4CNZA

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
100
Chain Sequence
b'MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
total genus 24
structure length 100
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4cnzA00
3NCPA 2CZ4A 2V5HG 5D4OA 4YB7A 2GX8A 4YB6A 3MHYA 1V6HA 1O51A 1J2VA 1O5JA 3T9ZA 1NAQA 4CO0A 1VFJA 1GNKA 3CE8A 2Z0GA 4YB5A 2ZOMA 5DS7A 4D3HA 4ZK7M 1NH7A 2NS1B 2J9EA 4R25A 4E98A 2NUHA 5D4LA 4AFFA 3OPKA 4RWWA 3L7PA 1NZAA 4D3GA 1VHFA 2EG2A 2RD5C 1V3SA 3AA9A 3HLUA 3O8WA 1NH8A 4CO2A 2ZFHA 3TA0A 2E66A 4RLEA 4CO3A 3AH6A 3NCRA 2J9DE 1UMJA 4IYQA 2GNKA 4NYOA 2J9CA 2XBPA 4OZNA 4C3LA 4Y6IA 1V3RA 2XZWA 1XK8A 1H3DA 4WK3A 3M05A 3DFEA 5DRKA 4WK1A 4CNZA 1V9OA 4NYPA 1P1LA 1UL3A 2JJ4D 1UFLA 4CO5A 3X3UA 5D4NA 4C3MA 3NCQA 2GW8A 4RWXA 2PIIA 2NUUG 2O66A 3GSDA 4USHA 2EG1A 3AA8A 4CO1A 3AHPA 5L9NA 1PILA 4USJC 2O67A 3N5BA 2VD3A 1HWUA 2XG8A 2J9DA 4OZLA 4RX6A 3BZQA 4C3KA 1Q1KA 4Y65A 3TA2A 3O5TB 4OZJA 1QY7A 3TA1A 4CNYA 5D4PA 1KR4A 3LF0A 2DCLA 4CO4A 1UKUA 2XULA 1OSCA 4USIA
chains in the Genus database with same CATH superfamily
3BM7A 2E1RA 1U8WA 1S9EA 3UNGC 4DPXA 3BGOP 5E3RA 3G6XA 5M2RA 4X64F 2I2YA 2WOMB 3I96A 1RKIA 2YNIB 2YQ1A 4X2BA 4NCGA 1KKHA 1LFPA 4B3MF 4J90A 2W2MP 1YRTA 3K17A 1GAOA 1RU2A 1MMLA 1N33F 1Y0HA 3PYDA 1IR2A 2CPXA 2J9CA 4PXDA 1ZBTA 4O4RA 3KLVA 3LGNA 4HL9A 4WFYA 5B0CA 4Y2IA 1VQMS 1RLCL 3MAAB 4KV8A 1JKHB 1E6VA 2VHGA 3QAEA 1Q81T 3C6UA 2OH2A 2DXFA 4FYYB 1IJEB 4UZCA 1ICEB 3TZWA 3OTOJ 2ALYB 3BO2A 1QY7A 4OX9J 1KP6A 1KVKA 3M9OB 4KO0A 5G0RA 2VC1A 1W2BR 4ELUA 2CZ4A 1NMEB 1S0MA 3SCLE 2R7OA 1S1TB 4YFUA 2W25A 2DJWA 3H5UA 3PW0A 2W2NP 1NAQA 4ZP7A 1A0OB 5F8JA 3JQJA 2BKNA 5CCMA 1NXIA 1ZM4A 5F8HA 2OPRB 2E1CA 4DV5F 1GMWD 2HEKA 5EWFA 3RTVA 1JQGA 1NHUA 5ETKA 4FN5A 2JHEA 3OSPA 1EB0A 1FDBA 4LF9J 2HWHA 4DPYA 1LFWA 5GAGU 3JTOA 4OI1A 4X4UA 1EJ7L 3GONA 3BBBA 3BSAA 5D78A 2HGMA 5DETA 2NSBA 3HPOA 1YZ6A 1KTQA 4X65J 5KFXA 3PXGa 4ATNA 2NXNA 4IRKA 1TAQA 5C42A 3TA2A 3FBFA 5FIIA 1I1GA 2PT0A 3R6LB 2AW0A 1TV6A 4ECQA 3E3XA 4C6AA 4FS2A 1IQZA 2E29A 3OSNA 2G2YA 2CRLA 2MEWA 3SQOP 4PQUB 5KG2A 5EX3A 4NA2A 2QLWA 4ZCKA 3KHRA 5HLFB 4Z2XA 1RWPB 4BDPA 5B0BA 3UDLA 2FVSA 1UCNA 5C5JA 4KGVB 3M6VA 1NJYA 3G6VA 5FLXU 2QFIA 2X1FA 2LQ9A 2QG9B 2DR6A 4R5PB 3W9JA 5GAHU 1T9VA 2IDEA 4WF9Q 3US5A 1IR0A 2HW3A 1U2CA 4IOAQ 2RKIA 3NOGA 2DR5A 3C14B 3DXBA 5CYMA 3U7JA 3FCHA 3T1HJ 2W01A 4X62J 5KFOA 2A2CA 2OLWA 4Y2CA 3CJ2A 1N88A 2KKHA 3ZTQA 1HNWJ 4CLWA 2X51A 2E1MC 1X31C 1PYSB 2NXJA 2LFVA 3HXMA 2PD1A 2YWEA 3GFXA 1HL6A 2V2QA 2E7XA 3QSIA 5DDPC 4USWA 3IG1A 1RAFB 5DZ6A 1C4AA 4KIAA 2EVZA 5DG7A 2B5JA 4F26A 4C4WA 4F2RA 3DLEB 3G8QA 2E9ZA 4DCJB 4ZPAA 2MY8A 2XI2A 4OX7A 4FPRA 1S97A 1CJKB 1Y9OA 3DRRB 1JK9B 4RW6A 3T41A 2Q6CA 3IFEA 3DM2A 1VC6A 4M5LA 2OMOA 3HFVA 5J2PB 1URRA 4J9PA 3EICA 5HMYA 3G96A 1NJIT 2MDAA 5KFBA 4LSLB 3UN5A 5L1LA 4DPTA 1UEVA 3RRGA 3W8GA 2RVJA 3OTOF 1UETA 2ZEJA 1OY9A 1T03B 4ZCMA 1S5ZA 3VAIA 4B9VA 2M4MA 3I5CA 4C11B 2QC3A 1XR7A 3VCDA 1HPZA 4NWBA 1WC0A 2B56A 1JJ4A 1T9XA 2D69A 4OZ1A 3W61A 3BB5A 1NK6A 1N5YB 2V68A 3HSJA 4EZ9A 2VD3A 4A8XA 1Q53A 2Z4PA 3PEJA 4NLYA 3TZXA 3U1LA 3VQTA 1RABB 3PO5A 3M8SA 4EYHB 3S1TA 5HMWA 4YB7A 5C25A 1T05B 2Q43A 1IQTA 4U96A 3NS6A 2UU9F 1DFDA 1U2RA 2ZH1A 4O3NA 4ZP8A 1PJ7A 4X4NA 1NKEA 1QSLA 4R0EA 1K47A 3UDEA 2AEFA 3WC0A 1RGVA 4DCOB 3KLHB 1O8BA 1C2PA 2OAUA 2D3OR 4QIGA 4Q0BB 5CABA 3DXSX 4ZVPB 1H3DA 2F63A 1QSSA 4HI2A 5B0AA 2B6AA 3R5JB 5KFDA 2R3VA 4CWBA 4CO5A 2B8PA 3NGRA 3K57A 2DRDA 5C7PA 3BBFA 3PR5B 2XQCA 1JLEA 4Q2MA 2QA1A 1AB8A 3TAQA 4K2XA 4OZLA 3AY0A 1B99A 2QMWA 2ADCA 3JAMU 3FQKA 2XSFA 2C2RA 5C24A 3KG4A 3DYAA 1NK9A 4YMEA 1L3VA 5IC4B 5CXTA 2XLKA 2X3GA 5HMZA 3Q23A 4KTQA 5D0GA 4ZVEA 3V6DA 3BREA 2HQDA 4IG3B 3T1AA 3GR0A 1NH7A 1HNWF 1OO0B 3IO1A 4DFMA 3MFIA 2BOPA 2DNOA 2VFUA 4Y2KA 3CJKB 4X4QA 2J7WA 3G71S 1PAUB 1X9MA 4M8LA 2HHXA 1NSPA 2E66A 1BQXA 1FTRA 4EO6A 1WKKA 5CH7B 1PCAA 4C2MA 2DHGA 4Z7YA 4A8SA 3TAMB 4YHHJ 2VG7B 1MMNA 3CMQA 4JYAJ 5IS2A 1F2GA 1VJQA 2GFFA 3FEYB 2R2SA 4XK8C 4RW9B 3ENAA 1TUGB 2HLUA 2QGFB 2VPZB 1VQLS 1S1VB 4CP5A 2ABYA 1RBLA 4NCAA 3V6HA 2JEGA 4AL6A 1R0BG 1RWWB 3W64A 2CFXA 2VG5A 3KJNB 5IC6B 5DJBA 2C42A 5A2QU 3P5BP 1EARA 2AEMA 5HBMA 3AXKA 5JJBA 3LA0A 2A1BA 5GAEU 3CJRA 3UD3P 1Y11A 2ZH6A 4DF8A 4ELVA 2KI2A 4JV1A 1G7CB 3FFIB 4IO1A 4LBPA 2VPYB 1FXRA 1HBOB 4OZ2A 2KVIA 3GJTB 1X5SA 1L3UA 3Q2SC 1HI0P 8ATCB 3OHBA 1DY3A 2FVQA 2XLJA 1V3SA 2C28A 1Y5IB 5HVHA 2VPXB 2LEPA 5E0OA 3LP2B 2N82B 1OQ3A 4JI2J 4CCHA 4B9TA 4C97A 4OHXA 3NGDA 2FIUA 1S12A 4JI8J 2FPHX 1RI7A 2OSQA 4NPOA 1OSDA 4ZLPA 2HNDA 1RT6B 2W9BB 3ETMA 1R0CB 5ETRA 5K14A 2E44A 3QO9A 1TVRA 2XMJA 4ER8A 5M2UA 2RDDA 3N6NA 2KT5A 4RBTA 3HO1A 3LF0A 2CJBA 3JS9A 4DSKA 1WJ9A 2W8LA 3R1HA 4A47A 4UY8T 1U0HA 4KGXB 3J81Y 2HYIB 2V0NA 4CO0A 1H0HB 2DNQA 5E3PA 5A76A 2MQLA 2YKMB 4C7QA 3PDNA 2GO9A 2VUGA 1AFIA 2L48A 2CQ4A 2QRRA 1VC0A 1SB6A 1FKPA 1TL7B 5DDRC 2H4YB 5LSLA 2MXYA 5CYJA 4B9UA 2PN6A 4AYBD 2HAIA 3QZ7A 2F7VA 3G86A 2HVZA 3LWLA 2C2ZB 2B3TB 1UFLA 4P2XA 2V8PA 2W2QP 3B4DA 2VH7A 2XMAA 2IJNA 1YLXA 1YZ7A 2AJ1A 1JJ2R 3ILJA 