5A6WA

Complex of rice blast (magnaporthe oryzae) effector protein avr-pikd with the hma domain of pikp1 from rice (oryza sativa)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
71
Chain Sequence
LKQKIVIKVAMENNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RESISTANCE PROTEIN PIKP-1
publication title Structural basis of pathogen recognition by an integrated HMA domain in a plant NLR immune receptor.
pubmed doi rcsb
source organism Oryza sativa
molecule tags Antiviral protein
total genus 19
structure length 71
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5a6wA00
3VTIA 3CJKB 1X0PA 2LQBA 1V3ZA 1URRA 1FE0A 2OFHX 2RSQA 1GXTA 1VQSA 4A4JA 2HQIA 2N4DA 2OP5A 2XMKA 3BB5A 3HHLD 1APSA 3GZ7A 1TR0A 1AFIA 1CC7A 2GFFA 1W2IA 4EFAC 4FNHA 1SB6A 3FRYA 3HX9A 5B0EA 2QLXA 3TRGA 5B08A 4NPOA 5T7LA 3IWXA 1FESA 2ROPA 2QYCA 1GXUA 2HLUA 2OMOA 1N5VA 3MZIA 4OJGA 2HFNA 2FB0A 3DCAA 4A47A 1LQ9A 2GGPA 4Y2MA 5B0FA 2G9OA 5A6PA 1IUJA 4OJHA 2XMMA 2GO8A 3KKFA 5B0DA 1Y9OA 5K9FA 2GA7A 4F67A 2W4PA 4NL5A 1Q4RA 4OJ1A 1KVIA 1KQKA 1JK9B 2Q3PA 4FNIA 1YRXA 3BGUA 2N7YA 2VV5A 2AJ0A 1OQ3A 2K1RA 5KAKA 1YG0A 2KKHA 1Q53A 2ZDOA 2BJDA 3KG1A 3LGNA 5F0UA 3T9NA 1K0VA 1WD6A 3WDOA 4HL9A 3HF5A 1CPZA 1S6UA 4HI2A 2QIFA 1Y3JA 2KYZA 1XBWA 2BYCA 4Y2KA 2N4CA 2FTRA 2L3MA 3HHLC 3LGMA 5T7LB 3CJKA 2AP6A 3UDCA 1Q8LA 1TUVA 2W4CA 1JWWA 5B09A 2LXFA 2FHMA 2AW0A 2KT2A 2KT3A 1FD8A 2XMWA 4Y2IA 4ZOSA 1SI9A 2PD1A 1TL5A 2OKQA 2K2PA 4DN9A 5B0GA 4OJ3A 2CRLA 2BUNA 2OD6A 1Q8BA 1RJJA 4DL0C 1TZ0A 5B0CA 3KG0A 5F0WA 1FEEA 1FVQA 2GV1A 2HFOA 2K7JA 4A46A 5B0AA 1MWZA 1N5QA 3HHLA 1X8DA 1YJUA 2RMLA 2JDJA 2K7KA 2RU9A 3FGVA 1VQYA 4ZA1A 2XMJA 2K1RB 4OIXA 1YJTA 2AJ1A 2HLTA 2OAUA 1AFJA 1FVSA 1TL4A 3F44A 2IFXA 4HH0A 3TOQA 4HI1A 5A6WA 3QMQA 2IYIA 3BR8A 1YJRA 1FE4A 4A48A 1QUPA 4Q2MA 2ROGA 2XMVA 3FMBA 1OQ6A 1OSDA 2GCFA 2ZDPA 3MCSA 2ACYA 5B0BA 3BM7A 3IWLA 1KVJA 2GGPB 2HIQA 1AW0A 1S6OA 3HFKA 2IYGA 2BJEA 2LDIA 1N5TA 1YJVA 3QGPA 3TNVA 3BF4A 1U7LA 3KNGA 4U9RA 2VH7A 4QOTA 4Q2LA 1P6TA 2OFGX 3DXSX 3I9ZA 3K7RA 2BBEA 1SQEA 2LQ9A 2W4DA 1N5SA 1R6YA 1MWYA 2PGCA 2QLWA 3HDSA 4HH1A 1X7VA 2RILA 3BN7A 2ROEA 3LO3A 3HHLB 3BDEA 4YDXA 1P8GA 1Y0HA 2FIUA 5IXUA 2OD4A 1ULRA 2ASYA 3E8OA 2EW9A 4DPOA 1Y3KA 4YEAA 1OPZA 2XMUA 2XMTA 1CC8A
chains in the Genus database with same CATH superfamily
3CJKB 1BHNA 3O3LA 4NMLA 4OYOA 4LMZA 5GMEA 2BW7A 5L1KA 1WHWA 4IH6A 4NPOA 3MCMA 4ZHRA 1EP4A 2IVMA 3QWUA 1M5VC 2MB0B 4HTJA 3JXOA 3PX0A 2CA9A 2XGPA 4NOHA 2PA3A 4ECTA 1TKXA 3ITHB 4OZ3A 3VWSA 4B3TJ 1W26A 3KJQB 4C8KA 3RRHA 2RDJA 3W64A 5GMDA 1T3NA 1LK5A 1JKHB 1WEXA 3PIPQ 4F2RA 3GR0A 3OSNA 2WHOA 3MR2A 4C6AA 4CO5A 3VHQA 2HIQA 1LXNA 2W25A 2LECA 1RI7A 2JHEA 4XDDA 1NJZA 3TAMB 3C15A 5L1IA 5DS7A 3NCPA 1AB8A 3O44A 3LTOA 4DR4J 1TUWA 2FJAB 3NNHA 5HK4A 4XIUA 2N82B 1N54B 3F56A 5ETMA 1WNEA 2CG8A 4FVCA 3QFHA 5ETQA 5KT7A 4ZN3A 4X66F 5LSLA 1VQMS 4FYWB 3V4MA 5I3QA 1Q0NA 4DL3A 5F3ZA 1TKDA 2Z8QA 4DX7A 1WEZA 2YX1A 9RUBA 3U27A 5D15A 2KG1A 3MGJA 5CD4H 1OY8A 2E1AA 5HMXA 2VC0A 4KGZB 2CJAA 4AUKA 2FLPA 4PG6A 3J81Y 1N5QA 4PUOA 3NXZA 2E5HA 4QJVA 4WFNQ 1VQ7S 3K59A 2VJVA 2IYIA 1XNQF 2X3DA 3D1HA 5E2QA 4ZVQB 2JVRA 1MU2A 1WACA 4B3RJ 5IOLA 4ANEA 4WU3A 2IMOA 2UUAF 4LJMA 4TQRA 1HI1A 3D6FB 2ADBA 2GIQA 1K47A 2WB4A 3Q8PB 1HD0A 2R2SA 4A4JA 2E1PA 1WC6A 4LRAA 2RUGA 1KNZA 3CULA 2BJ9A 4Q7AA 4IQXA 4P75A 2DNHA 5E3PA 1YSJA 4ZPTR 4YR3A 3GV5B 4QYZK 3U7JA 2ZWPA 3UO0A 4PWUA 4XPCA 3EDRB 4TLRA 3I4PA 4MK7A 5K8NA 5EHHA 3E01A 1KFDA 4DX6A 3KK2B 4ZPWR 2Z2MA 1TUVA 1XEZA 4DV6F 2P6SA 2KT3A 3JB9k 4DSJA 4N41A 1ZZNA 1MN9A 1RT3A 4KGVB 1L3UA 1NDKA 1VQ4S 1F9EB 2CZ9A 4DL5A 3C6UA 4FS1A 5KFEA 3HFKA 3CCJS 3RB4A 5FLXY 3KUHA 5IWAF 1YI2S 1SQEA 1Q7LB 2ZD1A 4WP9A 4C3MA 5ADZA 2LEAA 4DCOB 4WTYA 3EE3A 3TEGA 4PQAA 2UXCJ 1C4CA 1B0PA 2K06A 4MFBB 2DGUA 4DV0J 4CM0A 5B7WA 1M5SA 1ZPWX 2KH9A 1NEEA 1IBCB 3HFZB 5EWEA 1Y00A 1JLFB 3PYFA 1P9YA 2MHNA 4LRBA 5KOWA 4DR6F 1T3OA 2R7UA 4BWMA 2DHHA 4I64A 1IKVA 2J9CA 4N8OA 2B6AB 2YX7A 3NAHA 4QR2A 1FHTA 1NB2A 3DLEB 4ICLB 2UUBF 2QMUB 2IM0A 5LL6d 4FKYA 4X64J 2VU5A 4Q8FA 4DV7J 4JV1A 1Y7PA 1VBXA 2YH0A 2RRNA 1UJ4A 4EZ9A 4UQTA 1OYEA 2I5JB 1CJVB 2B8QA 5IT0A 1SC3B 1HWLA 4MK8A 4C97A 1WI8A 3KNGA 2A2DA 5M2UA 1XIQA 4DF4A 4DQRA 2CQGA 4WFZA 4KJIA 4QIFA 2B7BB 4DPOA 1UPMB 4ED6A 2IA0A 4A8OA 3C3LA 4DU8A 4DV4J 3D0IE 1PGZA 1WEYA 1UVIA 5C42B 3M32B 1BMQB 4WTOB 1KP6A 4ECRA 2FPHX 4RUAA 2VV5A 3OXFA 3KNAA 2GQCA 3FSXA 1RT5B 2LDYA 5IM0B 2AQ4A 5KFPA 2ZH1A 2W2QP 1WG1A 2PD1A 2QA4G 2QE5A 2WBRA 2NUHA 2HPUA 5HP1B 5L9NA 4O23A 4B3SF 1DBDA 2Z0GA 4JI0J 3EVWA 5J1EB 5IV3A 2XNQA 2EBGA 2ZDPA 4QIVA 5BXIA 2VBWA 1CG2A 3FK4A 5ETRA 2ZWOA 4N7TA 5KFLA 3MI7X 4A8KA 3V6DB 3KLIB 3RBXA 2RQKA 2EKNA 1XMBA 1BGXT 1CULA 2XMUA 3GIJA 2LKZA 1MMNA 3ZC4A 3R5JB 3D0HE 8AT1B 2GFFA 3R1LA 2QLXA 1RU1A 2V69A 1YIJS 1RYSA 5KFFA 3M8SA 3K57A 2KRBA 1P9QC 4O4GA 5K8MA 3GCXP 3RB6A 5LMNJ 2DKOB 4BC9A 3LP2A 3HSJA 1KFSA 1GX6A 1CQMA 2W2MP 1JNRB 4RU2A 3FUYA 3I9V9 4H54A 4PWWA 1X31C 4S0MA 1NM2A 4ZIVA 1MWZA 1VC5A 2X1AA 1KDNA 2OHDA 4NCGB 2KXFA 1IKWA 5KFAA 4DV2F 3AFGA 4YB1P 2UV8A 3D2WA 2M52A 4WFXA 1U49A 4X65F 2RIJA 