1MWZA

Solution structure of the n-terminal domain of znta in the zn(ii)-form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new zinc-protein coordination site in intracellular metal trafficking: solution structure of the apo and Zn(II) forms of ZntA (46-118)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ZntA
total genus 16
structure length 73
sequence length 73
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mwzA00
2AW0A 2GFFA 2GGPB 1Q53A 4DL0C 1YRXA 2PGCA 1URRA 2GCFA 4FNIA 2XMWA 2HLTA 3BDEA 3BR8A 3KKFA 1FE0A 2VV5A 1VQYA 4HH1A 3CJKB 2HFOA 2AP6A 5KAKA 2G9OA 2W4CA 1WD6A 3IWXA 4Y2KA 3T9NA 3HHLC 1TL4A 2FHMA 2ASYA 5B08A 3TNVA 2GV1A 2KYZA 3FRYA 2BJDA 3HF5A 5B0DA 1AW0A 1AFIA 1X7VA 3FGVA 3I9ZA 4OJ3A 1K0VA 1YJTA 4OIXA 2XMTA 1TR0A 4YDXA 2GO8A 2HQIA 1OQ3A 2ZDPA 2ROPA 3WDOA 2OMOA 5T7LB 2OFGX 3MCSA 4HI2A 4U9RA 1VQSA 3MZIA 4OJHA 4ZOSA 1TUVA 3QGPA 2N4CA 1Y3KA 3K7RA 5A6WA 4Y2IA 3UDCA 1YG0A 2GA7A 3BN7A 2GGPA 2RILA 3QMQA 1MWZA 4YEAA 5B0EA 5B09A 3BGUA 4HI1A 4Y2MA 1OSDA 2LXFA 3HHLD 1GXUA 1OPZA 3HFKA 2QYCA 3KNGA 4FNHA 2LQ9A 1FVQA 2OAUA 1FVSA 3BF4A 1MWYA 2N4DA 1RJJA 1SQEA 1YJUA 2CRLA 2K7KA 2KT3A 1CPZA 1SB6A 1KVIA 1W2IA 4DN9A 1JWWA 2OP5A 1N5SA 4A4JA 2OKQA 2RSQA 1YJVA 2FIUA 2IYIA 2BJEA 2KT2A 1P6TA 1U7LA 1OQ6A 2OD6A 1CC7A 1FE4A 4EFAC 3VTIA 1FESA 1TZ0A 2XMUA 2VH7A 1R6YA 1SI9A 2HLUA 2BBEA 3F44A 1TL5A 2FB0A 3LGMA 4HH0A 2BUNA 1Y9OA 2HFNA 2FTRA 3FMBA 4F67A 1V3ZA 4OJGA 5A6PA 4QOTA 1Q4RA 3DXSX 5B0AA 3HHLA 1FEEA 1CC8A 1X0PA 2QLXA 3HHLB 2QLWA 3HX9A 1LQ9A 2ROGA 1IUJA 2K7JA 2XMVA 3BM7A 4NL5A 2RMLA 1AFJA 4Q2LA 3IWLA 5K9FA 2Q3PA 5T7LA 1XBWA 1KVJA 1ULRA 2AJ1A 2HIQA 2RU9A 5B0BA 2ACYA 2L3MA 1YJRA 2XMMA 1Y3JA 2LDIA 2OD4A 4A46A 2W4DA 5F0WA 2OFHX 3E8OA 3KG1A 3CJKA 1N5TA 1Q8LA 3LGNA 3BB5A 3GZ7A 3LO3A 4OJ1A 2IYGA 2ROEA 2IFXA 4Q2MA 1APSA 3TOQA 4A48A 2QIFA 3TRGA 2XMJA 2XMKA 2JDJA 2ZDOA 5F0UA 2K2PA 2KKHA 2K1RB 4A47A 3KG0A 1KQKA 1N5VA 1Q8BA 2K1RA 1QUPA 2LQBA 2EW9A 4DPOA 1X8DA 1JK9B 2PD1A 2N7YA 2W4PA 1S6UA 5B0GA 5B0CA 3DCAA 4HL9A 4ZA1A 2AJ0A 2BYCA 1N5QA 1GXTA 1S6OA 1P8GA 1FD8A 5B0FA 5IXUA 4NPOA 3HDSA 1Y0HA
chains in the Genus database with same CATH superfamily
3BJYA 2AW0A 2KM8C 2HEKA 3U27A 4A8KA 1FHTA 1SV5B 2A6MA 1IJEB 2OSQA 3CVKA 1X5PA 2FGCA 1H6KX 4RO0A 3VZIA 4TQSA 1FKOA 1SJQA 1VFJA 1IBKF 1F2HA 4LF2A 3OUYA 2GJIA 2FDNA 1B0TA 5A2QU 2CPEA 1JXLA 2ABYA 2H5EA 1WD6A 3D4JA 2ASJA 3OR2B 2Y3YA 2RQKA 1HPZA 2KYZA 3FCHA 3P4UB 4DG1B 2NQPA 2F65A 2DRAA 4JV5F 3MR2A 4B9VA 2D7SA 2ZH4A 4YB7A 1N0VC 3KYLA 1XJWB 5HBMB 3A12A 1WHXA 2HVEA 2AJQA 2IC3B 3A8IA 2HZVA 4J7CA 1RE1B 3PX4A 1KVKA 1RWPB 3JTNA 5A76A 3FKBA 3OVAA 1H98A 3G4SS 4UW2A 1NSKL 3HCXA 4L6V3 3CCTA 5BYSA 1NH7A 4PABA 4W4MA 5F9LA 3QIDA 2OUGA 3DGPB 3UDCA 2X7IA 1NPKA 1H74A 1JLAB 3C14B 2OGUA 3IFEA 3OJSA 1UJ4A 4FP9A 3VALA 1SQFA 1TQLA 3KXDA 2W9BA 4DV1F 3D66A 3H0PA 2LXFA 2OPSB 4F8RA 3AY0A 4Q5VA 1RAHB 4NLXA 2CWKA 4I2QB 1YJUA 3H59A 3MM9A 2FVPA 5KTQA 2EK6A 1CPZA 3J7ZT 3SFUA 3KMSA 3DDNA 2SXLA 1JWWA 1GNKA 1HNVB 1IBMF 5KFAA 2PFFB 1UWBB 1FERA 1KR4A 2IYIA 1HYSA 1BQMA 1P6TA 1SC6A 3PACA 4KKOA 5MAOA 3OLBA 2BZ2A 1QAJA 1UJ5A 1CJTA 2M88A 1IQZA 3D2WA 2MQPA 3UE2A 1RYSA 3CNQP 1OO0B 1UEUA 1WOOA 2ZFHA 3BYPA 3D6HB 3N9UC 4DPWA 2MKHA 3DLJA 4ED0A 4RU2A 1WUUA 1H72C 4NCGB 4H4MB 4UZBA 4MK9A 2QJ3A 1LK5A 4YP3A 3QLHB 2HRYA 1RABB 1R6VA 3ENWA 5HO4A 1TMMA 2R2UA 2CJBA 3CCSS 1HR0F 3VAIA 2DGVA 4ZJQA 5KFFA 1FF2A 3VVTA 1S6QA 2P6SA 4IO1A 3NS7B 1QM9A 3SCKE 2Z2ZA 4DR2F 3CB4A 1HW9A 1NZ8A 4Q2LA 1RAGB 1I1GA 1KVJA 2GAHC 2ZJQQ 2R7WA 3VGVA 4FF2A 1NSPA 1ZA1B 2X1GA 4DV3F 4FKYA 4WTOB 5F0WA 5HQMA 2E5LJ 1G4CA 3KUHA 4GO7X 2AWZA 2XLJA 4ZJOA 5DM6Q 1FJEB 4XPCA 2F8HA 3QATA 3BQ2A 1U48A 4DR4F 3A3NB 4I56A 2QIFA 3GJRB 5KFVA 5DQGA 4B9SA 2EPIA 3G6VA 2JDJA 4WJBA 4N47A 5DM7Q 4YMEA 1EHWA 2CQ1A 2FY8A 1GEHA 3B54A 5KFOA 3FQLA 1UW4A 4PYDA 1T94A 1D09B 2FUG9 1RHRB 4MK8A 4NXMF 5CZVA 2AIRB 1F9FA 2HG4A 3B8HA 4WCEQ 4USUA 2XWYA 1CJUB 2VD3A 4F50A 1KLMA 1U0SA 2JC0A 3NEKA 2BKOA 3QT7A 1HQUB 1AZSA 2ZBRA 1D9FA 2JL9A 3V6DA 2GGPB 1N6QB 5IT9Y 4ZP8A 1NNDA 5LT5A 3AA8A 2HGLA 4NLYA 1PAEX 2H4WB 1VQYA 3MUVP 4DQQA 2FZCB 3ENVA 2B8PA 1QVGR 2DH7A 2YNIB 5B0DA 1J5EF 1VYAA 2EFVA 1VQKS 3KK1B 2J9DA 3I9ZA 5C24B 2E5LF 4J9PA 1GTEA 2UUWA 5GAHI 1AYEA 3C6UA 1DTQA 3GJTB 4ED3A 3S7RA 5IC4B 3A8KA 1RBAA 2NZCA 2OFGX 2XNRA 1Q1KA 1WC3A 2FJBB 2GHVC 3A3PB 1U47A 3M9MB 4ZOSA 4MMOA 4RNHA 3H90A 2XHCA 2F8MA 2HNYB 3ISZA 4M5MA 4IG3A 5F3ZA 3RW7A 1U2RA 2G0CA 1FT8A 3HHKA 4F4YA 1S49A 1R43A 4AFFA 1I51B 1UA1A 4I6WA 4KHRA 1YG0A 2GA7A 3OSNA 2VQFJ 2V8DA 3K8VA 1WI6A 5THWA 5IT0A 4IOAQ 1VHIA 1S72S 5B0EA 2GVZB 4IYQA 3R7NB 3HULA 5DDRC 1FDBA 4OZNA 1GXUA 1KEKA 5MLCV 3RZAA 2KZMA 3QYYA 1SJ3P 5H9FK 1ZTWA 1N56A 4ZPBA 2FLLA 2K7KA 2NYIA 4QJVA 2Y8YA 4ED7A 3DNCA 3MPVA 2RKIA 1PYOB 5A8KB 5KFQA 1U1KA 2KFZA 3UW1A 3BDPA 2H9ZA 2IRYA 3HD1A 1XR5A 2HBYB 1CJVB 2VFRA 3RRKA 2OPQB 3D6TB 3H2VE 4KV8B 1ZM9A 2EG2A 3B78A 2KH9A 2VONA 4Y3CA 2VG7B 1GAOA 5LSRA 3H42A 2FHJD 1R6YA 5HLFA 3KMQA 2OPPB 3L4BC 2R7TA 2ZVSA 4CT9A 1RYRA 4MJKA 3CC7S 2BUNA 4MKVA 1SJFA 1QSSA 1X4BA 3P5TL 2DEJA 1REVB 3ZZYA 1SBRA 