2B6AB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with thr-50
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase p66 subunit
publication title Crystal structure of HIV-1 reverse transcriptase (RT) in complex with THR-50
rcsb
source organism Human immunodeficiency virus 1
total genus 101
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b6aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB03
3DRPA 1REVA 3LALA 1SUQA 1SH0A 5L1KA 4URQU 5DGBA 3H59A 4J9QA 3IRXB 2W7PA 2C2DA 2FVPA 2DPJA 2E9TA 1JLFA 4F4YA 4IH7A 4I7FA 4NLRA 1EP4A 4LQ9A 4NLTA 3QGIA 1HNIB 4Y2CA 4EO8A 3M9MB 1RT4B 3RBEA 4IRCA 5C5JA 1N5YB 4RW4B 3DDKA 3LP2A 2VA2A 3NMAA 3IN5A 5D3GA 2ASDA 1S0OA 3DYAB 2RKIA 3M8QB 2YNHB 1J5OB 4RW9A 1RT5A 4EYHB 1S1TB 1Z4UA 1C0TB 4KB7A 3ISND 2IA6A 3UDLA 3FFIA 4YMEA 2I5JB 1DTTB 3M8QA 1J5OA 1IKYB 3KLIA 3QGGA 5C25A 5EUHA 2VG5B 4J9RA 4K4ZA 2CJQA 1C0TA 2BE2B 4I2QB 5KFBA 3I5BA 4WFXA 4WE1A 3V6KA 2QV6A 3SFUA 1JX4A 4ECQA 3H5XA 1C0UB 3TVKA 1RT7A 1CSJA 3DMJA 3Q8SB 4DL4A 1HYSA 1S1UB 3T19A 2IJFA 5FDLB 4WZMA 5DG7A 1C1BB 4NLPA 3T5HA 4ZPBA 1C0UA 5J2QB 1HNVB 3IGVA 1TVRB 3LP1B 3MEDB 2OH2A 2RF2B 2HNYA 5FDLA 1RYSA 4R5PA 4IR1A 1RT1A 1S6QB 2AX0A 3C6TB 2FVSA 2XCAA 4EBEA 4ICLB 4DEZA 1S10A 3LP1A 5KFMA 2ASJA 3IG1A 3GV5B 3PVXA 4R8UB 2YNFA 4WFZA 1IKVB 1JLAA 5I3UB 2VG7A 1S1XA 4ZVFA 3PW7A 5KG0A 3C6TA 4ICLA 5KT7A 2W7OA 1IKXA 4IKAA 3QO9B 3GV8B 1IKVA 4O4GB 3T1AA 5I3UA 4Q45A 5HLFA 2ZE2B 3GV7B 4QWEA 2W9BB 4RNFA 4F4WA 2WRMA 3PJWA 4MIBA 2HWIA 4O44A 5KFVA 1BQNB 3NKYA 4O3RA 2HAIA 4YQWA 4K4XA 5EWEA 1T03B 3PHEA 1RTJB 1ZTTA 2ZE2A 1QAIA 2J6SA 2BR0A 3KLEA 2HNZB 3BSAA 4QPXA 3UPFA 3G6YA 1TV6B 2R2RA 3KHGA 4PQUA 4J9LA 5CYQB 1C1CB 1TL1B 4QWCA 3KLFB 2ASLA 4LSLB 1D1UA 3H5SA 4ID5B 1RDRA 1KHWA 4NRTA 4RNMA 4PWDB 4ECTA 2UVRA 4YR3A 2R2SA 2HNZA 3CJ2A 4F4XA 3DM2B 1HQEA 4JV2A 1C1CA 2F8EX 1TL3A 2V0NA 4LSLA 5DG9A 1JLCA 4TLRA 3HVTB 4KAIA 3DI6B 2B5JB 5L9XA 5F8LA 2BRLA 2C22A 3DM2A 2V4QA 5KFQA 4RW8B 4ECWA 1VRUB 4NLOA 3FQKA 5KFKA 4RNOA 1LW2A 3G6XA 3HVTA 4Q8FA 3ISNC 5KG2A 1DTQB 2IC3B 2R8KA 4J9KA 2OPSA 1MU2B 1VRUA 3HVWA 3MF5A 4B3OB 4XO0A 3H2LA 3EPIA 2AGQA 5F8NA 3I0SA 3DOLA 4J9SA 4GC7A 3RB0A 2BQRA 2WK4A 4TN2A 5DQIA 3KK3B 3QZ8A 1MU2A 1FKOB 3GIIA 4ZPAA 1S48A 3GIMA 1HARA 1LWCA 3PR4A 1IKWA 2IAJA 1LWFA 1S9GB 4EBDA 4ZPDA 3JSMB 3DLKA 1FKPA 1RTDA 1FKOA 1TKTA 3MEGB 3KJVA 1DLOB 3ITHB 4ED2A 2JC1A 3KNAA 1JLQB 3KHHA 4RU9A 2JEFA 1NNDA 4QW9A 5KG1A 2BANA 3D28A 2WCXA 3M8PB 1N6QB 3IS9B 3QIPB 5F8HA 1DLOA 5KFIA 1JLBA 5K14B 3PR5B 4EEYA 1JIHA 1JLQA 3OLAA 4IFYB 4PUOB 4ZHRB 3N6NA 5EWFA 4K4UA 4I2PB 4IR9A 4TQSA 5F9LA 4ED3A 4H4MB 3G86A 5KG3A 2R8IA 3T5JA 3FDSA 2W8LA 2OPRB 3IRXA 4IFYA 1N56A 4ZHRA 5DG8A 4LSNB 1RA7A 4NZ0A 4K4SA 5KFOA 3BQ1A 1QE1B 3MFHA 1HNIA 5C42B 2UVWA 4IRDA 1RT4A 1S9EB 4QWAA 1N5YA 2OPRA 2EC0A 5F9NA 2WONB 2FJVA 3LANA 3GQCA 4RW4A 4G1QB 5F8JA 5J2PB 2FVCA 5KT2A 4DG1B 3VQSA 2W9CB 4ECSA 2AQ4A 3DYAA 4JV1A 3QLHB 2R8JA 2YNHA 2AWZA 4JUZA 2R2UA 2WTFA 3Q8RB 4TYBA 1S1TA 1SH3A 4F4ZA 2D7SA 1K1QA 3CDUA 4ZPCA 3NBPB 3T5KA 4DG1A 4ZP7A 5KFDA 2W9CA 2I5JA 1SV5B 3QLHA 1DTTA 3TQ1A 3C6UB 1XR5A 4IH5A 1IKYA 4KKOB 4TYAA 3LAMA 2OPQB 2VG5A 3BGRB 4TY8B 4ED7A 4I2QA 2BE2A 5HBMB 4YR0A 4ECXA 3TAMB 1HMVB 2FJXA 4KV8B 3C6UA 4YP3A 2UVVA 4TQRA 2UVUA 2R2TA 5KT6A 4X2BA 2OPQA 3CJ0A 4MKBA 1S1UA 1NHUA 2AGOA 2DPIA 1S0NA 1TQLA 1C1BA 2FJWA 1S9FA 3TAMA 2FLLA 5F8GA 1S1WB 5J2QA 1HNVA 1TVRA 2AU0A 4NLDA 3MEDA 1T05B 4M94A 3Q8QB 4EBCA 1RT2B 2RF2A 4U6PA 3MR5A 1T3NA 1S6QA 3CWJA 1RT6B 4Y34A 4MFBB 3H98A 4NLQA 5HROB 5I42B 3V4IB 4R8UA 2ATLA 2ZD1B 2V9WA 4HYKA 3MR3A 4FBUA 1TKZB 3N6LA 4XPCA 1GX6A 2IM3A 4MFBA 3PW5A 3RB6A 1MMLA 2B43A 2ILZA 4KE5A 5DLGA 5JXSA 3QO9A 2W9AA 1N4LA 4O4GA 3BJYA 5DLFA 4RW6B 2W9BA 2VG6B 4TY9A 5CYMB 3UQSA 3Q8PB 4DL2A 4NYZA 2C28A 1KLMB 1BQNA 1EETB 4ZP8A 3MEEB 4NCGB 2WOMB 1N48A 4O3PA 3MECB 3JYTB 1T03A 2GIQA 3PW2A 1RTJA 1HPZB 4TXSA 1LW0B 4MKAA 4FS1A 4QWBA 1TKXB 1TV6A 1ZTWA 3DLEB 2GIRA 2JC0A 5CYQA 1TL1A 3KK2B 2WOMA 3KK1B 2FLNA 3KLFA 3KLHB 2JEJA 1HPZA 4ID5A 4K50A 4KO0B 3PJXA 4ED1A 2FVRA 4PWDA 2UUTA 3MFIA 4WZQA 4Q0BB 1JLEB 3KK1A 2HNDB 5KFGA 5EDWA 3FRZA 4KHMA 4KSEB 2XI3A 3DI6A 2B5JA 2YKMB 4WYLA 4ECZA 1VRTB 3HVAA 4K4TA 4KBIA 5KFYA 3KHLA 2ZKUA 4RW8A 5DGAA 1R0AB 5HP1B 5KFPA 3CVKA 4J9MA 3QGHA 4NLWA 1T94A 3CO9A 1DTQA 2IC3A 3ICLA 1YVFA 3DRRB 2IM1A 3N6MA 3QIDA 4JV0A 3RB4A 4K4VA 5HP1A 5KFFA 3OL8A 4B3OA 1NHVA 2IJNA 4RW7B 2OPPB 2AX1A 2R8HA 1RA6A 1JLGB 1FK9B 2W8KA 4Y2AA 4NLYA 3KK3A 3RAXA 2XGQA 2IM0A 1LWEB 3I5CA 1RTHB 4RW7A 2OPPA 4XPEA 1S9GA 1RAJA 3JSMA 2D3ZA 3DRSB 5C24B 3DOKB 5KFXA 3MEGA 1W25A 3BR9A 4ECUA 2ILYA 1WNEA 1LWEA 4NLXA 1XR6A 1HQUB 2YNIB 3ITHA 1RT3B 1UWBB 3LP0B 3V6DB 3KLGB 3E01B 2B6AB 3CJ4A 4NLVA 4URSA 4LQ3A 3NL0A 4ECYA 4ECRA 3M8PA 2IMWP 1N6QA 4QW8A 5JUMA 3IS9A 3QIPA 2YNGB 1TP7A 2CKWA 3G6VA 4NLGA 1BQMB 4IG3B 5F8IA 5K14A 3IGNA 3CJ5A 3OHBA 3E01A 3FQLA 2BQ3A 2C2EA 2J6TA 1REVB 4PUOA 4ED0A 3OL6A 4I2PA 4H4MA 1BQMA 4IG3A 4RUAA 4R0EA 5KT5A 1JXLA 4ED8A 1JLFB 4I7FB 4U7CA 4LSNA 1EP4B 3I5AA 5J2NB 1QE1A 5C42A 5KFEA 2C2RA 1S9EA 1S1VB 2JEIA 5KG6A 2WONA 