1MWZA

Solution structure of the n-terminal domain of znta in the zn(ii)-form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ZntA
publication title A new zinc-protein coordination site in intracellular metal trafficking: solution structure of the apo and Zn(II) forms of ZntA (46-118)
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 73
sequence length 73
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mwzA00
1XBWA 5B0AA 2OFHX 2GO8A 1JK9B 4A46A 1JWWA 2FB0A 4OIXA 2RU9A 1MWZA 4OJGA 1TUVA 3K7RA 4Q2MA 5A6WA 1FD8A 2W4DA 3BR8A 4NL5A 2RMLA 2KT2A 2AW0A 3HHLA 4Y2KA 3KKFA 2HFOA 4YEAA 1Y3KA 2AJ0A 3BM7A 2LDIA 1Q4RA 2W4PA 3DXSX 2KKHA 4FNHA 1YJRA 2HLUA 1APSA 2OP5A 2ACYA 3HDSA 3LO3A 2XMKA 2GGPB 2FTRA 2QLWA 1QUPA 2KYZA 1CPZA 1FVSA 1N5SA 2K1RB 2GV1A 1KVIA 2GA7A 1GXTA 1Y0HA 2PGCA 3BF4A 3KG1A 2RILA 1P6TA 4HI2A 4DN9A 1AW0A 4ZA1A 4HH1A 2N4DA 2K7KA 2ZDPA 2OD4A 4U9RA 2EW9A 1FEEA 1N5TA 4A47A 1W2IA 3GZ7A 2OMOA 1CC8A 1FE4A 2QIFA 2VH7A 1URRA 3BB5A 3TOQA 3WDOA 2ROEA 4FNIA 1FESA 3BN7A 4NPOA 1V3ZA 3HFKA 1P8GA 1YRXA 1YJVA 2GGPA 2L3MA 1VQYA 1GXUA 4A48A 1SB6A 2IYIA 2LQ9A 3FGVA 1S6UA 2BJEA 2K1RA 1TL5A 2XMJA 3LGMA 1X0PA 4Y2IA 3BGUA 2N7YA 2GFFA 1X8DA 1AFIA 4ZOSA 2IYGA 2K2PA 3HHLC 2BBEA 1Q53A 3HF5A 2XMUA 1N5VA 2GCFA 3KNGA 1SQEA 1R6YA 5B0BA 3HHLD 2KT3A 5B0FA 2XMMA 1N5QA 2G9OA 1VQSA 2PD1A 2QLXA 3HX9A 5B09A 5B0DA 1OPZA 1OQ3A 3FMBA 1KVJA 3MCSA 3QGPA 2LXFA 1IUJA 2XMTA 2AP6A 3FRYA 1Y3JA 3IWXA 2QYCA 1LQ9A 1YJUA 2XMVA 3I9ZA 1X7VA 3T9NA 2ASYA 4OJ1A 1YJTA 4EFAC 2OD6A 4HL9A 1S6OA 1K0VA 3TNVA 4YDXA 5B08A 1Q8BA 5B0EA 2RSQA 2OAUA 3BDEA 3E8OA 2HLTA 3DCAA 3CJKB 4DL0C 2XMWA 1YG0A 4DPOA 3QMQA 4Q2LA 5B0CA 1FVQA 4A4JA 1Q8LA 4F67A 2LQBA 2HIQA 2VV5A 2HFNA 1Y9OA 3LGNA 2OFGX 5T7LB 1AFJA 4HI1A 1ULRA 3UDCA 1TL4A 2BJDA 5F0WA 5K9FA 4Y2MA 3KG0A 1SI9A 4OJHA 4HH0A 1OQ6A 2OKQA 2AJ1A 2HQIA 2K7JA 3TRGA 2Q3PA 2ZDOA 2JDJA 1OSDA 4OJ3A 3IWLA 2CRLA 1CC7A 3CJKA 4QOTA 1U7LA 1RJJA 5KAKA 5B0GA 3HHLB 2IFXA 5IXUA 5F0UA 3F44A 1FE0A 2ROPA 5T7LA 5A6PA 3VTIA 2W4CA 2BUNA 2FHMA 3MZIA 2ROGA 2BYCA 1TR0A 1TZ0A 1KQKA 2N4CA 1WD6A 2FIUA 1MWYA
chains in the Genus database with same CATH superfamily
4RO0A 1WG4A 4ANEA 3OLBA 4Q2MA 3EM1A 2WW4A 3CC4S 1NK0A 4FKYA 4Y2KA 2IA6A 4Y2AA 1ZETA 3PTWA 3CNQP 4PR6A 5DDQC 1Q79A 5LMNF 4OHWA 1WG5A 4UOFA 4Z2XA 1S99A 1L3KA 4UOGA 2V6AA 5CA5A 4JBCA 4ATNA 3DHWC 3CSKA 1VJQA 3LAMA 2B4PA 3W61A 3R9LA 1BWEA 3ENVA 1YI2S 1CG2A 4AD6A 2A0FB 4ZOSA 1R89A 2DJWA 1VC5A 3MMAA 2HAFA 2X51A 2OUGA 1XWLA 3G71S 5KFBA 3ADAC 3I9V9 2NSBA 2ZD1A 4U8YA 1S6OA 4HDGA 4WJBA 1NDLA 2FHJD 4EEYA 4DQQA 5HI7A 4WP9A 4LF2A 4DV0F 1S1WB 4Q44A 3MEDA 3CCVS 3W1YC 4DFKA 5D0EA 1RWMB 5GADU 3GILA 4J9OA 2EC2A 1QLNA 3MMBB 4K50A 1KP6A 2ROGA 4MIWA 4OYIA 2CYYA 4ANDA 3HCXA 3QIDA 2C1EB 3BREA 3V4MA 1Y7PA 3PJXA 5LSLA 4OHXA 3HJVA 3CJSA 3MEGA 1VHIA 1IBLF 4LR7A 4LVNP 1CVJA 5I42B 4ZVSB 3KLEA 1UCNA 1QJHA 2W2OP 2R3VA 2HS4A 1NJIT 5HVGA 3D5MA 2KTQA 1H7XA 2VBZA 1S9EB 4WCEQ 4ES1A 1EP4A 5HO4A 2DHSA 5DM7Q 5ETRA 1HMVB 4KH0B 3DOKB 4IG0B 1RADB 4ZCKA 5KFNA 2DR5A 3R6LB 1G3OA 5A8KB 4LRAA 3CC2S 1NK4A 1LFWA 1VQLS 4V19X 1DARA 4IQXA 1TV6B 1RT6A 2XULA 3DLLQ 3CJ2A 4DU7A 3DN9A 4RR5A 4ECUA 1P1TA 3KK1A 1FT8A 2HFVA 4DLGA 1J27A 2V9KA 4KH1B 3CCRS 2HNDA 1WDDA 2G2ZA 2HFOA 4BWJA 3R2CJ 3DMJA 1OIAA 1OMSA 1UVKA 4ECWA 2GV1A 3D54A 2HW3A 1P6TA 3H5YA 4CO5A 5C25B 1JLEA 2M70A 3AD9C 2QIFA 2Z2ZA 5E2QA 3QIPB 1RTHB 2X1FA 4RNOA 1TVRB 1MMLA 2VPZB 4NLOA 2UXCF 4JI0J 1WEZA 1R31A 5H9EK 4C3KA 1RT7A 2ZH2A 2F7VA 4UT4A 4EFAC 2X1GA 4OYWA 3CDUA 1K8AT 2G4BA 2DNGA 1T9YA 2HQ3A 4TY8A 5C5JA 2O1PA 2AJ1A 4ED6A 3GSIA 1RISA 1ZA2B 2E9TA 1RA6A 3ZZYA 5KAKA 5HP1B 2E1MC 1SJRA 1OYEA 2CVEA 1M90T 1RABB 2LQJA 4HVZA 1NKEA 3ONQA 2C2MB 3MZIA 5KFHA 1WD6A 4LF6F 2ZBPA 4X84A 4DSFA 5L1LA 2G0JA 3I0RB 5ETSA 2DCUB 2VPWB 2AGOA 4HACB 4RBTA 2D3O1 1QAIA 2LQ8A 3S7RA 3CMES 2KM8B 4L75A 4OV1A 5D0RA 2PI5A 4I2PA 2M4MA 1U4BA 1LWFA 4Y2IA 5AE3A 3NMRA 3MMCB 1JLBA 3SCIE 4TKTA 5B0FA 3THPA 1PYTA 1IBKF 3J7Z5 4C11B 5H1SV 1ZTWA 1GMWA 1U1PA 1D3WA 1RHUB 2VFRA 3I4PA 4TQRA 3NS6A 4J9SA 4RUCA 1RWNB 2CG8A 4M94A 2BJ9A 3UR3C 1SQGA 3KLFA 3CJRA 3IG1B 3X1LB 1C1CA 3CJ4A 4CH7A 4CH0S 3G8QA 4I2QB 3PVXA 2RU9A 2WTFA 2V4JA 3CJTA 3PJWA 2OTLS 3PO5A 3MXHP 1TKZA 3J80Y 2X3GA 2IA0A 2BW7A 2N7CA 4J9UE 5L1KA 2DRBA 1YRXA 4UZBA 5CYMA 4UUWA 2LQ9A 4LF7F 1HBNB 1SBRA 3J7ZT 4DFMA 4LSNB 3ILIA 1QSYA 1E6YB 4DL4A 2J6TA 3F56A 1QSSA 3BGLA 4EUVA 3M8RA 1U09A 3EXCX 1U1QA 2NZCA 1VRUA 2DKOB 3LP1B 4F50A 4ETXA 2ZH6A 1KTVA 2PSZA 1H2VZ 4DV7F 1YG0A 2NUUG 2ZJPQ 1CEZA 4JI3J 4P74A 3EZOA 3M8WA 4KV8A 2WHOA 4JV1A 1GX5A 3PACA 4F26A 2M8DB 1K44A 1DLOA 2PFFB 3MEEB 4I7FB 3GJQB 2LA6A 1SQFA 1TZ0A 3RBXA 4ZIVA 1M0SA 2V8GA 1NH8A 3VGSA 2OFHX 1CJVA 1MWZA 3R7BB 3R1LA 5LSRA 3ISNC 3PY8A 2IC3B 3KNAA 2OEKA 1WHVA 2LXUA 4MKYA 2AJ2A 1KN6A 4DU8A 1QE1A 2AX1A 3K5NA 1KS2A 4KO0A 1YTYA 3E2EA 2N82B 4Y3CA 3D4JA 4Q43A 2QE5A 4F3MA 3PEHA 3BYPA 3TOQA 2Y8YA 4LF8F 4KFBB 1J5EF 1VR6A 1T05A 2YPZA 2ZNYA 1UJ4A 3AJ2A 5DGAA 2XY7A 1EIYB 2GIQA 4LFAJ 1FRIA 2B51A 2IDEA 4K0KF 2LKZA 3IC1A 3HP6A 2HGMA 3DRPB 3BDEA 2LA4A 5E3CA 2AGQA 2POKA 