5LSOA

Crystal structure of spf45 uhm domain with cyclic peptide inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing/inhibitor
molecule keywords Splicing factor 45
publication title Rational Design of Cyclic Peptide Inhibitors of U2AF Homology Motif (UHM) Domains To Modulate Pre-mRNA Splicing.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lsoA01
2KFYA 3ULHA 2M7SA 2DNGA 3UD4P 2KT5A 2XSFA 2HGLA 3CTRA 3BS9A 2HVZA 3S6EA 1KQSR 2KG1A 5JVGQ 2JX2A 1YJ9S 2XNQA 5GMKa 2DGXA 3CCMS 3B4DA 4TU9A 1RKJA 2M8DB 3IWNC 1X5PA 1ZZFA 2O3DA 3L3CA 3BO4A 3G71S 5GADU 2K8GA 4UQTA 3CCRS 2MZTA 2F9DA 2M2BA 2KYXA 1NJIT 1VQ5S 3FEXB 5CYJA 2AYEA 2LYVA 3MUMP 1FXLA 2X1AA 2MKHA 2DB1A 3BEGB 2ZJQQ 3CC7S 4IUFA 2DHSA 3CCJS 2MSTA 2CQ3A 3DXBA 2MQLA 2HGMA 2XB2D 3TYTA 2MJNA 3ZZZA 2MSSA 1U6FA 1UFWA 2MMYA 2KXHA 1DHMA 4FXVA 1JJ2R 5HL7Q 2MZSA 2BZ2A 1Q82T 2KU7A 3MUVP 3MD3A 1VQ9S 2RU3A 2M8HA 1WHYA 1M5KC 2CJKA 1U6BA 2WBRA 2DH9A 3SDEB 4YOEA 3U1LA 3NS5A 2JWNA 5IQQA 1YTYA 2RS8A 1U1PA 1H2TZ 3J7ZT 3VF0B 3EGNA 3US5A 2N7CA 1SJ3P 2D3OR 1OPIA 2MQQA 3CMES 1N54B 2N3OA 4WIIA 2I2YA 1JJHA 4WF9Q 2DNLA 2ADCA 1YJWS 4LJMA 4BS2A 2LQ5A 1YI2S 1WI8A 4A8XA 4U67Q 4ERDA 2LA4A 2MQMA 1PGZA 3MD1A 2MYFA 3P5TL 3CCLS 2OJ3A 4PRFA 2MGZB 1VQPS 1Q86T 2MKSA 2LKZA 2GO9A 4WFNQ 2DNZA 4ED5A 1H6KX 1FO1A 2JVRA 2K3KA 3PIPQ 1HD1A 5GVQA 3TO8A 5IM0A 2ERRA 1NO8A 1WWHA 4QQBA 2KRBA 5ITHA 5IFMA 5GAHU 5JVHQ 2CPYA 2DO4A 3G9CA 2MY7A 2DNOA 2CPEA 4F02A 5LXRA 2MHNA 3MXHP 4FXWA 3J7YU 2CPIA 3MUTP 1VQ4S 2QEXS 1WTBA 3HI9A 4WFBQ 1U1QA 3UCGA 1HA1A 3VAMA 1NU4A 1WF0A 2MZJA 2KM8C 3VAIA 1U1MA 2GHPA 3MDFA 1WHXA 4CIOA 1WEZA 3MURP 2M70A 3G6ES 3CXCR 4IOCQ 3FEYB 1HD0A 4J5OA 2LECA 1W2BR 1OIAA 2CPHA 1X4CA 4F26A 2VOOA 3VAGA 2PEHA 4LIRA 2RUGA 2CQDA 1X5SA 2DO0A 2YKAA 2EVZA 1VC0A 3HHNB 2L41A 2M4MA 1FNXH 1VC6A 3UD3P 4Z2XA 3P6YC 2ZJPQ 1X4FA 1QVFR 2E5JA 5LSLA 1X4DA 5LXYA 2OIHA 2DNNA 3CC2S 2AYMA 2MZRA 4YUDA 2M52A 1VQOS 4IOAQ 1VBXA 2X1BA 3CUNA 1U1RA 4QU6A 1FT8A 3SXLA 5DETA 1G2EA 2CQCA 2X1FA 3S8SA 5D78A 2LXUA 3THTA 2BOPA 2DGUA 3G8TA 4CH1A 1Q7YT 3CC4S 5MLCV 1P1TA 3UE2A 3CMAS 2UP1A 1RK8A 2DGWA 3Q2SC 3VAJA 2MPUA 2KM8B 2DNQA 2DGTA 5BJRA 3G96A 2QA4S 3R27A 2DNHA 2JRSA 2LEAA 2SXLA 4C7QA 3LQVA 2LXIA 1SJFA 2DHAA 2I38A 2KHCA 2XS7A 2D9PA 3P49B 2OTLS 2E44A 1VQKS 1R8HA 3S01A 1VQ7S 2E5GA 1YHQS 4V19X 1D9AA 1SJQA 2KVIA 5HO4A 1DZ5A 2QFJA 1UW4A 5DDRC 3IRWP 2KRRA 3JB9k 2DNMA 1YWXA 2YWKA 4WKRA 1VQ8S 5EN1A 4F25A 1M1KT 1WHWA 2MQPA 1YIJS 5D77A 3R1LA 2RQ4A 2G0CA 3BO2A 1X5OA 3NS6A 2EK1A 2OTJS 2MKIA 2DITA 2J76E 2NZ4A 1K73T 4W90B 3Q2TC 2MKJA 2OSRA 2X1GA 2N82B 3I56S 3MI7X 2DK2A 2JVOA 3D2WA 1K8AT 2G1DA 2CPDA 2YTCA 2DGSA 1VQLS 2L9WA 1S72S 1P27B 1WF1A 5DDQC 2KG0A 1JJ4A 1XN9A 3DLLQ 1URNA 2MGZA 2VONA 4Y0FA 1VQMS 1VQ6S 2OSQA 2KXFA 3CPWR 2MKKA 3UCUP 1O0PA 1OO0B 5DM6Q 3CF5Q 2RNEA 2V94A 1SJ4P 1Q81T 3P3DA 5FJ4A 2DHGA 4QPTA 4TU8A 2MZQA 1U2FA 3H2VE 3TP2A 5LJ5Y 2CPXA 2DIVA 3VAHA 1KOHA 1A7GE 2M0GB 1X4AA 1M5OC 1WEXA 4P6QA 3CCVS 2F9JA 1VBYA 2CQBA 2MJUA 2YH0A 1KC8T 4Y00A 4TLQA 3RW6A 2E5IA 1VBZA 1H2VZ 2CPFA 1U1LA 5LJ3Y 2HZCA 2CQIA 4PKDB 2LCWA 1YITS 1VQNS 1QM9A 1PO6A 4RU2A 5GAGU 4W92B 1X4HA 3PIOQ 4LMZA 2KH9A 2PE8A 1FJCA 3VALA 1U1NA 3OW2R 2FC9A 2YH1A 1IQTA 1FHTA 3MOJB 3EGZA 1JMTA 1ZZNA 2HGNA 3R1HA 2NLWA 4EGLA 1WHVA 2CPJA 3NMRA 2LMIA 1M90T 2KI2A 1S79A 3U1MA 2LEBA 4OZ1A 4CH0S 2FHOB 2RS2A 3VAKA 4CQ1A 3UCZP 4IO9Q 1HL6A 5GAEU 3CD6S 4ZKAA 1N52B 2M9KA 3THPA 3CCQS 4YB1P 2KXNB 2ZJRQ 1X4EA 3NNCA 2XNRA 5CA5A 2U2FA 1M5PC 3NNHA 3UWTA 3CULA 3VAFA 2EK6A 2CQ2A 2J0QD 4WFAQ 1BY9A 1WG4A 3B4MA 5DDPC 3ZZYA 3G8SA 1YJNS 2DISA 2XS5A 3K0JA 3CCES 3V4MA 2AYGA 2RRAA 2MY8A 1WG5A 2U1AA 3I55S 2CQGA 2CQHA 2D9OA 2ADBA 1N88A 5CXTA 2DGVA 2F3JA 3SDEA 1R8PA 2RVJA 2DNKA 3S7RA 2MZ1A 1K9MT 1DBDA 2DGQA 2CQ4A 3SMZA 2DNYA 1AUDA 2B0GA 2DNPA 2DGOA 3RW7A 4M5DB 1U1OA 2HYIB 1F9FA 2DNRA 1WEYA 2MKCA 2RT3A 2FY1A 1A9NB 2VOPA 1FJ7A 2E5HA 1ZH5A 3H2UB 5IM0B 2VODA 1X5TA 1CVJA 2LA6A 3CCSS 2M88A 1X4GA 1D8ZA 1SXLA 4C0OC 2MB0B 1X4BA 2Q79A 4OZ0A 2RQCA 1M5VC 2AD9A 2KN4A 4WCEQ 1KD1T 2XS2A 2L08A 1X0FA 1WF2A 2J0SD 2CQ1A 2DH7A 4PR6A 1OWXA 4QU7A 2RRBA 1FJEB 4C4WA 1SJRA 2MXYA 1L3KA 1WI6A 1UAWA 2J8AA 2FPHX 1VC5A 3NNAA 2A3JA 1WG1A 2FC8A 1DRZA 3BO3A 3EX7B 5DM7Q 2DIUA 2AYBA 5H1SV 5DDOC 2CQ0A 2DHXA 1KOOA 1WELA 1U1KA 2MQOA 3CCUS 2CPZA 2MQNA 3G4SS 2G4BA 1QVGR 1B7FA 3N9UC 3LPYA 2DH8A 4UY8T 1H2UX 2CQPA 4TU7A 5LSOA 1N8RT 1UP1A 2N3LA
chains in the Genus database with same CATH superfamily
