5J2QB

Hiv-1 reverse transcriptase in complex with dna that has incorporated a mismatched efda-mp at the n-(pre-translocation) site
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
427
structure length
400
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase p66 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 105
structure length 400
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qB03
3HHKA 1XR6A 4RUAA 1HQUB 4TQSA 4F50A 3GV8B 4ECSA 1S9GB 3H59A 2AGQA 4TN2A 1T03B 2JC0A 1R0AB 4ID5A 3HVWA 4RU9A 4I2PA 2RDIA 1LW2B 4RW4B 3KK2A 3MFHA 3G6YA 4ED0A 1JXLA 3LP1B 3DRSB 1S48A 2I1RA 3EPGA 4ECQA 5KFGA 4K4VA 1TL3A 3H4BA 3PW0A 4ZPDA 2R2TA 2XI2A 1C1CB 3T5JA 1S9FA 2R8HA 4H4MB 2J6SA 1D0EA 1RTDA 1RT5A 4RNHA 4GC6A 3BQ1A 3LALA 2C28A 5EUHA 2HNDA 4NCGB 3BSNA 4R5PB 2ASJA 1TVRA 4R0EA 4O3PA 5DG9A 3IRXA 4WYLA 1BQMB 1SH3A 2W9AA 1YVFA 1JLQB 1RT7A 4EO6A 5KFCA 1HYSB 3MR3A 2V0NA 1DLOA 4K4ZA 1HNVA 5KFJA 1HQEB 2OPRA 2AX1A 4NLXA 1QAIA 2OPPA 1JKHA 5F8JA 3NAIA 2HNYA 1C1BA 1REVB 3I0RA 1RTJB 3RBDA 1S1VB 3PW7A 4WZQA 2BANA 3NBPA 4R8UA 5KG7A 5HP1A 3PW4A 2XC9A 3FDSA 1TKTB 3ICLA 4O3QA 3JYTA 4IG3B 4H4OA 5J2PA 2V4RA 3PW2A 1C0TA 3V4IB 4IOBA 1S0NA 3M8PA 2HNZA 4KO0A 5EWFA 2XCPA 4LSLA 5L1KA 5I42A 5J1EA 4URGA 1RTIB 1IKWA 3HVAA 1DTQA 2O5DA 3G6XA 2R8IA 4F4XA 2HAIA 5L1IA 4WE1B 1S6PB 4IDKA 5D3GB 3OSPA 2E9TA 3CJ2A 1SV5A 2W7PA 1VRUA 3JSMA 3LP0A 2VG6A 3TAMB 5DQIA 3PZPA 3DI6B 3OL7A 4MFBA 2IJNA 2D3ZA 2YNGB 3M9MB 4B3OA 2FLNA 1RDRA 1XR7A 2ZD1A 5JXSA 1JLFA 3DDKA 1S1UA 4NLDA 4F4YA 3PW5A 2HMIA 5DQHA 4PUOA 4MK8A 4JV0A 3RB6A 2UVWA 1RA6A 1N56A 1TV6B 4X2BA 2IBKA 4I2PB 2BRKA 4QPXA 2R2SA 3KK2B 2FJXA 2EC0A 2F8EX 1EETA 5CYMB 2B6AA 3H5YA 4LQ9A 4MIAA 3CJ5A 5KFUA 4ED2A 1NNDA 1TL3B 1RTHA 3KMQA 3NMAA 2C22A 1HARA 4DEZA 3ISND 2D7SA 4ZMMA 4Q45A 3DRPA 3V6HA 2WONA 5KT6A 4O3NA 2ZE2B 2YNIA 2HWIA 3KLFA 1FK9A 1IKVA 5KFTA 2R2UA 4DL3A 4IRKA 1RT5B 3OL8A 3PJXA 3TVKA 4ED1A 4YMEA 2HNDB 5L1JA 3H5XA 4JV1A 3H5UA 3ISNC 1K1QA 3KK1A 1TVRB 2RKIA 1LWCA 2W9BA 5KFDA 2WTFA 2IMWP 3BR9A 1RT7B 3MEEB 1RT4A 4KB7A 2VG5B 2JEJA 2OPRB 3DYAA 3LAMA 1IKXA 2OPPB 1JKHB 4G1QA 3MECA 3OLAA 1C1BB 4ZVGA 5F9NA 3LP2A 4ECWA 3CVKA 3I0RB 5EWEA 3QZ8A 2IC3A 3RAQA 3KK3B 3N6NA 2AWZA 2RDJA 2BANB 4M95A 5KT2A 3M8QB 1S49A 3Q8QB 4O4RA 4NLSA 3GIIA 5F8MA 1C0UA 3JYTB 4ECRA 1RYSA 5J2PB 3Q8SB 2YKNA 4K4SA 3KLEB 3FRZA 3PR4A 3M8PB 1IM4A 4WYWA 3UQSA 4KO0B 1J5OA 1JLGA 2BQUA 1SUQA 3V6DA 1QE1A 5I42B 5J1EB 1SH0A 4MKAA 1IKWB 3EPIA 1DTQB 2FVPA 4EBDA 2AQ4A 3RAXA 2UUWA 1S97A 3MF5A 2VG7A 4NZ0A 3KHLA 1Z4UA 4IDKB 4ZVFA 4K4TA 2WK4A 2ALZA 2ATLA 5KFXA 1VRUB 4J9RA 5KG6A 1LW0A 3DRRB 2VG6B 3LP0B 5KFRA 4WZMA 4NYZA 4J9OA 1TL1A 1TQLA 1LWFA 1JLEA 3C6UA 4B3OB 4NRTA 4IH7A 1DTTA 2IM3A 3DM2A 3QGIA 1JLFB 1S1UB 4RW7A 4QWDA 2HMIB 3MR5A 4FBUA 4PUOB 4K4UA 4I7FB 3SFGA 3NAHA 5JUMA 3IS9A 3QIPA 5J2MA 5KG1A 1WNEA 3G86A 2W9CA 2B6AB 4ED7A 3KLHA 3I5BA 3MR6A 2JEIA 4Y3CA 1RTHB 4U7CA 3CJ3A 1N6QB 4I2QB 1W25A 3KHHA 2WONB 1FK9B 1IKVB 5CYQB 1OS5A 1JLCA 4ZVHA 5KFYA 4F4ZA 3MFIA 4GC7A 4J9QA 4KAIA 5FDLA 1RT3B 4EEYA 1TKXA 4Q0BA 2UVRA 3KK1B 3FSIA 2RKIB 3E01A 4QW8A 4PWDA 4DL5A 1LWCB 3CWJA 2W9BB 5KFHA 3DLGA 3BREA 3QGHA 2J6TA 3D5MA 2RF2A 4RNNA 2V4QA 1S1WA 2FVCA 4ZPAA 3SI8A 3KJVA 2C2DA 1MU2A 3DOKA 4URQU 1N48A 2W7OA 3MEGA 2QV6A 3V81A 4DL4A 4J9LA 1FKOB 4RW8B 3QIDA 1FKPA 1NHUA 4ECUA 3MTKA 4NLUA 3MR2A 3C6TA 3QLHA 4EYIB 1C0UB 3UDLA 3MEDA 1I6JA 2HWHA 2AX0A 3GV5B 2I5JA 3KLIA 5I3UA 4NLQA 4Q43A 4ECYA 2IAJA 5K14A 3BSOA 4YP3A 4KKOB 2ASLA 3D28A 1JLGB 4NLTA 1SUQB 1VRTA 1ZTTA 3CJ0A 5L9XA 5EWGA 3V6DB 1QE1B 5L1LA 4XPCA 3M9OB 4ZVEA 1UWBB 3QO9A 5HROA 1SH2A 1HNIA 3I0SA 2VG7B 4FS2A 3IG1A 4PQUA 1C2PA 3ITHA 5C24A 4O3SA 3DLEA 3I5AA 1LW0B 3KLGA 3BQ2A 4Y34A 2CKWA 3I5CA 4M94A 3H4DA 1TL1B 4ID5B 3CO9A 1LWFB 1JLEB 1LWEA 4RNMA 2C2EA 1DTTB 3GIMA 3RBEA 3DM2B 5J2NA 4NLYA 4NLPA 5KT4A 4RW7B 3KHGA 3OL9A 4TLRA 2E9RX 4O3OA 4IR1A 5HBMA 4G3IA 2FJWA 4EYHB 3KMSA 3PVXA 4ED6A 2OPQA 2JEFA 4TQRA 2R8KA 3IS9B 1S4FA 4QW9A 3QIPB 4XPEA 5J2MB 3BJYA 2UVVA 1RTDB 1JIHA 2W9CB 4NLWA 3EZUA 3QYYA 4NLOA 3T5LA 3KLHB 3PHEA 4WFXA 3DRSA 4IH6A 3QZ7A 3GIKA 3CDEA 2UVUA 2ASDA 3FFIA 3TQ1A 3IRXB 1JLCB 4MH8A 4O4GA 1DLOB 1HNVB 1JLBA 3GYNA 5FDLB 2WOMA 1RT2A 4NCGA 4ZHRA 5J2QA 2FJVA 4TY9A 4K4XA 1TKXB 4Q0BB 4RW9A 4R5PA 5KFNA 4RW6A 3CJ4A 3Q8PB 2FVRA 2HNYB 4PWDB 4TYAA 1BQMA 4WFYA 3DLGB 4RNFA 3BQ0A 4J9SA 2R8GA 2V9WA 5KFEA 3LANA 5F8NA 3NBPB 4R8UB 3N6MA 3M9NB 2RF2B 5HP1B 1S1WB 4TY8A 4QWEA 3RB3A 4H4OB 1C0TB 1MU2B 4RZRA 3UR0A 3MEGB 1KLMA 3V81B 1S6QA 2HNZB 3HVTA 3SFUA 4LSLB 1FKPB 3IGNA 3QGGA 3CIZA 1K1SA 4ECVA 1TKZA 3N6LA 4XO0A 1U09A 4ZP6A 3C6TB 2BE2A 1KHWA 5KFVA 3GILA 2BQRA 2BQ3A 1JX4A 2JLEA 2I5JB 5I3UB 3V4IA 4IRCA 1HMVA 2IAJB 5K14B 1RT1A 5KG0A 1SV5B 4LQ3A 1S10A 3JSMB 3KHRA 1VRTB 2WCXA 3GV7B 1RTIA 4MFBB 4O44A 1CSJA 4ZP7A 3QO9B 5HROB 1HNIB 3I0SB 4WE1A 2ZD1B 4IR9A 2R8JA 4IH5A 1BQNA 3ITHB 5KFZA 5EDWA 4O3RA 3KLGB 4IRDA 2IM0A 2IM1A 1HPZA 4IFYA 4NLVA 3NGDA 4Q44A 1LWEB 1S9EA 2D3UA 3NKYA 4Y2CA 4ZP9A 3V6JA 1ZETA 1EETB 1NHVA 5J2NB 2W8KA 3BGRA 1S1XA 3T1AA 5KT7A 1D1UA 5HBMB 4LSNA 