3KYLA 2IAJA 4PQUB 1VK8A 3CDAA 2JX2A 5A0YA 3VZHA 5A8RA 2QYGA 3WIUA 1OQ6A 3C3LA 3OUYB 1N33J 2RDDA 1Y5LB 1IKVA 2H5EA 3TP2A 2XWYA 1S5ZA 5L1JA 2Q6BA 1KFDA 5KFRA 4U7UD 1K73T 1KLMB 2HRTA 2DH9A 2ZH7A 2LU1A 4MT1A 4K5SA 4U96A 9RUBA 4D3HA 3VAGA 4IFYB 1U1KA 1QUPA 3BKTA 1TTHB 2X1AA 3M05A 2QA4S 4CIOA 2VKRA 2HFUA 2LU2A 5DLFA 4DQRA 2V8HA 4PYAA 1WKJA 2KVQE 4ZVUB 1U48A 2V5HG 5DETA 5FLXU 3THTA 4DV6J 4DR6F 4I4BA 4C8NA 4ITSA 3OXGA 4TU8A 1VQSA 4TU7A 5FJ4A 1NSQA 3BBFA 3SDEB 5RUBA 2HHHF 2E7XA 4F4XA 2FVCA 4OYPA 4YB7A 1TK0A 4QIWD 3MCNA 3EGZA 2C22A 1NH7A 3VV2B 3CCLS 4ZDNA 4ERDA 3HHLB 1FE0A 1JB0C 1HPZB 4LF1A 5CD4H 3VTIA 2OLWA 4O0IA 2XS7A 4YQWA 1JWWA 4OIXA 1Q82T 5HSPA 1PBUA 1CJTA 2JVOA 3PW2A 2R2UA 3CMAS 4B3RJ 1GT8A 1T02A 2DISA 5K14B 4CRJA 1U1OA 1HNVB 2GMHA 1R3NA 3ETOA 2UUCJ 1YJVA 2BJ1A 4DL2A 2XO7A 2LYVA 2VA2A 3UPFA 4ZVTB 1WKKA 3OL6A 2V68A 3CDEA 5K8MA 1NB2A 3QPIA 3KHLA 4DF8A 3VAFA 1LW2B 3DFEA 1AUSL 2HVHA 1M1HA 3DYAA 2NXEA 3BBCA 1H2UX 2D69A 2YXLA 1DAXA 1XJWB 2ZZTA 1VBYA 2VFTA 2VHGA 4M5JA 2HWIA 5IT4A 1CBKA 1QAYA 1VLYA 2HMIB 2IIHA 3N6LA 4X64J 1VIXA 3H7HB 3OTEA 2CQDA 4QJVA 4QW9A 3MAAA 5DG8A 4M8LA 2UXBF 3M2RA 4C8YA 1RT2B 3W63A 2CG4A 2AZ1A 2C2DA 3MEGB 5HN0A 1S1TA 3PX4A 4J9VA 1X9SA 4OYAA 4ZPCA 3KLEB 2YKNB 1X0PA 3R7NB 3CE8A 2AGPA 3P8BB 1YLXA 3TI0A 2YX1A 2ZNZA 3HHLD 2QFJA 1HWLA 3PZPA 1HQUA 2M8HA 3CJ5A 1JMTA 4WZMA 3AD7C 3CULA 2QYCA 3QAEA 2D3ZA 4AT1B 3DDIA 3NNAA 2CQCA 2RSQA 3JQKA 3PV8A 3FCVA 4OX7A 1PC5A 2B9WA 3TRGA 2JSXA 5ETTA 1GTHA 4X4RA 3CJKA 3S1TA 1JJHA 1U1LA 2CQBA 2CNOB 3M32A 4NMXA 1NK9A 4TNOA 1IKXB 2GO9A 2MGZB 2DR8A 5K5MA 4B9NA 1FWPA 1PAUB 1SVDA 1Q5VA 1IR0A 2HNDB 3QRRA 3G8SA 2R4FA 2MHEA 1FVSA 1RAOA 3D67A 3IMQJ 1U24A 4WKYA 2D3OR 2HHXA 2BOPA 4X65J 4N41A 3QT6A 5KFUA 1LEOA 5BXIA 3W60A 3SSQA 2VDHA 2XI2A 2MHNA 1WSRA 1SKWA 3A8KA 3FMBA 3R5JB 1LW0A 4HYKA 5GADI 3BV8A 5A8WB 3I9ZA 4RW7A 1X7VA 3U02A 2ZE2A 1RT7B 2BRKA 2DH8A 3AT1B 3JTOA 1CJKA 2GHWA 5HLFA 2VASA 2BKNA 3DXBA 4OJHA 2BE9B 4ZLPA 3PW4A 2IM2A 5EDWA 4HTJA 3VGVA 2J7KA 2OPRB 4LR8A 4ZA1A 1C0TA 4USUA 2IJNA 2PN6A 2DCLA 4OFZA 4K5RA 2R7VA 5IFMA 2FJBB 5BR8J 3OSPA 3DXSX 2MKHA 4C8KA 3ILOA 1VBXA 1HHSA 3LWLA 2CJYB 2QO3A 5CZXA 3SIPB 4P6QA 4DL5A 3Q22A 2AQ4A 1JLQA 2KFZA 4DCPB 4DX6A 3N6MA 2OI2A 1HQEA 4P52A 2GNKA 1F9HA 1LWFB 3DRRB 1RAFB 3BPSP 3MUTP 4GKJF 5B09A 4FKXA 2ZHAA 5H9EJ 1Y3JA 4OX6A 3W62A 3ZZPA 2E1PA 5F3TA 1NUEA 1F2GA 2XS5A 1UFWA 2XLIA 1FI4A 3HSDA 3I82A 3ILJA 1KD1T 1G6BA 1LV5A 1UEVA 2VBWA 3P3DA 5KOXA 2OPSB 3PW5A 2QRRA 3OVBA 4ZHRA 3SQGA 3VR1A 2FJVA 1UJ5A 2KJVA 1FFWB 4B17A 1KQKA 5CCLA 5F9NA 4ECYA 4RU9A 3O6QA 2I1RA 4OYZA 4E0DA 5KFYA 2UP1A 2AYGA 4ED0A 1VQ7S 2NXUA 2ZJRQ 1G4CA 3F0NA 2J0WA 1TKZB 5HANA 5D4PA 2G1HA 2MQ8A 2IYIA 1YIJS 2MYFA 4R25A 4YS2A 1S49A 2YNHB 5L9XA 4TLQA 2MKYA 3LF0A 2LXIA 1NK7A 3VGTA 1V3SA 2CJQA 1N6QB 5B0DA 1CQMA 1OY9A 3MCMA 3MPDA 2X3DA 4DDFA 4ED3A 2D9OA 4NZ6A 1VRUB 2DYAA 1MNEA 1U2CA 4OV6A 2R42A 2JOQA 2H9ZA 1KRPA 3QQCD 3SCLE 5LXRA 4DV1J 1PO6A 1RT4B 4OJ3A 4KV8B 4IR1A 3C6TB 4C0OC 4CT8A 2P9EA 5JUMA 4WYWA 1TUVA 2FJEB 4WFBQ 1FKPA 2R7SA 2WVBA 2F9DA 3H25A 2FLPA 2NPIA 3NCPA 3VALA 1FXLA 5L9NA 3TZXA 5ADZA 4CNYA 1QE1B 4MH8A 2ZHOA 2GJIA 4KHPJ 4G3IA 1YJ9S 5G0RB 3T6JA 3B4MA 3T5HA 1X9WA 1UVLA 1GMWD 3HF5A 2C3UA 3KJVA 4IQMA 2HBZB 1H72C 4DEZA 1NDKA 3RRGA 3MR7A 4FS2A 3G96A 4DS4A 1SKRA 2PEBA 3M30B 4FXDA 3CW2C 3VQTA 3V4IA 5L39A 3FSIA 2UXCJ 4OZLA 4LF5F 3JSRA 1FKAF 2QSFA 2CQHA 2ZM6F 3TA1A 2DR7A 2DD8S 1P1LA 4RLEA 4MJKA 4LIRA 3RB6A 3BDPA 2Y8WA 1G2EA 2NUHA 1CS4B 3H2UB 4ILRA 4PWUA 2RILA 4MTPA 2ZDPA 2F3JA 3V6KA 1MN7A 3IP0A 4P2XA 4DL3A 4OQJA 4DR3F 3N5BA 5M2RA 3D9BA 1VQMS 1R8HA 3FZ2A 7FD1A 3BGUA 1SIWB 2CZVC 2ADCA 2FLOA 4RW8B 3NCRA 2ERRA 2PI4A 2DGOA 4IKAA 4JI8F 2AZ3A 1N32J 3SEOA 2OELA 4XAKA 5D15A 1K0VA 3CPWR 2VJVA 3I87A 1XIQA 2ZVIA 4DV5F 1Y9OA 4GC6A 3MM7A 4WE1A 2OKQA 2IVMA 1D8ZA 5J2QA 1NK8A 2FHOB 1C0UA 4P10A 5MLCV 1KHVA 1IBKJ 4Y2CA 2FZGB 3IGNA 1RWOB 3RYLA 1N52B 4ZCLA 5F8NA 1S6QB 2IPOB 1NJYA 5LJ3Y 3AA8A 3NGRA 3B4DA 5KT7A 1F3VA 3TAMA 4A8KA 1PILA 3K8WA 4X4PA 3G4SS 3MPYA 1X5TA 2LLZA 1JLFA 2H5IB 1M5VC 4PG6A 2L48A 1WC0A 1CJTB 4HH1A 4C98A 3DLJA 3W8GA 3K57A 1UWAA 2QA4G 1L3UA 1TL5A 3TEHB 5I3PA 4KHMA 4RX6A 2DO4A 1QD1A 2I9SA 2HS3A 2BZ2A 4TN2A 1MSWD 3BZQA 1FJGF 3M2UB 1WKLA 4YDXA 1MWQA 1NKBA 1M1GA 2IVFB 5M2UA 3KK3B 1AXQA 3QFHA 4PABA 4ZP8A 4DSIA 2MLZA 3K58A 2R7UA 2LEAA 3ZTQA 3OFEA 2WONA 1SCJB 2FC9A 5JMNA 2CJAA 3JSMB 1VQ8S 1NJWA 1XK8A 3GB0A 5F8MA 3TANA 4CP5A 2BUNA 2YKOA 4DV7J 4NA1A 4O4GB 1Z2ZA 2XWXA 1HLWA 4F7VA 1H74A 2QZ8A 2RQMA 4Y0FA 2AEMA 1K1QA 2YX4A 4I69A 4DPTA 3M9NB 1XR5A 2FUG9 4IDKB 4QIVA 2IM3A 1WTFA 2VQEF 3FUYA 3NBPA 4JYAF 4ZN3A 3BR9A 3POTB 5H9FK 1X0FA 2VQFF 4DS5A 2RF2A 4DR1F 1XN9A 3ZTOA 2NPFA 2W9BA 3CWJA 2M7SA 4P9SA 1VIOA 2Y1LB 3U1LA 1HQUB 1RT3A 4LF8J 2XBPA 3Q8SB 1UVNA 2MSSA 4DL0C 2F5GA 2M9KA 1R6VA 3PYFA 5B7WA 4HHUA 4B3TF 1U8SA 4K0KJ 1B0VA 3FKBA 3TUJC 3V81A 1QM9A 1SPBP 5IXUA 4QCLA 1NPKA 4PWDB 3ILLA 3US5A 3TX0A 2W2QP 3CO9A 3ITHB 1RXOB 4ICLA 1IKWB 3H90A 2VJUA 3M32B 4FF4A 2UU9F 1IKYB 2CZ4A 2W4PA 4EYHB 2LEBA 3H59A 2N3OA 5D6GA 3VHQA 3BPDA 3D66A 3G8TA 4NXNF 