1MWZA

Solution structure of the n-terminal domain of znta in the zn(ii)-form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZntA
publication title A new zinc-protein coordination site in intracellular metal trafficking: solution structure of the apo and Zn(II) forms of ZntA (46-118)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 16
structure length 73
sequence length 73
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mwzA00
2FTRA 1YJTA 3BDEA 2HFOA 5B0BA 1S6OA 1S6UA 1YJVA 2LDIA 1IUJA 2XMWA 3FGVA 3GZ7A 2QIFA 5F0UA 3LGNA 2ROGA 4Y2IA 1CPZA 2BYCA 1OQ6A 3HHLA 3MCSA 2RMLA 2ROEA 1YRXA 1APSA 2GGPA 2RILA 3FRYA 2XMUA 2ZDOA 3IWLA 4HL9A 2GFFA 2K1RA 1TR0A 3UDCA 5B09A 2BJEA 5T7LA 2K7JA 2AJ0A 2ASYA 2XMTA 2BJDA 2KYZA 2JDJA 2OP5A 1V3ZA 4YDXA 4Y2MA 1YJUA 1FE4A 2LXFA 2OFHX 2W4PA 4OJ1A 1AW0A 1CC8A 4Q2MA 1KQKA 2Q3PA 1FD8A 1TUVA 2ROPA 2K2PA 5KAKA 3DXSX 1URRA 1GXUA 1MWYA 2OMOA 1Y3JA 4Y2KA 1FE0A 2AP6A 4NL5A 2RSQA 4DL0C 1FEEA 4A47A 2QYCA 2EW9A 3CJKA 4A48A 2L3MA 1KVJA 4HH1A 2GO8A 1KVIA 2BUNA 2KKHA 2KT2A 1JWWA 1R6YA 2G9OA 2XMVA 4FNHA 2K7KA 3HHLB 2N4CA 2GGPB 2XMKA 1CC7A 1Q8LA 1K0VA 1VQYA 1XBWA 3T9NA 2XMMA 1YJRA 1P6TA 2ZDPA 1GXTA 2FIUA 1OSDA 2ACYA 2IYGA 1FVQA 5F0WA 5B0AA 5T7LB 2HLTA 1N5QA 2OAUA 4DN9A 1SB6A 1ULRA 5A6PA 1Y0HA 3BN7A 2CRLA 3E8OA 1Q4RA 2OFGX 5B0DA 3HHLC 4YEAA 3QMQA 2LQ9A 2N7YA 1TL4A 1W2IA 1YG0A 1Y9OA 5K9FA 5IXUA 4EFAC 3HF5A 3WDOA 3LGMA 5B08A 3KNGA 2RU9A 2AW0A 2OKQA 2OD4A 3VTIA 4A4JA 2HQIA 3HDSA 4Q2LA 1N5VA 2AJ1A 1WD6A 2OD6A 3F44A 3CJKB 4A46A 4FNIA 4OJ3A 4U9RA 1N5TA 1LQ9A 3BM7A 2HFNA 3KG0A 3QGPA 2VV5A 5B0FA 3HFKA 1Y3KA 2KT3A 3HX9A 4HH0A 1X8DA 3HHLD 3BF4A 3KKFA 1P8GA 2K1RB 5B0CA 3DCAA 5A6WA 4ZOSA 2IYIA 2PD1A 1TL5A 1FVSA 2FB0A 2GCFA 2HIQA 1FESA 1RJJA 2BBEA 2PGCA 2LQBA 2VH7A 2XMJA 4NPOA 4DPOA 4HI2A 1N5SA 1SQEA 3TNVA 2N4DA 1QUPA 5B0GA 2QLWA 3LO3A 4OIXA 2FHMA 2GA7A 1Q8BA 1VQSA 3BGUA 1TZ0A 3BR8A 3TRGA 3I9ZA 2QLXA 4QOTA 5B0EA 1OQ3A 1U7LA 1AFJA 4OJGA 3TOQA 4F67A 2W4DA 3BB5A 3IWXA 2HLUA 1Q53A 1X0PA 1X7VA 1MWZA 2IFXA 1OPZA 3MZIA 1AFIA 2W4CA 3FMBA 1JK9B 3K7RA 3KG1A 4OJHA 4HI1A 1SI9A 2GV1A 4ZA1A
chains in the Genus database with same CATH superfamily
1V5IB 3EVWA 1U1NA 1JLBA 2E29A 4XPEA 1HWUA 2UUWA 4NXNJ 2RF2B 5LXRA 4NXMF 3DKDA 4J9UE 1SJQA 2BACA 3GJSB 2QO3A 7FD1A 4FVMA 2G9OA 2PDAA 2UXDJ 1K0VA 1RWOB 1P6TA 4DF4A 2HNYA 2C3PA 3AB4B 1YKWA 4WFAQ 1RKIA 3EVMA 2WW8A 1WC6A 3D0HE 4FKXA 1I5OB 3ILOA 5KT4A 2MKJA 2VPWB 2X51A 2QYGA 2HNYB 3QZ8A 4URQU 3HI9A 3T9ZA 3U1LA 4PZVA 3A4TA 1HHSA 4OJGA 2HBQB 3OVAA 9ATCB 4AYBD 2VKZG 4L6V3 1M1HA 1RT5B 3OPKA 2J6SA 3QYYA 1NPKA 4NLRA 1GTHA 3R5DA 2W2MP 3IWNC 1TL7A 3AY0A 5JVGQ 3CCWA 2Y8WA 4Y2MA 4ILMA 4OI3A 2VUGA 1WDTA 2DGWA 3PW4A 4CO0A 4DV5F 1EQ0A 6AT1B 1U0HA 1DURA 2WCXA 1FKPA 2DY9A 4EZ6A 4QZVB 2GZOA 4QU7A 5D3GB 3NGUA 1TL7B 1KNZA 4L3NA 1R89A 3FBBA 5HJXA 2B4OA 3PYFA 3PRVA 1IQTA 1U0HB 4ED3A 1FKPB 1HYSA 2DNNA 4CO4A 3FCVA 4LF8F 4O3RA 3UNYA 4ED2A 1RWXB 3AJ2A 5JXSA 3OL7A 3R97A 1CG2A 5AJ3J 5HVHA 2PFFB 3KK1B 4DV7F 1ZOTA 3CMES 1HYSB 2UXBJ 3LAMA 1Q1KA 1CPZA 4I1TA 5HQ8A 1AUDA 1LWFA 2WSEC 1QLNA 1YDLA 4PR6A 4NLQA 4AE5A 4IOAQ 2FHJA 3PJXA 3EVOA 1OYEA 2Z2MA 4P2MA 2AP6A 1JLGA 2EFOA 4CO5A 5DRKA 3RBZA 4Z2XA 4KR0B 2RQMA 4B9SA 1S79A 2XC9A 1D9FA 3NNCA 4K4TA 2E9ZA 3W2WB 4ZPWR 4DPYA 4CDIA 4A8KA 2MKYA 2AJ1A 5LSRA 1BUXA 3D1OA 3GP9A 2MQQA 4NLWA 1NK0A 2ERRA 2CNLB 4KGKA 1F3FA 3HFKA 3TVZA 4LFAF 3R5JB 2ZZNA 3LF0A 1PGZA 2CJQA 3NXZA 4ZVEA 1MNEA 3ISZA 1B70B 2B9XA 3SV3A 4V19J 2I6WA 2HFVA 4DEZA 3KDOA 4DR2J 4WP3A 1HWIA 2FD2A 4KYZA 5G4DA 2I2YA 5KTQA 1C1BA 2WSFC 4NYZA 3GWCA 3N5BA 4XTTA 2BKOA 2W7AA 1KQKA 3N5FA 1Y3JA 4ELTA 1RWMB 2RRNA 1C1BB 3AFGA 1LOUA 1RQ0A 3MAAA 2E44A 2RIJA 2HKEA 3D3CJ 4QIVA 4G65A 3HHLC 2GNKA 2YQ1A 2XS2A 1MN9A 5DDOC 2Y3YA 4U9RA 2FHKA 1XNRF 1YJ9S 4C7QA 3OFGA 2VQFF 3MAAB 2RKIB 1RTZA 2HZCA 4X4VA 4USTA 3MM5A 3TZZA 4I7FA 3VAGA 4DX6A 2BW7A 1RAFB 2ATLA 3M6XA 2YBVA 3HHNB 4JI1J 3AD7C 3PW0A 1LK5A 2BZ2A 4OZ1A 2G4BA 4FPIA 3TR5A 3UCGA 4X66J 3W9HA 3W9JA 4UQTA 3MM5B 3ILIA 2W2QP 3OXFA 1ZETA 1BC6A 2CPEA 4OYXA 2VOOA 4USVA 4I6WA 3EUNA 2DRDA 2IBKA 4K5SA 4JYAJ 3ILJA 2RE1A 2A18A 3B82A 1S7IA 2QYCA 1KVJA 2XGPA 1N34J 3PR5B 5CD4H 2B3TB 5CQGA 2HHPA 1XNQJ 4HACA 4E2FB 1KFDA 2CQ0A 2PI5A 5IV3A 2HZAA 2DPIA 3T1AA 2OD4A 4DR3F 5DDQC 1NJXA 1QVGR 1RT6A 6FD1A 4IOCQ 1NZAA 3DGVA 3PV8A 4OV1A 1QSLA 1IR2A 4HACB 3T1HJ 1F0XA 2M7SA 2V8VA 1JQGA 2R9LA 1FI4A 1Q7LB 1VIXA 2PEBA 4WFZA 2XWYA 4U7CA 2BJ3A 1WOPA 1RT6B 1S0VA 4B9UA 3GMGA 3HCXA 1FD2A 2VASA 1WUUA 4Y2AA 3C2PA 3P49B 3CW2C 5KFXA 1UEUA 1HR0F 4OHVA 3J7AN 2JVOA 2JJ4D 2OFHX 4ILLA 3ZTQA 1SQGA 3OFFA 2Q6BA 3KFWX 2FJEB 5GAEI 1WC5A 3BGLA 2KJWA 2AIRB 1FRXA 5KG0A 1RWWB 5IT4A 4K59A 2PC6A 2MQMA 3T5HA 4RWWA 2VG6A 4NLSA 4F3MA 2HHWA 4KAIA 4QIGA 5L1JA 4ZITA 3EXCX 1Y9OA 1VQ9S 4CIOA 1JKHA 5K8PA 3CJTA 3MPVA 4NRUA 2RT3A 1IXKA 2JEIA 1KBRA 2GMHA 3D1HA 2NCKL 3TX0A 3JYTB 2PD1A 5M2PA 1YVFA 2KO1A 2X1BA 2VG6B 3AB2B 1M5VC 4USMA 3W60A 1FXRA 3KWMA 1DY3A 1LXJA 2FVRA 3HO1A 3GQCA 1JKHB 3MPWA 2XB2D 3SSRA 3MCNA 4Q7AA 2RDIA 4RWXA 2C3UA 3PZPA 3HFVA 4DFMA 3W5XA 3S01A 2R2TA 4YY3F 