1MWZA

Solution structure of the n-terminal domain of znta in the zn(ii)-form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new zinc-protein coordination site in intracellular metal trafficking: solution structure of the apo and Zn(II) forms of ZntA (46-118)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ZntA
total genus 16
structure length 73
sequence length 73
ec nomenclature ec 3.6.3.3: Cadmium-exporting ATPase.
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mwzA00
4OJHA 2CRLA 2IFXA 1P6TA 4OIXA 3HHLA 1AFIA 2BBEA 1FESA 1YJUA 2LDIA 2XMMA 2LQ9A 4OJ3A 5B0CA 4HI1A 1JWWA 1YJTA 1GXTA 1VQSA 2XMVA 1OQ6A 2OP5A 1S6UA 2GO8A 3I9ZA 1MWZA 3CJKA 1U7LA 4A48A 5B0EA 1TL5A 3QGPA 1KQKA 3BGUA 3LO3A 2W4DA 1Y3JA 1W2IA 4DL0C 3HFKA 4A47A 3BM7A 2AJ1A 4HL9A 1Y9OA 2OFHX 3HHLB 2N7YA 1TUVA 2GV1A 2HLTA 3VTIA 1CC8A 4DN9A 2GCFA 1FVSA 2XMTA 2HQIA 2K2PA 1N5TA 1SQEA 2PD1A 4HI2A 2G9OA 2HLUA 5A6PA 2K1RB 5A6WA 2ZDOA 3BN7A 4Q2MA 2ZDPA 4OJGA 2ACYA 3KKFA 1RJJA 1Y0HA 2QYCA 3HF5A 4A46A 1OPZA 1Q53A 2GGPA 5KAKA 2VV5A 2OKQA 3KG1A 2GFFA 3F44A 1FD8A 1VQYA 4HH1A 2ROEA 3T9NA 1X8DA 3BDEA 1XBWA 3WDOA 4A4JA 3KG0A 3FRYA 2FIUA 3HDSA 1X0PA 2BUNA 1CPZA 1AW0A 3IWLA 4NPOA 2KKHA 4U9RA 1Q8BA 2HFNA 5B0FA 1WD6A 1JK9B 2RSQA 2AJ0A 1ULRA 2XMWA 3LGMA 3KNGA 4OJ1A 2N4DA 5T7LA 3CJKB 2FHMA 3GZ7A 3LGNA 2K1RA 2BJDA 2OFGX 2ROPA 3UDCA 2RU9A 2LQBA 2N4CA 2QLWA 1KVIA 2IYIA 4NL5A 3E8OA 3QMQA 3MZIA 1V3ZA 2OD4A 4Y2KA 5K9FA 3BR8A 1IUJA 1SB6A 1FEEA 2HFOA 2XMUA 4ZOSA 4F67A 3TRGA 1AFJA 2PGCA 2RILA 1KVJA 3BB5A 1YJRA 1S6OA 2OAUA 1X7VA 2Q3PA 3BF4A 3HHLD 5IXUA 2AP6A 1FVQA 4Y2IA 1CC7A 1Q8LA 2QIFA 2JDJA 2ROGA 3HHLC 1GXUA 5B0AA 5B0DA 4ZA1A 3DCAA 1R6YA 1YG0A 3TOQA 2FTRA 4EFAC 2LXFA 1FE4A 1N5QA 2K7KA 2VH7A 2KT3A 5B09A 4YEAA 1QUPA 2RMLA 4QOTA 3IWXA 2W4PA 3FGVA 2GA7A 1LQ9A 1P8GA 1OQ3A 4DPOA 2KT2A 3HX9A 5B08A 3FMBA 2BYCA 2W4CA 1SI9A 1Y3KA 1YJVA 2AW0A 2XMJA 3K7RA 4FNIA 5T7LB 2IYGA 1TL4A 3DXSX 2FB0A 1N5VA 1TZ0A 3MCSA 2OD6A 4HH0A 4FNHA 4Y2MA 2QLXA 1YRXA 5F0UA 5B0GA 2BJEA 2ASYA 5B0BA 2L3MA 4YDXA 2KYZA 1FE0A 2GGPB 2OMOA 1APSA 1MWYA 2XMKA 1N5SA 5F0WA 2EW9A 3TNVA 4Q2LA 1K0VA 2K7JA 1URRA 2HIQA 1OSDA 1Q4RA 1TR0A
chains in the Genus database with same CATH superfamily
2CRLA 4QWEA 2Z4PA 5KG7A 3IBWA 3N01A 2IIHA 1F3VA 3W5XA 4LF8F 2FJDB 3HHLA 2CQ3A 4EWTA 2AJFE 4CP5A 4Q0BB 3Q22A 2YQ0A 2I2YA 5A2QU 1R8CA 3D66A 3FUYA 2LXIA 4PPDA 4WFXA 5C42A 4YY3J 3JB9k 2JRSA 1TFWA 4DR6F 1FDAA 5EHHA 2VHGA 2CPIA 2GNKA 4WP9A 2W9CA 1HD1A 2WW8A 1NH7A 1RDRA 2WSFC 4DV7F 3BPDA 3R5AA 4DFJA 1TTHB 2GIRA 2DXDA 2Q6CA 4CO5A 5DDRC 5E41A 2ZEJA 2XLIA 4JYAJ 1T9UA 5AE2A 2F4VF 2FHKA 2CPHA 3D1QA 3TZYA 1JLEB 2IA6A 3AD8C 1GAOA 2CJYB 2KYXA 2WVDA 4KGMA 1QTNB 2GV1A 1RTDA 1PC4A 5GAHU 1NK5A 1PO6A 2VFTA 3CNQP 3MEKA 5A0YA 5L9NA 5ADZA 3CC4S 3UN3A 4PG4A 2WOMB 1RCOB 2B4VA 3AA9A 2VD3A 2CJ9A 2EK6A 4LVNP 3OL8A 2BKPA 2PN6A 3RZAA 5E5NA 4LR7A 4CO4A 2DR6A 2ZHAA 3KKFA 3MM7B 2UXDF 1N52B 1Q53A 2GGPA 1NH8A 2P9CA 2PIIA 2FVSA 1CQMA 3W62A 1UAWA 3CJSA 2QSFA 3MEEA 4KH1B 3KLEB 2C2EA 1Q16B 3VGTA 1X0FA 4LFBJ 1SQFA 4ES1A 2COLA 2MHEA 1FT8A 2X3GA 4WFYA 2FIUA 3FMWA 1KLMA 1H2TZ 1O5JA 1ZPVA 3M30B 3QQCD 4PZVA 1FTRA 5IC4B 3UVJA 1QAXA 2AYMA 1Y5NB 3IG1B 3LGMA 4LRCA 3CJKB 5J2NB 1C2PA 1U1OA 2IRYA 2OFGX 2G0CA 3QYYA 2VF3A 3MURP 2QJ3A 5ITHA 2N4CA 2RQ4A 4K59A 1LK5A 3M8PB 2RH3A 4ZP8A 2V8HA 2VFUA 1HA1A 1KONA 2IAJB 3PHTA 3D68A 5EUHA 1KVIA 1T94A 2Q43A 3HJVA 3SFUA 5LL6d 4YS2A 2ZFHA 3L95X 1BQMA 3HK2A 4MJKA 4TQRA 4LSNA 4L75A 4O3PA 2X1BA 2RQMA 3ITHB 1PSDA 3CCUS 4J9RA 2DGWA 3OSPA 5DRKA 5HBMB 4DR1J 5DLFA 1WF0A 1RAFB 4OHVA 4LRBA 2D7SA 2M88A 4I6YA 3WC0A 1RA7A 2ROGA 4P74A 3GILA 1RT3A 3WIUA 2JC0A 2O1PA 4TYBA 4ZA1A 3FQLA 4ECSA 1FRLA 2VBWA 4IG0B 4OI3A 2UUBF 1U8SA 4NI2A 3QRQA 4EU0A 3SDEB 2HNDA 2QA2A 4J5OA 2YKNA 4L76A 1S4FA 2BJ9A 2X3DA 3A8IA 3UO0A 1UCNA 2EBEA 3MPUB 5DLGA 4DUYF 1EETB 3W3SA 4JI6F 2F8MA 1RWXB 4ALZA 4JV5J 2YVSA 4OYXA 5DS7A 2P6SA 2FJEB 1H6KX 3GSDA 3PDNA 4N77A 3KMQA 5BR8J 2W2MP 1P1TA 2QLFB 2RJZA 1S9GA 1HI8A 2MQNA 2HW3A 2D9PA 4KGKA 2BKOA 4FYWB 2W7PA 4FNHA 4CNYA 1GH8A 2H51B 5CD4A 2BJEA 4IFYB 3T6BA 4DFPA 3DOMA 2BJ1A 1Z2ZA 3DM2B 3ZTRA 1O6XA 1HPZB 2XI2A 1IR2A 1MMLA 2XWYA 1VC0A 1DQ9A 3BYRA 3RAMA 5M2UA 3G71S 3HHKA 2K7JA 3JTPA 3BJYA 2QL9B 1OSDA 1RTIA 1TKXB 3NLCA 1JLGA 4WPAA 4U95A 2V0NA 3I5CA 3OTDA 4DF8A 1TL7A 1DLOA 3R5GA 5D6GA 5C5JA 3OL7A 3LQVA 4KIAA 1P6TA 1R31A 3DLHA 3D0HE 2E29A 3M2VA 1S1UA 3OHAA 1JJ4A 1AB8A 1W25A 4USHA 4UUWA 3MR6A 1YJUA 2B3TB 4HDGA 3SQGA 4B3SF 4OJ3A 5HANA 4G1QB 2LDYA 1Z2LA 4KBIA 4EO8A 1NM2A 1QD1A 2WVEA 3D28A 3OR1B 4Q5VA 1OQ6A 2UUWA 3N5BA 2DNPA 2R7XA 5L1LA 4YDDB 4C8LA 3GFZA 4ZVTB 1FEHA 3CE8A 2EPIA 2PC6A 3BN4A 1RT2B 1HIYA 2EBGA 3H40A 1BC6A 2HK3A 4DL3A 4F4KA 3BGRA 3KK2A 3M9MB 9RUBA 2QE5A 1XMBA 1AZSA 1Q81T 4ECRA 1OIAA 3DRRB 4KV8A 1H2UX 1GNKA 2OO4A 3ZNJ1 4IH7A 3CCES 3V2UC 2C3PA 1WI8A 2HVDA 1U09A 2CQ2A 2EFGA 4M8LA 4WP3A 5J1PA 4P75A 4USWA 2ATLA 3TQ1A 4DUTA 2MKYA 2GO9A 2C2ZB 4ZPTR 3FSYA 5AXMA 1RJJA 2JEFA 4XTTA 1Y0HA 2ZC3A 1U1NA 1M1HA 3GYXB 4M5DA 4DZDA 2FJWA 4C9DA 3CCLS 3NNCA 2DH8A 2QMWA 1K8AT 4J90A 1BMQB 2CZ4A 