1FJGF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fjgF00
4X62F 1N34F 4DV1F 4DR3F 4DR4F 1N32F 1G1XA 4JI1F 4X66F 1LOUA 1N36F 2KJVA 4DV2F 3R3TA 2RJZA 4DV6F 2B7CB 1VMBA 2KJWA 2UU9F 2F4VF 4JI0F 4K0KF 5IWAF 3OTOF 4DR1F 4LF9F 4JI5F 1XNQF 1IBMF 1HR0F 2ZM6F 4DR2F 2UXBF 4NXNF 4B3MF 2E5LF 4LFCF 2YY3A 4GKJF 4JI8F 4LFAF 5LMNF 1FKAF 1XNRF 4B3TF 4KHPF 3T1YF 4DV7F 1RISA 4LF4F 2HHHF 1I94F 4DV3F 2BVZA 1HNWF 4B3SF 4LF7F 4OX9F 1IJFB 4DR6F 5LMUF 4B3RF 2UUAF 3T1HF 4JYAF 1F60B 4X64F 2B7BB 2VQFF 1IJEB 1IBKF 2UUCF 4DR7F 4LFBF 4YY3F 1QJHA 4NXMF 1G7CB 2J5AA 4DV4F 4AQYF 4JI6F 1FJGF 4DUZF 4DV0F 4JV5F 4LF5F 1XMOF 4GKKF 1CQNA 4LF6F 5BR8F 1J5EF 1XMQF 4YHHF 2UUBF 4LF8F 4DR5F 1HNZF 2UXDF 2UXCF 1B64A 4DV5F 4JI7F 1IBLF 1CQMA 4X65F 2VQEF 2BXJA 1N33F 4JI3F 3ZZPA 5AJ3F 1HNXF 1GH8A 4DUYF 4JI4F 4JI2F
chains in the Genus database with same CATH superfamily
6AT1B 2DR7A 3O1LA 3TA2A 5THWA 2EWHA 2V2QA 4MAKA 1DTQB 2EKNA 4OZJA 1TMMA 3D1OA 4IQXA 3I9ZA 3CO0P 2ZJRQ 1NK4A 2N4CA 3OTCA 4ILMA 4OHYA 4A8KA 3CMES 2C2RA 2Y0BB 2ZBPA 3QWPA 4PPDA 2I8EA 3T9ZA 1BLUA 2M88A 1KHVA 3CJ8A 2IYIA 3IRXA 3BN7A 5AE2A 3KYLA 1KRPA 3CDEA 2E1PA 2XZWA 1CJTA 2QIFA 3CIZA 4PG7A 3CJKB 4USMA 5LSOA 1WTFA 2NXEA 4DPTA 2HNZB 2ASLA 3RW6A 4C8MA 5KOWA 1QE1A 2I9SA 2G2YA 1YJVA 1N33J 2JVRA 4RPFA 4I6YA 2XB2D 1HI1A 4NLXA 1FFWB 5KG0A 2HK2A 2KYZA 3B8HA 1V3RA 5HL7Q 4J37A 3SDEB 4DR4J 3T9NA 2E9ZA 2QN6B 3HULA 2MQ8A 2GQCA 4IDKA 1PBUA 4NXNF 4Y3CA 3DRSB 2E5LF 4K4XA 2PFFB 4LFCF 3AFGA 4C48A 2MY7A 2IVMA 1ACMB 3BYRA 3GG0A 1ZH5A 1RQ0A 2AU0A 3UCUP 4R5PA 3PW0A 1HBMA 1QD1A 1EAYC 2V2KA 1RT6A 3HZEA 2HS0A 4KPCA 4OHZA 1GNKA 3D0HE 2RAQA 2XHCA 3N5FA 3QLHA 2V4QA 4FXVA 1RTZA 3HK2A 1IKVB 1LKZA 1H72C 5J1EB 1FXRA 2EFNA 3M05A 2B9YA 1REVB 1KTQA 1UEKA 1WKJA 2RMLA 3SIPB 4DV7F 1QSYA 1NCLA 3CF5Q 3QJJA 2NSCA 5DQIA 2HHTA 4ECWA 1HNIB 2V8VA 1VRQC 3A3NB 3GU0A 3I5BA 1HQUB 3UD5A 3LGHA 1NJXA 5KFFA 4DR6J 3QO9B 4OI2A 2W25A 1FK9A 3VF0B 2XO7A 3CCVS 2V2VA 3W1YC 3DOKB 1K73T 1XN9A 1QAJA 2WCXA 1U6BA 3TRGA 2B4OA 4RL1A 3ENAA 1YX2A 4KGMA 4L76A 4CTAB 4FBTA 4IOAQ 1KOOA 1U25A 3VVUA 1C1BA 3QRQA 2R42A 1HWLA 4C6AA 4QYRA 1S72S 2W2PP 2Y8WA 4PUOB 2HFNA 1NMEB 1WDDA 1HPZA 3DI6A 2KG1A 2DNOA 2G0CA 2NXCA 3H0PA 1MMDA 2KDOA 3JQKA 4DPOA 2XLJA 3G96A 3IS9A 5C42A 2Z56B 4M5KA 3DRRB 2B5JB 5I3UA 2DB1A 5KG3A 1X0PA 5CD4H 3DLEA 5A2QY 2QJ3A 3RBZA 2DNYA 4CP5A 1G7CB 3AJ1A 2I5JA 1S59A 1ZA2B 2ABYA 5CCLA 4AQYF 3HKWA 4EI2A 3M2UA 1C0UB 4AQYJ 4RU9A 4DR5J 3QQCD 1RTJA 5C2GA 9ATCB 4B9VA 4C7QA 3ET6A 2Q6CA 3K2YA 4LF8F 3CJRA 2YKMB 4WP9A 3O3LA 2D41A 2XTJP 2MZ1A 1O51A 1BC6A 4FVCA 4I7FB 2I2YA 2HHXA 2DR6A 1CQMA 4X65F 5DGAA 3G6YA 2B8PA 4OJ3A 4XIUA 2R7UA 5H9EJ 3M1VB 1JXVA 4DZ6A 2PI4A 1NSAA 2FVCA 2LXUA 3JTOA 3GJQB 3KUEA 3M9NB 3G6XA 4X4TA 4ZPTR 4CH1A 1ZM9A 4JI3J 3LO3A 5KG4A 4ED3A 1OSDA 3CMAS 2CQ2A 3ZTRA 4M5IA 3GIJA 2DEIA 5CYMA 2EBEA 1CULB 3PRBA 2VFVA 1RAHB 4P74A 1CJUB 1S1UA 1DQAA 4TU7A 4B9NA 4K4VA 3H25A 2AP6A 2H4WB 2I6WA 3O44A 3FBEA 2HRYA 2DPIA 2UV8G 4H4OB 4PWWA 5KTQA 4CLWA 4DEZA 4Q8EA 2OH2A 4DN9A 1VC0A 1JXEA 1H7XA 1P9YA 1W2BR 4I7FA 1CLFA 3CDWA 2COLA 3AD7C 1SC3B 4UY8T 1RWVB 1TKDA 1D9DA 3J81U 2JWNA 3GFXA 4LBIA 1VI7A 2MZJA 4OYMA 1U0HB 3V81B 2MHNA 4HI1A 3FC9A 3U02A 5KFTA 3L3CA 4DV1J 2BZ2A 3KLEB 2VDHA 1WC4A 5H1SV 1WG4A 1NUEA 3FEZA 3NGSA 4ALZA 4Y34A 1VHIA 5HJYA 5GAGU 2DXFA 1JLFB 3MR6A 1Q1KA 3QRPA 3SCKE 1IUJA 1X4FA 5DDQC 2AT1B 2XY7A 2LECA 1R6YA 1S0NA 5MAOA 2ILZA 4N47A 3BEGB 3KUGA 2KM8B 4IYQA 4OI3A 2Z2ZA 2P2CB 4ZVPB 2JEGA 2DGTA 5KT4A 3QLHB 3JTNA 4RW4B 4NOHA 2OI2A 2XMVA 3T1HJ 4LF1A 1UA0A 3OJSA 3UQSA 3VHQA 1F6TA 5GAEI 4ZKAA 4Z7YA 2RRAA 2L48A 3FCHA 5D4LA 3IG1A 3I9V9 3SXLA 1VS3A 1ZZFA 2YQ3A 3EDRB 1TTHB 5HK4A 4N56A 4NMLA 2AIRB 4LF4F 2AYMA 2HVEA 3D4JA 4ZPCA 1DTTB 4DZDA 5KFMA 1JXLA 5ETVA 1HNWF 3N9UC 5IWAJ 1OIAA 3QO9A 1K1QA 1UMJA 4F4ZA 1WC5A 5E5NA 4WF9Q 4B3RF 3MMBB 3M8PA 3NBPB 3OFHA 3A13A 4WK1A 5GVQA 2YNHB 2ZBQA 1JKHA 3HSJA 5CABA 1FEEA 1YRUA 2VB6A 2JDJA 1HBUB 4EU0A 1BQNB 4ZP9A 2N3OA 4P2FA 2DNMA 2C3MA 4LQ9A 3RRHA 3HFVA 5GMDA 1YVFA 4RW8A 5B0FA 3PKMA 3MURP 1RCXB 5F8JA 2IYGA 4IKAA 2FLNA 2P6TA 3KWMA 3I0SA 2M0GB 4JB8B 3IWXA 2BJDA 3KUHA 3JB9k 5AJ3J 2BE9B 3GMGA 4OFZA 2VASA 4EZ6A 2QA2A 2U1AA 2EFQA 1Q79A 2PD1A 3PFOA 3H2VE 4BS2A 2NXNA 1OY9A 3NAIA 1LW2B 2CQDA 2QFIA 4K2JA 1HD0A 3BPDA 4WXWA 3DOLA 2CPIA 3ZZZA 1T8EA 1DRZA 4OZ0A 2IDLA 4M63A 4LQ3A 2C3PA 4O3QA 2LU2A 2VC1A 4FF4A 3ET6B 3ETOA 4HLBA 3MPYA 1OO0B 2YKAA 2HQ3A 3GZ7A 3BZQA 3TW0A 5ETSA 2M9KA 1CS4A 5HATA 3KDNA 2BBEA 3MTKA 4LT6A 4DX6A 3TVKA 5M2UA 2XY5A 2PA3A 2BXJA 1RBAA 3IRXB 4RLEA 4DBQA 1DBDA 1WD6A 1Y10A 2ZVSA 3AY0A 5KG2A 3WC2A 1Q7YT 1BHNA 2KXHA 4MKVA 3QGGA 2AQ4A 2A3JA 1RHUB 2CQPA 2OUGA 2V63A 1FD2A 5L1IA 5IT0A 1PYSB 1T02A 4YR2A 3FSIA 2MZRA 4LVOP 4U7UK 5B0CA 5IZHA 2CPJA 4PUOA 3PFEA 4XDDA 3MMAB 1T9XA 4MK7A 1RTHB 4DUZJ 3A8EA 3I5AA 5LMUJ 5L8RC 2C2DA 1FWLA 1GXTA 1IR1A 3M2RB 3QGIA 2XWYA 3LTOA 1Q0NA 1X5TA 3DOMB 4PXEA 3VAIA 1UZDA 1HD1A 4RNFA 3OJUA 3BGRB 1ZTTA 1L3KA 2OPQB 4MMOA 2MJUA 3W65A 3KK1A 3FZBA 2PEBA 3RGIA 2H51B 3VAHA 2BOAA 1W2IA 1YRXA 1JLEA 3IR7B 