2F4FA 1CSJA 2OEJA 3CT9A 2CZ4A 3ICLA 3IN5A 4WZMA 3O3LA 3AT1B 4LR9A 3QGGA 4ES3A 3MM6A 2EC0A 4KHPJ 1R8PA 3PFOA 4OMFG 5B0AA 1GX5A 2NS1B 3UWTA 5A2QY 5FJ4A 1KTVA 1S9FA 4LFBJ 1X4GA 2YY3A 4WFBQ 1RA7A 2LCWA 3ZTQA 1PGZA 3H5XA 3N6NA 3QT6A 3RBZA 1RT4B 1TK0A 2HZCA 1QJHA 4ZPVR 5C5JA 2H5IB 3R6GB 2FJVA 1ULRA 1SV5A 1ZPVA 2AJ1A 2BJ7A 4NLDA 3ZTOA 4Q45A 1FRHA 4LF5J 2A1BA 2CZ9A 1P1TA 4I1TA 5J2QA 1B0PA 3CF5Q 3M30A 4CLYA 5KFXA 4QWEA 2ROEA 3KJVA 4TY8A 2F4VF 5L38A 2AZ3A 4RPFA 5DG9A 5ETPA 3E01A 1Z1ZA 3C15B 4C98A 5HN0A 3QRQA 4LF4F 3BSNA 4ES1A 4NEZA 4DUTA 1K0TA 4U7CA 3T1YJ 4LF9J 1Q8KA 3W3SA 1KS2A 5KFDA 1UETA 2XZDB 1LW2B 4P9SA 5G0RA 5I42B 4E0DA 3OTEA 4Y34A 1FJGF 3PYDA 3PX6A 1S7HA 4PYAA 1FI4A 1U02A 3K59A 3GWCA 2HFZA 3DGVA 3MM8B 4J90A 4HT5A 2NPFA 3R9LA 3Q8QB 2R2RA 2LQ5A 3Q8UA 3G82B 1YVFA 1T03A 2CZVC 3VR1A 1HNWJ 4HHJA 4OI1A 4NYPA 3A13A 1RUSA 4OZ1A 1GTHA 3L7PA 5CCLA 4Q43A 3OFFA 3C14A 1HWIA 2ADCA 3EMTA 1U1PA 1RAJA 2AEJA 5LMUJ 1IQTA 2QZ8A 4B3RF 1T7PA 1Q0NA 1MU2B 2CG4A 2MEWA 1EARA 1P27B 1FFGB 1RGVA 2KB2A 4ANEA 2LA6A 2GMLA 3DOKA 5RUBA 3T9NA 2AD9A 2ASDA 1OSCA 5E33A 5KG1A 3PG9A 2VPYB 4OV6A 3SXLA 1G3OA 3SCIE 3IAS9 4TU9A 4Z7YA 3VZHA 4ZK7M 2BQRA 1D0EA 5SUHA 4EGLA 5EWFA 2UUAJ 4ZVSB 2QYGA 1RT3B 2XMTA 3R5GA 3I5AA 1T11A 3L95X 2HQIA 3M6UA 4IG0A 4IFYA 5HVGA 3CW2C 2C3UA 3NAHA 4U9RA 2D3ZA 1R7IA 3W5ZA 1KWMA 4K4UA 4KHMA 1NK5A 3LP0A 1WKLA 1YLXA 1DURA 2Q1LA 4ZVRB 5ADZA 1N34J 2XSFA 2CPXA 3CCVS 2VPZB 2XHWA 3NP5A 1QAXA 1JLFA 1YJNS 7FD1A 1RTHB 3DRPA 1YQHA 3HO1A 4PXDA 4DJBA 4ED5A 4JV2A 1RT1A 2I5JB 3DOMB 2U2FA 5B09A 4IRCA 2BR0A 3BV8A 2HGMA 1X60A 3HFKA 2BV3A 3Q2SC 4BCAA 2HS4A 4FYVB 4UQGA 3M2VA 3BO4A 4KR0B 2KU7A 2OAUA 4L73A 2WOMA 2ATLA 1XWLA 5M2UA 1MROA 2DGTA 2CQ2A 1KQFB 4X64F 1SL2A 2MKSA 1T9XA 4LRDA 4NA1A 2VJVA 3BH7B 1RT7B 5ETSA 3TJ9A 4DN9A 2YWEA 2EVZA 4B17A 4ER8A 1OS5A 2ZWPA 4K4TA 4CO3A 3CWJA 4LRCA 4IOBA 4KH1B 3UPFA 2W8LA 3C3LA 3FSIA 2XS2A 3AJDA 3HHDA 3K5NA 1YJ7A 3AHPA 1U0HB 5LSLA 3OW2R 3ETOA 2XY7A 5EUHA 3I31A 1DQ8A 2DK2A 3JQKA 5GVQA 2BBEA 1TL5A 2ZBQA 2XWXA 4TKTA 3OL6A 1Q7YT 2CFXA 3K8WA 4KGXB 5BR8F 1S97A 1HBOA 5J1PA 2F9JA 2YNHA 1X9WA 1R8HA 4OJGA 3PYGA 2QX0A 3QIPB 4DV5F 3G86A 3SZ2A 4DFMA 4X4OA 4JI4F 3RW6A 1DLOA 4IQXA 3KJNB 2CA9A 3TANA 4OYBA 1YITS 1DJ0A 1NLKL 5IWAJ 3EICA 1AFJA 2W2OP 2HMIB 3TUPA 2PI5A 4YN3B 1RWMB 2VC0A 3T6JA 2Z2LA 1VLOA 3SQOP 3NOCA 3KLGA 3CCRS 1OY6A 1UPPA 2M8DB 4JYAJ 5D4LA 1EQ0A 3BGFA 3GJSB 5J2MB 2E5JA 3LGNA 3T9ZA 3EGZA 4RBTA 3TYTA 4Y0FA 1DHMA 3V6JA 2BE7D 1TL7B 2V4RA 3FBCA 1P9YA 1YSJA 3KK1A 2MHNA 1N0UA 2VZ9A 4HVZA 5C24A 5F8IA 1S1XA 3HSZA 4PZVA 4NCBA 3KG0A 1IM4A 2RHSB 2YKPA 3KHRA 1HPZB 2DH8A 2KDOA 3BS9A 5DG8A 3GE9A 3SV4A 3DU5A 3MAQA 1S0VA 5GAEU 2MPUA 5LMUF 3G87A 3DLEA 1LFWA 4YR0A 4FYWB 2RT3A 4LIRA 1UVNA 3M8ZA 2HAFA 2NUHA 3LA0A 1K73T 3Q8YA 3R6LB 3D68A 3U02A 1N33F 5KT7A 2W7PA 3EZ5A 3T6BA 1YRXA 2NXUA 4LMZA 1B3TA 3UQSA 5C42B 4NZ0A 1VK8A 3GMGA 3AOAA 3T5JA 3T1YF 1L3SA 4LF9F 3F0NA 5CZXA 1VC6A 1RTDA 4Q7AA 2RUGA 4USTA 1V9OA 5AE1A 3FRYA 2FVSA 2L48A 2DJWA 4GVLA 5J2NA 2XULA 3TAMA 1F1BB 4ANCA 1RTIB 4F4ZA 2ROPA 1TFYA 2BABA 1ELOA 3JSYA 3MM9B 3HMJG 2IIHA 3LPYA 3MCSA 2ZHBA 3MUMP 4X2BA 4ELUA 1FRIA 1VQ4S 3C6TB 2WONB 1UWBA 1WF0A 4DR6J 3DGPA 2XS7A 4X4PA 3CULA 2DRBA 2W7AA 1JLQA 3KFWX 3GQCA 4F3MA 2W9BB 3DU6A 5E5NA 4DL6A 2M52A 2JLGA 4E8UA 2HHSA 2EKYA 3PKYA 4ECXA 2DISA 3NNHA 2DY9A 2MZTA 2POKA 3T1HJ 1HWJA 3GP9A 2EG1A 3KK2B 2I0XA 4JI3F 5LJ3Y 3R2DJ 3D9BA 3EWGA 2GJFA 4NE9C 2F63A 2CRLA 1M5VC 2NLWA 1FRLA 3MTKA 3T41A 3U1MA 4ALZA 4C9DA 4K2JA 3SBMA 4DQPA 1YDLA 4A8QA 2L9DA 4QWDA 3PW0A 4UT4A 4P72A 3ITHB 4W98A 1NDPA 2JOQA 2OD6A 4TXSA 3J7A1 1RKJA 2IM0A 4NRUA 3J81j 3QJPA 2CVEA 1FCAA 2B7CB 3GIIA 2B6AA 4ZVHA 4EYHB 2GMHA 2D3OR 1XN9A 2GQ2A 2FB0A 3QT5A 4LF1A 3G6XA 2IA6A 1R0CB 2RVJA 3E01B 1UFKA 2OPSA 3O1LA 1KQGB 2RQ4A 2MYFA 2NXJA 3PEJA 4LIWA 4BC7A 5CAAA 4YY3J 4DQSA 1LV5A 5GAGU 4DX5A 2AGQA 4F67A 3FQKA 4RUBA 2DGXA 2HHVA 5CD4A 1Q81T 1BHNA 2FHOB 3GCWP 5KFSA 2QLXA 4A8XA 4DPYA 1XNQJ 3HVAA 3JSBA 3T5KA 4WXOA 1U09A 3ZTRA 2E9RX 1UAWA 1ACMB 4K4VA 3GYXB 1H0HB 3NCQA 3DLBA 2GZOA 4P2MA 2QFIA 4ED6A 1J2VA 1YBTA 1HQUA 2V69A 3MEGA 2MZJA 3KG1A 4UOHA 1JIHA 2C3PA 4Q2MA 4JBCA 4JV1A 4ZIVA 1BUXA 4DV4J 2XZWA 3MUTP 3QSYB 3I9V9 3Q23A 1SIWB 2DNLA 1C0UA 2VB6A 2AGOA 4F4AA 1JLCA 1JXEA 4C8ZA 2HPUA 1TKTA 3TZWA 1U8SA 1OIAA 1PCAA 1H2UX 1FFWB 1HNIB 4L75A 4P2FA 4WFNQ 1IXKA 2EW9A 2PT0A 5K8PA 2EXUA 1F3VA 4QIEA 4DR1J 1KN6A 3CJ2A 2YKNA 2YQ0A 2EKNA 4JOUA 4F04B 4TQRA 2FLNA 2CNOB 3FEXB 5IFMA 5CXTA 2VOPA 3R8YA 2HZAA 4IH7A 3VF0B 5KFBA 3RRHA 2UVWA 2M7SA 2YH0A 2ADBA 4DOZA 2FD2A 4C8YA 2G13A 3QPIA 2CYYA 1T0TV 4FXDA 4DL0C 4YUDA 4FNIA 2UXBJ 2V8HA 1XQIA 1NHVA 3Q8VA 3BQ1A 2AU0A 4EZ6A 5E2QA 3HM9A 3CJ3A 4FYYB 9RUBA 4HH1A 2MGZB 1V5VA 2J0QD 1EJ7L 5KG4A 4CLFA 1F2GA 2N7CA 5T14A 1N54B 1UFLA 1NKBA 3D1HA 1OWXA 2FHMA 4OYOA 4USWA 4C48A 4X62F 3H2LA 5H9EJ 5AXNA 3CJSA 2E1CA 2QV6A 2DR7A 4PWWA 2F9DA 2V0NA 3HVTB 4KGZB 1JJCB 2B4VA 1K0VA 4O4RA 4YFUA 4A8YA 2ZZNA 3EPIA 2V34A 2ZDPA 1TL1A 2CQHA 2E5IA 4C8NA 1U49A 4RUAA 4ECUA 3W8GA 1Y5NB 1P1LA 2KRRA 2HHUA 2CIMA 2WVFA 3PFEA 4WYLA 3SDEB 3ZZPA 