4DV5F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv5F00
1N36F 2HHHF 4B3MF 2B7CB 1XNQF 4LFAF 2UXBF 2BVZA 4DR3F 4LF6F 1G7CB 1HNZF 1J5EF 4X65F 2F4VF 5LMNF 2ZM6F 1IJEB 4GKJF 1G1XA 2E5LF 1FJGF 4K0KF 4OX9F 4JYAF 4X66F 4DV4F 1LOUA 4YY3F 4DUZF 4DR2F 4DR1F 4JI6F 4B3RF 4DV5F 2J5AA 4DV1F 4LF8F 2KJVA 1CQNA 1F60B 4DV7F 1IBLF 2VQFF 2BXJA 1XMOF 2UXCF 4DR5F 1N33F 1XMQF 1RISA 4JI2F 4LF4F 4NXNF 2VQEF 3OTOF 3T1YF 4JI0F 1HNWF 1CQMA 4LFCF 1N34F 4LF7F 4X62F 3T1HF 4DV0F 1HR0F 3R3TA 5LMUF 4DV6F 1GH8A 4GKKF 2UUAF 2UUBF 4KHPF 4JI3F 4JV5F 4AQYF 4JI1F 4JI4F 5AJ3F 4X64F 2UXDF 4B3SF 4NXMF 4B3TF 1IJFB 1VMBA 1IBKF 2UU9F 4JI7F 1B64A 1QJHA 4LF5F 4DR6F 4DV2F 1N32F 5BR8F 4YHHF 4LF9F 1FKAF 2YY3A 2RJZA 1XNRF 4JI8F 4LFBF 1HNXF 4DR4F 3ZZPA 5IWAF 1I94F 2KJWA 1IBMF 2B7BB 4JI5F 4DR7F 4DUYF 4DV3F 2UUCF
chains in the Genus database with same CATH superfamily
2V8HA 2HS4A 4FNIA 1R31A 1H74A 2DT9A 4DPXA 4LR9A 3KJQB 2EPIA 4YY3F 4OJ3A 2R7SA 3W5YA 2BKOA 3MMAB 2RUSA 1WSVA 1JNRB 1JLEB 1OQ6A 2QA1A 3CCUS 3RW7A 1FKOA 4M5GA 3C6TA 2B8PA 5KFPA 4ENOA 5A2QU 2AYEA 1MU2A 3GG1A 3V4IB 1SJ3P 1OSCA 2BQRA 2HVDA 4C48A 5LJ3Y 1X7VA 2ZOMA 4DLGA 1FDNA 2CDQA 1T94A 2UUAF 1XR7A 2BANA 2KZMA 2MPUA 5GADI 2Z57B 5AE3A 2FY8A 5HSPA 2XSFA 4LF2A 1U0HB 4FPRA 1BXNA 2ROGA 3DRSA 3OL7A 1NJIT 4RW6B 2YWEA 3J81Y 3EWGA 4R8UA 5E33A 4FXDA 1FE0A 3DU5A 2F65A 3BSOA 1WEZA 3SQOP 2PO4A 2GHWA 1UCNA 4JI8J 2NPFA 2B7BB 3KK2A 3VGUA 3K5LA 2CNKB 2FHKA 2XMUA 5LMNF 1Y7PA 1KBRA 1PAEX 2BE2A 2HFOA 4FVMA 4JV1A 2DISA 3W63A 2ZH6A 3CDEA 2KM8B 3M1VB 1YX2A 5L39A 1B0VA 1S9GA 2HNYA 1JJHA 2GVZB 1NZAA 4WK3A 3KLHB 1RHMB 1U45A 2V8DA 1VIOA 3CEDA 2V50A 2RDDA 4URQU 3NOGA 1HR0J 1X0FA 1LKZA 5GAGU 2VFVA 4ZN1A 1KQSR 2FLLA 4ZVHA 4ZPTR 4FF4A 2PFFB 3QATA 4UW2A 4OHYA 1TK0A 2J0SD 3LWMA 2GS8A 1JLFB 4KC5A 4NXMJ 3FK4A 4NMXA 4ED1A 4RWWA 2KDOA 2AX1A 3MFHA 2E9TA 2BJ1A 3PFOA 3T5JA 5J1EB 4OZ5A 1HNXJ 5K14B 1U25A 3PHTA 4DX6A 3MM9B 2WSEC 4ZJOA 2F4VF 4J9OA 3UCGA 1S0OA 2DCUB 2GJ2A 4BS2A 4GKJJ 1R8HA 3TEGA 1PBUA 2IM0A 1HBNB 1OS5A 3MM7B 2IJFA 2DK2A 2GZOA 3BV8A 3PKYA 3K58A 4EWTA 1HHSA 4HLBA 3BM7A 1Q81T 3PTWA 1IR2A 1IUJA 3CF5Q 3HZGA 2VQEF 4LSNB 1WHYA 5GAEU 4ID5A 1R8PA 3BGUA 3MR7A 3AXMA 4I68A 1B7FA 3X3UA 4RPFA 4Q2LA 5KT7A 3KDNA 4NLUA 1UZDA 3OUYB 5H9EJ 3KWMA 4G6VB 5IOLA 5KG5A 2V94A 5F9NA 1E6YA 2A18A 5F8NA 4EK2A 2BOAA 3HHDA 1N32J 1HLWA 3EMTA 2XO7A 1NDCA 2B9WA 1T11A 5IWAJ 4DUTA 2WAQD 1WHWA 1IKYA 1VDHA 5HVFA 3T1AA 5B0CA 3CB4A 5J2QA 1S1WA 1XNQJ 4HVZA 1KHWA 2VFSA 3PR5B 3GIMA 2UVUA 3T3FA 4WCEQ 3CGIA 4OYWA 1S6PB 2DNZA 1D1UA 1AROP 2MQMA 4PCQA 3DDNA 1PILA 3M2UA 3HXMA 3KLGB 2WB4A 3MEEB 1U24A 3E2EA 1OIAA 2QMWA 5C2GA 1VQNS 1AZSA 4X62J 5DRKA 2MJNA 1GT8A 2XTJP 1N54B 3GR1A 4FS1A 3Q86A 4OJ1A 3FSIA 4A8QA 2A10A 1F5CA 4M5DB 1DTQB 2MTLA 2KXFA 5LL6d 1FKAF 4K8RA 4CLYA 3JSMB 2RH3A 1HWLA 1XNRJ 2L08A 2DHSA 3H2LA 4A46A 1GFWB 1QE1A 4YOEA 1SKRA 4DQPA 3NGTA 4NASA 3M32B 1REVA 3LAMA 1Q8IA 3W5ZA 4WKRA 1EB0A 3I4PA 1SL0A 4DV7F 3M2RA 2FJDB 5DO2A 1RCOB 3OTDA 3C14B 2XSJB 3RTVA 5EWGA 4RU9A 1N5SA 2J6TA 1N5VA 4LF7F 3CJKB 1KSPA 5H9FK 1RWKB 2C28A 2BJ9A 3NL0A 2ZUGA 3VQTA 2W2NP 4IFYA 3TP2A 5D0GA 2W9AA 5LSLA 1UFKA 2VD3A 1FKPA 4TQSA 2XCAA 1RGVA 3POTB 3EDQB 1RAFB 1HYSB 1R8AA 2RB7A 4LF9J 4PG8A 1Z4UA 3CJ8A 3SSSA 4A4JA 1FDAA 3EDRB 1FFGB 1ZH5A 4DEZA 4B9VA 3QJJA 2R8HA 4ZVPB 3LANA 1VQKS 4F0KA 5DZ6A 1AB8A 2V63A 2V4JB 4TXSA 2I6WA 1F1BB 3JTOA 3R8YA 3OHBA 3ZZZA 2VF3A 4H4MA 2E5LJ 1L3TA 4OI3A 2JNJA 1MSWD 1RTDA 2DGUA 5HQLA 2H65B 2V2VA 4TNOA 4DR2J 5DZ7A 3TI0A 2DEJA 1YGYA 4XPEA 2F8MA 3IRXB 4WU2A 4LRCA 3J81j 2QL5B 1XMQF 2VQFJ 3HHLD 4QIEA 1XMOJ 2DY9A 1N33J 4IFVB 4J37A 1BLUA 3HZEA 2XY6A 1H38A 1UP1A 4OI1A 2RIJA 2HQGA 3D28A 4MK8A 4DPUA 4TYBA 2CWKA 1G4CA 3KYLA 1KC8T 3DGPB 1NKBA 5L1LA 1UWAA 3OR1A 2O5DA 1S49A 4YS2A 3H25A 3GYNA 5HMYA 1NNDA 3QZ7A 2SXLA 2ZD1B 5IT0A 3AQOA 3EZOA 1JKHB 3BQ1A 5KG3A 3NLCA 4CWBA 2GC8A 2MHEA 4DR4F 1C1BB 2R2TA 1MN7A 4LFBJ 1ZM3A 1T03A 2JEGA 1O0PA 5F41A 1UAWA 5HL7Q 1WC0A 3HVWA 1UWBA 1ZAXA 1S97A 4ES1A 1WC6A 4RNFA 1G3OA 1TL1A 3MD3A 2IBKA 3ENAA 1R43A 3SMZA 5DG7A 1VC0A 4DR1F 1X5PA 2B9XA 1JQGA 4DV4J 4LF8F 3B4DA 3W2WB 1L3SA 3VVUA 4DUZJ 3KMQA 2G0IA 2RQMA 2WONA 3CSKA 2Z8QA 4LF4F 5C42A 3E8OA 4ZVRB 5GMKa 2ALZA 3KHGA 5J2NB 1LW0A 4AQYF 3CDBA 4WZQA 4JI4J 1FCAA 3NCQA 4K4XA 1CJUB 3I0RB 3MM8A 3GIRA 4TY8B 2CQ1A 1ZZFA 4CTAA 2HNDA 2ZH4A 1RT3A 4PUOA 3NXZA 4DG1B 1GTEA 3RBXA 2AZ1A 2PC6A 2V8GA 3MAAA 3PYFA 3JB9k 2W24A 4ZPWR 4F2SA 2K7JA 4ED2A 1RT4A 2ZH3A 4Y2CA 4NPOA 3QT5A 4FYVB 3G71S 3B82A 1DTTA 1F6TA 4MIBA 4CDIA 1QDUB 3U7JA 1GAOA 5A8WB 3PJWA 2ZFHA 4B9SA 3B78A 5KG0A 5C7PA 2J5AA 2EWHA 4LIRA 2F63A 3TVYA 4DV1J 2D9PA 2J6SA 4DR5F 2GGPB 4PR6A 3IS9A 2M70A 2KFZA 3H5YA 4QIWD 5LMUF 2ALYB 2J7KA 1M5SA 3M9MB 4DV6F 2RF2B 3AOBA 3ISZA 2CXEA 1N8RT 3HHLA 2HAFA 3M8WA 5KG7A 3PW7A 2Q1LA 2WVCA 3RZAA 4LMZA 4DQQA 5A6PA 4X64J 3MHYA 4DR6F 2EFVA 3MOZA 1DJ0A 2NYHA 1S1XA 3CXCR 1QVFR 1MWYA 5KG2A 4DCJB 2GA7A 4R0JA 5DLFA 2IA6A 1KOHA 5AE1A 3W66A 4RBVA 1RTHB 1FWLA 4DFPA 1WI8A 1V5IB 4B3MJ 2XZTB 4DR3J 1RXOB 2PD1A 4KO0A 4DN0A 1U02A 4H4OB 