1CJTA 5DS7A 2M7SA 1CULB 3MR2A 3EUNA 5B0AA 2HAIA 1RT4A 5F8LA 4DCJB 3P5BP 4LFAF 1RKJA 3THVA 4BHQA 3SI8A 5K8OA 3PX4A 4KY3A 4WFXA 2HFSA 1KKHA 5EWFA 2DHSA 1RTJA 5J2QB 3N79A 4ZVHA 3DXBA 2JEJA 2CJAA 2VU5A 3OTCA 1JLQA 1JB0C 5KFQA 3EPGA 3D1OA 2L3MA 1Y5IB 2XLJA 1OPIA 4WK3A 1ICEB 2IA0A 1MMDA 3TZXA 2JJ4D 3DLHA 4Q0BB 1UVIA 4LF9J 2P6TA 3M9OB 1GK8A 3JTOA 4KH0B 2WOMA 4KH1B 2GCFA 2IDEA 5DZ7A 2L9NA 2VBZA 1NO8A 4WFZA 3LP2B 5GAHU 4CRJA 4DMZA 2DNOA 1EQMA 2I5JA 3GFYA 5K14B 3E8OA 4FXWA 3MM8B 4N8NA 4TYBA 3DGPB 4AL7A 1TK5A 3KLFB 1NK7A 5KT7A 5D3GA 1GMWA 4ZVTB 2HNZA 3DYAA 1HBOA 3IMQJ 1S9EA 3IFEA 4C8MA 2CJQA 5K8NA 2M3DA 3VAGA 2C2NA 1RT5A 4H4KA 3HHNB 1HQUB 1AW0A 2L41A 1VC6A 2J9CA 3RGIA 1X4FA 1PAEX 1K1SA 1VHFA 1RCOB 4TVAB 2GAHC 2GJ2A 4V1Ak 1JLCB 2YWGA 4IYQA 2M52A 4K4XA 2BRKA 2NUHA 1OQ6A 2ILYA 3IAM9 5JXSA 5J1EB 2DCUB 4ZHRA 3FMBA 5CZVA 3M2UA 2LXUA 5A6WA 2BOPA 2IAJA 2DGUA 3MM5B 2GHVC 4LT6A 1C4CA 3BF4A 1FFSB 4LBIA 4ZS6A 1R0BG 1VK3A 2LEAA 2SXLA 1FD8A 1HPZB 3N5BA 4KQZA 2LXIA 5GAHI 4QWBA 2HIQA 1NHKL 2OHDA 2GVZB 4N77A 4QJVA 5JUMA 3LUYA 3KYLA 3IRWP 2BJDA 4NZ7A 4LSNB 1S6QB 2QIFA 3FBFA 1PG5B 5F8HA 3CB4A 4MK9A 1G4CA 3DKDA 2DITA 3QYYA 1PYSB 3L7OA 4DV5F 4ZVRB 5ETMA 3W2WA 4LIWA 2KG0A 1BD6A 1YK9A 3OFHA 3WZ0A 3UCUP 3CF5Q 1UW9A 2V94A 2EXUA 5FJ4A 3Q8VA 1S1UB 3TZZA 5ETNA 3EZ5A 1U2FA 1FERA 4KGVB 5JMNA 1L3UA 4HEA9 4ZVQB 4OLOA 3EICA 1DTTB 1Y5NB 4TKTA 1RQ0A 4RW6B 1BWVA 4NLQA 4M5NA 4LF4F 3FGVA 2CQIA 4CO5A 1B99A 4E98A 4ETZA 4RU2A 2R3VA 2FTRA 3FSYA 2UVWA 4UOGA 4RWWA 2GMHA 4DFKA 3HD1A 5IOLA 3B6BA 3ONQA 3G2XA 1HL6A 1SC1B 3CJ4A 4WBFA 3QT8A 1UTAA 3J80U 2OI2A 1V3ZA 4M5LA 5A8RA 1IKXB 4QIGA 3SFGA 3ETOA 5F8NA 2XULA 1RAAB 1S5ZA 2KL8A 3C19A 3LPEA 3SMZA 3R7BB 2ATCB 3CIZA 4J9PA 3EXYA 2OEJA 2CNNB 2LA6A 3POTB 1RHRB 4ZJQA 3KK1B 2ZUAA 1X4BA 2RQCA 3BSCA 4NMLA 3VZHA 3G6VA 1EHWA 3PJ9A 5J2PA 3VGUA 2DIUA 5J1PA 4YY3F 2VG6A 2ZM6J 1U1KA 1TU0B 2NPIA 3HT3A 2X3DA 5KFZA 2DH8A 3LP1B 4OYMA 4UY8T 1RT3B 2YNHA 3ISNC 3FZBA 4ALZA 2OEMA 2XCAA 1N56A 4AYBD 4UUXA 4EZ6A 1FI4A 5C2GA 2WSCC 3M8WA 3KLIB 1GMVA 3Q83A 2YNGA 5AXMA 4JI4J 1OSDA 2PDAA 1QTMA 1B7YB 1FTCA 2LP4A 2W8KA 2X1AA 4MFBA 3FZ2A 3AHPA 1Q95G 2YX7A 2F65A 2IA6A 4DR6J 4I56A 1Y3JA 2BZ2A 1Q82T 1U8WA 2OP5A 1QUVA 2FLLA 1JKHB 2DH9A 3SDEB 3ET6B 4ZVPB 1EP4B 2JWNA 4Z7YA 2K7JA 2I0XA 3UDCA 5T41A 1TVRA 1UVKA 2D3OR 1YX2A 1JJHA 1HNIA 5D0HA 2LQ5A 3QIPB 2B51A 4OZJA 4ERDA 3DDNA 3CJRA 3G86A 2QA2A 2BA9A 1XR7A 1RLDA 4PXCA 4RR5A 1HKAA 3CE8A 2H5IB 4OYXA 1X9WA 5EDWA 2HVIA 1XC9A 3HD2A 2YNIA 4KE5A 4M5HA 1I3OB 1FA0A 3ZTRA 1FFWB 2QRRA 2E5LJ 3NOCA 3GFHA 3MM6A 3N01A 4I67A 2DEIA 2H4YB 3CO0P 1AZSB 1RAJA 4K4TA 2ZH2A 2YKAA 4NEYA 3HHLA 1HLWA 2VFVA 3TVYA 5KG5A 1FNXH 2H51B 2IPOB 4OZ2A 3NGUA 1U4BA 2J9DE 4XIUA 5F9LA 2R7TA 1L3SA 2R2TA 3CC2S 2AYMA 2W4DA 1S48A 4X64J 1OSCA 1OQ3A 4LF8J 3OXGA 3D6TB 4I6YA 2FVRA 2CVEA 2GQ2A 1TFYA 1FE0A 3RB6A 4KGZB 1DTQA 7AT1B 1S4FA 4GC7A 3KK3A 1APSA 3A1YG 3EDRB 1H72C 4J7CA 4K7QA 2LQJA 3LH2S 4CCHA 4KHRA 1VIOA 4E2FB 3IM9A 5KFBA 5HO4A 3RRGA 2QFJA 5DDRC 2F8HA 5EUHA 2E7VA 1YWXA 4J90A 3TX0A 3DI6B 1M1KT 2AGOA 3GWCA 4G65A 2OSRA 2JEFA 2J7WA 1I1GA 1SV5A 2ASYA 2YBVA 3OR1A 1NPRA 1YBUA 1UWBB 2YWWA 2F63A 1VYAA 2PIIA 4PG6A 2E66A 5HLFA 2FJXA 3PZPA 2CPFA 2H1YA 2XYPB 1Q5VA 1YITS 1KONA 3OT9A 4W92B 2BE2B 3QJLA 5J2NB 2PE8A 5BR8F 3AY0A 5KOXA 1K0VA 5EWGA 1SIWB 1F5CA 1JMTA 8AT1B 1T8EA 2JNJA 1WHVA 2CJXB 1M90T 1C2PA 5I3UA 1S79A 2R7QA 4JBCA 2BV3A 3CD7A 1UFLA 3NS7B 3NXZA 2RS2A 2G1HA 5ETPA 3NOGA 2M9KA 4PUOA 3CCQS 2ZM6F 4E8UA 3CJTA 2KXNB 2IMWP 2VHGA 2YPYA 5EX3A 3UWTA 4UZBA 3GONA 3OHAA 2GA7A 2XMMA 1VRUA 3IWLA 2FJVA 1SJ1A 2MY8A 4DX7A 4H4KC 3DMJA 4DL7A 1XR6A 1TL7B 3G87A 4OIXA 1U6ZA 2DGQA 3EWGA 2GFFA 3VHQA 1RI7A 4FZVA 1HI1A 3I4HX 2LQ8A 2RT3A 4FYYB 4JI4F 4JI5J 4I1TA 1OYDA 2EEYA 4DPWA 1X0PA 1I5OB 4HH1A 1RLCL 3D28A 5CD4H 2Q3PA 4DR6F 2G2ZA 3CD0A 4PR6A 1RHJB 4OLPA 3AQPA 2UZAA 3BO3A 3BV8A 3OFGA 5DM7Q 1QE1B 3GSIA 2K06A 2CPZA 3MPVA 1X8DA 3N28A 4USHA 4KTQA 2WHOA 3DC2A 2UV8A 2DXFA 4F3MA 3D7SB 4DSJA 2WBMA 2IVFB 4TU9A 1FRMA 3L3CA 4DCOB 5CYJA 1QAJA 4ZCIA 4EUVA 4DL6A 3ZZZA 2YQ0A 4QR2A 4USKA 3B82A 2Z2YB 3Q8YA 2B8QA 2UU9J 4LF5J 3LF0A 4DS5A 2MLYA 3BH7B 4DOZA 4DU7A 4J37A 2YXLA 3UW1A 3DRRB 4KHPJ 1N54B 4WIIA 3FSXA 4WF9Q 2Y1LB 4F2SA 4X64F 2RKIA 2BR0A 3OXFA 1GQEA 2MQMA 2V2ZA 4K4UA 1HMVA 4DX5A 2HWHA 2V8HA 1RT6B 5HROA 3UDLA 2ERRA 4RUBA 1T9TA 2YNFB 4DBQA 2NREA 3HFZB 2MY7A 1GXLA 3LP0A 2DBBA 4Y2KA 1YJ7A 5CQGA 1N5YB 3M2RB 2P6SA 4ZPWR 2Z30B 3ISND 4ILLA 2J6UA 3ETMA 1ZS6A 1X4CA 1UA0A 3QBCA 1S1XB 2JLGA 2WCXA 2ZNYA 1NZAA 1X4DA 2NXEA 1CULA 4OI2A 3KMQA 1WKKA 4LBPA 4ZN1A 2J8SA 2HHVA 3JAMU 2N4DA 3QRRA 2H9ZA 5C25B 1LW2B 2NPFA 2UUWA 1S77D 1FDBA 1RA7A 2Z2MA 5J2QA 2GIRA 2JZ5A 3FJ2A 1RWOB 4WXOA 3AOBA 1HWJA 3DRYA 4Y65A 3IS9B 3JB9k 1BXNA 3TNVA 1PCAA 2W24A 4FBTA 5IQ6A 1S57A 1T3NA 4FPIA 4K0KJ 1IKWB 4C97A 3BM7A 1PJ5A 2V0NA 5FLXY 3NGTA 3TUPA 1BUXA 2Z2LA 2BRLA 1UETA 3U02A 4O3RA 3LP2A 1LFPA 2QO3A 1RTDB 2R7XA 2X3GA 2QL7B 4WIQA 1PSDA 5K14A 4L3NA 2MJUA 1UVLA 3MM8A 1HBMA 3CDUA 1ZBTA 3DGPA 1NB2A 3UR0A 3KLFA 4ECSA 2LCWA 1GX5A 4JI5F 5E5NA 4W98A 1X4HA 4RW9B 5KFXA 4CLSA 3CW2C 4GVBB 4A8MP 3W2VB 3ZO7A 1NB7A 3EGZA 2YX4A 1HQUA 4ZVFA 2BW7A 1MMLA 1NJYA 3OD2A 4BC9A 5GAEU 1Y9OA 4ZKAA 1RB0A 3KMSA 4JI1J 1JLCA 2QFIA 3NNCA 2R42A 5H9FK 1C1CB 1M5PC 3ENQA 2D1CA 3BKTA 4KYZA 5J1EA 5DDPC 3K0JA 2HS3A 3MM5A 3HHLC 2CQHA 2O67A 5CXTA 2DGVA 2BABA 2RVJA 3DGVA 1GNKA 1EB0A 2VC1A 1HPZA 3GFZA 4NA2A 5D4NA 4F0HA 3D0HE 2EG2A 2GVZA 2DKOB 2W9CB 3HZGA 4RKUC 1X5TA 4F2RA 4LSNA 3BQ2A 1S6QA 4HDGA 3M9MB 4C0OC 4M63A 3H7HB 2QMWA 2XI3A 4YN3B 3PEHA 3GMGA 5HN0A 4OL8A 1RA6A 1ZPWX 2RD5C 1FJEB 2GV1A 2UU9F 4LF5F 4U7UD 1UWAA 4FKXA 2CQ0A 5EHHA 2V2VA 5GAEI 2EC0A 1S1UA 4KHPF 4O3OA 1VLYA 4WFYA 