4DV5F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv5F00
4DR7F 2UU9F 4GKJF 1HR0F 2UUBF 4DR5F 4DR4F 4DV6F 2UXCF 4JI7F 4LF9F 2UUAF 1J5EF 1CQNA 4DR2F 2UXBF 4X62F 1LOUA 4DV4F 1XNRF 2HHHF 4JI3F 5AJ3F 3T1HF 4YY3F 5BR8F 2YY3A 5LMUF 1HNWF 1XMQF 4JI0F 4LF7F 4B3MF 4DV5F 1N32F 4X64F 2VQFF 4JYAF 4DR3F 4DV3F 1XMOF 1N33F 4K0KF 1IJEB 1G7CB 1IBKF 1FKAF 4JI1F 4B3TF 4LF4F 2KJWA 4LFCF 4OX9F 2BXJA 4LF6F 3T1YF 4LFBF 2B7CB 2VQEF 1IBLF 1F60B 2J5AA 1VMBA 4DV2F 3R3TA 4DR6F 3ZZPA 2RJZA 1G1XA 2UXDF 4JI2F 4DV1F 4NXNF 4DUYF 4DV7F 4B3RF 4DUZF 4NXMF 2BVZA 2ZM6F 4DV0F 4AQYF 4DR1F 5IWAF 2B7BB 2KJVA 4JI6F 1XNQF 1I94F 1IJFB 1N34F 4KHPF 4LF5F 1HNZF 4JI8F 1GH8A 1FJGF 1CQMA 4JI4F 4X66F 4JI5F 4YHHF 3OTOF 4B3SF 4GKKF 1RISA 4JV5F 2E5LF 2UUCF 1IBMF 5LMNF 4X65F 1HNXF 1QJHA 4LF8F 4LFAF 1N36F 1B64A 2F4VF
chains in the Genus database with same CATH superfamily
4ZPCA 4LF2A 1NJXA 3TZYA 1SXLA 2YWHA 4RO0A 3DLJA 2HHHJ 3TUIC 1FO1A 4TKTA 6FDRA 1MWZA 5EN1A 2RMLA 4LF5J 1U45A 2EKYA 3MF5A 1F9FA 4F3MA 4FNIA 1H72C 3W2VB 1W26A 2HVEA 2XHCA 3A13A 2I8EA 2YNIA 2UXBF 3KLFB 3Q83A 4IRDA 1LOUA 4AT1B 4F67A 5GAGI 4UY8T 2RRNA 2H65B 4PPZA 1EARA 1UZDA 3EVMA 4CI0B 1RTHA 3BGOP 3T5LA 4QWEA 2YH1A 4WFZA 1TVRA 4RUAA 4XO0A 4M5LA 4JI0F 4CT9A 1TL7B 4KH1B 4Z7YA 2MXYA 2DH9A 1BQNA 2PMHA 4U96A 3QRQA 1JMTA 1UL3A 1XERA 3MDFA 4I0WA 4KO0B 3SV3A 3QSYB 2OELA 3ILIA 1G7CB 4K0KF 3FBCA 2UP1A 1J2VA 4PWDA 2XO7A 2Z2LA 1WHVA 3BDEA 1VQLS 5GAHI 4H4MA 3MCSA 2RNEA 1EB0A 1RTZA 4A8WA 1Q8KA 5D0RA 1VQKS 1U26A 4FYWB 3E3XA 3I5BA 3KJVB 4FKXA 1RT6B 1UW9A 1X4HA 2CIMA 3BPSP 4OI3A 4DHVA 3OVSA 3TANA 1ICEB 1JJ2R 3GJRB 3HPOA 5T41A 3EZUA 3IGNA 5G4DA 3SQGA 1Q95G 2BX6A 4ZKAA 5D6GA 3KHGA 2VQEF 2AQ4A 1U47A 2CXEA 4Q2MA 2GJFA 4DZ6A 5IT0A 2OSQA 4UOGA 4KQZA 5CCMA 1G2EA 1VBZA 3NCRA 4DR6F 2VKRA 1UEKA 3LGNA 3ZZPA 4CO0A 2E7XA 3M30A 3QATA 2N3OA 3GIIA 5F0WA 4EBDA 1S1WA 2Y1JA 1Z2LA 1RT2A 2Q6BA 1YG0A 4DDFA 1NJZA 2UUCF 4BS2A 3CVKA 2L41A 1S6PB 3TVKA 1M5PC 1L3KA 1S6QA 1XR7A 3BEGB 4OZ2A 1VLOA 3IBCB 2V4QA 1YHQS 3D6FB 3LUYA 3HVTA 2JRSA 1O8BA 2XYPB 4H4KA 2R42A 4FVMA 2GV1A 4ZCLA 3DXSX 4DN9A 5HQLA 1MROA 1VR6A 2EG2A 1U1KA 3NWGA 3G9CA 1SC6A 3UD3P 4Q8EA 2W01A 5HMXA 2E1RA 2ZDPA 4RW9A 3PZPA 4FBTA 2ROGA 3UN5A 4X62J 2DXDA 4PXDA 3O5TB 3H25A 1XNQF 4JOUA 3L3CA 2Q43A 3H98A 2LECA 2VV5A 4HT5A 1SL1A 4DCJB 4DG1A 2DR7A 1IBLJ 4B3OB 1SIZA 4DL4A 4OI0A 5GMDA 2FC8A 2DKOB 2VC1A 4USHA 2C2RA 3D2WA 1D9DA 2E9RX 2Q66A 2B56A 5MLCV 1R0CB 3PNIA 2JEJA 1PJ5A 2YKOA 2IFXA 4F36A 2XS7A 3UDLA 3M6UA 1RISA 1P8GA 3CIZA 3MECB 1PC5A 2E5GA 3H59A 4CLFA 4ECYA 2KFZA 3H40A 4B9SA 3N0VA 2P9EA 1XMOJ 4N5SA 1TVRB 1L3VA 1B99A 3H0PA 2U1AA 3MM9A 3C15B 1UCNA 3R27A 2KM8C 1RBAA 5KAKA 2W8LA 2RB7A 1C0TA 5GADU 4DLEA 1DTTA 1U1MA 1KTVA 1M0SA 1DHMA 2YPZA 3ENAA 3AH6A 2V8HA 2JVRA 1MG7A 2DHGA 2UUWA 3W62A 1RWXB 5IZHA 4OV6A 3MURP 2V68A 3CJ2A 2OD4A 2V8GA 3N6MA 4DR5F 4DV4J 1R89A 4WP8A 4RR5A 2GHWA 2E9ZA 1GNKA 4KJIA 2IVYA 1H7XA 1HARA 2CZ4A 3NGRA 1U1OA 1HI1A 2QL9B 4KHPJ 4RW7B 1W2IA 2WONB 4WE1B 2FC9A 4DV2J 1S59A 2QYCA 2H1YA 2EW9A 4CIOA 1H2UX 3VGUA 5EWEA 3DXBA 2DO0A 3C8YA 3LH2S 1NDCA 5GADI 2DRAA 5HVGA 2HQDA 2YNIB 3QLHB 4MK8A 3DRRB 4JI3F 3TZXA 5BR8F 2B9XA 3K7RA 4IFVA 2QMXA 2EEYA 4DV5F 1N32F 4X64F 5F8IA 4WF9Q 2GO9A 3QZ7A 2CJ9A 2WAQD 1RWMB 2CQBA 2E66A 2HNDB 3I9V9 2DHSA 1VQOS 4B3RJ 3IR7B 1JB0C 3MEDA 2QZ8A 4ELUA 4L3NA 4NI2A 1R7IA 4ZA1A 1IJEB 4QIVA 2IA6A 1DRZA 1HQ2A 2W1BA 4I7FA 3CJSA 4RZRA 2MKKA 3VAJA 1BHNA 2BANB 4XDCA 2KTQA 4OYMA 1W7WA 4M5MA 3H4DA 5CYMA 1JLFB 3MCOA 4HI2A 4Z7CA 3HULA 5CA5A 2L3MA 1WG1A 2BACA 2C3OA 1F60B 1N6QB 2ZH5A 2YNFA 4A8KA 1U0HB 2F9JA 3OR2A 4CO2A 2CJXB 4O23A 3CEDA 2HGLA 3A3NB 1IKXA 3O1LA 3QO9A 5L46A 1T9XA 3T41A 2MQNA 3I0RA 5HP1A 3UN3A 1I94J 2I5JA 1WI8A 4JV1A 1S49A 1DQ8A 2H9ZA 1HBMA 1UJ6A 2HNYB 2UXDF 3W5ZA 1G1XA 3Q22A 4DR4J 1T95A 5K8OA 4DI6A 3G4SS 2ZVSA 3TX0A 4G1IA 2I0XA 1YRTA 2UZAA 2V8DA 5D0HA 4BHQA 2RF2A 4ZJQA 2F9DA 4F4XA 2LP4A 3BBCA 4OV1A 3B6BA 3CGIA 3PVXA 2M4MA 4OJ3A 4OJGA 1UA1A 3DHWC 4O4GA 4OZ0A 2APOA 1FD8A 2ZNZA 3B54A 2GMHA 3K89A 2GQ2A 3KUEA 1RQ0A 4HDHA 5KFTA 4Y00A 2MLXA 5LMNJ 1IBMJ 3MTKA 3MR5A 3EUNA 1S72S 2QX0A 4MKVA 1M5SA 1P1TA 1GXUA 4CYUA 2YX7A 4DEZA 1RAAB 4LRAA 1R6YA 4CTAB 4RW4B 2I9SA 3WC2A 4XTTA 3CDUA 4NASA 3TAMB 4ECXA 2CJBA 2DD8S 4ES2A 2E29A 2DITA 2DEIA 4F4ZA 3AFGA 1RA6A 3OL6A 4JI8F 3JTOA 2W7OA 2Y1LB 2X3GA 3BZQA 4CLZA 3FBEA 3NNAA 2HQFA 3NS5A 4IQXA 4QW8A 2G13A 4PYDA 4RL1A 1WD6A 5CZXA 2CVEA 2XLIA 4LF6J 4ZS6A 2R7SA 1H98A 1S7IA 3R5AA 5CD4H 5H9EJ 1UVJA 1GX6A 5KFGA 3K5LA 1FRHA 3ILJA 1QSSA 4PR6A 5B0EA 4GKKF 1I1GA 1KFSA 3HFVA 1GEHA 1SJQA 2J9EA 2W2NP 4HDGA 1J27A 4NRUA 4WFYA 1T11A 2IVFB 4USWA 2OPQA 3M8SA 1GX5A 2XSFA 1KDNA 2ZWPA 3P4UB 2L9WA 4OYIA 2J8AA 3RRKA 3V5RA 4CLTA 3CXCR 3KLGA 1TK5A 1HNXF 1T9WA 1QJHA 2PEHA 2XG8A 5JJBA 4DV0J 4ERDA 5CABA 3DRSB 3I96A 2CQ3A 4LIWA 2R7XA 4OX8A 3RB4A 1FTRA 1TUWA 4LBHA 4Y3CA 1C4AA 3T6BA 2D3UA 5KT6A 1D3WA 3NCPA 3HHLD 3KLEB 1OY9A 1RTJB 2H4WB 4YMEA 3SZ2A 4MKAA 2KT5A 2BKNA 1C2PA 2C2MB 3DYAA 1NO8A 3LALA 3PRBA 3PTWA 5DO2A 1OSDA 5KFAA 3MUVP 4K2JA 4KGVB 