4CNZA

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
100
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
total genus 24
structure length 100
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4cnzA00
1NZAA 1V6HA 2Z0GA 1QY7A 2XBPA 3NCPA 1O5JA 3OPKA 1Q1KA 4RWWA 3HLUA 3TA2A 1VHFA 4IYQA 3TA0A 1P1LA 4USHA 1NH8A 1UL3A 2NUHA 2ZOMA 3O8WA 3BZQA 2O66A 3X3UA 4CO0A 4RWXA 4OZLA 2J9DA 2NUUG 4D3GA 5DS7A 4CO2A 2J9CA 4WK3A 3GSDA 4C3MA 2RD5C 4NYOA 1XK8A 4USJC 1PILA 2GW8A 1V3SA 2NS1B 1GNKA 2GX8A 1NH7A 1J2VA 4AFFA 4WK1A 4YB6A 2J9EA 3AA8A 1V3RA 4RLEA 4RX6A 3NCQA 2EG1A 4Y6IA 4CO4A 4CO5A 4NYPA 1VFJA 1V9OA 3T9ZA 4Y65A 4C3KA 5L9NA 2XG8A 3AH6A 1HWUA 1UMJA 3LF0A 3O5TB 3CE8A 2DCLA 4USIA 3DFEA 3TA1A 5DRKA 4CNYA 4ZK7M 2XULA 2ZFHA 3NCRA 3M05A 3AHPA 2JJ4D 4E98A 1O51A 5D4NA 3AA9A 4OZNA 3N5BA 2E66A 2EG2A 1KR4A 4D3HA 3L7PA 2V5HG 5D4LA 2GNKA 2VD3A 4OZJA 4C3LA 1OSCA 2PIIA 1NAQA 2O67A 5D4PA 1UKUA 1UFLA 1H3DA 4R25A 2J9DE 4YB7A 5D4OA 2XZWA 4CO1A 2CZ4A 4CNZA 3MHYA 4CO3A 4YB5A
chains in the Genus database with same CATH superfamily
3JSRA 2ZEJA 3FCWA 4IRCA 5DQGA 4A8FA 4LF9F 2AMCB 2VFVA 1TU0B 1X5OA 1ZZNA 3OXGA 4QYZJ 2MQPA 5KFAA 3PW2A 7FDRA 2VF3A 4NL5A 4JB8B 1RSCA 4I64A 4QU7A 4WK3A 4DUYJ 4A8KA 1AUSL 3DLGB 4Z37A 3VR1A 4HT5A 4BS2A 2W9BA 5KFYA 2VOPA 1YZ6A 2KKHA 3PCOB 4URQU 1G6BA 2XMTA 2WVBA 1QSYA 2W2QP 2VKRA 2C3PA 1FF2A 2VQEF 1MNEA 2P6TA 2HFZA 3IM9A 2JLFA 9ATCB 1WDDA 4O0IA 3ZZZA 3FQKA 3HO1A 2A6OA 2QA4G 2CQIA 1WOSA 2BKNA 2E66A 3CTRA 2IBOA 3EZOA 3FBCA 2GVZA 1ZS6A 1HQ2A 4B3TF 1GXTA 2J6SA 5JVHQ 1RADB 3K89A 4YB7A 5JXSA 5L1JA 1U1QA 2RE1A 2CQ4A 2UUBJ 1BQMB 2ZE2B 1TK0A 4DWIA 3ENAA 4RU2A 1F5AA 1UVIA 2IYIA 1FWPA 2C2ZB 3MGJA 4TY9A 2AEJA 2XYGB 1FFSB 4DPTA 1RT4A 1WC6A 3BKUA 2XQCA 3C2PA 2MEWA 2VC0A 5E33A 1IKYA 1JLQB 4G1QB 2R42A 5IFMA 2HHUA 3TJ8A 3E01A 3DOKA 2R8IA 1UWAA 1GEHA 1TKTB 4NLDA 2EBGA 1TV6B 4USVA 3HX9A 3O5TB 4ZPAA 5HI7A 2HKEA 1WC4A 3HHLA 5KFPA 1NDLA 1CJUB 1SJ1A 2HVEA 2FJAB 4IRDA 1VIOA 3KLIB 3IAM9 3PIOQ 4USMA 3MEGB 1T3OA 3CO0P 4O3NA 1P8GA 5LOQA 1TL3A 4G1PA 2FJBB 1AT1B 1S9FA 8ATCB 4DQSA 2BQRA 3MM7A 3HFZB 4OV1A 4P7TA 2ZHAA 3PVXA 1TUWA 1HLWA 1FJGF 4KH1B 5CYQA 3H20A 2UXBJ 3A8EA 3HULA 3LUYA 1B99A 1HBOB 2WSFC 2IY5B 2QYCA 3ZXWA 5F8GA 2FIUA 1KS2A 1B3TA 2HBQB 4TXSA 1RHRB 2ASYA 1REVB 4LSLA 3N79A 2M52A 3VAKA 3CD6S 3PW0A 4C8KA 2VFRA 2AKWB 3WQPA 2M9KA 4DUZJ 2LCWA 1VQKS 1XJWB 3D6TB 3CE8A 4ZVFA 2DGVA 4PUOB 4NI2B 4QWEA 3Q2SC 2V8PA 3SQGB 2DY9A 4KPCA 2MJUA 4LF6F 1O51A 5D4NA 5CZVA 2CJQA 3JTOA 3GFHA 5HMWA 4P75A 2UVRA 3D9BA 3G82B 1RHKB 2PA3A 2KN4A 3QLHB 4LF2A 2M8DB 2VBWA 2JDJA 4OYWA 1AZSA 2MQNA 2V50A 1H2VZ 1S9EA 5AE2A 2HQDA 2E1AA 3U1LA 2WOMB 1VRUA 3K0JA 2I5JB 4A8YA 5IT9Y 2HMIA 5K8MA 3OLBA 2D3OR 1H74A 2IC3A 4OX8A 4I2PA 4NCGB 2RB7A 1CC8A 4OYBA 5KFRA 3MZIA 3BGUA 4J9OA 2ZM6J 1OPIA 1Q16B 3IRXA 4CLPA 3HD1A 1FX4A 3SCKE 3IMQJ 1C0TB 3GIKA 4RW9B 1Q81T 1Y3KA 5AT1B 1BXNA 3LO3A 5D0EA 2FLOA 4TQRA 3CEDA 5ETNA 3MMAA 3QJJA 2AYEA 3BREA 4OI0A 5M2RA 3J80U 3QYYA 4WFBQ 2GGPB 3IS9B 4DV7F 3QIDA 1KOHA 2COLA 3CIMA 3JB9k 1RDRA 1YLXA 2PEHA 1KTQA 1WHVA 2ZWPA 2RT3A 3OVAA 1BQNB 2DGOA 4Z7YA 1RBAA 4DUTA 1LK7A 3OR1B 3RRKA 3N4WA 2FQQB 2E9TA 3KG4A 3TA0A 1VCTA 4DLEA 1R8CA 2LU1A 1F2GA 1DY3A 2VZ9A 2NXJA 2ILYA 5D6GA 2I2YA 2ADCA 1N5SA 1RTDA 1TFWA 3LP2B 4ZLLA 3HZEA 3PRDA 1DQ9A 4ER8A 4LF1A 4NOHA 3PW7A 4BC9A 1WKLA 4HI2A 2XM3A 5B0GA 1U1KA 2FLLA 1LW0A 4CLTA 4OJHA 1OS5A 2HZCA 4B08A 5BJRA 3W66A 1SIZA 3MTJA 1S6OA 4YFUA 4LR9A 3RRGA 1YBTA 3DLJA 2ZJPQ 3R6GB 2FHJA 4YY3J 2QC3A 2POKA 3MM8A 1HD0A 3VGUA 3KDOA 5C42A 4L75A 3CUNA 3EVOA 2HG4A 1CJKB 2W01A 2BR0A 3P49B 3KHRA 2ZZTA 1FJEB 2R7UA 1UFLA 5F41A 4Q2MA 4G3IA 2B5JA 2CYYA 2RHQB 3EDQB 3VAHA 2V4QA 1NRKA 1LNQA 4DFMA 2KB2A 4B17A 4N8NA 5GADU 5KFLA 4IYQA 1ZAWA 3TI0A 2IM1A 3CJQA 3MD1A 3ZTRA 1IBMF 3MCOA 3AD9C 3NMRA 1A6LA 2UVWA 2H5IB 1S1XB 2KXNB 1PAUB 2RQCA 4CT9A 1MN7A 4FS1A 3GCXP 5F3ZA 2Y8YA 4DR3J 3TX0A 5J1PA 4LIWA 1AUDA 3KLHA 1HMVA 3DFEA 1RK8A 1HFEL 4C8YA 2WAQD 3AODA 2OAUA 5KFVA 2D3UA 4DV6J 3R8YA 1Q8IA 1HBNA 2YX4A 2Q43A 1C0UB 2DT9A 1ZPVA 4KV8A 5C7PA 2K1RA 2GJIA 4DCOB 3CCMS 1S7IA 4LRBA 2ZITA 1RBOB 2MMYA 3WC2A 3CJ0A 4K0KF 4BLGA 4LFCF 4K4UA 3J81j 3U02A 4AYBD 2ZH1A 3I0SA 1AFIA 3SXLA 2XO6A 3KKFA 1SC4B 1VQMS 1RTHA 2W7AA 4ECWA 1VMBA 2AV5A 1F2HA 2MKCA 3IG1B 2R7RA 5KG3A 4CLYA 3A3NB 4ZA1A 1UZHA 4J9RA 1CG2A 5E3RA 3I82A 2HRTA 3NKYA 3ZTOA 4X64J 3OL6A 1PIEA 2CDRB 3W1YC 2Y9HA 2MQQA 1NHUA 4FVMA 4LSNA 3W9HA 4DR6J 2YQ3A 4PYAA 3GILA 5IV3A 2D7SA 5DLGA 3C19A 1WTFA 1CULA 3S1TA 2DHAA 1VBXA 2I6WA 2CPFA 2HQFA 3U27A 1H7XA 2D9PA 1RKJA 3HZGA 3RBZA 2GO9A 5LMUJ 2E5JA 4HHUA 1YJRA 2GAHC 1QDUB 2M70A 4LRFA 2JEGA 3D7SB 1YRUA 1LKZA 1X5TA 2RHSB 4HL9A 1RP5A 2FUG9 4DN0A 2VUGA 3A8IA 2QT7A 1IWGA 2HRYA 2A0FB 3J80Y 1HPZA 4ECSA 5F8HA 4NMXA 3DGVA 3NGRA 5F8JA 2B9XA 3HCXA 4ZJQA 4GC6A 1YI2S 2EC2A 5HVFA 1FWKA 2QA1A 5EGYA 1FNMA 2KFYA 2FHMA 4L3KA 1LWCB 2GVZB 3CDWA 3PFOA 3F56A 3FSYA 5HQLA 1X8DA 1S0NA 1S4FA 4KRWA 2VHGA 1KQSR 3EGVA 3C8YA 3GFZA 2PGCA 2HGMA 4KHPF 1UZDA 1NMEB 4JI1J 2FVCA 1MWQA 2EFQA 4A8XA 4WYWA 3MTKA 1RT4B 