4RUCA 1IKYA 2OPQB 3DRPB 3PJWA 1TV6A 2YNIB 3DLKA 3KLFB 5KFMA 3H2LA 4WXWA 3H40A 4URSA 4DL2A 5CYMA 5C42A 3IN5A 4HYKA 2ZKUA 3UPFA 2UUTA 3NL0A 1S1TA 3FFIB 4J9NA 3IGVA 3FQLA 3H98A 5KFIA 1EP4A 2ZE2A 4KE5A 4ZP8A 3LAKA 4JUZA 5DLGA 3Q8RB 4YR0A 4DG1A 1RT4B 4O4GB 1JLBB 4IQXA 2XI3A 1N4LA 3DYAB 3H5SA 2WOMB 1RT2B 1MMLA 4ZHRB 5J2QB 2GC8A 4J9PA 5C25A 1IKXB 4Q8EA 2GIRA 4RW9B 5DG7A 4IG0A 4RW6B 2FLLA 4FBTA 2OPSA 3MECB 4G1QB 2CJQA 3LP2B 2W8LA 2FVQA 4MK7A 5DGAA 2BRLA 2IC3B 2YNFA 3MEEA 2FLPA 4KFBA 2VG5A 5DQGA 5KFWA 4HKQA 4NLRA 2IM2A 2E9ZA 4TY8B 1RT6A 2B5JA 3PR5B 4K4WA 4ICLA 4K50A 1QAJA 2YKNB 4JV2A 1KLMB 4MIBA 2ILYA 1S6QB 5HLFA 4ZPCA 3KLVA 3HVTB 1J5OB 3KK3A 4KSEB 1T94A 1TKZB 3M8QA 5KG3A 5KFPA 4KV8A 3GQCA 2BE2B 2YKMA 4FS1A 2YNHA 3DMJA 5KFSA 4EBCA 1N5YA 4ECXA 1HMVB 3KLEA 1JLAA 1RT1B 4YQWA 4TYBA 3GIJA 2JC1A 5F8IA 4ZPBA 5KG2A 4WFZA 4O44B 3DOLA 5T14A 1T05A 3C6UB 4IFVA 5F8HA 1QUVA 4U6PA 3KNAA 1BQNB 1HQUA 2WB4A 5KFFA 1S9GA 2BR0A 3DRRA 4NRUA 1T03A 1R0AA 1HPZB 4MK9A 4IFYB 5KFAA 2GIQA 5KFLA 1S9EB 5C5JA 1LW2A 4RW4A 4ED8A 3V6KA 3BSCA 3LP1A 2WHOA 2AGOA 3BGRB 4ECZA 1S1XB 2JEGA 2R2RA 2WRMA 4LSNB 5DG8A 1S0MA 3OL6A 1T3NA 4I7FA 1IKYB 1C1CA 2XCAA 3DLKB 4H4MA 4YR2A 5C42B 4DL6A 2AU0A 2DPIA 2VA2A 4KHRA 3KOAA 4MKBA 1S0OA 4J9KA 1N6QA 4QWBA 4I2QA 1S1TB 5F8LA 3OHBA 5F9LA 2J6UA 3E01B 2XWYA 1EP4B 1RAJA 4ECTA 2OH2A 5CYQA 3T5KA 4EBEA 4YR3A 1JLQA 4DG1B 1ZTWA 4ED3A 1HYSA 2XGPA 3CDUA 5KFBA 5KG4A 1HQEA 1RYRA 1GX6A 1RT3A 3RB0A 1RA7A 5C25B 5KG5A 3RB4A 3KJVB 2D41A 3CDWA 3DOKB 4IG0B 1XR5A 2ILZA 4KBIA 2IJFA 4KHMA 2OPSB 3VQSA 4RNOA 4QWCA 4DL7A 4OL8A 1REVA 4J9MA 1KHVA 1RTJA 2YNFB 1S1VA 2DPJA 3E51A 4KFBB 1GX5A 2QE5A 3FQKA 4H54A 4WXOA 3OLBA 5KFKA 3QLHB 1RT6B 1TKTA 2B5JB 3MEDB 4IG3A 4ICLB 3T19A 4Y2AA 3KLIB 2VA3A 2B43A 3BSAA 4NLGA 5HLFB 5F8GA 1FKOA 4RW8A 3G6VA 5KFQA 4TXSA 5KT3A 5DLFA 4KV8B 4F4WA 5KFOA 2XGQA 2YKMB 3T5HA 1S6PA 2YNHB 3DMJB 5D3GA 1N5YB 3IG1B 4PQUB 3OHAA 2AGPA 1JLAB 4K4YA 5C24B 4KKOA 3DLEB 3TAMA 4EO8A 3DI6A 3HKWA 1TP7A 2FVSA 5KT5A 4IKAA 3DOLB 4QWAA 2IA6A 2YNGA 1UWBA 1T05B 2C2RA 3OSNA 4Q8FA 4IFVB 5DGBA
chains in the Genus database with same CATH superfamily
4HHJA 1HQUB 4TQSA 3H59A 4ID5A 2XMJA 4I2PA 4RW4B 5KFGA 1FRJA 1SL1A 1S9FA 3D68A 2XQCA 4NCGB 4LF2A 4LF9J 2Q79A 2GCFA 4DR6F 2CQ3A 3M1VA 3HK2A 1KQSR 2LP4A 3PW7A 1ZZNA 1X5SA 3GJSB 4DR1F 3RGIA 4YHHJ 3FDSA 2EK6A 3K5OA 3NOCA 4LFAJ 2DXEA 4LJMA 1WI8A 3MPUB 5A8RB 3GLJA 4AXJA 2XMWA 1T9VA 2M5YA 2ERRA 1M5HA 2EFVA 2JVOA 5B0EA 1RDRA 1XR7A 2M70A 3PDNA 4D3GA 2X1BA 5HVHA 2R2SA 2O67A 3FKBA 3C15A 2D7SA 5FIIA 1FI4A 1YSJA 2ZBQA 2GFFA 3CIMA 1Q7LB 1FRIA 4YDXA 4F0MA 2LEBA 1XNRF 4PPDA 3GYXB 3OLAA 5E2QA 1ZA2B 4LVNP 1VQSA 3IMQJ 4X64J 4EBDA 4C6AA 4NZ0A 1WC1A 4RO0A 3G82A 5D4NA 2YY3A 3CJKA 5KFXA 5ETOA 3G96A 4ZLPA 5IFMA 2CPDA 3QJLA 4DV6F 3C6UA 2LU1A 3DM2A 3TZZA 4FBUA 3MCNA 1Q0NA 2HFZA 2YWEA 2CQDA 3NGTA 4ZVOB 2DR8A 5D0GA 1U47A 1F1BB 3CCQS 3R5BA 4XK8C 1FK9B 5CYQB 4ZVHA 3IWNC 3SQGB 1H73A 4PEOA 4QW8A 1LWCB 1KVKA 1CG2A 3EGWB 1KTQA 4URQU 5IM0A 1PJ7A 2QV6A 1Y4ZB 2DBBA 2I0XA 4NLUA 2MKIA 3W9IA 4Q43A 2IAJA 3P5BP 2ASLA 3CCLS 3A13A 4LFBJ 2W25A 3WIVA 4CLKA 3R1LA 4I4BA 3TI0A 4PQUA 2OGUA 1TAQA 3G87A 5J2NA 2ZFHA 2W4DA 2BACA 4KH1B 3BBBA 4P6QA 1U0SA 2K3KA 3ZTRA 1RB0A 3GFYA 3IRXB 1VIXA 4NE9C 1WC0A 5DM6Q 2RRAA 3TW0A 4ZHRA 1WJ9A 3CJ4A 2FVRA 4WFYA 4J9MA 1HHQA 2CQ2A 3THVA 3JB9k 3UD3P 1Y5IB 1SJFA 1HHTP 1WTBA 2J0QD 1HWJA 3HSJA 1C0TB 1LEOA 3I9V9 4LSLB 3JSRA 2I6WA 4CH0S 4JV5F 2XTJP 4YY3F 2G13A 2WW8A 3NWGA 3S8SA 2DY9A 4OZJA 3DHXA 2RRBA 1UMJA 3V6JA 5D8HB 3DDIA 1TKDA 3JQKA 4KGVB 4NZ6A 5CYMA 2LKZA 1CVJA 2R7OA 1S1TA 4CWBA 2ZNZA 2ZE2A 5B09A 1FA0A 1RJJA 3DYAB 2GC8A 4RW6B 2HQDA 4FF1A 2UV8A 1LK5A 4OI6A 1KLMB 2EXUA 2DNKA 1WUUA 4P2MA 2YKMA 4DR5J 3DMJA 5CD4A 1HMVB 1WD6A 5KG2A 3HHLB 2VC0A 3IA0A 5F8HA 3K7RA 1T03A 2DH9A 4GRSA 2FD2A 3MM7A 2ZC4A 2CQGA 3GCXP 2VV5A 4LSNB 2G1HA 4LF8F 3OTOJ 3LW5C 4AE5A 1QSSA 4RUBA 4C8YA 3U7JA 1EP4B 4P52A 4OZLA 1HBNA 3VZHA 2B7CB 1KBRA 2QA4S 3JS9A 2RDDA 2Z58B 1KEKA 1KHVA 2D74B 2HG4A 5CCLA 4CO0A 4DV4F 4LFCJ 2JLGA 3PNIA 2BDPA 3OUYA 2WSCC 4ZLLA 2WVCA 2B7BB 2K3IA 5HMYA 3PYFA 4KHPJ 2C2RA 1NDPA 4BWJA 2E7WA 5DDRC 3PIOQ 4LR8A 2JC0A 4ZJQA 2MHEA 4ED0A 1VJQA 5D0RA 3H4BA 4OX6A 1YK9A 4DX8H 1FHTA 1WKLA 3MI7X 4WPAA 4O3PA 5DG9A 1D8YA 1HD0A 1CPZA 1YBUA 1JKHA 3M2RA 2GVZA 1HWUA 5GAGU 2KB2A 1S0NA 1U26A 1XTZA 2XCPA 3AH6A 3VAKA 1RTZA 1IKWA 4DU7A 4LF7F 1UA1A 1YZ7A 3CJ2A 1VRUA 3W66A 5L46A 2YNGB 1UTAA 5IV3A 2C3UA 1VQ9S 4A4JA 1Y7PA 1U7LA 2FJXA 2LYVA 3KMQA 4CZCA 3KLFA 1HKAA 4DLGA 3EVMA 4GO5X 1ZZFA 3J81j 5BYQA 2L9WA 1CJVB 3QT6A 5F3TA 4X4RA 3KXDA 2HHXA 3MECA 1RACB 4ZVGA 5HAOA 3RAQA 2NS1B 1IQZA 1KVJA 1RWPB 2LQJA 5IQ6A 2IDLA 4JI5F 1HR0F 5D0HA 2KVIA 1SH0A 4LMZA 4A8KA 5ETRA 1YIJS 4B3SJ 3WX4A 4TU9A 2Y0BB 1HNXJ 2V5HG 1X0FA 3TZXA 3KJQB 2JL9A 2B6AB 4DUYJ 2QLXA 4U7CA 2WONB 1FFGB 2H3EB 2MGZB 3FNNA 2YWWA 4LRDA 2BW2A 2UVRA 2AYBA 3FCVA 1LNQA 1YBAA 4B3RJ 1S1WA 3MEGA 3AJ1A 5E41A 4J9LA 1VIOA 2C2OB 3QLHA 1C0UB 6FD1A 3PFEA 1UFLA 3D6FB 4HR2A 3POTA 4NXNF 1REGX 1HHSA 2J7UA 3CMAS 4P73A 3C3LA 3MCSA 2DNHA 1KP6A 