3SF 3FFIB 2Y1JA 5BYQA 1SJ4P 4KO0A 3SCLE 3LAMA 1X0FA 4ERDA 1JLFA 1KVJA 1MLAA 4WCEQ 4NYPA 2LQ9A 3Q8UA 1VQ9S 3FSYA 3CJ2A 3OVSA 1JLFB 2HHHJ 4CQ1A 2D69A 4C8ZA 1SH2A 1RWNB 3M6WA 5HROB 1IVZA 2ZBIA 1U1OA 4PWDA 1WORA 3G8QA 1TKTB 1KQGB 3W64A 4MIAA 2HBRB 4KKOB 4JI0J 3SV4A 2GZOA 3O5TB 2FHMA 3A3PB 4I64A 4ZLJA 4KE5A 4OJ1A 1IQZA 4OZJA 3FMBA 3PW4A 1NJXA 1VHFA 4FXVA 3QRPA 1V5IB 5K8OA 2YNHB 2ZH5A 4GKKJ 2R8KA 1HYSA 3U1NA 2CFXA 1S6QA 4I6YA 4P2XA 2E5GA 2E9ZA 5KT3A 1KWMA 1N34J 4DV7F 4RX6A 1U0HA 3OL9A 3W1YC 1NRKA 2OPSA 5LSOA 4LREA 2VPZB 1U0HB 4FS2A 1XNRJ 3HULA 4RUBA 2XEXA 4FBUA 1DRZA 4DL2A 1RKJA 2HRTA 2HLTA 1X9WA 1NXIA 2XSJA 3GZ7A 4DR6J 5J2QB 3I0RB 4QYRA 2DVIA 4V1Ak 2LCWA 1B99A 3D66A 3N01A 2QMXA 1EP4B 5E3RA 1VLYA 1BQMA 1N32F 2I0XA 1HNIA 2RHQB 2DT9A 1Q78A 4DV2J 4YN3B 1HNIB 2B4OA 3G6VA 1N54B 4EYIB 3LANA 4R5PA 1HBUA 3UWTA 5A8WA 5HI7A 4BWJA 2CDRB 4Q2LA 1LV5A 2HHSA 4R5PB 1XBWA 4DR3J 2QEXS 1HBUB 1UMJA 1HD0A 2KVIA 4IRDA 3GB0A 4LBHA 1B7FA 3C14A 1TL1B 4NRUA 1X4DA 2UUTA 3ZTQA 2DR6A 2EKNA 2C1EB 2YNFA 4DG1A 1GAOA 5KT7A 1VRUB 3NMRA 2FDNA 2YNFB 3L7PA 3TNVA 1IR2A 3D5MA 1GXUA 3TX8A 2JVRA 4WFNQ 5DG7A 2GNKA 2QYGA 2C3PA 2G2OA 1H0HB 2AF6A 1J27A 5CYMA 2Y0BB 4GMKA 3M8YA 5CCMA 2AYMA 2D3O1 1U6BA 5DG9A 2QYCA 4JI1F 2MYFA 3DC2A 1U2FA 3W9IA 4H4MA 1CJVA 4AQYJ 2NZCA 4GO7X 3TAMA 1X7VA 5D6GA 3OD2A 3PR5B 4H4MB 3PX6A 3K57A 5JMNA 2PC6A 4I67A 3M4XA 4DQIA 3P6YC 3I5CA 4LF4F 2AGOA 5LMNF 1HW9A 4FYDA 4DMZA 4OX8A 2BQRA 2MPUA 3NAHA 1FCAA 4LRDA 4OYZA 2M70A 1DTQB 4LF9J 5F9NA 1X4FA 1S48A 2DNKA 5H9EK 3KG4A 2KHDA 3GMGA 5GAGI 5T7LA 1PJ6A 3TAQA 3QGIA 1UP1A 2ATCB 2IHR1 1KS2A 4FF1A 4LBIA 2FC8A 3MM7A 2EC2A 4EBDA 2WCXA 3OT9A 2J6SA 1NK5A 3CJRA 4ZJQA 2DGTA 2H5EA 2ZUAA 3DCAA 5KFRA 2AD9A 1RTHA 3WX8A 2GHWA 3C66A 5ETVA 1R8BA 1H2VZ 4V19X 4C97A 2RS8A 2VFTA 1TR0A 4YY3J 4YR3A 2OPQA 2ZHOA 4DL3A 1EKSA 3Q2SC 5KG2A 1F5BA 2OELA 4OZNA 1N5QA 2OPQB 3R6GB 3HFVA 1IKWA 3UQSA 2BBEA 3KK3A 3OXFA 4IQXA 2QLBB 1QE1A 2F3JA 3P45B 4QBUA 4ETXA 4DQRA 2KZMA 2HFOA 3DRPA 2CQBA 2MJNA 4N8NA 5B0GA 4DV0J 1M1HA 3GV5B 5GMDA 4DS5A 1OQ3A 3CCLS 2BJ1A 1YZ6A 1T95A 1I1GA 5CD4A 5CHCB 4DN9A 4MK7A 3SCIE 3RGIA 4I1TA 3UN3A 4DPWA 1T9WA 1RWMB 2GIRA 4OYBA 5KT2A 3MR2A 1ZZFA 2YKOA 3EDQB 2YX1A 2HNYA 2OO4A 1BUXA 4NLQA 5KFJA 2UVRA 5HATA 4NI2A 2MSSA 3CC2S 2YKAA 4LF2A 4MK9A 4A47A 4NI2B 4JV1A 3UNGC 1QSLA 3LGMA 4PG4A 4F0MA 1IBLF 3UDLA 5ETQA 2YNIB 3UCGA 2QSWA 3IR6B 3IG1A 4ED5A 2AYGA 2XI3A 2PEHA 1K73T 3R3TA 2LQ8A 2XZDB 2O01C 3ZZ0A 1YJUA 2RQ4A 4LSNA 3BQ0A 4K2XA 5HO4A 4LSNB 1RWPB 3D0IE 5IM0B 4F2SA 2C3YA 3UDEA 4M94A 1XERA 4WFAQ 2N4CA 4DSFA 4K5SA 3BH6B 2HVHA 3R1HA 1Y0HA 3G8TA 4TLRA 4CH1A 4KHPJ 2RNEA 2RU3A 4HL9A 1XR6A 1N88A 4DV3F 5DRKA 4HKQA 2CQ3A 3FSIA 3SIPB 3RTVA 2WAQD 4FXWA 3H2VE 4ED4A 4QWCA 1X4GA 4OI4A 1KR4A 5CYQA 2VFVA 2BR0A 1TTHB 2M9KA 3KOAA 4B9NA 3KK2B 3KLGB 2W9CA 4H54A 4DV4J 2RKIA 5K14B 2CJYB 4ECYA 2UXBF 1NSQA 2UU9F 4C7QA 1F6TA 3VAHA 4P72A 4DS4A 1F1BB 2Y8YA 4WZQA 3AAWB 3U7JA 4QCLA 3WDOA 1IM6A 2G4BA 1S49A 1CJUB 2UXCF 1WELA 1S77D 1X60A 3GU0A 1VC6A 1MMLA 3GTYX 2ZVIA 1M5VC 5G4DA 2MQ8A 2D9PA 5D0EA 3ZNUA 2XMVA 3IN5A 4ZVGA 3W5XA 3HJVA 4ECWA 4OQJA 2ZM6F 3DU6A 4YUDA 3CCUS 1ZOTA 2HPUA 2DITA 2V5HG 3T9ZA 3CD0A 1RAGB 2H9ZA 1K0TA 3AY0A 1WDDA 4M5MA 1YJVA 2CNLB 1J5EJ 2CQ0A 3DNCA 3SSQA 1OY8A 4RNHA 5J1EA 2W8KA 2O66A 4I7FA 3KG1A 3MMBA 3DN9A 1UETA 4NZ0A 3ETOA 2CPJA 3QGGA 1I51B 2DD8S 1O5JA 4I7FB 3OSPA 3E8OA 2VPWB 1Q95G 4CIOA 3KUEA 1KQSR 5HJXA 1ZZNA 1AFJA 5CQGA 3EVMA 1H6KX 3UE2A 3MWBA 3O8WA 4U7UK 2JLFA 3K8WA 5CCLA 3PXGa 3ENQA 1YDLA 2EFPA 1XMOJ 3CDUA 1UVIA 4F4YA 1VRTB 3RU0A 1ZETA 2KT3A 2ZUGA 2LLZA 4FZVA 4Q2MA 8AT1B 3NBPA 2V2QA 2OHDA 3I96A 4LQ9A 5I3UA 2XMUA 1X5OA 3NBPB 4R8UB 3LP1B 5KG3A 3C6TA 3RBDA 4X64F 1Q1KA 4AFFA 5I3UB 2AP6A 1YRXA 2HS4A 2PEBA 5HANA 4BWMA 4LFAF 5KFYA 4XDDA 3CCTA 2R7TA 1IWGA 2NR0A 4YR2A 3OLAA 4YQWA 4LF8F 3SEOA 3DLKA 3DDNA 2HNZB 4RO0A 3TZWA 4PQUB 1R8HA 1KFSA 2YPZA 2I5JA 1GX5A 1MSWD 3PCOB 2U2FA 1RAJA 3BQ2A 4KQZA 1S76D 2BYCA 2QMWA 1MROA 4A8MP 1T02A 1TMMA 4H4KC 2ZOGA 4PG6A 1C0UB 2VDHA 2DH8A 1TL3A 4M5IA 4O4GB 6AT1B 1U1KA 3W7BA 5ETNA 4PAAA 5HMYA 4L76A 1D8YA 1GH8A 5B7WA 1DQAA 3TJAA 3D6FB 3W5ZA 3FJ2A 3IBCB 3M32A 3MCOA 1TK8A 2FGCA 3OV7A 2WRMA 2KJVA 2VOOA 4IYQA 2YWKA 3TZZA 3ZZOA 2JEIA 3M32B 1RHQB 1TUVA 3I4PA 4X62J 2CG4A 2CWKA 3GIKA 1EX8A 1TL7A 4IFYA 3H5UA 1V9OA 1XJWB 3D1HA 1JLBA 1SJQA 4ATNA 4J5OA 1RT1A 2F4VJ 3BEGB 4RJVA 1TL7B 3CD5A 5FD1A 5KFBA 4I2PA 1Y00A 1P1LA 3IA0A 4QZVB 3AD7C 2VKZG 1URNA 1FFSB 1BGXT 3CJ8A 3HHLD 1MMDA 5DETA 1NDLA 2MKJA 4ED3A 4M5JA 1W2IA 2J5AA 3LQVA 2YVSA 3SDEA 4ZJOA 4RNMA 