2B6AB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with thr-50
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Crystal structure of HIV-1 reverse transcriptase (RT) in complex with THR-50
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 101
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b6aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB03
3V81A 2HNYA 2ATLA 3IS9B 3MEDB 3CJ3A 3V4IB 1TL1A 5F8NA 5CYMA 3H5XA 4Q0BB 3KLGB 5J2NA 3DMJA 4ZP7A 4ZP8A 2B6AB 4IFVA 1S4FA 3PJWA 3C6UA 3M8QA 4XO0A 4ECQA 3MFHA 1K1QA 4WE1B 4ECYA 3NKYA 4Y34A 1JLAB 3DYAB 4NZ0A 3FQLA 3LP1B 3PW4A 3BQ1A 2VG7B 2YNFA 4ECSA 2FLPA 1RT7A 4OL8A 1MMLA 1REVA 3DI6B 2FVSA 4Y2AA 3QGGA 4H4MA 3KK3A 2RDIA 5KG2A 3V6JA 3SI8A 4R8UA 3PR5B 3SFGA 3T5KA 1SUQA 1RTJA 3QLHB 1IKXA 3OLAA 4U6PA 4IG0B 2XCAA 4QWEA 1HQUB 5J2MB 1IKWA 4O3SA 1LW2A 1S9EA 2ZE2A 3LAMA 5K14A 1KLMA 3FFIB 2OPSB 4TN2A 3H98A 3LAKA 1K1SA 4TYBA 4ZHRB 2CJQA 1TKXB 2JC0A 4Q8FA 4PWDA 4I7FA 5J1EA 4IQXA 2IMWP 1XR5A 4ZP9A 3OL9A 3BQ2A 3NBPB 5DGAA 1LWFB 3KNAA 1SV5A 1RTDB 4J9KA 4EYHB 4ICLA 3C6TB 3KK1B 5KFOA 1LWEB 5C5JA 1TKZA 4ED0A 4K50A 3H5UA 2YKMA 3KLVA 4JV1A 4Q8EA 2RF2A 3DRPA 1JLCA 5KT2A 4LSNB 4RW8B 1DTTA 3I0SB 4ID5A 4DEZA 2OPQB 3LP2B 2XGPA 3MR5A 5F8JA 2YNGB 3DLEA 5KG4A 2R2TA 1J5OB 2HMIA 4O4GA 2WB4A 3MECB 4DL5A 2VA3A 1FKPA 4O44B 1TV6B 3I5CA 1DTQB 5J2QB 4ZMMA 1TP7A 3KHHA 1S9GA 4R5PA 2IM0A 1HMVA 2RDJA 4I2PA 2AX0A 4EO8A 2BANA 3NGDA 3T5JA 1QE1A 1OS5A 1RA6A 3BSCA 1EETA 4NLQA 4YR3A 5F8HA 3KHRA 1S9FA 1N4LA 2XGQA 3ICLA 4EEYA 3KLFB 4KO0A 4RUCA 3HVTB 3KK2A 2IA6A 2I5JB 3HHKA 3H5SA 4RW7A 4ZPDA 2C2EA 4LQ3A 2OPPA 1TL3A 3E01B 1RT5B 1S1UA 3QIPA 4XPCA 3CO9A 2YKNB 3M8PB 4ECVA 4EBCA 2IC3A 1JLFA 3LALA 5KFTA 2WOMB 4O3RA 4O3QA 4NLYA 4R0EA 2ZD1B 4RNHA 4WFZA 5KG6A 2W8LA 3T5HA 4RUAA 1JLEA 5KFLA 4YMEA 2D7SA 3CDUA 3OSPA 2ZKUA 4RW9B 5DGBA 1VRTB 1VRUB 2OPRA 5HLFB 2R8GA 2YNHA 4ZVFA 4WFXA 4ED2A 4RNOA 2R8KA 2J6TA 4MFBA 5C42A 4Y3CA 3I5AA 1LWCA 3IRXB 3ISNC 4MKAA 2VG5B 4JUZA 1LW0B 4B3OA 3DLKB 5HBMB 5KFNA 4G3IA 4WXWA 5KFSA 1RDRA 2W9BA 1BQMA 1RT6A 2IM2A 3QZ8A 3GYNA 4TQSA 4KFBB 2HNDA 5DG9A 4U7CA 1N48A 3KHGA 1T03A 4QWDA 3MF5A 4KKOB 4KV8A 5D3GA 2BQUA 4MIAA 1RT2B 3T19A 4J9SA 4KB7A 4KBIA 3RB4A 1MU2A 3DRSA 3H4BA 1C1CB 2HAIA 4KHMA 2W7OA 2RKIB 2ASDA 2J6SA 3QGIA 3M9OB 1EP4B 3G6VA 3GIMA 1HNVA 3GQCA 3GIKA 2VG6B 3T1AA 5KFPA 4J9NA 3V6KA 2E9ZA 3BR9A 4EBEA 4NLOA 4FS1A 1C1BA 4ZVEA 4I2QA 1R0AB 5HP1B 4MKBA 3JYTA 3D28A 4QWBA 3G6YA 2R8IA 1JLQA 4YR0A 3KLIA 2AQ4A 4K4SA 2UVRA 4URSA 3PVXA 1TL1B 4ECWA 5CYMB 3OL6A 3H5YA 1RYSA 3DMJB 3NAIA 5I42A 4IFVB 2XI3A 4RNMA 3C6UB 3M8QB 3OLBA 5F9LA 5J2PA 4URQU 3GV7B 4QWCA 4H54A 4IRDA 3BGRA 2BQ3A 5KFAA 2R2RA 4DG1A 2BRLA 2V9WA 2YNFB 4Y2CA 2WHOA 5KFUA 4K4UA 1D1UA 4NLRA 4IG3A 3DLGB 4H4MB 3KK3B 2IAJA 4IDKA 4MIBA 2UVWA 1IKVA 5DG8A 2JLEA 4NLTA 3TQ1A 1IKXB 5KFXA 5I3UA 5FDLB 1T05A 1N6QA 4F50A 4ECTA 3QO9A 3QYYA 4RW6A 5KFDA 3RB6A 2D41A 1IKWB 1SH0A 1S97A 3NL0A 1LW2B 1S9EB 1RT1A 1TKTA 1KLMB 1ZTTA 3GV8B 4H4OA 1S1TA 4ED3A 3PW5A 3OSNA 4FS2A 4GC7A 4YR2A 5KFRA 4F4WA 4PWDB 5J1EB 3BQ0A 3TAMA 3MR6A 4WZQA 5KFVA 2W9CB 5KT6A 2WRMA 4GC6A 3PR4A 1QAJA 4J9LA 2R8HA 3LP0A 3NAHA 2AGPA 1RT4A 5C25A 3DRRB 3KLHA 4ICLB 1RTHB 1NHUA 1XR6A 3IS9A 3QIDA 1HYSA 4QPXA 2W7PA 4ED8A 3D5MA 1JLGA 1S6PA 3V4IA 3IGNA 4Q43A 2D3ZA 2RF2B 3DRPB 1JLCB 1T94A 4NLWA 1DLOB 4ID5B 3PHEA 2HNZA 1RTIA 2WK4A 3DLEB 3GIJA 4J9PA 1XR7A 2HWHA 3FDSA 2HMIB 4O4GB 4WE1A 3HVAA 4M94A 3DYAA 3CDEA 2AGOA 5F8IA 4WXOA 1FKPB 3LP1A 3FRZA 5KG5A 4F4XA 2UUTA 4IRKA 1N56A 4YQWA 1S9GB 4R5PB 3RB3A 4I2PB 4KE5A 2WONB 2W8KA 3V6DA 4NLSA 1QE1B 1JKHB 3MTKA 3UPFA 1EETB 5L1KA 2AX1A 2AWZA 1HPZA 1D0EA 1GX5A 3QLHA 4NLPA 1S1VA 4G1QA 3KK2B 4TY9A 5DQHA 4RW7B 3CIZA 2OPPB 1TL3B 1S1UB 3QIPB 2ASJA 3KOAA 4PUOB 5KT5A 3MR2A 1S0NA 2IC3B 1BQNB 4ZVHA 4TQRA 3GV5B 2XC9A 4DL6A 4Q44A 3BREA 3ITHA 1JLEB 1JIHA 4K4TA 2JEJA 5DQGA 3M9MB 2OPRB 3BSOA 2YNHB 1LWFA 4ZPCA 4RW4A 1I6JA 4JV0A 5T14A 4KAIA 4QWAA 2AGQA 4QW8A 4LSNA 4RW8A 5L1LA 4B3OB 4URGA 3DDKA 3HKWA 5KFBA 4O3PA 2W9BB 1SH2A 2IM3A 1RT6B 5KT3A 3Q8QB 3T5LA 2JEFA 1FK9A 3I0RB 1CSJA 1S48A 2V0NA 3CJ0A 5EWEA 4FBTA 2O5DA 3BSNA 3DOKA 1T03B 5J2QA 4M95A 2CKWA 2UUWA 5D3GB 3H2LA 4MK7A 5KFWA 2E9RX 4NCGA 5CYQA 1N5YB 1GX6A 3MR3A 2GC8A 5L1IA 3G6XA 2C2DA 3KLEB 4IRCA 3UDLA 1MU2B 3DRSB 2GIQA 5KG0A 3EZUA 3EPIA 1S1XA 3Q8RB 3PW7A 3RAXA 3KLFA 3KJVB 4ZPAA 3DOLB 1NHVA 4NLXA 1HNVB 2FJXA 1C0TA 3E01A 1RT5A 3UR0A 2FVRA 4RU9A 2IJNA 1S1WB 3I5BA 1S6QA 4I2QB 2BQRA 2WOMA 5KG1A 2AU0A 2FLLA 4LSLA 1JLQB 1HQEA 1UWBA 3KLIB 3BJYA 5C24B 3FQKA 2FJWA 4IFYA 2R2UA 4RW9A 5I42B 1VRTA 4NLVA 1VRUA 2YNIA 1TVRA 4FBUA 4TY8A 1JLBA 5J2PB 3V81B 2HNYB 3PZPA 3RBEA 2BE2A 4DG1B 3BSAA 4DL3A 3SFUA 4PQUA 4MK9A 1RT3A 2VG5A 5J2NB 5EWFA 4EYIB 3DLKA 4DL2A 1S10A 2B43A 4IG3B 1HNIA 2IAJB 4IDKB 4DL7A 2C28A 2V4RA 3CWJA 2FVPA 4O3OA 5KFQA 2EC0A 3LANA 1RA7A 4KFBA 3QZ7A 3JSMA 5KFEA 4HKQA 3PJXA 5I3UB 1T05B 2FVCA 1RT7B 3QO9B 1REVB 4RW6B 4RNNA 2FJVA 4WZMA 3MEGA 1TKTB 4F4YA 5KFCA 1JX4A 1C0UA 4IOBA 2B5JA 4TLRA 4R8UB 5KG7A 1FKOA 4H4OB 1SUQB 1S0OA 1RTJB 1EP4A 