3LP2B 4NLUA 4WFYA 3OSNA 3V81B 5D3GB 4G1QA 2BQUA 4Q44A 4IQXA 5J2PA 5J2NA 2I1RA 2RKIB 5J1EB 4Q43A 2BRKA 5KFUA 4RW9B 2XC9A 1RT5B 1RYRA 4ZVEA 1S1VA 4MK8A 3BQ2A 1QUVA 2ALZA 3UR0A 5J2MB 1D0EA 2O5DA 4J9OA 4IRKA 3V81A 4DL5A 3FFIB 2XGPA 3SI8A 3HKWA 3NBPA 5J1EA 3H5YA 5KFNA 3H4BA 1SV5A 3KLIB 4HKQA 5C25B 3QZ7A 3DLGB 3NGDA 4IG0B 5J2MA 4KKOA 1U09A 4WE1B 4ZP9A 3BGRA 3QYYA 2UUWA 4TY8A 4RUCA 5HBMA 2RDJA 1S97A 1SH2A 2IBKA 5L1LA 4KHRA 1RT7B 1HMVA 2RDIA 3DMJB 4ED6A 3NAIA 4KV8A 1HYSB 1OS5A 3E51A 4WXWA 3DLGA 4DL6A 4IG0A 3GILA 4DL3A 3D5MA 2JEGA 3FSIA 4FBTA 3KLVA 4RNHA 3EZUA 1S1WA 3BQ0A 3GIJA 4H54A 4O4RA 3H40A 2HNYB 1T05A 4R5PB 3CJ3A 1RT1B 1RT2A 4ECVA 4M95A 4KFBB 5KG7A 1RT6A 3IG1B 3BSCA 3CIZA 4WYWA 2YNFB 3MTKA 1GX5A 4O3QA 5HROA 1JLAB 5I42A 3BSOA 3V4IA 1ZETA 2VG7B 1S1XB 2WHOA 3KOAA 1C2PA 2ZD1A 2XWYA 3OLBA 4DL7A 4FS2A 1TKZA 5KFHA 2HWHA 5KFZA 2AGPA 4KFBA 2V4RA 3OL9A 1XR7A 4OL8A 4MH8A 1IKXB 2JLEA 4RZRA 2QE5A 1KHVA 5HLFB 5EWGA 4K4WA 4RW6A 1IM4A 4O44B 5L1IA 5KG4A 2VG6A 3MR2A 5CYMA 4ZP6A 4YR2A 1KLMA 4QWDA 1EETA 4F50A 3MEEA 4NCGA 3T5LA 4NRUA 5KFWA 3MECA 3JYTA 4IDKB 4ZMMA 3KLEB 5DQGA 5KFJA 5KFTA 5KFCA 1LW0A 5KT3A 4O3SA 4PQUB 4Q8EA 3SFGA 4G3IA 1TKXA 3BSNA 3DLEA 3KK2A 4O3NA 3KLHA 4IH6A 4IDKA 4IFVB 4KO0A 3I0RB 3PZPA 3RBDA 1HQEB 2HMIB 4J9NA 4MIAA 1TL3B 4EO6A 3GIKA 2E9ZA 5T14A 2YKNB 3M9OB 4Q0BA 1JLCB 1JLEA 1S49A 4URGA 3V6HA 2HNDA 4WXOA 4J9PA 4IFVA 3I0RA 3GYNA 3RB3A 2HMIA 1S6PB 2YKMA 1VRTA 2YKNA 3CDWA 5DQHA 1QAJA 1LW2B 3KMQA 1R0AA 3EPGA 4K4YA 1S6PA 3RAQA 2OPSB 4MK9A 3M9NB 5KFRA 4NLSA 1S0MA 5F8MA 5KG5A 2J6UA 2VA3A 1RTIB 3DRRA 2D41A 2XI2A 3MR6A 3I0SB 3DOLB 2FVQA 2IM2A 3CDEA 5KFAA 5KFSA 2E9RX 4Y3CA 2GC8A 4GC6A 3NAHA 1JLGA 1FK9A 3H5UA 1JKHB 4IOBA 3OHAA 1RTIA 1LWCB 4H4OB 1IKWB 2IAJB 1LWFB 5KT4A 5L1JA 1RTHA 3DLKB 5KFLA 3KMSA 3V6JA 1FKPB 2WB4A 1RTDB 1TKTB 1S4FA 3DRSA 3OL7A 4RNNA 1JKHA 5C24A 4ZVGA 4MK7A 3KJVB 3PW4A 4H4OA 3DOKA 1K1SA 3LAKA 3PW0A 1HQUA 2FLPA 2YNIA 3V6DA 1RT3A 1UWBA 3LP0A 3HHKA 3KLGA 2BANB 2B6AA 3DRPB 4ZVHA 4O3OA 3OSPA 4EYIB 1SUQB 2XCPA 1I6JA 2D3UA 1JLBB 3KHRA 3H4DA 3BREA 2YNGA 2R8GA
chains in the Genus database with same CATH superfamily
3DRPA 5GAEU 3AFGA 4OX8A 3J7ZT 3R9LA 4M5GA 3F56A 4NLTA 2UXBJ 2WVEA 1KD1T 2MQMA 1PC4A 2YNHB 1FDNA 1UTAA 2AEJA 1C0TB 4P7VA 4WTOB 3NEKA 3M32B 3M2RB 1VQPS 3B4DA 1R3NA 3DHXA 5EUHA 5SZTA 2GAHC 2UXDJ 2RUGA 2IJFA 1FD8A 3VVTA 2AX0A 4OX7A 2XCAA 3LP1A 1SIZA 4WKYA 3JS9A 2J0SD 2B9WA 2RSQA 1BQNB 4O3RA 1VGYA 2VQFJ 1AT1B 2R7SA 2WVDA 1RDRA 2ZNYA 4CO1A 5A8RA 1S4EA 4F4XA 4JV2A 3SV3A 3DGPA 3D6HB 4USJC 5F8LA 2C22A 3BGOP 5AXLA 2HBYB 2GAGC 1ZAWA 5BR8F 1RU2A 3N5BA 3GFXA 2EC2A 4C3KA 3MEGB 3GSDA 4Q2MA 3G8TA 4USKA 4DCPB 2JWNA 1RWVB 1HBOB 5F8HA 1JLQA 3V5RA 2MLXA 3FJ2A 4QOTA 2XM3A 4ED3A 4H4MB 1A9NB 5KAKA 2OFGX 2JFDA 1UETA 3QT5A 2YNHA 2WTFA 3DXSX 1YZ7A 1WJ9A 1T9WA 4ZPCA 4DG1A 3OFEA 3M32A 3M2RA 1RK8A 2L41A 2MQOA 1RLDA 2LU1A 2RS8A 4YR0A 2J9CA 3OTBA 3C6UA 4HI1A 2GA7A 1NHUA 2EFOA 2HURA 2KYXA 1U8SA 3GFZA 6FD1A 3PFEA 3AOCA 4LFCJ 2CQ3A 4C11B 2CIMA 2N3LA 3PRDA 4C48A 2PGCA 1WI6A 1BQNA 1N48A 4DPOA 4B3RF 1RWMB 1Q8BA 2DRDA 4Q7AA 4HEA9 4PG4A 4ID8A 2R7RA 4HACB 4OZ0A 1TL5A 1JLEB 5KFGA 2KB2A 5DZ6A 2YWHA 1S76D 2EG1A 3HSGA 5KFPA 2POKA 3FC9A 1Q8KA 1E6VB 5HP1A 1LQ9A 1Z2ZA 3Q8VA 5L8RC 4PR6A 2QX0A 2D3ZA 5BXIA 3D66A 1FEEA 3MEGA 4FXVA 3DRYA 4IOCQ 4URSA 3E01B 2B6AB 2NREA 2HFSA 3CC7S 1HQ2A 3TZYA 2G0JA 1HBOA 2DNMA 2BQ3A 3QWPA 4LFCF 4H4MA 3M6WA 3G96A 4I7FB 3IAS9 3CJ8A 1X4GA 4LF8F 5J2NA 1YDLA 1NJZA 5KFUA 2O5DA 3KG0A 5EGYA 4USTA 3ZTRA 4IG0B 2R3VA 4ZP9A 2IBKA 3NMRA 5EN1A 2KT3A 3A3OB 4NPOA 3CGIA 2C2OB 4JI0J 2DR8A 3QJPA 3UN5A 2MTLA 2R9LA 2KH9A 2HWHA 4C11A 1MWQA 1N32F 3T9NA 4C8KA 2CQ1A 4LFAF 4HTIA 3BKUA 4CLZA 1VQ9S 5DQGA 4DSKA 3IFEA 4WWSA 3SMZA 4CM2A 3CW2C 3KG4A 1NB7A 1HQEB 4HACA 1PYSB 1JLEA 3V6HA 1ZAXA 5HVGA 1PYTA 4DI6A 3CULA 4USVA 4DFMA 5D4NA 4MK9A 2AYGA 2CPEA 3DOLB 3O3LA 1U1QA 4X84A 4C8MA 1U8WA 1VQ7S 5KT4A 1MN7A 1ZM4A 3VTIA 2DXDA 3LGHA 2B6AA 4OHWA 1HNZF 1I6JA 5E3PA 4JI0F 3KHRA 1JNRB 4MKYA 3TJAA 4I7FA 3J7Z5 1OY8A 3M05A 5C5JA 1NU4A 1TUWA 4U7UD 3NGKA 3SCJE 1S0OA 4OHYA 4UOCA 1Q82T 3R7NB 1R27B 4G6VB 3DGVA 1ZM3A 4DPYA 2CAJA 2R7VA 1F5AA 1TL7B 3BO3A 4OMFG 2ERRA 3EVWA 1N0UA 1YI2S 1R7IA 4CQ1A 2BKOA 4WKRA 2V2KA 1H3DA 1HNWF 3UDEA 1IKVB 3W60A 4KGVB 4HI2A 4OFZA 3DLHA 1YJ7A 4NL5A 2LEPA 2XZTB 2ZH4A 2D74B 2Z4PA 4F4WA 3NKYA 1T03B 3PHEA 1RACB 1IR2A 2MKCA 2E5LJ 1FRKA 1R0CB 4EU0A 1HL6A 2DGTA 1HQEA 4LSLA 2HIYA 3DM2A 3BN7A 1YWXA 2XMTA 2P6SA 1NK8A 1MU2B 2EWHA 5GMEA 3DOLA 1FNXH 2CQHA 2F4VJ 2DNHA 2FZCB 3PR4A 1RWPB 3NGUA 4C8OA 2UXCJ 3W9JA 2JEFA 5ETQA 5KG1A 3AA8A 4M5HA 1XMOF 2A18A 3IS9B 4UQGA 1VYAA 4LMZA 2W01A 1JIHA 4IFYB 2Y1JA 3JQKA 1H7XA 5F9LA 3MD1A 1N56A 4ZHRA 1X4FA 2VBWA 4BWJA 3QSIA 3PRVA 2N4CA 3HFKA 1KFSA 2BM0A 2BJDA 1SH3A 4NYOA 1RU1A 1VOMA 1GAOA 1SC1B 4LRBA 4AQYF 2FJXA 3TX8A 2W4DA 4YP3A 1CJKB 1YITS 1NJIT 2FJWA 1T9YA 2NSCA 2F7VA 4W98A 1EAYC 4QIVA 5DETA 3UDCA 2BV3A 3OXFA 4CH7A 4W92B 4Y00A 4RR5A 4FNIA 2E1AA 1PJ6A 4DMZA 2GQCA 3L7OA 4FXDA 9RUBA 3G8SA 5A8KB 1U24A 1H2TZ 4OX9J 2YKOA 3JYTB 1T03A 5CQGA 