2B6AB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with thr-50
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Crystal structure of HIV-1 reverse transcriptase (RT) in complex with THR-50
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 101
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b6aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aB03
5F9LA 2FVQA 4PWDA 1S1VA 5KT5A 5KFPA 3FFIB 3DRRB 3CJ3A 4PQUB 5F8NA 3M9OB 3IGVA 2V9WA 2OPPB 3GV7B 1T03B 2J6SA 2FVRA 1EP4A 1S97A 5HROB 2RKIB 3KOAA 2XCPA 2E9RX 4TYAA 4KO0A 3I5BA 3DLKB 1FKOA 4O4RA 5HBMB 1RA7A 5DQGA 4NLVA 2JEFA 4O3SA 2R8KA 1HYSB 4NCGA 3NL0A 3PW0A 2IM1A 4ZP7A 3UPFA 1JLAA 1J5OB 2WTFA 2AU0A 4DEZA 3DRPB 2FJWA 3I5AA 5EWFA 4RUAA 3G6VA 5KFNA 2J6UA 4IG0A 4NLRA 2ALZA 1XR7A 3DRSB 4I7FB 3JSMA 4MIAA 4YR2A 3T5LA 2YNHB 2OPQB 3MEGA 2ASLA 1IKWB 5CYMA 5J1EB 1S9EA 3BSOA 2VG6A 4NLDA 4ZVFA 1SV5A 3OL9A 3C6UA 1IKXA 4DG1B 5D3GB 4XPEA 1NHVA 4ZVEA 3ICLA 5KFDA 2FJVA 2ZE2A 1S48A 1JLFA 4EO6A 3KHHA 5KT2A 3H4BA 1TKZA 3QZ7A 3MR5A 3IS9B 4NLPA 1ZETA 4ECRA 2VA3A 3QGIA 4K4UA 1EP4B 1JLGA 3FQKA 4DL6A 4KO0B 2OH2A 4IG3A 1FKOB 3MR3A 2AGOA 2UUWA 3DMJA 5C25A 4TN2A 2I5JA 2W8KA 1TL1A 2QE5A 5KT6A 1JLAB 3PW7A 4FS1A 4NYZA 4EEYA 4EBDA 4IG0B 1XR6A 3JSMB 3GV8B 3KLGA 1REVB 3QO9A 3M8QA 1TKXA 4URGA 3OL7A 3EPIA 1S1TA 2XWYA 2XGPA 5CYMB 4YQWA 2BR0A 1S9EB 1VRUA 4ECYA 4WYWA 2JEGA 2JLEA 4K4SA 1QE1A 3HVWA 2FLLA 2E9ZA 4I2PB 3HHKA 3QIPA 4MKAA 3D28A 3PR5B 4WXWA 4IQXA 4X2BA 2ZE2B 1ZTWA 1HQUA 4O4GA 1TP7A 1TKZB 4TLRA 3QLHA 1S1WA 3I5CA 1UWBA 1S0OA 5F8IA 2C22A 3MEDA 3HVTA 1TKTA 5KG3A 5I42B 1KLMB 4R8UB 4YP3A 3KHLA 4WXOA 4KV8A 1SH3A 4QWDA 1RT7A 4IG3B 4M95A 1K1SA 4RNNA 5KFOA 3H5YA 2J6TA 2R8JA 3DMJB 1SUQA 5C25B 2I5JB 3BQ0A 4KBIA 1TL1B 2EC0A 1RTIB 2WOMA 1JKHA 3M9NB 5KFWA 1CSJA 3KK3A 3VQSA 3OHAA 4QWAA 3BQ1A 3IG1A 4EBEA 4M94A 4O3RA 4RNMA 3QO9B 4F4ZA 4WE1A 3KLFA 3DLGA 2UVRA 4F4YA 1S1TB 1IKVB 1BQNA 3H2LA 4O3OA 1N48A 1RT5A 1VRUB 4RW7B 4B3OB 3KK2A 1D1UA 4NLQA 1QE1B 3GYNA 2AWZA 3QIPB 3H59A 3G86A 4ZMMA 1HQEA 4O44A 3LAMA 3IGNA 5L1JA 4J9PA 3ISNC 1HQUB 4DL4A 4O4GB 2OPPA 4PUOB 2IM3A 4ED8A 1UWBB 5KFAA 3CJ0A 5DG9A 2RKIA 1TKTB 3HVTB 2GIQA 4ZVGA 5KFZA 1HNVA 1DLOB 4ED7A 3DI6A 4ED0A 4KV8B 1RT7B 3I0RA 3TAMA 1LW0A 3CDWA 2XI2A 3H5UA 5JXSA 3OL6A 4ECVA 2WOMB 1JKHB 3H98A 2ILZA 3H4DA 3KK3B 4KSEB 5C42A 3DDKA 4EBCA 4ED3A 3N6MA 3OHBA 4IFYA 2V4QA 3V6KA 4EYIB 4WE1B 3KLFB 3DLGB 1W25A 3T5JA 3RAXA 2V4RA 3H5XA 1BQNB 1IKYB 3KMQA 2UVWA 5KFIA 1RT5B 4QWCA 1C1BB 3M8PA 4KKOA 5D3GA 2YKMA 4NLUA 3OSNA 1RYRA 2YNIA 2HMIA 1HQEB 4O44B 5KG7A 5HLFB 1JLBB 5KG0A 3IS9A 5KG5A 4ED2A 2AX0A 4G3IA 1RA6A 4J9QA 1RDRA 3M9MB 4ECQA 3PVXA 4KFBA 4DL3A 4DL2A 2YNGB 1HNVB 4MK9A 3N6LA 5KFLA 5KFFA 3KNAA 3DI6B 3LP2A 3I0RB 2WB4A 3TAMB 1LW0B 1QUVA 4RNFA 3BQ2A 3T5HA 3FQLA 3DYAB 5KFXA 3V6HA 4O3PA 4NLOA 5C42B 1SH0A 2IMWP 1REVA 4ECWA 2F8EX 4IFYB 4RU9A 2R2TA 3LP0A 4J9LA 4JUZA 1DTQA 4J9SA 4IH6A 1BQMA 3BGRA 3QGHA 3M8PB 4KKOB 4I2PA 1QAIA 2HNDA 2GC8A 1OS5A 3Q8RB 4J9OA 2YKMB 2W9AA 2RF2A 3HVAA 5F8MA 4R5PB 2YNIB 3LP1B 2HMIB 3T5KA 1NHUA 1HPZA 1S1XA 2BQ3A 3PJWA 5EDWA 3OLAA 5K14B 1S9FA 5I42A 4TXSA 1JLEA 1KLMA 3MEEB 4KFBB 1QAJA 2HAIA 3BREA 3D5MA 4R8UA 1HMVA 2FVSA 1RT3A 3NGDA 4ZPBA 3LP2B 3FDSA 5KFYA 4MK7A 2CJQA 4KHMA 2XC9A 3GIMA 2RDIA 5F8HA 1RTIA 4DL7A 3BSNA 2ZD1B 3V6DA 4ECTA 5FDLB 4J9KA 5C24B 5KFTA 5KFJA 2E9TA 2BQUA 1R0AB 2W7OA 4QPXA 1IKVA 1FKPA 5J2NA 3LP0B 3QZ8A 4RW7A 1FK9A 4B3OA 4LQ9A 1DTQB 2WONA 4QWEA 1BQMB 3BGRB 1C0UA 3CJ4A 2HNYA 3I0SB 2HNDB 2I1RA 2R8GA 1HARA 2RF2B 2D3UA 4WZMA 4LQ3A 1C0TA 5KFHA 2W7PA 4RZRA 2ZKUA 1TL3A 3MFIA 4PUOA 2DPIA 4XO0A 1HPZB 5L1LA 3MECA 1S1XB 5DLGA 2OPSB 1JLEB 2R2SA 2XGQA 1DLOA 2W9CB 4H54A 1HMVB 5J2MA 3CJ5A 1RT3B 2YNFA 4YMEA 2HNZA 4MK8A 1NNDA 1S0MA 5EUHA 4Q8FA 4IDKA 3QYYA 1S0NA 1C1CB 3V6DB 2FLNA 5KT4A 3MFHA 3KLIB 5KFKA 4JV1A 2C2DA 2BE2B 1D0EA 1IM4A 4ZPDA 1IKYA 1FKPB 5J2NB 3T19A 4K4WA 2D3ZA 3QGGA 4WFYA 1FK9B 1S1UA 1C1BA 2WONB 1RTDB 3RBEA 4K4ZA 1C0UB 1T05A 2HNYB 3GIKA 5J2QA 4OL8A 2IM0A 4ID5A 4RW9A 5L1KA 2CKWA 3CDUA 2AGPA 5KFRA 1C0TB 5HLFA 1JLBA 4J9RA 1TL3B 1JLQA 4Q0BB 4H4MB 5CYQA 4Y2AA 3MECB 3BSAA 4HKQA 3BR9A 2YNGA 3KLHA 5KT3A 4F4WA 3UDLA 4JV0A 3KJVB 1LWEB 5J2MB 2D7SA 3ITHB 2YNFB 3PHEA 4LSNA 3GIIA 3CVKA 4GC7A 2HNZB 3FRZA 4URSA 3KHRA 1RT4A 3GQCA 5DGAA 2AGQA 4NLSA 3DYAA 3Q8PB 1S6QA 3MR2A 4ED1A 3DM2B 4IDKB 5JUMA 1TV6A 4R0EA 1K1QA 3KLVA 4RW8A 4Y2CA 1ZTTA 5KFMA 4NLXA 2C2EA 2W9BA 5KG6A 4MFBB 5KG2A 1S10A 3CJ2A 4F50A 4RW4A 4EO8A 3EZUA 2YKNB 3H5SA 4KE5A 1S1UB 5DGBA 3PW4A 4RW6A 2HWIA 1T05B 3LANA 4IH7A 2IAJB 3Q8SB 3CO9A 1VRTB 4R5PA 5J2QB 3LP1A 4ID5B 4RW9B 3MR6A 4ZHRB 4I2QB 5C5JA 1KHWA 5EWGA 3NAIA 4NLTA 2R8IA 1RT6A 1JLQB 5CYQB 2XI3A 1U09A 5KFUA 5K14A 3E51A 1LWCB 1MMLA 3ISND 4NLGA 3MEEA 1S6PB 3KLHB 1DTTA 2FVPA 4ZP6A 1LW2B 4YR3A 5DG7A 1SH2A 4LSNB 1RT4B 2BRKA 3H40A 3RB0A 4IRDA 4FBTA 2C28A 1S6QB 2ZD1A 1HNIA 1JLCA 3NBPB 5FDLA 5F9NA 3TQ1A 5C24A 1TV6B 3LALA 1R0AA 3KLEB 3PW5A 2DPJA 4RW8B 2VG5A 3LAKA 4IRCA 2W9BB 3E01A 4WYLA 5KT7A 2BANA 4RW4B 2IJNA 5T14A 1MU2A 1JXLA 4IFVA 2WCXA 3I0SA 