1LKZA 3CSKA 4CO1A 1FXRA 2OI2A 2IJRA 3MAAA 3OT9A 4OYOA 1RAOA 1DTQA 2IPOB 3BGUA 3NXZA 3TOQA 4CLUA 5DG9A 2MQQA 4LF9J 3BSAA 1OS5A 2M70A 2ZBIA 3FK4A 3AJ2A 3J7YI 5D4PA 5BJRA 4HACA 3R1HA 4XK8C 2GGPA 2WSEC 4OHZA 2NUUG 4C0OC 4I6YA 1QUPA 3SSSA 4LIRA 5LMUF 4PZVA 4LRFA 2VICA 3K5NA 4BLGA 4KIAA 3GLJA 2MB0B 2Z4PA 4C11A 1U02A 1IN0A 1ULRA 1YITS 2UVRA 2Y9HA 2ZZNA 1RTJA 1DFDA 1VBYA 4BDPA 4N56A 1S5ZA 1V3SA 2CKWA 2HFSA 2JEIA 5L1IA 2RKIB 3DC2A 1FVSA 4CO4A 2JVOA 1QSYA 1FKAF 2DCLA 2AF6A 5JVGQ 4LFCF 4OYBA 2BOAA 4M5JA 2JEGA 3QWPA 2IBKA 3JQMA 3GB0A 3JSMA 4V19X 2JC0A 5DDRC 3HT3A 2XYHB 4B9UA 1ZS6A 4CLPA 3P5TL 1HWLA 1KVKA 1TKTA 3PW4A 1U8WA 1HI8A 4WFAQ 1N5YB 4L3KA 1X5SA 4L72B 1QM9A 3KYLA 4ZIVA 3OXGA 2C3YA 2PSZA 2M5YA 1VBXA 1VMBA 1WACA 2HBQB 2D3ZA 2GVZB 1IKVA 3QPIA 5ETRA 4FBUA 2J9DA 2IRYA 5B0AA 1PKUA 2C2ZB 4BC7A 2DVIA 3TARA 1IQZA 2IDEA 3LP2B 1HWUA 3L7UA 3GFYA 3GMGA 2X1FA 1HIYA 4I6WA 1SJRA 5D77A 5E3CA 4P2MA 3LAMA 1N5SA 4NXNF 4OL8A 4KHRA 4B02A 2AYMA 3KG0A 4NL5A 4J9RA 2A10A 2BJEA 2ZH6A 2OTLS 4B3RF 3DGVA 2ZEJA 4DUZF 1O51A 5U47A 3CCVS 2JWNA 2FLNA 1UFKA 3DLEB 4OZLA 3T3FA 1WSVA 4CLWA 2P2CB 1WG5A 1TK0A 1GFWB 2AMCB 4FYYB 3TEHB 2GJIA 3UR0A 4AQYF 4A8MP 4ZLLA 2FHOB 4I56A 4A8SA 4FF4A 1JLEA 1RSCA 1CSJA 2KYZA 3DDIA 5RUBA 5AJ3J 2IDLA 3MEKA 4H4KC 4TY9A 3DM2A 1KQKA 4QU6A 4HHUA 3KLIB 4DPWA 3G86A 4OIXA 1WNEA 3BH6B 3R7NB 3J7Z5 1SL2A 1D1UA 4J9UE 2V94A 1PIEA 3CJ3A 1LXJA 3LGHA 4JI5J 3Q2TC 4X4SA 3VGTA 1RTDA 2OPPB 5HQ8A 5J1NA 4LFBJ 4O3SA 2NXCA 2GVZA 2NXNA 3HHEA 5M2UA 1HQEA 1PAUB 4YHHF 3BO3A 1URNA 2OIHA 2QN6B 4ID5A 4URQU 1R8AA 2JLGA 2LU1A 3L4BC 4LFAJ 1Y5IB 3H7HB 2EPIA 4PG8A 5J1EB 3PR5B 2MY8A 2PO4A 1Q8BA 3IGVA 4M5NA 4IFVB 3ENVA 3TAQA 2Y1IA 1FRKA 4JYAJ 2XMVA 3C19A 3DU5A 2PFDA 3V81B 3DOLA 2LDIA 3W60A 2G9OA 3ISNC 2GFFA 4UW2A 1UKUA 2R2RA 4C97A 1FTCA 3TWZA 1DJ0A 4QWDA 3MUTP 3IMQJ 3GIKA 4QR2A 5E41A 4XPCA 1Q86T 3T5HA 4GKJF 4QPXA 4LR9A 3JS9A 4A48A 1LWFA 1S9EA 2ASYA 3I0SB 5ETMA 1ZETA 2WB1D 3IM9A 4ALZA 1T03A 1HBOB 1PYSB 1S0NA 4B17A 2XY7A 4FYXB 1K9MT 4NYZA 4NZ7A 1VOMA 4OI1A 5A2QU 4B9TA 4ZPVR 3HSGA 2CWXA 5KT4A 2YNHB 1RWUA 4LVNP 4OYPA 4PXEA 4F0HA 4RUCA 2LXIA 1KTQA 2AEJA 3M1VB 3T19A 4OHXA 2MZJA 1VJQA 4QWCA 4IOBA 2W2PP 2XEXA 2E1MC 2E44A 1RAFB 2IJNA 3R5DA 4CLSA 1BMQB 2M52A 1M5OC 3IRXA 1Q5VA 1TL1A 1HKAA 4KKOB 4MJKA 2F3JA 3DRPA 2MZSA 5A0YB 3BSNA 1HW8A 2IYIA 3NMRA 1YJUA 2MJNA 1NM2A 4HTIA 2BQRA 4J9NA 4B3MF 4DQIA 1B0PA 3MECA 4PXCA 4IFYA 3KUGA 2D9OA 5E3PA 1PYTA 4DPUA 1KC8T 2EFOA 1ITPA 4X84A 3Q8YA 5HBMA 3T9NA 4OJHA 3LP0B 2I2YA 4J37A 4OZNA 1ACMB 4FKYA 1RAHB 3HHKA 4H4OA 3UD5A 2FJVA 2AWZA 3GE9A 4ED8A 3HO1A 4O4RA 3D0HE 3P5BP 2FVQA 3DDNA 2MZQA 3W61A 4GO7X 1Q7LB 3R9LA 2HBYB 3K5OA 4DXLA 2W9CA 3H5XA 2BRLA 2HHVA 1WELA 2ACYA 3IBFB 3JSBA 5C7PA 3PIPQ 5EWFA 5D0GA 2C2KB 4NOHA 3OV7A 3KHHA 4F4KA 1Z4UA 1NPKA 2KH9A 4LRCA 2PGCA 2DNZA 1IR1A 1OO0B 3G8QA 3F56A 5K20B 2FTRA 3PO5A 2XLJA 2ZUAA 2J5AA 1N54B 2B9EA 2PA8D 2YKMB 4WIIA 3ZZZA 5KFVA 2CPIA 3BGRB 3OFHA 3PEJA 2FIUA 4ZPDA 2V8VA 4X4NA 1P1LA 2VJUA 3KWMA 3W65A 4Y28C 3RJMB 3BSOA 2F5GA 5K14A 3G6XA 4B3TJ 1KKHA 1NHKL 3BB5A 1LWXA 2HEKA 4AXJA 4ZVRB 4B9NA 2BJ1A 1VC0A 3K17A 2YX1A 4CTAA 4DSIA 2UV8G 3NGUA 1XQIA 4MAKA 4K50A 3ICLA 4ES3A 1APSA 3M4XA 3HJVA 2VHGA 2VA2A 1BC6A 3LGMA 4KV8A 4DL7A 4C0BA 3PW5A 3D3CJ 3VVTA 4PUOB 1N56A 1MROB 1HNXJ 2H48B 3D68A 3MXHP 1S1VA 2CPEA 4J9KA 1K73T 2GS8A 2FHJA 2XZWA 1OQ6A 3M2UB 4U7UK 4NLYA 2A2DA 1RCXB 3DLLQ 5IM0B 3CJQA 2ZKUA 1U0SA 4ZOSA 4MYUA 3IO1A 3DOMB 3D54A 4TY8B 2PDAA 3CD5A 4MKYA 4WZQA 1IJFB 3TA0A 1ZPVA 2PT0A 3BKTA 3I4PA 1HNZF 2FLPA 4UY85 5DLFA 2ZE2A 1H38A 3QJLA 1VBKA 2HS0A 3EGNA 5DZ6A 2FVPA 3OFEA 4KSEB 2V9WA 2BQUA 3O44A 1WTFA 1X4EA 3OR2B 5DG7A 1JJHA 4HYKA 1HNZJ 3KJFB 2VG6A 5FD1A 3R6GB 1LWCB 4C8ZA 4DFMA 1JLAB 2NXUA 3VWSA 4N8OA 4U8VA 2XY6A 1JLFA 4B3SF 2E5LF 2HLUA 1RT6A 3CD7A 3ETMA 5DS7A 3ZNUA 2XCPA 1QTMA 3KUHA 2BANA 2LQ8A 4FXVA 1IBMF 1ZM9A 4H4MB 2AW0A 3W2WA 3FSXA 3CJRA 4WKYA 3HHDA 3MTJA 5T14A 4X65F 4IRKA 4DU8A 5F3ZA 4PWDB 4L6V3 1FERA 1U6BA 1DQAA 1S4EA 1RT5B 4DV5J 2HQIA 2POKA 1N32J 4S0MA 1UJ5A 3AODA 2CQPA 2XMAA 1RHJB 1YDLA 2HS3A 4DR7F 2XYGB 2NR0A 1REGX 4OZ1A 1IM6A 1WF1A 3G6ES 2FJWA 3IWLA 4OHVA 4DSJA 4Q5VA 3SCJE 3NOCA 2XLKA 1RJJA 1X4AA 2UVWA 4M5IA 3M9MB 1RTHB 1FE4A 1WOPA 3GG1A 5IT9U 3POTA 4IRCA 1S9GB 1HI0P 3S7RA 2C2OB 2XM3A 1N0UA 3MAHA 1NH7A 3Q8SB 1XNRF 1A0OB 2RRAA 1WC5A 3BPDA 1KQSR 1KLMB 2ZBCA 3HZEA 2AX0A 2AGOA 2IRXA 4GVLA 2J6TA 4P7VA 1S9FA 4RU9A 4M1KA 1YJTA 2HHQA 4LF7F 5KFDA 2KZMA 2HZCA 5C24B 1WC0A 3JXOA 2UVVA 2KDOA 1WUUA 1OMSA 3AQOA 5J2NB 6FD1A 5I3UA 2F8HA 1KVIA 4ZCMA 5AXMA 1JXEA 4YDXA 1F6TA 4DR3F 1XMOF 1C0TB 3AD8C 4PQUA 5B0DA 1FA0A 4FF1A 1N4LA 5FIIA 2DGVA 2V6AA 3H90A 3BR9A 4UUWA 3W2WB 2AJ0A 3HVWA 1FRJA 3IAM9 2R8IA 3H2VE 3IP0A 2FJXA 1D8YA 2X1GA 4P72A 2ZHAA 1TFWA 3MWBA 3DKDA 3W66A 4W90B 3RRHA 1Q82T 3BBFA 1IKXB 2XI3A 3QO9B 3J80U 1PILA 1NKBA 2J0SD 1IBLF 2VG6B 1GMWA 3NBPA 5DQIA 2IVMA 2V9KA 1RAIB 2D7SA 1V3RA 1WKKA 4O44A 5CYMB 4DV2F 4B3OA 1TV6B 2N4DA 3FBFA 1KN6A 2ZJQQ 2HVDA 1RWVB 2ZE2B 1VQ4S 3D0IE 4OQJA 1SV5A 2YNGA 4IH5A 