2B6AB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with thr-50
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HIV-1 reverse transcriptase (RT) in complex with THR-50
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase p66 subunit
total genus 101
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b6aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB03
3IGVA 4K4YA 4IR9A 2ATLA 4MFBA 3PHEA 4KHMA 3QZ8A 4IH5A 3V6HA 2E9RX 2D3ZA 4ID5A 1JLAA 2B5JA 3T19A 4R5PA 5KT6A 1HARA 3GYNA 1RTJA 4ZPCA 1HYSA 1C0TA 1NHVA 2YKMA 3N6MA 1JLQB 3Q8QB 2JC1A 4LQ3A 3QYYA 5KFVA 4O3SA 5KFAA 5KT7A 1TKTA 3TAMA 3PZPA 2YNHB 3DM2A 4TY8A 3ITHA 3C6TA 3KLHA 3V4IA 5HROA 2CJQA 3BR9A 1S1VB 4EYHB 4GC7A 3QLHB 4RW9A 1C1BB 1SV5A 2RF2A 4H4MA 1S1WB 2F8EX 1RTDA 3KLIB 5KG5A 3Q8RB 2VG6A 1QAIA 2IA6A 2OH2A 4R8UA 3BJYA 1KLMB 1REVB 3KJVB 1C0UB 3N6LA 2R8IA 4G3IA 1RA6A 2I5JB 4IG0B 3V6DB 1LW2A 1S1TA 5KT3A 5J2PA 1LWFA 3QGHA 4ZP7A 3LAMA 3PR5B 2D41A 2VA3A 4PWDA 3BSCA 4ED0A 5KFNA 4ECSA 2RKIA 4YR3A 4K4WA 3T5JA 3HVAA 4ED6A 4RU9A 1KLMA 5HP1B 2HNYB 4NLTA 3I0SB 1T03A 5F8GA 3QGGA 4J9PA 1RT7A 1RT5A 1MU2A 2HNDA 3G86A 4MKAA 1TKZB 5KFDA 3PW4A 2AU0A 1JXLA 2FLNA 5KFWA 1C1CB 3CDUA 5KFXA 4IG3A 4JV1A 4PWDB 2UVRA 1MMLA 4O3QA 4WE1B 5J2MB 3DLGA 1K1SA 2IM0A 4IKAA 4QPXA 4Q8EA 2ZD1B 1J5OB 3LP1B 3BSOA 2R2UA 3FQKA 2R2RA 1QE1A 2YNGB 3V6DA 2WRMA 1BQMA 3G6VA 3IS9A 3QGIA 4IFYB 2WCXA 1REVA 3KJVA 1VRTB 4R5PB 4OL8A 4M95A 4Y3CA 3KHRA 3RAXA 3SI8A 2D3UA 2YKNA 4QWAA 2OPQA 1S1WA 2WTFA 2HMIA 2W9AA 3LP1A 3LP0A 4DL3A 1RYSA 1S9EB 4X2BA 4ZPBA 2YNHA 3DM2B 4O3OA 4XPCA 3KLEB 3BSNA 1BQNA 1S0NA 4ZVHA 3H5SA 5HLFB 4TQRA 5C42A 2BRKA 3M8PA 4ZVGA 5KFZA 4J9LA 4ZVFA 1S10A 3QIPB 4RW8B 3GQCA 2V4QA 2YKMB 2RDJA 3CDWA 2J6UA 3DMJB 3OHBA 3KK2A 3FFIB 3KHGA 2OPRA 3IRXA 2ILYA 3H4BA 3QO9B 1RT6A 4NLRA 5EUHA 3I0RB 5JUMA 5KT4A 2R2TA 5EWGA 2XC9A 3HVTB 4M94A 2ZKUA 3CO9A 1RT2B 3E01B 3EPGA 3MR6A 4J9OA 4F4XA 1RDRA 4TXSA 1TV6B 3QIPA 4RW8A 3JSMA 5J2NA 4ECYA 5KFTA 4RW6A 1OS5A 3MEGA 1SH2A 1TVRA 3LP2B 2R2SA 4G1QA 4NCGB 3PW0A 2R8JA 1RTDB 1JLEB 2YNIA 3DRSA 4I2QA 5I3UA 3PR4A 1RTHB 4J9QA 3RB6A 1QUVA 1HQEA 2CKWA 1K1QA 5KFYA 2UUWA 5KG4A 3RB0A 1S6PA 1EETA 2UVVA 4U7CA 3KLGB 4LSNA 4MIBA 4KSEB 3LP2A 4RZRA 2R8KA 3MEGB 4QW9A 5L1JA 4ECRA 1C0TB 2XCPA 3GIJA 5J1EA 2XGQA 4LSLB 1YVFA 5DG9A 3HVWA 1JLBB 1XR7A 5FDLB 1HMVB 4TY9A 2ZE2B 3KK1A 2XWYA 4EBDA 3NL0A 5K14B 3H40A 5JXSA 4URQU 5I42A 3CJ0A 2BQUA 4G1QB 4NCGA 2AQ4A 1TVRB 2HNYA 4B3OB 2QE5A 1IKXA 1KHWA 1UWBB 4R8UB 5CYQA 2JEIA 1GX6A 3KLIA 1VRUA 1TV6A 4IOBA 4ED8A 5FDLA 3ICLA 4NLOA 3KLHB 3T5KA 4O44B 3MFHA 4MKBA 3DLEA 2W8KA 5DG8A 3I0RA 4NLUA 2JC0A 4YR0A 3OSNA 1JLCA 3BSAA 3IGNA 1RT4A 3H5UA 4WFYA 4GC6A 2WOMB 4J9RA 2XI3A 1N5YA 4HKQA 3CIZA 4DEZA 4NZ0A 1NNDA 5L9XA 4DG1B 2YNGA 1I6JA 1LW0A 1RAJA 1S9EA 4QWDA 3DRSB 3DRRA 2IM1A 1TKTB 3H5XA 4WE1A 3QZ7A 4WXOA 4JV2A 2YKNB 4DL5A 1UWBA 1N5YB 1JLAB 1JKHB 3NKYA 3T1AA 1JLGB 1XR5A 3H4DA 1W25A 3BQ1A 2JEGA 4ECWA 1GX5A 1KHVA 3OSPA 3DLEB 3DI6B 4F4YA 1QAJA 5T14A 4IFVA 4F50A 3DMJA 2IAJB 4ZP6A 4ED3A 5J2PB 3H2LA 4PUOA 1WNEA 2OPPA 3NAHA 4Y34A 3I5AA 5HLFA 3T5HA 3QIDA 4B3OA 4NLSA 3M8QB 4NLDA 2W9BB 4KKOA 5F8JA 1RTIA 1S6QB 4EBCA 3KNAA 2EC0A 4NRTA 1HPZA 4PQUA 1HMVA 2OPQB 3TVKA 1LWCA 3EPIA 1HQUA 3C6TB 3C6UA 5HROB 3NBPB 3DOLB 4WXWA 3KLVA 4LSLA 4K4UA 2C2EA 3DDKA 4NLVA 5KFIA 2AGPA 3V81A 4WZQA 4RW7B 4K4XA 5KFOA 2ZD1A 1J5OA 4EEYA 3RBEA 4RUCA 2WOMA 2AWZA 4NLPA 1HPZB 4IFVB 4PQUB 4ZVEA 3MR3A 3KHLA 1S6PB 5F8MA 3E51A 1S0OA 3KK3A 4RNHA 1RT1B 5C25A 3OL7A 3ITHB 4J9MA 1C1CA 1JLFA 4NLWA 3QO9A 3OL9A 4RNFA 4YQWA 1FKOA 2FVRA 2VG7A 5DGAA 2OPPB 5F8HA 1TL3A 2OPSB 4URSA 3EZUA 1N56A 1S1UB 5J2NB 2B5JB 2E9TA 4ID5B 3KLFB 3IN5A 4NLGA 2XCAA 4LQ9A 3LALA 1LWFB 4FBUA 1LW0B 3OL8A 3H5YA 4J9NA 4ED1A 3KMSA 3GIKA 4ZHRA 5L1KA 2WK4A 2FLLA 4IR1A 1DTQA 2BANB 4RW4A 5KG0A 3SFGA 1VRTA 2OPRB 3ISNC 2RDIA 1S1UA 3MEEB 3DLKB 5KFHA 2FJWA 2IJNA 2W8LA 3QLHA 4RW9B 5C42B 2J6SA 3H98A 4K4SA 2IBKA 4QWCA 3HHKA 5KFJA 4KO0A 5J2MA 2IMWP 1IKVA 1IKYA 3MFIA 4O3NA 4ED2A 3G6YA 4MK7A 3V6JA 3PVXA 2B6AA 2C28A 5KFFA 5KG7A 3VQSA 1CSJA 4ZMMA 3CJ2A 1JLEA 2YNIB 4JUZA 4J9SA 1DLOB 1N6QA 5KT2A 2BRLA 5KFRA 2C2RA 4IRDA 2B43A 5DQGA 5CYMA 4Q8FA 5KFLA 1C2PA 2JLEA 3RB3A 4RW6B 1S9FA 5F9NA 4RUAA 2HWHA 2WONB 1S1XA 3MECA 3G6XA 1JLBA 3DYAA 4KFBB 1VRUB 2VG5B 2I5JA 4IG0A 2W9BA 1U09A 3UR0A 1N48A 3MTKA 1JLGA 5F8NA 4ECTA 3M9OB 4XO0A 5DQHA 3FQLA 1JKHA 4Q44A 5F8IA 1Z4UA 4H4OB 4KBIA 3GIIA 4TLRA 3M9MB 3FSIA 3MEDB 3CJ3A 4NRUA 1JIHA 1IKYB 1IKVB 4MK8A 4TY8B 1S97A 1ZTTA 1SUQB 3SFUA 5DLGA 1TKXA 3OHAA 4IDKB 3NAIA 1FK9A 4HYKA 3IG1A 1JX4A 1JLQA 1RT3A 2W9CB 4FS1A 4ICLA 3KHHA 4I7FB 4KV8B 3RAQA 2J6TA 2XGPA 4K4TA 5KG3A 1TL1A 4DL4A 3I5CA 4ZPAA 4MFBB 1RT4B 1BQMB 1IM4A 2QV6A 3MR5A 2V9WA 1RTIB 5I3UB 1TKXB 4O4RA 3OL6A 4KKOB 2WB4A 3DRRB 2UUTA 2FJVA 3TQ1A 4O4GB 1SH0A 3T5LA 2C2DA 4TYBA 4O3RA 1HNIB 4DL7A 4EBEA 4JV0A 4NLYA 5KG2A 2W7OA 5L1IA 4TN2A 1MU2B 2HNDB 2IAJA 3MEEA 1T94A 5HBMA 1RT2A 3E01A 4O3PA 5KG6A 3KLEA 3FDSA 1S4FA 3V6KA 5C25B 4IH7A 4IH6A 4NYZA 4TYAA 3IRXB 1FKPB 5EDWA 4O44A 3KK1B 1ZTWA 