2L08A

Solution nmr structure of nonsense mrna reducing factor 3a from h. sapiens, northeast structural genomics consortium target hr4714b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHSHMVVIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRNPDDILLFRDRFDGYIFLDSKGLEYPAVVEFAPFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of nonsense transcripts 3A
publication title Solution NMR Structure of Nonsense mRNA reducing factor 3A from H. Sapiens, Northeast Structural Genomics Consortium Target HR4714B
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 10
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l08A00
2DHSA 2KRBA 1RK8A 2L41A 4WF9Q 2DH7A 1NO8A 3VF0B 1Q86T 3CF5Q 2AYEA 3DXBA 2BOPA 2ADBA 3S7RA 2YKAA 2ADCA 1NJIT 2E5GA 5CXTA 4C7QA 5DETA 2XS2A 2M0GB 1WF1A 3D2WA 2CQIA 4IUFA 2LCWA 1U1OA 2CPEA 3CCUS 5JVHQ 4V19X 2VODA 1QVFR 4CIOA 3V4MA 1N52B 2DISA 3I56S 1SJRA 1WG4A 1WI6A 3UCGA 5D78A 2RU3A 5BJRA 5DDOC 1U6BA 3S6EA 2AYBA 3SDEA 1SJ4P 2XB2D 3U1MA 3VAJA 1BY9A 2KI2A 1VQKS 3NNCA 2M8DB 1JMTA 2ERRA 1OWXA 3BO4A 3SDEB 1VQMS 2MY7A 2MJUA 2YH1A 2DNLA 2E5IA 5DDQC 3THPA 3Q2TC 2CQ4A 2YWKA 3EX7B 1AUDA 2VONA 2X1BA 1R8PA 2CQPA 1FXLA 2GHPA 5ITHA 3UD4P 2DNGA 3CMES 1SJ3P 1FO1A 2MYFA 1X4GA 1WHVA 2ZJRQ 5GAHU 1X5TA 2PEHA 2E44A 1Q81T 3ZZYA 2E5JA 1DHMA 2XSFA 3BS9A 2EK1A 2X1FA 1YWXA 2DH8A 2F9DA 1X0FA 4LIRA 2UP1A 1M5KC 3MURP 1WG1A 1WEYA 2KYXA 4UY8T 2MGZA 1OPIA 3US5A 4TLQA 3NS5A 1KQSR 1WF2A 2MXYA 3P3DA 1A7GE 3MOJB 1WI8A 2MZSA 2KM8C 2YH0A 4YOEA 3L3CA 1KOHA 5CA5A 4QU7A 2MGZB 1XN9A 1X4FA 2DB1A 3R1LA 3TP2A 4QQBA 2KFYA 2MB0B 3UCZP 2K3KA 3SMZA 3BO2A 4Z2XA 2OIHA 2D9OA 1X5SA 2DO0A 1DRZA 1Q82T 2CPJA 3CCLS 2F3JA 2EK6A 2KM8B 3G96A 3CULA 2ZJQQ 1URNA 3MUVP 3G71S 1A9NB 2JRSA 2DGSA 3CCES 1K9MT 2RRAA 2G4BA 1YI2S 5FJ4A 5DDRC 1X4DA 3DLLQ 3NMRA 1ZZFA 2EVZA 2CQGA 2OTJS 2CPFA 2LA6A 3THTA 2M70A 3UD3P 2DHAA 2CQ0A 3BO3A 2MQQA 1B7FA 1WHWA 4BS2A 1RKJA 1U6FA 2XNQA 3VAKA 2PE8A 4ZKAA 2G1DA 1Q7YT 2DGTA 2KG1A 5DM6Q 3CMAS 1SXLA 3NS6A 4TU7A 5H1SV 2A3JA 1WEZA 2MKJA 4PR6A 5JVGQ 1L3KA 1H2TZ 4CH1A 2JX2A 3N9UC 2D9PA 2FPHX 2FC8A 1PGZA 1WHXA 3NNHA 1N54B 2DGWA 2FY1A 2KXFA 1VQ6S 4UQTA 1KOOA 2CJKA 1VQPS 1YJNS 4F02A 2DNQA 1K73T 2XS5A 5CYJA 1X4CA 3CCRS 1VQ4S 2D3OR 3MD3A 2LYVA 3VAMA 1VBYA 2YTCA 2MQPA 2KXNB 3U1LA 3VAIA 3J7YU 1VQ9S 1HD0A 1UAWA 2JVRA 1M1KT 1H6KX 2RS8A 1F9FA 3CCQS 2LXUA 3S01A 2RUGA 1WELA 2J0QD 2L08A 5IQQA 2RNEA 1K8AT 2AYGA 2CPHA 2I2YA 2MZ1A 2HGMA 1VQLS 5GADU 2DGQA 2MKKA 2DGXA 1M90T 2CQCA 2HGNA 1FJCA 5GVQA 3G9CA 2RT3A 1P27B 2MQNA 1YITS 2QA4S 2Q79A 3G6ES 4FXVA 3NNAA 2LA4A 2X1AA 4YB1P 3PIOQ 1VBXA 2M2BA 1YJ9S 1WTBA 1PO6A 2MMYA 1P1TA 2OSQA 2CQDA 4P6QA 3CCSS 2F9JA 4IOAQ 3CUNA 4W90B 2U1AA 5IM0A 3UWTA 3G8TA 1FT8A 3MDFA 1X4HA 2RRBA 1U1PA 2HZCA 5HL7Q 2MZJA 5LXRA 2LEBA 1W2BR 2DIUA 5IFMA 4WKRA 5LXYA 2RVJA 3FEXB 4YUDA 2FHOB 3HHNB 2LKZA 3EGZA 3VAFA 4QPTA 4RU2A 1DZ5A 4LJMA 2M52A 4Y00A 1ZH5A 2MKCA 5GAGU 3VALA 2DNPA 1U1LA 4A8XA 1WG5A 4TU9A 3IRWP 3P6YC 1VQOS 2VOOA 2DNOA 3MUMP 2QEXS 5DM7Q 4WFBQ 3OW2R 2BZ2A 2MSSA 3I55S 2DGVA 2AD9A 1VC0A 4OZ0A 3H2UB 4PKDB 1DBDA 4M5DB 5MLCV 2M88A 5D77A 1U1KA 3UE2A 2LQ5A 2O3DA 2MQOA 2MPUA 2MKSA 4LMZA 5GAEU 2N3OA 2LXIA 1R8HA 2AYMA 1G2EA 2N82B 1HA1A 1YTYA 4ERDA 1VQNS 2DNRA 4FXWA 2MHNA 2LMIA 1UFWA 3MI7X 1H2UX 1SJQA 5LSOA 1KD1T 4CH0S 2MSTA 3MD1A 2CPDA 2MQLA 2VOPA 1X4AA 3TYTA 2M8HA 1VQ5S 2OSRA 3CC2S 2RQCA 2DNYA 3IWNC 3JB9k 2OTLS 2DK2A 1FNXH 4W92B 2J76E 2KU7A 2M9KA 1H2VZ 3P49B 1NU4A 2DHGA 4QU6A 2CPZA 2E5HA 2M4MA 2WBRA 5LSLA 4F25A 2N7CA 2LEAA 2DO4A 2MY8A 2X1GA 5DDPC 2CPIA 3CCJS 2DGUA 4Y0FA 2OJ3A 3K0JA 3CCMS 2JWNA 2MKIA 4J5OA 4IOCQ 1FJEB 3R1HA 1N8RT 2CQHA 3BEGB 3EGNA 5LJ3Y 1HL6A 2N3LA 1CVJA 1U1NA 3H2VE 1UP1A 3CPWR 2LECA 2CQBA 1JJ4A 2KXHA 3RW7A 4C0OC 1M5PC 4WFNQ 3B4DA 2DNZA 2MZQA 2L9WA 2M7SA 2DNNA 2MKHA 1WHYA 1VC5A 2XNRA 2MJNA 2DGOA 1S72S 2G0CA 2KHCA 1X4EA 2DH9A 2RS2A 3VAHA 2DIVA 2KN4A 2MZRA 1X5PA 3S8SA 3ULHA 2MQMA 3LPYA 4CQ1A 2I38A 2GO9A 1U1MA 3B4MA 5LJ5Y 3G4SS 2NZ4A 1D8ZA 1YJWS 1OO0B 1SJFA 2J0SD 4TU8A 4EGLA 1U1RA 2CQ3A 5HO4A 2HYIB 4ED5A 5IM0B 2NLWA 3CC7S 2CPYA 1D9AA 4OZ1A 2KT5A 2B0GA 1U2FA 1FHTA 1S79A 2DNMA 3ZZZA 4IO9Q 1JJ2R 1VC6A 2K8GA 1FJ7A 3SXLA 4C4WA 3CC4S 2XS7A 1M5VC 3FEYB 1VBZA 2RQ4A 1WF0A 1M5OC 2DHXA 5GMKa 3P5TL 2V94A 3Q2SC 1O0PA 1YHQS 1WWHA 2FC9A 2MZTA 2HVZA 3CXCR 1ZZNA 3CCVS 3TO8A 2KH9A 2J8AA 1WEXA 1QM9A 3VAGA 2KVIA 1QVGR 2DNHA 4WIIA 2KG0A 4F26A 3G8SA 3R27A 3CD6S 3UCUP 2CQ2A 2SXLA 2ZJPQ 3RW6A 1KC8T 2HGLA 1JJHA 1YIJS 1UW4A 1IQTA 4U67Q 3LQVA 1X5OA 5EN1A 4PRFA 2DITA 3J7ZT 3MUTP 2QFJA 2U2FA 3CTRA 1X4BA 1N88A 1OIAA 3PIPQ 1U1QA 4WCEQ 1VQ8S 3HI9A 1VQ7S 3MXHP 2JVOA 1HD1A 2CPXA 2DNKA 4WFAQ 2CQ1A 2KRRA
chains in the Genus database with same CATH superfamily