5EDWA 3IG1A 1RYRA 2W9AA 3TAMB 5L9XA 1IM4A 3TVKA 1IKYA 2ZE2B 5F8GA 1S0MA 5K14B 4ECZA 2DPIA 1RT4B 4XPEA 4IH7A 3MEEA 5C25B 3KLHB 5DG7A 5DLFA 4O4RA 1HYSB 2JEIA 5KFMA 1JLGB 1S6PB 3N6MA 3RBDA 3RAQA 1WNEA 4NRTA 4I7FB 5F8MA 5HROA 2DPJA 4KSEB 5KG3A 2HNZB 3ISND 4KHRA 1RTIB 2GIRA 5JUMA 3PW0A 2VA2A 3NMAA 3DM2A 3KMSA 2IJFA 4EBDA 3H59A 1SV5B 2C22A 3EPGA 4K4VA 1C2PA 5JXSA 5KT4A 2IBKA 4WYWA 3H4DA 3IN5A 1TKZB 3MEDA 1ZTWA 4F4ZA 2YKMB 3CJ2A 3OL7A 2UVVA 4Q0BA 3KLGA 2V4QA 1DTTB 1TQLA 2B6AA 3DLGA 3V6DB 5KFGA 2XCPA 3N6NA 1JLAA 4K4XA 4K4ZA 1HPZB 4RZRA 4G1QB 1S1VB 2WTFA 5FDLA 2VG7A 4J9OA 4LQ9A 3DI6A 1HMVB 2BANB 2QE5A 1KHWA 1QUVA 4HYKA 4WYLA 4KO0B 5KFHA 4ED6A 3ITHB 4IG0A 1HQUA 5J2MA 5DQIA 2W9CA 1S49A 2J6UA 1RAJA 1QAIA 1JLFB 3FFIA 4RW4B 3CJ5A 2OPSA 1HARA 3DRRA 4ZVGA 4K4YA 1RTHA 4MK8A 1KHVA 3IGVA 4ZHRA 1TKXA 3UQSA 4ZP6A 2FVQA 3Q8SB 2BRKA 1DLOA 1ZETA 5EUHA 3NBPA 2XI2A 5KFJA 3H40A 1RTDA 4J9QA 1FK9B 4TXSA 4MFBB 3KK1A 3C6TA 4QW9A 1LWEA 4ECUA 5C42B 2ALZA 3DOKB 1LWCB 3I0SA 3PW2A 4NCGB 2OPQA 3LP2A 5CYQB 2WONA 2YNGA 3KMQA 1BQMB 1J5OA 1JKHA 4K4WA 3FSIA 4MH8A 5KFYA 4ZPBA 3CVKA 3MECA 1S1XB 3GIIA 3GILA 4ECXA 4IR9A 4IR1A 3MFIA 2ILZA 2HNDB 2FLNA 4O44A 1TV6A 1DTQA 5F9NA 3OL8A 1C0TB 4KV8B 2JEGA 4ED7A 2C2RA 4PUOA 1U09A 5KT7A 3OHBA 1S6QB 3OHAA 1BQNA 2R8JA 4LSLB 1HQEB 1UWBB 5L1JA 3M9NB 4IH6A 3HVTA 2I5JA 3V6HA 3N6LA 4IFYB 3VQSA 2YKNA 4O3NA 2XWYA 4WFYA 2YNIB 3M8PA 1C1BB 1TVRB 1T3NA 5KFKA 4TY8B 1JLBB 3JYTB 2ILYA 2BR0A 2F8EX 2ZD1A 4JV2A 4ED1A 4Q45A 2BE2B 2E9TA 2JC1A 4PQUB 1RT3B 1YVFA 5HLFA 4YP3A 5KFIA 1HNIB 1Z4UA 4J9RA 4EO6A 3G86A 4J9MA 3I0RA 3HVWA 2D3UA 3BGRB 4NLDA 3JSMB 4TYAA 2I1RA 3IRXA 2WCXA 4NRUA 1LW0A 5KFFA 5HBMA 3Q8PB 1N5YA 2R2SA 3MEGB 3KLEA 5KFZA 4IH5A 1C0UB 2B5JB 1IKVB 1FKOB 3CJ4A 3KJVA 2QV6A 5DLGA 5EWGA 3DOLA 4ECRA 3IG1B 4X2BA 3CDWA 1N6QB 4KKOA 2IM1A 4NLGA 4IKAA 1RT2A 1JXLA 1S1WA 3QGHA 1IKYB 4RNFA 2ASLA 1RT1B 1SH3A 3RB0A 3E51A 4NLUA 1C1CA 3MEEB 2RKIA 1S1TB 1W25A 4DL4A 2OH2A 5C24A 3KHLA 2VG6A 2HWIA 5HROB 5F8LA 2UVUA 4NYZA 1NNDA 3DM2B 1R0AA 5HP1A 3LP0B
chains in the Genus database with same CATH superfamily
5K5MA 2Y8YA 1TUWA 5J2NA 4ZP7A 1S4FA 1M1GA 4DX7A 4WE1B 4P6QA 2L9NA 1OPIA 3K5LA 5HVHA 1R31A 4CLLA 5GADI 3PR5B 3T5KA 2W2PP 2HVEA 4H4KA 1P9QC 5BR8J 4PG5A 2RS2A 1ITPA 4LR8A 4N8NA 2BXJA 4IQXA 5HSPA 4P7TA 3GFXA 3KK1B 2MQOA 4ED0A 2R7OA 2YKMA 1LQ9A 3DLEA 2ZH9A 2NXUA 4ZLLA 3I5CA 2P5VA 2XG8A 2X1BA 1S9GA 1HMVA 3SEOA 2AX0A 5FLXU 4YR3A 5F8HA 3HFZB 3R7NB 4XPCA 2DEIA 5K8PA 5A8WB 5EHHA 3PIOQ 1JLFA 2WOMB 4O3RA 5KG6A 2D7SA 2DRAA 5HLFB 1VC6A 2XO6A 2V4JA 1I1GA 2ZOGA 4NI2A 2WVEA 1HA1A 5KFSA 2IPOB 2Q1LA 1Q8IA 1U49A 1SPBP 4KFBB 3IA0A 1N48A 1TTHB 3HVRA 4KV8A 1M5SA 3G2XA 3TA0A 1MU2A 4F3QA 4KHPF 4LF6J 2JX2A 3V6KA 1C1BA 1TL4A 1KOHA 2XY5A 2GNKA 3EGZA 2YWHA 1TAUA 4DR5J 5F9LA 2BMBA 4IRDA 2NCKL 1SIWB 3DRXA 3O3LA 5KFUA 2WHOA 4IG3A 2HS0A 3GJTB 2IAJA 1IBLJ 2DGTA 4NCAA 1N6QA 1T9WA 2EK1A 3VALA 2J8AA 3CIMA 4H4OA 3WHIA 1RT4A 2MY8A 5C25A 3DRRB 2DNNA 1TUGB 1JLGA 2FPHX 1DLOB 2QRRA 1RTIA 3FDSA 3D7SB 1FNMA 1QSYA 4OX7A 3HCXA 2DYAA 4KE5A 4OYIA 1JKHB 4C8NA 5GMDA 1G4CA 1L5UA 2DCUB 1TL3B 1S1UB 4GKJJ 4EZ9A 2HW3A 1SKRA 4IYQA 4WK3A 4MAKA 3BREA 3FZBA 2BJDA 2YNHB 5E3RA 4KAIA 2BM1A 4O0NA 5H9FJ 4JYAJ 4CLZA 2L48A 2PIIA 2JHEA 2ABYA 2ZOFA 3BB5A 3NCRA 2EWHA 4EMDA 1PSDA 1IBMJ 4Y2MA 5L1IA 2FHMA 5KG0A 3VAGA 5A6WA 2U1AA 2J8SA 2W7AA 4NLXA 1HNVB 5DRKA 2MTLA 2QLFB 3RW7A 3I87A 1JLQB 1U1QA 2MZSA 2YNIA 2QYGA 1NHKL 1LV5A 1PBUA 3BSAA 2KU7A 4MK9A 1N34F 4J9VA 4IDKB 5KFQA 1Q82T 1FERA 5KFEA 1YZ7A 4RNNA 2LXFA 4ETXA 2WBRA 1X31C 2RUGA 4C8ZA 4ZVRB 4J91A 5DJBA 4P52A 2ZH5A 1NXIA 4KH0B 1VBZA 3PM9A 1FRJA 5F8MA 1U8SA 3KMSA 1LNQA 2GA7A 1U1MA 5KT4A 3RW6A 3N28A 4F4ZA 2NR0A 1HW8A 3AAWB 3M8SA 1X4AA 2XCPA 2B3TB 1HR0F 2PFDA 3BDPA 3W65A 3J7ZT 2VKZG 3HK2A 3NMRA 3R1LA 5KFHA 4WP3A 1VJWA 3M30A 5ETRA 1TMJA 2XB2D 4HHJA 1RTHA 1Y10A 4Y6IA 3BKFA 4XK8C 3WZ0A 4C48A 1HD1A 2ZOMA 3T9ZA 4QYRA 5THWA 4NXMJ 3RRGA 2GMLA 2DISA 2D3O1 3FSXA 1LK7A 2ZITA 2FLNA 2W2OP 4DV6J 5AXNA 4TKTA 3HLUA 2GQCA 1BQNA 1GXLA 4OV6A 1NUEA 4F67A 3H0PA 4KGVB 4DFMA 4YB7A 1RT3B 2RU9A 3G86A 3I0RA 1N0UA 1NU4A 1FFWB 2OHDA 2EFPA 4WFNQ 2LXUA 1CBKA 5ETPA 4X2BA 3M32A 4HHUA 3HSGA 3FBBA 4ATNA 2X3GA 3KG1A 3KHLA 2Q43A 2VG6A 2VUGA 1EB0A 2GAGC 4DN9A 4X62F 3C14B 3D3CJ 1HBOA 1S6UA 1OY6A 4JI3F 3GCXP 2DHSA 4IFVA 2DBBA 1JLAB 3DYAB 2D9OA 5DS7A 2UUCF 3CJTA 4D3GA 2K7KA 3WBZA 5KG2A 3V6JA 4NE9C 2DR5A 3FSYA 2QMUB 1T02A 4M63A 1QLNA 4B3RJ 2AT1B 2WSCC 2ZZNA 2BABA 4K50A 4JV1A 3OVAA 1JLCA 5KG4A 3MOJB 1M0SA 1BMQB 1FF2A 4I2PA 2CPJA 4MIWA 4CYUB 2XGQA 5E3CA 4WFAQ 5DDRC 3FMBA 2UU9J 4GMKA 2WB1D 4RNHA 4W98A 2KHCA 5KFLA 2J9DA 3E3XA 1VRTB 4QIWD 2XSJA 3IRXB 2ADCA 1RDRA 4LF4J 1CJUB 1N32F 3J81j 3KHGA 3TUZC 3IWLA 4UOGA 2Y1IA 2KB2A 5L39A 2W7OA 2RKIB 2KJWA 1E6VA 3BR9A 4C11A 4DLEA 2NXCA 4FS1A 1RWPB 3M7VA 2HHQA 3C6UB 2EW9A 3BGRA 4DR2F 5EX3A 5KFXA 4Y0FA 4FYXB 2GJIA 3UN3A 3OBIA 4ED3A 1S99A 1FESA 2RT3A 5KFRA 4PWDB 3SZ2A 3J7A1 1NHUA 1RWXB 1Y5LB 2IVMA 2HMIB 1D9AA 1FKPB 4R5PB 2EPIA 1QE1B 1RACB 2AX1A 1IR2A 1M1KT 1X4DA 2ASJA 2XC9A 