4DV5F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv5F00
4JI1F 1VMBA 2BXJA 1FJGF 4X66F 1CQMA 5LMNF 4DV6F 4JI7F 4DV5F 1XMQF 1N32F 4DR3F 1I94F 4JYAF 2RJZA 1FKAF 1IBKF 4DR2F 4GKJF 1QJHA 2KJWA 1G1XA 2B7CB 1XNQF 2J5AA 4K0KF 4AQYF 1B64A 1LOUA 4DUYF 2UXBF 2UUCF 1RISA 2HHHF 1N34F 4DV3F 4LF8F 4JI3F 3T1YF 2KJVA 4KHPF 1N36F 1G7CB 4B3MF 4LF4F 3R3TA 1IBMF 2VQEF 1HNXF 1XNRF 1GH8A 4YY3F 4X64F 4DV7F 4B3RF 4B3SF 4JI6F 4LF6F 4DV4F 2B7BB 1N33F 5IWAF 1CQNA 2E5LF 4X62F 4JV5F 4DV1F 4JI2F 2YY3A 4DUZF 4DR6F 4JI0F 4JI4F 2BVZA 4DV2F 4NXNF 2UUAF 4B3TF 3T1HF 3OTOF 5LMUF 1HR0F 4DV0F 4LFAF 4GKKF 5BR8F 2VQFF 2UXDF 4JI8F 4LFBF 4JI5F 1HNWF 1IBLF 4X65F 2F4VF 3ZZPA 1IJEB 4YHHF 5AJ3F 2UXCF 1F60B 4DR4F 4DR7F 1XMOF 1IJFB 4DR5F 4DR1F 4LFCF 4LF9F 2UU9F 4OX9F 2ZM6F 4LF7F 1J5EF 1HNZF 4NXMF 4LF5F 2UUBF
chains in the Genus database with same CATH superfamily
2QSFA 3MD1A 2QLJB 4DSIA 3HX9A 2IJFA 1DLOA 4J9LA 2RILA 3PFOA 1HBNB 4PXBA 3DOMB 1KQSR 1IVZA 3TP2A 2KT2A 2KFNA 2Z56B 5IT9Y 4RO0A 3OSPA 2RDIA 3LQVA 4KHPF 3I9ZA 2ERRA 4NI2B 3N9UC 4B3MF 4F0HA 3PX4A 3KK1A 5GAHI 1R27B 5KFEA 4LBHA 2AHOB 2XLJA 3I5AA 2MY8A 4RUHA 1FRJA 1V9OA 2YKNB 1G3OA 3ILIA 1UEKA 4JV5F 2VKRA 3D4JA 1OYEA 5A76A 3CNQP 2W2MP 2K3IA 1P9YA 2VJVA 1FCAA 3NMRA 4MKBA 4QW9A 3DRRB 2QV6A 3UDCA 5B0GA 1M5VC 2UUCJ 2UXDF 4ZHRB 1NHVA 3K59A 5HK4A 2DT9A 4A8KA 4X4NA 1S0MA 1F5BA 4OQJA 2J7UA 5IM0B 1KEKA 2VH7A 3IGVA 2IJRA 4LF7F 2F9JA 1HI0P 1XJWB 4O3NA 5A8WB 3MXHP 3D28A 4PWWA 4KPYA 2ASYA 1QVFR 1IKXA 2CDRB 4CM0A 2CNKB 2UVRA 4QBUA 2HAIA 5E33A 2CNNB 4OZ3A 2DB1A 3W63A 4PYDA 4OHYA 2H4WB 1R43A 2D3ZA 2M52A 1FDAA 4LF9J 3D1QA 3NS7B 3W65A 2MB0B 4DUZJ 4F4XA 1M5OC 2GQCA 2HHXA 4K4WA 2O01C 1P8GA 1Q1KA 2ZE2A 1O8BA 2E5HA 2EFPA 3FZBA 2H54B 1CJTA 3J81U 1QAXA 4H4MB 4NLWA 5D77A 1YBTA 2IIHA 2AGOA 3JAMY 3CUNA 1YIJS 1KKHA 3M2VB 1L3UA 1T94A 3VZIA 2FJAB 3QIPA 5EHHA 2GO8A 4O3RA 1REVB 4KGZB 3IWNC 2DVIA 4A46A 4NRTA 3DLEB 1HNZF 3TI0A 2IFXA 1B0PA 5C24A 4TQSA 6FD1A 2CDQA 4H54A 4Q43A 4LRCA 5HBMA 2KZZA 3B78A 1M5HA 1G1XA 3PO4A 4F8RA 4GC7A 2BABA 2KM8B 3Q2SC 1NPPA 5GADI 5CYQA 3ZZ0A 2OUGA 1FI4A 2PEHA 2ZBPA 1FE0A 5KFKA 2FYXA 2LP4A 3LANA 3IWXA 3NAHA 4QW8A 2RF2A 1I3OB 4HACA 2IRXA 4Z7YA 3AH6A 5JXSA 4CH0S 4JI7J 4C48A 1EAYC 1WC4A 4Y0FA 2QG9B 2HS4A 4C9DA 3RRHA 2DIVA 2AJ1A 4CWBA 2Z30B 1F3VA 1Z2LA 2XC9A 3OV7A 1TELA 3CJRA 2E5LJ 5J2PA 2BM0A 2N3OA 1M90T 4WJBA 2CPXA 3UCUP 2RIJA 1FEHA 1JLBA 3TARA 2OH2A 1L5UA 3K0JA 1NBEB 2AEFA 5F8JA 2JVOA 4RX6A 3LO3A 3KHHA 2O3DA 4K50A 1S1WB 5HP1A 3KNGA 4F25A 3TZWA 5JJBA 1R0AA 2APOA 1W25A 3EZUA 1FKPA 3K2YA 1NNDA 2ALYB 4WXWA 2D7SA 4TY8A 4FXWA 4Q8EA 3DLGB 1EB0A 4B9NA 2DRAA 3ZXWA 2KO1A 4RBTA 2NXEA 2DCLA 2YWGA 3KG4A 1NU4A 2V4JB 4DL2A 3M2RB 3OFHA 1Q79A 2A6OA 4K4ZA 4QWEA 2FJXA 2DEJA 2ZEJA 3OFEA 3R5CA 4JYAJ 1VISA 3N6LA 1T9YA 2CQ3A 3OJSA 2XM3A 1HBMB 1H74A 3PYEA 1MNEA 1AZSA 5CYMB 5HVGA 5K8PA 1N88A 2KL8A 3PX0A 4NLVA 1IR1A 3OTEA 3NS6A 2MHEA 3VGVA 2HMIB 2UVUA 4MT1A 3EGVA 1PKUA 1TU0B 3J7YI 4QIWD 2HYIB 1U8WA 2F8EX 1RACB 4GRSA 3HHDA 2GX8A 1S5ZA 3OTDA 2LDYA 4ILLA 1X7VA 4CLKA 2CFXA 1N0VC 1KQGB 3LW5C 1RHRB 3CCZA 3EXCX 3HFVA 3LP0B 1HQEB 4OYXA 4WKRA 3VR1A 3W60A 4DV5J 5GAEI 2IDEA 1IKYB 2YKAA 1X4AA 1YJ7A 2WVFA 1NAQA 7FDRA 3MZIA 4EK2A 1XEZA 2IYGA 5LJ5Y 4K0KJ 3MMBB 5E3AA 3GJSB 4KB7A 5KFDA 1VLYA 3UNYA 2YKQA 5HANA 2M0GB 1GMWA 1RLCL 5DDRC 4A8SA 4OX7A 1IKWB 3DGPB 1GXUA 3UFCX 4LREA 2MYFA 4J91A 3FBEA 2OD4A 4WTYA 3M9MB 5B0BA 1I94F 1ZM2A 4FN5A 2EFNA 4AD6A 4C7QA 3EMTA 1RBLA 4FPIA 3ISNC 1D9DA 4K4SA 1YRUA 5ETTA 3GPAA 3MM9A 3A13A 1SUQB 1G7CB 3MUTP 1UETA 2AT1B 1DY3A 4HDHA 3Q8YA 4NPOA 1TUVA 3LP1B 2BKPA 3Q8QB 2DHGA 1VYAA 4CO3A 3TJ8A 3WIUA 3LTOA 4AXJA 4DV4F 3F41A 4K4UA 1BHNA 5KG1A 1NZ8A 3C8YA 4UTGA 3UD3P 2OPSB 3IBCB 1RT4A 2XI3A 5IC6B 4ICLB 4KGXB 3L7PA 3CMQA 4RW4A 4IRCA 2MGZA 1D8ZA 4TVAB 1BLUA 3EPIA 4QWAA 1XBWA 3CSKA 2A10A 5ETLA 3SV3A 3W61A 4QU6A 1LV5A 1NLKL 1S59A 1B0VA 4OHXA 2AJ2A 3I55S 4B3SJ 4G6VB 2MZRA 2M70A 5ADZA 3NNCA 4N77A 1UA1A 2IM3A 3VV2B 4GC6A 3J81Y 5D4LA 3H25A 2BJ9A 3KK1B 4KJIA 1DURA 4LF2A 1AT1B 1TKTA 1SC1B 3M1VA 5JUMA 1D09B 1Y0HA 1KQKA 3AB4B 2ATLA 2FZCB 2UU9J 3F73A 2ZZMA 3DRSA 4IUFA 3MFIA 4K5RA 3RBDA 3IAM9 4WU2A 5F8MA 1SKUB 4U7UK 4DR3J 2XSJA 1IR2A 3PM9A 2RDJA 4NYZA 1K47A 4EBCA 1LEOA 1RTIA 2RRNA 2R7QA 4UZBA 3VZHA 5BR8F 3CJ8A 1Q78A 5D0HA 2NREA 2HFVA 3IXQA 2H65B 3C66A 2RKIA 1IKXB 4ECQA 1T11A 1HBUB 1NXIA 2RH3A 1XERA 1C0TA 3BF4A 2HBRB 4BC7A 1E6YA 4LQ3A 1KRPA 2ZH8A 3HM9A 2Y1IA 1RAJA 1G6BA 3HXMA 2MLYA 2CA9A 5L1IA 1IM4A 2P2CB 4OYMA 3K5OA 4ZPDA 1XNQF 1S76D 4NZ7A 1KONA 4DSEA 3PRVA 1I51B 4QJVA 1SH0A 1RISA 2QLWA 3JSRA 1HNWJ 3MPWA 1GEHA 2E1RA 2ZE2B 2HBQB 4K2JA 3THTA 1S4FA 1S1XA 1FF2A 1NJWA 1VBXA 3AOBA 3LOUA 3NMAA 1RKIA 2QX0A 1SBRA 3QIPB 2MY7A 2I2YA 3ZZOA 4YFUA 2QFIA 3TZZA 4RNNA 2W9AA 2BOPA 5DZ6A 3HJFA 1YJVA 2V4QA 4J9QA 2CPZA 5F41A 5C24B 4MIAA 5KT4A 3PCOB 3E8OA 3C3LA 2ZH1A 1SJRA 1FD8A 2W9BA 3BKFA 4OZ0A 1MROA 5KFWA 5HBMB 1RWKB 4XIUA 4FDFA 3TUIC 4LF5F 1FESA 2W4CA 3MECA 3AAWB 3G86A 4ES1A 1JXLA 3UD5A 2C3OA 4NE9C 1FNXH 2Y8WA 3NCRA 3R7BB 2HHQA 3BDPA 