1AFIA

Structure of the reduced form of merp, the periplasmic protein from the bacterial mercury detoxification system, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
ATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKATADAGYPSSVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Mercury detoxification
molecule keywords MERP
publication title Structures of the reduced and mercury-bound forms of MerP, the periplasmic protein from the bacterial mercury detoxification system.
pubmed doi rcsb
source organism Shigella flexneri
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1997-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1afiA00
2RMLA 1FVSA 2RSQA 3DXSX 3KNGA 2FB0A 5T7LA 4ZA1A 2OMOA 2RU9A 2W4CA 4YDXA 3DCAA 3LGMA 1VQYA 2IYIA 3K7RA 4HI1A 5B0EA 2HFNA 4QOTA 3QGPA 1JK9B 2FIUA 2AW0A 2OFHX 1Y0HA 1YJVA 1MWZA 2ROGA 3T9NA 2LXFA 3BGUA 2HLTA 5B0DA 1SI9A 3BR8A 4HI2A 1K0VA 1VQSA 3IWLA 5B0FA 2W4PA 5B0BA 5B08A 1Y3JA 1IUJA 2OP5A 1SQEA 5K9FA 2QYCA 4A4JA 1S6UA 3HDSA 1CPZA 2AP6A 3BN7A 3TNVA 4DL0C 4FNIA 3VTIA 1N5TA 2OD4A 1Q4RA 2QIFA 2XMVA 1X0PA 2XMWA 1YG0A 2HLUA 3GZ7A 2GFFA 2XMMA 5KAKA 1Q8LA 4Y2IA 3F44A 4EFAC 3HHLC 3MZIA 3HX9A 1Q8BA 1U7LA 1GXUA 4A48A 1X7VA 3HFKA 1KVIA 2L3MA 2KYZA 2QLWA 1YJTA 3KG0A 1YJRA 2EW9A 4Y2KA 1TL4A 3CJKA 4A46A 1APSA 1AW0A 1SB6A 5B0GA 4FNHA 4NPOA 2K2PA 1RJJA 3FMBA 2GCFA 4HL9A 5B09A 5T7LB 2W4DA 4OIXA 1Q53A 1Y9OA 3E8OA 4DPOA 2KT2A 1OSDA 2IFXA 2LQ9A 1KVJA 2BYCA 1V3ZA 3HHLD 2HFOA 1MWYA 2AJ1A 3BM7A 4F67A 1ULRA 2ASYA 2BBEA 1FD8A 4YEAA 2GGPA 1AFJA 2CRLA 1S6OA 1YRXA 3TOQA 2K1RA 2K7JA 3TRGA 1FE4A 5A6WA 1N5QA 1CC7A 2G9OA 3HHLA 1QUPA 1GXTA 4ZOSA 5B0CA 3FGVA 1XBWA 3BF4A 2BUNA 1FVQA 2JDJA 3BB5A 4HH0A 3WDOA 1URRA 2AJ0A 2LQBA 4HH1A 1P6TA 2KKHA 2XMKA 5F0WA 1N5SA 1R6YA 1TUVA 1OQ6A 5F0UA 2K7KA 2N4DA 1TL5A 4OJ3A 2RILA 2ZDOA 3IWXA 2QLXA 4A47A 2VH7A 1TR0A 2FHMA 2OKQA 4NL5A 2ZDPA 1AFIA 2OAUA 3LGNA 4U9RA 4OJ1A 2XMJA 3CJKB 2BJEA 4DN9A 1P8GA 2HQIA 2ROEA 2LDIA 1WD6A 2PD1A 1N5VA 3LO3A 2GA7A 1JWWA 2GV1A 1Y3KA 5A6PA 2KT3A 2GO8A 1TZ0A 2IYGA 2Q3PA 3FRYA 1CC8A 2N7YA 2OD6A 2PGCA 2XMTA 3QMQA 1OQ3A 1LQ9A 2VV5A 2ACYA 1X8DA 3BDEA 2OFGX 4Q2MA 2HIQA 2GGPB 3KG1A 5IXUA 1OPZA 2K1RB 3HF5A 1FESA 2FTRA 3HHLB 3I9ZA 3KKFA 4OJHA 1FE0A 4OJGA 4Y2MA 2BJDA 3MCSA 5B0AA 3UDCA 2ROPA 1YJUA 4Q2LA 1KQKA 2N4CA 1W2IA 2XMUA 1FEEA
chains in the Genus database with same CATH superfamily
2PFFB 4CYUA 3TI0A 1LWEA 5GAEU 3TUZC 1UJ6A 1WORA 2V63A 2M5YA 4UTGA 1MWZA 5BYSA 1NK9A 2W8KA 2QSFA 1SQEA 4PWUA 5HK4A 2HHXA 3IA0A 4DL0C 1JLEB 2ASDA 5C42B 4ZPVR 1CJVB 3W9IA 1S9GB 1S1XA 4YY3F 1TL4A 2G0IA 1VQMS 2FVPA 3MM7B 4KIAA 5L1IA 3OUYA 4FKYA 1NJWA 4DQRA 1FKPB 3ELHA 3VAFA 5KFUA 3M2UA 4OHWA 4I6WA 3G96A 4Q43A 3OJSA 2R42A 5KG6A 5HP1A 5EX0A 4OLPA 5IWAJ 1JJHA 2FLOA 3ILLA 1UPMB 3PRDA 5T14A 3CCUS 1X9MA 4JYAJ 3VAMA 4CCHA 4HT5A 3SCLE 1RT7A 4N56A 5ETOA 1WI6A 1H7WA 3IFEA 4ELUA 2ZH8A 3BGLA 2HHHF 1VR6A 3U1MA 4CZCA 1RU1A 2UUCJ 4CLWA 2WB4A 1K1QA 1JKHA 3BYPA 5GMEA 3LWMA 2DTJA 1HBOB 3GILA 2D74B 4A8KA 1T7PA 4RLEA 4EFAC 2C28A 1T05B 3BQ1A 3WZ0A 3NAHA 2H54B 4ZPWR 4NASA 4ZPTR 3Q0AA 3OTOF 2RF2B 4QYZK 5A8KA 2W4DA 4TY8B 2Y1IA 3D67A 2VG7B 4OI1A 3IC1A 2BYCA 2ATLA 4HT7A 3EUNA 2AQ4A 2FZKB 3D0HE 5DQIA 3VCDA 2RKIB 4EBCA 5J1EB 4F4YA 1KEKA 2HK3A 3RAMA 5E3AA 2ZVSA 3C16B 4HH1A 1RT5A 3TEGA 5D15A 4RW4B 3TA2A 3KK3B 2XMJA 1SVDA 3MM5A 2OPPB 1BY9A 3M1VB 1NK5A 2FZCB 5CD4A 1KS2A 3D68A 2EFGA 3MEDA 1R0CB 4DHVA 2DKOB 5M2UA 3TO8A 2BJDA 2XGPA 4DV6J 3AOCA 2PA3A 3EPGA 3MFHA 3OLAA 4O44A 4DR7J 5ETVA 2XY6A 2V8DA 1RWOB 4PABA 3OSNA 2AW0A 3BGUA 2MZSA 4EZ6A 4ZVEA 3LP1B 1SUQA 3VTIA 2F8MA 2FC9A 3UFCX 2CA9A 5HVHA 3GP9A 2HYIB 5IM0A 4F50A 5F3ZA 4ECTA 3FCVA 1HWUA 5IZHA 4JI8F 4KKOB 1EJ7L 1MN7A 2D3UA 3PW2A 2EG1A 5D0GA 1V9OA 1O5JA 1OSDA 2KXHA 2U2FA 1YK9A 4I2QA 4GKJJ 2V9KA 1J5EJ 4LIRA 1SH2A 3NCQA 2HMIA 5A2QY 1U1RA 2XMKA 1PBUA 2KO1A 4USMA 2CPEA 4C3KA 4B9LA 1HBMA 3BSCA 1NPRA 2UUCF 3KXDA 2Y1RI 2KT3A 4MTPA 3MMAA 3CCTA 3QYYA 1TK5A 4WP9A 1FX4A 3MUMP 4YR2A 1NO8A 1XR5A 1JLBA 2ZH2A 2CZ9A 3V6HA 5D0HA 3NGUA 1YIJS 2V68A 3W2VA 4NZ0A 3W65A 2V8HA 2W9BA 2IM0A 4UUXA 2WHOA 3TUIC 1R7IA 4USUA 2XMVA 1VQ8S 1X0PA 3K5PA 3OW2R 4M63A 4TLRA 4B3RF 2GIRA 1AB8A 1FWLA 2QLFB 2ADCA 3R27A 4DPOA 1IKVB 3NOCA 4AL6A 2Z8QA 2QG9B 3LPEA 2MJNA 4OL8A 5D6GA 1R8BA 3I32A 1PSDA 4M5HA 4UZBA 3N28A 1I5OB 2J8AA 1P8GA 3KLFA 3OTCA 3IRXA 3EPIA 5F3TA 5M2RA 3PFEA 3GR0A 1Y3KA 4DR7F 1S7IA 2XGQA 4MT1A 2ZM6J 1HQ2A 2B4VA 3T3FA 2XO7A 2VJUA 3N5BA 1NSPA 1WACA 2V67A 2DR8A 4CTAB 3DRSA 3DCAA 4TYBA 1NK7A 3QLHA 2LECA 4OX6A 2VG5A 4G1PA 1WC1A 1VQLS 3TWZA 2QJ3A 2D1CA 3C14B 3M6WA 5E5NA 2MB0B 2BEFA 1J5EF 1B0PA 3MZIA 2UXCJ 1RAJA 3DC2A 3PIOQ 2BQ3A 1N4LA 4QYRA 4ED5A 4LF7F 3O8WA 5J2QB 4HKQA 3H25A 4WIIA 1JJ4A 4LMZA 3KUEA 3M9NB 3GV5B 3T41A 3Q22A 2X1FA 3AJ1A 4JI4F 1S1WA 1N88A 4RNMA 1J5OA 2ZOGA 2RILA 5IS2A 5CHCB 2ZWPA 4ZLPA 2M70A 2QA4S 2DISA 3CJ8A 3GG1A 4RZRA 1N8RT 3MFIA 2DXFA 5L1KA 2GW8A 1YKWA 2PSZA 4DV3J 3CMQA 1WUUA 1HW8A 3HF5A 2DB1A 3WX8A 5AE1A 1D9FA 2EK1A 3CCSS 3BO4A 5C5JA 2EPIA 4NA1A 4DV5J 1NZ8A 3KHLA 2CQHA 4EUVA 5IC6B 4MIWA 4JI5F 1U09A 2ZD1A 1JLGB 1RTHA 