3MR5A 4KJIA 2R7VA 2MKIA 4FYVB 2WVFA 4J9NA 1RT5A 2F4VF 1WOOA 3OXLA 3MFIA 1O6XA 3NCPA 5KG1A 5SZTA 1NDKA 4JV2A 4K0KJ 2G2ZA 1SI9A 2XO6A 2B43A 2QLJB 3ILIA 4Q44A 3OTOF 1FJCA 4LBHA 1BD6A 4F0HA 3IR6B 1HR0J 4WE1B 4HTJA 1RWOB 2IHR1 1I3OB 1W7WA 3GYNA 2W7OA 3D6TB 3PW4A 6FD1A 2OAUA 2DR5A 4K59A 5BR8J 2VU5A 4J9LA 3BBFA 4YUDA 2BV3A 2BOPA 1FVSA 3JSMA 1QAYA 4MIWA 2ZWPA 5E2QA 1RLDA 4KGXB 4ZJLA 2FPHX 4CO1A 4AL5A 1OQ3A 1BQMB 2F5GA 3ILJA 4X66J 2RDJA 1UFKA 2MSSA 4C4WA 3G71S 2KN4A 2JVOA 2YWEA 4ITSA 3M7VA 5CYQB 5DDPC 3GV7B 1AYEA 3C3LA 2WONA 5DZ7A 2V0NA 3QIPA 3UPFA 5D8HB 1RISA 1DLOB 4IG3B 1KFDA 2R8JA 1ZTWA 2CYYA 4ZHRA 4QR2A 3M6WA 3BGLA 1PO6A 4LUBA 2Z30B 3NWGA 4DHVA 2E5IA 2ALZA 4PXBA 3MUVP 4RZRA 3AQPA 3C16A 3UN2A 3QRRA 2GMHA 1SBRA 2CQCA 3CTRA 1U26A 3W5YA 2BDPA 2XCAA 2ZUGA 1VQ5S 2UUAF 1SV5A 1JKHB 1FWKA 4QIEA 4CCHA 4TYBA 1NKCA 3M2UB 1M1KT 4U7UD 2LEPA 3PJWA 4ZLPA 4J9MA 4DS5A 4O4GA 1NK0A 2MKKA 2M8HA 3BF4A 1UTAA 5A8KA 1Y9OA 4IH7A 1X0FA 2CJYB 4C3LA 3DC2A 3AXMA 3D7SB 4ZHRB 4ILLA 1X8DA 4WFZA 4DQPA 3GG1A 4IFYA 2FJAB 1SKSA 1HQEA 3MD3A 3MR3A 3PYDA 1KOHA 3G8TA 1CJVA 2N7YA 4CO2A 2VUGA 4OMFG 4ED4A 2XGQA 1S97A 4LF5J 2DK2A 1D8YA 3D3CJ 2L3MA 3BGFA 4QCLA 3IMQJ 2VJUA 4DV3J 1KHWA 2C3OA 1UZHA 2MZSA 6FDRA 1F3FA 3BR8A 2CG8A 3OT9A 5D0EA 4ETZA 2W9CA 1OWXA 1GQEA 3UI3A 3J7A1 2DHXA 1QE1B 1HNZF 4KGKA 1OY6A 3KLFA 2AZ3A 2HLTA 2QA4S 1WTBA 4ZDNA 3QJLA 3WDOA 4AD6A 4TN2A 2Y1RI 1AT1B 2EFGA 2ZE2A 4RJVA 5HVFA 4J9KA 2B3TB 1UETA 4DQSA 2PDAA 2HHQA 3BKTA 1NDLA 3VR1A 3NGDA 1OPIA 1VJWA 1WC0A 4KR0B 1RI7A 4XK8C 1FT8A 4F67A 2ZUAA 4GC6A 1Q8BA 3FMWA 1GEHA 1HNXF 5E3QA 3O2IA 4UOHA 1RBLA 1EQMA 3Q2SC 2WW4A 2FY8A 2DCUB 3UDCA 1MROA 2ZOGA 3GWCA 1TL3B 4KB7A 2NXJA 2XEXA 2WVBA 1CC7A 1JLBA 4JI4J 3A4TA 4J9QA 4FYDA 1IKXB 3DOKA 2FVRA 4Y2KA 2G13A 2GZOA 1HBOA 2E5JA 4ID5A 1HHQA 4KKOB 4DV1F 1U1MA 1RT7A 4LF9J 4WKRA 4CTAA 4NCGB 5CHCB 2IJRA 1X60A 3KLIA 1SL1A 3U27A 3L7OA 2PIIA 4MYTA 2HQFA 3R2CJ 2F8EX 2SXLA 3DYAA 4F0MA 3GIRA 3C15B 2CDRB 3EGZA 1G3OA 1WSRA 4EBEA 5HP1B 2B7CB 5JVHQ 3P6YC 1ZS6A 3K5NA 3DGVA 2KJWA 1H2VZ 3N6LA 5J2PB 2UU9F 5KFYA 3OW2R 2EVZA 1N56A 4I56A 2AJ2A 2B9XA 3R6GB 1GX6A 1R6VA 4NZ7A 2CJAA 4ZOSA 5J1PA 2MLXA 3GYXB 3N28A 2NLWA 4NLQA 5B0EA 4ANDA 4CH7A 2RUGA 2C3UA 2LLZA 2RU3A 1XK8A 4DN0A 3HHLC 3LAKA 4JI6J 2ZJQQ 2AW0A 1FJ7A 4B3MF 4B9TA 2RS8A 4HKQA 2Y8YA 1IQTA 1LW0A 4CLFA 1DQ8A 1QM9A 4J91A 4O3PA 3T6JA 3M9MB 3TVYA 4DL3A 4P71A 4P7TA 3BB5A 4OZNA 4W90B 5C25B 3BS9A 3L7PA 2OP5A 4DX8H 4LR9A 1SL2A 2DGSA 3FMBA 1SUQB 1Y5NB 3IR5B 4CLUA 3QWUA 5CYQA 1C0UA 4W92B 1CVJA 2KT2A 1U09A 2JJ4D 2MEWA 1BUXA 2MHEA 3A12A 5F0WA 3WHIA 2WW8A 1PGZA 1U1NA 3H20A 2FQQB 3TAMA 1NK5A 1YBUA 2W24A 4AL6A 2E1AA 5CH7B 3AA8A 3ZO7A 2QSWA 2RQMA 2KVIA 3ZZUA 1SIZA 1TV6A 2BVZA 3H90A 8AT1B 3HHNB 4RW8B 4LF7F 1NZ8A 2QL9B 2VBWA 2UV8A 1CG2A 4OX9F 4KH1B 2LQ9A 3S1TA 4XO0A 4LFCJ 5LMUF 3BSCA 3D28A 3HCXA 2BX6A 2FJBB 1V6HA 3FNNA 2MB0B 3QSIA 1J27A 1T3NA 3MF5A 1S6UA 2CWXA 2MKJA 3MWBA 1C4CA 4QIWD 4A8YA 1JLGB 4UT4A 4ZMMA 1N52B 1Q16B 5IC4B 1P27B 5E7OB 1RXOB 4FDFA 3AA9A 4DPUA 1N5VA 2UUCF 5E33A 5KOXA 3KJFB 4ED5A 1SH2A 3IFEA 1FVQA 2OPRA 2MYFA 3O5TB 2HMIA 2MPUA 2VIHA 1HL6A 4BLGA 4DU8A 4F04B 2G9OA 2ALYB 3D6MB 1RUSA 3PEJA 5IXUA 2KB2A 3EICA 1Y7PA 2GVDA 2WB4A 3E01A 1KR4A 1NSQA 2R8KA 3DLBA 5C24B 2D3O1 4E2FB 2VG5B 5HANA 3S6EA 4ZVEA 3V6JA 4FBUA 1J5EF 4K5RA 2D3OR 4EO6A 4RW4A 3J80Y 2GAGC 3R7BB 2LA4A 1RACB 5K20B 4J9UE 4DDFA 1AZSA 4OHXA 4GVBA 2DNNA 3RAMA 1CJKA 3FDSA 4LIRA 3PJXA 2P9CA 3JSRA 4CDIA 4ZPWR 2R2UA 2BMBA 1TKTB 3NG8A 2FJWA 3LOUA 4CLYA 3D54A 2WSFC 1KONA 4IH5A 1C1BB 2QSFA 1AFIA 4K4TA 2DRAA 4Z7CA 3EE3A 2V50A 2EPIA 2BQRA 3LALA 2EKYA 1BMQB 4O4GB 3CCSS 1X31C 1I94J 3K57A 1TZ0A 5HBMA 4DR3F 3E2EA 3BKUA 5F3ZA 3LPEA 5KFKA 1VISA 1S48A 4IFYB 3I31A 3US5A 3MR7A 3VGUA 1U1PA 4J7CA 4LREA 2MQPA 2HQIA 3B4MA 1RWXB 3OSPA 3EPGA 3SV4A 4OYAA 2RF2A 4OYBA 4P2XA 2NR0A 2ILYA 1VRUA 2RJZA 3R3TA 4A8XA 5AXKA 2RQKA 4Y2CA 4CO4A 1NBEB 2KHCA 1DTQA 3T6BA 4DL2A 2GO8A 1SKWA 3RR8A 1H74A 4RW7B 2W9AA 1P1LA 3DXSX 1GK8A 4Y2AA 1U1QA 4U8VA 3FFIB 1IBKJ 2ZWOA 1PJ7A 1KD1T 4HDGA 4MT1A 3PO4A 3CCUS 4B3SJ 4F7VA 2YNHA 4EUVA 4A8MP 4KQZA 4P52A 4U67Q 3Q8QB 3OVSA 1U1OA 3LP0A 2K7JA 3DKDA 1FTRA 1NHKL 1R3NA 2PEHA 3BR9A 2H65B 1YJRA 3G2XA 3L09A 3ULHA 4YB1P 3OR2A 4NLDA 2OMLA 1T7PA 3J80U 3IG1B 2OPPA 4PR6A 5A8WB 5HMXA 2FC9A 3GV5B 2YY3A 1RYSA 2IBKA 4JI7J 2DJWA 2AKWB 3HVAA 4NA1A 3P49B 2KU7A 2V4JA 4Y00A 3AD9C 4YN3B 5LMNF 1DZ5A 5HROA 4URQU 1YJTA 2GJIA 4PKDB 5DLFA 2VJVA 1AUSL 5D0HA 1VQLS 1AFJA 2HAFA 3GE9A 4ZJQA 1WHYA 2LA6A 4RKUC 1RT4A 3CJ2A 3PACA 2HBYB 1JX4A 1YG0A 4OHVA 4N5SA 2J7WA 3W9IA 4C0OC 1QUVA 2VFUA 1YIJS 2IVFB 1Y5IB 3RW7A 1APSA 4BC7A 3HSGA 7FD1A 1T9WA 2GAHC 3CDAA 1GXUA 5D4OA 1YDLA 3BSNA 3VWSA 5HP1A 2LDIA 1S7HA 5KFPA 2ZDOA 1ITPA 2KH9A 4TYAA 4DR6F 1ICEB 3ISNC 3JXOA 2M52A 4K8RA 4X4QA 4TU9A 1ZPWX 1YITS 4Y65A 4R8UB 3C6TB 2JEFA 1JLGA 1WHWA 2OIHA 1FWPA 3GLJA 1N6QB 1H7WA 4IRDA 2MSTA 3AHPA 2YNGA 2E9RX 2EEYA 4F25A 1S6PB 1C0TA 3M30A 3AQOA 1JLCB 2PFDA 1X4AA 2AYGA 1FRKA 1IJEB 1LFWA 3WQPA 2JHEA 4CLKA 4OI4A 1QAIA 