5A6WA

Complex of rice blast (magnaporthe oryzae) effector protein avr-pikd with the hma domain of pikp1 from rice (oryza sativa)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
71
Chain Sequence
LKQKIVIKVAMENNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of pathogen recognition by an integrated HMA domain in a plant NLR immune receptor.
pubmed doi rcsb
source organism Oryza sativa
molecule tags Antiviral protein
molecule keywords RESISTANCE PROTEIN PIKP-1
total genus 19
structure length 71
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5a6wA00
2K2PA 3WDOA 1SQEA 2BJEA 1CPZA 1TR0A 2GA7A 2HLUA 3BB5A 1KVIA 2N4CA 3E8OA 4DL0C 1R6YA 2EW9A 4OJ3A 4DN9A 3FGVA 2G9OA 2CRLA 1AFJA 2AP6A 1IUJA 2XMWA 4ZA1A 4Q2LA 2W4PA 3LO3A 3FRYA 3TRGA 5B0CA 2BBEA 1K0VA 1OQ3A 2KYZA 2FB0A 2XMJA 4OJHA 1X8DA 2QIFA 3QMQA 2HQIA 3HF5A 2FIUA 3DCAA 3IWXA 4OJGA 1V3ZA 4HI2A 2AJ0A 4HI1A 4OJ1A 1APSA 1YJVA 2KT2A 1AW0A 2BYCA 4YDXA 2VV5A 2ACYA 3KG1A 2GCFA 2GO8A 3HDSA 1QUPA 2AW0A 1FESA 2LXFA 2N4DA 1JK9B 1X0PA 3HHLB 1TL4A 2RU9A 1Q4RA 1U7LA 5K9FA 2LDIA 4ZOSA 3GZ7A 2L3MA 4FNHA 1OPZA 1URRA 3VTIA 3LGNA 5B0BA 3BF4A 1P8GA 2HLTA 1ULRA 2RMLA 3DXSX 4EFAC 1FVSA 4QOTA 2PGCA 2W4CA 4A46A 4NPOA 2ASYA 3BM7A 3IWLA 1TZ0A 1CC8A 1YJTA 3TNVA 1TL5A 1VQSA 2OD6A 1N5QA 2OP5A 2QLXA 1FE0A 1Q8LA 4Y2IA 4FNIA 2XMKA 1FD8A 2GV1A 1WD6A 2IYIA 1OQ6A 2GFFA 1XBWA 4HL9A 4A4JA 1Q53A 2ROPA 1W2IA 1SI9A 3CJKA 5A6WA 1N5VA 3LGMA 5B09A 4OIXA 4Y2MA 4HH1A 3HHLD 4A48A 1MWZA 2FTRA 1FVQA 1MWYA 3I9ZA 5B0GA 1YRXA 1X7VA 2QLWA 2ZDOA 3MZIA 5A6PA 5KAKA 1Y9OA 2BJDA 2OAUA 5F0WA 1GXTA 3MCSA 1YJUA 1CC7A 5B0DA 2KKHA 1SB6A 1FEEA 4Y2KA 5F0UA 1KQKA 4F67A 1AFIA 1VQYA 3F44A 3HFKA 3BGUA 2KT3A 2OFGX 3K7RA 4Q2MA 3QGPA 2LQBA 2XMVA 1Y3JA 3UDCA 2PD1A 2XMUA 1TUVA 2K7KA 3HHLA 1OSDA 3FMBA 1YG0A 2Q3PA 2N7YA 1N5SA 1S6OA 4HH0A 1Y3KA 2RSQA 3KNGA 4DPOA 3BDEA 3BN7A 5B0EA 5IXUA 3KKFA 5B08A 1N5TA 2ROEA 2HFNA 2FHMA 5T7LB 1LQ9A 2K7JA 3KG0A 1JWWA 2XMTA 2HFOA 2OD4A 1YJRA 2XMMA 1Q8BA 4NL5A 2IYGA 3HHLC 2ZDPA 2ROGA 2OKQA 2GGPB 2K1RA 3BR8A 2QYCA 3HX9A 5T7LA 2AJ1A 2VH7A 2JDJA 2RILA 1KVJA 1S6UA 5B0AA 4U9RA 2W4DA 2OMOA 4YEAA 2HIQA 2IFXA 5B0FA 2GGPA 2K1RB 1FE4A 3CJKB 3T9NA 4A47A 2BUNA 1P6TA 1GXUA 1Y0HA 2OFHX 2LQ9A 3TOQA 1RJJA
chains in the Genus database with same CATH superfamily
3D0HE 2CVIA 2RRNA 4ID5B 5I3QA 4DL4A 1XEZA 3Q8YA 3UCUP 3CJ8A 3E8OA 1JLFB 2OPQB 5A2QY 3MM5B 3G6XA 3OQ2A 1W26A 1HIYA 2LEPA 3PRDA 2W9CB 1EB0A 3TRGA 5DM6Q 1P9YA 1RE1B 1YIJS 3ZNJ1 4DX8H 5HVFA 1SKRA 1PC4A 3QMQA 9RUBA 4DV5F 3NP5A 3PYDA 4DL3A 3DLLQ 4LF7F 1Q8KA 2MZJA 2AJ4A 4NI2A 4JI7F 2B7CB 1FWLA 2P5VA 3MEGB 3CJQA 4RW4A 5M2RA 2KZMA 3OVBA 3TZXA 1PG5B 1H7XA 1RAOA 1S49A 4ZVEA 4ZCKA 3MCOA 3MM9B 3PNIA 2ZUGA 3LP1B 4HHHA 1OY6A 1S0OA 3DRYA 4RBUA 3A8JA 1AB8A 4ED3A 3C14A 3D7SB 1PYSB 4BC9A 2UUWA 2BANA 4WK1A 3SBMA 4DPTA 3R7BB 4B9MA 2L9DA 2IJNA 3P45B 4OZJA 1NJIT 1VIXA 3CNQP 2W7PA 2D41A 1N6QA 1RTDA 3DLEA 4F2RA 4IRCA 4YHHF 1H0HB 1RTIA 2EFQA 2EEYA 2FGOA 3BYPA 2K3IA 4EI2A 3PY8A 1NKBA 1JLEA 1G3OA 3PG9A 3O5TB 3ZZ0A 5F41A 4F02A 3MHYA 2BE7D 4K4WA 1I6JA 3LP0A 7FDRA 5F8GA 2JC1A 1JXEA 4YB6A 2BDPA 5C25B 1QAYA 3D6HB 4JI2J 3QQCD 1H3DA 1SJ4P 4B9TA 4A4JA 1FDDA 2A3JA 3B8HA 3KG4A 3NBPB 4QR0A 5D4PA 1UPMB 4O23A 2J6UA 5F3ZA 3M2VA 2P6SA 4TQRA 4C11B 1FJGF 1SH3A 1YWXA 1RT4A 2VPZB 4QWEA 4NXNJ 4QWAA 3CCES 4A48A 3UCZP 3I82A 1X7VA 2ZDOA 2AJQA 1VQ9S 1B0PA 2UV8A 2Q43A 4OX8A 4CLTA 5K14B 5LOQA 1TVRA 4FXVA 1WG5A 4USVA 5AXKA 4QZVB 2ATCB 3DDKA 1MLAA 4E98A 3FBCA 5J2NB 4F67A 2RT3A 2HRYA 2MZ1A 3NNAA 3Q8QB 3T41A 3V6DB 1M5OC 1WEZA 1PJ7A 2OHDA 3A3NB 3P5BP 3OL8A 1NJZA 3UDLA 2FLPA 1CBKA 3AB4B 4NLWA 2C2EA 2DITA 1NMEB 3AQOA 2MY7A 4K4ZA 4UY8T 2N82B 1BHNA 4DQRA 1BC6A 4DSIA 3EWGA 4RW7B 3VAMA 2AQ4A 1N54B 4KFBB 3UO0A 4ZPDA 2FVRA 1MG7A 1MN7A 3KNGA 1HYSB 1RT1B 3DLKA 3I5AA 2HHSA 3BO3A 1HARA 3BKTA 3N0VA 2GMJA 4JOUA 4TXSA 5T7LB 4F3OA 3OHBA 2DHXA 1EHWA 3P5TL 5CD4H 1DQ8A 1Q8BA 4WFYA 5KT4A 1XMQJ 4JV1A 2GAHC 4V1Ak 2CZVC 3NWRA 2UUAJ 1FDBA 1RHKB 1Q16B 1NZAA 1IKYA 2QL5B 1A6LA 1S1UA 1HR0J 5K5MA 2IM2A 3GIJA 3IS9B 1T9WA 1HBUB 2A10A 2ZBRA 4F0HA 2OEMA 4YY3F 3BQ2A 2AGQA 3RR8A 1RI7A 4PXDA 4JI2F 1ACMB 2B4VA 5CZXA 4OZ3A 2IVFB 3Q24A 4KH0B 3MECA 4NLUA 1KTVA 2ZJQQ 4Q0BA 2IM3A 4FYXB 2HGLA 1RYSA 4F4AA 2M70A 5HAOA 4F50A 2V9WA 3BB5A 2NZ4A 3Q89A 2HMIB 3GV8B 4OJ3A 4DV6J 4CLZA 3OJSA 2CRLA 2XMWA 5ETNA 4UZCA 3LO3A 3MEDA 1O8BA 5HBMA 2PI4A 1YRTA 3L9ZA 4KTQA 1UEVA 2YX4A 1Q79A 2WK4A 3H40A 4USMA 4P72A 3J7A1 1B7FA 4X2BA 2QJ3A 2D7SA 4LBHA 1B7YB 1G4CA 4YR3A 2HZAA 4U96A 3EJMA 3FCHA 4L76A 4ATNA 4X4PA 5J1EB 1N5YA 2B6AA 2ZBIA 3V6HA 1MU2A 3C14B 5F9LA 2ZOMA 5IM0B 3QSYB 1U47A 2FJDB 1GMVA 3FCVA 4O44B 2CUYA 3TA2A 3C8YA 3MCNA 2G2YA 4M5GA 4U8VA 1JLQB 1TL4A 1FWKA 1YRUA 2RF2A 4CI0B 1U1MA 2GX8A 3HVWA 1U1OA 3PV8A 1FI4A 1LWFA 4OHXA 2HNYA 2DCLA 1IWAA 1ULRA 3IBWA 3R1LA 1JLAA 2M8DB 1K0TA 4ELTA 2GQ2A 2C42A 3C16A 2JEFA 3M7VA 4FYVB 1WC6A 5BR8F 3PKMA 2PE8A 1TZ0A 3J7AN 1GTHA 5KFEA 3SXLA 1TU0B 3RJMB 2IVMA 2J9DE 2FJVA 5A8WA 5D77A 3UR3C 4YY3J 1RAFB 2NXUA 4RW8A 2QLXA 4IO9Q 1TL3A 4LF6J 4XPEA 5EN1A 4DFPA 1OYEA 1GH8A 3F0NA 5KFZA 