3LWLA 2VF3A 3TNVA 4YS2A 3H4BA 1QAIA 2R4FA 1BQNA 3ZTPA 4EU0A 4P7TA 3H4DA 4NLGA 1P1LA 4K7QA 5B0GA 1FNXH 3R3TA 4CWBA 2KT2A 4JB8B 2NXCA 2C2RA 2V50A 3FZ2A 3KFWX 3VGSA 1S6OA 2H4WB 4EBDA 2Q1LA 3UO0A 2B3TB 1G4CA 1FVQA 1N34F 2YH1A 2VFRA 2YKNA 2NYHA 2MKKA 4O4GA 4CO5A 4X65F 2ZJRQ 4FBTA 2LU2A 3QGGA 3Q86A 1RUSA 4I64A 2HGNA 1VQOS 4PWDA 3J7AN 4R8UB 3JB9k 4DG1B 4ZDNA 3BBBA 1RHJB 1S9FA 4ZLNA 3W64A 1PAUB 3ETMA 3R2CJ 4BC9A 4H54A 4EZ9A 1WOSA 1GT8A 1NRKA 1F3VA 1S9EB 1WC6A 3UWTA 4R5PA 1VIXA 1CSJA 4F04B 1DTQB 2R8IA 1RI7A 4ZVUB 3L7OA 1RT4A 1R89A 2HVEA 3MOZA 4FF3A 4GC7A 2R7SA 4Y2IA 2J8SA 1QSSA 3UR3C 4RW8B 5LMNJ 1M5SA 3KK2A 1RA6A 4FF1A 4OX9F 2J76E 2ERRA 3CE8A 3GWCA 2RJZA 1HYSA 2CDQA 1JX4A 3R7BB 4I2PB 5D78A 5J1NA 4CO3A 2XY7A 4ZOSA 3MXHP 4J9SA 3GYXB 2FD2A 2HAFA 4KE5A 3VGTA 2HSEB 4ECVA 2VDIA 3O44A 1IBCB 3TQ1A 4AD6A 3NAIA 1LKZA 5FIIA 3FNNA 3V6KA 3CEDA 3X3UA 1N36J 2HWIA 4RNNA 2V6AA 2Z58B 3NG8A 4JV5J 3GIJA 3WC2A 3W61A 2MHNA 4ICLB 9RUBA 4QU7A 4TXSA 2YNIA 3ZXWA 1YI2S 4X2BA 2X1GA 4USJC 2CQ3A 3D9BA 3OVAA 4X4TA 1PYOB 3EDRB 2F4VJ 1RHRB 2E1RA 5ADZA 3NP5A 5D4OA 1X7VA 3RYLA 5GAGU 2COLA 3H2LA 4KGMA 4N8NA 4PXEA 3I56S 4B02A 2HZVA 1XJWB 4L6V3 3FBBA 3HK2A 1NM2A 4CH0S 2E7XA 1MW7A 3QT8A 4LR9A 4V1Ak 5H9FK 4DDFA 2V4QA 2FUG9 5DM6Q 2LQBA 2KKHA 1XNQJ 3VVTA 1IJEB 2UV8G 1IR2A 4KGZB 3DOKA 2RRAA 4ZIVA 3PRVA 1LFWA 3EZUA 2OHDA 2XHCA 4O3RA 2E5HA 2C2DA 5HBMB 3UW1A 2B9WA 3EGZA 4QIVA 4XK8C 4B9UA 1PCAA 1Y5IB 2OMOA 4Q0BB 4EEYA 2X3DA 4DZ6A 2RDIA 1BQMB 4A4JA 4OZ2A 1JLAA 3GFZA 1F5AA 3E01B 3LAKA 3N79A 4O23A 3BGRA 5DS7A 4OIXA 1XNRJ 4L3KA 1E6VB 4DSEA 4IG3B 5E3QA 2G13A 2VG6B 2R7RA 4QR0A 2OJ3A 4QIEA 3PFOA 3CJ0A 1RACB 3SMZA 3OTEA 4JI2F 1Q5VA 5CAAA 2DXDA 4PXBA 2W2OP 3Q2SC 3W5ZA 2DNRA 1NDPA 4WFYA 4UUWA 1HNVA 5ETRA 2CPDA 3KHRA 1U2FA 1QY7A 2H5JB 3W5YA 2RU9A 3ENVA 4J9UE 4PYAA 3UN2A 5B0BA 3PR4A 1U4BA 3IBCB 3RJMB 4TU8A 3BN7A 3ZC4A 2POKA 2J6SA 2XMWA 3CDAA 3GCWP 2DVIA 4OX7A 5G0RA 2W2QP 5AE3A 4JI1J 1W25A 2ILYA 1ZM4A 2JEFA 3VAGA 2F9JA 3M6XA 2IAJA 2DHXA 2F40A 2VPYB 5I3PA 3RUBL 3DRYA 2R7OA 2FDNA 4ILMA 4WBFA 4RBUA 2E5JA 1AROP 5J2MA 4FXWA 5KOXA 1TUVA 4IOAQ 3MMJA 5FLXU 2R2UA 4KHMA 1TELA 4DFPA 2C3UA 4RWXA 3PJWA 1X0FA 1FWPA 4WFNQ 1KLMB 3FZBA 4L73A 1SBRA 2F5GA 3NL0A 4A8XA 2KXNB 2QL5B 2DY1A 4ZP9A 4MJKA 2QIFA 2RMLA 1FVSA 3DXSX 3CMES 3CJQA 1F0XA 2Z2YB 5K14B 2CPJA 2UVRA 4KGKA 3H0PA 3OHAA 1SC6A 3PDNA 4F2SA 1RTDB 1HQEA 3AFGA 2CFXA 2QFIA 5F8JA 1PC5A 3ILJA 4QR1A 4XO0A 3C3LA 2HBZB 3MUTP 1VMBA 2ZHBA 3VQSA 1EETA 3KK1B 1AW0A 3G8QA 2UXDJ 1JXEA 1AYEA 3PW7A 5KFHA 1ZM3A 2BJ9A 1V3ZA 2ZHOA 5E33A 1DBDA 2G9OA 4IG0B 3SV3A 1L5UA 1LWCB 5K8MA 1OJ4A 3BGFA 3LF0A 3BB5A 4F26A 1PJ7A 2B51A 4X4SA 2WBMA 2I1RA 2VL1A 3M8PB 1GX5A 1X5OA 2GVZB 2BJEA 2R2TA 2UXBJ 1CJKB 3IS9A 2NPFA 4WU3A 2C2MB 3TX8A 3LP0B 2RQMA 3J7YU 4PG7A 5KFSA 4DX8H 2QO3A 2KN4A 3AAWB 2MPUA 2DGQA 1TK8A 4PQAA 1WOOA 2OPSA 1WG5A 2AX1A 2ZNZA 2WRMA 3DDIA 3M8YA 2BKPA 2JJ4D 4K4WA 1KOHA 1KN6A 3IGNA 1RXOB 4B3MJ 4OFZA 2HQGA 3RRGA 4OYXA 4GVBA 2HNZB 1S57A 3CDWA 4CNZA 3Q8UA 1CJUA 4M5NA 1IR1A 4O4RA 4XIUA 2KRBA 1UVNA 2KH9A 4AXJA 3IBWA 3N6MA 2V34A 3TAPA 3G9CA 5E2QA 4M94A 2NSCA 1X5TA 2X51A 1UW9A 3PKMA 3G86A 3J80Y 1SQGA 2AEMA 5KFZA 3VV2B 2LDIA 1CLFA 1WG4A 4ECYA 3QWUA 3CDUA 2DY9A 2MSTA 1U0HA 1UAWA 1TVRA 4OJGA 3EZOA 4MFBB 3CC2S 4NX9A 4DPWA 1IBLJ 5C25A 4C8LA 2XWYA 1CBKA 4QWDA 3B4DA 3MEGA 4WE1B 5DGBA 2FGCA 2FJBB 4UY8T 2MKHA 1CPZA 3T6JA 2BZ2A 1CULA 2CXEA 3HHLC 2JC1A 1DY3A 4EO6A 5KFVA 1D0EA 3W9JA 3I0RA 1GXUA 2CZ4A 4WKRA 4L75A 1FA0A 2KTQA 4C8ZA 4QIGA 1GNKA 3EVMA 3W9HA 2UXBF 3OTBA 1FE4A 4C98A 3K5LA 5CABA 1VDHA 3VAJA 1KFSA 2XSFA 3MTKA 3UD3P 4LFAF 3GIKA 2M9KA 1KKHA 1PO6A 3PV8A 1QJHA 2LEPA 1ZZFA 1WWHA 4FBUA 5KT2A 2OELA 2QRRA 4F0MA 4ZJQA 1NCLA 3LH2S 4RNOA 4DCOB 4FYDA 3UDCA 4LF5F 3MCSA 3NGTA 1VHIA 2XB2D 2AJFE 5D0RA 1HNXF 2W9CB 2VBWA 1M5PC 3DRRB 2FJDB 1E6YB 3UDLA 2GAGC 4DSLA 2RQCA 8RUCA 4FNIA 1YG0A 4S0MA 2JL9A 3IG1B 2B6AB 1JLFB 4ZPCA 5D4NA 4K50A 5AXLA 4DX7A 4HYKA 4K4XA 1BMQB 1MNEA 4JI0J 4X64F 3I0SB 1U1QA 3BGOP 4H4KC 2QFJA 4NA2A 1O0PA 4B17A 2PE8A 3NMAA 2YNGA 2SXLA 4MAKA 2OPRB 1A6LA 1IKXB 1TV6A 5KFJA 4KRWA 5J2PA 4M5IA 3OL6A 3MI7X 2GV1A 4DI6A 2WTFA 4I69A 4QIWD 4OI3A 4WYLA 3PHEA 1C0UB 2F8EX 4TN2A 4PRFA 4Y3CA 1YJUA 1YZ7A 1RT6B 2MGZB 5JMNA 3O2IA 2M4MA 3IP0A 1GK8A 2VDHA 4Y28C 1FERA 2KB2A 2FHOB 4P9SA 3HSZA 5HMWA 1BWEA 2L3MA 2AT1B 1RCOB 1C0TA 1R8HA 4ZP8A 4HL9A 3TW0A 1M5OC 4NWBA 1V6HA 3KLEB 1AUSL 1RYRA 1Y5LB 3W7BA 3HZGA 1S49A 2CAJA 3TZWA 3FFIB 1HNWJ 4DUZJ 2DEIA 2AYMA 2HW3A 4DU8A 2N4DA 1T02A 4LF2A 3MAAA 2R7XA 1X5PA 2DRDA 2KDOA 4CLYA 2XS5A 1QVGR 2DNPA 2XEXA 4KV8A 3Q89A 3A3NB 1N5YB 4JI7F 2YKAA 4RW6B 4WKYA 1RT1B 4HTJA 2HFNA 3MECB 2R2RA 1VI7A 3DM2A 3DN9A 3PTWA 3CPWR 2R7UA 1F2GA 4RUBA 4D3HA 4NLQA 4ZVRB 1TL3A 1HQUA 5DLGA 2C2KB 2FC8A 5HO4A 2EC2A 4FF2A 2PI5A 1U1LA 3E51A 4Q44A 7FDRA 1YRXA 5HLFB 2K7JA 4NXMF 5A8RA 1QM9A 4QBUA 3CULA 4HACA 3C15A 3I9V9 1NJIT 1NPPA 3QFWA 2NS1B 3DYAB 2HHSA 4RBTA 3CW2C 4NLOA 1YX2A 2HNZA 3GIRA 2BDPA 1S1UA 3K89A 2IM1A 1IQTA 3ZZOA 2ACYA 2LU1A 4NA3A 2UVWA 3W8PA 5IOLA 2HQFA 2XNRA 2XMUA 3ITHB 1BQXA 3PO4A 3P5TL 4P72A 1Y4ZB 3H5YA 3FSXA 2DNYA 