1FJGF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fjgF00
4B3MF 4DV3F 4JI3F 2UU9F 4DV5F 4LFAF 2UXCF 4GKKF 4GKJF 4DV0F 1HNZF 2VQFF 4JV5F 2B7BB 1RISA 4JI2F 1FJGF 1N32F 2UUCF 1B64A 1XNRF 4KHPF 1GH8A 5IWAF 4YY3F 4DR3F 4DUZF 4NXMF 1IJFB 2BXJA 3R3TA 4NXNF 4DR4F 4LFCF 4LF6F 4JI8F 1VMBA 1G1XA 1G7CB 1HNXF 1N36F 4DV2F 4JI6F 2J5AA 4LF4F 1CQNA 5LMNF 2UXBF 3ZZPA 4LFBF 5BR8F 5LMUF 4K0KF 4X64F 4DR5F 1QJHA 1FKAF 2BVZA 2RJZA 2YY3A 4JI7F 4DV4F 1I94F 1J5EF 1IBKF 1IBLF 4JI4F 4JI5F 4X66F 1XMOF 2KJVA 4DR7F 4DR2F 3T1HF 2B7CB 4LF9F 4LF7F 1HNWF 4YHHF 2VQEF 4AQYF 4X65F 2E5LF 1IJEB 5AJ3F 4X62F 4LF8F 1N34F 1XNQF 1F60B 4DR6F 1CQMA 4DV6F 3T1YF 4JI1F 2HHHF 4JI0F 2UXDF 2KJWA 1HR0F 1N33F 1IBMF 4LF5F 4OX9F 4B3RF 4B3TF 4DUYF 3OTOF 2UUAF 4B3SF 2UUBF 2ZM6F 4DR1F 1XMQF 2F4VF 1LOUA 4JYAF 4DV1F 4DV7F
chains in the Genus database with same CATH superfamily
4RNFA 3DI6A 3BQ1A 2MKIA 2L48A 3AOCA 4JI5J 2J9DA 1VDHA 3BR8A 3KLHA 4USKA 1YJNS 4K2XA 1MROA 1RAIB 4UZCA 5KFYA 2DGWA 1QAIA 2MZRA 2A2DA 4ELUA 2B0GA 4G1IA 1UW9A 2KZMA 1UJ4A 3D6FB 4HI2A 2BACA 5D77A 3CEDA 3CJ4A 1V5IB 4DR5F 1S49A 1KHVA 5CZXA 2MKYA 1K8AT 2KL8A 2RVJA 4DBQA 1R8CA 1VHIA 3EGVA 3G6YA 4CQ1A 2B9YA 3GIJA 3UFCX 3AA9A 2OGUA 2QLJB 4N8NA 3G4SS 4RNNA 2RS2A 5GAEI 3M8RA 1YITS 2W24A 3RBEA 2AEJA 1EHWA 3JSYA 3QGGA 4WK3A 2HS4A 1ZM4A 2UV8A 1JLQA 1WKJA 4OI1A 2VUGA 1TP7A 3OD2A 4WBFA 4BC9A 1N4LA 1VQYA 3FSIA 1TL7A 6FDRA 2C2MB 4MK7A 2Z2MA 2JNJA 1B0PA 2MZSA 3NGSA 2HAFA 2CNOB 1TL4A 4NA3A 3KUGA 5LJ3Y 4H4MA 2HW3A 3WX4A 4BC7A 3TA0A 1RT4A 4LRCA 2VKRA 1RT3B 5KFMA 1WF1A 1RHJB 3MM6B 2DITA 4JI0J 1HYSA 2C2KB 3RAQA 1N54B 5J1EA 2H3EB 3CDBA 3FSXA 4QW9A 1YRTA 4CIOA 3GSDA 1J5EF 3KLFA 4P2FA 2AMCB 3TUPA 1M1KT 4IYQA 1TKZB 3A8JA 3PW7A 2HWTA 2WAQD 1RE1B 3JSMB 3JXOA 2GMHA 1LXNA 2RDIA 2EFNA 4OYMA 4WKYA 2FVRA 5HQMA 2CVEA 2E9RX 3IA0A 4USTA 2HG4A 1JLFA 4QZVB 2MZ1A 3M1VA 1F5AA 4MKVA 2AJ4A 3GR0A 3PCOB 1E6YA 1HBNA 1S79A 2K2PA 3FC9A 4K4ZA 2XY5A 2PD1A 1Y5LB 4OI6A 2CG4A 4J91A 1G6BA 4PWUA 3MD1A 4OZ5A 2GVDA 1REVB 2NYIA 3OR2B 4URSA 2CNLB 2E5HA 3K5NA 4M5HA 1VS3A 1YJRA 3OFHA 4PXDA 4DL3A 3QFHA 3BSAA 3N79A 4P72A 3PYEA 1FFSB 4K4WA 2W25A 3TZZA 4DV4F 2V67A 2VL1A 1S6QA 1NKEA 2RQKA 4V1Ak 5KOXA 2RRNA 3PV8A 3CGIA 3PR4A 3HFVA 1A0OB 4LF2A 2E5LF 2WSEC 1CPZA 2VG7B 1FWPA 1HQEB 4HACA 2QJ3A 1L3UA 2OH2A 3K57A 1UJ6A 1YLXA 1N0VC 5A6PA 3ZTRA 5KFCA 2Q6BA 2F3JA 4QWCA 2DNRA 3MR3A 1S12A 1KHWA 4X84A 3DRSA 2F40A 4DR5J 4MYUA 3UD3P 5CQGA 1GX5A 5DGBA 4QIEA 2V4RA 5BYRA 4J9PA 4DN9A 4JI2F 1AZSB 5HMZA 1UWBB 3GP9A 3SQGA 2VBYA 1D9DA 5AXKA 2OKQA 1LV5A 1AW0A 1FWLA 3OPKA 2BXJA 1Q7YT 1XBWA 2JEGA 2B9EA 3CB4A 2VBWA 3GB0A 1D9AA 1OQ6A 3SCIE 1FKOB 1NXIA 3ZTPA 4K8RA 2WSCC 4QW8A 1NH7A 3V81A 4ILMA 1VR6A 4FXWA 1U2RA 1N56A 5DM6Q 2C3YA 1M5PC 2AHOB 2OJ3A 2CPHA 5BXIA 1JLGB 3V6DB 2RUGA 2L08A 1RTHB 3RUBL 1UAWA 2E1PA 1IJEB 4ZVHA 5KG0A 3QRPA 2ILZA 1JXLA 2VPXB 3I4PA 3GG1A 4WFXA 4YN3B 1YKWA 2JVRA 1X9SA 1WC3A 3OTCA 3GLJA 2Z8QA 3AAWB 1FNOA 3QO9B 4IO1A 1J5EJ 1H72C 5D15A 2XBPA 5T14A 2F7VA 2HHTA 4F0MA 2Y8YA 3KK3B 2GAGC 1S1UB 1RISA 1EKSA 5KFXA 3K8VA 3ISNC 2KTQA 4OI2A 3RB0A 1W26A 4KRWA 4B3OB 2DNOA 1K9MT 4AL7A 3IBCB 3BKUA 3KLEB 5G0RB 1D3WA 3OVAA 2PA8D 8RUCA 2VICA 2YNIA 1PC5A 2MZQA 3AQOA 3HVTB 5DRKA 3PJ9A 1XMOF 4DR4J 4RBUA 3CD5A 5KFQA 4C8KA 4TY8B 4CLSA 3DMJA 2RE1A 2ZKUA 4QPXA 1IKYB 2CJQA 3B4DA 4OJ1A 4KBIA 1R6VA 4C6AA 3CJSA 5K9FA 4GVBB 1S0NA 3PKYA 3QT6A 1UFWA 2WONA 3DLHA 4DX7A 2DNMA 5KFBA 2JSXA 3GJSB 2BM0A 5FJ4A 1RWNB 5AXMA 4DV4J 2WTFA 4Y3CA 3PX0A 2EC0A 5LJ5Y 1X5TA 2RQ4A 3HHLA 4B9SA 2V9WA 4G6VB 2ZWPA 1SH0A 4IUFA 1RKJA 1KQSR 3NKYA 3E51A 2E5LJ 1IXKA 3FSYA 5F8IA 3E01B 1TMMA 3M7VA 1S1TA 4D3GA 2R7UA 4RW4B 3KK1A 2DISA 3V4IB 1RAGB 3MUTP 4F02A 1LWCA 5JMNA 1GMVA 3DNCA 1FEHA 4O3NA 1KDNA 1KWMA 1QE1B 3JQMA 3TVZA 3MUMP 2LA4A 2XS2A 3MPVA 5DQGA 2GQQA 2X1AA 3DRRA 2DGTA 3S7RA 4N56A 1FDNA 3MAQA 4JI2J 3A3NB 2WCXA 1RHQB 2LKZA 2GVZA 3MR7A 2CPYA 3IR6B 4LF5F 2XG8A 3SEOA 2AF6A 1FEEA 1WHWA 1FFWB 3MM5A 3EZUA 3IG1B 2CRLA 2JEFA 5KG1A 3CCUS 3DGPB 4JI3F 2B9XA 3CC2S 1IQTA 3EDQB 4BLGA 2POKA 1QUPA 2Z57B 3HD2A 1FJGF 4DR3F 4FPRA 5J2MB 3IWLA 4C3KA 2AWZA 4CH0S 4ERDA 2XY6A 1G7CB 1RWWB 4ZN3A 4OFZA 5EX0A 4NYPA 5DG7A 4LFBF 2JLFA 1X4DA 1YX2A 1H0HB 2ZHAA 1IKWA 1SUQB 1NKCA 2OSRA 5B0FA 2HGNA 1ULRA 2E9TA 4CLUA 5B09A 4ECXA 1LWFB 2VONA 2AYGA 2R2RA 2J0SD 2PE8A 2MQ8A 3TO8A 4RUCA 2L41A 4OYXA 1F60B 4F7VA 2D9PA 1K0VA 1DLOB 4N77A 2M8HA 2P6SA 1BUXA 3TAPA 2M7SA 1T9WA 3MFIA 3BPDA 5A6WA 5K8PA 3TZXA 3TARA 2Z2ZA 2NSCA 2XSJB 3T5HA 3QRRA 1DQAA 2NXUA 6FD1A 3EDRB 3SDEA 2PI5A 1T02A 1JLEA 3AD9C 1WEYA 3BEGB 4U7CA 4GRSA 5IZHA 1NK0A 3T1AA 4DL0C 1KLNA 4LQ3A 1RHMB 2ZH6A 2B9WA 4XTTA 1KTQA 2HRYA 1KC8T 2LQ9A 2KXFA 4NCGA 1REGX 1FKPA 4ZPAA 3W66A 1CJKA 3PW0A 1TKXB 2VH7A 3MMCB 4ID8A 3IAM9 3BGLA 1CS4B 3GZ7A 4CO2A 3T6BA 4ZMMA 2MY7A 2HVZA 4R8UB 2JH3A 2DGQA 3DXBA 3Q8UA 4NE9C 4YB5A 3GIRA 1FJEB 2MKCA 3C66A 1JB0C 3UR3C 2IYGA 2MZJA 2CA9A 3Q8VA 1S1VB 4EEYA 4OI0A 4CO3A 5K5MA 2QX0A 2E5JA 4PG7A 1VQ5S 4P2XA 2DR6A 2ZNZA 4FKYA 2UUWA 2XGQA 2DCLA 1LW0A 4IRDA 5D78A 3OFEA 2OPPA 