2DO4A 1XQIA 1DQ9A 2ZUAA 3LWLA 5DG7A 2Y1RI 3HT3A 1OS5A 2DHSA 3GPAA 4DSEA 2B9WA 1NSAA 3I31A 4TU8A 5F8LA 3GTYX 2VQEJ 3R5GA 4JI0F 3FEXB 2XMVA 3RBDA 4XDDA 4GKKF 1FCAA 1YJRA 4F4KA 1GXTA 4ECRA 4DZ6A 3QWPA 2C3MA 1EIYB 2NXJA 1DARA 4B9NA 1U1MA 1KKHA 3GV8B 1SQFA 5B0CA 4LF9F 1RBOB 2MY8A 4LUBA 1VRTA 4M5KA 3UDVA 5BJRA 2XWXA 5ETSA 5KFAA 3R7BB 3CJ5A 1YI2S 3CCMS 3C16A 4YDDB 1VRTB 5U47A 3CVKA 4NA3A 2H4WB 2ZE2A 2LXFA 4FVCA 4A48A 1H72C 4OZ2A 2KU7A 2CDRB 2XZTB 2HWIA 1T3OA 1GNKA 5B0DA 4XO0A 4P72A 4YUDA 3IP0A 5KG1A 1FF2A 2XYHB 4JI3F 3GCWP 1JLEA 4KC5A 1Z1ZA 1Y5NB 3JAMY 1CJKA 4RO0A 3M7VA 2XLJA 4O4GA 4JI7J 3IMQJ 1NJIT 1H0HB 1S1WA 5KOWA 4NZ6A 5I3QA 3Q86A 2P6TA 3A8EA 3MUMP 1EKRA 1JLEB 1R8BA 1S4EA 5HQLA 3HXMA 3OBIA 3OXGA 1CJKB 3KJFB 4O4GB 1NUEA 1H6KX 4FPRA 3HLUA 1S1WB 1NH8A 2CZ9A 5F8HA 4NMXA 2BKPA 2EG2A 4Y2KA 2V34A 1S9GA 1RT2A 1LFWA 2EXUA 3MR2A 2DD8S 1L3UA 3NMRA 3MOJB 4NEYA 4NA2A 2LU2A 5DS7A 4PKDB 4ZPTR 4DUZF 1S9GB 2NREA 3X1LB 1OSCA 1P1LA 1RT2B 3DCAA 2IYIA 3R6GB 1RBAA 5LJ5Y 4TXSA 4C3MA 4LRBA 3N0VA 4DR5F 1SH0A 3N9UC 4QOTA 2RRAA 3S1TA 4MK9A 1T94A 3MI7X 4DX8H 5HMWA 1WKLA 5FLXU 4DOZA 4DSJA 3QAUA 3FDSA 3DXBA 4YN3B 1VBKA 4FS1A 4JI5F 4HKQA 3IBWA 2R2RA 4RW8A 4UOHA 3RAMA 4C8KA 4YR2A 2AV5A 4EWTA 1X4DA 3PX6A 2A1BA 1EP4A 1TP7A 1RWNB 3I4PA 1WDDA 4WIIA 1U45A 1SIZA 5L9XA 2D3O1 2LQ9A 2BE9B 3QGGA 4NA1A 1MU2B 3T41A 5KFMA 4HHUA 2MZ1A 4RUCA 1VQKS 2FC9A 5KFSA 2DH9A 2GC8A 3IAS9 1FFGB 4PG7A 2G2ZA 1EP4B 3Q24A 2PIIA 4Y00A 4ED8A 4F36A 4LF5F 1SQEA 1EQMA 4I69A 3H4DA 2QLWA 3M6WA 1OIAA 2XYGB 4ZPAA 2VZ9A 3TAPA 4ZVQB 1OPZA 4D3HA 4FKYA 4GMKA 1N8RT 3E2EA 2XCPA 4DV2F 1IQZA 3Q8YA 4C0OC 3MAHA 3FFIB 2ZDOA 4L73A 3QLHA 4OYMA 3OSPA 3PIPQ 2PI4A 1X4EA 3F41A 3DHXA 3DLLQ 2P9GA 1FDNA 4F4XA 2F8MA 1KD1T 1KP6A 1GXLA 5D0HA 4PUOA 3GFHA 1CS4A 2DTJA 1EZZB 3CD6S 2CPXA 3ZZTA 4NYOA 1R0CB 3QLHB 3FBEA 4U7UK 4MIWA 3MEGA 5DQIA 1T8EA 4IR1A 4OMFG 3HDSA 1CS4B 3WIUA 4A46A 3L7PA 2W2NP 1LQ9A 4LIRA 3MUTP 1YRUA 2CJYB 4QYZJ 4LF4F 4G6VB 2HFUA 2HHHF 1E6VB 1D9DA 5A6WA 3TJ9A 1Q81T 3MMBA 3O2IA 3VF0B 4AXJA 4IRCA 5EHHA 3I5BA 2BR0A 4PPDA 3EGWB 4KGMA 3M4XA 3MM8A 2RQCA 2IRXA 2UV8A 1LKZA 3LQVA 1F1BB 3SEOA 1MWYA 4MKBA 3PW7A 2ZBPA 3R7SB 3MMBB 1HD0A 2KRBA 4C8OA 5CXTA 3TZXA 1RBLA 1L3VA 3MM8B 4X64F 3L09A 3LH2S 3NNHA 3I5AA 4LRDA 2E7VA 2DNPA 3W7BA 5I42A 4Q8EA 4DCOB 5LSLA 1HNWF 1U49A 3PACA 1U1QA 1M5OC 3S8SA 3VQSA 2YPYA 3PKYA 4OL8A 4DPWA 4RW9A 4I68A 5KFUA 3KXDA 2ACYA 3EDRB 2R7WA 1F2HA 2YKAA 4GO5X 2NYIA 2UUCJ 2EFGA 1PC4A 5L1KA 2VA3A 2ZH5A 5JJBA 1UVKA 5J2MB 3T5JA 2MQ8A 4RW9B 3GR1A 5HSPA 4UF4A 3KKFA 1WHWA 3TW0A 4P52A 2BQUA 1EB0A 1S6QB 3D4JA 2W9BA 4DV1F 3GE9A 2GA7A 3UD3P 2CXEA 4YS2A 2ZBCA 1T03B 3KDNA 5H9FJ 1BQXA 4X4TA 4Y65A 3TA1A 2NZ4A 2FLOA 4AUKA 2AT1B 3TA0A 3UVJA 2W9BB 2PSZA 2HQDA 3L7UA 3PX4A 2UVRA 3OLBA 4HDHA 2G1HA 5ETRA 4LFCF 1U2CA 3AT1B 1RZMA 5E33A 1P9QC 3FKBA 1SC4B 4ZPCA 2BJ9A 4EZ9A 1FWLA 2QT7A 3UVJB 4NLOA 4ZS6A 3U02A 2VDHA 1MSWD 2XMMA 3AXKA 3BBFA 4ZP8A 1U1OA 5F8IA 1IJFB 2M8DB 3CCZA 1YJWS 3QMQA 2KB2A 4U8VA 4LR8A 2E5LF 5K8NA 3FCWA 2FVCA 4CP5A 4NCBA 4Y3CA 3IO1A 2M70A 4OYOA 1TFWA 2H51B 2CFXA 2D1CA 2V69A 3Q8SB 4DL7A 5C7PA 2WVDA 3ISND 1NDPA 4MIAA 2W24A 4LRCA 2E5JA 1NKEA 4DR6F 2FHMA 3D68A 1WI6A 2VICA 5I3UB 2WK4A 4JI2J 4ZA1A 4OI6A 3SV4A 3BQ0A 2QIFA 8RUCA 4NWBA 1A9NB 3Q8RB 4I0WA 5HBMB 2R7TA 2DRAA 2W9CA 2HURA 3QPIA 3DYAA 1XJWB 3OSNA 1NK4A 3T5LA 4OHYA 4KRWA 5FJ4A 2DNYA 5JUMA 5H9EJ 4ZPDA 1VQ8S 4CLSA 1TQLA 4D3GA 1WNEA 2KVQE 3KLIA 3O8WA 2FYXA 1Q8LA 3J7ZT 2XSJA 3N01A 2W9CB 2ACMA 2DBBA 4CYUA 3DYAB 1R7IA 3JSYA 2N7YA 3H25A 2W7OA 1RWUA 5E3AA 3DHWC 4CLPA 2AW0A 1GK8A 1DBDA 3CTRA 2PN6A 2K06A 1Y3KA 3KLIB 3PTWA 1VJWA 2XSJB 2AWZA 2B5JA 1FX4A 2FZCB 4CYUB 2QEXS 2MSTA 1N33J 1YJNS 2HHXA 1LNQA 3BKUA 4MMOA 2C2EA 4QWBA 3C15A 1FA0A 5DDPC 1U1PA 1RAIB 3FMBA 1OO0B 2E5IA 3MFHA 3LA0A 3MM9A 2FHOB 2B5JB 1HW8A 2G2YA 4C11B 4P75A 1RA6A 1NK6A 3GSDA 1CJVA 4HT5A 4RNFA 1KHVA 1ITPA 5BR8J 3C15B 4TYBA 3IM8A 4QR1A 2K2PA 2XS7A 3MM9B 2PEHA 3H59A 2GW8A 1IR0A 1MW7A 3PKMA 2K3IA 3D66A 1CJVB 1FJEB 4F4AA 3DLJA 4M5LA 3IBFB 3E01A 3EJMA 4C2MA 2ZZTA 1KTVA 3MTKA 2OEKA 3UCZP 5KFOA 4OJ3A 4CLUA 1YSJA 1TKZA 3M05A 3K5OA 4WP8A 5BYRA 4YMEA 1VQOS 4JI8J 3MEKA 4R0EA 2A2DA 3W1YC 4F7VA 1WG1A 4B3RJ 4RNNA 1HNXF 2LEAA 2CQBA 1FTRA 2HWTA 1X4FA 2HQCA 2E1MC 4LREA 1AFIA 1RWKB 1TKZB 3QGIA 5DO2A 5B0BA 3MCMA 3GZ7A 2ROGA 1D09B 4NXNF 4MK8A 2IBOA 2L9DA 1VDHA 2GQ2A 2BJDA 2C2ZB 3TVYA 3DOLA 3ZNUA 1U09A 3HKWA 3IG1B 5E0OA 1F2GA 3PFEA 4G1IA 1YBAA 5KFYA 4DL0C 4CLWA 3CB4A 1CQNA 2QMUB 3H0PA 2UXDF 4EMDA 4DQSA 3GIJA 4DSLA 2UUBJ 1BQMA 3DOLB 3SFGA 4Z7CA 1KOHA 3OUYB 1R8AA 2ALYB 3NG8A 3FBFA 2DXFA 4XK8C 9RUBA 1Y7PA 1WELA 2B8PA 2E1PA 3G8TA 3ZTOA 2XMAA 4DL5A 1U1RA 1BGXT 2AYBA 2MJUA 4KHRA 4KHPJ 1BQMB 3VZHA 2B43A 1FK9B 2FHJD 2JZ5A 1VC5A 1P27B 3CJRA 1HLWA 2E9TA 1UPPA 4RW7B 2KL8A 3QT6A 5F9NA 1FDDA 3RYLA 1OPIA 1T0TV 1T9UA 1XMOF 1APSA 3TAQA 3H42A 4DSFA 4F2SA 3EPIA 1S0OA 2I8EA 4RNHA 2MQLA 2VOPA 4USJC 3MR7A 1N52B 4A47A 2WBRA 4ANEA 2JL9A 3A8IA 3BYPA 4C98A 4EGLA 4CH1A 1EARA 2IHR1 3NKYA 2OAUA 1PSDA 4IO1A 5BYSA 1UVLA 2HSEB 4LVNP 1W2IA 4UZCA 4F4YA 1JJCB 