3UQSA 2BJ3A 4F3QA 3M1VB 2JL9A 1FERA 5I3UB 1N0UA 3PR5B 5D3GA 2CFXA 1CQNA 4KGKA 1S79A 4PPDA 2XHWA 2K2PA 1K47A 3EXYA 1NJZA 1UMJA 4QU7A 1H7WA 2VL1A 1HL6A 3TEGA 1IXKA 4HHHA 4CTAA 4J9RA 4K4XA 1SL1A 4DR6J 1B0TA 1JJ2R 2HNYB 3DI6A 4ID5A 1X4EA 1JLGB 1WI6A 3CEDA 1ZZFA 5HLFB 3ENAA 3NAIA 3OD2A 1DTQA 2ZC4A 3OR2B 1B7YB 2MSTA 2HHHJ 3OL8A 3CDBA 2GCFA 2IRUA 1PIEA 2ZWPA 1BGXT 5KT4A 1C0TB 2IY5B 2XZWA 3D6TB 3TA0A 4IO1A 2YQ3A 2I2YA 2NLWA 1N5YA 4FPIA 2MKJA 3GG0A 3TJ8A 1J5OA 1BQNB 1H38A 4EBEA 3AHPA 2ATLA 2V67A 2RT3A 1B0PA 4FF1A 1FJCA 2FJXA 4DL7A 1UA1A 4OZ2A 4DV2F 2PT0A 5IS2A 2DITA 4QWDA 3KLVA 4ZLJA 2B3TB 3ZZUA 1F5AA 4M63A 1XR6A 4ZLLA 4QPXA 1FXRA 1QDUB 3E8OA 2HQDA 2GMJA 4Q2LA 3VVTA 2YNGA 1TL4A 1AUDA 4MK9A 4NLRA 3IRWP 2O01C 2VFUA 5C42A 1U26A 3W9JA 1CC7A 1F2HA 5IV3A 3W2VA 3QT8A 4RW9A 5EX3A 5J2MA 1RA7A 1U0SA 2E5JA 1X4HA 3SQGB 3FQLA 4ZPDA 2PIIA 2QLJB 4NE9C 2GAHC 2DGWA 4YEAA 2YY3A 5F8GA 4DFPA 2EBGA 2XO6A 2E1CA 1KVIA 3MM6A 2M2BA 3BKFA 3I5AA 1HYSB 1GTEA 4QR2A 1R8PA 5IQQA 1Y5IB 3EICA 4QBUA 1SH3A 5DDPC 4CLFA 4W98A 4FS1A 2P9CA 3D0IE 1S1VB 2UXBJ 3EPIA 3NXZA 5IWAJ 4ED7A 2QSWA 1U6BA 5KFZA 1FD2A 2ZZMA 5KFEA 2YWWA 3VWSA 3H2LA 3QRQA 1V9OA 4K2XA 1XMOF 2GC8A 4X4TA 4NCAA 3ZZOA 2HQFA 2HLTA 1TL1A 1TQLA 1XMBA 3D7SB 1U47A 3DOLB 1E6VB 3TZZA 2HHPA 1NBEB 3IR7B 4CLLA 4CLUA 4CCHA 3KJQB 1OY6A 5LOQA 4WYLA 2CA9A 3CCSS 3UN5A 2FGCA 4H4MA 4GVBB 5KG3A 4NYPA 1S1UA 3CJ3A 1S12A 2ZH8A 1QTNB 1VS3A 4A8FA 1YBAA 1FKPB 3RW6A 1AT1B 1HI8A 5HQLA 2HK3A 3QSIA 4KAIA 3NS7B 2C3PA 1FEEA 5KFMA 2QT7A 3IAS9 1X4GA 2CADA 4ELTA 5FDLA 5CH7B 1KHWA 4FXVA 1H6KX 5IC6B 4LSLB 4BDPA 1K0TA 4EK2A 3I55S 4A8QA 3A8IA 3DDNA 3SSSA 2RQKA 4NLYA 3CD5A 5E5NA 4RWWA 2MXYA 4F4AA 1TKTA 3OHBA 3G87A 3GIRA 5BYQA 1IBMF 1RTIB 4FBUA 2B8PA 1NDCA 3GR0A 1IBCB 3EUNA 1TKXA 1T9UA 2I8EA 2HHSA 5DZ7A 1UKUA 3DRSB 5ETLA 1P27B 2DGSA 3E01A 2DPJA 1FFGB 2CIMA 4B9VA 1GX6A 3K5MA 4AFFA 1RTJA 3KKFA 2EBEA 2CJKA 4JV5F 3BQ0A 4JP8A 2VUGA 4MAKA 2ZHBA 3NWGA 3B8HA 1Y0HA 3NOGA 3AB4B 3EWGA 1FA0A 4B3SF 3KDOA 3LP0B 5IC4B 1RU2A 4NMLA 1V3ZA 4B3OB 1FTCA 2HHUA 1S6PB 4DCOB 3IWNC 3O44A 1X5PA 4YMEA 5KG0A 3CTRA 4YB1P 1M5OC 3JSBA 2CAJA 3HJFA 3OVAA 2B9YA 2QL9B 2BE2A 3HVAA 1TMMA 3T9NA 1F9FA 4KIAA 1YHQS 3AFGA 1VQOS 4DR7J 3SYZA 1WOSA 3DM2A 5AE1A 3V6DB 1FK9B 2DRAA 3LGNA 2J0QD 4DMZA 3VAIA 3M2VA 3P45B 1WOPA 1LWCA 1WI8A 1WUUA 2Q3PA 4WE1B 2LDYA 5J2QB 4ILLA 2C2KB 1VGYA 4OYMA 2W4CA 1FKOA 4Q0BA 2QN6B 3P5BP 4AXIA 2R7QA 2HIYA 2RMLA 5L46A 3ZTPA 1RQ0A 2QLWA 3IFEA 2E5LJ 5EUHA 4K59A 1KDNA 1ELOA 1HNIB 4MYUA 3G6XA 3D6FB 4KKOA 1PCAA 4ZP7A 3NGSA 4NEZA 2OEMA 2QA1A 1RWPB 3HVWA 3EVWA 4IH5A 3D28A 3IAM9 3DU6A 1MU2A 3D1OA 4P2MA 5HMZA 2XMTA 1JJCB 1HBOA 3R5AA 2KVIA 3DCAA 2J7UA 3CCMS 2R8IA 1OSCA 4FPRA 3VQSA 4RL1A 3KHHA 4RW4A 2ZH3A 1QY7A 2JLEA 2WONB 2Z58B 1REGX 2XC9A 4NA2A 2B56A 3QO9A 1KWMA 1SIZA 3N6NA 2BM1A 4ECZA 5IOLA 2RAQA 5I3QA 3TAQA 2MQPA 1OYDA 4JB8B 5HAOA 4KBIA 1HNZF 2GVZA 1FJEB 1A0OB 3FRZA 4USTA 4OI6A 3BF4A 5CQGA 3PYEA 3MD1A 3HSGA 2XI3A 1DZ5A 2J76E 1HBUA 2YBVA 1XQIA 3GJTB 2HZVA 1U2RA 2BJEA 2K1RA 2NXJA 2Z30B 2EK1A 4F4WA 3Q8YA 4IO9Q 5EGYA 3GJSB 2KFNA 4YR0A 2XYPB 1M5KC 4H4OA 3W5XA 4DOZA 2W9BB 2XG8A 1NU4A 3AB2B 2BMBA 2P8IA 4CWBA 3DLGB 1X4CA 3UW1A 1BHNA 3CCWA 2B9EA 4WTOB 4YR2A 4RUAA 2Z8QA 1NSAA 1SKSA 1S0OA 5E3AA 2W8LA 1T0TV 1JX4A 3TVYA 1Q95G 1HWJA 3FZBA 4ELUA 2E9RX 5JJBA 3LPYA 4J7CA 1TL3B 3UCZP 5T7LA 1LNQA 3J7AN 1PJ6A 2DNKA 2E5HA 2V94A 1Q5YA 1W2BR 4WFZA 1GH8A 1C2PA 2WOMA 5LSOA 1RCOB 2VF3A 2LMIA 2ACYA 2KYZA 3CCQS 1KLNA 3PX6A 2G0IA 4RWXA 2PMWA 1FWKA 4C9DA 1W2IA 1URRA 3A3PB 1OWXA 4RKUC 3OJUA 4USIA 2COLA 1FDDA 4Y00A 5D3GB 4C6AA 2V8VA 3C19A 4ZCIA 4F3OA 1RWWB 1FRMA 3M8QB 1R43A 3IWXA 2D9PA 4I1TA 2BJ7A 1HD1A 2R7RA 4A8YA 1ZOTA 5D4NA 3ZZRA 4K4TA 2QMWA 3DDKA 2KO1A 4NZ0A 2UUCF 1NB7A 4G1QA 3MM5A 1JXVA 2L41A 3IR5B 4EU0A 4JI8J 2UVRA 3JTPA 1V6HA 1UAWA 4MIBA 3JTNA 1N8RT 1JLAB 2P6TA 4X4UA 4DV5J 3PO4A 1EKSA 3DLBA 3HHKA 3ZZ0A 1BY9A 4M5GA 4ZJQA 3O3LA 3I0SA 2ZBIA 4QWAA 1FJ7A 2CPXA 5KFSA 2CQPA 1D0EA 2XCAA 5E33A 1BQXA 1SUQA 2H48B 4X64F 3HHLC 4OX8A 2RHSB 2MDAA 3UCUP 1RTDB 3CMQA 1ZM3A 4AL5A 1FTRA 2BV3A 5DQIA 3CJ8A 1UWBA 2P2CB 4HTIA 4IH7A 2YKAA 4DR2F 4M5DA 4QWEA 4WU3A 1SV5A 3KLIA 3HT3A 2BXJA 3NMAA 1P9YA 2CQ4A 1W7WA 4FVCA 2C2RA 3J80U 2BJDA 4H54A 2R7TA 2YNGB 4A8MP 3BSAA 2ZOMA 2MB0B 4UY85 1WC3A 3R7SB 4USHA 4LBIA 4URGA 4V19J 4HT5A 1TK5A 3C15A 1TUGB 3R3TA 3DLEA 2HFZA 2HURA 5IM0B 3HMJG 3EVMA 1YRUA 2GGPB 2CQ0A 2L9DA 4U67Q 5FD1A 4K2JA 3T9ZA 4G1PA 2UZAA 3TYTA 3I31A 2DGXA 2G0CA 3UDEA 1Z2LA 3HHEA 2J8SA 4CM2A 1O6XA 3D0HE 4B9MA 2AD9A 3U1NA 3G82A 3I5CA 1GMUA 4ZKAA 2UUAJ 2EKNA 2HS0A 2I5JB 3UCGA 3ZZZA 5KG1A 2HHTA 2WB1D 1U6ZA 3W64A 2GVDB 3A4TA 2BANB 2OIHA 2YNIA 4DI6A 1LQ9A 1CLFA 3D1HA 1NMEB 4UY8T 3HLUA 5HJXA 4JYAJ 4X65F 3AH6A 1FX2A 4OZJA 5FIIA 2CPEA 3BGRA 2VQFJ 1TL7B 2LQ5A 2KG1A 4DR1J 1WC1A 3DLKB 4HHJA 4HDHA 5KG5A 1U2FA 3LANA 2MZRA 4ZK7M 1LXJA 5CYQA 2HPUA 1RKIA 3PYGA 4NCGA 2OPPB 3KLGA 4H4MB 2M0GB 3IM8A 4TY9A 3BR8A 4M5IA 1U49A 3LQVA 4L6V3 2BQRA 4B3TJ 5E3PA 5KFJA 1S1UB 5HBMB 4DUYJ 1NPPA 2DGUA 1VQ5S 1X4DA 4NPOA 2Z2LA 2UUBF 2V2KA 2UU9J 2HNZA 4DPUA 