3DOLA 4RW6B 4MH8A 3BJYA 4G1QA 5DG8A 4LSLB 4WFZA 4ZP8A 3JYTA 3GV5B 4KAIA 3PJXA 3RB4A 4Q43A 5EWEA 4QW8A 1EETA 3NKYA 1RT6B 4TQRA 1TQLA 1T3NA 4FBUA 2B6AB 1RT2A 3CDEA 1JIHA 2OPSA 5KFBA 4ECUA 2W9CA 1DTTB 4KB7A 4MIBA 1LWFA 3HKWA 4NZ0A 4H4OA 2R2RA 2AX1A 3CIZA 5I3UA 3PZPA 4NLYA 5KG1A 2IA6A 3V81B 5DQHA 4O3NA 1C1CA 2JC1A 1S9GB 1RAJA 1JLCB 1HNIB 5KFCA 3G6YA 1N5YA 3KLIA 4PWDB 1S1VB 2BE2A 2VG5B 4K4XA 4K4VA 1RTHA 4Q45A 1RT1A 3E01B 4TY9A 4IR1A 3IN5A 3V6JA 4QWBA 3PW2A 3OSPA 2FLPA 2BANB 1C2PA 2ASJA 1MU2B 3EPGA 5F8JA 1RTDA 4IFVB 4U6PA 2FJXA 1S4FA 3DOLB 3TVKA 3KMSA 4G1QB 4NLWA 3MTKA 3JYTB 5F8GA 4TQSA 1YVFA 4QW9A 2IBKA 1XR5A 4NCGB 4Q0BA 1EETB 5KG4A 4H4MA 4XPCA 3NAHA 4K4TA 3RB6A 3UQSA 4Q8EA 1RT2B 1N6QA 2JEIA 3BSCA 4MKBA 3PR4A 3KJVA 2D41A 5KFEA 4YR0A 4ECSA 3RB3A 1LWEA 3ITHA 1LWFB 1JX4A 3MEGB 2B5JA 4H4OB 3V4IA 1KHVA 4K4YA 5I3UB 2C2RA 3IRXA 1I6JA 2VG6B 1GX5A 4NRTA 3OLBA 3C6TA 1SV5B 4J9NA 3DM2A 1TVRA 3C6UB 2ATLA 4Q44A 1IKXB 4EYHB 2RDJA 3GILA 4RNHA 3SI8A 3Q8QB 1N5YB 5KFSA 4ICLA 3SFGA 1JLFB 4ZVHA 4MFBA 1RTHB 1RT1B 2BQRA 4DL5A 4Y3CA 3DLEA 2UVVA 2YKNA 3DOKA 2QV6A 4U7CA 3KK1A 2XCAA 2IC3A 4ZPAA 1JLGB 4RUCA 2ASDA 2R2UA 2WRMA 2IAJA 5KFVA 1VRTA 3T1AA 2WK4A 5KFGA 4ECZA 4IRKA 1RTJA 4IKAA 4ZHRA 4I2QA 5HP1A 2W8LA 4KHRA 1RYSA 2WHOA 2AQ4A 2JEJA 1N4LA 4WZQA 1T94A 4IOBA 5L1IA 1LWCA 2V0NA 4F4XA 1N6QB 3QIDA 4O3QA 1S6PA 5J2PA 3N6NA 3MF5A 2O5DA 2IJFA 1LW2A 4J9MA 3KLGB 3M8QB 1TKXB 2B5JB 3V4IB 1N56A 4TY8A 5F8LA 1WNEA 3IRXB 2VG7A 2OPRA 4TYBA 3C6TB 5L9XA 4JV2A 1TVRB 3NBPA 4NRUA 4URQU 3CWJA 3KLEA 4ICLB 3FFIA 3DRRA 2GIRA 4PQUA 2UUTA 3RAQA 5DLFA 3QLHB 1S1WB 2UVUA 3DLEB 1T03A 3DOKB 4ED6A 3UR0A 4IR9A 4IH5A 3KK1B 4ZP9A 3NMAA 4K50A 2IC3B 3MEDB 5HROA 2HWHA 3SFUA 3OL8A 2ILYA 2IM2A 4LSLA 3DLKA 2VA2A 5HBMA 3KHGA 3RBDA 1RTJB 4WFXA 4ZPCA 4FS2A 1HYSA 5HP1B 1SUQB 2B43A 4Y34A 4ECXA 5KFQA 5DQIA 1J5OA 1GX6A 4RNOA 3DRPA 2B6AA 3DRSA 4I7FA 3FSIA 5J2PB 3IG1B 2YNHA 1S49A 2OPQA 2JC0A 3GIJA 4GC6A 1IKWA 3G6XA 5J1EA 2FVCA 4TY8B 3V81A 2R8HA 2BRLA 2VG7B 2OPRB 4HYKA 1Z4UA 3KK2B 4DG1A 1S9GA
chains in the Genus database with same CATH superfamily
4HH1A 4M5HA 3AAWB 2CPJA 1U45A 2ZH9A 4FVCA 1RHQB 1YRXA 2DGQA 4NCGA 4W98A 1ZAWA 5EWFA 2J6UA 3MM8A 4P52A 3JSMA 3DRXA 4A48A 4F3MA 1SV5A 4B9LA 3MHYA 1TKZA 2O3DA 4NLPA 3OJUA 2ZJQQ 2BABA 1GTEA 2Y0BB 2DB1A 1SJFA 5ETVA 3ISZA 3CC4S 1N34J 4FN5A 4DR2J 1JJ4A 1R8PA 2F4VF 4I2PB 2CDQA 5E3QA 2HHHF 2DXEA 1V3RA 5IS2A 1RWUA 3A3NB 2GA7A 1RT7A 5C25B 2CJ9A 2HRTA 3UDVA 3Q2TC 3PX6A 5DM7Q 5D4OA 4C6AA 2FGOA 4DPTA 1ROFA 3GFXA 2W4CA 3AXMA 3QIPB 1IR2A 4DV1F 1CULA 4MMOA 5IT9Y 4ZVGA 3OR1A 3W63A 4DR4F 3R2CJ 2FGCA 2VV5A 2A6MA 4B9UA 1JK9B 1WKKA 5LMUF 4KRWA 4EYIB 4CNZA 3CULA 4B3SF 3I55S 3M2VB 5KG7A 1WTBA 2C2OB 5DZ6A 2V8PA 3FCVA 3T5HA 3BGOP 2F63A 1VHFA 2DY1A 3AHPA 1ZYQA 1G2EA 1WC0A 1MN7A 2ROEA 1R0CB 2GHPA 2NXCA 2Y8YA 5BR8F 2LFVA 1RSCA 2CQDA 1YZ7A 1JLEA 4EK2A 1HMVA 1RT3A 3FDSA 2CJQA 2POKA 2CWXA 1U1NA 2E9TA 1R0AB 3QZ8A 1GAOA 1HPZB 1S1XB 1N0UA 4KGKA 4D3GA 5L8RC 5J2MA 2QMUB 2DNHA 5F0UA 3CD6S 1S6UA 2WSFC 1T0TV 1H3DA 2V9KA 2OD6A 1D0EA 1WSRA 4CH7A 4EMDA 4OYZA 2AGPA 1EHWA 4UY8T 1JLQA 4DUYF 3BSAA 5KT3A 3KJVB 1RKIA 4F7VA 5AJ3J 2HNZB 3KHRA 1VQ6S 2LDIA 4A4JA 4U96A 2EK1A 1FNMA 4PPZA 1NJZA 1NPRA 2YKNB 2FC8A 3PW4A 2HWIA 1T05B 1VRTB 4R5PA 3R1HA 1KHWA 2B8QA 2IDEA 4TLQA 2X3GA 2JJ4D 2W2NP 2CQ1A 3DRYA 1JNZB 3QMQA 4ZP6A 1DZ5A 1SH2A 1MROB 5D0RA 4FBTA 3AA8A 2ZD1A 3HO1A 3PRDA 3NBPB 2EFQA 2CJYB 1TV6B 2QZ8A 2NREA 3E01A 2EG1A 1FJEB 1CJVB 1HWUA 4X66F 1WC4A 2OSQA 3RB4A 3GE9A 1TELA 4ILMA 1HFEL 2VB6A 5D4PA 1DTTB 1RHRB 3WQPA 4NLYA 2NYIA 3UNGC 1SC4B 4FZVA 2E5LJ 2VG5B 2CDRB 1ACMB 1FTCA 4ZN3A 1U8WA 3PW2A 4B9VA 2BANB 2JVOA 3M8WA 3BS9A 2RRAA 3NWRA 1B70B 2QLJB 4K4YA 1SQGA 2B4PA 3RJMB 4NRTA 2CZVC 5B0CA 2XSJA 1VJQA 3I87A 4F04B 4RNHA 1HA1A 1PO6A 2EFOA 2EPIA 1T11A 4Y6IA 2IC3A 2V63A 2YWKA 2RT3A 4IRKA 4EU0A 4LFCJ 4ZHRA 1I94J 2W8LA 1N4LA 5THWA 1N6QB 4O3QA 2BV3A 2O5DA 1VQPS 4ELUA 3SMZA 4ZVOB 4X4TA 3G9CA 4G1PA 3D9BA 2E1CA 2HBRB 2QL9B 2B51A 5DLFA 1TUWA 2ILYA 4LSLA 4AXIA 2V4JB 1HBOB 3TQEA 3VAKA 3A1YG 4C8NA 2R8HA 4HYKA 5DS7A 3PNIA 4AL6A 2FVQA 3MPUB 4JI1F 3M9OB 3W61A 3DGVA 3M8ZA 4KO0A 2PMWA 4O4RA 4C8YA 1UW9A 1NSPA 3TJ9A 2NUHA 3UCGA 1NBEB 1YBAA 2F1FA 4UF4A 4EWTA 3CIMA 3PO4A 3LPYA 4RLEA 5M2RA 2PFDA 3L09A 3TZZA 3BSOA 3OL9A 1IBKJ 4GRSA 3EZ5A 3MMJA 4ZVQB 3Q86A 2F7VA 3Q83A 3PX4A 2BOPA 1VJWA 2IYIA 2NSBA 2JSXA 4P73A 4OJHA 2BW2A 5CYMB 1VRUA 1NDKA 3UD5A 4BLGA 1FVQA 5ETMA 2O1PA 4HACA 3BKUA 1KLMB 1VFJA 1R8CA 3BZQA 4KHPJ 4M95A 2Y1IA 5ETRA 3IBWA 3OJSA 4DV4F 1CSJA 1YHQS 2GW8A 4TU7A 2KL8A 2F5GA 3VAJA 5T7LA 3SV3A 3MD1A 4RW7B 1YKWA 3RR8A 2VPWB 3DOMA 3GJTB 1LKZA 1Y00A 1WI6A 3TUIC 1R8BA 4ED0A 3H5UA 1FFSB 2B7CB 3BKTA 3VTIA 3HK2A 2IMOA 2CPYA 4EBCA 3V6KA 3MXHP 2X1GA 1BQNB 4M5IA 4XK8C 2NXJA 3M8PA 4KKOA 2QEXS 3BDPA 2F40A 5D3GA 4PG5A 1RA6A 2OD4A 4RWWA 3VGSA 4WTOB 1N34F 5D6GA 4DR2F 3OBIA 4DV3J 3DYAB 2XMMA 3V6HA 2E5IA 4NLOA 1X9SA 2HGLA 2D9OA 4J9LA 2FHMA 3BGRA 3QGHA 2KB2A 3QT6A 4JI6J 2RF2A 4HT7A 2QC3A 2BQ3A 5B0AA 5I42A 4PAAA 2FVSA 5ETKA 3HCXA 4J37A 2B9WA 