1FJGF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fjgF00
2UU9F 2BXJA 5IWAF 1G7CB 1F60B 4K0KF 4DV4F 4JI7F 2UUBF 2ZM6F 4X64F 1G1XA 4LF8F 4DR3F 4DR2F 4LFBF 1B64A 4DR5F 4JI3F 2YY3A 1IBLF 2VQFF 4LF4F 4LF9F 1XMOF 4LF6F 4JV5F 1XNQF 2KJWA 1CQNA 3ZZPA 2E5LF 5AJ3F 4YHHF 3OTOF 1N33F 2B7BB 1HR0F 4LFAF 4DR6F 4NXNF 4LF5F 4JI6F 1LOUA 4OX9F 3R3TA 4DUZF 1XMQF 1CQMA 4KHPF 1HNZF 2UUCF 5LMUF 1VMBA 2UUAF 4NXMF 4JI5F 2BVZA 2J5AA 1IJEB 1RISA 5BR8F 1XNRF 2B7CB 4DV7F 4YY3F 4JI0F 1IBKF 4JI1F 4X65F 4DV5F 4LFCF 2RJZA 1N32F 2HHHF 4AQYF 4DR4F 2VQEF 4JYAF 4B3RF 1I94F 3T1YF 1FKAF 1FJGF 1GH8A 4DV3F 5LMNF 1IBMF 1HNWF 4GKKF 2UXCF 4GKJF 4DUYF 1J5EF 4X62F 4DR1F 4DV1F 4DV6F 4B3SF 4DV2F 3T1HF 4JI4F 4B3TF 1QJHA 2KJVA 4DV0F 1N36F 4JI2F 4X66F 4DR7F 2UXBF 1N34F 1IJFB 4JI8F 1HNXF 4LF7F 2F4VF 4B3MF 2UXDF
chains in the Genus database with same CATH superfamily
2W01A 2R8JA 4OI2A 3Q89A 2KRRA 4F67A 3CCJS 2CPFA 1ZAWA 2MB0B 3MR3A 3CMES 1ACMB 2CQBA 2CQ3A 2XMTA 5IWAF 3TANA 5AE1A 1HWIA 2RB7A 4ICLA 3CJQA 3PV8A 4RNHA 1N56A 1ZA2B 2W9BB 1I3OB 4NLSA 3NG8A 2AJ2A 3OBIA 1O5JA 2JLGA 2B5JB 1U8WA 3LP0A 3QO9A 4ED0A 2MSTA 1UVNA 4PWDB 1IKWB 3M8WA 2GV1A 4X4PA 2W9CB 4OZ5A 2BKPA 3L7OA 4LVOP 3MM9A 4ZVFA 3SV3A 2AEJA 3MCMA 2QYCA 4OX7A 2YNGA 5A8WA 4RNNA 3QZ8A 3H90A 2DXFA 1PIEA 2W4CA 2ZBIA 3UNYA 5C7PA 4OYXA 4WU2A 5KFGA 4KGVB 2ZH4A 4NCBA 5K20B 1KVJA 3D4JA 1WOPA 2VG6B 4QIGA 3J81Y 1WHWA 4P73A 5J2NB 2XCAA 3DHXA 2Z2YB 2B9YA 1YJNS 1VQNS 2C2EA 1H7XA 2AJ4A 1AB8A 1JKHB 4JUZA 1OIAA 4C3KA 4CTAA 3BV8A 1QAIA 2CJBA 1FK9A 2E9RX 3QT7A 2XZWA 2QFJA 4F8RA 3ILIA 1GFWB 1TL3A 1LEOA 2OGUA 2Z4PA 5BYQA 3EGZA 3OFHA 2O66A 3W66A 3CCMS 5H1SV 4K50A 5LSOA 2DR6A 1RWNB 3CSKA 5D0RA 4XPCA 4FYWB 2MMYA 3KK2A 4NEYA 5KG7A 2LMIA 3CCLS 3D0IE 3HKZD 5E0OA 1SQFA 3UW1A 3C66A 5B0DA 3M9MB 1LK7A 1H2VZ 2X51A 4LJMA 3KHLA 2LP4A 3D1OA 4P2FA 3M8QA 3D6HB 1RISA 2HFZA 2GVDA 2J9DA 3QAEA 2AEFA 4WFAQ 5J2MA 2EG2A 4NCAA 1XNRF 4KB7A 3SDEB 4ATNA 5KG3A 5B0CA 5C42B 2DISA 1EARA 4Y2AA 3TEHB 1GX5A 3LPEA 3OXFA 1Q7YT 3VAHA 3TZYA 3UQSA 3K58A 3MCSA 1IBLJ 2HHWA 2EG1A 1ZZNA 2RIJA 3M6WA 5ETOA 2ZH8A 4ED1A 1IKYB 1T9YA 1JJCB 1U0HB 1AA1B 2HNYA 2MGZA 5I42A 1NCLA 1SC4B 2XZDB 3VTIA 2BR0A 2P9EA 2CYYA 3G82A 1W2IA 5K14B 3AODA 2KYZA 3M9NB 3BREA 3DRRB 1ROFA 3MHYA 2GAHC 3T1HJ 4M1KA 3RU0A 3LP1B 2M4MA 2AEMA 2GO8A 2QL7B 3WQPA 5CAAA 1D8ZA 2GVZB 4RWWA 1HKAA 1RCXB 5ETTA 4R0EA 4I7FA 2MPUA 3JSYA 3ILJA 1TL7B 4J9UE 3RUBL 4RU9A 4K4ZA 1F5CA 5IC6B 1WF2A 3BSAA 4UW2A 1WD6A 2VJVA 3VCDA 4C9DA 3FRZA 4USVA 1BQXA 2DGTA 3J7ZT 3JSMB 1SH2A 5ETVA 4J9RA 3O2IA 4QR2A 4O3NA 1M5SA 2CXEA 1X5OA 1RABB 2EXUA 2QC3A 1RJJA 1EKSA 3PHTA 3V81B 1KHVA 1FI4A 1V5VA 1FFWB 1TUVA 2APOA 2CJAA 2CPXA 2WRMA 4TKTA 5I3PA 4B3TF 4QCLA 1WSVA 2ZBRA 4TVAB 1UA1A 1VBZA 3D67A 3K57A 5JJBA 2LA4A 4IRDA 3GFXA 2P6TA 1T95A 3EPGA 3AXMA 4KPYA 1A6LA 1UVLA 4ECQA 2QLWA 2FGCA 3NLCA 4IG0A 2C2OB 4RL1A 5K14A 2BANA 2EK1A 4RU2A 4TY8B 4QBUA 1Q1KA 4EBDA 3JTPA 2HHTA 4ZIWA 2D3O1 4PPDA 3KK3B 3GSIA 4B3MF 1WUUA 4ZVUB 1S1VB 1VOMA 1U02A 2ALYB 1N0UA 2OMOA 4A8XA 1S6QA 2HHPA 3C6TB 3I4HX 1RT5A 3RJMB 4N56A 3BKFA 4RUBA 3KMSA 5L1JA 1X4CA 4OIXA 1BXNA 1WG5A 3ETOA 3GB0A 5GVQA 4CNYA 5F0WA 4RUHA 5KT5A 3KLVA 4DPXA 2NYHA 1YJUA 4OZ0A 4ED5A 4GMKA 1SL0A 3LAMA 3QT8A 1DARA 6AT1B 5KOXA 2NQPA 4F3QA 2KN4A 1TL4A 1HHSA 3W8GA 3PACA 3S6EA 2CJYB 2H9ZA 3BYRA 2LQBA 3SBMA 1BWVA 5M2PA 2Q6BA 3UN5A 4DR2F 2O1PA 1T9TA 3LPYA 4DQQA 4J5OA 4K2JA 4LBIA 4OV1A 4X84A 3CCSS 2V63A 3ZZOA 4EFAC 3GILA 2ZHBA 1U1LA 3M2RB 3OFEA 3TARA 1XMOF 1B0TA 3BO3A 4LFCJ 2DEIA 1H6KX 2OPQA 1ZTWA 3K7RA 3IP0A 1HPZB 2PC6A 4L76A 4Q2MA 4MIAA 1KVKA 2E7VA 3DLHA 1RTJB 1YVFA 2W25A 2MZ1A 2W9BA 2B7BB 4BLGA 1NK4A 1LQ9A 3K5PA 4RPFA 5KFRA 3KUHA 4NYPA 1S10A 2MHNA 2CG8A 3GYXB 2QLFB 2V2VA 3RBXA 1TU0B 1FDBA 2CJXB 3KLHB 3QLHA 4KBIA 4JBCA 4K5SA 1VR6A 3KDOA 1NEEA 3SIPB 1I1GA 3KHRA 4NWBA 2OTJS 1IM6A 1T8EA 1VMBA 3EDRB 5ETSA 1R3NA 2UUAF 2VFSA 2FQQB 1ZETA 3HHNB 3PIOQ 1WEXA 4DV2J 2V67A 2R7WA 2AYGA 1AUDA 1MLAA 2M8HA 2HZCA 2P5VA 4WFXA 1RTJA 1RU2A 1UFWA 2CDRB 4KHMA 3U27A 5GAHI 1KP6A 1WELA 5F41A 5KT4A 1XMOJ 3KTQA 3KNAA 1IBKF 1UW9A 2DNYA 2UV8G 4C8MA 3FFIB 4URSA 4LFCF 2W1BA 1UP1A 5L1IA 1JLEB 1OYDA 5HMXA 1KWMA 4I2QA 2XWYA 1ULRA 1FWKA 1NK5A 2DHGA 2GJIA 4AQYF 3EDQB 5F3TA 3BQ0A 3RTVA 4C8ZA 1S9GA 5C2CA 1FWPA 4O0NA 4JYAF 4CP5A 4N76A 2K2PA 3KK3A 1CJVA 1A7GE 1PYOB 1IWGA 3PW2A 1S59A 1PG5B 3CMQA 4HTJA 4G6VB 3OFFA 2HSEB 3DCAA 2MYFA 4ZVQB 5IWAJ 2VFUA 4MIWA 1V5IB 4Y0FA 1U49A 1S0OA 3W9IA 2ROGA 4ZVPB 2AGQA 1ZAVA 1RTIA 1R6VA 2O67A 3Q8QB 1TKTB 1WKJA 4PG4A 4K4XA 3PXGa 1PGZA 1WHXA 1CVJA 4CO5A 3DGPA 5KFBA 1FFGB 5F8IA 1Q4RA 1N0VC 5HANA 3IS9A 1RB0A 4NEZA 4ZN3A 4FZVA 4LT6A 1UW4A 4ALZA 3UPFA 5IS2A 2VICA 2V2KA 3L4BC 4P6QA 1H73A 2EK6A 3HFKA 4IR9A 4JP8A 3MI7X 2XULA 4K5RA 2O01C 1Z4UA 2JSXA 4JI8F 1JLCA 4B9UA 5L1KA 1JLBB 2QMXA 5KFZA 3TVZA 3QT5A 1BQMB 2AF6A 5A6PA 3IC1A 2YKAA 3R5AA 3MUMP 2UXDF 2K8GA 1NKEA 3G6XA 4F2SA 4B3OA 1FERA 1VIXA 1NU4A 2DT9A 1D9DA 2W8LA 3QZ7A 3TX0A 3OJUA 3SFUA 4C8YA 3QGHA 5E3CA 2HMIB 3K2YA 3ITHA 5GAGI 1TKTA 2XMWA 2OAUA 6FD1A 