3DYAB 1XR6A 3BQ2A 2FLPA 2JEFA 3CJ4A 3CJ5A 4MH8A 2ASJA 1LWEB 4K50A 4K4ZA 2FJXA 2GIQA 4ED7A 3N6NA 4I7FA 4KV8A 5CYQB 1R0AA 1NHUA 2ALZA 3GV7B 2DPIA 4FBTA 4ZPDA 1SH3A 4O4GA 2BR0A 4IDKA 2HNZB 1TP7A 2IM3A 4Q0BB 3BREA 3KMQA 5D3GB 3OLBA 2HMIB 1S6QA 1JLFB 3GV5B 4EYIB 2B6AB 3MEDA 1S1VA 2FVSA 3BGRB 2YNFB 3M8QA 3JYTA 1T3NA 2IM2A 5J1EB 1RTHA 2GC8A 4IFYA 4WFZA 4I2QB 5KFQA 3D28A 4Q45A 3TAMB 4EO6A 1QE1B 1FK9B 3V81B 3DLKA 4I2PA 5DLFA 1TQLA 5KFSA 3CVKA 2BQ3A 3DRPA 3DI6A 3DOLA 2YNFA 1LWEA 3JYTB 3GIMA 1RYRA 5C24B 1FKPA 3HVTA 3LANA 1TKZA 4H4OA 2FVCA 5F9LA 4K4VA 4WZMA 4URGA 1EP4B 3PJWA 4ZP9A 2FVQA 5HP1A 4ECZA 4U6PA 2IC3A 2GIRA 2DPJA 1S48A 3KK2B 2VG6B 3PW2A 4KAIA 5I42B 2WHOA 5K14A 3PJXA 2VG5A 4KFBA 2VA2A 1FKOB 2I1RA 5KT5A 4RNOA 1S1XB 4QW8A 3UQSA 4F4WA 5KFGA 2AGOA 3NGDA 1RT6B 4ZP8A 3OLAA 4ECXA 4XPEA 4I2PB 3UPFA 3KK3B 4IQXA 1N6QB 3FFIA 2R8HA 4LSNB 3DOKA 5KG1A 3KLGA 1TL1B 1C1BA 1SV5B 2IJFA 3CWJA 5EWFA 3KOAA 1S49A 4ZHRB 5KFKA 1BQNB 5L1LA 3PW5A 4WYWA 3IG1B 5KFBA 4KO0B 5D3GA 4Q0BA 5KFMA 2HNZA 1SUQA 4KHRA 4R0EA 4QWBA 4DG1A 3GV8B 1S9GA 1IKWB 1T05A 5KFEA 1HYSB 1D1UA 2AGQA 1IKXB 2FVPA 4TQSA 2VG7B 1DTQB 5DQIA 1RT5B 5EWEA 4ICLB 5DG7A 2HAIA 2R8GA 3I0SA 1T03B 2BE2A 5DGBA 1HNVB 2JEJA 2ZE2A 1N4LA 4NLQA 2AX0A 4NLXA 3Q8PB 1RT1A 3DLGB 4EO8A 3DRPB 4H54A 5F8LA 4F4ZA 5J2QB 3FRZA 5HBMB 4IG3B 3UDLA 4MIAA 1TL3B 2OPSA 1LW2B 1S1TB 3D5MA 3MF5A 2UVUA 2BQRA 2UVWA 1HNIA 3PW7A 1C0UA 2IC3B 1EETB 4FS2A 4ECUA 4QWEA 2AX1A 3NBPA 4KE5A 1DLOA 1HQUB 3C6UB 2RKIB 1LWCB 3LP0B 4RNNA 1T05B 4ECQA 4KB7A 1S9GB 4Y2AA 4H4MB 3MR2A 4WFXA 1D0EA 3RB4A 5C24A 3GILA 2WONA 4RW7A 1R0AB 3RBDA 4DL6A 5CYMB 1RT3B 2HWIA 2W9CA 3IS9B 3NMAA 2C22A 3DOKB 3M9NB 2O5DA 4YR2A 2V0NA 1RTJB 2RF2B 3H59A 4J9KA 4YMEA 4IRCA 2ILZA 1JLCB 3BGRA 3I5BA 3V4IB 1ZETA 2D7SA 4MK9A 5KFUA 1HQEB 4DL2A 1DTTB 4WYLA 4ECVA 2BE2B 2V4RA 2W7PA 2ASDA 5KFCA 1RT7B 4RNMA 3KLFA 2XI2A 3HKWA 4Y2CA 5C5JA 2ASLA 4PUOB 3LAKA 3M8PB 1RA7A 4YP3A 3CDEA 5J2QA 1IKWA 4IRKA 5KFPA 3JSMB 4Q43A 1S0MA 2BANA 4RW4B 3BQ0A 2E9ZA 1EP4A 3MECB 3Q8SB 1HNVA 3ISND 1DTTA
chains in the Genus database with same CATH superfamily
1RWKB 2I0XA 2N4CA 3LGHA 4EUVA 4C48A 4RPFA 2ZFHA 4B9UA 3LOUA 2D3ZA 1RQ0A 3ILJA 1M5HA 2B5JA 4ELUA 3DGPA 5L9NA 4R5PA 2J0WA 3GYNA 4ZPCA 4ETXA 2R7SA 2KU7A 4RL1A 1U1LA 1C0TA 3QGPA 4LREA 3QYYA 4ATNA 3CMQA 1TKTA 3K5NA 3CD6S 1PILA 1F9EB 1WI6A 2HS4A 2YNHB 1AB8A 5LOQA 5DZ7A 1KVIA 1QVGR 3ITHA 2FTRA 3KLHA 3DHXA 3MM8A 1YQHA 2AYBA 1B64A 1S1VB 2GZOA 2R9LA 4EYHB 1VQ9S 3QLHB 1FT8A 2W2PP 3K59A 1KOHA 3EE3A 3F41A 4H4MA 2EG2A 2VFVA 2E5HA 1S1WB 3A1YG 3GJSB 4PPZA 1R8AA 2XLJA 5GMKa 1TFWA 1QAIA 3GCWP 2DGWA 4R8UA 3TJ9A 2OH2A 1KLMB 3UCGA 1L3UA 3Q8VA 2HURA 3GIMA 1GNKA 5CZXA 2BXJA 3K5LA 1RA6A 1TL5A 1U2RA 3GMGA 3TZZA 3AT1B 2R8IA 3Q24A 3VAKA 2G0IA 4F7VA 5KT3A 4ZP7A 3DU6A 2EFGA 3D7SB 1RP5A 4NEZA 1DQ9A 1RE1B 1TUGB 3GFYA 2PIIA 3VAJA 4ED0A 2QL7B 4A8QA 4ZJOA 2RKIA 3C14A 4ED6A 1Q5YA 1S6UA 2IMOA 1KLMA 2VBZA 2XSFA 4YB5A 2VQEJ 1SKRA 3I0SB 5F8GA 4J9PA 4JP8A 2HNDA 3G86A 4MKAA 1CQNA 4B9LA 1Y9OA 2FLNA 2VOPA 5ETVA 3M2RB 2HZCA 3CDUA 3N5FA 1HBNB 5KFWA 3T1YF 4DV6F 2M8DB 2Y8WA 3F44A 3HM9A 1UVKA 5IWAF 3EYZA 1MMLA 4C8OA 3CCWA 5J2MB 1K1SA 1XTZA 1UJ4A 2LXFA 4O23A 4D3HA 5FLXU 2KG0A 3CXCR 1K73T 2ZD1B 2KHCA 1XMQF 1WORA 2E1AA 2ROGA 3P45B 1U24A 3ZTPA 2FY1A 2C42A 4NMLA 3ETMA 2BACA 2ZHBA 4X4NA 2GHWA 1H6KX 2G0JA 2EC2A 3KJVA 2LQ8A 1UCNA 4R5PB 2MQLA 3LO3A 3MMJA 2B9EA 3KHRA 3TANA 2D3UA 4M5IA 3WQPA 4QWAA 1S1WA 1L5UA 1KBRA 1AUDA 1F2HA 3MAHA 4NYPA 3C66A 3LP0A 1Q78A 3DC2A 3PYGA 2HRTA 1X9WA 4ZPBA 2LQJA 2YNHA 2WVBA 3NGKA 4XPCA 2F9JA 4O3OA 4ZVHA 3H5SA 5B09A 5DZ6A 2BKOA 2GVZB 2BRKA 3VV2B 3UCZP 4ZVGA 2DGTA 4CH0S 1VISA 3J7YU 1T9YA 2KM8C 3CW2C 2WZ1A 4DL0C 2J6UA 4ZLJA 2UXBJ 1YSJA 2ZBPA 4LFAJ 8RUCA 2V2VA 5T41A 4RBVA 5EUHA 3I4HX 4B08A 2BM0A 2HVDA 1VQ7S 1QY7A 3R5GA 2K7JA 3IR5B 5A2QU 4B3TF 2COLA 2MKYA 2AYEA 5IV4A 3MR6A 2DCUB 1Q1KA 3PEJA 4F4XA 2Y3YA 1SKSA 3J7YI 2KH9A 1M5OC 3ELHA 4RW6A 2GO9A 1D3WA 1OS5A 4ZKAA 1HD0A 4OIXA 3NLCA 3PX6A 2ZNYA 2ZOGA 4YFUA 3PW0A 2X1FA 1K0VA 5HATA 4GKKJ 2YNIA 3KJQB 4ZVSB 2W2NP 4ZVUB 4DQSA 4F2RA 2KB2A 2HSEB 1A9NB 4KT0C 4C3KA 1YJRA 2HFOA 5KFYA 2UUWA 2DHHA 1S99A 2G2YA 4DX8H 4USMA 1BGXT 1MWQA 2XEXA 1ZZNA 4B3SJ 3MTJA 1U6BA 3KLGB 2C2KB 4LSNA 3H42A 2R8KA 1XMBA 4ZK7M 3CCQS 3NRBA 4DR1J 2IDLA 4NZ7A 3RUBL 2VBYA 1WKLA 1VBKA 2XCPA 2VL1A 5J1EA 2Z2MA 4LSLB 1X4AA 3HVWA 1JLBB 2NR0A 4TY9A 3KK1A 2W4DA 2JLFA 2L9DA 5GAHU 5B0CA 3HXMA 2CQDA 1RK8A 3QQCD 3H40A 5I42A 3CJ0A 1TVRB 2HNYA 1HWLA 4B3OB 4LR7A 3BKFA 1L3KA 1UWBB 4DCOB 4R8UB 2Z8QA 5HJYA 2OI2A 3KLIA 4HHHA 2DGVA 2HWTA 1RAFB 1VRUA 1X5PA 2BW2A 2CFXA 2B4VA 4IOBA 1SJ4P 1UVMA 1KS2A 3FVYA 3T5KA 4I0WA 4Y28C 3M6XA 4IOAQ 5DS7A 5E3PA 2W8KA 3N5BA 4YHHF 1B3TA 3N28A 3P49B 1FRIA 2JC0A 2JDJA 4DV5J 2PSZA 1NSKL 3BSAA 1CJUA 2Z57B 1NEEA 1VQYA 4CI0B 3QRPA 4C0HA 4WFYA 1UEVA 2WOMB 2G2ZA 4J9RA 4LF5F 3W3SA 1A6LA 3UR3C 5IC4B 1U7LA 2N3OA 5A6PA 2RUSA 2NCKL 1NNDA 3CT9A 4QIVA 5L9XA 1I6JA 4K5RA 5CCMA 1H3DA 1PAEX 1S9EA 1RAJA 4QWDA 3IMQJ 1H2VZ 2FZCB 1WOPA 2XMKA 4HTIA 1R6VA 3IWXA 1FHTA 1WC3A 1RU2A 