3JSRA 4B3MJ 1U0SA 1JJCB 3KK1B 3M6VA 2BJ3A 3FBCA 4BBYA 3S8SA 1BQXA 3ZZUA 1P27B 2DIUA 1L5UA 4QR0A 5IS2A 1FJEB 1T95A 3UO0A 4A8XA 1QSYA 4K5RA 5IT9Y 2MMYA 4C0BA 1RHMB 1FKAF 4X4PA 1RA6A 1NK5A 2YWFA 1LWEB 5B0AA 1RTHB 4CP5A 3MDFA 2HHWA 1R6YA 2F5GA 1K9MT 1HQUB 3KLGB 5LMNJ 3IS9A 1BWEA 1N8RT 1SL1A 2V94A 1FRIA 4KRWA 2G2ZA 3CNQP 4X64J 2J8AA 1X4DA 1CJUA 3D4JA 4B17A 3V81B 2I1RA 3F44A 2BRKA 2DNNA 1KKHA 3ZXWA 1FEHA 2C2KB 4A46A 4BLGA 4DL5A 3EUNA 3K5PA 3KLIB 1Y9OA 5C25B 1FJGJ 3FSXA 3HZEA 4F3MA 2XHCA 1RT7B 2RDDA 1HYSB 2H3EB 4DL3A 3WHIA 1Q5YA 2NUUG 4Q2LA 4H54A 2JNJA 2C42A 1VI7A 4LFBJ 4M95A 2ZVIA 1SXLA 4F3OA 1FE0A 3CIZA 5C2CA 2EBGA 1GTHA 1IKXB 2JLEA 2WSFC 2KN4A 5A8KA 4ZIWA 1UJ4A 4LVNP 3JYTA 3T6BA 4PQUB 1QTNB 1XNQF 4X64F 3PRBA 2JVRA 3I0RA 1IBKF 3SSSA 4W4MA 3G87A 1QAJA 2UUBF 1Y5NB 1MG7A 2CPZA 4NLSA 2J6UA 5AE2A 5KFAA 5KFSA 2W2PP 3OHAA 1KDNA 4XIUA 1FXLA 3SXLA 1RTHA 2DVIA 3KMSA 4YY3J 2WB4A 2RRNA 1JWWA 1BXNA 3KJVB 3LAKA 3G82B 1HQUA 2AJQA 3KLGA 1AXQA 5A2QU 2V69A 1IBMJ 3JQJA 4K59A 2GV1A 1PC5A 3EXYA 2RU3A 3H59A 4PPZA 2AIRB 3K89A 2B3TB 2BACA 3DDKA 3H25A 4IOAQ 1HI0P 1S1TB 4XTTA 2CJKA 1UVMA 2IA6A 4J9UE 4DUZJ 3KLIA 5C25A 2AHOB 1H73A 1X5TA 1GQEA 2R7QA 1RT7A 2DHXA 1HYSA 2HFZA 5H9EJ 3D1QA 3T19A 2XMJA 3AAWB 1C0UA 2ZH6A 4M5DA 3X3UA 4L3NA 2DHSA 3AD9C 1B7YB 3OW2R 2DCLA 4P7TA 1O5JA 1RZMA 1YJRA 1TK8A 2E1MC 1M1KT 2BXJA 1IKXA 3T1AA 1S6UA 2NR0A 1NZAA 1QD1A 2ZE2A 2LP4A 4PQUA 2L48A 4DQPA 4AXIA 2IPOB 4ILRA 1KR4A 2KXFA 3BBFA 1QDUB 1FRLA 3T1HJ 3EZ5A 4WU3A 4RU2A 3QNWB 1VRUB 2V4JB 3FQKA 3I32A 1ZZNA 1C4CA 5IQQA 3C46A 2BJ7A 3BS9A 8AT1B 5JVHQ 3EPIA 2XMMA 3FZ2A 2CZVC 4DUZF 2FGOA 2CQ2A 4TN2A 1YBUA 1N5QA 3K5NA 1YJWS 4BS2A 2F63A 3KJVA 4ED2A 4PRFA 3M8PB 1F2GA 3O8WA 3QIPB 3GZ7A 1VBKA 1HR0J 2R8IA 1VQ8S 4CYUB 3MFHA 2UVWA 5F9NA 3MM8B 3GQCA 4G1QB 3GPAA 2OEMA 2M8HA 4I6YA 2E5HA 3CE8A 1S1TA 1N36F 4QQBA 4I67A 3T5KA 3NBPB 3HD2A 2W9CA 5KOWA 1WF0A 4B9LA 4P52A 1F3VA 3R5BA 4TY8B 4YEAA 3SBMA 2D1CA 2MKYA 2C3OA 1S0NA 2HFVA 3C15A 2FJAB 3W66A 4CLTA 3TZZA 4U6PA 4CLUA 3CWJA 2IYGA 2F4FA 2ZD1B 3N6LA 2DK2A 2QL7B 4ILMA 4CH0S 4KE5A 1HWIA 1UEVA 3TA2A 4F26A 3Q8PB 3N5FA 4DV2J 4TU9A 1SJ1A 4NCGB 1RCXB 2HHPA 2W2MP 1OYDA 3MPYA 1MLAA 5B0EA 3AB2B 2E7XA 1K44A 2CNNB 4MKVA 4QZVB 3N28A 2XI3A 4LRCA 7AT1B 3PNIA 2V4JA 5DGAA 2M52A 2CDQA 3OVSA 1B70B 2V8GA 3ICLA 3M7VA 2PSZA 1NAQA 2DO4A 4LRDA 4FVMA 2A10A 5LM7E 4HVZA 2O01C 1RKJA 2G9OA 3KG1A 2JFKA 4LUBA 2CWXA 2QSWA 3M8PA 3QIPA 1EX8A 4RWWA 3FQLA 4Z2XA 4U7CA 1EP4B 4CYUA 2AYMA 3Q22A 1FNOA 3MM8A 4DV2F 3B82A 4G1QA 5ETPA 2Y1RI 3NBPA 4P75A 3CIMA 5ETRA 3GFYA 3NGDA 5J2MA 4TY8A 2UP1A 2Z0GA 3CCSS 4OJHA 2CQ4A 4DL6A 3EWGA 2O1PA 1A7GE 4KHPF 2RVJA 2MQNA 1X5PA 2YNFB 2YBVA 2ZD1A 2CPIA 3R5CA 4JI6J 2CQCA 3OFFA 2A2DA 2IBOA 2JHEA 4PZVA 4O44B 3D6FB 1NDLA 2BX6A 3CPWR 4NCGA 2CJYB 4NRUA 1OSCA 5F3ZA 4QR2A 3SFGA 3BSNA 4CNZA 4M8LA 5HVHA 3DCAA 4MIAA 4DR7F 1B4SA 2CQ0A 4E8UA 3AB4B 1S6PB 4ED5A 1T9UA 2LEAA 1UCNA 2XI2A 1SVDA 3CDEA 3W9HA 4QU7A 4IOBA 2ZZMA 3ULHA 3Q2SC 3TUZC 4R0JA 2NQPA 2IIHA 3HVRA 2K7JA 1SUQB 2RRBA 2JL9A 1EIYB 3QJLA 1SH0A 4YN3B 3U27A 1RWWB 1TUVA 4DU7A 1EP4A 5IC6B 3AQPA 4DZ6A 2E1PA 4EZ9A 2O66A 2HLTA 5GVQA 3D54A 3R3TA 1SJQA 4QYRA 3UCZP 3TOQA 1KN6A 2DHGA 5FDLB 1BY9A 3IR7B 2XMWA 4AL7A 3IMQJ 3OBIA 4JV5F 1UWAA 2YNFA 3HDSA 4OZ5A 1IVZA 3PW7A 4DV7J 2N7CA 2RB7A 2CNKB 4J9VA 2W9BB 3PJWA 4O44A 3TNVA 5E3QA 2OELA 1QAIA 1XBWA 1VRQC 3UPFA 2FHKA 1U0HB 2ASLA 2DY1A 2Y1LB 4D3GA 4Y2IA 5H1SV 5GAGI 3HVTB 4CO4A 1X5SA 2ZBIA 2V67A 1DTQB 2IC3B 3CD0A 3GFHA 2Q66A 4B3OB 4A8SA 1G2EA 3ZZ0A 4DR5F 4CCHA 3UFCX 5KOXA 4ZPAA 3IWXA 2CUYA 5I3PA 2WBRA 5HMWA 4B9VA 1KFDA 3M30B 4OYBA 5K5MA 5KFIA 5K14B 1U2CA 1P1TA 4DWIA 2V8DA 5EWFA 4IR9A 2V2VA 5CCMA 1R8BA 4I6AA 4ZLPA 1LNQA 4BWMA 4FYVB 5G0RA 4X65J 5F8JA 5A0YB 2I9SA 2R2UA 1LXNA 3P45B 3Q8RB 2Y0BB 1MSWD 3M8WA 4TYAA 4LF1A 4DUYF 1I51B 2NUHA 3AJDA 4P74A 3TAMB 1XNRJ 4M5KA 4QJVA 2UVUA 4X2BA 5KT6A 2MZSA 1HBNB 4WFBQ 2DPIA 3HHLC 1SL0A 4OQJA 1NKEA 2HZCA 3BKFA 3B78A 1OY9A 3ZNUA 5GAEI 4Y34A 4L3KA 1RKIA 5I42B 2ATLA 2V9WA 1OQ6A 1M5OC 1H98A 2QLFB 3CJSA 3VVUA 2W9BA 3KWMA 4ES2A 2XSJB 2NS1B 1HPZB 3CD6S 1U0HA 4DPWA 1U7LA 1RBAA 2R42A 2NXUA 2LXFA 9ATCB 4K5SA 2RH3A 4LR9A 2QT7A 1WKLA 3TEGA 4KSEB 2VQEF 1V6HA 1S57A 2CVEA 1R6VA 3LF0A 3MOZA 3CO9A 2Q6CA 2VKZG 1DTQA 2IC3A 4B3OA 4RW7B 1AZSB 4PG8A 2OPPB 1RJJA 4PG7A 2WVCA 2W8KA 2DNRA 2B0GA 3Q8YA 2ZC3A 3D67A 4CLFA 1XNRF 2DGXA 1RWNB 2LA6A 1Q4RA 2J9DA 3TA1A 1XR6A 3TYTA 2A0FB 2NYHA 2IMWP 3ADAC 2G2OA 2YNGB 4IG3B 5K14A 5ETNA 3PM9A 2MB0B 1FJCA 2EK6A 1W7WA 1QUPA 2AJ1A 2UV8A 1GMUA 1U47A 4UTGA 1S1VB 4IQXA 2ZH5A 5A0YA 5M2RA 4Q43A 4BHQA 4ZVEA 4OHVA 3BQ2A 2FHMA 1LKZA 5AJ3J 4RUCA 1S97A 1CC8A 3EM1A 3GILA 1HBNA 1R89A 1T0TV 5L38A 4WP9A 3EE3A 3X1LB 4DSEA 3TUIC 3BSOA 5I42A 1VQSA 4YDXA 4DL7A 4FS2A 2P2CB 1DBDA 1KHVA 3W65A 1KQGB 1MWYA 3D3CJ 4CTAB 2XSJA 4ZMMA 4WJBA 5KFJA 3CCRS 4NA1A 1VQ5S 2CQBA 2XQCA 2DITA 2KFYA 4O3NA 3BYPA 1RAGB 4IO9Q 4DR6F 2BDPA 2HMIB 5ETLA 1V3SA 2BW2A 3W2WA 2OPSB 4CLYA 2Y8WA 3L4BC 5A76A 4E0DA 4LR7A 4B9TA 3QAUA 5E7OB 2GC8A 5AJ3F 1LWCB 3QRQA 4MK7A 5D0HA 4GO7X 2IY5B 