5KFTA 4OX9J 1FK9A 2DR6A 4LQ9A 1M5VC 2HNDB 2I1RA 2RUSA 1KWMA 1K44A 2D3UA 4LQ3A 3RG6A 1WUUA 4F4AA 2Q79A 2HHWA 2MKCA 5KT4A 4PEOA 4LRFA 2CQIA 1KVIA 4ZPDA 4WFYA 3BPDA 1UVLA 4ID5A 2J8AA 1UVJA 5HO4A 2QFJA 2YNGA 1HI0P 1L3KA 5ETQA 2YKPA 5AXNA 4ZPTR 4ED1A 3BGLA 4WP9A 2C2EA 3HXMA 4KE5A 2IAJB 4I2QB 3EVOA 5K14A 1LWCB 4UOFA 2FTRA 2PDAA 2FVPA 1N5QA 1R6YA 1EQMA 2Z2MA 3LH2S 5L9NA 5DO2A 4O0IA 4IRCA 1Q79A 1H72C 3DOLA 3J80U 2VZ9A 3DFEA 2LA6A 1OPIA 4BC9A 3D4JA 2PI4A 4LRAA 3M2RA 1T3NA 3TZXA 3L3CA 1BQXA 1SPBP 3W9JA 1LWFA 2GVDB 2UU9J 3EGNA 1OYEA 4PXBA 1N5YA 3MM5B 2F3JA 3SCJE 1C2PA 2Y0SD 3Q0AA 1RAEB 2VPZB 1S4FA 2BOAA 4PG8A 3PIPQ 4JV5J 1XR5A 5AJ3F 5ITHA 4Q8EA 2FHKA 4YR0A 2M4MA 3R7SB 1F5AA 1VQMS 1WC5A 2HEKA 1IKXB 4YDDB 1QY7A 4C98A 1FXDA 1IXKA 3K0JA 3TRGA 1B64A 4CTAA 3PIOQ 4DQIA 4K8RA 1RYSA 2IIHA 2K1RA 1LXJA 2Z30B 4TY8A 5F8LA 5K9FA 2ZJRQ 2GIRA 5A6WA 2MQMA 4A8KA 3UR0A 4IH5A 2IM2A 2KYXA 2VPXB 5HBMA 1RACB 2B6AA 4CWBA 2DNMA 1JXVA 4Z2XA 4ER8A 2E5LF 2OPRB 1GNKA 2ZC4A 2WBRA 4F0HA 2CZ4A 1UETA 3DGPA 1KVKA 3GR1A 2V6AA 1T03B 2E9RX 2VBYA 4F4KA 2CNNB 4ZKAA 3G87A 3IR5B 3RW6A 2DKOB 2YX1A 4IG0A 3MZIA 3TUJC 1IKWB 5J1EB 3VHQA 1SL0A 3C6UA 4DG1B 1RBOB 1X0FA 3KHHA 4LFCF 3Q8VA 3Q2SC 2LXUA 3SSQA 1JLGA 3ZO7A 2M8HA 4RBVA 1PKUA 4WK3A 1IBLJ 4FS1A 2H3EB 1NK7A 3MM8B 3JSMB 4HH0A 1PJ5A 2QLFB 1TP7A 1TKZB 4IQMA 2VBZA 2RQMA 4WCEQ 1OSCA 3GFHA 5IT9U 3AJDA 3W9IA 5KFWA 2AT1B 3KJQB 4UOGA 4TNOA 3IG1A 3FZBA 4O3OA 2J76E 3OR2A 5IWAJ 2RJZA 5HMZA 1D3WA 1FRMA 3OT9A 1HNVA 2LQ9A 3B78A 1SJRA 4DBQA 1RT7B 1LW0A 2VU5A 4G1IA 4M5DA 4ECVA 1IBKF 1MN9A 2YX7A 3K5OA 3HT0A 2V4QA 4RBUA 4H4KA 1WHVA 1IBMJ 3MD3A 3IS9A 3H25A 2OEKA 2HK2A 1K73T 4W90B 2HFOA 2RHQB 3OR1B 2DHSA 1WG1A 1F9FA 2V2KA 4WF9Q 2F8EX 3WIUA 3K8WA 1BQMA 3C16B 1UVNA 4KHPF 3P3DA 2YWWA 4CZCA 5B09A 3D5MA 4R8UA 2RRNA 3NRBA 3GIMA 3X1LB 4NA3A 3PEJA 3I9V9 3OVSA 2R9LA 4QU7A 5IQQA 3MFIA 1Q95G 3ZZTA 2XHCA 1JLEB 4ED5A 3OFEA 1HMVB 3CJ5A 3GYXB 1RT3B 4NXNJ 5B0BA 4ETXA 2KXHA 4JV1A 2BE2B 1REGX 1S1UA 2MEWA 2IM0A 3CT9A 3DDNA 2N7CA 1U2RA 3GSDA 4DV3F 3VALA 1V3SA 2N7YA 3OXGA 4UOCA 5J2MB 1FEHA 4PXCA 1RT4A 5GADI 4QQBA 1K1QA 4RW8A 2I6WA 2XLKA 4F50A 1ZA1B 2KN4A 3N28A 3LP1A 2R8IA 4P75A 4ETZA 1JLQB 3S8SA 4NCAA 1FTRA 1QDUB 4DS5A 4F2SA 4OX9F 3ADAC 1HNIA 1F6TA 2C1EB 3KLEB 2CYYA 2G9OA 2H48B 2IJNA 3O1LA 3ZFVA 4X4OA 3DU6A 1UMJA 4KAIA 2AJ1A 1ZPVA 1CS4A 1VYAA 2IJRA 2CPDA 4DF8A 1KBRA 5I3UA 4ZLPA 4GKJJ 2BJ1A 2RU3A 2QYCA 4DV2J 3CD5A 1RWMB 3E01B 3OSPA 3AOBA 3KMSA 2C3OA 1H2UX 3KTQA 3MWBA 2XLIA 5GADU 5H1SV 3FCWA 2R7OA 2B4UA 3AY0A 5EX0A 3LQVA 3DM2A 3A4TA 3LPEA 2IVMA 4TKTA 1QLNA 1JLFB 2DNKA 2VODA 3D3BJ 2E5GA 4Y2KA 1N0VC 4OZJA 1H38A 2NR0A 1UZDA 2WAQD 2XMKA 3CCVS 4NZ7A 3SXLA 4PCQA 4LF6J 4OJGA 2XSJB 4NRUA 2G1DA 4DR5J 3RAQA 4JYAF 2IC3B 3OL8A 1PSDA 3M1VA 3DLKA 1HYSA 5DQIA 2UU9F 3QRPA 4J7CA 3PYDA 2RQKA 4ZLLA 3DRSA 3N5FA 1TL7B 1FX2A 4ZCIA 1KP6A 3MPVA 4CQ1A 6FDRA 2GNKA 3H90A 3PXGa 1WJ9A 4QOTA 4W4MA 6AT1B 4JV5F 5LSOA 2OPPB 2FVRA 1S97A 1X60A 1BXNA 1X5OA 1OSDA 1B7FA 2WTFA 2FJWA 1NM2A 2MYFA 3DLLQ 2DGUA 3NWGA 1NHVA 1O8BA 2Y8WA 2NPFA 2XS5A 4KO0B 4WPAA 3MR3A 4N56A 2I5JA 2OLWA 2RQ4A 3QRRA 3CCRS 1IR1A 4KQZA 1S12A 1REVB 1XEZA 3GJSB 1U48A 2MKKA 5F41A 1V9OA 4TLRA 3S6EA 1Y0HA 3BN7A 4HHHA 7FDRA 4QR0A 1LFWA 4NYPA 2KG0A 3CC7S 3HFVA 2MPUA 1URRA 4AL5A 5ETTA 2UXDJ 3T6BA 1RWXB 2B4OA 1QSSA 1SJQA 1PILA 4RNMA 3NEKA 4DFJA 4F4YA 4PZVA 3K5LA 1VRUB 2RHSB 3G86A 4FDFA 2X1AA 4F3QA 3R5BA 4PUOB 2IM3A 4LFAJ 3UN3A 2GIQA 4MYTA 4JI3J 3J7AN 4N76A 4DCPB 2ILZA 3RZAA 4KSEB 3DDKA 4P7VA 1U1QA 5K8PA 5ETNA 5T7LB 2PMHA 4KR0B 2CFXA 2XMUA 5U47A 4NASA 2UUBJ 2OFHX 1PYTA 3ZZRA 1CQNA 1IBLF 2FB0A 3D3CJ 1LWXA 1AFIA 2ASYA 4JI0J 3M8RA 2ZH6A 2CWKA 1U1OA 3ZZUA 2CJBA 2PEBA 4RU9A 2R2TA 3BO2A 4R0JA 3L9ZA 3M8PB 4KKOB 1UJ5A 3Q8RB 2Z2LA 4J90A 3DHXA 1GMUA 1VBXA 4KGXB 4CH0S 2YH0A 1QSLA 1SXLA 3J7ZT 4FYDA 4GKKJ 3BREA 3E2EA 1U24A 4KHMA 1X4CA 4KPYA 2W1BA 5IWAF 2W7OA 4OI1A 2ZJPQ 4PXDA 1LK5A 1KQFB 1U6BA 3BGRB 4B17A 3IM8A 2RF2B 5IT0A 1C0TA 5ADZA 5L1LA 2W25A 1GMWA 1XNRJ 1PG5B 5ETSA 2HHSA 4MK8A 4NA2A 2YXLA 2I9SA 4NX9A 3KJFB 1H73A 4U95A 1IBMF 1IKYA 2QA2A 4LBIA 1FK9B 1C1BA 1ZS6A 1R3NA 4J9RA 4Q0BB 2W24A 1T8EA 1AXQA 1KEKA 3IXQA 4R25A 5JUMA 1U49A 1WOSA 5KFMA 4U9RA 2YQ1A 3SZ2A 3HZEA 1UPMB 2BEFA 1WF0A 1YIJS 4ID5B 2RS8A 2VKRA 2XO6A 2AYEA 1FKAF 3NNCA 2MZ1A 1MNEA 2G2ZA 4YR3A 5LMNJ 5DG7A 1PAUB 1U1MA 1DAXA 4C8LA 2GQQA 1YDLA 2V5HG 4LVNP 3TVYA 3W66A 3BJYA 2LVWA 2V34A 3PJXA 4NXNF 3HFKA 2MKHA 2F8HA 1JIHA 3VWSA 2D1CA 4KB7A 2AX1A 4CDIA 1OQ3A 3CPWR 3PZPA 4E0DA 5KG1A 2DYAA 2JC1A 4X65J 2W7AA 8ATCB 2P8IA 2YKOA 1ZM9A 5F8JA 3DOLB 2DNPA 1R31A 3Q24A 4DV0J 2HBZB 3DLBA 2HW3A 2V8HA 4Y00A 3O44A 3EYZA 1LWFB 1NO8A 1KHVA 2ZZMA 1AA1B 2VG6B 3CMAS 3A8EA 1N5YB 3HHLD 4CM2A 4RWXA 2DXFA 4OHXA 2QJ3A 4AUKA 5JJBA 2WBMA 4WU2A 1O6XA 2NQPA 3L7OA 4TU8A 2AJQA 1LW2A 4QR1A 4OV1A 4UQGA 1BUXA 3G8SA 1VQ5S 2BE7D 4ZA1A 3THPA 2XZWA 2C2MB 3NMAA 5HROA 3I9ZA 2MZQA 2BKNA 1XMOJ 3I6PA 2WSCC 3DRPA 2NXNA 4GKJF 2K1RB 1RAIB 3UCUP 4DV2F 1MG7A 1LOUA 4TY8B 1IBCB 1QTMA 5KT5A 2J7WA 4MJKA 3CJ3A 4I4BA 2A1BA 3GV7B 2J6SA 3JSBA 