3TP2A 2W1BA 3CD6S 1TKZA 2K8GA 2CWXA 2XTJP 4USHA 4HEA9 1HBMB 2HKEA 3MXHP 3S8SA 4KKOA 3KK1A 4QPXA 3JAMU 3GZ7A 5ETOA 3VQTA 2GZOA 5HJYA 2WOMA 1Q95G 3TAQA 2QSFA 3H4DA 2OPSA 2GA7A 3AH6A 2ZH4A 4KH0B 1S1TA 2V2ZA 1OWXA 2CQBA 1VK3A 2QGFB 4IFYB 1SC4B 1WC3A 4C9DA 2O3DA 2M4MA 4RBUA 4EEYA 5KT4A 2EFNA 1TL1A 3IAS9 4OI3A 1AZSA 4LSNA 4KRWA 2J6TA 2C2DA 3L7PA 4Q8EA 1KOOA 5IT9Y 4HI1A 4K4XA 2KB2A 2RJZA 3JSYA 2VQEF 3POTB 4EU0A 3T1AA 2KL8A 4K50A 2JH3A 4RZRA 4PRFA 5G0RA 3AA8A 3BN7A 2VG5A 3TJ9A 4QCLA 3ELHA 4J9LA 4MYUA 2MKHA 4Z2XA 1HBOA 1VRUB 1JLAA 2POKA 4CO1A 5KFKA 3EX7B 4WFBQ 4CNZA 4WYLA 2MKKA 2W24A 2YNGA 1PC5A 4F8RA 1KQSR 3MM7B 4R25A 3JSBA 4KR0B 4EO8A 4R5PB 1RWNB 3AD8C 2CQ2A 4F4XA 3QIPA 3Q2SC 3DN9A 4ECXA 2JFDA 2IBOA 2F40A 3GYNA 3CIMA 1WC0A 1HPZA 4IFVA 5BYSA 3D3BJ 1ZA2B 4PPZA 1N34J 2QO3A 2D69A 5B0GA 2FC9A 4RW8A 1HNWJ 3CCLS 5J1PA 2XHCA 1W2BR 4O44B 4OIXA 1LV5A 1HWKA 2Q66A 4HDHA 1PJ6A 5CZVA 1OIAA 2BV3A 1B64A 1RAFB 2GS8A 2KN4A 1N5TA 4TN2A 5DLGA 1ZS6A 4OI4A 3KLHB 3FVYA 4LR8A 4OL8A 3GFHA 3I5AA 1RHJB 3PY8A 3MUVP 1Q5YA 3ITHA 1PC4A 4KIAA 1T9VA 3PEJA 3FDSA 3N79A 4DR1J 1HWIA 3BH7B 3KHGA 1JKHA 4OJHA 4P2SA 3QSYB 5KFWA 1Y5LB 2ASJA 3BGUA 1T03A 1YG0A 5FIIA 1S1XB 4I6AA 3BGOP 1U6FA 2DRAA 1S1WB 2GMJA 4FZVA 3DLGB 4Q44A 1UL3A 4CLTA 2XS2A 3ILLA 2QA4S 3D9BA 2ALZA 3TAMA 3QGIA 2YKPA 1ELOA 3IM9A 3PW0A 3CCQS 3QQCD 4IRCA 2BX6A 3NGSA 3FMBA 4QIWD 2XY7A 4FYYB 4KGXB 2BM1A 2DT9A 5AXLA 1D9DA 2AU0A 2ZH6A 3BYRA 4ED1A 2EC2A 1FJEB 4Z7CA 1H3DA 1BUXA 4M94A 1NK9A 2AJQA 1F9HA 1HMVA 2PDAA 2W7OA 2F63A 2PC6A 2ZKUA 2V94A 2PI4A 2B9EA 3UI3A 2UUWA 1WD6A 3WDOA 3GV8B 3FCHA 5GAGI 4NLSA 2BQ3A 1JLEB 3DHXA 3ZTQA 3RAXA 3JSRA 1FK9B 4B9MA 2CPEA 3BO4A 3QWPA 4G6VB 4XDCA 3IWNC 2RMLA 4PQUB 4L3NA 4JV0A 1V9OA 4U7UK 1RWXB 5KTQA 2QLBB 2RS8A 5C24B 2XEXA 2W2OP 1ZM2A 3ZZYA 3M9MB 1M5KC 4TVAB 2BZ2A 5EUHA 2UXDF 2HHWA 2ZM6J 1BQMB 3PZPA 2V5HG 4JOUA 2WONB 2OO4A 2FZGB 4KBIA 3MAQA 3IFEA 1GMUA 3FZ2A 2LLZA 2GO9A 5B0FA 3CF5Q 1S79A 3J81j 3FCVA 2DH8A 1KTQA 4TNOA 2DHAA 2KM8C 4UOCA 3OJUA 3EGWB 1JNZB 2E9RX 1Q81T 2U2FA 4UF4A 2OEMA 4UY85 2AGPA 1EQ0A 4DU7A 1NHUA 2RU3A 4N5SA 1SV5B 3NNAA 4F3OA 1I94F 1F9FA 3OVBA 2LQ8A 3R8YA 3F44A 2IHR1 3BR8A 4MFBA 4H4KA 3I0RB 3GFZA 2AF6A 1FJGF 4LQ9A 3L3CA 3OFFA 3KLEB 3K58A 2RQMA 4NLGA 1JLFA 1BY9A 3SXLA 5KG4A 2DR7A 3DLEA 4JI6J 2VFVA 4ICLA 3C46A 2DNYA 1HR0J 2CUYA 2ZUAA 2HHTA 3VF0B 4FXWA 4K4SA 2KRRA 5ITHA 2BJ7A 2I5JA 2V4JB 3GFYA 3OUYB 2CQHA 5KFVA 4M5HA 3TWZA 1FFSB 1Y11A 4Y2IA 3NY0A 4ILLA 4DZ6A 2M0GB 2YVSA 3VAHA 4ILMA 2RT3A 5THWA 2APOA 2WTFA 3B78A 5KT6A 1IWAA 1D1UA 2CG4A 1R0AB 3T41A 3HZEA 1YJRA 4KHMA 3Q83A 3BBFA 3HHNB 5D4LA 3VAJA 5C42A 3M32A 2MQPA 3LOUA 4DUYJ 3R5CA 5CH7B 2F4FA 4Z37A 1FF2A 4OZNA 2XWYA 2F4VF 1N32J 3DYAB 4IOCQ 3UR3C 4DPYA 2G2OA 1RT5A 4C8YA 4LR7A 1VC6A 3HHLD 2DHXA 1RUSA 2NCKL 5E7OB 3IWXA 5EDWA 1TKTB 1IKXB 3LP0B 5K20B 5J2NB 2RF2A 4ZLJA 1RT1B 3B6BA 2GO8A 3DLLQ 2ZFHA 4OZ1A 4DQSA 2AJ0A 5HP1A 2X1BA 4QU6A 5J2MB 3DKDA 2FLOA 1BQNB 3DNCA 3N6MA 5J1EA 2BKPA 3A1YG 3HHLC 4OV6A 1I3OB 5AE1A 4GO7X 2WZ1A 3GB0A 4RNFA 3CJ3A 3QAUA 1X5PA 3DDIA 4NI2B 2ZVSA 2V8GA 5DG9A 2HVZA 3KLIA 5KG2A 1SC6A 3S01A 2GJIA 4J9MA 2A2CA 3HVWA 1QUPA 2XWXA 2R9LA 3NS6A 4LF8F 2BEFA 4W98A 2D1CA 4KE5A 3DFEA 4XO0A 1FJ7A 1T9TA 1R6YA 2QMWA 3SEOA 4OX9F 4AYBD 4DX5A 1IM6A 3CJQA 4CT8A 2DY1A 1DLOB 1RLCL 1U0HB 2LCWA 5EX0A 4U7UD 2CPJA 3A3NB 4L72B 3CJRA 1N56A 4FP9A 4L73A 3IN5A 4EBEA 2HFSA 1R3NA 3D6MB 1U8WA 3LPEA 2G9OA 1PCAA 3FBBA 2XMMA 1Z4UA 3N6LA 4I69A 3J80U 2CJ9A 3D1QA 4PCQA 4DL2A 4NCGA 2F8EX 2AX1A 3UDVA 2B5JB 4DFMA 5GVQA 1REGX 3OTOF 2RD5C 3VVTA 2EG1A 1R8BA 2IJRA 4ANDA 2BDPA 1WORA 4O3RA 3PKMA 2HVEA 2HW3A 2F8HA 3K5MA 2JFKA 4WP8A 2XO7A 2MQOA 1Q78A 3RBEA 1HBMA 2ERRA 1FI4A 2DR9A 2I38A 3C14B 3HLUA 1OQ6A 2OMLA 3CVKA 4MKVA 3MD1A 2VH7A 2AEFA 4ZJLA 3R5DA 2JEGA 5KG7A 4PABA 4DUZF 1GMWA 3I0SA 4DFKA 1XQIA 2JOQA 4J9QA 3OR2B 2X51A 1KD1T 4IFYA 2OFHX 1PBUA 5HROB 3OD2A 3TAPA 2AHOB 4FNHA 2FJEB 2KVIA 1N33J 4U8YA 2LU1A 2GGPA 2E66A 3PKYA 1Q79A 1CS4B 2YBVA 1J5OB 3MFIA 5KG0A 4PEOA 2N7YA 4LRFA 1KKHA 5HLFA 2GAGC 1IKYB 3ILIA 2N4CA 3POTA 2AJFE 1U0SA 1PO6A 4ENOA 1YJNS 4EI2A 2RUSA 4B3TF 4V19X 1T94A 1Q82T 1MMDA 3NS7B 4J9UE 1VYAA 2CNNB 4M5MA 1VRUA 2XZDB 3D4JA 4HHUA 1RB0A 5K14B 1HFEL 4ZMMA 2LA4A 4RNOA 3Q8QB 3MM7A 5B0BA 4DR7J 4TLQA 5IC4B 2DVIA 2AKWB 4R5PA 1UW4A 1EARA 5KFHA 4AXJA 2H5JB 1DTTB 3ZO7A 5AE2A 4USJC 5IXUA 3BJYA 4YB5A 1P1LA 2Z2LA 2HVHA 3W7BA 2CJKA 1JLCB 4MMOA 3QATA 2NXCA 1U2CA 4I0WA 1N52B 2P8IA 3MPVA 4I68A 3D5MA 1RU2A 4A8FA 4WK1A 4DR4F 1GXUA 4DR2J 4ZP7A 1R7IA 4GKJJ 2K3IA 3KG4A 3W62A 1IBKJ 1ZAXA 2J8SA 3V6HA 2V0NA 4CH7A 4O44A 4CH1A 4AD6A 3NNCA 3K8WA 1I51B 1VGYA 1NDCA 3IR6B 5KFSA 2MMYA 2WAQD 5HN0A 3MPYA 2VG7B 3EVOA 5H9EK 2P2CB 1OYDA 2IJFA 3SDEB 4TU7A 2DJWA 3HMJG 5DGBA 3DC2A 3ONQA 2JL9A 3WBZA 4OI6A 4X84A 3TUIC 3V6JA 1QVGR 2CNOB 1QY7A 4DS4A 2IC3B 5JMNA 1T7PA 4CLYA 1SKUB 3K17A 2HHVA 4ECSA 2WCXA 4PXEA 1G7CB 2PN6A 4BWJA 2MY7A 4B3RF 1SKWA 2KJVA 5HQMA 5EWFA 1TTHB 3MEDA 1S1XA 2XMKA 2YKOA 2L9NA 3L9ZA 4KFBB 5LT5A 1S1WA 2BQRA 2MQQA 4YOEA 1N5VA 1U1RA 5I3PA 4LUBA 5A6PA 2JLGA 2OPPA 4J7CA 4R0JA 2RKIB 2ZBPA 2MZ1A 1WF1A 