2COLA 4EEYA 3CF5Q 3SCJE 2BOPA 4FYWB 4C7QA 3HKWA 4OZ2A 3DLEB 1TL3B 3HP6A 2C3MA 2UV8A 3AD9C 2PN6A 3E51A 3RAMA 2R2UA 3D3CJ 2C42A 4M5LA 4EI2A 2XO6A 5CYQB 3H5YA 4X4TA 4DL2A 3UVJA 3M2VA 2AYBA 2UUBJ 5KG5A 3KWMA 4G3IA 1NJYA 4ZPTR 4OFZA 4DI6A 1EETB 4ELUA 4LVNP 1KDNA 3DDIA 2BEFA 4PPDA 1WORA 2YH1A 4Y2AA 3EX7B 4CZCA 1NCLA 2ATCB 5E3PA 1CS4A 2VJVA 2APOA 4R5PA 4PG5A 4J9PA 4DCJB 2KYXA 4TN2A 4B9MA 3P3DA 3UPFA 4L3NA 3FBBA 2MGZB 2VFVA 3PY8A 1B64A 1GT8A 3GFHA 3RYLA 4ZVEA 4IFVA 3POTB 2DO0A 3I6PA 2YWFA 2YWEA 3G71S 4M5NA 1RACB 1K9MT 4FXDA 5KT4A 1CULA 3UDCA 3TJAA 1GNKA 1RKJA 4LF5J 3KG0A 4DCPB 1RAOA 2YBVA 5KG0A 4DSKA 3AQPA 1JLFA 2IHR1 5HLFB 2UVWA 2RH3A 2CWXA 2PSZA 4IRCA 1PJ5A 1REVB 4RNNA 3CCRS 2LYVA 3DGPA 3TUIC 3VVTA 2D1CA 1VQ9S 1H6KX 2YNHA 4NLSA 3DU5A 5IQQA 4J91A 4DX8H 2AYGA 4UUXA 4P10A 4IG0A 2LP4A 1HARA 3NGDA 3TJ8A 2ZH3A 4YHHJ 3CD7A 1FA0A 2QA4S 4ZPAA 1X9SA 2CYYA 1KVJA 1IKXB 2N4CA 4AFFA 2UUAF 4YB1P 2XTJP 4YB5A 2DXEA 3C14A 4K4VA 1KQKA 4OJ3A 1FT8A 3BQ2A 5EWEA 2ZOFA 3K89A 1RT1A 3DDNA 3FFIA 3MMBA 4BWJA 2M52A 4K4UA 2Y0SD 5GAGU 4ZVPB 4CTAB 3OUYA 3MFHA 2UVUA 3R5DA 1UVMA 2O67A 4ZP6A 1U24A 2DGVA 1P6TA 1TFWA 2O66A 1SQFA 5L38A 1ULRA 1AFJA 5E3CA 4DFJA 2H1YA 5KFRA 2E1AA 3KLGB 2BQUA 1TV6A 3OT9A 2KJVA 3I5AA 1NSKL 1ICEB 1XEZA 1RTIA 3KLFA 3QT8A 3PVXA 4NCAA 2V2ZA 2N7CA 2OEJA 1C4AA 4ECTA 2AKWB 2X1GA 2CPIA 1TL5A 4EBDA 3RBDA 4QCLA 5LT5A 3UDVA 4RW4A 3DYAB 4A8WA 1RB0A 4IOCQ 3R5AA 1HYSB 3HD1A 1GX6A 2M5YA 2BABA 3B4DA 2AGPA 4YR3A 2DD8S 2WZ1A 5A8KB 5KFZA 1FF2A 1Y10A 1RUSA 1N5TA 3ISNC 3JSBA 4C0HA 3OVAA 1SC1B 3V6HA 5THWA 1SKSA 1NHVA 3W63A 3E01A 2FLOA 1OQ6A 2BANA 2I38A 3MM8B 4WK3A 2JLEA 4NXNF 1V6HA 3BSCA 5IT0A 5FLXY 4WP9A 1RTZA 2A6OA 1CJVB 3D9BA 2Q3PA 4ILRA 4OZ1A 2LQJA 2B0GA 3ICLA 1VC6A 3P8BB 1G3OA 1JLGA 3ENAA 2OFHX 2CJBA 2HAFA 2VICA 2V4JA 1N6QB 1UVKA 1WUUA 1RP5A 2G0IA 3UO0A 2IY5B 5ETVA 3QSYB 1U0SA 1YIJS 2XI2A 1LWFA 2JEJA 5FDLB 5CQGA 4JI5J 3ZTQA 4PRFA 4LF9F 1ZM2A 5HSPA 3KK3A 3LO3A 4OLPA 4FKYA 2KRRA 5IV3A 4U95A 1AFIA 1FRXA 1NO8A 3DLKB 3T6JA 2EC2A 3S7RA 3OTOF 2R7WA 4CLPA 3D2WA 3EPIA 1QD1A 1FE0A 1HNWJ 2HHSA 5KFPA 2DISA 1TVRB 3C15B 2DY1A 4QIEA 5AXNA 1FRHA 2QFIA 4F2RA 5L39A 3HHLA 3M4XA 2HSEB 1K47A 5EX0A 3CJ5A 4DXLA 4KRWA 4JOUA 2B51A 4EBCA 3KLIA 3T9NA 4U7UK 2FD2A 4JI4J 2IAJA 1XMOJ 3K5MA 3F56A 1X5TA 3HFZB 4C48A 2W9AA 1R6VA 4ZIVA 3J7AN 2X1FA 2BXJA 4A47A 4LIRA 1S1WA 2ZM6F 3FSYA 4O4RA 1D3WA 2BE2B 2GJ2A 2ZUAA 1E6YA 1WF2A 1TELA 4OHXA 4NLDA 3NCRA 5CA5A 1HBNA 3MM9B 2HHQA 2AJQA 2NPFA 3SMZA 2YQ3A 2D9OA 1Q82T 1D9FA 4USMA 2EK6A 5SZTA 2N7YA 2JRSA 3TRGA 4WZQA 2VFTA 3A8IA 5B0GA 1RHKB 3DLLQ 3BGLA 1U0HA 1RTJA 1G1XA 2LA6A 2PFFB 2BRLA 3ZTRA 2G1DA 2PC6A 3QO9B 2GJIA 3W7BA 4MH8A 1Y7PA 3ZZOA 4CLWA 4OJGA 4X4NA 4LSLA 3KK2A 1IKWB 4KO0A 4URGA 4NEZA 3TX0A 4C11B 3CDBA 2B43A 2K06A 5A2QY 1AA1B 1XR6A 5M2PA 3MAHA 2RILA 2ZE2A 1LNQA 1V5IB 1TMMA 3QJPA 1NMEB 2DR7A 2GVZA 2HGNA 3HSDA 1FJCA 1HBOA 1KHWA 4JUZA 4ICLA 2RAQA 5KFKA 1PO6A 4RW7A 3DRRA 5I42A 1UVNA 4ELTA 1C1CA 1Y5LB 3CUNA 5DQIA 5ETSA 4RW8A 3FMWA 3PYEA 2CJQA 2Z57B 8RUCA 1XNQJ 3CJ0A 5D3GA 1E6VA 4PUOA 1TR0A 3JTPA 2HQIA 3IM8A 1Q95G 3R9LA 3T41A 5IT9U 1NEEA 4YP3A 1B0TA 2WRMA 3QFHA 1CQMA 4PKDB 2D74B 3PEJA 5MLCV 4ZVFA 3UQSA 1HW9A 4MK9A 4NLYA 3MR3A 2N3OA 4RUBA 4WYLA 2E9ZA 3BR8A 3GZ7A 2NPIA 1FFWB 3A4TA 2D7SA 3JB9k 2EBGA 1N56A 1HLWA 5LSLA 1AROP 1S59A 2DXDA 4MK7A 2JSXA 2W9CB 4DV2J 4MMOA 2ASYA 4EZ6A 2HNYA 3QBCA 3OFFA 1U1NA 1SQEA 1KKHA 2DNZA 3HPOA 2L9WA 4K8RA 3PX4A 4A8QA 3MCMA 1FI4A 2CG4A 3VAHA 5B0FA 4F4WA 2MQ8A 4CQ1A 4I6AA 2GO9A 3LPEA 4QR0A 4AYBD 2FJEB 3HVRA 3N5BA 1UCNA 2ZBPA 1IKYB 4R8UB 2ALZA 3M7VA 4XDCA 1RLDA 1EARA 2AWZA 2HMIB 3DOLA 1M5OC 5ETOA 2OPRA 4PG6A 4H4KA 3P5BP 3TA0A 1QVGR 4OI1A 1F3VA 3O1LA 4DCOB 3BGRB 4X84A 3ZTOA 4G6VB 1R0BG 1X60A 5K14B 4DJBA 2QFJA 4HH0A 5ETRA 3HLUA 5C2CA 2P5VA 1JB0C 4WFAQ 2DHSA 3IXQA 2DH7A 3VF0B 4IH5A 4CNYA 4BDPA 2ZDPA 2YXLA 1NB2A 2GJFA 4RZRA 2QX0A 3JSMA 3PJXA 3SDEA 3TZZA 5K20B 7AT1B 1S10A 3CDAA 4YDXA 4I2PB 1JMTA 1VQMS 2DRBA 4LF9J 3N01A 1FXLA 3PW4A 3QYYA 4HHUA 2XMVA 1C0UA 2I1RA 2FJBB 1HQ2A 1TZ0A 2HVEA 1DHMA 5AJ3F 5KFOA 1HQUA 2V50A 5HBMA 1UTAA 4RWWA 1UKUA 1M5KC 5HQ8A 2AEFA 5AE2A 3HSJA 2WVEA 5CABA 2FY8A 3MHYA 1K1QA 1RAGB 5J1EB 2KM8C 2C2RA 4PQUA 1X0PA 2UXCF 1BE4A 1AXQA 3GIIA 3OFHA 4Q45A 2K3KA 5KT7A 3W5ZA 5DG9A 4HACB 3Q23A 1N34F 3PRBA 1ZZFA 4Q5VA 3THTA 2OPSA 3ETOA 2V34A 2OUGA 3BO3A 2MQQA 3OTCA 5DO2A 1XMQF 2DGTA 3MCNA 5DM6Q 3M30A 4RX6A 4U7UD 2HG4A 4Z7YA 2HHUA 3PTWA 1P9YA 4ED3A 4USIA 4QWBA 1X4CA 2D3OR 4DR6F 3DLJA 4B9VA 1T05B 3SQGB 5KFIA 3M1VA 1UAWA 4P2MA 1UJ5A 3M6XA 1T0TV 2A1BA 3OHBA 2HGMA 4IR9A 2OAUA 1JLQB 3R6LB 4M5HA 2B9WA 1ZM9A 4LFCJ 5H9FJ 5GAEI 3PFEA 1P1TA 3F73A 4IOAQ 4C8ZA 2U1AA 2YNFB 1C1BA 3R3TA 4JI0F 3ENWA 2E9TA 1DTTB 1IWGA 5F0UA 1CJUA 4DR4F 1U26A 5I3UA 3W65A 1AB8A 3GYXB 2IVFB 3SFGA 5HQLA 1HW8A 1R0CB 3HSZA 2BZ2A 1XIQA 1DTQB 5H9FK 3DRXA 2R7VA 3OL6A 1QAJA 4ID8A 2M3DA 4B17A 1U1KA 2LQ5A 4OYZA 3KMQA 1SC3B 4ED7A 4LFAF 1ZBTA 2AYMA 4P74A 1U8SA 1VQNS 1RA7A 2B7BB 4M94A 3TAQA 2NXEA 2MQLA 4O3PA 2M8HA 3TYTA 3CC2S 3IWNC 2DNYA 3CJKA 3AJDA 1FNXH 4NWBA 2CPZA 2ILYA 2CADA 2Z8QA 4LBIA 4B9LA 4XPCA 1RTDA 4RBVA 2WB1D 3CCWA 1YG0A 1N8RT 3GFXA 3MM5B 1S0VA 2FTRA 3PHEA 2FLLA 2J6SA 3LWMA 1BQNB 2VDHA 2XNRA 2DJWA 1RBLA 5HANA 3HMJG 4C3LA 3H5XA 3KG1A 4I1TA 2VG7A 2VPXB 3C19A 1ZA1B 1GMWA 2H65B 3LP0B 1SJ1A 3C16B 5F8MA 2DIVA 1X5PA 3PRVA 1HHQA 2MQMA 3M8QA 1TUVA 4KPCA 3W2VA 3L95X 4JYAF 1O6XA 4ANEA 3Q8UA 2K3IA 5IOLA 2KT5A 5LOQA 3OTDA 2VQFF 3K5LA 4ETXA 3I4HX 