4DV5F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv5F00
4LF9F 2HHHF 5LMUF 1XMQF 5BR8F 4JI0F 4B3SF 2J5AA 4X65F 1IBKF 1HNXF 1G7CB 2ZM6F 1N33F 1N34F 1N36F 2B7BB 1CQMA 4JI8F 1VMBA 2BXJA 4LF4F 4JI4F 4JV5F 1B64A 2BVZA 4X64F 4DV0F 2UU9F 1G1XA 4YY3F 2KJVA 2UXDF 4DV7F 1GH8A 4DR1F 4X66F 1IBLF 4LF6F 4AQYF 2UXCF 4DR6F 2KJWA 4DV1F 4KHPF 4DR5F 1IJEB 1QJHA 1F60B 4B3MF 1IBMF 2F4VF 3T1HF 4LFBF 4B3TF 1HNZF 1J5EF 4DV3F 1XMOF 4DR7F 4DUZF 4JI7F 4DR3F 2UUBF 4LF8F 1CQNA 4OX9F 5IWAF 4LFAF 4DR2F 4YHHF 3OTOF 4X62F 2VQFF 1LOUA 1IJFB 2E5LF 4GKJF 4NXNF 4GKKF 2B7CB 4B3RF 5LMNF 4DV6F 1XNRF 4DV4F 4JI1F 1I94F 2RJZA 4DR4F 2YY3A 2VQEF 2UXBF 4NXMF 3T1YF 4JI3F 1HR0F 1FKAF 1RISA 1XNQF 4LFCF 3ZZPA 4JYAF 4JI5F 1FJGF 2UUAF 4DV2F 2UUCF 4DUYF 4JI6F 4LF5F 4DV5F 3R3TA 4LF7F 4K0KF 1N32F 5AJ3F 4JI2F 1HNWF
chains in the Genus database with same CATH superfamily
4DL3A 3C3LA 4LF9F 1S9GA 2LLZA 3MCMA 1FKOA 1SB6A 2N4DA 3W64A 2XMTA 5HMYA 3RB3A 4NCAA 3F0NA 1VISA 2QL5B 1CS4B 2IY5B 1U0HA 5FLXY 3E2EA 1RWXB 1S9EA 2X1AA 1RT3A 4OX6A 4X65F 4DFJA 4K2XA 1YJ7A 4IFVA 3RB0A 5RUBA 3D6TB 5KFPA 1PO6A 2W25A 3IS9A 1OQ3A 1MNEA 1WG5A 2HGNA 4DUTA 4M5NA 4TQRA 4B3TJ 3OLBA 4L3KA 3CDEA 1P1LA 3GSIA 3I87A 1RU1A 3MD1A 3NGRA 1YJVA 3QGPA 3UDLA 4C11A 1NB7A 4WU3A 3JAMY 3ADAC 4X64F 5HVFA 1R31A 4FYVB 2C2DA 4DV0F 1S10A 3M2UA 1DLOA 2YKPA 2C2MB 1OY8A 3TAMA 2R8JA 4B9MA 1G1XA 3BSNA 4K0KJ 2C28A 1NSPA 5KFYA 1RT2A 2DGUA 1S1TB 3U27A 3MEGA 1VQLS 1AUDA 4O0IA 1W26A 1Q7LB 1IBMJ 3VGUA 5L1KA 1S59A 3I5CA 2ZH5A 1L5UA 4U8YA 4DPTA 3SI8A 1S79A 1T0TV 2VZ9A 4OJ3A 2OPQA 3SSQA 1SUQB 2FDNA 1RHKB 4HDGA 3KG0A 1IM6A 4USHA 5HMWA 2DH7A 1X0PA 1RT7B 3TAPA 2PDAA 1Q8KA 5LOQA 3BSAA 1V3RA 3FVYA 3IA0A 3UDEA 4K4UA 2L9DA 1S99A 4E0DA 1JXLA 4RW7A 3TVYA 1AYEA 2CQ0A 2MY7A 3PTWA 3BPDA 1V5VA 2P9CA 1FKPB 4RL1A 4YMEA 1NRKA 4ZVUB 2VKRA 4J9PA 2YKMA 2HHPA 1ZAWA 3R7SB 2JFDA 1XC9A 2RB7A 3LUYA 1Y5IB 1IVZA 2DHGA 4IG0A 9ATCB 5F0UA 1RWNB 2O5DA 3D6MB 3QIDA 2RIJA 3ZNUA 4HKQA 3OT9A 3OTOF 2Y1JA 3MM7A 4LRBA 3M6UA 1S6PA 2VQFF 1R6YA 1X4AA 2R2TA 3FEYB 3MZIA 4G1QB 2CQPA 1S6OA 2E1RA 5EWFA 3Q89A 2PIIA 2D3O1 4NXNF 3NWRA 1HNVA 3D5MA 2V8VA 1HQEB 2R4FA 3TQEA 3VVUA 1UZHA 1T8EA 2E29A 5IT9U 1URRA 5DS7A 3TUZC 1X4CA 2KRBA 3R6LB 2QO3A 4WU2A 2VIHA 2HYIB 3W2WA 2X1BA 2BJ1A 5KOWA 2FLOA 1C2PA 1D09B 1Q78A 2DCLA 1BLUA 2V2ZA 1RHMB 3MD3A 4OV1A 4E2FB 4ETXA 5KTQA 5CAAA 3DMJB 4LJMA 2BANB 3SYZA 1GMWD 2DH9A 2LQBA 3DLBA 1M5OC 2DJWA 4TVAB 4NASA 3VHQA 1FJGF 1SJRA 4OJHA 1UTAA 4AT1B 1WG4A 8RUCA 2UUCF 3RBZA 3AOAA 4TU9A 3PY8A 1T03A 4A8KA 2ZC3A 3KYLA 2DRAA 1VQ9S 3MR6A 3PVXA 3R2DJ 3W63A 2F8MA 4RWXA 1MG7A 2XEXA 3BN7A 3VVTA 1SL2A 3O8WA 4L6V3 1KP6A 5C24B 1K73T 3LALA 2M3DA 1E6YA 2X1FA 1TKZA 4WYLA 4Y65A 2YXLA 1RQ0A 4NLSA 1RE1B 1K9MT 3MCSA 2W9CB 4HDHA 4RW9B 5KFKA 1TL3B 4X4RA 3KMSA 3KNAA 2UUTA 3LGMA 3MTKA 3EYZA 2WVEA 1UKUA 1M1HA 2CJYB 1L3UA 1S9EB 2ZBRA 3IWXA 2CG8A 5ETSA 1VC0A 1SKWA 2ACMA 4ZP8A 1UMJA 4OZJA 4WTYA 2ZM6F 2BJDA 3BSOA 1TUWA 1RKJA 2HVDA 2M4MA 2FJDB 4ED6A 1QDUB 2CPXA 3K2YA 2CIMA 3KJFB 3OR1B 2CQGA 1FRLA 1WTBA 3CC2S 4YQWA 2CNOB 4MIWA 1WNEA 3LTOA 1KSPA 3JQJA 2O01C 3M05A 3N9UC 4GO5X 2FLNA 3QRRA 1TL3A 3KJNB 3QPIA 1TK0A 2MJNA 3BBFA 4F4YA 1HFEL 3TA1A 3VAHA 3PJWA 3A12A 3MMAA 1TMJA 1VS3A 3O6QA 5KFRA 2RUGA 3GIKA 1QSSA 2H1YA 2EC0A 2POKA 4ALZA 1FRIA 4NWBA 2DXFA 3G2XA 4DQPA 3G71S 3QRQA 1R27B 4HHJA 4MH8A 1VLOA 1XN9A 3MM8A 3WHIA 4RNNA 2UXCF 2XWXA 1XJWB 4O4GA 3TUIC 1GXTA 2CQIA 1AZSB 4DU8A 2AYMA 5DZ6A 5KFXA 3H2LA 5KFTA 4KHPF 2ACYA 3DFEA 4Q5VA 1KRPA 5G4DA 4DG1B 1WOPA 1YRXA 2WVBA 3Q8QB 1TKTB 1VYAA 2MLZA 3G6ES 2GV1A 3B54A 3ILIA 4AD6A 3T41A 3GG1A 3HD2A 4HR2A 2CXEA 1CULA 1V9OA 1VHFA 3M6WA 4MKAA 1FX4A 1LFWA 2EFQA 2QJ3A 3W5ZA 4OYMA 1FK9A 2RKIA 3Q23A 3SEOA 2HHUA 1CJVA 3LGNA 1X5TA 3GYXB 1NH7A 3NMRA 1DBDA 1BC6A 2NPIA 2PMWA 2MKYA 1RT1A 3FFIB 4HT7A 1QAJA 1DQ8A 1ZM9A 3E8OA 2WW4A 4OX9F 4JB8B 2JHEA 2P8IA 2CZVC 4LRAA 5DO2A 4C8OA 1KS2A 2H5EA 3EDRB 1XTZA 5K5MA 5DDQC 4ZN3A 4YHHF 2UUBJ 5DGAA 1SI9A 3EVMA 1U1OA 4LRCA 1M5KC 4CRJA 3QYYA 4CLUA 2FHJA 1HNZJ 3CD0A 1D9FA 2MDAA 3GCXP 4G1IA 1XWLA 3ILOA 4DX6A 1NSAA 2WBMA 2HQ3A 1RWKB 1KOHA 3DN9A 5DDPC 4QIEA 1WKJA 4DL2A 1LWEA 2FYXA 4DL5A 1ZM4A 4Q0BA 3LOUA 2WVDA 2JVOA 2AKWB 1YBUA 4X4TA 4U7UD 1XEZA 2AD9A 4F0KA 1I94F 1VR6A 1AFJA 1RGVA 3I82A 5F8GA 4UQGA 1VQ6S 5J2NA 4R25A 4IR1A 5B0EA 1REVA 4ZCMA 3HSGA 2XYHB 4QIVA 3OJSA 1MMNA 5HROB 2ZNZA 3T1AA 2AX0A 3NS5A 1C0UB 3BQ1A 4F26A 5L9NA 2ZKTA 1QLNA 3R5BA 1HMVB 2AF6A 3R7NB 4NRTA 5E5NA 1EARA 1VQ4S 4JI1J 1HWJA 4DV2F 3A4TA 3Q2SC 4NOHA 1BQMB 3CD5A 5K8MA 3TANA 1JMTA 1VQ7S 4YR0A 1N56A 3RUBL 2HMIB 2C3UA 4KE5A 3GQCA 4UW2A 4NRUA 4OMFG 3W8GA 4ANDA 1NDCA 1XR7A 3FBCA 1SH2A 1HHSA 2KRRA 2IRUA 3O44A 3LQVA 3H0PA 2IRXA 5J2PA 4DSLA 1HNWF 2YNIA 1MU2B 2ILYA 2UU9J 2H54B 4QYZJ 3PW2A 2VOPA 2BE9B 2WHOA 3IBFB 4RW4B 2VG5A 3NAIA 3FBEA 2ZHOA 4I2QB 3NP5A 2GIQA 4KT0C 3BYRA 2L41A 1T05B 2HW3A 2WBRA 3K5MA 2RNEA 5J1EB 5LJ5Y 4B9SA 4NLXA 4ZPWR 5CZVA 4ED0A 3BGRB 2OFGX 3F41A 2AYEA 3CO9A 3F44A 4EBEA 5KFAA 2DNRA 3TOQA 4CNZA 2FB0A 3BGFA 5KFOA 3BGOP 5J1EA 3P96A 