5LSOA

Crystal structure of spf45 uhm domain with cyclic peptide inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational Design of Cyclic Peptide Inhibitors of U2AF Homology Motif (UHM) Domains To Modulate Pre-mRNA Splicing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/inhibitor
molecule keywords Splicing factor 45
total genus 28
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lsoA01
1UFWA 3MDFA 2DNGA 2DH7A 2LXIA 3LQVA 2L9WA 3Q2SC 3RW7A 4EGLA 1O0PA 1WEXA 1Q7YT 1A7GE 2EVZA 2KI2A 2LEBA 2RUGA 2SXLA 5LSLA 3UWTA 1JJHA 2MKHA 4Y00A 1VQPS 1X4CA 2GHPA 3VAHA 2CQ1A 3UCGA 2NLWA 1YJNS 1WI6A 2B0GA 3BS9A 2CQPA 2DO0A 2CQHA 4WFNQ 4LMZA 1H2VZ 1F9FA 2DGOA 2KM8C 1VBXA 1VC6A 1KOOA 1U1KA 1WG5A 1X4GA 2DNHA 2LKZA 4ERDA 5LJ3Y 2DHSA 5GADU 2RQ4A 2XS7A 2G0CA 2D9PA 3CPWR 4TLQA 1VQ9S 2RRBA 2M8HA 1A9NB 2DGUA 3VAFA 1U6FA 5LXRA 4Z2XA 2MGZB 4YB1P 2K8GA 4WKRA 1DZ5A 3SMZA 1VC0A 2O3DA 2AD9A 1FNXH 2CPEA 2U2FA 3TO8A 5HL7Q 2ZJPQ 2OJ3A 2LXUA 5IM0A 4WCEQ 3P49B 4UQTA 2EK1A 1OO0B 4UY8T 4W90B 2MKCA 2MXYA 2V94A 2MMYA 3NNAA 5BJRA 1DHMA 2CPZA 2KM8B 1X5SA 3CC4S 1WHWA 2J0QD 2J0SD 3CF5Q 2KG0A 1H2UX 4C7QA 3EX7B 5EN1A 1P27B 3ZZZA 2MZRA 1HA1A 2LMIA 3S7RA 1PGZA 2I2YA 2KN4A 2MQOA 2MY8A 4IUFA 2QFJA 3S8SA 2DNRA 3VAIA 5FJ4A 2DH8A 1M5KC 2DGTA 3IRWP 3FEYB 1H6KX 4ZKAA 1WHVA 1IQTA 2M2BA 2Q79A 2BOPA 2X1GA 2MSTA 1KC8T 1X5OA 2X1FA 4M5DB 2M8DB 3PIOQ 2DHGA 5D78A 3SXLA 3V4MA 1VQ7S 2YH0A 3CCUS 4CH1A 1K8AT 5CXTA 3CULA 2MKJA 2N3LA 1VQNS 2CQGA 1UAWA 3UD3P 5DDPC 2KYXA 1X0FA 1YJ9S 5LXYA 2DNOA 3I55S 4QU7A 2E44A 4OZ0A 2N3OA 3R1HA 3MURP 2KG1A 2AYEA 3N9UC 2M4MA 4IO9Q 5H1SV 4FXVA 1U2FA 3G8TA 2CPYA 1U1LA 1RK8A 1M90T 5MLCV 4A8XA 2CPDA 2KU7A 2YWKA 1NJIT 4V19X 2LYVA 1K9MT 1Q81T 2VOOA 5GAGU 2FC9A 5HO4A 2LECA 2XB2D 1N8RT 2VONA 2CQ3A 3BO2A 3R27A 2X1AA 2M9KA 2MHNA 1BY9A 1U1RA 1WEZA 3P5TL 1CVJA 3MUTP 3CCJS 2DHAA 2ERRA 4TU9A 2PEHA 3DXBA 1OWXA 2HGNA 3VAGA 1G2EA 3THTA 2XNRA 3S01A 2MY7A 2XNQA 3MD3A 1L3KA 5IFMA 3CTRA 5DETA 1M5OC 1YHQS 2KHCA 5ITHA 1P1TA 2KRBA 2MZ1A 2CPJA 2DGSA 2MZJA 1X4FA 2RT3A 2MQQA 1Q82T 2FHOB 1UP1A 1YIJS 1FT8A 1X4AA 4F26A 2X1BA 5LSOA 4RU2A 1JJ4A 5IM0B 3JB9k 2NZ4A 2L08A 4YUDA 3VAJA 1YTYA 2CQIA 3VF0B 3HI9A 3D2WA 2CQCA 2DIVA 2AYMA 2DK2A 1YWXA 3SDEA 2JRSA 2N7CA 2KRRA 1ZZFA 2LQ5A 2F3JA 1FO1A 2M7SA 1R8HA 4QPTA 1OPIA 4CQ1A 3B4MA 2MQMA 1D9AA 3CCLS 1WHXA 1WTBA 1SXLA 4LIRA 4FXWA 1FJCA 3CMES 3IWNC 2HYIB 2YH1A 3US5A 1HL6A 1KOHA 2I38A 2OSRA 2JVOA 1D8ZA 4BS2A 3MXHP 3UCZP 2LCWA 2LA4A 2ZJRQ 2MKSA 1AUDA 3CCVS 1N54B 1WG4A 3HHNB 3CC2S 3EGZA 3EGNA 4WFBQ 3G71S 2DNMA 2DHXA 4PRFA 1QVFR 3TYTA 3BO3A 2M88A 2MYFA 3NS6A 1R8PA 2CQ4A 4TU8A 3OW2R 1WF1A 2FC8A 3MI7X 3UCUP 3G6ES 2OTLS 2M70A 3CCES 3R1LA 3NMRA 2DISA 1VBZA 3LPYA 1OIAA 1ZZNA 2EK6A 1FJEB 2LA6A 1QM9A 1WWHA 5LJ5Y 1S79A 2KXHA 2RS2A 2DNPA 1M5VC 1DBDA 3CD6S 1WHYA 2DIUA 5GMKa 2DNZA 1XN9A 3J7ZT 5GAEU 2L41A 5JVHQ 1X4EA 2XS5A 2KVIA 1WEYA 2KH9A 5DDOC 5JVGQ 2DNNA 5GAHU 2WBRA 2OIHA 4CIOA 3MD1A 2XS2A 3P6YC 3BEGB 2DNQA 2OSQA 5DM6Q 1DRZA 1VC5A 2MZSA 2JVRA 2MZQA 1HD1A 1VQ4S 1SJ4P 3CC7S 2M0GB 3MUVP 3CCSS 5DM7Q 1M5PC 1X4HA 3CXCR 1WG1A 1NU4A 1Q86T 1YJWS 2DNKA 2RS8A 1SJRA 2E5GA 3H2UB 3G8SA 2G1DA 3UE2A 1U1NA 1SJ3P 4F25A 3CCMS 4QQBA 1YITS 1K73T 3U1LA 2DGQA 2J76E 1FHTA 2DGVA 4OZ1A 1SJQA 5CA5A 5DDQC 1UW4A 1VQ6S 2DO4A 2FY1A 1RKJA 3G96A 2A3JA 2CPHA 1JJ2R 3K0JA 1M1KT 5DDRC 4TU7A 1WI8A 1U1MA 4W92B 4QU6A 1URNA 1PO6A 2JX2A 2E5HA 2HVZA 3B4DA 2MGZA 2U1AA 2DGXA 1H2TZ 3THPA 5IQQA 1S72S 2JWNA 2KT5A 4F02A 1NO8A 2D3OR 2QEXS 4C0OC 1VBYA 2AYBA 2E5IA 1QVGR 1X5TA 2FPHX 1HD0A 4C4WA 3BO4A 4IOCQ 3UD4P 1YI2S 2K3KA 1WF0A 4WF9Q 3VAKA 3L3CA 2N82B 3NNHA 2F9JA 3G4SS 1U1OA 2MKIA 2RU3A 2F9DA 2CQDA 3I56S 2OTJS 3CCRS 2ADCA 1U6BA 5GVQA 1KD1T 2CQ2A 2CQ0A 2DITA 2DB1A 2ADBA 2RRAA 2VODA 3CCQS 3FEXB 3CMAS 2XSFA 4Y0FA 3PIPQ 3MOJB 2CPIA 3S6EA 3P3DA 2VOPA 2MQNA 2MQPA 2DGWA 1KQSR 2DNYA 4PKDB 5CYJA 4IOAQ 2MPUA 2YKAA 4WIIA 3Q2TC 2D9OA 2CPXA 3DLLQ 1ZH5A 1WF2A 1JMTA 3J7YU 2E5JA 2CPFA 2MQLA 1X4BA 2PE8A 1VQOS 4LJMA 1U1QA 2KXFA 2DNLA 2UP1A 2RQCA 1VQ8S 2MZTA 2G4BA 1VQLS 2ZJQQ 4PR6A 1FXLA 2MKKA 1X4DA 2M52A 3CUNA 1SJFA 2DH9A 2CQBA 2RNEA 2HGMA 5D77A 2AYGA 2MJNA 2MB0B 3RW6A 3ULHA 4CH0S 3VALA 2CJKA 2MJUA 2YTCA 4P6QA 2LEAA 3SDEB 1FJ7A 2RVJA 3VAMA 3TP2A 1VQMS 2GO9A 2KFYA 2HZCA 1B7FA 4ED5A 2KXNB 2QA4S 1WELA 4J5OA 1N88A 2J8AA 1N52B 3U1MA 3H2VE 1X5PA 3NS5A 4U67Q 3MUMP 3ZZYA 1VQ5S 2HGLA 1W2BR 2BZ2A 3NNCA 1VQKS 4YOEA 3G9CA 1U1PA 4WFAQ 2MSSA
chains in the Genus database with same CATH superfamily