2KI2A 2YPYA 4GO7X 1S12A 1M1HA 1I6JA 3DLHA 3HKWA 5KFBA 3CJ0A 1XMQJ 5EWEA 4UOCA 4TU7A 4FBTA 1NJXA 1RHRB 2BKOA 1N5YB 5AE1A 1X4EA 2DGOA 3PW7A 3Q8RB 4PEOA 2HHHJ 1KP6A 4OZLA 1TUVA 3BJYA 1UZHA 3I4HX 2VFTA 1TVRA 2DITA 5LL6d 2HS4A 3M6XA 4OJGA 3IBFB 4DG1B 1R6YA 4PQUA 1WG5A 1EQMA 2B43A 3LOUA 3UO0A 2OSQA 3VGVA 1I94J 1B70B 2EC0A 3LUYA 4QU7A 4LF7J 1ZYQA 1REVB 3VGSA 1TKTB 2W9AA 1HHTP 3RR7A 2VL1A 1WC0A 2ZE2B 1B7YB 1LXNA 4ECZA 2AKWB 5DLFA 2BKPA 1YZ6A 2D74B 2ATCB 1GFWB 2G13A 3MMCA 5K8NA 3OW2R 2ADBA 3US5A 1SV5B 1Q86T 2RSQA 3KLGA 2JFDA 4N77A 1VOMA 3MM5A 2IY5B 2DRDA 1X0PA 3GYXB 1VQ8S 5F0WA 3QFHA 1FVQA 3IC1A 4CQ1A 2HFUA 3SCLE 1KHVA 1F9HA 2ZUAA 1TL7B 1V3SA 5L46A 2ERRA 2MQNA 1QVGR 4DR6J 3PW2A 3MUVP 1SI9A 3Q89A 4A8SA 2HG4A 1DTQA 2FIUA 1LEOA 3FNNA 1J5EF 3THTA 2DNRA 3M8PA 4WBFA 2R7RA 2C3OA 2B4VA 2ILYA 1NKBA 2DR6A 4DV7J 3PRVA 4R25A 2PA3A 4BWMA 1V5VA 1UMJA 3ET6A 4J9MA 1KQFB 5G0RB 5HBMA 2B5JB 2CDRB 1Z2LA 2PMZD 2E66A 4F36A 4KKOA 2JNJA 1RT2A 2CQ1A 1IKYB 3MM8A 3SQGA 4X65J 4A8QA 1GTHA 3H7HB 2HRTA 1XN9A 3V81A 3HFKA 2I8EA 3MEDB 5F8NA 3H5XA 2PA8D 3FRYA 4Y2AA 2OO4A 3DXSX 1C4CA 4DV3F 4EZ6A 1WD6A 2KL8A 5JMNA 2M0GB 2CJQA 4I7FA 5J1EA 1FWLA 4DF4A 1IVZA 2Z4PA 4DF8A 3DRPA 5KT2A 4LSNB 3BR8A 3D6HB 2OPQB 1RHKB 3TUIC 3BKUA 2XYGB 3K5OA 1MNEA 3QAUA 2AZ3A 1TP7A 4K2XA 4NLQA 2LQBA 3FCHA 3HVTB 1NCLA 1SJ1A 1VBKA 4DHVA 2HZCA 3M8YA 4ECVA 4DUTA 2IC3A 4N7TA 2ZD1B 2GHVC 1U0HA 4YMEA 3HHDA 4RW9B 3R9LA 1P1TA 4BHQA 2B4UA 3CO0P 1SL1A 2OD6A 1SVDA 4U7CA 5A8RB 2NUUG 3QT6A 3H20A 1NO8A 3M8WA 4RJVA 1VQ4S 5B0BA 2R8IA 2DK2A 1VFJA 3OLBA 3LTOA 4Q2LA 4Y28C 1PBAA 4K4UA 3T41A 2LA6A 4CWBA 4M5NA 1F3FA 3J7YU 5LSOA 3QRPA 1T05A 2M88A 1S7IA 3QWPA 5E41A 4TNOA 3DNCA 3LP0A 3PYEA 4YB6A 4ED8A 2JVOA 4S0MA 1R43A 2F4VF 3DLEB 3W5YA 4DSJA 1J27A 2MKHA 4PAAA 3HVAA 1UJ4A 3A8JA 3ILOA 2NXJA 4Y00A 4ELVA 2CRLA 1S9GB 4UUWA 2WONB 3KKFA 1GX5A 1FT8A 3K8VA 5A0YA 5T7LA 2NSCA 1N5SA 4OJ1A 2LXIA 5T14A 2V4JB 4NI2B 3T6BA 1KOOA 1R7IA 1CPZA 4PRFA 2DNLA 6AT1B 1YWXA 2LA4A 1CJTA 2GMJA 4CNZA 1ZPWX 1MU2B 4TLQA 2VQFJ 3EPIA 5U47A 3TJAA 4DV0J 3Q22A 3MM6A 3D1QA 2NYIA 4X4OA 3ETMA 4IFYA 2G0JA 4X4RA 5HVGA 2H1YA 2BE2A 3AOBA 4IG3B 3DLLQ 2IAJB 2FVPA 5A2QY 3W63A 2DXDA 4AE5A 4C3LA 4H4OB 1S0OA 4JI4F 1HNXJ 1J2VA 5F8GA 2CJKA 2ZZMA 1RT4B 5C25B 4OZJA 2RU3A 5KFMA 2FC8A 1JLGB 2VOOA 2JZ5A 2OKQA 1RTIB 2PT0A 5A6PA 1WDDA 2V4QA 3DLGA 1C4AA 1BLUA 2DGXA 2RHQB 4IOCQ 4WIIA 5FDLA 3TX0A 4A8WA 1Q4RA 2EKYA 1S7HA 1KHWA 4LRBA 1YJWS 1ZAVA 3SIPB 2GAHC 1UA0A 4ED6A 3OFEA 4CH1A 2FC9A 2B7CB 1MG7A 3FFIA 1HARA 2BJ8A 4KPCA 4ZHRA 1NMEB 3POTA 4JOUA 5B0EA 2G2ZA 1LWEA 2N4CA 3NP5A 1R8BA 3I0SA 3NEKA 1R3NA 1J5OA 3FUYA 4K4WA 1RK8A 1K0TA 2RHSB 2NREA 2K1RA 2CJBA 1H38A 3CJ8A 4KGKA 4CLKA 1RBOB 2YNIB 2VU5A 2M2BA 3PY8A 1ZOTA 1YVFA 3RGIA 2JOQA 2NS1B 2FDNA 1FXLA 2D3UA 1RWMB 2I1RA 5LSRA 1Y5IB 4DUZJ 2DR7A 3TI0A 3I9V9 4NEYA 2MQ8A 4B3TF 3PO5A 4P7VA 5B0FA 2LEPA 3KJVA 1P27B 4OLOA 3W62A 4M5GA 2LYVA 2OELA 2DIVA 3FCWA 1NPPA 2XNRA 4WP8A 2DNOA 4C8KA 2OJ3A 3CEDA 2XMTA 5HP1A 4Q7AA 4ZPWR 2ZJQQ 4ZP8A 1H72C 5ETOA 3OXLA 3HXMA 5EGYA 4X4NA 4CLUA 4CM0A 1RT7A 4LVNP 4USMA 1GMWA 2FZGB 2LU2A 4CLFA 3AA8A 2AJ4A 3LAMA 4LRDA 5K14A 3M30B 2GV1A 1LXJA 2WBMA 1VQLS 4DQRA 1I51B 1XR5A 3F56A 2VIHA 4ZP9A 3B78A 2B9WA 3IR5B 5C5JA 3TARA 2LP4A 1U48A 2V8PA 4N76A 3G6ES 5GMEA 2QO3A 2V69A 2EFOA 2AJ2A 2CQCA 4K0KF 3NNHA 4YUDA 3I96A 1Y9OA 1JXVA 4EEYA 2ZC3A 2CG8A 2X3DA 3HHKA 1NSKL 3E01B 4DR7F 4NOHA 2XHWA 3BO3A 1UVLA 2ZDPA 2OPRA 1Y5NB 3TZWA 4QIGA 5C42A 3EM1A 2VG5B 2DJWA 4OI4A 1U45A 4WXWA 1BQMA 2VB6A 3HT3A 2G4BA 5DG9A 1NB2A 3JAMU 1VQSA 3M32B 4P10A 5ITHA 3TP2A 1EP4B 2A10A 4DV4J 3MMAB 1LK5A 2VG6B 2E9ZA 3VAMA 1XTZA 3JYTA 4F0MA 1D9FA 4WJBA 4KY3A 3VAJA 1HBOB 3KLIA 1YRUA 2BYCA 1LFWA 2QEXS 4IFVB 2CQGA 5J2PA 3OR1A 4B3MF 4OHXA 1YHQS 2RVJA 3FEYB 4DN0A 3L9ZA 2H51B 1DBDA 2ACYA 1NH7A 3IXQA 2J5AA 2CQPA 3UI3A 1VQMS 4X66F 1NDCA 3ZC4A 2WRMA 1OO0B 5FLXY 3QIDA 2X1GA 2OEMA 2CVEA 1AZSA 4CTAA 1SCJB 1JLCB 4I0WA 1UJ6A 3PHEA 2YWKA 2PC6A 3MMBA 1S76D 2HWHA 3W8PA 2XEXA 2CG4A 4WXOA 5CXTA 5CABA 4I2PB 1SIZA 4JI7F 3D4JA 4OHZA 1HPZA 1LKZA 5DQHA 2IBOA 4IOAQ 4UTGA 1KNZA 1U02A 4MYTA 3A3PB 1G1XA 1BHNA 2ZBQA 1S59A 1VBYA 4NWBA 2O66A 2C3UA 1HNWF 4ZVPB 1MSWD 2XSJB 1RWUA 1FDNA 2JEFA 3AB2B 2POKA 3IBCB 1D8ZA 2AP6A 3MR3A 1WHYA 1MLAA 1XJWB 1E6VB 4C11B 1UWBA 2X7IA 1JQGA 3G4SS 1Q8KA 1FRKA 3L95X 2Y1JA 4DCJB 2CXEA 2EFQA 3SFUA 2IYIA 2LEAA 1QJHA 1W7WA 4P74A 5D4OA 4DSLA 1RHMB 5IT9U 1H7XA 4HKQA 3EGNA 4EUVA 2DNPA 2IFXA 3LGNA 4I4BA 1TKDA 3FBEA 5K8OA 3TVKA 1GXUA 2RMLA 4XPEA 4NRTA 4MKVA 3NMAA 4L3KA 3GONA 2VD3A 1W2IA 1TQLA 2AYEA 2VQEF 2L08A 3DCAA 3MM7A 1GEHA 3DI6A 3PFOA 4KHPJ 2X1AA 3M2RB 4ZVTB 3U1LA 2HWTA 1RAHB 4JI2F 4QCLA 4LBIA 1V3ZA 2YQ0A 1QSLA 3CJ5A 2OPSA 4LF9J 1TKXA 2RRBA 2FVQA 3W2VA 3GE9A 1ZAXA 4QW9A 2QA4G 4ECXA 2EBGA 3M2VA 4ZPVR 1VHFA 4UOHA 4EU0A 3GSIA 2DNMA 5CA5A 2CZVC 3R6LB 3UDCA 4CZCA 2I5JA 3VQSA 2HHSA 2GHWA 5F41A 1TVRB 3AHPA 4PQUB 5AE3A 2ZBIA 1KVKA 2HEKA 3K58A 1LW0A 3HHEA 4BBYA 4BCAA 2A18A 2LVWA 4NLGA 1HNZF 3NGTA 2EKNA 1XNQF 2DNYA 3MMCB 1OSCA 4F3MA 2DB1A 1N5TA 3DU5A 1FDAA 1T9VA 