4DV5F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv5F00
5LMUF 4OX9F 4K0KF 3T1HF 4LF9F 1RISA 4LFAF 4DV7F 2UUAF 4JYAF 2VQFF 4AQYF 4JV5F 1QJHA 2B7BB 3R3TA 4LFBF 5LMNF 2VQEF 4LFCF 4DR5F 1CQMA 4DV1F 2UXBF 1XNQF 2YY3A 4YY3F 3T1YF 2UXCF 4JI1F 4JI7F 4DR3F 4JI3F 4DR6F 1FJGF 1XMQF 4X62F 2UU9F 5BR8F 2F4VF 4DR4F 4DUZF 1IBMF 4DR1F 2UXDF 4GKKF 4LF6F 4LF7F 3ZZPA 4DR7F 4DV4F 1N33F 1F60B 1I94F 2BXJA 4DV2F 1IBKF 1N34F 2RJZA 2UUBF 1XNRF 1B64A 4DR2F 4DV3F 4JI6F 2ZM6F 4JI8F 5IWAF 1G7CB 1HNWF 4JI2F 4B3TF 4DUYF 4GKJF 4NXNF 4YHHF 1IJFB 1FKAF 2KJVA 1IJEB 2BVZA 2HHHF 1XMOF 2E5LF 2UUCF 4NXMF 3OTOF 2KJWA 1N36F 4B3MF 4KHPF 4LF5F 4JI4F 4DV6F 4JI5F 1HNXF 2J5AA 4LF8F 1J5EF 1HR0F 4JI0F 5AJ3F 1HNZF 1G1XA 1IBLF 1GH8A 4DV0F 1LOUA 1VMBA 4X64F 4LF4F 1CQNA 4X65F 4B3RF 4X66F 4DV5F 4B3SF 2B7CB 1N32F
chains in the Genus database with same CATH superfamily
3KK3A 3KK2B 2PMWA 1J5OB 1ICEB 1M5SA 1FERA 2KXHA 1TQLA 2WSFC 3NEKA 2RU3A 1MWQA 2FIUA 2R7XA 3RB0A 2W8KA 4WTOB 3RR8A 5KFJA 3BGOP 2FC9A 5CYJA 4RNOA 1YJWS 1REGX 3D6HB 2ZH8A 4R8UA 2HMIB 4NZ6A 3LF0A 4HH1A 4JUZA 4G1QA 2D9PA 3FRYA 1FF2A 4NMLA 4IH6A 4ETXA 3M8RA 4LF5J 8ATCB 3KNGA 1S1WA 4FKYA 2Z2MA 4NX9A 3ELHA 4I6YA 5HVGA 3LGHA 3BO3A 2I6WA 4PQUA 1F5CA 4QW9A 2O01C 4DQSA 1E6VA 4LR7A 4L74A 1M5HA 1Z1ZA 3BR8A 4ILRA 4RBVA 4CP5A 1T3OA 5HL7Q 2IJFA 4A4JA 3OHBA 3PX0A 2KFYA 3MPUB 4MAKA 1UMJA 3T5JA 1Y9OA 3L7OA 8RUCA 5LMNJ 4DV2J 1LWEA 3IM9A 4DV1J 5HJYA 3TAQA 1LXJA 2ZKTA 4TY8B 3DKDA 4GMKA 1YRXA 9ATCB 3IXQA 1WHXA 2ZFHA 2CPIA 1RUSA 3NS5A 4B08A 1ZM2A 3GFHA 1K44A 1OPZA 4YHHF 3D7SB 4C8YA 3K5NA 1KQKA 1UFLA 4X4QA 3DLEA 1WG1A 4ZK7M 2J0QD 3DLJA 4OFZA 2MKJA 9RUBA 4HYKA 2D3UA 3KLVA 3R5BA 1GXUA 2PE8A 3MEEA 4FXWA 4J9UE 2X1GA 3H25A 1CG2A 1LQ9A 2EFOA 2YWHA 3AFGA 2P6SA 2JNJA 5IQ6A 3TUIC 4Y2CA 1TK8A 1Q78A 4JI4F 2NYHA 2D3ZA 2HQCA 3LTOA 4MTPA 5A0YA 2OFHX 2GA7A 4KPCA 2B3TB 4O3RA 1RISA 1RWMB 4PXBA 3C19A 1IKXA 3CD6S 4OX8A 3U02A 2PC6A 5E7OB 5HVHA 4OYPA 5KFUA 2AYBA 4LSZB 2DR6A 1T03A 3IG1B 1FKOA 1X4DA 4QWDA 5KOXA 1GMWD 4DR4F 3IMQJ 3H5XA 4FF1A 4YDXA 4TU8A 1KONA 4PXCA 1F9FA 1T9YA 3DHWC 1RAGB 3NY0A 3HT0A 1CS4A 4ZS6A 3D6MB 2XC9A 4RUAA 4P73A 2E5LJ 3X3UA 4DL5A 2P5VA 1RWVB 2GHWA 1HQUA 4J9MA 2VBWA 2ZH5A 1WC0A 1R27B 4JI5F 1R0AB 5B0GA 3S1TA 4JI0F 2H5JB 2VPZB 4ZMMA 3C6UB 3C16B 4KO0A 2FHJD 2ZHAA 2BANA 1TUGB 2DCLA 2OPSA 2PD1A 5AE1A 2WVFA 1NLKL 1WELA 5ETOA 2V5HG 3P3DA 4DCOB 2X1FA 3FCHA 2AKWB 3MTKA 2IMWP 2E9ZA 2E1MC 1TELA 4MKAA 2F3JA 1NB7A 3KHRA 2V4QA 1UTAA 3K7RA 2RUSA 1G6BA 3BZQA 3V6HA 2HAFA 4IO9Q 5L1IA 4USVA 3G8SA 3DHXA 4ZN3A 3QZ8A 4W90B 2QO3A 1N34F 4PRFA 2W7PA 5E33A 3QO9A 1W2IA 4ANDA 1NDCA 4ZCLA 3UN5A 4DXLA 3HZEA 3MFIA 2ASJA 4X2BA 4Q8EA 5A6PA 2V9WA 3DI6A 2W2QP 1DJ0A 1WC3A 5J2MA 1WORA 4Y2AA 2MSTA 4YHHJ 3FSIA 3NG8A 3ILIA 1S9EA 3EZOA 1UKUA 3K2YA 4K5SA 2UVWA 1BQNB 4CLPA 3M6WA 5D6GA 5DGAA 4OIXA 5HBMB 1HBMB 3EVOA 3I0RA 1HNVB 2VBYA 1NKCA 2KXNB 4AQYJ 3C66A 2DO4A 5C25B 5T7LA 1OY8A 3JQKA 3DOMA 5H9EJ 1CJUA 5AT1B 2V6AA 4JV5F 1FJGJ 4DS5A 3RAMA 1VYAA 1CQMA 1GXLA 1SXLA 2DNKA 3PFEA 5F8LA 1U49A 1UVJA 2R8JA 4M5MA 3BKFA 4FYYB 4NZ0A 3T3FA 4NEYA 1DFDA 5HMWA 1IBCB 4G65A 4DSFA 4DV3F 1ZBTA 2M5YA 3SDEB 2W01A 4RLEA 3OUYB 3QATA 4PYDA 4U67Q 4USMA 2CJYB 1V5IB 3L09A 4KHPJ 5L9XA 1SL0A 4ZJQA 4KH0B 1N0VC 4FKXA 2RUGA 1MNEA 2XMUA 3VHQA 1WC6A 4DEZA 2QFJA 2HFNA 3I87A 5BYQA 2QLXA 1VRTB 3M32A 5HANA 2GVZA 4M95A 2HHPA 3T1YJ 2XSJB 3VWSA 4YR3A 3MM8A 1NHKL 2FZGB 3UFCX 3GSIA 1XNQF 3EWGA 3GR0A 2VDIA 3E51A 1D1UA 4ZVUB 4DHVA 4QU7A 5I42B 4DV4F 2K3KA 2YPZA 2AJ4A 3KG0A 4YMEA 1TZ0A 2VA2A 2BYCA 2AW0A 4EBEA 1IUJA 1Q95G 2HWIA 5ITHA 1EQ0A 1HI8A 4K4WA 2DNRA 3KFWX 2W2PP 2VC0A 1LK7A 2MHEA 2MZSA 1FWKA 1TUWA 4DV6J 3PYEA 3W8GA 2MZRA 3GCXP 4KFBA 2R7TA 3TYTA 4ZPWR 4Q43A 1Q8KA 1H3DA 1QSYA 4H54A 1UVIA 2JEIA 1ZPWX 2G0IA 1GH8A 4OZ5A 2CQ0A 4KGXB 2VJUA 3TO8A 1SVDA 2VQFJ 2ZZMA 4U7CA 4OI0A 4DL2A 5GADI 4FVCA 4OX9F 2J6UA 4JYAF 3QFWA 4IG0B 2R9LA 3AJ2A 3HK2A 3IO1A 3QQCD 4XPCA 1HARA 4BLGA 1QUPA 4RW4B 1HPZA 5EHHA 5KFCA 4OQJA 2VKRA 1X31C 3OFEA 2CDQA 1SJ4P 4C0HA 5DG8A 1MN7A 2KM8C 2MLZA 4ELVA 1L3UA 2HEKA 2OJ3A 4AL7A 3OR2A 3IRXB 1U25A 3AJDA 5HI7A 4F3QA 2CPFA 2M3DA 3P4UB 4PG6A 3BGRA 2DO0A 3HHLA 2ZHBA 4FN5A 3FEXB 2X1BA 4M1KA 3CJ5A 2IC3B 3M9OB 3NGKA 1BQMA 1FKPB 1S59A 3JSMB 1HNXF 2QA1A 1IM6A 2CQIA 1RAOA 2IHR1 3O2IA 2RS8A 2CIMA 2DK2A 2DNZA 1JLEB 2KDOA 3KHHA 2HFVA 3LWMA 4WYWA 3FMBA 2H54B 4LFCF 1R3NA 1NJIT 3RYLA 2JVRA 4CO4A 4DSJA 4JI7F 1F3VA 5HAOA 5ADZA 2ZD1A 1IBKJ 1GMUA 1XNQJ 1VQSA 1QAXA 4JI6J 3CCES 1YDLA 2J76E 3UN3A 2AJ2A 1S4EA 5LXRA 3CPWR 1F3FA 1TMMA 2ROEA 4DV4J 4DPUA 1XQIA 5IWAF 3IC1A 1FJCA 3SCIE 3BGUA 4C0BA 2VBXA 4H4OB 2OD4A 4ZVQB 1URNA 1C4CA 3MM9B 3DRXA 3UE2A 2XYGB 1UZDA 2CG8A 1TMJA 1VQKS 3LANA 6AT1B 4ECRA 3MFHA 1JLQA 2YKNA 4OYWA 1FEEA 4B3SF 2H3EB 5IT9Y 2B43A 2Y1JA 3V81A 3T9ZA 2BOPA 4H4MA 4JI3J 2YX7A 5CYMB 3VAFA 1PJ5A 2OTJS 3THPA 2AWZA 3ETMA 2CQ3A 3UCUP 1AB8A 1RWOB 4HR2A 4AUKA 5KG3A 2BZ2A 2ZZTA 4G1IA 3A13A 2F9JA 2BW2A 4WE1B 5JUMA 2OH2A 2ZDPA 5KFFA 4CLKA 3OFFA 2FVCA 1T9UA 2CYYA 5K5MA 1BMQB 3N79A 2DGTA 2HBQB 