5A6WA

Complex of rice blast (magnaporthe oryzae) effector protein avr-pikd with the hma domain of pikp1 from rice (oryza sativa)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
71
Chain Sequence
LKQKIVIKVAMENNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPIKLISALRKKVGDAELLQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords RESISTANCE PROTEIN PIKP-1
publication title Structural basis of pathogen recognition by an integrated HMA domain in a plant NLR immune receptor.
pubmed doi rcsb
source organism Oryza sativa
total genus 19
structure length 71
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5a6wA00
5K9FA 2HFOA 3UDCA 2ROPA 2QLWA 1YJTA 4OJ3A 1N5QA 5KAKA 1OPZA 4DL0C 4QOTA 3MZIA 5B0FA 1OQ3A 2EW9A 1OQ6A 4Q2MA 1P8GA 1TUVA 1CC8A 2K1RB 1N5TA 4YEAA 3HHLA 3QGPA 4HI2A 4HH1A 2GGPA 1Q8BA 3FGVA 2ZDPA 1VQSA 2W4DA 3HDSA 4OIXA 2HLTA 2LQ9A 3BR8A 2KKHA 3GZ7A 3FRYA 1X8DA 2N7YA 4OJGA 3E8OA 1W2IA 1SI9A 1TZ0A 2IFXA 2AW0A 1S6UA 2XMMA 1Y3JA 2PD1A 2W4PA 5B0DA 1Y9OA 1P6TA 2K7JA 3LO3A 2BYCA 1XBWA 5T7LA 2OKQA 2GGPB 1VQYA 4U9RA 1MWZA 2AP6A 3HX9A 3TOQA 1Q53A 1S6OA 1AFJA 2ROEA 1RJJA 2HFNA 4HH0A 1TR0A 2KT3A 2W4CA 3BF4A 3CJKB 2IYIA 2ZDOA 3HF5A 2XMKA 2VH7A 3T9NA 4HL9A 1FE0A 2BJEA 4NPOA 4Y2KA 5T7LB 3BN7A 2OMOA 4ZOSA 2PGCA 2XMVA 2FTRA 2RMLA 1URRA 3VTIA 4Y2IA 3F44A 1YG0A 1JWWA 2FHMA 1KVIA 1FE4A 2OFGX 5B0CA 2BJDA 2OD4A 2QYCA 2RSQA 2ASYA 5IXUA 1AW0A 2BUNA 2VV5A 4YDXA 3HHLB 1X0PA 4FNHA 1MWYA 3FMBA 4F67A 3KKFA 3KG1A 3LGNA 4HI1A 3IWLA 5F0WA 1GXUA 1FVSA 5B09A 1YJRA 3IWXA 1ULRA 3K7RA 5F0UA 4DN9A 4Y2MA 3HFKA 2CRLA 2GCFA 2RU9A 5B08A 2GFFA 3BM7A 2AJ0A 4DPOA 5B0EA 1YRXA 1QUPA 1N5SA 4A47A 2XMUA 2ACYA 2K1RA 4OJHA 2G9OA 2HIQA 2LQBA 4A48A 4FNIA 2N4DA 2KT2A 2K7KA 2BBEA 2HLUA 1CC7A 2IYGA 1LQ9A 2OD6A 1FVQA 2ROGA 1U7LA 2FB0A 1KQKA 4EFAC 2AJ1A 2K2PA 1Q4RA 3HHLD 4Q2LA 1GXTA 2KYZA 2XMWA 5A6PA 1CPZA 2LDIA 4A4JA 2JDJA 1K0VA 1X7VA 3BGUA 2QIFA 1WD6A 1Q8LA 2FIUA 2XMTA 2XMJA 5B0BA 2GA7A 3BDEA 4ZA1A 1FEEA 4OJ1A 5B0GA 1TL5A 2HQIA 1YJVA 3KNGA 2OAUA 2OFHX 3DXSX 3LGMA 3QMQA 1YJUA 1JK9B 1SQEA 1TL4A 1V3ZA 2QLXA 3TNVA 4A46A 5B0AA 3MCSA 2OP5A 3I9ZA 3KG0A 1AFIA 1KVJA 1Y0HA 3BB5A 1FD8A 1R6YA 3DCAA 3HHLC 3CJKA 3TRGA 2Q3PA 1APSA 1FESA 5A6WA 2GO8A 1N5VA 2LXFA 1OSDA 1SB6A 2N4CA 4NL5A 2RILA 3WDOA 2GV1A 1Y3KA 2L3MA 1IUJA
chains in the Genus database with same CATH superfamily
3UDCA 2CG4A 1R7IA 4LBIA 1RK8A 1NSAA 2DHGA 2J9EA 3E01A 3CMES 2AT1B 1YIJS 1NM2A 2CFXA 3HFVA 1Y11A 2OPQA 2RDIA 3WQPA 1MNEA 4OJGA 2HGLA 1S9EB 4X4NA 4LR9A 3RYLA 2F3JA 3H0PA 2DY1A 1XBWA 2GGPB 1KLMA 4KO0B 2BRKA 2OPRA 1M5OC 4PWDA 1X4BA 2XY6A 2BQUA 1XNRJ 5E41A 2RRAA 5DLFA 2YNFA 2CKWA 3BSNA 3T5JA 4HLBA 3PVXA 5HQLA 5BR8F 3ZZZA 1ULRA 2VG5B 3ZZYA 6AT1B 1FNOA 2HWHA 4QWCA 2LMIA 5JVGQ 1M5HA 1SH0A 1GTHA 2CUYA 1EETA 3S1TA 4B3RF 2DCUB 4LRCA 3PRDA 5H9EJ 4Z7YA 2RU3A 4Y65A 2CJYB 1NDPA 3GV8B 1K1SA 3N9UC 5LMUJ 4C11B 4PYAA 4O3NA 1PCAA 2GV1A 4CO2A 2X7IA 4F50A 3A4TA 2EWHA 5KFYA 4LSZB 1FWPA 5GAGU 4OMFG 2MB0B 3P6YC 4WTYA 4DFKA 3J7AN 1EKSA 2VG6B 1HLWA 2FPHX 3VCDA 5KFFA 2DIVA 2MQLA 3D2WA 4IOCQ 4HT7A 3LPYA 3V5RA 4X2BA 4OZ3A 5ETNA 3HD2A 1S9GA 2VG7B 2Y9HA 2XNRA 3G8TA 3A8IA 3TEHB 1TK0A 5HBMA 3PZPA 3HFKA 3F0NA 4A47A 1DBDA 2J0SD 1XERA 3X1LB 1YBUA 3FEYB 4OHWA 3PY8A 2VU5A 4JI2J 2HQFA 4JI3J 4OJ1A 2QN6B 1K1QA 1VBZA 4R0JA 1UVIA 1TELA 1XNRF 1CULA 4B3TJ 1VK3A 1XR5A 1RADB 3MXHP 3T1AA 4PWWA 4UQGA 2BE9B 3FGVA 4DG1B 2W4DA 3CXCR 2CPEA 1TU0B 3GSDA 4DDFA 5K14A 2HK2A 1HW9A 3CULA 1Q53A 4NI2A 4LUBA 1AROP 4QR1A 2H65B 3TEGA 3BN7A 4ZCIA 1FJ7A 2EPIA 1AW0A 5LMUF 4JB8B 4FNHA 3JXOA 4ECWA 3D6TB 4CT8A 2HBYB 1FXLA 3BH6B 2XSJB 4D3HA 1GH8A 2BJ1A 2R7RA 3NMAA 4CNZA 2MSSA 1XMOJ 1N32F 3CJ4A 1S4EA 1FA0A 2M8HA 3NOCA 3PYDA 3NG8A 1OWXA 3RUBL 5J1EA 1Z2LA 3GJQB 1TFYA 3KJVB 3BB5A 1Q82T 2BJ8A 4UOGA 3M2RB 4I7FB 4ANCA 2F4FA 4ZS6A 4WE1A 3LAKA 2MZQA 4CO5A 4IG3A 3DYAA 2YNHB 1QD1A 3EZ5A 4JI4F 2MZSA 2RUGA 7AT1B 4FYYB 2RQCA 4DV2F 3ISND 3AJ2A 4DUZJ 2BVZA 1FNXH 1D9AA 1PJ5A 1S7HA 3NRBA 3ZTRA 2E7WA 4NLWA 4OYWA 3NS5A 1JLCA 4CCHA 1B99A 2UXCJ 3IR7B 3SI8A 3KK1A 3RBEA 2GFFA 5KT6A 2VASA 2E5GA 2J8SA 1U1RA 2FJBB 2QFIA 1IQTA 2W2OP 3JTOA 3LP0A 2XS7A 2VHGA 4W4MA 4MJKA 2PE8A 4A46A 3HO1A 3TWZA 3AD8C 3A3PB 5CYMB 2IMWP 1VIOA 3BSOA 2Z0GA 2H3EB 1C0UB 1VQ7S 1SIZA 1CJKA 2CPJA 1N88A 2PIIA 3PEJA 2E7VA 2A3JA 3GZ7A 1S7IA 4CLYA 4A8SA 1CJUB 1LWFB 2OLWA 3MEKA 4CLTA 3CUNA 2ROEA 4HT5A 2DH7A 1MMNA 2W9CB 4CLWA 2KH9A 2JC0A 3PYGA 1YJ7A 3UD3P 2M8DB 3VAFA 4JI5J 4FYWB 1WTFA 2OIHA 3NP5A 1OYDA 1REGX 1W26A 1JXEA 1RWVB 5A76A 1UWBA 3ETMA 1R8BA 1HIYA 1OS5A 1R3NA 2OO4A 1JJ2R 1XN9A 4PPZA 4DUZF 4K4YA 2CJBA 2XWYA 1X60A 4J37A 2G0JA 3C14A 2R2SA 5CAAA 4K2JA 1RACB 2RILA 3WHIA 2RF2A 1FWKA 4LSNB 3IGNA 4PQUB 3EDQB 4ED4A 1P8GA 2K1RB 1N5TA 2RKIB 3K5LA 3NWGA 1T8EA 2X1BA 4PABA 1T03B 4NLOA 4ICLA 4ECSA 1K0TA 5HN0A 5HJYA 4KHPJ 3R6LB 4M5IA 4RNHA 2WRMA 3EVOA 4AUKA 4ED1A 1PC5A 4OV6A 3GIKA 4X66J 2YNGB 3TX0A 5HP1B 3HULA 5JMNA 2I0XA 1NLKL 4RU2A 1SV5A 3SDEB 3HHLD 1XMQJ 3H4DA 2AV5A 4IG0A 1VRUA 3C16A 3I5CA 4ZA1A 2DNQA 4DL2A 2CZ9A 3PW4A 2HVIA 2IVMA 4F4ZA 3FKBA 2XB2D 1FRXA 3DRSB 4ZVEA 3LF0A 