3PJ9A 1CPZA 5CA5A 2ZZTA 3TUJC 2BE2B 4DQIA 3DGVA 4X4NA 1RWKB 1FDDA 1P1TA 3NMAA 2NUUG 4B9SA 3H5SA 4MIWA 1N4LA 4ZCIA 4WBFA 3UN3A 1UCNA 2ZC3A 3HXMA 3T6JA 3K5PA 1RKJA 1YRTA 4ZPAA 1CSJA 3FBCA 2HK3A 1DZ5A 4DMZA 2XULA 1NCLA 3MM5B 4D3HA 4GKKJ 4ZJQA 2DXEA 3U1NA 3KDNA 5IV4A 4WCEQ 2UXCF 5L46A 1FD2A 1KQFB 5A0YB 4J5OA 1LFWA 3DMJB 3VGVA 3VGSA 1WHYA 4ZCMA 1LOUA 4DV0F 1XNRJ 2XYHB 4PQUA 1ITPA 3AXKA 3MR6A 3W66A 1EETB 3HT3A 3E3XA 1WTBA 3A3OB 3ET6A 1UJ5A 3IC1A 3QBCA 1G3OA 4K2JA 5ETPA 5C24A 4ANCA 3QRPA 1B0TA 3BPDA 4K4ZA 1LW2B 1VQ8S 3CEDA 5AXNA 3MMBB 4C8NA 4WFAQ 3TEHB 4MKAA 5HMYA 2HYIB 3RGIA 1TFYA 4X64F 1BQMA 1E6YA 3KK3A 4DV7F 1TU0B 3TZWA 1FKPB 1ZM9A 3QT5A 4UY8T 1H73A 2WONA 3UE2A 1BD6A 2KM8B 1CJTB 3FZBA 2FVSA 4PYDA 2HMIA 3EM1A 2V4RA 4ELTA 2DIVA 1FDBA 5C2CA 2GJFA 4X62J 3N01A 2FIUA 4RNNA 4W4MA 3PW5A 2VG6A 2M7SA 2H3EB 4L6V3 4URSA 2VOPA 3RZAA 1QVFR 4LF6J 3B4DA 3CW2C 3RYLA 2VDHA 3CC4S 2BRKA 4DV4F 5F9NA 4A8MP 9ATCB 4LSLB 1SV5A 3IR5B 3UDEA 2H4YB 3M8QB 3NAIA 2ZOFA 5M2PA 4F02A 3KUEA 1YHQS 4M63A 5T7LB 3C19A 4ES2A 3LUYA 4GVLA 1M1GA 2V4QA 5DQGA 4L74A 3I0RA 4TKTA 3E51A 2ZNYA 5F8JA 4E98A 3KLEA 1SH3A 5JVHQ 3L09A 3FGVA 1K1SA 3R9LA 1AFJA 1RGVA 1CJKB 5IT4A 1GK8A 1JXLA 2DYAA 3KLFB 1X5TA 5A76A 3UCZP 2NXEA 3PG9A 2BBEA 4JI0F 3FKBA 2N3OA 2CJXB 2ZH2A 4DPTA 4CRJA 3JQKA 4M8LA 3CE8A 1GX5A 3M9NB 3OFGA 4DX8H 1WF2A 1O0PA 4HT5A 2V4JA 1A9NB 1PYTA 2SXLA 4EFAC 3OUYA 2XQCA 1SB6A 5KFOA 3K5NA 2C2NA 3CNQP 1NK5A 1NNDA 5M2RA 2W8KA 4LBPA 3DHWC 1FX2A 4DI6A 3PYEA 1RAJA 3OXLA 1LWCB 3DOMB 3D3CJ 1R0AA 3NGUA 2ZOMA 3ETMA 2F1FA 5LMNF 3LWMA 3A12A 3JAMY 1SKRA 5GAHI 2C3UA 2C3MA 3LP1B 2VFRA 6FDRA 3NMRA 4J9NA 2MZTA 2OAUA 3DYAA 3I31A 4M1KA 2ZEJA 7FDRA 3PM9A 1JLGB 2CPHA 4U96A 4DXLA 3EJMA 4I2PB 1TKTA 4NLVA 3LP0A 1UP1A 1GTHA 3CCSS 3HHLB 4I67A 2NPFA 1RT1A 4WXWA 2J6UA 3SCIE 2IRXA 5J2MA 4E8UA 1RE1B 1VOMA 1IQZA 1BQNA 3LH2S 1NK8A 4JI4J 2IA6A 2YKNB 3RRKA 1S4EA 1QAIA 2QFIA 1RISA 3NOCA 5J2PA 3TZXA 3CJ0A 3KXDA 3BO3A 1ZA1B 3PW2A 4DLGA 4LFAJ 2CQ1A 2W9BB 4EYHB 3ENAA 4ZLLA 1RCXB 4USVA 1JWWA 1WKLA 1FD8A 2K2PA 2ILZA 3BH6B 3WC2A 3TX8A 3TQ1A 5L1LA 4ZCLA 2GIFA 1DQAA 4O0NA 1YBAA 2AYGA 3ZNJ1 1FRXA 2WVBA 1MSWD 1X8DA 2B43A 3JYTB 3VAIA 4PWDB 4MTPA 5E33A 2AJ1A 2NYHA 2H65B 3FEYB 1DLOA 2BACA 1U0HA 4TYAA 1VQPS 1K9MT 3P5TL 2DNLA 5CABA 4DUTA 4CLFA 3OL6A 3HM9A 4K4WA 2P6TA 2WW4A 2CVIA 2DPIA 2FHJD 4PXBA 3EPGA 2VKZG 4CLUA 2B5JA 3FQLA 5CYMB 1M5OC 5KG1A 4A8XA 4Y2MA 4NXNJ 2OEKA 5DDPC 3QFWA 2OPRA 4Q43A 1HLWA 2LMIA 1B70B 2AZ1A 3V81B 3LAMA 3D1OA 2OGUA 2DNGA 1N88A 3C14A 3LGMA 4JI5J 2KT5A 2AGOA 3AOAA 1KLMB 1K0TA 1RKIA 4MT1A 1S1UB 3W8GA 4TY9A 3GCWP 4F4KA 3C8YA 1N34F 3G96A 2Y0BB 1TVRA 1HNWF 2M5YA 3FJ2A 1HIYA 3OR2A 3CCRS 4OHXA 3AODA 1S0VA 5HROA 5GADU 2DEIA 4DPXA 2OFGX 3DM2B 1RTJB 1WG5A 4QWAA 1Q1KA 3RAQA 2QTWA 4J9KA 3B8HA 2E1RA 1J5OA 1C1BA 2KDOA 2IDLA 3I6PA 1RBOB 2P9GA 2V2QA 1IKYA 1VK8A 4IUFA 4OYZA 2DNMA 3C6TB 3QRQA 3HD2A 1RAHB 2HLUA 5CYQB 3DRPB 3ZFVA 3ISZA 4ID8A 1EZZB 3BSCA 4DR1F 4K4YA 4U7CA 3BS9A 4ED3A 4DEZA 2E7XA 1AUSL 4NLTA 5K14A 1Y3JA 1S57A 1XK8A 1HHQA 3QJPA 3MM8B 4X4QA 1GMVA 3TQEA 2PIIA 2QN6B 1C0UB 3DRXA 2DB1A 1DTTA 1RWPB 1YJUA 2VQFF 2KFNA 2HGLA 5ETSA 2VBXA 4JV5J 1SJFA 4KHPJ 1GAOA 2NXUA 4NLWA 3GYGA 3MPWA 1JLCA 1RWUA 4CO0A 1MNEA 3OJSA 4NZ0A 5EN1A 2KZMA 4HHHA 1B7FA 2BVZA 2EW9A 2GQ2A 2Y8YA 4LQ3A 2W7AA 3Q2TC 3N4WA 3QNWB 4H4OB 1CC7A 1D3WA 2M8DB 5HQLA 3OW2R 1GXLA 2AYBA 4X4SA 1NDPA 1S0MA 5D0EA 3KJVA 1SH2A 3H4BA 2A6OA 2VG7A 4F67A 4Y34A 4F4YA 2XY5A 2C28A 1AUDA 2MGZB 1WDTA 4YQWA 3SDEA 2BJDA 3T5KA 5FJ4A 1S6UA 2G2ZA 5DRKA 4B9LA 2IC3A 2MSTA 4Y2AA 1HARA 2HFZA 3N9UC 2MKJA 1IXKA 4I1TA 4YFUA 1JJHA 1RT7B 1AA1B 3HVAA 4USWA 5HO4A 2L9DA 3PX6A 5D4PA 1LWFB 4KFBA 1AW0A 1VISA 2F9JA 2JC1A 5H1SV 3NP5A 5A8WB 3OT9A 3W63A 1SJRA 1BXNA 3GJTB 3KHHA 2E1MC 2JEJA 2UXBJ 1CC8A 2RKIA 3PJWA 2HBQB 2ZM6F 3BV8A 1DTQB 1Q5VA 2QX0A 3BQ1A 1FCAA 4IG3B 1Z2LA 5HAOA 2BKNA 1W2IA 2ATLA 1FKOB 2BE2A 3UD3P 1KS2A 2FB0A 3PR4A 5IZHA 3LGHA 1G6BA 5E3RA 5HMZA 1KQKA 4Z7YA 2Q3PA 2DO4A 3P3DA 1U25A 1O8BA 5KG6A 4RW7A 1S59A 2Z2ZA 1Q8KA 2D41A 3CPWR 2DNQA 3M8RA 5F8NA 1HQ2A 1OPIA 1Y5NB 3M8PB 5T14A 2R8GA 3OVSA 2B4VA 4O3SA 4KH1B 3DRSB 3R97A 2NXNA 2JDJA 3H59A 1F1BB 2COLA 3CC2S 3MEGB 1KN6A 1WHXA 1TL4A 3HSDA 4CH0S 4OI0A 4EYIB 3MM5A 1FE4A 2C2KB 3PX4A 3PXGa 2IRYA 2L48A 4F50A 3BF4A 5D4OA 7AT1B 4FKXA 5A0YA 3DMJA 1HQEB 1ZAVA 3AJDA 2DITA 3CDEA 2BE9B 2E9TA 1RT6B 2FY8A 2W9AA 3SIPB 4ZLPA 4W92B 1EETA 1DAXA 4JB8B 3FRYA 4X2BA 2GX8A 3TVZA 3MF5A 1F60B 3MMJA 1RZMA 1H7XA 1VI7A 2C42A 4FF1A 1LW2A 2PMZD 4NA1A 4JI6F 3MMBA 3FRZA 2ZHOA 4FS2A 1VHFA 2HWIA 1QUVA 4AQYJ 3V5RA 1HR0F 1C1CA 2B9YA 3LALA 4M5DB 4EZ6A 1FNOA 1QM9A 5L1JA 3IMQJ 5LMUJ 3O6QA 1F5CA 2EBEA 4OZJA 1B99A 4AT1B 1TL3B 4GO5X 2RU9A 4ALZA 2VC1A 2N3LA 2R2RA 1FXRA 1HQUB 3BGRB 4QZVB 5J2QB 1T95A 1RAAB 2LDIA 3JQMA 5A8KB 1UPPA 2BJ8A 4QIGA 1KRPA 3ILOA 3K5OA 4UTGA 4WYWA 3TJAA 4DUYF 2RE1A 3A8EA 4MIBA 3RB3A 4DR5J 1N32F 3DGPB 3Q8SB 2D9PA 5T7LA 4JI2J 1FESA 4CTAB 1U1QA 3DCAA 1X5OA 2YNIB 3Q8UA 1XR7A 3LW5C 3V6KA 4LVOP 1PBAA 2LQJA 3BBBA 1S0OA 4FNIA 2FJXA 3L7UA 3FEXB 3KG1A 4KHRA 1NZAA 1CJKA 2X3GA 2V2VA 2CQIA 3MURP 