1RHJB 1RB0A 3ULHA 3Q23A 4CCHA 1W7WA 2MYFA 4LQ3A 3CC2S 2BQ3A 3IGNA 2BDPA 2W4DA 1P1LA 1KD1T 4KKOB 1MMNA 3IP0A 5B0BA 3CO0P 1EAYC 3W60A 2LEPA 5ETMA 3OFHA 1JK9B 2BJDA 1Y5LB 3RAQA 2Z58B 1WOPA 3DLGB 4LF9F 3CXCR 5CAAA 2D41A 2AGPA 5C5JA 5DLFA 2HBZB 5U47A 1RWUA 5F3TA 1UFKA 2J0WA 1KTVA 4HHUA 3KWMA 4DS4A 4JV1A 3MZIA 3G2XA 1JX4A 2YNGB 2IFXA 2R2SA 2VZ9A 3Q24A 3M05A 2YWEA 3HVAA 2HS3A 1IKYA 4QYRA 2EFNA 3UI3A 5MAOA 4E98A 5CD4H 3O5TB 2OP5A 2DB1A 1FI4A 1S1XB 2VPYB 4TYAA 1VIOA 1IM4A 1QLNA 2LQ5A 4ZP6A 3BDPA 3MR3A 3FFIB 3FZBA 3FRZA 1CJVA 2MPUA 5AJ3J 4YEAA 4J9SA 3KK2A 4C98A 1B7FA 4NLPA 1J5OA 1X60A 3MTJA 1TAUA 1R6VA 4UQGA 3M2RB 5KFDA 1VIXA 1F5AA 1RT1B 1ROFA 3L9ZA 2Q6BA 2QX0A 2YNHB 4X66F 2QA4S 3V4IA 1U0SA 2DRDA 1L3VA 4TY9A 4A8FA 1D8ZA 2HMIA 3FC9A 4P7TA 2HK2A 3MOZA 2DNGA 1S49A 1Q82T 4OLOA 1NCLA 3KLEB 1ITPA 2FUG9 4KE5A 1Q7LB 2VUGA 1M1KT 1FNOA 5K14B 3THVA 1B0PA 4ALZA 2UVRA 2HHSA 2DR8A 2PT0A 2CJBA 2OGUA 3A8EA 3OT9A 4ZPAA 3GJQB 1PIEA 3U27A 2HHVA 2DXFA 2DHXA 2JEGA 5DZ7A 2DRBA 4QWBA 3VGUA 2F5GA 3CW2C 3R2DJ 5FD1A 3H40A 2GX8A 3RZAA 1FDDA 1T7PA 1RAJA 2RQCA 2C2MB 2AYMA 2I0XA 3GIKA 5M2RA 3H2LA 5GAHI 5EWGA 4E2FB 2RNEA 4O0IA 4ZLLA 3WQPA 4BBYA 1IVZA 4TY8A 5DQIA 5ETQA 3DRYA 5L39A 1M1HA 2VQEF 2KVIA 3J7YI 3RRKA 4LF6J 4WFNQ 3ILJA 2XHCA 4C48A 3D68A 2GIFA 2YTCA 3M6XA 3RUBL 3UDEA 3UR3C 1YK9A 4WKRA 2HLUA 2W25A 3ICLA 1Q81T 4DQPA 3UCGA 1WNEA 1WEXA 1Q8IA 5F9NA 5KFYA 4IRCA 2Q6CA 3SEOA 2E5JA 3PHEA 5KFNA 3EJMA 2UP1A 1AYEA 4ECZA 2ZNYA 4M5HA 2X51A 2CA9A 2GCFA 4J9NA 1YIJS 2FC8A 5KFBA 3WHIA 3EYZA 4WF9Q 5KT2A 2IA0A 2DHGA 2I38A 1IKVB 4J91A 4LF8F 3ENVA 1MMLA 2CWKA 3HFVA 4CLFA 2E9TA 3CJ8A 1KTQA 3IG1A 3DRPB 5DO2A 3CF5Q 1QE1B 2WB4A 3TJ9A 2ATCB 2XMMA 2CPEA 1T02A 1ZM9A 3DLKB 1SC3B 1BD6A 1YJ9S 5HLFB 4WZMA 1VQ9S 1NH7A 2IM1A 3ZZTA 4GKKF 4TNOA 4IOAQ 2XO7A 5IT0A 4N41A 2YWWA 1BXNA 3ILLA 4USJC 1R0AA 3NOGA 1R8PA 3D0GE 2Y3YA 2R7WA 1IR1A 4WWSA 1NSPA 3C6UA 3C16A 4MJKA 3US5A 4TKTA 1WJ9A 2CQHA 4LRFA 4CQ1A 2RKIB 3DU6A 3T19A 2QTWA 4LR8A 3KG4A 4QCLA 1GX6A 3UD3P 4ZPVR 4I68A 3W3SA 1HBOB 1VHFA 4DN9A 2XLKA 3OSPA 3PHTA 4HACB 3PIPQ 2V8DA 4HHHA 1EIYB 2AZ3A 2UUTA 1BHNA 1WC4A 3DDIA 2XS5A 1NBEB 3K57A 1SH3A 2A0FB 2QN6B 1PAEX 1KVJA 2YWKA 1AXQA 4QR0A 5B7WA 1WC5A 4OL8A 1LFPA 4DR6F 2JVOA 2VQEJ 2NSBA 3DNCA 3TUJC 4OX7A 1QAYA 1F2GA 3TQEA 4Y2MA 3MI7X 1M5VC 1NAQA 4WFXA 3AB2B 2RD5C 1S12A 3U1LA 4ZITA 1EKSA 1BQNA 5HBMA 1M5KC 4ICLB 1HBMA 1HNVA 3TAPA 2XB2D 2XMWA 1NJYA 3QAUA 1FVSA 2GO9A 3GMGA 1JLBA 3G9CA 1UVNA 3T5KA 1T05B 2WW4A 3O6QA 5KFKA 1ZA2B 4BS2A 4ZVEA 3FEZA 2GIQA 1T11A 3CD5A 4OMFG 1KS2A 2KO1A 3R5DA 1VQNS 1R0CB 3R5JB 3DXSX 2VFUA 4NCAA 1T0TV 1PC5A 1YVFA 4ZCIA 2Y1LB 3DXBA 3OUYA 1QTNB 1KNZA 2BJ8A 3KLGB 2Q3PA 3RBXA 4RO0A 4URQU 4MIBA 4I67A 2JJ4D 1RWNB 4FF3A 2FHKA 1XNRF 3K17A 2JLGA 3TANA 3BBBA 1YTYA 4A48A 5GAEU 1VR6A 1KP6A 2Z2ZA 2RSQA 2AHOB 5L46A 1VRTA 1AW0A 2C2ZB 2HHXA 2NZ4A 2MQNA 1HR0J 3QT6A 3RJMB 3SSSA 1SKWA 2YKAA 3M8PB 2XLJA 2XSJA 3HLUA 5L1JA 3V6JA 4B9NA 3Q2TC 1TU0B 4KHMA 4QYZK 2H1YA 3TX8A 2AGQA 1S5ZA 3C8YA 5I42A 4MIAA 2HQFA 1D9FA 3PEJA 2ZE2B 4QOTA 3ZTOA 1IXKA 2CNLB 1DURA 3CO9A 2UXBF 1FJEB 1SI9A 4CO2A 5BYSA 1UAWA 3I5CA 1N33J 3I55S 1FK9B 2BABA 1S0OA 3SBMA 1MW7A 4A8YA 3IN5A 5A8KB 2ZVSA 4IYQA 3ENWA 2FVSA 4FYWB 4ZVOB 4N77A 3GU0A 4ZIWA 4P71A 2CXEA 2QMWA 3NBPB 1XMOJ 2RRBA 3QSYB 3EDQB 3P6YC 5GMDA 1P6TA 1U7LA 2FY8A 5EWEA 2V69A 4IG0A 2CAJA 4ANCA 2QRRA 3FJ2A 4U6PA 2XZDB 1JMTA 5DDOC 5A6WA 2FLOA 3UN2A 3OXFA 4RW4A 4XPEA 1K8AT 2WHOA 2VFTA 4C4WA 1JLAB 3R9LA 3OVBA 2CJQA 2OEJA 3MCMA 3BN4A 2E7WA 1H2TZ 3IRXA 1WEZA 2B8QA 1R8BA 3JYTB 2G1HA 5E41A 1VHIA 4CLZA 2QGFB 2J7WA 3VGTA 3J80Y 2LXFA 4CM2A 2JZ5A 1HNWJ 2IC3A 1FKPA 3AXMA 3PV8A 3H5UA 3JSMA 1YSJA 4TU9A 1B0VA 3QIDA 2XNQA 4DI6A 2GZOA 2J0XA 1XNRJ 1X4BA 4YN3B 3N4WA 4DSKA 1JLEA 1FCAA 2AIRB 2MHNA 2XZTB 4C8KA 1JNRB 2ZWOA 1Y7PA 1M5OC 3I5BA 1RK8A 1RCOB 1RAEB 4MIWA 4RU2A 3HFKA 1OSDA 4LF4F 1CC7A 3GCWP 3HKWA 2VC1A 4ECVA 4LFAF 2OPRB 5T41A 4U9RA 3R5AA 4ES3A 5KFHA 4CTAB 1PJ7A 1Y3KA 5LJ3Y 3FCWA 4DPYA 1UVLA 1GTHA 3I9V9 3MPYA 5KFXA 4H4OA 1IBMF 4JV0A 3ZZYA 1B0TA 3MM9A 3GR1A 2PDAA 3EVWA 2IA6A 1N4LA 4R8UB 3AOAA 3CDEA 4NLOA 3BDEA 1NDKA 5AXNA 2J6SA 2XWYA 1TR0A 1ZA1B 3G71S 4IR9A 1C1CB 2NXJA 4F7VA 5IC4B 1S1WB 3RR7A 5FIIA 3AA9A 4ZP7A 2ZBRA 2CQDA 5CYMA 2RRAA 4Q8FA 4DV5J 2H5IB 4OZ1A 1TTHB 4LSLB 1L5UA 5KG6A 2F4FA 3CULA 3OTBA 2C28A 5AXKA 3IAS9 3OTDA 5KT3A 3NCPA 2XSFA 1CC8A 4JI1J 4WE1A 3ZTQA 4DR5F 4CLTA 4DSLA 3H5YA 2A3JA 3BJYA 2QLJB 2UXCF 1PSDA 4DR3F 1NZ8A 4R0EA 2DHAA 4O44A 4MKBA 2FLNA 4CLSA 2NSCA 4TQSA 3HX9A 3AOCA 1KDNA 2XYHB 1NSQA 2QSWA 3GJRB 4F4ZA 1FXDA 2CQPA 4F67A 1SL1A 3TNVA 4KKOA 2G4BA 2GO8A 3QLHB 4NXMJ 2EK1A 1OQ6A 1RTZA 3EZUA 2VA3A 3DLGA 4QIEA 3MUVP 4UZBA 2WVEA 2VFRA 1RADB 4KYZA 4O4RA 1M90T 1NJXA 1G1XA 4HDHA 4WIIA 1GNKA 3OL7A 5D0GA 1DTTB 2YNGA 5K8PA 4O23A 2HIQA 4LF4J 3KLHB 5D0EA 1F6TA 2PEBA 2WK4A 2M9KA 5A0YB 4F36A 1PBAA 1PO6A 2NYIA 2K3IA 2L9NA 2C2DA 3NGSA 1KHWA 4M63A 1FRIA 5F8JA 1VQ6S 5F9LA 4Q7AA 1S1XA 2F9DA 4C11B 4ECWA 1NDPA 1S1UB 2AD9A 2HW3A 1ZAWA 1KKHA 3NMRA 1C0UA 1LWCB 4EK2A 