3VV2B 4ELVA 1H0HB 2D9PA 4LVOP 4DR5J 2ZH3A 1RWPB 5HROA 2B6AA 3TQ1A 3CCRS 3J7AN 1NEEA 5F8NA 1HQUB 3D3BJ 5IM0A 3BGFA 3PX4A 2R8JA 2V67A 4ZVEA 5DGAA 3CCJS 4K4SA 2ZKTA 3MEDB 2Z57B 1MMNA 3FZBA 2CQGA 4Y34A 3TAPA 2CZVC 5L9NA 3UDVA 1RWWB 3BN4A 2NUHA 1JXVA 1R8HA 1JJCB 5D4LA 5B0BA 4DR1F 1REVB 3TZZA 2MKIA 1JLAA 3HZGA 3MMCA 1NK7A 1JQGA 4CLLA 3GSDA 3EDRB 1CJKA 2M3DA 3I55S 1MLAA 2DNOA 3V2UC 1W2BR 2CJYB 2DT9A 5HL7Q 1JKHA 4DL0C 2QA4G 5JUMA 3JAMU 3J81Y 1TL5A 2KXFA 2B43A 4KE5A 4A47A 1R0BG 1RT1A 4IH6A 3R7BB 4QYRA 4ZPTR 5K14B 1S48A 2UUBJ 1SVDA 3R2CJ 4RW7A 5LT5A 4TU7A 3D67A 5EX3A 5J1PA 1JIHA 1HWJA 1Y7PA 4HLBA 4KPYA 4C0HA 3LTOA 2O5DA 4DX7A 4NLWA 5ETPA 2LEPA 5F8MA 3IRWP 3BJYA 5H9EK 1S0VA 2ZC3A 3QJJA 2KZZA 1CC8A 4XPEA 3ONQA 3QFHA 3VGSA 4WYWA 3H4BA 2GIQA 2WVBA 1KP6A 1VRTB 1V3ZA 4LREA 4A4JA 5FLXU 3MMAB 2RDJA 3HM9A 2H5EA 4K0KJ 3DLKA 3QBCA 2W8KA 2ZH8A 2OPSA 4FYVB 3TUJC 4IR1A 2A0FB 4MFBB 3TNVA 5HSPA 4KT0C 2AGQA 2VF3A 2GJ2A 2AEMA 2DNRA 3ISZA 1S4FA 5A6WA 3UQSA 5F8LA 4K4XA 2KFNA 2B4UA 1JX4A 4Q0BA 3TA2A 3V6KA 2Z58B 4JI0J 1FWLA 2EBGA 3BKUA 3HMJG 1QVFR 2JH3A 4ZVHA 3ZZTA 1NUEA 1DURA 4G1QB 5JMNA 4X4VA 1RHMB 3HCXA 3OTDA 5GVQA 4ECWA 2BDPA 1AUSL 2F8MA 3UVJA 3OL9A 2ZBRA 4JI7F 5HVHA 4IDKA 3PX6A 3I5AA 1CQNA 2QLJB 4DR6J 3PX0A 2OJ3A 4NCBA 1ZA1B 3OXFA 2VIHA 8AT1B 4DWIA 3H42A 4NLPA 4DG1B 3KHRA 4DV4F 1UZHA 4DL6A 3EDQB 3Q8VA 3J7A1 4ZPBA 2ZOFA 4ZVGA 3W63A 2W9CB 3MAQA 3FRZA 3S6EA 4IOCQ 2C22A 4RW6B 3CMQA 2BE2B 1HHQA 4ECUA 2V2VA 5LSRA 3CTRA 3MMCB 4CO3A 1HLWA 1VI7A 2CUYA 2X7IA 3C14A 1RAJA 5KG6A 1RWOB 1RT3B 3KK1A 3GILA 4M5DB 3MMBA 3THTA 3M8RA 2MKSA 1WI6A 3SBMA 3PEHA 2XSJB 3X3UA 4DV3F 4R25A 3J7ZT 4F02A 1FT8A 3PJ9A 5KFSA 4C8YA 1CJVA 1F1BB 3CPWR 3NS6A 4E98A 2HYIB 2EFVA 5M2RA 2ZOMA 3OTOJ 2I1RA 3M1VA 2VPYB 2V5HG 1UWBA 3VGVA 4TU8A 1YTYA 1TTHB 5K8PA 3U1LA 2W4DA 4N47A 3MM8B 4P7TA 2XGQA 2B5JB 3RG6A 2H5IB 5J2PA 2ZUGA 2CQDA 4O3OA 3KMSA 2BQ3A 4YUDA 5ADZA 3RU0A 2OMLA 3MFHA 3GU0A 5D4NA 2XNRA 3C6UB 4YEAA 3U02A 4NLVA 2RJZA 1RTDB 3CDAA 2QRRA 3QNWB 2QLXA 3CF5Q 2WHOA 3TVYA 3FSYA 4DV7F 1EX8A 4ECSA 4CQ1A 4WJBA 3DOKB 3MM7A 1WEZA 3GR1A 8RUCA 4M5GA 4OZJA 2Z30B 3UCUP 4X4UA 2GHPA 4U67Q 1XIQA 1Y10A 1N36J 4KFBB 2VZ9A 5HLFB 3MM5A 1YJWS 3RRGA 3HVAA 4MIAA 3DRPB 4F3OA 4MK7A 1TL1B 2P8IA 2BRKA 3GYNA 3NGDA 2JC1A 3JQJA 2V50A 2V8PA 2C2DA 1T3OA 2GA7A 1FFWB 2QA2A 2NQPA 4KC5A 5F9LA 2RH3A 3N4WA 4NMXA 1D8ZA 2C42A 3ZXWA 3GQCA 4ELTA 2XMTA 5E5NA 1DLOA 4AE5A 1HYSB 2M88A 3L9ZA 5CYJA 1T03B 4C3KA 1D09B 3GIRA 3CW2C 4LBIA 4NEZA 1ZM4A 2CQ4A 3R8YA 4OX9J 3UPFA 1UMJA 1FF2A 1Q8LA 2MEWA 4PWWA 1RADB 1RHRB 2HQ3A 4YP3A 4RWXA 2GQQA 4CWBA 2AYGA 4DZDA 2HHWA 4NCGA 2D3O1 5KG3A 2GHVC 3G8TA 3THPA 1MSWD 4ED5A 2WVEA 5CD4A 1QDUB 3KLVA 4DPTA 2ZD1B 3TVZA 2ZJRQ 4TLRA 1K8AT 2WBMA 1S6UA 1SUQB 1FXLA 1KEKA 2FLOA 2NCKL 2NS1B 2DNMA 3D6HB 1H2VZ 2HFOA 2HG4A 3JSRA 3PYEA 3OW2R 2QMUB 1UETA 4TXSA 5B0GA 4QWAA 4FN5A 2JOQA 1RE1B 2W2OP 1NZAA 2YTCA 5HQMA 2V2QA 4NX9A 4DR4F 2O1PA 4DV6F 4QU7A 1ZM3A 3BV8A 2VBZA 4R5PB 3R7SB 2K7JA 5DLGA 4RNOA 1VQ6S 2OPPA 3FEXB 3UN2A 4ZN1A 3G82A 3HDSA 3WX8A 1IUJA 1Q53A 1X8DA 4JP8A 2M0GB 2EVZA 3LQVA 4OHWA 4PYAA 3GJTB 3H2UB 1FEEA 3LP1A 1ELOA 4U95A 2HHHF 2KXNB 3KOAA 1QUVA 4IO1A 2FY8A 2RILA 3DMJB 1EQMA 2V2KA 1KSPA 5AE3A 4DR7J 1NB7A 3ZZ0A 2BMBA 1MMLA 4F25A 5HAOA 2YKPA 1WHXA 4ICLA 2MDAA 2OHDA 4ZVPB 2HQGA 4F2RA 5HMZA 3X1LB 3VTIA 1JLEB 2CNNB 2IMOA 5D3GB 4PG6A 4GVBA 1LXNA 1JLBB 1S1UA 2DGQA 3OPKA 3KK3A 4ZVSB 1FKPB 4CM2A 2QYGA 1KD1T 2OAUA 4L75A 2RHSB 3RAXA 5D3GA 3DLEA 1CBKA 1M5KC 3EGZA 2YKNB 2DY1A 4ICLB 4WU3A 4YB7A 4B3TF 4CCHA 2ZOGA 1QAXA 2DNKA 3RTVA 1WTBA 2M8HA 5A76A 4ZP7A 3CCLS 1VQ5S 2GO8A 1VQ7S 2HHPA 2PA3A 4CLYA 1RT7A 1CPZA 3TJAA 2B8QA 2KFYA 1X9WA 2MZTA 1TKXB 1JLGA 1TKZA 4NLDA 3W8GA 2CDRB 3G96A 1R27B 2BXJA 2LU2A 1DTQB 1SH0A 4ID8A 1NHUA 4XDDA 5IOLA 1EQ0A 1TR0A 5LJ5Y 2HS4A 2R7UA 3M8PA 2AV5A 3M2VA 2VKZG 3GFXA 1YKWA 1HHTP 2P6SA 3LF0A 4PCQA 5G0RA 3RAMA 1Q7YT 4OLOA 1YRUA 2MQ8A 2W25A 1ZZNA 3CC4S 4ILMA 1VCTA 1Y00A 2Y0SD 1C0UB 2XMMA 3ZO7A 1H74A 4ZVUB 2VG7A 3UW1A 1WEXA 3LPYA 2DGTA 4RW8B 3CCUS 4JV0A 1QAJA 2J0WA 2P6TA 3HHLC 1SC3B 2ABYA 4C8KA 3GZ7A 1A7GE 2GZOA 2FYXA 2GMJA 1IR0A 1NJWA 1FESA 2E5IA 1X31C 3IFEA 5E0OA 2E7VA 2E5JA 1H2TZ 2ASLA 1FKPA 2ROEA 4IR9A 1P9QC 5A6PA 4HVZA 5CHCB 2YQ0A 4DV7J 2JLEA 3GFZA 3M8PB 4BWMA 4NLGA 4KGKA 4C4WA 5A0YA 3TR5A 4EYHB 2VOPA 4NXNJ 2JL9A 5B0CA 3QAEA 4QIEA 5KFQA 1FDAA 2IJFA 1S12A 1M1HA 3GWCA 1HA1A 1NH8A 1ZAVA 3LP1B 4J91A 1JLGB 1FK9A 3ILLA 4C8NA 2G1HA 2FDNA 2I5JB 4ZVQB 2XHWA 3CDWA 2Z2YB 4HHHA 1DZ5A 3GIMA 3ZTRA 4TU9A 3R97A 4RNMA 4FPIA 4R5PA 5ETNA 4WYLA 5F41A 2DNQA 4QBUA 4KGZB 1ZZFA 1MNEA 2ALYB 3DYAB 1RK8A 3G2XA 3IA0A 4O3PA 4YB1P 1U1LA 1IM4A 2ASJA 2QSWA 2RAQA 4L76A 1S1UB 2DNNA 2EFQA 2W9AA 1MW7A 4ZCIA 4ZP9A 5ETSA 3BQ0A 3V4IA 2WVFA 3EJMA 3KK2B 2BJ3A 2N3LA 4PG4A 3B78A 3U27A 4DR3J 1J5OB 3QT6A 1NJIT 4EZ9A 4U6PA 3N28A 5DJBA 4UQGA 1X4GA 1NSQA 2VU5A 1JLQB 3A4TA 3TEGA 2BZ2A 3VAMA 1X5TA 3P45B 2AZ3A 4J9OA 1UA0A 1V5IB 1VQYA 2NPFA 3QGGA 4N8NA 3OLBA 3GJQB 1NXIA 1JK9B 5LXYA 1AT1B 1SQFA 3QT8A 2D74B 1WKLA 1XNRJ 