4L3KA 4G3IA 2JEFA 2HRUA 2Q3PA 2FHOB 3G8QA 4QBUA 3FEZA 5CHCB 1T95A 5A2QY 3ILJA 4H4KC 2E1CA 3TQ1A 5KAKA 2W01A 5E33A 1KOOA 4CLPA 5K5MA 2HNYB 1IBMJ 2PSZA 4DI6A 2DKOB 5HP1B 2KM8C 4X65F 3FEYB 4XO0A 1IR0A 2M0GB 3OPKA 5K14B 1UVJA 2MKKA 2C2MB 2CQHA 1HNIB 1XIQA 3R5CA 1Q4RA 3O5TB 2ZJRQ 1LFPA 4O3RA 3CD6S 2FC8A 2RD5C 3EM1A 3D6MB 1W26A 2W8KA 2OPQB 3Q8UA 4P71A 1W2IA 3MD3A 2L48A 3QWPA 2QGFB 3M05A 1S0VA 4M5DB 2B9WA 3Q0AA 1M0SA 1K0VA 1B7YB 1U1RA 2LXIA 2OPSA 3EVOA 1K8AT 4J37A 4P2FA 4Z7CA 2AJ4A 3PR5B 4K50A 4LR7A 1RWUA 3FMWA 3D9BA 4GKJJ 2NREA 4FS1A 3GMGA 4KPCA 2DJWA 2BABA 2QTWA 5F8IA 3ETMA 2F9JA 4M5LA 4LF5J 2DGOA 1N52B 2HFUA 2PFFB 1RHKB 3OFHA 4DR1J 2LECA 2UUCJ 3UN3A 1KVIA 3CB4A 4A48A 3OL6A 1T3NA 1U2CA 3VGTA 4B9LA 3PJ9A 8RUCA 3W64A 2K06A 2VKZG 1NUEA 3R5GA 2EG1A 4CI0B 4XDCA 1XR5A 2FZCB 4KBIA 1AB8A 3IC1A 2OFHX 1GX5A 4WXOA 3ENWA 2YX1A 1V3SA 3BSAA 4UTGA 5DDOC 1ZA1B 5ETNA 5IWAJ 2MMYA 2PEHA 5DETA 3HCXA 4PAAA 1XNRJ 4N8NA 2XO7A 3RRKA 3HHKA 4RWWA 2MXYA 3CT9A 3PV8A 1J2VA 4RU9A 1SC6A 3KK2A 3FCWA 3ENAA 3UDEA 4H4KA 3CD7A 4ZIWA 3LWLA 2WAQD 1WC6A 2HNDA 1VRQC 4P74A 3TWZA 3NXZA 1TK8A 3VALA 4A47A 1HYSB 2DCUB 4C0HA 2G0JA 1HQEB 2V4JB 2MQMA 4I56A 2DHGA 3RBDA 5C7PA 2YVSA 2OJ3A 3PTWA 5I42A 1S6PB 3RUBL 2KYZA 1X60A 1FNOA 3MM6B 2H51B 4NWBA 4X4NA 4PG5A 1N5TA 2G4BA 4NLDA 3RB6A 2P9GA 1N56A 1PC4A 3ILLA 3VR1A 1TL3B 1RTHA 1A0OB 3F56A 4OI3A 1VGYA 4LRFA 4Q45A 3QT5A 1TUGB 4F02A 3N4WA 4JI3F 3H5UA 5E3AA 2ADBA 3CDAA 1UEKA 2OPPB 1QUPA 3BS9A 5EWEA 1MN7A 2XMVA 1FCAA 4B3MJ 3M8QB 5K20B 2MJUA 1AUSL 2ZITA 3W2WA 2HW3A 3FRZA 3IWLA 1IM4A 4P9SA 1SUQA 3LGMA 3ZTOA 4IDKB 1HBMB 4J9RA 2VG6B 2AYMA 1RZMA 1TL1A 3L09A 1JLEA 4NRTA 3J7A1 4IH7A 2EFOA 2YWFA 2HMIB 3MR5A 1T9YA 4PUOB 3CF5Q 4OHZA 1S5ZA 4ED7A 4OZ1A 5EX0A 4Y3CA 1U48A 1NK4A 2HGMA 5BR8F 1YJWS 2HS3A 2J7WA 4PWDA 2W9BB 3DDNA 2JNJA 5B0BA 3NP5A 5CH7B 3TEHB 4ZPAA 2Y1JA 2OMOA 5G0RA 1SPBP 4ECUA 4DSFA 2E5JA 1XMOF 1KTVA 4NLQA 3X1LB 3CJ0A 5L1LA 4P72A 2KKHA 2LEPA 3NGSA 3Q23A 4CTAB 3FGVA 1YJUA 2DNRA 1GT8A 4YB7A 1UL3A 2MLYA 3ONQA 1W2BR 1DTTB 2RRNA 2GA7A 2DNZA 2OEMA 2Y1RI 3JAMY 4DFJA 1WKJA 2ADCA 3PHEA 4BWMA 3LPEA 1JB0C 3FC9A 2BJ3A 4CNYA 5IV4A 1JNZB 4NMLA 5J2QA 1TKXB 4HH0A 1RBOB 4DV3F 1PJ6A 2FY1A 2ZH1A 4PR6A 3HVTA 3OXFA 5LOQA 1B70B 4IOCQ 2BE2A 1RT1A 4C9DA 2A18A 5ETLA 3CXCR 2J0SD 2BMBA 1MWYA 2HQFA 4USWA 3W9HA 1U1NA 4RWXA 4NLVA 1OYEA 4FF3A 2PEBA 1FJGJ 4Y2CA 4DSKA 3HPOA 4DU8A 1HFEL 1SIZA 2R7XA 3PRDA 1H98A 2UUTA 5A0YB 5AXKA 1WSRA 4KE5A 1MW7A 1RT4B 4OV1A 2HZCA 2UXCF 4IG0A 2FLLA 2IC3B 1NK5A 3S6EA 1SJQA 4USHA 2OI2A 1X4FA 3PYEA 3CCWA 2ILYA 2CJKA 3JTPA 4KSEB 3HO1A 3NS6A 3BDPA 3ZZ0A 4ELVA 1MWQA 4WTYA 2HWTA 2Z4PA 2XNQA 1F0XA 3PYDA 3I31A 2RS8A 3AODA 2WSEC 1S9EB 3L7PA 3ZZOA 4D3HA 1YJNS 3I96A 2XCAA 2E1PA 2JX2A 1NJIT 4RLEA 4Y2KA 1DQAA 1B0VA 4KTQA 2OH2A 1FNXH 3W9JA 1NH7A 2DNPA 2EPIA 1RYRA 4ZITA 1NB7A 4KFBB 2R9LA 1R6VA 5A8KA 1N36J 3UVJB 1TKTA 1M5OC 5IZHA 5L39A 4CH7A 2QA4G 1F5AA 3J7YU 1KFDA 4KV8B 2YKAA 3K59A 4K4YA 1YX2A 3J81Y 2YWHA 3BKFA 2A3JA 1MG7A 1FNMA 4UZCA 3K5NA 2V2QA 2ZUGA 1U02A 5DZ6A 4O0IA 1ZS6A 3PW0A 1GNKA 3I4HX 4K59A 3TUPA 1CULB 3GFHA 1KSPA 4ERDA 1RHRB 1WEZA 2CADA 2DO0A 3WBZA 2V0NA 3IO1A 1CQMA 4NI2A 4EWTA 3I0RA 3MD1A 4JYAF 1QLNA 3ICLA 2GNKA 1M90T 3OVAA 2BE7D 2CUYA 2ZBRA 2HHSA 5HI7A 4CP5A 3JSMA 4B9UA 2NUUG 1S4EA 1T11A 1F2HA 2FLNA 2LDIA 4F4YA 1TUWA 5DQHA 1T9XA 4N77A 4J91A 2EC0A 4OJHA 5J1PA 3S1TA 5U47A 3ISND 3VAMA 1NPRA 4GO7X 3JQMA 3W7BA 2DHSA 4OJGA 2EEYA 3MR7A 1K1QA 3ZC4A 2ZH6A 4KYZA 1RT7B 3CEDA 2HVIA 4KB7A 3TARA 3C19A 3MOJB 2YPYA 2F40A 4G1QA 1TL4A 1S7IA 3QZ8A 4LRAA 4CH1A 3MM9B 2M88A 5HO4A 5KOWA 2I9SA 4ZS6A 1QE1A 1VLOA 3GIRA 2RQ4A 4ES1A 5BYSA 2IM3A 4WIQA 3QGIA 2CWXA 4RW7A 4I7FB 5D6GA 3KLHA 2V8PA 4C8OA 3CMES 1IKVB 1JXVA 5AJ3F 3Q22A 1RISA 3V5RA 2MLZA 3CWJA 1FDDA 3Q24A 4X4PA 4KJIA 2MQ8A 3V81A 1NHUA 3SBMA 1UETA 2HVEA 1NK7A 1ZYQA 4KGXB 2Z56B 5JVHQ 3QO9A 4F4KA 3DLEA 1YZ6A 3ADAC 3H4DA 4ID5B 3CO9A 2VBZA 1LWFB 2B4PA 3RBEA 3OL9A 1SIWB 1RHJB 1X4GA 4B3TF 2ZH4A 4ZLJA 4QW9A 2CZ9A 1GMUA 3M30B 2CVIA 1NHKL 2PMZD 3KDNA 3GYNA 3GU0A 3Q8PB 1U0HA 2R8GA 4KPYA 3DLGB 2V94A 5KFEA 5F8NA 4DPXA 1XJWB 2DT9A 1MU2B 1Z1ZA 1ULRA 3ETOA 4ECVA 1TKZA 4ZVPB 3VAFA 4FP9A 4X66F 4R0JA 1S10A 3J80U 3I0SB 3R6GB 1DY3A 4K2XA 4Y28C 4AD6A 4NA2A 2E1RA 4WFAQ 2L3MA 3PJWA 1N32J 1TV6A 3H2LA 2JHEA 4YUDA 2XY7A 4OZ5A 3PX4A 3IGVA 1NB2A 3A3OB 1ROFA 4Q8EA 5EX3A 4F8RA 2YH1A 1SXLA 2VG5A 2IM2A 2E9ZA 4F2RA 1JJ2R 2OHDA 2COLA 1S6QB 1TR0A 3KLVA 4KRWA 4I6YA 1QTNB 1NM2A 5LSRA 2XNRA 1U1MA 3AT1B 4W4MA 5ETKA 4AQYF 4CLZA 4DV7F 5B0AA 3C6UB 5AXNA 2B4VA 2ZBCA 1X31C 2BR0A 4PPZA 1R0AA 1HPZB 1GXTA 1LW2A 3V6KA 3BGRB 2XS7A 5DG8A 1S0MA 3FBFA 5LJ3Y 4HEA9 2QLFB 4H4MA 2RE1A 3ET6A 5GAHI 4J9KA 4QWBA 1HI0P 2VQEJ 4QIWD 3OR1A 4YR3A 3R27A 3K8WA 2CNLB 2HGLA 1RA7A 3CDWA 3IAM9 2YNFB 4QIVA 2DRBA 3UI3A 5H9FK 3X3UA 2KYXA 4JI4F 1CQNA 1O8BA 4PQUB 3HKWA 1IXKA 3PACA 2HQCA 4ANEA 5G4DA 1JXLA 1FTCA 2DR6A 4HDHA 4DR4F 1OPZA 2NPFA 4GVBA 1KKHA 2QMUB 1TVRA 2JDJA 4U96A 5KFCA 4DF8A 1HNVA 4I69A 1VQNS 3HD1A 4H4OA 4NA3A 3TUJC 1TL5A 1R0BG 2O5DA 4TNOA 4DZ6A 1FDAA 1E6YB 