1FK9B 2XMTA 3C14B 2J0QD 3H5UA 4QR0A 4MK8A 3VZHA 3GQCA 4MTPA 2IPOB 4K50A 2BW2A 2G0JA 2ATCB 4IG0B 2JFDA 1VQYA 2BRKA 4ZP7A 4C97A 4LRBA 3W7BA 4TQSA 1AUDA 1CC8A 4ICLB 3D0GE 2F9DA 2GHWA 1HBUA 4ED2A 4YB7A 5F8MA 2ROEA 5IQ6A 1SUQA 1Z1ZA 4NCBA 1RTIA 1TL7A 4QW9A 4DCPB 1SKRA 3HO1A 3GJSB 4IO9Q 2B9EA 2V8DA 3DLLQ 4EZ9A 1E6VB 1LWXA 4L72B 3RAXA 4JV1A 4K4UA 4QU7A 2IA0A 3G87A 3MECB 4Q5VA 3M8WA 1NHUA 1WKKA 2V4JB 4P10A 1HWJA 2YKQA 3CJQA 1JJCB 2DGVA 4E98A 4CLPA 1KNZA 1LW2A 3NNAA 4OI0A 3TYTA 3EGNA 1FXLA 1GTEA 1YLXA 5DG7A 2WVCA 4YMEA 5DG8A 1RSCA 4OV6A 1MWZA 1MWYA 1VRTA 4I0WA 1X5SA 2CQIA 3P8BB 3DOMA 3P96A 4FZVA 4UUWA 2W8KA 1S9GA 2HHHJ 2B6AB 1WG1A 3B54A 3LWMA 2L9NA 1TL4A 2AZ1A 2VA3A 1IBMJ 1BQMA 2LQJA 5A6WA 3FBBA 4ICLA 4CM0A 1X5OA 2CQ1A 2WOMB 4BHQA 4X62F 1ZYQA 3UCZP 4IO1A 1FKPA 1UEUA 3QZ8A 1SV5B 2MLYA 1IWAA 3NRBA 4ZITA 3L7UA 1HNVA 2AJ1A 1I5OB 1JLAB 2QT7A 1T9TA 3AAWB 4M94A 5IT9U 3R6LB 2RF2B 2CXEA 2E7XA 4M1KA 3NAHA 2X1AA 1IVZA 1DLOA 4IG3A 2Q43A 4CYUB 4WE1A 4DL6A 1N36F 1XTZA 4LFAJ 2V67A 2VH7A 3I96A 3TP2A 2MXYA 3G6ES 4DV6F 4R0JA 4I2PA 4BDPA 1FO1A 3HZGA 2HSEB 3GFHA 1F5BA 4I2QA 5L9XA 4FXDA 5FJ4A 1F5AA 1R0CB 3K58A 4ZP8A 4JI0F 4DU7A 2FVPA 2MQOA 4WTOB 3MEKA 1NKEA 1YWXA 2DD8S 1XNQJ 4LSZB 1QDUB 2CQ3A 2V9KA 4MK9A 1IQZA 4FPRA 4Z37A 2QC3A 2JC0A 5A6PA 1TKTA 1HBNA 3KHHA 4YHHJ 4O3SA 1P8GA 4C3KA 1LWEA 2YNFB 4WP8A 4F4YA 2GIFA 4ZIWA 2X1BA 4PZVA 3HMJG 2R7WA 3ZZOA 3MEDB 3K0JA 1RHKB 2JL9A 2EK6A 1XWLA 3LP2A 3AOAA 4G1QA 2LU1A 5KFDA 4HT5A 1XEZA 2A1BA 2XHWA 1S1TA 4BC9A 3B82A 3OV7A 1CEZA 2MMYA 2UU9J 5ETQA 2RRBA 2C3YA 4C8OA 5HQLA 2JFKA 2VG7B 3PR4A 4LF4J 2ZEJA 4JI2J 3W60A 4I2PB 1Q86T 3M8PB 3NBPA 3WX4A 2KXNB 2LXFA 4DUYJ 4JV5J 3QAEA 4ER8A 1UVLA 2W2NP 2CRLA 3KLGA 1IJFB 4U7CA 5IT9Y 2QA4G 2KZMA 3G82B 2G1DA 2R7XA 1P1TA 2Z58B 2R7RA 5LM7E 1HNVB 2E44A 4NYOA 3GR1A 4P9SA 3PHTA 4TY8A 4WFYA 5AE1A 2ZH7A 1FKOB 3PCOB 1U1RA 1KDNA 1S1XA 2OEKA 3F0NA 1OS5A 3G4SS 5L46A 2C42A 4DQQA 4JYAF 3MAHA 3UN5A 2J8SA 3JYTA 5IM0A 2QEXS 4LFBJ 1N5YA 2H1YA 1IBKF 2GW8A 2ZZTA 5A2QU 3I4PA 4OIXA 5AXLA 3R9LA 2Z2YB 2Q3PA 2IC3B 1BE4A 1MMLA 4RUCA 3BBCA 3DYAB 2RDDA 1TL1B 4LMZA 5HSPA 3HJVA 4FYXB 4L74A 1UFWA 2YQ1A 3SI8A 1KQFB 4QIVA 1XMOF 2PA8D 3R8YA 1Q7LB 4DXLA 3HP6A 1U2FA 1UKUA 2C2ZB 4GKKF 1AA1B 2PT0A 2FY1A 2R8GA 2XLKA 1HWUA 1RWNB 3S01A 2DGQA 2OTLS 4B9UA 3BYPA 3W66A 4TU8A 3ENVA 1X5PA 2EXUA 3QYYA 2DGXA 1RT2B 2FUG9 1I94F 2UVWA 2DH9A 4HYKA 3SCIE 2OEMA 5EDWA 4JYAJ 2X3GA 1N36J 1U2RA 3BO4A 1Q5VA 2DR8A 1RT1B 3K5PA 1DURA 4ZK7M 3OL8A 5F41A 3MM9B 1IXKA 2K7KA 2ATLA 2RKIB 4XPCA 2DHSA 1RWPB 4FP9A 2WOMA 4U96A 4ERDA 1JLCA 3BKFA 3MMCA 3I55S 3V6DA 1B99A 1RAOA 1KC8T 3IO1A 1T95A 2XWXA 3MI7X 2AV5A 2GHPA 1W25A 4G65A 4LIWA 3D66A 1RT3B 3CIMA 5SUHA 5K8MA 1ELOA 3D3BJ 3M6XA 4NX9A 4OX9J 1LWFA 2YWWA 1YSJA 5KFLA 2DBBA 3SCJE 1DTTA 2ZNYA 4DI6A 3N4WA 3KTQA 2P5VA 3HI9A 4WK3A 4O0NA 4X66F 4KBIA 3H4BA 4X64J 3C46A 2M4MA 1P9QC 3RB0A 2C1EB 2XC9A 2QV6A 4C11A 4DV2F 1S76D 3JS9A 1RAAB 2VFTA 4ZN3A 2FLPA 4I2QB 4OHWA 2CG4A 2HLUA 2DCLA 2N4DA 4DSEA 4NLSA 1QSLA 2ZHBA 3PKYA 2IY5B 4KHPJ 2ERRA 1FJGJ 5F8NA 4F50A 2EFPA 1RJJA 4OX7A 3ZZTA 5F8GA 3E01B 1MG7A 3QFHA 4LF9F 3B4DA 1D9FA 2ADBA 2IRUA 4A8QA 2AJQA 1JLFA 3D6FB 3MEEB 1FFSB 1HW9A 1LXJA 2VG6B 4OLOA 4JI8J 4N8OA 2UXDJ 1Y4ZB 2M7SA 2HHPA 2DO4A 5CAAA 2I0XA 4EEYA 4ECVA 2PMWA 3EZOA 3TAPA 3C66A 2K3KA 4LF8J 4NCAA 1WI8A 4FS2A 1KVJA 1XNRF 2BJ9A 1FDBA 3CDBA 3ENWA 2DGUA 3R1LA 4B3TF 4JP8A 3TX0A 1Y00A 3JSBA 1PAUB 2CJBA 1WC3A 1FRIA 3VAGA 2V68A 4K4WA 3UD4P 1NHVA 3E8OA 5GAHU 3DGPA 4BCAA 4F3MA 2N3LA 4V19X 2DO0A 2HNYB 3AT1B 2Y1LB 2RILA 2QLBB 2BKOA 4NLVA 5CD4A 3SYZA 1NKBA 4QPXA 1M5PC 5CXTA 2VA2A 4OZLA 3RUBL 3TX8A 2RSQA 1ZM3A 4CLLA 1X4EA 2Z57B 3BN4A 2LQBA 5AXMA 4HL9A 3OHAA 4DV3F 2CJKA 3W63A 4EBDA 4A48A 4FF1A 2AYBA 4GKJJ 5J1NA 1N54B 4MKAA 4ED6A 2YWHA 3QATA 2CQ0A 4L3NA 1U6ZA 1S1XB 2XMAA 2RQCA 1K1SA 5CCMA 1TK8A 4OYOA 1HW8A 4R5PB 3I6PA 4FYWB 4USHA 4ED1A 4PYAA 1HWKA 4L6V3 1UJ4A 1IKYB 1RT6B 3LH2S 1S99A 2EFVA 1SJQA 5F0UA 4P75A 4YEAA 1LWCA 3HDSA 5IT4A 4DV6J 3CULA 1TKXA 3VGVA 5JMNA 1TFYA 3KXDA 2DKOB 2VBZA 4YY3F 4NXMF 1M90T 3VQTA 2OPQA 3ILOA 3GSIA 3I5CA 1M1GA 4DV4F 5HLFA 2LEBA 2CVIA 3NEKA 1RA6A 2CPDA 4GVBB 2ASYA 3ADAC 3BBBA 3FCWA 3O8WA 2V34A 4DV4J 3DU6A 2HURA 3HVTB 3HHDA 2ZITA 1IM4A 4X62J 2VDIA 2VFSA 2Q79A 1HLWA 1FI4A 1RGVA 4DLGA 1B7FA 1XERA 1MNEA 3FFIA 1XMQF 3M8QA 2QRRA 4NXNJ 1I6JA 1SH0A 4RW7A 5I3QA 2KHDA 3ZTPA 4GC7A 1L3UA 2B8QA 5IQQA 4A8OA 2AYEA 3NXZA 3ZNJ1 5K14A 1SJFA 1TELA 1O5JA 1RAIB 4B9SA 1S6OA 3CCTA 3SSQA 2DVIA 3VGTA 3DI6B 2WVDA 2HS4A 3DMJA 2AF6A 2NQPA 1H98A 4ZLLA 3K5LA 3RBDA 1QLNA 2KRRA 4RO0A 3IS9B 1S1WA 2BE2B 3VV2B 4WFAQ 4DSLA 3PIPQ 2HIQA 2BJ7A 3KLFB 4DV7J 4GVLA 1JNRB 2CJXB 4Y2MA 1LK7A 2B56A 3FRYA 4QOTA 5M2RA 2OGUA 1VQKS 2GVZB 1PJ5A 3TJAA 4J5OA 1T9VA 2ZOMA 4NRUA 4V19J 1NM2A 3DDKA 3DCAA 3DU5A 2FGCA 3GPAA 4RW6B 2VF3A 4R8UA 3VALA 3DRSA 3MEGA 5DS7A 3KFWX 2BE7D 1Y3JA 1D09B 4WIIA 3T5LA 3QBCA 3KLVA 1RA7A 3V6KA 2V5HG 4O4RA 2BRLA 1S0MA 8ATCB 1CJUA 1S1UB 2E5HA 3U1LA 3KMSA 3W5XA 1NRKA 1RBOB 1UPMB 2HG4A 2BEFA 3AOBA 3MZIA 