3D6TB 2CJBA 4ZVRB 3W64A 5A76A 2Z2YB 5C7PA 5KT5A 1RLCL 3QT8A 1RCXB 2VONA 2YNIA 2UUBF 2J6TA 4Q7AA 3HD2A 1U24A 3O6QA 2LQJA 3B82A 4KGVB 5CYJA 3IM8A 1YGYA 4KB7A 5K14A 3D9BA 3ET6A 4IR1A 1R8HA 2LFVA 3EGVA 1FNMA 4RU9A 2HHUA 3G82A 3BBCA 4AL7A 1VQ7S 3JTNA 4ZVQB 4PXEA 2U1AA 3FSXA 2MHNA 2RUGA 5L46A 1U8SA 3CDAA 1TTHB 3UFCX 2LVWA 3VR1A 3QIPB 3F44A 3SSRA 4AYBD 3HZGA 1OJ4A 1WKLA 3K8WA 1ZM9A 3BGUA 2H51B 1OPIA 1BLUA 2RQMA 3POTA 4KRWA 3ENWA 5D4NA 2QSWA 3UN5A 4N56A 3PKYA 3VALA 2AEJA 2AIRB 3V81B 1T11A 5F8MA 1G1XA 2MJNA 1YBTA 2HFUA 5GAEI 3HVRA 1WC4A 2DY9A 1VQNS 2M5YA 2DVIA 3H4DA 1U0HB 2BX6A 3EXYA 4RPFA 2EKYA 1D09B 1NB7A 3P8BB 2CQGA 4O4GA 4ECYA 3VAKA 3M1VA 3MMCB 2GW8A 3ILOA 1UJ4A 3IS9A 4X65J 5H9FK 4LF9J 4QIGA 3T9ZA 2BMBA 3DMJB 4IH5A 1WHXA 3TZZA 5C5JA 2DT9A 3AOBA 3TAQA 3R2DJ 1U2FA 2BZ2A 4NA1A 4UOFA 1YLXA 1NJXA 3GR0A 4X62F 2I8EA 3SCKE 1AA1B 1KN6A 2BE9B 4MKBA 4LBPA 1GXUA 4DV4J 3T1YF 4M1KA 4DR6F 3AJ2A 1ZS6A 4ZIVA 5LMNJ 2C28A 2WRMA 4UOCA 1K1QA 2BJEA 2C1EB 2EWHA 2QLBB 4RZRA 1RK8A 2J5AA 2VKRA 2YQ3A 3QFWA 3NXZA 3NNHA 1U2RA 1UZHA 4CZCA 1X0FA 3QBCA 4F25A 4ZA1A 1S10A 2RRBA 4IDKA 1QJHA 1BQXA 1GT8A 2V8PA 3LH2S 1O51A 3TJAA 3MMBB 2RIJA 3TWZA 4X4RA 1SJFA 4ERDA 4KV8A 4WKRA 5F8LA 1FRXA 2J9CA 4DXLA 5J2QA 1TV6A 3DCAA 4HR2A 5G4DA 1HNZJ 1APSA 3G6VA 1GNKA 2XYHB 3Q23A 2CQPA 4GRSA 2BYCA 4U7UK 4IG3A 2ZH5A 1Y10A 4LRAA 4ZPBA 4QR1A 4DX7A 3KLIA 4X66J 1X5SA 4C2MA 4Q45A 1DTQB 3PW5A 5ETMA 3OL9A 1HLWA 4LJMA 2VQEJ 2R8KA 1JK9B 4RW7A 2CVEA 1I5OB 1TFWA 1IVZA 2BOAA 4JBCA 5IFMA 1I3OB 1S99A 3JS9A 4ZPWR 3TJ9A 5KFKA 1KKHA 1YDLA 4J9QA 2IMWP 2MKSA 4C6AA 3LGNA 5B0BA 3GIRA 8ATCB 2HVEA 2HLTA 3JQJA 4WFNQ 2MYFA 1M5HA 2DGWA 4OYWA 3I0SB 1WF2A 1H2VZ 2MJUA 1HHTP 4NPOA 2CPHA 3MF5A 5IS2A 4OI0A 1YJTA 4RNHA 2M52A 3TNVA 1FRIA 2ZH7A 1HPZA 1WEXA 4ZJLA 1J5OB 4OZ0A 1LXJA 1G7CB 2PC6A 4J9LA 2YWWA 5M2UA 1FD8A 2IM1A 2F5GA 1TP7A 3VVUA 1Q8IA 2CKWA 2EG2A 4I6AA 8AT1B 4DUYF 1WSVA 1SL1A 4RJVA 3HP6A 4A8FA 1TKXB 2WOMB 3O3LA 3KMSA 3J81Y 1KFDA 3HJFA 4NWBA 5D78A 5T41A 1UVNA 3P4UB 1VRTA 3T5KA 4C48A 3SFUA 5LMUF 1RHRB 1T3NA 3NOGA 1MWYA 5A6PA 4IH7A 3K0JA 1KDNA 3POTB 4F0KA 3FK4A 3R1HA 3I4HX 5GMDA 1GXTA 1T9VA 1X5OA 3NMAA 3NGSA 2KYXA 4NEYA 4CLLA 3OJUA 2V69A 2C3PA 5KFFA 4J9PA 1R89A 1CULA 3NOCA 4WE1B 2PA3A 5AXLA 2KM8B 4RLEA 4DR2J 1H6KX 2Z58B 1NM2A 1LFPA 1SJ1A 2F65A 2J7KA 3H90A 3DRPB 3QGPA 1S1XB 3N4WA 4FKYA 2W9BB 2XS2A 3EICA 2DEJA 4C8KA 1MU2B 3L7OA 4YB7A 3CCJS 4QCLA 3FMBA 2NSBA 1WHYA 1UZDA 3QJLA 4O3SA 4KBIA 1Y3KA 3NGUA 1F2HA 1C1CA 2DRDA 2VU5A 2ZH1A 1HNWJ 4A8MP 4CT8A 1RSCA 1JLQA 4U6PA 3NAHA 3K8VA 4KH1B 1ZYQA 1WI6A 3GJQB 2R3VA 2V9KA 3CW2C 3NMRA 3P96A 3IN5A 1JLEB 2YKNA 4DQIA 3QAEA 4DU7A 1IR0A 4GVLA 4KIAA 3MR2A 5RUBA 2ZUAA 2B56A 3AQPA 2GGPB 4Q8FA 3TUPA 4OQJA 3HX9A 3C16B 1QE1B 3CSKA 4I56A 4LR8A 4NLVA 4USHA 2JFDA 3GJTB 4CM2A 1RP5A 4AXJA 2XLJA 4DLGA 5K8NA 3M8SA 2M4MA 2HRTA 4TYBA 4EZ6A 2OSRA 2ALZA 2YQ1A 4FS2A 2BKPA 4LIRA 9ATCB 1UETA 2ILYA 1AROP 1E6YA 2VC1A 2Z2MA 3CJSA 3KK2B 3EYZA 1U6BA 1S9GA 4ILMA 5F8JA 1S6PB 4OHZA 2LKZA 1UPPA 3H5XA 4EBEA 4K0KF 4JV5F 1H72C 1WHVA 2RDIA 4FP9A 4FVCA 5DJBA 2IIHA 3MMBA 3TUIC 5JJBA 2R9LA 4DR1J 4IH6A 4ECXA 2LP4A 3NCRA 4P9SA 3KK1B 4NLYA 2E5LF 5GAEU 3ZNUA 1WOOA 2L41A 4F3MA 2DIVA 2BBEA 3GYXB 5DETA 3GV5B 3A8IA 2BW2A 3J80Y 1HKAA 4DZDA 1JXLA 4OLOA 3CULA 4ECQA 1RT6B 4OJHA 4WU3A 2ZHAA 2QIFA 1KP6A 4WWSA 2V50A 2FIUA 3Q8UA 2Q66A 2XM3A 4PRFA 3G6YA 3C2PA 2MKCA 4B3TJ 3H20A 2Y3YA 4FF2A 1RHUB 3HHDA 4USJC 1RLDA 2CPDA 3RU0A 3W5ZA 1HHSA 3OHAA 5I3UB 3S6EA 2J6SA 4LF4F 5F8NA 3OXFA 5HP1B 2Y8WA 2C3YA 2CAJA 1RABB 1TELA 2KB2A 3CD7A 3ICLA 4I6YA 4CO2A 4LFCF 2E1AA 3DLKB 3V81A 3NAIA 3MEGA 4RW4B 4LFAJ 5D3GB 2A6MA 3K58A 1Q4RA 1R0CB 4P74A 2XMAA 2KRBA 5AXMA 1QAIA 4B9UA 4RNOA 1I1GA 1OPZA 1MROA 1U0HA 2P6TA 2RAQA 2GJIA 4CO4A 2R8HA 4Q8EA 2HFZA 3ILIA 1Q78A 4E8UA 1UKUA 6AT1B 3G2XA 4O4GB 2ZM6F 1FVSA 4XO0A 3LUYA 1NCLA 3AD9C 1R8BA 2C2NA 4ZLNA 1XR6A 2ZWPA 2APOA 3S7RA 5DDOC 4OZ1A 1RHJB 2BANB 3J7Z5 1HBNB 2CQ0A 3MD1A 3SQGA 1U1QA 4KYZA 3WIVA 2VJUA 3I0RB 5FDLB 5KFIA 2GIFA 3TP2A 4ZLJA 3D0GE 4ZITA 5AXNA 4A8QA 4FNIA 1F5BA 2F4FA 4J9SA 3C6TB 4HT5A 3F73A 4JI0F 4NXMJ 2YXLA 3LP0B 5GMEA 3G71S 2YY3A 4A8OA 2MSTA 1A9NB 3ENVA 5KFCA 2HQCA 2GAGC 2XYGB 4KSEB 4Z37A 5EWEA 2YKPA 3ETOA 2J0SD 2DY1A 1MWZA 3AXMA 2R8JA 2MGZB 1N32J 1H74A 1RWWB 2M88A 4C3MA 4DV2J 2GVDB 2RQCA 3M2VB 2FJXA 1WC1A 3MCSA 2C2RA 2KXFA 2VZ9A 4DEZA 3NGDA 1Z1ZA 4OHVA 4TU9A 3MD3A 1YZ7A 2XZTB 1NHKL 3GE9A 2QZ8A 3K7RA 3CO9A 4J7CA 1RWUA 4ZP9A 4EBCA 4B9NA 4DV4F 3T1YJ 2B9XA 2LXUA 4LF7J 2QLJB 4PQUB 1NK4A 3HHNB 2DH8A 2ZE2B 2YWEA 4LF6F 3BBBA 3AB2B 1U1PA 3G87A 2PSZA 1YQHA 3NS5A 3HD1A 2HQDA 4ED2A 3M8QA 3MM6B 4KR0B 5HL7Q 1DTQA 2FVQA 1A7GE 1S4EA 2UVVA 1DBDA 3RRKA 3N28A 4ITSA 2VA3A 1PO6A 1I94J 4LF5J 5D4LA 3CDWA 3R5JB 5KG3A 2YPYA 4D3HA 1XNQJ 2HFOA 3CCVS 4HACB 3JQMA 5L1IA 4NL5A 2VA2A 4IQMA 1Q81T 1VK3A 1HNZF 1X60A 2DNPA 1KS2A 2YKMB 2OKQA 3B4MA 3IFEA 4LF1A 5CYMB 2JH3A 5CAAA 3PR4A 2XZDB 3KK2A 2KH9A 3MTKA 2GQCA 2LYVA 1NPRA 2JSXA 2VH7A 4O0NA 2ZD1B 3DLGA 3OFGA 1U1KA 2GZOA 1WJ9A 2QL7B 2OMOA 4ZVFA 4K4YA 2RHSB 3HFZB 1J5OA 3T5JA 4A47A 3CMQA 3M2UA 3ZZOA 1P6TA 