2QX0A 2PO4A 3I4HX 3O44A 4KKOA 4USIA 4K50A 1RHQB 3B54A 3CD7A 2W2OP 3QBCA 2AEFA 3WC2A 2GCFA 4DPOA 3BDPA 3MURP 3H5YA 4OYZA 4ES2A 1NCLA 2YKQA 1S77D 2I9SA 1S9EA 2V9KA 4KKOB 3HFZB 3DRSA 5HMZA 3Q89A 1RWPB 1V9OA 1TAUA 3BH7B 4RBUA 1FRMA 5T14A 1NDKA 3IGVA 1S9EB 1YJUA 3QRPA 1HBMA 3ETMA 2A6OA 1CSJA 1OWXA 4B9TA 2CUYA 2CPYA 2Y0BB 2OPPA 1SL0A 4ZJLA 5KFDA 5LT5A 3BO2A 1KQGB 2FJWA 2JWNA 1SL2A 4A8WA 1RLCL 3TWZA 2QRRA 3DC2A 1HBMB 4AQYJ 2RHSB 2V63A 2HNZA 4AFFA 3QRRA 4ZK7M 4J9OA 1H2UX 2FVPA 4HI2A 4UOGA 3I0RA 4QBUA 2AHOB 5A8WB 2AKWB 3HJVA 1RAAB 2HNZB 2R8GA 3G87A 2MZRA 5KG7A 1FDAA 3BBBA 4DR2F 4Q45A 1G3OA 4FYYB 4YB7A 4DQRA 3THVA 4N7TA 2LFVA 4BCAA 3VAHA 3Q22A 5D77A 2KHDA 3CC7S 2CJXB 3UDCA 4BHQA 3I0RB 4PEOA 1J5OA 1LWXA 1FKOB 1UFKA 5IV4A 3SZ2A 2CPIA 1SC6A 2HBYB 1U0SA 2CPJA 1V3RA 3QWUA 1FE0A 3R6LB 4ZJOA 2N4CA 5F3ZA 1JX4A 2HLTA 4DN9A 1J5OB 3ENAA 2CPFA 4MYUA 1V3SA 3GSIA 1EX8A 4DL4A 4UOFA 4U95A 1Q95G 3D0GE 4P73A 2FUG9 1ZA1B 2ZWPA 2ZM6J 3QRQA 2M88A 1TL3A 4LRFA 4TNOA 3IM9A 1C0UA 3PHEA 1I94J 3M9OB 3C14A 2FY8A 4JI1F 1ZM4A 4ALZA 1B7YB 4ZN1A 3LGNA 4QJVA 1RT1A 2VODA 2CYYA 1M5HA 2GGPA 4MK7A 2AJ0A 1TL3B 2MDAA 2C28A 1SBRA 4XAKA 3GG0A 1C0UB 2ZH1A 1TUVA 1GXUA 3C14B 5HVGA 3LW5C 3A3NB 5ETPA 4JYAF 2OPSA 2GAGC 4X65F 4DS4A 3GYGA 5MLCV 1RHJB 4RKUC 1N34F 4WKYA 1RT1B 2GGPB 2CPDA 4RU2A 3JXOA 1RTJA 4UQGA 5KFIA 8AT1B 4BWJA 2PMWA 2M52A 5ETNA 3O1LA 3CNQP 3EDQB 3ISNC 4DLEA 2OPSB 1YZ6A 3K89A 2XO6A 3AH6A 1FWPA 1L3SA 3HM9A 1S7HA 5IC4B 1Q86T 1FJ7A 2VPZB 3OXLA 1RTJB 4KY3A 2PGCA 3T1HF 1SJ4P 1T9YA 1UKUA 4FYVB 2CIMA 2YNHA 3L95X 3VAFA 3O3LA 4EEYA 2IC3A 2MKKA 2H1YA 3KNAA 3ZZ0A 4WFXA 2MZSA 4J9NA 3BKFA 4B3TJ 4RUBA 2HPUA 2A3JA 2IVYA 4N76A 4FF4A 2KN4A 2WVEA 4IFYB 3D2WA 3J7Z5 1UA0A 4ECSA 1RAHB 2JH3A 3ZXWA 2YNHB 2IM2A 2JDJA 5D0RA 3DGPA 2MB0B 1M5PC 3CIZA 2IC3B 1F9FA 1NB7A 5C25A 4KPCA 2GO8A 4UTGA 2OPRA 3AD9C 4ELVA 3DGPB 1ACMB 3BEGB 1T9TA 2KT5A 3NRBA 3F56A 1JNZB 4U96A 1HQEA 2RU9A 2JSXA 5C25B 4DQQA 1SH2A 2C42A 4DMZA 3KG4A 2LQ8A 4ZVFA 3CMAS 4IKAA 2OPRB 1AT1B 2NSBA 1S9FA 3H4BA 1UVNA 2BBEA 2LQBA 1N5SA 2JEFA 5D6GA 2J0SD 4QU6A 2CADA 2DNRA 4ER8A 3TRGA 2N3OA 1HQEB 4X62F 2MTLA 4JI5J 1U48A 3VR1A 2P9CA 4ZVRB 5J2NB 4A8SA 5LSOA 2VA2A 2CG8A 1PILA 5KFKA 3TQ1A 1IKXA 2DEJA 5CAAA 4QIFA 3L9ZA 4WF9Q 3NGTA 1HD1A 5DZ6A 3BQ1A 4O3OA 3M32A 1RUSA 1F9EB 3TEHB 1XWLA 4WK1A 3U1NA 1DLOA 1S6PA 4TY9A 1IKXB 2Z0GA 2OELA 1TL4A 2R2UA 1W25A 1B3TA 4C48A 3DLKA 4U7UD 4OX7A 2XTJP 3R1LA 2VBZA 4YHHJ 2HAFA 3M32B 4CO2A 2DNZA 1GFWB 3MEDA 1DLOB 5GAHI 1S6PB 1SUQA 4C4WA 2YX4A 1XN9A 2AGQA 2WVCA 2QN6B 1NHUA 3R2DJ 3DLKB 2KZMA 1H73A 2BM0A 1G7CB 1GQEA 4ZMMA 3KLVA 4WZQA 3OD2A 1UVIA 3MEDB 3PX0A 2XMWA 1IBCB 3OW2R 2DNOA 5KFLA 1BWVA 3TUJC 1SUQB 4USUA 1CULB 3VVUA 2BABA 4M94A 2K1RA 3OTOJ 4N77A 1NDLA 2OIHA 4YQWA 2OTJS 2OPQA 4YB1P 1AW0A 4DG1A 1ZS6A 4I2QA 2DK2A 3KOAA 3P4UB 3R3TA 4OFZA 2PMHA 2R7XA 2R7SA 4LF4J 1DTQA 1TFYA 2GHPA 2OPQB 2XQCA 4NLDA 4I2QB 4PPZA 5IWAJ 3J7A1 4EU0A 5IC6B 2OKQA 4IH6A 4OI2A 5CZVA 1SL1A 1D1UA 2HFNA 4O4RA 1SC1B 2ZOFA 1FERA 2BEFA 3BF4A 2YPZA 3BJYA 3JB9k 2VG5A 1DTQB 1XMQJ 1HBNA 5E3RA 4IDKA 4JI7F 4MIBA 3B4MA 2ZC3A 2QLXA 1LEOA 3SMZA 5DETA 3RZAA 4QYRA 1YX2A 3GB0A 4FP9A 4F3OA 2QFIA 2VG5B 5HQMA 1HBNB 3MCSA 5AXMA 1EJ7L 4IDKB 4NASA 3JSBA 1RWVB 2IMWP 4C3LA 1NXIA 3NAHA 3SQGA 1WORA 4CNZA 2A6MA 2RDDA 4OHXA 1HHQA 1HBUA 2DNKA 1SC3B 2GS8A 1CBKA 3WHIA 2C2DA 4JP8A 2B4PA 2MPUA 2B4UA 2FIUA 3UFCX 3PRDA 2AJ2A 1EETA 2V8PA 3SCIE 3SQGB 2XI2A 1HBUB 3LTOA 3HX9A 4NLVA 3HKZD 3MPDA 3MD1A 1EETB 3CUNA 3BR8A 3HSJA 3BSNA 1RB0A 4JB8B 4LFCJ 2HRUA 4URSA 3K58A 4DF8A 2FLNA 3QNWB 2H9ZA 2IFXA 2YKMA 3CF5Q 4HTJA 1O8BA 4A8OA 2OH2A 4OZJA 3JAMU 4K4SA 3NGKA 3MD3A 2K3KA 3GFXA 1NO8A 3H2LA 5KAKA 1JNRB 2YKMB 1RTDA 3GV5B 4G1PA 4ZDNA 3DOMB 3MR3A 4J9RA 2WSCC 2HK2A 3LOUA 2DHGA 4R8UA 5GMKa 4N8NA 1HKAA 3PXGa 2UZAA 1AROP 5FIIA 4KPYA 3NOGA 2B6AA 4DR6J 2MLYA 2CJ9A 2C22A 1RTDB 4CZCA 5GAHU 3BPDA 1IKWA 3BGOP 4J90A 1T05A 4R8UB 2R8KA 2PMZD 2O1PA 4KH0B 4FXWA 4AT1B 4Y2CA 2B6AB 2QLBB 1TZ0A 4NLYA 4O3SA 2HZVA 1UTAA 2WVBA 3UCUP 1T05B 2MQNA 3T1YJ 2AEJA 4IR9A 2DHHA 1IR1A 3GONA 2OSRA 3BBCA 1MWQA 2BE7D 4P2XA 3PO4A 1YBTA 3TI0A 2BANA 4R0JA 1WSRA 3NS6A 3K8WA 2HRYA 2ZWOA 1S1XA 2ZNZA 5LL6d 1YLXA 3MPYA 2L3MA 3PR4A 2L41A 1SPBP 4WXOA 3PDNA 1UEKA 1IBLJ 2J0QD 1FVQA 1TKTA 2BANB 2BJ7A 3MMAB 3HK2A 4C0HA 2YWEA 4UY8T 1S1XB 4B02A 3J81j 2I38A 4N5SA 2QMWA 3F44A 4URGA 4RR5A 4F4ZA 2OEJA 3OTCA 2DR8A 3VQTA 4CLZA 1RJJA 4DL2A 1TKTB 3W5YA 4DFKA 1HMVA 2DNGA 3LO3A 1Q8BA 2ZVIA 3I9ZA 3CDAA 5K20B 1O0PA 4DLGA 2AZ3A 4PG4A 3RU0A 4ECVA 2GQQA 5KFTA 5F0UA 3WZ0A 3R8YA 3QJPA 1W7WA 4B3MJ 5IT0A 3BO4A 3CDEA 3UDEA 1NSKL 3DXSX 1URRA 3POTA 4J9QA 3GJTB 3K5MA 2ILYA 4U67Q 1VQMS 5SZTA 2I5JA 1PYOB 2VL1A 3CJQA 1VHIA 5B7WA 4FBUA 3TVKA 4IH5A 2UUCF 4PYDA 3OHAA 3POTB 4UT4A 2BKNA 2BV3A 3G4SS 1SJFA 3M8WA 2W1BA 3V6DB 4K0KJ 5K8OA 3G8QA 1M1KT 1BE4A 3L3CA 2EFPA 1JIHA 3ZTRA 3IR7B 4B08A 3NMAA 5E5NA 2RAQA 4OJHA 3QSIA 1R8PA 2Y1LB 2ATCB 1YTYA 3UN5A 2BQ3A 3S6EA 4DR4J 5C24A 2JLEA 2KM8C 1HWKA 2XMUA 3NP5A 1RI7A 6FDRA 3CJ8A 4YOEA 2VC1A 2P8IA 3D54A 4CO3A 2DPJA 4QR2A 2QV6A 4M5IA 3EGNA 