4RUCA 1D8YA 2YKNB 2D3OR 3RBZA 3R1HA 5KFTA 1ZYQA 3OR1A 5BYRA 2F40A 3WZ0A 5EN1A 4DG1A 2FVSA 1FJ7A 1VRUA 2ASJA 2UXDJ 1H74A 1LW2B 2LQ5A 1RT4A 2XWXA 2LVWA 5D4NA 1S97A 3E2EA 3DRSB 1MNEA 2GVDB 1H3DA 1B99A 4I67A 4KY3A 4CT8A 5KTQA 4OMFG 4BWJA 4NASA 2QJ3A 3I9ZA 4F0MA 3F56A 2J7UA 3C19A 3HVTA 3G96A 4C8KA 4U95A 1XNQF 4WF9Q 1MMDA 2FGOA 2B4VA 2AZ3A 2GIQA 3GE9A 4TU9A 4OX9J 5E5NA 3W3SA 1WORA 2COLA 2KFZA 3FCVA 5E3PA 3MEEB 3BB5A 4DR6F 5EUHA 3UWTA 1RKJA 2JWNA 1GTHA 1R89A 2L9WA 3KXDA 4PXBA 4JI6F 2K1RA 2K3IA 1F3FA 3LAKA 3H5YA 2HLUA 3MR5A 2FY1A 3KJNB 1X60A 2VPWB 1JLGB 1TL5A 4CO3A 2HYIB 3V81A 5KFVA 3MEDA 2WK4A 2QMWA 3GG1A 2P9CA 1XK8A 2RT3A 4NLGA 3QLHB 1RHRB 3AOBA 2K3KA 2OD6A 3HHLD 4DV1J 2Q66A 3HJFA 3BJYA 3VGTA 1P9YA 1Q86T 3BF4A 1OSDA 4YMEA 2B3TB 1RAAB 4M5KA 3G6ES 1XMBA 4X65F 3J80Y 2VG6A 3NGUA 2PE8A 2ZJPQ 2A6OA 5KG1A 1FA0A 3IG1A 2QZ8A 1VLOA 5F8MA 3W7BA 1GMVA 3D7SB 3LP1A 1YG0A 3Q86A 1FX4A 4WWSA 4BC9A 1FNXH 2HVHA 4OI6A 3A1YG 1P27B 3TAQA 2F1FA 1ZZFA 2FIUA 2VBWA 3CJ2A 1N36J 3NY0A 1FKAF 2AW0A 3H59A 3DDNA 2FDNA 3PEJA 1QUVA 1RT3A 2JOQA 2W8KA 2HNDB 2H54B 1DTTA 3HZGA 3R9LA 4DV3F 1IBMF 2LA6A 1NK6A 2F8HA 1JXLA 2M9KA 2HW3A 2NR0A 3HD2A 3PJXA 2Z2MA 3PTWA 5HMWA 2DIVA 1J5EF 2Q43A 2PGCA 4L72B 4KYZA 3SDEA 2EBEA 2V0NA 4ZVTB 2IM0A 1U0HA 5SUHA 3IFEA 5KG5A 4DV6F 2KT3A 3NXZA 5KFHA 2BOPA 3L9ZA 4F4KA 3B82A 1RA6A 1SV5B 3B8HA 2JNJA 1YJRA 5E2QA 3MR2A 4F4WA 4FKYA 2RQCA 5L9XA 1YJWS 1TAUA 3FJ2A 2F65A 4M5JA 2KXNB 1VQYA 1GEHA 2HNZB 2PEHA 3CDAA 3MM7B 4TLRA 4NLWA 1KTQA 1HWLA 4R8UA 3ZNJ1 1CJVB 4JV1A 1VRUB 3QYYA 1GMUA 4G1IA 1FNMA 2XMUA 4YOEA 1CJUB 3BDPA 2HFNA 3PRVA 3T6BA 3OV7A 4DL2A 2XSJA 1Q8LA 3IR7B 3M1VB 2BRLA 2UU9F 3GG0A 1WF0A 3L3CA 3C46A 2J0SD 5EWEA 3FRYA 2MY8A 3CB4A 1LWEB 4KO0A 3MOJB 2RDDA 2MJUA 1S77D 4K0KF 2ZDPA 2PSZA 3AJ1A 4DQIA 2VPXB 2H48B 5HJXA 1RBOB 3HT0A 3TR5A 2E1MC 5H9FJ 4X62J 1N6QA 4M5NA 3DMJA 1RAIB 2K7JA 2V2QA 2R2UA 4DS4A 2I1RA 1K1QA 1Y10A 4P2XA 1S9EA 2C28A 2ZBQA 2VKZG 5EX0A 1V3RA 5KFEA 2NLWA 2M88A 4FXVA 2ZWOA 2YY3A 3D0GE 5IFMA 2JC1A 3T6JA 3ENQA 1FDAA 1KKHA 1I51B 4J9VA 3R7NB 3CUNA 5J2QB 3UD3P 3RAQA 4LF6F 3QBCA 2F5GA 3IG1B 2F9DA 2DR7A 2JFDA 3X3UA 1VGYA 2IA0A 1IKYA 2CQDA 4QOTA 4V1Ak 4N47A 2XCPA 3SV4A 3NNHA 2M2BA 1DJ0A 2IFXA 1VQ5S 2XS5A 1A9NB 2CZVC 4PWUA 4RKUC 3FEYB 1XR6A 1A0OB 4RWXA 3M2VA 3BDEA 2JEFA 1HWUA 5F9LA 3KYLA 1U6BA 3H2LA 1RDRA 4RLEA 3SQOP 3AH6A 2R7XA 4KGXB 2RQMA 3SCKE 2NPIA 2WHOA 3ZO7A 1X31C 1CQMA 3DOLA 3FK4A 2HHVA 2C3PA 4DSJA 4KHRA 4O0IA 2QMUB 2VUGA 4JI5J 2P2CB 3GIIA 4QYZK 3NS7B 1UVMA 3NOCA 3AB2B 3IBWA 1U1QA 3DNCA 1SC6A 3ETMA 4U7UK 4CYUA 5IT9U 1OS5A 1S0VA 3CD7A 3Q8RB 3W65A 3WC0A 4X4SA 3I87A 3OXGA 4LR9A 4K4YA 2PI5A 2I38A 3BGFA 4RW9B 1NLKL 1EKRA 3R1LA 2RRAA 3MXHP 2AHOB 3BGRB 3BGLA 3TOQA 1HQEA 2RHSB 3QFHA 4QIFA 3W9HA 2DGQA 4CTAB 5KFDA 2G2ZA 4DR5J 2B43A 3TVKA 3CJ0A 1XIQA 5KFJA 2R2RA 1TMMA 4F3MA 4NLOA 1WF1A 1XN9A 4DV0J 1I94F 4WE1B 1M5HA 2HFOA 2IC3A 4R25A 2LEAA 2MQNA 2AYEA 5DZ7A 3NCRA 4IDKA 5KFQA 2IRYA 4ZKAA 4ECUA 4EGLA 2WB1D 2ZJQQ 1ZOTA 1OPZA 2VG7A 3B54A 2XZTB 1U8SA 2L9DA 2IPOB 4H54A 3M32A 1RZMA 4QW8A 3HMJG 3AOCA 3M8PB 2XS7A 4GKJF 3N5FA 3L09A 1UPMB 3U1LA 3KFWX 5CD4H 1C4AA 3RBDA 2BEFA 2DRBA 2FZCB 4DSLA 4DR1F 1S6PA 4NI2A 1ZA1B 4B9MA 3IN5A 3HDSA 2BE9B 1HMVA 2E7XA 1H2TZ 2OPSB 2PO4A 3AJDA 4LBHA 4Y2MA 4Y2CA 5LXRA 1N48A 1FXLA 1SUQB 2ZOGA 4ID5A 2KKHA 5CYMA 2QL9B 2VC1A 4CLTA 1E6VB 4W92B 2E5IA 1UZDA 3F44A 3LGMA 4NRUA 4LIRA 5AXKA 4B3MJ 2CJQA 2IJNA 3KNGA 4ED4A 1HBNB 4C48A 1HNIB 1VS3A 2BQUA 1W2BR 2FVPA 1MROA 1X4GA 4KGKA 2XQCA 2IAJA 4A8OA 1NJWA 5HATA 4E8UA 1HQ2A 3G71S 1AXQA 3DLEB 4YB5A 2OPPA 3LH2S 4FYDA 2J9DE 3M9OB 3A3OB 1LV5A 1UVKA 2IDLA 2HFUA 1SJQA 3DN9A 5D4LA 2AIRB 1RT6B 1WTFA 2Z58B 2DYAA 4CM0A 4B3TJ 1Q95G 1UMJA 3QSIA 3UE2A 3DRPB 5A8RA 2DGSA 2LQ9A 5DQGA 1ZAXA 1BD6A 1R0CB 2DGUA 1XQIA 2DXEA 3IGVA 1VQSA 3HSZA 4QIVA 4CNZA 4XO0A 2ZM6F 4X4NA 3JAMU 1F2HA 4X64F 3BH6B 3CWJA 2CADA 2LEPA 4FPIA 2JDJA 4FYVB 1WI8A 4X2BA 3PRDA 5KFFA 2E1RA 2HQFA 4JI3F 4F36A 4NZ0A 4PABA 3DOLB 3K17A 3S01A 2RS2A 1PAUB 4AL5A 2B9XA 2NXCA 3TZWA 3MPUB 3Q8PB 2E29A 2M7SA 3B78A 4KKOB 5C24A 2VHGA 1DZ5A 1JLEA 3DRPA 5DDPC 1UFKA 1Q5YA 3VVTA 3TQ1A 1FJEB 4YUDA 4F4XA 2CQCA 4DL6A 1BQNB 3DRYA 3HFZB 5ETRA 4LRBA 1OY9A 1T94A 1F9HA 1PBAA 2AQ4A 1J27A 1D9AA 2Z56B 1SB6A 4ZCMA 2ZH7A 1RLDA 1RSCA 2HZAA 2CPZA 3RAXA 4IRKA 1QAJA 4RBUA 4ZVHA 4OJ3A 2DR5A 2EWHA 3SMZA 2YPYA 2MJNA 2QA4G 3MFIA 3ET6A 1RTDA 2PI4A 3OTCA 1Q8IA 4QPTA 4KIAA 4DXLA 1KEKA 4KJIA 2RNEA 1QY7A 2U1AA 5KG0A 2FPHX 3CGIA 2CWXA 4O3QA 1RUSA 4HLBA 4YY3F 4A47A 1BQNA 2VA2A 4LF2A 3GWCA 3MEGA 2AU0A 5B7WA 3EYZA 2Z8QA 1VIOA 2LU2A 4KE5A 2XY7A 3NMAA 1SJ1A 2RQ4A 3H4DA 3LF0A 4WJBA 3F41A 4WZQA 2OEKA 3AA8A 3R7SB 4ZVGA 3TQEA 2OJ3A 4UQTA 1IUJA 4YDDB 3H0PA 1QAYA 1S99A 4MYUA 2DBBA 3SFGA 4FYYB 3M2UA 2DHSA 4NLQA 2F4VJ 4B9SA 2OPRB 3LGHA 2O5DA 3E3XA 1EETB 2FC8A 3NKYA 1VC5A 2MQ8A 2CRLA 1OMSA 3PYFA 3TA1A 4DCPB 2DRDA 2F8MA 2JJ4D 1HYSB 4DR7J 2WSEC 4OI3A 2CQ2A 3NNAA 4USTA 2EFVA 2DNPA 3IM8A 1OWXA 3PYDA 2UUTA 5CHCB 4DV1F 1X4BA 3PYEA 2D9PA 2E1PA 1Q8BA 4O23A 1MWQA 