1B70B 1LQ9A 3UDLA 3PO5A 3GP9A 4DF4A 2ZZMA 1SL0A 3CMQA 3Q8UA 3CCLS 2W4DA 4G1QB 3AOCA 1TUWA 1VHFA 3DFEA 4KT0C 3A3OB 3WX8A 4Q2LA 4YDDB 4WFNQ 5EWGA 4YP3A 4DR1F 5KFOA 4GO5X 1Z2LA 1PSDA 1RB0A 3C15A 1W26A 1U1LA 2WZ1A 1YJWS 3OFFA 2AGOA 3H40A 1HI0P 2ZM6F 3PJ9A 3TJ8A 2D74B 3FEYB 3OPKA 2BQ3A 2FJDB 3KLGB 2OPSB 1TQLA 1XIQA 4RW6A 3J7ZT 4B3RJ 2HBZB 3NWRA 2YKMA 5F3TA 4DG1A 2HZVA 4B3OA 1OJ4A 2GX8A 4RBUA 1FNXH 4CZCA 1U6FA 2CPEA 1VQSA 1H73A 2H5IB 5EX0A 3D2WA 3MAAB 1PYOB 5LJ5Y 1QUPA 4ZCKA 2D7SA 4QWBA 5GAEU 2DRBA 2WTFA 3Q8VA 3W2WA 1EHWA 1U1KA 3IP0A 3SFUA 2RUSA 3DLEB 4ZVFA 2QFJA 5BYSA 3JAMY 2Q1LA 1WHVA 3UVJB 1UVKA 4HH1A 4B3SF 1JNZB 4AFFA 4HTIA 5F8IA 1H2UX 4WYWA 4ETXA 2Z2LA 3C14A 1VK3A 4F3QA 3JSYA 5DQGA 3UCGA 4L75A 4I6WA 1SJRA 3OR1B 2UXBJ 4WZMA 2DT9A 3T1AA 2MGZB 3RG6A 1IKXA 3KK2A 1PAEX 1S1VB 2M70A 2K06A 1MU2A 3JQJA 3MAQA 4QWAA 2HVZA 2O66A 3MMBA 2VKZG 3HPOA 2FD2A 2N82B 5G4DA 2ACMA 1RWUA 1TKXB 2DNHA 3TVZA 3GIKA 4JI0J 1T05A 1U47A 3DDIA 3DRPB 3UO0A 4DSKA 5CQGA 1A7GE 2W4CA 1S0VA 3J7YU 1V9OA 2GVZA 1FJGF 2GJFA 3JAMU 1NK6A 3MPVA 4TLQA 4DV0F 3GIIA 2UVVA 4KSEB 4OJGA 3TARA 2VV5A 1TVRA 2IFXA 4ANEA 3EUNA 1WJ9A 4DWIA 4NLWA 1DHMA 3CUNA 4YOEA 2FHJA 4USKA 2KO1A 1Q5YA 3J7AN 4ENOA 1NXIA 4J9PA 2AD9A 2P9EA 3EMTA 4AL7A 3M32B 2IRYA 1CBKA 1B4SA 1U02A 3TZZA 5FDLA 1EIYB 2D1CA 4JI3F 3M8RA 4LSLB 3R5JB 5I42A 2JZ5A 2YNGB 2MQQA 1JB0C 3OFGA 3ZZYA 4DLEA 3KDOA 4HHJA 4CLSA 2F8HA 4G3IA 4HR2A 4ES2A 4F4AA 1URRA 3OFEA 1FF2A 4FN5A 2NPIA 4IRCA 5HMYA 5J2NA 4A8FA 3R7NB 3V4IB 1VRUB 3SCLE 1DARA 3Q0AA 3BGUA 2OPSA 4ECTA 4FS1A 1IR2A 3MEEA 5FLXU 1WELA 1C4AA 4UF4A 3HSDA 2G0IA 4NZ6A 2XSJA 1GFWB 4IR9A 1MSWD 3THTA 4R0EA 1BQNA 2KJVA 3TANA 2HNDB 1D8ZA 2EW9A 2KFYA 2IA6A 1VIXA 4LSNB 1XR7A 3J81j 4ZVOB 4ES1A 5HBMB 3GFZA 5J1EA 3H2UB 4UOCA 3KNAA 1V3SA 1PJ6A 3W8PA 3ZXWA 2ZKUA 4NA2A 2W7PA 3TZXA 4F4KA 2ZHAA 4CNYA 2Z2MA 3DXBA 4ZS6A 5I42B 3H42A 1VQPS 4DQRA 1EKSA 4FVMA 3W3SA 1VQ6S 1U7LA 2IDEA 2DNGA 3OBIA 4NEZA 3UNGC 5BXIA 5KFEA 2VHGA 4J90A 3ICLA 3MCNA 3MR2A 2DITA 2F4FA 3M1VA 1HYSB 4LF7J 4JV0A 2UUBJ 1N0UA 4NPOA 1F2HA 3PYEA 1R0BG 5ETRA 2IC3A 3D68A 2R3VA 1N5SA 2K8GA 2W2OP 5LSLA 2NYHA 1YJUA 2E9TA 5K8NA 1SB6A 3MM8A 2BA9A 3PHEA 4LFAF 3WIVA 2F3JA 3F44A 3IBFB 3HT3A 2V94A 3PW2A 3NNHA 3U1NA 1RAEB 5CZVA 2RDIA 4K4SA 1UW4A 3N79A 5A8RB 2GO9A 2BKPA 2RQ4A 3I87A 1JLQB 1FXDA 4ID8A 5KT6A 1LWEB 2HFZA 2YNFA 5KFGA 2HHVA 4QWEA 1HARA 2X51A 3P4UB 4OYWA 3RZAA 4YS2A 5DM6Q 2V6AA 3I56S 1F9EB 3GONA 5HN0A 5I3UB 3PY8A 2CQHA 1RE1B 2F1FA 3BREA 4HHUA 4O44A 1I1GA 4ZVGA 4CQ1A 5T7LB 3PNIA 2AGPA 4M95A 3IA0A 2RHQB 4ZCIA 2Y9HA 3A8IA 2AEJA 3V4IA 3T19A 5EN1A 4ECUA 1RU2A 1RKIA 3N0VA 4P6QA 4H54A 2FZCB 2O5DA 3BQ2A 3NOGA 2KKHA 4ZVUB 3PM9A 4M5NA 2XZDB 3V81A 2HK3A 3MM5B 1HWIA 1EB0A 1EARA 3M6UA 4UTGA 4DSIA 4A46A 2XNRA 3GTYX 1TUGB 2FYXA 4OYZA 2RE1A 3QT8A 3FGVA 3I0SB 2LEAA 4O0IA 3CW2C 3MEDA 4DSFA 4DR7F 4X4NA 1X9SA 3HD2A 3MUMP 2HIYA 1HQUA 2J5AA 2AEMA 4XDCA 4A8SA 2DHHA 3GSDA 4JI6F 1FRXA 1JMTA 5D4PA 3M9OB 2OSRA 3LA0A 4KH0B 2D69A 3EVMA 5C24A 3KLEA 3GIMA 5IC6B 4DFPA 1FJEB 3D9BA 3VTIA 2HRUA 1KQGB 2V8PA 3BM7A 1K9MT 1UJ6A 3BPSP 3SQGA 3AJDA 1WUUA 1IN0A 4C3MA 1Y3KA 1VRTB 4NI2A 2J0WA 5JXSA 2GA7A 4YB5A 2ZHOA 4AXIA 1HI8A 1QTMA 2LQ5A 3MM8B 2VQEJ 4ZLJA 2B6AA 5LOQA 4CWBA 2XQCA 1B0TA 4DFMA 4G1PA 1UWBB 1R8CA 1DQ9A 1T94A 4QWDA 5IV4A 1SC1B 3W62A 2CPHA 5FDLB 4C8KA 5ETTA 1N33F 4CO5A 3OL9A 3CJSA 1R27B 3M32A 3R5DA 4IDKB 2HNYA 2W1BA 4XAKA 2PN6A 1RAFB 4USUA 2CJ9A 3ONQA 3TUJC 1E6VA 5AJ3F 2X1FA 2HHSA 2ZNZA 2VZ9A 4L3KA 5B09A 3C6UA 5DETA 1S10A 3I0RB 2JEJA 4ILRA 2MGZA 2GC8A 4OL8A 1RHMB 4ZPVR 3W8GA 3M8YA 1EJ7L 2DHGA 4HACA 3S7RA 1MN7A 2M2BA 9RUBA 4Q0BA 4AXJA 1FDAA 3C16B 3KG0A 4O23A 4DOZA 4KGVB 5LT5A 2W9BB 4DR4F 1N32F 1WEZA 1HHTP 3MOZA 1G1XA 4J9OA 1UCNA 2F40A 2E7WA 1VQMS 4JI1F 3BH6B 5E3PA 1KLNA 2CA9A 1HPZB 4KV8B 1FERA 1TL5A 5K9FA 3PZPA 2HMIB 3SV3A 4KFBA 2CDQA 2XYHB 5BYRA 1VMBA 4NCGA 4MFBB 1R8PA 1HNXJ 1X4GA 2OELA 3LGNA 1PC5A 3ZZRA 2DEJA 4MH8A 2J7KA 2KL8A 2YQ0A 3MCOA 2ZH9A 2WONB 2XY6A 2X7IA 3PX6A 2RNEA 2MLZA 4IRKA 3N5BA 3BDPA 2BANB 1WHXA 3QGPA 4ZPAA 1PILA 2NZCA 4U8YA 1Y11A 3CCES 1IBMF 2FHOB 1YKWA 1REGX 2B4PA 3SBMA 2QE5A 5D3GB 4UW2A 1KN6A 3LF0A 4IG0A 2B5JA 5B0BA 3BDEA 3HXMA 2VG7A 4DL0C 2DISA 2VOPA 1IM6A 2PGCA 1HHSA 3LAMA 4K2XA 1G4CA 4QZVB 2XMJA 3MMCB 3DM2B 1SCJB 4RX6A 4JUZA 3V6DB 1J5OA 3CJTA 2DPJA 5IV3A 5DRKA 5J2MB 2BUNA 1HBMB 2AJ0A 4DF8A 2FHMA 1UVMA 1R8HA 1SKUB 4NE9C 4PWDB 1FHTA 2CADA 2MY8A 2WSCC 4F26A 2OMOA 4DCJB 4KHPF 5CYJA 2YVSA 1T9UA 4X4VA 1ZBTA 2HEKA 1MWQA 3FSXA 3SQOP 4I64A 1T05B 2CZ4A 2WHOA 4JOUA 3R5BA 4ZP6A 1QSSA 2BR0A 5HAOA 4ATNA 3RR7A 1QVFR 2AX0A 2RVJA 3AB4B 3CD0A 2DNQA 3X3UA 1X4BA 3MMAA 1EQ0A 3OTDA 1XR6A 5C2CA 4G6VB 4ECSA 3SFGA 4J9SA 2R9LA 1NJWA 2OFHX 1CPZA 2IIHA 3CSKA 1OYDA 4N7TA 4DMZA 2GGPB 1G6BA 1S1WB 1U8SA 1M5HA 2BE2A 2DY9A 4MYUA 5GMKa 4Y0FA 2DYAA 1CULA 4IH6A 5FLXY 2DIVA 1JJ4A 4BWMA 1WC6A 1ZA1B 3EGVA 2FZKB 4KYZA 3V6HA 1E6YB 3MHYA 2CJQA 2J6SA 2E1RA 3WBZA 1ZPVA 1SJ4P 2UUWA 4EO8A 1WF1A 3EM1A 2YNIB 3ETMA 1YJ7A 2XMUA 3J7YI 4DPXA 3TAMB 3A3PB 3OL6A 