1B70B 3IO1A 4NEZA 3W61A 3VGTA 4DQSA 3I5BA 3M4XA 3A8EA 3DN9A 3ET6B 3N01A 3WDOA 5KFHA 2HHVA 2E9TA 3SDEB 3C6UA 3ZZUA 2HBQB 5H9EJ 1F3FA 2E5GA 8RUCA 4B3OB 2XWXA 1I51B 1OY9A 4I2QB 2CQBA 2M2BA 1VRTB 5KFYA 4DQQA 4BC7A 4X4SA 3AOAA 4Q2LA 2W4PA 3QLHA 1N8RT 2RS2A 1HNVB 5HVHA 4OX9J 2B7BB 3G96A 3LTOA 3IMQJ 2ZVSA 4EBDA 3PX4A 1IKWA 3O2IA 2FB0A 1TL1B 1VLYA 4WFXA 3SQOP 3WBZA 3RAXA 4DSKA 2ZZNA 4GKJF 3GIMA 3ELHA 3HF5A 2X51A 3OLAA 1ZM4A 1F60B 4DUYJ 2WONA 3D66A 2GMHA 4ZPAA 3BQ0A 1LV5A 3D3CJ 3L3CA 2I0XA 4ZHRA 1HQEA 4I67A 4XAKA 3LP2A 1X9SA 1G2EA 3C19A 2FLLA 1T9UA 3EGNA 2AKWB 4P7TA 2DNHA 4B3MF 2O66A 3FZ2A 2CJAA 3FBEA 4XDDA 4H4MA 1ZTTA 4Y34A 4PUOB 3W2WB 1H38A 3W9IA 1JJHA 4OFZA 3TZYA 4LF5F 2C22A 1FWPA 2DNYA 3DRXA 1WOPA 2W7AA 4J9UE 3BKFA 2VBWA 2PO4A 4O44A 2XY7A 1Y7PA 3BF4A 3RAQA 1D8YA 2RMLA 4NLTA 4EFAC 1ZPWX 1SQGA 2FGCA 3IGVA 4IFVB 4UT4A 5DG7A 5KFPA 5L8RC 1WKJA 3JTPA 4M5HA 1WSRA 4NYPA 1CC8A 3KDNA 2CNOB 4OI1A 1GX5A 1B4SA 1P1TA 2IM0A 4QW8A 3TQEA 2G2ZA 5KFMA 2MXYA 2V5HG 4WXOA 2HKEA 1QE1A 4RKUC 3PR5B 1YJ9S 3SCIE 3VHQA 3DI6B 2DR8A 1VQ6S 4Y00A 1CJVB 3C15A 1CG2A 1YI2S 1UCNA 2E5IA 3HKZD 4KPCA 5DLFA 3W62A 1E6VA 5A0YA 2V0NA 1JIHA 1HQUA 1N5VA 2CADA 4WXWA 5KFLA 4DJBA 4ECZA 2BQUA 4O3NA 2YBVA 3KFWX 3TVKA 4CO1A 2WZ1A 5CZVA 2NPIA 3OFHA 4IFYB 3IRXB 4M5NA 4B9SA 1FVQA 3GCXP 3OR1A 5B0GA 4RUHA 2VIHA 5AE1A 1NSAA 5KFNA 4TU8A 3KK1A 4DUZJ 4FF3A 3NLCA 2DHHA 1JQGA 3VZIA 3ZZZA 5ADZA 4I0WA 1NU4A 2NYIA 2QV6A 3FQLA 4JP8A 2DKOB 4CLFA 4G1QA 4O3OA 1AFIA 4S0MA 1ITPA 1LWEA 1JKHA 3PYFA 4C3KA 3DRRB 1N33J 5F8HA 3OVSA 4M8LA 2CQDA 3QIPA 3VV2B 2ZKTA 2RDDA 3AJ1A 3MPVA 5I3UA 1KD1T 2N7YA 1N5SA 3DYAB 3Q8VA 4TNOA 3OL7A 4X4TA 3BH6B 5IXUA 4X64F 3CF5Q 2LU1A 3DLHA 2HFNA 1IBKJ 2WVDA 1C0TA 2KI2A 4QIWD 2K7JA 3GONA 5CQGA 3W7BA 2P9EA 2ZHBA 2BJ7A 3RW6A 3T6BA 2ZD1A 2C2KB 3CE8A 3DLGB 5KOXA 4USTA 4DMZA 4RNFA 3W60A 3RBXA 3VGSA 3EE3A 4EK2A 1M5VC 3OTOJ 1SKWA 1J5EJ 3CCMS 2JVRA 3OLBA 1WACA 2RILA 4MT1A 2QE5A 1DAXA 1GXLA 2M7SA 4ID5A 5B0AA 3JB9k 4YEAA 1RISA 4ZPVR 3C6UB 4J90A 1N4LA 3W63A 1X9WA 1FE4A 2BABA 1YHQS 5KFWA 5ETRA 1KVIA 2BUNA 5D0HA 2FQQB 3SI8A 3U02A 3UNYA 3M32B 4DFMA 3OXGA 2D69A 1JLGB 3K57A 4B3SJ 2IJRA 3S1TA 1TL1A 2AZ3A 1EJ7L 3KLGA 2D3ZA 2H48B 2YPZA 3DKDA 3G8TA 4MYUA 1R8PA 1U0SA 1CJKA 2E5JA 3TZWA 2XWYA 4J9OA 1HI0P 4WYLA 2J8SA 2OI2A 3D6MB 3DHXA 3MWBA 4I7FA 1FKOA 3O44A 3NRBA 3T6JA 1T02A 4DU8A 4R8UB 5L1LA 2DNLA 1L3UA 1KSPA 4NYOA 2QMXA 3B78A 2ALYB 2LLZA 3CJTA 5IZHA 4IDKB 5IV4A 4QIVA 2GHPA 3MGJA 4ETZA 2QA1A 1J27A 4MJKA 2P8IA 4BDPA 4P7VA 4URGA 4IRDA 2R7OA 4U95A 1M90T 2NYHA 3BYRA 3W9HA 1P27B 1AUSL 2EBGA 4PWUA 1QUPA 2MSSA 3LF0A 1Z2ZA 2AJ2A 2EPIA 3IR5B 1X0PA 4UUXA 1N6QB 1N34J 1S0VA 2V8GA 1F9EB 4K5RA 5DZ7A 4B9LA 1QY7A 2CNKB 2CYYA 5D15A 1BQNA 1NK9A 4JI4F 1CLFA 4FNHA 1R0AA 3E2EA 1IKVA 1PIEA 1PYTA 2YKNB 3M8PA 1AZSB 3OXLA 1H2TZ 3HK2A 1OWXA 1CEZA 3DXSX 1GAOA 4G1IA 3DU5A 3JTOA 4MK7A 5E7OB 3CC2S 3BN4A 3DOMB 2VQFJ 2DO4A 1U45A 4RBVA 3IGNA 2Q6BA 3IWLA 1HBOB 3W5YA 5C25A 2MKIA 4YOEA 4DL6A 3PIOQ 2G1HA 5GMKa 2J7WA 1UW9A 1VQSA 2I5JA 5KT3A 4USKA 2RE1A 2I2YA 2Z2ZA 1VBYA 4I68A 2OP5A 1HBMB 3T19A 4L75A 1JJ4A 3H5UA 4B3RJ 1VQ4S 1K73T 2RDJA 3MAQA 1DFDA 4WFZA 3A12A 2DGUA 1CQNA 2YNHB 3GJRB 4CO3A 5KT6A 3KLVA 5GAGI 3CJKA 3CCRS 3MR6A 1FXRA 4DR6J 5SZTA 1HD0A 4MKVA 4EO6A 3KHRA 4DSLA 3W8GA 1HW9A 2RQ4A 1CJUA 5A8RB 1R3NA 1FO1A 4PPZA 2OPRA 3J7YI 1HL6A 3MEEB 4NASA 2W25A 2CPIA 2AD9A 1S6QA 2QLWA 5KG1A 4NLXA 1N56A 3PEJA 1RT6A 3QWUA 2OAUA 4C0HA 3QRPA 3RZAA 1XK8A 1Y5IB 1ZA2B 2JVOA 3LANA 4H4KC 3BSNA 1VQMS 2XNRA 2VFUA 1EIYB 4LFBF 4JYAF 1CSJA 3UDCA 1RT1A 4EEYA 2WONB 4ZVGA 3TAMA 3VF0B 3AHPA 3HSJA 1N34F 1S6OA 2BJ1A 2I38A 1UWAA 4PR6A 1HWUA 2I9SA 4LBIA 4CT9A 2N7CA 1TKTB 3M2RA 4K4XA 3THPA 1RT7B 2JRSA 2FC9A 2ROEA 4WBFA 3Q0AA 4Y28C 2V8VA 2WVEA 3QYYA 2DPIA 3CPWR 4DR3J 5F8IA 1RGVA 1RTZA 4K7QA 1YTYA 4KKOB 3DLEB 5EX0A 3PEHA 2XZWA 4FF1A 2PEBA 4OX7A 1FJCA 2LCWA 2DGSA 1XTZA 3N5FA 4TVAB 4DV3F 3L7PA 4IG0B 3OSPA 4DR5F 2H5IB 4G1PA 1U1LA 2OSQA 3R7SB 3PO5A 4P52A 4L73A 4NZ7A 3RBDA 3F41A 4ECUA 2UUBJ 3EPGA 1KVKA 2WSFC 3C15B 2W2NP 1FNOA 2VFRA 2W1BA 3LPYA 2BJ3A 2LA4A 2X1GA 2XO6A 2R2UA 1U48A 4GO7X 4K2XA 1E6YB 2AYMA 3EZOA 4DOZA 1BQMB 2B0GA 4YHHJ 4DL5A 1RYRA 2AX0A 4TN2A 4LVOP 4A8XA 2FJBB 2AYBA 2OPPA 2XY6A 1FXLA 3TA1A 5HROA 3P3DA 2IY5B 3QJJA 2EFOA 4CLYA 2UZAA 4R0EA 3I55S 3EZ5A 5CABA 5H1SV 3G8SA 2ERRA 3GSDA 2HNDA 1IBLJ 2YNGA 4HI1A 4OJ1A 4P2FA 3PW7A 1TAUA 3OL6A 3JYTA 2XULA 2YQ0A 4X4UA 3EVMA 3E01B 3KHHA 5H9EK 3PYGA 1FESA 1W25A 3HHLB 3M30A 2YWFA 2HBZB 4RR5A 2PIIA 5HATA 4CO0A 4F0MA 5DGBA 2JJ4D 2ZFHA 2LU2A 4UZBA 3MM7A 3S8SA 1K9MT 1DY3A 1F0XA 4HVZA 1FTCA 2YKMA 1UFKA 2BKOA 3DRSB 3GG1A 4ETXA 5DQGA 2AT1B 2EK1A 1X4EA 2PGCA 4UQTA 2DRBA 3VGVA 2V2VA 2XSFA 4K2JA 4PG4A 4QYZJ 3TI0A 4NOHA 1C0UA 5I42B 2CDRB 2IA6A 2R7XA 3EZUA 3MMAB 2F4VJ 4ZLLA 2AGOA 2YNIB 2HHHF 2HHQA 1U8WA 1OMSA 4GKJJ 4FS1A 3DGPB 3AD7C 3DXBA 5IQQA 3BV8A 4ZN3A 3CCWA 4JI7J 1X4AA 3MPYA 4AL5A 5C2GA 2G0CA 1HBNA 1PJ6A 3SDEA 1Q5VA 1S1VA 2XHCA 3ITHB 3HI9A 1T9XA 4P2XA 3OSNA 3BO4A 2UVWA 4JV5J 3UPFA 3ETMA 4QW9A 4X4OA 1R6VA 4OIXA 2XS7A 3MTJA 3GU0A 3NCPA 4HH1A 4Y2MA 2NQPA 3PJXA 