3M6VA 3K0JA 2LXFA 4JBCA 2D3ZA 4J5OA 2HNDA 1IKYB 2B5JB 2FY1A 3Q8YA 4PZVA 1C1CB 3ULHA 5IFMA 3T1HF 1RWNB 2WSEC 3KLHA 3RZAA 3KLGB 4FNHA 2KG0A 4JI3J 5T7LB 1NK4A 1VQNS 2DRBA 2BKNA 3MPDA 3NS5A 3C6UB 1ZM9A 2CRLA 2FLLA 2VBYA 3NS6A 3IMQJ 4WU2A 1HI1A 2VQEF 3N0VA 2BV3A 5KFFA 1D3WA 4PEOA 3OHBA 4JV1A 1R0AB 1HWIA 1UEVA 1YJ7A 1U47A 1C2PA 1LNQA 4C9DA 3OL8A 5L38A 4DSIA 4ID5A 4F4AA 4KHRA 4ZVFA 2NPIA 2YWWA 4OZ0A 4W98A 5F8IA 1UW4A 1BC6A 4F3MA 1RTJB 3TVKA 2NUHA 2RH3A 4Q2MA 2KFNA 3KG1A 3SDEB 3OTDA 2LEAA 2GC8A 3MM6B 2MZQA 4TNOA 3R5GA 4LF4J 4OYAA 1H2TZ 3HMJG 1G1XA 4DQQA 4NXNJ 3W5XA 5AT1B 2GNKA 4M8LA 4M5DA 3OR2B 2V2KA 4LF9F 3H5SA 1IWAA 4ELTA 3BSAA 3QJJA 4RPFA 4GKKF 4DUTA 3HSDA 3MF5A 3QJLA 1YDLA 2BM0A 4J9QA 3CMAS 3I5AA 4DR6J 3FK4A 4NLVA 3U27A 2LQ9A 2K3KA 4DV1J 2VKRA 2YXLA 1TL7B 3CIMA 3GPAA 1WHVA 3SZ2A 2DGSA 3NCPA 1IXKA 4F2RA 3CUNA 1U8SA 6FD1A 1RLDA 1VLYA 4ZHRB 4IYQA 4Y0FA 2E9TA 2R7VA 1A0OB 1RU2A 1REVA 3QPIA 4NLUA 2HWTA 2ZH4A 3VR1A 1RAFB 1RAGB 1X8DA 5HROB 5KFXA 2K1RB 3M30A 3T1YJ 3KLVA 4V19X 3LW5C 2ZBCA 3C46A 2XI2A 3HXMA 4ED0A 1DLOB 1BE4A 3F73A 1BWVA 3GJQB 2XS7A 2UP1A 1NLKL 1SCJB 1UL3A 2CVIA 2Q6CA 3OFGA 2AJ2A 2AX0A 3RRKA 5FDLA 1ZM2A 4C3MA 4W92B 4N5SA 3AXKA 8ATCB 3GYNA 3HD1A 3E3XA 2BE9B 4CO1A 5HMXA 4JV2A 1NK0A 3CD5A 2AZ1A 3AB2B 1EKRA 2IVFB 1NKBA 4FVCA 1GXLA 5HMYA 4CIOA 3TUJC 3MAQA 4I7FA 3OT9A 4KPCA 3KJNB 4CH7A 5K5MA 4I1TA 2CQGA 2P6SA 4F3OA 2I5JA 1EP4B 1GH8A 3HVRA 1Y5NB 2WVEA 1SH3A 3Q2TC 1N6QA 5HI7A 4P71A 3W2WA 4NMLA 4BDPA 1HLWA 5D4LA 1RZMA 4YR3A 4LBPA 1KNZA 3DLKB 1D1UA 2NZCA 3BQ2A 1HIYA 4CRJA 4I6YA 1QE1A 2RAQA 2UUAJ 3SIPB 1RWWB 4DR6F 1FXDA 3BKUA 1ZYQA 3TARA 1OWXA 1Q4RA 4DR2J 2ZE2B 4MYUA 1Q8BA 3PJ9A 2BRLA 2V4JB 3R5AA 2A2DA 4LQ3A 3T6BA 1MMDA 3MMBA 1IBMJ 3DRPB 2D41A 3NGSA 1VQ5S 2Y1JA 3MMCA 1RAEB 3MEEB 2Q6BA 3WBZA 1T9UA 4DPTA 4QWEA 5L1LA 3T1YF 1U02A 3T5HA 3G2XA 1U1KA 3QRRA 2KJVA 4OQJA 5CYMB 3CCJS 1ZA1B 3M32B 3PR5B 2EKYA 2DYAA 4PPDA 1OQ3A 3BDEA 4J9VA 1FKOB 1TAUA 4NLSA 4N8OA 3POTB 1RT3A 2RDDA 1FTRA 1FNOA 2ROGA 3BR8A 2NSBA 1NSKL 4FXDA 4PQUA 2V9WA 4XPEA 3MM9B 1RHMB 1WHYA 3OVSA 1DQ8A 3PYDA 4PUOB 4ERDA 3DGPA 3M8ZA 4G1QB 1UVLA 1D9DA 1I51B 1T03A 1RT2A 4KFBB 1LW2A 2A0FB 3K58A 5B09A 5KFKA 2AYEA 3QIPA 2KG1A 2W01A 3EYZA 1S97A 2ASYA 1S1TB 5GAGI 1XN9A 2GAHC 2CPZA 4B9NA 3GLJA 1P6TA 3DLEA 5K8NA 2JEJA 3LPYA 4WXOA 4B3OA 3I5BA 3LANA 4RW7A 3DOMA 4ETXA 2KZMA 1NMEB 1NHUA 3NXZA 2E1PA 3EGVA 3QT6A 2OFGX 3EXCX 4O3SA 3C66A 1F9HA 1HBUB 3UVJB 1DJ0A 4DR2F 2I2YA 5KG1A 3KJVB 1B7YB 3AY0A 3OBIA 4IQXA 4NCGB 3HFZB 5A0YA 3EXYA 4DQSA 4RJVA 4QPTA 3GFXA 4DFMA 4P73A 2EBGA 2FVQA 2R7QA 1MU2A 1SV5A 1G6BA 1S10A 2MDAA 3THVA 3M2RA 4HVZA 1T11A 2YQ3A 1S6PB 2DNNA 2PEHA 5KG5A 4U8VA 2ZJQQ 4P6QA 3BR9A 2HNYA 3R8YA 4H4OA 2LP4A 4LF8F 2FHMA 2HURA 4DEZA 4IDKA 2YNHA 3CJKB 1H72C 2XZDB 1NEEA 5KT5A 3K5NA 1HI8A 1RKIA 1OY8A 1HNIA 5E0OA 4ZPBA 4ES1A 1HHQA 3U1LA 4ED2A 4OZ5A 2RB7A 2IDLA 4U96A 5LXRA 3K8WA 3L3CA 4X4UA 2EWHA 4RNFA 2YQ1A 5D3GB 1TKTA 1T8EA 1FDDA 1J27A 2DITA 1Q5YA 3MM8A 2IA0A 4MYTA 3CJ2A 5K8PA 2IC3B 4DFJA 4DUYF 3CJ3A 1IKWA 4K5SA 2F3JA 4HLBA 4DX6A 2ZH9A 1VJWA 4CYUB 3ZZPA 1LWEB 2EI5A 2A6MA 3KTQA 4OV6A 3VAKA 4ZVQB 2C2OB 3BF4A 3ZNUA 3AB4B 4DOZA 2IVMA 1S1VA 3S01A 1JJ2R 1H6KX 1S1XB 4FS2A 2OKQA 5DG7A 3EICA 2MKYA 1WD6A 4NMXA 4F0KA 5KFBA 4LBHA 3OUYB 3OVBA 3W66A 1RWXB 5LSLA 2HIQA 3T5KA 2JOQA 1LWFA 5GADU 3DU5A 2FTRA 3M2UB 1X4DA 2ROPA 3J80U 2CUYA 4J9NA 5HN0A 5HP1B 2KVQE 3B78A 3U1NA 5CYJA 2UU9J 3SV4A 1H2VZ 1VCTA 1FRIA 2ZJPQ 1TP7A 1R8CA 2OEJA 3TR5A 5KOWA 2FY8A 1P9QC 1RT7B 2DNKA 2VPZB 4PG6A 1HNZF 2KM8C 3D5MA 5KAKA 2N82B 1VRTA 4KSEB 2O3DA 1FX2A 4AQYJ 3MR7A 4DR3J 4IH6A 2XSJA 3NGKA 5LT5A 1T9XA 5EWEA 4ZK7M 1S99A 4A8SA 4CI0B 1JKHB 3G82A 2BOAA 1DHMA 1U0SA 1QSYA 4LR7A 2HPUA 3EDQB 4HH0A 3SXLA 2AJ0A 2CG8A 2QA2A 4DU7A 1HL6A 2MKSA 3GSDA 4LF6F 1U49A 2WAQD 1DQ9A 4E2FB 4XTTA 4W4MA 2DGTA 1RYSA 5A8KB 3Q23A 3DLLQ 1BXNA 2EFOA 4NYOA 3AOBA 2WBRA 3JYTA 2BOPA 5I42A 1T0TV 1RT5B 1FRXA 4DV7J 3FEXB 2AEJA 3K7RA 4F7VA 4LSLA 5L9NA 1G7CB 3MM5B 2Z2LA 2D69A 2CDRB 4C4WA 2GO9A 4DL6A 2DNMA 2AF6A 2YPYA 3UDVA 4DSKA 3N01A 3MEDB 2I8EA 2W2PP 5T41A 2XC9A 3R6LB 4Y2KA 4A46A 3HM9A 4DR1F 2W2NP 1YZ6A 3I4PA 4O44B 1SXLA 1U26A 3FJ2A 4DCJB 4USIA 1PG5B 1L3SA 3G4SS 4HR2A 2IRXA 2J0WA 3NGRA 2GJIA 1SUQB 5GMKa 1URRA 5IM0B 1R6YA 3DHXA 5GVQA 1C1BA 4KFBA 4FYXB 3H7HB 1K47A 1D9AA 2F1FA 2X7IA 4TVAB 4GMKA 3US5A 5RUBA 3RW6A 4I2QB 1UKUA 3MHYA 1I6JA 1CVJA 2YTCA 2HMIB 3EMTA 2ADBA 1UP1A 1KP6A 4DWIA 2AD9A 2DXEA 1HBMB 1PJ6A 2BE7D 4R0EA 2YNFA 4C8OA 3MMAB 5FLXY 2OD4A 2J0QD 2BM1A 2HAIA 4M95A 1LK7A 5HMZA 2LLZA 1JLBB 1APSA 4YY3J 3JTOA 1AXQA 3D6MB 1KFDA 4RNHA 4DV4F 3W2VB 1WC0A 3RR8A 2MZTA 1HWKA 2W9BB 2C2EA 1IBKF 2V69A 1ZA2B 4PCQA 2CQPA 1B70B 3OQ2A 1ZAVA 3QT7A 2CQ2A 1W7WA 3MPUB 3CJRA 3LGNA 4O0NA 2PIIA 2WW8A 2WK4A 3NGDA 1JWWA 4PG5A 2B4PA 5CD4H 3K5OA 2JSXA 4BBYA 5L46A 1RAAB 3FEYB 2JFDA 4ED6A 4ECZA 2ZZNA 3R2DJ 1WC4A 2HHHJ 3J7Z5 1U1PA 2WCXA 5DGAA 5F9NA 4E98A 3QRQA 3BS9A 2Y8YA 3HT3A 2J9DE 2HLTA 3KLFB 1BD6A 3IRXB 3D1OA 2GJFA 2J9EA 4Z7YA 4AXIA 4CLLA 1V5IB 3SCIE 2HHQA 4P75A 3AH6A 3QGHA 1UEKA 2E29A 1Q79A 2C2ZB 1T9TA 1U6BA 3R5CA 1JIHA 4Y00A 