4RUHA 4MIWA 3DOLB 4URSA 4H4KA 2J0SD 2ERRA 1JXLA 4LF9F 2B43A 4ID8A 5HJXA 1RT5B 2B5JB 4OYOA 2ZBIA 2AIRB 1S0VA 1UA1A 4NLXA 4Y34A 3JSRA 2DNYA 4J9OA 3OLAA 3N6NA 1X9WA 3HFZB 3UDLA 1IR0A 1N0UA 1UEUA 2H65B 1RYSA 1IUJA 2HFOA 1BE4A 4B9MA 2V2VA 3NOGA 3AOBA 4DV3F 1UMJA 1AFJA 1WF1A 4ZVQB 2QGFB 5KFVA 3RBEA 3OJSA 4JI7J 2Q3PA 2AYBA 3HHLD 2V6AA 3NNHA 2ZZNA 3GG0A 4RW4A 1HQUB 2B6AB 3QT6A 3TZWA 2F7VA 3D6MB 4LF4J 4B9SA 3MTKA 4TNOA 4OHZA 2ZKUA 3ENQA 2IHR1 4FS1A 3D4JA 2RF2A 1C0TB 4ZVPB 3M7VA 4DL4A 3SCKE 3IN5A 1NDCA 1R3NA 2XSFA 3PTWA 4KGXB 4PXEA 3R9LA 3BKTA 2IDLA 2CPEA 4ED7A 2DRDA 4WP8A 1AUSL 1RA6A 3KLIA 3JSBA 3H4DA 3R8YA 2GJIA 3FFIB 1CG2A 2X1AA 1REVB 4B3OB 4CO3A 2WBMA 3PJXA 4HEA9 3MCSA 3VR1A 4Q44A 4NZ6A 1RBOB 1QTMA 3EX7B 1RWMB 3DRRA 2E9ZA 4RUBA 4B9TA 3IXQA 1Q8IA 2V8VA 2G2YA 4Q45A 3FFIA 1IBMF 4ID5A 2DD8S 4QYZJ 3DYAA 1OY6A 3HZGA 1GMVA 1IJFB 4N76A 4URQU 1X9MA 2EW9A 4B02A 1RWPB 2HFUA 1KWMA 3VALA 5D3GA 3OFEA 1SUQA 2OUGA 2Z8QA 4IG3B 3ICLA 4DLGA 2GZOA 2NZ4A 1DURA 3D54A 2YWEA 1U48A 3ULHA 5L1KA 3W8GA 4ECZA 4DR2F 1TELA 1U6ZA 2V4JA 4OIXA 3QRRA 1VBKA 5D3GB 4X66J 3E2EA 2VPXB 1U25A 2GIFA 2RDDA 1W7WA 3D9BA 1JKHB 4QWAA 3K58A 2ZH5A 1KQSR 1JWWA 4KPYA 3AHPA 3SYZA 3OXFA 3EVMA 3CUNA 4LFCJ 3CJ3A 4PUOB 3TI0A 5E3AA 2Q66A 3IGNA 3GYNA 2R2RA 3CD0A 1R8BA 3LP0A 3CD5A 2E5GA 2I9SA 3BGUA 5KT5A 5JVGQ 3ISNC 2GHPA 4JOUA 3U1MA 4DX6A 3R2CJ 1TL1B 2W2NP 2R2SA 2HBQB 3VVUA 3KYLA 1ZH5A 3MTJA 4JI0F 3MMAA 1FDDA 2GMJA 3OTCA 2HQDA 3Q24A 4YMEA 4GKKF 3DLKB 5KFGA 2R7UA 3UCGA 2XGPA 4GVBA 5HROA 1YJNS 2K1RB 3HI9A 2Y9HA 3FBFA 2DHSA 2APOA 2HSEB 2W9BA 2NS1B 2J0XA 2HHTA 3FRZA 1VQ6S 3M2RB 4IOAQ 3RB6A 1ZBTA 2VASA 5ETQA 3DLBA 2GJFA 3T1AA 4EMDA 1N33J 5DDOC 4KKOB 2MKJA 5FLXY 1V3SA 4CO2A 2FHJD 4YQWA 3BDEA 1VQ5S 3NEKA 4B3TJ 2RVJA 9ATCB 1IWAA 1RWKB 5KFFA 4V19X 3WX8A 4ZVFA 2KZMA 4GVLA 1CJVB 2CJQA 2C3YA 5KT7A 2HZVA 2MJUA 4YN3B 1LWEA 3NXZA 3SDEA 3SSQA 2BJDA 2ROPA 2BMBA 2CVIA 4P73A 2ZUGA 4OZ1A 4CM2A 2UUAF 3MM6A 1K73T 2ATCB 5C25A 2OD4A 1VHIA 3NP5A 1FRIA 4OHWA 4EI2A 1F5AA 5K8MA 3J81U 3PIOQ 4EYIB 1X4AA 1K44A 2GJ2A 2DGUA 4Y00A 1UFKA 1YJRA 2CKWA 4UOCA 2CQIA 2M4MA 3FC9A 5GADI 1SUQB 3H7HB 3DHXA 1CJKA 2EEYA 5A0YB 4YHHF 3O5TB 3R5CA 3P6YC 3M8SA 2UVRA 3KJVA 3HHLC 2XM3A 2ZH6A 3T1HF 1M5SA 1NLKL 1N33F 3A3NB 1YJWS 3AJDA 4FF3A 4X4UA 3BPSP 2W9CB 2EKNA 2K7KA 2XZTB 5IC6B 4O4GA 5HAOA 4L72B 1LXNA 1HPZA 4JV2A 3RAXA 2C42A 2QSWA 3G86A 1PYOB 5HL7Q 1RT1B 5AXLA 2HEKA 4C8KA 2KL8A 4U67Q 3O1LA 2JLGA 3LTOA 5L38A 1UEVA 3X1LB 1X9SA 1AA1B 3ETMA 3HKZD 1RAOA 1C4CA 3IM8A 3QPIA 4DU8A 4ZHRB 3QRPA 4DR4J 2E7VA 4EBCA 4F26A 1C0UA 2OPRB 4MK7A 4NLYA 4UUXA 4L74A 1CULB 3BBCA 1HNZF 1K1QA 3FKBA 1ZZFA 5KG6A 4C8YA 3I32A 1T9YA 3O6QA 3PRBA 1EB0A 3BQ2A 5B0GA 1Z4UA 5CYJA 1S0MA 2UXCF 4DR3F 3CB4A 5L1JA 5CXTA 1IQTA 5DM6Q 1GK8A 1WG4A 3LANA 3TA2A 2GGPB 2YNHA 3M1VA 1MWYA 1S1TA 4BWJA 4X4NA 1ZM2A 3ZC4A 3UR0A 1BWEA 2XWXA 3IRWP 4TU7A 1RP5A 2FC8A 1CS4B 1NAQA 2QO3A 2B9YA 3MOZA 4QR1A 3PIPQ 5B7WA 1BD6A 4IG0A 1QM9A 4LRDA 1RLDA 5LXYA 4FF2A 3KOAA 5LT5A 4OX8A 2Y1LB 2AGQA 1N36F 4PQUB 1XEZA 4ZPBA 5CHCB 4NYOA 5H9FK 1FRJA 2DGQA 1AT1B 4OZLA 4ZVGA 2V9KA 2LMIA 2OPQA 1CVJA 2FC9A 2DY1A 3T1YJ 3CDAA 3CIZA 2L9DA 4C6AA 4NI2B 3RYLA 3OXLA 3CPWR 4WYWA 4DUZJ 4MIBA 1VJQA 2AHOB 1KBRA 4JV5F 3FEZA 5GVQA 4CLKA 2IVMA 5BXIA 5C42B 3E51A 5H1SV 2ZZMA 1ZOTA 5J2PA 1KS2A 1SV5A 4BC7A 4J9SA 1UVJA 1WF2A 2EC0A 3HHLB 1QE1A 3UN2A 4X4RA 1HI0P 1HNVA 1WKLA 2WZ1A 3L7PA 3CSKA 2YKQA 3WQPA 3DLGB 1YSJA 2Z2ZA 5J1NA 3A3OB 6FDRA 1ZTWA 4OLOA 3H42A 4OYZA 2OSRA 3DRYA 2C2DA 1RHUB 1JNZB 4Y65A 2HHHJ 3KK1A 1F0XA 2VFSA 3O44A 4GO5X 4Q2MA 4EUVA 2M3DA 3HSZA 1S99A 4NOHA 4OJGA 1OPIA 1SIWB 3VGUA 4O4GB 3HF5A 4XPEA 4FXDA 5KFYA 5KAKA 3A1YG 2U1AA 2OKQA 5DO2A 1SL2A 4Q7AA 1F3FA 4JI3J 2AX1A 3WIVA 3ENVA 2BEFA 4XK8C 3D3CJ 4A8OA 1HNXJ 2ALYB 1WKKA 1U4BA 3HSDA 3WDOA 1RTIB 1X4BA 1HWLA 4I0WA 2KM8B 4DV4F 3LOUA 1RKJA 1X0PA 2NXNA 1WDDA 3IWLA 5L9XA 2KKHA 5KT6A 4NCGA 4ZKAA 4ENOA 4OJ1A 4DSEA 1BWVA 2K06A 5IWAJ 5IZHA 1S1UB 1YRTA 1WORA 1Y00A 4ED4A 3SQGB 3AT1B 2CQHA 4NYPA 5KG5A 4F50A 2KI2A 4G1QA 4N5SA 4MFBA 3MHYA 4NL5A 3MM7A 4XAKA 4UQGA 1JLBB 1ZETA 2VL1A 1TL7B 6FD1A 3G96A 1NCLA 4QPXA 1A7GE 1VQNS 1SB6A 2BXJA 4WWSA 3V4IA 3HO1A 4NASA 2O5DA 2IC3B 1F9FA 4X62F 5LMNJ 2POKA 1MW7A 3OTBA 1WDTA 1PIEA 1QAYA 3CULA 4Z2XA 2GVDB 1GXLA 4OX9F 1BQNA 1S1VA 4HACA 1FI4A 1IR1A 2AP6A 1RAIB 2MKHA 3SV3A 4YR3A 1S10A 3W5ZA 2ILYA 3W63A 1Y7PA 5AE1A 2AQ4A 4JI3F 5EN1A 1U24A 2AJ4A 4NLUA 4RKUC 3H5YA 2ZJPQ 3MM5B 3NGSA 4LR8A 3DU6A 4RW6A 2A6OA 1NK8A 2UXDJ 3MAQA 1BLUA 3GR1A 3T9ZA 3DFEA 1ZA2B 3TJ8A 1KLNA 2BE7D 2OMLA 3G82A 4EZ9A 3OVBA 3BKUA 1PJ7A 1C4AA 3MEGA 3UD5A 5CCMA 5M2RA 4M95A 3P45B 4WU2A 4DPWA 1H73A 1VQOS 3D6TB 3NKYA 3H90A 2VQEJ 1YWXA 1FA0A 4RPFA 2H9ZA 2CJXB 1AYEA 2NZCA 2ZZTA 3VGSA 4BC9A 2ZHBA 3MGJA 4FYVB 4B3SJ 1JX4A 2PMWA 3OTEA 1LFWA 4ZVRB 2KHCA 2KFYA 1VRUA 4PCQA 2R8HA 3CEDA 1KDNA 2C3UA 2Y1JA 1NO8A 5GAEU 3QGIA 1NK4A 1SC3B 1F9EB 3QWPA 2VIHA 4ELUA 2L3MA 2PE8A 2LP4A 2OEKA 2YKNB 3EWGA 3F0NA 1QJHA 4CNZA 2J8AA 3HD1A 3CMAS 4ECYA 1LK7A 1KOOA 3R97A 3QSYB 3MPVA 5D4PA 4U7UD 1S5ZA 4NLSA 3PYGA 2MYFA 3AH6A 2L08A 4HHUA 