1LEOA 3N6LA 2IJFA 3PW5A 5JVGQ 4O23A 3G71S 1N5YB 2J6SA 4DR4J 4DV4F 1X4FA 3HPOA 3VAHA 3OTOF 5IV3A 4B9MA 4PR6A 2MSTA 4F36A 1G2EA 1NPPA 4LUBA 5A6WA 4DN0A 4F7VA 4Y2IA 3MHYA 5E3QA 4WBFA 1M5HA 3IG1B 3QMQA 2WB4A 5DJBA 1XERA 2O67A 2R7QA 4Y2MA 2RU3A 3CCQS 1LWEB 3W2WA 2QA4S 1FWKA 3P5BP 1XNQF 4K4YA 3R5DA 3A8EA 4F3OA 4OI6A 5I3PA 2ACMA 3ZNJ1 3BKTA 3M6WA 1SQEA 4DR3F 4EEYA 4N56A 2YKAA 3DLHA 1RTDB 2DKOB 3K5MA 5L1KA 1NBEB 2ZUGA 2V68A 4F3QA 1YJVA 4IH5A 2HNYA 2KO1A 4B9LA 1NJZA 4C11A 4DSJA 5CA5A 1LNQA 2XCPA 2QE5A 3W61A 3LW5C 3BKFA 4BS2A 1F5AA 1KC8T 4EU0A 1U2FA 2WBRA 3TEGA 2AJ2A 2GIFA 1CEZA 1GMWD 3K89A 3CDWA 2XSJB 3P96A 4PQAA 4HKQA 3R97A 3CJ5A 3M30B 3NS6A 4UF4A 5IOLA 5D0HA 2JEFA 5GADU 1ZAVA 1FJ7A 3ZC4A 2LP4A 5IC6B 1J27A 2NPIA 2QSFA 3RAMA 7AT1B 1U6BA 2RAQA 2RKIB 3R27A 2HFSA 4LF7J 4K50A 2R7XA 1S7IA 3OR1A 1LQ9A 1WC4A 1CJVA 2OMLA 2UU9F 2WTFA 4NZ7A 3QFHA 1R3NA 4Q8EA 3AD8C 2AV5A 1JLBA 4LSZB 4WP8A 4M8LA 3GV8B 1VQNS 1HR0J 2RJZA 1L5UA 3MM8A 1MNEA 1EQMA 4I6AA 4P74A 3Q8PB 3CD6S 2OD4A 4DR5J 1Q79A 3UVJA 3RR7A 3JB9k 3M6VA 5GMKa 4DQRA 4F2SA 1FEHA 2JC1A 4NLGA 2QLFB 3T5LA 4WXWA 2YWHA 3TUJC 3G6YA 4G3IA 1IKYB 4GMKA 3RBEA 1M90T 4NCGA 4DLEA 4OX8A 3BBFA 2KKHA 1UVIA 2VG6B 1YRUA 4HACA 3W5XA 3ELHA 2XLIA 3MR6A 3PW4A 1FXLA 1HQEA 4HHUA 2MJNA 1LW0B 1Z2ZA 2J8AA 4KKOB 3GSDA 3TQ1A 4WE1A 4ECZA 1VBYA 1VC5A 2X3GA 4WFYA 3AXKA 3UN5A 2J7KA 1Q16B 4FVCA 2IMOA 1Y4ZB 2X3DA 2BXJA 2PI4A 1U25A 2J6UA 2HW3A 2J76E 3CO9A 5EX0A 2OPRB 1VDHA 2PGCA 4LVOP 3UR3C 2R7RA 4NI2B 3FEYB 3VHQA 5KT2A 4QZVB 4F4XA 4QU7A 2G2YA 4CYUB 1B7FA 1HI0P 2ZH7A 3IWXA 3HZGA 1D8YA 2XBPA 3C16B 3VQTA 5E7OB 3J7YU 2VA2A 2C3YA 2IMWP 3PO4A 3MMJA 1VLYA 3MECA 3ENQA 2GO8A 2I9SA 2R2TA 2ZKUA 3G8SA 2OMOA 4DR5F 4X4NA 2KYXA 1JLGA 1E6VB 4DDFA 4DUZF 1B70B 2LU2A 1YIJS 1NZAA 3LP1B 3W62A 3RU0A 5KFTA 1JKHA 1RAOA 1RT1B 4QR1A 1VISA 2GGPA 3DOKB 2C2KB 2AX0A 5KFPA 2KJVA 3NGRA 4ZLLA 3HHLD 4CLUA 3LQVA 3MXHP 4ZS6A 5D3GB 3PM9A 3OSPA 3H2UB 4RW7B 2HHPA 4ID5A 2DCUB 4EWTA 4UOGA 5KG5A 4R0EA 5ETTA 3GV5B 4IOCQ 2O5DA 1KLNA 3PO5A 2X1FA 4I4BA 2VL1A 2J0SD 1KLMB 3NBPA 1KVIA 1F9EB 3EUNA 3H25A 5E3RA 5LMNJ 3MEKA 3VAGA 3RG6A 4DV2F 2L9NA 2E7WA 4LR7A 1AROP 1X5OA 1FD2A 3GB0A 2XB2D 4M5HA 4GKJF 2JSXA 4OYXA 2VG5A 2DY1A 2OEKA 2YVSA 4OYPA 1Q5YA 4O3SA 2W01A 3I0RB 2FJAB 3WX8A 5F8HA 3LWLA 2LEPA 2OTLS 1FX4A 1CQNA 2YNHB 4LSNA 4O3RA 3M9OB 4M5DB 2YNIA 2PA3A 2RDIA 4CRJA 1PJ5A 3OHBA 2G4BA 3FMBA 4MT1A 4PEOA 4G1QB 1V3ZA 2WOMB 4ILRA 2RDJA 4WK1A 1HNIA 2FJDB 1Z2LA 5KFCA 3BGOP 1FNOA 1D3WA 3TUIC 5IT4A 3I5BA 1X0PA 3HHLB 2ZUAA 3IAM9 1B7YB 3PW7A 3IBFB 1ZBTA 3S8SA 3MURP 4KIAA 1K1QA 2RB7A 3PCOB 4DHVA 2MKKA 2VQEJ 2LEBA 3M8PB 5AJ3J 2M3DA 4CLZA 4XDCA 3M8WA 1TTHB 4NMXA 4NA3A 3KLGB 3VAKA 2MKJA 3R5CA 4MFBA 5IQQA 5D0GA 2Z8QA 2DNZA 5HAOA 3ZZOA 2LDIA 4RWXA 1IKVB 1VRQC 5IS2A 5BXIA 1OYEA 1TUGB 2M5YA 4KQZA 3SMZA 3CPWR 3BSAA 3ZTSA 3BB5A 4ILMA 2HRUA 3OJUA 2LFVA 1X9SA 4N76A 2HQGA 4OLOA 4OI2A 2YPYA 3FEZA 2CJXB 3KLVA 4R5PB 3OL9A 3HKZD 3ZZRA 3DHXA 3GPAA 2GMJA 2XS5A 2CQCA 5AE2A 2U1AA 1TL1B 1Q8BA 3HJFA 4DSFA 3DLEB 1KTQA 2V63A 4Q44A 2VIHA 4X64J 2UVRA 1N5YA 3HVWA 2W4PA 5B0GA 1T05A 1LXNA 1KHWA 4M94A 5KG6A 3D6FB 1ZZNA 4C97A 1YJWS 3UDLA 2VBZA 5IXUA 1C0TB 1UVMA 3EZOA 4NA2A 2D9OA 1BQMB 5CCMA 2VBXA 4P71A 1K44A 1TAQA 2MLZA 1VHFA 1BQNA 3GJQB 4HHHA 2FZKB 4L76A 4J9KA 1V6HA 1HNXF 1REVA 2MDAA 3N5BA 4ZPCA 2R8KA 4NLPA 1LWEA 3MMBA 2C22A 3W2WB 1BWVA 2BMBA 2BACA 1K1SA 1UEVA 2HFOA 2ZEJA 3MM6B 4NWBA 3WX4A 4TY9A 4EMDA 4ZLNA 2X1AA 3H4BA 1G6BA 1SC1B 2E7VA 1TL4A 2P9EA 2ASYA 2ZNZA 4I68A 4J9UE 3O44A 1HL6A 4CTAA 4ZMMA 1C2PA 1S6PA 1Y5LB 4OJ3A 1CJKA 3DFEA 1LK7A 3HSGA 4OHVA 4OZ3A 2FHKA 4QU6A 1PG5B 2UUAF 4D3HA 4DZDA 3MM7A 5EWEA 3F56A 2OTJS 2W8KA 5K20B 2D9PA 2M0GB 4J9NA 1SPBP 2UZAA 3TI0A 3KHHA 1TUVA 5J2QB 4QWBA 2YBVA 3OVBA 2Q6CA 3A8JA 1SH0A 3G82A 4IQMA 3MCNA 4CP5A 1T03B 3KOAA 1LKZA 3JAMY 1WTBA 2DNKA 4LF5F 3PEHA 5HROA 1NMEB 3BN7A 3UR0A 1HI8A 1S48A 4C2MA 1QE1A 2RILA 4WWSA 1KOOA 1NEEA 1S9GA 1UZHA 2VDIA 2IJNA 5E3AA 5KOWA 5M2RA 4ECQA 1CULA 4RNFA 4ED1A 2IBKA 3K5PA 2CQBA 5C2CA 3AOBA 5DRKA 5EWGA 1PSDA 1ZAWA 4OYZA 3I5CA 4O4GB 5FLXU 2AYBA 1S4FA 2OELA 4MKBA 1VQLS 2K3KA 3TUZC 3OVSA 3EXCX 2N4DA 4QYRA 1SH3A 3T19A 5L46A 4HDHA 3EVWA 1MWQA 3CC2S 3BPSP 4KHPF 1AW0A 2OP5A 3G96A 1N5SA 2HAIA 4YS2A 2V2VA 4ZVFA 1YI2S 4KO0A 4QIFA 1PYSB 3PXGa 4B3MF 4JI0F 4QYZJ 2KG0A 1CC7A 4QIWD 4R8UB 4LF4J 3GG0A 4ELVA 5A8WB 1ZPWX 5G4DA 4Q8FA 4K2XA 1QVFR 3HI9A 3TQEA 4C7QA 3GIJA 3HXMA 2EFNA 2J6TA 3OQ2A 5JUMA 4RJVA 4EBCA 5HI7A 1TKZB 4IDKB 3PZPA 3D1OA 3LGMA 3BKUA 4ID8A 4ZVOB 3GIRA 4HYKA 3HVRA 3DRPB 1JX4A 5D77A 3RUBL 2DNHA 4NYOA 1HBNB 2Y8WA 1T95A 2KXHA 1T3NA 1OPIA 4U95A 4F4KA 4WYWA 4YHHJ 2UUCJ 3JQJA 3MAAB 1X4EA 2ZBIA 5KFLA 1U1QA 2QTWA 2GX8A 3H40A 3CCWA 3M7VA 4B9TA 3FMWA 2CQIA 2QLWA 4WE1B 1QSYA 4OHYA 3RRGA 1I94F 1JJ2R 3FBFA 2Y1LB 3HP6A 4C3KA 2Z30B 4F26A 3TW0A 5HMWA 1E6YA 1Q95G 1XBWA 2V4JA 2ZOFA 2JHEA 3DRSB 2BKPA 3MPDA 1LFPA 1V3SA 2NXNA 5AXLA 3TZXA 4RNNA 2UUTA 3Q8RB 2FJXA 3HSDA 3S01A 2UU9J 4B3TF 2MQNA 3B4MA 3E8OA 4O3NA 4ICLA 4QYZK 1RWVB 3HSJA 1RWOB 2RF2A 5D4OA 2R7OA 2F5GA 2IYGA 4K0KJ 2B9WA 5HMXA 