5LSOA

Crystal structure of spf45 uhm domain with cyclic peptide inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational Design of Cyclic Peptide Inhibitors of U2AF Homology Motif (UHM) Domains To Modulate Pre-mRNA Splicing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing/inhibitor
molecule keywords Splicing factor 45
total genus 28
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lsoA01
3BO3A 2M2BA 5BJRA 1UW4A 3S8SA 2MY8A 4WFAQ 3SXLA 2HYIB 4CQ1A 2VOPA 5DDRC 4A8XA 2RRBA 2AYBA 2ZJPQ 2AD9A 3I55S 4FXWA 3UWTA 1JJHA 5LXRA 5H1SV 2N3OA 4LJMA 4BS2A 1WHYA 2M8HA 2MZTA 2LEBA 3P3DA 2HGLA 2KM8B 1D9AA 1YWXA 2U2FA 2RQCA 1VQ7S 2CQ0A 4LMZA 4C7QA 4QU7A 2KG0A 2X1FA 1BY9A 4P6QA 2ZJRQ 2DGOA 1HL6A 2MZQA 3MUMP 2MYFA 3SDEB 3VAHA 3CMAS 2DNMA 2MPUA 2CPZA 2DGVA 1P1TA 3H2VE 4LIRA 2M0GB 2KN4A 2QFJA 2J76E 4WFBQ 1FHTA 1FNXH 2DGXA 1KQSR 2KVIA 4J5OA 1VQ8S 4Z2XA 2OTLS 3EGNA 2MHNA 3TP2A 2MZJA 5GADU 3UCUP 4WFNQ 1WWHA 3CXCR 1OIAA 2G1DA 1SJ3P 2MMYA 4WF9Q 1WI8A 2BZ2A 4V19X 3CCSS 5DETA 2LMIA 2FC9A 2DO0A 2E5GA 2JWNA 2YKAA 4ZKAA 5ITHA 3B4DA 5GVQA 2VOOA 2DHAA 1D8ZA 2KM8C 1Q81T 2L08A 5LSLA 3CUNA 3G6ES 1ZZNA 1NJIT 1U1OA 1Q86T 3OW2R 1K9MT 1W2BR 2OTJS 2RQ4A 2M9KA 1VBYA 4WCEQ 4IOAQ 1A9NB 1X4BA 5LXYA 2N82B 2ADBA 3CC4S 1H2VZ 2MQOA 5JVGQ 1VQ5S 2MSSA 2XNQA 1X5OA 4QQBA 2DITA 5D78A 4IUFA 2KXFA 4WIIA 2HVZA 1VBXA 1ZZFA 2J0SD 2G4BA 3CCMS 2DNKA 1FXLA 1X4EA 1WG1A 1IQTA 3S6EA 3IWNC 1S72S 2CQPA 1WF0A 2CQHA 2JVOA 4QU6A 3U1MA 3FEYB 4IO9Q 1JJ4A 4ED5A 2L41A 2MJUA 1U1RA 3BS9A 1HD1A 1M90T 1CVJA 3VAKA 2MZSA 3LPYA 1YJ9S 1WI6A 4CIOA 3G8SA 1WF1A 1WELA 2YH0A 3CC2S 2E5IA 2RUGA 1UP1A 2KXNB 1KD1T 2FY1A 1WHWA 3TO8A 1DRZA 2CQ3A 3BO2A 1SJ4P 3RW6A 2Q79A 1M5VC 1WF2A 2KH9A 1N52B 2NZ4A 1NU4A 2DO4A 3NS6A 2DNRA 4OZ0A 3MXHP 1XN9A 2OSRA 3N9UC 3MOJB 2DNPA 3VAGA 2CQ2A 2L9WA 2E44A 3US5A 2M4MA 2DNNA 1HD0A 1PO6A 1JJ2R 2XSFA 3ULHA 2YTCA 1X0FA 1VQ9S 1WG4A 2CQIA 5DM7Q 4CH1A 4C4WA 1U1NA 1RKJA 1DZ5A 3VAIA 3G9CA 2DNLA 2JVRA 2OJ3A 4TU8A 2CQBA 2MKCA 1FT8A 5GAGU 1JMTA 3CF5Q 1QM9A 4PR6A 1VQOS 2X1AA 2RRAA 2RS2A 2KHCA 2AYEA 3UE2A 3CCES 1VQNS 2E5HA 2YH1A 1WG5A 2N3LA 3V4MA 2DNZA 1QVGR 3PIOQ 3SDEA 2AYMA 2O3DA 1X4AA 1KOHA 5IM0A 1X5PA 1YI2S 2G0CA 3I56S 4W92B 3CULA 2F9JA 4YOEA 2XS5A 2LXUA 2ADCA 3Q2SC 3Q2TC 3UD3P 3CC7S 1VQ6S 2DISA 5GMKa 2B0GA 2CQ1A 3NNCA 3LQVA 1RK8A 2A3JA 1A7GE 1SJQA 4IOCQ 2MZ1A 2MJNA 1U1QA 1U6FA 2XS7A 3CPWR 2N7CA 1X4HA 2DNGA 5GAHU 1N54B 1H6KX 2LA4A 2VODA 2GHPA 2V94A 1VQMS 1VQPS 4ERDA 1SJFA 1VC5A 1H2TZ 1VQ4S 2CPXA 2BOPA 2MKKA 2E5JA 1YJWS 2DGWA 3CCLS 3BO4A 4OZ1A 2KYXA 1M1KT 2KU7A 2F9DA 3D2WA 2MSTA 1U1KA 3CCRS 1ZH5A 1Q7YT 1DBDA 3U1LA 1KC8T 1OWXA 3JB9k 3J7ZT 3HHNB 3EGZA 3G8TA 3R1LA 2RS8A 1WHVA 2EK6A 3FEXB 5LJ3Y 2AYGA 1G2EA 1VBZA 5EN1A 1URNA 1VC6A 5FJ4A 2RVJA 4C0OC 3NMRA 2DIVA 1YTYA 2CPIA 1SJRA 2MQNA 3CTRA 2J0QD 1M5OC 4FXVA 2MKSA 4F25A 3G4SS 1FJEB 5LJ5Y 1PGZA 3R27A 1YHQS 2I2YA 2CPDA 2JRSA 2KG1A 3G96A 3ZZZA 4EGLA 4UY8T 1UAWA 2LEAA 2DK2A 2F3JA 2K3KA 1WEZA 5JVHQ 2KRBA 2KI2A 2D9PA 2RNEA 1YITS 2DGUA 3G71S 3R1HA 2HGMA 5CA5A 1P27B 3HI9A 2QEXS 3VAFA 1U1PA 1K73T 1X4FA 4Y00A 3UD4P 3P6YC 2DHSA 2FPHX 2MB0B 1U2FA 1M5PC 3CCUS 2CJKA 4YB1P 2MQQA 3RW7A 3L3CA 5IFMA 1FJCA 2LYVA 1X4CA 1X4DA 1FO1A 1K8AT 2OIHA 2KFYA 1M5KC 2M70A 2MGZB 3PIPQ 1DHMA 3NS5A 2D9OA 3CMES 5DM6Q 1U1LA 3VAMA 2LECA 5IQQA 1S79A 2LA6A 1WHXA 4TLQA 2M8DB 1VC0A 2LXIA 2XB2D 2K8GA 3MDFA 1U6BA 1WEYA 4F26A 3VAJA 1O0PA 2MKJA 2CPYA 5DDOC 2MXYA 1NO8A 2MKHA 2HGNA 3J7YU 1X4GA 2X1BA 5LSOA 2DHXA 5CXTA 1YIJS 3CCVS 3EX7B 2MQMA 2SXLA 3CD6S 4RU2A 1SXLA 1X5TA 2ERRA 2NLWA 3VF0B 4PKDB 3B4MA 1N88A 1R8HA 2DH9A 2PE8A 1YJNS 3MUVP 2CQCA 2JX2A 3H2UB 1U1MA 2RU3A 1X5SA 2WBRA 2FHOB 2M88A 5HL7Q 5GAEU 2CPHA 2U1AA 2DIUA 2LKZA 4UQTA 1VQLS 2DGQA 2XNRA 1FJ7A 1QVFR 2DNOA 3S01A 3P5TL 1KOOA 2CPEA 5IM0B 3MUTP 3P49B 1L3KA 3VALA 5CYJA 2QA4S 4U67Q 3NNAA 3THPA 2CPJA 2MQLA 2OSQA 3MD1A 3IRWP 2EK1A 2CPFA 2DGTA 2KXHA 4YUDA 4TU7A 2DB1A 1HA1A 2J8AA 2CQDA 2MY7A 2MZRA 2DGSA 4CH0S 4W90B 1F9FA 3BEGB 2ZJQQ 5D77A 3ZZYA 5HO4A 2DNQA 3UCGA 1Q82T 1OPIA 3SMZA 5DDPC 1UFWA 2DNHA 2DHGA 1B7FA 2XS2A 2KRRA 1AUDA 2MGZA 1WTBA 3CCQS 3NNHA 3THTA 3K0JA 4Y0FA 2CQGA 3MURP 3DXBA 2D3OR 2VONA 4TU9A 2HZCA 1OO0B 1R8PA 2UP1A 2M52A 4WKRA 2DNYA 2X1GA 2YWKA 1N8RT 4QPTA 4M5DB 2MKIA 4PRFA 2GO9A 2EVZA 2DH8A 3TYTA 3MI7X 3S7RA 2LQ5A 2RT3A 2CQ4A 2KT5A 2PEHA 2I38A 3CCJS 1VQKS 1WEXA 2DH7A 4F02A 2M7SA 2LCWA 5DDQC 5MLCV 1H2UX 2MQPA 2FC8A 3DLLQ 3UCZP 3MD3A
chains in the Genus database with same CATH superfamily