2HZAA 4YB7A 1BUXA 2P2CB 1M5VC 3IMQJ 3FEYB 1F5AA 1VBZA 3HHEA 5D4NA 1RGVA 1HNXJ 1WWHA 4DL4A 4Y6IA 3IR5B 2I6WA 4B3SF 2R8IA 2W24A 4L72B 2KH9A 2KVIA 2LU2A 5J2NB 4CRJA 4JB8B 2HNZB 4DR5J 4PYAA 1UW4A 4OZ5A 1X5OA 2BR0A 2YPZA 1OIAA 2ILZA 4Y2KA 3JSYA 4KQZA 2JNJA 1VQ8S 2P9CA 5B0EA 1HBUA 1EHWA 4NEYA 4ZJQA 1N48A 1WKKA 3EXCX 3DM2A 1NJIT 3I4PA 2VQEF 3MFIA 3BSOA 2VODA 3DKDA 2NYIA 4LSZB 4KHPF 3GILA 5D78A 3D1QA 2RU3A 2IDLA 5DDOC 2V68A 2XWXA 4TY8A 5EWGA 4M95A 2KI2A 4K0KF 4DR7J 5D0GA 4OHWA 2WOMA 4GC6A 4PYDA 5KG1A 1R8BA 1JLAB 3FKBA 2CQPA 3C6UB 4P2XA 3Q8YA 3NGRA 1Q81T 1IBMF 2QYGA 2E5JA 2YPYA 2VBWA 4U96A 1L3UA 1HBMA 2IMOA 4ZP8A 2ASJA 2ALYB 2QN6B 1VFJA 2BW2A 2E1MC 3T1HF 2GMHA 4C8LA 2YH0A 4ZJLA 2YKQA 1BHNA 4AL5A 3TWZA 3TP2A 1QSSA 3KUGA 4ZK7M 4Z2XA 4GRSA 3U1NA 3ZTSA 4Y2MA 2F3JA 2J9DA 1B70B 2WONA 3TAMB 1HMVA 5IC6B 2V9WA 2DGSA 3QAEA 3OVSA 4ZLJA 1JLBA 1ITPA 2XBPA 5HN0A 4P73A 3MMCA 4IQMA 2FVPA 2AW0A 1Y3KA 3ONQA 4XDDA 1T02A 3D6HB 4TYAA 1HKAA 2PE8A 2H4WB 5F41A 3FMBA 3JAMU 3J7Z5 3R7SB 1MMLA 5D4OA 3NS6A 4KC5A 3JYTB 4DR1F 1S5ZA 3KFWX 3R8YA 1EQ0A 2IDEA 1L3KA 3ET6A 1LXNA 2B5JA 2GQCA 3UR3C 1EP4A 5E33A 2BM1A 5A6WA 1UL3A 4MJKA 1VBYA 3L7UA 2WSFC 2KB2A 2K2PA 1F3FA 3Q0AA 2L08A 1YZ6A 2MLXA 3W9JA 1T03B 3Q8VA 1LW2A 3UR0A 4C8YA 1B7YB 1JNZB 1OSDA 4HTIA 1R0AB 1JXVA 1Q8KA 3WIUA 1IUJA 1REGX 1XMQJ 2BJ9A 4RW6A 4HEA9 2P8IA 1FVSA 4OHYA 2IJNA 2HZCA 2MZJA 3I0RB 3DN9A 1JX4A 4ZPDA 2G2ZA 4CLTA 4I0WA 1BWEA 3QLHB 1DJ0A 1IWAA 1SL1A 3CD5A 4DR6J 1LWEA 3S1TA 4DQIA 1WG5A 5CAAA 2XCAA 3I55S 1RYSA 1Q5VA 3BPDA 4YY3J 5DLGA 3IM9A 3H0PA 1S1VB 4XTTA 5KFDA 4OI0A 1H73A 1RAEB 4QOTA 3LA0A 4FXWA 4F2SA 3FNNA 1I3OB 1SJQA 1KD1T 2E29A 3JXOA 1TU0B 2JHEA 3EE3A 1FEEA 2A18A 4CT8A 5J2MB 3M32A 2XCPA 1SL0A 2AJ0A 3PZPA 1L3VA 4LF8F 1RWNB 3HZGA 4MK8A 4WK1A 2BRKA 2Q66A 3D6FB 3MEDA 2R8GA 2I5JA 3RW7A 1M5PC 4CO3A 2HNDA 3KHGA 3I82A 5B09A 5J2PB 4D3HA 3OXLA 1WOSA 3QRPA 1T3OA 2F8MA 3O2IA 1LWCA 3V6JA 3E8OA 5D6GA 1K0VA 3OL8A 2LFVA 5A8RB 2HRUA 3CDEA 3MECA 1Y4ZB 4KV8A 2VIHA 3TA2A 2HFSA 2Y1LB 2B9EA 3GIJA 5HJXA 3BBCA 4IFYB 4QBUA 4NX9A 1VI7A 2W2NP 3SSRA 4KB7A 3Q2SC 1O0PA 4J9SA 2MZTA 1VLOA 2UUCJ 1NH8A 4WFZA 1NJXA 2B8PA 2DNHA 4WIIA 3FZ2A 4KGXB 4ZVQB 2PMZD 5F8GA 2R7RA 2B56A 4DU7A 2HGLA 1JJHA 4F4XA 4DV1F 4U8YA 2OPPA 2OMLA 3FDSA 3H7HB 4WTOB 2AHOB 3AT1B 4YDDB 1G2EA 2DBBA 3KK1B 5B0DA 4Q43A 1VQYA 1S6OA 4ECQA 4R0EA 5CYQA 5JVHQ 4F36A 1WSVA 3HJFA 4P2SA 4OX6A 1TK8A 4N41A 2B4UA 4X65J 1EETA 4B3SJ 1U6BA 3S6EA 1Q8BA 2XB2D 2RDJA 3TNVA 4OYXA 1VBKA 3GP9A 4YFUA 4YEAA 3BO4A 3AB2B 5D4PA 3FQKA 1AUDA 1GTHA 1R43A 3FBFA 1TKDA 5IXUA 1FO1A 1FD8A 3OHAA 5AXKA 3DLBA 4DV0J 1J5OA 3GV7B 4NMLA 2G9OA 4OI3A 3OFEA 3K57A 2R2RA 3EGVA 4DQSA 1GAOA 2H5EA 2MGZA 4I6WA 2HVHA 5ETTA 3KLVA 1NK4A 1TKTA 4FVCA 3POTA 1SKWA 3ZZTA 1F2GA 2F8EX 2DB1A 2B6AB 4I2QA 5AXMA 2QL7B 3BO2A 4RNMA 3NGKA 4IG3B 2CJAA 3CCLS 4I69A 1N5YA 1VIXA 1Y3JA 5C2GA 2E1RA 5FJ4A 3AOAA 3R5CA 3O6QA 1VRUB 1NXIA 4J9OA 2CNLB 2M70A 1Q8LA 3D1HA 1NPRA 4B3RF 1S9FA 2R7TA 5F8NA 4F67A 5I3QA 5GADI 3EICA 4K5RA 2PI5A 3BJYA 3VGUA 5KFJA 1WEZA 1JWWA 3G82A 4I7FA 4OYAA 1RWPB 4Q8EA 3T1HJ 1XK8A 1REVA 4BCAA 4H4MB 2Z2MA 4Y2IA 3C6TB 3T5LA 3EGWB 3BBFA 2KXFA 2E9RX 2MKYA 4UQTA 4USHA 1PYOB 2DNQA 4X4OA 5KFWA 4CLKA 2J9EA 3VAMA 2HPUA 4QR2A 1WSRA 3Q8SB 2RDDA 4X4VA 1VHIA 1S7IA 3EVMA 3T5HA 3SCLE 1RHJB 3AFGA 2ZBQA 1Q16B 3RB3A 2VH7A 2DPIA 1T8EA 2PMWA 3TANA 2KZZA 4LT6A 5KFFA 5T41A 1T94A 4W4MA 2X1AA 3T3FA 1VBXA 2BKOA 3LP2A 3M6VA 3M2UA 4XAKA 1YJ9S 1KLNA 2MMYA 3ENQA 4P6QA 1VRTB 1N33F 3D54A 3MM7B 3RJMB 2FZCB 2QL5B 3R7BB 2OH2A 1OMSA 1RAJA 2ZBRA 3FEXB 4X64J 2HBYB 3N28A 3EGZA 4I68A 4UOFA 2V8DA 4LJMA 1ZH5A 2MKCA 4TQSA 1KN6A 4TU9A 3IRWP 1RA6A 1EB0A 2GNKA 3CCZA 5DG7A 1AZSB 1QTNB 3QZ7A 4ZP7A 2Y1JA 3JQKA 5D77A 4AL7A 2VC1A 3GONA 4C0BA 4ERDA 4F50A 1ZAXA 5G0RB 2FLPA 3GSDA 2HW3A 2W2QP 1A6LA 3CGIA 2Q6CA 3K5PA 1CJTA 4RJVA 2UVVA 3MEGB 4X4UA 1RT6A 3SEOA 3HHLC 4Q7AA 5DDPC 4YB6A 2QLFB 2DGUA 1HNVB 3HVTA 3IN5A 2ACYA 1S1XA 2OMOA 3IG1B 3V2UC 4O3NA 2DXFA 4XPEA 2RD5C 2HS0A 4FNIA 3FCHA 5IT9Y 1SC6A 4Q0BB 1IXKA 1S72S 2RF2B 3V6DA 1FFSB 3VZIA 3OVBA 1TMJA 4DUYF 4QWDA 2YWWA 1UEUA 1N5SA 3OFGA 2RS2A 1PKUA 3SI8A 4ZITA 2BQRA 4DN0A 4DMZA 2FJVA 1CJVA 3GIRA 1OO0B 1FESA 2HYIB 4CT9A 3BGFA 4DWIA 2HFUA 1SBRA 2IM3A 3W2WA 1N6QA 3ZO7A 3BR9A 3PYGA 5HP1A 1SPBP 2V0NA 4PWDB 4F0HA 1KEKA 1SL2A 2DHXA 3SV3A 2P9GA 4WTYA 1OYDA 3AJ1A 4W98A 3KLEB 3U02A 2QLWA 1UWBB 3VAGA 2HQ3A 3GYNA 3A8JA 3LUYA 5FDLA 2YNIA 3M6UA 3ZZRA 3NBPA 2NQPA 3J7ZT 3I0SA 1CC7A 3MUTP 2H51B 4DG1B 4R0JA 2V8GA 3MXHP 3AQOA 3V5RA 2J5AA 4WF9Q 2IRUA 3AA9A 4MIBA 2ADBA 3WX8A 2ADCA 4GO7X 3HK2A 4DFPA 1U1OA 2QC3A 1S6QB 3LAKA 1KRPA 4OYWA 4G1QA 1RXOB 3NG8A 3I56S 2EFPA 3UCGA 4B3TJ 4KFBB 4LF6F 5BJRA 1MWYA 4X62F 3DXSX 3FK4A 3I87A 2KYZA 3VVUA 1S9EB 4N7TA 3QZ8A 2HK2A 4CP5A 2M8DB 1FVQA 5DQHA 3PG9A 2W25A 2E5IA 3J81j 2ZVIA 2HHXA 4WIQA 1RT7A 4UOHA 4ZA1A 1IM6A 2DRDA 1VJWA 2YQ0A 3MMAB 1FFGB 4NLQA 1LK5A 1U25A 5A0YB 3MR6A 3PW7A 3H25A 3RR7A 1NB7A 4C97A 4N76A 2E66A 1F2HA 1YJTA 1J27A 1I94F 1VRQC 3G2XA 2NYHA 3FRZA 2XGPA 2EXUA 1U45A 2VBXA 4WE1A 4Y28C 5KFMA 1RI7A 3N79A 2YKNA 4JI8F 3QO9A 4QW8A 4K7QA 4HHJA 