1I51B

Crystal structure of caspase-7 complexed with xiap
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of caspase-7 inhibition by XIAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-7 SUBUNIT P20
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1i51B00
4ZVSB 2CNKB 4DCOB 2XYPB 2H5JB 1PYOB 2CDRB 2QL7B 1SC3B 1GFWB 2FQQB 1RHUB 1RWKB 2XYGB 2HBZB 2Y0BB 2H4YB 2CJYB 4LSZB 3GJSB 2QLBB 2CNNB 3KJFB 1RWOB 1RHKB 2CNLB 4ZVQB 3D6MB 4ZVRB 1BMQB 3RJMB 2CJXB 2HBYB 2C2MB 2QL5B 1RWPB 3R6LB 2CNOB 1RWVB 1I3OB 2C1EB 3GJTB 2H51B 2H4WB 3QNWB 1SC4B 2H5IB 1PAUB 3R7NB 1RWMB 1SC1B 5IC6B 4ZVPB 3KJQB 3P45B 3D6FB 5K20B 2H54B 1RWXB 1QDUB 1RHRB 3R7BB 1ICEB 4DCPB 1RHMB 3D6HB 3R7SB 1RHQB 3EDRB 2C2OB 3R6GB 4ZVTB 2P2CB 3IBFB 2QLFB 3IBCB 4ZVUB 4JB8B 2QLJB 2HBRB 1I51B 1RWNB 1RWWB 1F9EB 2DKOB 1RHJB 4ZVOB 3SIPB 5IC4B 1IBCB 3R5JB 1QTNB 2C2ZB 2XZDB 3KJNB 2H65B 1NMEB 3P4UB 2Y1LB 3EDQB 4DCJB 1RE1B 2H48B 3NS7B 3GJQB 2HBQB 3GJRB 2XZTB 2XYHB 2QL9B 2C2KB
chains in the Genus database with same CATH superfamily
1IBLJ 4OX8A 1T9WA 1VRTB 2AYMA 2B8PA 2ZHAA 3T5LA 1JLAB 3ONQA 1K73T 3GSDA 2I8EA 4PKDB 4Y28C 4KHPJ 4F04B 4LR8A 4PG5A 4YP3A 3GIMA 2ZM6J 4DV4J 2FIUA 3RG6A 5KT5A 2FQQB 1U6ZA 3MZIA 4U8YA 2MSSA 5B0DA 1HPZA 1FFSB 4IFYA 2MGZB 1PBUA 3LP2B 3GU0A 3I0RB 2MQPA 1OPZA 5LJ3Y 2QZ8A 4ED6A 2HHHJ 2NUUG 3LF0A 1RA6A 2KG0A 4D3HA 1WOOA 3D6TB 3TJAA 1S1VB 1NXIA 3HD1A 2WSCC 1J27A 2IRXA 5L1LA 1RTJA 2V50A 3DDKA 2HMIA 2ZNYA 3DC2A 4JUZA 2B6AA 4LF8J 4TYBA 2VPXB 1W7WA 3QGHA 2HQDA 3ET6B 3HHKA 3SDEB 2P9GA 3R5AA 4B3OA 2VG7B 4LMZA 1Q4RA 2EC2A 3AB2B 4HHHA 4KT0C 3LW5C 4C0OC 3Q2TC 3A8JA 1U26A 1IBKF 1PJ6A 1IN0A 4Q2LA 1CG2A 5HJXA 2IAJB 4M5HA 2CVIA 4F67A 4PG6A 2WOMA 3FEXB 2JZ5A 2CDQA 3KJVA 2DGOA 1FWPA 5I3QA 1N4LA 2HHSA 5KFLA 