2L08A

Solution nmr structure of nonsense mrna reducing factor 3a from h. sapiens, northeast structural genomics consortium target hr4714b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHSHMVVIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRNPDDILLFRDRFDGYIFLDSKGLEYPAVVEFAPFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Regulator of nonsense transcripts 3A
publication title Solution NMR Structure of Nonsense mRNA reducing factor 3A from H. Sapiens, Northeast Structural Genomics Consortium Target HR4714B
rcsb
source organism Homo sapiens
total genus 10
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l08A00
4CIOA 2DHSA 2M8HA 1S72S 3DLLQ 1CVJA 2MMYA 1VQKS 2G0CA 2DGSA 2OSQA 5IQQA 2RQCA 1U2FA 3CULA 3LPYA 2HVZA 2E5JA 1M90T 1DZ5A 2DHGA 5H1SV 1VBXA 1X4BA 2MKCA 3CMAS 1WELA 2F9DA 2MQNA 1NU4A 1WF1A 4LMZA 2M52A 3N9UC 4QQBA 2JWNA 2RRBA 3D2WA 2LYVA 3RW7A 1U1KA 2FY1A 2ADCA 3CUNA 3P6YC 2MKSA 1WG5A 1VBYA 2A3JA 4OZ1A 2MZTA 2M0GB 5GMKa 2YKAA 2YH0A 2M4MA 3OW2R 4W92B 2XB2D 1SJRA 3R1HA 2LEBA 1WHWA 1AUDA 2AYGA 1KD1T 2KRBA 1S79A 2CPFA 3VAHA 1H2VZ 3P5TL 2U2FA 2D3OR 2AYEA 5LSLA 5MLCV 1WEZA 2CJKA 1FJCA 2DNRA 2MZSA 1X4DA 2DITA 3ZZYA 2DISA 2CQBA 1D8ZA 1X0FA 3CMES 1X4EA 1QVGR 2DNHA 1M5OC 3CC4S 3VALA 1F9FA 1VQ5S 3NS6A 1WEXA 3CCVS 2CQHA 2QA4S 1N54B 5HO4A 3ZZZA 2DNYA 4P6QA 1K9MT 1RK8A 5D78A 3CCQS 1M1KT 2MQOA 1H6KX 3CCES 2E5HA 2M7SA 1M5KC 1WHYA 2RT3A 2ZJRQ 1X5TA 1JMTA 2DIUA 3SDEB 1U6FA 2NLWA 2X1GA 2LKZA 3IWNC 5CA5A 2CQ2A 1VQNS 1A7GE 3B4MA 2J76E 1P1TA 2AYMA 2MYFA 1U6BA 3TYTA 1YITS 2MY7A 3IRWP 3MDFA 3US5A 1H2UX 3CXCR 2CPXA 1KC8T 1UW4A 5DETA 4IOAQ 2G1DA 2YWKA 3P49B 2F9JA 2DIVA 2X1FA 1WTBA 4ZKAA 3EGNA 1U1PA 5IM0A 5LXYA 2XS7A 4YUDA 1HA1A 1FT8A 2CQPA 2XS2A 2MGZB 1VQ7S 1W2BR 1VC6A 1OPIA 1WG4A 3S7RA 1KOHA 1WG1A 2ADBA 1X4GA 2JVOA 4PRFA 4M5DB 4WFNQ 1P27B 1JJ4A 1VQMS 3CCLS 2MJUA 2AD9A 2KG1A 3U1LA 2CQDA 1YHQS 1HD1A 1BY9A 2O3DA 1U1LA 2PEHA 1X4FA 2KFYA 5DDRC 1X4CA 2G4BA 1FJ7A 1U1NA 1VQ6S 2YH1A 1FHTA 1VQOS 3CCSS 1QVFR 2HYIB 3NMRA 2ERRA 1VC5A 3CCRS 1Q82T 4C7QA 2L08A 3G9CA 2RQ4A 1WI8A 2OIHA 4UY8T 2MKHA 2ZJPQ 2DGOA 5JVHQ 1FJEB 2RRAA 3BO2A 1YJ9S 3MD1A 5D77A 1HD0A 3JB9k 3UCUP 2LECA 3I55S 1URNA 3UD3P 3R27A 2CQ0A 2FC9A 2K3KA 1VQPS 2KXHA 1FXLA 2DNMA 2DNGA 5FJ4A 2DB1A 3VAFA 2KRRA 4F26A 3S6EA 3UCGA 4QU7A 2DGXA 5EN1A 1VQ8S 1WF0A 1SJ3P 2MPUA 1U1OA 2MQPA 1Q86T 2CQGA 2FHOB 4Z2XA 4TU9A 3BO3A 1U1QA 3I56S 3RW6A 2RS2A 2I2YA 2M2BA 2KHCA 4F25A 3CC2S 2DH9A 1UFWA 3VAMA 3G6ES 3HI9A 4CQ1A 3CCJS 1B7FA 1G2EA 2DNOA 2LA6A 4IO9Q 2UP1A 3PIPQ 2N3OA 1WWHA 2MQQA 4YOEA 2YTCA 2DH8A 2LXUA 3UWTA 4C4WA 2CPDA 3THTA 1N88A 3UE2A 1U1MA 2J0SD 4TU7A 2DGQA 2MKJA 4YB1P 5GAHU 2QEXS 2XS5A 3EGZA 2DK2A 4PKDB 1K8AT 2KXFA 5HL7Q 2M88A 1A9NB 2LMIA 5GAGU 1UAWA 1VC0A 1WF2A 2MKKA 2GHPA 2LEAA 2X1BA 4QU6A 2HGMA 3P3DA 2KT5A 4WF9Q 2E5IA 2RNEA 4A8XA 2F3JA 5IFMA 4LIRA 5GVQA 3MD3A 1ZZNA 2MZQA 1L3KA 4QPTA 1YI2S 3NS5A 1SJQA 3EX7B 4UQTA 1VQ4S 2EVZA 2CPIA 1YWXA 1ZH5A 3PIOQ 2DHAA 2DGWA 2RS8A 2XNRA 3G71S 3SMZA 2KU7A 1WHXA 1R8PA 1X5OA 4IOCQ 1PO6A 2JX2A 2N3LA 3V4MA 2DH7A 2DNNA 2CQCA 2MQLA 2Q79A 4FXVA 3HHNB 4EGLA 2MXYA 1YTYA 3NNHA 2MB0B 3BEGB 3TO8A 2L41A 2LA4A 3G4SS 1JJ2R 3SXLA 5JVGQ 1U1RA 3CCMS 3J7ZT 2VOOA 5LJ3Y 3UD4P 2JVRA 1OIAA 3S01A 2RUGA 2ZJQQ 1VBZA 2XSFA 4WCEQ 3MOJB 1DBDA 1JJHA 1NO8A 2CQ4A 2DO4A 4FXWA 1YIJS 1N8RT 4OZ0A 1DHMA 2CQ3A 2DGUA 3G8SA 3VAJA 1X5PA 3MI7X 2HGLA 1HL6A 1FNXH 2MZJA 2MHNA 3CD6S 3H2VE 2OJ3A 4U67Q 2NZ4A 1H2TZ 3SDEA 3CF5Q 2XNQA 1XN9A 1M5VC 2DHXA 2VONA 2VOPA 2EK6A 4WKRA 2V94A 5DM7Q 1DRZA 1O0PA 3NNCA 2B0GA 4ERDA 1WEYA 5LJ5Y 1KOOA 5LXRA 4WFBQ 3VAGA 4RU2A 3UCZP 3BS9A 3THPA 1Q81T 2E44A 4ED5A 5DM6Q 3LQVA 4IUFA 2CQIA 2SXLA 3G96A 1M5PC 2J8AA 2OTJS 2M70A 2MZ1A 2HGNA 2I38A 3FEXB 2MGZA 3DXBA 4WIIA 3MURP 4Y00A 1N52B 5ITHA 3L3CA 2MZRA 5IM0B 2DNPA 1VQ9S 2FC8A 2KH9A 3VAIA 1RKJA 2OTLS 2LQ5A 5DDPC 2U1AA 3VF0B 2KN4A 1VQLS 3MUTP 4Y0FA 5CXTA 2MSTA 4F02A 4WFAQ 3CC7S 4C0OC 2BZ2A 3NNAA 1ZZFA 2KYXA 2RVJA 2MY8A 2KVIA 5DDQC 2DNLA 4TLQA 2MQMA 3S8SA 1YJNS 2LCWA 4PR6A 2CPEA 2CPZA 3ULHA 3VAKA 3CPWR 1UP1A 1K73T 3CTRA 4CH1A 3CCUS 3Q2SC 2FPHX 3BO4A 1NJIT 2QFJA 5DDOC 1D9AA 1FO1A 1X5SA 2KG0A 2GO9A 2L9WA 1QM9A 2J0QD 2MJNA 2DNZA 2DGVA 1KQSR 1Q7YT 2MKIA 3R1LA 2N7CA 1OO0B 3H2UB 2X1AA 4W90B 3K0JA 1SJFA 2WBRA 2DNKA 2CQ1A 4TU8A 5BJRA 2D9PA 3B4DA 2N82B 3MUMP 2VODA 2DO0A 2OSRA 2KXNB 2KM8B 2KI2A 3Q2TC 2DGTA 3MUVP 2PE8A 2RU3A 2D9OA 2EK1A 1OWXA 1YJWS 2K8GA 5GAEU 3MXHP 5GADU 3J7YU 3FEYB 4CH0S 2HZCA 2E5GA 3TP2A 5CYJA 2M9KA 1X4AA 3G8TA 2LXIA 4LJMA 2KM8C 4J5OA 1IQTA 1X4HA 2CPHA 2MSSA 3U1MA 1SXLA 5LSOA 2CPYA 1PGZA 2CPJA 2JRSA 1SJ4P 2M8DB 4V19X 4BS2A 1WI6A 2DNQA 2AYBA 1WHVA 1R8HA 2BOPA
chains in the Genus database with same CATH superfamily