1LXNA 1RWXB 4Q8FA 4F50A 3JQMA 1TMJA 2XC9A 4PWDA 5HROA 1H3DA 2Z8QA 4FNHA 4ANDA 1WHXA 3E01B 2MQ8A 3KHHA 3DOKB 5HL7Q 2BVZA 4Y2AA 2XS7A 4AQYF 3M8WA 4J9PA 4OJGA 1IBLJ 3CW2C 2NUHA 3HHLB 3O8WA 3EVWA 2C2KB 1T05B 2KZMA 3QATA 5RUBA 1HR0J 1A7GE 4O4GB 3MI7X 3CMQA 5LL6d 4TU7A 2HVDA 1EETA 4WK1A 5CXTA 2DIVA 2OD6A 2E1CA 5A2QU 1IM6A 2HSEB 3KK3A 2ALYB 2DHXA 3GR0A 3QT8A 3DDNA 3UDVA 1HNVA 2I0XA 3DOMB 1TKXA 3DRXA 5FLXU 3G8TA 3SV4A 4GKKJ 3ZFVA 1FT8A 4IOCQ 2UXDJ 3TRGA 2KT2A 4DV1J 1R43A 2CQ2A 4B3MJ 3NGUA 1PJ5A 3IO1A 2NREA 4IRKA 2LP4A 3I5BA 4LSLB 3KMQA 2DRAA 4DR7J 3T6JA 2KTQA 3K5NA 3TANA 5AJ3J 2F7VA 3F44A 2Z2MA 2PFDA 2E1PA 4MMOA 2L48A 3LP0A 1XN9A 3O44A 4KT0C 1G3OA 3CCUS 4X66F 3IN5A 1NEEA 4XDDA 1Q79A 4I67A 5DM6Q 2GAGC 3OLAA 4LBIA 1S9EB 3FEXB 1WF0A 3QJPA 3S8SA 4EYHB 4OMFG 4NCBA 2W8LA 1N36J 2BA9A 2OPSA 4Y2CA 2HK3A 2FZCB 3LQVA 2XMMA 4J37A 2YNIB 4I2PB 5IWAF 2E5HA 5HVHA 2IVFB 2FHOB 3FBBA 2CQCA 1APSA 5ETPA 4R8UA 2VODA 3IRXB 1VISA 5A8RB 4B9VA 3MHYA 4DR2J 2FJDB 1QY7A 1VOMA 1PYOB 2LDYA 3CGIA 2ZH9A 3JYTB 3M2RA 2J7UA 4M5KA 3H2UB 3AB2B 1YITS 3LP1B 3CCSS 2P9EA 4D3GA 4RUCA 3AD7C 4HYKA 5ETQA 4ZPTR 2KXHA 2CADA 3O1LA 1QAYA 2HAIA 5K8OA 1R0BG 3SMZA 2HHSA 1JLEA 3KTQA 3AH6A 4LF8J 5DDOC 2NPIA 2CQHA 2AJ0A 2KM8C 1UVKA 4K5RA 4HLBA 2C2RA 3GP9A 5L46A 5AE3A 4R0JA 3TZWA 3QMQA 1X4DA 1KQFB 2DH7A 2DR6A 5HQ8A 2DGTA 3CJ4A 4N47A 3Q8QB 3DLLQ 2ZH2A 4I56A 2KVIA 2NZ4A 3OXFA 2CG8A 2ZZNA 4WIQA 4QIWD 3QAUA 1S4EA 4HDHA 3ENWA 4Y34A 1TUVA 3MR3A 1LW2A 1XR7A 1D09B 4B3SF 1R8AA 4NPOA 1UL3A 4EZ6A 4GO7X 4C4WA 3H5YA 3OTBA 4M1KA 2MKKA 3KHGA 2KFNA 2PE8A 5C42B 2I1RA 2DHSA 1FRHA 3Q8YA 1TL4A 1N33F 4N77A 1XIQA 2K3IA 3MMJA 1RE1B 3LAMA 2B5JB 3THPA 4NX9A 2P8IA 2DPIA 3FRYA 2KZZA 3UCGA 1ZPWX 1EZZB 1DQAA 3P5TL 1PJ7A 4IR9A 1KR4A 4LQ3A 1RWKB 4JI2F 3M1VA 1G1XA 2NZCA 3L4BC 3I5CA 4NZ6A 2U2FA 4LT6A 1RAOA 4TYBA 1U49A 4JBCA 2H5JB 1FEHA 2YH0A 2DNHA 5KAKA 4OIXA 1TTHB 3A3PB 3JQJA 1URNA 2ADBA 3CNQP 5DG8A 1VRTB 3KLHB 3OJUA 3AOBA 2V4RA 2RNEA 1FTRA 2JWNA 3I56S 4YR2A 3VGSA 4P7VA 2DBBA 5K14A 3DCAA 1YJNS 1HBNB 8RUCA 2C1EB 3EGZA 5FDLA 5HAOA 4DL6A 3DU5A 3C6UA 2OSRA 3D6MB 3HT3A 3CMAS 5E2QA 2VIHA 3PACA 3BQ2A 2CQ3A 3M8YA 5DDRC 5HP1A 3TEGA 1RT6B 1RTHB 1RWOB 1RTZA 2HPUA 1RYRA 2N7YA 1FI4A 3KLFA 4M5HA 2ROPA 2XGPA 3L09A 3W62A 4IFVA 1H98A 2NSCA 2R8HA 4MIBA 2QMUB 3V6JA 2P9GA 5KG4A 4DZ6A 1FERA 3BBFA 2LXIA 4FYVB 5SZTA 1UAWA 3O3LA 1JKHB 3BPSP 4KKOB 2A10A 4Y2MA 2JNJA 4K2XA 2VJUA 2BABA 1HI1A 2Z56B 5GAGU 1RACB 2AYMA 1NB7A 2YPZA 2XI2A 2YKOA 4Y6IA 4JI8F 1RABB 3IR7B 5IT0A 1E6YA 4ZDNA 2VG5A 2WCXA 3ILOA 1DJ0A 2HS3A 3GIRA 3RZAA 1PSDA 1VQSA 1HPZB 4TU8A 3CC7S 5GMEA 4RW7A 1Q5VA 2G0IA 3MR7A 4QYRA 2BJ1A 3NEKA 1K47A 1ZAXA 2EWHA 4U6PA 5GAGI 1B7FA 4CH7A 1B4SA 2IPOB 4OYMA 2LMIA 1YJTA 5L39A 2BEFA 4NLVA 1I3OB 2RS8A 2BW2A 1F5BA 2KL8A 1WTBA 4J9VA 3FK4A 3TOQA 4QWBA 2GHVC 2MKSA 3LOUA 4AXIA 1KLMA 3UDCA 2XLIA 2ZUGA 2F63A 2AQ4A 2ZHBA 1WHWA 4PWDB 4TLQA 1RWVB 2C22A 3N5FA 3VZHA 1QJHA 1RTJA 4YS2A 4X65J 4DR4F 1DARA 3D54A 2OLWA 3R7SB 1X4BA 2XYPB 3PJXA 4MKBA 4MIWA 4QW9A 1OMSA 2O3DA 3UWTA 1CEZA 4O3QA 1M5KC 4CYUB 1MU2A 3TARA 1RAEB 3MM6B 4PQUA 1AYEA 5M2UA 2V9KA 2GNKA 3MECA 3PTWA 2AGOA 1SKSA 1EETB 2CAJA 1RWMB 4QPTA 2IRYA 3KK3B 4LRAA 2C3UA 1RT5B 2V8DA 4IO1A 3H5SA 1BLUA 2HBRB 1FJ7A 3UI3A 2B9EA 1Y5NB 1TKXB 1TR0A 5KFSA 4F7VA 3FCVA 5CZXA 2RILA 1WF2A 5U47A 1HI0P 3CJ5A 1MG7A 3B54A 4K59A 1M5PC 3MUTP 5KFFA 4DQIA 2GS8A 3UDEA 4HEA9 4L74A 1QVGR 4ZVHA 1BWEA 4USIA 4X4SA 2QLXA 2HVHA 4MJKA 7AT1B 3CD0A 3NGSA 5LMNF 4I6WA 1DAXA 4Q7AA 3TEHB 1D3WA 1I94J 3NAHA 2C2EA 4B9LA 1FFWB 4J5OA 2OO4A 1YQHA 2CZVC 3AB4B 4XPCA 1NPPA 4CIOA 3BR9A 1FK9A 4YB5A 1FDNA 2EFGA 3V4MA 2VA3A 2WSCC 1RUSA 3CIZA 5D0GA 1K9MT 4ZVUB 4JV1A 1HW8A 4YHHF 2BE7D 4RNHA 2C42A 1ZTTA 1TL1B 5ADZA 1BUXA 2DTJA 3CJ8A 3UO0A 3TUZC 4HT7A 4CO0A 3BYPA 2OPSB 1YK9A 4UZCA 2ZJRQ 3G6XA 2JHEA 2ZDOA 4ZP7A 1YJWS 4O3RA 3EZUA 5ETLA 2ZC3A 2FTRA 2CQPA 5M2PA 4PG7A 1WWHA 1RTIA 4R8UB 1DHMA 4PG8A 2KXFA 4ILLA 4BWMA 4ZITA 1ZM2A 2DCLA 5CABA 2MKIA 3RB3A 5HK4A 3M2RB 3VVUA 4B3RJ 1Y9OA 3UQSA 4CLWA 3KK2A 2NPFA 3A1YG 1N32F 3QGIA 1ICEB 1S76D 2UUWA 1T9UA 4C3LA 2HWTA 4DV2F 2CPEA 1D8YA 2J9DE 4QIFA 1RCOB 5T41A 1U6ZA 2XZWA 1WSRA 4ECZA 4KTQA 1VLYA 3KNAA 2OP5A 1Z4UA 2M5YA 3TO8A 4WP9A 1BHNA 1ZM9A 3VGVA 1SC3B 3OFGA 2HVZA 1S97A 3CJRA 3W64A 4EU0A 2DNPA 1CS4A 1NSAA 2JSXA 3MF5A 3NLCA 2KG1A 3DHWC 2GFFA 1N34F 3FZBA 2FJVA 3IA0A 1NNDA 4K50A 1HNZJ 2M8HA 1FRJA 3AA8A 4XTTA 2XZTB 3NGKA 3ZZPA 4ILRA 3EE3A 2N3LA 5HLFB 2DNNA 1KOOA 5CHCB 4DQPA 3OFHA 3IBFB 1MMNA 3MR5A 1HW9A 3H0PA 1LW2B 3FEZA 3GLJA 2BBEA 5IV4A 3N6MA 3R5AA 4I2QA 3T41A 3ISNC 2B56A 3TUPA 1ELOA 3RB0A 1U26A 1NAQA 4B02A 5A8KB 2HYIB 2VFSA 4JV0A 3NMAA 1DBDA 2WVFA 3GJQB 2H4WB 4DF8A 5ETTA 1MSWD 1U02A 3T1YJ 4ED1A 1VI7A 1Y10A 3TVYA 3GJSB 2V63A 4X2BA 2MXYA 4PG4A 3EXCX 1GTHA 3C3LA 2ASLA 2K06A 4FXWA 4NXMF 2Z2LA 3GTYX 2LU2A 4JI4J 3KJNB 4DU7A 2HHXA 3EVMA 4KJIA 3VAFA 2F4FA 3MAAA 3HK2A 1R3NA 3MR6A 3W9IA 1HWLA 1L3VA 2DGXA 3M1VB 5MAOA 3BGRA 4DL3A 1Z1ZA 5HJXA 2WVEA 4BC7A 2C3MA 1S1VB 1ACMB 3SZ2A 5GMKa 2R9LA 2WONA 3ONQA 4K8RA 1HBMB 