1BC6A 5IT9U 3KLEA 4WE1A 5KFWA 2Q6BA 2IM1A 3TA1A 3PYGA 3M8QA 1UKUA 2XULA 2HSEB 4QOTA 3MHYA 3K58A 3PJXA 3S6EA 4PG8A 3POTA 1WWHA 3L3CA 1NEEA 1XNRJ 4A8MP 4YHHF 1IKVB 2LQ8A 2JEFA 4ZLJA 3GIJA 4TY8B 4BWMA 2R7WA 2DH9A 1LV5A 3EMTA 1IKYB 3AAWB 3IGVA 3FMWA 3BS9A 4BWJA 2WBMA 1LWCA 3CTRA 3SIPB 2QLFB 3C15A 1V9OA 1ZA1B 2Y0SD 2LXUA 1WHVA 4A8FA 4RW7A 1YDLA 2ZD1A 3OHAA 4MYUA 2LKZA 2ALZA 5AE3A 4QYRA 1HBUB 1QAIA 4R0JA 4K4XA 1WC4A 5K8NA 1WEYA 3N5BA 3IAM9 3DI6B 3CW2C 1KOOA 1SC1B 2IC3B 3EXYA 1N4LA 1Q8BA 3D1QA 4WKYA 2WAQD 5LJ3Y 2MKJA 3EXCX 1NDPA 4CLZA 2PMWA 1NJXA 3FGVA 4KPYA 4JI2F 2OMLA 1JXLA 2YWWA 2XC9A 2CADA 1RAHB 2WW8A 3VTIA 2BANA 5DGBA 5DS7A 2NYIA 4RBUA 1VK8A 1GMVA 3FBBA 1VQSA 3DGPB 3H5XA 4FNHA 2UZAA 2RRBA 2WB4A 1JLFB 2EI5A 2YWFA 1EP4A 3LAKA 2KN4A 1IBLJ 3Q8VA 4HACA 1VQOS 5KFVA 3QWPA 2XS2A 2RQKA 3EUNA 4UZBA 2C3OA 1BHNA 3T3FA 5H1SV 4ELTA 1D8YA 4IH7A 2VC0A 4GC6A 1RT4A 2AF6A 5CHCB 2QT7A 1FI4A 2RIJA 4Q7AA 2VG6B 1F9HA 3S7RA 1KLNA 5L46A 3NOCA 4ZP9A 4DPOA 3HSDA 4QU7A 1X0PA 4DSEA 3TWZA 1MROA 3T19A 4NLSA 1AZSB 1R43A 1ZM9A 2YWGA 4K4WA 3PW2A 3THTA 2YNFA 2G2OA 2E1PA 1NPRA 2BQRA 4O3SA 1JJHA 1XWLA 2F8EX 4WFZA 2IM0A 4LR9A 3D4JA 2PSZA 2GCFA 4CLKA 2OTLS 4H54A 1N32J 4ZHRB 2DY1A 1VFJA 4OV6A 1FK9B 1GMWA 3MMJA 4P73A 2DGUA 2YWHA 4B3OB 3ZTPA 1E6YA 3K5MA 2V9KA 1FX4A 1S7HA 4NXNJ 2GQCA 2EKYA 2HBQB 5A6PA 3AH6A 4IFYB 3GV5B 5IM0B 4DR2J 2XO6A 4DSJA 5F8NA 2AYMA 1XNQJ 4ECXA 3MPYA 4O23A 4ZP6A 2Z8QA 4Y3CA 1HI8A 2KRBA 2DR8A 2DNZA 4LSZB 1T95A 3G82B 5K8OA 3W5ZA 4I2PB 1M5KC 4F67A 4LSNB 4DI6A 1VK3A 5D8HB 3DLLQ 2CVEA 2ACMA 3M8PA 1TKTB 4CO4A 2R8GA 3NCPA 1JLGB 3CF5Q 3K0JA 2HWTA 2Y1RI 1FDDA 4YP3A 3HKWA 4GO7X 5KFYA 3AQOA 2AIRB 2APOA 2FJDB 4PXCA 1B3TA 1WEXA 2YNGB 4DV3F 3KMQA 3KK2A 1FVQA 2MQOA 4KT0C 3LANA 1AA1B 3NGTA 4EBCA 3MECB 4WWSA 4N8NA 3DRSB 3W2WA 1IVZA 3V4IB 3BPDA 2RQ4A 3UDCA 3WIVA 4BLGA 4DF4A 3VR1A 1VRTA 4KBIA 1CJVB 2D3O1 3H5SA 2D3ZA 3CJSA 3MPDA 1RHMB 1Y5LB 1NSAA 3MZIA 1QTMA 3A13A 4RR5A 1R8CA 3H4DA 4YS2A 2VFRA 3K8WA 2OPSB 4V1Ak 3U1NA 3BYPA 4OL8A 2FZKB 1YJNS 3A3OB 3EVOA 4DR4J 4NLVA 5KOWA 4ZJLA 3Q0AA 3UO0A 2XMKA 1YIJS 4DG1B 1WC3A 2MZJA 3ENVA 4I7FA 3MM9B 2OELA 3JYTA 4ZCLA 4QCLA 3AD8C 1IBLF 3J81j 2ZBIA 3AD7C 4P9SA 1R6YA 3CC4S 4AUKA 3CD5A 3N01A 1SQGA 5CD4H 5H9EJ 2IRUA 5I42B 5CQGA 4GVBB 1DTQB 4JI0J 3IR7B 3D67A 2J0WA 2J5AA 1FEEA 4C8NA 2J9EA 3TX8A 3HKZD 5F0UA 2ZH9A 3ZZ0A 2YQ0A 1N6QA 4K8RA 1K1QA 3TOQA 5KFSA 3J80U 4C8ZA 2UUBJ 3LGHA 2DNNA 3SBMA 2EPIA 1H2VZ 2GNKA 3AXMA 5GADU 2CQIA 3DOLB 2ZKUA 2MLYA 1CS4B 1MU2A 3TQ1A 1IN0A 4ERDA 4M1KA 1S9EB 3B54A 3NG8A 5ETVA 2MQMA 3CWJA 1U47A 1N32F 1UVLA 4GC7A 3FKBA 3HDSA 1DLOA 1TK0A 4WCEQ 2KG0A 2D9PA 1B7YB 3FBCA 5KG0A 5F8MA 2FZGB 4TYAA 3RR7A 4NXNF 1TAUA 3IWNC 4Z37A 5JVGQ 1DBDA 1NDCA 3PYFA 4QYZJ 2F5GA 2WONA 3ELHA 4M5GA 3M2VA 1TQLA 4X4TA 1RCOB 5DM7Q 4KV8B 2EFVA 3HVAA 3CD0A 3ILOA 2ZKTA 1TMJA 3BR9A 2ILZA 1SKSA 2BX6A 2CPIA 1UPPA 2B0GA 4A8QA 3JB9k 2AJ4A 3DDIA 5E3QA 3IR6B 2LVWA 1S48A 2FTRA 4K0KJ 2GJFA 5D77A 4KO0B 2BW7A 1OQ6A 3RUBL 1VQ6S 1SH3A 3I56S 4DSFA 4L72B 4BHQA 2H9ZA 1JMTA 3C8YA 2DO0A 1HWLA 2KT3A 3RR8A 3VAJA 2XCPA 5KFMA 4C98A 1CULA 3NAHA 4K5SA 3TUJC 3D0HE 1Q7YT 1RTHA 2FZCB 3PX0A 2PEHA 1FWLA 3HMJG 2K8GA 3RGIA 5AXKA 2V2VA 2BOAA 2PFDA 3MEEA 3M8WA 3EZUA 5F8LA 3T6BA 5DDQC 1VRQC 4URQU 3CB4A 4M5IA 5KT7A 2VA3A 2XMUA 4DV1F 4KC5A 4NLRA 4OI4A 1WKLA 5BXIA 2WOMA 4F3QA 1ZTTA 1S9GB 4X4RA 2YNIA 2JEJA 4DBQA 3I0RA 2AWZA 5J1PA 1TKZB 3SQGB 2E5IA 1UEUA 3TJAA 1VC5A 3D5MA 1TV6B 4OYWA 3ZC4A 1HWIA 5KFHA 1YVFA 3TVZA 2F4FA 3CCZA 2KM8C 2DPIA 2F65A 4N76A 1VJWA 3K2YA 1Y3KA 2H51B 1S1XA 2EWHA 2OPQA 2UV8A 3MAAA 2HPUA 2KZMA 5HO4A 4MFBB 3I4PA 4QQBA 2XZTB 3MF5A 4BC7A 2QZ8A 2ZM6F 2CQPA 2HHQA 1XN9A 5D6GA 1U6FA 4F4XA 3HCXA 1Q7LB 2UUBF 1P9QC 3T1YF 4B02A 2DGSA 2WK4A 5CYMB 1Q16B 2Q66A 2AYEA 4GMKA 3HSGA 3ET6B 3M8RA 3FJ2A 4E98A 2UVUA 4MIAA 3UI3A 4DUZF 2CQ2A 2E5LF 3OUYA 2BABA 3CCJS 4IH6A 3EZOA 2XWYA 3IG1B 5FJ4A 2GGPA 1REGX 1K0TA 2CXEA 4XPEA 1SIZA 3B4MA 2R7RA 2EKNA 3JSRA 3NNCA 2Z2YB 1H7XA 2CQGA 3CT9A 1UVMA 1FA0A 2QFJA 4M63A 1VRUB 2WSCC 2FB0A 5LMNJ 3RAXA 3IBWA 3DM2B 1FFGB 1L3SA 4NZ7A 4B3SJ 2HRUA 3H7HB 3UN2A 1CLFA 4CI0B 3K89A 4C8KA 3E01B 5B0FA 1L3KA 2BJ7A 4HH0A 3KDOA 4FF2A 4DS4A 1B0VA 4JI4F 2OJ3A 1RAGB 4YR0A 1VQ8S 2J6TA 3VZIA 3M1VB 1H6KX 3MUMP 4PQUA 2HIQA 3FRZA 3FMBA 1M1KT 3BH6B 3FCVA 2V50A 3KHLA 2XMWA 1TELA 4WPAA 1SJQA 2MHEA 3DDNA 3O1LA 3BEGB 1VQ5S 2ZH4A 3M32B 2ZOFA 5KFCA 2IRYA 2FLOA 4ZVUB 4Q8EA 2HQ3A 3C14A 5CZXA 4FPIA 2CQ0A 1HNVB 5C25B 2C2MB 3VQSA 1WACA 4ZPWR 2EG1A 5A8RB 1WKJA 3I9V9 1P6TA 1Y10A 4S0MA 2DGOA 3IC1A 4BC9A 3A4TA 4DN0A 3IWLA 4PXEA 1SQEA 2Y8YA 5G4DA 5IV4A 3NS7B 4JI6F 3DLEA 3TW0A 2C3PA 2B8QA 2QL9B 1CJKA 1U6ZA 5HVGA 4QR2A 4QW9A 4DU8A 4DL6A 3PY8A 3AFGA 2QL7B 5E2QA 3O2IA 2E1AA 3PIPQ 1YI2S 2P5VA 1JLEB 2RS8A 4QJVA 4XIUA 1JNZB 1KONA 1VBKA 4ZIWA 4YR3A 3D6TB 2VBYA 2J0XA 4FYWB 1NK4A 3EM1A 4P52A 2DGWA 3IBFB 4I69A 2HHHJ 1XBWA 3SCJE 4JV5J 1U8SA 1X9SA 3I4HX 3QIPA 2WSEC 1T3OA 1TK5A 4EFAC 3EGWB 3I82A 3MMAA 2OGUA 3L7UA 1FX2A 2B9XA 2NR0A 5LT5A 1T05A 5IWAF 1Q86T 1ZM3A 3BSCA 1FNOA 3CXCR 