1S1XA 2W9CB 2VF3A 3IR5B 3TI0A 2OFGX 2DH7A 2M5YA 2XMJA 3LQVA 3Q2SC 3QLHB 2XMUA 4A48A 1VK3A 2ZH2A 5HLFA 2JSXA 1WEXA 1XJWB 4HTIA 1A7GE 5H9EK 3DCAA 3MM5A 2W1BA 2VV5A 3KKFA 3L9ZA 3MAHA 4NWBA 2RUGA 2SXLA 3OR1A 3R6LB 1RXOB 3HCXA 3H8YA 4EK2A 3CDAA 5LSLA 4ZLJA 3TVKA 4B3OB 1JLEB 4W4MA 3KJFB 3R5JB 5M2UA 5KFWA 4JV5F 4M5GA 2BA9A 2MKHA 2UVUA 2HBYB 1HI0P 2ZE2B 4ED4A 1VQPS 3KWMA 2C28A 2B9XA 1S1WB 1S7IA 1X4CA 3EVWA 4LT6A 2UUCF 1WJ9A 4I0WA 3NNAA 1RWNB 2C42A 4U6PA 4J7CA 3M1VA 4QU6A 3B78A 1N6QA 4QW8A 3OFEA 1RT4A 4ZPVR 1CQNA 1R8CA 2ZNZA 4O3QA 4O3PA 1XTZA 2R3VA 3CJRA 1RAOA 4NEYA 1PG5B 4WFNQ 3BYPA 4KIAA 3LF0A 3QO9A 1VC6A 1RCOB 2K2PA 2XSJB 5HQLA 3KLVA 4DR7F 4MMOA 3AJ1A 5B0CA 1DLOB 2GV1A 2DNHA 4CDIA 1TK0A 2LKZA 4NLGA 3MWBA 3S1TA 5GAHI 2WONA 1R7IA 1TKXA 3I32A 1FWLA 1NSPA 3R97A 1AB8A 2CWXA 2Y1LB 4MKVA 5FDLA 5F3ZA 4Q5VA 3G6YA 2UVRA 3P96A 4USIA 3VAFA 1Q16B 3DYAA 1SH2A 3C14A 4DPOA 4PAAA 3GQCA 2UUWA 2NXJA 1S0VA 3VGUA 3E2EA 2J9DA 3C6UB 1RP5A 2IM2A 1VC0A 1RWKB 3PRVA 2V9KA 5KFKA 1FNXH 1C0UB 2AJ0A 2NXUA 2OGUA 4ZVFA 4JI6F 5HL7Q 3G86A 1KBRA 2ZJPQ 4I7FB 5LMUF 1P8GA 1XMBA 3DLGA 2W7PA 3MHYA 3N01A 1M0SA 3F56A 5J2QB 3P49B 2HFZA 1QAIA 3GCXP 2VICA 1FA0A 3RR7A 4IRDA 2ZHOA 2MDAA 4CP5A 4BWJA 1OO0B 5DQIA 5F8IA 1NK7A 5C42A 3HD2A 4OZ3A 2MMYA 3HP6A 2V68A 1DHMA 1DQ8A 2HLTA 3O8WA 5BJRA 5CABA 5KT6A 4E0DA 1FRXA 4A4JA 1PJ6A 3SCJE 3CC4S 3DU5A 4ELUA 2CDQA 1U45A 2ZD1A 2W01A 3Q24A 4M5JA 2WHOA 3M8YA 3CF5Q 5IOLA 4OI3A 3TUIC 3BF4A 1R8AA 1H2UX 1S6PA 2R8HA 1RLCL 1VRTB 4USWA 1X60A 1SUQA 4MT1A 2HRUA 4ICLB 3WDOA 1C1BA 3MZIA 4UZCA 1PGZA 1PSDA 3NBPB 3T3FA 1S77D 4DR4J 3BPSP 4IUFA 2QFJA 3S8SA 3ZO7A 4B3TJ 3KNGA 1SV5A 4JP8A 2C2RA 1KS2A 5CQGA 3PZPA 4JYAF 3DLEB 3QRRA 3R5DA 2FVRA 4K4ZA 3ZFVA 1GQEA 2DCLA 5IV4A 3L4BC 2NQPA 2QO3A 2G13A 2OD6A 2QLJB 1TMMA 2Q79A 2QA2A 4DR4F 4DF4A 1QSLA 4DZ6A 2H4YB 1X0PA 1VRUB 3QIPB 2X1GA 4AD6A 2UVVA 4MFBA 3SEOA 1X5OA 2X1FA 4M5DB 2J7WA 5D78A 1DFDA 4NLPA 5D4LA 1CPZA 1SH0A 2OELA 5HVHA 4CH1A 1UA0A 1REVB 2DY1A 1X8DA 4DPUA 4I6AA 5HQ8A 1EP4B 2R8GA 1VQNS 3G82B 4P75A 1RT1B 2CZ9A 4PG6A 3CJKB 3R9LA 4ER8A 3T6BA 4KJIA 4EUVA 2VPZB 5L9XA 1UAWA 2BUNA 5IQ6A 5IT9U 3P8BB 2Y1JA 2KYXA 1AW0A 4DL4A 2WRMA 3GIRA 5KT5A 4U7CA 2W2PP 3BN7A 3CW2C 3ISND 4FDFA 2VQFF 4PQUB 4OZ0A 4ILMA 2XMTA 1UEVA 3DGPA 3H5SA 4F36A 1OMSA 3FCHA 1R27B 4GO5X 4OHXA 3G8TA 3PW2A 1IBMF 1WC0A 4KGZB 2FGOA 5L1KA 2GA7A 4NMLA 4AT1B 4M5HA 3BREA 4DPWA 2XO6A 1REVA 2NSBA 3ETMA 4CLFA 4J9RA 3D4JA 5AE1A 1F9HA 1M90T 4O3NA 2XWYA 1U7LA 4ZPCA 5L1LA 2NCKL 4V19X 3LGNA 3HHLD 5G0RB 1RT4B 1NB7A 4JV1A 2WVCA 3PV8A 2QE5A 2ZH7A 2LECA 4ALZA 3NEKA 3LWLA 4I67A 2BANB 3LA0A 4PWUA 5JXSA 2XB2D 2PFFB 1RA7A 2OH2A 1S1WA 2CQ3A 4WWSA 4DS5A 1RACB 3R7SB 2PA3A 2Z8QA 2M9KA 2MHNA 4Y3CA 3T1AA 4E2FB 4F0KA 2A2CA 4X4SA 4EYIB 3M2RA 3AJ2A 3P5TL 4RKUC 1FDNA 4ZPDA 3CCJS 4DQSA 1OYDA 4C98A 1AA1B 4OZNA 4NXMF 1BQMA 1OWXA 3VAGA 2YQ1A 3THTA 3S01A 4ILLA 4P10A 4OYBA 3LWMA 4K4YA 3KUHA 1DQAA 1IVZA 2XNQA 2AJ2A 3MD3A 4DL0C 3JSMB 1VGYA 1T03B 4PWWA 2YNHA 1QD1A 4HVZA 1TKZB 3SI8A 3LAKA 3AD8C 5CCMA 4P7VA 4URSA 3UR0A 2DGSA 2MZJA 3G6VA 3FUYA 2AX1A 2FJDB 4F0HA 5F8LA 3FZBA 2B51A 3RTVA 4JBCA 5BR8J 2BRKA 4RU2A 3D0HE 3A12A 3PYEA 4YUDA 1P9YA 5C25A 2ZM6J 3JQKA 2UU9J 3VF0B 4UY85 3HI9A 3D2WA 4F0MA 2BDPA 2CQCA 3C8YA 1FXRA 2DK2A 3TOQA 1RWMB 5AXMA 1JLAB 1E6YA 2B56A 3H59A 1HNIA 3I0SA 2N7CA 4DF8A 4Y6IA 4ZVHA 4B3OA 2H65B 2LQ5A 1BE4A 3A13A 5SUHA 3QBCA 2A2DA 3ELHA 4X4QA 3OTOJ 3GYNA 4DUYF 1BQMB 4FS1A 3BBCA 3NXZA 2W9AA 1RAHB 3C14B 1FVQA 3B4MA 4R0EA 2B5JA 3AA8A 5KFIA 4AL7A 2QSFA 3GONA 1WHXA 3MTKA 4ED7A 3F44A 5FDLB 2LP4A 2BJ3A 4RW8B 1UZHA 4DR1J 1FJCA 1PYTA 4WP3A 1T05A 1KOHA 2L9DA 1ZTWA 1MWZA 4ECUA 2X3DA 3MXHP 1HQUB 3UCZP 4DFMA 2PMWA 1DURA 2W24A 3TAMA 4LR8A 4KB7A 4D3GA 2MKSA 2ZJRQ 2KFZA 3SSRA 3D68A 4X66J 1A6LA 5H9FK 3FEZA 4OL8A 1WC6A 4JV0A 1IR2A 1H74A 1VLOA 4U8YA 1RB0A 3NGSA 4DOZA 4WFBQ 1FKOB 4CCHA 4PXDA 4C11B 4DEZA 2GVZA 1IKVA 1D9DA 3TYTA 2MQQA 2ZUGA 4XTTA 1FDBA 2JLGA 1NDPA 1RHMB 3BO3A 3ENAA 4UW2A 4DQPA 1JXEA 3H5YA 4MIWA 1TQLA 3E8OA 4DSKA 2CQ4A 3IR6B 3D66A 2E1PA 1WF1A 4TXSA 4HDHA 4Q2MA 1JLEA 2AV5A 1GTEA 2W8KA 4QWBA 3R7BB 3D6TB 2RJZA 4ZVGA 3NMRA 1J5OB 4WFXA 3ZZUA 3Q8QB 1VBZA 1CJVA 3JAMY 5A8RB 4C9DA 2IM1A 2BV3A 4P2FA 2EK6A 1S9FA 4JI3F 1WWHA 3MECB 1E6YB 1S79A 1UWBB 3SFGA 4X64J 1T02A 1EP4A 2KXHA 3C16B 1FJGJ 1UJ5A 4FF2A 1FX2A 3PO4A 5L1JA 1LOUA 2F7VA 3KK2B 3MM6B 2RS2A 1Q53A 2RSQA 2VQEJ 1N34F 4F8RA 4HI1A 2ZITA 3I0RA 3JQJA 3O5TB 2BE7D 2PIIA 4ITSA 5KAKA 3J81Y 2C2EA 2VBWA 4OYMA 1TL7B 1WOOA 4C0HA 3OVAA 3DOLA 1YGYA 1RT7B 2HNZA 2NUUG 4HACA 2H5JB 5EWFA 1SB6A 1WEYA 3FC9A 2KH9A 2EC0A 3B82A 5JVGQ 5F9LA 2DNNA 2DR7A 3WBZA 3N6NA 3BSNA 2XYGB 2OIHA 1FRLA 5J2PB 4A8KA 4DU7A 2B43A 4XPCA 4FZVA 2OSQA 4NA1A 5DM6Q 1DTTB 3FCVA 1DRZA 4PABA 4A8FA 2XZDB 3NL0A 1HNZJ 2LXFA 1HWUA 4IFVA 3MR3A 2V6AA 3JSRA 4OZLA 2VJVA 5B0GA 2ZEJA 2HVHA 1CJTB 1QTNB 2EI5A 2PD1A 5DM7Q 2FZGB 2FJXA 4JOUA 4ZPAA 2HHUA 1YJWS 4EEYA 5F8JA 3HHLA 2AU0A 3OD2A 3PO5A 2ZOGA 2ZFHA 2E5GA 2ZHBA 2AGOA 3K5OA 3TUPA 1B99A 3A8JA 3UE2A 1SJ3P 4ES1A 5FIIA 3U1LA 4CYUB 2J76E 4HYKA 5KG6A 2JC0A 1LFPA 3I5AA 4ZJOA 3DDIA 5CA5A 1KHVA 4F04B 1S1UB 3W9IA 1X9WA 5LL6d 3A8EA 3D1QA 1RKJA 3G96A 2A3JA 2NUHA 4ZPTR 2JEIA 3CIMA 3K0JA 4GKKF 3QAUA 2HQ3A 1FDAA 1HWJA 2VDHA 3DRSA 4ZMMA 3GILA 2QMXA 3K17A 4HI2A 1GXUA 1T9UA 5HJXA 2A0FB 2E5HA 2JX2A 1U1PA 2CNNB 2XS2A 2BX6A 2VASA 3KTQA 5KFEA 2OI2A 1H98A 2BJ9A 1S12A 2U1AA 2WVBA 3DRRB 2PO4A 4IOBA 4IDKB 3EGWB 4CZCA 5HLFB 5E3AA 4K7QA 4LBHA 3NNHA 2ZNYA 4PYDA 4X2BA 1D9FA 5IQQA 1S72S 4DN0A 3GFHA 3ET6B 1XR5A 4DV7F 4DHVA 1QAYA 4DR2J 3CIZA 1F60B 1YVFA 2DRDA 4PXEA 4JI3J 2QEXS 1VBYA 3M6VA 5HMWA 3W1YC 3FGVA 3W3SA 3HM9A 3ICLA 1X5TA 5LM7E 