4ICLA 1KOOA 4PG8A 1WWHA 5C24B 1RT5A 2MY7A 2HVIA 3I32A 4X84A 2KFYA 3C6TA 4WKRA 2GX8A 3FMWA 4GC6A 5BYQA 3JTNA 4H4MA 3O6QA 3BZQA 4ICLB 2VBXA 2YWFA 1M0SA 4IFVA 1QTMA 2AYMA 1N0UA 4EYIB 2UXCJ 1MMNA 3C6TB 4HR2A 1XMOJ 3ILLA 3ONQA 2H65B 2IA0A 4Q5VA 3V4IA 2IM1A 4H4MB 5D3GA 1RA7A 5D15A 1W2BR 2YWKA 5EDWA 2EBEA 4IFVB 3RR7A 4TLRA 4JI2F 3HD2A 1KLMA 4NZ7A 4J9LA 3FRZA 5GAGI 4Z7YA 3V4IB 2XI3A 1L3TA 1WHXA 2N82B 2F40A 1H2VZ 3E51A 3TA2A 1U26A 1VFJA 2QL7B 1GMUA 5D4LA 1URNA 1YRTA 1F5CA 2CNNB 4JOUA 4NCGA 1VBYA 1I3OB 5EX3A 1OY6A 4BLGA 1KLMB 3KK1A 2NXUA 2L48A 4QW8A 4DPUA 2FJXA 5DM7Q 4PCQA 1LWEA 5K9FA 4P6QA 4ECTA 1FXLA 4NCGB 1RHKB 4DV4F 3KG0A 4R5PA 1ELOA 2B51A 1UWAA 2YNIA 1FEHA 2JFKA 1HW9A 1EKSA 1LWEB 1N33F 4ZVHA 1VMBA 2GJIA 3DNCA 3W2WA 4R5PB 1NRKA 4P2FA 4DPXA 3QQCD 1Q16B 2YNIB 1VC0A 2K8GA 3R7NB 1FNXH 2GFFA 3OT9A 5KFBA 3RAXA 1B7FA 3PFOA 2CQDA 2R3VA 5BR8F 1FHTA 3ZFVA 2Q3PA 5ETVA 1IWAA 1JXEA 4ECXA 1ZTWA 3C8YA 4C0BA 5L39A 1QTNB 1C4AA 2J9DA 1HPZB 2LECA 1T95A 2LVWA 2EC2A 3E8OA 5ITHA 2QSWA 2H5IB 3D28A 4ZLNA 1N5VA 3PG9A 4O23A 1N5TA 2DGUA 1WG4A 1JJ2R 4NEZA 5KT6A 4DDFA 2ASJA 3PY8A 4JI8F 2DCLA 4ZVTB 2UVVA 1NK7A 5JVHQ 3FEYB 4B3RF 3IXQA 3BYRA 5A8RA 2V4QA 3TX8A 4NLUA 2WVFA 3RTVA 3RG6A 4E0DA 2G1DA 5HAOA 3R9LA 2J0XA 2WW4A 1VI7A 3GR0A 4RUHA 4USHA 5A8KA 2AX1A 4IRKA 5F8GA 4CI0B 2ASDA 1OY8A 4BC7A 1NNDA 2DH7A 3TUIC 3BREA 5HMYA 2RKIA 1NJWA 3CCLS 2W4PA 5A8RB 4YR3A 2EFQA 3H90A 5D78A 2D69A 2KXNB 2BUNA 2L08A 1HNVB 2RRBA 5A8KB 1M90T 3LP1A 1CC7A 3M8ZA 4B3SF 3F0NA 3TZYA 3BV8A 3OR2A 2UUBF 3EZOA 2GMLA 2H4YB 1FRHA 1VLYA 1X60A 1VQLS 1UMJA 2C3YA 3MECA 2IMOA 3LP1B 1X8DA 4ZIVA 2CQ1A 1QSYA 2F5GA 1A6LA 1TL5A 1NBEB 3OR2B 2J9EA 1N4LA 4KHPF 3RJMB 1TMJA 5KG3A 4L72B 3EMTA 3HP6A 1OJ4A 3MECB 3QATA 4CCHA 1G6BA 1YWXA 3PYEA 4DCJB 2FLPA 1S1TA 3C19A 5HLFA 1U2RA 4ETXA 3UE2A 3L7OA 4X65J 4ED5A 1S6UA 1DTTA 1U4BA 1TL1A 5AE1A 3MMCA 3I82A 1RT7A 2K7JA 1K1SA 4OJ1A 1CEZA 3EPGA 1SJ3P 3CULA 1S1TB 5HLFB 4LBPA 1DTTB 2R7OA 3H2VE 1TL1B 2DGXA 3PW2A 2XY6A 3MMCB 1DRZA 3OFHA 1RT7B 3CEDA 2OFGX 5GADI 3D6TB 2O3DA 2VJUA 4A4JA 3NWRA 2WONA 4DUYF 2VV5A 3E3XA 2ZOMA 2KXFA 2X1GA 2FPHX 3MXHP 4OX8A 3CT9A 2AZ1A 3AJ1A 2Z2ZA 4QR0A 3DRPA 2LQJA 2XZDB 2PA3A 4ZP7A 1VISA 4X4UA 3KLGB 4MTPA 3GV7B 2WONB 2MXYA 3SQOP 1L5UA 1RDRA 4ZHRA 3DRPB 1D3WA 5KT7A 3JYTA 3JSMB 4ZVUB 2G0CA 4E98A 5THWA 5KFQA 1F3VA 3N79A 4DX5A 4UY85 1R43A 4JI6F 3M8PA 4CT8A 1ZAXA 4NLGA 4LF2A 4ZHRB 2CJBA 1RSCA 2W8LA 1MROA 2XLKA 4QW9A 4RBVA 3FCHA 4AQYF 5B08A 1N32J 1NJZA 3GJQB 3M8PB 1HWLA 4Q2LA 1SJRA 4X62J 3P5BP 4H4OA 4A8FA 2F8HA 3D9BA 4DS5A 2GQCA 4DSIA 3K17A 1YQHA 3K5NA 3HD1A 1NPPA 1MROB 3OL6A 3VALA 3RRGA 1NKCA 3AJDA 3H98A 2ADCA 3OLAA 4H4OB 4OX9J 2DKOB 2QA1A 3W8GA 3KK3A 4QIEA 2ZZMA 4USKA 2H5JB 2ALZA 3KMSA 2H3EB 2OSQA 4NLPA 2AF6A 1IWGA 5CA5A 4NI2A 4DN0A 2QFJA 1PCAA 1HNZF 4M5JA 3HPOA 4F0HA 3KK3B 3IN5A 1X5OA 3LUYA 2KKHA 4K4VA 2E1CA 1Q82T 3BSAA 1I51B 2CQ3A 3FC9A 3NGRA 1CJTA 1YGYA 5DDRC 1NHKL 2HHUA 2E5GA 4NI2B 5IXUA 4PXDA 5AXLA 1R0AB 2XS5A 3FEZA 2CWXA 2NPIA 4ECZA 4C3KA 2V94A 1DJ0A 1Q78A 4EBEA 2DEIA 1CJTB 5CCMA 3KHHA 3IA0A 3TNVA 1NH7A 2CVIA 2ADBA 2DRBA 2ZM6F 2P9EA 4WJBA 2DJWA 2HVZA 3VVTA 1OQ3A 4NYPA 1CLFA 4M5HA 3GYNA 3CE8A 5MAOA 3H2UB 1I94F 3EM1A 2VG7B 3IRWP 1H7WA 5F9LA 3NY0A 3CMQA 4ZCKA 1GAOA 2XLIA 1FNOA 4WU2A 2KXHA 1IM6A 2IY5B 1FX2A 4YDXA 3LPYA 2A2CA 2W01A 2UU9J 1X5PA 4QYZK 1UPMB 5EN1A 2Z8QA 2YWWA 2WB4A 3ULHA 3Q8UA 5LJ3Y 2OHDA 1X4GA 4ZVOB 4RBTA 4NZ0A 2YQ3A 4B9VA 2Z57B 1GTEA 4TYAA 3ZZUA 3LGMA 2Q43A 3M2UA 3KYLA 1WD6A 1F5AA 2AYEA 1LW0B 1Y5LB 3BO3A 3MR6A 5D4OA 1NPRA 1U6FA 2MLZA 3ZZOA 3NGDA 1RE1B 5DG8A 3PO5A 3C6UA 5GAEU 3M2UB 3CCSS 4CLTA 5ETKA 2HK3A 1IN0A 4C8MA 2MKIA 4B3TF 4TQSA 2YKPA 5IM0B 4JV5J 4F2RA 5ADZA 4PWDA 4LQ9A 3C6UB 4J91A 5T7LA 1KLNA 3US5A 4J9SA 3DMJB 2XGQA 3NS5A 4CNYA 3K59A 4AL6A 4ZCIA 4OI4A 1S4FA 3GLJA 1IBKF 2OJ3A 2NSCA 4P10A 4LRAA 1RTIA 1S12A 2XHCA 1SKSA 3VHQA 4PWDB 1LW2A 1MG7A 5T7LB 2HFSA 5C42A 1XR6A 5L38A 3G8SA 3OFEA 1R27B 5LXYA 1G1XA 3TP2A 3IBCB 3NBPA 4FYDA 1RTIB 4CWBA 3JQJA 3DU6A 3IGNA 4AL5A 1LW2B 4CRJA 4DR1J 4DU7A 2ZUGA 2BJ1A 3FSXA 4KH1B 5C42B 2CG4A 2G13A 3MM6A 2CQPA 4NX9A 4K5RA 2DNHA 3UD4P 3FK4A 3N6LA 2LA6A 1MU2A 3NBPB 1H98A 1PYTA 1K47A 2DGSA 2XHWA 3MM6B 2N3LA 1QE1B 4H4KA 2ROPA 1WTFA 3V5RA 1TK5A 1KC8T 2E5HA 3G86A 1F6TA 3EGVA 4PAAA 4FZVA 2Q1LA 2ZH6A 2G0IA 4X4RA 4OYAA 2C3OA 4TLQA 1UCNA 2V2KA 3FFIA 4PQUB 4TY8B 1RCOB 4F50A 3DLHA 2XNRA 5J1NA 4W90B 4YHHF 2AGOA 4ENOA 2DR6A 4I6AA 4WP9A 3MR5A 3QJLA 3MOZA 5H9EK 3W65A 2VB6A 4ZPVR 4ELUA 3RW6A 4OYPA 4F8RA 2R8JA 2LXIA 3P8BB 2KRRA 2LCWA 2F7VA 2MGZB 1E6VA 4C8LA 3OTOF 4ZN3A 4TU7A 5F8JA 3VGTA 2QA2A 2ZD1A 2E9RX 1Y4ZB 1VRQC 2DCUB 2HIYA 3Q2SC 4NRTA 4P7TA 2RVJA 4LF6J 3DDIA 3HSGA 1O5JA 4WK3A 4FF2A 2ZDPA 3CJ0A 3ZC4A 4ED7A 3HT0A 5LMUJ 4ILRA 3VGUA 4O0IA 3I9V9 5IWAF 1IJEB 2ZD1B 1GMWA 1N5YA 2JHEA 4Y28C 1JLBB 4B9LA 4UUWA 1EAYC 3WBZA 2AJ4A 5ETOA 4IQXA 3Q2TC 1UW4A 2BVZA 2QLFB 2GJFA 4F67A 3KUHA 1YHQS 2D7SA 1XMQF 3FZ2A 2N4DA 5L9NA 2BE2A 4NLXA 1SCJB 4IG3A 2GHWA 1GEHA 2JVRA 2XY7A 2FVSA 5B0EA 2RHQB 1N5YB 3K5LA 1NDCA 3IWXA 1Z4UA 1D8YA 2NUUG 3JTPA 3K7RA 