5D0HA 1FERA 3R9LA 5ETLA 1DTTB 3VF0B 1KTVA 4F25A 4J9NA 3HZEA 3H40A 4LRCA 2CZVC 4MK8A 1H72C 3GJQB 3DMJB 5KG5A 4DV7J 2LEBA 4C0OC 1VCTA 4NLTA 1WNEA 4Q0BA 3UW1A 3CCSS 4Y28C 5K9FA 2ZH3A 1Q4RA 4FDFA 2P9GA 4USHA 1HNZJ 5L9XA 1RTIA 2XHWA 2J76E 3P4UB 1JXEA 3D54A 3U27A 2GA7A 3P6YC 1HWUA 4JB8B 2J9DA 3N6MA 1RDRA 2AGQA 1WHYA 3BV8A 3GZ7A 1X5TA 4EK2A 3A12A 2ZNZA 4KE5A 4PG7A 3Q8SB 2CNOB 2EBEA 4U8YA 3S01A 3UVJB 3OW2R 3LALA 1EETA 5IV3A 4HT7A 1RHUB 1RWUA 1DQ8A 4IH5A 4NLQA 4FYXB 2HNDB 3R2DJ 4P72A 1N8RT 1TP7A 3C6TA 4CO3A 2C2NA 1JJCB 3CJKA 2DNKA 2W7OA 3TZZA 4ECUA 2CPZA 2DTJA 2LCWA 4M5DA 2VFVA 1IBKJ 4NYPA 1TMMA 3OFGA 4HI1A 2UVWA 2B51A 1QD1A 2HQCA 2LU1A 2O66A 2MZRA 1EQ0A 4RW9A 4PXBA 4LFBF 2Q1LA 3M2RB 4K5RA 3T6JA 2EK6A 3BQ0A 4F4WA 4DV6J 2C3YA 1S1VA 4ZVHA 5LSOA 3KK3A 4A4JA 4A8YA 3QT8A 3K7RA 2CZ9A 3ZXWA 2GHVC 2RU3A 4QIWD 3PW5A 3FDSA 2Y1IA 2IDLA 4CT8A 5ETPA 3UCUP 1X4EA 4USUA 4HKQA 4Q45A 4P2MA 2RE1A 2K3KA 1ELOA 4QWEA 4LUBA 2PMZD 2DNYA 1UA0A 3FFIA 3K8VA 1HR0J 2CDQA 2DD8S 4GRSA 2VASA 4CM2A 3MEGB 4MMOA 3R5DA 2ZUAA 2OD6A 4WE1B 4QWCA 3IR5B 2FJWA 3HT0A 2KO1A 1JLAA 3ENWA 3DFEA 1S6OA 2BJ9A 3KUGA 3M8QB 1T3NA 2H65B 2LA4A 1YJTA 3JQMA 3LP2A 2C3MA 2CWKA 3N5FA 2FGCA 3PJ9A 1WHXA 2ZVIA 3OXLA 3MPWA 3MURP 2Q3PA 4QR1A 2R7SA 1RT6A 2W9BA 1KQFB 2CNKB 3CJ8A 4WTYA 4J7CA 3H90A 5CZVA 1BLUA 4KKOB 4ZJOA 3S8SA 4DV4J 4WTOB 3L4BC 1FRMA 4DV7F 3OL7A 3C15B 3A3NB 2LP4A 3CE8A 5GMKa 2Z56B 4E8UA 4X4SA 4WU3A 1UFKA 3GQCA 1HNZF 4M5MA 3PKMA 4OX6A 2I6WA 1NH8A 4CLSA 4WP9A 1R8HA 4LRFA 3TP2A 2P2CB 2ZJRQ 1TL7A 4AL7A 1VR6A 4WK3A 4N7TA 2M52A 1BWEA 2FVPA 2XYHB 1SJFA 3A3PB 1Q0NA 2RQMA 1C1CA 3CDBA 3TVYA 3DNCA 4LF8F 1QAXA 3IGNA 1DARA 4KHPF 5ETSA 1M0SA 1RAEB 3QGGA 1EP4B 4ECRA 1GTEA 1YGYA 4F2SA 3B8HA 1O5JA 3I0SB 3CVKA 4OYZA 2W4CA 3PW4A 5KFRA 4LRBA 4N47A 4OI0A 1RWVB 3OL6A 3PZPA 1M5OC 2LQBA 3I5AA 3CCUS 4NASA 3KHGA 1RT4B 2BQUA 5HP1B 1IKVA 3GFYA 4HTIA 1S6QA 3CMES 3CGIA 4TY8A 2R2TA 1WG1A 4XAKA 4NI2B 2ZZMA 3CJTA 2HVHA 1HNIA 4QW8A 1WSVA 1S59A 1R7IA 3O44A 4K4VA 2V8GA 4DR5F 3GR1A 2F4VJ 1RTZA 2IVMA 1MW7A 5L1KA 4KPCA 3Q86A 3D2WA 3K5OA 3QFHA 5LOQA 4DFKA 3HVTA 4P6QA 4DFPA 1HBUA 3EJMA 4WJBA 1X0FA 4CNYA 1E6YB 1HR0F 3N9UC 1NKCA 5KT5A 1RBAA 3R5CA 2IC3A 2HQFA 3ILLA 2FD2A 3NWRA 1R3NA 2AJ0A 2NREA 1S6UA 2DH8A 1XMOJ 5K20B 2IVFB 1UZHA 2FHOB 4K59A 2WRMA 3A8JA 3HHLD 1ZTWA 3KLFB 3BQ2A 3CCWA 3BGLA 3N79A 1WC5A 2KHCA 2LDYA 3CNQP 2NXCA 5IOLA 3V2UC 4DX8H 3DGPA 4WFBQ 1TL4A 1GX5A 5HVFA 2GQQA 5HJXA 4CLLA 4Y6IA 2XZWA 4ZVFA 4CLUA 3OFEA 4F50A 3MCMA 1T0TV 5HQ8A 2B4OA 5H9FJ 2IBKA 3UR0A 3F56A 5THWA 2QL5B 3HHEA 1WEZA 2JH3A 2PFFB 1FWPA 1P9YA 3KK2B 4PG5A 4PYAA 2GAGC 1S0VA 3QRPA 2IY5B 2VDIA 5GMDA 3H98A 3PHEA 4TN2A 5ITHA 4Q44A 3W2WB 1TUVA 3QIDA 2BBEA 1M5HA 5F9LA 3CIZA 1CVJA 1N34J 2N4CA 3KNAA 1GMUA 1SC6A 2UUCJ 1NDKA 4J37A 2KT2A 4M94A 2E9RX 2LYVA 2M0GB 4O3RA 4X64J 1RJJA 2UP1A 4K4ZA 5LXRA 5CAAA 1PJ6A 1UW4A 4B3OA 4OX8A 2FC8A 5EGYA 1Z1ZA 3DOKA 4B3MJ 3RBZA 1ZZNA 2YKOA 1NK5A 2J8SA 1N33J 4C8MA 1WF1A 2D9OA 2L41A 4PPDA 3RJMB 4U7UD 1TTHB 4LQ3A 5CYQA 3H2LA 1HARA 1HYSB 2H5IB 1J5EJ 1X60A 4ECZA 1QUPA 3VAFA 4NOHA 5BR8F 2XTJP 2DGQA 1ZOTA 2F8MA 1K8AT 2M8HA 1RWOB 3G82A 4R8UB 4LSNA 1SJRA 1DHMA 2H3EB 1WHWA 1VQ9S 1F9EB 1RK8A 1N6QB 2FY1A 2FJAB 3SCIE 4BS2A 2B7CB 1TKTA 1NBEB 4UOGA 1N54B 1JLGA 1O6XA 4LF4F 2CWXA 2MYFA 4OJ3A 3CPWR 1MU2B 1QSYA 2V2ZA 4RNMA 2QYGA 1J5OB 1S79A 4TKTA 1KFDA 1QDUB 2HFVA 3EE3A 2F4VF 3BBCA 1RBOB 5AT1B 2QJ3A 4B3RF 1TK8A 4OMFG 3QRQA 2BM1A 4B9LA 4DV5J 4DV0J 4OHWA 2ZC4A 3G6ES 2RJZA 2CG4A 4UOFA 1DLOB 1FE0A 2W1BA 2Y3YA 1F6TA 2D3UA 3DRSA 2KFYA 5DLFA 4CLPA 2CUYA 2VB6A 3V4IA 5I4MA 2XZDB 1SKUB 4J9LA 2EFNA 1RHQB 2JLGA 3Q8PB 2HZVA 3IMQJ 3EWGA 1CJVA 1I3OB 3MR5A 3R5AA 3DLKB 2WONB 3CJ3A 4RX6A 2DB1A 1M5PC 4JV0A 2CJ9A 2FY8A 2OPSA 2QA4S 2GS8A 1X4CA 2IFXA 3DKDA 4DQQA 2WW4A 3OL9A 4KGMA 3TJ8A 3UDVA 3SFUA 3PR4A 1LOUA 1CPZA 1NCLA 1CJUA 1CQMA 1SH2A 4CDIA 5CA5A 4XDCA 5I42A 4GVBA 1DTQA 4RNOA 4V19X 3TYTA 2YBVA 4W4MA 1D9AA 2FGOA 3RB3A 1GEHA 3JAMY 4RNHA 1CULB 2L9WA 2V8DA 3KLIA 3QT5A 2DBBA 5KFZA 1EX8A 4K4SA 1A6LA 1RTHB 4IRDA 2VQFF 1WDDA 3DOLA 2BUNA 4GKJJ 2AJ2A 1CS4A 1XMBA 2E5GA 2RHSB 1OPZA 3LP0B 2NLWA 1N34F 3GSDA 2W2PP 4ED2A 2UUCF 4NRTA 2B9WA 3HULA 3MGJA 4TNOA 2XCAA 2IAJA 4Z7CA 2CNLB 4ES3A 5D4OA 4C0BA 4HEA9 3I0RB 3GIIA 1NLKL 5HL7Q 3CMAS 3QATA 2LU2A 1S1WB 1VYAA 2ROEA 4CIOA 4QBUA 4EZ6A 1N52B 1B70B 3KUHA 2IMOA 4ED7A 4H4MA 1I51B 4IR9A 2OKQA 1D9FA 4FNIA 1J5EF 3OTDA 1S1XB 3OTBA 2OPQB 5AJ3J 1OIAA 2HMIB 2R4FA 1EKRA 3W5XA 4WIIA 1RXOB 3HI9A 5A2QY 2G13A 4ED5A 3VVUA 3ETOA 1J27A 2OP5A 5DM6Q 3HHLC 1SXLA 2RSQA 1SJ1A 3R6GB 1K44A 3OTCA 1L5UA 3ZFVA 1RT2A 1REVB 4USJC 2DO4A 3HZGA 2D41A 2VBWA 2HVIA 2WSFC 1MN9A 5D0RA 5T41A 1FRXA 2VBZA 2VA2A 3BKFA 1OSCA 5J2MB 4DV0F 3DDKA 2GMHA 5KOXA 1XJWB 1ZM2A 1IKXB 3OUYB 3Q2TC 2AKWB 4LFCJ 3TUPA 1ZETA 1LWEA 3OVAA 2GGPB 4IO9Q 2ZHOA 1HQ2A 3UQSA 3WHIA 2G0JA 2ATCB 3EVWA 5A8WB 5MLCV 2DEIA 2UU9J 1R0AA 2XYGB 4FF1A 2RS2A 4TU9A 4OYAA 4ES1A 2OIHA 3QJJA 5C2GA 1H74A 3EDQB 4FKYA 2D7SA 4USVA 1S9GA 1LWFB 2HRTA 4M5JA 3OQ2A 1ZAXA 2HQGA 3P3DA 2DYAA 1TKZA 3SQGA 4I6WA 