4K4TA 5F8HA 4EO6A 5T41A 1KTVA 2JOQA 1UVMA 3GR0A 2DHHA 4HL9A 4NCGA 4WKYA 4P72A 2HFNA 3UD4P 1L3VA 1WF0A 4IG3A 4OHYA 2V34A 2HK3A 3OT9A 5B09A 3R5BA 4TQSA 1MN7A 1G4CA 1O51A 1XR6A 4NCGB 4R5PA 2COLA 1U02A 1U1OA 2RU3A 4KY3A 1AUSL 3HJVA 4CM0A 4CYUA 4J9OA 2FJBB 2GVDA 2OD4A 3DOKB 3H20A 3Q86A 4OI4A 1UFLA 1ZM9A 5KFXA 4BC9A 4EI2A 4F4ZA 4YDDB 3W61A 1ZS6A 1HW9A 3J7YI 3MTJA 2EFOA 2V8HA 5GVQA 2DRBA 1KD1T 1S10A 2CQ2A 2KZZA 1YDLA 2CQ0A 2V2QA 2JNJA 3KG4A 2H51B 4BC7A 1LW2A 1Q5VA 2BJ7A 5DG7A 1SKWA 1UVLA 1FEEA 4NLTA 5IWAF 3FEXB 2UUTA 3V5RA 3OTEA 2WVEA 4IFVB 2UZAA 2YNGA 3GG1A 1JLAA 3NOCA 5HROA 3QGGA 3EXYA 1M1GA 2BQ3A 3CDWA 3ISZA 1S5ZA 2FLOA 3IS9A 2PSZA 1C1CA 2K7JA 3KJNB 4C8LA 3MOJB 3CJSA 4IH6A 1RAGB 5J2MB 5CH7B 2R7UA 2ZD1B 5A2QY 1PBAA 4TYAA 2MQNA 5C24B 2UXDF 1FTCA 2MQPA 2BE9B 3DXSX 3R7NB 5EHHA 3ENWA 5HQMA 3Q2TC 1JK9B 4DUYJ 3CCZA 4A46A 3ISNC 1LK7A 1JLBA 3JSBA 4FN5A 5E0OA 4X4OA 2FY8A 4WE1A 5D8HB 2CNOB 3DLLQ 2FGCA 2Z4PA 1N0UA 2MQLA 2O67A 5KFOA 4O4GA 4IQXA 3AOAA 2Y3YA 2KXFA 3IFEA 1PJ5A 3OTBA 2DNLA 4ZA1A 1GFWB 4DMZA 2RQCA 1TKDA 3DLGB 1N32F 2UXCJ 1TL1B 4YY3F 2IJFA 2G4BA 3KLIB 2W2MP 5HMXA 2ZJQQ 1VQLS 2OLWA 1SL0A 1X4DA 4ZLNA 4RNNA 4QW9A 1SJFA 5CYMA 3V2UC 1D1UA 3C6UA 4WZMA 4ES2A 3DI6B 3DGVA 2YX4A 5E3PA 4YR0A 3ULHA 4IKAA 4MJKA 1SVDA 3QSYB 1RISA 1RWUA 2D74B 4Q8FA 2MJUA 4QYZJ 5AT1B 3UN2A 2VC1A 5F8GA 1SC6A 3HFZB 3EPGA 3LANA 3QNWB 3QLHA 4H4MA 1GNKA 3E3XA 2QV6A 2HEKA 4HT5A 3T19A 4C2MA 2I5JB 5J1EA 2QA4G 3M8WA 4YB7A 2UXBF 1Q7LB 1NZ8A 1X7VA 3OXFA 3QT8A 2ZH1A 3I31A 2IMWP 4DV4J 1VQMS 4QBUA 2ZZMA 4OYOA 3CJ8A 3CJ2A 4NCAA 1ZAVA 5ETPA 3C2PA 2RDJA 1LEOA 1PC5A 1J27A 2ACYA 4RUCA 2IYGA 1WELA 4OJGA 3VCDA 1RWPB 4J5OA 2FZCB 3B54A 2R2UA 5HMYA 2WZ1A 1JLBB 3KHGA 4K8RA 1KRPA 1N52B 3DOLB 2RAQA 3F0NA 1PJ7A 3U1MA 3U7JA 2XMKA 3HVAA 1IKWA 2E9RX 4DV5J 1HBOB 3OUYA 3FZ2A 5J2NA 4Y2IA 2LDYA 4RLEA 2X51A 2D3ZA 3K57A 2VBZA 2YKNA 3J80U 3E51A 4YOEA 1NK9A 5J1PA 4LRBA 1BHNA 3HT3A 1FE4A 2QLWA 1KQKA 4DCPB 4NYPA 4DI6A 2DNGA 1IKXB 5LMNF 3Q89A 1R0AB 1XNQF 1GMWD 2AWZA 2ROGA 1AROP 4ZCMA 4FBTA 2KI2A 4CO1A 4OQJA 5K14A 2LEBA 3MM5B 3WC2A 3R3TA 4Y65A 2AZ3A 3R5CA 3UWTA 1NAQA 3UN5A 4ILRA 3UDLA 2V8DA 1KN6A 2YWWA 4Y00A 3CD0A 3IAS9 4LRDA 5I42B 3I82A 1U0SA 2HMIA 3CJ3A 2AKWB 4ED3A 3NOGA 2A10A 2CNKB 1F0XA 1PCAA 1I1GA 4HHHA 2P2CB 2HURA 2YKNB 2E29A 1FI4A 3UCGA 1PILA 4RW6A 1YJNS 1NJZA 2CQPA 4YHHJ 3DDNA 2XY6A 2XHCA 4DX6A 1H2VZ 3W5YA 3PKMA 1IKYB 1SQEA 3DU6A 2B9YA 4ZITA 4RNMA 3DLKB 1MMLA 1VCTA 3NGTA 3GYGA 4M5MA 3W60A 1U1KA 1GX5A 1WG5A 4KGXB 1X4GA 3H4BA 1KHWA 1WOSA 4PWDB 1B0VA 1NZAA 4ERDA 4WJBA 3QZ7A 2QX0A 5EWEA 1NB2A 2VA2A 1KLMA 4QIGA 3TUZC 3MMJA 4UF4A 2ASLA 2CJBA 4ZP6A 2DRAA 2O01C 5HROB 1RTHA 4PEOA 2B8QA 5GAEI 1I94J 1VQ9S 3T1YF 1A9NB 3BGLA 2NXCA 3M32A 1Z1ZA 5LXRA 3NCQA 1V5IB 2CJQA 2CVIA 2BJ8A 3I9V9 3DFEA 4YB1P 4C8OA 1B0PA 2K8GA 1VISA 1JKHB 1FNMA 1RTZA 1WSVA 3BM7A 3C66A 1CBKA 2WB1D 3VV2B 3W8GA 1DJ0A 4K4UA 2O3DA 2GFFA 2RKIA 2R2TA 1TL3A 2ZVIA 2BXJA 4P74A 2AD9A 3QFWA 5E2QA 2ZH6A 3M6WA 4OLOA 4B9TA 5K8MA 4ZN1A 2JJ4D 3CJQA 1U8SA 3LGHA 4PG7A 3PVXA 1ZPVA 3LOUA 2QLXA 2YWFA 3H98A 5KFUA 3ZTOA 4CT8A 5CCLA 5HP1B 2HHPA 3IA0A 2F4FA 4MFBB 5AXLA 1I94F 2EK1A 4Y2CA 5BXIA 2E1RA 4UY8T 3HZEA 4KHMA 4M5IA 2HW3A 3BBFA 5HN0A 1N0VC 1SIZA 2BKPA 2ZKTA 4HTJA 3A8IA 3VTIA 1U2RA 2DKOB 2QMWA 4JI1J 1JLQA 3ITHA 2V2VA 3H90A 5AXNA 1VQ7S 2FVQA 1FE0A 2P9GA 5J2MA 3N5FA 4LF9F 2AZ1A 2XLJA 2N4CA 3QJLA 4C7QA 4FS2A 1VR6A 1CEZA 5EN1A 1CSJA 2CWKA 3OTOF 2JC1A 6FDRA 3LP1A 3S7RA 3V6DA 2OPSB 5DLGA 3V4IB 4KHPJ 2KN4A 1Q79A 3IWXA 4OJHA 7FDRA 3MR2A 2FJEB 1OYEA 2MY8A 3QT7A 3FNNA 1JLFA 3D6MB 2HBQB 3VAIA 1HYSA 1Y3JA 3ILIA 5ETTA 2F1FA 4LF5J 1M5KC 2HVIA 2DGTA 3SBMA 3K8WA 4F67A 3IRWP 1KWMA 3FEYB 1H6KX 4DU8A 2V8VA 5F41A 1TL5A 1WSRA 3P45B 3D6FB 4PCQA 3FJ2A 3N28A 1VBKA 3HLUA 2FVPA 2HAFA 2M2BA 3QO9B 8RUCA 4FF4A 3W2VA 3T5LA 4RWXA 3Q22A 3GFYA 5D0RA 1JNRB 1RT2A 4BCAA 1RAAB 4RWWA 2DXFA 4LQ3A 3VVTA 4ENOA 2HVEA 4ZLLA 4PPDA 3OL7A 3PIOQ 1S9GA 2DHGA 3N5BA 3SXLA 2OEKA 2VG6A 3HZGA 3SQOP 5KG1A 3V4MA 3W2VB 3OTDA 5FLXU 2Y0SD 5A8KB 1ULRA 2QL7B 3HHDA 3KXDA 6AT1B 2H48B 3M9NB 2HS4A 1UFKA 5I42A 5CXTA 4X84A 2Z58B 1EKSA 3M2VB 4K4WA 2IBOA 3MECA 1S97A 4OI0A 1RUSA 4YP3A 2YKOA 1ZA1B 2IMOA 2H4WB 4WXWA 1MROA 4J9KA 5DDPC 3BQ1A 1RT5B 2XY5A 3TA1A 3KLGA 2V69A 1YJ9S 5LXYA 1X0FA 4QU7A 1SC1B 1AXQA 2YNIB 3OL9A 1EETB 2E44A 2NYHA 2N3OA 3R1HA 2LQ8A 1HWIA 2EC2A 2UUCJ 1T9TA 3G2XA 3A3PB 2VG7A 3DNCA 3MURP 3GV5B 3N9UC 4IO9Q 5H1SV 3HT0A 4FXVA 1U2FA 5J1NA 1IM6A 2YWHA 4DG1B 1IBKJ 2HBRB 2YNFB 1U1LA 4X4TA 4AUKA 1QAJA 3GB0A 1GMWA 5MLCV 3RU0A 3H40A 4JI7J 1S4EA 2RDIA 4ZN3A 3QSIA 3G87A 4A8XA 1EAYC 2Q43A 4LF7F 2KU7A 2YWKA 1Q5YA 1NJIT 1UZDA 2LYVA 3QIPA 4NLSA 2KJWA 1Q95G 3T5JA 1IBMJ 4NX9A 3R6GB 5HO4A 4DL7A 3TQ1A 4ZVUB 1PYOB 3GJSB 1H73A 4LF6J 4LF1A 1GX6A 2GMHA 4YS2A 4LF4F 3BO2A 3MFHA 4X4UA 2ZZTA 3R27A 3ENVA 1URRA 4I4BA 2QJ3A 5M2PA 5AE3A 2X1AA 3MEKA 3H4DA 4ED0A 4C8YA 4J9SA 3K8VA 2RILA 4RPFA 4FXDA 2APOA 4DL6A 5K8NA 2BMBA 1J5OA 5AE2A 4TU9A 4LVOP 4NYZA 4I2QA 1UETA 3H25A 4F3MA 2IPOB 1T9XA 1JLGB 2CVEA 1OQ3A 2GJFA 2QTWA 2MY7A 2VFRA 3H5UA 3HULA 3LP1B 