4EYHB 1AXQA 2BJ8A 2XG8A 4OZ0A 1WC4A 4K4YA 4LQ3A 4J5OA 2RQKA 1DZ5A 5J2MA 1U6ZA 2BE2B 4IG3B 1S0MA 3K0JA 4QPXA 2LDYA 1X9MA 1U02A 2FZGB 2GMJA 1VHFA 3OTEA 4F0KA 1KHWA 1S6QA 1FE4A 1VCTA 1CC8A 3OJSA 2IIHA 3HULA 1D9AA 2OMOA 4YR0A 2U1AA 2Y9HA 3LWMA 3B4DA 1T03A 1ZPVA 1KTQA 3SYZA 2E1RA 2LXUA 3VGSA 4RX6A 4CH0S 1NU4A 3PIOQ 3G2XA 3OJUA 1QAJA 1WEZA 5A2QY 5E7OB 3IAM9 4DX7A 1HIYA 3TQEA 3M8SA 1PJ5A 4ZOSA 2AJFE 4WCEQ 1JLQA 4PG5A 2BOPA 2X1AA 3UI3A 1HWJA 2VPXB 4A8XA 1JB0C 1WKJA 4QWEA 2HS0A 1DAXA 1YBUA 3W64A 1WG5A 2J6TA 1AZSA 4LMZA 4O44A 2NR0A 4FXDA 4CO1A 1JLQB 2YNFA 3IFEA 4RPFA 1VGYA 4X4PA 2VBYA 2CVEA 3R1HA 4WZMA 4KTQA 1KWMA 4NCAA 2C2NA 3D5MA 4OV6A 1AZSB 4O44B 3RRKA 5I3UA 2J7UA 5C2CA 3QFHA 2YNFB 1WTBA 3QIPA 1N5QA 4DJBA 5A6PA 4L76A 1NK5A 4P9SA 3N28A 2DR7A 4KBIA 5HBMA 3NNAA 3P6YC 5KG6A 3OVSA 1LWFB 2LLZA 2VFSA 2VD3A 2JX2A 3QIPB 4GKJJ 3PEHA 1IVZA 1HL6A 2HEKA 4M1KA 3J80Y 1JLGB 5HATA 1GH8A 4I6YA 3BB5A 4PG6A 2PE8A 1BLUA 1M5SA 1TMMA 5DZ7A 1H2TZ 1CQMA 3T1YF 5A0YA 2YX7A 1WSVA 3I87A 1HNIA 2DGOA 2BYCA 3ZTSA 2EFNA 2DO0A 1U6BA 2RB7A 2DR5A 3QT5A 2GIFA 2IVMA 2RUSA 2ZH8A 1J5EJ 2GAHC 4QWAA 2HRTA 1PAUB 5A0YB 3D3BJ 4A8YA 4EBCA 1HNIB 1UEVA 3Q23A 1JLCA 3DLEA 5EUHA 4DV4J 3T9NA 1VOMA 1IBLF 5KFWA 5L8RC 4PXCA 2I1RA 4C11A 5CYMA 1LWCA 5FD1A 2D9PA 2VF3A 2OD6A 2J76E 3G71S 2R7VA 3A3PB 2F4VJ 4WTYA 1JLCB 3DLEB 4F25A 2E7XA 3ZZYA 4I4BA 3WIVA 1K44A 3NWGA 2J7KA 1Q5YA 3DOKA 5CYMB 1LWCB 2XM3A 2JC1A 3UO0A 2PFDA 4ZVPB 2IM0A 1X0PA 1MWZA 2RD5C 3VAIA 3H7HB 4N47A 2RS8A 3VWSA 4DZDA 1S6OA 3RBXA 5HJYA 1IUJA 4UZBA 3EWGA 2QSFA 1JXVA 4Y2IA 3SFUA 2HG4A 3UN2A 8ATCB 1N48A 3FRYA 3DOKB 1VS3A 5AXNA 1RHUB 3I56S 4B3MF 1VQ5S 2F9DA 1JLFA 1QAYA 3W62A 3KUGA 2AJQA 3CJKA 2RNEA 4KGZB 2V8HA 4TKTA 1S5ZA 4I7FB 1RU2A 4HHJA 5KFCA 4OZ5A 4BC9A 1C1CA 1JLFB 3N6MA 4I2PA 3KJQB 3CJKB 3RB6A 3DN9A 3RR8A 2FJDB 2B0GA 2YY3A 3IG1A 1PYSB 4ED1A 2KZZA 5D0GA 5CCLA 4K0KF 2CQGA 3MEEA 2LEBA 4PQAA 5DGAA 2IJNA 1C1CB 3A8KA 1FJGJ 4ZLLA 3CC4S 4I2PB 4W98A 3TOQA 2HHVA 2MZQA 1NJYA 1K0TA 1UVMA 1REVA 3OUYA 1YJVA 2MJNA 2QC3A 2VHGA 3ET6A 1HQ2A 3MEEB 3UW1A 4DI6A 2J7WA 2MHEA 4DR4F 2UVUA 3MUVP 1IBMJ 2GHVC 4B3SJ 1S97A 3Q83A 3TAMA 3SCJE 2FY1A 1SKWA 1XR7A 1FK9A 4CLKA 3EGZA 2XY5A 4NL5A 1REVB 4QWDA 4DR7F 3R2CJ 3AD8C 1BQNA 4HH1A 1BY9A 1MMLA 3ET6B 1S99A 1AYEA 1ZTTA 4MT1A 3EZUA 2EC0A 2QA4G 3GIKA 4RW7A 1Y11A 1O51A 2HVHA 3OVBA 3TAMB 1RISA 4YFUA 4KV8A 1BQNB 4ZKAA 2ZH9A 2NS1B 3CCES 2X3DA 2CZVC 1SV5A 4A8QA 3OL8A 4K2JA 2BQRA 2UXCF 1M5KC 3H20A 1U7LA 4J37A 2B7BB 4KV8B 1PJ7A 3UPFA 1RHRB 5DG9A 4P2SA 2XYPB 5DGBA 1SV5B 3CGIA 1XEZA 2FTRA 3RAQA 3UWTA 5KFNA 1ZH5A 1DQ8A 2HNDA 5A76A 3CCVS 2YX1A 3GFZA 3M2VA 4Q2MA 1PG5B 2G2OA 1TKDA 3O5TB 1WF0A 4OHWA 4N56A 4TU9A 1FDBA 4DUYJ 4DQPA 4DV0J 3M2RA 2HNDB 3CDWA 1QAIA 4DUTA 3BN7A 4JI4J 3DLBA 3M2VB 2HS3A 1VK3A 2ZBRA 2MKSA 2X1FA 1RCXB 4LSZB 1F60B 2DH8A 3AA9A 2M4MA 4FXVA 4MH8A 2RQ4A 4GVLA 2QA4S 4DL6A 4LF7J 3M6VA 1D8ZA 4HH0A 4ZJQA 3M2RB 1RABB 2DGQA 1JMTA 3JTOA 3KTQA 2R4FA 5D0EA 1TK8A 1SXLA 1N56A 1PO6A 4ZCMA 3ZZZA 2UUAJ 2ZJRQ 2Z58B 2EI5A 4JI6J 3BQ2A 2A0FB 3VAKA 3SSSA 4HHHA 3BS9A 3RB3A 4OYBA 1NK8A 1NMEB 3A1YG 1YRXA 3KLEA 3OV7A 2VU5A 2DIUA 4J7CA 5B09A 1WEYA 2M2BA 4WWSA 3BR9A 2JEJA 5KFHA 1FD8A 2KM8B 5HVFA 1TTHB 1T9VA 3M9NB 4QCLA 5A8WA 2IRUA 4KHMA 3KLEB 2HQ3A 4X2BA 4O3NA 5F8NA 4USWA 2IM3A 1E6YA 4J9PA 5E3QA 2U2FA 3Q8QB 3M8YA 4U8YA 1UZDA 3QT8A 3EYZA 4KT0C 2NYHA 1FKOA 2KTQA 4C8NA 3C16B 2E7WA 3M6UA 5ETQA 1Y00A 4N8OA 1E6YB 2ZE2B 4MFBA 2YKOA 2QMXA 2KFNA 4RUAA 2IA6A 2JRSA 2YQ0A 2BOAA 1HA1A 5ETMA 3TEGA 2HLUA 4MKAA 1HNZJ 4ZP6A 2P6SA 1FT8A 1C0TA 1A0OB 4RU9A 4MFBB 4JV0A 4GC7A 1QD1A 4RL1A 1YITS 4FBTA 1KS2A 3CO0P 3M1VA 3P5TL 1I6JA 3SI8A 5LMNJ 3G6XA 4F26A 1C0TB 2APOA 4ID8A 3QGHA 1KVIA 1G4CA 1R6YA 1PIEA 4Z37A 2GVDA 5SUHA 1NSPA 2HGMA 3TANA 1T9WA 2JFDA 1NLKL 2EWHA 3M1VB 4ZVSB 3QZ7A 3JSRA 4F0MA 3VAJA 2E66A 3CJSA 1VLOA 4OZ3A 3BM7A 2GVDB 2IPOB 1IKYA 3TUPA 3MGJA 3RUBL 2YH0A 1A7GE 2GJ2A 4OIXA 3N4WA 3PCOB 4MKVA 1N6QA 4PWWA 5RUBA 2QE5A 2V8DA 4AL7A 2AQ4A 1IKYB 2HFZA 2IDEA 3BDEA 2DNLA 3MWBA 4I64A 3J7YI 3WX4A 4M5DA 2LKZA 3BSCA 1TU0B 4O0NA 3IWLA 2KYZA 2ABYA 3C3LA 2Q79A 2P2CB 1N6QB 4IQMA 2QGFB 1FEEA 2POKA 1K73T 5M2RA 4Q43A 4M5DB 1TV6A 1NKBA 4LFBJ 2O5DA 4EUVA 3NL0A 1OSDA 3DM2A 3HHKA 3NCPA 3R5BA 5HK4A 1U1KA 4YEAA 4A8MP 4IFYA 3X3UA 2LMIA 4QIWD 5IS2A 3VTIA 2WZ1A 2GVZA 4WBFA 3NCQA 4Q44A 4DFPA 1X9SA 1TV6B 3M8QA 4P7VA 1AB8A 4FDFA 1WOSA 3DM2B 2COLA 2FC8A 3MF5A 4QWCA 1RAJA 5B0GA 3K2YA 3CWJA 2L9NA 2LP4A 4RW8B 2VFVA 3V2UC 5DJBA 2XO7A 4ECUA 2GVZB 4HVZA 1RYRA 1XERA 2W4CA 3KG1A 1U8WA 3CCJS 2EPIA 1ZAWA 3M8QB 1ZZNA 1QJHA 2JOQA 3GCXP 1TK0A 1D0EA 3HHLA 3T6BA 2CKWA 1IBKJ 1ZYQA 1AA1B 4C8ZA 2C2KB 4KGVB 2XBPA 4RZRA 2MQOA 1C2PA 4I67A 4YB6A 1HFEL 2EEYA 5HN0A 1WF2A 3KJVA 1MN7A 3N6NA 5IT9Y 3KJNB 3KMQA 1B0VA 2Z4PA 3HHLB 5IZHA 2KYXA 3G96A 5J2NA 4DL3A 1N54B 3P45B 1ZM2A 4EBDA 3D6FB 3Q8VA 2BRKA 3J81Y 4KQZA 2GO9A 3W66A 3Q8PB 2IDLA 2ZFHA 4L3KA 1N32F 3KJVB 4CQ1A 4FNIA 3D1QA 2QL5B 2HHTA 3EE3A 1IM4A 4ES3A 2XSFA 5H1SV 3MMJA 1RADB 3VGVA 2QG9B 2MHNA 4PUOB 2OUGA 3NEKA 1YZ7A 1SJ1A 4LSNA 1ICEB 3K57A 4OX9F 3RW7A 