3N6NA 5DG8A 4WE1A 1XNQF 1SPBP 1VS3A 3SDEB 4JI6J 4H4OB 3SYZA 3DRYA 4RUAA 2MEWA 1FO1A 4TVAB 1KDNA 1JNZB 2HWHA 3FEYB 3QZ8A 3PHEA 1HNVA 1N5SA 1VQNS 2CPYA 3CW2C 1G2EA 3KLIA 1RISA 2GVDA 5A6WA 2CQGA 5IT0A 1S1WA 4ZDNA 3MEEA 2B0GA 1RACB 1WC0A 1JLAA 2GVDB 1IXKA 1KLMA 2W2PP 1NSKL 5DS7A 3DM2A 3RBEA 4WJBA 2NUUG 2WBRA 2YKQA 4Q8EA 4ZJLA 4F7VA 2YPYA 4KGZB 4X65J 4ZPTR 2QL7B 2ZWOA 3BGFA 4X4RA 4DX7A 4R0JA 2V4JA 5LMUF 7AT1B 4LFBJ 4QIEA 2NYHA 3JQKA 3GG1A 2FZCB 3BZQA 2BX6A 1VIOA 1R0BG 3NNHA 4K4WA 1HNZF 4OX7A 3BGOP 1RWUA 3T1AA 2VFUA 4JI2F 2FY8A 3IFEA 4A8SA 4FBTA 3GQCA 2VDIA 1RBAA 2F8HA 1TAUA 1B0PA 3I31A 1F5AA 2R8HA 4DR7F 1FDAA 1FRLA 4K4YA 4USMA 4JOUA 2CAJA 4JP8A 1JLEA 1R31A 4ZPBA 4ZMMA 1FD8A 4QWBA 2DGUA 3EZ5A 1VRQC 4C2MA 1BWVA 1F3VA 1TVRA 1U8WA 3PM9A 1TAQA 4P71A 2UUAJ 1JB0C 3TUPA 2DNGA 4P6QA 3RAXA 1TVRB 3QLHB 2V2KA 4P10A 2I9SA 2QLJB 3KFWX 4A8QA 4LRCA 4NZ7A 1UEKA 1SQEA 2IJNA 4AYBD 2IAJB 2YTCA 4DV7J 4MYUA 2BA9A 3CJ4A 4C98A 1L3SA 1SJFA 1AZSA 4X4QA 2KJWA 2RQKA 2J76E 5J2NA 3LALA 3VAKA 2R2RA 4BHQA 3D6MB 3BGRA 3CULA 1AZSB 1VHIA 5J2NB 2RRNA 2DY1A 4C11B 2R2SA 3T5HA 1M5KC 3GYGA 2HFVA 3ZNJ1 1IR1A 1JJCB 2MLYA 2W24A 1N32J 3WIUA 3QRQA 2QLWA 4QPTA 4N7TA 1YG0A 2BE7D 1S1XA 4RW7A 2CADA 3NGKA 2LEAA 3JAMU 3W5YA 1P27B 3ICLA 3TW0A 3LWMA 2C42A 2C3UA 5E41A 2BJDA 3QZ7A 1YRUA 1TQLA 5HVGA 3HLUA 2IMOA 3K5PA 3J81U 3PKYA 2KDOA 2HRUA 2W4CA 2Z2YB 4OMFG 3M2RB 3KJVB 2VQEF 3J7ZT 3FUYA 4K4TA 1LW2B 3HHEA 4GRSA 4F4KA 3NXZA 4PQAA 3UI3A 2RRAA 3E2EA 4KB7A 4MT1A 4MKVA 1SH0A 1HI8A 4USIA 3CJ5A 4D3HA 3MTKA 5F41A 3NL0A 1GMWA 4NRTA 4G1QB 4EYHB 5A0YA 3I6PA 2EFQA 3V4IB 1BQXA 1WG5A 3TJ8A 4FVMA 2J7KA 2QA1A 3OLBA 1M5HA 1WEXA 5D4LA 1LNQA 1SCJB 2HVDA 2H4WB 4ZP7A 1NKBA 4Q5VA 4ED6A 1B64A 3W9HA 4FYWB 3K0JA 1FNMA 2GS8A 4JI1J 4Q0BB 3BV8A 2YX7A 4U7CA 1HMVA 2F9DA 3FEZA 2E7WA 1NDCA 5AT1B 3LW5C 2WONA 3H5XA 2D3ZA 5HK4A 3OFFA 1VQYA 5KFSA 1J2VA 3QWPA 5ETMA 1TL5A 2YKPA 5D77A 4WBFA 1WTFA 2ZD1A 3VGVA 2E44A 1WF1A 2AX1A 2P9GA 1TKDA 5LMNJ 2NSCA 3MI7X 3JSMA 4O44B 4Q7AA 2VONA 3MEKA 3PRVA 2MLZA 4PKDB 4G6VB 5CD4H 2GO9A 3TZYA 2Y8WA 4NX9A 1WKKA 4TQRA 1Y10A 1RU2A 1S6PA 4IH6A 3SFGA 5DZ7A 2R7WA 3TOQA 4WP9A 4I6AA 1T05A 1NK0A 1ZAXA 1OS5A 4LSLA 2IFXA 3MURP 3HJFA 2YH0A 1L3KA 4NLSA 2DXEA 2FLNA 3PHTA 3MFIA 4PWUA 3THTA 2LA4A 1Y5IB 4DDFA 1NK9A 1B0TA 5AXMA 5ITHA 1M1KT 2XS7A 3ZZYA 2MQMA 2G2YA 3HMJG 5J1PA 4F4ZA 1HI0P 4MFBB 1RQ0A 1NCLA 5H1SV 4QQBA 2IRUA 1TKXA 2XS5A 3WC2A 4KGKA 1ZS6A 3PACA 3C8YA 2MHNA 5KOXA 2NXUA 1TKXB 1Q4RA 4N5SA 2RU9A 3RBZA 4IOBA 3BYRA 4UOCA 4ZPDA 5C25B 2BQUA 1RBLA 1FDNA 3BH7B 3MPYA 2BJ8A 3UFCX 2DCUB 4ZPWR 3L3CA 2QO3A 1T11A 2BM0A 4USTA 4PPZA 3ENAA 2ZNYA 2Y0SD 3NGTA 2DNHA 2SXLA 2L08A 3AH6A 4IFVA 1H2UX 3UR3C 3LTOA 2IDEA 4FYXB 1HHSA 4DUYJ 4IFVB 1KOOA 3QRRA 2WW8A 3R9LA 2LYVA 3QFWA 3CPWR 4YHHF 3SI8A 1U25A 2KRBA 4TU7A 4C3MA 3N6LA 3QT5A 1B70B 6FDRA 3G6YA 2LEPA 1R27B 3CXCR 2V69A 4CTAA 4FNHA 2G2ZA 3SQGB 1S0OA 2HYIB 5D4NA 2R8JA 3ILIA 4DUZF 2KT2A 2V8GA 2ROPA 1T9YA 4CT8A 3KXDA 3X1LB 4XTTA 3NKYA 4G3IA 1SV5B 1IBLJ 3IR7B 2XMAA 2V68A 1B3TA 1VQ7S 4IO1A 1S79A 3GE9A 1UW4A 3TA2A 3LP0A 1FNOA 2P8IA 1RT7B 4CO1A 2PDAA 4KRWA 4B9TA 2HHXA 5HVFA 2F8EX 1FFWB 4FKYA 3VF0B 4Y3CA 3IWXA 4I68A 2MZTA 4RBTA 4CLWA 4P9SA 4KYZA 3Q2TC 3HHLC 1I94F 1OQ6A 1W7WA 3RJMB 1RWVB 2XZWA 2JC0A 1WG1A 3PYDA 2HBZB 4JUZA 3RRHA 2R8GA 4NCBA 1D3WA 1NPPA 3EGNA 5DQHA 3MM6A 1VI7A 4NASA 2EI5A 1T03A 3TUJC 3M8WA 2A10A 3K59A 1IKVA 2HHHF 1XMBA 3MM6B 2BRLA 4B3RF 1Y3JA 1QTNB 5MLCV 3CJSA 2EBEA 3Q86A 2AJFE 4WXOA 2W25A 4ES1A 2IC3A 1OO0B 2MMYA 4U9RA 1WG4A 4KJIA 3C16A 3IC1A 1FX2A 1JLGB 2QX0A 1MN9A 1FWLA 3W8GA 1ROFA 2UXBJ 1S0VA 4OZLA 2IC3B 2UU9J 1NSAA 1QVFR 3QGHA 1FE0A 4ZCIA 1T0TV 4YDDB 4PR6A 4AD6A 3CTRA 3HZGA 3IS9A 2N4DA 1WHYA 4CLLA 5KFKA 5FLXY 4GKKF 3R5DA 2VQFF 2YX4A 3GFXA 1HHTP 4HH0A 4WWSA 4ITSA 3MEGB 4HT7A 4UOFA 1QTMA 3L7OA 3RW7A 3MR7A 2HGMA 2CQDA 4RNOA 2QSFA 1DURA 2BOPA 4UY85 4ZP8A 3BBCA 2P6SA 5KT5A 1PILA 3SXLA 5DDQC 2O67A 4DR1F 2H5IB 4NWBA 3GG0A 2KH9A 4OYXA 2V8DA 4X66F 2FY1A 2RIJA 1FEHA 4DR6F 4WYWA 2B8QA 4J9UE 3VAJA 1UEVA 3JXOA 4Q45A 4OL8A 3DXSX 2V4RA 1VR6A 2OH2A 4YB1P 2MGZB 3UR0A 1VQMS 2QA4G 2CQ1A 1QD1A 3V5RA 2A2CA 2HVIA 4C8OA 1WSVA 3D3CJ 3BO2A 2HG4A 1KVKA 2IJFA 2W7PA 2I2YA 2H3EB 3WC0A 4HDHA 2ALZA 3CEDA 1N52B 2DNOA 3GFHA 3P5BP 3ITHA 2DGXA 2L48A 5HBMB 3QYYA 3F73A 1XK8A 3D54A 3MMAA 2R7RA 2AGQA 3VVUA 3Q8PB 1MU2A 3K17A 4X64J 3K5OA 3PY8A 4QIWD 2HZAA 4ANEA 2UV8A 2NXCA 4LFAJ 1MU2B 2QLXA 4OIXA 1KTVA 2CZ4A 4DN0A 3RZAA 4E8UA 3AQOA 3VAMA 2E1CA 4LF8J 2EK6A 5DO2A 2CJQA 5LM7E 4HHJA 5I42A 3BYPA 2HS0A 3AOCA 3CDWA 