1LWXA 2E9TA 1FX2A 2FPHX 3ZO7A 3VQTA 1AFIA 2RNEA 2GJFA 4ELUA 2UVWA 3J7Z5 1R89A 3HHEA 3AD8C 2F8EX 5CYMB 1GAOA 4LQ9A 3G71S 5HQ8A 2HEKA 3NMAA 4JI2F 2ZE2B 4IRKA 1BE4A 3H42A 3CD0A 4CYUA 3DC2A 1NO8A 3SV4A 2H5JB 2HVDA 4LF6F 2KVQE 2CPJA 4NOHA 1RYSA 4OYOA 2B8PA 2BQUA 3RAXA 2UUWA 4G1IA 2WK4A 4DR2J 2KZMA 4F26A 2ZJPQ 1L3SA 3G9CA 3MM7B 3US5A 1S1UB 1KWMA 2NZ4A 5KG1A 5HATA 2ZWPA 3SCJE 4YN3B 1Q5VA 1Q5YA 2ZH8A 1T9UA 4CLFA 1FERA 2YX4A 1HBNB 3NGKA 1QSYA 1XC9A 1S57A 3PRBA 2MZJA 5LMUF 3QRRA 2RF2A 4RNNA 4FYXB 4ZCIA 3OUYB 3MTKA 3MR2A 2J6TA 3GV5B 1IJEB 4YP3A 2E5GA 2IA6A 1VRTA 3S01A 3R3TA 5F0WA 2XYGB 3I87A 1XMBA 3AFGA 3ITHA 1R8CA 3PXGa 2XYHB 1HI8A 2PC6A 1M5PC 1N33F 4HACB 3QSYB 1PJ5A 3LUYA 4RBUA 4NLPA 5CA5A 3J7AN 5J2MB 3UD4P 4DDFA 3SDEB 1UJ5A 1CJTB 2ASDA 2IVMA 3IFEA 2VONA 1JLBA 2GHPA 2F4FA 1YRXA 2YQ1A 1BQMA 1GEHA 3M2RB 4KIAA 3LANA 2GVZB 4HHHA 3ZXWA 1FKPB 4BC7A 5AE2A 3T9ZA 2AJQA 3C6TB 4NXMF 2BQ3A 2VASA 5KG0A 2SXLA 4K0KF 5HROB 4WE1A 1Q16B 2ZM6F 2CQPA 1BQNA 2IM1A 4DQPA 3K57A 2CWKA 1NHVA 5HVGA 2AJ2A 3CE8A 5HBMB 1OWXA 1KR4A 4OHVA 3KLFB 5KFMA 4ZJOA 4MIWA 4FF2A 1FTRA 1V5IB 1R6YA 5LXRA 1X9SA 4JUZA 2LA6A 1N4LA 1RT2B 1MMLA 5IT0A 2GIRA 3VVTA 2VOOA 3FCHA 3MECB 1JMTA 4WBFA 2CPZA 4M5GA 4OI2A 4NLRA 1V3ZA 2ROGA 1WOPA 5JMNA 1HIYA 2OD6A 4WU3A 3TA0A 4J7CA 4UQTA 2X3DA 4EU0A 1TAUA 4YQWA 4DFKA 3GIJA 1WHXA 3U27A 5T14A 3FZBA 4CO1A 4OYZA 3QMQA 4JYAJ 2L9NA 2OAUA 2V8DA 4X4QA 2VPZB 2BVZA 3PEHA 4ANDA 2I2YA 3M6VA 5A2QU 2KT2A 4KHRA 2H9ZA 4FXDA 4USTA 4IQMA 4UZBA 2DXDA 1ZTWA 1ZM3A 4C11B 3CPWR 2CG4A 2HHHJ 2XZDB 3VAJA 1R27B 4JBCA 3QLHB 4F36A 1QVGR 2YTCA 2VPYB 1VQMS 1D3WA 1F2GA 1TUVA 2ZOMA 4A8XA 1IBKJ 1N5YB 4ZDNA 1RU2A 3DI6A 1TP7A 4IKAA 3DOLB 3DNCA 4IFVB 1FWKA 3G8SA 4ECSA 1F60B 1S9GB 4M5KA 4QOTA 2B56A 4TN2A 3AA9A 1WHYA 4ZVUB 3M8RA 2NLWA 1X4EA 4YHHF 3C16A 2HRTA 1RWVB 1TELA 1S6OA 1WEXA 2CDRB 3K8VA 2VDHA 3DGPA 1V6HA 4HHUA 1C1BA 2QA1A 3KJNB 3D6HB 3ELHA 2EFNA 2EFPA 4LIWA 3LWMA 1AFJA 1HBOB 4MJKA 5D3GB 2YKPA 1EIYB 4BBYA 2DVIA 1FO1A 1CBKA 2EI5A 2ZBIA 3TAQA 4TKTA 3EGNA 5D0EA 1RWOB 3W2VA 3H5YA 5KFUA 1GFWB 4F0HA 2AW0A 5KFTA 1K9MT 4YOEA 2MLXA 3PJXA 4EZ9A 5L1JA 3H5XA 3KK1A 3NCQA 5KFDA 4X64F 2C2ZB 4JI7J 4GKKJ 3LAMA 4ZN3A 3H8YA 2F9DA 5F8MA 1S99A 3Q8SB 2QC3A 4K4SA 2F3JA 2E5LJ 4OX7A 1JLGA 1M1GA 4L74A 1DTQB 3DFEA 3BO4A 5BYRA 2XMMA 2NPIA 3MF5A 2VG7A 3KHLA 2KHCA 3BM7A 1JNRB 5KG6A 4YDDB 1U6FA 2E1MC 3JSYA 1I5OB 3NAHA 4ZVTB 2A2CA 2IYIA 4R25A 3I5BA 4DCOB 2ZH3A 2JEIA 1W25A 3NCRA 2A10A 2ROEA 2N4DA 3P5TL 1YJ9S 1TMMA 4DL5A 1FRHA 2RKIB 3CCRS 3QJJA 3H7HB 2PMWA 3N5FA 1H3DA 4QU7A 3K17A 1NDKA 2XYPB 3VGUA 1PKUA 2CFXA 3F73A 3MM5B 1I6JA 3RTVA 2E5HA 4NLTA 3M8YA 2XZWA 4WP3A 3BH6B 4ZVEA 3KDOA 4FS2A 4DS4A 4DUTA 2AYEA 1XEZA 4RKUC 3KTQA 1LWEA 3NNCA 1BXNA 1AYEA 4XPEA 3H2VE 4AQYJ 4WFXA 3DRSA 5CYJA 2OIHA 3HD2A 2DIUA 4MH8A 2FGCA 2BEFA 3NGRA 2Y9HA 5FDLB 2P2CB 3QAUA 2E7XA 2GQQA 4RNFA 4J9SA 2XM3A 3CC2S 1X4HA 3N6MA 3ILIA 4TY8A 3UR0A 5A8WA 3VVUA 2F1FA 2OO4A 4JB8B 2D69A 2MHNA 1LFWA 3GV7B 1NSKL 3GFZA 4IR9A 4EMDA 2KXFA 2DNLA 1S1XA 5KT7A 4CLLA 3BEGB 5GADI 1VOMA 1N0UA 2ZKUA 2RU9A 2Z30B 1JWWA 1FVSA 2ATCB 2WOMB 2YX7A 4DR5F 3MEEA 1FJ7A 3BGUA 3DRYA 5DQGA 2AZ3A 1SKWA 3ZTQA 3MMCA 4KGMA 4W98A 4I0WA 4NMXA 4EBCA 1KOHA 1WSVA 4KC5A 4P75A 2KU7A 5HSPA 3AB2B 3M4XA 1WOSA 2W2NP 3OTOF 1HQUA 2X1FA 2V63A 4IFYB 2PDAA 4RW4A 1SB6A 4OYIA 4LREA 2VU5A 1RBAA 2MB0B 3JAMU 3ZZTA 2DGXA 2BA9A 1E6VA 2F63A 3MCMA 5C42B 1WORA 4MKBA 1S0OA 2E66A 4LFCF 2DXFA 2J6UA 3A3NB 2Z0GA 2XGPA 4OHWA 2C3MA 3TUIC 1MWZA 4DL7A 3R6LB 1LQ9A 4RNOA 4CO2A 4ZK7M 1EAYC 1B0PA 9ATCB 3H0PA 4KHPF 4Y2AA 2R3VA 4C3LA 3BR8A 5F8GA 1RHQB 2KO1A 4M5IA 2LCWA 3J7ZT 4DN0A 3OHAA 2UXBJ 3EZ5A 3A8EA 5FLXY 4QIEA 4AYBD 3MDFA 4DR7F 4PABA 5J1NA 1FXLA 1PC5A 1FWLA 2U2FA 2CNKB 4J9VA 1UJ6A 2XI2A 2X51A 3CCVS 5BJRA 3CCES 1WC5A 1JLQB 2C3PA 3CULA 2CQCA 2R7VA 4M5JA 1QAIA 3KG1A 1RCXB 4ZCMA 2JRSA 4XTTA 5KG7A 1ZM4A 1KFSA 3S7RA 4K7QA 2DH8A 3WQPA 1RAGB 1U49A 3M8WA 3HHNB 2VIHA 3OSPA 2AZ1A 2MZ1A 3HHLC 1VQ6S 2HHTA 4CQ1A 4WCEQ 2VH7A 2HAFA 1QAYA 4DSIA 2ZUAA 3MM8B 4UQGA 1IM6A 6AT1B 4DV5J 5KT6A 2BJ7A 1FK9A 2OEJA 4DCPB 3N01A 3EX7B 3SQGA 4JV1A 3M2VA 3NG8A 4AL6A 1LWCA 4AXIA 3OQ2A 2QIFA 1UKUA 1Z2LA 4PYAA 4B3SF 3C66A 3LP2A 1X4AA 1HNXF 1YRTA 4WKRA 1SJ1A 2CPXA 2ZVSA 2GO8A 1J5OA 4CO5A 5J1EB 1M5KC 1S97A 1YHQS 1DZ5A 3J81U 1SL0A 4A46A 3LP0B 1VFJA 2EFQA 2HKEA 2FHMA 4FZVA 5I3PA 4YFUA 2HVHA 3GJTB 4K4UA 2DNGA 4OYWA 4IYQA 4CIOA 1WNEA 2J8AA 3HI9A 4OZ0A 4B3RF 2F65A 4K0KJ 2JH3A 5CQGA 2X7IA 5DJBA 4EEYA 2VFTA 2MZSA 1AA1B 5DG7A 5KFHA 3BREA 2XG8A 3KG4A 5E3CA 5A8KB 3KJVA 3DOKA 1N48A 3QT7A 2VZ9A 3EICA 2HFSA 1L3KA 2BV3A 4DR3J 3TX0A 1I1GA 2J9CA 1NLKL 2HLTA 2UUBJ 5C24A 3I5AA 3AOBA 3IM9A 2DCLA 1FESA 3QIPB 1ZPWX 3GR1A 2UVVA 1L3UA 3BN7A 1JIHA 2W9CB 3EZUA 3P45B 3QZ7A 2LEAA 3D67A 3WX8A 4I6AA 4Q0BB 4NI2B 1DRZA 4RW6A 3OR2A 5LSLA 2M8HA 3UO0A 3P96A 5CXTA 1KLMA 1U4BA 2LQ9A 4YB1P 3CIZA 1PGZA 4ANCA 1F5BA 1NZAA 2JLEA 5I3UB 3R5JB 1HMVA 3JSMB 3KHRA 3HHLA 1RTIA 2GIFA 4ZP7A 3AAWB 2PN6A 5KFZA 1CJKB 3RRHA 4ZCLA 1HW8A 1FE0A 4M1KA 2A6MA 4LSNA 4U67Q 4ED4A 2R7TA 4DX7A 2NXEA 