5J2QB

Hiv-1 reverse transcriptase in complex with dna that has incorporated a mismatched efda-mp at the n-(pre-translocation) site
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
427
structure length
400
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords HIV-1 reverse transcriptase p66 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
total genus 105
structure length 400
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qB03
3PJXA 1N4LA 1DTTA 4Y3CA 1EETA 3FFIA 4IFVA 5KG1A 5HROA 5KFJA 1RT3B 3BQ2A 4RW7B 4ZP8A 3DYAA 2FJXA 2JC1A 1MU2A 2VG7B 1RT5B 2W9BA 1HMVB 2OPSA 3TAMB 1TV6A 2VG5B 4KV8A 2WONA 2W9AA 4KKOB 4ED8A 4O3PA 3V6JA 4YMEA 3MR2A 1IKXB 4ZMMA 1RT2A 2B43A 1JLAB 5HBMA 1N5YB 3DLEA 3MEEA 3H98A 4QW9A 5L1JA 1J5OB 1NHUA 2FVCA 4O3NA 5KFPA 5HP1B 1NHVA 3QGGA 1T05A 4J9SA 4I2PB 5KT6A 2BR0A 2R2TA 1RA6A 2R8KA 3M8PA 4K4XA 3QGHA 2IA6A 2JEFA 1U09A 4ED0A 1T03A 4NRUA 4MFBB 4MKBA 3OSNA 2ZE2A 5KFZA 2OPQB 3I5CA 5KFCA 3KMSA 1S0MA 3C6UB 2HNYA 3DLGB 1LWEA 3CWJA 1S48A 1UWBB 3T5JA 2UVUA 4ZP6A 2B5JB 2FVSA 4PUOA 1RDRA 2O5DA 3NKYA 3DRSB 4FBUA 4FBTA 1VRTB 5F8GA 3CDEA 3I5BA 2JLEA 5KG3A 5J2PA 3VQSA 5EWFA 5DLFA 1ZTWA 3KLEA 3V81A 4RW6B 3GYNA 4IOBA 4F4WA 4IH5A 2GIQA 1HQEA 4EO6A 3DOLB 3H4DA 3HVAA 1C0TA 3KK1B 3KJVA 3KK3B 2BRLA 3TQ1A 2OH2A 1IKYB 3E51A 3BQ0A 5C5JA 4ECVA 2BANA 3H59A 2V0NA 1RT6A 2VA2A 3MEDA 4ZPCA 5KFTA 2R8IA 1D1UA 3QYYA 3ICLA 4MIBA 4EBCA 3RB4A 1FKOA 3QLHB 3UPFA 1S6QA 5KFUA 5CYMA 2DPJA 2XI2A 1BQMA 1HNVB 1HQUA 4RUAA 3GV7B 1N48A 3KNAA 4XPEA 4PQUB 4NLQA 4TYAA 1RT4A 1DLOA 4NCGA 1S1XB 1BQNB 5D3GB 4R8UA 3KHGA 5KFLA 3LP1B 3QO9A 5K14A 1LWFB 5C24B 2RKIB 2FVQA 3RAXA 4R5PB 1T94A 2IM1A 1S1WB 2YNFB 3E01A 4H4OB 5HLFB 2AGOA 2D41A 2XI3A 3ITHA 4TQSA 1C1CB 3M8QB 3FRZA 4Q0BB 4RW8A 4DL3A 4TY8B 4XPCA 1REVA 4GC6A 2W7OA 2ASDA 5EDWA 5I42A 1JLBB 1IM4A 3GIJA 4YR2A 2ZKUA 4ECWA 2W9CB 4Q8FA 3LAKA 1S1VA 5F9LA 2FVRA 2B6AB 3KK2A 4IRDA 1JKHA 1S9GA 1S1UB 1KHVA 2ILYA 4YR3A 2AX1A 3IGNA 4DG1A 4WXOA 4ZVGA 1RT3A 3GQCA 2ASLA 3QIPB 4I7FB 5J2QA 3MFIA 3M9OB 2AU0A 3MR5A 4RW4B 5KFHA 5EUHA 4NRTA 2VG7A 4OL8A 5KFIA 3SFUA 1RT5A 1LW2B 3KHRA 4YP3A 2IBKA 2VG5A 3G86A 3IG1B 4TY9A 4QWCA 4WZQA 4KHMA 3GIKA 2J6TA 5DQIA 3T5KA 3RB6A 1JLAA 3LP2A 5DG9A 4IG0B 2IM2A 3NBPB 3NAHA 1J5OA 5DG8A 2I5JB 3KLIB 1HPZB 4O4GA 5HP1A 4I2PA 2VG6A 3UDLA 4MKAA 4RZRA 4DL2A 2CKWA 2YKMA 2ZD1B 3OSPA 4ZP7A 4URQU 4KAIA 3OL9A 2OPQA 3C6UA 2ILZA 2QE5A 5FDLB 1RTHB 5F8NA 4F4ZA 4ECUA 3HVTB 3DLKB 3NMAA 3PVXA 2IJFA 1TL1A 3DRSA 5I3UA 4KHRA 2W8KA 1VRTA 4QWEA 1JLQB 2WOMB 1TP7A 1R0AB 3TVKA 2XC9A 2BQRA 3DOKB 3H40A 4RW6A 1HNIB 2HNDB 5KT2A 3DOLA 1TL3A 3DI6A 3KK1A 1WNEA 3OL8A 2V4RA 4Q8EA 2IAJB 2JEIA 1SUQB 1S1TA 3KLGA 4ZPBA 4DL7A 4LSLA 4JUZA 3N6LA 4H54A 5KFBA 2E9ZA 2WB4A 4DEZA 4B3OB 3DRRB 5KG0A 2BQ3A 3H5XA 3BREA 1XR5A 5J2NB 3IGVA 5DGBA 2BE2A 2R2UA 2D3ZA 5DG7A 1W25A 4IG3B 1QE1B 3MF5A 4PWDB 3D28A 1QUVA 4WE1B 2DPIA 3V6DB 5D3GA 1S1XA 4IH7A 4QWBA 1JLGB 1C0UB 4U6PA 4IRKA 4NLWA 1LWFA 5C24A 5L1IA 4J9KA 3MEGA 2YNIA 2I1RA 5J1EA 1RT7A 1DTQB 4H4OA 4LQ3A 3V4IA 5KFEA 3QZ7A 4G3IA 1S97A 5C42B 1N6QA 4Q0BA 3GIMA 4IKAA 3IRXB 1JLCB 1JLBA 2IC3B 2R8HA 5CYQB 3DM2B 3QGIA 2HMIA 1GX5A 4QWDA 1IKVB 1FKPB 1S9EB 1RAJA 4O3OA 2W9CA 3MR3A 2RDJA 4G1QB 4WFZA 2B6AA 3T5HA 2OPPB 1JLFA 1TKZA 4O3SA 2GIRA 5EWGA 2YKNB 1RYRA 3MFHA 3NAIA 4Y2CA 1NNDA 4O44A 5C25A 2FLNA 4K4ZA 1JLEA 2YNHB 4RW9A 4F4YA 5JXSA 4M94A 3Q8RB 4FS2A 1C2PA 2C2EA 1VRUA 3QIPA 3JYTA 5KG2A 2XGQA 3CDWA 4RNFA 3KLVA 3CJ2A 3DRPB 3ISNC 3BSOA 1IKWB 1RTIA 4XO0A 5L1LA 4NLGA 5KFNA 2R8GA 3BGRA 4IFYA 3KLHB 2AGPA 4RNMA 2R2SA 1RTJA 5DLGA 1TKXA 4NLDA 5J2MA 4ICLB 2QV6A 3OLBA 1DTTB 1EETB 4R0EA 4IFVB 5HROB 4ECXA 2OPRA 3LP0A 4ZVHA 3NBPA 3I0SB 3RBDA 2JEJA 3KLIA 4K4UA 1HPZA 3IN5A 4KFBB 5KT3A 4ZVEA 3Q8QB 5KFQA 3PW0A 2OPSB 2WTFA 4EYIB 3I5AA 4LQ9A 3NGDA 2YNGA 2WONB 2ZD1A 4O3RA 3LAMA 1ZETA 4NLTA 4F4XA 2IJNA 2WHOA 1QAJA 5HBMB 3MEEB 4JV1A 1HARA 3OHBA 5FDLA 1RTHA 1S49A 1YVFA 2UVWA 5KFGA 4Y34A 1KLMB 3DLKA 5KFMA 2RF2A 4Q45A 1RTDA 4ID5B 4RUCA 1C1BA 3UQSA 5JUMA 1S6PA 3M8PB 2C2RA 3SI8A 1JLQA 2BQUA 1R0AA 3CJ4A 5L9XA 4MK9A 3DOKA 3G6VA 2ZE2B 1HNIA 1SH0A 2HNDA 4RW7A 1RA7A 1S9FA 2JEGA 2HNYB 3C6TB 2BRKA 4GC7A 4IQXA 3JSMB 3BQ1A 4LSNB 5L1KA 2E9RX 1HYSB 2UVVA 4K4VA 1HMVA 2IAJA 1LW0B 2EC0A 4PUOB 3TAMA 4KKOA 1K1QA 2IMWP 4B3OA 1LWCB 3DRRA 1IKXA 3CJ5A 3KLEB 5J2NA 3V81B 1D0EA 3PZPA 5KFAA 1N5YA 5KG7A 2AQ4A 2HNZB 3KLFB 5KFWA 3GV8B 4ED2A 3GILA 5DGAA 4ZPAA 3KJVB 1XR7A 4IRCA 4NYZA 3T5LA 2C22A 3I0RB 1EP4B 2XWYA 4ECYA 3IS9B 5KG6A 4DL4A 3PW2A 2D3UA 4J9OA 1I6JA 3SFGA 4MFBA 2HWHA 2HAIA 1DTQA 2FJVA 3DLGA 3PR5B 1HQUB 2C2DA 1SH2A 1DLOB 1UWBA 4IDKB 3CVKA 2B5JA 1JLCA 5CYQA 5K14B 3H5UA 4ZP9A 4K4SA 4NLOA 1S9EA 4ED1A 2W7PA 1TKTB 5T14A 3H5YA 4J9MA 3E01B 3RAQA 5DQHA 1T3NA 2AGQA 1S4FA 3T1AA 5KT5A 4ZHRB 4TYBA 3KK3A 3PHEA 4RW8B 3KOAA 4J9QA 1IKYA 4WYLA 3CJ3A 3GIIA 4QPXA 1S1VB 1N56A 4TN2A 3QIDA 3CDUA 2ASJA 3QLHA 5F9NA 2E9TA 4KSEB 3FDSA 4Y2AA 3KLHA 1JKHB 1HNVA 3RB3A 5F8JA 2R2RA 3Q8PB 3OL6A 4PQUA 3OL7A 1BQNA 4DG1B 5KT4A 2V4QA 5J2QB 3LP1A 2WK4A 3I0SA 2RKIA 4HYKA 1GX6A 