3HVAA 2VG6B 4LSLA 3ETOA 5EUHA 4JV5F 1T05A 2I6WA 3A1YG 1U0HB 2CVEA 3EX7B 3AXKA 4NYPA 1IKVA 4TKTA 1VRTA 3TVKA 2OLWA 1TVRA 2VPXB 2YX7A 2DXDA 2ZITA 4HACA 2OFHX 4PWUA 3RRHA 5E3AA 4I6YA 3A8JA 1TKXB 2UZAA 3FZBA 5A6WA 2J76E 1GAOA 3EGVA 5E7OB 4ZVTB 2QSFA 2R8IA 2PI4A 2UXDF 3FGVA 5B7WA 1UL3A 4GO7X 1SH0A 2KM8C 2AW0A 2CPJA 4X66F 4ZK7M 2CQCA 3QGIA 2BQRA 4QBUA 4X2BA 2FUG9 5KFFA 4DLGA 3IG1B 1E6VA 3OHBA 1XIQA 4NI2B 3E01B 1RTDB 1WDDA 3NCQA 4PQUA 4V1Ak 4S0MA 1RT5A 5B09A 2QG9B 2W9BB 2LECA 1LFPA 2ASJA 1XNQJ 3G9CA 2LCWA 3WIUA 2AYBA 1PILA 2JC1A 3KDNA 5CYMA 1FTCA 1RZMA 1U1NA 2IVMA 4F4XA 4C8KA 1HA1A 4WF9Q 1IXKA 4DMZA 4K50A 1LW2B 2MQMA 2IM1A 4YDDB 2W2PP 2QMWA 4DUZF 2P5VA 4U96A 3S7RA 4LF8F 4MMOA 2HLUA 3N4WA 3ZZYA 4KGVB 1NB2A 2MQOA 1PYOB 4IG0B 1PC5A 2O3DA 5GAEI 4F0MA 1YJRA 2XM3A 4LFAF 2XS5A 2HHWA 3CTRA 2QTWA 5CZXA 1TFWA 2EBGA 1H72C 1O0PA 2O67A 1LOUA 4J9MA 1GEHA 1TU0B 4JV1A 3SDEA 2MXYA 3MEEA 1JJCB 4URQU 4WIQA 1XQIA 1YKWA 4MYTA 1YWXA 4B3RF 2JLEA 5E3RA 5KFCA 3IBWA 1JB0C 3GG0A 2AT1B 3HFZB 4PYAA 1HBUB 1FDAA 1WKKA 1WTFA 2E66A 2IHR1 3FDSA 3GP9A 4K5RA 3ELHA 2KVIA 3KUGA 3TR5A 2RJZA 4D3GA 2UUAJ 2AIRB 4CH1A 2Q66A 3K5PA 2KH9A 3R5CA 2R2RA 2BKNA 4HACB 1KQKA 3I5AA 2JNJA 4HI1A 3CCVS 1R8HA 2XQCA 4F2SA 2XBPA 3GIRA 1QAYA 2AX1A 3SQGA 3BQ0A 3EJMA 1SL1A 4QIFA 3CUNA 1A9NB 2IA0A 4PPDA 4C97A 2GW8A 2XWYA 3MPYA 3PKYA 1RHQB 2FLLA 5KFEA 1DZ5A 1QE1B 1BMQB 2J0WA 3DXBA 5AE3A 2Z2YB 2W2QP 5HVHA 3IWNC 4DI6A 5DG9A 1RA7A 2LXFA 1W7WA 4CM2A 4A8WA 5DZ7A 4A8MP 3MMBA 3QAEA 4DHVA 5IQ6A 2AEFA 4IO9Q 5KFDA 2WB1D 2H4WB 5HQLA 1T3NA 2V2KA 1SJ3P 4LF7F 1WC5A 4GKJJ 4ENOA 4HH0A 1UJ6A 2P6SA 5EGYA 5DM7Q 1XBWA 3W9JA 4P52A 3EGZA 1QSYA 1DQAA 3W9HA 3RJMB 4PG8A 2AHOB 2D69A 4F4ZA 2AQ4A 1JKHA 4XDDA 4EBCA 3EZUA 2CPDA 2BDPA 2MZJA 4B3SF 3AODA 1KTQA 1PBUA 2J5AA 2VPZB 2IAJB 2XSJB 2Z4PA 2ZWOA 3FCHA 4PXDA 3PX6A 4XAKA 1SJ4P 3JTOA 1YRTA 1IBKF 2PFFB 1Q8LA 3QIPA 2W4CA 4NMLA 5ETLA 1N36F 2HLTA 4ZCLA 1QD1A 1RADB 5I4MA 4CZCA 3EWGA 4MKVA 1HNXJ 1TELA 1U8WA 1JLCA 2XMKA 2Y1IA 2HKEA 1FWLA 2LDIA 2RT3A 2X3GA 3OQ2A 2M8DB 4PABA 4CLPA 3MUMP 4G65A 1REVB 4LSNB 3ZZZA 5I42A 2DRDA 4HL9A 5J2NB 4D3HA 1MROA 3OHAA 4JP8A 2JWNA 1RDRA 2C2KB 4LR7A 2C2NA 4FNHA 2FVRA 4ZA1A 3UQSA 4OL8A 2DGWA 2ZC4A 1F5BA 4F4KA 4CP5A 3EVOA 4DR1F 4OJ1A 4K59A 4P2FA 1U1RA 5E41A 1B70B 4NLTA 4QR2A 1HWLA 3KJVB 2ZVSA 4V19J 2H3EB 1P9YA 1YJ9S 3W65A 1F0XA 4MK7A 3U1LA 1O8BA 2GHWA 3DMJA 2BJ3A 4NYOA 4ED2A 3BYPA 1B99A 1BWEA 2HRUA 3AJ2A 3I55S 1EKRA 1RI7A 2B56A 4IH7A 3TUJC 2IJFA 3ET6A 4IG3B 1ZBTA 1AA1B 4DPWA 5A2QU 1J5EF 4NMXA 5K14B 1OO0B 3J7ZT 4TY8A 4CO5A 5C2CA 4DR7F 1VC5A 5IM0B 4ZPVR 3NMAA 2Y1RI 2G1DA 3QLHA 3LANA 5HBMB 4X84A 1HQEA 2FZCB 2ATCB 2D9OA 4JI0J 1YLXA 5B0FA 2GQ2A 1X4EA 1RT6A 1JJHA 5E3QA 2NZCA 3UFCX 1JWWA 4LUBA 3MR5A 2OJ3A 3QLHB 1IM4A 2XO6A 1VGYA 4A8YA 3AFGA 2E5LF 2DKOB 2VBWA 1Y3JA 4OI4A 2E1CA 3HX9A 4GKKF 1CSJA 4IG3A 2B7CB 4K4ZA 3PXGa 3FRZA 5KG0A 2IM2A 3POTA 2VA3A 4PEOA 2D1CA 3WX8A 4KB7A 2GC8A 4FVMA 4ED3A 3TJ8A 2HHHJ 1Q1KA 1WHVA 2YVSA 4P7VA 2ADBA 2DBBA 3D0HE 1K47A 2V0NA 3VZIA 4FN5A 2GAHC 4XIUA 4OYPA 1U45A 3FMBA 3GTYX 3G96A 4DEZA 1CEZA 4DV5J 5KG4A 2HVZA 3BV8A 3ISZA 4DN9A 1FDDA 5AE1A 1WF1A 3X1LB 3M8RA 3Q0AA 2MB0B 2YKQA 4UOGA 4QW9A 1S1UA 3GILA 4RNHA 3SMZA 2ZH3A 1UFWA 1S0OA 1KEKA 2JSXA 3GONA 2YH0A 4ZMMA 5C5JA 3DI6B 1MROB 2HVEA 2PA8D 2R7QA 3PG9A 4WFXA 1JLQA 4ZP9A 3ULHA 4B17A 1WHYA 3ZZRA 4X4SA 1RHUB 1C1CA 3CJQA 3R7BB 3KK3B 4JI4J 2E9RX 2BABA 3DRPB 2DNZA 1GMUA 4U8VA 2VQEJ 1U2RA 2QN6B 3KG1A 4JI2F 1VRUA 1CC7A 2DR5A 2JJ4D 1UPMB 4JOUA 4QQBA 2Q43A 2HVHA 5T7LA 5LMUF 1AXQA 1HWKA 4PWDB 2VFUA 1OPIA 3DOKB 4JI0F 4DPUA 2XGQA 1YVFA 2XSJA 3ZFVA 2FLPA 5JJBA 3SV4A 2JRSA 2VPWB 2CQBA 1CJUA 2YWWA 4TU8A 3W9IA 3VAKA 5F8MA 1BWVA 3H4DA 1HNWJ 1GMVA 3AA8A 3NAHA 2XMWA 1N32J 2QMXA 1N33J 4OZ3A 4J9OA 4JI8F 1TFYA 3HVRA 3M8PA 5AXLA 2FJVA 2I2YA 1OYDA 4RKUC 2CJQA 1S9GB 3FSXA 4L3NA 2AZ3A 2DR6A 1VBXA 2KYXA 4IRCA 4C3LA 4JUZA 2FPHX 4MTPA 4LF1A 3M32A 4LBIA 3QRPA 5L38A 4RW6B 4XTTA 4JI2J 4W90B 3GIIA 1DARA 1VJWA 1YQHA 1NAQA 1TZ0A 3MM6B 3PIOQ 4ZLLA 2OEKA 4IDKB 3GCWP 1RTHB 1WF2A 2YNFB 1URNA 3EDQB 3ETMA 1M5HA 1FEHA 1JLEA 3I9ZA 2YWGA 5HJXA 2YH1A 5HVGA 2Y0BB 1HIYA 1JJ4A 2XI3A 1FO1A 5KG3A 5DJBA 1ZTWA 2G4BA 1P1TA 1Z1ZA 5D0GA 4KH1B 4UZBA 1Q0NA 2K2PA 4DV0J 1YJWS 2CRLA 1ZPVA 1HQUB 3CCSS 4NLVA 2BJ8A 2J8AA 3PIPQ 3HPOA 3V5RA 1QY7A 3BS9A 4A8QA 2HWIA 1J2VA 2VB6A 3GJRB 7FD1A 4DSEA 5K8OA 4B3TF 1F9EB 1SH3A 2DEIA 3T6BA 1SJFA 4YY3J 4CH0S 4CDIA 2PE8A 4K4YA 1E6YB 2W4PA 2HFNA 1NJYA 2KT5A 1R0BG 2W2NP 5C24A 4BC7A 2UUBF 3M9MB 2RILA 2RDDA 2RS8A 4M5DB 4FKXA 4NLQA 5KG6A 1AROP 5KG1A 5IWAJ 2VA2A 2JVRA 3HXMA 1U02A 3PYGA 1O6XA 3K58A 4PZVA 1OIAA 4TYBA 2R7OA 2GJIA 3V6DA 3O1LA 4Q2LA 2VONA 2CA9A 3B78A 5F8JA 2VJVA 5GAHI 1GFWB 4DCPB 5A8WB 1RAFB 4ES2A 3AOCA 4XDCA 4GKJF 4NA1A 1TAUA 4KH0B 1S0MA 2XMVA 3I5BA 4FBUA 5LSRA 4FYDA 2IDLA 5CYMB 1F2HA 2VF3A 5AE2A 4L72B 2F5GA 1XMQJ 4USMA 4WKYA 5C25B 1EP4A 3CJ4A 3K5LA 2B0GA 4K4SA 1CJKA 1S12A 2IDEA 2GO8A 1KR4A 2V8HA 2ZD1B 5M2UA 2JEFA 5J2MA 1SKRA 3PW0A 2R7XA 2WZ1A 3KLFB 2CPEA 5I3PA 4ID5B 