4U95A 4M5HA 2FVSA 1V3RA 1SQEA 1ZM4A 4NXNJ 1Q0NA 5D77A 3GFXA 4K4YA 3C16A 2AJFE 2L08A 3HI9A 2YVSA 1WACA 4WZQA 1LWEA 1YJUA 1TKTB 4FYDA 2YKMA 1R7IA 4WXWA 2BKOA 2Y1RI 3DOMA 2ASDA 2HFSA 4BBYA 4L3NA 2EXUA 1VJWA 2BR0A 1AA1B 2V8PA 1TKXB 4P73A 3MM8B 1S4EA 2I0XA 4UOHA 1D09B 4NLPA 4CYUB 3MDFA 2H5JB 2FIUA 4ZVPB 5GAEU 4GRSA 4A46A 4J91A 3E01B 4X4OA 4C2MA 1JNZB 3RG6A 1Q4RA 1VRQC 1HBMB 2VBYA 1RTJB 1CPZA 4ANCA 4URSA 4J9NA 2FC8A 1KONA 3FNNA 2KXFA 1YZ7A 3J7A1 3FDSA 1I94F 2NS1B 5J2NB 2CPDA 2Y0BB 4LRFA 4CLSA 1UTAA 3LGMA 1IR1A 3AOCA 1SC1B 3QFWA 3EJMA 2E5IA 2J9DA 2RKIB 3LP2B 3RW7A 5M2PA 5KOWA 2KZMA 5L8RC 4KRWA 5C24B 3TNVA 1Q8BA 1EHWA 2XEXA 1H0HB 3H20A 3H8YA 3OTOF 1M5HA 5F8IA 3LUYA 3OQ2A 2BW2A 1GQEA 2VA3A 1VRTA 3KMSA 4DV2J 2Q66A 1HA1A 5AE2A 2W9CB 1QVGR 1LWCB 2YWHA 5KFLA 4ELVA 2UVVA 4Q0BB 4ZVGA 3MWBA 4L3KA 3TUPA 4WK3A 2OP5A 1PG5B 3Q24A 4DN9A 1AW0A 4DV1F 3CGIA 4ZPBA 4MFBA 2XYGB 2CDQA 2BQ3A 4ZVHA 1WHWA 2DVIA 2PEHA 5E7OB 2XSJA 1LFPA 3UE2A 1NNDA 3C2PA 3MTJA 2OSRA 1P9QC 3FSYA 4ZPAA 2OD6A 4CO3A 3W65A 4B9TA 4X4NA 4DUZF 2DBBA 2AHOB 4WF9Q 4KHPF 4AL7A 4C97A 2HIQA 3RB3A 1RTZA 4N8OA 4HH0A 2EC0A 3MR3A 2PDAA 2DXEA 3EZ5A 4MMOA 3JS9A 2XZTB 1Y11A 3L9ZA 1YZ6A 3K2YA 1XMOJ 2W25A 3M8PB 2YQ0A 2IRXA 2VFVA 4IFVB 3TO8A 3BQ1A 1S7HA 4O3NA 2AJQA 3CCTA 3V5RA 2BACA 1RSCA 3QT7A 3W5YA 3H0PA 5EWGA 1RHJB 4A8WA 4I6WA 2FHJA 3BYRA 4C0BA 4DG1B 2EK6A 4P2FA 3QLHA 2MQMA 1T3NA 3J7YU 3P49B 4KTQA 4PUOA 5KFFA 1JXEA 1U1RA 5D78A 4UQTA 3MFIA 2B6AA 1CJUB 1IUJA 4OLPA 3OFFA 1U0HA 3O5TB 4QPTA 1F3FA 4ED1A 3HHNB 3QYYA 4ES2A 1D9DA 3QMQA 5EWEA 3MGJA 2D1CA 3GPAA 3PHTA 1SJ3P 2PE8A 2HWHA 2CRLA 2NZ4A 4DPXA 3V6JA 3CIMA 1ZAVA 2DGVA 2B4VA 1Q78A 2RUGA 3QWPA 1TR0A 1IBMJ 2A6MA 3L3CA 1NCLA 1N32F 5J1EA 1SJ1A 4I6YA 3RJMB 2NXNA 3UD5A 3KLHA 1BD6A 2C3OA 2HWTA 3HFZB 3DC2A 4UW2A 4OI1A 5DRKA 4FNIA 1JIHA 2GJFA 4EGLA 4ZP6A 3C14B 4NA3A 2LEPA 3VAMA 4JV5J 5KFOA 2O3DA 1GXLA 1VLOA 3IA0A 3QZ7A 1YBUA 3UVJA 4DZ6A 2WVEA 2NR0A 5DGBA 4B3SJ 3G6VA 4MYTA 2ZUAA 1NKCA 4OX9J 1YJTA 2QJ3A 3AXMA 2EG2A 1BWVA 2JC1A 2OFGX 1IM4A 4RW6A 4BCAA 3MM5B 1RJJA 5DZ6A 2MLXA 3U1MA 3TAPA 4C7QA 3MURP 4IG3A 2GQQA 4PWWA 4RZRA 3H98A 2Z2YB 4X66F 3OW2R 1BUXA 2MJUA 2IJFA 1BQMA 1PBAA 5HMWA 1SJQA 3IS9B 3BBBA 2OMOA 1RWVB 1MROA 2VH7A 3PEJA 2W01A 3AOAA 5L38A 3V2UC 3FVYA 4K8RA 2XHCA 4RNFA 2IYGA 5I42A 3CIZA 2CXEA 1C1BA 4NLVA 3I5BA 4PPZA 4QIFA 1TUWA 1HNWJ 4XIUA 5EHHA 4HR2A 2PC6A 3Q8QB 1Q86T 4K4UA 1UWBB 5K8NA 2C3MA 1RUSA 5KFVA 1S9EA 2A10A 3N01A 1I5OB 1SV5B 3KLIB 1EETA 2AF6A 2VG6A 5AXMA 3LAKA 3JYTA 1HD0A 2AU0A 4BS2A 2VC0A 1HMVA 3GV7B 3UWTA 2QA2A 3DOKA 4IG0A 3Q8PB 1UL3A 1ZM9A 4JI7F 1YVFA 2QL7B 5A8KA 5GMDA 5D0GA 4ECSA 4O3OA 4DN0A 2MY7A 3TARA 1HI1A 4LVOP 2CWKA 3GFYA 4ZMMA 4Y65A 3RB4A 3FMWA 4OYOA 1TV6A 3C15B 2U1AA 1T9TA 3KWMA 3HK2A 3AA9A 3UFCX 2YNFB 1APSA 3H2VE 1S57A 2JRSA 2BEFA 3FJ2A 1S4FA 3X3UA 1VQ4S 2WBMA 3WC2A 1S0MA 4J37A 3HT0A 4NASA 2EW9A 3S01A 4JI1J 3KMQA 3JB9k 4LRBA 1BXNA 2YWEA 1WSVA 1YJ7A 4I67A 1HNZJ 5C25A 4ZVQB 1T9WA 2RQ4A 3G86A 2XS2A 2DNPA 5KT3A 2B43A 2DHGA 3ZXWA 1RTHA 1TVRA 2E44A 3TWZA 5BYRA 2OAUA 2QMUB 4V1Ak 2VG7A 7AT1B 3ENWA 2CNNB 4OZ3A 2Y3YA 2DNQA 3QJPA 4W92B 2FLNA 3QWUA 3T6BA 2ZBRA 3TQ1A 4IR9A 3HULA 1ZPVA 2BYCA 1XBWA 3CT9A 5HK4A 1FO1A 5BYSA 4USKA 4ZLNA 5CCMA 2EFVA 1T03B 3DNCA 2IM1A 2GJ2A 5HP1A 3C8YA 3FFIB 4M5LA 2H54B 4GO5X 4UZCA 2Z0GA 1N54B 3KG4A 4QIEA 3I0RA 3W8PA 1FF2A 3P96A 2NCKL 2V63A 3P6YC 4HACA 1MMDA 1KC8T 3QJLA 2QEXS 1KOHA 2CNKB 4DSJA 3IM9A 2Y0SD 3R5DA 1DJ0A 3PIOQ 5AXKA 2CPYA 1BE4A 5C2CA 1N5VA 4PRFA 3CJQA 4KR0B 4KGMA 4CDIA 2IJRA 3NS5A 4EZ9A 5T41A 4KJIA 2JHEA 3MMCA 4QWCA 4DXLA 1LWEB 4PG4A 2VBXA 2N3LA 2OO4A 3DOMB 4P71A 3UNYA 2CWXA 1D9AA 2GQCA 5GAHU 4J5OA 3GV8B 4X2BA 1M5SA 1KBRA 4AL6A 4NL5A 1J2VA 3RBEA 1C4CA 4HL9A 3WIVA 1RP5A 4DLEA 3IG1A 1Y00A 2B5JA 2WW8A 2UUTA 2ZZNA 4I2QA 2C28A 3JAMY 3MMAB 1HNXF 4A47A 1WNEA 3GZ7A 3BGFA 5HQ8A 4QR0A 4LFBJ 4Q8EA 1YQHA 2CQ1A 4KPCA 1FNMA 5A2QU 3FCHA 2ZD1B 1VC6A 4RNHA 2W7PA 1VMBA 1YBTA 5B0BA 2E29A 3MEDB 3PKYA 3SMZA 1HBNA 4ZJOA 3C46A 2D74B 3OL7A 2CDRB 4LSNA 3E51A 1E6YA 2XNRA 1GEHA 1FVQA 3AJDA 2DNOA 1HARA 2HFNA 2DR6A 5F0WA 1FDAA 3LP1A 1JKHA 2IMOA 5LM7E 4BWMA 4CQ1A 4FP9A 3Q89A 5IWAF 4DR2J 4ED8A 4DPWA 2EEYA 2AJ4A 2WSFC 3J81j 4O0NA 4YP3A 1JXLA 4NLXA 3OTCA 5A6WA 3MEEA 4I7FA 4P72A 5CAAA 2BQUA 2C42A 3BJYA 4NI2A 2EPIA 4B9SA 4XPEA 4A8SA 1X4AA 4FBTA 2IC3A 4OZ5A 3QJJA 1RAEB 1EP4B 3VZIA 4KSEB 3L95X 2KRBA 1VDHA 4L74A 2GIFA 2DHHA 2P5VA 4WFAQ 2XMUA 3OTBA 1MG7A 2WBRA 3U7JA 4KFBA 4OZ1A 3HX9A 4PXDA 2Z57B 2XZDB 5KT5A 5EN1A 1RT6B 5GAEI 2ZUGA 1S72S 5KFPA 4TYBA 5K9FA 3DRPA 3KK1B 1RAIB 1WHYA 4IRCA 3KFWX 2K7JA 4C3LA 2DIVA 4OZ0A 2ZJQQ 4PQUA 5KFGA 3DMJB 3EX7B 1OS5A 3CB4A 1MWYA 1F6TA 3OXFA 3OUYA 1XMQF 4OL8A 1KTQA 1IQTA 2XSFA 3LGHA 1JLEB 3UI3A 1UP1A 3H5SA 2XMKA 4FYXB 1HHTP 3K89A 1N5SA 1FFSB 1DBDA 3VF0B 2J0SD 3BGOP 1RE1B 4FDFA 3J81Y 2F8MA 1WF0A 2F9JA 4QZVB 4IFYA 2L3MA 4L76A 3EVOA 5KFXA 3GJRB 4EBDA 1IQZA 3MEKA 4HLBA 2DTJA 3ELHA 4NYOA 3SCJE 2D7SA 4OI3A 3IN5A 4FYYB 4TY8B 3O8WA 2B6AB 1FCAA 1ZS6A 3KHRA 1WWHA 4FXWA 1JNRB 2UUBJ 3HZEA 3HZGA 3RUBL 2APOA 5BJRA 5HATA 