3M2VB 2VIHA 2D74B 3H40A 2HQDA 1FX4A 4QWEA 5C25B 2HZVA 5KFCA 4YMEA 3OV7A 2XMJA 5FLXU 2CVEA 1RXOB 3VGTA 3QRRA 2VL1A 1IR2A 2DCUB 1Z2ZA 3J80Y 1HYSB 3NCRA 2HNDB 2BJEA 2JWNA 2W4DA 2PGCA 2MLYA 4C0HA 4XAKA 4ZVRB 4RNHA 1VMBA 4DV1J 3AD7C 1D0EA 1HW8A 1LWCA 3GLJA 4KY3A 3DOMA 2CJQA 3MR3A 1UEKA 1G2EA 4WJBA 3MTKA 1TV6A 2VFUA 3LP1A 1IWGA 3DOKB 5GAHU 4ID5B 1S9FA 3HKZD 1X4CA 1Y10A 4AL5A 2WK4A 3ICLA 3K2YA 3IBWA 4ZVFA 2HHQA 1WF0A 2AW0A 1JLGA 1C0TA 2D3ZA 2VFTA 1S76D 4WZMA 3CSKA 1FFGB 4BDPA 5HI7A 3HHLA 4NLOA 4JUZA 1J5EJ 3OVAA 3CDBA 2GCFA 4NCBA 2AIRB 5A8RA 2L41A 3P6YC 4U9RA 4QOTA 3VGUA 2YKNA 4Q45A 4O0IA 2HGMA 4ZK7M 4NE9C 4DF8A 4USKA 2J76E 4PXCA 4CT9A 2KVQE 4EMDA 2R7WA 2DXDA 2XZTB 5KFMA 2OH2A 2W9BA 3SSRA 2FJDB 2G2YA 2A0FB 5LSRA 2ZNZA 2IM2A 5SZTA 2WBMA 5KG3A 1WDDA 2JLEA 3SMZA 1YBUA 5ETVA 4BCAA 1N33F 2QSWA 1U6ZA 2Q79A 2DH9A 4FF3A 4NLRA 1UAWA 3JYTA 4PWDA 2JVOA 1S7IA 2CXEA 3NGTA 4QPTA 2EWHA 3MM6B 2W01A 3UQSA 4RR5A 2MYFA 1Q8LA 3GR1A 5D3GB 3UDLA 1ZOTA 4ERDA 1FVQA 2ZZMA 2AT1B 1QJHA 2ZITA 4ZP9A 4DL6A 3T3FA 1UKUA 1FWPA 5HVHA 2V8HA 2NZCA 4ECUA 3PNIA 1PAUB 4OV1A 3HK2A 1RWOB 1RAIB 4IRKA 5CYMA 4F2SA 2QZ8A 3MMCB 4DR7F 2EXUA 2KHCA 2M8HA 2OLWA 3D66A 3V81A 1X4HA 5D0HA 1FE0A 4A8QA 4WE1B 4ZJOA 1ZM4A 3TVKA 1N6QB 4RW4A 1UJ6A 2OSRA 5FDLB 3SZ2A 4IG0B 1VBKA 3SCLE 5BYQA 2ZE2B 1IUJA 2FQQB 4F4WA 1S1UA 1F5AA 2XNRA 1JK9B 4DR2F 4K8RA 4OYWA 5CHCB 8ATCB 4GKJF 3AD9C 1NJIT 1Q53A 1IBKF 2R7VA 5D0GA 2R2UA 5DM6Q 1N0UA 1UWBA 4RW6B 4NRTA 5I3UB 4IOAQ 4DSKA 2MPUA 1RTJA 3G6ES 5ETNA 4OHZA 2DBBA 2FVPA 4WKRA 1EKRA 1ZAWA 3PFEA 1PIEA 1JMTA 3B54A 4BHQA 1NPRA 3TUZC 1OS5A 5CD4A 1UFWA 3QO9A 1LWEB 3AOBA 5KT2A 4JV2A 2V2KA 2BRLA 3C6TA 1YKWA 1QE1A 4RUHA 2EKYA 5CYQA 2CDRB 3DRPA 4R8UB 1T9UA 2VODA 2E5LJ 3HSGA 2YQ0A 5F41A 2JC0A 3BB5A 2YTCA 5BJRA 1A7GE 4ZVPB 1BWVA 1NLKL 2CPIA 3G8TA 1OY6A 5HMWA 1YJWS 3MM8A 4OZLA 1JLBB 4J90A 5HJXA 2N7CA 1Y9OA 2V9WA 1C0UA 4M95A 1TELA 3SV4A 4GVBB 1BE4A 4ILRA 2ATCB 2OD6A 1UVNA 2IAJB 1V3RA 2Z30B 1WWHA 2K3KA 3MECA 3D0GE 4PG8A 2AGQA 1FVSA 4LF2A 2AD9A 2FDNA 1FRLA 1NU4A 2AJ4A 2YWEA 1OSDA 2E1CA 3RU0A 2IYGA 3OLAA 3QGPA 1NZ8A 3HVTB 1VJQA 4MH8A 1S5ZA 5F8LA 3W2WA 4P2FA 3TO8A 1HNIB 2BW2A 2MGZA 2C2MB 5U47A 2JNJA 3EDQB 2B56A 4NLXA 3RBZA 4BLGA 3EGVA 1GQEA 3GONA 3TA0A 4RU9A 1JJ2R 2NR0A 4GKKF 5DG8A 2KHDA 4IR9A 2UV8G 4DN0A 4FPIA 1RT2B 2HS3A 2PFFB 3Q8YA 1RT7A 3NWRA 4DLEA 2CNKB 1R43A 2DNNA 4HI2A 2W7PA 1XNRF 1LWFA 2KJWA 4OI2A 4ITSA 2G4BA 2FHMA 2H54B 3AJ2A 1IBMJ 2IJNA 2MDAA 3PFOA 4UW2A 5KG5A 2HQFA 4ED7A 4QQBA 5BR8J 1QSSA 5A8WA 3RG6A 1IN0A 1FRHA 2F8MA 2HQ3A 3PHEA 4I6YA 1U1OA 1DTQA 1S9EB 2W9CB 3AOCA 3GQCA 1DHMA 4YS2A 2HVIA 3Q8VA 1FKOA 3EXCX 3PV8A 3Q8RB 2HAFA 2QA2A 5D0RA 3W2VB 3P45B 3NLCA 1DQ9A 3JSMB 2HIYA 1HNVB 2CPDA 3CCTA 1L3SA 3UFCX 4LT6A 2HHSA 3PIOQ 2FC8A 2ZOGA 2DNOA 1SPBP 3PHTA 2DCLA 1VQSA 4X62F 3G87A 3RUBL 3OTDA 4ETZA 1S9GB 1A6LA 2WVCA 4IRDA 2XMAA 1RWVB 4LF6F 4ZCKA 2B7CB 4RW9B 2R7SA 5A2QU 2I0XA 4CLLA 3CJSA 4ZVUB 4WWSA 3TX0A 3DRSA 3CMQA 4OYPA 2HHXA 3MEGA 2ZDOA 3T9NA 2O5DA 3PYGA 5D8HB 2ABYA 2YWHA 2VPXB 1U1NA 2QRRA 2ZD1B 3CJTA 4C2MA 1SCJB 2R2TA 3KG0A 2GV1A 4MK9A 3PO5A 2R8HA 4OZ0A 4DPWA 2K7KA 1HQEA 1QSLA 4UOHA 5LSOA 2DH7A 3MTJA 1H98A 4FBUA 3VAKA 5DG7A 2CQDA 4OX8A 1RT6A 3M8WA 2UVRA 3EXYA 1S6OA 5DZ7A 1S6QA 1VRQC 2DK2A 5CQGA 3C16B 1O51A 4WK3A 2V9KA 1IKVB 2YWWA 4ECZA 4MAKA 2V50A 2UXDJ 2XMTA 4PG4A 5IQ6A 2VICA 1NPPA 4B9VA 4UT4A 1GT8A 4M5DA 4DCPB 1EHWA 5DQHA 1T02A 1NPKA 2HHUA 4C0BA 2HFNA 4DFJA 3V4IA 1RP5A 4PXDA 2RQCA 1YDLA 4X4RA 1TL3A 4ZPVR 2Q43A 1KHWA 5F0UA 3OL8A 5CAAA 1HQUA 3BGRA 5J2QA 3CJ4A 2KT2A 2DRBA 5AJ3J 3DRRA 4QR1A 5A8KA 3MR5A 2M3DA 1U26A 2JEFA 3H7HB 2YWKA 2V67A 3PJXA 3MUMP 5F8MA 1N8RT 2QG9B 2VASA 2QT7A 3NG8A 4J91A 4G1PA 2XMVA 3T1YJ 2KFYA 4K0KJ 2I9SA 2CFXA 3DGPA 2XI3A 1JLQB 1RBLA 1JIHA 3M6XA 2OI2A 4ZS6A 4MYTA 4CTAA 4C8LA 4P73A 3KLGA 3CJ8A 4C7QA 2QV6A 1DRZA 2YNIA 1YQHA 1N36J 3PW7A 3HD1A 2Q6BA 3GIIA 5DDQC 4XTTA 3LA0A 4FDFA 3W5XA 2Y3YA 3D28A 4X4OA 4IKAA 1D09B 3CUNA 2ZUGA 1WKKA 4JYAJ 1RA6A 2R7OA 1SH0A 3H25A 4JI4F 4LSZB 4YY3J 4R0EA 1S49A 4HR2A 4KV8B 5C25A 1FDAA 5HL7Q 4NYZA 3DLKB 3I4HX 1HYSA 1X5SA 2HRUA 3CJKA 1ZTWA 3PDNA 2IMWP 2HNDA 1ICEB 4DJBA 5HVFA 3WZ0A 3PRBA 4LFAF 2XYGB 4OYAA 2C2EA 2HEKA 1HI8A 2BR0A 3IRWP 2MJNA 1M0SA 3QJJA 4C3KA 1NHKL 1NSKL 1X4FA 1UFLA 1RTZA 2D3O1 2IBKA 4CWBA 4L3KA 1LNQA 2HRTA 2YKMB 3GSIA 2QLWA 2BOPA 1NDLA 3G6XA 3LP2B 4RLEA 2Y9HA 2XM3A 3TR5A 3JTNA 1AXQA 1APSA 4ID5A 2EFGA 4A8YA 2LQBA 1TK8A 3IM8A 3GP9A 1O6XA 3H8YA 4DZDA 2DNPA 2UUTA 3SBMA 1TAQA 4NMXA 1M5PC 1VQOS 2KG0A 5SUHA 4DG1B 4LFCJ 1KC8T 4DV5J 1KONA 1IKWB 5E3QA 4V19J 1Q4RA 4CO3A 3QJLA 1J27A 2YKAA 3DLBA 3M2RB 1H6KX 1YZ6A 2G0JA 3C66A 3FNNA 1SL0A 3Q23A 1FEHA 3G2XA 3F73A 3IA0A 2H1YA 4UUXA 4NXNF 2DGTA 1URNA 3UDCA 4IQMA 3SFGA 2HHPA 2LP4A 1U6BA 5F0WA 3CB4A 4JI5F 4A46A 3DI6B 3ZZTA 2EPIA 3J7ZT 4A8WA 2M70A 3NGRA 4ETXA 2A18A 4F4AA 3I9ZA 2KXHA 3N0VA 2ASLA 3L95X 4F4ZA 2BQUA 1VQNS 1Y0HA 5LJ5Y 4B9UA 4LRDA 1I1GA 2VHGA 4WFYA 4ZVEA 5DDOC 3TZZA 5HBMB 2JEIA 4CI0B 4PPDA 4QW9A 4KPYA 1NJWA 2R3VA 1IBLJ 3SQOP 4LSNB 4OJGA 2Z4PA 5D3GA 1WSVA 1T0TV 3ZTSA 3H2VE 4OLOA 3BSOA 3MCOA 2XYPB 