4FNIA 4P2MA 4M1KA 1HNXF 2G2YA 2MJNA 2V4JA 3J7YU 1KTVA 4LF5J 1X7VA 4DPOA 1FE0A 1HWKA 3ETMA 4YP3A 3CDAA 1TL1A 4A8XA 4WKRA 2ZH7A 3SIPB 3TWZA 2FIUA 4CT8A 4HH1A 2O1PA 2A6OA 1NK6A 4ZPDA 2ZH1A 1RTDB 1OYEA 3EGNA 4I6WA 2VDHA 4FKXA 4CLTA 4OYBA 4X4QA 1FJGJ 5HANA 2V5HG 4USJC 4KHRA 3BB5A 2Q66A 3OVBA 4Q45A 3A4TA 3WHIA 5L39A 4LR8A 3JYTB 4DR3J 4JI1F 2JLGA 3GIIA 1CJUB 4UOCA 1K1QA 1QVFR 1DJ0A 1HMVA 4ZPBA 4IOCQ 4DFJA 1RAFB 3QWPA 1RT2B 4O4GB 1VHFA 1CVJA 4LFBJ 1R27B 4R25A 1YWXA 2BZ2A 1HNIB 2YNGA 2PIIA 1N0UA 1J27A 4G65A 3CCJS 1SVDA 3I0RA 1NJWA 3X3UA 3R27A 4I1TA 1N5TA 4ZLJA 4KKOA 3N01A 1G1XA 2D3ZA 1S10A 5CXTA 1TV6A 3FBFA 2F4FA 3A3PB 3BGOP 4NLUA 3FJ2A 1NK8A 5ETQA 1H6KX 3FCWA 1IM4A 3VAFA 4PQAA 5ETLA 2HQDA 1RWUA 2OMLA 4F50A 1RBLA 3UCZP 1X5PA 1VQ7S 2HNZB 3QRQA 4LSLA 2BKNA 1M5SA 2YTCA 5BR8J 2ZD1A 1FRXA 4QR2A 1RAHB 3DC2A 1LWEA 3MTJA 2NZCA 3DLGA 1RSCA 4KPCA 5E5NA 2KKHA 3TA2A 4ZK7M 2G2OA 2CJAA 4M5NA 1OPIA 1NB2A 2N7YA 4PYDA 1DURA 1WACA 1R0AB 1JJCB 3V5RA 1UJ5A 2FVCA 4QIGA 1S1WA 5ETVA 1F9EB 3UN2A 2XSFA 4NXMF 4IFVA 7FDRA 2ILYA 3PFOA 1N52B 4DL5A 4K2JA 2C22A 5I3QA 3C8YA 2AYMA 2F5GA 2VFTA 1FTRA 4K0KF 1IR2A 2AGQA 2XTJP 5HATA 4O3OA 5LOQA 4BHQA 3R5GA 1QM9A 4CLKA 4DR7F 4Z7CA 1R43A 2ZOGA 1LW2A 1X4BA 1XN9A 1DTQA 4K5RA 2WVFA 2E7WA 3K5LA 2HFUA 3EE3A 2ZHOA 3KLFB 4ECSA 2WRMA 5B08A 2IM0A 3IP0A 2W4CA 1C4CA 1XTZA 1HNXJ 4CCHA 3DDKA 5CYQA 4QU7A 3VF0B 2VA3A 4NLXA 3FCHA 2R7RA 1PJ6A 1U4BA 2BBEA 3ONQA 5LL6d 5JXSA 3TQEA 3PJWA 2XC9A 4ZJOA 4X4RA 1TMJA 2VBZA 1B64A 2BA9A 4PUOA 4KT0C 1BE4A 2VODA 1CJTB 4H4OA 1PAUB 3BJYA 3DU6A 4IOAQ 1TELA 4JI1J 2HNDA 3PO5A 4J9RA 1SKUB 1I6JA 3SCJE 4W98A 3I32A 4USVA 2BMBA 3L3CA 1SJ4P 3HFKA 1QAJA 4LF9F 5I3UA 5IC6B 3KJVA 4P52A 2CVIA 2VQEF 3DDIA 4DL7A 2B4VA 1EIYB 4HLBA 3QWUA 5AJ3F 2YKOA 2E5IA 4O44A 1OIAA 2CAJA 4ED0A 1XR7A 4LSNB 3ENWA 4CO0A 1OPZA 2P5VA 1UWAA 4TU7A 3ZTOA 3MM9A 1V3ZA 1HD1A 2CJYB 5KFNA 5KFGA 2H65B 4GKJF 2EG1A 2KHCA 2CIMA 2UUTA 4B3RJ 2MJUA 2FLNA 4M5IA 5L46A 2NXCA 2GZOA 1FWKA 3GJTB 1OWXA 1H74A 3CNQP 3EPIA 2G4BA 4KHMA 1L3TA 5ETSA 2ROEA 5F8LA 2KRRA 4JI6F 2GJ2A 3W65A 2R2UA 2QT7A 3D0IE 3CTRA 4FF4A 2OD4A 2DD8S 4DR2F 1Q8LA 2HQCA 4CI0B 3UE2A 1M5KC 3H4DA 2GS8A 2L9DA 1WF2A 2H54B 4NXMJ 1XQIA 4DF8A 1N33F 1VBXA 3T9NA 3C16B 4Q2MA 3PVXA 4ECUA 2JFKA 2ZBPA 1ZA2B 2UUBF 3TI0A 3W2VB 3QLHB 1FRHA 2B56A 3L7OA 3PIPQ 4TVAB 4DR7J 1MNEA 1PIEA 2XHWA 1RB0A 2LXFA 1DQ9A 2OIHA 1Q53A 4DN0A 2UVVA 2CNKB 4ZJQA 1SH2A 2D3OR 2XHCA 2W7AA 3MFHA 4F4YA 2PEHA 3AB2B 5EN1A 1JXVA 2AGOA 3MGJA 5K8NA 1ACMB 3GTYX 1U24A 1TZ0A 4AE5A 4DS5A 4KGMA 1HBOB 2KRBA 2KT2A 1J5OA 4OX8A 3UCUP 4LF7F 2QG9B 1VRUB 1UFLA 4RJVA 3R6GB 3RZAA 3H90A 2FTRA 2ZUAA 5J2QB 3JSRA 3V6HA 3MEEA 1DY3A 3WC2A 1N5SA 2ZH2A 3DMJB 1Z4UA 4B9MA 3LP2B 3C14A 4B3SF 4ZVEA 3OTBA 2DXDA 1KONA 3PR5B 4DV1F 2X7IA 4ZOSA 3QSYB 1JX4A 4DV6J 3H5SA 2WONB 3KWMA 5HP1A 3UVJB 2IAJB 2HGLA 4ZVOB 4LF9J 4N41A 4R5PA 4OZJA 2VQEJ 3IR5B 2G9OA 1S4FA 1BHNA 1PILA 5AJ3J 2W2MP 4X4SA 4DG1B 3OFFA 1CQNA 3LAMA 4FF3A 4KO0A 3BDEA 3U7JA 4F04B 2PFDA 4P7VA 4E0DA 3LPYA 3HHEA 3Q83A 2RKIA 1MMLA 2UVRA 1JXEA 4GKJJ 1D9FA 5HBMB 4YR3A 3BF4A 4KGKA 3BQ2A 4PWDA 4WYLA 5IT9Y 3PJXA 2ZE2B 2KM8C 2OTJS 3S1TA 2C3MA 4QYRA 1NUEA 4O3RA 1KVKA 2RF2A 3DRRB 1ZS6A 4RW8B 1JNRB 4B3TF 4JI6J 2RU3A 3JTOA 2P8IA 3TX8A 2MYFA 3ET6B 3UDVA 3HSDA 2GQ2A 1P9QC 2C2EA 1Q86T 4MK9A 4DR2J 1DHMA 3DOLA 2KO1A 2QA2A 1DTTA 4YY3F 4J9QA 4EK2A 2IDLA 2YKNB 5D4LA 3OFGA 3M2UA 1ITPA 4BS2A 1RTZA 4V19X 1C1CB 1SQFA 3OR1A 3D2WA 1Y11A 4OZ0A 1N33J 4C8MA 1BXNA 4ZLNA 5D0RA 1TL3B 4J5OA 4EMDA 2M4MA 1C1BB 2AX0A 2AJQA 5A8KB 2UUBJ 3F41A 5B0AA 2KVQE 4YMEA 1Q82T 3ENVA 1RT1A 2R8IA 1YJUA 4JB8B 2DCUB 3K8WA 2LVWA 3H2VE 4NA1A 2RHQB 1PKUA 5GMEA 1VC5A 3DU5A 1RT6A 3SI8A 2WW4A 4S0MA 4J9KA 1AB8A 3A8IA 4ZVRB 3W7BA 2DT9A 1LNQA 5AXNA 4XDCA 3BYPA 5CYMB 2YWHA 2R7TA 2GO9A 3M2VA 2ASJA 4KC5A 3ENQA 5HMYA 2UU9F 4F3MA 4ES1A 4ECRA 3JQJA 4DV5F 2X1GA 5L9XA 1Q4RA 5JUMA 4WJBA 2RAQA 4QWDA 1JLBA 2Y1JA 3MI7X 1T9VA 3DOMA 5HK4A 1NAQA 1N5YA 3CW2C 4LF7J 2J76E 3G8TA 1HWLA 4JYAJ 4W4MA 4N7TA 4P74A 2BW7A 4I56A 1VRTB 4C0BA 4DLGA 2GGPA 1HWJA 2P9CA 2BRLA 2YNHB 3DM2B 1Y3KA 2R7QA 3TYTA 3IR7B 2VF3A 1S5ZA 5A2QY 3KG4A 2GIRA 2I2YA 1N6QA 4EYIB 2QL5B 4DV1J 1FD8A 3KLVA 1BWEA 2C2RA 1U48A 2FJEB 4PYAA 5E7OB 4L74A 2DNGA 3KLIA 3CUNA 2XMWA 1S9GA 3GYXB 4XPEA 2Z2LA 3I82A 4UF4A 3U1NA 2IC3A 4QWAA 2G0IA 5EWGA 1YRUA 4UY8T 3HD1A 4NRUA 3NY0A 4DCOB 5KFJA 2HNYB 3CT9A 3M8QB 5CABA 3TUIC 3QFWA 5KOWA 2HQIA 1RCOB 2A1BA 5SUHA 4HI1A 3KHRA 4MMOA 2FUG9 3N6MA 3VGSA 1WTFA 1XMBA 2G0JA 2EW9A 1GH8A 1GTHA 3J81U 4ZVTB 5L1KA 2YKMA 4KQZA 2EFQA 3QYYA 3KUHA 2YH1A 1HI8A 1KN6A 4B02A 1QJHA 1FKAF 3LALA 1TVRB 5GAGI 2FGCA 2KFZA 1FX4A 1IBKF 2VD3A 1RZMA 2CPDA 3CJTA 3D5MA 4FF1A 1TFYA 3CJKB 3CCRS 3BGFA 4NCBA 2HWHA 2YKPA 3Q2TC 4JP8A 3W60A 3RB3A 2FY1A 4NLYA 3R7SB 1SJFA 4YY3J 1B7YB 2KFNA 2V8DA 2WOMA 2F8EX 5FLXU 5KAKA 4UOHA 2BYCA 1VISA 2CQCA 3CC7S 5E3AA 5EDWA 3O1LA 4WTOB 2DGOA 3LP0A 4JV0A 3KK2B 1RLCL 3LW5C 1MLAA 1Q8BA 3MD3A 1ZH5A 4EO6A 2E7XA 2RS8A 3FFIB 1IKVA 2BX6A 1N36F 4NLPA 1RWOB 1WC1A 4Y00A 2R2TA 