4XIUA 1F9HA 2MTLA 2CJBA 4HT7A 3IBCB 4DL5A 3I56S 3QJPA 3W61A 3W66A 1JKHB 1SPBP 5KOXA 2ZM6J 2RE1A 1SC1B 2D3O1 1WSVA 1WUUA 2OIHA 1XR5A 2G4BA 3HULA 2DNLA 1IN0A 2FZGB 1GX5A 1TMJA 3N4WA 3DLEB 1R0CB 3GE9A 3T1HJ 2DTJA 4IFVA 5F0WA 3PDNA 4OYBA 4TKTA 2IAJB 3U1NA 3MM7B 3ZZRA 1WG5A 1UW9A 2F7VA 1VR6A 3NAHA 4FKYA 4Y34A 2PMZD 3HP6A 5HLFA 3THTA 3ZC4A 4NXMF 5F41A 4MTPA 1Q8IA 4UQGA 1VQOS 1KSPA 4YEAA 3Q2SC 5E5NA 3GTYX 4RWXA 1RBAA 1ZOTA 4BWMA 1VC6A 3PYEA 1ROFA 2CZ4A 4ZVTB 2QGFB 1LWCA 3ADAC 2YH1A 1HQUA 5HROB 3OTDA 3OV7A 8AT1B 4YB7A 2C3YA 3SBMA 3Q0AA 2DNNA 5IQQA 2UXDJ 1J5EJ 3R6LB 1Q7YT 3V81A 2EWHA 3TAQA 4Q7AA 1J5OA 2Q1LA 5DJBA 3RBEA 2Y1JA 4DSIA 2WOMA 1WC0A 3FBEA 4PQUB 2ACMA 2MMYA 3C8YA 2GW8A 3E51A 2FJAB 3KK3A 3BR8A 3RBXA 1L3TA 3ZZPA 3QAUA 3D2WA 2MLYA 1JLFA 2JHEA 2NXNA 4NLWA 3G87A 2A3JA 4AD6A 3W5YA 4RNFA 1YITS 4PZVA 2E66A 2JEIA 2DO0A 2XSJB 2OPPB 4PWUA 5AJ3J 3M4XA 4ZDNA 4GO5X 1EAYC 2B7CB 3EVMA 3EZUA 3OR1B 4L75A 4YDDB 2XM3A 4PRFA 1QTNB 4DPYA 3G82B 3ZXWA 1GQEA 2E9TA 4X65J 1BD6A 2J9DA 2XCAA 1Q95G 3MAAA 5D4OA 4NXNJ 2UV8A 3GYGA 1LW0B 3H5YA 3HX9A 4ED1A 2OTJS 2ZH9A 2K3IA 2A6MA 3OFEA 1D8ZA 3R5DA 3WC0A 1NCLA 1NDPA 1F9FA 2WSEC 1NK6A 1VRTA 2IVMA 3RR7A 4A4JA 1VHFA 3MEEB 3OTBA 4WP8A 1WJ9A 5AXLA 2YVSA 4HVZA 3E3XA 3BKTA 2V69A 2PN6A 3H98A 4PXEA 2GAHC 4QWCA 2BE9B 2JFDA 2LCWA 3CCRS 3HHKA 2V63A 2IBKA 1BWEA 2YQ0A 3EDRB 5E41A 1IKVA 1IKYA 1HHTP 2QG9B 3HFKA 1G2EA 2FGOA 2V34A 2B6AA 4RWWA 2LEBA 1PCAA 2CNLB 5KFFA 1OO0B 3DKDA 3MGJA 3IXQA 4WIQA 3LGNA 2NLWA 4OYWA 2YNIB 1N88A 5IXUA 1RZMA 4V19J 2BRLA 3NNHA 2BUNA 4P9SA 1MNEA 4AXJA 2DNMA 3FJ2A 5DQGA 4JI7F 3R2CJ 1DQ8A 4G65A 4QYZK 4RW6B 2I6WA 5F9NA 3EVOA 4RUAA 1Q82T 4DV6J 5F0UA 1XK8A 3NS6A 2WAQD 3IAS9 2MPUA 2G13A 2MZSA 2V4JB 4OX6A 2F1FA 2VG5B 1NK9A 2I5JA 4IG0A 2QZ8A 1CULB 3KG0A 5AE1A 2NXJA 4NE9C 3UR0A 4E2FB 2AJQA 3Q23A 4KIAA 4CZCA 4P74A 4I6YA 4ZA1A 4CDIA 2E5LJ 4DR5F 4XO0A 1PYTA 3FQLA 3HHLB 5F8IA 1Q8LA 1Z4UA 4KBIA 2NYIA 4WU3A 4HLBA 2BDPA 2KVQE 1VLYA 3G8TA 3M9MB 4PG8A 1H0HB 2MZJA 1FF2A 1WF1A 1JIHA 2XS7A 3KG1A 3FC9A 3OJSA 2LXIA 3SFUA 4A47A 1VC5A 1Z2ZA 2XULA 2IBOA 1FK9A 2K7KA 2E1RA 4U67Q 1JLQA 3IAM9 4OX8A 1A0OB 4I7FB 3ETOA 3LPEA 4MKYA 1MWYA 2GJIA 3O6QA 5MAOA 4DL4A 1AROP 3I5CA 2VPYB 2W4CA 4ZPAA 2VIHA 2QV6A 3MR5A 3T6BA 5I3UB 1FJGJ 2DIUA 2LA6A 1NXIA 2BABA 4NA2A 2FJVA 2JRSA 2ASYA 2DR6A 3G82A 5B0FA 4TYBA 4J37A 4UQTA 3BB5A 4DPXA 4O3RA 2BJ7A 3ULHA 3BPDA 1VJQA 2FDNA 5L1IA 4TN2A 2Y8YA 3R8YA 2HNDB 1G1XA 4FYXB 4PR6A 1RT2A 4YS2A 1TFYA 1SJ1A 2AYMA 4ZIWA 2DT9A 1NZAA 2XBPA 4Y00A 2E5LF 4FYVB 2MQ8A 1T9WA 2G2OA 4G1PA 3D6HB 4TYAA 1M1KT 2ZBCA 4RKUC 4CRJA 3P8BB 2VODA 3FCHA 1BY9A 2GJFA 4XDCA 2N4DA 3MCOA 3N6NA 2FHJD 2QMWA 2RD5C 5CYQB 4NX9A 2ALZA 3GV7B 4FBTA 1FDNA 3BV8A 2BR0A 4IDKA 4JI5F 2HNZB 1I5OB 1GAOA 1TP7A 2IM3A 3FZ2A 4HACA 5D3GB 3HF5A 3OVAA 3QFWA 3SV4A 3SQGB 3QT5A 2XHWA 1RWUA 2NXEA 2FVSA 3BGRB 2YNFB 4USIA 4HEA9 2CZ9A 4LT6A 1GH8A 3SIPB 4IFYA 1TTHB 3EWGA 4MAKA 3D28A 2LU2A 1PSDA 3TAMB 3E8OA 1XJWB 1EKSA 1N5TA 4DR1F 4DQPA 1QE1B 1FK9B 1X60A 3V81B 2CJAA 1SIWB 4DF8A 3HVRA 2DNYA 1Q8KA 1VS3A 3CVKA 4NA1A 3IN5A 2JVOA 1R43A 3G6ES 3DRPA 1CVJA 3JYTB 1BE4A 3OT9A 4LFAF 4ANCA 1FKPA 1YTYA 4K4VA 3M8SA 4WZMA 4JI4J 1ZH5A 3MAAB 1EP4B 1IXKA 2H4YB 1R8BA 4ZP9A 2FVQA 5HP1A 1YZ6A 2MEWA 2XZWA 4B3TJ 4M5NA 2GIRA 4U6PA 2DPJA 3PW2A 3KK2B 2VG6B 3OUYA 4DSKA 1B4SA 1UFKA 4KAIA 4OZ3A 3PJXA 1K44A 2B8QA 2AZ3A 2R3VA 4UZBA 1FNXH 3M30B 3UD5A 5KT5A 1R3NA 3DLBA 4YHHJ 5LMNJ 1BWVA 5D4LA 1PAUB 1MMNA 5IM0A 1I1GA 1RAEB 3NGDA 1N54B 4DR4J 3Q86A 3W2VA 4DR7F 4XPEA 1FWLA 3UPFA 3KK3B 4WTYA 3X1LB 2M3DA 1N6QB 1OYDA 2F4VJ 4AQYF 2R8HA 1FFWB 4A8SA 5DM7Q 1PIEA 2D1CA 1Q0NA 1C1BA 4OJ1A 2ABYA 1EX8A 4P7VA 5JJBA 1L3VA 3NS7B 5KFKA 4ZHRB 3A8IA 3T6JA 2CPHA 4JI0J 4QU7A 1F2GA 3M6UA 4AT1B 3TX8A 2GQ2A 5D3GA 5D77A 3DGVA 4HACB 2YWWA 5K9FA 2AW0A 2VOOA 5DDQC 2I9SA 4LRBA 3GV8B 3PKMA 2KFYA 3MM9B 1HYSB 5ETLA 5C2CA 2IY5B 2RILA 2FVPA 3D1HA 5DQIA 4QOTA 2RUGA 4HI2A 4LFBF 4OZ0A 4DUZF 3ZO7A 7FDRA 4N41A 1VC0A 1AFJA 1SQFA 4W4MA 3DRPB 4H54A 2BZ2A 4OHVA 4PCQA 1RWVB 4F4ZA 5HBMB 1FDAA 3M6WA 1DBDA 4MIAA 4DV4J 2BBEA 1LW2B 2HHWA 2ZH1A 1WACA 1E6YA 1HNIA 2J0QD 3PW7A 1C0UA 2VQEF 1SXLA 2IC3B 1QAXA 5LL6d 4QWEA 3NBPA 1F5BA 4N56A 3C6UB 4RNNA 2PI5A 3NS5A 3WIVA 4KB7A 3EGZA 3MM5A 4Y2AA 2PMWA 4ES1A 1F3VA 4OYOA 4WFXA 5GVQA 1DAXA 3GU0A 3OPKA 3D54A 1K47A 2OKQA 2MKKA 2GGPB 3HHEA 2V8DA 3ISZA 2VV5A 3MR7A 4JI3J 2F9DA 2HBRB 3QWPA 5ETKA 5A6WA 4OHZA 5K8NA 1KD1T 4N7TA 1VBZA 2BV3A 3A4TA 4BHQA 1XIQA 3U7JA 4HHUA 5BXIA 3M2UA 3H59A 1QSYA 4J9KA 4Y2IA 3R5AA 1GXLA 1U6ZA 3I5BA 5HSPA 1WC6A 4UTGA 1UKUA 3DRXA 3MM8B 2D7SA 3FGVA 1DTTB 2CQGA 1M0SA 1IBCB 2VFTA 3IM9A 4WYLA 4C3LA 2DITA 2V4RA 4ECVA 1HI0P 3S1TA 4CM2A 3KLFA 4Y2CA 5C5JA 3VVUA 5J1PA 3ZTSA 4PUOB 2E7XA 2YWKA 1Y5IB 1T7PA 5DO2A 1S7HA 1X5SA 2B4UA 1J27A 4UW2A 2MLZA 3MMBB 4KYZA 3TJAA 1H2UX 1UVIA 4LJMA 2BANA 1T9UA 2IYGA 1ELOA 2XSJA 4OFZA 3BQ0A 2KYZA 3OXGA 1NK7A 3HO1A 3Q8SB 3VQTA 2JOQA 1HNVA 1U47A 1NO8A 4KHMA 4IH5A 3C16B 3O3LA 1VQLS 1JLAA 2KFNA 3T19A 1DQAA 5KT6A 4Z37A 1HARA 5GMDA 1RTJA 3MURP 2M52A 1NHVA 3L9ZA 