3PV8A 2W2MP 3K8VA 2EFOA 2UZAA 2YQ1A 1GH8A 1IBCB 1X31C 1RWXB 1YK9A 1TFYA 5JVGQ 2B4OA 1RTHA 2K1RA 3H2LA 2D9PA 2OLWA 3G6XA 1PGZA 2C2EA 2YVSA 2HFOA 1KOOA 3B78A 1VQPS 3N4WA 2XS5A 1S4EA 4IR1A 3UI3A 3FSIA 1WTFA 5BYQA 1O51A 3M9NB 1HD0A 3UVJB 3M2VB 2GMJA 4F4KA 4ES2A 3DI6A 1PYTA 3PW0A 2PT0A 2XZWA 2GGPA 4ZOSA 1B0PA 1KSPA 3BF4A 2F4VF 2VHGA 1LXJA 4NZ7A 1CS4B 4ECWA 4KTQA 2V2QA 2V9KA 2R42A 4R5PB 2DIUA 1GFWB 2ZZTA 1RT5A 3WQPA 4RNHA 4RU9A 2VG5A 1U1LA 4YR2A 4WFYA 4EBEA 1IBKJ 4UF4A 3OW2R 1RBAA 5T7LB 1C0TA 1A0OB 2PDAA 2IJFA 5ETLA 4DF4A 4IFVB 3EVOA 3H90A 3CJQA 4KAIA 3UE2A 2XQCA 1I51B 4P72A 2N82B 3G86A 2JL9A 1CULB 2NS1B 5LSOA 3LOUA 3TUZC 2R7SA 3PKMA 1T9XA 1I1GA 2VOPA 1X4AA 1SIWB 4GVBA 4K50A 2WSCC 2QTWA 2ZH2A 2NXUA 4A8YA 2WHOA 2LEAA 1YQHA 4MKAA 2VZ9A 2LLZA 2H48B 2XMTA 4J9UE 1JLFB 3ZNJ1 3R2DJ 4OQJA 1D09B 1FJEB 2FZKB 4AL6A 1M0SA 3M8PB 4A8OA 2FJXA 3DGPB 2HHVA 4TYBA 3VGVA 3H8YA 3AAWB 2C2NA 1PCAA 2YKPA 1RWVB 3Q89A 4MFBA 2P6TA 2HHHF 1NK6A 4IG0B 2UV8G 3HHDA 4X66F 4ECRA 3CO0P 4HH1A 2XY5A 2WVDA 4R8UA 4DSLA 2BVZA 2C1EB 2EKNA 5HI7A 3C14B 1IR0A 4ED5A 2NLWA 1F9HA 5KFAA 4QWCA 4UY85 3ZZZA 1RHUB 4J9KA 1RT1B 3FFIB 3MMBB 1UZDA 3TJ9A 2RDIA 1L5UA 1BD6A 3JTNA 4X2BA 2FC9A 2HVZA 4ZVSB 3OUYB 1HNIA 4LSNA 2HRYA 5LSRA 2PA3A 1QM9A 4DL7A 3OLBA 3QIDA 2SXLA 5KFSA 2ZJPQ 3NXZA 1KC8T 4O0IA 2UXBJ 1K0TA 1LW0B 4MYTA 3QT7A 4P2FA 3TQ1A 4ZHRB 2R3VA 4DOZA 1TV6B 2PEBA 1RE1B 5C24A 1NHKL 2L3MA 4F4AA 1RTIB 4DX5A 1KLMA 2E5LJ 3RZAA 2GAHC 3M6WA 2XYHB 2CQIA 2CPEA 4ZLPA 4H4OA 3SZ2A 3V4MA 2DEIA 4PCQA 4RW4B 1Z2ZA 2LXFA 4FS2A 4FDFA 4ZPBA 2XMWA 3VAJA 1BY9A 1SUQA 3HF5A 2C3PA 4JI1J 3Q2TC 4LUBA 4CNZA 2VONA 2QYCA 1KONA 2FVRA 2R2SA 2DY9A 1PC4A 3E01B 3JSRA 3BS9A 3OR2A 1YWXA 4QPXA 2DH8A 1UEKA 1LFPA 4LRAA 3A8KA 4TLQA 3W8GA 2XHWA 2MXYA 2YWHA 4B9SA 2HHTA 3R6GB 3TEGA 1JLGB 1TP7A 4YN3B 4ZIWA 3L4BC 4X62J 4BHQA 1IM4A 4A4JA 2V4JB 4Q2MA 1X5SA 1VQSA 2VDIA 2CPJA 4DL0C 5JUMA 2ZWOA 4CM0A 1QDUB 4DL3A 4DX7A 3J7YI 1X4DA 3D0HE 3HD2A 2F5GA 2ZC3A 3EZUA 1HWJA 1LWFB 3OPKA 2CQ0A 4IDKA 1FKPA 1XR7A 1WHWA 5BXIA 1U6FA 3VAKA 4ZKAA 9ATCB 2BJEA 2VASA 3KK3B 2Z0GA 1LV5A 2FIUA 3I32A 1MROA 1IKVA 3ILLA 1NAQA 3N9UC 1FERA 2DHHA 2DR6A 2FPHX 2EW9A 2BDPA 4NMXA 2B8QA 4HT5A 1T05A 2B9YA 5JXSA 5DLFA 5CYJA 3DMJA 3MMJA 4NL5A 2KXNB 1FWKA 3HHLB 2RUGA 2XO7A 1SVDA 3N0VA 2I2YA 3OV7A 4OJHA 1HHTP 2ZH6A 1RAAB 5DZ6A 1N32F 3KLIB 2ZWPA 3NNAA 2YNFA 1RT4A 1UMJA 2XYPB 4AUKA 2IAJB 4KKOA 4K4YA 5E2QA 1OPZA 4ATNA 3AD8C 4QZVB 3UWTA 2VKZG 1S6PA 2W9BA 2RUSA 1S1WB 3JAMY 1W2BR 1XNRF 4ITSA 3BM7A 4QPTA 1E6YB 5F8IA 4Y00A 3A12A 1HBNB 1HR0F 2VOOA 1ZM4A 3R5BA 1R89A 1UVJA 1X7VA 4KT0C 6FD1A 1VC0A 4C8OA 1RU2A 3TARA 1S0MA 3IO1A 3HHLD 2H54B 2OP5A 3V81B 1RAHB 2DT9A 1HA1A 2EFGA 2F4VJ 1UFWA 1FX2A 1U0HB 3PO5A 1U8WA 1LQ9A 4TVAB 2HZVA 2OSRA 5BYRA 3C2PA 1H2VZ 2DHGA 1NZAA 4OX8A 1GXTA 3QPIA 2KHDA 2C2OB 1JIHA 3KK2B 3A3OB 4DQPA 4KO0B 3UN2A 4ZPCA 2VG6A 1S77D 4L3KA 4WFNQ 4HT7A 5ADZA 4AXJA 5L46A 4PQAA 1DLOB 3AXMA 3IRXB 2BX6A 3VHQA 2BMBA 3CW2C 4N8OA 1HI0P 3HDSA 3GPAA 4M5GA 3MEEB 4S0MA 2N4DA 2GVZB 3S8SA 3ULHA 1HBOB 3FC9A 3ZTPA 5DGBA 5L8RC 1KFDA 1NK7A 1D8ZA 4ICLB 2XMJA 2AZ3A 4JI6J 3RBZA 4RW7B 3DRRB 1FK9A 2IPOB 5HO4A 5I42B 1ELOA 1NK0A 4JV1A 4DUZJ 1WKJA 4ZVOB 4M5IA 4Y65A 4IO1A 1MLAA 1HWUA 4QWAA 2W8KA 4RL1A 1E6VB 3JTOA 4PUOB 2AEMA 3QRQA 1YLXA 1WF0A 1CQNA 1FWLA 4KGVB 2V94A 4DSFA 2HIYA 2G2YA 4MKBA 2HNZA 4DZ6A 3R27A 5KFBA 3U7JA 1U4BA 2HHHJ 4P71A 4O4GA 5BR8F 2LU1A 2OHDA 3DRPA 2V4QA 1WC3A 3HI9A 1WDTA 4LFBF 2CJ9A 3SSQA 1YRXA 5GAHI 3H5UA 2XG8A 1XJWB 2G0JA 2DR5A 1UETA 2IC3A 2HHWA 1FE4A 1UFLA 3CVKA 1MU2A 2C3YA 4RO0A 4U8VA 2HNYB 1WC6A 4JBCA 3KXDA 3JS9A 2VKRA 4WFXA 3GYGA 2CQ4A 1V3SA 3GTYX 2X1BA 3M05A 4ED1A 1KR4A 4DL5A 1UVIA 2CG8A 2V63A 4B3OA 2YKOA 3MURP 1WEYA 2EKYA 3RRHA 1Q4RA 3US5A 1YJUA 2V8PA 4U9RA 4DV5F 3KJFB 2BA9A 4GO5X 1WI8A 4OYOA 3LP1A 5KG7A 1ACMB 1RAFB 2JLGA 5DS7A 1SH3A 3DOLB 3HXMA 1DRZA 2OPRB 1TL7A 3LGNA 4DV7J 1WOPA 1A9NB 3EUNA 2YKMB 1YI2S 3HULA 2W2PP 5HVFA 2RJZA 2W2OP 2CQGA 3UN3A 3GJRB 5IWAJ 3JYTA 1PIEA 2B4VA 4AE5A 1ZETA 2VC0A 4TXSA 3PO4A 3DC2A 4DV4F 4FVMA 2QMUB 2FVQA 2DRAA 5LL6d 2OI2A 4NLXA 4DR2F 2RKIA 1K73T 5ETKA 3JSMB 3MD3A 4ED2A 3DOMA 4A8FA 4L73A 4KH0B 2XULA 1NK5A 1V3RA 2QJ3A 1RISA 2J0QD 3RU0A 4UOGA 2RRNA 2CPHA 2L9DA 2XYGB 2MZ1A 3DCAA 3HVWA 4AQYF 5HMZA 1D1UA 1DY3A 2BJ3A 2LA4A 2HK3A 4C3MA 1C0UB 3I0RA 1T9UA 1Y9OA 4W90B 4M1KA 5IM0A 3MDFA 2W4CA 5HL7Q 1HQUB 5HBMB 1B99A 7FDRA 4WKRA 2XLIA 2AJ2A 4E8UA 1APSA 3CIZA 2IMWP 2CWKA 1Q5YA 4LF7F 4GKKF 2HWTA 5KT6A 4PQUB 3O8WA 3OJSA 1OQ3A 3EXYA 4OX9F 5HQMA 2OD6A 3RB4A 4CLUA 1GTEA 4UTGA 3J7A1 2FGCA 1U2CA 4LMZA 4DLEA 2CNNB 3Q22A 1AT1B 4BWMA 4KJIA 1YGYA 2OPSB 3QGHA 2XMKA 3KG4A 4EFAC 5J2MA 1U02A 2XI3A 4DR3J 2G13A 3M30B 3BYPA 1CJKA 2C3OA 1NSQA 2O5DA 3CCJS 4Y0FA 3KHRA 3GG0A 5KFVA 2IM2A 4MIAA 3IAS9 4CLYA 1QUPA 4X4RA 1QY7A 3R1HA 1HR0J 3BEGB 1ZTWA 5K5MA 1HNZF 1JJ4A 1PC5A 2IRXA 4EUVA 3VR1A 2VBZA 4R25A 5KT5A 4EMDA 2MZRA 4RUCA 1S99A 5K8PA 5KFQA 1YJWS 3M8ZA 4JI3F 5LMNF 3BGOP 2XLKA 2AJ4A 3H59A 1HPZA 1C1BB 3M9MB 1FHTA 1S79A 5K8NA 1CJUB 1SIZA 1LWXA 2YX4A 2B3TB 5I3UB 4I64A 1UJ4A 2GQQA 3CD0A 1Y0HA 2X3GA 1P9QC 5IV4A 