2IY5B 2M8HA 4DX8H 4WK3A 4JI2F 3DYAB 4DR5F 1WELA 2VB6A 2ZZNA 5LT5A 3TX8A 2M52A 3IG1A 1SKSA 2AJ0A 2A3JA 3T3FA 1EKSA 4LSLA 3MEEA 3D6HB 3RG6A 1HR0J 2B5JA 1WHWA 5C42B 1UWBA 3RTVA 2G2YA 1SB6A 3V4IB 1FKPB 3ZZYA 3BGRA 1X9MA 2CQBA 3PM9A 1C0TB 1M5OC 4JBCA 2R8JA 1R3NA 3MR6A 2QA4S 5IZHA 3DI6B 3DOLB 4ZVEA 4DQPA 4M5NA 3D3CJ 4DV1J 5KG5A 2J76E 4B3TF 5HQ8A 4K2XA 1N5QA 1RTZA 2GGPA 3AOCA 3EE3A 1KVIA 1NPRA 3BH6B 3MCMA 2X1FA 5IM0A 1PC5A 3ZFVA 3M1VA 4LQ3A 2ZZMA 1HWJA 3NMAA 1JNRB 1TMMA 1NPPA 3C3LA 3HHDA 2DR9A 3D68A 2OPSA 4I2QB 2ZVIA 3TR5A 2V4QA 5L38A 2RHSB 1S1VB 4OX7A 4G6VB 4FF2A 3ENAA 5F8NA 1ZPVA 3UQSA 2G4BA 1VLOA 2X3GA 2BW7A 1SKRA 1R0BG 1GXTA 2VJUA 2FDNA 3RBXA 4ATNA 3LWMA 2OIHA 1FJEB 3L7UA 1M1GA 2K06A 3NL0A 4C8ZA 1TAUA 4CO4A 4DCJB 3ETOA 4ZA1A 1B70B 1KTVA 1PSDA 5IT4A 1S7HA 1F2GA 1JQGA 3VAMA 1FEEA 1FD8A 1FRHA 4K4UA 2VBYA 1FX2A 4WE1A 2CVEA 2YX1A 2RJZA 1X60A 2DXFA 1S1XB 4XPCA 1N88A 4F4KA 3EGZA 3NWGA 4JI7F 4ZPWR 4DV3J 3KLHB 5GAEI 2E5IA 4F0MA 4ZP9A 3UPFA 2WZ1A 1HNWF 2XMVA 3R5AA 3M8QA 3KHHA 4A8OA 5KFTA 4O3OA 3MM6B 4M5MA 1CQMA 5JXSA 1XMQF 3A8EA 4S0MA 4NXNJ 3O2IA 2O01C 1H73A 4FYVB 1DQ9A 4DBQA 4OJHA 4WTOB 3GIMA 1JJ2R 4DR1J 4PQAA 1DBDA 1SKWA 2B9XA 1NH8A 2KDOA 1JLBA 4V19J 1K0TA 1L3UA 1K1QA 3W7BA 4LVNP 2UU9F 4KGZB 1JLCB 1VQYA 1NLKL 5BYQA 2IAJA 2GO8A 3BJYA 2HQGA 3DCAA 1VRTB 1VISA 4GRSA 4RNFA 2HQCA 3TUJC 1N36J 5KFJA 1RQ0A 3H42A 2HVEA 1X8DA 2OTLS 1DTQA 2PI5A 4ZVTB 4DL7A 1JXLA 4RW8B 2UVUA 5IT9U 1JLQA 5HROA 2HNDB 3H7HB 2VQFJ 1OS5A 3QLHA 3HHKA 4RBTA 5LMNF 2KFNA 4QWDA 4F04B 2QFJA 1QM9A 2J0QD 1E6VB 2V4RA 3PDNA 4CNYA 3MPWA 1N36F 3MMCA 4F4WA 2CQ1A 3NGSA 2W4PA 1HWIA 3C16A 3JAMY 1CPZA 1YJVA 3D1OA 1UVNA 3UN3A 4ELUA 2W9BB 3RR8A 4X66F 5HJXA 3QGIA 2VG7B 4JP8A 2VQFF 4A8MP 2EFVA 1IUJA 3K58A 2ATCB 1Q8BA 2W24A 1R8HA 3FCWA 4ZJLA 5BXIA 1Y3JA 2HVIA 1Y10A 2G0CA 3OL9A 2OSQA 4NRTA 3EGWB 3K8VA 1SV5A 4RBVA 4ZVQB 1X31C 2OPQB 3DLGA 4PABA 2YX4A 4KT0C 1WF1A 2MTLA 3ZTSA 1PG5B 2ADCA 5CYMA 2QSFA 4RNHA 2Y0BB 3W2WA 3V2UC 1MN7A 4PG6A 4JI3J 1SJRA 5D4OA 3MM7A 3Q8UA 3QO9A 1YBUA 1HNIA 4HL9A 3JQJA 3MZIA 3ENQA 5AJ3J 5KT5A 3CMES 2YKQA 4ED8A 2YXLA 3FBBA 2BA9A 4NZ7A 2FLPA 3T9ZA 1N54B 3RAQA 3VHQA 3CCQS 3NBPB 4MKYA 3GV8B 2HBYB 4ZVOB 3CCES 3HVTA 5FD1A 4PEOA 4DSJA 2YNFA 3RGIA 2I1RA 1RT7B 3NKYA 1G4CA 5HBMA 1QSSA 4ED3A 4WKYA 2C1EB 2F8MA 4DR6J 3PFOA 2C2DA 5LXYA 1NK8A 1AA1B 2J6SA 2UUAF 5EDWA 3C15B 1OMSA 3Q86A 1WG4A 1YBTA 1RKIA 1REVB 3DLKA 4ID8A 1NKEA 1KFDA 2MEWA 1PIEA 3PEJA 2XY5A 4GMKA 4WZQA 1IXKA 2I8EA 3G86A 1GX5A 1MN9A 1U1LA 2B4PA 1X4FA 4AQYJ 3MECB 5T41A 1TUGB 5DLFA 1T9VA 4DG1A 5C24B 3K5LA 5CABA 1EZZB 4AL6A 3OJUA 1WI8A 4NX9A 5DG7A 2MKHA 2NYHA 4NI2A 2CJYB 4U96A 4H4MB 4E98A 2DNGA 3FRZA 2OAUA 1PCAA 2CQGA 1MU2A 2IM2A 4FF4A 1U1QA 4BLGA 1WC6A 1RWUA 1R31A 4TY9A 2VBZA 1JB0C 3M9OB 2HMIB 2PMHA 1RWMB 1XQIA 2DH8A 2R2TA 4C4WA 4ZCLA 4A8QA 1KTQA 2OD4A 5GAHU 1Q8KA 2DR6A 4K5RA 1SPBP 3H98A 3VV2B 2UXCJ 2CDQA 4USUA 1VC0A 3A12A 3AQPA 7FD1A 3ISND 1VLYA 4IRDA 4QIWD 2RNEA 2XLKA 2AJ2A 5K5MA 4NLVA 3IN5A 5GVQA 2VV5A 3RJMB 4P7VA 4UQTA 4E0DA 4TNOA 4KB7A 2P6SA 4HYKA 4I68A 4N5SA 3DGVA 3KLEB 2JX2A 2L9DA 2DNNA 3KHRA 3IR7B 2XYHB 3G6VA 3KJQB 1S4EA 5KT7A 1FK9B 1O5JA 2HBZB 3G4SS 1V3SA 2FVRA 1J5OA 2X7IA 1Y9OA 4QWAA 2DO4A 4V1Ak 1H0HB 3M8WA 4Y34A 3E51A 2ZHOA 2HVDA 1VIOA 3JYTA 2IDEA 2RUSA 4DV4F 1XN9A 1YLXA 2VFRA 5KFYA 2XQCA 4KRWA 2B0GA 3TA0A 4ES3A 1TK5A 3THPA 1RACB 2C3MA 1NRKA 1NNDA 2CQIA 2XBPA 5D6GA 2Z56B 4ZIWA 2B4OA 4RUAA 5J2NB 2ASYA 1RT2A 4NPOA 4LF7J 1T11A 3DRSB 2FC8A 4YDDB 2U1AA 1LEOA 4Y0FA 1N56A 2RVJA 4LQ9A 1ZTTA 2IIHA 2I5JB 1YBAA 3UDCA 2OP5A 3OJSA 2AV5A 3CD0A 2XY6A 5I42A 4CH1A 1CJTB 5DDOC 1U2RA 2DY1A 2GHVC 5T7LA 3H5XA 2LQ9A 1RCOB 1R0AA 5E3RA 3PZPA 1DTTB 1T9WA 1LKZA 1SBRA 3VVUA 4C97A 4ID5A 1B64A 1NK0A 5FLXY 2HG4A 2Y9HA 3UVJB 3W64A 4DPOA 2CPHA 2LFVA 3UDEA 4B3SF 4IG3B 3CO0P 2XMUA 3KJNB 4CIOA 4FP9A 2J9DE 4ETXA 3TANA 3LPYA 2HVZA 1U4BA 4QW9A 4ES2A 3TAMB 2BQRA 4QBUA 2HS4A 6FD1A 2LYVA 4DXLA 1TKXB 2LP4A 3DLBA 5KFFA 4JI4J 2YKMA 4GKJF 5CD4H 1RU2A 4OHZA 1XR5A 2RKIA 2E9ZA 2AYGA 4ZVPB 2V2ZA 1B3TA 3FFIA 3SCKE 1N5YA 3D0GE 4L74A 2PI4A 3X1LB 4KYZA 4F7VA 4UT4A 3PXGa 4LBHA 2MQOA 4URQU 4DV2J 1QE1B 2M7SA 1QJHA 1S6PA 1N33F 4NLTA 3A4TA 1SQFA 3W8GA 2CAJA 4TQSA 2GMJA 5J2QA 5D3GA 3MEGA 2HWHA 3CXCR 5DETA 4IOAQ 2YWKA 3AA9A 4RW4B 2XCPA 1LWXA 1TKZA 3CIZA 3DKDA 1G7CB 2NXUA 5KFZA 2UXBF 1KHVA 4LRCA 3HJFA 2YBVA 4NCBA 3A3PB 3RRGA 4FXDA 3RRKA 1ZA1B 5CYQB 3JSYA 3J81Y 3V4IA 5KFLA 4CDIA 4R8UB 5KFXA 2VKZG 2IC3B 1FXDA 4QR1A 1YKWA 3TZXA 2C2MB 4F3OA 4MAKA 4USMA 1APSA 2VU5A 2ZKTA 1NHUA 2LEPA 3CCSS 2A2CA 4K5SA 2NYIA 3PR5B 1N0VC 2G1HA 3DOMA 2ERRA 4HACA 2IHR1 1PILA 2KT2A 3EVWA 4P74A 3GFZA 5FJ4A 3VAFA 1WTFA 1U47A 1LW0B 3CGIA 1WF0A 3MCOA 4KE5A 4I4BA 3NAHA 3BH7B 4JYAJ 4RW6B 4EK2A 2FHOB 2OMOA 4KC5A 2I2YA 8AT1B 2V6AA 4GC7A 1NJWA 2N3OA 1EARA 2EG1A 4XDDA 4IFVA 3CDWA 2MKJA 3DRXA 1RTJA 1S10A 1WJ9A 4ELTA 2RILA 4L76A 4G65A 4N41A 3GV7B 4DUZJ 4DF8A 1ZBTA 2KT5A 5ETSA 2D3ZA 5ETQA 1EP4A 1SIWB 2JNJA 5L46A 1YWXA 5F41A 2DH7A 1RGVA 2QL5B 4DN0A 3OPKA 4ZHRA 5KFKA 2HRUA 1YJRA 3T5LA 3CCMS 2H5JB 3UD4P 4PG8A 1C1CB 4MIAA 4RPFA 5CCMA 2HQFA 1RAAB 3W2VA 1IR0A 4PWUA 7AT1B 5DO2A 3CJ4A 5KT4A 1X5PA 2MHNA 1VK3A 2GZOA 5D0GA 4Y6IA 5J1EA 3UDVA 4M5JA 3A8IA 1RJJA 3H5UA 4AYBD 1HFEL 3DRPB 2DTJA 5BYRA 2GX8A 2OUGA 4C6AA 2MGZA 4WIIA 2Z4PA 1BQXA 1EAYC 3OTOF 1UA1A 1RWOB 4NLSA 1YJUA 2MZRA 2VDHA 3D54A 3MPYA 2JDJA 4IH6A 3VAIA 3VF0B 3MUTP 2K1RB 4DUYJ 3BN4A 1RE1B 1ZZFA 4FYXB 3V5RA 1TV6A 4M63A 4ZPVR 2IPOB 2W4CA 