2B4UA 2OGUA 3H20A 2YX7A 1J5EF 4D3HA 4J37A 2BQUA 1T02A 2ROEA 2HVEA 3GTYX 2V68A 4H54A 1W25A 2F40A 1WKJA 3EVWA 1UJ4A 4Y2IA 4WFAQ 2JLGA 3SFUA 3HHLD 4CQ1A 3SI8A 2A6MA 2LLZA 1XNQF 2BE2B 4DR7F 2BV3A 4QCLA 2MLXA 2E7XA 2I1RA 3U7JA 2AYBA 2ZJPQ 4DR3J 3T5LA 4DF4A 4DLEA 3D0HE 3D6HB 2XI3A 5H9FJ 1JJHA 4O23A 3DDIA 5LXRA 4LJMA 3I9ZA 2N3OA 3TWZA 3LP0B 4ZLPA 1S0MA 4G1PA 2WVFA 3V4IA 1SH0A 3ZNJ1 3ZTRA 3P3DA 1IR1A 3P8BB 1R89A 1JLEA 1D9AA 3ITHB 2KM8B 3ILJA 4O0NA 3ITHA 3ZTSA 4Q2MA 3QJLA 1B0PA 1QLNA 4O4GB 4Y34A 4ZDNA 2PC6A 2AJFE 3OFEA 4O3SA 3OL6A 4QU7A 3RAXA 2KG0A 4HHJA 3TAMB 2ZNZA 5KOWA 2WRMA 3NGRA 3SBMA 4BWJA 2AX0A 2F8EX 2ZITA 3LGMA 3TVYA 2X1FA 1RT2B 3WIUA 3KUHA 1HL6A 2MZQA 2WTFA 2MYFA 1N33F 3FBBA 3RG6A 3SDEB 3VAHA 4ECQA 1OSDA 4LQ9A 4K4YA 4M63A 4ES3A 2CPZA 1JB0C 3KMSA 4LIRA 2OD4A 4QIGA 2ZHOA 4U96A 4FNHA 2LQJA 3FRYA 3OL9A 3J7A1 2J76E 5ETPA 5EGYA 2W2OP 1JWWA 3TARA 4LQ3A 1F9HA 2DR5A 4O3RA 2IVMA 1SC1B 1VQ8S 1LXJA 3CT9A 1ZM2A 2HNZB 1RT1A 2BQ3A 1YVFA 1S6UA 2QA4G 4F0HA 5KFDA 1ZAVA 2VL1A 2B9WA 2CA9A 4XIUA 3UCUP 5E2QA 3H4BA 4LFBF 3BGFA 1CJUB 4YEAA 4DV2J 1Y3KA 2BKPA 2IM1A 4WF9Q 3FQKA 4QR1A 4URSA 4OZ5A 4YR3A 3I5BA 3D9BA 3EICA 3L7UA 5FLXY 1KFSA 1QJHA 5DETA 4B3SF 1C0UA 2H3EB 4I2QA 2DO0A 3NOGA 4P73A 5KFCA 2XM3A 3PR4A 4DV0F 2CDRB 4K4WA 2UUWA 4I7FA 4PYAA 3RGIA 2X7IA 3B4DA 1EQMA 3MR7A 3EZ5A 1QSLA 3HT3A 4KGKA 4GKKJ 3K5OA 5DGBA 3GFXA 3MEGA 1PYSB 2DHAA 4TKTA 3NGDA 1WC6A 4AE5A 5HQ8A 2B7CB 4Y2MA 4OZNA 4CT9A 2YNIA 4ZK7M 2UXCJ 2HLUA 4LRDA 4LR7A 4DHVA 4U6PA 4FS2A 3G6ES 4OHZA 1NJIT 4C8OA 5IT9U 2C22A 3H5XA 2HQCA 2V8PA 5E3CA 4ZP9A 1R7IA 4NZ0A 5KFHA 2AHOB 3K7RA 2NS1B 1RLCL 5SUHA 5T41A 1JLCA 1KTVA 3HVAA 5KFIA 2MQ8A 2HFSA 3KLIB 4XPEA 5JVGQ 4BC7A 2ZEJA 1SKRA 3GR1A 1SL2A 2NSBA 1GEHA 2BW7A 5KFAA 4LF5J 4QQBA 4IUFA 2IHR1 4WIIA 1SUQB 2R7UA 4OZ3A 4N76A 4A8SA 1UJ6A 3CJ3A 1JXLA 2VASA 3O6QA 1U26A 4P2FA 5U47A 1GXUA 1ZPVA 5C25B 2L9DA 3LP0A 3FSXA 4ATNA 2BW2A 2LXFA 3NG8A 3CCZA 2VDHA 3J80Y 1FX4A 1VJWA 3UFCX 4LUBA 2CQPA 4LSZB 2R2RA 5HLFA 1NAQA 3JTNA 2E5LJ 3QJPA 3D1OA 2LQ9A 1FNXH 5FDLB 2KTQA 3B6BA 1KHVA 3AD7C 2IRYA 4I2QB 1JJ4A 2L41A 1U1RA 4NMXA 3SIPB 5DLGA 4CLKA 4RUAA 2ZWOA 3J81j 1M90T 1CVJA 4ED6A 3HJFA 4WZQA 1YJ9S 1C2PA 1MG7A 1QTNB 4YMEA 1JLAB 4CIOA 2VBWA 3HHKA 3W5XA 5LSRA 1WOOA 1WELA 2WSEC 2D69A 3CC2S 5KFUA 1U0HA 1FRLA 3FQLA 1KD1T 2XY7A 4PXBA 4DEZA 3M8SA 4DMZA 5C5JA 2CQ3A 5DS7A 4K5SA 2QLBB 1SJ4P 3RW6A 1OY9A 4NLPA 3JYTA 3D0IE 1IKWB 3RRHA 2K2PA 4OYPA 4Q8EA 3CJ2A 4LF1A 3L09A 2NXEA 1CG2A 1NH7A 2YWHA 4IG3B 2H5IB 5L8RC 5HJYA 2F63A 3IA0A 2V5HG 3ZTQA 3HF5A 3GPAA 1HNWF 4KBIA 3KHHA 4B3OB 3QFWA 2L9WA 3AB4B 3IXQA 4FZVA 4RZRA 3MM8A 1H0HB 1TELA 2UUAJ 2QFIA 2QV6A 1XK8A 2HK2A 2QJ3A 1PO6A 3SCKE 1GMWA 2YTCA 3N6MA 4TYAA 4YHHJ 2HS4A 2GS8A 1I3OB 1VK3A 3UI3A 4ED1A 2VA2A 1OMSA 3VWSA 2BE9B 3TZWA 5DM7Q 3JSYA 4ETXA 4CH1A 5DZ7A 1DJ0A 4BDPA 4C4WA 1FX2A 3W60A 1QY7A 1S6QA 1DZ5A 3DMJB 3J7YI 4MAKA 1QUVA 2JVRA 4CO0A 3LAKA 4A8QA 3MPDA 2DXDA 3NGKA 5KT2A 2GVDA 2ZKUA 4RW8A 4NYZA 1FT8A 5EHHA 1Y00A 4X64F 4R0JA 3K5MA 4F4ZA 5GAGU 1BD6A 1QM9A 4OZLA 1RWXB 2X1AA 2RRAA 3JSMA 1UPPA 4L76A 4DPUA 4NOHA 2PI5A 4KAIA 1EJ7L 3HMJG 3EPGA 2XBPA 3GYXB 3NWGA 4Q2LA 4J9OA 1X9MA 2UUBF 1G1XA 2B4OA 1H98A 3ENWA 4B08A 4HACA 2JEGA 4U95A 2Y1JA 3V4MA 1IBMJ 2QL5B 1MLAA 2C2RA 1OY6A 5A2QU 4NA2A 1X4AA 1KOHA 4KO0A 2K7KA 4GRSA 1H74A 2POKA 1JKHA 2KL8A 4YB5A 3KTQA 3N28A 4JV5J 2HK3A 2OMOA 3I56S 1EP4B 4LIWA 5A6WA 5LMUJ 3ENAA 2CJQA 2LXUA 2RILA 4DSJA 2XS5A 3PHTA 2ZBRA 3HXMA 3UD3P 4DZDA 3GIRA 2FHJD 4RNMA 1SJ1A 1CQNA 1VRUB 3DOKB 5GMKa 3T5HA 2KZMA 2YNFA 2CQ1A 2VG5B 1RK8A 3K2YA 5A8RA 1VLOA 1HR0J 1Z2ZA 2MZ1A 1IBLF 4JI7F 4JI1J 1SB6A 1QAIA 2XS7A 4ZVSB 1S1UA 3JQMA 4DCOB 3CPWR 5A0YB 5GAHU 3FEZA 1N54B 4ECVA 1IQZA 2QMUB 1HNVB 2PO4A 2XTJP 2OEKA 1U6ZA 4IRKA 3AXMA 2B9YA 2VODA 1VQPS 3NOCA 3GJRB 1KRPA 2RQMA 3OFGA 3M6UA 4C3MA 1SJFA 2EKYA 1VC5A 4DSLA 4OL8A 2K1RB 3IG1B 3UD5A 1RTDB 5KFZA 2Y8YA 2APOA 3NGTA 4ZP8A 2HBZB 4FXDA 2HFUA 3QGIA 3AJDA 3BREA 2BOPA 3RB4A 3AJ2A 3RBDA 1W2IA 5IWAJ 3FFIB 1DARA 3C19A 4EK2A 3HDSA 5FIIA 5BXIA 3P96A 3EZOA 1SQEA 3FUYA 4BC9A 2Q66A 1M1KT 4G1IA 4B3RF 1LK5A 1TZ0A 5L39A 1O8BA 4MIBA 1NDCA 2QN6B 4WBFA 3PKMA 3DC2A 1DQ9A 1Q8BA 2ASDA 2MSTA 2PA3A 3MMCA 5K8OA 2KDOA 1AXQA 3BBFA 2PMWA 3ILOA 1F5BA 3U1LA 1VQYA 1YRXA 5KFBA 4LF6F 2YXLA 2UUTA 2RHSB 2C3OA 3M9NB 4DOZA 2YQ0A 2V50A 4WTYA 4M5DA 3G8TA 4F4WA 3R1LA 4Z7CA 4NLOA 1WHVA 2EXUA 5LJ3Y 2PFFB 2H51B 5F8HA 2VJVA 2L3MA 3CJ0A 3B78A 4DJBA 2A0FB 3IM9A 1RT3B 1MMLA 1VCTA 2RVJA 3TUIC 1TV6A 4M8LA 5HATA 4O3PA 3V5RA 1JLQA 2DIVA 3CDBA 1PSDA 1Q1KA 1X7VA 2CPIA 3FVYA 3MTKA 3HD1A 4USKA 2MQNA 3CTRA 2W7AA 3UO0A 3OL7A 4ECSA 2JL9A 4KYZA 3GV8B 1B99A 1NMEB 2OLWA 3W5YA 4FXVA 2J0QD 4OI0A 3GG1A 2DEJA 1XQIA 3CJQA 1H7WA 3PJ9A 5FLXU 5D8HB 3GFYA 4H4MB 2BKNA 4JBCA 3V6DA 2DY1A 2I2YA 2CPDA 2VFRA 4P2XA 4YY3F 2W9CB 5L1IA 4KJIA 4LF6J 3BM7A 3HFVA 2DHHA 3W1YC 4ID8A 5C2CA 4KRWA 1T9TA 1RT5B 1RZMA 3EE3A 4N77A 3ZZZA 4UY8T 4F36A 1GAOA 2LEAA 1RHQB 3KUGA 3FFIA 4IH7A 4QWCA 5D15A 1RWPB 4B3TJ 1WEZA 1RISA 5IT4A 4G1QA 2V4RA 5JVHQ 3C16A 2KRBA 2VA3A 4OZ2A 1N5QA 2QRRA 2Y1IA 3KMQA 3PHEA 4ED3A 2DGUA 3GZ7A 1HHSA 2AWZA 3AOAA 4WU2A 2B9XA 2I5JB 2HWIA 3ILIA 2FD2A 4JI2F 1P27B 4K0KF 4WXOA 4KE5A 2KFNA 2G13A 4LSLB 4ZIVA 1VR6A 2DTJA 1RU1A 3Q83A 4O44B 1HIYA 2HHUA 2GZOA 4FBUA 1V3ZA 3CCTA 2V67A 1BQMB 1S9EA 1U2FA 2H48B 3JSBA 4WU3A 2W4DA 5IQ6A 2ZM6F 1U45A 1M5PC 1TFYA 4X4NA 2GAHC 2CJKA 2QSWA 2C2OB 3RW7A 3V2UC 1TL4A 3L3CA 2V4QA 4IFYA 4JYAF 1S1XA 1X4CA 5I3QA 4MT1A 1HQ2A 2YX1A 5ETNA 1U2RA 1MWZA 3VGSA 4PYDA 4DG1A 2IVYA 4KV8B 4DV1J 2VFTA 1W7WA 4YN3B 3CJ4A 3QRQA 2Y1RI 3IWLA 1G3OA 1RTHB 4MKVA 1IBLJ 2EG1A 1RXOB 4JI7J 3KK1A 2CJBA 3TRGA 1YJVA 3NS5A 