4C11B 4OI2A 1UVJA 4JV5J 3KUGA 1DTTA 4KYZA 2R7SA 1MWZA 3LPYA 2CQ1A 3OVBA 3JTNA 1SJ4P 3I9V9 1R8HA 3BO3A 2YKPA 3ZZRA 1VJQA 3R5JB 5T14A 5C2CA 1KLNA 3LGHA 2L9WA 5G0RB 4B9UA 5CAAA 4DV4J 2DNOA 5FDLB 1P9YA 3CULA 1GXUA 2ZNYA 1JQGA 1NHVA 2MY7A 3JSYA 5C24B 4M94A 1T11A 3UN2A 3ELHA 4F2SA 4KO0A 5C25A 4DSJA 2UU9F 1HYSB 3B82A 2B7CB 2LQBA 4USJC 5H9EJ 3KLFB 1X5SA 4QIGA 4WYLA 4USUA 2GMLA 2FC8A 3ZNJ1 1G2EA 3R5BA 4DCPB 1RAAB 1ZM3A 2CNLB 4JI5J 4QOTA 4LSZB 2FPHX 4JI7J 1OJ4A 4M63A 8AT1B 3MDFA 4N8OA 2YH1A 2EFNA 3PXGa 2ZZMA 3HMJG 3I31A 9RUBA 4MFBA 1BY9A 2ZH3A 1QD1A 4EZ9A 1L3TA 2FGOA 3THTA 1M1KT 2Z30B 1CJTB 3FBEA 4LF5F 2LQ9A 5EX3A 3PR4A 1U2RA 4TY8B 2ROEA 2V9WA 3SFGA 5IXUA 4K7QA 3M2VB 2E44A 1O5JA 1E6YB 2K7KA 4J9QA 3ETOA 1WG4A 2MHEA 5B08A 1F0XA 1LWFA 4GKJJ 4K4XA 4J9UE 5THWA 1WSVA 3MPUB 3VQSA 1KVJA 4I69A 1YRXA 4EI2A 4F04B 3MD3A 1M90T 3SCIE 4PPDA 3DLGA 3D1QA 1LFWA 2IM0A 4FS2A 1NM2A 1T95A 4I1TA 4O4RA 4DR1F 1VQNS 4WPAA 1UWBA 5D8HB 1XR5A 3K57A 2H4YB 5C5JA 3POTB 4N7TA 2QL7B 2PSZA 4DFPA 2KJVA 2LQ8A 2Y8WA 3KK1A 1Y00A 1ZZFA 3BR8A 1GX6A 1SKRA 1KLMB 2WBMA 3G6VA 3FSIA 5EWFA 5D3GB 3KJFB 5KFMA 4DV5J 4ZPVR 1HD1A 3HKZD 3M6VA 1N56A 3VTIA 4KHRA 2G2ZA 1NK5A 1ZH5A 3CDUA 3HSDA 3UN3A 1RTJB 4CLFA 2HHHF 3W3SA 2J5AA 3BSOA 3A4TA 1NK9A 2DR9A 3RRHA 4DSFA 5JVGQ 5DS7A 1KFSA 1MU2B 2ALZA 3AY0A 1W26A 3VGTA 3H4DA 4IG0A 1ZTWA 3Q24A 3G6ES 4JI0J 1XNRF 1RHUB 2PI4A 2AWZA 1I6JA 1C1BA 2OMOA 4NWBA 3ET6B 3GU0A 2ACMA 3QT5A 5HN0A 1A0OB 2GO8A 4DV0J 4ZVEA 2HRUA 4G1QA 4F0KA 4V19J 1XNQJ 1IKWB 4ES1A 2AX0A 3QAEA 3MR2A 1IJEB 1U1OA 1TV6A 2F1FA 1S1UA 2XY6A 4ZPCA 2XI3A 2VKZG 2AJQA 4ES3A 1JLCB 1CJUA 5K20B 1KVIA 5J2PA 1TKZB 3KLIA 5BYQA 2B9WA 3FQLA 1D8ZA 3MEGA 3IR6B 2DXDA 3PG9A 2DNRA 3HXMA 5BR8J 3SCLE 1NSQA 1GFWB 1HNXJ 3B6BA 4USHA 1UTAA 3K2YA 2CVIA 5GVQA 1WEXA 4PWUA 4BCAA 2ASJA 1UVNA 2V68A 2W7OA 1S1TB 4KPYA 4CDIA 4B9NA 1YJVA 5F8LA 3NGTA 5A8WA 5KFTA 4F3QA 1DURA 3JAMU 1IKXA 5CCLA 2NYHA 3D6HB 1JLGB 4LF9J 3NCQA 1HBOA 3ENVA 4CO5A 3TZZA 1ZETA 1U0HA 2J0QD 1YGYA 5KOXA 1RT7A 3U7JA 4RL1A 3D0GE 4AL7A 3IWNC 1IQZA 1FK9B 2CPYA 1FJCA 4A8QA 3IR5B 4X4PA 3LF0A 4ALZA 1S7HA 4X4QA 1REVA 2FY8A 4MKVA 3MCMA 3T1AA 3EDRB 3L7UA 4X4VA 3RGIA 1N5VA 3F0NA 4NYZA 1S0OA 1H38A 2VQEJ 5T7LB 3HF5A 2VICA 4E8UA 1UKUA 3OHAA 2WW4A 1LWXA 4CP5A 1SJRA 1UPMB 3H2LA 4CO3A 1UW4A 3M32B 4GVLA 1FA0A 2RQKA 1RXOB 1SH0A 2KVQE 4F36A 1IVZA 4EMDA 4B3TJ 1W25A 2QV6A 3BZQA 4MK8A 3IP0A 2YWEA 2XCAA 3BH6B 3PKMA 2WOMA 2YQ1A 3RW6A 5F8MA 2DR8A 2I5JA 4J7CA 3K7RA 4WWSA 1KSPA 2R2SA 2AJFE 2CJAA 1D1UA 1JLBB 4Q44A 2G0CA 2GMHA 3OTOF 1YBUA 1U1NA 4KY3A 3H5UA 2L41A 2Q3PA 2RU3A 1RWPB 3AAWB 1GK8A 1VQYA 2WRMA 3RJMB 3H98A 1VQOS 5H9FJ 2DNZA 1C0TA 5I4MA 4W92B 4RW9A 5CYJA 2QYGA 3HHEA 4RW8A 4OZ3A 5DDPC 2XO7A 3ILJA 3UDLA 3E8OA 4KB7A 4EBCA 2F65A 4HR2A 1SC6A 1I5OB 4QBUA 3SSSA 2VD3A 3UD5A 2UP1A 2LQJA 4NLXA 2XHWA 3HP6A 3OL7A 5CCMA 3HVWA 2C2DA 4JI3F 2YQ0A 3D0IE 2QLJB 2MGZA 3OD2A 1VK3A 2BV3A 2LA6A 2B0GA 2F8HA 4K4ZA 2G9OA 3SBMA 2GJFA 1WJ9A 4RWXA 3VF0B 2MZSA 1B0PA 1VHIA 2AYGA 1NK6A 2QG9B 5KFNA 3H7HB 4YUDA 1PC4A 4I2QB 2VG7B 4KHMA 1XR6A 3TJ9A 3PJWA 1EAYC 1FJGJ 3L3CA 3R1LA 4X4TA 2HNYA 2ZOGA 2BXJA 3D66A 2DCUB 3ULHA 5DQIA 2W2OP 2XG8A 2YWFA 3OVSA 5EWEA 3HPOA 3U1MA 3DI6B 2EEYA 3NOGA 1JJ4A 1RB0A 5DETA 2V8HA 4PG6A 3GIMA 2M3DA 2YX1A 3QWUA 2B6AB 4QPXA 4U7UD 3X1LB 3F73A 1PGZA 1SJFA 4ITSA 3AQPA 5E41A 1U25A 3IWXA 1XC9A 1IR0A 4LF6J 2M4MA 1VBKA 3HLUA 4F25A 3MEDA 1FFGB 1JB0C 2X51A 2HGLA 1VQPS 4KFBB 2WONB 3WHIA 3AFGA 1PYTA 2OMLA 1YX2A 2YX7A 1VR6A 4CLKA 5EUHA 4ZP8A 1LXJA 3WIUA 1C4CA 2IDEA 2APOA 4Y2KA 2F9JA 1FO1A 1SL2A 2R7QA 2O1PA 2X3GA 1TUGB 2DNLA 4HHJA 1U0SA 2VOOA 1O6XA 2KT5A 4J9KA 3KYLA 3DLKA 4KO0B 5C25B 1HQEB 1M5OC 1NCLA 2DEJA 1HNIA 3TX8A 1HHQA 3C15B 2AJ4A 4YN3B 3MFIA 2VDIA 2XS5A 3ZTQA 2B8PA 1GTEA 2XMVA 4LFAF 2CNOB 5GAHU 4DPXA 3KLVA 1Q0NA 3M30A 4ECQA 2B8QA 3J7YU 3ISND 4ZPDA 4DV7J 5BYSA 4R5PA 1RWWB 4EFAC 4ED6A 1N5TA 1T03B 1KKHA 1GMWA 4K5SA 1WOOA 4JV2A 2IM3A 4A8WA 4PXEA 1S6UA 3IG1A 2OPRA 4PABA 5GAHI 4NA3A 2W9CA 1HHSA 1EKSA 1D0EA 5KFDA 3TVZA 2E5IA 3J7YI 1NJWA 1RT2A 1S59A 1X4EA 2NQPA 4AE5A 1IBKF 1HNWF 3DHXA 2J6TA 4OZ5A 1Q82T 1LFPA 4TQSA 2KYXA 2GQCA 1LWFB 2QSWA 4ANEA 2MLXA 3I55S 5AXMA 4UOGA 2GC8A 2EKYA 4ETXA 4ED4A 5LJ3Y 3QT7A 3ICLA 4DN9A 1HIYA 2HZAA 1F5CA 2BOAA 2BM1A 3HKWA 2JVOA 3CO9A 2GHWA 3CWJA 1UWBB 1EKRA 1UJ5A 3X3UA 3Q8UA 5AXKA 1KQGB 2Z57B 1KRPA 4G6VB 1UCNA 2YKAA 3LH2S 2U1AA 1RA6A 3LWLA 2PT0A 3KK1B 2XMAA 5K5MA 2EFPA 1M5HA 1PBAA 2HNDB 1YTYA 4X62F 3H4BA 4CWBA 2VONA 1NXIA 2R8JA 3D1HA 2IYGA 1JLFB 5F8NA 1IBMJ 1SQGA 4ZMMA 1LWCA 4A8SA 2D3ZA 4DPUA 3Q83A 4HTIA 4GRSA 3BGLA 1LK5A 3T5KA 3RAXA 1U09A 3QIPB 1S6PB 2P2CB 2DIUA 1SKWA 5C2GA 2V5HG 2OKQA 3V2UC 4LF4F 2HNZA 2KG0A 1WI6A 3PFEA 1RU2A 4IG0B 2D41A 3IGNA 3HVTA 4ID5B 1FDDA 3VVTA 1C1BB 3DGPA 3CB4A 4YR3A 5E7OB 2F4VF 5D0HA 4X4RA 3VAIA 4N41A 3WDOA 3UE2A 5CQGA 4DQRA 5FIIA 4O3PA 2N7CA 1NJXA 3K8VA 4K0KJ 1IKVA 2G2YA 4LFCJ 4C8OA 1S1UB 3OT9A 4A8MP 2MQMA 1N5QA 1R7IA 3C6TA 1T05A 1S77D 3D3CJ 4ECRA 2DGWA 5J2PB 1UW9A 4O4GA 3PZPA 1AB8A 4TNOA 4F4XA 3G71S 3W9JA 3UPFA 4UF4A 