1N5VA 4USWA 5F8JA 3WDOA 5IC6B 2G2YA 2IDEA 2IA0A 5KOWA 2V68A 3Q83A 3M6UA 3NGKA 1S9EA 2MSTA 1KD1T 2GGPA 8ATCB 4KO0A 2YX1A 3C2PA 2VQEJ 3K59A 2D69A 3QWUA 2ZH3A 5AXMA 2RHSB 1RYSA 2QA1A 4KC5A 2R42A 3TZYA 1H72C 2BJ7A 4ETZA 5GMEA 3M2VB 1KQFB 1SQGA 3DM2B 3KDOA 3H59A 4NXMJ 4A8KA 5G4DA 3NGSA 1LNQA 4Y00A 1AXQA 1FDNA 1Z4UA 1MN9A 2BZ2A 2FGOA 2ZWOA 2FJEB 1TL4A 2CQPA 4KHPF 2Q3PA 4USVA 4WP9A 2KXHA 1IUJA 4QIWD 3BO4A 2B4VA 1NHVA 4L3NA 2VA3A 1LV5A 3DGPB 1B0TA 3NKYA 2ZJPQ 3MCNA 1X4HA 3M9OB 3BH7B 2BX6A 5GMKa 4IOAQ 4H4OB 3MPDA 2IFXA 3OPKA 1VIXA 1KQSR 2M2BA 2MY8A 4PR6A 3OJUA 2QA4G 1GNKA 2JJ4D 4ELUA 1D09B 3PFEA 2VG7A 1KOOA 2MZTA 5KFQA 5MLCV 1S10A 4DLGA 3G82B 2HKEA 4KIAA 4JOUA 4CO0A 3ZZPA 1NBEB 4X4VA 3RW7A 3GTYX 4IOBA 3M1VA 1NHKL 4F7VA 1NJYA 1QSLA 3RRKA 2DNRA 3ILJA 1YRUA 2VQEF 5E7OB 4CH0S 1RB0A 1RT7B 4QR2A 4ZN3A 1QAXA 3VQTA 2DR8A 2KYXA 1U02A 5JVHQ 4ZK7M 5G0RB 1FKPB 2GO8A 4DQRA 4WK3A 2M70A 4QIFA 3DMJA 2ROPA 4K8RA 3AODA 1GMVA 3DRYA 1T9XA 1FRHA 3QGPA 2WZ1A 1MWQA 4AD6A 1N52B 2EG2A 4U8VA 2HHWA 4KPCA 2E7XA 4NXMF 3TARA 2APOA 1HPZB 4QR0A 3CPWR 4HKQA 4CTAB 4I2QB 3I87A 4NXNF 3VR1A 3TUZC 3DKDA 1VISA 3C8YA 5IM0B 3FSXA 4AXIA 2UUCJ 1TVRB 2J5AA 2F1FA 4P2SA 3NL0A 2XSJA 3U1NA 4URGA 2EG1A 4ED6A 3OVAA 5KG5A 5KFVA 5IS2A 4WYLA 2PC6A 4OQJA 4NE9C 4OJHA 1OY6A 4QIGA 3UD5A 3ZO7A 2F9JA 3O3LA 3WIVA 1TKDA 1HBNB 2CQ2A 3KJVA 1ITPA 4RO0A 3M2RA 4I7FA 2YH0A 3DN9A 2XMTA 4IR9A 4LBHA 2W9BB 4FS1A 3D1HA 3BDPA 4QWAA 3TAQA 1DTTB 3G6ES 3CD5A 2C2ZB 3SCJE 5DDPC 3EGVA 4RZRA 3HDSA 2AGPA 3L7OA 2CXEA 2XS2A 5E5NA 3CCZA 2JZ5A 4AQYJ 2J8AA 4RW6B 4UZBA 2M0GB 2JEFA 3BN4A 1LW2A 3KLHB 3AHPA 2CVEA 4KB7A 1FX4A 1SBRA 4L6V3 2BQ3A 3GV7B 4EO8A 4C3LA 1GEHA 4NZ7A 4NYOA 3L3CA 3CWJA 5A2QU 3PFOA 2MQNA 5AXNA 5HVFA 2K7KA 1UZDA 3LPEA 3CCTA 1IKVB 3KUHA 3MUVP 5IV4A 3RZAA 4FBTA 3H2UB 4MIBA 1U8SA 4USTA 1L3UA 4GC6A 1BE4A 1JK9B 4TN2A 1C0UA 3UN2A 4CM2A 2UUCF 2G1DA 2VKRA 5T14A 2E9ZA 2B6AB 3I9V9 3NCQA 3MF5A 1CJUA 1VQKS 1LWFA 3PR5B 1FF2A 4DV0J 3OSNA 2CPZA 4I6WA 2QEXS 2E5JA 3CJ8A 4NCGB 4NLGA 3NOGA 2W9CA 2NPIA 4IFVB 1YJNS 4LRDA 3P5BP 2ZEJA 2MHEA 3CJKB 5K8MA 4UZCA 1JXVA 1TL7A 2MKCA 4WZMA 4KH1B 1HNZJ 4UOCA 2PT0A 1AUDA 4Y0FA 1H74A 1KN6A 2Z2MA 2QX0A 4U7UD 3M8PB 4WTOB 4OYIA 1ZM3A 4LFCJ 4DR3J 2FHJA 5CABA 2CQCA 2BW2A 3FZ2A 1QUPA 3I4HX 3R8YA 2I9SA 4AL7A 2GQ2A 1CPZA 3AJDA 3PO4A 1F0XA 3TAMB 5LOQA 4LSNA 3ZFVA 4AQYF 3QMQA 1X5PA 3CCQS 4PQUA 3RRHA 3O8WA 1JLQB 1WEYA 4RBTA 2V8PA 2RKIA 2D41A 2CWXA 3IM8A 3MI7X 4YEAA 1WEXA 5M2PA 1L3VA 1CQMA 3BGFA 2MQMA 3M8QB 5L1JA 5ETQA 1T9TA 5F3TA 1NCLA 4M5DA 1P9QC 1MN7A 3KJFB 5FLXU 4HL9A 1SH3A 3JAMU 2YNGA 3D6MB 3Q89A 1R89A 1WWHA 4HDGA 5HP1A 3W9HA 4QJVA 2QC3A 3SDEA 3Q8VA 4ED0A 1MSWD 1P1LA 2ZBRA 4FKXA 3SCIE 2ADCA 3OV7A 4ED8A 2IVYA 4CH1A 3DRSA 2JNJA 3D0IE 5DQGA 3VHQA 2HFZA 4QIEA 3EXYA 1V3ZA 1WG1A 4P72A 4QIVA 1CJVA 3EE3A 1UVJA 1QAJA 1FTCA 2XZWA 1SL2A 1IKYB 1NSQA 5ITHA 1DQ9A 2EFNA 4ED5A 3B6BA 1HNZF 3EDRB 2DNGA 3MUMP 4Y28C 5KAKA 3PM9A 3I0RB 2Q43A 2LEPA 1UJ5A 3ICLA 3ZZRA 1HQEB 4HHHA 4KH0B 5H1SV 1RAOA 4LFCF 4DR3F 1YI2S 4F4KA 1SKWA 3L09A 3OTDA 4ZVFA 2LU1A 4YUDA 3QGHA 3W8GA 4NLPA 4O3SA 3HMJG 1NJWA 2GAGC 4ECVA 2P8IA 3IS9A 3MD3A 2JX2A 3DM2A 2C2OB 4N8NA 1MG7A 1RTHB 2UVRA 2BJDA 4MK8A 1F2HA 3GCXP 2C2EA 1GXUA 2ZH2A 4L76A 2ZOMA 2RU9A 4OI6A 4B3MJ 5LSRA 1KBRA 3OFHA 2V9WA 3D9BA 4WZQA 4EBCA 3QBCA 1WKJA 2NSBA 3ITHB 1S76D 3ET6B 1O0PA 2WSFC 4ZVQB 1NRKA 3L4BC 1FKOB 3DGPA 1UEVA 3C6TB 4NL5A 4QPXA 1G2EA 1VLYA 1KHWA 4H4OA 4OZ0A 2JEGA 2GVDB 3LQVA 3I5BA 3HZEA 4GO7X 1WG4A 2HSEB 1YTYA 3G82A 2QT7A 4C2MA 1DLOA 1MWZA 2ZH1A 3MM9A 1WOOA 2D3O1 1JKHB 2BACA 3RG6A 1GXLA 2EK6A 1HQUB 3VAKA 3ZZ0A 4NLQA 2RMLA 2JC1A 3BR9A 3FVYA 2QLJB 2QRRA 2ZH5A 4ED3A 3OTCA 1RWPB 3D68A 4UUWA 5KFWA 2VFUA 2QV6A 2NR0A 4DV5J 1RT7A 3WX4A 2N4DA 2MXYA 9ATCB 3FCWA 3RR7A 5G0RA 1O8BA 3CTRA 4C8OA 3RBZA 2NXCA 1QDUB 3RW6A 3LAMA 5KG4A 3PW5A 4QBUA 2QTWA 1S1TA 5LMNJ 1YITS 3QGGA 3GYGA 1X5SA 1F5BA 2B7BB 2HFOA 4DS5A 1RKIA 2JOQA 4DV1F 3HKZD 3H5YA 4NZ0A 4CTAA 3RAMA 3BQ2A 3SCLE 2ZDPA 3DLLQ 4RUCA 2H4YB 3CCUS 3KFWX 4X4OA 1F9FA 3EVMA 5KT7A 5IM0A 4ECQA 3HHKA 2XO7A 1TVRA 1Y9OA 4ZPVR 4DHVA 4OI3A 4RPFA 1YHQS 2QMUB 2ZUGA 3OVBA 3D0GE 1UW9A 1VHFA 1H2UX 3BEGB 3FFIB 3B54A 3BSAA 3K5MA 3K17A 4IR1A 3MMBB 4TQSA 3FMBA 2J0XA 1MMDA 4B9NA 4O44B 1HBNA 4K4XA 3DDNA 2DNOA 1ZZFA 4DSEA 3LA0A 3EPIA 2W9BA 3N79A 4FNIA 4DF4A 1JLFB 4QCLA 1IKWB 2DT9A 3I82A 5B0GA 3UW1A 4BS2A 3ZTQA 2FJDB 3RR8A 3EYZA 3GIJA 2RE1A 1S5ZA 4OZLA 3W63A 1HI8A 4QW9A 5ETKA 3GIMA 3Q24A 4X4RA 2YKAA 2KU7A 4MFBB 3V81B 4RW6A 2E1MC 4P2MA 3KLHA 4DV5F 2GO9A 2MKHA 3QSYB 4FZVA 4P73A 3IN5A 3FEZA 4ERDA 2WHOA 1S77D 3CC4S 3CSKA 2IYIA 1B3TA 2OMOA 4R0EA 3OL7A 5FD1A 4RBUA 1VJQA 1RWWB 3IR5B 1IR1A 3BQ1A 4IQXA 2IMOA 1IKVA 3IFEA 4PXDA 4PRFA 4A8YA 1H0HB 4P2XA 3SCKE 4KRWA 3GMGA 3M30B 5HO4A 4FF2A 1JLAB 5DZ6A 3EWGA 5KFUA 3OHBA 3MECB 1WI6A 3MR7A 4KT0C 2B6AA 1FK9A 1ZTWA 3ENVA 3PYFA 4U7CA 3ETOA 1QE1B 5B0AA 1KVJA 2R7VA 4P9SA 4USKA 4TY9A 3G6VA 4IUFA 4HACB 4F8RA 5HVGA 4NCGA 4DL3A 4DR7F 3TA2A 3JB9k 1CS4B 4IFVA 3H5XA 3R27A 2R8IA 1VR6A 2ZC4A 3FRYA 3D28A 1ZM9A 4N7TA 2DR5A 2YKNB 1AT1B 5AXLA 3I96A 2K7JA 3QT7A 1BQXA 