4P9SA 2B56A 2DNGA 5DQGA 1IBLJ 1DTTA 4A8FA 2C3UA 1UA1A 2HVZA 3S6EA 4RW6A 2BACA 5CHCB 1SL0A 4LSZB 3B4DA 1YBAA 3E01B 5H9FJ 2V67A 3H42A 1WD6A 2XC9A 3DM2B 4LSLB 3CJKB 3IA0A 1P8GA 2F9DA 2HHTA 2V4QA 1CEZA 3KOAA 4ZITA 2MKHA 3CCJS 4ZVUB 3TYTA 4KAIA 4DPXA 5HL7Q 4EEYA 3TEGA 1GMWD 4HH0A 2RU3A 1WHYA 2UUBJ 2OD4A 1CJKB 2H4WB 1D0EA 2Y8WA 4NASA 1KNZA 4RW4B 2B4PA 3ZXWA 2FHMA 2YVSA 1NLKL 1YG0A 1IKXA 5D8HB 3BR8A 1LNQA 2N7CA 3UNYA 5KFSA 5KFWA 1YJWS 3KJFB 4BS2A 1SL1A 4ES3A 5DGBA 1MWQA 4RX6A 1TUGB 3CGIA 3NGKA 1VQPS 2JSXA 2K1RB 2XWXA 3UQSA 3ILOA 3B54A 4XDDA 3FDSA 3POTA 3KK1A 3AXKA 5KG4A 3SSQA 1MMNA 3R97A 3MUTP 3AT1B 4DUYJ 3RB4A 3KG4A 1WTBA 3HI9A 5EX0A 3G8QA 3Q86A 3GTYX 2MZJA 2KM8C 3PX6A 4HT5A 5KFUA 4DV0F 2ZBPA 2XZTB 1Y10A 4F26A 2ASDA 2F5GA 3LP1A 4FPRA 1SC6A 1QJHA 2UUAJ 1RT3A 5DQHA 4PYDA 1EAYC 2E5JA 4K0KF 5LXYA 4JUZA 4DG1B 3C3LA 2LU2A 2Y1JA 5JJBA 3CD5A 1E6VA 5SUHA 1EZZB 4K4ZA 3FMWA 4OHVA 3PW4A 2HK2A 4MYUA 3R2CJ 1JXVA 4NLYA 2ABYA 2MPUA 2AEFA 3BBCA 2AIRB 3GIIA 3C8YA 3LAKA 2MHEA 3PYFA 3VQTA 2DEJA 1R7IA 1N32J 4DR1J 3S01A 1EX8A 2E5GA 2QLJB 1FK9B 1M1GA 3BPSP 4YB5A 4LQ9A 1JKHA 1J5OB 2KRRA 3MMCB 4K4VA 2DNMA 1T11A 2Z56B 3ET6A 1EP4A 3ICLA 3TUJC 3UI3A 3LGMA 4QWCA 4URGA 1K73T 4KPCA 3AXMA 2AJQA 4JI1F 2FVQA 3QIPA 1JLAB 2G1DA 3DLLQ 3T1YJ 3O44A 1VQMS 4ECXA 4DL0C 1ZA1B 1S0MA 4GMKA 2A2DA 2PO4A 3VAHA 4PQUB 1QLNA 1VBYA 4KPYA 2CQBA 4RU9A 3OL7A 3IO1A 1IWGA 3UNGC 1WSRA 3T3FA 1PO6A 2HBZB 2ZBCA 4UOCA 3DN9A 4TY9A 1AZSA 1FXDA 2FVPA 4X4NA 3GCWP 3H5UA 3RRHA 3FC9A 1XK8A 2DXEA 4IQXA 1G3OA 4CH7A 4DZDA 2R8KA 3OR2B 4ELVA 1GTEA 3PKYA 1Y00A 4DSKA 2NYIA 4NLTA 4XO0A 4ED0A 4IH5A 1B3TA 1Q8BA 4U95A 2BQ3A 2AV5A 3JSMB 2AEMA 3V4MA 4ED6A 2ZVSA 1IBLF 5IT9U 2C1EB 4MK7A 1C1BB 3FKBA 1DBDA 4RO0A 2HFNA 2DNYA 4C2MA 4M5DB 1FRXA 3BDEA 4P2MA 3PRVA 2XHCA 1EIYB 4C6AA 4ILMA 1WOOA 2B4OA 3KKFA 4IFYB 2H5EA 3DI6A 2XM3A 1M5VC 4WCEQ 3IBCB 4FYDA 2IYIA 2PA8D 1RJJA 1NDCA 2UUBF 1WG1A 1DARA 2XG8A 1LW0B 3EX7B 2XO7A 3CJ8A 4BCAA 5K20B 4MKAA 2G4BA 1CPZA 3ZNUA 4XK8C 5A2QU 4OI6A 1O51A 3MPYA 3SV4A 3K5PA 2J7UA 1RWXB 5F3ZA 3KUEA 1UWBA 2XSFA 1XR5A 5KFHA 4J9SA 4NRUA 2RJZA 5B0GA 1M0SA 2ZE2B 3MGJA 2HQGA 2WSFC 1IKYB 3A8EA 3V81B 2BE2A 3V6KA 1LXNA 5J2NA 4WYWA 4ILRA 5L46A 2BEFA 1FXLA 2DB1A 3OVSA 1ZPVA 3O5TB 3LALA 1HNWJ 4XTTA 4MAKA 2XB2D 3PR5B 4DUYF 3ZTPA 1C4AA 5AJ3J 4K4YA 4NOHA 3HHLD 2L9DA 3PG9A 1IWAA 2YWEA 3EGNA 1WUUA 2IRUA 2UUAF 2H5JB 5KG2A 5BXIA 1D1UA 3GG1A 4IG3B 3RU0A 2I2YA 1FVSA 1F0XA 1TL7A 1CJUB 4NA1A 3KUGA 4A8XA 4PWDB 4I69A 3BB5A 1FEEA 2HFOA 2GO9A 2QMXA 2CNOB 4TQSA 4NXMJ 2CPYA 2DO4A 5F0WA 3MR6A 4CLPA 2IM2A 3KLEB 3J7YU 2CPIA 1IR0A 1L5UA 5E3QA 4YQWA 1N32F 4DR1F 4FXDA 3ELHA 2DR9A 1QE1A 4M5JA 4Z37A 4DQPA 2VOOA 1O5JA 4AD6A 2CNKB 4R0EA 1VQSA 1NSQA 5F3TA 2ROPA 5HP1B 2BJ1A 3CCTA 5B0FA 2J0XA 2IJFA 3T1YF 4KBIA 1NH7A 1XIQA 1ZETA 2RQKA 2L48A 1YJRA 3HSDA 1NDLA 2VF3A 5AXKA 4ED4A 2KYZA 2PFFB 1VOMA 1T95A 3G8TA 2CRLA 3R5CA 5MLCV 3AJ1A 3KLVA 1D8YA 2RDDA 1S9GB 1RXOB 1F2HA 4AT1B 4J9KA 1RWPB 1SJFA 4J9RA 1N48A 4QR0A 3NWGA 2XMKA 9ATCB 2E44A 3R9LA 4DCPB 4CP5A 4B3MJ 4M8LA 1S99A 4NZ0A 4PPZA 1OS5A 5IWAF 2WTFA 4A8OA 4F25A 5KFDA 1CC7A 1YIJS 2G0CA 2KHDA 2EK1A 3X1LB 3DRRA 2B9YA 4LF2A 5RUBA 1O6XA 2MKJA 3I56S 3T9ZA 2V2KA 5L1IA 2I5JB 1NCLA 1P27B 1J2VA 1URNA 1JX4A 2GHWA 2BJEA 3SYZA 2KXFA 1RT6A 2ZH5A 4B9TA 5E7OB 4C3LA 4M94A 1JLFB 2YNFA 4YR0A 2IVYA 2NXUA 4P6QA 1CSJA 4DPYA 4IRDA 4O3PA 4JV1A 2O5DA 1RAOA 3M2RA 4YFUA 1R8CA 2KB2A 4LMZA 3R5JB 4OHWA 2W2QP 1IQTA 3TR5A 4WTYA 3JYTB 1VLOA 4M5KA 3N0VA 4Q2MA 2QSWA 1FRKA 2Z58B 4I6WA 1S1XA 3OL6A 3EDQB 4OX6A 5B08A 3M2UB 4KO0B 1RWUA 1F9HA 4USUA 1IBMJ 1S7IA 3PW0A 4PWWA 3BYRA 2IM0A 5SZTA 2NSBA 4F8RA 4LFCF 3HHDA 5C25A 1LW2A 1WDTA 1NK5A 2E1CA 2U1AA 2ADBA 4NEZA 2NSCA 2CQ4A 4QW9A 4CLUA 1Q4RA 4RBTA 3H2UB 3S1TA 2V2QA 3CJ3A 2ZZTA 3IS9A 2FQQB 5E2QA 1HNWF 2HRTA 4OV6A 2Q79A 2RHSB 1KD1T 2J0SD 3NKYA 3M8YA 1XTZA 4U9RA 1SJRA 2MXYA 3M8SA 1ZAWA 5I42B 5AJ3F 1IKWA 2AYBA 5H1SV 1XNRJ 3VR1A 4F4ZA 1KOOA 2YWHA 3MM7B 5AE1A 3W5XA 5THWA 2VUGA 4AL5A 5DG8A 2XI2A 2CQPA 1TL5A 1ZTTA 4JI0J 1D9FA 3UD4P 3RBXA 1RTDA 2QA4G 4R0JA 1FRJA 4ES2A 4Y2MA 4DWIA 1YJ9S 5CAAA 5A76A 1ZM9A 1DAXA 3P96A 4RW9A 4AQYJ 2KYXA 4NXMF 4GVBA 4OYWA 3BH6B 3W2VA 4NCAA 2MSSA 3MMJA 3N4WA 2HHXA 3L9ZA 1RSCA 4FXVA 5HI7A 1VGYA 4L3KA 3RTVA 5HAOA 1VQ9S 2W2PP 1B0PA 3GZ7A 1U6BA 2W8LA 1C1CA 1LWEB 4YS2A 4ZPVR 1HBNB 2EBGA 5IQQA 1YTYA 2EC2A 2KKHA 1U1PA 4DV3J 4PQAA 3ZNJ1 1MG7A 3ZTOA 4DPTA 2ZOFA 2CUYA 2Z57B 3EMTA 2KJWA 2GVDB 4R5PB 2MGZB 2VQEJ 1Q86T 2MKSA 4OX7A 4ED5A 1S10A 1V3SA 2W9CA 2JH3A 1NK0A 4IG0B 3GU0A 5ITHA 5L1LA 3V4IB 3N6LA 4UOFA 3MR7A 2WVFA 4CYUB 4HKQA 5G0RB 1NU4A 3L4BC 2CG4A 4LF1A 4B3MF 1Q8LA 4G1IA 1TP7A 4J5OA 3SFUA 1U8SA 1OIAA 3M30B 4LIRA 3VQSA 2CQDA 4UTGA 1HHQA 2K3IA 4GKKJ 2ALYB 3F73A 3P6YC 3I32A 1NK6A 2QA1A 1NUEA 2EFGA 1JNRB 4YUDA 4OZ3A 1MROB 5KFAA 4ZMMA 4CLFA 1FKOB 1VIXA 3E01A 2XSJB 1G2EA 3NAHA 1QSSA 2CNLB 2RHQB 3DM2A 4LSLA 3CJKA 4QIVA 2ZFHA 5IS2A 4DL2A 2QG9B 5M2RA 3KFWX 1G6BA 1U2CA 4GRSA 4DL3A 2XMJA 4CZCA 2QA4S 3M8PB 3GYXB 5K8PA 4JV5J 2XMWA 1IVZA 2KHCA 3HJFA 4DV1J 4DSIA 2VFTA 1HNIB 3QGGA 5KFKA 