3CWJA 1FKOA 1N32J 2ZJPQ 4RNNA 1Q95G 1RT2A 1ZM4A 2ROGA 3VVTA 1VYAA 2QLXA 2WRMA 5I3PA 3W5ZA 1S0OA 1MLAA 4WP3A 4JI1J 4NI2B 4CT9A 1AB8A 3HKZD 1D3WA 3FKBA 4I69A 3SQGB 2A10A 2ADCA 3CD6S 4WBFA 2YBVA 3IAS9 4DR5F 4D3HA 4UOGA 1B64A 1Q8IA 4IR1A 1NAQA 3CCJS 4JI7F 2IJNA 5D78A 4O44B 1CJTB 1VOMA 2O67A 3CJKA 5T14A 3QPIA 4PYDA 4TVAB 4KFBB 1RWMB 1TL1A 2IRXA 5GADI 4QPTA 4X4SA 2JOQA 2HKEA 1KWMA 4ZCMA 2PMHA 3DHWC 4YR0A 1H38A 2XMKA 4OLPA 1YJ9S 1VCTA 2ZVIA 1Q78A 3DRRA 2DH7A 3QIDA 4X84A 3GV8B 3NMRA 2EI5A 2GHVC 2P8IA 2QMUB 2ZDPA 2GIQA 4RNHA 2HWHA 1S1TB 1Q4RA 5ETKA 1K8AT 1UEVA 3NOCA 2ZKTA 3ZTSA 3RB6A 4TKTA 1V3ZA 2NUUG 3H7HB 3EVOA 5KT3A 5D6GA 5CYMB 2Y1IA 1NEEA 2ZC3A 5GADU 1PC4A 2XS5A 2J9EA 1XMBA 1MW7A 5D77A 4USIA 2MKCA 1NDCA 4KY3A 3WZ0A 1ZAXA 1YJNS 2M8DB 4ES3A 2IM0A 2HGLA 2OJ3A 4OZ5A 2JLFA 1S57A 2VKRA 2J6TA 1N0VC 3NMAA 1H6KX 2HQCA 2MKHA 1ZM2A 3CJ4A 1S49A 3W61A 3QSYB 1AZSB 2DTJA 3GCWP 3R97A 4ZVHA 4PWDA 3R5GA 2QYCA 3QMQA 1RK8A 3D67A 4G1IA 2E7VA 3D1QA 1N88A 3R7SB 1KS2A 1R0AA 4NLRA 3TA1A 1G2EA 2MKYA 1K0VA 5IWAF 2FDNA 4YFUA 4C9DA 2J8AA 3HHLD 2FVQA 4PG5A 4JI5F 1VQNS 4PG6A 2BJ8A 1Z2ZA 2Y0SD 2XULA 4M5GA 4EYIB 2FHKA 4WXOA 3OQ2A 4NEYA 5KFBA 3TWZA 2NZ4A 2KFZA 3HT0A 2XYPB 4FPIA 4LR7A 1FRHA 2WB1D 5KFZA 3OVBA 2F63A 4JI8F 5KFVA 3OLBA 1F2GA 1O0PA 2H9ZA 2G1HA 3CXCR 1VR6A 4ANCA 1XJWB 2JX2A 3KJQB 2WBMA 3KJNB 4DUTA 3J7Z5 2YWGA 3MOJB 2CVEA 1RLCL 3J81Y 3P45B 1JJHA 4NLGA 1IKWA 3QAUA 4NXMJ 1NH8A 3OR1A 4RU2A 1JWWA 3PDNA 2E29A 1U24A 4DG1B 4B3OB 1HQEB 3RRGA 4CI0B 2DXEA 5H9FK 2DXDA 2F9JA 3IAM9 5KFQA 2VOOA 1FE0A 2KFNA 1RAGB 2EBGA 1Q8KA 2EG1A 2GQ2A 2QA1A 3DLKB 3K5MA 3MM7A 2C2KB 2RHSB 2ZZNA 5JJBA 3H5XA 2NCKL 3IXQA 5J2PA 4PWUA 4F0KA 1MN9A 1Q8LA 2GIRA 4TY8B 5E41A 2V9WA 1R8BA 1RWKB 5DLGA 3IBWA 3TNVA 2PSZA 3VAMA 1NK9A 2QGFB 2RU9A 3JTPA 1GMUA 2I5JB 1FD8A 2QTWA 2RIJA 1YK9A 3B78A 5HROB 2VBXA 5JVGQ 1ROFA 1ULRA 2ZC4A 3P5TL 4PG8A 2MDAA 4Y2IA 1XC9A 2MTLA 3TJ9A 1NNDA 1T11A 1VJQA 4V1Ak 2R8HA 3T3FA 1QJHA 2ASJA 2HGMA 3K7RA 2J9DA 2GNKA 2XSFA 4IFVB 4WU3A 2BW7A 3KNGA 3N6NA 2OD6A 1JLBB 3KK2B 3EYZA 4NLYA 2FJXA 4DUZF 1M5SA 3M8ZA 3TZWA 1RP5A 3NP5A 3TUIC 2C28A 4RW9B 2B51A 5EGYA 2UXCJ 2WK4A 2XBPA 3CCQS 3DNCA 1SXLA 2AJ4A 3QT7A 4MIBA 2OSQA 1H0HB 3GCXP 1ZOTA 2OLWA 3MPDA 2VD3A 3THPA 1CJKB 4MJKA 4TNOA 3POTA 5BYQA 2HZAA 3N6MA 3RB3A 2E1CA 2EK1A 2LDYA 5LMNJ 2D3UA 2X3DA 1XQIA 4LR8A 4AYBD 2K1RB 1O8BA 1TMJA 4DCOB 5LXYA 3SZ2A 4QU6A 3H8YA 3D1HA 4UOFA 3FSYA 4DUYF 1D9AA 2KM8C 4S0MA 1IBCB 1FDNA 1YGYA 3EJMA 4JI4F 3P3DA 2XG8A 2J9DE 2DNRA 1WF2A 3I32A 4L73A 4HI2A 1Q81T 2VICA 3NGKA 4QR1A 2YWKA 2ASDA 1DY3A 3D6HB 1M5KC 1A0OB 4UQTA 1S4FA 5J2QA 3A8KA 4F8RA 1EETA 5ADZA 1FA0A 3R27A 1LW0B 3CO9A 3R5CA 1U8WA 5G0RB 1TP7A 3GJTB 2J7UA 1ZETA 3RB4A 4N8NA 2B4VA 3DMJB 4UQGA 2WAQD 3CNQP 1V5IB 4PXDA 3OTBA 1NPPA 4JV5F 2CNNB 3HM9A 2E5GA 1DAXA 2CIMA 2BJ1A 3LW5C 2UZAA 3CJ0A 2RH3A 2ZE2B 4K5SA 5T7LA 4O3OA 4EMDA 2XM3A 1BQXA 2VC0A 1S7IA 5DZ6A 4NRTA 2PC6A 5RUBA 2HWTA 4B08A 1WF0A 1NLKL 5EHHA 3DM2A 4H4KC 3VQSA 5E3RA 1IR0A 3CE8A 4HVZA 4C8NA 7AT1B 2CKWA 2I1RA 2RT3A 4M8LA 4QJVA 5DQHA 1YQHA 2W01A 4R25A 3VAFA 3TQ1A 2CZ9A 3QZ7A 3Q83A 5GAGI 4PPZA 4ED0A 2NUHA 2H48B 3FQLA 8RUCA 5KFJA 1SQEA 3H59A 5KFNA 3TAQA 4WCEQ 4LRAA 7FDRA 1OY8A 5LSRA 2HAIA 2D9OA 2HQDA 1V5VA 3D0IE 3DHXA 1RABB 4GKKJ 3MECA 3Q89A 2LP4A 1LEOA 5HO4A 2BKNA 1MMNA 3NY0A 2GMLA 2R7TA 2KT5A 3PG9A 3MGJA 3I4HX 1Y0HA 4YDXA 4P2MA 2Z4PA 5U47A 4MFBA 2IM3A 4LBPA 4NYPA 3UNYA 2VL1A 2L9WA 3LP1B 4N76A 4ELVA 2ZD1B 2JEIA 2HHHF 2YPZA 3D5MA 4LSNA 5B0AA 4Q8FA 1X9WA 1JQGA 3UDVA 5MLCV 2OKQA 2P6SA 4LF2A 1WOPA 1GMWD 1FKPB 1RU1A 3HHEA 1HIYA 3ISND 4HT7A 2LCWA 4KE5A 5AE3A 5KG6A 1N5YB 1J5EJ 3IWNC 3DLJA 2R7SA 1RYRA 1FESA 4NLTA 2VG5A 2HBQB 4X4UA 3EPIA 1NPKA 2J9CA 2UUAJ 3PW7A 1UA1A 2R8IA 3FZ2A 3QGHA 1VFJA 1SVDA 2JNJA 1WC1A 1YI2S 1JLEB 1FX2A 1YBAA 1FRLA 3V5RA 3KLIB 5L38A 4J9RA 2HRTA 5I4MA 3MDFA 3VGSA 4F2SA 2U2FA 2AHOB 4AE5A 4F02A 3CJ5A 1KBRA 2LYVA 3HFKA 4LVNP 1Q53A 3HX9A 2XI2A 4Y28C 4E8UA 5F8LA 1S1VA 5L1JA 1WOSA 4RBVA 2IAJA 3A1YG 5FIIA 1YTYA 4FNIA 1AROP 1JLQA 1QY7A 2AMCB 2OFGX 4WWSA 2ZH5A 1RT4B 3IGNA 3W64A 1CQNA 1IKVA 3BSAA 2DRDA 1X9MA 2PMZD 3Q86A 4X4PA 4YHHF 3CGIA 1F1BB 5A0YB 5IOLA 1SPBP 1NK8A 3B6BA 1OQ6A 2L9DA 3S8SA 3H5YA 2CPZA 1M0SA 2YTCA 4MKBA 4KHRA 5CZXA 1X4CA 4DJBA 2QZ8A 2FIUA 4F4XA 5HQ8A 2ZBRA 1VQ8S 2CPXA 4LFBF 1KLMB 1VQOS 3W2VA 4WYLA 2OPRB 4ZPBA 2D9PA 3ZZPA 3BSOA 5KT5A 1NK7A 2RRNA 3M2RA 2E66A 3AH6A 1U48A 3E3XA 4JI2F 1NH7A 1VGYA 1DJ0A 4YB6A 2ZM6J 4YQWA 1BWVA 2EG2A 4W4MA 2UUTA 1VC5A 3H98A 1N34F 1PCAA 1JIHA 2K3IA 3NLCA 3F73A 2A0FB 3EWGA 3MM9A 4QW8A 2BM1A 2GQQA 3M2VA 4CIOA 3UFCX 3Q24A 2FHJD 2DY1A 4USTA 1SH3A 5D0RA 5ETLA 2DR9A 4DFKA 5D4NA 4H4OA 2VQFJ 3OD2A 3KLHB 1VK8A 2VPZB 3HHLB 4F4WA 4DL5A 2CUYA 4FKYA 4NLOA 1TAUA 2HS3A 2POKA 3VCDA 3PEHA 5J2NB 1S5ZA 1X4HA 2XMMA 3MM6A 3PRDA 1ZAVA 5C7PA 3OLAA 3M8SA 1IKWB 1N5QA 1RKJA 2QLFB 1NJYA 1C1CB 1NSPA 1NB7A 4C11B 3CCWA 2P9GA 1D1UA 5KFRA 4B17A 1F9FA 1U2CA 4DPYA 1VBYA 2YX4A 4KPYA 1WEYA 3GR0A 5KT2A 2FB0A 4HH0A 2AX1A 3CJ3A 5B0DA 2UXBF 1F9HA 4C2MA 