2O66A 4E98A 3EM1A 4PEOA 3HSGA 3M8PA 2DO0A 1C1BB 2D9PA 4HHUA 4UT4A 3F73A 2R7WA 3K7RA 5F0UA 5A8KB 1XC9A 3TAMA 3NS6A 2ACYA 1DTQB 4J90A 3D4JA 2W25A 4B3SJ 4LQ3A 5C7PA 4QZVB 1DZ5A 1JLQA 3PTWA 1HNXJ 3BO2A 2ATCB 3K5NA 1SQEA 1J5EJ 2XG8A 2GIQA 4WP8A 1HMVB 4EMDA 2DRBA 3I0SB 1VC0A 1Q0NA 3SBMA 2VONA 4WPAA 2CZ4A 3BBFA 3PW7A 1XEZA 1I5OB 3M8QA 3RGIA 2B4PA 2GJIA 2DXDA 1Z1ZA 3KLGB 5M2RA 3PHEA 3N4WA 3ZXWA 2I6WA 2PMHA 2XLIA 3BSCA 1NSKL 1D9FA 3C66A 3AOCA 3ULHA 1HBMB 2E5HA 4I56A 3G86A 3FBEA 4ECYA 1Q81T 3R5AA 5DDRC 3LUYA 4H4KC 4QYZJ 2AJ2A 4B17A 3WX8A 4RBVA 4DR4J 3DLGA 1UJ6A 3AXMA 1Y5LB 3VALA 1EKRA 2C28A 3MHYA 2F63A 1CC7A 3M6WA 1SJ3P 1HW8A 2JL9A 4DEZA 4EYHB 2DHHA 3FBBA 4FPIA 1IKYA 3UN3A 4GKKJ 2I38A 3HT0A 1VHIA 3I0RA 1A6LA 1XMBA 1WACA 3DCAA 1HQEA 2QSWA 1PAEX 2OMLA 1SC1B 4RNFA 1Y5NB 3E3XA 2KHDA 1FFGB 4Q2MA 4ZPCA 1OY9A 3AOAA 2ZBPA 4ECXA 1HNWJ 3OL6A 3H7HB 1RAEB 1W2IA 4ECRA 2JWNA 4EGLA 2UVUA 1PIEA 4YDDB 2RH3A 4B3SF 4ZPBA 1RTHA 3BQ0A 1NK0A 1RHUB 1U2RA 2DGTA 1BMQB 3PV8A 2YVSA 3B82A 3GSIA 3IRXB 4UF4A 3GIRA 2QMXA 4ZOSA 1I3OB 4AT1B 3GIIA 3AXKA 3LANA 2KRRA 5L8RC 3WC0A 4OYAA 1E6YB 2G9OA 2LQBA 3ITHA 4ES1A 1JNZB 2UUAF 3CW2C 4ILRA 2QA4S 4A8MP 2DR6A 3IBWA 1FKOA 3CJ3A 3TZXA 2JDJA 2E1RA 4HVZA 4B9LA 1X7VA 3BGUA 5EX3A 3KXDA 4EI2A 1C0TA 2NLWA 3A8EA 5D15A 1K73T 2GVDA 4DUYF 1G1XA 2HZCA 3JS9A 3CDEA 1VLOA 2ZH9A 2AQ4A 5L1IA 5D0GA 3QJLA 2J9DE 4F4YA 4TVAB 4XPCA 2CQIA 3HJVA 1KFSA 4ZPAA 2JFDA 4KGMA 2C3PA 5J2NB 2G4BA 2CDRB 1JKHA 3FCVA 1M1KT 1RSCA 1HQUA 3FK4A 1LFPA 1OYEA 3BYPA 3ZTOA 4NASA 2D74B 2CQDA 3H5SA 4OHXA 5L9XA 2DGVA 4BWMA 3PX4A 4DV6F 1NPPA 2BJEA 3NNCA 3N0VA 1SKRA 3JQJA 1RQ0A 1I6JA 1TUGB 1D8ZA 5AXKA 1PJ7A 5GMDA 5EWGA 2JVRA 2KN4A 3EX7B 1NK7A 1VRTA 3R6GB 4OYBA 1HWKA 3U1LA 4O3QA 5RUBA 2O5DA 4CLFA 5D78A 1HNWF 4FYXB 2WTFA 4CRJA 2HQGA 2LXUA 2HQIA 4PKDB 3P96A 1GMUA 4GVBA 3MCSA 3VWSA 2RIJA 3VQSA 4P6QA 1IXKA 4J91A 1OJ4A 8AT1B 2DNMA 3M05A 4RWXA 3GJTB 3JSBA 3M8YA 4I0WA 2XYPB 3R7BB 1PYSB 2Y1RI 3HHLA 5DG9A 2HHQA 2KKHA 4YB7A 3FC9A 1OPIA 3FFIA 3SSSA 2A2CA 2PDAA 2VDHA 1RAFB 1VQ6S 4FF3A 1K44A 1IBCB 5DDOC 5HK4A 2DO4A 1UJ4A 3QRQA 4O44A 4ETXA 3M6XA 4M5NA 3IRWP 2B7CB 3LALA 2CWKA 3ENWA 1X0PA 1JLFA 1MWYA 4WBFA 1WC0A 2QO3A 3DDKA 1NHUA 2QL9B 1S97A 3C46A 1WDTA 4DV7J 4P71A 2AMCB 4ZLNA 4PZVA 1RXOB 2OHDA 5KG6A 1YJVA 1P1TA 2LEAA 3HFZB 1RE1B 1UEKA 3U27A 1WNEA 4MFBA 1U2FA 2LDYA 5ETPA 3X3UA 3V81A 2CJAA 5DJBA 4J9KA 4KGKA 2AGQA 3L9ZA 4JI1J 4HTJA 4K4WA 3AQOA 4OJ3A 3VZIA 2QL5B 2X51A 3A1YG 3CIMA 2YWEA 2AHOB 1RWNB 4KJIA 4YP3A 2W4PA 1UVKA 3BPSP 5D4LA 4F25A 1F9HA 3QZ8A 4DJBA 2F5GA 4MYTA 4JI8F 1TUWA 5EHHA 1MROB 1LK5A 1B70B 1RTDB 5D3GB 1XTZA 3ZNJ1 4P74A 3IG1B 1IM6A 1JLAA 3GONA 2QA2A 1MMLA 3MECA 1LXNA 2VUGA 5F8MA 3MEGB 4EBEA 2CPFA 4DSLA 1PO6A 2F7VA 2W1BA 3MM8A 2HNDB 1Q95G 1R6VA 1YJ9S 4EZ6A 2EFOA 4ZPWR 4M5LA 1UTAA 3I5AA 4HACA 4ZPDA 2H9ZA 1NPKA 1CS4A 1RCOB 3W7BA 3R5CA 1TKZB 1C2PA 1U2CA 4C48A 4DX8H 2PEHA 7FD1A 3W1YC 4C9DA 3KLEB 2FJAB 2QLFB 2UU9J 4RUAA 4B9SA 3PACA 1O5JA 1YDLA 4F36A 1TKTB 3FDSA 2B9EA 1C1BA 2V2KA 1TQLA 3DRRB 2QLBB 2F8MA 1SJ4P 5C25B 5LM7E 5IT9U 3TVZA 1DURA 4KY3A 4ZVPB 2YXLA 2FY8A 2VC0A 3H40A 2ZJRQ 4K4UA 1F9EB 3NBPB 1JJ4A 2R4FA 1WC1A 4DPOA 2OH2A 4ZHRA 3W64A 4KHRA 2ZVIA 4LMZA 3JSRA 4USIA 4QU7A 1M5VC 1HMVA 2XTJP 3QO9B 4A4JA 3CCSS 3I0SA 3OL9A 5J2MB 1RT5B 4TU9A 1UFLA 1RWXB 1GTEA 2FYXA 2ZC3A 4YR0A 2OP5A 2MLZA 3KLGA 1R6YA 3LOUA 2HBZB 2LA4A 2V4QA 1OSDA 2NXNA 2FZCB 3DU5A 3MM7B 4HH1A 4AFFA 4N47A 1HBMA 1S6QB 2N7YA 3GB0A 2XM3A 1Q86T 2VZ9A 3PW0A 2AU0A 1WC5A 2CNLB 2F65A 1S4FA 1WOPA 1BQNB 2NUUG 3CF5Q 3UO0A 1ZM2A 2XMVA 3DGVA 6FD1A 1U0HB 2XCPA 2CNNB 1FRLA 3UR3C 2AEFA 2MTLA 4TLRA 5B7WA 2FB0A 2GJ2A 5LL6d 3ADAC 2MGZB 2JSXA 1ZS6A 1NNDA 2VODA 1UVNA 2WVEA 1YJUA 4LF9J 3MPYA 3MTKA 4YQWA 3BJYA 3KJNB 1IJEB 1QSSA 1DARA 1NEEA 3T9ZA 3SSQA 2ALYB 4LVNP 1S0MA 2RD5C 2FZGB 4EYIB 2EFQA 1Q1KA 2NXEA 4YR3A 4NOHA 1K8AT 4MIAA 4NLYA 3UCZP 3TJ8A 2BE7D 3UWTA 2P2CB 2CAJA 1JQGA 3D66A 2I5JB 4IFYB 1N33F 2FHOB 2HW3A 3QLHB 4R5PB 2YX7A 4NCAA 4YOEA 4AL6A 4J9OA 4AXJA 2G1HA 3SEOA 3P4UB 4B9VA 1QTNB 2MDAA 4ECUA 5KG7A 1U6ZA 3KNAA 3SQGA 2CPHA 2UP1A 4WFBQ 4DXLA 1FJEB 5E3RA 1M0SA 4LF7J 4N76A 4KV8B 1APSA 2BR0A 2Z30B 3CMQA 1KSPA 4G6VB 5J2NA 5DM7Q 2FVQA 3MM5B 4RW7A 2DGUA 4LF6J 4K59A 4DV3J 1IBLJ 5AE2A 1CC8A 1E6VB 1T9UA 4RU9A 5DETA 3W61A 1DQAA 4WCEQ 4KHMA 5H9FK 2CQ3A 3HX9A 5KFGA 2XEXA 1RBAA 2W7OA 2EEYA 4GRSA 4LF9F 3HKWA 4TLQA 4QYZK 1HBUB 1PAUB 2BABA 5HMXA 2CNOB 4ATNA 3FQLA 1S99A 1JB0C 4JBCA 2ZKUA 2HVZA 2HMIB 5BJRA 1NB7A 1NDLA 2O3DA 4DQIA 1FVQA 3ZZOA 5AJ3J 4NLXA 1X31C 4LIWA 2VOOA 5MAOA 1UP1A 1FXDA 5HMZA 4Z2XA 4OX9F 1WHVA 3MMCA 1NK5A 4B3RJ 4RNOA 2MZ1A 1ZZNA 3OQ2A 4LFBF 1O6XA 2CDQA 1DFDA 2ZZNA 3BZQA 4LF1A 1U1QA 1S72S 2J76E 4RLEA 1SI9A 3OFEA 4KGXB 1FI4A 3EICA 2OKQA 2X3DA 4U9RA 4DQPA 3OTBA 2PEBA 4YN3B 1WF2A 1BLUA 2XQCA 1R8AA 4ZP8A 1LWCB 1SC6A 3BS9A 5IWAJ 4DV3F 4DR1J 1IBLF 3S7RA 1NXIA 3Q23A 1U1NA 3ELHA 4IH5A 2ZH7A 4EFAC 1N0UA 1X4DA 2V94A 1A7GE 2DNNA 3PNIA 4FF4A 1NAQA 1F6TA 3DXSX 2HYIB 2Z56B 4K50A 4TYAA 1BXNA 3H4BA 1GMWD 1UAWA 2E1AA 9RUBA 1PYTA 2Q6BA 3HHEA 2ZJQQ 3MMAB 3NY0A 4F0MA 1QM9A 3H42A 1M90T 2W2NP 