1V3ZA 3HHKA 2H5IB 4PXDA 1TK5A 2XCPA 1NSKL 4JOUA 2YNGA 1R0BG 1VCTA 3VZIA 2DNGA 5DGBA 4DV0J 2EK1A 1FFSB 4IH7A 1HNIB 4V1Ak 3NGSA 1RT4B 1YBTA 3E3XA 3RBEA 1VQKS 2LQJA 4DF8A 1RBOB 2E7WA 3POTB 1J5OB 1J5EJ 2GMLA 2H9ZA 3UDLA 3CCQS 1VLOA 4WK1A 4CLPA 4K8RA 2CJQA 4I2QB 3IM9A 3G4SS 3I55S 3BDEA 4DR4F 3T5HA 3G6ES 4ZK7M 1U45A 1WKKA 3LA0A 1K8AT 1WEZA 2RF2B 4FP9A 2LMIA 3QT6A 1S6QB 2MY7A 2HK3A 1NO8A 2ROPA 3CCVS 4ES3A 1CULB 4DSFA 1WOPA 1UPPA 3WZ0A 4A4JA 3T3FA 5ITHA 3PIPQ 3L7PA 1KHWA 2RJZA 4LIWA 4ECTA 1CLFA 4DPUA 3CJ2A 3PDNA 3EX7B 4JI1J 2BRLA 1B0VA 4DL0C 2AJ2A 4NLOA 1WSRA 1O8BA 2OPSA 3MMAB 2PD1A 4JI3J 2GCFA 2VDIA 1LWCA 1NLKL 2LYVA 3ITHB 4LBPA 2O67A 1DZ5A 3RW7A 2HFNA 4DDFA 3J81j 2FZKB 2MQQA 1HNIA 1RT4A 3CCMS 3P3DA 3KUEA 2KRRA 3POTA 3C3LA 4JUZA 3MOJB 4F4ZA 2ZJRQ 3TI0A 2HPUA 3D0GE 4I2QA 1HNXF 1BD6A 2RRAA 2OPQA 2AGOA 5F0WA 2QRRA 4M5JA 1BHNA 4NLDA 2RF2A 3EVOA 1FX4A 1S6QA 2CPJA 1WF1A 3H98A 1RAEB 3V4IB 3Q86A 2CPHA 4I1TA 4DN9A 1GX6A 3BM7A 5CXTA 1VDHA 2VU5A 4LF7F 4L74A 3ETMA 1PILA 1CULA 2VD3A 2M70A 4CLWA 4MYUA 5AXMA 2LDIA 2KJVA 4PWUA 5IT9U 4CO2A 4DV6F 3UN2A 3ZZOA 3M8RA 3OTDA 4DR1F 1WOSA 3PKYA 4ES1A 1F2HA 4ECZA 1VRTB 4K4TA 2BZ2A 2A3JA 4HL9A 3MMBB 3MAHA 2DRBA 5HVFA 3QIDA 2IVYA 4DQIA 3MMAA 4ZPVR 3MM7B 4RWXA 5KFXA 4X4TA 1WKJA 3ITHA 1WOOA 2Y3YA 4PEOA 3BZQA 1M5HA 1BQMA 1JXLA 2XULA 3JB9k 4C3LA 5IWAF 4Q44A 1Q78A 3DXBA 1F9EB 2U2FA 2XTJP 4I68A 1YRTA 3CJTA 4IO1A 2MLZA 2ALZA 1D0EA 4JBCA 2DGSA 2LQ5A 2M2BA 2LA4A 4ED6A 3VCDA 2V6AA 4YB7A 2GMHA 4RNHA 3W5YA 2BE9B 2HNYB 3B8HA 3HHLB 4KFBB 1ZETA 4JI8J 3V4IA 3EYZA 2HS4A 2XWYA 2AGPA 3NLCA 3OL9A 2R7UA 3O6QA 4OZJA 3CDAA 2DGUA 1HBMB 5JJBA 4JI4J 4YR2A 2CJXB 1JK9B 1R8HA 3THPA 1XK8A 2VBZA 1FHTA 3R5AA 4EO6A 5T14A 4ELVA 5D6GA 1CJVB 4NI2B 4NA3A 1VQ4S 2E29A 1VRTA 2YKNA 5IV4A 3MMBA 4YS2A 4UY8T 3ILIA 2E9RX 2QLXA 5IT4A 2CVIA 3NAHA 3PX6A 2VOOA 3UD3P 3ILOA 3MM7A 2LU2A 3PW0A 4A8WA 2QC3A 3A8EA 3P5TL 4FVCA 2R8GA 1YK9A 2B4VA 4OYZA 5LSOA 2ZBQA 1I94J 2RT3A 3QGIA 2HQDA 2E1RA 2VA2A 3NMAA 4FZVA 1L3KA 3M8QB 1AA1B 5K8MA 5RUBA 3OV7A 3NNCA 3CXCR 3LH2S 1DTTB 5B0CA 2Q6BA 2BOPA 5FD1A 2BE2B 2YKAA 4K2XA 2OMLA 1TTHB 1SL2A 5LOQA 1TVRB 1X5OA 5AXKA 3BBCA 3PYDA 2HNYA 1RYSA 2VV5A 4ICLB 3PEHA 3HHLA 3ZZZA 4R8UB 4WBFA 3C6TA 2JX2A 2PE8A 3WC2A 4U67Q 4NXMJ 4IKAA 2CZ9A 2JLGA 2Q79A 3CUNA 1FVQA 3CJKB 1SQFA 4HDGA 2CQDA 4K7QA 3D6TB 4DOZA 4QPXA 3P5BP 4JYAF 3R97A 2XNRA 1UJ5A 5I4MA 4ID5B 4AYBD 2ZBRA 4UQTA 1MWZA 1U48A 1VQNS 1CJVA 4NI2A 3W62A 1I94F 1RISA 4OI2A 2VJUA 3HI9A 3RRKA 4DR3J 3TAQA 2ABYA 3VGTA 2MGZB 2Q43A 2F9JA 4P73A 2DYAA 3UDVA 4FKXA 1TUGB 5DO2A 3GIIA 1HARA 2CNOB 2AZ3A 3ZNJ1 4YB6A 5L46A 1YRUA 3US5A 4N56A 2Z30B 3I82A 1MMNA 2XB2D 4AE5A 4LF9F 4PUOB 2F1FA 2IRXA 4WP3A 2Z58B 4X4SA 4HHUA 5KFOA 3MPVA 2GX8A 2OPRA 1HFEL 5J2PB 3QLHB 4KJIA 3MD3A 2YQ3A 1BE4A 1DTTA 4KKOB 1EHWA 1UZDA 2BE2A 3PX0A 4OZ1A 4U7UK 4TQRA 3W63A 2H1YA 2DD8S 5F8GA 1TVRA 4B3SF 2QMWA 4FPIA 4CZCA 2IA0A 4MFBB 1T3OA 3FVYA 3R7SB 5HROB 3H2VE 2QLJB 4R8UA 3HSDA 4DV3F 4HYKA 5T41A 1MMLA 4EK2A 3C14B 2GVDB 3CJKA 3T9ZA 2VIHA 2VPXB 4ZN1A 1OY6A 2V8VA 2NLWA 5MLCV 1RSCA 7FD1A 2L9NA 4ID5A 4K50A 3UD4P 2B7BB 4Q0BB 1JMTA 2VBYA 3CJQA 3NRBA 1LK7A 3K7RA 2MYFA 2Y8YA 3CEDA 2MGZA 4JI5J 3QGHA 1T94A 1WG1A 1O0PA 5J1NA 3ZFVA 2F40A 4TNOA 3SCIE 1UVNA 3I87A 3VGUA 1KWMA 4G65A 2WVFA 1W25A 3IAM9 3CJ4A 1UWBB 3HK2A 3NS7B 3PXGa 1REVB 4PUOA 1CQMA 3EJMA 1NKBA 3TUPA 3IC1A 2X1AA 5FIIA 1N33F 3LWLA 2IYIA 3LP2B 3BPDA 5J2PA 2VB6A 3R1HA 1RBLA 4IRKA 4DJBA 5J1EA 4NOHA 4TKTA 2CG8A 2DEJA 2QL5B 3DLGB 2IVFB 4KKOA 3ET6B 3C16B 5D0RA 2BE7D 2UUWA 3OR2B 3DDNA 2X1GA 2RHQB 2YKQA 4DQRA 2OUGA 4JI5F 3DHWC 4XDCA 4C8ZA 3IBWA 2G1HA 5HROA 2VG7B 4ZLNA 5LT5A 2GJ2A 3GJRB 3BR8A 3J80Y 2FQQB 2GMJA 3C14A 1Q0NA 1YKWA 4DV4F 1Q1KA 4ZCIA 4C2MA 1VK8A 5KFTA 4UUWA 1VIXA 3GLJA 1VQYA 3UE2A 2MKHA 2C2MB 3PZPA 4Q0BA 2PMZD 4WIQA 3T1YF 3SZ2A 5F8MA 4TU7A 2MDAA 5I3QA 2V50A 3JTPA 4UY85 2BVZA 2DY9A 3H5UA 2XY6A 4H4OB 4ELUA 3PJ9A 3CCES 1IXKA 2EW9A 3A8IA 4OLPA 3GTYX 1UWBA 3CCUS 4I64A 2BA9A 1RAFB 1REVA 3RBZA 2WW4A 3HD1A 1DURA 2B4UA 1HWKA 2XYGB 3A3NB 1N34F 1KSPA 3LP2A 1Q5VA 1NDKA 3RTVA 3DYAB 2ZHAA 3M2VB 3A12A 3W61A 1I1GA 2ZJPQ 3W1YC 3TZWA 3F41A 5KFBA 3ET6A 3V6KA 1JX4A 4HR2A 3OR2A 1S1UB 4WZMA 2UUAJ 1C1BB 1RXOB 1P9QC 4RKUC 3HHDA 3Q8UA 4UT4A 1Y5IB 2VG7A 5CD4A 2AP6A 1GT8A 2DGQA 1HLWA 4DUTA 4UOFA 3K58A 5EWEA 2VC1A 1RTJB 2DR5A 2NZ4A 3CF5Q 4UOHA 1ZYQA 4BC9A 5CYQB 4PWDB 2HNZA 4DZDA 2V0NA 1WHXA 1S6OA 1IWGA 3MF5A 3H2LA 5F8NA 2DXFA 1ICEB 2QIFA 1KOHA 4GC7A 1Z2LA 4Y0FA 2HQCA 2WSEC 3P49B 1FKOA 2QMUB 3ENWA 5HAOA 3CCZA 1DLOB 3QPIA 2MLYA 4ETZA 4CWBA 3BH7B 2PMHA 4NCAA 3QATA 1UFKA 1RAHB 3EMTA 1RA7A 3BQ1A 4X4RA 2WONB 2FHJA 1WHVA 3AA9A 2AQ4A 3DYAA 2PMWA 3FMBA 5B09A 2R8JA 3M2VA 3CCWA 4LF5J 1CPZA 3LAMA 3LQVA 5DDOC 1TZ0A 1BLUA 4DFPA 1AUSL 3GWCA 1S1UA 1C1BA 3GIRA 1FI4A 2ATCB 2XMKA 4JI2J 1RT6B 5A6PA 4C8YA 3ENAA 4ILLA 3DNCA 4FBUA 1UFLA 4MT1A 2APOA 1P8GA 4G1PA 1RGVA 4NYPA 1FE4A 2VG6B 5CYMB 3MEEB 2FYXA 2WOMB 2HFOA 1RTJA 2QMXA 2H5EA 1LW0B 5CYQA 4NZ7A 2MPUA 3D2WA 2FVRA 4PWDA 2LKZA 4XAKA 4L6V3 1APSA 1DARA 3UN3A 4KHMA 2XEXA 3WIUA 