2FQQB 5K8PA 4WJBA 1EP4A 1JJCB 4IUFA 4GKJF 4RW9B 3SCIE 1YG0A 4G1QB 2V69A 1GQEA 1U1KA 4LF5F 3B4MA 2UUCF 1UW4A 3CCJS 2QN6B 1AZSB 5HMZA 5H1SV 2HK2A 2KZZA 4U6PA 3M32B 1PO6A 3QFHA 1X4DA 2W4PA 1SCJB 3JSBA 4Z2XA 3TEGA 1NSQA 3I4PA 5MAOA 2N4CA 1X9WA 1U25A 3UN2A 3KOAA 2VBXA 4I2QA 3T5KA 4EBEA 3MGJA 4N5SA 4ED3A 1UP1A 5IWAF 5C25B 1ZOTA 2ZHOA 4PG8A 3GYGA 4NEYA 4TU8A 3OLBA 4FN5A 2GO9A 3NLCA 4P10A 1UPPA 4LBHA 5KFOA 4USJC 1JLAB 3DLEB 1UZDA 4EO8A 3CUNA 1T9TA 3OXLA 2YNGA 4J9UE 4U95A 3J80Y 2V2KA 1H7XA 1DARA 1YJTA 4FYVB 1N8RT 4PXEA 3OXGA 2E29A 2QT7A 4E0DA 1FRMA 4CO3A 3ZZZA 1T0TV 1EX8A 4JI6J 1U0HB 1CJVA 2H5EA 1SQEA 2DNOA 1YITS 1QY7A 4F2SA 1WEYA 1S1VB 2IVYA 4PWUA 4USMA 4IG3B 5K8MA 1ACMB 3FBEA 4PG6A 2VFUA 3D4JA 1UVMA 4QR2A 3SV3A 2XSFA 1UFWA 2HAIA 1JK9B 4CT8A 2LQBA 1SV5A 2OLWA 3TAMB 4CNZA 3DLLQ 2PGCA 4U9RA 1JQGA 2KRBA 1IBCB 5DM7Q 1TV6B 2HFNA 3H25A 4W92B 2W7AA 2B6AA 1N54B 3CJ5A 2V9KA 1VQ5S 4DEZA 2WONA 2MGZA 4B3MF 3PFOA 2HK3A 1SVDA 2ZVIA 1NZ8A 1UVIA 1QTMA 2VG5B 3BF4A 4I6WA 2OPRB 3QT8A 4ECWA 2BANB 5KT2A 4CM0A 1C0UA 5J2PB 4K5SA 2YKNA 2C42A 3OJUA 3PR4A 3M8PB 5SUHA 2AQ4A 1S59A 4ZVFA 1WF2A 2RT3A 1VHFA 2IRXA 2DHHA 4ELTA 1HNWF 3EMTA 4RUHA 3UR3C 5I3QA 1U24A 1MLAA 5DDQC 1HBUB 3BKUA 2XLKA 3G86A 3K0JA 3Q8VA 2DYAA 3THTA 4M5HA 1YLXA 1XNQJ 3R1HA 1F9HA 1TL7B 2N82B 1XMQJ 2ZDPA 3GZ7A 2P6TA 4YB5A 4OX9J 3UDCA 2W2QP 2W7OA 3GSIA 4HI1A 4DSEA 2D3OR 2QL5B 3IR6B 2QLJB 5K14A 3V6DB 1T8EA 4QYZK 1HNIA 1L3VA 3AOCA 1PYOB 3OTDA 2VKRA 2K7KA 2HVZA 2OPQA 3IS9B 3MZIA 2DEIA 4NLWA 4NLOA 2J5AA 2UVUA 4RX6A 1IN0A 4WWSA 4PQAA 1U1QA 2APOA 1HNVB 4I68A 2HGNA 4TY9A 1RUSA 1TFWA 2CJBA 3W63A 3OJSA 4H4OB 3HFKA 2Z2MA 4ZCKA 4Y6IA 3IGNA 4OYBA 4OIXA 4ZP6A 3SCLE 4CO4A 1FJGF 3UW1A 1UEUA 1C4AA 5AE3A 1SKUB 2LVWA 2FHJD 4FPIA 1Y3JA 2ZNYA 2LDYA 2VFSA 2FY8A 3UWTA 2KG0A 1EKSA 5HJYA 1VDHA 3M7VA 3MMAB 3O2IA 3FFIB 2CAJA 4LF1A 4A8YA 3FQLA 4FNIA 5KFIA 1VK8A 2MQOA 4DR7J 5HJXA 5CABA 1R8BA 1H6KX 2ZOFA 2BRLA 4HKQA 4C7QA 2M7SA 1R8AA 4MIBA 2WVEA 2DY1A 1NK6A 3MAAB 1UWAA 3P8BB 3GQCA 4B02A 3QBCA 3FJ2A 3TVZA 1SQFA 4ZPBA 4DV1J 2HIYA 4O44B 2Q43A 4E8UA 2QYCA 3TUZC 1VI7A 4JOUA 1OSDA 2PE8A 2HPUA 4ECZA 2JEGA 3T1HJ 1NH8A 2E44A 5GADU 1H2VZ 1N36F 4C8NA 2XWYA 2YPZA 2ZH2A 2WB1D 4PWWA 1FD2A 1HYSA 1HQEA 1RT3A 2ZH9A 4OL8A 3UCGA 4ZKAA 3E51A 1RXOB 4X4OA 2B5JB 1J5EJ 3BPDA 2KT3A 2FJAB 1FKOA 4RW8A 2M2BA 4L76A 4YB6A 5KT3A 4TXSA 5M2RA 3RR8A 1S6PA 2YNHB 4NYOA 2GX8A 1BUXA 1VQ8S 2K8GA 1RU1A 1S7HA 3FBBA 1KQFB 3LTOA 1RWWB 3GV8B 3PEJA 2AGQA 4A8OA 3HVWA 3B6BA 1QD1A 2VFVA 3MFHA 4DUZF 4ECQA 1TL3A 1IWAA 4FKXA 2HHVA 2VPWB 3TJ9A 1D0EA 2GJ2A 2OD4A 1RSCA 2YWKA 1Q8IA 5HQLA 1RAOA 1BQMB 2W9AA 3AD9C 2AX1A 3A8IA 3RG6A 1P9QC 4V19J 2OPPA 5F8JA 4USVA 1REVB 1RTJB 1OY9A 2A2DA 4WZQA 3U02A 2IIHA 2F8HA 2IFXA 1SI9A 5EWFA 4QZVB 3L7OA 3HVAA 4WE1B 2AEMA 4IDKA 3PKMA 2XS5A 1YJVA 2VG6A 1X7VA 4P7TA 4DQIA 2HMIA 1YGYA 4PUOA 4Q7AA 4XIUA 4CRJA 1PYTA 3AOAA 1RAHB 4MIAA 3I9ZA 2VFRA 4ED2A 2R7SA 4ES3A 3DRPA 4JI1J 3PYGA 4YMEA 2RSQA 5DDPC 1D8ZA 1O0PA 1V5VA 2W9BA 3GFXA 1FJCA 3SIPB 2NR0A 7FD1A 3RB3A 3UE2A 4X62J 2HYIB 1YKWA 3TA2A 4EK2A 2HSEB 4WYWA 4KO0B 2CJXB 1Y5LB 4NYPA 2Z2LA 4CTAA 1JXEA 2ZH7A 3MEKA 3Q2TC 1TQLA 2VQFJ 2W2OP 1DTTA 3CDBA 3KNGA 4ZPTR 3SFGA 1SJRA 2J9DE 4A8MP 3MR6A 2V68A 3AJ2A 2Y8YA 1VC0A 2KH9A 4RBTA 2O66A 2ZZTA 1TKXA 4OLPA 3E01A 2VBWA 4C8LA 2GGPA 1ZM9A 4M5NA 4B9NA 3GTYX 2FVCA 4DF4A 1RAFB 2HWHA 1MNEA 1Z2ZA 3D28A 5EWGA 3HSGA 1NKCA 4F3OA 4ZA1A 4UY85 1LW0B 3B82A 2F7VA 2CKWA 4WKYA 1WG4A 1Q82T 2RQMA 2CPIA 5K8OA 5CD4H 3T5LA 3M2UB 2ABYA 5A0YA 3A12A 1RQ0A 2DNQA 2EFGA 3HT0A 2WW4A 1KQKA 3MPDA 2FJVA 3PKYA 2IPOB 4WK3A 2OKQA 3SYZA 3PCOB 2HQGA 3VF0B 1PG5B 3GE9A 5A6PA 3PO4A 3ZTPA 4TLQA 5IC4B 2VICA 1H72C 1ITPA 3Q86A 3E3XA 4LQ3A 3TJAA 1N32F 2OTJS 4IH5A 5EDWA 5H9EK 3BGLA 2OSRA 4Y00A 2UUAJ 1S9EA 3AJDA 4FYDA 4AFFA 1KS2A 2H5IB 3QGPA 1Q86T 2DGTA 2RAQA 2QJ3A 5AE1A 2QRRA 4O4GB 2JJ4D 1A6LA 4G65A 1AROP 2CJQA 4ZVRB 2XLIA 4KFBA 4NX9A 4JI0J 4QYRA 1D09B 3UVJA 3OFFA 3MPVA 3FSYA 1RBLA 3DXBA 3Q83A 1CJUB 4KV8A 1M1HA 3CO0P 4TYBA 1FF2A 1DJ0A 1VS3A 1CC7A 2QL7B 1UFKA 2GHWA 1OQ6A 3KNAA 3EE3A 2IRYA 2YQ0A 3A1YG 1OY6A 2HBQB 1ZAWA 4WU2A 5GMEA 5GVQA 2VQEF 5C5JA 5CAAA 4ED8A 3IAS9 2B51A 1IKYB 5A6WA 1WC3A 1VJWA 3DLKB 2HHWA 2EK1A 1ZM2A 1U45A 3K5MA 5THWA 2N3LA 4DG1B 3TANA 2HHUA 4FYYB 3I6PA 5KFBA 3F0NA 2MZQA 2KJVA 3RU0A 3KHHA 2G9OA 5D78A 2DPJA 4H54A 1VK3A 1PBUA 5IXUA 2XHWA 3UCUP 5B0GA 5HLFB 1P6TA 2HZAA 1SC1B 4HT5A 1NRKA 4Y65A 5HVFA 2V6AA 2DGWA 2XGQA 2NYIA 4LVOP 3CCSS 4FF4A 3R7BB 3G8TA 4QCLA 2FVSA 1T05B 2FJBB 2K1RA 5K8NA 3OSNA 4F50A 3LP1B 1RE1B 3DRSB 1NSAA 4ZPDA 1C1CB 3HZEA 5C2CA 2XWXA 4RNHA 3BQ1A 2ZWOA 3LALA 5EUHA 3ISZA 4F0KA 4ILMA 2CQIA 4WYLA 1HNWJ 1YVFA 1RT7A 2HHQA 3L9ZA 2BBEA 1B64A 3TNVA 3GR0A 3MMBB 3TZYA 2IDEA 1FX4A 2P6SA 3CJQA 2V4RA 3GP9A 3BKTA 2HNZA 8AT1B 1BHNA 4URGA 3UFCX 1WELA 2V67A 1MROB 2BJ8A 3HHDA 1IBLJ 2MZTA 1KQGB 1HL6A 5GMDA 1WACA 2EG2A 3CJTA 1I94J 2WBRA 3HMJG 4NPOA 2KDOA 1IKVA 4B9VA 2R2UA 2MQPA 1RT5B 1WF1A 3TVKA 2CVEA 4EFAC 3MEEB 2GS8A 2JEJA 3W5YA 4DQQA 2V8VA 4CLYA 3NEKA 4DR2F 3O3LA 2RMLA 4ECRA 3JYTB 