2VQEF 1UW9A 2APOA 2CJBA 1SIZA 2XS7A 4O4GB 5B0BA 5D15A 2UVWA 1TQLA 2J76E 2FJDB 2YBVA 2V4JB 3HVTA 4FDFA 5D78A 4LBIA 1G3OA 5FDLA 4YY3F 1H38A 3IRWP 1EP4A 1ZS6A 2HYIB 4LF8F 1BWVA 3CDEA 8AT1B 1B4SA 1IXKA 4EBDA 2BOAA 3IM9A 3PKYA 2HVIA 2JEFA 4RZRA 2DXEA 2MKYA 2V4JA 3HVTB 4PABA 4DBQA 1NK6A 1TUGB 3MM8A 2VBYA 3ISZA 4DHVA 1B64A 5T41A 4LR9A 5DETA 3I6PA 4NEYA 3OUYB 4Q43A 5KFSA 2WBMA 3H2UB 2BQRA 1SJRA 3MM8B 3MPWA 4O0NA 2CQ4A 4HR2A 5H9EJ 2XY5A 5BYRA 2NXJA 5CCMA 3FMBA 1YZ6A 3R7SB 3KLFA 2LECA 3G6ES 4GMKA 5AXMA 5C42B 1ELOA 4ECUA 2VC1A 5EN1A 4RWXA 2JFDA 2J0XA 1R6YA 2G0JA 1B0PA 2HS0A 2BVZA 3M4XA 4IQMA 1HD1A 1TMJA 2UXDJ 4FYWB 4RW9B 1IBMJ 1MMLA 4CLWA 1FDDA 1MROB 1LWEB 5A6WA 4CLPA 1RK8A 3L7UA 1NK4A 2DTJA 4FXVA 4K4YA 1N5VA 2FJVA 4G1QB 4DWIA 2HFVA 1EJ7L 4KHPF 2G0CA 1KLNA 9RUBA 5KFHA 1REGX 4USKA 1V3ZA 2ZOFA 1UFWA 3ET6A 3BM7A 3IRXB 3PM9A 1BLUA 3V6DB 2IY5B 2YNIA 2FY8A 3H2LA 2IM0A 2MZSA 3FBCA 4W98A 2A2CA 3Q8RB 2AZ1A 3ZFVA 2R8HA 2FLPA 2B6AB 4WK3A 1UJ6A 3MD1A 5D0RA 2OAUA 3UW1A 3VAMA 2AW0A 1UL3A 1S6OA 2JDJA 2NXUA 3GTYX 4L75A 1H3DA 3SBMA 3KHRA 1UWAA 1TK0A 1Y0HA 1J2VA 2AP6A 2Y0SD 1S0NA 2LLZA 4X4VA 4RW8A 2ZKTA 3I0SA 3OL6A 2VQFJ 2G2ZA 2YNFA 1S7HA 2V8PA 1CS4A 4WIIA 4PEOA 2QL9B 3PX0A 4EBCA 1A0OB 2HAFA 2XULA 3MTJA 4FZVA 3MMCA 5D77A 3K5NA 4IFVA 3OL7A 2XNRA 2ZZTA 3B8HA 4OHVA 3FBBA 4DG1B 3KTQA 1TP7A 2F7VA 1T9XA 2DPIA 2B4OA 4DV1F 4U7UK 4DSIA 3ZTRA 3WZ0A 2FUG9 5HL7Q 1WSVA 4F3OA 1SC3B 3EGNA 1SH3A 4NLQA 2HBZB 3FEZA 2PC6A 3UVJA 3AH6A 5DDOC 4ER8A 4LSZB 3R5CA 3TVZA 2BM0A 2HZCA 4NLTA 3MAQA 3QIPA 2AYGA 1RI7A 2DXDA 1F0XA 2DCUB 3FSYA 1RTIA 1U2RA 3JYTB 2W7AA 3IO1A 2SXLA 2XMVA 1P8GA 4RPFA 3WX4A 3CCVS 1DRZA 4ZVQB 3VHQA 2CIMA 1AUDA 2QA4S 1G2EA 1R8PA 1O0PA 4LF2A 2EBEA 4Y3CA 3WQPA 1OPIA 5KFCA 3M8PA 1WG4A 2R7RA 