3UW1A 2Y8WA 2H1YA 1VRQC 3FK4A 2Q3PA 3OV7A 1T95A 1I94F 2FZKB 5IFMA 2I9SA 2KB2A 2UU9J 5HJXA 4CTAA 3TEGA 2XMJA 3ETOA 1E6VB 3AOBA 1NEEA 4GC7A 2VG6A 1UPMB 2J7KA 1HIYA 2C42A 4CM2A 5GAHI 4LSLB 4P6QA 4G1QB 4LT6A 1K44A 3HJVA 3IWXA 5F8MA 3EGZA 4EWTA 1CBKA 3MM8B 4OI4A 4ED5A 2FZCB 3MURP 3G8SA 2HHVA 4LBHA 5KFSA 1U8SA 4DV0F 4WE1B 4AD6A 3KG1A 4NEZA 5F0WA 4DSJA 3OTDA 5DDOC 3RW6A 2EG2A 2OELA 4F4KA 4DQPA 1U26A 1VYAA 1MU2B 2GHVC 5F8NA 2D3O1 1UA0A 3E2EA 3KDOA 1BQMB 1PBUA 1T05A 4WK1A 4MAKA 1RABB 1HARA 4NMXA 2DGXA 5AE3A 3TJAA 3GONA 3D4JA 2VIHA 1NJYA 1L3VA 3W64A 4KPYA 2QEXS 2VFUA 1VQ9S 1X0PA 2FLOA 3OUYA 2XLKA 1DTQB 4WXOA 2E9ZA 2QLFB 4ZVQB 3BH7B 2Q1LA 5C24B 2VPYB 3QIPB 2R7WA 3W5YA 2J9EA 2DR7A 3TEHB 1FERA 1Y5NB 5FDLB 3ISZA 3DLEA 4Q44A 3M9NB 5EGYA 5CYQB 2YQ1A 4C3LA 3IBWA 3NOCA 1M0SA 4L72B 1JKHA 2RQCA 2DO4A 3MAHA 3J80Y 2YVSA 3CCVS 1QLNA 4ANCA 1VI7A 2FHOB 4CH1A 3DLLQ 3CJ8A 5F41A 2C2ZB 2R2SA 2OPRB 2BOAA 4EUVA 1IBLF 2X1FA 4IQMA 2VA2A 1FTCA 1UP1A 3UDCA 1FESA 5I3PA 3IRXA 3VVTA 2R7VA 2L9WA 2WZ1A 4PR6A 1RQ0A 2K3IA 1TUGB 4HEA9 4NI2B 3PO4A 3MOJB 5K14A 1OS5A 4MTPA 1U2FA 1N36J 2E5GA 4DUYF 3EX7B 2ZC4A 2CPIA 3BSOA 4O44B 1PGZA 3BN4A 2XLIA 4Y2KA 3C2PA 1I94J 4H4KC 4C2MA 5J2PB 4YS2A 4FNHA 1GNKA 3MM9B 4WIQA 4OIXA 3ZNJ1 5F9NA 1UVLA 1UVJA 4JOUA 2HVHA 1GXLA 2DNHA 4DQIA 3POTA 2MQPA 1R8AA 5B0GA 3W1YC 2BE2A 3H2LA 5K8MA 3LA0A 5LMNF 1FDDA 3CCWA 1KRPA 1RK8A 3I5CA 3MMBB 4ZCKA 4X66F 5C42A 1AUSL 1LQ9A 1S1XB 4DV0J 1R0CB 4U96A 3T5LA 3RRGA 3V4MA 1P6TA 4CT9A 1JLCB 4ETXA 2GCFA 5HLFA 2ZDPA 3H42A 3T3FA 4ECQA 2NLWA 4P2SA 1VQMS 2HHPA 1IKXA 3T5KA 4LVNP 5DG8A 2DGUA 2D74B 2FVSA 2IVMA 3EJMA 1M5OC 4B3MF 4DV3F 2G1DA 4EYHB 2V0NA 4DL2A 2MLYA 2W4DA 4QU6A 3R2DJ 5GADI 3PACA 3BO3A 4NEYA 3AT1B 3K5OA 5DG9A 4UQGA 2RB7A 4NWBA 2XMVA 2DNPA 2CPZA 4WWSA 4Q43A 2CG8A 4F3OA 1JJ4A 1U6BA 4X64F 1WEZA 1OO0B 3UNGC 2LDIA 4YDDB 1MSWD 3HMJG 1JNZB 2AV5A 4MH8A 3J81j 3I5AA 4RU2A 4QBUA 2O5DA 4F3QA 4AQYF 3FBEA 2M9KA 2V2ZA 4X65F 3GR1A 3K5PA 2KU7A 3DN9A 2RU9A 3MAAA 3G71S 1HR0F 4B17A 1XIQA 2FLLA 1WI6A 3F44A 1NSQA 2ZDOA 5G4DA 3BN7A 4RW7B 1FRKA 4IG0A 5I42A 1NMEB 1CEZA 3C14B 2A0FB 3GYGA 3CJRA 2MQNA 3GMGA 3M8ZA 3HKWA 4B9UA 3VR1A 3I4HX 4ANEA 4MIWA 2ACMA 1C0UB 1U1QA 5J2NB 2V34A 2MB0B 2IPOB 4X4TA 4M5GA 2Z0GA 4NLDA 2GW8A 3ZZPA 1WNEA 1P1LA 3M30A 2GJIA 3N6NA 2ZZMA 1QY7A 5KTQA 1RT7B 4DUYJ 1TU0B 1SH3A 1GT8A 4RUAA 2QMWA 1TR0A 2QA4S 1SJ1A 4KO0B 1TAUA 4KV8B 4K59A 1X4CA 5DLFA 4F2RA 4ED7A 2HFZA 2BANA 3R5AA 2YX1A 1SL1A 2WW8A 1JMTA 1QSSA 4WZMA 2RKIB 5CYJA 2DIUA 1O8BA 4RKUC 4YUDA 3MCNA 4ALZA 1X4AA 1QSLA 3K0JA 2YWFA 1R8PA 1R8BA 3W9JA 1RAAB 5LMNJ 2GX8A 3H4BA 3B54A 5MAOA 1FE4A 3HKZD 4PXBA 2XB2D 3MM7B 2G0CA 4X66J 4IFYA 2EK1A 3EXCX 4I7FA 5IQQA 4HYKA 4IG3B 4KE5A 2PGCA 4F36A 3SZ2A 3PYDA 1T9UA 1IWAA 2HFSA 4RBTA 1R3NA 1URNA 2IHR1 3QBCA 1FHTA 3MEDA 4C11A 2UXBF 2UVWA 1B0TA 3IWNC 3VAHA 5KG2A 1AFJA 4BCAA 1SPBP 3C6UB 2NXEA 3A1YG 2IRYA 2B8PA 4K4VA 4B3MJ 1Y4ZB 4DV3J 2CZ4A 2FJAB 4LRFA 1Y0HA 4DV2J 1FVQA 4LUBA 1NO8A 3ZZTA 3PHEA 4GVLA 5A8RB 1F0XA 3CIMA 4X62F 1N34F 4FYVB 4DR6F 4C98A 1Q79A 4UOGA 3OXLA 2AJ1A 1RT1B 2R7OA 4RW6B 4I6AA 1U1OA 3MCOA 1G3OA 3CMES 4U8VA 3LTOA 2ZKTA 1EETA 1UEUA 5DDRC 3TJ8A 1S4EA 4D3HA 3OSNA 4ILRA 4X64J 1V9OA 3FEZA 4GC6A 1YZ6A 2VQFF 1VQ4S 3ZXWA 2KM8B 2J6SA 2RIJA 3BSCA 1JLAB 2FVQA 4AQYJ 4ZITA 1S0OA 3D67A 4I2PB 4X65J 1XWLA 4HHHA 3MEKA 2OPQB 4ENOA 3GFXA 1JLBB 3OL7A 3F73A 5HMXA 2YBVA 1HR0J 4WF9Q 1MN9A 2A3JA 2B6AB 2LA6A 1B70B 4UW2A 4M5DB 4A8SA 3T1HF 2F63A 3P5BP 2NREA 2B5JA 3G9CA 1YJVA 1QUVA 3D68A 4U67Q 4HVZA 1YQHA 4JI7J 2IJNA 3CMAS 4RX6A 2FQQB 4UUWA 1CULA 2NPFA 1QVGR 3BO2A 2CQIA 3R5BA 4HTJA 2M0GB 1WOOA 3TVKA 2OI2A 1J2VA 2W9CB 1I51B 1IQZA 1EARA 2Y0SD 3NG8A 4WZQA 3ILOA 1TL5A 2R42A 2BUNA 3PRBA 5HROA 2IRXA 3GIKA 4USHA 5KFIA 4FVMA 5KFWA 1ZBTA 1T3OA 4DX5A 3LGNA 4Q0BB 1U0HB 5IOLA 4E2FB 1WG4A 4O0IA 3RTVA 3HPOA 2F8MA 4Y2MA 4Q8EA 1KLMA 3ZTQA 1RTIA 5L1LA 3D6HB 4A46A 3DYAA 1CC7A 4W92B 4A8MP 2IFXA 2CPEA 1RACB 1S0MA 3MZIA 2ROPA 1S6PA 2ZC3A 1ZAVA 4EBCA 1Z1ZA 1FK9A 5M2PA 4C3MA 3LP1A 2M3DA 2BABA 3A3OB 2CQ2A 4MK8A 1MMNA 1TKTB 4KB7A 2UXBJ 1S97A 5KFRA 2KXHA 2MPUA 5CD4A 5HI7A 3C15B 3K17A 4OJ3A 4K4TA 3GSIA 4ICLB 1GMWD 5JJBA 4XK8C 5KT6A 2EI5A 3P3DA 3L7UA 1LWXA 1YBTA 1MN7A 4X62J 1N34J 2L3MA 1FD2A 3NBPB 4NLQA 2JVOA 4DR6J 2HMIA 4DSEA 4DEZA 4ZPCA 1ZOTA 3EM1A 3AFGA 1HBUA 1RI7A 2H48B 1M90T 2LFVA 1IKVB 1F5CA 2P2CB 4FVCA 5KFZA 1PYTA 3RAMA 4O3SA 1T03A 2VC0A 2GHPA 3TAMB 1WG1A 4DS4A 1HNWF 4TU9A 3C6TA 4RNOA 2VQFJ 2R8HA 2C1EB 4PWWA 2NZ4A 3BR9A 4NPOA 3KKFA 1CJVA 2JLEA 2BW2A 4L73A 4ECTA 2UXDF 4IRCA 1EP4B 4PQUA 5KG4A 3TUJC 3DRPB 4QR0A 4WYWA 5LM7E 1FNXH 1DRZA 3QSIA 4K4UA 2IYIA 4CLFA 2JC0A 2V2QA 3KYLA 3FDSA 4ECZA 4RZRA 2J9DE 2E7VA 4ZLPA 2P6TA 3T1HJ 2OEJA 1NZAA 1WC0A 2FYXA 1LFPA 5MLCV 1PYSB 1QAXA 1SC6A 4OZ3A 3LUYA 2IY5B 3IS9B 3MPUB 4W90B 1NJZA 4J9LA 3P6YC 1RDRA 2OUGA 3UDLA 1NK9A 4M95A 1S9EB 2DNZA 2QSFA 3FBCA 1GK8A 1Z2LA 2EWHA 3HO1A 4ID5B 3EUNA 4LIWA 3RAXA 1MW7A 1NPRA 4OYIA 2DXEA 1T05B 2E1CA 4A47A 4EZ6A 3B82A 2NUHA 1U1PA 4MFBB 3N9UC 5H9FJ 1F9HA 2OPSB 