1MWZA

Solution structure of the n-terminal domain of znta in the zn(ii)-form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZntA
publication title A new zinc-protein coordination site in intracellular metal trafficking: solution structure of the apo and Zn(II) forms of ZntA (46-118)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 16
structure length 73
sequence length 73
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mwzA00
2QYCA 4Y2KA 1OPZA 2BJEA 2K1RA 2LDIA 4A46A 2AJ1A 1X7VA 4OJ3A 2HLTA 2GA7A 5B0GA 3IWLA 3FRYA 2GV1A 4DN9A 2RU9A 2VV5A 1N5TA 3BDEA 2AJ0A 4HH0A 3HF5A 1YJUA 3TRGA 1GXUA 2ROEA 5T7LA 3IWXA 2RSQA 3WDOA 2PD1A 1Y3KA 3TNVA 1OSDA 1CC7A 2OAUA 1V3ZA 1FD8A 4HI1A 1APSA 2BJDA 2GFFA 2VH7A 1S6UA 3KG0A 1N5QA 2RILA 1TZ0A 5B0EA 2OP5A 5B08A 2N4DA 1K0VA 2AP6A 1Y3JA 2GGPB 1WD6A 2Q3PA 1QUPA 2XMJA 4OJ1A 4HL9A 2XMMA 3UDCA 4YDXA 3BGUA 1JWWA 1SI9A 1Y9OA 1Q53A 2IFXA 3FGVA 1FESA 2QLXA 1VQSA 2CRLA 2IYIA 3HFKA 1N5SA 1FVSA 3BB5A 1TL5A 1Q8LA 1VQYA 3MCSA 2KT3A 2BUNA 3T9NA 3QGPA 2HFNA 5KAKA 1S6OA 2XMUA 3HHLA 2GCFA 1R6YA 1IUJA 4DPOA 1YJRA 2K7KA 1N5VA 2JDJA 2IYGA 5A6WA 3MZIA 5B0DA 1YJTA 3DCAA 1P6TA 1YJVA 4NL5A 1AW0A 4A48A 2HIQA 2OFHX 2QIFA 2RMLA 4OJGA 2L3MA 1Y0HA 3HDSA 1TL4A 1OQ3A 1Q4RA 3BN7A 5B09A 2BBEA 2ACYA 2FTRA 5B0FA 4QOTA 2K1RB 1FVQA 1MWYA 3HHLD 3CJKB 4EFAC 1W2IA 2KT2A 4HI2A 1RJJA 4F67A 1YRXA 5F0UA 3LGNA 1KQKA 1JK9B 4YEAA 5K9FA 4FNIA 5T7LB 1OQ6A 2ZDOA 3KG1A 1CPZA 1YG0A 4ZOSA 1SB6A 2K7JA 1Q8BA 2QLWA 2LQ9A 4OIXA 2W4PA 1URRA 5B0CA 2XMKA 3HX9A 1AFJA 1P8GA 1TR0A 1U7LA 1ULRA 1KVIA 2GGPA 4U9RA 5B0AA 4Y2MA 3GZ7A 2OFGX 3K7RA 3KKFA 1XBWA 4Q2LA 2AW0A 3KNGA 2KYZA 4ZA1A 1FE0A 1SQEA 1GXTA 2ROGA 2KKHA 2OD4A 4FNHA 4Q2MA 3CJKA 1CC8A 4NPOA 5B0BA 4Y2IA 2HLUA 2FIUA 3BM7A 1TUVA 1FEEA 1AFIA 3BF4A 2LQBA 4HH1A 2HFOA 2EW9A 2N4CA 2OD6A 2OKQA 5IXUA 3VTIA 1FE4A 2G9OA 2ZDPA 2BYCA 3DXSX 3HHLC 2GO8A 2K2PA 3LGMA 3TOQA 2XMWA 2XMVA 3QMQA 3HHLB 2FHMA 2W4CA 1X8DA 2HQIA 2W4DA 2FB0A 3LO3A 4DL0C 3F44A 2ASYA 2XMTA 3FMBA 4OJHA 1LQ9A 2LXFA 3E8OA 1MWZA 2PGCA 4A4JA 5A6PA 2ROPA 1KVJA 3BR8A 3I9ZA 5F0WA 4A47A 1X0PA 2N7YA 2OMOA
chains in the Genus database with same CATH superfamily
4WP9A 3BYRA 4YDDB 3BSAA 1JLGB 1FX4A 2HEKA 4BWJA 4Y65A 1B70B 1X4EA 1KP6A 4M5HA 1HQEA 4RWWA 3CCWA 3HP6A 1BQXA 2GGPB 3DLLQ 2UUCF 4P75A 3TUZC 2ZH5A 1UA1A 2OPQA 4LFAJ 4C2MA 1RKJA 3I56S 2LA6A 4X4RA 2UV8G 1YJRA 3QT6A 2MSTA 2DR5A 2QG9B 2YY3A 3D0IE 3AB2B 4EMDA 2DTJA 3EGWB 4EYIB 3UD3P 4I64A 4M5LA 3WC0A 2CPEA 2HFUA 3RZAA 3BSCA 1U7LA 1I5OB 2YX7A 1Y10A 4DV0F 2BXJA 4Q2MA 5BJRA 1N48A 4LF4J 1N36J 2DNYA 4P74A 2RDIA 4ECYA 3UO0A 1KLMB 1JLBB 2PMWA 2ASYA 1FHTA 4LR9A 2V4RA 2OSRA 2ALZA 2YTCA 4LSLA 5T14A 1WOOA 2P6SA 3D6MB 4J9UE 4A46A 3GB0A 1H74A 4D3GA 2VV5A 3U02A 2VJVA 1X0FA 4QWDA 1RISA 1UVIA 2GQCA 1U4BA 1JLEA 4LF2A 1J27A 2ASJA 4UQTA 5EWFA 1JWWA 4F04B 1XMBA 1Q53A 2Q66A 4MYUA 3ZXWA 3UDLA 3N6LA 2HQFA 2IDLA 3MTKA 4NMLA 1LWCB 1GMVA 2G1DA 1BXNA 2OUGA 2QA4S 3W62A 3ONQA 1XEZA 4IR9A 4KH1B 2EC2A 2R8JA 2VDIA 4NXNF 3PCOB 4A8YA 2U2FA 2CIMA 2Z2ZA 5A8RA 3RBZA 2FY8A 3EGVA 4XPEA 1VMBA 4OYAA 3RAXA 1U1OA 3OBIA 1YRUA 2QL9B 1ZOTA 4B17A 1S6PB 2I38A 1FD2A 2PT0A 5AXKA 5C25A 1OJ4A 1ZM9A 3IO1A 3M32A 4L6V3 3AQPA 1GH8A 3N6NA 2XSJB 4CYUB 3A8IA 3KLGB 3TJAA 1SC1B 1RWWB 3CCQS 1VDHA 1Y3KA 2E1MC 1HKAA 3GYNA 1NPPA 1UMJA 5HATA 5F8NA 3GV7B 4ITSA 1RWMB 5IV3A 1WF2A 4WE1A 1FKPB 3U7JA 4UW2A 2A2DA 2RQ4A 4IO1A 3AJ2A 2VODA 1M5VC 1S7HA 2ZH9A 1R31A 4X65J 4U8VA 2GVDA 3HLUA 1WOPA 2JDJA 3QAUA 4NLQA 3SQGA 4EI2A 2NSCA 2FLOA 3DMJB 2HK3A 4LF9J 3HVAA 4QIVA 1VYAA 1M5SA 1P27B 2F4VF 3CCSS 1IKVB 2UUAJ 3D3BJ 1DTTA 4LVOP 2AU0A 2QA1A 4M5NA 1YJWS 2NXCA 3FBEA 3ZZPA 4F3QA 2F8EX 1ITPA 2XLJA 3JQMA 5KFMA 2QTWA 2E9TA 4A47A 3C6UA 1K1SA 2ZUAA 3DLEA 4JI7J 3TARA 3G6VA 3QO9A 2XYPB 3ISNC 2AJ0A 4LFCJ 2J0XA 4ILLA 2G2YA 3AFGA 4MFBB 4IFVA 1GTEA 1NM2A 4CLZA 1WD6A 4NLXA 2F5GA 2Y9HA 2SXLA 1J2VA 3WIUA 2AKWB 5JMNA 3CJ4A 3Q89A 2EG1A 4P73A 3T5LA 4C0BA 3DRXA 5AXNA 1Y0HA 3K5LA 4ZIVA 4DLGA 2HK2A 4I67A 3PX0A 3FBBA 2AHOB 2EKYA 1RBOB 3PYFA 5ETVA 2DGUA 2XLIA 4ECVA 9RUBA 2KXFA 4PG5A 2KFZA 2Z56B 4WFAQ 4G65A 3KHRA 4WFXA 2AF6A 2MQLA 1N54B 4ZMMA 1QY7A 2J7WA 4HKQA 1H73A 2HAIA 1X5PA 2AJFE 4I2PA 2EBEA 2I5JA 1RT3B 2P8IA 3MMJA 3DM2A 3GQCA 2DPIA 1WC0A 5HLFB 1JJHA 4X4VA 4QR1A 5K14B 1MWQA 3IR6B 2PIIA 2V4JA 4PQAA 4A8MP 4DWIA 3E2EA 2LEAA 3GFZA 1AYEA 1T9UA 3FRZA 4Q8EA 3HKZD 2W1BA 2R9LA 2KTQA 4DV6J 5CCMA 3VGUA 3T9NA 4RBTA 3R2DJ 2HHTA 5D78A 1SVDA 1SCJB 2CJYB 4MH8A 2L3MA 4N8OA 3R5DA 4QW9A 3OT9A 3VGVA 2DT9A 4JI0J 2IC3A 1KQSR 2ADBA 1DLOA 4YS2A 3NKYA 5M2RA 2R3VA 1H2UX 2RH3A 2O66A 3CCUS 5KFWA 2MKSA 2V8GA 1P9QC 3M6WA 3OD2A 1SIZA 3H7HB 5GMEA 1HBNA 3M05A 3CJTA 3I31A 2EFNA 5CYMA 3UVJA 4YFUA 2IY5B 2HPUA 3M8QA 3HHLC 3TOQA 3MECB 2Y1IA 3PKYA 3AHPA 5BR8F 2FB0A 5HROA 3IRXA 1HWLA 2RVJA 3I5BA 4X4TA 3T5HA 3G82B 3P3DA 2XGQA 1UPPA 2C3YA 4PYAA 2RS8A 1S1WB 2AYGA 4ID5A 4EO6A 1Q16B 4GRSA 2ZZTA 2BM1A 2JFKA 3MPUB 3BO3A 4J37A 2JC0A 3IA0A 2VA2A 3RR7A 1V3RA 3C3LA 2BA9A 2XMJA 4R0EA 2ADCA 4CT9A 5HVFA 1UJ5A 4OZLA 4RW6A 1RBAA 2WONA 3BO4A 3NEKA 3CJ0A 4CO3A 