4XDDA 5I4MA 3ETOA 2R2UA 3AJDA 3KUEA 1HFEL 2DGVA 2UV8G 1N32F 1X4AA 1KDNA 4TY8B 5A8KB 2KFYA 4U96A 1RCOB 2H5EA 2J7KA 4K8RA 4OI6A 1BHNA 3EZUA 3W1YC 1WHVA 2DR9A 4M5JA 1SJQA 2MKSA 3F41A 3QT7A 2BYCA 3M8QB 4WXOA 3R2CJ 4WF9Q 1YJNS 2R2SA 3GLJA 2N4DA 2H4WB 3I9V9 1BUXA 1MN9A 3EGWB 4RNFA 2GS8A 4J9OA 2QTWA 4LF5J 1M5HA 2CQDA 2DK2A 2D1CA 3VZIA 1V3SA 1HD0A 3KJQB 4YMEA 3W3SA 1AZSB 2KH9A 2CKWA 2JWNA 4NYOA 2H54B 2HZAA 3Q0AA 4PZVA 2FHJD 1HBMA 1RAAB 2MTLA 4AL7A 2HEKA 2LMIA 5A8RB 5C24B 4IUFA 2LXIA 2K7JA 2Z2LA 5CAAA 3DLGA 4E0DA 3CCJS 4OMFG 4QR1A 3KWMA 1WDDA 4NLRA 1YJVA 2RVJA 1TVRA 1FFGB 3K89A 1R8AA 3R27A 3TI0A 2V2QA 3ZZ0A 4YY3J 2ZH8A 1T0TV 4M63A 3M2VB 1NHVA 3EZOA 2XMKA 3CDBA 3DRXA 3W7BA 2V2KA 2IA0A 3JSRA 5D3GB 4YHHJ 2FVSA 1T05B 1CJTA 4M5KA 3US5A 2ZH2A 3G87A 3M2UA 4F26A 2XSJA 3W2VA 3PR5B 2XO7A 1VK3A 5IQQA 4TY8A 4DFPA 5ETTA 3SFGA 3HHNB 1BQMA 1F9EB 2MZQA 3JTPA 2GIFA 2QA4G 2C3YA 5K8NA 3GONA 1TK5A 1JJHA 1XNQJ 4NLPA 1NKCA 2QGFB 2KFNA 3D1HA 1N5QA 4RUCA 4JV5J 3EGZA 2C2ZB 4E2FB 1VR6A 2XBPA 3MAHA 4J9QA 3RRHA 1CJUB 1S1UB 3HK2A 4XTTA 1EQ0A 5A0YA 1WEYA 4IO1A 4TQRA 1DTQB 3PJXA 4MKVA 1M1KT 3H4BA 4WZQA 2OI2A 2PSZA 4FYDA 1F2GA 2H48B 4R5PB 1LFPA 1X5SA 2P6TA 4I6YA 3QJLA 3M30B 2HQ3A 1VRQC 3L09A 3R3TA 1WF1A 1S4FA 4NE9C 1WC3A 1KFDA 3UNYA 4F3QA 1U0SA 3RBEA 5KFKA 2QV6A 1HNIA 3E3XA 1FE0A 2BJEA 3MDFA 4OJHA 5ETOA 4X4RA 2BA9A 4KV8A 3G6YA 4L6V3 4DV7J 3V2UC 4QW9A 1ZPWX 2MDAA 2P9EA 3RAQA 4Y2KA 1IKYB 2CZVC 2IBKA 4FP9A 3HO1A 3LGMA 4DR7F 2YKAA 1CC8A 3CJ0A 4KFBB 3EGVA 3J81U 2UUBF 4EZ9A 4FVMA 4KR0B 5CH7B 2CQPA 4V19J 4JV5F 3LH2S 4IQXA 3ENVA 4ZN3A 2BDPA 1WG5A 2CJYB 1VS3A 4ZCIA 3H5UA 2COLA 5E3PA 5G0RA 4Y00A 2MKIA 5LMUJ 4OI0A 1GTHA 2NCKL 1U45A 3MFHA 3CB4A 1D0EA 4OI3A 4B3TF 3KNAA 1HBNB 4CWBA 2JHEA 1H74A 2VFUA 1DLOB 