5SZTA 5EDWA 1PG5B 1I1GA 2MEWA 1R8BA 4E2FB 4N47A 2XS5A 1FE4A 1Q79A 5HMWA 4XAKA 1RK8A 5E3PA 2WVDA 3M2VB 3VZHA 5DETA 5CA5A 3GCWP 4RX6A 2JRSA 2W4CA 2MGZB 2VC1A 3LH2S 4KV8A 1F0XA 1WHVA 4OYBA 2RRBA 3JYTA 1HQ2A 4FF1A 2D3O1 1VLOA 2YNHB 4OZLA 5I3PA 3W7BA 1YRUA 3D7SB 3NY0A 1T05B 1XC9A 1WORA 3QGIA 5HQ8A 3H40A 2B5JB 2B6AA 3FMWA 4OZ2A 2L41A 2JH3A 3FKBA 1Q78A 3MM5A 3QWPA 3TW0A 1SQGA 1L3VA 4OZ3A 3W2VB 4Q2MA 5IV3A 1OQ3A 4IYQA 2LEAA 3C6UB 3C19A 4DR7J 2A3JA 1LXJA 1F9EB 3NBPB 2DGXA 1TR0A 4HH1A 2YWHA 3IWXA 3Q8PB 3IG1B 4L3NA 3MOJB 3KLVA 1J5OA 4YR3A 3FVYA 2ADCA 1PYSB 4IR9A 1RT2B 4ZCLA 2E5JA 1DURA 3GJQB 3Q8SB 3ENVA 5FD1A 2EFNA 1U1NA 1S12A 5KT4A 2QV6A 3TUPA 5CCLA 1EP4A 1BD6A 1HNVB 4DX8H 4DZ6A 3RR7A 3DFEA 2YX1A 1X9SA 4NLOA 4QCLA 4HHHA 3U1LA 1WOSA 2W9CB 5JUMA 3CCTA 2VBWA 2CFXA 2R7RA 1JJ4A 1QSYA 4ECWA 1KDNA 4EBCA 1VQ8S 1LFWA 4GVBB 1XR6A 2DNGA 1X4AA 2CQ4A 3P8BB 1F5BA 4X4SA 4DCPB 3AD8C 1N5TA 4MKYA 2ERRA 2B43A 4ZPCA 1J5EJ 3DLJA 3AH6A 2J9DE 4RW9A 3OQ2A 5GMDA 2QE5A 2HVHA 2ASYA 4KSEB 3HD1A 4GRSA 1RU2A 2OD4A 3A12A 4K4WA 2RMLA 1NU4A 5CD4A 1FX2A 1B7YB 3HVAA 4P2XA 3K0JA 5F8JA 2GQQA 3PXGa 5IC6B 2ZWPA 1EQMA 3HVTA 1ZTTA 1QTMA 4IKAA 1M5KC 4FP9A 4FXVA 3PEJA 3QLHB 2JVRA 2PMZD 1MLAA 1NK0A 3D0GE 2A1BA 2V0NA 2HSEB 3DMJA 1HQEB 3TJ8A 3D6MB 1FRMA 2VG5A 5ETMA 2LXUA 5A8RA 2HBZB 5EUHA 5K8MA 1ZTWA 1XWLA 2RJZA 4N77A 3K57A 5E2QA 3ETOA 2VPYB 3DM2B 1SL1A 1WTBA 3RBZA 2DEIA 4WP3A 5E3QA 2B4UA 1VBXA 2JFDA 1IKXB 1RAGB 4NI2B 5FLXY 3HHKA 1IBKJ 1U1PA 2NZCA 3RRGA 3GR0A 4K2JA 2JFKA 4L6V3 4CLKA 4CLUA 1NXIA 5LM7E 2B9EA 4UZCA 3DLKB 2V2QA 4URSA 4YY3J 2WCXA 4LRDA 4OI2A 2G0JA 5C2CA 2A6OA 2WB1D 2NREA 3GLJA 2OFGX 3MCNA 4ECQA 2RU9A 1FXRA 3LP0B 1KKHA 3BGLA 4ZVOB 3OLBA 4CO0A 4W4MA 2HBYB 2IM3A 3DI6A 5J1PA 2UUAJ 4MKBA 4F04B 3SQGA 4EEYA 2MY7A 3QGGA 2GJFA 2VPXB 3A8KA 4BWJA 1HMVA 2M8HA 2I5JA 3JSRA 3HKZD 2CQ0A 1JXEA 4LUBA 3BYPA 1JLCA 1R0BG 5IZHA 1NLKL 2H4WB 2ZH5A 3S6EA 3PVXA 4OLOA 2Z2MA 4KRWA 3CIZA 4TU9A 5LMNJ 4MKVA 4EYHB 2Q43A 2BACA 2CJKA 4AFFA 3BGRB 4Y2AA 3HP6A 1K1SA 2AJFE 1VCTA 2W8KA 2XY7A 2HWTA 2KHDA 1S1UB 1SV5A 2DXFA 4Y28C 4CM2A 2XMMA 1TL7A 1QAJA 4CLPA 2FVQA 1AYEA 3PCOB 1HHTP 1O5JA 4I7FA 2C2EA 3GE9A 2HZAA 4HI1A 5IS2A 1T7PA 5GAHI 2EXUA 3KLEA 2DJWA 2BJEA 1U09A 5A76A 5IQ6A 3UPFA 3HDSA 3HMJG 4C3KA 5HN0A 2DITA 1K0TA 2BJ7A 3ADAC 2DRDA 2O3DA 3WC0A 1WC3A 3UDVA 3QT6A 2BE7D 4NLWA 4GVLA 4LF6F 5L38A 4QZVB 3ILIA 3BKFA 2ZUAA 4DPYA 2V4RA 2F4VJ 1Q95G 5DQIA 2MKHA 1KRPA 3RRKA 2HBRB 2BW7A 4RW7B 1FFSB 4EMDA 1LK5A 1RYSA 4LR8A 4TLRA 3VAMA 2Y3YA 3KJNB 3SCLE 2V2ZA 4WFYA 9ATCB 3WQPA 2M8DB 3QRQA 1RWMB 1FRJA 2E5HA 3V6DB 2KFNA 3I96A 4IG3A 4NA2A 1VQSA 4Q44A 2VQEJ 2K3IA 5LOQA 3A1YG 4YB5A 2UV8A 5KT2A 1YJRA 1U49A 5KFVA 3W8PA 4CO3A 3DN9A 2IRUA 2DO0A 4F2RA 1AXQA 5KFZA 3DHXA 1RABB 4YHHF 2BZ2A 1YJ7A 2AD9A 1S10A 2RRAA 4LSZB 5KG1A 2HIQA 1HARA 2KT3A 3EVOA 2X1FA 7FD1A 2W2QP 2MQ8A 2I2YA 4DSEA 3R6GB 1FKOB 4D3HA 1S6QA 2RQCA 4R5PA 1FJCA 1IKWB 4NOHA 4AL6A 4PYDA 1MU2B 2OP5A 1C0TA 4ZCIA 3BO2A 2ILYA 2CQ3A 4O3PA 3G6VA 4CNZA 4W90B 2QLWA 1VC6A 2BANB 2EFPA 2P6TA 2JLFA 2DIUA 1WDTA 1XEZA 3ILLA 4IOAQ 1VJQA 4N8NA 1TL3A 3GIKA 4ECZA 3ISND 4FYYB 4JI0F 3DRSB 1LQ9A 3DRRB 4R8UB 2R7OA 5H9EK 2AU0A 1GXUA 2RE1A 1NM2A 2K7KA 1Q8BA 1RWWB 4EO6A 2JC1A 2ASLA 3L4BC 3QWUA 3KK2B 2FZKB 4F7VA 2C2RA 4NLGA 5L1IA 2KTQA 4BC7A 4DU8A 1CEZA 2VDHA 1UW9A 3CJRA 3NP5A 4PXDA 1FFWB 2MQLA 2MKCA 2XI2A 2BE2B 4O3SA 3VQSA 2Q79A 3PKMA 3ZZUA 1TK5A 2W4DA 3T9NA 3UD3P 3EX7B 1T9UA 1S9GB 3GP9A 2HNYB 4AXJA 1LWFA 2H48B 3UD5A 3R5GA 5KG4A 3GV5B 2D69A 2ZNYA 3QIPA 5KFTA 2CJYB 2WSCC 4QJVA 1NBEB 2VG6A 2HQIA 5C24A 4RUBA 4RW8B 5KFYA 4X4NA 4P74A 1UL3A 1T9WA 1ZPWX 2C3UA 3DDIA 5DGBA 1SC1B 4K59A 4KKOA 4DV7J 4PWUA 5F8MA 1YWXA 4G65A 3P45B 2W1BA 2LP4A 3PO4A 3A3NB 5F0UA 3P49B 2ZHAA 5KFRA 2MZJA 4LF7J 1RAAB 1WG5A 1PO6A 2XB2D 3Q83A 4Y3CA 4WXOA 5JJBA 1B70B 5CHCB 2HS3A 3MAQA 2MSTA 2ZE2A 2CQIA 1UVKA 3BR8A 3CD5A 3SXLA 2JZ5A 3W8GA 1VQ5S 5AXNA 4FDFA 2XHCA 4J9SA 1X4FA 3OXLA 1X5TA 4KAIA 3DU6A 4KBIA 4F26A 1Q53A 5BJRA 1NSQA 4I69A 3CC4S 3H0PA 5AXMA 3ENWA 3PG9A 3PX6A 3KG0A 3PX4A 3QFWA 2FQQB 3VCDA 1R0AA 2XYPB 5HROA 3BEGB 4ID5B 1APSA 5KOWA 2C22A 3MEGA 4DFJA 4ZIWA 2LEBA 3X1LB 4IH7A 3OR2A 2GO9A 4QWBA 4ZA1A 2AGOA 3HD2A 3H4DA 3DGVA 4QR1A 3ZO7A 3KTQA 4Q43A 2HS0A 2DH7A 2JDJA 1XMQJ 1E6YB 4C8KA 2M52A 2KRBA 2DHHA 4XIUA 4EYIB 5IT4A 2DTJA 2KN4A 5AJ3F 1S4EA 3R5CA 1UZHA 2KXNB 4DI6A 2ZDPA 3MUTP 2ZBCA 2LU2A 1IKYB 1S57A 4KHRA 2O66A 5J2QB 1S1WB 3TVKA 4Y6IA 2G2YA 4NRUA 1KNZA 3MEKA 3T6JA 1Y5LB 3TZXA 4OYAA 3FFIA 3ZNUA 2BYCA 1VOMA 4JI5F 2N7CA 4DR4J 1D09B 1CS4A 2R8JA 3RYLA 5CCMA 4CLLA 3R7SB 6FDRA 3M2UB 1VQ7S 2LKZA 2POKA 3TAMA 2BV3A 2XGPA 1ZZNA 3CC7S 3RB4A 2WSFC 1AZSB 1OY6A 4ELVA 1ZM4A 4DPTA 4DR1J 3VGSA 4LF8J 2CKWA 4EO8A 3D6TB 1Y10A 3BPDA 4B9MA 2Z2ZA 3MEDB 5B0EA 4DCOB 4LF4J 2QMXA 3DXSX 3M6UA 3J7A1 5HMZA 1AFJA 4HYKA 4GKKF 3R2DJ 4JI3F 4CLFA 2ZH7A 1EETA 4DBQA 2VU5A 3H8YA 2AQ4A 4AQYJ 2YWGA 3GFHA 1QE1B 1Q7LB 2OEJA 4USKA 3CMQA 3KNGA 3VAKA 1REVB 1JLAA 4U6PA 3PRBA 3I6PA 5KFGA 2Z2LA 2QYGA 2VZ9A 4J9VA 1U2CA 2MQQA 2DGSA 2BM0A 