3CMES 3CEDA 4CYUB 3VAMA 5IQQA 2O5DA 2W25A 2IMWP 1FRKA 4DN0A 3CO9A 2AJ4A 1WC5A 1Y5LB 3IAM9 2NPFA 4GVLA 3GE9A 3TAQA 2H5JB 3TUJC 4DZ6A 2FVCA 4ELUA 3IAS9 1R6YA 4F26A 4WFZA 1O0PA 3KDOA 3OR2A 3KNAA 3HM9A 4NLUA 3W62A 2HS3A 4NPOA 1RA6A 1CS4B 1XMBA 4NYPA 1NO8A 5DDOC 1T8EA 1U8WA 4JI6J 2BACA 2MKHA 2HGNA 1NSKL 1RGVA 1WC4A 1SKSA 3MGJA 1L3VA 4P72A 3QZ8A 4CCHA 3D28A 4I0WA 4Q43A 2XYHB 4B9VA 1Q0NA 4ECTA 1DTTA 2ZNYA 2QMXA 4ANCA 1R0AA 1UWBA 3QLHA 4PXCA 2WONA 5C24B 1YK9A 5KFKA 3ZFVA 1HLWA 1U24A 4DN9A 3M2VB 3QBCA 2W9BB 4HACB 4F4XA 3DN9A 3PW4A 1RHKB 2DH9A 2PE8A 3KK3B 3NCRA 3WZ0A 2CIMA 1SV5A 4B9LA 4B3RJ 2HHVA 2BUNA 4WIQA 4ILMA 1K0TA 3I0SA 5KG7A 4LFAF 4U9RA 4CP5A 3EDRB 3TW0A 5B08A 3LGNA 4DF8A 5BYQA 4F4AA 2ATLA 1U49A 4C8KA 3ISNC 3DOMA 4PG6A 3R5DA 1QAXA 3BZQA 4HH1A 3C14B 5ETSA 2BM1A 5B7WA 5J2PB 2DIUA 4J9UE 4MTPA 4MK8A 4NLWA 4UQTA 4IQXA 1NHKL 1HNIB 3JQKA 3WX4A 4U7UD 3GONA 1K0VA 4V1Ak 1TKXA 3E01A 4N8NA 1V5VA 7AT1B 2XQCA 1QVFR 2OHDA 1CPZA 2XHWA 1KOOA 2Z2YB 3G82A 2ZZMA 5CYJA 2OFGX 2QA4S 3F0NA 2HQFA 2LDYA 1IJFB 2R7OA 4CLSA 2AJ1A 4KPYA 4UW2A 2Z30B 3VTIA 2CPJA 2ZBCA 1EETA 2RSQA 1X0PA 3CJ8A 2KXHA 2HHPA 5KFEA 5CYQA 5A76A 5J2MB 4N56A 3NY0A 2J7UA 3BPSP 4OHWA 2XLKA 2V8VA 1UVKA 2XG8A 3L7OA 2I0XA 3C6UA 1LFWA 3A8JA 1RTIA 3DRYA 2AIRB 3E51A 1H73A 2DGSA 1PILA 1TUWA 3KJFB 4PWUA 3GFHA 3VGUA 5D77A 4ZCLA 5C42A 1RTJA 2PT0A 3UCGA 3IGVA 3EJMA 2CNKB 4OJ1A 4DUZF 4ZOSA 1N0UA 1UFWA 3L9ZA 1HPZA 4GO7X 1R0AB 1RHJB 1B7FA 3Q8UA 1OS5A 1AUSL 2GAGC 2IM3A 1RAGB 2KRRA 3S1TA 1XMOJ 3OV7A 1WTBA 4WYWA 5AXMA 1XMQJ 2GGPB 2AF6A 3TX0A 3QIDA 3MURP 1VOMA 2KJVA 3UN2A 2ZKTA 2VONA 3CDAA 5KFWA 4KV8A 2V0NA 1OJ4A 4DG1B 4X65J 2R7TA 1D9DA 5T14A 1ROFA 2X1GA 3EGVA 2R4FA 4KFBB 4R5PB 3DXSX 2MKIA 3KHLA 4BCAA 4RW9A 4XO0A 4NE9C 5ETQA 5B0BA 2GO9A 3OBIA 1TKTB 3AXKA 2EVZA 4IRDA 1WKLA 1Q5VA 1XC9A 1DTQB 4G65A 1Q8LA 2Z57B 3NS7B 4M5NA 4I6WA 3RYLA 3W61A 4FBTA 2RT3A 4QZVB 1KVJA 3PW5A 2KT5A 5ETMA 2OKQA 2EWHA 3PNIA 3POTB 2CJAA 3SCIE 4RNFA 4DL5A 2EFNA 1TKDA 4QYZK 3F56A 2HAFA 2BE7D 1FWLA 1WSVA 2M7SA 1SUQA 2BJ8A 4K2JA 5DDQC 2W4CA 1GT8A 3NWRA 2MQPA 2FC8A 1KWMA 3DLLQ 2CKWA 4O4GA 1NDKA 3R5BA 5D3GB 1IBKF 5DGAA 1AB8A 2FHJA 1JLBB 1L3SA 1JLCB 2IJRA 4L75A 4EYHB 1F3VA 1S0VA 2YY3A 2VQFF 1RTZA 2FJBB 4P7VA 3S8SA 2UXCF 2MY8A 3V4IB 3MECA 2HYIB 4ZLNA 5DDRC 3DLKB 5DZ6A 4ALZA 3MUMP 2VQEF 2AQ4A 1WC3A 2Q1LA 4KH0B 4ILLA 1HNZJ 3FK4A 3OUYB 3H40A 4DLGA 4CZCA 2UVVA 3N4WA 3N6NA 4QIEA 5JUMA 4DV4F 4BS2A 4HKQA 1Z2LA 1OYDA 3EUNA 2JSXA 4DL2A 2HHHJ 3C66A 3BDPA 1JLQB 1YG0A 3FCWA 3QFHA 4ZVGA 1SQFA 4C3LA 2YKNA 2QLFB 5KAKA 2ZBIA 4DR6J 3BKUA 1VQ7S 4LF9J 4ZHRA 3D6FB 2HS0A 2CQ0A 2YKMB 2HNZA 4LMZA 5DG9A 1LWEB 4P75A 4L72B 5THWA 2V4JA 2HZVA 4ED0A 3VQTA 4LFBJ 2BJEA 4H4MA 1SIWB 2JHEA 2V4JB 2VC1A 2VD3A 4P71A 4CO2A 2V8DA 2JC0A 4MYUA 2FYXA 4GMKA 2ZHBA 4ZHRB 4P6QA 2ZJRQ 3DRPB 4NLXA 1T11A 3MAAB 2DGOA 3NEKA 3RUBL 3MTJA 3IR6B 4CDIA 2W8KA 3M8WA 4N47A 2RD5C 5KT4A 2UXDJ 1TKXB 2DNMA 3IO1A 5KOXA 3K5PA 5DLFA 3RB3A 3C6UB 3UVJB 2NXUA 3UPFA 2BANA 2WSFC 1HWLA 4YS2A 1JLFA 4WFBQ 3V6JA 1FHTA 3VZHA 1HARA 2KVIA 4LSLA 4CLWA 2Y0BB 1UVLA 3R5AA 3GU0A 4Z2XA 9ATCB 4B9UA 1GMWD 4F8RA 1RAOA 4LSNB 3QWUA 4IDKA 2Y1LB 1NDLA 3TZZA 1SKWA 5GADU 3GMGA 4PABA 4A4JA 1WWHA 4OFZA 4J9NA 2G1DA 5K8MA 2DKOB 1OQ3A 3DGPB 3O44A 4O0IA 1WI8A 3I5CA 4HR2A 4JV2A 5D0HA 1YX2A 1PBUA 2ZZTA 3CJTA 3HD2A 1T05A 1HHTP 4DV3F 5A8WB 2RKIA 3M8QA 4QIVA 4DPYA 1AROP 2FQQB 2JWNA 3M2RB 3GJTB 4ZKAA 2J7KA 3DOMB 2FHKA 5ITHA 2YKQA 2QA1A 1LW2A 2ATCB 4WKYA 2HWTA 3HHLA 2VG6A 5J2NA 2GC8A 4WE1A 2D3UA 4EWTA 2GMHA 3LGHA 2GIQA 3BH7B 4HHUA 1IJEB 2FLOA 4FYYB 5IV4A 5CD4H 3HPOA 2XYPB 4DR2F 1S0OA 1NLKL 2L08A 4PPDA 2XMAA 4KQZA 2FLLA 1XR7A 1YJRA 1J5EJ 2CAJA 3KXDA 4YR0A 2D7SA 3OW2R 2PN6A 3UNYA 4TQSA 2RQ4A 4QW9A 2HPUA 2M9KA 2RDIA 3D54A 3GLJA 4ZPDA 4BHQA 1VDHA 1VBYA 4ZPAA 4LRCA 3GV7B 3RAMA 4OX8A 5LXYA 2IAJA 2DBBA 2N82B 1LW0B 1Y9OA 3BDEA 4L3KA 4JV5F 2NZCA 4WXWA 1FKOA 3KLVA 1AT1B 4PG8A 1VQ5S 2F4VF 2J7WA 2XNQA 4AYBD 4IOBA 1IKYA 5HN0A 1GX6A 3VGVA 5B0CA 2OD6A 3SCJE 1N5YB 4ECYA 3CDEA 3WBZA 1KVIA 3C8YA 3TX8A 3QGHA 4DXLA 2HVZA 1VBXA 1ZZFA 1C1BB 2ZE2B 3D7SB 5SZTA 3U27A 2DNKA 1S5ZA 2R7XA 4RNHA 3C6TA 2MLYA 2CDQA 1WG1A 4DV7F 1IQTA 4Y28C 3S6EA 4EO8A 1Y5NB 3QWPA 1S72S 4X4TA 5A8KB 1SKUB 2H4WB 1B3TA 3W2VA 4DR4J 3PJXA 1TU0B 1IM4A 2CXEA 2O66A 4IO1A 2MJUA 2P6TA 3MM5A 4NLQA 3QRRA 4ED5A 4Z7YA 2UU9J 2ZDPA 3KWMA 2CRLA 3LPYA 3MZIA 2PMZD 3VAKA 2VJUA 3GCWP 3K17A 4J9QA 1K1SA 2JOQA 2PMHA 2XMVA 3N5FA 3HKWA 3I31A 4RUHA 1R31A 2E5IA 4DL3A 2GHVC 3JAMU 4B3OA 1NHUA 5HBMB 7FD1A 3BO2A 3PV8A 3AOCA 1YBTA 4F0KA 3KJNB 1RADB 5B0DA 2KH9A 1NU4A 3N6LA 2ACMA 4TN2A 5RUBA 1CC7A 2DR7A 3JYTB 5HQLA 3MXHP 1RHRB 1ZM3A 1XN9A 2OSRA 4WPAA 2IM0A 3MOJB 4DR7J 5CZVA 3OJSA 1CEZA 3FNNA 1RT6A 1ZA1B 3DRXA 1E6VA 1RYSA 1W26A 4O3NA 1FRXA 3QLHB 4Y2CA 4Q0BA 2YNGB 2YKPA 4ES1A 3PW2A 1VMBA 1HD0A 4LR9A 4RW7B 1JJ2R 3L95X 3GSDA 3ULHA 4F3QA 1EZZB 1PC4A 5L38A 1NSQA 4DX8H 3CCWA 1WG4A 1H7XA 2CQIA 2VH7A 1QDUB 3QJJA 1C0TA 1F6TA 2IBOA 5FD1A 2DXEA 3NAIA 1U1NA 5AXKA 3FKBA 2WAQD 4ZP6A 3G8QA 4BLGA 3H0PA 4K8RA 3CJRA 1RWVB 5KFFA 3MM6B 1BLUA 3BF4A 4CNYA 