1UW4A 2R7XA 1RTIB 4W90B 3CC2S 2XY5A 1IN0A 1W7WA 1YWXA 2ZWPA 4F3OA 4E8UA 1MROA 4H4MA 3VAHA 4TU7A 1U49A 1RTDA 3TI0A 3MDFA 1EAYC 5AJ3F 5D3GA 4L74A 3RBXA 2ZNZA 4DV4J 4WFAQ 4K7QA 3DLKB 3NLCA 1R0AB 3OR2B 3VTIA 5J1NA 3F44A 3MEGA 1DAXA 4CLLA 1HHTP 1XNQF 2ZE2B 5B09A 1NSPA 2DPJA 4J5OA 3IBCB 4J9QA 2NXUA 4DCPB 1BWEA 2C42A 3TX8A 3BGRB 4TNOA 5CYQB 4TY8B 4Q8FA 4FDFA 4USJC 3D3CJ 4EEYA 5KFSA 3R3TA 3LP1B 1YQHA 2FIUA 1PC4A 2K3KA 2NZCA 3I4PA 3NAIA 1N32J 4ZVGA 3Q8YA 2K3IA 2HHHF 2IVFB 4RUHA 2M3DA 1S1XB 4YY3J 2BA9A 1YJTA 1TKTA 1U26A 1HR0J 4B02A 2DIUA 1SIWB 1TUVA 4NLVA 5IWAF 4C3MA 4DR1F 4ID5B 4QWBA 2ZHBA 1WTBA 5KG0A 4KYZA 4LSLA 1TKXB 1RJJA 5C24B 4JI4J 2QYGA 2YWFA 4CDIA 4B9UA 2G13A 3NBPA 4DV2J 5CXTA 1WKKA 1WKLA 2H51B 2P6SA 5IXUA 1Y7PA 4O0NA 1SH2A 2ABYA 1NKEA 2C3MA 1HA1A 3J80Y 4YHHJ 3WZ0A 1RT4B 5J2MA 2CIMA 3FZBA 2RAQA 4JI0J 1M5SA 2BBEA 4MK7A 1JMTA 1U48A 4Q45A 5L38A 4YB6A 4JP8A 2IRYA 2L48A 4ZDNA 4C0BA 2XYGB 3MM7A 1N6QB 1RA6A 4M1KA 2DNKA 4WU3A 4DV4F 3POTA 4CZCA 1QJHA 3DOKB 3OTEA 2M7SA 1FRIA 1BHNA 1S57A 4E0DA 3OD2A 4IKAA 4ZP9A 1BQNA 5L1KA 1OO0B 2AW0A 3K5OA 4LF8F 1X5TA 2V4JB 1IKXA 4DU7A 1KS2A 2XNQA 4L72B 3TVKA 2WOMB 1U0HA 4PXEA 2R9LA 2C1EB 2WBMA 1TL3B 2GS8A 4F3QA 1JJCB 5IFMA 2LXIA 4Q44A 4YY3F 1H2TZ 2XI3A 2B9YA 2BE2A 2HEKA 4K5SA 5F3ZA 1HR0F 3MPWA 5B0EA 4NA1A 1FD2A 2IDLA 3PJXA 3T5HA 2C2KB 2OTJS 2MPUA 1N34F 2DGOA 3TANA 4KKOB 4ZCLA 2FVSA 2V63A 1IVZA 4QPTA 4Q43A 3MWBA 4MKAA 2IM0A 3LTOA 4ZIWA 4JV0A 3DOMB 1ZPVA 1EB0A 2XMAA 3HVTB 4C97A 4Q5VA 4J7CA 3G2XA 3R97A 4M5KA 2SXLA 5B0FA 2A6MA 1IBKF 2GMLA 2CQ4A 3PRVA 5AE1A 1KKHA 4YHHF 3R5BA 3VAMA 3UI3A 2EC2A 4JI0F 3BGOP 1B4SA 4DZDA 1IBMJ 5HAOA 3QLHA 1C1CA 4R5PA 1PGZA 4XO0A 4CH7A 3L7PA 4DL5A 4FXWA 3UCUP 1N36J 3HT3A 3KOAA 2F9DA 2HURA 3OFFA 3VF0B 4LIRA 4B3OA 3ISZA 4HI1A 4F2RA 2KHCA 2IM1A 2A10A 1S1UB 2V8HA 2ZFHA 2JLGA 1UETA 1P27B 2DITA 4WIIA 3M8WA 8RUCA 1FNMA 1H2VZ 2KZMA 4KV8A 3UN5A 3A12A 2QIFA 2XMJA 3CIZA 4ID8A 3MM5A 1WUUA 2RUSA 3UPFA 2J0QD 1J27A 1RBLA 3T1HF 1RAIB 2KB2A 3HXMA 1PYOB 1E6VA 1SB6A 4J9MA 3BKUA 1X5OA 3T5LA 3BKTA 3UNYA 3UVJB 5F9LA 2B0GA 3KMSA 4NEYA 3QRPA 1B0PA 1S6UA 3UD4P 4MKVA 3OW2R 1HKAA 4RNMA 3E51A 3TOQA 2EBGA 1KTVA 2HFNA 4HH0A 5D4NA 3K5PA 1N48A 2KT3A 5I42A 1U25A 2HNZB 2EFVA 4RW8A 2QZ8A 5KT3A 1NO8A 2HMIA 4X65J 1SXLA 2ZD1A 1XIQA 1B7YB 4ZLPA 1YK9A 3CJ5A 4DX6A 4ZJOA 4DF8A 4C8YA 2V6AA 2DGQA 2CRLA 3JQKA 2U2FA 1H7XA 1QSYA 2AYGA 1F2GA 4NLTA 4CT9A 2HLUA 3KUEA 2HQCA 3KLFB 2GMHA 1CSJA 4L3KA 3M9MB 4K4ZA 2L08A 4WK1A 1IBMF 2DHAA 2FDNA 2X1AA 1FKAF 4ZVSB 2V50A 3O5TB 1MU2B 1WHWA 1QVFR 3MPUB 1N36F 2KL8A 4U96A 2D3OR 2ASDA 4DR6J 4USMA 2CQGA 3M8ZA 1S48A 4EWTA 4LR8A 4FYVB 3ILOA 1EETB 3CCLS 3PW2A 3W5XA 3RAQA 2NZ4A 2LLZA 4EO6A 1LWCA 4C8KA 5ETVA 1U1KA 2HHPA 2B5JB 2GW8A 2XSFA 1TK8A 2RDDA 3LWMA 2B9WA 1FE4A 2MQ8A 5DO2A 3IR6B 1BY9A 1R8CA 2A0FB 4H54A 5ETLA 3OVSA 3CDWA 4QWEA 5DQHA 3OBIA 5SUHA 4OX8A 1CQNA 3BYRA 1VQLS 5I4MA 1PBAA 3BDEA 3MMAA 2IY5B 1KONA 2ZH4A 3LGMA 1M5KC 4DU8A 1S9GB 3VV2B 2Y1LB 4BLGA 1RTIA 1FCAA 5LSOA 4I2PB 4J9UE 2M5YA 5HBMB 4NWBA 2DY9A 4K4TA 4X65F 4TU8A 1NJZA 3NMRA 1R8PA 3WC2A 2PI5A 1F1BB 3W60A 4HTIA 1V6HA 2VG5A 2KO1A 2OELA 2PSZA 1RI7A 2WSCC 5D0EA 2O01C 3N28A 4UUXA 4G1PA 2YQ3A 3DLKA 2FVPA 3OR2A 3NGTA 3DU6A 2G2ZA 4NLSA 4LRAA 2ZE2A 3EGNA 2FGCA 2PA3A 2CADA 2XY7A 4KTQA 2PGCA 1LWXA 4NXNJ 3EGZA 3W2WB 3O44A 2RSQA 2HS0A 3BGRA 4YDXA 4NMXA 5CYQA 4TY8A 2Z57B 4C11A 5HQMA 4DR6F 1RCXB 5JUMA 1NPRA 4J9SA 5KFTA 1SPBP 2KZZA 2L41A 1X9WA 1UPPA 2HZAA 2FLLA 2IM2A 4Z7CA 3SFUA 1Q8IA 4Q2LA 3CDUA 3U1MA 2VFSA 1R31A 2IIHA 2LYVA 2VG6A 1S1XA 5LSLA 1AB8A 3CD7A 3CC7S 4WU2A 2HWIA 2RRBA 2I8EA 4EU0A 4ID5A 4ZP7A 3OT9A 4PG7A 5HROB 1RYRA 3PKYA 2IA6A 4QOTA 2KM8C 4I64A 5F8IA 4P7VA 3M7VA 4RNNA 1YLXA 1TKXA 1F5CA 3A3NB 2MMYA 1IM4A 1PG5B 3D54A 4JV2A 2Y8WA 1EQMA 1U6BA 4XDCA 3OSPA 1YSJA 4OZ1A 4Y2AA 3MFHA 3ZZUA 4I68A 3KWMA 3W3SA 1RT4A 4LFAJ 4IG3B 1VBKA 4WJBA 1FVSA 2E9RX 2CQHA 5KFIA 2XMUA 4ENOA 3I56S 4DG1A 3SYZA 4S0MA 2DXFA 1U6FA 5KFXA 3V4IB 1VOMA 3TVYA 3HI9A 2HVDA 3DOKA 2FJWA 1U8WA 2R7SA 3V2UC 2LA6A 2Q6CA 2N3OA 1FESA 2YX4A 3HHNB 3KMQA 2MJUA 3R5JB 3D7SB 3OR1B 2AYEA 2KDOA 1YX2A 2HWTA 2V4JA 2RQMA 4U6PA 4IH7A 2DCLA 3GJRB 5CCLA 2WOMA 3VAJA 3HD1A 3TUPA 2EBEA 2BV3A 3PR4A 1VQYA 1FDDA 3TW0A 1SJQA 2FTRA 1R8HA 4Y3CA 5JJBA 4FXVA 1CJKB 1TL1B 3CDBA 3EUNA 1HWJA 4TYBA 2MZRA 5KFEA 4J9NA 2YNHA 3CT9A 2DJWA 4JYAJ 2BOAA 1ZOTA 2CQBA 2ATLA 5KFKA 3DOMA 2BANB 3FJ2A 1S59A 3J7A1 3AA9A 1HFEL 1HI0P 2HFUA 2DR7A 4LJMA 4R8UB 2C2NA 5A6WA 3ZTSA 2KI2A 1KOHA 4LFAF 1RZMA 1JLGB 5THWA 3C3LA 2MKJA 1BD6A 3CJSA 3BPDA 5A0YB 4ZJQA 4WFXA 2XLJA 1IWAA 2XZTB 4UY8T 4L75A 2J7KA 3UDVA 2G2OA 2BKPA 3W9JA 2XZDB 3Q8UA 3V6HA 2HS3A 1Y4ZB 1SVDA 5IV3A 1B7FA 4B9MA 1HQ2A 2CPYA 4DPYA 1C4AA 5K8OA 2HNYB 5CYMA 2Z2ZA 2JFKA 3JSMB 4B9TA 4YMEA 4OZ5A 3AJ1A 4PPDA 5ETSA 4PG6A 4G1IA 2H1YA 3TZZA 2WVBA 4O23A 2E5IA 4U7UK 4NLUA 4I4BA 4WFNQ 1I94F 1HD1A 2H54B 2PMZD 4ANDA 5D8HB 3MAHA 2FJVA 3QQCD 3OXGA 2QLXA 4WYWA 3UVJA 1S9FA 3Q8SB 1YRTA 1T02A 1X4FA 2QL7B 2B8PA 2V2VA 2GHWA 4LF4J 1SV5B 1UKUA 2LQ9A 2HHTA 4IG0B 4OYMA 2HNZA 4IO9Q 2FVCA 4YB5A 1SL0A 4JYAF 3IMQJ 1TR0A 2HGMA 3BF4A 