1SC3B 2UV8G 3CD5A 3DRRB 4RJVA 5KFFA 3RZAA 4J90A 3RAXA 1K0TA 2J0QD 2EFVA 3EDRB 3AJ1A 1QAXA 2B56A 3U1MA 3CC2S 2CA9A 2HHXA 3JTNA 4JI2F 2A1BA 3OVAA 1V5VA 4ECRA 4F0MA 2CKWA 2BABA 2KG0A 2HGMA 4R0EA 3HFZB 4LR8A 2WONA 2UUCJ 2OEJA 1H38A 5D3GB 2HLUA 2QA4G 1RT5B 3UR0A 2E5GA 1WWHA 3SYZA 2HHHJ 3FCWA 1TAQA 1N88A 3SCKE 4HKQA 3M8ZA 1NM2A 2RDJA 3E51A 3BB5A 4ZJLA 2BJEA 3H40A 4ZLLA 1ULRA 4CLKA 2J7KA 1TAUA 4BC7A 1RT6A 3IG1B 1U1NA 2R4FA 3VAIA 2IRUA 1KQKA 3M2UB 1XR7A 4RZRA 1VISA 4PCQA 2CQIA 3EVMA 2VG6A 5CYMA 4RO0A 3MEEA 1LW0A 4CH1A 2QEXS 4X4VA 1UZHA 2ACYA 4DBQA 3ZO7A 5CH7B 2KU7A 4IFVB 4PQAA 3RBDA 3THTA 4PXCA 1QLNA 2MKIA 3GCXP 2BYCA 4CO3A 5K8PA 1LW2B 2X1FA 2UXBF 2E1CA 2MJNA 4K4YA 3M9NB 2YWEA 1RTIB 3DRRA 1NKCA 2DH8A 3TUJC 5DS7A 3OPKA 4B3TJ 5KFLA 1BWVA 1S4FA 3CMES 2UXDF 2RQ4A 2FLPA 2AYBA 4ZVHA 2Z2ZA 3M8YA 4X62J 3D0IE 5F3TA 2PT0A 1PBAA 2BJ1A 2W7PA 4FF1A 3M9MB 4EO8A 2RQMA 1NJYA 3WDOA 3GSIA 4RW4B 5D3GA 2Z57B 1RT5A 3ISND 1TL4A 3HP6A 3W2VB 4ZVOB 3N79A 2VQFF 4WFAQ 1C0TA 1WSVA 1YBAA 1OPZA 2OH2A 4PKDB 2XZDB 2FVSA 5LJ3Y 3IG1A 2PA3A 3GV5B 3NGRA 4WFZA 1U1OA 1JQGA 3GV8B 2G1DA 2VONA 4YQWA 3NCPA 1IN0A 2PEHA 2BR0A 1YGYA 2KO1A 5DM6Q 1TL1B 1UA1A 1SCJB 5IZHA 2PI4A 1Y4ZB 2J9DE 4P10A 3RYLA 3DI6B 3MURP 2ZITA 1LW2A 3G6XA 4Q8FA 3I6PA 2R8KA 3N9UC 3BN4A 2EFNA 2YXLA 2M88A 1IWAA 2MXYA 1RHQB 1KLNA 2WK4A 5DQIA 3KK3B 2N82B 1FT8A 2F8MA 1CBKA 5GMDA 1WC1A 1XN9A 1NSAA 4L76A 3D28A 4ZS6A 4NEZA 3PR5B 2X7IA 4L75A 4MJKA 4Z37A 1GMVA 1EKRA 3FBBA 3CDBA 5HMXA 3G86A 2W8LA 1BUXA 3T41A 4NZ0A 2AJFE 4IRDA 2GGPB 2IJRA 2LFVA 1SQGA 4DQQA 5BYSA 2FJVA 4RW4A 4LF6J 3FZBA 1QJHA 3D1HA 4TYBA 5GAHU 1SV5B 3W2VA 4O0IA 4Y28C 1X9MA 5K20B 2ZH8A 1HMVB 3MM9B 1HHTP 2R2TA 4MKBA 3SIPB 1T05B 1NPPA 2IRYA 3I4PA 5K8OA 3TRGA 1TKZB 2MKSA 1KRPA 1W2IA 3L3CA 2CQPA 1MROB 3BKTA 4NYZA 2C28A 2GIQA 1S7IA 4IYQA 1FTRA 1TL1A 2HS3A 1MW7A 4ZJQA 1VR6A 4WZQA 2LQBA 5F41A 3DI6A 1O6XA 4F67A 1RCOB 3KHLA 2EI5A 3F0NA 1IQZA 4LF6F 3CVKA 7FDRA 4CDIA 2DH9A 3HO1A 2HK2A 1H6KX 1E6VA 4NLYA 3KK3A 5HQMA 2XGQA 2YQ0A 4KQZA 1UJ6A 1WNEA 3M6XA 1SBRA 2KHCA 1LXJA 5F8IA 1FDDA 3E01A 4RUAA 2XS7A 4EFAC 2GGPA 5KFEA 4DXLA 5IOLA 1V3RA 1DAXA 3HMJG 3OTEA 2HYIB 2BQUA 4PG6A 1FERA 4EWTA 3JSBA 3AXMA 4J9OA 2R7XA 3LGMA 3VWSA 3I9ZA 2HHTA 1SV5A 1UPMB 1RQ0A 1U09A 1WC6A 3QWUA 1HMVA 3MM9A 4IG0A 3FSIA 2OLWA 3KLVA 4OYWA 3GIJA 2H54B 4GKJJ 4ZCKA 1T05A 1LFWA 2CPFA 2P9GA 3K5OA 1GX5A 1Q8LA 3KOAA 1C2PA 1TKZA 1PKUA 2A6OA 3A1YG 5HLFB 5GADU 1IM4A 2KT2A 1MROA 2MKJA 4ZP6A 2ZH9A 1IBLJ 4IDKB 2A6MA 2EKYA 3J7A1 2CJAA 4LF2A 4AT1B 3A13A 1FFWB 4ANDA 4URGA 1PJ5A 3L7UA 4ZVTB 1BGXT 2KKHA 2GFFA 1YQHA 2ROEA 4OYOA 1ZA1B 2ZC4A 1OQ3A 2VA3A 5BJRA 1KNZA 3R6LB 4USHA 2BJ9A 4Y3CA 4NXNJ 1JKHB 5HATA 2BEFA 5ETTA 3OTOJ 1JLBB 2MQLA 5BYQA 4J9QA 2C2DA 1F1BB 1VS3A 3HULA 3EGZA 1FDBA 3W5ZA 4LQ9A 3H7HB 3HSJA 4YHHJ 1S7HA 1ZBTA 3FMWA 2B9EA 4U95A 2Q1LA 4QR1A 3SQOP 2E5LF 2QJ3A 4ECQA 1GMWA 2Y0SD 3QJJA 1HBUB 4OI6A 1WI8A 3Q2TC 1T11A 1TL7A 4G1IA 4I6WA 1S10A 2KT5A 5C2GA 3PVXA 2ZUAA 3QT7A 5I3UB 4NXNF 4WIIA 1A0OB 1BMQB 4OYAA 2V8PA 3R5JB 3QO9B 1IKVA 4Q45A 4ZPWR 5HLFA 2F4VF 2WRMA 2C3PA 2GO8A 3B4MA 1X9WA 1B3TA 2UXCF 1TV6B 2LQ9A 1C1CB 4U9RA 4YR3A 1FNMA 4AFFA 3SCLE 2ZM6J 4NMLA 1SPBP 4ECWA 4YHHF 2VBXA 4KIAA 2VOPA 4J9KA 2AGQA 3W64A 2XMAA 1KBRA 1MU2A 1KP6A 3H20A 3V2UC 1I3OB 1CQNA 3OUYB 4DLEA 2DNKA 2EFQA 2VH7A 2WCXA 1N6QB 3S6EA 1JLBA 3CC4S 5FJ4A 2CDRB 4B08A 1Q7LB 4KR0B 2FB0A 2HHUA 2NXNA 2ZHBA 1IJEB 4IFYA 3OFHA 1CJTB 4V19J 5H9FK 4QWAA 1S9EB 1KVKA 2J0XA 4JV1A 1IJFB 3EGWB 1FF2A 1K1QA 4OX9F 2FY8A 4C8NA 1XR5A 3BBBA 4B3MF 2HRTA 5IC4B 3NS6A 2AJ0A 3W5XA 1WF2A 5E3CA 3J7AN 4OI1A 1HBUA 1CJKA 1KS2A 2GNKA 2AU0A 1HI1A 1RT2B 4TVAB 2FPHX 4Y6IA 4GVLA 5LXRA 3DN9A 1XMBA 2N7YA 4NMXA 3QO9A 3PHTA 1UVIA 3DOMB 3IO1A 3IWLA 4J5OA 2GZOA 3PW2A 2V5HG 4A8OA 2ZOMA 1TV6A 2PO4A 1VMBA 5LMNF 1NH7A 2UUTA 2PDAA 4QIWD 3KK1A 2YTCA 1S0VA 3DFEA 4DFJA 2EKNA 1D9FA 1RHRB 3EGVA 3MWBA 4NASA 5LXYA 4E2FB 4B9SA 2IMOA 4DPTA 4NE9C 2HAFA 1U1LA 1JLGB 1FK9B 1S72S 5D77A 1FJGF 3OUYA 1LWEA 3BDPA 3NL0A 1HW8A 4KTQA 1N6QA 1KQSR 3DC2A 4NLGA 2CWKA 2ZH2A 4JB8B 3LPEA 4LFBF 1B64A 5D0GA 2PFDA 3BV8A 1CJTA 4A8KA 4BDPA 2YH1A 2CXEA 1S9EA 1NHKL 1JJHA 2J9EA 4WFYA 1WORA 3OSNA 2W2NP 1VBYA 5K9FA 3A8KA 4N8OA 4PABA 2DR9A 3V81A 3CMAS 3NOGA 3H4BA 2PA8D 2DNLA 2XYPB 1YJVA 3IRWP 4CO5A 1KVIA 1TKDA 2VODA 3U02A 3J80U 3D68A 4WTYA 1U2RA 4OYIA 5E33A 2HHSA 4R5PB 4S0MA 4F4KA 2VPWB 1RT2A 2ZWOA 1WC5A 1S1XB 4W90B 4O23A 5KFZA 2VHGA 5LMUJ 3KUHA 2QE5A 3SSQA 4YDDB 3DOMA 1Q81T 4C9DA 4YY3F 1UA0A 4F50A 4M5MA 3KLEB 2X1BA 4ELTA 4IH6A 3KYLA 1IBMF 2HQ3A 1NXIA 5L9NA 1KEKA 2BW7A 3PO4A 1URRA 4N41A 1PJ7A 3MR6A 3BPSP 1NJWA 5CYJA 4QCLA 1JLGA 1FK9A 2F8HA 2JH3A 3D9BA 1XMQJ 1VHIA 2PC6A 2ZWPA 2OIHA 3ENVA 3OL7A 2YPZA 1VFJA 4X4NA 3DRPB 4DV5J 4EYIB 3H4DA 4LF4J 3G82A 4UZCA 3BO4A 2D3O1 3N4WA 3C2PA 3KKFA 2HEKA 4F7VA 4IRCA 2K3IA 2VL1A 2WVBA 2AEMA 3PEJA 2X51A 3PFOA 4WFXA 3VHQA 2AKWB 5CCLA 4HH1A 4X4QA 1FRMA 1U1RA 2KI2A 1PIEA 2EG2A 3T1HF 3LP1B 3GE9A 4R5PA 4F04B 3U1LA 1Y0HA 2K8GA 2WAQD 1S1XA 5KG0A 2FJDB 3OXGA 5KT7A 2HRUA 4O4GB 2HWIA 2DIVA 4K4XA 1ZTTA 