4OYZA 1BQMA 1CJKA 3LWLA 4RW4A 2BW2A 2E7WA 2BQRA 2QX0A 2HHQA 2F4VJ 1MU2B 2B3TB 1UCNA 3HFKA 9RUBA 1IBMF 3K8VA 3D0GE 4KB7A 2ZHAA 3W5YA 1N5QA 3WDOA 1FWKA 2K1RA 2VFUA 2RNEA 4ZA1A 4LREA 1U48A 2R2RA 1TFWA 3MF5A 1A7GE 3QO9B 4N76A 4DLEA 4JI8J 1CS4B 3DOLB 3C2PA 5HJXA 1YBTA 3T1AA 1VBZA 4NX9A 3LWMA 1NHVA 4JI3J 5LJ3Y 3OTOJ 4PKDB 3H4DA 4HI1A 4DL5A 4LUBA 1R6VA 1L3TA 2WVCA 4F3OA 4YMEA 3VTIA 1N0UA 2R7VA 1S6PB 2OGUA 4NLVA 2KI2A 3DDKA 5T14A 5KFNA 1SL2A 3JTNA 3VZIA 1XNRF 4CLZA 4YB1P 4DG1A 4QOTA 2DVIA 3VAFA 2GIFA 5F8GA 3ZZOA 2HBYB 4JI0F 5LM7E 4DSFA 1NSPA 4QR1A 1VBKA 2KDOA 4NYOA 3IR7B 2F3JA 4OI4A 1ROFA 3KDOA 5HVHA 2CZVC 3UDVA 2DNRA 1WEYA 2MKCA 2FY1A 1U09A 1FK9A 4AQYF 2QYCA 3K59A 1J5OA 3QNWB 1RWWB 1X4GA 2C2DA 1BQXA 1N5TA 2AX1A 5HQLA 2NXNA 1VR6A 4WZMA 2BM1A 4D3HA 1PAUB 4LFAJ 2AJ4A 3NP5A 4QU7A 4GVLA 4NLRA 3NNAA 3VGVA 1JLAA 1GTHA 4N8OA 1IUJA 3JQKA 2JLFA 4CDIA 4DV3F 3MEGB 4BDPA 2QN6B 3MFIA 3SCIE 2AT1B 3W62A 4PQUA 2DR8A 5HMWA 5L38A 2P5VA 2VQEF 1KR4A 3HJVA 1AROP 4I0WA 4HDHA 2NCKL 3IWNC 2DRBA 4K4SA 3BO4A 2OH2A 3G71S 1J27A 2BDPA 2M2BA 2ZZMA 1TV6B 3TAMB 3FEXB 2BJ8A 2LYVA 1RADB 3MUMP 3CC7S 3W8PA 1MLAA 2XLIA 4X4OA 2E1MC 2MJNA 4NLGA 1FWPA 4F3QA 2D7SA 4DN9A 1W25A 4C8YA 1JIHA 2J9DA 3OR2A 3DU6A 3H8YA 3GSDA 3GILA 3W60A 1HWKA 5CCLA 1R43A 4YOEA 4IR9A 4P73A 3VF0B 4GKKF 3JSMA 1SJ3P 3AB4B 3QIDA 3SCKE 4M1KA 2FB0A 1C1BA 2KZZA 1D3WA 2ZUGA 2JFKA 3K89A 1PGZA 2XZDB 2MYFA 3I9V9 5A0YB 1TKZB 2OPPB 3SQGB 3R2DJ 2LKZA 3HVAA 4M5DA 2DNZA 4AE5A 1FO1A 2K3KA 2BJ3A 1HD1A 3TO8A 3IRXB 2UV8G 4IFYA 4Y2AA 4RJVA 3OFFA 2G2YA 4I6AA 2HQ3A 3K57A 2ZWPA 1LEOA 4JV5F 3A12A 4DV1F 2ILZA 4WFBQ 4CLKA 4DEZA 2HEKA 1LW0A 1WHXA 3PXGa 2IVMA 3CDBA 3IWXA 3U7JA 1WC6A 4K8RA 2F4VF 2QMUB 3RB0A 3CT9A 3H98A 1BMQB 5KG3A 2E1RA 4U7CA 2ASJA 3JQJA 1TMMA 2WK4A 2VBWA 2ZE2A 4Q2LA 5DETA 1IKYA 3Q8SB 1ELOA 3HF5A 4DI6A 3V81A 3OBIA 4U6PA 2GIQA 3AD7C 1UEVA 2ZH8A 2UP1A 3PX0A 2OAUA 2DR7A 4K50A 2DGTA 2JRSA 3OTDA 1GXTA 2AQ4A 4DU8A 4JI3F 1S49A 3BGFA 3OTOF 2XS7A 2YKMB 3J7A1 1PC4A 3M32B 2IM1A 4F67A 4KFBB 4WKRA 1CC8A 2IFXA 4OMFG 4FVMA 1AA1B 1BWEA 2KZMA 4JP8A 2A2CA 3R1LA 1NPKA 3HT0A 2NZ4A 1QSYA 3M6WA 4IG3A 2VL1A 1SPBP 4IO1A 2PI4A 4QIWD 2DTJA 1UEKA 3H4BA 2DK2A 1CJUA 1NJWA 4PWDA 4B3TJ 2IY5B 2DY1A 2B8PA 2MKKA 4OZLA 2AJFE 2DR5A 4BC7A 4DV7J 4A8SA 3TP2A 1X4AA 4O23A 4I7FB 1WKJA 4DX8H 4OYOA 3KLEA 2YX1A 2PN6A 5F8MA 4P72A 5F8IA 4IH6A 2M5YA 1HI8A 2VV5A 2QZ8A 2VC0A 2HK3A 4ZDNA 4C8NA 1RT2B 2OELA 3DNCA 1B0TA 3AOCA 3R3TA 1B70B 2CPJA 3NMRA 3M6XA 3EZUA 4PPDA 5ETKA 4OZ1A 3UCZP 4OFZA 5HP1A 1XEZA 1N52B 2AEJA 4XPEA 2CJ9A 2UXDJ 3NNHA 4O44B 2CQ2A 2PSZA 4WFAQ 2VH7A 3G8SA 2FDNA 4ED8A 3G6YA 4LR9A 1MWYA 3MTJA 3OXLA 4YY3J 1S9GA 4DLGA 3RYLA 2DYAA 5KFIA 4HHUA 1AT1B 4DFJA 2AZ3A 3RB3A 3RW7A 1X9MA 5KFOA 3PO4A 4I2PB 1UEUA 3RR7A 3CO9A 4NLSA 3TA0A 1ZH5A 2JEGA 1NSKL 1OMSA 5L9NA 3WQPA 4NWBA 4FDFA 1D8ZA 1REGX 1LV5A 3DLEB 2C42A 3DDIA 2YWFA 4ELUA 2R8JA 2BKOA 3EVOA 2G13A 2V63A 4B9MA 4A48A 5ETVA 2FC8A 2N4CA 4X4SA 3BBBA 5DDOC 2DHXA 2W4PA 1XBWA 1WELA 5A8WA 3TVKA 4OJHA 1HBMB 4FS2A 2W01A 4ATNA 4H4MB 3L7UA 3E2EA 1N8RT 3I5CA 3KHHA 1UP1A 2JFDA 1JLFA 5F8JA 2UXBJ 1EQ0A 4YR3A 4WYLA 5B0DA 4F4YA 4I64A 1T02A 3NRBA 1JQGA 5ETSA 3NY0A 2EFPA 1RUSA 3R5DA 5E3CA 3M1VB 2C3MA 2QGFB 1Q5YA 1F3VA 6AT1B 1EKSA 3JYTA 3TZWA 4PEOA 2XHWA 1PJ7A 3OVAA 4KIAA 4U8VA 1AB8A 1OPZA 2FHKA 1JJ2R 2MZSA 1LWXA 3MD3A 4KO0A 2DPJA 3KNAA 4Y2CA 3PHEA 4C9DA 1YZ7A 4C3MA 4ZP8A 4KC5A 4J9OA 1CJVB 3C6UB 1IBCB 4MK8A 5IZHA 1FX2A 1T0TV 2VJVA 2NR0A 3MPWA 4UUWA 3CCLS 1VQYA 3EM1A 3WX4A 5C2CA 5IC6B 1Q79A 4RNFA 1KFSA 1WWHA 2W25A 2Y8YA 1RWKB 4QCLA 1RT1B 3T5HA 3AJDA 3GYNA 1ULRA 3TUZC 3MXHP 1VQ4S 2R8GA 2R7SA 1QSLA 5L8RC 5CD4A 4RPFA 1RGVA 5I42A 3QAEA 3J81Y 3MM7A 1W2BR 2W4CA 4ZOSA 3GJQB 5HK4A 3LO3A 3O1LA 2M4MA 2Z2ZA 3P4UB 4DJBA 2HQFA 3KNGA 2ROGA 2YKPA 1R27B 3CJ2A 2WRMA 4BLGA 4B3TF 4USJC 1U24A 4X4PA 1VQOS 1VBXA 1RYSA 3C14B 4DV7F 1N36J 3VVUA 3UR3C 2RDIA 1YRUA 5KFGA 4J91A 5I3PA 3H25A 3UE2A 1UPPA 1NK4A 2MTLA 3Q2SC 5B0BA 5BJRA 2ZWOA 3NCRA 1VCTA 3LQVA 4K59A 2FJAB 2G0JA 1T05B 1YHQS 1D9AA 4P10A 2PD1A 5LL6d 1LWEA 1VQ8S 1HBNA 2VKRA 2A6OA 3RBZA 5KG6A 3UPFA 1S4EA 5K9FA 3RAQA 1TMJA 5E3AA 4ICLB 4JB8B 3CMQA 1U02A 5J2MB 2ZH4A 1U0SA 3OL8A 1F3FA 2Y0BB 5BR8J 3TQ1A 2CPDA 2GVDA 3IBWA 4NLPA 2UXDF 4R5PA 2MGZA 2FLNA 1F60B 4ECYA 1K0TA 1O0PA 3SZ2A 3LTOA 4IG0A 2EKYA 3GIJA 2YH0A 3V4IA 3K58A 4TLQA 3A8KA 2E29A 4CO0A 1PC5A 3FQLA 4CYUA 4YB6A 5G0RA 4ELTA 2HKEA 5C42B 3JS9A 1QM9A 4G3IA 1SH0A 2UXCJ 4NPOA 1MW7A 3M30A 4FF4A 1E6VB 2VQFJ 4Q8FA 3QGPA 3DU5A 2FHOB 3R5BA 3A8JA 4AXIA 1GAOA 2WAQD 3GJSB 3EZOA 2XNRA 1MROA 3NEKA 1FKOA 2XSJA 1WC0A 2H3EB 4KKOB 2DISA 1FD2A 2UXBF 1WG5A 2D9OA 3TWZA 3H2LA 2H48B 2MZ1A 7FDRA 3M8PA 1SC3B 3B78A 1J5EJ 4UOHA 2CDQA 4RW7B 3KHLA 5IM0B 2FD2A 2V50A 3PCOB 4DS4A 2LEPA 4NXNJ 2X7IA 1MN7A 2H65B 3BKUA 2XS2A 2L08A 3GR1A 4TYAA 1MU2A 3PNIA 1L3KA 1VC5A 5K8MA 3N6NA 4LRFA 1R8BA 3KXDA 2IM3A 2VASA 3LPYA 2YPZA 5KT4A 1H2UX 1H38A 1WOPA 3T19A 3QO9A 1CS4A 2HFUA 1YKWA 4N47A 4BWMA 1MSWD 1FX4A 3DOLA 2BE7D 3MEDB 1IJEB 4C8OA 1RKIA 4LVOP 1X5PA 5GADU 3QLHB 1TZ0A 1N34J 1VS3A 4DQIA 2CWKA 