3GG1A 5H9FJ 2MZSA 2XCAA 2F7VA 3WIVA 4EGLA 5EX3A 1XERA 1K0VA 1SJ3P 2GJ2A 4ZIWA 3SQGB 1FRIA 1RTIB 5B09A 5K8PA 3IO1A 1HBOB 5J1NA 3CDAA 3FC9A 4X4VA 4N56A 3MMCA 1FTCA 2NS1B 1IJFB 1VRTB 2MJUA 4GC7A 5F9LA 2YWFA 2GHPA 3MOZA 4OFZA 4U6PA 4DCJB 1FT8A 3FQKA 4WE1A 1XMOJ 4JV5F 1WI6A 1P27B 1N6QA 3QIPB 4KHPF 3IGNA 1D9FA 3KK2A 4PZVA 2ZE2A 4RBTA 4FXDA 1NK0A 5IQQA 3EICA 3IS9B 4NA3A 3MM9B 2O67A 2BKOA 2U1AA 2RB7A 4E0DA 3NBPB 5I3UA 2C3YA 4G1IA 2QYCA 3DU5A 4BC7A 2LFVA 2B4PA 2ZHAA 4UZCA 3CCMS 1VIXA 3MCNA 4OJ1A 2R4FA 5DJBA 1JXVA 2C3PA 3AJ1A 3H42A 3OL7A 2F65A 3BDPA 2OUGA 3U1LA 1LWEA 1SJ4P 5KT3A 1VJWA 1TMJA 2LQ5A 1QLNA 4R8UA 4DWIA 3FSIA 2PFDA 1D8ZA 1FWKA 4A48A 2ROGA 3T1HJ 4QU7A 4CQ1A 4JI1J 3I32A 4YB6A 2D3UA 3MCSA 3VZIA 1GTEA 2E5JA 5DGAA 2B6AA 3ENVA 3VV2B 2YX4A 3HDSA 4FF2A 1T03B 1DFDA 1E6VB 1JLBA 5KFIA 4IR1A 1D8YA 5KFQA 3HZGA 2EK1A 3FBFA 1RWWB 1GXTA 2OP5A 1KR4A 3C2PA 4GVBA 1CJVA 2B9XA 3QT7A 3K0JA 2UXBF 4NXMJ 3K89A 4TY8B 1UW9A 2ROPA 4UUWA 3KFWX 4OX6A 3ETOA 2WVDA 4C8MA 2IAJA 3QSIA 2IIHA 2VB6A 2MZJA 3ZZPA 2ASDA 1H2TZ 4OYMA 3KDOA 4ED8A 2QC3A 3HVTA 4RUCA 2YH1A 1S7HA 1SL1A 1WOOA 2IRUA 3NEKA 1QAXA 3AT1B 2DGVA 4TU8A 1HNIA 2E5GA 1HMVB 2VKRA 3G86A 4NLUA 1TQLA 2L9WA 1VLYA 3GIMA 2OEJA 1NH8A 4O3NA 1R8HA 2G1HA 5IM0A 3BYPA 3UN2A 1UWAA 3J7A1 2DEJA 5CXTA 3DXBA 1RT2A 4RPFA 1T9YA 2MHEA 4FPRA 4YEAA 2QYGA 4KO0B 4FYVB 2DPJA 2QL7B 2ZH8A 3HX9A 3AQOA 2C2RA 2XZWA 4WIQA 3QYYA 5ETLA 4UOGA 2J9EA 1QSYA 1Q7YT 2QLJB 4TQSA 4OLPA 3ZTOA 2FY1A 1TFWA 3M4XA 2XC9A 1RTHB 2EFVA 3TW0A 3V6DA 3HHKA 2FGOA 3OHBA 1QTMA 2JZ5A 3G71S 1S9EA 2WW8A 1H74A 5HANA 2VA3A 2W9CA 4HKQA 2DIUA 2M88A 2DGOA 4K5SA 4AQYF 4KTQA 2CJYB 2KTQA 1UEUA 3EZOA 2EG2A 3W2VA 3EGZA 2VJUA 1RCOB 3JSMA 5LMUF 4J9VA 4X4TA 2P5VA 3EMTA 4M5JA 1HNVA 5KFUA 2ZJQQ 4Y65A 1F3VA 5HQ8A 3B4MA 1DJ0A 2Y1IA 3R6GB 1K44A 4OHWA 4ZPBA 1S9GA 4WZQA 2LXIA 4RW9A 4K4UA 1RDRA 1EKSA 1VFJA 4M5NA 3D54A 3W5YA 4D3GA 2HGNA 1MG7A 1BLUA 3D6TB 3H5UA 3AY0A 1NSQA 1U8SA 5D78A 2EFPA 4WXOA 2DGSA 5KFGA 2CNLB 1LQ9A 2I2YA 1F6TA 1FDNA 4DR5F 3QGHA 3S6EA 2VFSA 3GV7B 1I6JA 4JI2F 1LXJA 4TYBA 3PYDA 4L75A 1BWEA 4JI8J 2HNZB 4DSFA 5KOXA 3QZ7A 4WU2A 4PR6A 4JI7J 2YNHB 2CIMA 3GYXB 3C16A 1KSPA 3CO0P 3DU6A 2HLTA 2HHHJ 2RHQB 5GADI 4RO0A 5E41A 3SFUA 3CTRA 3GTYX 3GPAA 3OL9A 3K7RA 5CCMA 1VQLS 2GHVC 3CXCR 3R7BB 2HZAA 1U2FA 2NSCA 2XS5A 1FTRA 4WPAA 4LREA 3ULHA 2VOOA 2LU2A 5MLCV 3LANA 1WOSA 4DV3J 4J9OA 1B4SA 2MKCA 5B0EA 2E9ZA 2CAJA 4DV1F 3VAFA 1VQ9S 3LPYA 5AXMA 5KFDA 5ETTA 2AZ3A 4B9TA 1VQ6S 4RNMA 4QIEA 1KOHA 1SJ1A 1KVKA 2Z57B 2CQ3A 1QAJA 5KAKA 3I82A 3G4SS 2UVWA 3R7SB 2XCPA 4ZN1A 1R8PA 1JLQA 4YDDB 1RHKB 1N48A 1I5OB 5B0CA 2OJ3A 1Z1ZA 3F41A 4X4PA 1PG5B 2J0SD 4KC5A 5E0OA 3M6UA 4B17A 3IWLA 2BJ1A 2ZKTA 4CLKA 2RF2B 1J5EF 4J37A 3UD5A 2VZ9A 4YDXA 1HBUB 2E29A 2HK2A 3VR1A 5AE3A 1IM4A 2IY5B 2HWTA 3THVA 4IYQA 4KV8A 1OPZA 4IOBA 3DLKA 1V3ZA 1URRA 1CLFA 1BC6A 2O01C 3SCKE 4DR3J 1W25A 2HVDA 4CLZA 2OTLS 2M2BA 4BS2A 5B0DA 4NEYA 2W4PA 4LF1A 3DLHA 1RSCA 3R7NB 3KLHA 2Z56B 3M2UB 1FWLA 1LK7A 1NAQA 2FTRA 3NRBA 1HNZJ 4P74A 5IC6B 3TA2A 2CRLA 1XMQJ 3CD7A 1V6HA 2YKMA 2LYVA 2GC8A 1S10A 4HH0A 2UUCJ 4KSEB 5HSPA 3H5XA 4CO4A 4P7VA 2B51A 1NXIA 3GJSB 1S6PB 4FYDA 4Y2CA 3DLGA 2W2PP 4CDIA 4DG1A 2IVFB 2BANB 3E8OA 1WKJA 3GU0A 3I96A 3OXGA 3M2RA 2R42A 3QIDA 1HHSA 3RW6A 2HURA 4DHVA 5KFBA 2J9DA 1S1VB 5ETKA 1M90T 3NGKA 4ED2A 3SI8A 1H2UX 4WP3A 3OTEA 3DI6A 5KFNA 3GFXA 2VD3A 2XI2A 2E7VA 3RB0A 1TUGB 2W4CA 4ZITA 3MAHA 3I0SB 3RBDA 3H2LA 1S77D 4USIA 2XGQA 4V1Ak 1M1KT 2DGWA 3HP6A 2OTJS 4RWWA 2IFXA 2BXJA 1LFPA 2JX2A 5HBMA 1RHQB 2GGPB 1KWMA 4EUVA 2MQ8A 2ZH7A 1NRKA 4ECVA 4HH1A 3U02A 3CO9A 1JLEA 1Q86T 5HLFB 5DDRC 1NK7A 3H5YA 4HACB 2Z2YB 3A8IA 4FYXB 1FK9A 3W9HA 1MW7A 5E3CA 4ECWA 3DDNA 3N6NA 2N4DA 2CQ0A 2VPZB 1TR0A 5H9EJ 3CT9A 2MKSA 3H0PA 3SQGA 1RTIA 2E5LF 4HLBA 4UZBA 1YTYA 2YPYA 2J0XA 3FMWA 3T9ZA 1EB0A 2RAQA 3JQJA 4CCHA 3Q86A 3HFVA 4FN5A 4F36A 1VRTA 3H2UB 1L5UA 3VQSA 3WIUA 3O8WA 1S72S 1ZYQA 5RUBA 4DFPA 1TK5A 3EZUA 2MQLA 2MKYA 4DL0C 4NZ6A 3ISND 3PEHA 4MKBA 1V5VA 1UVKA 2ZZNA 4O3OA 5L38A 1U09A 3RR8A 3IS9A 3CDUA 3CMAS 3MM9A 3TI0A 2X1GA 4RUBA 3IG1B 3NBPA 2HG4A 3PRVA 2LQ9A 2NREA 2XS7A 4EBDA 1X7VA 5JXSA 1X4AA 1P8GA 3OSPA 3OHAA 3MEKA 2XHWA 3ISNC 4P71A 1U24A 2NXJA 5H9FK 4K5RA 4ZKAA 2NPIA 2NZ4A 2NSBA 1T8EA 2F5GA 2P9CA 3KMQA 3ENWA 3OBIA 1A0OB 4U67Q 2MLZA 1MROB 1Q16B 3R1HA 4K7QA 1T9XA 3KTQA 4PAAA 2R7QA 3DOLB 1H0HB 1SL2A 4NZ7A 2FHOB 1R89A 3BSAA 3BO2A 1IJEB 4U95A 1F2GA 2KI2A 2MQNA 2EVZA 2DNZA 3R6LB 3DDKA 2ZH5A 3HT0A 4CM2A 3M8YA 1E6VA 4DQQA 4M5GA 3MEDB 1SC1B 1REVB 1IBMF 4F7VA 2WVEA 3D68A 5A2QY 2OIHA 2A1BA 4OHYA 2QL5B 1RK8A 3EUNA 5BR8F 2VQFJ 2H9ZA 2I8EA 1F3FA 2OPPB 1Y4ZB 1VCTA 4TY8A 1SJQA 3KHLA 1V3SA 1HL6A 1DURA 3PACA 3THPA 2Y8WA 3GJRB 3UR0A 4B3MJ 2ZBRA 2DR6A 5F8IA 4LF9J 3TRGA 2C22A 2HWHA 2BE7D 1NBEB 1OY9A 4A47A 3TJ8A 2HS0A 3OR1B 1XR5A 4I7FB 2JLFA 3GJQB 1VDHA 2KKHA 4DQPA 1M1HA 4GRSA 5C7PA 4YHHJ 5EWGA 4LFBJ 2BMBA 3QLHB 1IKXA 5J2NA 2PEBA 4LF5J 2H4WB 3D7SB 4KO0A 2JRSA 1F0XA 3CWJA 1NHVA 2R7RA 1MWQA 2PMHA 1KBRA 2FD2A 4ELVA 1LKZA 4RWXA 1RBAA 1MWYA 3KHRA 3IR7B 3R2CJ 4P2XA 4F0MA 3ET6B 4NI2A 1RTHA 