2ZOFA 4MK7A 3T5KA 2YWFA 2A2DA 1U7LA 2Y1JA 5CXTA 3GFHA 3F44A 4YB6A 1UVJA 1VK3A 3SV4A 4DSEA 3RAMA 3D6HB 1F1BB 3HHLA 5KT2A 4DR7F 2YTCA 4NXMF 4I2PB 2MEWA 2DR9A 4CLPA 1NSPA 1JLBB 2AKWB 2HAIA 4U7UK 3QBCA 2RDIA 2ZH9A 4IOCQ 1PC4A 1I6JA 4C4WA 5KG4A 3AD8C 1ZYQA 3UR0A 1D8YA 1MN9A 4OYBA 2N7YA 2ZOGA 5K14A 2BBEA 5GAGU 1HNVA 4ZVRB 4P7VA 1F5CA 2PD1A 1I94J 1FX4A 4QR1A 3UVJB 2BJ8A 1Z1ZA 1K1SA 2MTLA 9ATCB 2VDIA 2E5LF 3T1YJ 2KXNB 5KFDA 3A8EA 1LWXA 4XK8C 3RGIA 4PCQA 3W9IA 3KLFB 1SI9A 3NNCA 4ILMA 3QATA 1C1CB 1LW2A 1O0PA 1G7CB 1UFLA 2L9WA 4DPYA 2V4JB 1IVZA 3AOBA 4RW6B 4NLQA 3ZZTA 2DY1A 4ALZA 4LRCA 3OTOJ 1HW8A 2XY6A 4Q45A 3J7YI 1IWGA 4O3SA 3DHXA 4IG3B 3MPUB 3CC7S 2JLFA 5CYMB 2HMIA 4TVAB 2V4QA 4KQZA 1ZAXA 3G6YA 4YFUA 3PCOB 2DXFA 3K5LA 3MD3A 1BQMB 4N5SA 1XERA 3RRKA 1YK9A 3PX0A 4FVMA 1IM6A 1MROB 3UDLA 1RT2A 2R9LA 1NAQA 3ZO7A 1X8DA 2JFKA 4JI6J 4CLTA 4LF4F 1PKUA 1WG1A 3MTKA 1XEZA 3IR6B 3H4DA 4CLYA 2VODA 2ACMA 1OQ3A 2YKNA 1C1BB 3MCSA 3K0JA 3FRYA 2AEJA 3NLCA 2JFDA 2PFDA 5DG9A 1DLOB 3BSCA 1V5IB 3C6UA 4DWIA 4YOEA 2EFNA 1F0XA 1PJ7A 1VFJA 2VV5A 2QTWA 4HI1A 1EETB 2CNLB 2VG6B 3JYTB 1WDTA 2EKYA 1CJVB 3GYXB 2JEIA 2DH7A 1SC4B 1S77D 2KH9A 2N4CA 4DUZJ 2PMHA 2J7WA 4KO0B 2LVWA 3TVKA 3K7RA 3N0VA 3NNHA 2I6WA 1PSDA 3NY0A 1Z4UA 1T05B 4OI4A 2W1BA 5DG7A 4C8ZA 4F8RA 1IKXA 2MGZA 2BVZA 1VBKA 3PG9A 3D3BJ 2B9XA 4ZVEA 3QNWB 1WEXA 2XLKA 3OHAA 1MLAA 1BMQB 2HGLA 2IAJB 3UNGC 5A0YB 4DV3F 5A8RB 2E66A 2B7CB 3AAWB 3GMGA 2VPXB 4PXEA 3LTOA 2HQCA 4MKAA 5LMUF 1IKVB 1NXIA 1N36F 2KI2A 2VG7B 2Z56B 5A8WA 2ALZA 3GYNA 2WVCA 4M5KA 1EZZB 2ADBA 3H42A 2ZH5A 2RRNA 3DRYA 2ROPA 3SBMA 4F2SA 5F9LA 1D9FA 3WX4A 4N76A 3FSXA 4KHRA 2OPRA 1TAUA 3FQKA 2QG9B 3KJNB 2E7WA 3Q86A 2V50A 4PG5A 1LXNA 1AROP 1UEUA 3ULHA 3LPEA 3HD2A 1B70B 1ZAWA 3FBBA 3NKYA 3CCUS 3OR1A 2XCPA 4Q8FA 3PDNA 2B7BB 3DRRA 3RZAA 4RUHA 1KQFB 4LBHA 3W7BA 1HHQA 3HVTA 3OFGA 4CH1A 4KB7A 4CLKA 3FC9A 1VQ9S 2JJ4D 4M1KA 3K8VA 1NPRA 5ETOA 1ACMB 2OPSA 2FB0A 4NLWA 4OJGA 4LFCF 4W90B 3OL9A 2AW0A 4K4ZA 4GMKA 4LSZB 3TA2A 4HI2A 2IDLA 2B5JB 1HIYA 5KFTA 2IBKA 1S48A 2FD2A 2EI5A 4X66J 2A6OA 3M8ZA 2FZCB 1SJ4P 4G65A 4Z37A 3DU5A 1Q7LB 3KNGA 3A3NB 3DYAB 3HPOA 2RD5C 2WSEC 2YNHA 3JSYA 2DNNA 3F73A 4MIAA 1N6QA 2R8HA 5ETVA 2CQGA 1RGVA 2VKZG 5DS7A 1RWUA 2MMYA 2PO4A 2FZKB 2ZVSA 2UUAF 1I51B 1JKHB 3MAAB 3JQJA 4KY3A 4DX8H 5D4OA 3CXCR 1X5SA 2YWKA 3M2RB 1LK7A 5CYJA 2IRYA 1DQ8A 3H40A 1NJXA 1RT4A 4J9KA 3EGWB 3Q8UA 1S1TB 2CJBA 2ZH1A 1XNQJ 3C6TA 3HDSA 1NDPA 2F8EX 5KTQA 5ITHA 4JI7J 3MM9A 4M5NA 3GIIA 4LRDA 1FWLA 5K20B 4NLGA 2CQIA 4NI2B 3ZNUA 4G6VB 3PW7A 1I3OB 1S6UA 1TAQA 1UA0A 2D3UA 2CVIA 1T11A 3MHYA 4GO7X 5ETKA 1AZSA 1UFKA 2IM0A 5KG7A 1RK8A 1R6YA 3P4UB 2DHAA 4F04B 2XMAA 5G0RA 3T5JA 2MZQA 4DUYF 5HL7Q 5GAHI 5B08A 2J8AA 4M95A 3CJKB 5KFQA 4ES3A 4DPOA 2KL8A 2F4VF 3AJ1A 4NLUA 2LQBA 4MKBA 4LQ9A 1ZZNA 1N4LA 3V6HA 2SXLA 4J9LA 1M5PC 3GTYX 2DIUA 3ZC4A 2P6SA 2JEJA 3M30A 4X62F 4EWTA 3ET6A 4S0MA 2MZSA 3M6WA 1RB0A 1L3VA 1UEKA 4DR4F 3GIKA 3KJFB 2XQCA 2RHQB 5F0UA 3MOJB 5DM6Q 3N5FA 1NM2A 1M1KT 4NZ7A 4GKKF 1DY3A 3NOCA 2VIHA 5IT9Y 2MZTA 5DQHA 2W2NP 1ZM2A 4DR5J 2E1RA 4PXBA 4WFXA 1S0VA 1FRLA 8AT1B 4IRDA 3ZTSA 1CS4A 1FDNA 1LW0B 4F4ZA 3BO2A 4RW7B 1SC6A 1RZMA 2ZE2B 1MW7A 4MK8A 2ZKUA 5C2GA 1PYSB 1CJKB 4OI0A 2MQLA 5DDRC 4B9UA 3G2XA 2XMVA 5F8LA 2NQPA 3D2WA 1YITS 2JC0A 1N56A 1UW4A 3R6GB 1Y4ZB 4RW8A 1TU0B 1NRKA 4YY3F 2MKIA 1GAOA 3SQOP 1XR7A 4EO8A 3BH6B 3QZ8A 4CLWA 3G6ES 2CPFA 2UVWA 1IWAA 1UPPA 4QQBA 2HRYA 1HI0P 3QGHA 1VYAA 2DNHA 1S76D 1EJ7L 3IGVA 2UVUA 1RLCL 3MUMP 2MJNA 1RI7A 3CD6S 2V2ZA 1JLQB 2WVFA 3K17A 1YDLA 1HQEB 4URQU 2FYXA 2C2EA 1S6QA 4IRKA 3KK2A 2KRRA 5J2PA 3EZUA 2CJXB 4NX9A 4UOCA 4O3PA 2NYHA 2DT9A 7FDRA 1NLKL 3HFKA 1VQYA 2LECA 1H73A 2EFGA 4K4SA 2PA3A 3RBZA 1RKJA 4MKVA 4F0MA 2M5YA 3PM9A 5SUHA 6FD1A 2ZFHA 2AP6A 3UN2A 1WC4A 1HNXJ 4JI5F 1R8BA 2ASYA 4ZITA 1TMJA 4A8XA 4ZHRB 2V2QA 2KFYA 1BLUA 2OGUA 3L09A 5CABA 3BSOA 2MLYA 4P2SA 1XNRF 3M2UA 3MUVP 2CQ2A 4N8NA 3KK3A 2ZBCA 2J5AA 4JI4F 2BOAA 4I64A 2FHMA 1GFWB 2AWZA 3LALA 2F4FA 3IBWA 2XB2D 2G13A 3JSMA 4KE5A 1YKWA 4TLRA 4ECXA 2OMLA 5ETMA 4O4GA 2JNJA 4WP8A 5D4LA 3D68A 3TUIC 2U2FA 2B4UA 2AV5A 1NZAA 3WDOA 2ZEJA 8RUCA 1N34F 2PMZD 3T41A 3GSDA 2RDJA 3ENQA 1R0BG 4IDKA 2XGPA 3MAHA 4YN3B 3HSJA 3EDQB 3POTA 5JXSA 4E8UA 2J9DE 1I1GA 3B6BA 3GIJA 1B3TA 3GE9A 5B0EA 4F4KA 1WF2A 3D6MB 3ZTRA 3C6UB 3CVKA 1U02A 1ULRA 4ID8A 3HKZD 1X60A 2E5GA 4CLZA 3OSNA 2RE1A 3OT9A 2E9ZA 2JDJA 5HVFA 4FZVA 2M52A 1VCTA 2VG5A 3B82A 1V5VA 2UXDJ 3KXDA 1KQGB 2WSCC 4XDCA 5AT1B 3HO1A 4R5PA 1S7IA 4EMDA 4WBFA 4CZCA 4LF9J 3F41A 3PYDA 4QWBA 4PWDA 1R8AA 2DNZA 4NEYA 3ETMA 3ITHA 1IKWA 5GAGI 3AY0A 5GMEA 3TVZA 2RS8A 3KJVB 3R97A 3R5CA 1RBAA 3FCWA 1IKYA 3DGVA 3QT5A 4FN5A 1XMQJ 1GXUA 1SKUB 4BC9A 3M8SA 3T1AA 3WQPA 1QVFR 3M1VA 4IOBA 1FRKA 1NK5A 5ETPA 5I3UA 3V4IB 3RAQA 4IH6A 5AXNA 5HJYA 1T94A 1W25A 4L72B 5IZHA 4QIGA 4C0HA 4USWA 2HHWA 3R1HA 3PXGa 1A7GE 2P9GA 4PG7A 1QAJA 1HWUA 2C2OB 1KR4A 2HNYA 5CHCB 3RU0A 2ZH4A 1JLGA 1H2TZ 1LKZA 1EX8A 4ENOA 4OX9F 3OR2A 4C8OA 3BM7A 3KUEA 3Q2TC 1IN0A 2MKCA 2HYIB 1ZH5A 1GXTA 2BX6A 3KG1A 2W2MP 1RACB 2N4DA 