3CCVS 1S7HA 1H72C 4C3MA 4MH8A 3EJMA 2BJ8A 1EQMA 3FZ2A 4OZ0A 3LW5C 4J9NA 1NSKL 1TVRB 1WC1A 1L3UA 5CH7B 1XIQA 1IKYA 4PWDB 1FK9A 4C3LA 2GVZB 1FXRA 4H4KC 3TEGA 1J27A 3M8YA 2DR8A 3C66A 2AEFA 2DGOA 4GC6A 1W2BR 4O44A 1GXTA 1VQSA 1T03A 1VHFA 1D1UA 3MECB 3BQ0A 2X51A 3AD7C 3BEGB 3TVZA 2UVVA 2C2MB 4C8OA 4K4UA 4YB7A 2R8KA 4C8NA 2HHSA 1OYEA 3IS9A 2Q1LA 3ET6A 5I4MA 1X60A 1TL3B 3LPEA 3VHQA 2ZUAA 5HVGA 3VCDA 4ZLPA 3PYEA 2NUHA 2MKIA 2SXLA 1N5YB 2VG7B 2KJVA 1MG7A 2Z0GA 1NRKA 4ELVA 4ICLB 2VG5B 2IC3A 3VAJA 3QFHA 2YNIB 4OYMA 1RE1B 4E0DA 1UZHA 3DDNA 1U1RA 2GVDA 2G13A 3DDIA 5KG3A 2PA8D 2QA4G 2KRRA 2V50A 4QIWD 4OX7A 1N5TA 3MR2A 2GW8A 1HNXF 5T41A 1FKOB 4Y2AA 3I55S 2FLNA 3T19A 3Q2SC 4X64J 1WHVA 5MAOA 1I1GA 2D41A 4HVZA 3OSNA 2V2KA 4DQRA 2PSZA 1S76D 4AXIA 3G6XA 2ZE2B 5EWEA 1NPKA 2OSQA 4DV2J 2B8PA 3K5OA 5J2QA 1N88A 2G0IA 2I0XA 2F40A 2KB2A 3POTB 4DR7J 3PO5A 1XBWA 1OY9A 2EWHA 2HHPA 4RU9A 2AEMA 1QLNA 2RS8A 2H3EB 2HPUA 4CM0A 2XGQA 2XY5A 4RNFA 1BHNA 6AT1B 3PW2A 2XMWA 3NGUA 2UUCJ 4O3RA 3MXHP 2FVRA 2E7WA 3I56S 2V8GA 2N3OA 1LV5A 4W92B 4FP9A 3CJ5A 4KGVB 4FN5A 2BM0A 2QYGA 1SCJB 2YWFA 3DMJA 1YVFA 4Y2KA 4RW9B 3BR8A 2E66A 3MMCB 5D78A 4F25A 1FEEA 1SH2A 4I7FB 4ED6A 3RAQA 1UVMA 2BVZA 2ZNZA 2XB2D 3OFGA 3I5AA 3GIJA 5K5MA 4ETXA 2DH9A 3M4XA 4KGZB 1G3OA 1HBMB 3BF4A 4CLLA 2J9DA 1C0UB 3DOLA 2OEMA 1HW9A 1DBDA 1FD2A 3K5NA 1FNXH 1DJ0A 1ZM3A 1K47A 4K2JA 4M5LA 4WXWA 4AT1B 2JDJA 3E01A 3Q89A 1GXUA 2VQFJ 2HHVA 5HMXA 5HQLA 4LF8J 2NXJA 3QGHA 2VH7A 4QW9A 3V81A 4DV6J 2ZM6F 3UR3C 3L3CA 4O44B 3FBEA 5F8MA 3MD1A 5J2QB 3CO0P 4RNHA 3FK4A 3DNCA 1HBUB 3KHGA 3AQOA 1R0AA 5DDPC 2QX0A 2BQRA 1N6QB 3N6LA 3C15A 4PRFA 4DCJB 4QWDA 3NMRA 3PEHA 4FDFA 2RB7A 1VR6A 3BREA 3DC2A 2JFDA 2H5JB 4C4WA 1DTQB 5I3UA 1N5VA 1RLCL 3GV8B 1RBAA 2ZH3A 2DNHA 2ABYA 3A8EA 4GRSA 4HH0A 4Y2MA 1GTEA 3M2UA 5F0UA 3WX4A 3BH7B 3J7YI 3NNAA 1T9TA 2MZTA 1S0NA 2CQ4A 2XYGB 4DR1F 3Q83A 1KD1T 4RW8B 2VQFF 1D9DA 4OZ3A 5DJBA 4KFBB 3V6KA 4V1Ak 5KT3A 1J5EF 3M8QB 2AZ3A 2N82B 2KRBA 4JI0J 3MM6B 1RKIA 1FERA 5E33A 4ES2A 1Q1KA 1VI7A 5KG1A 3OJUA 4IQXA 2CADA 2W1BA 1MNEA 4A8KA 1VLOA 3DYAB 4C8MA 1AXQA 1RTJB 4JI8J 2MY8A 1RTDB 2YKAA 1XR5A 2F1FA 2BJ7A 2XMMA 2BZ2A 1HHSA 2ZOGA 4HI1A 1UEKA 1OSCA 1S6PA 2EFQA 2W25A 4LQ9A 4BWMA 4K4XA 3BO4A 1JLEA 2OTJS 3EDRB 5E0OA 3GLJA 1U0SA 5F9NA 4JI1F 4UY8T 1HW8A 1S57A 2CPYA 2RKIA 4RR5A 1Q82T 1YI2S 3KUEA 1TL5A 3HT0A 2FY1A 1RU2A 5KFHA 4X66F 4Q8EA 2ZKTA 3L7UA 1CJTA 4K4TA 1TKZA 2VG6A 1T9WA 2W4DA 5FDLB 2RU3A 2MDAA 4CYUA 3KLFA 4IH6A 3JSMA 2V67A 1VJWA 2AJ1A 3FCHA 3ILLA 2UV8G 5HSPA 1EIYB 2V4QA 3R1LA 4AE5A 2B9XA 1HHQA 2CG8A 2MEWA 4DV5F 2HFVA 1S1TB 2HQIA 3D7SB 3TZZA 2C2KB 2HRTA 5LJ3Y 2XC9A 3KK3B 1IKXA 1UVIA 3M8WA 2R9LA 5A6WA 1B7YB 4DS5A 4K50A 4M5HA 2V8PA 2HS4A 2NPIA 3D5MA 3KXDA 1JLBA 2FZGB 4N8NA 5EDWA 4JI5F 3KG1A 1VIOA 4PYDA 2A1BA 1UJ4A 2D3O1 4KYZA 1P27B 3I0RA 1JNRB 3HJFA 5HROB 3JQKA 1B0PA 1YIJS 3OTOF 3W9IA 3L4BC 1SKUB 5HBMA 3KG0A 2KTQA 1D3WA 4I2PA 4GKJF 3KJFB 3MMAB 2Y8YA 4CZCA 2HGLA 5LXRA 1N34J 3M6VA 2IPOB 5EX0A 3M1VB 4NXNF 2DGXA 3KHHA 2N4DA 4LFAJ 2K1RA 2DNKA 2CIMA 4TLQA 4RUCA 1TK0A 2MZRA 4OQJA 4K8RA 2E9TA 2LQBA 1KQGB 2VB6A 1WEYA 2DR9A 1OMSA 1IJEB 4NXMJ 3HVTA 4ZITA 1RB0A 3O8WA 5KFCA 1LW2A 1T0TV 4J91A 4USMA 4DCPB 2MPUA 1QY7A 3DLEB 1S9FA 3D0GE 1VC6A 2XZDB 1QE1B 1REGX 3WBZA 2FJXA 1S6OA 1X4CA 3PX6A 1QAJA 2AV5A 3H59A 3IA0A 4U8VA 2BE2A 2QLJB 3MPDA 3ZZOA 2RRAA 4J7CA 4TY8A 4C8ZA 5F3ZA 1SJ3P 1IM6A 1FRXA 1LW0B 2LXFA 1FE4A 3LPYA 3ONQA 4HT5A 4WE1B 4WU3A 5HVHA 3FSIA 2DR7A 1WI6A 5HQ8A 4QOTA 2BR0A 1RZMA 1RACB 1VRTB 2ZD1A 2FLPA 2AT1B 2BE2B 3SIPB 5KG0A 3KJVB 1Q86T 3VAFA 4ANEA 1S0OA 3VZHA 1JXEA 4TY8B 2ASLA 5GAGI 1RHQB 1JLGB 4NMLA 4V19J 1F60B 2IM1A 2YNGB 1KFSA 2MY7A 1WSVA 3E3XA 4JB8B 5C2GA 5ETLA 4WTOB 4WTYA 1TL4A 2GVZA 3ENAA 1TZ0A 2Y0SD 4JI4F 1SJ1A 2VJUA 4OFZA 2HAIA 2WHOA 2V68A 1S49A 1DLOB 1T03B 4B9LA 1NEEA 1RAEB 1WUUA 2W7AA 2PI5A 3OUYA 4WCEQ 5ETKA 1HMVB 3ELHA 5F0WA 1E6YA 2G2OA 4LSLA 4I6WA 2J8SA 2R4FA 3MM9B 4FKXA 5D0HA 1EKRA 1KOHA 1RT7A 1URRA 1HNZJ 2FVPA 4YOEA 3RGIA 4ANDA 2CG4A 5K14B 3DLLQ 1Q4RA 2XLKA 2F9DA 1VS3A 4OJHA 1U26A 4PG7A 2YTCA 3VAKA 4AL5A 1F6TA 2IFXA 2KN4A 3PX4A 5AE3A 3AFGA 3PFOA 1AUDA 2EFVA 1N48A 4LF6J 4LMZA 1ZZNA 5J1EA 3PM9A 1CQNA 1HBNA 4O3QA 3CD6S 4P2FA 4PQUA 3D0IE 3R2DJ 2YKPA 2OPSB 3AA8A 2MZSA 3CDUA 4KO0B 3IBCB 3N5FA 1UFWA 3TARA 1U1MA 1VQ8S 4A48A 2FZCB 4WXOA 1BQMB 2K8GA 4Q43A 2E5LF 1HBNB 3QZ7A 5FJ4A 2R8IA 4PXCA 1WSRA 4FZVA 4CLPA 3OVSA 4DSJA 1Y3JA 4OI6A 2OPSA 4KO0A 2KFNA 1B3TA 2JLEA 4G65A 4UZCA 2YWHA 4CH1A 1VISA 1FRKA 1RWUA 1ZM4A 1RSCA 3A13A 4RO0A 7FDRA 2WW4A 1DY3A 3AAWB 2AGPA 4FPRA 2GCFA 3MMJA 1FVSA 2XMTA 4KPCA 4WFZA 3DRPA 4U6PA 1XMOJ 4UTGA 1B4SA 4NMXA 4C0OC 3NS6A 4R5PB 3OFFA 1HNIB 3Q8PB 5LMUJ 3QATA 3KJQB 4A8MP 1RABB 4ZK7M 1WEXA 2XEXA 2DTJA 4ZMMA 4JI2J 2QYCA 2Y3YA 2HS3A 4DFKA 1SXLA 4DU7A 2XSJA 4ITSA 1VRTA 2ZD1B 1SJ4P 1DFDA 4R0EA 4ETZA 1DQ8A 2O3DA 4KHPF 2PT0A 2YX4A 4O3NA 3EZOA 3S1TA 5SUHA 4C7QA 3R5BA 2BUNA 1CPZA 3LWLA 2J6UA 4O4RA 3H2LA 4WBFA 1KFDA 1RHMB 1GT8A 2QLBB 5B0FA 1S7IA 3CD7A 5F3TA 4DSFA 3V6JA 1SH3A 3GZ7A 5KFKA 4F3MA 3PJWA 3LGHA 2VC0A 1RQ0A 