5A6WA 3V6DB 2XY7A 5D4OA 3EZOA 3FRZA 1RYSA 1IBLF 2F4VJ 1TKTB 5G4DA 1OSDA 1VRTA 3W7BA 2Y9HA 4OJ1A 1L3KA 4F4AA 1D0EA 1B70B 4U96A 1WDTA 4L6V3 4DV2J 2Z2MA 4GVBB 5IWAJ 4ECVA 1YHQS 3TZZA 4XK8C 2BACA 5ITHA 1P1TA 2HS3A 1GMUA 3KLHA 3ILOA 2D3UA 3AB4B 4ZP9A 2W7AA 1HPZB 1X4FA 1J2VA 2RT3A 3BPDA 3QT6A 2FHOB 4RO0A 1FRJA 3TJAA 4CLTA 3C15B 3AHPA 4UZBA 4BDPA 1FT8A 3KLHB 2HFOA 1K0TA 3TA2A 1XK8A 3FBCA 2EFVA 3BB5A 4F26A 4WTYA 2X1BA 4USVA 1H3DA 1JJ4A 1W26A 3AXKA 1UW9A 2CDRB 3CB4A 4KKOB 3JB9k 1YTYA 4ELVA 2XG8A 4KPCA 3DOMB 4WFZA 2WSEC 3H0PA 3SDEA 2J7UA 4P52A 5T7LB 2VG5A 3DC2A 2F65A 1JJCB 4PG8A 1OQ6A 3QIDA 4N47A 2F3JA 4U7UD 4KT0C 1R8HA 1VIOA 1FKPB 2V0NA 3RAXA 4CLPA 1Z2ZA 4RBVA 2XCPA 1SXLA 4YEAA 4LIRA 2B8PA 3MAAB 2QZ8A 3CO0P 4DFKA 2I8EA 2HYIB 2YH1A 5GMDA 2I38A 1LWFB 1TU0B 2BBEA 4FYYB 2XMAA 4I64A 3OJSA 4DSEA 4KQZA 4BS2A 4NASA 2RH3A 3V6KA 2YKMB 2KB2A 2LCWA 4C48A 1KVIA 2RE1A 3M8QA 3PW0A 5DJBA 2VKZG 2KYZA 4WE1B 3TARA 3KLEA 2DY9A 1AUDA 1N54B 4LR7A 4CH7A 5B08A 2DR9A 2X3GA 4Y2MA 2YX1A 3NG8A 4C3KA 1MSWD 2W25A 3EGNA 3G71S 4DV2F 2DNMA 1EQMA 4X4RA 3HXMA 3KG1A 1QVFR 1TUGB 5A6PA 2QLBB 2OPRB 3PJ9A 3PEHA 3MM7A 4FF1A 2MYFA 2YNHB 1R8PA 3BV8A 1SV5B 1J5EJ 1TKTA 4ANDA 3M8PA 1JLFB 4NRTA 2BR0A 2ZBQA 3MI7X 1HBUA 2AT1B 2YY3A 3UCUP 3SCKE 1CS4A 4LRAA 3V4IA 2NPFA 2GO8A 5KFRA 2K3IA 1RBOB 2ATCB 5CZXA 3OR2B 4KGVB 4ECZA 3CCES 5KFZA 3TNVA 4C0BA 3R1LA 2DISA 2GGPA 4IH7A 2LA6A 3RRKA 1T3NA 5LJ5Y 1MMNA 1YZ7A 1U48A 5KFVA 1MWYA 3OFHA 4S0MA 3UD5A 5KFGA 2NYIA 4MTPA 1V6HA 4OI2A 2DNPA 2HFSA 1DBDA 4LBPA 4U95A 1S48A 3BR9A 4WTOB 3OLBA 3KHRA 3CD6S 3H7HB 3DHWC 1RT2B 2DCUB 1X31C 3PDNA 3L7UA 2Z56B 3C15A 4UOGA 5GAEU 1FWKA 2WOMB 5F0WA 5AJ3F 2RIJA 1KSPA 3DRPB 1TV6B 3AD7C 2FB0A 3MEGB 2MQ8A 2YWEA 3ILLA 3UVJA 3NGDA 3D9BA 5HMZA 4TY8A 1H7WA 1YJRA 3GMGA 1SJ1A 2DNQA 2C3OA 3K5PA 3KK3A 5B0BA 1T8EA 1S0NA 5F3TA 2PDAA 1TL4A 3Q8UA 2W4DA 3MPWA 3JQMA 3FK4A 4DV7J 1VC5A 1SI9A 1N5SA 4QPXA 4J9NA 5KFYA 1VQ4S 3N0VA 4I56A 3IP0A 1M5PC 3GFZA 2PFDA 1R0BG 2HHHF 3H5XA 1HNVB 2ZKUA 2H54B 1FFWB 4ZCKA 5K9FA 3VGSA 1ZM4A 3D28A 4I68A 3RB6A 3EVOA 1EARA 1N5YA 2ZH8A 3H2UB 2J8SA 3G82A 1YJUA 3NGUA 2EPIA 2AMCB 3IBCB 2YPYA 1U1NA 4F25A 2NREA 5D4NA 1SQGA 2B4UA 1YITS 1K73T 4M5NA 4QCLA 2IDEA 2DGQA 4CT9A 1VK8A 3IR7B 1FHTA 2HHWA 3E01B 2J5AA 1IKYA 1GTHA 2V4QA 2WAQD 1SJQA 1AFJA 1FD2A 2ZC3A 5DDQC 1UW4A 2CJYB 2VPYB 3BQ0A 4ELTA 1KQFB 2BQUA 4ZVQB 2DO4A 4LIWA 4U7UK 2AEMA 3NCRA 1U47A 3KLFA 1MU2B 4WPAA 3CDEA 4ZPWR 4E98A 1F2GA 2VA3A 2JDJA 4LSNB 5D0GA 5HAOA 5DDRC 3QJPA 3LP0B 1UWAA 5E33A 3EPIA 5C2GA 3VVUA 5A8WB 3RR8A 2Q3PA 1FKAF 3EJMA 4JI8F 1S6OA 2G1HA 4L3NA 4F7VA 4ECYA 3M05A 3OFGA 1DAXA 4IO1A 2YKPA 1PO6A 4B9UA 3HHLB 4DR5J 3RRGA 5EDWA 5H9FJ 2Y1IA 3B4DA 5K14B 2B7CB 4IG0B 1N36F 4QWCA 4CO0A 5DRKA 2E7XA 2Z2ZA 4JI5F 3MPUB 3AQPA 1EHWA 2D41A 2WCXA 1Q78A 4RNHA 2JWNA 4BWMA 2KT3A 2YVSA 3C3LA 1HNZF 4LF7J 3JTOA 4RW4A 4FF3A 3HPOA 2AYBA 2E5IA 3AD9C 3MEGA 3PW7A 1BQXA 1FDDA 3BKUA 4NZ6A 4DR3F 4IRCA 1HD0A 1R3NA 3W8PA 4C4WA 3K5MA 3MMAB 1YI2S 3WC0A 2J9EA 1XMQJ 1Q8KA 4WF9Q 1W7WA 2VFTA 2Z2LA 1S1UA 4IG3B 2Q6CA 3M8QB 4ED8A 1GH8A 3MR7A 1D09B 1RT3A 2F9JA 1BLUA 1QLNA 3RBZA 2QRRA 3MM6A 1BC6A 5EX3A 7AT1B 2F9DA 1SIWB 1SKRA 1K0VA 2RMLA 3LGMA 1UEUA 3AA9A 3GPAA 3WIVA 2I1RA 4AXIA 3OHAA 1EKRA 2RF2B 4YR2A 3THVA 1JXVA 1LXNA 1RABB 3ET6A 4N77A 2B5JB 2J6UA 5EGYA 1U26A 3D67A 3KMQA 2ADBA 2LQBA 1Y7PA 3BYRA 1FKPA 2RRAA 2RB7A 5HANA 2VODA 3BGUA 2JFKA 1NCLA 3AOCA 3EZUA 5KG3A 1AFIA 1PKUA 1RKIA 3IM9A 5CYMB 5LOQA 2GZOA 1HBNA 4FVMA 4CLZA 4IH5A 1HI8A 2C2KB 5IS2A 1CC7A 2CG8A 3X3UA 1ITPA 3HKWA 4NZ0A 2E7WA 1RYRA 4R25A 3SQGB 3PIPQ 2EG1A 3S6EA 1NKBA 1TFYA 3P3DA 3G6XA 3HFVA 3TZWA 1BGXT 1IKVB 1JLQB 5DGAA 1T95A 1YRXA 3QRQA 1TV6A 3SZ2A 2CZ4A 1GXTA 1MN9A 5ETNA 4IOAQ 2MPUA 4HR2A 1HQEA 1IM4A 1ZH5A 3ZZPA 1HKAA 1WF2A 3J7YU 4DX5A 2CPFA 4RW6B 1VQOS 2WK4A 5ETVA 5KT7A 5DZ7A 3AB2B 1Z4UA 1S9EB 3W65A 4E8UA 3AT1B 1RHQB 3LAMA 1VS3A 1EZZB 3UI3A 4XPEA 4PUOA 1NSQA 3U27A 1RADB 1VQ8S 1UEKA 2YBVA 3GJTB 2CRLA 5DQGA 3PR5B 3HO1A 3J7AN 1FXLA 1C0UA 2M52A 3CCTA 1ZBTA 2YNGB 2DH9A 3B8HA 3EM1A 2CQBA 3IRXB 2E9ZA 3A3OB 4ZVEA 4PQAA 3K59A 3M6UA 2AYGA 4ANEA 2V8GA 2GX8A 1HNXF 3RBEA 4CH0S 2HNYA 3BJYA 2CJKA 2H3EB 5IZHA 4QR2A 1RAEB 3FDSA 1WDDA 3EZ5A 2QG9B 2HWIA 1QAXA 3HHEA 3HSDA 4NLOA 4FPIA 4WIQA 4B3RJ 4JI5J 4KPYA 2X7IA 4MAKA 2RF2A 3TWZA 4LF5F 2HZVA 1ZTTA 3OQ2A 3TP2A 1G6BA 1M5SA 2OPRA 3BDEA 5D4PA 3ONQA 2MKYA 1FWPA 3VQTA 3KDOA 4O4GB 2ZM6F 2ROEA 4A8MP 5HVFA 4JI2F 3BQ2A 4DSLA 3PW4A 2B4PA 4LF8F 2OAUA 1N88A 4M1KA 1K47A 1U0HA 1F1BB 4NI2B 4DV1J 4JI0J 1XBWA 1NPRA 2JH3A 3HFKA 1FX4A 5IT0A 3KLEB 4LF9J 3MUMP 3LH2S 1Z2LA 3BGRB 2HGLA 4UTGA 4JI1F 4GC7A 4DXLA 3MFIA 4DV4F 1YRTA 3Q8VA 4ZCLA 4G1QB 2C3UA 2GQCA 1R89A 1C1CB 4M63A 2GMLA 1R8BA 1RDRA 4UQGA 4WFAQ 2HMIB 3IC1A 4M8LA 2KT2A 2O66A 3AJDA 4NLUA 4Q7AA 4F3QA 3MDFA 4N56A 3IN5A 2ZH9A 3ZZRA 2L9WA 3UW1A 1K44A 1O0PA 2YNIA 2W8LA 1F6TA 4NLQA 4RW9B 4WK1A 1Q7YT 1GEHA 2EVZA 1RT5A 8ATCB 3GV7B 2R9LA 2KVQE 4UOHA 1RI7A 5IT9Y 3KOAA 3NGKA 4MK8A 3OSPA 2HIQA 2V4JA 2BE2B 4JYAJ 3M2VA 1B64A 1JB0C 3MOZA 5DO2A 3W9JA 2OPQA 3BN4A 1N56A 2FDNA 1JX4A 4KC5A 