1N48A 2RDJA 2XULA 3TVZA 4Z37A 5D4PA 2E5LF 2AKWB 3CF5Q 4YFUA 3TQEA 1HNZF 2XWYA 4QR0A 2P8IA 3ZZRA 3KLEA 3DMJA 4LBHA 3I4HX 2RS2A 4NASA 1TFWA 1ZA2B 3GJSB 3KLIA 1VQNS 5KG6A 5HMYA 2WVBA 2MTLA 2Q3PA 3E8OA 4J9VA 4DV5F 4I1TA 1BGXT 4OIXA 4O4RA 2YH1A 4RLEA 1CJVA 3KDNA 4K7QA 2GW8A 4ELVA 2C3YA 4ECWA 3GILA 2WCXA 2XZDB 3F41A 2AMCB 1LQ9A 2E7WA 2GNKA 3T9NA 3UNGC 3F44A 5IM0A 2FLNA 4TY8A 2MDAA 1RLDA 4MMOA 4JYAJ 1YI2S 2G0CA 1RCOB 2F9JA 2OPQB 2R8IA 3TANA 5AJ3J 2HHQA 2AEJA 4O44A 3LUYA 3Q2TC 1TKZA 2VIHA 3DCAA 3CC7S 3ETOA 2DISA 1S1WA 1LWFB 4E8UA 1Y10A 2B0GA 2VKZG 1OYEA 4KY3A 3NNCA 3O1LA 4TNOA 3UVJA 1N5VA 2A3JA 4HDGA 2DYAA 4LF7F 4JOUA 3FSYA 3ZZPA 4K4TA 1F9EB 1U6FA 4C3KA 3IBCB 2EBEA 2ZC4A 2N7CA 2XEXA 2V8HA 5EWEA 2DNGA 2VPXB 2AGOA 2J9EA 2WZ1A 1SC3B 2XZWA 4PPZA 4AXJA 5KT3A 2A18A 1H6KX 2HKEA 2GQCA 1JK9B 2YKMA 4NWBA 4TVAB 5J1EB 4NLRA 4NLVA 3MCOA 3BN7A 2LA4A 3HX9A 4Y2AA 1P8GA 2B4PA 2GHPA 2HQDA 4JI3J 4DV6F 1IBCB 2XO7A 4ERDA 5CCMA 1WDDA 3V6KA 3Q8SB 1H2TZ 3C6TB 3BN4A 3FCHA 4W4MA 2CPXA 2Q6BA 2DY9A 1P9YA 3OPKA 3BV8A 5KFJA 3R97A 3W2WA 5B0GA 3R5GA 1YJWS 4LT6A 1S9GA 4I64A 2DGWA 5KFPA 3OHBA 3BGRB 1R8CA 3CCLS 2HNYB 3HVTB 4ICLA 1UTAA 4MKBA 1N0VC 2GCFA 2F9DA 4WE1B 3A1YG 3OVSA 1UKUA 4EBEA 2NUUG 3M8ZA 4F2RA 4DFPA 1OSCA 4OYAA 5H9EK 2KKHA 1BE4A 2CFXA 2ROPA 2XSJA 2XMMA 4NA1A 3CWJA 3M2RA 3QSIA 2Q6CA 3A3NB 1RT1B 3JB9k 4ETZA 5I3PA 5F8LA 1FRJA 1NDPA 4TY9A 3HZEA 4IRCA 4NLSA 1TL1A 1NK6A 2N4DA 3EDQB 4QJVA 4A46A 5D3GA 5EN1A 5AT1B 1IR2A 3B54A 2CWKA 2VFUA 1YBAA 2W24A 3SQOP 3ZNUA 4CLPA 5KG4A 2B4VA 3NMRA 4M5MA 2WK4A 4R5PA 2KVQE 1SJRA 3LH2S 4IR1A 3NRBA 1M5SA 2ZVSA 3EWGA 3OHAA 5D4OA 2X3DA 3DLJA 1M5OC 3MWBA 2QL9B 3K89A 3MPWA 1FJEB 3CD0A 5DQGA 2YWGA 2K06A 1YHQS 1SH2A 5GAHI 4A8MP 1CQMA 5BR8F 4HTIA 2JH3A 3H2LA 1EKSA 2KG1A 2FY8A 1NZAA 4EGLA 5CH7B 1UAWA 1S12A 3T1YJ 2DK2A 2EC0A 5KFYA 2V9WA 5AE3A 2RHQB 1HBOA 3SV4A 3BGRA 2YQ1A 2KI2A 1VQSA 4RL1A 2G2YA 1T0TV 3H25A 3R1HA 1MW7A 3A12A 1KVKA 1S59A 1HI8A 1NBEB 5B0EA 3J81U 3VAFA 1MWQA 1V3RA 4ZPCA 5JMNA 2FJAB 2YKNB 1NB2A 1U1PA 4DSIA 2QZ8A 1S77D 1NSAA 3PX0A 3P6YC 1FRIA 1LWEA 2G2ZA 4MJKA 1YZ6A 3NGSA 3VHQA 2H65B 5J1EA 2MQQA 3MHYA 4RU9A 1M5HA 5DG7A 1IKXA 5IFMA 5EWFA 1FJCA 1T9XA 2LYVA 3H98A 1GTEA 4GC7A 3W8PA 4ZVUB 1RT2A 3BSAA 4DUTA 1N36F 2G2OA 4NXMF 1T7PA 3K57A 1VIOA 3OT9A 4H4OA 6FD1A 3G6YA 2V2VA 3HKZD 2KFYA 1K8AT 4PG4A 4QWBA 4LFCJ 1Q95G 2UXBF 2C3PA 4RW4A 1RU2A 3KFWX 2BJ1A 3FBEA 2IC3A 4HDHA 4QW8A 3CD7A 3PIPQ 2ZH3A 1TK5A 2J6UA 5I3UB 3TZXA 5DM6Q 1NJYA 4QU6A 1IUJA 1MMDA 3KLHB 4L73A 4RW8B 2VV5A 3EXYA 2FTRA 4DX7A 3AHPA 1HWKA 1VK8A 4TLQA 5I42B 1RT7A 4DV3J 4DS5A 2P9CA 5KG1A 1NK7A 3I96A 1HNXJ 4NLGA 5KFVA 3UN5A 2NXJA 2XB2D 1F60B 3I82A 2BJ9A 3E2EA 1ZAWA 2F8HA 2H4YB 2IC3B 2XGQA 1LWCA 4JI2J 2MKJA 2CPYA 5HANA 3SQGB 3R2CJ 2MLZA 2DCLA 3K59A 3E3XA 1XIQA 3MF5A 3NLCA 3J7YU 4RO0A 1CLFA 4KGVB 5LSOA 5CXTA 4C6AA 1YIJS 1TL3A 2XSJB 3DFEA 1RA7A 2VU5A 5E3QA 4OYXA 2FLPA 4FYXB 3KLEB 3CD6S 1FD2A 1HWIA 3MCMA 1GQEA 1HWUA 3OVAA 3MR3A 2BA9A 2OI2A 5AXLA 2MEWA 3D6MB 5KFXA 2C2DA 4JI5J 1UWBB 1Z4UA 4RW9B 2PSZA 2BRKA 3VF0B 2AT1B 1ZM4A 2GMLA 3B4MA 4YY3J 2ALZA 3N01A 1N88A 1R8HA 4X62F 2W9BA 3MUVP 4MKAA 4MIAA 2BBEA 3KKFA 3CJSA 4CT8A 4ZJQA 3M8RA 2Z58B 3MM7B 2W9AA 3ENVA 2ROGA 3CW2C 3T9ZA 1U1MA 1U25A 3J81Y 3QT8A 3QGPA 1FI4A 5KG5A 1FTRA 5CYMB 5HP1B 2RU9A 3TAPA 3RBXA 1HHQA 1N34J 3OSPA 1RTJB 2PDAA 4OQJA 3EPIA 3X3UA 1N34F 2LKZA 2AJ2A 4KSEB 4Y3CA 1VQLS 1HPZB 1RACB 2XLIA 1NK9A 2XNRA 2M5YA 4USHA 1FVSA 2N4CA 1S49A 3P49B 2CPEA 2QGFB 4DFMA 1KNZA 4OV6A 5LMNJ 4B9TA 4RBTA 5AXNA 1NZ8A 1RWWB 1RP5A 3IFEA 4KGMA 5D0GA 5ETRA 3PW7A 3NNAA 4UT4A 1NK0A 5HLFB 3A8IA 4DQRA 2IIHA 1RHMB 2GX8A 4LRAA 2CPFA 2DGTA 4EYIB 3T5JA 3PZPA 4ZVEA 5ETTA 1EAYC 4YUDA 3IMQJ 4TU7A 2DB1A 3GIIA 1HA1A 2NPIA 2OPRA 1AFIA 1WC1A 4XDDA 1IM6A 1FWKA 1GMVA 2MY7A 3SV3A 1RBOB 2MZRA 4W90B 3M1VA 4CH0S 2VQFJ 1RTIB 4J9LA 4P2MA 4USTA 3MMAA 2ZJQQ 1MN9A 4M5LA 3ZZYA 4NA3A 3A3OB 3T6BA 1Z1ZA 4KT0C 3R7NB 3W9IA 3LP1B 2EFPA 1OPIA 5IWAF 1Q82T 4ID5A 3FZBA 2E9TA 1XTZA 2J9DE 4EBDA 2DNHA 4OJHA 4CWBA 4RW4B 4QWAA 3THVA 4IFVB 1HNXF 4K4SA 4USVA 3EVMA 3RAQA 2VBYA 4JI0J 2XS2A 1FDDA 2F7VA 2EC2A 4OYZA 2GJ2A 4ZVOB 3AA9A 3I4PA 4CLYA 5A8KA 1S99A 3IRXB 2QYGA 4URGA 1HBMB 4Y0FA 1KHWA 3DXBA 2W7PA 3BKFA 5KFGA 5B09A 3K8VA 1YBUA 1HI1A 2UXBJ 1Q78A 2HVIA 2B5JB 2W2NP 5T7LB 3KLGB 3GG0A 4HTJA 4A47A 2UP1A 2YBVA 2M52A 3Q89A 5EX0A 1R6VA 2F4FA 1S76D 4QPTA 2COLA 4ZPTR 1CJKB 2OPPA 4KKOB 4M5IA 4ANEA 4ELTA 2C2MB 4X65F 2QTWA 5HMXA 4HVZA 5JXSA 2LQ5A 3OTDA 1KLNA 3OR2B 2DEIA 4NZ7A 4Q45A 2CQ4A 2PEHA 2HAIA 2ZOFA 3LF0A 4NLDA 5LMUF 1KS2A 1M0SA 1I6JA 5C24A 1CS4A 3MOZA 4RWXA 2DR6A 2PFDA 1LWXA 3QZ7A 2OEJA 2A1BA 5MLCV 2DR8A 1DQAA 1MWYA 3KJVB 2BDPA 4DFJA 1RWNB 1DTTB 2KT2A 3HFKA 1R0BG 4C8YA 1BC6A 4WP3A 1VISA 4RR5A 3BO3A 3DU6A 1YJ7A 5ETOA 1OQ6A 2AW0A 2UUBJ 2P5VA 1NM2A 1TL5A 3R7SB 3KK2A 3QRPA 4KGZB 4MH8A 2RUSA 1R3NA 2VG6B 3SEOA 4A8XA 3ZZ0A 3V81A 2FVPA 3OTEA 4CI0B 1WACA 1O6XA 3PEJA 4F7VA 1HBUB 3I55S 4FXWA 4DI6A 3LAMA 2JEJA 2J0XA 5DRKA 3UWTA 3ISZA 5H1SV 2KHDA 2K7JA 4FYWB 4RX6A 2RKIB 1EIYB 2M8HA 3DU5A 3TA1A 4C97A 4Q7AA 5BYRA 2FIUA 