2RF2B 3IC1A 2QLWA 2OTLS 2ZC4A 1TKXA 1FKAF 1DAXA 2K3KA 1HLWA 4I69A 2HWIA 4K7QA 1WC3A 5LSRA 1HBUA 3D3BJ 2KT5A 4M5NA 3B78A 5KOXA 3TUZC 2PGCA 4MTPA 3C8YA 4MKYA 4N47A 3H2VE 4DR5F 1HWJA 1N6QA 1I94J 5HI7A 1IXKA 3C6TA 3KDNA 1NKBA 4P2MA 1N32F 1NDLA 3G8QA 4XPCA 3BO2A 3N79A 1XQIA 3ISZA 2QIFA 2C2NA 2QEXS 1N0VC 1NK6A 1S12A 4KV8B 2HIYA 4DV1F 3TOQA 4EFAC 3HFVA 1F5BA 5SZTA 4PXDA 3NAIA 3MFHA 2I38A 1KC8T 4IRCA 3ENWA 2RE1A 4ID5B 1LNQA 4C3KA 4W90B 3QNWB 2WSCC 1AROP 2R2TA 2VICA 3UNYA 3KTQA 4L3KA 4UY85 4C11A 2KT2A 2BYCA 1RT4A 3TP2A 2HMIA 3J7Z5 3P5TL 1UPPA 2I8EA 4K5SA 3MEDB 5KFSA 3QZ8A 3PO4A 5IT4A 3I96A 2A2DA 4X65J 3P5BP 3G4SS 2HURA 5HLFA 4EGLA 2W8KA 1RAAB 4HT7A 1RT3B 1SH0A 3QT7A 2JZ5A 5EX3A 5GMDA 4JV0A 3W65A 4C11B 3MM5A 1Q7YT 4ZPDA 2MQ8A 1YBUA 1QUVA 2WB4A 2KG0A 4DV7J 3DMJB 4ZJOA 3DGVA 4H54A 4CLZA 4FS2A 1WC4A 1NXIA 3C3LA 3GTYX 4RNNA 4TQSA 2W2PP 3FEYB 2HBYB 2MLXA 3BBFA 1YLXA 4F4WA 3KUHA 1W26A 3KUGA 2PI4A 4LFCF 4OHYA 4M5DB 3TJ9A 1JIHA 1A6LA 2IM2A 4M63A 4QYRA 4DPTA 1TUGB 1WTFA 3ZTQA 4RUAA 4TVAB 4P9SA 3W60A 3BO3A 2QMUB 4TU9A 3M8ZA 4CIOA 3GIKA 3NS7B 2D3OR 2UXBJ 1FJGJ 2EFPA 1RWOB 4DL6A 2GO8A 2X7IA 1R7IA 4WZMA 3QAUA 5KFTA 4CCHA 5FLXU 3W9HA 4PWUA 5IV3A 1NJIT 4RWXA 1XMOF 2WVCA 1G6BA 4YY3F 1GEHA 1HQUA 2B6AA 4A8QA 4DL0C 4CO0A 1NJWA 2HHWA 1WJ9A 1E6VB 1X5SA 2B0GA 3GFYA 1XNRJ 1UTAA 3GFXA 3KLIB 1ZAXA 2UU9F 2E1RA 2EVZA 2HG4A 2Q79A 1CC8A 3MCNA 4PYAA 4NXMF 3RW6A 1FJ7A 2CJKA 1U0HB 3OR1A 3W61A 2IVYA 3FQKA 1S72S 1VIXA 2VG7A 4LF5J 4NLGA 4X4SA 4ECUA 2RAQA 3LP1A 5L8RC 4IH5A 3EZUA 1RT2A 4WK3A 3HVTB 2CWKA 3IS9B 5C25B 5KT4A 2JFKA 4DL7A 3R27A 1C0TA 4AFFA 3C2PA 2J0QD 4KFBA 2ZWPA 4WKYA 4AL7A 2BJ3A 4KSEB 2EC2A 1PYSB 4XDDA 2I6WA 4DN0A 5KFEA 3IR5B 3T9NA 1D9FA 1SJQA 3O3LA 1R89A 3M2UB 4X64F 3IM9A 4C98A 3ZZPA 5KFUA 8ATCB 3PKYA 4HHHA 1FO1A 2FHMA 1VFJA 1JLFA 2XG8A 2KG1A 5IM0A 2HBRB 1HYSB 2UU9J 2RU9A 4C0HA 1SJFA 1V3RA 2FVCA 3EMTA 2FGOA 4NLRA 3M6UA 3MZIA 4R8UA 3JTOA 2H1YA 3HCXA 2YH0A 3O2IA 2XMUA 2XZWA 3G2XA 4P10A 2HWHA 2RKIB 2F8EX 1GMWA 4OYPA 4DX5A 3VAMA 1SKWA 3J7AN 3FCWA 2ZHOA 2M8HA 4ZHRA 1H74A 3HT3A 2HFZA 4F36A 2DKOB 1VGYA 4CLFA 1GMWD 2FD2A 5HK4A 4KY3A 5IXUA 5DGBA 1SKSA 4IKAA 4ZCMA 4OI0A 1PYTA 1DTTA 1S1WB 1WG1A 4AYBD 2OH2A 2R7QA 4RBUA 1FJCA 3QIPA 4ZS6A 1J5EJ 1VBYA 2ZWOA 1XJWB 2PA3A 3ZZ0A 2HS0A 2V94A 1XNQF 1I5OB 2VUGA 2YNFA 3H20A 1NHUA 4WIIA 3RR7A 2QA1A 3GIRA 3LP0B 2NUUG 3AQPA 3RUBL 3NCPA 3RBXA 5MLCV 5KFRA 2WONA 2GA7A 2P2CB 3KLFB 2ILZA 3EYZA 2EG1A 2GX8A 2VFRA 1VCTA 5JUMA 4DPUA 2CPZA 4ZPCA 4B3MF 1KLMB 3EGVA 3UN5A 4IO1A 4M1KA 1QDUB 2YNHB 4KR0B 2XCPA 4QQBA 1B7FA 2IYGA 3DXSX 3P8BB 3R7BB 4RWWA 4ZIVA 3A8KA 2EKYA 2WK4A 4F3QA 3CTRA 1R27B 1FKPA 2WCXA 3KMSA 1M1KT 3GONA 1HQEA 3DRSB 3ILJA 2W9AA 4JYAF 3RU0A 4U7CA 3UCUP 1FE0A 2ZBQA 4NA2A 3WC2A 3FNNA 1ACMB 1L5UA 1KTVA 4NWBA 4RNOA 2VFVA 2G1DA 2UVWA 1N5SA 3TZXA 1M90T 1WWHA 3MM8B 3PZPA 1FNMA 3Q8UA 1IKWA 4OZ2A 4MIAA 1S6QA 2A3JA 5K20B 1S77D 1C1BB 3W2VA 2HHQA 2L9WA 2CQBA 4OYBA 3B8HA 3G8TA 1SKRA 4ZVEA 1Y11A 4UOGA 2NR0A 3FBCA 2AJ2A 1T9VA 5E3PA 1CSJA 1RISA 1TU0B 1AFIA 2QFIA 4K5RA 1LWEB 3M8QA 4BS2A 5B0CA 3CDEA 5CAAA 1TUWA 1RWVB 3QJPA 2KDOA 1WC5A 2LFVA 1XNRF 2HQ3A 1SV5B 2QN6B 4GC7A 2MZJA 3RW7A 1YX2A 1HBOA 2VONA 4DWIA 3QGPA 1KTQA 1NJXA 2KVIA 4F8RA 3DLGA 2VC1A 3MI7X 5CABA 5ETVA 1F2GA 2W2QP 3TAMA 2WOMA 3EPIA 1O0PA 1U6BA 3PACA 3IGVA 2C2RA 2DNGA 3ADAC 2WSEC 2DEJA 2IJNA 5IV4A 4DG1A 5RUBA 2IMOA 1HMVA 5U47A 4J9UE 1T05B 1S1WA 2ZH1A 2PD1A 4DPYA 1RHJB 2HLUA 4CTAA 4IOBA 1XN9A 1R6VA 1T95A 1VDHA 3Q2TC 1JLQB 4ES3A 2CPJA 4IRKA 2VV5A 3GJQB 1F1BB 2KM8C 2J9DE 4BHQA 1IKXB 2V8DA 4CTAB 1YDLA 4LT6A 4Z7YA 4ED1A 1XMQJ 4FKYA 5KFJA 4LREA 5EWGA 4FVCA 3ZZZA 3HHNB 4WYLA 5KFOA 2LEAA 1OYDA 5HP1A 3TVYA 4ILRA 1H38A 2QRRA 4LRFA 1HWKA 5K8PA 3PXGa 4WFBQ 3OUYB 2AJ0A 3NGKA 5JXSA 3GFHA 4NLQA 1KQFB 3LGNA 2QFJA 4EBDA 3TAQA 4B3RJ 4X4VA 2D3ZA 4NEYA 4ZVHA 2DRBA 1PILA 2C2OB 2E1MC 2IYIA 4CLSA 3E8OA 4NCBA 3GU0A 1V3ZA 4ED3A 4NCAA 4DSIA 2WAQD 4Y28C 1N34F 1LOUA 2XQCA 5D77A 1GX5A 3OL9A 2M70A 2D69A 4IFVA 3T41A 2XLJA 1M5PC 4LFAF 2OAUA 1S6QB 3OL6A 2BX6A 4GO7X 1PJ5A 1FVQA 2IVFB 2ADBA 4FBUA 4IDKA 2ZITA 4ZP9A 2YKMA 3OR2A 4LBHA 3CC7S 2FTRA 5GAHI 1MN9A 4CH0S 1XMQF 4A8FA 1TKTA 1RT6B 4Y6IA 4DV4J 2D74B 1Q0NA 1YKWA 3W2WA 4I68A 3B82A 4OV1A 4E98A 2B7BB 2DBBA 1S48A 5C7PA 4X2BA 1P8GA 4LF7F 1VRQC 1GFWB 2EI5A 3J7ZT 1RCXB 1JJHA 4WKRA 4ZDNA 4RNMA 1EZZB 2DB1A 3RB0A 1J5OB 3OHBA 1ZAVA 3K7RA 5KFXA 2XSJB 5T14A 4BDPA 5IT9Y 3ZTOA 2FJVA 2RD5C 4URGA 2JVOA 4R25A 3THVA 2OD6A 3GWCA 4MKVA 4WE1A 4CI0B 4MK8A 3LALA 4ZVOB 2MQPA 1TVRA 3EXCX 1URNA 3IWNC 1M5KC 3PW4A 2NREA 5IS2A 3OPKA 3M2VB 2OI2A 4I64A 1V9OA 1U1QA 2M5YA 1RAGB 2HQGA 1NKEA 1RHRB 4OLPA 3C6UA 3AXMA 3CJ4A 4NE9C 1EKSA 3TEHB 4X4QA 1HR0F 4ELTA 2VOPA 2PO4A 3B4DA 4DUYJ 2FLLA 1N4LA 1D9AA 4KHMA 3HMJG 1HFEL 2NQPA 4XDCA 5HMWA 2HFSA 3CCRS 1TP7A 3H5UA 1NUEA 1X31C 5KG2A 1XR6A 5M2PA 2NCKL 4RW7A 2HQCA 2OIHA 1YZ6A 2VDIA 3MPYA 4O23A 2YXLA 3UQSA 2KVQE 4LSLB 2UUCF 4OL8A 1H0HB 4MKBA 3G82B 3N28A 4EO6A 3TVKA 4LF9J 2PFFB 3MEGB 4MKAA 4A47A 2MZQA 3VAGA 3POTA 4DHVA 2BOAA 3BV8A 2Y1RI 5HATA 2HMIB 1MWQA 2M0GB 2N7YA 3EGWB 