3KLEA 5A8RB 1RADB 3G6YA 1GK8A 3DGPB 3H5SA 4LBHA 1XEZA 1RWOB 4NRTA 4C98A 4EGLA 3PACA 1WC0A 1HR0F 5L9XA 2J76E 2BBEA 5KFKA 4RNOA 1W26A 5KG2A 1VRUA 2D9PA 1P9YA 1UKUA 3MMCB 1S9GB 1DRZA 4C8LA 4OJ3A 3GJSB 3DLLQ 1ITPA 1JLQB 3Q89A 3KHHA 1U1PA 3NWGA 4NWBA 4PPDA 1G1XA 5HO4A 1TU0B 5E0OA 2D3OR 1ZPWX 2FJEB 3TO8A 3ZZPA 3LUYA 2HBRB 2XLJA 5D15A 5C42B 4FF4A 3FCHA 2KDOA 3MGJA 4DG1B 1R8CA 5BR8J 1HHQA 1ZOTA 5EHHA 3MM6B 2DKOB 3C6UB 3VR1A 2AEFA 4ECXA 4KV8B 1Z1ZA 3MCNA 1TQLA 4FYYB 1KTQA 3RR8A 1B7FA 3K8WA 5E2QA 2AV5A 4FXWA 3DU5A 2DNOA 4DSLA 1WHYA 1X4BA 1ACMB 4I4BA 2IM3A 5B0BA 2ILZA 4RPFA 4O4GA 1VK3A 3RBXA 1VQLS 4WPAA 1RI7A 1EARA 3MECB 4DR2J 4OV6A 2JC0A 2GIRA 2FLNA 1VBZA 4ED1A 2HSEB 1SIWB 5CA5A 3TVZA 3FRZA 4DX7A 1PCAA 5HQ8A 3FGVA 2ALYB 2B8PA 2MQ8A 5HP1B 3RR7A 1YG0A 3VAGA 3VAFA 3WQPA 1HIYA 4V19X 2IM0A 3MMCA 1NDCA 1S9GA 5C24B 4B3RJ 2YWKA 2P9CA 4O3PA 2LVWA 2HHQA 5JMNA 3CT9A 1Q16B 4WK3A 2VJVA 3R2DJ 1KONA 1DJ0A 2NZCA 3I5AA 5J2NB 2DHAA 2KJWA 5C42A 5KG6A 3MPUB 4JI6F 3OQ2A 4BCAA 1EB0A 4DR2F 1QUVA 2K3KA 3MM6A 4WCEQ 3NCQA 4WE1B 1H2UX 2CZ4A 2QG9B 3FRYA 3QBCA 3AD7C 2RDIA 3NAIA 4KV8A 1OS5A 2VZ9A 1YX2A 4FBTA 2B9XA 4J37A 5LJ5Y 1SJ4P 1GFWB 2DXEA 2PI5A 2OEKA 2IDLA 3MTKA 4MYTA 2CNLB 4PXBA 2E5IA 4LF8J 1ZS6A 3GJTB 5L1IA 2UU9J 2QO3A 3ZTSA 2GHVC 4QWDA 3Q23A 3MECA 4FF2A 1HA1A 5KFCA 5DDRC 1HI8A 4ANEA 1L3VA 3IA0A 3WBZA 2E9ZA 2FC8A 4ETXA 3PIOQ 4K0KJ 8ATCB 1G7CB 1S6PA 2D41A 3DRXA 4F02A 1N32J 3TAPA 2I6WA 3SDEB 2DHHA 4LFAJ 1LWFB 1JJ4A 5LL6d 3DLKB 4RBUA 5LSRA 5C24A 4GRSA 2KFZA 1K1SA 2F9DA 4O3OA 5D0EA 6FDRA 4RBTA 4ALZA 1M90T 3OTCA 5ETSA 1SUQA 5L1KA 4ERDA 4URQU 1IQTA 4RX6A 2DPJA 4O0NA 2NXCA 3PKMA 2VASA 1XQIA 1F3FA 1N5YB 4M63A 4FN5A 4DV7F 2UU9F 2J7WA 1FD2A 3PYGA 1IBCB 2C3YA 2I5JB 3AHPA 3FUYA 4WE1A 4K0KF 3IP0A 3TVKA 2Z2LA 1YJNS 3MI7X 2HKEA 1HNZJ 2C2ZB 1R31A 3KXDA 2OD4A 3W8PA 2FC9A 5FDLA 3GP9A 5A8WB 1M1GA 4EBEA 3DLBA 3LW5C 2P5VA 1GXTA 4ZVFA 1D3WA 3A4TA 4K2JA 4QWEA 3AY0A 4MIBA 2J0WA 2VKRA 1VHFA 2NPFA 4U8YA 1T7PA 2BM1A 4Y2KA 2ZBPA 3BSAA 2FLOA 3KLFB 1RAIB 4LSLB 1D1UA 2HS0A 3IM8A 4RNMA 4QYZJ 2FJBB 3DM2B 2XO7A 2QTWA 2F8EX 1G3OA 1Q86T 3GJQB 3H8YA 4P71A 3L09A 2KXNB 2BJ8A 1U6FA 4RW8B 1D9AA 3HVTA 4E98A 3UR3C 1HNWJ 2RIJA 4X65F 2HZAA 2VC0A 4IQMA 2DNYA 2HG4A 3SDEA 2PN6A 4DF4A 2P9EA 3K8VA 1LWFA 4ZPDA 3UWTA 3DLKA 4DX5A 1XJWB 4RU9A 1NNDA 4QW9A 2BKPA 3EXCX 3M30A 3OLAA 4ZHRB 2OTJS 4A8MP 1ROFA 1K0VA 1QE1B 2ZFHA 5BYRA 3B54A 1N5YA 2EC0A 2KG1A 1AB8A 3LANA 3H42A 3D7SB 3RAMA 4OHZA 2I5JA 1S77D 3D1OA 3BGRB 3PYEA 2VUGA 1KQFB 1XMOJ 3TAMA 4ZCMA 2HVHA 1URNA 5CAAA 3ZTOA 1GNKA 5A8WA 3MR3A 4TU8A 1IR1A 1Y11A 4XPCA 2AJ4A 3MR7A 2DEIA 2ZZTA 3HXMA 3PO5A 2PFFB 4MKAA 2FDNA 2KRBA 3QQCD 2GS8A 4HHHA 1SJFA 2VFVA 3KLFA 1HPZA 4AQYJ 2I2YA 1N54B 2KTQA 1U49A 4QIFA 4RW8A 3TZXA 1R0AB 1HKAA 3BH6B 4C7QA 3RB4A 4LVOP 3CCLS 1NHVA 3NWRA 2YVSA 4I0WA 4ZDNA 1V9OA 4RW7A 1AZSA 3PX4A 2OPPA 4OYXA 1SKUB 2QZ8A 2N3OA 2LDYA 4LQ3A 1NMEB 1QM9A 1VJQA 2L3MA 5JUMA 2VFTA 1UVKA 4ED0A 1CJUB 4NZ6A 3KDNA 4DSIA 4IG3A 1WDTA 5KT5A 1QE1A 1UMJA 1U6ZA 4ATNA 4NLUA 1S1VA 4MTPA 1YLXA 3MTJA 3FFIB 2XGPA 3HKWA 4FYWB 1S12A 5KFNA 1X0PA 1F6TA 3BGRA 5B08A 4CIOA 1RWUA 2RUSA 4L72B 1T9VA 2KFNA 2JEGA 3GR1A 2M9KA 3LO3A 1VBXA 4PAAA 1ZA2B 4M5IA 3OLBA 1NPRA 2AMCB 1NJXA 2ZH3A 1LEOA 2GJFA 2E5JA 5AE3A 2VF3A 1X4CA 2YH0A 5KFWA 4YB1P 5GAHI 4OI0A 3FSYA 5KT3A 2YPYA 4CTAA 2E44A 3J7YU 2E66A 1HWUA 3BF4A 3I0RB 2HQFA 3FCVA 2HMIA 4A48A 4DV0F 3TEHB 5SUHA 5DQHA 2ZEJA 1R0AA 1UL3A 5HJYA 3CSKA 3I0SB 2KYZA 4P2MA 1J5EF 3DDIA 4MMOA 2HIQA 5L1JA 2JLFA 2J6TA 3PYFA 2HW3A 5DRKA 4ZPTR 2KVQE 2MJUA 3CCTA 3KJNB 1XNQJ 4X4OA 2NXEA 1Y10A 1IM6A 3RW6A 1NDPA 1U25A 1IBKJ 3IRXB 2FVPA 5DJBA 4WFNQ 4NLRA 2UUBJ 5U47A 1H74A 4F0HA 4NEYA 3FFIA 3F73A 1J5OA 3QGGA 1NK6A 2FD2A 1XTZA 3QGPA 4LJMA 3H5XA 1C0UB 4EZ6A 1CSJA 4JP8A 4M5DB 4F0KA 4JI1F 1M5SA 1T9TA 2OMOA 3DLJA 3VQTA 1NZ8A 3UD5A 4RUBA 4DEZA 1T02A 1X4HA 1F9HA 2JOQA 4JI3F 1GH8A 2ZE2B 3ENQA 3K5LA 3O5TB 2Y1IA 2L08A 3K59A 2R2RA 4LRFA 5A6WA 4QWCA 4OJ1A 2W4PA 4KT0C 5HMZA 2ZUGA 1VC6A 4AUKA 2KL8A 2HFUA 3BGFA 2AT1B 3N0VA 2BOAA 3HHLD 3U1NA 3I0SA 4P2FA 1OPIA 1WEYA 2MZQA 2DRAA 5GADI 4EBDA 3JSMB 5L39A 2MZRA 1W2BR 2OFHX 3KNAA 4OI3A 2V2QA 1YTYA 4EEYA 1RAAB 4K4UA 2VPZB 4TQSA 1VC5A 1Q53A 3H90A 3T5JA 3IRXA 2VFRA 2BKNA 3BYRA 5HMYA 3VALA 1N5TA 2FVCA 1CC7A 2W9CB 1QVFR 1B99A 2MZ1A 3TQ1A 5HI7A 2C3MA 3C15B 3CJ0A 2C2NA 1E6YB 3MR5A 2LXUA 1PBUA 5DLFA 2CADA 3ZC4A 8RUCA 1N36J 1EETB 4FS1A 2Z56B 2ASYA 4QWBA 2MSSA 3KK2B 2YKPA 1MMDA 2MEWA 4AL5A 2YY3A 1WD6A 1X8DA 3Q24A 1X4EA 1HD1A 3RRGA 2YKMB 4WYLA 2ZKUA 4J9MA 4F2SA 4P9SA 2IM1A 1OO0B 2IJNA 2R8HA 4L73A 4YUDA 4Y2AA 1FXRA 1VQMS 3H2UB 3RU0A 3JSMA 3D3BJ 3FEZA 3RRHA 3BR9A 1JJ2R 1AUDA 2I8EA 1OIAA 3RG6A 2ZOFA 3J81Y 3O1LA 1NB2A 4QW8A 4UOGA 3LGNA 1NK7A 1WTFA 2VDHA 2G2YA 4N77A 1UEKA 4JI8F 2JEIA 1TELA 2VPYB 3CD7A 4PYDA 1HD0A 5J2MB 4JI4F 2FUG9 4DX8H 5CD4H 1ZM9A 1U4BA 1WG4A 1SH2A 3Q83A 1ZH5A 3KNGA 2Q3PA 1NCLA 1WUUA 2U1AA 1E6YA 2OKQA 2DBBA 2XNQA 3BSCA 2WHOA 2HQGA 4KFBA 4DPXA 1RUSA 2M7SA 2DR6A 5EWGA 1EETA 3HHEA 4A8YA 1HBMA 3SV4A 1VIOA 4OV1A 3KK2A 2DNQA 3HHNB 