2J9CA 1BXNA 1HQEB 1N0VC 3CIMA 2OFGX 1IQTA 3QQCD 4U67Q 3MGJA 3OR1A 4MKYA 4M8LA 1SKUB 2BUNA 4WPAA 3SQOP 4YQWA 1X4BA 1U1QA 4NRTA 3QIPA 4N5SA 1IBLF 1X9WA 1RAIB 1WC5A 3GJQB 4QIWD 2M0GB 1WF1A 1RWKB 2IIHA 4LF2A 3SBMA 4USTA 2GVDA 2GMLA 1WG4A 5HROB 3PNIA 3Q8RB 3DLHA 1RTDB 1W26A 1UA0A 1H0HB 2HVIA 2FJWA 3HZEA 3NNCA 2MJUA 1GX5A 2MLYA 4WXWA 5E41A 3HO1A 1HI8A 2VG7B 1H74A 4MIWA 2DNGA 3FRYA 3KNGA 6AT1B 5KFXA 1PBUA 2Z58B 1R31A 4OV1A 4N47A 3M8QB 3DLGA 4OZNA 1X0FA 5KG2A 2C3UA 4K59A 4LREA 1IVZA 3W2VB 2RSQA 3NS5A 2CAJA 5HAOA 4K4ZA 3MOJB 1TL1A 2H9ZA 2Y1IA 4ECVA 1IQZA 2QLXA 3QSIA 1FNOA 3DGVA 3D7SB 1URNA 4WZMA 2BJ8A 2IA6A 4QYRA 4DV3F 3VGTA 1KQGB 4LRBA 2UUAJ 2IA0A 1NH7A 2AIRB 1N0UA 2ZZNA 1FTRA 4H4MA 1JJCB 1GMWD 2MKJA 2JH3A 1HBUB 3A13A 1Q78A 3NNHA 3PX6A 4P9SA 1VQ6S 3IAM9 3EJMA 1YJNS 1BQMB 2KFNA 1R8CA 4ZN3A 4DV6F 4RKUC 3BSAA 3FZBA 3V4IA 3R5JB 1B3TA 2GS8A 1JXEA 4Y3CA 2UUTA 4EO6A 4TY8B 2HKEA 1MMDA 4E2FB 3KTQA 4ZCIA 2MDAA 4URSA 2WOMB 1G6BA 1O5JA 4ZVRB 1ZS6A 4WU3A 3G6ES 4V19J 1QJHA 2M2BA 2AU0A 1TKZA 5H9EJ 2IFXA 2ZOGA 2CKWA 5RUBA 2VPZB 5CH7B 2RRBA 1U1PA 1Q8IA 1HBMB 4F04B 2HLTA 4HYKA 2RVJA 2FHOB 1U7LA 2X7IA 2XY7A 2QL9B 1AZSA 2H5IB 3BQ0A 3MM6A 4HHHA 3WZ0A 1FTCA 4I67A 2EEYA 2ASLA 4IKAA 2XMMA 5AT1B 3TOQA 5H9EK 2HBRB 1R27B 2BQ3A 2MLZA 2WONB 4AQYJ 2MQOA 1HMVB 1SKRA 3NGSA 4YHHF 1JLBB 2EWHA 4UOCA 4B3MF 3MEGA 4CH0S 3MMCB 4HKQA 4IQXA 5G4DA 1VK3A 4DFMA 4DSEA 1LOUA 5EX3A 4CCHA 2LVWA 4NXNJ 3K5NA 3DDKA 4QU6A 3RAXA 2VU5A 2DO4A 2MY8A 4DHVA 2PFDA 3ET6B 2B5JB 3QJLA 4DDFA 1EP4B 5EGYA 4J5OA 2POKA 2NSBA 4FYVB 4CYUA 3WHIA 5KG6A 3HT3A 4OX9J 2VFSA 3BKUA 4AXIA 1VLYA 3CPWR 4RUHA 3IBFB 2P6SA 5CCLA 3CJ8A 2XC9A 5KFLA 3TAPA 2ZH7A 1HFEL 4CO5A 1WJ9A 1LW2B 3RB6A 1RT2A 2W4DA 1S4FA 5EHHA 3MPDA 4NA2A 2ZEJA 3GLJA 1SJFA 3D0IE 1TUWA 4LIWA 4RW6B 4FF2A 4XIUA 4KYZA 3QT5A 4JV5F 2HLUA 2ZKUA 1NDKA 2CPYA 3VV2B 4DL6A 3W62A 3OTOJ 1VDHA 4O0NA 5K9FA 3B6BA 2F1FA 1UWBA 2CJXB 2ZHAA 3AXKA 2J0WA 3P5TL 3OL9A 3O44A 1LWEB 4CWBA 1T9YA 5L1IA 1SV5B 4C8KA 3M2RB 3CD6S 4FYXB 5K8MA 4FYYB 1RCXB 1UW9A 3U27A 4PXBA 3TVZA 1BMQB 4IYQA 3GCWP 4ANDA 3M8SA 1TKXA 4TQRA 2ZM6J 2HQCA 5HVGA 4CH7A 1FRKA 1NSPA 2EI5A 1SI9A 2AX0A 1QVFR 4CIOA 2B4PA 2EBEA 1KP6A 3GFZA 1Z1ZA 3BN4A 3N5FA 1U48A 4QWEA 5KAKA 4ZS6A 3MEDB 2I5JB 1UA1A 2HNDB 2J6TA 1S97A 3RUBL 2CIMA 5B0BA 3D66A 4JI5F 4ZCKA 1LWCB 1SJ3P 3NS7B 2MYFA 1TL4A 4PAAA 1KVKA 4DZDA 3MECB 1NKCA 2PO4A 1UWAA 4KV8B 4XO0A 2OELA 3CDUA 4ZVHA 3HHKA 5E0OA 2QO3A 1FXDA 4GKJF 4OJ1A 4EO8A 1XTZA 4ED6A 2BOAA 1JKHA 1H38A 3KLHA 2W8LA 3VWSA 5KG3A 5J2QA 1RJJA 4KY3A 4K2XA 4JI4F 2X51A 3OXFA 3W60A 2OPPB 1X8DA 3TUJC 5A8WA 4A46A 3CE8A 4CI0B 2XSJA 3FBEA 1HI1A 4NOHA 3CMAS 3LGMA 5EWFA 3GQCA 2L9NA 3D0GE 1H2TZ 4CH1A 1MSWD 1WHXA 2DGWA 2CJKA 2ZH5A 3RB0A 2DCUB 1RZMA 3FBCA 3UD5A 2LDYA 2Y1RI 4USVA 2JVRA 1N5VA 2RS8A 2VPWB 3CCQS 2HQFA 5GAGI 3FGVA 2FHJD 2QSWA 4J9NA 1K8AT 2E1CA 3AJ2A 5KOXA 3LF0A 4OYIA 4DV3J 1QSLA 3BKTA 1VQLS 3VGSA 2OEKA 3CWJA 3Q83A 1M90T 2BM0A 4L75A 1P27B 4C3KA 3FQLA 2DPJA 3GU0A 3N6MA 1CSJA 1V9OA 2V5HG 3CCSS 1J5OB 2GHVC 2R7OA 3G8TA 4ALZA 1S0NA 1P8GA 1WNEA 4RU2A 3H5SA 5T7LA 4YR0A 2WVCA 4DV6J 4A8MP 1RKIA 2NUUG 2GZOA 4C98A 2VV5A 1KTQA 1TKTB 1WC4A 1F5BA 1FRIA 4ANCA 3TVKA 3P6YC 1VQOS 4I2QB 1VYAA 1YSJA 5CZXA 1H3DA 3ILOA 4X4SA 3H2UB 1Q0NA 1RADB 3PW5A 1M1GA 1YRUA 2HAIA 1N5YB 4CDIA 5GAEU 2LXIA 1R8HA 2LDIA 3GMGA 3X3UA 2DNRA 2MHNA 1NM2A 3MD1A 2ROPA 1QAYA 3MAAA 5CD4A 1Q1KA 3BYRA 4HLBA 2M9KA 4RBUA 1O8BA 2AZ1A 1RCOB 1XNQF 3G82B 4I7FB 4NLGA 1SCJB 4J9VA 1FKOA 1X9MA 3M8PA 2Z30B 4ETZA 9RUBA 4C8NA 3PJWA 3H2VE 4Q44A 1S57A 5C25A 3PW2A 2G0CA 2BE9B 3W61A 4IH6A 4HTJA 1KWMA 1S49A 4USJC 1RWMB 1FX4A 1FNMA 4B3MJ 1Y5NB 1RHRB 4AD6A 1UJ6A 3I96A 3T5JA 2NZ4A 1YKWA 3LP2B 3M2UB 4KPYA 4ED0A 4DV2F 1FKAF 2YNGA 2XY6A 1QAIA 2QGFB 2VFRA 2AJ1A 4ID5A 3CXCR 2JLFA 3IGVA 4CLSA 2HVDA 3AB4B 2J8AA 2VUGA 1LW0A 4GMKA 4ZHRA 4PWWA 3NAHA 3RTVA 2B7CB 3DRSA 4WU2A 3LQVA 1V5VA 2Q6BA 3NWGA 1C4CA 3D6TB 1EAYC 4JV2A 3HCXA 2XZDB 2UU9F 1XQIA 2QE5A 1HD1A 3M8YA 2EFQA 5AJ3J 4JV5J 1CJTB 2WVFA 1R6YA 2ABYA 1FEHA 3LTOA 3J80U 5DETA 1PYSB 1RT6B 2LCWA 5HMXA 1R3NA 3W1YC 5KFTA 5GMDA 3HVTB 1WI6A 2UXCJ 4P75A 1QLNA 4ILMA 3H4BA 1S1XB 1SJ4P 5T14A 5F8LA 2CDRB 3AOBA 3U1MA 5AE1A 3P45B 3TZXA 2DNLA 1N34J 1R8PA 3V6DB 3NGTA 4CO4A 3ETMA 2BACA 1NKBA 3NCQA 4TLRA 4F7VA 2XSFA 4ER8A 1WKLA 3HM9A 3T9ZA 1YBAA 4NI2A 1S1TA 3W2WB 5D8HB 1BC6A 4K4WA 3K7RA 5HP1B 2MB0B 1YJVA 4NLOA 4M5DA 2FYXA 3GFYA 3W9IA 2OPQB 3ZZUA 3SSSA 3LALA 3E3XA 4M5MA 3CT9A 2HEKA 2R7XA 2G4BA 1H7XA 5HATA 3SCKE 2YNIB 2IJRA 3NMRA 2EVZA 3NBPB 4NCGA 3I5BA 1XBWA 3Q86A 3UNYA 3I0SB 3LANA 2XNQA 2JFDA 5CCMA 2ATLA 4KGMA 3ITHA 2O1PA 4OHZA 4WXOA 1JLEA 4JI0J 4ECSA 5ETMA 4NYPA 4LRFA 4DR4J 1QUVA 3ZXWA 3TZYA 4B9NA 4GKJJ 2Y0BB 4F02A 1U6ZA 4G1QB 1Y00A 2IVMA 2Z4PA 1RT3A 3KJVB 2IM1A 3IS9A 5D15A 1S1UB 4DUTA 4N8NA 5D0HA 1WELA 2RNEA 3VQSA 4DF8A 3NGUA 2Q1LA 5LMUF 2WBMA 3GR1A 4FPRA 3GE9A 2RIJA 4LFAJ 1CC8A 4FXVA 1MWQA 5E3AA 1SC4B 2ZD1A 1LKZA 5M2RA 1PAUB 2W4PA 1RT7B 1OJ4A 4OI2A 4FKXA 2OSQA 4RW9A 1AUSL 3H20A 4BBYA 3M8RA 3PR5B 3PEHA 2K7KA 3GJSB 4YUDA 5EDWA 2IYIA 1DZ5A 3MPWA 3MR5A 4KR0B 3DOKA 3MWBA 2IM0A 