5BYSA 1TUVA 2ZJQQ 4DDFA 1ZYQA 2OEJA 4W4MA 2CDQA 2EK1A 2XHCA 2K2PA 2DJWA 3VF0B 1GQEA 4UF4A 3IAS9 1PBAA 3VAIA 4O3OA 4LQ3A 5A6PA 2G9OA 3BGOP 4U7UK 2MGZB 2QTWA 2XS5A 2J5AA 3NGTA 4RW6B 2I5JB 1IWGA 4DSLA 1FWLA 2ACYA 4IOCQ 4QZVB 1BUXA 2L48A 2KXFA 2DITA 1SQGA 2EFOA 3R6GB 2Z57B 2ZM6J 4ECWA 2U2FA 4B3RF 4I6AA 4OYIA 5KFBA 4HH1A 3C14B 5DDQC 3MFIA 1B0VA 3VVTA 3I82A 2M9KA 1NK7A 4Z7CA 2CYYA 4FXWA 1FDNA 2JLFA 5K8NA 3QBCA 4RW9A 2YQ3A 2J9EA 3SCLE 4U9RA 1RTHB 1JK9B 4F4AA 1IKVA 3EZ5A 2PMZD 5DM7Q 3TR5A 3FZBA 3F41A 4LBIA 1OS5A 1U1KA 2R8JA 4IRDA 2DHGA 5D0EA 5GADU 4S0MA 1FWKA 1KHVA 5J2MA 2FQQB 2UUBJ 1NJYA 1E6VA 3P49B 3LWMA 1ZTTA 3TRGA 2HWTA 3GB0A 3X3UA 1F9HA 3HZEA 4DV6F 1RAHB 3GYGA 2Z56B 4LRAA 3EPGA 2Y0BB 4I4BA 2AEJA 2JEIA 3MR5A 4ZCKA 4FBTA 1GX6A 4WFNQ 4OZ5A 5ETMA 1X4HA 3FJ2A 4LVOP 4G1IA 1SC4B 5HJYA 5I3UB 4RLEA 3DCAA 3KWMA 2Z2MA 4ILMA 2HRYA 1T9XA 2CUYA 1M0SA 2VPYB 3PYFA 5CZVA 2IJFA 2CZVC 3LH2S 3M2RA 5D4LA 2FUG9 2DHAA 5ETTA 3TJAA 5F8GA 3ET6B 2VA3A 4ANCA 3IWXA 2HVZA 3FGVA 1DTQA 4DR2J 1RWNB 3MM8A 2W7OA 1WG5A 3ZNUA 3CCSS 2WVFA 4DV1J 2H4YB 5E3RA 1VQ7S 2NXEA 2AJQA 2F3JA 4N8OA 2IY5B 2BM1A 2MKCA 1TL3A 2IRUA 3ILIA 1U49A 3CGIA 4ZLJA 1XC9A 4OI4A 4QPTA 2DCUB 5HN0A 1EHWA 3V6DB 3GIIA 4WJBA 2E5LJ 3PW7A 4LBPA 5B0BA 3R5JB 4YDXA 3GJRB 4DF4A 3HHDA 2IBOA 2MSSA 3FSXA 3OBIA 4K0KF 1NSPA 2NLWA 2BABA 4EZ6A 3KFWX 4WF9Q 1NZAA 1Q78A 3CMES 3PG9A 2BKNA 2NPFA 3MMCA 4ERDA 2CFXA 3CCQS 4JI1J 2CNNB 2N3LA 1X5OA 2ZE2A 3DKDA 4ZVSB 3OVAA 1IN0A 5A76A 3TANA 2BQ3A 4PG5A 5ETNA 2GQCA 1O8BA 2LDIA 3OQ2A 3LAMA 5FDLA 3CJ0A 2Z30B 3KK3A 4QIVA 3CT9A 1WTBA 4OI2A 4HDHA 5ETOA 3AB4B 3CDWA 2E7XA 3GIMA 3ZTPA 2XULA 4JI4J 2FHJA 1JLQA 3MR7A 1KQKA 1JJCB 4WFAQ 5A8KA 3I4PA 3D67A 3VAHA 2YX7A 2KHDA 4PKDB 5KT2A 3IRXA 3EXYA 2MMYA 4GVBB 3KLEA 1YBAA 2DXEA 3U1NA 1BY9A 1CJUA 2LLZA 3S6EA 2ASDA 1TMJA 5C24A 4QIFA 4HL9A 3UW1A 3W1YC 2L41A 1JLCA 3D2WA 2G1HA 3VTIA 2HLTA 3W9JA 4TXSA 1SIZA 2DYAA 3DN9A 4DMZA 1FX4A 3K8VA 4UOHA 4UQTA 4QWBA 3ZZRA 1IBLF 3MPWA 2WONB 3ZZTA 2B8QA 3BSAA 2MHNA 1VQ9S 3BN7A 1R0AB 3K5PA 5C24B 4LF6F 4J9LA 4ECVA 2PFDA 4O3SA 4YB6A 3SSSA 4OX6A 2IMWP 1NB7A 3G6ES 4ZP7A 3CJRA 5FD1A 2LEBA 2IAJA 2E44A 1SL1A 7AT1B 3T1HJ 1YZ7A 4JP8A 2R7TA 1Q5VA 1YHQS 3W8PA 2D3UA 3H0PA 4QIGA 2NYHA 1FCAA 2W24A 3I0SA 4F7VA 3RRHA 2HHUA 2DEIA 3GSIA 2RSQA 3DLEA 4MT1A 2MB0B 4K4VA 3MAAB 1RT6A 8AT1B 3RBZA 1V5VA 2YPZA 4MAKA 3WZ0A 3EUNA 4B3MJ 2D9OA 3ZXWA 2HNZB 7FD1A 4C2MA 1LWFA 4AQYJ 1HI1A 4Z37A 1EETA 2PEBA 2FPHX 3KLGB 2QMXA 5BYQA 1T7PA 2AX0A 3PYDA 2DO4A 1SC6A 3HVAA 2RQKA 3PRVA 2ZOMA 4BLGA 4USKA 2MXYA 2C28A 1M5VC 4B9VA 5DG9A 3CCMS 3C16B 1Q8LA 1UWAA 2OELA 2F5GA 1H7XA 3CVKA 4QWCA 4P2SA 1YG0A 4O0NA 4N56A 1VK3A 2CNLB 2X1FA 5A2QY 2KT3A 5B09A 3KNAA 5IT0A 2FGCA 2RMLA 2XNRA 3HSJA 3MD3A 3AD9C 5HMYA 3HVRA 1XK8A 1LQ9A 2K3IA 3MM9A 4P72A 2Z2YB 3BKFA 3TO8A 2CDRB 3HX9A 3FMBA 4DPOA 5B08A 1VQKS 2DPJA 1YJVA 2D1CA 4OI1A 2VJVA 4DSKA 3V4MA 4NYZA 1P9YA 1U1PA 2JSXA 2O67A 3PFEA 4DL5A 3GPAA 2IBKA 1TK5A 3EM1A 4E2FB 3DOKB 2FLOA 4F4XA 4JBCA 2X1GA 2J76E 2VKRA 1J2VA 1EJ7L 3IR6B 4DR5J 4B9UA 5LOQA 4M5JA 4ZJLA 1OO0B 2BE9B 2EXUA 4Y0FA 3V4IB 2HYIB 3IP0A 4U8YA 3M8RA 2BANA 4Q2LA 1TKDA 1G7CB 4F04B 1CLFA 2C3OA 1A0OB 1ITPA 3K5MA 5GAGU 4PPZA 3M8PA 1C1CA 3OR2B 4HACB 2MLZA 5DQIA 1X5TA 3M30A 3NCRA 4KJIA 2MQQA 1OY8A 2VBZA 2W8LA 4G1PA 1NPRA 2RRNA 1RADB 4W98A 4DPXA 5F8LA 3NBPA 4I2QB 4CRJA 5ETRA 3K0JA 2M8DB 2XY7A 1WEZA 3NY0A 3B4MA 1FTCA 2E5HA 2XI3A 2WVBA 1DRZA 2DGSA 1UVKA 2G2ZA 1YJTA 4LF2A 1H98A 2BRKA 5KFQA 4PXBA 2BQUA 3PNIA 2LQJA 3DDKA 1IKWB 5L1IA 4J9MA 5KFWA 3ZZUA 4ZN1A 4DR7F 4GKKJ 4DR3J 1VYAA 5HVFA 3TQEA 2DRAA 2GC8A 3JQMA 1S9GB 2YKOA 1DQAA 4CH7A 5G4DA 4AQYF 1SL0A 3PJ9A 4AUKA 5HMZA 2DXFA 2YKMB 2DNZA 2HNYA 1NHVA 1Z1ZA 1R0CB 1Y9OA 2OFHX 2YWGA 1U6FA 2CQGA 1EX8A 4IFYA 4KC5A 4NLTA 3Q8YA 2UZAA 3SMZA 1X5PA 2AWZA 2QL7B 2CQCA 3MMBB 5D0RA 4DLEA 3ZTSA 3C16A 2CPDA 4HI2A 2XNQA 4X62J 5LMNF 4DBQA 2LA6A 4DX7A 4EYHB 1VQLS 2BOPA 3MUTP 1H3DA 3D1HA 2AD9A 1X4GA 1EP4B 2E5IA 3DOMB 1UETA 1MU2A 2CVEA 1FRHA 1HNVB 3KHLA 3GV5B 4H4MB 1NZ8A 1TKZB 2VG6B 2IRXA 1FFWB 3F44A 2AKWB 1VQYA 3TX8A 3JSMB 4F4YA 1KP6A 1X4EA 3K8WA 3CDBA 3GE9A 4TYAA 3Q8SB 3CJ8A 3LUYA 3CF5Q 1PJ6A 5D0GA 2A10A 3CJQA 2C1EB 2R7WA 3BS9A 3T5KA 1NBEB 2DISA 2F4FA 2UUTA 3MF5A 5DGAA 2XYPB 4USIA 3RB3A 1WD6A 3MOJB 4PR6A 5LM7E 4A8XA 5DG8A 2YPYA 3KNGA 3M32A 3QFWA 1E6YB 2CJAA 2HZCA 4RJVA 3UDCA 4CDIA 2RUGA 3U02A 3JYTB 1FF2A 2RNEA 4IR9A 2JNJA 1UZDA 3BGRB 5E3CA 3KK2B 2DNMA 2V2QA 3QMQA 4DFMA 2LQ5A 2MKSA 1M5OC 3NMAA 3CMQA 3BYPA 5KFNA 1Y5IB 3RR8A 4DCOB 1S97A 5KFAA 3IG1A 2AMCB 2GAGC 4DV2F 1FXLA 5LSLA 5KFLA 2RQCA 2GHWA 2HK2A 2XHWA 3H98A 1BQXA 4JI2F 3HD2A 4RBVA 1KRPA 3UDVA 2JHEA 2E5JA 1IQZA 5CA5A 3TYTA 2ZBPA 3H8YA 5GMKa 4J9PA 5D8HB 3K2YA 1S1XB 2AYEA 3EVWA 3K59A 2R3VA 2ZJRQ 2HGNA 1PCAA 2LEPA 4DR4F 3THTA 3SBMA 1MROB 4LJMA 4TN2A 3ITHA 3PRDA 1JXVA 3VZIA 4DI6A 4DL2A 1RK8A 1U8WA 2DGVA 2NYIA 3H2UB 3KG4A 1FFSB 2VBXA 4IDKB 5KFDA 3G87A 1LW2B 4PQAA 3JXOA 4G6VB 2UUAJ 1Y3KA 1I51B 1RWWB 1HQ2A 2HNDB 2YWKA 3K89A 3G6VA 4DUZF 4DXLA 4ZLLA 4FNIA 1L3VA 1A9NB 2WRMA 5T7LB 1VQ4S 1LWXA 1IKVB 1RTZA 3DRPB 