3ZFVA 1XMOJ 2HPUA 4GKJF 2LVWA 4AUKA 4O3RA 5A0YA 2AEFA 4EGLA 1T9YA 4OYXA 4URGA 1NPRA 4KRWA 3TR5A 1C2PA 3HVWA 2CNLB 2V8HA 4EWTA 1TVRB 2N7CA 5L1LA 3FBFA 4NASA 1KP6A 3AXKA 5KG7A 1X4DA 3PR5B 3R1HA 2ZH8A 1SJ3P 1NO8A 1VBXA 1RT1A 5C5JA 4PQUA 4CM2A 3T1YF 3RBEA 2HZCA 1UVNA 3C19A 2EC0A 3NCQA 2HWIA 5HQMA 1HNWJ 1PIEA 2YXLA 3MTJA 3DLGB 3NGRA 1EKRA 1HKAA 3OSNA 1EP4B 3MD1A 3LWLA 1OSCA 1Z4UA 1TK0A 1K0TA 1FE4A 1RADB 3TA0A 4QYZK 2HFSA 4TLRA 5C42B 2KRBA 4BWJA 3OR2B 3ZC4A 3IRWP 3NKYA 2NREA 3MMJA 4WFBQ 2KTQA 1UW9A 1LWFB 1NDPA 3KG4A 3RAQA 2XS7A 4LJMA 5E0OA 4N41A 2CQGA 2E5LJ 3T1HF 1A6LA 2E1MC 3BO2A 2F65A 2A2DA 1F60B 1H3DA 1CJVB 1RHRB 3BGOP 4TXSA 3RBXA 3VZIA 3Q8RB 2G4BA 4C8YA 2Y3YA 4WU2A 1KLMA 4DV2J 1VLOA 3FRZA 4ZVSB 2DGWA 1HMVA 4NMXA 3CDUA 3ITHA 1QVGR 1GXLA 2MQLA 2VPXB 3VAKA 1VIOA 2XSJB 4PAAA 1N4LA 4B9MA 1R43A 3O6QA 4D3GA 4FF3A 4EFAC 3FVYA 2H5EA 4ECXA 3ELHA 3KKFA 1B7YB 3QT5A 5KFIA 2J6UA 4PCQA 5K14B 4DR2J 4PRFA 2BM0A 4DS4A 1KVIA 1A9NB 4ZA1A 4A47A 2JLGA 4F2RA 2FVSA 3TQEA 2HFOA 2DNLA 1N5TA 2GVDB 2FGOA 3MAAA 4LF6F 3PRVA 5K5MA 3NL0A 3EVWA 3KK3B 1R7IA 1WACA 3TEHB 1RTDB 2IM2A 2ZH1A 2B0GA 4GO7X 3C6UB 4XTTA 5EWEA 4TQRA 5HJXA 2JRSA 4OYPA 5HVGA 2VQEF 2F8MA 2BQUA 3W2VB 3DDNA 3C2PA 1M5OC 4KIAA 3BQ0A 1S9FA 1HYSA 2MJNA 1UAWA 2K2PA 3DGPB 2W2MP 3IBCB 1RZMA 2YPYA 1SJ1A 4HDHA 5BJRA 2NYIA 3GB0A 4YR3A 3THVA 2C2EA 2HHUA 3K8VA 3AB2B 3OTEA 5DDOC 4WFXA 2HYIB 3MM7B 2HBRB 1SC4B 4CRJA 5DDRC 4USJC 3CC7S 1RTIB 1TL7B 4P73A 4USVA 5KFCA 1X7VA 3PXGa 4U6PA 1L3SA 3G8SA 5KAKA 5L9NA 4NLPA 4M5HA 5EUHA 4QQBA 2XCPA 3SSRA 1YZ6A 4M5DA 1Y5LB 4I4BA 2KYXA 4NWBA 4QBUA 3DRPA 3BJYA 5IFMA 4ED8A 2Y1JA 1LOUA 5K8OA 3IM9A 2IJFA 2LFVA 2YX7A 2BANA 2XLIA 4BBYA 1HBOB 4ID5B 2BABA 2LXIA 4KKOA 3LPYA 1IBLJ 1RT7B 3UN3A 4AT1B 2FJVA 1NSKL 3PVXA 3RRKA 2AGQA 4HEA9 5E3CA 4RUHA 2A6MA 2CPYA 5D0GA 2C22A 2GV1A 4DSJA 2DGOA 4QIFA 1QTNB 3WC0A 4ECQA 3TUPA 3HVRA 4JI5J 2WVEA 4FYYB 2YH0A 5DGBA 1EP4A 2NXUA 3R2DJ 3MUTP 5LXRA 1XNQF 4OZ2A 2H54B 1R89A 2PO4A 1JLAA 2HVDA 3TO8A 3OUYB 1T03A 3Q2TC 4I1TA 1JK9B 4H4MA 4IQMA 4M5LA 4CLZA 1URNA 4RUBA 2M5YA 3SMZA 1WWHA 2J0SD 4P7VA 1HFEL 2QYGA 3MCSA 3LANA 5HVHA 4A8WA 1FCAA 2NSBA 2I38A 2R7QA 4OI6A 4WTYA 5B7WA 1FKAF 4OV1A 1YHQS 2W9CB 1S6QA 3EZUA 4PXCA 3PX0A 4OQJA 5ETPA 4WPAA 3SSSA 4PQUB 3T41A 3NS6A 2KI2A 2MZTA 2G2OA 3T5JA 4KO0B 4LRCA 3HD1A 4ELUA 1TR0A 3AD8C 2F4VJ 3BGRA 4UZBA 4WIQA 4DV0J 2LMIA 3RJMB 4DR3J 3LP0B 2XNQA 4Q2MA 3KHLA 1EETB 2CQBA 2Q6BA 4RWXA 2W4PA 3FQKA 3EZ5A 1UP1A 4X2BA 3UWTA 1GMVA 2JSXA 4OJHA 4K7QA 2ZH4A 1N34J 2VPWB 4P2SA 2V69A 3PTWA 1MROB 4NL5A 1LV5A 2DHAA 2F7VA 2FC8A 3PV8A 1C1CA 4RWWA 4X65J 1TKZA 4F36A 5A76A 4Q0BB 1TAQA 2A18A 3FK4A 4HACB 5KFSA 4DPWA 2GJ2A 2A6OA 2KZZA 2RD5C 3GYGA 3ZTOA 5HMZA 4PEOA 5L1KA 1S77D 3ISZA 2GMJA 3DLKA 4OZ1A 4CO3A 5KFXA 3NNCA 1DFDA 1HMVB 3K89A 1UVJA 3HJFA 3ILLA 1I51B 2XS2A 1CS4B 2CNOB 1ZZNA 2C2NA 2L41A 3H2LA 5F9LA 4NYZA 1IWGA 3FUYA 3MCMA 3OXGA 4O3NA 2NS1B 1RHJB 3PIOQ 3L4BC 2MZQA 3SDEA 1GMWA 3RTVA 3KHRA 3K5OA 5KFWA 3KK3A 4ECZA 1HNZJ 4UUXA 1RTDA 3FBCA 1AXQA 2ACYA 3Q8YA 2YX1A 2UUBF 3GILA 2V2ZA 3CC4S 2J0XA 2IVYA 2YNIA 4LF6J 2ZH2A 2VONA 4EYHB 4DV5F 5HI7A 1LNQA 4U95A 3EDQB 1UWBA 1IBLF 4OZ3A 4FF2A 2YH1A 1GX5A 1S9EA 3T1YJ 3JYTB 1RDRA 1BGXT 3CD7A 4ZVRB 4C8LA 1LFPA 3WIUA 2BACA 2AJFE 4KO0A 3SEOA 1RTJB 4IOBA 4C0BA 5B08A 3FJ2A 1EZZB 1WNEA 2HVIA 2AWZA 2C2MB 2O01C 5KT7A 1T3OA 3QJPA 5J2MA 2H3EB 3DRYA 1N48A 1J5OB 1WKLA 2YKNB 1RT5B 1GTHA 2MKSA 2WBRA 1U49A 1LK5A 2QO3A 3X1LB 2Z0GA 1XBWA 4B9LA 3MXHP 5L39A 3HF5A 1VLYA 2B9WA 1FTCA 1FRMA 4IFVA 3CC2S 4UY85 3UR3C 2GS8A 1RCOB 2JLEA 3IC1A 2D3ZA 4GMKA 1MU2B 4QWCA 1C0TB 3MPUB 3L95X 4QIGA 2UUCJ 3KJVB 2HQGA 4M5MA 3HFZB 1R0AB 4URSA 2VODA 4DX5A 5J2QB 1IKYA 4Z2XA 4I67A 1REVA 4P72A 3OTOJ 1OPZA 2RKIA 3W9HA 3H4DA 1AW0A 5LJ3Y 4DR7J 1BY9A 1RAJA 4USWA 4PQAA 3UVJA 2K1RA 3HSZA 3OUYA 1HA1A 5D3GA 4DR2F 1UWAA 4C0HA 3MPWA 2A2CA 1U4BA 4ELTA 1VQ4S 4H4MB 2ZFHA 1H2TZ 1SC6A 1KQKA 1RWWB 2GCFA 1SQGA 1U0HA 2ZD1A 3NGUA 2XZTB 3M8QB 1WEXA 1QAXA 2DH8A 2CPFA 4WJBA 5ETOA 4B3TJ 1OYEA 4LRFA 5C25A 3LGMA 4KAIA 2CFXA 3K17A 2ROPA 1VDHA 3PW5A 1XR5A 3OXFA 1FFGB 3V4MA 1SIWB 3KJVA 4LSLA 2CNKB 5LL6d 3TZYA 2KXFA 3MM6B 4TY9A 1YBTA 4I68A 5EWFA 3PX4A 3DN9A 5HMWA 3KMQA 4RR5A 1M5VC 4EBCA 1ZAWA 1B0VA 2IM1A 2QG9B 5ITHA 5FD1A 3GFYA 3UD3P 2DNKA 2QLWA 3V2UC 4DR1J 4CLTA 1Q82T 2JH3A 4OI1A 4KV8A 3Q8PB 2VG6A 3ZZ0A 4B3MJ 2H5JB 5A8KB 3IN5A 1D0EA 3C8YA 3IM8A 3ZTQA 2RS2A 1NZAA 2HFVA 5GAHI 4C98A 2ZBIA 3DLHA 1FNOA 2GGPA 2J76E 1S12A 1TKZB 3DRXA 2CWKA 3PYGA 2EFOA 3F56A 4NLUA 1P6TA 2B7BB 2VQFF 3TEGA 3KOAA 2HVHA 2MQNA 4MIAA 1S79A 3MFHA 1TU0B 1XNRJ 3FCVA 3F41A 5EX3A 1S9GB 1HQ2A 4CH0S 4ZLNA 1S4EA 3M2VB 3CPWR 1L5UA 3CD5A 3QNWB 4OYIA 2CAJA 3LUYA 5GMEA 2HGNA 1FNMA 2V4RA 2WSEC 1KEKA 4DL7A 5IS2A 1YRTA 3K8WA 1S6PA 1PBAA 3M30B 4IOCQ 5HLFB 2C2OB 1UL3A 3UDEA 3OVAA 5ETNA 4OX8A 2KVQE 3A8JA 4LF5F 1TUVA 5E3AA 3QT6A 2FJEB 3KG1A 5F9NA 4WKYA 1PYTA 2IMOA 4PABA 3QFWA 3Q8SB 1NJZA 2QMXA 3HHKA 2B4UA 2O3DA 1RHQB 2UXCF 4K4ZA 2DNZA 2YWFA 3U7JA 3OL7A 2XMWA 1EX8A 3CT9A 1TV6B 2CZVC 3M6VA 