3NY0A 3N6MA 1JLQB 3T9ZA 4O3SA 2L48A 5KFVA 4QR2A 2RRBA 5KFAA 1V6HA 4C6AA 4A8YA 4BCAA 3PZPA 4EU0A 2CPJA 4RBUA 1UPMB 2IRUA 3C6TA 1FKAF 1P6TA 2D9PA 2DHSA 2Z0GA 5GAGU 3EMTA 1Q16B 2KKHA 1SV5A 2C3PA 4RUBA 2E29A 2VU5A 2F8EX 5HJXA 1RTDA 3G71S 4JI7J 1KQKA 4LBPA 2ADCA 5HMZA 3BJYA 3D68A 3EX7B 3KJVB 1RTZA 2ZZTA 3VZIA 4E8UA 4A8FA 2OO4A 1UJ6A 2QL9B 2HGLA 2CNOB 1RWWB 1S1TA 3QPIA 4Y65A 3W8PA 1DURA 3W8GA 4AL6A 1WSRA 4LVNP 5D8HB 3KUEA 3J7A1 3CMAS 1KDNA 2EK1A 4B3RF 1FDBA 4KGXB 1HNWJ 1HBUA 3QT8A 1JB0C 4FKXA 2HYIB 5HQLA 1GTHA 5B7WA 5MLCV 4ECSA 3T5JA 3HVAA 2MQMA 2FJDB 3MXHP 2EFOA 2XNQA 1VJWA 4G1IA 4YY3F 2HNYB 4NLTA 2VJUA 3CJSA 4F0KA 2BEFA 1RT5A 4PKDB 4GO7X 2VF3A 3AH6A 2QFJA 5ITHA 2E44A 2XMMA 3MAQA 4CO5A 3J81Y 4FF1A 5ADZA 1U0HA 4QPXA 1NJZA 3UFCX 4ED4A 3IP0A 5KOWA 4JI2J 2JL9A 1QVFR 1J5OB 3TJ8A 2R2UA 1VOMA 3FQKA 3G6VA 3OTOF 2K3KA 1ZPVA 2V67A 2WRMA 3IS9A 3D0IE 3LTOA 3QGIA 4DR4F 1X5TA 1YJVA 2WCXA 1VRTB 2DISA 4M95A 2V68A 3B8HA 4HTJA 1MLAA 2KO1A 1BHNA 2LA4A 3MM9A 2YKNA 4N8NA 2OPQA 4QBUA 1GMWD 2YXLA 2HMIA 4CWBA 4DXLA 2DNRA 2W9AA 4LF8F 4C0BA 4KH0B 1UTAA 4DL3A 4QU6A 5SZTA 3DM2B 4F02A 2O1PA 5EN1A 1BQNA 3B82A 5HLFB 3FEZA 5AT1B 4J9LA 1SQGA 1WHYA 5LSOA 1VLOA 1REGX 2V4QA 3GQCA 1UZHA 2IRYA 2RDJA 1U1MA 4BS2A 2MSSA 2C1EB 3A8JA 3WX4A 1SB6A 2BVZA 3OHBA 1VBYA 3KHGA 2OPRA 3SMZA 3RU0A 4BWJA 3H4BA 3QO9B 3MOZA 3T41A 3ZNUA 1WDTA 5JMNA 1U4BA 2GNKA 1CJKA 1RT6A 2YX1A 1RLCL 3I0RB 2XC9A 1BXNA 2CVEA 2NZ4A 1LFWA 4USJC 2HHUA 2NXUA 3CO9A 3E01B 3EPGA 2L9WA 4WK1A 2XO7A 2HVIA 4FF3A 4ECYA 3GFXA 1FEHA 1IM6A 1UP1A 1FE4A 3R27A 2G0CA 4X4QA 1X8DA 2E5GA 4G1QA 2RS2A 2R8JA 3PEHA 1RTDB 1JLEB 1YDLA 3CJ8A 4J9QA 1N5QA 3I55S 1P1TA 1R8HA 1ZA1B 4IO1A 2OMLA 3RB6A 2HHXA 1RHKB 4GRSA 3GLJA 3TUZC 2O67A 2ERRA 4ZVRB 4JI6F 5KG4A 3MEKA 1IR0A 3KUGA 1EETA 1UEKA 2B3TB 3CJQA 1ZM2A 2C2NA 4KJIA 1IWGA 4DU8A 4QW9A 4F8RA 2XLKA 2HW3A 2PEBA 1ZM3A 4ECRA 1C0TB 2D69A 4DR2F 3GIJA 1CULA 1VMBA 2HK2A 2WVCA 4HI1A 1YK9A 1YVFA 4BC9A 1YHQS 3MD1A 1UA1A 2V5HG 1ZA2B 4NA3A 4KPCA 2ZE2B 5HMYA 3MZIA 2OSRA 2XWYA 2RU3A 4I6AA 4DUYJ 2QLFB 4M8LA 3NNAA 3ZZ0A 3SXLA 2J7UA 4CO3A 4NCGA 2AQ4A 2YKPA 4EGLA 4CH7A 1IKXA 1KHWA 2P5VA 2KT5A 5CYQA 3ILIA 1GX6A 1HHQA 2PDAA 2DKOB 2Z58B 1C4CA 5ETMA 4AFFA 2EFVA 4ANDA 3MWBA 1OY6A 3X3UA 2ZITA 2H48B 1M5PC 3POTB 1VBXA 4ED8A 3ICLA 2NXCA 2HRYA 2OSQA 4NLOA 4O44B 7FD1A 4DSJA 3TW0A 3B78A 1NBEB 1QAYA 3ZTOA 5DG8A 3I0RA 4NLUA 4L72B 4UOHA 1CJKB 2HBQB 4OI6A 1T3OA 3W2WA 4YR0A 1CS4A 3CCJS 3SDEA 1UZDA 5HN0A 3IGNA 1FWPA 2QLJB 4X64F 4DPUA 4X4SA 1YBUA 2XYHB 3GSDA 1N5YA 1FD2A 4AXIA 1I3OB 2VFUA 4DEZA 4NZ0A 1HWKA 3W64A 4JI8J 1DFDA 1HW8A 4CYUA 2Y0SD 1FDDA 4DG1B 3CD0A 1SJRA 1LW0A 2ZVSA 2PFDA 3DRSB 1W26A 3JS9A 4DR2J 1TKTB 3I32A 1FFSB 3QZ7A 2MB0B 4JV2A 4OMFG 2V8VA 1UWBA 1N5YB 5EHHA 1JLAB 1O0PA 3EGWB 1Y4ZB 3IR6B 2MGZA 1S79A 1P27B 1JLGB 1CS4B 4ZN3A 1GMWA 1KHVA 2FZKB 4PWWA 3OSPA 3DI6B 4LIRA 1E6VB 4ZP6A 4ED3A 4OJHA 4PUOA 4X4OA 4X65F 3VALA 5HMWA 2XQCA 1FNMA 3T5HA 1YIJS 1NPRA 2K1RB 4AQYJ 3M8QB 2A1BA 3Q22A 3MCNA 1D8YA 4X64J 4KKOA 1ZM9A 3MMAB 4I69A 5LJ5Y 3RTVA 3G8QA 1RTIA 3OVBA 1S6QB 4EBCA 3KNAA 1IUJA 2KL8A 1CJVA 1HPZA 1V5VA 1HMVA 3BKUA 2MZ1A 1PC4A 3PM9A 4ITSA 3C6TB 4JI8F 3KLVA 1R6YA 2CJ9A 3JSBA 1YI2S 4X4PA 1YBTA 4RUHA 1IQTA 2FB0A 2YWGA 3DDKA 2L9NA 2LXUA 3UW1A 4C4WA 3HHDA 2JFKA 2ZD1A 3LA0A 3GJTB 3PFOA 2AEJA 4KRWA 4NLPA 4ZVEA 5K8OA 3MR3A 4YB6A 4B3RJ 1S6PB 5F8MA 2D9OA 2R42A 4Y0FA 1UMJA 2QTWA 3AA9A 1RT1B 4RNHA 3W5XA 3PIPQ 5CXTA 3CDAA 3QO9A 1LNQA 3KFWX 2J0SD 1U1PA 4M5MA 4OX7A 3VGTA 2FVRA 4NL5A 4KPYA 3M30A 1CLFA 5D6GA 1RAHB 4USTA 5F8HA 3HHLD 3GYXB 5IZHA 1PO6A 2QL5B 2IVFB 2C3UA 2FIUA 4ID5B 3KLFB 2B9XA 1JXVA 2POKA 3C16A 4FZVA 3LALA 1HA1A 1HWIA 4PG5A 5GAEI 4DSLA 3OL8A 4L6V3 1OQ3A 1GTEA 1PJ6A 2CQ3A 4FYWB 3FEXB 4LIWA 1LQ9A 3GIKA 4QQBA 2YPZA 4IR1A 1F60B 2FLLA 1HLWA 2BANB 4C11B 1ZZFA 3FCVA 4OYZA 2OPRB 2ROEA 4V1Ak 2RSQA 3SFGA 5KG0A 1O51A 3IRWP 4L73A 4PEOA 1AYEA 5KFHA 2W8LA 2ZHAA 1KTVA 3QLHA 2K8GA 4I64A 4X84A 1LWXA 4K4SA 4W98A 3K5PA 1N8RT 5KFJA 3HDSA 4KO0A 3VZHA 3J81U 2CNKB 2IMWP 4IQMA 4LF6F 2E7WA 2O3DA 2AJ1A 4O3NA 1B99A 3G6YA 1IR1A 1TL7A 2ZEJA 2L08A 2N7YA 2C28A 1CJVB 1MSWD 3HZEA 2QN6B 1FJEB 3H2UB 3AQOA 4DV2J 4JUZA 2BKNA 3BO2A 4J9SA 1N6QA 1SI9A 5KT2A 3BDEA 2XB2D 1WI8A 3PRDA 2JLEA 3RB3A 4G6VB 4C8ZA 4X4TA 1HBUB 4USVA 3Q2TC 2BW7A 2WONB 2CQCA 3HI9A 1N0UA 2OEJA 3BN4A 3MECA 2YQ3A 2YWHA 3IBFB 3UDVA 1UA0A 1DY3A 2MJNA 1X5OA 3LW5C 1VCTA 3POTA 2Z2YB 1GMUA 1L3SA 1MW7A 3U1MA 2CDQA 5G4DA 1R8CA 1U09A 3DLLQ 2CA9A 2H54B 2H3EB 1N48A 3IM8A 3MTKA 3AXMA 2CPDA 4C98A 5DQHA 1FRJA 2HVZA 1WHXA 3NCRA 2ZH7A 3RW6A 3QBCA 3GIIA 4WFAQ 3OJUA 1DHMA 2M2BA 2J76E 1HIYA 3C15B 1XEZA 3MEDB 3UCUP 1OQ6A 4CLFA 3CSKA 1ZTTA 5IV3A 3DNCA 2YTCA 4X66F 2B51A 4Q2LA 3HD2A 3NAIA 4WKRA 1RT3A 3KHHA 3RAQA 4KV8B 4LF7J 2VH7A 2RH3A 4CO1A 2VICA 2YPYA 1CG2A 1OPIA 1PC5A 2XGPA 3CC2S 4Q2MA 2QMXA 3H7HB 1RT4B 3CULA 3D3BJ 5D0EA 2ALYB 3SQGA 1RTIB 3OL6A 2GA7A 2MKJA 3DRRB 1R27B 3NCQA 5AXKA 5U47A 3TQ1A 3CO0P 1R7IA 1SH0A 5L38A 3BH7B 2XYPB 1S4EA 3EICA 1G7CB 4DL7A 2PFFB 4JV0A 1VQ4S 2W7OA 3AA8A 3TI0A 4HDGA 5GMEA 