3KLGB 3U1NA 3N9UC 4QR0A 2Z2ZA 3MM5B 3LW5C 4OL8A 2QTWA 3SI8A 1SUQA 5C7PA 2B51A 1F5CA 1R8CA 3D6FB 5CD4H 1KLMA 4OYZA 2XULA 4DUYF 3CCRS 2JC0A 2FZCB 2RJZA 3LGMA 3ONQA 1N34J 3TW0A 4Q8EA 1S6OA 3TA2A 1HIYA 1U6FA 4QIEA 4DL5A 2DO0A 1DTQB 2AYBA 4CT9A 2I9SA 3HFVA 2ZBRA 4AT1B 1IJFB 2C2EA 1RT5B 3OVBA 3M8PB 4J37A 3LALA 2Y0BB 2KH9A 1JLEA 1K44A 2L41A 1VRUB 1EJ7L 1PJ5A 2LFVA 5HBMB 2XLIA 1HR0J 5G4DA 4MT1A 1ZS6A 3W5ZA 1SJRA 4KKOB 2BQUA 1RT2B 3OQ2A 3V5RA 3MM8B 3UWTA 2F65A 3SQGB 3G6VA 3O1LA 2HZVA 3R1HA 4I2QA 3NWGA 5E0OA 1MWYA 1RJJA 3D1HA 1RTZA 4EWTA 2DGUA 2D3OR 5IWAF 3CULA 1H7WA 4UF4A 4Y2CA 4NLRA 3MXHP 1IKVA 2RS8A 2HK2A 2E5JA 2L9WA 3QO9A 5KAKA 2J9CA 4FNHA 1R8HA 4M5MA 3KJFB 2VPYB 1WF0A 5J1EB 3PYGA 4JBCA 4EGLA 2AGPA 4M5JA 4YY3F 4NLWA 3DRPB 2FTRA 2B9EA 2HIQA 4WE1A 3CDEA 5F8IA 3OFFA 4F4XA 5KG5A 3CC2S 1YTYA 2ZHAA 3QJPA 2KZMA 5H9EJ 1FHTA 5K8MA 4FKXA 1D0EA 5H9FK 3KOAA 4PUOB 5KT5A 2IC3B 2Y3YA 2EK6A 1U0HB 4X62J 3M1VA 3ZNUA 2CIMA 3PFEA 4JI3J 1K73T 2UUCJ 1ZM4A 1CSJA 3ADAC 1N36F 3ZZOA 1CVJA 2E9RX 3UDLA 4RUBA 2KKHA 3BKTA 2MHNA 1QSSA 4USWA 2CYYA 1WHWA 2CAJA 2WOMA 1HL6A 4I6YA 1G6BA 2RILA 3D66A 4USTA 5LMUF 3TJ9A 2HNYB 2KO1A 4ZVQB 5F3ZA 3GJQB 2QLJB 4KFBA 1T05B 2OMLA 3CJKA 4ED4A 1RAFB 1VYAA 3MEGA 1EX8A 2HHXA 1Q95G 4ALZA 2VASA 1VC0A 4USKA 5L9XA 3NGSA 3D3BJ 3MEEA 3HF5A 2C3YA 3WQPA 2P8IA 3HDSA 3TZXA 4KSEB 3HHLA 2IJRA 4OYBA 2Q66A 3IN5A 2E5LF 4DZ6A 1N32J 4QR2A 1HW9A 2AJQA 2GX8A 1RE1B 2PN6A 1WWHA 5T7LB 4B9UA 3N5BA 2CVIA 1YQHA 2UV8A 1YLXA 4NA1A 2DXEA 3DRRA 4MYUA 3Q8VA 2DXFA 7FDRA 1YK9A 1DLOA 1URRA 3KYLA 3GU0A 1UJ5A 1RTDA 4DR2J 1CJTB 4RUHA 1CQNA 1JKHA 4V19J 3R5CA 2M70A 3J81U 1HWLA 2CNOB 5D6GA 1REGX 3BF4A 3MM6B 2QSFA 3OHAA 3BZQA 1CQMA 3VAIA 4AXJA 2PI5A 1WC6A 2GHPA 4IFYB 4QQBA 4O3NA 3R97A 4ED1A 2BE2B 3U27A 2ZH4A 2E7WA 3E2EA 2R42A 4DSKA 1Y3KA 1N5VA 4B9SA 1IQTA 3A3NB 2KRRA 5E7OB 5EWGA 1WOOA 2VFVA 1RT1B 3TNVA 2EXUA 3PYFA 2HKEA 2DIUA 1EQ0A 5F8LA 3PV8A 2Y1LB 2D69A 3KJNB 2ZJPQ 5B0CA 1D3WA 3QSIA 4USIA 3HX9A 1CLFA 4ZDNA 1X5TA 1L3KA 3CSKA 3SFGA 1UCNA 2HBZB 2O3DA 3OLAA 4QWEA 3FFIB 2E5IA 4ZHRB 3H90A 3B82A 3POTB 5DGAA 3FMWA 4ICLA 1LWEB 3JQJA 2F8HA 4I68A 1G3OA 3I0SB 1RU2A 5BJRA 3R8YA 1X5PA 2R2TA 1J5OB 4O4GA 1RAAB 1YBAA 2E1AA 4DLGA 4X4PA 2RDDA 4K8RA 3GPAA 4J7CA 3NGDA 2EG1A 3R3TA 2K1RB 3MM9A 1M5OC 4ILLA 4LRFA 2KFYA 4P2SA 2LLZA 4O3QA 2QX0A 3ELHA 5IT4A 4AL5A 1U2CA 4P72A 3QFWA 3D6MB 3V2UC 3HSZA 2QL9B 1G7CB 3FEZA 1U6BA 4TQSA 4K5SA 2BV3A 4NA3A 4J9SA 3T1HF 3DRSA 3D0GE 3GIKA 2OTJS 3EYZA 4EBEA 4OJHA 5HP1B 2QT7A 3H5YA 4ES3A 4IO9Q 3M2UA 4QWCA 1X4GA 3MCMA 1JXEA 3I6PA 4OX8A 5DG8A 4G65A 2ZJRQ 3EVOA 1J5EJ 2FD2A 4ECTA 4J5OA 3NL0A 1KKHA 3W9HA 4F3OA 4CLPA 1HI0P 3GR1A 4YOEA 1YJNS 2BM0A 3MPWA 2ZNZA 2BJ7A 3FCVA 3NAHA 2R8HA 4IOBA 2D3ZA 2RD5C 2VDHA 3DYAA 1N33F 3QNWB 5IM0B 5L38A 4YQWA 2O1PA 3JTOA 4CP5A 3RJMB 1FDBA 3LH2S 4A8YA 1PJ7A 2MKCA 4DS4A 1ZM2A 2E5HA 2I2YA 4PYDA 1AT1B 3M9MB 2OPRB 4AYBD 2KZZA 3Q86A 2V34A 3LGHA 4PPDA 3PDNA 2HAFA 1SH2A 5LT5A 1GH8A 1FK9A 3BSNA 4M5HA 4DV3J 4CYUA 3KLEB 3OTCA 4ILMA 3ETOA 5DZ6A 1NDPA 2E1MC 2FVRA 4RU9A 1S1WB 2VC0A 2B8PA 1S6QA 1SKWA 4AFFA 3KLIB 4PQAA 1WI8A 3FQKA 1VRTA 2XMVA 2HFZA 4TY8A 5J2PB 3OR1B 3VVUA 5I3PA 2YKPA 1JJHA 1RQ0A 3KXDA 1Q5YA 3IWNC 4ZCKA 3LANA 2B9XA 1PAUB 3QBCA 2FVCA 3A8IA 2G1HA 1IM6A 3BYRA 1RTJB 4LF2A 5CAAA 4KIAA 4CTAB 1OIAA 5D78A 3MMBB 5ETSA 3EPGA 1C2PA 3H4DA 3K59A 4DX8H 1RWWB 4F8RA 3NS6A 1P6TA 2HHVA 4NPOA 1HPZB 5ETVA 1RADB 2V67A 5CYJA 3AT1B 1UEKA 4HYKA 1HQUA 1S49A 3CD5A 1XIQA 4WK1A 2QMWA 2LQJA 3CDBA 3BYPA 2B4PA 5D4NA 3A3OB 5D15A 2RE1A 2FB0A 3H40A 4TXSA 2K06A 2KG1A 2H5EA 3B54A 1R6VA 3DDIA 4UZCA 4A47A 2CJXB 1TV6A 1N5QA 2C2RA 1X4CA 1RHQB 5KT7A 3CPWR 4ZITA 2VHGA 3P96A 1UWBB 3N6LA 4H4KC 3B4MA 2AJ0A 2R7VA 4ZLNA 1SKSA 1QDUB 2A2CA 2F4VJ 2E9TA 1NK4A 1Z4UA 2HK3A 2P9EA 4HI2A 2HQCA 1RGVA 3Q8PB 4Y65A 1N5YA 3G96A 3TOQA 4K2JA 4C8MA 2XMUA 3OD2A 3EVWA 3C16B 4C0HA 1S1TB 4DCPB 1UWAA 2A3JA 5E5NA 5BYRA 1UA1A 2WVDA 1H2VZ 2Y1RI 3IS9B 1TL1A 5CYMA 3DMJA 4OX9F 4L6V3 3SCJE 2HHWA 4XO0A 1OYEA 4U7UD 1KC8T 3MM7B 3LP1B 1ICEB 1REVA 3DI6B 2YWFA 4DPUA 2VH7A 5ETMA 4NYPA 2VF3A 1IKWA 2ZE2A 3IAS9 2OPSB 2CZ9A 3KFWX 4TYBA 1TKXB 2C1EB 1SBRA 3W2VB 1FWKA 1WG1A 2XZTB 1SV5A 4OQJA 2XGPA 2GJFA 1CULA 5J2QB 1KDNA 2FHKA 4ZCIA 4B9NA 4JI4J 3SCIE 2CQDA 2I5JB 2CDQA 3QIPA 3PRDA 3RUBL 5KFTA 3IAM9 3T5HA 4WFZA 3P8BB 6FDRA 1YJRA 3CDUA 1TL7A 5DGBA 2BE9B 4YFUA 2MKSA 2NUHA 4B3SF 4O0IA 2QG9B 1RWOB 3ISNC 3ZTQA 1LW0B 3EUNA 4WU2A 2MDAA 3GYNA 3I55S 2CWKA 4MIAA 3QRRA 4OI2A 3BH6B 1KWMA 1ZM3A 3EZOA 4J9NA 2OP5A 3CE8A 3SSQA 4MKBA 1URNA 1WF2A 1RYSA 2ROGA 1KEKA 4B17A 2Z2MA 2R2RA 4YN3B 1SJ3P 2HFVA 2J0WA 1D1UA 4ANDA 2QN6B 4MIBA 2UVWA 5ETQA 4W92B 2NZCA 1KLMB 1P1LA 3KJQB 3GV8B 2FGOA 3ENQA 3DGVA 2XS7A 4QPXA 3ZTSA 2NLWA 4O23A 4F2SA 1HBMB 4B3TJ 1X7VA 4C3MA 4DPOA 5IQQA 2AWZA 3KUEA 2XWXA 2PI4A 1PIEA 2OSRA 4XIUA 3M6UA 2CPXA 4DL6A 1JLEB 2XLKA 2XY7A 1QTMA 3JAMY 4QU6A 1H73A 1W26A 1WJ9A 4QW8A 3MUTP 4LSNA 1PYTA 4PXBA 4V1Ak 4X4SA 2GIFA 4NCGA 1R8PA 3VF0B 4RWWA 5IS2A 3UR0A 4YB5A 3I5BA 4I2QB 1WEZA 3GFZA 3GIRA 1CJKA 3I56S 3D1OA 4RW9A 2XS2A 