1CQNA 3BN4A 1WHVA 1K1QA 1VR6A 5DO2A 5AT1B 5LXRA 1ZH5A 3CCZA 1E6YB 2CQCA 4MJKA 3KK3B 3BQ2A 2UZAA 1L3VA 1VIOA 2DNRA 3M6WA 2XO6A 3OLBA 4C4WA 1O5JA 4JI3J 3PRDA 2HMIB 1GEHA 3QZ8A 3EZ5A 1NSPA 3LF0A 2UU9J 2BUNA 2VG6B 4O3PA 2YQ1A 4LIWA 4ZPDA 1U1LA 7FD1A 5AJ3F 3HCXA 2XSJB 4ECQA 1SUQB 1CBKA 2GMLA 2E5IA 1UTAA 5CZXA 4OQJA 4IDKB 1T05B 3T1YF 4K0KF 2DHGA 4F3QA 3BKFA 8RUCA 3UW1A 5K5MA 1ULRA 3G82B 5KFYA 4ZVGA 3BKTA 1N36F 4Y0FA 4LF7J 4KB7A 2HNZA 4LF4J 2QJ3A 3M7VA 3ZTPA 4HYKA 2GIRA 3KUGA 1R31A 1XN9A 2YNHA 3OPKA 2HZCA 1TK0A 1J2VA 1X9MA 1FXDA 1RA7A 3KJNB 1YRXA 1UVLA 1GNKA 2CWKA 4K4VA 4JYAF 3DLJA 2AYEA 2V34A 4YY3F 2A10A 1T9WA 4DSEA 4Q5VA 1TL5A 2HNYB 2CZVC 3CDWA 3NWGA 2YPZA 1U4BA 3MMAB 5B0AA 3S7RA 1VQYA 1CS4A 3AXMA 1FRKA 2GAHC 1PJ7A 2J7UA 4C11B 1R8CA 3UCGA 4JP8A 3W8PA 2YQ3A 3VZHA 4ZVTB 2XSFA 1U2RA 3CD0A 4B3OB 4N76A 1NJYA 3JTPA 2V8DA 2O1PA 3I87A 2ASYA 1YGYA 2LEPA 3PO4A 3CIZA 1HNXJ 3N5FA 1BQXA 4AXIA 3VCDA 1X0PA 3QT8A 1WG4A 4F04B 5DM7Q 4LBIA 3L4BC 2HAIA 2O66A 4CLWA 3G8QA 3IBFB 2MZQA 3M6VA 4UQGA 5C5JA 1YBTA 4LFCF 4DV5F 4CNYA 1IR0A 2J0QD 3UCUP 1RHUB 1F2HA 1HW9A 4ZP8A 3W61A 1LW0B 1JJ4A 3U1MA 1RABB 4WIIA 2MLXA 2IM1A 4DBQA 4OJ3A 3ZZZA 4DPUA 5DLFA 1Q8BA 1UETA 5D4NA 2Y0SD 3G6YA 3HJFA 3KLVA 3S1TA 1HHTP 4X4UA 1HBUA 1YK9A 3GSDA 3D6HB 1U45A 4YB7A 2WB1D 3I55S 3DRYA 2MTLA 3QMQA 4ZVHA 5KFJA 1ZBTA 3ZXWA 2CPZA 5KFXA 5J2PB 4G65A 4Q2LA 1VLOA 4OHVA 3Q89A 4BBYA 3M30B 5KFZA 1NKEA 1G1XA 1R6VA 1KHVA 2QA1A 4JBCA 3NL0A 1HBNB 2GW8A 1U02A 5KFTA 3UPFA 4IO1A 1NKCA 3M2UA 1AT1B 2BABA 3CGIA 2CPXA 4Y00A 1TP7A 2YXLA 1IBLF 3AA9A 1C4AA 5I42B 1UEVA 3WX8A 2OELA 4XK8C 1TL7B 3IBCB 3O2IA 1U1PA 2PEHA 2I1RA 1MN7A 3P5BP 1S6PA 1FNXH 1RAOA 2IVYA 1FJCA 1CEZA 4NLYA 3HPOA 4DL7A 2J5AA 3T5HA 5JUMA 1YJTA 2VDIA 2BANA 4WKYA 1ZETA 3BGLA 3IGVA 1S1VA 3SSQA 2OPRB 4I56A 1ZTTA 1N5SA 3LO3A 1XMOF 3VVUA 3L7OA 2FJBB 4QYRA 2V6AA 1UA0A 1SQGA 3ENQA 2DXFA 4UOFA 1X9SA 4X66J 1UMJA 2ZBCA 1HD1A 3BPSP 1YVFA 2MKIA 1X9WA 2FVRA 1HWJA 1TVRB 3CCVS 3MAAB 1OQ3A 5DQIA 3H90A 3LGNA 4RBVA 2KZZA 2MEWA 3HF5A 1S12A 4LRCA 4CLPA 3GE9A 1SIZA 3M1VB 3T5LA 2XG8A 4CP5A 4DSLA 2AX0A 2IPOB 1C1BB 4HHJA 1XNQJ 4K2XA 3MFHA 2C3OA 3SCJE 2MSSA 2C2ZB 3WHIA 4HACA 3MEEB 3US5A 3T19A 1U48A 2UUAJ 2FLLA 3MPDA 1K73T 4CO2A 1X4BA 3FBEA 3HVRA 2DD8S 1AROP 1DY3A 2ADCA 3T1HF 2DY9A 4JI1F 4H4MB 5GAEI 4AFFA 2HQGA 1KLNA 3RTVA 2D3OR 3PVXA 2RVJA 4QW8A 2OPQB 1Y3KA 1RADB 1RYRA 2G0IA 1ZM3A 3HSZA 3RRGA 1AFIA 4P72A 2NLWA 1YX2A 2FLNA 3J81U 1FKPA 2EI5A 2UVVA 2FJWA 1Y5IB 4C8ZA 1PKUA 2YKQA 3M9OB 4C8OA 5K9FA 1CJTA 1R0CB 4NXMF 5IS2A 3QGGA 4EBCA 3JTOA 4DV6J 2H5IB 3KYLA 1XR6A 4USTA 2KYZA 2J7WA 3G9CA 3F0NA 4M5KA 2GVDB 3IG1A 4DN9A 3J7YI 5CCLA 1RJJA 5L39A 2EFQA 3ZZ0A 2XLJA 2WRMA 4LSLA 1GH8A 4EO6A 5IWAJ 2PA8D 3M8QA 3KJVB 3J7AN 4P52A 5CYJA 1RTDB 2B8PA 1RLDA 1B3TA 4I4BA 3NCQA 1YJ7A 1SQFA 1MROA 4C3LA 2NYIA 1X0FA 4CLSA 4F0KA 1QDUB 1H38A 4C98A 3DOLA 4LVNP 2YNFB 2HFUA 4O3QA 1RHMB 4NASA 3W5ZA 1RHRB 1NK4A 6FD1A 3MWBA 5KT5A 1V5IB 3KLFA 4DR6J 2OMOA 4QWDA 3G6VA 2UP1A 2W2NP 4USUA 3UNGC 3GIRA 2ZH9A 2UUBJ 3P8BB 2VUGA 1C2PA 1ACMB 1REVA 3D67A 3W65A 2MY8A 4KGKA 3VAGA 2R8JA 3BR9A 1KTVA 2CQPA 1WOPA 2AMCB 2AYMA 1PAEX 4B9NA 2HFOA 4YN3B 3AHPA 3ZNUA 4F0HA 1M5HA 3CJ2A 2ACMA 3GIKA 4F25A 1IQTA 2KU7A 3TOQA 2X1FA 4MKYA 3IXQA 2HFVA 3IRXB 1YJVA 2QFJA 4PKDB 1WELA 3BDEA 4RW7B 3OR1A 2V68A 1CJUB 4I7FA 1R8AA 1VQ5S 2YY3A 4ZPCA 1U1MA 2DGQA 1HWUA 4YUDA 1YRUA 4ED0A 1FRMA 1OMSA 3ZZUA 2ZC4A 4DS5A 2WVFA 3QLHA 4I2PA 3WQPA 4DOZA 2W8LA 4NWBA 1EJ7L 2PMWA 1JQGA 1S0NA 2BYCA 3FFIB 5GAGU 1SI9A 4JI8F 3OFHA 4B3SJ 4N8NA 4OMFG 2BOAA 2CKWA 4NLDA 3VAMA 1NO8A 4B02A 2J0WA 1H7WA 4HDGA 4JI7F 1SBRA 3EYZA 1PSDA 4ZP6A 2GNKA 4KQZA 4M5IA 3AQPA 4NLPA 5A6WA 1NKBA 1F5BA 5I4MA 1S4FA 2ACYA 2FZCB 1KVJA 3GILA 3PTWA 3X3UA 2HHHF 2VBZA 5E3AA 1WJ9A 1JX4A 1C1CB 1GFWB 5L8RC 3O5TB 1N5YB 1NSAA 3P96A 2R7TA 1EAYC 1NK6A 3HO1A 3EGNA 3R2DJ 1JXEA 5F8GA 3TVYA 3UVJB 3I5BA 1FRJA 4IH5A 3J7Z5 4DV3F 1S99A 1AYEA 3T5JA 3NKYA 5F3TA 2HBZB 2B0GA 1R27B 1WC5A 2XSJA 2GVZB 4KGMA 4I2QB 2QIFA 4A8SA 1SUQA 5LM7E 4RJVA 3VALA 1XC9A 2KO1A 2LEBA 3GMGA 4DV2J 4IDKA 1T05A 2Y1JA 2NQPA 1WC1A 2RRBA 4G1QB 4X65J 2K1RB 3G82A 1X4DA 2QEXS 4OYBA 2Y1RI 2GQQA 3TNVA 4OYXA 1YZ7A 1RT4B 2RILA 1SVDA 4FXVA 3BREA 5KFRA 3W9IA 3GWCA 2Y1LB 1KLMA 4CYUB 3H98A 2DTJA 4GC6A 3MHYA 1L3TA 1OO0B 5MAOA 4ES3A 3I5CA 3UWTA 3T6BA 2CZ4A 3IP0A 3TARA 4PG5A 5B08A 4QR0A 4PG7A 4K4TA 4Q0BB 2HNYA 2HBYB 2FVQA 5E5NA 4PYAA 2F3JA 3KKFA 4DR3F 3DM2A 1YJ9S 3MMAA 4NA2A 3TZYA 3OQ2A 1NUEA 5D77A 2CPFA 1W7WA 3KJFB 2H51B 1FA0A 4C11A 4P10A 1FXLA 3R5GA 4ZHRB 1EP4B 4I6WA 5IFMA 2PI5A 2DR5A 3CCWA 4N77A 3K8VA 3PR5B 3NGDA 2VQEJ 4B3OA 3BGFA 1TKXB 2G0CA 1HNZF 2PO4A 3RW7A 1XMQF 3KOAA 4KAIA 2KYXA 4LIRA 2WSCC 2D9OA 2A3JA 2XLKA 1TV6B 1HI0P 3EVMA 4ATNA 2UUCF 2JJ4D 4USMA 2D7SA 2MQMA 3EPIA 2DO0A 3BBCA 1FO1A 4ES1A 3G8SA 3CD5A 1UZDA 3Q0AA 1NB7A 3Q22A 2QMXA 1B0VA 2FGCA 1D9AA 1C0TB 2FJVA 4AL7A 3HJVA 1LW0A 2FYXA 2JSXA 3MUTP 3X1LB 2EFOA 3C15B 3TA1A 4C0OC 1FFWB 1VQKS 4P9SA 5IT9U 2G1DA 5LXYA 2XY6A 3FCWA 2CJBA 4LR9A 1QAYA 3V2UC 1SXLA 2B9WA 2AEMA 5A8RB 4HL9A 3B82A 2AP6A 2XMWA 4OYIA 3IAM9 2Q6CA 4H4OA 