1FE4A 3D66A 3K2YA 1AZSA 2KT3A 2IYIA 2DD8S 4C98A 2GW8A 3R7NB 1O51A 4B3RF 2VPZB 3JSBA 3JS9A 3Q89A 3EZOA 2MKIA 4IOBA 4YEAA 3OVSA 3CVKA 2D9PA 2WTFA 2CNOB 2Y1IA 1FERA 3OL6A 3OTBA 2HSEB 2K8GA 4P10A 2R8HA 5A8WB 1RI7A 1KLMB 3DDKA 2HWIA 4CM2A 1YZ7A 2LXIA 4XTTA 4R5PA 5IQ6A 4ZS6A 4DV6J 1SXLA 3MR7A 1EJ7L 2DCUB 2WVCA 2IJRA 2WOMB 3EXYA 1WHVA 2BOPA 2HNDA 3F41A 4UUWA 2E5JA 1RHRB 1P9YA 4QWEA 2B6AB 1F2HA 1SJ1A 2JWNA 2WHOA 4WYWA 1S9FA 2H48B 4KO0B 2PT0A 3NXZA 2MKSA 1RT4A 4NA2A 1IKVA 2ILZA 1YK9A 4UUXA 2YNIA 2NPIA 1K0VA 4M5LA 4ZPCA 2O5DA 4EWTA 1HYSA 4ZJOA 1C1BA 4DFKA 3VQSA 1UJ5A 3QBCA 4NLGA 3GIKA 3H20A 1QVGR 3GFYA 5ETVA 4DSKA 1VBKA 4P6QA 3MAAB 4K0KJ 4Q8EA 3AAWB 4P9SA 1M1KT 4ZLNA 3FNNA 3DMJA 2FUG9 4CI0B 1JLEA 5KT3A 4TN2A 3OQ2A 1TELA 3OXLA 1FFGB 1KLNA 2MY7A 3BBBA 3Q8SB 4NLWA 1N34F 5HANA 3FJ2A 3MEDA 2RQKA 3DGPB 2VD3A 3CJ2A 2E1MC 3CCWA 1HBOA 2ZH8A 4TQRA 3LGMA 3S7RA 4WP8A 3PX0A 3TA2A 4PRFA 2CKWA 1N4LA 4DS4A 2LLZA 5I3PA 2GVZA 4OYOA 3L95X 1ICEB 2KFYA 4IR9A 3QWUA 1RU1A 1QVFR 1FRXA 2A10A 5J2PA 1LQ9A 4Y28C 1T05B 2F4VF 3M2UB 4ED7A 2RQ4A 1QAJA 2XHWA 4QYRA 2JLEA 2OPPA 3K57A 3KUEA 3UCUP 4RZRA 1BMQB 2JEJA 1QD1A 3DFEA 2YWGA 5DGAA 4Z2XA 1RT3B 3TZYA 4EZ6A 1O8BA 3SI8A 2C2EA 3G6ES 2VIHA 2BKNA 3OFHA 5G0RA 5L8RC 3IBWA 1NSAA 1G2EA 2Z2MA 4O3PA 3K5MA 3LP1A 3Q8PB 1RAJA 4G3IA 4GKKF 3RZAA 3JTOA 3KDOA 4DV5F 2KXFA 2J9EA 4FKXA 4HTIA 2X1BA 3H40A 4A8YA 4WF9Q 4Q8FA 2F3JA 3MD3A 1ZZNA 3O3LA 2B8PA 5DQGA 2HURA 1X9WA 3M8RA 3WDOA 2XI3A 3MCNA 2QL7B 5LOQA 1XR6A 1B0TA 3T19A 1PO6A 3EZUA 3V4MA 1S1TA 5F8GA 4IDKB 4TYBA 2AZ3A 5AT1B 2H4WB 1RP5A 3C14B 1CJKB 4C11A 3X3UA 2C2ZB 3GQCA 2L48A 3AA8A 3PW4A 2YWFA 1VFJA 3MPUB 1ZAXA 3TUZC 1TMJA 1RABB 4NCGA 3GCXP 4LREA 3HCXA 4NASA 3LOUA 1HNVB 5LM7E 3JQKA 5J2MA 4KSEB 2V94A 1CC8A 1NDCA 1LFPA 1LK5A 1FKOA 5F8JA 4TKTA 3MM9B 2CG8A 1CSJA 3OT9A 1H74A 4DFMA 4ZP6A 2W7OA 2J8AA 2ZDOA 2HGNA 3KLEA 2ZITA 1PJ7A 4FF3A 3HT0A 3PNIA 2ZE2B 2VL1A 4CTAB 2PDAA 3KK2A 4KV8B 3NNAA 2WONB 2GJ2A 3M6XA 2CA9A 2LCWA 4PR6A 4MKVA 3PYGA 4NYOA 4FDFA 3Q2SC 4U7UD 2Z8QA 2AGPA 3J7Z5 1NXIA 2PIIA 3AJDA 3R1LA 3BSAA 4YB5A 2X1AA 3M9NB 2EEYA 5DG8A 2V8GA 1DQ8A 3KK1A 4DL5A 1XTZA 1RB0A 1ZTWA 3Q83A 1CULB 1GAOA 5H9EK 2W9AA 3J7YU 2CFXA 2HHVA 5A76A 2ZD1A 1S5ZA 2RDDA 2NUHA 1HHQA 1FF2A 4J9MA 4BS2A 1WI6A 1NDPA 3CJKA 3GPAA 2DHSA 4JV0A 2QFIA 1CJTA 2EFQA 3M8PB 1T0TV 4C2MA 5E3QA 3CJSA 3MHYA 3N9UC 2Y8WA 2RRBA 3KLIB 2G2ZA 1VBYA 4OZ1A 2YKAA 4FS1A 1GK8A 1Q79A 3HFVA 5GAHI 2PSZA 4HVZA 4B3MF 1AUDA 3O44A 1KN6A 2M5YA 2KRBA 1NK9A 3BN7A 4OMFG 4JUZA 3VAHA 4GVBA 4DN9A 2GIQA 2GCFA 4PQUA 4W98A 3VALA 1FESA 3M32B 4IYQA 5IV3A 2ZNYA 2V4JA 4B9NA 2AJ4A 4CLSA 2UUCF 2V68A 3C66A 4USVA 4MKBA 3Q23A 1U6BA 1IBMF 2R7VA 4ED2A 2A1BA 2DR5A 5AXNA 3IRWP 1YSJA 1FRKA 2CPXA 3OR2A 4DUTA 1LOUA 5IT0A 4KAIA 2H54B 2JZ5A 2KVQE 2BM0A 2CQPA 1FT8A 1YJ7A 1VQ7S 4J9RA 1CJVA 2X51A 3OTCA 4LSZB 2OLWA 1Q4RA 4JI5J 2KG1A 3U1LA 2I0XA 2HNYA 1SH2A 2DBBA 2HS3A 3LP2A 4IH7A 1NK5A 4QR2A 4ECYA 2G2OA 4RX6A 2V2VA 5ADZA 1QSLA 4K4VA 2QLFB 2FZGB 3JSMB 4Q44A 3TWZA 2RRAA 4QYZJ 5HLFB 5CAAA 4DSFA 1SC3B 4KQZA 5HP1B 3FQLA 3DLHA 3MMAA 2R7OA 2LQ8A 3U02A 4MIBA 2EKNA 1F9EB 4FYWB 1RAOA 2GVDB 3BGFA 1B7FA 4FBUA 2C3OA 3R3TA 1ZS6A 1U0HB 4X4TA 2LXUA 1HNXF 1GEHA 5A2QY 3H0PA 3UE2A 1KHWA 1SUQB 1Z2LA 2J0SD 2DGQA 3ZO7A 1VCTA 3NAIA 4LFCJ 5CZXA 2QL9B 2VG5A 4U7UK 1EETA 2J7WA 1BQMA 2PO4A 4NMLA 5HK4A 2BACA 5K8MA 1XMOJ 3A3OB 1VQ4S 4DR4J 2X3DA 2W7AA 3IG1B 4ZLPA 5K20B 1N48A 5D8HB 2FY8A 4OHYA 2DPIA 3HHNB 4LSLB 2Z2YB 2B5JB 3TZZA 1YTYA 3GJTB 3AOAA 3IMQJ 1UWBB 2LA4A 1U1RA 3I6PA 2HHHF 2FJXA 5F3TA 4TY8A 4QOTA 4P73A 4RKUC 4PWDA 3BGRB 1VIXA 3B54A 3G8SA 1S57A 3PW7A 2QLXA 1RYSA 4QIEA 2NZ4A 3HLUA 3T1AA 4F0KA 1JK9B 2W7PA 4G1IA 4D3HA 4O0IA 4DR3F 1O0PA 1OYDA 4OYBA 3W61A 1PYOB 1ULRA 3C6TA 4QWBA 2UXDJ 1IKWA 2RQMA 3SQOP 1DAXA 5HMYA 3LQVA 4USJC 2NREA 3HVAA 4ZPAA 5DGBA 2GGPB 3MURP 5EX3A 4Z7CA 3MAHA 3NG8A 5IM0B 2C3YA 2XC9A 5B0DA 2GIRA 3M1VB 2V9WA 3NOGA 1XNQF 2KN4A 5HQMA 1Q0NA 4U6PA 3BPSP 2RIJA 2KYXA 2UV8G 4IQMA 1CEZA 2OPSB 1U7LA 4TLQA 4Q43A 3S8SA 4GVLA 3IAM9 1B7YB 3VAKA 3SZ2A 2BYCA 4AD6A 2VHGA 2ZBIA 4RW7A 4K50A 4YMEA 4B9SA 4K2JA 1AROP 3EJMA 2WK4A 4W90B 2WBRA 3AY0A 3R7BB 3MUMP 2BMBA 1TL1A 1BQNA 4I0WA 3Q2TC 3KXDA 2C42A 1N6QA 4JV5F 1KQFB 1YJWS 4USKA 4YFUA 3G6YA 2ZBQA 2HRYA 4ZP8A 4LFBJ 4J5OA 3MM8A 4WE1B 3H4BA 2R3VA 2JRSA 2KYZA 4WU2A 2DNQA 1GX6A 1QTMA 2BXJA 1FD2A 2RQCA 3GP9A 3CMAS 2NXEA 4DHVA 4U7CA 2YWEA 1BUXA 2F8HA 2ILYA 2AKWB 3D2WA 2VQEJ 1VI7A 1Y00A 4H54A 4MJKA 3CUNA 3H5YA 3M8QB 3MPDA 4A8KA 4EZ9A 1HBMA 1NBEB 4F3MA 3PTWA 1OYEA 2MLXA 3CJQA 1S79A 2EXUA 1WNEA 5LSLA 1FEHA 5KFHA 4ANCA 4NEYA 3GSDA 2EFPA 3D6TB 4NZ0A 4DV7F 1F9FA 1SL0A 2O66A 4I69A 4L6V3 3FC9A 1QAIA 1Q95G 1JLBB 2ROGA 3TA1A 3BPDA 3LPEA 3R5BA 2VPWB 2BEFA 4MYUA 1NB7A 2IRUA 4OI1A 1VQSA 4M94A 2GNKA 3M30A 2HFNA 5K8NA 1WTBA 2IAJB 3N01A 2EFOA 4DX5A 3TJAA 1RT1B 4Q0BA 2HRTA 1SL2A 3HD2A 3ZTOA 1RAIB 1N32J 4J9NA 3HVWA 2XY7A 4MTPA 4ED4A 1DTQB 2BE7D 1RTIB 1LWCA 1WDDA 2NQPA 3CCTA 1YDLA 1JLQB 5D0RA 5HROB 5H9FK 3QLHB 4DSEA 5M2UA 1RADB 4UY8T 1FJGF 2W2PP 4ZIVA 4KBIA 4LR8A 2D69A 2XWYA 3MMCB 3M9MB 4M95A 2BQUA 4MFBA 2WSEC 4TU9A 