1FD8A 1HQ2A 2IA0A 4OZ3A 4OHXA 3R5AA 4DPWA 3E2EA 2ATLA 5FLXU 3VV2B 3K2YA 4Z7YA 4NYZA 2MY7A 1LWFA 4B3OB 1JLFB 3RZAA 2OFGX 3LPYA 3HLUA 1E6VB 5LT5A 1RWMB 2MDAA 2RVJA 1KLNA 2HURA 3M30A 2DGSA 3Q2SC 3OVBA 4F4ZA 3L7UA 5F0UA 2JOQA 4Q2LA 1OYDA 1UW9A 3DLGA 3OTEA 3D5MA 2XULA 5LMNJ 1WDTA 2V4QA 2E5IA 2MZRA 1MU2A 4USKA 1YJRA 5E5NA 2KRRA 4WIIA 2KT5A 2KG1A 1QVFR 3I0SA 1Q8KA 2RJZA 1NEEA 3PG9A 2EC2A 4Y34A 1VQYA 3VCDA 4A8FA 2J9DA 1VBKA 3KMSA 2R8KA 2GQ2A 4Q2MA 4W90B 2ZHAA 1Y00A 3BJYA 3UN5A 3AA8A 4U8VA 3GIKA 1VBZA 3CDEA 3EUNA 2FYXA 1JLCB 2Y0SD 4QU6A 2IY5B 4OX8A 3A3PB 3R2DJ 1RAIB 5T7LA 1I3OB 4RZRA 3RBXA 1S6QA 1VQ7S 3MUVP 3QGGA 1K1SA 2QMWA 1U09A 1JX4A 3C46A 2I5JB 2JZ5A 3V4MA 3B54A 4DX5A 3GG0A 4GVLA 1HW9A 3IBCB 4FXVA 4Q5VA 2JLFA 3K89A 1FXDA 3HXMA 3KLGB 2IM0A 1RHMB 1HPZA 3RW6A 2XB2D 3FMBA 3UNGC 4ILRA 4FPRA 3BGRA 5B0DA 3EJMA 3T1AA 1YRUA 2EW9A 1K0TA 5DZ7A 1Y10A 3LO3A 5RUBA 3M2VB 1EZZB 4ZP8A 5LXYA 4YR0A 3LQVA 1UA0A 4ITSA 2XI3A 1WG1A 4FKYA 1SJ3P 2RUSA 4EZ6A 3LP2B 5DGAA 2FVQA 2YNFA 4DUZJ 2WVFA 4K4WA 2CDQA 4G1PA 1J5OB 5KOXA 1R7IA 1NPKA 1ZAVA 3M8ZA 1CS4B 4EI2A 7AT1B 1OIAA 1PIEA 1FRXA 3DRRA 2G2YA 1BMQB 2H54B 1VQKS 5KFAA 5KFLA 1BQXA 3N79A 4ETXA 2AGOA 2DNNA 1EARA 1GXLA 4IO1A 3VGVA 2FHJA 5ETSA 1T9WA 2HHHF 2F4VF 3DGVA 2VA2A 1N6QA 2ZJQQ 5F9LA 1FRKA 2GVDB 4CT9A 1FWPA 2EBEA 3VTIA 3KJVB 5ETPA 3DOKB 1IBKF 4QWCA 3MPYA 2HFVA 1RT6B 4ICLB 1PAEX 3G6VA 4F4WA 1E6YA 1O6XA 2G0CA 1YI2S 2NUHA 3U1NA 2QZ8A 5C24B 4KGKA 1G4CA 2FLOA 4Q8FA 3GCWP 2DK2A 1XR6A 2B3TB 1YJ7A 2LQ8A 3KUGA 2BKOA 1G2EA 3KJFB 1VC5A 1B0TA 4USUA 4OV6A 1F6TA 3UD5A 4LIRA 1RTDA 4J5OA 2HBZB 5IT9U 2C28A 4QIGA 4C4WA 2MKCA 1YWXA 4R0EA 3CW2C 3OR2B 2IVFB 2XMUA 4K4ZA 2UXDJ 4F4AA 2M3DA 1FFWB 2HBYB 2U1AA 1ZAXA 4DPUA 3J7YI 4R8UA 5KTQA 1M5SA 3PW4A 1Y9OA 3PW2A 3T6BA 1BLUA 3BGFA 1GTEA 3ENVA 1RTIB 3G6XA 1TZ0A 4MAKA 2AJFE 3TYTA 3D0IE 1Q53A 3R2CJ 3KFWX 3D1QA 3QRQA 1S1UA 8ATCB 1FRLA 2YWGA 4I2PB 1N5SA 3DU5A 4JI7F 4OYXA 3PM9A 4GKKF 5HL7Q 4FVMA 2QG9B 5IOLA 1HNZJ 2E5LF 3M1VB 4DV0F 9RUBA 1IKXA 1X4BA 1RP5A 4WK1A 2X1GA 3TRGA 2B4UA 2RQKA 4UY8T 3Q8QB 4NLSA 1CLFA 2HRYA 3GONA 2R4FA 2MQLA 3EZOA 1NKEA 1LV5A 3QSIA 2EKYA 3D3BJ 1WG5A 1OQ3A 3MHYA 3T1YJ 4A8QA 3FSXA 4NZ7A 5B08A 1DAXA 4HACA 1X9MA 2RQCA 2KFZA 4OI0A 2V8HA 5JUMA 5J2MA 4PZVA 2H4YB 3SDEA 3C15B 1CJTA 4ALZA 1OPIA 4I2QB 2BYCA 4Z37A 4P2XA 5KFYA 3MFIA 3FSIA 1V9OA 2P9EA 2EKNA 3G2XA 2JVRA 2BUNA 2C2DA 1Q1KA 4JI8J 2ACMA 2Z57B 1FKPA 3AXKA 4UOHA 3M8SA 3WIUA 3C6TA 2RS2A 3MEDA 3KLIA 2PI4A 3HJVA 1KRPA 5L9XA 5B0FA 3NY0A 5HROA 2UZAA 2A6OA 3G82B 3CJKB 2D1CA 3IBWA 3GSDA 5ETTA 1NK9A 3DM2B 3KHGA 2NSBA 2E9RX 5EN1A 5HBMA 4EYHB 1F5CA 4U7UD 2G1DA 4TVAB 3P3DA 2DR7A 2AEJA 1H2TZ 2KL8A 1RT2A 3IR5B 4K4XA 4HI2A 3PX0A 4TYAA 4LRBA 2FDNA 5IM0B 1NK8A 2FIUA 1Q7YT 2BQRA 3V4IA 2IAJB 3W1YC 1SV5B 2MQNA 1EB0A 1HLWA 4N56A 1IVZA 3DN9A 3C14A 2HZVA 5J2NB 4UOFA 2BE9B 1F3VA 3SSQA 4B9TA 2EBGA 3W5XA 2AJ0A 3IN5A 4HYKA 2N7YA 3MUMP 1SJ4P 1FDBA 4KY3A 1NXIA 1A9NB 4IQXA 4C11A 4J9PA 3F44A 4ZHRB 3KWMA 4ID8A 3R5DA 1TMJA 1B7FA 3TAPA 1J27A 3C2PA 2E7VA 3U1LA 1WHVA 2YKNB 3RW7A 4ES2A 1T94A 2B9EA 2OSQA 2NXCA 1N5YA 3KYLA 3I55S 2JC1A 4WFZA 1X5PA 3FEXB 3DOLA 7FDRA 2BJEA 4IFVA 3Q89A 1VHIA 2QSFA 1S9GA 4MK9A 3MAQA 3V2UC 1K47A 4LBPA 1PSDA 3W62A 3BSCA 2GQCA 1B3TA 3Q8YA 4OMFG 2BOAA 4DL6A 1GMWD 1GMVA 1EQ0A 2Y1IA 2GW8A 1S1TB 3VZIA 2LA4A 2W24A 2B0GA 2YBVA 3B78A 3SCKE 1X5OA 2IJFA 3PRVA 2UXBF 2CNOB 3T19A 1Q79A 5HMWA 1SKSA 1HBOA 1YDLA 5KFQA 4LUBA 3TOQA 1EJ7L 2YKMB 3DMJB 5D3GA 4QJVA 3QPIA 4HVZA 1ZBTA 2MY8A 5KT5A 2V8GA 2PA8D 4C0OC 5DGBA 3DU6A 3OT9A 4MTPA 2Y1LB 1T03B 2XS2A 4PXDA 4N41A 3AD7C 4RBVA 2RDIA 1EHWA 3G6YA 1VLYA 3ZTSA 3EPGA 2VJUA 2DB1A 1L5UA 4DX6A 1OMSA 3B8HA 1DQ8A 4IOAQ 4MKYA 3QAEA 1DLOA 4OYAA 5KFJA 3PO5A 4NLXA 4NEZA 4USIA 3NAIA 2BW7A 3NBPA 4YS2A 3DOMA 2C1EB 4O3QA 5LJ5Y 4IOBA 4CDIA 4DR6J 3HHLD 2KFNA 4MYUA 5L1KA 2H48B 1DTQA 5EGYA 1R8HA 4F04B 1VQPS 2W7PA 5SZTA 4DV5F 2MPUA 3RJMB 1RHUB 2ZD1A 4I67A 3PW5A 3NMRA 4X2BA 2IBKA 4QPXA 3I56S 1NCLA 2RB7A 2MSSA 2G0IA 2VF3A 3CC7S 1I51B 2C22A 2KHDA 2D9OA 2WSFC 4KGZB 2PMHA 3LH2S 1RWXB 1KC8T 4C97A 4Y2IA 4N47A 2VUGA 1EQMA 1AW0A 2RKIA 4FYWB 3BR9A 2KJWA 3ZNUA 2J0XA 1JKHB 2H4WB 2AEFA 3HVRA 2AWZA 2RDJA 4M95A 3MURP 4QR0A 4WFBQ 3MM5A 1KN6A 3TO8A 2JSXA 4S0MA 3IP0A 1W7WA 2E1AA 2C3OA 2DGQA 1IKWB 4C2MA 1GXUA 4K4TA 4F3MA 1H74A 1VRUB 2C3YA 4Y2MA 2MJNA 3MPWA 5CZXA 2RIJA 2DD8S 2Y3YA 5D77A 1RKIA 1APSA 3CJ3A 4DV6J 2FZKB 1O5JA 4Y0FA 5FDLA 2BM1A 1RT3B 4DR3F 1R43A 3K5LA 1S72S 1G1XA 2UUBF 1FKOB 4RW8B 3OD2A 2Z2YB 3NNHA 3BSOA 4X84A 1Y3KA 1XERA 1VISA 2MTLA 1MN9A 3W61A 2Z8QA 5HK4A 4ER8A 2XSJA 5LSOA 1SBRA 1NMEB 1TFYA 1RABB 2QL9B 1BWEA 1UVLA 2WOMA 2AF6A 2J9EA 4R5PA 3OTCA 2DHXA 4KQZA 4DWIA 1S1WB 4QWEA 4P2SA 3MEGB 4OI1A 2F4VJ 1FEHA 4WTOB 2CJ9A 3LF0A 3N6LA 4CLSA 2JFDA 2DNMA 5KFVA 3HX9A 1DQ9A 2HFOA 2BKPA 1FFSB 3POTB 2ZBPA 3OV7A 2ROPA 1RKJA 2V2ZA 4ZPWR 3H90A 2OP5A 3HKZD 4JV5J 4IFYA 3NGDA 3ULHA 4YY3J 4RUCA 3DRPB 2DIVA 2G2ZA 4DL2A 5C42A 4OHYA 3DLHA 3UPFA 1NSPA 3H98A 2ACYA 5DLGA 2RHSB 3JXOA 1S6UA 3TR5A 2VJVA 4L75A 2YQ3A 3EDQB 4A8WA 4HT7A 2BJ1A 