4J9NA 2W4DA 3B4DA 2CG4A 1K8AT 4DL0C 1N88A 1BWVA 2DISA 1AW0A 5ETRA 4OI6A 2KH9A 3OQ2A 3K5LA 2RKIB 1NSPA 5ETMA 2IAJB 3N28A 3DOMA 2B4OA 5LM7E 2BX6A 5KG5A 5A8WB 4U96A 3BB5A 1IKXB 3RW7A 1IWAA 1VS3A 3AQOA 4AL6A 4ZIWA 4FKXA 2PI5A 2ATLA 1WELA 3QO9A 3KUEA 3R5CA 2B4VA 3PKYA 1U0HB 1RT7B 3HFVA 1KHWA 4NLWA 2CWXA 2WBRA 3MOZA 2JZ5A 5GMDA 3ZZOA 1U6BA 4WE1A 3HFKA 2RRNA 1T9VA 3ILIA 4ID8A 3K8WA 3KG1A 1U4BA 2V94A 2C28A 4NYOA 3MPDA 4I4BA 2UZAA 3M8ZA 5IQQA 2LECA 3UFCX 2YWKA 3Q89A 1EB0A 2LQ5A 4A46A 2BJ9A 2GJ2A 1VIXA 1NPRA 1PO6A 1VQLS 1Q5YA 3HHDA 4CNYA 2LEPA 3V6DA 4RNMA 3RR7A 3AJDA 3BDPA 1OY8A 2ZWOA 4Q0BB 4QYZK 3SI8A 4KHPJ 4BHQA 2YNIA 3ISZA 2H9ZA 1GMVA 5IC6B 3OV7A 2VPWB 1KONA 1WC5A 5CD4A 5EWGA 4B3OA 3TAMB 2QLFB 1U8WA 2QIFA 4LF7F 5A8RA 2IA6A 3OUYB 4RZRA 4YR0A 4JP8A 4V19X 3QRQA 3FMBA 3NBPA 4PCQA 2LKZA 4RW8B 3OHBA 3JYTA 4Y0FA 4NCAA 1WF1A 2G1DA 3LP1A 1SJ3P 2D1CA 4AQYJ 3HJFA 3B4MA 3MURP 3MM5B 2Y3YA 4NLQA 3L95X 2BYCA 4MYUA 5KFUA 4QU6A 1IUJA 3CJKB 2FJXA 1TAUA 2IM2A 3Q2TC 5A6PA 4DU8A 4DLGA 2MGZB 3CDEA 1MROB 2IRUA 3V81B 4OQJA 3MFHA 2PFFB 2Q79A 3D1OA 4U8YA 4UQGA 4ZKAA 3M7VA 1Q7YT 3FC9A 2MQLA 1VBYA 2Y1RI 2PN6A 2GQ2A 3LGNA 5J2NA 1Q95G 1I51B 3T5HA 3R6LB 3WZ0A 3HHLC 3N9UC 4XK8C 2YKMB 5SUHA 1SQEA 4DV3F 2R7WA 2DD8S 3UCZP 3FFIA 2HNYB 4E0DA 2E1MC 3KJQB 3BO2A 2GQQA 3OR2A 3Q23A 2N82B 4ICLB 4OYPA 2OUGA 2AJ2A 2DNKA 1ZA2B 2PD1A 1VC0A 1K0VA 3DNCA 4RNFA 2D3O1 1V3SA 1TAQA 3LTOA 4NXNF 4WTYA 2OI2A 4L73A 2BZ2A 2RQ4A 1HI8A 2V2KA 2OSQA 2NR0A 2B3TB 2MZJA 5KG1A 4PXCA 1QSSA 1P1TA 1U6FA 4IKAA 4O3SA 5KT3A 4C48A 5DQHA 2QRRA 3G8QA 2YVSA 3HT0A 1F9FA 2LXFA 4X66J 1XEZA 4C2MA 1J27A 2HQGA 2JL9A 2PC6A 1JXLA 1E6VA 4OI3A 2QA4S 2CXEA 3MEDB 5K8PA 3TZXA 1GT8A 4P9SA 4UOCA 1RI7A 2AEFA 3E3XA 2IFXA 1FKPA 3TW0A 5D4LA 2YNHA 4RPFA 3BSNA 2PIIA 2ZUAA 5D4PA 4U9RA 2RF2A 5HO4A 4XDCA 2GZOA 4I6YA 2DR5A 1DQ8A 1RT1A 2R2RA 3M6UA 2C2NA 1K1QA 5IWAJ 1NH8A 3C66A 2XS2A 4N56A 4CZCA 1NU4A 4OFZA 3MXHP 4IUFA 2N4CA 5A0YA 1IQTA 1YHQS 3DLKB 3US5A 5GADI 2NSBA 4QCLA 1HNIB 1VRTA 3OXLA 5DGAA 3L9ZA 3EMTA 2CNKB 1F3FA 2VQFF 2ZBCA 3M4XA 4MAKA 1FRKA 2A18A 5F0UA 3GFXA 1GXLA 3DKDA 2AP6A 3W5XA 3M30B 4DX5A 5B0EA 2HURA 1IM4A 4Y3CA 4QIVA 3R9LA 4R5PB 2P6SA 1IJFB 2Z58B 4LIRA 1WG5A 2MLYA 1AXQA 4CM2A 4KSEB 1TL7B 2NCKL 3MPVA 3SCJE 1RT6A 3WX4A 2QFIA 3R97A 4RKUC 3K5MA 1J5OA 1H72C 1RZMA 2OPRB 4P2MA 1FWLA 2CPZA 1WNEA 2W9CB 1X4CA 2NXNA 4MKAA 3ITHB 2FVQA 2MKYA 1RT2B 2RQMA 4H4KA 2E9RX 1UEUA 2C3YA 3KUHA 3A12A 1T9WA 2G4BA 1N5YA 1QUVA 1JKHA 1MMLA 1UFWA 4WKRA 3VQTA 4PEOA 3BN4A 2HLTA 3N6NA 4KKOA 4JYAF 4MKYA 2HFSA 1OY9A 2XMJA 4CRJA 5CD4H 3J7ZT 4Q8EA 2Z2YB 1R8BA 1T7PA 4B3SJ 4F3MA 2HZVA 5E3AA 3I4HX 5AE1A 2F40A 1Q78A 3EICA 3JTPA 1JJ2R 3CCJS 1FXLA 1R8PA 1N33J 4J9LA 3MMBA 2JVRA 3TJAA 2EG2A 2FJWA 1J5EF 3P6YC 1UVLA 3C16A 2FJEB 3RU0A 4M5DA 3EYZA 2OEMA 2UUAF 1RLCL 1CC7A 2D74B 2KI2A 3ZTSA 3QRRA 4J90A 4NEYA 3GMGA 4G1IA 3H8YA 4DZDA 2RMLA 3DRPA 1NKEA 1EP4A 3ZZ0A 4JI2J 4DL2A 3CCZA 2BANA 2IA0A 2IRXA 3SYZA 1WKJA 1XK8A 4WU3A 2VBXA 2HFOA 4USTA 1VQ7S 2JX2A 1RCXB 2WB1D 3MOJB 4MK9A 2HNZB 3QGGA 2BQ3A 1HHTP 2PDAA 1FKAF 2AGPA 3HVTB 4C3KA 4WIIA 5ITHA 2DB1A 4AXJA 4WFNQ 1M0SA 3TA1A 1PAEX 3DGPB 2UVVA 2OFGX 4PKDB 4DCJB 3IAS9 4C0BA 4DL4A 4HDGA 2QL9B 2ABYA 2ERRA 2KJWA 4ECYA 1Y5IB 3N01A 4RW6B 3KJVA 5HVGA 3GYXB 1IKVB 4FYDA 1YZ7A 4CYUA 2Q66A 1LWEB 4QR0A 4C8MA 4ED0A 2RDJA 1TVRA 4CH0S 3C6TB 3MM6A 2F9DA 3GSIA 3CD7A 2DRBA 1OQ6A 5HQMA 1IR1A 3AJ2A 1Y7PA 4HTJA 2H51B 3GR1A 5D0RA 3GPAA 1K73T 4YOEA 4RBUA 1S72S 1KWMA 2B43A 4DQQA 1RT5A 2C2MB 3NS5A 2HWHA 1X9SA 4USWA 2Z4PA 3MPWA 4B9TA 2BKOA 3GZ7A 1UA0A 3LALA 3KWMA 2ILZA 3RYLA 3GYNA 2FHKA 1Y0HA 4MH8A 5L9NA 3QBCA 1SCJB 3J81U 2VG6A 3QO9B 2WSEC 4F8RA 2QMWA 2UV8A 2G13A 1SI9A 4UOHA 1SXLA 4LQ9A 3OL8A 3I4PA 3QZ8A 1NDCA 3FZ2A 2F3JA 2EC0A 2AW0A 3AHPA 1Q86T 4JI8J 2OIHA 4WE1B 3RB4A 3CD5A 4CT8A 3ETMA 3NXZA 4IQXA 5D78A 1JMTA 3NOCA 5ETKA 1PYSB 3N6LA 1VQ9S 1T94A 2RU9A 3K59A 2A6MA 4YP3A 2QTWA 5B0DA 4FBTA 1HQUB 4Y00A 3TQ1A 2OHDA 2CQGA 4F4AA 2DJWA 1BC6A 2HQIA 4Q5VA 5KFEA 1S48A 2AYBA 2RDDA 2ZOMA 2RRBA 5I42A 3MAQA 3AT1B 5HANA 2DH9A 5HATA 3V6DB 1Q7LB 4FF2A 1TL1A 4RJVA 1UFKA 5E0OA 1X60A 4FDFA 4CLUA 1V3RA 3R2CJ 4F2RA 2YKNA 4NYPA 2QFJA 1XMQF 3RUBL 1RISA 1M1HA 4ED7A 2KT3A 1F1BB 4OZ2A 2J8SA 5F3TA 1VLOA 1JXVA 1ZYQA 3DLHA 4B3OB 3CC2S 1QAXA 4PZVA 2QLBB 1KQKA 3M05A 2L08A 2PO4A 4XAKA 3NBPB 1IBCB 4OYOA 4RR5A 4D3HA 4DR4J 1X5PA 2AIRB 1G7CB 2UUCF 1QSLA 2RAQA 2FY1A 4ZVQB 2V67A 4P73A 1X0PA 1HWJA 4UY85 6FDRA 4PPZA 2XB2D 4RNNA 3K5PA 2V2ZA 3ZZUA 1I1GA 3VZIA 3BKFA 1M1GA 4DOZA 1JX4A 1HWKA 5CYMA 1FX2A 2X1GA 1FDBA 4OYXA 3VAGA 3AXKA 2MZTA 5J2NB 3UR3C 3RR8A 4ERDA 2OJ3A 4NZ7A 3FFIB 4KGZB 2FVSA 3KFWX 1BMQB 2CKWA 4RUBA 4ENOA 3CJ3A 2CVEA 1NJIT 2R7VA 1TQLA 2UUTA 1VQ4S 4C6AA 3M8QA 5HLFA 3OR2B 2E5LF 2G1HA 3E51A 4OZNA 2I9SA 1YJ7A 4WXWA 2K3KA 3OSPA 3T1HF 4C8NA 2XNQA 1MLAA 2XMUA 1QAIA 4RUHA 3MEEA 5LMNJ 4CQ1A 2EPIA 1NZAA 2Z0GA 4RNOA 4HACB 1S49A 4DS5A 5A8KA 1HBUA 4JI6F 4WU2A 2CJKA 2YWWA 1KEKA 2CZ9A 1E6VB 4UUXA 2R8KA 3KMSA 1SH2A 3H59A 1FKPB 3D5MA 4YHHJ 2YNHB 4RLEA 4LFBF 2M88A 2DITA 