2HGLA 1Y4ZB 4WJBA 1SPBP 5G0RA 1YWXA 4DQPA 2VPWB 1TTHB 2IVFB 4EMDA 1XNRJ 3PJWA 3LA0A 3ADAC 5G0RB 1HFEL 4K4VA 3A3PB 3WIVA 4I2PA 4USIA 2BJDA 3LP2B 2AGQA 2GFFA 3I9V9 3JSRA 4JB8B 4DDFA 3GWCA 4FPRA 2VPYB 4ZJOA 3BBCA 3OTOJ 4EZ9A 3M8YA 4CO5A 1VHFA 1FNMA 1YJUA 3W5ZA 1ITPA 2OEMA 1S57A 3M4XA 3BJYA 1BY9A 3A8KA 1QAJA 3PACA 4NYOA 1JIHA 2RMLA 2FGCA 2YWEA 2BEFA 2EPIA 1FE0A 3PRVA 4PZVA 5A0YA 2RAQA 4I56A 4ZCKA 1P9QC 1R8BA 5CCLA 4KB7A 4OI2A 5EX3A 2V2QA 8ATCB 3CMAS 1H38A 2PI4A 3M30B 3PDNA 2ABYA 3D3BJ 4ZVPB 4XDCA 1P1TA 1EB0A 3SSRA 3VCDA 4B02A 1NRKA 2WSCC 4OI3A 5A8RB 2KN4A 4ANDA 3KJVA 2D1CA 2JEIA 4RJVA 3BBBA 2ZUGA 2BVZA 4NL5A 4CLFA 1FK9A 2QLWA 2HSEB 1G4CA 2EEYA 2JDJA 3M32A 4J5OA 5LOQA 2Z0GA 3CJKA 3Q8PB 1KQKA 2OTLS 2VG5A 3EGNA 2MHNA 4I6AA 3W65A 1TL7B 1S6PB 2MZJA 4MKYA 2HBQB 4PG7A 4P10A 4WFNQ 4YP3A 1JXEA 1RKIA 4MYTA 4JI8F 2QX0A 2MMYA 1SJ3P 1CJKA 3I32A 1RAEB 1S48A 5KG3A 3CJKB 2IA0A 2AX1A 3KNGA 3GSIA 4K50A 4MK7A 1IR0A 2CNOB 1TMMA 1S6PA 2H54B 1JLGA 2RRNA 4NLTA 1LW2B 2FUG9 2MKYA 2N7YA 4UQGA 3DDKA 3PRDA 3PFEA 4HT5A 5GVQA 3LOUA 2Z4PA 2UVRA 6FDRA 2VOOA 1VI7A 3AY0A 5HMWA 4M94A 1SVDA 5ETVA 4DV1F 3QSYB 5A8WA 4ED8A 1IKVB 3DLHA 4Q0BB 3CNQP 1D8ZA 4NI2A 2QLJB 1Q81T 5F8NA 5LSLA 4OYWA 2QL7B 3RRKA 3L7PA 3CUNA 1R43A 1D1UA 3DM2A 3IBWA 3H7HB 4CH7A 2EFGA 3O2IA 2HVDA 4ZA1A 1W2BR 4NRTA 1Q86T 1K9MT 3LALA 4M5HA 2OTJS 2BJ7A 5J2NB 4CM2A 3H4DA 1LWFA 1C1CA 3QO9B 1TMJA 1TP7A 2QC3A 1NCLA 4DBQA 4I2PB 4RWWA 4B3MF 4FF4A 4IOAQ 1D0EA 1A9NB 3PO4A 1DURA 5CD4A 2ADBA 3IWXA 3CC4S 5IT9Y 1DAXA 4ZN1A 2ZH2A 4K0KJ 1H2VZ 3UQSA 2KT3A 3ZTPA 2MQOA 1KDNA 2BANB 2LQ8A 1L3UA 3BQ2A 4DV5J 3ONQA 1T9UA 3CDUA 3KK2B 4ZPBA 5IOLA 1S4FA 2ASYA 2DITA 4OX9F 3R7BB 5D78A 2KXFA 2P6SA 3FMWA 1N5TA 4ECUA 3HO1A 4ZJLA 2IDEA 1NK4A 5CZXA 2IRXA 1SCJB 2L48A 3AQOA 5KFSA 2J0SD 4USUA 3CCMS 3IR7B 1IKVA 3OL8A 1FDBA 1X4EA 4FVMA 4J90A 4A8FA 1IN0A 1FKOB 3M7VA 1HW8A 4LRFA 4PG5A 4UOHA 2R8KA 3IWNC 1URRA 2W2PP 3DHWC 2R2UA 3EVOA 4ZVHA 3V6DB 1PJ6A 1RBAA 4USJC 2YNFB 4OI6A 3U1MA 4UZBA 4J9PA 4PEOA 4ECZA 3BS9A 1FDNA 1WKKA 1RJJA 2VG7B 1MU2B 1JLAA 2R42A 4I69A 4DV2F 5KT7A 3QGGA 4NXNJ 1VBKA 3HULA 1B4SA 1HQEB 2EW9A 1WF1A 4MFBA 4U8YA 3WQPA 2KFZA 3OQ2A 2FZCB 3DRPA 1UP1A 2KXNB 1RHUB 2FY1A 3KOAA 5F8JA 2B5JA 5T7LA 3KLGA 3B82A 1WHWA 1QE1A 2DVIA 4DQSA 3KHGA 1FERA 3T3FA 1FKAF 1WF2A 5HBMA 1N52B 1XR5A 2A10A 1BWEA 2DO4A 4ECXA 5F8GA 3DYAB 2DNRA 4DPOA 2OFHX 4R8UA 1JKHB 4WK1A 4UUWA 4HT7A 3AD9C 2VKRA 2Y8WA 2EG2A 2IYIA 2DNPA 2QYCA 3PFOA 3VAGA 1E6VB 4DCJB 3JSMB 3Q8YA 2CQ2A 3US5A 2E44A 2LQBA 1UA0A 5BR8J 4ID5B 1BMQB 2DNNA 4N8OA 3UDCA 3NMAA 2WVDA 3MM5B 2XSFA 3CVKA 3HHDA 4A8KA 3HHLB 4K4ZA 3H5UA 4QOTA 4U7CA 1U09A 1YJTA 4JP8A 1EARA 1F5CA 3IRXA 1TL3B 2BKOA 2D41A 4YR2A 4K4UA 2HHXA 2B43A 1WUUA 3Q86A 1Y7PA 1NK8A 5IXUA 3BQ1A 1RKJA 2VZ9A 4EZ6A 3VAIA 3M9MB 2DNLA 3G9CA 3A13A 1J5OA 2OJ3A 4B9MA 4TU8A 3AOBA 3P4UB 4PQUA 1PIEA 4KFBA 2CQBA 3KK3A 4J9SA 4DV7J 4AL6A 2GQQA 3MCSA 1A0OB 3MEGB 3J7Z5 4DR5J 1KEKA 5K14B 2FHMA 2FVRA 4DR3F 1VQOS 2WHOA 1X31C 4NXMJ 3BGLA 3NCPA 1KLMB 3QIPB 5L9XA 5AE2A 3K5LA 2PEBA 2KHCA 4NCGA 3UE2A 3QT5A 3CCES 1QTMA 3LO3A 5HSPA 1HR0F 1XERA 4C9DA 5L46A 3R3TA 3ILLA 1P1LA 3HSDA 3BSNA 1SC6A 1WG5A 3M8PB 2HNDB 1I51B 1BQNA 2HIYA 1FNOA 3PIOQ 3D3CJ 3OLAA 2O3DA 2KYZA 3BGOP 4Q44A 2R2SA 5F9LA 4DS4A 1IKXB 3QMQA 1R8AA 1AA1B 1U8SA 3T5KA 4QBUA 1WORA 4W92B 1LOUA 4ZPWR 4D3GA 2ADCA 1E6YB 2CVIA 5A2QY 2UUCF 4RNOA 2OP5A 3DDNA 1VYAA 5F0WA 1LK7A 4OLPA 4ZCIA 2R8JA 2E1CA 3N5BA 3EMTA 3BKTA 3P5BP 3BGUA 2V69A 3FDSA 2R8HA 2R9LA 4DV6J 2ASLA 2VHGA 2R8GA 2ZD1A 2IJNA 1SJQA 1Y5IB 1DLOA 5IC6B 4IOCQ 2HQ3A 1TQLA 4IR9A 1TK0A 3OFHA 3Q8QB 1HYSB 5HJXA 5AE1A 3PX6A 4ZMMA 1HKAA 3O5TB 1KQFB 4E2FB 5C42B 1S1TB 3UDEA 3HFZB 2A2DA 2LU1A 1PG5B 4TXSA 4IDKB 2QT7A 1DQ8A 5D4LA 3MMBB 1S9EB 1S6OA 4JUZA 4ES2A 4EUVA 5GAGI 4RBVA 1VJQA 1GK8A 3HP6A 2XC9A 4EEYA 3AA8A 4ZVQB 2EFQA 1EETB 1FEEA 4CNZA 4ZN3A 2RIJA 5HVHA 5KFNA 1ZTWA 2E5JA 2B6AB 1RT4A 4RW6B 3JAMY 1ZTTA 2BYCA 3O8WA 1QD1A 2E66A 4GO5X 4LF8J 2X51A 2YNIB 3C16B 2BJ3A 1CC8A 1RB0A 3RBEA 3BO4A 4YHHF 1BHNA 1AYEA 2AP6A 2KYXA 3X1LB 4CLUA 4DU8A 1EKRA 2KU7A 1UVNA 4J7CA 2BABA 3RTVA 1HYSA 3I0RA 4DPTA 3OXLA 4FNIA 5HAOA 4JI5F 5HI7A 1U1KA 4C8LA 2C2KB 2BQRA 4LF4J 4K2XA 2HW3A 3TA0A 1Q8IA 1S1TA 2CG8A 1RUSA 3C15B 3CE8A 3L4BC 2J8SA 2JNJA 2VC0A 4B17A 2ZHAA 4C8MA 3OLBA 2ZH4A 1C0UB 1D09B 2A2CA 4DR1J 1OWXA 2FJWA 1VFJA 1UMJA 2DCUB 2XMWA 4V19J 1F2HA 1RAIB 2QSFA 3J7ZT 4ZIWA 3OJUA 3EGZA 2BXJA 5I4MA 2W7OA 4RNNA 1SV5B 1V5IB 2HFVA 1GX5A 2FJDB 2RS8A 1Q7LB 5F3TA 4DU7A 4WTOB 5I3UA 3KLFB 2HLTA 1UA1A 1VBZA 2MHEA 4O3QA 1NJZA 1G2EA 3KHRA 1TV6B 3H90A 1SQGA 1S0NA 1URNA 1JNRB 2WONB 2DXFA 5B0AA 5B0FA 4P74A 3LANA 4LF9F 5EUHA 3BQ0A 2A6OA 3M2UB 4F50A 2UV8A 1JJCB 3M2UA 2AZ1A 2WB4A 2WBMA 3PKYA 3D6TB 2FJEB 1LV5A 2ILZA 3M8PA 4LR8A 3Q8RB 4YDDB 4K4XA 5LJ5Y 3R27A 1SI9A 5D4NA 1B70B 1JLBA 2QA2A 1SH3A 1S1XB 2F5GA 1HQUB 2OH2A 1TKZB 3TVKA 3R5CA 1ZAXA 2C28A 4PQUB 1RAAB 4XPCA 4FP9A 3H5YA 1NNDA 4LF4F 1HNWJ 4C8ZA 5HMZA 2FJVA 2K3KA 4OHXA 2XCPA 3IBFB 4K5RA 1XWLA 2DRDA 4QYRA 2RNEA 2D9PA 4CLTA 2ZH9A 1RABB 3TJ8A 1REVA 3RB0A 2B8QA 3SCLE 1YQHA 