2WB1D 1RA6A 3A1YG 4PWDA 1NB2A 2FLPA 3FSXA 4ID5A 2QO3A 4TLQA 4DZ6A 1KBRA 3LOUA 4U6PA 1UP1A 4OHVA 1FD2A 4JI5J 2WVEA 2Z2MA 2M8DB 2VF3A 5HATA 5GAGI 2HHWA 3MTJA 5KFPA 1BUXA 1KS2A 4CZCA 1HI1A 4MFBA 1XR6A 1CJTB 4FYVB 3LUYA 2ZJQQ 1EKSA 3QGHA 3E8OA 1Q78A 4QR0A 2MZQA 1S4FA 2P8IA 1GXLA 4OLPA 1PC4A 3RB6A 5AXNA 4GKJF 2QA2A 3P5TL 2FC9A 3ET6A 2KXFA 2VBXA 4WFXA 3FUYA 2UUWA 1SH0A 3ZNJ1 4ED1A 4J9UE 5ETNA 3PW7A 4NZ6A 2QE5A 3FVYA 2OEJA 1HNXJ 2HQIA 2HBRB 3WIUA 2V2KA 2ZITA 5M2PA 2C3UA 4P2SA 4MKBA 4ZKAA 1WOPA 1VBZA 2AEJA 1YJWS 2AZ3A 2C2EA 4K7QA 1X8DA 4GO5X 2RILA 5GAHI 2GHPA 1VIXA 1VRUA 1O0PA 4ZOSA 1YWXA 3CJ0A 1RLDA 4FKXA 4URSA 1SKRA 3AJDA 3ILIA 1TL3B 1RYRA 4O0IA 5AJ3F 1P27B 2MY7A 4DL0C 2ZVSA 4LVNP 1VI7A 4RKUC 3IRWP 3CDWA 4RJVA 3IN5A 2CJXB 3E01A 3T9ZA 4FBTA 2RAQA 2GZOA 2GAHC 3CCES 1TL5A 2HG4A 2HGLA 1NPKA 1AUSL 4PWWA 4RUCA 5J1EB 1PJ5A 3M1VA 4AT1B 3CEDA 3BKUA 5KG7A 4J91A 4EMDA 2L9DA 1D8ZA 4TYBA 3VGVA 1LNQA 3MEKA 3RB0A 5BYSA 1FF2A 4NYOA 3QIPB 2WBRA 4DSLA 1NKBA 3C46A 3D0GE 1FRHA 1UVNA 3M32A 1UJ6A 2JNJA 1T11A 1U1MA 2CPFA 3MMAB 5D3GB 1WDTA 4ICLB 3H25A 4DX7A 4LFCF 1VLOA 4ANEA 1U26A 3AT1B 2JC1A 1HNVA 2W9AA 3RAQA 5EWGA 2JX2A 1SV5A 3G9CA 4LF5F 1G1XA 5A8RA 1X5OA 3VGSA 4RUHA 2FHMA 1Y4ZB 3I6PA 2B4VA 1QVGR 2MQ8A 2IA6A 4RUAA 3MR3A 1C0TA 4PQAA 4ECYA 2FVRA 5F41A 1RTIB 5SUHA 4ZVRB 3TA0A 4JI5F 2VFSA 2MHNA 2NPIA 2O3DA 1UAWA 5KFFA 1FT8A 2JVRA 3D9BA 2CPHA 2FJBB 4ZA1A 2UXBJ 2HBZB 2BKOA 1JXVA 1EETB 1CSJA 3M6UA 1FESA 1IUJA 5LL6d 2FLLA 2K1RB 3CUNA 2J7UA 4O3QA 1KC8T 2KM8B 1Q1KA 1HW9A 3MM5A 1UEKA 2KYZA 3EPIA 1LK5A 3KLGB 2XYPB 4ED3A 1RHRB 2DHXA 2V5HG 2IPOB 3SXLA 3C6TB 5HSPA 4KAIA 4IFVA 4CT9A 1HNXF 2MJUA 4O44B 3GJRB 1YBAA 2CVIA 3MUTP 4C0HA 3ZZPA 3VALA 3FSYA 4PR6A 4M5DB 4PKDB 1XMQJ 2Z0GA 3ISZA 3OR2B 3HHLA 2AT1B 4WZQA 1YRXA 2HAFA 5EDWA 3J7YU 3IM9A 5IFMA 3RG6A 3UD4P 3QJLA 3AA9A 2N3OA 1DTTA 2CPYA 5LSRA 1ZYQA 2BEFA 2BR0A 3GYXB 1C1BB 2C1EB 1IBMF 3HSZA 4DXLA 3KK3B 4TU8A 3DMJA 2F8HA 2DNRA 3D1HA 2A2DA 1KD1T 3PFOA 4QWBA 3SMZA 3ZTRA 2PO4A 2UVRA 5FD1A 3OVSA 1U1OA 2R7XA 4G6VB 1TFYA 4ZITA 2P6SA 4UY85 2FJVA 1WORA 2OEMA 1KHWA 2X1BA 1DZ5A 2MGZA 2EW9A 1JWWA 1B64A 4W98A 1TZ0A 3NBPB 5A8KB 2MPUA 5HK4A 3R3TA 3G8SA 1JLAB 3Q8UA 2EFQA 3P96A 4DPUA 3UVJA 3FK4A 3K5PA 1KQGB 4OZ3A 3SFGA 3MR2A 2RH3A 1PBAA 2QSWA 4ZVTB 1VGYA 2FJXA 5T7LA 4C8OA 3R7BB 2KJVA 3LW5C 1F5AA 2XGQA 3UWTA 3AJ2A 3H59A 4DL4A 3CCQS 1XK8A 2K7JA 2XNQA 5GAEI 2NQPA 5DRKA 5DG8A 3DRYA 2R2RA 1BMQB 3SSSA 5E5NA 3GILA 1PC5A 4MK7A 1RWNB 2G2ZA 1HWJA 2PIIA 2AZ1A 3AOAA 5T14A 1VBXA 4KB7A 2RUGA 1N36F 1MSWD 3D6FB 4DDFA 3FC9A 2OUGA 5KFNA 3VZHA 4DR1F 5D4PA 3J80Y 3M2RA 1WELA 4USIA 2J6UA 3EVMA 3UNYA 4EI2A 4I2QB 5KFAA 3NNHA 2V69A 2HIYA 1T94A 4NCBA 2XS5A 2DNGA 1UJ4A 3EGZA 1HQUB 1VQKS 1UVJA 2HFSA 1RCXB 2UXBF 4HH1A 4ZK7M 2WCXA 4DUYJ 2L08A 3W7BA 3L7PA 1C1CB 2MMYA 4LR7A 4ANDA 4J9VA 3L09A 4OJGA 1NDLA 2PA3A 2AGOA 3U1MA 1GFWB 3ZTOA 3DOMB 3MEGA 4P10A 1NO8A 2G4BA 5CCLA 2W4PA 4Q5VA 3L9ZA 4NEZA 1QE1A 4L6V3 2R7TA 2XWXA 1PAEX 2JEIA 1U6BA 5KFKA 2BJ1A 4YOEA 4CQ1A 3HP6A 1XMQF 2RMLA 5AXLA 2H54B 2P9CA 2ZZTA 3CIMA 2OFGX 1S6QB 3OR1A 1URNA 1JLBA 2BM0A 2ASYA 5A6WA 3GCWP 3W5YA 1R6VA 2ZNYA 1VQ4S 3MMBB 1HNIB 1CC7A 2FJEB 4RU2A 1TR0A 4KKOA 3D66A 1JLQB 4RZRA 1WG4A 1T7PA 4PEOA 2MKIA 4DV3J 4U67Q 3TQEA 3RYLA 2AHOB 2OFHX 2AYBA 2JFDA 3BF4A 1N0VC 3MPVA 5IQ6A 1TL1B 1Y5NB 3HVTB 2K2PA 2XY5A 1NHVA 4DL2A 1A7GE 1KN6A 1N56A 2GC8A 3TEGA 4IRCA 5LMUF 3QLHA 1FD8A 4IDKB 1U25A 4ZS6A 1UVIA 1SUQB 5K5MA 2JZ5A 2LECA 1ZZFA 2PDAA 2UUTA 4EU0A 3W9IA 2XB2D 4USMA 2G1DA 2CPEA 3H4BA 2J8AA 3HX9A 5H9EK 3JSBA 3W63A 3D28A 3T9NA 5B0DA 1Q79A 2UUAF 4FF4A 4AL5A 4F3OA 4RNFA 1UZDA 2DNMA 1XTZA 2XGPA 1LWXA 3DRPB 2CQ1A 3EPGA 1OPIA 3I0SA 3PCOB 3OL8A 4DEZA 2BA9A 1TU0B 3ZZOA 4IR1A 2B7BB 2R8KA 2EC0A 3MPUB 2F3JA 1XC9A 4RNNA 5HQMA 5HP1A 5DQGA 2VJUA 3J7A1 2N4DA 2HK2A 2YNHB 2E7VA 4JI7F 4NI2A 1AFJA 1RTJA 4PWUA 1HBMA 2DGTA 3GG1A 2OTJS 4NX9A 3BPSP 1RSCA 2XG8A 1QAYA 4M5KA 4DUYF 3UFCX 4A48A 2YWKA 2HRYA 3G6YA 4OHZA 4ILMA 2CJKA 1F3FA 2RF2B 2K3IA 2ZH5A 4WIQA 3DOKB 2VKRA 3Q22A 6FD1A 2YKQA 4OYBA 2LXFA 3KJQB 3PACA 1FJGF 3PEHA 5KFEA 2QLJB 1KQSR 3V6JA 5JMNA 4JI1F 3OD2A 3TI0A 2CNNB 1RYSA 5CYQB 4UUWA 1F5CA 4Y34A 3BKTA 2FHJD 3DLGA 4CO2A 5KFGA 3KLFA 4LVOP 3QBCA 3HFKA 3LQVA 3NRBA 3H2UB 5B0EA 2NXUA 4NXMF 5AE1A 1PYTA 4DWIA 2OPPA 5RUBA 4LRAA 1LW0B 4UTGA 2WTFA 2DGXA 2KU7A 3MCNA 4WZMA 2AV5A 2VICA 3LGMA 5KT2A 4WP8A 2UXCF 5GMEA 4X66F 2JWNA 2H5EA 4I56A 1FNMA 2ZE2B 2W7AA 3ZZRA 3NY0A 3NGKA 3MM8B 1X4FA 2YY3A 1KOHA 5L1JA 2HFZA 1RQ0A 2R2UA 1EAYC 4DJBA 1FDNA 1YBTA 4FBUA 5HROB 4KFBA 1W26A 3DC2A 1NB7A 4ED0A 3D1OA 5D0EA 2J0QD 2KHDA 3UE2A 2G0CA 4JP8A 4Y00A 4HR2A 4DV1J 2KZZA 3CDEA 2J7KA 2GVZB 3ONQA 2W9CA 4EEYA 1K9MT 1QLNA 2P9EA 2Y9HA 2K06A 1T8EA 4IKAA 2GV1A 3CCLS 1U45A 3R1LA 1FFWB 4J9KA 1F5BA 4BCAA 4UQGA 2KH9A 4WU2A 1CJUB 4DQIA 1LKZA 1HYSA 2R8HA 1H73A 4O0NA 1PIEA 4LFAF 1OYDA 3BGRB 2G1HA 1VISA 4R8UA 2ZM6J 5HAOA 3KLIB 4OI6A 3OXFA 5KFIA 3T1YJ 4MH8A 3R5GA 2V4QA 2V9WA 3ULHA 1WI6A 4EGLA 2V4JB 2JC0A 2DRBA 4D3GA 1J5OA 4NZ0A 2MKSA 3D6HB 3TEHB 3MXHP 1BY9A 4DUZJ 