1REGX 3W2VB 3VZHA 1TL1A 3CCZA 2QC3A 3M2RB 3M8YA 2HSEB 2F9DA 4WZMA 1PSDA 1CG2A 1R8BA 2GQCA 2AYGA 2UUAF 3K8WA 1HPZB 1R8PA 3ZC4A 3DM2B 3JSMB 2OEMA 2FC8A 3J81j 3DRXA 1FX2A 5CYQB 2XHCA 5FDLA 4LF5F 1PG5B 1N0VC 1OY9A 4Y00A 2CPIA 3G8SA 2NZ4A 1SQFA 4R0JA 4OX7A 4DCOB 1FKPA 2HIYA 3LP2B 4ED4A 3GJQB 5I3UB 4AL6A 1TK5A 2K06A 5A8RB 1FXRA 1RWWB 4OYXA 2FJWA 3FK4A 1TUGB 4KV8B 3OL7A 2VASA 2LA6A 4ILLA 3AT1B 1XMBA 3P5TL 2W1BA 3AJDA 4I2PB 3CDUA 5K8NA 1XMQF 1B3TA 2GVDB 4EZ6A 2Z2MA 3D3BJ 3D1QA 1O51A 3GFZA 3R27A 4J5OA 1NEEA 3FNNA 2V68A 3CJ2A 4E8UA 1U7LA 4EWTA 2WSFC 1X9SA 4DR3J 1DTTA 2DNHA 2QLBB 2VBYA 1D9DA 1RBLA 4X4NA 2V4RA 1WSRA 3UD5A 2Y9HA 2EK6A 3PRDA 1RSCA 1CQMA 1K8AT 2BJ9A 2DGQA 3DLJA 1UWBA 5KOXA 1IKXA 5U47A 1WDTA 5JVHQ 3T1HJ 2KO1A 1U1KA 3HI9A 2MMYA 3UN2A 4ZIVA 3AD7C 3CPWR 2R2SA 4CTAB 5GMKa 4NLOA 2RH3A 3GFYA 3UCZP 2ABYA 2IMWP 3TWZA 3QATA 5HATA 3D0IE 3AHPA 2V50A 2OH2A 4KTQA 4URGA 2ADCA 1RAHB 3R5AA 1NDKA 1HMVA 1HD0A 1GH8A 2AU0A 1IBLF 1LW0A 2DK2A 2PN6A 3ITHA 2E1AA 4TLRA 2UXDJ 1OYEA 1B0PA 4TNOA 2QFJA 4JV2A 4DR6F 2ALZA 2E9TA 3HHKA 2R8GA 1U48A 5HK4A 2MJUA 2BBEA 1EETA 3BSCA 2YKAA 3FQKA 2M5YA 2DO0A 3ILJA 3NOCA 4OX8A 4F8RA 3LP2A 4P72A 4UQTA 2CQ4A 2HHQA 2K1RB 1FFGB 4PG5A 3N0VA 3ZTRA 5CA5A 1SC6A 1PYSB 2F8EX 3IC1A 3P5BP 4YR2A 5KT2A 4OHXA 3H40A 3H7HB 4DLEA 1P8GA 4V19X 1JLBA 1TL7A 4OJGA 1HQUA 2FIUA 2XMJA 4FVCA 4UUWA 4K4TA 1GX5A 1QAIA 2VJUA 4CLFA 2W7PA 3TUPA 1X60A 2V9KA 4YOEA 2ERRA 1MLAA 3H98A 3M2RA 3QT6A 2MKSA 5D3GB 4FXVA 3OSPA 1UA0A 3MM5A 2HS4A 1ELOA 2PSZA 2EEYA 2Q79A 4FXWA 2CWXA 1VIOA 4P71A 1H74A 4LF4J 4ED7A 1ZPWX 1H7WA 3NOGA 5E2QA 2JOQA 3CMAS 2DGVA 2WONB 3HVTA 3C19A 3LA0A 2NUUG 4MIBA 5KFBA 3NGKA 2IM0A 2ZJRQ 4BC9A 1EHWA 3JSYA 4M1KA 4WBFA 2R8KA 4NLGA 2V94A 1N8RT 3PNIA 4LFAJ 1L3VA 2HNZA 3B6BA 4MK8A 3BREA 4ZVEA 1LNQA 1RWOB 3HFVA 4DDFA 1XNRF 3VWSA 7FDRA 4DV2J 4CO4A 1VLYA 3M9NB 3H90A 2VFTA 1FJEB 2O1PA 1V3SA 3FUYA 5HO4A 4FZVA 3ZTOA 3D68A 4DPOA 1IKYA 1IKWB 2XZDB 1GXUA 4O4GB 3UDCA 4CLWA 3BO4A 1VBYA 1W2IA 5HANA 2L3MA 4PYDA 3SBMA 4KKOB 3VR1A 4Q44A 1YI2S 2EPIA 4O3NA 4ZCIA 1XNQF 3T1YJ 5AXKA 1ZM2A 3M7VA 1UVLA 3NG8A 2KG0A 3N28A 4JI5J 2IJNA 4F04B 1ZA1B 4WP3A 5D0HA 1U4BA 2J6SA 2AGQA 2UVUA 2WCXA 3MEDA 1JX4A 3ZZUA 2O66A 4JBCA 5D3GA 1IBLJ 2HHTA 3CIMA 4B3RJ 3BZQA 5ETNA 4U95A 2XMMA 2J9DA 1FNXH 3G6VA 4IUFA 3RRKA 1HYSB 2DNOA 2ZOGA 1HBNB 2ZEJA 1H2UX 2W2OP 3DI6A 1QUPA 3DU5A 3OR1A 1FCAA 1NM2A 1N32F 5FJ4A 3BO3A 1Q8IA 4ZVFA 1SQEA 1WOOA 2HAFA 3LGHA 2GMLA 3LF0A 1RP5A 4EEYA 1IBKJ 2J9EA 4NZ6A 4CLTA 5I3UA 2Y8YA 2GZOA 3UO0A 2YNFA 4RWWA 3O5TB 3PR5B 2KM8B 1S1VA 4B9NA 3T9ZA 4GKKJ 2MQNA 2RD5C 2W24A 4P10A 1U1MA 3BN4A 2UVVA 2PGCA 3EZ5A 2M8HA 3B8HA 3THTA 4F67A 1Y11A 3P6YC 2GNKA 1S4EA 4QZVB 2QV6A 1IUJA 2WVFA 1S1WB 2KDOA 5SUHA 1R0AA 1Q79A 4NL5A 2OGUA 1VMBA 1N5TA 2DTJA 1R89A 3CMES 3NBPA 1AT1B 2BRLA 5B0GA 3CCMS 2HFUA 2JH3A 2NR0A 2CNKB 3R1LA 1HWIA 4JI7J 4U67Q 3JYTB 4LR9A 1VCTA 2GIRA 2LMIA 2C3MA 2HAIA 2B4PA 2QSWA 1J5EJ 2KFZA 3FQLA 2GVZB 5HI7A 2U2FA 2ZBCA 4GVLA 1LXNA 3MMCA 4NCGA 1UWBB 2VPYB 3QFWA 4C2MA 1UEKA 2KB2A 2RRAA 2SXLA 3W5XA 4FS1A 1ZM3A 3CO0P 3QJJA 3MEDB 1KQGB 2DGSA 3TA0A 4PPZA 2M0GB 2N3OA 3H59A 2YKNB 3DLEA 4KFBB 4XPCA 4DV1F 1WUUA 3GR0A 3L95X 3W2WB 1JLFB 4DV1J 3HKZD 4WFZA 5K8PA 2V8PA 1UFLA 3ET6B 5D78A 1YJUA 2GVDA 2HPUA 5H1SV 2KN4A 1FE4A 4KYZA 4GVBB 2HIQA 2RQCA 1RHJB 3SCLE 3QWUA 4EO6A 3PEJA 3UWTA 3T1HF 1VQKS 3W61A 1T9XA 1WJ9A 2RRNA 4OZ0A 1N52B 3BGUA 1FXLA 5D77A 2LEPA 1I94J 2DHAA 4I4BA 1T9UA 4DSIA 1K1QA 3QZ8A 4EK2A 1U47A 5J1PA 3KK2B 2QRRA 2B5JA 3HMJG 3H5SA 3PYEA 3Q2TC 4ZVQB 4YB7A 3M30A 2PA3A 2QA1A 4AXJA 1JK9B 2EFOA 2W4DA 3Q83A 4X62F 3BGLA 4CCHA 2ZKUA 4DZ6A 1K44A 2HWHA 4NA3A 2FVCA 3SCJE 4YHHJ 1FNMA 4QOTA 5H9EK 4A48A 2EK1A 2UV8A 4ICLB 1KOOA 4ZLPA 3PR4A 4EMDA 3C6UB 2KKHA 4CT8A 1VK8A 2GHVC 2KT2A 4OYAA 3MECA 4WFAQ 4ANCA 4B9TA 2N7CA 4C3KA 2DGOA 2LXIA 2X7IA 4TN2A 5J2PB 3J7Z5 1WACA 1E6VB 1TAQA 2VG7B 3ENVA 5C42A 4HI2A 4Y34A 1AUSL 1UEVA 2K1RA 4NA2A 2RU9A 4KRWA 3HDSA 5HMZA 1FVSA 1OMSA 1XR5A 1RTJA 1V6HA 4YDXA 2E5HA 2MQQA 2OD6A 2OMOA 3GU0A 3V6DB 2QLFB 3DYAB 3FEZA 3IM8A 5L8RC 5CH7B 2H65B 4DR6J 3UE2A 2VKZG 1PJ5A 3QAUA 2DNGA 4DV6J 1R3NA 4KY3A 4M5DA 1UETA 4ZS6A 4RBVA 5FLXU 4M95A 3OFEA 4DF4A 1EQ0A 5KT3A 1VQPS 2MHNA 1VQMS 4USJC 1T95A 3OTDA 5T7LB 3RYLA 1U49A 4PWDA 2OHDA 1FNOA 4Y0FA 4AYBD 4CO1A 1VRUB 1S77D 3CMQA 3KLVA 3PX4A 2R7SA 1ZS6A 3IS9B 3JS9A 3IFEA 3AB2B 2XCAA 2XC9A 2BKOA 4ZVSB 4J9VA 2I8EA 4RPFA 4ZPCA 2OTLS 2MQLA 4IFYA 1CPZA 2WSEC 3JTNA 1ZA2B 5KT5A 3MM9B 3GLJA 4B3SJ 2FD2A 2XYGB 3I96A 4PXBA 4TQSA 3KLEB 2KVQE 3T6JA 4OFZA 1N33F 3O3LA 4CNYA 5KFZA 2IBOA 1U1QA 3EGWB 2XLJA 1S1UB 2R3VA 3N6NA 4PUOA 5DDRC 5A76A 3FC9A 4B9VA 3G8QA 2ZNYA 2XZWA 3SCIE 4B9UA 1HBUA 2NCKL 2APOA 2FJEB 1FDNA 2WK4A 3OFGA 5BXIA 2NLWA 1S6QA 2HS3A 2JFKA 1UW9A 1XK8A 1NK9A 3LPYA 3ZTPA 4BBYA 3LAMA 1S9FA 4DSKA 1TV6B 2WOMA 3QBCA 3CCLS 1IWAA 2GHPA 4NZ7A 5DQHA 2IMOA 5DG7A 1NKEA 1GNKA 2CFXA 3NY0A 1FWPA 2L9NA 3BKTA 4I6AA 4WIIA 2QEXS 1SCJB 4LBPA 1BQXA 4CIOA 1BGXT 1CBKA 1XR6A 2MZTA 2UUCJ 4LIWA 3M1VB 4IH5A 1CJUB 4FKYA 2ZE2A 