5I3UA 2ZH6A 3DRSB 3OTOJ 2HBYB 2MZ1A 4YOEA 1LXNA 3QLHB 1YQHA 4MIBA 3W62A 2OEMA 2BE2A 2VG5B 2UUBF 1WKKA 5LM7E 4DF4A 1HBNA 4M5MA 3BQ0A 3PYEA 2CADA 1OYEA 1CEZA 1VQKS 4DL2A 1N32J 3SSSA 3M7VA 1WC5A 3G8SA 5AE2A 3DFEA 1N0VC 4NEZA 2LKZA 2GS8A 1ZTWA 5KFQA 3CCZA 3G71S 1S0MA 1EHWA 5J2NA 1TKDA 2MQOA 4ZJOA 1S1WB 2GVDA 1QD1A 4NRUA 1VISA 2VFVA 1J5OB 3T5JA 4J7CA 3C6TA 2QN6B 2QV6A 2YWFA 1XEZA 4DCPB 4ATNA 4NCAA 3CT9A 4P52A 1NBEB 1IJFB 2WVDA 5KG3A 3ENAA 4O3QA 2H3EB 2RNEA 3VVUA 1EZZB 1C4AA 4JI8J 3HO1A 5BYQA 3RU0A 5ETKA 2GCFA 3BYRA 4DMZA 4KC5A 3P3DA 2I38A 3ZTSA 4ZP6A 2ZD1B 1WEXA 1GEHA 2HEKA 1RTHB 4IFYA 3CB4A 3IBFB 1X4FA 1VQPS 3DXBA 2KM8B 1BQNB 2I0XA 4IRDA 2CG4A 2KVIA 4NL5A 2ZDPA 1H2UX 1DZ5A 3JSRA 3SYZA 5KFCA 2GX8A 2XLIA 3Q83A 2DNQA 4GO5X 1FO1A 1RE1B 4QIFA 3MURP 4J90A 1ZAWA 5DM7Q 4J37A 2GQ2A 4YR0A 2YKNB 4O4GB 3KYLA 1GMWD 5L1JA 5F8LA 2DH7A 4G65A 3VHQA 2AP6A 4YB6A 4PWDB 3JSMA 3CD0A 4B3RJ 2HBQB 5AJ3F 3TEHB 2D9OA 5IT9U 4KTQA 1NJZA 3SBMA 2VBXA 3UD4P 1RDRA 2KT5A 2KXFA 4CQ1A 3GIIA 2F4FA 1N32F 1RLCL 3GE9A 4Y2CA 4R5PB 3HULA 4LRDA 2JDJA 1RT4B 3K57A 4Q8FA 4TLQA 3ZO7A 2Z56B 3M8SA 4YUDA 4ID8A 3KK2B 2OTJS 1N56A 2E1MC 2WVBA 1X4GA 2W7AA 1YLXA 1HYSB 2DR7A 1UA0A 1FRLA 3R5DA 3PKYA 4RUCA 5IQ6A 4WFBQ 2BQRA 3OPKA 3PYGA 1MROA 1M0SA 4G6VB 2R3VA 4C0OC 4X62F 1WEZA 4C11A 1V5VA 2XYGB 1MMLA 4JV0A 2RRNA 3M4XA 5ETSA 1BUXA 1FKAF 1N33F 3IAS9 2HG4A 3CCQS 4DF8A 2PMZD 4U95A 1YGYA 4WP3A 3OFHA 4ECRA 2YNIB 4LF7J 3CD7A 2R8GA 1YJNS 2FJAB 1TMJA 3HHLD 3A13A 2AJ1A 1R27B 1SJFA 1FD8A 3IM9A 2VU5A 1CG2A 4L74A 2CJAA 2QMXA 4KAIA 4ES2A 1NDKA 4UQGA 4JI4J 2RHQB 5F0WA 5F0UA 3H20A 2FHKA 4Y2AA 3PXGa 2GZOA 4USTA 1X4EA 2HQIA 1HPZA 4CO0A 5EN1A 4EYIB 4ZLLA 1JB0C 3DU6A 2VZ9A 3OLBA 2FYXA 4L3NA 3CJSA 5B0AA 2BJ1A 4KQZA 4FS1A 2GJ2A 1P9YA 1BHNA 2RSQA 4GO7X 2YKQA 3THPA 2LQ8A 2V94A 4OYIA 3CC4S 4BLGA 5DLFA 3QGPA 2ZOMA 4FYVB 4JI5J 4QJVA 2DR6A 3DOKB 3QO9A 1GMWA 2B43A 1SL2A 2R7WA 1RQ0A 4TQRA 4CDIA 2ZH3A 3RGIA 3WIUA 3H2UB 7FD1A 1T94A 5GMDA 3JSYA 3CDEA 3ENQA 4BWJA 2CWKA 4YMEA 4LSNA 5SUHA 4YB7A 2WZ1A 3GTYX 4DS5A 2M88A 2VBZA 2KI2A 1N34J 4DLGA 1JLAB 2MMYA 2ZUGA 5E41A 1EARA 2PA8D 4X65J 4UW2A 4WP8A 3SQOP 1TUGB 3G8TA 1GMVA 2C3PA 3BGRB 3OFEA 3UN3A 2FJWA 2H5EA 1IR0A 3MPWA 4A8WA 4OZJA 4J91A 4KH0B 3I9ZA 3ZTOA 2XHWA 2WW4A 4Q2LA 1VIOA 1KC8T 2MLXA 1RWKB 3D28A 2HFUA 3NY0A 4YHHJ 2HS4A 2BJ8A 1Q86T 1NJXA 5B0DA 3GJTB 5KFWA 2HHTA 2E1CA 2XG8A 1SKUB 4MMOA 1Q78A 5C7PA 1S6UA 1HMVA 3Q24A 1OO0B 4N76A 1RA7A 4X4RA 3U02A 1F2HA 1CQNA 1TFYA 2A18A 2Y0BB 1HNVB 1IVZA 3B6BA 1U2CA 2EFNA 4L76A 3R1HA 2B8QA 3M9OB 4OX9J 1VBXA 2NXUA 4RW9A 4NLWA 4P2XA 4RR5A 4ZN3A 3HHLA 5ETTA 3FGVA 3MCMA 2H5IB 3UI3A 3L7PA 2XCAA 3RB6A 5HQMA 2JLFA 2BRKA 3SFUA 5G0RB 5KFDA 5DDOC 3KMSA 4OJ1A 1Q7LB 1TKZA 2RIJA 2IAJB 4IR1A 1FT8A 1Z4UA 5J2MB 1RSCA 1HKAA 1FE0A 5IV3A 2LCWA 2RUSA 5HJYA 1RTIA 5F8GA 3V5RA 5AXNA 1F9EB 1X4CA 2Z2MA 2CVEA 2XMMA 2ABYA 4DL5A 4MK7A 4B9VA 1WTFA 3M8QA 2ASJA 2CQ1A 2GIFA 3DNCA 2RS2A 3DI6A 1HQEB 4YB1P 4WIQA 2MQLA 1FXRA 1FCAA 5CCMA 2V5HG 1FDNA 2M52A 1UJ4A 1N0UA 4IFVB 2QGFB 3TQEA 2VH7A 1EETB 1UVKA 4DBQA 3KG4A 4YHHF 4A8MP 3TZYA 1KVKA 3KLIA 2J7UA 1H3DA 2Q3PA 4H4KA 2HVIA 1WC3A 4RUAA 3DLGA 3PG9A 1AFIA 1K44A 3BO3A 2AHOB 2DBBA 1RAOA 1U24A 2LVWA 3PVXA 3EVOA 2IIHA 1NAQA 4ZP7A 1H7XA 3I4HX 1SJQA 1B99A 4ECXA 3ZZZA 3IS9B 2ZC3A 2XULA 4OI0A 3L9ZA 5KFIA 4FYYB 3SQGA 3MD1A 2WONA 4RX6A 2E5GA 4PPZA 5IT4A 3ZTQA 4QYZJ 4TYAA 2MQPA 2OPSB 2D3OR 2BABA 3VF0B 4M5KA 5L9XA 1NKCA 3TJ8A 3J81j 1N5SA 4DV0F 1GFWB 1KLNA 3RAXA 1TR0A 1XMOJ 4JI2J 2GHVC 2IJFA 3FBCA 2DRAA 2PD1A 4A8FA 3RRHA 4GVBB 3W63A 1SKSA 4I67A 4UOGA 2IA6A 1CJUB 1WG1A 1UWAA 4F36A 4LFCF 3NNHA 4MKBA 3DOLA 4K0KF 5LJ3Y 3GIMA 3HKZD 3Q8SB 1L3VA 1QDUB 4KJIA 2IMWP 1EQ0A 4G3IA 3ET6A 4OYPA 1AZSA 4P7VA 1RTZA 3Q8VA 4QPXA 5C24A 4I68A 2G0CA 2EBEA 4IRCA 2BACA 4P2MA 4DR4J 2JLGA 1K0TA 1U0HB 2GFFA 4IRKA 5LSOA 5CZVA 4ES3A 1SJ4P 3RR7A 2RVJA 2IBKA 1TVRB 3GFHA 3HT0A 5IQQA 3CCLS 3HJFA 5HVGA 2XZTB 5C25B 4M5GA 1S48A 1FF2A 3S7RA 4LRAA 5DRKA 3MEGB 1WDDA 1ULRA 5DZ6A 4Q45A 2E5IA 2OMLA 4J9RA 3DLBA 5LMUF 1CULB 1VFJA 3A8JA 1WELA 2HFSA 2JC0A 1OY6A 3PACA 3QT5A 2VIHA 3I0RB 3V6DB 4WFXA 1H38A 2NREA 1KQGB 2B0GA 2ZH5A 1F1BB 1UZDA 4UOHA 1XR7A 4YFUA 1JLCA 3VGVA 5IC4B 4TQSA 3PJXA 3B4MA 3O5TB 4LJMA 1R8PA 2OPQA 4EBEA 3NCRA 5EDWA 4USWA 2OFHX 3T9NA 2C2NA 3WC0A 1Y3JA 2RS8A 4K2JA 4AE5A 4CT9A 4ILRA 1ROFA 3HZEA 3MGJA 3F41A 1HA1A 5KG4A 4BS2A 1XMOF 1UCNA 4Y34A 3EE3A 4DL4A 3BM7A 1EB0A 4YEAA 4IOBA 1FRKA 1WNEA 4C3LA 7AT1B 2DNHA 3NNCA 3CF5Q 3MR2A 2DH9A 4YP3A 4WZMA 3QSIA 4M5JA 5L39A 5CA5A 5A6PA 4B3SF 2DGUA 2HVDA 3T5LA 5KT7A 4DR4F 3NMRA 3HVTA 4M1KA 2YNGB 3CDBA 4CO2A 2CJBA 4IUFA 1TV6B 5J2PB 3WIVA 3RTVA 1FRMA 3JTPA 5GADI 2W4PA 3CGIA 3PNIA 6AT1B 2HHUA 2YKOA 3ZZ0A 3O6QA 1FK9A 3V81A 2EK6A 4K59A 5GAHI 1NUEA 3HFKA 4CH1A 3V4MA 2UUWA 1R0BG 3BKTA 2E7WA 3HKWA 4OV1A 4KT0C 5DG9A 4QCLA 1TL1A 2M3DA 3F0NA 3SCKE 2C3YA 5DQHA 2CPIA 3PEJA 4UOFA 2ZKUA 1UWBA 1C0TB 1S5ZA 2GO8A 1S0VA 2DHSA 3IAM9 2XMTA 5IV4A 2P9EA 2MQ8A 1KQSR 5A8WA 3TJ9A 4EI2A 2E66A 2C3MA 3RW7A 4JP8A 3R97A 2FZGB 2F65A 4IFVA 1VGYA 4H4MA 1XC9A 1VBYA 3MAAB 1XWLA 1RKJA 3DRXA 2YH0A 3CSKA 