1FJ7A 3WX4A 4QYZJ 4BWJA 1QSLA 4LRDA 5KOWA 1R3NA 2OKQA 4P10A 3UE2A 4WTOB 2HURA 2O3DA 2AJ2A 1AB8A 1YK9A 2FJBB 4PWUA 5HATA 5B09A 3I5CA 3EX7B 1I3OB 2AZ1A 2PMWA 2RDIA 1NK9A 5AJ3F 2HPUA 3HD2A 4J7CA 4GKJJ 4YY3F 3EPIA 4EI2A 1T7PA 4MTPA 1GAOA 1XMQF 4U7UD 4FNHA 1PO6A 4A46A 1FEHA 2RD5C 2FY1A 4DUZJ 3DN9A 1SH2A 1JNZB 5I3UB 1V9OA 3M9NB 4ED6A 1S10A 5KFFA 4ZHRA 1RT3A 3KK1B 3LA0A 1FVQA 2MMYA 1UVLA 2RF2B 1AXQA 3TP2A 3C15A 1B7YB 3BBBA 4GKKJ 4I2PB 1E6YA 4W98A 3O2IA 4DPOA 2F8EX 3QYYA 3U7JA 2DPJA 1LW0B 3GIJA 3FRYA 3ZZOA 3GCWP 2HHXA 4RBVA 4X66J 5LSLA 2BEFA 2H4YB 3PKMA 4Y2KA 5K9FA 3SCKE 5KFXA 3D9BA 1O0PA 3JQKA 5L1JA 3KKFA 5J2PB 5T7LA 3GJSB 4FVCA 4HHJA 5C25A 4JI6J 1UPMB 1RBOB 1N5YA 5DDPC 3MM5B 2DRDA 3Q8UA 4K8RA 5ETQA 5JXSA 2MGZB 2ZHBA 1JWWA 3OL8A 2GCFA 4AL6A 1FNXH 4ATNA 1SJ4P 3BYPA 3TUPA 1UEVA 3JSMB 4A8OA 1G3OA 4DUYF 4Q0BB 1QY7A 1VQSA 3N9UC 3D1HA 1BLUA 3KFWX 3QGIA 2IM3A 5J2MB 1GTHA 1Y9OA 3HSDA 3MR3A 2W2QP 1A6LA 3DLKB 4NXMF 2DBBA 3D1OA 3F0NA 3RZAA 1UPPA 1HD1A 3PY8A 2PN6A 1LEOA 3KG1A 1U2FA 2ZZTA 4FF2A 3PW0A 3GV5B 1RA7A 2D3OR 5KFZA 3N01A 5L8RC 5KG0A 3SYZA 2IAJB 4DV1J 1U25A 4RW6A 1VRUA 4DOZA 4USUA 5J2QA 1VC5A 3CD6S 4JBCA 1TUGB 3BR8A 1E6VB 4ZIWA 4J9QA 2KG1A 1NLKL 4HACB 2K2PA 2IHR1 3RBXA 5AE1A 4CDIA 2JHEA 1S1WB 1WDDA 3UI3A 1UEUA 4K4YA 3WZ0A 1VISA 3M30B 1C1CA 3SV4A 2A2CA 2HRUA 2FZCB 1JKHB 1CQMA 4IG3A 4PABA 3OVBA 2HW3A 1YJNS 1YZ7A 5CQGA 5HMYA 2PI5A 1HW9A 5ETLA 2N7CA 3CNQP 2BV3A 1T05A 1FWKA 2KT3A 4G1QA 2QO3A 2BKOA 2IC3A 5AXNA 3MPWA 1T02A 4M8LA 1DY3A 4TYBA 2BJ8A 4DPXA 5LJ3Y 4CLKA 3EPGA 2ILYA 3OR1B 3V6HA 4LF8J 2HK3A 3EICA 2MKJA 2QGFB 2R7VA 5DRKA 3SCLE 2V4JA 3M8WA 5LSOA 3F73A 2BE2A 3MPYA 1FDDA 2AJ4A 1WC4A 4MFBA 4CH0S 3Q23A 3CC2S 5J2MA 1S1TB 4U8YA 3BM7A 4LF8F 2YX4A 4JV5J 1KVJA 1JNRB 3J80Y 4LSNB 3MMAA 5KFUA 3JTNA 3CCMS 3A1YG 2WW4A 3B82A 3N5FA 2FJEB 4DQRA 1RCOB 2RIJA 1IR2A 3D6MB 1HR0F 3LWMA 2G2YA 2EWHA 3DI6B 3ETOA 1TL7A 2R7OA 3KG4A 3D66A 2VB6A 3MPUB 1XMBA 1SQEA 3NBPB 1UFLA 2AJ1A 3FFIA 2KVIA 3H5YA 2DH8A 3Q0AA 5KG7A 3BN7A 2D1CA 2XWYA 4LT6A 3BGLA 2J0QD 1K0VA 2VPZB 5DDOC 3HHLB 1BE4A 2LA6A 2X3DA 2ZNYA 4Y6IA 3G87A 1LWEB 1HPZB 3BF4A 4LQ9A 2CPZA 2HBZB 5BXIA 1ROFA 1ZBTA 2CJQA 2VONA 4RLEA 1VHIA 5GAEI 1JJ4A 4USVA 1KHVA 2Y0BB 4N41A 4LR7A 1RI7A 3S01A 2C28A 2ZC4A 4Q45A 2AX1A 4EFAC 3K58A 1RXOB 1NDPA 2H54B 1F2HA 2KJWA 2E5LJ 1S6PA 3IRXB 2JNJA 2VBYA 1R0AA 4EZ6A 3RBEA 3CIMA 2MZ1A 3CDBA 2HVIA 1HNWJ 2AEFA 5A8KB 4DJBA 2YNHA 2ACMA 5L38A 1U09A 1KWMA 1S9GA 3QRRA 2B7CB 4N76A 4DF4A 1VRUB 2XMJA 1KNZA 1HBOA 2DXFA 1T3NA 2W4PA 2DH7A 4ECQA 2HK2A 4ITSA 2HNZB 3SQGB 2AYBA 4LR8A 1JLCA 1WEYA 2J0XA 3PHEA 4LJMA 4Q7AA 2DCUB 2DB1A 4OMFG 1H7WA 3OTEA 4J90A 4G6VB 1UFWA 5HN0A 1ZOTA 3W5YA 1R8PA 2IM2A 3PR4A 2UVUA 4FF3A 3NEKA 4WWSA 3GV8B 4G3IA 1AZSA 3OJSA 5FLXY 3K59A 4PQUB 2A18A 1KR4A 2JJ4D 1U6ZA 4M94A 2BVZA 3PACA 3KK2A 4HH0A 1XMQJ 4A8FA 2FVSA 4Q8FA 1LK7A 2NZ4A 5J2NA 3VAFA 2NSBA 2MGZA 3AXKA 2PE8A 2VFUA 2FUG9 2DR5A 1FFSB 4DUYJ 2V69A 2AD9A 2J7WA 5IT9Y 3AHPA 1C4CA 3AOBA 1XR6A 3PV8A 1P9YA 1TL4A 2L48A 4ZPWR 1KQFB 3TW0A 5A2QY 3VAGA 2IA0A 2AIRB 5IC6B 3T9ZA 3TJ9A 1N8RT 1VK3A 3TZWA 3V6DA 3ULHA 4FS1A 4ZVTB 2IM0A 1SIWB 3UWTA 3DNCA 5DGBA 4E0DA 1PAEX 3PIOQ 4F8RA 2OTJS 1FNOA 1SI9A 2GC8A 3M6XA 4KRWA 2EBEA 3GYGA 4CNZA 3W2VA 1I51B 2OFGX 3QSIA 4P6QA 2VQEJ 4I2PA 3HFZB 1ZH5A 4JI4F 4FYDA 1FJGJ 2ZH4A 1RYSA 9RUBA 4QOTA 4YR2A 2R9LA 2DGOA 2CRLA 2RRBA 2JEFA 1N34J 2KU7A 3Q24A 1Y11A 2XZTB 3E8OA 4ZJLA 1FFGB 3UDEA 5A8WB 4DFJA 3KXDA 5D78A 3PG9A 2HQCA 2LCWA 2HRTA 3CWJA 1F2GA 1VS3A 5H9FJ 1Y3JA 4PQAA 4Y2MA 3G71S 4PUOA 1Z1ZA 5C24A 1SKSA 3RW6A 9ATCB 2EG1A 3D0GE 3K0JA 5LL6d 3I82A 4L74A 1R6VA 1EKRA 1M1GA 1VIXA 4AQYJ 4YOEA 4RBTA 1N52B 2KRBA 1KOHA 1C0UA 2VUGA 4CH1A 4LMZA 4USJC 4N7TA 3PCOB 1FD2A 2UU9F 3FQLA 2ZJPQ 4JI3J 2GQCA 1IBCB 1IKVB 4F4WA 3FC9A 4DCPB 4DUTA 1PBUA 2AJFE 4DSKA 4C3LA 4ZP8A 3DI6A 3IM8A 3T6JA 3ENQA 4XAKA 1UVKA 3NG8A 2W7AA 1DQ9A 1TKZB 1RHQB 2UV8A 4MIBA 4AL7A 1Q4RA 1TKTB 3A3OB 3GR0A 4RKUC 4RPFA 4FXWA 3WQPA 3TUZC 3CCSS 1RT5A 2V4RA 4DR1J 4V19J 1ZA2B 2L9NA 2COLA 3FGVA 4P52A 4PXBA 4U9RA 1RKIA 4IUFA 3GP9A 4QIFA 5F3TA 4X4PA 4QW9A 1S0MA 2OEJA 1LFWA 3HI9A 5L39A 2QEXS 1EKSA 4RNFA 1YZ6A 3R5JB 4FS2A 4DL2A 3CCWA 3A8EA 4YR0A 2G2OA 5A8RA 2K06A 3V4IB 1XJWB 2EFGA 3DRYA 3EZOA 5CYQA 5E33A 2Y8WA 2WRMA 2HIQA 4J9VA 3NY0A 3SQOP 1T05B 1NK4A 1WHWA 1WJ9A 1IVZA 2J7UA 1X5OA 3CJ4A 4G65A 5C42B 2M2BA 2DHAA 2JLFA 5DG8A 4WKRA 1V5VA 2GGPB 2XI2A 1VQMS 1XC9A 2A6OA 2NREA 1YLXA 2R8KA 3SEOA 1OJ4A 4LF6F 1RUSA 1BUXA 2B4PA 4IKAA 2B51A 4TLQA 2XZDB 1HNIA 2FHJD 1GQEA 2O01C 1SBRA 2V2ZA 3I0SA 2KL8A 3MGJA 4EUVA 4USKA 7FDRA 3K57A 1TK8A 1F5CA 4NYOA 4P9SA 4EGLA 5KG2A 4K4UA 3FVYA 3DLGB 5KG1A 3KJVA 2U2FA 2JZ5A 2KHCA 2F65A 2OP5A 4KV8B 3WIVA 5K8NA 4X4RA 1NK8A 4LF1A 2RU3A 3LW5C 1E6VA 1OPIA 1WSRA 1EIYB 3DRSA 2DIVA 2CJKA 3AY0A 2VG5A 4ER8A 3MEGA 1B7FA 1S6OA 3HX9A 2DTJA 2IAJA 3IR6B 3KDOA 2VD3A 2LYVA 3NAIA 3P8BB 4KO0A 4QJVA 2SXLA 4WPAA 3RW7A 4X4OA 5KFLA 3EZ5A 4R0JA 5G0RB 4WIQA 1RLCL 3CO9A 2WB4A 4OJ1A 5F8GA 4DSLA 1AFIA 3NS7B 1Q5YA 2KJVA 3AA9A 2O66A 8ATCB 