2RKIB 4U7UD 2XCPA 1FKOA 3LOUA 5HBMB 3POTA 1FI4A 1U7LA 2DGOA 1S9EA 3FEZA 5EN1A 2CPFA 3VGVA 2VKZG 2BA9A 3MUVP 1VQ9S 1HBNA 5F3TA 2W8KA 2RSQA 3GU0A 3IFEA 4OJ1A 4LF6F 3QQCD 1RBLA 4IG0B 1JWWA 3QO9A 1W2BR 1TKXA 2XGPA 1XERA 2B0GA 1YJTA 4DR5F 2YWGA 1FESA 1HD0A 5A8KA 2CPXA 2DEJA 1ZTWA 4JB8B 1RKJA 1UWBA 1S0OA 4PXEA 3QJPA 1SH3A 5CD4H 1SUQA 1RTIB 1VLYA 4JP8A 3VQSA 4LF5J 3QNWB 3CB4A 2WVEA 2VIHA 3JXOA 1R8HA 5C7PA 2PA3A 2FZGB 1SBRA 1AW0A 2DCUB 2DO0A 3OV7A 3C3LA 1BWEA 4NL5A 1WWHA 4L3NA 2CIMA 3KJNB 1RHKB 2VUGA 4B3MJ 3OR2B 2HWTA 2ZWOA 3SQGA 1NK9A 5HLFB 3PVXA 5KFLA 1HNVB 4V19X 3KNAA 2LCWA 1LW0B 5SZTA 5KFXA 5L38A 2OIHA 3K17A 1CJKB 1DTQA 4J9SA 3Q23A 2J9DE 1RWWB 1X4AA 1Q86T 1P27B 4ERDA 2UXDF 3PACA 4BWJA 3HFZB 1M5PC 1JQGA 2KRBA 4FXWA 1Q78A 1T9WA 3EWGA 1IN0A 5HQLA 3K59A 3HVRA 2YX4A 2G2YA 2R7TA 4LFAF 1BQMB 1C0UA 4KTQA 4OZ3A 2W4DA 4JI3F 1WF1A 3ZXWA 2KU7A 2IFXA 4OX7A 2UUCJ 2YNFA 3ZZYA 1NKEA 4C2MA 4DX8H 3WDOA 4EGLA 4RUBA 3BO3A 4OQJA 3QJLA 3VAMA 2UUBF 3HD1A 1B0TA 2ZITA 5K5MA 1YI2S 4K4WA 3K5MA 1F5BA 4K4ZA 3EGVA 3GIKA 2HHUA 4JI0F 1JLBA 3UFCX 4JI8J 4NOHA 5D15A 2DGSA 2HPUA 2ATCB 3MAAA 3PV8A 5DGAA 3FRZA 2QN6B 2U1AA 2JLGA 5CCMA 4RO0A 3OVBA 4MFBB 4DCJB 1S1UB 4GKKF 2HKEA 1NDPA 1OQ6A 3PTWA 2HSEB 4TVAB 2XMVA 1IQTA 2NPIA 3MCMA 3MEEA 2RD5C 2JHEA 2FDNA 3BBBA 4YB5A 1WEYA 2VD3A 1SVDA 1UVKA 4L72B 1RT4B 4Y0FA 2A0FB 4RW8B 2M52A 3S01A 4QZVB 1XNRF 3NCQA 1UJ6A 2M3DA 4DSKA 4F8RA 2GJIA 3U27A 2P2CB 4CO3A 3MEKA 3UW1A 4DMZA 2DHXA 4N8OA 1NJIT 3OXLA 3D6TB 4LREA 3HM9A 1HNIB 2HVIA 2BJEA 4FNHA 3EGZA 5E3PA 2ABYA 1T02A 3TVKA 4P7TA 2XEXA 1F5CA 4XPCA 1CS4B 2QFIA 4ITSA 4LVOP 5CD4A 3MEGB 3V4IA 1Q7YT 5I3UB 3MMAA 2ATLA 1KONA 4ELVA 4Y3CA 3FNNA 2WRMA 4X4RA 2BXJA 2HHVA 4HTIA 5LMNF 3FSYA 4I68A 2E7WA 2ZOGA 4U7UK 4NI2A 2X1FA 2ZNYA 3M05A 3CWJA 3UR3C 3HKZD 2G0JA 1HWIA 2C42A 1GTHA 2ZC3A 2AEMA 3NXZA 1UZHA 3R7BB 3CCWA 4A46A 1J5OA 1FCAA 2VBXA 4XAKA 4FYYB 4X65F 2OPQA 2PC6A 5F9LA 1U8SA 2MQPA 4V1Ak 2W2OP 3TA2A 4DV0F 1EP4A 2LQ8A 2NZCA 3DLKB 4NCBA 4NLVA 1HYSB 3QPIA 4NLRA 2ALZA 3DRSB 4DX6A 2ZDOA 2ZH3A 2ASLA 4UTGA 3G82B 1J5EF 1YJ9S 3H20A 2ZE2A 2C3UA 2ZVIA 5KT6A 3MUMP 1XR6A 3M8QA 2HLUA 1S1TA 1WC3A 4FVMA 5EX3A 4K4SA 3VGTA 4FPIA 1C4CA 3RTVA 4IQXA 4X4UA 4RUHA 1PBUA 4WKYA 1Y5IB 5H9EJ 1XMOF 4Y2IA 3UE2A 3HDSA 3P4UB 1KDNA 3UI3A 4QWDA 1K1SA 4J91A 4OX8A 3BQ0A 2I5JB 1NK5A 2Q1LA 2QL7B 1TTHB 3A3OB 2MHNA 2CPIA 1WEXA 4CLFA 2QSFA 3MOZA 4NMLA 2Z2ZA 4B3OB 1ZAXA 4DQSA 4J9PA 2PIIA 1Q8LA 4ZJOA 1RUSA 3R27A 2CZ9A 2J9CA 5LSRA 1DLOB 2GS8A 2ADBA 3H98A 4UT4A 3UNYA 1RWNB 2KHDA 1X8DA 3DKDA 3EE3A 2KH9A 4F36A 2A6OA 3SIPB 4DJBA 2WW4A 1L5UA 4O3PA 4OHWA 2IMWP 3C46A 2UZAA 2MJUA 2DRAA 1QAIA 3IR7B 2LQJA 2FJEB 5B08A 4DSEA 1TK0A 1TFWA 1S9FA 1QAJA 5ETPA 5IV4A 4A8SA 4YS2A 3F41A 1YBTA 5C24B 4FKXA 2MHEA 1FKPA 1S76D 2BJ3A 2CAJA 1X7VA 3I0SB 2R8GA 2H5EA 3GWCA 1PYSB 2DK2A 2FC9A 2ZOFA 3OFHA 4PG4A 4B3MF 3P96A 3FSXA 1I3OB 1IM4A 5A76A 2EBEA 2ZBRA 1Q16B 1RTDB 4W92B 3SV4A 5J2QA 3MPYA 4MKVA 1C0TB 3VGUA 2QL5B 4H4MB 1KS2A 3R5AA 4ALZA 1QVFR 1LWEB 2D7SA 2FZKB 3DDIA 2ZUGA 4URSA 5HL7Q 1FRIA 2RS2A 4J9UE 5KG2A 2LA4A 3LGHA 3CO9A 3C15A 2YQ0A 5C5JA 5HMXA 1KTVA 1RCOB 5E3CA 3ISND 2XY5A 4IYQA 4WFBQ 1U26A 2G0IA 5C2GA 3RB0A 2LDYA 3C66A 1JLCA 5FDLA 2F4FA 2P9GA 2EVZA 4CH1A 2WCXA 4ZP8A 3GV5B 2UUCF 3QRQA 4J9VA 1VMBA 9RUBA 2D3OR 4ECUA 4UOHA 2Y1JA 3PFEA 1NK6A 4NZ0A 4H4OA 1U1LA 4ZVSB 4AQYJ 5KFCA 3NMRA 2RE1A 3WC2A 2HQDA 4K4VA 1HR0J 4JI8F 3EPGA 4OI0A 2FD2A 3JQMA 3DC2A 5IM0B 2EWHA 1LQ9A 3IRXA 5D0EA 1M5KC 2NXEA 3CCLS 3AA9A 1FRXA 4DFPA 4K2JA 2XM3A 1L3VA 2MQOA 1RJJA 5E3RA 3ZZPA 2KM8C 2CRLA 1G4CA 3K58A 2VC0A 2O01C 3MF5A 2IA0A 2AJ0A 2C3MA 3RBXA 2HVZA 3EXYA 1Y4ZB 2VG7A 4TYBA 4DFMA 2WSEC 3M2UB 4PQUA 3L4BC 4C8MA 4C8ZA 1Q7LB 1N52B 2D3O1 1N54B 3ILJA 3KHGA 2B43A 5A8RB 5KFQA 3AT1B 1LXNA 4YDXA 4I7FA 4CLYA 4S0MA 2DNRA 3G6XA 2FVCA 1S9GA 2DHGA 2CQGA 3FZ2A 2DY9A 5KFPA 4C97A 2VF3A 2PE8A 5HROB 4JI2J 1UEUA 2IRXA 2IM1A 1JLAA 3DRPB 3I5AA 3OTOJ 4MKYA 1GK8A 3TZYA 4YR2A 4I0WA 3OUYA 4OYWA 1R0BG 2E29A 4XPEA 5KFDA 3H4BA 2QIFA 3QZ7A 1RHJB 1ZH5A 2V94A 4QIEA 3IM9A 5IC6B 4C9DA 4K4UA 4DPYA 2CADA 1GFWB 3KKFA 1FKOB 3TJAA 4M5KA 4P2FA 3WC0A 2GO8A 2V2ZA 1O51A 1YZ6A 5HQMA 3KLGA 4URGA 3OL7A 3PRVA 4QYZJ 1S9EB 5LL6d 4CNYA 2R7SA 2DR5A 4UZCA 2B56A 3MEDA 3CJ8A 4YP3A 3KHLA 4RNNA 1WDTA 3U02A 4KBIA 4FYXB 2GCFA 1FD8A 1HBMA 3OHAA 1Y5NB 3QO9B 4F4ZA 3DLGA 1S4EA 4EZ9A 2XMAA 2DVIA 3MMCB 3CJKA 1UWBB 3OTEA 2R7UA 3IBCB 5KFZA 1XN9A 2KFZA 2WVFA 1TR0A 3N01A 2K06A 2KZMA 2V4RA 4XDDA 1CVJA 3DLHA 1AROP 3M9MB 2KRRA 1S79A 2ZH1A 2HURA 3JSRA 1URNA 3IRWP 5CZVA 1ZBTA 2QA4G 3C19A 2V67A 4Y65A 3SQGB 7AT1B 2F8MA 1OS5A 4CO1A 4DR1F 4B3TJ 1WHYA 3E8OA 4EZ6A 2EKNA 1FFWB 1OMSA 4MK7A 2PN6A 2FJDB 3HHLC 1T9YA 2BKPA 3CSKA 4J9KA 5KFJA 4YEAA 3EDQB 3EVMA 5IT4A 1W2IA 1IKVA 2IPOB 1U1PA 1DTQB 3CJ4A 2ZHAA 3U1NA 4CO5A 2FIUA 1Y7PA 3MECA 2ADCA 1YWXA 5DLGA 2XGQA 2MSTA 1SC3B 1WD6A 4AFFA 4F2RA 2ZUAA 1FEEA 4CT8A 3TAQA 2XG8A 2VFVA 3NGKA 1WI8A 1WEZA 3MM7A 1SI9A 1C0UB 1CJTA 2HBYB 3N0VA 1AFJA 4JV0A 1ZAVA 2YNFB 4LSNA 2IRUA 4ZS6A 3MR2A 1E6VA 2OEMA 2DGWA 3R2DJ 3KLVA 4ZVTB 