3HM9A 3FFIA 3DRSB 2HLTA 1I94F 1H38A 2R7SA 1SKUB 1WG5A 4DG1B 4J90A 2LMIA 2IIHA 2QA2A 3K58A 3R7BB 2ZBPA 2AJFE 3KTQA 4OI6A 2HFSA 1RT1A 3TEGA 3BB5A 4NLYA 1RSCA 3EX7B 1CS4B 2Y1RI 3H90A 2QL5B 2YNHA 1U2FA 2R7UA 1VLYA 1K9MT 2Z8QA 4FBTA 4ZDNA 2CZVC 4FNIA 4UT4A 3J80U 5CXTA 1G4CA 5MLCV 3OVAA 4B9MA 1REVB 4NI2B 1VCTA 3W65A 3B4MA 2JSXA 1IBLF 5IFMA 2R7OA 5CA5A 1T9VA 2KVQE 3KLEA 1U1QA 4O3OA 4O3QA 4JBCA 4DSEA 5K14A 4FXVA 4OYAA 2XY5A 2R8IA 1Y10A 2MQQA 4YR0A 2HVZA 4QJVA 4NLUA 4CLLA 2WW8A 2EPIA 4RUHA 2XULA 3P45B 2UUBJ 4OZNA 1LWXA 4DR2J 7AT1B 3BYPA 4CO5A 4OV6A 4WYLA 1BGXT 4P75A 1F60B 1DHMA 2C2OB 3QFHA 1FFWB 1F0XA 3RB4A 3QO9B 1GXTA 3ET6B 1N36J 1FKAF 1NZAA 3GIIA 2I5JB 2V8HA 1XR5A 2KTQA 3HSJA 3GYGA 1S9EB 2UVUA 3MUMP 1IR2A 2C3OA 3CCMS 2HQ3A 4L76A 4B9VA 4IQXA 4H4KA 2YBVA 4C8OA 3MR6A 2R7VA 4CNYA 2F8EX 2W8LA 2B7CB 3VR1A 4Y6IA 2WVDA 4DL6A 2C22A 4I1TA 2KHDA 3Q8SB 4X62J 1I1GA 4HTJA 1NKBA 2HPUA 1SJRA 5CQGA 3BSOA 4O3NA 4E8UA 4M5IA 2JFKA 4K7QA 1FO1A 2JH3A 2CQ4A 2C3UA 2H9ZA 3J81j 1Y5IB 3P5TL 4N8OA 2HBYB 1RAFB 1TK0A 3PJWA 1GQEA 3CDBA 3SV4A 2OI2A 4WK3A 4LVNP 4B9TA 4NXNF 2HHHJ 4HHJA 3TVZA 4A46A 1RU2A 2RU9A 1RT2B 2XHWA 3AD7C 3DRPA 3UVJB 3DFEA 1QE1A 1RBAA 3NAIA 2GQ2A 1RACB 2QEXS 3DGVA 3PW5A 4UY8T 4P7VA 1YJUA 1AROP 5I3UB 1OSCA 2VF3A 4RX6A 3KMQA 2MQ8A 3DLKA 3FNNA 3KLIB 2V8GA 1NJWA 2RMLA 1TP7A 4X65F 4NLGA 2IM3A 1Z2LA 1IBLJ 2O66A 2XMVA 2UUAF 5LT5A 2XCPA 3OPKA 1P8GA 3MMCB 2VONA 5CHCB 4Z2XA 4OYOA 2ZH3A 1ZPVA 2MLXA 4NL5A 2MSSA 3PX4A 1WHVA 3HHLD 4EUVA 4NZ7A 2LQJA 4CO3A 3Q0AA 2RKIA 1FTRA 2ZM6J 2DH8A 4RNFA 5E5NA 1OPIA 3L95X 4B3TJ 2KRRA 3FK4A 4URSA 2XQCA 1B64A 3J81Y 2D69A 4QZVB 4F2RA 1HBOA 3BO4A 2EWHA 3PW7A 1QAJA 2JLFA 3OTOJ 3UD4P 2ALYB 3HJFA 4GVLA 4WFZA 3NXZA 3ZZRA 5KT5A 4DV0J 3A8IA 4NYZA 2J8AA 1BE4A 1JKHB 3V6DA 3GIMA 3GJSB 3H5SA 5GMKa 3T1HJ 5D78A 3EMTA 1RAHB 1HWKA 2A2DA 2B4UA 2BJ9A 1D8YA 2EVZA 2QLBB 1QJHA 1UFWA 2C2EA 1H7XA 1U47A 4ZVRB 4KGVB 2G1DA 3G6YA 4JV2A 4ICLA 5D0RA 3V6KA 1U2RA 2D9OA 3T5HA 3SCKE 2K8GA 3W5YA 1B99A 4DR1F 2F63A 3LP0B 2XZWA 4X4PA 1BWVA 2VB6A 3DM2B 4UQTA 1U1PA 3GV5B 2VASA 4IDKB 4J9OA 5KTQA 4JI8F 3SMZA 5ETLA 2IVFB 1Q4RA 3QT7A 2Z2YB 1ZAVA 1HIYA 3CGIA 4P6QA 4LIWA 3U1MA 4B3MF 2KHCA 1VQ4S 3DU5A 4LMZA 1N0UA 1WHWA 2WTFA 2ZJRQ 1QAIA 2DEJA 4PG7A 2LXIA 4NYOA 1GMWA 5B08A 4L6V3 4CRJA 3KLGA 1PCAA 4YB6A 4F4KA 4P9SA 2AYGA 3H59A 5KG4A 2M4MA 5ETSA 3KDNA 3IM8A 1SL2A 3W1YC 2UUAJ 4EI2A 5KT7A 2ZHOA 4N76A 1A7GE 2XG8A 4TN2A 3S01A 1MU2B 1DZ5A 2CZ4A 1JWWA 1NSKL 1SJ3P 3IR7B 3CCWA 3M8PA 1FT8A 1PBUA 3I31A 3BGFA 5IQQA 4P72A 2FHJA 4WP9A 5HMYA 4U7UD 1SJ1A 2VG6B 3PY8A 2HVEA 3RRGA 3OLAA 2PIIA 1ZZFA 2ZE2A 1ULRA 2AEMA 2CNOB 2E7XA 1O5JA 1S7HA 4DOZA 5LSOA 1KQGB 1S6QA 5HP1B 1NK8A 2QLWA 4R5PB 4FVMA 4C7QA 4KQZA 1HNIA 3UR0A 4M5DB 1WF1A 2HGLA 3EPIA 1JIHA 2NR0A 1FK9A 2C42A 3CTRA 2LEAA 3IBFB 2IM0A 1YX2A 5LMUF 4HT7A 5JVHQ 3M7VA 2V2ZA 2CPJA 3V81B 2ZH9A 1N52B 2NZCA 2DISA 2EK6A 2XNRA 4ILMA 2W9AA 3A4TA 4QYZJ 3CCTA 2WVBA 3M6UA 1ZZNA 2B9XA 5K8MA 2BQRA 1WDDA 4DR1J 3PYFA 5IOLA 2LFVA 3VVUA 4WFYA 1NK7A 3NGUA 4ID5B 5DG7A 2HHQA 1FFSB 2PI4A 3MPWA 2RQ4A 4CIOA 4JOUA 2DGWA 1BWEA 1JLAA 5H9FK 3MXHP 4DX7A 4URGA 3HO1A 1UW4A 4G3IA 2BRLA 3FKBA 2ZH1A 3K5MA 1UWBB 3JYTA 3GV8B 4LRDA 5HMZA 4B17A 4LF1A 2AMCB 2NCKL 2P9EA 4ECTA 2GJIA 4NLVA 1HFEL 3GLJA 2IVMA 3FMWA 1VK3A 4RWXA 4ZJOA 3VAMA 2F7VA 2Q43A 2VL1A 2DXDA 3PW2A 1S9FA 1L3TA 2L3MA 4OI3A 1LW0B 1RKIA 2OLWA 3RW7A 2H48B 3K8WA 2OIHA 1TKZB 2BXJA 1RTIB 4DDFA 2MQOA 2DJWA 3MAAB 4BCAA 1UCNA 2R8GA 1HWLA 4C8ZA 2DD8S 3EM1A 2ILZA 1B4SA 2D74B 4F50A 3RBDA 2DGSA 1CJTB 2HNYB 2AF6A 2GAGC 2KKHA 5K20B 3NNAA 2OPRA 2M7SA 1WKKA 4KGZB 4IO1A 1ZTTA 4DUTA 1G2EA 3PRDA 3PO4A 4YB5A 1MWZA 5KG5A 4CTAA 2YWGA 1RYRA 2V4RA 1XERA 2QV6A 2DTJA 2P6TA 3GFYA 4DMZA 4AXIA 2PFFB 3PDNA 3V4IB 5F8MA 3GTYX 4BHQA 4KH1B 1YJNS 3VAHA 3L3CA 4M5NA 3CCRS 4ECSA 4LF2A 1Q5VA 5A76A 2VBZA 2LQBA 3EDRB 1C1CA 5B09A 5J2NB 3K8VA 3B6BA 3IWNC 2EFQA 1CULB 2BJ1A 1A0OB 4OHYA 1RT3B 3EGNA 5F8HA 3QJJA 2NLWA 1NPPA 5I3QA 4JI2F 4EYHB 1AT1B 3W9HA 3Q8VA 2HQDA 4LSLA 4C0OC 1VQ7S 5JJBA 1OY6A 5H1SV 3AD8C 4MYTA 4BC9A 2J7UA 2VD3A 4UZCA 4DF8A 1DLOA 3MOJB 2R8HA 1T3NA 3K59A 5C2CA 1YWXA 1TL4A 2OUGA 3CDAA 1HNZF 5D4OA 1VMBA 2LP4A 1HHSA 1ZOTA 1VQMS 4DV7J 1DQ9A 3FSXA 2R3VA 3FSYA 2BKPA 2DIUA 2HIYA 4OZ0A 3IRWP 1RT7B 2GW8A 3MAHA 2H5EA 4WFAQ 5BR8J 2BJ3A 2KFNA 4M5LA 4YY3F 4K4SA 2DY9A 1TV6B 2E5IA 3MGJA 4KGKA 2XI2A 4F2SA 2UU9F 4F4XA 2VICA 3QLHA 2CJAA 3BKTA 3KOAA 1ZM3A 4KJIA 2YXLA 2P2CB 4N56A 5DJBA 1L3SA 1UA0A 4TU7A 2J6TA 3GYXB 2FJBB 2J8SA 3F56A 3HHEA 2HGNA 2DNQA 1DTTA 3FBEA 4DZDA 3HSZA 4K4XA 2ABYA 3KLHA 1VBYA 2JHEA 1X8DA 4R25A 4UOHA 4ETZA 1RQ0A 4CI0B 1HL6A 1WSRA 1XJWB 5FJ4A 2PMZD 4IR1A 5GAEI 4C11A 1HBNB 4ZVGA 4C6AA 2RILA 1S1UA 3CWJA 3NS7B 3HULA 4QWAA 4WCEQ 3IWLA 3LQVA 4IFYB 2ZWPA 3TVYA 1LWCA 1Y11A 4PXDA 3DRSA 4K0KF 1U24A 1W25A 2NXEA 2A18A 4DG1A 5GAGU 1YG0A 2CKWA 5KFTA 1N56A 3VGSA 4ZJLA 3OLBA 1E6YB 3MR2A 4EWTA 1PAUB 4RPFA 1SC1B 2CPZA 1L3KA 1SQFA 3D4JA 1RLDA 1WSVA 1VC5A 2M0GB 5DQHA 2JL9A 3MEGB 1REVA 3WDOA 4NI2A 4ZCKA 2AJ0A 2MKIA 2HS0A 