2AZ1A 2H3EB 1SUQA 2RF2B 4ZPWR 3Q8SB 3CJTA 3TP2A 3D3BJ 1RT1B 4YDDB 1PG5B 2BDPA 4ZCMA 5I3UA 3QPIA 2Z2ZA 3UD4P 1FKOB 3JSMA 4C0OC 1S1VA 4ZVGA 1GH8A 3BEGB 1KFDA 2CPJA 5LXYA 5A0YB 2QN6B 4Q2LA 1HBMA 4C11A 5B0AA 3K58A 4F0MA 4AT1B 3J81Y 1QVFR 1EARA 3R5GA 4M5LA 4KR0B 5L9XA 1C2PA 3PYDA 4DR5F 1N32J 1FDAA 3EGNA 5G0RA 1K1SA 3HHLD 4M5NA 3M8RA 2A2CA 2BJ8A 5KTQA 2CJXB 4HHHA 4DV2J 4K4YA 3GQCA 1PJ6A 5C24A 3DRRA 4W90B 2EK1A 4ED3A 2L3MA 1D9AA 3QT6A 1VJWA 1SPBP 2IBKA 1HYSA 1J5OB 2HBZB 4LR8A 4FP9A 4RUAA 3H40A 1R89A 2ZBIA 1N34J 1UETA 4GVBA 1XBWA 2XSJA 4OI1A 1VC6A 5IZHA 3D6FB 4CTAA 4H4MA 5HJYA 2OH2A 4PQAA 1VQ5S 2BE2A 1RYSA 2BUNA 1N5YB 1NO8A 5E3PA 3DMJA 4C7QA 4YDXA 4PXDA 5F9LA 1GQEA 2MSSA 2XYHB 2O67A 1YSJA 2IMWP 4HVZA 3PR5B 2VBZA 1WC0A 3P5BP 4CO1A 2GIQA 2R2UA 1CJTA 3SSQA 5HMZA 5L1IA 2BW7A 3Q86A 4ED5A 4DS4A 3TA2A 1F3VA 4TY8A 2AEMA 4KGVB 2VH7A 2MSTA 1Y4ZB 2JC0A 1YVFA 3M2VA 2NUUG 4CO2A 2DGSA 1N6QB 3W65A 3BSCA 4OX9F 4PRFA 2RD5C 3MMBB 1CBKA 1PILA 1XMOF 1EQ0A 1X7VA 5ETVA 2HWIA 2CPIA 3UN5A 3PX6A 4WBFA 5KG2A 3C16B 4M5DB 1B0VA 2V8VA 4Y65A 4NXMJ 3PNIA 1R0AA 4G65A 5KFBA 2MKJA 1S6QA 1R6VA 1WKKA 2DHHA 2UXCF 4DSLA 5FD1A 4WF9Q 3DRPB 1EP4B 1L5UA 3AA9A 3PYFA 1SC1B 5H1SV 2BANB 4IR1A 2AF6A 4P2SA 3PEJA 3PX4A 3MUVP 3POTA 4UY8T 1URRA 1RAJA 2OGUA 3OTDA 2IIHA 2JEIA 4RU9A 4LVNP 3T5JA 2HBYB 1NK8A 3DRSB 4DX6A 1O8BA 3NNAA 3UD3P 3NCPA 4F26A 4I7FB 3ADAC 5D3GA 2ATCB 3C46A 4P6QA 4X4OA 3BM7A 4DPWA 3M9MB 3R5DA 1NK0A 4IG3A 4U8VA 3BQ0A 5EX0A 4UOFA 1Y5LB 3ZZYA 2VBYA 4MIAA 3KJVB 1FRIA 2B7BB 2Y1LB 4L3NA 4OYAA 2UU9J 1TVRB 1V9OA 3EPGA 4YMEA 5E3CA 2FB0A 2HW3A 4DFKA 3QZ7A 3GG1A 3H90A 3ET6A 4J9SA 3PO5A 2JJ4D 2YXLA 2R7TA 3NWGA 4DSEA 3JQKA 4QQBA 1IKWA 4NA2A 3SSRA 1N48A 2G2OA 2C3OA 3OTCA 5MLCV 2B51A 4OLOA 3PV8A 2CRLA 3QQCD 1RWNB 4DUYF 1JLCA 1RHQB 1U47A 4IFYA 4KGXB 2CNNB 4UQTA 4TLRA 1JK9B 1TKZA 3CSKA 4BDPA 1BGXT 3TAQA 2X1FA 3H25A 3V5RA 5LJ5Y 4LF5J 2FHJD 2VG6B 5KFHA 1SVDA 1WUUA 3NGDA 3A3OB 2J7KA 3G86A 1JWWA 2I38A 1JLAB 1NDKA 2DO4A 3VALA 1U1MA 1S1TA 1OQ3A 3VV2B 2HHTA 4GO5X 4ED2A 2XMKA 1VDHA 1LV5A 2HFUA 1UP1A 3J7A1 2D9OA 3FRZA 5LSLA 2OELA 3NWRA 1JLGA 1ULRA 4IQMA 5K8NA 3G4SS 2ZFHA 2QE5A 2UUBF 3AD8C 5GAEU 2HQ3A 2B4PA 2VU5A 2XWXA 3O6QA 1N0VC 4ZLNA 5I42B 2E7WA 2JEJA 4NLSA 4DR1J 1RAHB 1XTZA 4Y28C 1S99A 2BKPA 1ZA1B 2F8MA 2BRLA 2YKNB 5T7LA 1V6HA 5KFKA 3CMES 2CPHA 2GVDA 3MMCB 4AL5A 1YJUA 2O5DA 5KFGA 1EJ7L 3M32A 2LYVA 5GAEI 2L9NA 2YTCA 5LSOA 2DO0A 4NZ0A 2IJRA 4TKTA 3BJYA 4LRCA 2HHHJ 4WFZA 2ZOFA 3UCUP 3HVAA 3BYRA 3TUIC 1RWUA 1FESA 1JLBA 2RUSA 3HM9A 2VASA 2W25A 2HHQA 3PHTA 3IM8A 1Y3JA 4C0HA 2SXLA 4Z2XA 1WC1A 1XNRJ 3I0RB 1P27B 4ZJOA 1EIYB 3PEHA 4AD6A 2XTJP 5CYMB 1XERA 3GIIA 1QE1B 1CJVA 1XWLA 4OZJA 4A8OA 2IHR1 2UXBF 3QFHA 3DRYA 2W9AA 1A9NB 2A3JA 4A4JA 5D4OA 3SQOP 3G87A 2JRSA 4Z7CA 4DSKA 3H5XA 1ZM4A 4DSIA 1S12A 2V69A 2CJBA 4CLLA 4U7UK 2DYAA 2MZQA 2FZKB 4FXDA 2XZDB 4OV6A 2RRAA 2W9BB 5KG7A 3M8QB 4WTOB 3BGFA 4DUZF 5DGBA 4FYXB 3RBEA 2HAFA 1UJ4A 1NK7A 1RLDA 4KE5A 2EG1A 5IS2A 1LEOA 1T0TV 4NLPA 4KAIA 5KT4A 4KQZA 4ZVPB 3MEEB 4YB1P 2VG7A 1MMDA 2ZH6A 1HBUB 5E3QA 3M8PA 2B9YA 1PC5A 4O23A 1P6TA 1KTVA 1DZ5A 4H4OA 3DI6A 3BH7B 4NRTA 1R27B 1U45A 5KFZA 1YIJS 1YDLA 2X3DA 2MPUA 3AOAA 3UVJA 3PRBA 2B6AA 3GE9A 1TELA 4WXOA 2Y0SD 5B7WA 2DEIA 2ZM6F 1SUQB 3PJ9A 3NAIA 4F4KA 2NXEA 3HJVA 2GCFA 1YJ9S 3OL9A 3LAKA 1N4LA 1IKYB 5B0CA 5I3UB 6FD1A 3JSMB 2ZKUA 1B0TA 2DGUA 2EW9A 4AFFA 3HSZA 4KFBA 3PYEA 3G9CA 3BF4A 3KLEA 2DY1A 3IC1A 3ZNUA 4FPIA 4ZCKA 1FCAA 3T9ZA 4FF4A 4CCHA 2EVZA 4RW4A 3W8PA 3K17A 4KGKA 2V2VA 2L9DA 3MCSA 1NHKL 1S79A 2MDAA 3HSJA 3CDAA 1BQXA 2HGNA 1UEKA 1SKUB 3OTOJ 3DN9A 1QLNA 4X4UA 1TL3B 2JH3A 4LVOP 1X31C 2KHCA 1F9EB 1W2IA 1SJQA 3DRRB 2J76E 3FSXA 2ZD1A 4EO8A 2E1RA 3MM7B 1HQEA 1YBAA 2VA2A 2ZVIA 5CYQB 2DVIA 3C15A 3VAJA 3EWGA 2IJFA 4UUWA 3C14A 4RWWA 4CLSA 1OYDA 4L6V3 1P1LA 5JJBA 4GVBB 4WJBA 2XSJB 2GMJA 2VV5A 2C2OB 3WC0A 2LA4A 4CTAB 2ZH7A 2Q6BA 4H4MB 4JI3J 2IMOA 3BO4A 2BE2B 1T03A 2EK6A 5F0WA 3DMJB 4OLPA 4YY3F 3GV7B 3A8KA 2R7OA 3U1NA 2FVRA 3ZC4A 3KNGA 3FCHA 3TYTA 4XO0A 4PWWA 1NUEA 1W2BR 3OTEA 2GIFA 3T9NA 4RBVA 1SIWB 3T3FA 5DZ6A 2DH8A 5DRKA 4R0EA 2KRBA 1VQ8S 3CJSA 1AZSB 1X4AA 2FLPA 3GJRB 2W2PP 2GIRA 4R25A 1VRUB 3MWBA 2PEBA 4ZVRB 2HMIB 4N76A 3UR0A 1S10A 4F02A 1S1WA 1CSJA 4DMZA 3M6WA 1WEYA 2IC3B 4P52A 1RKIA 4OHZA 4ILMA 1TP7A 4LUBA 1R0AB 4OYIA 3W60A 1S6QB 3O2IA 1KN6A 4DR3F 4DFJA 2HHWA 1NH7A 1CQMA 4DV6F 3Q8RB 3MMAB 1VGYA 2IVYA 2NXCA 2ZBRA 3ZTPA 2J0WA 1UJ6A 2B4UA 3PYGA 2HNDA 2D69A 3GB0A 2V6AA 4BWJA 1NPKA 1JLFA 5F9NA 4ZP6A 2H5EA 5KFOA 4AUKA 1H7WA 3Q0AA 3OBIA 4OL8A 1D9DA 4IG3B 4UZBA 4NLOA 3TVKA 3SDEA 2BRKA 2VB6A 3QIPA 5J1NA 2ZC4A 1S6PA 1FE4A 4WP8A 2ZVSA 2R2TA 4ZVOB 2FDNA 5J2QA 1RTDB 4ID5A 5DO2A 4X64F 1LW0B 1S57A 4LFAJ 3BKTA 2HVIA 1ZOTA 5L8RC 4QWAA 4DR6F 3GG0A 2NS1B 3W2VA 1X4FA 2PMHA 2RVJA 2GV1A 2XY5A 1RBLA 4CO4A 2NLWA 1OIAA 1OY6A 5ETOA 1WI8A 4A48A 3DLEA 3P4UB 5LMUF 1SB6A 1NZ8A 3MM8B 1HWUA 2AJ1A 1H2UX 4IFYB 4O44A 3LPEA 1K44A 2QJ3A 2VPYB 1NLKL 3OFEA 3DLBA 4X84A 4J9MA 3WIVA 1IBKJ 1HNWJ 4I0WA 2CA9A 4EUVA 4CLZA 1TL5A 2MQOA 1W7WA 