4R5PA 4KFBA 3PW5A 1S1WA 2YNFA 4KO0B 3LANA 3MECB 3BR9A 3MTKA 4NLRA 4RNNA 5HLFA 5KG4A 5KG5A 1C1CA 3M8QA 1XR6A 4K4WA 5KFVA 4TY8A 4K50A 2VA3A 3LP2B 4NLPA 3HKWA 1S10A 1TQLA 4ED7A 4I2QB 3G6YA 2WRMA 4RNOA 4YQWA 4O4GB 2AWZA 1KLMA 3PW7A 4K4TA 4ID5A 1K1SA 5KT7A 2VG6B 1S1UA 1TVRB 3H4BA 2W8LA 2UUWA 2YKMB 3M9MB 3M9NB 5KFOA 1RT1B 4EEYA 4I7FA 1FK9B 4JV0A 4M95A 4MIAA 4RW4A 3C6TA 4EO8A 3DMJB 2XCPA 1SV5B 3JSMA 3BSNA 3NL0A 4LSNA 4DL5A 2ATLA 1LW2A 1HYSA 3CIZA 1LW0A 2FVPA 4H4MB 4O3QA 3GV5B 4HKQA 4EYHB 1TL1B 3IG1A 5I3UB 2FLPA 1LWCA 1QAIA 1SH3A 3PR4A 3FFIB 3EPIA 4IG0A 2IM0A 2R8JA 2IM3A 2HNZA 3DYAB 3KLFA 4ECTA 3KMQA 1TL3B 2I5JA 3DI6B 1MU2B 4NLYA 3RBEA 4O4RA 1JIHA 3I0RA 2CJQA 2W9BB 1EP4A 1S1TB 3KLGB 1TV6B 4KV8B 4LSLB 3IS9A 4URSA 4ECRA 3D5MA 4IR1A 1RT2B 4NLSA 2RDIA 2BE2B 1JXLA 3RB0A 3DLEB 2XCAA 3KHLA 3EPGA 3UR0A 4EBDA 1S0NA 2C28A 4MK7A 4DL6A 3QZ8A 3HVTA 3PW4A 3LALA 5F8HA 4IDKA 1T05B 4RU9A 4QW8A 3N6NA 5EWEA 2V9WA 2HWIA 4ED3A 3V6HA 3CJ0A 2WOMA 3EZUA 1T03B 1TKTA 3MEGB 2JC0A 2YNIB 1ZTTA 5J1EB 1RT7B 3V4IB 4TLRA 5KFYA 3T19A 5KFRA 1LWEB 4ZHRA 4J9LA 1N6QB 4KBIA 4U7CA 4KB7A 1SUQA 4Q43A 4MH8A 4ED6A 4NLUA 4WZMA 4NLXA 2HMIB 3CO9A 5J2PB 2F8EX 4J9PA 4F50A 3V6KA 4KE5A 1HQEB 5F8IA 4IR9A 1JLFB 1TKZB 4IG3A 1QE1A 4PWDA 3N6MA 4WE1A 4O44B 5C25B 1C0TB 2GC8A 1JLEB 3V6DA 4RW9B 4IH6A 4EBEA 3OHAA 1OS5A 3H2LA 5KFSA 3Q8SB 1VRUB 1JLGA 3JYTB 1C0UA 1MMLA 4NZ0A 2BANB 5F8LA 4ECSA 1RT6B 2WCXA 4ECZA 3MEDB 1Z4UA 4KO0A 2FJWA 3MECA 4ECQA 1RTIB 5KFDA 1FKOB 3BGRB 1S6QB 5CYMB 4IFYB 2UUTA 1BQMB 1KHWA 3BSAA 4QWAA 1RTJB 5KFXA 1TKXB 5J2MB 5C42A 2XGPA 1RT4B 3HHKA 4NCGB 4JV2A 4R8UB 4MK8A 3IRXA 4WFYA 4TQRA 4J9NA 2IC3A 2OPRB 3LP0B 3DM2A 3QO9B 3H5SA 3PJWA 4URGA 4K4YA 3OLAA 4J9RA 1IKVA 1FKPA 4I2QA 4NLVA 4G1QA 4Q44A 3BSCA 4X2BA 2OPPA 4RNHA 3ISND 4ZVFA 2YKNA 1CSJA 3FQLA 3ITHB 1TVRA 2YNGB 2YNHA 4TXSA 3MR6A 5KFKA 1REVB 3G6XA 1RT1A 5DQGA 3BJYA 4WYWA 5I42B 1S0OA 1FK9A 5F8MA 2AX0A 1JX4A 4FS1A 2D7SA 3DMJA 1SV5A 3DRPA 3HVWA 2J6UA 3FQKA 2ALZA 4WFXA 1IKWA 3DDKA 4ZPDA 1RYSA 3KK2B 2FLLA 2RF2B 5KFFA 1RTDB 4H4MA 4WXWA 2UVRA 3FSIA 1C1BB 1S9GB 1S6PB 3KHHA 4YR0A 2J6SA 4ICLA
chains in the Genus database with same CATH superfamily
3ISZA 3WX8A 3NS5A 3UO0A 2W9BA 2W9AA 2DEIA 4UUWA 1CJVA 2HIYA 5HP1B 4I2PB 1RA6A 4YN3B 1U09A 2CJYB 4ILRA 2UZAA 1RAGB 1UWBB 4OI4A 2KG1A 3DLBA 3KLEA 4F4WA 4CZCA 3OXFA 4MKVA 3FK4A 2GHWA 4ECVA 5JMNA 1HKAA 1B99A 2XMJA 3JSRA 2CZ4A 5D3GB 1DLOA 2Q43A 4BC7A 1YSJA 4YY3J 2M8HA 1FX4A 1YZ7A 1V6HA 3CCLS 1ZZNA 4Q8FA 3PX4A 3GFHA 1GXLA 3O5TB 2HGNA 2HS3A 2L3MA 2RU9A 2ZNZA 2OTJS 3GWCA 3R7NB 2NXNA 3NGUA 2UXBF 1KNZA 3O8WA 1B70B 1RHRB 5LM7E 2ZUGA 1KBRA 2HHTA 5DG9A 4IG0B 3TANA 4ELUA 3KLIB 5B09A 3CMQA 3CCJS 1N88A 4MKAA 1Q79A 4ZN3A 5F8NA 4GKJF 4C7QA 4X64F 2WOMB 2XMTA 5K8OA 4JBCA 3Q86A 2QA1A 3PEHA 2AMCB 1Q95G 2XM3A 4EWTA 1CS4B 4WP8A 3TEGA 3PG9A 5DDQC 1KVJA 4X62F 3J7YU 4OI0A 1O6XA 2D74B 1WDTA 1OYEA 1NPPA 1HBNA 3GIMA 3KUEA 3W8GA 1NKCA 2JVRA 3DM2B 3S7RA 2CZ9A 2K1RB 2VDIA 2GIRA 1NLKL 2HFVA 4DFKA 2R8GA 4IFYA 4HI1A 1QSSA 4FF3A 4IFVB 5K8PA 4ZVHA 1PBAA 5G0RB 2VQEF 1UTAA 4NXNF 2ZD1A 2OELA 4B3MJ 1FXLA 4U7UD 1TL5A 5CCMA 1KLMB 4DPTA 1FRHA 5KFMA 1TFYA 5B0EA 1WTFA 4OJ1A 4JI5F 2CXEA 2HNDA 4WBFA 5A2QU 2E9RX 4FF4A 4L76A 5IM0A 3DRRA 1RAFB 2UV8G 1JQGA 1HI0P 4UZCA 3ADAC 4MFBA 1U8WA 2LU2A 2AKWB 2BJ7A 5CYQA 2UU9F 1FFGB 4BLGA 3P49B 3W5ZA 2IFXA 2WSFC 2KL8A 4RKUC 4OMFG 2MYFA 1TFWA 1BQNA 1F9HA 2WK4A 1BD6A 4Z7YA 1S1WA 3BR9A 3ZZRA 4NLRA 1QVFR 3M2UB 1H98A 2HHHF 2V8GA 1P1LA 3I6PA 1WD6A 1TQLA 5AJ3J 2NXCA 1NUEA 1UVNA 1MN7A 4G1PA 3MMCB 5KFOA 1IBLF 3MOZA 3A13A 3TNVA 4DSKA 4NOHA 1LK7A 2R8JA 2W2OP 1MSWD 4ECTA 3DN9A 3PYDA 1S57A 3J81U 2FUG9 3KLGB 1H2UX 2WB1D 1IBKF 1WOSA 3DLEB 4FKYA 4MK7A 3QZ8A 3QRPA 3OW2R 2QSFA 4CLLA 4B17A 1BGXT 1UJ6A 4CNYA 5J1EB 3D54A 3B6BA 4Q43A 4DQIA 2MKHA 1YJRA 1HR0J 1VQYA 3AA8A 3DGPB 3BF4A 3TJAA 3VHQA 5EHHA 5F8LA 5L8RC 4L72B 2JX2A 4PABA 4ZVTB 1AYEA 1IN0A 5C42A 3QO9B 4B3SF 1IKVA 5A8WA 2IHR1 2FJDB 3ISND 2M2BA 3DLJA 3MR6A 5KFKA 4D3GA 4IR9A 3OD2A 1KOOA 2HPUA 3VGTA 3FQKA 1TR0A 1IKWA 5IXUA 1S59A 2EXUA 1S6PB 4OZLA 3AD9C 1DTTA 4ED5A 2GJFA 2XZWA 1UZHA 4NZ7A 3D7SB 3SV3A 4DV7J 3UD3P 3CB4A 2AJ4A 3AQPA 2F1FA 1J5OB 3BPDA 4DZDA 2KM8B 2WZ1A 3CPWR 4DN9A 1T03A 2XS7A 1S0MA 3M2VA 2I8EA 1HI8A 1S48A 1CC7A 2O5DA 3K5LA 1WF1A 3BO2A 2GQCA 1NZAA 3IXQA 3KK3B 2CA9A 2GW8A 3VAHA 3TQ1A 4OHXA 2BANA 3MURP 4FXDA 5GAHI 3EICA 1PJ5A 5KFTA 3BGFA 3H25A 2BABA 5CYMA 1AZSB 4B9LA 1HNVB 3SMZA 3GV7B 2DR5A 1S1XB 4R8UA 2PE8A 5KFLA 1U6BA 2RKIB 2FVQA 2FYXA 2Q3PA 4ZCIA 2P6SA 1FERA 5HLFB 2D41A 4TQSA 1IBMJ 1EHWA 2CDQA 4F02A 2JVOA 2NUUG 1PJ7A 4LF8F 2RMLA 3KHRA 4N7TA 2KYZA 1RWKB 4LF6J 2AYEA 5DQIA 3T5KA 2IM2A 5GAEU 1HPZB 5HP1A 4I2PA 5FIIA 3MPVA 2L48A 4USVA 3U7JA 2MKCA 1QD1A 4QWEA 2H54B 3E2EA 2J0WA 2P2CB 5DRKA 4KPYA 4X4TA 3RW7A 4ZPBA 2E9ZA 2RE1A 3DU5A 4P72A 1VISA 2FHOB 4C8MA 3C2PA 5D3GA 2FPHX 4IRKA 1WKLA 2LA4A 3MEGA 2V68A 5D78A 3RRKA 3N9UC 2DB1A 3IBFB 5GVQA 5B0DA 3NRBA 2E5LF 1EB0A 4O3SA 5ETOA 5C25A 1MMDA 1J5EF 2W7AA 2QL7B 3HSGA 3G71S 1Y3JA 2ZZNA 3C3LA 1U26A 3IBWA 3ZNUA 2XYGB 