5AJ3F 3U02A 4ZVTB 3OXFA 3FC9A 2I5JA 3HI9A 4MIWA 3TAMA 5A6PA 2QEXS 2CZVC 1S7IA 1X4FA 2E1RA 3FSIA 2KZZA 4ED2A 1G6BA 3PYFA 2CJXB 3TR5A 2MB0B 3WHIA 2Y9HA 2ACYA 2L9NA 3T6JA 2DPIA 4YB1P 1CULA 1X8DA 2HFZA 3MEDB 4TLRA 3F73A 1JLEB 1DLOB 2ZH8A 1F0XA 4CRJA 1Y11A 2J6SA 5F3ZA 2C42A 4OX6A 1X4DA 2F8MA 2C2EA 2O67A 1FO1A 2XGPA 4GKKF 4HEA9 2JLEA 2VBZA 1IVZA 1M5KC 2M70A 2YVSA 4YQWA 3ZXWA 2MGZB 2VF3A 1DHMA 2W2QP 2XMTA 3BYRA 1RCXB 3DYAA 1NHVA 1L5UA 2D9OA 2HNYA 4KR0B 3FRZA 5KFTA 1HQEA 1WOSA 4MFBB 2LA6A 1WHXA 2DR9A 3QT6A 2M8DB 1VC0A 3OR1B 4DX5A 4RUBA 3NGUA 1O5JA 2WW4A 2K8GA 3HZGA 3MDFA 3IN5A 1FXRA 1WEYA 5DQHA 3FBCA 2ZH7A 5ADZA 2AGPA 1IWAA 1REGX 3TA2A 2B7BB 1V3SA 3TUZC 3ET6A 3AT1B 4H4KC 2OPSA 3H42A 4OYOA 4RUCA 1Q5YA 3C46A 2HBYB 2EBGA 1FCAA 1X4GA 3M32B 5F8MA 2Z2LA 5HVFA 2X1BA 4CO4A 2DHXA 1C0TB 5BYSA 4F3OA 4KHRA 1RBLA 2F1FA 5MAOA 3NBPA 3CCVS 3AJ1A 2MQMA 3HJVA 3O3LA 3PR5B 4DR2J 4DR1F 1QUPA 1FJGJ 4DFKA 1FF2A 2YPYA 4RU2A 3NAHA 1RT3A 5M2UA 2OAUA 1F2GA 1SXLA 4LBIA 2Z8QA 1X5TA 4UZCA 2NLWA 2I9SA 2ERRA 1N32F 2ZUAA 4OMFG 4PKDB 4C8NA 4EU0A 2RQKA 4X4VA 1B0VA 4QR2A 1YJNS 2EI5A 3EM1A 1NJWA 5CYQB 5J2MA 4WFYA 1UVMA 4FN5A 4DPXA 1N33J 2C2ZB 3H2UB 5E7OB 3KG0A 2XMJA 1Q4RA 1UW9A 1S9FA 3IC1A 4LVNP 2RE1A 3G86A 1PBAA 2OPQA 4HH0A 4ITSA 4Y65A 1H72C 3FGVA 5GAEU 2V2ZA 2CPHA 3VVTA 2FVSA 4ER8A 5F0UA 2CYYA 3E01B 3GJQB 2XY6A 2VFSA 3BPDA 1HNIA 4NI2B 4ZPVR 1BQMA 4IH5A 3MEKA 4DR4F 1QAYA 3ISND 1D9FA 3S01A 4A48A 1VGYA 5IM0B 3OFFA 3DM2B 3GIJA 1S1UB 3VALA 4AXIA 1X9WA 2NREA 2W01A 3G6XA 3OTCA 4U67Q 3J80U 4F2SA 1FKPA 2QO3A 4NCBA 3PTWA 2LEPA 1T03B 2CJYB 2ZH6A 2OSQA 2DRAA 1HBNA 3DLBA 3QO9A 1FXDA 1K1QA 3MD1A 1KFDA 2EK1A 2KO1A 1EHWA 2XYGB 3PRBA 3W2VB 2E9ZA 1HMVA 1VRUA 3NL0A 1SL0A 4G6VB 1N32J 3MR2A 3QAEA 2UXDF 4Y2KA 1B0TA 4AQYF 2ZOMA 3QATA 2CQDA 4CTAB 4A8WA 4AL5A 1FJGF 5LL6d 2R7RA 1U0HB 3T19A 3D1QA 1VLYA 2HIQA 1N6QB 5KT5A 2NXNA 1XBWA 3CMQA 2DHGA 3CSKA 3WX8A 1I1GA 8AT1B 2J6TA 3SSQA 4LVOP 3LW5C 3PEHA 3IR5B 4IG0B 4ZLLA 1AUDA 1S4EA 2E1PA 2MGZA 3W7BA 3ZZUA 3CCQS 4QIWD 1YLXA 3Q24A 1PJ7A 1U7LA 2CQGA 3MMCB 3NP5A 2D3OR 3BB5A 3QYYA 4A8YA 4ED7A 1ZYQA 1RT6B 4TU9A 2BR0A 2HFOA 2HZCA 4UTGA 4DUYJ 2ZZNA 4O3OA 1EQ0A 2HURA 1LKZA 2VG7A 3MPUB 4AD6A 1R8PA 4BBYA 2CNNB 1UEVA 2NYIA 1RI7A 2DNYA 2YWKA 3D0GE 2GVDB 1TL7A 4M5DB 5IZHA 4CTAA 4ZS6A 2VQEJ 1Y0HA 1HBMA 3PYDA 5IS2A 4F0MA 3TYTA 3MI7X 4OX9J 1T03A 3QAUA 1T9VA 4FKYA 4LSNA 2I8EA 3SYZA 4M95A 5K8PA 1EX8A 2QMWA 4OJGA 3W3SA 1NEEA 4C0HA 3CCJS 4OV1A 2GO8A 3PG9A 3W9HA 2BMBA 1WEXA 2DH7A 1FKPB 1OPZA 1PKUA 2GV1A 1WTFA 1FRMA 2P9GA 3DGVA 4XAKA 3HK2A 2LCWA 1U4BA 1SL1A 2EFVA 1H2UX 4EO6A 4B3MJ 3PO5A 1ULRA 3LP2A 3D5MA 3ICLA 3DLEB 3MD3A 4CO1A 2E1MC 1LFPA 1V6HA 3VVUA 3GIMA 2B9EA 2M2BA 4EFAC 1HQUA 1S6QB 1UW4A 5BJRA 4HYKA 4F02A 4UOCA 1IKYB 3SXLA 1AZSB 2FDNA 3H8YA 3MAAA 3MUTP 2VOPA 1TAUA 2XMKA 3DNCA 3HVRA 4GKJF 2RRBA 3DOKA 3PVXA 4G1QB 3OTBA 1RDRA 1C1BA 2IAJB 2ZE2A 3QPIA 2AD9A 1HBUA 4TYBA 1KONA 1N4LA 1KN6A 3ZC4A 3RB6A 1KTQA 1C4AA 1WHYA 5M2PA 3BSCA 4NEZA 1T9WA 1TR0A 2MZTA 3HSJA 3Q0AA 1JNZB 2NXCA 2LEBA 1UVJA 4KPCA 3MFIA 1MROB 4FKXA 1MSWD 5J2QB 2U2FA 3PM9A 2RQCA 1GNKA 4YB6A 1XMQF 3TUPA 5H9FK 3GQCA 4JI6F 4FF2A 4I6YA 4C7QA 1F5AA 1HMVB 2CUYA 4X4PA 5KFQA 2DRBA 1AW0A 2Y0SD 2GJFA 1RWKB 2JC1A 3RR7A 5C2GA 5D6GA 3FZ2A 2GHWA 3LWLA 1FDAA 1H3DA 3LPEA 4DL0C 4JV1A 1TAQA 2J9DA 1EP4A 3UR3C 2HHHF 2AU0A 4LRBA 2E1AA 4M5JA 2ZWPA 3UDVA 1U0SA 2ZFHA 1J27A 1LNQA 1YRUA 1BWVA 4DV4J 2EFOA 5LT5A 1RQ0A 2GVZA 1NSPA 3TZYA 4OYMA 4E0DA 2MPUA 2JFKA 3GP9A 2DGVA 4DX6A 3H2VE 1WSRA 1S1VB 3DLGB 3RR8A 3JTOA 4X84A 2M0GB 4N41A 1Q53A 4H4KA 2QFJA 4PXDA 1FK9B 2GIFA 1NPKA 4P7TA 2DGXA 1BQXA 4PWWA 2R7WA 1KQSR 4PXEA 4PCQA 3IGNA 4PAAA 4C48A 1GXLA 3AAWB 4X66J 1WC0A 1IBKJ 1LWCB 4J91A 3TP2A 4LF2A 4UUXA 3MECB 5C25A 5K20B 1IWGA 1RAFB 4DL7A 4LF8F 4BWMA 3ZZOA 4WWSA 3JS9A 4KH1B 7FDRA 2IYGA 1TKTA 1OIAA 1VRTB 2H9ZA 3I0RB 3MEDA 3CXCR 1YZ7A 2Q43A 2BZ2A 3OVBA 3D66A 2W2MP 3ETMA 5GADI 1MN7A 3CCSS 4V19X 1PYOB 1G7CB 3SFGA 2LMIA 2FC9A 3RU0A 3W63A 1NB7A 1IXKA 2E5GA 1M1GA 2GQ2A 3BSOA 2YKAA 4OHYA 2IMOA 2M3DA 2XLJA 2IRUA 3EGWB 2R7QA 5KFRA 1N56A 4I7FB 4AT1B 4JI1F 2RB7A 1UETA 2BE2A 2OUGA 1RSCA 3G87A 4KHPF 1UZHA 2XI2A 2YKOA 4A8OA 2IJFA 2ZBPA 3RBZA 2D74B 3MM8B 1A6LA 2CG4A 4FS1A 3OR1A 2KM8C 3OD2A 2O01C 2XMUA 1FTCA 5M2RA 3W66A 3AFGA 3V6HA 2HHWA 1ZZNA 3MM9A 4DSKA 1U1OA 4OYBA 4XTTA 1VIXA 1XMOF 2QLXA 1B64A 4NRUA 3CGIA 3V81B 4JI8J 2UUCJ 3GR0A 3N0VA 3MAHA 3MEEA 4OLOA 3TJAA 6AT1B 4WCEQ 3MR6A 1U47A 1X4BA 1HWJA 2ZD1B 3BR8A 3GV5B 3UR0A 3MM7A 4OI1A 4DUZJ 1IBMF 3TOQA 4NXNF 4FYDA 1QSYA 3EYZA 1RAHB 2MSSA 1M1HA 1NPRA 1X5OA 5CYMA 5HP1A 1OY8A 2HRYA 4ZLJA 2GJIA 1PJ5A 4DL6A 3FMBA 3TEHB 2XO6A 1P6TA 4S0MA 4CM0A 4M5GA 1YGYA 3OUYA 2R2TA 4TQRA 2G4BA 4KHPJ 3VGTA 2EKNA 2HVHA 1FXLA 3VR1A 4IQMA 4KIAA 3MPYA 4GVBB 2B51A 4CLLA 4QYZJ 3HVWA 5DO2A 4LBPA 3VZIA 4ZCMA 2CQHA 1WF0A 4PUOA 4DR5F 2JVOA 1WJ9A 1Y3JA 3C14A 3R9LA 1XEZA 2QIFA 4X4RA 2FZKB 1J2VA 3CIMA 4Y6IA 4F67A 2P2CB 3EX7B 3Q23A 3FEYB 4IO9Q 4NLYA 1DFDA 3OTOF 4ZVRB 1WNEA 4HHHA 1HD1A 1WDTA 2MZSA 3MMBA 1WI6A 5ETKA 2FVQA 3M1VB 4GVBA 3G8SA 3KLHA 1XNRF 1D3WA 