3VHQA 4W90B 3P6YC 1VC0A 4PWDB 1HI8A 2W2OP 3BBBA 2Q43A 5IWAJ 1T03A 2P9EA 4JI3J 5K9FA 2ZC4A 5HMYA 1OYEA 1EKRA 1RAEB 1U8WA 4DUZJ 1ICEB 4LR7A 1RQ0A 2AIRB 3O1LA 3JTNA 3VAJA 3N9UC 5IT9U 2HFOA 3A8KA 2W2NP 1F1BB 2ZDPA 3NLCA 1V9OA 1AZSB 3PV8A 4C8OA 1EQMA 4GKJF 2LXFA 2BR0A 4QU6A 5I3UB 3M8PA 5H9EK 3MM6A 2DXEA 4PYDA 3OJSA 4KY3A 1RTDA 1K1QA 2ERRA 1RT2B 4RPFA 3PRVA 3GR1A 4OX9J 1SH0A 3GLJA 1SC3B 5IT9Y 3FSIA 4C8LA 2BZ2A 3FFIA 4IUFA 2B4UA 2XCPA 1YHQS 5J1EB 5HI7A 3ULHA 2NZ4A 5M2UA 4ED6A 3MM7A 2FGOA 1ZAWA 2VL1A 1X60A 1ROFA 4DSIA 1WEYA 3EPIA 3PHTA 4WTYA 4RNNA 2ASDA 3DLKA 3QGHA 5GAGI 2LQ9A 4KO0A 1AFJA 2XC9A 2G1HA 3ZTOA 4CI0B 3JSMB 4DV3F 3ITHA 3EGNA 1SH3A 3T41A 5LJ3Y 4O3PA 1JLFA 3MEGA 5DJBA 4X4OA 1H2VZ 1T0TV 4J90A 5BYQA 3MMBA 2X1BA 3A8EA 5DS7A 2KVQE 1CULB 1LWFB 3H42A 4DN9A 4A8FA 1PCAA 5LSOA 1T05A 1FJEB 1KOHA 4Q45A 2H1YA 5KFTA 5M2PA 3D1QA 2R7VA 5B08A 4KIAA 4DCJB 4NRTA 5F8GA 4H4KA 2NQPA 5D6GA 2P2CB 3LAMA 1U8SA 4CRJA 4P72A 5J2NA 5MLCV 5HMZA 3OR1B 4OI1A 2FZKB 3B6BA 5K8MA 3SQOP 5GAGU 4CQ1A 3OLBA 1T9WA 2DGXA 5EUHA 1S1XA 3MOZA 3MMAA 1IQZA 4H4OA 3KYLA 4C8NA 4QPXA 3QRRA 3SDEA 1KHWA 3KJVA 3SIPB 4KGMA 3L4BC 4F0KA 4IO9Q 4NXMJ 1UEVA 1RT1B 3HSGA 2LLZA 2ROGA 5IV4A 1Y5IB 3SV3A 1KONA 1U49A 2DRDA 1IBLF 1Y5LB 5ETKA 4LF5J 4WZMA 3I82A 3MHYA 1U48A 4DR5F 2MKHA 1N34J 3T1YF 3VAMA 2EBGA 2QN6B 1CQMA 2IHR1 4F2SA 2GV1A 2DO0A 4P71A 4DL6A 3JSRA 4FXVA 3HHKA 1QAXA 1A0OB 2ZE2A 1FD8A 4ANDA 2YPZA 4P2MA 1EP4A 1FEHA 4ED7A 3MD1A 3BGRA 3R1HA 2VASA 3L9ZA 4OHXA 2CVIA 2R7WA 3LOUA 4TU8A 1EETA 3ELHA 4ZN3A 3QYYA 3DGPA 4DPOA 4LF8F 2BANB 3MWBA 4ZCMA 3QBCA 3KJNB 2M5YA 4OJGA 2MZSA 3HULA 4OHVA 4X62F 2PE8A 1GMWD 3P5BP 5L1JA 2EFVA 2HNZA 2XG8A 4K0KJ 2D1CA 1VC5A 4OLPA 2BW7A 1BMQB 2J9DA 4DR2F 4DL3A 3IS9B 4ZVQB 2CJXB 3MFIA 1XIQA 2ZBQA 1QSYA 3TA2A 4CTAB 5HBMB 5G0RA 3FMBA 4RNHA 5DGAA 1TQLA 1S9GB 3UDVA 1AB8A 1OPZA 4V19X 4ED8A 2ZH6A 3RG6A 2B5JB 2AYBA 1DURA 3BSNA 3D28A 1VBYA 1XNRF 1JXVA 1UWAA 2CWXA 1NH7A 2DRAA 5JVGQ 2BQUA 4OX7A 1FFWB 3EXYA 4CM2A 2YNGB 1RT4B 4DFMA 1TKXA 2RT3A 4Y2AA 4QIWD 5J2MB 3TQ1A 4LF6J 1LWEA 3DCAA 3KFWX 2MGZA 2QL7B 1QAJA 5HN0A 2OPRB 4USKA 3KLEB 2C22A 1JLAB 4DMZA 4FYYB 3H25A 3PO4A 4PUOA 1S72S 3HK2A 3VR1A 3ISND 4TN2A 4UZBA 3DRSB 2MSSA 3CD0A 1WKJA 4FVCA 1AFIA 5E7OB 3Q8PB 2Z4PA 2D7SA 4Q5VA 1RHMB 2LU2A 1LK5A 4KQZA 4ED2A 2I8EA 2M88A 4M95A 3GTYX 4CLLA 2CDRB 5F8MA 1RKIA 1JLQA 1SJQA 4IQXA 1TTHB 1HYSB 4P2SA 4HACA 3PACA 1FTRA 2KXHA 4ED5A 4PCQA 4ZP8A 4CLTA 5CXTA 1PBUA 4GO5X 2C3PA 2E7XA 3BB5A 4RW7B 5DLGA 4LMZA 2V9KA 2PSZA 4Q44A 2GIRA 1LW0B 4AXJA 2MB0B 4TNOA 2DGVA 2KRBA 5AT1B 4WP3A 1MLAA 1NSAA 1VCTA 2HVHA 5LMNJ 3JYTA 3SSSA 5LMUF 4DPTA 2AMCB 3D9BA 1NPRA 3ZZRA 5B0BA 3AJ1A 4ZCIA 4NYZA 4QYZK 3ZTPA 2OPQB 4PXEA 3MPVA 5EX0A 2YNFA 1VLYA 4NLYA 4DV4F 3POTB 1DJ0A 2KDOA 4KKOA 3NOGA 2OHDA 3I9ZA 2FQQB 2HHVA 3THVA 2LQ5A 4J9NA 2FVCA 5DM6Q 4K59A 3I96A 3D6TB 3WIVA 2E44A 5KTQA 2B9WA 4RUCA 2WBMA 4CCHA 4IDKA 4KR0B 2FJBB 1DTQB 2RKIA 4TYAA 2EPIA 3P96A 4AD6A 1NJYA 4OL8A 2UXCF 4PRFA 2DR6A 4USWA 3VVTA 3HVWA 3MCNA 1R8AA 1KFSA 3DFEA 2CPDA 3IFEA 2CUYA 2MKJA 2QJ3A 5HK4A 2APOA 4LSLB 3HHLD 4DZ6A 1SQGA 3OV7A 2XY5A 3RAQA 1H72C 1XC9A 2RQMA 1VQ6S 4OZ0A 2VB6A 2N82B 2J9DE 1CC8A 1MW7A 3QGGA 3HZEA 1H98A 3T9ZA 2BYCA 4C8ZA 1NZAA 4KGKA 5IZHA 4OI0A 3CMAS 2YKQA 1VGYA 3MPYA 1X4AA 3NAIA 3MAQA 2H4YB 2HRYA 1GX6A 1WC6A 5A8RB 5E2QA 3JAMU 3OXLA 1FRHA 1IBKF 2R7TA 4NZ6A 5JXSA 2R7RA 4ES3A 3I5CA 3R3TA 5J2PA 2CZ4A 2YWHA 3W9JA 3BKUA 1T8EA 5C25B 1U1NA 3EUNA 3KWMA 1O51A 3M32B 3R5BA 2A3JA 4ZN1A 2MYFA 3TZWA 4NLSA 4PEOA 1D9AA 4OX8A 1IKXB 1RI7A 2W9BA 2R2RA 5JVHQ 3BN4A 2EC0A 3W60A 2HFVA 4F4WA 3WQPA 3JAMY 3BBCA 4M5MA 5JUMA 2KHCA 4W4MA 4WE1B 5ETQA 4ZVOB 2HSEB 3TUPA 3ENWA 4R0JA 2CFXA 2LDYA 2ZZNA 2W8KA 4CO1A 2VOOA 4W92B 2GVDB 3R7BB 2XY7A 2XS2A 3SQGB 3RBXA 3N28A 2DIUA 4BLGA 3K58A 3PDNA 3U1MA 2RD5C 1IJFB 3TWZA 1WSRA 2RSQA 5K8OA 4MKYA 1OYDA 3QWPA 2CPJA 2IBKA 2VC1A 4CO0A 4FF4A 4DV5J 2IM1A 1DTTB 1GTHA 1VJQA 3QT8A 1HWJA 3OL7A 3R1LA 1T3NA 4ED3A 4HEA9 4ED1A 2WVEA 4DR1F 4N8NA 5B7WA 1TFWA 4C4WA 3Q8QB 1WHXA 2CQ2A 3DLEB 3W65A 4OFZA 4DJBA 3EZUA 2D74B 4F67A 3R5JB 4F26A 3ETMA 1YG0A 2LKZA 4ZVFA 5A0YA 1FNXH 4DR7F 4IFVB 4QW8A 5BYRA 4QWCA 1FCAA 2B56A 4UY85 3KLIA 3P5TL 4ZVRB 1Q8IA 3D1OA 4ICLB 1UW4A 2DNNA 3VTIA 3H2UB 4OZ3A 1RAIB 4OI3A 4F4XA 4ECUA 3GIMA 1R0CB 4YB1P 2XNQA 5KFXA 5KFKA 3G87A 4CLWA 1AT1B 2R7XA 2NS1B 1YDLA 4ANEA 1S1TA 5D15A 3AOBA 5FD1A 5MAOA 2BDPA 3FGVA 3UCZP 1RA6A 2XS5A 3S8SA 4USTA 2Z58B 1FRMA 2UUWA 4M5IA 4B9TA 1YJTA 2MLXA 4I2PB 2I5JB 2J8AA 2XI3A 1FXRA 3DM2B 3NGSA 2NSBA 2DHHA 2OO4A 4FPRA 2HMIA 4M1KA 3F56A 1RZMA 2V4JB 4PG6A 2DR9A 3OXGA 2X51A 2VIHA 3NS5A 1VQPS 1HIYA 4Q2LA 3TO8A 5L1KA 5HJXA 2N4CA 4M5DA 3CCZA 1DHMA 2HZVA 3BGFA 1UWBA 2X3GA 3AA8A 2HW3A 1R8CA 2DYAA 2AQ4A 4JI1J 2IC3B 3MD3A 5E3AA 4DR3J 3H8YA 1L5UA 2JEGA 3OQ2A 4KFBB 3SCJE 1UA0A 4KC5A 3W2WA 1NXIA 1NKEA 3VAIA 3F0NA 2VQFF 3RW6A 1HBNB 2MPUA 3DKDA 2GAHC 5CYMB 2ZJPQ 3UVJB 1UFLA 4ENOA 3C8YA 3M8QB 4E2FB 2HQDA 3IRXB 4MTPA 3PW5A 1N33F 2GIFA 4HDGA 4RU2A 2MQNA 5E3RA 4F2RA 5C2CA 4ID5B 4R8UA 2R2UA 2NXNA 2J0QD 3GYXB 3IWNC 2AZ3A 3EJMA 