3SDEA 3M2RB 3JTPA 3M8YA 4E0DA 2VPZB 4F4KA 4F36A 5KAKA 2J0XA 1UEVA 4USHA 4YB6A 4FBTA 1JK9B 3CO9A 4H54A 1TMJA 5DDOC 3JS9A 1BMQB 2J0QD 3KMSA 1F60B 4UTGA 2GIQA 1U0SA 4IFYB 4C0BA 3CJTA 3J7AN 5K8OA 4IOCQ 1R6VA 4NX9A 1FKPB 4K4TA 4DR5J 2QRRA 1YBUA 4C8NA 2XMAA 1HIYA 4UY8T 3H20A 4A8FA 5EWEA 4OZNA 1K44A 3KJVA 3FUYA 5LMUJ 4DV6J 4EFAC 4UT4A 2LDIA 4K4UA 1Y5NB 1NK9A 2DIVA 1Q4RA 4J9NA 4DR6J 5KFFA 4M5IA 1PJ5A 2Y0BB 1T02A 4RU2A 2PE8A 3CD7A 4H4MB 5MLCV 2GAGC 4F50A 2JLEA 1RTDB 3PY8A 2DGVA 4YFUA 4S0MA 1K0VA 2CQBA 3E01A 3GFZA 3KLFA 5DDQC 4F02A 1RZMA 2A0FB 2MKIA 2ILZA 2MZSA 2GFFA 4OYXA 3RW6A 5I42A 4CH7A 3PEHA 5CZVA 3OR1B 3FBEA 4WZMA 4A8MP 4O0NA 4Q8FA 2HFSA 2FD2A 8AT1B 4ZP6A 4KHPF 4NLXA 2OGUA 3BREA 4QU6A 1KVIA 1UVNA 1FRHA 1GMUA 3AOAA 1EAYC 4NLDA 2UXDF 3BB5A 4C8OA 1V3ZA 4C3MA 3RB6A 3NGKA 5CYJA 1N88A 4Y2KA 2E9ZA 2BR0A 1TKDA 1UWBB 2EI5A 4LQ9A 4OL8A 3LW5C 1TL1B 3Q8UA 2KM8C 2DNRA 3SYZA 3KK1A 5E0OA 1S9EA 1XR5A 1YBTA 4O0IA 3HSZA 2IFXA 1RWPB 1DQ8A 2ZH1A 2B4PA 1H7WA 3EXCX 3KJFB 1RUSA 4ZLNA 2N3LA 5FDLB 2WONB 5C42B 3ZC4A 4OMFG 2PT0A 4QWCA 1HQUA 1P1LA 1PYOB 3ZXWA 1NJZA 4V1Ak 1OWXA 4I67A 2LU1A 5F0WA 2CAJA 2CWXA 2PIIA 4GC6A 4QBUA 4U7UK 5CYQA 3OTOF 4OI6A 4I6YA 4FPIA 1SQEA 2DNLA 3TQEA 3CJSA 3MM8B 2LA6A 4CTAB 2HNDB 4B17A 1RT3B 4PUOB 4M95A 2ZITA 2OHDA 2YWKA 4CCHA 1WF2A 3MAAB 1ROFA 5BXIA 5DDPC 1RT4B 4NE9C 4QIVA 1EARA 1B64A 1DTTB 4O4RA 1RHRB 1YKWA 3MMJA 2DNKA 2LQ8A 1VQYA 2K2PA 4QQBA 4DX5A 2GW8A 3QJPA 3LAKA 1IBMF 4OYZA 4LJMA 1NHVA 4HDGA 3EYZA 1BE4A 5THWA 1H73A 4YR2A 3GONA 5I3UA 4O3QA 4PYAA 2WK4A 3HM9A 4TN2A 1VBZA 3BDPA 1TQLA 3QZ8A 3G8QA 1WG4A 2ZC4A 2C3PA 1X8DA 5FIIA 2PMHA 1RAOA 1HD0A 3HHLB 2B8QA 1P6TA 4Y0FA 1CJTA 1N4LA 2YKMA 3ILJA 2NQPA 3GSDA 4ZVSB 1EJ7L 4C8ZA 1BHNA 5CZXA 3QO9A 2XS7A 2HPUA 1S1XB 5KFJA 2XG8A 2DNNA 2RNEA 2ZC3A 1RHQB 4YUDA 1HBUA 4Y65A 2X1GA 1TMMA 2GX8A 3ILOA 2YKPA 4DL7A 3TUIC 1TUVA 2KYZA 2EEYA 2VG7A 4LF5F 3OTBA 4O44A 3OD2A 1V6HA 1RTJA 4XPCA 1RADB 4X84A 4KO0B 1HBMA 5T14A 1OY8A 1T9YA 4NLTA 1C2PA 5BYSA 4MFBA 1UVIA 3G82A 4E98A 4NMLA 1NSKL 1TV6A 4X2BA 3MPUB 3HCXA 3PW4A 4LQ3A 3NNHA 3SSQA 1M1GA 3KKFA 1OMSA 2HHSA 2DHXA 5ETRA 5DLGA 1FF2A 3QAUA 4KV8B 3JYTB 2W7OA 1ZPVA 2GNKA 4ECYA 3PW5A 4F8RA 1TZ0A 3VWSA 3GPAA 3WHIA 1RWNB 5BYRA 3ZZ0A 2UVVA 4OYPA 2ZH9A 1LWEA 2MZRA 4RJVA 2H54B 2VPWB 2B6AB 1GK8A 3PO5A 3D54A 3TEHB 2X3GA 3MM5B 1QAXA 1L3UA 4AL5A 2IIHA 1T8EA 1RT1A 1X5OA 3ET6A 3VALA 1VISA 3V81A 5L9XA 1TUWA 2FIUA 2ZJRQ 1OPZA 4P52A 2ACMA 4ZPVR 2YPYA 2DKOB 2AV5A 4A8YA 3PIOQ 4DL4A 4ERDA 2HHWA 1J5OB 1WD6A 3WZ0A 2B7CB 1T0TV 2FVRA 4IDKA 5T7LA 1U1LA 4HTJA 3ENQA 2AJ1A 4I56A 2CPZA 1F9HA 3DYAA 4UZBA 4ZS6A 4PWWA 3D1QA 5A2QY 2OKQA 2K3KA 2VA3A 4ZKAA 1EP4B 2JHEA 2RD5C 1OYEA 3W62A 3L09A 3DHWC 2DNYA 4X4RA 2HAIA 1XJWB 3Q23A 3V4MA 2ZBRA 3MECB 2H9ZA 2ZJPQ 3O2IA 3I5AA 3G6YA 1RCXB 1NB7A 4IOBA 1YZ7A 2E44A 4OJHA 2CG8A 4X4QA 3I4HX 4YDXA 1N56A 4K4YA 3NGDA 2W2PP 4RW9B 2CPXA 1ZBTA 3FBFA 2M5YA 1EKSA 3UR0A 4BCAA 1S77D 4DF8A 1TAUA 2QIFA 3N4WA 4LF6J 1FWKA 1W25A 1TU0B 1J2VA 8RUCA 2KH9A 3MMCA 4BWMA 1K8AT 2V67A 2DRBA 3SBMA 1U0HA 3HVTB 3BKUA 2Y1IA 4EZ9A 4M5NA 4Q45A 4YN3B 2FVCA 4CRJA 2NSBA 4U96A 1I5OB 2WZ1A 4Z7YA 7FDRA 2QYCA 2VG5B 3A8EA 3R5AA 4K7QA 4IQXA 2ROPA 3PX0A 2QFJA 1LEOA 5A8RB 3NCRA 3AJDA 2XHWA 4USTA 1WOOA 2IYIA 2AT1B 2PEHA 1MWQA 3T5LA 2R8KA 3DOKA 3OFGA 3KUHA 3TZZA 2B3TB 4M5JA 1WSRA 4KPCA 2GQCA 2FZCB 2XWXA 1A6LA 1KQGB 1PKUA 2FUG9 3KNAA 3MPVA 2DNHA 4YHHJ 3EGNA 3MR3A 1EQ0A 2E66A 1B4SA 4G3IA 4PXEA 4MJKA 1CJVA 4IUFA 1BC6A 2V6AA 3GIJA 2FB0A 3PJXA 4HHJA 4DQRA 2IDLA 4I64A 2EBGA 1X4EA 3HULA 4ED0A 1O8BA 3KLIA 3NNCA 2Y8WA 4ZP8A 1BY9A 5K8NA 5L1KA 3D0HE 1RT5B 4UOCA 1Y4ZB 1JLFA 1FNOA 3FEXB 3GIIA 4N5SA 3DI6B 4RKUC 2YH1A 3SQGB 1YI2S 1WKJA 2XNQA 4FYXB 4A47A 2U1AA 3BF4A 4LFCF 4RBTA 3HX9A 4JI0J 3TWZA 2EKNA 1HMVB 2OJ3A 3PR4A 4TY9A 2I5JB 2HNZA 2VHGA 1LV5A 5D0HA 2B4VA 3VGTA 2C2MB 4N8OA 1JLCB 2R3VA 1VK3A 3D9BA 3O6QA 1CBKA 3IN5A 4P75A 2JEFA 2OPRA 3ZZOA 5M2PA 4C8MA 2G1HA 3TANA 3TAQA 1WC5A 3CW2C 2J9DA 3NCPA 4XTTA 4C0OC 3V5RA 2DNQA 1NEEA 1YJ9S 1SKSA 4C97A 4ECVA 3FSYA 2ZBPA 4ILMA 1JJCB 2KHCA 1RI7A 1SV5B 2HRUA 4HR2A 4OYOA 1TL7B 3PYGA 1IBLF 4I7FB 4CQ1A 2WW4A 4DL2A 1NSPA 3KLEB 4H4KC 5HANA 1A0OB 2QC3A 2HHPA 3HFVA 3HT3A 4F4YA 4JB8B 2G0CA 4LT6A 4ED8A 4MYUA 1ZETA 3IWNC 1FEEA 3KK3A 2YH0A 3OSPA 4IO1A 3GFYA 2A2CA 4B3TF 1IBKF 3QSIA 1CG2A 1K47A 5KFKA 5HAOA 2ZJQQ 1S7HA 4NEZA 2N7YA 2QEXS 5HLFA 1S1TA 2C42A 1JIHA 3P96A 2AGQA 2DGOA 2YXLA 5LXYA 1Z1ZA 4WIIA 2NXEA 1KTQA 3K7RA 2AJ0A 2JVOA 3UN3A 5J2PA 4IG3B 1HI8A 4OJGA 1FX4A 4U95A 5GADU 3DC2A 1LFPA 5D0EA 2AIRB 1YVFA 4AL7A 3TJ9A 1VS3A 1RE1B 3GZ7A 3ITHA 3I31A 4JV0A 2L48A 1ZAVA 2HYIB 3LP1A 3IR6B 4DPWA 2FJVA 1DBDA 2FC9A 4NYPA 3OJUA 3PV8A 3GFXA 3F0NA 4DSLA 3O5TB 3EZ5A 3EICA 1VRTA 3CDUA 2KVQE 5AJ3J 4JI7F 1XQIA 2UVWA 4IRCA 1I3OB 1ZS6A 4DV2F 4BDPA 4P9SA 2IAJA 4BHQA 1RBLA 4NL5A 5A0YB 4R5PB 3FRYA 2L9WA 3C14A 1R89A 1U6BA 1C0TB 3RAXA 1KTVA 2HZVA 2AP6A 1RWXB 1Q16B 1XBWA 4JI5J 4DFMA 2GHPA 2GHVC 1X0PA 4OIXA 5DM6Q 2XZDB 4DS5A 3LO3A 1TL3B 3MWBA 4EZ6A 2OEMA 1RHKB 3HI9A 2F8HA 