2BX6A 2YH0A 2IA6A 2UV8G 5J1NA 2GMJA 2IPOB 1JXVA 2RUGA 4X66F 3AD8C 2NSCA 3FCVA 1DTQA 2UUAF 1RT4B 3HSZA 4RW6A 1GTHA 3TO8A 2YQ3A 4H4OB 4LFAJ 1DRZA 2Q79A 2D3ZA 3R5JB 4IFVA 1M5VC 4X4UA 4R8UB 2NZ4A 1N5SA 3NS6A 1SBRA 4ZVFA 1FESA 4OZ0A 1I94J 2ZBQA 3CB4A 3N9UC 2LVWA 3MMAB 1RT7B 3M05A 5C7PA 4ZITA 2V2KA 1I5OB 2NCKL 4F04B 1FRHA 1HW9A 2M4MA 3FJ2A 1RWMB 5K8NA 1CBKA 1B7YB 2RF2B 5LMNF 4C11B 2HRUA 2HEKA 1CSJA 2V34A 1TVRA 4X2BA 1GXTA 5HK4A 4N5SA 3C3LA 2AJQA 2W4PA 2P9EA 3GYNA 3GIKA 2VICA 1X0FA 2HNDA 2C1EB 1VQ9S 4Q8FA 3I87A 3QNWB 1RWUA 2GGPA 4HL9A 1UWAA 4PWDA 2NUHA 2LFVA 4DR6F 3HCXA 2OMLA 2IDLA 3ZO7A 2FB0A 4C11A 2ZC3A 3C15A 3WDOA 2RF2A 1QE1B 4U8VA 1U2CA 1KLMA 2C2NA 3QIPA 2V9KA 4F3MA 1KSPA 2MKCA 3M6WA 4OYIA 1CJUA 1ACMB 3IM8A 5E41A 4USWA 4NCAA 1HBOB 1ZPWX 3KG1A 1JMTA 4X62J 4G3IA 4PR6A 4PWDB 1BQNB 2V63A 1MU2A 1T3OA 3D67A 1UL3A 1NH8A 1YRTA 1KBRA 3R6LB 1FFWB 2AYEA 1SC4B 2BOAA 4NZ6A 4P2SA 2ALYB 2AEMA 1TVRB 2E5HA 1VRQC 3DLKA 1JQGA 3A4TA 3DRSA 4NMLA 4RKUC 3ENQA 4NX9A 5F41A 2UVWA 2CJ9A 2J0WA 2JZ5A 2RH3A 1XJWB 5LM7E 3U1NA 4J9KA 4I67A 1C1CB 2IFXA 1PYTA 2N3LA 2ZM6J 2DNZA 1QVGR 3I0SB 2CZ9A 4WFXA 2AYMA 4TY8B 3D4JA 2K3IA 3G82B 1NPPA 3NCQA 3SDEA 1X5PA 4C98A 3MR5A 1KKHA 2NR0A 1FFGB 1TUGB 1UVIA 1S1VA 3DLGA 3M2VA 2G0JA 3CULA 4YOEA 4IKAA 3PYGA 3AH6A 1TUVA 4KTQA 3Q2SC 2BRLA 4IH6A 1RT5A 2B6AA 1F3FA 2RJZA 1VQ6S 3EXCX 1ELOA 4C2MA 4USMA 2LP4A 4U7UK 5KG0A 1RYRA 4B3TF 1FEHA 4QWDA 4DQQA 5CABA 5E5NA 3LQVA 3W8GA 5DG8A 2D3O1 1A7GE 1K47A 5L1LA 2FJXA 2V6AA 1S97A 2MJNA 1U1QA 1E6YA 1U02A 2LDIA 3DI6A 3IS9B 5KFLA 3H59A 4C0BA 1LXNA 5E3PA 1JX4A 1X4HA 3AQPA 4I4BA 5D0RA 4DWIA 3KYLA 4DUYF 3LTOA 5E3AA 2IBKA 2XWXA 4DV0J 2R7SA 3BYPA 3Q8VA 5GMDA 5IT0A 3MM6A 3HHLC 4DSFA 1FD8A 2V94A 2XCAA 1VQMS 4RBUA 2V8GA 3HVTA 4ICLB 1ZS6A 4CYUA 2W9CA 1VQ4S 3WC2A 2W1BA 4EBCA 5HQMA 4DL4A 4P9SA 1S9GB 3M9OB 1Q16B 4AUKA 2ZOGA 2MKKA 1TK8A 1FWPA 5H9EJ 2G1HA 1X60A 2GIRA 1JLGB 1RAJA 1UZDA 2QE5A 2XHCA 5D0EA 2XY5A 1Q79A 5E0OA 2IM2A 2YNGA 4OZ1A 3GB0A 3JXOA 1SIZA 4IFYB 5CQGA 1CJTB 4MK9A 2I6WA 3R8YA 4AQYJ 4OI4A 3M6VA 2PIIA 1MMNA 1R0CB 2OELA 4I68A 4YB7A 5KFOA 3D2WA 1NKCA 1PCAA 3UDLA 4DPWA 3W2WB 3CCRS 4OX7A 3T1YF 4B9SA 3M8QB 3MEEB 1ZH5A 1Q7YT 1DBDA 2R7VA 1KC8T 1RWOB 2H5EA 4QIFA 3KK1B 3M6XA 3CDWA 2CVEA 3CO0P 3MM9B 1I94F 4NCGB 2BM0A 3HHNB 2DD8S 2J9CA 3D1HA 4X64J 4UY85 4GKJJ 1T3NA 5K14A 1LEOA 1VRTA 2EK6A 1S1WB 1PAUB 3DLEA 3FEXB 2AYGA 1WD6A 2C3MA 3GCXP 5GAEI 5L9NA 5K5MA 1C4CA 2YNHB 4DQIA 2O1PA 2DT9A 3GYGA 3VQSA 1VC6A 5FJ4A 4C0OC 4KC5A 2OO4A 4IYQA 3CJ5A 1YTYA 1NKBA 2E9RX 2HQGA 4RPFA 1RE1B 3TNVA 2HZAA 4AFFA 5J2PA 1Q8KA 4KHMA 4UOGA 2F65A 3JQJA 3K58A 3EZUA 3G2XA 2MKSA 4F25A 3QQCD 3G4SS 4CLZA 3RJMB 2W8LA 4W98A 3MAQA 2CNLB 2VFVA 3R2DJ 1PGZA 3OXGA 4LFCF 1S7HA 5JJBA 4F4KA 3TJ9A 5KT6A 2JRSA 4WP8A 5HVGA 2HMIB 3TEGA 1U48A 3G96A 2E7VA 1TL1B 1WOPA 2F3JA 2WVEA 2NYHA 2CZ4A 4EI2A 2DPJA 2GVZB 1APSA 2AEFA 3CD5A 4L3NA 1YITS 4IG0A 2JLFA 3MFHA 2HGMA 3G71S 1V9OA 4NEYA 5CA5A 4HI2A 3PW0A 4F4YA 4J9RA 2G0IA 5L1JA 3IP0A 1KQGB 5J2QA 1O51A 1K73T 4Y00A 3T1HJ 3DOLB 3HLUA 4LREA 3UD4P 2WB1D 2DHSA 2FPHX 5KFMA 5KG2A 4N7TA 4X4QA 1ZM9A 3M30A 4FYVB 3CCUS 4URQU 2E29A 4RW7A 1KP6A 1MROA 4ENOA 3TQ1A 5J1PA 2PA8D 2FGOA 2ILYA 3R6GB 5E33A 3A8EA 2Y3YA 1UEUA 1RTHA 2OIHA 2UVUA 2CWXA 4LF7J 3FBFA 5EDWA 2UZAA 1NUEA 1NKEA 3P45B 1ZOTA 3I5AA 3AODA 4L74A 1U1LA 1QSSA 2LECA 3DHXA 4Q5VA 4P52A 4JV0A 1S79A 3HHEA 2OPPB 3MPVA 5HROB 3PCOB 2WOMB 1VQKS 3DGPA 4JI4J 4LF5F 4FF1A 3PYEA 4M5KA 1K44A 2LXIA 2WOMA 3D68A 1BUXA 4ILRA 4WP9A 4E98A 1FFSB 3DRRB 3RZAA 2WW8A 5L1KA 2KB2A 3VAJA 1J5OB 1U6BA 2HHTA 3T1HF 1AZSA 4JI0F 3RRGA 2HBRB 1UCNA 2MXYA 4X4OA 4ECRA 5G4DA 4KGXB 3DRSB 1UFLA 4OJ3A 4PQAA 1FVQA 1GFWB 4UF4A 3H5SA 3MCNA 1UFKA 2WVCA 3DRRA 2SXLA 2Z2ZA 2QG9B 1ICEB 3KJQB 1BXNA 2CADA 3ZZTA 2HFNA 2YX4A 1VHIA 9RUBA 4X4SA 1MNEA 3N79A 1X9SA 2AV5A 2VDIA 3VV2B 1GH8A 1N5YA 2YWWA 1CJVB 2DJWA 4FVCA 3DOLA 2CQCA 2JX2A 1FE4A 3KUEA 4OZJA 2JFDA 4WK3A 2AJ0A 2FZGB 2R3VA 3GFZA 3NKYA 1T94A 1LW0A 4B9NA 1FA0A 2VB6A 2B8PA 2PD1A 2VUGA 2RU3A 3HSGA 4AL7A 1NJXA 1NXIA 4B3SJ 1X5SA 2YWFA 4DCPB 2G9OA 2WBRA 1UEKA 2FHOB 2M88A 4M1KA 2AZ3A 5HL7Q 5ETLA 2B3TB 2U1AA 2Z2MA 3UN3A 8RUCA 4ZP7A 1UPMB 3HT0A 4HLBA 2VPZB 2DGQA 1ZETA 1FJ7A 4JI3F 2DNOA 3ZTOA 3J7AN 1GMUA 4WYLA 3P5TL 1T9YA 4FDFA 4KO0B 3SSSA 1PC5A 2ZVIA 1L3KA 2B56A 3W9JA 3DI6B 3IS9A 1CULB 3T41A 4CO3A 5KTQA 4QWEA 4L6V3 1HBNB 1R27B 2C3UA 4OHVA 3THPA 2MQLA 1PAEX 1VS3A 1L3TA 3IRWP 4R0EA 5FDLA 2H1YA 2KJWA 5K9FA 1XR6A 2ZH5A 1N6QA 1KR4A 2RDDA 3PY8A 4QPXA 2NQPA 2JJ4D 3SQGA 2YPZA 4YDXA 2J8AA 3Q22A 3T1AA 1REVB 4DSEA 1F9FA 3BEGB 3B8HA 2XZTB 3LP1A 2HMIA 3JTPA 1F1BB 1DY3A 5GMEA 5IC4B 2DNQA 3MMJA 3UW1A 5HO4A 4J9MA 5HROA 3SMZA 5DDPC 5I42A 4HI1A 5IV3A 3POTA 4XK8C 3PXGa 3G6VA 3SZ2A 2OPRB 1YSJA 1S10A 3KG4A 2LU2A 3K8WA 4FPIA 2UU9F 4IG3A 1YDLA 4JI4F 1JLFB 2ZH1A 3ELHA 3NXZA 3C2PA 4PUOB 2K1RA 3IG1A 1RTDA 3THTA 3W64A 4R25A 3NNHA 3K0JA 1YKWA 1T05B 1NK5A 1T95A 5F8IA 5CHCB 2HG4A 4WZMA 4K59A 2VBXA 2YNHA 3QT7A 1HNVA 1OO0B 2Z56B 4WKRA 3AB2B 3BH6B 1N8RT 5E3RA 1D8YA 3WC0A 5DQIA 4ED4A 3DKDA 1IKWA 3BR9A 4PRFA 4UOFA 5DJBA 1N36J 2HHSA 1XNQJ 3OSNA 2IY5B 2DH8A 3S7RA 1UJ5A 2ZDOA 2JEFA 2X3GA 5EWGA 3LWMA 2F4VJ 4FF3A 1ZBTA 2I38A 2HWHA 5CAAA 4GC6A 3PX4A 2ASJA 1AFJA 2OPSB 5F9NA 2PGCA 3ET6B 4KKOA 2J5AA 3CIZA 3I6PA 2HQIA 1CJTA 2HRTA 3KLFA 1HI0P 3K5NA 3UCZP 2GA7A 3NBPB 3TI0A