4ZIVA 2MTLA 3W8PA 5F3ZA 1KQKA 4KGZB 2FLPA 1UCNA 3JTNA 4YB7A 1RJJA 3FRYA 4JV2A 3VGUA 2A18A 2E66A 3Q86A 2AGPA 2IBOA 1U8WA 5GVQA 1HBMB 1RTJB 1FRIA 2FHMA 1SBRA 4KFBB 2JHEA 2ATLA 2UV8G 2FJWA 1H2TZ 4KIAA 2MGZB 5C25A 1FA0A 3OXGA 2UZAA 2D1CA 2OAUA 2YPYA 2HYIB 5BYSA 4UQTA 5C2CA 3PG9A 3FMBA 1UVMA 4QR1A 1T9YA 1RT3A 1HQUB 2HQGA 5E2QA 3MM6A 1WELA 1D8YA 2DRBA 3E8OA 3QGPA 2LYVA 1GFWB 4KSEB 2YX7A 2IM3A 4QQBA 4N76A 2RDJA 5F8JA 1S72S 2FJDB 4ED3A 1W25A 4OHYA 3Q8YA 4U95A 1U1MA 2U2FA 3JSMA 4P73A 1XNQF 2M2BA 4F4AA 3HM9A 2CXEA 2MEWA 4EBDA 4OHVA 3D0GE 4NYOA 4UY85 3B78A 4J37A 2JFDA 3TP2A 4OX9F 1LK7A 1WOSA 2CPFA 2Y3YA 4RUBA 2XQCA 4NLGA 3D28A 3RRHA 1U6ZA 3M32B 4DPWA 2JDJA 3FEYB 3HLUA 5KFKA 2MQLA 2R9LA 5KFOA 1HNWJ 2QFIA 2GC8A 3A8KA 3RR8A 2IRUA 2N7CA 1I1GA 4WP8A 3LH2S 3OR2A 2UXDJ 4N47A 4L3KA 2XO6A 3ZO7A 3K5MA 2C3OA 2X3GA 2VPZB 1YJTA 5LSOA 2HFVA 4MT1A 3LF0A 4PAAA 3KNGA 1TFWA 3SYZA 6AT1B 1NK5A 4OZ1A 2D9OA 3DLJA 5D3GB 3NCQA 5SZTA 3HK2A 1ZTTA 1Y3JA 3G6VA 3Q89A 2VG7A 1HQEA 2ZBRA 1IUJA 3H98A 4O3QA 2VJVA 4C0OC 3J7YI 5K20B 3QT7A 4FPIA 1KNZA 4PG6A 3ICLA 1T9TA 4FYWB 1Q7LB 1VK8A 1PC4A 2UUCF 1AZSA 1UWBA 3D9BA 1FRMA 3M2RB 3PTWA 4PXEA 1UZHA 4TY9A 3VAJA 4FN5A 1FKOA 2R7SA 4DLEA 4AL6A 4M94A 1QAYA 2RJZA 1UVNA 4RWXA 5LXYA 3ZZUA 5BYQA 2ERRA 5JVGQ 2X1BA 4IOBA 2EVZA 2V6AA 3H2UB 3VALA 3ILJA 1JLGA 3V6DA 1RTHA 1ZA1B 4OZLA 2DR8A 1FVSA 3T1YF 1SJRA 3R2CJ 2CQGA 3ZZOA 2DRAA 2RT3A 2CQ1A 4TQRA 3KLGB 3IMQJ 2GMLA 4Q2LA 3TX0A 2HFNA 5KFLA 3MAAB 3H20A 2MKHA 3CCES 4QWBA 1PAEX 3BGRB 1KD1T 4EGLA 1AUDA 3VV2B 2HS0A 3QO9A 3SSSA 3Q23A 3I96A 3KK3A 2J9CA 1U1NA 3VZIA 1S1UA 1RT5B 1RADB 2UVUA 1XNQJ 2WVCA 4LRBA 4OZ2A 4B3OA 3MEGB 3VQSA 1WSVA 3BZQA 4AXIA 2WB4A 3G82B 3KLEA 5G0RA 2CDRB 1LXJA 1V5VA 5ADZA 3G8QA 4OX7A 2K7JA 2AEFA 2CDQA 3DGVA 3HVTA 3OJSA 2IVFB 4WFNQ 3NNCA 3QT8A 2IM2A 2BQ3A 1ZETA 3OXFA 4TY8A 3GCWP 5CA5A 4DHVA 2HHWA 1L5UA 1IKYA 3W9HA 4CRJA 2VKZG 2ZH3A 1TKDA 4DX6A 1Q0NA 1VGYA 4RBVA 4ED6A 2GQCA 2Y9HA 4NLSA 4OHXA 1GXUA 3CJQA 1GMUA 4J9UE 7FD1A 2GO8A 3D0HE 3HZEA 2QMUB 1FDAA 1R31A 1FRJA 5DETA 3W2WA 3IGNA 1W2IA 5FD1A 2QC3A 2CUYA 1WHXA 2VFSA 2HK3A 4YQWA 1X0FA 1VFJA 3MECB 3I0SA 3EGWB 4DZDA 3MMJA 1AYEA 3E01A 3MMAB 4B9LA 4WP3A 3FQLA 1UEKA 4B08A 3V4IA 3EICA 4B9VA 3R9LA 3BBFA 3DFEA 4ATNA 4DX8H 5D0EA 4JV1A 2QL9B 1QE1A 3UI3A 2DBBA 4RR5A 4MIAA 2AYBA 1GMWA 2GV1A 1S57A 3QJJA 2PDAA 2KT5A 2UUCJ 3LOUA 1H2VZ 3BO4A 2Y1LB 1KEKA 1HPZA 3NCPA 5KFTA 1XMOJ 5I4MA 2COLA 1Q81T 4ZP9A 4O0NA 2MZTA 2JRSA 4CDIA 4J90A 3H7HB 3KFWX 4DR1F 4OHWA 3IG1A 2FD2A 3RJMB 2BM1A 5HJYA 2ASYA 3GJRB 3DRYA 1RHUB 1EETB 1WG5A 3D66A 3SBMA 3LANA 1VJQA 1YJ9S 3AY0A 5GMDA 1N8RT 3AXMA 4X4OA 4A8QA 3LGHA 4ZPWR 4L75A 2KG1A 3OQ2A 4DCPB 4OX6A 1LK5A 1X5SA 4LRAA 2C3PA 3BS9A 1S76D 1UPPA 3HVAA 5HSPA 1SUQA 2E1RA 3US5A 3CO0P 2JC1A 2CPJA 3GPAA 4QYZJ 2N4DA 1P27B 4DSFA 2DEJA 2VB6A 3G2XA 2OHDA 2DYAA 4DDFA 3GFYA 2MSTA 4ZCMA 3UNYA 1RWKB 1DLOA 4LSZB 2DNYA 4USUA 3H59A 3ULHA 1OY6A 3UPFA 2K8GA 2HGMA 3VCDA 2XYPB 1GEHA 1EX8A 2PI4A 2XSJA 2FPHX 1NJIT 2FY8A 4OZNA 4CM0A 2B4UA 2EXUA 4ZVGA 5IM0A 3NP5A 3S01A 2IMWP 2BJ9A 4PZVA 4MIBA 1YBUA 3KDNA 1A6LA 4JI8F 4RPFA 4JI3J 4XDDA 5T41A 7AT1B 1BD6A 2IVYA 2EPIA 4MJKA 4ILLA 3HCXA 2VZ9A 3FZ2A 2Q79A 1RUSA 1EB0A 1TKXA 2WVDA 3SXLA 3OL6A 4I2QB 4ES2A 4IRKA 3BBBA 4PXCA 3EPGA 4C7QA 1VBKA 3ITHB 1KSPA 3JQKA 3ADAC 4R8UA 4A4JA 1KLMB 2OTLS 2XCAA 2IA6A 1ROFA 3CDEA 3SFUA 3T5JA 3NS5A 5A0YB 4XAKA 3DLKB 1NSAA 5IT0A 1DARA 2CJKA 1RKIA 4I69A 3DI6B 2YQ0A 1UVKA 1PSDA 1FK9B 1QD1A 1S1VA 3L9ZA 3R5CA 2V8VA 4GKKF 3ISND 2MXYA 3LP1B 3O5TB 4CLWA 3QJLA 3KLHB 1MROB 5DZ6A 4Q5VA 3R7BB 2WVBA 3HFZB 1HHQA 3ZZ0A 1WSRA 4CLPA 1SIZA 4JUZA 4FYYB 5E3PA 1SV5A 2I6WA 3NCRA 3IXQA 3RYLA 1RYSA 2C2NA 2CQ3A 5F3TA 3OSPA 4DR1J 2E44A 3QATA 5IT9U 2NR0A 3PYFA 1SXLA 2AP6A 5HO4A 5B0BA 3OJUA 2QTWA 3GILA 1YSJA 1RTDA 3IAS9 3NGTA 1WD6A 3I5BA 2W9AA 2AJ2A 4NMLA 2W9BA 1JLQB 3NGKA 2CJ9A 1X9MA 1Y00A 1CJUA 3I31A 1TL7B 1S59A 2V68A 3M6VA 4ZA1A 4FS1A 1RT2A 1QTMA 4URGA 4ZCLA 2XCPA 1WTBA 4O4GA 1QDUB 2LU2A 4WU2A 4F0HA 1ZM9A 4PQUB 4H4MB 2CQ0A 1HNIA 2M8DB 3G96A 4AL5A 1RT4B 3H5XA 4GO7X 4GMKA 2I1RA 1U1LA 2KI2A 5E3QA 4I68A 1HYSB 2W4PA 2B4PA 2H5IB 5J1EB 1D1UA 1RWXB 4IQXA 3UQSA 1Q8KA 1V3RA 2O3DA 1C4AA 5H9FK 2LQ5A 2BJEA 2YNFA 4XPCA 2MLXA 1QSYA 5T7LA 1VC6A 2Z4PA 3IBFB 1EZZB 2HNZA 1PCAA 1JLFB 2FJBB 1WC6A 3M1VB 4J9OA 4JI8J 1UTAA 5D4OA 4R0EA 4PPZA 1OYDA 2HVDA 2VG5A 4LF1A 1NB7A 5EHHA 3NLCA 4ZHRA 2E1AA 2V9KA 1E6YB 2LEPA 1HBNB 1T8EA 2LDYA 4OV6A 2ZVIA 2RSQA 5LT5A 4MKYA 1UFKA 1YIJS 1HWIA 2GVDB 3DKDA 3B4MA 1R0AA 2K1RA 1HNVA 1D8ZA 3GE9A 1YG0A 3R3TA 5RUBA 3KOAA 4I67A 3A13A 5KFUA 5A2QU 2FB0A 3A12A 3GCXP 3J7ZT 5L9NA 3J7AN 4J7CA 1Q78A 5LSLA 4O4RA 5C25B 3FRZA 2RHSB 4L3NA 2Z56B 2CQHA 1S6QB 4NYZA 1HI1A 1ELOA 1GXTA 3A8EA 1U0SA 2BJ1A 1HFEL 3CCZA 3PEJA 2N82B 4GKKJ 1YI2S 4RL1A 2PEBA 4C97A 4DI6A 5CH7B 3N28A 4HACB 4YFUA 2MKKA 4DQSA 4YB1P 4DPTA 2W01A 3C19A 1VQSA 4DL6A 3VZHA 4DSLA 1RBAA 2J0XA 1NNDA 3NL0A 3GU0A 3DRSB 1RLDA 3I9ZA 4OQJA 2W8LA 3AJDA 4JV5F 3SQGB 2FHJD 1WJ9A 1IN0A 1ZTWA 2DK2A 1N32F 1FO1A 4P71A 5B7WA 