1E6VA 2P2CB 1RBLA 4C0OC 2O66A 5KG6A 4O3PA 4A8MP 2EW9A 1D9DA 3MUMP 1KOOA 2GV1A 1S4FA 1GMVA 1RXOB 5FLXY 4JV5J 4IH6A 1RAAB 4Y2KA 2AJ0A 3IRXB 1FKPB 2WVFA 2X51A 4YN3B 2CPYA 2ZH8A 1KQGB 4OYIA 3HFVA 2MXYA 3K89A 2UUBJ 4MH8A 4K2XA 1T95A 1YRXA 3WHIA 1U1KA 1Y5NB 4K4ZA 3CE8A 2CPIA 2GIQA 4TU8A 4ED7A 1HQ2A 3KXDA 1W2BR 1Y7PA 3U1LA 1TELA 3A8KA 4DV5F 2RHQB 4Q8EA 2DPIA 2NZCA 1WWHA 2AJFE 4ZPDA 1URNA 2J9EA 2DD8S 4FVMA 4U8YA 1QJHA 3TRGA 3GV5B 4EYIB 3MM5B 2B6AB 4B3SF 3MEDA 2YKOA 4DV1J 5E3AA 3C15A 1WC5A 3CB4A 3JYTA 2DY9A 4JYAF 1Y5LB 4OYMA 2IM2A 3Q8UA 5J1EB 4DMZA 1FERA 5KFQA 3UD3P 2CWXA 1E6YB 2P9GA 2LU1A 3GB0A 2QSWA 3TUJC 3DLKA 3D1OA 2OUGA 2HQGA 1TQLA 3C14B 2VKZG 3OFFA 5KFSA 4TU9A 5LMUF 2YNFA 1LWEA 4I56A 5A2QY 4WJBA 1RYRA 1TAUA 5D0RA 1ZAXA 1LK7A 5LT5A 1CPZA 2VASA 4H4OA 1TKZA 1M1GA 1FX2A 1WOOA 4HR2A 5T7LA 3R97A 4EFAC 1LKZA 1H38A 2A10A 4ECZA 1YGYA 3RW7A 2XLIA 2LECA 4ZLPA 2DK2A 3MMCB 4TNOA 4XAKA 4F25A 3LGMA 2DNKA 3F0NA 2PA3A 2WHOA 2FY8A 1G6BA 2VG5A 3IBWA 4DSEA 1U1QA 1KFSA 2XNRA 2CVIA 4DR5J 1FKOB 2CXEA 4RNOA 1VIOA 4OI2A 4P71A 2DGQA 1NUEA 2HPUA 3TQEA 1RAGB 2BJ1A 1S12A 3K7RA 4F4WA 3AY0A 5KFGA 1KN6A 4F4KA 4ZP8A 3OLAA 4ECXA 2XS5A 4IQXA 1RWNB 1CEZA 2VUGA 3V2UC 4ELTA 3HSZA 3KDOA 3PRVA 4MYUA 4A8OA 3HT0A 5KG1A 3KG4A 5H9EJ 5LJ3Y 2RS8A 1SV5B 2IJFA 2MZTA 3CWJA 4Y6IA 2VDHA 2JZ5A 3CCVS 1H72C 1S49A 3EXCX 4B9VA 2UUAJ 2Q6CA 2OD6A 2KHDA 1F0XA 2W2QP 5KFBA 4M5DA 3ZNJ1 4Q0BA 5KFMA 2J9CA 2KXNB 1KQFB 1U0HB 3KTQA 2HK3A 1VQ8S 1LXJA 4X62J 1KR4A 3D6TB 1S9GA 2MY7A 4FDFA 1R0BG 2AJ4A 1YWXA 3VHQA 2ZM6F 2C2OB 3MI7X 4WU2A 3VAIA 1UVLA 1IBMF 1NK5A 3JTPA 4DV7J 2OHDA 3HLUA 2DYAA 2HAIA 3C2PA 1QLNA 1T03B 1JNRB 1X9MA 2BE2A 2YX4A 2ZUAA 2WBMA 3GR1A 3MPDA 4FVCA 3MM7A 2AIRB 1RSCA 1N4LA 4OZJA 1NK4A 2JEJA 4NLXA 4R25A 1FRLA 3CD7A 2OTLS 3ILLA 5F8LA 1MG7A 4ZOSA 1SC4B 1YX2A 5E7OB 5B0DA 2CZVC 3UDLA 6FD1A 2OPSA 2XMAA 2A2CA 3D5MA 3MF5A 2DR5A 2UVUA 2BQRA 2UVWA 1JJCB 3CD5A 3TOQA 1XNRJ 4NPOA 4ZVPB 4EK2A 4ECUA 1EQ0A 2AX1A 3BDPA 1U49A 2HS3A 3RYLA 2RKIB 1T05B 1RUSA 1S9GB 3T1YJ 4DCPB 4DS5A 3AODA 4KTQA 2J9DE 1B7FA 2Z56B 1WKKA 2WONA 4A48A 3QT7A 4RW7A 3FSXA 2LVWA 4CT9A 4WF9Q 3OVSA 4DL6A 2HHPA 4FPRA 2W9CA 3IS9B 3JTOA 2CRLA 2C22A 1T9VA 5LXRA 1M1HA 2V0NA 4IRCA 3VGUA 3CEDA 1N33J 3W9JA 2RMLA 3FMWA 1RB0A 1IBMJ 3GIRA 4K2JA 2QYCA 2CDRB 4MK9A 1HQEB 4DV2F 2CQ0A 1B0VA 3L09A 2KJVA 4PXBA 3I9ZA 2W7PA 2F63A 1RT7B 2ASDA 4QIEA 3AD7C 4NASA 1YJWS 5H9FK 4P2FA 1KP6A 3M8PB 4NWBA 3KWMA 1HL6A 2E5JA 3LF0A 3SSQA 3CDEA 3HT3A 1VQMS 4EZ6A 4LRCA 4LRFA 4IRKA 4QCLA 1B0PA 4GKJF 3FUYA 4PYDA 2DHXA 1X7VA 1T9XA 4P2MA 1CBKA 5M2UA 1ICEB 2BA9A 2HBZB 5CH7B 2HHHF 4JI5J 2DR7A 3PHEA 2DR9A 4B9NA 2QA4S 3BYRA 4ID5A 4ANEA 5K8PA 3WX8A 3CIMA 1HYSA 4J9VA 4TLQA 2CPXA 4LQ3A 2JC1A 1SVDA 2ZH6A 1HWJA 1FE0A 3OQ2A 5KT7A 3NGUA 3O44A 3VAFA 1LOUA 2HVHA 3CCLS 2ZWPA 4PYAA 3HJFA 2QJ3A 3IWLA 1BQXA 5HROA 3V4IA 4OZLA 3AHPA 1J5EF 1KFDA 4LF9J 4RW9A 4NZ6A 1C1BB 2MY8A 4FXVA 2PGCA 3Q8RB 5KG5A 4AE5A 2VG6A 5EGYA 2IA6A 1QTMA 2EVZA 2ZBIA 5ETQA 1REVB 4ALZA 2EK6A 1C0UB 4F2SA 4FYDA 2KM8B 2I5JB 4IG0B 3V6DB 3TO8A 4CO4A 1R8PA 4P6QA 4CP5A 4DHVA 8ATCB 3QGHA 4ZLNA 3I87A 3LAMA 2DR8A 1UETA 3L7UA 3CJTA 2D41A 3MHYA 3BO3A 2VA3A 2OGUA 1SJFA 5C2GA 1UFLA 2B56A 1VQ6S 2UXCJ 4YR3A 3RJMB 4K4WA 1EHWA 4DDFA 5BR8F 2ZZNA 2C2ZB 1T03A 3QGGA 1RT7A 5F3ZA 3PV8A 1MU2A 5KFDA 1TKZB 3PW4A 2AU0A 1JXLA 1C1CB 1SL1A 4IG3A 2A6OA 3D66A 4PWDB 1X4GA 4O3QA 3DLGA 3PFEA 4ZCMA 3UVJB 2EXUA 3TUIC 2AJ2A 2KT3A 4NXMJ 2R2RA 1QE1A 2YNGB 1V3RA 1Y00A 1BQMA 3ENQA 4OI4A 3LWMA 4Z7YA 1NH7A 3UO0A 4A46A 1IBKF 4Y2MA 1TAQA 3RAXA 3ZTQA 4Y3CA 4OL8A 2HG4A 2V6AA 3GWCA 3M05A 2HRUA 3CTRA 3UD4P 3SI8A 1RADB 4DR6F 4DSFA 3AOCA 2WTFA 2CWKA 5EX3A 4ER8A 1X4FA 4M5GA 3LP1A 2H5EA 4RX6A 4RBTA 2D3OR 4H4KC 1X4CA 2HS0A 3FNNA 4X2BA 2DEJA 4DU7A 1S0NA 3G4SS 1F5AA 2ATCB 5CYJA 2DRAA 4J9NA 4TQRA 2C3MA 1V9OA 3FZBA 4YUDA 3BM7A 4EMDA 4RW8B 1G4CA 3QATA 4X62F 4B3MJ 4LMZA 2YKMB 2R7XA 1V3SA 1NDLA 3DMJB 2QO3A 1UJ5A 2LEPA 2XTJP 3TWZA 3FFIB 5HL7Q 2ZJQQ 4I6WA 3IRXA 1NDCA 2ILYA 1WF0A 4UUXA 4C11A 3EGVA 4KHPF 5JUMA 1Q8BA 2DGUA 2XMTA 5KT4A 2A0FB 3N79A 1HI8A 1S7IA 2O01C 3OTEA 1NJIT 3L3CA 1QSLA 4OZ2A 3C3LA 3M7VA 2R4FA 1RDRA 4F67A 3QIPA 3JSMA 4L76A 4KGKA 4X66J 4AYBD 2GMLA 4LF2A 1YBAA 2VJVA 2KT2A 1RKJA 4DFPA 4DV4F 4WBFA 1RGVA 3THVA 1TVRA 3LP2B 2R2SA 4NCGB 2CUYA 2G9OA 3AB4B 2OFGX 1XMOJ 4AUKA 3GG1A 1QUVA 2H4WB 2HZVA 1T11A 3OFHA 2CKWA 2BX6A 2GMHA 4MIWA 5H9EK 3W65A 1S6PA 2VFRA 3M8ZA 3QWUA 4U7CA 3FEYB 3CCTA 3TEHB 4OZ5A 4MIBA 2Q43A 5AE3A 2RAQA 5HANA 1FVSA 3A12A 4F4AA 3MEGB 4RZRA 2R7QA 3RG6A 4OHWA 3K0JA 2HKEA 5L1JA 4V19X 4NCBA 4N76A 5HQMA 4LR9A 1NH8A 3BGFA 3KDNA 1OMSA 5FDLB 1HMVB 1QUPA 5LSLA 4DUZJ 1YG0A 1YRTA 3R5CA 2V9KA 4EBDA 1VQ5S 4CLSA 1HKAA 2DRBA 3NL0A 1ZYQA 1N33F 1G3OA 4DFMA 2BQUA 4G1QB 4DX6A 3T3FA 3E2EA 4Z7CA 2QE5A 3NEKA 1HR0F 4L74A 1O8BA 2P9EA 2UXBF 4B17A 1WF2A 1HW9A 1NMEB 3BBCA 3OTCA 1GEHA 5I3PA 3TARA 1U48A 4WIIA 3PJ9A 2M5YA 3MFHA 1QM9A 3K2YA 4MKBA 4JOUA 4KGMA 3AQPA 5A8KB 3PO4A 2B4PA 2Y1IA 2M88A 4FPIA 3OSNA 2V8HA 3FK4A 3TZYA 4OJGA 2FD2A 1RT4A 3D4JA 3HSJA 4I4BA 4XTTA 3PXGa 