4W4MA 2JFKA 2MZQA 2ZOMA 1M90T 1TFYA 3F73A 2Y1RI 4Q8EA 4IG3A 2NZCA 4ID8A 3W63A 3IA0A 1CULB 1YBTA 5IOLA 3UDEA 4LIWA 2Y8YA 2E1CA 3ZZYA 1D1UA 4KHPJ 2MLYA 2ZFHA 5HAOA 3ZZ0A 3CC7S 1PJ6A 2CG4A 2MZJA 3P5TL 1REVB 1SC3B 1NDKA 2CDQA 2YKMB 4JV5J 2IYIA 2HHXA 1PAEX 1S6UA 1DLOA 3N9UC 4DR6J 1GAOA 4OFZA 4XTTA 3PO5A 1TKZA 5DGBA 1H7WA 3R97A 1WHVA 1M1KT 5JMNA 1QSYA 5L46A 4CLKA 4F50A 1BY9A 2ROEA 2ZEJA 3D54A 3I31A 4ANCA 4E2FB 2QGFB 3E01A 5KFNA 4OYZA 1DQAA 2RVJA 3M6UA 5KFCA 3DLLQ 2XMJA 4N5SA 3KJVA 4O44A 1UVJA 3RAMA 1YZ7A 2ZD1A 4DL7A 1GQEA 1Q8KA 3M6XA 1XR7A 3WC2A 1N5YA 2IMOA 3NCPA 2CPYA 2GMLA 3TVYA 5KFUA 4LR7A 2MLZA 4J9KA 1Y11A 2LXIA 2OFGX 2ZBCA 2UXCJ 3TRGA 2BJ8A 5G0RB 3MAHA 4USKA 3B4MA 3JAMY 2YNFA 5IV3A 3HZEA 1TKZB 4YN3B 3U1NA 4DL5A 4I64A 1RE1B 2JH3A 3KG0A 1TK5A 2IA6A 2XMVA 3RB0A 1HW9A 2RKIA 4UF4A 1LK5A 2FHMA 3TW0A 1SJ4P 2HG4A 1FRIA 1NHUA 5D0GA 4A8YA 2HGNA 2F4FA 4Y6IA 1CS4B 1Y3JA 3L95X 4I68A 3ZZPA 4ECRA 2ADCA 4DL3A 3RW6A 3C15A 3SCIE 4Y00A 2E5GA 2WB4A 3GYGA 1NSAA 1HI1A 3ZTPA 4TQRA 2GZOA 2J76E 1S49A 3UD5A 2DTJA 1CS4A 4GVBA 1IBKJ 4KV8A 4RR5A 3M2UB 4DQRA 5G4DA 1C0TA 4Z2XA 3Q23A 5T7LB 4DUZF 3IXQA 2YH0A 3DLGB 1TUGB 3T1AA 1YLXA 3MR6A 2H3EB 3V6DB 2IRXA 2K06A 4MKYA 4HTIA 4WXWA 1XJWB 2WAQD 3G86A 1JIHA 1CJTA 5HK4A 3VAMA 1QVFR 4K0KJ 2JVRA 5DZ6A 4ZVSB 3HK2A 1OY8A 2BKNA 2NUHA 3U7JA 1HBOB 3BKUA 3OQ2A 2HHQA 5CQGA 2OI2A 4P7VA 3SSSA 4V19J 3IO1A 2KO1A 1IN0A 1FD8A 2HWIA 2W2NP 4RX6A 3SQGB 2DNOA 5DG7A 2A6MA 3IRXB 4DV5F 3J7YU 1FFSB 2HURA 2J6TA 1JKHA 4WKRA 1KN6A 3I82A 2VFRA 2F3JA 5JXSA 3I55S 3FSIA 1U1NA 4CDIA 1K44A 3MFHA 3EMTA 1VC0A 3OUYA 5DM7Q 2FJXA 1TR0A 2DNRA 2L3MA 1RT3B 1JLCB 3CJTA 5E33A 2HQDA 2HEKA 2ZE2B 4MH8A 1NM2A 3US5A 4EEYA 1UJ4A 4B3RF 3HHLB 2DHHA 3NAHA 3N6MA 4HT5A 5ETKA 2WSCC 1YJ9S 1Q5VA 2LYVA 4FVMA 4HDGA 4IUFA 1FJGF 3KUGA 2OKQA 2IYGA 3CF5Q 2D41A 1OQ3A 3LP0B 5B0BA 1RWPB 5HBMB 2JZ5A 5IT0A 1KLNA 4GKKF 3R7BB 1SCJB 2XS2A 2J7KA 3I0SA 3QJPA 3HHEA 1T02A 3GQCA 3H25A 5FDLB 4JI0J 4PRFA 4ZLJA 2F63A 1C0UA 1U09A 4CLZA 1Q82T 5J1EB 3MECA 3BN7A 4AE5A 3NL0A 2E5JA 4JI8J 2B0GA 2A3JA 2XLIA 1RQ0A 4IFYA 2LQJA 3QIDA 2J8SA 1O0PA 2EFNA 3JXOA 4NX9A 2HQ3A 2B6AA 2ZNYA 3UDVA 5LJ5Y 4DQSA 3T1YJ 1Y0HA 4MT1A 1U45A 2BDPA 2CAJA 4ZITA 3DFEA 2AX0A 5IZHA 3K59A 5HL7Q 4ZHRB 4HYKA 4IOCQ 5F8NA 3AQOA 2N3OA 2DPIA 1HNXJ 1EAYC 1IJFB 1R8HA 1X4DA 1FKOA 1VLYA 2YX1A 3IBFB 3MAAB 5D4PA 2W2PP 2IJFA 5BXIA 2XEXA 1KC8T 3AOAA 1L3KA 3CULA 1VQKS 5HVFA 3SZ2A 4LREA 2N7CA 4DU7A 1I5OB 1TVRB 2RSQA 1PSDA 2Y0SD 3CDBA 4IFYB 1NSPA 3MOZA 2ASDA 5D8HB 1NDLA 4QYZJ 4A4JA 4F25A 3I5AA 1K8AT 2HRUA 1RWKB 2CPEA 4TXSA 3G6VA 3GP9A 1YBAA 3TNVA 4LF4J 4ILRA 4DN9A 3HULA 5MLCV 5LT5A 2BJ9A 3MEGB 3AJ2A 4DSFA 2PFDA 3W2WA 1KS2A 1B3TA 4PWDA 2ZC3A 1HIYA 1FRLA 4YB6A 1IQTA 4DZ6A 3D2WA 2DR8A 4ZA1A 2X1GA 2CVEA 3BEGB 3OVSA 4JI6J 1LW0B 1R8BA 4Y3CA 3MD3A 4OYIA 4QR1A 3GV7B 1RA7A 2ILYA 1TL1A 4HI1A 4BBYA 5F8LA 3VAJA 2FVRA 4I4BA 3D28A 3PIPQ 4L3KA 1HNIA 1F5AA 2C42A 3A3NB 3UN3A 4A8WA 3C2PA 3MPDA 4UOCA 5B0EA 5AJ3J 2MSSA 3V4IB 2RQKA 3MTKA 4C8OA 3FZ2A 3W1YC 1G3OA 3N6NA 2YX7A 2VBYA 1C4CA 1N6QB 1WOSA 3R8YA 4JI5F 4ZJQA 2VBXA 1KFDA 4WFYA 4L75A 3GLJA 1SL2A 1DFDA 3EGVA 1DTQB 3C8YA 5ETQA 4NXNF 2GC8A 3NGSA 4QWCA 2ASLA 5B0GA 5F8HA 4QWAA 1EB0A 2ATLA 4X64J 3G8TA 3GJRB 2DNGA 4U9RA 3K5MA 2B56A 3AT1B 2RH3A 1TQLA 3POTB 4NRTA 4WP9A 4ZJOA 5DETA 4OZJA 1JNRB 5L38A 1T9VA 2GHWA 5I3UB 3VALA 4Q43A 2UUBJ 1HFEL 2KI2A 4M63A 2CIMA 3PX6A 2BJ1A 4ZCIA 5A8KA 3CD5A 2CUYA 2ADBA 1NKBA 3RR8A 2BKOA 2EC0A 3AY0A 4O3SA 2ZZMA 2PD1A 2YBVA 3MEEA 1HI8A 2AD9A 3GMGA 2YQ1A 4OHWA 3DGPB 3PZPA 1VYAA 1X4FA 3KG1A 1NB7A 4IG3B 1KRPA 3GR1A 4AUKA 4ETZA 4XK8C 1NZ8A 2WOMA 4KC5A 3UCGA 4OV6A 3KLFA 2IIHA 1UEUA 4MK8A 2B8QA 1KHWA 1NH7A 1WWHA 2MKIA 1RHKB 4WP8A 2Z2LA 2VQEF 2M0GB 4HKQA 1HNVB 4OYMA 1FE4A 3PNIA 2N7YA 3QT6A 3KMQA 2MLXA 1FKOB 1F1BB 2XI2A 3LOUA 2AWZA 4GVBB 4NLTA 4Y2KA 5A0YB 2KXFA 3LWLA 2G2YA 2VQEJ 3CC2S 1FT8A 2C3UA 3BBFA 4NMXA 3ENVA 4UZCA 2XGPA 4I6WA 4LF7J 1BE4A 3C15B 4N7TA 2FLLA 3MPVA 3IWXA 1RT6A 3MGJA 4EMDA 4KSEB 4K4WA 3N5BA 3OLBA 1ZM9A 3MMAA 4DUYF 1SKWA 2OEMA 4CLPA 1IWAA 2OPPB 4TU8A 4U6PA 3H8YA 2RU9A 2H4YB 3FGVA 2UUWA 3QJJA 1SI9A 1UWAA 4DHVA 1TV6B 2WBRA 1MMLA 3TJ8A 2FJEB 3W62A 4JI4F 2YNFB 3TP2A 4DV0F 1BC6A 1YKWA 7AT1B 1HHQA 4ZK7M 2GVZA 1VBXA 3K5OA 4K4TA 2C2DA 3P4UB 4DPYA 2RILA 2HVIA 2HQIA 2DJWA 4NE9C 3OL8A 1S9FA 1VQ6S 2L41A 3M05A 2I2YA 2D69A 3HHLA 1WSRA 3RR7A 1HNXF 2DXDA 2Q1LA 1PBUA 2HQGA 1LWCA 2ZBPA 3HI9A 4K59A 3ZZTA 2JHEA 4N8OA 1YWXA 4P2MA 4NI2B 3OR2A 4N77A 3FC9A 5RUBA 4PQUB 1ELOA 4ZVOB 1HA1A 3DKDA 4ES2A 3GV5B 3PFEA 4LSNB 3CCTA 3VAGA 4EBEA 2WVCA 1U47A 4IRCA 1VRTA 1M1GA 1S1UB 4FXWA 2QIFA 4IH7A 3GPAA 3HFVA 2XM3A 2CQPA 2DGOA 2HS4A 2VB6A 3TEGA 1JLFA 2W7OA 1X9WA 1FE0A 1B7FA 2VFVA 1RWWB 3CJKB 1C1CB 1UL3A 5E41A 2XBPA 2HAFA 2JEJA 3D0HE 3MEDB 5ITHA 5J2MB 1EHWA 4LF5J 5IXUA 4J7CA 4OJGA 2UVWA 3KUEA 4P2SA 2Y0BB 1CJTB 3LA0A 4FS1A 3JQMA 2D3ZA 1U7LA 1CULA 2MQMA 3EE3A 3I0RB 4J9MA 2J0QD 3OD2A 1GXUA 4B02A 4RZRA 3KK2B 4ECTA 1T03B 1IBLF 4DV4J 4IQXA 2R7UA 4CZCA 4DLEA 1JX4A 1HARA 1HD0A 1Q16B 