1REGX 1V9OA 4KHRA 2ZBCA 1RUSA 5F0WA 3FJ2A 2GVZA 5D6GA 2CDQA 1D9AA 2VG7A 2HHXA 3Q8SB 1SB6A 3KJFB 4Y2KA 4ELUA 1VQYA 2MGZA 5F3TA 1KONA 3M9OB 2HVIA 2D74B 1JNZB 2GVDA 2OFGX 1HQEB 3BO2A 4Q0BB 2HVHA 3UI3A 1Y3JA 5HMYA 1RT5B 1NPKA 2R7RA 5E3RA 5L1KA 4LF4J 4Y6IA 1X4BA 4J9KA 4ZN1A 4DF8A 1H98A 5IM0A 4V19X 4LUBA 3DM2B 2HBYB 2D3UA 5L9XA 4PQUA 4QR2A 1RDRA 3CB4A 1ELOA 5HSPA 5CHCB 1LQ9A 2RUSA 3NEKA 2YH1A 3DMJA 4HT7A 4RW9B 4GC6A 1AT1B 3VAGA 2HVDA 2ZNYA 3IR6B 4EYIB 2OIHA 2Q1LA 1IKVB 2SXLA 2IYGA 5HMWA 1X4CA 2ZDPA 3EM1A 4MTPA 4I69A 3TEGA 2ROGA 1EQ0A 2DK2A 2F4VF 5IV3A 3HT3A 1ZPVA 2AJ1A 3BH7B 4ZP7A 1SH0A 3CWJA 1FK9B 1S6UA 5A8KA 1FX4A 2DHSA 5CXTA 1SPBP 5GADI 4ICLB 2VB6A 3US5A 3EX7B 2HIQA 1C1BB 4EU0A 1HA1A 2AJFE 2K1RB 3LPEA 4OZLA 2WVCA 3TX0A 3W5XA 4ZJQA 4ED7A 4DR4J 4DR7J 1ROFA 4PEOA 2LQ9A 1RBOB 3TUZC 1VI7A 1EX8A 1CPZA 2GA7A 3N6LA 4L72B 3D1HA 4KV8B 2AWZA 3A1YG 4PG7A 3V2UC 1TKZB 1WTFA 2E7XA 2FD2A 2V4JA 3MOZA 4GO5X 5JMNA 4GKKF 2F8HA 2WB4A 4DFKA 2CQ3A 2Z56B 1RZMA 3MEEA 4LSLA 1FX2A 1LEOA 3ZTPA 4XK8C 2Z8QA 2N3OA 1JB0C 4ES1A 1QTMA 4KO0B 4X4QA 2HQIA 5DS7A 3I96A 3KLIB 4JV0A 3V4IA 5KFUA 5E41A 3W1YC 2ZH2A 4HKQA 1OO0B 1J5EF 3D1OA 4DV1J 1EETB 3LW5C 2JLGA 4QU6A 1TL7B 3BREA 2V34A 5AE3A 5HVGA 4QPXA 3DYAA 4USWA 1C2PA 3QPIA 2IDLA 4Y0FA 1WEYA 2KXNB 2A6OA 4BWJA 4P10A 1S59A 1X4GA 5JXSA 4HHJA 3GFXA 4ZK7M 2O3DA 5K9FA 3MURP 3LP2B 2KRRA 3CMAS 1SQFA 4L74A 2UUCJ 4J91A 4QIFA 5GAGU 5I42A 1CQMA 4N7TA 1NK0A 5ETPA 1I94F 2ZVIA 3TQ1A 2C2ZB 2OTLS 3MAAA 3BBFA 4WK3A 4AT1B 5L38A 3C46A 4C8YA 1RTJA 1RAJA 3KJQB 4JI1J 3HHKA 2VPYB 3TVZA 3PW0A 2XI2A 4X84A 3QSIA 1TKXA 2KHCA 4HEA9 3N9UC 2AV5A 1R8CA 4KKOA 5ETLA 1MMLA 2DXEA 3CJ2A 5DQHA 1Q8LA 2W2MP 4UUWA 2QTWA 3GIIA 3IM9A 4C8NA 2M9KA 4PG6A 5DDPC 4ECRA 4DPUA 5C42A 3UW1A 1N52B 4KHMA 2NREA 5KFVA 4O3PA 2YTCA 1TFYA 3LWLA 4FYYB 5IC6B 2HVZA 3LGMA 1S48A 2GVZB 1CJVA 1F3VA 1RAIB 4CNYA 4X65F 1HD1A 4YR2A 2UXCJ 1CS4A 1REVA 1S1TA 2AYEA 3M6VA 3OR2B 4OZ5A 4PG5A 1HWJA 4PYDA 1CJTB 4NLRA 2MKJA 4BWMA 3H98A 4KHPF 4F26A 1NDCA 3X3UA 3CO0P 2FZCB 1RT5A 2OO4A 5B0DA 3I56S 4J9VA 3U1NA 4DV3J 2MZQA 3IC1A 3IRXA 2YNFB 4Y3CA 3W3SA 2XSJB 3BGLA 4Z2XA 2AZ1A 4EZ9A 2XBPA 4ALZA 3AJDA 3ISNC 2YNGB 4EWTA 1SH2A 4FBUA 2EKNA 1VYAA 1WOSA 3I4PA 5J2NA 1BWEA 3PXGa 4M5IA 4G1QB 4HYKA 2MLXA 3CJ4A 4R5PA 1LWEB 5DO2A 3VZHA 3KJNB 1GEHA 1JNRB 3J7ZT 1LNQA 1OY8A 4OL8A 5E3QA 2UUCF 1M5KC 2VFVA 3CIMA 2KTQA 3KKFA 1RT3B 4OYBA 4USIA 2FHMA 1U6ZA 4CH0S 3IBCB 5EDWA 3A8KA 1MMDA 1H7WA 2CA9A 3KUGA 1D0EA 2DR9A 1DLOB 2ZOFA 1FKAF 5DDQC 2UU9J 1NLKL 2QYCA 3B6BA 3EUNA 3MM8B 3SSSA 2JWNA 1VBXA 2MKKA 1MW7A 2B8QA 1TK8A 2AX1A 2KJVA 1C0UB 1YVFA 3WIUA 3ZFVA 1GX6A 4C0OC 1WORA 2AEFA 2KN4A 3BSAA 3BGRB 3AAWB 2IFXA 2VL1A 1KQFB 3T1AA 4AUKA 1YJWS 5HROB 3KLEB 1XMQF 3EGZA 4O3RA 1VBKA 2OFHX 3K2YA 1IR2A 1FTRA 2H54B 2RS8A 3H59A 3S01A 3M05A 1U02A 3HM9A 5DRKA 3JSRA 2ZH3A 3GYNA 4O0IA 1LOUA 3LWMA 1S76D 1EKSA 4QPTA 3SCJE 2LQ5A 3EMTA 1K47A 4DPXA 4NCGB 4ZVHA 2QA4S 4N77A 1KHVA 1R43A 2KYZA 4L6V3 2HS3A 4TLRA 5SUHA 1DQ9A 2MHEA 2QX0A 3CD0A 3E3XA 1X8DA 1NHVA 4J37A 2HHHJ 3D4JA 5HP1A 1RADB 2JL9A 5AT1B 1RKIA 2C3MA 1MNEA 1CJKB 3M9MB 2R2RA 3ZXWA 3LGHA 1S1WA 5GAHI 2HEKA 2GJFA 4YDXA 4ED5A 3R3TA 3X1LB 3CCZA 2VG6A 4UF4A 2COLA 4IUFA 3FDSA 5HQMA 4ED8A 1FKPB 5LM7E 5KG7A 1S12A 3ZTQA 4ED0A 1LK5A 2B6AB 1L3TA 2Z2LA 5KFBA 2BM1A 1UVJA 3V6KA 1T94A 2RU9A 3C66A 3GP9A 4ZOSA 3GQCA 4W98A 3RBEA 1U2CA 2DIUA 4K4UA 4K50A 4G6VB 1OIAA 2F9JA 2OPSB 3DOKB 1XR7A 3VTIA 1QAXA 1Q1KA 3MUMP 2VPXB 4OYXA 2E9RX 1GMUA 2HS4A 2Q79A 4H4OB 5IT9Y 3L7UA 3RW7A 4M63A 2O5DA 1URNA 2ASYA 2WBRA 3PJWA 4ZIWA 3C3LA 1NB2A 1JJCB 1FFSB 2H9ZA 4NMLA 5C42B 1R0AB 2QT7A 1BGXT 1HMVA 2RKIB 3FBBA 4CM0A 4KC5A 1XC9A 4WYWA 4K59A 3TJ8A 1QSSA 4C8MA 1FE0A 6FD1A 4HTIA 1S79A 7FD1A 2EG1A 1WD6A 1RWMB 2BA9A 1T9YA 5E0OA 3ULHA 1NH8A 4I2PB 2I5JB 1S0MA 2HWIA 4DG1A 1RHQB 1S1TB 2NLWA 5A2QU 2NSCA 3KLFA 1HNIB 1O0PA 5CYQB 2R4FA 4KPYA 4LREA 3L09A 2LECA 1ICEB 4F36A 4HLBA 3UQSA 5B09A 2VQEF 1V5IB 4KY3A 1ZTWA 3HULA 3FEXB 4DV6F 3DLBA 2KFNA 2DGOA 4DCPB 5HQLA 2YWHA 3M9NB 2CQ2A 2HWHA 3K5LA 5LSOA 4L3NA 1LW0A 3PACA 4YP3A 2Y1JA 3G82B 1M5PC 2DH9A 5D4OA 4AE5A 4C97A 4R5PB 1U6FA 2G2OA 4DR4F 2J8AA 2MPUA 3M8QB 2KVIA 3MM6A 3DDNA 5C2CA 3JAMU 4NRUA 3RRGA 4LMZA 4ZLPA 3HMJG 1FEHA 3MUTP 4N47A 2KXHA 2ZJPQ 2ACMA 4QIEA 3H25A 3DNCA 3CJ0A 2IMOA 3MMJA 2D3O1 4DV0F 1RA6A 3DOLA 1JLCA 1WC0A 3TX8A 4CRJA 4C8OA 2XB2D 1DURA 2F8MA 3CCLS 2RU3A 2J0XA 1VC0A 3TAMB 1BWVA 1RWXB 3FMWA 2FVSA 2QL9B 3KG0A 1M0SA 2V8HA 3GMGA 1MN9A 2J7UA 1Q7LB 3HSDA 1F1BB 3PHEA 4DX6A 1F2GA 1RB0A 2L48A 3HHLC 1NH7A 3BPSP 4IOAQ 3GFYA 2XC9A 2VQFF 1XNRF 3QRRA 1MSWD 3GWCA 5BR8J 5DQIA 1NK7A 2FHJA 2YKQA 1NDLA 1IM4A 2JDJA 2ZZTA 3M1VB 4AFFA 3KJVB 2BQ3A 2QSFA 2JLFA 3HZEA 2MQOA 4FVMA 4J9NA 2R7UA 1NNDA 1ZETA 3I0RA 5FDLA 2DEIA 3FRZA 3MM5A 4I2QA 1FF2A 4NCGA 1RJJA 4MMOA 4YFUA 4IG0A 3UCGA 3BS9A 5BXIA 1NK8A 4ZP8A 3RTVA 3VAJA 2UUTA 7AT1B 1W2BR 2AYGA 3FGVA 4MKYA 3CXCR 1OYDA 1YBUA 2FVCA 1AFJA 2AP6A 1IUJA 5KFQA 5ETSA 2YVSA 1T0TV 2VG5B 2ZHOA 3GTYX 2MQPA 1Q82T 3Q8PB 1VQ8S 4QYZK 2DNGA 3K5OA 1D9DA 2L9NA 1WKKA 2VG6B 1CULB 4WE1A 3KHGA 4CO5A 2R2SA 1BQMA 