1VIXA 2Z0GA 2YQ3A 3RR7A 1F60B 4NLUA 2C2DA 4CDIA 2B8QA 1NM2A 1HBNA 5J1PA 4YR0A 2Y8YA 3SCLE 2D3UA 2MHEA 5IOLA 1MU2A 2CJXB 3PHTA 1UAWA 2BKOA 3QPIA 4LBPA 4WE1A 3R97A 3M8YA 3N79A 4ED8A 1NJYA 2G4BA 2BKNA 3MR7A 3HSDA 2C2MB 3N0VA 4A8OA 1NB2A 1IQZA 1DARA 5J1NA 4F2SA 3PW4A 1R0AA 2LEBA 1RAEB 2EG1A 4OZ1A 3BDPA 1BGXT 3PYEA 5CZVA 1NNDA 3BREA 2BRLA 4OYZA 3TX8A 3KK2A 1VQ5S 1RYSA 5KG3A 4QBUA 3BR9A 5A0YB 4J9KA 1CPZA 3PW0A 1HNZF 3KDOA 5H1SV 3K5LA 1SUQA 3DM2A 5KG7A 1N56A 4DU8A 2KT2A 1HNXF 2GJIA 2W2PP 3UDVA 4F0MA 5HVGA 5L1KA 1NJXA 1RADB 2GIQA 2VDIA 3KLGA 2KG1A 4Q2MA 1F9HA 3Q8UA 1LK7A 3IWXA 4LRCA 5GVQA 3K7RA 2IIHA 3JQJA 2FVCA 3W9HA 3AT1B 3W5XA 4ED3A 1VQ7S 2KTQA 4DCPB 2A6OA 4LF7J 2O01C 2OP5A 1H7WA 2BE9B 5KG6A 3TAQA 2HK3A 4I4BA 4PR6A 4AT1B 5LSOA 1J5EJ 3GFXA 2R2RA 1M1HA 3M2VA 2GO9A 3U02A 3N28A 2J9EA 4RW4A 2VA2A 2JFKA 1WHYA 3CJ5A 3T1YJ 4PG4A 3KYLA 5EWFA 3AJ2A 3UDEA 3J7AN 2ZZMA 2IMWP 3H2VE 1AT1B 2OPSB 4JB8B 4BBYA 1KC8T 2QLJB 4B17A 2K8GA 1MLAA 1H2TZ 1R8BA 1QM9A 2HLUA 5ETNA 4C8KA 3FQLA 1JNZB 2FDNA 3NG8A 5E7OB 1FT8A 1IBKJ 2PEHA 3DLBA 2X3DA 3T9ZA 1VQLS 3VAKA 3ZTOA 4TLRA 4EUVA 1QJHA 1KLMA 1VRUA 1JX4A 2ZC3A 4DL6A 4ANDA 3J7ZT 2K3IA 4LFAF 2KYXA 2YX1A 3QRRA 2OSRA 5IT9U 2N3LA 3W2WA 1RTJB 3VZHA 2VUGA 4DI6A 1BC6A 5EWGA 1N5SA 1KEKA 4F0HA 2E7XA 2HHVA 4I7FA 4RW6A 3QATA 2WAQD 2IM3A 3OT9A 1KQSR 4IRDA 2D69A 5THWA 5D4PA 4MK9A 3IG1B 2L3MA 5KOXA 3G6VA 2YWFA 4DV0J 1H98A 4LR7A 2A6MA 4GO7X 1N6QA 1SVDA 2JEIA 2QRRA 1RAIB 1U0HB 5ETLA 3GJRB 3DMJB 2WVDA 2VJVA 1KNZA 4F4WA 4OZ5A 2E1AA 2XHCA 1N6QB 5MAOA 3MEKA 3GCWP 4B3RF 3DHWC 4J7CA 3RR8A 3V4IB 1IBLF 3C46A 5KFRA 1KHVA 4H54A 4KIAA 4X64J 4KPYA 4C4WA 3AA8A 4FXDA 2W9BA 1GFWB 2HIYA 1PCAA 3RYLA 1RU1A 3MWBA 4WTYA 2VBXA 4OJ3A 2J0SD 4ID5B 4OHXA 2WVEA 4N77A 2ZC4A 4ENOA 