3FZ2A 1WKLA 3THPA 1HNIA 3GCWP 4KGZB 4O3OA 4OHWA 4K0KJ 4GVLA 3D2WA 3QO9B 1F2GA 4F4YA 5KFCA 4DR7J 1D8YA 5L9NA 1DRZA 2CA9A 2Y9HA 1H98A 1TU0B 2DPIA 4C9DA 3TA1A 2BA9A 3QGPA 1GAOA 1AA1B 2VPZB 1VI7A 5HMZA 3TR5A 4FKYA 2IBKA 3ENVA 3GP9A 1PJ6A 1LOUA 5KFGA 3HHNB 2Z8QA 3GTYX 2QE5A 1QUVA 2RH3A 5J1NA 2GO8A 4IG0A 3M1VB 5J2MA 4X4VA 1QAIA 4P2MA 2DH9A 1UVJA 4B3MJ 2LMIA 3B4DA 4J9QA 4MFBB 2CPDA 1NLKL 2WONA 3EX7B 3GILA 3A8EA 2JL9A 2KT5A 4UUXA 2MLXA 4RBVA 4LFAF 1YKWA 1S79A 4X66J 2R8JA 1HBNA 5IT9Y 3D9BA 4WFYA 5IOLA 2ZC4A 4PCQA 4JV2A 2EBEA 4F0KA 4ZJQA 2DH7A 3EE3A 4QYZK 4U95A 1QTNB 4NLDA 4TYAA 4DFPA 2WCXA 2R3VA 3QJJA 2N3LA 3CJKB 4JI7J 3MEGB 3J80Y 3Q2TC 4KTQA 2GVZA 1R89A 1JXLA 1FCAA 2GGPA 3E51A 3OJSA 3MEEB 1YRXA 2E1PA 4OI1A 5DM7Q 2WVFA 3HHLB 1OY8A 4FZVA 2UU9F 4L3NA 3L7UA 2B8QA 2F8MA 2GW8A 1S57A 1K9MT 4E8UA 2DD8S 1NBEB 5EN1A 2FHJD 5HQ8A 1S9EA 4ZOSA 2C42A 4ANCA 4TN2A 1K1SA 4UT4A 4DQQA 4BC9A 1DHMA 1RTDB 1AUSL 2MYFA 4LRCA 3I4PA 2FJAB 1Q8BA 3ZTPA 4XAKA 4EFAC 3NCPA 1FFGB 2RDJA 3R7SB 2AW0A 1RHJB 1RA6A 4DZDA 1UTAA 3HO1A 3KLFB 5DZ7A 5AXLA 4EI2A 5C2CA 3HULA 4C8LA 2R7SA 1TK0A 5LOQA 5DDPC 4G6VB 3A8KA 4ED2A 3RU0A 1YDLA 2H4YB 3JB9k 2VQEJ 2I6WA 1HQ2A 1Q53A 3WC0A 3QZ8A 2ZEJA 2AJFE 5D3GA 2JLFA 4KB7A 4JI2J 2GQQA 4RU2A 4CO3A 4Y2KA 4ZVEA 3W8GA 1V9OA 3G6YA 1NZAA 1XEZA 1FRHA 5HAOA 4WKRA 2W2QP 2OFHX 1GNKA 4NXNF 2WSFC 5I3UA 1BWEA 3RB6A 2F63A 1BGXT 1F5BA 4AL6A 1U2FA 4GC7A 4FF1A 4DMZA 3PR4A 1QAJA 2BKNA 2HRUA 1DURA 4ICLB 1HYSA 5JJBA 3ZZTA 1FI4A 1DARA 1S0VA 4O4GB 4A8XA 4CDIA 3NWRA 2AGOA 3L09A 3MM9B 1PG5B 1HNZJ 4DX6A 2LKZA 2KT2A 2V8DA 3CMAS 1XNQJ 4TQRA 4CNYA 3EICA 1SQFA 4ZPCA 3W66A 4M5KA 1TMMA 4QWAA 5L1LA 3ZFVA 2R7QA 4NA2A 3Q8QB 5KT3A 1F3VA 4OYPA 2O5DA 2W2MP 4IRCA 1VQYA 3DRSB 1VQNS 1PCAA 2FJXA 3E01A 3TAPA 3DKDA 4DUYJ 3NG8A 4HH1A 3AXKA 4ZS6A 5C24B 4V19X 4FBUA 3M2UB 3NY0A 2RQ4A 5CCLA 2EVZA 2ZZTA 4ITSA 2VG5A 5J1PA 4D3HA 4DL7A 2MLZA 3MCNA 1RA7A 3JSMA 1HLWA 8ATCB 4WTOB 3B6BA 1FKOA 1Y3JA 1EP4A 2A2DA 3MMAA 3NGRA 1RYRA 2DRBA 4F2RA 3UW1A 2FJDB 2JEIA 1ACMB 1WNEA 2VA2A 2W2NP 3I31A 4WYWA 1RB0A 1FNXH 1RWKB 3CCTA 3M4XA 1OPZA 1DTTB 4DJBA 3WX4A 1ZZFA 2Y0SD 3JS9A 3RTVA 4J9OA 3WC2A 2BANB 2XSFA 2OGUA 4KO0B 3D67A 3EJMA 1TR0A 1X4BA 5DQIA 3CCZA 4ENOA 3EXCX 3BM7A 4X65F 1ZETA 4LSZB 3NBPA 2R7WA 4LIRA 1FK9B 5IWAJ 4ECUA 1AROP 5FJ4A 5I3QA 4X4TA 4U9RA 4LMZA 2XNQA 4O44A 2QLXA 1VIXA 3UVJB 1S6QB 3CCJS 1S5ZA 3ILIA 4I56A 1VBXA 2IMOA 5B09A 2XMWA 3IR7B 3TZYA 4YY3J 5JVHQ 4FPRA 4TY8B 5MLCV 2F8EX 1UZDA 1YITS 2JC1A 5LMNF 2FJEB 1U47A 1FTRA 2DR8A 3CCQS 1VRQC 4FYVB 3HVWA 2DHHA 1N0VC 1SC1B 3BH7B 3BS9A 3MZIA 4RLEA 2ZH6A 2VOPA 3T1YF 2UVUA 1HKAA 4C97A 2E44A 1WC1A 5AJ3F 1UW9A 2YH0A 6FD1A 1UVKA 3ENAA 1YI2S 1JB0C 5M2UA 4ECQA 1YJTA 2OUGA 4XDCA 3BQ1A 1K8AT 2YNFA 1MMLA 3WIUA 4ZJOA 3MAQA 1UVIA 5HMYA 1HQUB 4CO4A 1NK8A 2MKIA 1W2BR 3NXZA 1X0FA 4Q8FA 5LMUJ 2IMWP 1SC4B 1FJEB 3J81Y 2MJNA 1KBRA 2OAUA 5K20B 4MMOA 4UOFA 2RNEA 2MQLA 5IT0A 1ZA2B 3H5UA 3RR8A 3AQPA 5F0UA 3G9CA 2YXLA 3TUPA 1NK7A 1A7GE 4E0DA 4QOTA 3JSRA 1TV6B 3KHHA 5ADZA 2DH8A 3T5JA 3M2RA 2HIYA 1N4LA 2OFGX 3ICLA 3OVSA 4OV1A 1WTBA 1VK3A 2ZNYA 2CPHA 4NLYA 4R0EA 4C8OA 4RUAA 9RUBA 3I9ZA 2W25A 4WFXA 2J6TA 2E5LJ 2EI5A 2KYXA 4CLYA 1ZH5A 2CPIA 2VFSA 2BEFA 1HI8A 3E8OA 3S7RA 3T1AA 1HWJA 4C7QA 4DU8A 1U6ZA 1U1NA 2H54B 4URSA 5D77A 1TL1B 5CYMB 2KXHA 5MAOA 3OL6A 3DMJB 5I42A 1NJYA 2XI3A 1X9SA 2FY1A 3OJUA 1IWAA 2V9WA 1NJIT 3BGOP 4YS2A 2XMJA 5KFDA 2D41A 1IKWB 2LQ9A 3ZTOA 5CHCB 2XBPA 3BQ0A 1YGYA 3MR6A 5KT6A 5H9EK 4F26A 1CJVA 2J6UA 1S6PA 2KM8B 2ZHBA 5GAEI 2OTLS 2HNZA 2DEJA 1QM9A 1XK8A 1CULB 4IRKA 5BYSA 1B64A 3I32A 4C0BA 2BE7D 2ZDOA 3HZGA 4RR5A 1NZ8A 3QIPB 3JTPA 3MR2A 4CT8A 4ZCLA 2C2OB 2G0IA 4ELTA 4N47A 4DPYA 3G87A 2EFNA 4HTIA 4HI1A 4O3PA 4ZVOB 2KXFA 3DOKA 2UUWA 4MK7A 3ZZYA 4DQIA 4DFJA 2ASYA 4WCEQ 3RAXA 1UFLA 4ZPAA 2HGMA 3EGWB 1RT5A 3O6QA 2IJNA 4Z7YA 4ES2A 1WC4A 2K8GA 3LF0A 2E7VA 1VISA 3F73A 5IXUA 4M1KA 1VRUA 1HHQA 3AODA 4TU8A 3RBEA 4WF9Q 2HHUA 2P6TA 3MPYA 4DL2A 3OFGA 3K89A 1VQKS 2CNNB 1F60B 1JJ2R 2XYPB 3QZ7A 1FVSA 2FJVA 3OXGA 5CZXA 3FKBA 3IG1A 3GJSB 5CD4A 2U2FA 4O4RA 1CC7A 3QMQA 2ZBCA 2VJUA 5JXSA 1TKZB 2V8VA 3PKMA 4DR4F 2C2ZB 3ZZUA 2F40A 2J7KA 3N6NA 3PEHA 3T1HJ 2M3DA 1KD1T 1FE4A 4WYLA 1FEEA 3VHQA 4KRWA 2B7BB 3MR7A 1RAJA 3N4WA 4HDHA 4MK8A 4B9MA 1NDLA 4DR3F 1UFWA 1BY9A 3C6TA 1E6YA 1U7LA 1U1PA 4NCGB 4OYXA 1RAIB 1WSRA 1A6LA 1JNRB 4A4JA 2JEGA 4ED7A 4PUOA 1U09A 3OHBA 4LR9A 2Q3PA 1CJKB 3S01A 2YKNA 1VLYA 5CZVA 5HJYA 2YH1A 4E2FB 1RXOB 3TRGA 3W9JA 1KVIA 1WC5A 1HNIB 4J9RA 1RABB 3W3SA 3RZAA 1N33J 2XLJA 1JMTA 2J0QD 1KONA 1CG2A 4LBPA 1KVJA 2A6OA 3CJ4A 2IM1A 1WOSA 4FVMA 4USHA 5GAGU 2VC1A 3VV2B 3SQOP 2PDAA 1XQIA 2YQ3A 3D68A 1RBAA 3SSSA 2NYHA 5CCMA 1F9EB 2HNYA 4K59A 4CRJA 3V4IB 3BBBA 3DDNA 3U02A 3QSYB 3PW4A 2FLPA 3C8YA 3P5TL 2KRBA 4H4MA 4NL5A 3NRBA 2HLUA 3QLHB 4IG0B 4CLSA 5J2MB 1F2HA 2IYGA 1LW2A 1O8BA 4U8VA 5C2GA 4AQYF 4DQPA 1LWFB 3LPEA 4EYHB 3LWMA 3BPSP 4OZ3A 2DVIA 1EETA 3BV8A 2HVZA 1HBNB 5HMXA 2LQ8A 2DNKA 1Y4ZB 3J7Z5 1YSJA 1MWZA 2BX6A 2YX7A 3H25A 2ROPA 1NK9A 2B4OA 1M5PC 3S8SA 3I5AA 4NZ6A 