1LWXA 1RP5A 1GXLA 1RAOA 1JLCB 2YWGA 4DLGA 2H4WB 4M5LA 1FXDA 4KHPJ 1M1HA 2YKMA 2CYYA 2DJWA 3CDWA 1FWPA 3KMQA 2HBZB 1WG5A 4UF4A 1TMMA 4EMDA 4C0HA 1UVJA 5KG5A 5H9FJ 4KH0B 4ZLJA 4FKYA 3TJ9A 1YJTA 2QFIA 1RTDB 3HM9A 3FEXB 1UFWA 1T8EA 1OSDA 3B6BA 3HVWA 3S1TA 4OLOA 1J27A 2ADBA 3M1VB 4DV1J 3LPYA 2V63A 4DR7J 2G0CA 4FF3A 4ANCA 2BUNA 1L3SA 2P8IA 4OYPA 4Y65A 3WX4A 2WSCC 2DGOA 4NXMF 3GYXB 3IN5A 2KM8C 1LK5A 3KUGA 3CCJS 1HW9A 3M8QA 5ETVA 3KFWX 1FRXA 2VG5B 4J9RA 2AF6A 2OTLS 3UVJB 2QV6A 3SFUA 3AJ2A 4DCOB 3Q8SB 2CFXA 5DG7A 3S7RA 3AOAA 2ZH1A 3IGVA 1H0HB 4OYMA 4DR3F 4ZITA 1P6TA 1D9DA 3HZGA 4IR1A 5KFMA 3HSZA 1XERA 1IUJA 4ICLA 3K0JA 2W7OA 4Z7CA 3O44A 3C66A 3GV7B 3G8QA 5HSPA 4ZVUB 2NSBA 1H7WA 1Y00A 2J6SA 4C4WA 4DV1F 3KHGA 2LEBA 3UW1A 2NYIA 3BGUA 3E2EA 2UVRA 2DR7A 1JLCA 2V4QA 5KFQA 4JV5J 1QY7A 3FK4A 1YJ9S 2HGNA 2VFUA 3RB0A 2BQRA 1F5BA 1T9XA 3QZ8A 5GMKa 2B9YA 4RL1A 2HRYA 2WBMA 4I56A 2ZZNA 1LV5A 1RTDA 4RLEA 2COLA 4HDHA 4YOEA 4FPRA 2EFGA 1G6BA 3NNHA 4GVBB 4P72A 2ZHOA 3HJFA 3M1VA 3DU6A 1SC4B 3HF5A 3IBFB 4KPCA 5G0RB 2EVZA 3MUVP 4OI4A 1H72C 4KGXB 4OJGA 1O51A 1FWKA 4DCJB 4QIGA 4DR5J 2AW0A 3HJVA 1GXUA 2V8HA 5DDQC 5KFDA 4CM0A 4RUHA 5IFMA 3QLHA 2VG5A 1SJ3P 2JJ4D 3HLUA 3UVJA 1FX2A 3JAMY 4DX6A 5AE1A 2VFSA 3Q8QB 1QVGR 3MUTP 2KZZA 2G0IA 2FIUA 4MFBA 3WIVA 1RWXB 1SJRA 2RS2A 2OGUA 1QSSA 2FHJD 2W9AA 3MHYA 1ELOA 1KLMB 3TA0A 2XS2A 3AH6A 2Z2YB 1HHSA 4C0OC 2GVDA 4DUYJ 4UZBA 3MAAB 4M1KA 1U1MA 3TQEA 2CJBA 2Z2MA 4DS5A 2K06A 5FLXY 4WP8A 3MMJA 3R5GA 1NPKA 4NA2A 3CO0P 4B9MA 5KFYA 5CHCB 4J91A 4NLWA 1M5PC 1EZZB 3W9IA 2HZVA 4K4VA 2ZNZA 2AX1A 5JVGQ 3VAMA 1TFYA 1FESA 3GB0A 4ZCLA 3K2YA 1RAJA 3OT9A 3OFGA 1FDAA 4WU2A 3DOKB 5D4PA 4ECUA 3K17A 4GVBA 2MHNA 1F60B 4ECYA 3TW0A 2RQCA 1YIJS 3G6VA 3OHBA 2C2EA 2ADCA 4HT7A 2VQEJ 1N5SA 4LRAA 3CB4A 4ED8A 1JLFB 4P2XA 3A3PB 4EI2A 3AQOA 2B4OA 4F4AA 4MK8A 1YRXA 2XMVA 3H5YA 1A6LA 4PWWA 4J7CA 2M4MA 2ROGA 4USUA 4GKKJ 4WF9Q 3DLGA 4N5SA 3C16A 4N7TA 1HWJA 3ISZA 3BQ0A 1EJ7L 4KPYA 3CJ3A 1NEEA 2R7WA 3JXOA 5KG7A 1PAUB 4ZVPB 4A8QA 1WC3A 2LXIA 1JLAB 3NY0A 3W7BA 1JXVA 2V2ZA 1I5OB 3GYGA 3KDOA 3MZIA 1KLMA 1JNZB 3AD8C 3ZTQA 5IXUA 4N8NA 4ZJOA 4Q8EA 2R7TA 1Q7YT 4X66J 1MNEA 3MAAA 2I38A 3L95X 3VAJA 1S49A 5B0FA 3W2WB 1Y3JA 3RB3A 1VJWA 3I9V9 1M5VC 2ZJQQ 3RAQA 2XWXA 2G13A 2ZDOA 2DNZA 4B9UA 1FA0A 4GC6A 2C3UA 3PCOB 2QLBB 4AL6A 1FRHA 3MEKA 3V6JA 4GKKF 1FKPB 4ZVSB 1TKTB 2FZGB 3R5DA 4RNNA 4ZVGA 3PW4A 4H4OA 3DOKA 2DH7A 1CS4B 3UI3A 3TJ8A 3OSPA 2UUAF 4DR6J 2JVOA 3NGTA 4ZN3A 3NOCA 2RD5C 1JLFA 4F4YA 4PYAA 1WACA 2GHPA 3HPOA 3RUBL 2V9KA 2DTJA 3AODA 3IWNC 4DHVA 4KB7A 1C4AA 2F65A 4X66F 4K4ZA 3I5BA 3G71S 2JSXA 3LTOA 4NCBA 3TR5A 3CMQA 4NLPA 4PG5A 5ETMA 3UNGC 3ELHA 1EQ0A 2EXUA 2RHSB 5HL7Q 2DCUB 1JLAA 2MSTA 3PG9A 2HBQB 2FHOB 3N01A 3WX8A 1FWLA 1YZ6A 5KFVA 2HAIA 1LFPA 3NS5A 1J2VA 3DKDA 2YWWA 2LQ8A 2YQ1A 4DR4J 3ILLA 1FVSA 4TLRA 3ZZTA 1NH8A 2QA2A 1HWLA 4LREA 2KXHA 3VGSA 5K8NA 3EDQB 4QPTA 1M5KC 3MM5B 4J9SA 1K47A 1N52B 1YHQS 3GIMA 3H0PA 4LF5F 2OHDA 5M2PA 1FKPA 5D8HB 1TKTA 1WELA 2JC1A 1CS4A 1PAEX 1X60A 1DLOA 5CZXA 3M6UA 2C1EB 3FDSA 1FCAA 1EKSA 5DG8A 4LSNB 4K4SA 3QT8A 2OAUA 5M2UA 2M5YA 1U6BA 3VQSA 2JZ5A 1H2VZ 1MN9A 4KH1B 4ZP7A 5B0DA 2KM8B 2OPQB 1GTEA 4ED7A 5HBMB 3RGIA 3EICA 3TARA 1RHKB 1SKWA 2EPIA 2XMUA 2IHR1 4MAKA 1ZZFA 1S1WB 4CLSA 1T3NA 2Z8QA 2XLIA 4TLQA 2FGCA 3PW5A 2B43A 4ZA1A 3FBEA 2KHDA 3QFHA 1U02A 1DQ9A 3UQSA 2IFXA 1HNXJ 2WOMA 3KLHB 2QN6B 2EBEA 3TP2A 1NK0A 2WW8A 3HVAA 1AW0A 4KBIA 4ZOSA 2UUCF 3N6MA 3OL8A 3MM5A 4LF7J 2ACMA 5DZ7A 2HHHF 2XBPA 2GIFA 3GMGA 1Y7PA 1R8PA 2ILYA 2ZBCA 4HLBA 1KVJA 3K5MA 4DV6J 2QLWA 3L9ZA 1G4CA 1X31C 1Y3KA 1BQMB 3IGNA 3CJ5A 2CPDA 5KTQA 4DR1J 2HVEA 1LOUA 2H65B 2HWTA 2HVIA 2BMBA 4LSNA 4USMA 2MQPA 4USIA 3ZZYA 1L3TA 3NCRA 1UVLA 4F25A 4RW9B 1RYRA 3EZOA 4DU8A 3IBCB 2OSQA 2GVZB 1UP1A 1RTZA 5HBMA 5L1LA 4KHRA 3DMJB 3MCSA 4YB5A 2B8QA 3LOUA 2W4CA 3EZUA 1S1WA 3KJFB 1OWXA 2M0GB 1RT1B 4ECVA 2W24A 1Y5LB 3MAQA 4N76A 4QU6A 2MZJA 4O3QA 3OD2A 4P6QA 5ETOA 2NPIA 5IWAJ 2V4RA 4OL8A 4MH8A 2OI2A 2XHWA 3M2UA 4B3TF 3M8SA 3ZTPA 2NCKL 3OJSA 2ZH7A 1NBEB 4X62F 3KLHA 5AXNA 2LCWA 3MUMP 4QIEA 4DN0A 4OZLA 3GIKA 1TL3B 2YKNB 3M9OB 4IFVA 2DNPA 3GYNA 4KC5A 2NXJA 2KZMA 3FNNA 3QRPA 2J7UA 5KFRA 3GCWP 2XY7A 1RTIA 5AT1B 4AD6A 2IAJB 2FY1A 2B7CB 1F9FA 3P96A 1NUEA 1TMJA 2BANB 4EUVA 5ADZA 2D3UA 4F2RA 2DISA 3BREA 4QBUA 5IM0B 3I4HX 4H4KC 3LALA 3G2XA 1X7VA 2H5JB 3JTOA 2JRSA 1KC8T 2MY8A 5IQ6A 5J1PA 1D8ZA 3ILJA 2ASDA 1S99A 2CG4A 4RW9A 2WZ1A 3QMQA 1Z4UA 2GQQA 1BC6A 3PTWA 1JXEA 5CABA 3R8YA 2GVZA 2IVMA 1OJ4A 2FTRA 3DMJA 4DL4A 3A8JA 2EEYA 4C3MA 1HNVB 4N47A 1NSQA 3I56S 1F0XA 4ZIVA 1RT1A 3C6TB 3GONA 3AXKA 4LBIA 3CTRA 3W3SA 4ED4A 3FKBA 3R7BB 5B0GA 1KTVA 1RLCL 3PY8A 4J9LA 2CQGA 2B4PA 1SQEA 3BO2A 1S5ZA 5E3RA 1TL3A 1GMWD 3HFVA 4PXEA 3NP5A 5F0UA 4OHXA 1NK9A 1FFGB 4AXJA 3TANA 4XO0A 1SKRA 2YX7A 3ETOA 1CG2A 5HQLA 2ZOGA 4Q5VA 2IAJA 2LLZA 4B9NA 2DGWA 3BEGB 1VQ6S 1CEZA 1ZPVA 4JYAJ 4F36A 2BANA 2H48B 2IDEA 3J7YI 3OJUA 4CI0B 3MPDA 2GJIA 3N6NA 5IM0A 3VF0B 3OR1B 5EX3A 1X0FA 5KG3A 1CVJA 3I96A 2OPRB 2JDJA 3OVBA 4M5NA 3E8OA 1ZAVA 4LIRA 