3O1LA 3WC0A 4QYZJ 2A6MA 2V8PA 2EC0A 1TZ0A 3M30A 1U47A 4W90B 4KPCA 1UVJA 4J9PA 3P49B 4HTIA 4ZVOB 2DR8A 3ADAC 1HBNA 3OTBA 3QPIA 1XJWB 5JVGQ 2MXYA 1K8AT 2V63A 4OI1A 1XTZA 2QL9B 3GG0A 5D6GA 4Y3CA 1NH7A 1OJ4A 4PUOB 5BYRA 1R0BG 4URGA 3NS5A 5L9XA 4Y28C 4IH7A 3VTIA 3HI9A 5I42A 1NMEB 2J7KA 2RSQA 4NRUA 3HHEA 1MU2B 4G3IA 1TL7A 3M05A 5T41A 2FUG9 3MZIA 2FZKB 4DDFA 1VC0A 1PYSB 2ZBQA 2FHKA 1KVIA 4B08A 4ED5A 4TXSA 1CVJA 1XBWA 4NEZA 4IG3A 4ZOSA 2OKQA 3A4TA 2X7IA 2XBPA 2K7JA 1ZPVA 4ZA1A 2Z58B 4ED4A 1KEKA 1PJ5A 4QWCA 4YP3A 1RACB 4RW4B 3E01B 2MZRA 2ILYA 2XB2D 3AB4B 4HT7A 1RT3B 2J9DE 2HS4A 3M8PA 2QLFB 1WUUA 1L3KA 4AE5A 1UWBB 3MAAA 3PCOB 4CZCA 5F8HA 4YR0A 3C6UB 2LA6A 2VA2A 4QWBA 4XPEA 3A8KA 3JS9A 3LWLA 2LVWA 3M1VA 2IM3A 3CCUS 3A13A 3ZZOA 4OZ5A 4U8VA 1U1KA 4J9SA 2ZBIA 3MEEA 3QO9B 5GMKa 4KYZA 4NX9A 1QE1B 2VF3A 2L3MA 1TAUA 4ZVSB 1PILA 1EX8A 1RAGB 4AL6A 4H4MA 4RX6A 3R5AA 4H4KC 1FKAF 1H72C 4EWTA 1DARA 2OPQA 5GAEU 2J6SA 4F3MA 4GMKA 4CIOA 3CCES 3SV3A 1YWXA 1KQGB 2WSFC 2H5EA 1LEOA 3DXSX 2HBRB 1FNMA 4E2FB 3KMSA 2RH3A 2ROEA 1QD1A 3SYZA 2RNEA 5AXKA 1VS3A 1TMMA 2VPWB 1RQ0A 2B3TB 2CADA 2HQIA 2M9KA 4P2MA 5EGYA 2C1EB 3W3SA 3E2EA 2B4UA 4P6QA 4K59A 4B3MF 2GVDA 3MECB 1RWMB 3FSYA 4LF9F 2RDIA 5LJ3Y 4NL5A 2ZJPQ 2BM0A 2RDDA 2AV5A 2P9EA 3HULA 3J7YU 1HKAA 3MPUB 4O4RA 2DRDA 5C2GA 2HQCA 4DSIA 1EIYB 1ROFA 1N0VC 3W2WB 2EEYA 2FVCA 1I94J 3ZTRA 2H48B 3FEZA 1RTDA 3QT6A 1SIWB 2R7XA 3LQVA 2RRAA 4YHHF 5LOQA 2I6WA 1UVMA 4LFBF 2GHWA 1FJGJ 2YNFA 4ECYA 5FD1A 4M5LA 3W60A 3HHDA 1P6TA 4MIAA 4LF5F 2J8AA 1VBYA 1UFKA 2Q1LA 1FERA 3M2VA 3WX4A 2IDEA 1YLXA 2KFZA 4YR2A 2G13A 4KT0C 1X4EA 3MDFA 3P4UB 4J9RA 1JB0C 1H2VZ 2R8KA 2DHSA 2GMHA 4EK2A 4Y6IA 1X60A 2CDQA 4L76A 3BQ0A 3N28A 3MR7A 4ER8A 1CULB 2VONA 1WSRA 2ALYB 4ZDNA 1NJXA 2BJ3A 1S48A 3Q24A 1SKSA 2CQ4A 4P7TA 2C2OB 3IRXA 2BA9A 1MMLA 4O4GB 1XWLA 4JI3F 3CC7S 2ZHBA 2UU9F 3W1YC 1CJUA 3EWGA 2WSEC 3NOGA 3CMES 4DL4A 3DOKA 2F4VJ 3I56S 4RL1A 1VHIA 4FF4A 3BEGB 2RQ4A 2RHSB 4ELUA 3AB2B 4HVZA 2V8VA 3K5LA 3CJ5A 3FFIA 3ILJA 4TU9A 1T11A 1TKZB 2AWZA 5HATA 2ZVIA 4LF7F 4LF4F 3OTCA 3R3TA 3UN5A 1IVZA 3THTA 3PW4A 2VPYB 4QBUA 4KKOB 3KK1B 1B7YB 2HSEB 1S6QB 1GMWD 2LXUA 5DZ6A 2WOMB 3RAMA 2CPYA 2LXFA 4URQU 1UA1A 4FBTA 1MLAA 3HKWA 4RKUC 4OX7A 2OPSB 2VBYA 3BSNA 2YWGA 2E44A 2F9DA 1S1TB 4C48A 3KWMA 3ZZRA 4LF8J 1IR1A 1ZZFA 3M8ZA 3RR7A 1RAEB 4FVMA 1LWXA 1N5YA 3RJMB 4Q2MA 1HA1A 5DETA 3V4IB 3BM7A 4OX9J 1S97A 4ZLNA 3UVJA 3MM6A 1TL1B 4N47A 1PYOB 4NLQA 1AZSB 3R27A 3R5BA 2OD4A 2L08A 1WTFA 2HRYA 1VBZA 1OSCA 5JJBA 4NYOA 3A3PB 2GVZA 3DRRB 3TUPA 4F26A 4I2QA 4OZ2A 2CYYA 6AT1B 1HNXF 1X4GA 3AAWB 5G0RB 3OFEA 2PE8A 3MOJB 2ZH3A 2RS2A 2VG5B 5G4DA 1JLAB 2FHJA 3H20A 3OTOJ 4G1QA 4IO9Q 2YNGB 3UNYA 2K1RA 3TYTA 2EK6A 3TANA 2OSQA 1WC4A 3LAKA 4LBHA 1DQ8A 2ZJRQ 4WF9Q 4Y2KA 2XLIA 3UD4P 3KLGB 2R8IA 2B4OA 2E7WA 2DGXA 2AJ2A 1Q8IA 1RT4A 2PSZA 1FEEA 2KXNB 2DISA 5FDLA 1UZHA 3W9JA 1EQMA 4IG0A 1JJCB 4CYUA 3A8JA 1G4CA 4NYPA 5HVGA 3QAEA 1HPZB 4IFVB 2PT0A 2AEJA 4DUZJ 3MD3A 3N5BA 3BZQA 1U7LA 2DNKA 4RW8B 4RW6A 4Q0BA 2UVUA 5K8OA 1YITS 3BKUA 4NCAA 1QTNB 3SSSA
chains in the Genus database with same CATH topology
5KFYA 3CJKB 4ZVGA 2ZOGA 2DNOA 5EWFA 3O3LA 3MEDA 2DCLA 1VQSA 1S1XA 4NMLA 1N36F 2YKOA 2XMKA 2L9NA 4KFBB 4Y0FA 4X62F 4LMZA 4KB7A 2HNZA 5LT5A 5L1KA 1S1WA 2BQRA 1WHWA 4IH6A 4NPOA 4HYKA 3OTDA 2GIRA 4ETZA 1S9GB 2MQQA 1R31A 1A6LA 1XN9A 4IRDA 4YOEA 1N5VA 1U1RA 1VQ8S 4LF6F 4ZCKA 2B7CB 2YNHA 4RW9B 4ZHRA 3OPKA 1EP4A 2IVMA 2R7SA 3QWUA 5I3PA 4LUBA 1M5VC 2MB0B 5A6PA 2I0XA 4HTJA 2HZCA 1TK0A 2JLGA 3PX0A 2OPPA 2XGPA 4NOHA 2PA3A 4ECTA 1J2VA 3DRSA 1X9MA 1FXDA 4R0JA 1RA7A 1TKXA 2RKIB 1YRXA 3ITHB 1UVLA 1GNKA 2MZ1A 4K4VA 4JYAF 1WF1A 3DLJA 3VWSA 2AYEA 2HHXA 3MEGA 2ZDOA 3T9NA 2O5DA 5D8HB 2ABYA 2YWHA 2VPXB 1CPZA 5CA5A 1U1NA 3TUJC 4YY3F 2BE2B 4C8KA 2A10A 3RRHA 4DSEA 2QRRA 4Q5VA 2ZD1B 2RDJA 1TL5A 2HNYB 4C2MA 2CZVC 1LK5A 1T3NA 4DQIA 3CDWA 1JKHB 3NWGA 2R2TA 1WEXA 3PIPQ 3KG0A 4X4NA 4F2RA 2GV1A 1U4BA 3GR0A 3MMAB 4MK9A 5B0AA 3S7RA 3OSNA 2R8HA 3PO5A 4OZ0A 2WHOA 2K7KA 1HQEA 1QSLA 1FDDA 1P1TA 1VQYA 3MR2A 3NMAA 2NUUG 5LSOA 4B9SA 2DH7A 3MTJA 3H5SA 1H98A 4FBUA 1FRKA 3VAKA 5DG7A 4CO5A 2CQDA 4OX8A 1RT6A 4MIWA 2UVRA 3EXYA 1N4LA 2J7UA 4C11B 4ZCIA 2HIQA 1S6OA 1LXNA 1R8CA 3UCGA 2W25A 2LECA 1RI7A 1S6QA 2YQ3A 2ZC3A 2JHEA 2DK2A 3HXMA 5CQGA 4XDDA 1O51A 3T6JA 3VZHA 3K5PA 1NJZA 1RKJA 2XSFA 1U2RA 1YRTA 3CD0A 4WK3A 1CSJA 4ZPAA 3TAMB 4B3OB 2V9KA 1IKVB 4ECZA 4N76A 4MAKA 5L1IA 1NJYA 5DS7A 3JTPA 2V8DA 2O1PA 3I87A 1FHTA 2ASYA 3NCPA 1DZ5A 1YGYA 3O44A 4DMZA 2LEPA 3PO4A 3CIZA 2XMTA 2XULA 4PG4A 3N5FA 1BQXA 3MM5B 4D3HA 4AXIA 3VCDA 1X0PA 5IQ6A 1WG4A 2FJAB 3NNHA 5DM7Q 4B9VA 4XIUA 1GT8A 4M5DA 2N82B 3U1NA 1N54B 3F56A 5DQHA 2HAIA 1T02A 2HHUA 4WCEQ 1WNEA 2UXCF 2O66A 1FD2A 4C0BA 1KQFB 2HFNA 5A0YB 4DFJA 3V4IA 4FVCA 1RP5A 4J5OA 1LFWA 3DMJB 4PXDA 1WHYA 5KT7A 4ZCMA 2RQCA 3G8QA 1LOUA 4DV0F 2MZQA 4X66F 4X4RA 3M6VA 1TL3A 5LSLA 1VQMS 4ZPVR 2Q43A 4UQGA 3V4MA 5C5JA 4PQUA 5I3QA 4LFCF 3MR6A 4DV5F 3HT3A 1EETB 1KHWA 5F0UA 4CNYA 1IR0A 2J0QD 3UCUP 3E3XA 1WTBA 1HW9A 4ZP8A 5F3ZA 4DL3A 1TKDA 3OL8A 2Z8QA 3IC1A 1UJ5A 