1Q1KA 1HQEB 3MM6A 1B0TA 1IXKA 1NCLA 1WC3A 1YWXA 3DCAA 4UQTA 1RBLA 7AT1B 1CLFA 1PYOB 1YJVA 1HD0A 2B0GA 2WVCA 3L09A 1L5UA 5KTQA 4LF5F 3KLFA 4KB7A 3BREA 1LW0A 3M2RA 1OY8A 3D28A 1F3VA 2Z0GA 1NAQA 2LQ5A 4G1PA 3MR7A 4RW4A 4DQQA 2X1BA 3NNCA 4P2FA 3ITHB 1YBUA 2YWFA 3KLIA 3UD4P 4JI8J 2QLFB 1VGYA 4E8UA 5FDLB 1RU2A 2XNQA 3W9IA 1PG5B 1YBTA 2DNHA 5FJ4A 1M5VC 5AXLA 1HNVA 1YGYA 4LF4J 4C98A 4RBUA 1QE1B 3EXYA 2JFKA 2VFSA 2VDHA 2YPYA 3TJ8A 4DV3J 1X5PA 3NGSA 3CMAS 2VH7A 4KKOA 5LMNF 4ZCKA 3DOLB 3O6QA 1LQ9A 2BJ7A 1YX2A 4P71A 1N88A 1CC7A 3L95X 4YS2A 3U1NA 3G6VA 1S7HA 4AL5A 4BC9A 5GAGU 2EC0A 1V6HA 5LMUJ 5DETA 5IS2A 3K5MA 4K4VA 1IKYB 2DNPA 3PYDA 4ID5B 3TYTA 2W9BA 1MMDA 3IS9A 4E2FB 3Q8RB 1NPRA 1NJYA 1U0HA 3M8QB 5IQQA 3VR1A 1WG4A 3HSZA 3OQ2A 4QCLA 4J9MA 3BO4A 4KGMA 2EC2A 5L1KA 2HVZA 1EETB 4GO5X 1FKOB 2DIUA 4ED4A 5JVHQ 2ERRA 3MOJB 1XN9A 5EUHA 4DV6J 1SQGA 4WP9A 3UR3C 2EK1A 3FQKA 3US5A 1VDHA 3M6WA 4UF4A 3JB9k 1FKOA 2XS5A 3CJKB 4F0MA 5K5MA 4WCEQ 2ZD1A 6AT1B 2FVRA 2QTWA 2N4CA 1NKCA 2C3UA 2VOOA 1N5TA 2JX2A 4OI6A 4USTA 1OYDA 5H1SV 2CPFA 2IY5B 1SCJB 1HWIA 2DGWA 2CADA 3CJ8A 5HVFA 2XSJA 1T94A 5IQ6A 5KG5A 3VAHA 1PSDA 2FHKA 3MMBB 1NRKA 4FDFA 4JI1J 2XULA 4M63A 2UUTA 4O0NA 4AD6A 1ZAWA 2X1AA 3FCWA 2EI5A 3OLAA 2FQQB 4MIWA 3T5JA 3ZTQA 4X64J 1VC6A 3QIPA 3DRRA 3MOZA 4OX9F 1S76D 4WU2A 4QZVB 4H54A 2CDQA 3GSIA 2V0NA 3AD7C 1X0FA 2CNKB 4HR2A 4UOCA 2CWKA 2KN4A 1RDRA 1H73A 3PJXA 2MY7A 1LK5A 1ZTWA 3LPEA 1S0OA 3MM6B 1NNDA 2LXFA 1MU2B 3NAHA 3ITHA 3DM2B 3U1MA 2A1BA 2HLTA 2BE7D 2Q1LA 1ZYQA 3SCIE 2WVDA 3CMES 1NK6A 1YJRA 2AGPA 1TL3A 5DQGA 3CULA 1WDTA 3NOGA 4I6AA 1FK9B 3WHIA 3RBZA 2KO1A 3QT7A 3UFCX 1T9UA 3VVUA 4OYWA 2QSFA 3D4JA 4I4BA 1K47A 2VG5B 1GMVA 3ENWA 3MM7B 3Q86A 4TQRA 1UVMA 1XBWA 2LA4A 1U8SA 2KG0A 4LSLB 1U1QA 1VQ8S 1DBDA 4V1Ak 1OY6A 2XO6A 1TMMA 1OSCA 2GMLA 2WSFC 1Q78A 3ZNJ1 3KLHA 1LV5A 2E9TA 3FEYB 2F1FA 2B7BB 5LM7E 1TU0B 3WC0A 2K7KA 1BQMA 2XC9A 4KR0B 4P2SA 3KJQB 4HT7A 2ADCA 1RKJA 2C3PA 1S1XA 2UUAJ 3RB0A 1CEZA 4JI7J 1SKRA 2LDYA 4YB6A 2OD6A 3UO0A 1TAUA 4I1TA 3ZTPA 2HHTA 1YQHA 3KJNB 4ED0A 3T1YJ 3M2VB 3HJFA 1AYEA 2UU9J 2QLWA 3OTBA 1EHWA 2DISA 2ZWOA 3OTOF 2N7YA 4F50A 3MI7X 4PAAA 5I3QA 3R1LA 2CPJA 1FHTA 1EP4B 5CYQB 4O3RA 1URRA 2KXHA 2PFFB 3VAKA 2MTLA 4A8XA 1TKXA 3W7BA 4OI2A 4RX6A 2GVDA 2K8GA 1UJ4A 5I3PA 4ETZA 5IC4B 1HWKA 1FRIA 4ECZA 1Q8IA 1FRLA 3AOAA 3C6TA 4LFAF 2VODA 3DMJA 5HJXA 4MYTA 2R7QA 2DK2A 4ED3A 2ZZMA 3OL7A 1RWKB 2E5HA 1AA1B 5KFCA 1EP4A 1TV6A 3FZ2A 2QLBB 3N6LA 1LW2A 3ZZYA 1YRXA 4C3MA 4KGXB 5KT7A 2A6MA 2YNFB 4OI4A 1ZTTA 1KONA 1N5VA 1HBNB 1RTIA 2EXUA 2W4CA 2MSSA 3LANA 5ETTA 3MHYA 4MK9A 4UT4A 2NXEA 3SFGA 4EYIB 2E7WA 1YJ7A 2CFXA 3MCNA 1M5HA 1JXLA 2W24A 2UXCJ 1RU1A 2R3VA 1VQNS 1EETA 3AB2B 1XK8A 3QZ8A 2YWWA 4JUZA 2AHOB 1RABB 2YY3A 3EM1A 3HP6A 1N48A 1XTZA 4DL3A 2HVHA 2Q6CA 4ZVOB 2I6WA 4C7QA 5F8HA 2G0IA 2LXUA 4K59A 3QWUA 4NCGB 4Q2LA 2RE1A 5C2CA 1RAGB 5K8MA 3BQ1A 4ED2A 3CCQS 1U1RA 1AUDA 3QFWA 2ZH7A 4X65J 5A8WA 3D7SB 2HAFA 1BY9A 4WP3A 3T1AA 1SUQA 2HHSA 2UUCJ 4JI1F 2LFVA 1GXLA 4IH7A 1T9TA 1UWAA 5KFRA 2LEAA 1HYSA 1WC6A 3PKYA 2KT2A 1KLMA 3OD2A 4RNNA 5KFHA 1WWHA 4X4QA 1RT1B 1X0PA 2DNGA 4WXOA 3GONA 5KFYA 2CYYA 3TX8A 1Y5LB 5I4MA 3TAMA 1KBRA 2CG8A 1RHKB 3POTB 3HLUA 3PFEA 4K2XA 5HI7A 5KFWA 3H2LA 1FCAA 2OPRB 2MQOA 1MU2A 4GC7A 2VL1A 1I6JA 2RUGA 2XCAA 3GYXB 3SDEB 3P6YC 4K4ZA 1DARA 1REVA 2ZFHA 4O3NA 1EAYC 3MD3A 2W7PA 2QMWA 4ZJOA 2XMKA 1Y5NB 4KAIA 1KHWA 5C2GA 4NA2A 3HT0A 2CA9A 1SC1B 3K5PA 3QIPB 3V6DB 2RQKA 3S1TA 3VCDA 3AJ1A 2L9DA 1TUVA 4I7FB 3A8IA 3OFGA 3DGPA 3TRGA 3THVA 3H5SA 4M95A 2DRBA 1H3DA 2CAJA 1HBMB 3OBIA 2HNDA 2K1RB 2BOPA 2Y8YA 4ANDA 2IBOA 4J9PA 1O6XA 4WK3A 1AFJA 1WF0A 1PBAA 3OSPA 4IYQA 4XIUA 2QJ3A 1NMEB 1FX2A 5IV4A 2FJAB 4HL9A 5HK4A 4OLPA 2B4OA 4DS4A 3DOKA 4DCOB 4NCAA 5H9FK 2ZHOA 3FMWA 2B5JA 4HH1A 2ASDA 4B9VA 2QL5B 2GIRA 1UWBB 3FCHA 2HZVA 2XY5A 3SFUA 3KMQA 1VJWA 3EVOA 2NYIA 2WZ1A 4BCAA 2WSCC 2EK6A 3C6UA 2ZH2A 1HR0J 1F9EB 2OSRA 1U4BA 2NLWA 1YIJS 2HSEB 3IS9B 3W8PA 1RLDA 3LAKA 2WCXA 4X4TA 1K0TA 3PHTA 1CJUA 1IKYA 4MT1A 3PYGA 2W9BB 2HBRB 1L3SA 5AT1B 4DX8H 4KY3A 1VHFA 1S1VB 4K5SA 3IG1A 2GAGC 4HKQA 5E3RA 2ZH1A 1CS4A 1RT4B 1UVNA 2J8SA 2YQ3A 1QD1A 4ECTA 2CPXA 3C14B 3IWXA 4PRFA 1T9YA 1U6FA 1RGVA 1SC4B 2F40A 1X60A 2O67A 4ED1A 3PW7A 3PO4A 4ZPAA 5LXRA 1UW4A 5C42A 4B3SJ 3MMJA 4RNHA 2QFJA 3ZTOA 2B8PA 1TELA 3PRVA 2LLZA 1RZMA 1RT2B 4HI1A 4PG5A 4QR0A 3J7YU 1N36F 2OEKA 2FB0A 1CJTB 1FX4A 2HMIA 1SH3A 1Q79A 2HZAA 5E7OB 3SSRA 2MHEA 2FZGB 3FFIB 4QR1A 1R8BA 1U24A 1WF2A 2RHQB 3BGRA 3W5XA 2LQ9A 3UVJB 4ANEA 3I56S 2YKMA 5DM7Q 1J5EF 1D9AA 1HPZA 3UCGA 1O5JA 1X7VA 4JB8B 1VQPS 2FD2A 1SJ3P 3BSCA 3CD0A 3VF0B 3C2PA 5KFJA 3MCMA 3C3LA 3N5BA 3GTYX 2BM1A 2XMWA 3PRDA 3HKWA 4R0EA 3RB3A 1S1TA 4EBEA 2OH2A 1QTNB 3F44A 4TN2A 2HIYA 3V6JA 3CT9A 1SB6A 3VALA 4NXMJ 2B3TB 2OEMA 2WTFA 3RGIA 2DNYA 4AXIA 4AUKA 4OX7A 2HWIA 4DPYA 2VA3A 3R2DJ 4NA1A 2NZCA 2ZVIA 4ZLPA 2X51A 3AD9C 4LSNA 4UOHA 5C5JA 2DNLA 4ECVA 2MYFA 1N33F 2P5VA 4CP5A 1TQLA 2NSCA 3MEGB 2CJAA 2MHNA 3JAMY 4NLUA 1IKWA 2PIIA 4C8LA 5EHHA 4IG3B 