1UFWA 1S6PA 2MMYA 3CEDA 2RSQA 1WOSA 4ZCMA 3MUVP 2B5JB 2M8HA 5KFVA 2CJKA 3HMJG 3FK4A 3PW7A 3U1LA 2LVWA 1VK8A 1B64A 4ED1A 1FNMA 2A0FB 5IT0A 2RS8A 3W5ZA 1H2TZ 5KFCA 4DR4J 4ZCKA 3US5A 4FYWB 1NBEB 1YRXA 1UJ5A 1UJ4A 3IAS9 1R0AB 2QLWA 2CYYA 2UVRA 2G9OA 3AFGA 2D69A 3UN2A 4RUCA 4PRFA 1SKUB 4L6V3 4YB7A 2ZH1A 1N36F 2V8VA 4MIBA 3HX9A 2D3UA 2ASLA 4DXLA 2ZBRA 3VWSA 2R2UA 1UVNA 5GADI 3IG1B 4RNHA 3V6DB 5KFMA 3BGOP 1S0NA 4QW8A 4DSEA 4KHMA 2ZBQA 1SH3A 1S6UA 3FBBA 1WEZA 3A8IA 4ZPAA 3CXCR 3DRSB 2P8IA 1HD0A 3QAUA 2FZCB 3L95X 1HNZJ 2ZC4A 3MEGA 1LK5A 2A10A 5E3PA 2Q6BA 3UD3P 3HSGA 4NZ6A 4F4KA 5B7WA 4I68A 2A18A 1LOUA 3C16B 4ZVSB 1NM2A 3NCPA 4USWA 3CUNA 2LQBA 4QIFA 3K5MA 1UZHA 4C8LA 1HFEL 2IMOA 5D78A 1FEHA 3CJ5A 1TV6A 3TAMA 2JEIA 4DHVA 2AMCB 2HFZA 1RK8A 4UW2A 1ZM3A 3R27A 1NKCA 3QGIA 3O8WA 3HSZA 2E7XA 1NEEA 4ANCA 1T7PA 2KVIA 2HNDB 2UXCF 1KLMA 4MKVA 3BGLA 2VDHA 4DF4A 2HQIA 1WHWA 4WU3A 2VQFF 2PMHA 3UFCX 3KLGB 5GMEA 2MKIA 4CLLA 2VICA 3VVTA 1Q0NA 4P7VA 4F36A 3EGVA 2ZNZA 4NCGB 2L9WA 4IH7A 1JJ4A 5A0YA 3CJSA 4DDFA 3IN5A 1TKZA 3M4XA 2OPPA 3SQGA 2JOQA 1OO0B 1FKPB 1WSVA 3K17A 4IOBA 4K5RA 5LJ5Y 4J9QA 3IRXA 3GIMA 3D4JA 1F1BB 4H54A 4PXBA 1KDNA 4Y34A 2E5IA 1J5EF 2VFSA 4F50A 4HTIA 3D67A 1FTRA 1Q8KA 2J5AA 2PGCA 4MJKA 3QRQA 2I9SA 3VALA 4CNZA 1RAEB 4NXNF 3D6FB 4EO8A 3MOJB 3ZZPA 4DR7J 1ZZNA 1HW9A 2GAGC 2LMIA 5HMXA 3RR8A 2PI5A 4CH0S 2IDLA 5EGYA 3PRDA 4AUKA 5HSPA 4O3NA 1JJCB 2WW4A 2VA2A 2Y3YA 1F5BA 4Q43A 1S0OA 2J0QD 1YJNS 3CCES 2CDRB 4GO5X 2X51A 1N88A 3WC2A 4LRCA 3M6UA 4F4AA 3MR3A 1BHNA 1K9MT 2CIMA 5FLXU 1U1OA 3KJVB 1YJTA 3KLHB 3GFXA 2YKMA 2O1PA 3M32A 3UO0A 1WACA 1S1WB 1N34F 1KQKA 4KFBA 4K2XA 5ETQA 1SXLA 2OPRA 2R7RA 5KFLA 2AD9A 1RBLA 4HACA 2D3ZA 2WW8A 3KWMA 2CQ1A 2EKNA 2RRBA 4C4WA 4OYAA 1RE1B 5CYMB 3EGWB 2IBKA 5H9EK 5HMYA 2MQOA 2J0WA 3ZZ0A 4QZVB 3AD8C 1B7FA 2B7CB 4DR4F 3TANA 1IM6A 3D1QA 4WXWA 2IJRA 3NGSA 3FSIA 1SKWA 3NL0A 4I7FA 1EJ7L 2UVVA 4P52A 3DRPB 2JDJA 5B0EA 3ZTSA 5JVGQ 1IXKA 4O4GB 1RWMB 2XMVA 2Y9HA 2AZ1A 4S0MA 1ZYQA 4YEAA 3CJ0A 2V5HG 2C2MB 3CCRS 1RT2A 2I1RA 4IUFA 2J6SA 2MSTA 1S7HA 1XWLA 1TL1B 1U6FA 2RRNA 3R6GB 1T9VA 1YJVA 3PFOA 2HQCA 1AXQA 4B9VA 1M5KC 1KHVA 2WBRA 4R8UB 2YKQA 1HNZF 4DV4J 3OFEA 4O44A 2XQCA 4X65J 1S76D 2A6MA 2MQQA 2DNLA 2RH3A 3ZZRA 1X7VA 1FRIA 3AAWB 3UVJB 4DV0J 1LK7A 1RWVB 4OI0A 3ENWA 5H9EJ 1YDLA 5KT6A 4I2PA 2C2OB 4TLRA 3PIPQ 3QGHA 4KR0B 3T5KA 4JOUA 4QQBA 2HLUA 3AODA 4N7TA 2E1PA 2KFNA 3DLEA 2GGPB 2V9KA 4GKJJ 2V68A 2EBEA 4NLUA 2P9GA 2XCPA 2RU9A 1M5SA 3M9NB 2KO1A 1PJ6A 3KHRA 4USMA 1D09B 1WJ9A 1QDUB 1RAIB 2BKPA 4ZP7A 2XLKA 2CPHA 1X5SA 5E33A 4H4MA 4ECRA 4WTOB 1S6OA 3EE3A 3LANA 1XQIA 2B9WA 4QBUA 3MCOA 2MZRA 3RG6A 4CLYA 4X84A 4K4WA 2UUCJ 1L3VA 4C0HA 4M5MA 2X1BA 3A3NB 5BYRA 3NG8A 4EU0A 2CQCA 2VG5B 3MAAB 3M1VA 5KFEA 3THTA 2YKNB 1U26A 2HURA 3CC4S 3P45B 4DN0A 5L1KA 2LQ9A 1YLXA 2A1BA 2ZOMA 3VAJA 1JWWA 3O2IA 3J7Z5 2ZHOA 2I38A 3MMBB 2NXJA 2D9PA 3P49B 2OTLS 4Q7AA 5ETRA 1SJQA 4DV6J 4N56A 4DR7F 1SQGA 4AXJA 1KFDA 2OPQB 2OKQA 1OJ4A 2O01C 4ANEA 5EWEA 1CJVA 3B8HA 3C6UA 2J7KA 2WB4A 1R89A 3BN4A 3D2WA 4FYXB 2R8HA 3QRPA 1XN9A 2PT0A 2DY9A 2MLZA 3DOKA 3MOZA 2RQMA 2BVZA 3LGNA 2JLEA 1KTQA 2RDJA 1RT1A 4CO2A 1M5OC 1PBAA 1LWCB 3NWRA 4QWEA 4ZCLA 3D3BJ 4PG4A 3PIOQ 3FVYA 1SB6A 2FGCA 3OW2R 3GYGA 2FC9A 4IDKB 3NGDA 1AUSL 1KP6A 4HLBA 1DLOB 3GCXP 4B9SA 4GC6A 3VAKA 4CQ1A 5F9NA 4IO9Q 2BXJA 4FP9A 2ZJRQ 3D5MA 2BMBA 4X62J 1EETB 3CULA 5I3QA 3OHBA 3C14A 5HQMA 1WG4A 2CFXA 4QYRA 2XS5A 3GJTB 3I55S 4C11B 1BQMB 1V5VA 4B9NA 2V9WA 3GIKA 3KJQB 4FNHA 3T5JA 1S59A 3IBFB 3HXMA 1Q53A 1T05A 2VOPA 2GNKA 2HFVA 4OX9J 2AJ2A 3CCSS 4PCQA 3QWPA 2KN4A 3QJPA 4DUTA 4OZ5A 1HYSB 4DUZF 4JYAJ 1U2RA 4ED7A 3O6QA 4ICLA 2FPHX 4UQGA 5J2MA 3OQ2A 1OY8A 5KG0A 1RHMB 4ITSA 4DV4F 4YR2A 2Z8QA 2QE5A 2KFZA 2GX8A 5DZ6A 2C22A 5M2PA 3FCWA 4X65F 4EMDA 2KFYA 4CLTA 2VIHA 3PFEA 2AGPA 4DQSA 1NXIA 3V5RA 2KG1A 1RABB 1X60A 4WP9A 2HVEA 1PILA 4P2SA 5C42A 3I0RB 3IC1A 4EK2A 4A8YA 3HVRA 2ZJQQ 1TR0A 4GKJF 3AA9A 3MWBA 2VKZG 2DPIA 1NKEA 2KU7A 1KQGB 3SCLE 1KEKA 3MR5A 3BR9A 4B9UA 1SUQB 3FCVA 1N33J 4G1PA 3IGVA 2OFGX 4EI2A 1OY9A 3T6BA 1S1TB 4I2QB 2VB6A 3JSRA 5ETOA 2AJ0A 4KKOA 3TJ8A 3G82B 5D0RA 2W2MP 2CXEA 3G6XA 2IBOA 1YI2S 3HKZD 4J9MA 2UUCF 3MD1A 3BBFA 2OPSB 5DGAA 4D3GA 2R4FA 3QSIA 1YZ6A 1TELA 3F41A 2HHUA 5D4OA 2ZC3A 3C46A 5GVQA 4RW7A 1FDNA 4LRDA 5IM0A 1NJZA 1C0TB 2BYCA 3G9CA 1DURA 4F02A 1F6TA 2FVSA 3I6PA 2LDIA 4H4OB 1P9QC 5C24B 2N7YA 5CYQA 2W2OP 4U8YA 4CTAB 1M1HA 1RU1A 4KGKA 1U1MA 4DV6F 4CIOA 4LF9F 3FEYB 4HYKA 1OYEA 3WIUA 3H5YA 1Z4UA 5KG7A 4M95A 2BE9B 2PA3A 2DO0A 4ID5B 4LRBA 2FIUA 3LGHA 4QPXA 3TW0A 4Z2XA 3MCNA 2CAJA 3C6TB 3ZTQA 1PKUA 4PZVA 2DNNA 1WKLA 5IWAJ 5DO2A 3MEDA 4F4XA 3PACA 3SXLA 4NCBA 4U7UK 1FRLA 3L7PA 3W9JA 2FY8A 3QLHA 1BQNB 2DXDA 1ZAVA 1VDHA 1FDDA 3WC0A 2IIHA 1K47A 3CMAS 1C0UB 3QZ8A 5AXNA 2HSEB 4DX6A 1VQKS 3NCQA 5D4PA 1VQ7S 2B5JA 5E0OA 2MEWA 2V6AA 1FNOA 1S97A 3J80Y 1WDDA 3MEEB 3WBZA 4HHHA 4P74A 1IN0A 4GO7X 2J76E 3BQ0A 3GV8B 2E9RX 3M2VA 2LFVA 1R0AA 3HP6A 3ITHB 2MKYA 1PYTA 3HHEA 4X62F 3AOAA 1VQ6S 5DM6Q 4DV2J 2JC0A 1H3DA 4WE1B 3H20A 2QSFA 4ZN3A 5DG7A 