2W2QP 4I64A 4NLDA 5J2MA 1WHWA 4R0EA 1WEZA 5CD4A 3KLIA 1U6ZA 4NEYA 3IN5A 4KFBB 4ZIWA 2KJVA 5KFQA 2OPSB 5BJRA 4BWJA 4FYVB 3L7OA 2CJAA 1FRXA 3W9JA 1S6UA 2KKHA 4JV5J 2XTJP 2J76E 1VS3A 4QIGA 2LEBA 3SI8A 2BQUA 1BMQB 1VIOA 1HMVA 1HBUA 4E0DA 1TELA 1CS4A 1XEZA 1B0TA 4ED2A 4OYXA 3NLCA 4A8FA 1RGVA 3PTWA 3PKYA 2CG8A 1UL3A 5B0BA 3ZNJ1 1CPZA 3HZGA 2BJ1A 4ZP9A 3I56S 1KWMA 2X7IA 3H5YA 2K1RA 3AXKA 4UOHA 4RUHA 5AE3A 1D9AA 2XY6A 1R8PA 2MEWA 1QM9A 1S1VB 5GADU 2ASJA 3QLHA 2HS0A 4O0IA 4AL5A 3GG0A 4LFCF 3TRGA 4ID8A 3F44A 3M8QA 2EKNA 1NJXA 4DUYF 1KLMA 1T7PA 4QYZK 2UUWA 4CH0S 1RT1B 4JV0A 3CULA 3BSNA 3ONQA 3GIRA 2MHEA 2FJAB 2FLPA 3QJJA 2D69A 1MU2B 5E7OB 2Y0BB 3ZXWA 1EQ0A 3MMAB 4CIOA 2C42A 2V8VA 5J1PA 2M4MA 3QWPA 4YFUA 2B7BB 4DV6J 2DISA 2KXHA 2ROEA 4ED3A 4U7UK 3K7RA 1CVJA 3G82B 4WKRA 1SPBP 4KPCA 3MUMP 3DXSX 1LV5A 4C8NA 2YTCA 1T11A 5F41A 4USIA 1QTNB 3CCUS 3NCRA 3R97A 1RBLA 1W7WA 3KJQB 5J2PB 2GJ2A 3RG6A 1LWXA 2V2VA 3OHAA 4ECZA 1RT6B 2MSTA 4LF9F 3UCGA 4M63A 4QJVA 1F2HA 3J7AN 3HHKA 2LKZA 2OPRB 1W26A 2MLXA 4G1QA 4X2BA 3BSCA 1BLUA 1RISA 1FJGF 3MEKA 3MMCA 2YNHA 3BJYA 3M6VA 3DRPA 2AV5A 2HHQA 2FJBB 1W2BR 1UKUA 5KG1A 3VWSA 3BN7A 4L6V3 2CUYA 1UJ5A 1LFPA 4ZMMA 3AFGA 2GS8A 3H98A 3DLEA 2RS8A 4PXDA 5KFPA 1X4BA 5KT6A 2U2FA 3QGHA 4OYPA 3SYZA 1Y3KA 3K0JA 2G0IA 4J5OA 3SSRA 2B5JB 1NSPA 2VD3A 4P10A 4FVMA 4CYUA 3VQSA 1JNRB 1RJJA 4OI1A 2H5JB 2VA2A 4ZPCA 1PC5A 3ICLA 2CPDA 1G2EA 1BWVA 4TYAA 3KHGA 3MPDA 3MUVP 3QO9A 4KGXB 3TVYA 4CDIA 2AGOA 4Y2MA 4DL3A 2NR0A 1MG7A 4DSJA 1T9XA 5F9LA 2VJVA 1PYSB 2VF3A 4IRDA 5E0OA 3CMES 2AX1A 4DG1A 4WXOA 4P71A 4AD6A 4NCAA 1NH7A 2JZ5A 2HHXA 3ETOA 2PD1A 4U96A 3U1MA 1G3OA 1DJ0A 1S7HA 3H90A 1J5OA 3GJSB 2I5JB 1EAYC 2DTJA 1RAAB 1C4AA 1R7IA 2BJEA 2IY5B 2FZGB 1YX2A 1NK0A 2XWXA 1QY7A 2VJUA 4NZ6A 3C46A 4W98A 1JNZB 3H40A 1HWJA 3QBCA 1OO0B 2PDAA 3CGIA 4TU8A 2IAJB 4Q8EA 1MWYA 2YWEA 3VAIA 1QUPA 3HJFA 2RILA 1FD8A 1S1XA 1R89A 2Z56B 4U6PA 4DR2F 1ZZFA 1AA1B 4RWXA 1U0HA 3RUBL 4O3OA 1KS2A 3D3BJ 4IOCQ 3M7VA 4MTPA 1WHVA 4RW9A 3HFZB 4P9SA 1C2PA 2C2EA 4FF1A 4CLZA 1K0TA 1J27A 3CJ2A 3LO3A 3K5OA 4C11B 3U27A 4NLGA 1BUXA 2R2SA 2G9OA 3M05A 4WTOB 1HPZA 3F41A 5LL6d 3UNGC 1EARA 3I5AA 4RR5A 2VPWB 4OHYA 4USWA 5IQQA 2UUCF 1HARA 3R1HA 1KKHA 4XTTA 5L9XA 3EZ5A 2CQBA 3I4HX 1WC0A 3R2CJ 3LWLA 1AB8A 2ZBQA 2DHHA 4JI0J 4ZPAA 3T5LA 3SSQA 2DITA 2V2KA 5KOXA 1PGZA 3QJPA 3F0NA 1YIJS 4P2SA 4RLEA 2C2DA 3MPWA 1U6FA 4R25A 2PI4A 1RTZA 3OR2B 4DL0C 1PBUA 4RW8B 4P52A 4DF4A 3QIDA 2W2NP 3VAKA 4ANEA 1XMOJ 3RB3A 4LF5J 4M5NA 4UTGA 3LGMA 3W9IA 4CO5A 1GX6A 4KFBA 4N77A 5JVHQ 4JI2F 2BA9A 4A48A 1YHQS 3P5BP 2ADCA 1JXEA 1U1NA 1N52B 5KT7A 2SXLA 3DLLQ 2MKYA 1SV5B 3H2VE 4LR7A 3POTB 4RX6A 3CIZA 3IG1A 2LMIA 3A8KA 1G1XA 2AJFE 2HVEA 3V2UC 1TL3B 3RBEA 3MM7B 1NK5A 2BEFA 2E1CA 1KQSR 4I6WA 3RB0A 4ES1A 3EPGA 2PO4A 4DL6A 1Q8KA 1YLXA 3EYZA 3VAMA 1K0VA 4J9LA 1N8RT 3HSDA 4FZVA 4ZA1A 4DX7A 3V6KA 5DO2A 3QT8A 4S0MA 1QE1A 2Y8YA 2BKPA 5ETLA 3BBFA 3GR0A 3VTIA 1MMLA 2UP1A 4NYPA 3BGRB 1RTJB 4DQPA 3CJSA 4DR1F 3LP0B 2O67A 2POKA 3MZIA 3DU6A 3KDNA 3SQOP 1WEXA 2K2PA 4A46A 4DV2F 1RT1A 2QA4G 1H73A 2XO7A 4NXMF 4YB5A 1A9NB 3KK2B 2J6SA 2F3JA 1XNRJ 3PV8A 2RAQA 2MMYA 3PCOB 1SKWA 2KT3A 3AOAA 1TUGB 1MU2A 3MMAA 4DUTA 3V6JA 2PC6A 1IKXB 2GNKA 4C97A 2MQNA 3T1HJ 1NCLA 2X3DA 2F9DA 3P3DA 1IJFB 4PUOA 2DR6A 1VRTB 2L08A 5J2PA 2N4CA 4IH5A 2HQGA 6FD1A 3K2YA 3DOLB 2HBRB 1Y5IB 1RT6A 1R31A 2DIVA 3GFYA 2KFYA 1HA1A 1VQ8S 3UPFA 2XI2A 4XPEA 2MHNA 2KDOA 2ZJQQ 1Q5VA 1X8DA 4R5PB 5HQMA 3NP5A 5E33A 1HNZJ 5A2QY 2OO4A 4TY8B 2QYCA 1I94J 3LAKA 4WFAQ 3FJ2A 3IGNA 3FEXB 3M9OB 4GMKA 1UFWA 2HVIA 3D67A 4ZVSB 2IBKA 3TR5A 4J7CA 2E7XA 3N79A 4RO0A 2E5IA 2J9DA 2BM1A 2B4PA 3I32A 5IT4A 1WKKA 4ECUA 4M5JA 2NZCA 2IJFA 5I3UA 1U47A 3IM9A 2DVIA 4DQRA 1HIYA 2O3DA 4DCOB 3GP9A 4Q5VA 1DFDA 3VV2B 2ROGA 3EMTA 3BS9A 5HK4A 3TARA 9ATCB 3V4IA 1T3OA 3QZ7A 1Y0HA 4ELTA 1FCAA 3FBFA 3QSYB 3UN3A 3R5JB 3J81Y 2KU7A 1FTCA 1J2VA 3CNQP 2X1BA 2DEJA 3EE3A 4AFFA 2AGPA 2BXJA 2B8PA 2WW8A 5ETQA 4RNMA 1Q7YT 4B9UA 4F8RA 2HHUA 2PFDA 4KRWA 3PW0A 3NGDA 3LAMA 1SJ1A 1UJ4A 1X9MA 2OI2A 1WOOA 5T7LB 3UQSA 3EZOA 3CJ4A 2AEFA 4CLKA 3L9ZA 5L1KA 2IAJA 2OD4A 5E41A 1UVKA 1OQ6A 2VODA 2RQCA 2AQ4A 2BDPA 2DNZA 1Q8LA 3FZBA 2VUGA 3TOQA 4ZLJA 4UZBA 1P6TA 2HWHA 2QC3A 2JOQA 1N32F 3SDEB 2HHSA 2GCFA 4C2MA 2MJUA 2R4FA 3NNAA 3UVJB 1TKTB 1WUUA 1S4FA 2AZ1A 4UY8T 3CW2C 4C8LA 3ILIA 3QSIA 2RB7A 2DGQA 4IO9Q 2H48B 1FXRA 4USMA 3HP6A 1DQ9A 4PQUA 1VQLS 4DV3F 2QA2A 5J2QB 2KTQA 1VK8A 4AQYJ 5E3PA 1ZBTA 4K4WA 4ES2A 5BR8F 4C8KA 4YHHF 2B51A 1Q7LB 4OJ3A 3M9NB 1V3ZA 1RADB 3M8SA 4LBIA 2RHSB 3CCZA 2FHJA 2KVIA 4M5KA 3GV5B 2DD8S 3TP2A 2HAFA 1SC1B 4ETXA 4ZCKA 1OY9A 5H9FJ 3AJ1A 2G4BA 4P2FA 3K89A 4NLSA 2BE2B 1JB0C 1VC5A 4ZN1A 1PJ6A 2VBYA 3BYRA 1YRTA 3O6QA 4QYRA 3L7UA 1N6QB 2CNLB 4F04B 4OQJA 2HMIB 4JI6J 3VGSA 2DGTA 1JLFB 2MZJA 4PWDA 3TUZC 1JLEB 2YXLA 3C15B 3ENQA 2WCXA 4ZVQB 2RT3A 2DXFA 2RD5C 3GYGA 1KHWA 2YH1A 2E29A 3AD8C 4DQSA 9RUBA 4TXSA 3MM9B 4C8ZA 1TZ0A 2ACMA 3ZO7A 2MJNA 1SV5A 2CQIA 2ALZA 4I67A 2CZVC 3PJXA 3IC1A 4P2MA 5HO4A 4DV1F 1TK8A 3G2XA 2B4UA 2CPZA 2Z8QA 4AXIA 