1RHJB 4HACB 2EG1A 2QT7A 3FEXB 4RL1A 2K1RA 1MMLA 4TU9A 3HVTA 4Z2XA 2JNJA 4BS2A 4K4YA 5I3UB 4O3OA 1KVJA 1XWLA 2PFDA 4M5NA 3FRYA 2WVEA 1MU2A 2OO4A 2IYIA 2OFHX 3BGUA 3GG0A 4DV6J 1ROFA 1UW4A 4L74A 4HYKA 2BQRA 3CD5A 5IT4A 2FVCA 4HI1A 3W7BA 1JLBB 2OPRB 1WACA 3ZZUA 2VPYB 4GMKA 3U1NA 3CDBA 2AGQA 2JC1A 5LMUF 2VODA 1S9GA 2ZNYA 1FERA 2CPJA 1NK6A 5ETOA 3M8ZA 4JI5F 1C1CA 1Y5NB 1IM6A 1VQNS 1IQZA 2O1PA 2Y0BB 1GMWD 4F4WA 1WF1A 2OMOA 3K5MA 1R0AB 1KD1T 2PGCA 3AQPA 3MM6B 1FKPB 3H5UA 1FWKA 4IOAQ 4TY8B 3CJQA 3L95X 2BE2A 4U67Q 4M5DA 1LFWA 5GAHU 2DEIA 4DN9A 3BV8A 4KGKA 3AODA 4Z7CA 3VCDA 2MZ1A 1H7WA 3CW2C 2QA4S 4LF4F 2ABYA 3ULHA 4QU7A 3DKDA 1H3DA 3MFHA 1K1SA 2DO4A 1Q7YT 3BKUA 2DIUA 4I67A 2WSFC 4EUVA 1NO8A 2JC0A 3B6BA 4YB7A 3M8PA 3R2DJ 2WK4A 4KGVB 4DV3J 1X4EA 4OYBA 3TQEA 2QE5A 3EE3A 1CG2A 2YKPA 2VDHA 3P8BB 1RWNB 4KC5A 3BB5A 5DLFA 4OI6A 1S57A 4CQ1A 3M6XA 2XMVA 2MHNA 2MSTA 2ZKUA 4R8UB 4PG6A 5IWAJ 3L4BC 1AB8A 4KYZA 4JI0J 5B08A 3D66A 2C3UA 1TAUA 1A7GE 4ZP8A 1NSQA 5KT6A 2FPHX 2Z2YB 4DFJA 2V34A 3SQOP 2UXBF 5JMNA 4PG7A 2JHEA 2F9DA 3AT1B 3SFUA 2R4FA 3Q0AA 2OLWA 1RWUA 5HN0A 1UCNA 3PW7A 2OPQB 4EZ6A 4PR6A 1UZHA 1C0UA 1UFKA 1BGXT 2VBZA 1KLMA 2IAJA 3DU6A 3DDNA 4FNHA 2YBVA 4USIA 4ZVRB 4Q2MA 4USVA 5HATA 3RBEA 3FSIA 5ETMA 3D0IE 2KH9A 4HR2A 1NEEA 3QZ8A 4DF8A 1LWFA 2J76E 3TUJC 4IDKB 4UF4A 1LW0A 2PMWA 2CQHA 1QSSA 4F3MA 1WSRA 3QPIA 2BQ3A 5CZXA 4ZITA 4MMOA 1HNXJ 2ZH9A 2HRYA 3I96A 5DETA 3K5NA 2KM8C 1W26A 4Y3CA 4CIOA 1RWXB 4RUCA 1AW0A 2HNDB 4RKUC 2BV3A 1HFEL 2AJFE 3GIKA 5GADU 3MAAA 4TU7A 2HVHA 4DCPB 1N8RT 3R5BA 2ZUAA 1Y5LB 1Q16B 1TP7A 3T1YF 1NRKA 2MQLA 1S6PA 4FPRA 4ECRA 2F4VJ 1LWCB 1TQLA 5FD1A 4NCAA 1RT4B 2EBEA 5K8MA 4ZPBA 2E1MC 4O3SA 4YB5A 4RW4B 5F8NA 2VKZG 4KO0B 4P75A 3QT7A 3VAJA 1JNZB 1P27B 3PZPA 3QT6A 3C2PA 3QFHA 4YQWA 3C15A 3G6ES 4U9RA 3ZTQA 3O5TB 4J90A 2J9DA 4A8FA 1XMOF 4L72B 3R1HA 1U2CA 4CO0A 4NASA 3VAMA 3EPGA 3IM9A 3WZ0A 4KKOB 3US5A 4KHMA 4QWDA 2GGPA 3FCHA 1HNIA 1UEVA 5LL6d 3E2EA 2WB1D 1DTTA 4WFNQ 3DRSB 3CT9A 4USJC 4JI8J 4PUOA 3H40A 1R8PA 2XHCA 3I32A 1PJ5A 3LGMA 3V81A 5ETKA 3M32A 4NLTA 3HJVA 2XSJB 2VUGA 3KHRA 5T41A 2P9EA 2W1BA 3T5LA 3RB6A 2E29A 2EG2A 1TZ0A 2JVRA 2ZFHA 3BPDA 1NB2A 1RYRA 1RTDB 3KDNA 5DQHA 4X4OA 3N5FA 3V2UC 4ZPAA 1T0TV 3OTBA 4N47A 2RKIB 1B7FA 3KLVA 2A0FB 3ETOA 1GXLA 1FNMA 1QUVA 1C0TB 2Z58B 4G1IA 4DJBA 4W90B 4L73A 1O5JA 1KTQA 3Q86A 4DR5F 3UDVA 1HHTP 3J7YU 5THWA 1F5AA 1LK7A 5IQQA 2XULA 4UUXA 2DNYA 4HTJA 3VQTA 4ED7A 2ZWOA 3MM5A 1PSDA 5HQLA 2HK2A 3Q8RB 1S1XB 1JQGA 1JLFA 5C5JA 2BDPA 1FTRA 1GX6A 4MKVA 4X2BA 5GAGI 4HH1A 3SZ2A 1VCTA 4YY3F 2BJ8A 2GMHA 2MKCA 5GAEU 5KT3A 1LFPA 1NH7A 4YMEA 4K2XA 4DXLA 2QFJA 4U8VA 2LMIA 2KT3A 4PG8A 1LWEA 2MJNA 2VG7A 5HVHA 1HD0A 1QM9A 3H4DA 2R7UA 3MEDB 2ZOGA 1LNQA 4GVLA 3G6VA 1VQYA 4CLPA 3SBMA 5A0YA 2UP1A 5KG3A 1V3RA 5DQGA 1S6QA 2AGPA 4J37A 4LF8J 1RKJA 3THPA 2DTJA 4WU3A 4ANDA 1S49A 2CPIA 3QWPA 4G3IA 2PN6A 1YBAA 1SQGA 1WJ9A 1H72C 2Y0SD 2ZJQQ 3FEYB 2H4YB 1UVJA 5LMNF 5J1EA 2Q6CA 2CQ4A 3K8WA 3CEDA 4MK7A 4OL8A 2FVPA 3CCRS 5DZ7A 4XPCA 1JLQA 5HQ8A 2FLLA 1Q8BA 2BQUA 3PIOQ 2CQCA 4EBEA 2YPYA 1FHTA 3TA1A 2KZMA 4BHQA 2QZ8A 2D1CA 2JLGA 4ZK7M 4PYAA 1S72S 4DR7J 4YR0A 4WCEQ 4ZVSB 4DZ6A 2K06A 5KFYA 4KE5A 4I2QA 2MLXA 2ZHBA 1S9GB 2J0QD 3DU5A 2XCAA 3CDAA 3HHLA 1PJ7A 3CJ3A 3DRXA 4BWJA 1RDRA 1HWKA 3MGJA 4U96A 4ES3A 4Z37A 2NS1B 1T03B 5BYQA 3D1HA 4WBFA 2UUWA 2RNEA 4RWWA 2P9GA 1FO1A 1IJFB 3LWMA 2UV8A 1WI8A 2BE2B 1NPKA 3HVWA 2MTLA 1VFJA 1RTHA 3CCES 2RJZA 3BS9A 3UR0A 2J5AA 1RE1B 3PDNA 3T6JA 4ZLLA 2WOMA 1OO0B 4A8YA 2G1DA 4A8WA 1RCOB 4RLEA 4DDFA 1TKXA 4B9SA 3BGLA 1GH8A 3QATA 1EZZB 2J9EA 3D0GE 5L9XA 1YDLA 4URGA 1MSWD 2L3MA 2HLTA 5KFFA 1VQOS 2RAQA 3MPVA 2HQDA 2VICA 2MSSA 3OFFA 1RA6A 3LPYA 2HVZA 3NGTA 1UWBA 2QYGA 5AT1B 1HBOB 5AE2A 2G9OA 3K89A 1ACMB 1FRHA 4OV1A 2MPUA 2V8DA 1GTHA 3VGSA 1O51A 2C2NA 1R8AA 4YHHF 3FRZA 4UT4A 2P6TA 1RLDA 3TAQA 3TZYA 3MUVP 5L38A 4J9PA 2B5JA 2MXYA 1DFDA 1IBCB 1ZM4A 3K17A 1BQMA 3OT9A 1FKOB 3IN5A 2ZH6A 3KLEA 1N0UA 3VQSA 1VIOA 3CO9A 1C0UB 2KJVA 5E3QA 1KLMB 4NCGA 3GFHA 4LSLA 5T7LA 3TAMA 5A8RB 4ECTA 4Y2MA 4CM2A 2R2TA 2ZM6J 1RUSA 3FDSA 1FT8A 2RUGA 1LW0B 1XMQJ 4F50A 7AT1B 4C6AA 3H4BA 4YDXA 1D0EA 2F8HA 2VFVA 5CYJA 5LXYA 4UQTA 1YLXA 3CJ5A 1W7WA 2KDOA 2CRLA 1R31A 4ED1A 3A8IA 3MAAB 2YQ1A 2LLZA 4R5PA 2EFOA 1YTYA 2MKIA 4ELTA 3ET6A 5ETSA 4CNYA 1H2TZ 3IR7B 3BPSP 2HAFA 3DLKB 5CHCB 1FJGF 4RW6A 5F3ZA 1DJ0A 3F0NA 4KIAA 4I7FA 4KV8A 3TA0A 2MQNA 4FKYA 2P6SA 1N5YA 2RU9A 4P10A 1F5CA 4PEOA 4LF5J 2LCWA 5AXNA 2ZNZA 4QIGA 4MK9A 2N7CA 2BANA 1MMNA 1S9EA 2FY1A 2B4UA 1FJCA 1LK5A 1KS2A 2RT3A 3M8YA 5F8IA 4CYUA 3QRRA 2JEFA 5D8HB 1JLAA 2BE9B 1SQFA 3P5TL 1URRA 1ZPWX 2CPFA 2K2PA 3A8KA 2XMAA 1HIYA 3SCJE 2QL7B 4EEYA 3ZC4A 3H2UB 1RWOB 2CQ0A 1KQFB 4RU2A 1RT7B 3CCQS 1VQ6S 2COLA 2GGPB 4W4MA 1SB6A 2NSBA 2ZUGA 5CXTA 5D4PA 5M2RA 1HI8A 1DTTB 3CDEA 1BC6A 3I31A 3GU0A 3HO1A 3JSBA 4AL5A 2GV1A 2IBKA 4EWTA 2V9KA 1JJ2R 2C2EA 2XB2D 3BO4A 3V81B 4ZLPA 3PW5A 3M32B 2D3O1 2Q6BA 3O1LA 4NEYA 4LRBA 4CLLA 2UUCF 2W7PA 4DPTA 3O8WA 4B9UA 2UUTA 2Y8YA 2RD5C 2PSZA 