1RU1A 4LR9A 2G1HA 1TP7A 2YWHA 5ADZA 4RBVA 5EX0A 1GNKA 3DOMA 3OXLA 5HQMA 1VQ6S 1KKHA 1EHWA 3GPAA 4G1IA 4RW4A 4ZS6A 4DOZA 4ID5A 5B09A 5BXIA 3AD8C 1BHNA 1LXJA 4MK8A 1OYEA 2E5LJ 5DQGA 3T3FA 2NUHA 4TYAA 4ID5B 1DQ8A 2ZJQQ 3GIJA 2PA3A 3LP2B 3G6ES 3JTOA 2RE1A 1QAXA 3BKFA 5HSPA 2VG7B 2WK4A 3Q0AA 2OKQA 5F9LA 3JS9A 2VBZA 1RTIB 4OI6A 1KD1T 2EK1A 4DF4A 3DMJA 2ROEA 1DLOA 4DR5F 2E5HA 3OTEA 1A6LA 4WKRA 5G0RA 2KYZA 1LW0A 2VBXA 3FBBA 2DR9A 2A18A 2XC9A 4J9NA 2EXUA 1S1VA 1RKIA 2XULA 4DZDA 1TU0B 1FKPB 3M30A 3ELHA 4CRJA 1S1VB 3VZIA 3MECA 3PW2A 4UOHA 3ZZTA 3CVKA 3OHAA 1HIYA 2A1BA 2GA7A 2VOPA 3KJNB 1YSJA 3KJFB 4NLXA 3I56S 4LF7J 2JH3A 1X4EA 4ZHRA 4ZCLA 2FVCA 2OP5A 2LU2A 2ILZA 4CYUA 1K8AT 2Q6BA 4OZ1A 3N0VA 4ECZA 2ACYA 3FQLA 1NKCA 2B51A 4CYUB 2FHJA 1XNQJ 2V8HA 4CNYA 4NMXA 3M9MB 4F4AA 4DPUA 2KU7A 1WC5A 3NCQA 2AJ0A 3KYLA 3SFUA 4XAKA 3W2WA 4U95A 5K8NA 1V3RA 3EGVA 4ZLLA 1R6YA 1C2PA 1B0VA 1M5OC 3PIPQ 1O8BA 3W2WB 1DY3A 2VJUA 3AXKA 1KNZA 4Y00A 2ZZTA 2FJXA 4ED8A 2V94A 1GMUA 3OR1A 4DV0F 3IMQJ 3GIIA 2PIIA 1REGX 1Q53A 4RW8A 3H5YA 3ZZUA 3HO1A 3MR3A 4R0EA 2FB0A 3QSYB 2MY8A 5LMUJ 3GYXB 3L95X 1NM2A 2AJQA 2V9WA 2YNGA 4F26A 3CIZA 1SQFA 1VFJA 4JI3F 3W61A 2HFSA 4Y2MA 5KT4A 4ECSA 1HNZJ 2J0QD 1IBCB 2CVIA 4ED2A 1UEUA 1RADB 1S6UA 2OD6A 3CCZA 1JXLA 2VG6B 1G3OA 5ETOA 4ANDA 4LMZA 2U1AA 4I0WA 1WWHA 3VAGA 1N36F 1RAEB 2V67A 2MZSA 3ZTPA 1RT2A 4IG0B 3BB5A 4DR7J 2Z58B 3L4BC 3NEKA 3EVOA 1VC5A 4MIBA 4YB7A 1S5ZA 3T19A 1RT2B 1FEEA 2AV5A 4O23A 5HN0A 3NY0A 2DRBA 4KFBA 4K4SA 4MMOA 4WK1A 4X4PA 4A8FA 1WKLA 4WU3A 5I3PA 3MM5A 1NEEA 3S7RA 3H20A 3MR5A 4K4VA 2IM3A 3TRGA 3MMCA 4HH1A 3IGVA 4GC7A 4M5DA 4ZVRB 4F0KA 2CQIA 4KSEB 1NZAA 1RT5B 5HJYA 2YKNA 4YFUA 3FRYA 1S10A 4M5DB 1V3SA 1S9FA 1E6YB 5AXNA 3GSDA 1VK3A 1KC8T 5DM6Q 2X3DA 3DU5A 4QR0A 4LQ3A 4C0HA 2EWHA 1REVB 3HFKA 2YQ3A 2VJVA 1LWFA 5F3ZA 4HEA9 2HIYA 1H38A 5EDWA 4CM2A 3EPIA 2Q79A 2YWWA 1F9HA 2B4PA 2Z2LA 3HDSA 2I1RA 3OFGA 4DL7A 3LPEA 1BXNA 4DU7A 4EFAC 2ZBPA 1S9GA 3E3XA 2QLFB 3OUYB 1HWLA 4DLGA 2LEBA 4K8RA 3V4MA 3UN2A 1HWJA 1VK8A 2AJ4A 3HVAA 3W65A 4QU7A 4FVCA 3N9UC 1RHKB 2EEYA 4F36A 2VQEJ 1EQ0A 4OZ2A 2Z2ZA 2FJDB 3M2VA 4TXSA 2H1YA 1XMQF 4HACA 4ZPAA 4KH1B 4Y2IA 3SZ2A 2XZTB 3M2VB 1FWPA 1J5EF 4UQGA 4HACB 3BKTA 1O6XA 4LRBA 1H98A 4HHHA 3PW0A 1HNXJ 4NE9C 4P52A 4IOAQ 4Y6IA 1DTTB 3P49B 2MZRA 1FT8A 2C2NA 4ID8A 1AYEA 4KGXB 4FNIA 1LFPA 3IBWA 1RT6B 1NK8A 2E1PA 1YX2A 1ZA2B 2BVZA 2VF3A 1RT3B 5L1LA 1U1RA 3GCWP 1Y11A 5THWA 2D1CA 4O4RA 2NPFA 4CO5A 2AKWB 1QUVA 1KQKA 2DXFA 5HP1A 3EPGA 2F1FA 2HIQA 2CG8A 4NA1A 9RUBA 4JI8F 4NLOA 2ASLA 4CZCA 4DFPA 3M1VB 1KLNA 1HPZB 5JJBA 2B6AA 2COLA 2DRAA 3NS6A 2HQFA 5GADU 1TKZA 2QV6A 2QA2A 2NQPA 1TKZB 1JLQB 2CQPA 3HVTB 2IY5B 3GONA 3ISND 4QIVA 3VTIA 3R7NB 2HBQB 4P73A 1IBKF 5KG6A 3AODA 4RR5A 1DZ5A 2YXLA 3FCVA 3AB2B 1OY9A 3V6DB 1RT4A 5HMXA 5D3GA 4UT4A 1JMTA 1VOMA 1RABB 3H4BA 1BY9A 4M8LA 4HHUA 1W25A 4RUHA 4JV2A 3M8ZA 5A8RA 1UFLA 4UUXA 4C8YA 1LWCB 1RA7A 1HQEB 2DO4A 2IPOB 4P7VA 2VV5A 3OR2A 1ZYQA 2UUBJ 5FDLA 1WACA 2WOMA 1C0TA 4IUFA 3V81A 2XNRA 4ELTA 3OR2B 1S1TA 1NLKL 1YLXA 4QIGA 3FBEA 1UAWA 3DOLB 2CPFA 2HNDA 4WZMA 3MDFA 3PRBA 4W92B 3BPSP 1EJ7L 1S99A 2YKMA 1MWZA 2FJAB 3KTQA 4ZITA 3I9V9 2VICA 4C9DA 2Q1LA 1OPZA 2WSEC 4KGVB 1L3VA 3A8IA 3H90A 1IJFB 2OTLS 5M2RA 1X5TA 1YBAA 2G9OA 4C0BA 4Y28C 2R7SA 2GQ2A 3SQOP 4J9KA 4C3KA 1H72C 4DCOB 1D8ZA 4YHHJ 4EK2A 2XLJA 3QJJA 5C2CA 3MD1A 3QT7A 3ILLA 1WC3A 3HHLB 4DX6A 1LQ9A 3CJKA 5B0FA 2MKKA 3HM9A 3D9BA 1SL0A 4JI6F 3KDOA 1IJEB 4OHZA 4MAKA 5E5NA 1WOOA 3OTBA 3CJKB 2RRBA 2OPRB 2RUGA 4WYLA 2OJ3A 2HFZA 3G6XA 1YJRA 2UUWA 2XY5A 2FJEB 3DLEB 4KR0B 1OSDA 2J9DE 4DSKA 1RTDB 3AFGA 4JV5F 4AXJA 2F5GA 1NPRA 5AE2A 4F50A 4X4UA 3OTDA 4CLYA 3M8QB 1LK7A 2WVEA 2QE5A 5IV4A 3OW2R 4X65F 4RW9B 1G1XA 1JKHB 1FRHA 5H9EJ 2GGPA 4M5HA 5L38A 5GADI 3IM9A 3FFIA 3OL8A 3KLHA 1H3DA 4OHWA 4F3OA 4LFBF 2AGPA 4B9LA 4NEZA 5E2QA 3ZC4A 2GGPB 4E0DA 4FYYB 3KLHB 5L9XA 2H4YB 1U1PA 4TU9A 2ZKUA 5B08A 3CDAA 2ZEJA 1NB7A 1P9QC 3OHBA 1FXDA 1OYDA 2X7IA 2E7VA 5HROA 1WUUA 3MPUB 2LDIA 1S12A 1XR7A 2RS2A 2J0XA 1G6BA 4B3RJ 1TKTA 1SC6A 4KKOA 1HR0F 3UD3P 4ZPVR 1UWBB 3G82B 4EZ9A 1NK6A 5J2MB 3VGUA 2OPPB 5KTQA 2ILYA 4AUKA 3PV8A 2YNHA 4RKUC 4E2FB 1LWEA 4UUWA 4P7TA 2RQCA 2J8AA 1HLWA 1U1NA 3KKFA 2UUAF 1LWEB 5L9NA 1NAQA 1PAEX 2DH9A 2V0NA 5MAOA 2VQFJ 3HSJA 3I32A 3MPWA 3B54A 5HAOA 5A2QY 3PVXA 4CLUA 3AXMA 4QWDA 5GAGU 7FD1A 2DGVA 1QY7A 3MHYA 3QNWB 1SC3B 5I4MA 2H65B 1NJYA 1RDRA 2R7VA 3F41A 1EETA 3DGPB 4DR1J 4OJHA 1Q16B 4Z7YA 5J2QA 3H0PA 3I0RA 3A3OB 2J7WA 2PGCA 1KQFB 4X66J 2FLOA 1EETB 4IR1A 2M8DB 2RF2A 5M2PA 