4WU3A 1WG4A 2JEFA 1VQ7S 3L09A 4GVLA 4QR0A 2GVZB 4FBTA 3EVWA 3ZZZA 3CXCR 3D68A 2JLEA 4B3RJ 3HHLB 4Z2XA 2YQ1A 3HHEA 4KHPJ 2XB2D 5AE2A 4OZ1A 4DR7F 4X66J 2XMAA 2V94A 3R27A 4PG4A 4A8XA 1N48A 4FNHA 5K14A 2XZTB 4QU6A 4LSZB 1YBAA 4CLFA 2YWKA 4L73A 5IT9U 1FFWB 4GC6A 2LYVA 3EM1A 5IC6B 2CIMA 1JXVA 3KK2A 3VZIA 2J0QD 1JKHA 1S1UB 3TX8A 4G6VB 4DHVA 4I7FB 2CQ2A 3B54A 2LCWA 2LEPA 2CVIA 4L3KA 1U48A 2XMMA 4YP3A 4AXJA 1FDDA 1YBTA 2Z2LA 1SBRA 2K7JA 5AE1A 1CJKA 3UDLA 1NU4A 3CCVS 4ZP7A 4URQU 3TA1A 1JWWA 2QE5A 2EFGA 4LR9A 3GU0A 4P7VA 2R7XA 4WP9A 1VQNS 1VRTA 2A3JA 1R0AB 3TVKA 4K8RA 1HNXF 5M2PA 2RU3A 2L9WA 1HNIB 4USTA 3DOLA 1T9WA 5FLXU 1S1TA 3HFKA 4RUBA 1RXOB 1JJ4A 5LT5A 1P9QC 5KOWA 3HXMA 1GTEA 1HFEL 2YWGA 1RAHB 4UQGA 3W2VA 1S7IA 3IRXB 2R8HA 2BW7A 2BKOA 2EFNA 2YKNB 2BMBA 2ZHAA 2V2ZA 4M94A 3RTVA 3GR1A 1Q0NA 3NXZA 4RNFA 4JI8J 1LKZA 1BE4A 4CI0B 1VCTA 1RTIA 1M90T 4OLPA 4PRFA 3OVAA 4Z7CA 3AOBA 4WP3A 3Q8QB 1KEKA 4FXVA 4LQ9A 5AJ3F 1CC8A 2VFSA 4NASA 2YKAA 2IMOA 3OHBA 1RBOB 2ADBA 1OSCA 1M1GA 2PEHA 4FYYB 4NYOA 3OXGA 4Q2MA 2IMWP 4USKA 3EWGA 4U67Q 3UDEA 3I0RB 5ETMA 1EP4B 4ECYA 1KVKA 4DBQA 2VICA 2J5AA 2XHWA 2CJBA 1YJ9S 4ED4A 2MSSA 5D4OA 1HBOB 4KIAA 2UXDJ 1VYAA 4LFAJ 4ES3A 2W4DA 2ZM6J 3MOJB 1FNMA 2H3EB 3R5BA 3FCWA 4TLQA 2R7TA 2IRXA 4DV4J 3ILOA 3BDEA 2IYIA 2GGPB 1C1CA 2Z0GA 2C1EB 1UW4A 2GJIA 1UPMB 4F4AA 4I2QB 3WIVA 3WBZA 2AJ0A 2HIQA 1S99A 1TVRB 4OZ0A 2YKMB 2CQ0A 1RKJA 2Q6BA 3CD0A 1HWIA 1T02A 3KJNB 1ZS6A 2NSCA 2DGUA 4UQTA 4OX9F 5LXRA 4RL1A 3H0PA 4KGZB 2HQDA 2OHDA 2C2MB 1ZA2B 3SDEA 3PFEA 1TKTA 2VQFJ 2WVBA 3T19A 1SUQA 1R0CB 1WC1A 1VI7A 2X1GA 2NYHA 3MWBA 3OUYB 4WFNQ 1OS5A 1JLGA 2HKEA 2GAHC 4F26A 1UVIA 4Y65A 2UUTA 2RUGA 3NCPA 1KVIA 2FZKB 2IC3A 4URGA 4J9NA 2VHGA 1OY6A 2E5GA 5DDPC 4ZVFA 1CSJA 4X65F 1RABB 3N5BA 1Q16B 4KT0C 3EDRB 1JX4A 1MROB 3PKMA 2NPFA 4GKKJ 5DS7A 2KM8C 1E6VA 4CLUA 1O8BA 2GZOA 4DSFA 4QYZJ 3TVZA 5HROA 4LF6F 1ZYQA 2V5HG 1N0VC 1KTQA 1X4FA 3D6MB 2QMWA 3MEEA 4MJKA 1X4AA 2HWTA 1DQ8A 2OKQA 1LEOA 3OBIA 3I5CA 2XLKA 1S77D 3TUJC 1HNWJ 4DU7A 4DSEA 3UI3A 3WHIA 3DNCA 1RE1B 3FBCA 3WIUA 2R7OA 3KJVA 3C15A 2OH2A 1WC5A 4EZ6A 2CPXA 2OLWA 2GQQA 4IQMA 1D1UA 4MAKA 1APSA 3MAHA 4ITSA 2B0GA 3MCSA 1KQKA 1XQIA 1T94A 2HGLA 3E01A 2ZH3A 4DR5F 2MDAA 2L9NA 1U1KA 4DS5A 2MTLA 3KDOA 2FQQB 2MGZB 1KFDA 1IQTA 2MKIA 2KO1A 4UF4A 1PAEX 3CMAS 2YKOA 3W62A 2CPIA 2NCKL 1VQPS 1I3OB 3MAAA 1TAQA 4F3QA 2XMUA 3DLHA 4O4GA 2I9SA 5CZVA 2KZZA 3BKUA 1M1HA 1FESA 1T9TA 1JLQB 2JRSA 1VQ6S 2LVWA 2OMOA 3DI6A 4PCQA 2XY5A 5ETRA 5KFBA 3R2DJ 4X4PA 4Z37A 4BBYA 4WE1B 3V6DB 4IH7A 1RAEB 4XIUA 5AT1B 3QAUA 2WW4A 4CT8A 4G3IA 2KT5A 1HHSA 3VAGA 3IO1A 1UFLA 4LRBA 5LSRA 1LFWA 2OPPB 1TKZA 4DR6J 1RYRA 3HF5A 4C9DA 3JYTA 3R1LA 2HK2A 2V34A 3G6ES 1TKXA 1VQMS 3OLBA 2V63A 3D0GE 5ETNA 5KT3A 1FRLA 2WTFA 2LQBA 5ETVA 2YNGA 5K5MA 2MY7A 3LPYA 2C3PA 8ATCB 2Z2ZA 4NCBA 1EKSA 2KJWA 1NDKA 1R0AA 3DCAA 3DC2A 4NWBA 1HNIA 4RW7A 2C2ZB 3D2WA 2KT2A 4TNOA 3JSMB 1ZAVA 1VHFA 3N4WA 3K58A 3TAMA 1X4EA 3CJ5A 3KLEB 1D0EA 2QL5B 5DGAA 2CQDA 4KR0B 4DV6F 4J9OA 1NB2A 1YBUA 4I4BA 5HQLA 4JYAF 1SH2A 1DLOB 3AXMA 4MYTA 1GK8A 4HHJA 4NLOA 4J9MA 5DQHA 2AGQA 2V69A 1F5BA 3OJSA 4P75A 2EW9A 1RWWB 2ACYA 4J90A 5LMUF 3A1YG 3FDSA 2PA8D 3GONA 1V9OA 1OY8A 4OI2A 5KT4A 1U4BA 4DWIA 4ANCA 1UCNA 5HL7Q 2ZH9A 4CT9A 5KG5A 3B4DA 1DURA 3D1HA 1NSQA 3HKWA 4F7VA 3DKDA 1S10A 5GAHU 2W25A 1LOUA 4EO8A 1VLOA 1A0OB 1LW2A 4ZS6A 4CO2A 2HFUA 1YJ7A 1SH3A 3EPIA 3HM9A 2UXBJ 4A8SA 3I0RA 2K3KA 1EP4A 4KV8B 4URSA 4XDCA 1VDHA 1M1KT 1ZA1B 3Q83A 4WIQA 4Y0FA 1YJUA 3N5FA 5F8HA 5D4NA 2XNQA 2W01A 1L3KA 1R27B 4GKJJ 3ZZ0A 1NXIA 1UP1A 3AT1B 3X3UA 3HDSA 4NLXA 4IG3A 3IR7B 3N6MA 2GC8A 4IH6A 3W60A 2VONA 3R3TA 4K5RA 1NK9A 3MEDB 1FT8A 3BGUA 2GGPA 4X62J 4IFYB 1B64A 4DFPA 3W8PA 2BJ3A 2ZFHA 3TZZA 3R5AA 2H65B 1F60B 4I2QA 3ZTRA 4FPRA 1FJEB 3LTOA 1NM2A 4X4QA 4LF7J 1TVRA 3FBBA 3CTRA 1VK3A 1FD2A 2PMZD 3V5RA 2IRUA 5I42B 2ZH8A 1ZOTA 4CLSA 2CNOB 5HMZA 2ZDOA 5C2CA 1URRA 1N5TA 4EGLA 3JSBA 2JC1A 1RWPB 3OR1A 4PEOA 5IM0B 1SJRA 1HL6A 3MR2A 4NXNJ 5ETKA 4DR4F 2MZQA 4OLOA 4MFBB 3HLUA 2QMXA 4WCEQ 3KMSA 4B9NA 2HNYA 1UVJA 3J7Z5 1RQ0A 4EFAC 3C19A 3DRSB 5EWFA 2C3OA 3U02A 2ZZTA 2BRLA 1FEHA 1H3DA 1ZPWX 2DCLA 2HZAA 1TK5A 2LQ9A 4NLQA 3LOUA 2HFNA 1BQNB 1Q5YA 4DX8H 3P6YC 2H5IB 4C6AA 2QT7A 3H20A 1Y00A 3MGJA 1S1WB 4JOUA 2XI3A 2UU9J 2XHCA 2P6TA 2W7OA 2M3DA 3KG4A 2HK3A 4ECWA 1RAIB 1V5IB 5LXYA 5L9NA 1B7YB 1YRUA 3U1LA 3MFIA 3QFWA 1M5SA 1FA0A 2QTWA 5IC4B 1AFJA 1EKRA 3LP2A 4LIWA 1YJNS 3M32B 2CWXA 1M5HA 1YTYA 1HW8A 4I56A 3ZTOA 3ZFVA 1IBLJ 3UCUP 2JEIA 2FD2A 2RQMA 1JK9B 3HK2A 1X9SA 2Q6CA 5DG7A 3GFXA 3TQEA 5LJ3Y 2VZ9A 4ZCMA 5KFEA 3R8YA 5C42B 1SJ3P 5KTQA 2UUBJ 2IBOA 1GX5A 1IKVB 3MR3A 4ZJLA 4WFZA 2MGZA 3R7SB 2OFGX 4OZ5A 1XMOF 2XGQA 4LF5F 3R6GB 4YS2A 3BSOA 1IKWB 2XS5A 5FD1A 1GXTA 5DLGA 2IJRA 1DTTB 4AYBD 1GAOA 3D6HB 1RCXB 5FJ4A 1RAOA 2QG9B 3HSZA 1UEKA 2OEKA 1QTMA 4ZKAA 2UVWA 5KFGA 2RF2A 4M5LA 2KH9A 1JLQA 2BZ2A 1U1MA 3HT3A 3I9V9 3KUGA 3CC7S 2QZ8A 4PXCA 2GIFA 2HVDA 2VC0A 3KLFB 3GV8B 3GILA 2AEJA 2AEMA 3BH7B 2XY7A 2FLOA 1H6KX 4TU9A 3SXLA 2FC8A 1VQ9S 4OI6A 5BXIA 2FJVA 