1LWFB 3IWLA 2HGLA 4PG7A 4D3HA 4OHZA 2E5LF 1PCAA 3LALA 3M30A 3OR1B 1RWVB 1N33F 1IR0A 4F7VA 2KZMA 3FEXB 1FHTA 3F0NA 4UZBA 4CLFA 2X7IA 1UEKA 1HBNA 1P1LA 3FDSA 2BBEA 4AXJA 3PR4A 2YNIB 4DF8A 2G9OA 3QSYB 1K9MT 2E9ZA 3LO3A 2RDJA 1ZS6A 4ZLLA 2CNLB 1FEEA 3KKFA 5HN0A 1L5UA 5KFPA 1BUXA 1M5OC 2CZ9A 1CC8A 1FRHA 3KLGA 4WZMA 4YFUA 4IH6A 3MCNA 5D15A 5J2QA 5LMUF 1DTTB 4HI2A 5IQ6A 2HNDA 4Y2IA 1JJ2R 2DGVA 2YWKA 1PC5A 3N79A 4DG1B 1FEHA 5IM0A 4K4UA 2NS1B 4X4QA 3C6UA 1S6PB 4QIWD 2PMHA 5DS7A 4UOFA 2UU9J 4MK9A 3HVAA 4GO7X 1N5SA 4ICLB 4ED6A 1QAXA 1WEYA 1YK9A 1C1BB 2DIUA 1S4EA 3LW5C 2BW7A 3FCWA 4CRJA 1SJ3P 3KWMA 1ZPVA 4MKAA 2IM1A 3CJ5A 3KLIA 4DCOB 4DLGA 1HNWJ 1X9SA 2OPQB 1BQMA 1BHNA 1YJTA 5GMDA 1N32F 4DU8A 2I8EA 1OPIA 3PKYA 2AYBA 3BSNA 1EQMA 4N8NA 1N8RT 1X5PA 4TQSA 3DOKA 2FUG9 4DWIA 4ILLA 2GGPA 2MDAA 4NCGA 1P9QC 1ICEB 1DLOB 3FBBA 4C8LA 1FDDA 2GFFA 4ZIVA 2YQ0A 4G3IA 4I6AA 3BN4A 5T7LA 2A10A 2W2QP 2ZWPA 1RAGB 4M8LA 2HAIA 4OYPA 1S79A 2LU1A 1RWMB 2D1CA 4ZS6A 4ED7A 3RYLA 3DXSX 4HACA 1FRMA 1Y00A 1DQ8A 2KU7A 4LSZB 1JLGA 4TY9A 5KG4A 3BSOA 1TTHB 3WBZA 1SH0A 2LKZA 3O1LA 4PZVA 4PQAA 4UY85 5A8RB 5KG2A 4PWWA 1FKPB 3PFOA 2BX6A 3A8KA 1SC1B 1S1WB 3MMCB 2FTRA 3W5YA 2CFXA 5C42A 5EWFA 1NPKA 1WC3A 1FXDA 1NUEA 3T9ZA 3HHKA 1L3TA 3TA0A 1QJHA 2KJVA 2L48A 1FWLA 3MEKA 1Q79A 2IMWP 1P6TA 1RBAA 2W2MP 4CYUB 1QUPA 1EETA 2HLTA 2J9CA 1WACA 4ZP7A 5EX3A 5C25B 3IRWP 3CCES 1NXIA 1DBDA 1UCNA 5GADI 3T9NA 4OZ3A 2LQ8A 3ZTSA 3HSDA 2ZOFA 3TZXA 1N34F 1MN9A 3JSRA 3Q8UA 3CD6S 1N5VA 1UZHA 3LGNA 4X65J 3BSCA 4L6V3 1O8BA 1QLNA 2GO9A 4LFBJ 4CLUA 3AAWB 4JI2J 4AL6A 1PKUA 4F4AA 4M5HA 5F9NA 1X9MA 1H72C 3ZTQA 2V8HA 1KLMB 1F6TA 4FBUA 4FF1A 4KGZB 3QQCD 2BACA 1J2VA 3FSXA 5A6WA 5DM6Q 2ZHAA 4F2RA 1C0UB 2BJ3A 4DX7A 3IMQJ 3KG4A 1XNRJ 3VVUA 1U1OA 2EFPA 4JI7J 4JI7F 2UUBF 4RW6B 1VK3A 2D3UA 2HBZB 4QIEA 4QR0A 4ZVRB 2R7VA 1W7WA 4ZPDA 1SJRA 4KAIA 1NSQA 2B51A 1SKUB 5BYSA 1R31A 4LQ3A 4FN5A 2PMWA 2CVIA 3OVAA 2NPFA 4GC6A 1XBWA 2NZ4A 1RT1A 4OYWA 3G4SS 3ENWA 3NS5A 1JQGA 2GMJA 2Z57B 3DOMA 4M95A 3HP6A 4LF9F 2WVBA 2Z30B 3Q83A 3R6LB 2PFFB 4USWA 2QFIA 2C2ZB 3MMBB 4PG6A 1NJYA 1QTMA 1CQNA 5KT3A 4EYHB 4ZOSA 3FUYA 3H7HB 5E3AA 1FO1A 1U6FA 3CDUA 4RW4B 5AJ3F 5IT9Y 4CQ1A 1CJUA 5DQIA 2CJ9A 4U67Q 1FDNA 4YEAA 4B17A 3EZOA 1IBCB 5KFKA 1RGVA 2IM3A 2VONA 3NBPB 4IO9Q 2U2FA 4ER8A 2UUCJ 1JXEA 1Q53A 4WE1A 2QE5A 2N4DA 4DN0A 3O44A 3OSPA 4AFFA 1WG4A 4M5DB 2JLEA 2BM1A 2OPRA 1RT7B 1T03A 2HWTA 5M2UA 3Q22A 3BYPA 2FHJA 3PRBA 3CJSA 1JLQA 2P9GA 1SV5A 1ZM2A 3DU6A 4XDCA 2W7PA 1NJIT 4C8NA 4FYXB 3UCUP 3O8WA 1HBUB 3BR9A 2ZJRQ 4RW9A 1AFIA 3FBCA 3ENAA 2HNZA 3MM7A 3VZHA 2KH9A 2R8GA 3PY8A 9ATCB 1F2GA 5H9EK 4F3OA 4RNFA 3LWMA 1K47A 3M2VB 1IKXA 2V8VA 4AT1B 3THTA 3P8BB 5DLGA 2X1AA 1R43A 1S12A 1WDDA 5DG8A 3OR2B 2LCWA 5U47A 5KAKA 1J5OA 3QPIA 1KOHA 4DR3J 3P6YC 3E51A 2WZ1A 4YQWA 1RU1A 3CNQP 4ED2A 4IG0B 2IBKA 3PW4A 2OTLS 4OHVA 2IAJB 1JLBA 1EQ0A 4AL7A 3H4BA 2IVFB 1RT2B 1YQHA 1VISA 1MWYA 5M2RA 1NK8A 4DSKA 2GNKA 5KFAA 4HHJA 2CKWA 4F26A 1VQ9S 4E0DA 1AZSB 1R7IA 4L73A 2XLJA 2QTWA 1NRKA 2C2NA 2HFSA 2POKA 1YJ7A 1H0HB 2C2MB 3CTRA 4LRAA 4Q45A 4XIUA 3GIJA 3VAKA 4IKAA 2GMHA 4A8QA 8ATCB 1XERA 1YSJA 1S5ZA 3TAPA 3CO9A 5D78A 2FHKA 4NLXA 4KT0C 3UVJB 2XY6A 1K0TA 1C1BA 3D1QA 3FBEA 3TI0A 1EIYB 3UN2A 3PO4A 1VQ7S 3G2XA 1WKKA 1FNOA 1Y7PA 2RUGA 2VDIA 4CT9A 5CA5A 4YB1P 2F8EX 4CO2A 2RE1A 2C22A 2V8PA 3C6UB 3FSYA 1U1MA 4WK3A 2M70A 2ZNZA 3MR7A 2DRAA 4UTGA 4FXDA 4FNIA 5I4MA 4IDKB 3THVA 4U7UD 3EGWB 2YX4A 3G8QA 3UR3C 1IM4A 5D6GA 3NGRA 3M2RA 1F0XA 5AT1B 5CYQA 1D9FA 2E66A 1N32J 3MD1A 2OSQA 3PYGA 3AFGA 2W4DA 5L1LA 1B64A 1BMQB 3JB9k 2YVSA 3MCOA 1HI0P 5H9EJ 4IOAQ 5I3QA 1S1WA 3MMCA 3PG9A 3CXCR 2UXCF 2WONB 4OYBA 3ZNUA 3HVTB 4O3RA 4RNMA 1TL3B 3QRQA 3UCZP 4DX5A 2J0XA 2BRKA 3ISZA 3TWZA 2RAQA 1R0AA 2I5JA 5LMUJ 2AJ0A 1FK9B 4HHUA 4Y34A 3D5MA 2IJRA 3OVBA 2MZSA 5DLFA 1VRQC 4QYRA 3HVRA 3FKBA 5I3UA 2MKKA 5K8OA 3SXLA 4UQGA 5J2NA 2A0FB 1IQZA 1GK8A 3W8PA 4RO0A 4M94A 1NH8A 2BZ2A 4PYDA 4DI6A 5E3QA 5GMEA 4OZNA 4H4MB 2V4JB 2VODA 2V94A 2GQ2A 3QMQA 3PM9A 4MKVA 2ASYA 3FFIA 3KLIB 2JL9A 4DV3J 2QN6B 2I9SA 2V9WA 1IVZA 1DHMA 3MAQA 3FCHA 2YKNA 4YHHF 4LUBA 1WTBA 2QG9B 3FEZA 3GIRA 1ZH5A 4X4TA 3AXKA 1S76D 2VV5A 3MMBA 5DJBA 1CJKA 3MUVP 4LRFA 4USMA 4PQUA 2QRRA 4B3OB 1PO6A 4ZP6A 3JQKA 1P1TA 4FVCA 4FKXA 5IM0B 3CW2C 4U96A 3JSMA 3CCRS 4LF5F 2B9WA 4EO8A 1U25A 2KT5A 2YNGB 5DO2A 1TL1B 2BQ3A 4OI0A 2VKRA 2JLFA 1NDPA 4Y65A 1Y9OA 4YR3A 1HNZF 2FJAB 2UUCF 1S7IA 2XTJP 2QYGA 3Q0AA 4O3PA 4KFBA 2DH9A 2QSFA 2BOAA 2J5AA 3HHLC 3OL7A 4WBFA 5B09A 1SKRA 3MF5A 3LTOA 1YTYA 4M5MA 1QDUB 2JRSA 2HBYB 4J9LA 3P45B 2OPSA 2C2KB 4QJVA 2XNRA 1JXVA 2EI5A 2V34A 2AJFE 4MFBB 5LJ3Y 1VQMS 3OT9A 2HHHJ 4JI1F 1EX8A 3BS9A 2WW8A 2ZH9A 2L9NA 2XYPB 3BKTA 4LF9J 2RHQB 1X7VA 3GIMA 1QE1A 2WVDA 3AQPA 3MMAB 2ZM6J 4F04B 1FJCA 3D6FB 1U2RA 2YWFA 5E7OB 1L3SA 1T9XA 1S1TA 1XTZA 1JLQB 3A13A 3MM8B 4P71A 5HSPA 4YY3J 1YRUA 3H20A 2VF3A 3MAAA 3S8SA 5GAHU 3J7YI 2B9EA 4DFMA 4UOHA 1KQKA 3A3PB 3NWRA 4LMZA 1C2PA 1URNA 2HRYA 4M5DA 1APSA 4LQ9A 2DKOB 4WTOB 2DCLA 2XMMA 2ZKUA 