5AXMA 4ECYA 3W7BA 1ACMB 1SV5B 3CCSS 4D3HA 1S0VA 3HVTB 4F3OA 3OW2R 1FX4A 1NEEA 4WP8A 3W2WB 3KYLA 3ZZUA 1CJKB 5EDWA 2ZBIA 3BSNA 3VGVA 2JEJA 2DNPA 2CQ1A 3AQPA 3TQ1A 4RL1A 4OZ3A 3TVKA 3BYRA 5LXYA 1B70B 2R2RA 1VLOA 4X4VA 1UEVA 1EX8A 1LK5A 4QIGA 4NRUA 2IRYA 5IZHA 4YDDB 5M2UA 4DLGA 4F26A 4J37A 4LBHA 2HZVA 2X3GA 1KLMB 3ET6A 1FESA 4DQRA 2JWNA 2B6AB 2I5JA 2WONB 3QJLA 3VAIA 2HWTA 3UWTA 2UU9J 2GGPB 3NMAA 4QPTA 3UQSA 1SB6A 5F3ZA 4DCJB 2AT1B 2H4YB 3BBCA 2ROGA 4ZKAA 2WZ1A 1EJ7L 4DJBA 4IH5A 4DQIA 3CJKB 1RTDB 3QMQA 1C4AA 3CJ3A 3CIZA 4WU2A 1JLBB 3N5FA 2DH7A 3E8OA 2BEFA 3D1HA 1LW2B 4JI4J 3M6VA 3MMAB 1Q53A 1XR7A 2MDAA 2E1CA 4DLEA 1JJ4A 1UW9A 2AJQA 1UPPA 4X4UA 4DBQA 4D3GA 3MD3A 3OV7A 3HHKA 1OJ4A 2FB0A 5DM6Q 2N4DA 2EW9A 3GV7B 3JTPA 1D9DA 4DR4J 1Q7YT 1XMQF 4KY3A 1I5OB 5HJXA 1BY9A 3GYNA 4ZVPB 1RT2A 4RBTA 2BQUA 2M70A 2V50A 3UVJA 2B51A 3PEHA 1H2VZ 4LUBA 3G96A 3M8ZA 4GVBB 3DDNA 3A3OB 4OI2A 3Q8YA 5I3UA 5D4NA 2NXCA 2SXLA 3SSRA 3CDUA 4CH0S 4CYUA 3TZZA 3KLIA 1HD0A 1K0VA 4JI5J 1KQSR 2I1RA 3PACA 1YGYA 1WTFA 4LBPA 1N6QB 4JI0J 3IAM9 1VQPS 5KFMA 3OL6A 1C0TB 4HI1A 1OO0B 2FJEB 3CE8A 3MMCA 1GT8A 2P9GA 1UWAA 3NKYA 2IMOA 2KG0A 4PZVA 3LUYA 1R43A 1LXNA 2LLZA 1QTMA 2VU5A 2ZBCA 4V1Ak 2OMOA 3M8QB 2KZMA 3DLHA 3TOQA 1RCXB 2ACMA 2IVYA 4WXOA 1RHMB 4A8WA 5A8RB 3JB9k 2VFVA 2CPXA 4KRWA 4U8VA 3LPEA 3HHLC 3PR5B 1U1NA 3AY0A 4A8QA 1HQ2A 1N34J 3D3BJ 3OR1A 2EKNA 2BKOA 2GQCA 1HHTP 1Y3JA 1R89A 3I4HX 5D8HB 3SQGB 3TWZA 1JKHA 3PTWA 2RDDA 1EKRA 2W9CA 1U1MA 3K5PA 1EZZB 3IS9B 4K2XA 5I4MA 4K5RA 1EP4A 2HKEA 3CSKA 4NCBA 3OL9A 2LDIA 3V5RA 3FDSA 1ELOA 2BKNA 2VPXB 3BPSP 4HTIA 5DGBA 2BACA 2GAHC 1R31A 2GFFA 2RIJA 1U1KA 1S6OA 1N54B 2F1FA 4JV5J 4J9VA 3LP0A 2RDIA 4ECXA 3R1LA 3SCLE 4I64A 3J7AN 3DM2A 4J9QA 3TRGA 2EEYA 3M2UA 4IDKA 2RQMA 2ADCA 2KFZA 4N8NA 4LRBA 4DFPA 2UXDF 4DV3J 2JX2A 1XMQJ 4YOEA 1TFYA 2BA9A 4BWMA 5DRKA 4QWEA 1BUXA 1S79A 2FZKB 1N5TA 2WRMA 1F9HA 2ACYA 2ZDOA 2GMHA 2IM2A 2QYCA 3KDOA 4I69A 2GVDB 1PYTA 5I3PA 2NPFA 4KHRA 4F02A 3BH7B 3BREA 3N0VA 4ZVFA 1LWFB 4J7CA 5HO4A 4O0NA 2LU1A 3IBWA 3M9MB 1HKAA 3N28A 2RHSB 1UJ4A 5DM7Q 3M2VB 3OTEA 3BSCA 4WZQA 3D3CJ 4Y28C 3SV3A 4I2QB 3FBBA 1MU2A 1S4FA 5AE2A 4CO1A 1EB0A 5EUHA 1KFSA 2P8IA 3D9BA 1PYOB 3TZWA 3C14B 3R6GB 4Z37A 5KG1A 1JLFB 1TKXB 3UDVA 4LF7F 3D54A 2GMJA 4Y00A 1UVMA 2VG6A 4FYXB 2GJ2A 2E66A 4O4GB 3H7HB 2XS2A 4NRTA 1U6ZA 2YNIB 5HP1A 2LDYA 4R5PA 2VOOA 2IYIA 1RLCL 4M5DA 1FTCA 2PSZA 3HCXA 3W9JA 2DIVA 4Y2IA 3PO5A 1YJTA 1OYEA 3D1QA 2W9BB 4LR9A 4DPXA 1VQYA 4FDFA 4Q2LA 4I2PB 4PUOB 5C42B 1U26A 3CJ0A 1MMDA 3NCQA 5LSLA 3EXCX 4XO0A 4X64F 4OX9J 4RNHA 3J7A1 4C97A 4JYAJ 1ZAXA 3UO0A 3B4DA 3CD7A 1D3WA 4B3OB 1Q16B 2KM8B 3ZTSA 4LSNB 5G0RB 4ECUA 1VGYA 4QPXA 3V4MA 5FDLB 3CVKA 3PNIA 3J7Z5 4ID5A 1N5YB 3CB4A 4O44B 3H2VE 2DKOB 2MKCA 2R7QA 2HVHA 2J0SD 3ISNC 2UV8G 3PM9A 4WJBA 2EC2A 1UZHA 2I9SA 4QIFA 2CQBA 3LOUA 2UXDJ 1JXLA 2DGQA 3T1AA 1UWBA 4DF4A 1XK8A 1BQXA 1HNXJ 2VJVA 5CABA 2CJ9A 4LF5F 2J5AA 3M4XA 5AXLA 1NUEA 1LW0A 3NOCA 4CT8A 2HVIA 2LVWA 2QA4G 5DS7A 4USWA 5HVFA 3VQTA 4ZVTB 4RU9A 4LFCJ 4JP8A 1RABB 1TKZA 3N6LA 2ERRA 4JI7J 2W1BA 3RGIA 5DETA 1RTIA 2MZQA 4RNMA 2BV3A 3MAAA 5H9FJ 3LP2B 2DGVA 3HVRA 1M5PC 4QBUA 4FS2A 5CCMA 3K0JA 2NXNA 1PGZA 1CJTA 2HNYA 4NA3A 1C0UB 5IWAJ 4DV2F 3CEDA 1S7IA 1MROA 3CJQA 2D7SA 4U8YA 2JDJA 1NK5A 3LAKA 1FEHA 1TL1B 2OKQA 2XMJA 3AODA 3AXKA 2E5HA 4OV1A 3D28A 4PAAA 4XIUA 5HQ8A 3G8TA 4UUXA 2F40A 2ZUAA 5HK4A 3IR6B 4ZVSB 3OD2A 3P5BP 3SZ2A 2ZC4A 2Y8YA 2OFGX 2Y1IA 4AD6A 4N7TA 2OPQB 4IKAA 4B3SJ 2H51B 1VC0A 2XWXA 1VC6A 3KK1B 1P9YA 5J2NA 4OI4A 2XGQA 1CULA 4NOHA 3R3TA 4WIQA 3HVWA 4LFBF 3I4PA 2GV1A 1RT3A 3WIUA 2HZCA 2G2YA 3DLLQ 2BRKA 1VBZA 3UDCA 1Q8BA 2ATLA 4MKYA 3KG1A 4ANEA 1CBKA 3MF5A 3W8PA 1APSA 5C2GA 4OX6A 3OJSA 5FLXU 4C8NA 4ZCMA 1OMSA 1VJQA 2YQ1A 5BJRA 3MUTP 2COLA 4C2MA 3ZXWA 4X4TA 3IGVA 1QSSA 1RT4B 2YPYA 1ZM4A 1WTBA 2CJKA 3NCRA 2E5LF 3N9UC 2OAUA 5DG9A 4UUWA 2KJWA 3ZC4A 1RT7A 4CLYA 2DR5A 4QR1A 3VAJA 4Q2MA 1Y0HA 3WC2A 1TV6A 1K1SA 4LF9J 2DNYA 2L41A 1JJ2R 2IJRA 1N5VA 4HEA9 2PGCA 4YFUA 1X4HA 1Q86T 3R7SB 1GK8A 1IWGA 3VCDA 1TVRB 2CFXA 2G13A 4OHZA 1FD2A 5KFQA 3CCQS 2XGPA 2GJFA 4DN0A 2LECA 3I9ZA 1NPRA 2XMAA 2CWXA 4EMDA 2OTLS 4YR2A 1URRA 4CO0A 1U6FA 5J2QB 1VRUB 3GP9A 2AU0A 4A8MP 1JXEA 1T9TA 8AT1B 2GIRA 4LT6A 4ZP8A 3W62A 3EXYA 1HBNA 1QY7A 3HDSA 3SQOP 2E5GA 5J1EB 2FPHX 2QIFA 4W4MA 4IFYA 2BE9B 3BH6B 4TLRA 2N7YA 3PVXA 3BF4A 2PO4A 2R42A 2M2BA 3SI8A 4MFBB 1NO8A 4X66J 1HA1A 3QIPA 2ILYA 1RE1B 2JFDA 4OJGA 4CH1A 5JVGQ 2OEKA 2MTLA 1E6YA 2E29A 1ZH5A 1VJWA 1U2CA 3RBEA 1B7YB 1XR6A 1YLXA 2UZAA 4GC6A 4AQYF 4NLTA 1I3OB 4A47A 3FEYB 4MMOA 5D4LA 3L7PA 2AJ1A 4TVAB 4K50A 3MEGA 1O6XA 4RW9B 2EFVA 2K7JA 2CQ2A 4ELTA 2CZ9A 4WKYA 2RS2A 2YNFB 3F73A 1FJGF 4LFBJ 1B3TA 1SV5A 3R1HA 1HI0P 4KAIA 1VK8A 3MEDB 4DX6A 3HVTA 2VDHA 5KAKA 1SIWB 1QVFR 5KFZA 2CPYA 3W2WA 2FD2A 3QT8A 4GO5X 1CJKA 2YH0A 3VZHA 1X0FA 4PEOA 1HWUA 5E3CA 4E0DA 4PWDB 1WOSA 1HWJA 5BXIA 1NM2A 2IAJB 1DTQB 1UVKA 1XIQA 2G0JA 2VHGA 1FRXA 3B82A 4FF4A 4KHPF 1AZSB 1U8WA 2DGOA 3TR5A 4HKQA 5A8WB 4WPAA 4PWUA 2DNMA 