2ZBPA 2KHCA 3C16B 1VRUA 5K8OA 1BWVA 2VZ9A 2MQQA 2F4FA 5B08A 3MMJA 2B9EA 3SEOA 4ZCMA 2XS5A 2DK2A 1A9NB 4DPTA 4UTGA 2R8GA 2HHUA 3BB5A 3M7VA 2EBGA 4LR9A 4PAAA 2P2CB 2HGMA 4K8RA 1S1WA 1SV5B 3NGKA 3ONQA 3DLGB 4OI6A 1TK8A 4USIA 2D41A 2IJNA 5AE1A 2DHAA 2XNRA 1UCNA 3EICA 3QIPA 5CYMB 4OLPA 3W2WB 2ZOMA 1DURA 3OFGA 4FXVA 4J90A 5KFAA 1SIZA 1TK0A 4EBCA 3MM7B 3QO9B 4IH5A 4M5KA 2FVCA 2VBXA 3I87A 4X4SA 2ZJQQ 4Z7YA 3GR1A 5DLGA 2CQ4A 1DHMA 2VUGA 2V8PA 2EPIA 3N4WA 2LDIA 2DHXA 3Q22A 3HVTB 2IM0A 2RDJA 2W8LA 2KFZA 4MIWA 2YNFB 3UCZP 1HQUA 2GQQA 1OSDA 5HBMB 2VC0A 3ZZRA 1HWKA 2DJWA 3IBCB 1PJ5A 3M2RA 1N52B 1Q5VA 1UFKA 4M5DA 3AQOA 4ENOA 4M5GA 1RWNB 4CNZA 3I9ZA 5KG7A 2M3DA 3OHAA 3NEKA 3DLKB 5CHCB 3NRBA 2IFXA 4P2FA 4DQIA 4F0HA 4KIAA 2VA2A 4C8OA 1UTAA 2GQ2A 3P8BB 4A46A 2IVMA 2AGOA 2QN6B 1RHQB 1S1UB 4X4PA 3BO4A 1JKHA 3RU0A 4IFYA 4DG1B 2BM1A 1NB2A 4P2SA 1SC1B 4QZVB 4ZLJA 1UEVA 5FLXU 4XPEA 2XZDB 3B4DA 3IBFB 4NI2B 2N82B 2VODA 2QZ8A 1R43A 4QW8A 3ICLA 4J7CA 5ETKA 2OD6A 2DGTA 1RA7A 5AE3A 4MKAA 4LBIA 2Z30B 4OYZA 4LFAJ 1MU2B 2CG4A 3SCLE 3RB0A 1I94J 1SL1A 3Q0AA 3MMBB 3TVKA 5DS7A 2XO7A 1OJ4A 3HPOA 3RB6A 2H9ZA 1IKXA 2XI2A 3CJTA 4DWIA 1UVIA 1RWXB 3O8WA 3IRXA 2ZC4A 3CB4A 1XIQA 4LRBA 1PAEX 4DL0C 1IM4A 4F3QA 2C3UA 2RH3A 5HMXA 1R6VA 4LIWA 3W9HA 3K5PA 1FDBA 3P6YC 2E5LF 1YJTA 1YRTA 3IP0A 2FTRA 4P2MA 1NHKL 5KFQA 3T5KA 1RCXB 2CPFA 4FF1A 3SCJE 1TUWA 5E3CA 4X65F 2D3OR 3R5CA 1F5CA 1RAGB 1FJCA 1GNKA 2G13A 3PJ9A 1UWAA 4GO7X 3QYYA 4DR2J 4ECXA 3T6JA 1J5OB 3VGSA 2MLYA 3OVAA 3KK3A 2Y1LB 3PG9A 1M5KC 2CWKA 2ZJRQ 3JYTB 2MDAA 2NLWA 2FYXA 1A7GE 1VQNS 4OV6A 3AB4B 4RNMA 2P9CA 5L39A 4ZN3A 3J81U 4DFPA 1RBLA 3MGJA 3VGVA 2UUWA 3I9V9 2RE1A 3NCRA 4OX9F 1BGXT 3HX9A 1KSPA 4DR2F 4C8YA 4OZ2A 2NUUG 1RT2B 1WG1A 2B9YA 2CNKB 2R4FA 1VQMS 1TP7A 2HVHA 5KFDA 2MJUA 2BJ3A 1NK4A 1NDKA 4YB7A 3M4XA 3OL8A 3RBZA 2ZOGA 2ASLA 2YPYA 1DARA 5DDRC 3QZ7A 4KHPJ 1HHTP 4KY3A 5KOWA 4C7QA 2WSFC 2OHDA 4Y2AA 5AXMA 2W2NP 1AB8A 5D77A 3D1HA 3AD9C 2FC9A 2KXHA 5T7LB 1TL7B 5ETRA 1R0AB 4MT1A 3DDIA 4DEZA 4CO5A 4AUKA 2RS2A 2M2BA 1S49A 3OUYA 4F2RA 3H5SA 1J5EF 4IR1A 3HI9A 1NK6A 2OEJA 2VFSA 3O5TB 4YOEA 3F44A 4NA1A 2B8QA 4ID5B 3UWTA 4OLOA 1CG2A 3GWCA 3TAPA 3D4JA 4F8RA 5KFIA 3GU0A 5A0YA 4DI6A 5RUBA 3P3DA 3LAKA 3J7YI 3KYLA 3NWRA 5IFMA 5DZ6A 2EW9A 5GMEA 4USHA 4A8WA 2H3EB 2ASDA 3HXMA 2QMUB 2CPIA 2HS0A 4JI2J 3WC2A 2VFVA 2YKMB 2RF2A 2MQLA 4L3KA 1HI0P 2K2PA 2BDPA 3ENWA 1TFYA 5DZ7A 2E29A 5B0GA 3SXLA 3FFIB 3VR1A 1R7IA 1PYTA 3I31A 1MW7A 1WACA 1N5YB 3B82A 1JLAA 1S0MA 1ZYQA 1UA0A 5B0AA 2XNQA 3BSCA 2QIFA 3OVBA 2CNNB 1S6PB 3B78A 2HZVA 3DRRA 4H4KA 4K4TA 5J2QB 2E44A 3AB2B 3TRGA 5D3GB 2JLFA 3PX6A 3OXFA 3MEGB 1PKUA 4FNHA 1REGX 4F36A 3FEXB 5KOXA 4WXWA 4NXMJ 1LWEA 4B3TJ 1TKZB 8RUCA 4OJ1A 4ZCKA 2DEIA 1SH0A 2LQ5A 3GSIA 2P8IA 1FE0A 4NLQA 5DQIA 4F02A 4I6AA 1RLDA 2FHKA 2DNLA 4BWJA 2BRLA 3OSNA 3ISZA 4KR0B 3POTA 2ZH4A 3CTRA 2YQ3A 1Q1KA 1FO1A 2L9WA 1TAQA 3AD7C 3DOMB 5U47A 5KFPA 4NXMF 4HACB 1S4FA 3Q8QB 3HJVA 4OHWA 5MAOA 2DO0A 2HAIA 3MUVP 3V81A 3IS9A 5GMDA 2HZCA 1YG0A 3WQPA 2YWHA 3FDSA 2PD1A 4OI3A 4CLFA 3PV8A 5LSOA 4DZDA 4LF4F 4KHMA 1PGZA 1QLNA 1D0EA 2M8DB 3TI0A 3J80Y 4N56A 4X4NA 4IFVB 3PCOB 3OD2A 2R2UA 7FDRA 2DHGA 1VBXA 1RTJB 4ZOSA 3QJPA 4L75A 2F9DA 3KG4A 4TVAB 5E7OB 1T94A 4JI7J 3T1YF 2FY1A 2ZH6A 1EP4B 3G6XA 3QRQA 2BW2A 3D7SB 1HNWJ 1F60B 1VGYA 1IBLF 1T9UA 3FZBA 4CLKA 2EI5A 2IM3A 2JC1A 4FYDA 3L7PA 1XMQJ 2GA7A 2DITA 1D8ZA 4ZHRB 3CC4S 1G6BA 2CIMA 3T1HF 3W2VB 2XULA 4IQXA 3BKUA 3NS7B 4PXCA 1M1HA 4JI0F 1TKDA 1QUPA 2D1CA 4EYHB 4RW9A 1X5TA 1JMTA 3FMBA 1I6JA 1FRJA 2YNGA 1U6FA 1KFSA 5J1EB 4CO1A 1LFWA 5HVFA 1RHKB 2AJQA 3GIIA 5K14A 2ZBCA 2CZ9A 2UU9J 4A4JA 4CLLA 4FPIA 4EBEA 3GYGA 4YUDA 3FMWA 2BJ9A 3QT7A 2MGZB 2C22A 4C9DA 4Q2LA 4HEA9 5KFGA 5C2CA 1HMVB 4JI8F 2W4DA 4AL5A 3CCLS 2AD9A 1RAHB 3OLBA 3KNAA 4K4ZA 1S9GA 4HH1A 2GAGC 5CD4A 1TV6B 2YH1A 3MOZA 1FHTA 2BANA 1C4CA 2L08A 4DCPB 4NEZA 1AZSB 1RHMB 2JLGA 2ZEJA 2HNZA 3T5HA 3MFHA 3R2CJ 2Y1JA 1FXLA 5LMNJ 3TVZA 1KDNA 4F4ZA 4P71A 2HFUA 1Q86T 3BO3A 5ETMA 1E6YA 4GC6A 5CH7B 3CC2S 1RT1A 2JOQA 1ZM4A 1RWPB 2R7UA 4RNOA 2YTCA 1ZAWA 1UETA 2CPDA 4R5PB 1U1MA 2OI2A 1IBKF 2QJ3A 1RTIA 4ZVGA 2VPYB 4X66J 3N79A 5I3UA 4CLWA 2OPRA 1Y0HA 3VZIA 2LEAA 4DL3A 2PC6A 1JJCB 3MTJA 1UVKA 2JSXA 1L3KA 1GMWD 2AHOB 4WU3A 3G71S 2KTQA 2ZH7A 1IVZA 1RT4B 1IKVB 1U45A 2G0JA 1XR7A 3HHLC 2YNIB 4ILMA 4LF6F 2VJVA 4DU8A 3SBMA 4YB6A 1HYSB 4QIFA 1NMEB 4MK9A 1C1BB 1CJUA 4HI2A 2BJ7A 4USTA 2CQ3A 4URGA 2MZJA 3BGUA 2PMZD 3VTIA 2Y1RI 3DMJB 4K4YA 1JLEB 2OMLA 4Y2KA 2EBEA 4RL1A 4B9TA 2VH7A 3QQCD 2FZKB 2HLTA 3MCSA 1WDTA 3MEDB 1GH8A 3FBFA 1GT8A 4ELVA 1HBOB 4W4MA 4RUCA 1RBOB 3G82B 2UUAJ 1HNZF 2GVZB 2NXNA 2KZZA 3ULHA 3W60A 3ZZTA 4LR7A 2XGPA 3UO0A 2BE2A 2W2MP 4CM0A 5J2PB 1RBAA 2YPZA 1AYEA 4PYDA 1OO0B 4KKOA 1F1BB 2BVZA 5EX0A 2OPPB 4TXSA 2ABYA 2BJ1A 1BHNA 3QT8A 5J1NA 1I5OB 2POKA 4C0BA 4ECSA 4KPYA 3TP2A 5CYJA 4KPCA 3ETMA 5LL6d 1WKKA 1T03A 2W1BA 5HSPA 5G0RB 3QJJA 4U8YA 3LP1B 5E2QA 1M5PC 4RUBA 3QGPA 1AUSL 5FDLA 3IWXA 2DGSA 5IQQA 5CZVA 2R2RA 1U2FA 1M90T 3OFFA 1S1UA 1G3OA 2ZH1A 3JTPA 4I2PA 4MK7A 2V50A 1UJ4A 3LH2S 2DVIA 4WFYA 3M8SA 3OBIA 