2BRLA 4RNMA 3A3OB 4ZS6A 2YKQA 3BB5A 4ZPVR 2ROEA 3GG1A 4LUBA 3ISZA 1UPMB 4OYXA 4J9PA 5I4MA 3H4BA 3NRBA 1S1XA 3HKWA 2XNQA 4NXMJ 2KM8C 1BQNA 2AIRB 3MM7B 2FY1A 4WWSA 4H4KC 3OR1B 3GLJA 3I6PA 4J9QA 1YJWS 1C0UB 2MQNA 4HEA9 2VC1A 4IOAQ 2BDPA 4Y28C 4ER8A 3I32A 3KOAA 3R5BA 5LMNJ 1JJ4A 3ZFVA 4WFNQ 1VQKS 3B54A 2G2YA 1JLCA 2KDOA 2ZDOA 3HVTB 3GV5B 4CNZA 3TAMB 5A6PA 4WPAA 2ZBQA 4PZVA 1JLFB 4NOHA 2GHPA 1PYOB 1HNWF 1RAJA 4UF4A 2GO8A 4BHQA 2UV8A 3MF5A 4TXSA 3U27A 3W2WA 4LIWA 5KFKA 2HLUA 3NGDA 2RUSA 5KG2A 5AJ3F 5A76A 4R0EA 4B3MF 5AXLA 4YHHF 2XY5A 4RPFA 2CKWA 4DV0J 4A48A 4DZDA 2GHVC 4G1IA 3D3CJ 1UVIA 1HYSA 1SL0A 4P75A 2J9EA 4CM0A 2R2RA 1Q7YT 2KT3A 2G9OA 4IYQA 1FEHA 2DGQA 3SZ2A 1Q1KA 1K9MT 2VPYB 4PG8A 2QLBB 4DSLA 3RB0A 1S1VA 1SXLA 2NXCA 2XMWA 2IBOA 3EGVA 2AMCB 3N9UC 5L1IA 4JI1F 1WORA 1S9GA 4IUFA 4LF4J 1IBLJ 3SFGA 3E3XA 3DGPA 1QUVA 4I68A 2LCWA 1CSJA 3PIPQ 2DB1A 5HROA 4Y34A 2V69A 1FHTA 2MQQA 3BS9A 3DOLA 1E6VA 3Q83A 4XPCA 2AT1B 2HK2A 3NBPB 3M6XA 3CD0A 1ROFA 4Z7CA 2FPHX 2Y1IA 4GVBA 3BEGB 1ITPA 2RF2B 3MM9B 1N5TA 2K3IA 2KU7A 2WAQD 4ZCMA 2FQQB 1A9NB 3VVUA 1VC0A 4OZNA 1FRHA 2ILZA 4KC5A 5ETQA 4U6PA 2W7AA 1RT3B 1U8WA 2FGOA 4NCBA 3K59A 1AZSB 2KN4A 4F0HA 3OBIA 3QGPA 4LSLA 1AB8A 1YWXA 3CO0P 1EQMA 5F8JA 4PKDB 2K3KA 3V81B 4AE5A 2R7XA 5HVHA 3KG0A 4ICLB 3UD3P 4BC7A 5GMKa 4DV3J 5FLXY 4YB5A 1RT5A 1RTIA 4CO1A 2QLFB 4X4VA 3ET6B 3K5PA 5LMUJ 3N79A 3M9OB 3JXOA 2JWNA 1N36J 3AQPA 4RBVA 3O2IA 3GR1A 1EQ0A 2ILYA 3THVA 3TX8A 1OO0B 3DRSA 4AUKA 3WHIA 5H9FJ 5LXYA 1S9FA 5K8OA 2Z4PA 1T8EA 2YPYA 4LBPA 4RNNA 3FK4A 4PEOA 5DLGA 3KUGA 1W26A 4CTAB 3I56S 4F36A 3LP0A 2HVEA 1HR0F 2FJDB 1C4AA 4DV4F 3AQOA 2RQCA 4B3OA 2OTJS 4R0JA 3DI6B 4ID5B 4YUDA 4LF6J 1S6PA 2H4WB 2MPUA 1DTQB 1HW9A 2XLJA 1REVA 1Q8LA 2WCXA 4JI2F 4LFBF 2JLGA 1ZBTA 1GMVA 1OSDA 4DBQA 3UO0A 1U1MA 2V9WA 2DEJA 3V6DA 1FK9A 3IBFB 3Q8RB 3L7UA 3ZNJ1 2W8KA 3NAHA 2B0GA 2LFVA 2KHCA 4XO0A 1N5YB 3WC0A 1J5OB 4P7TA 3DLHA 1LOUA 3NGKA 4C8LA 2YQ1A 2DPIA 2AJ0A 1RYRA 3S8SA 3LO3A 3OV7A 3DKDA 2K06A 5A2QY 2GA7A 5DDOC 2HHQA 2GX8A 4U9RA 3KK2B 1RHRB 2MKKA 5J2PB 1CC8A 2YH0A 1YX2A 3ICLA 4FF2A 5D8HB 4LFCJ 1Q8KA 2HBYB 2GW8A 5KFAA 4PYDA 1SL2A 2GFFA 2VU5A 1HNIA 2ABYA 2W24A 2XMMA 4JV0A 1DRZA 1X5OA 5C42B 4USMA 4Q5VA 4J9MA 3W2VB 4RW9B 1MMNA 5J2MB 1RHKB 2R8GA 1RBOB 4C3MA 2A2CA 1WJ9A 4UQGA 4CI0B 3VAKA 4TYAA 3VGUA 4C48A 2HZCA 3QGIA 2VOPA 4F02A 4AQYF 5DQGA 3A12A 4AYBD 2YX7A 1FRXA 4LF7J 4DUTA 4WU2A 3VAJA 3MM6B 2VICA 4Y6IA 4GC7A 3B78A 3GCWP 2DY9A 4KGZB 1RAHB 1VBZA 2JEFA 2DK2A 1T7PA 4DX7A 3OVSA 1KEKA 4B9LA 2ZKTA 3I96A 2FJWA 1FE4A 1KVKA 1YSJA 3IRXA 1KOOA 2HBQB 3Q0AA 1R27B 3SSRA 4O44A 3FGVA 1NHKL 2OPQA 3T1HF 5LJ5Y 1Q53A 3FEZA 3N28A 1TL1B 3NGUA 1S10A 4I0WA 3HXMA 3MAQA 4AXJA 1T3OA 2RH3A 1UETA 3N4WA 3OPKA 2DNYA 4DJBA 3IO1A 1AFJA 5DO2A 3PR4A 4Y2MA 1ZPWX 3T19A 4Q7AA 2KT5A 3DLGA 3KUHA 3MECA 3SFUA 4R8UA 2ATCB 2VG5B 2VD3A 1RU1A 1J5EJ 3H5XA 3GIMA 2XM3A 5KT6A 4ZVOB 4NWBA 5EWFA 2F4VJ 3HFVA 4R5PB 8ATCB 3M9MB 2KJWA 1TL3A 5LT5A 2Q6CA 1YJRA 5FDLB 3EMTA 2W2PP 3ISND 4HT7A 2WVDA 2R8KA 4FF3A 1A6LA 4X62J 5THWA 3Q8VA 3CF5Q 1R0CB 4B02A 2WK4A 3T5LA 5U47A 4DHVA 4DR4J 1B99A 1T9VA 2OJ3A 1OJ4A 1LK5A 1NEEA 2F40A 4LQ3A 3R27A 3FBFA 4GKKJ 2V4RA 5IT0A 1URNA 2CZ9A 3EPGA 1QAXA 4JUZA 3P5TL 4EZ6A 2HHVA 1VHFA 3M4XA 3M8QA 3SXLA 3KHGA 4TU9A 3LA0A 3CCZA 1WC6A 1H3DA 3WZ0A 2QGFB 2QX0A 4KT0C 1ZA1B 4O3RA 3VAHA 4K7QA 2ASJA 3HHDA 2FY8A 2JZ5A 2HSEB 4YY3J 3T1YF 5G4DA 1O51A 4NLDA 2NREA 2EFPA 2KXHA 1XTZA 1JLAA 3KTQA 3O1LA 2E7VA 3SCKE 2L9NA 4ECVA 2K7KA 4QYRA 2I38A 4DL6A 3GP9A 3GONA 2EWHA 2XGQA 3MI7X 2DO0A 4USVA 3UD4P 2BE2B 3MOZA 2A3JA 4ZPTR 2ZWOA 2BA9A 5MAOA 4X4SA 1CULA 3DM2B 1S1XB 4ECRA 2R8JA 2M3DA 1N5QA 4PAAA 4DF4A 3M2VB 4O4RA 3BKUA 2HQGA 4RUBA 2JEGA 4OJ1A 3IXQA 2DNRA 2EVZA 5E3RA 3EE3A 3Q2SC 1RTDA 3UN3A 2W9AA 3DRXA 4F67A 1U1NA 3JAMU 1GNKA 1FKOB 4M5MA 3I4HX 4KPYA 1FDBA 2HQIA 3R5GA 5T14A 4JI6F 1JLCB 2DNLA 1B4SA 4JI5J 3CDWA 4UTGA 4J90A 3HVRA 1WF1A 3PHEA 3NG8A 1L3TA 2IHR1 2W4DA 2E1AA 2Q79A 1VQNS 2F1FA 1XNRJ 1U25A 3W2WB 2FTRA 3R8YA 4KKOB 5F8HA 3FEYB 2HEKA 4JI4J 4DQSA 5IM0A 4USJC 2GQ2A 4XTTA 1TK8A 5HMYA 2GGPA 1MU2B 2BE7D 1UZHA 3KDNA 2XMJA 4KGXB 1HBOB 1RAAB 2OHDA 2NYIA 2DEIA 3BH7B 1S59A 3GWCA 4TQSA 4RBUA 3BO3A 2QLXA 3FBEA 2HVZA 1G1XA 4F0KA 2DNMA 2WB4A 1RT1A 4RW4B 2HKEA 2I5JA 1YJNS 1N34J 2H3EB 2YWGA 3QRPA 4A4JA 2GVDA 2BANA 3NGTA 2IMWP 4E2FB 2UV8G 1R0AA 3QO9B 1S9GB 1QTMA 5B0GA 4QYZK 3K5OA 2GVZB 1TL7A 3DGPB 4KYZA 3RR8A 3DLKA 4ECTA 5HROB 6AT1B 4NYZA 4ZVFA 3MCOA 3PNIA 1KFSA 2PA8D 2Y9HA 1HBUB 4FNHA 3QGGA 2K1RB 1WELA 2OPPA 4ECQA 2PGCA 4JI0F 4ZN1A 5K8PA 4WFYA 4H4OB 1BC6A 2B4OA 3CCES 5HBMA 3OLAA 5F3ZA 2RRBA 4ED2A 4ETZA 3TJAA 2J9CA 2EFQA 3MR6A 2FVQA 2MZ1A 2LXFA 5JVHQ 3M6UA 2QC3A 5B0CA 3MMJA 3MPVA 5T7LB 1DTTA 4U8VA 2C2NA 3J81U 3IWLA 3M7VA 4RU2A 2VB6A 2WOMB 1XC9A 2AYEA 3SI8A 2RNEA 1RT5B 2K8GA 5HMXA 3IBCB 2BM0A 1NHUA 2DRDA 1RHMB 6FDRA 3MM8A 1O5JA 2KKHA 2V8DA 4CYUA 2MZJA 4DFJA 2FLLA 4LT6A 4WP3A 1KSPA 3NCQA 2R7OA 3RR7A 3BN4A 2FDNA 1HBMA 2C3YA 2HZAA 3BQ2A 3QSYB 2G2OA 5D0HA 5J2NA 1HQ2A 2A18A 4G1QB 1IJFB 1R8CA 4K4WA 1Q8IA 1Y5NB 4QW8A 