1SI9A 3GIMA 3AODA 1FRLA 3MEGB 2NXEA 3ADAC 5JMNA 2MKHA 2R7QA 2BJEA 4DBQA 3CCUS 5CYQA 2D3ZA 2BW2A 3PJ9A 5KG4A 4LSNB 1R3NA 3FQKA 1PBUA 1VC6A 1ZBTA 4TVAB 2KT2A 1XC9A 2E1AA 3ENVA 1HI1A 2MKCA 3FSYA 2V67A 2HAIA 2HHSA 3LAKA 1RACB 5EX0A 3DU5A 4DV3F 5CYQB 1KVKA 4G1QA 1REGX 1ZZFA 5D8HB 5F8MA 1CULA 4CH7A 1J2VA 4DV6J 3W3SA 3HSDA 4OZLA 1RTHA 4J9KA 3FBCA 4LSLA 3NCRA 2KFZA 1S76D 2IJRA 3I5CA 4JBCA 5E2QA 4FYWB 4UUXA 2B9YA 4G1QB 2O66A 4B9MA 2V6AA 5I42B 3CJ3A 4TN2A 2EKNA 1RTHB 3TJ8A 3J7YU 1VK8A 4LSLB 3NGSA 3DRRA 1SVDA 1S10A 4RW6A 1OQ6A 4NXMJ 3BGRA 3OHBA 3OTDA 1WC0A 3DFEA 5DLGA 2KHCA 2PT0A 2W2PP 3TUZC 2Y8YA 3DRRB 2UU9F 2IRYA 3GG1A 5M2UA 4RW6B 5J1PA 4PWUA 3V81A 2LQ5A 4OLPA 3BGRB 2Q66A 1RAEB 1RXOB 1UJ4A 3QJJA 4UOCA 1SB6A 5T41A 5DLFA 1Q0NA 1UJ5A 3HHDA 1RP5A 1GT8A 2CQIA 1SKRA 4J9VA 3V81B 4JV1A 5B0FA 4K8RA 5F41A 2EBGA 1Q8IA 1FVSA 2FB0A 2NPFA 3C66A 4WFNQ 1U1LA 1S0NA 3V6JA 2HQFA 4OI1A 5EWEA 2XZWA 3NLCA 2W9AA 4M8LA 2W25A 1FRKA 1B4SA 3I0SA 2OO4A 1Q79A 5LOQA 4ES1A 2RJZA 2VKRA 2O67A 7FDRA 4JV5F 1K8AT 5L46A 2DNMA 3ITHA 1P1TA 3D6MB 3C46A 3HVRA 3I0SB 4DV5J 1UFWA 1WHYA 2EW9A 2WOMA 2VDIA 2ASLA 3LP0A 2XMKA 4F02A 4WIQA 4KGXB 5GMDA 3IR5B 2MSSA 3ITHB 2R7UA 5HMXA 3BSOA 3GU0A 2KJVA 3FNNA 1LFPA 4HEA9 5GVQA 1TAQA 3U7JA 2M0GB 3KNGA 4GVBA 4B17A 1SKUB 4HTIA 2WOMB 5CHCB 3V6HA 2R7RA 2YWGA 4E8UA 3LP0B 2UUTA 5AT1B 2Z2LA 3VZIA 4LF8J 2V2VA 1T02A 3DOMA 1LV5A 1XMBA 4DR1F 2GIQA 2D74B 3KLHA 4GVBB 1X0FA 4FF3A 4DV7J 1Q53A 1U47A 4DQIA 4ATNA 1JK9B 2OMLA 3EX7B 2SXLA 4X4SA 3GIIA 5CABA 4K4UA 3KK2A 4WYLA 2C1EB 2RILA 3LPEA 2Z56B 4P71A 3CCQS 2J6UA 4FS2A 2XMTA 2W7PA 3DRYA 3KLHB 3CCRS 1GMWD 2VFRA 1ZA2B 2VC0A 2LYVA 5D4PA 3IC1A 3JQMA 4EO8A 3KK2B 2QL9B 4KO0A 2CZ4A 1UAWA 5AE3A 1WKKA 1WC3A 1B0PA 3W5ZA 2UP1A 2ZKUA 4YB5A 2OLWA 2X3GA 2RUGA 1R8CA 2AEMA 2DHAA 3PVXA 3CSKA 1KDNA 1VQ4S 2HQIA 1LK7A 3RGIA 5K14A 4S0MA 2HS4A 2V5HG 4ZLJA 1VR6A 4KO0B 1FFSB 4F3QA 5E41A 3K8VA 4LFAJ 1VBZA 2FLLA 4U6PA 1NEEA 2YWHA 1KN6A 1GX5A 1X31C 3P3DA 3UN3A 3EXYA 2BMBA 3OTBA 2BDPA 5K14B 3MMAA 1BD6A 5HROA 2ZHOA 1N36F 4HI1A 1YJTA 5DQGA 1HI0P 5HL7Q 5AE2A 5C5JA 2UVWA 3E01B 3H40A 2AMCB 3IS9A 2ROEA 3AAWB 4MYTA 2CJKA 4LR7A 1TR0A 4W92B 2I0XA 3PRBA 1WACA 4K4XA 1WI8A 5HROB 5AXKA 5E3CA 3CJ4A 4IRDA 1U2FA 2HGLA 3IS9B 1QM9A 3P96A 4LF6F 2F4FA 1VQYA 2J8SA 2H5EA 4WFYA 2JC0A 2V2ZA 5LMUF 1T11A 4V1Ak 3FSIA 4OX6A 4B3OA 1S59A 2CQCA 2AD9A 5E3PA 1UFLA 3MM7A 5IQQA 3CIMA 5L1LA 3HVAA 4DCPB 1Q8KA 1XNRJ 2ZH4A 3MAQA 3A12A 4EI2A 2KT3A 2VQFJ 1T7PA 1TELA 4QPTA 3UQSA 2F8EX 2LEPA 2Z2YB 2D3UA 3DRXA 2EG1A 2Y1JA 5ETTA 3KUEA 3M9MB 2FVQA 2DHXA 1NZ8A 1UZHA 5C2GA 3T19A 4B3OB 3BGUA 4XDCA 2MZJA 3MM7B 1OMSA 1LXNA 4M95A 4K4WA 1KR4A 4HT7A 3W8PA 3B8HA 3HVTA 4C8YA 3A3OB 1JJHA 4DSKA 4PXEA 4DWIA 4HDGA 5BXIA 3R5CA 1B0TA 2ZH7A 3V6DA 1Y5IB 3DDNA 2WTFA 1PBAA 3HVTB 2VBWA 1KFSA 2XNQA 2YVSA 3ENWA 5J2QA 2ZC4A 4OYIA 5KFJA 1T9XA 3ZTPA 3QAEA 3ETOA 3HF5A 4DR3J 4CLYA 2EKYA 2GIRA 2XEXA 2MQPA 2ZNYA 5J1EA 1HQUA 5EWGA 5J2QB 5KFPA 1N88A 2HIQA 4FYXB 3QO9A 4HLBA 1RK8A 4ZPBA 4X4OA 3SCKE 5GMEA 3LP2A 2D3OR 5J1EB 4IOBA 1HQUB 1U25A 3HJFA 1WF1A 1K9MT 4DR7J 2G0JA 1NK9A 2RMLA 2RH3A 3QO9B 2Y1IA 1HR0J 2BRLA 1O6XA 5AJ3F 3RB0A 3AQPA 2DGTA 3LP2B 1FNMA 1X5SA 2F9JA 2DYAA 1FJCA 4DFJA 2UXBF 4HYKA 1XIQA 4C6AA 2NLWA 3HVWA 2IYGA 1M1GA 4TQRA 4CLFA 4RW4A 3DRSB 4F4WA 1PC5A 4FN5A 2ZH3A 2FGCA 4EFAC 4MKYA 4AD6A 1Q7YT 2V9WA 3MFIA 2LU1A 4LT6A 5K5MA 1YIJS 1YK9A 2HWHA 1S1UA 4GRSA 1WC1A 4ERDA 2KG1A 1UVJA 1FESA 5KT5A 4P74A 4RW4B 2R8HA 2Z30B 1RYSA 3SIPB 4GKJF 2DY1A 3NAIA 4ECWA 3SBMA 3THTA 4PYAA 2OPPB 3U27A 1X7VA 5A2QU 3I96A 1WJ9A 2YTCA 1S1UB 2HFOA 4NE9C 4YY3J 4ECQA 2RU3A 3G6YA 2DR9A 3PYDA 4GO7X 2W8KA 5KFZA 5HO4A 2OP5A 1KSPA 2MLXA 2HQGA 2QJ3A 1J5EF 2B56A 4LF1A 3FQLA 4JI0J 4XPCA 1AUSL 2DVIA 4GKKJ 3MDFA 4Q0BA 1R8HA 3AOBA 5J2PA 2BM1A 4LIWA 3CXCR 5G0RA 3TARA 1UW9A 3SXLA 2DIVA 1UETA 4V19X 4NMLA 4KSEB 2F4VF 2EK1A 2XCAA 1X9WA 4ZP9A 4KB7A 4Q0BB 4LF9J 3FUYA 5J2PB 3W61A 2VFTA 2ZBQA 2C2OB 5KG5A 5KT3A 1X4BA 4ID5A 5G0RB 2DGVA 1HPZA 3WC0A 4L74A 3U1MA 2VONA 1QY7A 2V68A 1VRUA 1RAOA 1B99A 4ECYA 5CYJA 3D0IE 1ZM3A 3M30A 3V4MA 4ID5B 2CQ4A 5EGYA 3R5AA 3J80U 1RAGB 5DQHA 1VRUB 3GILA 3G9CA 3Q0AA 4LVOP 4X66F 1FXDA 4CLLA 3D6HB 3M30B 3OL9A 5CZXA 4KIAA 1RU1A 5B0AA 2QZ8A 1QAXA 4WXWA 4Y34A 2B8QA 4FF1A 4IYQA 3A8JA 4DXLA 1NSQA 2NZCA 4JI3J 3BGFA 1NM2A 1V6HA 3EICA 4H4KC 5FLXY 3AHPA 1HARA 1W26A 1XNQF 2EFVA 2KG0A 1HNVA 4KE5A 2CAJA 5D4NA 2YNGA 1VQ7S 1MMDA 1Y10A 1FJGF 1VJQA 4OI0A 5KG2A 2W4DA 4F04B 1BMQB 3MZIA 4KJIA 5HI7A 1S72S 1X5TA 4IO9Q 2DISA 3PJWA 2BX6A 3RBEA 3CDUA 3BPSP 2YXLA 2CPHA 2YNGB 1OY9A 1B64A 1IBMF 1OYDA 2B4VA 2ASYA 1K1QA 4WYWA 4WE1A 2EK6A 3WQPA 1L3KA 4ED0A 4ANDA 1S1VA 1ZPWX 2K7KA 4ZCLA 2MMYA 4ETZA 3NS7B 3I6PA 3DLGA 4DHVA 3CCTA 1S57A 2NXCA 1J27A 5FDLA 1JXLA 1KRPA 4WE1B 2ZHBA 1U8SA 1FFWB 1TUGB 2NUHA 4DUZJ 4M5NA 2J5AA 1CJUA 1S1VB 1X4HA 3HSZA 3HZGA 5GAGU 2NQPA 3F73A 2IVFB 4M5GA 2CWKA 3DLGB 4KFBA 1KQSR 4DR5J 2HW3A 3FVYA 1KEKA 3M8RA 1DFDA 3D67A 5FDLB 2QTWA 1P9YA 1RT4A 3L4BC 1AFJA 5L1IA 1UL3A 1FWKA 3T6JA 2Y0SD 3ENQA 2ZVSA 3LANA 1CJUB 1ZAVA 3ZNJ1 4C9DA 3B6BA 4K4ZA 