2MTLA 4TU7A 5IT0A 1OPIA 3LQVA 2G0JA 4EGLA 4MK8A 1ZAXA 4KV8B 4P74A 1K1SA 3HVWA 4F4XA 1ZTTA 4YDDB 1SC1B 3CCES 4DSJA 1A7GE 3PIPQ 3NNAA 2PO4A 4MKVA 3DM2B 4OX8A 4NI2A 2BBEA 3JXOA 4HHUA 2GGPA 2XTJP 5AXMA 3TVZA 1B64A 3HSJA 3S6EA 2FPHX 4LFAJ 2HK2A 2K8GA 3IWXA 2GMJA 2MQMA 1TL3B 1HQUB 4I6AA 3BPSP 3EZ5A 2W8LA 1I94F 4OMFG 2HS3A 3QQCD 3CCVS 2JH3A 1LXJA 1B7FA 2QYGA 3BJYA 5A8RB 3EWGA 2NZ4A 3MAHA 4LF5J 2WOMA 3C15B 3EM1A 4HACB 2N4CA 1TFWA 3P5BP 1HNXJ 2ATCB 4N41A 1JMTA 3O1LA 4NCBA 1VRQC 1GQEA 3QATA 5FD1A 4F3QA 1S1UB 2VA3A 4DPYA 4QQBA 2AYBA 5LSRA 4AUKA 2NYIA 2G2ZA 1HI0P 5KFGA 3ISND 4X66F 2ZH1A 2XBPA 1YJWS 2OTLS 3KDNA 4F0HA 3BDPA 2HVHA 4X64J 2HNDB 4B9TA 2BANA 3R1LA 1NXIA 3FKBA 3T19A 2ZBQA 3JQJA 5HAOA 2ILZA 5DDRC 5DO2A 3BO2A 1TL5A 1KQFB 4DXLA 3KLHB 1UPPA 4FP9A 6FDRA 1UMJA 1Q81T 4LFBF 3NBPA 4O3PA 1ZZNA 2CJQA 2ZEJA 1HR0J 3FRYA 1KR4A 1NB7A 5DZ7A 1PJ5A 4P2FA 5CQGA 3AJ2A 4EO8A 4ED1A 4X4NA 1EKSA 5U47A 1TKXA 5E3RA 4HHJA 4RL1A 2DO4A 3CNQP 1WSRA 5CH7B 1X4BA 2HRUA 1DTTA 4ZA1A 4AL7A 2JFKA 1IWGA 1HWLA 2IYIA 2U1AA 4CLSA 2LFVA 3V6DA 1U1NA 2L9DA 5BJRA 4ID5B 3FQLA 4NRTA 5EUHA 4TY9A 1MMNA 4GC6A 3M9MB 4A8OA 5LJ5Y 5BYRA 1P1TA 1SB6A 4ECWA 4ITSA 1RAIB 2CJ9A 2VUGA 1A9NB 4WFZA 3PM9A 4M5DB 2NLWA 1RISA 2O66A 2VFUA 1UFLA 5H9FJ 2L41A 2CYYA 3M2VA 1F5CA 2EKNA 5IWAF 5HJXA 1CS4A 2QLBB 2RT3A 5F8MA 4J9PA 4JYAF 2VFTA 2W9AA 1CJTA 2PMHA 4DR5J 1UETA 5EGYA 1M1KT 1MWQA 1QAJA 1M1HA 4WJBA 3QFHA 3AA9A 1O8BA 3TAMA 2D7SA 4JI7J 1SH0A 3GYGA 1W26A 2RHSB 1VS3A 3HHKA 5JVGQ 1REVB 3RBXA 5KFTA 3B82A 4FZVA 3OXLA 2V2ZA 4ZVSB 4JUZA 5KT4A 1NNDA 1KBRA 3M30B 4NLYA 1OMSA 1OS5A 3UE2A 3KNAA 3AJDA 2J5AA 1Q8KA 3JQMA 1QAYA 2KHDA 1KVJA 3DLHA 1JLQA 1IM6A 1S6QB 1HR0F 4NXMJ 1CC7A 2YKMB 5FDLB 1F3FA 2A3JA 1XBWA 4DN0A 2W7OA 4B9SA 3PW4A 3BREA 3NLCA 3LTOA 4KO0B 3DMJA 2XWXA 2ZFHA 4JI6J 2ALZA 3LP2B 3UPFA 3P8BB 3H8YA 2IYGA 3PHTA 2OD6A 2YX7A 3DGVA 1U6FA 2IJNA 3H42A 4UT4A 3UCZP 4C2MA 1OPZA 2MZJA 3R5JB 4OJHA 4DV6F 4I7FB 2NUUG 3UCUP 4IO1A 1H98A 1M5KC 5CYQA 2I5JB 2R8HA 2FVRA 2WSCC 2C1EB 3K17A 2E7VA 1N6QB 3ONQA 2B8PA 3W2WB 1IM4A 1YWXA 3T1HJ 2GQCA 1HD0A 2AGQA 1QE1B 1LW0A 2Z4PA 2HQ3A 4WZQA 2WSFC 2QMUB 4ZVGA 3MDFA 4GKJF 3IR6B 4WK1A 1F60B 3GONA 2GHWA 1MLAA 3TRGA 4DR5F 2VQEJ 2XLKA 1VRUA 1Q7YT 3N5FA 3OXFA 4OYOA 2YWGA 4Q7AA 2CJKA 5DETA 1RK8A 4GVLA 2IM3A 2WVFA 4KPYA 3HI9A 3BPDA 3MMBB 1JLEA 5C42A 1CJVA 4IKAA 2VICA 1S9GA 2AYGA 1FESA 3MMCB 3CO0P 3MM7A 3VQTA 3G6YA 3QGIA 1FKPA 2D9PA 2E9ZA 1WEYA 4CLZA 2OP5A 4NYZA 1FFGB 4LF9J 5BR8J 4GKKJ 2DH8A 2X1AA 3D6HB 3A8KA 2DGWA 2YQ0A 4QU6A 4MIAA 1NB2A 1RT3B 4ED4A 1HARA 4JI6F 1TU0B 1PIEA 3OD2A 4X4PA 4U67Q 3P49B 4PQUB 3I6PA 2CNKB 1NH8A 2PEBA 5AXKA 3FUYA 3DGPB 1NSQA 5KG0A 4NLRA 2Y9HA 2VJVA 3ZZRA 1T03B 2IDEA 1RT2B 4DN9A 3UD5A 1LW2B 3NOGA 1HBOA 2Z57B 3QIPB 4A8QA 1NHKL 2ZM6F 5HL7Q 2M8HA 4ZCKA 1T05A 4KH1B 2CQIA 4MH8A 2FJVA 1RBOB 2RF2A 4OYBA 4TY8A 3N6LA 4ANEA 3DLEB 4P10A 2CPXA 2VG7A 4ZCMA 1YTYA 4B3OB 1Y0HA 4RW7B 2RKIA 1H73A 3DOMB 5E7OB 5J1EA 2DGXA 4ER8A 3MWBA 3C16A 1WF1A 4DFKA 2EEYA 4DS4A 2UXCF 5HQ8A 4OZ1A 2AGPA 4RW4A 3KK3A 4UY85 1NHVA 2OPPA 4BWMA 3M1VA 2DK2A 4B3TJ 3FDSA 5A0YB 1QTNB 2BJ7A 2DR9A 1R8AA 2BUNA 2CNNB 3SSQA 1Y11A 1YSJA 1MU2B 1SV5B 3UCGA 3M2RB 4ELVA 3LP1A 3HJVA 5IT9Y 3JSBA 2ZOFA 3QMQA 2DHGA 5KFEA 2APOA 3NS7B 4DV3F 4CLPA 5BR8F 3BZQA 4OZ3A 3G6ES 4KKOA 2QL7B 4DX5A 2BXJA 3GB0A 2HNYB 1BGXT 3HCXA 4H4OB 4DV5F 4QOTA 4IDKB 2YNHB 4DL7A 2H9ZA 4K8RA 4OYWA 2LYVA 5THWA 4ZMMA 4ZLJA 4RU9A 2HLUA 3L7UA 5L8RC 3F44A 1HNIB 2O01C 3AHPA 2FGOA 3A3OB 2R2SA 1TQLA 2BW2A 4NEYA 1S4EA 4UF4A 1RJJA 4DQPA 1FWKA 3I31A 1VQ9S 4HDHA 2DHHA 3KHGA 4OYZA 1TKTB 2H4YB 3CC7S 4K4UA 2YWEA 3AOAA 1M5HA 3MM8B 3JAMU 3J7A1 3DDNA 1P27B 2WVCA 5F8NA 1X60A 1IKWB 1HFEL 1PYTA 1CC8A 2PC6A 2CQBA 1S6QA 3AQOA 2YKMA 2UUTA 1S1VB 3MR3A 2CQ0A 4KO0A 1IKVA 4URQU 5ETLA 1D09B 5HSPA 4ENOA 1W2BR 3LP2A 1S79A 1X9WA 3I55S 1XERA 3HD2A 4B3TF 2HFZA 4F4ZA 1LWFB 2HFVA 1RP5A 4R0JA 2EW9A 5LMNF 2VC0A 1FJCA 5MLCV 4NPOA 3I87A 4K5RA 3FMBA 2AJ4A 2LXUA 3J81U 3LOUA 4DPXA 2DNLA 3MR6A 3GG0A 1UA1A 2DPIA 1N5QA 2RD5C 3V4IB 4CTAA 3N4WA 4EWTA 1VK8A 1VQ4S 2DCLA 3M8WA 2ZBIA 4OJ3A 3MPVA 4NYPA 1RCXB 1VRTB 2O1PA 2MHEA 2ALYB 5I4MA 3ZTRA 4X4OA 3C14A 2XSJB 1RHUB 1N36F 1LQ9A 1VC5A 1FJ7A 3NEKA 3W60A 1FFWB 4JV5F 2P6TA 3G82B 2DNGA 3RAQA 1SKRA 5JUMA 1KDNA 2KHCA 4EK2A 4ZPDA 5J2QA 4ANDA 2ASLA 3GSIA 3AD7C 1XMQJ 5B0EA 1YBTA 1JK9B 1PBAA 4HI2A 3UDEA 2F4VF 2ZUAA 2G4BA 2CPHA 5ETNA 4OZNA 1KONA 5F41A 2AZ3A 4RKUC 5F9LA 3JYTB 2J0SD 1K9MT 2JNJA 2A10A 1XK8A 1NDLA 2HRTA 1LK5A 1LFPA 5I42B 2XY5A 2RQKA 2VOPA 3FSIA 2W7PA 4LSLB 5JVHQ 5KFLA 4FPRA 1PYSB 3C2PA 1KSPA 3MR5A 1XNQF 1Z2ZA 1UEUA 2BW7A 1T3NA 4LF8J 1U1MA 2QMWA 1JLGA 2ZZTA 2N7YA 1YVFA 3OV7A 1RWUA 1D8ZA 2LXIA 3D54A 4IQMA 5IXUA 1Y00A 3KHHA 2JHEA 1JJCB 2LQ5A 2MKJA 4FF4A 4KY3A 4B08A 1X31C 4XDCA 1C1BB 4KHPJ 4ZITA 2VONA 4X4VA 3HHDA 4LVOP 1UVJA 4CM0A 4J9LA 2P2CB 1EQMA 3KJFB 3THTA 4DUYJ 3KG0A 2BMBA 3AQPA 1IQZA 1XNRF 1UJ5A 2G2YA 3QJPA 2YX1A 3CO9A 3LA0A 1MN9A 4R8UA 3D2WA 3D7SB 4DG1A 2OO4A 4C48A 1S0NA 2YNFB 2HBRB 1GXTA 4ZPAA 3CCWA 2VHGA 3LUYA 1H0HB 2XMAA 4PR6A 3GQCA 2XQCA 3QAUA 4J9OA 1GX6A 4NOHA 4MK9A 