2DGUA 1FVSA 2V8HA 4TU8A 4DPOA 2ZC3A 1P9QC 1VK3A 3A8JA 3W64A 2PEBA 1CJUA 4IRKA 4XDCA 4A47A 2FTRA 2WW8A 3QO9A 3HHLD 5F0WA 3A1YG 4DR2J 2C3MA 2E5GA 2X51A 3O3LA 2D74B 4XTTA 5C25A 1QUPA 3MTKA 4JB8B 2YNGA 2Q79A 2MEWA 2B0GA 2QLBB 2VJUA 3N6MA 5KTQA 4X64J 1Z4UA 4CRJA 4LF9F 4DPWA 2XMMA 1UVIA 2YVSA 4DUZF 4JI1F 2CJXB 4J9RA 4J9SA 2ZWPA 1JLFB 2FIUA 1NHUA 2PA8D 3DMJA 3QBCA 3KXDA 1RZMA 2EFQA 2E5IA 1NDCA 2HNYA 1U1NA 5KFHA 2V4RA 3CDUA 1LWEB 3D6HB 4KHRA 3JSYA 2GFFA 2VG7B 3GG1A 1KHVA 3LALA 4N8OA 3W66A 2BJDA 4WFZA 4O0IA 2MDAA 4HVZA 5E2QA 5LJ3Y 1ZZFA 1RT5A 5A0YB 1HL6A 5KG5A 1U45A 2DPIA 2PC6A 2OAUA 1ZM9A 4IG0A 1S6QB 1WNEA 5EWFA 1YZ7A 2YH1A 1JIHA 2OTJS 4URQU 3ONQA 8ATCB 3M8RA 1VQLS 4NLGA 4LR8A 4O4GA 5J1EB 4ILRA 4OHWA 3TA2A 2F5GA 1JLQB 2EKYA 1WEZA 1VBZA 4OX8A 1SCJB 2NLWA 3VHQA 4JI7F 3CVKA 2RQ4A 4WWSA 1NB7A 1RTZA 4C3LA 1SV5A 2ZJPQ 5DGBA 5KFAA 2EI5A 4F3OA 1VRTB 4DV0J 1B64A 2BA9A 3GQCA 1VBYA 4MJKA 3DM2A 4KH1B 4LSZB 4ZMMA 1TMMA 2F3JA 3HHLB 3VAHA 2U2FA 2DD8S 4ED4A 4WF9Q 3BO2A 6FDRA 3NEKA 1J5EJ 3BN7A 3MPDA 3T1YJ 3EVOA 1Y7PA 4FYXB 3AA9A 1TKDA 2MKSA 4E2FB 4V19X 3W5YA 3P6YC 2HWTA 2CNOB 3CIMA 1V3ZA 4Q45A 4Q0BA 4OJ3A 2VQFF 2FD2A 3CD7A 4O44A 1T9UA 2NPIA 3RAXA 3H5XA 1KSPA 3HMJG 1RTHB 1VIXA 3SSQA 4ZCLA 3EGNA 1VQ4S 4CCHA 3DN9A 3EZOA 4LSNB 2WOMB 2AYBA 5LM7E 4WFXA 3PX6A 3GIMA 4JYAF 1TKXB 2LFVA 2W4PA 4UUWA 2E1AA 4DSLA 3CB4A 3D3CJ 3IGNA 2EK1A 4A8OA 2NQPA 1M0SA 3T9NA 3CXCR 1T9VA 3AY0A 3TAPA 4BWMA 2LXIA 2XO6A 3CC4S 2C28A 3PXGa 4DR1J 3HVRA 5A6WA 1YX2A 3TW0A 1CC8A 4TY9A 1UWBB 3PYGA 4PXCA 2Q3PA 3GMGA 1NKBA 2WHOA 2JSXA 1I5OB 3FFIA 2VBWA 1VDHA 2LVWA 2B9EA 2XMKA 2YH0A 4DF4A 1R6VA 2ZH3A 2ZH4A 2V8VA 4CO1A 3AD9C 3ZTSA 4FS1A 2KXFA 2YKMB 2DHSA 1U1OA 2ZVSA 2Y1JA 1EKSA 3FZ2A 2YNIB 1Q86T 5IM0A 2LYVA 3KLEB 3FSYA 4R0JA 1U1KA 1DARA 2B9XA 1VMBA 3JXOA 3HULA 2MKKA 4Q7AA 4DV5F 3HHNB 4C2MA 5EDWA 4NCGB 3M2UA 4KAIA 1RHMB 2D41A 4LSLB 4B3TJ 2EEYA 3TAMB 4K0KF 3FQLA 2OEMA 2IDLA 2AZ1A 1G4CA 1X4BA 3BJYA 2OD6A 4AUKA 3CDWA 5GAGU 2LKZA 1Y5IB 2A6MA 4C8KA 2BOAA 5BJRA 3A8EA 2NCKL 3UN5A 1D8YA 2E1CA 4Y00A 4DR4J 2X3GA 1WC6A 2DR6A 1QVGR 2GA7A 1R6YA 2HS3A 3OL9A 2YWWA 2JEJA 1HYSA 2W2OP 4HL9A 4H4MA 2E7XA 2J6TA 4NL5A 5DRKA 1S9FA 4M95A 2VG6A 4R5PB 4JV2A 4ZVQB 1SC3B 2EKNA 3M2VA 4WKYA 3H0PA 3TWZA 4RW6B 3OL7A 3S7RA 5C7PA 5B0EA 1PO6A 4I7FB 4KV8B 3KK2A 1N5YB 4WP3A 3RUBL 4H4KC 2O67A 4C0BA 1XIQA 4ZPTR 4ECUA 5K20B 5DDPC 2QC3A 1SL2A 1S9EB 3EX7B 3MWBA 1HW9A 4CYUB 1BE4A 1JLAB 3AXMA 4JP8A 4HHJA 2Z4PA 4M8LA 3M8QA 3LAKA 4C8YA 4X65J 2FJVA 1WDDA 4LRAA 3GYGA 3ZO7A 1CULA 3ZTRA 3KJQB 4ZPCA 4ZN3A 4B3SF 2XZTB 1FDBA 4FYYB 5HMWA 1R8CA 4EYHB 4DFKA 5KFJA 5KAKA 4I64A 2WTFA 4BBYA 2R7SA 5KOWA 4NLYA 3BSNA 1BY9A 1MWQA 4Y2CA 1FE4A 4IR9A 2B4VA 3J81j 1NJZA 5L1JA 1KNZA 4OYOA 1FFGB 2H51B 4LIWA 1CJKA 2V9WA 1YITS 1SKRA 1L3SA 3QRPA 2QA4G 5DM6Q 5G0RB 5HJYA 1ZPVA 2Z2ZA 2J0XA 1FFSB 3SFGA 3NWRA 1YWXA 5ETQA 2UU9F 4X4RA 4DL5A 2NR0A 3EUNA 1GTEA 1VQ7S 4ZPWR 2HGMA 1RT2B 1TAQA 3WQPA 4DR3F 3LPEA 2HZAA 2KKHA 3DHWC 1QJHA 4LRFA 4RJVA 3A3OB 2HURA 3G6YA 3T5KA 1VC5A 1KVKA 2V5HG 1WOOA 2R8HA 2LECA 2VPXB 4Y2IA 1BQNA 1CJUB 1TTHB 2DXEA 3NCQA 3AHPA 4ELUA 1TK8A 1ZZNA 4M5IA 3VALA 4N5SA 1IUJA 3QGIA 2OHDA 1HA1A 3LP2B 2AD9A 4ED8A 5C25B 4CNZA 3BBCA 5DG7A 2YNGB 2GJFA 4V1Ak 1NKEA 2PT0A 3GLJA 1C2PA 2DNRA 1X4HA 1ULRA 1HNWF 3KLGA 3OR1B 3EVMA 2KFZA 2JWNA 2WB4A 4RNHA 4O4RA 3DMJB 3S1TA 5LOQA 3QSYB 1K8AT 1WG1A 3RZAA 3NNHA 1RA7A 9RUBA 2I9SA 1B70B 5KG7A 3GJQB 2CKWA 3UPFA 1HR0J 3CPWR 1EJ7L 3TX8A 4ID5A 2HEKA 3GV8B 1U02A 4LT6A 4JI3F 3ZFVA 2J8SA 3ISZA 1RWWB 4ZS6A 5AE3A 2EVZA 2YKOA 3NLCA 4LFCJ 5E7OB 1G2EA 1HQEA 3QWUA 1YJNS 3NGUA 4FS2A 1N32J 2W7OA 4O4GB 3MMAB 2DH8A 2G2ZA 2FHMA 5K9FA 3NGRA 3MMBA 3TRGA 2BW2A 3RB3A 3AD7C 5B0FA 2CVEA 5FIIA 2VQEJ 1WC1A 4U7UD 2ZBCA 2DGXA 2IM0A 1IKWA 1PJ6A 2RMLA 3R6GB 2ZDOA 4DV6F 1FK9B 1S1UA 3DM2B 2QLXA 3OTOJ 2XLIA 3KOAA 3BSOA 3Q83A 2LA6A 4MYUA 3W9IA 3OXGA 3CCVS 2R8JA 2KVQE 3EWGA 4EU0A 3B8HA 1U4BA 1U26A 5IZHA 2L9WA 3TANA 4RPFA 3LP1A 2E1PA 4C0HA 2I0XA 1FD2A 4MK8A 1EQMA 5HMZA 4NXMJ 3BGRB 1U1QA 3NGDA 2C3YA 2N4CA 3JS9A 1U1LA 3HP6A 5EX3A 3K5PA 3N6NA 5KFCA 4O44B 2OPSA 1UFLA 4ETXA 3MI7X 4WK3A 3GV7B 5KFMA 4OJHA 2MJUA 2KB2A 3TEGA 2DNQA 1WC5A 1SPBP 1AXQA 3W8PA 3CCJS 1RQ0A 3KUGA 2CADA 1YBUA 4CT9A 2ALZA 2OJ3A 3N79A 4M5HA 4OLOA 3MOZA 3BDEA 3FMBA 1NK9A 5ETVA 3KYLA 3TVZA 3D54A 4F36A 1HWIA 4P7VA 2HHHF 4DV3F 5H9FK 4CTAA 4QCLA 3WHIA 2HK3A 3FFIB 3GFZA 1WG4A 2GMJA 4P6QA 4CO4A 2OPPB 2OEJA 4GVBA 2IRUA 1NZAA 2ROGA 5IWAF 3FNNA 4ED0A 1A0OB 2WSEC 4JI0F 1VQMS 2CQ2A 2MQPA 2EWHA 1F9EB 1PC4A 4IQMA 4QYZK 3M9NB 1GT8A 1X5PA 1VOMA 3P3DA 2YWKA 3PO5A 3RRGA 5KFBA 1KOHA 3M2UB 1RT3A 2LU2A 1HBUA 2DNLA 2EW9A 2R7XA 4CH1A 2KHCA 4JV1A 1SJ1A 2KRBA 4EYIB 2GO9A 1T3OA 5KFSA 4DV2J 4MYTA 4F4KA 3GWCA 1RB0A 1WDTA 5FDLB 4DWIA 4JI1J 4MAKA 3KG1A 2RB7A 1LXNA 5M2UA 1KWMA 2VV5A 2ZD1B 1HYSB 2VIHA 1HNXF 3NP5A 3OL8A 5J2MB 2J7WA 2VG6B 1CQNA 3K5LA 4OI2A 3G8TA 1X9MA 3LF0A 1HQUA 2D3UA 3DLBA 9ATCB 5D4OA 4RW9A 2CXEA 3KK2B 3V6DB 4ENOA 1RTJA 2JDJA 1VRUB 3AA8A 4S0MA 1HPZA 1N36J 1ZOTA 2F4VF 4IOBA 