4BHQA 5CH7B 4OJGA 4ANCA 5IOLA 2EFPA 2WW8A 1VC6A 3LP1A 1RTHA 2AJ0A 4MFBB 1UVMA 1YJVA 4U8YA 3V6DA 3W2WA 2OGUA 4JI3J 1EZZB 4YMEA 2ADCA 5M2PA 2FJEB 2B43A 2HWTA 4RX6A 3PW2A 4LFBJ 2VV5A 4F4ZA 1FA0A 1YBAA 3KG1A 3M8RA 3TARA 2EFGA 2OEKA 2OPSA 3DOKA 2NUUG 2CIMA 3I32A 3O8WA 4LRCA 1KQSR 2R42A 1NSPA 3SFGA 1WG1A 4YB1P 1YX2A 3KMQA 1GFWB 4WTOB 1XERA 1RTIB 2UXCF 1TK5A 2H4YB 1U25A 2LDIA 1SBRA 4PG8A 1JX4A 4K0KJ 2L3MA 2H1YA 2BRKA 1HMVB 2H65B 2RKIA 1RWNB 2J9EA 4Q5VA 2PDAA 3LAMA 4QOTA 5LL6d 4I6WA 1YITS 2JFKA 2UUAF 3LAKA 3PFOA 3QT5A 4NYZA 4LF9F 1MWQA 1UWBB 1UA1A 4Q44A 3PW4A 2NXJA 4JUZA 1WC5A 1B3TA 4M94A 3THVA 3HCXA 1KR4A 5JUMA 1HNIA 3DRSA 3FEZA 4Y2IA 5CYQA 1K8AT 3MFIA 2IYIA 5HK4A 1QLNA 1ZBTA 2GFFA 5G0RA 5DG8A 2FY8A 4Z7CA 3V4IB 2CPFA 4ZP6A 2EXUA 3OR1B 2OELA 3QNWB 3M2UB 3W65A 1IBMJ 1NJYA 2DD8S 2KL8A 1LW0B 2DHGA 1VRQC 3PDNA 1T95A 3JSBA 5IWAJ 3ITHA 1ZA1B 5GADU 2UXDF 2BE2A 3QLHB 4ER8A 3PYEA 2RRAA 4DWIA 2MY8A 3K89A 4NXMF 1NDPA 4WJBA 5U47A 1RWVB 2E1CA 3QJPA 2HFVA 5FLXY 2OUGA 5KG4A 4ZVOB 2KFYA 3A3PB 4F4WA 4EO8A 3M6WA 3ZZTA 2W2QP 5D8HB 1OSDA 2Z4PA 5E2QA 4I1TA 2FJWA 1NPPA 3J7YU 5KFAA 2PI5A 3H2LA 4CCHA 2GIQA 4DPOA 2ILZA 1HNXJ 1VQLS 3SCLE 4JI0J 2BJ9A 2CZ4A 4NMXA 2EC0A 4OX9F 1FJ7A 1K44A 4M5JA 2ZH8A 2MB0B 2J0QD 3M8ZA 3R8YA 3UD4P 3PTWA 2FJAB 2ZH9A 2OD4A 4PZVA 5MAOA 1R27B 2AU0A 1C1CB 4MIBA 4N8NA 4LSNA 4K8RA 3R5BA 4J9MA 4LQ9A 3VAFA 1RTDB 1FDNA 4KQZA 2ZNZA 2ADBA 2O67A 3PO4A 2XGQA 4OHWA 3M32A 4NLSA 2F3JA 2H4WB 4WIQA 3SZ2A 1KVJA 5FD1A 1QVFR 4B3RF 2XNQA 1KNZA 2KG0A 1HWIA 2DGQA 4NRTA 4B3MJ 5EX3A 2JNJA 3KLGB 1VISA 2OMLA 2G0JA 3CIZA 3TA0A 4CDIA 5LXYA 3PM9A 3BPDA 4TQSA 2Y1IA 3OTCA 4OYPA 1KC8T 3LA0A 2W8LA 4CTAA 1SQEA 3NBPA 1KBRA 1J2VA 4I7FB 4P73A 4WU2A 3U1LA 1E6VB 3J81U 2DRAA 4XPCA 4ECSA 5IWAF 3UD5A 1S9GB 4BCAA 1NBEB 3A3OB 3OUYA 3HFVA 3WQPA 5B0CA 2BEFA 3FRYA 4NZ0A 4Y65A 2HHTA 1LW2A 1N5YB 1OQ3A 1RU2A 4KT0C 5KTQA 2PN6A 2H3EB 1PILA 4PXCA 1QVGR 2X1BA 1UEUA 2QFIA 1F6TA 3WHIA 4RU2A 2A18A 2VDIA 3RBZA 4YS2A 1V3ZA 4WKYA 5CCLA 1FRKA 4LSLB 2MZRA 1NRKA 4B17A 4Y2CA 2ABYA 4FKXA 1FRMA 3BGOP 4KO0A 4NZ6A 4WP3A 5KOWA 1N36J 2HQGA 5LSLA 1X31C 2UVRA 1RWOB 3W2VB 1AZSA 1KOHA 2HNYB 2Y1RI 4WCEQ 3ILLA 4Q43A 2LXFA 4NCBA 1SV5A 1RXOB 2M3DA 5HJYA 3DOMA 2DXDA 4PXBA 2G4BA 4WZMA 4B08A 4TY8A 1EETA 2WVFA 5FJ4A 4V19J 2IBOA 2X1FA 4WP9A 1XMOF 4HDHA 1DLOA 1C0TB 3GCWP 3SYZA 2IA0A 1IKXB 3UE2A 1PYOB 3A13A 1RWKB 3R97A 1X5PA 4LRDA 2UXBJ 2I1RA 3R6GB 4DF4A 1N33F 1QSYA 4H54A 5L1JA 4C8ZA 4UTGA 3Q83A 2F40A 4IOBA 4X62J 3FUYA 4DV0J 2ZWOA 1VMBA 1RBLA 2OPRB 3KLHB 2C2DA 3TR5A 4KAIA 1X9MA 4B3OA 2ZKUA 2VUGA 3QIDA 1ZZNA 1HWKA 1ZZFA 2DR6A 4FN5A 2CJKA 3GPAA 4DR1F 2R7VA 3I9ZA 4NLGA 2EI5A 5BYQA 4QWBA 3VWSA 2A2DA 2J76E 2QGFB 3KWMA 5KAKA 1U49A 4DCJB 2Y0SD 4G3IA 2ZZMA 3T3FA 3V5RA 2VG5A 4K4TA 1IBLF 4JI5F 2B4UA 2G1DA 5AJ3F 3T1HF 3HSZA 3IAS9 3DHWC 1FRLA 3CCQS 2BM0A 4MH8A 3GJSB 5KG5A 4DZ6A 1Q7YT 1JJ2R 2GJ2A 1PCAA 2MKHA 4DR7F 2ZC4A 3D54A 2XI3A 5T14A 3UD3P 3CD6S 3DGVA 4LRFA 1R7IA 3MR5A 3CVKA 5B0EA 1N5TA 2VD3A 1VK8A 2ZE2A 4IFVA 1V5VA 2BJ8A 1ZAWA 2IRUA 4GVBB 2HS0A 4YDDB 1Q95G 2MEWA 3KDOA 3FKBA 3GIKA 2NZCA 3QO9B 4ZMMA 2ZM6J 4J9RA 5C24A 2IVYA 1S0NA 1QSLA 2MQLA 3CJ3A 2Y8YA 1HFEL 4WP8A 4W90B 4G65A 1RA7A 3BZQA 2FYXA 1KOOA 3DI6A 2DGXA 1VQOS 3VGUA 4HACA 2WSCC 4I2PA 1UAWA 1X4FA 4RW8B 4DG1B 2WCXA 4USUA 3T9NA 3ONQA 4OLPA 3KLFB 1G6BA 5JVGQ 4M5KA 1SC4B 2QYGA 4EUVA 4X4VA 4XIUA 2D1CA 1N88A 1D8ZA 1S5ZA 2LQ8A 2MDAA 4DSEA 3RB3A 3CCUS 2D3OR 5D0GA 2CWKA 2PEHA 5H9FJ 4DN9A 4E2FB 2G9OA 4CLSA 2R8IA 3Q22A 1TV6B 3MAHA 1DARA 5K20B 3K5MA 1CJUB 2E7WA 3PJ9A 4CLWA 2VFTA 5HMXA 5J2MA 2CNLB 2VASA 3CDUA 4IG3B 1UA0A 2OLWA 3MDFA 1BXNA 2WB1D 4ECWA 2CQ1A 2BE2B 3AXKA 3CDEA 5B7WA 1TUWA 1LKZA 2WVBA 3AD8C 4HI2A 4QJVA 4F4XA 5L9NA 2XGPA 2KT2A 4KGMA 3KK3B 1B99A 1AW0A 2DH7A 3GB0A 5THWA 1HR0F 1JMTA 2P9GA 2XLIA 2BRLA 3KUHA 4KFBA 4MYTA 1HI8A 3HDSA 1VRUB 4RUAA 2E1RA 2HHWA 1S1WB 2PMHA 1FRJA 3I0SA 5KFTA 1H2UX 3PFEA 3THTA 1RAGB 2QO3A 1UJ6A 2V94A 1Y11A 4B3SF 1M1HA 1P8GA 1RT7A 1XNQF 4AL6A 2AMCB 4RWXA 4DI6A 5IT4A 2W4CA 3H2UB 3OTBA 4A46A 5HO4A 4C98A 4PWWA 1HW8A 4NLPA 1SC3B 1IXKA 2J0WA 4LF8F 1EARA 3IG1B 4RO0A 3EXCX 4DPYA 1N36F 2DHAA 3NGTA 3G6ES 1XMBA 1NZ8A 1VR6A 3ISND 4WIIA 2QA2A 2QG9B 2FZKB 2D9OA 5KFSA 2BR0A 1HQ2A 3M6UA 5ETOA 2ROPA 2X3DA 1W2IA 4W92B 4K4SA 3BR9A 3QGIA 4PWDB 2XTJP 1LFWA 5HI7A 2RB7A 1Y5LB 4CP5A 1S57A 3U1MA 5KFDA 2VG7B 4WTYA 2EFVA 3MEDB 3R5GA 4CTAB 3HHLD 3D1QA 4DR3F 2KO1A 1YRXA 3JQKA 3MZIA 3VQSA 4EGLA 2NXEA 1DTTB 1SJ3P 1N48A 4OHYA 1Y9OA 1ZAXA 3H0PA 1S1XA 1RT4B 4MIWA 2W9BA 2ZH4A 3CUNA 1WG4A 2KKHA 4QYRA 2DBBA 3I31A 4IFYA 5DZ6A 1U4BA 1Y00A 3UVJA 4URSA 1TUGB 1FJEB 1UMJA 1GMWA 5ETVA 4U7UD 3M8WA 3NWGA 4Q2MA 1NHUA 3CCTA 4YB5A 2RNEA 2YX1A 5MLCV 4DV1F 4BLGA 4RNNA 3O1LA 3W9JA 3GFZA 2XCPA 2IRXA 2HIYA 2XMUA 2ZBPA 4A8WA 3HKWA 1RAAB 3VAHA 2DR5A 4LFCJ 3HT0A 4DSJA 2W2PP 3OBIA 1XIQA 1C4AA 2B8PA 4WFBQ 1TAQA 1UFLA 1YG0A 2RF2B 3OPKA 2XCAA 1BQNB 3UN3A 3W2VA 3U7JA 5I4MA 3OVAA 3SV4A 2YH0A 4E0DA 1XJWB 4OYOA 1D1UA 4M5DA 3FNNA 3H5SA 3G86A 2F63A 2M0GB 2CG4A 2GNKA 5LSRA 1UVKA 2XMMA 4LF8J 1FK9A 5A8KB 4JI1F 1UFWA 5A8WB 3J80U 2V68A 