2DGVA 3J81j 1RHUB 2L48A 1NB2A 3W2VB 2MZRA 2OHDA 4QR2A 2VFRA 1BY9A 1QJHA 2R7QA 2GHWA 5D4LA 3MAAB 1W7WA 3OFGA 1YSJA 4ZDNA 1S5ZA 3EXCX 4IRDA 2R42A 1P8GA 4M5GA 4O23A 2DHAA 2AF6A 4USMA 1JXLA 1NDLA 3HJVA 4G65A 3JYTA 3TO8A 3VCDA 1WKJA 1WELA 3BGUA 1L3UA 4OYBA 2GQCA 3KNGA 1ELOA 3V81B 1YQHA 2VBWA 1UL3A 1C1CA 3KLIA 1S1VB 4RBTA 4D3HA 4TY9A 4C0BA 2ASJA 2RQCA 3R3TA 3ENWA 3GG0A 3LTOA 5F8GA 4TQSA 1UFKA 2RB7A 2DBBA 2ZWPA 3GG1A 4N8NA 1R6VA 5KFEA 7FD1A 4L6V3 3HD2A 3OLBA 4BS2A 3VZHA 3JTOA 2AJ4A 3GILA 2KXNB 3TVZA 2G2OA 4DR7J 4ANDA 4DPWA 1CG2A 3SSRA 1QSYA 3KK1A 2DO4A 1OJ4A 5KFGA 2BKOA 3IWXA 1CBKA 1A0OB 2IJFA 3V4IB 3HF5A 1TKDA 3PG9A 2MQLA 2OGUA 3TANA 3BYRA 1WTFA 2UUTA 1WHXA 1LEOA 1S1WB 4IR9A 1D9DA 3BBFA 4Y34A 1NAQA 1GX6A 2MKJA 4AQYF 3CJQA 3KFWX 3FKBA 3GIJA 1HWKA 4GC6A 1IR0A 3HHEA 1HR0F 4ENOA 3KK2B 4WFZA 4OI4A 3JS9A 2IHR1 1K8AT 2V8DA 1OPZA 5I4MA 1S99A 3CCQS 1J5OB 4RUAA 2XZDB 3GCWP 3AJ2A 4KC5A 1XR7A 2GAHC 3K5PA 1ICEB 3T5LA 1TUVA 2OPQB 3KDNA 3H2UB 2VFUA 4LF9F 2BW7A 1NPKA 3GLJA 4ZVEA 2C2ZB 1Y5LB 2VA3A 1EP4B 2CJAA 4CO2A 2APOA 4OYIA 3DMJA 2G1HA 3FRYA 4M5MA 1TL1A 2Q66A 2CG8A 2ZBCA 1AUDA 2QMWA 3BBCA 4ZLNA 3GYGA 3HVWA 1VQ7S 2UXCJ 1RI7A 2ZE2B 2KYZA 2HLTA 3QLHA 1MMDA 3HLUA 1FRHA 3C14A 4L76A 2WB1D 2XS2A 4EBEA 3VR1A 2UVRA 1S1TB 3PKMA 1RT5A 3RRKA 2JDJA 3THTA 4JI2F 1X4BA 2W2QP 4DF4A 3GCXP 3CEDA 3OTOF 1VQSA 4USWA 1YJNS 1UPPA 2ZZNA 3B8HA 4C48A 2Y9HA 4E98A 1XC9A 3T5JA 3UD4P 3RYLA 3LW5C 4NLUA 3OSNA 4DUZJ 1FO1A 3W1YC 2OFGX 3J81Y 5JVGQ 4DL3A 2O67A 3GJRB 1U1KA 1JNRB 4C3KA 1VBYA 4U8YA 1GMWD 2MZSA 4I2PA 1I1GA 5FLXY 3QAUA 1YJWS 5EDWA 2XQCA 3OLAA 1EB0A 4DV6J 1FNXH 3T3FA 4OHYA 4ATNA 2OTLS 1NK4A 1NK0A 3QWPA 4QJVA 1DRZA 4WZMA 5KFHA 4YB7A 4RZRA 2KVIA 4DFKA 4K7QA 1H2TZ 1NEEA 1NNDA 1H98A 5KFKA 2BMBA 1FKPB 3CGIA 2I38A 4LRDA 3FEXB 2FHJA 4DLGA 5CYQA 4CRJA 3KLHA 5DJBA 4FKYA 2BM1A 3GQCA 1VQYA 3ETOA 2A10A 4R0EA 2AIRB 3UDCA 2GMJA 4B3TF 1FHTA 1WOPA 5J2QB 3EICA 3C2PA 3ELHA 1NB7A 1S6PB 3ETMA 2DIVA 4UW2A 3JSYA 2AJ2A 2C28A 3IP0A 3LALA 1R0AA 4MTPA 3LAKA 1YJ7A 4QU6A 3GPAA 3ENAA 4IFVA 4G1QA 5DG8A 3C15B 3UCZP 4Q43A 5K8NA 4TQRA 3NLCA 3AQPA 1JLCB 4PWDB 3LWMA 2HHXA 5HVFA 2C3YA 5HAOA 2R7XA 3BF4A 1U4BA 4EI2A 2MLYA 2D74B 2M8DB 4NMXA 2RIJA 1NSQA 3AXKA 1KKHA 2BZ2A 3KJVA 3I82A 3MM6A 4H4OB 4YUDA 1I6JA 1GX5A 3C6TA 3OFFA 5AE1A 2Q43A 2RDJA 1FRJA 1NMEB 2YKNA 3DOKA 1OIAA 2ZBIA 2V2QA 1R43A 2FHOB 1VRTA 3BV8A 3R5DA 4L3KA 3SBMA 2WHOA 4CM0A 5J2PA 2QO3A 3IRXB 4XTTA 1VQOS 3A3PB 3W3SA 3NBPA 4URQU 1S72S 8RUCA 1X4DA 2HWHA 2VFTA 2L9WA 4A8YA 3M8SA 2VA2A 3K5NA 3R9LA 1D9AA 1FDDA 5DZ7A 5D0GA 3TX8A 3MCOA 2VPYB 3AD8C 2VG7B 4JI7J 3VAIA 1BD6A 4ANCA 4PQUB 1SIWB 3IC1A 1XMBA 4HHUA 1W26A 2A18A 2R8KA 2DH7A 3S7RA 4DEZA 2KDOA 2DR9A 4I7FB 4DR7F 4LFBJ 2AHOB 4B08A 4DPXA 4EO6A 1KC8T 3BR8A 2VDHA 3HJFA 4GVBA 4IO9Q 2BE9B 3PFOA 4XIUA 3RAMA 1PC4A 1JLAB 4Z7CA 1VQ8S 1UA1A 4NYZA 2FJBB 4EEYA 3N9UC 2VOOA 3OPKA 4WYWA 2FLLA 1M0SA 2KM8B 4MKAA 3T6JA 4X2BA 3KYLA 4CLLA 1N33J 3WBZA 3I4PA 3SCKE 1QM9A 1Q5VA 4E8UA 5KG3A 2Q6BA 1WHWA 4WXOA 5AXLA 3AD9C 3R5CA 2V4JA 2K8GA 2ZFHA 1HI1A 3TOQA 2H4WB 4ZIWA 3CE8A 3BM7A 1CLFA 5CHCB 3M30A 4C11A 5MLCV 1N8RT 1SQEA 1RADB 2NXUA 3QT7A 4OLOA 1F1BB 2W2MP 4P2SA 1SKUB 3ISNC 4ED8A 4OHZA 2F4VJ 2ZH7A 3CJ0A 1S57A 2Q3PA 1RCXB 1FDBA 3H4DA 4C0HA 4FXVA 2AP6A 1SC6A 3DLGB 3HT3A 5KFIA 4QWCA 2EEYA 1RWKB 5KG5A 1YRTA 4J9QA 2O66A 4FP9A 1VBZA 5H9EK 2WB4A 4WP8A 4NXMJ 2UXCF 2ZZTA 3IO1A 4J9OA 3W8PA 3D6FB 4DXLA 2YTCA 3T5KA 3SCIE 3UVJA 3CF5Q 1GH8A 5G0RA 1KLMA 1RHMB 2AMCB 1KQSR 3G8TA 5KFYA 3BO4A 5F8HA 1F2GA 3GONA 4ZCKA 1Y9OA 4WKRA 4RW7A 2WONA 4YHHJ 3EM1A 3ZTPA 2XMWA 2GAGC 2KFNA 3K8VA 3B4DA 2OPSB 2W9CB 2H5JB 2DNNA 1G7CB 1T3OA 1S0MA 4F02A 2CXEA 2FLNA 2HZVA 4DUZF 3R7NB 2D3ZA 4LF8J 3RBEA 2RNEA 3UN2A 3AODA 4EFAC 3CJSA 5HVHA 3MECB 3M8YA 3QAEA 4OIXA 3VQTA 2MQQA 3ITHB 4GC7A 2QA4S 5LJ5Y 3DYAA 3Q8PB 4USHA 1A6LA 1F3FA 2UP1A 3IAS9 5DGBA 4RW6A 3Q8SB 3LANA 1CJTB 4DV6F 5EWGA 1SJ1A 3KG0A 4UUXA 2PSZA 3A8KA 2Z58B 1HI8A 2FYXA 4LSNB 3SDEA 3H40A 3W5YA 4CLUA 2KKHA 2I2YA 5HN0A 4LR7A 1F9HA 2IVYA 2HGNA 2OELA 2MQ8A 3HHLB 4QW8A 3AOAA 1EKRA 4HI2A 1TU0B 3PDNA 4QIGA 4HVZA 4DR3J 2AYBA 1S7HA 1S59A 2OUGA 1FWPA 4DL0C 8AT1B 2QLXA 1I94F 3CW2C 2J9EA 2V68A 3MTKA 3JYTB 3PY8A 1RK8A 3X3UA 4H4KC 4NCGB 4MKBA 3PR4A 2VICA 3RB3A 3HHDA 1HWJA 2VL1A 3GP9A 4ZVRB 4A8XA 1SV5B 4J9NA 1I51B 4EYHB 1DQAA 3AOCA 2IAJA 3T1AA 4I2QA 4HR2A 1LWCA 4F25A 4O0NA 2EFGA 3R8YA 1RXOB 4LF1A 3NCRA 2VONA 1T95A 3D67A 4ED6A 3KK1B 4K50A 2GJ2A 2XYPB 5A0YA 4ZPCA 1YJVA 3BH6B 3AB2B 2VQEJ 3L7UA 2YNHA 2VH7A 4IUFA 1A9NB 3H0PA 2AV5A 3HSDA 3OW2R 1CULB 3IGVA 3AH6A 4WK1A 3MAQA 3KDOA 5DQGA 3UPFA 3O5TB 2AU0A 3I56S 2KVQE 2CVIA 2OEJA 3ZTSA 1IKXA 2FJVA 1UW4A 2UXBJ 1FE0A 1YRUA 1Z2ZA 5DETA 2BYCA 4DN0A 2GJFA 2XY7A 2UUWA 4WFAQ 2QE5A 3TEGA 4NEZA 1KOOA 3GV8B 4X4VA 2K7JA 3KWMA 5FIIA 2CPZA 3ILOA 2YBVA 2JEGA 2JLEA 1QE1A 2E9ZA 4DLEA 3D66A 1VC0A 2HS4A 3PR5B 4ZCLA 1HQUA 1UVIA 4O4GA 2IBOA 1TKTA 4KV8A 1F3VA 3H5YA 3NY0A 3ZNUA 3MTJA 3DMJB 1HHQA 5IZHA 1TL1B 2WOMA 4JI7F 1MWYA 5J1NA 3SYZA 1VGYA 4KGVB 3CDAA 3GYNA 4ZMMA 4O44A 3T9NA 4DL4A 