2NSCA 2ZKTA 4PXEA 3IR6B 1LW2B 1HI1A 1SH2A 4OX6A 2WRMA 2HHWA 1U1RA 1MG7A 4I4BA 3CJSA 1F9HA 2MZQA 3A4TA 3M8QB 4IR1A 2HW3A 3HHLC 1YJRA 4F67A 1NKCA 2WCXA 4NXNJ 1VRQC 4B3OA 2PA3A 1CULB 4CDIA 3SQGB 3W2WA 3MM8A 4DL3A 2FHOB 2CPEA 4ED2A 2LQ8A 5I3UA 2XO7A 1WF2A 4NLOA 2YTCA 1UJ5A 1Y00A 2ZZNA 1N52B 4ZVEA 3SCKE 1T8EA 3DDIA 1Q8LA 4WFAQ 4QIEA 1CJKB 4E0DA 4I2PA 4JBCA 1LQ9A 4M5KA 1Y4ZB 2OPRA 3HZEA 4IH5A 2YNHA 2HVEA 3AFGA 4ECWA 4DL6A 4HI2A 1E6VB 4JI8F 2LXFA 2OGUA 2J7KA 4A4JA 3HSZA 3HKWA 1YJUA 2HQIA 1RBOB 5IFMA 1QDUB 2CZ9A 3K8VA 3JB9k 2D69A 5I42B 3CC7S 1RSCA 5A6PA 4QR2A 5GMEA 3MM6A 1UKUA 2VQFJ 4N76A 2IMOA 2BRLA 8RUCA 2VFRA 1CBKA 3B82A 1BQNB 4IG3B 4ECXA 2E9RX 5D3GB 5DS7A 5L46A 1GNKA 3OQ2A 1X5SA 1R7IA 2WVCA 1IXKA 4M5LA 2IMWP 1ZH5A 2V8PA 1FRIA 3PKYA 1RI7A 3IBWA 4LVNP 3R5DA 3FBCA 1SJQA 2VZ9A 2X3DA 2R2SA 5A8KA 4F02A 2RQMA 1XC9A 2CPYA 3KLGB 3HI9A 2GIRA 4KGMA 3WBZA 4NA2A 4RZRA 3W3SA 2CIMA 2J8AA 2O66A 3X1LB 4FYDA 2CQBA 3MPUB 3QNWB 4HT5A 1CS4A 2UVWA 2PI5A 1UVLA 2CJBA 3UW1A 4USWA 4R8UA 3PRBA 2JOQA 5C2GA 3B54A 4DPYA 4ID5B 4RBVA 1FRXA 3A12A 3TNVA 2RS2A 1I6JA 3UN2A 1SKWA 3ZNUA 3E51A 4RWXA 4P2MA 3T1HJ 2FHKA 2FVQA 2VHGA 2XMWA 1PILA 5F8GA 1P1LA 1Z2ZA 4LF8F 4PRFA 3SIPB 3D0HE 4F0KA 2GQ2A 3G71S 2IY5B 2OPQA 4ZP9A 5HI7A 3ADAC 3G9CA 4OZ5A 1KC8T 4C3KA 2GCFA 4OYWA 3ZTOA 3TEHB 3DRPA 1L3VA 1RHKB 2KRRA 2OP5A 3HSDA 3GCXP 2VONA 3CC2S 1RWPB 4IDKA 3ENVA 5KG0A 3T6BA 3HCXA 2CQGA 2DGOA 3KLHB 3EVWA 2LXUA 1RU2A 1S1UB 4PKDB 5CZVA 1P1TA 1RAAB 4DR7F 4FP9A 4NYPA 4YR3A 4B3RJ 1SC6A 1X60A 2HNDA 3TUPA 2VA3A 4JI2J 1RWMB 1GK8A 1NSPA 4JI4J 2CNLB 1SKSA 4UY8T 1M1KT 2V69A 4WE1A 2MKHA 2IRYA 1LWCA 1DRZA 4ANEA 2OIHA 1IKVA 3D6MB 2MZJA 1UL3A 2XYPB 1FDDA 4GO7X 5D15A 2DKOB 2B7BB 5I3QA 3TZXA 1ZA2B 2B43A 1S77D 4KO0A 4X66J 2VFTA 3MR3A 3CCTA 4K5SA 2Y3YA 3Q8PB 1QAYA 3KWMA 2F4FA 4ZDNA 4C98A 4EI2A 4ZJLA 1YJTA 1YI2S 3HFKA 2OSRA 2G4BA 2FLNA 2DGVA 2XGPA 5IOLA 2XS2A 2CWXA 4C8ZA 1S79A 3ZNJ1 2G0CA 3FBFA 5DGAA 4OHVA 1FX2A 2XCPA 5L1LA 2R7VA 1CSJA 4KKOA 3ILJA 3CCSS 2HNZA 4X62J 3FBBA 4JUZA 4FF4A 2GHPA 4CTAB 5CABA 1N5VA 3EXYA 4QIFA 3W8GA 2M3DA 2X1GA 4J5OA 1FKAF 4GVBB 2QLFB 2ZJRQ 1K73T 2E7VA 1XMBA 2MQ8A 2ZDPA 2N3LA 2RS8A 3H8YA 2VU5A 4DQIA 1IBLJ 1WHVA 1D3WA 1X8DA 2C3PA 4OJGA 3Q8UA 2PMZD 3MR6A 3OPKA 2V94A 4G1QA 3D3BJ 4NYOA 2YWHA 2XZDB 1RTDA 2HPUA 2JLFA 1U6FA 3EM1A 2MQOA 2CJYB 3V6KA 2IC3B 1RT3B 2YWEA 3PR5B 3QLHA 2HIQA 4OYAA 2E44A 3KKFA 4K8RA 3I87A 4L3NA 1QY7A 3TR5A 4ZP6A 2HFOA 2C22A 2DK2A 1YJ9S 2R2RA 2ZM6F 5K8NA 4L75A 3PFEA 2DY9A 2FLPA 4KSEB 3NGKA 2GC8A 1XMQF 5F0UA 2WONA 5C42B 4YP3A 3EDQB 4A8MP 3U02A 2VFSA 3H42A 4GKKJ 2ASDA 2AWZA 4UQGA 4NEZA 3G2XA 3R3TA 2EC0A 2VC1A 1HQUB 4UOHA 3JTPA 2QA2A 2XS5A 3BQ2A 4RW9B 4JI3J 1Q0NA 1RTJB 3UE2A 3MEDA 3J7AN 2DGTA 3MHYA 1EP4A 1HPZB 4BLGA 3M05A 4DS5A 2R7OA 1NDKA 1Z1ZA 4P2XA 1VHFA 1BWEA 4DUYJ 4QOTA 3ZZYA 4Q44A 4HTIA 3NXZA 5HVFA 4CO2A 2EXUA 1UPPA 3GIIA 3VAKA 2P5VA 1YHQS 3H20A 4B3OB 4NWBA 3R9LA 1NSAA 4DHVA 2EBGA 4J9UE 3W2WB 3MM8B 5EX0A 4AYBD 5EWEA 4HHHA 2KYXA 1HHSA 2AX0A 2IM1A 2K3KA 4EGLA 4H4KA 5K5MA 4TQRA 3SSRA 1MW7A 3H7HB 2HHSA 1S12A 4I2PB 1TL4A 3G82B 5AJ3J 1YGYA 3OLBA 5KFNA 1FTCA 1OIAA 3U1MA 1F0XA 4LVOP 1PBAA 3UWTA 4TLQA 2AYEA 2YNHB 2B8PA 2XI2A 1U48A 2W2NP 2GZOA 4RU9A 1OS5A 4FF2A 3B4MA 4ZJQA 1IBKJ 1HD1A 4GKJJ 2W9CA 4A8XA 2GW8A 4J7CA 4G65A 2RVJA 1T03A 3DOLB 3SV4A 3ZZTA 4ZIWA 3BH6B 5B0AA 2XNQA 1WC0A 3PW0A 3CMAS 2F63A 3DHXA 2HZCA 4R0EA 2J6SA 4DR6J 2M9KA 5FJ4A 4DR2F 1T7PA 3J7A1 2J0WA 2XSFA 1KN6A 2MKJA 5KFPA 5A8KB 4K7QA 4ITSA 4ZOSA 4UY85 4DG1A 4X64F 1JMTA 4Y2AA 1IN0A 1U09A 2U1AA 2VF3A 2HHHJ 1Y11A 2ZBRA 2AJ4A 1GMVA 1CS4B 1WI6A 4V19J 3T1AA 1H98A 3M6UA 2FZKB 2XS7A 1HBOA 3DOKA 4M5JA 1F3FA 4OFZA 3GV5B 2DR7A 1SJ4P 4CT8A 4ATNA 3B4DA 4DN0A 5LXRA 4ZN1A 4D3GA 2J6UA 3ZZPA 4QWCA 4EFAC 1T9XA 4DU7A 3CCMS 2VD3A 2DO0A 1Q4RA 1N33J 5IS2A 3M30A 2KXNB 1FKOA 2DNOA 1N6QB 1WSVA 3EGZA 4EO6A 3MDFA 1RGVA 2VG5B 3D68A 3H98A 1VI7A 4C8MA 3KTQA 2ZOMA 2R42A 4ZCKA 3DRPB 1OQ3A 5A8RA 3C14A 4C11A 5LSRA 5RUBA 1OYDA 3NOGA 1KOOA 1UW9A 4AT1B 1UVKA 3GYNA 3K58A 3KUHA 3M4XA 1WHYA 3JTNA 4OZNA 4IH6A 3BBBA 2HVDA 3W5ZA 4ZVTB 4O3PA 4DV0F 1PYTA 5E3PA 3G4SS 2GIQA 4NA1A 5B09A 4KTQA 3ZZZA 2ROPA 4NRUA 3JQKA 2JH3A 1IBMJ 4EZ9A 4OI3A 3R7SB 4DCOB 3I4HX 2E9ZA 1HWLA 4LMZA 8AT1B 1J5EF 3DLKA 4DQSA 2UUBF 4WE1B 5DJBA 5HROB 3HT0A 2AW0A 3QT8A 1YZ6A 4DQQA 1AUDA 2W25A 1AFJA 4IFYA 1IKVB 4OI1A 3H59A 2DCUB 2GAGC 1M1GA 5D0EA 3HDSA 4NMXA 4ZVPB 2FVRA 2YQ0A 2IPOB 4NZ0A 1IQTA 4I6AA 2JFKA 2XNRA 3WX4A 1TL3A 4OJ1A 2CQPA 3TO8A 3EICA 2VOPA 2I8EA 1ZA1B 2DBBA 2XYHB 3TJAA 4PQAA 2FJEB 2BM1A 3MEKA 1NUEA 4C8NA 4AQYJ 3KJVB 2MQQA 2EFGA 3OJUA 3NY0A 1Y10A 3PEJA 2HNZB 1RT7A 2LA4A 1F2HA 3D1OA 1PAEX 3QMQA 1V6HA 2CJQA 1N56A 3HT3A 1JJHA 4CLWA 4DR1F 4Y2KA 3QZ7A 1CC7A 3AJ2A 4OYIA 5EN1A 3PEHA 1EIYB 4C4WA 4WYWA 1V5VA 1AROP 2R7WA 1RAEB 3I6PA 3L7OA 1SJ3P 1RT6B 1ZM3A 4G1QB 3L9ZA 4LFBJ 2Q66A 2VPWB 2QSWA 2ZBQA 2HWHA 5AXKA 1SL1A 3KK3B 2ZBIA 3IRXA 4QPXA 1Y3KA 2JFDA 1FDNA 4TYBA 4NX9A 1K0TA 2AEMA 2QGFB 2UV8G 3LUYA 1N54B 3QLHB 3ZTPA 2GVDA 1XR5A 5E41A 3QJLA 