3TOQA 2IAJB 2HNDA 1KTVA 2FLOA 3LQVA 5AXNA 2YKPA 4ED7A 3PYFA 4CNZA 3UE2A 2L08A 3EXYA 3ITHB 1GAOA 1YZ7A 4RW9A 1GT8A 2BJ3A 2JC1A 1B0PA 3EXCX 4OJ1A 5T41A 3UR0A 3N01A 2R7OA 4FKXA 4XPEA 4RNMA 4Q45A 2R2RA 4A4JA 3ZNUA 4IUFA 2CQ4A 1CSJA 2O1PA 3HVTA 1R8AA 4ZN1A 4OX6A 3RU0A 2R2SA 4ECRA 3CCRS 2YKOA 3R5AA 5M2PA 3UW1A 5ETMA 3H5SA 3HLUA 4FNHA 3G8QA 4KGZB 4X4RA 3T5KA 2X1GA 4RBTA 1B3TA 2W2QP 4RUAA 4F3OA 2NPFA 2KG0A 4C8ZA 5DM7Q 3EX7B 4WZQA 3DLGA 5KG5A 1UVIA 3G86A 3KHGA 4KC5A 5IM0B 3Q23A 1FDDA 2UVRA 1S6QB 3BH7B 1KVKA 2QL7B 4Q7AA 4ZPDA 3W2WB 2XI3A 4CT8A 5K8PA 1R31A 2HNZA 3M4XA 2XGPA 3AJ2A 1F3VA 4DQIA 5DJBA 4ZCLA 4K0KF 4NZ0A 4ZVQB 2FZGB 3I0RA 2RB7A 1NU4A 2BYCA 3HHLA 4N77A 4ZJOA 3G9CA 1T0TV 4K4YA 4JBCA 1S9EB 5KFUA 4M5JA 1VBKA 1HR0F 4MKYA 2VPYB 4ZIVA 1TK5A 2VBYA 2OPPB 3CCZA 3CB4A 5AT1B 5H9FJ 5A8WA 1PG5B 3NS7B 2IBOA 4Y6IA 2XYGB 2LQ8A 4FXWA 4UZCA 3RYLA 1L3VA 1KQSR 1JJ2R 3NGTA 3OHBA 2W7AA 4DFJA 1FX4A 4QYZJ 5DO2A 2IMWP 4H4KA 1F0XA 1U0SA 2M3DA 2V8GA 4ECYA 3CEDA 1WI6A 2ZH3A 3IGVA 2HW3A 1UPPA 3Q22A 2APOA 3NCRA 2PI5A 3U1MA 3KLHA 1WG5A 1WSVA 1M1HA 3LP2B 1PKUA 4E0DA 4GRSA 1VQ9S 5D15A 3POTB 3W9JA 4RNOA 1WORA 3FEXB 3GJRB 4PG4A 2W9BA 3I82A 1KSPA 1E6YA 5F8HA 5JUMA 2H4YB 3LP1A 2LKZA 3QIPB 3MM5A 4LRDA 5CA5A 3BQ1A 3VAJA 1K47A 2R2TA 1XMQJ 2Q66A 1LXNA 1VC6A 2HFUA 3CCMS 4X64F 1F5CA 1KKHA 4DV5J 2R4FA 1TL3A 1L3TA 4KTQA 1UJ5A 2FLLA 2QX0A 3G82A 2KT3A 3JQMA 1U45A 1N8RT 3MEGB 2OHDA 3ENQA 5G0RA 3IWLA 1LWCB 5KFAA 3JSMB 1VQ7S 4CYUA 2QL5B 5KFHA 1FRJA 5DG9A 4M5DB 4EK2A 1HNIA 4YY3J 4X4OA 2DIUA 3TUZC 1TFWA 1FEHA 1K44A 3TI0A 2MQMA 4I6AA 3E51A 4W98A 4DX7A 3NS5A 2UVUA 1J2VA 1NJIT 1RT3A 2EC2A 4DL4A 2OTJS 1RTHA 4HHHA 2UP1A 5A8RA 2YKNA 2QMWA 1WDTA 2OD4A 2DNPA 4KHMA 1KFSA 4U9RA 3CVKA 1BXNA 4ZVTB 2FTRA 2OO4A 5BR8F 2ZOFA 2W8LA 2UXDF 1VBZA 1NB2A 3T5HA 2PE8A 2HHWA 3L9ZA 4NA3A 4J9VA 1SQFA 3BO3A 3EGWB 4CO0A 3KK1B 5H9EK 1HBNB 4B02A 2BJEA 3AODA 5B0GA 1T03B 2GFFA 4Q43A 3BV8A 2VFRA 1BWEA 1GH8A 3G6VA 3K59A 2ZH6A 1UFLA 1N6QA 2Z8QA 3P5BP 3C6TA 3DOLB 2OEJA 2ZBCA 1OMSA
chains in the Genus database with same CATH topology
2DR7A 3O1LA 3TA2A 5THWA 2EWHA 4MAKA 1DTQB 4OZJA 3D1OA 4IQXA 3I9ZA 2ZJRQ 1NK4A 4ILMA 2N4CA 3OTCA 4OHYA 4A8KA 3CMES 2C2RA 4PPDA 3QWPA 3T9ZA 2I8EA 5KFQA 1BLUA 2M88A 1KHVA 3IRXA 2IYIA 5AE2A 3BN7A 3UCZP 3KYLA 3CDEA 2XZWA 4PG7A 2QIFA 3CIZA 3CJKB 5LSOA 1WTFA 3RW6A 2HNZB 2ASLA 4C8MA 5KOWA 1QE1A 2I9SA 1YJVA 2JVRA 4I6YA 2XB2D 1HI1A 4NLXA 5KG0A 2KYZA 3B8HA 1V3RA 5HL7Q 4J37A 3SDEB 3T9NA 2E9ZA 2GQCA 4IDKA 4NXNF 4Y3CA 3DRSB 2E5LF 4K4XA 2PFFB 4LFCF 2MY7A 2IVMA 3GG0A 1ZH5A 1RQ0A 3UCUP 4R5PA 3PW0A 1HBMA 2V2KA 2ZH5A 1RT6A 3HZEA 2HS0A 2AU0A 4OHZA 1GNKA 3D0HE 3N5FA 2V4QA 3QLHA 4FXVA 3HK2A 1IKVB 1LKZA 5J1EB 1FXRA 2EFNA 3M05A 2B9YA 1REVB 1KTQA 4DV7F 3QJJA 2RMLA 1QSYA 3CF5Q 2NSCA 5DQIA 2HHTA 4ECWA 1HNIB 2V8VA 3I5BA 1HQUB 1NJXA 5KFFA 3QO9B 4OI2A 2W25A 1FK9A 3VF0B 2XO7A 3CCVS 3DOKB 1K73T 1XN9A 1QAJA 2WCXA 1U6BA 3TRGA 2B4OA 4KGMA 4IOAQ 4CTAB 4FBTA 1KOOA 1U25A 1C1BA 1HWLA 4QYRA 1S72S 4PUOB 2HFNA 1HPZA 3DI6A 2KG1A 2DNOA 2G0CA 4DPOA 2XLJA 1MMDA 2KDOA 3G96A 3IS9A 5C42A 3DRRB 2B5JB 5I3UA 2DB1A 5KG3A 1X0PA 5CD4H 3DLEA 5A2QY 2DNYA 1G7CB 3AJ1A 2I5JA 2ABYA 5CCLA 4AQYF 3HKWA 3M2UA 1C0UB 4RU9A 1RTJA 4B9VA 4C7QA 2Q6CA 3K2YA 4LF8F 2YKMB 3O3LA 2D41A 2MZ1A 1O51A 1BC6A 4FVCA 4I7FB 2I2YA 2HHXA 1CQMA 4X65F 5DGAA 3G6YA 4OJ3A 4XIUA 2R7UA 5H9EJ 3M1VB 2PI4A 2FVCA 2LXUA 3JTOA 2G4BA 3M9NB 3G6XA 4X4TA 4ZPTR 4CH1A 1ZM9A 3LO3A 5KG4A 4ED3A 1OSDA 3CMAS 2CQ2A 3GIJA 5CYMA 2EBEA 3PRBA 2VFVA 1S1UA 1DQAA 4TU7A 4B9NA 4K4VA 3H25A 2AP6A 3O44A 2HRYA 2DPIA 2UV8G 4H4OB 4Q8EA 5KTQA 2OH2A 4DN9A 1VC0A 1JXEA 1H7XA 1W2BR 4I7FA 1CLFA 3CDWA 2COLA 4UY8T 1TKDA 1D9DA 2JWNA 3GFXA 1VI7A 2MZJA 3V81B 2MHNA 4HI1A 3U02A 5KFTA 3L3CA 2BZ2A 3KLEB 5H1SV 1WG4A 3FEZA 4ALZA 4Y34A 3MR6A 5GAGU 1JLFB 1Q1KA 3SCKE 1IUJA 1X4FA 5DDQC 2XY7A 2LECA 1R6YA 1S0NA 5MAOA 2ILZA 4N47A 3BEGB 2KM8B 4IYQA 4OI3A 2JEGA 2DGTA 5KT4A 3QLHB 3JTNA 4RW4B 4NOHA 2XMVA 1UA0A 3OJSA 3UQSA 5GAEI 4ZKAA 2RRAA 2L48A 3FCHA 5D4LA 3IG1A 3I9V9 3SXLA 1VS3A 1ZZFA 2YQ3A 4N56A 4NMLA 4LF4F 2AYMA 4ZPCA 1DTTB 1JXLA 5KFMA 1HNWF 3N9UC 1OIAA 3QO9A 1K1QA 1UMJA 4F4ZA 5E5NA 4WF9Q 4B3RF 3MMBB 3M8PA 3NBPB 3OFHA 4WK1A 5GVQA 2YNHB 1JKHA 1FEEA 1YRUA 2VB6A 2JDJA 1HBUB 4EU0A 1BQNB 2N3OA 2DNMA 2C3MA 4LQ9A 1YVFA 4RW8A 5B0FA 3PKMA 3MURP 5F8JA 2IYGA 4IKAA 2FLNA 2P6TA 3KWMA 3I0SA 2M0GB 3JB9k 3IWXA 2BJDA 3GMGA 4OFZA 2VASA 4EZ6A 2QA2A 2U1AA 2EFQA 1Q79A 2PD1A 3PFOA 3H2VE 4BS2A 4ED5A 3NAIA 1LW2B 2CQDA 1FJEB 4WXWA 1HD0A 3DOLA 2CPIA 3ZZZA 1T8EA 1DRZA 4OZ0A 4M63A 4LQ3A 2C3PA 4O3QA 2LU2A 2VC1A 4FF4A 3ETOA 4HLBA 3MPYA 1OO0B 2YKAA 2HQ3A 3GZ7A 3BZQA 3TW0A 2M9KA 2BBEA 3MTKA 4LT6A 5M2UA 3TVKA 2XY5A 2PA3A 2BXJA 3IRXB 4RLEA 4DBQA 1DBDA 1WD6A 2ZVSA 3AY0A 5KG2A 3WC2A 1Q7YT 2KXHA 3QGGA 2AQ4A 2A3JA 2CQPA 1FD2A 5L1IA 5IT0A 1T02A 4YR2A 3FSIA 2MZRA 4LVOP 4U7UK 5B0CA 5IZHA 2CPJA 4PUOA 3PFEA 4XDDA 3MMAB 4MK7A 1RTHB 3A8EA 3I5AA 5L8RC 2C2DA 3M2RB 1GXTA 3QGIA 2XWYA 1X5TA 4PXEA 3VAIA 1HD1A 4RNFA 3OJUA 3BGRB 1ZTTA 1L3KA 