3TOQA 2QC3A 4Y2AA 1GMVA 1ZM2A 8RUCA 3CE8A 4DS4A 3QRPA 2HHWA 4EO6A 4EI2A 1BGXT 3D7SB 3OFHA 1K9MT 1VQ5S 5EN1A 2P9GA 3P45B 1JNRB 1RT6B 1TVRA 1U24A 5F8MA 2FJWA 3DDIA 3CO0P 1NB7A 2V2KA 3NXZA 4UQTA 3HJVA 4P2SA 1HWLA 3POTB 4OX7A 4DPOA 4RNOA 3MPWA 4I64A 4ECSA 4K4ZA 1T9WA 3EZUA 4Y2CA 3W64A 3BZQA 3PRBA 3N0VA 2NYHA 3IA0A 5AXMA 3GR0A 2IHR1 2HS0A 2DNRA 2A0FB 1NK6A 2DNYA 2ZE2B 5ETRA 3MOJB 1O8BA 1IKWA 2BW2A 2DIVA 4QR0A 4N5SA 3M2RB 4LFAF 2DHHA 2XMWA 3IWNC 3OXFA 3MM5B 4FS2A 2OIHA 4B3SF 2BJ8A 2VJUA 2IJRA 2MY7A 3FFIB 4KPYA 2BANB 2YPZA 2DYAA 2HWTA 5I3UA 4JYAF 2J0WA 4Y2KA 5LJ5Y 1HWUA 1VJQA 4DSEA 2Y1IA 4HEA9 1YRTA 3TNVA 2NCKL 3KHGA 2I8EA 2DR6A 3UD4P 4JI8F 4WK3A 1YJTA 4LBPA 1Q78A 2LYVA 2RRNA 3ZTPA 2E9ZA 4LR8A 1XR6A 2R7SA 5T7LB 3OV7A 4B3OB 1VQSA 4K5SA 1QSLA 1C1BB 4KRWA 2VBWA 3I0RA 2C2NA 5KFUA 4YB1P 1G7CB 1PIEA 4XK8C 3DI6B 1OJ4A 3ETMA 4LSNB 4PKDB 3AD9C 2R42A 4ZN1A 3NY0A 4JB8B 3VAFA 1FTCA 3KUEA 2GS8A 2RRBA 3Q22A 3NL0A 2ZZMA 3OXGA 4X62J 4X4UA 4P73A 2YKQA 1AUSL 2AJFE 3D28A 5C42A 3PNIA 1DQAA 3R7SB 1FKPB 2J7UA 2GO9A 3DLGA 3ILOA 2FVCA 4RKUC 2AQ4A 2KHCA 5BR8J 1LOUA 3OTDA 4ZCLA 1N36J 1DY3A 2CPZA 5GMDA 4KGKA 5CYJA 2V94A 3SDEA 4MH8A 2YKMB 2MMYA 4URQU 2IM1A 4HTIA 2W25A 3UCZP 1VBZA 1RTIA 2CJ9A 4DF8A 2QA2A 3DKDA 4AL7A 4Q0BB 1HNVA 3NGTA 1FKAF 5FDLA 3VTIA 4EFAC 4G1IA 5ETNA 1F9HA 3BGRB 1M5KC 4CNYA 4CH0S 4DS5A 3FVYA 1REGX 2EFOA 3RR8A 1RT2B 3EJMA 4CQ1A 2XO7A 2RQMA 3OL8A 5K8NA 2JH3A 3KJFB 4BBYA 2F8EX 1NDKA 2CDRB 2V5HG 3KLHA 1NM2A 2DGQA 3DRRB 1O5JA 2XG8A 4F0KA 2L08A 5A0YB 1U26A 1GXLA 3VGTA 3DOLA 2MHEA 1T3OA 5LXRA 3K58A 4F02A 2Z56B 4BWJA 4K4XA 1IR0A 1RK8A 2CJYB 2DPIA 2OI2A 2MXYA 2EI5A 3QWUA 1NKEA 4C0OC 1BQXA 1R8CA 2VG6A 2RIJA 2UP1A 2IM2A 3LAKA 4K0KF 3RAXA 2CADA 1RLCL 4NLSA 1RT3A 2PA8D 2ILZA 1EP4A 2NSCA 1N34F 3HZEA 2PMWA 2ILYA 1JLQB 3OTBA 4AXIA 5B0BA 1M5PC 2W7OA 2JEIA 2A6OA 1MN9A 4V19J 3OD2A 3KLFA 4OHZA 4JI7J 3G2XA 5ETVA 3GZ7A 1NSAA 1APSA 4DL4A 4NI2A 1HQ2A 1QAYA 1QDUB 1EETB 4RR5A 2R4FA 4DPTA 1RTJB 4S0MA 5F0UA 1HQEB 1CJKB 2C2MB 4ZP6A 1BMQB 1WDDA 4H4KA 5JMNA 5CD4H 2LECA 2DNOA 4MKYA 1IBMJ 1EAYC 2B7BB 3H8YA 4HT7A 5F8LA 3EPGA 3KWMA 4NXMJ 4I69A 1U1NA 1KKHA 1J5OA 2MQLA 3J7YI 4LQ3A 1MMDA 5EGYA 2CPYA 4X4TA 1WACA 4CLPA 2AJ0A 2VFTA 3EDQB 1RT7A 3X3UA 1WC5A 1WHYA 3M1VB 2KM8B 2IRUA 4LF6F 1FXDA 2FGOA 2YWWA 2E44A 2ZD1B 5DO2A 3UVJB 4UTGA 2P8IA 1F5CA 1FWPA 3BO3A 5ETMA 3DYAB 4PPZA 1WG5A 4RW6A 1IR1A 3KDOA 4YB5A 2DXFA 4CYUA 1X4HA 2HBZB 5HJXA 1L3KA 1SC3B 3CJQA 1M1HA 1XMBA 3J81U 3IM9A 4ANDA 3T1HF 5L1LA 1XC9A 4B9NA 2F7VA 1FWLA 2KT5A 3IMQJ 3CMAS 3PKMA 4L3KA 2BKNA 4PCQA 3V6KA 3MECB 1U2CA 2JLEA 3HF5A 3D0GE 3BSCA 1Q82T 2FC9A 2JVRA 2F4VJ 3FGVA 1VIOA 3SFGA 3HT3A 5K14B 4U7UD 5L9XA 4OIXA 4OZ0A 5D3GA 1CVJA 4X65J 4ZP7A 3DM2A 4ZJLA 4PWUA 4KO0B 3FSYA 3WDOA 4X65F 4DLGA 5D6GA 3CIZA 4DV7J 3HFZB 4RUCA 4R8UA 1DTQB 4ZPAA 4OL8A 3LP1A 2DTJA 4ZPDA 1HHQA 2IVMA 1R0AB 4B3OA 2QO3A 2WRMA 3E51A 4UUXA 5KFWA 2MZQA 4EYIB 1VBXA 4N7TA 2V50A 3LWMA 1GMWA 1Y5IB 5KFNA 2ZH3A 3OBIA 1VQ8S 4IG3B 1VQ6S 1VRUA 3M2UB 4Z2XA 2DO4A 4ED2A 1IBKJ 4OHXA 1FXRA 3PTWA 3V81B 2K3IA 2DR9A 4ZLPA 4YEAA 3RB6A 1BWEA 3CD7A 3K5OA 3I4PA 3L7UA 2XNQA 3M8SA 3H5UA 4ZCMA 2D3UA 2YNFB 4DR2J 3W2VA 5KG7A 1TKTB 1WNEA 2QYCA 1XMQF 2B9EA 2CDQA 1ZM4A 2Q6BA 2Y0SD 4JV0A 5CYMA 1C1CA 3TP2A 2QMWA 2WW4A 1HD0A 2R3VA 4ZITA 5HP1A 2NXEA 2YNGA 3PHEA 2P6TA 2RSQA 5EDWA 4ECVA 1NK7A 1OQ6A 1UKUA 3CCUS 1JKHB 1KQSR 4ATNA 4F2RA 4NLOA 1TZ0A 1WHVA 2BM1A 2O1PA 5BYRA 2RF2B 4O44B 5DDOC 1Y7PA 2CPDA 3QAUA 2F40A 2B51A 4IR9A 4DXLA 2VUGA 4X66J 4K59A 4F4WA 3W66A 1YKWA 5HLFB 4WIQA 2ZH6A 5AT1B 2ERRA 3PX0A 1M0SA 4YOEA 1WF1A 2ZBPA 1FFSB 4NLRA 5KFHA 4AXJA 4JV5J 5F3TA 2GAGC 1Y00A 3DXSX 3KK3B 1N52B 1SUQA 2BQ3A 5KFJA 4FXVA 3SSSA 4DR3J 3NBPB 1FK9B 3A3OB 1KFSA 3M8PA 3UNYA 2PO4A 4PQUA 6FDRA 4MYTA 1HWKA 2XMVA 1UP1A 4WKRA 4A8MP 5DGBA 1BC6A 4JUZA 2EK1A 2E7XA 2GQCA 2V9KA 2WONA 1RB0A 1C0TA 4P7TA 2W4DA 1SXLA 3IG1A 3CJKA 5C25B 2BANA 1ZS6A 3GFHA 1YGYA 3LO3A 4OJ1A 4URSA 2IFXA 1NK9A 2I1RA 2W2PP 5E0OA 1QLNA 1HNZF 4MAKA 1RWWB 5L39A 4DUYF 3TJAA 5GAGI 3Q89A 1R89A 4ERDA 1G1XA 2EFPA 1DFDA 1JQGA 1N5VA 2MLYA 2X1BA 5D0RA 8ATCB 5F8GA 3K0JA 3WIVA 3AJ2A 4B02A 4M5IA 1JMTA 2UXBF 1A9NB 2E1MC 1C1BA 1S0NA 4B9UA 3MF5A 4MFBB 5KFMA 1P8GA 3TX8A 3DXBA 3TVKA 1IKVA 3A4TA 3FCWA 4NPOA 2LLZA 2XY6A 1S10A 2CQ4A 2FQQB 1XK8A 3GCXP 3V4MA 3M8QB 5CHCB 3BREA 2IDEA 3AODA 2CQ0A 3DMJA 2CQ3A 3JQMA 4R5PA 3OTOJ 2HBQB 4V19X 4OZLA 3HHLC 1DBDA 1EKSA 4I2PA 4DFPA 1IBLJ 2GV1A 4DX8H 1TAUA 2BJDA 1QAIA 1BLUA 1QD1A 1MN7A 1X7VA 4DUZJ 2Z2YB 3P3DA 4PUOA 1S12A 3M8RA 2GW8A 3W7BA 4ES2A 4O4GA 1T9YA 1T9TA 2HNZA 4ZDNA 2WZ1A 2ZC4A 4PG8A 3LANA 4KYZA 1HMVA 2N82B 1TV6B 2W2MP 2ZH9A 3HD2A 4IFYB 1FRKA 1FNXH 3W8PA 3MZIA 4OJHA 3KLEA 3RJMB 2WW8A 2QMXA 1PBAA 2DHAA 2N4CA 1T8EA 2OHDA 1K8AT 1XIQA 4MTPA 1S79A 2WSFC 1VQMS 2DR8A 1S9GB 4QIGA 4JI8J 4ILLA 4B3SJ 2VF3A 5KG0A 1EZZB 1H73A 2CJAA 4I67A 1RAFB 2I5JA 3DOMA 5IQ6A 4I2QA 1D9DA 3U7JA 1QTNB 4RLEA 3I4HX 4CLWA 4ZHRB 2J9CA 2IRXA 5DG7A 2NSBA 4C8KA 3PY8A 3CTRA 1S1WA 2IDLA 4JI2F 3H4DA 2RUSA 3GG1A 4G65A 4DR1F 2VKRA 3MM7B 3GSIA 4CWBA 4FBUA 4YHHF 1TMJA 