2LQJA 2CVIA 3JSYA 2DR8A 1Q0NA 3FNNA 2KI2A 4M5HA 3E51A 4NLSA 4ECRA 1W25A 3KHLA 3BYRA 3IN5A 1B0VA 4F4AA 4JI4J 2GIFA 3OFFA 2H5JB 4UOFA 4LFBF 5ETVA 4LQ3A 5J2QB 5CXTA 1HNIB 2DO4A 3M2UA 3Q8QB 1ZM2A 2YWKA 1KS2A 4DFPA 2HRYA 3KTQA 1IWAA 3MEEA 3QT5A 4RUBA 1C1CB 1YBAA 2VPWB 4DQSA 2H3EB 3CJ5A 3V4MA 3FUYA 4JI2F 1QAYA 3SI8A 2DHHA 3C46A 1OQ3A 1G4CA 1IKWB 2K3KA 2MQMA 3DU6A 3NGTA 4Z37A 5GAHU 2HKEA 2R8HA 3TO8A 4I67A 2XBPA 2BW2A 3KNGA 1EJ7L 1H6KX 1SV5B 2FZKB 2YNGB 1HBUB 2LVWA 2OUGA 2ALZA 1CS4B 1RT4A 4P75A 3IG1B 4KPCA 4YY3J 5GMKa 2NPIA 4O44B 5IWAF 2LQBA 1CJUB 1VQ9S 1TFYA 1N5QA 5KFEA 2OLWA 3VZIA 4YR3A 3PDNA 4I2QA 4PKDB 2IMWP 3DGPB 1FXDA 2ATCB 4D3GA 3M9OB 4DR2J 1NK0A 2B6AB 1AROP 2XTJP 3ZTSA 2XQCA 5CAAA 4W92B 3NMAA 4J9LA 3MFIA 2HWHA 2G4BA 4IOAQ 4DSFA 1X4FA 1S79A 3MZIA 1FJGF 4ZLJA 1NDKA 2ZBPA 4NLOA 5THWA 2CQ0A 1JLCB 1RWNB 2NYHA 4IO9Q 2KYXA 5I42A 1P27B 4B9MA 4YQWA 2XS2A 1VFJA 1B3TA 4C9DA 3WBZA 1NU4A 1SJ1A 2BKPA 3CJ0A 2OPRA 3FMBA 3SMZA 2VPXB 3LP0A 4RU2A 3B4MA 2P9GA 1FRXA 2CQ1A 2HFZA 4NLTA 4ZP6A 4IFYB 5A8KA 5IV3A 2HFNA 3N79A 2K1RA 5M2PA 3ET6A 1IBKJ 1KRPA 1VYAA 3ELHA 3ZZUA 4URGA 4NLRA 5KFPA 2XGPA 1E6YB 3DLHA 1HHSA 1RHUB 2CPHA 3JYTA 1XR5A 4GC6A 2CZ9A 3HKZD 3A8KA 1GK8A 4ES1A 2RQMA 4WFXA 1NSPA 2H51B 3IR5B 2ZM6J 1K44A 1F9HA 2MLZA 2DJWA 2OGUA 1X4BA 2BJ9A 3EGVA 4ZHRB 1R31A 3A3PB 1Q81T 2F4VF 1WC1A 3AAWB 2HAIA 4ZVFA 1UP1A 1QVGR 4TNOA 4ANCA 2EKNA 3BQ2A 5D0EA 3SDEA 4GMKA 4DU7A 3G8SA 2C3MA 2RQ4A 3LOUA 4OYXA 4Y2IA 4RWWA 1TP7A 5B7WA 1LWFB 1S9EB 2QL7B 3ADAC 4UTGA 3M32B 3AQPA 3QMQA 3TQEA 4DR2F 3R5BA 2K3IA 3RR7A 1FWPA 2VC0A 3TA1A 1J5EJ 1KQGB 3DFEA 1JLQA 1RAEB 3CDEA 1X9MA 3CCZA 4YFUA 2PC6A 1G6BA 2R2SA 1I5OB 5HO4A 3T1HF 3GG0A 5EWGA 4L73A 2F4VJ 2LKZA 4DLGA 3R5CA 3IXQA 1QAIA 5ETOA 3EYZA 1U1PA 4F7VA 4CO5A 2RT3A 3O3LA 4CH7A 2MKHA 2R7WA 3I87A 5AXKA 5J1EA 2EFPA 3FCVA 5KT2A 2OO4A 2YH0A 2M8DB 4J5OA 4JYAF 2B9YA 3P96A 2BBEA 3L7PA 4ZLNA 2ZITA 3FEZA 4NWBA 4RJVA 2LEBA 4KBIA 1DAXA 2BJDA 2Y1RI 4KYZA 4LRBA 4FP9A 3EWGA 3W3SA 3HD1A 2OFHX 4DFKA 2PD1A 4Y2AA 2PMZD 3QAUA 1LNQA 4MH8A 4YHHJ 5F9NA 3ZC4A 3A12A 5HJYA 2PEBA 3OR1A 5DZ7A 4KHMA 2HHUA 2J7KA 2DGSA 4PPDA 4WBFA 2HNZA 5SUHA 5B08A 3MAAB 1LWCA 2R2UA 3AB4B 2FLLA 4ZK7M 1MN9A 2BM0A 4OX6A 5KFNA 1LW2B 4MMOA 2R7RA 1AW0A 3K8VA 4TYAA 4I64A 3QGHA 3R3TA 1SKUB 3UNGC 4LFCJ 1NDLA 3KLEA 4A8QA 4ZMMA 3PM9A 3C16B 5BYRA 4K4WA 4DV1F 2YKQA 4JV5F 5L1LA 3DOMA 4TY8A 2R8GA 2HGMA 2RVJA 2CPDA 2QE5A 1SJFA 4M5KA 3KLGB 4EO8A 2DPIA 2OPQB 4NEYA 2HFVA 1PJ6A 2OMOA 3QQCD 4TVAB 3CCTA 4NYPA 5KT5A 3K8WA 1OYEA 2GW8A 2DYAA 1X4DA 1X9SA 4QQBA 1YVFA 4EEYA 2AKWB 1WOOA 1NSAA 1N0VC 2C2EA 2Z56B 1LWEA 4R8UB 2QIFA 1EZZB 2R7TA 4C8OA 1I94F 4AFFA 1F3FA 1S99A 2VG7B 5D15A 3FSIA 3HHLA 2BA9A 3R6LB 2VFRA 3VQSA 5B0FA 1UVIA 4WK1A 1TL3B 2DEJA 4JV2A 1HNWF 2RS2A 3NL0A 2J76E 1B4SA 3M8ZA 2FHMA 4NZ0A 3E01B 4R8UA 4X66F 1PCAA 2M7SA 1RACB 3B8HA 3I4HX 5DQHA 3NLCA 4LUBA 4P73A 1GT8A 4PG7A 4CYUB 4DN0A 5L9XA 3J81j 4I68A 1YI2S 2R4FA 3PYFA 1VRQC 1IWGA 2HGNA 5CCLA 2HMIB 4GRSA 4GVBB 1HMVA 5D8HB 3Q2SC 2CNOB 3MPDA 2VQFJ 4LSLA 3QJPA 5LOQA 1A9NB 1UTAA 2MKCA 3R5GA 1J5OA 3L7OA 3C6TB 1GMWD 5E3AA 3HFKA 5SZTA 3PW2A 3M8YA 3HK2A 2V4JB 1Y0HA 2W2MP 3GPAA 1NSKL 4H4OB 1X4CA 1NZ8A 5F8JA 3C16A 1XEZA 2MLYA 3OSNA 2YXLA 4KH0B 5HBMB 3CCES 2HNYA 2I38A 4C8MA 2DR9A 3VQTA 1HFEL 1JLBA 2IC3B 1MWQA 1CULB 1R43A 1YSJA 4DF8A 3T1HJ 1PGZA 1U2CA 4DQPA 1OIAA 2CQ2A 2WK4A 4OFZA 2UXCF 1YJ9S 3E2EA 3OUYA 4Y0FA 1TKDA 4LF9F 3IWNC 2BYCA 2QFIA 3I6PA 5E2QA 2QA4S 3C66A 1NK5A 2AJQA 3DHXA 4UZBA 2JFDA 2ATLA 2VDIA 2B4VA 3G82B 2LMIA 1PJ7A 3BH7B 3SSQA 1M1KT 2Q79A 1U49A 1M90T 2RSQA 4F0KA 2KVQE 3RYLA 3J81U 1BQMB 1BXNA 3V81A 4EU0A 3Q89A 4P74A 3H5UA 3PJWA 4QYZK 3KLHB 4N77A 2GX8A 4ZITA 1SPBP 1FJEB 2RU9A 2KM8B 4DSEA 2L08A 2VQFF 3CUNA 2WW8A 1TZ0A 4DX5A 2GAHC 3OTCA 2ROPA 5GMEA 3W9JA 1IBKF 3GFHA 3F41A 3IC1A 1PC4A 5BYSA 2KHDA 3CJTA 1VK8A 2KRRA 2QG9B 4B3MJ 3QLHA 1Z2ZA 3VHQA 1QLNA 3HSJA 4C48A 4PEOA 4UUXA 1HNVB 3B4DA 1B64A 2MQLA 3ISND 4NRTA 4ENOA 3GV7B 3BDPA 4EBCA 3CB4A 3NKYA 5T7LB 2WONA 4WE1A 3M32A 2IIHA 5C25B 4K4TA 3CC7S 3K2YA 3CO0P 2F63A 4WXWA 2WOMA 1K1SA 1U2RA 1DLOB 5D4OA 4C6AA 1NKEA 2RS8A 3M2RB 3NRBA 2YQ1A 4O4GB 5HLFA 3FBBA 1SL0A 3I9ZA 1R8CA 1FDNA 1BWVA 3DRXA 4YB5A 3UDCA 4AYBD 3P3DA 7FD1A 3H20A 5IWAJ 4ILLA 4NA3A 4F3QA 3M7VA 2CNLB 3H8YA 2ZM6F 2CQIA 1VIOA 4YN3B 2V34A 2C1EB 3HF5A 2MPUA 1HMVB 1ZAXA 5HP1B 3MPVA 2Q3PA 5KFIA 3PXGa 1S57A 1F0XA 5KG4A 5CH7B 1F5AA 3ZFVA 2UXDJ 3AT1B 2WOMB 3EE3A 2G0CA 2B9WA 3M05A 3NCQA 1T8EA 1N6QA 5IXUA 4CZCA 4NPOA 4WZMA 2J6UA 2FVCA 4JI6F 3CJKA 4RW8A 3RAQA 2WBRA 2RUSA 1N34F 4KHPF 5HANA 1GH8A 2AT1B 3EVWA 1KFDA 2BABA 2FJDB 3QRPA 2E1AA 4CNYA 3LP2A 3DLBA 3HVRA 2VFVA 1HBNA 1K1QA 1MN7A 1RTIB 2DGUA 2ZBQA 4LSZB 2XWXA 3I32A 3M8QA 3S8SA 1FJCA 2Z8QA 3FJ2A 5KFKA 2R2TA 1Y3KA 4JI5F 2D41A 4NI2B 3VAIA 2RKIA 1T0TV 4WFNQ 3OVAA 1CULA 4ZN3A 3MR6A 4Z2XA 3MM8A 2CQCA 1U48A 3FDSA 3O8WA 4NE9C 4DBQA 2RDDA 1WORA 1XWLA 2BW7A 1HBUA 4CRJA 3MUMP 4C11B 1RT7B 2BR0A 2J6SA 3RR8A 4W4MA 1CVJA 4ZDNA 4OHYA 2FGOA 2QT7A 4NZ6A 2HFUA 3KDNA 2G0JA 2M9KA 