2F65A 4PG5A 3T6JA 2XY6A 3V6DB 1FFGB 3MM5A 3GQCA 1LNQA 4EO8A 2KZZA 1CQNA 4CT9A 1KLMA 3AD9C 5ETTA 3NWRA 2B6AA 2WONA 2GGPA 3D6TB 2B4PA 4ZPBA 3OQ2A 3AA8A 3NWGA 3T1YF 4NA2A 3H4BA 3O44A 2BJ7A 1VI7A 2EBEA 4CWBA 4KTQA 4Y3CA 4DUZF 3SFGA 5CYQB 2QE5A 1FE0A 1K0TA 5KG0A 5KFAA 3CJKA 1RTDA 2Y0SD 3MCSA 1R8CA 4KGMA 1X5SA 2ZOMA 2EG1A 4OZLA 1RAAB 1LW2A 1KC8T 5L8RC 4RNNA 4UTGA 2Z56B 3QNWB 3MMAA 3AB4B 4OLPA 2V68A 2L9WA 4LF8J 1S97A 2RT3A 3CNQP 4F3MA 4DV6F 3I0SB 1U1OA 2LEBA 2V9KA 3Q8RB 3G82B 3R6LB 1F5BA 1UA1A 2XYPB 1NKEA 5F0UA 5KFGA 3MMBB 4X4NA 1WI8A 3TW0A 3UNGC 4L73A 4ED5A 3CJSA 1RWWB 1RHRB 3ZZOA 2VQFF 2IBOA 2BUNA 2C2RA 4GVBA 4X84A 2B7BB 4FZVA 5M2PA 1HI1A 4DX5A 4J9KA 4GKKJ 4OJ3A 1S1VB 2KYXA 2AX0A 3C2PA 2BMBA 1WEYA 2HNZB 4ELUA 3DC2A 1KEKA 4MK9A 3CJTA 1N6QA 1T94A 3W61A 2DY1A 3BO2A 5B0AA 2HHWA 2RJZA 1C0TA 4JB8B 1RA7A 4DL3A 3H98A 5G4DA 1S57A 4AL5A 3D1OA 5KFRA 3C6TB 2MQMA 5THWA 4YB7A 3M8QA 4XK8C 3GIJA 1UJ5A 4LBIA 3AH6A 2YQ0A 5J2PA 1S0NA 5A8RA 1S9GB 4EFAC 3D0HE 1S6UA 2O67A 3M30B 1S6PB 4ECQA 3PCOB 3A1YG 3FGVA 1S6QB 2CNKB 1HNIB 4RR5A 4K4ZA 2FVQA 5HSPA 2OD6A 2ZEJA 2JC0A 4WK1A 1VISA 1PJ6A 2KT2A 1FNXH 3BQ1A 4OHXA 1FE4A 4DR6J 3SQGA 4EZ9A 3PJXA 4Q0BA 1X5OA 2QL7B 1NU4A 2AEFA 5DLGA 3IS9A 1VBXA 1MWYA 3QAEA 4DFMA 3QGGA 4Y65A 5DDPC 1W2BR 4B9LA 4DR7F 4PQAA 1RGVA 3DRRB 2D1CA 4NLRA 7FDRA 3EICA 1NRKA 1IBKF 1O0PA 2FQQB 1RHUB 1F2HA 4DUZJ 1WG4A 4JI6F 1YZ6A 5KFVA 1R0BG 1U8SA 3CCVS 2FZCB 1FRJA 3FCVA 4FPIA 3PRVA 4WXWA 1YJRA 1M1GA 3LA0A 5HQMA 4GC7A 1GAOA 3T9NA 4P74A 4RW7A 5F8IA 5SZTA 2BX6A 2VH7A 4EBCA 2B9EA 2JC1A 1K73T 2IY5B 3LGNA 1AUSL 2HVDA 5B0EA 3W9IA 4HVZA 2DYAA 4ES1A 3R5GA 5EN1A 4OYMA 3CMQA 3A8KA 2YY3A 3GJTB 2DNHA 1U0HB 1VRQC 4JI3F 2CRLA 2DT9A 3UDLA 2AEJA 2F4VF 2GVDA 1TL5A 3QYYA 1YRUA 4ED2A 1HQEB 3UPFA 3ZZPA 4FBUA 2AX1A 1RKJA 1LWFA 2HWHA 1R8HA 1U4BA 2KRBA 1SC4B 2ZNZA 5GAGI 3ISZA 1H0HB 4ZPCA 4IRKA 2LKZA 3M2VA 5L1LA 4FP9A 4PABA 4I2QA 3LALA 2V63A 4ED6A 1U48A 2ZZNA 1RXOB 4MYUA 4V19X 1FXRA 2FJDB 2QMXA 3FUYA 2DITA 4HI2A 3ENAA 3DDKA 1RWKB 3C14A 1QSLA 3A3PB 1JLFA 1TKXA 3N6MA 2K1RB 4KIAA 2UXBJ 1YRTA 2RHQB 3ZFVA 2E1PA 4U7UK 4O4GA 3POTB 4F25A 2ZH4A 2YNIA 1S10A 1IKWB 1KHVA 3ILOA 3PKYA 4NASA 1WACA 3M1VB 1NHVA 2W9BA 2M8HA 2U1AA 4I2PA 4PUOA 4DR7J 5C42A 4ERDA 5RUBA 5EWFA 1U1LA 3WC0A 3PXGa 2DRAA 2RQKA 2E44A 2AQ4A 1OIAA 2XBPA 2EI5A 4L3NA 4B3OA 2FGOA 1FXLA 2BM1A 4LSNA 5G0RA 1KN6A 3ENQA 2V4JB 1DLOB 1X4FA 5AJ3F 4Q5VA 1SC6A 5FDLA 1T9XA 5E0OA 3LGMA 4A8KA 5CCLA 3BV8A 1N5YA 4DX8H 1RZMA 3PW0A 2ZJQQ 2B9WA 5LJ5Y 5DDQC 3F44A 2B0GA 1N5SA 3QJPA 7FD1A 4J5OA 4LJMA 4K4UA 1I6JA 1VQ8S 3CT9A 4CM0A 3VALA 2MY7A 1RJJA 2CPHA 2VG5B 4K2JA 2NUUG 2LCWA 1Y5NB 3PKMA 2ASYA 2HSEB 2F4VJ 1TKDA 4O3PA 2L9DA 1FVQA 4Q45A 3ZNJ1 4HDGA 1LEOA 2A1BA 2E7VA 3W64A 2AZ1A 3TZXA 4F0MA 2GHPA 3BM7A 4RUCA 4OZJA 4BWJA 3O1LA 2GHVC 1DQ8A 1KWMA 1KRPA 3D0IE 3TA0A 2W4PA 2I8EA 4RKUC 1NNDA 3DOLB 4DFJA 1EHWA 3UW1A 3S8SA 2J9DE 4Z7YA 4CNZA 2JLEA 3LP2A 2ZJPQ 3QRPA 2AP6A 2HAIA 3HJVA 4LFAJ 4K4YA 2FJXA 4MKVA 2V34A 2W24A 1S1TB 4NLQA 3PJ9A 4C3KA 1K1QA 1JJCB 2O5DA 2Z0GA 1H73A 2LYVA 2RE1A 2DCUB 2CG4A 3DOKB 1IBMJ 1TL1A 3CCJS 2C3PA 2YWFA 1HD1A 4DL7A 1PC4A 3BS9A 4UOCA 2NPIA 1QUVA 1P27B 3AT1B 3TAMB 4LF6F 4TLQA 2KYZA 3D6FB 3N6NA 3TEHB 3HHDA 5IC6B 3VAGA 4YUDA 2BJEA 4ZN1A 3CUNA 3BGLA 4NCGB 3OTCA 1X5TA 2RB7A 1X5PA 2OPQA 4H4KC 3BSAA 4L72B 5KFWA 3OVSA 2YQ3A 2KJVA 1V3RA 3KK1A 3I56S 1FX2A 1DAXA 2MGZB 1UEKA 1RI7A 4AE5A 3QZ7A 1IQTA 2CQGA 4CLWA 1WI6A 2K2PA 2DPJA 3Q22A 3GIRA 1EQMA 4OYZA 5DQGA 4ED3A 3LWLA 4I4BA 4FNHA 1GFWB 2EC0A 3VVTA 3KJQB 1N8RT 2QJ3A 2V8PA 3KXDA 4ID8A 1RBOB 2V2QA 4DR5J 1SUQB 2IYGA 3ZNUA 3CMES 2NXUA 3MECB 1C1BB 2EXUA 2IDLA 2UXCJ 4DR3J 2MLYA 4Z7CA 3T5LA 4XTTA 1H2UX 4TXSA 1VDHA 5F8GA 1KOOA 4USIA 4ED0A 3BQ0A 1RT4A 4EU0A 3JXOA 2G0CA 3S7RA 2A10A 2MQPA 4ENOA 3EGWB 2FLLA 3SXLA 2W7OA 2JRSA 4OYXA 2MJUA 1O8BA 3I6PA 1HBUB 2FHOB 5C24B 1OWXA 3PG9A 2UVVA 3HPOA 3W2VB 1TVRA 3DMJB 2AYEA 4OHWA 4EYIB 5D3GB 1X0PA 3NL0A 4NE9C 2QC3A 4RW6B 2DGXA 5GMEA 3TX0A 1FNMA 4KR0B 2WOMB 4MH8A 4B3RF 4MK8A 1AA1B 2BOAA 3MAQA 1FRKA 2EKYA 2JOQA 3VV2B 4OYBA 2PFDA 3Q83A 4USKA 2DR7A 5J2QA 1SH2A 1VRUA 1IQZA 1S72S 2OSRA 3MM6B 2VG7B 3PRBA 2RAQA 2KB2A 2WCXA 1I94J 5E3RA 3DCAA 3OL8A 1MLAA 5J1EA 2J7KA 1CLFA 2DGUA 1U09A 4I0WA 4RWWA 3H2UB 3TA2A 4C3LA 3NP5A 2PMHA 4MFBA 4IQMA 5ETVA 4LREA 3CMAS 3MEKA 2B4OA 2HQGA 1RTJB 3SCJE 3D2WA 1TL7B 2G9OA 5IT9U 4CYUB 4PXEA 1TL3B 3GFZA 4Y2KA 5KOWA 4GO7X 1RT5B 2V67A 4RW9A 3HT3A 2L48A 3LP1B 1DARA 3GSDA 3QGHA 2IDEA 1ZTWA 2YNFA 3EVMA 1JQGA 3NGDA 3IFEA 3QRRA 1KFDA 5CZXA 2EG2A 3MEDA 3LPYA 4YS2A 1H6KX 2R2TA 3PZPA 2JEFA 2QL9B 2V2VA 1KBRA 1XMBA 4IRDA 3CIMA 2G2OA 4PWDA 4S0MA 1SJQA 1X9SA 2IAJA 3OR1B 1DTQA 4XDDA 3K5OA 4PWWA 1AZSA 1O51A 5KG7A 1HW9A 5IT4A 5A8WA 3Q2SC 1VQLS 5JMNA 3BPDA 2LQ8A 2W9CB 5ETRA 4DPTA 4NA1A 4N47A 1SKSA 1X9WA 1V6HA 1EP4B 1VBKA 1JB0C 5KFIA 1V5VA 3GILA 1XEZA 5F0WA 1HR0F 4I56A 3QT5A 4ZPTR 4MK7A 3G86A 2XS7A 4QWCA 5CYQA 1FHTA 4U95A 1N32F 4KV8B 3NNCA 4XAKA 3HKZD 3DGPB 4HT5A 1AFJA 4B3RJ 2HZAA 4ZVHA 4UOFA 1H7WA 2WBMA 5ETKA 2IRUA 4OI1A 