1WORA 1VJQA 2GMHA 2F40A 7FD1A 1JLGB 1Q8KA 1HW9A 5B08A 2J6TA 2CQHA 3M2RA 4JI3J 4PQUA 2AWZA 4A8MP 4P2XA 4DPOA 3D6MB 1ZA1B 2OKQA 1RACB 4NLDA 5KG5A 3QRQA 2HQGA 1WTBA 4X66J 3SEOA 2VPZB 2J0QD 3C6UA 4Z7CA 4QU7A 4X84A 3VCDA 3HHDA 3AB4B 2CWKA 3VTIA 2K7KA 3HULA 1Q81T 1B3TA 2AV5A 1NU4A 3QFWA 3QGPA 3CIZA 5IV4A 5HP1A 1D8YA 3AQOA 2CNOB 1YBTA 4DPXA 3FDSA 2F9JA 4HH1A 1K0TA 2ZBQA 3NP5A 3IAM9 2DRBA 3EM1A 4LUBA 3T5JA 1K8AT 2KRBA 5IV3A 1S7IA 1AROP 2N7CA 5LM7E 2XLIA 4OI2A 2GVDA 5F41A 3NNHA 3R7NB 2C22A 2IM2A 1RWMB 3ILIA 4LT6A 3PXGa 4JI3F 5E41A 3LPEA 3MFIA 3OFFA 4KKOB 2MQ8A 2YXLA 3OR1B 2ZVSA 3TAPA 2XC9A 1YTYA 3P45B 4X62F 1VQ6S 3S8SA 1BWEA 1FKOB 3G9CA 1NBEB 2DNLA 2V8DA 2C3UA 1CULB 4N8NA 4X65J 2DH7A 2EK1A 4FF2A 3FMWA 1UEVA 3JTNA 1A6LA 3KHLA 3CD6S 4K2XA 3ZTPA 3CCMS 2VD3A 3B82A 1HKAA 1X5PA 2AQ4A 3DOLA 3OJUA 2UUBJ 2PIIA 4UOHA 4OYAA 3OTOF 3W9IA 2HVDA 1S59A 2IBOA 5M2PA 1VQKS 1AYEA 2V8HA 1H0HB 1NZAA 1V5VA 2HHPA 3DCAA 3TYTA 1OMSA 2VG5B 1OQ3A 2Z4PA 3GPAA 1G1XA 3KLFB 1HPZB 4QQBA 2XLJA 2GA7A 2KT3A 3CO0P 4B3MF 5A2QU 3AODA 1B7YB 3CD7A 3H5SA 4L3NA 2MLZA 2AT1B 2CQIA 2LCWA 4KGVB 3A8EA 1UP1A 2NXNA 3DOLB 2DHXA 3PRVA 2FVQA 3HHLA 1Q16B 1OJ4A 3R5JB 2E29A 2MQNA 3DRRB 3OXLA 1RT3B 2KL8A 4EK2A 4L74A 1GT8A 3PFOA 2IVFB 4A8YA 5E2QA 1P6TA 1YG0A 3B54A 4A8FA 4NLOA 3P4UB 2ZJRQ 1TTHB 2PD1A 4RW9A 1SL0A 4B9NA 3BSAA 3V4MA 3JSMB 3Q22A 2NZ4A 1MG7A 1Y10A 3FUYA 4NMXA 2MHNA 4KPCA 3RBXA 2B9WA 3F44A 2Z8QA 2Y1RI 3FK4A 3UI3A 1Q95G 1T9UA 2DEJA 3I5CA 1FD8A 2FHMA 1HBOA 3OXGA 3DLJA 1UETA 3NGKA 5ETRA 4CM0A 5HQMA 2LKZA 2MQMA 5HVHA 2AMCB 4LFBF 4F4ZA 4YEAA 2RB7A 4J5OA 1U1OA 3D7SB 1FX4A 1Q79A 4K4TA 3B78A 4B3SJ 3DGVA 4OHWA 4CLKA 5GAHU 4HDHA 3LUYA 2ZBPA 4F36A 3D1OA 3BH6B 2WB1D 2QMWA 4Y2IA 3TOQA 1S9GA 4NEZA 2XGQA 2VA3A 4B9LA 1Y7PA 