2QV6A 4ETXA 2EFNA 4WFBQ 1S77D 3IBWA 4P2XA 4TQSA 3UNYA 3N6NA 3PFOA 2C2NA 2VBXA 1QE1A 2GVDB 2FGCA 3MD1A 5BYQA 3BO2A 4QPTA 1U1NA 5CZVA 1FI4A 3DLGA 5BR8J 3WDOA 3KK3B 4M5DA 4CM0A 5A8RB 3W1YC 4Q43A 3MEEB 5FDLA 2UUBF 3NNHA 4IDKB 1P6TA 1OPZA 1Y4ZB 1NHVA 4DS5A 4JI2J 3OUYB 1IQTA 3M6VA 4J9SA 1GTEA 2MJUA 3E01A 4USIA 3Q8PB 3OHBA 2UUAF 5EX0A 3W64A 1XNQJ 1HL6A 5KFBA 3D6TB 4X62F 4F2SA 1TAQA 4EK2A 3GCXP 3AJDA 1F5BA 1S1XB 1DTTB 2MSTA 3KNAA 2PI4A 5IFMA 3WIUA 2AP6A 3RUBL 2CQHA 3EGWB 1BWEA 4C2MA 3MM9B 3BS9A 2DR6A 3IAS9 2IYGA 2YBVA 4QIWD 1UAWA 1WOSA 2OPSB 3I31A 4OYAA 4B08A 2DHXA 3DDKA 4DX6A 3OXLA 5KOXA 3QGPA 3ZZRA 1CG2A 4DL5A 1VRTA 1GMUA 4O0IA 4I69A 2G1DA 4Y2CA 4DMZA 2F7VA 1BQXA 2IM1A 2ZDOA 2VFTA 1LFPA 2AU0A 5AE2A 2YWEA 4QWBA 4LF4F 1T9VA 2D69A 3AXMA 2A3JA 4ILRA 2VASA 4K7QA 1BD6A 2J9DE 2P9CA 4UZCA 2J9CA 4YDDB 5DM6Q 1R0AB 2AYEA 3NP5A 3W9HA 2CG4A 3TI0A 2BUNA 2QC3A 2G2ZA 3T1YF 2CPYA 4Q44A 1CJKB 3UCZP 5KFMA 2N82B 4RW9B 4CT8A 5ETKA 4A8YA 4BBYA 4EMDA 5ITHA 3AA8A 3SXLA 2XMUA 1RB0A 3ILOA 4F26A 5F0UA 4WTYA 3AOCA 4HEA9 2KB2A 1CJTA 4K5RA 5DDQC 2VJVA 3HVTB 2MZRA 2BE9B 3BKFA 3D5MA 4NMLA 5IT4A 3VZHA 4OZ3A 1L3UA 1HQUA 3QIDA 1S6QB 2E1CA 3JYTB 2YKNA 1NB2A 1L3TA 1C1BB 1MWYA 3NGKA 4NLQA 4NLXA 3EXCX 1RP5A 4LF7J 1GXTA 1U7LA 4DV0F 2NXJA 3P49B 1WKJA 3I0RB 2MKYA 3JTPA 3HXMA 4KFBA 2DXEA 4OYZA 5GAEU 1FDBA 2YVSA 4QIGA 1RYRA 3G6YA 1OWXA 4D3HA 3RBDA 1D9FA 2IRUA 5E3QA 3SIPB 4IG0A 2JDJA 1BGXT 4LBPA 5HMWA 2QA1A 5I42B 2UXBJ 3EMTA 3LO3A 1ZPWX 4F04B 5HROB 1NPPA 3RB6A 1Q16B 4Y65A 2ADBA 3HHNB 4O3QA 4OZ5A 2V63A 1B70B 3NWRA 3OJUA 2RQCA 4X2BA 2DY9A 3CE8A 2Z2ZA 3FKBA 1S97A 5KFOA 4RUHA 4U7CA 4IQMA 4MKBA 5MAOA 2ZH9A 2FPHX 4EO6A 5KT3A 4IG0B 5EGYA 4I2QB 1SKWA 1FNMA 3A8JA 1NBEB 3OHAA 2HWTA 2Z2MA 2MQPA 3LWLA 3D1QA 2XB2D 1KLNA 4B9LA 1FRMA 4FPRA 1TMJA 1KOOA 4URSA 1BQNB 2YKAA 4ED7A 3T5KA 1N33J 1D0EA 2KKHA 2F4FA 2VBWA 4FXDA 1WHYA 1C1BA 4HTJA 1FE0A 1AZSB 2YWGA 1CJVB 4USMA 4F4YA 5EDWA 4EWTA 1VLYA 2Y3YA 2E1PA 3ET6B 4KTQA 2ILZA 2GNKA 2JSXA 3MR2A 2DGXA 4FZVA
chains in the Genus database with same CATH topology
4ZPCA 1SXLA 2YWHA 3DLJA 3TUIC 1FO1A 4TKTA 6FDRA 1MWZA 5EN1A 2RMLA 1U45A 2EKYA 3MF5A 1F9FA 4F3MA 4FNIA 3W2VB 2UXBF 2I8EA 2YNIA 3KLFB 4IRDA 1LOUA 5GAGI 4F67A 4UY8T 2RRNA 4PPZA 4CI0B 1RTHA 3T5LA 4QWEA 2YH1A 4WFZA 1TVRA 4XO0A 4JI0F 4CT9A 2MXYA 2DH9A 1BQNA 2PMHA 1JMTA 1UL3A 1XERA 3MDFA 4I0WA 4KO0B 3SV3A 4K0KF 1G7CB 2UP1A 1J2VA 4PWDA 2XO7A 2Z2LA 1WHVA 3BDEA 1VQLS 5GAHI 4H4MA 3MCSA 2RNEA 4A8WA 1VQKS 1U26A 3E3XA 3I5BA 3KJVB 1RT6B 1X4HA 2CIMA 4OI3A 4DHVA 3OVSA 3TANA 1JJ2R 3HPOA 5T41A 3EZUA 3IGNA 5G4DA 3SQGA 4ZKAA 5D6GA 2VQEF 2AQ4A 3KHGA 1U47A 4Q2MA 5IT0A 2OSQA 4KQZA 5CCMA 1G2EA 1VBZA 3NCRA 4DR6F 2VKRA 3ZZPA 3LGNA 4CO0A 2N3OA 2E7XA 3M30A 3GIIA 4EBDA 2Y1JA 5F0WA 1S1WA 1Z2LA 1RT2A 2Q6BA 1YG0A 4DDFA 1NJZA 4BS2A 3CVKA 2L41A 1S6PB 3TVKA 1M5PC 1L3KA 1S6QA 1XR7A 3BEGB 1YHQS 2V4QA 3LUYA 3HVTA 2JRSA 1O8BA 4H4KA 3Q8PB 4FVMA 2GV1A 4ZCLA 3DXSX 4DN9A 1U1KA 1MROA 2EG2A 3G9CA 3NWGA 1SC6A 3UD3P 4Q8EA 5HMXA 2E1RA 2ZDPA 4RW9A 3PZPA 4FBTA 2ROGA 4PXDA 3O5TB 3H25A 1XNQF 4JOUA 3L3CA 2Q43A 3H98A 2LECA 2VV5A 4HT5A 1SL1A 4DG1A 2DR7A 4B3OB 1SIZA 4DL4A 4OI0A 2C2RA 2FC8A 1D9DA 2VC1A 4USHA 2E9RX 3D2WA 2Q66A 2B56A 5MLCV 3PNIA 2JEJA 2YKOA 2IFXA 2XS7A 3UDLA 3M6UA 1RISA 1P8GA 3CIZA 3MECB 1PC5A 2E5GA 3H59A 4ECYA 2KFZA 3H40A 4B9SA 3N0VA 2P9EA 4N5SA 1TVRB 1L3VA 2U1AA 3MM9A 2KM8C 3R27A 2W8LA 5KAKA 2RB7A 1C0TA 5GADU 4DLEA 1DTTA 1U1MA 1DHMA 1KTVA 1M0SA 3AH6A 2V8HA 2JVRA 2DHGA 2UUWA 5IZHA 3MURP 3CJ2A 3N6MA 2OD4A 2V8GA 4DR5F 2E9ZA 1R89A 2GHWA 1GNKA 4KJIA 1H7XA 1HARA 2IVYA 2CZ4A 1U1OA 1HI1A 4RW7B 1W2IA 2WONB 4WE1B 2FC9A 2QYCA 4CIOA 2EW9A 1H2UX 5EWEA 3DXBA 2DO0A 3C8YA 3LH2S 5GADI 2DRAA 4JI3F 2YNIB 3QLHB 4MK8A 3DRRB 5BR8F 2B9XA 3K7RA 4IFVA 2QMXA 4DV5F 1N32F 4X64F 5F8IA 4WF9Q 2GO9A 3QZ7A 2CJ9A 2WAQD 2CQBA 2E66A 2HNDB 3I9V9 1VQOS 2DHSA 3IR7B 1JB0C 3MEDA 2QZ8A 4ELUA 4L3NA 4ZA1A 1R7IA 1IJEB 4QIVA 2IA6A 1DRZA 4I7FA 4RZRA 2MKKA 3VAJA 2BANB 4XDCA 2KTQA 3H4DA 5CYMA 1JLFB 4HI2A 5CA5A 2L3MA 1WG1A 2BACA 2C3OA 1F60B 1N6QB 2ZH5A 2YNFA 4A8KA 2F9JA 3OR2A 4CO2A 4O23A 3CEDA 2HGLA 1IKXA 3O1LA 3QO9A 4N76A 4JV1A 2MQNA 3I0RA 5HP1A 2I5JA 1WI8A 1S49A 1DQ8A 2H9ZA 1HBMA 1UJ6A 2HNYB 2UXDF 1G1XA 3Q22A 1T95A 5K8OA 3G4SS 2ZVSA 4G1IA 2I0XA 1YRTA 2UZAA 2V8DA 4BHQA 2RF2A 2F9DA 4F4XA 4OV1A 3CGIA 3PVXA 2M4MA 4OJ3A 4OJGA 1UA1A 3DHWC 4O4GA 4OZ0A 2APOA 1FD8A 2ZNZA 4C7QA 2GMHA 5KFTA 2GQ2A 4HDHA 1RQ0A 4F25A 4Y00A 3MTKA 3EUNA 1S72S 2J0SD 1M5SA 1P1TA 1GXUA 4DEZA 2YX7A 1R6YA 4CTAB 4RW4B 2I9SA 3WC2A 4ECXA 3CDUA 3TAMB 2CJBA 2DD8S 4ES2A 2DITA 2E29A 1RA6A 3OL6A 4JI8F 3JTOA 2W7OA 3BZQA 2X3GA 3NNAA 3NS5A 4IQXA 4QW8A 2G13A 2XLIA 1WD6A 5CZXA 2CVEA 4ZS6A 2R7SA 1H98A 3R5AA 5CD4H 5H9EJ 1UVJA 1GX6A 5KFGA 3K5LA 1FRHA 1QSSA 4PR6A 5B0EA 4GKKF 1I1GA 1KFSA 2QFJA 1SJQA 2J9EA 4HDGA 4NRUA 4WFYA 3M8SA 2IVFB 3G6ES 3CF5Q 1NJXA 4ILLA 2OPQA 1GX5A 2XSFA 3KHRA 2L9WA 3RRKA 2J8AA 3V5RA 3CXCR 1TK5A 3KLGA 1HNXF 2XG8A 1QJHA 2PEHA 5JJBA 4ERDA 3DRSB 3I96A 2CQ3A 4LIWA 2R7XA 4OX8A 3RB4A 