3I4HX 4BHQA 2VFRA 4UZCA 1RWPB 1TR0A 2YNGB 3BDEA 4FDFA 4N8OA 2R7VA 4OQJA 2J7UA 4ES3A 2FGCA 3HHLC 3W2VA 4X64J 1XNRJ 4CLSA 3M9OB 1KD1T 3JTPA 4HTJA 1FTRA 3W8PA 3W3SA 1WC0A 2DIVA 3EE3A 5GADI 1C4CA 4IYQA 2BUNA 3GWCA 3UVJA 1PBAA 3IRXA 5IM0A 2EXUA 1PGZA 3MECB 1RU2A 2KG1A 2CDRB 2W9AA 2BOAA 3PO5A 1VQYA 1LQ9A 3CCTA 5JMNA 2KXHA 2OKQA 3C6UA 3KK3A 5L1JA 3DHXA 1C1CB 2QT7A 2ROPA 3GR1A 4G6VB 1Y0HA 1SVDA 4F02A 2H48B 3CULA 4EO8A 1KQSR 2MQPA 3QQCD 2BW2A 4QR1A 2HQFA 4DL6A 3M2VB 4CLZA 2LQ8A 4UOHA 3G87A 6FDRA 5MAOA 2DR7A 2RRBA 2HGLA 2KFNA 1OS5A 1YZ7A 3O2IA 2EC2A 5L9XA 2H9ZA 3V81B 5LXRA 2FVSA 1FJ7A 3M30B 2OUGA 3DC2A 4L73A 3DKDA 2YWFA 2HFSA 2XG8A 3NEKA 4EFAC 1F3VA 4DJBA 5IT0A 2DHHA 3EMTA 3HJVA 4NLUA 2CJXB 1NUEA 2A18A 3CW2C 4U9RA 3VTIA 4DG1A 3PFOA 5CYJA 5IZHA 5H9FK 1OPZA 2G1HA 3MXHP 1GXLA 1AZSA 3FMWA 2C1EB 3I0SB 1VQ5S 4DX5A 3M8ZA 3POTB 1HBOB 3D6HB 3VQTA 5I42B 4LQ3A 5F8LA 3KMQA 1JNZB 2DO4A 4M94A 2XMUA 1HKAA 1UW4A 2Q1LA 3CDBA 5L1IA 3RW6A 5F8NA 1RAGB 4ZPBA 4DX7A 1EAYC 3E3XA 4JI5F 1LW2A 1UVJA 1JLGA 1FDBA 1HNIB 4OV6A 4ECQA 1JLEB 4TYAA 2N4CA 4OZ2A 5CCMA 3KLIA 2F1FA 4ECUA 4OZ5A 2GMJA 1EQMA 3US5A 4ITSA 3D4JA 3M6VA 2LFVA 4A4JA 3OJUA 2NUHA 3ENAA 4TY8B 1T7PA 3PKMA 2B8PA 3EXYA 8ATCB 3OL9A 3CJSA 3N79A 3QWPA 4Y2KA 4Q45A 2CG4A 3A3NB 4ZLJA 3DRYA 1H38A 4P6QA 3MMBB 4YN3B 2WAQD 3LH2S 1KHWA 1X5SA 4ECVA 1MMDA 1YBTA 2RDIA 1UPPA 3ILLA 3M8PB 2CKWA 1RABB 3J7YI 2AJQA 1F2GA 1X0FA 1M1KT 1HNXF 1KQFB 3ZO7A 1Y5LB 4DFPA 1RT4A 4LVNP 1U6BA 5CCLA 1KVJA 4XK8C 2B7BB 4TY9A 3OXGA 2E5GA 1S1VB 3D28A 4J91A 1M90T 1ROFA 2CPFA 1TKZB 2M9KA 2DY1A 4KBIA 4LF4F 2J0XA 3MGJA 3JAMU 3WC2A 1SJ1A 4C0OC 2AP6A 2FTRA 3PW7A 5E0OA 4N7TA 2BVZA 1YG0A 5CD4H 2Y0SD 3I32A 4M5IA 1GMWA 3R5GA 4ATNA 3HP6A 1EB0A 5E3CA 1T9WA 1MW7A 2F65A 4LSNA 3W7BA 4LQ9A 3L3CA 3G82A 1IR2A 4KHRA 5GADU 3LP1B 1VBKA 4HTIA 2XGPA 4WK3A 4CLYA 1JLCB 4DXLA 3IGNA 3EXCX 3TZWA 2BANA 1LK5A 2FZGB 3M2VA 3PEHA 2XNQA 4FPIA 2DNQA 4H4MB 5ETMA 1H73A 4RW4A 3PW4A 4KPCA 2BJEA 3VCDA 3IO1A 3TEGA 2RQKA 1IQTA 3NS6A 1MU2A 3FEXB 2VHGA 2XTJP 2OSRA 4DR5F 1DRZA 4N47A 3KJQB 3K17A 3TW0A 2MZRA 2HRYA 2NXCA 2Y8WA 3THPA 3CXCR 2G2YA 4CH7A 1JKHB 2NREA 4QWDA 5IC6B 4KJIA 3FKBA 3M6XA 5GMEA 1BD6A 2V67A 3PW5A 3TRGA 2FGOA 2VC0A 2F63A 5EX0A 5HSPA 1Q82T 3MOJB 2H5IB 3VAFA 3AJ1A 1HARA 4R8UB 2DVIA 4DFKA 3QT5A 5D15A 1X4BA 3Q8UA 1N34J 3A13A 4FF4A 3K59A 3MM7B 3DU6A 2FY1A 3IBCB 4YS2A 2W7OA 5GAHU 5CQGA 2GJFA 4L75A 1X5PA 5IWAF 1K0TA 4EBDA 4MKYA 2NXUA 4EYIB 3DLKB 3AD9C 2ZWPA 4I7FB 3RU0A 3WIVA 3ZXWA 2NPFA 4O3RA 2LP4A 2RAQA 3QGGA 3J81U 4QWCA 1XMOJ 4ES1A 2BOPA 3E01A 3KTQA 1TV6A 2VV5A 2ZUAA 2ZH1A 1U1LA 4LF7J 4Q0BB 1HI0P 3KUEA 3AQPA 4R8UA 2C2EA 2BM1A 1FRJA 2EG1A 2AJFE 4X4PA 4O3SA 1J27A 3ENWA 3GYNA 5D0EA 1I51B 3NCPA 5AXNA 1OJ4A 2A2DA 3DRSB 3L09A 4WFBQ 1IR0A 4YB5A 5D4NA 2E7XA 2BA9A 3GV5B 4DR7J 3PM9A 1JLBB 1TL7B 3PYFA 1TKXA 3NGUA 4YP3A 4U7CA 2RHQB 3V81A 3BM7A 2DD8S 4QW8A 5K9FA 4PUOB 2HURA 4P73A 3DOMB 2DB1A 4DWIA 2HQCA 1U26A 1EKSA 4IKAA 2OAUA 1HHTP 1S6UA 3S6EA 4NPOA 2NYHA 3TJ9A 1EETB 1DFDA 3MM9A 1N88A 3ZZPA 2HFVA 3GE9A 4Y6IA 5DLFA 1ZH5A 1JIHA 2LVWA 2OPPA 5D4LA 3ITHB 5I3QA 4LR8A 2Z2LA 5LT5A 1GQEA 5GVQA 1D9AA 2HRTA 2GJ2A 4NZ0A 3UVJB 4DZDA 1R0CB 2UP1A 4USTA 4CI0B 1S0NA 3H4BA 4DV5F 1YTYA 2UUWA 5D4OA 5F41A 5LM7E 1C0TA 3J80U 2VG5B 2KHDA 5GMDA 1UVNA 2AJ1A 3HVWA 3SIPB 1Q53A 2OTJS 2ZHAA 1U0SA 3T5JA 2YNIB 1SC1B 3HHLA 1LWFA 1U24A 4K5SA 3WDOA 1KLMB 4RNOA 4N41A 2JX2A 1YGYA 4IOBA 1T9VA 3L7OA 3KLGA 4DX8H 5F8IA 2YNHA 2RMLA 4BWMA 4DOZA 1IBCB 2VUGA 2DY9A 2FJAB 5EN1A 2CDQA 2D9PA 4JV5J 4FYWB 2EG2A 2BQ3A 2M2BA 2QGFB 1BQMA 5LMUJ 4Q8FA 2YQ1A 4NXNJ 3UR0A 5C42B 4FS2A 2COLA 4I56A 4F4WA 1ACMB 2MKIA 3QIPB 1IWGA 1N36J 3KHLA 4NEYA 3HCXA 4YB6A 2KXFA 4C9DA 3GIJA 3MOZA 3CJ3A 5B0DA 1WF0A 2RE1A 1D1UA 4JI4F 2DIUA 1SV5A 2XLKA 3HT3A 3B82A 3SXLA 1LKZA 3R8YA 2BZ2A 1U6FA 2AEMA 5FD1A 4P2SA 2RU3A 3RTVA 1X5OA 4IOCQ 1VQ8S 3QMQA 2FVQA 2HHXA 1RWVB 4DS5A 4M5HA 1FVQA 1WEXA 1WI6A 2E7WA 4YY3F 3Q8RB 2BQUA 3VALA 3UDVA 2HK2A 3ZTSA 3TZXA 4QU7A 4F25A 2LQ9A 2ROGA 3MAAA 4OIXA 2B9EA 3MUVP 4O23A 4DS4A 1HPZA 1VI7A 1MN9A 7AT1B 3OVAA 4AQYF 4PXCA 1FWKA 2IC3A 4DL7A 3NGDA 2NSCA 1KHVA 4RW8A 5BYQA 2RUSA 5KT6A 3AY0A 2QMUB 3OPKA 2C2ZB 2MSTA 3B4DA 3C15B 5ETPA 3SSRA 5D6GA 4ID5A 1N0UA 2HZVA 1S1XA 4H4KA 3SZ2A 2IYGA 2FVPA 4K4VA 4QU6A 3OTBA 3Q86A 1WD6A 3LP0A 4FYXB 3SV3A 3LW5C 2ZBPA 4HH1A 4ZP6A 2D74B 3KKFA 4C7QA 3BH6B 1UEUA 3CGIA 4OZLA 1RAEB 4ZVOB 1T03B 4FP9A 2VU5A 3DHWC 1NK4A 4ILMA 2E5LJ 3DYAA 1SUQA 1DTQA 2VQFJ 4DSJA 1NO8A 3ZZ0A 4EYHB 2BEFA 3GIMA 3M8QB 1BXNA 4FXDA 3V6HA 1MSWD 1FEEA 5E33A 3IGVA 4USIA 3IR5B 3QJLA 4DPYA 4I67A 4JI8J 1JLAB 1VIXA 4Y2AA 1SBRA 3SDEB 4NCGB 2ZFHA 2CJKA 1RCOB 4IO1A 3THVA 2VC1A 3K5OA 3F56A 3TAMB 4I7FA 1TKDA 3ISND 3D66A 4A46A 3M2UB 3OV7A 1N5QA 3RG6A 3HHLD 4ICLA 3HSJA 5CABA 3D54A 2YBVA 3MMAB 1HNVB 1X31C 4DL4A 1SQGA 1F9HA 2QLWA 3IR6B 4OYOA 3AB4B 4DUZJ 1FI4A 1TUVA 2Y1LB 4G1QA 3QSYB 3D6FB 4JI1F 3I9V9 4OHZA 1MN7A 2L08A 2YNGA 3DXSX 3P45B 5J1NA 4B08A 4RW8B 3J81Y 4K4WA 2EFGA 2Z56B 4M5KA 4NCBA 4C8ZA 2PT0A 2NS1B 4JI3J 3TNVA 