4A8XA 3QATA 2FHJA 3BGUA 1T3NA 3B82A 2E7VA 4FS1A 3V81A 5C42A 3IP0A 1Q79A 4ZLNA 4J90A 1NPKA 4WE1B 1DAXA 4USUA 2YKNB 3HJVA 4LFCF 2BKNA 3NOCA 1EZZB 4RR5A 3ZNUA 4RPFA 4N56A 3CDWA 4OMFG 5DJBA 3A3NB 3DLEA 4JYAJ 1TL3A 1DARA 4ECZA 4OZLA 3GB0A 2VQFJ 1IJEB 2D69A 1RTHB 2K1RB 4IH7A 4CO1A 1RDRA 2EFNA 3K0JA 2ZKTA 2QLBB 3KUHA 1RYRA 4NLWA 4O44B 3TA1A 5KG4A 5LJ3Y 1DLOA 1HL6A 5BYSA 3IRXA 5FIIA 4C0OC 3IA0A 4WJBA 4OZJA 1WHYA 2FJDB 3MEEA 4WBFA 2KHCA 3DI6B 3W3SA 2WTFA 4CO2A 2GGPB 1VS3A 1QE1B 2ZNZA 2BBEA 2XMAA 4ED4A 5KOWA 1VJQA 1Z2LA 3G4SS 5E7OB 2NSCA 2IBOA 4EGLA 3EZOA 2Y8YA 2W7PA 1JLCB 3WBZA 3L7PA 2VQEJ 2XS7A 1RT5B 2FHMA 3BPSP 2BYCA 4RWXA 2VG5B 3CJRA 4KHPJ 4DBQA 4ZVTB 5F8HA 3QFWA 3R2CJ 1NUEA 1RABB 4RBTA 3KYLA 1WEXA 1NNDA 4JV0A 1C0TB 2J9DE 2FZGB 3DFEA 1D8YA 2C2KB 3UCUP 4K0KJ 5JMNA 5CYMB 4PEOA 3PCOB 3CJ4A 3CTRA 3PIPQ 5IS2A 2VF3A 5HMYA 4DU8A 2VJUA 3MEKA 3JQMA 5F3TA 1VQ7S 1IBMJ 2CPXA 3O3LA 3CSKA 3AD7C 2KRBA 4GVBB 8AT1B 2CXEA 2ZOMA 1VOMA 5HLFA 4NE9C 3DXBA 4DS5A 2L48A 4KGZB 3UDLA 1FRJA 2ZDOA 3GIMA 4KBIA 1SQGA 4O3OA 3FCWA 1FDDA 1ZAWA 2BV3A 2I0XA 4NZ6A 2FB0A 5KFNA 1HNXF 1JNRB 2KFZA 4NA3A 4GC7A 4EYIB 3L7OA 1C2PA 1H72C 4PG4A 3Q8QB 4DFKA 3EZ5A 4DR5F 3FSXA 2ZHOA 5DDQC 3THPA 2YWKA 1IKXA 1T95A 4MFBB 3CMES 2UU9J 3TW0A 1X4GA 2HBZB 2KKHA 2ZJRQ 2HS3A 4FBUA 5D0RA 4M5JA 3QRRA 4DR1J 3I5CA 3VZHA 4J9MA 1M5SA 1NJZA 1KQSR 2AP6A 2V2VA 3TEHB 2ZBCA 2BJ1A 4YOEA 4CTAA 4QQBA 1U2RA 1PJ7A 3QT6A 3UCZP 2YKMA 3W5YA 1MN9A 2JEIA 4DR7F 1HNIB 4LSNB 3CULA 3MUVP 2VD3A 4NXMF 3KLGA 4UW2A 3PHTA 1J5EF 1RHMB 4LF4F 2BW7A 5SUHA 1B7FA 3PKYA 2ROEA 4BS2A 4ZJOA 5H1SV 1IR1A 4UQGA 5C24B 1S9GB 4B02A 2D3UA 3DYAA 1KLMB 2FC8A 3SYZA 2A2DA 5A76A 3GV5B 4F8RA 1HYSA 2XHCA 4H4OB 5E5NA 1VQ4S 3A3PB 3HKZD 1W25A 3I9V9 2MQPA 2D3ZA 3U1LA 1EKRA 2NXCA 5A8KA 4LRDA 3K58A 5L1JA 3MTKA 1V3ZA 3ZFVA 1RHQB 4OHVA 1SUQB 3PFOA 1Q7LB 3EWGA 3RRGA 5GADU 2D41A 2RT3A 3MM8A 2Q79A 4N77A 2JZ5A 1BWVA 1OSCA 3PIOQ 4C2MA 1WTBA 1NJWA 1QTMA 2F9JA 4PXCA 3OR2B 3NY0A 2YWGA 3M9OB 2DVIA 3HHNB 2IYGA 4LF8J 4M5KA 3VALA 5KFEA 1L3SA 4F4ZA 3MUMP 4UUWA 1GK8A 1PILA 2QRRA 2JC0A 5LMUJ 2CVEA 2YX1A 2MPUA 3DHXA 3G87A 3OTEA 3W64A 2CZ4A 3NP5A 1T7PA 3CJTA 3CMQA 4IDKB 1FKPB 1Z4UA 1S48A 3DLKA 4W92B 1D0EA 4P7VA 2ASDA 2J8SA 1GEHA 3OJUA 4ES3A 5CZVA 3QJJA 1MROB 3SIPB 1IKVB 4Q8FA 4KGKA 1TVRA 2GO8A 3C15A 4J9RA 3CCMS 2JWNA 4Y34A 2ZC4A 3EGNA 3NL0A 1RWWB 2HFZA 4FF3A 1CVJA 2RU9A 3F44A 5CD4H 3DMJB 4YY3F 1GMUA 4ECXA 2HFVA 2DNNA 2F7VA 2RMLA 3NLCA 2QLJB 1UPPA 1X4EA 3EMTA 4DV1J 1YBTA 1GXLA 2KN4A 3Q24A 1BLUA 3MTJA 2BE7D 1RT4B 3BREA 3UNGC 3OSNA 4KKOB 2R7UA 1U1RA 2PD1A 2BE2A 4LRCA 4EYHB 3CC7S 4NRUA 1S6PB 3R5GA 1BQXA 1D9AA 2W9BB 1U2FA 5M2UA 4RUAA 3KKFA 3MM9A 1EJ7L 4C4WA 1ZM3A 4O3QA 2C2MB 3EM1A 1TAUA 2AV5A 2WSEC 1HQEA 3AHPA 3OLAA 4HDHA 4PG8A 4ZCLA 1H7WA 2J6UA 3G8SA 3EPGA 1VR6A 1LK7A 2VB6A 1SB6A 2CRLA 4PABA 3K17A 3ENVA 4A8SA 1N4LA 2EPIA 2JVOA 3NMAA 3MCOA 1NK8A 5E3RA 3WC2A 2VL1A 2XS2A 1IKWA 5HROA 4IUFA 3ISND 4C11A 2RE1A 2X3DA 4NLRA 3OL7A 2UUCF 1I5OB 2FLNA 2VG6B 4OZ3A 2YY3A 5F8JA 2GIQA 3W66A 2WK4A 1TUGB 1KQFB 2E7XA 3Q8PB 3TI0A 4MKVA 1R7IA 5ETQA 4LR9A 5A6PA 1F6TA 2JJ4D 5B7WA 4B3RJ 2E44A 4K4SA 2UP1A 2OEMA 1MNEA 4Y2CA 3HX9A 1FK9B 1TK5A 3OXGA 5L1KA 1U47A 4ZLLA 4H4KC 1KOHA 2CNKB 4LQ9A 5K8OA 4X65F 1F60B 1F1BB 1DQ9A 4L74A 2OD4A 3OQ2A 1VIOA 2W1BA 5D0EA 5J1PA 2QMXA 2AJFE 5ETPA 4IOBA 3TR5A 2IBKA 2ZBIA 1YRTA 3IR6B 2NZCA 3MAQA 4YMEA 3CO9A 1WDDA 5F9NA 4ZN1A 4J9LA 2OTJS 3P4UB 2CPFA 1NDLA 4O4GB 4MT1A 4ZVGA 4ZDNA 4DV0F 4QJVA 1XMBA 2XZTB 1TK0A 3DRPB 1N33J 4IRDA 4PR6A 1BQMA 2KDOA 2W9CA 3RBEA 1N54B 2LEPA 4Z37A 2C22A 1N5QA 4DPUA 2IC3B 2QZ8A 4EK2A 4NLTA 1UEVA 4CO0A 3AODA 2YTCA 1MU2B 3VAIA 3OSPA 1S6UA 1ZOTA 1M1KT 4PZVA 3QGPA 3S01A 3R7NB 4KHMA 4NXMJ 1J5EJ 3CCTA 3IFEA 4LF4J 2YNHB 2ZZMA 2XWYA 2MQNA 1YITS 4LF1A 4QIVA 1SH2A 3A8EA 2UXDF 1IKYA 4HR2A 3W8PA 2F40A 3LGHA 3J81U 2KZMA 4QW9A 2HWIA 2FVCA 4B3OB 3VTIA 5DQGA 2V2KA 2HMIA 3VAFA 1FDNA 2JOQA 3LP1B 2DNPA 1FRMA 4WP3A 3C3LA 1K44A 1ZAVA 2AD9A 1U49A 4Z7CA 4OZ0A 2MTLA 1DBDA 2E7WA 3BGRA 2M88A 2H5JB 1TL7B 4KSEB 3KDNA 2O3DA 1KFSA 5K14A 1WOOA 4LBPA 1RQ0A 2KT3A 1YTYA 3UW1A 2FGOA 4DUYJ 2IVYA 4NASA 2J0XA 2LMIA 2MSTA 2RQCA 4JI7F 3AH6A 3BH7B 3OTBA 2A0FB 2B9XA 1NU4A 1FDAA 2M4MA 1AYEA 1L3TA 4P52A 3HFKA 4ECUA 4X64F 3KLFB 2GIFA 4PXEA 3K5OA 1NSAA 1WC0A 2RKIB 1IN0A 1UP1A 2LECA 4I2PA 3DOMB 2RB7A 2MZQA 2HQDA 2R8KA 2V4RA 1M1HA 3R97A 2CZVC 5HK4A 4NLVA 2C2DA 3LPYA 2GC8A 3V6KA 5LJ5Y 3UFCX 2CA9A 2HS4A 2CQ3A 2BANB 4QIGA 4NA1A 5IM0B 1VK8A 2W7AA 1WC1A 2F65A 2FHKA 5J1EA 3TZWA 4DX6A 2CNOB 3SXLA 1SV5A 4MTPA 5GMKa 3M2RA 4LF6J 4BLGA 1ZZNA 2LQBA 2V8HA 4ZMMA 1RBOB 4HACA 2GHWA 4CLLA 4FN5A 2CQ2A 4AT1B 3BV8A 4FP9A 3IR7B 4E98A 2Y9HA 3D3BJ 2GA7A 1JK9B 5IQ6A 4G65A 3P96A 4NYOA 4J7CA 4P7TA 3C66A 3GR0A 4TY9A 5L9XA 2CQ1A 1RK8A 2RQKA 2AYEA 3RRKA 2NCKL 2E5GA 3I31A 2F4FA 1CJKB 3MPUB 1NBEB 3WIVA 3SQGA 1I94J 2NXNA 5L1LA 5KT2A 2MHEA 1DQAA 3K2YA 3M8WA 3PACA 4DSIA 4O3SA 2DYAA 1Y11A 1YBUA 2DCLA 1JLQA 2YX7A 2KJWA 4JI8J 3HT0A 4KE5A 1QSYA 1XWLA 2EG2A 2RQMA 4K4TA 3KHLA 3MOZA 3ZZYA 1UFKA 2F63A 2ZUGA 1JXLA 1DTTA 4ZVUB 2XMUA 1YZ7A 1HPZB 4FYDA 4A48A 4HVZA 1YJ7A 