2RKIA 3FGVA 2IAJA 3NL0A 4KBIA 4LBPA 5H9EK 2KYZA 5A2QY 1X0FA 1RHJB 3BSAA 3Q8PB 3EGWB 1FXDA 2HK2A 1S0MA 3IFEA 4DEZA 2Q1LA 1RAFB 2FC9A 1U1RA 2QMXA 2MHNA 5FLXY 4WFAQ 1FRMA 4JI1F 3R7BB 4MK7A 3ENQA 4USKA 1UA1A 2ZBPA 4X4NA 3EXYA 4IOBA 1WD6A 2XEXA 4WZMA 1HMVB 4OZ1A 2W4PA 2V8GA 3PM9A 1P9QC 3CCVS 2ACYA 2CQBA 5KFJA 1SBRA 3VCDA 2N3OA 3GIJA 4KV8B 1S5ZA 2K1RB 2RJZA 4P2XA 3TQEA 2GVDB 4OX7A 4X62J 4FF3A 3QNWB 4ZLPA 4QW8A 3NY0A 4UTGA 2EXUA 1RAIB 3CCRS 3I0SB 1IBLF 4RO0A 1OSCA 3R3TA 2IJNA 4FKYA 1T02A 4ZPBA 4CNZA 2CZ4A 1Q8KA 1HR0F 2E5GA 4Q0BA 4IOAQ 4DG1A 1KVKA 3QRPA 4LF4J 1VC5A 2OPQA 4B9MA 2OEKA 1ZBTA 2O66A 3TAMA 3UW1A 3GSDA 5HBMA 1H73A 2K7JA 3OUYA 2HIQA 2FD2A 4LJMA 3AJ1A 1CJVB 3QGPA 2F4VJ 5AXNA 1QTMA 3H2VE 4LSNB 2JLGA 1Q53A 4ZOSA 1QUPA 2OD4A 1IN0A 3GV8B 2VC1A 4UW2A 2V2QA 4GKKF 1CULB 4FBUA 1DLOA 4Y2IA 2XWYA 2RH3A 2UXDF 3E2EA 5KT6A 3MM5A 3IRWP 3FBFA 4DV1F 2WTFA 4B3MF 4URGA 3FNNA 3CJKA 4F0HA 2XMWA 3SIPB 3DDKA 3N5BA 4DR7F 1MROA 4O3OA 4NMLA 3V81A 5AJ3F 2CJYB 1RQ0A 1VQ6S 2KHDA 3IBWA 4ZCIA 2M2BA 4QJVA 4URSA 1CLFA 1SL1A 4YQWA 1BD6A 1M5VC 1OWXA 1YRTA 2RDIA 2ZH5A 2I8EA 4A47A 2YKMA 4ECVA 2Y0BB 1S9GA 4PG5A 4DL7A 3M8PB 5DM7Q 1NKCA 3BS9A 3HSGA 5AXLA 1GMUA 5D77A 4H4OB 1TK8A 3ZO7A 3NNHA 4ICLA 2J0SD 3PW4A 1N36F 1R31A 1U1PA 3MCNA 4V1Ak 3Q8VA 4DX8H 1FD8A 3K5OA 3UVJB 3OJSA 1VBZA 2XY7A 2H65B 3T6BA 4DPYA 3PIPQ 2LDIA 4DR2F 2M7SA 4PAAA 5HROB 4C9DA 5L38A 3W63A 1QAJA 4ZN1A 2EKNA 1M5SA 1FD2A 1DFDA 2KM8B 3GWCA 3BBBA 2CPXA 1ROFA 1IXKA 2DK2A 3KLEB 3DXBA 2BOPA 2JOQA 4FN5A 2RS2A 3WBZA 2N4DA 4ZVTB 1H6KX 2WZ1A 3T19A 2ZKTA 3A8JA 3D28A 4RW4B 2W8KA 2LVWA 3PDNA 5EN1A 3TZYA 3F41A 3TNVA 1FRXA 2J6UA 4LF8F 4NLGA 3FVYA 5HMXA 2OTLS 2GW8A 2AD9A 2DNQA 4YB6A 2QX0A 4LF7J 2CJ9A 2DRDA 1X9MA 3M8SA 2MLZA 3HDSA 1HNVB 5JUMA 2ZD1B 1FEEA 2MYFA 2AZ3A 1U24A 1T9XA 5KFIA 3SV3A 4OYZA 4WKYA 4ZP9A 1Z2LA 4H54A 5LT5A 2V34A 4ZLJA 3C14B 1JNZB 2JC1A 3IBCB 3GJTB 1H2TZ 2MZRA 3DOLA 3AOCA 4F4WA 1N0UA 5JMNA 1F60B 1DTQA 1OSDA 2AGQA 4QIEA 1B7YB 2XLJA 4LBHA 3CCQS 5DLFA 3G2XA 4NASA 1TL7A 1KHVA 4HKQA 2CFXA 5IOLA 1NB2A 3CCWA 1RT3A 2Q6CA 4ELTA 4XIUA 1HL6A 4ELVA 3OPKA 3Q22A 2V4JA 5KG6A 3LP0B 4ATNA 2QLWA 4KC5A 3MM9A 1VYAA 1G4CA 3V6KA 2J7WA 4DV3J 3ITHA 4TYAA 5H9FK 3KDNA 4HH0A 4KGMA 5L1KA 3TR5A 1UEVA 4L72B 3FJ2A 3NG8A 1ZAVA 1J2VA 2A1BA 2BM0A 3A13A 3GV5B 5J2MA 3NS6A 4FXVA 1OPZA 2FYXA 1TMMA 1SH3A 4ECXA 1UMJA 1S1WB 3V4IA 4I6AA 1AFJA 4NXNJ 5KT7A 1F6TA 3P3DA 4OJ3A 3S7RA 4NA1A 1EQMA 3HI9A 1MW7A 4HH1A 3VWSA 2DKOB 1HARA 1KC8T 1TZ0A 3QFWA 1SV5A 1CPZA 4FNIA 2QL5B 5CH7B 5J1EA 1R6YA 2BJ7A 3P96A 2VFTA 4OJ1A 1RA7A 1VHFA 3P8BB 1MN9A 2J9DA 1PKUA 4NLUA 1WG1A 3R2DJ 2W7PA 1JJHA 4QZVB 1JLEB 1HWIA 4O0NA 2R4FA 1U48A 3SDEB 2XHCA 4ES2A 2DHGA 4LREA 4DHVA 2OTJS 3JSBA 2W1BA 1SL0A 2LLZA 3UNYA 4DI6A 1WHYA 3H42A 5J2QB 2HFVA 2V0NA 4E98A 3RG6A 1AA1B 1EX8A 2VQFJ 2QO3A 3VAMA 2J8AA 3D4JA 4DPOA 2DXFA 4KIAA 3QJLA 3W2VB 3JS9A 2CUYA 2HS4A 4RW6A 4OHWA 2PMZD 4K4WA 2VPZB 3DLEB 2MB0B 1Q1KA 1LWEA 5G4DA 4WZQA 4W98A 4ELUA 5KOWA 3W5ZA 4O44B 3DC2A 4NLRA 1QTNB 3CDBA 4UT4A 1FTCA 1WORA 3I5AA 4FYWB 2BJDA 3DM2A 4C3MA 1FNXH 4WFYA 4ZIVA 4IDKA 1D9FA 1GNKA 3EJMA 4K4SA 3HVRA 2J9EA 2JEFA 4F4YA 2HLUA 5L1LA 3NP5A 3EUNA 4NE9C 4L76A 1FNOA 4JYAJ 4WCEQ 1RJJA 3HHKA 3QWPA 1OYEA 4MTPA 3NCRA 1JIHA 1CVJA 2BE9B 2ZNZA 1NBEB 3D0HE 5KFWA 2X7IA 5KT5A 4DX7A 4FPRA 1C1CA 3LA0A 3PW5A 2HHPA 1B70B 2EBEA 2QA2A 2IDLA 3PHEA 1OO0B 2BJ3A 1B64A 4K2JA 1NJYA 3CCLS 4DL5A 2FGCA 2VL1A 5IM0A 4ECUA 4DBQA 1J5EJ 2ZH4A 5K14B 3MAHA 2UVUA 3M9OB 3M2UA 3TAPA 3D2WA 3M9NB 3HD2A 1HQUA 2UUAJ 2XCPA 4X65F 3C6UB 3J7Z5 5KFCA 2LEAA 2QZ8A 2YWGA 3HHNB 2DR7A 1DRZA 3TUJC 4YEAA 5BXIA 2HEKA 4ZHRA 2WW8A 2XSFA 3LWMA 5HMYA 1T8EA 4RX6A 2MZ1A 3CXCR 5IQ6A 5HP1B 2MJNA 2HS0A 1LOUA 2Y1IA 3KLGA 4K4VA 2VDHA 4DG1B 2F8EX 3PX0A 4EBEA 2OPPA 2MY8A 2QEXS 4ED8A 2GA7A 4OI4A 3EM1A 4KH0B 5LSRA 2OPQB 4IFVB 4MT1A 2H48B 3R27A 1NDPA 3L7PA 2WVDA 4XPEA 1T9TA 5HBMB 1PBUA 3B8HA 2NYIA 3D67A 1KP6A 2W2NP 4QR2A 1Q8BA 1U7LA 3BBCA 3DXSX 3W7BA 6AT1B 4C98A 1DLOB 2MTLA 3DYAA 3D68A 5DG9A 3G96A 2UV8G 4JOUA 4OZLA 1FVQA 4LRDA 2FZGB 7FD1A 4C97A 1REGX 2H54B 2VG5B 3MEKA 5K9FA 1H0HB 1NK4A 3FDSA 4DDFA 2K2PA 2W2MP 1X4HA 2YNGA 2E7VA 3W2WA 2YNFA 1I94F 2DPJA 3LANA 2O01C 4IH6A 4NEZA 4RW7B 1UVMA 4ZJLA 1NJZA 1KNZA 3KXDA 3R7NB 2WHOA 4EGLA 3QSYB 4GC7A 1N54B 1S9GB 3LGMA 5DDQC 3RAQA 1V5VA 3RTVA 3CT9A 2HIYA 3BPDA 2ZHOA 4GMKA 4MYTA 2LEBA 3RBDA 3PRVA 4K4TA 1HA1A 5KFXA 5I3QA 4F3OA 2OEJA 3CCES 5EHHA 4FYYB 1TFYA 1T3NA 4HI1A 2F5GA 1NSKL 4ZS6A 3CC4S 3LW5C 4F4ZA 2GHPA 5HSPA 4M8LA 2DGQA 4PXBA 4HACA 4OHVA 1Q4RA 3JXOA 4B3RF 3GFYA 3PY8A 1BQMA 2ZE2A 3NNCA 1VFJA 3M6XA 4J91A 5KT2A 1YKWA 5D15A 4IH5A 4FF1A 1UPPA 1WEZA 2W24A 5CA5A 4EBDA 2RIJA 4PQUB 2EFVA 3CF5Q 2XULA 3MECB 4ZN3A 1XMQJ 3G6YA 4ZCLA 1U1LA 4Q45A 5B09A 3FKBA 1JLQA 1FKOA 4CM0A 1TKTA 2XNRA 2YKQA 3L7OA 3G8SA 5A76A 4M95A 2CWKA 1HNZF 2DXEA 2KFZA 4W4MA 2UUCJ 4PR6A 4P10A 4S0MA 2BQUA 3P45B 1KBRA 3DOLB 2AT1B 2YWHA 4DJBA 3CPWR 3I32A 3THVA 1DTQB 2FLNA 2KDOA 4C8ZA 2JFDA 3WX8A 1SQFA 2CQDA 1PCAA 4CH1A 2A2DA 3MPYA 2XGQA 1KD1T 4M5GA 1WDTA 