2DNKA 3PRVA 1HHQA 2MEWA 4BLGA 4KGZB 5HN0A 4N77A 2W2MP 2DITA 2RVJA 1D8ZA 1Y9OA 3UCGA 3FSYA 3V4MA 4PWWA 6AT1B 3G4SS 3V6JA 1EIYB 1M5SA 1T11A 3BH7B 2ASDA 3MPDA 1SV5B 2GO9A 3FFIA 4WFYA 2A3JA 4RNFA 3TX8A 4WK1A 1SKSA 2WVCA 4N76A 4X4UA 3M32B 2HBYB 2IBKA 1WG1A 4M63A 5BJRA 5IXUA 4ILRA 3HKWA 3KLHA 2EBEA 2HHHF 2F4FA 2BMBA 4WXWA 2UV8G 1V5IB 3T5HA 4IR9A 4W98A 1X8DA 2XCPA 5ETQA 1ZAXA 2J9DE 2VG6A 5GAGU 1GTEA 2EFVA 1UFKA 5F9LA 1G7CB 1KLMA 2K3IA 1BQNB 1N4LA 1HI1A 3C6TB 3D2WA 3MM8B 3R97A 3JQKA 5MLCV 3HHLB 1UJ4A 2RS2A 5LL6d 4DQSA 2KYZA 3MR7A 5AJ3J 3T5KA 1KLNA 3AAWB 2VH7A 2HBRB 3JSRA 2QLXA 4P2XA 1X9WA 3EGNA 4P75A 2B43A 4WWSA 4CWBA 2XMAA 4QR0A 2EFNA 2W8LA 1TK8A 1N5YB 3I4PA 3ZNJ1 3BR8A 2IPOB 4K7QA 3MAHA 1VHIA 3CJTA 4C8LA 3VAIA 1Z4UA 2AZ1A 3I6PA 4C3MA 1KC8T 3MF5A 3WBZA 5DGBA 3OL6A 2KJVA 2V8DA 3ICLA 4Z37A 3L4BC 2HGMA 2I5JB 2MKKA 1U8SA 1AFIA 1Y5NB 3OVBA 2HMIA 2KI2A 4LF5J 4P7TA 5A6PA 2F4VJ 4FF2A 3MM5B 4OYWA 1ZETA 4CYUA 2JEJA 1L3TA 3G6XA 1OY6A 4Y3CA 3CDAA 3NXZA 2FC9A 2F40A 2LDYA 3CJ0A 4PR6A 2DCUB 3C16A 1MMLA 1HBNA 3PZPA 3W62A 3P4UB 1Y7PA 4IRKA 4I6WA 5D0RA 2CJ9A 3CJRA 4USWA 1UVIA 2ZJPQ 3OD2A 4RW9A 4DCJB 2XLIA 3T5LA 1VQNS 2Z30B 4MYUA 3FBFA 2J0QD 4EGLA 3UD4P 1NU4A 3NNAA 1RACB 3CCJS 1KBRA 2CPZA 3OUYB 4DV3F 1NKBA 4N8NA 5HLFB 4JI7F 1LWEB 2XS2A 3DLKA 1FRMA 4KAIA 1CQNA 1TTHB 4F50A 4BCAA 4DU7A 3RBDA 1IKWA 2F8HA 1WKLA 2B5JB 4OLPA 4ZPDA 4EUVA 1VFJA 4HT5A 4U6PA 2XHWA 2CQ3A 4C4WA 4DPXA 1JLAA 3MAQA 4ECRA 2CYYA 1KVIA 5CHCB 3IMQJ 3MURP 1S7IA 3OLAA 3NCRA 2MLYA 2CWKA 4IRDA 2QA4G 1S1TA 2I5JA 3BF4A 3Q8YA 5DM6Q 1LV5A 3K5NA 1KONA 1ZYQA 2FY8A 2ZBIA 4USUA 5LSLA 4JV0A 4DQQA 3BDPA 1U09A 1DLOB 4QIGA 4RUAA 5J2QA 3HULA 1RUSA 3FSIA 4ELTA 2RHSB 1RWMB 1V3ZA 2YKNA 3DLEB 4KFBA 1YHQS 4JI3F 3UD3P 3P49B 4WZQA 5IT9Y 3D3CJ 2ZH9A 2HK3A 1S1XB 3DGPA 1BHNA 4QWAA 3HD1A 4C8MA 3GMGA 3P8BB 3MMCB 2CUYA 4B3OB 3QSIA 3H20A 2ZE2B 3K7RA 4MFBA 2J9CA 1G6BA 3WC0A 3GV8B 1PYTA 5KT7A 1NPPA 2AEJA 3CE8A 3JYTA 3PCOB 4ECSA 2J7WA 1ZTTA 1WWHA 3EZOA 4QYZK 1RLDA 1ICEB 2EWHA 1WC4A 5HLFA 4K2JA 1FKOB 4I64A 4M5LA 1NPKA 2KU7A 3JSBA 2PFDA 1H98A 1WHXA 3CVKA 1Y4ZB 5CYQA 2XNRA 1NH8A 4H4OA 4CO2A 2JLFA 1WSVA 3UR3C 5KG2A 2RDJA 4Z7CA 5KFSA 3KG4A 3OTOJ 4DL0C 2PD1A 2X1GA 5BYSA 2HHVA 2ILZA 2QA2A 3IN5A 3BKUA 2WSCC 3BPSP 1LW0B 1TP7A 3V6KA 2LU2A 3GB0A 1A6LA 4TXSA 1NK5A 3DCAA 3VQSA 4WE1B 4PG7A 2DNYA 3W1YC 2IM3A 2CNNB 3W60A 4AE5A 2ZZNA 3KHGA 4W4MA 4AFFA 3VAMA 2ZD1A 3DLLQ 5DQIA 5DQGA 2RF2B 4PAAA 2FHKA 1N5SA 2BYCA 4OI2A 4CTAA 2YTCA 4X65J 4BDPA 3HJFA 4P9SA 1R6VA 4C6AA 4QPTA 1FD8A 5LSOA 2JEIA 3MCOA 2JC0A 1GTHA 4LF9J 3LAKA 2JL9A 4KHMA 1N5YA 5A8WA 1C0TB 4YFUA 2C22A 3LO3A 4EI2A 3C2PA 4X4OA 2VFSA 4H54A 2MQ8A 2J7KA 3P3DA 4I68A 2E1MC 4WP8A 2CAJA 2FHOB 2NXEA 2QIFA 2V69A 5HMXA 5IV4A 4NXMJ 3CCUS 1HBOA 3VGVA 1W2BR 3U7JA 4CO3A 2FHMA 1Q4RA 3S8SA 1NZAA 2XY6A 4KHPJ 1NSQA 3PX0A 1RT3B 1T9TA 5IT4A 4RUHA 1NMEB 2G9OA 1N48A 2HNDA 4IQXA 1UVMA 4FPRA 3GYGA 2GIFA 1R8CA 3KDOA 3E51A 4RU2A 4Y28C 2HNZB 4J9LA 2Z2ZA 2VG7A 3HHDA 4CT9A 3DM2A 1JQGA 2K7KA 4M5GA 1HNZF 5D8HB 2F3JA 1KDNA 5A0YA 3H42A 4PKDB 4ZP7A 1Q5VA 3KHHA 1WOSA 3Q22A 3JB9k 4ED5A 1Z2LA 1UWAA 4A8FA 3HHNB 3D67A 4IH6A 2M52A 3TJAA 5LMNJ 2I1RA 4OX9J 1RTHA 1ZOTA 3SCKE 5HP1A 2HVIA 2CZ9A 4Q2MA 2LQ5A 1F9FA 3C15A 1CJKB 2LA4A 2QZ8A 2X51A 3D0GE 3I56S 1EP4B 2IC3B 1WEYA 3G86A 2XYPB 3IRXB 4DN0A 4F7VA 1X4DA 5C25A 2HNYA 3MAAB 2ZH6A 1LWCB 3BEGB 4TU7A 2D3UA 5JVGQ 1LXJA 2OD4A 2OPSA 4JI6J 4RUBA 2J8SA 5ETRA 4A8XA 4WFNQ 3W66A 1S97A 2R7WA 3PYDA 4N5SA 3HM9A 4DFMA 4ETZA 3IAS9 4R5PA 1F1BB 2UXCJ 1Q8BA 1UJ5A 5KT4A 1YSJA 2CZ4A 4O44A 4WXOA 5ETOA 1FKAF 1RT5B 4OLOA 3OVSA 1Y10A 1WORA 2YKOA 5EDWA 1UZDA 3DOKA 2P6TA 4DR4J 3LWLA 2K7JA 2Z58B 2CPYA 1YRUA 2B9XA 2VFVA 4F36A 2Z57B 4DUYF 1LWXA 3NRBA 2Q6BA 2MZ1A 1CLFA 1RAIB 4ECXA 4MAKA 4DR1J 1MWQA 1RAOA 1WC1A 2XZTB 2YNHB 2AGPA 4Q8EA 4O0NA 1WELA 1XERA 2OP5A 2CNLB 4W92B 3PHEA 3F73A 1G3OA 3PFEA 4K0KF 5AJ3F 2RQMA 1OWXA 5E3PA 2OELA 4M5JA 4P74A 4ZPTR 4ZIWA 3D1OA 2KFYA 2LU1A 4OYBA 5G0RA 3R1HA 1B7YB 4HHHA 2BR0A 2FJXA 2YQ3A 4ERDA 3LP0B 1NK6A 1DTTB 4J9NA 1SIZA 3W5YA 4C11B 3TAQA 5IFMA 2U1AA 3TZZA 3LPEA 2JLGA 3CC4S 1S1WA 3QT8A 1ULRA 2MZQA 3EM1A 3OTCA 2Q3PA 3BGRA 5KFNA 3OSNA 3KWMA 2CJBA 4DQIA 2W01A 3N5BA 2DR8A 2VOOA 2BW7A 2ASYA 4FYYB 4IFVB 2HHSA 2R7TA 3TZYA 4UOCA 5KFVA 4AL7A 1KVKA 5A8RA 2XI2A 5DG8A 4O4RA 3KNGA 3B4MA 1CS4A 1SKUB 5JUMA 5F3ZA 2CQ1A 2VODA 3T3FA 4NX9A 4OHWA 2YQ0A 2AWZA 3D9BA 4UT4A 5L46A 4WJBA 3GFHA 3T9NA 2OO4A 4C8NA 5A8KA 5FDLB 3VAJA 1ITPA 1S4FA 3C66A 4DR5J 1I5OB 3OXFA 1Q81T 2UVRA 4RNMA 1DY3A 4MFBB 1NSKL 2M7SA 1HYSA 3DRSA 4YEAA 2G2ZA 4CM0A 2K3KA 4NE9C 1RKIA 1PC4A 1RT6B 5T41A 1HNIA 1HW9A 1RLCL 4FNIA 1JLGB 4C0BA 1VRQC 3FCWA 2DGTA 1VQSA 1T02A 1PKUA 2KJWA 5HBMA 1VK3A 3UCUP 3CJ5A 2MGZA 2E5IA 4O3PA 4A8OA 4Z2XA 5J2MB 1C0UA 3AD8C 1FFSB 4K4XA 3MHYA 3RB4A 3IR7B 2YWKA 5HROA 2MSSA 3IAM9 2BX6A 1U2CA 3S01A 1HD1A 2HQGA 2KZMA 2ZJQQ 3QO9A 3R6GB 1LWFB 2L9WA 3I0SA 3RB6A 4J9KA 3U1MA 1GK8A 2ZOFA 4N56A 3Q8SB 1HW8A 1S49A 2W7AA 2YX4A 5KFQA 4HYKA 3A8EA 2YWEA 2DNLA 3AA9A 2A10A 3OR2B 1H7XA 