2MZJA 5HATA 2Z58B 1RT6A 3UN5A 5B0GA 2GVZB 3CMES 3K0JA 2GGPB 4CIOA 2CUYA 3RB4A 3QGIA 5KFPA 3W1YC 1ZBTA 4UY8T 3D28A 4YDXA 2BOAA 4ZA1A 3PVXA 2XZWA 3R5BA 4DPWA 4PXCA 4M5LA 2YBVA 2K7JA 3H42A 3IBWA 3IMQJ 3VAHA 1K0VA 2W1BA 4NLTA 2FJBB 4DFKA 1U1LA 1RBLA 3QYYA 1S9EB 1RT1A 1X60A 3GYGA 3THVA 1I5OB 1BQXA 1YX2A 4CH0S 1BE4A 1T9YA 2MZRA 3RB3A 2CQ3A 4NYOA 4NLPA 2YY3A 4BLGA 2QJ3A 4OYMA 4OZ2A 1FJGF 1PAEX 2H5JB 1T9UA 1JIHA 2F7VA 1CEZA 2JEJA 1VQPS 2N7CA 1Q79A 2LDYA 2RIJA 4OX9J 2KTQA 2UUBF 2HQGA 3GG0A 3DXBA 3EXYA 2Q79A 2V0NA 4W90B 4LT6A 1TAQA 2CKWA 5D3GB 1KTQA 4HVZA 4DPTA 2DY1A 2QGFB 3DC2A 3DOLB 1UW4A 3CCES 2M8DB 3HD1A 4DPXA 3PTWA 2LQ5A 2YKOA 5HVFA 3L7OA 1S10A 1LFPA 4LF9F 2F9DA 3N01A 1XMOF 4Y2IA 3TWZA 2C28A 3AFGA 3CC7S 2DKOB 5I3UB 1WORA 2V94A 3BGLA 3CJRA 1GXTA 3FJ2A 3VGTA 3GFYA 4WZMA 4R8UB 4QYZJ 1EHWA 4WFBQ 1WG4A 1NAQA 2UXDF 3VQTA 1HYSB 4DV1J 2Z30B 1SC6A 3R7BB 5IC6B 3DM2A 2BUNA 4B3SJ 1IXKA 2ZH7A 1ZZNA 4DR1F 3CJQA 4N56A 1JWWA 3AB4B 4YHHF 1UFKA 2Q6CA 3N79A 4BS2A 1Y00A 2YPZA 3CMQA 2G0CA 4K4YA 2XS5A 3X1LB 2HQ3A 2C3MA 1CC8A 2XI2A 4RBTA 2R7TA 5IM0A 4OI6A 5B0AA 2YNGA 4Z7CA 4AD6A 1PO6A 3LA0A 3MECA 2JLGA 4IR1A 2HNDB 5F9NA 1X5SA 1RZMA 1X9WA 2YVSA 5HQMA 3R27A 2QL5B 1HD0A 2VBYA 1T3NA 5A8KA 3DLBA 5EX0A 2BR0A 4L73A 4OJ3A 4M5IA 4HTJA 2LEBA 4PG8A 5IV3A 4A8FA 4EO6A 2MGZA 2FHOB 3KWMA 4JI0F 1NRKA 3JSMB 3KLEA 1FKOB 1PKUA 3QT5A 2M9KA 4HT5A 1S1WA 4GKKF 2JRSA 3NOGA 1SH3A 1C1CA 2HFOA 2PMHA 4ZPTR 4IQMA 3TVYA 4F04B 4MTPA 1VQ7S 1NNDA 1R0AA 2NQPA 5D0HA 2ZFHA 3KG4A 1QAYA 3GB0A 2KN4A 3PJWA 3MFHA 2Y8WA 1K1QA 3NKYA 4EK2A 2FVSA 3QGGA 5ETTA 4ERDA 1RTJA 4LVOP 3UD5A 2XCAA 4O3SA 3K5MA 3OTOF 3H98A 1KR4A 4N5SA 3NBPB 1RAEB 1VHIA 2UXBJ 1T9TA 2UZAA 4RW8B 5B08A 1P8GA 5F8JA 2K2PA 2F3JA 2J7UA 3QPIA 3BBFA 4LFBF 4DS5A 4O44B 2RQKA 4ZMMA 2UUAF 3KHRA 1SB6A 2W01A 3KK2A 4FF3A 3H5SA 4RW7A 2AYGA 4LQ3A 3CO9A 4OYAA 3GZ7A 2X1FA 1MMDA 2W8LA 2ZWOA 3H8YA 2XMKA 1VLOA 1DQAA 2ZKUA 2C2NA 2R8GA 1ZM9A 3HSJA 1QY7A 1EAYC 1S77D 2BBEA 3AOCA 4KQZA 4B3OA 3DLKB 1ULRA 2W9BA 2WW4A 2NZ4A 1TZ0A 3A12A 1QVFR 2YTCA 2VZ9A 1JJCB 4U67Q 1IWGA 3NS5A 4UQGA 4YR0A 4Z2XA 3NAIA 3GV7B 4P71A 3AQOA 2YNFB 2IVYA 1HWUA 2H5IB 3SDEB 4LFAJ 3WIVA 2E1RA 2MEWA 3JQKA 4IO1A 3C16A 1S1TA 1TL5A 3Q23A 4FS2A 3ZXWA 3J80U 2KYZA 3IS9A 3D5MA 4Q43A 3RRKA 2QA1A 3BBCA 3RAMA 3W2WA 3R2CJ 3QT7A 2MZ1A 5HK4A 3LP1A 5HQLA 3V6DA 2Z2LA 5E33A 2O01C 1QAXA 3P3DA 3PHTA 2DGWA 1RWNB 1B0VA 4FYWB 1AFJA 2AYMA 3UD3P 1FTCA 2MZTA 2PMWA 4HHHA 1SJFA 1G2EA 3IM9A 2AGQA 3VZIA 3HHLC 4A8MP 3DDKA 3T5LA 1AUDA 2P9CA 1ZPVA 5J2QA 4W4MA 2GC8A 3H2VE 1C0TA 5KTQA 1WUUA 2XY6A 2ZH1A 2BQRA 1H6KX 5DM6Q 7AT1B 5I42B 3QATA 1JLBA 4LFCF 2P9GA 1TK8A 3CWJA 5D0RA 1O6XA 2R9LA 3C15A 1BC6A 1C0UA 4G1IA 4MKYA 1RKIA 1FDDA 3A1YG 1CJVB 1S6PB 2HNZB 3ISND 2RAQA 1FX2A 2BDPA 2UVVA 3FBFA 1KQKA 3AD9C 3UDVA 1IBKF 2PE8A 3X3UA 2WTFA 3G8SA 2EC2A 2JJ4D 4C98A 4U96A 2MY7A 3KUGA 2XM3A 4QJVA 3MI7X 3TJ8A 3OR2B 3IGVA 1CS4A 2QYCA 1ZA1B 1HBMA 2V8HA 3DOKB 1LWCB 4NXNJ 1RUSA 1FXRA 4IR9A 3FK4A 2HQFA 4IUFA 1U24A 1QUPA 1M5HA 1D9DA 4I1TA 2DHXA 2QFIA 2EFVA 3JSBA 4BDPA 4CO2A 3F0NA 2E1CA 4ES1A 4MJKA 4Q5VA 2UP1A 2NPIA 5KFFA 3BO2A 3P5BP 4RBUA 2ZWPA 5LJ3Y 1VQOS 1FJ7A 1EKRA 1OQ3A 2QV6A 3IG1B 1U26A 3QGHA 2ASLA 2AEJA 4X64F 2E29A 1DZ5A 5GAHU 4RPFA 2V2ZA 2ZM6F 3PACA 1FFSB 1EZZB 1NPRA 3H2UB 4TVAB 5HMWA 4ECYA 5GAGI 4UY85 4DXLA 4NZ0A 2YX1A 3VVTA 3MCSA 2Q6BA 3MAAB 1JNZB 3R5DA 3KK3A 4L72B 3AA9A 4C6AA 4ID8A 4OHVA 3LWLA 1X4HA 5IC4B 3M8RA 3QWUA 2WSEC 3J7YI 4HACB 3PX6A 1GK8A 3IRWP 3EWGA 3BQ2A 2JH3A 3KNAA 1S72S 1FE0A 3C6TB 1E6YB 1UPPA 3MR5A 4C0OC 1YG0A 1NH8A 3GMGA 3EZ5A 1SC3B 2BW2A 2IM0A 2RQMA 4EO8A 3BSCA 1OS5A 2F9JA 2VBWA 1VQ5S 2L3MA 3PKYA 4FDFA 2OPPA 2YKNB 1SQGA 4EBCA 4KPYA 2CQHA 3M6WA 4L74A 3RYLA 3OSPA 2MZQA 1ZAWA 4ZVFA 4F0HA 4MFBA 2D9PA 2A0FB 4LJMA 4JUZA 3MAHA 4P9SA 2OLWA 4F25A 4FXVA 1IUJA 3T19A 2NSBA 4KBIA 4JI8F 4DV2F 4KHMA 3Q83A 3NNCA 2V50A 3SSRA 3GIMA 1RCOB 1H2UX 1VGYA 4ZIWA 3MCOA 4K4SA 4DWIA 2CJYB 1WI6A 1NB7A 3PCOB 3UE2A 4RNMA 2BQ3A 1Q1KA 2QIFA 1IQZA 3IWXA 1UVMA 4H4MB 3ULHA 3UDEA 3HM9A 3TQ1A 3Q8UA 1HWKA 4ILRA 4FPIA 1LW2B 3TUJC 5DDQC 2DO4A 2YWGA 3PW5A 3OSNA 1KQSR 4YR2A 3SV3A 2W9CB 4J9LA 4I6WA 5LMNJ 1XR6A 3RBZA 4ZIVA 2WW8A 2DNGA 4OFZA 1T94A 3O2IA 4JI5F 4WTYA 1Q8LA 1F0XA 4M94A 3JSYA 2Z56B 2UUTA 2W8KA 5L1KA 1EETB 3HT0A 4KJIA 3PG9A 2CJ9A 3UCUP 4QR1A 2DHAA 3T1YJ 4R0JA 3OUYA 3BGUA 2GZOA 5AJ3J 5DQGA 4RW4A 4NMXA 1WEYA 4QIFA 1YBUA 2G2OA 1RT6B 4WKYA 5FD1A 4ANEA 3KLFA 1U4BA 4LF8F 3SCKE 1L3VA 2KDOA 2HS3A 2ZVSA 2QFJA 2H4WB 3HSDA 2CQ4A 3MTJA 2CQIA 2FJWA 2KVQE 5DETA 4NLVA 1KN6A 1VMBA 1ROFA 4PABA 5HANA 5AT1B 1VR6A 1WHXA 5J2NB 5EWFA 3W9IA 2MQMA 3IO1A 4I69A 4PZVA 2N3OA 3UR3C 1SJ4P 2GVDA 1DY3A 2NXNA 4TLRA 2UV8G 2PD1A 2VDIA 1NJWA 2F4FA 4UZBA 1IM4A 2PEBA 1IN0A 3PXGa 1R0BG 5H1SV 3RBDA 3N6MA 2DPJA 1FRXA 2C22A 2UXCF 2YKMB 2GJ2A 4LUBA 2QA2A 4RL1A 5D0EA 2C2MB 3HZEA 4I67A 5CQGA 4K4XA 2W4CA 2HURA 4AUKA 3CCMS 1UPMB 1NJZA 1HMVB 1T9XA 3MWBA 1DAXA 3AJDA 2CJAA 3W64A 1JLFB 4RO0A 3GG1A 4ZVGA 1DQ8A 1L3SA 4JI6F 3C3LA 1RI7A 2MSTA 2HVDA 1XMBA 3UD4P 2LCWA 3HPOA 3TX8A 7FD1A 