2BJ7A 2IM2A 4ZHRA 1VQ4S 2R8HA 3IGNA 1X4HA 3D9BA 3BGUA 1EZZB 3I56S 4PEOA 5LMNF 5ETPA 3K5NA 4PR6A 4CIOA 2YKOA 4ED3A 2Q3PA 1OSCA 1YRXA 5HLFA 2D7SA 4HH0A 4X62F 2G2OA 1OJ4A 5GAEI 5AXNA 2AMCB 2RUSA 3N4WA 4QWEA 1XWLA 2JX2A 3R5GA 3KK1A 3M8SA 4J9PA 4DF4A 4RBVA 3MZIA 2BA9A 2G0IA 3UI3A 4C3MA 4C98A 5J1PA 1R6YA 3R6GB 3NGKA 5K5MA 5KT6A 4CLLA 3NS6A 2CQIA 1YDLA 3BPDA 2DNHA 4K8RA 4P9SA 3WHIA 3ILOA 3M8YA 4I7FB 3ZXWA 5IT4A 4W90B 3G8SA 2MY7A 4WU3A 1L3VA 2B5JA 3QO9B 1K73T 1Y5NB 2A2CA 4NCGB 4NLPA 1TELA 4F02A 2HFVA 2FHJD 4O3OA 3T19A 4K7QA 5A8WB 4IR1A 4ZPTR 2FJDB 1Y3KA 4EK2A 1AT1B 3N6LA 3J7A1 3IS9B 4ZVEA 4DPWA 2QA4S 1NHVA 2E5HA 1J5OB 2BXJA 4B9LA 3D68A 3FQKA 3PJWA 1MW7A 3WX8A 2ALZA 1TUWA 3CCWA 4ZCKA 2M8DB 1TL7A 1U6ZA 1UFLA 2QV6A 3FVYA 3DDKA 4DV6J 4QU7A 3OXLA 4DV4F 3V4IA 1NDCA 4E98A 3CCUS 5CD4A 4UOGA 1IKXB 1RAHB 1IXKA 1RXOB 2PDAA 3AD7C 4TLQA 4ES1A 2RU3A 3NEKA 3S7RA 4LF8F 5HQLA 5CZXA 4C0BA 4R8UB 8RUCA 3W60A 3EWGA 1B70B 5ETLA 2V5HG 3BQ1A 1NPRA 5HVGA 4NLDA 4MIBA 4TYAA 3W9JA 2YWHA 2V2ZA 1G2EA 2XMKA 4FF2A 2C3MA 2VQFF 1WNEA 4OJ1A 2CPJA 2G0CA 3KK1B 2G1HA 2N4CA 3MM5B 4I6YA 4EO6A 4NZ6A 2KJWA 3KLFB 1VQLS 5F8JA 2O3DA 3D3CJ 1REGX 3SCJE 2HWHA 3ICLA 5FD1A 2I5JB 1JJ4A 3EM1A 4C0HA 3JSBA 5KFWA 7FD1A 4DPUA 2EKYA 3DLJA 3HT3A 1T3OA 1AW0A 5T14A 4OX8A 1RT5B 4FF4A 1JMTA 2ZKTA 3M8ZA 3GJSB 1Q0NA 1SIZA 2KVQE 3G9CA 1DAXA 1IKVA 4V19X 3H42A 3TUJC 3MM8A 1QD1A 3QIPA 4PAAA 3CCQS 3UD4P 1NNDA 3DOKB 1B4SA 1MU2A 2VG5A 4ZPAA 4NXMF 4LF6J 1K0VA 2EFOA 1Q7LB 1FRJA 2MKJA 3DRSA 3RGIA 3T41A 1RHQB 1N33J 2OH2A 2OLWA 3D1HA 1S1XB 4Q0BB 2EVZA 2HZVA 4U7CA 1B0PA 3DU5A 1CJKB 4CH1A 1ZTTA 3UFCX 3HF5A 2LXFA 1MWZA 2XYGB 1WC6A 4HH1A 2UVRA 2AX1A 5IQQA 1OQ6A 1ZBTA 5FDLA 3KOAA 1F5BA 1HR0J 3QRPA 1UAWA 1RT2A 4Q0BA 4H4KA 2HHHF 2ZUAA 2YWWA 3AA9A 4RW8A 2ZH3A 1CSJA 2GJ2A 3SCLE 1R27B 4URGA 4NA3A 3T1YF 1GT8A 3G6YA 2XI3A 4Z7CA 2C2RA 2ZC4A 3JYTB 1TP7A 3T5JA 2W2OP 1AFJA 1U4BA 3J7AN 2K1RB 1M1HA 1HWKA 4P74A 1U1KA 2V8DA 4YS2A 1YITS 1CPZA 1V3ZA 3FMWA 1NSKL 3U02A 1DRZA 4C4WA 5HMYA 2CPDA 5D3GB 2DY9A 1VC6A 4P7TA 4DSIA 1DURA 2MGZB 3O6QA 2CQHA 2B8PA 2YNHA 3IR5B 3GV8B 4DCJB 1RBLA 2HS3A 2I6WA 1HL6A 3A4TA 1S6QB 3VZIA 5HLFB 1PYTA 5DDRC 2CNKB 4WCEQ 2J0WA 1RHUB 4ETXA 3THPA 3RRHA 2SXLA 2ZVSA 2KFYA 1I94J 1G6BA 2W24A 1WC4A 4ZMMA 2B4OA 1LFWA 4DR4J 2GCFA 1U1PA 2H51B 1FVSA 3V4MA 4DZDA 1D0EA 3D66A 3GCXP 2LLZA 1C1CA 3NBPA 2UXBF 3O5TB 1LW2A 1PC4A 4NYOA 3DYAB 1KBRA 4C11B 4DV5J 3ISNC 4NLVA 3GSDA 4YDXA 4CH0S 1RT7A 4IOBA 4RW4A 4QWDA 4DUYJ 5FJ4A 3DC2A 4OLPA 2AT1B 3TJAA 2R4FA 5CH7B 2P6SA 3TZZA 4LF4F 2XO7A 2FJVA 4ZP9A 2MQOA 3HXMA 2J6UA 1F60B 2KRBA 1MN7A 3I0SB 1DY3A 2VZ9A 3JTNA 3ZZRA 5D3GA 4KQZA 3OL6A 4B3SJ 5L9NA 3IM9A 2FYXA 5L39A 1WHYA 3E8OA 1FX2A 3N01A 3POTA 4HVZA 1U2FA 1UETA 2BJEA 1RAEB 2PT0A 5SZTA 3EPIA 4ZLPA 2DR9A 3Q2TC 2F9JA 2GIRA 4DFKA 3D6TB 4WFBQ 2G1DA 3OLAA 4KH1B 2H5EA 4I56A 3Q8SB 2E9TA 3MPWA 2YTCA 3ZTOA 3OTOJ 2YWGA 1RLCL 1ZPWX 2MXYA 4DX6A 1XR5A 1KQFB 2LDIA 3CJ4A 3HSJA 3N0VA 3ULHA 5HO4A 3OPKA 3QNWB 4FNHA 1NK7A 2WW4A 4O44B 5I42B 4X4VA 1U2CA 4RW6A 5LM7E 3P49B 4IH5A 1AZSA 2E7WA 4WKYA 5KFXA 4U8YA 2FVCA 2DHXA 2DO0A 2KHDA 3UR0A 1NMEB 2XSFA 2XO6A 1VQOS 2HRTA 2BM0A 2BUNA 5ETMA 3KDNA 4ES3A 1M5PC 1BLUA 4Q8FA 1YGYA 2AP6A 3SSRA 2BMBA 4D3GA 4F0HA 1LOUA 4OX9F 1XMQF 2IY5B 5D0EA 1L3UA 2YKPA 3ONQA 5KT7A 1HBMB 5HROB 3BO4A 2VPZB 2YNIA 3AB4B 3P96A 3B4DA 3MURP 1S9GB 3CDWA 1TK0A 1MG7A 3MPYA 4CLSA 3I5BA 5LXYA 3EX7B 1FKPA 2WOMB 1HQUA 3HKWA 4WXOA 5A0YA 2J8AA 2FY8A 3I5CA 2QO3A 2MKHA 4I1TA 1X4AA 2RDIA 2UVVA 3QRRA 1YJVA 3CJKA 4JI0F 1DQ9A 1RKIA 2ACYA 2HPUA 4HACB 2B6AB 4F4YA 3I96A 4PPZA 4WIIA 4DFPA 8AT1B 2RJZA 2X1BA 2YKQA 3I9V9 5LOQA 4YP3A 2Y8WA 4ED8A 5K9FA 2GJFA 3HD1A 1XC9A 2DGWA 3CPWR 1WG1A 4YHHJ 2HBRB 3RB6A 2DNLA 2Q6CA 4KFBB 1MROB 3RW7A 2KM8C 1OYEA 3W2VA 2HVEA 3HPOA 3W5XA 2RRNA 2R7OA 3K8WA 4DUTA 1E6VA 2X3GA 2XYHB 2BW2A 3BH7B 1YZ6A 2ZVIA 1IKWA 2DY1A 5HVHA 1LNQA 3V2UC 1B0VA 1R0BG 3WIUA 1KQSR 1S1UA 3KJVB 4X4UA 2M52A 3PX4A 3GTYX 5DDOC 3QWPA 3VQTA 2UP1A 1CEZA 3DI6A 3S1TA 2VC0A 2BE7D 3OTDA 4ZPWR 3OUYB 4AYBD 2MQQA 1KLMA 2GQQA 3LANA 4OQJA 3BO2A 2E1AA 3C3LA 5KFOA 4QWBA 4MKBA 4J90A 3QWUA 1PJ7A 3GCWP 2FZKB 3PDNA 2V8GA 3PHEA 4XDDA 2DO4A 3CEDA 2V9KA 3R5BA 4UT4A 4O4RA 3QATA 1W26A 1WC1A 3GZ7A 4FBTA 4W98A 3SSQA 3W2WB 3Q8VA 3K0JA 5IC4B 2FLNA 3DRRA 4P10A 1RP5A 1H2UX 2Z2ZA 1LKZA 2XHCA 3GJQB 2GAGC 1XEZA 4A8KA 2J9EA 2YXLA 3M30B 2AYMA 1R0AB 1KTVA 4JB8B 4CWBA 2HVZA 3GR0A 5EWGA 1SJFA 2MZRA 4JYAJ 2DNKA 1WC0A 3KJQB 1K1SA 4GKKJ 2VIHA 4KV8B 1URRA 2DGXA 2QA2A 3EVWA 2PIIA 3FQLA 3P5BP 2R2TA 4WTYA 3Q24A 1S1VA 1KD1T 3I0RA 3R5DA 3CJ8A 2HHUA 2AJQA 1VI7A 5C25A 4ITSA 2V4RA 3P3DA 1G1XA 4G65A 1JLAB 3CJRA 4TY8A 1ZM4A 2AGOA 1T7PA 5CYQB 1KR4A 4DL4A 2NREA 4LFBF 5GAGU 4B9VA 1HHTP 2KFNA 4ENOA 2H5JB 1NHKL 1QSLA 4LF1A 4J91A 2R9LA 5AE3A 1VRTB 3NNCA 4PXEA 4C6AA 3FZBA 4IFVA 2Y1IA 4KH0B 3V5RA 1LXJA 4B08A 4I2QB 4ZDNA 2K7KA 5F0UA 3PKMA 3FNNA 1DTQA 3BGOP 3EVOA 4DOZA 1UJ5A 3CVKA 4OZLA 2XHWA 3TX8A 1YI2S 2I0XA 2JEIA 2BYCA 3DLKA 1HR0F 2FD2A 5T41A 3K8VA 1BGXT 2G0JA 4J9SA 1AYEA 