3DLGA 4Q7AA 2GO9A 4K4SA 4HDGA 3M30B 2MKKA 3TUPA 2YKQA 1T3NA 1TUWA 5SZTA 3R6LB 5EGYA 3Q8PB 2P5VA 1HQ2A 4HYKA 2VFVA 2LU1A 3OT9A 5E3QA 5DZ6A 4TKTA 1GH8A 2WRMA 2ZH7A 3C14A 4EK2A 1K1SA 2DHGA 4N56A 4CM2A 1RCOB 3MPUB 2CPJA 1XNRF 3JSMA 1IJEB 4P2XA 5D4PA 4LF8J 2ZC4A 1KP6A 3OTOF 1NSAA 3SCIE 5IT9Y 4ILLA 1WSVA 3T1HF 2XCAA 4EBDA 1S0NA 4KY3A 4Y2IA 4UOFA 3LALA 4DF8A 4MIWA 3CJ0A 3EZUA 5AXLA 3MEGB 1PILA 2ZHBA 1RWNB 2OUGA 3IA0A 4GVBA 4EZ9A 4B08A 1CULA 1HQEB 2M8DB 2L9DA 4TU7A 5C25B 5B0CA 4FN5A 3H2LA 1E6YA 2FDNA 1N34F 2EC2A 2GFFA 2FJWA 4PAAA 1UAWA 2M5YA 1EJ7L 5J2MB 2ATCB 4XDDA 4NCGB 3OFFA 2H4YB 1HNZF 2I2YA 2OTLS 1FKPA 1G6BA 4RNHA 1I94F 3ITHB 5FLXY 3ELHA 3Q8YA 1KONA 3AJDA 2QSWA 1FJCA 1N36F 4WFXA 4WPAA 3FSIA 3QFHA 1N4LA 2DCUB 4Y3CA 4V1Ak 2IVMA 1XC9A 2OAUA 2VG7B 1RT5B 2JL9A 3HD2A 1HMVB 1HBUB 4KV8A 2XMKA 2WONA 3AD7C 3VALA 5HBMA 4QW9A 1FE4A 4M5DB 3G8SA 1VQOS 2R8KA 2IA6A 4NRUA 2A2DA 3MM5B 6FDRA 3CWJA 4ALZA 1RDRA 5D0RA 1M5VC 4C3MA 3V81A 4RW6B 4ZLLA 1KSPA 2EFVA 2ZOGA 3MEDA 2DPJA 3QLHB 3B4MA 4RUAA 4HTJA 5CZXA 4YB6A 4LFBJ 4WK3A 3M8QB 4QU7A 1HD1A 1MWZA 2GAGC 3L4BC 4XPCA 5I42A 4PG6A 4JI7F 1N5QA 5DDRC 2W9CB 3UE2A 3Q2SC 5IT0A 3BGOP 2DR9A 1VQSA 3A3NB 2E5JA 2LDIA 1KQFB 1SL2A 3PIPQ 2E5HA 2ILYA 2MPUA 3GQCA 2W24A 5EUHA 4KH1B 2RDDA 2EKYA 4AL6A 2J7UA 4LFCJ 3G86A 3NGTA 3GIKA 1U02A 3VCDA 2JDJA 3TJ8A 1F5CA 3RRHA 1SKRA 2DT9A 4F4ZA 3DLKB 2DNLA 3NMAA 3PVXA 1FNOA 3DRSA 2W8KA 4C3LA 1C4CA 3DOMB 3NWRA 3N6LA 3C8YA 2D3ZA 3IMQJ 2VC1A 1X4DA 1KOHA 2QEXS 2C3MA 2DO0A 5L1IA 2I1RA 1RT7A 1DTQB 2BOAA 4ZVOB 3ET6B 1PAUB 4ZLNA 2OSRA 2WVCA 1NBEB 1KFSA 2G1HA 4A47A 3B82A 4G1QB 2KFNA 2YNHB 4OX6A 2DNNA 4IO1A 3DRPB 1P9YA 2BOPA 4DSIA 1H38A 2PFFB 4Q2LA 4CLWA 4AQYF 4LF9J 4L75A 3M32A 3RBDA 3KXDA 1FJ7A 2FB0A 4EYIB 3I87A 3CD5A 2R42A 3TI0A 4DSLA 2MB0B 4JV1A 1FJGJ 4YUDA 2X3GA 3OTEA 2HSEB 1Q8IA 5JUMA 3MM6A 3NNCA 1YJTA 2D3OR 4GC7A 4LSNB 3DHXA 4CYUB 5LMNJ 4M5IA 4PXBA 3P8BB 5DETA 5KG7A 4IRCA 2V9KA 2BE7D 4CH1A 4OJHA 4DL4A 3RU0A 1UETA 5D15A 4E2FB 5LSLA 4DX5A 1Z1ZA 3M2RA 4OHWA 1Q4RA 2C3UA 2Y1IA 5T14A 2Z30B 2N82B 5KT5A 4UT4A 4PYDA 1IKYA 2WVFA 1UWAA 3GIIA 3MM8A 3PM9A 3CDUA 3O2IA 2V6AA 2HQFA 1S79A 4DG1B 3PO5A 3GG1A 3MUTP 4OIXA 1KC8T 1P27B 3I96A 1K9MT 3PW5A 4X84A 3W61A 2RRBA 4NPOA 4OHVA 1PSDA 2VA3A 5CABA 4OV6A 4RNOA 1FDBA 4X4VA 2ROPA 1FK9B 2EBGA 2XCPA 4DL5A 3FRYA 3KG1A 2MY8A 2KI2A 4ZJQA 2LXIA 4PXEA 1QLNA 1CG2A 3DYAB 3KLFA 2LXFA 3MAQA 3T6BA 1RACB 3NGKA 4HHHA 4O4RA 2A6OA 2EFOA 1OJ4A 5ETTA 1Q8BA 2ZHOA 1F1BB 4WU2A 4ECRA 1RT2B 2W4CA 3UR0A 5HVHA 2E1RA 2VKRA 3N6NA 1B7FA 3M30A 1ZTTA 2UXCF 3PYEA 1U0HB 1HI1A 2JSXA 3UDVA 5F8IA 3M6UA 4GO5X 4RW9B 2VH7A 3PXGa 3BSAA 2XGPA 4L3NA 5HQ8A 4DR2J 2MZSA 1OMSA 2CNKB 4J9RA 2RSQA 1R8HA 2ZBIA 1O0PA 2Y1JA 2DH9A 2E7VA 4A8QA 2KXFA 2BACA 2RUSA 1S9GB 2DNOA 2RJZA 1FEEA 1EETA 2LDYA 4LRDA 2ZH2A 2B9XA 2VG5B 3HHLC 3CCRS 4OYOA 2CYYA 1TAUA 5HI7A 3I4PA 1HD0A 4HHUA 2UUCJ 3WDOA 3C6UB 1MN9A 4NL5A 3HCXA 3M8YA 2M7SA 2LXUA 1AFIA 3BZQA 5THWA 3M8RA 5F8GA 4KYZA 2OFHX 1HQEA 2O66A 4B9TA 3HVAA 4A8KA 2YBVA 3UCZP 1OPIA 3UD4P 3RB4A 5KFUA 2V8PA 3KNAA 2F63A 4NCGA 3T41A 1X4GA 1RHQB 4OZ2A 3GJTB 3BR8A 2GVDA 3ITHA 1U2RA 4Q0BB 2XSJB 3NWGA 3CD6S 1IM4A 1FRMA 2JFDA 3KJFB 5K8NA 2VG7A 2VOOA 1RT5A 5GMDA 3HSJA 4P73A 3IG1B 4OX8A 1F2GA 3NS6A 4JI2J 4M5DA 4QOTA 1N5VA 1SI9A 1U7LA 3MM5A 5EX0A 4X4UA 1X4CA 1WACA 2MKSA 4KHRA 4FXWA 2XC9A 3DOKB 3UDCA 4RW6A 3OFHA 4LSLA 5E3RA 4JUZA 3RR7A 2WB4A 4P6QA 3W7BA 2BQ3A 3BREA 2R2UA 1M5PC 1QE1B 4NA2A 3G87A 1XMQF 4DCJB 2LQJA 1RZMA 4QQBA 2UXDF 1D8YA 2W9CA 4F36A 2M52A 5CHCB 2ZM6F 3T5HA 4DPWA 1K73T 1VJQA 1VRUA 2EFPA 2HGMA 3UW1A 5DDOC 2KVQE 1R43A 2UV8A 1SJ4P 1CJUB 2BJ8A 2EWHA 5K20B 4DV2J 1WHXA 1Y9OA 4Y34A 3DLKA 3PNIA 1RTDA 4H4KA 1C1BA 1H7XA 2AYGA 1S9FA 4C4WA 3QRQA 3DOMA 3VAFA 3THVA 1LW0B 4PUOB 3MCOA 1U1OA 1K1QA 1GMWD 2LECA 3GE9A 1N5YA 1XTZA 3AHPA 3C16A 3FSYA 2C22A 2IRYA 2HZCA 2D3UA 1I6JA 4I1TA 1DTQA 3CO0P 1ZM9A 3ET6A 2R7WA 1O5JA 2A2CA 3E8OA 2NLWA 2HVZA 2CAJA 4J9QA 2HZVA 4QPXA 2BBEA 5F9NA 1F9FA 4KSEB 3G9CA 2F65A 4DPOA 5GMEA 3TAQA 1Y10A 3KKFA 4PQAA 2AYBA 4ZPVR 3NOCA 4OV1A 2VBXA 2N7CA 1HBMA 1AW0A 2YNFA 1LXJA 4WIIA 4WTYA 5H1SV 3I55S 4NLPA 4ED7A 2QLWA 3G6YA 3W2WB 3MD1A 5H9EK 1V3RA 4GKKF 5SUHA 3GMGA 3FC9A 5HJXA 3LPEA 2QLJB 4EEYA 5IWAJ 3F56A 2EI5A 1SIZA 4LSNA 3US5A 2HW3A 5I3UB 1RWVB 3O44A 3EDQB 3FFIB 1G7CB 4DZ6A 3JQJA 1KDNA 3NMRA 4NA3A 1DBDA 3CCQS 1VHIA 3RBZA 2RHQB 3BDPA 1T05B 4K2JA 1HNWF 2BX6A 1SC4B 1B0PA 3NGSA 3V4IB 4TLRA 2HQCA 1LWEB 3D1QA 4HH0A 4MH8A 1XERA 3CO9A 2Y8WA 1M5OC 1RUSA 2F4FA 3PFOA 1C0UA 2DRAA 1WJ9A 2H9ZA 1GNKA 1KRPA 1DARA 4CQ1A 3RW6A 3OLAA 3NG8A 4HEA9 4Q44A 3ZC4A 3VF0B 1HW9A 1FK9A 2BYCA 4UY85 2Y0SD 3K5NA 5HVGA 4J37A 3DYAA 3BN4A 3NNHA 5L38A 4K0KF 1S4EA 2V4JB 2J7WA 3MD3A 2F4VJ 2JWNA 1RT2A 4FDFA 3PJ9A 1DZ5A 5C2GA 2WBMA 3M8PA 4K4XA 4LF4F 3T1YJ 4CO3A 1W2IA 4KGVB 3OXLA 2ZWPA 1YQHA 2GX8A 5F0UA 1TL7B 2KHCA 2VV5A 3IAM9 8AT1B 1UW9A 4HTIA 2F7VA 3P5TL 2IVYA 1HQUA 2XBPA 4PQUB 2VFRA 3P96A 1LWFB 1N32J 4NEZA 2JH3A 1HWKA 4NX9A 3CJKA 1IWGA 4XAKA 4YR2A 2YVSA 2YWFA 4JI3F 4OYAA 1S9GA 3HFVA 1D3WA 2JFKA 2ASLA 