3B78A 4EEYA 2YPYA 2CIMA 4U7CA 1RT3B 4P72A 4IO9Q 2HFNA 4TN2A 4N5SA 3CCTA 1S0VA 2V4JB 3IGVA 3CVKA 4U67Q 3VHQA 1FHTA 2E29A 3MM9B 3W5YA 2G0JA 3T5LA 1JJCB 3T1YF 4M5JA 1N52B 1VK8A 5IT4A 2PMWA 2W4CA 3FMWA 3CJ2A 3AXMA 4JI4F 5J2MB 2E5LJ 2XBPA 1X4GA 4IH7A 4PUOA 4NI2A 4CI0B 3SQGA 3V4IB 2ROGA 3T1HJ 5DJBA 1JNRB 4WFXA 2ASDA 2X1BA 3RB6A 4TU9A 3EX7B 1RTIB 3G82A 2MKHA 2CDQA 1CQNA 2XLKA 4F67A 1QM9A 3QLHA 2ZH8A 3RBXA 3I6PA 1GX5A 2VFUA 2QSFA 3NRBA 4JI6J 1N6QA 2R8GA 4JV5F 5KFQA 1SV5B 2DNYA 4ECTA 4FVCA 5LXRA 2WK4A 1MWYA 3I87A 5J1EB 3KK2B 2JFKA 2JLEA 5BYRA 2ZJQQ 3S6EA 2M0GB 4U95A 4DV4F 3DDIA 5E5NA 4ZK7M 4LFBJ 4NCGA 5I3PA 1XMBA 1NKBA 3I9ZA 2YBVA 1Y11A 3R1HA 4B9SA 2ZDPA 4QWDA 1FVSA 1YWXA 3GYGA 4OHYA 1RAGB 5ETSA 1CS4B 1WC3A 1GAOA 1WACA 1TKDA 3SEOA 3DRSA 2WVCA 4BBYA 1EHWA 4JI5F 2GGPA 3IS9A 1BE4A 4OZ0A 4JI7F 2PA8D 2AX1A 4I7FA 1L3SA 3QSIA 2KO1A 4DR5J 1BQNA 2R7XA 3S01A 2J0XA 4E2FB 3OR1A 4M5MA 1O0PA 2VPXB 3FEYB 1L3KA 3NS7B 2X1AA 3PO4A 4I68A 2QGFB 1Q8LA 2BACA 1F9HA 3LP2A 5FJ4A 3DU6A 3BDEA 5IC4B 2VJVA 1C4AA 3DM2B 4P71A 4NRUA 4GKJF 5B0FA 4IDKB 2R3VA 2RUGA 1N8RT 2WB4A 2OFHX 3ILLA 1LQ9A 1V3ZA 4NLTA 1IR2A 3J7AN 4OHXA 3FUYA 3N0VA 4EYIB 2EFOA 2YY3A 2IVMA 1X9WA 4OX6A 2P5VA 4NLYA 1RGVA 3MAAB 3OW2R 2AU0A 5F8IA 1Z2ZA 1CJKA 2EI5A 2J9CA 4TVAB 4RBTA 5DG7A 1RU1A 3BGRB 2AHOB 4FZVA 3TWZA 3EZ5A 2GX8A 1FXRA 1C1CB 1L3UA 4H4KC 5EDWA 2LFVA 4EO6A 4P74A 3MUMP 3BQ1A 4QWCA 2K8GA 4M5IA 4OX9J 3KG0A 1JLAA 1DTTB 1XMOJ 1VRQC 2KU7A 3EPIA 5IM0B 2NXUA 4DV5F 4Q43A 1YG0A 3M2UB 5KG0A 2RSQA 4DXLA 3KOAA 4C8LA 1S1XA 2Y1JA 4P2FA 4ZHRB 1K0TA 3KHLA 2BJEA 1T9YA 3BGOP 2UXCJ 3JAMY 1U2FA 3ZZTA 1WOPA 4DF4A 4ZVSB 3GONA 2ZBQA 2E7XA 3OFFA 3KLGB 4JI0F 3W61A 2DNMA 1RHMB 1R0CB 3IXQA 2OPPB 1C0UA 1XQIA 4DV0F 2KRRA 4PYDA 2DNGA 3GCWP 5DZ7A 1TK5A 3BV8A 4ETZA 3MMCA 1XNQF 5A6WA 3W8GA 4QR1A 4WP3A 4MFBB 4LMZA 2CQ0A 1V5IB 2HHVA 4EWTA 4ANCA 1JXEA 1FRLA 1AROP 2E9ZA 3IWLA 3DYAB 1U2CA 2BMBA 4EK2A 3I96A 2HQCA 1HKAA 1U8SA 3BN7A 3SFUA 3RAMA 1GMWD 5BR8F 2FVPA 2H1YA 1KDNA 1ITPA 5IT9U 1HNXF 2CPDA 5B0BA 3UNGC 3V6HA 4JUZA 2P9CA 2LXUA 3OSNA 3I0RA 3QGHA 2YNGB 1FE0A 3W2WB 1QE1A 2YNFB 4LR7A
chains in the Genus database with same CATH topology
2ZVSA 4I6YA 2R2TA 1FDNA 2EFGA 3V4MA 2DR5A 2VA3A 3JSRA 2WSCC 3CIZA 4IRCA 1DQ8A 2FDNA 1K9MT 5DQGA 1RT1A 2R2RA 5J2QA 3M6UA 1RTDB 4JV1A 1K1QA 4A8FA 1HW8A 4YHHF 4LF9F 2VFVA 1X5OA 1NH8A 4RNHA 4ID5A 2C42A 1ZZNA 1ZTTA 3C66A 1TL1B 3OXGA 4QYZJ 2XS2A 2MQPA 4N56A 5KFAA 5ADZA 3PW2A 7FDRA 5DO2A 4CZCA 2DTJA 4X64F 3TUZC 1NU4A 4HT7A 4CO0A 1LW0B 4OFZA 2OPSB 3MXHP 4NL5A 4IUFA 4I64A 2N4CA 4QU7A 5A0YA 2HVIA 1ZOTA 4WK3A 2ZJRQ 1YHQS 3DLKB 5L8RC 3US5A 5GADI 4A8KA 3G6XA 2JHEA 2NSBA 3DLGB 2ZDOA 4QWAA 4ZP7A 4DR6F 3GG0A 2NS1B 4Z37A 1HNIB 3VR1A 1VRTA 3OXLA 1YJWS 4O3RA 4QCLA 3EZUA 1X4FA 3W2VA 5DGAA 4HT5A 4BS2A 2W9BA 5KFYA 2VOPA 2KKHA 2PMHA 2RVJA 2GV1A 2ZC3A 2FTRA 2CQPA 2XY5A 5M2PA 4PG7A 1WWHA 4URQU 4CO4A 2NLWA 1RTIA 1OIAA 1G6BA 4R8UB 1WI8A 2XMTA 4A48A 3DLEA 2VQFF 1QSYA 1DHMA 2ZBCA 3M4XA 4MAKA 4PG8A 2KXFA 2VKRA 1FRKA 2C3PA 4ILLA 5LMUF 1SB6A 2A18A 5F0UA 1FF2A 3GFXA 4BWMA 2VQEF 1GXLA 3MM8B 1MNEA 2AP6A 1HWUA 2HFZA 2AJ1A 2P6TA 3M30B 5B0EA 1IM4A 1H2UX 1ZM2A 4IFYB 2DCLA 4O44A 2JLFA 2MKIA 3RB3A 4Y3CA 4O0IA 3ZZZA 4QIVA 4R5PB 3FQKA 3M2RB 2P6SA 1IJFB 1Y9OA 4LIRA 3HO1A 1WG5A 3UQSA 1AXQA 2CQIA 2VPYB 2QA4G 3KK2A 4KSEB 2NPFA 3OFEA 3A1YG 3DLBA 3MPVA 3SCJE 4X84A 2E66A 3CTRA 1N32F 2IBOA 4J9MA 1RT6A 3QGIA 3WX4A 1S76D 2UUWA 3K5MA 4RKUC 4C3LA 1J5OA 4I0WA 2HWTA 4EUVA 4B3TF 1TL5A 4DV2F 1GXTA 2CPEA 2MQOA 1D8YA 2J9DE 2OPRB 4QIFA 2J6SA 2RKIA 4YB7A 5T41A 1U6ZA 2XZWA 5JVHQ 4ECZA 5JXSA 5L1JA 1U1QA 2RE1A 3FGVA 2IAJA 4KTQA 4KBIA 1VLYA 2CPZA 2OP5A 2CQ4A 1WNEA 3NL0A 3KNAA 2KYZA 5A2QY 1Z4UA 2M5YA 1BQMB 3TO8A 2W9CB 1X4CA 2ZE2B 1TK0A 4DWIA 1X0FA 3BSAA 4MKAA 3ITHB 4RU2A 1ZM9A 2FVQA 1F5AA 1UVIA 3OFGA 1RT2B 2IYIA 2RQMA 2HVZA 1S97A 4H4KA 3Q8PB 2E9RX 3EGWB 1FXDA 1UEUA 2C3YA 4EU0A 3MGJA 4TY9A 2DNPA 1S0MA 2JSXA 3MF5A 3NLCA 1RT4A 2KG1A 3IFEA 3DHWC 4DEZA 2Q1LA 2G4BA 1N5YA 3C2PA 2FC9A 1QUVA 1JKHA 2GFFA 1MMLA 1UFWA 4WKRA 1N34F 3VQTA 3FZBA 2FJVA 3BN4A 1U1RA 2VC0A 2HLTA 2QMXA 3IA0A 3N6NA 4KKOA 1NNDA 4MKYA 4JYAF 5E33A 2MHNA 5FLXY 4WFAQ 1FRMA 4K50A 4JI1F 2M8HA 1IKYA 1JLQB 1FRJA 4G1QB 4MK7A 3ENQA 1UA1A 2XMJA 3J7ZT 5CD4H 4X4NA 3EXYA 4Q8EA 3AA8A 4IOBA 1WD6A 5IFMA 3NGKA 2XEXA 3ZZPA 1R8BA 2HHUA 4WZMA 3E01A 1T7PA 3DOKA 4ILRA 1HMVB 2R8IA 4OZ1A 2W4PA 1TKTB 4F3MA 4NLDA 2V8GA 3PM9A 1P9QC 2N3LA 5E3AA 2ACYA 2EBGA 3CCVS 5HLFB 3I4HX 1TV6B 2DNNA 1KOOA 2CQBA 5AE1A 5KFJA 5CHCB 2F40A 1Q78A 1SBRA 3HX9A 4DQPA 3VCDA 3JTPA 3O5TB 4ZPAA 2N3OA 1JJ2R 5HI7A 3GIJA 4KV8B 3OFHA 3HHLA 5KFPA 2K1RB 1MMNA 3MR5A 1HW9A 3CCJS 1FXLA 2RJZA 1LW2B 1SJ1A 1R8PA 4J9LA 3FEZA 4OX7A 2FJAB 3MMBA 1VIOA 3KLIB 4IRDA 4FF3A 2BBEA 3IAM9 4ZLPA 2JVRA 3N6MA 4QW8A 3PIOQ 3R5AA 3MEGB 1T3OA 2EG2A 2FJWA 4I2QA 3ISNC 2B56A 1J5EF 3CCRS 1ELOA 3RB0A 1U26A 3I0SB 1IBLF 1OSCA 4O3NA 3P6YC 3R3TA 1NAQA 1UVLA 4B02A 5A8KB 2IJNA 1P8GA 2HYIB 2FJEB 3RU0A 2VFSA 4M5DA 3EYZA 1TL3A 4JV0A 1T02A 3NMAA 4ZPBA 2UUAF 4CNZA 2CZ4A 1CC7A 