4ED8A 1PAUB 4USUA 2QLXA 1PG5B 1Q5YA 1TKTB 2J7UA 4CWBA 3T5LA 2UV8A 4HR2A 1APSA 1UW9A 5G0RB 4E8UA 1IM4A 5IQQA 4R5PA 4JV1A 4G3IA 4ED2A 1G1XA 2XBPA 4ZPWR 3KK1B 2YH1A 2LCWA 3GJTB 1Y5LB 1EP4A 1TR0A 2ZH8A 2ZH2A 3LF0A 1TL1A 2DHXA 3MECA 3T1YF 1K1SA 3MCMA 1R8PA 1QAIA 1NKCA 5DETA 4ZCLA 4FVMA 3B6BA 3BGFA 1F2HA 1LEOA 4KQZA 2LQ9A 1JMTA 2CAJA 2G4BA 2GMHA 1UPMB 2JC1A 5D4NA 3PR4A 4PG6A 1Q79A 2OP5A 3Q86A 3A12A 1FXDA 4RX6A 1MWZA 2WBRA 4TY9A 5CZXA 3THPA 2ZOFA 3M32B 1YTYA 5B0EA 5F8JA 1B64A 3P4UB 1D09B 3SCIE 5A8WA 1FFGB 3MWBA 2XS7A 5BR8F 4RW4B 4QW8A 4BBYA 5KOWA 4KE5A 1EAYC 2CNOB 3FEXB 4RW7B 3G9CA 3BM7A 2UVUA 3GR0A 4K4WA 2BV3A 3TA0A 2J7KA 3AODA 5J1EB 4FF1A 3HM9A 5A8WB 2QZ8A 4MYTA 4NZ7A 1U1LA 1JLAB 3UD3P 3J81j 1JLFB 5DG7A 4HKQA 4ICLA 2CXEA 2CNKB 1PAEX 3DXBA 1OJ4A 2FDNA 2YNIA 4R8UB 3G6YA 3LA0A 2UXBF 2MQMA 3K5LA 2J6TA 2B4UA 3UI3A 3GQCA 4NEZA 2V4JB 1Y4ZB 1HKAA 5I3QA 5DQHA 3Q8VA 4KTQA 4LR9A 4LF4F 4B3OA 4YUDA 3SEOA 1FKOA 3GCXP 3QSIA 2QG9B 1RT4B 4A4JA 5HQMA 1MMNA 3BQ1A 4QBUA 3ZZYA 2EFNA 5H9EJ 3MUVP 4PUOA 2HFNA 2GMLA 2KO1A 4CT8A 4YR0A 3CIMA 5T7LA 2GAHC 3IBFB 4KAIA 2KFZA 1LFPA 1PBUA 1XTZA 5LSOA 1VQMS 3IR7B 2ACMA 2DK2A 3NL0A 4CLYA 1CJTB 2B4OA 1JKHA 3SQOP 4H4OA 3HLUA 2JJ4D 1RT1A 2MTLA 3OTOJ 5DZ6A 4DS4A 2AZ1A 5K9FA 5HO4A 4FYDA 5IOLA 3IAM9 3QT8A 1ZM9A 3UDEA 2CQ0A 1RTHA 4ZOSA 5G0RA 2KXNB 5I42A 4EK2A 1XNQJ 4FYXB 2CPXA 4DEZA 4CLUA 1U2RA 3SCJE 1X7VA 3GG1A 1S59A 1T3NA 4F0MA 1CC7A 2FJAB 2JEJA 4M94A 1T8EA 3GMGA 1KKHA 2AF6A 2Z58B 2Y1IA 1OWXA 3JTNA 1FK9B 4NLDA 5AJ3J 1IBCB 5I42B 1IBKF 2MLYA 3FDSA 3J7YU 4YEAA 2R42A 2VPZB 1PC5A 1HBMA 1ZA1B 2CA9A 4FYYB 3VQTA 4A8WA 4P2XA 1B99A 2W4PA 3I0RB 4L73A 1HR0J 5KFMA 3QWUA 1DARA 1HWUA 4HLBA 4M5IA 1NHKL 4UT4A 5KFZA 2V63A 2W9BB 2C22A 1JQGA 2CQDA 2H5IB 3TA1A 5KG4A 4AXJA 4X4PA 3QJLA 4I2PB 1GMUA 2XMJA 3P96A 1M5HA 2AGOA 1NPPA 2JH3A 2LA4A 2PDAA 4BCAA 4F4ZA 4A8YA 3C19A 3NBPB 4I2QA 4Q0BA 4DJBA 2DPIA 1EQ0A 2ZVSA 4PABA 5JJBA 4HTJA 4LUBA 4O0IA 3TAPA 5BJRA 5JMNA 2FJBB 2B9WA 2HNZA 2BW7A 3SXLA 3FVYA 3H25A 4F0KA 2ZH9A 1CJVA 5CYMA 2P8IA 5AXNA 1TK8A 5DZ7A 4DV3J 3KLGA 2BRLA 1N8RT 3TNVA 1I6JA 4JI7F 3QGGA 4KRWA 4F02A 3V6DA 4HTIA 1QVGR 2CJBA 3KJNB 3RB4A 1D8YA 3CWJA 1ELOA 1M1GA 1N54B 1WOSA 1WOOA 5CYMB 2O66A 2WB1D 3FBBA 5KFPA 2Z2LA 2LXUA 1Y10A 2IA0A 3RG6A 4ZLNA 3U1LA 1VBXA 1VC5A 2VKZG 1FESA 5LMUF 2HVIA 5EGYA 3U7JA 3TAMB 4YB5A 1DTTB 1T05A 2DNLA 1UA0A 2E9RX 3R1HA 3QIPB 1S6UA 2JOQA 3NGRA 3V5RA 3EVOA 2H54B 3F73A 2XYHB 2OHDA 2CPFA 1MU2B 2V34A 3NRBA 4R0JA 3SZ2A 1N56A 2DNRA 5AXKA 2DCLA 2M7SA 2YQ1A 2VPWB 5IFMA 3D1OA 3HFKA 5I3PA 1UVNA 2R7SA 4Y2CA 2HRUA 3KLHA 2FVQA 2IM0A 4CT9A 2MQOA 1UW4A 1LWCA 2F9JA 1MLAA 3DI6A 3VWSA 1FHTA 3JSYA 4K2XA 4MK9A 2R7VA 3T5JA 3MUMP 3LP2A 4D3HA 1WHWA 4NCGB 5A8KB 3Q23A 2P9EA 2BANB 1U47A 3EE3A 4OV6A 2A6MA 3T5HA 1RT7B 5IQ6A 4JI8F 3JAMU 3JYTA 5IT9U 1C1CB 3QIDA 3ETOA 3W64A 4C48A 5CCLA 3OLBA 1D0EA 1QSYA 3J80U 4YHHJ 5H9EK 1OPZA 1S9EB 1P1LA 3AB2B 2GFFA 1Q95G 2XTJP 3A8JA 3I6PA 5J2NA 1YITS 2N7CA 2F65A 1CJUB 3DGPA 3J80Y 1IVZA 2ROEA 1X8DA 2XO6A 3NWRA 3IMQJ 3N4WA 3VGVA 1RYRA 2J9CA 1D8ZA 3C15B 3PCOB 4J37A 1QSLA 1TAUA 2BA9A 3QJJA 1Q8BA 1V5IB 4NRTA 2ADCA 2B56A 3D6FB 4PG8A 3TWZA 3RBDA 1FDBA 2HZAA 3OT9A 1HL6A 1MROA 2XCAA 4ZIWA 3DGPB 4M5GA 1FKPB 4MMOA 3SI8A 4DQSA 1UWBB 4CLWA 2KXHA 1QSSA 1CS4A 1LXJA 3DU5A 3FCVA 2DIUA 4ECTA 3HKWA 4OZJA 1ROFA 3AOCA 3W5YA 4F67A 4YFUA 5AJ3F 1LW0A 3MR3A 3H4BA 1FX2A 1YK9A 2A18A 2OGUA 3RTVA 1H7WA 3CJ2A 2WTFA 3MMBA 2RDJA 4ECXA 1TV6A 2KH9A 2HVEA 1SVDA 4JI5J 4P7VA 2XO7A 2HKEA 2OPQB 4RL1A 2XS2A 2HNYB 1R6YA 1RTJA 3S8SA 2BACA 4F3OA 3I9V9 3LAKA 1I94F 4DZ6A 1KHWA 3EICA 4H4MA 1ZS6A 2HQFA 2ZNYA 4ATNA 4IQMA 1VK8A 2F63A 2XMAA 2LECA 2ASJA 1HNWF 4QCLA 2LKZA 2BW2A 5CD4H 1UJ5A 4ER8A 1KVKA 3DLJA 5FIIA 3R7NB 3HP6A 2GHVC 2W4CA 5F8HA 1SI9A 4Q8FA 2NXUA 4LIRA 3DHWC 1TAQA 4QU7A 2JVRA 2CZ9A 5CYQA 3CCTA 3MEEB 1XERA 2VZ9A 4RZRA 3KDOA 1L3SA 1TMMA 4P6QA 5AT1B 2LYVA 3GV7B 3OW2R 3J7A1 1UVLA 3ILOA 1WOPA 2ZH4A 3UNGC 2FYXA 2YNGA 3UCZP 3W66A 3HSGA 5A8RB 4J9VA 2OPRA 4PWWA 2M2BA 2R8GA 3N0VA 1CULA 2VDHA 1K9MT 1NSQA 3ZFVA 4NRUA 1WKJA 4OYWA 4HYKA 2P6TA 2HIQA 4ECQA 2E1AA 2Y8WA 2P9GA 3BR9A 2UXCJ 3R6LB 3Q8QB 4DX8H 2MQLA 1U2CA 4USVA 3TUJC 2VU5A 4LIWA 5D4OA 5KFIA 4B08A 3SFGA 1N5YA 1KSPA 2O01C 3MDFA 4LF7J 1UP1A 4XO0A 3DOKA 4RU2A 2YX1A 4UZBA 1GTHA 1SJRA 2AYGA 1P9QC 3CC2S 1BQNB 1S1VB 5K8OA 4MFBB 4QIEA 3UVJB 1JLAA 4USTA 2ZH7A 1MSWD 4DOZA 3J81Y 4KHPJ 2FHOB 3I9ZA 1NB2A 1ICEB 2RDIA 4I56A 3CJKA 1U7LA 2B7CB 4IFVB 3PV8A 4DQPA 3MAHA 2ZBRA 4WZQA 2VA2A 3W2WB 3SV4A 5LJ5Y 3HHEA 2V5HG 4ZJQA 1W2IA 1FRMA 1VRUB 2MGZA 3Q0AA 4C0BA 3U27A 2VQEF 3M9NB 3WHIA 2Q6BA 1ZPWX 1X4DA 1JB0C 2FZKB 4NLWA 1VQPS 2ZVIA 2IM3A 2CQ1A 3PKMA 2HGMA 3I5BA 3NS5A 3MCOA 4YR2A 4A8SA 5D15A 4USJC 1BXNA 2LQ8A 1RAJA 3QLHB 5J2PB 2ZDOA 4PEOA 2V4RA 1WC6A 1T3OA 3R5DA 3SSRA 3Q8RB 4P71A 2DT9A 1HHTP 4GKJJ 3TUIC 5J2MB 3CO9A 3IO1A 2V69A 4L6V3 4A46A 4AL6A 2GQ2A 3NGDA 4FF4A 1KNZA 2H4WB 4NXNJ 1S4EA 3V6HA 2RS2A 2RIJA 2V2ZA 3BZQA 3QO9A 1MN7A 1HNWJ 3T6JA 3QLHA 5E2QA 4K4ZA 3HPOA 1NK0A 3N9UC 3FRYA 3AXKA 3C6UB 3OXGA 4GMKA 3UE2A 1WACA 2GIQA 2QV6A 3E01B 