2YX1A 3QIPB 1FRIA 3MR5A 2JLFA 4NE9C 4OZ3A 4DV3J 2R3VA 3L3CA 1H2VZ 2VG5A 2N3OA 2CG4A 4FP9A 3NAHA 5B0FA 3IWLA 4DR3F 1EIYB 5RUBA 4DL2A 4YHHJ 3TEHB 3C6UA 2ILZA 2CQPA 1PKUA 3SBMA 3IRWP 3FMWA 1DRZA 2EEYA 4IOAQ 4A8WA 5KT2A 4M5HA 2NZ4A 1WNEA 4ANDA 1BC6A 4DEZA 1FTRA 1RHUB 1JJHA 4ETZA 3A8EA 2HBQB 5L46A 4PWDB 2B56A 2IPOB 1SC6A 3D28A 4BS2A 4LUBA 3HX9A 4OZJA 5ETPA 2N3LA 4Q0BA 1FWLA 2XSJA 1VQ4S 3PX6A 4IKAA 2EK1A 2A18A 1SL1A 2M70A 1OIAA 4DV0F 4W92B 4BC9A 4CM0A 4ELVA 2J8SA 4ZPTR 1L5UA 3KLVA 4Y6IA 5L1LA 2H51B 1X0FA 2AW0A 2YY3A 2WVEA 4ZDNA 2G2ZA 4BCAA 2V2QA 4NLTA 4LREA 2WHOA 3B8HA 1URNA 3T9ZA 4LVNP 2DH7A 3D66A 2B4VA 4ID5B 2RQ4A 2KN4A 2HBYB 3KWMA 4MK9A 3DOKA 2YX7A 3GSDA 5MAOA 2R9LA 3QMQA 2JEGA 4IQXA 2ASYA 3QGPA 4FYWB 2HQIA 4KKOA 3E3XA 4KQZA 4DV1J 2AIRB 2DRBA 3ILLA 4JI1J 2KYXA 2GMHA 3BO4A 3PW2A 1U25A 2CADA 2G2YA 1IR0A 4DMZA 3S01A 4F3OA 1WKJA 5K14B 1MLAA 3ZZYA 2CVEA 1N33J 4ZHRB 3GJRB 2K06A 2VASA 1NSKL 3TA2A 1XIQA 2QYGA 2CQ4A 4DR7J 1JKHB 5C7PA 3LP1A 1VQ5S 1ZM2A 1CQMA 4EU0A 3T6JA 3DFEA 2NXUA 1CJUA 5KG4A 1ACMB 1QAYA 4K59A 4LF7F 4YQWA 4C0HA 1CJKB 2E66A 2DR8A 4OHZA 5D4LA 3Q23A 4RW4A 3DMJB 1LW0A 4EYHB 5HJYA 3W5YA 2DYAA 4YOEA 2IA0A 1JIHA 4UOGA 1YRXA 2CNNB 1S1TB 2YKPA 2XNRA 2MLZA 3CJTA 1N5SA 3OV7A 5HAOA 2WSCC 1UVLA 3HVTA 3PW4A 1YK9A 4YB7A 3UN5A 4O23A 4J9UE 2KHDA 3AB4B 5KFRA 4UUXA 5H9FK 1HNXJ 4JI4J 3W2VB 2NPIA 5E3CA 4RWWA 4YEAA 4KE5A 1X4HA 1D9DA 2X1AA 1WELA 1IXKA 1EX8A 2HHVA 3MMJA 1UEUA 2Y3YA 1Z4UA 2VB6A 1S76D 1RTIB 5KFDA 5MLCV 3VVTA 1RT4B 4JV2A 4V19J 3JSYA 2ZC3A 3CC2S 1NK6A 3W2WA 4DUZJ 3A12A 1BHNA 1XNQF 1WEYA 1K47A 4ZPWR 2W4PA 1S0OA 2J0SD 3I9ZA 2FHJD 4L74A 5KFFA 3TZXA 2NS1B 3KHHA 4PWWA 4ICLA 4WF9Q 2MZTA 1FI4A 3FFIA 2XQCA 1R0BG 2FJXA 4DPUA 1FRJA 4ED8A 2ZH1A 3BYPA 1FDNA 3TX0A 2K3IA 1FFSB 1OPZA 2PMWA 1FWPA 3QGGA 1T05A 3FUYA 3J7ZT 2JNJA 2ZE2A 1OWXA 2GHPA 2OEJA 2QLFB 3IR6B 1LWEA 3G8TA 4KGKA 1X5OA 2UUAF 1S5ZA 3T5JA 2CQ1A 4CWBA 3TUIC 5DLFA 3H4DA 1U45A 3MMBA 2HYIB 3K57A 4LJMA 1X9WA 3K8WA 1XN9A 2MZ1A 2V67A 4DFMA 2IM1A 4HI2A 2UUBF 3FVYA 2C3YA 1KLNA 1C1CB 2OEMA 3GSIA 2DNYA 3ENWA 3PACA 3L95X 2AHOB 3IR5B 2QN6B 3AJ2A 1QAXA 5AXMA 5KFHA 3SFUA 2V4JA 1NB7A 4QWCA 1VMBA 3I31A 3CDAA 3A8JA 5LSOA 4ZITA 4F4KA 2K7KA 4HACA 2VG6A 3QT5A 3H2UB 1RTHB 4QIWD 1OSDA 1TL1A 1TP7A 2R7QA 3SIPB 1NPKA 1TL7A 3RR8A 3SEOA 4RBVA 4LF1A 1SUQB 4LF2A 3RJMB 1M5KC 4OX9J 5KG0A 1XR5A 5DGBA 2DO4A 4G1IA 4DV5J 3C66A 1JLGB 1LWFA 3HJVA 2OSQA 2PSZA 2YNIA 2CQHA 1ICEB 2M0GB 5A0YB 2IC3B 3QGIA 3PEJA 5IS2A 2D9PA 1WC3A 4O44A 4LRAA 2RS2A 3QIPA 5M2RA 3OVSA 4ZVPB 1E6VB 1S0VA 4XO0A 6AT1B 1K44A 2G2OA 1UPPA 3UN2A 2CJXB 5CQGA 5HROB 1QDUB 4WJBA 4ZVEA 4YDXA 2QA4S 4CTAA 4DJBA 3MEEB 4X65J 1YVFA 3QRRA 2C2RA 3FSXA 3G6VA 5CCLA 2XS2A 3D0HE 3SSSA 1HYSB 3OTCA 2P9EA 2FC9A 3PZPA 3EJMA 5KFAA 3KJVB 1WG5A 4NYZA 2XWYA 4Y28C 2HLTA 2QMUB 3NEKA 2HAIA 4Y2KA 1XK8A 4YY3F 4U95A 1UWBA 1BQXA 5ETSA 4DCPB 2W7PA 3E01B 4KJIA 2HHWA 1UA1A 3KOAA 1N56A 3J80U 1PCAA 4N5SA 4AUKA 1UEVA 2J0XA 3A8IA 3TZYA 3GB0A 4V19X 4LVOP 3LANA 3EGZA 5KFVA 4K50A 3MAAB 1L3TA 4DR5J 4O4GB 4OZNA 1YJWS 4K4TA 4ID5A 3J81j 3H4BA 5E2QA 3M9MB 4QZVB 4RBUA 4BWMA 1H0HB 2YQ0A 1PO6A 4IG0A 3DI6B 1CJTB 5ADZA 4CH7A 4PG5A 1NK8A 1WSRA 2KXNB 3QQCD 4DOZA 1PG5B 1ZH5A 1WF2A 2V9WA 3V6HA 2CDRB 2WOMA 1NDLA 2MQ8A 2XZDB 4ZHRA 1WI8A 3T9NA 4ED6A 4MT1A 1WI6A 5CH7B 4N76A 1TKZB 2ZNYA 4U9RA 4HL9A 1HWLA 2YX4A 4JP8A 1JJCB 2RRAA 1YI2S 3JYTB 4ECSA 2DBBA 3D3CJ 3OTDA 1FKOB 2GMLA 1IQZA 1TKXB 4LFBF 3HI9A 4M1KA 2A10A 3DM2A 3W66A 3H7HB 1UA0A 4B3MF 3FQLA 2YNGB 2LEAA 4OI3A 4F0MA 1REVB 3BGLA 1RHJB 1X5PA 3DMJA 3HVWA 1RYSA 4ZPDA 4WWSA 4PPZA 1X5SA 4WXWA 4LMZA 4IFVA 4RW7B 4N47A 2F8HA 5G0RA 2D1CA 1CLFA 3TAMB 1X0PA 1VQKS 4USUA 1GTHA 2YWWA 3N01A 4ED0A 1ELOA 1I1GA 1KR4A 3JB9k 1R6VA 1T9VA 4EI2A 3FNNA 2FVSA 3JQMA 3ENVA 2B4OA 3LGHA 4EO6A 2BV3A 3M4XA 4B3TJ 3E51A 3GTYX 2H4WB 4N8OA 3P4UB 4ZK7M 2AZ3A 2MXYA 1RT4A 2FTRA 1NZ8A 3CCSS 2V8DA 4JYAJ 1WWHA 1Z2ZA 3R9LA 3M8ZA 4ER8A 3WZ0A 5EDWA 1N54B 4ZVUB 2FVRA 1U49A 1T0TV 4A4JA 2QLBB 2YPZA 1REGX 5AXNA 5DM6Q 1XJWB 4ZVGA 5LMUJ 5T41A 4X4RA 1AT1B 4NRTA 2MQPA 5KFIA 4H4KC 2R7RA 1LW2B 3M2UA 3HPOA 2J6TA 3DXBA 3BBBA 3NBPB 2WVDA 4F3MA 4RZRA 1T9UA 2ZUAA 1ZPVA 5GAGI 2VOPA 3V4MA 1L3VA 2N7YA 1GEHA 2BQRA 2W2MP 3UNYA 5LMNF 2A0FB 3B78A 1HR0F 1IR2A 2V4RA 3KLGA 4HR2A 2GV1A 5J2NB 2HHPA 3IGVA 1S72S 3THPA 4IG3B 1TK0A 4PZVA 2WAQD 4QWBA 3UFCX 5J1EA 2PI5A 2FHMA 7FDRA 4FF2A 2Y1LB 3KFWX 1AUSL 2H5EA 4QWDA 2ERRA 3DGPA 1NNDA 2FLNA 1G4CA 2E44A 3DGVA 4PWUA 4DV7F 3VAJA 5K8MA 3JTPA 3CE8A 2P8IA 3ULHA 2VPZB 3VVUA 2JEJA 3OR1B 2RVJA 3PX0A 1RHMB 2KB2A 3EXYA 3X1LB 1RTHA 2CJ9A 1S6PA 1S12A 3HHLD 2HNYB 3RGIA 3C6TB 3GJQB 2R7SA 4OX7A 4K4VA 2EC0A 1TUVA 1F5AA 3BKTA 1PYTA 3EGVA 1NK7A 4YB1P 2J9CA 5KG6A 4R0JA 5D6GA 3ZZOA 4DQQA 4DR4J 1FF2A 2ZVSA 3CVKA 4IDKB 1YJVA 5A0YA 1A6LA 4G65A 1IBMF 2E1MC 1GMUA 4B9VA 2QJ3A 2ZH6A 1VIXA 4DS4A 3KK3A 3PHEA 3OTBA 2FHKA 3VGUA 1GMWA 3ZZPA 4TN2A 1AZSA 3CEDA 3MPYA 1HNVA 2VKZG 3K5MA 1NJIT 2CRLA 2RKIA 3GCXP 1R6YA 3VZHA 1VBXA 4I68A 5HLFA 3PO4A 1VBYA 3LP2B 3PRBA 4X4OA 3OFEA 3PW7A 1EZZB 1M0SA 4X4SA 2CQCA 2F40A 