4ZJQA 1AA1B 3AB2B 4TVAB 4G3IA 1HWUA 2VHGA 3QRRA 1GXTA 3CIZA 4HH1A 1YJUA 3Q83A 3SV3A 1WHVA 4JI1F 3A13A 1OY8A 3M32A 1H74A 1UFWA 2KRBA 3NOCA 4DX5A 5A0YB 1EQMA 1DJ0A 1XQIA 3VAHA 3PCOB 3RRHA 1NU4A 3RGIA 4WCEQ 1F3FA 2XS2A 3H5XA 4WE1A 1H2TZ 3EDQB 1O5JA 3UN5A 3US5A 4WXOA 2YKNB 3V4MA 3OR1A 3R5JB 3MMCA 2ZVIA 2GS8A 1NSQA 3TVZA 2M70A 3VAGA 4DV7F 2KZZA 2M7SA 1Y11A 5DM6Q 3NKYA 1Z1ZA 1P9QC 2PT0A 5GAHI 3IA0A 2CPEA 3ZFVA 3SDEB 5LSRA 3H4DA 1W25A 3TYTA 2ZZMA 3BQ1A 2JEGA 4ECWA 1RWPB 5K20B 2HFZA 1JQGA 4PAAA 1TR0A 1QAJA 2LEAA 5T14A 5LM7E 5GAGI 2M9KA 2W24A 5J2PB 1WC1A 2BJDA 1NKBA 1AT1B 3I5AA 1NLKL 1X9SA 4GKJJ 3BN7A 3K5OA 1FCAA 1U2FA 5BR8J 3NGTA 4NLSA 3VGSA 4NLDA 2W9BB 2RVJA 2ZWOA 3QSIA 9ATCB 2WB1D 3IFEA 4L3NA 2EC0A 4NRTA 2KDOA 2AP6A 2CNNB 5E3RA 1DZ5A 5HMXA 1U02A 3EPIA 1S57A 2DNHA 4WXWA 4B9TA 3DOLB 1FEEA 2H65B 4LSLA 2LFVA 4BC7A 3WC2A 1H73A 1SKUB 1WD6A 2WVDA 4JI0F 4IO9Q 3CC7S 4NLVA 1VIXA 1WEXA 5M2RA 1J2VA 5KFIA 4NCAA 3KJNB 3SZ2A 3OFGA 4WZQA 2MSTA 3IR7B 2RB7A 5ETOA 5LMUJ 2N3LA 2PEHA 4EEYA 1FRXA 2AWZA 1NZ8A 1HPZB 4IFVB 3I31A 4RO0A 3UVJA 4NOHA 1VQPS 2Q6BA 1S0OA 3AJ1A 4OI3A 3SQOP 5C25A 2HLUA 4AL7A 3MPVA 3OXLA 4ILRA 4FN5A 4J9MA 1C1CA 3CNQP 4DX7A 1CC7A 1D09B 2K1RA 1ZBTA 3NGSA 3HSDA 2W1BA 4RJVA 5AXMA 2HHSA 5GAEU 1HBMB 1RI7A 2BOPA 2AEFA 2VBWA 4F3MA 1TL3A 2QRRA 4URSA 3PIOQ 3BPSP 3EVWA 4ZIVA 1S1UB 2J7KA 2YH0A 3R1LA 2YWEA 3D6FB 4RLEA 2SXLA 3HHLC 1LEOA 1LWFB 4D3GA 3MDFA 2ZJRQ 1OJ4A 2C2MB 5G0RB 2I2YA 3FBBA 2MGZB 3HHNB 2CQPA 1B0TA 1XNQJ 2HQDA 4ZHRA 3NMRA 3IO1A 2WK4A 4C8MA 1RAIB 1DTQA 5L1KA 4RW4A 1IBLJ 2ACYA 2KJWA 3H2VE 3PNIA 1MWZA 1Q53A 3ISNC 2GMJA 4CNZA 1KEKA 1Q7LB 3EZOA 2R7OA 2FJWA 4MT1A 5LMNF 2XMWA 2DRDA 2RDDA 3JSRA 2LDIA 4OJ3A 2J6SA 2XO6A 5J2MA 4LF9F 3WBZA 3V5RA 4UOGA 3MFIA 2ZUGA 4ED2A 3V6JA 4MK7A 3PVXA 2VC0A 2MKSA 5KG7A 3FCWA 4B3MF 3GCXP 3DU5A 2RNEA 3CJ2A 1FJCA 5K8MA 4DQIA 4DUYF 1DLOB 5IFMA 1HNXJ 4MYTA 4QR0A 5FJ4A 3ET6A 2B43A 1T02A 4DFJA 2XMJA 5CYMA 4OX9F 5KFLA 1UEUA 4Q8FA 2JSXA 3UDCA 2HWHA 1S1XA 1HNWF 1OSCA 3G6XA 1JLBA 3DYAA 4KFBB 3CJKA 1VRUB 2Y1LB 2VQFJ 3O2IA 3IWNC 4F0HA 1V3ZA 2W9BA 3CPWR 2X3GA 2WVEA 3GSIA 1PYSB 1A7GE 1JLGA 3A3OB 1KQSR 3M9OB 2GFFA 3NCPA 4N8OA 2AD9A 1H7XA 2BKPA 3D3CJ 4LSZB 1JKHA 4UY8T 4DR3J 1IBLF 1H98A 4LFCJ 2MKIA 1BLUA 2HFSA 3SCJE 4ELVA 3FSIA 4O0NA 5CHCB 4CLTA 2BE7D 1S97A 1AZSB 2X3DA 3PYDA 3Q8YA 4FF4A 1N32F 1SUQB 1T9TA 5DLGA 5E33A 4HL9A 4IDKB 1GK8A 2HFNA 4WK3A 3UWTA 5BYRA 4HYKA 4DQQA 3L4BC 2R7WA 1U26A 2NSCA 5GADI 4FS1A 4ICLA 2DCLA 2XY6A 2AMCB 3JTNA 2J6TA 1U1OA 4LFCF 1JJHA 5KG3A 4K4TA 2Q79A 4HDHA 4J90A 1ZS6A 1JJ4A 1Y10A 2Q3PA 2V2QA 3AOAA 4MFBB 3GONA 1D9FA 1BQMB 4I67A 1TMMA 1CJUB 2V9WA 2H1YA 1TKXB 2OMOA 4O4RA 2EEYA 4KKOB 2B9WA 2W4PA 3MMAA 2MDAA 4LBIA 5DRKA 4W92B 1ITPA 2DHGA 4O4GB 2OELA 3T5LA 2HHTA 2LDYA 3AJDA 3RAMA 2C2DA 4X4VA 5EX0A 1RHRB 3L7PA 4EBEA 5KG2A 2XMUA 2V94A 1RLDA 2DXDA 1MU2B 4B9SA 1YJ7A 2IAJA 2HEKA 1N52B 1U8SA 2AZ1A 3E01A 2Y1RI 4KR0B 2E1CA 4OYPA 1KLNA 2UU9F 3H8YA 4DPOA 2C3OA 3FDSA 1FTCA 3UNGC 3W2VB 2RQ4A 4ZJLA 2NPIA 5C25B 1RJJA 4IH7A 4NYZA 4ZPWR 3CCSS 1TUVA 2X1GA 3D67A 3GFZA 5EDWA 5M2PA 2ZBRA 3DYAB 1XR6A 2KN4A 2FLPA 2IYIA 1EZZB 2ZBQA 3CJ4A 2ASJA 2HFUA 1CJTA 4GVLA 4DJBA 1X0PA 1PJ7A 1RCOB 4KV8A 1YJTA 3KKFA 3CGIA 1R0AA 2BJ8A 2H51B 2MQNA 4ZCKA 1WHWA 9RUBA 5JVHQ 3B6BA 3B4DA 2A18A 2QLWA 3BREA 2V8PA 2GQCA 1K8AT 2DH9A 4WP3A 1UVJA 2L3MA 4DR6J 4DCJB 3PX4A 3OLBA 4M1KA 2EKYA 2HMIB 3K8VA 2KXFA 2J8SA 2R7VA 1RISA 3ZZYA 2GVDB 3M8QA 4I68A 2Z4PA 4GMKA 1T3NA 4N47A 4W90B 4Q45A 3J7AN 2GC8A 1FXRA 2P6SA 2B0GA 4JI1J 3EJMA 1C4AA 5CD4H 2ROPA 4EO6A 4P52A 3F56A 1WG4A 3W5ZA 4I2PA 3S7RA 5DLFA 1OYEA 2YBVA 2V8GA 2BQ3A 2Y9HA 4MMOA 3DI6A 1XBWA 3DOLA 4GVBA 4OYAA 1CJTB 2MLXA 3J7ZT 1EIYB 3LANA 1YJNS 5F9LA 4M5HA 2DVIA 2EKNA 2MHNA 4URGA 2F3JA 1OY9A 1QD1A 2J7WA 1WEYA 3GZ7A 1EB0A 1FWKA 2MKCA 3PJWA 5ETRA 5B0AA 5L8RC 1FD8A 2IC3A 2UUCF 4M5JA 1S48A 5JVGQ 2QLBB 4USWA 5IWAJ 1MN9A 4FNIA 4CLPA 4KFBA 3DCAA 2I1RA 3P6YC 1S1XB 2YQ1A 2F40A 5CABA 3MPWA 4QW8A 1RWMB 1YZ7A 3UQSA 3I96A 2OLWA 4FNHA 4X4RA 2ZDPA 3GPAA 2JX2A 5I3QA 4I2PB 5AE2A 3RR8A 2VFSA 3VTIA 3AOBA 3NOGA 4LSNB 4J9UE 1XNQF 3TNVA 4QPTA 4C7QA 1TL1B 3HD1A 1U6FA 2NQPA 4JBCA 5EWFA 2GIFA 2W2MP 1FJGF 3PW5A 2UXDF 1FXLA 4DN9A 3IG1B 4C2MA 1RHMB 4U95A 2ZJPQ 4R0JA 4J91A 1N36J 4CLUA 3FKBA 1SUQA 2KYXA 4WP9A 4R0EA 4DG1A 2JWNA 3WDOA 1IKWB 1T05A 1FTRA 1GT8A 5KFEA 3JB9k 1M5KC 1D1UA 2CG8A 2AGQA 2IPOB 1NB2A 1IKXB 4TQSA 2ZOMA 1DTQB 1WTBA 1RT5B 5DG7A 4PPDA 3JQKA 4ES3A 4UZCA 3I82A 3CUNA 1HNVB 5AJ3F 3EZ5A 2NYHA 2ZE2A 4NLQA 5KAKA 1M90T 4FF2A 4P7TA 1HD1A 3Q8PB 3S01A 4WPAA 1RT1A 1VDHA 5A8KA 1CQMA 4GVBB 1U1RA 4EO8A 4NXNF 2XMVA 4QIGA 4OI1A 3TZXA 3FBFA 5AXNA 4IG3B 4H4KA 1N5VA 2VB6A 1TL3B 4KGVB 1S1TB 5ETPA 1Y3JA 5DETA 3P3DA 2E5IA 2EBGA 2GVZA 2DH7A 1SJQA 1VK8A 4CM0A 2KFZA 5C7PA 3RBZA 1EETB 4FS2A 1VGYA 2JJ4D 1DLOA 4CQ1A 4PABA 1UL3A 1LWCB 3LP0B 1IWAA 3J80Y 5LXYA 2XY5A 4H4MB 1PYOB 3MR2A 1Z2LA 5CZVA 5C24A 2WW8A 3ZZZA 3VWSA 1XERA 2U2FA 2IJRA 4F0MA 4LF6J 3NNCA 1R0AB 3RBDA 3NG8A 3OTOJ 3PY8A 2I8EA 5HAOA 1IBKJ 1UAWA 4YOEA 2HIYA 3M9NB 3M1VA 5IT9U 