1T02A 4NPOA 4X4OA 3F56A 1IKYB 4PWDA 3HXMA 3NWGA 4OZNA 1L3KA 1NSAA 2NSBA 3PHEA 4TLRA 3UWTA 3M6WA 4YB1P 1CEZA 3R7SB 1R43A 4HHJA 2G0JA 2DNQA 4X65F 4J9QA 2ZBCA 3L7OA 2E1PA 3G8SA 4DV5J 4J9KA 1NJZA 2W01A 3TW0A 1IBMJ 3BDPA 2A2CA 2QT7A 4QYZK 1WHYA 5F41A 5L39A 2IDEA 2P5VA 2OLWA 1HWIA 4FPIA 4KT0C 1PKUA 4K0KJ 2CWXA 4DV0F 4CQ1A 4KHRA 4WK1A 3W7BA 1FWPA 4NX9A 4CO1A 4ZCIA 3UPFA 2XY6A 1U45A 5K14A 1RUSA 2DIVA 4UOFA 4Y2IA 1U0HA 3HULA 2HHHF 4IR1A 3DRXA 5B0AA 2DO0A 1KEKA 2H48B 4TKTA 1KN6A 3PEJA 1WHXA 2JL9A 4IYQA 2DR5A 3I87A 1UJ6A 1VMBA 2B51A 2GS8A 8RUCA 5KTQA 3C6TB 1QUPA 2LU2A 4L3NA 1REVA 4F2RA 1RBLA 4OX9J 1UFLA 4ILLA 1AZSB 4ZVUB 1S1XA 1NDKA 1TQLA 1OQ3A 1MMDA 1U02A 2OPPB 5E7OB 5THWA 1NK9A 3OFHA 2J6SA 4ED5A 2VG5A 4M5KA 1B70B 2AW0A 2B9EA 3C46A 4F2SA 2M52A 2J7WA 3GP9A 5DQGA 3KHRA 3A4TA 1L3TA 1NMEB 5IWAF 3C14A 2FB0A 3K17A 2ALZA 3L9ZA 2QA4S 2YBVA 4NLPA 1CBKA 2OPPA 1RHKB 4LSZB 1Q7LB 4JUZA 1YRXA 1G2EA 1FNOA 2ASYA 4WIQA 5GMEA 4NZ0A 2HHXA 1BGXT 3S7RA 3AY0A 1N32J 4K4YA 2OMOA 2LU1A 3NG8A 2MZ1A 2LVWA 2F4VJ 2RT3A 2NXCA 4XIUA 2QL5B 3UD4P 1HNIA 3NAHA 1VLYA 4P7TA 2JWNA 4H4OB 2I5JA 2DH7A 1SBRA 4KB7A 3A3PB 3CCJS 2BDPA 3KLHB 3B54A 2EG2A 2HBZB 2R7RA 3AJ1A 3I4HX 2BBEA 3GJSB 3QO9B 1FJEB 2C3MA 5BYRA 2NSCA 5F8IA 2YY3A 2J0WA 4X4TA 1SC1B 4IUFA 5F8NA 3DM2A 2XMVA 1RGVA 2B4PA 5C2CA 3M9OB 1RT5A 2B5JA 4B9NA 2VOOA 1G4CA 4I7FA 1VOMA 1RU1A 4DQQA 4LFBF 4EEYA 1JLCB 1WC0A 2DY9A 3BSOA 1SPBP 1UL3A 2OJ3A 4OYAA 3BH6B 5JVHQ 3LO3A 2MSTA 3T3FA 1F5CA 2VODA 3P3DA 1DHMA 3R3TA 2AU0A 4IO9Q 2KJWA 2RUSA 3CXCR 3PW0A 4DR6J 3S01A 1K0TA 1RI7A 1HQEB 3DRSA 2HAFA 1YJ9S 4DN9A 2RRBA 1JJ2R 4ZPVR 1H2VZ 3RRKA 4OMFG 1PGZA 4N41A 5ETSA 1SQEA 2I1RA 4KKOA 3ZO7A 3PW5A 2RHQB 2VBYA 2ZDPA 1C1BA 3W2VB 3ISND 3QAEA 1KVJA 3I0SB 3JAMY 5H9FJ 3BSNA 4ZP6A 1LKZA 3KLVA 1R8HA 1TFYA 4ED0A 1FD8A 3EGNA 3JQJA 3MAAA 3K57A 4KH0B 2MJNA 1R0BG 3N6MA 3NCQA 5IM0B 1U2FA 4X84A 5F9LA 1HYSA 2HVHA 2KZZA 1CJKB 1XR7A 4LF1A 4UW2A 1IBKJ 3LP1B 3HDSA 1KR4A 1EARA 3CJTA 1LWFB 3MEDA 1AW0A 3EGZA 1VBZA 1YQHA 2F8HA 3GCWP 3OD2A 4I1TA 4RW8A 1ULRA 5ETPA 5HLFB 1YBTA 1HBOB 5E3QA 4MYUA 4DV0J 4JI6J 3AOAA 3M05A 1V6HA 2GQQA 1B0TA 2IJRA 2W2OP 3NOCA 2KU7A 4Y3CA 2PEHA 4IG3A 4CYUB 2V9WA 3M6XA 1IBLJ 1QVFR 4M5MA 3I31A 1ZAWA 3PY8A 2RILA 3BGLA 1LWCB 3BB5A 4F0HA 2R7OA 1Q8KA 1WELA 2MKKA 4DG1B 5CYQB 4OHXA 2QC3A 3CCZA 3IRXB 4ZN3A 3VV2B 4K4SA 1S6PB 4U96A 2DNOA 1T11A 2YWWA 5B0DA 2JEGA 5EWFA 4NLVA 3PVXA 5CQGA 3PX0A 1J5OA 3CW2C 1YGYA 3DI6B 3H5XA 3TUPA 1N5QA 2RHSB 3IFEA 4N7TA 3AJ2A 3US5A 4B3TF 4AD6A 1UKUA 5A8RA 1HD0A 1NDPA 1S9EA 3PR5B 1YJ7A 4QU6A 3JS9A 4YP3A 1FJGF 3L09A 3BSCA 1I3OB 2DHHA 3QT5A 2UP1A 3RJMB 1WNEA 2DGTA 3BBBA 5HP1B 2A0FB 4P52A 4ZPAA 2YNFB 4C97A 5L46A 4TU8A 3VQSA 1O51A 3LP2B 1DZ5A 4DQIA 2JX2A 4B17A 3DLKA 1X4FA 1R8AA 1S79A 2DVIA 3EDQB 2H5EA 2FY8A 4QR2A 2DNNA 3D6HB 2E1CA 3RRGA 1RXOB 1YRUA 4D3GA 2CQPA 4NA1A 4RBTA 5GAEI 3OV7A 3V81B 4CLTA 4EBEA 2R2UA 2PMHA 2KYZA 2L9NA 3UFCX 3H5SA 4QR0A 1NU4A 2XMKA 1NNDA 3HVWA 4I67A 4FXVA 4PAAA 4LSNB 1N36J 1K0VA 4LF5F 4NLOA 3TX0A 1XWLA 4NA3A 4QJVA 3CCWA 1UWBA 1HARA 1TV6B
chains in the Genus database with same CATH topology
2CRLA 4QWEA 2Z4PA 5KG7A 3IBWA 3N01A 4LF8F 2FJDB 3HHLA 2CQ3A 4EWTA 2AJFE 4Q0BB 3Q22A 2I2YA 1R8CA 4PPDA 3JB9k 2LXIA 4WFXA 5C42A 2JRSA 1TFWA 4DR6F 1FDAA 5EHHA 2CPIA 2GNKA 2W9CA 1HD1A 2WW8A 1NH7A 1RDRA 2WSFC 4DV7F 3R5AA 5DG7A 2GIRA 2Q6CA 4CO5A 5DDRC 2XLIA 5E41A 5AE2A 2F4VF 2FHKA 2CPHA 3D1QA 2IA6A 1JLEB 1GAOA 2KYXA 4KGMA 2GV1A 1RTDA 1PC4A 5GAHU 1NK5A 1PO6A 2VFTA 3MEKA 5A0YA 5L9NA 5ADZA 3CC4S 4PG4A 2WOMB 2B4VA 3AA9A 2VD3A 2CJ9A 2EK6A 4LVNP 3OL8A 2PN6A 4BS2A 3RZAA 5E5NA 4CO4A 2ZHAA 3KKFA 3MM7B 2UXDF 1N52B 1Q53A 2GGPA 1NH8A 2P9CA 2PIIA 2FVSA 1CQMA 1UAWA 3MEEA 2QSFA 3KLEB 2C2EA 1Q16B 1X0FA 4ES1A 2COLA 2MHEA 1FT8A 2X3GA 4WFYA 2FIUA 3FMWA 1KLMA 1H2TZ 1O5JA 1ZPVA 3M30B 2VQEF 1FTRA 1QAXA 2AYMA 1Y5NB 3IG1B 3LGMA 3CJKB 5J2NB 1C2PA 2IRYA 2OFGX 2G0CA 3QYYA 3MURP 5ITHA 2N4CA 2RQ4A 4K59A 1LK5A 3M8PB 2RH3A 4ZP8A 2V8HA 2VFUA 1HA1A 1KONA 2IAJB 5EUHA 1T94A 2Q43A 3SFUA 3HK2A 2ZFHA 3L95X 1BQMA 4MJKA 4TQRA 4LSNA 1QAIA 4O3PA 2X1BA 2RQMA 3ITHB 1PSDA 3CCUS 4J9RA 2DGWA 3OSPA 5DRKA 5HBMB 5DLFA 1WF0A 4OHVA 2D7SA 2M88A 4I6YA 3WC0A 1RA7A 2ROGA 3GILA 1RT3A 4ECSA 2JC0A 2O1PA 4TYBA 4ZA1A 3FQLA 2UUBF 1FRLA 2VBWA 4IG0B 4OI3A 1U8SA 4EU0A 3SDEB 2HNDA 2QA2A 4J5OA 2YKNA 1S4FA 2EBEA 5DLGA 4DUYF 1EETB 3W3SA 4JI6F 2F8MA 4ALZA 2YVSA 5DS7A 2P6SA 2FJEB 1H6KX 3GSDA 3PDNA 4N77A 3KMQA 1P1TA 2RJZA 1S9GA 1HI8A 2MQNA 2HW3A 2D9PA 4KGKA 2W7PA 4FNHA 4CNYA 1GH8A 2BJEA 4IFYB 3T6BA 4DFPA 3DOMA 1Z2ZA 3DM2B 1HPZB 2XI2A 1MMLA 2XWYA 1DQ9A 3RAMA 5M2UA 3G71S 3HHKA 2K7JA 3JTPA 3BJYA 1OSDA 1RTIA 1TKXB 3NLCA 1JLGA 2V0NA 3I5CA 3OTDA 4DF8A 1DLOA 5D6GA 5C5JA 3OL7A 3LQVA 4KIAA 1P6TA 1R31A 3DLHA 3D0HE 2E29A 3M2VA 1S1UA 3OHAA 1JJ4A 1W25A 4USHA 4UUWA 3MR6A 1YJUA 2B3TB 4HDGA 3SQGA 4B3SF 4OJ3A 4G1QB 2LDYA 1Z2LA 4KBIA 4EO8A 4Q5VA 3D28A 3OR1B 1OQ6A 2UUWA 3N5BA 2DNPA 5L1LA 4YDDB 4C8LA 3GFZA 1FEHA 3CE8A 2EPIA 2PC6A 3BN4A 1RT2B 2EBGA 1BC6A 3H40A 4DL3A 4F4KA 3BGRA 3KK2A 3M9MB 2QE5A 1XMBA 1Q81T 4ECRA 1OIAA 3DRRB 