2E7WA 2DGWA 1CEZA 1HYSA 4H4MB 4HKQA 3J7YI 3IBCB 3BV8A 2R7UA 3GCWP 1D9FA 1TV6B 1VJWA 2XSFA 2ZBPA 4OYMA 3KHLA 2DRDA 3VGVA 5EWEA 2I0XA 2CJKA 1B0VA 3PHTA 2APOA 2GQ2A 3I82A 1C0TB 2FGOA 3UWTA 2W2PP 3W9HA 3QNWB 1U1RA 2KFZA 1X7VA 4ECQA 4C98A 1UFKA 2DJWA 4FKXA 1S6QB 2V8HA 4MK8A 3H5SA 2BW2A 1R8BA 3KYLA 2JLGA 4JV5F 4N41A 4DDFA 3G6XA 2OMLA 4FS1A 4TVAB 5I3QA 5H9EJ 2RF2B 2B3TB 4HT5A 4DX6A 3T3FA 1CJTA 2OPSA 4O3PA 5IV4A 4MMOA 2NQPA 1RSCA 2FVCA 4WFBQ 1JMTA 1SJQA 3Q22A 1NHVA 4EMDA 4F67A 1BWEA 3R5DA 4CCHA 1DQAA 4ZIVA 1RB0A 1Q81T 5KFCA 1WC6A 3DLGB 2PT0A 1RBAA 3ZTQA 2BKNA 4ZP6A 3JAMU 4FBUA 1YWXA 3HVRA 3CDEA 1SKSA 2VPXB 3OQ2A 4IOBA 4HH1A 2GIQA 4DU8A 3BKFA 1NK4A 3Q2TC 4O0NA 2FJEB 2GHVC 4EBCA 1FKOA 1RU1A 1Q1KA 4P74A 2XYHB 2O1PA 2ASDA 1REVA 1L3SA 2DR7A 1S1VA 3C14B 4M8LA 1RI7A 4M5MA 3NGRA 1AXQA 2FY8A 2DNQA 1A7GE 2IYGA 2DK2A 3IWNC 2XEXA 1U0SA 2PIIA 1TKDA 3AODA 3CUNA 2X1FA 2VDHA 3TWZA 2Z4PA 3TYTA 5D0HA 5FDLB 1XWLA 5K9FA 2DNRA 3ZTPA 1U2FA 4D3HA 2KG0A 2EPIA 5F3ZA 4GVBB 4HDHA 2ZBCA 4B3OB 3OTOJ 3H5XA 4NMLA 1CULB 4OYZA 1Y5NB 5CXTA 2DPIA 2DNMA 3LUYA 4HLBA 1E6YB 4J9KA 3G82A 2EG1A 2DNHA 4OYIA 2NXJA 1MNEA 1JLCB 3R7BB 1T9YA 5A8KB 2RDJA 1FKPB 1S9EB 2C2NA 5D8HB 3RAMA 4UW2A 3O3LA 1FDAA 5IFMA 2GO8A 5EWGA 3MFHA 4CLTA 4F4YA 4FYDA 4C0BA 1Y4ZB 3CDWA 3AH6A 2MLYA 2XMWA 4NA1A 1Q86T 3RYLA 1N34J 1ROFA 4QIFA 2OPRA 3NBPA 3FEZA 3AQOA 3AB2B 3H42A 1VLYA 2WONB 1R8CA 2QO3A 1NRKA 1QAJA 5HBMB 4QIVA 4W90B 1S49A 1HLWA 4Q45A 4C48A 5IWAF 5HANA 1ZAXA 1N36J 3A4TA 2DHXA 1SH0A 2JHEA 4X64J 4E98A 5GMKa 5J2NA 3V81B 4RBTA 5KFWA 2VBZA 2HFOA 4IYQA 1DHMA 3OPKA 3HZEA 4B9SA 1UMJA 2B5JA 2CQGA 3LA0A 4ED1A 3CJQA 3JTOA 4KGMA 2BJ9A 3T1AA 1VRQC 3HULA 5GAEI 4C3KA 2DNGA 2R2RA 2IVFB 2Y1RI 3DRYA 4QIEA 5IQ6A 4YDDB 1FX2A 4KO0B 2XG8A 4CRJA 1R8AA 1XR6A 5JVGQ 3LW5C 3JS9A 4DLEA 2XLIA 2VQEJ 5M2UA 1U2CA 2EG2A 3S8SA 2O01C 4AT1B 4JI7J 4A8YA 3RRGA 3S6EA 4M95A 4F25A 3C6TA 3AY0A 1U8SA 4JI5J 5HVFA 3TW0A 1IBCB 3TO8A 3IM8A 2F4VF 2I5JA 2CJQA 4IR1A 3IAS9 2RDIA 1BXNA 1LK5A 3T1YF 2HEKA 1I51B 4IDKA 2KRRA 4QW8A 3MXHP 1H74A 1RK8A 1RT7B 1CBKA 1LQ9A 5F0WA 4I6AA 3CSKA 1L3UA 2AD9A 4KB7A 4PYAA 1RKIA 1NHKL 3QWUA 1U1LA 3ETMA 4BHQA 5B0AA 5KFSA 3Q8SB 4NZ0A 4PG8A 2AJ2A 2HRTA 5D0EA 3J7A1 1BQMB 3OJUA 4QWAA 1SB6A 4CLPA 4PKDB 4K4YA 3MDFA 2HHHJ 4OFZA 5E3AA 2IDEA 5LOQA 1X60A 4WYWA 4A8MP 1SXLA 2Y9HA 3ILJA 4C11A 3WQPA 4H4MA 3GFZA 2UVRA 2XYPB 3MM6B 3NCQA 3U1NA 5KFJA 3BQ2A 2PEBA 3L7PA 4ZP8A 1FVSA 2CFXA 4JI0F 3W64A 4CLYA 2CPFA 1TV6A 3N28A 3AAWB 4MYUA 3CD7A 5B08A 1JLAB 5HMYA 1IBKJ 4LBHA 3H8YA 4J9SA 2BR0A 2R2TA 1U1QA 4MKBA 2A1BA 5KFZA 5EX3A 5GADI 4QR2A 5IV3A 2BJDA 2UVUA 1LNQA 2ZITA 3K5PA 4N8NA 3M2RB 2JJ4D 3GYNA 3AA9A 1C0TA 3KK1B 3SCKE 1IKYB 4LRCA 3MM8B 1VC0A 3QYYA 5AXKA 1S6QA 5E5NA 4ZJOA 2MKJA 5HSPA 1FNXH 4AL7A 3OR2A 1FVQA 4B3SJ 4NI2B 4RW8A 3G96A 2VIHA 2B9WA 2B6AB 3OVBA 1WF0A 1KHVA 2XULA 1YDLA 2HFZA 3EXCX 2AU0A 3DRXA 1DY3A 4XK8C 4TY9A 4KHMA 3RB6A 1X31C 5DG8A 5HATA 3EGWB 3MHYA 2COLA 5I4MA 3J80Y 4ZLPA 3GPAA 3POTA 3D9BA 2DHAA 1WTBA 1SL0A 4F2SA 2D3O1 2NUHA 1TL3A 3MM7A 2ZKTA 4JI1F 2EBEA 3LH2S 4LR8A 5CYJA 2P9GA 1RLCL 3ZZUA 2VFTA 1F6TA 3CJRA 1TL4A 2ZBRA 4M5GA 1Q78A 1H72C 2D9OA 5CD4H 4LIRA 5G4DA 1N33F 3FMBA 2FLLA 1RAJA 2NREA 2UXCJ 1H7WA 3CCTA 2WSEC 5JXSA 2ZOMA 2LP4A 5KG2A 2QIFA 3ISNC 4W4MA 5J1NA 3M1VB 3BGRA 3PYGA 2DXDA 3KLHB 3WC2A 3M8WA 1RTJA 1EETB 3LP0A 4ZOSA 1Z2LA 3I0SB 2PN6A 2RNEA 4AE5A 5FDLA 3ZTSA 2N4DA 1NAQA 1WC4A 3UD5A 2X51A 5HMXA 3SZ2A 2BRKA 3BQ1A 2UVVA 4B3OA 1LWCB 1IKXA 2BM0A 1NMEB 1GQEA 3KG0A 1VBZA 3A3OB 4JB8B 4QBUA 1ZM3A 2FIUA 1JLCA 3H5UA 5A8KA 1S9EA 4JI4F 1WDDA 3RAQA 2E5LJ 2GVDB 4TYBA 2ZJRQ 3W63A 2QFIA 1J5EJ 2E9TA 4UOCA 3CT9A 2J8AA 1SIWB 3OL7A 4FYXB 1EQMA 4R5PA 3MECB 3F73A 2F5GA 3EVOA 4DUZF 4TY8A 2WBRA 2E1AA 2OD6A 3JQKA 5L39A 1F9EB 1SQFA 4MIAA 3NOGA 1UVMA 4E8UA 3CCMS 3O1LA 1V5VA 2ZJPQ 1QVGR 4I0WA 3IWXA 1VGYA 3PR4A 1NEEA 4U8YA 2P9CA 2M88A 3FGVA 1XMBA 4LSLB 3D5MA 1JXLA 5DZ7A 3Q89A 4P7TA 2PA3A 1F3FA 4F0KA 1F3VA 4USHA 1FWKA 3BO3A 1NH8A 4J91A 3PY8A 1QSLA 5DM7Q 3LWMA 1R3NA 4J9PA 2DGXA 5A8RB 1NJYA 4DXLA 1VRUB 1X5TA 4KO0A 2I38A 1XMQJ 4K5SA 2QFJA 5KFXA 3DHWC 1RWOB 3PJWA 3IP0A 2DY1A 1NDPA 5A76A 4DUYJ 2MQLA 5D0GA 3QPIA 2DGSA 1WG1A 2IDLA 3G8QA 1RTDB 5D77A 1C1BB 3SCLE 4YR0A 1Q53A 1FO1A 1TU0B 1RT3B 1FXDA 1FE0A 5KAKA 1VBKA 1WORA 3QATA 2B9EA 1TTHB 4YMEA 2B43A 3PRVA 1N5YB 3DDNA 5L1JA 1SQGA 3C16B 1NHUA 4O3NA 4QCLA 1HHQA 5T7LA 2XLJA 2J7KA 1SQEA 2OPQB 2HS4A 4C8YA 4WKYA 1RP5A 2Z2MA 3I5BA 2AJ1A 4DFJA 3CCWA 2PGCA 1VOMA 3BQ0A 2ZDPA 3H59A 2V0NA 3PRDA 2DH8A 4DV5F 5A6PA 4GO7X 2HFSA 1BQMA 2OJ3A 2RH3A 3NY0A 4F0HA 5C24B 3RAXA 3UVJA 1HBMB 2YNFB 4H4OB 5CAAA 3MI7X 4RPFA 1JLBB 1MW7A 2V50A 2ZKUA 2Z2YB 3K17A 3SQGB 4YR3A 2VFUA 4LRFA 5J2QA 1S6OA 3IFEA 3N0VA 4C0OC 2DY9A 1GMVA 2PMHA 4WZQA 3FKBA 1OQ3A 1JLAA 4B02A 2Z57B 4PG7A 1GFWB 4CO1A 3W3SA 1YZ6A 2XO6A 3M6XA 3OSPA 2Q66A 2ZVIA 2ZOFA 4KAIA 3OL9A 2BUNA 4DI6A 3W5XA 4OYWA 4USJC 5I3PA 1K8AT 3RBXA 3OFGA 3KK1A 4JI6F 3SV4A 1JJ2R 1PIEA 1P8GA 4H54A 2DGOA 2BE2A 2E1PA 1HHTP 1W25A 1QUVA 2QRRA 3HD1A 1C0UB 4NLWA 1H2TZ 4KC5A 2DKOB 3JXOA 3HO1A 