2MY8A 3BJYA 3PJXA 1DAXA 2ZOMA 3DDIA 2KXNB 1VJQA 4RR5A 1C1BB 3EVWA 1Q95G 2CPHA 3G6YA 3TA2A 3EPIA 4DSFA 4ZVHA 4R0EA 3BR9A 2CQHA 3V2UC 4XO0A 1HQ2A 2ROEA 2IVYA 1SL0A 5ETKA 5B0CA 3IXQA 3MR3A 2D41A 3GJSB 1NHVA 3UPFA 4I1TA 2QFIA 2V4JA 3DRRB 3BB5A 3BO2A 4F4AA 2Z0GA 1WHWA 3NGTA 5C2GA 1RAJA 4DR2J 1BE4A 3CD6S 4LFBJ 3DOLA 5KFJA 2BE2A 3MPVA 4PG6A 2R42A 3DOMA 2WRMA 2WTFA 3LP1A 1PJ6A 3CT9A 1M5PC 1ZAVA 2G2OA 5F0WA 2PC6A 3G82B 4LF8J 1CJVB 3Q8PB 4MIAA 3KOAA 1N6QA 1FK9B 2RKIB 3UNGC 3H25A 3TP2A 1FRXA 2P9EA 1GX6A 1H2VZ 2YY3A 2VQEF 1Y00A 2R8HA 1B4SA 2GCFA 2G0JA 3GFXA 2N7YA 4OZNA 4KO0B 4ECYA 4H4KC 3CD7A 3AOBA 3KK1B 3U02A 3OL8A 2RSQA 1HR0F 3RBXA 2EKYA 4RO0A 3CC7S 2IFXA 1NDLA 1DHMA 4LFCF 2GGPA 2PEBA 3DLGA 2V2QA 3MDFA 4OI6A 4ZPAA 4ED8A 3ZZTA 3OXLA 1JXVA 5IOLA 1FJGJ 2Z8QA 3QGHA 2QA4S 4LF2A 4ZHRA 4DV4J 3IM9A 2F7VA 1FF2A 5KG5A 1MWYA 4JI6F 2V9WA 2PEHA 4KGMA 3V4IB 4K8RA 2ATLA 4X66J 2DHSA 2OPRA 4Y2CA 3PACA 4ECWA 1HR0J 3CB4A 1W25A 4ZKAA 2WOMB 8AT1B 4XPEA 2MYFA 2HQDA 1KFSA 3MFHA 2AJ0A 3CJKA 1QE1A 3DDNA 4LREA 4ZHRB 3IWLA 4ZCKA 2GA7A 3C6TA 4ELVA 1BQNA 1NLKL 4NLDA 2J0SD 4WKRA 4FBTA 4QYRA 2ZZMA 3SQGB 4G3IA 1U25A 3K89A 3TARA 3D7SB 1U2FA 2XULA 5G0RB 1FHTA 2HZCA 1LK7A 5KFIA 2B6AB 1J5OB 4Y2MA 4IOAQ 4OYZA 1S72S 4H4MA 2JDJA 4L74A 4P2MA 1AW0A 5HJYA 4C8YA 4LBHA 2R2UA 1N6QB 3KUHA 2VDIA 1A0OB 2QE5A 1NJWA 1B64A 1JNRB 2G0CA 3HHEA 4PRFA 2W9CA 1AB8A 1NK0A 2C3PA 4NEZA 2B3TB 3H2UB 3MEEB 2UU9F 1K1SA 3SFGA 5GAGI 1QTMA 1S0VA 1T94A 1NCLA 1WC3A 3RAMA 1OQ6A 4QWEA 4J90A 4LFCJ 2ZH7A 1Z2ZA 4QJVA 4BWJA 2ZHBA 2V34A 4KKOA 4O44B 1NHUA 4CLKA 1FRKA 1RTDA 1O5JA 1IN0A 4DV7J 3MPWA 5KAKA 3GJTB 1IKYB 3JSMA 3L9ZA 2XS7A 1EJ7L 3K8VA 2JEGA 4U7UK 3UW1A 4RZRA 3OBIA 4ZVRB 1IJEB 1RTJB 2P9GA 4WPAA 1HBMA 2DGXA 3KHRA 1RYRA 1I6JA 4JYAJ 3N5FA 1TL1B 1LEOA 4L76A 1S7HA 2XO7A 4B3MF 2IYIA 1KFDA 1DQ9A 1RWUA 1IBMF 1CJTA 3ISNC 4I0WA 5HQ8A 1FXDA 2C2OB 3PRBA 4PXEA 4LFBF 2IA6A 2PO4A 5CXTA 1YDLA 1YITS 4GC6A 3R5DA 2R7UA 2WB4A 5KFUA 2OI2A 4AXIA 1XMOF 3SFUA 3TO8A 2V6AA 6FD1A 1HWUA 4YR3A 4O3QA 2V2VA 2BM0A 3BBBA 4LMZA 2GGPB 4EZ9A 4QPXA 2B8QA 2GFFA 2ZZTA 5C7PA 2R7RA 2QL7B 4GC7A 3C46A 4B9LA 2AMCB 2GMHA 1RA6A 3CEDA 3H2VE 5AXMA 3I0RB 4M5MA 4KO0A 1FERA 4PG4A 3KXDA 2IIHA 1S6PB 2FJBB 3QNWB 1IJFB 4G1PA 4QCLA 2CVIA 1HLWA 1UP1A 3UN3A 5HQMA 1IR1A 2BE2B 3QT7A 1FE0A 1VRTB 4KSEB 4NLPA 5DLGA 5KG7A 1HI8A 4RUCA 4DV6F 1NJZA 1QVFR 2N3LA 1RAAB 2V4JB 3DRRA 1SIWB 3GPAA 4LSLB 5LXYA 5GAEU 2ZH4A 4URSA 4ED1A 1L3SA 4J9RA 4NXMF 1X7VA 1S6QB 3I31A 4KQZA 4RX6A 3TEHB 2MKHA 4PQAA 1Q86T 3FCVA 1Q5YA 2E1PA 3CWJA 1NBEB 1RB0A 3OTEA 5CD4A 3CCQS 4HVZA 1QUVA 2YPYA 1DURA 2B4UA 4KIAA 4MJKA 3TQ1A 1PAUB 1FJCA 3CDWA 4C0HA 4JYAF 2C3YA 4MK9A 3GV7B 3MMJA 2GQQA 3K0JA 3DLHA 1NHKL 1BUXA 1M1GA 2BV3A 2LXUA 4KGXB 1C4AA 4NLWA 3DNCA 4RJVA 2V5HG 4ZITA 1P27B 4F3QA 5ETVA 2B9YA 4ZDNA 1SC3B 4QWBA 4ZLNA 1RT2B 5EX3A 3WZ0A 4IDKA 3NWGA 4OYIA 3RAQA 4IFYB 1IKXB 1H2TZ 2VBZA 3N6MA 4ZVGA 5EWGA 1QSLA 1NZ8A 1X4FA 1EX8A 2UXBJ 3Q8VA 2QYGA 1RBOB 2OEJA 4RW6A 3MEKA 3CNQP 4OI1A 2DRBA 4CO0A 1A7GE 1NPRA 2ZVIA 2DR9A 4KPYA 1X9MA 3TX0A 1M5VC 1TMMA 3CCWA 4WE1A 2YPZA 5D4PA 1NJIT 2VL1A 1F5CA 5M2RA 5BR8F 1MWZA 2XY7A 1WI8A 2QL9B 4QIWD 1WC6A 2H4YB 3HZEA 5ETTA 2IAJA 4KGKA 1R0AB 1HBMB 3DGVA 3MTJA 5F8HA 3NGSA 2J6TA 2BRKA 4I2PA 1FRHA 1VOMA 2A2CA 5BYRA 3KLGB 3ENQA 1NXIA 2ZM6J 3X3UA 4DBQA 3RW7A 3A8KA 1KKHA 2GX8A 1RBAA 2EFPA 3PDNA 3GSDA 1H0HB 4LIRA 2NXJA 1NDPA 1KWMA 4Y2IA 1RYSA 2GS8A 2IVFB 2HNYB 2ALYB 1D3WA 2PI5A 1X4GA 2M88A 2ZDPA 5SZTA 1K0VA 3S1TA 2BE7D 4LSZB 2QX0A 2EW9A 3VF0B 2OPPB 1P6TA 2BJ7A 3FBBA 3UI3A 3VV2B 4PQUB 2X3DA 4DV7F 1RTIB 2ZUGA 5B0BA 1KNZA 1QAXA 2R9LA 3EPGA 3VGSA 5T14A 3ZZOA 1S48A 5B08A 4GMKA 2XSFA 3TVZA 5H9EJ 1UVKA 5AT1B 3RRGA 5J2QB 1NK7A 1QJHA 3EUNA 5A0YB 3KLEA 4A8SA 2ZDOA 3VAGA 1F60B 2Y3YA 4RBTA 4LF6J 2V8GA 3EICA 3SQOP 1NK8A 2E7VA 1UAWA 4F3MA 4HEA9 4AL5A 3M8WA 4NLYA 2DEJA 3UNYA 3AH6A 3G8TA 1R8AA 3DDKA 4DQRA 3M8SA 1B0TA 1YX2A 3K57A 1S76D 1FA0A 4DR4F 2M70A 2V4QA 2PMHA 4OHYA 1R7IA 1YIJS 2BACA 2DXEA 3A3OB 4KR0B 3BQ2A 2HBQB 3V4IA 1KN6A 1ZZFA 2HS0A 3FZ2A 4GVBA 2HQIA 1Q16B 1QM9A 2OSQA 4IQMA 4NYZA 2ZH2A 4OI3A 2DPIA 2HG4A 1JXEA 2WONA 3HVTB 1T3OA 4ECZA 1YBAA 2B4VA 4ZJQA 4DV3J 2N82B 3RZAA 4EU0A 3H5UA 2MTLA 3UN5A 4USVA 2D7SA 4CLLA 2A6MA 3I0RA 3OW2R 5KFMA 1VQOS 1VC6A 2L48A 3KK1A 2DT9A 2D3OR 5IC4B 3R9LA 4RLEA 5FIIA 5M2PA 3HFKA 2QLJB 3A8IA 2VDHA 4NLRA 2GVZA 3HLUA 3CSKA 4J9QA 1OSCA 2HEKA 4DV4F 2OMLA 2P2CB 2Q6CA 2VICA 5THWA 4O3OA 4ANEA 3JXOA 4ECTA 4UUXA 2HFOA 2JZ5A 2J6UA 2I38A 5A8KB 2UXBF 2KZZA 2CJAA 1FFWB 1F3FA 5HP1B 4NI2A 4CYUB 3T1YF 1ZZNA 2MKCA 5ITHA 3IG1A 1I3OB 1CJTB 4ER8A 4Q7AA 1T9YA 1FT8A 1RISA 1SPBP 2VD3A 2ASLA 1B0VA 4MKBA 4USKA 4UY85 5IV3A 2AGOA 2KHCA 2MZSA 2MKJA 2A1BA 3AXMA 3FRYA 1HL6A 3L7UA 3M4XA 1PIEA 4MT1A 5ADZA 3KJVA 2DPJA 1C1BA 2A0FB 2YX1A 3C14A 2HFZA 4Z7YA 3CF5Q 3A3PB 4F2RA 1YK9A 3IP0A 4UOFA 3OR2A 3KK2A 1JJ2R 4BS2A 1TVRB 1DJ0A 1PJ7A 2NYIA 1IKVB 3OFHA 1EZZB 2HNDB 3FJ2A 3R3TA 4HHUA 4ELUA 2LEAA 2E5JA 1F6TA 5F9NA 2C3OA 3H5YA 4WP9A 3VGTA 2BKPA 1YZ6A 2LKZA 5KFLA 9RUBA 