1S9EA 3AA8A 2VC1A 4LSZB 1XMQF 1TZ0A 1DTQA 3PX6A 1LEOA 1B3TA 2UZAA 1XTZA 2F9DA 3ETOA 2W2MP 3EGNA 4DPUA 3D6TB 2KZZA 2CPYA 4RW8A 3CJ5A 3MTJA 2PMWA 4FDFA 4NLPA 4U6PA 4CNYA 3M8RA 2DNOA 1PKUA 3MOJB 5EX3A 4I2PA 4ILLA 1RADB 3NRBA 1OY9A 5B08A 1G2EA 1AA1B 2DCUB 4ECSA 2CKWA 4Z37A 1HNZJ 4LRBA 1R31A 2YKPA 1SL0A 5DG8A 2ACMA 4JI1F 3D4JA 4LR8A 2VD3A 4OHXA 2JRSA 3X1LB 1F9FA 2BVZA 5D4PA 2P5VA 4A8YA 4DL3A 1FNMA 1YHQS 3GFYA 3D0GE 1F6TA 1T9YA 5A6WA 4FPIA 3E2EA 4ICLA 4E0DA 5KFAA 4KB7A 1PILA 4LUBA 3MCNA 4LF6J 4A47A 4RUHA 2DNZA 3IN5A 4LREA 2BJ3A 1WHXA 5I3UB 2XNQA 2I9SA 1HW9A 2JEGA 3PZPA 4KHPF 4P2SA 1DQAA 3ISZA 2BE2B 2IHR1 4DLEA 1WKJA 2QEXS 3QBCA 1KTQA 1NDCA 1QSLA 2K06A 1HBNB 4ZS6A 2QLJB 1VOMA 2CQ4A 4OYMA 2FLNA 1HHTP 3FSYA 3IRWP 3UR0A 2B9XA 1Z1ZA 1Q8IA 4NE9C 2EC0A 2DO0A 2JZ5A 2MKIA 3QIDA 5D77A 3HX9A 3HLUA 3SCJE 2AEFA 4U7CA 5J2NB 2HIYA 2UXDF 2W24A 4DR1J 2GVDB 1Y9OA 5HBMA 3B54A 1B0TA 3OR1B 3C6TB 1R3NA 3GR1A 4XPCA 4IR9A 2CIMA 3OL7A 1NSAA 3O3LA 1VK3A 4C0HA 2Y0SD 5JJBA 3U7JA 4QR2A 1RWMB 4Q0BA 2X3GA 2MSSA 2YX4A 2V0NA 1S12A 2KFZA 2G1DA 2OAUA 2R7TA 4MKYA 4I56A 1JXLA 2QL9B 3EGWB 1KHWA 3HFVA 2CNLB 1BQMA 1S7HA 2A1BA 5GAHU 4FXVA 1FDBA 3H90A 3V4IA 3E01A 4IFYB 1YBUA 2P8IA 1SC4B 1ACMB 1WOPA 4RO0A 3TJAA 1RHQB 2K3IA 2GQQA 4HI1A 1VQYA 4ZVPB 2NXEA 4OZLA 1E6VA 3UNYA 2IY5B 4PXDA 4IG3A 3RB0A 2VG6A 2L9NA 2MY8A 2HHPA 1O6XA 2G1HA 5I3QA 4LRFA 5A76A 2JEIA 3PO5A 4B3MF 2DGOA 2K2PA 2MZRA 2G2OA 1TMMA 1RAHB 4DV4J 2H51B 1RWVB 3MUVP 1U2RA 1IBKJ 2EFQA 4DZDA 1H74A 4CO4A 5GAEI 2V8GA 2VFSA 4ED7A 3TAQA 3JSMB 4YN3B 1TK0A 5ITHA 2XYPB 2ROEA 4CLUA 2OEKA 1U25A 3D66A 4BC7A 1RB0A 2IMOA 5C2CA 1RWPB 3GCXP 1IBLF 3K2YA 4N47A 4WTOB 2L9WA 2J9CA 3KNGA 4C6AA 4OLOA 4URSA 5A2QU 1U6ZA 4ZKAA 2RQ4A 4LVNP 2F63A 1Z2LA 3QAEA 3VALA 3BH6B 4NLXA 2H48B 1AUDA 3TZZA 3BH7B 2YBVA 1S4FA 3AD9C 2P9CA 2J7WA 2QLWA 1YJTA 3DLJA 1YJRA 2FJEB 1WHWA 2GHPA 5G4DA 4ZIWA 5BXIA 3TZXA 1LWXA 1KLMA 3HP6A 1MROB 2RE1A 1MWYA 4C11B 1S0OA 2UUBJ 4Y65A 2V8VA 2DGVA 3AXMA 2LA4A 3MCOA 5K14A 4D3GA 2FQQB 3PW0A 1ELOA 3ZZUA 3ILIA 1RTDA 2MJUA 2Q66A 3A12A 4X84A 2B9EA 2F8HA 1O51A 1GTEA 2V8PA 2NQPA 2QA4G 3GV8B 3KK1A 3FBEA 1FDAA 1FEEA 2Y3YA 2LDYA 3Q8RB 2W4CA 2AWZA 4QW9A 3TA0A 2FIUA 3CVKA 4IO9Q 3ICLA 4UQTA 2DD8S 4IG0A 5HATA 1LWCA 1HPZB 2BA9A 1N5TA 3VAIA 2Y1LB 4LT6A 1NKEA 3FC9A 4ALZA 3IM8A 4OHYA 3CCRS 1U7LA 1SJRA 4A48A 1HHSA 3M8PA 3PY8A 4PYDA 2GVZA 5C2GA 2J9DA 2MLZA 2FVCA 4KYZA 3LALA 3ZNJ1 1CJKA 2HHWA 5H9EK 2CWXA 3D1QA 1M1GA 2R8JA 2HFOA 4JI0F 3QO9B 3CJ4A 3G6XA 3LP0A 3D1HA 2KYXA 1SIWB 4OI6A 2DEJA 3WDOA 2VASA 4Q5VA 1DURA 3F56A 3H2VE 1WSVA 3QSYB 2IBOA 2VPXB 1WF2A 4LSNB 3IGVA 3PCOB 4XAKA 2HWHA 1SL1A 4TKTA 3ZFVA 2UV8A 2CZVC 1GAOA 3IXQA 4Y6IA 2VKZG 2V2QA 1REGX 2N7CA 4O0IA 1UFKA 2DHAA 5KG7A 1B0VA 4OI4A 3MD3A 3GMGA 3GJSB 1ZS6A 2IVYA 3L09A 3HSGA 2AU0A 3L95X 5AJ3J 4W90B 3C8YA 1WJ9A 3TA1A 4USKA 3A3PB 2OSRA 1I3OB 3C19A 2HQDA 3FMWA 3OJUA 1QUPA 1HNWF 1U8WA 4DUZF 1RGVA 1HMVB 4MFBA 5KFPA 3SI8A 1XIQA 1Y10A 4R25A 4WE1A 5KFYA 2E5LJ 3LO3A 5E3PA 3OR1A 4RW9B 2VODA 3PYFA 2DR5A 3H5UA 4CP5A 4F02A 1ZH5A 3KJQB 1S76D 3CWJA 3HHLB 3JS9A 2ZH7A 3SEOA 2QZ8A 3R9LA 1XQIA 1V3SA 5EHHA 4FKXA 3LGMA 3V2UC 4LF1A 1PGZA 4X62J 3OSPA 3IWLA 1TKZB 2I6WA 2MQNA 2XZWA 3D3BJ 5DDPC 1N33J 4WFAQ 1NK8A 1QLNA 2H65B 3QNWB 4F8RA 1KTVA 4PG4A 2RUGA 1SQFA 3GJRB 2F7VA 2XYHB 3SFGA 1RTIB 1Q16B 2EG2A 3VWSA 1NH7A 1ITPA 1R43A 5CXTA 3EX7B 3TOQA 4UOCA 1X4AA 1ICEB 1C4CA 1M90T 4ED3A 3VAHA 2R9LA 2W9CA 4WXWA 4X4QA 5KFMA 3DRRA 4NZ7A 1UFWA 1E6YA 2JVOA 2ZKTA 3M8QB 1VHFA 4J9KA 4ZN1A 2UVVA 5H1SV 2P9GA 3KUGA 3FQKA 5KFOA 3EVWA 3HVAA 2C3OA 3DI6B 1ZOTA 4DJBA 5F8HA 3ZZTA 2Z30B 3IG1A 2B6AA 4U8YA 1JLFA 1YRUA 3W1YC 2YPZA 4RWWA 3KKFA 2XI3A 1Q1KA 2MY7A 3DKDA 2M0GB 4YDXA 1ZBTA 3QZ7A 2HRYA 3G6VA 3I0SA 2QA1A 1OSCA 1IUJA 2QYCA 2CPFA 1FXLA 3KLIB 2OPRA 3DLGB 1IKXA 4E8UA 4K4YA 3N6NA 1NK6A 4ED8A 1V3RA 4JI3F 3R6GB 2XS2A 2E5LF 1AT1B 1C0UA 2HVZA 3WHIA 4M5LA 2M2BA 4ANCA 3T9ZA 1VQ6S 3RBZA 1RT6A 4CLFA 3RBEA 2MGZA 4YB5A 2L08A 2UVUA 3SQGB 4ZJLA 2WONB 4OHZA 1SIZA 4L72B 2VV5A 2J6TA 3FEZA 3CIZA 1FRHA 1VJQA 2EXUA 2BQUA 3TYTA 1WKLA 5DQGA 4LF4F 1CQMA 1Q82T 2IRUA 3T1AA 5K20B 5B7WA 1TUWA 3HHEA 5JXSA 3KLEA 2FJXA 1QUVA 4NXNF 1YJ9S 1VQSA 3H59A 2BKOA 3RG6A 3FFIA 5K9FA 1N54B 3GZ7A 2E9RX 1B4SA 1N52B 5ETPA 4ZCLA 1RHKB 4RBVA 2AV5A 3DOLB 2B56A 3H40A 4OHVA 3K59A 2J7KA 3P6YC 2ZVIA 3OXGA 1LOUA 3H98A 3ET6B 1Q53A 1AZSB 4DV1F 5C24B 4XDDA 4DSFA 3KOAA 4DV2J 1SKWA 1YBAA 2JX2A 1LV5A 1N5YA 2ZHAA 2FLPA 3RB4A 4RW6A 1RT1A 2XLJA 1KWMA 2W25A 3MECA 3R7SB 5DJBA 2OI2A 3QWPA 4ECUA 1JXVA 3IR7B 5K8OA 3QRPA 1M5VC 2JLEA 4QWAA 1OIAA 4I0WA 4Z7CA 4WWSA 3Q8QB 1ZPWX 2Q79A 4URGA 5E3CA 1QAXA 1K8AT 1UZHA 2X1BA 4Z2XA 4ZVOB 1DARA 2Z2ZA 4HDGA 4CM2A 3BKFA 3R7NB 4QWCA 5HLFA 1S72S 1PAEX 4ZVHA 1NZAA 3FRZA 2BX6A 3A1YG 4OI2A 2CJYB 2LA6A 3DYAA 4YQWA 1JLCB 2J0XA 2RDJA 3BBFA 2DIVA 3AD8C 3ZZYA 5SZTA 2QX0A 2OPQB 4F4KA 1FJEB 2PI4A 5KT3A 1UVIA 5B0CA 1HWJA 3S1TA 2MQQA 3ITHA 3KMQA 1OQ6A 4K2XA 4NLTA 2M7SA 1TAQA 1VC6A 5LXYA 2E44A 2R8KA 5D0EA 3A4TA 1IKYA 2M8DB 5H9EJ 2IPOB 2B5JA 5KG2A 1C1CA 2MLYA 2CJXB 2FHJD 1KD1T 4NLDA 3B8HA 3CTRA 1VBZA 2OSQA 3KLGA 2OUGA 