4X4NA 3LQVA 1S97A 1N6QA 4NI2A 3TAPA 2DGVA 1LXNA 2HMIA 2RRNA 2B6AA 1JLFA 1JLEA 3W65A 3Q8RB 2CPHA 4FS2A 4CO0A 1NKBA 5KFNA 1OYDA 2VBWA 3BBCA 2QV6A 5IZHA 3JTNA 2A6MA 4ATNA 4K4UA 2EVZA 1NJZA 2ALYB 2NYIA 1U24A 3MM9A 2DIUA 2RQKA 2IJNA 2M9KA 5EN1A 2OGUA 3LGNA 3CC4S 3HMJG 1MWQA 4B9MA 3M8PB 1SVDA 4RU2A 3EGNA 1RA7A 4B3RF 1SJFA 1KN6A 4KHPF 3KNGA 1WOPA 4K0KJ 4CO4A 4X66F 4HVZA 2HNZB 3S1TA 1GXUA 4DN0A 1N0UA 1SKUB 2FZCB 4QPTA 3IS9B 3SFGA 3P45B 4LF4J 1HQUB 4ERDA 3CDBA 2XMVA 2GVZA 3G4SS 2QLXA 4A8OA 3HHLA 3CCES 2AYMA 2G1DA 3THTA 2H1YA 2W1BA 3CJKB 5BYSA 4WYLA 1KTVA 3CJ3A 1NPRA 3M1VA 3SCJE 3KLHA 5F8JA 2V4QA 3I0SA 3WX4A 3MTKA 1Y5LB 2B9YA 1O51A 8RUCA 2DNKA 3JAMY 5ITHA 3WC0A 2CWKA 3TZWA 1DAXA 4OYBA 2K8GA 2I6WA 2AJQA 4K7QA 1ZAWA 1S1UA 4I6YA 2W8LA 1NO8A 4I7FA 4JI3J 2F8MA 3TA0A 1RWMB 3NL0A 3K8VA 2MQMA 2FVPA 4O3QA 1MMNA 1GT8A 1LWCA 3D0IE 1QAIA 2IM3A 3FCVA 4KTQA 3MCMA 4NLYA 3D4JA 4BDPA 2W9BB 4MKYA 1F0XA 3GYXB 4EUVA 5LJ5Y 7FD1A 1CJVB 5CA5A 4DR3J 1VR6A 2C28A 4RU9A 3Q0AA 2EK6A 2HWIA 3QT7A 5F3TA 1RHKB 2JC0A 4KBIA 1KD1T 2DXEA 4B3TF 2F8EX 3D6TB 4JI8F 4PR6A 4ZVRB 3FBEA 2FGCA 2AF6A 4Y00A 2HQ3A 3MECA 3BEGB 2VL1A 3IRXA 4TQRA 1VC6A 4FVCA 2ZH5A 4NLVA 3PIOQ 2U1AA 1U1PA 3NS7B 2YKNA 5HN0A 4DV0J 3D6FB 4F2RA 2D7SA 2J6UA 3DDKA 3R5CA 4QR1A 4NMXA 5IOLA 4DPYA 5DJBA 4CNZA 3UR3C 4KKOB 5A6WA 3FEYB 1PYOB 3OSNA 1Y7PA 3BB5A 5U47A 2MQQA 3KUHA 2QL9B 1P1TA 3NKYA 2G0JA 4LFAF 2KRBA 4ZCLA 5KG3A 1ZTWA 1YKWA 2HRUA 2ZEJA 4CP5A 5A8RA 4C8OA 2ABYA 2ZWOA 5C5JA 4DV4F 3LF0A 5BYQA 2R8IA 4MIBA 3QJLA 1FKAF 3M6WA 2HURA 3LP1B 1HBOA 1QJHA 3MR7A 1KQGB 4DR1J 1XBWA 2HLUA 3FRZA 2MZRA 1HBNB 1FHTA 1NKEA 3MCNA 1NJWA 3Q8UA 3GIJA 2NSBA 3VR1A 5BYRA 2G0CA 3A3PB 3HKZD 4NXMJ 7AT1B 1I5OB 4DLGA 1RT3A 2G13A 4RW4B 4OL8A 3AOCA 2HG4A 1WHYA 3HHNB 1ZM4A 3R5GA 2LFVA 2CKWA 2YKMA 2ZD1B 2OPQA 3RZAA 2OP5A 3HVTB 2VQFF 2L41A 2VU5A 1T8EA 3CF5Q 2HNDB 3OL8A 4DL7A 4IUFA 4RJVA 3DRRB 2CPYA 3MF5A 2R7VA 2NXEA 1T95A 2QGFB 5C24A 3ZZTA 2DNPA 4H4OA 3HT0A 4LQ3A 1D8ZA 1YITS 4PPDA 2AT1B 4FNIA 2B8QA 2YH0A 2B7CB 1JLBA 5CYQB 2RIJA 5JJBA 3DDIA 3NAIA 4Y2CA 3BPSP 4K4ZA 3SQGA 4KH0B 3OUYA 1AROP 2FY1A 4K2XA 1ITPA 4ICLB 2YQ3A 4ECXA 1D09B 1YGYA 1Y11A 2LLZA 4O3RA 1FRKA 2BVZA 1ZETA 4GRSA 4F4XA 2J9EA 4LBPA 5HMWA 1MROA 1IUJA 1AUDA 2Z58B 1XNQJ 4I69A 1CQNA 4RUCA 3ENAA 3HHDA 4U8VA 2ZE2B 3MTJA 2GA7A 3VQTA 3EVMA 1B3TA 2KZMA 3W1YC 1XR7A 3MMBB 3GZ7A 3QT6A 2LQ8A 3BM7A 5B0GA 2F9JA 3PR5B 4FPIA 2OIHA 3CJ8A 1IWAA 2UUAJ 3KTQA 2CQ3A 1YG0A 2C2OB 4Y2AA 2GMJA 3OL6A 3K59A 3BH6B 4J9VA 4RNNA 1SC3B 3FZ2A 1Q82T 5B7WA 4HT7A 1IVZA 2J9DE 1NDCA 5A8WB 2AWZA 4HACB 4ILMA 2VG6B 1VFJA 2ZZMA 2ATLA 3QAEA 1TL1B 2IM0A 2HNZA 2DHSA 3KMQA 4ENOA 2IIHA 3IS9A 3D1OA 1IM6A 4WK1A 1PC4A 1V3SA 2BE9B 2HVHA 2ZH4A 3EX7B 3CIMA 1T03B 4DPXA 4OJGA 2YNIB 3M2VB 4LT6A 2HBZB 5KFYA 2CPEA 2YPYA 3Q8VA 4U7CA 1RU2A 1ULRA 4DR6F 2Q1LA 4WZMA 4NLUA 2Q79A 2HRYA 4F50A 1QSYA 2LQ5A 1UZDA 1IR1A 5GAGU 4WE1A 4O44B 3V6DA 4EBEA 2BANB 1B4SA 3Q24A 3FCHA 1TMMA 3GLJA 1RWUA 5CYMB 2AP6A 3EUNA 4R8UB 4WFYA 2VPYB 3PYFA 2QX0A 1HWUA 1BY9A 2OPPA 2EFQA 2C2KB 4CTAB 5BR8J 1RLDA 3TJ9A 3PDNA 5DQGA 5F8MA 2AX0A 2LA6A 1SCJB 2MQOA 1TMJA 2YWHA 1RWXB
chains in the Genus database with same CATH topology
3PJXA 1FEEA 3IC1A 2B3TB 4HT5A 1EETA 3ISZA 5HO4A 2LDYA 3NS5A 4DV1F 1TK8A 2ZH2A 2B9XA 3T3FA 2B4UA 2W9BA 2OPSA 2CPZA 2VG5B 2W9AA 3HHLC 4O3PA 3CCRS 4UUWA 4MMOA 2NQPA 2CYYA 1TAUA 5HI7A 3I4PA 2FVCA 4WFBQ 1JMTA 2Z8QA 4AXIA 1HD0A 4WU3A 5HP1B 1SJQA 3Q22A 1NHVA 4I2PB 4F67A 1WG4A 1BWEA 1RA6A 2JEFA 1U09A 3R5DA 4CCHA 1DQAA 3WDOA 4ILRA 1Q81T 1VQ7S 5KFCA 3L09A 3C6UB 4NL5A 3DLGB 2UZAA 2M7SA 2PT0A 4QR0A 2LXUA 1UWBB 4ZP6A 1AFIA 3BZQA 4FBTA 5THWA 4FBUA 3ZZZA 3M8RA 1YWXA 4OI4A 5F8GA 3CXCR 3CDEA 2KG1A 2JLEA 3HVRA 1SKSA 2VPXB 3OQ2A 2OFHX 3HHLB 3DLBA 3KLEA 4IOBA 4Z2XA 4HH1A 4CZCA 2GIQA 1HQEA 4F4WA 2O66A 3HHEA 3OXFA 1NK4A 2GHWA 2XB2D 4B9TA 3HVAA 4A8KA 5AE2A 4OZ1A 3Q2TC 4DR7F 4ECVA 2FJEB 2GHVC 3UCZP 2V94A 3R27A 1OPIA 3UD4P 3RB4A 4EBCA 1FKOA 2XMJA 1Q1KA 3JSRA 4PG4A 5KFUA 4A8XA 1N48A 3KNAA 2CZ4A 5D3GB 1DLOA 4NCGA 4FNHA 1X4GA 5K14A 4QU6A 1YBAA 2Q43A 4BC7A 1YSJA 2M8HA 2YWKA 3BR8A 3ITHA 1U2RA 4Q0BB 2XSJB 2O1PA 3NWGA 2ASDA 1V6HA 1REVA 4GC6A 3CD6S 2LYVA 1L3SA 1IM4A 3CCLS 1FRMA 1ZZNA 2JFDA 4Q8FA 2DR7A 2CIMA 1S1VA 3PX4A 4M8LA 1RI7A 3KK2A 3GFHA 3VZIA 2J0QD 1JKHA 1S1UB 1AXQA 3TX8A 4G6VB 2DNQA 4DHVA 1A7GE 1GXLA 4I7FB 3O5TB 2HGNA 2CQ2A 2LCWA 2LEPA 5K8NA 2HS3A 2L3MA 2IYGA 2CVIA 2DK2A 2RU9A 2VG7A 2VOOA 3IWNC 1RT5A 2ZNZA 1U48A 2OTJS 3GWCA 2XMMA 2XEXA 2UXBF 4YP3A 3IG1B 1KNZA 3O8WA 4OX8A 4AXJA 1FDDA 2ZUGA 1F2GA 3NS6A 2HHTA 5DG9A 4IG0B 3TANA 4ELUA 2PIIA 3KLIB 2Z2LA 5B09A 1SBRA 2K7JA 5AE1A 3CCJS 4M5DA 4QOTA 1TKDA 3UDLA 3CUNA 2X1FA 1N88A 4MKAA 1NU4A 1N5VA 3CCVS 1SI9A 2Z4PA 4URQU 4ZP7A 3TA1A 1JWWA 3TYTA 1U7LA 1Q79A 3MM5A 2QE5A 5FDLB 1XWLA 5K9FA 5F8NA 2EFGA 5EX0A 4X4UA 1X4CA 1WACA 4P7VA 2DNRA 4GKJF 4C7QA 2R7XA 2MKSA 4KHRA 1U2FA 4D3HA 1VRTA 2A3JA 4X64F 1VQNS 2WOMB 2XMTA 1R0AB 4FXWA 3TVKA 2XC9A 2KG0A 3DOKB 3UDCA 5M2PA 2RU3A 2L9WA 4RW6A 5K8OA 1HNIB 4JBCA 2EPIA 3DOLA 2QA1A 5F3ZA 3PEHA 3OFHA