4KV8A 1H2UX 1GNKA 2OO4A 4IH7A 3CCES 3V2UC 2C3PA 1WI8A 1U09A 2CQ2A 2EFGA 4M8LA 5J1PA 2ATLA 3TQ1A 5AXMA 2GO9A 4ZPTR 3FSYA 2JEFA 1RJJA 1Y0HA 2ZC3A 1U1NA 3GYXB 4C9DA 4M5DA 2FJWA 3CCLS 3NNCA 2DH8A 2QMWA 1K8AT 2CZ4A 4RUHA 4MIWA 3DOLB 4URSA 4H4KA 2J0SD 2ERRA 1JXLA 4LF9F 2B43A 4ID8A 1RT5B 2B5JB 2ZBIA 1S0VA 1UA1A 4NLXA 4Y34A 3JSRA 2DNYA 4J9OA 3OLAA 3N6NA 1X9WA 3UDLA 1IR0A 1N0UA 1UEUA 1RYSA 1IUJA 2HFOA 4B9MA 1AFJA 4DV3F 1UMJA 1WF1A 3RBEA 5KFVA 3OJSA 2Q3PA 2AYBA 3HHLD 3NNHA 2ZZNA 3GG0A 4RW4A 1HQUB 2B6AB 2F7VA 4B9SA 3MTKA 4TNOA 4OHZA 2ZKUA 3ENQA 2IHR1 4FS1A 2RF2A 1C0TB 4DL4A 3SCKE 3IN5A 1R3NA 4PXEA 2XSFA 2CPEA 4ED7A 1RA6A 3KLIA 3JSBA 3H4DA 2GJIA 3FFIB 1CG2A 2X1AA 1REVB 4B3OB 4CO3A 2WBMA 3PJXA 4HEA9 3MCSA 3VR1A 4Q44A 4NZ6A 1QTMA 3EX7B 3DRRA 2E9ZA 4B9TA 3IXQA 1Q8IA 2V8VA 1IBMF 4Q45A 3FFIA 4ID5A 2DD8S 4QYZJ 3DYAA 3HZGA 1IJFB 4N76A 4URQU 1X9MA 2EW9A 4B02A 5D3GA 3VALA 3OFEA 1SUQA 2Z8QA 4IG3B 2NZ4A 3ICLA 1DURA 3D54A 2YWEA 1U48A 3ULHA 5L1KA 4ECZA 4DR2F 1U6ZA 2V4JA 4OIXA 5D3GB 3E2EA 2VPXB 1U25A 2ZH5A 1JKHB 4QWAA 3K58A 1KQSR 1JWWA 4KPYA 3AHPA 3SYZA 3OXFA 3CUNA 4PUOB 3CJ3A 3TI0A 5E3AA 2Q66A 3IGNA 3GYNA 2R2RA 3CD0A 1R8BA 3LP0A 3CD5A 2E5GA 2I9SA 3BGUA 5KT5A 5JVGQ 3ISNC 2GHPA 4JOUA 3U1MA 1TL1B 2R2SA 3KYLA 1ZH5A 3MTJA 4JI0F 3MMAA 1FDDA 2GMJA 3OTCA 3Q24A 4YMEA 4GKKF 3DLKB 5KFGA 2R7UA 3UCGA 2XGPA 5HROA 1YJNS 2K1RB 3HI9A 2DHSA 2APOA 2W9BA 2NS1B 2J0XA 2HHTA 3FRZA 1VQ6S 3M2RB 4IOAQ 3RB6A 1ZBTA 2VASA 3DLBA 3T1AA 5DDOC 4KKOB 2MKJA 5FLXY 1V3SA 4CO2A 2FHJD 4YQWA 3BDEA 1VQ5S 2RVJA 5KFFA 4V19X 4ZVFA 2KZMA 2CJQA 2C3YA 5KT7A 2MJUA 1LWEA 3SDEA 3SSQA 2BJDA 2ROPA 2CVIA 4DOZA 2UUAF 2ZUGA 4OZ1A 3MM6A 1K73T 5C25A 2OD4A 3NP5A 4OHWA 1FRIA 4EYIB 1F5AA 5K8MA 3PIOQ 1X4AA 2GJ2A 2DGUA 4Y00A 1YJRA 2CKWA 4UOCA 2CQIA 2M4MA 5GADI 1SUQB 4YHHF 3DHXA 5A0YB 3O5TB 3R5CA 3P6YC 3M8SA 2UVRA 3KJVA 3HHLC 2ZH6A 3T1HF 1M5SA 1N33F 1YJWS 4FF3A 4X4UA 2W9CB 2K7KA 4O4GA 4L72B 1LXNA 1HPZA 4JV2A 3RAXA 2C42A 2QSWA 3G86A 5HL7Q 1RT1B 5AXLA 4C8KA 4U67Q 3O1LA 2JLGA 5L38A 1UEVA 3X1LB 1X9SA 3QPIA 3HKZD 1C4CA 4ZHRB 4EBCA 4F26A 1C0UA 2OPRB 4MK7A 4NLYA 4UUXA 1HNZF 1K1QA 5KG6A 1ZZFA 4C8YA 3I32A 2UXCF 3O6QA 3PRBA 3BQ2A 5B0GA 1Z4UA 5CYJA 1S0MA 4DR3F 3CB4A 5L1JA 5CXTA 1IQTA 5DM6Q 1WG4A 3LANA 3TA2A 2GGPB 2YNHA 3M1VA 1MWYA 1S1TA 4BWJA 4X4NA 1ZM2A 3ZC4A 3UR0A 1BWEA 2XWXA 3IRWP 1RP5A 2FC8A 2QO3A 1NAQA 3MOZA 2B9YA 4QR1A 3PIPQ 5B7WA 1BD6A 4IG0A 1QM9A 5LXYA 4FF2A 3KOAA 5LT5A 4OX8A 2AGQA 1N36F 1XEZA 4ZPBA 5CHCB 4NYOA 1FRJA 2DGQA 4OZLA 4ZVGA 1CVJA 2V9KA 2LMIA 2OPQA 2FC9A 3CDAA 3CIZA 2L9DA 3RYLA 3OXLA 3CPWR 4WYWA 4MIBA 3FEZA 5GVQA 2IVMA 5C42B 5H1SV 3E51A 2ZZMA 1ZOTA 5J2PA 1KS2A 1SV5A 4BC7A 4J9SA 1UVJA 1WF2A 2EC0A 3HHLB 1QE1A 4X4RA 1HI0P 1HNVA 3L7PA 3CSKA 2YKQA 3DLGB 1YSJA 5J1NA 6FDRA 1ZTWA 4OLOA 2C2DA 2OSRA 3DRYA 1JNZB 4Y65A 3KK1A 1F0XA 2VFSA 3O44A 4GO5X 4Q2MA 4EUVA 2M3DA 1S99A 4NOHA 4OJGA 1OPIA 1SIWB 4O4GB 3HF5A 4XPEA 4FXDA 5KFYA 5KAKA 3A1YG 2U1AA 2OKQA 5DO2A 1SL2A 4Q7AA 2AX1A 3ENVA 4XK8C 4A8OA 1U4BA 3WDOA 1RTIB 1X4BA 1HWLA 4I0WA 2KM8B 4DV4F 3LOUA 1RKJA 1X0PA 3IWLA 5L9XA 2KKHA 5KT6A 4NCGA 4ZKAA 4DSEA 4OJ1A 5IZHA 1S1UB 1YRTA 1Y00A 3SQGB 4NYPA 2CQHA 4F50A 5KG5A 2KI2A 4G1QA 4N5SA 4MFBA 3MHYA 4NL5A 3MM7A 4XAKA 4UQGA 1JLBB 1ZETA 2VL1A 6FD1A 1L3SA 3G96A 4QPXA 1A7GE 1VQNS 1SB6A 2BXJA 3V4IA 3HO1A 4X62F 2O5DA 2IC3B 1F9FA 2POKA 1MW7A 3OTBA 1QAYA 3CULA 4Z2XA 1GXLA 4OX9F 1BQNA 1S1VA 2AP6A 2MKHA 3SV3A 4YR3A 1S10A 2AQ4A 2ILYA 5EN1A 1Y7PA 5AE1A 4JI3F 1U24A 2AJ4A 4NLUA 4RKUC 3H5YA 2ZJPQ 3MM5B 1D8YA 4RW6A 3DU6A 1NK8A 3MAQA 1BLUA 3GR1A 3T9ZA 3DFEA 1KLNA 2OMLA 4EZ9A 3OVBA 5CCMA 1C4AA 3MEGA 4M95A 5M2RA 4WU2A 1VQOS 3NKYA 1YWXA 1FA0A 2ZJRQ 2H9ZA 4BC9A 2ZHBA 3MGJA 1JX4A 3OTEA 1LFWA 2KFYA 2KHCA 1VRUA 4PCQA 2R8HA 3CEDA 2C3UA 2Y1JA 1NO8A 5GAEU 3QGIA 1NK4A 3QWPA 4ELUA 2L3MA 2PE8A 3CMAS 2YKNB 4DFJA 1J5OA 4CNZA 1QJHA 4JV5F 2J8AA 4ECYA 1LK7A 1KOOA 3MPVA 5D4PA 4NLSA 2MYFA 3AH6A 2L08A 3CCVS 1S7HA 4C3MA 4MH8A 3FZ2A 4OZ0A 3LW5C 4J9NA 1L3UA 1TVRB 5CH7B 1IKYA 4PWDB 1FK9A 4C3LA 1FXRA 4H4KC 2DR8A 3C66A 2DGOA 1W2BR 4GC6A 4O44A 1GXTA 1VQSA 1T03A 1VHFA 1D1UA 3MECB 3BQ0A 2X51A 3BEGB 2UVVA 3TVZA 4C8OA 4K4UA 4YB7A 2R8KA 4C8NA 2HHSA 3IS9A 2Q1LA 5I4MA 1TL3B 2MKIA 3VCDA 4ZLPA 2NUHA 2SXLA 1N5YB 2VG7B 2KJVA 2Z0GA 1NRKA 4ELVA 4ICLB 2VG5B 2IC3A 3VAJA 2YNIB 4E0DA 3DDNA 1U1RA 2G13A 5KG3A 2PA8D 2QA4G 2KRRA 4QIWD 3MR2A 4OX7A 1N5TA 2GW8A 1HNXF 5T41A 1FKOB 4Y2AA 3I55S 2FLNA 3T19A 3Q2SC 1WHVA 5MAOA 1I1GA 2D41A 4HVZA 3OSNA 2V2KA 4DQRA 2PSZA 1S76D 4AXIA 3G6XA 2ZE2B 5EWEA 2OSQA 3K5OA 1N88A 2I0XA 2F40A 2KB2A 3POTB 3PO5A 1XBWA 4RU9A 2EWHA 2HHPA 1QLNA 2RS8A 2HPUA 2XGQA 2XY5A 4RNFA 3PW2A 2XMWA 4O3RA 3MXHP 2FVRA 2E7WA 3I56S 2V8GA 2N3OA 1LV5A 4W92B 4FP9A 3CJ5A 4FN5A 2BM0A 2YWFA 3DMJA 1YVFA 4Y2KA 4RW9B 3BR8A 2E66A 3MMCB 5D78A 4F25A 1FEEA 1SH2A 4I7FB 4ED6A 3RAQA 1UVMA 2BVZA 2ZNZA 2XB2D 3OFGA 3I5AA 3GIJA 5K5MA 4ETXA 2DH9A 3M4XA 1G3OA 1HBMB 3BF4A 1C0UB 2J9DA 3DOLA 3K5NA 1HW9A 1DBDA 1FD2A 1FNXH 1DJ0A 1ZM3A 4O0IA 5J2QA 4WXWA 2JDJA 3E01A 2HHVA 1GXUA 5HMXA 3QGHA 2VH7A 4QW9A 3V81A 2ZM6F 3UR3C 3L3CA