1WNEA 1NUEA 2KO1A 3R5JB 1YJTA 1NSAA 3DLHA 5KFEA 4JI2F 2R7VA 3BJYA 1FO1A 2Z4PA 1NKEA 3FBCA 3UQSA 1T9XA 2HGMA 1JXVA 3P3DA 4L75A 4EUVA 4FKXA 3CIMA 1JNZB 1X9WA 3CC2S 5F8HA 4GKKJ 4JI3J 4ID8A 4AXIA 3D5MA 3M8QA 5IQQA 1LWFB 3I5CA 2XYGB 1IM4A 1VC5A 4PXCA 4NZ7A 5ITHA 3QIPB 1HWUA 2CVEA 2UUBJ 3PNIA 2VG6B 4ES3A 2HGNA 5C24B 3MM6A 1XTZA 2L9NA 4FBUA 4YB7A 3BPSP 4KKOB 3BQ0A 4DPOA 3R5DA 1U8SA 1SL2A 4DL0C 1FJGF 2IVYA 4QWAA 3BSAA 3C46A 1YJUA 4RUHA 3C2PA 2WBMA 2B51A 4M63A 1UEKA 3AFGA 1VFJA 3AB4B 4LVNP 1RP5A 1SJQA 2C2NA 2EVZA 2ZE2B 2KXHA 2PA8D 2EK6A 4K5SA 4USVA 3UCUP 3M9OB 1FT8A 5EWFA 1QY7A 1JLQA 1FA0A 1FNMA 2GVDA 4NWBA 2WHOA 5ETVA 3TOQA 1SC6A 4O3OA 3UVJA 4ZLPA 3NOCA 2CRLA 2W9BA 5E5NA 2FC8A 5B0DA 1UFLA 3L3CA 3CCES 1R0AB 2QLFB 5HROB 1PAUB 2XLIA 1VQMS 4LBIA 3MEGB 2D9OA 2FJEB 2V8PA 3OR2B 3UE2A 1KFDA 2RRNA 2HVEA 3OTEA 1FDDA 1WG1A 2DH8A 2Y1LB 4OX9F 3TA2A 3TYTA 1HW8A 1CULA 1T95A 5KFCA 2YNIB 3LQVA 3CMES 3SSRA 2MKJA 1SJFA 1F3FA 4WP9A 2DRAA 4DU7A 2NUHA 3AT1B 1FESA 1A9NB 1NDLA 1CVJA 2FLOA 4EBDA 4FYDA 4WE1A 2RSQA 2HHTA 3OFEA 2UP1A 4RNOA 3FFIB 4KHPJ 3KUGA 3MTJA 2LA4A 3HLUA 1CS4B 2UXDJ 1FRXA 1YJVA 3W3SA 5L1JA 5EX3A 3LTOA 3UDCA 1YLXA 4MK9A 3TAMB 3PRDA 4NZ0A 4ECSA 4B02A 2HHHF 2AWZA 2IRYA 1IVZA 3KG4A 4UUWA 4RW4A 2VBXA 3MFIA 2QA2A 2B0GA 4ELUA 1T9VA 2QFIA 1WKLA 2OPSB 3AAWB 4K0KF 2APOA 3HJFA 4USIA 3H2UB 1XERA 1UETA 3UI3A 1TKXA 2G9OA 1M0SA 2A6MA 3Q0AA 2GIRA 1FXLA 4P72A 4OI0A 2WVFA 1EETB 3G2XA 2IA0A 1IQTA 1SKWA 3OL8A 3O8WA 5ETSA 4GO5X 2AJQA 5I4MA 2N4CA 1QLNA 4I6AA 2E1MC 3OTOJ 5KT6A 2QJ3A 1JLAB 3K8VA 3C16A 1AW0A 3MR6A 3BGFA 2M4MA 2FHOB 3EZUA 5AXLA 3SDEB 5J1NA 1G6BA 2CPHA 1UKUA 1NRKA 3NAHA 2W2MP 1DLOA 1U1RA 3JQKA 2WOMA 3GWCA 5IFMA 3EPIA 2O01C 4KH1B 1IBMJ 3CJ5A 5KT5A 4OI4A 2B9YA 1KLNA 2CQCA 5D78A 2XLJA 2QL7B 1PJ7A 4ANEA 2X3DA 4FKYA 4WKYA 3KJVB 2KG0A 2CPEA 4X4UA 2H5JB 3O3LA 1RA6A 4M5MA 5D4OA 4ZCKA 3TUJC 3MPWA 3DDKA 3W2VA 3GYGA 4ICLA 4NLQA 3AB2B 1FRIA 4B3OA 4DZDA 2M9KA 3R6LB 1E6VA 3OFHA 2PEBA 3HSJA 1WEYA 1N52B 3N0VA 4RUCA 2KZZA 1MW7A 2M3DA 3NBPA 2Q3PA 5FJ4A 2VH7A 2W4PA 3L7OA 3GV8B 4CIOA 3L7PA 2MDAA 1SKUB 5G0RA 1CPZA 4OZ1A 1MMLA 3E01B 4LF5J 2MQOA 3KLFB 3HVRA 1BUXA 2BOPA 1D8ZA 3CCZA 4OFZA 3VF0B 5JVGQ 2OFHX 4Q7AA 2RQKA 3JSBA 1O51A 2YKQA 3Q22A 1X31C 5I42B 1SCJB 3ZTQA 1K73T 4DX7A 1DY3A 3RR8A 1K1QA 4DLEA 3IBCB 1U7LA 3Q89A 4CNYA 3T19A 4DV5F 1FEHA 3HSGA 2YKNA 4RNNA 4DHVA 4F4WA 2XMTA 3CCQS 4KH0B 1Y00A 4PPZA 1SC4B 2BEFA 4PWDA 1HNWF 4RWXA 3BKTA 1WUUA 2CQHA 4DV0F 4WFBQ 2H1YA 3G6ES 4QYZJ 1QD1A 3J7Z5 4QPTA 4P2SA 2I9SA 1S9EB 1N5YA 2ZVSA 3DCAA 4MK7A 2V69A 3FNNA 4QW9A 5EHHA 4ZPAA 3ZZYA 2IVFB 1HKAA 1U6ZA 4AUKA 1BWVA 4ZIVA 2YY3A 4E8UA 2ROEA 3BQ2A 4WIQA 3RAMA 4ETXA 1HQUB 2LYVA 1S1VA 3EVWA 1G7CB 3OL6A 3SEOA 2C3OA 3T41A 4KB7A 3N01A 2VBYA 3I0SA 4HL9A 3JQJA 5CYQB 3D1HA 2DD8S 2BE9B 2K06A 4TYAA 5MAOA 2DXEA 2EFOA 1XMBA 1VBKA 4W92B 1NZ8A 4JOUA 3US5A 2QMUB 4O3NA 4N7TA 3R5BA 2Z30B 3S01A 1DZ5A 2YNGA 2FJWA 3IO1A 1PJ6A 2EG1A 3DLGB 2CA9A 2OMLA 4G1QA 2X1BA 2R7XA 3OVSA 2V9WA 1CC7A 2RT3A 3IAS9 1CLFA 4C8YA 2VA2A 1UJ5A 3N9UC 4Y00A 2CDRB 2OUGA 4ZHRA 3LOUA 1FK9A 1PIEA 3PRVA 1X4CA 5I3UB 1KR4A 2NYIA 3H42A 2HZCA 3EPGA 4J90A 1I94F 3PIPQ 1Q1KA 1TAQA 3BDEA 4X4OA 3E3XA 3TAPA 1RHUB 1F2HA 1ULRA 4K2XA 4YDDB 4ECUA 5DGAA 1CJTB 2CZVC 5B0BA 2YKMB 2WRMA 1RJJA 4JBCA 3N79A 3QO9B 2HQFA 3UDLA 4B3RF 3FZBA 3H7HB 4F4ZA 3EE3A 3RAQA 1HWKA 3FCVA 4PG4A 1HNIA 1BQXA 1HBUB 3M8PA 4NCGA 3VAHA 3H90A 1NJXA 3MPYA 2KYXA 2VG7B 3EGVA 4O44B 3CJ0A 1F2GA 4QWEA 1P1TA 1RTJB 4DXLA 4IRDA 1J27A 2M88A 4KGMA 1HBMB 2NSCA 3SFGA 1SIWB 3J80U 4MFBB 4P71A 3G82B 2C1EB 4CH1A 1TV6B 1FVSA 2XBPA 4MMOA 4F25A 3I87A 1T3NA 1YRTA 1PC5A 2CNLB 1Y3JA 1FI4A 3S8SA 4HT5A 2G4BA 2DYAA 4Y2MA 4ATNA 2E1CA 3G96A 5L8RC 5HVHA 2JSXA 3TQ1A 4QW8A 1TL5A 2F4FA 1IKVA 2OPPA 2Y9HA 2YQ3A 3M05A 1LWEB 2DVIA 1S0MA 2RVJA 1KVJA 2HRYA 3BSCA 4WF9Q 2HFVA 5B0FA 4KJIA 3R7BB 3RJMB 1Q7YT 4L74A 1RT1B 2BJDA 2DH9A 3ET6B 3FDSA 3K5NA 4M5LA 3PM9A 3V81B 2R4FA 2AZ3A 1NJYA 1ACMB 2IC3A 3QYYA 4LFCJ 1ITPA 3DNCA 1SUQA 3F44A 4CO2A 3WX4A 5GVQA 4C11A 4NXNJ 4IDKB 5M2UA 4RW7A 4OZJA 5T7LB 4K5RA 2C2ZB 4OX8A 4J9RA 1RWVB 4CYUA 3BGOP 1TVRA 2J7WA 3CNQP 3WBZA 3DYAB 4QIGA 2P5VA 4DUYF 1Q5VA 2VASA 4DS4A 2HRTA 5F8LA 4NCAA 1AT1B 2VFUA 1IJEB 1WHXA 4UF4A 4GC7A 1MMDA 3IFEA 4I6WA 3RB0A 1OO0B 1T9TA 4ZP9A 3BN4A 1U8WA 3TNVA 3CO0P 2DR5A 5IT9U 2H5IB 2F9JA 5E3CA 1MWZA 1IBLJ 5HP1A 4F0MA 3HHNB 1KQFB 3H5UA 1SBRA 4M5KA 2EW9A 1RKIA 3A3PB 2IYGA 4EBEA 1QTNB 1OSDA 1U1KA 1Q8LA 1ZAWA 2HFUA 1IKWA 2UU9F 3CDWA 3QJLA 3GSIA 3BO3A 1QM9A 3PACA 4B3TJ 3FSXA 4PQUA 4TU8A 1AUSL 2U2FA 2MQPA 3MMCB 3GV7B 3KG1A 2X51A 1L3KA 3U1NA 4YR0A 4M1KA 2DR7A 1QSLA 3DRRA 3MXHP 1VGYA 4MAKA 4QOTA 3CJ4A 4X4VA 3DRPA 2IPOB 2D41A 5HQMA 3FCHA 3BBBA 3WDOA 2HQ3A 1K9MT 1DQAA 1B3TA 2DNMA 4RNMA 3CD6S 3VAFA 3DOKB 3KHHA 4ZP7A 1FNXH 1LWCA 1NK6A 2BJ3A 2YVSA 4BBYA 3R2CJ 3IRWP 5C25A 3HO1A 3CJQA 5IXUA 1CJVB 3U27A 5E7OB 2CVIA 2LVWA 1U6FA 4ZVQB 1RLDA 4RW8A 3MTKA 2XYHB 3FCWA 4JI7J 1GX6A 3CD0A 5HVGA 4DV2J 4WFZA 3KLIB 1GNKA 3TZYA 1RAHB 3HSDA 1YSJA 4XDCA 2NXCA 2UUCF 