4XIUA 6AT1B 2MZTA 2W25A 3ENVA 2QA4G 4QIGA 3R1HA 4LVOP 1H7WA 3TOQA 5EWEA 1S1TB 2F65A 4BHQA 1SCJB 3EVMA 2CJKA 4YR2A 4WP9A 2MZSA 1X4DA 3MMBA 3LGNA 2NR0A 4C11B 4BCAA 2VF3A 2HHTA 3NLCA 4NLDA 4B9LA 2ZC3A 1NSKL 4JI1J 4JI6F 4NCGB 4DV0F 2GS8A 3CJ5A 2AMCB 1NZAA 2IA6A 2LKZA 3DNCA 5J2MB 2ZH3A 1FKOB 1H2UX 3I0SA 3U7JA 4DV4J 1UW4A 1KC8T 1WOOA 2E1CA 2WVFA 2DIVA 2QV6A 4WBFA 2HFOA 2OFGX 4WZMA 1AT1B 4N47A 3HSZA 4PUOA 1LK7A 2GJFA 5CCLA 3N5BA 4JI1F 3BKTA 1Q78A 3PKYA 3NGDA 3KK2B 1TVRB 2PEHA 2HFVA 1X4CA 4OX8A 4DQQA 3HHEA 4Q2MA 2UUTA 1S97A 1FTRA 4EFAC 3EDRB 2DGOA 2IJFA 1UVMA 2OEMA 3MD1A 3N28A 2XLJA 1URNA 3GONA 3OHBA 5E33A 5A2QU 1F0XA 3VGTA 1U1OA 4DL4A 1JLGA 3A1YG 3KK1B 4ECZA 4JB8B 3D6MB 4PG4A 1Y11A 2DH9A 4YY3F 3DM2A 4KGMA 2BBEA 2LA6A 3PIPQ 2ZD1B 4YR0A 3UI3A 4P75A 4X4OA 2V67A 3AT1B 4PKDB 2LMIA 5KFBA 3CJKB 5GAGU 5E0OA 3PX4A 2K7JA 1WF2A 4ZCIA 1F3VA 2MKKA 3SYZA 1NSQA 3J7A1 3ZZUA 5AXKA 2OKQA 4B3SJ 1DLOA 4FVMA 1KVKA 2WW8A 4HDHA 4OI4A 4QPTA 4B9UA 1T9YA 3D0IE 3PEHA 1ZH5A 1TL7A 2KU7A 4DQRA 2AEMA 3O6QA 4ZLLA 3PY8A 1TFWA 5I4MA 3TO8A 3R5DA 1NKCA 5BR8F 2R8KA 2H65B 4GKJJ 2CVIA 4GVBB 3UNYA 5LJ3Y 4A48A 2K3IA 4FVCA 4E8UA 3PYDA 4F50A 2XSFA 2CNLB 3I0RA 4A47A 4ILRA 2AQ4A 4PQUB 3PJWA 2HGLA 1AW0A 3SDEA 3LANA 2VOPA 2E9RX 2V4JB 1AFIA 5F3ZA 1RTDA 2Q43A 5LXRA 2N4DA 2QA2A 4DSIA 1EKRA 3P4UB 1FWPA 3GJSB 1N33J 3KJVA 2I38A 3OR2B 1Y5NB 3IA0A 3K5OA 3BM7A 1TL3A 1U49A 2F7VA 1CJVB 2HBRB 2P6TA 4C8KA 1GTHA 2P9EA 4WFAQ 2UXBJ 3IR5B 5F8MA 3T6BA 1YJNS 3PACA 2HNYB 2CPEA 3LP2B 4LT6A 1Y3KA 2RU9A 1FI4A 1UP1A 1S9EA 1AFJA 2Q6CA 3HMJG 1OY6A 1RHJB 3TZWA 1MG7A 3T41A 3KWMA 3DOKA 2KO1A 1NKBA 1GMUA 4L3NA 3K0JA 4RUHA 5A8KA 4NMXA 3KHLA 1RT6A 3GLJA 1U48A 1NCLA 3MMAB 1MMNA 3MPVA 2M9KA 4WFXA 3FCVA 3K7RA 3DDNA 1XJWB 5KFEA 1FDNA 5SUHA 4EU0A 4RNNA 3R6LB 1Z1ZA 3FBCA 3BKFA 3KDNA 3CJRA 1HIYA 3F56A 2HK3A 2J9CA 3DLLQ 1WC1A 4HTJA 1DZ5A 1V5VA 2DCLA 2CYYA 3LP0A 2MKCA 2KB2A 3B8HA 2QSWA 5A8RA 2VG5B 4DR7J 3M6WA 1RZMA 3M8YA 1NSPA 4R0JA 1EETB 2EG2A 2WAQD 2IVFB 1BQMB 4Z37A 3AXMA 4MK8A 5HAOA 3LUYA 1T95A 3SSQA 4B9VA 3PYEA 1QTNB 4I6WA 4MMOA 2R9LA 4RWXA 3L7OA 1T02A 4HLBA 3J7AN 1WORA 3W9JA 3GB0A 2PN6A 2C2KB 4ZMMA 3NOCA 2ZH5A 4NA3A 4Y2CA 3NS6A 4TY8B 1HBNA 4PWDB 2V63A 4DR7F 2Q66A 1H6KX 4O23A 1SI9A 3PJXA 1WHYA 4X64F 3BBCA 4J9PA 2BJDA 1NEEA 5L1KA 5ETOA 2AYMA 2MYFA 3PR4A 3D28A 2VKRA 4LF9F 4I6YA 2KJVA 4LF5F 3BGLA 3C6TB 3FSYA 2AIRB 3ADAC 1IKWB 4DLEA 1Y5LB 3GFXA 1NJXA 1M5HA 2BRKA 4G1QA 2XZTB 2Q6BA 2WCXA 1FRLA 3OTOJ 2XMTA 2O3DA 4DF4A 3DU6A 5J1PA 3HULA 3N0VA 4OQJA 2BQ3A 3DC2A 3NMRA 3U27A 2ZWOA 3OTEA 2OELA 4RW7B 4ECTA 1HD0A 2W9CA 1SC4B 4ZVUB 1U24A 2YQ0A 4WIQA 3HFKA 2YKOA 3S6EA 3UCGA 4LF8F 4QU7A 1SQEA 2V5HG 3V6HA 1KNZA 4B3RJ 5KG2A 1TL1B 3RW6A 1BQNB 3LTOA 2OFHX 1UFWA 3BYPA 1N6QB 5AXLA 4AXJA 2B7BB 3RB3A 3KNGA 1HMVA 3ILOA 1MWYA 3CE8A 3GIJA 3FSXA 3BDPA 2R7SA 4CO2A 1ZM2A 4CYUA 3MM8B 4CP5A 1UEUA 5B0EA 1UAWA 2WB4A 4NLPA 4USWA 2GHPA 5FIIA 1CQNA 2UZAA 1WC0A 1HR0F 4JV1A 3ZZOA 3NS5A 4Q45A 4EMDA 4OI0A 4OZNA 2K7KA 2JFKA 4YP3A 1BWEA 1VRQC 1HBMB 2I6WA 2MXYA 3F0NA 1ZETA 2V69A 2CUYA 3CDBA 2FQQB 3HHLD 4R25A 4DV1F 3UN5A 3CT9A 3JSRA 1Q8IA 4WJBA 4O3QA 1HL6A 3K8WA 3W5ZA 3CD6S 3QGHA 3TQEA 3MTKA 1DRZA 3W3SA 1S77D 2JHEA 1WEYA 5I3QA 3CIMA 1IKYA 3SQGB 1M5SA 4OIXA 3SSSA 1RDRA 3AJ2A 4BDPA 3N6NA 2FHJD 3DXBA 3BV8A 4Y00A 3M30B 3EDQB 4DPUA 2DNPA 1GFWB 3JQMA 2AEFA 1N34J 3ILJA 3OXGA 4Q0BB 4NLXA 4KTQA 2NSBA 2MSTA 1L5UA 3OL7A 2XMKA 2W2OP 1K73T 4DSLA 1LWCB 3CCUS 2GQCA 4PWWA 4K4SA 2L9NA 5DG9A 5KFNA 1H3DA 2JEIA 2C28A 1RHUB 3LA0A 4NRUA 1S76D 1KEKA 3AODA 2XTJP 4DU7A 2F4VJ 4YDXA 2RU3A 3VQTA 4OYXA 1HQEA 4ZDNA 2HQIA 1GTEA 2R7QA 3KG0A 4MFBB 2ZWPA 1X4AA 2NXJA 3G8TA 2IMOA 4DV3F 1VRUB 3QRPA 2PA8D 1LXNA 3G82A 2CPYA 3HM9A 4B3OA 4PPZA 4DS5A 3V6KA 2D3O1 1N5VA 2J9DA 4WXOA 2MMYA 1VQKS 2CJAA 4M5IA 1L3VA 5C7PA 3TQ1A 2WBMA 4IO1A 4GKKJ 1NU4A 4MH8A 4CT8A 3V6DA 4NXNF 5EWGA 3D5MA 4DV5J 3C6UA 1S1WB 3KLFA 4DR1F 5GMKa 4TLRA 4X4UA 3U1NA 2YWWA 3UR3C 3QIPB 3RAMA 2DPJA 1V3ZA 1RT5A 3TJ9A 2BJ8A 1HPZA 3FVYA 3LALA 1UW9A 4C3MA 3BQ1A 4NWBA 2FLNA 1WEXA 1IJFB 1RWWB 1MROA 5AE2A 4Q5VA 1WSVA 2V8HA 3R8YA 2VFUA 1WSRA 4UW2A 1FVQA 1ZM9A 5KFWA 1UEKA 5HATA 1RTHA 2GMHA 4X4VA 2XLIA 3ET6B 3R7SB 2GAHC 1VYAA 4ZVRB 2ZFHA 4P72A 2NSCA 4Q7AA 4DZ6A 1HQUB 3L09A 4KFBA 2XS7A 5D0HA 2EFNA 1PJ6A 3M2RB 1TQLA 2V34A 1TKTA 5KFOA 2ADBA 4M5DB 1P27B 1JJ4A 4KHRA 3HZEA 5A6PA 2DXDA 5BYSA 3I4HX 3AH6A 2B43A 4QJVA 1ZPWX 1B0PA 2FB0A 1U1NA 2ACYA 2E7XA 1IR2A 1O6XA 2HHQA 1JKHB 4IFYB 3ZTQA 1DJ0A 3JB9k 4I67A 3OR1A 2DNMA 2KRRA 2DGXA 4FZVA 3V6JA 2FJWA 4TYAA 1SKUB 3WIVA 3GCWP 3I4PA 8ATCB 2XSJA 3DN9A 3MM5A 1JLFB 3EYZA 2IBOA 3ILLA 2AW0A 3THTA 4HT5A 1WC3A 3DRYA 4ZPDA 1TVRA 2QC3A 1IKXB 2Q3PA 1HW9A 1RWVB 3LW5C 4OZ5A 3IRXB 3K5NA 4JI3F 4OJ3A 1XBWA 3ITHA 4J9QA 4FN5A 3WIUA 1ZOTA 1F3FA 1EHWA 4F4YA 3C2PA 3KLGB 2EVZA 5KFCA 3N6LA 5AJ3F 2F8EX 4PPDA 3TEHB 1IQZA 2MB0B 4HHUA 3BEGB 2MQ8A 4O4GA 2DYAA 5IV4A 3J7ZT 2J7UA 2VOOA 1RXOB 1P6TA 4KGKA 4B3MJ 4WCEQ 3UW1A 5D0EA 2QLWA 4FXWA 1N8RT 1XMBA 2XYPB 2E66A 2H51B 5L1LA 1H2TZ 3GZ7A 3LO3A 2B7CB 1LW2A 4WKRA 3KK3B 4K4WA 3S1TA 3NNCA 4DR6F 4O3SA 1F5AA 4RU9A 1MWQA 5T14A 