4HDGA 4C3LA 4OLOA 4OHYA 2E5LJ 3IS9B 2ZHBA 2IAJB 2LQJA 4Q43A 4YN3B 2W2OP 3GPAA 3MCOA 2C2KB 5I3QA 1GK8A 2JJ4D 4AXJA 4F04B 3GCXP 3LH2S 3M7VA 3L7OA 3NKYA 4F7VA 1BD6A 3KNGA 3KJFB 4OYPA 3ITHB 4XDDA 5DZ7A 4H4MB 4XPCA 4M5NA 1SBRA 4Y0FA 1RP5A 3NGUA 3OVBA 3KOAA 3TO8A 5GADI 3MM6A 4CTAB 5KFUA 3DLKA 2BE2A 3PNIA 4MTPA 4TXSA 3X1LB 1MN7A 4I68A 3MUVP 4C9DA 3KG1A 4WXWA 4RBVA 4X4VA 3W2VB 1N48A 4B9MA 3IA0A 3SV3A 2KRRA 4P7VA 2MLZA 2R8JA 3GB0A 4EUVA 4JI4J 2ZDPA 4C48A 2YVSA 1RT2B 3BQ1A 5J2QA 1G3OA 1EQMA 3R5BA 2ZFHA 5JXSA 4MKAA 4N77A 1CQNA 2MZSA 3QT6A 3KTQA 5KG1A 1AW0A 2L3MA 1FDAA 4IQXA 4LBIA 2DH7A 1MWZA 4C3MA 2I5JB 4KHMA 4KJIA 3C16B 1LWEB 2X3DA 2LLZA 4OX9F 1BQMB 3LP0A 1DQAA 2ACYA 3W62A 3PX4A 1R0AB 1UWAA 3HJFA 4WKRA 2A0FB 2GX8A 1SIWB 3BH7B 1LW2A 1S6PA 4ITSA 1S10A 4IOCQ 1RT3A 1H2TZ 4DL3A 2ZBPA 1NPPA 1HW8A 4F0KA 1GNKA 2AMCB 3KJVA 2G0IA 1S1WA 4JI6J 3RRKA 2NSCA 2DPJA 3R2CJ 4PWDB 5D15A 4OYIA 4X4PA 4LF9F 4ID5B 2UV8G 2XMMA 2ZUGA 3CC7S 2XI3A 3PM9A 2NZ4A 2BJ3A 1YJVA 3MM7B 2XBPA 1FRJA 2V34A 4HLBA 4ZPTR 2HMIA 2Q79A 4X65F 4F02A 3FEXB 1Q8IA 3BDPA 3L95X 4DX6A 1KQKA 4H4OB 2I9SA 4QZVB 1RU1A 1W2IA 4TQSA 2HHUA 1S1UB 1C0UA 4CO1A 1BWVA 3OFHA 2PI4A 1PO6A 3D3CJ 2BJEA 1UA1A 4HDHA 1FO1A 1G4CA 3MFHA 1REVA 3JSYA 3SSQA 1YRUA 4PABA 2FQQB 4J9RA 1X4GA 4DPWA 2JFKA 3D6MB 1BQNA 4O3OA 1HA1A 1VLYA 2V6AA 5ETMA 4OJHA 2HNZB 2ZBQA 2RNEA 4ENOA 3GJSB 3M30B 1S77D 5J2MA 4LF7J 1FEHA 1IKXA 1IKWB 3N0VA 1OMSA 2NUHA 2HGNA 4USTA 5IWAJ 5A8WA 4O4GB 4U7CA 4E0DA 1UPMB 3T1HF 4DLGA 1HMVA 1HFEL 2HFOA 3F0NA 4X62F 1A9NB 5DO2A 3BDEA 5K8PA 3SCKE 4NLGA 2VV5A 5KT3A 2XNRA 5E3AA 1TUWA 1C4CA 1LWFA 3WX8A 1P1LA 3FZBA 4NMLA 5B0GA 2NUUG 3Q89A 4WFNQ 3AA8A 2JDJA 3DHXA 3B82A 4K50A 2ERRA 1WOOA 3QNWB 3BJYA 2QLBB 2BV3A 4W92B 3CJ4A 4EBEA 2KL8A 5KFJA 3DHWC 4LF6J 2N7YA 2W24A 2VODA 2B9YA 3HFZB 2HFNA 1S76D 1MLAA 1RUSA 4LJMA 2ROPA 2UXDJ 3MEDB 1RAAB 3LP1B 1V6HA 4ZPBA 1CJTA 3U02A 2CIMA 1SL2A 1IBCB 3B78A 3ADAC 3HVWA 2CQDA 3TUZC 1K1SA 5E41A 1RAIB 2XLIA 4EBDA 3A8IA 1H38A 4W90B 3HF5A 5I3PA 1U7LA 4NE9C 2PA8D 1W25A 1N5SA 1RT1A 2E7WA 3DLHA 1SV5B 3P49B 1HQEA 1M5VC 1DRZA 1X7VA 1V3RA 4Q8FA 4B08A 2V67A 1JLCB 5IXUA 5ADZA 2IBOA 3VVTA 5B08A 4N8OA 2ZH8A 3DLBA 4UW2A 1YJUA 1HD1A 4QIFA 2ZWPA 4JI3J 3AHPA 2AGPA 3QMQA 4WFAQ 1C0TB 1FHTA 2RDJA 1SCJB 4FXDA 2W8KA 1Q5VA 2GJ2A 4LFBJ 2AJQA 4U7UK 4P2FA 1TL3A 1QAJA 3PYEA 3C66A 3D68A 3M9MB 4BBYA 2GMJA 2M5YA 3G87A 1GT8A 2B9EA 4OI2A 2OO4A 1N5VA 1R8AA 2WVCA 3THVA 1NM2A 3GMGA 3Q24A 2ZBRA 1YBUA 3MR6A 2MQNA 3EDRB 1RACB 2OD4A 4DSIA 2EG2A 4JOUA 3M4XA 2I1RA 1ZAWA 1ZH5A 4RL1A 5J1EA 1UMJA 3MM5B 4EO8A 3FQLA 7FDRA 2CJAA 1U09A 3R97A 1TFWA 2EFPA 2WZ1A 5DGAA 1X5PA 2MQPA 2O1PA 3X3UA 5JVHQ 4IFVB 4KY3A 4Y2AA 3ZNUA 4JUZA 3QZ8A 2GVDA 4ZMMA 4LF7F 3CO0P 4ED6A 2FHKA 5D3GA 4ICLA 1U1NA 4E2FB 3HHLB 4F4KA 3R27A 4PUOB 5B7WA 1F9FA 2AU0A 3AOCA 4L3KA 2PGCA 3JTNA 2V63A 4B3TJ 1FJ7A 1SL0A 5IT4A 3O6QA 4URGA 2RHQB 1OS5A 1R8PA 1RWXB 5HI7A 1KWMA 4OYXA 4O3PA 1HHSA 3PRDA 2NXEA 3HHNB 1UW9A 2ZC3A 2DXDA 3HVRA 1V5IB 4DFJA 4IG0B 1P1TA 2GHWA 3N4WA 1XEZA 2MKCA 4WYWA 5IZHA 5ETOA 5A0YA 2Z2LA 4PG4A 3PG9A 2A3JA 4ES2A 3MR7A 1DQ9A 2E9TA 4JYAF 4DUTA 4LF6F 1YJRA 2ILYA 1YJ9S 2MGZB 1W7WA 4X4OA 4DR3J 2UXDF 1B0PA 4ZCIA 4RW8A 3ENQA 2V94A 2N3LA 4TQRA 4FXWA 3IRXB 5EHHA 3MI7X 3CCVS 4NEYA 1TKDA 3CJ5A 1AT1B 1D0EA 4Y65A 4LF8J 2K1RA 3TX0A 5T7LB 1FJCA 4P74A 1F0XA 4KHPJ 2BW2A 2EBGA 3KLGA 4DZDA 1JNRB 2UVVA 4UQTA 4RW4B 1GX6A 2BRLA 4PCQA 2N7CA 4ID8A 2WVDA 4O44A 4UF4A 1DURA 3MMCA 1KLMA 2OSRA 2FHJA 3OR2A 3PO4A 4ZVSB 3SEOA 4JI3F 3Q8RB 1XQIA 2DIUA 3FZ2A 1TKXB 2GQ2A 1FXDA 4JI8F 4M95A 5LM7E 5F3ZA 3BO3A 1UVKA 4G1IA 2XHCA 2EXUA 4USKA 4CNZA 1C1BA 3V81B 4F4ZA 1SPBP 2SXLA 3MD1A 2IYGA 2LDIA 2YX1A 3ISND 4DR5J 2BKPA 2DEJA 4G1QB 3AOBA 2VPWB 4C8YA 3FSIA 2Z2ZA 3EGNA 2Y1LB 2CAJA 5BYRA 2HHPA 4ZN1A 1SKWA 6FDRA 2AX0A 3UCGA 3Q8YA 4MIBA 1U2FA 3W60A 1SC3B 2NZCA 3NBPA 1NRKA 5A8KA 3E2EA 1Q8KA 4YB5A 2CQ3A 4DOZA 4CH1A 1QE1B 4NYZA 2EK1A 2GMLA 5FDLA 1S4EA 4CYUA 2F1FA 5H9FK 1VOMA 3GSIA 4PAAA 2DK2A 3OT9A 4A8WA 4YDXA 4B9NA 3IP0A 4MYTA 7FD1A 3IBCB 4B3TF 1FKOB 3VWSA 1GXUA 5I3UA 3G8TA 3T5JA 2PE8A 3OR1B 3O3LA 1PG5B 1JLBB 1GH8A 2J0SD 3GWCA 3KG0A 2J6SA 1UWBA 4WYLA 4Y2MA 5CD4A 2RU9A 2RT3A 4J9QA 4OZJA 3RAMA 1HHTP 3N6LA 4ZIVA 1KR4A 1VQYA 2EFOA 3V5RA 3TAPA 1X4AA 1P8GA 1YKWA 1KHVA 2ASLA 4ETZA 2IVYA 4OIXA 3SDEA 3DLJA 4ED4A 1XNRF 4L3NA 3K59A 2AQ4A 4PRFA 3KMSA 3WX4A 2HS4A 9RUBA 4I2QA 2DHHA 4LBHA 1NJWA 3OV7A 1Y7PA 4DR3F 3QLHB 1HQUA 4U9RA 4MK9A 1RWKB 2JLEA 3FRYA 1KNZA 4TVAB 2FDNA 1Q82T 4UUXA 2MSTA 5HMXA 3EZ5A 2HS3A 3SZ2A 2VQEJ 1CC8A 3M8YA 3M2UA 1OY8A 2ZJPQ 2I0XA 2PC6A 3DOMA 3Q83A 1RT5B 4FP9A 4X84A 3VV2B 2CJQA 4ECTA 2HZAA 4K4UA 4ANCA 4C8LA 2DHSA 5BR8J 3BYRA 3GP9A 5JUMA 2JL9A 1KEKA 2MQQA 3GTYX 1RTDB 2GIRA 3OBIA 2XSJA 2YKNB 2BVZA 2JRSA 1EIYB 1PBUA 5DQHA 3MMBA 2ROGA 3NXZA 4LF4J 4KRWA 4M5HA 1RTJB 4I1TA 1JLQA 3ZO7A 1LEOA 1HBMB 4NLXA 2VOOA 1ULRA 3O8WA 4B3RJ 3PRVA 2H48B 4AE5A 3H5YA 4DQRA 1HBNA 4DU7A 1TL1A 3J81U 4B9SA 2A18A 3W66A 2QTWA 2BJ8A 4N56A 2RRAA 3KFWX 3GV8B 1R31A 4JV2A 2QA4G 5J2NA 1S99A 3NCQA 3KK1A 3AODA 