1DBDA 2D74B 1HR0F 4G1PA 2KI2A 2E5GA 2FJBB 4Q0BA 4IOAQ 4DG1A 4DF8A 1MSWD 1S9FA 4ED1A 4DQSA 3MM7A 2BQRA 3GMGA 4OV1A 4G1IA 4P7TA 2ZHAA 1VI7A 3H8YA 3TVYA 2RMLA 1VC5A 3DRPA 3PVXA 1NKEA 1FJGF 2OPQA 5CYQA 2MXYA 4X2BA 1EP4A 3H20A 4PG4A 3ZZ0A 4B9MA 3A8EA 1ZBTA 4DL2A 3CCZA 1GTHA 2BANA 2O66A 3EXCX 3C3LA 3LUYA 2ASLA 1HBOB 2IA0A 2WSFC 4FXWA 4NXMF 2Z2LA 2QYCA 3TAMA 3UW1A 2LU2A 3GSDA 2IRXA 5HBMA 5F8GA 3SYZA 2FIUA 1XK8A 2K7JA 4WU3A 1KS2A 2VBXA 2HFOA 2HIQA 3OUYA 2HHXA 4KJIA 1VQ7S 4TXSA 3VAFA 2FD2A 2JX2A 2WB1D 4LJMA 1R3NA 3AJ1A 3HK2A 3MOJB 3QGPA 3MR6A 1HWLA 2HNZB 4MK9A 5AXNA 1QTMA 3H2VE 3QGGA 4LSNB 1Q53A 4ZOSA 2JLGA 1QUPA 2BQ3A 2ASYA 1REVB 1L3VA 2OD4A 1IN0A 2DGXA 4LSLA 3M1VB 3N79A 1HHTP 2PDAA 2M52A 5MAOA 3GV8B 3BGRA 3VAKA 1FKAF 2VC1A 3PW0A 2AGPA 2VFRA 4C8KA 3CD6S 4UW2A 4GKKF 4DL3A 3HVTB 1Z1ZA 4C3KA 4WIIA 4FBUA 1DLOA 4Y2IA 2M9KA 2XWYA 2LCWA 2RH3A 5ITHA 1VQKS 2UXDF 4BC7A 2DB1A 3E2EA 5KT6A 2C3MA 3MM5A 3CE8A 4AXJA 4WFNQ 1M0SA 3IRWP 1S1VB 4DV1F 2WTFA 3SZ2A 4ZVFA 3TA1A 5GMKa 2DGVA 4PUOB 2R9LA 2WONA 4B3MF 2UVVA 4QWEA 3Q2SC 4URGA 2OFGX 3FNNA 3ONQA 4PKDB 1HBMB 3SQGB 3CJKA 3IAS9 4C0BA 4C11B 4DL4A 4OI2A 2MJUA 4HDGA 4LF6F 1O51A 2ABYA 5D4NA 5CZVA 2ERRA 2KJWA 2XMWA 1UVJA 4ECYA 2CJQA 1DTTA 1Y5IB 3DDKA 3JTOA 3N5BA 3GFHA 5HMWA 2R7SA 1MROA 3N01A 4DR7F 4O3OA 4NMLA 4RW6B 1MWZA 3LPYA 2CQ1A 3OVBA 3JTNA 3KJVA 3V81A 1SJ4P 3I9V9 2UVRA 1R8HA 5AJ3F 3GYXB 3BO3A 1IKVB 2YKPA 1RQ0A 3ZZRA 4FYDA 2Q66A 1LWEB 4QR0A 4C8MA 4ED0A 2PA3A 5T14A 2RDJA 1KLNA 2KN4A 3QLHB 1VQ6S 2L9WA 2M8DB 5G0RB 2VBWA 1TVRA 2JDJA 4B9UA 4CH0S 2KHDA 3IBWA 2DNOA 3C6TB 5FDLB 2MQNA 2M2BA 4ZCIA 4QJVA 3CULA 1GXUA 3MM6A 4URSA 1CLFA 1H2VZ 1SL1A 4YQWA 1BD6A 1M5VC 1OWXA 1S9EA 2F9DA 2ZNYA 5AE2A 1YRTA 1NHVA 2RDIA 3CD7A 2E1AA 2ZH5A 3U1LA 2DRBA 2WOMB 2I8EA 2MY7A 3JSYA 1OQ6A 4A47A 2YKMA 1VRUA 3AJ2A 3K0JA 4ECVA 5C24B 4M94A 1Y7PA 2I5JB 4HTJA 4A8YA 5IT9Y 4F2SA 2HMIA 4KO0A 3GR1A 5C25A 5K8MA 4DSJA 1S9GA 2UU9F 3OLBA 2D3OR 1K73T 4YOEA 4RBUA 4PG5A 4DL7A 1S72S 2IC3A 3M8PB 2B43A 5DM7Q 1NKCA 4DQQA 4OX8A 1RT5A 4I2PA 1HYSB 3BS9A 3NS5A 4NCGB 2RB7A 1CC8A 3B82A 2HWHA 5KFRA 2B7CB 3MZIA 1X9SA 5AXLA 3BGUA 2LQBA 4USJC 4J9OA 2Z4PA 5H9EJ 5D77A 4H4OB 1TK8A 3KLFB 3NNHA 4ICLA 1OPIA 1Q16B 1X5SA 3IRXA 3PW4A 3MPWA 4B9TA 4QIGA 4WYLA 1N36F 2J0SD 2GMLA 2FC8A 1G2EA 3GZ7A 1R31A 3SCKE 1U1PA 1UA0A 3LALA 3KWMA 3R5BA 1C0TB 2ILZA 3GIKA 4RW9B 1Q81T 3RYLA 1ZM3A 1Y3KA 3GYNA 2FHKA 1Y0HA 4MH8A 3LO3A 4QOTA 4DX8H 1FD8A 2FPHX 3K5OA 5L9NA 2FLOA 3OJSA 1VBZA 2XY7A 4M63A 4TQRA 3CEDA 2VG6A 3QO9B 3MDFA 2WSEC 3MMAA 4N8OA 3T6BA 3QJJA 4F8RA 2QMWA 2UV8A 2G13A 2YH1A 1SI9A 2EFNA 1SXLA 4LQ9A 3PXGa 3OL8A 3HMJG 2AYEA 2ZZMA 3BREA 3I31A 3I4PA 3QZ8A 4OI0A 4MFBA 5M2RA 3FZ2A 1BY9A 2F3JA 3PIPQ 2LDIA 4DR2F 2EC0A 2AW0A 3AHPA 3QYYA 2ZH3A 1Q86T 2M7SA 4EZ9A 5HROB 2OIHA 4WFBQ 1L3TA 2GGPB 2FGOA 3THTA 4WE1B 4C9DA 3IS9B 5L38A 3RB4A 3CD5A 4DV7F 3QIDA 1KOHA 2COLA 4CT8A 1M1KT 4IQXA 3CIMA 3JB9k 1RDRA 5D78A 1QAJA 1JMTA 4LF5F 2LQ9A 5EX3A 3PR4A 3N6LA 1VQ9S 1M5SA 1FD2A 1T94A 2PEHA 1U2RA 1DFDA 2RU9A 1KTQA 2KM8B 3GWCA 3K59A 1WHVA 2CPXA 2RT3A 4YP3A 3OVAA 1ROFA 1IXKA 4TY8B 1BQNB 2ROEA 2DGOA 2DK2A 2V9WA 3SFGA 3KLEB 5IXUA 3DXBA 2BOPA 2JOQA 4FN5A 2RS2A 3M2VB 1LK7A 3WBZA 2E44A 2N4DA 3OR1B 3RRKA 5B0DA 3N4WA 4FBTA 1O5JA 1H6KX 1E6YB 2E9TA 2K7KA 4J9QA 1HQUB 3ETOA 4Y00A 3TQ1A 1WG4A 3KG4A 3T19A 2ZKTA 2CQGA 2DJWA 2MHEA 3TA0A 3D28A 1BC6A 4RW4B 2W8KA 5B08A 1F0XA 1LWFA 2HQIA 4Q5VA 5KFEA 4DLEA 1R8CA 1S48A 4K4XA 2LU1A 2AYBA 1F2GA 2LVWA 3PDNA 2ZOMA 5EN1A 5THWA 2RRBA 2VZ9A 3VQSA 2ILYA 5D6GA 2I2YA 5I42A 3F41A 3MAQA 2ADCA 1KVJA 1N5SA 3TNVA 1RTDA 1TFWA 3LP2B 2DH9A 4I69A 3HZEA 1FRXA 3PRDA 2J6UA 1YRXA 4LF8F 1DQ9A 3V6DB 1Q7LB 4NLGA 3FVYA 5HMXA 2OTLS 2GW8A 2AD9A 4NOHA 4FF2A 1TL1A 2DNQA 3PW7A 4BC9A 5E0OA 3MD3A 4HI2A 5B0GA 4YB6A 1U1KA 2FLLA 1M90T 1LW0A 1V3RA 3SCIE 4OJHA 4F2RA 1OS5A 2HZCA 2CJ9A 2YKNA 4PPDA 1X9MA 3M8SA 3HDSA 4NYPA 2QFJA 1HNVB 5JUMA 2ZD1B 1FEEA 4B08A 1XMQF 2MYFA 3DLGA 5BJRA 3D1QA 1LFWA 2IM0A 1U24A 1RISA 4ED7A 5KFIA 3SV3A 2KT3A 4WKYA 4ZP9A 1SIZA 4FS2A 3MTJA 1S6OA 1T95A 5F3TA 1Z2LA 4H54A 4I1TA 4O4RA 4YFUA 4DR1F 5LT5A 1VQNS 1ZYQA 3RRGA 1UWBA 3DLJA 5D8HB 2ZJPQ 1JNZB 2JC1A 3DLHA 1XR5A 1H2TZ 2MZRA 3K57A 2FHJA 4B3OB 3DOLA 5C5JA 3CC2S 1QAXA 3POTB 4F4WA 1N0UA 1KQKA 3M05A 2POKA 3MM8A 2PSZA 1HD0A 4DFPA 1F60B 2L08A 1DTQA 2PO4A 5C42A 3CUNA 2KJVA 1OSDA 4XAKA 3NBPB 2HG4A 4D3HA 3KK1A 1Y00A 1ZZFA 3BR8A 2AGQA 1GX6A 4QIEA 2BR0A 3P49B 1SKRA 1KLMB 2XLJA 3KHRA 1X5PA 2WBMA 4J9PA 3G6VA 3FSIA 1G7CB 3CCQS 5DLFA 1QSLA 2UUCF 1FJEB 2FY1A 2R7UA 5EWFA 1UFLA 5F41A 4Q2MA 1KHVA 5D3GB 5KFMA 4G3IA 4HKQA 2B5JA 4ZPVR 2CFXA 2CYYA 1X0PA 1HWJA 3HKZD 3CCWA 3VAHA 4UY85 2V4QA 1HD1A 1NRKA 1RT3A 2Q6CA 6FDRA 3M6VA 4XIUA 4DFMA 1HL6A 4ELTA 1N56A 2KB2A 3VTIA 4PPZA 4KHRA 3OPKA 4B17A 4ELVA 2XB2D 3Q22A 2V4JA 4N8NA 5GADU 3K5PA 4RNNA 1NK5A 5KFLA 1ZH5A 3CDUA 5KG6A 4IYQA 1RTJB 3ZZUA 3LP0B 1I1GA 4ATNA 2QLWA 2HHHF 1ZAWA 4KC5A 3TI0A 3W3SA 2J5AA 3VZIA 3BSOA 4DOZA 2IM1A 1JX4A 3MM9A 1HWKA 1NK9A 5CYMA 2DR9A 3RRHA 3MD1A 4DSFA 3V6KA 2J7WA 5JVGQ 3ITHA 5