2CJYB 3EDRB 2F8EX 2V6AA 5EHHA 2V2ZA 3IR7B 3G4SS 2LXIA 2WBMA 2ZJRQ 4DV5J 1NEEA 1SIZA 1WELA 2HNZA 3MMAA 2HG4A 2L9WA 4GMKA 4CYUB 3CTRA 5B0FA 3EDQB 2BVZA 3CJKB 1FHTA 3KUEA 1K0VA 1T7PA 1U26A 3DDIA 5J2MB 2C3UA 4WFAQ 2WOMA 2B4PA 3OD2A 1TR0A 2CXEA 4MK9A 5A8RA 2ZH6A 1NSKL 2KDOA 2HQFA 1W7WA 2BQRA 2XG8A 3FSYA 2OJ3A 2EVZA 4DV2F 4A8YA 2I6WA 2JZ5A 4NXNF 3FCWA 4JI8J 4ECVA 3H2VE 2FLOA 3IA0A 1WI8A 2BACA 2KM8C 1FCAA 1JLGA 3BEGB 2E44A 2CZ9A 4PKDB 5K8OA 1TK0A 4CQ1A 4DL7A 3UNGC 5K8PA 3AA9A 3TYTA 5K8MA 2B9EA 3IWXA 1JXVA 4AXIA 5HBMB 4TY9A 1L5UA 3GYGA 5KG6A 3BJYA 2RQKA 4RWWA 5ETQA 5HJXA 5BYRA 1Q0NA 3FQKA 3N5BA 2M8HA 5KG2A 2HHPA 1RHMB 4TLQA 3MCMA 2GCFA 2GO8A 2V2QA 4KE5A 3NGRA 5E33A 4DR5J 4ED1A 4DS5A 3MOJB 5DLGA 5J1EA 1NXIA 3MPWA 2MQNA 4NX9A 4F7VA 2ASJA 2PFFB 1AYEA 2DB1A 3NS7B 3DM2A 1WC3A 4YR0A 1N0VC 2DNQA 5ETKA 3FZBA 3MMCA 2BV3A 1VFJA 3IG1A 2V4QA 4X64J 2OTJS 3HLUA 1IBKF 4JI5J 1KLMB 5J2PA 3JXOA 1VLOA 3EVWA 4YQWA 3Q86A 5AJ3J 4RW6A 1TQLA 3Q2SC 2DJWA 1VJWA 3BM7A 2GQQA 1TL5A 3QO9A 2GS8A 1FRHA 1SJRA 2QEXS 1QDUB 3NGKA 4PABA 1WTBA 2HZVA 3KHLA 2F9DA 4ZKAA 3DFEA 5E5NA 1S7IA 1PKUA 4ZVSB 3AH6A 5CA5A 2XO7A 1EAYC 1FNXH 1C1BA 1CS4B 1REVB 1XN9A 1RU1A 1SI9A 1DTTA 1CJTA 1HBMA 3NCQA 4UOGA 3FC9A 2IPOB 3BGFA 3TAPA 2JEJA 2E1MC 4FXWA 2GHWA 5KT2A 4CH1A 4UY85 3RR7A 2Y1LB 1LW2B 4HDGA 1YZ6A 2DCUB 2DGTA 4O4RA 3R7NB 4RUCA 3PX0A 1IM6A 4A8SA 3CGIA 4XTTA 3CJ5A 2Z30B 3K17A 4DUTA 2V4JB 3PVXA 4F4KA 4OZ2A 1X5TA 2HNDB 4AD6A 3AODA 1CC7A 4P2SA 4OMFG 3R9LA 1EQMA 1ZM3A 3HVTB 2E1PA 2B51A 1SVDA 4OI2A 2FDNA 2QMUB 1FDAA 2Z57B 3RUBL 3Q2TC 1T8EA 2XHWA 3KK3A 1S9FA 4FZVA 4NA2A 2HK3A 2LA6A 3N6MA 2FY1A 2R2TA 2GC8A 1F9FA 2B3TB 3HHLA 3M30B 3GILA 3N6NA 2UXBF 3KTQA 5D0RA 2PMZD 1EP4B 3QT7A 4HH0A 4PQAA 4X4NA 1PJ5A 4RUBA 2XY5A 1N0UA 1NO8A 2POKA 3BDEA 5E3AA 3EGWB 1HWLA 4ES3A 4QWCA 3VAIA 4GKKJ 2K8GA 1NJWA 5D3GA 3CC4S 2HFSA 3VVTA 4F4YA 2HSEB 2E9ZA 5LMUJ 4C4WA 3CD5A 1RT2B 1V3SA 4CYUA 1VC5A 4LF2A 3PX6A 3BR8A 1B0VA 4DHVA 2VBXA 3I87A 1RKJA 2LMIA 2IBKA 1KTQA 3OFEA 3V4MA 1VDHA 2DNNA 3NG8A 3AY0A 2VBZA 3LOUA 4LSNB 3I9V9 1S1VB 3HPOA 5ETTA 4CLKA 2H5EA 4LFAF 4F2SA 1KWMA 5KFGA 2CFXA 5IT0A 2OH2A 4OYMA 3C6TA 4UQGA 2K2PA 2BW7A 2CWXA 3QAUA 2FHOB 2KVQE 3G8QA 1SCJB 4GC7A 4DL0C 2EW9A 4C3LA 4IQXA 4ZJOA 3WX4A 2QMWA 1DRZA 1R0BG 1XWLA 1T03A 1WDDA 4ID8A 2A1BA 4LQ3A 4N76A 4FYDA 2VOOA 3OR2A 2FPHX 2XMJA 4ZHRB 1UVLA 2QFJA 1SL0A 1DQAA 4H4KA 2KT5A 2UXDJ 3K59A 1FKPA 4UOHA 2VC0A 1U09A 3DRPA 2PFDA 1QUVA 2C3OA 3UVJB 1KFSA 1RWPB 4P75A 3RG6A 3ZO7A 1VBZA 1VQKS 1UP1A 2BXJA 2K3KA 2DNOA 2VKZG 3ZTOA 5GVQA 5J2QB 2AW0A 1TKDA 5EUHA 1LWXA 3PIPQ 1IN0A 4ES2A 2Y0BB 4ZVPB 2W7OA 5JVHQ 3JYTB 1F5CA 5EWFA 4RBTA 1SUQA 4QQBA 1U1RA 1N32F 2O01C 3RB6A 2KFZA 3ZTRA 2YWGA 3GZ7A 4AQYF 4KGXB 1S77D 2CJ9A 2W2OP 2B5JB 5J1NA 1RT3A 2VHGA 1WUUA 2GHVC 4ZCMA 2D9PA 4URQU 2RH3A 4M5DB 4DFJA 4QBUA 2FUG9 4ILRA 4J5OA 1KLNA 1ZH5A 2MKYA 5LJ5Y 4TY8B 3BQ1A 3OTOF 3BKUA 3FFIB 1DZ5A 3HHEA 5KG0A 1LXNA 2EK6A 5BJRA 3JSMA 4RL1A 3D2WA 3D67A 5CYMA 5KFXA 2NR0A 4ANEA 2LDYA 1NKCA 2IJFA 5DGAA 2XYPB 2W8KA 3D5MA 1BE4A 1S6PA 3H5YA 1IBCB 3MI7X 2HNZB 3IWNC 4ZPTR 3PHTA 1Q53A 2WW4A 5LT5A 1Q86T 2P9CA 2Q6CA 2FLNA 1IJFB 1D3WA 1TVRB 2IC3A 2HRUA 3HJVA 3BSCA 3I5CA 4R25A 3UDVA 3OW2R 2AGPA 1S9EA 2DNRA 2HPUA 2HZCA 1AXQA 2DO0A 3QGHA 3ILJA 4OYZA 3H4BA 2W9CA 1M1GA 3WC2A 1YJUA 5HN0A 5EWGA 3IP0A 4IOCQ 1V6HA 4Z7YA 1FEEA 3AT1B 4FDFA 1VOMA 1IKWB 5FIIA 4EYHB 1FT8A 3P49B 5HLFA 3HFKA 4DDFA 4JI3F 4CWBA 1WNEA 3KNAA 1UEKA 2NXNA 2LQBA 2DTJA 1TL7A 2MZSA 3DOLB 4D3GA 1VRUA 2PD1A 3FVYA 4NI2B 3RGIA 2V4RA 2CPEA 2ZBQA 4U67Q 4C9DA 4ED6A 1F9HA 3CJRA 4LVNP 3NNCA 5DDRC 2RJZA 4ZPCA 2VJVA 4A8KA 2HW3A 4JI8F 1BMQB 2CPJA 3BN7A 1MROB 1S72S 5KFJA 4AQYJ 5BYSA 5B08A 4LIWA 3CMES 3GG0A 3MAAB 1IKYB 3CT9A 3TUJC 3Q8RB 4M95A 1RTJB 2KG1A 3RYLA 4FPIA 1HBUA 2XQCA 1FERA 1Y4ZB 1FD2A 2IHR1 3DLJA 1KLMA 3SQGB 4H4OA 5J2PB 1NK5A 4BS2A 4TKTA 4RW6B 4KHPJ 3ZZRA 4RW9A 3QZ7A 4NLDA 3TVYA 3IRWP 1QD1A 2GO9A 2LEAA 2O1PA 4GVBA 5HANA 2NUHA 2EC2A 3UDEA 4DV7F 2HQ3A 3P6YC 2W4DA 3ENQA 4LR7A 1S7HA 4UW2A 2GGPA 2KHDA 2YKAA 4CLPA 2HMIA 2MQMA 4OV1A 2XLKA 3IXQA 3PCOB 3QATA 3H7HB 3T5LA 4O3QA 1IBMF 2N3LA 2YWKA 1IQZA 4OZNA 3ZZPA 4P6QA 2NXCA 4QWDA 2HLUA 4TYAA 3BDPA 1R6YA 1UW4A 1RQ0A 4R8UA 4C11A 1R8AA 4EMDA 3J81j 2F1FA 3PZPA 4ZVUB 1KEKA 5E3CA 3AA8A 1NSQA 1RTHB 4MFBA 1VS3A 3MUVP 3TEHB 1IR1A 2JC0A 1OS5A 1PC5A 3CEDA 2YNFA 5DG9A 2FHJD 1GQEA 4OI6A 2ZITA 1DHMA 2VPWB 1U1NA 2DYAA 2BKNA 3ENAA 1JLBA 2VFSA 5CCMA 2FVPA 3EPIA 4FXDA 3QFHA 4JYAJ 1Y5NB 2JEGA 4DR2F 5L39A 2DGVA 3GV7B 2CPYA 4ZVTB 5IQ6A 2E29A 2W24A 3LALA 2ACYA 4DQPA 2MLYA 1VHIA 3G9CA 1FJGJ 1L3VA 5HMZA 2JOQA 2J9DA 2B5JA 2QN6B 1HNXF 3KOAA 4PYAA 3VCDA 2N4DA 1JLAB 3GR1A 3IBFB 2R7QA 5FLXU 2UP1A 4DCOB 3I6PA 1U7LA 2WSEC 3EVOA 4DX5A 1JLCB 2DNZA 2H5JB 2MLZA 4JB8B 2KU7A 4DUZF 5F9NA 1HNWF 2JHEA 2YX7A 4K5SA 3JSMB 1VQ5S 2HK2A 4PPDA 1SC1B 1TMMA 3R5CA 4M5LA 4OX6A 1X4HA 4OYAA 1TL3B 1FXDA 1HI1A 2A0FB 3FEYB 2IAJA 2WHOA 4HHUA 3GLJA 3QZ8A 2JLEA 3PRVA 1LWCA 3D28A 4CIOA 4YUDA 3CCSS 3R6LB 3SMZA 4N5SA 2G13A 2UV8G 3BGRA 2X1AA 1M5SA 3KLEA 3DC2A 1TMJA 2XMKA 3D3BJ 3W66A 2IC3B 2GV1A 1UJ5A 