3NS6A 1RBLA 2QG9B 3M2UB 5SUHA 1KLNA 3H0PA 3M8WA 4RW8B 1N5QA 3SFUA 1J27A 3QGPA 2ZBQA 5AE3A 2OELA 1VS3A 3WZ0A 1N33F 4NXNJ 3I0SA 3MR5A 3FZ2A 3G82A 2CADA 4B02A 3U1NA 1UEUA 1IJEB 3MMBA 3MMJA 3CDWA 1R7IA 4WU3A 1XMOF 3QWUA 1RT6B 4K59A 1X4AA 3O8WA 2FTRA 1J5EF 4X65J 5CZVA 3KMSA 4P2FA 3OBIA 1S1VA 1N48A 5C25A 1KR4A 1IN0A 1FDBA 1JNZB 2HNZA 1FD8A 4N5SA 1LKZA 3MDFA 1TKTB 2CUYA 5KFSA 3RG6A 1LV5A 4G1PA 4NLDA 3G4SS 1FWLA 4K4TA 1HYSB 3SIPB 1RU1A 3A12A 1EETB 4UOGA 1FRHA 2RRNA 4PG4A 2QFIA 1KQFB 4A8SA 3EE3A 3ZZ0A 2YKMB 3E01B 3PR4A 1DQAA 1NB2A 3C6TA 3L4BC 4FS1A 1XWLA 1LFWA 3KNAA 3SDEA 3ZTRA 3GFXA 2CNNB 1R6YA 2U2FA 1S9GA 4LRAA 3GE9A 5HROB 2MJNA 3M30A 1S6PA 1F1BB 4DL0C 1HNWF 3IBCB 1RHKB 2KL8A 2ALZA 2VIHA 2W7AA 4ZLNA 1GEHA 2MEWA 4FF2A 5IM0B 1WC1A 1WD6A 5KFPA 3DYAB 3DLBA 3R27A 4EBDA 3RB6A 1WF0A 1UJ6A 4NEZA 3R8YA 3P49B 4X4RA 4HL9A 1JLGB 4M94A 5IXUA 1X7VA 1CEZA 1W26A 2HS4A 1YJ7A 3N01A 1SPBP 2GNKA 4UW2A 1IR0A 4NMXA 1M0SA 3C15B 3DRRA 3M8SA 2HNDB 4F8RA 4ZA1A 1N32J 1WDTA 2M8DB 3KJVB 3ISND 5DDRC 3PYDA 2BE2B 2VOPA 3D66A 2WBRA 1SBRA 2C3MA 4L75A 4EGLA 5K8OA 4JI8J 3CJRA 2Q66A 1S48A 2C2KB 4I7FB 4FYDA 2XMKA 3EGVA 1YHQS 2V0NA 1AUDA 2DPIA 5KT6A 3B78A 5D4PA 4DUYF 5E3PA 2E1AA 2AGOA 3MM7B 1YJVA 2H65B 1EARA 2FDNA 4B3MJ 2GS8A 2RVJA 3HHNB 3M9NB 2HFOA 2RDJA 1KVKA 4ZP9A 2PI5A 5D15A 3T41A 2R2UA 3OJUA 4PG8A 4Q44A 4QR2A 4PR6A 1SQGA 1UPMB 3RTVA 4J9PA 4WTYA 5A2QY 2DBBA 1U0HA 4EO6A 2X1AA 5E2QA 2MZJA 3EPGA 2LQ9A 1J5EJ 1U02A 2ZOFA 4DV5F 2CQCA 1YI2S 1HQEA 2B5JB 2RF2B 3Q89A 1T9WA 4P2MA 4DZ6A 3G6XA 5HN0A 4ZHRB 4P2SA 3B8HA 1UP1A 2J9DA 3RRHA 4JI1F 1YBTA 1X4GA 2CVEA 1RTHB 3OXLA 2Y8WA 2IRXA 3ONQA 2HG4A 2LA6A 2M52A 5F8NA 3SYZA 2RH3A 3RW6A 1Q0NA 2P9CA 1CSJA 1MG7A 3KLFB 2WVCA 4ED1A 1MROB 3MCOA 3PYGA 3I96A 1NDLA 4IFVB 2ADBA 4DPOA 1KSPA 2QZ8A 5B0CA 2K1RA 4AXJA 4NXMF 4CZCA 3T6BA 2O1PA 3Q86A 2MMYA 4F4YA 3POTA 2Q1LA 1WOOA 1RP5A 5LMUJ 1IKWA 3GZ7A 1GTEA 3GG0A 1D09B 3HP6A 4KBIA 2CDRB 3KJFB 1V3SA 3M1VA 2GC8A 3ITHB 2XTJP 1JLCB 3JAMY 1WKLA 2A6OA 1HMVB 4YQWA 3ETOA 2POKA 2OPPB 1I51B 2WAQD 2OEMA 1XC9A 2MY8A 2ZVIA 4M5KA 3TZYA 2V2KA 3Q8UA 1ZYQA 4IG3B 2HFZA 4WBFA 5J1NA 3TJAA 3GWCA 3ZO7A 4QU6A 3KK3B 4HH0A 5EX3A 1VQOS 4OHVA 2F8HA 1YQHA 2V4JA 2HRUA 4K4VA 2W2MP 4GKJF 4ITSA 3RBZA 2O3DA 3MPVA 4J9RA 2YX4A 1RA6A 3CJ2A 3A8JA 5B0FA 2B8PA 4NLXA 4DUYJ 3CC7S 4F4AA 3FBFA 5IV3A 3HZGA 2MKHA 1SCJB 2OHDA 4IH7A 2YVSA 2HURA 4G1QB 3JSYA 4CDIA 1SIZA 4KT0C 3CC4S 3QWPA 4WFBQ 1XN9A 1H98A 4NPOA 3P96A 1P1TA 2QT7A 3JSRA 2VG5A 4P52A 3TUZC 5KG2A 2ZUGA 2E1RA 3G6VA 3FQLA 3C3LA 2OO4A 3OXGA 1Z4UA 2ROPA 4NWBA 4M5GA 4B9UA 2KXFA 3CJ4A 3U7JA 2PA8D 2ASDA 2NUHA 3W66A 4PQUB 3GONA 3VF0B 1DBDA 3O3LA 2QSFA 2R7RA 1E6VB 4OZ2A 4F0HA 1JXVA 2I2YA 3RU0A 4IOBA 4ZLJA 4PPDA 3KHLA 1J2VA 4OJHA 1HW8A 3HFZB 2UUBF 5HATA 2CJXB 4DR2F 3DOLA 4EZ6A 4B9SA 4USTA 1GX5A 2VKZG 1U6BA 4U96A 4AL6A 4DQQA 3CCLS 1LWEB 4QQBA 2FGCA 3JTOA 2LA4A 1S1TA 5GADU 1V3ZA 2N3LA 3R97A 1N36F 4DWIA 1P9QC 5KT4A 3UCZP 1SQEA 5D77A 1SH0A 3DOKA 4YP3A 3QIPB 2DR9A 1KOHA 3K5LA 1Y4ZB 3DLEB 1RWXB 3KUHA 2XO6A 3TAMA 3MURP 2A2CA 3R5CA 2NREA 3I82A 4G6VB 2VV5A 5F41A 3Q8QB 3MEEB 2YKQA 2N82B 4I6AA 2XLIA 4NCGA 3HXMA 4BC7A 4DSIA 4X62F 2HFUA 4PKDB 5A2QU 1WUUA 2R8KA 3WX4A 3CD0A 3JQJA 3OHAA 2UV8A 4IUFA 3NLCA 2Y0BB 2QMUB 3M8YA 1U1RA 3TARA 1IKXB 4JI2J 2MGZA 4FPRA 1NMEB 3VQSA 5K9FA 5KFLA 4F0KA 6FDRA 3TP2A 1CPZA 2HRTA 4K8RA 1T03B 5L38A 4W92B 1FKOB 1S99A 1Q1KA 4KPYA 2HYIB 1KVIA 2HHTA 2V94A 3W5ZA 5KFEA 2HHHF 4GKJJ 1SUQA 1HNZJ 3MECA 1C1BA 3M2RA 1N88A 4X4SA 3HSDA 5HMXA 4F04B 1OQ3A 2EBGA 5CH7B 3MM5B 2DNLA 2FJAB 1NXIA 5ETNA 1WKJA 2VODA 1HQUB 1TAQA 3IA0A 4YY3J 4L3KA 4W98A 2BE7D 3TJ8A 5EX0A 2LU2A 1X4EA 1C2PA 5L1KA 4KO0B 2X3DA 2BANB 2OPSB 2DEIA 4QIVA 4X4OA 4Y34A 1HBUA 2WSEC 3ZTPA 2WSCC 3MHYA 2GMLA 5C24A 2IJNA 2KH9A 2N7CA 1H74A 3MWBA 3PFOA 3KKFA 4PPZA 3JAMU 3W2VA 4ILLA 3QRQA 3JQMA 3DMJA 1YZ7A 2ZM6F 1YBUA 5D3GA 5ETPA 4B3TF 2XY7A 3PX6A 3X1LB 2ASLA 4RW6A 2WOMA 1D9AA 5H9EK 4YB1P 5LOQA 2BVZA 1DRZA 1H72C 2DNNA 4AFFA 2KT5A 3FVYA 1VFJA 3OTOF 3FQKA 2IBKA 2DVIA 1Q79A 3GPAA 3F41A 3JS9A 3WIVA 3MM6A 4DFKA 2W2NP 3MR7A 2VG7A 3WBZA 4DV0F 1Q5YA 4K0KJ 1XBWA 3DI6B 4ER8A 2DHHA 2ZC3A 3PIOQ 2FHMA 5J2MB 4P2XA 3ADAC 4I6WA 4CLUA 4LQ9A 5JXSA 4NLWA 1UL3A 3TUPA 3T1HF 2GQQA 3E3XA 5T14A 5E3AA 3R7NB 3N5BA 4EEYA 4DCPB 3I0RB 3LH2S 1AFIA 1RTJA 1TL7A 5T7LB 5KFOA 4F4WA 3DOMB 4FYVB 1RWPB 2VFSA 4CH7A 1TL3A 1CJUB 4UY85 1QD1A 1HHQA 3LW5C 1Z2ZA 3EGZA 2KI2A 1NK9A 1RT5A 3W5XA 4ZIVA 2OSQA 2ZKUA 3LP1A 4J9LA 3IWXA 3R2CJ 5BYRA 4BDPA 2R4FA 2WB1D 1IKVA 3SSQA 4QW8A 5LSRA 1NH8A 2UUWA 2DNOA 5J2PB 2MQLA 4USHA 3LAMA 2Z2LA 3HSGA 4ZPDA 1SJFA 2MXYA 2ZH7A 1WHYA 3UNYA 4KSEB 1NK6A 2J9EA 1NJZA 4ES2A 1NHUA 2BW7A 1MN9A 5HLFA 2W2OP 4Q0BB 3QBCA 3RB3A 1VQ5S 2XEXA 3M32B 3V2UC 1BLUA 3GG1A 2DXEA 2XMTA 2GVZB 2L08A 2MZTA 1QDUB 2Z57B 3HMJG 3OSNA 3MM8B 1PILA 1RHQB 2DH9A 3KJNB 3NGRA 5L9NA 2FVRA 2B4VA 3H8YA 1TK5A 3OFGA 1F9EB 1OY9A 3MPDA 3LO3A 3UD5A 3AOBA 1BC6A 4KV8A 2OMLA 2UUCF 3WX8A 3DGPA 4KB7A 2YX1A 4PYAA 4RW7B 3KUEA 2B9YA 4ED7A 1DY3A 4HACA 4C8LA 4C3MA 4P10A 