2UXBF 1WELA 1S0OA 3CD0A 2NREA 2YWKA 2R2UA 3KLFA 1S12A 4M94A 5JXSA 2MYFA 1IQZA 4ES3A 2PMWA 4DR5J 2K1RA 2WVCA 1VC6A 5HANA 2ROGA 2FVRA 2GX8A 1MU2A 3C19A 2LDIA 2NQPA 4A8WA 2UVVA 2YKMB 4V19X 1RAHB 1RAGB 4CLPA 3JTNA 1T03A 1EP4B 5HLFB 1NZ8A 1N56A 2CNKB 3W5ZA 2V4RA 2ZVSA 4BBYA 2PFFB 1SC4B 4R25A 4GC7A 3GR0A 1KR4A 2AJ4A 4CQ1A 3HHDA 1VQSA 3PDNA 3MEDB 2Z8QA 1FHTA 1TZ0A 2B5JA 3MAAB 1ZTTA 4C8NA 3GFYA 4YR2A 5E0OA 3MD1A 2KJWA 3MAQA 2RDJA 4X84A 3H2LA 3KK3B 3AT1B 2VH7A 4P75A 4OX6A 4OZ2A 3GFXA 3Q2TC 3MURP 4A8OA 2QG9B 2IBKA 2V8GA 5EUHA 1ZAWA 3QNWB 1SL1A 3HP6A 3KK2B 1RT1B 2LVWA 1JNRB 4Y2MA 2VA2A 3NCRA 1D8YA 1OY8A 4LF4F 4GKJJ 3AB2B 3DLEB 3EJMA 2VQFF 4N77A 2AX0A 4ZITA 2GHPA 4GVLA 4I2PA 2XLKA 1AA1B 2J7WA 3TNVA 4ZIVA 3IGVA 4LT6A 2P9GA 5F41A 5M2UA 3IO1A 4OIXA 1NDCA 3HSZA 1X0FA 3M1VB 1HHSA 1N0VC 4X4PA 3KJQB 4B08A 5KFJA 3M2VA 4OHVA 1ZPWX 3QRRA 5I3UB 3SXLA 1X8DA 2CPIA 5F8LA 5F9NA 4DR5F 4DV1J 2BDPA 1V9OA 1S0VA 1ZA1B 2A18A 1IR0A 4EUVA 2N7CA 3H90A 3R1HA 3W2WA 4G3IA 3HF5A 4LRBA 5IT0A 3W65A 4Y2KA 4DUTA 1Q5VA 3DMJB 1S1WB 2LCWA 1RBOB 4OLPA 2DRDA 2B51A 2OD4A 1LXJA 4ER8A 5D0HA 2KXNB 4KQZA 2LEBA 3KTQA 4U8YA 1CLFA 1BWVA 5GAEI 3IBFB 3D1QA 1RAAB 3HVWA 4H4KA 1RHQB 2J7UA 3QJJA 4XAKA 3KHLA 2KT2A 3OJSA 4YB1P 4NLDA 2E9TA 1ZAVA 2XC9A 2XHCA 4Q8EA 5B0BA 3E2EA 5HROA 3F41A 1V5IB 2YWHA 1G7CB 1I51B 2AX1A 1ZAXA 3N6MA 1N54B 1HL6A 2MKSA 2HAIA 2JVOA 3TUIC 3MEEB 4J9RA 3P8BB 4KR0B 2HRTA 5KFOA 2OUGA 2QSFA 4BDPA 4A8XA 5IT9Y 4GKJF 1WG5A 3GCWP 3SV3A 4AL5A 4LREA 4PWUA 1H7WA 2GZOA 2W4CA 2A6OA 2XMKA 4FS2A 3C6UB 1L3SA 2IHR1 2J9DA 1FKPA 3BREA 3CO9A 4DN9A 2X1GA 4FKYA 4JI2F 6FDRA 4JI3F 3IC1A 3V4IA 2P6TA 1HYSB 2DK2A 1LW2B 4B3TF 4WIQA 1HPZA 1R0CB 4I2QA 5KFRA 1HNVB 5T41A 4NEZA 3OR1A 4LF2A 3H5UA 3V6DB 3FNNA 2KTQA 3I31A 3VGSA 2VBZA 4MKYA 3GR1A 1I1GA 2X1FA 5DDQC 2AWZA 5LJ3Y 3D5MA 1HNIB 5C2CA 2YH1A 1B64A 3M32B 4O3PA 1UA0A 3AD9C 1Y3JA 5EN1A 3CVKA 4DR7J 1GMWA 2W2PP 3IAS9 4DR2J 1TL1A 3GJSB 3PJ9A 3CEDA 3G6YA 4ES2A 3DLHA 2VBYA 2LFVA 3OL8A 1XMOF 3PX6A 4OZNA 2LKZA 5DG8A 3KHHA 2OSRA 2DISA 1DTTA 4CNYA 4OX7A 2IPOB 2ZM6J 2VICA 2BANA 4M8LA 4M5JA 4W98A 4DN0A 1UWAA 4ZVTB 3MR2A 4R8UA 3B4DA 1KLNA 1WD6A 4UOFA 1TL7B 3OLAA 1T0TV 2PO4A 1SJ1A 1LKZA 4BHQA 4CI0B 1VQPS 4J9PA 5ADZA 1JLGA 1R27B 2PI4A 3O2IA 5A0YA 2QLWA 1RHRB 4ZJLA 3GQCA 2DNYA 3G87A 4DPUA 2C3YA 3PYEA 1RHKB 2XGQA 4I69A 3H98A 3J81Y 2XMMA 4FN5A 3MPVA 4RUBA 2W01A 2RQ4A 4KSEB 2UXCF 4ZLLA 4OI4A 2HNYA 1NK6A 3JSMA 5DGAA 5CD4A 2Y3YA 2OFGX 2D3UA 2Z58B 4DOZA 1EX8A 4JI6J 3DFEA 4LBPA 3J81j 5GADI 2K8GA 1FFWB 1UFWA 3HZGA 2JH3A 1S1VB 2HIQA 1TMJA 4M5DB 1CJTB 4RWWA 1VRQC 2YWWA 4OFZA 2XMWA 4NYZA 2H5IB 1RISA 4W92B 1N5YB 1NMEB 2DXEA 1GT8A 1RGVA 2DEJA 5CCMA 3M4XA 4ZMMA 2OFHX 5ETTA 4DR2F 4O4RA 3NS7B 2UZAA 2DH8A 4ZVUB 3CJKA 4IRCA 3R9LA 1REVB 4C4WA 4ZP6A 5L39A 4DL0C 2IM3A 3DXBA 1NUEA 3TA1A 5DGBA 2JLEA 2ZOGA 4IDKB 5D4OA 2IC3B 2ZM6F 2MLXA 2AJQA 2WSEC 3TQ1A 3IAM9 1NDKA 1YBTA 2BEFA 4DFMA 1N4LA 1CJVB 3TQEA 4UY85 4DWIA 4C6AA 4C8LA 4JI5F 3G6XA 4FVMA 1FX2A 1Q7LB 2PA8D 3ONQA 3UDLA 1KWMA 3MR5A 1KVIA 5EGYA 1ZYQA 1DRZA 2ACMA 3NEKA 4F4XA 4FXDA 3J7YI 2YKMA 5HMWA 2HHUA 1EP4A 5HLFA 1M5PC 3S01A 2KFNA 3IS9B 1KRPA 1RLCL 2UUAJ 3IP0A 1SKUB 3QYYA 2CA9A 3TRGA 3GU0A 3GFHA 5KFZA 1HD0A 3MEDA 1VJWA 1TAUA 1RU2A 5H9FJ 3FBCA 3K0JA 2WB4A 2RT3A 3MAAA 2HS4A 4DUYJ 3HVAA 1PJ6A 4JI6F 3Q0AA 3GG0A 3KK3A 3CJTA 2R7TA 2CQ0A 2YKOA 1WOSA 1IJFB 4DL7A 3EZUA 1JJHA 4X66F 4RW9B 2FQQB 3MOZA 3K89A 5F8GA 3KK2A 1URNA 1RT1A 3GYXB 2IJNA 5E3PA 5T7LB 1T95A 4X64J 2EC0A 2JRSA 1YG0A 2ZH8A 2R7QA 3TJ9A 5B0CA 5E33A 1XMQF 1K9MT 3DLEA 2R2TA 3RJMB 1LWEB 3CDAA 4DV6J 1BQMB 1TV6B 3BBBA 2C2MB 2IRUA 2VKZG 3N6LA 1T05B 1DLOB 3TUJC 3MM9B 4K4VA 3PIOQ 4WXWA 3R5GA 3V4MA 5BYQA 5KG3A 3KNGA 2B8QA 1TP7A 2CVIA 3I9ZA 1AFIA 3Q8RB 1OMSA 2KRBA 1VQ9S 1G3OA 3US5A 5I3UA 4NA3A 3M9NB 4J9LA 2IRXA 3AH6A 2MQQA 1WF0A 2YKQA 4FF1A 1QVGR 5J2PB 3EGWB 2QFJA 3TYTA 3Q86A 1S1WA 3WBZA 3ENAA 2HRYA 1WSRA 1HWLA 1AZSB 5D0RA 2P9EA 1S1TB 2GVZB 1YJWS 1SUQB 1Q7YT 3ET6A 1VQ4S 2FZKB 5FDLB 4ILLA 1MLAA 2QYCA 1NB2A 2EFGA 2XGPA 3C6TA 3KKFA 4OV1A 3RTVA 2MKIA 3B78A 2VOPA 2WW4A 2WONB 3CCVS 2J6TA 4WFYA 1J5OB 1YVFA 4X4UA 3N5FA 1LQ9A 3D6HB 2UUTA 3T3FA 2KYZA 3MUTP 3KDNA 4ECTA 1XJWB 2MQPA 3QFWA 2BQRA 2O1PA 3MEEA 2LXFA 3Q2SC 4FP9A 4G1QB 4X64F 1NJIT 4P2FA 1GX6A 4WKRA 5H9EK 1RWOB 1X9MA 1YGYA 4V19J 2V2QA 2FC8A 3U7JA 3C6UA 3BKFA 3QAUA 2HBQB 1FRMA 1FJCA 2VL1A 2K06A 2W8LA 4E2FB 2ZDOA 1DHMA 3KHRA 2OEMA 3M6VA 4CLKA 3OLBA 2BKNA 2DGXA 5DG7A 2HHXA 5K8PA 3EZOA 1TMMA 1VMBA 4IRKA 2VV5A 2Q66A 1HYSA 4DPXA 4JI8J 5HJXA 2AJFE 2HVHA 4Y2CA 1YJRA 1RKJA 3LW5C 5F8NA 1HNVA 3DOLB 2WW8A 4DBQA 1VFJA 1KQKA 1GXTA 3V6DA 4DFJA 1ZBTA 2C22A 1PILA 3L95X 2NYHA 3OFGA 4N8OA 1T9VA 5ETRA 5K8NA 1SJRA 3HCXA 1HNIA 4LRFA 1UPMB 2L3MA 1ZH5A 3GP9A 5E3AA 1U47A 3M32A 1VS3A 2HBRB 3A3OB 4F0HA 1N5QA 2O67A 3MMBA 1RHMB 2MY7A 2C3UA 3R1LA 4GO5X 3SV4A 2OEKA 1HI1A 3NGUA 5CD4H 1FK9B 1IKWA 1D3WA 1ZA2B 2OPSB 3O6QA 5DZ7A 2VPXB 3RB0A 4Q0BB 2VPWB 5IZHA 1WC4A 4PYDA 4HR2A 1G6BA 4OI2A 2VFVA 4P7TA 5FIIA 2XBPA 4F67A 4DFPA 1RU1A 1H98A 2GQQA 2ASJA 3Q22A 1YRXA 2WVDA 1FDAA 4ITSA 3CE8A 2W8KA 2JEJA 3FCHA 