3DU6A 2AD9A 1D3WA 1Y3JA 4IDKA 3BSOA 4NLWA 1SUQA 4I4BA 2O5DA 5KFQA 4KYZA 2DKOB 5BJRA 2CA9A 2YKAA 2P6TA 2WVBA 3DLGB 4AD6A 1U1LA 3CO9A 3LPEA 2XY7A 4CLFA 2QYCA 3N28A 3AJ1A 4NCGB 1T9WA 3QYYA 1WF0A 2OPPB 2MKHA 3OJUA 3PX6A 2X1AA 3J7AN 2HNYA 3LAMA 4RPFA 3DRPA 4DR2F 2VL1A 5SZTA 2V4RA 1UJ5A 1VQ7S 2QX0A 1M5SA 4RLEA 2IIHA 2IRXA 2PI5A 1XNQF 2DNLA 2KVQE 4IYQA 4DR7J 4I0WA 4OJ1A 1RHKB 2M3DA 3TUIC 2CPDA 5FLXY 1WOSA 1UTAA 1E6VB 4NA1A 3MDFA 3R8YA 2L9NA 3C6UB 2YNHA 3RU0A 1RT7A 4L74A 1YK9A 2VQFJ 3WBZA 3JSMA 2RQCA 2VOPA 2Z30B 4KFBB 3BN4A 1M1HA 1FXLA 2DVIA 5G0RB 1R27B 4CLTA 4NLOA 2R9LA 3P8BB 5KG6A 3NWGA 1H7WA 3ZZTA 3R7NB 4DL5A 4PZVA 3MTKA 2DCLA 4KSEB 4MT1A 3TZYA 1SI9A 3PVXA 4YEAA 3PKYA 2HURA 3UR3C 4XTTA 2POKA 3HM9A 3BR8A 4AQYJ 1RA7A 2RF2A 3HD2A 4AXIA 1ZPVA 5LJ5Y 1VMBA 2W9CB 4KR0B 3WQPA 3ISNC 2VQEF 2YX7A 3I87A 4K4TA 3W9HA 3M6XA 3CJQA 4L75A 1FRKA 3OPKA 4J5OA 2DY9A 2VJVA 1ZPWX 3AQPA 3MD3A 4OQJA 3I55S 1WUUA 1MNEA 4KGZB 2CJYB 4ZPCA 3M8ZA 2EFGA 2U2FA 4V19J 1MWYA 4KQZA 3W1YC 3J7Z5 2HKEA 4QIVA 5L39A 2XMTA 5J1NA 1D09B 2QN6B 4DR4F 4IUFA 1FWKA 3KKFA 5C42B 4NA3A 3E51A 1RADB 1LW0A 2KXHA 3T5LA 2ZWOA 1RAJA 3PFEA 1WTFA 1N5QA 1AXQA 2DISA 4QPTA 1NK0A 1FJEB 1APSA 1ZA2B 2XMVA 2R7QA 1PYOB 2ZE2A 1CG2A 2IMWP 1ZAVA 1S0OA 4JI0F 1YITS 3TVKA 2E5JA 3MM8A 1JKHA 1S72S 1U48A 2KJWA 2DIVA 2R7VA 1VS3A 3LTOA 4U95A 2LQ5A 5E7OB 3JTPA 1LXJA 2B43A 2D1CA 3F44A 2JSXA 2H5JB 4FF3A 8AT1B 2RKIB 5HJYA 5HROA 4YB1P 3ZZYA 4ED8A 2RD5C 5KG4A 2YH1A 4YY3J 1S1TA 2FVCA 1Z2LA 1U1QA 3MM6B 1VQPS 2Y1JA 4ZVQB 4WK1A 2BE2B 2GVZA 2OPRA 1FE4A 1B0TA 1SC4B 5C2CA 1Q5YA 2QSFA 4OZ0A 4H4KC 3QFWA 1F2HA 2NCKL 2XY6A 2B5JB 3QWUA 2KTQA 1S9FA 1U4BA 2VKZG 2XS7A 3O5TB 1XIQA 2MB0B 2QIFA 4ECWA 3C2PA 1FVSA 1EHWA 5J2QB 4RW6B 4DR7F 2BDPA 3BGRA 2DGVA 2OHDA 4F3MA 1I6JA 2RUSA 3BO4A 1MMDA 2MLXA 2V8VA 2ZOMA 1OJ4A 1RE1B 4RWWA 1YX2A 3R7SB 2IHR1 1Q95G 2BQ3A 3LO3A 3FBEA 3NNAA 1IM6A 1WC1A 5B09A 2YXLA 2V4JA 2CYYA 4K0KF 3HHDA 1AUDA 2MZTA 4DL7A 5HLFA 1Z2ZA 4U8VA 1HPZB 2LXIA 3H20A 2FYXA 3JXOA 3NS5A 5KAKA 3IS9A 4AQYF 1LW2B 4R5PA 1S6PB 1HLWA 1RT3B 2YX4A 2DITA 3M6WA 2XEXA 1PGZA 3M9NB 4P7TA 2K7KA 3KJVB 1S7IA 3H2VE 4KHRA 3NLCA 3ITHA 7AT1B 3KWMA 2Z57B 4MAKA 3EX7B 2VZ9A 2I38A 1YG0A 2NYHA 3GFZA 4HVZA 4CTAA 3OLBA 1RKJA 4XO0A 4ZDNA 5F9NA 3MAHA 2HFUA 1X4HA 2W7PA 1HIYA 3RB4A 2O01C 4ILLA 3W2VA 5EUHA 1F1BB 1WTBA 2ZH7A 2BE9B 1H98A 1HKAA 4KGKA 1C0UB 4ECVA 3NL0A 4DQPA 3JQKA 3HHKA 2J9DE 3DRRA 2B6AB 4JBCA 4ETXA 2DRAA 4OI3A 3LWMA 2ATLA 3HJVA 4ALZA 2QMUB 1WSRA 1BQNB 3PRBA 5J2PA 4ZN3A 4DV2J 1WI8A 3UPFA 4TLRA 4B17A 4LSLA 1U1RA 2I5JA 3C16A 5C24B 2C2OB 5HN0A 3DYAB 3VGUA 4OV1A 1BQMA 2GO8A 2BYCA 2M88A 1T03A 4LF5J 2YTCA 1JB0C 4C11A 3V6DB 4YY3F 1HMVB 1QM9A 2WVFA 1R8BA 1YJ7A 3MCSA 4J9OA 3D7SB 3W65A 1IR1A 4FVMA 1N5YA 4F0MA 2CG8A 2NS1B 1D9DA 3GIKA 5D4LA 2X7IA 2DXEA 3ICLA 2YKPA 1X4DA 1FRLA 4ZLLA 3FCWA 2HK3A 3T5HA 3MOJB 3TARA 3OFFA 2HVDA 3MM7A 2F9DA 5KG3A 2I8EA 1PKUA 2HHSA 5LMNF 5KFLA 2U1AA 6AT1B 4B3SF 2QV6A 3FEZA 5KTQA 2AJFE 4DR6J 4H4OA 3KLHA 3NMAA 2KFZA 2VG5B 1S1UA 2DCUB 3ZTSA 3TJ9A 3W8PA 9ATCB 1S49A 5HBMB 2B4UA 5DLGA 4DS5A 4N5SA 1X9WA 4NLUA 1RT1B 1PSDA 1I94J 3I5BA 3KYLA 5IT9Y 1HQEB 1KVJA 1SL1A 2Y0BB 1R89A 2IJFA 4DCPB 3KHHA 3W3SA 3CDUA 2HNZA 5ETQA 2EC2A 2BJDA 4OZ5A 1HHQA 3M30A 2JLFA 3V4MA 4CLYA 1IKWA 2XM3A 1NZAA 3NGSA 2XO7A 4A8OA 4O4GA 3GYNA 4J9MA 2A6OA 1RZMA 3M05A 3H42A 4IG3A 2M7SA 1BGXT 4OYOA 5K14B 3BSNA 3QO9B 2DR9A 3RW6A 5ETTA 1IBMJ 1TVRB 1F3VA 2A6MA 1FKAF 3TNVA 1MG7A 1GQEA 3C19A 3NP5A 1SVDA 4UOHA 3A8KA 3BZQA 4K4YA 1MWQA 2ZDOA 2AP6A 3GLJA 1IXKA 1KVIA 1N0UA 1WD6A 1U0HB 4HHJA 4ILRA 3TAMA 2VG7A 3H0PA 4DX5A 1VHIA 2PMHA 3G4SS 3VAKA 4DQSA 5EN1A 4DN9A 3PTWA 1KDNA 1FFSB 2VFTA 2VU5A 5DG9A 2RDIA 3MEDA 3LP1A 1YQHA 2DNPA 1H2UX 2MKYA 1FKPB 2GVDB 4DV2F 4H4KA 5LXYA 5HANA 4LF1A 4L76A 2OI2A 2G9OA 5EWEA 5L8RC 1KRPA 5BYQA 4OFZA 4QWAA 2OEKA 4F0HA 2HHHF 4LMZA 1XR5A 4NRUA 1Y00A 1VBYA 1Z4UA 2RB7A 2DR7A 3UD5A 5MAOA 1HBOA 4I67A 1D1UA 4JV5F 1CEZA 3AB2B 4LIRA 1RISA 1V3ZA 3KLEB 1JLCA 2HBYB 3G2XA 4HTJA 3CULA 1LXNA 3P45B 2BACA 1HWKA 3I31A 2V8HA 2CKWA 1U0SA 1QJHA 3QQCD 2QLXA 4DHVA 4N41A 5IT0A 4LR8A 4P71A 5KT4A 3HD1A 4I6AA 3SV4A 1N36J 2RRNA 3POTB 1Q8LA 1T9YA 1F60B 5A0YB 3V6KA 4DR1J 5E33A 1ACMB 2R42A 1RWMB 4LF2A 2QEXS 1JX4A 4YDDB 1GXTA 4YQWA 3MWBA 4ZLNA 4ECSA 4AFFA 4RW8B 2YH0A 4NLDA 2B4PA 1VHFA 1WC6A 4DR6F 3OLAA 3HLUA 2YPZA 4RUBA 2F40A 1LWCB 1BE4A 3NCRA 1GTHA 1RB0A 4EWTA 1T9TA 3CCRS 3QPIA 4RW7B 4CRJA 2ZD1B 3QGIA 2CQBA 4CM0A 2YKMA 1HD0A 1I94F 5D4NA 3A8EA 4FS1A 3GV7B 4LRDA 1PILA 3RBXA 3GFHA 3TANA 1NZ8A 1B4SA 2MKKA 1EZZB 3BGUA 3MMCB 1KLMB 1LK7A 2YQ3A 2C2DA 3CSKA 4PUOA 2BZ2A 2X1GA 2BANB 2ADBA 1S0NA 3C3LA 3NAIA 1JIHA 3IWXA 3RBEA 3DU5A 5IQQA 4FZVA 2R7UA 1FCAA 3ZZZA 4ZVGA 4HACB 4GKKJ 3CDAA 2JVOA 1XERA 3CCMS 4ZPVR 3BN7A 4IG0A 5L1IA 1VQNS 1NNDA 1IBKF 3DGVA 3CD6S 1QUVA 3HK2A 2AX1A 1UL3A 1M90T 1M1GA 2NPFA 1NSKL 5AXMA 4FVCA 4RWXA 1MROB 1T02A 3J7YI 1IWGA 4DV6F 3I9ZA 5LMUJ 5L9NA 4Q2LA 3DRXA 2M2BA 2YNFB 4KH1B 1IKYA 3IRXA 2CQHA 4F4YA 2ASDA 2H1YA 1AROP 1ROFA 4MJKA 5HQLA 4F8RA 4QIEA 5FDLB 4CYUB 