3PEHA 2RKIB 1T05B 2WVFA 1H38A 3IWNC 4ZPCA 1TZ0A 2PMZD 1O51A 3VGUA 1RTHB 3CO0P 3QGIA 4DEZA 4DUZJ 3JTOA 2PEBA 1PYSB 2JVOA 3R3TA 3A8JA 3DOMB 4EZ9A 4KHPF 1IR1A 3CDEA 1TV6A 1FF2A 3DDIA 5D4OA 2DD8S 3QGPA 3VR1A 2HK2A 3W64A 3ZC4A 5K8NA 3MM9B 5BR8J 5GAEU 4QW9A 4ECXA 1SXLA 2KHCA 3KLHA 4I69A 2W9CA 4IYQA 1U1RA 2QEXS 2D74B 4NXMJ 4WYLA 4URQU 1FRKA 2Y1JA 5B0FA 3L7UA 5C2GA 1T05A 5KFSA 3DLKB 3VGSA 1CBKA 2VPYB 2MZTA 3DHWC 4NYZA 2KYXA 2Q79A 4CM2A 5HQMA 5HP1A 3IR6B 5BJRA 4OYOA 1SBRA 3EZUA 1HPZA 1RAOA 4QZVB 2EFQA 4AD6A 4C97A 4UUXA 4UUWA 4DJBA 2IVMA 4JV2A 1V3SA 3H40A 3SYZA 3GYNA 5J1NA 4DDFA 1VDHA 4HR2A 2DH7A 3SQGA 3KLGB 4H4MA 5KG6A 2EKNA 3M8QB 4P52A 1MSWD 1V6HA 2HGMA 2GHVC 2BABA 4LR8A 4GC7A 3CT9A 4H4OA 4ZN1A 4EYIB 2OFHX 5AXLA 4J9NA 3GFZA 2Y3YA 5ETNA 1JNZB 5J2PB 4ANEA 3T5KA 2UUAJ 3V6JA 2HS0A 2VBZA 4KR0B 1UWBA 2A18A 3NP5A 3T5LA 1SQEA 2QLBB 4LF8J 1HQEB 2KXHA 1SKSA 4DPTA 4GKJJ 4JV0A 1JLFB 3QAUA 3DLBA 1AROP 3A8IA 5A8KB 3OW2R 1PILA 2UVUA 2GA7A 2WONA 5GADU 1HW8A 4DS5A 4JI4J 4LSNA 4A46A 1T0TV 3TAMB 3OSNA 4K4SA 4NLUA 2VJUA 2EFGA 2AZ1A 1HWJA 3BM7A 2A2DA 3ZZZA 4B9TA 2NXUA 4USIA 2H1YA 2DITA 2IBOA 2IVYA 1FTCA 1LWCB 3IBCB 4AXIA 2QX0A 4ECSA 1RT1B 4X66F 2L08A 3UDCA 2VU5A 3VHQA 2GW8A 4ZPBA 4CH7A 5HBMA 3I4PA 2WCXA 4K2XA 3OHBA 4C3LA 2DCUB 1E6YA 4AQYJ 3OJSA 3TYTA 9RUBA 4NA2A 3NMRA 4RW8B 4LF7F 2FB0A 3QJLA 3PCOB 3Q8YA 4RBTA 1N34J 3C14B 4JOUA 3HM9A 4DR2J 1N52B 2MQLA 2G13A 4WK1A 1RTDB 3RBEA 3NRBA 1H98A 2R7RA 3RRGA 3BR8A 1RTHA 1UEVA 3R27A 4H4KC 3DGVA 1UA0A 2ZDOA 4L74A 2N3LA 4GVLA 4OI4A 3K89A 5D0HA 3QFWA 1M0SA 4M5LA 5JVHQ 3VAFA 3V6HA 4NOHA 4ELUA 2CQ4A 4WP3A 5EDWA 2X3DA 3TO8A 4PKDB 2VFTA 3G87A 1KONA 5EGYA 2CWKA 3KLEA 2PA8D 3SEOA 4ECYA 3DM2B 1IKVB 2PN6A 1X8DA 3DXBA 3G82B 1TKXA 3GIKA 1JB0C 1S0NA 2JEGA 3V6DA 4EWTA 3Q2SC 2NXNA 5B08A 4Z7YA 1RWXB 1TMJA 2KG0A 1UTAA 3J80U 1GMWA 4HL9A 2J6SA 1V9OA 3BZQA 2C3OA 1EP4B 2HVDA 4LFAF 1HBOA 2LEBA 4Z37A 4BHQA 1S7HA 1X5TA 2KZZA 1SL1A 2BV3A 3PW0A 2NSCA 1Z2LA 4MJKA 4IQMA 3VAIA 4G1PA 4OJHA 3HLUA 4PXDA 2H4WB 1R8PA 2M3DA 1RK8A 2YH1A 1HBUA 4JI1J 2MEWA 5KT2A 1RHJB 1EJ7L 2HBQB 1MMNA 4XPEA 1RHMB 2ROPA 1RWOB 4RJVA 2RRBA 1RCOB 1TKXB 3M8RA 1U26A 4WYWA 2V50A 1HYSA 1JLAA 1WOOA 4BCAA 1RT4B 1IJEB 3LP2B 1SVDA 4EZ6A 3EGNA 3CE8A 3KHHA 4O4GB 2GQCA 3MECB 4ILMA 1VHIA 2EC2A 2N82B 3EUNA 4S0MA 1T3NA 4NLYA 2B4UA 2MTLA 2WTFA 1SUQA 4ID5B 1NK0A 4MYTA 2VH7A 4OZ1A 4OI1A 5MAOA 3JQJA 5LMNJ 4U8VA 4CO4A 4I0WA 4OYAA 2D9OA 3OTEA 5J1EA 4ERDA 2UXBJ 2KL8A 4X66J 5DDQC 4YB7A 2WSFC 2W7AA 4P72A 5JVGQ 3T3FA 2LECA 4P75A 1Q81T 2E5LJ 4FF3A 2EEYA 2KB2A 4WIQA 3K5LA 2CQ0A 1IR2A 2FJBB 3CCZA 4Q7AA 2ZH2A 1GX6A 2V68A 1KQGB 4OZ2A 1UKUA 4Q44A 1S6OA 2M5YA 3ZZUA 2MKSA 1WC5A 2YKMA 5AXMA 2FC9A 3IRXA 1YIJS 5F8GA 4DFJA 2VOPA 2FZGB 1SH3A 4M5IA 3C16B 4G1QA 4I2PA 1GXTA 3H5SA 5D77A 2AGPA 4OHYA 4CCHA 2UZAA 1RWUA 2VL1A 5EHHA 4PUOB 3HHDA 1QM9A 1T9UA 1GTEA 3D3BJ 3GONA 1F9EB 4O4GA 4TNOA 2H5IB 4CLYA 3M1VA 2XGQA 3EZ5A 3LUYA 1GNKA 1N5QA 4QPXA 2QLXA 1YX2A 2BE2A 1SQGA 2GHPA 3M32B 4OX6A 1RYSA 1ITPA 1QTNB 4L3NA 4QU6A 1LXNA 1LW0A 5KFIA 6FDRA 5C5JA 1S48A 1N36F 3VGVA 2XLKA 2R2SA 1OO0B 2OHDA 1RACB 2CZ4A 3KHGA 3BQ2A 3J81j 4IO1A 2R8IA 4KKOA 2HIYA 5DQHA 3M4XA 4MTPA 1TKDA 2KTQA 3VWSA 4ZLNA 3TUZC 2IDEA 4H4OB 2XMAA 3BPSP 3VF0B 2ZH1A 3BGRA 2HK3A 2NCKL 5KFYA 2YNHB 4DX8H 4YR2A 2X1FA 5B0AA 3PVXA 2HIQA 2BE2B 4PG8A 5F3ZA 1WEZA 3H98A 3CIZA 1CC7A 3W5ZA 1CLFA 3TA2A 2P8IA 4UY8T 2ZZTA 3CD0A 4TYBA 4WFZA 2ERRA 3O3LA 1VHFA 4PUOA 4CO0A 4A8FA 5J2PA 5CCLA 3B6BA 4K4VA 1VK8A 1WI6A 2NUUG 1BWEA 2MQPA 4C2MA 3GFHA 1F3VA 2QL5B 2KVIA 1S72S 3OL9A 4DR5F 3PW5A 1VBKA 2WVEA 2QLJB 5A76A 3BBCA 1Z1ZA 1Y5LB 3EXCX 2DNQA 3ZTRA 1X0PA 3CMAS 3A8EA 2DNZA 5KOWA 1LFPA 1B7YB 1P8GA 3OFGA 3E01B 3ET6B 3NGDA 2VOOA 1TAQA 3N28A 1AUSL 4LRCA 2RF2A 5K8MA 3CCVS 5CYMB 1W25A 1FESA 3EXYA 2ZD1B 3V6KA 2VDHA 3PR5B 2DNNA 2OP5A 2H65B 4GO5X 3MM6B 1S1XA 1X4EA 4R5PA 2VQFJ 4DR7F 2OD4A 2XC9A 1E6YB 2RF2B 2FJWA 3MWBA 5IV4A 4GRSA 1R8CA 4M5GA 4CO1A 2IC3B 4DV7J 3OHAA 4RNOA 5H9FK 3C14A 3WX4A 2ZH6A 4KGMA 3AD8C 1RAFB 2CJKA 1WKLA 3HJVA 3L7PA 2ILZA 3TAMA 2KT2A 3VV2B 2HKEA 4MAKA 1FJGJ 1HNVA 1S57A 2KDOA 2QA1A 1U0SA 5BR8F 5K8PA 1KNZA 3W2VB 4FS2A 3M7VA 3HVWA 2V6AA 4OLOA 1T11A 2F7VA 1NAQA 2NXEA 4DV7F 2E44A 2NYIA 4CI0B 3OTBA 1N4LA 3ISND 4CLWA 2CNNB 4LVNP 2C1EB 4FP9A 4J37A 3U1MA 5C24B 5JUMA 4NXNJ 1FRXA 1UJ6A 1QVGR 3ILLA 1IBMJ 2XB2D 3R5CA 1LWFA 4DMZA 3X1LB 4RW7B 1Y5IB 4A48A 4TU7A 1TFWA 4ZCLA 2W9AA 4USUA 2RMLA 3W61A 2WBMA 3DLGA 2CA9A 1HBMA 2DVIA 2VD3A 4KTQA 3H5XA 4NZ7A 2ZHOA 4KRWA 2A1BA 1VBYA 2G4BA 1UWBB 2BANB 3HO1A 4Q5VA 2ZITA 4WPAA 2KM8B 5DGAA 1M5KC 3GJTB 5A2QU 3JS9A 2YPZA 1FCAA 5E3RA 2ZH5A 2ABYA 2IRUA 2OEJA 3DRXA 1S4FA 4DPOA 4LSLA 2OIHA 2LFVA 4DL0C 3WIVA 1EP4A 2OO4A 4ELTA 1RAJA 2GIFA 5HP1B 2JC0A 5HI7A 1RYRA 4ECVA 1JWWA 2ZZNA 1QE1B 3ELHA 1N5TA 2AKWB 2EBGA 4C7QA 2Y9HA 3RG6A 2R7QA 4B9NA 4BDPA 4OL8A 2R7TA 1VJWA 1X5SA 3I6PA 4MFBA 3A12A 4PG5A 4A8MP 3HX9A 3IAS9 1SIWB 4WFNQ 3NWGA 3RB4A 4OHXA 7FDRA 4C0OC 3KLEB 3R2CJ 5FLXY 1NKCA 4JI2F 3JYTA 2DPJA 3VQSA 4MK7A 2VG7B 1FVQA 2CQ1A 