2HAIA 3GZ7A 3UDCA 2Q66A 1FFGB 2GHPA 2XEXA 3MEDB 4KKOA 1S9EA 3TRGA 4G1QA 1TZ0A 3FQLA 5H9EJ 4NE9C 1RT3B 2NLWA 3T1YJ 1WI6A 2B0GA 3BS9A 3D1OA 3W66A 3PKYA 1JWWA 2DO0A 2CQHA 1HQEB 4LMZA 5KFMA 4K2JA 1S0OA 2V63A 3O6QA 1KOOA 2JEFA 1IR0A 2RHSB 4RUBA 4MYTA 4WU2A 2QLFB 2BVZA 1UL3A 2J0WA 3CSKA 3IO1A 5KFNA 5LJ3Y 2DHSA 4WK3A 5GADU 2RQ4A 2G2YA 4USMA 4O3RA 4KR0B 1GT8A 3CJ5A 2UV8A 3ZZTA 1SL1A 4CTAA 1AYEA 2VG7B 4DX8H 5DGBA 4OYIA 4DPTA 4AE5A 4QR0A 3MM9B 2M8HA 4OI1A 1EETA 2WVDA 2DGUA 1Q8BA 4KE5A 1U6FA 4C3MA 4DS4A 1LW2B 1C1BB 4DX7A 4Z2XA 2MGZB 1RWXB 3CMQA 1LWCA 2G0IA 1U09A 1NBEB 1MROB 4ZP8A 1S6QB 4WKRA 1IBCB 1T9VA 1DZ5A 1WKKA 2DD8S 1H72C 3PG9A 3HSGA 1L5UA 1TR0A 4G6VB 4A8OA 2CPEA 2IA0A 4UUXA 3TO8A 4O3SA 1I51B 2LQJA 1JQGA 4QWEA 1S0MA 5IM0A 1DY3A 4CM2A 3CWJA 3MM8B 4IQMA 1NHKL 4M5KA 5C2CA 1SKSA 3PEJA 4W90B 2J7KA 4EZ9A 3K2YA 2MKCA 3AY0A 1G3OA 1S49A 3MM8A 2MXYA 2R8IA 1XMOF 3ZTSA 3MCOA 4JI4F 1P6TA 1X5SA 2E1AA 4O4RA 5KFCA 4QIVA 4TKTA 5C24A 1NDCA 2ALZA 1C4CA 3JYTA 5M2RA 1X9MA 1FERA 1WHWA 4DLGA 1WD6A 1R0CB 2V50A 1RTDB 1YJ7A 2J0SD 2LLZA 1KP6A 4RW4B 4ZVRB 2KG0A 1FRMA 3BDPA 4F2SA 1IJEB 3IS9B 4XDDA 1AZSB 2IVYA 2W9BB 3EX7B 1HNVA 1NK5A 2NXNA 3CO9A 2CKWA 3DGPB 3NCPA 1CJKB 2IHR1 3KFWX 1HA1A 3DYAB 3OR2A 4FKYA 2CZVC 3Q8PB 3RB4A 1CJTA 3FMBA 5JUMA 4OLPA 2OPSA 3J80Y 4J9QA 4IG0A 3N6LA 2AW0A 1QUVA 5KFHA 1CJKA 3L95X 2MQOA 2DNRA 2FHJD 5IXUA 3OVSA 4G3IA 1HLWA 4I2PA 4DBQA 4I6YA 4L72B 2OMOA 2R2SA 3NLCA 1TKXB 2W2OP 3IWLA 2B3TB 1FFSB 4KFBA 3CJKA 2UXBJ 1D3WA 4ZKAA 4ZIWA 3JSYA 3SYZA 4L73A 3TQEA 1NSAA 2G2OA 1YZ6A 3K7RA 5A8KA 2BOPA 1BUXA 8AT1B 2WOMA 4R5PB 4J9LA 4RBUA 4JV2A 3EICA 4B08A 4ZLPA 2MSTA 4PYAA 2KZMA 2M8DB 1ZYQA 1JXLA 4LQ9A 2LDIA 1YBTA 1HBMB 4OYXA 3MMCB 5HSPA 1N32J 1ZETA 4OYAA 1FNOA 1K8AT 3VZIA 3CULA 2N4DA 5IC6B 3QYYA 4RW8A 3T5KA 1BQNB 4DG1A 2FTRA 3TUJC 3GV8B 3QZ8A 1N5YB 4JI4J 4KFBB 2ATLA 3OL6A 4CRJA 1FRHA 1XMOJ 5A8RA 1V3RA 4F4KA 3WQPA 3UD3P 1P9QC 1F9EB 4L76A 3RYLA 2C3MA 2MTLA 2IJRA 4QWAA 3I55S 2C22A 2UXDJ 2R7TA 3LPEA 1CS4B 4AYBD 2GIFA 2HQIA 4J37A 5T14A 1WOPA 3CNQP 3IGNA 3JTNA 4ICLA 2HFUA 2E9TA 2K06A 3C46A 2AYEA 2M4MA 3W64A 4N8OA 4WU3A 5J2PA 5KFSA 2CPYA 4FBUA 3UNGC 1HARA 1RK8A 2P5VA 3BGOP 5KFJA 3RG6A 2W7OA 1IKWB 5A2QU 1CULA 4F50A 3ZTPA 3PY8A 5KG5A 3DDKA 4DR2F 2VFUA 3EDRB 1Q4RA 4DDFA 2DBBA 1RA6A 2QGFB 3PYGA 4FKXA 2R7XA 1K9MT 2GCFA 2AJ1A 2YQ3A 2FC9A 2GHVC 3VR1A 2P9EA 4ID5A 9RUBA 1U6ZA 4J9PA 2QL5B 1SBRA 3TAPA 4B3SJ 1LV5A 1SQFA 2C1EB 3PYDA 2OMLA 3NS7B 2ALYB 1BY9A 4QIEA 3UDVA 4TQRA 2LFVA 2NZCA 1WEZA 2YX7A 1CVJA 3MUTP 4NLXA 4USJC 4IFYA 4CO5A 1MG7A 1R31A 1WNEA 4K59A 3TANA 1WKLA 4GO7X 2PEHA 4LFBF 2HGNA 4NLYA 3NBPA 2BOAA 1OPZA 1VHIA 3AAWB 3DI6A 3GTYX 2B6AA 3OBIA 2VG5B 4G1IA 1N4LA 1R6YA 4B3SF 4FYDA 1Y9OA 4NA2A 1CQMA 3P5BP 4MH8A 4BHQA 1TL1A 3KK3B 1S6PB 2ILYA 4F4XA 3M4XA 4XAKA 5KOWA 3CTRA 3I4PA 5DETA 5KFQA 1XERA 1M5OC 4ID5B 4HKQA 1RHUB 3UVJB 1WC4A 2MZ1A 1FKOA 5DQHA 4DV6J 1L3SA 2Y1RI 1IWGA 2HG4A 3DLKA 3SV3A 3T1HF 4ZDNA 2FJVA 4YB6A 4I1TA 1Q82T 1L3UA 3ZTRA 1HPZA 3MPVA 1H38A 1YIJS 1X4AA 5E41A 4LFAF 4Q44A 3IBFB 5ADZA 1NUEA 1PYSB 4GVBA 5ETSA 3W9HA 3I96A 5LSOA 1EIYB 2L08A 1SC4B 3KHLA 1RU2A 3TVZA 1UCNA 2CQIA 5C7PA 4DR1F 2HQFA 2OPQB 3C16A 2JRSA 3WZ0A 1TL3B 3T6JA 4IR9A 2F5GA 5KFAA 2PMZD 4EBCA 5HVGA 5DLFA 1DTQA 2HNDA 4N76A 1JKHA 1RAIB 2M7SA 4H54A 5ETKA 4QPTA 1KVJA 4LFAJ 1QSSA 1OPIA 4RW9A 1PIEA 1DTQB 2BEFA 2HNDB 2MQMA 2R42A 4K5RA 3CCLS 4B3MJ 3IMQJ 1HBUB 4FNHA 5GMEA 3FFIA 4FXWA 3FQKA 1S1VB 1N5VA 4N7TA 3US5A 3W2WA 1HL6A 2Y8WA 3C19A 1KLMB 4DFJA 2JVOA 4OX9J 1D8ZA 4LFCJ 4GVLA 4KH1B 3TW0A 4GKJF 2IM0A 4WP9A 2IM3A 4DJBA 3D3CJ 1NDKA 4IR1A 2LA4A 1Y4ZB 2ZHAA 2H5IB 2VKRA 4KV8A 4B9SA 2W2NP 2L3MA 1A0OB 1WG4A 3GIIA 3MMAA 3HHNB 5ETMA 1CULB 3P4UB 4TN2A 4QR1A 2ILZA 3Q8RB 3T9NA 2DHXA 2Z0GA 3KJQB 4TYBA 1HQUA 2E5LJ 3DLEA 2UUBF 1NEEA 2XLIA 3I6PA 3NS6A 2XQCA 4OHWA 2DXEA 2QT7A 4A8YA 1T05B 1VIXA 1S1VA 4FYWB 4TU8A 5L46A 3OW2R 2XC9A 3HVWA 2IIHA 4ETXA 1HMVB 3OHBA 2KO1A 1NHVA 2XMMA 3MPDA 3TAQA 4WZQA 2AF6A 1N34J 1EX8A 2VDIA 5D15A 5E3QA 3A4TA 1UPMB 4NL5A 2RD5C 2M70A 3M2UB 2FHKA 2XHWA 3POTA 3KLGB 2XO7A 2ZBIA 4H4KC 2UUAJ 4K4XA 1HWLA 2JFDA 2P6SA 1HR0F 3LPYA 4URQU 4K4VA 1EB0A 5ETLA 4J9VA 2LU2A 4X4VA 2RU9A 3NAIA 1KFDA 1S4FA 2QMUB 4RUAA 3K58A 3DOMA 2BW7A 1TVRA 2H9ZA 3HVTA 4PUOB 2IJNA 2OEMA 3J81U 1RHRB 2EBGA 4RUHA 1M5VC 1RHJB 3JS9A 1WHYA 2MLZA 4NA3A 1RGVA 2DIUA 2XWXA 1FK9A 1T3OA 1NJYA 1NH7A 4ZHRB 3TEHB 5GMKa 2DNZA 5A0YA 3PXGa 5JVHQ 1Q8LA 4X65J 5HP1A 1XNRF 4AQYJ 1VI7A 2AHOB 2XS5A 2IRXA 2PN6A 3F73A 2E7VA 5DDOC 3JAMU 4DR6J 4I7FA 3MPYA 4ZJQA 1XIQA 4ED2A 1BMQB 2OEJA 2MEWA 1TKZA 1UTAA 2VPXB 1T11A 2WBRA 3IXQA 1OY9A 3MD1A 4ZPBA 5LSRA 4A8SA 2HWHA 3BEGB 2BYCA 3DRYA 2HHQA 5D3GB 4TLRA 5B0DA 2WSCC 3OLAA 2O5DA 2XYPB 1LWCB 4OJ3A 2MHEA 2XMWA 3QQCD 1HYSB 1B0TA 3WIUA 6FD1A 2UU9F 5IV3A 2HHXA 3M32B 3HSJA 4Q2LA 2XGQA 1RTIA 3JTPA 4X4PA 4AL6A 1SJ4P 5LT5A 3CC7S 1WTFA 2KDOA 3MUVP 1UA1A 3DRRA 3EMTA 1LWEB 4FPRA 1X4HA 2A6MA 5AXKA 5B0EA 1WG1A 7FD1A 4DR3J 4IFYB 5DS7A 2CA9A 3D7SB 3G8SA 4JI7F 4TVAB 2AEFA 3OXLA 5A8WA 5F9NA 2KHDA 4CO2A 4DQIA 3DRSB 3GLJA 5L1IA 2GVDB 3DOKA 