1PILA 3CGIA 3MMCA 4C8MA 3KNGA 4U96A 2YKOA 3I9V9 2O1PA 4NEZA 5HSPA 2GHVC 3FCWA 3DOLB 4MK8A 1ACMB 3R8YA 2WONB 4KHPJ 3N5FA 1Q5VA 1KFDA 3SXLA 3G86A 2J76E 1NJIT 2DCLA 4DV1F 1M1HA 1T03B 3DLJA 4ZIWA 5U47A 3H98A 1U0HA 3CCJS 2B7CB 1CBKA 3HO1A 3FEZA 1S12A 4CIOA 2CPHA 1S48A 2EEYA 4M5KA 3G6XA 4WBFA 2W9AA 1VIXA 1D09B 4CNYA 3M8PB 1SJRA 3CJKB 3MM6B 1XERA 1WG1A 2YKMA 2RDDA 1RTDB 3K5PA 3I5AA 3CDWA 3W5ZA 4AQYJ 4TLRA 5KFDA 1MMNA 2KN4A 3J7ZT 2XB2D 3FFIB 3MM8A 4ECTA 4A4JA 1LQ9A 2XZWA 1KLNA 2VKZG 4C8YA 4GKKF 2IPOB 3MM7B 4JOUA 3V6JA 4LF1A 4H54A 1YJUA 3WZ0A 3HMJG 1S0NA 2ILYA 2CPFA 3AXKA 3FMWA 1WKKA 4R25A 3K57A 2YBVA 3BS9A 5ITHA 1VQMS 4JI4F 3LPYA 1XMQJ 3T1HJ 3ITHB 4U67Q 2IVMA 1H6KX 4O3NA 3TW0A 1L3SA 3MEGB 4URGA 3V2UC 3SEOA 5J1NA 1U02A 5J1PA 1RABB 3CCVS 2DXFA 2QSWA 3PKMA 1T05B 4KV8A 2HHUA 1HR0J 1LW2A 2RQKA 2HNYA 3DU5A 3EDRB 1RHQB 2KH9A 5J2NB 5L38A 2KHDA 2GQ2A 3CW2C 2CG8A 3LPEA 4LVNP 3MEKA 1DFDA 3GG0A 3DDNA 4HYKA 3CB4A 3LWMA 2IRUA 4OJHA 1SV5A 3G71S 1S1XB 3QJJA 4F50A 4UZCA 3ZZYA 3ZZ0A 3MMAB 2EKNA 4H4OB 1VQ4S 1R89A 4NLWA 1N5TA 3PW0A 3IR7B 1VQ9S 2ROEA 3EVMA 2HFSA 3TNVA 2HGMA 1OY6A 3I55S 2P5VA 4FF2A 3SDEB 2FVSA 3MFHA 2NYHA 4JI2F 4JI6F 3OL9A 3KJVB 1JKHA 2XEXA 3N6MA 4TY8A 1UTAA 2K3KA 4ECZA 5RUBA 2OPPA 3EX7B 2HVDA 3MCSA 4DG1A 4K4YA 2E9RX 5IT4A 1KOOA 3PFEA 2XYGB 4NL5A 1FKPA 2C3OA 4J9SA 3HM9A 2AGQA 5K8PA 3DRPA 1D9DA 1NUEA 3HI9A 4LBHA 3OR2A 2ZE2B 2DH7A 4YY3F 4DF4A 3QLHA 1EP4B 2PFFB 2FHOB 1E6VA 2LQJA 3M9OB 1F9EB 2HLUA 3BGRB 2ZM6F 1K73T 3MAAA 3ZFVA 4B3MJ 2G9OA 1EETB 1FDAA 2W4CA 2VF3A 3DGPB 1NSQA 2BX6A 2DPJA 2V8HA 2R7QA 5A2QU 3D6HB 1AA1B 4NCGA 1B7FA 1ZA1B 3MI7X 1RTJA 2DO4A 4A8OA 2BQ3A 1IM6A 1FRIA 1S57A 2AX1A 1VOMA 2ZKUA 2BKPA 4EBDA 2HNZB 3JTOA 4WXWA 1S5ZA 2IM2A 4CNZA 4O3QA 1KQGB 4ZVHA 4YHHF 3LH2S 1YX2A 4WYLA 4Q0BA 1YKWA 2HS4A 1JJ4A 2V8PA 5KFEA 3PX4A 4C48A 1QE1A 4MJKA 2Y1RI 5A2QY 2CQDA 4JYAF 3UCGA 2DJWA 3QFWA 3ZNJ1 2WVFA 2DBBA 5DETA 1S4FA 2AZ1A 3EXCX 4MIAA 2G2OA 3QGIA 3VZHA 4ZA1A 1FJGJ 4UOHA 1TL7A 1YSJA 2QSFA 5KG7A 2ZOGA 3ICLA 4OYIA 1S7IA 2Y0BB 1NMEB 3EE3A 4Y34A 5DDRC 1X5SA 3HFVA 2FZCB 2EK1A 3PM9A 1LWEB 2I9SA 5KFGA 2MGZB 3JS9A 1KS2A 2EG2A 4DCOB 1D3WA 2ZOMA 3FBCA 3AB4B 4DEZA 2KL8A 1NZ8A 1N0UA 4PUOB 3VWSA 4X4QA 4LFBJ 1RHJB 1WELA 5J2QA 2YH1A 5CYQA 2PMZD 3UQSA 4HR2A 1TKZA 1NU4A 2XMAA 4FF3A 1C1CB 3KLFA 2UU9F 1SXLA 2W7AA 4NLTA 3A13A 3OTBA 1U45A 1Z1ZA 3AOAA 1YRXA 5DDOC 3BREA 2GJFA 4UF4A 3MEEA 1JLQB 2V68A 2XY6A 4DL2A 2FC8A 1JMTA 1VC6A 3SV4A 2COLA 2ZH1A 4B3OA 3HHNB 3W5YA 2KKHA 2HBRB 2OD4A 4AE5A 2Y0SD 4O44B 3H90A 2OD6A 3DHWC 3ZC4A 1C0TB 1VBXA 2GMJA 2HVEA 3O2IA 4PXCA 3EZOA 3W9IA 2B51A 4AT1B 4K5RA 2OH2A 1M0SA 4NLUA 4JI5J 4C11A 1YQHA 1SL1A 1UFWA 3JYTB 2D3UA 4XK8C 5CA5A 2LU1A 2F63A 4RNOA 2W9CB 1QDUB 1Y3JA 3QZ7A 3Q0AA 4WIIA 4DSEA 1ZM4A 2KZZA 3I87A 2YVSA 2IRXA 1HNWF 3V4MA 4JV5F 3D67A 5SUHA 5I3PA 2YNFB 1XNQF 2W01A 2OGUA 5KT2A 3NGUA 4KKOB 2UVWA 5KFYA 1RWNB 3OL6A 3A12A 2B9XA 5FIIA 4YB7A 2J6SA 1JK9B 3AXMA 3EM1A 3LP2A 5DQGA 2ZH7A 4PWDA 5DG7A 1MROA 5F8IA 4IDKB 3L09A 3TAPA 2AW0A 3SFGA 2C42A 2LA4A 1VISA 1HWUA 2VG7B 4GC6A 2WVDA 1U2RA 2GMHA 2DR7A 3NS6A 3A8JA 2WOMA 3CD5A 5GAEI 2CJQA 1HQUB 3LGMA 5GVQA 1TAUA 5F41A 3LP1A 3ZZOA 3MUTP 1HBMA 3KLHA 1FXDA 1REGX 1VS3A 3TRGA 3IWXA 5B0EA 2RILA 3DLBA 2ZC3A 4GKKJ 4DX6A 4OJ1A 2CJAA 3MURP 4WFYA 2JJ4D 5AJ3J 1EIYB 3OJUA 3RTVA 2H4WB 3IR5B 5H9EJ 1ZPWX 2B6AA 3U27A 1ZM2A 3NNCA 2VBZA 5DDPC 3DI6A 4OYMA 4PWWA 3CUNA 4N41A 2XLKA 2FLPA 1H0HB 3GR0A 5GAEU 1RWPB 3RB0A 3W5XA 2VICA 3L7UA 2MQOA 4B3TF 4QU7A 2UXDJ 2ZJQQ 2UVUA 1U6BA 3UNYA 4WWSA 1TUWA 3I4HX 1X4BA 4I68A 1QAYA 2IVYA 5L8RC 1YJ9S 2B8QA 2W7PA 2ZUGA 2VFTA 1RHRB 4CZCA 4RUAA 1RWVB 2YX4A 3GMGA 2BVZA 1YZ6A 1RWOB 4RW9A 2Z8QA 1IJEB 2XZDB 3UW1A 2W9BB 4QJVA 3IWLA 5IS2A 1VR6A 4N5SA 2GMLA 4L72B 2GHPA 1CVJA 1R7IA 4RU9A 2P9CA 3TVYA 3H5XA 4FYDA 4RUHA 1B0VA 4WFBQ 1SJ3P 5F9LA 1S6OA 2GCFA 3MAHA 4RNFA 1PBAA 3QAEA 4IOBA 3ILIA 2LEBA 1X4CA 4F25A 1T3OA 1G6BA 2DHXA 3OW2R 1AROP 1OPIA 5F0UA 4BDPA 1HNXF 3G9CA 3KK3A 4OYBA 2RRBA 2ZH4A 5DRKA 4ZVEA 3NMAA 4K4UA 1JJ2R 2UUBF 3GJSB 4C97A 2OLWA 3C19A 1ZA2B 5D4LA 2ATCB 5GAHI 4EZ6A 3PTWA 1GX5A 1FXLA 3DOKA 3QWUA 1VRTA 3MEDA 4CH0S 1GFWB 5B0GA 4OYOA 5ETMA 3Q22A 3TUIC 3UD4P 3AAWB 2LP4A 3BKTA 4J9OA 1RTZA 2B4PA 4D3HA 5HVGA 1W26A 7AT1B 3CCRS 2PDAA 1X5TA 3MOJB 3S1TA 1FWLA 2MJUA 1CJUA 4ANCA 4DQIA 2MZRA 2QA2A 3KLIB 1RYSA 4TVAB 3H0PA 2Y1JA 1RXOB 1TUGB 2HQCA 2MKYA 4RW4A 3ZZUA 2RNEA 4URQU 2BBEA 3M6UA 2BOPA 3K5OA 1RJJA 8ATCB 1NK8A 4LJMA 2GW8A 3NNAA 4Q43A 4ZLJA 2H5JB 5GAHU 5L46A 1N52B 1U25A 1FNMA 1S1TB 3GCXP 4L3KA 2D9PA 4K4ZA 3FUYA 2CQ3A 4F0HA 5HANA 3QMQA 3TZXA 5CZVA 1PAEX 3FDSA 1VI7A 3BR9A 4DV7J 3M2UA 2OPSB 5KFJA 3O6QA 3CWJA 3GG1A 1NDPA 1I94F 3P8BB 5E0OA 3D0GE 3HF5A 1KQFB 5HQLA 2HMIB 1CC7A 5E3CA 1FTCA 5LL6d 3OUYA 2W7OA 3W9HA 2OTJS 2KFYA 4O3SA 3FCHA 1FDBA 2VC0A 2HFNA 4IR1A 1IUJA 1UWBB 2ZEJA 2ZHOA 2QLFB 2W24A 2GVZA 1HI1A 1QVFR 2DD8S 3RB6A 2QYGA 1TVRB 1WJ9A 2YQ0A 3IC1A 4FNIA 2VOPA 4QIFA 2V4QA 3R27A 3GIIA 2DNLA 3R2CJ 4OIXA 5H9FK 5CABA 1PG5B 4WF9Q 3W2WB 3QZ8A 2BV3A 3QQCD 2OPRA 1B0PA 1TK0A 5ETOA 2VFUA 4B3SF 4DV2F 2ZBCA 