2AEMA 2MMYA 2GIRA 4M5MA 4PUOA 4LT6A 4N41A 1Q5YA 1XBWA 4HL9A 3HSGA 2R8GA 2DNMA 2HBRB 2V63A 5A6WA 1SC6A 3SIPB 3MFHA 1L3KA 2MQ8A 5DM7Q 4MKAA 4MAKA 1YJNS 2NS1B 3IAM9 3TW0A 1VHFA 1LK7A 1KHWA 2W9AA 4WPAA 2HAIA 3R27A 1SKSA 3UR0A 1VJQA 1XNRJ 4PWDA 4IRKA 2ASLA 2AHOB 4C7QA 1SL2A 2PA8D 4IYQA 3B4DA 4F8RA 2IDEA 4IR9A 1KQKA 2R7SA 4FPRA 2U2FA 3HO1A 2K06A 1B64A 4KJIA 2KT3A 3WC0A 3MR7A 2Z0GA 1IJEB 2C2OB 2B9YA 2BOPA 2V2KA 2XMVA 3ZZYA 4B3TF 3MM9A 3RAMA 2VODA 2KZZA 2X3GA 3NKYA 1TUVA 4H4MB 3NS6A 3TO8A 1S97A 2XSJA 4B02A 3MPDA 4I4BA 2CQIA 3NL0A 1P9QC 4P2MA 1IQTA 4ECTA 2WAQD 4JI6J 2ATLA 5AE2A 4FF4A 3RB0A 1WF0A 3D6FB 3E51A 2E66A 2MQQA 1S4FA 1XMOJ 1T05A 2ZEJA 3AFGA 1WDTA 1JWWA 1SKUB 2R7WA 3CDBA 3WZ0A 3ISZA 2CNNB 2JEIA 4LR9A 4FYWB 1XR5A 3TANA 3OT9A 5I3PA 2PT0A 3NY0A 4W4MA 4DBQA 1NDKA 2R7TA 1HBOA 4I64A 3FSIA 4CNZA 1UWBA 2DISA 4P71A 3OV7A 1MMNA 3SSQA 1UVIA 2G0IA 4WZQA 3MM8A 4BBYA 2VDHA 5A0YB 2RD5C 3ADAC 2V8DA 3QT6A 3TOQA 4JI4J 2OPPB 2FC8A 1L3SA 4NLOA 2YNHA 2FZGB 2VICA 4U7CA 2N4CA 2F7VA 4PAAA 2QA4G 5LXRA 1X4DA 2MZTA 4HTJA 1RAEB 3D0IE 3VQTA 2B9WA 2ASDA 4C8LA 2NPFA 4DSFA 2QLFB 1JLBB 3M6XA 4YN3B 1AUDA 3R5AA 2ZOGA 2HGNA 1S9EB 2VF3A 5D0EA 3PRBA 5GAHU 3BSOA 3MEKA 1RBAA 1BUXA 2ZC3A 4R0JA 4ANDA 2W01A 3HVTA 1GTEA 1S6QB 3U27A 6FDRA 1JLFA 2OPQA 2QC3A 2CPXA 2CQHA 2QRRA 3QRQA 1JKHB 1WHWA 3HVAA 2CPZA 3A4TA 4N8OA 3E01A 3H8YA 3DRRA 1SXLA 1HNVA 1YSJA 1UL3A 3MPUB 1K1SA 2EBEA 1Z4UA 2DPJA 4ZS6A 5KFOA 3OTDA 3ZTSA 5HLFB 4FBTA 2YKOA 2HYIB 3CC7S 1ZOTA 1HHQA 4PCQA 4ELVA 4JI6F 1QTNB 3MM7B 4ZCLA 4Y2AA 1VIOA 3LQVA 3SV3A 2E5HA 1IKXA 2A2CA 1QM9A 1RACB 2IAJB 4WF9Q 1YK9A 2XEXA 1TKTA 1URRA 3M2RB 4TU7A 2NCKL 1T9TA 2UVUA 3UWTA 4ILLA 3B54A 3M8YA 3HXMA 1KRPA 1NAQA 4KGKA 2L08A 3ZC4A 1S1UB 1BY9A 2B4OA 1VQPS 3KJVA 5EGYA 4C0BA 5CD4A 2VBYA 5KT7A 3GSIA 2OD6A 3KLHA 2DR7A 1N5QA 1RAHB 2UU9F 4QU7A 2FHKA 1CVJA 4MK8A 4K4VA 1B0TA 3D68A 4L3KA 1A0OB 1NUEA 2CQ4A 3K5PA 3MECB 4OI4A 1ZM2A 4CH7A 1PAEX 1OQ6A 2LEBA 4ZCIA 3L95X 4CLUA 4DL2A 1FFWB 4LSZB 1D9FA 3KXDA 4JV2A 3R2CJ 2C2MB 4OI3A 1H73A 3OTEA 5LJ3Y 4NA3A 4NCAA 1T3OA 3GFHA 2E5LJ 2WTFA 3RRHA 3T1HJ 1T03B 1NK6A 2XS5A 5IT9U 2AF6A 1IWGA 2FTRA 2PMWA 1Z2LA 1QAJA 1FKOB 2MTLA 3QGGA 1RCOB 3F56A 1UTAA 2CQCA 1HQUB 4ENOA 5J1PA 2VOPA 2BJDA 3OUYB 1YJ7A 3OFFA 4IO1A 2E7VA 2P2CB 4DV7J 5F0UA 3SEOA 1P1LA 2HURA 3MXHP 3W8PA 4OV6A 4NLQA 2OEJA 4NE9C 1EKRA 1YKWA 3QWPA 3H42A 1FFGB 1DJ0A 1KQGB 1SJQA 3R5DA 4IKAA 1PAUB 1R31A 2HAFA 4LRBA 5LMNF 4DPWA 2K7KA 3K5NA 1T05B 1SIWB 3UN2A 1O5JA 1VCTA 2Q3PA 3L4BC 2DNKA 1V3RA 1SUQB 2JX2A 2RVJA 2V67A 3AOCA 3WX8A 3MR3A 2RSQA 5HQ8A 1WWHA 1WF1A 3M8PB 1LWFB 1M1KT 5C24B 1O6XA 4F3QA 5KFRA 1PBAA 1SV5B 4ED4A 4F04B 1BD6A 4DN0A 4RNMA 2CG8A 2KJWA 2RHQB 2XMTA 5IC4B 1EP4A 4DLEA 1YJRA 3FFIA 4KGZB 3RB4A 1NKEA 1ZAVA 2HGMA 4DS4A 1HYSA 4MIAA 4ICLA 4OYIA 1GK8A 2K1RA 1XQIA 5E3PA 1PSDA 2CJQA 5T7LA 3JAMY 2X7IA 3DU6A 3KYLA 2DXFA 1LWCB 3JSYA 1RT2A 1GMWD 2EFNA 4U9RA 1HPZB 4XDCA 5G0RB 4ZDNA 5ITHA 3FBFA 4X66F 1OSCA 3T5HA 4B9VA 2Y9HA 1C4CA 2IRYA 3DGPA 1TKZA 1PGZA 1Y0HA 3N79A 1VGYA 2CJXB 3V6JA 2GMLA 1PBUA 1F5AA
chains in the Genus database with same CATH topology
3D0HE 2CVIA 2RRNA 4ID5B 5I3QA 4DL4A 1XEZA 3UCUP 4DSKA 3E8OA 1JLFB 2OPQB 5A2QY 3MM5B 3G6XA 3OQ2A 2LEPA 3PRDA 2W9CB 3TRGA 5DM6Q 1YIJS 4DX8H 1SKRA 1PC4A 3QMQA 3NP5A 4DL3A 3DLLQ 4LF7F 2MZJA 4JI7F 2AJ4A 2B7CB 3MEGB 2P5VA 4RW4A 2KZMA 5M2RA 3OVBA 1H7XA 1S49A 4ZVEA 4ZCKA 3MM9B 3PNIA 2ZUGA 3LP1B 1S0OA 3DRYA 4RBUA 4ED3A 4BC9A 2UUWA 2BANA 4WK1A 4B9MA 2L9DA 2IJNA 4OZJA 1NJIT 1VIXA 4F2RA 2W7PA 2D41A 1N6QA 1RTDA 3DLEA 4IRCA 1UVMA 4YHHF 1H0HB 1RTIA 2EFQA 2FGOA 2K3IA 3PY8A 1NKBA 1JLEA 1G3OA 3O5TB 3ZZ0A 5F41A 4F02A 3MHYA 4K4WA 1I6JA 3LP0A 5F8GA 2JC1A 1JXEA 4YB6A 2BDPA 5C25B 1QAYA 4B9TA 1H3DA 1SJ4P 4A4JA 1FDDA 2A3JA 3B8HA 3KG4A 3NBPB 4QR0A 5D4PA 4O23A 2J6UA 5F3ZA 3M2VA 2P6SA 4TQRA 4C11B 1FJGF 1SH3A 1YWXA 1RT4A 2VPZB 4QWEA 4QWAA 3CCES 4A48A 3UCZP 3I82A 1X7VA 2ZDOA 2AJQA 1VQ9S 1B0PA 2UV8A 2Q43A 4OX8A 1NK7A 5K14B 1TVRA 4FXVA 1WG5A 5AXKA 4E98A 4QZVB 3DDKA 5J2NB 4F67A 2RT3A 2HRYA 2MZ1A 3NNAA 3Q8QB 1M5OC 3V6DB 1WEZA 2FLPA 1NJZA 3OL8A 3UDLA 3AB4B 4NLWA 2C2EA 2DITA 3AQOA 2MY7A 4K4ZA 2N82B 4DQRA 1BC6A 4DSIA 4RW7B 3VAMA 2AQ4A 1N54B 4KFBB 4ZPDA 2FVRA 3KNGA 1HYSB 1RT1B 3DLKA 3I5AA 3BO3A 1HARA 3N0VA 2GMJA 4JOUA 4TXSA 5T7LB 4F3OA 3OHBA 2DHXA 3P5TL 5CD4H 1DQ8A 1Q8BA 4WFYA 5KT4A 4JV1A 2CZVC 1FDBA 1Q16B 1NZAA 1IKYA 1A6LA 1S1UA 5K5MA 2IM2A 3GIJA 3IS9B 4YY3F 1HBUB 2A10A 3BQ2A 2AGQA 3RR8A 1RI7A 4PXDA 4JI2F 5CZXA 2B4VA 2IVFB 3Q24A 3MECA 4NLUA 1KTVA 2ZJQQ 2IM3A 2HGLA 1RYSA 2M70A 2V9WA 3BB5A 2NZ4A 2HMIB 3GV8B 4OJ3A 3OJSA 2CRLA 2XMWA 3LO3A 3MEDA 1O8BA 5HBMA 2PI4A 1YRTA 4KTQA 1UEVA 2YX4A 1Q79A 2WK4A 3H40A 3J7A1 1B7FA 4X2BA 2D7SA 4YR3A 4ATNA 3FCHA 4X4PA 5J1EB 1N5YA 2B6AA 2ZBIA 3V6HA 1MU2A 5F9LA 2ZOMA 5IM0B 1U47A 2FJDB 4O44B 3TA2A 3C8YA 1JLQB 1TL4A 1YRUA 2RF2A 4CI0B 1U1MA 2GX8A 3HVWA 1U1OA 3PV8A 1LWFA 4OHXA 2HNYA 2DCLA 1ULRA 3IBWA 3R1LA 1JLAA 2M8DB 1K0TA 4ELTA 2GQ2A 2C42A 2JEFA 5BR8F 2PE8A 1TZ0A 1GTHA 5KFEA 3SXLA 2IVMA 2J9DE 2FJVA 5A8WA 5D77A 3UR3C 2NXUA 4RW8A 2QLXA 4IO9Q 1TL3A 4XPEA 