5EWGA 2GMJA 3DRPA 1IXKA 1HBMA 1OJ4A 2NPIA 4CLWA 2ZH4A 1S9GB 4OZ1A 2R8KA 2CADA 2C3YA 5A0YB 3MR6A 1Y0HA 3NAHA 1VRUA 2HK2A 2CPHA 4KGMA 4DV5F 2K1RA 2BJEA 2VHGA 1LWXA 5HJYA 1WI8A 5HBMA 4W92B 1QSYA 1NPKA 1Y10A 3MAQA 2FZKB 3BSAA 4B9VA 1I3OB 1NXIA 4P7TA 3M9MB 2BE2A 1URNA 5SZTA 1P1LA 4DWIA 2IAJA 4B02A 4X62F 2LEPA 3BSCA 5HATA 3HHLC 3TA0A 4DLEA 1YJTA 2MGZA 2DGXA 3M6XA 1OS5A 1IQZA 2RHQB 3Q0AA 4DZDA 1H2TZ 5ETOA 1UMJA 1RWVB 5JJBA 5GAGI 4CTAB 1LQ9A 3BKFA 2BJDA 1S57A 3IAM9 4DL5A 2QIFA 4J9UE 2V4RA 1HHQA 3VWSA 1HNWJ 1NO8A 2HPUA 2D3OR 4C0OC 3AQOA 2UV8G 3UO0A 1B4SA 3JYTB 1QVGR 1DLOA 1RJJA 4CO4A 2FPHX 3BGRA 2HHHJ 2AJ4A 1Y5NB 4EFAC 2ZDPA 3MEEB 2B9EA 2FYXA 3MMCA 3BO4A 3J7Z5 3NMAA 3I4HX 4Y34A 1WUUA 2DJWA 3VAKA 4O0NA 3L3CA 4V1Ak 3FBBA 4MKAA 2N82B 2DYAA 3BH6B 2W4CA 3MGJA 1RTJB 3CCWA 4PG5A 1SKUB 3G4SS 2A6OA 2CYYA 1I5OB 1Y5LB 5J2QA 1V3SA 2XULA 3GR1A 3I56S 4QWDA 2M3DA 3WX4A 3CCRS 1B3TA 1UVIA 2ADCA 3WX8A 1U6BA 5ETQA 3AXMA 2EFPA 5KFPA 2HHTA 3ADAC 3V81A 2DITA 2GS8A 4PG4A 1UVJA 4DQQA 1NPPA 1OY6A 1N5QA 2GNKA 2JLEA 4JUZA 1K1QA 2VUGA 1JNZB 2RDDA 3CMAS 1HMVA 1T0TV 2HQDA 3GFXA 3IRXA 3DLBA 3PFOA 3PJXA 4N5SA 2PEBA 2W2QP 1GXLA 1PAUB 3DLHA 3KLIA 3I9ZA 2XSFA 3PYFA 4KAIA 3RBDA 5GADI 1TAUA 1G7CB 1L3TA 5C25B 2F8EX 1LKZA 3W62A 4ECSA 3PHEA 2QL9B 3Q23A 3AFGA 4KGKA 1T94A 2C3PA 3QWPA 3OV7A 2R7RA 2VQFJ 2ACMA 4DR7J 2XLKA 1HBOA 2DGWA 4KBIA 2AX0A 5HK4A 3OUYB 2F8HA 1RBLA 1QE1A 1U2CA 2DNYA 3DM2B 4PKDB 2YKAA 4WIIA 4ZVOB 4NPOA 5MAOA 3QGIA 5C42B 3HMJG 3KK1A 3EGZA 1BWVA 3LO3A 4AQYF 3IM8A 5CHCB 1FK9B 1JMTA 3TVYA 2R4FA 3BH7B 5L39A 1ICEB 4LJMA 3GSIA 1U1QA 3GE9A 1NJWA 3GYXB 3LP2B 3O2IA 2UP1A 2B7BB 3I5CA 3EGVA 3JSMA 2MZTA 1TUVA 3GU0A 1ZOTA 2XZTB 2R2RA 3X1LB 4K4SA 2B6AB 2RNEA 2Y8YA 2HGMA 5D77A 1Q0NA 3FBEA 2MB0B 3ZNJ1 1F3FA 3RW6A 4X62J 4RL1A 4HHJA 3D5MA 3VALA 1EJ7L 1CC8A 2AP6A 5DG8A 1IN0A 1OSCA 2KL8A 4JI0F 4DV1F 1R0AA 1RE1B 4P6QA 2LEAA 1PAEX 2VIHA 3MM9A 4NLRA 4R8UB 4YY3J 2UXCF 5EX0A 2DVIA 4YHHF 1S59A 4I6WA 3ETOA 2C2DA 2RVJA 3VAMA 4LSZB 4RBTA 3SSQA 2GQ2A 3VHQA 4OZ2A 2R7WA 2KFYA 3H42A 3SIPB 1B7FA 2KTQA 2UUBJ 2QA4S 3GJQB 2DPJA 3BZQA 3M8SA 3FRYA 4C8KA 4KO0A 1PC4A 3SFUA 1U0HB 5BYSA 3J81j 2GQQA 3MEEA 3NS5A 4OHVA 2IVFB 1PBUA 3A8KA 2EFGA 3ZZYA 5I3QA 1YKWA 1W2BR 1VQ5S 2V8PA 3B6BA 3U02A 3V6JA 4M95A 2IY5B 2GJ2A 1VLYA 1VQKS 2QN6B 2QSWA 4MIBA 3A3NB 1T03A 4M94A 3L7PA 2I2YA 3UR3C 3UDEA 1IWAA 4GKJJ 1UFWA 3O3LA 3MAAA 4J90A 2HHSA 2J9CA 2LXIA 2GC8A 2ZOMA 3RW7A 4EGLA 1BD6A 1NLKL 2VFSA 1REGX 4ID8A 3D6HB 4QIWD 1NM2A 2FIUA 3KUEA 2DXDA 3CJ0A 4WYLA 4OYPA 2HNYB 2ZOFA 3O44A 5LMUJ 3NWRA 1W25A 3V81B 2HIYA 2Z57B 3DKDA 1C0TA 4FP9A 4MK7A 4DUZF 3PW5A 2J6TA 5F8NA 1JJHA 5T7LA 5RUBA 1HW8A 2R7OA 4DL2A 2NR0A 1BQNA 1N33F 3KNAA 2W4PA 1XNRJ 4N41A 2ROPA 2Y0BB 4LSNA 3VAHA 2BANA 3Q83A 3LP2A 4NLVA 4RJVA 2CQ1A 4UOFA 4DCJB 4D3HA 4EO8A 4A8WA 2WBMA 1ZM2A 4ZJLA 3VGVA 2FVSA 2XBPA 3QPIA 2HHVA 4RZRA 1TMJA 4ECRA 2BABA 3KK1B 2AIRB 1T9YA 4JV5J 1F9FA 2DGOA 4DV3F 2KM8C 1VBXA 1ACMB 1HHSA 2PMHA 1WKJA 3N4WA 2IDLA 1YRUA 1YX2A 4DQRA 2IRUA 3U1NA 2BM0A 3ZTQA 2PC6A 4F3OA 4LF6F 3DMJA 2XS7A 2ZDOA 3CD7A 3PFEA 2HQGA 3PTWA 2POKA 5D0HA 2VQEF 1KQGB 2D9PA 2G0CA 2IVMA 3DN9A 2PT0A 3PM9A 3CPWR 2I5JA 2QC3A 4OZJA 4TLQA 2RRBA 3EUNA 4ED1A 3QT5A 1TELA 5E3CA 1OY8A 4V19J 1VQ6S 2HLUA 3ZC4A 2JZ5A 2LVWA 4Y2AA 2IRYA 4NYOA 5KG0A 3GG0A 4Z7CA 4NMXA 2R8JA 2VL1A 3PCOB 2JLFA 3GWCA 4J91A 4EU0A 3SMZA 3AOBA 3WHIA 1V3ZA 1UJ6A 1WC3A 2ZBPA 2EKNA 3I0SB 3EYZA 2VD3A 3CVKA 2U2FA 2PA8D 4FYVB 3ZNUA 2ZH3A 5HBMB 1M5HA 1SCJB 2OJ3A 3D0IE 4GKKJ 3MMBA 4LRFA 5I3PA 2LXUA 3VGTA 3FSYA 1AT1B 4WCEQ 2VJUA 2ZC4A 3SCLE 1FXDA 4ZK7M 2VG6B 1RT7A 1RTJA 4HACB 3M8RA 1MU2A 1RQ0A 3KJVB 4UQTA 1NSKL 1O5JA 1VYAA 2G2ZA 3KG0A 4HH0A 1ROFA 2XYHB 3I0RB 2V94A 2CG4A 4USUA 3E01A 2XGPA 4ZVPB 2EFQA 2HSEB 3ZZOA 2CPZA 1N36J 2KM8B 4G1PA 4O44B 4YFUA 2GJIA 1F2HA 3NRBA 1UWBA 2J0QD 5D0EA 1S99A 4Z37A 3RRHA 4Q8EA 4LREA 2HWTA 2ASDA 4HDGA 4FVCA 1H0HB 2HFVA 4Q43A 3MCMA 1P27B 3FKBA 1NK4A 3ZZZA 5K8PA 2MZRA 1HBNB 2LMIA 2R7QA 2OPPA 2YKQA 1VFJA 3KUGA 3NKYA 4C6AA 4C97A 4ZOSA 2Z2YB 1IBLJ 4Q0BA 3PX6A 1J5EF 5KT3A 4OYWA 3LTOA 1BXNA 3UQSA 5L8RC 1U4BA 2DEJA 5FJ4A 2DH8A 2KFNA 4I69A 1WC5A 2ZUAA 3NWGA 2PI4A 2ZBRA 3MM7B 1N33J 2CJXB 1RBAA 1NJXA 3HHKA 2WSFC 1YG0A 5DG9A 2IYIA 4C11A 3TEGA 3KMSA 1WHVA 3ENQA 4O44A 3HJFA 1IQTA 3MCNA 1MW7A 2FQQB 3AH6A 3KDNA 5E7OB 3UPFA 3K89A 4RX6A 5B0AA 3M30B 4LSLB 5CZVA 3RAQA 4U8VA 1ZPWX 5G0RA 5CAAA 4B3RF 1KC8T 2ZVSA 2P6TA 4U9RA 1UKUA 2YH0A 3W63A 2B4OA 4K5SA 4PXCA 2OUGA 3H2LA 1NH8A 3CCUS 2B4VA 4BBYA 3PR4A 1O6XA 1E6VA 2ZWOA 1ZA2B 2MKJA 2N3LA 4CLKA 1HHTP 2BM1A 1RLDA 2CQGA 4R0JA 1BWEA 1YK9A 1G1XA 1C0TB 1IBKF 2JEGA 3T9ZA 1C2PA 5FLXY 3M2UA 3POTB 1LWEA 3GSDA 3I87A 2F63A 2DNOA 2GAHC 2LU1A 2XI3A 1NNDA 3CJ4A 5K8OA 4XIUA 1NKCA 4PQUA 5KT2A 1VJWA 2D1CA 3LW5C 5IC4B 5IT4A 1IKXA 3KYLA 2H1YA 2EG2A 2Q6BA 1V5VA 2BJ1A 5KFFA 1DTTA 2KG1A 4AXJA 1SL2A 2FLLA 1RT1A 4USKA 3FBFA 1UVNA 2GVZB 2J9DE 3FSXA 1NDLA 1D8YA 1LNQA 1QJHA 2HKEA 1F3VA 2HRTA 4FNIA 4BLGA 1U1RA 2OO4A 2EXUA 3A1YG 2E66A 2CAJA 2CPDA 1U8WA 3C6TA 4WXOA 5KTQA 2FJAB 1TP7A 5I4MA 4DV3J 1I6JA 1Q81T 2VOOA 