4DPTA 2NXNA 4J9MA 4KFBB 3WX8A 1WHVA 5KFEA 3UNGC 3I55S 2V50A 1RT4B 1F9HA 2AGPA 3DI6A 3W9IA 2J0WA 3SCLE 3KLGA 1MLAA 1JWWA 4FNHA 2HBRB 1BWEA 4DV0F 1F5BA 5K8MA 4CM0A 5F0WA 2WHOA 2BA9A 3H5UA 4JI4F 3DI6B 2CA9A 2F1FA 2IJFA 3BN4A 4O3QA 2V0NA 1S49A 3JSMA 3BH6B 2VQEF 2DT9A 3B78A 4RJVA 2F63A 3NOCA 4LF7F 1FRIA 2FJAB 4OHZA 5EWFA 4NOHA 4LF5J 4CTAA 4ED6A 1H3DA 2MZTA 2VFUA 4M5MA 3CC2S 3LGHA 4OLOA 4RLEA 2X7IA 2D9OA 2FZKB 2HBZB 3G6VA 2CNKB 3K5PA 1U24A 1RKJA 2UUAF 3MCOA 1PJ6A 1GMVA 2GV1A 5IQ6A 1KONA 4DV2J 1UJ6A 1KQFB 4CTAB 2DB1A 5KFGA 4X4QA 2V2QA 2KI2A 1WOOA 1HBOA 2RDJA 3QT7A 2J8AA 5KFRA 2P5VA 2RSQA 2ZH2A 4BS2A 4C97A 1QDUB 2UV8G 2CQ2A 4BDPA 3PEJA 2CPZA 2H48B 3GIRA 4K2XA 3OR1A 4N41A 4CM2A 5KFVA 3KLFA 1HBOB 2A10A 3UR0A 1YG0A 1QUVA 3V6KA 2WBMA 3A13A 1SIWB 2QLJB 3CD0A 2ZJQQ 3G82A 5I4MA 3MPUB 1PKUA 2V8GA 3QGPA 2HHHJ 2HVEA 1Q5VA 2K1RB 3OR1B 3UDLA 4R25A 1NHVA 5KT2A 1TVRA 3KLFB 4DG1B 2D41A 3AA8A 4MJKA 1T3NA 3PYGA 1VBXA 1VQSA 4QQBA 1FTCA 3SDEA 3G82B 2LA4A 2FJVA 2M8HA 3ICLA 4ITSA 5IOLA 4L75A 1R0AA 2OTLS 4LR9A 1Z2ZA 2LDIA 4I56A 2J9DE 4IH7A 1TVRB 2WB1D 4BWMA 5KOXA 1VQ6S 4HL9A 4X64J 4DV3J 3SDEB 1V3ZA 2ZHAA 1R0BG 3QFWA 3W63A 1HNWJ 3FZBA 5LMNF 4JUZA 4ED4A 1DHMA 2JEGA 4O3PA 1R6VA 3ZZRA 3TO8A 4ZLPA 3H8YA 3CD5A 1XBWA 2L9WA 2VG7A 1HI8A 3SSQA 3GJRB 7AT1B 2CRLA 5ETLA 2ZBIA 4WTOB 3VCDA 3KHRA 2IAJA 3KHLA 1QSSA 1YJ7A 1VQNS 3TZWA 2V4JA 3HHLD 2VPYB 4DV1J 4UW2A 1BXNA 1QUPA 5CH7B 4ZIWA 4RNOA 2IAJB 3PW5A 3JQKA 1RGVA 4YP3A 2Q6CA 3W2VA 2V4JB 1ROFA 3D7SB 4LBIA 1X4CA 3VAMA 1VQPS 2CJAA 1LW0A 2ZJPQ 1JJ4A 5IFMA 1PAEX 2R42A 5GADU 3CPWR 3DDKA 1G2EA 2EVZA 3EZ5A 4W4MA 2KVIA 3MHYA 3TYTA 4ANCA 3W2VB 2WRMA 3JS9A 4WPAA 1UWBA 2WAQD 2CQHA 4IUFA 1RLDA 4CT9A 4LFBF 4LJMA 4Y6IA 2KH9A 2F3JA 2F65A 2DITA 1ULRA 5IM0A 2M5YA 2E5LJ 2M9KA 1XTZA 4NLTA 3IRXA 2DNQA 1UWBB 4OYWA 2YH1A 3BKTA 2N7CA 3G6ES 3DMJA 1UP1A 3HZEA 2AYGA 1ZM9A 4EO6A 3AOAA 3QIDA 2VIHA 3QSYB 3GFYA 1V5VA 3R27A 2VH7A 4NPOA 3H5XA 3T5KA 3CDBA 2HVDA 2HYIB 4ZVGA 3IRXB 4OQJA 2H54B 5DM6Q 1EHWA 5HP1A 2HHQA 5CD4A 3TJAA 1RHMB 2MYFA 1SH3A 2DXEA 4BBYA 3UR3C 1Z2LA 2HMIA 1GX6A 5F3TA 4PXBA 1UA1A 2ILZA 3ZO7A 2J9CA 3THPA 3RB4A 3VV2B 1IKWB 2ZEJA 4WFBQ 2R2SA 4X4NA 5HP1B 2MEWA 3AQOA 4Q8FA 5H9FK 2M3DA 2B9EA 4IG0A 3GYXB 3S7RA 1TKXA 4G3IA 1H74A 2KDOA 4LBHA 2HMIB 1NB2A 1CVJA 3OQ2A 2ZKTA 1FKAF 1TUWA 3IR6B 3PM9A 4OZNA 3T3FA 3ZZPA 1DQAA 4IG0B 1H7XA 3LALA 1TKXB 1QE1A 4XIUA 1P8GA 1NAQA 1N0VC 1C4CA 2OEMA 2XMJA 2YKNA 2FQQB 1R31A 4WU3A 2V4RA 2OGUA 3KHGA 3HMJG 2DXDA 1X4AA 1XR5A 1WEXA 4H54A 2ZITA 2XULA 4DU8A 4PQUA 1XK8A 2FJBB 2C2MB 4TY8A 3ELHA 3FGVA 3CO9A 3HHEA 2YKNB 2FGOA 3AXMA 4MAKA 1BHNA 1FO1A 3AOCA 1RT3A 1VIOA 4M63A 2BXJA 2PA8D 4PRFA 3UD5A 3CJ2A 2RS2A 2VJVA 2JNJA 2HGNA 1I1GA 4AXIA 4EK2A 1HHTP 5I3PA 2CDQA 1HMVB 3RRHA 1RT3B 1VYAA 2JLFA 4JV2A 5LM7E 1Y0HA 1Q4RA 5KFFA 2JLGA 3MTJA 2MGZA 3PHTA 1JLAA 3WDOA 2B7CB 4DV6F 3FJ2A 2OI2A 3H5SA 2CNOB 1IKVA 4PABA 1FRJA 1N36J 3PNIA 2C2RA 5IT9U 2ZOGA 2RF2A 4Y0FA 2FDNA 4K7QA 2R8IA 1S48A 1JLAB 2AX0A 2O01C 4RNMA 1H38A 1HNXJ 2AU0A 5HANA 3J81U 1IKVB 1QVFR 2I5JB
chains in the Genus database with same CATH topology
5F9NA 1FDDA 3GIMA 1U1NA 1JLBA 3RYLA 2E29A 4XPEA 1OPIA 1FRLA 1HWUA 3MEGB 2UUWA 4ZHRA 2RF2B 1XMOF 1APSA 3DRPB 1D3WA 5LXRA 5KT7A 2MKHA 3TAQA 4NXMF 4DSFA 2R7QA 3JYTA 3JSMB 2BJEA 4DBQA 3CCUS 5CYQA 2D3ZA 2BW2A 2G0CA 5KG4A 4E98A 4LSNB 4F2SA 3EPIA 1S0OA 2I8EA 5THWA 4RNHA 5KFQA 1R3NA 1SJQA 3N79A 3FQKA 4UY85 2MQLA 1VC6A 2BACA 2VOPA 1R43A 4USJC 1ZBTA 4JI6F 2QO3A 3M8PA 4CT8A 7FD1A 1N52B 1ZAXA 4A47A 2WBRA 2JL9A 4NLGA 4FVMA 2KT2A 1XC9A 4C98A 4EGLA 2E1AA 2G9OA 2PDAA 3ENVA 4ZHRB 1HI1A 2MKCA 3FSYA 4CH1A 2CJBA 2HAIA 2HHSA 1K0VA 3LAKA 1P6TA 5EX0A 2IHR1 3DU5A 4DV3F 3NKYA 2W8LA 5CYQB 2OAUA 4G1QA 1PSDA 4IO1A 4DF4A 1ZZFA 2HNYA 1MROA 5BYSA 1UVLA 4LVNP 5D8HB 1W2IA 5F8MA 2C3PA 4CH7A 1J2VA 2XLKA 4QW9A 4RBVA 3AB4B 3W3SA 4F4YA 3FCHA 4AQYF 4WFAQ 5B08A 4OZLA 1RTHA 1NJZA 4J9KA 1RKIA 3M8PB 1HWLA 4Q2LA 1SJRA 2PO4A 3I4HX 3O44A 2WW8A 4KKOA 4LSLA 3NCRA 4H4OA 3D0HE 4USIA 2KFZA 4K50A 1S76D 3I5CA 4A8FA 4JBCA 2F8HA 3CD7A 5KT4A 5E2QA 2MKJA 4DS5A 3WC2A 2GCFA 2VPWB 2GQCA 4DPOA 4UUXA 3BDPA 4DSIA 2B9YA 2X51A 4G1QB 3MURP 1YQHA 2O66A 3K5NA 2HNYB 3H5YA 1MROB 3OL6A 4B9MA 4ES2A 3QZ8A 3VALA 4URQU 5I42B 3HI9A 3CJ3A 2YKQA 4TN2A 3T9ZA 3U1LA 1S77D 2I9SA 3RRGA 1NKCA 1RTHB 1HHSA 1S9EA 3J7YU 4OJGA 3OVAA 1VK8A 2V9KA 4KKOB 3H98A 4LSLB 2ADCA 3DRSA 5HMZA 4AYBD 3OLAA 4H4OB 2VKZG 2QA1A 4L6V3 3DRRA 1RT5B 3OPKA 1V9OA 3KK3A 2J6SA 4QIEA 1S10A 3QYYA 4RW6A 2ZZMA 1TAUA 4NLRA 1OQ6A 1GTHA 3BGRA 2ALZA 3KMSA 3OHBA 3OTDA 3R5DA 4RBUA 3DFEA 3IWNC 1FRMA 2OSQA 4NLPA 5T14A 3AY0A 2AF6A 5JVGQ 5DLGA 5CA5A 2KHCA 3CCWA 3IGVA 1S9EB 4Y2MA 1YJUA 4ILMA 1HBMA 4OI3A 2PT0A 1CSJA 1OWXA 2VUGA 3TUZC 4DN0A 4B9TA 2QFJA 1HNZF 3DRRB 2DGWA 3PW4A 2CPYA 4CO0A 2UU9F 3HPOA 2IRYA 4DV5F 3KK3B 3IN5A 3GG1A 5M2UA 4RW6B 5J1PA 1X5OA 3LUYA 2KKHA 1DURA 4K4VA 2OPPA 2E1CA 2WCXA 4PWUA 3V81A 2LQ5A 4OLPA 1FKPA 1SL0A 1Q82T 3BSAA 5LT5A 5KFDA 1KQGB 3BO2A 3BGRB 4EZ6A 2CQ3A 2FJWA 2Q66A 2JWNA 4QZVB 1SL2A 1UJ4A 4A8WA 3QJJA 4QU7A 5D3GB 4UOCA 1KNZA 2QRRA 4L3NA 