3HVWA 3I87A 5KFVA 1A7GE 3NS7B 3MR6A 1KP6A 3B8HA 2BJ7A 1WORA 4DR4F 1CJTA 2DHHA 3KMQA 4OHZA 2Y1IA 3V81B 1RXOB 1HLWA 2XS7A 2P9EA 2HHQA 4TYBA 3VHQA 1VJWA 4XO0A 3OTEA 2NXNA 3X1LB 4LVOP 4CO4A 5EWEA 3WBZA 3G87A 1UW4A 5KT4A 4K0KJ 2ROGA 3R5JB 1NSKL 3Q0AA 2YWGA 3KUEA 1YVFA 1P8GA 4WFYA 2PFFB 3PFEA 2V2VA 4LSNA 3TVYA 4OYOA 4I4BA 2UUAF 4BBYA 3R1LA 2K06A 2F4VF 3CCTA 3PXGa 2XWYA 2V50A 4QJVA 4HT5A 1WEXA 2J8AA 4HT7A 3FUYA 4IR9A 2ALZA 2ZFHA 1Z2ZA 4EO8A 2V63A 3KJNB 2GHWA 2MHEA 1ZAWA 2LEAA 3VQTA 1U02A 3D3CJ 1PBAA 4C4WA 2YNIB 5DO2A 2QYGA 2HS3A 5DZ7A 2X3DA 2JJ4D 2CPXA 1SKSA 1K73T 4Z7YA 4ETZA 2FC8A 4ELTA 3W5ZA 4DFPA 1KFDA 5KG7A 1B7FA 1Q1KA 4OV1A 2RUSA 4L76A 3UR0A 4QIFA 3PW4A 4ECVA 3W9IA 3OHBA 3W3SA 4WCEQ 3NNHA 3PW2A 3PDNA 4C8OA 3NS6A 1VIOA 1O5JA 4CNZA 3KG0A 3C16A 1BQNA 2PO4A 4G1PA 3FVYA 5B0CA 1H2UX 3HXMA 3W2VA 2APOA 3QLHA 4CNYA 1UZDA 3HHLB 4CP5A 2DPIA 1TUWA 2HRTA 2MHNA 3WIUA 2PMHA 2EBEA 4A48A 2HHSA 3AXKA 2XGPA 4C8YA 4LF6F 1ZM2A 1S1TB 1SQEA 2ZEJA 2A6MA 4DJBA 4DL4A 3KK1B 4CH7A 1PJ7A 4TXSA 1LWCB 2ZH9A 2R4FA 3TQ1A 1G2EA 4AYBD 3BM7A 1WOPA 4FF2A 1AT1B 3CWJA 1B4SA 2VOPA 1YHQS 2GIQA 1NZ8A 2ATCB 3Q22A 1HBOA 5EUHA 1IVZA 4JV5J 3T19A 1VRUA 1N32J 1RU2A 1SC1B 2GVZB 3MOZA 1HKAA 5J2QA 4RNHA 1PYOB 4X4UA 3ZZZA 3MM5B 1HL6A 1BMQB 4M5KA 2I5JA 1OY8A 4TU8A 2DEIA 4FBUA 5ETPA 2KG0A 3OTOF 4FZVA 3LP2A 3BBCA 3OL9A 4PEOA 2HVIA 1IWGA 2I0XA 5DGAA 2HPUA 2BEFA 1ZZFA 2FVPA 3GFZA 3JAMU 1X5OA 3J80U 2DXFA 2VPWB 3UVJA 5GAEU 5D0HA 2IAJA 1G4CA 4YOEA 1RAEB 2XZDB 4NXNF 3P49B 3QIDA 3W2WB 4KTQA 2PT0A 2LP4A 4DG1A 1IKWB 2KZZA 4PRFA 3CF5Q 2DPJA 4RWWA 4KY3A 2UUAJ 2ASLA 3MUVP 2F4VJ 2AT1B 3I0SB 4KYZA 2WBRA 2HZCA 1RGVA 3D7SB 3K89A 2A2CA 3CMQA 5HBMA 2W2NP 4NLOA 4J9MA 2BQUA 3N0VA 1XK8A 1JJ2R 4Y6IA 1NK4A 2ZE2A 1JJHA 5H9EJ 3VVUA 2R8GA 4Y2IA 2KXNB 4ZVSB 1VQOS 1JQGA 4RW8A 1NSPA 3QAUA 1HPZB 3SDEB 1VBYA 3ET6A 1U7LA 3SCKE 4TN2A 4LFAF 2MKJA 3RW7A 2B3TB 1YRXA 1NJXA 1JLEB 2DY1A 1NLKL 3HZGA 1H38A 3R8YA 2V8HA 3GV5B 4B3SJ 3SV4A 4LFCF 2QRRA 3SSRA 4NCGB 2YKNA 3BKFA 1FKPB 5KFAA 4QYZK 1CJKB 1C1CA 1S6OA 2BE9B 4LBPA 1P9YA 1RBOB 3NGRA 1UKUA 2G1HA 3AA8A 1TL3A 1C1BA 5A8KA 3FZBA 4Y2CA 4UOFA 2HHUA 3QMQA 5THWA 1U49A 3DOKA 3BQ0A 4NOHA 5ETOA 5C5JA 2LLZA 2HHHF 2FGOA 2YQ3A 2ABYA 2DGSA 1IBMF 4LF6J 1S77D 1RHRB 1BC6A 5CYMA 2W2PP 4WXWA 1LOUA 2AYEA 4WPAA 1T11A 3M05A 1X4EA 5HVFA 1Y10A 1FF2A 1WHYA 2JZ5A 1T94A 1WDTA 1LW0B 4HHJA 2Z2YB 4B3TJ 2RDDA 4R0JA 2VHGA 2OPPB 4RW9A 1UMJA 3RR7A 2V4JB 2FZGB 1NHUA 2W8KA 1XC9A 1TUVA 3D3BJ 5IM0B 3BSNA 4WU3A 4HL9A 1VRTA 5BR8F 4WP9A 3FNNA 2BJDA 5KFPA 1GAOA 1TL1B 2YNHA 3OTOJ 3DM2A 4OLPA 4PG4A 2XYHB 3D1OA 4QPTA 5ETRA 5KT3A 2FJXA 2ZJQQ 4ITSA 4K4SA 1T7PA 1C0TA 4L6V3 2WSFC 3M9MB 5F0UA 1RWMB 2FC9A 1FFGB 3HHDA 4F25A 1HMVB 2GFFA 3WX8A 1RYRA 4NXNJ 2DNQA 4DPUA 2NXJA 3AJ1A 1RU1A 1Y5IB 1HWUA 3QAEA 3IRWP 2HNYA 2YNGB 5HVGA 3M8QA 2XZTB 2ADCA 3I0RB 5DQHA 3Q8PB 2HZVA 5CD4H 2J7WA 4KKOB 2VFVA 4CZCA 1TV6B 5HN0A 2BRKA 4DV5J 2EFPA 4LF4F 5HAOA 4RU9A 4YR2A 2D69A 2B4OA 3M8YA 2BVZA 3R1HA 1BWVA 1JIHA 3O3LA 3R7NB 2CWXA 1TTHB 1TVRA 3KHHA 2B7CB 1SV5B 1YK9A 4LFAJ 3AB4B 5M2UA 2J7UA 2V8PA 2ZD1B 3TJ9A 2FHJA 3MXHP 4QIVA 1M5HA 3EVMA 3CJKA 4TLRA 4B9NA 3NRBA 1LWEB 4M5LA 3FKBA 3HHNB 1VQ6S 3DLGB 4ZPTR 2DH7A 3SCLE 4LFCJ 1RP5A 2HBQB 3CSKA 3AJ2A 1YGYA 2PN6A 3IN5A 4Z2XA 2W9BB 4DV7F 1S48A 2N3OA 1I5OB 5J1NA 3ILLA 4DXLA 2X51A 5DDPC 1S1WB 4DCJB 1VQKS 2HLUA 3KK2A 2J8SA 5B0EA 1LKZA 1R7IA 1Q16B 3R5DA 2CJXB 3MR2A 4IFVB 3O8WA 1APSA 3TAQA 3UWTA 3U1MA 1CG2A 2E1MC 2HAIA 2HKEA 3FFIA 3MDFA 2HHHJ 4I64A 2DTJA 2Q6CA 2O67A 4J9VA 1IBMJ 3F56A 1X4FA 3M6UA 1UVIA 2ZOMA 3GYNA 1LEOA 2XS5A 2MQQA 1LW2B 1NDKA 3NMAA 4OJGA 4YHHF 1E6VA 3TA1A 3T6JA 3RGIA 3W62A 3MWBA 2YNFB 4FBTA 4LF8F 4ZP8A 4NX9A 4K5SA 1IBKJ 5CCLA 1SI9A 2QLBB 4OLOA 1Y7PA 5T7LB 5E0OA 3TUZC 3BGUA 1YDLA 2C28A 4B3RF 3PIOQ 4G1QA 3HSZA 3C3LA 3E3XA 3JAMY 2BR0A 4M5JA 3RRKA 2PC6A 3MM8A 3OL8A 4NZ0A 1HW9A 2DNKA 1HNZF 2VG5B 1N5VA 2VU5A 3EWGA 4WE1A 4PUOB 5KFFA 4ZHRB 4ZS6A 4H4OB 4HHUA 2J6UA 3ZZYA 4KGXB 1ZPVA 3PHTA 2HNDB 4IO9Q 1EJ7L 3CCQS 1VMBA 4KH0B 2XO7A 2OO4A 3CPWR 1MU2A 1H3DA 2J5AA 4LQ9A 5KFDA 3PY8A 2K1RB 1BQMA 1HNVB 2R7XA 3CE8A 5AE2A 5I3UB 2DHSA 3KJVB 1MWZA 3V6JA 1KR4A 2CADA 1TK8A 4Q8FA 3CDUA 4ZVUB 1NBEB 5A8WA 4DU7A 4H54A 3CJ3A 2K7KA 3TR5A 4OYAA 2OMOA 3D1HA 3EVWA 4NLRA 2KT3A 4Y0FA 4LF4J 3GIMA 3NGDA 3K59A 2AQ4A 5C24A 5KG6A 3QIPA 2XY7A 1LFWA 3BDPA 1AROP 4BWJA 5DDQC 4A8WA 2ZJPQ 2EKYA 2QGFB 5FDLA 2AJFE 1CSJA 5IQ6A 2BJ3A 4ZIWA 3IFEA 2CQ4A 4YEAA 4NLWA 4ANDA 3R6LB 1R0BG 4CO5A 2D7SA 3PRDA 3LWMA 3RB4A 1HHTP 4NA2A 5DQIA 4IH5A 3HJFA 3QJPA 2AKWB 3IC1A 2IJFA 2VV5A 3V6KA 2BV3A 5KFHA 2OPRA 4X2BA 4DV7J 4X4PA 2UP1A 4A8YA 4F4WA 3ZZRA 3W5XA 2SXLA 3KNAA 1F3VA 5L1JA 1ZM3A 3HDSA 2KVIA 2BDPA 3FBBA 4KH1B 5E3RA 2Y1RI 4DV6F 1SQGA 3R97A 3L95X 4TKTA 2KJWA 5E33A 3IGVA 4NI2A 1NCLA 2RH3A 2ZITA 2AD9A 2BQRA 2B8QA 3EVOA 3THVA 4CO1A 1XMQF 2QZ8A 5AE1A 2ZBCA 1DAXA 1KKHA 3LAKA 1AA1B 1AFIA 4WTYA 5IXUA 4HR2A 5J2PA 4YHHJ 4RLEA 1SJQA 1PJ5A 3FMWA 1ZYQA 4LF8J 3M4XA 4NZ7A 1ZPWX 5A76A 1UL3A 4LR7A 4LBIA 3MHYA 1J5OB 2R3VA 