5BXIA 3RAXA 2MHNA 3MMJA 1W2BR 2VJVA 2FHKA 4CYUB 2E66A 3I6PA 3G9CA 1BGXT 1Y3KA 2YTCA 2M4MA 5EWEA 2ZBIA 2JHEA 2H5JB 2AEJA 5LT5A 1OQ3A 2EW9A 4NA2A 5KFNA 3P45B 3DRPB 3J80U 1D1UA 1RT6B 4URSA 4DLEA 4XDDA 3M30A 5F8HA 2DH9A 2V34A 3W66A 3FQKA 1N8RT 5HMYA 2ZBCA 2E29A 1M1HA 1QE1A 1W25A 1S1VA 1CJTA 3KG1A 3W5YA 2IJFA 4GMKA 2BJ3A 4IYQA 2POKA 1N5YA 3FBFA 1X4AA 2LQJA 2GNKA 3IXQA 2HG4A 2MQOA 5HI7A 4I67A 3NWRA 2YKNA 2V2ZA 1Q8LA 2FD2A 3GG1A 1REVA 1V3SA 4DZ6A 2RQKA 3THPA 4OZJA 4DV0F 4C98A 1GX5A 2OPPB 2EK1A 2L9NA 3DLGB 3UNGC 4MTPA 4IDKA 2IC3A 5I3PA 4OL8A 3LGHA 1F3VA 2HPUA 1F5AA 1X4EA 3A8JA 5A8KA 3AOBA 2XO6A 1DTQA 4DPWA 4ZKAA 2VPYB 3SSRA 4LF5J 2BM0A 2LQ5A 4CWBA 4NPOA 4ZVRB 1ROFA 1U45A 5KG2A 5IQQA 2KXFA 1SJFA 4NYPA 2WB1D 5HQ8A 2XCAA 1N33J 3K2YA 3KHGA 5KFBA 2D3ZA 1U1PA 1LEOA 4DX5A 2CQ1A 1C4CA 5LJ5Y 3RRGA 4V1Ak 2AZ3A 3EPGA 1L3KA 3GFZA 4RX6A 2I1RA 4ZVOB 2M52A 3I55S 4JV5J 2DRAA 2ZBQA 1CEZA 3L7UA 2AD9A 3QT8A 5LXYA 1R0BG 1S49A 2F4VJ 1OPZA 4K5RA 1FT8A 4HI2A 4PCQA 2ERRA 1T3OA 2BMBA 4F0KA 4RW9A 2PN6A 1BC6A 4MAKA 1C0TB 2AF6A 5T7LA 3QAEA 4XIUA 2B56A 4DL4A 2KT5A 5KOXA 3NAHA 1AFJA 4M5MA 2W7PA 1L3TA 1FWLA 1WJ9A 2KM8B 4AYBD 2Z2LA 1P9YA 1LWEA 5J1PA 2FLOA 1BQMA 1TV6A 2DD8S 1KC8T 2ZHOA 4BWJA 4X4QA 5KFDA 2CJQA 1T05A 2ASYA 2YBVA 3KG4A 5GVQA 2Y1IA 4QYRA 5CA5A 3FMWA 2Q1LA 1H6KX 4M5GA 4D3GA 1RLDA 3CCRS 3HSDA 5A8RB 3IM9A 2GIFA 4NZ6A 2AYMA 2DGWA 2V8VA 2WBRA 4LF5F 4P10A 1VCTA 4RJVA 5KT2A 3VZHA 2E5LJ 1TFWA 2RRNA 3D3BJ 4O4GB 3LH2S 1UFKA 3IRXA 5J2PA 2CJ9A 1VRTB 5GAHI 5HSPA 3GLJA 4OX9J 1Q8KA 4ZLJA 1AZSA 1U4BA 2BOPA 4NMLA 1JIHA 1J2VA 2GVZA 2YNIB 2L9WA 1SUQA 1E6YA 4LFBJ 1UVLA 4PAAA 2FLNA 3QT6A 2VD3A 4MMOA 5HVHA 4GVBB 3UDEA 5FDLA 3QJPA 3CJ0A 4F3MA 2J0WA 2V5HG 2XI2A 4JV5F 3ZTPA 4PUOB 1FE0A 1IR2A 4FPRA 4B3MF 4OYPA 2WONA 5FJ4A 1X4GA 1J5OA 1QTMA 3HHLB 1VK8A 3AA8A 2F8HA 3GE9A 1KVKA 3G71S 2F4VF 3P5TL 2OTLS 4DI6A 5B08A 1XWLA 1ACMB 3QGIA 3UQSA 5IOLA 3T1YJ 4JUZA 2IYGA 4N56A 2OD6A 4ED2A 1B0VA 4EK2A 2IBOA 3G96A 2QGFB 1RTZA 1SC3B 1EQ0A 2OI2A 4G1QA 3SMZA 3TO8A 1RDRA 4OI0A 2UUBJ 4ELVA 2KFZA 5E3QA 3RB4A 2HK3A 3QIPB 3FSIA 3I32A 5SZTA 3PO5A 3JYTB 2MKYA 3D67A 3VAGA 4NLRA 5U47A 1G4CA 3Q8QB 4KGZB 4IH6A 4KPYA 1TTHB 2RVJA 5GAGI 2VPZB 1UA1A 4WFZA 1JX4A 3W8PA 5D77A 2I2YA 1WSVA 2XYHB 5IQ6A 1URRA 2JEIA 2E5LF 4Y2IA 5GAEU 2CYYA 4OHYA 4DX7A 1NH7A 3DOLA 1NK9A 4QWDA 3W2VB 5F0WA 3HLUA 1X9SA 3SQOP 1Q79A 1PBUA 4UQTA 5D4PA 1VQ8S 4CIOA 2VBXA 1T7PA 5ETOA 3OTOJ 1RAJA 4G65A 1FO1A 5LXRA 1XNQJ 1U7LA 2V69A 5LMNF 1RUSA 1K0VA 2GAHC 1HBOB 2ZKTA 1LK7A 2ILZA 2V67A 4F4AA 4OI1A 1FRKA 2B3TB 2R7OA 3QIDA 2UV8G 4MK9A 3SZ2A 2VJUA 4CLUA 4IRDA 1RWKB 2HIYA 2WCXA 4IQMA 1FRJA 3AY0A 4TKTA 5J2QB 1KNZA 5L9NA 2DNPA 1OIAA 1OQ6A 4Y34A 4XK8C 3THVA 2HHHJ 3KLIB 3TZWA 3QFHA 5L1LA 3VGTA 2OPSA 3BR8A 3MM8B 2EKNA 2DTJA 3A13A 4XPEA 2AZ1A 2G0CA 5C42B 5B0DA 1JLBB 3T1YF 3LO3A 4Q0BA 1T9YA 3DNCA 1U1OA 4CM0A 4HDHA 4ZPTR 3H8YA 1RWMB 4C8MA 2UUBF 2X3GA 3SFGA 4EZ9A 3ILIA 3N01A 3R7NB 1Q5YA 4DCJB 4F02A 4KFBB 3LGNA 4MKBA 5K5MA 3S6EA 3QT5A 2HFVA 3MM6B 2AJ0A 3B4MA 2IJRA 2E1PA 3PKMA 3CGIA 3T6BA 3GPAA 3BV8A 3RU0A 1WC3A 2DHSA 1TAQA 4CYUA 2XWXA 4NRUA 1WHXA 3R2CJ 1FJGJ 3M2UB 2R8GA 1FEEA 3OXLA 3JSYA 2E44A 4DL6A 3NGRA 3DRPA 2F40A 1CBKA 1WF1A 1RT6A 4ZHRB 2XHWA 2V0NA 3VVTA 2ZZMA 5A2QY 3IG1A 1KP6A 3VGUA 3Q8PB 2LECA 2HLTA 3PHTA 4A8FA 2KVQE 3R2DJ 3OTOF 2EI5A 1QAIA 2VFRA 2Y1JA 2P9CA 2HNDA 3AFGA 4OYOA 2XULA 2V8DA 3T9NA 4LF8J 4DSKA 4C8ZA 3CCMS 3V6JA 2QMWA 5BYSA 3RB3A 1XR6A 3K8WA 4DPTA 2DR9A 2RJZA 1LW0B 3K8VA 4USHA 1TKZA 1U24A 2AIRB 1V3RA 1EHWA 2EVZA 3KLEA 4RKUC 1KEKA 3OXFA 2VBWA 3T41A 3CJQA 2K2PA 1Q4RA 2WVFA 1UZHA 2H5EA 2OPPA 5KFCA 3NCPA 2OAUA 2RHQB 1N34J 2NSCA 5A8WB 2HQ3A 3JQMA 1ZM4A 1UEUA 2YQ0A 3DRRA 1S6PB 3HM9A 3QPIA 5C25A 2YKPA 3PXGa 5CHCB 1VGYA 4DQQA 1D9DA 5E2QA 5K20B 3FSYA 1GQEA 4CO1A 1YZ6A 3K58A 1HHQA 2AEMA 3NGDA 3GV5B 1XQIA 1IBKJ 3QO9A 2QJ3A 1NKBA 1H38A 5KFAA 1FJGF 4F4WA 1RT5A 3J7ZT 4WP3A 4LQ9A 2LQ8A 2CJXB 3T5KA 4ZVHA 3FEXB 1VDHA 5GADU 4WF9Q 2FUG9 2Z4PA 3GYNA 4PG4A 3ILLA 1HNXF 1VQNS 3VGVA 2ZNYA 5KFPA 4RW4B 4PXCA 2DKOB 1J5EF 3PRBA 3LP2B 2M88A 5HATA 2NPFA 3D1OA 3NNHA 1S6QA 4FVCA 4ECZA 2CPDA 1WC6A 4JI7J 4UOHA 5FLXY 3JAMY 1UVMA 3RB6A 4HYKA 4BC7A 5AT1B 2EKYA 2W7AA 3U02A 3H25A 1H3DA 1NJXA 1PKUA 4X4TA 3DI6B 3T1HJ 2YPZA 2HRUA 2DPIA 3IWNC 1RWUA 1UCNA 3SQGB 1QLNA 1FFSB 4OLOA 1JLEB 1T9WA 4I6YA 2FY1A 3TAPA 3D6FB 3CMAS 4URQU 4DR4F 4M5HA 2MGZA 4CLSA 1F3FA 4RW7B 4KBIA 4PXBA 3HJFA 5AE3A 1RT3B 1OSCA 5KFMA 3J7YU 2BUNA 4O3RA 5KFLA 3FRZA 4N41A 4F04B 1EARA 2DYAA 3PX0A 2EFPA 3BO3A 2Q79A 2GIRA 5A8RA 4GKKF 2FC9A 3CCJS 2LP4A 4TQRA 2ZITA 5EX0A 1RTJB 4X62J 2G0IA 1O51A 4O4GA 2U1AA 1AYEA 1TL5A 5DLGA 2R8JA 4JV1A 1ICEB 4IO1A 2VB6A 3AQPA 4MYUA 1VC5A 2RS2A 3C15B 2I5JA 1A9NB 4IFYA 2VIHA 2CPXA 4MIWA 1BUXA 1NKCA 1WHYA 2YNIA 3K57A 4WWSA 2OJ3A 5CZXA 3CJRA 2D7SA 2KJVA 2HQDA 4PUOA 1RT2B 2HFSA 3OUYB 1VYAA 2R8HA 3KLVA 5I3QA 1FXRA 2IAJB 2JLFA 1K47A 1KFDA 1QY7A 2H48B 1JXLA 3MMCB 3AAWB 1R43A 4JI7F 2VFTA 4NCBA 1U09A 3UCGA 2BJ9A 3O1LA 1JWWA 3BBCA 3S8SA 2ASLA 2HVEA 4KAIA 1QUVA 1CG2A 3MCOA 3CD6S 1IWGA 2A1BA 2NCKL 1WI8A 4QU6A 2OEJA 1FERA 4KE5A 2KG1A 