3C66A 3PJ9A 1WEYA 3G9CA 2RU3A 1S1WA 4L73A 1SC3B 4CO0A 3MR2A 1REVB 2RKIA 3UDCA 3LP2A 2ZITA 3GFZA 2CQ3A 2CJ9A 2HRUA 5C24A 2WRMA 1F60B 1YRTA 2V34A 3MMBA 3EYZA 1IR2A 3NEKA 3I0SB 2HG4A 3W66A 4NRUA 2DXDA 2Q43A 3OFHA 2W9CA 3A13A 1TFYA 4GKJJ 2VONA 1X31C 1SUQB 4EYIB 2MY8A 5GVQA 4XDDA 1PJ5A 2LP4A 2CPHA 3LOUA 3PFOA 1Y10A 4EI2A 3CUNA 1FNOA 4Z7YA 2J6SA 1UW9A 4B08A 1WTBA 4M5DB 4JI3F 3GU0A 4F2RA 2B8QA 5AJ3J 2R2TA 2QL5B 1AYEA 1SH2A 2HBRB 4B3MJ 2CUYA 1XNQF 1EARA 1SJFA 1FNXH 1B64A 4JOUA 3L7OA 2WZ1A 4HKQA 4YHHJ 2Q1LA 4FYVB 4NRTA 1RHQB 3Q23A 4OMFG 3GYGA 5J1PA 4A8OA 5E0OA 1RDRA 2JVRA 4WXOA 2C2ZB 2KZZA 3DLEB 2ASLA 1UJ6A 2IVYA 2W7OA 4ZPWR 4OLOA 1N88A 2HVDA 4DX5A 1Q81T 1UVMA 1F5BA 3SV3A 5ETNA 1Y3KA 1RYSA 3M8PA 1RCXB 4LFAF 4EBCA 4IFVA 2MKSA 2KHDA 4C8MA 3G82B 1U6FA 1HFEL 2FJAB 3L4BC 1OY8A 3OJSA 3QIPA 4DQPA 1P8GA 3NP5A 4K4VA 3W9HA 2YNIB 4WK1A 3IRXB 4PXCA 3TUZC 4O44B 3TZYA 3T3FA 2OPQB 4DG1A 5EX0A 4WTYA 2V0NA 1N33F 4DSKA 2HGNA 1ZTTA 2AYMA 3BGRB 2O66A 1L5UA 4UUXA 4NLSA 2BABA 4RJVA 1N48A 1HWIA 4DR5F 5CYQB 3CCJS 1T95A 1CJUA 2VZ9A 3RBDA 4LJMA 4N47A 1EB0A 4NCGB 5KG6A 3PKMA 3KLGB 2G1DA 4ZIWA 2IFXA 3NWRA 3MECB 4NLTA 4I6AA 4R8UB 5B0AA 2AX0A 4DV6F 4D3GA 1Q16B 5F41A 5E41A 1NSKL 2CPZA 1KQSR 4DCJB 2HNZB 4GVLA 1SH0A 3M6VA 4H4KA 3EGNA 1IJEB 3D0GE 3GQCA 4OHVA 1FESA 4O23A 2RJZA 3C16B 2GAGC 3MPWA 4JV2A 4LF5J 2YKMB 2J0XA 3RRHA 3TZWA 2O5DA 1S97A 5KFWA 1L3SA 1OPZA 2ZM6J 3HD1A 3C14A 4OI2A 2X1BA 3GCXP 3PRDA 4C11A 5SZTA 1X9MA 3HM9A 3FBCA 1VISA 4WIQA 4BLGA 5J1NA 3PRVA 3EDRB 4ZP9A 1HR0J 4DV4J 4LR9A 1DQAA 1KNZA 4DR3J 1JQGA 4YDDB 4B3RF 3S6EA 3LH2S 2GZOA 4N77A 4CT9A 1F9EB 5DJBA 2ZC3A 2XTJP 3WX8A 1U45A 2CPJA 2MQOA 4YR3A 3LWMA 2BKPA 4JI2J 2VFSA 2KT2A 2H4YB 3TW0A 3A8JA 1TELA 1NHVA 1H98A 3CD7A 3JQMA 4E98A 2NSCA 4QU6A 2OSQA 1EAYC 1TKDA 1ICEB 2Z2MA 4KGVB 1DFDA 1GK8A 3OXLA 2RVJA 2H1YA 1PAEX 3IS9A 2GMLA 1X4FA 2F8HA 1WOOA 1VQPS 1CULB 5CZVA 5C7PA 1T9XA 3UDVA 3MR5A 1VRTB 4LREA 1RBLA 3RAXA 2KYXA 4CO2A 3LW5C 2EFOA 4FYWB 4ED4A 4PQAA 1NO8A 4QOTA 1EKRA 3CJ0A 4DQIA 3OTDA 4U7CA 4X4QA 4W4MA 5JVGQ 1KKHA 2GIRA 1JK9B 2RB7A 5KFCA 1FD8A 4MFBB 1PGZA 3PFEA 1RWXB 1OPIA 1FXDA 2F65A 1O8BA 4WIIA 2EG1A 2H65B 1FJGJ 3PRBA 2RIJA 4AQYJ 1QSLA 3PW0A 3FEXB 2M88A 1TFWA 2OD4A 1DQ9A 2XSJB 1VOMA 1X4BA 2A1BA 2CPIA 2UUWA 2YNFA 1VI7A 2R7WA 2UXDF 2KG0A 1DURA 3BN7A 1YGYA 3W5ZA 2OH2A 4EO6A 5LL6d 4WKRA 4LF9F 3HSZA 2R2SA 4N7TA 2RRAA 3TR5A 2QV6A 3BO4A 4OHYA 4O3QA 2AEFA 3TQEA 1S0NA 1UZDA 1NZ8A 1RT1B 3A1YG 2FVRA 2GS8A 3T1HJ 4N56A 2FVPA 3D1QA 3R2DJ 1WC5A 1VQ6S 4ED5A 4F4YA 2YH1A 4ZJLA 2H51B 1R0AB 2VQEJ 3L7PA 3H5UA 1N0VC 1B7FA 5CD4A 1WHXA 2HVIA 1KLMA 2DGTA 2KB2A 3NL0A 4I56A 3WBZA 3QLHB 2LDIA 5IQ6A 5KFIA 4PUOB 3TJ9A 2FHKA 4LMZA 2JH3A 5HQMA 2QFIA 1RWKB 2V2VA 2YKPA 1T03A 3M8YA 4F25A 1DHMA 2AYBA 3FFIA 2X7IA 2J6UA 3BSNA 1D1UA 2RS2A 1SB6A 1U0HB 1AFIA 4OHZA 2QMXA 3SDEA 1KVJA 1RAGB 2D41A 1HKAA 2DHXA 5IV4A 3MFHA 2ALYB 2XYHB 1NK6A 1HWKA 5IT9U 3AODA 5BR8F 1DTTB 3W3SA 3VCDA 2F63A 5E3QA 5J1EB 1FRJA 4CO4A 1HPZA 1RLDA 3AXKA 4QYZJ 2O67A 3KLHB 3RTVA 1TP7A 3QAUA 2VOOA 2OEJA
chains in the Genus database with same CATH topology
1RAJA 4LVOP 1WG4A 3GFYA 4ZMMA 4Y65A 2GO8A 3RB4A 3FMWA 3M32B 3OLBA 4FF4A 4BHQA 2UV8A 1TV6A 4Q2MA 3MF5A 2UU9F 3CC4S 4TXSA 3U27A 1NK0A 2U1AA 3W2WA 4Y2KA 3KWMA 2IA6A 3HK2A 4Y2AA 1ZETA 1IKYB 3AA9A 2YNFB 4PR6A 3UFCX 2CZ4A 5DDQC 2W4PA 4LIWA 5KFKA 1APSA 2HLUA 4EYHB 2LEBA 3NGDA 3H2VE 3H59A 2JRSA 1Q79A 5KG2A 2N3OA 4OHWA 5AJ3F 5LMNF 4R0EA 3FJ2A 5D6GA 1WG5A 1S4FA 3G8TA 4Z2XA 4NXNF 4B3MF 1S99A 1L3KA 3X3UA 2WBMA 1VQ4S 3UQSA 5AXLA 3WC2A 5CA5A 1S0MA 4JBCA 4J37A 4F3QA 3M1VB 4ATNA 4YHHF 2XY5A 2EW9A 2JL9A 3DHWC 3S01A 2CKWA 1FERA 3CSKA 3LAMA 5I3UB 2B4PA 3KMQA 1N0UA 1BWEA 4A48A 3PR5B 5D3GA 2GHVC 3ENVA 4G1IA 3JB9k 2CFXA 1CQNA 4KGKA 1YI2S 1CG2A 1S79A 2YWEA 4PPDA 1UVIA 4I67A 2XHWA 4ZOSA 1HYSA 4ICLA 2K2PA 1SL0A 1R89A 2J9EA 3EXYA 1NJZA 2DJWA 5C25A 1VC5A 3MMAA 2X51A 2R2RA 2RQ4A 1UMJA 3G86A 2DNPA 1Q7YT 5KT3A 2KT3A 2XS2A 2B43A 1XWLA 2G9OA 1FEHA 4IYQA 4QU7A 3G71S 2DGQA 2DHGA 3SZ2A 1H7WA 2VL1A 5KFBA 1Q1KA 1HL6A 2VPYB 1K9MT 4PG8A 1IXKA 3I9V9 1RTHA 4DSLA 1TVRA 2NSBA 3RB0A 2E44A 1S1VA 1SXLA 2ZD1A 1S6OA 4CTAA 4J9RA 4HDGA 4K4XA 4WJBA 5BYRA 2OAUA 2FHJD 4EEYA 2XMWA 1SL1A 2IBOA 5L1IA 5HI7A 3N9UC 4DQQA 4JI1F 1B0TA 2VG7A 1JJ2R 3ENWA 2HNYB 4DV0F 1S1WB 4Q44A 3MEDA 2DNQA 3DI6A 1S9GA 4ID5A 1X4EA 3CCVS 4IUFA 1JLGB 1WI6A 3CEDA 1ZZFA 3SFGA 5HLFB 3NAIA 4DFKA 4W92B 3QJPA 1DTQA 2FLNA 3QWUA 2ZC4A 3OR2B 5GADU 3E3XA 3T6BA 3GILA 3DGPA 1QUVA 3TQ1A 4IR9A 2MSTA 4J9OA 4I68A 2LCWA 1CSJA 1QLNA 3MMBB 3PIPQ 4K50A 3OL8A 2DB1A 5HROA 3CDBA 1ZPVA 2BYCA 2ROGA 4MIWA 4Y34A 2GCFA 2IRUA 2MQQA 1FHTA 3BS9A 1XBWA 1E6VA 3DOLA 3CT9A 1FO1A 5BYSA 1BGXT 5KT4A 2CYYA 5CCMA 2EFVA 1C0TB 3DNCA 1T03B 2IM1A 2GJ2A 4XPCA 5HP1A 2XZWA 3C8YA 3QIDA 3FFIB 3NBPB 4GO5X 3M6XA 3BREA 3CD0A 1ROFA 3TA0A 1Y7PA 3PJXA 3V4MA 4IO1A 2YQ3A 2Z0GA 2I2YA 2NLWA 2FPHX 5LSLA 4OHXA 1N54B 2Y1IA 3KG4A 3MEGA 4QIEA 1IBLF 1N5YA 3I0RA 1CVJA 4LVNP 3BEGB 5I42B 2MKJA 3GG0A 1J5OA 2RF2B 1FF2A 3MM9B 1N5TA 2K3IA 3P96A 2KU7A 3KLEA 3P6YC 2WAQD 4ZCMA 1BQNB 