3UDEA 4X4NA 1MWZA 4DBQA 4YMEA 1JIHA 2ZFHA 2G0JA 3HJVA 2GC8A 1VQKS 3Q8VA 4HH0A 2K06A 3RBEA 4R8UB 1NHKL 1OSDA 2G2ZA 4I4BA 3PYDA 5D4NA 2GNKA 3MMCB 4BWMA 4AFFA 3NMRA 2DY9A 1A6LA 4C7QA 2CNKB 1NK9A 2ZOFA 2UXBJ 2A10A 4JI8F 1WTBA 2CZVC 1EJ7L 1HYSA 2KG0A 2WW8A 3BO2A 1S1UA 5ETTA 2W2MP 4I69A 2N3OA 5CCLA 1NHVA 1RT7A 4HHHA 2G4BA 4XAKA 2DVIA 1R27B 4DUYJ 3LGNA 4EU0A 1JXEA 1OQ6A 1D8ZA 4EK2A 2QT7A 3BJYA 4DR6F 1R6VA 5KG0A 3NCQA 2HVZA 2VZ9A 2W4PA 4YB5A 4Z7CA 4NYPA 2ALYB 1IWGA 4CO5A 2AEJA 2LVWA 3K59A 2CDQA 3KHHA 1RWUA 3B8HA 1PC5A 2JFDA 4WTOB 3O8WA 3NGKA 2XMVA 1QM9A 4ZKAA 4ZCKA 2MXYA 3CC2S 2WSCC 4ECQA 4B3RJ 1U09A 5D4PA 5KFBA 1BQNA 2R4FA 1RA7A 2YKMB 4WPAA 3CXCR 3UR0A 1RT6A 1U1LA 3POTA 4JV0A 3FZBA 3BDPA 4QYZJ 4L74A 2MMYA 3WC2A 4Q8FA 4K4WA 3WX8A 2RS2A 5KFVA 5IQ6A 2LQ8A 2DGWA 3FSYA 3UCUP 3R6GB 1FDDA 3MM8B 4OYZA 4PR6A 3J81U 2YWGA 4I2QA 2PI4A 1DTQA 1GMWA 1F2GA 2V67A 2VBWA 1OMSA 2CQHA 1TL4A 3OFEA 4RO0A 4Y0FA 3IRWP 4W98A 1S99A 1DARA 3CJ2A 1CJTA 5F8HA 5GADI 3G4SS 2J6UA 5DZ6A 5LSRA 2EW9A 2F3JA 4NEYA 4QIEA 4PG7A 1NB2A 4P6QA 3J81Y 3J7Z5 2RHSB 2H5EA 3GFYA 1PYSB 4EUVA 2HKEA 2MKCA 2B43A 2MQQA 4OJ3A 4B9UA 4DCPB 1N6QB 2BRKA 4AL6A 1XR7A 4KV8B 1TZ0A 2WVCA 1LW2B 5FDLA 2HNYB 2NUHA 2H51B 2VFSA 1BUXA 1PAUB 2BUNA 3IG1A 4FVMA 2DGTA 2R42A 1WI8A 5GADU 3A3PB 1SV5B 5G4DA 3BN7A 2FHKA 2JRSA 2ZWPA 2KT2A 2D3ZA 4G1PA 4TU9A 2HHHJ 1U1PA 2HRUA 4ELVA 4QWBA 3DNCA 2HWTA 1IKXA 1JKHB 4TY8B 5AE1A 3QSYB 3JSYA 3OLAA 3MCOA 4B9NA 1Y00A 4RZRA 1LEOA 2HAFA 1P1TA 2OPPB 5HO4A 2KB2A 2VQEF 4FBUA 2FJDB 4X64F 4DG1B 4WFNQ 3BH7B 3OFHA 1FKOA 2V8DA 1DBDA 4O4GA 3DRPB 1REVA 3Q24A 1GT8A 3OR2B 2JOQA 2YKAA 4B08A 3H5SA 4ZVTB 2MKKA 2IBOA 3QLHB 2CQGA 3K17A 4YUDA 1E6VB 3MAAB 3KHLA 2DNOA 3KUEA 4X66J 1N56A 1TL1B 3ENAA 3CJ3A 3HDSA 3EVOA 4NCGB 4QOTA 1MWYA 1RTJB 1LXJA 4YR2A 3OXFA 4ZVUB 2KXNB 3OTOF 2V2KA 1T9YA 4RBVA 3D54A 1RU2A 2KYZA 2VD3A 2FIUA 2U1AA 1X9MA 3GV5B 4ILRA 4Q0BB 3J7YI 5KFFA 2IMOA 2OIHA 1KNZA 2ROPA 3D6FB 4DX8H 1QE1B 3TQEA 1L3KA 2WHOA 2PN6A 3OVAA 2DGOA 5I4MA 4ICLA 4GVBA 2MQ8A 2L9NA 5HQMA 3Q83A 1SJ4P 1HI0P 2M70A 3FK4A 3HHEA 3KTQA 3DU6A 4LRCA 3TJ8A 1TL7B 4LSZB 1PGZA 3PHEA 1YK9A 4DR4J 2IFXA 3HKWA 2L9WA 1Z2ZA 4ZK7M 4NCBA 2CWKA 1Q7LB 3HHLA 2QMXA 2GHWA 4DUTA 2WTFA 1RWXB 1PSDA 2E5LF 3NBPA 4IOAQ 3FZ2A 1BGXT 3K8WA 4EEYA 3CPWR 4OYWA 4QWEA 3J7YU 2BJ8A 3N4WA 4NA3A 3LGHA 4WKRA 3A4TA 3WX4A 2M3DA 3HD2A 3IP0A 1VQLS 5J2QB 5CYQB 5DDQC 5LM7E 1TKZB 3KUHA 4DFJA 1J5EF 4CT8A 3KLFB 2X3DA 4F3MA 2HRTA 4YP3A 2F8MA 2XWYA 1LKZA 2XWXA 3L3CA 3MEEB 3C15A 3GCWP 1NDKA 1XMOF 3T1AA 2W8LA 3SCIE 3EPGA 3NRBA 4B3OB 4EBEA 3CE8A 1K47A 1Y11A 3G96A 1OY8A 4KFBA 2C2MB 4WU2A 4J5OA 2HHXA 4NLPA 4B9MA 3R7NB 4L76A 3RUBL 4OHZA 3JQKA 1RCXB 2E7VA 1W2IA 1CSJA 4C11B 2OEMA 4YEAA 2FJWA 3KMQA 3UN5A 3I6PA 3D3CJ 2JX2A 2J7UA 2E1AA 3GJQB 1NBEB 2POKA 4NLGA 4NASA 1HNZJ 1N32J 2E1RA 4LF7J 4Y2IA 3FBFA 4J9KA 2F9JA 1GXLA 4C9DA 2ABYA 2JVOA 2WSEC 4IG3A 1X7VA 2AEFA 1IR0A 3DOLA 2RJZA 2RAQA 1S9EA 3LP2B 1MROB 1ZETA 3PEHA 2YNIA 2JNJA 2UUCJ 4C6AA 4ECSA 4ZPDA 2DEJA 1HBUA 1CJVA 1V6HA 3M1VA 2WOMB 4LFAF 1FX2A 1HMVA 4YQWA 1XR6A 2FDNA 1PKUA 3LP1B 5LSLA 5SZTA 1N5VA 2VDHA 5IC6B 3AD8C 4MKAA 1OQ3A 3IAM9 2RF2B 1HBMB 3M4XA 4C0HA 3KLHB 3W2VB 4Y3CA 4FXWA 3TA0A 3ZTRA 4ZOSA 2MHEA 1WC3A 4NI2A 4DV0J 4L73A 3KKFA 4UOGA 3CJKA 4LF4F 1N36F 4QYRA 3U1NA 1C4AA 1NDLA 1FRJA 1WC1A 3G6ES 4OZ1A 2B6AB 1W25A 3DGVA 2WAQD 1UP1A 3DI6B 3H2LA 4ELUA 1L3VA 1NSPA 1LFWA 3TVKA 4KE5A 1RACB 2VFVA 1N5QA 1IQTA 2Y1LB 3GJRB 2XULA 4FDFA 3SMZA 2LXUA 2R2SA 3M2VA 3GU0A 3VAHA 4U8YA 2VJUA 4MYTA 5DG8A 2HYIB 4P10A 4I6WA 2V2QA 4NXNJ 4L75A 4RW9B 1PYTA 3TANA 2MZTA 1X31C 4P2XA 4FS2A 5DLFA 1NSKL 2GIQA 4EGLA 4BBYA 2HIYA 3MM5A 2BKOA 1CPZA 3G8SA 1IR1A 3VZIA 3W66A 1UZHA 3AT1B 3SSRA 4UUWA 3GZ7A 3QJPA 2HBQB 1I1GA 3OTCA 3CJRA 2D41A 1Q78A 4FBTA 2DHGA 2IVFB 2DNGA 4QR2A 1S0OA 2FJXA 3VCDA 3N5BA 2DKOB 5E41A 2BJ7A 1W7WA 5A6PA 4O0IA 2O01C 2XNRA 2R8GA 2K1RA 1KC8T 1ZYQA 4CLUA 3AOCA 5GMDA 4ED4A 1JXLA 3KK3B 2R8KA 4GVLA 1L3TA 1TL3A 5E33A 2VPWB 5LJ5Y 2VPZB 3NS7B 4USUA 4PXDA 5C5JA 3TAMA 4X65F 4Y6IA 3C14A 3MCMA 2XHCA 4NE9C 3DOKB 4ES1A 2HGNA 4FYWB 9ATCB 1VRTB 3MEDB 1XWLA 3R5GA 4F0MA 5ETLA 4LF9F 2F4VJ 4ZPTR 4ERDA 3M30B 5D0RA 2VFRA 4DDFA 3T6JA 4OHYA 2KJVA 3AY0A 2UUAF 2CG4A 4LRBA 1CJUB 3LUYA 4MAKA 3V81A 2I2YA 1SPBP 4DXLA 3V6DA 3KUGA 3KLVA 1CS4A 4RW4B 1F5CA 5F0WA 3I4PA 5BYSA 5KFRA 2XO7A 1VBKA 2WCXA 3C16A 1YWXA 3DLGA 1U6FA 2ZH3A 3RJMB 2XQCA 4JI7F 1NKCA 1RTHB 1AUDA 4LFCF 1DRZA 1TMJA 4BS2A 4KGXB 4F4ZA 2Y3YA 1B7YB 3D2WA 2Z2MA 2VHGA 4A8KA 3BZQA 1JLCA 2KM8B 1NH8A 3FJ2A 3M2UB 1V5IB 4N77A 2A6MA 1DQ8A 2EXUA 4DF8A 4LREA 1YGYA 1BLUA 4DL5A 1VHIA 3BGOP 1GQEA 4KGVB 4OZNA 1S10A 2FY1A 4U9RA 3OUYB 2YXLA 5KT7A 1V5VA 2AX0A 4DLEA 4DU7A 3A3NB 2V2ZA 4K7QA 2YKPA 2GO8A 2CYYA 2A1BA 2HQIA 5KG5A 4DQRA 5KFQA 2GVZB 1HQ2A 2VG6A 3PRBA 4QCLA 4HDHA 4CLKA 2J6TA 3UD5A 3IMQJ 1WG5A 8RUCA 1UCNA 3E01A 4OYPA 3QFHA 3C2PA 4B02A 3KK1A 3M2RA 1TMMA 2C2NA 2MLYA 2M7SA 2RRAA 2P6TA 4UUXA 5L1IA 4TXSA 4DV6F 2C1EB 4E98A 3CDEA 1WF0A 2FPHX 4FF1A 3DYAA 4DSJA 1QSSA 1URNA 2R8HA 4JI0F 2JVRA 2HS3A 1WORA 5ETNA 1C1CA 1SH2A 4Y2MA 