3U1LA 1GXLA 4ED7A 4USKA 3C14B 3TAMA 3QFWA 3J81U 4LFBF 2B7BB 1FE4A 2JFDA 3RRHA 4JI6F 4P10A 1RT5B 3KG1A 1VI7A 2HMIA 4QYZK 3IAM9 5FLXU 1E6YA 2JNJA 2ZDPA 1QVGR 4DSIA 3CMES 1NJXA 1KSPA 3FQLA 4UY85 3OVAA 4OX6A 1FJ7A 1ZPWX 1N33F 4KGMA 3UO0A 3LP0A 5B0FA 2PA8D 2AW0A 4JI5J 2XHWA 4R5PB 3QATA 1DHMA 4CCHA 4K0KJ 4I6YA 1GMVA 1LNQA 3N4WA 2M0GB 2E7VA 2DNZA 2CQBA 2AYGA 2JH3A 2ZD1B 5K8OA 2DNLA 3FEYB 1Z1ZA 4QWEA 5AT1B 5DDOC 3HP6A 1Y11A 4P2XA 1HWLA 4XO0A 2Y1LB 4FYVB 1KR4A 1VC5A 4DS4A 1FVSA 3MURP 1JJCB 4YMEA 1UAWA 1IWAA 3HMJG 2XNRA 3H2VE 4OL8A 1YLXA 4DV5J 4NXMF 1HW8A 3THVA 4NLSA 1WKLA 4DU7A 2OP5A 1Q8KA 2W9BA 4HL9A 4PQAA 3EZOA 5MAOA 3O6QA 3C16A 4ZITA 4YN3B 1X9WA 4ZHRB 1UVMA 1RT6A 3QBCA 5CYQB 2XI3A 3CCES 4F3OA 1R27B 3KLHB 4B9MA 3H8YA 4YHHF 4Y2MA 4YOEA 2DPJA 3M6VA 1QUPA 1Z2LA 4MH8A 1B4SA 4LSLB 5KOXA 4B9SA 3NKYA 4FBUA 5KFBA 2R2RA 2GV1A 3PKYA 2GZOA 4LF8F 4I6AA 2OSRA 2OJ3A 5IOLA 2BE2A 3D6MB 3R1LA 5DDPC 4IFVB 4U6PA 2AJFE 4G1QB 2FJAB 1RABB 2K3KA 3DHWC 5GMKa 1JXEA 1LK7A 2GVZA 4OZNA 2K7KA 3W62A 1EKSA 1U6FA 4USUA 5KFSA 4OV6A 4PG7A 2QV6A 2YWEA 1L3SA 4IKAA 1FNOA 4KHRA 2CQCA 3ENQA 5HMYA 3G96A 1MMNA 3MM6B 2MLZA 2V8GA 2ZNZA 5GAGI 1S6OA 2LU2A 3C6TB 4JV2A 2PO4A 2HFUA 3KLEA 2MLXA 4WTYA 3LGNA 3DOKB 2OMLA 4HACB 1XIQA 3IA0A 3MUTP 1VC6A 2DCLA 4DR3F 4KT0C 3FSIA 5J2PB 3VVUA 1OO0B 3DOMB 1L3TA 1VBKA 4DPUA 5F8NA 3TAPA 3A8JA 3TJ8A 4TYAA 4A8MP 3PRBA 2KXFA 3JQKA 3D0HE 3RBZA 1U6ZA 1ZA2B 1SQFA 3QGPA 5D3GB 1JJ2R 1UKUA 1JLFA 2HIYA 3MR5A 3EVWA 3ZTRA 4ECRA 5E41A 1G6BA 5GAGU 4DV7J 1M5HA 1UCNA 1TK8A 5HJYA 1VQKS 2C2KB 2BVZA 3G2XA 2FUG9 4AD6A 1XMQJ 2C22A 4AE5A 3HVTA 4GVBB 2VQEF 3UWTA 1PIEA 5I42B 2MKSA 2W2PP 1D9FA 1FA0A 3CNQP 4DSLA 1NPPA 3CTRA 1TL5A 1TL7A 1G3OA 3H2LA 5LXRA 1N48A 4K2XA 3T1YJ 2D9PA 3FBEA 1NSAA 1YGYA 3IGNA 3P8BB 1WORA 3D1HA 2OPPA 3VAHA 3CO0P 1X4EA 4OJ3A 1UA0A 5D0HA 1X9MA 1OY6A 1T9UA 1CJUA 2C2NA 1N36J 3M7VA 3M30B 4C11B 2UXBF 4AT1B 4OI3A 5DDRC 2G13A 5CAAA 1KVJA 4Z37A 4M5LA 4IOCQ 1RDRA 3W5ZA 4F0MA 2YNGB 3N6LA 5LSLA 1QUVA 3BQ2A 1IUJA 1SH0A 4JOUA 1REVA 2FY8A 2XSFA 1EZZB 4RJVA 2MQNA 4A8QA 3DLJA 5BJRA 2P5VA 1EARA 1KQKA 3K2YA 1HD1A 5K14B 3NGSA 1XBWA 3NGDA 4ZPBA 1HNZJ 2KI2A 2XC9A 2H1YA 3MR7A 1H2VZ 1ZZNA 2F65A 2CJXB 2H4YB 3V6DA 3D1OA 3KUEA 4OI2A 1FD2A 2LEBA 2XO7A 3FK4A 2ZKUA 4PUOA 1CC8A 3NNAA 3M2RB 3UVJB 4FNIA 5G0RB 4J5OA 3QYYA 2X1BA 4KIAA 2WONB 1P9YA 3BB5A 1P1LA 4RW9A 1NSKL 1HL6A 5KFRA 1SCJB 3HULA 2E5JA 4LF7J 4DCOB 2MGZA 1IM6A 2JRSA 2YY3A 3CCSS 4JI5F 2LLZA 2J0WA 4NLXA 2DNGA 3H5SA 4K0KF 4CTAB 4WBFA 3TR5A 3IWLA 1DJ0A 1MMLA 2B3TB 5E3AA 1B7YB 4F0KA 2KZZA 3MGJA 2LYVA 5T14A 1XK8A 4RW6B 4LSZB 2UV8A 5EWEA 4C4WA 1TQLA 5I3QA 2B6AB 1U2CA 3FC9A 3HKWA 2DEIA 2IA6A 3SDEB 5DQHA 1F60B 2QMXA 1EX8A 2GQ2A 2VFSA 1RAJA 1NCLA 4JBCA 2R3VA 3JAMY 2QA1A 4NE9C 3DGPB 2QSWA 2KG1A 3EDRB 4DV5F 1EQ0A 2IBKA 4Q0BA 3NAHA 4K4TA 3RB6A 2RRBA 4FF1A 3FVYA 1BMQB 1B99A 1JX4A 1AB8A 2J7UA 3C6UB 1FDNA 1VS3A 3FCHA 2LECA 3I31A 4ZVHA 2BQRA 1RISA 3NP5A 1JLGB 1DURA 4OZLA 4TU9A 5E33A 2JVRA 2R7WA 2WVBA 2HHTA 1WSVA 2HHQA 4ZVUB 4L74A 2Z57B 3W2WA 2M5YA 3LO3A 1RU2A 2KT5A 3FFIA 2ZKTA 1KNZA 3WX8A 4CI0B 2L41A 1V5VA 2L9NA 4C3MA 4KGZB 1APSA 2HFNA 4FS2A 1KRPA 2B9XA 2G0CA 2PEHA 1M1KT 1R89A 4UZBA 2NS1B 3IG1B 2LXIA 3HX9A 5HSPA 3UN5A 5CXTA 1HLWA 1V3ZA 1Q81T 3VAGA 2BACA 5A0YB 1YG0A 4I64A 2ZOMA 4OHVA 3EX7B 3NL0A 4JYAJ 4M5DB 2R7RA 5KFNA 2EFPA 5HMWA 4MIAA 2YNHB 3GTYX 3KG4A 2VG6A 4NLDA 2PD1A 2Y3YA 1RAAB 3R6GB 2CA9A 1GQEA 3IS9B 2X7IA 1ZETA 3BPSP 1U02A 2ZH2A 1P9QC 2AGOA 3ONQA 2DH8A 1SC1B 4EBDA 2LXFA 2QLWA 3P6YC 3EPIA 2H9ZA 2GGPA 1N5SA 3GJQB 4CLKA 2HZAA 2U2FA 3TUZC 2E1AA 4R8UB 2MZJA 3MDFA 3H5XA 1V5IB 2QTWA 3HHNB 3M6XA 2YH1A 3BQ1A 4O3RA 2ROPA 3MMBA 4BBYA 3SCLE 1SL2A 2ZBPA 2HRYA 1QE1B 3QT8A 2HBQB 1HQEA 5L1JA 1HQUB 4O4GB 2BJ9A 4USJC 5KFAA 3G8QA 5DG9A 2RKIA 1TKTB 1NKCA 1JMTA 4KV8B 5GAEI 1HQ2A 3I0RA 1BHNA 3OL6A 2WOMB 5J1PA 3G71S 4DN9A 1S7IA 4YB1P 1RTZA 4DI6A 5T41A 2FPHX 1AYEA 4O44B 3P5BP 1H0HB 4FXDA 2E7XA 4DV7F 2V69A 4G3IA 1N5TA 4ECQA 3T1HJ 1RWPB 1UJ4A 4DU8A 5KFFA 3DU5A 3LP2A 3TAMB 1JJHA 5FJ4A 3VV2B 2UUAJ 3ULHA 2GMHA 3W7BA 3PYGA 1XMQF 2FY1A 3JB9k 3LP1B 2HMIB 3ZZ0A 2G4BA 2R4FA 3PJWA 1E6YB 2DITA 1CC7A 2E1RA 4P9SA 2BM0A 3D6HB 1RTIA 2A3JA 4PWWA 4PYAA 4DL7A 3BSNA 3T1YF 1NK8A 1RU1A 4OZ1A 2YWFA 4N41A 2EKYA 1GEHA 2FHJD 4QPXA 5J2NA 3LP0B 2OI2A 3K89A 2CQPA 5GAEU 3QSYB 4IO1A 1Q5YA 2DPIA 3V4MA 3FMBA 1BGXT 4KJIA 1N36F 2YPYA 4WIIA 1WC1A 4M8LA 4P74A 5DDQC 1ZOTA 4Q8FA 4X4SA 4I6WA 2P6SA 1TMMA 1NHKL 1DBDA 4B9TA 3QGGA 3PYEA 2VC1A 5L1KA 5AXMA 5HLFA 3GFZA 1Q4RA 4I56A 3P49B 1ITPA 2IDLA 3CVKA 4HTJA 1ZM2A 4DX5A 3DM2B 5IV3A 4HI1A 2V50A 4K59A 4Y2CA 1ZTTA 4AYBD 1CJKA 2AYMA 3MI7X 2HZCA 1KLNA 1TMJA 2YKAA 1IWGA 1HNZF 1CPZA 1HKAA 2X51A 3D1QA 4KPCA 3E51A 1YJUA 3FBBA 2MMYA 1M5SA 4BCAA 6FD1A 1ZM3A 4DQPA 4HLBA 2BBEA 2W9BB 3TX0A 5KT7A 3M6WA 3H7HB 3M1VB 4CLTA 3WZ0A 2LP4A 2JX2A 2BDPA 2VQFJ 2BUNA 1RT6B 1RAHB 5AXKA 1G1XA 3G6YA 5K20B 4Q45A 2LQ5A 2W01A 2FJXA 4NLWA 3QJJA 4LF7F 4FYWB 3LWLA 3DNCA 2I0XA 2JEIA 4I69A 2CUYA 1NH7A 4U8VA 1NUEA 4ICLA 2LQBA 3SFGA 4MFBA 4DL5A 2RILA 2DR7A 2R2UA 