3MD1A 1LOUA 2FVPA 4RW8A 1WF2A 2Z30B 1WWHA 3BBFA 4QIWD 4KFBB 3F0NA 1RYSA 5IS2A 4ZLPA 3HF5A 2G2ZA 4RUBA 3NAHA 3K89A 1FJ7A 5GVQA 3CCZA 3NGTA 3G6ES 1MSWD 3DN9A 2HK3A 4R0JA 1FRLA 1FA0A 1RT6A 3NRBA 4USUA 5LM7E 1D0EA 2EFPA 4GRSA 2KU7A 2Q79A 3NNHA 2A6MA 1A6LA 1RAIB 1S76D 2DHSA 3BN7A 1QM9A 1HPZB 3GB0A 2HBRB 4RJVA 5GAHU 1HLWA 2D3OR 4ED4A 3L7UA 1TKTA 5FLXY 3OR2B 3B54A 1T05A 4LRCA 1XTZA 2KG1A 1T95A 1HYSA 3J7YU 4DU7A 1EETA 3BGRB 1SKRA 4UF4A 3HHLB 2ZH2A 3KHGA 3P8BB 3BKUA 4C8MA 2YKMA 3E01A 2LXUA 1OYDA 2YKOA 1BQMB 3C46A 1X4CA 2BBEA 3G87A 3H20A 1NSAA 3MCNA 2MB0B 5B0DA 2IPOB 3HD1A 5HROA 2ZITA 3BEGB 2N3OA 2MKYA 2H4WB 3QGIA 4O3SA 4DPWA 5IM0A 3VAKA 3E2EA 3PW4A 4AT1B 2K06A 3HI9A 2X7IA 1JJHA 3DYAA 3VTIA 2Z4PA 1JLGA 2HHUA 2ZD1B 1ZETA 2MKSA 2W4CA 2HRYA 3C15A 4MT1A 4LIRA 2HNDA 2C2NA 2APOA 2PA3A 4TYBA 2KT3A 1PYSB 5HQLA 2Y9HA 3W63A 2MKKA 3JSBA 1Q8LA 1FDNA 2UUCJ 3KJVA 3A3NB 2HGMA 2BE2A 1R8AA 1S77D 4WP3A 2C3YA 1YBAA 2CPDA 2CVIA 5CD4A 2AV5A 4NLSA 1IWAA 3AQOA 3EUNA 2FLPA 2XI3A 2XCAA 3IR5B 4I7FA 2VPWB 1NPKA 3JTNA 3I32A 3HD2A 3D67A 1YKWA 1JLQB 2YKNB 2KN4A 2EFGA 1S0MA 4IOCQ 3MM7A 4NYPA 5A8KA 5IV4A 4LVOP 2B56A 1GMVA 4H4MB 4Y0FA 3G8QA 3BQ2A 2J9CA 1Y00A 3NBPA 2FJVA 1FDAA 2D3O1 3S6EA 4ATNA 3J7ZT 4ZOSA 1QVGR 3QSIA 5EGYA 4M5JA 2C1EB 4PCQA 2QYGA 1YITS 2E9RX 1UETA 2B5JA 2RF2A 3D5MA 4OJ1A 5LL6d 1FRMA 1G3OA 1A9NB 5K8NA 2QLFB 4ZHRA 1X9MA 1ZS6A 2N4CA 3H42A 3RAXA 1T8EA 1CVJA 4V19J 2BM0A 4DU8A 4OYIA 3FBCA 3TA1A 5D0HA 1OS5A 1VOMA 4DL4A 4A8OA 1RTHA 3AHPA 4DV7F 4ED8A 2FY1A 4A8XA 2XM3A 1FWPA 3J81U 1PKUA 5LMNF 1K47A 3CCUS 1U45A 3TI0A 3KLFA 4DV1F 2F8MA 5J1PA 3QPIA 4LF7J 2PEHA 3ZZZA 4M8LA 2HQIA 2ZH6A 2NS1B 5BR8F 1RDRA 1HWIA 4IFVA 1NK0A 1NK4A 4HLBA 4XDCA 1V9OA 1TFWA 3I5AA 3AJ1A 2NQPA 3THTA 1TUVA 3Q8PB 1G7CB 2BR0A 2M88A 2YH1A 2FJWA 2K7KA 3AAWB 3VZIA 5E3QA 3H4DA 1IJFB 3EZ5A 3BR9A 2YKPA 4AYBD 5DZ6A 2MZ1A 3KUGA 4KC5A 3ITHA 1JLCA 1HMVA 4C9DA 2OPPA 1IKYB 4X64J 6FD1A 4RZRA 2V8VA 2ZOGA 1PG5B 2PN6A 4IG3A 4TQRA 2FYXA 5C7PA 4RBUA 1CJVB 4FXDA
chains in the Genus database with same CATH topology
2KZMA 3DLHA 3KK3A 2DR7A 3TOQA 3KK2B 1JLAB 3OVBA 5J2QA 4C4WA 1J5OB 1SH2A 1VRUA 2IVYA 4WXOA 4A8WA 5A8RB 1IQZA 1S72S 2OSRA 1M5SA 2CJQA 3MM6B 3JB9k 2VFVA 3BN4A 2E7WA 1FERA 2KXHA 1H2TZ 1TQLA 2CPXA 2WSFC 3IRXA 1WEZA 4KRWA 2VG7B 3PRBA 1R8BA 3JYTB 3HHLC 2RU3A 3PR5B 1U1NA 2KB2A 3AY0A 5E41A 2FIUA 2WCXA 3RB0A 4A8QA 2R7XA 5E3RA 3DCAA 2W8KA 3OR1A 3OL8A 3RR8A 2GQCA 1HHTP 5KFJA 2J7WA 5J1EA 1Y3JA 2FC9A 1R89A 5CYJA 2J7KA 1CLFA 3J80Y 2LXFA 3I4HX 4RNOA 1YJWS 2JZ5A 2DGUA 5D8HB 1U09A 4I0WA 2IC3A 1FKPA 4RWWA 3H2UB 3TA2A 2ZH8A 4R8UA 3SQGB 4C3LA 3H5UA 3JSMA 4NZ6A 3PV8A 2HMIB 3NP5A 1JKHA 1YSJA 2PMHA 4TU9A 1B0VA 3LF0A 4HH1A 4JUZA 3QIDA 4MFBA 4G1QA 2D9PA 4IQMA 2XNQA 3FRYA 2W9CA 3CMAS 3K5PA 1U1MA 3MEKA 1FF2A 3IS9B 4NMLA 4K2XA 4IH6A 5I4MA 2J0XA 4ETXA 2B4OA 4K5RA 1EP4A 3CSKA 1RTJB 3SCJE 3M8RA 3D2WA 1X4BA 4NCBA 2G9OA 3N4WA 3OL9A 4DSKA 2LDIA 4PXEA 3KNGA 1JLEA 3V5RA 1S1WA 1FCAA 3FDSA 2MHNA 1TL3B 4C8KA 1JNRB 1ELOA 2VPXB 1Y7PA 3GFZA 2Z2MA 1M5OC 3I5BA 4Y2KA 1RK8A 4NX9A 5KOWA 4GO7X 4I6YA 4HTIA 5DGBA 1RT5B 2BACA 4MIWA 3BO3A 4RW9A 4PQUA 1F5CA 4QW9A 1R31A 3HT3A 2GFFA 4RU2A 2L48A 2RIJA 2O01C 3HFKA 3LP1B 1DARA 1OSDA 3GSDA 3QGHA 4LF4F 1ZTWA 2YNFA 3NGDA 3IFEA 1U1KA 1S6OA 1CC7A 1E6VA 4DQSA 1N54B 2F1FA 3HKWA 1KFDA 5CZXA 2EG2A 3MEDA 1M5HA 3LP0A 2RDIA 3LPYA 4ECXA 1Z1ZA 3BR8A 3R1LA 1H6KX 2VC1A 3SCLE 2R2TA 4ECVA 4LFAF 4I64A 4ILRA 3PZPA 2JEFA 2OPRB 4RBVA 5T41A 1T3OA 5HL7Q 4U9RA 2IJFA 3R5AA 3DM2A 4A4JA 4ES3A 4J9QA 3OHBA 5KFHA 3TRGA 3M2UA 3PX0A 2KFYA 4IDKA 1XMBA 4CTAB 4IRDA 2RQMA 3CIMA 4MAKA 1UMJA 3T5JA 2ADCA 4PWDA 1Y3KA 1Y9OA 3L7OA 5LJ3Y 1UVLA 1GTHA 1LWEA 3I9V9 3MPYA 2KFZA 1SJQA 5KFXA 4N8NA 1X9SA 4H4OA 3TAQA 1LXJA 4DFPA 1IBMF 2UXDF 4JV0A 2ZKTA 4TY8B 2IAJA 3OR1B 4GMKA 2JX2A 3ZZYA 1B0TA 1YRXA 3MM9A 1DTQA 3IXQA 1WHXA 4YOEA 4XDDA 3K5OA 2ZFHA 1TFYA 2CPIA 2BA9A 4BWMA 5DRKA 4QWEA 3NS5A 1S79A 4B08A 3GR1A 2PDAA 1N5TA 1O51A 1ZM2A 2WRMA 5KG7A 1HW9A 2IA6A 5IT4A 5A8WA 1N4LA 2ACYA 3GFHA 4R8UB 2ZDOA 3CDEA 4NLOA 3Q2SC 2GMHA 2IM2A 2QYCA 3BDEA 1VQLS 1OPZA 4YHHF 2W9CB 4I69A 5AXNA 2J6SA 4C8YA 2XWYA 1TR0A 3K5NA 1KQKA 4NA1A 5I3PA 3G71S 4N47A 2NPFA 1SKSA 1UFLA 4KHRA 4X4QA 3DLEA 1C1CB 1X9WA 4IR9A 4F02A 1WG1A 4ZK7M 1V6HA 3BREA 1EP4B 3N0VA 2J0QD 3DLJA 4OFZA 4ZVFA 1LWFB 2MKJA 1JB0C 5HO4A 1S1WB 4HYKA 2D3UA 3KLVA 5KFIA 3RR7A 3GILA 3R5BA 5FIIA 3AA9A 1GXUA 2PE8A 1XEZA 2LU1A 4ZP7A 5F0WA 3IBWA 2CQDA 3MEEA 5CYMA 3M9MB 1HR0F 4I56A 3N28A 2RRAA 4Q8FA 4FXWA 4OZ1A 1UJ4A 2X1GA 5DM7Q 3H25A 3M2VB 3OTEA 3BSCA 1CG2A 1LQ9A 2EFOA 2YWHA 4LSLB 4ZPTR 2P6SA 5KG6A 1L5UA 4WZQA 5IQ6A 4MK7A 3TUIC 4Y28C 3SV3A 4I2QB 4Y2CA 3CULA 3G86A 1TK8A 3OTBA 1Q78A 2XS7A 4QWCA 4JI4F 5CYQA 1FHTA 2D3ZA 1MU2A 2C28A 1S4FA 4KV8B 4MTPA 2OFHX 2GA7A 5AXKA 5A0YA 3IAS9 2B3TB 5EUHA 3OTDA 4CO1A 5KT3A 4XAKA 3HKZD 1KFSA 1RISA 4O3RA 3NCPA 4HT5A 4PXBA 2XSFA 1AFJA 1CC8A 3CD6S 1IKXA 4WE1A 4OX8A 4ZVHA 3U02A 1H7WA 2WBMA 4DR5F 2PC6A 2IRUA 4DSLA 4OI1A 3H5YA 5E7OB 2A3JA 3BJYA 5KFUA 3NS6A 3M2UB 5SUHA 