5GADI 2IAJA 2UUCF 2AYEA 4CT8A 2CPFA 2LA4A 3OTCA 3M8YA 3RAQA 7FDRA 1E6VA 3G8TA 1A0OB 3OPKA 3MEDB 2LEAA 2ZWOA 2V4JB 5L8RC 3RYLA 2DO0A 3LF0A 1X4CA 1LWFB 1S1TA 1EETA 4J37A 4PG7A 4WFXA 3GU0A 4CO1A 3NMAA 2G1DA 2CNNB 5B7WA 4B3TJ 3ILLA 2CUYA 2Z2MA 3NMRA 3THTA 4LRAA 3VVUA 2RDDA 3L9ZA 3I0SA 4N8NA 4QPXA 2ZH1A 2DHGA 3Q0AA 2EWHA 4DF4A 2YH1A 3V4IA 1Q4RA 4TN2A 4XTTA 1M1KT 1VMBA 4RW4B 4WTYA 3F73A 1DZ5A 3CJ8A 4PG4A 4NLTA 3CMQA 4KGMA 3SI8A 2NXCA 5E3PA 1IKXA 1S4EA 4OZJA 1XR7A 4LREA 2DRDA 5E41A 4M63A 3CEDA 3UCUP 2AYGA 3SCJE 2QLJB 4OZ2A 2ZHOA 5CABA 1I94J 4ZPTR 4ICLB 4YY3F 2B9YA 2BE9B 2UXDJ 2YKOA 1WORA 4QR2A 3NCPA 2A2DA 3V6HA 4EBEA 3TA2A 4KBIA 1RU2A 2VPXB 5JXSA 2COLA 2G0JA 4UOCA 3CCZA 5A8RA 3C2PA 4GKKJ 4BC9A 1YJ9S 1RHKB 6FD1A 3TRGA 3FFIA 3AQPA 2XMJA 3J80U 2XMKA 4ID5B 3KUGA 2AMCB 4G1PA 2MKCA 4C3LA 1JJHA 1TL3B 1CG2A 1AB8A 3NAIA 2CQDA 1RI7A 1LWXA 1NDLA 1SKUB 2CPJA 2M9KA 3PJ9A 4DV0J 2ALZA 1ZM3A 4ZVUB 5KT4A 4CH1A 1KONA 2K06A 5KG3A 1SJRA 1OY9A 1WSVA 2N7YA 2JX2A 2JVOA 2CPIA 3HFVA 3P8BB 3QT8A 4N77A 1UJ6A 4RBVA 4USKA 2BYCA 2I6WA 2W9CB 2MQ8A 1FD8A 2LQ8A 2WCXA 3MMAB 5B0FA 3PIOQ 1N6QA 1RAEB 3QJLA 1RHUB 4P75A 1Y0HA 4A8FA 2W2QP 4CCHA 1YWXA 4WIIA 4XO0A 2XYHB 5LSOA 2GCFA 4JI5F 5DETA 2R7VA 2HLTA 4PWDB 2M4MA 5K5MA 3KKFA 4M5DA 1FE0A 4WU3A 2JLFA 2APOA 4OX9J 1F0XA 1JLEB 3IRXB 4G1QA 4GVBB 2NR0A 2C28A 3R3TA 1IR2A 1T9UA 3TEHB 2VICA 1O6XA 2L41A 1VK3A 3FBBA 5IV4A 1HD1A 2KN4A 5E3CA 5C7PA 1H7WA 3OT9A 4IH6A 3PYFA 1ROFA 3ZXWA 4AQYJ 4IKAA 4ED8A 4LQ9A 2ZH8A 2MB0B 2RRAA 2Z4PA 4LBHA 4FYDA 2CXEA 2BM0A 3ET6B 3FSXA 3D5MA 1WKKA 1Q7LB 3IR5B 4O44A 2O66A 3CXCR 3SEOA 1NUEA 2J9DE 3DI6A 3C6TA 5KFEA 4WU2A 1YBUA 2CPHA 1O51A 3CSKA 5IWAF 5FDLB 2JEGA 1EKRA 4CLLA 4DX6A 3I55S 1X31C 3BGRA 3MCMA 4ZPWR 4DSKA 2WAQD 2B5JA 4PPDA 4C0HA 4JI4J 4DZ6A 1HHSA 4NEYA 1WC0A 2IPOB 5AJ3F 1C4AA 1OSDA 1S5ZA 4NOHA 4ZLJA 4E98A 5DLFA 3M32A 2FZGB 4XDDA 3GIMA 1HW8A 1V3RA 2FVQA 5L9NA 1S6PB 2YKMA 4NASA 2C2ZB 3QQCD 4PG5A 3CCLS 1VOMA 3JSMA 1W2IA 3GFZA 3TAQA 1X9MA 2A3JA 1HHTP 1S76D 2J8SA 3PDNA 1BY9A 1WSRA 2RNEA 5ETKA 2AT1B 2VG7A 3CUNA 1BQNB 4URGA 1FESA 1HLWA 3MAHA 2VH7A 3IS9A 3SYZA 1X4DA 2A10A 2LDYA 2M70A 2V2QA 3DRRA 3GYNA 4FKXA 4KJIA 4C4WA 2QA1A 3UDVA 4HH0A 2DITA 2XMAA 2KI2A 2W1BA 2HGNA 3I32A 4FPRA 1PO6A 2BJ9A 4FN5A 2I2YA 5HROB 5J2PA 4UY8T 2HVIA 3WIUA 3WC2A 1N88A 2I38A 5K8MA 1U4BA 2YWKA 1HNZJ 4P2XA 2DPJA 1FDDA 2E5GA 3DN9A 1RWNB 3JTPA 1TKXA 4TU8A 1S0MA 1DARA 4QCLA 2UXCJ 1SIZA 1CC8A 4HLBA 2QL9B 1UL3A 3AAWB 2BW7A 2ROGA 2DD8S 4DWIA 4USVA 5U47A 4Q0BA 1IUJA 3QGIA 4U8YA 1NKCA 2ZKTA 2VASA 3HT0A 1MSWD 3IGVA 2MQMA 1XNRJ 2FLPA 2HIQA 3KJQB 4Z7CA 2LMIA 4CH7A 2ACYA 4Z37A 4CZCA 3JS9A 5KT3A 4M95A 4DFJA 3TAPA 2XY5A 1QE1B 4HR2A 1HKAA 2GC8A 2DB1A 1KOHA 5H1SV 3EX7B 5LM7E 4KFBA 1CULB 4RL1A 3DOLB 4I2PB 1NJIT 1RQ0A 1RTJA 1WI8A 2Q66A 2XYPB 1NO8A 2H48B 3W5YA 4X4RA 2HIYA 1PC4A 3DRXA 4NCAA 1UVLA 3DLKA 2HRTA 4PUOB 3HHNB 2HVZA 3ISNC 4MYUA 2FJEB 3PVXA 2P2CB 4GKJJ 1AT1B 2VKZG 4OX9F 1PJ6A 1C0UB 4X66F 2KVIA 3RBDA 1ZH5A 3QFWA 1UW9A 1JLCB 1IM6A 2LQBA 3D3CJ 3MAAA 4NYZA 5J1NA 3UNGC 4B3RJ 1B0VA 3AD7C 5K14A 1D1UA 3BSOA 1VJWA 4UZCA 4JI5J 1HYSB 2E9TA 1GK8A 3DCAA 4HL9A 1PYTA 4I7FB 4UUWA 4ZA1A 2PEBA 3LP2B 5A8WA 4WPAA 3VGSA 2XZTB 1HNWF 3DYAA 4RW6B 1HFEL 3TO8A 4RBUA 2ZM6F 3NCRA 3ONQA 4P10A 3EVOA 4WP3A 4KGVB 4N41A 1JXVA 3SV3A 3NGDA 5F8NA 2VG5B 3BR8A 1Q8IA 3CMES 3UI3A 3DLLQ 2IVYA 2JEJA 2OLWA 4AL6A 3VV2B 4ZVQB 1VRUB 5KAKA 5FIIA 2CAJA 2G1HA 2W4CA 4JI1F 4PRFA 2BE2A 4ZHRA 3NGUA 4LFCF 5B08A 2Z57B 3WHIA 3THVA 4GKKF 1IWGA 3DM2B 3BR9A 5KFYA 3NWRA 1J5OB 2BRLA 3D54A 4QWCA 4DV6J 2JZ5A 3VGUA 1WEYA 2XEXA 1QY7A 4NRTA 1RU1A 1ZZFA 2FLOA 3EVMA 4EK2A 5GAEI 5KFGA 3CCMS 5HP1B 1U45A 2LXUA 2ZITA 1TK8A 2DGSA 2VBYA 2G2OA 1GQEA 2C2RA 4DCJB 1VRTB 1RTHA 2QSWA 5ITHA 2C2EA 4DEZA 2RS2A 1I5OB 1SKSA 4C0BA 4LJMA 2BOPA 1IKWB 2E1PA 2MKYA 4U8VA 2KVQE 1GMUA 4TYAA 1SL0A 1MWZA 2EBGA 3FZBA 3I0SB 2BQUA 2DNPA 3MM5A 2R7UA 1U1MA 4CM2A 3R2CJ 1OPZA 4NMLA 2R9LA 5KFZA 3KNGA 3O2IA 4FNHA 5FD1A 4K4SA 1SQGA 1H7XA 1UZDA 4DFKA 5CH7B 1DTTA 2XQCA 1RJJA 2YX1A 1NRKA 2IVFB 2YX7A 1NB2A 1FJGJ 1SB6A 3SCLE 1UA0A 2CNLB 1N32J 4TYBA 3OHAA 4I6YA 1R27B 1UMJA 2OKQA 3CD0A 1BD6A 2FIUA 3A1YG 3MD3A 4PQUB 2DNMA 2FVRA 3ZO7A 3UD3P 2BX6A 4ECYA 1SL1A 2VOOA 1R8AA 4L72B 4C11B 1UVJA 5ETLA 1RAAB 3IR6B 3QSIA 2Z0GA 2AX1A 1NDCA 8AT1B 1GX6A 2YNFA 4DQIA 3W2VB 1FKOB 5LOQA 1UEKA 4A8SA 2ZC3A 1S9EA 2R2SA 2DNGA 2MY8A 4OZ5A 1TU0B 2XM3A 1C1CB 2HWHA 1FDNA 4QOTA 1KRPA 2NREA 2D74B 3G6ES 1MMNA 2BJ3A 2JRSA 1VIXA 2FY1A 4CTAB 3ADAC 3E2EA 3K5LA 2K8GA 4DCOB 4NX9A 5HANA 5D4NA 3HLUA 4UOFA 4AUKA 3T5HA 3TZZA 3G8QA 5LL6d 4LFBF 3BM7A 2RMLA 4Y28C 4X4SA 1B4SA 1S1VA 2HVDA 3AA9A 4A8OA 1NHKL 1RCXB 4PXBA 3C46A 1UCNA 2G2ZA 1U6FA 5IM0A 1XTZA 2L9WA 3R5JB 2XMMA 5C25A 3MPUB 4A46A 3SQGB 1AXQA 2C2DA 2ZVIA 2UVUA 2D69A 1WHWA 2Y1JA 4LF7F 4ZN3A 3O5TB 4RW9B 1K47A 2MZRA 2VFUA 3TX0A 1QUVA 3AOCA 2GIRA 3ZZUA 3QBCA 2WVDA 3KLHB 3DC2A 2MSSA 1SCJB 3KK3A 4IRKA 1DRZA 2XYGB 2B0GA 5K8OA 3I6PA 1RHMB 1IBCB 3QGHA 2KXNB 1FA0A 2YTCA 3KLIB 1KQKA 1XMOJ 3CDUA 2K1RA 3R5BA 4TNOA 4CLSA 3GTYX 3N4WA 2E66A 1EIYB 1ZYQA 