4K4TA 1M5KC 2YX4A 5HLFB 4PZVA 1UZDA 3BYRA 4B3TF 2NYIA 2IVMA 2K8GA 4USUA 1SC4B 3I56S 4J9KA 5CD4A 2AYGA 3T5HA 2WONB 2JJ4D 3N0VA 4DR4F 3IFEA 2WW4A 1JJ4A 3OVAA 5J2NB 2POKA 2XY7A 1ZTWA 1N4LA 3NKYA 1GAOA 2F65A 3Q22A 2H5EA 5J2QA 1J5OA 2AU0A 4M94A 2V50A 3P45B 3FEZA 4WTOB 1NH8A 1V5IB 2HLUA 1RAIB 1U47A 2B7CB 1LWXA 4PXDA 2D9OA 2MKYA 2V2KA 3PJXA 4ZVUB 1PC5A 5SZTA 1S0NA 1JNRB 5BXIA 3BKTA 2Z2LA 3RU0A 1EP4B 2AP6A 2YX1A 2JLEA 4CLYA 4P74A 2BKNA 3DXSX 3RJMB 5DM7Q 1Q53A 3JYTA 5KT2A 1VQSA 4NZ6A 2R2UA 3W9HA 2DR8A 2AKWB 4M5GA 2VL1A 1UA0A 4WYLA 4P72A 3POTA 3NBPA 2ASJA 1D9AA 3KJNB 2QIFA 1Q82T 3ILLA 4RUAA 3PNIA 3Q24A 1HWUA 5L39A 4X65F 1O6XA 4RR5A 3SCIE 1F6TA 3EDRB 4RW8B 4WIIA 4X4TA 2WZ1A 1DAXA 2F7VA 2BACA 3M7VA 5KG6A 1KHWA 2XWXA 4A48A 4DX5A 3OBIA 2CZ4A 4PG5A 1N5TA 1VRTA 3OVBA 5CA5A 5T14A 3IM8A 3TOQA 4Y65A 3FJ2A 1WOSA 4CLUA 1JLGB 3H90A 3OD2A 3PR4A 1DTQA 3MEEA 3FCVA 1YRXA 2JEIA 2VPZB 2VB6A 1T9TA 4B17A 2B3TB 2W9CB 5F8HA 3PYFA 3DXBA 4NLDA 1AUSL 1TL5A 3H5SA 5I4MA 2SXLA 4J9OA 2V8GA 2BRKA 2XQCA 3OXFA 2LQ9A 3R5AA 4DQPA 4Y6IA 3HF5A 2A2CA 1JB0C 3SSSA 3RB0A 2Z57B 3V6HA 4IFVA 1WWHA 3CMES 3KLFA 3DLHA 2PE8A 3PKMA 3CJ0A 2M8DB 3AOCA 4LSNA 4E8UA 1YSJA 1K44A 4YOEA 2RHSB 2A2DA 4BDPA 3S6EA 2I5JB 1WEXA 1JXVA 3T41A 2WVBA 1ZYQA 3R2CJ 4DG1B 2CG8A 3UR3C 4LFAJ 3JQMA 2AYMA 2CAJA 2HFZA 5MLCV 4ERDA 1T95A 4EBDA 1UAWA 2KI2A 4X4QA 4FVMA 5KT7A 2XY6A 5EUHA 3RYLA 4OX9J 3DOKB 3HLUA 2VA2A 3IBFB 4CLFA 3R7NB 2IVYA 4U8YA 1H2VZ 5H1SV 3QGHA 5F9LA 4DL0C 2QN6B 5KFRA 1HR0F 4CI0B 2YKMA 3CCUS 5CAAA 1X4FA 2YNIA 3M30B 1H73A 3LGHA 3GONA 3RTVA 3GSDA 4KFBA 1M1HA 3MM7A 3DI6B 5DDQC 4LFCF 2WSCC 1WTBA 5KFIA 1JLCB 2ZH7A 4JI6J 1S10A 4UZCA 1S6UA 4DV1J 3KHLA 4N41A 4ECSA 1N32F 4LJMA 4IO9Q 4PWUA 3C46A 1RAHB 3C14B 4C11B 1DLOB 3V4MA 3VGUA 2W8LA 1N34F 1MN9A 3BYPA 5D0GA 1FEEA 3D6TB 3T5JA 3QRQA 2Z2MA 3PVXA 3UCGA 4EO8A 2VQEF 3THVA 3E3XA 1A9NB 3KFWX 3C16A 5E0OA 3N01A 5HQMA 2DHXA 3CF5Q 4IH7A 1CEZA 3TUZC 5LSOA 1TR0A 3IMQJ 3Q2TC 1GX5A 4JOUA 4AE5A 1VHIA 4PAAA 1ZTTA 2G0JA 1TFWA 5A2QU 3GIRA 3OTOF 4J9MA 2DNHA 1X0PA 4NLQA 3A3NB 3RR7A 3AOAA 1QSLA 3GILA 3QQCD 2V0NA 2RRBA 4DLGA 5CQGA 2L41A 4IFYB 3CO0P 4CLZA 4LF6J 1EETA 4NXMF 2HRTA 4CH7A 1QAIA 3MEGA 1DQ9A 3CWJA 2UUAJ 3Q8VA 1VK8A 3UO0A 2M5YA 4RBUA 3M6VA 5BYRA 1TL3B 1FRLA 1OMSA 4WPAA 1W2IA 2AJQA 3ITHA 1Q7LB 3D7SB 3G96A 2J9DE 3HD1A 3DCAA 1HWJA 1XR7A 3FK4A 2CYYA 3W1YC 4HKQA 2KU7A 1B4SA 4KQZA 2DNMA 4E98A 4I0WA 4AXIA 2XTJP 2X1BA 2LEBA 4O23A 3UD4P 3ENWA 4X4VA 5HJXA 5C2CA 4TYAA 1CJTB 2P9CA 2B8QA 1VJWA 1RXOB 1FWPA 3QYYA 1LKZA 2EC2A 4ES2A 5G0RA 4CZCA 1SXLA 3VWSA 2J0SD 1PYSB 4O0NA 2B4PA 4QWBA 3LH2S 4DV7J 3FGVA 3R27A 2FQQB 3I9V9 3HHKA 3M6WA 1RT2A 1JJCB 1FXLA 2B9WA 3QAUA 1X4DA 5K8OA 3VAGA 4KBIA 1CPZA 1X9SA 3PY8A 3QJPA 3IRXB 2W8KA 4J9NA 3G8SA 3I82A 2YQ3A 3BSCA 5CYQB 1NSKL 2GVDB 4KY3A 3T19A 5CD4H 1K9MT 2E66A 2CPDA 4HHUA 3FUYA 2BEFA 4JV0A 3LP2A 2RF2B 2MLZA 2C2MB 1P6TA 3AD8C 3C6UA 3P5BP 1RAGB 2N82B 1ICEB 3H2LA 4DV2F 4FYWB 3GP9A 3GFXA 5IQ6A 2ZOFA 2CG4A 2E7WA 3PJWA 1DQ8A 1VJQA 1WUUA 2BUNA 3OR1A 5J2PB 5J2QB 3E01A 4QZVB 1J5OB 1U8SA 3NS5A 5KG2A 4XK8C 1XNRJ 1RBAA 4WFYA 5AXLA 4PPDA 1TL7A 1GFWB 3OHBA 1SH3A 5KFOA 1RJJA 5HMYA 1BXNA 1BMQB 1JKHA 2FJDB 1EQ0A 4AL6A 2DJWA 1RHQB 1S97A 4RNOA 1T9WA 4TNOA 1VBKA 3UI3A 1TMJA 5HP1B 4I6WA 4B08A 4DFMA 2FGCA 3SDEA 2M88A 5B0CA 3N4WA 3JYTB 5LT5A 2L48A 1N36F 3CJTA 4KH0B 4XO0A 4L3KA 3CIZA 2RQCA 4B9VA 2HQCA 3POTB 3NBPB 1HKAA 2YWFA 3KLIA 4Q5VA 5ETNA 2FUG9 1CVJA 3MMAA 2GAHC 4DUTA 4NXNF 1MLAA 3VAFA 1WEYA 2JRSA 1ZS6A 1UEUA 2WBMA 3CULA 4ZLJA 3SI8A 1APSA 1WORA 4KHPJ 1AZSB 4B3MJ 2GMLA 3BM7A 1F2GA 2R8GA 1UFWA 2M4MA 2A18A 2DGSA 4DPUA 4NLSA 1F60B 5KFZA 4IRDA 2JEGA 1A6LA 1H2UX 2NXUA 1MN7A 5B0DA 4I1TA 3OUYA 1Q8KA 2RHQB 3M8WA 4JV5J 1FK9A 4HEA9 1JXEA 2Z8QA 1YKWA 3QGGA 2YNFA 1DTQB 3MEEB 1NK8A 3VAIA 1HQ2A 5K14A 1RU1A 3FCWA 5D6GA 3W9JA 1LOUA 2UUBJ 1JWWA 2UXDJ 3MR5A 3ENAA 4KRWA 1JLEA 1KLNA 1Q5YA 3BO3A 3N5BA 2XWYA 4OYPA 3ETMA 1JX4A 3BGRA 1OY8A 4LF7J 3UNGC 2LQBA 1L3TA 2RRAA 3DYAA 1TFYA 4P2SA 4ZPVR 3GR0A 3DLLQ 2QL9B 1SJFA 4RNFA 3J7ZT 1KTVA 4IFVB 1WKLA 4DX7A 2KVIA 3MPYA 3KLFB 5GMDA 4W98A 2QTWA 1FXDA 3FMWA 1B0TA 3WIVA 1S7IA 4OI0A 3Q89A 2CJAA 1CJVA 1XK8A 1S4EA 4TLRA 4LUBA 3PG9A 1KP6A 4OYZA 5HAOA 4ZLNA 4LBPA 1HNVA 1DHMA 1WOPA 2DISA 3R5JB 2Y1LB 2CZVC 3MCNA 3NG8A 1U2FA 3GJTB 1ZAXA 1M5PC 5A2QY 2W7AA 3UN3A 5EGYA 4PCQA 3U7JA 4ZCIA 2NXCA 4QYRA 4DFPA 3AXKA 1C1BA 3NAIA 2V67A 3PHTA 2QO3A 1ZAVA 3MM9B 2OPPA 5DG8A 1RADB 2Q43A 2B6AA 1TKZA 1HNZJ 4ELVA 4PQUA 1BD6A 2WAQD 4LR7A 3MURP 1NHKL 1MMDA 2VASA 4QQBA 3Q8SB 4ZA1A 1NK5A 4NCBA 3BREA 3D67A 4DLEA 3T1HF 4KFBB 1SI9A 3MM7B 2YXLA 3IP0A 3IR5B 1OPZA 4M1KA 2MGZB 1UPMB 3AQOA 1N48A 2XMJA 2Y9HA 4K4XA 1QAJA 3RGIA 3ICLA 2HQ3A 2DH7A 5JVGQ 4P2FA 1C4CA 4O3QA 2M8HA 4QR1A 1Q95G 2BXJA 3GCWP 1CQMA 4MKAA 2H5JB 3H5YA 1QTMA 2FVSA 5FDLA 3C16B 5KT5A 2GHVC 2KHDA 1TKTB 3M1VB 2ZD1A 1CLFA 4FBTA 5CH7B 2XYGB 3C19A 3ELHA 1RAOA 5J2MA 4MTPA 2KG1A 4B3RF 3RRKA 1KVIA 2KT5A 3ENQA 1D9FA 1NK4A 5J1NA 2VFUA 3RB4A 4JI2F 2NZCA 2ZVIA 5BYSA 3CJKA 1KFSA 4JI4F 2BVZA 