1MMDA 1H38A 1KC8T 4EBEA 3QJLA 1QJHA 1A9NB 2QEXS 1VC0A 2HS4A 3AHPA 1NJIT 1KOHA 4OZNA 1FRHA 2ILZA 4KC5A 3D5MA 2ATLA 4DSJA 2Y0SD 3R5DA 1DJ0A 4U6PA 2W7AA 5AXKA 3PIOQ 2KTQA 1H7XA 2CPYA 1RT3B 2VBZA 2RT3A 1B0PA 4FF1A 1FJCA 1S9EB 4WCEQ 2FJXA 1N5VA 4PRFA 4DL7A 2FGOA 4ES1A 4NCBA 3K59A 4KR0B 1EP4A 4DV2F 1UA1A 5HO4A 2DHSA 2PT0A 4KGMA 2KN4A 5IS2A 2DITA 5DM7Q 4QWDA 3KLVA 3OBIA 3QGPA 1HMVB 3NS5A 4EZ9A 2B3TB 5T41A 3ZZUA 4KJIA 1F5AA 3DOKB 4M63A 1XR6A 4LSLA 4IG0B 4QPXA 1YWXA 2JHEA 4ZCKA 5KFNA 3MMCA 2DR5A 4QWCA 1FXRA 5F8JA 4PKDB 1F2GA 3E8OA 2K3KA 1LWEB 4PG4A 2GMJA 2VBXA 3V81B 4Q2LA 1G3OA 4AE5A 5A8KB 2YNGA 2N3LA 2R7XA 1TL4A 3CC2S 4MK9A 1AUDA 4NLRA 2OO4A 1NK4A 1LFWA 3KG0A 1VQLS 3IRWP 2O01C 4V19X 2VFUA 4ICLB 1DARA 5C42A 1U26A 3UD3P 4BC7A 5GMKa 4IQXA 1TV6B 1CC7A 1RT6A 2XULA 3W2VA 1D9AA 3DLLQ 5FLXY 3CJ2A 4RW9A 4YB5A 3DN9A 1RT5A 2GQCA 5EX3A 5J2MA 1RTIA 1RA7A 5GAHU 4CO1A 2E5JA 4J5OA 3GV8B 4ECUA 4X4VA 1M5SA 4X2BA 1X4HA 1P1TA 3SQGB 3FQLA 3KK1A 4AL6A 4ZPDA 1FT8A 3K5PA 3N79A 3M9OB 4DLGA 2V9KA 2PIIA 2JWNA 3AQPA 3CCRS 2HNDA 4RBVA 3O2IA 3GR1A 4NL5A 1J2VA 3RBEA 1C4CA 2ILYA 3THVA 2DGWA 2HFOA 4BWJA 4YEAA 4HL9A 2YY3A 3TX8A 1OO0B 3DMJA 3DRSA 1RP5A 4AUKA 5F8GA 4DFPA 1OIAA 4DLEA 1UVKA 2EBGA 5H9FJ 3IG1A 1Y00A 4ECWA 5LXYA 1S9FA 5K8OA 2GV1A 2B5JA 2Z4PA 1T8EA 2E1CA 3D54A 1KVIA 3MM6A 2HW3A 2WW8A 2M2BA 1P6TA 2UUTA 3H5YA 2ZZNA 3I5AA 1HYSB 4I2QA 2C28A 1GTEA 4QR2A 4CO5A 3JAMY 1R8PA 5C25B 3MMAB 5IQQA 4A47A 1Y5IB 1HNXF 1JLEA 2M70A 4RNNA 1WNEA 3GZ7A 3BGFA 2QIFA 5HQ8A 4QBUA 4QR0A 1SH3A 4Q8EA 5DDPC 1YQHA 2CQ1A 5DLGA 5E2QA 3QIPB 1RTHB 2X1FA 4RNOA 4FS1A 1TVRB 1FNMA 2P9CA 1MMLA 3D0IE 3FCHA 1S1VB 2ZD1B 4CTAB 3I56S 1VC6A 4RNHA 2VPZB 3EPIA 3LP0A 2W7PA 4ED7A 4NLOA 1HR0F 2QSWA 1VMBA 5B0BA 2UXCF 2FJDB 1C4AA 1U6BA 4DV4F 1WEZA 3AQOA 2E29A 1FD2A 1R31A 5KFZA 5KFEA 2RQCA 2ZZMA 4B3OA 2OTJS 3MEDB 3DI6B 4ID5B 4R0JA 3VWSA 4YUDA 3H2LA 3PKYA 4C3KA 1RT7A 1V9OA 3SMZA 1HBNA 1S6PA 4K2XA 1XMOF 2ZH2A 3C46A 2GC8A 2MPUA 2F7VA 2D74B 4X4TA 4EFAC 2X1GA 4NCAA 1DTQB 3OL7A 4LSNA 1HW9A 3CDUA 3E51A 1E6YA 3ZZOA 2XLJA 2XNRA 1REVA 2HLTA 1TL1A 1K8AT 2G4BA 2DNGA 1TQLA 2HQ3A 1FVQA 1Q8LA 4TY8A 2DNOA 1HARA 2WCXA 1XMBA 2HFNA 5C5JA 4JI2F 2O1PA 4LFBF 5F0WA 1FDAA 2JLGA 1U47A 3LP1A 2AJ1A 3DOLB 1E6VB 4ED6A 1JKHA 2IMOA 1ZBTA 2HHPA 3IR7B 1OSDA 1RISA 4DBQA 2E9TA 4BWMA 1RA6A 4CCHA 3ZZYA 4CQ1A 4FP9A 5KAKA 1SJRA 2E1MC 5HP1B 2CVEA 1U1MA 2V9WA 4WYLA 1M90T 5IWAF 3V6DA 1FK9A 3Q8RB 2LQJA 4ED8A 3CCSS 4HVZA 2W8KA 2AJ4A 3NAHA 3ONQA 2FGCA 1NKEA 3MZIA 2WSFC 4H4MA 2B0GA 5KFHA 1WD6A 4YP3A 4LF6F 2KHCA 4XO0A 4X84A 4DSFA 1N5YB 5L1LA 1JXLA 3I0RB 4NLXA 3OTCA 5KG3A 3WC0A 5A6WA 3MEEA 4NYPA 1J5OB 4P7TA 3DLHA 1LOUA 1S1UA 3CJ3A 3NGKA 2DCUB 4C8LA 2VPWB 2AGOA 2ZH8A 2DPIA 4I7FA 2AJ0A 1RYRA 4RBTA 1VS3A 4A8FA 3S8SA 3LO3A 2BQUA 1YBAA 3OV7A 1QAIA 1FKPB 2C42A 3S7RA 5A2QY 2GA7A 5DDOC 3RW6A 2HHQA 1HI8A 2GX8A 3BJYA 3CMES 2KM8B 4XPEA 2EPIA 4KAIA 4A8SA 4B9SA 4OV1A 4U9RA 3KK2B 1X4AA 4FBTA 2C3PA 1FEEA 2IC3A 4OZ5A 2MKKA 5J2PB 5KFMA 3QJJA 2QT7A 1CC8A 2YH0A 1EP4B 3IAS9 1X4GA 4ELTA 2PI5A 3ICLA 4I2PA 5FDLA 4FF2A 5D8HB 3VZIA 4KSEB 5CH7B 2M4MA 1KHWA 3L95X 1U4BA 2KRBA 2GW8A 4FXVA 1H6KX 5KFAA 1LWFA 1SL2A 4Y2IA 4LSLB 4BDPA 1K0TA 2GFFA 5AE3A 3NMRA 3MMCB 1JLBA 3SCIE 2P5VA 4TKTA 4WFAQ 1HNIA 3I55S 4A8QA 2XMUA 3DDNA 3OTBA 3SSSA 2RQKA 2ABYA 2W24A 4NLYA 5B0FA 2XMMA 4JV0A 3THPA 2WBRA 3CD5A 3U7JA 4KFBA 5E5NA 4OZ1A 3HX9A 4PXDA 1DRZA 1X5OA 4RWWA 2MXYA 1IBKF 1TKTA 5C42B 3OHBA 5KT5A 3J7Z5 5EN1A 5BYQA 4Q5VA 4J9MA 1RT6B 3W2VB 1IBMF 4RW9B 1MMNA 5J2MB 1RTIB 2R8GA 5GAEI 2ZUGA 4C3MA 4C11B 4FBUA 5H1SV 2A2CA 1ZTWA 1S72S 5KFPA 4TYBA 5K9FA 3GR0A 3DRPA 3KK1B 1U1PA 4UQGA 3EUNA 4CI0B 3VAKA 1TKXA 1D3WA 1WHYA 4IRCA 3KFWX 2VFRA 2K7JA 4TYAA 2I8EA 4C3LA 3I4PA 4TQRA 2HHSA 2HZCA 3NS6A 4J9SA 3QGIA 2VOPA 4F02A 4RUCA 4AQYF 5DQGA 4M94A 1UKUA 2DIVA 4OZ0A 3UR3C 2ZJQQ 4PQUA 4AYBD 5KFGA 3DRSB 3DMJB 3EX7B 2YX7A 1FRXA 1P27B 2DGSA 1OS5A 3E01A 3CB4A 3KLFA 3IG1B 2DPJA 4WU2A 1MWYA 3VAJA 3MM6B 3OXFA 3X1LB 1C1CA 3OUYA 3CJ4A 2CIMA 4CH7A 1XMQF 4Y6IA 4CH0S 3G8QA 4I2QB 3PVXA 4GC7A 1GX6A 2RU9A 1KTQA 4B9VA 4OL8A 1IQTA 3B78A 2WTFA 2XSFA 3K5MA 2V4JA 4AFFA 1JLEB 3UI3A 1RTJA 1UP1A 1VBZA 3KKFA 2EBEA 2CJKA 4JV5F 3BQ0A 2JEFA 2DK2A 3H5SA 3PJWA 2OTLS 1T7PA 2VUGA 2XMKA 4MAKA 2ZHBA 3NWGA 1HHTP 3PO5A 3B8HA 1N5SA 3OVSA 3MXHP 1KEKA 1Y0HA 4B9LA 3AB4B 1DBDA 3VF0B 1FA0A 4B3SF 2J0SD 1TKZA 3J80Y 2ZKTA 3LP0B 2X3GA 2IA0A 3I96A 2FJWA 2N7CA 1FE4A 1YSJA 3IRXA 1KOOA 2F8MA 3J81Y 5L1KA 4NMLA 1WF0A 3Q0AA 2F9JA 4QZVB 1R27B 1V3ZA 1YRXA 4IFYA 2DRBA 3SSRA 2L3MA 5CYMA 4O44A 4UUWA 1FTCA 3FGVA 2LQ9A 4B3OB 2HHUA 4LF7F 1HBNB 1S6PB 1SBRA 5KFXA 4EBDA 2OPQA 3IWNC 3J7ZT 1IQZA 3MEKA 3O44A 4HLBA 1X5PA 4YMEA 5KG0A 3CTRA 4DFMA 3T1HF 4LSNB 2DTJA 5LJ5Y 4NYOA 3SCJE 1Q53A 3FEZA 1E6YB 4YB1P 3N28A 4DL4A 3JSBA 1M5OC 1QSYA 1TL1B 2D7SA 4OI3A 2J6TA 3HJFA 1S10A 3F56A 4I0WA 1QSSA 3BGLA 3OVAA 3IN5A 3HXMA 3MAQA 4TY8B 4EUVA 2B9YA 3M8RA 1U09A 4AXJA 1T3OA 2BE2A 3O8WA 2RH3A 3EXCX 1U1QA 2B6AB 1FCAA 3HVAA 1VRUA 3KHRA 3LP1B 4F50A 3T9NA 1UETA 1WWHA 3N4WA 4FXWA 1JNRB 1F9FA 3OPKA 4ETXA 2ZH6A 4KIAA