2JWNA 1MWQA 2CJBA 3MMBA 3SQOP 2ZH4A 4OI3A 3VWSA 1HNZJ 1S1XA 4USIA 3MTKA 2MQOA 4ZP6A 1VC0A 3MEEB 5D8HB 1CQMA 5IV3A 2XMKA 1IBLJ 3TOQA 1PO6A 1EAYC 4CLZA 1WI8A 4NASA 4ZCIA 3EXYA 1JLCA 4LJMA 1T9XA 5C2GA 3O2IA 2YXLA 4FXVA 4K4XA 1QTNB 5HP1B 1F9FA 1WUUA 1RAOA 4R5PB 2EFOA 1IBCB 2LEBA 1BQNB 3WZ0A 2XLJA 2LXIA 4ELVA 1KOOA 2CZVC 2QA1A 2PSZA 3QZ7A 1HQ2A 4A8KA 2KYXA 1FT8A 2RILA 3FEXB 2YY3A 3CD6S 2AZ1A 2DGVA 3H0PA 1U1RA 4C9DA 3UO0A 2HSEB 4UZBA 3JS9A 3THTA 1M5VC 4PWDB 3AOAA 3BPSP 2HVEA 4GO5X 2QLXA 2GA7A 4QIWD 2J0WA 2CYYA 3M9OB 2RF2B 3CIZA 3H25A 3NAHA 3BKTA 2PMZD 2F9DA 4DQRA 3KHLA 2QO3A 3DCAA 2YWWA 4PABA 2HRUA 3N6LA 4DPYA 4LREA 4RW7A 4JYAF 1O0PA 4EZ9A 2EFGA 3MF5A 3M8WA 4PKDB 3HF5A 4DFKA 1F6TA 2I5JB 3Q8QB 3DOLB 2L9NA 5AXLA 1DQ8A 2AZ3A 2KN4A 4U7UD 1KOHA 3OW2R 1DTTB 2V4QA 2MKSA 1MG7A 4J9NA 3UD5A 1IM6A 3M2UB 3T41A 3KJFB 3OR1B 4ZDNA 4ZN1A 3M8PA 3J7Z5 4Q7AA 3J7A1 1C0UA 3QGHA 5HVHA 5J2NA 3WDOA 3W8GA 2OSQA 3KXDA 5LMUF 3LWLA 2HIYA 3JTPA 3O44A 3ZC4A 1RT7A 2V94A 1XMQJ 4Y2AA 3G86A 4JI4F 3EYZA 1H98A 5LXRA 5H9EK 3O6QA 4KV8A 2DH8A 4ECYA 3NGUA 1RT6B 5EX3A 3S6EA 1UETA 2Q43A 2CWKA 3THPA 5GMKa 3TZYA 2MSSA 2V69A 4ZP7A 3M2VB 4IDKA 4WIIA 4RUHA 2F8HA 2YPZA 3OLBA 2JX2A 4OL8A 4TQSA 3HT0A 5K8OA 2LQJA 2WHOA 3K58A 1HW8A 2BKPA 1M1HA 1SKRA 2HBRB 3DOMB 1N5YB 1FJCA 4YB6A 4DOZA 1OJ4A 3QNWB 2RRAA 4P75A 3MM7A 2QE5A 2G13A 4IG3A 4I0WA 2M88A 3Q2SC 2Y0BB 2F9JA 1SL2A 1WKLA 4WFZA 1P1TA 2GGPB 2GAHC 4MKBA 2DVIA 1H73A 3KMSA 1N6QB 1URRA 2VASA 1N88A 1JK9B 4NRTA 1K0TA 3K2YA 5AT1B 2RMLA 3C6UA 3S8SA 1FJ7A 4EBEA 3KLIB 1RWVB 2WBMA 1S9GB 2OP5A 4DZ6A 1NK7A 1L3KA 4CLYA 1Q8IA 3C46A 3I55S 2IC3B 5HQ8A 2DY9A 4RNMA 3AQPA 1X4GA 4ZJLA 2WVEA 5A8RA 3M6WA 4ER8A 1RHKB 4UT4A 4RW6A 2QYCA 3NNAA 2F1FA 3RB6A 3DOKB 2A10A 4K7QA 1SC3B 1CLFA 4M5MA 2YWKA 2QV6A 3V2UC 4ES3A 4CWBA 3NOGA 3CD7A 4DSKA 3FQKA 3SSQA 1CC8A 3P4UB 2RRBA 4JBCA 2C3UA 1U25A 2H4YB 1B0VA 3KTQA 1NKBA 2YKMB 3CJ5A 1JLAA 4IKAA 3LPEA 1M1GA 2HIQA 5L38A 4I2PA 1VQPS 1Y9OA 5L8RC 1FI4A 3DLBA 1Q5YA 1TAQA 5D4NA 1T0TV 2OPQA 1U1KA 2W2OP 4HH0A 2OEKA 3EZ5A 1VK3A 2DB1A 2ZHBA 3KHGA 2CFXA 4RW9B 1VCTA 2ZH8A 1S6UA 3MCMA 5DM7Q 2B6AA 5DS7A 5ETMA 5DJBA 2GJFA 1T3NA 2HFOA 1VLOA 4CYUA 4M5DA 3PW5A 3TW0A 2AIRB 3ZFVA 4ZKAA 5D4PA 2D3UA 1I3OB 2CQBA 5EWFA 2DHAA 1BQXA 2WOMB 2ZWOA 4F4XA 3T9ZA 2ZJRQ 4A8OA 4ZVFA 4OMFG 4FP9A 1C0TB 3P5TL 1V6HA 1FNMA 2OEMA 2DR5A 5KT7A 1WDDA 1U45A 3D54A 5LMUJ 2JEJA 8ATCB 4C8NA 3LP0B 3QT5A 2W9CA 3CC4S 3RBDA 4JI4J 5CCMA 2VJUA 2IJRA 4U6PA 4OYZA 3HVRA 2G2ZA 2CNNB 1IR0A 2KH9A 1SL0A 4OYWA 1IJFB 2AX1A 4WFBQ 2YKAA 2RD5C 3VGTA 1W2BR 2Z30B 2V2KA 2CZ9A 4Q0BA 1NU4A 4NZ6A 4DQQA 3MPYA 1U0HA 2DRDA 2ZNYA 4EFAC 3U1LA 4CTAB 4FDFA 2VG6B 4ZPVR 1YJ7A 2B51A 2GNKA 2QA4G 4ECWA 3CCMS 1KS2A 1C2PA 1IR1A 4B9TA 1FXLA 3CO9A 2ZBIA 3PYGA 4M63A 4AFFA 2H51B 1F5BA 2YWEA 2HURA 3H8YA 3GJQB 3CD0A 3LO3A 1V3SA 5KG5A 1TKTA 3NXZA 4YDXA 3GV7B 2BOPA 4PG8A 2XMTA 1DFDA 3G6ES 1VQ8S 2HK2A 1WF0A 2RNEA 2ZH5A 2CQPA 3C15A 4HTIA 2LU1A 4ICLA 5HQLA 1KVJA 4DPXA 4LR9A 1FCAA 3D6MB 2XYGB 2PMWA 5KT5A 1DBDA 4RO0A 3UDEA 1WC4A 3NBPA 1UA1A 3H5UA 2ZUGA 1AXQA 2HZAA 2P9GA 2QL7B 5L1IA 3VTIA 2YX4A 1N5QA 1PG5B 4I6YA 5CAAA 4QWEA 4IH7A 3AD8C 4FYDA 4PCQA 2ZZNA 2MLZA 1VIXA 1EQ0A 2EC2A 5D0GA 3TAMA 2XULA 3OUYB 3N5BA 1Q5VA 4A8FA 3TANA 4CLLA 1SJ3P 4N5SA 1OSCA 2AW0A 5ETTA 3TNVA 1EP4A 4KGVB 2XMUA 3LGMA 4IH6A 3DRPA 5KT2A 1UEVA 3PKMA 1N48A 3RU0A 5U47A 4X4NA 2YH0A 1NM2A 3DLEB 2UXCF 3BREA 5CHCB 3DDNA 4PPDA 1S99A 3G6XA 1JKHB 1X4HA 4KR0B 1S0VA 3W63A 1XNRF 5E41A 4HDHA 4AUKA 3DHXA 4DUZF 2JEIA 3HX9A 2QSWA 2OD6A 1RA6A 2XI3A 1TKZA 2LXUA 2AJ0A 3IS9A 3OHAA 3NMRA 4V19J 4AXJA 2NQPA 3GFHA 2ADBA 3IRXB 1S9EA 2BJ8A 3WQPA 2XMAA 4ID5A 3ELHA 1D09B 1XR6A 3VAKA 1HD0A 3W61A 4TYAA 3TRGA 4F67A 2W1BA 2LCWA 1ZZNA 5K14B 1ZAXA 4MFBA 3GQCA 3OLAA 2J0QD 1KQFB 2OPSA 1XEZA 3MPWA 5KFEA 1O6XA 1U47A 4HKQA 5A8WB 3M6XA 2R8JA 2ZM6F 1VOMA 3NAIA 3QGIA 2IM1A 3DHWC 1REVA 1U2CA 3ZTSA 4YR0A 3DXSX 2O01C 4MYTA 3Q8RB 1HBMA 1RTJA 1WHVA 4KFBA 3CCSS 4C8LA 4EI2A 1X9WA 3UN3A 1OY9A 3L4BC 3POTB 2MGZA 3D6TB 3UD4P 5F9LA 3B6BA 2BE2B 2BKOA 4DWIA 1F2HA 1F1BB 3CJ0A 4PG5A 2KFYA 2LQBA 1FX2A 2ALYB 1HQUA 2XZWA 5E3CA 3HHLC 4P10A 1NH8A 1BY9A 5C42B 3HHKA 2QIFA 5IC4B 2OFHX 2IIHA 3I9V9 1FRLA 3AH6A 4TLQA 1VBZA 3SFGA 4WFAQ 4ED1A 1BLUA 5ETNA 2J6TA 5HLFB 5JVHQ 3H40A 1IKXB 2HEKA 2DNLA 5CZVA 2V8GA 3SV3A 3EZOA 5IV4A 2H4WB 2LQ8A 4IR1A 3VAIA 1ICEB 2WK4A 3M32A 8AT1B 1HHSA 2Z58B 2H5JB 2B43A 1WC5A 3CJ2A 2N3LA 5IWAF 1VQNS 3HT3A 2U1AA 5IS2A 2R8KA 4OYPA 4Y65A 1X60A 4BDPA 4HDGA 3OT9A 3CDWA 4NCAA 5HMWA 3GWCA 4U9RA 4F26A 3ILIA 2VOOA 1GQEA 4QCLA 1WWHA 3PZPA 4LRDA 2UXCJ 1TQLA 5D3GA 1HA1A 2HLTA 1TK0A 1XNRJ 3L09A 3K7RA 3FGVA 4DUZJ 2RQMA 2FHKA 3VAMA 4USWA 1VQLS 5ITHA 4ZVPB 5GAGU 4K4YA 2NCKL 1YJWS 3UN5A 3PX6A 1NDPA 4URQU 4IG0B 2I38A 5I42B 3QZ8A 5FIIA 2HHXA 3HP6A 2EBGA 3L7PA 2KYZA 2FJVA 4OX9J 3VGVA 1NRKA 3IM8A 2DKOB 4KHPF 2HQ3A 4DMZA 1SIWB 4P9SA 1SB6A 2MQMA 2AU0A 3U27A 3M2RA 4DV2F 3M30B 4Z37A 2HQFA 1U6FA 2IDEA 3J81Y 4KJIA 3AHPA 1JWWA 3GV8B 4H4KA 2LECA 3I6PA 2ZM6J 1SC4B 1TK5A 2KHDA 2ZOFA 