1WKKA 3KK3A 1RGVA 5KFPA 4ECXA 3D1OA 3KLEA 2FZGB 2QLBB 3BBCA 2WB4A 2P8IA 4NASA 2FJEB 2BXJA 1S79A 2VPXB 1RCOB 1JJ4A 2FUG9 1U1OA 1IUJA 3QRPA 4YR2A 2XY5A 3T6JA 3RRGA 4UUWA 3OHBA 3E01B 1RAJA 3GJRB 2GGPB 1JLQA 2M4MA 1GX6A 2HBRB 3RB4A 3VQSA 2OPSB 4LF8J 2B9XA 3WC0A 2VA3A 2OUGA 1XBWA 2ZHBA 3HFVA 5I4MA 2DH7A 4KKOA 4XDDA 4DV0J 4I1TA 4DV4J 1UWBA 3NS5A 4RJVA 3MM8A 2UV8G 4MYTA 4JI6F 1U1LA 3VHQA 1CC8A 2MSTA 2AKWB 4GC6A 1IR2A 5A76A 1GK8A 4PRFA 3QFWA 3BSNA 1A7GE 1NK0A 4WP8A 4X4SA 5ETMA 1SC3B 2VL1A 2PI5A 2CPYA 3ENQA 2W1BA 4HTJA 2GAHC 4ATNA 4UOGA 2DGVA 5J1EA 3TVYA 2R8IA 1TU0B 1PILA 1VBYA 3LP0A 3PZPA 5GAEI 4MFBA 4UUXA 3HF5A 3DDKA 4BDPA 2P9CA 1RA6A 4LF7J 3KK2B 3IM8A 1EETA 1OO0B 3SZ2A 1HD1A 1HARA 1NAQA 3UNYA 4ZN1A 2YNIA 4PKDB 4LF4F 1U2RA 2HNDB 1U6ZA 1IR1A 4OZNA 4QYZJ 2X3GA 1P8GA 2KM8B 4ZPVR 3CCTA 2QMXA 1IWGA 4BCAA 4LBIA 4EUVA 5I42B 2PO4A 2FVPA 2XLJA 2ALZA 4L72B 1WDDA 4AL7A 5KFRA 4J9OA 1XNQF 1P1TA 5E3RA 4JI5J 1HWKA 1HR0J 2C2KB 3A8KA 1NU4A 1XMQF 3QIPA 2W9CA 4V19X 2ZZNA 1RTHB 4OX9F 2AJ1A 1OS5A 3NWRA 4DFPA 3H20A 4Q0BA 3SI8A 1S76D 2RU3A 2L08A 1RWKB 1WOOA 2CQ4A 4DXLA 2YH0A 2RUGA 3TP2A 3R9LA 4ZLNA 2K2PA 2AX0A 1R8PA 5I3UA 3W2WB 2EWHA 1SUQB 4C48A 2LMIA 2WVDA 1UJ4A 2R7UA 3BBFA 2K1RB 3VAGA 1SH2A 3VAIA 2QYGA 2NYHA 2F8MA 3IG1A 2CJAA 2DR9A 1C2PA 1CJKA 4DV2F 4CM2A 3AB4B 4QQBA 3JTNA 3DHWC 4M94A 1TL1B 4RNMA 1JLEB 3QNWB 4NLYA 4EGLA 4IR1A 2O01C 4PG4A 3PVXA 4NXNJ 2OEKA 2DO4A 3R8YA 1WHWA 2CG8A 2YKOA 2DHAA 3GJQB 3MMJA 1H7WA 4NCGA 2CQBA 4OJ3A 2KI2A 4RW9A 2FTRA 3BQ0A 4PWDB 1DFDA 2V9WA 2D3O1 2DRAA 2HQIA 2UU9F 2AV5A 1VR6A 3LOUA 2XY6A 2HQ3A 2HNZB 2MYFA 5G0RB 3SFUA 4NCBA 3KG0A 1RADB 3GILA 1S77D 1AZSA 4C8KA 5A8RA 4K5RA 1CSJA 2IHR1 1NDCA 4AL5A 2ALYB 3M32A 4X65J 2R8JA 4LR9A 2UP1A 1T02A 1U8WA 2GJIA 3NKYA 1VCTA 5F41A 4DLEA 2HS4A 1ZETA 2GHVC 2GMJA 3QJPA 3FUYA 2YKQA 4WXWA 1F3FA 5C2GA 4OQJA 4J9NA 3Q8RB 5GAHU 5J2QB 3NS7B 5DS7A 3TQEA 5C25A 3VAHA 2OMLA 4IO9Q 2FHKA 3W8PA 4DV1F 1T7PA 1DHMA 4JV2A 4PCQA 4ZPCA 3HVTB 3L3CA 1R3NA 2BE2B 1G6BA 4CLWA 1JLAA 1RT1B 3BO3A 4OZ2A 3T1HF 1VC6A 4NRUA 4DSJA 3IXQA 2GIQA 3SSRA 5GMKa 2WHOA 1YBTA 2CJYB 2R2RA 4HL9A 1YTYA 5F8LA 3ZNJ1 1J5EF 3JQJA 5CYQA 4N8OA 2O1PA 3N9UC 4C3MA 3RBZA 5KG5A 4IG0B 1RK8A 4ZIVA 2KN4A 4ILLA 3RAMA 1NBEB 2L41A 1S1VA 4MT1A 1X8DA 2QE5A 3AY0A 3AQOA 1H38A 4IG3A 1PCAA 3FBCA 3CJ8A 3EWGA 2CA9A 4FXWA 1EKRA 2FB0A 3TAMA 4JP8A 1FE4A 2Q6BA 2V34A 4U7UK 2RHQB 3M6WA 2J76E 1U2FA 2AD9A 4LRCA 2IMOA 3P6YC 2MKYA 2R2TA 1B4SA 2J6SA 2XEXA 4E98A 3BN4A 2D9PA 3M6UA 3A4TA 3IRXA 1SH3A 2IYGA 4EO6A 3GB0A 3HSZA 3FRYA 5T7LB 1GMWA 1Q8LA 2OPRA 3OBIA 3D0GE 3WZ0A 1JJHA 3T9NA 2DEJA 2BANA 1ZPVA 2XC9A 1TKTB 2PIIA 5J2PA 3ZZPA 1C0TA 3M8PA 4LSLA 1LK7A 2HIQA 3DRXA 5DO2A 3G6ES 1RLCL 1WF0A 3L4BC 4F25A 3NOGA 5DQIA 2IJNA 2CNNB 1Y11A 2XMKA 4JI1F 5K9FA 2HS0A 1S12A 5D4PA 1ELOA 4MK8A 4JV0A 1Q8BA 1HBUA 2BRKA 2XMTA 3QWUA 1GH8A 2P5VA 2B4OA 3N0VA 3THPA 3V6HA 4B08A 5E3QA 1TL7A 4X62F 2BJDA 1RLDA 2WTFA 3LA0A 4OJ1A 5BXIA 3DYAA 4O0NA 1Q81T 3I0RB 5D4LA 4JI3J 4L3NA 4O4RA 2VQFF 3AQPA 3UQSA 1V3RA 5L9NA 3V6DA 3P4UB 2PD1A 3OFGA 4OLOA 1DBDA 4DPOA 3SQOP 2XZTB 4C3KA 2VODA 3DRRB 3R7NB 3ZZYA 2YXLA 4TU7A 4DQRA 1VYAA 2NSCA 2Z2ZA 1TK5A 3D0HE 3IS9A 1PBAA 3D6TB 2KXHA 1N6QB 1N88A 3CNQP 3CCZA 4KAIA 2LLZA 5IT9Y 2ZKTA 5H9EJ 2A0FB 2MKJA 3L95X 3PIPQ 4B17A 5BR8J 2A1BA 2WBMA 2Q66A 1QAXA 2PFDA 2X1AA 3UDLA 2CYYA 1M5VC 1F9FA 1P27B 1QE1B 4X4VA 2JFKA 3K5PA 3AHPA 3RR7A 3OW2R 3MUTP 3BQ2A 5AXMA 3R97A 5FD1A 1XMOJ 2FJDB 3GIMA 4RW7B 2B8QA 2MKSA 2V50A 4ED6A 4TQRA 2R42A 4DL0C 1RTDB 2LXUA 3QYYA 3ZFVA 3KLHB 4WFNQ 3MMAA 3FFIA 3BYPA 5LL6d 5B7WA 2DNYA 3CMQA 2IRUA 3D3CJ 1XWLA 3ZZUA 5KFNA 2VDIA 1LXNA 4R8UB 4PXCA 4U8YA 1H0HB 3V81B 5L8RC 3MAAA 3G4SS 1XK8A 1N34F 3EXYA 4L6V3 2AYGA 1OY8A 4PYDA 2UUAF 4IRCA 4E2FB 1AUDA 4X4TA 4O44A 4DV3J 3QO9B 4DSLA 3MXHP 1FXRA 3F41A 4Q44A 2D3UA 4M5MA 3MAHA 2KFYA 3EVWA 1URRA 3BYRA 3D54A 4JI0F 2J0WA 3EGVA 2NXJA 3D2WA 4FVCA 3HJFA 1IKXB 3BH7B 1IQTA 2W8LA 5E0OA 1SL2A 5KFWA 1R0CB 4M63A 3AXMA 4B9SA 2B5JA 1QAJA 1Y5NB 3I82A 1TKZB 2CIMA 2O3DA 2UXCJ 4DS5A 1GTHA 2YNHA 2M8DB 4HDGA 2NXNA 3MTJA 1SQGA 2W4CA 5KFFA 2XHCA 5FJ4A 2DISA 2Q1LA 2WRMA 1OSCA 2DITA 2J7KA 1HA1A 4BLGA 3UCZP 2AU0A 5M2UA 1WWHA 4WF9Q 3IRWP 2FGOA 4X4UA 2XMAA 4NL5A 3M6XA 1AT1B 3CTRA 4I64A 4HH1A 3LGNA 2NZCA 2D41A 2ZDOA 2ILZA 2QX0A 1REVA 1RTJA 4M8LA 2OELA 3FQKA 3GPAA 4DHVA 3IWXA 3MEDB 3KLIB 4LF4J 1X4CA 3W3SA 4O23A 3DLBA 2RH3A 2M9KA 1M1KT 1IJFB 3OVSA 4RUAA 5AT1B 5JVGQ 2R7RA 1R0AB 5D15A 1LW2B 1C4CA 3PHTA 4FDFA 2R7QA 1WI6A 4C0BA 2I1RA 1D9AA 3T5JA 3HFZB 2M52A 4H4MB 3DXSX 1P1LA 2DR5A 3ET6B 2Y8WA 4RU2A 2DGUA 3OR1B 4K2JA 3MR3A 4WP9A 1URNA 2HNYA 1PYSB 1BGXT 1KONA 5HP1A 3SMZA 2VHGA 1IBLF 3V4IB 2F5GA 2HHPA 4KO0A 2W2PP 2QEXS 3GWCA 5L1IA 3MOZA 2EVZA 1I94F 3C14B 3FZ2A 2D3ZA 2HLUA 4UW2A 5JXSA 3EYZA 1NPPA 1H2UX 2J8SA 3KUEA 5ADZA 1NNDA 3IBFB 3HM9A 3CSKA 4O3NA 2HWIA 3W65A 4DL3A 1YQHA 3OL8A 2VB6A 5E7OB 4GVBB 1ICEB 4ED1A 3PY8A 4DV2J 1Y0HA 3ISNC 1TVRB 2AMCB 4M5DA 3W8GA 2IMWP 1NJXA 3NGUA 2CXEA 1QDUB 1UPMB 1S49A 3GIIA 5ETVA 3WHIA 3N28A 4OYPA 2KXNB 1N5VA 4MKAA 2CPFA 