chains in the Genus database with same CATH topology
2B4UA 3H20A 2YX7A 1J5EF 4D3HA 4J37A 2BQUA 1T02A 2ROEA 5KAKA 3PW0A 2JLGA 4H54A 1W25A 2F40A 4Y2IA 1UJ4A 4WFAQ 3SI8A 3SFUA 3HHLD 4CQ1A 4DR7F 2LLZA 1XNQF 2BE2B 2BV3A 4QCLA 2E7XA 2I1RA 3U7JA 2AYBA 2ZJPQ 4DF4A 3T5LA 4DLEA 3D0HE 2XI3A 5H9FJ 1JJHA 4O23A 5LXRA 2N3OA 4LJMA 3I9ZA 4ZLPA 3LP0B 1S0MA 4G1PA 3V4IA 1SH0A 3P3DA 2KM8B 1R89A 1JLEA 1D9AA 3ITHB 3ITHA 4Q2MA 3QJLA 1B0PA 1QLNA 4O4GB 4Y34A 4ZDNA 2PC6A 2AJFE 3OFEA 4O3SA 3OL6A 4QU7A 3RAXA 2KG0A 4HHJA 3TAMB 2ZNZA 5KOWA 2WRMA 5KT2A 2XO7A 4BWJA 2AX0A 2F8EX 2ZITA 3LGMA 3TVYA 2X1FA 1RT2B 1HL6A 2MZQA 2WTFA 2MYFA 1N33F 3SDEB 3VAHA 4ECQA 1OSDA 4LQ9A 4K4YA 4M63A 4ES3A 2CPZA 1JB0C 3KMSA 4LIRA 2OD4A 4QIGA 2ZHOA 3OL9A 4FNHA 2LQJA 3FRYA 3J7A1 2J76E 5EGYA 1JWWA 3TARA 4LQ3A 2DR5A 4O3RA 2IVMA 1VQ8S 1LXJA 3CT9A 1ZM2A 2HNZB 1RT1A 2BQ3A 1YVFA 1S6UA 2QA4G 5KFDA 1ZAVA 2VL1A 2B9WA 4XIUA 3UCUP 5E2QA 3H4BA 4LFBF 3BGFA 4YEAA 1Y3KA 2IM1A 4WF9Q 3FQKA 4QR1A 4URSA 4OZ5A 4YR3A 3I5BA 5FLXY 1KFSA 1QJHA 5DETA 4B3SF 1C0UA 4I2QA 5KFCA 2DO0A 3PR4A 4DV0F 4K4WA 2UUWA 4I7FA 3B4DA 3EZ5A 1QSLA 3HT3A 4KGKA 3K5OA 5DGBA 3GFXA 3MEGA 2DHAA 3NGDA 4TKTA 4AE5A 5HQ8A 2B7CB 4Y2MA 4OZNA 4CT9A 2YNIA 4ZK7M 2HLUA 4DHVA 4U6PA 4FS2A 3G6ES 4OHZA 1NJIT 4C8OA 2C22A 3H5XA 5E3CA 4ZP9A 1R7IA 4NZ0A 5KFHA 3K7RA 2NS1B 5SUHA 5T41A 1JLCA 1KTVA 3HVAA 5KFIA 3KLIB 4XPEA 5JVGQ 4BC7A 1SKRA 3GR1A 1SL2A 2NSBA 5KFAA 4QQBA 4IUFA 2IHR1 4WIIA 1SUQB 2R7UA 4N76A 4A8SA 1UJ6A 3CJ3A 1JXLA 2VASA 3O6QA 1U26A 5U47A 1GXUA 1ZPVA 5C25B 2L9DA 3LP0A 3FSXA 4ATNA 2BW2A 2LXFA 3NG8A 3CCZA 3J80Y 1VJWA 3UFCX 4LUBA 2CQPA 5HLFA 2R2RA 3QJPA 1NAQA 3JTNA 3D1OA 2LQ9A 5FDLB 2KTQA 1KHVA 2IRYA 4I2QB 1JJ4A 2L41A 1U1RA 5DLGA 4RUAA 1M90T 1CVJA 3HJFA 4WZQA 4ED6A 1YJ9S 1C2PA 4YMEA 1JLAB 4CIOA 2VBWA 3HHKA 5LSRA 1WELA 2WSEC 3CC2S 5KFUA 1FRLA 3FQLA 1KD1T 2XY7A 4PXBA 4DEZA 3M8SA 4DMZA 5C5JA 2CQ3A 5DS7A 4K5SA 1SJ4P 3RW6A 4NLPA 3JYTA 3D0IE 1IKWB 3RRHA 2K2PA 4Q8EA 3CJ2A 4Z37A 3L09A 2YWHA 1CG2A 1NH7A 4IG3B 5L8RC 3IA0A 2V5HG 3HF5A 1HNWF 4KBIA 3KHHA 4B3OB 2L9WA 3AB4B 3IXQA 4FZVA 4RZRA 3MM8A 1H0HB 2QV6A 1XK8A 1PO6A 3SCKE 3N6MA 2YTCA 4TYAA 2VA2A 2HS4A 4ED1A 1VK3A 3UI3A 3VWSA 5DM7Q 3JSYA 4ETXA 4CH1A 4C4WA 1DJ0A 4BDPA 1QY7A 1S6QA 1DZ5A 3DMJB 3J7YI 4MAKA 1QUVA 2JVRA 4CO0A 3LAKA 4A8QA 3NGKA 2ZKUA 4RW8A 4NYZA 1FT8A 5EHHA 1Y00A 4X64F 4R0JA 3K5MA 4F4ZA 5GAGU 1BD6A 1QM9A 4OZLA 2X1AA 2RRAA 3JSMA 4NOHA 2PI5A 4KAIA 3HMJG 3EPGA 2XBPA 3GYXB 3NWGA 4Q2LA 4J9OA 1X9MA 2UUBF 1G1XA 2B4OA 1H98A 3ENWA 4B08A 2JEGA 2Y1JA 3V4MA 2C2RA 4NA2A 1X4AA 1KOHA 4KO0A 2K7KA 2POKA 1JKHA 4YB5A 3KTQA 3N28A 2OMOA 3I56S 1EP4B 4LIWA 5A6WA 2XS5A 2CJQA 2LXUA 2RILA 4DSJA 3HXMA 3UD3P 3CC7S 3T5HA 2FHJD 4RNMA 1SJ1A 1CQNA 1VRUB 3DOKB 5GMKa 2KZMA 2YNFA 2CQ1A 2VG5B 1RK8A 3K2YA 5A8RA 1Z2ZA 2MZ1A 1IBLF 4JI7F 1SB6A 1QAIA 2XS7A 1S1UA 3CPWR 5A0YB 5GAHU 3FEZA 1N54B 4ECVA 1IQZA 2PO4A 1HNVB 1U6ZA 4IRKA 2B9YA 2VODA 1VQPS 2RQMA 3OFGA 3M6UA 4C3MA 1SJFA 2EKYA 1VC5A 4DSLA 4OL8A 2K1RB 3IG1B 1RTDB 5KFZA 2APOA 4ZP8A 4FXDA 3QGIA 3BREA 2BOPA 3RB4A 3AJ2A 3RBDA 1W2IA 3FFIB 1DARA 3HDSA 5FIIA 3P96A 1SQEA 4BC9A 2Q66A 1M1KT 4G1IA 4B3RF 1LK5A 1TZ0A 5L39A 1O8BA 4MIBA 3PKMA 3DC2A 1DQ9A 1Q8BA 2ASDA 2MSTA 2PA3A 3MMCA 5K8OA 2KDOA 1AXQA 1F5BA 3U1LA 1VQYA 1YRXA 5KFBA 4LF6F 2UUTA 2C3OA 3M9NB 4DOZA 4WTYA 4M5DA 3G8TA 4F4WA 3R1LA 4NLOA 1WHVA 5LJ3Y 2PFFB 5F8HA 2L3MA 3CJ0A 3B78A 4DJBA 1RT3B 1MMLA 2RVJA 3TUIC 3V5RA 1TV6A 4M8LA 4O3PA 4J9PA 3V6DB 1JLQA 2DIVA 3CDBA 1PSDA 1Q1KA 1X7VA 2CPIA 3FVYA 3MTKA 2MQNA 3CTRA 2W7AA 3OL7A 4ECSA 2JL9A 3GV8B 2J0QD 2OLWA 4FXVA 4OI0A 3GG1A 1H7WA 5D8HB 3GFYA 4H4MB 4JBCA 3V6DA 2I2YA 2CPDA 2VFRA 4YY3F 2W9CB 5L1IA 4KJIA 3BM7A 4ID8A 4KRWA 1RT5B 4N77A 3ZZZA 4UY8T 1GAOA 2LEAA 4IH7A 3FFIA 4QWCA 1WEZA 1RISA 5IT4A 4G1QA 2V4RA 5JVHQ 2KRBA 2VA3A 1N5QA 2QRRA 2Y1IA 3KMQA 3PHEA 4ED3A 2DGUA 3GZ7A 1HHSA 2AWZA 4WU2A 2B9XA 2I5JB 2HWIA 2FD2A 4JI2F 1P27B 4K0KF 4WXOA 4KE5A 2KFNA 2G13A 4LSLB 2HHUA 2DTJA 4O44B 4FBUA 1V3ZA 3CCTA 1BQMB 1S9EA 1U2FA 3JSBA 4WU3A 2ZM6F 2W4DA 5IQ6A 1M5PC 1U45A 1TFYA 4X4NA 2CJKA 2QSWA 3RW7A 3V2UC 1TL4A 3L3CA 2V4QA 4IFYA 4JYAF 1S1XA 1X4CA 5I3QA 2YX1A 1U2RA 1MWZA 4DG1A 2IVYA 4KV8B 2VFTA 3CJ4A 2Y1RI 3IWLA 1G3OA 1RTHB 2EG1A 3KK1A 2CJBA 3TRGA 1YJVA 3NS5A 3CMES 3CEDA 3VAMA 5IQQA 2O5DA 2W25A 2IMWP 1FRKA 4DN0A 3CO9A 2AJ4A 1Y5LB 3IAM9 2NPFA 3GE9A 3TAQA 3TUJC 4ELUA 2FVCA 3IAS9 1R6YA 4F26A 4WFZA 1O0PA 3OR2A 3KNAA 3HM9A 4NLUA 2HS3A 4NPOA 1RA6A 1XMBA 5DDOC 4NYPA 1NO8A 1T8EA 2BACA 2MKHA 2HGNA 1RGVA 1SKSA 1L3VA 3MGJA 4CCHA 3QZ8A 3D28A 4I0WA 4Q43A 4B9VA 4ECTA 1DTTA 2ZNYA 2QMXA 1R0AA 1UWBA 3QLHA 4PXCA 2WONA 5C24B 5KFKA 3ZFVA 4DN9A 1U24A 3M2VB 2W9BB 4F4XA 3PW4A 3DN9A 2DH9A 2PE8A 3KK3B 4B9LA 3NCRA 3WZ0A 2CIMA 1SV5A 2HHVA 2BUNA 1K0TA 4ILMA 3I0SA 5KG7A 4LFAF 4U9RA 3TW0A 5B08A 4DF8A 3LGNA 2ATLA