5DDOC 2I0XA 2B9WA 3QO9B 4WCEQ 4UY8T 4RBUA 4PCQA 4YUDA 3RBEA 1RT4B 5KFHA 4B3OA 1NKCA 1M0SA 1GT8A 4LRDA 2DNNA 4UF4A 3OFFA 3RGIA 4CQ1A 3MCNA 1JLFA 2C2RA 5EWEA 3NL0A 3SSSA 3J80Y 2KT3A 4I2QA 2DH8A 3KLHB 1N34F 2B6AA 4J9SA 1J5OA 1R43A 3R2CJ 2AV5A 4F0HA 4ID8A 3MI7X 2WW8A 3MWBA 2A6OA 2EVZA 3H8YA 1TQLA 3DRPA 5DETA 2HBZB 1RXOB 1WEZA 2BXJA 2RQ4A 4F3OA 4UTGA 2GAGC 3CIZA 1VBZA 1JLQB 3D1HA 2MPUA 1S57A 2RF2A 4KV8A 3KLIB 3MFIA 3J7YU 2LQJA 3CJKB 4FF1A 3HSZA 5EHHA 1N5VA 3CCRS 5B0AA 4LVOP 1FESA 3NBPB 3TYTA 1TL4A 3NNCA 2OPSB 2G13A 2NQPA 1TL5A 3Q24A 3BKFA 3C8YA 1LWCA 4YB1P 3MPUB 2K8GA 2OPRB 4DF8A 2CQDA 2UVWA 1OSDA 3C14B 4LF6F 1SC4B 1S5ZA 3LWMA 3NKYA 3HO1A 1SJQA 3KFWX 2H51B 3HSDA 4OHVA 3HK2A 3DLGB 5H9FJ 4WTOB 4WYWA 1N54B 4ZOSA 3PV8A 4J37A 4HLBA 3KLFA 1F5AA 1H6KX 2F4VF 2LEBA 3AQOA 1D0EA 4E98A 3HZGA 4OI0A 2FHJD 3L7PA 1UA1A 2DHXA 2DNMA 2MLXA 2W8KA 5IS2A 1CC8A 2NXNA 2V63A 1Y3KA 4GRSA 3T19A 2I9SA 3C16B 4ZVPB 4I69A 4ZN1A 4X62J 5A2QY 1KTVA 4DR3F 1NNDA 4J7CA 3ZTQA 1G2EA 5LJ3Y 2QYCA 2C42A 2ZBQA 3HF5A 4OZ1A 1RCXB 2YWHA 3DGPB 3DOLB 4C48A 1U6ZA 4FF3A 2XB2D 5KFWA 4DR2F 1X4HA 3MEGB 2HWTA 4J9UE 4TLQA 2EI5A 3M8QA 2EKNA 2E44A 3NS7B 1RTZA 2KL8A 2OIHA 2IRYA 1DTQB 2DYAA 1RJJA 3CJ8A 5K14A 1RT1B 2IJRA 5L39A 4X4QA 3J7A1 1SXLA 2CQ2A 2F9JA 3R5JB 3N01A 3HT0A 3GZ7A 3N6LA 1APSA 2HZAA 4RU9A 2KTQA 2VBXA 5LMNF 1CULB 5HL7Q 5HAOA 4R5PB 2B4OA 5BR8J 2MHEA 3TI0A 4B3MJ 1FD2A 3RR8A 3WX4A 4DUYJ 1YJNS 1CVJA 3J7AN 1TKTA 2B51A 4A47A 3RR7A 1U1PA 1PCAA 1QTNB 1G4CA 4Q43A 2FZKB 3BBCA 4AUKA 5DRKA 3H5XA 1L3KA 5IQQA 1B7FA 2LYVA 4AQYJ 2E9ZA 3M1VA 3NLCA 2FQQB 2G0IA 4X4VA 2NSBA 1RHRB 3IRWP 1BY9A 2CADA 1P9QC 5JXSA 4LT6A 2W9BA 3WQPA 2YKMB 3QJPA 1YJTA 2XY5A 3PO4A 2PMZD 3QZ7A 3QFHA 2MGZB 3CCES 3OUYA 4ZJLA 2DNPA 5L1LA 1NJXA 1UCNA 4LRFA 2ZH8A 2D3ZA 1IQZA 5F3TA 3JQMA 4B02A 4C98A 4RW7B 5K20B 3MUTP 2DISA 3PJ9A 3MM6A 1D8YA 1RTIA 1VDHA 4ZJOA 3ONQA 1I1GA 1PAEX 4M8LA 3NNHA 1RT7A 2AJ2A 4KC5A 1Q7YT 1H3DA 1RK8A 3PHTA 3U1NA 1QVGR 3RAXA 2H5JB 3MR2A 2OPQB 5KFGA 4H4OB 2AJ4A
chains in the Genus database with same CATH topology
4DL3A 3C3LA 4LF9F 1S9GA 2LLZA 1FKOA 1SB6A 2N4DA 5HMYA 2XMTA 3RB3A 4NCAA 5FLXY 3E2EA 1S9EA 2X1AA 1RT3A 4OX6A 4X65F 4DFJA 4K2XA 4IFVA 3RB0A 5KFPA 1PO6A 2W25A 3IS9A 1OQ3A 1MNEA 1WG5A 2HGNA 4TQRA 3OLBA 3CDEA 1P1LA 3MD1A 3I87A 3QGPA 3UDLA 4C11A 1YJVA 1NB7A 4WU3A 3JAMY 4X64F 1R31A 2C2DA 4DV0F 1S10A 3M2UA 1DLOA 2YKPA 2R8JA 3TAMA 4B9MA 1G1XA 3BSNA 2C28A 5KFYA 1RT2A 2DGUA 1S1TB 3U27A 3MEGA 1VQLS 1AUDA 4O0IA 1Q7LB 5L1KA 3I5CA 2ZH5A 1L5UA 3SI8A 1S79A 2VZ9A 4OJ3A 2OPQA 3SSQA 1SUQB 2FDNA 4HDGA 4USHA 3KG0A 5HMWA 2DH7A 1X0PA 1RT7B 3TAPA 2PDAA 3BSAA 1V3RA 3FVYA 3IA0A 4K4UA 2L9DA 1S99A 4E0DA 1JXLA 4RW7A 3TVYA 2CQ0A 2MY7A 2P9CA 1FKPB 4YMEA 1NRKA 2VKRA 4J9PA 2YKMA 2HHPA 1ZAWA 2JFDA 1XC9A 2RB7A 3LUYA 1Y5IB 2DHGA 4IG0A 5F0UA 2O5DA 3QIDA 2RIJA 4HKQA 3OTOF 2Y1JA 3MM7A 3M6UA 1S6PA 2VQFF 1R6YA 1X4AA 2R2TA 3FEYB 3MZIA 4G1QB 2CQPA 1S6OA 2E1RA 5EWFA 2PIIA 4NXNF 1HNVA 3D5MA 2V8VA 1HQEB 2R4FA 1T8EA 2E29A 1URRA 5DS7A 3TUZC 1X4CA 2KRBA 2QO3A 4WU2A 2HYIB 3W2WA 2X1BA 5KOWA 2FLOA 1C2PA 2ZH8A 1Q78A 2DCLA 1BLUA 3G8SA 3MD3A 4OV1A 3V6JA 5KTQA 4ETXA 3DMJB 4LJMA 2BANB 3SYZA 2DH9A 2LQBA 3DLBA 1M5OC 2DJWA 1FJGF 1SJRA 4OJHA 1WG4A 4C8KA 2UUCF 3PY8A 4TU9A 2DRAA 1T03A 4A8KA 2ZC3A 3KYLA 1VQ9S 3MR6A 3PVXA 2F8MA 4RWXA 2XEXA 3BN7A 1SL2A 3O8WA 4L6V3 5C24B 1K73T 3LALA 2M3DA 1E6YA 2X1FA 1TKZA 4WYLA 4Y65A 1RQ0A 4NLSA 1K9MT 3MCSA 2W9CB 4HDHA 4RW9B 5KFKA 1TL3B 4X4RA 3KMSA 3KNAA 2UUTA 3LGMA 3MTKA 3EYZA 1UKUA 1L3UA 1S9EB 3IWXA 1VC0A 1SKWA 4ZP8A 1UMJA 4OZJA 4WTYA 2ZM6F 2BJDA 3BSOA 1RKJA 2M4MA 2FJDB 4ED6A 2CPXA 3K2YA 2CIMA 3OR1B 2CQGA 1FRLA 1WTBA 3CC2S 4YQWA 4MIWA 1WNEA 3NMRA 1KSPA 2O01C 3M05A 3N9UC 4GO5X 2FLNA 1TL3A 3QPIA 2MJNA 4F4YA 1HFEL 3VAHA 3PJWA 3MMAA 1VS3A 3O6QA 5KFRA 3GIKA 2RUGA 1QSSA 2POKA 4ALZA 1FRIA 4NWBA 4DQPA 3G71S 1R27B 4HHJA 4MH8A 1XN9A 4RNNA 3MM8A 2UXCF 2XWXA 4O4GA 3TUIC 1GXTA 2CQIA 4KHPF 2AYMA 5KFXA 3H2LA 5KFTA 2ACYA 3DFEA 4Q5VA 1KRPA 5G4DA 4DG1B 1YRXA 3Q8QB 1TKTB 3G6ES 2GV1A 3GG1A 1VHFA 1V9OA 3M6WA 4MKAA 1LFWA 2EFQA 3Q23A 1FK9A 2RKIA 2HHUA 3SEOA 3LGNA 1X5TA 3GYXB 1NH7A 1DBDA 1BC6A 2NPIA 3FFIB 1RT1A 4HT7A 1QAJA 1DQ8A 1ZM9A 3E8OA 4OX9F 2JHEA 5DO2A 2CZVC 4C8OA 1KS2A 2H5EA 1XTZA 5K5MA 5DDQC 4YHHF 5DGAA 1SI9A 1U1OA 1M5KC 3QYYA 2FHJA 3CD0A 1D9FA 2MDAA 4G1IA 1XWLA 2WBMA 2HQ3A 1KOHA 3DN9A 5DDPC 4QIEA 4DL2A 1LWEA 4DL5A 1ZM4A 4Q0BA 3LOUA 2JVOA 4X4TA 1XEZA 2AD9A 1I94F 1AFJA 1RGVA 3I82A 5F8GA 4UQGA 1VQ6S 5J2NA 4R25A 4IR1A 5B0EA 1REVA 4ZCMA 4QIVA 3OJSA 1MMNA 5HROB 2ZNZA 3T1AA 2AX0A 3NS5A 1C0UB 3BQ1A 4F26A 5L9NA 2ZKTA 1QLNA 3R5BA 1HMVB 2AF6A 4NRTA 5E5NA 1VQ4S 1HWJA 4DV2F 3Q2SC 4NOHA 1BQMB 3CD5A 5K8MA 3TANA 1JMTA 1VQ7S 4YR0A 1N56A 2HMIB 2C3UA 4KE5A 3GQCA 4UW2A 4NRUA 4OMFG 1XR7A 1SH2A 1HHSA 2KRRA 2IRUA 3O44A 3LQVA 2IRXA 4DSLA 1HNWF 2YNIA 1MU2B 2ILYA 4QYZJ 3PW2A 2VOPA 2WHOA 4RW4B 2VG5A 3NAIA 2ZHOA 4I2QB 3NP5A 2GIQA 4KT0C 2L41A 1T05B 2HW3A 2WBRA 3K5MA 2RNEA 5J1EB 5LJ5Y 4B9SA 4NLXA 4ZPWR 5CZVA 4ED0A 3BGRB 2OFGX 3F41A 