1LW0B 1HQUA 1WEZA 1G3OA 2YX1A 3BGRA 5J2QA 5C24A 1JJ4A 3U1MA 3U27A 4WIIA 3CJ4A 2KG1A 2KT2A 3MGJA 5CD4H 2DRBA 1B0TA 2IM1A 4DBQA 3DRRA 4QR1A 5A8KA 2E1AA 4OJ3A 1LW2B 5HMXA 3MR5A 3ZZZA 5DLFA 2VC0A 3CEDA 2M3DA 5AXNA 1Q8BA 2CJAA 4AUKA 1UETA 5D4NA 2FLPA 2Y0SD 3MMBB 4PG6A 3J81Y 4C8NA 1U26A 3G6YA 2JEFA 4WFAQ 3HJFA 2YWKA 4MKAA 3S1TA 5HMYA 3KLVA 1HHTP 2HYIB 1N5QA 4X4UA 4PUOA 1TFYA 1HBUA 4X64F 3PJXA 2E5HA 3GSDA 1BQMA 5F8MA 4QJVA 3MUMP 4WFNQ 1N8RT 1U45A 1E6YA 4YB7A 2VASA 2QT7A 3NG8A 3KK3A 2WB1D 4DV7F 3I55S 1VQ7S 3K59A 3DRYA 1FKPB 1ZM9A 4G1PA 3QMQA 2IYIA 4ZVHA 5KFJA 1ZBTA 4UY8T 1XNQF 2WONA 2XMVA 3D1HA 2KFYA 5E2QA 2I9SA 3UE2A 2CFXA 2JVRA 3DGPA 1BD6A 2KM8B 1MU2A 2CPZA 5KFXA 1WACA 2XI3A 1JLQB 5J2PB 4Q2LA 4OHVA 3FZBA 1JIHA 3M6XA 2FVSA 4WU3A 2HMIA 4ZS6A 2IMOA 2UUAF 4MYTA 4CTAA 4C8LA 4LJMA 2V4RA 4ELTA 3KLGA 2DIVA 1FDBA 2QV6A 2YNIA 3M30B 4BBYA 1HI1A 1YQHA 4C7QA 4TQRA 1DRZA 2ADBA 2GIQA 2FIUA 3N01A 4RNNA 5KFZA 3PW7A 1NKEA 2WB4A 1G1XA 3PW5A 2VG6A 3Q8PB 1KHVA 2M7SA 2Q6BA 2QA1A 4JBCA 3GIIA 3NL0A 1HBNB 2GW8A 5DDQC 4L6V3 4URSA 2VOPA 1HD0A 3RZAA 1QVFR 3B4DA 3UPFA 5KFTA 4A4JA 2R2SA 4IO1A 1NKCA 3M2UA 3RYLA 3D28A 4X4OA 4IKAA 2RUGA 1KNZA 3CULA 3CUNA 3CC4S 2BABA 2BRKA 2ZUGA 4DV4F 5F9NA 4A8MP 3CGIA 4Q7AA 4IQXA 2CPXA 1RA6A 4LSLB 4Y00A 2DNHA 1SH0A 2R7OA 1TP7A 5E3PA 3H25A 1YSJA 4ZPTR 4JI4F 1SV5A 3IR5B 4YR3A 3GV5B 4R0EA 1IBLF 1S49A 3M8QB 3U7JA 4KV8B 5C25A 3NAIA 3AA9A 1FDAA 1C4AA 2ZOFA 5HL7Q 4NYZA 4PWUA 5I42B 1UEVA 3DLKB 4XPCA 4TLRA 1N33F 5M2PA 4F02A 3I4PA 1YHQS 4MK7A 3I4HX 4XK8C 5K8NA 1HYSA 5EHHA 3E01A 1KFDA 3KK2B 4M63A 1X5SA 2HRUA 5T7LB 3CJKA 1ZTWA 4ZPWR 3O2IA 3PDNA 1U1PA 2Z2MA 3LUYA 4ES2A 2PEHA 1TUVA 1XEZA 2HNDA 2I1RA 4DV6F 2IMWP 2P6SA 2KT3A 3JB9k 4DSJA 4DJBA 2V4QA 1ZZNA 4N41A 3WZ0A 3PRBA 1S6PA 5DQGA 1FNXH 4LFAF 1RT3A 3I0RA 2C2EA 4TKTA 3E51A 1HI8A 2IVYA 2ZNYA 5F8JA 2BR0A 1CEZA 4NLYA 1FJCA 4E98A 3KLEA 3HPOA 1SH3A 3IRWP 1L3UA 5JVHQ 4DL7A 2MJNA 3L09A 3FGVA 1M0SA 3QJJA 2J5AA 1K1SA 3T5HA 5JUMA 1YJTA 2BANA 1AFJA 1RGVA 4WKYA 5IT4A 1ZETA 1VQ4S 1JXLA 4C3KA 3KLFB 4DL5A 1X5TA 3C6UA 3BGLA 3UCZP 1X4FA 1UFLA 4FS1A 5KFEA 3HFKA 3IGVA 2IBKA 3CCJS 3RB4A 1S1VA 3SSQA 5FLXY 1YI2S 5IWAF 2OPRB 4I56A 2BBEA 1SQEA 2YKMB 4JI0F 1ZTTA 1N5SA 2QLWA 2BOPA 1Q7LB 2N3OA 3G6XA 3LO3A 2ZH2A 3LP2B 2ZD1A 1XMOF 4C3MA 4RLEA 5ADZA 4M8LA 3L7OA 2LEAA 2FJBB 4WTYA 3CE8A 4QYRA 3TR5A 3JTNA 1UA0A 1AXQA 1APSA 1GX5A 3M9NB 4PQAA 3OFGA 4ID5A 2EFGA 1C4CA 4DX8H 1B0PA 1WF2A 4A8YA 1O0PA 2LQBA 4HT5A 1TK8A 2V4JA 3ENQA 1A9NB 2SXLA 4MFBB 2DGUA 3H8YA 4EFAC 3OUYA 1X9SA 1SB6A 2DNPA 2UUTA 5B7WA 1UMJA 2ZBCA 1TAQA 5KFOA 3K5NA 1M5SA 1M5PC 1VQOS 1HD1A 2KG0A 1ZPWX 2KH9A 1NEEA 1YVFA 2MKIA 1X9WA 5SUHA 4DG1B 2FVRA 1KC8T 5EWEA 1KONA 1IKWB 1NK5A 1Y00A 5E3QA 1JLFB 1HWJA 4V19J 1TVRB 1NNDA 2MHNA 5M2RA 2W8KA 1Q4RA 4CO3A 5KOWA 3CCVS 3QJLA 2YKAA 3DHWC 3DLBA 4DR6F 1T3OA 2R7UA 3M2RB 4BWMA 1H6KX 3C66A 3FNNA 1OQ3A 4I64A 1SL0A 3Q23A 1IKVA 2J9CA 4N8OA 1FEHA 5DQIA 3F73A 3IA0A 3LGNA 1RAJA 2B6AB 2YX7A 3NAHA 3OXLA 4QR2A 4RBVA 4UUXA 4NXNF 2KZZA 1LWCB 3HF5A 2DGTA 1R0AA 3DLEB 1URNA 2ZOMA 4ICLB 3GE9A 2UUBF 1SIZA 2F1FA 5LMNF 3M1VB 3UDCA 2IM0A 5LL6d 3LWMA 4IQMA 3T5LA 2XG8A 3JAMY 1SKRA 5GAHI 3SFGA 2C3UA 4Q8FA 2C3MA 2HHPA 1Y7PA 2VFRA 3LP1B 1VBXA 2YH0A 4DSLA 4JV1A 2AX0A 1C1BB 4HHJA 1U6BA 5F0WA 2RRNA 3CB4A 4K2XA 3MFHA 1UJ4A 4JI5F 4A46A 2C3OA 3SCJE 2MSSA 4EZ9A 3DI6B 4UQTA 3ZZTA 6FDRA 3NMRA 2I5JB 3MEEB 2MZTA 4J9NA 2OAUA 5IT0A 3DYAA 3US5A 3I31A 2EPIA 3T19A 1U48A 4M1KA 1HWLA 3J7ZT 4A8WA 2FLLA 2M70A 4MK8A 7FDRA 3PM9A 4C97A 1K73T 1JLGB 2CPHA 4CO2A 4ETXA 2A18A 1X4BA 1WI8A 3KNGA 2KFNA 3HVRA 2A2DA 2DD8S 2KXHA 3I9ZA 5M2UA 3N0VA 4I2PB 2ASLA 1TKTA 1AROP 3L95X 4NLVA 4F4ZA 4DF4A 3LP0A 1UP1A 1GTHA 3T1HF 4DQRA 2ADCA 4H4MB 3CCSS 5GAEI 2BQUA 4JI1F 4AFFA 3HHLB 1VQNS 4I67A 2CQGA 2NPFA 1Y0HA 1RT1A 3RTVA 4WFZA 4WXWA 1KLNA 4QIFA 4KJIA 5LJ5Y 2D3OR 3PVXA 2RVJA 4B9UA 2B7BB 4QW8A 2OPQB 4DPOA 1I1GA 1Y3KA 4WFYA 2J6UA 3SCIE 4ED6A 1RYRA 2IA0A 4ZVEA 5DDOC 4A8OA 3C3LA 5HBMB 2IRXA 3D0IE 2JEIA 1PGZA 4CI0B 4PPDA 4QW9A 5J2MA 4KPYA 1ZM3A 4E8UA 3RRGA 1AFIA 2NLWA 1VOMA 1NJWA 1WEYA 1IQZA 1UVIA 1BQNA 2FLNA 3LH2S 1NK8A 5C42B 3M32B 1FKPA 2IA6A 2EI5A 2YKNB 2UVVA 4LSNB 2FJWA 3RRKA 4OJGA 2Z4PA 1Y5IB 5D3GA 4C8ZA 4ECRA 2YKQA 3H2VE 4OLOA 3BSOA 1QAIA 1RISA 3GG1A 3M9OB 4C8OA 5J2PA 5K9FA 5H9FJ 2MZSA 2FPHX 3CJ0A 4NXMF 3BO3A 5IS2A 2XCAA 3QGGA 4RUAA 2F7VA 4EGLA 4EBCA 3JTOA 5EX3A 2VV5A 3OXFA 3PW2A 4DLGA 3KNAA 2GQCA 3FSXA 1RT5B 2LDYA 3KYLA 1XR6A 1XERA 1K0VA 1SJ3P 2GJ2A 2CQ1A 2W9BB 4EYHB 5IM0B 2KYZA 3SQGB 2J7WA 1FRIA 1RTIB 2AQ4A 3G9CA 5KFPA 2ZH1A 1JWWA 5B09A 1FD8A 5K8PA 1WG1A 2PD1A 1HBOB 3IO1A 2K2PA 2QA4G 3IG1A 2ILZA 2QE5A 5J1NA 4DN9A 3J7YI 3TX8A 2WBRA 2NUHA 3WC2A 3TQ1A 5CCLA 3CDAA 5L1LA 1RJJA 4ZCLA 4X4VA 1DQAA 2EFQA 2HPUA 5L39A 3ZZ0A 1YBAA 2AYGA 4N56A 3MMCA 1FTCA 2XLJA 1FRXA 1MSWD 1X8DA 2B43A 2NS1B 1IJFB 1VRTB 2WRMA 3JYTB 3VAIA 2MJUA 4GC7A 4MTPA 5E33A 5L9NA 4LSLA 5HP1B 4PWDB 4O23A 5F9LA 2AJ1A 4B3SF 1GH8A 4EO6A 1DBDA 2YWFA 2PA8D 3FEYB 1DLOA 2Z0GA 2GHPA 3MOZA 3M8QA 2BACA 5J1EB 4OFZA 4U6PA 1FT8A 2XNQA 2EBGA 3FQKA 2ZDPA 4QIVA 4WE1A 3KJVB 2VBWA