3W63A 3O3LA 5BR8J 2EI5A 4O0NA 2HFZA 2JWNA 2QV6A 3NL0A 1S1UB 2NYIA 1RT7B 3GIJA 4O44A 4QR0A 3HVTA 1VLOA 3CCMS 2HQ3A 1C0TA 2MLZA 4WYWA 4ZPBA 1V3ZA 2XS7A 1MMLA 1NPKA 1HWKA 1LOUA 1U24A 4ZJQA 4NOHA 2W9CA 1RCOB 1RE1B 4K2JA 1F3VA 2YWKA 2ZH2A 4LIRA 1P6TA 2LEPA 2QMWA 1AXQA 3KJFB 3SI8A 1ZBTA 1FVQA 1BQNB 3BBFA 3W1YC 1X4HA 5IWAF 3FC9A 4HT7A 4JI3F 1VRUA 1RT6B 4DUZF 4ZPAA 1R0AA 2E5GA 3Q86A 2AGPA 3CMQA 4NPOA 3MR7A 3RW7A 3H40A 2O3DA 2M8HA 4GKJJ 3CNQP 4I2QB 1ZZNA 4QIGA 3E8OA 3VF0B 4PPZA 3VV2B 2BRLA 4YN3B 3CO9A 2A2CA 4Q7AA 2H9ZA 2VG7A 1RK8A 1BWEA 4J9VA 1QSLA 3TYTA 1HQUA 2GS8A 4U7UK 2EFQA 1CEZA 2FGCA 1L3UA 1CJTB 2X7IA 1FWKA 1PJ6A 3CEDA 4USHA 1F60B 1Q7YT 1GMUA 1G3OA 1QUPA 4OX9F 3MGJA 3D5MA 3OTDA 3UDCA 3GFXA 3VAKA 1FK9A 2BMBA 4IKAA 4WU3A 5KT6A 4FKYA 4MIWA 2HWIA 4F02A 2QIFA 3UPFA 4LSNA 3BPSP 2CVEA 1P1LA 3R5CA 2KI2A 1SBRA 3IXQA 2VUGA 5HMXA 4NA1A 3JQJA 2BM0A 4LQ3A 4DSFA 4DV3J 5FDLB 4V1Ak 1KKHA 1SJ1A 2J9CA 1UAWA 2Z2LA 4USIA 1Y4ZB 3IG1B 2VBYA 1KTVA 2PC6A 2BJEA 2NUUG 4IOCQ 3MXHP 2CAJA 2AJ4A 3ZZZA 4ZCLA 2MKIA 4HI1A 2IM3A 4N7TA 2UP1A 1SUQA 4M8LA 2VPYB 4LBPA 2V69A 1CQNA 5HMWA 1SC4B 3OPKA 4F4KA 3HFKA 1FVSA 4USJC 2KT3A 2UV8A 3DOMA 4J7CA 2FZGB 2NXUA 5DM7Q 1SIWB 2NCKL 1XJWB 1X5OA 5LOQA 1FKOB 5ETRA 1QUVA 4PABA 4O4GB 1REVB 3ILLA 5KFCA 4NLOA 3QSIA 2MZQA 3HD1A 3ZTQA 7FDRA 4NMXA 3CT9A 2CADA 3K7RA 3EVWA 1FDNA 4NXMF 4HVZA 1TFYA 3ENQA 1F5AA 1IBLJ 2B4OA 2XGPA 2CQPA 1B0TA 4UY8T 4PQUB 4ALZA 4KTQA 4IH5A 2I0XA 1X9WA 4DR5J 3T1YJ 4LF5F 2B0GA 1JX4A 2QLJB 2M9KA 1N34F 4K4SA 2IJFA 5L9NA 4JBCA 2XM3A 1UVNA 2DR8A 4TU7A 1K44A 5THWA 2Q1LA 1CJKA 4Z2XA 3T19A 1RLDA 1U0SA 2DNKA 4MT1A 3J81j 1R8BA 4LF8J 4IQMA 1WOSA 2UVRA 1DZ5A 1KDNA 1U2FA 1YLXA 3RRKA 4X62J 5I42A 2ACYA 2Z2YB 3L7OA 5C24A 3QRQA 4GVBB 3EZ5A 6FD1A 1QVGR 3Q2SC 4UOCA 5B0CA 1F0XA 4YR0A 5K5MA 5KOWA 2V6AA 4DR2J 4K0KF 1F9FA 2QC3A 4MKVA 2ZHBA 2VA3A 3GFHA 3BF4A 2OKQA 2Q79A 2L08A 2ZJRQ 3HHLB 4DPXA 2DEIA 2B7BB 1UZDA 1S49A 1S4EA 1P9YA 3NBPB 1S97A 2QEXS 2AWZA 3GSDA 4LBIA 3B82A 1I3OB 1G7CB 4KSEB 3CIMA 3PY8A 1WI6A 3CDAA 1XNRJ 1IBMF 1RBLA 2HBYB 2OPSA 2IAJA 2KZMA 3DDKA 2C3MA 2ZBPA 1HBOA 2JEIA 1WEXA 2IMWP 1NAQA 3V4IA 1FRKA 4LF6F 1KD1T 2OI2A 3HT0A 2HHSA 1Z4UA 5K8NA 4OHWA 4RW8A 1NHUA 3MUVP 1UVJA 4HTJA 2RDJA 2FJEB 3C15B 2ZITA 1RGVA 4L3NA 5KT5A 1X4FA 1WC5A 3BV8A 2Y8YA 1TVRA 4ECWA 2F8HA 3CULA 1KRPA 3M8WA 3Q8RB 1X8DA 3J80U 4PAAA 3HSDA 5FLXU 4BC9A 2N7YA 1WHWA 4DX5A 1HNIA 2AJ1A 2O67A 5H9FJ 2VKRA 2MEWA 2EFGA 5T7LA 2YNHA 4R5PA 2BE9B 4ZITA 2IA6A 1M1KT 3PR5B 2FHJD 1M5KC 1GAOA 2OMLA 2ZD1A 4OV6A 1WC4A 4QPTA 1TK8A 3Q8SB 1WF1A 4LUBA 2M2BA 1KEKA 4BCAA 1Q82T 1N5SA 3PVXA 3B4DA 4MK7A 4ZVGA 1EX8A 3G8TA 3J80Y 4IG3B 5FLXY 1TKTA 4TQSA 3QT5A 1EAYC 2VONA 2R7OA 2W25A 1S9EB 5LMNF 5LMUJ 5LXRA 4WJBA 3DN9A 2EFOA 3AQOA 2YNIB 4IH7A 2LFVA 1F2HA 3RU0A 2HWHA 3FVYA 2G13A 4CLYA 1HBUB 1CJVB 3M1VB 3MPDA 5A8WA 4DV4J 1HMVB 1VQOS 2HZAA 1M90T 1XK8A 4KB7A 2BKNA 4HHUA 1X9SA 1S6QA 2DNPA 3G2XA 3PO5A 1PYOB 1S6UA 4NZ0A 1JNRB 1FJCA 4NI2B 2IDEA 1UEUA 1GEHA 3N0VA 3KNAA 3GP9A 4TQRA 4K2XA 2DHAA 3LW5C 2UXCJ 3PNIA 4PWUA 3RGIA 2GZOA 2DNMA 3E51A 3O5TB 3GIKA 5EWEA 4PXBA 1VRQC 2CPIA 4FYXB 4X4UA 1T9TA 2L9DA 1F5BA 5AE2A 2I6WA 1WWHA 1SL2A 2G0CA 4J91A 1N4LA 1M5PC 4XTTA 3NWGA 2X1GA 4C0OC 2GJ2A 3M2VB 4A8SA 5IQQA 2FHMA 3JXOA 5HP1B 2B4VA 3NGTA 1OO0B 4K8RA 3MUMP 2ZVSA 2LDIA 2LMIA 2HLTA 3TVZA 1SKWA 2YKNA 3MM5B 2VU5A 1SQFA 1B4SA 3ENVA 4ZP6A 2QA4G 1IBKJ 2X1FA 4DI6A 2OP5A 3RBDA 3RB4A 4Y00A 4M63A 2W2QP 2BJ3A 4DL7A 2L48A 1IKYA 2J5AA 2EK6A 4MKBA 1N6QA 4JB8B 3GONA 2IYIA 3W8PA 4I56A 1KBRA 4M94A 3FCVA 2DHSA 4WKYA 1HWIA 5F9NA 1T9XA 1NK7A 2YX1A 2AYMA 4CO4A 3PX6A 5A6WA 1TV6B 4CH1A 4EO8A 2K1RB 1QAIA 1U47A 1HA1A 2DXDA 1VJWA 4U95A 2DNHA 1HNVA 1N0VC 1FA0A 5ADZA 2IJRA 2RB7A 1UEKA 2F1FA 3VAFA 1TL3B 2J0WA 2BJ1A 3D66A 5EDWA 4TY9A 1KN6A 5DG9A 2ZBRA 3IAS9 3T6BA 3TAMB 4OI2A 2LECA 4WK3A 3C14B 1PIEA 3I0RB 4WK1A 1YBAA 3WDOA 1FWPA 2OAUA 3K2YA 4DQPA 1RAHB 4A8QA 4IG0A 2AP6A 4KJIA 2HG4A 1D9FA 4U6PA 4H4MB 2GX8A 5IOLA 4DV5F 1SI9A 1YZ7A 1LXNA 3US5A 1NCLA 2QLXA 5DQHA 3RR8A 3V81B 2R7UA 5A76A 4DR1J 3DRRA 3V6DB 3C46A 3NG8A 3LF0A 1CS4B 5KFOA 1LWXA 5D77A 3C16B 3DLGB 1Y5NB 2MHNA 4OV1A 1B64A 1KSPA 2CQIA 3KG1A 1QTNB 4DR7J 1TL1A 2BABA 1TR0A 4H4KC 2DNZA 1WTFA 4RKUC 2ZWOA 4DZDA 1RB0A 3AJDA 4OQJA 1UJ6A 4FS1A 2GQQA 1MMDA 1WDTA 4U7UD 2W4DA 1JLCB 1I6JA 3M8ZA 2HGLA 6FDRA 1VBZA 3NGRA 2GA7A 1TAQA 1NEEA 1N5YA 1G1XA 1MU2A 5L39A 3THPA 3B78A 1HPZB 4K4VA 1ZTTA 1UKUA 1SL0A 4HL9A 1B99A 1WNEA 5FJ4A 1BY9A 1A9NB 4Y2CA 3PJWA 1VQ8S 4G1IA 1FRXA 2QMUB 1IBMJ 1PC4A 1NDCA 2NR0A 1UVMA 3HJFA 2XZTB 5A8KA 3ZTSA 4ER8A 2VG6B 1S77D 1HD0A 1RTIA 5CZXA 1MSWD 4OYXA 3M6XA 4XPCA 1XN9A 3GPAA 3E01B 3MM9A 2IA0A 3HX9A 3RRHA 2D9OA 3LAKA 3OHAA 2NPFA 3DRYA 2FUG9 2KYXA 3KK1B 3M2RB 3UE2A 5KT4A 4AYBD 4NLRA 3UI3A 5KG4A 1T02A 2AEMA 3LO3A 2XMTA 5CYJA 5IC4B 2FLLA 3DYAB 5KFLA 2CQ1A 2PMHA 3ET6A 4JI1F 5I3QA 2D3OR 5C42A 1M5HA 2XHWA 1NLKL 4DPWA 2CPZA 4DR3F 3D7SB 3TZYA 2XBPA 4GMKA 2VQFJ 2PFDA 3IGVA 3OFGA 5KFZA 4HLBA 2RE1A 1MNEA 1ZS6A 2PEHA 5KG6A 3A1YG 4FYVB 1Q8LA 2E7WA 3L7PA 4XO0A 4BHQA 1HL6A 1N33J 2ZZMA 3CVKA 