3J81j 1RTJB 2RF2B 3TZWA 3MOJB 1NKEA 4CO0A 2ILZA 1JLCB 3BGRA 3J80U 3LWLA 3V4IB 5IQ6A 1IJEB 4FP9A 2M4MA 3TA2A 2HIQA 3L7OA 5KFCA 4RNMA 3HKWA 2F4FA 2XI2A 3U02A 2ASLA 4KQZA 2I38A 3LAKA 2G1HA 2OD4A 2U1AA 4OYXA 3R7SB 4YP3A 5KFPA 3JSMB 3HFZB 4F26A 5E3CA 4UOFA 4Q43A 2VC1A 1S0MA 5IT9Y 1S5ZA 3MECB 2DH8A 3QFHA 1RHJB 4PG6A 3ISND 1Q4RA 1DTTA 3IGVA 4K4YA 4IR9A 2ATLA 4MFBA 4DPTA 3QZ8A 2LQ9A 3V6HA 2E9RX 1HHSA 2HZAA 5F3TA 3MUVP 3D9BA 4BBYA 1NAQA 2FHMA 2QMUB 3O5TB 4N77A 2XHCA 3NXZA 2YKMA 5ETNA 3Q8QB 2FGCA 1HBOA 5A8RA 2MJUA 3CCZA 4ZCLA 3TAMA 1RABB 2K2PA 1FRHA 2OEMA 1SBRA 4U8VA 3W2WB 4CLZA 1AZSA 3DM2A 2ZH4A 2QSFA 1NJXA 4OV6A 4TY8A 2CJYB 2CJQA 1WOSA 3BR9A 3SSSA 4GC7A 3ENVA 2QYGA 4UOCA 2RF2A 3U27A 2RRAA 5BYQA 3KLIB 4U9RA 1PGZA 3KYLA 1EKRA 1JMTA 2ZNZA 2BYCA 2CIMA 2Z2LA 4J5OA 3DOMA 2PD1A 3N6LA 7AT1B 3T1HF 1RBOB 1Q79A 4I1TA 1LW2A 4DPWA 5J2PA 1LWFA 3W63A 3S8SA 4WFNQ 2Y0BB 3WZ0A 3VAMA 3PR5B 2JH3A 4LUBA 4PWDA 2EFPA 3BSCA 3I9V9 3MMBA 4P2XA 4UT4A 5KFNA 3CCES 3TAPA 1DRZA 4K8RA 2GAGC 3GR0A 3L95X 2GJ2A 5HVGA 2WSCC 4RU9A 4DLGA 5HP1B 2QC3A 1V5IB 3MPUB 4OZNA 3S6EA 3NP5A 1WELA 2VPXB 5F8NA 3N9UC 3C19A 5B0BA 5KFXA 1UPPA 5CQGA 1X4DA 5A8WA 4JV1A 4ZN1A 4C8KA 4F3QA 4JB8B 4IUFA 1MROA 4WWSA 2UVRA 1IVZA 4WE1B 1R89A 2IM0A 4IKAA 3MUTP 4KH1B 3HZGA 5K5MA 3BSOA 3LP1B 3V6DA 3DN9A 2VDIA 3N0VA 4P2SA 1B7YB 4IFYB 2AEMA 3LUYA 3ZZUA 3EM1A 1REVA 4ZLLA 4JYAJ 2EPIA 5H1SV 1JJ2R 1PG5B 4ZCIA 2E1PA 2FUG9 2H9ZA 3ZTRA 3BGOP 3G9CA 2LQ5A 2P9CA 2IRXA 2NUUG 3M8YA 1S9EB 1RYSA 1FXDA 2MHEA 4ZS6A 5D4PA 3BBBA 2F5GA 3BSNA 3KLEB 3EXYA 3PKYA 4K0KJ 2B7BB 3ONQA 5C42A 2AV5A 3M8PA 5FD1A 5KFZA 1S10A 4ZVFA 1FA0A 3M2VA 3QIPB 3UN3A 2PI4A 3CDWA 3QT6A 3KK2A 1KTQA 4QR1A 4ZPVR 2N7CA 4NEYA 2D74B 3OUYB 4CTAB 2HAFA 3K17A 2G1DA 1XNRF 4NLRA 2V2KA 3MD3A 2R2TA 3R5BA 5EWGA 3HVTB 4M94A 2ZKUA 4A8XA 1RT2B 1JK9B 4J9OA 2EG1A 3VVTA 2M0GB 4TXSA 2BJ9A 1DARA 4DV0J 1TV6B 4RW8A 2QFIA 2NSBA 3AXKA 4RR5A 5J2NA 4EI2A 5KFTA 5IS2A 2OP5A 2E7VA 2BJEA 4QJVA 2BOAA 3H0PA 4DR7J 1KNZA 1FVQA 4JI3F 4YB1P 3MEGA 1SH2A 2FC8A 3RRGA 3AJ2A 2KZMA 2KRRA 1SCJB 1NB7A 2DEIA 5A76A 5B0GA 3DRSA 4I2QA 1WEZA 5I3UA 2HVEA 1RTHB 2QLXA 2ZC3A 3LPYA 5D0GA 3PR4A 1WC4A 1HQEA 1URRA 4J7CA 3A3PB 1TL7B 3PACA 4OHYA 1K1QA 4DS4A 1SIZA 3R7NB 2N82B 1F1BB 3JQJA 1VHIA 3MM6B 1GXUA 4C3MA 3J7Z5 3RB0A 2UVVA 4F3OA 2X1BA 5IT0A 4KSEB 3LP2A 3OBIA 4P10A 2DNQA 1TK0A 2UZAA 2F8HA 4PXDA 4ERDA 2DGXA 4LRDA 2IVYA 2FYXA 1TZ0A 4L3KA 4UF4A 3M8RA 2VKRA 2XGQA 3H25A 1N36F 5DG9A 1RCXB 2GGPA 4K7QA 2UU9J 4C8NA 2YX7A 5HI7A 2JLGA 1XR7A 2GQQA 3M8WA 4X4UA 3O1LA 3Q89A 1IR2A 1NPKA 5K14B 3HHLA 5JXSA 4URQU 5ETTA 6AT1B 2HHHJ 2UUCJ 5B0EA 5D4NA 2DY1A 5D15A 4USUA 4ZVQB 2NREA 1X31C 2OJ3A 2FHJA 5L46A 1P1LA 3GG0A 2HQ3A 1RWOB 1U25A 2CQHA 3SEOA 5H9FJ 1TV6A 4BLGA 4KC5A 3T9NA 4DQRA 2L41A 5FDLA 1XN9A 2DNGA 2FHOB 3D6MB 1NPPA 3KLHB 3TX0A 2QA4G 3DLEA 3M32B 2UV8G 5A0YA 2VPZB 4CLKA 2APOA 1JLCA 1SC6A 3ILOA 1I94J 1S59A 3PHTA 4ILLA 1T8EA 4KY3A 3H5UA 2AT1B 3BS9A 4GC6A 2B9YA 2LYVA 4K5SA 1I51B 1LFPA 2OAUA 4Z2XA 2XI3A 3AFGA 1FO1A 4HKQA 1FI4A 3OD2A 2R7RA 4USHA 2KXHA 3ENWA 3UNYA 2Z30B 2Q66A 1KVKA 2PE8A 1NJYA 2QT7A 5D0HA 2YNGA 5G0RA 4CLWA 4OZ1A 3DRRA 2IM1A 2DNPA 2EBEA 1FFGB 5HQ8A 3CC4S 2CJKA 2LMIA 2RU9A 4DBQA 1TKDA 2F8MA 3W7BA 4ETZA 2PC6A 3AAWB 3TA1A 3CCUS 1XMQJ 2ZHOA 4XK8C 4NI2A 1O6XA 4QIWD 3F73A 3T1AA 2KI2A 4JI4F 2P8IA 1VQSA 4ID8A 1GFWB 4A8WA 2IDEA 2MYFA 4ES2A 2OEKA 2RHSB 3M6VA 4F4YA 3P5TL 1S0VA 1D9AA 4F50A 3DMJA 1HNZJ 3FMBA 1VRQC 1XWLA 1AW0A 3H2LA 1WNEA 2OPPA 2VBXA 1ACMB 4N5SA 2J8AA 3G2XA 1NDKA 2UXCF 1BMQB 3JXOA 3QIDA 2E1MC 3MM6A 4B3OA 1KWMA 2R7UA 4M5KA 1S72S 5DDRC 2WW4A 2UUBF 2ZH2A 4M5LA 5T7LB 3TP2A 5F8JA 2CPZA 1SJ3P 4DFKA 2B8PA 3CMES 3CJKB 1WTFA 4LF5J 4PQUA 3TVKA 2OPQB 1T0TV 2BM1A 1K9MT 3C6UA 4OLOA 2NPFA 4K4UA 3NBPB 1NK8A 2HQFA 5CA5A 3K8WA 2EFQA 4BDPA 2C2EA 4UUWA 2ZOFA 2UUAF 2AGPA 1P9YA 1HBOB 4QZVB 4RW7B 4LR8A 3SCLE 5A8RB 5KFOA 2IFXA 2DIVA 3MCMA 4K4XA 2HHQA 4RUCA 1PKUA 5D78A 3G96A 4KGZB 2J0XA 1NM2A 3UE2A 2IA0A 3KHLA 5CCLA 4DV3F 2JNJA 3OL7A 4M63A 4ED5A 1AXQA 4DZ6A 2P6TA 1HNXF 3ITHB 3K57A 3OL9A 3D1QA 3DDIA 3DFEA 4YQWA 1Q86T 2WBRA 1N0VC 1FKOA 1WKJA 1Q5VA 1Y3KA 4F04B 2VG7A 5DGAA 1SL0A 3BEGB 2OPSB 1QDUB 1ZM4A 1N34J 1X4BA 2XZTB 2CQ1A 1S6OA 3BF4A 2W7AA 3HJVA 1N56A 1Q81T 2DNZA 2VZ9A 3SYZA 2QA1A 5J2NB 4OLPA 1TK5A 3R2DJ 2B5JB 2ADBA 2XG8A 2UP1A 2EI5A 4NLGA 4MKVA 2OFHX 2V2ZA 4LQ9A 4LFBJ 3R1HA 4C8YA 3CF5Q 2RQMA 4FBUA 2FJBB 2QEXS 1S77D 1F5CA 2H5IB 1YKWA 3GJQB 3KMSA 2IHR1 4FXDA 4LF4J 1X4EA 3UN2A 1PJ5A 2CAJA 2HBYB 2HQIA 3TEGA 2FLOA 2GHPA 1RU1A 2IIHA 3NWGA 4CTAA 3AD8C 2RDIA 2Z2ZA 1S1UA 1EJ7L 4IYQA 4DV0F 1S76D 1U8WA 3DLKB 3CCMS 4QIFA 3LH2S 2CQ4A 2IJNA 4RW9B 4C8LA 5C42B 5CD4A 2XWXA 3OXFA 5E0OA 3VF0B 4CO2A 2QIFA 2HHVA 5HVHA 1YJ9S 1OPZA 1SC3B 4F36A 4DI6A 4HHJA 3ZZOA 3EUNA 4O0IA 4WFBQ 1B70B 2W2OP 2CQ2A 3PTWA 1XC9A 2F4VF 2M8HA 3QNWB 3IC1A 4DV1F 3FSYA 3VQSA 3OW2R 1LV5A 1CSJA 4QYRA 1AFIA 4ZMMA 2BJ3A 1JLEA 1VQKS 2H5JB 3K58A 1OIAA 4PG7A 1OWXA 2ZC4A 1ULRA 5KFRA 2C2RA 4IRDA 3A8EA 1FESA 4KHPJ 2F65A 1C2PA 2CYYA 1S9FA 1NKCA 2MZRA 3BO4A 2WSFC 2AHOB 