2HWHA 2ZHBA 3L3CA 3J80Y 4DS4A 4B3TF 1FDBA 1X4FA 2GCFA 3LH2S 5AE3A 4OYPA 1DTQA 3D28A 3MPVA 3E2EA 1OY6A 1D9DA 2KM8B 1NPPA 2AT1B 1FWPA 4EWTA 4RNOA 1G4CA 2E1PA 2MEWA 2DHAA 3KDOA 2CFXA 2JFKA 4FF4A 3OR1B 1Q53A 1RTJB 2KG1A 3NAIA 2WB4A 3QIPB 5IT4A 1XR5A 3AOCA 2AQ4A 4KH1B 2JX2A 1J2VA 5IC4B 3MM5A 1TTHB 2GVDB 3MR2A 2KTQA 1RWUA 4LSLB 1FJGF 1BQNA 3PYDA 1NLKL 1YDLA 3J7YU 4E0DA 3BKFA 2CJYB 1F9FA 1HWLA 2IRYA 3NKYA 1NDPA 3LP0A 2GX8A 3C16A 4I6YA 5KFYA 2CQCA 4V1Ak 4X4QA 4LR7A 5GVQA 2ZE2B 2GQ2A 1HIYA 1PAEX 2QA1A 5HJYA 5DRKA 2QIFA 1HWKA 2FUG9 4JI2F 1X4HA 3BBBA 3DLGB 3FJ2A 2I9SA 2UVRA 5IFMA 1C1CB 3ELHA 8ATCB 1S7HA 3GV8B 4RW8B 5F3ZA 4NPOA 1B4SA 1NZ8A 3KHHA 1DFDA 1TL1B 3NWRA 3F41A 3C8YA 2DEJA 2Z2LA 5D3GB 4OYMA 1K1SA 3H42A 2OKQA 2WCXA 5C7PA 5J2NA 3L9ZA 2AF6A 3TQEA 3GCXP 4DSJA 3CEDA 4ECYA 2EFVA 4BC9A 2ZH1A 3F0NA 2V6AA 1H2UX 4X66J 2XEXA 5FLXU 3C46A 2UXDJ 4F4YA 4FZVA 2J76E 3EYZA 2E5HA 4NLUA 3IGNA 2WBRA 5J1NA 4CLZA 5DG8A 4ED8A 3OBIA 2OJ3A 4DQRA 2R2TA 4LBHA 2QA4G 2GAGC 1URRA 1IBKF 3PR4A 2CUYA 2N3LA 2V67A 4KHRA 2WW8A 3V4IB 4PXDA 4ENOA 2MKHA 1EKSA 2R9LA 1JLAA 3DNCA 4B9TA 1U09A 4PWUA 2DH9A 4I56A 5JJBA 3C6UA 4DPXA 2CZ9A 1U1MA 2CVIA 4JI7J 4MYUA 2NXJA 4O3RA 4TU8A 4B9UA 1TKZB 3LAMA 3IC1A 2LQ9A 4YS2A 1EX8A 2DKOB 4IO9Q 3WC0A 3T6BA 3MPYA 1T9VA 4FBTA 1DQ8A 2JC1A 5B0CA 2I8EA 3QGGA 4X4PA 4ELVA 3FEZA 3G6YA 4WKYA 3BZQA 3CB4A 1NKEA 1KBRA 2CDQA 1S76D 4QR1A 2HQGA 3MM6B 3TO8A 2H4YB 3TAMA 1ROFA 4MAKA 2KG0A 5ETNA 2LQ8A 3GG1A 3D68A 1IJFB 4J37A 1N88A 4WCEQ 4LQ3A 1AW0A 4DLGA 1H98A 3D6MB 1CG2A 3DU6A 2L41A 3BN7A 2YKAA 4K4XA 5CXTA 4ZP9A 3HVAA 2AEJA 3PYFA 1I6JA 4V19X 4CYUB 1T03A 3MZIA 5GMEA 3EDQB 3PM9A 3B54A 1OY8A 3SDEB 1R0AA 2MY7A 1HWIA 2UXBF 2HRTA 4HDGA 3NCPA 2G2OA 2GHPA 2VA3A 5ITHA 3UD4P 3MR7A 3AA8A 1DURA 3CNQP 4RNFA 1UZHA 1RT2B 3ADAC 2JDJA 1WHVA 5GAHU 2QMWA 2PEHA 4OI6A 1F5CA 2XGQA 2KVQE 2EK1A 4L6V3 4DPOA 1UPMB 3KJNB 1CPZA 2E5LF 2ZH9A 1KHVA 3O5TB 4UY8T 3UDEA 1OPIA 2KL8A 4U7CA 2V69A 3QLHA 2AGOA 1A7GE 2XM3A 3CJ3A 5A2QU 4LR8A 2KFYA 2OPQA 3PX0A 2HIQA 5F0WA 2KT2A 3PDNA 3G96A 1S1VA 4BC7A 3CCES 4JI1F 2RRAA 5DDRC 4DQQA 3L09A 5I3PA 3UD3P 2ZITA 1N32J 2DTJA 2QG9B 3H40A 1TAQA 5KFCA 1VHFA 1YVFA 1SXLA 4LVOP 5IZHA 3DRYA 1PG5B 3RBXA 2EC0A 1TKXB 1XNRJ 3KJVA 5B08A 1S1UA 3BH6B 4HI2A 4QYZJ 4C6AA 1RSCA 5CHCB 2R8HA 5J2PA 1NHUA 3QWPA 2HFNA 5LM7E 2LXUA 1KVIA 3T1YF 2VFUA 2J7KA 3RAQA 4WP8A 2DR8A 3GWCA 5A8RA 3M1VB 2MKKA 2QT7A 1MW7A 3MCSA 4NLPA 1UVLA 3VQTA 4OYBA 2R4FA 1GQEA 4G1IA 4A8KA 2CQDA 4QYZK 1JQGA 1WD6A 1XERA 2LEBA 5KFHA 4IFYA 2D3O1 1N36F 1W7WA 2LKZA 2W01A 4HL9A 1FJGJ 1RU1A 3PRDA 2DNOA 4WFBQ 1SH0A 1JKHB 2VPYB 3KLHB 1T11A 2G1HA 5J2QB 3ISZA 2PA8D 3LW5C 4JP8A 3KUEA 3WDOA 1XC9A 3BDPA 1VQ5S 3KK1A 4JI2J 2DK2A 5A8WB 2Y8WA 2XSJB 2DR9A 2NUHA 4DEZA 4UZBA 4F0MA 4ES1A 1QAXA 3KJQB 3CJKB 1FD2A 4O44A 2FJAB 3QWUA 4DPYA 3MF5A 2OO4A 3W9HA 4KIAA 4IRKA 4D3GA 2FDNA 3X1LB 1Y5IB 4I4BA 4OLOA 2H3EB 2M7SA 4J9QA 1QE1A 1VC5A 2MJNA 1GXUA 3H98A 3DHWC 2DGOA 2RHSB 4FF1A 3NEKA 4U6PA 4FNHA 1EQMA 2XLJA 1VMBA 2PMHA 1YJRA 3T5KA 5BR8J 5DGAA 1YX2A 4QIFA 1JLCA 3N6NA 4URQU 4M63A 3I9ZA 4LFBJ 4OIXA 3IBWA 2DNMA 4FPIA 2K8GA 2AX1A 2A2CA 2B6AA 4F3MA 2WVBA 2F8HA 3KMSA 4OX7A 4IG3A 1LFWA 1OY9A 5HVHA 2WAQD 2UUBF 5CYMA 2C2ZB 2Q43A 2RHQB 4HI1A 1PBAA 2PI4A 1VRUA 1B0VA 5D4LA 4GVLA 5KTQA 4L76A 5EN1A 5C5JA 2U2FA 2BJDA 5MAOA 4DN9A 1NRKA 4JI6F 4CM2A 2DNKA 3G8QA 4TKTA 4DUZF 1ZPVA 3MAAB 1Q86T 2ZVSA 3C6TA 2Z56B 3CJ2A 4UZCA 1IR2A 4DV5J 3TX8A 3CCUS 3DM2B 1N52B 3SCIE 1FKOB 1SJRA 1KNZA 4DPTA 3NRBA 4F3QA 3D67A 4PPZA 3RGIA 4Q2LA 5C25B 1VQKS 2ERRA 1OWXA 3T1AA 3T19A 2A6MA 3FCVA 5EUHA 5U47A 1F0XA 4UT4A 3QAUA 1VRTA 3IWLA 4F3OA 4USKA 3MM7A 4LF5F 3AY0A 2F9DA 3BQ1A 5KT3A 1WG1A 3TVYA 2HURA 3A1YG 2Z2ZA 1T9TA 4DV4J 2JEGA 3FVYA 5DZ7A 2MZSA 2BKPA 3ZZPA 1MG7A 3SFUA 4QU7A 4DR2J 2YNGB 1XN9A 5F9LA 2W7OA 3R1LA 5HMWA 3SV4A 2QV6A 2J7UA 3UN5A 3GSIA 1HHSA 2OIHA 4RLEA 4EU0A 4ZPWR 4K2JA 1CLFA 4ID5B 2ZJQQ 3K59A 3RR8A 5G0RA 4WYWA 2NREA 1M5HA 2QA2A 1R8AA 3EDRB 3DRSB 1VISA 5KFGA 4PG7A 3D5MA 3IBCB 4B08A 4K5SA 2GV1A 1S0OA 1S9GA 5E3QA 1Q7YT 3GJTB 2A10A 4NZ0A 4TU7A 1W2IA 3BSNA 2A3JA 3QMQA 2PGCA 3ZC4A 4H54A 3NOGA 4ZCMA 1HNVA 2FY1A 3IG1A 4LF7J 3LWLA 4GKKJ 1CEZA 3GIKA 1OYEA 2K7JA 4F0KA 3D1OA 4Q0BA 2VBYA 4C9DA 4DV7F 2RF2A 2ZFHA 3HFVA 2J7WA 4DPWA 5B0AA 2DGQA 2DGXA 3G9CA 3PJ9A 5IWAF 1RWOB 4NCBA 3BB5A 3K8WA 1NDCA 4TNOA 4O23A 1GMVA 2BJ7A 4G1PA 3N6LA 1BGXT 2WW4A 2PIIA 1FXRA 1KS2A 4OV6A 5LXRA 1P1LA 1MWZA 5LXYA 2HHPA 2ZNYA 1WACA 2C28A 2KO1A 3W5XA 4PWDA 3OD2A 1RLCL 3KOAA 5L9NA 4NI2B 1S1TB 3CJSA 3KLEA 1EIYB 4ZPVR 3IWXA 1T9WA 4C8MA 2QEXS 1NK9A 5DM7Q 1HNZJ 2MSSA 3T1YJ 1FCAA 2ACMA 2P9EA 4M5DB 5KFUA 2OGUA 1MMNA 4EZ9A 2GFFA 2MKSA 2FVSA 4XK8C 1S12A 4DG1A 3MI7X 3D4JA 2GW8A 4NCGB 2CPDA 1MN7A 1G7CB 4WWSA 5I4MA 4JI3J 5LMNJ 2OTLS 2KU7A 1OS5A 3P49B 4F25A 3ITHB 4OI4A 1S6QA 2EG1A 1JLEB 1N36J 3KNAA 3J81Y 1FRLA 4USWA 2R8JA 4KFBA 2MKIA 1VGYA 3M32B 2CQHA 1S9EA 1ZPWX 2CQBA 2KXHA 3ILIA 1CBKA 3HSGA 1RT3B 3IS9B 2AGQA 3TUPA 4OL8A 1ZA2B 2JEFA 1ZTTA 4CLFA 6FDRA 2ROGA 1ZYQA 3MMAA 1LEOA 3B4MA 3VCDA 2ZD1B 2J0SD 4DR3F 2ZH8A 5A0YA 1IBLJ 5AXLA 2R7QA 4RW9B 1VCTA 2UUWA 3QNWB 4NYZA 3WX4A 1JJ2R 2GIRA 2Z2YB 3ILJA 3H4DA 1KTVA 1FJ7A 3CC4S 1F9EB 1HNWF 2RQ4A 4ILLA 3JQJA 2ZH4A 3DOKB 2O01C 1YHQS 3G6VA 5FD1A 3ZZ0A 3CCVS 2HBQB 1TQLA 2AMCB 3FUYA 4F26A 3B8HA 2FQQB 2V8VA 3RW6A 2VA2A 5C42B 2Y3YA 2NR0A 7FD1A 3THVA 3EVWA 2DITA 1PJ6A 1XMOF 2QSFA 1PSDA 3QGIA 3PXGa 3RG6A 3BDEA