2ZBCA 5HMZA 3I96A 5LMNF 3QNWB 4JI2J 3KTQA 2GQQA 5B0CA 2AF6A 1CLFA 4EBDA 1VQOS 1HMVB 5HJYA 2JWNA 1S6OA 4W92B 4KE5A 4ETZA 2X51A 1NAQA 2NUUG 4G6VB 4OLPA 3UO0A 4CLTA 4J91A 2B5JB 1NCLA 3MEEB 5H9EK 3GIKA 2YXLA 1N8RT 2VODA 5A0YA 2H54B 1UPMB 2VQFF 5HMYA 2HHXA 2VV5A 5DDQC 2HK3A 3VWSA 1TKZA 3AJ1A 1HBMA 1F5BA 2AP6A 4IDKA 4ED4A 1RP5A 3NNCA 1U1LA 2MZ1A 2DBBA 5L1JA 2J9EA 5CYQA 3FC9A 4GC7A 1HBNA 3DHWC 4U7UK 3THPA 4I0WA 2VDHA 3US5A 4U67Q 4YQWA 3C16A 3TAMB 3BQ0A 3GYGA 4GO5X 4QBUA 2HFUA 2GIQA 2RD5C 1NSQA 3UN2A 2UV8G 1RACB 4OI4A 5DLGA 4HI2A 2XGQA 4ZVGA 1W7WA 1TP7A 2VHGA 1J5EJ 2B9XA 2WBMA 3NS5A 3QGPA 1WELA 2C1EB 4DMZA 3KLFB 2UUBJ 1IVZA 3IBCB 1E6YB 3DRSA 3LPEA 2XTJP 3OFEA 2MLXA 1X5TA 4C8MA 1IWAA 4N8OA 4OV1A 1RDRA 3MFIA 3QLHA 3W65A 1HI1A 1TUWA 2JFDA 3BGUA 2IY5B 1UVKA 1HBUA 5KT5A 1T9VA 3MMCB 2UV8A 3PJWA 1QTMA 5SZTA 5C2GA 3ZZZA 1GFWB 1SKWA 3V4IB 4LFAJ 1RT6A 1TVRB 2PE8A 2AEFA 3MR3A 1Q5VA 1NK4A 3M9NB 3ITHA 2KL8A 2YQ3A 3FUYA 1GH8A 1IKXB 5AXKA 2KT2A 2O3DA 1U7LA 1RWKB 4XIUA 1BE4A 5D78A 2B6AB 4LSLA 4YR3A 2BA9A 3CCES 2Y9HA 3K57A 1RISA 2WSEC 3VCDA 3AXMA 2HS3A 2AHOB 3U1NA 1AZSB 1S1UA 1SI9A 2ZE2A 4AE5A 4L3NA 1SC4B 2W24A 2FYXA 3LALA 3LUYA 1Y9OA 2HFNA 4X84A 4W90B 1M5SA 3E3XA 1JB0C 1ZOTA 4DU8A 1XMQJ 2CWXA 4MKAA 5I3UB 4Y6IA 3SIPB 1S1WB 3AB2B 3ISND 3GILA 4DSIA 4PXEA 3V2UC 1OMSA 2HHQA 2HNDA 2PIIA 4P6QA 2IAJB 4I7FA 3EE3A 3B6BA 4ZVEA 1YHQS 4IFVA 2OH2A 3FCVA 3IWLA 2H4YB 2Q3PA 1UFWA 3LOUA 5T7LA 3QO9A 3C8YA 4FPIA 4ZCKA 2B8QA 4O3QA 1JLFB 3UDEA 5EHHA 2DNQA 5HQ8A 2W9CA 1VQ9S 2CKWA 4ZP9A 3I87A 4H4OA 1S1TB 2DHSA 3FJ2A 4YR2A 4IR1A 5HL7Q 3AFGA 1WOSA 3OL7A 2XCAA 3ILIA 2DCLA 4A8WA 2DGWA 3GFYA 1Q86T 4GC6A 1IJFB 1NJWA 4DBQA 4KTQA 4KSEB 4NLVA 2N3LA 1FDAA 3TVYA 3KNAA 1NH8A 2CJQA 5J1EB 4PAAA 2B3TB 3OUYB 2HHHJ 1NJXA 4BLGA 3R1LA 2K2PA 2YX4A 4FF4A 4L74A 2B43A 1CS4B 1FKPA 3DLGB 3EGWB 1TKDA 3IP0A 4JI0J 5F8JA 2E1AA 2AKWB 4DX7A 2YKNB 4WFAQ 3BO2A 3RTVA 2V8VA 4O3OA 1N32F 4XAKA 1AFIA 3QRRA 3CDAA 4CIOA 1S6UA 2Q79A 3MMAA 2N3OA 1RCOB 2DGUA 2IC3A 5A8KA 4JI1J 4LF6J 3VAMA 2RQCA 1F60B 4MK7A 4A47A 4C8OA 4F0MA 1ZAXA 2GFFA 2MQOA 4DV1J 3P6YC 2DXDA 4H4KC 4ETXA 1PILA 2J7WA 2GVZA 2JFKA 2AZ1A 3LAMA 2B4UA 3D0IE 4Y65A 4KT0C 3CJKB 3MFHA 2OPPA 4JI3J 3PIPQ 4QW9A 1JLAA 2G9OA 4JP8A 3LGHA 1C4CA 2W9AA 1D9AA 1LWCB 3DDKA 2BOAA 1YX2A 2MTLA 3C19A 2R8IA 4EO8A 3FRZA 1FK9A 4DSLA 2DVIA 3LH2S 3OR2A 2QL5B 1TR0A 4YDXA 2DR5A 1FNMA 4JI7F 3ET6A 4FYXB 4OHWA 4DR6F 4QQBA 3PV8A 2R8GA 1RZMA 2H65B 2PC6A 4DV6F 2V67A 5D4PA 3EXYA 4KPCA 1CJTB 3W9JA 2DXEA 4PXCA 9ATCB 4K5RA 1V5IB 4RNMA 1Y3KA 3W9HA 4LFCJ 4PWDA 2D1CA 3W9IA 1URNA 2XGPA 2V8PA 3NOGA 3H5YA 5D8HB 3GV7B 3VAJA 1WWHA 3IRXA 4NLWA 3TA1A 3QZ8A 2J0XA 1JJ4A 1S9EB 1RHJB 1JNZB 2EEYA 2HK2A 1R31A 4ZIWA 1VQPS 4HI1A 3PJXA 4DG1A 4USJC 4KY3A 2NZ4A 5J2PB 4LRBA 2CVIA 3PHTA 3LTOA 1FVQA 4MIBA 2M2BA 3BF4A 4V1Ak 1KD1T 2WVCA 3KG4A 3C66A 4RWWA 3WZ0A 4P7VA 1X0FA 2KT3A 2RE1A 1HA1A 2Y1RI 3QZ7A 1RA6A 1S6QB 2GHWA 5GAHU 3CCJS 1H2TZ 2ZM6J 1FRMA 4U96A 1RBOB 1GT8A 2LQJA 2EC2A 4M5KA 3UCGA 2ZNYA 1KDNA 1ICEB 3WC0A 1SKRA 1FE4A 2OSRA 1EB0A 1I6JA 5KFRA 4DR7J 2AJ4A 4F25A 2BVZA 6AT1B 2RH3A 4P52A 1FRJA 1RBLA 1VI7A 2XSJA 4M5GA 2HLUA 3D0HE 1DQ9A 1PKUA 3DMJB 4FVMA 4OYAA 5HK4A 1FTRA 4C3MA 5KFKA 3L3CA 2W2NP 3UD5A 3JAMU 2J5AA 1TFWA 1XNRF 3KDNA 3RBXA 2MZSA 4M5LA 3PW2A 2F1FA 1U1RA 5G0RB 3TR5A 4KH0B 4DL5A 3J80Y 3OR1B 5T41A 1T02A 2DGOA 1PC5A 3NNAA 1VC0A 2JJ4D 1WTFA 1WF2A 3BPDA 3HX9A 2MJUA 4O0IA 3N5FA 1JLBB 2K7JA 2PEHA 3KLEB 1MW7A 2ZJPQ 1U6ZA 4TVAB 2QN6B 5KG2A 1L3UA 4DV5J 2KHDA 4FF1A 1RHQB 1CJUA 3IS9B 4ITSA 1WG1A 3TA0A 4PG6A 2HKEA 3LP0B 4CM0A 1R0AA 2A18A 3TZYA 2V4QA 2E1RA 1OY8A 3O8WA 1KP6A 4AT1B 3J7AN 5EX3A 2UXCF 3CGIA 2XO6A 4H4MA 2GNKA 1IKYA 1HIYA 2F3JA 1L3VA 4GRSA 3MGJA 4QWAA 2CQPA 3BBBA 2CNKB 3V81A 3MDFA 4ZVTB 1PAUB 1RT5B 4K4WA 1SJ4P 1AUDA 4IUFA 3WQPA 3HHEA 3CJ0A 1LW0A 1WEZA 2D3O1 3JXOA 5GMEA 1RLDA 1FRXA 4RW4A 3RB4A 2VU5A 5CYMB 1MG7A 2IBOA 4WKYA 4BHQA 4RZRA 2FPHX 2H5JB 4TLQA 5F9NA 4DL7A 4H54A 3POTA 1N36F 5HVHA 1ITPA 4OFZA 1FJCA 2WB1D 2YWGA 3GLJA 3NRBA 1GXTA 2YNGB 1YBAA 4J9QA 1S0OA 5ETOA 3ZZ0A 1RSCA 2OPRA 4WZQA 4ECWA 1UWAA 4USHA 4J9VA 3PRVA 4CDIA 4AL5A 1Q53A 2GVDB 3MWBA 4QIVA 1URRA 4RW8B 4LVNP 3V5RA 3JYTB 2ZH2A 4C8LA 3NKYA 4U6PA 2WSCC 2EFQA 1U1OA 1L3TA 2A2CA 3M2RA 1HBUB 1RXOB 3PRDA 1M5OC 3ULHA 1S99A 4NXNF 3OXLA 3IR7B 3M2VB 3MI7X 2CG8A 1RWXB 5A8RB 5I3QA 2R8JA 1NHUA 1WC1A 2R8HA 2HSEB 1KSPA 4JI6J 4DU7A 2ZOMA 1EX8A 3G9CA 1VQ7S 1X5SA 4AQYF 1JLGB 2XC9A 1YZ6A 3NGKA 4USIA 2H1YA 1RTZA 3H20A 1ZTTA 1W25A 1H2VZ 2V9WA 4LSLB 1VRTA 1FX2A 3EGNA 4IRDA 2GHPA 3GR1A 1P9QC 4O0NA 5D15A 3MEGB 5IT9U 2JNJA 1S1UB 2C2OB 2LKZA 3J81Y 3RB3A 3EYZA 5DS7A 2PN6A 3K7RA 3WBZA 3MR5A 4LF8F 2UXDF 1UTAA 3K17A 1S77D 3MTJA 4B08A 2H3EB 3FZ2A 3UN3A 2BE2B 2ASLA 2CJKA 3R1HA 1F3FA 1OYDA 1WOPA 3BN4A 3T3FA 4DL3A 2XLKA 3H5SA 4QW8A 2AGPA 4AYBD 1TL3A 3ILJA 2QLBB 2HNDB 2C3MA 1DTTB 2HFVA 2EBEA 1XEZA 2RS8A 3SSQA 5DZ7A 1VGYA 3FBEA 2DHXA 3U1LA 3PR5B 3QJJA 5DQHA 2DNNA 4BWMA 2DIUA 2Z58B 4CO4A 4FBTA 2BRKA 3NGSA 1D8ZA 3TWZA 2HMIA 2E5HA 3CIMA 4OYIA 3F41A 5HBMA 4A4JA 3NLCA 4FS1A 2ATCB 5HATA 