5LXRA 1EP4A 4RWXA 2E9RX 3W66A 2ZITA 4M5GA 2CQ4A 2RF2B 1RWXB 3MPVA 2ZH6A 4QPXA 1VIXA 2W2NP 2ZE2A 4DSJA 1FRIA 1RB0A 1U2CA 3T1YF 1Q7LB 5C5JA 2RMLA 1GTHA 4ECTA 2ZE2B 1Q81T 3M2UB 3PJ9A 2RDIA 2HHPA 3J7AN 2E9TA 3MGJA 3AD9C 4KC5A 4O3NA 2Y1LB 3CT9A 5HL7Q 4F67A 2PSZA 1S0MA 2R7XA 5F8HA 4DL4A 1RLDA 3PRDA 5D8HB 2UP1A 3H59A 4IG3B 8ATCB 4X4VA 5KOWA 3CDEA 4G65A 4DX8H 5DLFA 3ETMA 1VQ4S 3OL7A 1TL1A 5K20B 1VQ8S 2JZ5A 1HWIA 2HFUA 2DH7A 5B0CA 1VRUA 1F9EB 4O0IA 5C24A 4CH0S 1ZBTA 3R27A 3S6EA 2CXEA 5EWFA 1HQUA 4PUOA 2PN6A 5C24B 2CVEA 2IBOA 3QMQA 4F25A 1HQUB 4PUOB 5LXYA 4J37A 5E33A 1HWUA 4Q44A 4ZVPB 1IN0A 2Z30B 3FBCA 4QYZJ 1CJTB 4DPOA 3POTA 5IT9Y 2M7SA 2XYGB 4OJGA 1C1CB 3OTCA 5IZHA 3POTB 2RDJA 3J80Y 4LFCF 4K5RA 4OX6A 4WKYA 2HK3A 2RAQA 1UPMB 3UW1A 2ZHBA 2ZH3A 1Z2LA 3G96A 1KSPA 3HSGA 4EUVA 2DTJA 1YK9A 3BBFA 2JWNA 1HW8A 2P2CB 3A4TA 2XB2D 3TWZA 5LJ3Y 4L3NA 3OXGA 2J0WA 4CO0A 4DR5J 4KT0C 2R7UA 1RP5A 1DTQA 3RAMA 3US5A 4WXWA 3HFZB 3PX4A 3O2IA 3QAUA 2XG8A 1YKWA 4DR4J 2WW4A 1QAIA 2JEJA 5C42B 4A4JA 1PKUA 3OJSA 3OVAA 2G0CA 3PX0A 1CULB 2VPYB 3BBBA 2GQQA 5IS2A 4CH7A 2WVBA 2DIUA 2V2ZA 4I6WA 3VQTA 1WHWA 2YQ0A 3NGDA 5LOQA 1N6QB 2X1AA 3MM8B 1X9MA 4NPOA 5KG0A 4LIRA 3T41A 2NLWA 5A6PA 4LSZB 5KFDA 3S1TA 1H7XA 4LR7A 2R2TA 1E6VA 3VGTA 3B8HA 5C7PA 2PI5A 4PYDA 2AHOB 2JSXA 2M88A 4J9VA 1E6VB 2W9AA 2FQQB 3CF5Q 2ZFHA 1S72S 3D6HB 1SI9A 3Q22A 4EZ6A 2DGQA 4UZCA 5KFHA 3AJDA 1U45A 3PJXA 3B78A 3J7YU 3MMJA 2XSFA 5B0AA 1UTAA 4WTYA 4OYWA 4ER8A 3DHWC 5B0BA 4ZVOB 5C2GA 3ISNC 4K2JA 5IXUA 2A3JA 2Q43A 1H7WA 1N4LA 4NXNJ 2LVWA 3Q8RB 1T7PA 1EIYB 2PMZD 2OEKA 2OFHX 1L3UA 2LDYA 4DUYF 3JYTB 2POKA 3KG0A 5KG4A 4L3KA 3I0SA 2OSQA 3C15B 4JI3J 1NBEB 4BDPA 1T3OA 1WC6A 1EAYC 3I0SB 2GJIA 5DDRC 2W2MP 2VD3A 2FHOB 3DHXA 2ROGA 3PTWA 3EZUA 1KFDA 1O51A 2M52A 3EX7B 2CDQA 3FCWA 2QFIA 2FC9A 3UDCA 4DPYA 4URGA 4FN5A 3HF5A 3HP6A 2YNIA 4DL0C 2KHCA 1N36J 2MQOA 3ULHA 2QZ8A 1A9NB 5KG7A 2MQNA 5KFFA 2C3MA 1R8AA 3CGIA 1WHXA 4HLBA 1DQ9A 4P2MA 3AA9A 3G4SS 2VUGA 1HI1A 3G9CA 4O3QA 5IM0A 1PBAA 4WFZA 2J0SD 2VFSA 2DB1A 4DU8A 2Q6CA 3D2WA 2AJ2A 1F9FA 5AXLA 2BM1A 4USJC 2V2VA 2GHPA 3AOAA 1N0VC 1RHMB 2EBGA 1YJ9S 2MKYA 3OBIA 3BR9A 1YBUA 4DCJB 2BE2B 3NP5A 2N3LA 1A0OB 1P8GA 2GVZB 4ZOSA 2IRXA 5ETLA 1Y4ZB 3IRXB 2K7JA 3P4UB 3KK2A 3KLGA 3N28A 5K14A 3SSRA 1CC7A 4N77A 2ZOFA 4BBYA 2XLKA 3W3SA 4CO4A 3MAAB 3MAHA 2OEMA 3KLEA 5KFEA 1K44A 1VBXA 1S9EB 1BD6A 3WHIA 1LOUA 1SKUB 2DR5A 2K1RB 1K47A 2MSTA 1WEZA 2B3TB 3D3BJ 3KLEB 3UCZP 3ZZZA 3C19A 4CLFA 4FP9A 1CJUA 3NWGA 2JRSA 3F0NA 1EZZB 2VC1A 4Q8FA 3R7BB 4JV0A 3MPDA 2DHHA 2Y9HA 2XMMA 3GV8B 3J7YI 5D78A 1U7LA 3GILA 2FIUA 4U67Q 4ECVA 2FZKB 2OSRA 4C8NA 2Z56B 1CBKA 2DGOA 1IBMJ 1P1TA 3QO9A 4LVOP 2WSCC 1RWOB 1D09B 5H9FJ 2VG5B 1XMQJ 3M8PA 2ASYA 2HGLA 4HTIA 3QO9B 3IWNC 4C0OC 2GO8A 3DDKA 3RR8A 4PEOA 1GMWD 2X51A 1NU4A 2A2DA 4FKXA 1D9FA 3M8PB 2UVVA 2BE9B 1XIQA 2DPIA 1ZM2A 1FK9B 1JNRB 4URSA 4FDFA 1QSSA 3U27A 2VPXB 4XPEA 2HVEA 2RQMA 5KT6A 1U8SA 1VRTA 3LOUA 2QC3A 4U6PA 1SJ1A 3EYZA 4ES2A 3NS5A 4KPYA 1RCXB 2GAHC 4DPTA 1SC4B 3D67A 4OX9J 3DRXA 2OIHA 2I8EA 4ED1A 1RAIB 1HBMB 4R8UA 3LP1A 3KHHA 2VHGA 4KAIA 1LK5A 1HQ2A 4JI8J 1N5YB 5AE3A 2Z0GA 2HFNA 2B4UA 5A8KB 2W1BA 5D0GA 2DNNA 2HNZA 4P75A 1BQNB 1HNWF 4JYAF 3HSZA 2R2UA 2KFZA 2M0GB 3PG9A 1RBOB 3W2VB 5EUHA 4PQUA 2LKZA 2MY7A 2XHWA 4YEAA 2ASDA 4RZRA 4P74A 3R5CA 1IBKJ 2GAGC 2CJBA 5L1IA 3CJ0A 2MHEA 4J9QA 2GMJA 3R2DJ 4PCQA 4USWA 1VQKS 1C0UA 5SZTA 1RCOB 2DYAA 3N6MA 2E5LF 2XCAA 1VQLS 1XN9A 4OYMA 3HD1A 5IWAJ 4O4GA 4J9RA 3HD2A 2DISA 3UVJB 5L1JA 3GJTB 1VCTA 2IDLA 1P6TA 4P2FA 4GKJJ 2A6MA 2DCLA 1NKEA 4YOEA 3U02A 2BABA 4P2SA 5GVQA 2LQ5A 1WHVA 5F8MA 3CCRS 3UD4P 2J9CA 5K8PA 2DNMA 1QAJA 4L74A 4DV6F 4DPXA 2DRDA 2CNOB 3KUGA 3TI0A 2N3OA 4CDIA 1EKRA 3PR4A 3BN7A 1W2BR 3L9ZA 2OD4A 2BJ3A 5EWEA 1VQPS 4TKTA 4O0NA 1J5OB 3V6JA 2HWTA 2PE8A 3GJQB 2J7UA 2V8VA 1G7CB 2JL9A 2PMHA 1AB8A 3CCJS 3IBFB 5U47A 5E7OB 5KFMA 4LF7F 2AEMA 2NXJA 2V34A 1LXNA 1WI6A 4PG7A 1DBDA 4WK3A 3WBZA 3DLJA 3VAFA 5FLXU 1Z1ZA 2G13A 2I38A 4H4OA 3I5BA 3TA1A 4OV6A 3OL6A 1NJIT 2MKCA 3EGZA 5DLGA 1JWWA 2OFGX 2DK2A 3MM9A 1WJ9A 3QPIA 2QGFB 4J9LA 4ETZA 2HQGA 2PFFB 1U09A 2F40A 3MM9B 2PMWA 4YR0A 4DSLA 4JV5J 4LF6J 1JJ2R 5KFWA 2P9EA 1TL4A 1FVSA 4B3OB 4DV5J 4HYKA 2CQ2A 2YH1A 2AX0A 4GVBB 2YQ1A 3N5BA 2VB6A 4KPCA 3EM1A 2C2EA 4TY8A 2HHUA 4NYOA 4KV8B 2QJ3A 3A8KA 4EU0A 4RW6B 1Q8KA 2WVDA 1N33J 3K7RA 4M1KA 4TY8B 1S57A 3M8RA 1VDHA 3AJ1A 2ABYA 3DOKB 1L3TA 3D0HE 3K58A 3KMQA 3HHDA 3RAQA 2CYYA 4OLPA 5E3PA 1KVIA 2UVUA 3HT0A 5KAKA 2K3IA 4EGLA 4ED0A 4KO0B 3BN4A 2RT3A 1RHUB 1ZAWA 1QUPA 