5LJ5Y 2ZOFA 4CH7A 2D3UA 2ZH2A 1S6QA 2FJEB 2MLZA 4WFZA 3D0HE 1PBAA 2ZM6J 4H4OA 3TEGA 4OHVA 2UUCJ 3HFZB 4FNIA 1CS4A 4I1TA 1IBMJ 5F0UA 1Q7LB 4AQYF 1K47A 1H72C 5DDPC 1S6OA 5CXTA 4C0OC 4LSNA 4XAKA 3C19A 3IWLA 4OYAA 3NY0A 3RBDA 2CPZA 3IO1A 4U95A 1TL5A 2ZM6F 3EZ5A 1V9OA 3WBZA 2FPHX 1NJIT 2DEJA 2KG0A 2HIYA 4E2FB 3KUHA 2N7CA 4URSA 1KS2A 1H38A 1NK7A 4HI1A 1C4AA 1UZHA 5EHHA 2WVBA 3J80U 1OSCA 3OLAA 1IWGA 4CH0S 1TUVA 3IGVA 3OTDA 4KJIA 5C25A 2UXCF 1U6ZA 3OUYB 1VHIA 3QAUA 1T3NA 4ZITA 4X62J 3SFGA 1KQGB 1WC4A 1SJ4P 2QMXA 1F9HA 5IOLA 3NGRA 4C3LA 2XO6A 2YKNA 1S72S 4ETZA 1ELOA 1SQGA 1RUSA 2VBWA 1HNXJ 1OQ6A 5A0YB 2DR8A 3M05A 4QQBA 1C0UA 2YNHA 1RLCL 2H4YB 3RW7A 2VASA 2R7XA 2JJ4D 1KKHA 3TUPA 1HBUA 4LF1A 1TL4A 5KG6A 4PXEA 4X62F 5GAGI 2V2KA 2RF2B 3IR6B 3P5BP 4CT9A 2C3PA 2AWZA 1XK8A 1X0FA 4ICLA 2QMWA 2ZKUA 3HD1A 2CQHA 5E5NA 2JEGA 3G87A 2E5HA 3IC1A 4MYTA 2HHHJ 1JLAB 2PFDA 1IWAA 4EYIB 2DIUA 3RR7A 3RAXA 4YR3A 2R2SA 2B4VA 1P1TA 4LF7F 4NOHA 3BZQA 2G0IA 3K59A 4DPYA 3DRRB 4DR3J 3P49B 3EGNA 2GV1A 3E01A 1LWEB 5K8PA 2F63A 1S48A 2JVOA 1DQAA 3CD7A 3FEZA 2VDIA 2BJEA 2QO3A 1YHQS 1B99A 4O44A 1VK8A 2VG6A 1XNQJ 4RWWA 1U26A 2HWTA 4PZVA 3CCRS 5KFVA 4ED0A 3HHLA 3POTB 4RLEA 5ETNA 1D3WA 3DLEA 3FSIA 1YJ9S 3J81j 3CEDA 3I55S 4OJGA 5HVGA 4LUBA 1V5IB 4HHJA 1VQ8S 2CJQA 1RAEB 2ROPA 5KG3A 3PO5A 3BYRA 2CZVC 2LQJA 3PHEA 1EQMA 3V81B 1A6LA 3H59A 3IS9B 1TTHB 1WWHA 4PG5A 5L1IA 2FHJA 4JV5J 4YQWA 1CC7A 2E7WA 4AE5A 2B4UA 2W2QP 1RISA 3DYAA 3D6FB 4JI4F 1SH3A 3QNWB 4PXBA 1YRXA 1VHFA 2R42A 4LIRA 2ALZA 1R8BA 3CJ3A 2MZQA 2KZMA 1T3OA 2D74B 1D09B 1Y5IB 3EVOA 2NXCA 1PAUB 2AU0A 4UOHA 1MWZA 5C42A 4WWSA 3LWLA 1X5OA 3GG0A 2CQCA 4EGLA 2I9SA 1FKPA 1H7XA 1C0TA 2QYGA 4DV2F 3H25A 1S0OA 2BE9B 4AL7A 3MOJB 3DI6A 3DOLA 3T9NA 1JXEA 2N7YA 2DGUA 2GHWA 4ZK7M 3HP6A 3VAJA 1NJYA 3H2VE 1B4SA 4U67Q 4QCLA 4K4XA 4DMZA 4YS2A 2XHCA 4DV7J 5F9LA 4Y3CA 3VAGA 4RW9B 2DY9A 2YNGB 4DCOB 1NZ8A 1RSCA 5DRKA 2VICA 1YZ6A 1VOMA 1N5TA 2FIUA 2OTJS 5K14B 4CLYA 4N8NA 3HVRA 1U25A 4Y2IA 5B09A 3TJ8A 3HKZD 1VQ9S 2KH9A 4I2QA 2V9KA 4NYPA 3DXSX 3E8OA 1HWUA 1S1VA 2J6UA 4ZP7A 2D7SA 2BZ2A 5SZTA 3KTQA 1NPKA 3ZC4A 1PYSB 1RWKB 4QYZK 1R6YA 4F4XA 3I96A 3ZTRA 3K89A 1FXRA 4C8LA 1GXUA 1S9GB 1YX2A 3M6VA 2YKPA 4XK8C 3FQKA 4JYAF 4OX6A 2MJNA 2UVVA 2BANB 1Q7YT 1JIHA 3MFIA 3E2EA 3SQGA 1SJFA 2DNKA 4TU8A 5BJRA 2W01A 2HNZB 1I51B 1KWMA 2IVYA 2OSRA 2KXNB 2KM8B 1MSWD 5IXUA 4DPXA 2B9WA 2EK1A 1FJGJ 5GADU 1D9DA 2HLUA 4I7FB 1E6YB 1S1XA 4DUZF 1BD6A 3I5BA 3RUBL 3GMGA 3JTNA 4I56A 3FGVA 3KLHA 4G1PA 1Q16B 1TU0B 5C2GA 5I3UB 3MM6A 2OPRB 4LMZA 2CJ9A 2OGUA 5HJYA 2ROEA 1EIYB 3AHPA 3PRVA 3PRBA 4ZPTR 3RB4A 1S99A 4ALZA 4RO0A 2EFGA 1B0VA 1XERA 5IC4B 2LEBA 3PKMA 2OEKA 3QAEA 2AX1A 3HSDA 1H2VZ 3Q24A 3P5TL 2YVSA 4BC7A 1YRUA 1BC6A 3M8ZA 1EQ0A 3TW0A 2DNHA 3CCZA 3FK4A 1CJUB 2DNYA 1K9MT 1NHVA 2AZ1A 3VGUA 2AP6A 4ECWA 2KHDA 1JLCA 3QATA 1S7IA 2DHHA 3KLVA 1UL3A 3IM9A 3IFEA 3RRHA 3IAS9 3TYTA 2HZAA 4DJBA 3BR9A 1VRTA 2V8VA 2XMWA 2J7KA 1LWFB 2F9JA 2Z57B 2RAQA 4DUYF 4GO5X 4A8SA 3HK2A 1HA1A 2AF6A 2NS1B 3GILA 4H4KC 3R2DJ 3PVXA 4RW8A 3DHXA 1BE4A 1J2VA 4OI2A 2JFDA 4LRDA 2O1PA 3QJLA 3CMQA 3ZNJ1 5THWA 4J9LA 1E6VA 3HSJA 3KJFB 1S0NA 3ET6A 1NH7A 1KBRA 5JVHQ 3FCHA 2BE2B 3L9ZA 4OYMA 2LECA 5D4LA 3R27A 4U8VA 5KG4A 4IKAA 4ED1A 1M0SA 4F26A 4KKOB 4DOZA 3FRYA 1SJ3P 2NZCA 5HVHA 4DV6F 2IMWP 2W9BA 3GJRB 2UVRA 3CO9A 5KT2A 4XDCA 2VG7A 4CQ1A 1S6UA 2FJBB 1R0CB 4HDGA 3CD5A 4IO9Q 2UP1A 2FVSA 3QGGA 5JJBA 2AX0A 3R9LA 1T03B 4TU7A 1AXQA 4YB1P 1MLAA 4CRJA 4LRAA 5H9EJ 1K8AT 5HL7Q 2M88A 2OPQA 3P96A 2UUBJ 2ZH9A 3GTYX 5FDLB 1ZM3A 1URRA 4J9KA 3EUNA 4A8XA 4DL6A 3IXQA 4I2PB 2GMLA 4N77A 1WD6A 4OL8A 3EX7B 1UVLA 4OHXA 2DGWA 3QT6A 3SMZA 3KOAA 3LF0A 1Y7PA 2H1YA 2YY3A 2NPFA 5LSRA 3UD5A 3NNHA 4IG0B 1GQEA 3HKWA 4K0KF 2E5LJ 1HKAA 4NCAA 3W66A 1OQ3A 1OIAA 4QR0A 1ZAVA 1JLFA 5L9NA 2UUBF 1VBZA 2CZ4A 1JJHA 2PEBA 3NBPA 4OZ0A 4O4RA 3MR3A 5HMZA 2E7VA 4EI2A 4X65J 2PMWA 2OJ3A 1QSYA 4OYIA 2R7WA 1RT7A 4ECUA 2EK6A 1FRMA 3QFWA 2LDYA 1S12A 4ANDA 2HK2A 2APOA 2FZCB 1EB0A 3ELHA 4RU2A 1FCAA 5L9XA 1HQ2A 4ED5A 4OZJA 5L1JA 3KLGA 3QWPA 5HQLA 4Y65A 2WVDA 4M8LA 3I0SB 3C15A 3OFEA 5IC6B 2DRAA 1REVA 1WKLA 2P9GA 1LV5A 4PUOB 4OX9J 2GC8A 1J27A 2MY8A 3MECA 1T7PA 2FVQA 5M2RA 4ECVA 5C24A 1R27B 2LU1A 4ZVHA 2J6TA 4UZBA 4H4MA 2HHSA 4QIVA 1VDHA 5IT9Y 3MAQA 2F5GA 2HPUA 1RA6A 2DR7A 2KI2A 2PGCA 2XGQA 2D9OA 2XYGB 4ZJQA 5KAKA 1JLGB 3QFHA 2E5GA 3TAQA 2HMIA 2KM8C 4BBYA 2JEFA 1UJ6A 3C46A 3M2VB 3WZ0A 3DM2B 3PW0A 2MSSA 3PHTA 4F4AA 2LU2A 4V19X 3D1QA 1J5EJ 4YN3B 3OV7A 1CVJA 2J5AA 1QAXA 1ZA2B 2MQNA 2A2DA 4OZ3A 2HFSA 2ACMA 3GIRA 1N0UA 4P7TA 1U1KA 3FBEA 1DLOB 2HHPA 4UOFA 1WG5A 2A18A 4CLZA 2M4MA 4UQGA 4FS2A 2QRRA 3OW2R 3KFWX 3D67A 4LF2A 1FK9A 2JC0A 4A8FA 1BXNA 3MEKA 6FDRA 1WEZA 3W1YC 2XMAA 2DNRA 4FPRA 1NUEA 1JNZB 2PFFB 3E3XA 2EKYA 1S0VA 2VA3A 3CCVS 1P8GA 1UZDA 1RK8A 3I0RB 5F0WA 3ZZ0A 3QZ8A 5KTQA 5CQGA 3SDEB 2X1GA 2QGFB 2CQ2A 3B4MA 4OV1A 1ACMB 5JUMA 4NLOA 1RTDB 3NCQA 4KGXB 3A13A 2IBKA 1Z4UA 5J2NA 4IRKA 4CLPA 4NL5A 4ZKAA 3DRSA 1FWLA 3IGNA 2XS2A 1VS3A 4QPXA 3KJVB 1W2BR 1HLWA 1VC6A 3MWBA 1IJEB 5E41A 5F8LA 1V6HA 1VJWA 2DRDA 3P45B 1TL3B 