5A6PA 3W9IA 2UV8A 1M1GA 2ADBA 4C0OC 3QIPA 1WDDA 4O0IA 4YS2A 2UXDJ 3MCMA 3QSIA 4U95A 2Z2YB 2DBBA 2Y0SD 3G8QA 3JYTA 2GMJA 3KG0A 1Y0HA 4AE5A 2ZZTA 3GILA 1EJ7L 3ZNUA 5CH7B 1T94A 4ZN1A 2HHSA 1HBUA 3MZIA 2MJNA 1VQ5S 4I1TA 3AD7C 2BM1A 2M9KA 4DQSA 3E01B 4C7QA 2CJKA 2B4UA 1EIYB 1WEZA 4C3KA 5KT4A 2R3VA 3NNAA 2OPQB 2FJXA 4X62F 2Y8YA 1VI7A 3HSJA 4XTTA 3W2VA 5KTQA 1KLMB 2OPRB 4DMZA 4PWDB 1QAYA 2VF3A 3MFIA 3IWLA 2CZVC 2YNFB 1VQOS 3DDIA 1X4CA 4F2SA 1HBOA 2AKWB 1LFWA 4H4MB 4HEA9 2C2DA 4P52A 3HPOA 1KTQA 4C0HA 4CLZA 2W9AA 1YBAA 2ZH6A 4PG8A 4F26A 2C3OA 1UL3A 2R8KA 5J2QA 1FEHA 3HVRA 1PSDA 3KLIA 3TJAA 2CG8A 1V5VA 2ZHAA 5C42A 1JLBA 4RL1A 1HARA 1Q8BA 2OSQA 2LU2A 1SCJB 3EXCX 3BGLA 5IT4A 3NXZA 4OYXA 2C2RA 2NS1B 4ZCMA 2BYCA 2J6SA 2A2DA 4M63A 4LR7A 2DEIA 1AUSL 3TR5A 2GQCA 3FUYA 1A0OB 4ALZA 3ENQA 3LWLA 4ILMA 4KFBA 2UXDF 1XK8A 5C2GA 5CZVA 3ISNC 4YFUA 3MM6A 4DCOB 2OGUA 2COLA 2Y0BB 3SIPB 2B9XA 4DV7F 2R2RA 2AGOA 2DNZA 5C5JA 4CO4A 4CP5A 1NH8A 3M2UA 2ILYA 5BYRA 4LSLB 4ELTA 1RP5A 2BRLA 4OYZA 2KFYA 4JI1F 4K0KJ 2VC1A 3KUGA 1F60B 3MGJA 3V6KA 3CCWA 1FD8A 2UUWA 4BC9A 3R7SB 3CB4A 4HHJA 1R0AA 1ELOA 1Q16B 1EZZB 1GK8A 2DHXA 1T3NA 1CULB 3MTJA 2HZVA 1ZETA 2AYBA 4QQBA 3G8SA 3AB4B 2FHJD 1YKWA 4QW8A 1Y00A 3JTPA 4NRTA 3UR0A 1Z2ZA 2QE5A 2W24A 5DS7A 3LP1A 1Y10A 1LW0A 2ZOFA 5K14B 3POTB 3CCES 2PFDA 2W2QP 4NI2B 3ZZTA 1HWUA 5CYJA 2RS8A 4EBDA 3CNQP 4WXOA 2BW7A 2YWGA 2VDIA 2UVWA 4DSFA 3PG9A 4BCAA 3F56A 2GJFA 1IKXB 2AJ1A 5A8WA 1NK8A 2H4WB 3HK2A 3G4SS 5L46A 2P5VA 4Z37A 4USUA 2RNEA 1NZAA 1S6PA 2DVIA 5C24A 4DSIA 3B8HA 5DQIA 2R7UA 2UU9F 2BE2B 5J1EB 2BXJA 4K2XA 1FDBA 2YY3A 3CJ2A 3DHWC 1U1MA 4WE1B 3E8OA 4MH8A 2DNLA 3DYAB 2PD1A 3MR3A 1D0EA 1S6OA 1FTRA 1MW7A 1U1LA 4K0KF 1Q78A 3R5DA 3PEHA 4LVOP 1N6QA 4CO3A 1YZ7A 4DSJA 4RW4A 2N82B 1RA7A 2MEWA 3LP2A 2J6UA 3IWXA 2HGNA 1JLCB 3P3DA 7FDRA 1CVJA 4RR5A 1N5SA 1S0NA 5CQGA 2RB7A 3EVWA 2HHVA 1NU4A 3J81U 1C1CB 3QWPA 3OHAA 3KK1B 1KHVA 3PIPQ 1DQ8A 2GA7A 2MKKA 4KGVB 4PQAA 3TP2A 1GFWB 1SQFA 4Q7AA 3WIUA 4I6AA 3CO0P 2J9CA 3DI6A 3LP0B 3HHLC 1I94J 4B3OB 3TA0A 3ZC4A 4UTGA 1TL3A 1S79A 1JLEA 2GC8A 5DRKA 3MR6A 4TXSA 5KG1A 1DJ0A 2MZJA 2WAQD 4M95A 1KQGB 1NK4A 1RHJB 1RABB 1Y5IB 1U0SA 2ZUAA 1P6TA 3N5BA 2D9OA 2AP6A 2WK4A 2NXJA 1RT3A 2B4OA 3VAIA 4U67Q 3DC2A 4KKOA 2YPYA 3MOJB 3P49B 1L5UA 3RBDA 3UE2A 2V9KA 3QATA 3DLBA 3DRXA 3M8SA 5HL7Q 2KG0A 2N3LA 3D0HE 4WKYA 3J7Z5 1SKSA 2DNHA 4UW2A 2UXBJ 3HVTA 2GCFA 1RTJA 4Y6IA 3BM7A 1GAOA 5EDWA 2XS5A 4MT1A 3THTA 3T6JA 3DLJA 5DM6Q 5I42B 1UWBB 3C15A 4ANEA 3GWCA 4RW8B 4NX9A 2E1CA 2ZD1B 3H2VE 5KT5A 4FYDA 5BR8J 5K9FA 2NYIA 2L9DA 2NUHA 2EXUA 1VQMS 1HWIA 4ED7A 4OHZA 3C14B 3PJWA 3EMTA 1RT2A 3OUYA 1XR7A 3N6NA 5ETMA 2IAJA 4K4SA 2RF2B 1S1UA 2GHVC 3T19A 3W62A 3IA0A 2MLYA 2ALZA 3A8KA 3UFCX 2DGSA 4N5SA 5EWFA 4J9VA 4FBUA 5E3CA 4O3OA 3DHXA 3H20A 4L73A 2HAFA 4ICLB 3VVUA 2FHMA 1VBXA 1KDNA 5IC4B 2KVIA 2D1CA 1VBYA 3QZ7A 5KFHA 3M8RA 1WORA 4ZCKA 4A48A 1T11A 4LF7F 1UMJA 2YQ1A 1H73A 3PCOB 2B43A 5D6GA 1LOUA 4LF6F 4DS4A 1DY3A 4X4SA 2W2MP 4PG5A 3KYLA 5GAHU 1VRUB 2DB1A 4A8QA 2BKOA 2F8EX 2VQFJ 2N4CA 3C16B 1TK5A 2FLPA
chains in the Genus database with same CATH topology
3UDCA 2CG4A 5EWEA 2ZBIA 4F8RA 2JHEA 2CQGA 1R7IA 5LT5A 1OQ3A 4NCGA 4DL3A 1RK8A 2EW9A 2DHGA 2J9EA 3E01A 4NA2A 3CMES 4DR7F 3TA2A 3JB9k 1S48A 5KFNA 1YIJS 4IFVA 4EWTA 3H5XA 2CFXA 3R27A 2R8IA 2ZC4A 3DRPB 2OPQA 2RDIA 3FRYA 1D1UA 1EETB 1MNEA 4OJGA 3CCLS 3D28A 1RT6B 1S9EB 2HGLA 4URSA 1ZM9A 4X4NA 3PW2A 3RYLA 2DR5A 4DLEA 2YKNB 4XDDA 3RAQA 2NZ4A 2F3JA 2LLZA 5AXLA 3I96A 2K7JA 4EO6A 1XBWA 2GGPB 3M30A 1LWCA 1BQXA 1KLMA 2O66A 4KO0B 2BRKA 4E98A 2OPRA 5F8HA 2DH9A 4C8KA 1M5OC 1U1KA 1X4BA 2XY6A 2HHPA 4PWDA 2BQUA 2B5JB 2GW8A 2XSFA 1TK8A 3FQKA 5E41A 1N8RT 5HMYA 2RRAA 2ZBCA 3M8PA 5DLFA 2YNFA 2CKWA 2DO0A 3LWMA 3BSNA 2ZH7A 2E29A 1C1BB 1QE1A 2D9PA 3T5JA 4HLBA 2B9WA 3PVXA 1FE4A 1W25A 1S1VA 5DO2A 5BR8F 3IR6B 1BY9A 3ZZZA 1R8CA 3KG1A 3F73A 2R7WA 3K7RA 1ULRA 5F0UA 5A8KB 2VG5B 3ZZYA 2IJFA 1FNOA 1XC9A 4GMKA 4IYQA 4H54A 2HWHA 2POKA 1N5YA 3TAMA 1X4AA 4QWCA 2LMIA 5JVGQ 3NS6A 2ACYA 1DTQB 3CDWA 3OVSA 2LQJA 2GNKA 4QWEA 3IXQA 5DQHA 3OBIA 2HG4A 2W25A 5SUHA 1M5HA 4LQ3A 4OX8A 1SH0A 1GTHA 1CQNA 4QZVB 2MQOA 1VQLS 5HI7A 4I67A 1EETA 1DZ5A 1JLQA 3S1TA 5I4MA 4B3RF 2DCUB 3BO2A 2YKNA 1Q8LA 2FD2A 3GG1A 1REVA 3BDEA 3PRDA 5H9EJ 3MMAA 3K5NA 1KONA 2ZH4A 3LGMA 1M5KC 2RU3A 1SQEA 1V3SA 2RQKA 2XG8A 2GIQA 3THPA 4OZJA 1S9GB 4DV0F 4C98A 1HMVB 4Y65A 3GV8B 2DRBA 1K1SA 1GX5A 2OPPB 3N9UC 2EK1A 3I0SB 1RTIA 1FCAA 1VC0A 2L9NA 3DLGB 4C11B 4O3NA 2VONA 2GV1A 2CZ4A 5LSOA 4I2PB 4CO2A 3UNGC 4MTPA 2M5YA 4IDKA 5HBMB 1XEZA 4NWBA 3M8QA 3PW7A 2IC3A 4K4TA 4X65F 4F50A 5I3PA 2B4PA 2GJIA 4TU8A 4OL8A 1NJZA 2EWHA 3NMRA 1R8PA 5KFYA 1Z1ZA 3KLGB 5M2RA 3WC2A 5GAGU 3PHEA 4OMFG 3N4WA 2HPUA 2PI5A 2MB0B 1F5AA 2PMHA 2XLIA 3P6YC 1X4EA 4HTIA 1V6HA 2VG5A 4WTYA 5A8KA 4DFKA 2KO1A 3BSCA 2PSZA 2VG6B 1RI7A 2FPHX 1DTQA 2WSCC 1D9FA 3C66A 4ZKAA 2O01C 3N28A 4UUXA 3VCDA 5KFFA 2VPYB 4G1PA 2YQ3A 3DLKA 2FVPA 2DIVA 3ULHA 3OR2A 2MQLA 3SSRA 3DU6A 1HBMB 2E5HA 4I56A 2BM0A 3D2WA 4IOCQ 2LQ5A 4HT7A 4NLSA 2ZE2A 3EGNA 3G86A 2FGCA 2PA3A 3LPYA 