2MZSA 2MZTA 4ZVGA 1VS3A 1FRKA 3I4PA 2O5DA 4C97A 2PFFB 3R6LB 1TL1A 4CO5A 3V6DA 1RP5A 4OHZA 3QFWA 1VRUA 1RTIB 1EETB 5F3TA 4ETZA 2Y1RI 2HBYB 4M63A 5SUHA 2EK6A 2DYAA 1NJIT 3DDKA 3DGVA 3MEGB 4K59A 2BJ3A 3CD6S 2FZGB 2ASLA 4EMDA 1LW2A 3RAQA 1FFWB 1S99A 2N4DA 3EYZA 1UJ4A 2NZ4A 2PMHA 3IG1A 1D1UA 4X66F 4U95A 1PYOB 3BN4A 3U1LA 3MTJA 1U7LA 2PI4A 3ITHB 4R25A 1E6YB 3UVJA 5DG9A 3SXLA 1NDLA 4B9TA 1LXJA 3SQGA 1T05A 2DXFA 2QRRA 5MAOA 3RW7A 3VTIA 1K1QA 4Q2LA 3NRBA 2IHR1 3DFEA 3SCLE 1DBDA 1X9WA 1OY6A 3HHEA 4CP5A 5KFTA 3V6JA 1OY9A 5EWGA 4HH0A 4TXSA 3GYXB 2F40A 4ZCMA 3LWLA 4IOCQ 3R8YA 4X62F 2VOOA 3MMCA 2DR5A 2ACMA 1U0HA 4AFFA 3SYZA 2I6WA 5IT0A 2ZZTA 1E6VA 3PRDA 2HZVA 3PIPQ 1WTFA 4PPZA 2VDIA 4MH8A 2IBOA 1IBLF 2AQ4A 1KDNA 1RCXB 3MF5A 1KFDA 5I42A 3G87A 2UXCF 1I1GA 2W9BB 4L6V3 3MD3A 1SIWB 1MROB 3FSXA 3CJ4A 2GJ2A 4MIWA 3DC2A 1U24A 4BC9A 4C3MA 3WC0A 3M9OB 1S48A 2HHTA 5HSPA 3PHEA 4IG3A 3MECB 5D3GA 2OTLS 1X0FA 2GJIA 3CCWA 4OZJA 2D9PA 4IKAA 2FLOA 4NLPA 4PWDA 4F0MA 3C6UB 1ITPA 1R0BG 3MCMA 2K1RB 4OIXA 3MR2A 3F44A 4WP9A 3HVTB 2HHPA 2HGNA 1FNOA 2GIFA 3WC2A 2DNNA 2CUYA 4BCAA 4XAKA 1MU2B 2PO4A 3E01B 1I94J 4KR0B 3ILOA 2AJ0A 2W4DA 2OI2A 3OL6A 1TL7B 2ADCA 3GIJA 1KBRA 4GKKF 2JZ5A 1F9FA 2MQMA 3GJRB 1JKHB 3J7Z5 1C1CB 4NOHA 3IAS9 3D5MA 1XN9A 3MMJA 4DV4J 4YEAA 3PACA 4I6YA 3SDEB 1NK7A 3I0SA 4FXDA 4XDDA 1U1PA 2MMYA 2FC9A 1R8BA 1EX8A 2V2VA 2KJWA 1QD1A 5CCMA 4DUYF 3UDEA 3P4UB 4M5DB 2OELA 2KYZA 1V3SA 3KLIB 3U27A 3OHAA 3BQ0A 5KFUA 3D6FB 4ER8A 1MWZA 2XMUA 1OSDA 1RHUB 1ZETA 1N34J 3RW6A 3RR8A 1Q5VA 2WBRA 3MAQA 4FF3A 3RG6A 3CCLS 5F8LA 2C2RA 3JSMA 3P96A 2IJNA 3M8PB 3FC9A 3OUYB 2R8KA 2L08A 5KFLA 1GXTA 3KLHA 5E3RA 1YQHA 2BYCA 1O0PA 1RK8A 4P7TA 5LSLA 2NPFA 3CJ2A 2HS0A 2YNFB 5AJ3F 2BKOA 1UVNA 2BJEA 1TVRA 1OPIA 2QEXS 3GTYX 4KT0C 3L3CA 5K14B 3EGWB 4B9MA 3NNAA 2KN4A 2DXDA 2HHVA 1QSYA 1JLEB 3OSNA 1YVFA 2V2ZA 4DSJA 1IBKF 4GKJF 4ANCA 3W2VA 3W5XA 4ECYA 5BR8J 3FKBA 2HHUA 1H6KX 4ZVOB 3DYAB 4DOZA 3KJFB 3BSAA 4DSFA 4C8LA 2HBZB 2HFUA 2HQFA 3BR9A 4OZLA 2J9CA 1VLOA 3GB0A 2C2KB 4WZQA 3W62A 4YR2A 1CJVB 5ETPA 4DR6F 2IAJB 3L09A 3M8SA 2FHJA 2OFGX 4G1PA 3PTWA 1HNVB 1XNQJ 3BQ1A 3V4IA 2RQKA 4ID8A 3TX0A 2AEJA 2W2PP 3OTCA 1R0CB 2R9LA 4HT7A 1LWFB 4ED6A 3CE8A 3PJ9A 3CD0A 2B4OA 4Y28C 1VGYA 2ACYA 2JL9A 3HSJA 1B99A 1WELA 2NXJA 2CVIA 2IA0A 3HZGA 4TN2A 4FZVA 4F26A 3J80U 1C1BB 2H5IB 5KG4A 2XG8A 2UVVA 4OMFG 1VQ8S 2HRUA 1XQIA 2JX2A 3QGPA 4I69A 4RUBA 2ZHOA 2QJ3A 5FLXU 4QIVA 2B6AB 1TKZB 4USTA 3BGOP 4PQUB 3KDOA 4P73A 1TUGB 3ZZRA 1S6PB 2F1FA 1T3NA 2IM2A 2HIYA 1N33F 5HO4A 1EKRA 4NMLA 1B7YB 2IC3A 1QTNB 5IXUA 1NMEB 2BBEA 2P8IA 5JVHQ 2G2OA 2G1HA 1SVDA 2VC0A 1WKJA 1WF0A 2K7JA 1PGZA 2R8IA 1IR0A 4Q8FA 5AE1A 3C15B 1X4CA 1HMVA 4M5MA 4N8NA 1YJWS 4PG4A 1TV6A 4FYVB 4ECVA 1QE1A 2B9YA 2HGLA 5C42A 3AB2B 2W2QP 4F4YA 2NXNA 4NLXA 4MFBA 1HNIB 5GMKa 1YG0A 5LMUJ 4D3HA 4JI5J 3KMSA 4PUOB 2GQQA 1Q8IA 1YRTA 5CCLA 1IBMF 3CJKB 3QSIA 4YUDA 1M5SA 2I38A 1S7HA 1TL1B 4OLPA 4DBQA 2H9ZA 3MAHA 2LQJA 3OVSA 2ZC4A 4OZ1A 1X31C 3I0RA 4WFBQ 3JTOA 4ZJOA 3AJDA 3WX8A 1BQXA 1IWAA 1YK9A 2GHWA 2NUUG 4DMZA 3HKZD 1U2RA 1FX4A 2PD1A 3IG1B 3O6QA 2CJ9A 2YX7A 4LR9A 4LF4J 3HSGA 1U49A 3CGIA 1RT1A 4N56A 3UVJB 2E9TA 3IS9A 4XPEA 2XLKA 2ILYA 2RUSA 3MUMP 1F1BB 4ZVHA 2G13A 1T05B 4C8OA 3IO1A 4QPTA 3NL0A 3R97A 3KMQA 1KR4A 2ADBA 4H4OA 4DSKA 3MM5B 1QLNA 2DNGA 4I68A 3R1LA 4AQYF 2KTQA 4N7TA 1UVMA 3NWGA 2H3EB 3R5GA 1S1VA 1PG5B 1GMUA 2LEAA 3MMCB 5U47A 3G82A 1S6OA 4L76A 1U0HB 1R3NA 2FB0A 2BW7A 4DU8A 1WC3A 2QA1A 4YB1P 4A8QA 1AYEA 2FGOA 1UWAA 2H1YA 1S1TA 3MOJB 1H0HB 4B9LA 2C2OB 2L9NA 2ILZA 2AV5A 3AJ1A 3KG0A 2UXBJ 3DOLA 1OWXA 4LFBF 1VQPS 1URNA 2HVIA 3MCOA 1ZBTA 3S8SA 4DX8H 1K0VA 2V63A 2N7YA 5D4NA 2AIRB 4USKA 2C2ZB 3L7UA 1FWLA 3BGFA 2RDDA 4PWDB 2Z0GA 3BR8A 2D3OR 4F4ZA 2Q1LA 5DQIA 3A3PB 4RW7A 2DNZA 2DR9A 5HL7Q 1NJXA 5IC4B 3TYTA 5ETRA 4HLBA 4YS2A 1VC0A 3JQJA 2R7TA 2ZH5A 2DITA 1VQ5S 2PIIA 2PDAA 5H9FJ 1AFIA 4I2QB 2YPZA 4FF1A 2E5LF 3QJJA 5J1PA 3PW2A 4IYQA 2YY3A 2V6AA 2FHJD 3OR2A 1HARA 1U1MA 3RBZA 1BWVA 1OSCA 4F2SA 3C6TA 3UCZP 2AF6A 3DLJA 3EJMA 4QR0A 3TVYA 3I0SB 3DNCA 2DRDA 2IA6A 2FDNA 2ZITA 4QYZJ 2M7SA 4DCJB 1FA0A 1NK0A 4LBIA 2QMUB 2GVZA 2KG0A 3HPOA 4OV6A 1N6QA 4YB6A 1SIZA 2K7KA 5KOXA 4X4SA 4P9SA 4ALZA 4CLTA 1EHWA 2EFVA 5DDOC 2W01A 1H38A 2VG5A 3V5RA 4X4PA 1L3KA 5F9NA 4C0OC 2XZWA 5AXMA 2BE7D 1S0VA 3BEGB 4K4VA 3QIDA 4HDGA 4WP8A 2X1FA 1HBNA 1XMOJ 3GR1A 5HMXA 3DOMA 3N28A 1WKKA 3D9BA 3F56A 3J80Y 3JSMB 2I1RA 3K7RA 5B7WA 2HSEB 2HWIA 5IV3A 1HHQA 4NI2A 5E5NA 1C4AA 2RU3A 5FLXY 2A3JA 1TVRB 2YKNA 4GO5X 1X4GA 4ZKAA 3ISND 4OZ2A 2CJKA 3TVKA 3O2IA 2F8MA 1IJEB 3QT5A 4ED5A 2H48B 2AX1A 4B02A 3DRRA 2NUHA 3W2VB 5H9EK 4ZHRA 1VQKS 3IC1A 5HROA 3NOCA 2B5JB 2G2YA 4DZDA 1WD6A 1X5OA 3LGNA 1BQMB 3VF0B 4OI4A 1MWYA 4FVCA 1U6ZA 5A8WA 4FNIA 1NPRA 2R7RA 3HD2A 1EARA 1BUXA 1REGX 3IA0A 4ZIVA 2HG4A 4DR5J 5T7LB 4DPXA 2XGQA 3V4IB 4X4UA 2OMLA 2WVDA 4UW2A 2DPJA 3O44A 2DY1A 4U7CA 4F7VA 1B3TA 1RYSA 4UOGA 1Y3JA 2EPIA 4PABA 1WHXA 4URSA 3GZ7A 1U0SA 5L9NA 3KJVA 1DZ5A 1H7XA 3FVYA 2RE1A 3NCPA 4LFAF 1Q81T 