2HG4A 2VOPA 4WU3A 5HP1A 4G6VB 2AQ4A 1KFSA 2JEJA 2GVZB 4IOBA 3N79A 4OZ2A 4F26A 1RQ0A 2OMOA 1X0PA 2E66A 4ANEA 5IQ6A 1RP5A 1OY8A 2CPEA 5E2QA 2CQ2A 1H6KX 3KUHA 5D77A 1WG5A 4RPFA 4RU2A 1RB0A 1FERA 4DZDA 1S49A 2AD9A 2V2VA 2HS0A 3R97A 3BEGB 2UV8G 1FXRA 5LJ3Y 4RR5A 1N32J 4MIWA 4KYZA 2CQ3A 4Z7YA 3ET6A 3LA0A 4ZPVR 2LKZA 1VIXA 4GVLA 2JEFA 4O3SA 4LRCA 4GMKA 3GSIA 5G4DA 4CLPA 2M7SA 3MEGA 1M90T 1Q0NA 3PYFA 4B02A 1MWQA 2RAQA 5KT2A 1DQ8A 4USIA 4LF5F 4IG3A 1VIOA 2NZ4A 1KQGB 1BE4A 2DNYA 5BYSA 3OTCA 2J9DA 4YQWA 1F0XA 4WXWA 3Q89A 1T7PA 2J6TA 4OZ5A 3KK3A 3NS7B 3EGWB 3PX0A 3J7Z5 4K5SA 5GMDA 4WE1A 2DRBA 2GMLA 3IBFB 1SKSA 3H59A 5D78A 3OD2A 3ZZZA 2ZH4A 1EAYC 4B3RJ 1M5OC 3HVTB 2MY7A 4ILLA 4NPOA 3CDWA 4QYRA 2FZCB 3U1MA 5C42A 4BDPA 4ED3A 3CCMS 4IFYA 1IKYB 3CD7A 3G82A 1C1BB 1KTQA 2YKMA 1VQNS 5IC4B 2KT3A 1YX2A 2YNIA 4CLWA 4DWIA 5KG0A 4NYOA 3I32A 2N4CA 1CJUB 1K9MT 1VK8A 2J0QD 1WF2A 3CJTA 1S0VA 2AKWB 4L73A 4ELTA 2ACMA 3HVAA 5DRKA 4N7TA 3BGFA 2HAIA 1HBUA 1X4FA 2XB2D 2P6TA 1EIYB 4BWMA 4DDFA 2MKYA 4B3OA 5CABA 1RZMA 2VASA 1SB6A 5H9FK 4MAKA 1DLOA 1IQZA 2LEPA 3NCPA 4X4PA 4ED4A 2DH9A 1S0NA 3V6DB 4OYPA 2ZBQA 2C2DA 1HIYA 3T19A 2H65B 3T1HF 4DX7A 5F3ZA 3BH7B 3TEHB 5BXIA 4FF4A 4F4WA 2PFFB 1Y3JA 1VQ4S 2LU1A 3PHEA 3GIIA 2UUAF 1X5PA 1RLCL 9ATCB 1S6QA 2Z8QA 3TW0A 1C4AA 1UWAA 1X5TA 5KG6A 1SL1A 4EO8A 3RW7A 4IOAQ 4N5SA 4RW9B 4NLTA 2J0SD 2Z0GA 1LW2B 1NKBA 2HQ3A 2MGZB 4LMZA 4HHJA 2E1MC 1VQLS 1Q8BA 5C24A 3NS5A 3PW5A 4M63A 5L46A 2JWNA 1I5OB 3K7RA 1MU2A 2OTJS 3I0SA 1PBAA 3JAMU 2XY6A 1U47A 2M88A 4ZPWR 4YB6A 3QFHA 1T9VA 1UFLA 1P1TA 2IY5B 2JOQA 1RT1A 2DHHA 5IFMA 3V6JA 4A8OA 4RX6A 2L3MA 1RTDA 5HVGA 4P72A 1YVFA 3POTB 4H4MA 3BN4A 1FJGJ 3BSCA 2D41A 1LWEA 4C8KA 2B5JA 2LMIA 4OI6A 2HGMA 2VDIA 1TVRA 3U7JA 3Q8UA 3CUNA 1PCAA 3DLEA 4LUBA 2UVVA 4U7CA 2XCAA 2HHPA 4ZPAA 4UQTA 4LR8A 1HHTP 1HBNB 1RTJA 4ZJQA 1TL4A 1T94A 1WC6A 2M2BA 3AJ1A 4J9MA 3L95X 1TKXB 2DNQA 2QGFB 3TZWA 3MOJB 4WIQA 1WG4A 5A8KB 2RVJA 2GFFA 3DRRA 4UUWA 2VQFF 3PJ9A 2NCKL 3SFUA 3SEOA 1U0SA 4HT5A 2Y1RI 1RLDA 2MTLA 1SUQB 3DXBA 2E44A 1DQ9A 2HVDA 4Y28C 3V2UC 2JC0A 3W64A 1VK3A 3MPWA 2DXDA 3NGRA 4OZ0A 1NLKL 2BRLA 3W2WB 2IVFB 2DGXA 3ZTQA 2VJUA 2ZH8A 2QX0A 3GZ7A 3FFIB 5DM6Q 4LRBA 2DNOA 3GMGA 2WVCA 5GMEA 1U2FA 2QLBB 4M5NA 4ZP7A 5HI7A 1PC5A 5IM0A 3G6VA 1SKWA 1QAYA 1NZAA 2AZ1A 1RAGB 2XULA 4DHVA 3FMWA 2IRYA 3ICLA 4YY3J 1S48A 3HZGA 3QGIA 5B0GA 3FQKA 4B9NA 2OH2A 1M1HA 1AZSA 2GHVC 2BR0A 2A2CA 4ECYA 1DY3A 2F9JA 3M2UA 5AE2A 3RU0A 2EFVA 2XLJA 2IYGA 2N3OA 2FQQB 1J5EJ 4PG6A 3ENVA 3LGMA 5A8WA 2BJDA 2R8JA 5K8MA 5A8RA 5ETLA 3F44A 2EC0A 1N5VA 1JKHA 1FDAA 1WOOA 1N32F 1GT8A 1NZ8A 3UDEA 2PGCA 3KLFA 3ZZOA 2GGPB 1NJYA 4NLQA 5E5NA 2AWZA 3N5BA 4PRFA 4CYUA 5M2PA 1UEVA 2MJNA 3AD7C 1AT1B 3FBCA 3DI6A 2PMZD 3F0NA 4P2MA 5JXSA 2P9EA 2HQFA 3ZNJ1 1OYDA 1TK5A 1UFWA 2K3IA 3OQ2A 3RAXA 3MMBB 2UVWA 1VRQC 3GIRA 4P6QA 1RYRA 1QAXA 1HQEB 1JLBB 4ED2A 2AX0A 4KFBA 4DL2A 4LIWA 2XYHB 1RAFB 3I0RB 1LV5A 4JI4J 1U25A 3S1TA 2GC8A 1D09B 2ALYB 4KH1B 3US5A 4TXSA 3MEEB 4ES2A 5A2QY 3G6ES 3H42A 3LP2B 2RDIA 3B4MA 5GVQA 5BYQA 1RWOB 3WX4A 3T9ZA 1U1RA 2AEJA 3DN9A 2ROGA 4B3RF 2HNYA 1HARA 2WVDA 3NGTA 1NH8A 2W7PA 1TL3A 3MMCA 2DT9A 1TUGB 4ZK7M 3TARA 3QT5A 3PM9A 3V5RA 1VDHA 3GFYA 4H54A 1O5JA 5EUHA 4X64J 4Q2LA 4IDKA 2J7KA 1FWLA 5J2NB 2RH3A 2CKWA 2KJWA 5F0WA 4A8FA 4OYAA 3D54A 4HKQA 1TAQA 2NSCA 4C8OA 4QIVA 3ILLA 3MMAB 3R6LB 1PJ7A 2XYGB 2L08A 2N82B 2YWHA 1S10A 4RW4A 3FJ2A 3EZUA 3L7PA 3NAIA 3E3XA 4U67Q 2EXUA 2QRRA 1IJEB 1B0VA 3R5GA 3PO5A 2BRKA 4NI2B 2HFSA 2ZHOA 3P45B 5F9NA 1PAEX 3W9HA 1MWZA 1PJ6A 3Q8YA 4CLZA 2MXYA 1LFPA 4ZIVA 1JB0C 1VCTA 3JTNA 2VJVA 1EETA 1RT2A 2BJ8A 4DQQA 3OTDA 5KAKA 4C7QA 4AL7A 3CIZA 5C2CA 2DIUA 4O3NA 1V6HA 1U0HA 3OTBA 3M32A 1FRKA 1PYOB 2HRUA 4K4XA 1RTHA 3O8WA 2FLPA 2LEAA 3TUPA 3ILIA 4LF4J 2L9DA 3HI9A 1SKRA 1BC6A 1YITS 2JFKA 4USVA 4QW9A 3MCSA 1MSWD 2WW8A 3MM9A 1RWVB 4ECSA 1QTNB 3D7SB 3RGIA 2Z56B 2DRDA 3KXDA 3RR7A 4LR9A 3B82A 1SIZA 4RUCA 3W5XA 3W2VA 1SJ4P 1CEZA 5KFVA 3FGVA 4ECZA 3O3LA 5CZXA 2ZHBA 1FWKA 4DZ6A 4L75A 4DQRA 2XMJA 2V0NA 2GIFA 2XS7A 3M8QB 2KJVA 4BC7A 1J27A 2MDAA 4FPRA 4CT9A 3D68A 2P9CA 4ICLB 2XNQA 3AFGA 3CCJS 1DARA 3QSIA 1YTYA 5BYRA 5HP1B 4ECXA 4RNOA 1S77D 4NWBA 4USTA 1TFYA 4N47A 3BKFA 2JL9A 3DCAA 4OYXA 3V81A 3SQOP 1HNXJ 1S1VA 1Q53A 2CG4A 1B0PA 2WZ1A 5CA5A 1F2HA 1XTZA 5LM7E 3KOAA 4DR6J 1FJGF 1FRLA 3I5BA 4Q7AA 2XWXA 1UP1A 1GXUA 3UD3P 1X31C 4NA1A 4CO0A 1RGVA 4ZVFA 2KTQA 4C3LA 3ET6B 2E5HA 4RL1A 4DL6A 1OWXA 5RUBA 4K5RA 2A2DA 5C25A 3CCZA 3IMQJ 2ZM6J 4ES1A 3PW7A 2Q6CA 3O2IA 3MCNA 3QIPA 3D28A 3EJMA 4OYOA 1S1WA 1ZM4A 2ZH5A 3PEHA 1KFDA 2N3LA 3CXCR 4IG3B 4M1KA 3B6BA 1X4HA 3M9NB 4QWAA 4M94A 5CYJA 4HDGA 3J7YI 3HPOA 3KK2A 1O0PA 3HSZA 3M2VA 3LAMA 5SUHA 4LBHA 2EC2A 3TP2A 3JTPA 3HSGA 1ULRA 2Z2YB 3NS6A 3WIVA 3KK3B 1H7WA 4ILRA 4YY3F 4WE1B 1W25A 2CJKA 1KD1T 2HQGA 1EJ7L 4WJBA 2MB0B 2EG2A 2OKQA 2KFYA 2MKIA 2HS3A 5M2UA 2HFVA 5JMNA 3RUBL 4RNFA 2Z4PA 4RKUC 4CO4A 5C42B 4ECWA 1Y10A 4IFYB 1H74A 1Q8IA 1OY9A 2YKMB 5F8MA 2YNIB 4LJMA 3AQOA 1HPZA 1KOHA 2HQIA 1S1XA 2YVSA 4PABA 2QG9B 2GX8A 3J7YU 