2ZNZA 3HVTB 3IM8A 5KG1A 3D0HE 3MTJA 3BEGB 2QLWA 3BYPA 3FKBA 3M7VA 1P8GA 2NLWA 3H20A 3CO0P 1E6YA 1FE0A 3ZNUA 1SQEA 5H1SV 4ZVSB 3TP2A 1K0TA 1TUVA 2F7VA 4PG4A 2O5DA 2XMWA 1HQEB 5EWGA 1ZH5A 4KHPF 3AODA 1S0VA 4I7FA 3CD6S 4PPDA 2PA8D 4DV1J 5T41A 3KG4A 2MY8A 4WFZA 2YQ3A 2JL9A 1VRUB 3THTA 2AJQA 2A0FB 3IM9A 4FPIA 3OVBA 1IKWA 1R0AB 3GV8B 3UR3C 4QQBA 4LRAA 2XO6A 4XIUA 4F4YA 2NPIA 4XDCA 1NK6A 3FQLA 1U1MA 2YWEA 5K20B 5C2GA 4J9RA 3CCLS 2ZNYA 2BE2A 2GJIA 4AQYF 3CJ5A 1Q79A 1AUSL 3M8YA 1IVZA 2RF2A 2ASLA 4YR3A 2H5IB 3W2VA 3UN2A 4CP5A 2C3UA 1YIJS 1FK9B 1YBUA 2Z30B 1JLEB 4ETXA 1DY3A 1X0PA 4LSNB 3KJQB 4DFKA 2LYVA 4X4PA 4WIQA 3KDOA 2IRYA 1RAJA 2PD1A 5KFAA 2CZ9A 1TKDA 2RUSA 4ILMA 2N4DA 3QPIA 4JI4J 3C66A 4YDXA 4DSLA 2AD9A 2HNDA 3GWCA 1XMQF 1LFPA 3T1HF 3W3SA 1C1BA 1TL5A 3FNNA 2J8SA 2FYXA 2UVVA 3M8RA 7FD1A 5CAAA 4A48A 2JC1A 2CQCA 1ELOA 2VG5A 5AE3A 1LV5A 1T95A 3I0SA 3AD9C 3PFOA 4HI2A 5KFPA 1M5OC 2E1PA 4ECRA 4X84A 1SUQB 3DC2A 2C2KB 3NY0A 1HR0F 3M8SA 1XTZA 1CLFA 3TAQA 1FFSB 4ZPVR 4DQSA 3U1LA 1U1KA 4LT6A 1FE4A 3DOMB 3NAHA 3OFFA 1QLNA 5KFUA 1WDDA 2HS0A 3CSKA 1NJWA 1RAOA 3K5MA 3IN5A 4G1QA 3TA1A 1C0UA 3T5JA 4Y2KA 2DH9A 3DHXA 2XSFA 3L95X 4KGZB 4JI2J 1APSA 3N01A 2JH3A 4JI6J 2GFFA 3IBWA 2E5HA 5KG3A 3V6KA 3S7RA 1IWAA 1VQSA 1GNKA 3CJ8A 2C2OB 1H7WA 1QTMA 3BQ0A 3PW4A 2JEFA 3H5UA 4QZVB 3TI0A 1FKAF 1N88A 1KVJA 3BH6B 1Q86T 1VQ5S 3MR5A 4KPYA 4KBIA 1KQKA 3QRPA 4YY3J 1JJCB 2DISA 1ULRA 4I1TA 4DX7A 1XBWA 4WP8A 1RADB 2ZM6J 3BSOA 3C6UB 4LRDA 1CJKB 3CJQA 4ELTA 3EGZA 2R2TA 3QO9B 3GILA 4F4AA 4B3MF 3P45B 5D4OA 3H2VE 2F9DA 3M30A 3F44A 4EWTA 3K0JA 3LP0A 3BR8A 2Q6BA 5I42B 4RJVA 4AL5A 3MR3A 5C24B 4WCEQ 4IFYA 4F36A 2WB1D 3CC4S 3R7SB 1NKBA 1K0VA 1O6XA 2KO1A 1FERA 1N8RT 4USVA 4YHHJ 5D3GA 1S1VA 4NCAA 5D8HB 1OSCA 2RHQB 1RTHA 2KG1A 3RRGA 1O0PA 2B8PA 4F3OA 3QJLA 3H59A 2OFHX 4JYAJ 4JUZA 2E29A 2RQCA 2FTRA 3PRDA 4G6VB 1BQMA 2OJ3A 1T7PA 2E9ZA 3HFZB 2K7JA 2DH8A 2W2PP 1UETA 4M5JA 1S79A 1HLWA 2IAJB 2OELA 1FJGF 3E3XA 3LANA 4DQQA 2FVRA 3H4BA 1K9MT 1HBOB 4QWAA 1IM4A 4KT0C 3V4IB 2CA9A 2CKWA 2IM0A 3VVUA 4RLEA 1X4DA 3J7A1 2ILZA 3SSQA 4GC7A 3T3FA 3TEHB 4ZHRA 4PKDB 1FT8A 4FN5A 3BDEA 3R9LA 4RW8B 4X4SA 4M5GA 4B9VA 1M1GA 3D1HA 3K89A 1K8AT 3BKFA 3CF5Q 4AXIA 3X1LB 3NP5A 1RT5A 3BQ2A 1QD1A 3C6TA 3JTPA 3NCRA 1Q8KA 1WACA 2V50A 2V5HG 2C2DA 3PW2A 1EB0A 4LFBF 1DLOB 4C3LA 4RX6A 3OSNA 2DCUB 3R97A 3CJSA 2C2EA 2UU9J 4U7CA 5B0DA 3NXZA 1UL3A 2HIQA 2UUTA 2CNNB 1HNIB 4K4TA 4C98A 1A7GE 2LXIA 5T7LB 2WVBA 2YNHB 4R5PB 4XDDA 5HROB 2ZD1B 4P9SA 3ZZTA 2YH0A 3OHBA 3F41A 3BM7A 3W64A 4NZ7A 1UFKA 4K5SA 4TYBA 6AT1B 2AV5A 2R7SA 2B9YA 4O3RA 3TX8A 4J9PA 3SZ2A 1TKTB 2OMOA 1VQ7S 4CLFA 1EZZB 3CDUA 4JI5F 5AXLA 3HSZA 4RW6B 2JLFA 5EN1A 1J5OA 1U26A 2H48B 1SKSA 5IM0A 1Y7PA 2XMMA 3PYEA 1EQ0A 1KVKA 2RIJA 3KK2A 1HNWJ 4JV5J 4O3OA 4ETZA 3QGPA 1XNQJ 3QIPA 1R8HA 1D8YA 2C28A 3M9MB 5A8WB 1WEZA 1SKRA 4OZ5A 1DQAA 5F3ZA 1IBCB 4CO2A 4E8UA 1JLGA 1VQNS 1Z2LA 1S6QB 4J9QA 2ZBIA 2GGPA 5DO2A 3PIPQ 4RL1A 1I51B 3BPDA 4YOEA 4DL4A 4NYOA 3SYZA 2MDAA 3PW7A 3DXSX 4E0DA 3B4MA 1KTQA 1HW9A 4A8WA 1NO8A 5F8LA 1WHVA 1RAGB 3PYGA 1RAAB 2VH7A 3MR2A 1ZPVA 5DZ7A 1UJ4A 4AUKA 1NRKA 4QBUA 4RUBA 3NCPA 3SBMA 3SFUA 2CRLA 1KLMA 2DGQA 1JLBA 5AJ3F 2PEBA 3Q8UA 4O4RA 1UW9A 2VBXA 1T94A 1V3SA 3DLKB 4KHRA 1AW0A 4KO0B 2QX0A 1RSCA 2DNQA 4DFPA 2MY7A 4B3TJ 2YKNB 4K50A 3ILOA 2QE5A 4KRWA 1URRA 1JLFB 2UXDF 3I32A 3PG9A 5B0AA 2OSQA 1EKSA 1VHFA 4CLSA 3MMBB 1IKYB 1U2CA 3VGTA 4ZPWR 3V5RA 2KFNA 1LWCA 5AXMA 2KRRA 3ILJA 3TUJC 3CMES 1ZZFA 2UZAA 2Q6CA 1OWXA 3HT3A 4HTIA 2K3IA 2EVZA 1RDRA 3H5YA 1RAFB 2BOAA 1W2BR 3A3OB 2RU9A 4FXDA 4P7TA 1HNVB 5DGBA 2F65A 1ZAVA 3G8QA 1S6PA 4TLQA 1PO6A 2H54B 4C3KA 5F3TA 1HW8A 4ZS6A 4CDIA 2XSJA 1FF2A 4CYUA 3KLGA 4ZJOA 3K5NA 5B0FA 3OL8A 3TX0A 4EFAC 1SC6A 1HNXJ 4DSKA 3HSJA 3NNHA 2H65B 5CD4A 3UNGC 2OEKA 2UUBJ 2L41A 3LQVA 1VK8A 4IG0B 2DIVA 4MK9A 4YB6A 2XYHB 2V9WA 4OLOA 1FEEA 3EMTA 4ZVPB 1R8PA 1TELA 1OY9A 2XTJP 4BC7A 3DLHA 3VGSA 1EARA 3DRRB 2V94A 3HHDA 1WSVA 2MJNA 2QYCA 3TR5A 2FD2A 4ES2A 3DMJA 4NWBA 4OZ2A 4CWBA 4DN0A 3CCTA 1GXUA 2WW4A 4HT5A 1G2EA 2XCAA 4PQUA 3CCES 3KG0A 1FRLA 1IKVA 2JLEA 2FVPA 1F6TA 4UT4A 1NK4A 4IH6A 5ETPA 1IXKA 2JLGA 2DRBA 2QGFB 3EDQB 2HURA 4FKXA 1PJ5A 3QT7A 3PIOQ 3KDNA 1CG2A 4O23A 4DU8A 1MN7A 2WSFC 1Q95G 3PZPA 3X3UA 2QFJA 1S9FA 1FJ7A 1Q4RA 3JB9k 2AJ2A 3AA9A 1RLCL 3OVSA 4RNMA 2A18A 1N5YB 1U1QA 1MU2B 1MN9A 2DK2A 4MFBA 4RBUA 2XMKA 3QIDA 1YRTA 4LRFA 1Q5YA 5G0RB 2ZHAA 4OI6A 1F3FA 2HZCA 4I6AA 4LIWA 4V19J 2RRNA 2KVIA 2LQBA 4HH1A 1XQIA 2CQBA 4KAIA 5D0EA 2DITA 2I1RA 3S01A 3TJ9A 1VFJA 3R5AA 4ZLNA 4DV7F 1I94J 5A8KB 4PG8A 1RHUB 1RTIB 5KG2A 2HHPA 1TKXB 2ACMA 2C2ZB 1Q0NA 3MM9B 1WUUA 3O44A 3PJXA 1Y9OA 2KT5A 3KOAA 4OZJA 4Z37A 1X4GA 3FSXA 2AYEA 1ZM3A 4RWXA 2QRRA 5KAKA 2MQPA 2DB1A 4HHJA 3FQKA 1RT3A 1BD6A 1YI2S 3N79A 5LXYA 2BJ9A 1UVKA 3P49B 4F7VA 3ADAC 2J0SD 5C7PA 2BE7D 1RUSA 5HLFA 3ET6B 5K14A 5C42B 1SB6A 1YJ7A 2DY1A 3R6LB 2V8VA 4DPUA 5JJBA 1WG4A 1GXTA 1T9VA 2FVQA 4B3SJ 4TKTA 1VK3A 8AT1B 2Z0GA 4DV2J 1FO1A 3CIZA 2CXEA 1H7XA 4HACB 2OTLS 2BACA 4B9SA 2HQGA 2GAGC 3FRYA 3S6EA 4CM0A 1MG7A 2NXEA 