3KNAA 2ROEA 1XTZA 2OEKA 2ZH2A 3IRWP 4LRDA 5IT9U 2E5JA 2HKEA 2M2BA 3WDOA 4YY3J 2AZ3A 1FJ7A 1FXRA 2DH9A 2XMTA 4OX9F 4FBUA 2BR0A 4MIBA 3GFYA 5D78A 3ET6B 3I5CA 4ILMA 2DNKA 2UXCJ 2XBPA 1REVA 1TK5A 1RABB 1RT6A 3EZ5A 4LQ9A 1JK9B 3DLEA 4WIQA 3X3UA 4DEZA 3BH7B 2RSQA 2BJ1A 2BANB 2QMXA 3KK3A 3SMZA 5ITHA 4P52A 2DGWA 1SL0A 1OQ6A 2FJWA 1OJ4A 3MCSA 4JI6F 4Y34A 2X7IA 4USMA 1RAFB 5LMNJ 4IO1A 4F04B 2LEPA 4DV1F 4WK1A 1ELOA 1PAUB 3BZQA 3NGSA 5HLFA 2OKQA 2C1EB 2CPHA 4FKXA 4CLSA 1HMVB 2V68A 1U25A 2DRBA 1PCAA 4DL4A 1TV6B 2L9DA 3GSIA 1PBUA 1FJEB 1VR6A 1QE1B 2QYCA 5KFQA 4F3QA 1S0OA 4U6PA 4IQXA 3KHGA 4WZMA 4I56A 4MFBB 5J2NA 2CQ1A 4F4AA 4NLUA 3RBXA 3FQKA 4AL7A 2ZHAA 3OW2R 2OSQA 4LIRA 4P71A 1RWVB 3Q23A 1NJYA 1TK0A 1IWGA 5KFVA 2C42A 1T02A 2BJ7A 5L8RC 1S1WA 2VBYA 1DQAA 1NM2A 3I0RB 3JAMU 4ECZA 5GVQA 4KPCA 3H2VE 3UDLA 2X1AA 2NYHA 4J9VA 4RNMA 2CWKA 3QAEA 2GS8A 4LF6F 4YDDB 1R89A 4DI6A 3DLGA 2R3VA 2LQ5A 4ED3A 1U6BA 4YN3B 1WHWA 2B56A 2V4JA 2UUAF 1RT1B 4F2RA 3QO9B 3HK2A 3IS9B 3M2RA 4USHA 2DHHA 2B51A 2BMBA 5D0RA 1UJ6A 2IVFB 4DX6A 4RW8A 4DQRA 4H4OB 1TUWA 4ZP7A 4DS4A 2BX6A 2CQIA 4TKTA 2ATCB 1HBMA 7FD1A 2DNPA 3UQSA 2XEXA 5E3CA 5I3PA 4WXOA 5CYMA 2XHWA 2HQGA 3T3FA 1S1VB 1X5TA 2DHAA 4FXVA 1PIEA 2VBXA 3T9ZA 1AA1B 3OXLA 1UP1A 2DGQA 5IV4A 2HMIA 1SQEA 4NA3A 1VC6A 1HLWA 2HNYB 1N5QA 1JLGA 2FJBB 1ZAWA 6AT1B 1J27A 4YHHJ 1S1TB 3VGTA 5H9EJ 4DV7F 2HFSA 3G6XA 3VVUA 3GE9A 1RT5B 5KFGA 3HFZB 3RAMA 4IG0B 3VVTA 3I5BA 4UOCA 1WG5A 3D2WA 1N5SA 3LP0A 1J2VA 1UMJA 4DL7A 1FVQA 1IKYA 1UTAA 1NDPA 2LDIA 3HVAA 4W92B 1NCLA 3LA0A 2BZ2A 2FY8A 3SEOA 4RW7B 2V2QA 2GNKA 3PV8A 2G0IA 3IWLA 4LF1A 5DLGA 2I5JA 3PYDA 3LAMA 4UOFA 4NLRA 1GQEA 1R8HA 2QL5B 3DRYA 3CTRA 4MKYA 1FRMA 1SV5B 3DGPA 3S01A 2LU1A 2FC8A 5M2PA 3OLAA 1Y9OA 2UZAA 5DO2A 5KFXA 1HW8A 4X84A 3OFGA 1XNRF 2CQDA 2KFYA 5G4DA 4ZVFA 2C2DA 3P49B 3OR2B 2W24A 3TJ9A 3KUEA 1FJGJ 3C6TB 2KXHA 5L1KA 1W2BR 3TQ1A 1SUQA 2QMWA 2AMCB 3PW4A 1XR6A 1VQ9S 3MR7A 2HFNA 2GVZB 3BBFA 3G8QA 4Q0BB 2A1BA 2XY5A 3DI6A 3K57A 4ICLA 1JLCA
chains in the Genus database with same CATH topology
2B5JA 2MXYA 2QSFA 1ZAXA 2HNDA 1DFDA 1ZM4A 3MD1A 2VA3A 4DSIA 1M5PC 5A2QY 2W7AA 3HX9A 1BQMA 2IJFA 1FKOB 1DLOA 3IN5A 4J9LA 2RILA 1SKSA 2ZH6A 5EGYA 3PFOA 1HBNB 4PXBA 3KLEA 4PCQA 3U7JA 1N0UA 4UY8T 3VQSA 4ZCIA 1M1KT 1KQSR 3TP2A 4WE1A 2KT2A 1VIOA 3CO9A 2MKHA 4QYRA 4DFPA 1C0UB 2KFNA 5IT9Y 1C1BA 3OSPA 2KJVA 3NAIA 5E3QA 2RDIA 3LQVA 4KHPF 2IRYA 3I9ZA 1KLMB 2ERRA 1LWCA 4NCGA 3N9UC 2QO3A 4B3MF 1ZAVA 3MM9B 3PX4A 2OPPA 1DRZA 3GFHA 3KK1A 2OIHA 1IKVA 4LSLA 5DG8A 1R27B 2MZJA 5KFEA 5GAHI 2XLJA 5T7LA 1UL3A 3I5AA 3TAMA 5A8RB 2MY8A 4ECTA 4Y2MA 2R2TA 2Q43A 4RUHA 1FDDA 1FRJA 2B6AA 1TKZA 4GO7X 3FDSA 1FT8A 1V9OA 2RUGA 4ELVA 4PQUA 2YKNB 2B7BB 5I3QA 1G3OA 1BD6A 2B43A 2WAQD 1S77D 4KO0A 3MR3A 2VFTA 4JV5F 3CCTA 3MURP 4K5SA 2VKRA 3Q8PB 1LW0B 1QAYA 3KWMA 1MMDA 2VASA 4QQBA 4ZDNA 4F50A 3Q8SB 4ZA1A 1NK5A 4C98A 2K3IA 4NCBA 3BREA 1FCAA 1YJTA 4DLEA 3H4BA 4YDXA 3T1HF 4KFBB 3NMRA 4MKBA 1SI9A 3MM7B 4QW9A 1D0EA 2F8HA 2VFVA 3DRRB 1YI2S 2QV6A 3HFKA 3UDCA 5B0GA 2OSRA 5CYJA 1M5VC 5LXYA 2G4BA 4UQTA 3IR5B 2UXDF 4ZHRB 1OPZA 1NHVA 4M1KA 3K59A 2MGZB 2FLNA 2DGVA 3AQOA 2DT9A 2XGPA 1N48A 3CJ5A 2XMJA 2XS2A 2KDOA 4A8KA 2CRLA 4C8ZA 1R31A 4K4XA 4X4NA 1S79A 1QAJA 1S0MA 4ED1A 1F5BA 4OQJA 2G0CA 3ICLA 5DGAA 2J7UA 4OHVA 5IM0B 2LLZA 1KEKA 4R5PA 2XCPA 2HQ3A 2DH7A 5L1LA 5JVGQ 2EFOA 2VH7A 1C4CA 1CSJA 3IGVA 4O3QA 2MKIA 2F9JA 2M8HA 1YTYA 4ELTA 4KKOA 4CNYA 1H2TZ 3IR7B 4QR1A 3CCSS 2HNZA 1HI0P 4O3NA 2BXJA 3DLKB 5CHCB 5A8WB 3MXHP 1FJGF 1CQMA 4MKAA 4RW6A 5F3ZA 4JUZA 1DJ0A 4FF4A 2GHPA 3D28A 4CTAB 1N5VA 3EXYA 4KPYA 2ASYA 4KIAA 4QIFA 1QVFR 1IKXA 2M3DA 3H5YA 4I7FA 4KV8A 3TA0A 2X1GA 1QTMA 2MQNA 4J5OA 1FKAF 2FVSA 2UVRA 2P6SA 5FDLA 4QBUA 5KT5A 1N5YA 2ZJRQ 2GHVC 2HAIA 2RU9A 1K73T 5E33A 1F5CA 1XMBA 2KHDA 2LCWA 2ZDPA 1TKTB 2DB1A 5AXNA 3M1VB 2ZNZA 4QIGA 4MK9A 2N7CA 2BANA 1MMNA 2N3LA 2RS8A 2ZD1A 3H8YA 1CLFA 4DQIA 4FBTA 5CH7B 1S9EA 1WHVA 1D3WA 2FY1A 2B4UA 1X8DA 4OHYA 1FJCA 2C3PA 4OJGA 1LK5A 1R43A 2PMZD 2D3ZA 1KS2A 2M52A 3MR6A 2RT3A 1FDAA 5J2MA 5F8IA 4MTPA 2KG1A 2JEFA 3D1QA 3OPKA 3RRKA 4B3RF 5D8HB 1JLAA 1KVIA 2KT5A 2V94A 3ENQA 4G1QA 2MB0B 1D9FA 3P5TL 4NYOA 4F4XA 1NK4A 5J1NA 2YWHA 2VFUA 1URRA 1ZPWX 1M5OC 3RB4A 2GQCA 2HHXA 4JI2F 1RTDA 2HPUA 2CPFA 2JLFA 4K4WA 2K2PA 2O01C 1P8GA 1U6FA 5BYSA 1Q1KA 3CJKA 3SCJE 2ZE2A 1KFSA 4JI4F 2BVZA 2MQOA 2MZSA 1O8BA 2E5HA 2EFPA 2MZTA 3FZBA 4ZVGA 1VS3A 1FRKA 3I4PA 2O5DA 4EEYA 4C97A 3V6KA 2PFFB 2IC3B 1TL1A 1RT3B 4CO5A 1QAXA 3ZC4A 3V6DA 4H4MB 3H2UB 4NLWA 2YWEA 5D77A 3PR5B 3QLHA 1RP5A 2HIQA 4OHZA 2E44A 3KKFA 1VRUA 1RTIB 3I87A 1EETB 5F3TA 4L3NA 4ETZA 2Y1RI 1QY7A 3TR5A 3JAMY 2AGOA 4ZP6A 3CUNA 2HFOA 4M63A 5SUHA 2C22A 1YIJS 2EK6A 3M2VB 1NJIT 3DDKA 2CQ0A 3MEGB 1KQFB 4RU2A 1RT7B 3CCQS 1L3UA 1VQ6S 4K59A 1T94A 3VZIA 2COLA 2DK2A 2FJAB 3QIPA 5EHHA 2GO8A 3CD6S 2ASLA 2GGPB 2R2RA 1YJ9S 1LW2A 4O3RA 1SB6A 1REVB 2NSBA 2ZUGA 5CXTA 5D4PA 3IWNC 2DVIA 3RAQA 1S99A 2N4DA 5M2RA 4A46A 2ZM6F 5K8NA 3EYZA 1HI8A 1UJ4A 4NRTA 3PFEA 2NZ4A 3DLEB 1HNZF 