2WRMA 4NLYA 2AJ1A 2I5JA 5HI7A 2V0NA 5B0CA 1HD1A 3AXKA 4JOUA 2C2OB 2IDLA 3K17A 1WUUA 5KT6A 1F5BA 4K7QA 5C5JA 3HSGA 4C0HA 1VQOS 3KHGA 4WP3A 5KFMA 1U0SA 1FTCA 1S9EB 4ZVFA 2ZJPQ 3KKFA 1DTTA 3TUIC 2LXFA 3DOKB 3QSIA 2JH3A 3WX8A 2QX0A 3M6UA 2CQ0A 4F67A 2DB1A 5EN1A 4J9VA 3FKBA 4XO0A 3I56S 2GJIA 3I5AA 5A8KB 3QPIA 2BR0A 4F25A 1RT6B 1HHSA 3HZGA 4K59A 5HMWA 4OYWA 1JX4A 3UVJA 4ZVSB 1UPPA 4UOGA 3UDLA 1F6TA 4IG3A 2PA3A 4CO0A 2IYGA 4M5HA 3UR0A 2QEXS 4FYYB 2HBQB 4QU6A 4YHHJ 3TAMA 4LF4J 3LP0B 1TKXA 5A8RB 3R5JB 5EWFA 3PW2A 4O3RA 2CRLA 2N4CA 2RS8A 3AFGA 2IRYA 4DPWA 2V2QA 2N3LA 5D4NA 2XCAA 3N5FA 4I64A 1FDAA 3CWJA 3T1YJ 2E1RA 1XWLA 5IWAJ 1T9XA 2L41A 1KR4A 4J9OA 5JVGQ 3CW2C 2XEXA 4ECQA 2FD2A 1VMBA 2RRNA 2GIFA 3GYNA 1FFWB 1NO8A 2J8SA 2FLOA 1QE1A 4YHHF 2VPXB 4HT7A 1IBLJ 9ATCB 3MI7X 3ZTPA 5KG1A 4X84A 4CO3A 1HBNB 1M5VC 2VONA 4P2XA 1ROFA 1FVSA 3H2LA 1KOOA 4NLRA 3W5YA 3Q8RB 3T1HJ 3BS9A 1I1GA 4RW4A 1S59A 3ZNUA 4IUFA 4JI0J 2BX6A 2BOAA 2E1PA 4N8OA 5IWAF 4FKYA 3CDAA 1FNMA 4JI5F 4HHHA 2FJVA 1N5SA 5ITHA 5CYQA 4CLTA 5HN0A 4R8UA 2IM1A 1W2IA 2IC3A 2FGOA 1X0PA 2BABA 3L4BC 3KMSA 4G1QB 2HIQA 1DFDA 2VC1A 4M1KA 2DRBA 3TVYA 3VVTA 1FKAF 4JI8J 3SV4A 2GO9A 2E9TA 5KFUA 4KH0B 2UV8A 2EC2A 4J37A 3H2UB 4WK1A 1LW0A 4WYLA 4AXIA 1H98A 4ZN1A 1GXLA 4RW6A 5H9FJ 2W9CB 2FHMA 3MEEB 4DX7A 2ASJA 2IRXA 1RYRA 1OWXA 5GAEU 1X9SA 3O1LA 9RUBA 2A6OA 3BREA 4LFCF 3A8KA 2XZWA 2WVEA 1X7VA 1IR1A 3C8YA 3DHWC 1FWKA 3TNVA 1CLFA 3U1MA 2CPJA 1D8YA 1W25A 3GR0A 2AYBA 1FNOA 2Z2ZA 4R0EA 1XMOF 4DR4F 2KKHA 4CYUB 2ZHAA 2QYCA 4KH1B 3SV3A 1Q53A 1IBKJ 1OPZA 4CCHA 3R5GA 3CDUA 3RBEA 2Y3YA 4AT1B 1WOSA 1CBKA 2M0GB 1Z2ZA 4NLUA 1YGYA 2LQBA 2CWXA 1OY8A 1KD1T 3HO1A 1XNRJ 3B6BA 1QUVA 4I7FA 2U2FA 1FRIA 2AYEA 5MLCV 1C1CA 3VCDA 3QSYB 1T8EA 4OYPA 3GE9A 3GYXB 3ZZPA 3BGOP 2O67A 4ANEA 1VQ5S 4IRCA 5D78A 2OH2A 2AT1B 2UXDF 2C2NA 4LF6J 3JAMU 4DX6A 2DT9A 2WSCC 3AJ1A 1VJQA 4NZ6A 3F73A 3IWNC 5CA5A 2MKYA 3JXOA 3DRPA 1U09A 3MDFA 2G1DA 1XNRF 4ED6A 1IKYB 1D1UA 1U1PA 3ILIA 2Y0SD 4CWBA 4EO6A 4QWCA 2XWXA 5KG0A 2K1RA 2HHWA 3A8JA 2JL9A 4L73A 1MMDA 2HW3A 4L72B 2RDIA 2YX7A 2ALYB 3SIPB 1KP6A 1ITPA 3AD8C 2XMMA 3BSOA 3GG1A 4UOCA 1HI8A 2CXEA 1U2CA 2ZUGA 3GV5B 2R8IA 2HYIB 1VC5A 1Q82T 1LXJA 1HNZJ 3BO2A 1U8WA 1NM2A 1IM6A 4EUVA 3UD3P 4C8NA 2K3KA 1L3TA 4LFBF 1G1XA 1LWFA 1LNQA 1FDDA 5A8WA 1KLMA 3KG1A 2ZZTA 3NCPA 2VFTA 5ETLA 1HQEB 3QIDA 2DNOA 3HDSA 1V3RA 1MMLA 5B0FA 2WOMA 3NP5A 5LMUJ 2COLA 2VQEF 4B3OB 3AOBA 4OZLA 3A3NB 1KRPA 3MF5A 4B02A 2B6AA 4HKQA 3EXCX 5GADI 4KO0A 2EC0A 2HAFA 3V6DB 2KL8A 1IN0A 2W8KA 1YI2S 1SJQA 3C6UB 2H5EA 4O0NA 3KLFB 2UVWA 3Q8YA 3PRDA 3SSRA 1WHXA 2WW4A 4DL2A 1YVFA 1D9FA 2ZDPA 5LMUF 4J9UE 5M2PA 1XC9A 3UFCX 4UY85 4ITSA 1WKJA 4NYZA 1RT5B 4PG7A 5B7WA 2DKOB 3S01A 3MAAA 5F8IA 1HPZB 3R6GB 2ZNZA 2QA1A 2DXEA 1FNXH 1Q5YA 2QT7A 1UKUA 2AJFE 3CF5Q 2ZBRA 1MROB 3HF5A 4FBTA 4UZCA 3BR8A 4DFJA 1R8CA 4ERDA 3FUYA 5G4DA 1RTHB 1KVJA 1NDLA 2HFZA 5DJBA 1Q81T 2YQ1A 4JI6J 3DGPA 1UFLA 1PBUA 3DLJA 1T9TA 4DV0J 2SXLA 3G96A 2Q1LA 2MZ1A 1N32F 2A6MA 3VWSA 1NJZA 3ZXWA 5E3PA 1R89A 3SCIE 4IG0A 4KFBB 4DDFA 1RKJA 1FFSB 4KGVB 1TKTB 4HR2A 2AEJA 2QTWA 2MQMA 4F2SA 2R7RA 3I32A 3CPWR 1T05A 3PYFA 4X4QA 3M2UA 2QLJB 2G9OA 1KQKA 1X5SA 2KJWA 3CJ0A 3PW5A 2DGVA 1KQSR 4N7TA 1HARA 3QRRA 3CNQP 4U9RA 5F9NA 2V8DA 1RT3A 3OR1B 4CZCA 1QAYA 1QDUB 2PE8A 3BBFA 3EGVA 3BDEA 2B56A 3MXHP 3FEYB 3H8YA 2BUNA 1HNIB 3WC0A 5DQHA 2E1AA 4N76A 1X4HA 2XSJB 5ETTA 3DU5A 3W62A 3W65A 3MM5B 1W26A 2QLBB 4YY3J 1A0OB 3GJQB 1KONA 2CJBA 3CULA 4RBUA 5H1SV 1X4BA 3PFEA 2A0FB 3W63A 1FA0A 2RMLA 3ITHB 4AFFA 2YH0A 4IDKA 4W92B 2B3TB 4O3NA 2XB2D 1BLUA 3C14A 3G2XA 1CJKA 4X4RA 2R7TA 1IBCB 3QT5A 2Z2LA 3Q8VA 1W7WA 3M2VA 5E3AA 2DISA 3R97A 1X4EA 4O4GB 3NGTA 2ZHBA 3BF4A 2F1FA 1Q8LA 2Z0GA 5HO4A 3ZZZA 1HNVA 2FJDB 4EEYA 1UPMB 1R8AA 5B0BA 4UF4A 5BR8J 4Y2MA 3UNGC 2QG9B 3CDEA 1SC6A 2RT3A 1HI1A 1Y4ZB 3QMQA 3MM9A 3SFUA 1LW2B 2J0XA 1WOPA 3TARA 3CSKA 4ES1A 2BKPA 1YITS 1S6QB 3THVA 3US5A 1SVDA 3I5CA 1DY3A 2H5IB 4H4OB 5EUHA 4B17A 3H4DA 2ZE2A 3VZHA 3W5XA 4CTAA 5KFSA 1OPIA 1CS4B 3MR2A 3UN2A 1KOHA 1HWLA 4B08A 4KV8A 5JMNA 1X4GA 1VR6A 3EMTA 2WONA 4WFNQ 2MHEA 2FLLA 2BV3A 2FGCA 5ETPA 3LGHA 3WX4A 2ZVSA 2CQDA 1JWWA 2RSQA 1BY9A 4ER8A 1UVJA 1C2PA 4LSNB 1MNEA 1FJ7A 3D9BA 3T5JA 1VQ6S 2FJAB 5D4PA 4WPAA 2HKEA 3G9CA 3EPIA 1FX4A 2OO4A 1EX8A 4BWMA 2AGQA 4LFAF 1HW8A 1K1SA 1L3SA 3KUGA 1VQPS 1I94F 4HH0A 3HT3A 4CLUA 1CULA 1QY7A 5F8HA 2MPUA 2MQPA 2XMJA 2L3MA 2HHXA 3CCJS 5KFRA 3OSPA 3CJ8A 2HQDA 1PC4A 5C25B 3KMQA 2P5VA 2FVPA 3ISNC 1K44A 1OY9A 2J0WA 5K9FA 3M8PA 4C48A 2YKNB 2WB1D 3KLIA 4ECRA 1TZ0A 4PYAA 4J9SA 4NE9C 3BQ2A 4J91A 4D3GA 1C0UB 4P52A 1YQHA 2YNHB 3PIOQ 1TR0A 1R8PA 4RJVA 4IOCQ 3G8QA 1HBUB 2RD5C 4C8MA 2Q79A 4WTYA 4RR5A 2CJXB 3WHIA 4ILLA 4OFZA 2F40A 3M32A 2JVRA 2Y8YA 2RUGA 3LAMA 4EBDA 1YIJS 3GFHA 2ZUAA 2B51A 1P1LA 1P9QC 4ICLB 3EWGA 2NCKL 4X2BA 5I42B 1GMVA 2QE5A 5DM7Q 2CADA 3H90A 3W8PA 3BSNA 1NAQA 3IM8A 4WFBQ 1WC5A 2LVWA 2HEKA 5DM6Q 2GFFA 4X64J 3EM1A 4JV2A 4LRFA 2M70A 3RYLA 4DLGA 1XEZA 2RHQB 5A6WA 4C3KA 3L3CA 2CDRB 4LF9J 3EPGA 4LBPA 3N6MA 4LF5J 4KHPF 3E01B 4PXDA 2C2RA 1VQLS 2ATLA 3CC7S 2EWHA 2KVIA 5DDQC 1U02A 3FZ2A 2HQ3A 3JSMA 1RAFB 1UMJA 4O44B 4BC9A 2VG6B 3MR5A 1D9AA 5D15A 4PCQA 5HLFA 2DNZA 3TX0A 2XG8A 2BKOA 3HHLB 5EGYA 5HP1A 1U8SA 3NGUA 3DLEB 4DR5J 1I3OB 4EO8A 4B9MA 2RKIB 4DQSA 2GVDA 2IA0A 2RB7A 3I82A 4ZPBA 5IS2A 1U0HA 3D3BJ 3PO4A 4LJMA 3W9IA 4LF8J 1SUQA 2Z58B 1GMWA 1IQTA 2XM3A 1JXVA 3BQ0A