2CNLB 2AZ3A 3NNHA 1M1GA 4ECTA 4DSFA 5FDLB 2X3DA 1HNWJ 1AUSL 2F9DA 5IXUA 1TZ0A 3KUGA 4QCLA 1T9TA 4LF2A 2R2SA 2J8SA 4YFUA 4CP5A 1HBUB 3Q22A 4OFZA 2HNZA 4DR1J 4LBPA 1KN6A 3MFHA 3MAHA 4I67A 4N77A 4KH0B 1NXIA 1CQMA 4X62J 1T05A 3I96A 4WP3A 2N4DA 5LT5A 2RUGA 3CDBA 4JI4F 4V19J 3A12A 2ZEJA 2I8EA 3BR9A 1YBUA 4ZCMA 3NG8A 1MROA 1QD1A 2AGQA 3JQJA 1TV6A 1MW7A 1DFDA 2H54B 4X4QA 1CJVA 5GAHI 2YKQA 1XNQJ 3K57A 4ES3A 1DTTA 3CCUS 4PWUA 4Q2MA 1S6QB 3IR6B 2DISA 3FUYA 2RMLA 3TQ1A 1VHIA 5LXYA 1FXLA 2QYGA 2VG5A 5JVHQ 2MY8A 4WYLA 2BANA 4WWSA 1BWVA 3NOCA 4X64F 2HYIB 3EUNA 4X4NA 1S9GB 1NJWA 3RRGA 3M4XA 3IN5A 4QWBA 5L39A 1MU2B 1K0VA 2CVEA 3TWZA 1Q1KA 3UQSA 1T9XA 1N6QA 1FT8A 2KHCA 3OUYB 1ZZFA 5E7OB 2C2RA 2JLFA 4Q44A 5GAHU 3SI8A 1K0TA 1WDDA 3D0GE 5D4NA 1RT1B 1SJ3P 1D8ZA 2RDDA 3W60A 2NUUG 1UEKA 4FF2A 1FJCA 4A47A 1HBOA 4F4XA 3QIDA 1S6PA 1R8AA 4FF3A 3N6NA 3PCOB 4KY3A 3KLGB 2PT0A 2B5JB 1WNEA 2M70A 5L9XA 1TVRB 2DGTA 1VR6A 3TA1A 1TAUA 2D69A 2UVUA 3DLEB 2HK3A 2B9EA 4GO7X 3MEDB 2PI5A 4ZLJA 1RE1B 3GR0A 2HHHJ 2FLOA 3RBDA 1RTJB 4WFXA 1PGZA 2EI5A 2NYHA 1HBMB 3TI0A 4OLPA 4QIFA 3CJRA 4NZ6A 1Z4UA 2DR8A 1D8YA 4PWDA 4LF4F 5B0EA 3DRRB 2J5AA 3F56A 2V9WA 3CJKB 3CC2S 3TNVA 1FFGB 2BX6A 4DV1J 4ZVPB 1RA7A 2XTJP 3PW0A 2DTJA 1VLOA 4LIRA 3BYPA 4HEA9 5EGYA 4MT1A 2OAUA 4DR4J 5CYMA 2CPHA 2J0XA 2VHGA 2H5IB 2R7VA 5LMUJ 3CMQA 1H7XA 1NRKA 5E0OA 4MYUA 4B3SJ 4PKDB 2HIQA 2HFZA 3SSSA 4TN2A 4ZN1A 5KTQA 2CNOB 2B9YA 2XWYA 1A7GE 3LUYA 3HHKA 4ZOSA 2HVEA 2M9KA 4LF9J 2RU9A 3I5CA 5F8IA 3TYTA 5KFOA 2CQ4A 5BR8J 4C0OC 2C3PA 3D2WA 3QWUA 1AZSB 4PR6A 1HNXF 1HW9A 1IJFB 3BDEA 1IKVB 1BQNA 5HANA 1D1UA 1BLUA 1VOMA 2EBGA 3CD0A 4DR6F 3AB4B 1XQIA 2SXLA 4WFNQ 2XMTA 2CQ0A 5AE3A 5A8WB 2XI2A 1JKHB 3VVTA 3N6MA 3OHBA 3KLFB 3KMQA 1Y3KA 3MM7B 5D8HB 4CYUB 2ZM6F 2B8PA 2HVHA 1NU4A 4MK9A 3DI6B 1X5SA 4DSJA 3ZC4A 4DUYJ 1E6VB 4QPTA 5A2QU 1RAOA 4JUZA 2K2PA 4IH6A 5ETOA 1XJWB 4BHQA 2HNDA 2W9AA 4ID8A 3MPDA 1NHUA 5HATA 2CQHA 5CCLA 4E2FB 4KFBB 3DXSX 5KOWA 3WHIA 2CNKB 1MLAA 2OO4A 2BQUA 3A13A 1Q82T 2EW9A 1NDCA 4I1TA 3F73A 4X66J 2EFNA 2HQCA 2QT7A 2V8VA 2HAFA 3G4SS 3A8IA 4A8WA 1C1CB 2EK6A 3GB0A 3KLIB 1RBAA 3B54A 2HNYB 3CDUA 3VAFA 4GO5X 4QIWD 1B3TA 1TL3B 4Y2AA 2E1PA 3FBFA 3UDLA 4DOZA 5B0DA 2KO1A 4IDKB 3I4HX 2MSSA 4DPOA 3CJ2A 3P5TL 1K47A 1FF2A 2YPZA 4OMFG 4IH7A 4ZJLA 3MR6A 3IWNC 1U09A 5KFUA 4NLGA 4OYMA 4F67A 2GVDA 2COLA 3J7A1 1HNWF 2ACYA 2XZTB 3MM5A 1R7IA 4RW4B 3M6UA 4NEYA 4Q5VA 1F9EB 4QBUA 3R5JB 4CLSA 1VISA 5A6PA 2MZTA 1IVZA 3CDEA 5CQGA 2OPSA 4PYDA 2W9CA 5FD1A 4MIBA 3W8GA 4X62F 2JZ5A 3J80Y 3W65A 4M5JA 1XWLA 5HK4A 4IR1A 3NOGA 4CIOA 1GXTA 4HDHA 4PPDA 3NGUA 4JI1J 1N88A 5B7WA 5LOQA 1EETB 5KG4A 5EHHA 3TA0A 1HHSA 1RT2B 1X4GA 2H51B 3ITHA 5HJXA 2ERRA 3D0IE 1U0HB 2ZVSA 3M32B 3Q8QB 5I3PA 3OXFA 1YK9A 2KT2A 1RTHB 1UTAA 2W4PA 1YJRA 2XBPA 1XNQF 2ASDA 3C8YA 5HQ8A 3T41A 1WACA 2WK4A 4P71A 1J2VA 2AEFA 3CCTA 4WZQA 2GO9A 4XDCA 4X84A 5L1IA 3MM9B 1N56A 2OPRA 3LF0A 2DD8S 4AXJA 3HSJA 2BJ7A 3VZIA 3QLHB 1T03A 4ZP9A 3PHTA 2B4VA 3HHLA 4DUTA 3EMTA 3ZTOA 3VF0B 2YQ3A 5H9FJ 5CH7B 1IKWA 5J1EA 2NLWA 4LT6A 2DJWA 1FX4A 4DV4J 4EUVA 4DG1A 1P6TA
chains in the Genus database with same CATH topology
4HH1A 3VAIA 1QTMA 1BD6A 3AAWB 4MIWA 5KT5A 2J7WA 4MJKA 3CJ3A 2CQ3A 4PQUB 1SIWB 2CPJA 2A1BA 4I4BA 3IC1A 3GV7B 2J6SA 3JSBA 1XMBA 2RKIB 2XCPA 4ZPVR 1U45A 2ZH9A 1FKOA 2LKZA 3LOUA 1VIXA 4FVCA 5HBMB 2A18A 2JEFA 1YRXA 3POTA 2R8KA 4O3SA 2DGQA 4NCGA 2DH7A 3S7RA 1ZAWA 2KDOA 4GMKA 4DEZA 5EWFA 5G4DA 2J6UA 2DR9A 3MM8A 4I7FB 3JSMA 2M7SA 1U7LA 2DGOA 3MEGA 3DRXA 4DR7F 1M90T 1S9EA 4A48A 4F3MA 1SV5A 3FEZA 5EN1A 2CPFA 4B08A 4B02A 4B9LA 3MHYA 4EO6A 2VKZG 5KT2A 1TKZA 1KC8T 2O3DA 4NLPA 3BR8A 2BA9A 3MUVP 3HJFA 3OJUA 4IO9Q 1DQ8A 2ZJQQ 4USIA 2BABA 1VQ9S 1GTEA 1HBNA 4IG3A 1VIOA 4LF5F 5F3TA 2DB1A 3PFOA 1SJFA 2W8KA 2RSQA 2NZ4A 4XIUA 3IFEA 4OJ1A 1KQGB 3RAMA 1PC4A 4LF6F 1JLAB 1VQ8S 1UA1A 4NYZA 2FJBB 4EEYA 3ISZA 3N9UC 3CC4S 2VOOA 4IG0B 2DNYA 4FN5A 3OPKA 5BYSA 1JWWA 3QO9A 1W2BR 1TKXA 2XGPA 1XERA 2J9DA 3OTCA 4YQWA 1F0XA 1YJTA 2B0GA 4DR5F 1JJ4A 4WYWA 1R8PA 2YWGA 2F4VF 2FLLA 1M0SA 4I2PB 1FESA 1HD0A 2CDQA 4MKAA 2KM8B 5E3QA 3T6JA 5A8KA 2HHHF 2CPXA 4WXWA 4X2BA 3KYLA 1ZTWA 3WBZA 3I4PA 1RKJA 3SCKE 1QM9A 1UWBA 1S0OA 1V3RA 4PXEA 4E8UA 1T7PA 5KG3A 1RWUA 5IS2A 2Q6BA 3QJPA 1WHWA 4WXOA 5AXLA 2GA7A 3R5CA 1SH3A 2J6TA 1RT7A 2V4JA 2K8GA 2ZFHA 5CD4H 5C25B 1SUQA 1HI1A 2CJ9A 1RTIB 3TOQA 3Q2TC 1VLYA 3CE8A 4OZ5A 3PX6A 5DM7Q 3VQSA 3KK3A 5D4OA 3BM7A 1CLFA 3EGWB 3PX0A 5CHCB 3J7Z5 4K5SA 3M30A 4WE1A 4C11A 5MLCV 1N8RT 2DRBA 2GMLA 2FGOA 1SQEA 3CB4A 1ROFA 2NXUA 3GFXA 2W4CA 1SKSA 4OLOA 3QIPB 3H59A 5D78A 1R8HA 4P2SA 4DV1F 4MMOA 3ISNC 5IT9Y 2PA3A 3ZZZA 4OHZA 2ZH4A 4ED8A 2ZH7A 1SBRA 3CJ0A 1M5OC 1AW0A 3HVTB 2DCUB 4ZVGA 2DO0A 2MY7A 3OV7A 3OR1A 4DR4F 2FGCA 4ILLA 4NPOA 3CDWA 3C3LA 2Q3PA 2VV5A 4QYRA 4B9UA 1BWEA 4NL5A 1FDBA 1JK9B 1WWHA 4L3NA 3U1MA 3H4DA 2CIMA 4C0HA 4FXVA 5C42A 2AP6A 4BDPA 4ED3A 3CCMS 5LMUF 1SC6A 4IFYA 4KRWA 4EYIB 3DLGB 4CNZA 3HT3A 3CULA 1IKYB 2VUGA 4B3SF 3OR2B 3CD7A 5KFIA 2HWTA 4QWCA 1C1BB 1KTQA 3SQGA 3I55S 2YKMA 1VQNS