2FLPA 3TI0A 2PMHA 1DTTB 3IG1A 1D1UA 2IFXA 3CDEA 4KSEB 1BC6A 1B0PA 2GC8A 3I31A 3NGKA 5C24A 3HO1A 4X66F 3JSBA 4AL5A 4TQSA 2GV1A 6FD1A 4EWTA 2V9KA 1JJ2R 3BN4A 2IBKA 3U1LA 2C2EA 1XMQF 3MTJA 1U7LA 2PI4A 2XB2D 3ITHB 4R25A 5F0UA 2WONA 2CDQA 4H54A 4Q43A 1E6YB 5C42B 5DG9A 3BO4A 3V81B 3SXLA 4ZLPA 4YP3A 3PW5A 3M32B 5HBMA 4B9TA 2KZZA 4A8MP 3B78A 2Q6BA 3O1LA 1M5HA 3U02A 3PO4A 1G1XA 1LXJA 4F8RA 3SQGA 4GC7A 2VFSA 1T05A 2BABA 2KM8B 3Q2SC 2ASDA 5GADI 2UUCF 5CYQA 3ZZ0A 2QRRA 5MAOA 2AWZA 3RW7A 2W7PA 3O8WA 3VTIA 4B9UA 1K1QA 4Q2LA 4UQGA 2PEHA 1FE0A 3NRBA 2IHR1 3DFEA 3R3TA 2EC0A 2UUTA 3SCLE 1DBDA 2VC1A 5KFKA 1X9WA 3LANA 1HQUB 3HHEA 2RD5C 2PSZA 3IWXA 5KFTA 3NAHA 3V6JA 4QW8A 2DGUA 2RF2A 1FVSA 2V8HA 3JTPA 5EWGA 2QA2A 4TU8A 2XS5A 3BQ2A 4DPOA 4HH0A 4TXSA 3GYXB 2F40A 4ZCMA 3LWLA 2ZC3A 1P9QC 2IRXA 4RW9B 4IOCQ 3AH6A 1VK3A 5JXSA 4X62F 1RTJB 3UE2A 4CH0S 2VOOA 3MMCA 3MEDA 2DR5A 4IRKA 4Y0FA 2DGTA 4XDCA 3MHYA 4AFFA 1EP4A 1HPZB 4A47A 2HS4A 3M05A 2FTRA 4DS5A 4C9DA 2R7OA 2WW8A 3QO9A 3HHLD 3SYZA 3RRHA 5F0WA 2DIVA 2AJ1A 3A1YG 5IT0A 2C3MA 1Z1ZA 2E5GA 1Z2LA 2X51A 1E6VA 3PRDA 2XC9A 3O3LA 1VHFA 3OV7A 2D74B 3PIPQ 1WTFA 1BWEA 4QOTA 5C25A 3ZZYA 4PPZA 4Q44A 4HTIA 5J2PA 1QUPA 3MTKA 4MH8A 2BM0A 2IBOA 2N3OA 4CO2A 2YNGA 4LF7F 1IBLF 2Q79A 1M90T 4WJBA 3GIIA 2B0GA 2AQ4A 3VAKA 2CPXA 3UCUP 3MF5A 2RIJA 1KFDA 5I42A 1FEHA 1JLBA 3TARA 2OH2A 3N6MA 1I1GA 2P5VA 2UXCF 1YHQS 1L5UA 5KTQA 3K0JA 1Z4UA 3H20A 2W9BB 4LF9F 4L6V3 4B3OB 4NWBA 3MD3A 1SIWB 5F8JA 1MROB 2XMMA 3FSXA 1UVIA 2JVOA 3CJ4A 2GJ2A 4MIWA 2YVSA 3DC2A 4DUZF 4JI1F 1U24A 4RX6A 4DHVA 4BC9A 4C3MA 3WC0A 3M9OB 1S48A 4J9RA 3LO3A 3KHHA 4J9SA 2HHTA 2O3DA 2EBGA 3PHEA 4K50A 4IG3A 3W2WB 1S1WB 3MM8B 1JLFB 5EX0A 3MECB 4AYBD 5D3GA 5EWEA 2OTLS 1X0FA 2GJIA 2FIUA 5HP1A 3KNGA 2KYXA 1NHUA 4F25A 1HHSA 2PA8D 3DMJA 2AX0A 2IM1A 2EFQA 2E5IA 3CCWA 4OZJA 2HNYA 5JJBA 2D9PA 1R0AA 1U1NA 2K3KA 4IKAA 2APOA 4EGLA 2FLOA 5KFHA 1W25A 3EZUA 1FKPA 3K2YA 4H4KA 5K5MA 1NNDA 2V4RA 4NLPA 4PWDA 4TQRA 3SSRA 1MW7A 3CDUA 4WXWA 2D7SA 3C6UB 1LWEB 4TY8A 4KHRA 4FXWA 4Q8EA 3DLGB 3JSYA 2HHSA 2GFFA 4I2PB 2DRAA 4B9NA 1TL4A 2VG7B 3GG1A 1KHVA 3LALA 4N8OA 2KO1A 1YGYA 2K1RB 4RBTA 3OLBA 2BJDA 2DCLA 2YWGA 1FTCA 3KG4A 5KFNA 4OIXA 1OIAA 1NU4A 4WFZA 2V4JB 3U1MA 4O0IA 4DL2A 1F0XA 3MR2A 2MDAA 4HVZA 4LVOP 5E2QA 5LJ3Y 3UWTA 3F44A 4TLQA 1ZZFA 1RT5A 2HHPA 2AYEA 3HVTB 2YNHB 3M2RB 2XI2A 5A0YB 2HGNA 1U48A 1HL6A 5KG5A 1U45A 2DPIA 1FNOA 2PC6A 2OAUA 3WC2A 1ZM9A 2DNNA 4IG0A 3OFHA 4RU9A 1S6QB 4BCAA 1WNEA 4XAKA 1MU2B 1Q79A 1OS5A 4FF2A 5EWFA 2PO4A 2V9WA 3B4MA 3E01B 4QWEA 4K4ZA 2FJXA 3OFEA 3R5CA 2YH1A 1JIHA 4KR0B 2OTJS 4URQU 1HD1A 3N6LA 2AJ0A 2W4DA 3ONQA 3M8RA 1VQLS 3OL6A 2W9CA 2CQ3A 3OJSA 4A8XA 2ADCA 2GW8A 3GIJA 4GKKF 1HBMB 2JZ5A 4NLGA 1F9FA 2MQMA 2RVJA 1T03A 1MNEA 3DOLB 5CYMB 3SV4A 3ZZTA 5K8PA 1N88A 4O4GA 1JKHB 5J1EB 5B0AA 3J7Z5 4ILRA 2XNQA 1C1CB 3PX0A 4NLVA 3PW0A 4NOHA 4OHWA 3OTEA 3NS6A 2MHEA 3TA2A 3CMAS 3IAS9 3DHXA 1JLQB 2EKYA 3D5MA 2HMIB 1XN9A 2UVUA 1WEZA 1VBZA 3MMJA 4OX8A 4YEAA 2HZCA 3PACA 2NLWA 4I6YA 3SDEB 4R0EA 1NK7A 2J6SA 4JI7F 3CVKA 3J7YI 3I0SA 4FXDA 2RQ4A 4QIWD 4XDDA 1NB7A 4C3LA 2M9KA 1U1PA 1SV5A 2ZJPQ 2MMYA 5FJ4A 2FC9A 4DR2F 1R8BA 2HYIB 5DGBA 2KJWA 5KFAA 2EI5A 4F3OA 1VRTB 1T7PA 2F8EX 3J7A1 5CCMA 3HHDA 1B64A 4DUYF 2GX8A 2J0WA 2XSFA 2BA9A 3GQCA 3OTDA 1KN6A 2MKJA 4M5DB 1VBYA 5KFPA 2KYZA 1V3SA 3KLIB 3U27A 3OHAA 3BQ0A 4MJKA 5A8KB 3DM2A 5KFUA 2LDYA 4ITSA 4ILLA 4ZMMA 2F3JA 3HHLB 1X7VA 3VAHA 4ZOSA 1MWZA 2U2FA 4UY85 4DG1A 4X64F 2CFXA 2DD8S 1N0VC 4WF9Q 1KQGB 3LW5C 1JMTA 1OSDA 2XMUA 3BO2A 4Y2AA 1IN0A 1U09A 6FDRA 3CCZA 3EXCX 2U1AA 3BN7A 1ZETA 3LP0B 1HQEB 3RW6A 4WKRA 2AJ4A 1Y7PA 3VR1A 3RR8A 5GAEI 1WI6A 4V19J 1IKYB 3AA9A 1TKDA 2WBRA 3T1AA 1H98A 2YKAA 1X4AA 3M6UA 2MKSA 3MAQA 4FF3A 1NAQA 7FDRA 2XS7A 3MZIA 4V19X 1HBOA 3DOKA 1XEZA 3CCLS 3P6YC 2IYGA 2HWTA 5F8LA 3JSMA 2C2RA 3P96A 5LJ5Y 3CIMA 4OFZA 3MMBB 2IJNA 3M8PB 1V3ZA 4Q45A 5E3AA 3OUYB 2L08A 2R8KA 5KFLA 4OJ3A 4Q0BA 1GXTA 2VQFF 2FD2A 5E3RA 3KLHA 4KB7A 3GV5B 2DR7A 1YQHA 1SJ4P 3CD7A 5KFDA 4CT8A 4ATNA 2BYCA 3B4DA 4O44A 4DN0A 5LXRA 1O0PA 1RK8A 2NPIA 3RAXA 4P7TA 3H5XA 1VLYA 5LSLA 1KSPA 2NPFA 2YKQA 4D3GA 3CJ2A 2HS0A 1RTHB 1VIXA 2M0GB 2YNFB 3ZZPA 3HMJG 5AJ3F 3SSQA 4QWCA 4EFAC 2BJEA 4ZCLA 1UVNA 1TVRA 3EGNA 1OPIA 1VQ4S 5DDRC 4A8SA 2QEXS 4KT0C 4OX7A 3L3CA 4CCHA 3CCMS 2VD3A 1IKWB 3DN9A 1GXUA 1Q4RA 2DO0A 5K14B 3UFCX 3EGWB 4B9MA 3NNAA 2KN4A 5IS2A 4LSNB 2WOMB 2AYBA 2HHVA 3M30A 1QSYA 2MYFA 1JLEB 4WFXA 2KXNB 3OSNA 3PX6A 3GIMA 1FKOA 1YVFA 2DNOA 1N6QB 2OD4A 4DSJA 4WTYA 3M9MB 5B0BA 1I94F 4JYAF 1TKXB 1ZM2A 3EGZA 2W4PA 1IBKF 4EO6A 4UUWA 4GKJF 2E1AA 4FN5A 2EFNA 3MDFA 4C7QA 3CB4A 3W2VA 4DSLA 1RGVA 2VG5B 3IGNA 2EK1A 4ECYA 3H98A 3ISNC 2HHUA 1D9DA 1VI7A 4K4SA 4C8MA 4A8OA 1H6KX 1YRUA 3KTQA 2ZOMA 3DYAB 2NQPA 1M0SA 3MM9A 4DOZA 3T9NA 3BSAA 4DSFA 1SUQB 3CXCR 1G7CB 3MUTP 1UETA 4C8LA 3TAPA 3AY0A 4ZCKA 3DRPB 4BWMA 1OQ3A 5A8RA 4HDHA 2LXIA 3BR9A 4C11A 5LSRA 3CC4S 4OZLA 2C28A 3PXGa 4NPOA 1TUVA 2J9CA 3LP1B 3HVRA 5A6WA 3Q8QB 3TW0A 1KOOA 1CC8A 4TY9A 1UWBB 2DHGA