chains in the Genus database with same CATH topology
2DBBA 2COLA 3KK1B 5B0DA 1X9WA 4EEYA 3CF5Q 4Q43A 3SCJE 2BOPA 5E3RA 4QIWD 3WC2A 1VQYA 1S6OA 2VL1A 4C7QA 4ECQA 2XS2A 1IKWA 5HROA 2M0GB 1WF1A 3HKWA 4IUFA 3DLEB 1TL3B 3HP6A 2C3MA 4R0EA 2UV8A 3ISND 5CYQA 4C11A 5JVHQ 2RE1A 3HJFA 2PN6A 3E51A 3RAMA 2R2UA 4NLRA 4P2SA 2C42A 4OX6A 2GMLA 1WG4A 5HROB 1TK8A 3PNIA 3Q8RB 4N41A 2B4UA 3DLHA 1EETA 1RTDB 5CYQB 3OL7A 4X4TA 3H5YA 4DL2A 1UA0A 1U6BA 3S6EA 1H0HB 3M2VA 2AYBA 2UUCF 5KG5A 3KWMA 2FLNA 1Q8BA 2VG6B 2XB2D 4G3IA 2HVIA 2RDJA 1NJYA 2YY3A 4ZPTR 3TNVA 4OFZA 5F8JA 2FJWA 1EETB 4ELUA 3HZEA 4LVNP 3NNCA 2GIQA 4PPDA 4YFUA 4YEAA 3BO4A 2MJUA 2WK4A 2YH1A 1GX5A 3AB2B 4Y2AA 5D4PA 1KQFB 4WXWA 2E7XA 3Q8PB 3TI0A 3FQKA 5E41A 3EX7B 4CZCA 1AUDA 3HO1A 1HI8A 1GTHA 1R43A 2VG7B 4MIWA 1R7IA 1TKDA 2DNGA 5IXUA 3FRYA 1FO1A 3KNGA 1FD8A 5A6PA 3OHAA 5AXKA 2JJ4D 5KFXA 5B7WA 3DLBA 5E3PA 1R31A 4OV1A 2E44A 4N47A 1J5OA 3GV7B 3M8QB 4K4SA 4NMLA 3DLGA 2G9OA 2APOA 4OI3A 3OFEA 4OZNA 4R5PA 1X0FA 2UP1A 5KG2A 3K57A 2C3UA 4K59A 2R2RA 4DQSA 1MNEA 4PG5A 4Y2CA 4J9PA 1GAOA 3W2VB 3HX9A 2KYXA 2H5EA 1FK9B 2RSQA 2MGZA 4I6WA 4TN2A 3OXGA 1TK5A 3NS5A 4B9MA 5L1KA 3P3DA 3UPFA 1U47A 4K4ZA 3MOJB 2HVHA 4L3NA 1TL1A 3KLVA 1NK4A 1TKTA 4FVCA 4H4KC 1KOHA 3POTA 4LQ9A 1SKWA 3ZZTA 2MGZB 2H9ZA 1F2GA 2VFVA 5K8OA 4X65F 2F8EX 2Y1IA 1F60B 2DB1A 4ECVA 3PY8A 2B6AB 1GT8A 4I2QA 1B64A 5AXMA 1DQ9A 3GFHA 3RYLA 2OD4A 3OQ2A 3BO2A 4ZVEA 1VIOA 1IQZA 5J1PA 2QLXA 2QMXA 4RNMA 4IFVA 3POTB 3NGKA 1FNOA 2DO0A 3I6PA 2AJFE 4IG3B 2CJAA 3CCLS 4IOBA 3TR5A 2YWFA 2IBKA 4I69A 2ZBIA 1YRTA 1N5YA 2YWEA 3IR6B 1URNA 1VIXA 3G71S 3MAQA 4WZMA 4YMEA 1Y3JA 3CO9A 5F9NA 1K9MT 2IA6A 4FXDA 2E1RA 5FJ4A 5KT4A 3R5CA 4QYRA 3O6QA 3UDCA 4DV3F 4J9LA 1VRUB 4J9OA 2OTJS 1GNKA 1KQGB 2CPFA 2M70A 1Q8LA 3D1HA 4O4GB 4B3RF 4ZVGA 4ZDNA 1RKJA 4DV0F 4QJVA 1S9FA 2R7TA 2IA0A 1NH7A 4F67A 5F8NA 5I3QA 5GADI 1XMBA 3KG0A 4K5RA 1N0UA 2ZZNA 1FTRA 4H4MA 2PI5A 1TK0A 3DRPB 3BJYA 5KFJA 5KG0A 1WEZA 2JH3A 2MKJA 4IRDA 1HBUB 4DSKA 1JWWA 4I7FA 4PR6A 3AQPA 1JLFA 1BQMA 4Q8EA 2IHR1 2KDOA 2W9CA 3RBEA 1XK8A 1REVA 4BCAA 5HLFB 4H4MB 1Q78A 3NNHA 2Z2MA 1N54B 3C6TB 4Y2IA 3EGWB 3T5LA 2LEPA 3PX6A 2UVWA 2RH3A 4Z37A 2KXFA 2E9RX 2PSZA 1VQ6S 4UQTA 4IRCA 3IAM9 2C22A 1N5QA 4USHA 1YJNS 1BQMB 2KFNA 2DNQA 4X4OA 2IC3B 1REVB 4RNNA 1R8CA 5KFWA 2QZ8A 3CCRS 4DV6F 4NLTA 4RKUC 1UEVA 4CO0A 3BSAA 3FZBA 2LYVA 2J9EA 3VAMA 3DGPA 2HPUA 3V4IA 4QR2A 3TUIC 2YTCA 1MU2B 3Q8SB 3VAIA 2D1CA 3OSPA 1JXEA 1VQ9S 1S6UA 1ZOTA 4Y3CA 1M1KT 1H6KX 2YNHA 4NLSA 4X4VA 3QGPA 2UUTA 3S01A 4EO6A 4KHMA 3T5HA 3DU5A 4TY8B 3SCLE 5IQQA 1MMDA 4DX8H 2AYGA 3KTQA 4ZCIA 1Q16B 4UUXA 3RB3A 2VH7A 2DPIA 3CCTA 2MDAA 3IFEA 4IG0A 1HARA 2YNHB 3NGDA 2ZH3A 1T8EA 2ZZMA 4URSA 2WOMB 3TANA 2XWYA 3UD3P 2KZZA 1G6BA 1O5JA 4LT6A 2MQNA 5KFFA 3CD7A 1FA0A 1YITS 2QA4S 4ZPAA 1X9SA 4WU3A 5T41A 3G6ES 1T94A 2CYYA 1KVJA 1IKXB 2N4CA 4AFFA 2X1AA 4V19J 3T3FA 1QJHA 4QIVA 2UUAF 4YB1P 1VBXA 1SH2A 2M2BA 2AU0A 3LP2A 3M6VA 1TKZA 4YB5A 3M2UA 5H9EJ 4XAKA 2IFXA 3A8EA 1YJ9S 1KLNA 2ZOGA 2MMYA 2UXDF 1IKYA 2CKWA 3ENQA 4P6QA 1VRTB 4K4VA 1N33F 2F40A 1KQKA 2VPZB 4OJ3A 1FT8A 3D54A 5CH7B 2KZMA 2RRBA 3MM7B 3BQ2A 1U1PA 4QW9A 1Q8IA 2HWIA 2FVCA 1HBMB 4B3OB 2OH2A 5EWEA 2HLTA 4HYKA 3VTIA 2ZOFA 2RVJA 5DQGA 1RT1A 1RAJA 3FEXB 2V2KA 2FHOB 2HMIA 1U7LA 3DDNA 3FFIA 3MMBA 3EGZA 3N28A 3VAFA 1FDNA 4I68A 4BWJA 2V8DA 4LJMA 2M52A 2XY7A 2JOQA 4K4UA 1ZH5A 2Y0SD 2MKCA 3LP1B 4TQSA 5GAGU 2DNPA 1FRMA 4CTAB 3BQ0A 3OUYA 3MFHA 1KN6A 2UVUA 3R5DA 3C3LA 3MM6A 1UVMA 4TU9A 2O67A 3WZ0A 3IRWP 4ZP6A 1FTCA 1RA6A 4I67A 1U24A 2GNKA 3CCZA 1ZAVA 5DG7A 2ASLA 2DGVA 1P6TA 4IKAA 2AD9A 2XMMA 3QZ7A 1U49A 1TFWA 4ZP7A 3TOQA 2Y1JA 4OZ0A 2O66A 1DBDA 1R27B 2E7WA 3BGRA 2M88A 5D77A 2BQ3A 4KSEB 4AL7A 2WONB 5L38A 2VC1A 1ULRA 2O3DA 1AFJA 2MQOA 1KFSA 5K14A 5E3CA 1HMVB 4C0BA 1SKRA 1RQ0A 4YHHF 4DFJA 1JLBB 2KT3A 5KFRA 2E1AA 1YTYA 4ERDA 3UW1A 2FGOA 3KLGB 2EWHA 2IVYA 4F50A 1ZAXA 2J0XA 2LMIA 4UOCA 4B3MF 3MEGA 5G0RB 2FLPA 3GSDA 4CH0S 2HW3A 2MSTA 3MMCB 2BQUA 4HKQA 4IQXA 1TV6A 5G4DA 1VK3A 4DFMA 1A6LA 4DSEA 2KJVA 3CGIA 3I5AA 2Q6CA 3K5PA 1LOUA 2RQCA 5EX3A 4CCHA 2LVWA 4JI7F 1XEZA 2UVVA 3AH6A 1RTIA 3KLFA 3MEGB 3OTBA 2B9XA 3K5NA 3DDKA 4QU6A 1NU4A 4X4UA 1FDAA 3PVXA 4NCAA 2M4MA 1RT6A 3SEOA 1L3TA 2N7CA 3HHLC 3RAXA 1C4AA 4ECTA 4Q7AA 2DO4A 2MY8A 2X1GA 3HFKA 4DHVA 5DDPC 2CPIA 4ECUA 1TL5A 4YB6A 4X64F 4EBDA 2DGUA 3RBDA 4QCLA 3KLFB 5LT5A 2B5JB 3QJLA 4PXEA 4DDFA 1EP4B 4RW4A 1HNVB 3DYAB 3HVTA 3K5OA 4A8WA 3IN5A 5EGYA 4J5OA 4IOCQ 2POKA 2NSBA 2ACYA 5KG6A 1S1XA 3HT3A 2OMOA 2VFSA 2RKIB 3R5AA 1HYSB 3IG1B 1GX6A 4AXIA 3V2UC 1IN0A 1UP1A 1VLYA 4O3NA 3CPWR 4XPEA 2LECA 4RUHA 2RD5C 2HS0A 2M5YA 4I2PA 2BABA 3B4DA 2RB7A 2MZQA 2AGPA 4FNIA 2P6SA 2R8KA 3FCHA 5IT9Y 5CCLA 4YR3A 2V4RA 1SC6A 4Q0BB 2DD8S 1IXKA 5A8KB 5KFZA 1S72S 2XC9A 5KFLA 3TAPA