5EN1A 4DFPA 1GH8A 5KT5A 5KFZA 2CJBA 2VONA 2YNIA 2UUBF 4Q7AA 1U24A 3O6QA 2LQJA 3B82A 5CYJA 4KB7A 1YGYA 5K14A 4IR1A 1R8HA 1FNMA 4RU9A 2HHUA 4AL7A 1VQ7S 3JTNA 4PXEA 2U1AA 3FSXA 2MHNA 2RUGA 1U8SA 3CDAA 3UFCX 2LVWA 3VR1A 3QIPB 3F44A 3SSRA 4AYBD 3HZGA 3K8WA 4KRWA 1ZM9A 3BGUA 2RQMA 1OPIA 1BLUA 3POTA 5D4NA 4N56A 3ENWA 3PKYA 2QSWA 3VALA 3V81B 5F8MA 1G1XA 2MJNA 5GAEI 3HVRA 1VQNS 2M5YA 2DVIA 3H4DA 3EXYA 2EKYA 1NB7A 2CQGA 4O4GA 4ECYA 3VAKA 3M1VA 3MMCB 2GW8A 1UJ4A 3IS9A 4QIGA 3T9ZA 3DMJB 4IH5A 1WHXA 5C5JA 2DT9A 3TAQA 1U2FA 2BZ2A 4NA1A 1NJXA 3GR0A 4X62F 2I8EA 3SCKE 1KN6A 4DR6F 4MKBA 1GXUA 3T1YF 4M1KA 3AJ2A 2C28A 2WRMA 4UOCA 1K1QA 2BJEA 2EWHA 4RZRA 1RK8A 2J5AA 2VKRA 2YQ3A 3NNHA 1U2RA 4CZCA 1X0FA 4F25A 4ZA1A 1S10A 2RRBA 4IDKA 1QJHA 1BQXA 1GT8A 3LH2S 4EU0A 1O51A 4X4RA 3MMBB 2RIJA 4ERDA 1SJFA 4KV8A 4WKRA 5F8LA 1FRXA 2J9CA 5J2QA 1TV6A 3DCAA 5G4DA 1APSA 3G6VA 1GNKA 3Q23A 2CQPA 4U7UK 2BYCA 2ZH5A 4IG3A 4ZPBA 4QR1A 3KLIA 4Q45A 1X5SA 4C2MA 3PW5A 1DTQB 3OL9A 2R8KA 4LJMA 1JK9B 4RW7A 2CVEA 1TFWA 4JBCA 5IFMA 4ZPWR 1S99A 4J9QA 5KFKA 2IMWP 2MKSA 3LGNA 5B0BA 4WFNQ 2HLTA 2MYFA 1M5HA 2DGWA 3I0SB 1WF2A 1H2VZ 2MJUA 1HHTP 4NPOA 2CPHA 3MF5A 5IS2A 4OI0A 1YJTA 4RNHA 2M52A 3TNVA 1FRIA 2ZH7A 1HPZA 1WEXA 1J5OB 4OZ0A 1LXJA 1G7CB 2PC6A 4J9LA 5M2UA 1FD8A 2IM1A 1TP7A 1Q8IA 2CKWA 2EG2A 4I6AA 4DUYF 1SL1A 3HP6A 4A8FA 1TKXB 2WOMB 3O3LA 3KMSA 3J81Y 1KFDA 3HJFA 4NWBA 5D78A 5T41A 1UVNA 3T5KA 1VRTA 3SFUA 5LMUF 1T3NA 1MWYA 5A6PA 4IH7A 3K0JA 3POTB 3R1HA 3I4HX 1GXTA 1X5OA 3NMAA 2KYXA 3OJUA 2C3PA 5KFFA 1R89A 4WE1B 5AXLA 2PA3A 2KM8B 4RLEA 1H6KX 5GADI 3QGPA 1LFPA 1SJ1A 2J7KA 3DRPB 2XS2A 1S1XB 3N4WA 2W9BB 4C8KA 1MU2B 3L7OA 4YB7A 3CCJS 4QCLA 3FMBA 2NSBA 1WHYA 3QJLA 4O3SA 4KBIA 1Y3KA 2ZH1A 1C1CA 4A8MP 4CT8A 4U6PA 1JLQA 3NAHA 3K8VA 1ZYQA 1WI6A 2V9KA 3NMRA 3P96A 3IN5A 1JLEB 2YKNA 4DQIA 3QAEA 3MR2A 1IR0A 4KIAA 2B56A 3AQPA 2GGPB 4Q8FA 4OQJA 3HX9A 3CSKA 1QE1B 4NLVA 4I56A 4USHA 5EWEA 3RTVA 2JFDA 4ECZA 4DLGA 1RP5A 4AXJA 2XLJA 5K8NA 3M8SA 2M4MA 4TYBA 4EZ6A 2OSRA 2ALZA 4FS2A 4LIRA 2Z2MA 1UETA 1AROP 1E6YA 2ILYA 2VC1A 3KK2B 3EYZA 1U6BA 5F8JA 1S9GA 4ILMA 1S6PB 4OHZA 2LKZA 3H5XA 4EBEA 4K0KF 4JV5F 2RDIA 1WHVA 4FP9A 5DJBA 4FVCA 2R9LA 3TUIC 3MMBA 5JJBA 4IH6A 4ECXA 3NCRA 2E5LF 3KK1B 4NLYA 5GAEU 2L41A 4F3MA 2DIVA 2BBEA 3GYXB 5DETA 3GV5B 3J80Y 2BW2A 1JXLA 4OLOA 3CULA 4ECQA 1RT6B 4OJHA 4WU3A 2ZHAA 2QIFA 2FIUA 2Q66A 4PRFA 3G6YA 3C2PA 2MKCA 3H20A 4FF2A 3HHDA 4USJC 3RU0A 2CPDA 1HHSA 3OHAA 5I3UB 3S6EA 2J6SA 4LF4F 5F8NA 3OXFA 5HP1B 2C3YA 2KB2A 4I6YA 4CO2A 3ICLA 3CD7A 4LFCF 2E1AA 3DLKB 3V81A 3NAIA 3MEGA 4RW4B 5D3GB 3K58A 1Q4RA 2KRBA 5AXMA 1QAIA 4B9UA 4RNOA 1I1GA 1OPZA 1MROA 2P6TA 4CO4A 2R8HA 2GJIA 1U4BA 4Q8EA 2HFZA 1Q78A 4E8UA 1UKUA 2ZM6F 4O4GB 1FVSA 4XO0A 3LUYA 1R8BA 1XR6A 3S7RA 2APOA 5DDOC 3J7Z5 4OZ1A 2BANB 1HBNB 2CQ0A 3MD1A 3SQGA 3I0RB 5FDLB 5KFIA 3TP2A 4A8QA 3D0GE 5AXNA 4FNIA 1F5BA 3C6TB 4HT5A 3F73A 4JI0F 3LP0B 3G71S 2YY3A 4A8OA 2MSTA 1A9NB 3ENVA 5KFCA 4KSEB 4Z37A 2YKPA 3ETOA 2J0SD 1MWZA 2R8JA 2MGZB 4C3MA 2M88A 2RQCA 3M2VB 2FJXA 3MCSA 2C2RA 2KXFA 2VZ9A 4DEZA 3NGDA 1Z1ZA 4OHVA 4TU9A 3MD3A 3GE9A 2QZ8A 3K7RA 3CO9A 1RWUA 4ZP9A 4B9NA 4DV4F 2B9XA 2LXUA 4PQUB 1NK4A 3HHNB 2DH8A 2ZE2B 2YWEA 4LF6F 3AB2B 1U1PA 2PSZA 1YQHA 3NS5A 4ED2A 3M8QA 3MM6B 4KR0B 5HL7Q 1DTQA 2FVQA 1A7GE 2UVVA 1DBDA 3RRKA 3N28A 4ITSA 2VA3A 1PO6A 5D4LA 3CDWA 5KG3A 4D3HA 2HFOA 3CCVS 5L1IA 4NL5A 2VA2A 4IQMA 1Q81T 1VK3A 1HNZF 3B4MA 2DNPA 1KS2A 2YKMB 2OKQA 3IFEA 5CYMB 3KK2A 4F50A 2JH3A 2KH9A 3MTKA 2GQCA 2LYVA 2JSXA 2VH7A 2ZD1B 3DLGA 3OFGA 1U1KA 2OMOA 4ZVFA 4K4YA 1J5OA 3T5JA 4A47A 3M2UA 3ZZOA 1P6TA 3IO1A 2J6TA 4DQSA 3I5BA 3M4XA 3A8EA 3DN9A 3N01A 3WDOA 5KFHA 2HHVA 2E9TA 3SDEB 3C6UA 3ZZUA 5H9EJ 4B3OB 2E5GA 2XWXA 4DQQA 4I2QB 5KFYA 2CQBA 2M2BA 1VRTB 4BC7A 4X4SA 1N8RT 4Q2LA 2W4PA 3QLHA 2RS2A 1HNVB 2B7BB 3G96A 4EBDA 2ZVSA 3PX4A 2RRAA 1IKWA 3O2IA 2FB0A 1TL1B 1VLYA 4WFXA 3WBZA 3RAXA 1L3UA 2ZZNA 4GKJF 4HKQA 3GIMA 3HF5A 2X51A 3OLAA 1ZM4A 1F60B 2WONA 3BQ0A 2GMHA 4ZPAA 1LV5A 3L3CA 2I0XA 4ZHRA 1HQEA 4I67A 4XAKA 3LP2A 1X9SA 1G2EA 2FLLA 3EGNA 4P7TA 4B3MF 2DNHA 2O66A 3FZ2A 2CJAA 4XDDA 4PUOB 4H4MA 1ZTTA 4Y34A 3W2WB 1H38A 1JJHA 4OFZA 4LF5F 2C22A 3DRXA 2DNYA 2W7AA 2VBWA 2PO4A 4O44A 2XY7A 1Y7PA 3BF4A 3RAQA 1D8YA 2RMLA 4NLTA 4EFAC 1ZPWX 2FGCA 3IGVA 4IFVB 5DG7A 5KFPA 5L8RC 3JTPA 4NYPA 1CC8A 4OI1A 1GX5A 2IM0A 1P1TA 4QW8A 5KFMA 2MXYA 4J9PA 4DV5F 2V5HG 4WXOA 4RKUC 1QE1A 1VQ6S 3PR5B 1YJ9S 3SCIE 2DR8A 3DI6B 4Y00A 1CG2A 1YI2S 5DLFA 2E5IA 3HKZD 1E6VA 5A0YA 2V0NA 1JIHA 1HQUA 1N5VA 4WXWA 4DJBA 5KFLA 2BQUA 4O3NA 3TVKA 3KFWX 4CO1A 5CZVA 2NPIA 3OFHA 4IFYB 3IRXB 4B9SA 1FVQA 3OR1A 5B0GA 4RUHA 5AE1A 5KFNA 4TU8A 3KK1A 4FF3A 3NLCA 3VZIA 3ZZZA 5ADZA 4I0WA 1NU4A 2NYIA 2QV6A 3FQLA 1AFIA 4G1QA 4O3OA 1LWEA 1JKHA 4C3KA 3DRRB 5F8HA 3OVSA 4M8LA 2CQDA 3QIPA 2ZKTA 3AJ1A 5I3UA 3MPVA 1KD1T 2N7YA 1N5SA 3DYAB 4TNOA 3OL7A 4X4TA 5IXUA 4X64F 3CF5Q 2LU1A 3DLHA 2HFNA 5CQGA 1C0TA 2KI2A 4QIWD 2K7JA 3W7BA 2P9EA 2ZHBA 3RW6A 3T6BA 2ZD1A 3CE8A 3DLGB 5KOXA 4DMZA 4RNFA 1M5VC 1SKWA 3CCMS 2JVRA 3OLBA 1WACA 2RILA 2QE5A 1DAXA 1GXLA 2M7SA</