1O0PA 1R8AA 3KTQA 4LF5F 4KV8B 1HBUA 1UL3A 5E3PA 3ZZZA 3CCSS 1X8DA 3AOAA 3M9NB 5K9FA 1FKAF 1C1BB 5KFKA 4FF4A 4OZ5A 2H3EB 1VCTA 2VBXA 3K7RA 4Q45A 2CZ4A 3L7PA 1SXLA 1N52B 4PYAA 2KM8C 5LXYA 2HGNA 1FRLA 4F4AA 3F41A 1N6QB 1GQEA 3F44A 1OYDA 1AFIA 5C24A 4CI0B 3CXCR 3DM2B 1GT8A 3T9NA 2ATLA 1WKKA 2HBYB 3A4TA 3M8QA 2MSSA 3TANA 2SXLA 1XNRF 4LIWA 3S1TA 4OZNA 4OZ0A 2IRYA 2VODA 1U25A 1IKXA 3MDFA 1OWXA 2CPZA 1WACA 4DV5F 5IZHA 3LAKA 3NS7B 3M6VA 2YWEA 2NPFA 4DU7A 3R6GB 2RB7A 3P4UB 1DTTA 4ID5A 2R7XA 2YNGB 3CC4S 2WVBA 3MECB 2VA3A 3R5AA 1SJQA 2BANA 1B3TA 3FBCA 2R4FA 4CCHA 3SV4A 4KO0A 3LPYA 4RUCA 1NDKA 4HR2A 3DU6A 5ETLA 5LXRA 5A8KB 1Y11A 2IHR1 2MKYA 5M2PA 1U1OA 1AB8A 2QLBB 4PG6A 2MGZB 1L3TA 4DR4J 2B0GA 4MKAA 4YB1P 3QRQA 2IM2A 4JV5F 2G1DA 1T03A 1FO1A 2K3KA 1X5OA 3UVJA 2A1BA 1KS2A 2ASDA 1C1CB 2HAIA 1T8EA 2J6SA 1T3OA 3GQCA 2MJUA 2MPUA 5E2QA 1R0AB 2MHEA 4A8KA 2AQ4A 4FNIA 2CFXA 3MPDA 2DNHA 4ECWA 4DR3J 1OSDA 4YDDB 3CCUS 4H54A 2IA0A 5KFAA 1UVNA 3DFEA 3AXMA 3SBMA 4RW6A 1SH0A 3V4MA 3DRYA 5KFVA 4GC6A 3UCGA 3KLHA 1RTHB 3SXLA 2CADA 5IQ6A 1VIOA 2ZHOA 3IR6B 4JI1F 3UN2A 3FRZA 1TK5A 1N56A 1S4EA 2D1CA 4X84A 4KGMA 3MTKA 2BJ9A 3Q24A 3KK2B 4RW7B 2XO7A 1AW0A 3CF5Q 2FLOA 3OTDA 4WP9A 1BQNB 2FQQB 3ITHA 4L75A 3D54A 3CUNA 4NMLA 1RSCA 3BSOA 1KSPA 2X51A 4RWXA 3GSDA 3MOZA 2K3IA 4B3OB 3MGJA 2W9BB 3RRHA 3I0RB 4USVA 3H2LA 1MW7A 5CYQA 1GX6A 2WAQD 4ZN1A 2C2DA 3AD7C 3ZZRA 2KFNA 3FVYA 2MLYA 2MB0B 3MHYA 4PXDA 2J9EA 4LSLA 4AQYJ 1Q78A 5BR8F 5HJXA 1PILA 2HSEB 3PZPA 2N82B 2EG2A 2AMCB 3P45B 5A76A 3I82A 2FZKB 2E5GA 3DLJA 4OYOA 3PJXA 2ZKTA 3S6EA 3W5XA 2EFGA 5KG7A 1RHUB 4ZK7M 2DY9A 5EDWA 1MMNA 4PPZA 2XZDB 5HROA 5KG3A 1RP5A 2GIRA 3W2WB 2I0XA 1FD8A 3VTIA 3CJ2A 3BGFA 3R2DJ 1SKUB 4JB8B 4Q0BA 2B6AA 3V6DB 3MEKA 5JVGQ 3O5TB 1B99A 3QT8A 1B7FA 2VG7A 4J90A 4B9TA 4BC7A 1VK8A 2FHJA 2R7UA 2Z2YB 4LF6F 3IP0A 3DOMA 3G8TA 1VS3A 5KFJA 3CW2C 2CQ0A 2QL7B 4DR5F 1OY9A 1EARA 4LREA 3PO4A 3LP2A 1WTFA 2B9YA 1RWVB 3DGPA 3FSIA 4I64A 4QZVB 1DJ0A 1C0TB 1IBLF 4QPTA 2HVHA 3TEHB 1IJEB 3QJLA 2YX4A 2F1FA 2EEYA 1NSQA 1APSA 2XWYA 1JLBB 3BO4A 5HI7A 3AY0A 3TAQA 4KH1B 3DN9A 3PX0A 3BGRB 1YRTA 2XTJP 3C15B 4NRUA 2LDIA 3PIPQ 4ED5A 5KFZA 3HP6A 3MD3A 1C0UB 3LQVA 5DLGA 3CD6S 2W4PA 3MURP 4M5DA 2OEKA 1FJGJ 1Y0HA 4GKJF 3CD7A 5ETNA 3RG6A 1W25A 2OH2A 4ZVUB 2KXNB 4B9LA 1RCXB 2HPUA 2UUBJ 2M5YA 5HL7Q 3TO8A 1BUXA 4GRSA 3CJ3A 3O8WA 4DDFA 5FIIA 4JYAF 2E7XA 2ROEA 2GS8A 3G82A 5B7WA 4ECSA 1IBMF 3ILJA 2RDIA 5GAHI 2HHTA 5F3TA 1MROA 2N7YA 5D8HB 4F4KA 3ZNJ1 1NSAA 4FVCA 4CO1A 4OI0A 1JJ4A 3EDRB 3RBXA 1CS4B 1GMUA 1TKZA 3KLVA 2RF2A 2HYIB 1YJUA 1XMOJ 4DEZA 1PC5A 3GWCA 1WDTA 5D4LA 1WSVA 2G9OA 4ZLPA 2WB4A 2XQCA 3R5JB 2ALYB 2AD9A 4A46A 4PWUA 1S9FA 1XC9A 2V9KA 1OQ6A 3D6TB 2A6MA 1N8RT 2UXDJ 1RU1A 4C2MA 4GVBA 2H48B 3DHXA 2W24A 5IFMA 1RAOA 2QMXA 1RKJA 1NK5A 4DR1J 1T7PA 2G2YA 3CGIA 5KFNA 2HHPA 2VJVA 4CO0A 3NOCA 1BD6A 4YHHJ 4QIVA 3B8HA 2HQDA 3KUHA 3T3FA 4NX9A 2OMOA 3BPDA 2OIHA 3K5PA 3UFCX 2UVRA 2HLTA 4CO5A 4AXIA 1TELA 4NXMF 1GMWD 3KK3B 1VDHA 3Q8YA 4F50A 1YJVA 2Z57B 1S97A 3W61A 4DV6F 1FWPA 4ZKAA 1ZTTA 2V8GA 1N88A 4J9UE 3W7BA 3TAMA 4WZQA 2B56A 4FP9A 4U7UK 2PEHA 2W7PA 3V4IA 1ELOA 3IGNA 1SQEA 1WOPA 3GIJA 2NXEA 5D0GA 2QC3A 1XR7A 4JI0J 2M7SA 3ENWA 5B0DA 3OT9A 4LR7A 4NLSA 3QLHA 1S1VA 4G1QA 3MMJA 4GKKJ 2OPPB 4KC5A 1FRIA 4P73A 2MQQA 2CWXA 2J0XA 2JWNA 2IVFB 2AF6A 4Q44A 1LWFA 1GTEA 4U8YA 2HRYA 3C66A 4URGA 3CTRA 2VFRA 3ET6B 4N8OA 3CDAA 3CD0A 4FYYB 1GMVA 1S1XA 4B9VA 1FX4A 3NGKA 3OTOJ 4WPAA 2FLLA 1HQEA 2OEJA 2Z0GA 3P6YC 2R2UA 3QAEA 2RQCA 2P2CB 1Q7YT 4B3RF 3V81B 4OHYA 2FGCA 3UNGC 4LFBJ 2AZ1A 4DSIA 1BWVA 2UUAJ 2V5HG 2J0SD 2KFZA 2XHCA 1WELA 3PYDA 2CQBA 4B08A 1HNWJ 3J7AN 4NCBA 2DNZA 5DG7A 2HFSA 4I7FB 5JUMA 4KHRA 4PXEA 3PW0A 2LU1A 3H59A 4K4VA 3CCVS 2CQ2A 2L9DA 1ZTWA 2RRNA 3OL7A 2DHGA 1F6TA 1F9FA 1MWQA 1Q5VA 4KR0B 3EMTA 3FGVA 4AL7A 4K4ZA 4LF4F 4RZRA 2GMHA 2J9DE 4OLPA 1PYOB 1D09B 1FXDA 4Z37A 1U8WA 1FEHA 4K5RA 1KFSA 3NLCA 3OUYB 2J7WA 3NNAA 1YBTA 1XBWA 4RW4B 4CLWA 3UQSA 1M5KC 3OPKA 3KK1A 2HVIA 2DTJA 2QA4S 1Q16B 4ER8A 4MH8A 3IFEA 4ZPBA 1AXQA 3MFIA 4N41A 4LRAA 2MKJA 3OL8A 1OJ4A 4I6AA 3JTNA 4XDDA 5L1JA 1RAGB 1P9YA 4IH6A 3V6HA 3MD1A 4XTTA 5A8WA 1PYSB 1FD2A 5HLFA 4HEA9 3VR1A 4PR6A 1B0TA 2GVDB 1Z2ZA 1I3OB 4IH5A 3DOLA 4ZVSB 2HBRB 2GFFA 1EKSA 4IKAA 4DX5A 1FRMA 4NLUA 2YWWA 4A48A 1YJ9S 4DQSA 2HWIA 1B0PA 3W60A 3N0VA 4NYZA 5GADU 2FYXA 5ETKA 3LP0B 2HGLA 2P6SA 1WEXA 4ZJLA 1A9NB 1U1RA 2FUG9 5IV4A 2IIHA 2BOPA 4F02A 5DO2A 2FY8A 2GCFA 1XMQF 4DSFA 3K5NA 4R8UA 4NZ7A 4DL0C 3GLJA 5A0YB 2HHHF 2V63A 2VV5A 2OI2A 1Q7LB 2VONA 4LFCJ 2M8HA 2CPEA 4HH0A 3EDQB 4P75A 1I94F 3VWSA 3AJ1A 3G8QA 2PGCA 1HBUB 4LF7F 5KOWA 3GFHA 2ZUGA 1SL2A 2IA6A 1U2RA 1TL3A 1S1UA 1TFWA 1NPKA 5BYQA 4HLBA 3ZZ0A 4OMFG 2YNHA 2M4MA 4CH7A 4RNOA 2GQ2A 2C2KB 2H9ZA 1IBKJ 2J76E 4G3IA 2IRXA 4GO5X 3OFHA 2HNDA 4ETZA 2DGSA 3H4BA 1FJCA 3M9OB 1HNVA 2O67A 3MPVA 3QQCD 4WU3A 3HD2A 1JLQA 5M2RA 3TQEA 2IDLA 3M8QB 2PO4A 1H2TZ 1KQGB 4LBHA 4URQU 4ELUA 2BJEA 3DLGB 3JXOA 4DR6F 4IDKA 1F1BB 2JLEA 9ATCB 3NCQA 1IKXB 5FDLB 4DOZA 2C3PA 3A13A 3GJRB 4LF1A 3Q2SC 