5ETQA 3KHLA 2QT7A 2WVEA 4AD6A 4H4OB 1RWUA 4O3PA 3TVZA 5DGAA 2XMUA 4EUVA 4ELTA 3N01A 2DEIA 1Z4UA 2QFJA 4DV0F 5KFIA 1WDTA 2V2ZA 2MGZA 1JLEA 4GVBA 3SQGA 4ZKAA 1RT2A 4ZVPB 3M8QA 5M2PA 3W63A 4OQJA 1BXNA 4RW9A 2HQ3A 4DI6A 3I56S 3FDSA 1S1XB 4FDFA 3AQOA 4E2FB 2FTRA 3D67A 5JJBA 2G0IA 3I82A 4KC5A 1B64A 3X1LB 4ZCIA 2Q43A 2H51B 1SH2A 2HWIA 3BH6B 3HHLA 4HDGA 2B4PA 3L7OA 4NLUA 1CQMA 3W1YC 4CNZA 1FEEA 4DCPB 4BDPA 4MIAA 1S1VB 2OPQA 2HYIB 2FC8A 2HNZB 2VFSA 4FXWA 1B99A 3JSMB 1TV6A 3BBCA 3Q86A 2ZHAA 1EP4B 3QAEA 2AYMA 2L3MA 2HHHF 1NK0A 1H3DA 4LF8J 2ALYB 2IM3A 2OFHX 4M1KA 2PMZD 4ECTA 2MQQA 1Q8LA 2C3OA 1NK8A 2ZH5A 2C42A 1PBUA 1SJ1A 1LXJA 1LWCA 4JI6F 2MKIA 3VQSA 4A48A 5HVFA 4OYWA 1R0BG 3M32B 1HBMB 2LVWA 5J2NB 3KLIA 2DH9A 2RHQB 1N48A 2KJWA 1NJYA 2WVBA 2K1RB 3M4XA 2PSZA 5CYQB 3ZFVA 4B3MJ 2QMUB 2WHOA 4M5NA 1TKXB 1QUPA 1T05B 5DDPC 1RT4A 4DPXA 1X8DA 3BYRA 3H98A 1N4LA 2PD1A 1LW2A 4RX6A 5I42A 1IBLF 3P49B 5DQIA 2AEMA 3O6QA 5IM0B 4IG0B 1N33J 3BGLA 1FO1A 2BJ1A 3MEEA 4XPEA 3M1VA 1NXIA 4K7QA 2OO4A 2P5VA 1HNXJ 2ZD1A 3MMBB 3MEDA 3Q83A 3KJVB 4EZ9A 1KNZA 4TY8B 3BDEA 2LXIA 1WC6A 3FK4A 4DPUA 3TJ8A 1S59A 2PDAA 3ENAA 2ZJRQ 2HVHA 3C15A 3R5AA 4J9RA 1H38A 1LWFA 1TELA 1MU2A 4J5OA 3KK2A 4CO5A 1VR6A 4K8RA 1ZETA 1KBRA 2Y0BB 2XI3A 1VBKA 3HKWA 2VFVA 4WFZA 3SSRA 3Q8SB 5KT6A 4OYMA 3DLKB 4CLKA 1W26A 1PJ7A 2HURA 4KB7A 2XI2A 2WK4A 1OQ3A 3DRYA 3S6EA 4X4QA 4UY85 2UUBF 2HQFA 4FZVA 3M05A 3H7HB 4LT6A 3MCOA 1W2BR 2KRBA 2HQDA 3ZZTA 4LBIA 4NXNJ 2VQEF 4KFBB 5CQGA 2QEXS 2B4OA 4ENOA 1U0HA 3D3BJ 1U8WA 4R0JA 4YDDB 5HQLA 2KG1A 3V6DB 4KAIA 3ZNUA 4HTJA 1X4AA 1S57A 3IBWA 4USMA 3M2UA 4IO9Q 4J9SA 2V8GA 4TLRA 4HACB 2QRRA 1IN0A 2BEFA 4WP9A 3IRWP 3RB0A 3Q2TC 2LQ9A 2IA0A 2PMHA 1MLAA 2OJ3A 1WG4A 3S1TA 1FVSA 1MWYA 4NZ6A 4D3GA 3QIPA 4FF3A 3QWPA 1WEXA 1VS3A 1DLOB 4RUHA 3LP2A 3PR4A 5JVHQ 3W60A 1MROB 5HSPA 3C6UB 4J9OA 4DR7F 3AB4B 2BJEA 2QA4G 2VA3A 3M6XA 4DUYJ 1TK5A 4X4VA 1DAXA 1NU4A 2GJ2A 3JTOA 1RAIB 2KXFA 2QL7B 3MR7A 2EFGA 3IO1A 3QO9B 4LRFA 5AE3A 3MPYA 4TU7A 4J9MA 3B82A 3CJRA 3IGNA 1YZ7A 1KFDA 5D0EA 3F44A 1XMOF 3GFXA 2HQCA 1O0PA 1RT5A 4CO0A 3D6MB 1A6LA 3MMCA 3CJ4A 5L1IA 5BYQA 1WKJA 2HBRB 4DV2J 4DV3J 5J2MA 2D41A 3CJTA 3MD1A 3NG8A 3D1QA 3OFGA 4NLQA 3PYEA 5F41A 3R7BB 5A6PA 2M8HA 4DL2A 1RADB 3NWGA 5J1EA 5LXYA 2QGFB 1F6TA 2VPWB 5KOXA 2E29A 2KFYA 3CC4S 1CS4A 1KHVA 1NPRA 1SUQB 1Y11A 2ZZTA 5H9FJ 3JYTA 3EDRB 5IZHA 4RU9A 2LU1A 3HK2A 3MOZA 1WJ9A 4NL5A 1Y10A 1AA1B 2BDPA 1MMLA 5K9FA 2HHTA 2KTQA 1A7GE 3B4DA 3UFCX 1M1GA 2GVDA 2RU9A 2V6AA 4RW8A 1R8BA 3IM8A 4OX6A 1YJRA 2QG9B 1Y3JA 4KV8A 3N28A 3N79A 4R25A 3RGIA 3OLAA 4ECRA 1VCTA 3BEGB 3CDEA 1N5TA 4YB6A 2ZOGA 3EM1A 1HBOB 1RKIA 2CQGA 3K2YA 3J7Z5 3TARA 3Q24A 2UVVA 4OI0A 2KFNA 3AH6A 5BJRA 2YQ1A 2P9CA 2O01C 3HVTA 3N6MA 4OI3A 4RW7A 4DV7F 2ZDOA 1TL7A 4Y00A 3T1AA 3EGVA 3GONA 4M5JA 1YTYA 2B56A 5I4MA 4QPTA 2DT9A 3IC1A 2OEMA 5DZ6A 4F0HA 3CDBA 3L09A 2VC1A 4CO2A 1YK9A 4IFVB 1CBKA 3JSRA 1JK9B 1SVDA 3FNNA 5FLXY 1ZA2B 4WF9Q 3CD5A 2YWFA 4C6AA 1N5QA 4J9LA 1I3OB 3IXQA 4MIWA 1HARA 4CI0B 3HDSA 2KZZA 2PFDA 2FHJA
chains in the Genus database with same CATH topology
3BJYA 2AW0A 2KM8C 1FHTA 3U27A 4A8KA 1SV5B 1IJEB 2OSQA 3CVKA 1X5PA 2FGCA 1H6KX 3VZIA 4TQSA 1IBKF 1FKOA 1SJQA 1VFJA 3OUYA 2GJIA 2FDNA 1B0TA 1JXLA 2CPEA 2ABYA 2H5EA 1WD6A 2ASJA 3OR2B 2RQKA 1HPZA 2KYZA 3FCHA 4DG1B 2NQPA 2DRAA 3MR2A 4B9VA 2D7SA 2ZH4A 4YB7A 1N0VC 3KYLA 5HBMB 1WHXA 2AJQA 2IC3B 3PX4A 3JTNA 3OVAA 3G4SS 1H98A 4UW2A 4L6V3 3CCTA 5BYSA 1NH7A 5F9LA 3QIDA 3UDCA 1JLAB 3IFEA 3OJSA 1UJ4A 4FP9A 3VALA 2W9BA 1TQLA 4DV1F 2LXFA 2OPSB 4F8RA 3AY0A 4Q5VA 4NLXA 4I2QB 1YJUA 3H59A 3MM9A 2FVPA 5KTQA 2EK6A 1CPZA 3J7ZT 3SFUA 3KMSA 3DDNA 2SXLA 1JWWA 1GNKA 1HNVB 1IBMF 5KFAA 2PFFB 1UWBB 1FERA 1KR4A 2IYIA 1HYSA 1BQMA 1P6TA 1SC6A 3PACA 4KKOA 5MAOA 3OLBA 2BZ2A 1UJ5A 2M88A 1IQZA 3D2WA 2MQPA 3UE2A 1RYSA 1OO0B 1UEUA 2ZFHA 3N9UC 2MKHA 3DLJA 4ED0A 4RU2A 4NCGB 4H4MB 4MK9A 1LK5A 4YP3A 3QLHB 2HRYA 1HR0F 3ENWA 5HO4A 2R2UA 3CCSS 2CJBA 3VAIA 2DGVA 5KFFA 1FF2A 1S6QA 2P6SA 4IO1A 1QM9A 3SCKE 3CB4A 1HW9A 4Q2LA 1I1GA 1KVJA 2ZJQQ 2R7WA 4FF2A 2X1GA 4DV3F 5F0WA 4GO7X 2AWZA 2XLJA 5DM6Q 1FJEB 4XPCA 2F8HA 3BQ2A 1U48A 4DR4F 4I56A 5KFVA 2QIFA 5DQGA 4B9SA 2EPIA 3G6VA 2JDJA 4WJBA 4N47A 5DM7Q 4YMEA 2CQ1A 5KFOA 3FQLA 1UW4A 1T94A 2FUG9 4MK8A 4NXMF 5CZVA 1F9FA 2HG4A 3B8HA 4WCEQ 4F50A 2XWYA 2VD3A 1KLMA 2JC0A 1HQUB 1D9FA 2JL9A 3V6DA 2GGPB 1N6QB 5IT9Y 4ZP8A 1NNDA 5LT5A 3AA8A 2HGLA 4NLYA 1VQYA 3MUVP 4DQQA 3ENVA 1QVGR 2DH7A 2YNIB 5B0DA 1J5EF 2EFVA 1VQKS 3KK1B 2J9DA 3I9ZA 5C24B 2E5LF 4J9PA 1GTEA 2UUWA 5GAHI 3C6UA 1DTQA 4ED3A 3S7RA 2XNRA 2OFGX 1Q1KA 2FJBB 2GHVC 1U47A 3M9MB 4ZOSA 4MMOA 4RNHA 4K0KF 2F8MA 2HNYB 3ISZA 5F3ZA 4IG3A 3RW7A 1U2RA 2G0CA 1FT8A 3HHKA 4F4YA 1S49A 1R43A 4AFFA 1UA1A 4I6WA 4KHRA 1YG0A 2GA7A 3OSNA 2V8DA 3K8VA 1WI6A 5THWA 5IT0A 4IOAQ 1S72S 5B0EA 4IYQA 5DDRC 1FDBA 4OZNA 1GXUA 1KEKA 5MLCV 3RZAA 2KZMA 3QYYA 1SJ3P 1ZTWA 1N56A 4ZPBA 2FLLA 2K7KA 2NYIA 4QJVA 4ED7A 3DNCA 3MPVA 2RKIA 1U1KA 5A8KB 5KFQA 2KFZA 3UW1A 3BDPA 2H9ZA 2IRYA 1XR5A 2VFRA 3RRKA 2OPQB 3H2VE 4KV8B 1ZM9A 2EG2A 3B78A 