5KFMA 1N5YB 2RS8A 3DMJB 2YWEA 2KG1A 4R0JA 2B4PA 1N88A 1I6JA 2ZE2A 1RTZA 3PW7A 3H2UB 4EI2A 3H2VE 5LSRA 1LWEA 4HT7A 4KO0B 1S0MA 2F4VF 1J5EJ 1NK9A 1F9FA 2HNYB 1FD2A 4HHHA 2HHSA 1HLWA 1KOOA 4ECZA 4NL5A 4IFVB 4NLRA 2W4PA 2NSBA 3M8PA 4NA1A 4PXCA 4TN2A 5GMKa 2FLPA 1XNQJ 1RTIB 1G7CB 3NAIA 4FDFA 5FLXU 2C3YA 5CYJA 5LSLA 5FIIA 3NCQA 3RRKA 1YHQS 2Z0GA 3IAM9 1NB2A 2CNOB 4PYAA 4USHA 4BWMA 1D09B 2MHEA 4MMOA 2VASA 2DEJA 4LSLB 1HNZJ 2IHR1 2V4JA 2FVQA 2R7SA 1MU2B 1VJQA 4X4RA 1KFSA 5CABA 1NZAA 1PJ5A 3LP2A 4ZPVR 4DR3F 1G4CA 5AE2A 5HMZA 3ADAC 2V69A 3T5HA 5ADZA 2MKCA 1LWXA 2PA3A 1UVIA 3WDOA 1S1TB 4NPOA 4BC7A 3J81U 2AJ1A 2DNMA 4XAKA 4JV5F 4ZJLA 2AV5A 2LDYA 1X0FA 3RB3A 1Z2ZA 4BS2A 1RI7A 3QGGA 4RW7A 2HMIA 3CC4S 3HCXA 4B3RJ 2XY5A 2UV8A 3GFYA 5HJYA 3DLEA 2YQ3A 1OY6A 2FLOA 2QT7A 4F0KA 2J7WA 2GS8A 3OTOF 4ECWA 2BQRA 1Y4ZB 2BJDA 3PJ9A 3TUPA 3C6TA 4DQPA 3C16A 4G1QB 4I2PB 4QQBA 2DH8A 1NPPA 2R3VA 2XNQA 3MMJA 5CZVA 1U48A 1VQPS 1WDTA 3UO0A 1RADB 2EPIA 4Q2LA 5HQ8A 1O6XA 1R8AA 3TUIC 4RUAA 1M5VC 2MKYA 2OSRA 2BVZA 3MDFA 4N41A 1VCTA 1TK8A 4USJC 1S9EB 5KFLA 5DG9A 1JJHA 2B7CB 3ITHB 3GU0A 3MM6A 4R5PB 1XMQJ 1NBEB 4ELVA 1GXLA 3NOGA 4HDHA 5CXTA 3TJ9A 1KVIA 3I32A 2XG8A 2ATCB 4DBQA 4J9QA 3HSGA 3EICA 4LFAJ 2DB1A 1QSSA 3ZFVA 4ZP8A 4LRDA 3DI6B 1KSPA 5A2QY 2VG5B 4Y28C 3RZAA 4DR4F 2OMLA 2ZUGA 1KDNA 1N54B 4HEA9 1FXRA 2CPIA 3UDLA 2R42A 3DYAA 4C11A 3AD9C 4EU0A 3BBBA 3EJMA 3EVMA 1C0TB 2LXUA 4DSEA 1REVA 2DK2A 2FHOB 5LL6d 3KJFB 4FPRA 2QSWA 4X4OA 1GH8A 1HNWF 3FMBA 5THWA 4LBPA 3QIPB 2CQGA 2DHAA 1JK9B 4ANDA 1D3WA 1VQ8S 3SI8A 3MUTP 1NJZA 4NMLA 1SPBP 1HD1A 1YBUA 3R2DJ 3AHPA 2ACMA 2XSJB 4J9OA 2OUGA 3J7Z5 2RD5C 4EUVA 1TVRA 4B3SF 3NGTA 2NXJA 4DV2F 1Q78A 3T1HF 5HROA 4F4ZA 3CIMA 3M6VA 2V4QA 2GX8A 3R5JB 3FBFA 4DR1J 4KPCA 3UNGC 2VA3A 1CG2A 3DM2A 2EW9A 3CJ3A 1HQUB 1UPPA 1NJXA 5DRKA 5L8RC 1U24A 3PX0A 3MTJA 2R8KA 2Y1LB 1VFJA 1GMWD 2OELA 3LQVA 3MM5A 4PCQA 5G0RA 2CPHA 1ZM3A 1FTRA 2GGPB 1YRTA 4JI3J 5CCMA 3H5UA 1T9WA 2HQCA 4YR0A 4EBCA 3D6MB 4A8SA 1WJ9A 3UVJA 1NO8A 1HMVB
chains in the Genus database with same CATH topology
2R8JA 4OI2A 4F67A 2KRRA 3CCJS 2CPFA 1ZAWA 2MB0B 3MR3A 2CQBA 5IWAF 2CQ3A 2XMTA 3TANA 5AE1A 1HWIA 2RB7A 4ICLA 1N56A 3PV8A 4RNHA 2W9BB 4NLSA 3NG8A 3OBIA 1O5JA 2JLGA 2B5JB 3QO9A 3LP0A 4ED0A 1UVNA 2MSTA 1IKWB 4X4PA 2GV1A 2W9CB 4OZ5A 3L7OA 3SV3A 4LVOP 3MM9A 4ZVFA 2QYCA 4OX7A 2YNGA 5A8WA 4RNNA 3QZ8A 2W4CA 2ZBIA 4WU2A 5KFGA 2ZH4A 4NCBA 1KVJA 2VG6B 4QIGA 3J81Y 1WHWA 5J2NB 2XCAA 3DHXA 1YJNS 2B9YA 1VQNS 2C2EA 1H7XA 2AJ4A 4JUZA 1JKHB 4CTAA 1OIAA 4C3KA 1QAIA 2CJBA 1FK9A 2E9RX 2XZWA 2QFJA 4F8RA 1TL3A 2Z4PA 5BYQA 3EGZA 3OFHA 2O66A 3CCMS 5H1SV 5LSOA 3CSKA 4XPCA 3KK2A 2MMYA 5KG7A 2LMIA 3CCLS 3D0IE 3HKZD 5E0OA 3UW1A 5B0DA 3C66A 3M9MB 1LK7A 1H2VZ 2X51A 4LJMA 3KHLA 3D1OA 3M8QA 1RISA 2HFZA 2J9DA 3QAEA 4WFAQ 5J2MA 4NCAA 2EG2A 1XNRF 4KB7A 3SDEB 4ATNA 5KG3A 5B0CA 5C42B 2DISA 4Y2AA 1GX5A 3OXFA 1Q7YT 3VAHA 3UQSA 3K58A 3MCSA 2HHWA 2EG1A 1ZZNA 2RIJA 3M6WA 2ZH8A 4ED1A 1IKYB 2HNYA 5I42A 2MGZA 3VTIA 2BR0A 2P9EA 2CYYA 1W2IA 5K14B 2KYZA 3M9NB 3BREA 3DRRB 1ROFA 3MHYA 4M1KA 3RU0A 3LP1B 2M4MA 2GO8A 1D8ZA 4RWWA 4R0EA 4I7FA 2MPUA 3JSYA 4K4ZA 4RU9A 1F5CA 1WF2A 3BSAA 4UW2A 1WD6A 3VCDA 3FRZA 1BQXA 2DGTA 3J7ZT 3JSMB 1SH2A 4J9RA 3O2IA 4QR2A 4O3NA 1M5SA 1X5OA 1RJJA 3V81B 1KHVA 2APOA 5I3PA 4TKTA 1TUVA 2CJAA 2CPXA 2WRMA 4B3TF 4QCLA 4IRDA 1VBZA 1UA1A 3K57A 5JJBA 2LA4A 3GFXA 2P6TA 1T95A 3EPGA 4KPYA 1UVLA 1A6LA 4ECQA 2QLWA 2FGCA 3NLCA 4IG0A 5K14A 2BANA 2EK1A 4RU2A 4TY8B 4QBUA 1Q1KA 4EBDA 3JTPA 2HHTA 4PPDA 3KK3B 4B3MF 1S1VB 1VOMA 2OMOA 1N0UA 4A8XA 1S6QA 2HHPA 3C6TB 3I4HX 1RT5A 4N56A 3KMSA 5L1JA 1X4CA 4OIXA 3KLVA 1WG5A 3ETOA 3GB0A 5GVQA 4CNYA 5F0WA 4RUHA 5KT5A 4OZ0A 1YJUA 4ED5A 4GMKA 1SL0A 3LAMA 1DARA 5KOXA 2NQPA 4F3QA 2KN4A 1TL4A 1HHSA 3PACA 3S6EA 2H9ZA 4DR2F 2LQBA 5M2PA 2Q6BA 2O1PA 4DQQA 3LPYA 4J5OA 4OV1A 3CCSS 4X84A 3ZZOA 4EFAC 3GILA 2ZHBA 1U1LA 3M2RB 3OFEA 3TARA 1XMOF 1B0TA 3BO3A 1H6KX 2OPQA 1ZTWA 3K7RA 1HPZB 2PC6A 4Q2MA 4MIAA 3DLHA 1RTJB 1YVFA 2W25A 2MZ1A 2W9BA 2B7BB 1NK4A 1LQ9A 3K5PA 5KFRA 4NYPA 1S10A 2MHNA 3GYXB 3KLHB 1FDBA 3QLHA 4KBIA 4JBCA 4K5SA 1NEEA 1I1GA 3KHRA 4NWBA 2OTJS 1T8EA 1VMBA 2UUAF 1R3NA 2VFSA 1ZETA 3HHNB 3PIOQ 1WEXA 2R7WA 2AYGA 1AUDA 2M8HA 2HZCA 2P5VA 4WFXA 1RTJA 3U27A 1UFWA 4KHMA 5GAHI 1WELA 3KTQA 5F41A 5KT4A 3KNAA 1IBKF 2DNYA 2UV8G 4C8MA 3FFIB 4URSA 4LFCF 1UP1A 5L1IA 1JLEB 5HMXA 4I2QA 2XWYA 1ULRA 1NK5A 2DHGA 2GJIA 4AQYF 3RTVA 5F3TA 3BQ0A 4C8ZA 1S9GA 4JYAF 4N76A 2K2PA 3KK3A 1A7GE 3PW2A 4HTJA 4G6VB 3OFFA 3DCAA 2MYFA 2VFUA 4MIWA 4Y0FA 1U49A 1S0OA 2ROGA 2AGQA 1ZAVA 1RTIA 2O67A 3Q8QB 1TKTB 4PG4A 4K4XA 3PXGa 1PGZA 1WHXA 1CVJA 4CO5A 3DGPA 5KFBA 5F8IA 1Q4RA 1N0VC 3IS9A 4FZVA 4LT6A 1UW4A 4ALZA 3UPFA 5IS2A 2V2KA 4P6QA 2EK6A 3HFKA 4IR9A 3MI7X 2XULA 4K5RA 2O01C 1Z4UA 2JSXA 4JI8F 1JLCA 4B9UA 5L1KA 1JLBB 2QMXA 5KFZA 3TVZA 1BQMB 2AF6A 5A6PA 3IC1A 2YKAA 3R5AA 3MUMP 2UXDF 2K8GA 1NKEA 3G6XA 4F2SA 4B3OA 1FERA 1VIXA 1NU4A 2DT9A 1D9DA 2W8LA 3QZ7A 3OJUA 4C8YA 3SFUA 3QGHA 5E3CA 2HMIB 3K2YA 