1FTRA 3T6BA 4Y3CA 1C4AA 5KT6A 2D3UA 1D3WA 3NCPA 3HHLD 3KLEB 1RTJB 4YMEA 3SZ2A 4MKAA 2KT5A 1C2PA 3LALA 3DYAA 5DO2A 1NO8A 3PRBA 5KFAA 1OSDA 3MUVP 1LKZA 3CSKA 4CO1A 1FXRA 5DG9A 3BGUA 1DTQA 2MQQA 3TOQA 3BSAA 1OS5A 2M70A 2ZBIA 3J7YI 3AJ2A 5D4PA 5BJRA 3R1HA 4XK8C 2GGPA 2WSEC 4OHZA 2NUUG 4C0OC 4I6YA 1QUPA 3SSSA 4LIRA 5LMUF 3K5NA 4KIAA 2MB0B 2Z4PA 4C11A 1IN0A 1ULRA 1YITS 1RTJA 1DFDA 1VBYA 4BDPA 1V3SA 2JEIA 2CKWA 5L1IA 2RKIB 3DC2A 1FVSA 4CO4A 2JVOA 1QSYA 1FKAF 2DCLA 2AF6A 5JVGQ 4LFCF 2JEGA 3QWPA 2IBKA 3GB0A 3JSMA 4V19X 2JC0A 5DDRC 3HT3A 4B9UA 3PW4A 3P5TL 1HWLA 1TKTA 1HI8A 4WFAQ 1N5YB 1X5SA 4L72B 1QM9A 3OXGA 2C3YA 2PSZA 2M5YA 1VBXA 1VMBA 1WACA 3QPIA 2D3ZA 1IKVA 4FBUA 2J9DA 2IRYA 5B0AA 2DVIA 4BC7A 3TARA 1IQZA 3LP2B 1HWUA 3GFYA 3GMGA 2X1FA 4I6WA 1SJRA 5D77A 5E3CA 3LAMA 1N5SA 4NXNF 4OL8A 4KHRA 4B02A 2AYMA 3KG0A 4NL5A 4J9RA 2A10A 2BJEA 2ZH6A 2OTLS 4B3RF 4DUZF 1O51A 5U47A 3CCVS 2JWNA 2FLNA 3DLEB 4OZLA 3T3FA 1WG5A 4A8MP 2GJIA 3UR0A 4AQYF 4A8SA 4FF4A 2FHOB 4I56A 1JLEA 2KYZA 1CSJA 3MEKA 4H4KC 4TY9A 3DM2A 1KQKA 4QU6A 3KLIB 3G86A 4OIXA 1WNEA 3J7Z5 1SL2A 1D1UA 2V94A 3CJ3A 1LXJA 3Q2TC 1RTDA 2OPPB 5HQ8A 5J1NA 4O3SA 3HHEA 5M2UA 1HQEA 4YHHF 3BO3A 1URNA 2OIHA 4URQU 4ID5A 1R8AA 2JLGA 2LU1A 1Y5IB 2EPIA 4PG8A 5J1EB 3PR5B 2MY8A 2PO4A 1Q8BA 3IGVA 4IFVB 3ENVA 3TAQA 2Y1IA 1FRKA 2XMVA 3DU5A 3V81B 3DOLA 2LDIA 2G9OA 3ISNC 2GFFA 4UW2A 1UKUA 2R2RA 4C97A 1FTCA 4QWDA 1DJ0A 3MUTP 3GIKA 4QR2A 5E41A 4XPCA 1Q86T 3T5HA 4GKJF 4QPXA 4A48A 1LWFA 1S9EA 2ASYA 3I0SB 1ZETA 2WB1D 4ALZA 1T03A 1HBOB 1S0NA 4B17A 2XY7A 4NYZA 4NZ7A 1VOMA 4OI1A 4B9TA 4ZPVR 5KT4A 4RUCA 3MR5A 2YNHB 1RWUA 4LVNP 3M9OB 4PXEA 3GV5B 3EPIA 2LXIA 1KTQA 3M1VB 3T19A 4OHXA 2MZJA 4QWCA 4IOBA 2XEXA 2E1MC 2E44A 2IJNA 3R5DA 1M5OC 2M52A 3IRXA 1TL1A 4KKOB 4MJKA 2F3JA 3DRPA 2MZSA 5A0YB 3BSNA 1HW8A 2IYIA 3NMRA 1YJUA 2MJNA 4HTIA 2BQRA 4B3MF 4J9NA 1B0PA 3MECA 4PXCA 4IFYA 5E3PA 2D9OA 1KC8T 2EFOA 4X84A 5HBMA 3T9NA 4OJHA 3LP0B 2I2YA 4J37A 4OZNA 3HHKA 4H4OA 2FJVA 2AWZA 3GE9A 4ED8A 3HO1A 4O4RA 3D0HE 2FVQA 3DDNA 2MZQA 4GO7X 1Q7LB 3K5OA 3H5XA 2W9CA 2HHVA 2BRLA 1WELA 2ACYA 3PIPQ 3JSBA 3KHHA 5EWFA 4NOHA 3OV7A 4F4KA 1Z4UA 2KH9A 2PGCA 2DNZA 1OO0B 3G8QA 3F56A 3PO5A 2FTRA 2XLJA 2J5AA 1N54B 2PA8D 4WIIA 2YKMB 3ZZZA 5KFVA 2CPIA 3BGRB 3OFHA 3PEJA 2FIUA 4ZPDA 2V8VA 4X4NA 1P1LA 3KWMA 4Y28C 3BSOA 5K14A 3G6XA 3BB5A 4AXJA 4B9NA 1VC0A 2YX1A 4CTAA 4DSIA 2UV8G 4K50A 4MAKA 3ICLA 4ES3A 3M4XA 2VA2A 1BC6A 3LGMA 4KV8A 4DL7A 4C0BA 3PW5A 4PUOB 1N56A 1MROB 3MXHP 1S1VA 2CPEA 4J9KA 1K73T 2FHJA 2XZWA 1OQ6A 3M2UB 4U7UK 4NLYA 2A2DA 3DLLQ 5IM0B 4ZOSA 2ZKUA 4MYUA 3IO1A 4TY8B 3D54A 4MKYA 2PDAA 3CD5A 1IJFB 3TA0A 1ZPVA 2PT0A 3I4PA 4UY85 1HNZF 2FLPA 5DLFA 2ZE2A 2HS0A 3EGNA 2FVPA 3OFEA 4KSEB 2V9WA 2BQUA 3O44A 1WTFA 1X4EA 3OR2B 1JJHA 4HYKA 2VG6A 5FD1A 4C8ZA 1LWCB 4DFMA 1JLAB 2NXUA 3VWSA 4N8OA 2XY6A 1JLFA 4B3SF 2E5LF 2HLUA 1RT6A 3CD7A 5DS7A 1QTMA 2XCPA 2BANA 4FXVA 1IBMF 1ZM9A 4H4MB 2AW0A 3W2WA 3FSXA 4WKYA 5T14A 3HHDA 3MTJA 4X65F 4IRKA 5F3ZA 4PWDB 4L6V3 1FERA 1U6BA 1DQAA 1RT5B 2HQIA 2POKA 1UJ5A 2CQPA 2HS3A 4DR7F 2NR0A 4OZ1A 1WF1A 4DSJA 2FJWA 3IWLA 4OHVA 4Q5VA 3SCJE 2XLKA 1RJJA 1X4AA 2UVWA 3M9MB 1RTHB 1FE4A 3GG1A 3POTA 4IRCA 1S9GB 1HI0P 3S7RA 1N0UA 3MAHA 1NH7A 3Q8SB 1XNRF 2RRAA 1KQSR 1KLMB 2ZBCA 3HZEA 2AX0A 2AGOA 2IRXA 2J6TA 4P7VA 1S9FA 4RU9A 4M1KA 1YJTA 2HHQA 4LF7F 5KFDA 2KZMA 2HZCA 5C24B 2UVVA 2KDOA 3AQOA 5J2NB 6FD1A 5I3UA 2F8HA 1KVIA 4ZCMA 5AXMA 1JXEA 4YDXA 4DR3F 1XMOF 1C0TB 4PQUA 5B0DA 1FA0A 4FF1A 1N4LA 5FIIA 2DGVA 4UUWA 3BR9A 3W2WB 2AJ0A 3HVWA 1FRJA 3IAM9 2R8IA 3H2VE 2FJXA 1D8YA 2X1GA 2ZHAA 1TFWA 3MWBA 4W90B 3RRHA 1Q82T 1IKXB 2XI3A 3QO9B 1PILA 1NKBA 1IBLF 2VG6B 3NBPA 5DQIA 2IVMA 2V9KA 2D7SA 1V3RA 4O44A 4DV2F 5CYMB 4B3OA 1TV6B 2N4DA 1KN6A 2ZJQQ 2ZE2B 1VQ4S 3D0IE 4OQJA 1SV5A 2YNGA 4IH5A 4ELVA 1H0HB 2D9PA 4LVOP 2ZH3A 5HROA 2B6AA 3TQ1A 3CCRS 1NEEA 5F8NA 1HQUB 5IM0A 3PX4A 3BGFA 2R8JA 4ZVEA 5DGAA 3CCJS 4K4SA 2ZKTA 3MEDB 3FZBA 1MMNA 4Y34A 2CQGA 3TAPA 2CZVC 5L9NA 3BN4A 2NUHA 5D4LA 1R8HA 5B0BA 4DR1F 1REVB 2MKIA 1JLAA 3HZGA 3MMCA 1NK7A 3GSDA 3I55S 2M3DA 2DNOA 3V2UC 1W2BR 2DT9A 5HL7Q 1JKHA 4DL0C 2QA4G 5JUMA 1R0AA 3J81Y 1TL5A 2KXFA 2B43A 4KE5A 4A47A 1RT1A 4IH6A 4QYRA 5K14B 4ZPTR 1S48A 4RW7A 5LT5A 4TU7A 5EX3A 1JIHA 1HWJA 1Y7PA 4HLBA 4KPYA 4C0HA 2O5DA 5F8MA 4NLWA 3IRWP 2LEPA 1S0VA 3QJJA 3BJYA 2KZZA 2ZC3A 1CC8A 4XPEA 3ONQA 4WYWA 3H4BA 2GIQA 1VRTB 2UUCF 1V3ZA 4A4JA 2RDJA 3MMAB 3HM9A 2H5EA 3DLKA 2W8KA 2ZH8A 2OPSA 4IR1A 3TUJC 4MFBB 3TNVA 2AGQA 4KT0C 2GJ2A 3ISZA 2DNRA 3UQSA 1S4FA 5A6WA 5F8LA 4K4XA 2KFNA 2B4UA 1JX4A 4Q0BA 3TA2A 3V6KA 2EBGA 3HMJG 1QVFR 2JH3A 4ZVHA 3ZZTA 1DURA 4G1QB 4X4VA 4ECWA 3OTDA 5GVQA 2BDPA 2F8MA 3OL9A 4JI7F 3PX6A 4IDKA 3I5AA 1CQNA 3PX0A 2OJ3A 4NCBA 3OXFA 4DWIA 4NLPA 4DG1B 4DV4F 4DL6A 3J7A1 4ZPBA 2ZOFA 4ZVGA 2W9CB 3MAQA 3FRZA 3S6EA 4IOCQ 2C22A 4RW6B 2BE2B 4ECUA 5LSRA 3CTRA 3MMCB 4CO3A 1VI7A 1RAJA 5KG6A 1RT3B 3KK1A 3GILA 4M5DB 3MMBA 3THTA 3M8RA 2MKSA 1WI6A 3PEHA 2XSJB 3X3UA 4DV3F 4R25A 3J7ZT 4F02A 1FT8A 5KFSA 4C8YA 3CPWR