2OPQB 4MMOA 2MJUA 3KK1A 3FZBA 3VAHA 1W2IA 1YRXA 1JLEA 3IR7B 3MR5A 4KJIA 2R7VA 2MKIA 4J9NA 1RT5A 2F4VF 3OXLA 3MFIA 4JV2A 3NCPA 5KG1A 5SZTA 1SI9A 1FJCA 2B43A 4Q44A 3OTOF 1BD6A 3IR6B 4WE1B 4HTJA 2IHR1 3GYNA 2W7OA 3PW4A 6FD1A 2OAUA 2DR5A 4K59A 4J9LA 4YUDA 2BV3A 2BOPA 1FVSA 3JSMA 1QAYA 4MIWA 5E2QA 2FPHX 4CO1A 4AL5A 1OQ3A 1BQMB 2RDJA 2MSSA 4C4WA 3G71S 2KN4A 2YWEA 2JVOA 4ITSA 5CYQB 5DDPC 3GV7B 3C3LA 2WONA 3UPFA 2V0NA 3QIPA 5D8HB 1RISA 1DLOB 4IG3B 1KFDA 2R8JA 1ZTWA 2CYYA 4ZHRA 4QR2A 3M6WA 3BGLA 1PO6A 4LUBA 3NWGA 4DHVA 2E5IA 2ALZA 4PXBA 3MUVP 4RZRA 3AQPA 2GMHA 1SBRA 2CQCA 3CTRA 1U26A 2BDPA 2XCAA 2ZUGA 1VQ5S 2UUAF 1SV5A 1JKHB 4QIEA 4CCHA 4TYBA 1NKCA 3M2UB 1M1KT 2LEPA 3PJWA 4ZLPA 4J9MA 4DS5A 4O4GA 1NK0A 2MKKA 2M8HA 3BF4A 5A8KA 1Y9OA 4IH7A 1X0FA 4C3LA 4O3SA 3DC2A 4ILLA 1X8DA 4WFZA 3GG1A 4IFYA 2FJAB 1SKSA 1HQEA 3MD3A 3MR3A 3G8TA 1KOHA 2N7YA 4CO2A 2VUGA 4OMFG 2XGQA 1S97A 2DK2A 1D8YA 2L3MA 3BGFA 4QCLA 1KHWA 2C3OA 6FDRA 2MZSA 2W9CA 3BR8A 2C2EA 4ETZA 1OWXA 1GQEA 3UI3A 3J7A1 2DHXA 1QE1B 1HNZF 4KGKA 3KLFA 2QA4S 2HLTA 1WTBA 3QJLA 4ZDNA 3WDOA 4TN2A 2Y1RI 2ZE2A 2EFGA 4J9KA 2B3TB 1UETA 4DQSA 2PDAA 2HHQA 3VR1A 3NGDA 1OPIA 1VJWA 4KR0B 4F67A 1RI7A 4XK8C 1FT8A 4GC6A 1Q8BA 3FMWA 1HNXF 5E3QA 3O2IA 3Q2SC 2DCUB 3UDCA 1MROA 2ZOGA 3GWCA 1TL3B 4KB7A 2XEXA 1CC7A 1JLBA 4J9QA 4FYDA 1IKXB 3DOKA 2FVRA 4Y2KA 2G13A 4DV1F 1HBOA 2E5JA 4ID5A 4KKOB 1U1MA 4WKRA 1RT7A 4CTAA 4NCGB 5CHCB 3KLIA 1SL1A 3U27A 3L7OA 2PIIA 4MYTA 2F8EX 2SXLA 3DYAA 3EGZA 1G3OA 5HP1B 2B7CB 5JVHQ 3P6YC 3K5NA 2KJWA 1H2VZ 3N6LA 5J2PB 2UU9F 5KFYA 3OW2R 2EVZA 1N56A 4I56A 5J1PA 2B9XA 1GX6A 4NZ7A 2CJAA 4ZOSA 3N28A 3GYXB 4NLQA 2NLWA 5B0EA 4CH7A 2RUGA 2C3UA 2LLZA 2RU3A 1XK8A 4DN0A 3HHLC 3LAKA 2ZJQQ 2AW0A 1FJ7A 4B3MF 4B9TA 2RS8A 4HKQA 1IQTA 1LW0A 1DQ8A 1QM9A 4O3PA 3T6JA 3M9MB 4DL3A 3TVYA 4P7TA 3BB5A 4OZNA 4W90B 5C25B 3BS9A 3L7PA 2OP5A 4DX8H 1SL2A 2DGSA 3FMBA 1SUQB 1Y5NB 3IR5B 4W92B 3QWUA 5CYQA 1C0UA 1CVJA 2KT2A 1U09A 2JJ4D 2MHEA 5F0WA 2WW8A 1PGZA 1U1NA 3H20A 3TAMA 1NK5A 1BWEA 2W24A 4AL6A 2E1AA 5CH7B 3AA8A 3ZZUA 2QSWA 2RQMA 2KVIA 1SIZA 1TV6A 2BVZA 3HHNB 4RW8B 4LF7F 2UV8A 2VBWA 4OX9F 1CG2A 2LQ9A 3S1TA 4XO0A 5LMUF 3BSCA 3D28A 2FJBB 1V6HA 3FNNA 2MB0B 1T3NA 3MF5A 1S6UA 2MKJA 3MWBA 1C4CA 4QIWD 4A8YA 1JLGB 4ZMMA 1N52B 1Q16B 1P27B 5E7OB 3AA9A 2UUCF 1N5VA 5E33A 5KOXA 1SH2A 3IFEA 1FVQA 2OPRA 2MYFA 3O5TB 2HMIA 2MPUA 1HL6A 2G9OA 3PEJA 5IXUA 2KB2A 3DLBA 1Y7PA 2R8KA 2WB4A 3E01A 1KR4A 5C24B 2VG5B 3S6EA 4ZVEA 3V6JA 4FBUA 1J5EF 4K5RA 2D3OR 4RW4A 3J80Y 2LA4A 4DDFA 4OHXA 2DNNA 3RAMA 3FDSA 4LIRA 3PJXA 2P9CA 3JSRA 4ZPWR 2R2UA 3NG8A 1TKTB 2FJWA 3LOUA 3D54A 2WSFC 1KONA 4IH5A 1C1BB 2QSFA 1AFIA 4K4TA 2DRAA 2EPIA 2BQRA 3LALA 2EKYA 4O4GB 3CCSS 3K57A 1TZ0A 5HBMA 4DR3F 3E2EA 5F3ZA 5KFKA 1S48A 4IFYB 3I31A 3US5A 1U1PA 2MQPA 2HQIA 3B4MA 3OSPA 3EPGA 3SV4A 2RF2A 2NR0A 2ILYA 1VRUA 2RJZA 3R3TA 4A8XA 5AXKA 2RQKA 4Y2CA 4CO4A 2KHCA 1DTQA 3T6BA 4DL2A 2GO8A 1SKWA 3RR8A 4RW7B 2W9AA 1P1LA 3DXSX 4Y2AA 1U1QA 3FFIB 1KD1T 4HDGA 3PO4A 3CCUS 2YNHA 4EUVA 4A8MP 4KQZA 4U67Q 3OVSA 3Q8QB 1U1OA 3LP0A 2K7JA 1FTRA 3ULHA 1R3NA 2PEHA 3BR9A 1YJRA 3L09A 4YB1P 3OR2A 4NLDA 2OMLA 1T7PA 3IG1B 2OPPA 4PR6A 5A8WB 5HMXA 2FC9A 3GV5B 2YY3A 1RYSA 2IBKA 3P49B 2DJWA 3HVAA 4NA1A 2KU7A 2V4JA 4Y00A 5LMNF 1DZ5A 5HROA 4URQU 1YJTA 2GJIA 4PKDB 5DLFA 1AFJA 1VQLS 3GE9A 1WHYA 2LA6A 4RKUC 1RT4A 3CJ2A 3PACA 1JX4A 1YG0A 4OHVA 4N5SA 2J7WA 4C0OC 1QUVA 2VFUA 1YIJS 2IVFB 1Y5IB 3RW7A 1APSA 4BC7A 7FD1A 3CDAA 3BSNA 1GXUA 5D4OA 5HP1A 3VWSA 2LDIA 1S7HA 5KFPA 2ZDOA 2KH9A 4TYAA 4DR6F 3ISNC 2M52A 1YITS 4X4QA 4TU9A 1ZPWX 4Y65A 4R8UB 3C6TB 2JEFA 1JLGA 1WHWA 2OIHA 4IRDA 1N6QB 1H7WA 2MSTA 3AHPA 2YNGA 2E9RX 4F25A 1S6PB 1C0TA 3M30A 3AQOA 1JLCB 1X4AA 2AYGA 1FRKA 1IJEB 1LFWA 2JHEA 2J0QD 4OI4A 1QAIA 1FK9B 2XMTA 3H5UA 4QR0A 4MK8A 3VZHA 3GQCA 4MTPA 4K50A 2BW2A 4ZP7A 4IG0B 2JFDA 1VQYA 2BRKA 4C97A 3W7BA 4TQSA 1AUDA 1CC8A 4ICLB 3D0GE 2F9DA 2GHWA 1HBUA 4ED2A 4YB7A 5F8MA 2ROEA 5IQ6A 1SUQA 1Z1ZA 4NCBA 1RTIA 4QW9A 1SKRA 3HO1A 4IO9Q 3DLLQ 2V8DA 4EZ9A 4JV1A 1E6VB 4L72B 4QU7A 3RAXA 4K4UA 2IA0A 3MECB 4Q5VA 1NHUA 2V4JB 1HWJA 2YKQA 4E98A 1KNZA 2DGVA 3NNAA 1LW2A 4OI0A 3TYTA 3EGNA 1FXLA 1GTEA 5DG7A 5DG8A 4YMEA 1MWZA 1MWYA 1VRTA 4I0WA 1X5SA 2CQIA 3DOMA 3P96A 4FZVA 4UUWA 2W8KA 1S9GA 2B6AB 1WG1A 3LWMA 2L9NA 1TL4A 2VA3A 1BQMA 2LQJA 5A6WA 4ICLA 4X62F 1X5OA 2CQ1A 2WOMB 4BHQA 1ZYQA 4IO1A 1FKPA 1UEUA 3QZ8A 1SV5B 3NRBA 1HNVA 2AJ1A 1JLAB 2QT7A 4M94A 3AAWB 2RF2B 2E7XA 4M1KA 3NAHA 2X1AA 1DLOA 4IG3A 2Q43A 4WE1A 4DL6A 1N36F 1XTZA 2MXYA 4DV6F 2VH7A 3I96A 3TP2A 3G6ES 4R0JA 4I2PA 4BDPA 1FO1A 3HZGA 4I2QA 3GFHA 1F5BA 5L9XA 4FXDA 5FJ4A 1F5AA 3K58A 4ZP8A 4JI0F 2FVPA 2MQOA 3MEKA 1NKEA 1YWXA 2DD8S 2CQ3A 2V9KA 4MK9A 1IQZA 4FPRA 4Z37A 2JC0A 5A6PA 1TKTA 1HBNA 3KHHA 1P8GA 4C3KA 1LWEA 2YNFB 4F4YA 2X1BA 3HMJG 2R7WA 3ZZOA 3MEDB 3K0JA 2JL9A 3LP2A 2EK6A 1XWLA 4G1QA 2LU1A 5KFDA 4HT5A 1XEZA 2A1BA 2XHWA 1S1TA 4BC9A 3B82A 3OV7A 1CEZA 2MMYA 2RRBA 2C3YA 4C8OA 2JFKA 2VG7B 3PR4A 4I2PB 1Q86T 3M8PB 3NBPA 3WX4A 2KXNB 2LXFA 3QAEA