5GAGU 4PZVA 4K50A 3ZZ0A 4P2SA 3BGFA 4KTQA 5THWA 1QDUB 4QZVB 2I6WA 2A1BA 3OFFA 3D0GE 1KTQA 1N8RT 2FD2A 2ZBCA 2F4VF 2OHDA 2O1PA 3SV4A 2VONA 4LRCA 4OX6A 1N48A 2R7VA 5L38A 2GIRA 2AGQA 1RZMA 2V4JB 4DV0J 4H4MB 5J1EB 3EWGA 4Z7YA 3NY0A 2DHAA 1TK5A 3N6MA 2ERRA 5L9NA 4DUZJ 1KVKA 3DXBA 3BKTA 1VHFA 4Y28C 1G2EA 2HS0A 2YQ0A 1Q8IA 4C8MA 4RNFA 2XNRA 1LFWA 1FVSA 1ZAWA 1XEZA 3CGIA 3HKZD 1RTHB 3GCWP 3RZAA 5E3RA 1V9OA 3M8PB 4AFFA 5KFBA 4B9LA 1SUQB 4LF4J 2I9SA 4OMFG 1AZSA 1B7YB 1VMBA 2P8IA 4P73A 2ZH5A 1X9SA 1T7PA 4ZIVA 5IFMA 3RB0A 1Q1KA 1F5AA 4TY8B 1MLAA 4OV6A 4QYZK 2KHCA 3N79A 4LR9A 2F8MA 1YBAA 1M1HA 2KRBA 3QGPA 2CPJA 2YPZA 2P9CA 4RW7A 4EZ6A 2R7SA 3V6HA 1EQ0A 3EXCX 2G0JA 3PNIA 5K5MA 3T41A 5KT4A 1U25A 1XC9A 3HD1A 4F2RA 1HNWF 1UP1A 2VPWB 3DM2A 4NOHA 5LMNJ 4QOTA 4RW7B 4URGA 2C2OB 2IFXA 2XI2A 3IG1B 3PJWA 4H4OA 4QIFA 5BYQA 2AQ4A 1FCAA 3OPKA 2L9NA 4HH1A 1ZM3A 2HBZB 2CNLB 4OYZA 4A47A 5IM0B 3BSOA 1KFSA 3VAJA 1FEHA 2VBYA 1FRIA 3MEDA 4WBFA 5C5JA 1XWLA 2K7KA 3O1LA 3W2WB 2DIVA 2AYMA 3M8ZA 1YWXA 3PRDA 3HDSA 2DR6A 3I5BA 5B0FA 1NK6A 3PRBA 4OFZA 1YLXA 4NRUA 4CLSA 1KLNA 2KRRA 2B9WA 1GAOA 1ZZFA 1U24A 1JLGA 2J6SA 1FO1A 1KDNA 1TTHB 3OR1B 2JHEA 2PI5A 2FVCA 4C3LA 2JL9A 1WACA 3ILJA 4CQ1A 4OIXA 3TZXA 2D7SA 3TX8A 4DCOB 4B3TF 4K2XA 4B9NA 1D9AA 5KOXA 3W5ZA 1WTBA 4CI0B 4ATNA 1HNIB 4CO3A 1F5CA 1W2IA 1APSA 4CWBA 1QUPA 4LVNP 2NXEA 5A76A 3CMES 2E1CA 3IWNC 4HHUA 5ETRA 2OSRA 1TUWA 3PX4A 1LK5A 1KNZA 3R8YA 3DMJB 3CD5A 2HZAA 2YWGA 3HVRA 4L74A 3GJRB 4PWDA 3QWUA 4F4WA 3C6TB 3CCVS 1VQSA 4NI2A 2V2KA 3GP9A 4JB8B 1O8BA 3CC2S 4B3MF 2HVDA 1S1TA 1MWQA 5HI7A 1NK8A 1RU1A 2DT9A 2J0XA 3PHTA 4UOCA 4DN9A 5K20B 3TAMB 4CLLA 2AGPA 4PRFA 2AJQA 2YNFA 2GIQA 4JI2J 4LF8J 2M88A 3TZYA 1UPPA 3PX0A 1FTRA 4I2PB 4MIAA 3MF5A 4O0IA 4Q0BB 3QMQA 4EYHB 4P2MA 4RNOA 1FESA 3FFIB 2EEYA 2FC8A 4LF2A 2HRYA 4NLDA 4YDXA 2ZWPA 4JI6J 3G6ES 4H4KA 5BR8F 2OTLS 2Z30B 4I2QB 1GMVA 4TNOA 3AODA 2WW4A 3LALA 4HEA9 4OX8A 3RBXA 4A8QA 3J7A1 4DR6F 4F4YA 3GIJA 2QFIA 1OIAA 1ZZNA 2Q1LA 4X65F 4RU9A 3M2RB 3GIMA 1FJEB 1QM9A 2PGCA 1KONA 3QAEA 3T5HA 4NEZA 1NK0A 4OZ5A 4HLBA 4KHRA 1S1XB 2OKQA 2W9CA 3OSNA 5DZ6A 2IC3B 1RHKB 3LP0A 1MMDA 2AEJA 3BBBA 4NXMJ 3OTCA 1YBUA 1U49A 1WORA 5F0UA 4MKBA 4IRKA 2EKYA 3EE3A 3MR5A 5J2NB 1H7XA 1XN9A 1JLCA 3J7ZT 2L41A 1CJUB 1X4EA 4WYWA 4QJVA 4RR5A 3TX0A 2KVIA 3SSSA 1VOMA 2V67A 4FYXB 5CYQA 4GRSA 5GAHU 2IBKA 4WFYA 4NZ7A 3DRXA 4QYRA 5BYRA 4CIOA 3OL8A 3P6YC 4K0KJ 3SQGA 3D1HA 1HQ2A 2FLPA 4OX7A 2XTJP 1RCXB 4P9SA 4GMKA 4CLYA 2MZSA 2CXEA 2E5LF 1RSCA 2JVRA 1IUJA 2MZQA 2DPIA 1HD1A 3LUYA 1FF2A 2M0GB 2CJ9A 2NS1B 3DLJA 3CCSS 4PPZA 4L75A 4ZVSB 1YSJA 3CXCR 4K0KF 3D3BJ 1XQIA 1NU4A 1Q86T 1TFWA 2DNKA 5D3GA 2FJWA 2RS8A 2WONB 4YR3A 1VQYA 1SJRA 4HT7A 1RTDA 4J9MA 4TY9A 3DHXA 3ITHB 3RAMA 2G1DA 4DUTA 1HR0J 1RT6B 1E6VB 2OP5A 2WVFA 4QQBA 3CCMS 2BQRA 2UUAF 2KJVA 1SC3B 4KRWA 1NHUA 4UUWA 4MK9A 4USTA 4ED6A 4LFCF 2DGVA 4EBEA 3UFCX 3UNYA 5B7WA 2UVWA 4P71A 5U47A 2V5HG 3R5GA 2VB6A 3M7VA 1LXJA 4YN3B 3NP5A 4ETZA 4OHZA 4ZHRA 5KG7A 3M30A 3G8QA 4LSLA 3KJVA 2FY1A 4G65A 4DSJA 2RUSA 4KYZA 1JJ2R 4KHPF 3TR5A 1QE1B 2CIMA 2MLXA 4CNZA 1YJVA 2BKOA 4GC6A 2GAGC 4TU7A 1M1KT 3CJTA 1HWKA 1U1MA 4XO0A 1VDHA 1VJQA 3MCSA 1CG2A 1WC1A 2F40A 2ABYA 5KFLA 2DR8A 2JEJA 2I0XA 3HSZA 2GGPB 1SH3A 1XR7A 5AJ3J 2V9WA 1CJVB 1GK8A 3QGHA 5D6GA 3CDUA 5F8MA 1HNXJ 2HVZA 2EBEA 2FHJA 3Q8SB 2GHWA 2H5EA 4DSIA 2CUYA 4P2XA 1RTIB 5JMNA 2KKHA 1N5TA 3EVMA 2VBXA 3VQSA 2OPPB 5I3UB 1XMQF 1TK8A 2FLNA 4KSEB 1YQHA 2GW8A 2HQCA 3THPA 2W9BA 2ASYA 1Y00A 2DTJA 2KT5A 3ZXWA 2IAJB 4Y2KA 1QTMA 3OVBA 2CJAA 4F02A 2DEIA 1Y3KA 5KG2A 2NZ4A 4DR5F 3RGIA 2V2ZA 3T1HJ 2ZZNA 2NSCA 2XMVA 3OXGA 1HFEL 3HK2A 1K1SA 1Y5IB 1S76D 2VH7A 2K1RB 4AL5A 1JIHA 2ASJA 1VRQC 4W98A 5CD4A 4ECWA 1C4AA 4IOCQ 2BRLA 1RWOB 2AJFE 2K3KA 1JLCB 4M5DA 4YMEA 4KV8B 3IGVA 5KFDA 3KLFB 4DV0F 1CLFA 3CE8A 3FMWA 4USHA 3HF5A 1UVKA 4ECXA 1N6QB 4EMDA 2C2MB 2RQMA 2MKIA 1LW0B 2IA6A 4X4NA 3F41A 1QY7A 4B9MA 4LFBJ 3PACA 3RUBL 2L48A 3R5AA 3K5LA 1R43A 2CQDA 4Q45A 2ZE2A 2XCAA 1RAJA 1S7HA 4M5LA 2OTJS 2G9OA 2RKIB 3L09A 1DQ9A 2MLYA 1S6QA 2C2ZB 4LUBA 4IYQA 3M9OB 2DR5A 3QJJA 4ZP7A 2DB1A 3QRPA 1MNEA 2LQ9A 2QYGA 1TAQA 3TJ9A 5I3UA 3FSIA 1ZAXA 3Q8YA 5KG4A 1FRKA 2E1MC 4L3KA 3BR8A 1UJ4A 4ZVTB 3CCQS 1F5BA 4IDKA 2XM3A 3GIKA 5EUHA 2VC0A 5KFTA 3SCIE 4C8ZA 1FJGF 4OV1A 2A18A 2C2NA 4Y0FA 3JXOA 4X64F 2CPIA 4EBDA 1SPBP 2VOPA 3FCWA 3CEDA 2XZWA 3IG1A 1KQSR 1S1TB 5CYQB 4YQWA 2XSJA 5CYJA 5E5NA 4LBIA 1FD8A 2D9OA 2HNZB 4ZS6A 1NMEB 2CPXA 4ES3A 1DARA 1HI1A 2WTFA 3HX9A 4NLWA 1TL7A 2BW2A 3RB3A 1Y11A 2E5JA 2PE8A 4DL3A 1X4BA 1KKHA 4MKYA 3OJUA 1S6UA 1XNQJ 1KEKA 5CD4H 3EDQB 1T9WA 4ECQA 4OI6A 3KK2A 3MMBB 4NXNF 3NGRA 2IC3A 1RT6A 2VU5A 4B17A 4EWTA 1HIYA 2QYCA 4PR6A 4OX9F 9ATCB 4CLUA 2MKKA 2YXLA 3CUNA 2BKNA 2EWHA 4R8UA 3CDBA 2MJNA 4DPXA 1IJFB 4YB5A 4X66F 2FUG9 4ANCA 3R2CJ 3IBWA 4PXBA 2YTCA 2CFXA 4WP8A 1IR1A 3KHHA 3UN3A 4N8NA 3SDEB 1NKEA 4NXNJ 1FJ7A 3K5NA 1NRKA 3W5XA 2EW9A 1ELOA 1RWWB 2N7YA 2GO9A 2RQKA 1LW0A 3CT9A 3VZHA 3R2DJ 2HZCA 3QATA 2EFNA 3FVYA 4ED5A 4DPYA 3TJ8A 4H4OB 2KXNB 2OFHX 4MYUA 2WW8A 1R6VA 4C8NA 2RRNA 4CNYA 4XDCA 2J8AA 4O23A 1CJUA 3QFHA 4KO0B 5FD1A 4UT4A 4ECTA 4DSFA 3H2VE 3L7OA 4NCBA 1KR4A 1RAFB 1X5PA 2QA1A 4ZCIA 4U67Q 4JI8J 4DFPA 2FHMA 4O3OA 3D54A 2BZ2A 4DV6F 2VFVA 2YKMA 3M1VB 2VZ9A 3NNCA 3RJMB 2D69A 1TVRB 2WB4A 3HVTB 1LWFA 2D3O1 3G9CA 2MSSA 4KH0B