5GAGI 2XULA 3PYDA 2VJVA 3BO4A 2COLA 1F9FA 4X4TA 4ELTA 3TO8A 2C3MA 5B7WA 1XIQA 4X66F 3M8RA 2LLZA 1SH3A 3IXQA 1ZYQA 4C98A 2HNZB 1URNA 2PI5A 2OIHA 2OD6A 1MN9A 3BR9A 5GAHU 4L72B 4Y34A 4JI2J 2ADBA 2OPRB 4NRTA 1S59A 2J9CA 3ZTPA 1FD2A 2GMJA 2DR6A 3CJ3A 1FERA 2IVMA 2AEFA 3B8HA 3VAGA 3G9CA 4WFNQ 1VI7A 1GQEA 4YQWA 3CCRS 2DPIA 1S76D 2OTLS 3OXFA 5GAEI 4YP3A 2ZZMA 2PN6A 1TELA 1WDDA 1PC4A 4ED6A 3DRYA 3Q2TC 2YWFA 3I5BA 1RAIB 1BQMA 2QSWA 3AQPA 3HHLC 1H72C 4PPDA 2MKKA 2ZOGA 3C15A 2HHUA 5D4PA 8ATCB 3RG6A 1FVQA 1RYRA 3T9ZA 2LQBA 4LRFA 4HEA9 1FJGJ 3SCKE 2D7SA 3HFKA 2FDNA 4ZLJA 3I82A 1KWMA 1IN0A 3RGIA 4HHUA 1RHJB 3KK3B 4WFXA 2XC9A 3M6VA 3ONQA 4C3LA 4FF2A 1M5HA 2J8SA 2O1PA 5HLFB 1GMWD 4HH0A 2YPZA 1S1TB 3HKWA 2FY1A 3LALA 2VB6A 3LGHA 3OW2R 1KS2A 2JEIA 5BR8F 4U8YA 1V9OA 2D74B 2PSZA 4DF4A 4NZ6A 3G87A 3C6TB 1OPIA 4MT1A 3DLEA 5HJYA 5J2PB 2AYBA 3NGRA 2CPIA 4NYZA 2AEJA 3MEDA 3J7YU 4LFAF 1NHUA 4ILRA 4F0HA 2VKZG 5F8GA 3J7YI 2LCWA 4PXBA 3RB3A 2BMBA 3ITHB 2M7SA 3IC1A 2W7AA 4UOGA 1RAJA 3LP1B 2AJ2A 2AKWB 4OX9J 3V6HA 4ED3A 1S72S 2MB0B 4B9NA 2UXCF 3JTNA 2EKYA 3P5BP 1VRTB 3HT0A 4C8LA 1SB6A 3T1YF 2XZWA 3GJRB 2IAJB 1ELOA 3MCOA 3MMBA 1UVLA 3QBCA 2Y1RI 4KT0C 3HJVA 1WC4A 4CLZA 1OYDA 3CMAS 3QMQA 2ZNZA 1QJHA 1FD8A 2P9EA 1I51B 1R3NA 3GILA 1M90T 2VONA 4TKTA 3RUBL 3VAIA 3QT8A 4BLGA 5KFHA 3J81U 5HI7A 1P27B 1W26A 4Z7CA 2FGOA 2RS8A 1EKRA 2HHHJ 1VQPS 2D1CA 4J5OA 3U02A 1ZA1B 2F3JA 1TKZA 2XEXA 4K0KJ 2VFRA 1D8YA 5LSRA 3M4XA 1KOOA 2DNPA 2XMKA 2OI2A 5HK4A 1C0UA 2CQ2A 3N6NA 3AA8A 3SZ2A 1N34F 1JXLA 3M8QB 3UN2A 2K1RA 2P9GA 1GH8A 2BRLA 2ZWOA 1YK9A 4RL1A 1SH2A 4UOFA 4CLSA 3M30A 1AFIA 3MM6B 3W9IA 1RTIA 4JUZA 3Q24A 2VUGA 1CSJA 4RLEA 4ZK7M 4A8WA 3RU0A 3KHRA 1GMWA 4ZVUB 1R8CA 4PABA 1H2UX 2DHAA 2IRXA 2UXBF 3H59A 1IM6A 5J2MA 1ZA2B 3GMGA 4P6QA 3FEYB 3K89A 3M9NB 2HMIA 2HKEA 2NXUA 4W98A 4ZITA 2MYFA 2KJVA 2CJBA 3BBCA 2RU3A 5HMXA 2Z56B 1JLQB 2GVDB 3NKYA 2RHQB 5DQGA 1TFYA 2KI2A 2KL8A 2OMOA 3UVJB 3Q8RB 1JLBA 2W9BB 1RT6A 2R7TA 4R0EA 4RR5A 5FDLA 1GXTA 1WJ9A 2FZGB 1VRQC 2OSQA 1RBAA 2GIFA 2XWYA 2I8EA 2WVBA 2W01A 5K20B 5KOXA 4ECTA 1CULB 1RT7A 2HG4A 2HHXA 1SC3B 2ASDA 4ED7A 2AHOB 2ZKUA 5A8KA 3NWRA 2DO4A 3EVMA 1U1MA 1JLGA 3G86A 3AD9C 4WE1B 4K4SA 2HURA 2KT2A 4I2PA 4WTOB 4DV5J 2CYYA 1U2FA 2EBEA 4A8OA 4XO0A 1Y9OA 1VK8A 1UA0A 1AA1B 2ZH8A 2YNFA 2ZZTA 3QAEA 4USJC 5B0GA 1S9FA 1HNWJ 3MURP 1D9DA 4DV0J 2UUBF 2QN6B 2ASJA 5ETPA 4NYOA 2YX4A 3TUZC 4QR0A 1Q8KA 2AJ4A 3UDEA 2AMCB 4QIFA 4CO5A 1FJ7A 1S99A 2IJNA 2PFDA 3NGUA 1IQZA 2CZ9A 5KFWA 3KFWX 1YIJS 1HL6A 5KFNA 2GMLA 3LWLA 2NPIA 3VAJA 4RW4B 3AHPA 4P10A 3CCVS 1RKJA 1U1QA 2FJBB 4DWIA 2DPJA 3PZPA 1NHKL 1TKXB 3N6MA 2CNOB 2HLTA 3CWJA 2ACYA 3D3BJ 2V5HG 3D4JA 3K5PA 2MZTA 1NO8A 2DHGA 1HNZF 1X5SA 2L3MA 4X65F 3W5XA 4AD6A 1RWOB 5F3TA 3N28A 4LSLA 4OHZA 2QZ8A 4J9PA 1G1XA 1RQ0A 2VBZA 1CC8A 1FJEB 2ZHOA 5GMEA 5D0RA 5D3GA 4WTYA 2E5IA 5KT3A 4Z37A 1R27B 3C16B 1GMVA 3W64A 2CJXB 2VFTA 2MY8A 1VJWA 3TARA 1HA1A 3PFEA 1T3OA 4QYZK 4CI0B 5K5MA 1U2RA 2EK1A 2MKYA 2DGTA 1N6QA 2KG1A 1C4CA 4QPXA 3GG0A 2OTJS 2HQDA 1DLOB 2RILA 2WOMB 3MD1A 1CJKA 2GJIA 4ZLLA 5K8PA 4Q0BA 3ETMA 1QSSA 4LR7A 4TVAB 1RACB 3MUMP 1NPRA 2E7VA 4NA1A 2HWHA 2BBEA 2DR8A 4KPYA 2QT7A 1VQLS 2BDPA 3FZ2A 2MSSA 1I94J 2E5GA 3IM9A 1RB0A 2QTWA 1TFWA 4RUAA 3TRGA 1S4FA 2CJQA 1SPBP 1VHIA 2QA4G 4KY3A 2HFZA 2BQ3A 5RUBA 4ICLB 1Q5YA 4OZ0A 1FXDA 1U1OA 4B3OB 2LXIA 5ETQA 4C7QA 1E6VB 4B3RJ 5HJXA 2MMYA 3GB0A 2G13A 2QA4S 4PZVA 3OVAA 5EX0A 4R25A 2ZZNA 1T03B 5KTQA 2B56A 2O67A 1S48A 3DOLA 2MHNA 1YJNS 1NPKA 4AYBD 1KP6A 5G0RB 1S0NA 3F56A 2Y8YA 3DOMA 2XMWA 4KTQA 2I1RA 3TR5A 2IMOA 1S7IA 3FBBA 1MMNA 2AYGA 5IM0A 3LA0A 4ED5A 2RDIA 4LVOP 5KFAA 5K9FA 1YG0A 3MZIA 7AT1B 2LQ9A 2ZDOA 1WKKA 4ZVTB 3DLLQ 1P8GA 5U47A 2VC0A 3WIVA 2CZ4A 4RO0A 1PYTA 2RQ4A 2DXDA 3R97A 2YKNB 3OV7A 3MECA 4PG7A 1RU1A 1LW0B 1BWEA 3B6BA 2BA9A 2VOOA 4ZPDA 1KFSA 4PWDB 5T41A 3Q8QB 1TKTA 3W61A 3GU0A 1TP7A 4Z2XA 1KD1T 1UJ4A 3MI7X 2HHQA 2HIYA 1Y0HA 2WBRA 2DBBA 4OX7A 1YRXA 2EC0A 2JEJA 3SCJE 1N5YB 2N82B 4IR1A 1Q0NA 1EX8A 2YWWA 4DL6A 1TTHB 3H5XA 3OFFA 3BS9A 3D66A 3TA1A 2NR0A 2MZ1A 5D77A 3U1MA 5ADZA 1HHQA 1S1VB 3SV3A 5CABA 1RBOB 5DG8A 4IRKA 2RKIA 2IMWP 2LECA 2QLBB 3I0SB 3UFCX 4ER8A 2HQCA 1A7GE 2FGCA 3IS9B 3THPA 2FPHX 1C1CA 4GO7X 1ZM9A 4DUYJ 2K8GA 2OEKA 1S6UA 1UTAA 5CYMA 2KB2A 4C0HA 4DJBA 6FD1A 4A8KA 2GCFA 2YNGB 4LRAA 3S1TA 1FHTA 4JI6F 1F3VA 4G1QB 3K8WA 1KEKA 2YTCA 2WW8A 3PHEA 3H4BA 3SIPB 2OAUA 1KLMA 1RISA 2R2SA 3MCMA 4ZHRB 1SVDA 1B99A 2ZH2A 4CP5A 1HBOA 2ZBQA 4UQTA 4WWSA 2M2BA 2B4OA 3T1HF 1FK9B 1ZOTA 1H2VZ 1IBCB 2QLXA 1YZ6A 3MR5A 3LP2A 2JX2A 1DARA 4JI1F 4HACA 4ED4A 3IM8A 1X4GA 2G1DA 3NS6A 3F41A 5CD4H 3QIDA 1EIYB 1RT5A 2UU9J 4KYZA 4MIAA 3V6KA 4O4GA 4N76A 4IG0A 3ZZPA 1VLYA 2ABYA 2BX6A 3DRXA 2XCPA 1SJ4P 2BRKA 2VL1A 2BVZA 5D8HB 4WYWA 3ISNC 1HNIB 3M8PB 3GCXP 2Z0GA 4NCGB 1RSCA 3UWTA 1SJ1A 2CJAA 2Y0SD 1KQKA 3RRHA 4DQIA 1X60A 3TX0A 1EHWA 1HPZA 2BW2A 2CJ9A 4DL5A 2OPQA 3AODA 1WOPA 1CQMA 4FNHA 2MJUA 5CH7B 2Q6BA 5HBMA 4FZVA 2FHJD 2MXYA 4CLTA 2CNNB 3OXGA 4I2QA 1N5QA 3FMBA 3I32A 4ZPBA 