2W2NP 1HR0J 4WU2A 2M0GB 4ZP6A 2G0IA 3CCVS 2B43A 1HNXJ 3IG1A 3H0PA 3RW6A 4LFCJ 4O0NA 4Q44A 3I87A 4KGMA 5ETTA 3V6DA 3I0SA 4WZQA 4LRAA 4OX9F 4WWSA 1HQEB 1IQZA 4NLWA 4ZIWA 5HQ8A 3FCHA 3DRSA 1U1NA 1TKXB 5C7PA 1JLGB 3I82A 2VPWB 1Q16B 3BZQA 3Q0AA 4JYAF 1QY7A 2LLZA 2ALZA 4USVA 3D3CJ 3CVKA 3CJQA 4CO3A 1HHSA 4ES1A 4CM0A 3PRBA 1RISA 3BN7A 3C16A 5CA5A 4K2JA 2U2FA 3LAMA 2P2CB 3DOMB 3MZIA 2ZD1B 2V4RA 5FDLB 3IP0A 3ENAA 2RRAA 3VGSA 2J6TA 3VV2B 3NLCA 4FYVB 2OEKA 3BPDA 3S7RA 2C2EA 3W66A 2W9BB 2CWXA 3UN3A 3IXQA 1TK8A 3J7AN 1FJ7A 2HNDA 2M88A 2EFOA 2BANB 4OZNA 3BGUA 1HWIA 4CWBA 4DFPA 3KLGA 2C3YA 4DQQA 4CT9A 1XNQJ 1WI6A 3ILJA 1HW8A 1N33F 4NCGA 3HDSA 3CCUS 3BSNA 1QD1A 1QVGR 3QQCD 1FKPA 1G1XA 3EPIA 1ZM2A 2J9EA 2KT5A 2HGLA 5CH7B 4B3RJ 1H7WA 4UZCA 3N6MA 4OHYA 4NE9C 2JX2A 2HS4A 4RBUA 1GEHA 2MZTA 2LDYA 1NJIT 2DT9A 2VG7B 1JNZB 2HGMA 4CNYA 4ENOA 3AQOA 2R7UA 1T3OA 3BJYA 1DHMA 1HI0P 2BM0A 3MPUB 5FIIA 2AF6A 2Q6CA 3HSJA 3D6MB 1UZDA 4IKAA 5D4LA 1Z2LA 3NS5A 2BUNA 4L75A 2HS0A 4EBDA 3CMES 3J7YI 1CBKA 2POKA 1O8BA 3A13A 2Y1IA 4CO4A 1P1LA 2FVCA 2LA4A 3NBPB 3EVMA 2HZVA 1FWLA 3TOQA 3KJVA 1H6KX 3F0NA 3KLHA 4KV8B 2I6WA 2XMAA 4G6VB 3DLKB 3KK2B 1S1WA 2KRBA 2HVDA 1R8AA 5A8WB 5KT5A 5E41A 4UY85 2DRDA 2EG1A 2Z0GA 2KVQE 2ZBIA 4ECWA 5CYMA 4C3KA 1YQHA 3M6VA 2WONB 4FVCA 4KJIA 4LVNP 2CADA 1MN9A 1SQEA 4EBCA 3GIRA 1H74A 2F8EX 1LKZA 2ZJPQ 3DHWC 4LF6J 3H90A 4JV2A 5L9XA 2CG8A 1N4LA 4NI2B 1DFDA 8RUCA 4WJBA 3DRPA 1SH2A 2Q43A 1UL3A 2F40A 2GMLA 4P2FA 4O4GA 2ACMA 2E5LF 1W2IA 4DV2F 4YDXA 3CNQP 1HR0F 1KHWA 4JV0A 3TAPA 3QT5A 3GV5B 3V6JA 1HNXF 1TL1A 2WVBA 2C28A 2E9TA 4OHZA 5M2UA 2W1BA 3K5LA 4PG8A 5KFFA 4R8UA 2XYGB 3Q8PB 1Q7LB 3ZC4A 5B0CA 4EYHB 4LF8F 3Q23A 2C2RA 3I9ZA 3BO2A 4EBEA 1HNVB 3NS6A 2XEXA 3MAHA 2W9AA 3PHTA 3FNNA 3CCZA 4G1QB 4EFAC 3UVJA 3GQCA 3VCDA 1K8AT 1VQLS 3RAXA 3MHYA 3OTEA 3C15B 3TX8A 4Y0FA 4ZVEA 4TN2A 2Y0SD 3P3DA 2IC3B 4QPTA 3UN5A 4OJ3A 1RTHA 1XERA 3ILLA 2MLXA 3D0IE 3DHXA 1K44A 2IJNA 2GGPA 3UDEA 1KC8T 1FCAA 3M8QB 1H2VZ 3TUIC 1TL3B 3MECB 1AFIA 1SVDA 1VQNS 2NS1B 4OI3A 4HVZA 1Y7PA 5F0UA 4B3OB 1U0HB 2H54B 1FHTA 3QWUA 2ZEJA 2RMLA 2XGPA 4PG5A 4O0IA 4EGLA 1XNQF 2W7AA 1KRPA 3U1MA 2PMWA 2LEBA 4WK1A 4FN5A 3F56A 1X4EA 3BDPA 2HBRB 2NUUG 2ZDPA 2B4VA 3AJ2A 2EK6A 3PJWA 4J9VA 5LOQA 1KSPA 3DRXA 2FLPA 2BBEA 2VG5A 3MAAA 2V8GA 3OLBA 2QL9B 2YKNA 2WVDA 5HJYA 2CQGA 4PXEA 1T94A 4B3RF 1LXJA 4FBUA 3F44A 4RNNA 3MMBA 4DR5J 4A8QA 4OYPA 2GW8A 1BC6A 3D66A 4B9LA 5D6GA 5D15A 1TQLA 1RBAA 3TVZA 1AYEA 1CVJA 4A8WA 4Q0BA 4Y3CA 3HVWA 4EO6A 3K5NA 2OO4A 2OPQA 1CLFA 3W61A 2QTWA 3FBCA 2A3JA 2HZAA 3HVTB 1HWLA 3MCMA 3PW2A 2VPXB 1VC0A 3PDNA 3BYPA 4NLOA 7FD1A 1VI7A 2AHOB 1LWCA 2P9EA 2DGXA 3OSNA 4IR1A 2RF2B 1VQ5S 4RUAA 2BJ7A 4IDKA 3BEGB 3LA0A 3DLGB 2QYGA 4IQMA 2FHJA 1QAXA 2CVIA 4HT7A 1DLOA 4X4QA 5KFYA 4FKYA 2GS8A 3R6LB 2V34A 1RAHB 4RW8B 3BGRB 1REVB 2DJWA 3A3PB 3JAMY 1EETA 1V9OA 3CDAA 2FGOA 1JLEB 1NPPA 2D41A 2QJ3A 5CCMA 3TQEA 2YKOA 1RBOB 4X66J 5A8KB 4LF6F 1CQMA 2N3OA 2D3O1 4LJMA 1KS2A 4C11A 2ZH7A 1WI8A 4NLDA 3E3XA 1Q8IA 2CZ9A 2HHHJ 4RUHA 4EWTA 3AD9C 2R7OA 3I4PA 1CG2A 3WX8A 4CT8A 5IV4A 2AU0A 4DR2J 3CDEA 5HATA 5LXRA 3OTBA 1NKBA 1HYSA 3V2UC 1R0CB 3Q8UA 3I96A 3OPKA 1HA1A 3R5AA 4OX8A 2RIJA 1WC3A 3MDFA 1NNDA 4P75A 1RHKB 1TAQA 2HHWA 3ADAC 3PEJA 1BE4A 2LECA 3TAQA 2HHPA 2EVZA 2EFVA 2ZKTA 2HWTA 1KTVA 5G4DA 5AE2A 4MKYA 1NDPA 2B7BB 1QVFR 2Z4PA 2AGQA 2OIHA 2HG4A 2Q66A 3DLBA 4PAAA 3OVBA 5KT3A 4HTJA 3DCAA 4MYTA 5T7LB 4ETXA 3I0RA 2DHHA 1JXLA 1YSJA 5FD1A 1KQFB 3PM9A 4CH1A 1P1TA 3D54A 4KRWA 2HBQB 2DNQA 2DNHA 2VZ9A 3ZZTA 1F9EB 4HR2A 1WC4A 3OV7A 4N41A 1I6JA 4ZP9A 4P2XA 4AFFA 4V19X 1SUQA 1M5HA 4OI1A 3QSYB 1SCJB 1S1TA 3MFHA 4I2QA 5D77A 4Q45A 1E6YB 1X5OA 3G82A 2OTJS 3FFIB 1FESA 2B6AB 2EFNA 4PWUA 2GO8A 1A0OB 2X1GA 1XMBA 1ZAXA 3HM9A 2YQ3A 2YTCA 5F41A 3OUYB 1GH8A 2OPSA 4DF8A 4ER8A 2ZH6A 1SIZA 1F2GA 4TU8A 1GX6A 4NL5A 4RZRA 1C0TA 4TY8B 2CPXA 2WZ1A 2AP6A 3VGTA 4A47A 2RB7A 3RUBL 4H4OA 5C24A 5KFPA 4Y00A 2KT2A 4DR5F 4CTAA 4C48A 4OYIA 3TA1A 3D1HA 5DLFA 1RTIB 3PYGA 4W4MA 5KT2A 3SSRA 2DD8S 3PV8A 1U25A 2G2OA 2HGNA 1MWZA 4ID5A 1NMEB 3KLIA 3MM9B 3C6TA 3KTQA 1S1VB 3HHKA 3D9BA 4KT0C 4EYIB 3KG1A 3DLJA 1BY9A 5ADZA 3B4MA 3MMAB 4DFMA 4PYAA 4ZJLA 1TAUA 1BQNA 2ZOGA 1KLMB 1YVFA 3SDEA 1C0UA 2HW3A 2UVUA 3CWJA 1NRKA 3JSYA 1LWFB 2B0GA 2DGOA 3OSPA 4J9NA 1H7XA 3W9HA 3I5AA 1UKUA 2EI5A 5HMZA 1N6QB 2BX6A 3MEEA 4OZ0A 2QL5B 2XWYA 1KWMA 4L73A 1OWXA 2XO6A 4ZLNA 2ZH9A 4ZPDA 4FF3A 3ITHA 1N5VA 3SV3A 3H5XA 2MQNA 1DQAA 1IM4A 3HKWA 4X66F 4IFVB 2KTQA 2CJBA 4WE1A 3M05A 1U49A 5HBMB 4F0MA 3FRYA 2ZKUA 1RYRA 4RNOA 2PEBA 2XY7A 4UF4A 3QMQA 1U45A 1KQSR 1I94J 1NH8A 2HHHF 2XNQA 4LFBJ 3CCMS 3OJSA 2M8DB 3T41A 1H73A 3J81j 4C8ZA 4YDDB 1DJ0A 1IJFB 1HQEA 2K8GA 4DR2F 4UQTA 5KG1A 1TKXA 1KVJA 3QT6A 1JLGA 2AYEA 2XTJP 1KLNA 2BOAA 5L39A 4CI0B 4XDCA 3GB0A 2V4JB 4JI7J 1T9XA 3IR5B 5J1NA 1RT7B 3P8BB 1YRTA 4OQJA 2FJDB 3RRKA 3W9IA 1KVKA 3GP9A 3JSBA 1U47A 3DOMA 4F04B 4MT1A 2ZD1A 2XY5A 1TUWA 5FDLA 1G7CB 1JK9B 1KVIA 3MAQA 2F4FA 1SBRA 1KBRA 2ADCA 4U67Q 2OPRB 3P5TL 2OJ3A 1FJGJ 2W9BA 1A6LA 4HACB 2RAQA 2COLA 1XMOJ 4V19J 5D0EA 