2KJWA 2E1AA 2HS0A 3D3CJ 4KGXB 3D0IE 2UUAF 2JWNA 5T7LA 4TU9A 3TX0A 3SSRA 4WF9Q 3BBCA 3KDOA 3KWMA 3IR5B 5LL6d 3M6UA 2YWHA 3C6UA 3OL9A 5KTQA 2RRBA 5B0FA 1KRPA 1DAXA 3CXCR 2FVSA 3NWRA 1X9SA 2EVZA 2W1BA 1EAYC 1R0AA 4DV2F 3HHNB 1NJYA 2NCKL 4FYWB 4EMDA 2HHVA 1JQGA 3HVTB 3ADAC 2RU3A 3P4UB 2VQFJ 3P96A 4FN5A 1IBMF 1X5SA 1RTJA 4KGVB 4K4VA 1T3OA 4EYHB 3A8IA 3PEHA 3ISNC 3SDEA 2B4UA 1WDTA 1IN0A 3ENWA 3MM6A 5HANA 2IRYA 1FJGJ 2C42A 4IH7A 5MAOA 1FK9B 4DV0J 1R6VA 3V81B 1EIYB 1VYAA 2D3O1 1SPBP 4HHHA 1JNRB 3K5MA 2NR0A 4RU2A 3J7ZT 4F25A 3OR2A 4AYBD 3M05A 1KOOA 2QTWA 3JTNA 2PGCA 4AFFA 2XCPA 2Y8WA 2MEWA 3FBFA 1TL1B 3BN4A 5J1PA 4LFCJ 3CD6S 4K0KJ 3I82A 5CCLA 4K4SA 4GRSA 1SJ1A 2OLWA 3HPOA 3PX4A 3IWNC 1UWBB 1EX8A 1ZPVA 1RABB 5HVFA 1Y7PA 1RBAA 1U1OA 4PG8A 1TL7A 3EJMA 2DPJA 2PFDA 1N48A 2A2CA 3W3SA 2NXJA 5A8WB 1S77D 1Q8LA 4C7QA 4ZHRA 1BLUA 1UVMA 3FCHA 2MXYA 2KRRA 4H4MB 4DQIA 3FCWA 4UZCA 2OIHA 5HROA 2L48A 2K1RA 4LQ9A 4F4WA 4QWBA 4O3OA 5LMUJ 1DLOA 3MEKA 1FFSB 1U45A 2OH2A 1RBLA 4U9RA 3MPYA 4WK3A 4PWWA 1GTHA 2WB1D 1I1GA 2ZWOA 1Q95G 1XMBA 4G1IA 4NI2B 4IH5A 2GGPB 3K8VA 1VQ7S 3JQKA 2FHJA 2EFVA 2FB0A 3W8GA 1OYDA 2OGUA 3GU0A 2VQFF 2JVRA 4IOCQ 1F5BA 3JAMY 4HTIA 5EWGA 4V19J 3DDKA 4K4ZA 1J2VA 3I5CA 1L3TA 8AT1B 1EP4A 2KYZA 1FJGF 2WOMB 4KBIA 3D6FB 1WI8A 3LGHA 3BSOA 4LRCA 3Q8PB 1T9WA 5KT6A 1K73T 2VB6A 3DLKA 2CQCA 1S59A 1FHTA 2MYFA 4WTYA 3UQSA 2HKEA 2QE5A 2KU7A 1HD1A 2QLXA 2HGLA 4C8NA 3BSNA 2DIUA 5DDQC 3VGUA 1NU4A 1SJ3P 2N3LA 3DHWC 2ZNYA 1U48A 2ZE2A 4MKAA 1UTAA 4B3SJ 3BEGB 2V2VA 3NWGA 3J81Y 2V4JA 4WYWA 2BANB 2ZBRA 3G87A 1WF0A 4LBIA 1KQKA 1W2IA 4CT8A 3ILOA 3FVYA 3H5XA 1VBKA 3DRPA 1MG7A 1YJVA 1FEHA 2KL8A 3IO1A 3A8EA 2A6OA 4O3NA 3NBPB 2ZITA 4C8KA 3HDSA 1FRJA 3I96A 3MEEA 1KHVA 5M2PA 1X4HA 2KFYA 5EWFA 4WPAA 3LAMA 1L3KA 5CYMA 1TKXB 1FTCA 4LIWA 1PC4A 3M32A 1DTTB 3J7YI 2QT7A 2QC3A 2AJQA 2VOOA 1WTBA 1AFJA 4USVA 9ATCB 2H1YA 2QSWA 1FKOA 2AIRB 2GIQA 2B4OA 2PT0A 2Z0GA 3POTA 3PX0A 4QZVB 3KUHA 2HZCA 4C97A 3TUPA 2AKWB 2GA7A 4ZCIA 2J6UA 3MM9A 2IM2A 3CCMS 4PUOA 4G1QA 2MKCA 4N7TA 1T9VA 4I4BA 3QZ8A 3WQPA 2VA2A 4PKDB 3M2VB 3PW5A 1L3UA 4C0BA 1CS4B 1DRZA 3CJTA 2DT9A 1S1TA 2ZBPA 2UU9F 1TTHB 1URNA 1QTMA 1FI4A 3VZIA 1CJTB 4USHA 4ZVTB 1YITS 4AT1B 1KVIA 4FVMA 4BCAA 1G3OA 2HGMA 3NKYA 4AL5A 2GMHA 1GMUA 2DJWA 3TAMB 4AQYF 4DR3F 2PDAA 3E8OA 2GMLA 2LMIA 4F67A 2ZZMA 3R5BA 1FD2A 5KFNA 2XM3A 3UN5A 1DFDA 5KFRA 1HBUA 4CLKA 3UVJA 4C8YA 3WX4A 2YWKA 3KJVA 3TVYA 3S8SA 5ETMA 3UNGC 4K4TA 2B9YA 3V6JA 3BV8A 4NCGA 2LQJA 1N5VA 2YY3A 2XO6A 1I94J 2V4RA 4CLTA 3TANA 2LEBA 2ZC4A 1MSWD 3N9UC 4WCEQ 2CNOB 4PAAA 1JLQB 2AGOA 3L4BC 2N3OA 3AODA 2B7CB 2C22A 2B7BB 5LOQA 3OFFA 4DV7F 1S6PA 4B9MA 3DMJB 4J9MA 4N77A 3RB3A 5ETQA 1K0VA 1SI9A 3P45B 1NPKA 2CQDA 1T95A 3RBDA 3GV7B 4PXCA 3CJKA 2PN6A 4KR0B 3VZHA 2IFXA 5CYQB 1JNZB 1QVFR 2O5DA 4X66J 4ECQA 3PRBA 4Q8EA 5CZXA 4JOUA 5FJ4A 1VC0A 3AT1B 4HEA9 2K7KA 2AMCB 2ZDOA 2Q43A 2HZAA 2EFPA 2IJRA 1Q0NA 5D3GA 4BHQA 1YRTA 5D8HB 4LFBJ 2VPWB 1LW0B 1SC3B 4QW8A 2HQCA 1XR6A 1ZETA 3TP2A 4U7UD 4U7UK 2BR0A 2YVSA 4ETZA 2NXNA 2O67A 4C8MA 5HQLA 4NZ6A 2IC3A 4Y2MA 1D8YA 1VLOA 1VRUB
chains in the Genus database with same CATH topology
3PO4A 2LCWA 4U6PA 3P5TL 4NLPA 2PFFB 1Y4ZB 3TI0A 3H5YA 3FSXA 1LWEA 2DNYA 5GAEU 4CNYA 3M8RA 3TUZC 2DNOA 1RTIA 1UJ6A 3M6VA 2M5YA 1MWZA 5F8GA 3V5RA 2LXFA 4JBCA 5EX3A 3K0JA 4I2PA 2D3ZA 5BYSA 4J5OA 5AXNA 2HNDA 4ILLA 3NRBA 1IKYB 1NK9A 5B08A 2W8KA 1G2EA 1X4CA 2QSFA 2B5JB 2FY1A 1SQEA 4PWUA 2HHXA 3IA0A 2DCUB 4DL0C 4ECSA 1C1CB 1JLEB 2CKWA 2ASDA 5C42B 4ZPVR 4Z37A 2Z2MA 2CVEA 3ULHA 5IFMA 3T1HF 2XMMA 1S9GB 2WSEC 1R31A 2ABYA 2YKPA 1SL0A 1S1XA 5DG8A 3KLHA 4DL5A 4JI1F 3RZAA 4MK7A 4B9VA 4YY3F 1WTFA 1TL4A 3M8QA 2ASJA 2VD3A 3KLGB 1VQMS 4FNHA 4OHXA 2KG0A 2JRSA 3X1LB 1F9FA 2BVZA 2CQ1A 5D4PA 2FVPA 2P5VA 3MM7B 5T7LB 4KIAA 5L1IA 2RS2A 3DNCA 3OUYA 1NK4A 1VQNS 2DRBA 3DI6A 2XNRA 4A8YA 4DL3A 1NJWA 1FNMA 4DQRA 1FKPB 1YHQS 3GFYA 1HQEB 3NS5A 4YB1P 3C6UB 3VAFA 1ZM9A 2CRLA 3D0GE 5KFUA 2FLLA 5A6WA 2VBYA 3NS6A 2MQLA 3M2UA 4WU2A 4OHWA 1HI1A 4I6WA 3G96A 2VQEF 4Q43A 3N0VA 3E2EA 4ICLA 3OJSA 1FXRA 4E0DA 2BV3A 5KFAA 5KG6A 1FCAA 4KB7A 5HP1A 5CCMA 2V5HG 1FDNA 2M52A 1PILA 1D3WA 1UJ4A 4LUBA 1N0UA 4IFVB 4OLPA 5EX0A 5KFFA 3OHBA 4JV1A 1R0AB 4A47A 1JJHA 4RUHA 2DNZA 2FLOA 2VH7A 3IN5A 1HWIA 1EETB 1UEVA 3PRDA 1U47A 1UVKA 1C2PA 5T14A 4C9DA 3CCUS 3OL8A 5L38A 1X9MA 4DSIA 1WHXA 4DBQA 3KG4A 5I3UB 4ID5A 4KHRA 2XNQA 2I9SA 1HW9A 2NPIA 4ZVFA 4YHHF 3VAMA 4A8MP 2JEGA 4OZ0A 3PZPA 4CCHA 3KLIA 4H4KA 2J7UA 1H3DA 2Q3PA 4HT5A 2HVIA 3SCLE 5F8IA 4KHPF 1UW4A 4RUAA 4P2SA 1BC6A 4F3MA 1DQAA 1RTJB 3DLGA 3ISZA 1RT7A 2BE2B 2IHR1 4N56A 3TVKA 2NUHA 2RH3A 4Q2MA 2KFNA 1WI6A 3KG1A 4DLEA 3SDEB 1H7WA 3IFEA 3OTDA 4ELUA 1AFIA 2LEAA 2GC8A 3MM6B 2MZQA 2ZH8A 1KTQA 3BGLA 2QEXS 3BO3A 1QSLA 2HHHF 4TNOA 1HBNB 2DBBA 3U1MA 1U24A 4CZCA 4ZS6A 2LVWA 3PVXA 1VOMA 2CQ4A 1H2TZ 1NAQA 4ZP7A 2FLNA 1H7XA 3HMJG 1HHTP 3FSYA 2WB4A 1G1XA 4DQQA 3I4HX 3IRWP 1K1QA 2GNKA 3UR0A 2B9XA 1JKHA 4M8LA 1SJQA 3OR2B 4M5DA 2V2KA 3LWMA 2DTJA 4LF9F 1HBOB 4ECXA 3ZZZA 1Z1ZA 3IS9B 3H5SA 3GILA 4ELTA 1Q8IA 2D74B 3BSAA 3QJJA 2EC0A 4GKKF 2DO0A 