2QSFA 1X4AA 2OD6A 3TVYA 5HN0A 5KT2A 4ECSA 2UZAA 2AWZA 3IXQA 2D7SA 3UNYA 4FDFA 4IH5A 4HHJA 5E3AA 4F8RA 1NSPA 2W25A 4LF9J 3IR6B 1HNVA 5LSLA 2W2OP 4M94A 4EBCA 1S59A 3G9CA 3HKZD 2HGLA 4A47A 1PG5B 2XY5A 2XG8A 3AOBA 3RB6A 2L9WA 4FYDA 5DLGA 5JXSA 3BJYA 4RW6B 1L3UA 1R43A 1ZM2A 4KYZA 1EQMA 2V34A 3VAKA 4D3HA 4ZP8A 4TXSA 5H9EK 1ZTWA 3DLEB 1IR0A 1TK0A 2JEJA 4F3QA 3PJXA 2QA4S 2HNDB 5EDWA 3AT1B 4KGMA 3D0HE 2H51B 4B3SJ 1VQOS 3QFWA 1OMSA 1PGZA 3R6GB 3J81U 4DV3J 2V68A 2W7AA 2XLKA 4JV0A 2B51A 2DO0A 1DQAA 2XZWA 1K73T 4IUFA 5EX0A 1SC6A 3V6DB 4U96A 3U7JA 1R8AA 4ZVRB 4GKJF 4LSZB 1M0SA 3OL6A 3OR1A 2CJ9A 2QGFB 5C7PA 3HT3A 2C2RA 2F3JA 4OZ2A 2R7OA 2CRLA 2RKIB 5J1EB 3KTQA 1DFDA 1FRJA 2L9DA 1IBLF 3ZZRA 3QZ7A 5THWA 3SQGB 1N5VA 1NRKA 4WXWA 1RABB 3QAEA 2J5AA 2OSRA 4LT6A 4DSJA 3C8YA 2RILA 4FYXB 4X4UA 1XC9A 2QYCA 1N33J 5KFHA 4U8VA 1JB0C 4RW6A 4ZVQB 4DFKA 5KG4A 3MR2A 4MIWA 1YJUA 1SKSA 5HJXA 3OTOF 2W2QP 3DLEA 4IDKA 1XWLA 2OO4A 3UCGA 4J9NA 4UW2A 1RWKB 3SEOA 2HNDA 1UAWA 3VV2B 4J9PA 4ITSA 1D09B 2ZVSA 2HQIA 2D9OA 3P8BB 3EPGA 4RBVA 3TWZA 1DQ8A 4ENOA 4XDDA 2IM2A 3QRRA 2H4YB 2M3DA 5T7LB 3P4UB 1IKWB 4HTJA 4DV4J 1JKHA 4A8FA 2OJ3A 4CT8A 3V6DA 4G3IA 2K2PA 2QYGA 2PEBA 2RU9A 4KY3A 5B7WA 2RNEA 3NG8A 2O3DA 1WHWA 2E9TA 1TFWA 3T1YJ 4Y2CA 1GEHA 3SSRA 1NK4A 2XSFA 2HHVA 1FTCA 2RKIA 5A2QY 3IR5B 5IV3A 1D8YA 4EYHB 4HT5A 1AROP 1FJ7A 3QSYB 1AFJA 4YMEA 1IKYB 1WTBA 3THVA 2HVDA 3SQGA 3GU0A 4ZPBA 5J2QB 2K7KA 3MEDB 2ZM6F 2XO6A 4Y2MA 4OZ3A 3V4MA 1RE1B 2ASJA 5MAOA 4HH0A 2K1RB 3Q0AA 1OYEA 1N34J 2QFJA 5I3UA 1UW9A 3ONQA 4RNFA 4C6AA 1UEUA 2YX4A 2GHWA 3HT0A 1KOOA 1P1LA 3JSYA 3R2CJ 2HNZB 5G4DA 3LWMA 1B0TA 4GMKA 2R2SA 1C1CA 3RJMB 5DG9A 1QTMA 2EFPA 3NXZA 4KAIA 2B5JB 3K57A 2YX1A 4DS4A 4OIXA 3ISNC 2OP5A 2M8DB 3MPWA 1N0VC 1FKOB 3FEYB 1S48A 5T7LA 2AZ1A 1IKWA 4FNHA 5HANA 3FBFA 4C97A 3MCMA 3VGVA 2A2CA 4JI7J 4I2PB 1QAYA 1WDDA 2MKKA 1AYEA 6AT1B 3R27A 1UW4A 2KVIA 3JAMU 3OXLA 2G4BA 2X3GA 5DM7Q 2SXLA 1S79A 5IT0A 4NX9A 3CDUA 4GO5X 1RB0A 3MXHP 1IKYA 3CJRA 2WB1D 2RMLA 2ZKTA 2W1BA 3P6YC 1RHUB 1VLYA 3NNAA 2UVVA 1S9FA 1Q8IA 2FLLA 2DB1A 5J2QA 3MEDA 2N4DA 4NLQA 2GO9A 3EGNA 2K1RA 4Z7YA 2RAQA 2HVZA 3GG0A 1N4LA 5FLXU 3MCOA 3JQMA 4TY9A 4DL2A 1PSDA 4P2SA 3S01A 3HX9A 1TKXB 1Q95G 4ER8A 2PIIA 4CNYA 4CRJA 5D78A 4JI7F 4KO0B 2GW8A 1SB6A 2GQ2A 3MFIA 1DHMA 1Q79A 4CO0A 2B5JA 3KJQB 1RHJB 5DDPC 4KGZB 1YVFA 5D4OA 3HCXA 3O2IA 4B02A 4UUXA 3I5CA 2P6TA 4XPEA 2D69A 2E7VA 3GR0A 3DRSB 2Y9HA 1WC4A 4NLXA 4OX6A 2YNIB 1RT3B 3LP0B 4NLVA 3VAHA 5E5NA 2LECA 1TP7A 4KGKA 2MHEA 3I31A 4I2PA 1U1KA 5ETKA 2QA1A 2RE1A 4H4KA 1QSLA 5LMUF 2RQKA 1DY3A 1SI9A 3BGLA 2XC9A 4OZNA 4YFUA 2AYEA 3SI8A 2I0XA 3QYYA 3TX0A 3W8GA 1REGX 3D5MA 5GAGU 2QL9B 1X9SA 4I69A 4O4RA 4XK8C 3T6JA 1V5IB 1PO6A 1XIQA 2ZDPA 2DGVA 3GG1A 4WYWA 3M4XA 2VICA 5D4LA 1U2FA 1B0PA 3VZHA 1FO1A 4R25A 4K4WA 1PYOB 1XMQF 3T5LA 4O3SA 5E41A 1TKXA 5CZVA 4DV5F 1YSJA 4KO0A 4CLLA 4LF4F 3C19A 2XS5A 4WXOA 4DQSA 2CPXA 2CPYA 1TR0A 3PV8A 1S0MA 3UCUP 1WEXA 2X3DA 4USWA 2FVQA 1AFIA 2AD9A 1F5CA 1U26A 4ZKAA 2MZTA 2XYHB 3R1LA 1VC0A 2DT9A 4CT9A 4QYZK 3DRSA 2J8SA 2YNIA 1RT3A 3LP0A 3D6MB 5HK4A 3WC0A
chains in the Genus database with same CATH topology
3VZIA 3DRPA 2DNGA 2G0CA 5GAEU 4FF3A 2BUNA 1L3SA 5BYQA 5DGBA 4OX8A 3J7ZT 4J9QA 2C2DA 1VS3A 3F56A 2EK1A 3EGZA 4IH7A 1FDBA 4LQ9A 4NLTA 1HNIB 1RT4B 3RBEA 3E3XA 1VQKS 4Y65A 1KD1T 2LQJA 2MQMA 2WSCC 2DGOA 3WX4A 4NXMF 3GYXB 4DF8A 1S7HA 2KM8C 3IN5A 2E7WA 1PC4A 3POTB 1LK5A 2YNHB 1J5OB 1FDNA 1AUDA 1ZBTA 2GMLA 1C0TB 2H9ZA 4P7VA 3FMWA 3CCJS 3UDLA 3CCQS 3M32B 3M2RB 4WK1A 1VQPS 1HW9A 3M8QA 2Q1LA 3B4DA 1R3NA 1FRXA 3DHXA 3KFWX 2VG5B 5EUHA 2AF6A 2CJQA 4I2QB 4QR1A 5SZTA 4J9RA 2OTLS 2QV6A 2E5LF 3SFUA 4ECQA 3AJ2A 3G4SS 3I55S 2RUGA 3Q8SB 3BDEA 2CFXA 2IJFA 2Y0SD 1QTMA 5DG7A 4DR4F 3QJJA 3S7RA 3T5HA 1HBUB 3G6ES 4OI6A 4ZK7M 1WI8A 3Q2TC 1U45A 1FD8A 2ZH1A 3IGVA 1H0HB 1K8AT 1WEZA 4DR3F 2RF2B 4FP9A 1P6TA 1D9DA 3HZGA 4IR1A 2LMIA 1S6QB 2MY7A 2AX0A 4OX7A 4G1IA 2XCAA 4I6WA 1S10A 3LP1A 2KT5A 5KFMA 3PVXA 1SIZA 1NO8A 5I3UB 2ROPA 3CCVS 1XERA 4NXNF 4WIIA 1IUJA 4ICLA 3K0JA 4WKYA 4ES3A 2J0SD 2W7OA 3QO9B 1IKVA 2B9WA 3O44A 4Q45A 2RSQA 4ZPWR 5HLFA 2F4VF 3C66A 3GV7B 3G8QA 4DSFA 2WRMA 2C3PA 2GO8A 3B4MA 1X9WA 1BQNB 4O3RA 2NSBA 1H7WA 3WZ0A 1Y00A 1VGYA 2J6SA 4A4JA 4C4WA 3T3FA 2UXCF 4DV1F 1TV6B 3KHGA 2LQ9A 1C1CB 4U9RA 2LEBA 5ITHA 3PIPQ 3UW1A 2R7SA 2NYIA 1RDRA 3L7PA 1KHWA 2ZNYA 2RJZA 3BGUA 4LIWA 4CO1A 5A8RA 4YR3A 4ECTA 2DR7A 2UVRA 3E2EA 1CLFA 3CJ2A 4F4XA 4JV2A 1FNMA 3SV3A 3DGPA 3PDNA 3EX7B 1JLCA 4AFFA 3SCLE 4USJC 5F8LA 2BRLA 2C22A 1B0VA 4DL0C 2V4QA 4NMLA 5KFQA 5AXLA 4ECWA 4NLOA 4YHHF 2VBXA 1ZAWA 4KIAA 1O8BA 2VOPA 1QY7A 4J9KA 2OPSA 1YJ9S 3MMAB 2AGQA 2HGNA 2PD1A 5BR8F 2VFUA 3N5BA 3RB0A 2BQRA 1F5BA 3QZ8A 1MU2A 5GMKa 2B9YA 2GCFA 1LWCA 2HRYA 3GFXA 3H20A 3V2UC 2WBMA 4I56A 2ZZNA 4C3KA 1LV5A 1RTDA 2LYVA 4RLEA 2COLA 4HDHA 3MEGB 4YOEA 1CQNA 3OUYB 4FPRA 2EFGA 3GSDA 4DLEA 3ITHB 1G6BA 3NNHA 2DNKA 4Q2MA 3G8TA 2EFQA 2ZHOA 3HJFA 2VH7A 2O67A 2JWNA 2WCXA 1N6QB 1HBOB 1DZ5A 5F8HA 3M1VA 3S6EA 3DU6A 1JLBA 3HF5A 1JLQA 3CC4S 5FJ4A 3V5RA