1SB6A 5T41A 3DC2A 1HBMB 1R89A 1YGYA 5DDRC 5DLFA 2HHUA 2E5GA 2B4OA 1UJ5A 5IXUA 4PXDA 5AXLA 1R0AB 3HHDA 2XS5A 1RP5A 3FEZA 1GT8A 1IQTA 2CQIA 4ED3A 2NPIA 1SKRA 4ECZA 3V81B 2HNZA 4JV1A 1FKPB 4C3KA 2V94A 5B0FA 1HYSA 1DJ0A 1Q78A 4AFFA 2DNNA 4CO4A 4ZK7M 5F41A 2EBGA 4EBEA 1Q8IA 4LF8F 4J9OA 1FVSA 1H2UX 2FB0A 4O3RA 2NPFA 3C66A 4ED2A 2FVPA 5CCMA 3KHHA 3IA0A 3AJ2A 4HI2A 4WFNQ 5JXSA 3TNVA 1U1LA 1S0NA 1NH7A 2CVIA 2ADBA 3OL7A 2DRBA 2ZM6F 3V6JA 4OI1A 5EWEA 1CG2A 2P9EA 2XZWA 3NLCA 4WJBA 2DJWA 2HVZA 2W9AA 3I0RA 4M8LA 1OQ3A 4QBUA 2PFFB 4NYPA 5A8WB 3KK1B 1CLFA 2W25A 1FRKA 4DV7F 2HNZB 3GYNA 1ZOTA 3I0SA 3CMES 3CE8A 2R8GA 1HYSB 5MAOA 2MZRA 3H2UB 1I94F 5KG7A 2VG7B 3IRWP 1H7WA 1FDAA 5F9LA 4DR2F 2OO4A 1Q79A 4Q45A 1G3OA 4ES1A 4ZCKA 1GAOA 4YB7A 4DQRA 2RJZA 3LAMA 3THVA 1Q1KA 1CPZA 3VAHA 2VKRA 4BCAA 2O67A 4I1TA 5HQ8A 2XLIA 1FNOA 5D77A 3Q22A 1AUDA 1LWFA 4WU2A 7FDRA 2KHDA 2WSEC 3CC7S 4JV5F 1K8AT 1QLNA 2KXHA 3UDCA 2DNMA 4PR6A 4BHQA 3I0RB 3ITHA 4NLQA 4YDXA 1J5OA 1P1TA 4AE5A 3LPYA 4IOAQ 2FHJA 1FKOB 2A2CA 3C46A 3HVRA 3PJXA 3SZ2A 1X5PA 2CPIA 3I0SB 1SC6A 2CPJA 1UFWA 1V3RA 2Z2MA 3QWUA 1FE0A 2AP6A 5EN1A 2Z8QA 1JLGA 1WHYA 2EFOA 4CO5A 2WB4A 2EW9A 3ULHA 2WOMA 5DRKA 4Z2XA 5LJ3Y 2ASLA 3LP0A 1X4GA 4KR0B 2N4CA 2RQMA 2XMKA 4B9SA 4F02A 5F3ZA 1JX4A 1S79A 2XC9A 3IR5B 1D9FA 2MSSA 3NNCA 2HLTA 4DN9A 3ITHB 1J5OB 2CPFA 2R7UA 5HMXA 4RBTA 4MYUA 4NZ0A 2YQ3A 3BSOA 4K4TA 2E9ZA 3W2WB 2KJVA 4ZPWR 4B9VA 3FNNA 1LFPA 4HEA9 5GVQA 1GTEA 1TAQA 4TYAA 3ZZUA 3U7JA 2M0GB 2Q43A 3LGMA 3KNGA 1V3SA 3M2UA 4B17A 3KYLA 4HTIA 2AJ1A 1WD6A 1F5AA 2AYEA 5LSRA 1LW0B 3D1OA 2WOMB 1Y5LB 5CHCB 4DL4A 3V6HA 2MQQA 2R7RA 4NLWA 2YWGA 1NK0A 3BO3A 2ERRA 4E8UA 3D0GE 4KGKA 3MR6A 3HFKA 3TVZA 5D4OA 3LP0B 2UUTA 2Z2LA 3VZIA 2FUG9 4LFAF 1T02A 1U6FA 3ZZOA 3NGDA 3DOMA 1LV5A 2ZZNA 1XMBA 4DR1F 3LF0A 1PGZA 2CJQA 5DG8A 4ZVEA 3PO5A 1MNEA 2GIQA 3C6UA 3ISZA 2M88A 2D74B 2B9XA 3KLHA 1TL3A 3SV3A 1X0FA 4V19J 5GAEU 3M2UB 4FF3A 4TNOA 3CCSS 1Q53A 1C0UA 4DEZA 1U47A 4DQIA 3PHEA 4ATNA 1JK9B 3M9OB 2OMLA 1HWIA 2FD2A 3EX7B 4JI1F 1IN0A 2SXLA 5G4DA 4X4SA 1ZM4A 3GIIA 2I2YA 4K4UA 4C8MA 4WYLA 4ALZA 2MKIA 5KTQA 3KK2A 4B3TF 3LGNA 2YKPA 1C1BA 1RT1A 4QJVA 5IM0B 4TQSA 2VODA 2WSFC 2CYYA 4NYZA 1M5HA 2GGPA 3GWCA 2RILA 3N5BA 3CCQS 4F2RA 5ADZA 4PWDA 4LQ9A 4MK7A 2J6UA 3C6UB 5T7LA 4FS2A 2AJ0A 2XMTA 3DRYA 3US5A 3KLHB 2W7PA 1TL3B 2MDAA 3CCRS 1KLNA 2W7AA 4J9SA 2C28A 2VFRA 1SBRA 4XAKA 3DMJB 3GG0A 1C0UB 2ZH1A 1KQKA 2XGQA 3N5FA 3NS5A 1TUVA 2VC0A 4CNYA 3K59A 4AL6A 2LYVA 1GXUA 4ZCIA 1Y3JA 3LW5C 5D4PA 3IC1A 4JYAF 2OPSA 4EO8A 4OI4A 1S4FA 4X65F 4DS4A 5MLCV 4RKUC 3KK2B 1N34F 4KO0A 4ELTA 2RRNA 2CZ4A 1C1BB 1RT1B 1UAWA 4WKYA 5AE3A 1B0PA 1IBKF 1LOUA 2OJ3A 2NSCA 2GGPB 1RTIA 2UP1A 2CPDA 1SKSA 1RQ0A 2ZKUA 4YB5A 4RU2A 4PWDB 2E44A 2OLWA 1LW2A 1RTJA 2RIJA 4UQGA 5KFIA 5T7LB 2X3GA 2RUGA 1R8CA 4QIVA 2DHAA 4BWJA 3PVXA 3HHLC 5C42A 2M52A 1XR6A 3O1LA 3CSKA 2GNKA 5L38A 3G8SA 3OFEA 1VQ4S 1R27B 5LXYA 2XS2A 3ISNC 2HQIA 1LK7A 5DDOC 1G1XA 4DLEA 5K14A 2OPSB 4U9RA 3AH6A 2HS4A 2V5HG 2FHKA 4KO0B 3TP2A 1XNRF 1YJ9S 4F3QA 5E41A 3NBPA 1L3SA 4FYDA 3K8VA 1VBZA 4C7QA 1RTIB 3OFGA 2FLLA 3HM9A 1S7HA 4U6PA 1Q86T 1NEEA 2YWHA 3DU6A 3IGNA 2VPZB 2VQFF 1FJ7A 1KN6A 2RKIB 3OXLA 4AL5A 1LW2B 1RTJB 1GX5A 2HZCA 2PGCA 3P3DA 4X4VA 2ZUGA 3FSXA 3T1HF 3EXYA 3MM5A 1SJ4P 5C42B 2CG4A 1UKUA 2G13A 4I7FA 3MM6A 3VAGA 2CIMA 2CQPA 4NX9A 3OTBA 2YNHA 3L95X 3VAFA 4K5RA 2BDPA 5K14B 3O3LA 3MMAA 2DNHA 3UD4P 4EEYA 2IC3A 1BD6A 2MKKA 5HROA 2ATLA 2ZHOA 3M6XA 3N6LA 2LA6A 3KNAA 3ZZ0A 3HHNB 4WFXA 1MU2A 2MZSA 4J9NA 3NBPB 1N36F 4HI1A 1H98A 3PW0A 1LK5A 1YJTA 2BZ2A 4OZ1A 2G4BA 3TR5A 5DQGA 3UCGA 1HI0P 5HL7Q 5AE2A 5C5JA 2UVWA 3E01B 3H40A 2HPUA 2A3JA 2DGSA 2IVYA 3IS9A 2ROEA 3AAWB 4MYTA 4UQTA 2KN4A 4N76A 4FF4A 3MM5B 4IFYB 3D2WA 3J7Z5 1UA0A 4ECSA 2XHWA 3OXFA 2CJKA 3MM6B 1TR0A 2JH3A 4W92B 1ZETA 2YNHB 2IM2A 1BC6A 2I0XA 2JDJA 3PRBA 1WACA 2CPEA 3DGPA 4K4XA 1M5PC 2N3LA 3CIZA 2MB0B 2VOOA 2IC3B 1WI8A 4I6WA 1QE1B 5HROB 4H4KA 3EUNA 5AXKA 2ROPA 1WTFA 1F9FA 2IBKA 4K5SA 1NB7A 2RE1A 5E3CA 2A18A 3V5RA 1TK5A 3B82A 5C25A 1KC8T 2QYCA 1KVJA 3CJ4A 2XGPA 4IRDA 3PR5B 1U2FA 2E5HA 5CD4H 2GO8A 2HGLA 3G86A 2B3TB 5CQGA 3IS9B 1QM9A 3P96A 4FZVA 2Q1LA 2HHPA 2ZH6A 4LF6F 2OPRA 1VQYA 2H5EA 4X4RA 2C3OA 1KFDA 2CQ0A 4ELVA 4TLQA 4WFYA 2JC0A 2PI5A 2V2KA 3BEGB 5LMUF 2KT5A 3NRBA 3FFIA 4PQUB 3FSIA 4OX6A 3F56A 3T1AA 2DPIA 4B3OA 1JNZB 2CQCA 2AD9A 5E3PA 1HQEA 1UFLA 3MM7A 4TY8B 3CIMA 2RU9A 5IQQA 2OD4A 5L1LA 3HVAA 2JSXA 4DR3F 5C25B 4F50A 5DDQC 3DLHA 2XNRA 4DQQA 1SH2A 2C42A 4DMZA 5J1NA 1QVGR 2ZH4A 1NJXA 3MAQA 3KG4A 1RT6A 4ZVFA 6FD1A 4IOCQ 3CMAS 2KT3A 4W90B 1T7PA 4YHHF 1NZAA 2AGOA 4IKAA 4QPTA 2OPRB 3PV8A 2NSBA 2F8EX 4OV1A 3UQSA 3H4BA 1S9FA 1UVNA 2LEPA 1QSLA 2D3UA 3DRXA 2EG1A 2Y1JA 2BBEA 2LQBA 3M9MB 1F0XA 1N5SA 2FVQA 2DHXA 2M7SA 2JEFA 2V8VA 4I6AA 3MR5A 5D6GA 2J0SD 3T19A 4QU6A 4B3OB 2DNRA 3BGUA 3TRGA 4XDCA 2N3OA 2R9LA 1HQEB 2MZJA 3MM7B 1Q7LB 1VIXA 3QJLA 1LXNA 4WFZA 3MOZA 2XWYA 4U7CA 4M95A 2VB6A 4ZPVR 4X62F 4K4WA 4ELUA 3RW6A 1KR4A 1L5UA 4HT7A 4F8RA 2R8JA 1U48A 3B8HA 2LXIA 3VR1A 1RT6B 1S0VA 2P9CA 3HVTA 4B9U