5F8NA 2GCFA 4F04B 1HKAA 1UCNA 3H98A 5KFUA 1HR0J 1XQIA 1VQSA 4ES3A 3R5JB 5EN1A 4ZLPA 1FJGJ 3GIMA 3M9OB 1X4BA 2IM1A 4B3TJ 1S59A 4B9UA 4PWDB 4OYOA 2AJ1A 4O3RA 2YBVA 2PT0A 2Z4PA 2KXNB 3DDIA 4F2RA 3QLHA 1ITPA 1FJCA 1O0PA 1Q5YA 2IAJA 3IAS9 2P6TA 5AJ3F 1NH7A 1HA1A 3A8EA 4A46A 3UPFA 4OI0A 2RHSB 1HYSB 2B9WA 1S6QB 1QVGR 2D7SA 2DHGA 2KI2A 3WZ0A 4OYIA 2D41A 3MXHP 3AHPA 4C11A 2CPHA 2JVOA 4L75A 3MD3A 2AYBA 1F60B 2OPSB 3Q8SB 4K7QA 5DQIA 3MUMP 4IRKA 3NAIA 1NZ8A 3B6BA 2XSJB 1IM4A 2MDAA 4G1PA 3IGNA 3A1YG 2DXDA 4X4OA 3FRZA 1OSCA 3T1YJ 1SC1B 5KFZA 2QG9B 3BM7A 1ZM9A 1URRA 4K4ZA 3QBCA 1BQMB 4RL1A 2Y3YA 3MFHA 4ELVA 4OI1A 4C8MA 2IVMA 2ZH7A 1FF2A 3M2RA 4HI2A 3QSIA 3KJVA 4ZCKA 1VGYA 2QRRA 1JLCA 2K2PA 5DDPC 1LW2A 2FD2A 2BRKA 5A8WB 1IQTA 4DV1F 1JLCB 3ZTSA 2YY3A 1YGYA 2B7BB 2VH7A 1R3NA 3M8SA 4HDGA 3TUIC 1F2HA 2VU5A 4YB6A 4S0MA 2ADCA 2BKOA 1PG5B 4G1QA 5JXSA 2W2QP 1R43A 3OPKA 4AT1B 4OI2A 3V4IA 4QW8A 3T5LA 3CWJA 1DHMA 3C14B 4N47A 1KN6A 1EQMA 4DG1B 3CMAS 5FJ4A 2K06A 1Q0NA 3N79A 3IRWP 1HNXF 2L9DA 3TA0A 1FXLA 5T41A 4TN2A 2J6TA 2KG0A 4Q0BA 2G0IA 5D0HA 3A13A 2A0FB 4DCPB 1X4HA 3CC7S 4Y34A 1MWQA 3BGUA 4LFCJ 3GV7B 3HKWA 2FHKA 5CYMB 1OWXA 3VVTA 3QWUA 2W8LA 4IR9A 3T5JA 1CS4A 2KVQE 4LUBA 1KEKA 3GLJA 3PFOA 5E3QA 2QMUB 1AUSL 4N41A 1CS4B 1CJVB 4OYAA 4DL5A 1CSJA 2X1FA 4O44A 3TAMB 3FK4A 4AL7A 3F44A 2VODA 3PDNA 1SXLA 2RB7A 2HHQA 2MLXA 5HVHA 4IH5A 4Y65A 3I82A 1HARA 2ASJA 1A7GE 4TU8A 3FC9A 2JNJA 2ZH9A 5KFTA 2QN6B 3RB6A 4U7UD 2EC0A 3CNQP 1APSA 4EWTA 2CPXA 4HTJA 5KFQA 1VC0A 4ED7A 3RG6A 2FPHX 2LA6A 3UD5A 4WP3A 5T7LB 1QJHA 3G2XA 3GIRA 3LGNA 1N5TA 4IH7A 4RWWA 4JBCA 1UFKA 3WIVA 3FEXB 3MM7B 1PAUB 4MFBA 1RUSA 1KTQA 1N48A 1CVJA 2EKYA 2FHJD 2HS3A 1N56A 4ZVQB 4PRFA 2UUBF 1RTHB 1BE4A 1V5VA 2FVRA 2N7CA 3Q8YA 2HZVA 2OTJS 5C25A 2ZH4A 1ZAVA 2E66A 3DI6A 3W62A 1B7YB 2Z2MA 4NYZA 4ZVEA 3FZ2A 5EWGA 3IR5B 1JIHA 2B8PA 3DI6B 3HKZD 1IKWB 3KK3B 4N56A 1JQGA 4RPFA 3FBFA 5IQQA 3OJUA 1QE1B 4UF4A 5F0WA 3NGSA 3TEHB 4XDCA 3EE3A 4PZVA 3DRPB 1AUDA 2FUG9 1S6OA 4TQSA 1QM9A 3QJLA 3EXCX 1WOPA 1H73A 1RYSA 3QQCD 2ZHAA 2HHVA 3CCWA 2NCKL 2D3OR 1WOSA 3SQGA 4O3SA 1PYOB 4IDKA 3BDPA 4D3GA 3QAEA 1JJHA 3LAKA 3BQ1A 4CLTA 2HNYB 4IDKB 3NMAA 2HSEB 4ZLNA 2HHWA 2IA0A 4CI0B 2E5IA 1SV5A 2HMIA 4QJVA 5KFOA 2NREA 3IM8A 5J2PA 3B82A 1VJWA 3KK1A 5DM7Q 2HMIB 1RT7A 2ZC4A 3DLGA 2OUGA 5D0RA 2VZ9A 1U24A 5J2PB 4FF3A 1OIAA 1S4FA 2E5JA 3KK1B 1FD2A 2B43A 4A8XA 2BV3A 3DLGB 2B7CB 1F5CA 4ZVHA 4DQPA 3IG1B 1X31C 4PG5A 4FS1A 4LF1A 2XHCA 4KGMA 3T1HF 4C48A 3H2UB 3W63A 4Y2CA 3SSSA 1UZDA 2X1BA 3HSDA 4M5NA 5JVHQ 1N8RT 3FVYA 3GR0A 4LT6A 3PO4A 1UKUA 1MW7A 5GAHU 1VQ5S 2C2RA 3CD7A 1K1QA 2GHVC 2CNKB 2BJ7A 1HFEL 2FLLA 1U6ZA 3ENVA 2AQ4A 1TUWA 2JEGA 2Q66A 3B4MA 4UY8T 3EZOA 2CWXA 4QYZK 1ZH5A 3MUVP 1AA1B 4U96A 1FDBA 3G87A 2MB0B 3NNCA 1JLGA 3PFEA 2FJBB 2M8HA 1N5VA 1VMBA 2AYEA 5CYQB 1M5PC 2RDDA 2DO0A 5BJRA 2ACMA 3CUNA 4DHVA 4IKAA 2XGPA 2IVYA 1K0VA 1GXTA 2W9CB 1DAXA 2RKIB 1U1QA 1SH3A 2HAIA 4BS2A 5EX3A 4GO5X 1L5UA 4HVZA 1FVQA 4DUTA 3FSXA 5ETPA 4BCAA 3TP2A 3FGVA 5E0OA 1ELOA 3V6HA 1VBZA 3MEGA 2CPIA 2CIMA 3ZFVA 2MQQA 4C8KA 2R3VA 5KFVA 3HT3A 1B4SA 1X5SA 4UW2A 2DR7A 4AE5A 3NCRA 4NLVA 4DXLA 5BYSA 3CMES 1FTCA 4ECRA 2AWZA 1C1BA 2HKEA 1U6FA 5JVGQ 3BPDA 4OLOA 1C1BB 1SL2A 4X2BA 4X4SA 1ZTWA 1HBOA 3R97A 1U26A 4EMDA 5JUMA 2KO1A 1RJJA 2M2BA 2UV8G 2MGZA 1MNEA 5EHHA 1HBOB 4DSIA 5J1EB 2VL1A 3KNAA 4KHMA 4K50A 3MMBB 2GMHA 3TARA 1YZ7A 3EUNA 4MTPA 4PWWA 2B9YA 3TAPA 3RB4A 4EBCA 1UJ5A 5HBMA 2D9OA 1HHQA 3BO4A 2ZC3A 2EFNA 4WPAA 4FPRA 1Y5LB 4F4WA 1RZMA 4USUA 2DHSA 4H4KA 3JSYA 4TY9A 2QA4S 4DSEA 2KXFA 2Y1IA 3GWCA 3TJ9A 3NNAA 3AJ2A 1FJ7A 4DQSA 4I69A 3TO8A 2M3DA 1UJ4A 3T9NA 1UW9A 3C6TB 2HHTA 2JJ4D 2HQCA 2VA2A 3Q83A 4XPCA 3M05A 1HNWJ 4JYAJ 4LJMA 4M95A 2RSQA 1AROP 4CT9A 1JJ4A 4LF5J 2ZBRA 2IVFB 1U1MA 3NGUA 1YTYA 2IBKA 2D3UA 5GAHI 4NXMF 3DLKB 1G4CA 3A3NB 3H2LA 3QT8A 1AFIA 4A48A 1GK8A 2W9BA 3BR8A 5FIIA 1VJQA 2QIFA 2HQ3A 2XYPB 4UZBA 4U8VA 2AT1B 2LQBA 4NOHA 2W9BB 2NS1B 1RAFB 3Q24A 4NEYA 3LP2A 5F8GA 2I5JB 2EFGA 3BSOA 3BJYA 3TZXA 2VG7A 4Y0FA 4PABA 4TYBA 1RTIA 3OTOJ 2LFVA 1C4AA 5KFPA 4NZ6A 2P9CA 2OGUA 2N82B 4QU6A 2PD1A 1MROB 1XEZA 2FGOA 2F8MA 3NS7B 4M63A 2V9KA 1Y3KA 1TL3B 4DFKA 5DDOC 4DV6J 2H5JB 1FKPA 2R9LA 3JQMA 1YJ7A 3CO0P 4DR4F 5B0EA 2EPIA 4W98A 2A6OA 3R6LB 5CXTA 3C2PA 1X4CA 2V6AA 2XLIA 4ECQA 1LEOA 4B02A 3D6TB 3IP0A 3D7SB 4IFYB 5L8RC 5AXKA 1Q5VA 3GJSB 1JLBB 1U02A 3RUBL 1RT1B 1AXQA 2HGNA 2FJWA 2APOA 1XC9A 2KRRA 5F0UA 4I2PB 4NLUA 2Q3PA 2OI2A 3DRRA 1MMNA 3M9NB 2JFKA 3VALA 1RXOB 2F65A 2OMOA 3DRRB 1H2TZ 3ADAC 3QATA 2JLGA 