chains in the Genus database with same CATH topology
1S1XA 2W9CB 3IR5B 3TI0A 2OFGX 2DH7A 2M5YA 2XMJA 3LQVA 3Q2SC 3QLHB 2XMUA 4A48A 1VK3A 2ZH2A 5HLFA 2JSXA 1WEXA 4HTIA 1A7GE 3DCAA 3MM5A 2VV5A 3KKFA 3MAHA 4JI8F 4NWBA 2RUGA 2SXLA 3OR1A 5LSLA 3H8YA 3CDAA 3TVKA 4B3OB 1JLEB 4JV5F 5M2UA 5KFWA 2BA9A 2MKHA 2UVUA 1HI0P 2ZE2B 1VQPS 3KWMA 2C28A 2B9XA 1S1WB 4LT6A 1X4CA 2UUCF 4I0WA 2C42A 4U6PA 3M1VA 3B78A 1N6QA 4QW8A 3OFEA 1RT4A 4ZPVR 1CQNA 1R8CA 2ZNZA 4O3QA 4O3PA 1XTZA 4WFNQ 4KIAA 3LF0A 3QO9A 1VC6A 2K2PA 4DR7F 2XSJB 3KLVA 4MMOA 3AJ1A 5B0CA 1DLOB 2DNHA 2GV1A 1TK0A 2LKZA 4NLGA 3MWBA 3S1TA 5GAHI 2WONA 1R7IA 1TKXA 3I32A 2DRAA 4Q5VA 2UVRA 5FDLA 5F3ZA 3G6YA 3P96A 4USIA 3VAFA 1Q16B 3DYAA 1SH2A 4DPOA 3GQCA 2UUWA 1S0VA 3E2EA 2J9DA 3C6UB 1RP5A 2IM2A 1VC0A 2V9KA 5KFKA 1FNXH 1C0UB 2AJ0A 2NXUA 4ZVFA 4MKYA 4JI6F 5HL7Q 3G86A 2ZJPQ 4I7FB 5LMUF 1P8GA 1XMBA 3DLGA 2W7PA 3MHYA 3N01A 1M0SA 3F56A 5J2QB 3P49B 2HFZA 1QAIA 1FA0A 3RR7A 4IRDA 2ZHOA 2MDAA 5DQIA 4BWJA 1OO0B 5F8IA 1NK7A 5C42A 3HP6A 2MMYA 3NNAA 5BJRA 1DHMA 1DQ8A 2HLTA 3O8WA 5KT6A 4E0DA 1FRXA 4A4JA 3SCJE 3CC4S 3DU5A 4ELUA 2CDQA 1U45A 2ZD1A 3Q24A 2WHOA 3CF5Q 3TUIC 4OI3A 3BF4A 1R8AA 1H2UX 1S6PA 2R8HA 1VRTB 1SUQA 2HRUA 4ICLB 3WDOA 1C1BA 3MZIA 1PGZA 1PSDA 3NBPB 3T3FA 1S77D 4IUFA 2QFJA 3S8SA 3KNGA 1SV5A 2C2RA 1KS2A 5CQGA 3PZPA 4JYAF 3DLEB 3R5DA 2FVRA 3ZFVA 1GQEA 2DCLA 2NQPA 2QO3A 2G13A 2OD6A 2Q79A 2QA2A 4DR4F 4DF4A 1QSLA 1X0PA 1VRUB 3QIPB 2X1GA 2UVVA 4MFBA 3SEOA 1X5OA 2X1FA 4M5DB 2J7WA 5D78A 1DFDA 4NLPA 5D4LA 1CPZA 1SH0A 4CH1A 1UA0A 1REVB 1X8DA 4I6AA 5HQ8A 1EP4B 2R8GA 1VQNS 1RT1B 4PG6A 4KJIA 3CJKB 3T6BA 4EUVA 2VPZB 5L9XA 1UAWA 2BUNA 5IQ6A 2KYXA 1AW0A 4DL4A 2WRMA 5KT5A 4U7CA 2VQFF 3BN7A 3ISND 4PQUB 4OZ0A 4ILMA 2XMTA 1UEVA 3DGPA 3H5SA 3FCHA 1R27B 4GO5X 4OHXA 3G8TA 3PW2A 1IBMF 2FGOA 2GA7A 4NMLA 3BREA 1M90T 1REVA 2NSBA 4J9RA 5AE1A 4O3NA 2XWYA 1U7LA 4ZPCA 5L1LA 4V19X 3LGNA 3HHLD 5G0RB 1RT4B 1NB7A 4JV1A 3PV8A 2QE5A 2ZH7A 2LECA 4ALZA 3LWLA 4I67A 2BANB 2XB2D 4PWUA 5JXSA 2PFFB 1RA7A 2OH2A 1S1WA 2CQ3A 4DS5A 2PA3A 2Z8QA 2M9KA 2MHNA 4Y3CA 3T1AA 4X4SA 4EYIB 2A2CA 1U1RA 3M2RA 3AJ2A 3P5TL 4RKUC 1FDNA 4ZPDA 3CCJS 4DQSA 4C98A 4OZNA 4NXMF 1BQMA 1OWXA 3VAGA 3THTA 3S01A 4ILLA 3LWMA 4K4YA 1DQAA 2XNQA 3MD3A 4DL0C 3JSMB 1VGYA 1T03B 2YNHA 4HVZA 1TKZB 3SI8A 3LAKA 5CCMA 4P7VA 4URSA 3UR0A 2DGSA 2MZJA 3G6VA 2AX1A 2FJDB 5F8LA 3FZBA 2B51A 3RTVA 4JBCA 2BRKA 4RU2A 3D0HE 5C25A 4YUDA 4UY85 3VF0B 3HI9A 3D2WA 2BDPA 2CQCA 3C8YA 1FXRA 2DK2A 3TOQA 5AXMA 2N7CA 1JLAB 1E6YA 2B56A 3H59A 1HNIA 3I0SA 4DF8A 4Y6IA 4ZVHA 4B3OA 2LQ5A 5SUHA 4X4QA 2A2DA 4DUYF 3GYNA 4FS1A 1BQMB 2W9AA 1FVQA 3B4MA 4R0EA 2B5JA 3AA8A 5KFIA 4AL7A 2QSFA 1WHXA 3MTKA 4ED7A 3F44A 5FDLB 1FJCA 4RW8B 1T05A 1KOHA 2L9DA 1ZTWA 1MWZA 4ECUA 3MXHP 1HQUB 3UCZP 4DFMA 1DURA 2W24A 3TAMA 4D3GA 4KB7A 2ZJRQ 2MKSA 2KFZA 3SSRA 1A6LA 3FEZA 4JV0A 3EGZA 4DOZA 4WFBQ 4CCHA 1FKOB 4PXDA 4C11B 4DEZA 1IKVA 1D9DA 3TYTA 2ZUGA 2JLGA 1FDBA 3BO3A 4DQPA 4UW2A 1JXEA 3H5YA 4MIWA 1TQLA 3E8OA 4DSKA 2CQ4A 3IR6B 4TXSA 1WF1A 4HDHA 4Q2MA 1JLEA 2AV5A 1GTEA 2W8KA 4QWBA 2RJZA 4ZVGA 3NMRA 1J5OB 4WFXA 3ZZUA 3Q8QB 1VBZA 3JAMY 5A8RB 4C9DA 2IM1A 2BV3A 1S9FA 2EK6A 4JI3F 1WWHA 3MECB 1E6YB 1S79A 1UWBB 3SFGA 1T02A 1EP4A 2KXHA 1UJ5A 4FF2A 3PO4A 5L1JA 1LOUA 2F7VA 3KK2B 3MM6B 2RS2A 1Q53A 2RSQA 4F8RA 1N34F 4HI1A 2ZITA 3I0RA 3O5TB 4ITSA 2PIIA 5KAKA 3J81Y 2C2EA 2VBWA 4C0HA 3OVAA 3DOLA 1YGYA 1RT7B 2HNZA 2NUUG 5EWFA 1SB6A 1WEYA 2KH9A 3B82A 5JVGQ 5F9LA 2DNNA 2DR7A 3WBZA 3N6NA 3BSNA 2OIHA 1FRLA 5J2PB 4A8KA 2B43A 4XPCA 4FZVA 2OSQA 4NA1A 5DM6Q 1DTTB 1DRZA 4A8FA 3NL0A 2LXFA 1HWUA 4IFVA 3MR3A 2HVHA 3JSRA 4OZLA 5B0GA 2EI5A 2PD1A 5DM7Q 2FJXA 4JOUA 4ZPAA 2HHUA 1YJWS 4EEYA 5F8JA 3HHLA 2AU0A 3PO5A 2ZOGA 2ZFHA 2E5GA 2ZHBA 2AGOA 3K5OA 3UE2A 1SJ3P 4ES1A 5FIIA 3U1LA 2J76E 4HYKA 5KG6A 2JC0A 1LFPA 3I5AA 5CA5A 1KHVA 1S1UB 1X9WA 5LL6d 3A8EA 3D1QA 1RKJA 3G96A 2A3JA 2NUHA 4ZPTR 2JEIA 3CIMA 3K0JA 4GKKF 3QAUA 2HQ3A 1FDAA 1HWJA 4ZMMA 3DRSA 3GILA 2QMXA 4HI2A 1GXUA 2JX2A 2E5HA 1U1PA 2VASA 3KTQA 5KFEA 1H98A 2U1AA 3DRRB 2PO4A 4IOBA 4IDKB 3EGWB 4CZCA 5HLFB 5E3AA 2ZNYA 4X2BA 1D9FA 5IQQA 1S72S 4DN0A 3GFHA 1XR5A 4DV7F 4DHVA 1QAYA 3CIZA 1F60B 1YVFA 4PXEA 2QEXS 1VBYA 3M6VA 5HMWA 3FGVA 3W3SA 3HM9A 3ICLA 1X5TA 4K4TA 5F8HA 4EO6A 5T41A 1KTVA 2JOQA 1UVMA 3GR0A 4HL9A 4NCGA 4WKYA 3UD4P 2HFNA 1L3VA 1WF0A 4IG3A 4OHYA 5B09A 4TQSA 3NNHA 3R5BA 1O51A 1XR6A 4NCGB 4R5PA 1U1OA 2COLA 2RU3A 4J9OA 2FJBB 2OD4A 3DOKB 3H20A 4OI4A 5KFXA 4BC9A 1UFLA 1ZM9A 4F4ZA 4YDDB 1HW9A 3J7YI 3MTJA 2EFOA 2V8HA 5GVQA 2DRBA 1KD1T 1S10A 2CQ2A 2KZZA 2CQ0A 3KG4A 4BC7A 1LW2A 5DG7A 1SKWA 1UVLA 1FEEA 4NLTA 5IWAF 3FEXB 2UUTA 3V5RA 3OTEA 4IFVB 2UZAA 2YNGA 3GG1A 1JLAA 5HROA 3QGGA 3EXYA 2BQ3A 3CDWA 3ISZA 3IS9A 2FLOA 2PSZA 1C1CA 2K7JA 4C8LA 3MOJB 4IH6A 5J2MB 5CH7B 2R7UA 2ZD1B 5A2QY 4TYAA