2GIFA 5IT4A 2KJVA 1KBRA 2W7OA 2BANB 3ZNUA 2M52A 4GVBA 2AEMA 2W2QP 2HBZB 4N8OA 3AD7C 4G3IA 2XI2A 4FS2A 3F0NA 3CCLS 4C48A 3HSJA 2C2DA 5M2RA 3Q8SB 2M5YA 5F8HA 3CULA 4NLVA 1B3TA 3WC0A 5F8GA 1FXRA 2VFRA 3KLGA 4FXDA 2ZBQA 5FLXY 1RCXB 2XNRA 1YBAA 2HBYB 3P96A 4IFYB 5KG3A 4I7FB 1FDBA 3BGRA 4USMA 3P8BB 3N5FA 4P7TA 4J9SA 4RW4A 5GAHU 1NPKA 1MMDA 4E8UA 3MEDB 1RT5A 4C11B 2HWIA 3H5YA 3Q24A 2QMXA 4ED8A 3BYRA 3MEGA 2QN6B 1X31C 3U02A 3BV8A 4F0KA 2EK6A 3G82A 2XNQA 4LIRA 4C0HA 1WKKA 4JI7F 4NL5A 3M8PB 4K50A 4LMZA 1U09A 5D6GA 2XMMA 4ED4A 3HSGA 2H5EA 2N4CA 1H7XA 2VBXA 2W7PA 4AT1B 3PEHA 2DJWA 3PRVA 4BWMA 2MY8A 5IWAJ 3DGPA 1SCJB 1YZ7A 2NUUG 1H7WA 3MPDA 4UTGA 2OFGX 1SKWA 9RUBA 2EEYA 2CQDA 4KAIA 1F3FA 1R89A 2QFJA 4ED2A 1GX6A 1S7HA 5J2MA 2XWXA 3T1YJ 2ZVSA 2NS1B 4IDKB 2B7BB 4O23A 3JB9k 2F65A 1W7WA 1X8DA 3VAGA 3OVSA 2DO0A 1YTYA 3KJQB 2D41A 5B0DA 1XJWB 2WB1D 3MECA 3D1QA 3I56S 1LWFA 1KFSA 3ENAA 3MMAA 3RG6A 4UUXA 5J1PA 3P45B 3HULA 4JI5F 2DHGA 1NDCA 2B5JB 4TNOA 4F4ZA 1B99A 4DF4A 2IMOA 4ZLLA 3TZWA 1BGXT 2LMIA 1A9NB 3MR5A 1S7IA 4QOTA 4KHPJ 3EMTA 1CULB 1KQGB 3PNIA 1R6YA 4DU8A 3QPIA 1KVIA 2DHXA 2EFVA 2XM3A 4DFMA 4Y28C 1NHKL 2E29A 1F2GA 3RBZA 1NDLA 5HROB 4U7UK 1EKRA 3JSBA 2I8EA 4C8ZA 1NHVA 4DUTA 2M70A 1RWPB 1MWYA 4FYXB 3MMCA 4Y34A 3PM9A 3PX4A 1CS4A 1EQMA 2MMYA 1K47A 5BJRA 4X4VA 2KDOA 4MKAA 3NWGA 1RTIB 4O3PA 3DYAB 2DNNA 2K3KA 4E98A 3HHLD 1VLYA 5C7PA 3RBXA 1HI0P 2C2OB 5ETKA 1S6PB 2ACYA 5LSRA 2NYHA 1OQ3A 1R8HA 3LQVA 4DSIA 4JI0F 4CYUB 9ATCB 3NWRA 1OSDA 3NEKA 4NLTA 2CKWA 2FDNA 4F8RA 3GG0A 3IO1A 3BH6B 4EU0A 3HI9A 3QQCD 1NPPA 1O51A 2MDAA 3UCGA 1S9FA 3IM9A 2DIVA 3CVKA 1GTEA 1RAJA 1FXDA 1XERA 2HMIB 2IBKA 2EKNA 2YKQA 2O66A 1HBUB 2PA3A 3CXCR 3SMZA 3OBIA 3DRXA 2GMJA 1Q95G 2NPIA 3FCVA 3MCSA 1K1SA 2QLWA 1OMSA 2VDIA 2JL9A 1T03B 5GADU 2JOQA 3JYTA 1D0EA 3C6TB 1XR5A 2VC1A 5DLGA 4I2QA 4XIUA 2NSBA 3ITHA 1DZ5A 4U8YA 1CJVB 3AODA 3N4WA 2IA0A 4OJHA 5HL7Q 1RA7A 2DR9A 2ASDA 3WIVA 2XEXA 2OLWA 2DH9A 5A0YA 5H1SV 1L3SA 2H9ZA 3DLKA 2BE7D 4F2SA 3M8SA 2ZZTA 4M8LA
chains in the Genus database with same CATH topology
1AROP 2UU9F 3H20A 4RNFA 3DI6A 2MKHA 4F3MA 3CCES 4QWBA 3BGRB 4ES1A 4BWJA 5DDQC 4DV5F 2X1GA 3BQ1A 5L9XA 1Q4RA 4EGLA 4A8WA 1KD1T 1AUDA 2ZJPQ 5JUMA 2HS0A 3QO9A 2MKIA 2EKYA 2L48A 4WJBA 3SSSA 4QWDA 5FDLA 1JLBA 3Q23A 2AJFE 2J9DA 3I96A 3MI7X 2Y1JA 3DOMA 1N5YA 1CSJA 1NAQA 3KK3A 2J9CA 5IQ6A 1U1NA 3BR8A 3KLHA 3IFEA 3VZIA 1S1UA 2J76E 1YJNS 2CQ4A 1MROA 4K2XA 3G8TA 4YEAA 1RT5B 1HWLA 5KFYA 2UVUA 2DGWA 4NLWA 1QAIA 2MZRA 2A2DA 4CO5A 4B3OA 2D7SA 3PRDA 3MEGB 3VQSA 3LWMA 4I56A 4ELUA 3RB4A 3BZQA 1VRTB 2B0GA 2WB4A 4G1IA 4AXIA 4C0BA 4DLGA 1HHTP 4NA2A 5DQIA 4IH5A 2KZMA 2GGPA 3HJFA 3QJPA 1HWJA 3KLEA 1UJ4A 2P9CA 5G0RA 2BRLA 2YNHB 4HI2A 3DM2B 1LXJA 3IC1A 2BACA 1Y3KA 2R7QA 2IJFA 3TYTA 5ADZA 3G8QA 2VV5A 3IR7B 3CEDA 3CJ4A 5D77A 4DR5F 3V6KA 4OX7A 1S49A 2BV3A 2K7JA 3KG4A 5KFHA 5A2QY 2GIRA 1KHVA 2I2YA 1N6QA 2OPRA 5CZXA 4EYIB 4X2BA 1K8AT 2CDQA 4X4PA 2UP1A 1FD8A 3KLVA 2RVJA 1BWEA 2C2RA 4A8YA 1U48A 3HVTA 1R8CA 2FJEB 3ZZRA 4DBQA 3OJSA 4F4WA 5E7OB 2IVFB 2SXLA 3KNAA 4WFNQ 3G6YA 5L1JA 2DNGA 3NNCA 1ZM3A 2B9YA 3HDSA 3KLIA 4CQ1A 3CUNA 2IM2A 2XMWA 3GIJA 2BQ3A 1S9GA 3UFCX 1ZETA 2KVIA 3OXFA 3AA9A 3GYXB 2BDPA 4XPEA 4N8NA 3G4SS 4TY8A 5CA5A 2Z2LA 4RNNA 4DHVA 5E3RA 2Y1RI 2HHWA 2RS2A 3I82A 1L5UA 1IKYA 3U1NA 2IC3A 5GAEI 4QWAA 4DV6F 3L95X 4TKTA 3M8RA 1YITS 5EWGA 2W24A 2VKZG 3RBEA 2ZH3A 2KJWA 1TKDA 3JSYA 5E33A 3IGVA 3QGGA 4WK3A 2HS4A 1VGYA 2RH3A 1YRUA 1ZM4A 2ZITA 2UV8A 4RBVA 1JLQA 4ED6A 4OI1A 2GQCA 2AD9A 2BQRA 2VUGA 4UY8T 1TP7A 4NLSA 1N4LA 4BC9A 1VQYA 4OHXA 1GXUA 4NRUA 3FSIA 5KFJA 3THVA 6FDRA 4CO1A 2HNYB 7FD1A 1XMQF 4MK7A 2QZ8A 3CT9A 2GO8A 3M8QB 5AE1A 2ZBCA 3TUIC 2Z2MA 3D0HE 3HZEA 1DAXA 5KOWA 1B0PA 1FDAA 2MZSA 1R31A 2HQIA 1FRJA 2A1BA 5DETA 5SUHA 1TL4A 4HI1A 4NA3A 3LAKA 3KHRA 3W2WA 5LJ3Y 4H4MA 1AFIA 3IGNA 4MMOA 4WTYA 1W2IA 2FUG9 5IXUA 5FD1A 3N6MA 2HW3A 1WTFA 1XMBA 3WX4A 5J2PA 4BC7A 2EW9A 4RLEA 1GH8A 1GTHA 3TA0A 1SJQA 1RT4A 1WHXA 2VFSA 5L1KA 3FMWA 4YQWA 2VKRA 2YKMA 1ZYQA 1X0FA 1VFJA 1RT3B 5KFMA 3MECB 4KQZA 1WF1A 2EFQA 3QYYA 3I0SA 3MM6B 2DITA 3EGWB 2YH1A 3MMJA 1HYSA 1HI8A 3M4XA 3E01A 3MMAB 3RAQA 1N54B 1KN6A 4NZ7A 5J1EA 1ZPWX 4B9LA 3CDBA 3FQLA 3FSXA 4B08A 4QW9A 1UL3A 1YRTA 4B02A 1QJHA 1FKAF 3LALA 4CIOA 3MHYA 1TVRB 5GAGI 2FGCA 3V4IA 3GSDA 1J5EF 4B9VA 1IBKF 2KFZA 3KLFA 1J5OB 2VD3A 3DFEA 1M1KT 2JWNA 4IYQA 4ATNA 4DX8H 4JV1A 1TKZB 2CPDA 3PW7A 2CJBA 1QE1A 3MMBA 3D5MA 4FF1A 2HWTA 2WAQD 3UI3A 2ZH4A 2DBBA 4OI3A 3VWSA 1S1XA 3JSMB 1TFYA 2GMHA 4MIAA 1LXNA 3CJKB 3CCRS 2RDIA 2EFNA 3BGFA 2GV1A 2HWHA 2AYBA 4NCBA 2YKPA 3Q2TC 4USIA 3MTKA 4WKYA 3RB3A 3QJJA 2FY1A 4NLYA 2MQOA 2FVRA 2PDAA 2KT5A 3LOUA 1H2VZ 4ZP6A 1VC0A 3MEEB 5D8HB 2CVEA 3BO4A 1SJFA 1CQMA 2XMKA 1KEKA 2E9RX 2KFNA 3IA0A 3TOQA 1PO6A 2HG4A 1JLFA 1HPZA 2V8DA 3NCPA 1WI8A 4QZVB 2WOMA 2F8EX 5KFTA 5I4MA 2COLA 1Q81T 4ZP9A 2MZ1A 2MZTA 2JRSA 4ZCIA 5KAKA 3M1VA 1F5AA 3EXYA 1JLCA 3KFWX 2BYCA 2AJ4A 4LJMA 3GR0A 2CQCA 3CC7S 3O2IA 5E3AA 5EDWA 4DR1F 4OHWA 3IG1A 3O1LA 2FD2A 