3EPIA 5HANA 2K7JA 1LW0A 3JTOA 5GAEU 3HSDA 4LF9F 3FK4A 2MQQA 1MSWD 2UU9J 5ITHA 3NCPA 3UDVA 2QSWA 1T3OA 2CQ1A 4C8ZA 1TTHB 3HT3A 4C8MA 3TX8A 1QM9A 5LMNF 4BHQA 3M2UA 4A8SA 2N7CA 1U6BA 4LFAF 2CZ4A 1OJ4A 4GC7A 4J9QA 2GZOA 3ZZRA 3TJ8A 2WVBA 2OTLS 4DPYA 4CYUB 3W60A 5AJ3J 3MWBA 4EYIB 3OTBA 4ECYA 3T3FA 3HP6A 2BM0A 3M9OB 2GMHA 1P9YA 3A8JA 5HQMA 4KH0B 4F67A 4DQSA 3QATA 5KT4A 2I8EA 2I38A 4TLRA 4O3OA 4B9MA 3D66A 4FNHA 2QFJA 2MKHA 2LFVA 2IBOA 2WZ1A 3SEOA 3EGZA 4ZJLA 4O4GA 2ZC3A 1DLOB 2LU2A 4B3TJ 4QR1A 2RILA 2NQPA 1TK0A 1NJYA 3NBPB 2RF2B 3DOMB 2V4JA 1CEZA 4F3QA 4XAKA 1N5QA 1NJWA 2W2MP 1HI1A 4N76A 1CJUA 1BY9A 5HN0A 1VRTB 2WCXA 2QLWA 4K8RA 5ETQA 4V1Ak 2ZD1B 4DZDA 3P49B 3I32A 3ITHB 4BC9A 4IRDA 3MM6A 4ZP9A 4X66J 4DFMA 4OFZA 3RYLA 1D1UA 1IKYA 3DLKA 3H40A 1FDNA 1NJZA 5IS2A 3BPSP 4DG1A 1JLBB 3DCAA 4LFBF 3CCUS 5L38A 2N3OA 2NCKL 4FBTA 3SSSA 2IJRA 4MK7A 3H2UB 1N0VC 4DN9A 1XQIA 2B9YA 5HLFA 1R31A 3M8QA 2VD3A 3SXLA 1G3OA 6FDRA 4C98A 1T05A 2PA3A 1BQNB 1HBMA 2AP6A 3NNAA 1MMNA 2GAGC 3LP1A 4DV7J 1UCNA 1Q95G 3VWSA 1C1CA 4PG7A 3FVYA 3WDOA 1X5TA 3CDUA 3MCOA 1SKRA 3RB0A 1BD6A 1WC4A 1NKBA 4KHMA 3MMBA 2AT1B 3CC4S 3OFEA 1X0PA 5GAGI 2BJ9A 5IQQA 1UVNA 5F3ZA 5E3PA 2AGPA 1MROA 1FEEA 4QWAA 1LKZA 1QSLA 1RAEB 5EHHA 2QA2A 2XSJB 5B0CA 4JI4J 1KDNA 2BOPA 1VQ4S 1S48A 2UXDF 2QFIA 4K4VA 2R8HA 1UAWA 1RT5A 3LGHA 3WC2A 1SC4B 4ZOSA 4R5PB 5HMXA 2ASJA 4ETZA 4DR4J 1BC6A 3B4DA 1HWLA 1QJHA 2G2OA 5M2PA 2XO6A 3D7SB 4MKVA 2ZOGA 2DRDA 4CLUA 3JYTA 4PXBA 5CZVA 3PX6A 4F4XA 1RWNB 3N5BA 3DI6B 1MMDA 3QQCD 3OL7A 3M9MB 4B3OA 1JLFA 3GG1A 1HNZF 4ENOA 3E8OA 4UF4A 2ZH5A 4DCJB 4ZMMA 2ASYA 5AXLA 3C16B 3IR7B 5D4OA 1U8SA 1RT4A 2CPHA 3U1MA 4JI2J 4RR5A 3DGPB 2VBYA 1C1BB 1D9DA 5F9NA 3CVKA 3T1YF 2IC3A 3KK3B 3N6NA 1LXJA 3O8WA 5IC6B 3KLEB 1B99A 4CCHA 3BV8A 1FKAF 2AIRB 4ZVSB 1Z4UA 3O6QA 2BKNA 3NRBA 4LF6J 4WZMA 2L9DA 3VGSA 2VC1A 2POKA 4QWDA 1FVQA 1K73T 2H1YA 1N34J 4N7TA 3W2VB 3EXCX 3O1LA 3K58A 4JI8F 2GMLA 5H9FJ 3CD5A 1JLCA 4L73A 5T41A 4RL1A 2DTJA 3KK1B 1G7CB 3QGHA 4KR0B 1PAUB 4OI4A 3BO2A 4DL4A 1VBXA 3QIDA 2CZVC 2MEWA 1D9FA 4DJBA 1FT8A 2I5JA 1VQLS 2VOPA 3R7SB 4KKOB 1JLGB 4NCAA 1ZTTA 1BWVA 5LMUJ 4XPCA 1UWBB 1K44A 2VG7B 4KT0C 4LT6A 4O3SA 2QO3A 2AHOB 3KLGA 4HLBA 3HZGA 3I5CA 1VQOS 2C2EA 1U1PA 4QIFA 2LQ5A 4HTIA 2FJWA 3CJRA 1S4FA 2ZEJA 1Q78A 2CQ0A 5IT4A 4IH6A 3T41A 1UZHA 1N33J 5JJBA 1CULA 1UVKA 5LM7E 3ILOA 2GV1A 3M9NB 1RI7A 4NA1A 1ZH5A 1F9EB 1KHWA 3TZWA 4DUYF 3KKFA 4BS2A 4MMOA 4J90A 3BZQA 3BB5A 4MFBB 1CS4A 2KTQA 4RPFA 4DPTA 1LWEB 4NXMJ 1EETB 3O44A 1WTFA 3TA1A 2YNIB 2PT0A 4URSA 2ZM6J 2BX6A 2C2NA 3NL0A 2H65B 2GVDA 3W5ZA 3LAKA 4DMZA 1VMBA 3H5SA 4DOZA 4GMKA 2FLPA 2CPEA 3BGOP 3EDRB 4G6VB 4TY8B 1RT6A 4ICLA 1L3TA 1DURA 3CJSA 2BZ2A 5A8WB 3MM9A 4DBQA 1XN9A 5KG3A 2ZZMA 5KFSA 3CCMS 4CLTA 4F7VA 4ED5A 3CGIA 2R7WA 2FC9A 1QUVA 4QPTA 4YEAA 1KD1T 3D1HA 1FJEB 1IBMF 3KUHA 1S1XB 4I7FA 2CRLA 2NXUA 2DPIA 1KNZA 3HDSA 5MLCV 3DKDA 4ECTA 1NDLA 4UT4A 5KG4A 1RAAB 4ZVQB 2V2VA 4AT1B 3BDEA 2XBPA 5DRKA 4OYMA 5KFKA 2LXFA 1UEVA 3DLJA 1O51A 2B43A 4NLGA 3MMCB 5DLFA 1HWIA 3HULA 3T5HA 5CCMA 4LSZB 3IG1B 3C8YA 4P7VA 4UOCA 2JWNA 4AUKA 2Q6CA 1AXQA 1LOUA
chains in the Genus database with same CATH topology
4HHJA 1HQUB 4TQSA 3GV8B 3MM8A 3PEJA 3H59A 2UV8G 2AGQA 4A8OA 4MYTA 5G4DA 4ID5A 3HVWA 4JI6F 2XMJA 4I2PA 1U1LA 4RW4B 2VFVA 3MFHA 1JXLA 1CC8A 1FTCA 4DUZF 4ECQA 5KFGA 4HDHA 1TL3A 4DR4F 1OPZA 2MSTA 1FRJA 2NPFA 1SL1A 2HHVA 1S9FA 2VPWB 1D0EA 2GJ2A 4GC6A 2OD4A 2YWKA 4PRFA 4NCGB 3BSNA 1A7GE 1NK0A 1Q8IA 1TVRA 2JDJA 2Q79A 4X4SA 2GCFA 1BQMB 4DR6F 2W9AA 2CQ3A 3M1VA 5KFCA 2VL1A 4DF8A 1HNVA 2PI5A 2AX1A 1P9QC 4V19J 2OPPA 2CPYA 4I69A 5F8JA 3HK2A 1REVB 1RTJB 1KQSR 3PW7A 2A2DA 1ZZNA 1VQNS 4WZQA 1X5SA 3U02A 3ENQA 4DR1F 2F8HA 4HTJA 3FDSA 2EK6A 3K5OA 2IFXA 4H4OA 4NA3A 4ATNA 3TUJC 1TL5A 4LJMA 1SI9A 1WI8A 5EWFA 4QZVB 3L7OA 5A8RB 2DGVA 5J1EA 3HVAA 3TVYA 2R8IA 2O5DA 4TNOA 1FDAA 1E6YB 1PILA 4WE1B 4AXJA 4IDKA 2E9TA 1VBYA 3PKMA 2XMWA 2XS5A 2M5YA 3LP0A 2VG6A 1YJVA 2FPHX 2ERRA 3PZPA 1X7VA 1M5HA 5GAEI 4MFBA 2EFVA 2JVOA 5B0EA 4P7TA 3VQTA 1AFIA 1RDRA 1XR7A 4UUXA 3HF5A 2M70A 3PDNA 3DDKA 4D3GA 4BDPA 4DQIA 2X1BA 2HMIA 1YGYA 4PUOA 2RNEA 4ELUA 2P9CA 4Q7AA 1RA6A 2UVWA 4XIUA 3J7Z5 1R89A 3HHEA 2R2SA 3KK2B 2O67A 2F8EX 1EETA 5CYMB 1OO0B 1GAOA 4LQ9A 3G71S 4MIAA 3SZ2A 1HD1A 3I9ZA 2VFRA 4ED2A 2R7SA 5HQ8A 3NMAA 4ES3A 1HARA 1NAQA 2D7SA 3DRPA 5FIIA 4JI2F 2ZE2B 2YNIA 1YSJA 4PKDB 2GFFA 4IRKA 3CIMA 1Q7LB 1FRIA 4LF4F 1U2RA 4YDXA 4YMEA 2RSQA 2HNDB 5DDPC 1U6ZA 4OZNA 1D8ZA 2LEBA 4QYZJ 1O0PA 3CD0A 2W9BA 3GFXA 1FJCA 1XNRF 4PPDA 2X3GA 2NR0A 1P8GA 3GYXB 3DC2A 1NO8A 3SV4A 3OLAA 7FD1A 3RB3A 2KM8B 4ZPVR 5E2QA 3UE2A 2HYIB 4LF6F 4LVNP 1VQSA 2CPJA 3CCTA 2QMXA 4NOHA 3TA2A 1RYSA 4BCAA 4WYWA 4KO0B 2BQUA 4EUVA 1Y5LB 4NYPA 5I42B 2PO4A 4EBDA 2FVPA 3RAXA 2UUWA 2XLJA 2ALZA 4NZ0A 4G1IA 4L72B 2Z2LA 5D4NA 2WK4A 2YY3A 2KZMA 3CJKA 4AL7A 4CTAA 5KFXA 1JXEA 3G96A 2ZH7A 5KFRA 3MEKA 4F26A 4ZLPA 5IFMA 2ZJPQ 3Q2TC 4J9OA 1XNQF 2CPDA 1P1TA 3QJLA 4DV6F 1TQLA 3C6UA 5E3RA 2LU1A 1HWKA 1L3SA 3G9CA 1DTTA 3CDBA 3DM2A 3MM7B 3US5A 1S1UB