3NMRA 3QT7A 3D0IE 4WJBA 1R6YA 4U67Q 4A8SA 1JB0C 3KDOA 1NK7A 3OBIA 2QGFB 4NA3A 2OPPB 1IKVB 1S0VA 2HHVA 1BQNA 2D3OR 1WF1A 2ZVIA 3NWGA 2AYMA 4NLVA 1KN6A 2UUCJ 3AXKA 1TL4A 1MROA 4C4WA 4KFBA 1VRUA 4U7UD 4JYAF 1NH7A 3OL9A 3H98A 2WVEA 1LW2A 2CIMA 2IC3B 4X66J 1UPPA 3Q8VA 1RDRA 3GQCA 4WP8A 5KFLA 5KFSA 1SUQB 2M0GB 1D9FA 1LK7A 4C11B 4J9KA 3GJTB 1Z2ZA 3ZNJ1 4G1PA 4YB1P 3MMAA 3I9ZA 2WTFA 1JLEA 4CYUB 2P2CB 1TVRB 2HVIA 1U48A 3C8YA 4P73A 3V4IA 5L46A 4ZN3A 1Z2LA 3SCIE 1S5ZA 4ZJQA 2IY5B 3TJAA 1WC1A 1WEXA 2R2RA 3CTRA 2EG2A 4EGLA 4DFKA 1N36F 4LRBA 3JQMA 4RW6A 2QG9B 3NS5A 5EN1A 2R2UA 3DMJB 2QL9B 3W9HA 1S6OA 1TUGB 3GTYX 5HP1B 2CQDA 2I0XA 2P8IA 3I56S 4J9MA 4N41A 1UEUA 3OPKA 3CT9A 4YEAA 1SI9A 1X4DA 1RTZA 3K5MA 3CCMS 4K4VA 1H0HB 5A0YA 5BYQA 1N0VC 2J9EA 4ANCA 4QU7A 3M1VA 3L95X 4PQUB 2VIHA 1VQOS 4XK8C 4MTPA 1SH0A 1JWWA 4JV5F 3MDFA 1VBYA 1UJ6A 5D15A 2RS2A 2GVZA 3KLHA 3IAM9 4B3SF 2PI4A 1R0CB 1X4HA 3RBEA 2FHJA 3SV4A 4X4PA 3EJMA 4KIAA 3E51A 3HF5A 4TQRA 5KG6A 3NG8A 5BR8J 4NEYA 3VV2B 1Y11A 2KJWA 3DRPB 4DV3F 4J9UE 3JAMY 4MIWA 4WXWA 4KGVB 1NK5A 2P9CA 1FTRA 2ZM6F 4LFAJ 4NLPA 3K2YA 1HWJA 1WI6A 3ZTOA 2QSFA 3J7ZT 2HEKA 1AUDA 1D3WA 2GV1A 4NLSA 5CXTA 3CCLS 5J1EA 5FLXU 2XO6A 1LWCB 1NK8A 5K14A 4OHWA 2LFVA 4ZJLA 2F9DA 2R7QA 3MM9A 5C25B 2CPFA 1GXLA 4DOZA 2CPYA 4NXNF 2UXCJ 5C5JA 2AEMA 2J76E 2N3OA 5DG9A 2ZBIA 1YQHA 3QQCD 3PJ9A 4O3RA 3R3TA 1HBNA 3T1YJ 1M5PC 2ZKTA 2J0WA 4HDHA 2ATLA 3MM7A 2L9DA 2GMHA 2E9RX 4V19X 1O6XA 1NB2A 4YMEA 2FVPA 2FLNA 2FJAB 4U9RA 3CPWR 5M2RA 2NLWA 4LSNA 1YHQS 1TK8A 4KGKA 1UA1A 3M6WA 4P7TA 3CUNA 2XMVA 4IO9Q 4NCBA 2RAQA 2AW0A 3ZTRA 3OUYA 4I1TA 4QR2A 2VV5A 2P6SA 2JL9A 3F73A 2W7PA 3LF0A 2CPJA 4JV2A 2OELA 4P7VA 5E3RA 2Q66A 5AE2A 3P4UB 2RHSB 3D67A 4CT9A 1H98A 2UVRA 2G2OA 4CO1A 2F40A 5LSOA 3CULA 1XN9A 1VHFA 3L7UA 1S6PA 1IWAA 3O1LA 3FC9A 3CCSS 1N34J 4F3OA 4DMZA 2KU7A 2NXNA 4WPAA 5DS7A 4OHVA 1NJWA 5AT1B 1BQMB 4USUA 4L76A 3W65A 3KLGA 3N5BA 1NDPA 2GO8A 3MEEA 1QAYA 2YNIA 3C15B 3R9LA 3IBWA 3VTIA 3RBDA 1NDKA 3THTA 4EU0A 2QLJB 2NS1B 1RLCL 3EXYA 4JI8F 2V4QA 1JMTA 3W9JA 2BKNA 5F3ZA 3PW2A 1PCAA 1EZZB 4PKDB 5L9NA 1YBAA 5F9LA 4ZMMA 3KHLA 4M5DA 1DTQA 2ZEJA 3BSNA 4NLYA 1I6JA 2UXBJ 2H5EA 3JSMA 5HO4A 3ICLA 3M8ZA 3IA0A 4DDFA 3DLBA 2A2DA 4WBFA 2CADA 2HK2A 1FRLA 4CLWA 2W8LA 2MLZA 4OYMA 2NUUG 3M32A 3V2UC 5ETTA 4FYWB 4LIWA 2F8EX 2FVSA 1HR0F 1OY9A 2DCLA 1B0PA 2XY5A 4DSIA 4OLPA 2KKHA 1PBAA 4UOHA 1S6QB 1U26A 4PQAA 5KFQA 2XSJA 3DLEB 3EGZA 2OPSA 4J91A 2E1PA 4NXMF 1IJFB 2KFYA 3CJKA 2AX0A 3R1LA 4KQZA 3QFHA 2YQ1A 3IP0A 3P6YC 3HHEA 3G4SS 2E1RA 2MKSA 3UN5A 1HNXF 4OX6A 1WWHA 1V5VA 2HFNA 3QPIA 1FWPA 2Z2YB 3POTA 5I3QA 3UNYA 5ETNA 4GKJF 1HYSA 2V9KA 4K4ZA 2YKOA 3CVKA 4EI2A 4IQMA 3CCWA 3D6HB 2AGPA 4BC9A 2EFGA 1LOUA 3AJ1A 4I4BA 3NS7B 4LREA 3MMBB 2QX0A 3EGWB 2V4JA 1QVGR 4OYIA 3EM1A 1H2TZ 1HD1A 3FEZA 4O23A 4ECRA 2HK3A 2CQPA 3IRXA 2HW3A 3LPYA 2R8IA 3MPDA 4ALZA 4PG6A 1X4BA 2V2KA 2CG4A 3MGJA 4KHMA 1VMBA 4ZDNA 4CT8A 3SFUA 2CPDA 4IFVA 1N32F 2ATCB 2OSRA 2OLWA 1HWIA 2XQCA 3OHAA 1LXNA 3OVBA 4DSFA 2DY1A 2RUGA 2I38A 4Y2IA 2C2DA 5D4LA 5IWAF 2UZAA 3JAMU 3DGPA 1RA7A 1WF0A 3TZWA 2C3YA 4M5HA 1TKZB 3MUVP 4RZRA 3C3LA 2FJXA 3FRZA 3QGPA 1URRA 3NEKA 1XNQF 2ZD1A 5H1SV 1JKHA 3ZTSA 3DXBA 3TX8A 1C0UB 2CUYA 4JP8A 5CQGA 1HNZJ 2X1AA 5LT5A 4X65J 1F5AA 1C1BA 5A6WA 2BKPA 1Q86T 2JLGA 3MF5A 2K1RB 3LPEA 1GEHA 1MG7A 1FTCA 5IC4B 3OT9A 3P5TL 4LF1A 3K5OA 3M30B 5DM7Q 3BH6B 4ECXA 2JOQA 3NRBA 4TLQA 1RTIB 1LNQA 1M1KT 4FVCA 4X62F 1YJWS 3BYRA 1RAEB 3LGMA 2F5GA 3W2WA 4U8VA 2FTRA 2R42A 5H9FJ 1NMEB 2H4YB 3B54A 3BH7B 2HVZA 3AY0A 3IMQJ 4OHXA 3ZZRA 2DGWA 3OSNA 2NZ4A 4M94A 3G8SA 5KFUA 1D0EA 5J2MB 2OH2A 2JC0A 5SUHA 5LJ5Y 1XNRF 5J2NA 4OQJA 3G8TA 1QAIA 2F7VA 2HMIB 4HI2A 2VICA 2F1FA 3W1YC 3A3OB 1CJUA 3I0RA 4TY8A 3DKDA 1HI1A 4DSJA 2CQGA 1B0TA 4DG1A 3WIUA 1KHVA 1W7WA 3LGNA 5KFXA 1JLBB 3PDNA 1RT6B 4NLRA 2H51B 3H2VE 2LQ5A 3IGVA 4HKQA 5A8WA 2MLYA 3UR3C 3UW1A 1UW4A 2IHR1 2W2OP 2Q6CA 3IWLA 1L5UA 4ZOSA 4AE5A 4WFAQ 4PRFA 1W2BR 2GGPA 1RT7B 2OO4A 3D2WA 4J9QA 1NH8A 5A8KB 3BN7A 2AF6A 4F3QA 2XMJA 1DAXA 4LF9F 2RF2A 3UD4P 2R8GA 5B09A 2PMWA 3KXDA 1JLGB 2V68A 1W2IA 4CZCA 1VQ4S 2H3EB 3PYEA 4F67A 4ZCMA 3MCSA 2IBOA 3L9ZA 2IJRA 2ZOFA 4I2PB 4DN9A 2XI3A 1WTFA 3DLGA 4B9TA 4H4KA 2IDEA 2YNFB 4CH0S 2E5LF 1XK8A 4LBHA 5JVHQ 3VR1A 4ANDA 4OV1A 4DR2F 2BJ8A 2HLUA 1RTHA 3OJSA 5E41A 2VQFF 2BXJA 1XMOF 1N33F 3SI8A 2LQJA 5B08A 3HPOA 1UFWA 4H4OA 3FJ2A 1QUVA 2LEPA 3J80Y 4D3GA 2MZQA 4UQGA 2E7XA 3ZFVA 2XNRA 1HI0P 4FF3A 1MNEA 3M2VA 4FS2A 4M8LA 2EFQA 2MGZA 2HBQB 3VVTA 3AOCA 5EGYA 4B08A 4LSLB 3OTCA 3B4MA 2YNHA 5JXSA 2W25A 4LFBF 2QO3A 2UUTA 1T05A 2XS2A 5KFOA 2VOPA 1FRKA 5D3GB 1N48A 1DFDA 4USWA 2B5JA 4P2MA 2C2KB 3Q2SC 1UVJA 2XLKA 2YBVA 4J9LA 3QGHA 4URGA 4DV4F 3JXOA 3QRRA 4DUZF 3N5FA 1N6QB 1VIXA 4Q5VA 1UVMA 2BM1A 3UNGC 3FGVA 3M8SA 3ELHA 3C6UA 1NKCA 3AD7C 4JI6J 4KGXB 1IR0A 3OLAA 1N0UA 3M6XA 1CJKB 4L3KA 2YKAA 4Q0BB 3CE8A 4N56A 1IWGA 4HTIA 3T6BA 3IG1A 4C6AA 2R9LA 4U7CA 5IV4A 1ZM2A 3CCJS 5B0AA 3R1HA 5G4DA 3T1HJ 1RT2A 3S7RA 3I9V9 3G6XA 4JI4F 4ZVEA 3FQKA 4MYTA 