3BGLA 5HQ8A 2JSXA 3K8VA 3VQSA 3P4UB 1E6YB 4JI8J 3ETOA 2AT1B 1DAXA 1IN0A 1NB7A 2UXBF 2B3TB 3MECA 2IYGA 4PZVA 1YJVA 3G82A 4I7FB 3MPWA 2RMLA 4WXOA 3D4JA 2MTLA 1S1WA 5HJYA 3NWRA 1YVFA 3EWGA 2GO9A 1RP5A 3PXGa 1FFGB 4DUYF 4DR6J 3J7AN 1RU1A 1TK5A 5GMKa 2JHEA 5DQIA 4DS5A 3WBZA 3DDIA 1JNZB 2IJNA 1IKWB 4CH7A 1LK7A 4JV2A 2HVIA 1NJXA 4DS4A 4ZJLA 1G4CA 1H2TZ 2CPXA 2AGOA 2HBZB 5HVHA 2E5JA 2YPYA 1RWKB 3RAMA 4UQGA 1R43A 2QZ8A 1YJNS 2RKIB 4I6YA 3LALA 5CH7B 2CNLB 4B3RF 3NOCA 4IYQA 2D3O1 4ZLPA 2RUGA 1BWVA 2BJDA 5D0HA 2BE2B 2J7KA 2CQ0A 4Y28C 3MR6A 2M52A 3GSIA 4USMA 4OI4A 2WRMA 3GIRA 3GYGA 4ID8A 4LQ9A 1HHTP 2V34A 2CJKA 3RB3A 1JB0C 4OX6A 1PJ7A 1VQYA 1AZSA 3PJ9A 1S0MA 1D1UA 3UN3A 2BW2A 3MZIA 4EZ9A 3W8GA 5I3UA 1VIOA 5KFSA 3IBFB 4KHMA 2R8IA 2QO3A 1UPMB 2WZ1A 3JSBA 3B54A 2EFPA 1RT2A 5CHCB 5IT0A 5EHHA 1ZTWA 2OFGX 2F40A 4FNHA 3H4DA 2HNDB 4B9LA 4F8RA 5IXUA 4NLVA 1KHVA 1Q81T 1GK8A 1C1BB 2CQ4A 4FP9A 2K2PA 1R0BG 2JEJA 5J1EA 1SKUB 5BXIA 3KXDA 5L1LA 1O5JA 2VG5B 5L9XA 3I0SB 1SJFA 5J2PB 5KFHA 2P9GA 3HXMA 4MMOA 2WB4A 3LWLA 5HP1A 3VQTA 1OS5A 1S59A 3VAGA 3JSMA 3M9NB 3V6HA 1FESA 2DGSA 3UWTA 1HHSA 2ZVIA 5CD4H 3AD7C 4DHVA 2XMUA 1NNDA 4FZVA 4UOFA 4ED0A 3GE9A 2KJWA 4G1QB 4J9MA 1C0UB 3CDBA 3Q23A 1CULA 1LWFA 4CLPA 1D0EA 2ZDOA 3IBCB 4ZPCA 2FJAB 4OMFG 2HHHF 1S76D 2LCWA 1TV6A 2NZCA 1RYRA 1KVIA 2M4MA 3QATA 3HVRA 4RR5A 2A6OA 1LNQA 3OR1A 2VQEJ 4X64J 3GJTB 2XI2A 1NK0A 4IRKA 1R3NA 4JV1A 1RHKB 1HD1A 4ZP9A 5CQGA 2CPYA 2YWFA 2FHJA 2BQRA 2BEFA 1IR2A 2PO4A 2JZ5A 4ATNA 3OSPA 2ATLA 1KR4A 3I0RA 2YQ1A 4ECXA 1F9HA 2J9EA 1RT1A 4K4XA 2RU3A 4IRCA 1KWMA 4AL7A 2DNRA 3BGUA 2C2RA 4ZLLA 4MIBA 3LA0A 2QLBB 2PA3A 5KFIA 4WZQA 3ISZA 4J9LA 4NA2A 1OIAA 1U1RA 2EWHA 3ZO7A 5A0YB 2FLNA 4X66F 3F73A 4H4MA 5ETSA 3LP0B 1U6ZA 2QFIA 3KMSA 3EICA 3OTOJ 4IFYB 3MDFA 4X2BA 5LT5A 1C4CA 3QNWB 3WHIA 2E1CA 3SCLE 3HPOA 3TZZA 3T5KA 1BC6A 3HZGA 5D3GB 1S1VB 3NGDA 3W7BA 2M8DB 4KPCA 1T11A 3HCXA 1NK5A 1JQGA 5EX3A 1HARA 3W61A 2HHWA 2V2VA 2BANA 2KU7A 2MZJA 2CNOB 2FC9A 5D0GA 4N76A 3M6VA 5HL7Q 2NREA 3CD7A 2X1AA 3TEGA 1BQMB 3BQ1A 4P7VA 4KYZA 1YITS 3SCKE 4Z7YA 2ZH8A 2N3LA 3IS9A 1YTYA 4ZDNA 4C3MA 4DPYA 1H3DA 4P2FA 4DR4F 1TU0B 2WK4A 2NXJA 1DQ9A 1HPZA 4CTAA 5HBMA 2CJBA 5F8JA 2E5LJ 2K8GA 2K7KA 3FEXB 2V63A 1FI4A 1EHWA 1S9GA 1O8BA 5KT3A 2Z57B 2WBRA 3PR4A 2MQMA 3RYLA 4NLDA 4ZHRB 3IGNA 3Q8YA 4S0MA 5E3QA 4LR8A 4I0WA 4M5DB 5KFNA 2B5JA 3UFCX 2HHQA 1WKLA 2MZ1A 3PEJA 1RT5B 3C6TB 5E5NA 2CJ9A 4JP8A 2YNGA 1RT4A 2N7CA 5J2MA 4GO7X 2B9EA 1J5EJ 3Q2TC 1QJHA 2Y8WA 2D69A 2M0GB 2PGCA 2FJVA 5IFMA 1HHQA 4IRDA 4KH0B 3KHGA 2ZKTA 3KLEA 4NRUA 4UTGA 1JLAA 4URSA 1XR5A 2QL5B 4NX9A 3D68A 1TP7A 1XMOJ 4C8KA 2F4FA 2E66A 3LTOA 1WHYA 4P52A 4A8XA 4DOZA 1NJZA 2Q3PA 4EYHB 3DRSA 3FEYB 1C2PA 2V0NA 3VALA 1BE4A 5KOXA 1HFEL 3DXBA 1R6YA 2KM8C 1ZAXA 1UVLA 5EGYA 5HAOA 5B09A 2H3EB 1H38A 2PI5A 4EBCA 3CTRA 3G6YA 2G0IA 4N56A 3OTEA 3CC7S 1Q8BA 1J5OB 2IIHA 1Q1KA 2VPXB 5IM0B 1FNOA 5E3PA 4N47A 1HNZF 1N32F 3MF5A 4LF7F 3KK2B 4RW7A 2E5IA 1B3TA 2YWWA 3QIPB 4ZP7A 2OEJA 1BHNA 4DL0C 1LW0A 4G3IA 1U0HB 1YBTA 3EYZA 3AH6A
chains in the Genus database with same CATH topology
2DCLA 4DV1F 4YDDB 1X7VA 3KG4A 3BSAA 2MY8A 1IR0A 3DOLA 2RJZA 1T03B 1S9EA 1JLGB 3DLJA 4WFZA 2YQ3A 5U47A 4BWJA 4Y65A 2JL9A 1X4EA 3H98A 1VRUB 3LP2B 1HQEA 4RWWA 3CCWA 3THTA 3HP6A 3CCJS 1MROB 1BQXA 2AJQA 1ZETA 3PEHA 2YNIA 2GGPB 3DLLQ 3OVBA 2B7CB 1IKWA 1R0AB 3HO1A 4ECSA 3GV8B 2UUCF 3FEZA 3UR3C 3TUZC 2ZH5A 4ZPDA 4CIOA 4QQBA 1UA1A 2CPHA 2OPQA 4C2MA 1HBUA 1S48A 1V6HA 3M1VA 4XIUA 3I56S 2WOMB 1RKJA 3G6XA 4LFAF 2W9AA 1HMVA 2LA6A 4F4YA 4YQWA 1XR6A 1VIXA 4X4RA 2FDNA 3LP1B 2UV8G 1YJRA 5LSLA 2MSTA 2NPIA 5SZTA 2DR5A 4CNYA 1N5VA 4XDCA 2YY3A 1NK6A 3FQLA 3D0IE 1U1MA 4MKAA 1OQ3A 3IAM9 2RF2B 2YWEA 1HBMB 3AB2B 3M4XA 3M8PB 4C0HA 1SJRA 2DTJA 3MM6B 3CJKB 3KLHB 3W2VB 3EGWB 1XERA 1WG1A 4EYIB 2YKMA 3UD3P 4Y3CA 1RTDB 3K5PA 4I64A 4FXWA 3TA0A 3I5AA 4J9RA 3CDWA 3CCLS 2ZNYA 2CPEA 3WC0A 4ZOSA 2MHEA 4TLRA 3RZAA 5KFDA 2BE2A 1MMNA 3BSCA 2GJIA 4AQYF 3CJ5A 1Q79A 1U7LA 2KN4A 2YX7A 3KKFA 2RF2A 2ASLA 4YR3A 4DV0F 2BXJA 4Q2MA 3CJKA 5BJRA 3J7ZT 1N48A 2XB2D 3W2VA 2DNYA 2C3UA 2RDIA 4ECYA 4LF4F 1N36F 1KLMB 1JLBB 1YIJS 3FFIB 1FK9B 3MM8A 4QYRA 3U1NA 1C4AA 1FRJA 3G6ES 4OZ1A 4ECTA 2B6AB 2ASYA 1W25A 1FHTA 4A4JA 1LQ9A 1JLEB 2WAQD 2XZWA 1KLNA 2V4RA 2OSRA 2VKZG 4ETXA 2ALZA 4C8YA 2YTCA 4GKKF 1X0PA 4LSLA 5T14A 3MM7B 2P6SA 4JOUA 1UP1A 3DI6B 4LSNB 3H2LA 4A46A 4ELUA 4DFKA 3V6JA 3GB0A 2LYVA 4X4PA 4D3GA 4H54A 1L3VA 2VV5A 1LFWA 3U02A 1YJUA 2IRYA 3WZ0A 3HMJG 3TVKA 1RAJA 2PD1A 4KE5A 5KFAA 1X0FA 4QWDA 1RISA 1S0NA 2ILYA 2VFVA 1UVIA 2CPFA 2GQCA 1U4BA 3FMWA 1N5QA 1TKDA 1IQTA 1JLEA 4R25A 4ILMA 2N4DA 3QPIA 2XULA 3SMZA 3K57A 2LXUA 2ASJA 3BS9A 5ITHA 1VQMS 4UQTA 5EWFA 2R2SA 4JI4F 3C66A 4YDXA 1JWWA 4DSLA 1XMBA 3LPYA 3ITHB 1Q53A 2AD9A 2HNDA 2Q66A 4MYUA 3UDLA 4U67Q 3GWCA 3M2VA 1LFPA 3T1HF 3N6LA 1XMQF 2IVMA 3W3SA 1H6KX 3MTKA 4NMLA 4O3NA 1C1BA 1LWCB 1TL5A 3FNNA 3VAHA 2G1DA 3TW0A 1L3SA 2QA4S 3MEGB 3ONQA 2UVVA 1XEZA 4URGA 4MYTA 5DG8A 3M8RA 7FD1A 4IR9A 2HYIB 4A48A 4I6WA 3V2UC 2JC1A 3SEOA 4RW9B 2CQCA 5J1NA 1ELOA 2VG5A 