4YP3A 4NLTA 5A2QU 1WNEA 1FDDA 3E51A 4RU9A 3O1LA 2MKHA 4WE1B 3DLHA 1WD6A 2GJ2A 4RUCA 1LWXA 2HWIA 4EBEA 5T14A 1T9TA 2BW2A 1YJNS 2ZH2A 2QT7A 1PJ7A 2GX8A 3BKUA 1HNVB 3H42A 1GMVA 1R6VA 2DR8A 4K4XA 3KLIB 1NPKA 2ADBA 4DR2F 1S1WB 3PW7A 3MEEB 1BC6A 4FXDA 1JLAB 1T9XA 1Y7PA 4NXNF 2GIFA 1KLMB 2HW3A 4NCAA 4LVNP 1ICEB 2H54B 4I56A 2DNPA 1WEYA 3DM2B 2J9DA 3SCKE 3K5NA 1Y9OA 3VAIA 4MKAA 2FVPA 4QIFA 3D0GE 2BJ9A 2ZBCA 2CQCA 4F3MA 1NSPA 1TFWA 2LP4A 1UVMA 4B3SJ 1Q79A 2V4JB 5H9FK 4QWEA 3CO9A 4MKYA 5ETTA 1UVNA 2VG6A 5LT5A 4A8YA 1FE4A 1TUGB 3CE8A 1VYAA 4J9MA 2CPDA 2DHXA 2MZ1A 2ZJPQ 1UA1A 4IG0A 3TVKA 3P3DA 1TFYA 2FYXA 2CRLA 3IAM9 3FZBA 4XK8C 1DJ0A 2AEJA 3U1MA 3N4WA 2ZBQA 2DNQA 4F3QA 1SVDA 1S0NA 2FLPA 1H74A 2XMJA 1JLEB 2CZVC 2VC0A 3O6QA 4W90B 1TZ0A 1RWWB 2UUCF 4L73A 3KWMA 2K8GA 5IC6B 2CA9A 1NMEB 5IT9U 3VWSA 2J8SA 1WC4A 1RT5A 2V50A 5AJ3J 1IUJA 3I55S 1SJ3P 4AL5A 2VBYA 1KBRA 3J80U 2JHEA 3DLBA 1E6YA 2UXDF 1GFWB 2CUYA 1T8EA 3CDBA 5A76A 3ZZPA 2ZZMA 1FWKA 3LWLA 1M1GA 3DGVA 3LF0A 1REVA 2ZH8A 4OZ0A 1BWEA 1JXEA 3QIDA 2H51B 3W9JA 3SCJE 1WSRA 1CG2A 1YHQS 4RNNA 4Y2AA 3BGRB 4BC7A 1TELA 3KHRA 1FX4A 2R7OA 3JTPA 2XO7A 2V4QA 1R0AA 2EFOA 3HCXA 4ECUA 2UZAA 1RTJA 4ZVTB 4ELUA 1Z4UA 3M6XA 1ZM4A 3DKDA 1VBYA 3OUYA 2FVQA 1R0AB 3CSKA 3AT1B 1RTJB 4DBQA 4ZP6A 3RRGA 4RNFA 4DZ6A 2XMWA 3T6BA 2QTWA 1S1XB 4RW7B 3GJRB 2G0JA 5AE1A 4DF8A 1OY6A 4A8KA 9ATCB 1CQNA 1X8DA 4UOGA 1ZPVA 2MZQA 3K8VA 5KFCA 1NB2A 5DGAA 1RAAB 2JDJA 2HEKA 4B17A 4DV1J 4L6V3 4YDXA 1IBMF 3EWGA 3BF4A 1UVKA 1Q86T 2RH3A 3PJWA 4IQMA 3TVYA 3BO3A 2CPZA 3H8YA 3UNYA 2RVJA 1NHVA 2GW8A 3HI9A 2LMIA 2M5YA 3R7SB 3TVZA 4DQQA 4OFZA 1UWAA 5HLFA 2JEFA 5LL6d 1DTTA 4IO9Q 2ZKTA 3PEHA 5A0YB 1OJ4A 3RB3A 5HLFB 2HVZA 2MZJA 3QFHA 4AXIA 2CZ9A 1RT6A 3PYEA 1UJ6A 1RT3A 2VFRA 4WFXA 2ZZNA 2RUSA 1GEHA 1YITS 3FQKA 4JI5F 1SIWB 3SV3A 3J7Z5 2AU0A 3TYTA 5KFIA 4OX9F 1RHJB 1DARA 2ZDOA 1HMVB 2MQLA 4LIWA 3U1LA 3J7A1 4PYAA 4HT5A 2WONB 3M1VA 4USHA 1HPZA 4DJBA 5HMZA 4LF4J 5BR8F 4B9SA 1OPIA 3DLLQ 2ZD1B 1NHUA 2RJZA 4B3MF 3M6UA 1JLQA 3VGSA 4DLEA 3HVTA 3JSMB 1QLNA 4OI3A 2BZ2A 3I9ZA 5IQ6A 4PXCA 3ISZA 3R8YA 1M0SA 3HPOA 2WHOA 3CB4A 1C4CA 1JK9B 1UFWA 3V6DA 1S6PB 3NOGA 3BSNA 4DFJA 3CD6S 2JLEA 3QIPA 3UN5A 3P8BB 1EARA 2R7QA 1UVLA 1T05B 2IRYA 2KFYA 3VQSA 2VASA 2CJAA 4LSLB 5GAEU 3QIPB 1Y5NB 3D1QA 2JC1A 3BSCA 2XS2A 5SUHA 2DIVA 1GXLA 1LWCA 4I4BA 1HQEA 2G1DA 5KFLA 1ZM3A 1ZTTA 5IWAF 4JB8B 4GKJF 1YRTA 3O44A 3NRBA 4WU2A 2KL8A 4JI4F 3OSNA 4URQU 1S7HA 1SB6A 2XYHB 2NPIA 1FXRA 2DNYA 3VHQA 3DOLA 1WDTA 4TLQA 3THPA 4O3OA 4WFYA 3S8SA 1WF0A 3ZTOA 1SQGA 4J90A 1QSYA 4IOCQ 4ILMA 1YJTA 2BMBA 1IR0A 1D1UA 5D15A 4EI2A 2PFDA 1KRPA 5KG5A 1YVFA 2ZJRQ 3LO3A 1IKYA 3TX0A 1K1SA 1OMSA 4XIUA 4B08A 1EB0A 4WFBQ 2CJ9A 4R25A 1IKYB 3GFZA 3M6VA 2RILA 2CJKA 2F63A 2KM8C 4KIAA 4WTOB 3BREA 2ATLA 3HHLA 5F8IA 1R0CB 3N5FA 3BGLA 1D0EA 3ZTRA 1PYSB 2ZH1A 4PXBA 3R2CJ 3DYAA 2WVCA 1P9YA 2OPRA 3I87A 2CQHA 4USKA 2DGWA 3FNNA 3DLEA 4CO2A 3DYAB 2GC8A 2F9JA 4A8OA 1D9DA 1RTDA 3CCQS 3EMTA 4CTAB 2J6UA 2OLWA 2MKSA 1YI2S 4LF6F 2J9EA 3BSAA 3M8QA 4RLEA 4X84A 4DV5F 1Q8LA 1AT1B 2AEFA 4RW9A 1JKHA 3D1OA 3AA8A 3K89A 4NLRA 1PC4A 4JI7F 3LP0B 2W01A 3UCUP 1UA0A 2XGQA 3T1HJ 3Q8QB 3NGRA 1N33F 3JSBA 2BKPA 3KDNA 4K0KF 2BEFA 1FRJA 2LQJA 4B9VA 3C6UA 3DFEA 3HK2A 4WP8A 1PSDA 1UL3A 2DEIA 3D4JA 2EG1A 2MQPA 2HLUA 4KH0B 3H40A 2DKOB 3C6UB 4NLDA 1SIZA 3R5AA 5IFMA 3HVRA 5IC4B 4DV3J 3I4HX 1QAYA 1N0UA 1PBUA 4CCHA 1SKRA 2QFJA 5GAEI 1NJZA 1UWBA 3G82A 2WVFA 1T03B 1IKVB 3TQEA 5J2MA 2L3MA 2HRYA 2OPPA 1WF2A 1FRXA 4ZN3A 1FJGF 1CQMA 4BLGA 2YWFA 4F0HA 4B3TF 3MUTP 2C2DA 4JI0F 3CCES 1T9VA 2L9WA 4UTGA 3EVWA 4NLYA 4EO8A 2FVSA 3C16B 4UQTA 3NCPA 3QGPA 3ZXWA 3HVWA 2LXUA 5DZ6A 1LFWA 4PXEA 4L72B 1R89A 3PIOQ 2XQCA 2XI2A 2BXJA 3HZEA 2H48B 3NOCA 1CC8A 3IS9B 2UXCJ 1SL1A 1FJEB 4ECXA 1PGZA 3QT6A 2WBMA 4GC6A 4DWIA 3PYFA 3TANA 5M2UA 3O3LA 1PYTA 1N34F 2MKIA 3DGPA 2C2ZB 4EO6A 3HX9A 2VIHA 2ZM6J 1JXVA 5HQ8A 2AZ1A 3H5SA 3PKMA 2GIQA 4HI1A 4ANCA 2GMLA 1PIEA 1I5OB 2CJXB 3FKBA 4XO0A 1RK8A 1XNRF 1VBKA 3KMSA 3ILOA 1PO6A 3K2YA 2E7XA 2XCPA 4ZVFA 2DBBA 2KN4A 4MYTA 4ZP9A 1FHTA 1FTRA 2GFFA 3KLFA 4CLPA 2JX2A 1TK0A 2F7VA 2IJRA 3JSRA 5BYRA 1RYRA 3M2UA 3KLFB 4LBPA 5D4OA 1NDKA 3TEGA 5ETSA 2ZWPA 2B9EA 2MXYA 2BQ3A 1NO8A 5F3TA 3FCHA 4DV2F 6FD1A 4IG3A 4K4UA 2LXIA 1M90T 3B4DA 3Q23A 1RSCA 3MOJB 2BANA 3JQJA 2GJFA 2BANB 3D68A 4DR3F 4ZIWA 3CCMS 3H25A 5E3CA 1KOHA 3ITHB 1YBTA 3MMAB 3LPYA 1RE1B 4PXDA 1CEZA 5KFAA 2BKNA 2C3OA 2Z8QA 3SBMA 1SUQA 4TNOA 2O3DA 4OZ3A 1SKWA 1RA6A 3RRKA 4NLGA 3DRSA 3FDSA 1CJTA 3OQ2A 4E98A 1SUQB 1X4AA 2BJEA 3DRSB 