4JI1J 1VQ6S 4OV6A 2PDAA 5DDRC 2HWIA 1DQ9A 1HNVA 3THVA 1HFEL 1M1HA 2J7UA 2V8VA 2VODA 1C4AA 2YX7A 3ULHA 1DHMA 3UO0A 4F3MA 2YQ0A 1REGX 4FXWA 1JX4A 2W9CA 2LMIA 2E29A 1YTYA 5DQHA 1FDBA 4C9DA 5CAAA 3R27A 5IT9Y 2EC2A 4PAAA 3A8JA 2E7WA 3V6JA 3DOLB 1Y3KA 4DV1F 5ETLA 4GVBA 3C66A 3DOMB 3PW0A 3KK1B 5DJBA 3W60A 3R7NB 1YDLA 3A4TA 4WK1A 5IM0B 1WELA 1H7XA 2DB1A 1LWXA 2DR9A 4KR0B 2Z58B 2LDYA 3IBFB 3KUEA 2ZHBA 5KFDA 2E1AA 1PGZA 2DNOA 1R7IA 4X64F 2R7UA 3QSYB 3D68A 3IR5B 3A13A 3I55S 3HK2A 2VDIA 3QLHA 1DRZA 1V3RA 1D9AA 2Y1JA 3NMAA 1HQEA 4G1IA 1TKTB 4Q8EA 2BQUA 4B3MF 4DR3F 2X7IA 4C2MA 1U4BA 3M7VA 6AT1B 2G2ZA 1U47A 1IR1A 4IH5A 5HATA 4F4AA 1KONA 3AJ2A 3DM2A 3HFZB 2MLXA 2KRRA 4XDDA 4JYAJ 5JMNA 2IM1A 1CQNA 3IGNA 1IKXA 1QUPA 4NI2A 1Y5IB 2N4DA 9RUBA 1M5VC 4QWDA 3JSYA 3NAIA 1WACA 2MQNA 2UUWA 2FHMA 3DLKA 1KVKA 2RKIB 3GJSB 3D1OA 5D6GA 4QYRA 5ETOA 4ITSA 4WU3A 1UMJA 1C1CB 3D6FB 4ETZA 2XGQA 2FLPA 2HGLA 2XM3A 3LP0A 2NXJA 5CYMB 1VYAA 4DSKA 3QRPA 1OJ4A 1BGXT 4ZVGA 1GX5A 4V19J 4MKAA 1G2EA 4DR7F 2GQ2A 2VJUA 1NK4A 3WC2A 1H6KX 2D3ZA 2KVIA 5KFMA 1N36J 4L73A 3UCZP 1KLMB 5ETKA 4ILLA 4A48A 4WYLA 4DQSA 2PGCA 2R7WA 1YITS 1HBOB 4LBPA 1JJ2R 4ES2A 3CJ2A 3H5SA 3VZIA 2BABA 4FN5A 3LP2B 4HACB 1Q82T 1SJRA 3NGSA 2BUNA 5LXRA 4MH8A 5KFBA 3BGRA 3GYXB 4F4XA 3AA9A 4O4GB 1RWUA 3CDAA 1H3DA 3K59A 4IG0B 2RDJA 3VHQA 3WX8A 3MR2A 3K17A 4KE5A 4JV5J 4PEOA 4IH6A 2J8AA 1V3SA 3LUYA 5KFIA 1M5OC 1S1UA 3T5HA 2C2OB 2VKRA 4B3SJ 1NCLA 3TA0A 3IR7B 4B9LA 3NNAA 4K50A 1HW9A 4TU7A 2KT5A 4DL3A 4AT1B 3D3CJ 1P9QC 1IXKA 4ZVFA 4CM0A 4DV3J 1J5EF 1SIZA 3ZZTA 1HPZB 3MAHA 1P9YA 2DGQA 3TVZA 1SXLA 2OPQB 5D4NA 4GMKA 2ZM6J 1PSDA 4RNHA 4PG5A 4UUXA 2GAHC 4A8XA 3T5KA 3A8IA 5HBMB 2FYXA 1SQFA 5AXKA 4B9UA 3VGVA 4CO4A 2V34A 4I2QB 3BBFA 4I0WA 3QNWB 2IM2A 4USMA 2JWNA 1VQ9S 2UV8G 4KGZB 5E3AA 2LXFA 1VR6A 4P2FA 2PA3A 3BZQA 1UPMB 4J7CA 1BQNB 2JJ4D 3N6LA 1ICEB 3O44A 1NAQA 3V6DA 1GTHA 2NCKL 1MROB 1X9MA 4KFBB 1VRUB 3FQLA 4HT7A 5F8IA 4RBUA 3Q8YA 4UY85 1NPPA 2J6UA 2D3UA 1LW2B 3EUNA 3KOAA 1S79A
chains in the Genus database with same CATH topology
3CC4S 5AXMA 3ENWA 2V8HA 3CJ5A 4GO7X 2HS4A 3PX6A 1ZM9A 2K8GA 3KG0A 1S6UA 5KT5A 4FNIA 1R31A 5CYMA 4OI4A 3PX4A 2KB2A 2B9YA 2DT9A 1KLNA 2CQCA 5D78A 3VCDA 4C0HA 4DJBA 6FD1A 2XLJA 1R0AA 4A8KA 2GCFA 2YNGB 5HROA 3BEGB 2EPIA 3S1TA 4OJ3A 4YY3F 2R7SA 1FHTA 4ID5B 4JI6F 4WKYA 1APSA 5KOWA 2C22A 3MEGA 4G1QB 4DFJA 3KJVB 2KG0A 2LEBA 2CPEA 3MMAB 3X1LB 4IH7A 3OR2A 3K8WA 4X4UA 2GO9A 2YTCA 1JNRB 1KEKA 4QWBA 2WW8A 4ZA1A 1JLEB 1OQ6A 3PHEA 3H4BA 2AGOA 2QA1A 3CCUS 3O3LA 3RW7A 1RA6A 1FKOA 3H4DA 2OAUA 1KLMA 5D4OA 3C6TA 1RISA 4ZCKA 2R2SA 5KFPA 3TUJC 4QR1A 4ZHRB 3MPWA 2AYEA 3DDKA 3W2VA 2ZH2A 4Q43A 3KTQA 1MU2A 2HS0A 2DH7A 2JDJA 3GG1A 1HBOA 1OSCA 3V4IB 4UQTA 2BQRA 4ICLA 2M2BA 1E6YB 2B4OA 4NLQA 3AB2B 3T1HF 4C8KA 2M52A 1FK9B 1FRIA 1ZOTA 5LJ3Y 1X7VA 2ZOMA 4DLGA 4B3OA 1FDNA 2KRBA 2CDQA 2M9KA 1E6VA 3OFHA 1H2VZ 1T94A 2UUAF 1XR7A 4XIUA 2BANA 2QLXA 4EYIB 5IT4A 1WEYA 1N52B 3MR5A 2DTJA 3N0VA 2KZMA 3LP2A 2JX2A 2MPUA 1DARA 5GADI 4RUCA 4JI1F 2KZZA 1MW7A 2M3DA 5AE3A 3NBPA 2KN4A 5AJ3F 2XSFA 3R5CA 1X4GA 2Q3PA 5FJ4A 2G1DA 4FPRA 2VH7A 2W4PA 3L7OA 3NS6A 2KXNB 2ROGA 3DRSA 3F41A 3GV8B 4CIOA 2ZDPA 3OL7A 3L7PA 5CD4H 1NJIT 3MUTP 2ZBCA 3QIDA 2LU2A 1IKYB 2MDAA 4KHRA 2YWEA 4RW6B 3J81Y 2O66A 5G0RA 4R8UA 5J2QB 1CPZA 5E33A 1S1WB 3TVKA 1RT5A 1FE0A 4OZ1A 1MMLA 4FXDA 4Y6IA 3E01B 4MIAA 3V6KA 3DU5A 4O4GA 4NRUA 2MQOA 3KLFB 1KNZA 4N76A 3MEKA 3BSOA 3T6JA 1Y5LB 1WEZA 4IG0A 3HVRA 2PO4A 2GHWA 3ZZPA 2BOPA 3FFIA 1VLYA 1D8ZA 3CCZA 2BYCA 4OFZA 2ABYA 2NPFA 2B7BB 1VOMA 3VF0B 3DRXA 3KK2A 3K5LA 2N7CA 5JVGQ 4JI5F 2OFHX 4Q7AA 2RQKA 3JSBA 1O51A 2XCPA 1SJ4P 2FHKA 2BRKA 2YKQA 3Q22A 2VL1A 2BVZA 5D8HB 5I42B 4WYWA 3ISNC 2XMUA 2R8JA 1K73T 5LMNF 1HNIB 3RYLA 5CCMA 3RR8A 3M8PB 1Y7PA 1K1QA 2Z0GA 2BE2A 4NCGB 6FDRA 3M2UB 2HFOA 4FVMA 4DLEA 2DISA 1VQ7S 1U7LA 4JV1A 2LKZA 2POKA 3UWTA 1SJ1A 4CNYA 2CJAA 3TAMA 2ZH6A 2Y0SD 3CDEA 1KQKA 3T19A 2BV3A 2KM8B 2XGPA 3M1VB 1ZZNA 4DV5F 3CC7S 3RRHA 4DQIA 1FEHA 2YKNA 4RNNA 3RB4A 2WSFC 5L39A 1B0VA 4DHVA 4F4WA 4ELVA 1S9GA 1ZM4A 2XMTA 3CCQS 2HNYA 1HPZA 2CKWA 1JJHA 4EO8A 1Y00A 4PPZA 2BW2A 2CJ9A 4DL5A 2OPQA 4WK3A 1NZAA 3KLHB 4B9MA 1U45A 4PWDA 1HNWF 2V8DA 1CQMA 3MEDB 1VIOA 5B0EA 4FNHA 3CEDA 2MJUA 5CH7B 4RWXA 2CQHA 2Q6BA 2QMXA 3DXSX 3M6UA 5HBMA 4DV0F 3J7A1 5HMZA 1AFJA 4FZVA 4WFBQ 2FHJD 2MXYA 4URQU 3G6ES 4QYZJ 4HYKA 4GKKF 3OXGA 1X0FA 1LKZA 4JI3F 4I2QA 3J7Z5 4QPTA 4P2SA 2ZH7A 5GAGU 2I9SA 1EETA 2VFVA 1N5QA 4DBQA 3FMBA 1KQSR 4ZVHA 2FLLA 1S9EB 4ZPTR 3H8YA 2AQ4A 3I32A 2ZVSA 3DCAA 1N5YA 4ZPBA 4FF4A 4MK7A 3NMRA 3FNNA 4QW9A 2YWGA 2PFFB 3D0IE 4UW2A 4WJBA 3GFHA 4OHYA 1QE1B 1Q7LB 5EHHA 1R6YA 1TK0A 2J0SD 4ZPAA 3ZZYA 4U67Q 2IVFB 3LWMA 4A8SA 1JLFB 1U6ZA 1JB0C 4KC5A 4AUKA 1NK7A 4ED1A 2YY3A 4RWWA 2KDOA 4E8UA 3KNGA 2ROEA 3VAKA 3OBIA 2AX1A 3BQ2A 4NA3A 3MFHA 2OPPB 1IKVB 1S0VA 1REVB 3RAMA 1JLAA 2E9TA 4U6PA 2HHVA 1BQNA 4ETXA 3PRBA 3I6PA 3PFOA 3T5JA 5KFGA 2D3OR 1HQUB 2Z2LA 2VZ9A 5J1EB 4OZ5A 2LYVA 2MQQA 1WF1A 1S1VA 2DGSA 2BM0A 5K14B 1U25A 3NWGA 3SDEA 