4B02A 4WIQA 4F4WA 1QD1A 4P2XA 1N54B 2RRAA 4ID5B 1NK6A 4DV7F 2IDEA 5E3QA 3PEJA 3O44A 2HFNA 3ZO7A 3UPFA 4NASA 4TY9A 2MXYA 1M5VC 2RUSA 2QZ8A 4C8YA 4OI3A 4X64J 2QLWA 2APOA 3R5GA 1NKEA 2ZM6J 1HWIA 1IR1A 1PGZA 4RW8A 4PWWA 4KYZA 1S48A 1T95A 4DI6A 1T03B 4M95A 1OMSA 2YQ1A 5GVQA 2F5GA 1U0SA 3CCWA 1H0HB 2AEFA 3KJVB 4RX6A 1KRPA 4KGXB 3TEGA 2JDJA 5KG1A 2AU0A 1R0CB 1RLCL 3AJ2A 4A8OA 2MKKA 1PC4A 1Y7PA 3OTEA 3ISZA 4OZ1A 4DL3A 1RT3A 3DLKA 4DBQA 2V4RA 2HBQB 2VPXB 1RT7B 4RW6B 2MQPA 4F7VA 3CJSA 1IBCB 5K14B 4IH7A 4YEAA 4OYWA 3KLHB 4NEZA 1VQ9S 4PG4A 2DCLA 2IJFA 3MUMP 1N36J 4ZN3A 3ZTRA 1T0TV 4X4UA 3C14A 2QSWA 1YJ7A 3CT9A 2V2VA 4HL9A 2KG0A 1JLAA 1LWXA 3SDEA 1HHSA 1Q0NA 2AEMA 4JI8J 1WKJA 4DV2J 4UW2A 3C2PA 3L4BC 3ITHB 3BN4A 3G71S 4TU9A 2ACMA 3PX4A 1HI1A 4JP8A 4DCOB 1O51A 3IM8A 3Q8SB 2BRKA 5SUHA 1NM2A 5EUHA 5C42B 4G1PA 2ALZA 3UCZP 4C3KA 5CYQB 1BQMB 5KFYA 1L3UA 3CVKA 2ILZA 5RUBA 1T11A 3U7JA 1NSPA 3D0IE 2BVZA 3KG0A 4LSLB 3BEGB 3JYTB 3OXFA 4JI5J 2XYHB 5HO4A 1FNOA 5KFIA 3DHWC 4FXDA 2VFUA 3IRXA 5CH7B 2R2SA 1CJUA 2DT9A 4USJC 3C46A 1R27B 3K8WA 4ECRA 3CDWA 1IR0A 4RNFA 3RB0A 2RKIA 2CNLB 5HROB 3HHLD 3ZZPA 1AZSB 3HMJG 4Q0BB 2B6AB 3C6UA 2V2QA 1VQ6S 3PJ9A 4Y34A 3HI9A 3FQLA 4Q2MA 2VG7B 3VAKA 3M05A 2XMAA 2PFFB 4LF8J 4M8LA 2VQFF 1O5JA 4U6PA 1K47A 4DV0F 1NK0A 3DOMB 2JSXA 4HDGA 1UEUA 4PWDA 2ZH3A 5HN0A 2AV5A 2DGVA 3OL9A 3TYTA 4ZCMA 4J9KA 5KFOA 3WX8A 3PNIA 3LP2B 4USUA 1VJQA 2HMIA 3DGPB 4OIXA 3JQMA 1FKPA 1KFDA 3EGVA 4R5PA 4FXWA 1QE1A 1KTVA 4ZPDA 3GR0A 3CNQP 1HNXF 2CPYA 3OR2A 3M8ZA 3NGUA 2UXCJ 3D0HE 2R8KA 4CLTA 3VGUA 3K17A 4Y3CA 2YKQA 1LWCA 2ZBPA 1JK9B 2MMYA 1MN9A 4WWSA 4QWDA 3MF5A 1HFEL 4M5DB 3SYZA 1WC3A 2BJ3A 3MPUB 5AXMA 4FN5A 3FEXB 3OTBA 4NLOA 1DQ9A 4QWBA 2WZ1A 2VBZA 4JI6J 4P2FA 5T41A 1X4FA 1B4SA 2VICA 4UQTA 3OV7A 3G82B 1MN7A 4DG1A 2BRLA 4K7QA 1M90T 1H74A 4LF5J 3TVZA 1MROB 5E3AA 5KOXA 1TKTA 3WDOA 3C19A 1VC5A 2W4DA 4E98A 4DL4A 5A2QU 2RF2B 5L8RC 2BJ1A 2WK4A 4J9PA 2JVRA 1UAWA 2DGQA 1Q81T 4X4QA 2ZH8A 3MAAA 1EIYB 4DUZF 1V6HA 3M2VB 2M52A 3CIZA 3TZZA 1S0NA 4RKUC 2BZ2A 5D4PA 4ZVHA 3AH6A 4GVBB 3GV5B 4CM2A 2VPWB 4K4TA 4L76A 4HACA 4OX6A 5I4MA 1V3RA 4JV0A 3SMZA 4FYDA 4DV1F 1XNRJ 2IM3A 3BDEA 3BN7A 5KFWA 2BACA 3CB4A 3G6XA 1BXNA 2GIQA 3EZUA 1NHVA 4DV5J 3U1MA 4HT7A 1FA0A 2XMMA 4KT0C 3L3CA 5AXKA 2KHDA 3CCLS 3VZHA 3PRBA 2V6AA 5LSLA 4EYIB 3K57A 4DSEA 3ILLA 1RLDA 5G0RA 2DR9A 3VCDA 3P49B 3K2YA 4QBUA 4FF2A 2GO9A 2VKRA 1JX4A 2B5JA 4BWJA 1SUQB 5GAEU 5SZTA 3TAMB 5LM7E 1YIJS 1IKYA 1S0MA 2CNKB 3FC9A 1F5AA 1WF1A 3RAQA 5LJ5Y 4EBDA 4C4WA 2BW7A 1WHVA 3MEDA 4JV5J 3HJVA 1Z1ZA 5AE2A 1U1KA 4G1QB 1S1VB 4LQ9A 2JFKA 1RISA 1V5IB 2HQIA 2CPFA 2I38A 1KLNA 2W9CA 4DV4F 8RUCA 4PG7A 2COLA 2LECA 4ZP6A 1DFDA 2OD4A 2H65B 1XWLA 3KNGA 2ZH2A 2V2KA 2ZVIA 2DNQA 1H3DA 2V68A 2OPQA 2WVCA 3Q0AA 3KMQA 5GMKa 3GIIA 1S1XB 2KT3A 1UETA 1XERA 3KDNA 2AJ1A 3KDOA 1NKCA 1HQEB 3HVTA 1AYEA 2PSZA 2YKAA 3HJFA 3HKZD 1NEEA 2ZD1A 3N5FA 5DDOC 8AT1B 4YP3A 1UKUA 1A0OB 4JI1J 2IRUA 3LO3A 2UXBF 5BXIA 4PKDB 2KVIA 2KJVA 3UNYA 1X9MA 2N4DA 1IKVB 3EVMA 1TFYA 2AIRB 5A8RA 3VAFA 3AD8C 1UEVA 2AHOB 1UP1A 3T6JA 4ZLJA 2HZAA 1SL0A
chains in the Genus database with same CATH topology
1N5TA 5AJ3F 1GT8A 5K5MA 3T9NA 2ATLA 3DU5A 1FDAA 2YH0A 6FD1A 1UVKA 1YI2S 3KLGB 5J2NA 3U1NA 4ZP7A 3N9UC 1JB0C 1S4FA 4QR0A 3M8QA 2MSSA 5M2UA 4ECQA 4WE1B 1YJTA 3MM5B 2SXLA 4P6QA 3TANA 1XNRF 4LIWA 2L9NA 4XDCA 3BQ1A 1OPIA 2YNFA 3LW5C 1K8AT 4OL8A 1MMLA 3S1TA 3K5LA 1R31A 4OZNA 4OZ0A 2IRYA 3MAQA 5GADI 3PR5B 3T5KA 3SI8A 5HMYA 1UVIA 2VODA 1SUQA 1U25A 1IKXA 3MDFA 1OWXA 1HQUB 2CPZA 1WACA 2B51A 4H4KA 1F5CA 1R8CA 4CO4A 4DV5F 5CD4H 1NK8A 1KLMA 5IZHA 1P9QC 2XULA 4PG5A 2MKIA 3LAKA 2RS2A 1W2BR 4DUYF 1X0FA 3M6VA 3CCRS 2JC0A 2YWEA 4N8NA 2BXJA 4Q8FA 2NPFA 4IQXA 2IMWP 1FJEB 2RB7A 2RJZA 2MJNA 3LGMA 3J81Y 2OAUA 4P7TA 4MMOA 2RNEA 3KK1B 2MQLA 3GFXA 3ONQA 5IT0A 2MQOA 4ED0A 2R7OA 3H5UA 3TW0A 2YKMA 3AQPA 5F0UA 3RR8A 1S6OA 3TA2A 4Q8EA 3G9CA 1DTTA 4ID5A 1U6FA 1LQ9A 2R7XA 1NK7A 2YNGB 3DLEA 4QIEA 2ZH9A 3CC4S 1A7GE 2NXUA 3MECB 4DL5A 4E0DA 4QOTA 2VA3A 3I5CA 2DO0A 1TV6B 2P5VA 1DTQB 3JSRA 2XG8A 5ADZA 3KHHA 2X1BA 2DH8A 3R5AA 1S9GA 1HMVA 1SJQA 3SEOA 3T5JA 2AX0A 2AYBA 2BANA 3M2RA 2R4FA 2I9SA 4CT9A 4CCHA 4YR3A 5F8HA 3SV4A 1N4LA 2OFGX 3ICLA 3OVSA 4KO0A 3LPYA 4RUCA 1IJFB 2C2EA 4OV1A 4XPCA 1RT5B 3DU6A 3OVBA 3M8PB 5K8PA 5A8WB 5EHHA 3PIOQ 5LXRA 1WTBA 1JLFA 3LALA 1VK3A 4J37A 2WOMB 2ZNYA 5A8KB 2CPHA 4O3RA 4NLYA 4R0EA 5KG6A 4C8OA 2IHR1 4RUAA 2KH9A 1JLEA 5M2PA 2D7SA 3I9ZA 1U1OA 2L41A 2DRAA 1VRUB 5HLFB 2W25A 4WFXA 1VC6A 4PG6A 2J6TA 2MGZB 1L3TA 2B0GA 2V4JA 1I1GA 2ZOGA 4MKAA 2EI5A 1HA1A 2KYXA 5HBMB 5KFSA 2XLIA 4YB1P 5G4DA 1ZH5A 2IM2A 2Q1LA 1Q8IA 1U49A 4JV5F 4KFBB 3IA0A 1N48A 3HVRA 2G1DA 1T03A 2CPIA 1FO1A 4KKOB 4KV8A 1SJRA 2K3KA 2VFSA 1M5SA 1X5OA 2BQUA 1RT2B 3OQ2A 3V5RA 1HI8A 2A1BA 3E8OA 3MM8B 1KS2A 3TA0A 3UWTA 1MU2A 2ASDA 1C1CB 2HAIA 4F3QA 3SQGB 1T8EA 2J6SA 4KHPF 1T3OA 3G6VA 3S7RA 3GQCA 3T1AA 2MJUA 1HWJA 2JX2A 3O1LA 4C7QA 3V6KA 2MPUA 3R1HA 5E2QA 1C1BA 4I2QA 3NWGA 1R0AB 5E0OA 1TL4A 1U6ZA 2MHEA 1KOHA 4A8KA 1U1NA 2AQ4A