2JVRA 2EWHA 1OY6A 3C66A 2YY3A 1H98A 6FDRA 2BANA 2HRUA 5KTQA 1HQ2A 3SQOP 3TZYA 1T03B 2Y1RI 2MHNA 2QEXS 1IKVB 4PXDA 2HMIB 5GMDA 3VAIA 4A8KA 3NGRA 2M70A 4IOCQ 4L74A 2MQ8A 1Y0HA 1LFWA 2HAFA 8ATCB 1P9YA 3GLJA 2CZ4A 5KAKA 3GE9A 1S0VA 4OJGA 2I8EA 3W64A 5K5MA 2VA3A 3U1NA 1HBUB 4IOAQ 3PVXA 1K1QA 3Q24A 4A46A 2X1FA 3S8SA 1VRTB 2VPZB 2W7OA 5KFTA 2HNYB 2XZWA 1Q7YT 4QIEA 2W7PA 2VG7A 2DGWA 4RLEA 1UVMA 1GXUA 3RBDA 4DQRA 1R6YA 2DHAA 2QLXA 4ZVGA 3ENVA 3SBMA 2AWZA 3IR6B 2OFHX 1PIEA 4RBVA 1UW4A 4OJ1A 3ZFVA 2ZITA 1NSAA 2YWKA 4ECTA 4OYBA 1JLBB 5AE3A 3QT7A 3Q2TC 2HPUA 4BWJA 5IT9Y 2RILA 4CLWA 3UD5A 3J81U 2DGSA 3ZZUA 3NBPA 3U27A 2DRAA 4TQRA 4ZJOA 4OV1A 1SJ4P 1TKTB 4KV8A 3K2YA 4X4RA 3W7BA 1R3NA 2O66A 2MZQA 1CJTB 3V6HA 3CSKA 3DLKA 3KK2A 4QYZK 5C5JA 3EYZA 4I4BA 1S12A 1WEXA 3W8GA 3MPDA 5KFRA 2HVHA 3GJRB 1RT4B 2GQQA 4CM2A 4MTPA 1FVQA 1ZM4A 2KJVA 4C8KA 2KH9A 1Q78A 1VRQC 3K5OA 1FJCA 3T9NA 1ITPA 1D9DA 2WONA 1RTJB 3PW5A 1Q1KA 4QWAA 5A2QY 2R2SA 1JLQB 4NI2A 3THPA 2OMOA 3PJXA 3QPIA 2B9XA 4WP8A 1VFJA 1I94F 4LF7J 2R8IA 1RCXB 4LFBF 2GMJA 2DNPA 2WOMB 1F9FA 4URSA 1FFGB 5I4MA 2E5HA 5LT5A 3HZEA 2ATLA 4ECUA 4ZLJA 1T9WA 2MB0B 4JI7F 4QYZJ 1GT8A 3RBEA 1HNVA 2DH7A 3DOKB 4ZPCA 4G1QA 5CABA 1Z2ZA 5D3GB 2HNZB 4O3QA 3DYAB 1HBOB 1S9EB 4DSLA 3C15A 3N9UC 1RT5B 2NXCA 4Y28C 1AFJA 4MKBA 2FJWA 1N5YA 2IC3A 5HVFA 3ULHA 1SI9A 3Q89A 3BS9A 3NAIA 1FJGF 2ZHBA 1FDAA 3M8QA 5D0GA 1XMOF 1TL3A 2PFDA 3MECA 1ZZFA 2O3DA 4Q8EA 4ZHRB 4IRCA 4L76A 2IAJB 4B3OA 1QUPA 1U0HA 3FRZA 4Q5VA 3EVWA 3TJ9A 1PYOB 2CQ3A 2MQLA 3KJNB 4WKYA 3HO1A 4KSEB 1V3RA 2KXHA 1P6TA 2PC6A 4C98A 2HRYA 1YGYA 4KGXB 2EPIA 2ZVIA 3CDWA 2HLTA 2GQCA 1RDRA 1XJWB 2F8MA 1RTZA 4RWXA 3Q8QB 1KN6A 2AW0A 2XMTA 3W2WB 3H59A 1TTHB 4P7TA 3PR4A 4NYPA 2FYXA 3DXSX 4R25A 1WC1A 4WFNQ 3SCJE 3EXCX 3SSSA 4U96A 1ZTWA 5JVHQ 2QT7A 4HHJA 3R5GA 2BKNA 3W65A 4B3SJ 1NK9A 2IHR1 3A3OB 3LOUA 5DRKA 1U1QA 2VDIA 2F1FA 4JI2J 1NAQA 2OUGA 1X31C 2XYHB 3RAMA 3HPOA 3Q22A 3HVTA 3TARA 1PBUA 1V6HA 1NDKA 2YQ1A 5LSRA 1F5AA 1SQFA 3Q8RB 3GPAA 3IM8A 5KOWA 3E51A 5U47A 3HLUA 2K7KA 1RWNB 5LSLA 4M5GA 4A4JA 4ZIVA 4FF2A 2NQPA 1ZOTA 3TRGA 4QU6A 3PKMA 1FT8A 4L72B 5A8RB 2FLOA 2RF2A 3W3SA 3I31A 1Y11A 1XMQJ 3DLGA 1I51B 3OLAA 4PG7A 4C7QA 3R8YA 1DQ9A 2VJUA 4P71A 5BYSA 4RW8A 4ANDA 3BGRA 1REVA 2ZH3A 2FZGB 3W63A 2E9ZA 5EN1A 1JLEA 2MQPA 1HIYA 2V8PA 3M7VA 2RQ4A 5A8KA 1RHUB 2DR6A 2AJ1A 1RAFB 3D68A 2HQDA 3OJUA 1NHUA 2RE1A 3MI7X 5J2PB 2JVOA 2APOA 1RACB 2C3OA 2VG6B 1S72S 3RZAA 1BLUA 1WF1A 1WC5A 2ACYA 1N5SA 2OSQA 5CYQB 2OD6A 2QV6A 3FEZA 1Q81T 2DHGA 6FD1A 3T1HJ 3KHGA 2K2PA 2YNHB 2ROEA 3H2VE 3HFVA 2DIVA 1KOHA 4FS1A 3BREA 3AA8A 4LF7F 3KDNA 4ED2A 1VISA 2QLFB 3MTKA 1QAIA 4ZK7M 2WSEC 1U1LA 2C2ZB 1RU2A 4TNOA 2YNGB 1MNEA 2D74B 4QWDA 3AH6A 3L09A 4O3SA 2B4UA 5HANA 2YH1A 2EFQA 1GFWB 4MFBB 4J9UE 2P9CA 2NZCA 3TI0A 3SEOA 1UFKA 3WHIA 5L1JA 4N5SA 2EW9A 3BSOA 4OHXA 5E3RA 2ZDOA 4ECQA 2KT3A 3ZZYA 5T7LA 2XBPA 1TVRB 2AYGA 4F7VA 3T5LA 1U7LA 4IRKA 3TEHB 1TUVA 2DNKA 3QFHA 2CJYB 3SIPB 4TXSA 4C0BA 4YHHJ 4ECVA 2IYGA 3DFEA 2LU1A 2HYIB 3AB2B 4EZ9A 1A9NB 2VBXA 3M2VB 2VODA 5LMNJ 3QFWA 3T6JA 2FHJD 3JTPA 3HCXA 4HI2A 3QJJA 4E0DA 3H5SA 2YNIB 3JXOA 1E6YA 2CA9A 1JXEA 4NRTA 3FFIA 4J9LA 2B6AA 3N5FA 3MM6B 1VJQA 2J8AA 1DRZA 1TKDA 3OUYA 4ED3A 4DPUA 5LMUJ 3R7SB 3TJAA 1QAYA 3HHLB 5HVGA 4TU7A 1SKRA 1UVJA 3R7NB 3I0SB 4LBHA 2N3LA 5AT1B 4TY8A 3PYDA 3CTRA 4DL4A 2FJEB 5BYQA 4MH8A 4HL9A 4X4UA 5GMKa 4URQU 4Z7CA 1BGXT 4X2BA 1RTIA 3D6HB 1Y5LB 4ZLLA 1T9YA 4PABA 4DR3J 1FF2A 4ID8A 1S9FA 5IXUA 1HHTP 4WP3A 1FRHA 1WTFA 4B3SF 2VBYA 1DTQB 1YJUA 3EJMA 3KK3B 1NK8A 2QC3A 4NA3A 1B4SA 4DZ6A 4RNMA 3MM9A 1RZMA 4JI2F 3KUHA 4Y2IA 1S1VA 1ZA2B 4MIWA 4AL6A 1VMBA 1N0VC 1TK0A 4JI6J 2E1AA 1IBKJ 4K5SA 3J7ZT 2RUSA 4ECZA 1V5IB 3MMAA 4RL1A 1FKAF 5CZXA 2GJFA 2FJBB 2JC1A 1Z1ZA 2BJ9A 3MMCA 2Q1LA 3QZ7A 1URRA 4Y6IA 4LR7A 1LWFA 1SV5B 5MAOA 5IV3A 3OR1B 4NMXA 3K8WA 4ZLPA 1Y4ZB 2FUG9 1IR1A 3PTWA 1R31A 5IFMA 1N6QA 1XMQF 2CPEA 1H0HB 5DQIA 4FF1A 1WNEA 5HLFB 1RP5A 3FQKA 1NZ8A 3UCGA 3VAMA 1WF0A 3NMAA 2V8DA 3KG0A 2GHPA 4FNIA 2HIYA 2R7WA 3MURP 3G6ES 3BKFA 3GR0A 5DLGA 2PEHA 4F0KA 2RUGA 4IFVA 5HBMA 1WORA 5I3UB 3FBEA 2HHSA 4M5IA 5A6PA 2DCLA 4B08A 4PUOB 4B02A 3BQ1A 4LR8A 5AXLA 2QLBB 3W1YC 3X3UA 4F4WA 1U1RA 3PO5A 1DQ8A 1CQNA 1W26A 4MMOA 3T1HF 3CIMA 3PYEA 1VRUB 4NYZA 2JHEA 1Y3KA 1UPMB 3DMJB 3K7RA 4DPOA 2C3PA 3GV7B 2MDAA 2KM8B 2V4JA 3G96A 1FXRA 3RJMB 1NJXA 5B09A 1VHIA 3PY8A 1R8HA 3A4TA 1TL4A 2VFRA 1RT7A 1DZ5A 2OMLA 1SKSA 4O4RA 4USTA 1UMJA 2IRYA 3CCWA 1EKRA 2ZZNA 4W90B 4B17A 2R9LA 3O3LA 4MIAA 2N82B 3FUYA 4USIA 2XMUA 5DDQC 2VPYB 3GG0A 2VONA 2F7VA 3CPWR 4CO1A 5IC4B 2VD3A 3MEKA 1T9UA 1SC4B 3WIVA 4ZPBA 2F9JA 1T03A 4X4TA 4YHHF 2GZOA 1IKVA 2HZCA 2HMIA 3HULA 5DG9A 5GAGU 5LMNF 4YP3A 1GMUA 2XY6A 4X4VA 2CKWA 2OLWA 2GJIA 3OL9A 2IRXA 3R1HA 3ISZA 2NLWA 3BSAA 3I5BA 2BQUA 3CD6S 4JI8F 4DV5J 2PMZD 5IT4A 4XAKA 5LMUF 2HWIA 2NYHA 1HBUA 2FZKB 5ETLA 2WB1D 4DUZJ 3M8ZA 1X9SA 4NLXA 3M8RA 4LQ3A 1VRTA 2C2KB 2HNYA 3H40A 1B0VA 2LXFA 1R8PA 1VJWA 2GC8A 2RKIB 1HMVB 1AUDA 2AKWB 1EARA 3JQMA 4ZVOB 3QATA 1HWUA 4LF4J 1UJ6A 4DR3F 2JL9A 2B9EA 5HROB 1QTNB 4BBYA 4ZPTR 1LQ9A 3HK2A 2AX0A 5KFJA 1HARA 5GAGI 3LP0B 3TA2A 1JLBA 3ILIA 1RAGB 1X0FA 1DY3A 2UUTA 1WF2A 2WVEA 1W7WA 1UAWA 4UT4A 1ACMB 1RTHB 3LW5C 2XGQA 1FE4A 4WPAA 4JI6F 3G4SS 1IBKF 1RHQB 3IGNA 1TKTA 5LSOA 4XPCA 3MCSA 2V69A 5DJBA 1IR2A