chains in the Genus database with same CATH topology
3QGPA 5FDLA 3KLHA 2DHSA 2M8HA 3IWXA 4DX8H 2DGSA 4G1PA 5CZVA 5IQQA 4JV0A 2R2RA 1U2FA 4WK3A 1M90T 3OFFA 1Q16B 1S1UA 1G3OA 2EFQA 4JI2F 2ZH1A 3M8PB 3DYAB 3JTPA 4DR5F 5I3UB 1WELA 2VB6A 2ZZNA 4I2PA 4C2MA 3MM6A 5E3QA 5LT5A 2OPRB 3TX8A 4LMZA 2M52A 3MHYA 3N9UC 4MK7A 2CJ9A 2RRBA 1UJ4A 3KLIB 2ROEA 3LH2S 2DVIA 4WFYA 3AHPA 3M8SA 3OBIA 3PRBA 3IG1A 4ZPTR 4XIUA 3RB4A 1SKSA 2AJ0A 1S99A 1VBYA 2A3JA 3T3FA 4OZ1A 2MZTA 2W25A 2YKAA 3ENVA 2QA4G 4FS1A 4ALZA 1Q79A 3MEEA 4LSLA 4QIGA 2B5JA 2EFGA 5GAHI 2PSZA 4HVZA 3R1HA 4B3MF 1B0VA 1XERA 2LEBA 1WHWA 3PKMA 1AUDA 3QAEA 5C42B 3O44A 4LVOP 1KN6A 2AX1A 1UWBA 2M5YA 2KRBA 3RTVA 1NK9A 1H7WA 1SB6A 3BN7A 4OMFG 4JUZA 3TOQA 3VAHA 1H2VZ 1S1TB 4BHQA 5EWEA 3P5TL 3Q24A 2YVSA 4BC7A 1YRUA 2CJKA 4DN9A 4YR2A 2GIQA 2MZSA 3V4IB 1FKPB 2GCFA 1BC6A 1X4DA 3BGRA 3MMBA 3LGNA 3ZZYA 2CQBA 1X9MA 3PM9A 2NR0A 1C0TB 4C11B 3TW0A 4BCAA 4PQUA 2DNHA 3CCZA 1M5OC 4JBCA 3VALA 1FESA 2R8JA 1R3NA 3M32B 3MR6A 2QA4S 5IZHA 4IYQA 2HHTA 2DNYA 1K9MT 3NLCA 4NLDA 4B9LA 3DI6B 1NHVA 3DOLB 2ZC3A 4ZVEA 2ZNYA 4JI6F 4NCGB 2V4JA 4B9NA 4DQPA 2AJ4A 2AP6A 4ECWA 2KHDA 4DV0F 3CJ5A 2UUCF 1JLCA 3C66A 1NZAA 2IA6A 2LKZA 5KG5A 3DNCA 4MKBA 3KLVA 1UL3A 2J76E 5J2MB 3Q23A 3IFEA 3RRHA 4B3TF 5HQ8A 4K2XA 3IAS9 1U6BA 1IBMF 3TYTA 2R7VA 4DJBA 2ZH3A 4ED2A 2A1BA 3BR9A 1N5QA 2DR5A 5AXNA 1VRTA 2V8VA 1FKOB 3IRWP 1YSJA 1H2UX 1FRKA 3I0SA 3U7JA 2GGPA 2CPXA 2XMWA 1KC8T 1UW4A 3OR2A 1KVIA 2J7KA 2E1CA 1LOUA 1LWFB 2F9JA 5IT0A 2DIVA 4KAIA 2X1FA 4DUYF 2QV6A 2HFOA 4GO5X 5IM0A 1PC5A 2JZ5A 4A8SA 2OFGX 3ZFVA 3HK2A 2BM0A 1HA1A 1FT8A 2CQPA 3M1VA 4WZMA 4LQ3A 2AF6A 4N47A 1VQ7S 2ZZMA 1HWJA 4J9RA 2X51A 3OTCA 2NS1B 3GILA 3NMAA 1JNRB 2OLWA 4H4KC 4PUOA 1LK7A 3C3LA 3HHDA 1Q4RA 2DR9A 3PVXA 4RW8A 3N5BA 2OPSA 5CCLA 3DHXA 4JI1F 4I2QB 3TR5A 1Q78A 2KG1A 3U1LA 2V4QA 2I0XA 5L38A 2HNYA 1S1VB 4OX7A 1J2VA 1SH2A 2DBBA 2HS3A 3LP2A 4G6VB 3PKYA 4FF2A 4OI2A 3NGDA 3KK2B 4IH7A 2JFDA 1TVRB 1NK5A 2PEHA 5F8NA 1ZPVA 4QR2A 2O1PA 3UQSA 4ECYA 1X4CA 3QJLA 4OX8A 2G4BA 4RX6A 5ADZA 4DQQA 1QSLA 4K4VA 5THWA 4J9LA 3HHEA 4Q2MA 2X3GA 1SKRA 1E6VA 2UUTA 1S97A 1FTRA 1GXTA 4EFAC 1S0NA 3JSMB 1NH7A 2FDNA 4Q44A 4ATNA 3LWMA 2OIHA 5JVHQ 2DGOA 2IJFA 3FCHA 2BE2B 2RRAA 1FJEB 1UVMA 4QYZJ 3MD1A 5HLFB 3N28A 2XLJA 3NL0A 4C8ZA 4DSFA 1TAUA 2LECA 4CO4A 1URNA 5D4LA 3R27A 4KQZA 5KG4A 5HP1B 3ETOA 4IKAA 4ZA1A 4ED1A 1M0SA 3FQLA 4F26A 3DLHA 3OHBA 4KKOB 5E33A 1F0XA 1KTVA 4DOZA 3FRYA 1PSDA 3MMAA 1SJ3P 2R7OA 5IT4A 4DL4A 1U1OA 4DV6F 1JLGA 2IMWP 1S7HA 3A1YG 3KK1B 2W9BA 4ECZA 1F2GA 3U02A 4MIBA 4PG4A 2UVRA 3CO9A 2DH9A 3VAMA 5KT2A 1FEEA 4XDCA 4YY3F 1FD8A 2VG7A 1FRHA 4K4UA 4CQ1A 3DM2A 1S6UA 4KGMA 3BGFA 2BBEA 2FJBB 1B7FA 4FBUA 2VBYA 4HDGA 2C3OA 2LA6A 3CD5A 4IO9Q 3PIPQ 3R3TA 2UP1A 4WE1A 3QGGA 2CVEA 2FVSA 5JJBA 2YX1A 2RJZA 1S1XB 2ZD1B 2LXUA 4X4TA 1HNXF 4XPCA 2AX0A 5A2QY 4YR0A 3UE2A 1T03B 1N88A 4F4KA 3UI3A 1KHWA 1SUQB 4X4OA 1Z2LA 2J0SD 4TU7A 1AXQA 2DGQA 4YB1P 3EGZA 3NWGA 4PKDB 5H9EJ 1K8AT 3NAIA 4ZPWR 4JI7F 5HL7Q 2M88A 2LMIA 2OPQA 5KFBA 5CZXA 3P96A 3CJKB 2ZH9A 5GAGU 5E0OA 3PX4A 2K7JA 1WF2A 2VG5A 5FDLB 3KLHB 4ZCIA 1ZM3A 1URRA 2MKKA 4J9KA 4U7UK 3SYZA 1EETA 5GAEI 2E5IA 2J7WA 3EUNA 3J7A1 4ZP9A 4A8XA 3ZZUA 3UPFA 5AXKA 1BQMA 1HNWF 4DL6A 2OKQA 2PO4A 2XMVA 1DLOA 3R5AA 3IXQA 3M8QA 3KHHA 4I2PB 4NMLA 4O3OA 3MM6B 4FVMA 5KFTA 2WW8A 4HDHA 4OI4A 4A8OA 4QPTA 2GMLA 4N77A 2BACA 5K8MA 1WD6A 4B9UA 4OL8A 3EX7B 1VQ4S 3D0IE 3PEHA 1UVLA 1ZH5A 1CQMA 5JXSA 2W7AA 4OHXA 2DGWA 1XMQF 3IG1B 3A8EA 3SMZA 3KOAA 2KU7A 4ZLPA 3LF0A 4DQRA 1N48A 3O2IA 5D8HB 1Y7PA 3O6QA 4OHYA 2O01C 2DPIA 3HHNB 4LSLB 2YY3A 2NPFA 5LSRA 3PY8A 2B5JB 1TFWA 1YTYA 3NNHA 5I4MA 1DQ9A 4IG0B 1GQEA 4DBQA 3TO8A 3HKWA 4OJHA 4K0KF 3R5DA 1NKCA 5BR8F 3GIMA 2R8KA 1UWBB 2LA4A 1JJ2R 1U1RA 3I6PA 2HHHF 4NCAA 1OQ3A 2CVIA 5LJ3Y 4PQAA 5F3TA 2K3IA 1OIAA 4FVCA 4QR0A 4A48A 4E8UA 1ZAVA 1JLFA 4TY8A 5L9NA 4QOTA 4F50A 2UUBF 1VBZA 2XSFA 2CZ4A 1DBDA 1JJHA 4RKUC 4PWDA 1SKWA 3BGRB 3NBPA 4OZ0A 3I0RA 1VIXA 2B9XA 4O4RA 4ILRA 4A47A 2AQ4A 1NH8A 2KDOA 3MR3A 3G8SA 4PQUB 1JLBA 3PJWA 5HMZA 3PW7A 4V19J 1K0TA 2HGLA 1AW0A 1L3UA 2QLXA 1RYSA 2OJ3A 1K1QA 3W7BA 4QIEA 2NZ4A 3HLUA 3T1AA 3SDEA 1QSYA 1JK9B 2W7PA 4LVNP 3LANA 1RT7A 4G1IA 2R7WA 4D3HA 4O0IA 2VOPA 4DR3F 4ECUA 2UU9F 2EK6A 1FRMA 2E9RX 2V4JB 1AFIA 2LDYA 1O0PA 5F3ZA 1RTDA 2Q43A 2APOA 5LXRA 2N4DA 1JLCB 2QA2A 1VQYA 4RU2A 4DSIA 1ULRA 3C6TA 4QWBA 1FCAA 1IKWA 5L9XA 2RQMA 1DAXA 5BYQA 5L1JA 4ED5A 4OZJA 5HMYA 3LQVA 4USJC 3KLGA 3QWPA 2IAJA 2GO8A 3BJYA 2NREA 3HVAA 4Y65A 3DCAA 1VRTB 4ZPAA 5DGBA 4M8LA 2I38A 3KJVA 3I0SB 2GGPB 3OFEA 3OR2B 3MURP 4RNFA 3TUJC 5KFJA 1Y5NB 2DRAA 1REVA 5EX3A 1RQ0A 3IA0A 3K5OA 3MAHA 3NG8A 2P9GA 5IM0B 1X8DA 2C3YA 3BM7A 1LV5A 1TL3A 2XC9A 5B0DA 2GIRA 3M1VB 2OTLS 2V9WA 1U49A 2F7VA 1XNQF 2KN4A 2P6TA 4C8KA 1GTHA