1E6YA 4FXVA 4K4XA 1HBNA 2BM1A 1S79A 2K2PA 1F9FA 5HP1B 4K4ZA 2DGOA 2XY5A 2PD1A 2ASYA 1Y5LB 4R5PB 3LP0A 4JV0A 3DRYA 3KK2B 4OI6A 2EFOA 2CG4A 1EETB 1WG5A 3LW5C 2LEBA 1G6BA 1BQNB 3LANA 3WZ0A 1Q8BA 3MD3A 1YJ9S 3AY0A 4PWUA 2XLJA 2LXIA 3MD1A 4ELVA 4OZ5A 1KOOA 1ZH5A 1REVB 2NYIA 4EO6A 1N8RT 4X4OA 3OR2B 2RS8A 2CZVC 2E7XA 3FFIB 1IKVA 2E5HA 2QA1A 4URSA 3K5NA 4A8QA 1VS3A 1YJRA 2PSZA 3OFHA 4PXDA 4ZPWR 4NLPA 3QZ7A 4DL3A 3BSAA 1N36F 3N79A 4Y00A 2R2TA 2KG1A 3OQ2A 3UW1A 4A8KA 4OX6A 1LK5A 2KYXA 1FT8A 1X5SA 4K4WA 2Q3PA 2RILA 3FEXB 3OV7A 1T95A 2C3PA 2W25A 2YY3A 3CD6S 4DV4F 1I94F 3BS9A 2VL1A 1S76D 1S6QA 3HVAA 1NKEA 1SUQA 5IFMA 2DGVA 2I9SA 2KB2A 1U1RA 2RQKA 4C9DA 2E1RA 3US5A 4CTAA 2XMJA 2JC1A 2CPJA 3ETOA 1E6VB 3THTA 1M5VC 4PWDB 4QYZJ 5KOXA 2RRNA 1NEEA 2N4DA 4GC7A 3PV8A 3CGIA 1P27B 4DSFA 3PR4A 2VG6A 2J7KA 2VB6A 2E5LF 2WSEC 4GO5X 2QLXA 4DDFA 1CPZA 2C42A 2GA7A 2VG7B 4QIWD 3GFYA 1HQEB 2J0WA 2CYYA 3M9OB 2RF2B 3CIZA 3H25A 2MSTA 4ZCMA 3NAHA 5GAHI 1L3UA 4LSLB 1DLOA 2OH2A 3K57A 1UJ6A 4P6QA 2PMZD 2F9DA 4DQRA 4G1QB 2DNYA 4LT6A 3KHLA 1N0VC 2QO3A 3DCAA 5A6PA 5KFCA 3IWXA 5F8MA 2HRUA 2Q6BA 3N6LA 3H59A 3EGZA 4EWTA 2F3JA 3ULHA 4QWCA 3UPFA 4RW7A 2K8GA 2DNRA 3MR3A 4JYAF 1KHWA 3MM8B 4OI4A 4X84A 1O0PA 2HGMA 3DRSA 4EZ9A 2F40A 4ED5A 4MYUA 2EFGA 3MF5A 3VCDA 3MURP 3UD3P 5CQGA 1GX5A 4PKDB 3HF5A 4DFKA 5DGBA 3G8SA 4QIEA 2PI4A 2HHVA 5KFSA 2V4RA 1U8SA 5BYRA 2XSJA 4DV0F 2FPHX 2I5JB 3Q8QB 3DOLB 4WE1B 2L9NA 1NJIT 5AXLA 1DQ8A 4J9PA 3KG1A 2KN4A 4DN9A 5F0WA 4DSJA 4OZNA 1KOHA 3OW2R 4JI2F 2B4UA 1DTTB 5HMZA 3OTDA 1UWBB 4ZVGA 5IM0A 2V4QA 2MKSA 3SQGA 5DDOC 2VBYA 4J9NA 1D9DA 3RW6A 3NP5A 5AXKA 2OKQA 1LV5A 2EG2A 3M2UB 1AW0A 3S01A 2IMWP 3OPKA 4F4KA 2BXJA 4DQPA 1U26A 4MIBA 1Q7YT 1A6LA 1MU2B 1XBWA 2GHVC 2JEGA 5F8NA 4JI8F 3OR1B 4ZDNA 1UA0A 3CB4A 2VBWA 3M8PA 3GB0A 1D9AA 4XDDA 3J7Z5 1OQ6A 5T41A 3SCIE 3E2EA 4Q7AA 1BD6A 3J7A1 1C0UA 3QGHA 2IVYA 1FKOB 5J2NA 1BQMB 3WDOA 2WSCC 4QW8A 2EPIA 4MJKA 1NH7A 3V81A 4ILLA 2VZ9A 2OSQA 5LMUF 4ILMA 1T05A 4WK1A 4MAKA 3LWLA 3FZ2A 2Q79A 4FXWA 1U2RA 1N56A 3JTPA 3O44A 3ZC4A 5DM6Q 2C3YA 1HARA 1M5PC 2DGXA 1RT7A 2V94A 2OJ3A 5AE3A 4Y2AA 1TKXA 3G86A 4JI4F 2CPHA 3SXLA 3OL6A 3EYZA 1H98A 4I2QB 5LXRA 4ES2A 4IRKA 1JLGB 4PXCA 3EPGA 4C7QA 3V6DB 2RUGA 2L08A 3ITHB 1RTHB 3O6QA 1KSPA 1UAWA 1NJYA 4KV8A 1L3VA 2DH8A 4ECYA 4KPYA 1IJEB 1RT6B 5EX3A 2QEXS 3S6EA 4ZVHA 2VFUA 4R8UA 1UETA 1KLMB 4A4JA 5KG0A 2Q43A 2OTLS 2ILZA 2XCAA 1JXLA 3THPA 1VQ9S 2VPXB 3I4PA 5GMKa 2IA6A 1X0PA 1ROFA 2FLOA 3OUYA 2XLKA 3CDEA 3GG1A 3SFUA 3T5JA 1DTQB 3NS5A 5A0YB 4WXOA 4XAKA 2E9ZA 4WFXA 3DLKB 2MSSA 2JVRA 1X9SA 2Q1LA 3OTCA 1DARA 4ZP7A 5C24B 5IT0A 2VPYB 3QIPB 2CJKA 3M2VB 4IDKA 4WIIA 4RUHA 1RKIA 4I69A 2R7WA 2F8HA 2J9EA 3DI6B 3OLBA 2DR7A 1UVKA 2JX2A 1PSDA 4OL8A 4TQSA 1FK9B 2Z8QA 3AAWB 5K8OA 1FNOA 3QO9B 4IO1A 1S1VA 1FERA 1Y5NB 2LQJA 2WHOA 3R5CA 2V8VA 3K58A 4GKKF 5FDLB 1HW8A 3ISZA 2XBPA 3ISND 5T14A 2MXYA 1SKRA 3LP1B 1N5YB 3DLEA 2F7VA 3O5TB 4YB6A 2HHTA 1FJCA 3KK3B 3QJLA 4DOZA 4Q44A 3KLHB 1S1UB 3M9NB 5EGYA 5CYQB 2RRAA 1MROB 1RISA 3MM7A 2QE5A 5KFXA 4C3LA 3IBWA 2G13A 3K8VA 1M0SA 3ISNC 4L72B 2KTQA 1JKHA 2RQCA 4OI2A 4IG3A 4I0WA 3RB0A 2M88A 4Q5VA 3Q2SC 2F9JA 2DO4A 4KRWA 1SL2A 2DNOA 3MAHA 4B3OB 1K9MT 3J80Y 2YVSA 4AL7A 4WFZA 3ZZ0A 1P1TA 2GGPB 3KLEB 5G0RB 1D3WA 1SIZA 4MKBA 4JUZA 3CCVS 2DVIA 1QLNA 3OVAA 1VI7A 5E3PA 2FHOB 4CH1A 1SV5A 2PA8D 3KMSA 3DLLQ 2YNIA 3NCRA 5F41A 3IXQA 1PC5A 2R2SA 1N6QB 2OPRB 1URRA 2MZQA 2VASA 3RYLA 1N88A 1JK9B 1RYSA 2CQ3A 5F3TA 4NRTA 4EUVA 1IBLF 2X1FA 3OSPA 3AQOA 4IQMA 2E44A 2VA2A 1K0TA 3HVTB 5DRKA 1FTCA 3K2YA 1XMOF 2RMLA 3C6UA 3S8SA 2NR0A 1SXLA 1UP1A 4RBUA 1FJ7A 4EBEA 3KLIB 2WBMA 3UDCA 3CD5A 1FESA 2AP6A 3IRXA 1S9GB 5I3PA 5B0BA 5HO4A 3OJUA 5KFQA 2OP5A 2R7VA 4C8KA 3GILA 1YSJA 2L9WA 4TY8B 1NK7A 1L3KA 3DMJA 2RE1A 2ZKUA 4QPXA 1Q8IA 4ECRA 1RTDA 3C46A 4PR6A 3I55S 1RQ0A 1IKYB 2IC3B 3IAS9 5HQ8A 1WD6A 2K3IA 4RNMA 2CJQA 3AQPA 3B4DA 1X4GA 3I5BA 4KBIA 4OJ1A 5A8RA 2W9AA 4NMLA 4HEA9 3M6WA 3PO4A 2W9BA 1JLQB 3NGKA 3MOJB 2CJ9A 5K14A 1X9MA 5K9FA 1Y00A 1S0NA 3PKYA 4RW6A 1OS5A 4MTPA 2QYCA 1UFWA 3I31A 1U2FA 2WONA 3NNAA 3DLHA 2E5GA 2F1FA 4DUYF 3RB6A 3DOKB 2A10A 3EX7B 3M6VA 4ZA1A 2ZC4A 4FS1A 1RT2A 1QTMA 2CPIA 3BSOA 4URGA 2DNMA 4ZCLA 5KFBA 2JSXA 2XCPA 4O44B 1CLFA 1WTBA 4O4GA 2BM0A 2LU2A 2YWKA 4WU2A 5FJ4A 2QV6A 1PGZA 3V2UC 3BN4A 4ES3A 2XLIA 3CD7A 4Y2KA 3C2PA 5AXMA 4H4KC 2WTFA 1ZM9A 4PQUB 4DSKA 4Y3CA 3PX0A 2EC0A 3FQKA 4H4MB 5LJ5Y 1X5TA 2CQ0A 4C2MA 1HNIA 3SSQA 2RQ4A 2M8DB 1CC8A 5J2PB 3HHLA 3G96A 4B9SA 4AL5A 2RRBA 4JBCA 1RT4B 2C3UA 1U25A 4FNHA 1GNKA 4GO7X 2V9WA 3H5XA 1B0VA 3MM9B 4GMKA 2I1RA 4OIXA 4G6VB 3KTQA 1U1LA 1NKBA 2YKMB 5F9NA 3CJ5A 1SH0A 1UVLA 1JLAA 2KI2A 4IKAA 4I68A 4JOUA 5E3QA 1RKJA 1KQSR 3NKYA 4IUFA 1UVJA 3E51A 2HVHA 2HIQA 1IXKA 1GXLA 2DNHA 5L38A 3FSYA 4DQIA 4I2PA 1VQPS 1Y9OA 5L8RC 1HYSB 5F8IA 3E01B 2W4PA 3POTA 2B4PA 2MQPA 3DLBA 1R8AA 5B0GA 5J1EB 1D1UA 1TAQA 2BE2A 5D4NA 2OPQA 1S1TA 4D3GA 1U1KA 2R7UA 3H2LA 5K8MA 5LMNF 1FDDA 4RW4B 4IQXA 4HH0A 3UQSA 3KK1A 2DISA 3EZ5A 3V4IB 1VK3A 2DB1A 3MUTP