2KH9A 2VONA 4Y3CA 2VG7B 1GAOA 5LSRA 2FHJD 1R6YA 5HLFA 3KMQA 2OPPB 2R7TA 2ZVSA 4CT9A 1RYRA 4MJKA 2BUNA 1SJFA 1QSSA 1X4BA 3P5TL 1REVB 3ZZYA 1SBRA 3ICLA 1CSJA 3CT9A 4WZMA 2CZ4A 3IN5A 3O3LA 3QGGA 4ES3A 3MM6A 2EC0A 1R8PA 3PFOA 4OMFG 5B0AA 1GX5A 2NS1B 3UWTA 5A2QY 5FJ4A 1KTVA 1S9FA 1X4GA 2YY3A 4WFBQ 1RA7A 2LCWA 3H5XA 1PGZA 3N6NA 1RT4B 1TK0A 2HZCA 1QJHA 4ZPVR 5C5JA 2FJVA 1ULRA 1SV5A 1ZPVA 2AJ1A 4NLDA 4Q45A 1FRHA 2A1BA 5J2QA 1P1TA 4I1TA 1B0PA 3CF5Q 3M30A 4QWEA 5KFXA 2ROEA 3KJVA 4TY8A 2F4VF 5L38A 5DG9A 3E01A 1Z1ZA 4C98A 5HN0A 4LF4F 3BSNA 4ES1A 1K0TA 4U7CA 3W3SA 1KS2A 5KFDA 1UETA 1LW2B 5G0RA 5I42B 4E0DA 3OTEA 4Y34A 1FJGF 3PX6A 1S7HA 3K59A 3GWCA 2HFZA 2R2RA 3MM8B 4HT5A 2NPFA 3Q8QB 2LQ5A 1T03A 1YVFA 2CZVC 3VR1A 4HHJA 4OI1A 4NYPA 4OZ1A 1GTHA 3L7PA 5CCLA 4Q43A 3OFFA 1HWIA 2ADCA 1U1PA 1RAJA 1IQTA 2QZ8A 4B3RF 1T7PA 1MU2B 2CG4A 1P27B 3GV5B 1RGVA 2KB2A 4IOCQ 2AD9A 2LA6A 2GMLA 3DOKA 3T9NA 1OSCA 5E33A 5KG1A 2VPYB 3SXLA 1G3OA 3SCIE 3IAS9 4TU9A 4ZK7M 3VZHA 1D0EA 2BQRA 5SUHA 4EGLA 5EWFA 1RT3B 2XMTA 3I5AA 3L95X 3M6UA 2HQIA 4IG0A 4IFYA 2C3UA 3NAHA 4U9RA 2D3ZA 1R7IA 4K4UA 4KHMA 1NK5A 3LP0A 1DURA 2Q1LA 5ADZA 2XSFA 2CPXA 3CCVS 2VPZB 2XHWA 3NP5A 1QAXA 1JLFA 1YJNS 7FD1A 1RTHB 3DRPA 1YQHA 3HO1A 4PXDA 4DJBA 4ED5A 4JV2A 1RT1A 2I5JB 5B09A 2U2FA 4IRCA 2BR0A 2HGMA 3HFKA 2BV3A 3Q2SC 4BCAA 2HS4A 4UQGA 3M2VA 3BO4A 4KR0B 2KU7A 2OAUA 2WOMA 2ATLA 1XWLA 5M2UA 1MROA 2DGTA 2CQ2A 1KQFB 4X64F 1SL2A 2MKSA 4NA1A 4DN9A 1RT7B 2YWEA 2EVZA 4B17A 1OS5A 4K4TA 4CO3A 3CWJA 2W8LA 4IOBA 3C3LA 3UPFA 2XS2A 3FSIA 3HHDA 3K5NA 3AHPA 5LSLA 3OW2R 3ETOA 2XY7A 5EUHA 3I31A 1DQ8A 2DK2A 5GVQA 2BBEA 1TL5A 2XWXA 4TKTA 3OL6A 1Q7YT 2CFXA 3K8WA 1S97A 5BR8F 1HBOA 5J1PA 2F9JA 2YNHA 1X9WA 1R8HA 4OJGA 4DV5F 3QIPB 3G86A 3SZ2A 4DFMA 4X4OA 4JI4F 3RW6A 1DLOA 4IQXA 3TANA 1YITS 1DJ0A 1AFJA 2HMIB 2PI5A 2VC0A 3T6JA 2Z2LA 3KLGA 2M8DB 3CCRS 5D4LA 3BGFA 5J2MB 2E5JA 3LGNA 3T9ZA 3EGZA 4RBTA 3TYTA 4Y0FA 1DHMA 3V6JA 2V4RA 1YSJA 3KK1A 2MHNA 1N0UA 2VZ9A 4HVZA 5C24A 5F8IA 1S1XA 4NCBA 3KG0A 2YKPA 1IM4A 3KHRA 1HPZB 2DH8A 3BS9A 2KDOA 5DG8A 3GE9A 3SV4A 3DU5A 3MAQA 1S0VA 5GAEU 2MPUA 5LMUF 3DLEA 1LFWA 4YR0A 1UVNA 2RT3A 4LIRA 2NUHA 1K73T 3U02A 1N33F 5KT7A 2W7PA 3EZ5A 3T6BA 1YRXA 2NXUA 4LMZA 3UQSA 5C42B 4NZ0A 1VK8A 3GMGA 3T5JA 3T1YF 1L3SA 4LF9F 1VC6A 5CZXA 1RTDA 4Q7AA 2RUGA 1V9OA 5AE1A 3FRYA 2FVSA 2L48A 2DJWA 5J2NA 2XULA 3TAMA 1RTIB 4F4ZA 2ROPA 1TFYA 2BABA 1ELOA 3JSYA 3MM9B 3HMJG 3LPYA 3MCSA 2ZHBA 4X2BA 3MUMP 4ELUA 1FRIA 1VQ4S 3C6TB 2WONB 1UWBA 1WF0A 3DGPA 2XS7A 4X4PA 3CULA 2DRBA 2W7AA 1JLQA 3KFWX 3GQCA 4F3MA 2W9BB 3DU6A 5E5NA 4DL6A 2M52A 2JLGA 4E8UA 2HHSA 2EKYA 3PKYA 4ECXA 2DISA 3NNHA 2MZTA 2POKA 1HWJA 2EG1A 3KK2B 2I0XA 4JI3F 5LJ3Y 2CRLA 1M5VC 2NLWA 1FRLA 3MTKA 3U1MA 4ALZA 4C9DA 4DQPA 4A8QA 2L9DA 4QWDA 3PW0A 3ITHB 4TXSA 2JOQA 2OD6A 3J7A1 1RKJA 2IM0A 4NRUA 3QJPA 2CVEA 1FCAA 2B7CB 3GIIA 2B6AA 4ZVHA 2D3OR 2GMHA 1XN9A 2GQ2A 2FB0A 3G6XA 2IA6A 2RVJA 3E01B 2OPSA 3O1LA 1KQGB 2RQ4A 2MYFA 3PEJA 4LIWA 4BC7A 4DQSA 1LV5A 5GAGU 2AGQA 4F67A 3FQKA 2DGXA 2HHVA 1Q81T 2FHOB 5KFSA 2QLXA 4A8XA 3HVAA 3JSBA 3T5KA 4WXOA 1U09A 2E9RX 1UAWA 4K4VA 3GYXB 1H0HB 3NCQA 3DLBA 4ED6A 1J2VA 1HQUA 3MEGA 2MZJA 3KG1A 1JIHA 2C3PA 4Q2MA 4JBCA 4JV1A 2XZWA 3MUTP 3I9V9 3Q23A 1SIWB 2DNLA 1C0UA 2VB6A 2AGOA 1JLCA 1JXEA 4C8ZA 2HPUA 1TKTA 1U8SA 1OIAA 1H2UX 1HNIB 4WFNQ 2ASDA 1IXKA 2EW9A 2PT0A 5K8PA 4QIEA 1KN6A 3CJ2A 2YKNA 4TQRA 2FLNA 4JOUA 2VOPA 5CXTA 3FEXB 5IFMA 5KFBA 2UVWA 4IH7A 3VF0B 3RRHA 2M7SA 2YH0A 2ADBA 4DOZA 2FD2A 4C8YA 2G13A 3QPIA 2CYYA 4FXDA 4DL0C 4YUDA 4FNIA 2V8HA 1NHVA 2AU0A 3BQ1A 4EZ6A 5E2QA 3HM9A 3CJ3A 2J0QD 4HH1A 2MGZB 5KG4A 1F2GA 2N7CA 5T14A 1N54B 1UFLA 1NKBA 3D1HA 1OWXA 2FHMA 5H9EJ 2DR7A 4X62F 3H2LA 5AXNA 2QV6A 2F9DA 2V0NA 3HVTB 2B4VA 1K0VA 4O4RA 4YFUA 4A8YA 2ZZNA 3EPIA 2ZDPA 1TL1A 2CQHA 2E5IA 4C8NA 1U49A 4RUAA 4ECUA 2XB2D 1Y5NB 1P1LA 2KRRA 2HHUA 2CIMA 3PFEA 3SDEB 3ZZPA 3PW5A 1N5YB 2E1CA 3N6LA 2IJFA 5JVGQ 4O23A 3G71S 2J6SA 4DV4F 1X4FA 3HPOA 3VAHA 3OTOF 4B9MA 1G2EA 4PR6A 2MSTA 4LUBA 5A6WA 4DN0A 4Y2IA 3MHYA 5E3QA 1M5HA 3IG1B 3QMQA 2WB4A 5DJBA 1XERA 2O67A 2R7QA 4Y2MA 2RU3A 3CCQS 1LWEB 3W2WA 2QA4S 1XNQF 4K4YA 3R5DA 3A8EA 4F3OA 4OI6A 5I3PA 3M6WA 1SQEA 4DR3F 4EEYA 4N56A 2YKAA 3DLHA 3K5MA 5L1KA 2ZUGA 4F3QA 1YJVA 4IH5A 2HNYA 2KO1A 4B9LA 1NJZA 4C11A 4DSJA 5CA5A 2XCPA 2QE5A 3LW5C 4BS2A 1F5AA 1KC8T 1U2FA 2WBRA 1CEZA 3CDWA 2XSJB 3P96A 4PQAA 4HKQA 3CJ5A 3M30B 3NS6A 2JEFA 5GADU 1ZAVA 1FJ7A 3ZC4A 2NPIA 2QSFA 3RAMA 1U6BA 3R27A 2RKIB 4K50A 2R7XA 3OR1A 1LQ9A 2OMLA 2UU9F 2WTFA 4NZ7A 1R3NA 4Q8EA 2AV5A 1JLBA 3GV8B 4M8LA 1VQNS 2RJZA 1L5UA 3MM8A 1MNEA 4I6AA 3Q8PB 3CD6S 2OD4A 1Q79A 3RR7A 3JB9k 3M6VA 5GMKa 4DQRA 1FEHA 2JC1A 4NLGA 3T5LA 4WXWA 2YWHA 3TUJC 3G6YA 4G3IA 1IKYB 4GMKA 3RBEA 1M90T 4NCGA 4DLEA 4OX8A 2KKHA 1UVIA 2VG6B 1YRUA 3MR6A 2XLIA 3PW4A 1FXLA 1HQEA 2MJNA 1LW0B 1Z2ZA 2J8AA 4KKOB 3GSDA 3TQ1A 4WE1A 4ECZA 1VBYA 1VC5A 2X3GA 4WFYA 2J7KA 1Q16B 4FVCA 2IMOA 1Y4ZB 2BXJA 2PI4A 1U25A 2J6UA 2HW3A 2J76E 3CO9A 5EX0A 2OPRB 2PGCA 2R7RA 4LVOP 3UR3C 3FEYB 5KT2A 4F4XA 4QZVB 4QU7A 1B7FA 1HI0P