3JSYA 4ZITA 4AL5A 6FDRA 1IQZA 1YLXA 4LRAA 2GHVC 3UI3A 4TU7A 2KG1A 4C9DA 1LXNA 4P73A 2RIJA 4E98A 1HBNA 1UWAA 1W7WA 4DOZA 3M2RA 5BJRA 1NHKL 3O8WA 4ECTA 2MQOA 4U96A 1U1NA 4Q44A 3PRBA 4H4OB 2CQBA 2FPHX 4TLRA 2YKQA 1N5SA 1OSDA 3I4PA 3SSRA 3H20A 1PBAA 5L39A 1RAOA 2A2DA 3R6GB 3CJ3A 4NRUA 4TY8B 1IKYB 1IKVB 4MK8A 2AF6A 1VFJA 3VR1A 1JNZB 1NJWA 3TR5A 1EARA 3UDEA 5I4MA 1M5SA 1TKXA 3EGNA 3OHAA 3QJJA 3IG1A 1JX4A 4LBHA 1APSA 2DO4A 1FNOA 3ENAA 2W9CB 3GFHA 4OI0A 5HK4A 1TL1A 1F6TA 4S0MA 2DJWA 3BGLA 4A8KA 2VPWB 3KUHA 1NK0A 5KTQA 4P72A 1IM4A 3P4UB 4WKYA 2WB4A 4U7UD 4PG4A 2UUTA 3HK2A 1BC6A 4CCHA 1HNIB 4IOCQ 2ZDOA 5FIIA 4NLYA 1K0TA 1U2CA 2DXFA 1FRKA 4ZVOB 1TK8A 1T94A 3MEEA 2PA8D 5HBMA 1NSAA 3DRYA 2W25A 3KLEA 1CC8A 3PG9A 3DGPB 1HR0J 2DNOA 1SKWA 2VD3A 2EFNA 2K06A 2QX0A 3V6KA 4LF4F 1PBUA 1RWXB 4CH1A 4O44A 3KK1B 1ZTWA 2HGMA 4DUTA 4WTOB 5E2QA 3BQ2A 3K5MA 4NI2B 3CJ5A 2DXEA 5ETSA 2JEFA 1LWEB 2HFVA 4K50A 2FJXA 1BUXA 5BYSA 3BH6B 4FXWA 4I7FA 3DXBA 3VGVA 2W01A 1NHUA 3QMQA 3ET6B 1SH3A 4O4GA 4HT5A 1XMOF 1IJFB 3WIUA 4Q0BB 1VK3A 1FRMA 1WG1A 4M5DB 3KMQA 3JAMU 3FRYA 5DDOC 1S6QA 1JLFB 2RQCA 2BMBA 2LLZA 2QA2A 3OR2B 1S1VA 3W9HA 5A8WB 3HPOA 2YY3A 4FYYB 1KVJA 1RTHA 4WFZA 4I2QB 4JI6J 4JI2F 5CAAA 1Y0HA 2PO4A 1FJ7A 4CLYA 4P75A 2MKHA 1MMDA 2XYGB 3D0HE 4XDDA 4CT8A 1MN7A 2X1AA 5HO4A 2RJZA 1TUWA 1KONA 2GVDA 2ZKTA 1AUSL 1JXEA 2V4JA 3D0GE 4LF1A 3P5BP 4PXCA 3JAMY 5C24B 5IT4A 4YY3J 2FVCA 3HVTA 3R9LA 3W1YC 2CPFA 3NGRA 3LQVA 1KKHA 2RRNA 3BZQA 3C46A 2DB1A 4NMXA 1UVNA 3MPYA 4DZDA 5I42B 4EZ9A 3W62A 4EWTA 5K14A 4YDXA 2CJXB 3M2VB 3CJRA 2VA2A 5HVFA 3HMJG 4ZPTR 3QRQA 3THPA 2XZDB 2LKZA 3TA0A 2GO8A 2YWFA 2JVRA 4OV1A 2XY7A 2AGOA 1RT6B 5DDPC 4PQAA 2NUHA 3JQMA 4LF7F 4DWIA 3FFIA 2DGSA 4DN0A 2MQPA 3M2UB 3DOKA 3KLGA 4B9MA 4RU2A 3DLHA 5E3QA 3SCKE 5J1NA 2FQQB 4LF8J 1JWWA 3KOAA 1NSPA 1WDDA 1U0SA 5L1LA 2R7TA 1BQNB 3QJLA 1HI1A 4WYWA 3QSYB 4KO0B 2DHAA 3PYFA 2GCFA 1VQNS 1VI7A 3B54A 3BYPA 3HSGA 2HNZA 2KTQA 2DGOA 4KHRA 3N01A 2FC9A 3A3NB 4QWBA 3TVYA 1FX4A 5B08A 4CYUB 1ZAWA 2V50A 2VQFF 3VCDA 4CIOA 3I6PA 3R7BB 1R31A 4Q5VA 2VG7B 3G8SA 2PMHA 1P8GA 5EWEA 4ICLB 3DXSX 4DV3J 3GJRB 3MCSA 2R8GA 3I0SA 2GX8A 3FBCA 5DGBA 4JV5F 1RACB 4K59A 2CQIA 2AX0A 5THWA 4DR3F 2CADA 3DLGB 1HNZF 3HKZD 2KVIA 5J2QB 3FRZA 3KJFB 2HLTA 3M1VB 3TUPA 2RT3A 2AKWB 3B4MA 1YRUA 4HH0A 1NRKA 1ZPWX 1HBMA 5IC6B 3SCIE 3W60A 4CLLA 1U45A 1I94F 1X4HA 4GKKF 4C97A 3DOMB 3PX0A 3PO5A 2J5AA 4B02A 2B4OA 3HCXA 4KE5A 2AYGA 1HQUB 1TL4A 3NWRA 3R3TA 5GADU 4ECQA 1LK5A 1VYAA 2CG4A 3CDBA 1RKIA 4LVOP 1KRPA 1D0EA 3RB4A 1HFEL 1H7WA 2LP4A 2X7IA 3DDNA 3GILA 3RRKA 2RQKA 3H90A 3AD9C 4NYOA 2NS1B 4DLEA 1W2IA 2ZH3A 3BGUA 3DHWC 4U7UK 4OX9J 5CYMB 1RT3B 2HWIA 1QSSA 4OHXA 3NMAA 3ZZTA 2ZH5A 4UY85 3P96A 2FJEB 2MZQA 1M5VC 1SQEA 3DOKB 2O5DA 1KC8T 4YR2A 2MQQA 5IOLA 2FHKA 4YMEA 1MROB 4USKA 3OR2A 5KFUA 1ZETA 4DL2A 5IM0B 4DF4A 2VONA 2HGNA 2BE2B 3QAEA 4QYZJ 3DLJA 5RUBA 1RHQB 1SL2A 1N34F 3RZAA 2LQBA 3BBFA 4MJKA 4K0KF 2DBBA 1RHUB 1RA7A 2HQCA 3W9IA 3KNGA 1X0FA 1ZAVA 5J2QA 1IKWA 4CNYA 2YKAA 5SUHA 3GP9A 1N32J 4ENOA 4RW4B 2E9ZA 4ILMA 4E0DA 4OQJA 1EP4A 1UW4A 1TU0B
chains in the Genus database with same CATH topology
2N4CA 2I0XA 4EUVA 4LFCF 4NXNF 2ZFHA 4B9UA 3LOUA 2D3ZA 1RQ0A 4ELUA 1M5HA 2B5JA 3DGPA 5L9NA 4R5PA 2J0WA 3GYNA 4ZPCA 4ETXA 2R7SA 2KU7A 1U1LA 1C0TA 3QGPA 3QYYA 4ATNA 1TKTA 3K5NA 3CD6S 1PILA 1WI6A 2HS4A 2YNHB 1KVIA 1QVGR 3ITHA 2FTRA 3KLHA 3DHXA 3MM8A 1YQHA 2AYBA 1B64A 1S1VB 2R9LA 4EYHB 1VQ9S 3QLHB 1FT8A 3K59A 1KOHA 3F41A 4H4MA 2EG2A 2VFVA 2E5HA 1S1WB 3A1YG 4PPZA 2XLJA 1R8AA 5GMKa 1TFWA 1QAIA 2OH2A 2DGWA 4R8UA 1KLMB 3UCGA 1L3UA 1GNKA 5CZXA 2BXJA 3K5LA 1RA6A 1TL5A 1U2RA 3GMGA 2R8IA 3Q24A 3VAKA 4G3IA 5KT3A 4ZP7A 3DU6A 2EFGA 1RP5A 1DQ9A 3GFYA 2PIIA 3VAJA 4ED0A 4A8QA 2RKIA 4ED6A 1S6UA 2IMOA 1KLMA 2VBZA 2XSFA 4YB5A 1SKRA 3I0SB 5F8GA 4J9PA 2HNDA 3G86A 4MKAA 1CQNA 4B9LA 1Y9OA 2FLNA 2VOPA 3M2RB 2HZCA 3CDUA 3N5FA 1HBNB 5KFWA 3T1YF 4DV6F 2M8DB 3F44A 3HM9A 1UVKA 5IWAF 3EYZA 1MMLA 4C8OA 3CCWA 5J2MB 1K1SA 1XTZA 1UJ4A 2LXFA 4O23A 4D3HA 2KG0A 3CXCR 1K73T 2ZD1B 2KHCA 2E1AA 2ROGA 1U24A 2FY1A 2C42A 4NMLA 2ZHBA 2BACA 4X4NA 2GHWA 1H6KX 2MQLA 3KJVA 3TANA 4R5PB 3LO3A 3MMJA 3KHRA 2D3UA 4QWAA 1L5UA 1S1WA 1AUDA 3MAHA 4NYPA 3C66A 3LP0A 1Q78A 3DC2A 1X9WA 4ZPBA 2LQJA 2YNHA 4O3OA 3NGKA 4XPCA 2F9JA 4ZVHA 3H5SA 5B09A 3UCZP 2BRKA 4ZVGA 2DGTA 4CH0S 3J7YU 2KM8C 2J6UA 1YSJA 5T41A 4RBVA 5EUHA 3I4HX 4B08A 2BM0A 1VQ7S 1QY7A 2K7JA 3IR5B 4B3TF 2COLA 4FF1A 2AYEA 3MR6A 1SKSA 2DCUB 1Q1KA 3PEJA 4F4XA 3J7YI 2KH9A 1M5OC 4RW6A 2GO9A 1D3WA 1OS5A 4ZKAA 1HD0A 4OIXA 3NLCA 3PX6A 2ZNYA 2ZOGA 4YFUA 3PW0A 2X1FA 1K0VA 2YNIA 4DQSA 4F2RA 2KB2A 1A9NB 4KT0C 4C3KA 1YJRA 2HFOA 5KFYA 2UUWA 1S99A 4DX8H 1BGXT 2XEXA 1ZZNA 3MTJA 1U6BA 3KLGB 4LSNA 2R8KA 1XMBA 4ZK7M 3CCQS 3NRBA 4NZ7A 2VBYA 2XCPA 2VL1A 5J1EA 2Z2MA 4LSLB 1X4AA 3HVWA 1JLBB 4TY9A 3KK1A 2W4DA 2JLFA 2L9DA 5GAHU 5B0CA 3HXMA 2CQDA 1RK8A 3H40A 5I42A 3CJ0A 1TVRB 2HNYA 1HWLA 4B3OB 1L3KA 1UWBB 4R8UB 2Z8QA 3KLIA 2DGVA 2HWTA 1VRUA 1X5PA 2BW2A 2CFXA 2B4VA 4IOBA 1SJ4P 1UVMA 1KS2A 3FVYA