3ITHA 5GAGI 1TKTA 2XMWA 2OAUA 6FD1A 4RUCA 1D8YA 2YKNB 2D3OR 3R1HA 5KFTA 1ZYQA 3OR1A 5BYRA 2F40A 3WZ0A 5EN1A 4DG1A 2FVSA 1FJ7A 1VRUA 2ASJA 3E2EA 1LW2B 2LQ5A 1RT4A 2XWXA 2LVWA 5D4NA 1S97A 3DRSB 1MNEA 1H3DA 4I67A 4CT8A 5KTQA 4OMFG 4BWJA 3I9ZA 3F56A 2J7UA 3HVTA 3G96A 1XNQF 4C8KA 4WF9Q 1MMDA 2FGOA 2B4VA 2GIQA 3GE9A 4TU9A 3W3SA 5E5NA 2COLA 2KFZA 5E3PA 3MEEB 3BB5A 4DR6F 5EUHA 3UWTA 1RKJA 2JWNA 1GTHA 1R89A 2L9WA 4PXBA 4JI6F 1S0VA 2K1RA 2K3IA 3LAKA 3H5YA 2HLUA 3MR5A 2FY1A 2VPWB 1JLGB 1TL5A 4CO3A 2HYIB 3V81A 5KFVA 3MEDA 2WK4A 2QMWA 3GG1A 2P9CA 1XK8A 2RT3A 4NLGA 3QLHB 3HHLD 2K3KA 2OD6A 3HJFA 2Q66A 3BJYA 1Q86T 3BF4A 1OSDA 4YMEA 2B3TB 3G6ES 1XMBA 4X65F 3J80Y 2VG6A 2PE8A 2ZJPQ 5KG1A 1FA0A 3IG1A 2QZ8A 5F8MA 3W7BA 3LP1A 1FNXH 2HVHA 1YG0A 4BC9A 4OI6A 3A1YG 1P27B 3TAQA 2F1FA 1ZZFA 3CJ2A 2FIUA 2VBWA 1FKAF 2AW0A 3H59A 3DDNA 2FDNA 3PEJA 1QUVA 1RT3A 2JOQA 2W8KA 2HNDB 4DV3F 1DTTA 3HZGA 1IBMF 2LA6A 1NK6A 2F8HA 1JXLA 2M9KA 2HW3A 2NR0A 3PJXA 2Z2MA 5HMWA 2DIVA 1J5EF 2Q43A 2PGCA 4L72B 3SDEA 3ZZ0A 2EBEA 2V0NA 2IM0A 5SUHA 3IFEA 5KG5A 4DV6F 2KT3A 5KFHA 2BOPA 4F4KA 3B82A 1RA6A 1SV5B 3B8HA 1YJRA 5E2QA 3MR2A 4F4WA 2RQCA 5L9XA 1YJWS 1TAUA 3FJ2A 2KXNB 1VQYA 2HNZB 2PEHA 3CDAA 3MM7B 4TLRA 4NLWA 1KTQA 1HWLA 4R8UA 4JV1A 1VRUB 3QYYA 4G1IA 1FNMA 2XMUA 4YOEA 3BDPA 2HFNA 3T6BA 3OV7A 4DL2A 2XSJA 1Q8LA 3IR7B 3M1VB 2BRLA 2UU9F 3GG0A 1WF0A 3L3CA 3C46A 2J0SD 5EWEA 3FRYA 2MY8A 3CB4A 1LWEB 4KO0A 3MOJB 2MJUA 1S77D 4K0KF 2ZDPA 2PSZA 3AJ1A 4DQIA 2VPXB 3TR5A 5H9FJ 2E1MC 1N6QA 3DMJA 2K7JA 2R2UA 4DS4A 2I1RA 1K1QA 1S9EA 2C28A 2VKZG 5EX0A 1V3RA 5KFEA 2NLWA 2M88A 4FXVA 3D0GE 2YY3A 5IFMA 2JC1A 3T6JA 3ENQA 1FDAA 5J2QB 3UD3P 4LF6F 3CUNA 3RAQA 3IG1B 2F9DA 2DR7A 2JFDA 3X3UA 1VGYA 2IA0A 1IKYA 2CQDA 4QOTA 3NNHA 4N47A 2XCPA 3SV4A 2M2BA 1DJ0A 2IFXA 2XS5A 1A9NB 2CZVC 4PWUA 4RKUC 3FEYB 1XR6A 4RWXA 3M2VA 3BDEA 2JEFA 1HWUA 5F9LA 3KYLA 1U6BA 3H2LA 1RDRA 4RLEA 3AH6A 2R7XA 2RQMA 3SCKE 2NPIA 2WHOA 2HHVA 3DOLA 1CQMA 2C3PA 4DSJA 4KHRA 4O0IA 2VUGA 3GIIA 1UVMA 3AB2B 3IBWA 1U1QA 3DNCA 1SC6A 4U7UK 1OS5A 3CD7A 3Q8RB 3WC0A 4X4SA 3I87A 3OXGA 2PI5A 4K4YA 2I38A 3BGFA 4RW9B 3R1LA 2RRAA 3MXHP 3BGLA 3BGRB 3TOQA 1HQEA 4QIFA 5KFDA 4CTAB 2DGQA 2B43A 3TVKA 3CJ0A 5KFJA 2R2RA 4F3MA 4NLOA 1WF1A 1XN9A 1I94F 4WE1B 1M5HA 2HFOA 2IC3A 4R25A 2LEAA 2MQNA 2AYEA 3NCRA 4IDKA 5KFQA 2IRYA 4ZKAA 4ECUA 4EGLA 2WB1D 2ZJQQ 1ZOTA 1OPZA 2VG7A 1U8SA 2L9DA 4H54A 3M32A 4GKJF 4QW8A 3HMJG 3M8PB 2XS7A 3N5FA 3L09A 3U1LA 3RBDA 3KFWX 5CD4H 1C4AA 2DRBA 4DSLA 4DR1F 1S6PA 4B9MA 3IN5A 3HDSA 1YIJS 1HMVA 2E7XA 1H2TZ 2OPSB 2PO4A 4Y2MA 4Y2CA 5LXRA 1N48A 1FXLA 1SUQB 2ZOGA 4ID5A 2KKHA 5CYMA 2VC1A 1E6VB 4W92B 2E5IA 3F44A 3LGMA 4NRUA 5AXKA 4LIRA 4PWDB 2CJQA 2IJNA 3KNGA 2BQUA 1HBNB 1HNIB 1VS3A 1W2BR 2FVPA 1MROA 1X4GA 4KGKA 2IAJA 4A8OA 1NJWA 4E8UA 3G71S 1AXQA 3DLEB 4YB5A 2OPPA 3LH2S 4FYDA 2J9DE 3M9OB 1LV5A 1UVKA 3DN9A 5D4LA 1SJQA 1RT6B 1WTFA 1UMJA 3UE2A 3DRPB 5A8RA 2DGSA 2LQ9A 5DQGA 1ZAXA 1BD6A 4QIVA 2DGUA 3IGVA 1VQSA 4CNZA 4XO0A 2ZM6F 4X4NA 4X64F 3CWJA 2LEPA 2JDJA 1WI8A 4X2BA 3PRDA 5KFFA 2E1RA 4JI3F 4NZ0A 3DOLB 3S01A 2RS2A 4AL5A 2B9XA 3Q8PB 2E29A 2M7SA 3B78A 4KKOB 5C24A 1DZ5A 1JLEA 3DRPA 5DDPC 1FJEB 3TQ1A 4YUDA 4F4XA 2CQCA 4DL6A 1BQNB 3DRYA 1T94A 2AQ4A 1D9AA 4ZCMA 1SB6A 2ZH7A 2CPZA 3RAXA 4IRKA 1QAJA 4RBUA 4ZVHA 4OJ3A 2DR5A 2EWHA 3SMZA 2MJNA 2QA4G 3MFIA 1RTDA 2PI4A 3OTCA 1Q8IA 4QPTA 4KIAA 1KEKA 2RNEA 1QY7A 2U1AA 5KG0A 2FPHX 3CGIA 4O3QA 4HLBA 4YY3F 4A47A 1BQNA 2VA2A 3GWCA 3MEGA 2AU0A 5B7WA 3EYZA 2Z8QA 1VIOA 2LU2A 4KE5A 2XY7A 3NMAA 1SJ1A 2RQ4A 3H4DA 3LF0A 4WJBA 3F41A 4WZQA 3AA8A 4ZVGA 2OJ3A 4UQTA 1IUJA 4YDDB 1QAYA 1S99A 4MYUA 2DBBA 3SFGA 3M2UA 2DHSA 4NLQA 4B9SA 2OPRB 2O5DA 3E3XA 1EETB 2FC8A 3NKYA 1VC5A 3TA1A 2CRLA 1HYSB 2VOPA 2F8MA 2JJ4D 2WSEC 4OI3A 2CQ2A 3NNAA 2EFVA 2DNPA 1OWXA 2UUTA 5CHCB 4DV1F 1X4BA 2UVRA 2D9PA 4O23A 1Q8BA 3CMES 2JFKA 2MZQA 2ZOMA 1M90T 3F73A 2Y1RI 4Q8EA 4IG3A 4ID8A 3IA0A 4LIWA 2E1CA 3ZZYA 1D1UA 2ZFHA 3CC7S 2CG4A 2MZJA 3P5TL 1REVB 2CDQA 2YKMB 2IYIA 2HHXA 1S6UA 1DLOA 3N9UC 1GAOA 4OFZA 3PO5A 1TKZA 5DGBA 1H7WA 1WHVA 1M1KT 1QSYA 4F50A 1BY9A 2ROEA 3D54A 3I31A 5KFNA 5KFCA 3E01A 3DLLQ 1DQAA 2RVJA 3M6UA 2XMJA 4N5SA 3KJVA 4O44A 1UVJA 3RAMA 4DL7A 2ZD1A 1GQEA 3M6XA 1XR7A 3WC2A 1N5YA 2IMOA 3NCPA 2CPYA 2GMLA 3TVYA 5KFUA 4J9KA 2OFGX 2LXIA 2ZBCA 3TRGA 5G0RB 3JAMY 3MAHA 3B4MA 2YNFA 3HZEA 1TKZB 3U1NA 4DL5A 1TK5A 4I64A 2JH3A 3KG0A 2IA6A 2XMVA 3RB0A 1HW9A 2RKIA 1LK5A 2FHMA 3TW0A 2HG4A 1FRIA 1NHUA 4A8YA 2HGNA 4Y6IA 1Y3JA 3L95X 4I68A 3ZZPA 4ECRA 2ADCA 4DL3A 3RW6A 3SCIE 4Y00A 2E5GA 2WB4A 1HI1A 4TQRA 2J76E 1S49A 2DTJA 4KV8A 3M2UB 4DQRA 5G4DA 1C0TA 4Z2XA 3Q23A 5T7LB 4DUZF 3IXQA 2YH0A 3DLGB 3V6DB 3T1AA 3MR6A 2IRXA 4MKYA 4HTIA 4WXWA 2WAQD 3G86A 1JIHA 3VAMA 1QVFR 2JVRA 3HK2A 2NUHA 3U7JA 1HBOB 3OQ2A 2HHQA 5CQGA 4P7VA 3SSSA 4V19J 3IO1A 2KO1A 1IN0A 1FD8A 2HWIA 4RX6A 3SQGB 2DNOA 5DG7A 4DV5F 3IRXB 3J7YU 2J6TA 1JKHA 4WKRA 1KN6A 3I82A 2VFRA 2F3JA 5JXSA 3I55S 3FSIA 1U1NA 3MFHA 1VC0A 3OUYA 5DM7Q 2FJXA 1TR0A 2DNRA 2L3MA 1RT3B 1JLCB 5E33A