2ZC3A 2XULA 4A8KA 1T7PA 4RLEA 3MF5A 2JZ5A 3QJLA 4EFAC 2MKIA 2C28A 3QIDA 5D77A 3HX9A 2BM0A 3HLUA 3CMAS 4J9QA 1T05B 3SCJE 3BQ1A 4OI0A 3I5AA 3WZ0A 3NAHA 4U7CA 4ZPWR 5J2NB 5KFIA 4ZPTR 3SQGA 3MD1A 3OTOF 3Q0AA 2UXDF 2WONA 2W24A 2RF2B 4RX6A 5A8KA 2E5GA 4NLVA 2W4DA 4PPZA 4TY8B 2Y1IA 5IT4A 1Y9OA 2VG7B 4OI1A 3U27A 2LQ9A 3IC1A 1B0TA 2K3KA 3OR1B 5HBMA 2BYCA 3C6TB 2ATLA 4HT7A 4QYZJ 3EUNA 4TYAA 2AQ4A 1R3NA 3D0HE 3GR1A 5DQIA 2VKRA 3VCDA 2MQPA 4XPCA 2RKIB 2OPSB 2D3OR 4IR9A 2CIMA 2BABA 4EBCA 5J1EB 3OL7A 4F4YA 3O3LA 1KEKA 3RAMA 3CIMA 1VK3A 4C0HA 5E3AA 2Y0SD 2ZVSA 5JJBA 1WHVA 3U7JA 3VF0B 2DGSA 3SZ2A 4HH1A 5L9XA 3NCPA 1NKCA 1IXKA 4F2RA 1N5SA 3CUNA 4QR2A 4DV0F 1KLNA 1U8SA 2X3GA 6FD1A 1RT5A 1VLYA 4Q0BA 2MSSA 2YX4A 2V0NA 3RAXA 1TR0A 4ZHRB 4IYQA 2KFZA 2G1DA 4Y0FA 2GHVC 2E9TA 2R7VA 2OAUA 4RW4B 2R7TA 3TA2A 3KK3B 2XMJA 4MKYA 4I56A 2IJFA 1JXLA 1REVA 2DRAA 3EGWB 1KHWA 2PD1A 3MM5A 4A8FA 3RRHA 1BQMA 3QPIA 4NLUA 2OPPB 1S7HA 2A1BA 1BY9A 2HWTA 4FXVA 3M1VB 5GAHU 2ZH4A 1NK5A 1SKSA 1FDBA 4I67A 3VR1A 2IA6A 1KS2A 1WG1A 2EFGA 1X8DA 3MEDA 5HROB 5KFXA 4DHVA 2K1RB 4LFCF 3M30A 5M2UA 3E01A 3V4IA 4MKBA 4IFYB 3KLVA 3NNHA 3DOLA 4V19X 4K0KF 3TO8A 2BJDA 3LW5C 5LJ3Y 3HKZD 2XGPA 3GIMA 3Q8SB 1L3VA 2ZBCA 3C46A 2XI2A 3HXMA 4ED0A 2PA3A 3EPGA 2IMWP 1DLOB 4KJIA 3MFHA 4G3IA 3OLAA 2K3IA 3F73A 4O44A 2GQQA 4HI1A 1VQYA 2XY6A 2V8DA 4P7VA 2XS7A 3OSNA 2UP1A 2AW0A 1UL3A 4OZLA 1E6VA 2CVIA 4QPXA 2Q6CA 2MZSA 3BGUA 5C24A 4PXDA 4I68A 2G0CA 3OFGA 4IG3A 4EZ6A 2AX0A 4ZVEA 2EBEA 3RB0A 3RRKA 2VG6A 1ZM2A 5FDLA 2L9NA 4C3MA 4W92B 3LP1B 1SUQA 3VTIA 4IRCA 2F8MA 2FC9A 2MY8A 2HHPA 3UFCX 2BACA 2HYIB 5IM0A 2JLGA 4F50A 5I3QA 4N5SA 1K0TA 5F3ZA 2GFFA 4ECTA 4IRKA 5LSOA 5CZVA 4ES3A 1SJ4P 2JEIA 3RR7A 1HWUA 2RVJA 5IZHA 2IBKA 3PO5A 1TVRB 4B3MF 3GFHA 3GYNA 5IQQA 3CCLS 4JI8F 3E3XA 4KKOB 3HJFA 2DGOA 4CO1A 5HMXA 2K2PA 5C25B 2MZRA 4JV2A 2D3UA 3PW2A 1NK0A 2EG1A 1S48A 1FF2A 1V9OA 3S7RA 1O5JA 1OSDA 2KXHA 3CD5A 2U2FA 5DRKA 3MEGB 3AB2B 4I2QA 3MUVP 1U2RA 1ULRA 2V9KA 2EFQA 4Q45A 2IVFB 2E5IA 4FVCA 1NKBA 4LIRA 4CO4A 1GXLA 1SH2A 2OMLA 3NCQA 2V8GA 5GAEI 5HMYA 4CIOA 3TUJC 3MAQA 5A2QY 2HMIA 2VFSA 4I7FA 4ED7A 4J9RA 3TAQA 3DLBA 1U1RA 5LMUF 1VFJA 2XMKA 4CH7A 5K5MA 3JSMB 1WELA 4I1TA 2CQGA 2JC0A 2P6SA 2KO1A 4F3OA 3PACA 2CPEA 4C3KA 2I5JA 3I0RB 1TK0A 4B9LA 1HBMA 3BSCA 1EP4B 1GH8A 3HVRA 3V6DB 1Y5NB 1SH3A 5ITHA 3Q2TC 2ROEA 4WFXA 1N6QA 1H38A 5HI7A 2NREA 2UUCF 2Y1RI 2KT3A 4MTPA 3MMAA 3W2WA 4NMLA 4BDPA 1KQGB 1U25A 2B0GA 5D4LA 2ZH5A 3CCTA 3QYYA 4BC7A 1TK5A 3MUMP 4YR3A 1XR7A 2IMOA 1KNZA 4YFUA 4YR2A 3DLKB 1JLCA 1NO8A 1XR5A 1D1UA 3BQ2A 1JLBA 2ZH2A 3V6HA 4I6YA 1IBLF 3K2YA 4N47A 1YIJS 1QE1A 2L9WA 2J9CA 3KNGA 4TQSA 3W2VA 4DR6F 3PJXA 4NZ0A 1FXDA 3B4MA 4OLOA 4URSA 3O5TB 3TARA 2V8HA 1ZYQA 2W9BA 1U6ZA 1R8PA 2OPQA 2IM0A 2RQ4A 3NCRA 4LJMA 4UUXA 2OFHX 4ZKAA 4LVNP 4EBEA 2WHOA 1Z2LA 3T9NA 3QAEA 3VALA 4NLXA 3WC0A 1Y3JA 1OWXA 2RS8A 3TUIC 1R7IA 1AUDA 1Q4RA 4AE5A 2XMVA 1VQ8S 1X0PA 2ZE2B 3K5PA 1S4FA 3OW2R 4CT9A 4M63A 4TLRA 4ILRA 4B3RF 4MYUA 1ROFA 1Q8BA 2GIRA 3HZEA 2BRLA 2P9CA 2J7WA 2V4JB 2QLWA 1YJTA 3DLJA 1YJRA 2FJEB 1WHWA 2GHPA 3MGJA 5G4DA 3R5AA 2A2DA 2ADCA 4LQ3A 3F41A 1HA1A 5KG4A 3T6BA 4BS2A 1KLMA 3R27A 3HP6A 4DPOA 1XMOF 1MROB 1MMDA 1IKVB 3MMBA 4AL6A 2Z8QA 4Y34A 2RE1A 1MWYA 4DL4A 3BM7A 3DRPB 4YEAA 2D41A 4C11B 1S0OA 2MJNA 4IOBA 1FRKA 1VQ5S 2Y1JA 4Y65A 1WNEA 4OL8A 5D6GA 3MMCA 4C3LA 1R8BA 2V8VA 3MEEB 2DGVA 2DNHA 3NNCA 2Q6BA 3WBZA 3I32A 3CF5Q 4QWEA 2LA4A 3MR2A 5L1LA 5K14A 3T1YF 2DH9A 4D3GA 1PSDA 3T5HA 3PW0A 1ELOA 1U1KA 3ZZUA 2KJVA 4YP3A 4OQJA 4WZMA 3N28A 1RTDA 5CYMB 2MJUA 2J8AA 2Q66A 1P8GA 5CA5A 5L39A 3CCJS 3KLFA 3OTCA 3IRXA 3EPIA 5F3TA 5M2RA 4X84A 3M32B 3PFEA 3PR5B 3GR0A 1Y3KA 5A6PA 2F8HA 4DR7F 1O51A 2EKYA 2XGQA 4PPDA 1OQ3A 3BDEA 2B4VA 4B3SF 1GTEA 3T3FA 2XO7A 2DGUA 1D8YA 2NQPA 1FKOB 1WACA 3N5BA 2QA4G 3T5LA 1TAUA 4NLSA 3GV8B 4CTAB 2DR8A 3KK1A 5KT7A 4DR4F 3NMRA 3HVTA 4N8OA 4M1KA 2YNGB 1FDAA 1FEEA 3CDBA 3DRSA 3POTB 4CO2A 2CJBA 4IUFA 2LDYA 3Q8RB 2W4CA 1TV6B 2AWZA 3DCAA 4TYBA 4QW9A 3QLHA 1NK7A 5J2PB 3TA0A 1RT3A 1FTRA 2LECA 1FNOA 4OX6A 2VG5A 4G1PA 2FIUA 2ROGA 3CVKA 3RTVA 1VQLS 1FRMA 3BR8A 2NSBA 3ICLA 3JTPA 4IO9Q 4UQTA 5GADI 4FXDA 2W4PA 2DD8S 4IG0A 3CGIA 2D1CA 1LWCA 1HPZB 3PNIA 4PQUA 3M6WA 2BA9A 5E5NA 1N5TA 3VAIA 4XPEA 3MM9B 2YKOA 3ZZ0A 2MB0B 2V9WA 2HHUA 1WHYA 3O6QA 3OVSA 1DQ8A 1J5EF 4PUOB 4LT6A 1NKEA 4ERDA 1FK9A 1B0PA 3DGPA 4G1QB 4ALZA 1UVLA 3MZIA 3V81A 4OHYA 2EK6A 4K59A 1U7LA 3CCRS 1SJRA 4A48A 1HHSA 5GAHI 1D9DA 3HFKA 4CH1A 3V4MA 1RAJA 3DC2A 3M8PA 3PY8A 3PIOQ 1T03A 1RT2A 2BQ3A 2UUWA 2J9DA 1LW2A 4KFBB 2FVCA 1N4LA 4QYRA 4ED5A 4LF7F 3LALA 3O8WA 3K58A 5B09A 2E7WA 5J2QB 4HKQA 5KFKA 2AYEA 2HHWA 3H25A 3QIPA 4WIIA 3HKWA 3D1QA 2KG1A 4OV1A 4KT0C 3EYZA 2R8JA 1JJ4A 5DG9A 2HFOA 4QCLA 4LMZA 4JI0F 1S97A 2ASYA 1S1TB 3QO9B 3CJ4A 1TL1A 2M3DA 3LP0A 3D1HA 3G6XA 3M9NB 3GV5B 2KYXA 1SIWB 5GAGI 3Q22A 1XN9A 4OI6A 3SCKE 2X1FA 2C3YA 2CPZA 3AJ1A 4JI4F 3WDOA 5DQHA 2CPIA 2VASA 4B9NA 4Q5VA 1DURA 1P6TA 1S1WA 3PEJA 3F56A 3H2VE 1N88A 3DLEA 4RNMA 1J5OA 5K8NA 2ZOGA 2RILA 2JEJA 3LPYA 5IS2A 2ZKUA 1UWBA 5CHCB 4WXOA 4B3OA 3I5BA 3LANA 4ZLPA