4DLEA 1VHFA 3GG1A 2Y0BB 2FHJA 2BE2B 2UU9F 2HHXA 1QSYA 2BM1A 3OFGA 4ILMA 3KJVB 2FZGB 5AE2A 4ETXA 4X4PA 3OBIA 2V9KA 5B0EA 4X66F 2EK6A 2X1GA 2DNZA 2OPRB 3HD2A 2UUAJ 3M2RB 2KHCA 3R5DA 3CCQS 1RTIB 2BRKA 2CNLB 3PV8A 4U7UD 3DN9A 1U6BA 3DU5A 4MAKA 5ETKA 3DXSX 4HKQA 1HW8A 1HBUB 2VKRA 4L3KA 1PJ7A 3ZTSA 4ZIVA 3AD8C 2DHSA 1UWBB 3NBPB 3QLHA 4A4JA 3HMJG 3SSRA 1KN6A 1LW2B 2ZOGA 3CMAS 2VBWA 3I0RA 2E9RX 5FLXY 1FRXA 3RU0A 3ILOA 1X9SA 2HAIA 3CT9A 4DUZF 1WKKA 3A1YG 4DU7A 4OYMA 2BQUA 1N32J 5J2NB 3Q86A 2QT7A 2YNFB 3J81Y 1BD6A 4J9MA 4Q0BA 3EPGA 1NDKA 1HYSB 4OV6A 1IR1A 1FTCA 2D7SA 4QWCA 4NXNJ 5B0CA 2ZEJA 2WONA 2BKPA 1XBWA 3QZ7A 2Q43A 2XTJP 3M1VA 2CQ3A 4EI2A 4UOCA 4C8YA 3D3BJ 1FVQA 2VKZG 2HFSA 5L46A 2UVUA 1X4BA 5KFOA 4AL6A 3MM7B 1Q7LB 1Q8LA 3PCOB 4R5PA 4CM2A 2HHQA 3UVJB 5F8LA 2DYAA 4U95A 1QSLA 4RU2A 1RTDB 3WHIA 2HLTA 2W9AA 2GHWA 5KFMA 4J9UE 5KG1A 1HYSA 3QIPB 5L38A 4M5GA 3RUBL 3HVAA 1LWFB 1U2FA 2B7BB 2V2ZA 3OTBA 2P2CB 4KGMA 4USJC 4ZHRB 4C48A 4B3SF 4N7TA 2BJ8A 2RMLA 3CEDA 1X5TA 2D3ZA 2Z56B 4M1KA 3BGOP 1SQEA 3D54A 5L1JA 2YWEA 2EFVA 4IKAA 4KHMA 5DGBA 5DO2A 1I51B 2ABYA 1IVZA 1E6YB 1T05A 1JLGA 3GWCA 1HL6A 4P7VA 4QIFA 5C7PA 3DRSB 5K8OA 2F1FA 3GIKA 2K2PA 2ILYA 1RU2A 3C19A 5M2UA 2M8DB 3ZZTA 1AA1B 1R27B 4UUXA 4RR5A 3I55S 4AD6A 5A8KA 2W9CA 4W90B 3AQPA 3MHYA 5KG2A 2V63A 5CD4H 1SKUB 1APSA 3C14A 3OSPA 1TL1B 1KR4A 1RT4B 1U8WA 2JC0A 3NBPA 4CI0B 1S1TA 2AYBA 1H7XA 2ZITA 2YTCA 1U02A 3KUGA 4OLOA 1LK5A 4N8OA 5T7LB 2PMZD 2GVZA 4RU9A 1TL7A 5J2MA 1IR0A 2M4MA 3DMJA 4DPUA 4XPEA 2KU7A 3V6DA 5HO4A 2FY1A 4KAIA 1F5AA 1VYAA 2PA8D 3HHEA 3A3OB 1FESA 2HFNA 2BQ3A 4IRKA 3RZAA 4C8NA 4ECRA 3QSIA 3ZXWA 4DR3J 2MKJA 1Y3KA 2IJRA 2MYFA 2H5JB 4RW7A 4RNOA 2V4RA 3Q23A 2EKNA 3KG4A 4USTA 1UFLA 3G4SS 4MIBA 2EFQA 4DV2J 4DL0C 