1PSDA 2AYBA 4DR3F 2UXCF 1KLNA 4R0EA 2DHAA 1T03A 3IG1B 4RW8B 4O44A 1N5QA 4MKBA 3SFUA 1FKOA 1X4DA 4QWDA 4Z37A 5KOXA 5KG1A 4DR4F 2FLNA 2NSCA 1JLFB 3QGPA 1TKXB 5AE3A 4LF7F 3H5XA 3D54A 4TQSA 4FF1A 2GMJA 3HX9A 1VS3A 4Y00A 3WZ0A 4YDXA 1UVMA 2VG6A 1N33F 4TU8A 2QSWA 1KONA 4PXCA 2GJ2A 2E66A 1F9FA 4F4ZA 1FXDA 3I0SA 2CQPA 4O4GB 4F67A 3MR5A 1SL1A 2XS2A 3FZ2A 3TNVA 3DHWC 4KKOA 4NRTA 1U6ZA 2YNIB 2G4BA 5HP1A 2LDYA 4R5PA 2VOOA 4ZS6A 2IYIA 2XC9A 4RUAA 4M5DA 1FTCA 2PSZA 2GO8A 3QLHB 2DIVA 3X3UA 2EK1A 4B02A 4Y2IA 3U1NA 1UEUA 1IJEB 3MMBA 3MMJA 1OQ6A 4DL5A 2P5VA 3CDWA 3EZUA 3PO5A 2GHWA 1R7IA 1YJTA 3D1QA 2VA3A 3DLGA 4WU3A 2W9BB 1XMOF 3QWUA 1HQUA 4J9MA 4QIEA 2VBWA 1RT6B 4K59A 2ZH5A 3MUVP 1VQYA 1X4AA 4Q2LA 1R27B 3O8WA 4JI5F 4I2PB 2VFRA 1R0AB 5B0GA 4O4RA 4PUOB 2FTRA 5C42B 1NJXA 1M90T 1U26A 1J5EF 3CJ0A 5CZVA 3S1TA 3KMSA 1MMDA 4JI0F 1G1XA 3NCQA 4HDHA 3EXCX 5LSLA 4WIIA 2VPZB 3OBIA 3C6UB 4ZMMA 4XO0A 4KO0A 1S1VA 2FHJD 4X64F 4RNHA 3J7A1 1GNKA 2ZHAA 2BANA 2DCLA 1ZAXA 2OPSA 4C97A 2PD1A 5C25A 3OL7A 1N48A 1KR4A 5AE1A 1IN0A 1DTTB 1FDBA 3B4DA 1JNZB 2HNZA 3CD7A 1FD8A 4N5SA 2YNGA 1LKZA 3MDFA 1TKTB 1D3WA 5KFSA 1WELA 4O23A 5K8PA 2HIQA 4B3OB 2V5HG 1Q16B 3P3DA 3KLHB 1LV5A 2KM8B 2WK4A 2M9KA 4LSNB 5G0RB 4G1PA 5A0YB 2X1FA 4ECUA 1PO6A 4NLDA 2NYIA 1VGYA 2K3IA 2L9NA 4QPXA 3G4SS 4K4TA 2C2DA 3FCHA 3MTKA 2IMWP 1HYSB 2E9ZA 1KHWA 3V4MA 4M63A 5FDLB 1FRIA 1EETB 2E1MC 5F8JA 1VQ6S 3CVKA 5F9LA 1FRHA 4MKAA 4Q7AA 1S1XA 2F9DA 4C11B 4ECWA 2F3JA 2RRNA 1NB7A 4PG4A 1S1UB 3KHRA 3PNIA 2V4QA 3K7RA 2AD9A 2HW3A 1G6BA 3BZQA 1KQFB 4ID5A 3J7Z5 1ZAWA 4A8SA 3ZZ0A 1N5YB 3V6HA 2YKMB 3E01B 3PR4A 4IO9Q 5L1IA 1DQAA 3NMRA 3CB4A 1C0UA 1LWCB 3C6TA 4FS1A 4O44B 1XWLA 1LFWA 3H2VE 3HM9A 3FFIA 3DRSB 3G8SA 2HLTA 3DHXA 1I94F 3KNAA 2MKCA 3QZ8A 4W90B 2QO3A 2R7QA 1N34F 1H38A 2R7SA 4PRFA 2HVHA 2J0SD 2W7PA 3ISNC 2UV8G 3PM9A 4WJBA 1WG5A 3SDEA 4DG1B 2I9SA 3GFXA 4QIFA 1R6YA 2LMIA 5E33A 3QO9A 2CQBA 2U2FA 3LOUA 1S9GA 1W2IA 2QA2A 4ZCLA 3K58A 1JXLA 2DGQA 3GE9A 5HROB 2MJNA 2AJFE 3M30A 1S6PA 3T1AA 4DL0C 3KTQA 1HNWF 4OI6A 3HZEA 1RT1A 3BB5A 1UWBA 4NLYA 3MFIA 4DF4A 2ALZA 2ASJA 2W7AA 4X2BA 1XK8A 3EX7B 4Q8EA 5A6PA 2V9WA 2Y1RI 1BQXA 2R7UA 2YNHA 1U2FA 3DI6A 1VLYA 4FF2A 1DJ0A 1K9MT 5IM0B 2Z8QA 5J2MA 4FBTA 4Y2AA 2MSTA 4ZDNA 1WD6A 3FSIA 3NG8A 2CJ9A 2CZVC 5KFPA 1S9EA 3DYAB 4FNIA 3DLBA 3R27A 4EBDA 5CXTA 4LF5F 5MLCV 1UKUA 1WF0A 1UJ6A 2J5AA 3OVAA 3RB6A 3K2YA 4K5SA 4B9MA 1REVB 2UVWA 3M4XA 5AXLA 3P49B 4X4RA 4HL9A 1BQNB 1JLGB 4M94A 3M6WA 3B4MA 5IXUA 1X7VA 5D6GA 5DGAA 2JSXA 4OIXA 1LW0A 5HBMB 1IBLF 1CEZA 5IFMA 1HBMB 2HS4A 2R7OA 3I0RA 3N01A 4CT8A 1HNVB 2VBYA 2GNKA 1NKCA 5CA5A 4UW2A 2KXNB 3KLEA 1U1QA 2LVWA 2HVIA 1IR0A 2QA4G 5DS7A 3C66A 4O3OA 3VQTA 4O3QA 2DO4A 4JBCA 5C25B 4DSEA 4RU9A 5T7LA 5K14A 1M0SA 3DRRA 3M8SA 1TKZA 3N6LA 2ERRA 3DOMA 2HNDB 4FXVA 5H9EJ 5DETA 4F8RA 4JV5F 1RTIA 4DS5A 4ZA1A 2XY5A 2MZQA 2R8IA 3RAMA 4RNMA 2BV3A 1CQMA 2MQQA 1GXLA 5H9FJ 1SXLA 3LP2B 4YR0A 2M8DB 3KJVB 2HVZA 3ISND 2DGVA 4QJVA 3HVRA 2DNKA 4NLUA 5DDRC 1M5PC 4QBUA 3PFEA 4FS2A 2BE2B 5CCMA 2VOPA 2WW8A 2EPIA 3K0JA 4RUHA 5F8LA 2XULA 1U49A 2WBRA 1UVJA 4OZNA 1SBRA 2C3MA 2R8JA 1PGZA 4CO5A 4EGLA 2HNYA 4WYLA 4NA3A 1BGXT 4NZ0A 1C0UB 5K8OA 3T3FA 1F60B 1DFDA 4DV2F 1S48A 2Q66A 1DHMA 5HMWA 4I7FB 4FYDA 4DSFA 3CEDA 2XMKA 1MROA 1F0XA 4DV3F 1ZBTA 1YHQS 2M5YA 3RB4A 3SDEB 2V0NA 2D7SA 2JDJA 3QO9B 1NK5A 3LAKA 4RLEA 1AUDA 1FEHA 2DPIA 5KT6A 1TL1B 1GXTA 3OUYB 2OKQA 2XMJA 3B78A 5D4PA 4DUYF 5E3PA 2E1AA 2AGOA 4U67Q 3MM7B 1YJVA 2E5HA 3D28A 3L09A 4OV1A 4XIUA 5HQ8A 2FDNA 1FKAF 1NZAA 3G8TA 3GIIA 2RVJA 4UUXA 2F40A 5L9XA 2I5JB 3HHNB 3M9NB 2V8HA 2HFOA 3IR6B 2RDJA 4ZP9A 2PI5A 3SZ2A 2R2UA 1SL0A 1XR5A 2ZC4A 3OJUA 4PG8A 2KTQA 4Q44A 4QR2A 4PR6A 1N0VC 2OFGX 2Y1IA 2RUGA 1MNEA 1S9EB 2XMUA 2UVUA 3MUMP 2OPQB 2C3OA 4IKAA 3RTVA 4DEZA 3CCMS 4J9PA 2HQ3A 4WTYA 5A2QY 2DBBA 4B9VA 4EO6A 2X1AA 2QFJA 2HFNA 3I87A 4IQXA 5E2QA 4H4KA 5BYQA 1VC0A 2MZJA 2QLXA 4C8OA 3MR6A 3EPGA 2R7VA 2XWXA 4CNYA 1VRTB 2LQ9A 3M32A 2ZOFA 2F8EX 2W8LA 4DV5F 1VC6A 2CQCA 3KK1B 1YI2S 1HQEA 2B7CB 3VR1A 5J2NA 4M95A 2B5JB 2RF2B 4Y6IA 2HHPA 4DL6A 2C22A 4I1TA 4OI4A 2KHDA 2XGQA 3G6XA 2XSJB 3VWSA 4YR3A 5HN0A 3MM8A 4NOHA 3R3TA 3Q8SB 3HVWA 4ZHRB 4LFBF 3I4PA 3UFCX 1I1GA 2GV1A 4HTJA 4P2SA 1RT3A 3B8HA 2HPUA 1NKBA 2HZCA 3DLLQ 1UP1A 1XNQF 2BRKA 1VBZA 1SJRA 2J9DA 5CQGA 3GR0A 3RRHA 3E51A 3UDCA 1Q8BA 2ATLA 4JI1F 4MKYA 3BSOA 3KG1A 4O3NA 1X4GA 4E8UA 2CVEA 2JFKA 1FO1A 1RTHB 2JH3A 2CQ4A 2C3UA 3MF5A 2H9ZA 1D1UA 1APSA 3OXLA 4DHVA 2IRXA 3ONQA 1Y5IB 4QU7A 3P5TL 4N8OA 5I42B 2HG4A 2LA6A 4DV4F 4OX6A 2M52A 2K3KA 3OJSA 5F8NA 3SYZA 2RH3A 2AJ4A 4C8NA 4ZCMA 3RW6A 3KG0A 4YMEA 1TK0A 2P9CA 3PJWA 1CSJA 1TZ0A 2VA2A 1GQEA 2BYCA 3CDBA 2AW0A 3SV4A 4EBEA 3KLFB 1IUJA 2HWIA 5ITHA 1HI8A 4K4WA 4ED1A 1MROB 2DNRA 4WK3A 3KFWX 4LVNP 5BJRA 4B9TA 4NXNF 3MUTP 2COLA 4HHJA 4C2MA 2VC0A 3TVZA 1LK7A 4A46A 4X4TA 3IGVA 2MHEA 2MZSA 3I96A 2RU9A 1RT2B 2XHWA 1RT4B 1QSSA 4IFVB 2ADBA 3DRPA 3DFEA 1ZM4A 1QE1A 4DPOA 1WTBA 1KSPA 2QZ8A 3NAIA 2MZRA 2CJKA 5B0CA 3NCRA 2K1RA 2GQ2A 2E5LF 3N9UC <