1V5VA 5U47A 5L38A 3RZAA 2GIQA 2ZHAA 4LQ9A 3K5NA 1IJFB 3IAS9 3UN3A 2JOQA 4IQMA 4G65A 2LA6A 1KSPA 2COLA 2UUAJ 4RW4A 5I3UB 3DI6A 2M9KA 5F8IA 1ZS6A 1U49A 2IJRA 4A46A 2MJNA 1VIOA 3QT7A 5E3CA 3MOZA 1UWBB 4FXVA 3OTEA 2KYXA 4G1PA 4ZVOB 3RW7A 1SJ3P 1B7FA 1DAXA 1TKXA 4IOBA 3SSRA 2LMIA 3H8YA 2DNHA 1NK8A 1LQ9A 4NL5A 1KFSA 3SDEB 5KT6A 2F9JA 4JI7J 2VIHA 1JLFA 3V81A 1VDHA 2HHVA 3M8PB 1ITPA 4TU7A 2PEBA 3AD9C 5F8GA 4RU9A 3RRHA 4QPXA 3VHQA 4C3KA 4WBFA 2FLNA 3AB4B 3TR5A 1NU4A 2HZCA 3Q8QB 4MIWA 3PV8A 4QU6A 4DV4F 2EEYA 4UOCA 3IXQA 4G1QA 2VDHA 3GIMA 2DT9A 3VAGA 5F0WA 2VG6A 2H4WB 3VAHA 3M2UB 2HS0A 2IM3A 2C22A 4D3HA 2IM2A 1FJGJ 1AZSA 4HT5A 3GIRA 5F3TA 3PIOQ 4HHHA 4HYKA 2KG1A 3WDOA 8RUCA 4JI1J 1YSJA 2MTLA 3QJPA 2R8IA 3F73A 3BGFA 1VRTB 4HHUA 3KDNA 3T5KA 4YUDA 3ZZUA 2Z58B 1SQFA 1QTNB 2W4DA 2DHAA 3CCTA 3K5LA 1FNXH 4ZJQA 1U24A 4ZHRA 1FK9A 3SI8A 2IYIA 1RHJB 1T9UA 2GJIA 3DCAA 1FKOA 4NXMJ 3QSYB 5K8MA 1U1KA 1OWXA 4LIWA 2IA0A 1NSQA 4I7FB 2XSJB 4I64A 3THPA 4IFYA 3UCZP 5IM0A 3JYTB 1G6BA 3GU0A 4L73A 4DLEA 4OYMA 1X4BA 4GKKF 2UXCJ 3PJWA 4X66J 1G2EA 4F4AA 3VGTA 2M70A 3GE9A 4DMZA 4YB6A 5AE2A 2BMBA 4EYIB 4MKYA 1O51A 4A8KA 4I6YA 2E5HA 1HBNB 4I2PA 1YHQS 3LPYA 4YR2A 3DN9A 3SYZA 4R25A 1UFWA 3IM8A 5J2NB 3TRGA 1K73T 1IM4A 2CQCA 4NMXA 2BE7D 3KK1B 2VONA 3GG0A 2ASJA 3EYZA 1BXNA 4ZPDA 3OXGA 2CDRB 2KB2A 1DJ0A 2ZH2A 2KDOA 4FYDA 3PHTA 3D0IE 2MSSA 3QGPA 4PPZA 2D74B 1NHKL 2YNGA 3CC2S 3B6BA 3OJSA 1QVFR 4QWDA 4KH0B 3QRRA 3KXDA 1U02A 2GIFA 1RAOA 4PYDA 1U1PA 1OYEA 5DDOC 3MECA 4LT6A 3QAUA 3I32A 2HVEA 2MZ1A 1RT5A 2QMXA 4K2JA 3F41A 1L3TA 2HNYB 4F36A 4CH7A 1NUEA 5DQIA 5EX0A 4MKVA 1OY6A 2A10A 1XMOF 1YTYA 3J7ZT 4P75A 2FUG9 1CBKA 2KXNB 1FRIA 4LFAJ 4J9SA 1WG5A 3WZ0A 1NK7A 3M2VB 1J2VA 3EGVA 4UT4A 3GYGA 1AYEA 3KUEA 2ZZNA 1IWAA 1SJ4P 3MAQA 1N5TA 1RTDA 2KFNA 2LEAA 4DG1A 4LREA 1RT7B 2YKNA 1K0VA 3MM9A 4NLPA 4TY9A 3RBDA 3JSMB 1S57A 2CPJA 4PG6A 1I5OB 1WF2A 2ZOGA 3NMRA 4OZNA 3CD7A 4WXOA 1NJZA 3NEKA 3D3BJ 3VAMA 2ZBCA 2AYGA 4QYZK 1FTCA 2GW8A 2HHTA 2BRKA 5KFTA 2HWIA 2O67A 3HT3A 3FNNA 4RO0A 4CH0S 2Y8WA 2BXJA 2WHOA 3WC2A 4G3IA 2YPYA 2HLTA 3MEEB 4WP3A 5GVQA 4GVLA
chains in the Genus database with same CATH topology
3BM7A 1P8GA 2DHXA 2E1RA 2V5HG 4C8KA 3SXLA 3E01B 3C6TB 5B0FA 1KHVA 2ASLA 4ETZA 2IVYA 1L3KA 1S9EA 4OIXA 4HH0A 3SDEA 4KAIA 3UNGC 4IFVA 3DLJA 4CT9A 1HNXF 1XNRF 2MJUA 4L3NA 3K59A 4FF2A 2AQ4A 4O44B 4PRFA 4DS4A 1YBAA 3KMSA 2CVIA 3WX4A 1B0VA 2HS4A 3MUTP 4C0HA 2OJ3A 4JI4F 3ZZPA 4I2QA 4YR0A 5E3RA 3G6XA 1VQ8S 5M2RA 4X64F 3FSYA 4PR6A 4M5DB 3VZIA 2WOMB 3VALA 2I2YA 2J6TA 3I96A 3M1VB 4PKDB 3OV7A 2Z0GA 1H6KX 3ISZA 3OR2B 1NJWA 3HHLA 3MUMP 4PQUA 1Y7PA 1RKIA 2YNIB 2HIQA 3FRZA 4DR3F 3FMBA 3QLHB 1HQUA 4X2BA 4U9RA 4WZQA 4MK9A 4NCGA 1YRXA 1M1KT 2JLEA 3FRYA 5EDWA 3J7YU 1LFPA 4B3MF 5IFMA 1YRTA 3KHLA 1KNZA 1GAOA 3UD4P 2XMWA 2FDNA 1Q82T 3QJLA 1MMLA 1SJQA 4UUXA 1N33F 3AA9A 2MHEA 2MSTA 3DDNA 3O1LA 3BEGB 2N3OA 1DTTA 1Y0HA 2CPYA 5LSRA 1ZYQA 1VQ5S 5HMXA 2CPXA 3EZ5A 2ZH4A 3M32B 2ZOFA 2HS3A 2BR0A 3GYXB 5KFCA 2J9CA 4PXDA 1C1BB 2IRYA 3SZ2A 1IBMF 2FLOA 1ZBTA 4O4RA 3KLVA 1CC8A 3LGNA 4Q8EA 3M2UA 4HL9A 2HQ3A 3KK3B 4TU8A 2ZJPQ 3DMJA 2F8HA 2I0XA 4WFYA 5B0CA 2PC6A 4Y2IA 5CZXA 1VQMS 2DNRA 3D1HA 2A2DA 1KD1T 2CQ0A 1HNVB 5C25B 3PFOA 4QWBA 3DOMA 3SMZA 3VQSA 2PO4A 4KV8A 2UVRA 1JKHB 1RT5B 1WACA 4FP9A 4ZPWR 1E6VA 4X84A 2EG1A 3QAEA 5FD1A 1Q81T 3OVSA 3C6UA 5A8RB 1U1OA 3I9V9 2OH2A 4G6VB 2R7XA 1P6TA 2CJQA 4ECTA 1IJEB 1TFYA 4K4UA 2P6SA 2DGOA 4C8LA 3IC1A 4BC9A 3BO2A 4UY85 1QY7A 2DHSA 2FJVA 4DN0A 3IWLA 4PXEA 3M9OB 4KO0A 2X1BA 1KHWA 1SQEA 5G0RA 2VC1A 1W2BR 1DZ5A 5G4DA 4ELUA 2MGZA 2CZ4A 2EW9A 1JWWA 1B64A 5JUMA 2JL9A 1TZ0A 1S0MA 3SCLE 3NBPB 2R7OA 5A8KB 1S1TB 1KEKA 2MQQA 2MPUA 4JI6F 4YFUA 2W25A 2DJWA 3R3TA 3DLEA 1RTDB 3G8SA 3H5UA 1JLAB 3PW0A 2EFQA 3P96A 1NAQA 3TW0A 2GIRA 2C3PA 3K5PA 3OBIA 4ZP7A 1KQGB 2XSJA 2YKNB 5F8JA 2BVZA 5CCMA 1U6ZA 2JRSA 3SFGA 5DQHA 1ZM4A 3MMBA 2OPRB 4QR2A 5F8HA 4QW9A 2E1CA 4DV5F 3MR2A 2RH3A 2QSWA 2ROGA 5EWFA 4KRWA 3RTVA 1VGYA 2FJXA 1RTJB 4DL6A 4I1TA 3PY8A 5T7LA 5E2QA 1NHUA 3O2IA 1JLQA 4C8OA 2KJVA 1HBMB 4NLXA 3LW5C 2E1AA 3PIPQ 1YI2S 2P5VA 2VOOA 4FN5A 1ULRA 2JHEA 3O8WA 3OSPA 1JLEB 2RS8A 1FDBA 4QJVA 1F5AA 2HWHA 2XGQA 3UWTA 5GAGU 1LFWA 4XIUA 1JNZB 3JTOA 1KONA 4OI1A 3AJ2A 4X4UA 3H59A 4YR3A 4AE5A 4DL4A 3CCQS 1XK8A 2K7JA 3H5YA 2VBYA 2XNQA 4DQRA 5GAEI 2NQPA 1HBNA 2J0XA 1TL1A 4B9SA 3BSAA 5DRKA 5D78A 5DG8A 2A18A 1NK4A 2HGMA 3DRYA 5DETA 2R2RA 4N56A 2NSBA 3HPOA 2RRAA 2DGWA 3SSSA 5E5NA 3KFWX 3GV8B 1KTQA 3GILA 4I69A 1PC5A 1R31A 2QA4G 5J2NA 4JV2A 1S99A 4MK7A 3NCQA 1HWJA 1XBWA 2PIIA 3KK1A 3DU6A 3SCJE 2AD9A 1D3WA 5KFXA 5T14A 1Y3JA 1VBXA 4IDKA 1U8SA 3BSOA 4NLWA 4KB7A 3PXGa 2RUGA 1X9SA 3I4HX 4ATNA 1N36F 4IRKA 1SUQA 4I4BA 1MSWD 4DDFA 1TAQA 5C42A 3TA2A 2O5DA 5KFQA 3QIPA 2WSEC 5KFNA 1T3OA 5FIIA 1I1GA 3VZHA 1TK5A 4DR1F 2PT0A 4EFAC 5BJRA 2AW0A 3EGWB 5D4PA 1TV6A 2YKAA 3J80Y 3M2RA 4ECQA 1WELA 3I82A 2P6TA 4USIA 2J6UA 3E3XA 3DLGB 3MMAA 4FS2A 1IQZA 2E29A 3OSNA 4I2QB 5KFAA 3NNHA 1U1LA 2CRLA 3CO9A 2XY7A 1T94A 4NCBA 4PQUB 2XS5A 2DNGA 1UJ4A 