1RAHB 2NXNA 4ILRA 3JB9k 5RUBA 1C1CA 4NXMJ 5I42B 1FNXH 2B56A 5I3QA 4C3LA 4PPDA 3ZO7A 2GV1A 4CO3A 2KYXA 2EVZA 1HWKA 4NL5A 3DOMB 1U2RA 4KBIA 3RR7A 2D74B 2FJVA 5CYJA 1VISA 3EDRB 2KT5A 2EW9A 2KB2A 3GFYA 1KHWA 4RW4B 4AQYF 3I5AA 3ONQA 4K59A 1UZHA 4CWBA 4CLSA 4ZCMA 1QDUB 3TQ1A 1WC1A 4OHXA 2M4MA 3NLCA 2L9NA 1D9AA 5CH7B 2BACA 1Q8BA 1U48A 4ZVSB 2IIHA 4NLWA 2DPJA 4LR8A 4X4NA 3KLVA 3SMZA 1NNDA 5C42A 1S7IA 2HZCA 4HR2A 3RBXA 3RYLA 2N7YA 2I6WA 1BMQB 2IM2A 4DEZA 1X0PA 4YS2A 3DMJB 1DLOB 2KKHA 3EXYA 3NWRA 1CULA 5K8MA 2X1GA 1RTZA 5G0RB 4LF9F 4CNZA 3IWLA 1LW0B 2XBPA 3GR1A 4Z37A 1IWAA 5KG1A 2MTLA 3T6JA 2C2KB 3JAMY 3S01A 2KZZA 3D28A 4Z7CA 1N6QA 3MCNA 2VA3A 3M30B 4U8YA 3MM8A 2AMCB 1U49A 3MECB 4B9MA 2B9XA 3WQPA 3J81Y 3GCXP 5K9FA 4YB5A 3CJQA 4F8RA 4ZVUB 2Y1RI 4J91A 4ZHRB 4J9PA 3IXQA 2LU1A 2MJUA 1I6JA 4X4TA 1NH8A 3EGWB 2LXFA 2NZ4A 4YY3F 4QOTA 2XWYA 5IT4A 2IA6A 3PO5A 3OVBA 2BOAA 1MG7A 1RAOA 3WX4A 5LJ5Y 1U0SA 1SBRA 3NG8A 4IRCA 1MWYA 5CABA 3PW5A 5EGYA 1LKZA 3MR6A 4C8LA 1Q82T 2XM3A 4YMEA 4ZA1A 4DR2J 2V8PA 4J9OA 5LSLA 4Z2XA 2Z57B 3JYTA
chains in the Genus database with same CATH topology
2ZHAA 3MEEA 5E5NA 2B0GA 3OTBA 1JLAA 2HHVA 3CCWA 3CJKB 2D3OR 1IXKA 1KLMA 4ICLA 3SQGA 4QW9A 3BDPA 4IDKA 2RRBA 4O3SA 2OPRB 5DS7A 2RUGA 4D3GA 3OR1B 3QAEA 4WYLA 2OJ3A 3DM2A 1JJHA 2HFZA 3RBEA 4MH8A 3G6XA 1YJRA 3LAKA 4WJBA 2HQIA 2UUWA 1T94A 3HHKA 3P96A 3BQ1A 2FJEB 4RW8B 2XY5A 2NUUG 3DLEB 2WBRA 4KR0B 2YKQA 1OSDA 2J9DE 4DSKA 4Q8EA 4ICLB 2HNYB 4IDKB 1RTDB 3NMAA 4KTQA 2HHWA 1FKOA 4JV5F 2IA0A 4MIWA 2R8IA 4CI0B 2E5IA 4ZPTR 2EFVA 1SJRA 1SV5A 4AXJA 2YNGB 3BGFA 3BS9A 4QJVA 4X4RA 2HMIA 5KFOA 4R0JA 2V4JA 5LMUF 5AE2A 1FKOB 4F50A 4EEYA 2NREA 4X4UA 3OTDA 1DFDA 4QIEA 5J2PA 3B82A 3RW6A 3M8QB 1VJWA 1LK7A 3GG1A 3MF5A 3BZQA 4QR2A 1AW0A 2QE5A 1VIOA 3PNIA 3KK1A 4I2QA 1RT7A 5DM7Q 1YIJS 2HMIB 2ZC4A 3DLGA 3OW2R 4X65F 4RW9B 2VZ9A 1G1XA 1JKHB 1FRHA 3NNHA 1U24A 5J2PB 4FF3A 1OIAA 4BC9A 4K4WA 4OX7A 5H9EJ 1RWUA 1HNZF 2OMLA 3MZIA 3AB4B 2GGPA 3T1AA 5L38A 1S4FA 2E5JA 2RD5C 2VFUA 5GADI 1ZPWX 3KK1B 1FD2A 2B43A 4I2QB 5D4PA 4JI2F 3FFIA 3IFEA 4A8XA 3OL8A 2GQCA 2BV3A 3KLHA 1H3DA 4A8SA 3DLGB 4OHWA 4F3OA 2B7CB 4FBTA 4LFBF 1F5CA 2AGPA 4ZVHA 1S97A 4B9LA 4DQPA 3GQCA 3IG1B 5E2QA 4PG5A 3ZC4A 2GGPB 4FS1A 4E0DA 3VCDA 1YQHA 4AL6A 3KLHB 4KGMA 3G86A 5L9XA 1U1PA 2F8HA 5L1KA 3T1HF 1TAUA 1B0PA 4TU9A 3I31A 1F5AA 2ZKUA 5B08A 3H2UB 3CDAA 4Y2CA 3SSSA 2IM0A 1NB7A 3LH2S 1P9QC 2X1BA 2R8HA 4DR7F 1FDAA 3OHBA 1FRLA 4K4YA 1FRMA 1FXDA 3C46A 5HROA 4JOUA 5JVHQ 1N8RT 3FVYA 3GR0A 3ENWA 4LT6A 2LDIA 5E3AA 3VZHA 3H4DA 1JLEA 1R31A 4ALZA 1XR7A 2RS2A 4ZPBA 1RI7A 1HBNA 3PO4A 2J0XA 1G6BA 1UKUA 1MW7A 4ZMMA 1TKTA 5GAHU 1VQ5S 4KFBB 2C2RA 1FD8A 1SC6A 1GQEA 3G71S 2BE2A 3CD7A 4QWBA 2DGUA 1K1QA 2GHVC 2KTQA 4KKOA 1HR0F 3EZ5A 3UD3P 2NYIA 3MCSA 1HFEL 2FLLA 1HBNB 1WTBA 1U6ZA 4ZPVR 1F0XA 3QJPA 4C2MA 3MM5B 1UWBB 5KFXA 3KHLA 3ENVA 2AQ4A 1TVRA 3PM9A 4KHPF 1FESA 1S1UA 1U1LA 1FA0A 2JEGA 1TAQA 4EZ9A 2PO4A 2Q66A 3MMCB 5J2MB 3B4MA 1NK6A 4UY8T 3IRXA 1JB0C 1ZH5A 2OPPB 3MUVP 2DNGA 4P6QA 3RAXA 1FDBA 1TVRB 4QU6A 2MB0B 5KTQA 2ILYA 3QLHB 1S1UB 2V2KA 3V2UC 4AUKA 3PV8A 3NNCA 1JLGA 2YNHA 4RKUC 2I9SA 3KFWX 2L41A 2YKNB 3PFEA 4A8QA 2FJBB 1LWEA 4NZ7A 4UUWA 1SQEA 4P7TA 2M8HA 1N5VA 4OHYA 1VMBA 2IJNA 2W7AA 2IAJB 2AYEA 4AYBD 4MJKA 5CYQB 2RQCA 3CCSS 3V6KA 1M5PC 2J8AA 2DO0A 2YTCA 5BJRA 1HD1A 1KONA 4MYUA 3CUNA 3KHGA 1U1NA 4DHVA 4IKAA 2XGPA 2IVYA 1U4BA 3KKFA 2UUAF 1LWEB 5L9NA 1K0VA 1GXTA 1NAQA 2W9CB 2DH9A 2BA9A 2V0NA 3CJ4A 5MAOA 3I32A 1DAXA 4C98A 2KXHA 1L3SA 2RKIB 3MPWA 1SJFA 1CLFA 1U1QA 1S9EA 4X4QA 2W7OA 2KJWA 5A2QY 2RQKA 1SH3A 3PVXA 2J76E 5J2NA 2HAIA 4BS2A 2CPEA 5EX3A 3LALA 4GO5X 2K1RA 1GTEA 1L5UA 3VAKA 4HVZA 4QWDA 2R2RA 4DV4F 1FVQA 4BHQA 5GAGU 3FSXA 7FD1A 2DGVA 2WTFA 1M5SA 3BGRA 4BCAA 3CULA 2P5VA 4ILLA 1QY7A 1LWFB 3DXBA 3FGVA 5E0OA 3TP2A 1ELOA 4Q43A 3MHYA 2KFNA 5J2NB 3V6HA 2PA8D 2RRNA 5I4MA 3MEGA 1VBZA 4C11B 1RGVA 1NJYA 2CPIA 2R2SA 3T5HA 2CIMA 1M5KC 3ZFVA 1RDRA 2XWXA 2MQQA 2R7VA 3F41A 3R1LA 4C8KA 2IMWP 1EETA 5L39A 5KFVA 2OH2A 4OJHA 1Q16B 3HT3A 5J2QA 1X5SA 1NK7A 1NJWA 3I0RA 4UW2A 2J7WA 2DR7A 2PGCA 4AE5A 1KQFB 2FLOA 1EETB 3NCRA 4NLVA 4IR1A 2M8DB 2NSBA 2RF2A 2W24A 4KHRA 5BYSA 3CMES 5M2PA 1FTCA 5LXRA 3P5TL 1EP4A 2QLWA 4QPTA 5J1NA 4ECRA 1YG0A 2PI4A 2AWZA 1S1XA 1Z2ZA 4RWXA 4RW7A 2E9RX 1S9GB 1C1BA 3BDEA 2ZITA 2CQ4A 2RF2B 3NGKA 2ZOMA 1U6FA 3MPVA 2ZH6A 2LEAA 4OZ5A 4QPXA 1VIXA 1P27B 7FDRA 3ICLA 5JVGQ 3TW0A 2ZE2A 2VG5A 1NK4A 4DSJA 4OLOA 1FRIA 1C1BB 2YWGA 3LWMA 4QWAA 1SL2A 2C42A 4X2BA 4X4SA 1PC5A 1XTZA 2C3UA 1ZTWA 