4ECYA 1Q81T 4NPOA 3V5RA 2XY7A 4KTQA 4X2BA 3R5AA 5DDRC 2PGCA 3LUYA 1ROFA 1S9GA 1U45A 4H4KC 3EGZA 5KG2A 4QYZJ 2VG7B 5IQQA 3W2WB 2KXFA 3O44A 4B17A 2RSQA 2HS0A 3BGRA 4RBVA 4NYPA 2WB1D 4YDXA 1SJFA 3G8TA 2XNRA 5HQ8A 5CYQA 4TY8A 3DLGA 4C11A 4DR6F 4J9SA 5JUMA 5KFTA 1TK0A 5HBMA 3PZPA 2L41A 2KZZA 3HFKA 1UJ6A 2XCAA 1X9WA 1Y5LB 3VALA 3K2YA 3KHGA 5KFBA 2D3ZA 2FLLA 2IM2A 1U1PA 2C28A 4A47A 1DBDA 3MHYA 3SFUA 2CQ1A 1Q8IA 1C4CA 1CC7A 3M6WA 5LJ5Y 1XERA 1SJ3P 3RRGA 2J0SD 3X1LB 1HW8A 2JL9A 4DEZA 4EYHB 4Q2LA 3FEYB 3EPGA 1L3KA 3CDUA 3GFZA 4RX6A 1IKYA 3U1MA 4OHWA 2VFSA 3PY8A 1R31A 2LYVA 2I1RA 2VG6A 1S1XA 2M52A 5LSLA 3I55S 2I38A 4OJ1A 3CC7S 3CD7A 2DRAA 1K1QA 4WU2A 1CEZA 1VBZA 3I0RA 1A6LA 1XMBA 2HWIA 2RRBA 2AD9A 1WACA 2I8EA 3DCAA 4R0JA 1HQEA 2QSWA 1UVIA 1XNRF 4EU0A 2OMLA 5LXYA 4ID5A 4ZP7A 1VK3A 4PG7A 5HROB 1XR5A 1S49A 3MXHP 1RYRA 1OPZA 3PKYA 4K5RA 4QOTA 1Y5NB 3E3XA 2KHDA 3T1AA 4RNFA 2IA6A 4UQGA 2KM8C 4I64A 4Q2MA 5F8IA 1FT8A 4HI2A 4ZPCA 4PCQA 4P7VA 2ERRA 3FGVA 1T3OA 4RNNA 4DG1B 2W4DA 1TKXA 1F5CA 3CXCR 4ECXA 2MMYA 3OL6A 1IM4A 3D54A 4RW9A 2PN6A 1BC6A 1W2IA 4JV2A 4ECRA 2CPEA 2JWNA 4MAKA 4EGLA 3GSDA 2UVUA 4DDFA 1C0TB 4YDDB 2RH3A 5K14A 2AF6A 4B3SF 5T7LA 3QAEA 4XDCA 4XIUA 1U6BA 1HW9A 3OSPA 2B56A 3CULA 4DL4A 2KT5A 5KOXA 1Q53A 3NAHA 1AFJA 1YSJA 1RTHA 4ZPBA 3BQ0A 2W7PA 1L3TA 1NK0A 1U2RA 4OZ1A 2DGTA 4LUBA 4Y2AA 3MFHA 1AROP 4QR1A 2KM8B 4AYBD 3ZZUA 2Z2LA 3PV8A 2YVSA 3B82A 3IRXB 1LWEA 5J1PA 2FLOA 1BQMA 1TV6A 2DD8S 3BN7A 4I68A 2QMXA 3KWMA 4ZOSA 4ZCIA 1KC8T 2ZHOA 3W3SA 1RT4A 4BWJA 4X4QA 1FJ7A 5KFDA 2EPIA 4IG3B 2CJQA 3GIIA 1T05A 2ASYA 1AW0A 5LMUF 3KG4A 4FNHA 4WJBA 5GVQA 3LANA 2Y1IA 4ECWA 4CT8A 1FVSA 2KRRA 2E9RX 5L8RC 4QYRA 5CA5A 3WC0A 2CQHA 3FMWA 2Q1LA 1FXLA 1H6KX 5KFIA 2XSJB 4D3GA 2XMUA 4D3HA 1E6YB 3CCRS 2G9OA 2LQBA 3ITHA 1GH8A 2R7RA 3NMAA 4ES1A 4CNZA 1JNZB 2MSSA 2UUAF 3I56S 4DG1A 1N32F 4ILRA 2QA4S 4A8MP 3CJ4A 3SYZA 3IBWA 1FKOA 3CJ3A 1U6FA 1FA0A 2M8HA 2JDJA 2E1RA 4HVZA 5KFXA 4B9LA 1X7VA 3BGUA 5EX3A 5A8RB 1C0TA 2NLWA 3NG8A 4NZ6A 3V4IB 2AYMA 2DGWA 2V8VA 1VOMA 1OWXA 2WBRA 3A8EA 3TVYA 5J1EA 4LF5F 1K73T 3HI9A 3DOKA 5KT2A 1Z2LA 3VZHA 4DUYF 1G1XA 2HZCA 1TFYA 3KJVB 2FJWA 1TFWA 2RRNA 3BB5A 3CDEA 1Q82T 3V2UC 2R7SA 3M2RB 2ZH9A 4I7FB 2LA6A 2Q6CA 2N3OA 1FESA 2YX4A 2AQ4A 4O4GB 3HHNB 3LH2S 3KMQA 3IRXA 5J2PA 2MJUA 4ZS6A 4WE1A 3LAKA 5L1IA 2CJ9A 2MZQA 1VRTB 4CO5A 3QJLA 3OR1B 2J9DE 2AYEA 4F4YA 5GAHI 2KDOA 4IG3A 3DYAA 2YNHB 4XPCA 2CQIA 3EZ5A 2HWTA 2V4JA 1KFSA 2RQMA 4ZPAA 2JFDA 4KGMA 4U6PA 2C3PA 4IH7A 2DCLA 5J2NB 4JI4F 1U4BA 2BOPA 2MZSA 5CCLA 2WOMA 3VAJA 4NMLA 1JIHA 2G4BA 2RUGA 1J2VA 1JKHA 2YNIB 2L9WA 1M1KT 1SUQA 2EBEA 2RQCA 1E6YA 2BV3A 3ISND 4DV2F 3AJ2A 1UVLA 3PR4A 2FLNA 1HQUA 2BVZA 2VD3A 1VQYA 4MMOA 1FNXH 1LFPA 5FDLA 1FDDA 3QJPA 1D9AA 2D74B 2CQDA 3H5SA 4OHXA 3CJ0A 5L9XA 4F3MA 2J0WA 1S7HA 2DGVA 2V5HG 4BWMA 3TW0A 3NRBA 2XI2A 3PX4A 4JV5F 4DV6F 4PUOB 1FE0A 2BJEA 3NNCA 2E7WA 3N0VA 1SKRA 4NLWA 4FPRA 4B3MF 3NS5A 1SJQA 1JLCA 2FTRA 4CCHA 2WONA 1RQ0A 1R8HA 4Y3CA 1I6JA 5JJBA 1D8ZA 5FJ4A 1X4GA 5AXKA 4FXVA 1J5OA 1QTMA 3HHLB 1VK8A 3AA8A 1TL1B 3CDBA 2F8HA 3EUNA 3GE9A 2JVRA 5EWGA 1HWJA 3IR7B 2KN4A 3G71S 2F4VF 3P5TL 3EX7B 4TYBA 3SI8A 1NK7A 3KK1A 2OTLS 1VRTA 2MZRA 5B08A 5KFEA 3RBEA 1XWLA 2GFFA 5KT6A 2VASA 4J9NA 3QGIA 3UQSA 2E5GA 2YNHA 3CT9A 1U1RA 2FJBB 2DJWA 1HWKA 1IQTA 3U1LA 4JUZA 2IYGA 4O3QA 2O5DA 4N56A 2OD6A 5D78A 1HNWF 4ED2A 1B0VA 3JTOA 1ZOTA 3LP0A 2IBOA 2CQBA 3G96A 2ATLA 2XS7A 5KFKA 3DOMA 2WTFA 4MJKA 2BANB 4G1QA 3SMZA 3TO8A 2LXUA 1RDRA 2HQIA 3FJ2A 3J7A1 2PE8A 4PKDB 4OI0A 4ELVA 3P96A 3AA9A 4A46A 1HFEL 3MCSA 3HO1A 1HI0P 2KFZA 5E3QA 3RB4A 2DR7A 4LJMA 3VWSA 4R8UB 3QIPB 2RIJA 5A6WA 3VQSA 3FSIA 4P6QA 5CYMB 2KI2A 1IXKA 3I32A 1KOHA 2IMWP 5SZTA 2DNMA 1VIOA 3M05A 4RWXA 3JYTB 3PO5A 4LFAF 3JSBA 4I0WA 2Z0GA 3BSOA 1C0UB 3VAGA 1VQ7S 1SIZA 2Y1RI 4NLRA 5U47A 3HHLA 5DG9A 1JLGB 2CPJA 1N88A 2PIIA 5THWA 3C3LA 3PEJA 2HHQA 3Q8QB 2A3JA 2MKJA 1BD6A 2KKHA 3GZ7A 4YB7A 5A0YB 1OPIA 3FFIA 3SSSA 2A2CA 4IH6A 4WFXA 2XLJA 4KPYA 4A8SA 2PDAA 4UY8T 1LWFB 2RVJA 2OLWA 5GAGI 2J7KA 2VPZB 3MEKA 3CUNA 1VQ6S 1UA1A 4WFZA 4FF3A 2ROEA 4HT5A 3V6HA 2HS3A 1Y4ZB 1JX4A 5DDOC 2DH7A 2DO4A 1UJ4A 5D77A 2I2YA 1B7FA 4B9MA 4O44A 4ETXA 1MMNA 2CPYA 2W9CB 5IQ6A 1URRA 2KH9A 2JEIA 2E5LF 4Y2IA 2JC0A 3M6XA 5GAEU 2CYYA 3IRWP 1C4AA 2B7CB 3LALA 5K8OA 3UD3P 4OHYA 3ENWA 2M8DB 1NH7A 3DOLA 1X0PA 3VAFA 1JLFA 1MWYA 2HNYB 5CYMA 1NK9A 4QWDA 2JFKA 3JSMB 3W2VB 1WTFA 5F0WA 3HLUA 1X9SA 4B9TA 4YMEA 4OZ5A 1Q79A 2OIHA 4UQTA 3NP5A 3AJ1A 5D4PA 1VQ8S 1JXEA 4CIOA 4PPDA 1UWBA 2VBXA 4PG6A 2QO3A 1T7PA 3DDKA 4G1IA 1NHUA 1R8BA 1OS5A 1R3NA 1RAJA 1FO1A 1S97A 5LXRA 1U7LA 4O23A 2E5IA 3C46A 2OO4A 4NLUA 4U7UK 4I4BA 1JJ2R 5LMNF 4WFNQ 1XN9A 4PPZA 1I94F 1K0VA 1HD1A 4DUZF 1HBOB 2ZKTA 2PMZD 1LK7A 2ILZA 5D8HB 3MAHA 2FJVA 4K4YA 5KG6A 1YJVA 4OI1A 1FRKA 2B3TB 3OXGA 2QLXA 2R7OA 2CJBA 1P1TA 2LEAA 2XWYA 3QIDA 2UV8G 4J37A 3U27A 2R2SA 4MK9A 3SZ2A 1WNEA 4WYWA 1S9FA 4IRDA 4MFBA 3Q8SB 1U2FA 1YRTA 2LDYA 2RILA 1T02A 1X4FA 2CJAA 5DJBA 2RF2A 3X3UA 4J9KA 4KGKA 3V81A 2AGQA 2WCXA 4IQMA 4LSNB 3IGNA 4HTJA 4K4WA 1FRJA 3AY0A 3AQOA 4OJ3A 4TKTA 5J2QB