2AYEA 3CO9A 3F44A 4EBEA 5KFAA 2DNRA 3TOQA 4CNZA 2FB0A 3BGFA 5KFOA 5J1EA 3P96A 3HVAA 2VG6B 4LSLA 3ETOA 5EUHA 4JV5F 1T05A 3A1YG 2CVEA 3EX7B 4NYPA 1IKVA 4TKTA 1VRTA 3TVKA 2OLWA 1TVRA 2VPXB 2YX7A 2ZITA 4PWUA 2OFHX 3RRHA 5E3AA 4I6YA 1TKXB 2UZAA 3FZBA 5A6WA 2J76E 1GAOA 5E7OB 2R8IA 2PI4A 2QSFA 2UXDF 3FGVA 5B7WA 1UL3A 4GO7X 1SH0A 2KM8C 2AW0A 2CPJA 4X66F 4ZK7M 2CQCA 3QGIA 2BQRA 4QBUA 4X2BA 2FUG9 5KFFA 4DLGA 3IG1B 1E6VA 3OHBA 3E01B 1RTDB 3NCQA 4PQUA 1RT5A 5B09A 2W9BB 2LECA 1LFPA 2ASJA 3G9CA 2LCWA 2AYBA 1PILA 2JC1A 5CYMA 1FTCA 1U1NA 2IVMA 4F4XA 1HA1A 4WF9Q 1IXKA 4DMZA 4K50A 1LW2B 2MQMA 2IM1A 4YDDB 2QMWA 4DUZF 2P5VA 3S7RA 4LF8F 4MMOA 2HLUA 3N4WA 3ZZYA 2MQOA 2XS5A 4IG0B 1PC5A 2O3DA 5GAEI 4LFAF 1YJRA 2HHWA 3CTRA 5CZXA 1TFWA 2EBGA 1O0PA 2O67A 1LOUA 4J9MA 4JV1A 3SDEA 2MXYA 3MEEA 4MYTA 1YWXA 4B3RF 2JLEA 5E3RA 5KFCA 3IBWA 1JB0C 3GG0A 1HBUB 1FDAA 1WTFA 2E66A 2IHR1 3FDSA 4K5RA 3TR5A 4D3GA 2KVIA 2RJZA 4CH1A 2Q66A 3K5PA 2KH9A 3R5CA 2R2RA 1KQKA 3I5AA 4HI1A 3CCVS 1R8HA 4F2SA 2XBPA 1QAYA 2AX1A 3SQGA 3BQ0A 1SL1A 4QIFA 3CUNA 1A9NB 2IA0A 4PPDA 4C97A 2GW8A 2XWYA 3MPYA 3PKYA 2FLLA 5KFEA 1DZ5A 1QE1B 2J0WA 3DXBA 5AE3A 3IWNC 5DG9A 1RA7A 2LXFA 4A8WA 4A8MP 3MMBA 3QAEA 4DHVA 5IQ6A 4IO9Q 1SJ3P 5KFDA 2WB1D 1T3NA 4LF7F 2V2KA 5EGYA 4HH0A 1UJ6A 2P6SA 5DM7Q 1XBWA 3EGZA 1QSYA 1DQAA 4PG8A 2AQ4A 2BDPA 1JKHA 4XDDA 4EBCA 3EZUA 2CPDA 2MZJA 4B3SF 1KTQA 2J5AA 4PXDA 2VPZB 2IAJB 2XSJB 2Z4PA 3FCHA 3PX6A 4XAKA 1SJ4P 3JTOA 1YRTA 1IBKF 2PFFB 1Q8LA 3QIPA 2W4CA 4NMLA 1N36F 2HLTA 4ZCLA 5I4MA 4CZCA 1JLCA 2XMKA 2Y1IA 2RT3A 2LDIA 2X3GA 3OQ2A 2M8DB 3MUMP 1REVB 4LSNB 3ZZZA 5I42A 4HL9A 5J2NB 4D3HA 1MROA 3OHAA 2JWNA 1RDRA 4OL8A 4FNHA 2FVRA 4ZA1A 3UQSA 2DGWA 2ZC4A 1F5BA 4F4KA 4DR1F 4OJ1A 4K59A 1U1RA 5E41A 4NLTA 4QR2A 1HWLA 3KJVB 2ZVSA 4V19J 1YJ9S 1F0XA 4MK7A 3U1LA 1O8BA 2GHWA 3DMJA 4NYOA 4ED2A 1BWEA 2HRUA 3AJ2A 3I55S 1RI7A 2B56A 4IH7A 3TUJC 2IJFA 4IG3B 1ZBTA 1J5EF 5K14B 1OO0B 3J7ZT 4TY8A 4CO5A 4DR7F 1VC5A 5IM0B 4ZPVR 2Y1RI 2G1DA 3QLHA 3LANA 5HBMB 4X84A 1HQEA 2D9OA 5B0FA 2GQ2A 1X4EA 1RT6A 1JJHA 5E3QA 3UFCX 1JWWA 4LUBA 3MR5A 2OJ3A 3QLHB 1IM4A 1VGYA 4A8YA 2E5LF 2VBWA 1Y3JA 4OI4A 2E1CA 3HX9A 4GKKF 1CSJA 4IG3A 2B7CB 3PXGa 3FRZA 5KG0A 2IM2A 3POTA 2VA3A 2D1CA 4KB7A 2GC8A 4FVMA 4ED3A 1Q1KA 1WHVA 2YVSA 4P7VA 2ADBA 2DBBA 3D0HE 2V0NA 3VZIA 4FN5A 4XIUA 1U45A 3FMBA 3G96A 4DEZA 1CEZA 5KG4A 2HVZA 3ISZA 4DN9A 1FDDA 5AE1A 1WF1A 3X1LB 3M8RA 3Q0AA 2MB0B 2YKQA 4QW9A 3GILA 1S1UA 2ZH3A 4RNHA 3SMZA 1S0OA 1UFWA 1KEKA 2JSXA 2YH0A 4ZMMA 5C5JA 3DI6B 1MROB 2PA8D 2R7QA 4WFXA 4ZP9A 4B17A 1JLQA 3ULHA 4X4SA 4KTQA 1WHYA 3ZZRA 2E9RX 1C1CA 3KK3B 2BABA 3DRPB 2DNZA 1U2RA 3KG1A 4JI2F 1VRUA 1CC7A 2DR5A 2JJ4D 4JOUA 4QQBA 2Q43A 2HVHA 5T7LA 5LMUF 1AXQA 1HWKA 4PWDB 2VFUA 1OPIA 3DOKB 4JI0F 2XGQA 1YVFA 2XSJA 3ZFVA 2FLPA 5JJBA 3SV4A 2JRSA 2VPWB 2CQBA 4TU8A 3VAKA 5F8MA 3H4DA 3AA8A 3NAHA 2XMWA 2QMXA 4J9OA 4JI8F 1TFYA 3HVRA 3M8PA 5AXLA 2FJVA 2I2YA 4RKUC 2CJQA 1S9GB 3FSXA 4L3NA 1VBXA 4IRCA 2KYXA 4C3LA 4JUZA 2FPHX 4MTPA 3M32A 5L38A 4RW6B 4W90B 3GIIA 1DARA 1VJWA 1YQHA 1NAQA 1TZ0A 3MM6B 3PIOQ 4IDKB 1RTHB 1WF2A 2YNFB 1URNA 1M5HA 1FEHA 1JLEA 3I9ZA 2YWGA 2YH1A 1JJ4A 2XI3A 1FO1A 5KG3A 5DJBA 1ZTWA 2G4BA 1P1TA 1Z1ZA 2K2PA 1YJWS 2CRLA 1ZPVA 1HQUB 3CCSS 4NLVA 2J8AA 3PIPQ 3HPOA 3V5RA 1QY7A 3BS9A 4A8QA 2HWIA 1J2VA 2VB6A 7FD1A 4DSEA 5K8OA 4B3TF 1SH3A 3T6BA 1SJFA 4CH0S 2PE8A 4K4YA 1E6YB 2W4PA 2HFNA 1NJYA 2KT5A 5C24A 4BC7A 2UUBF 3M9MB 2RILA 4M5DB 2RS8A 4NLQA 5KG6A 2VA2A 1AROP 5KG1A 2JVRA 3HXMA 3K58A 1OIAA 4TYBA 2R7OA 2GJIA 3V6DA 3O1LA 4Q2LA 2VONA 5F8JA 3B78A 5GAHI 5A8WB 4GKJF 1TAUA 4ES2A 4XDCA 4NA1A 1S0MA 2XMVA 3I5BA 4FBUA 5LSRA 4FYDA 5CYMB 5AE2A 4L72B 5C25B 4WKYA 1EP4A 3CJ4A 3K5LA 2B0GA 2GO8A 2V8HA 1KR4A 2ZD1B 5M2UA 2JEFA 5J2MA 1SKRA 3PW0A 2R7XA 3KLFB 2CPEA 5I3PA 4ID5B 3W2VB 3VZHA 1TL1A 3CCZA 3M2RB 2F9DA 4WZMA 1PSDA 1CG2A 1R8BA 2GQCA 2AYGA 2UUAF 3K8WA 1HPZB 1R8PA 3ZC4A 3DM2B 3JSMB 2FC8A 3DRXA 5CYQB 5FDLA 4LF5F 1N0VC 4Y00A 2CPIA 2NZ4A 4R0JA 4OX7A 5I3UB 1FKPA 3LP2B 1TK5A 4AL6A 5A8RB 1FXRA 2FJWA 4KV8B 3OL7A 2VASA 2LA6A 4ILLA 1XMBA 3P5TL 4I2PB 5K8NA 3CDUA 1XMQF 4EZ6A 2Z2MA 3R27A 3D1QA 1O51A 3GFZA 4J5OA 1NEEA 3FNNA 3CJ2A 4E8UA 1U7LA 4EWTA 2WSFC 1X9SA 1DTTA 2DNHA 2VBYA 1D9DA 4X4NA 2V4RA 2EK6A 3PRDA 1CQMA 1K8AT 2DGQA 3DLJA 1UWBA 5KOXA 1IKXA 5U47A 5JVHQ 1U1KA 2KO1A 3HI9A 2MMYA 3CPWR 2R2SA 4CTAB 5GMKa 4NLOA 2RH3A 3GFYA 3UCZP 2ABYA 2IMWP 3D0IE 3AHPA 2OH2A 4URGA 2ADCA 3R5AA 1HMVA 1HD0A 1GH8A 2AU0A 1IBLF 1LW0A 2DK2A 2PN6A 3ITHA 2E1AA 4TLRA 4TNOA 1B0PA 4JV2A 2QFJA 4DR6F 2ALZA 2E9TA 3HHKA 2R8GA 1U48A 2MJUA 2BBEA 1EETA 3BSCA 2YKAA 3FQKA 2M5YA 2DO0A 4OX8A 4F8RA 3LP2A 4UQTA 2CQ4A 2HHQA 2K1RB 4PG5A 3N0VA 5CA5A 4YR2A 1SC6A 2F8EX 3H40A 3IC1A 4DLEA 5KT2A 4OHXA 1P8GA 1JLBA 4OJGA 1HQUA 2FIUA 2XMJA 4FVCA 4UUWA 4K4TA 1GX5A 1QAIA 4YOEA 2W7PA 2V9KA 2ERRA 3H98A 3M2RA 2MKSA 5D3GB 4FXVA 3OSPA 1UA0A 3MM5A 1ELOA 2HS4A 2PSZA 2Q79A 4FXWA 1VIOA 4ED7A 1ZPWX 1H7WA 5E2QA 3CMAS 2JOQA 2DGVA 2WONB 3HVTA 2NUUG 4MIBA 5KFBA 3NGKA 2IM0A 2ZJRQ 4BC9A 3JSYA