1HBOA 3T1YF 5E41A 4NLPA 2BJDA 1U26A 1YRUA 1Q7LB 1TQLA 5JUMA 3QZ7A 5C5JA 3HLUA 4Y2KA 2E1MC 2RMLA 1GTHA 2E1AA 2IMOA 2KO1A 3K5PA 3K5MA 4ECTA 1RJJA 2ZE2B 2M2BA 1Q81T 2UV8G 3PKYA 1FERA 2MGZA 2B5JA 3M2UB 2KDOA 2HRUA 2W4CA 2RDIA 1MNEA 2HHPA 4OMFG 5EHHA 1HBOB 1Q7YT 3M2RB 5J1EB 4DSIA 2E9TA 3MGJA 3KJVB 1FK9A 2E29A 4KC5A 5DGBA 3HXMA 2VQEF 4O3NA 2VL1A 3CT9A 3KNAA 4KHMA 3J7ZT 5HL7Q 4F67A 4K4TA 2PSZA 3MMBB 3X3UA 1S0MA 4K50A 2R7XA 1LW2B 5F8HA 4DL4A 3HHEA 2B5JB 2GMHA 3PRDA 3C3LA 5D8HB 2JOQA 2UP1A 3H59A 4IG3B 4F4KA 4PQAA 3UI3A 3TARA 2RRAA 3E2EA 2DNZA 4X4VA 4KB7A 3EUNA 5KOWA 3CDEA 2DJWA 4DX8H 5DLFA 1SH0A 1HI8A 4USIA 4MTPA 3CJ5A 1VQ4S 3OL7A 4J9SA 4D3HA 2B9YA 3TAPA 2DNLA 3MTKA 5F41A 1TL1A 3RB4A 1XR5A 4EBCA 1UJ5A 3KNGA 5HBMA 1VQ8S 3NL0A 3H5YA 2JZ5A 4NRTA 2D9OA 4G1QB 4EYHB 2YWEA 3BO4A 1HWIA 2ZC3A 5A0YA 2EFNA 2DH7A 3I6PA 2EFQA 3TUZC 4FPRA 3V4IB 1Y5LB 5B0CA 1VRUA 4F4WA 1BQXA 1WG5A 2DHSA 5C24A 4H4KA 4O0IA 4CH0S 1ZBTA 3JSYA 3R27A 4TY9A 4FVMA 5F8JA 3S6EA 2QA4S 4DSEA 4NA3A 2XMKA 1R7IA 2KXFA 5EWFA 2Y1IA 2J7KA 2QA1A 1HQUA 3GWCA 1HBMA 3OLBA 4PUOA 1XMOF 3HHNB 1M5HA 3NNAA 3AJ2A 1WEXA 1FJ7A 1XWLA 5D4LA 2PN6A 4DQSA 5C24B 4I69A 2CVEA 2IBOA 4MKBA 3QMQA 4F25A 2KG1A 1JX4A 1HQUB 4PUOB 5LXYA 4J37A 3TO8A 4ZP7A 2W4PA 1NKBA 5HMWA 5E33A 2M3DA 4Q5VA 4ED6A 1UJ4A 3T9NA 1B64A 1HWUA 1Q8IA 3K0JA 1FNMA 2CKWA 1N5YA 4Q0BB 2BDPA 4Q44A 1IN0A 2YX7A 4U7CA 1HMVA 2F9DA 3C6TB 2HHTA 2JJ4D 4QYZJ 2VA2A 3FEZA 4DPOA 2E7WA 3MOZA 4XPCA 3M05A 3POTA 3IO1A 1WI8A 3LW5C 4LJMA 5IT9Y 5A8KA 2WONA 2M7SA 4F02A 3H5XA 2D3ZA 5HP1B 4M95A 3OFFA 4OJGA 2RSQA 1BQNA 1C1CB 1AROP 1VQYA 3OTCA 5IZHA 1X9SA 4CT9A 3POTB 1JJ4A 5KFSA 2OAUA 1J2VA 3QWPA 2IVFB 1TL5A 1FKAF 2RDJA 1U1MA 2YKPA 1YTYA 5D77A 3GYNA 3J80Y 1WTFA 3W2VA 2IBKA 4LFCF 2ZD1A 4K5RA 4OX6A 5CZXA 2D3UA 4WKYA 5GAHI 3CC4S 3DLKB 4NXMF 3H2LA 2E44A 1WF1A 1R8CA 2XY7A 4A48A 1HL6A 1AFIA 2B6AB 2AX1A 2P9GA 1TKDA 2W9BA 3BR8A 5FIIA 2QIFA 2X3GA 2ERRA 2NSCA 3UW1A 3MI7X 2XY6A 3JSMA 4O44B 2W4DA 2HQ3A 2ZHBA 2K7KA 4Q7AA 4LF5F 2VONA 3MEKA 4NA2A 2ZH3A 1Z2LA 1FRKA 4PKDB 3CJ3A 3G96A 4NOHA 2LQBA 4G6VB 5CD4H 2W9BB 2GO9A 1KSPA 2NS1B 4EUVA 2DTJA 5CA5A 3Q24A 2JWNA 1HW8A 4NX9A 2BUNA 3LP2A 1YWXA 2XB2D 5F8GA 2I5JB 4TQRA 2EFGA 4L3NA 5LJ3Y 3BSOA 3OXGA 2J0WA 4CO0A 1TK5A 1S6PA 4IH6A 3SFGA 2LECA 3BJYA 2VG7A 4OV1A 4NCGA 4Y0FA 2R7WA 4TYBA 3TOQA 1RTIA 4KT0C 3LUYA 2R7UA 1RP5A 1C4AA 3TR5A 5KFPA 4NZ6A 2P9CA 2O5DA 1DTQA 1UVJA 2EG2A 3RAMA 2ZNZA 4I6AA 2N82B 1T05A 3US5A 4WXWA 1ZAXA 1OS5A 2PD1A 1MROB 1XEZA 2FGOA 2F8MA 1NK0A 5K5MA 4LSLA 3O2IA 3PX4A 4M63A 4NCGB 3QAUA 2XG8A 3PZPA 2IFXA 2AW0A 1RT4B 3MURP 3HJFA 2V9KA 3CIMA 3CCVS 2DGSA 5D3GB 1QAIA 1Y3KA 2YH0A 2JEJA 5C42B 1TL3B 1L3KA 4NLSA 4A4JA 4DFKA 5DJBA 2FLNA 5DDOC 5KFGA 3OJSA 5CZVA 3OTOF 2KM8B 3MFIA 2K3KA 3OVAA 2G0CA 4PWUA 3THTA 3PX0A 2LA4A 1Y5IB 4DDFA 4FF4A 1NK9A 1B0TA 1FKPA 5A8RB 2R9LA 2VPYB 1IKXA 5AXMA 2GQQA 1ULRA 5IS2A 3MTJA 5ITHA 1M1KT 4CH7A 2XMTA 4DR4F 2XS7A 3ZZYA 2DIUA 2MQMA 4I6WA 5B0EA 2EPIA 3VQTA 3HMJG 5FDLB 2E1RA 1WHWA 3NGDA 5J1PA 4RU2A 4F4ZA 2WOMB 4ZK7M 5CXTA 1IKXB 1C0TB 1HI0P 3C2PA 1X4CA 1N6QB 3V81B 1V6HA 2X1AA 1CPZA 2XLIA 4ECQA 4N8OA 4MFBB 3MM8B 5LSRA 4DL6A 3RB0A 1RQ0A 4NPOA 5KG0A 4QQBA 4B02A 2IRUA 5H1SV 1S1TB 1X9MA 1J5OA 3K5LA 4LIRA 2FTRA 1TKXA 4ZDNA 2XS5A 2VKRA 4IFYB 5L8RC 2C22A 3WC2A 5AXKA 1TV6A 4X62F 1JLBB 2NLWA 4KGKA 5A6PA 3PACA 3C8YA 1RT1B 1AXQA 2MHNA 5KFDA 2HGNA 2HNDB 2NXUA 1H7XA 3S1TA 1TKXB 5KOXA 2FJWA 2APOA 1XC9A 1Q4RA 4N5SA 2R2TA 2KRRA 2RU9A 4IOBA 2JFDA 5F0UA 1X5PA 4I2PB 1U47A 1TV6B 1E6VA 2IYIA 4UOCA 4ZPDA 3VR1A 4NLUA 2YKMB 5C25B 2BQUA 2F4VF 3B8HA 2Q3PA 2PI5A 1R8PA 1FDNA 3DRRA 1MMNA 2JSXA 2M88A 3MPYA 2VBWA 3OFHA 3UFCX 3M9NB 2DCUB 4ZPWR 4N76A 3MEDA 3L3CA 1YJWS 2QO3A 2JFKA 3VALA 4WF9Q 1E6VB 5GMKa 2OMOA 2BM0A 2W9AA 4PPZA 3DRRB 3CF5Q 2ZNYA 1H2TZ 2Y0SD 2ZFHA 2JLGA 1S72S 2DNHA 3MEDB 4YP3A 1SI9A 3Q22A 4EZ6A 4NLTA 5F8LA 1WNEA 4ZPCA 3R5BA 1FDDA 2DGQA 3FMWA 5KFHA 1U45A 3PJXA 2SXLA 2L08A 3AH6A 3B78A 3J7YU 4PG8A 4IFVA 3AQPA 3E51A 4RU9A 1H2UX 3UR3C 3MMJA 2XSFA 2O1PA 2MKHA 3O1LA 4WE1B 5B0AA 4WTYA 3PEJA 3DLHA 3JTNA 2DNRA 1WD6A 1K9MT 2GJ2A 3DHWC 4RUCA 3THVA 1T3NA 1HHSA 5B0BA 3ISNC 4F4XA 4IFVB 5KFNA 1KOOA 2HWIA 5IXUA 4EBEA 5T14A 2WB4A 2WW8A 2ZVSA 2A3JA 2LYVA 2Q43A 1H7WA 3MAQA 1N4LA 2BW2A 1YJNS 2B4VA 2ZH2A 2QT7A 3CPWR 2GX8A 2IYGA 1HNVB 2LVWA 4ZKAA 4YHHF 4DFMA 3SI8A 2DR8A 4WIIA 3Q8RB 4OHVA 1T7PA 2UVWA 1U25A 4K4XA 2PMZD 2KRBA 3KLIB 4TU7A 4C3MA 3N6LA 2OFHX 1L3UA 1GX6A 2LDYA 6FDRA 3G6YA 4DUYF 2ADBA 4DR2F 1S1WB 2LEPA 3JYTB 4V19J 2POKA 1R27B 3KG0A 3PW7A 3MEEB 1BC6A 5KG4A