2QYCA 3EGZA 2B9XA 2NR0A 5KG2A 5EX3A 1HQUB 3N28A 3AJ1A 4NA2A 2QLWA 4ZCKA 5LT5A 3KHRA 5HLFB 4NCGB 1VQKS 1T05A 3QYYA 4Z2XA 5IWAF 1Q86T 1ZM3A 1UVJA 3BSCA 4BDPA 1WF0A 1FNOA 2OPPB 2MKHA 2UXBF 4HH1A 4ZK7M 2WCXA 3CXCR 5B0BA 3OJUA 3UDLA 2FVSA 2L08A 3W7BA 1FERA 3PX6A 2X1AA 5C5JA 2HNYA 3M6VA 1NJYA 3VF0B 1DTTB 3L7PA 3LAMA 3G6VA 3DRPA 1KTVA 1C1CB 2MMYA 2X1FA 2LQ9A 4DR2F 4F25A 2VL1A 4R5PB 5SZTA 5GAHU 4J9NA 3L09A 3HZEA 1UJ5A 4OJGA 3US5A 2V4RA 4WF9Q 1VQ7S 1IR0A 2HW3A 1M5SA 2PA3A 2AGOA 4RLEA 2PI5A 2IRXA 1XNQF 2RKIA 3H40A 4IOAQ 2DNLA 2DR5A 2CZVC 4MK8A 3DXBA 3U1MA 4IYQA 3DMJB 5CYMA 4I0WA 3U7JA 4OJ1A 2M3DA 3TUIC 3FCHA 3MEGA 5KG5A 2LEBA 4C0OC 2CPDA 5FLXY 1NO8A 4NLTA 1WNEA 2G4BA 5KFOA 2A2CA 2OLWA 2W4PA 1E6VB 3MDFA 4NA1A 4Y2CA 5CCLA 3UW1A 3CJ2A 3CCSS 1N88A 2KKHA 2L9NA 3C6UB 4Y28C 5K9FA 4Q5VA 1QE1A 2X51A 2ZH3A 2E1MC 4L6V3 2R7TA 1Q4RA 2YNHA 3RU0A 2P9GA 1RT7A 3HXMA 2XWXA 2PD1A 2YWEA 2JEIA 4USHA 3GFXA 5L9XA 1RTIA 2XHWA 1HL6A 1U6BA 5KFKA 3WBZA 2J76E 3JSMA 2E7XA 2RQCA 1JXEA 4YOEA 5DDPC 2VOPA 4CQ1A 3HP6A 3D54A 3U27A 2GA7A 4KFBB 3BN4A 1XMQF 2RMLA 3P6YC 1HWUA 3IG1A 2J9DA 3N6MA 2DVIA 1FXLA 5G0RB 1RDRA 1R27B 4NLOA 2R9LA 5AXLA 1C4AA 5KG6A 3NWGA 4KIAA 2AGQA 1WHYA 1H7WA 3ZZTA 2P9CA 2EVZA 3GZ7A 5DG7A 1X5TA 2B5JA 2ZNZA 4DL5A 4KE5A 4PG7A 3MTKA 3Q8SB 2DCLA 4KSEB 4F26A 2EBEA 3CIMA 1SI9A 4F2RA 2OFGX 4C4WA 3PVXA 3DLEB 4YEAA 3G8QA 3UR3C 1S6QB 3PKYA 2E9ZA 3S01A 4ZPAA 2MY8A 2XI2A 3OR1A 1URNA 4OX7A 1JLBA 2BM0A 2POKA 3OW2R 3HM9A 4FPRA 1S97A 2ASYA 1EETA 3LALA 3BR8A 5A6WA 1RA7A 1Y9OA 2RF2A 3DRRB 4HT7A 1ZPVA 2ZNYA 4AXIA 1VMBA 5LJ5Y 1VQ4S 3MMBB 2W9CB 1JK9B 4KR0B 4RW6A 3ISNC 2VQEF 1HNIB 1CC7A 2FJEB 2YX7A 3I87A 4K4TA 4RU2A 1RWUA 1TR0A 2Q6CA 3IFEA 4KKOA 1DQ8A 1JLQB 4RZRA 3DM2A 3M6XA 4IH5A 1VC6A 1WG4A 4NLQA 1T7PA 1FRKA 2OMOA 5J2PB 2HNDB 1URRA 4J9PA 3OPKA 4J5OA 2MKIA 4U67Q 3RYLA 5HMYA 3G96A 2OFHX 1N8RT 1NJIT 2MDAA 1ZPWX 3AQPA 2AYBA 3MD3A 1TP7A 2JFDA 5KFBA 3BF4A 3C6TA 4LSLB 1N0VC 3MPVA 5IQ6A 4CO3A 4OQJA 3I55S 5L1LA 1TL1B 1MNEA 3CJKA 1UEVA 1Y5NB 3HVTB 3RRGA 2K2PA 2XY5A 4ZPCA 2RVJA 1NHVA 3OTOF 1UETA 2EFGA 2U2FA 4DL2A 1A7GE 4V19J 3M9MB 2DNKA 1MWYA 2W7OA 1N56A 2GC8A 1KN6A 1T03B 4ECUA 2CPZA 2DTJA 4ZCMA 2LCWA 4M5DA 3VAIA 4B9VA 4KQZA 2VFVA 2M4MA 3I5CA 3J7Z5 4IRCA 4C11B 4QIVA 4NYPA 5LMUF 3QLHA 3OFGA 4HI1A 1XR7A 3VCDA 2UVWA 1FD8A 2B51A 2XMTA 4IDKB 5L39A 1U25A 5J1NA 4ZS6A 1UVIA 4DR4F 1HPZA 4IUFA 4NWBA 1SUQB 2LU1A 2JZ5A 5K5MA 2O66A 3KKFA 2LECA 1ZZFA 5C42B 2B56A 1JJ4A 2PDAA 4NA3A 3E51A 2KXHA 1LW0A 2UUTA 4EU0A 4OZ1A 3BB5A 2MZRA 3T5LA 1NK6A 1N5YB 4RW9A 4PXBA 2VD3A 4EZ9A 4A8XA 4LFBF 2Q1LA 1Q53A 2Z4PA 3M2RB 3PEJA 4K5RA 3T6JA 1RAJA 4NLYA 3PFEA 2XB2D 2EK6A 3BQ0A 1WTFA 3U1LA 3VQTA 4F4WA 1N5QA 2G1DA 2CPEA 1AXQA 1S1VA 2C3YA 2DISA 3PO5A 3M8SA 3H4BA 4QPTA 2J8AA 3HX9A 4ZVHA 4EYHB 1NK0A 1FJEB 5LSOA 3S1TA 1APSA 3JSBA 5HMWA 3KK3A 4A4JA 2XMVA 2R7QA 4A8YA 3D28A 2ZE2A 1CG2A 3T9NA 2IMWP 1ZAVA 3K7RA 4YB7A 1S0OA 5B0DA 4JI0F 2GHVC 1Q79A 2UUAF 5C25A 2RU3A 4FF4A 1T05B 4AL5A 4QIWD 1YITS 3TVKA 3PW5A 3FDSA 2E5JA 3MM8A 2Y1IA 1JKHA 4F3OA 1S72S 2Q43A 4CT8A 1U48A 1IQTA 3NS6A 2UU9F 3UCUP 1X4EA 4RNFA 2KJWA 2DIVA 2DNMA 1XTZA 4HKQA 2R7VA 4Q45A 1VS3A 1DFDA 2RE1A 2K3KA 1ELOA 2XGPA 3DRPB 2LQ5A 5E7OB 2CQ1A 3JTPA 4QWEA 1U2RA 4LUBA 2ZH1A 4O3NA 4ZP8A 1LXJA 3EPGA 1OPIA 2B43A 3I0SA 2PMZD 4X4NA 2D1CA 1NKEA 3F44A 2DNYA 1UA0A 1QSLA 2JSXA 3FFIA 4R0EA 3OL8A 4FF3A 4DEZA 2BA9A 3ZZOA 2RKIB 4IR1A 5HROA 3K8VA 2B7BB 4YB1P 2R8KA 2EC0A 2CDQA 3WC0A 2DD8S 3ZZYA 2F3JA 2VASA 2RD5C 4ED8A 1XC9A 4RNNA 1RGVA 5KG4A 2YH1A 3KLHB 3MEGB 4MMOA 1O8BA 5HP1A 5DQGA 1C2PA 2OAUA 3R5DA 1S1TA 2OD6A 4WE1B 3J7A1 4QWCA 2N4DA 3IR5B 4QIGA 2D3OR 2FVCA 2FJWA 4Q0BB 1Z2LA 2KO1A 1U1QA 1JLAA 3DXSX 3ENWA 1H3DA 3MM6B 1VQPS 2Y1JA 2YNHB 3DFEA 1QSSA 1S6OA 4JI7F 4WK1A 3M8QB 2BE2B 4HI2A 1T3NA 5B0AA 2LA4A 1YJTA 2B6AA 3LP2A 2C3MA 2OPRA 1AFJA 5KFDA 1FE4A 4CO5A 1B0TA 3N5FA 1RTJA 2FGCA 3K57A 4PWUA 1WHXA 1HBMA 2QSFA 4OZ0A 4H4KC 3OXLA 2DGTA 3GG1A 3PR5B 2OTJS 3MPWA 4NX9A 3MURP 2Q3PA 1JLEA 2XY6A 4QR1A 4Q2MA 2R7SA 1RT6A 2W9BA 2B5JB 1KQFB 2QA1A 3QWUA 2KTQA 1S9FA 2XG8A 1QAYA 3TAQA 1U4BA 4K2XA 4OZLA 4DUYF 3UFCX 2VKZG 2XS7A 4WTYA 4A48A 3O5TB 3AY0A 2QMWA 2YWKA 2ADCA 2HRYA 3G6YA 4OHZA 3FQKA 2MB0B 4ILMA 2QIFA 2XSFA 2C2RA 2CJKA 4ECWA 2RF2B 5C24A 3C2PA 3KG4A 1FVSA 3DYAA 2K3IA 2ZH5A 5J2QB 4RW6B 1NK9A 4YMEA 5DM7Q 1L3VA 5CZVA 5CXTA 1BLUA 4KKOB 3DOKB 4DR7F 2VKRA 3S8SA 3Q22A 2BDPA 3BGRA 6FD1A 2XLKA 2DGVA 2X3GA 2YKQA 2LXFA 5HMZA 3Q23A 4KTQA 4F3MA 3PACA 4ZVEA 1I6JA 1FJGF 3PEHA 1FRMA 5KFEA 4DV7F 3V6DA 3BREA 3OL7A 3BO4A 3V6JA 1KQSR 4IG3B 3T1AA 1MMDA 3CE8A 5GMKa 2V8VA 4JI1F 2ZOMA 3TI0A 3GR0A 1NH7A 1HNWF 1OO0B 3IO1A 4E8UA 4X4SA 4DFMA 4WU3A 3MFIA 4RWWA 2BOPA 1RYSA 5CYQB 2DNOA 2VFUA 3GQCA 2IHR1 4UUWA 4Y2KA 1HNZF 1F5CA 3CJKB 4X4QA 4Y34A 2J7WA 3PKMA 2BQ3A 3G71S 3LO3A 2FHJD 4OX6A 3NNAA 1X9MA 4M8LA 1NH8A 3DLGA 4CO2A 5B09A 5KFGA 2HHXA 3KLFA 2E66A 1BQXA 2V4JA 4LVOP 1FTRA 1R8HA 2CYYA 4K0KF 4EO6A 3HFKA 3LQVA 3HHDA 1AUDA 3NRBA 5CH7B 3TP2A 2ZJRQ 3H2UB 4AL7A 2MZTA 5B0EA 2NXUA 4C2MA 2DHGA 4WK3A 4DL7A 5HLF