2AYMA 4NLVA 1G7CB 3M2RB 1KN6A 3OL6A 3JTPA 3SEOA 1TL4A 3MM9B 2WSEC 1MROA 4E0DA 2F4VF 2VPZB 2C3OA 4F4KA 4KB7A 4KFBA 4C4WA 3N01A 4J9OA 3UCGA 2VBYA 3I0SA 1VRUA 4HL9A 1S0OA 5CYQB 5KAKA 2J0XA 4JYAF 1NH7A 1UEVA 2DCUB 2GJ2A 4BS2A 3D1HA 1R8HA 3OL9A 3H98A 4USHA 2DD8S 4YB6A 1LW2A 4FBTA 1JK9B 2IM0A 1HBNB 3CO9A 4H54A 5DDOC 2CIMA 2IC3B 2J0QD 3KMSA 1OS5A 4TYAA 1F60B 5MAOA 1RDRA 3MM7B 2IJFA 2EFOA 1XMBA 3GQCA 2GIQA 2DK2A 3K58A 3PKYA 4W92B 4EWTA 1HHSA 3US5A 4HLBA 4JOUA 3BM7A 4IFYB 5KFLA 5KFSA 1SUQB 1Q81T 4C0BA 4O3NA 1IUJA 5K8OA 4IOCQ 2M0GB 3CF5Q 3R5BA 4NX9A 3HZGA 3S01A 1FKPB 1DZ5A 2YNGA 2VQEF 4K4TA 4LSNB 1WHYA 1D9FA 2QRRA 4C8NA 2FJWA 1LK7A 4C11B 4UY8T 4J9KA 3IO1A 5GAEU 3H20A 4A8FA 4ID5A 5EWEA 2EG1A 3DLGB 4OZNA 1Z2ZA 1R8PA 2OMLA 4G1QA 3KJVA 2X1BA 2R7XA 4G1PA 3OVSA 4YB1P 2V9WA 3BGUA 3MMAA 3I9ZA 4I68A 1B7FA 1CC7A 3X3UA 4Q2LA 2WTFA 2RT3A 5KT7A 1JLEA 1TVRB 3IAS9 1CLFA 4C8YA 4EFAC 4NLUA 1UJ5A 2VA2A 2LDIA 2HVIA 3OUYB 5H9EJ 3N9UC 4Y00A 3KWMA 4G6VB 1U48A 4ZHRA 4K4UA 1Y5NB 3C8YA 5KG5A 1NK9A 3LOUA 2V94A 3V4IA 5F9NA 1E6YA 2A18A 5F8NA 1FK9A 2DIVA 1Q4RA 1Z2LA 3SCIE 4J9NA 1X4CA 5I3UB 3HHDA 1KR4A 2NYIA 1WEXA 2HZCA 2R2RA 3EPGA 3CTRA 5KFFA 2EG2A 1T02A 2XO7A 4EGLA 1I94F 4RU2A 3PIPQ 1Q1KA 4DFKA 1TAQA 2PE8A 3CD7A 4H4MB 5MLCV 2B9WA 4F50A 2JLEA 3BDEA 1RTDB 3PY8A 1N36F 2WAQD 1WHWA 2DGVA 4YFUA 4X4OA 3E3XA 1K0VA 1IKYA 4RW6A 3T1AA 3TAPA 5B0CA 3CB4A 5J2QA 3NS5A 1S1WA 1ULRA 2CQBA 4K2XA 5EN1A 3E01A 2R2UA 3DMJB 4YDDB 4ECUA 3GFZA 3KLFA 5DGAA 1S6OA 5DDQC 4HVZA 4F02A 2CZVC 5B0BA 1KHWA 2VFSA 2YKMB 2WRMA 3PR5B 3GIMA 2CQDA 5HP1B 1RJJA 2I0XA 2UVUA 3T3FA 4WCEQ 4JBCA 3I56S 3N79A 4J9MA 3QO9B 4N41A 3CGIA 3UDLA 4B3RF 1S6PB 1UEUA 2MKIA 3FZBA 3OPKA 4F4ZA 3CT9A 4YEAA 1SI9A 1X4DA 3K5MA 3CCMS 3RAQA 2DNZA 1HWKA 2GFFA 2ILZA 2MZSA 1D1UA 3RW6A 1AROP 5I42A 4CH7A 4K4VA 3PEHA 4PG4A 1H0HB 1HNIA 1BQXA 1HBUB 3M8PA 2MQMA 4PCQA 5CZVA 5A0YA 3DDNA 3OR1B 1PILA 4NCGA 5BYQA 3M2UA 3HXMA 1N0VC 3VAHA 3KLGB 1NJXA 3MPYA 2KYXA 2J9EA 2VG7B 4WZMA 2WB4A 3MEEB 4A8MP 1U24A 3M1VA 3L95X 4O44B 4QU7A 4Q8FA 3CJ0A 3E2EA 1OIAA 2QMWA 1F2GA 4PQUB 4QWEA 2FD2A 1VQNS 4ZP6A 1P1TA 1RTJB 4IRDA 1VQOS 4XK8C 4MTPA 5DRKA 4KHPF 2MJNA 1SH0A 4NLXA 1JWWA 2M88A 4JV5F 1GT8A 1N54B 3GR1A 3MDFA 1HBMB 3BREA 2NSCA 4KGMA 1UJ6A 4OJ1A 4FS1A 3SFGA 3FSIA 1VBYA 1UVNA 1SIWB 4QU6A 1KVIA 1FRHA 2RS2A 4NLDA 3KLHA 4MFBB 2UXDF 3BB5A 3IAM9 4B3SF 4A8QA 1X4HA 2A10A 2PI4A 3RBEA 4CH1A 1TV6B 4C8OA 1V3ZA 4C3MA 1FVSA 1F5CA 3RB6A 4M5DB 2FHJA 1DTQB 3NGKA 5CYJA 1N88A 2KXFA 3SV4A 4Y2KA 2E9ZA 4X4PA 2BR0A 4KIAA 3E51A 3HF5A 5LL6d 4TQRA 1FKAF 1TKDA 5KG6A 2XBPA 1UWBB 3NG8A 4MMOA 2EI5A 4LQ9A 4F25A 3I87A 3JSMB 4OL8A 3LW5C 2RH3A 1TL1B 2KM8C 1T3NA 2DNRA 3SYZA 3KK1A 1YRTA 5E0OA 1HWLA 1S9EA 1PC5A 2KJWA 2L08A 2DHSA 3H2LA 1XR5A 4A46A 1Y3JA 3S8SA 4HT5A 2G4BA 3DRPB 4Y2MA 4O0IA 4DV3F 2IFXA 1QE1A 4ATNA 3JAMY 2E1CA 4YOEA 1DQ8A 4MIWA 4WXWA 3G96A 2ZH1A 1SKRA 2B4PA 4DQPA 1H7WA 1NK5A 3EXCX 5L8RC 2P9CA 2JSXA 1FTRA 2ZM6F 3M32B 4NLPA 2N3LA 5FDLB 3TQ1A 2WONB 3K2YA 4QW8A 1TL5A 2OPPA 1IKVA 1HWJA 1REVA 3LAMA 5C42B 1WI6A 1Q8IA 2YQ3A 4OMFG 2QSFA 3ZC4A 3J7ZT 3M05A 1AUDA 1LWEB 2DVIA 1D3WA 2GV1A 4NLSA 2PT0A 4QWCA 1HQUA 5CXTA 1P1LA 3CCLS 1S0MA 2RVJA 5J1EA 1KVJA 2HRYA 3BSCA 4WF9Q 1LWCB 1NJZA 1OWXA 4WKRA 5B0FA 1NK8A 4KJIA 4I67A 5K14A 3I4PA 2LU1A 4OHWA 1SL0A 5F0WA 4DV7F 3M2RA 2FJDB 5DO2A 2PIIA 2F9DA 2R7QA 3MM9A 1Q7YT 4GC6A 4QBUA 5C25B 2CPFA 1GXLA 4DOZA 1RT1B 2BJDA 2CPYA 2DH9A 3OTDA 1SJ3P 3FDSA 2XSJB 3RTVA 3K5NA 4U7UK 5CYQA 4NXNF 3PM9A 5C5JA 2J76E 2N3OA 5EWGA 4RU9A 5DG9A 1N5SA 3OTOF 3V81B 2ZBIA 4I6YA 4OI6A 2J6TA 1N5VA 1YQHA 2R4FA 1SQEA 4LF7F 3CJKB 1KSPA 4O3RA 2DNLA 3MM8B 1NJYA 3R3TA 1HBNA 1M5PC 2IC3A 2C28A 2LA6A 3QYYA 2HNDB 2ZKTA 4B17A 4CTAB 1RT3B 2J0WA 4HDHA 4PUOB 2ATLA 3NL0A 3MM7A 2L9DA 2GMHA 4M95A 2E9RX 4V19X 2ZUGA 3VQTA 2ZITA 3DNCA 2YWKA 4CCHA 1WF2A 1ROFA 4IFYA 3TP2A 4YMEA 1SUQA 3F44A 2W9AA 5LSLA 2FVPA 2FLNA 5DDPC 1RT4B 2FJAB 2VD3A 4CO2A 1FKPA 4U9RA 3WX4A 3CPWR 4QIVA 5GVQA 5M2RA 2NLWA 4LSNA 4TQSA 1YHQS 1B64A 4C11A 2XCAA 1DTTB 1RGVA 4O4RA 3POTB 4IDKB 5M2UA 1TK8A 4RW7A 4OZJA 5T7LB 3MMJA 4KGKA 2DNKA 1UA1A 3M6WA 4P7TA 4K5RA 3CUNA 2XMVA 1HYSB 4OX8A 1R8AA 2RB7A 4J9RA 4IO9Q 1VQYA 2K2PA 4PG8A 4QQBA 4NCBA 1TVRA 1Z4UA 2AW0A 2GW8A 2J7WA 3SSSA 4A4JA 3WBZA 3QJPA 3DYAB 3LAKA 3OUYA 4QIGA 1IBMF 1FDAA 2P5VA 4I1TA 4QR2A 2VV5A 4DUYF 2VASA 4LJMA 2P6SA 1NHVA 4HDGA 1ZH5A 4DEZA 2JL9A 3EYZA 4DS4A 3F73A 4B9VA 5THWA 3QJJA 5F8LA 2R8HA 4NCAA 4YR2A 2VFUA 1IJEB 3LANA 1VQKS 5I3UA 1WHXA 4O3QA 4GC7A 2V4JB 1MMDA 4TXSA 2W7PA 3LF0A 2WK4A 3IFEA 2CPJA 3HM9A 4TN2A 3JTOA 4JV2A 1VBZA 3OHBA 3ZZZA 4P7VA 5E3RA 2Q66A 4H4MA 4I6WA 3BDPA 3RB0A 1TQLA 1OO0B 4OI3A 5AE2A 4ZP9A 3BN4A 3QZ8A 1L3TA 1RTDA 1MSWD 2DGUA 3TNVA 4CT9A 3G8QA 1H98A 4TNOA 2DR5A 2UVRA 3TI0A 1WG4A 2ZC4A 2C3PA 1X8DA 1YGYA 5FIIA 2F8MA 4XPEA 2F9JA 2PMHA 3IRXB 4WU2A 4CO1A 5E3CA 1MWZA 2F40A 1HD0A 5LSOA 3HHLB 3CULA 1P6TA 1XMQF 4Y0FA 3HHLD 4QIEA 1N4LA 2YKMA 5HP1A 1XN9A 3HHNB 1VHFA 2NQPA 3GSDA 3H5UA 1KQFB 4C8ZA 4IFVB 4J37A 1BLUA 3QO9A 5CZXA 3HZEA 2XS7A