chains in the Genus database with same CATH topology
3MPYA 3SV4A 3K5PA 5DS7A 3QO9A 2J7UA 2M7SA 3MR2A 5F3ZA 4NLOA 7FD1A 1VI7A 4N47A 1UWBA 2XSFA 1LWCA 4BWMA 1MSWD 1XR5A 5KFHA 3DOLA 3EUNA 4J9SA 5B0AA 4NRUA 2RJZA 3MEDB 1IJEB 1M0SA 5B0GA 2HAIA 2P9EA 1RT4A 4C8OA 5F8LA 2ZE2B 2DGXA 3MGJA 1RKIA 4LFAF 4LVOP 2WSFC 3OSNA 1RKJA 3THVA 4IR1A 4BHQA 1IKYB 1X5PA 3SI8A 5K8OA 3PX4A 3A8EA 2RF2B 3V81B 5GADU 2BE2A 3V6KA 1LXNA 4WFXA 4WYWA 5J2NA 3QLHB 4ILRA 1VQ5S 4RUAA 1TZ0A 5EWFA 1FXLA 4IDKA 1VS3A 2DB1A 3BEGB 4DQIA 3OVSA 1ZPVA 3DLGB 3O5TB 2DHSA 1RTJA 3LALA 2FHJA 3N79A 4IQMA 5J2QB 1QAXA 4ZVHA 3DXBA 4MAKA 2JEJA 2XB2D 3PR5B 4DUYF 2CVIA 2CJAA 4HT7A 1UFWA 1DLOA 1S6PA 2MMYA 4X4QA 5KFYA 3CEDA 2RSQA 3OTCA 1JLQA 4ZCMA 3MUVP 2B5JB 2M8HA 4RW8B 5KFVA 3BGRB 1C4AA 2CJKA 1REVB 1JB0C 2DJWA 3HMJG 5KFQA 4K4YA 4NOHA 3PW7A 3HHLD 3U1LA 2LVWA 3JAMY 1VK8A 1B64A 2L9DA 4ED1A 1EETA 1V9OA 3CDAA 3EPGA 2FGOA 1FNMA 1JLEB 3D1OA 2D41A 5CCMA 5IT0A 2RS8A 2YWEA 1H2TZ 2YKOA 5KFCA 4ZCKA 3EGNA 2L3MA 1Y5IB 2IRUA 2UUAF 5A8KB 2XLJA 5KG2A 1D1UA 3US5A 4LF6F 1CQMA 3GG1A 1OPIA 4IG3B 2N3OA 4WK3A 2IA0A 3RU0A 1MMDA 1YRXA 1FVSA 2I2YA 1UJ5A 1UJ4A 4LJMA 2JJ4D 1KS2A 3IAS9 1F0XA 4C11A 1R0AB 3DLHA 2QLWA 4Q0BB 2CYYA 2UVRA 2ZH7A 1UVIA 1WI8A 4NA1A 4A8XA 4PWDB 4I69A 4NLDA 3E3XA 2G9OA 2P6TA 3M9OB 3BB5A 1FEEA 4RUCA 4PRFA 1Q8IA 3JTOA 4L6V3 4YB7A 2ZH1A 2WOMA 4EWTA 4RUHA 1N36F 2HFOA 2GO9A 2V8VA 2R7OA 4MIBA 2GCFA 3I4PA 3HX9A 1CG2A 2D3UA 2L9NA 2QMXA 4CT8A 2ASLA 2VBZA 2AU0A 1NO8A 4TQSA 4WFZA 3CDEA 3LP2B 5GAHU 2CPYA 2DO4A 5F0WA 3MR6A 4DMZA 2DNOA 3VWSA 2I5JA 5LXRA 2IM2A 3KLEB 2R2UA 1UVNA 3GFYA 3OTBA 5GADI 5K14B 3E8OA 4FXWA 3J7YU 2CPIA 1IR0A 3IG1B 3MM8B 4RNHA 1NKBA 1HYSA 4N8NA 4TYBA 1L5UA 5E3QA 3V2UC 4AL7A 4YQWA 3V6DB 1TK5A 3I96A 3OPKA 5KFMA 3KLFB 1HA1A 1NK7A 4DR1F 1S0NA 1N32F 3R5AA 4OX8A 4QW8A 2RIJA 4DSEA 4FXDA 4KHMA 2DR9A 3MDFA 1SH3A 1NNDA 1QE1A 1S6UA 1TAQA 4Z37A 1WEZA 4ZPAA 5KT7A 2HHWA 3CXCR 3DRSB 5D3GA 2HNZA 1HD0A 3DYAA 3PEJA 1HBOA 4C8MA 1S9EA 3IFEA 3QAUA 4DQPA 2CJQA 5K8NA 2M3DA 2LECA 3L95X 2VOOA 1O5JA 3VAGA 1RT5A 2ZC4A 3TAQA 3MEGA 2HHPA 4H4KA 2EVZA 2EFVA 1LK5A 2A10A 1HQUB 2ZKTA 3HHNB 2HWTA 1KTVA 5E3PA 5G4DA 5AE2A 2L41A 1VC6A 2J9CA 2Q6BA 4MKYA 3UD3P 4R0EA 2B7BB 4NZ6A 1VQSA 1X4FA 1QVFR 5F3TA 1K1SA 1VHFA 2Z4PA 2AGQA 2ROPA 5HP1B 4F4KA 5B7WA 2OIHA 3CCTA 2GJ2A 5B0FA 1JLCB 2J0XA 2YWGA 4I68A 4IYQA 2IJFA 2A18A 1LOUA 3NCPA 3T1YF 2HG4A 2Q66A 4KBIA 1NH7A 2M52A 3DLBA 4K4XA 3OVBA 3CUNA 2LQBA 2BRKA 2NUHA 5KT3A 1OQ6A 2RQKA 2L48A 4QIFA 4HTJA 3DCAA 1YJRA 2ILYA 3IAM9 3K5MA 4C8LA 5JXSA 4MYTA 5J1EB 5AXKA 2DCUB 2KYZA 5T7LB 4ETXA 4ZHRA 3I0RA 1HFEL 2IMOA 1JXLA 2PFFB 3FMBA 5CZVA 1YSJA 1VOMA 1T95A 2LXUA 3M2UA 5D78A 5FD1A 5A6WA 1FEHA 2BOPA 2IAJA 1KQFB 2DGUA 3CJ5A 1TV6A 3TAMA 3G8TA 2CRLA 3MM5B 3PM9A 4CH1A 2GHVC 3R5CA 1C4CA 4LT6A 5MLCV 2JEIA 3AJ1A 3BF4A 4DHVA 3KLVA 1P1TA 1D8YA 3D54A 2HFZA 4KRWA 1RK8A 1S9GB 4ZS6A 4UW2A 1ZM3A 2DNQA 1VK3A 3R27A 2DNHA 2LEAA 1NKCA 2SXLA 1FD8A 1HPZB 2VZ9A 3N5BA 3ZZTA 4KQZA 2LXIA 5GAHI 4J9KA 1SJFA 4QWBA 4J9RA 1N48A 3QGIA 3OV7A 2HIQA 4N41A 4QR0A 3O8WA 3NWGA 2XMKA 2E44A 2E7XA 4N77A 1NEEA 1I6JA 4ZP9A 1T7PA 4AFFA 4V19X 2KVIA 1SUQA 4QJVA 2HNDB 5JUMA 1M5HA 3LUYA 1KLMA 4M8LA 2UXCF 1S99A 3KYLA 3IRWP 2BJDA 4NZ0A 4NZ7A 4PPZA 4LSNB 1OS5A 1S6QB 2QIFA 5IWAF 2WTFA 4OI1A 5F8HA 3BGLA 3CB4A 4A8OA 4F25A 4DF4A 2HQIA 1WHWA 4WU3A 1S1TA 3MFHA 5KFDA 1CC7A 4I2QA 4MK9A 5D77A 1YIJS 4Q45A 2VQFF 1E6YB 2G0CA 2KHDA 1X5OA 2PMHA 3UFCX 3KLGB 2EK1A 2OTJS 2MKIA 2DITA 3FFIB 3X1LB 3QYYA 1FESA 3DRRA 2B6AB 2B9YA 2EFNA 4PWUA 2MKJA 2GO8A 3L7OA 2X1GA 1XMBA 3I56S 4DV5F 3T9ZA 1ZAXA 2V2KA 5L1IA 3HM9A 4P7VA 2YQ3A 3W2WA 2YTCA 5F41A 2I5JB 2ZNZA 4LIWA 4NCGB 3OUYB 2L9WA 4IH7A 1GH8A 1P27B 2KG0A 2OPSA 1JJ4A 1BD6A 1J2VA 5A0YA 3OFHA 4DF8A 4DDFA 3IN5A 1URNA 1TKZA 3M4XA 2OPPA 3SQGA 3WZ0A 1JX4A 2GHWA 2BJEA 2ZH6A 3SYZA 2KXFA 3UCUP 2JOQA 1OO0B 1FKPB 1RT6A 1SIZA 3CF5Q 2ZH5A 2V94A 5FJ4A 1F2GA 1S1UB 4B9TA 5E7OB 4C3LA 4TU8A 1GX6A 4NL5A 4M94A 4RZRA 3EZ5A 1JLFB 1C0TA 1U2FA 1FERA 4IOBA 4K5RA 2CPXA 2YNFA 4TY8B 5LJ5Y 4YR0A 2IVYA 3IRXA 4J9QA 1L3UA 2AP6A 4HEA9 3GIMA 4OLOA 4A47A 2NXUA 4H54A 4P6QA 1DTTB 1Y5NB 4PXBA 4TKTA 1CSJA 1RQ0A 4RW6B 2RB7A 4Y34A 4NLQA 4H4OA 5C24A 5KFPA 4Y00A 2E5IA 1J5EF 2KT2A 4DR5F 4CTAA 4IRDA 4O3PA 2VFSA 4F50A 4LF4F 4HTIA 3FGVA 3TA1A 4JV1A 2CQIA 3D1HA 1FTRA 2J5AA 2O5DA 2PGCA 4CO5A 1RTIB 4E98A 3M2RA 4YFUA 5DLFA 4ETZA 4RU2A 1R8CA 4MJKA 2KB2A 4LMZA 2I9SA 3VALA 5KT2A 4OHWA 4CNZA 2FTRA 3FSYA 2UVWA 3SSRA 4NXNF 1IQTA 4RWWA 2DD8S 3TR5A 4EO8A 4WTYA 3JYTB 3PV8A 3MOJB 2GMHA 3N0VA 1U25A 4Q2MA 3ZZPA 4DFKA 1ZZNA 2HGNA 1MWZA 2QSWA 4ID5A 1HW9A 1FRKA 4I6WA 1S1XA 3OL6A 4OX6A 2LMIA 5HMXA 3RR8A 3KLIA 3T19A 3MM9B 2PI5A 5B08A 4CH0S 3C6TA 5EGYA 3ONQA 3PRDA 3M2UB 4KO0B 4AUKA 1HL6A 4O3NA 3KTQA 1RWUA 1S1VB 3CJ4A 2VA2A 3HHKA 4KT0C 3PW0A 1F5BA 2IM0A