3TANA 2R8JA 2MZTA 5AE3A 4NXNF 1LV5A 1T95A 3I0SA 5J1PA 4FS2A 4A8YA 5DLFA 3PFOA 2GIQA 4HI2A 2U2FA 2CIMA 4EGLA 4BBYA 3MM5A 5KFPA 3CCVS 5A8RA 2QSWA 1M5OC 3PKMA 1CPZA 3G8SA 1T05B 4KV8A 4ECRA 4XPEA 2HHUA 4X84A 1VMBA 3VZIA 3RAXA 1LW2A 1SUQB 2RQKA 3DC2A 1U1OA 2HNYA 3DU5A 3SSRA 1HR0F 4UUWA 3M8SA 1XTZA 3GZ7A 1CLFA 3TAQA 3QJPA 3OBIA 1I1GA 3OTCA 4ZPVR 4DQSA 2D41A 1YRUA 1Q78A 2KH9A 4FBTA 5J2NB 2DHGA 2IVFB 2DNGA 4QR2A 3U1LA 1ZOTA 5L38A 1U1KA 4B17A 1S6PB 2KHDA 2I38A 1FD2A 2GQ2A 1S0OA 2PT0A 2FJXA 3VCDA 3N5BA 4LT6A 5AXKA 1FE4A 5C25A 5E41A 1ZM9A 4LVNP 3NAHA 3OFFA 1QLNA 5KFUA 3MEKA 1DFDA 3GG0A 3IO1A 2HS0A 3CSKA 3M32A 3DDNA 4HYKA 3CB4A 1NJWA 3LWMA 2IRUA 4L6V3 3K5MA 3IN5A 3AQPA 4OJHA 1SV5A 5A6PA 1GH8A 4G1QA 3N6NA 4O0IA 2O01C 3TA1A 3G71S 1S1XB 1C0UA 3QJJA 4F50A 2XSJB 3T5JA 3ZZYA 3ZZ0A 3MMAB 4Y2KA 3KLGB 2XNRA 2DH9A 4H4OB 1VQ4S 2K1RA 2R8GA 1R89A 3DHXA 3CCQS 1KC8T 4NLWA 2XSFA 1ZYQA 1N5TA 3L95X 3PW0A 3IR7B 1VQ9S 2ROEA 1JXLA 1Y3KA 3TNVA 2HGMA 3I55S 2P5VA 3KK3B 4FF2A 2E1MC 3GYNA 5F8NA 1UMJA 1APSA 3N01A 2JH3A 3SDEB 2GFFA 3MFHA 3GV7B 1L3TA 4ITSA 4JI2F 2FVSA 2R8KA 3IBWA 1TL3A 4JI6F 5E33A 3OL9A 1WF2A 1JKHA 2VPWB 2XEXA 3N6MA 4TY8A 3KJVB 2E5HA 4WE1A 5KG3A 2K3KA 3V6KA 1FKPB 5LJ5Y 4ECZA 3U7JA 3S7RA 4UW2A 2A2DA 2RQ4A 4IO1A 3AJ2A 2VPZB 2VODA 1M5VC 1S7HA 2OPPA 3EX7B 2ZH9A 1VQSA 1R31A 4PXDA 5C5JA 3TAMA 3MCSA 1GNKA 4DG1A 4K4YA 4X65F 1H7WA 1QTMA 3BQ0A 3PW4A 4Y6IA 2JEFA 2E9RX 3HLUA 3H5UA 4QZVB 5IT4A 1KOOA 3PFEA 3TI0A 2JDJA 3QAUA 4NL5A 1FKAF 4NLQA 1FKPA 1N88A 2C3OA 3SQGA 3DOKB 1KVJA 4J9SA 4ES1A 3HM9A 2HGNA 2NSCA 2AGQA 5K8PA 2FLOA 3DRPA 1VRTB 3MEDB 1D9DA 3DMJB 1XWLA 1Q86T 1VQ5S 3MR5A 4KPYA 4KBIA 1KQKA 3HI9A 3HVAA 3OR2A 4QIVA 4LF9F 2ZE2B 1M5SA 2DH7A 4YY3F 1P27B 2DISA 4ZPTR 4DF4A 4ERDA 2F4VF 3QLHA 3CCSS 1IKVB 1ULRA 3M30B 4I1TA 1EP4B 4DDFA 2VFRA 4OHYA 3T6JA 2PFFB 1XBWA 2FHOB 2KJVA 1DTTA 3AY0A 2CG4A 4LVOP 2UUAF 3BSOA 3C6UB 2AU0A 2QA1A 1E6VA 2LQJA 3M9OB 1YJWS 2HLUA 3BGRB 2ZM6F 1K73T 3LUYA 4ELTA 3ZFVA 3ZZPA 4MAKA 3V81A 2R2TA 4F3QA 3EGZA 2I2YA 3QO9B 2F8EX 3GILA 2G9OA 4B3MF 5D4OA 3H2VE 1EETB 1FDAA 2W4CA 2F9DA 3V6DA 3M30A 2XLJA 3F44A 4EWTA 3KLVA 5KFMA 3K0JA 3LP0A 2DPJA 2V8HA 2R7QA 3BR8A 1F5CA 4RW4B 3I4PA 3C6UA 5F0WA 4A47A 5BYSA 2E9TA 5KFRA 2XO7A 2Q6BA 5I42B 2WCXA 1K1SA 1YWXA 4NCGA 1B7FA 3DLEA 3DLGA 1U6FA 2ZH3A 4AL5A 3TARA 3G6VA 3MI7X 1RTJA 2DO4A 4A8OA 3MR3A 3QO9A 2BQ3A 3ISNC 2AJ0A 5C24B 4JI7F 1NKCA 1FRIA 2J0XA 4WCEQ 4IFYA 4ILLA 1RTHB 1AUDA 4LFCF 2AX1A 1DRZA 1VOMA 2ZKUA 4BS2A 2WB1D 4EBDA 4MFBB 2HNZB 4IFVA 3CC4S 1NKBA 3JTOA 4F4ZA 1K0VA 1GTEA 4WXWA 2KO1A 1WD6A 1FERA 2IM2A 4NLXA 1N8RT 4CNZA 5D3GA 4O3QA 2SXLA 1S1VA 4NCAA 5D8HB 1KQGB 4ZVHA 4YHHF 3LH2S 3D2WA 1OSCA 1J2VA 1RTHA 2Z2MA 2KG1A 4A8KA 3BZQA 4WYLA 4Q0BA 3CJ4A 3RRGA 1O0PA 1JLCA 2HS4A 4F3OA 1JJ4A 2KM8B 2EG1A 3T5LA 1NH8A 5KFEA 3QJLA 3H59A 3PX4A 3FJ2A 3DRXA 2OFHX 4C0BA 1QE1A 4MJKA 2Y1RI 1Y0HA 5AXNA 5A2QY 3K5LA 4JUZA 2CQDA 3M2UB 4DLGA 4N77A 2E29A 2RQCA 2FTRA 4I67A 4JYAF 3UCGA 3PX0A 2DJWA 1DQ8A 3PRDA 4G6VB 4DF8A 1BQMA 2DBBA 2EKYA 2OJ3A 5DETA 1YGYA 1S4FA 1T7PA 1BLUA 2E9ZA 3EXCX 4DL5A 2DGUA 2K7JA 2DH8A 2XLIA 1GQEA 4ECVA 4MIAA 4OZNA 2KXFA 1S10A 3QGIA 4PG5A 2FY1A 1UETA 4U9RA 4WFAQ 3OUYB 2KFZA 3VZHA 4ZA1A 1S79A 5KT7A 2AX0A 4DLEA 3KHRA 4WFXA 2IAJB 1FJGF 1YSJA 3E3XA 3LANA 2QSFA 5KG7A 4DQQA 2FVRA 2AF6A 2ZOGA 2MQLA 1N54B 4ZMMA 2YKPA 3ICLA 3H4BA 1K9MT 1QY7A 1HBOB 4QWAA 1IM4A 2GO8A 2CYYA 2J7WA 4HKQA 4KT0C 2A1BA 4Y34A 2HQIA 2HAIA 5DDRC 3V4IB 2CKWA 1X5SA 2IM0A 1X5PA 2AJFE 2EK1A 3PM9A 4I2PA 2EBEA 4RLEA 1LWEB 2I5JA 5KG5A 2I9SA 4DQRA 1RT3B 1X4DA 5KFGA 2MGZB 3J7A1 2ILZA 3SSQA 5KFQA 4GC7A 3T3FA 3MMJA 3DM2A 3GQCA 2DPIA 2VG6A 3PRBA 4ZHRA 4QCLA 4PKDB 4HDHA 1FT8A 4FN5A 1KS2A 5HLFB 1JJHA 2EG2A 4X4VA 3BDEA 1D3WA 2ZOMA 4QR1A 5K14B 2J6TA 4RW8B 4X4SA 3IR6B 2PIIA 2V4JA 4PQAA 3AB4B 4A8MP 1WG5A 4B9VA 4DWIA 3D1HA 3E2EA 2LEAA 3E01A 1K8AT 4DEZA 3GFZA 3CF5Q 4AXIA 3X1LB 1N0UA 3NP5A 1RT5A 3BQ2A 3C2PA 3VWSA 4PUOB 3FRZA 3C6TA 3JTPA 4Q8EA 3HKZD 4B02A 3NCRA 4X4QA 3KK1A 1WACA 3M2RA 2R9LA 2KTQA 2V5HG 2M7SA 2C2DA 2RRAA 2P6TA 3PW2A 1WELA 4LFBF 4UUXA 5L1IA 5CCMA 5J2QA 2YH1A 1DLOB 3T9NA 4RBTA 5CYQA 2PMZD 4RX6A 4C3LA 3UQSA 4TXSA 3OSNA 4DV6F 2HHTA 1TKZA 2DCUB 5D78A 4E98A 1NU4A 2C2EA 3CDEA 4U7CA 5B0DA 1UL3A 1WF0A 4FF3A 1C1CB 3KLFA 2UU9F 2FPHX 2HIQA 4MH8A 2L3MA 2UUTA 1SXLA 2W7AA 3DYAA 4FF1A 4DSJA 4N8OA 1QSSA 4NLTA 1URNA 3R5DA 4QW9A 1HNIB 3OTBA 1U45A 2DT9A 4K4TA 1Z1ZA 2R8HA 4C98A 2IC3A 1KQSR 2ADBA 1YRXA 1A7GE 1DLOA 5DDOC 3BREA 4JI0F 3NKYA 2JVRA 2HS3A 2LXIA 5T7LB 3MEEA 5M2RA 1JLQB 2XY6A 1H2UX 2YNHB 2RH3A 4R5PB 4XDDA 2O66A 4DL2A 3CCUS 2FC8A 1JMTA 1C1CA 1SH2A 5HROB 5KFWA 2MKSA 2V8GA 1P9QC 1VC6A 4Y2MA 3M6WA 3SV4A 2COLA 2ZD1B 1SIZA 2ZH1A 4B3OA 3HHNB 3ZZTA 2KKHA 2OD4A 1HBNA 3M05A 4AE5A 2YH0A 3OHBA 2Y0SD 3F41A 3BM7A 3I31A 4O44B 3O3LA 4NZ7A 2EFNA 2OD6A 3DHWC 4K5SA 5CYMA 3ZC4A 1C0TB 4TYBA 4YFUA 1VBXA 2GMJA 2HPUA 2AV5A 3M8QA 3HHLC 2EI5A 3TOQA 3MECB 2Y1IA 3PKYA 2R7SA 2HFZA 3AHPA 2JWNA 2QV6A 5BR8F 2FB0A 5HROA 2B9YA 3O2IA 3IRXA 1HWLA 1S1UB 4O3RA 2RVJA 3I5BA 2NYIA 4PXCA 3TX8A 4X4TA 4J9PA 3T5H