4NASA 2CYYA 3G71S 3GYNA 4A8QA 2ERRA 2HS4A 1YJ9S 4QYZK 4DV5J 1LQ9A 3HT0A 3VGSA 3KK1A 1XC9A 3NOCA 1VQ9S 3T41A 1W25A 1BE4A 2A10A 3GJSB 2FHOB 4TY9A 4DV5F 4O23A 2ZVIA 4KV8B 3C16B 2ZNZA 3L7PA 4LF4J 4ILLA 2D9PA 3H98A 5CYMA 4R25A 3BV8A 3KLEB 2HFOA 2YX7A 1EKSA 2R7WA 3BQ2A 3LWLA 3JYTA 4LRAA 3S7RA 3QLHB 2HG4A 4LVNP 1JIHA 2ASYA 2QIFA 3F73A 2QO3A 1YJWS 2CPFA 2M52A 4ANEA 1C4CA 4H4OA 1GMUA 5F8JA 4GKKJ 4WZMA 1OSDA 1ZAWA 4WP8A 5KFWA 1VQYA 4DL5A 1EARA 5K5MA 1HWIA 4DFJA 4B9MA 2PMWA 1J5OA 1FJGF 1ITPA 3UDLA 2WTFA 1N5YB 1VMBA 2K06A 1RTHA 1N52B 2NXCA 3VVTA 2I6WA 4PG7A 5MLCV 3CCSS 3T1YF 3EE3A 1HNIB 2NLWA 2UVVA 3K58A 4Q5VA 2DGQA 1WUUA 2L41A 4DSLA 1PAUB 2CQ1A 3QAEA 1NKEA 3DOMA 2E1RA 1VFJA 3NXZA 1RT7A 4RBTA 4ZDNA 4LF5F 2HNDB 2AHOB 5C25A 2E1MC 4BHQA 9ATCB 2RUGA 4FF1A 3OD2A 4ELUA 4MT1A 3NKYA 3SCIE 1R31A 2PMHA 2RKIB 4DR2J 2ACYA 1TKXB 1QDUB 1SB6A 2YNGA 3D3CJ 3PYDA 3KHGA 4K4UA 3MEDB 1IR2A 3NWRA 2I38A 3OFHA 1MMNA 4I2QA 4O4GA 4CTAA 5IQ6A 5KT7A 3KK2B 1RAOA 4NLXA 1TL7B 4P6QA 3D6HB 4CH0S 2RDIA 1RYRA 4ICLB 3AFGA 1FVSA 1T94A 3AJ1A 4MK7A 5F3ZA 3G6XA 5A8RA 3QT6A 4MFBA 3T5HA 1LXJA 1Q5YA 2M88A 4G1IA 3ELHA 2ZKUA 4ZHRA 4O3SA 5KOWA 4CIOA 1ZA2B 4ZCMA 5L39A 1AZSA 2ALYB 4ZVUB 2DR8A 4ZPCA 4RBVA 3MECB 2ZJPQ 1WF0A 3GIRA 4I1TA 2OPPA 2RJZA 5IFMA 3O5TB 5LXRA 4M5LA 2KVIA 4ZLJA 4YHHF 2DCLA 4OL8A 5E0OA 4H4OB 4JI1J 1G7CB 3K8WA 4I6AA 3J7YI 3BN7A 2HNZB 3TUIC 2W8LA 4K7QA 2PI4A 1UVIA 4KRWA 5KT6A 2P5VA 1EX8A 2YKMA 3BEGB 2CPZA 3M6WA 5IC4B 4C0BA 1QD1A 2MB0B 1RT5B 1ZM9A 1CVJA 1UCNA 2BUNA 3BGRB 3DRPA 4OZJA 5LL6d 3ZZPA 1N5TA 3PYFA 4NMLA 3ZZOA 5JUMA 5T14A 1ROFA 1SI9A 2BOPA 3ZZUA 5F9LA 1OS5A 4FF4A 4B3TJ 1AXQA 1IWAA 2FD2A 4U9RA 4ED5A 2PFFB 3LTOA 1QAXA 1NH7A 4GVBB 3UD4P 1DQ9A 2RHQB 3OL8A 4P72A 4C3MA 3J7A1 4C8OA 1U1LA 1SPBP 3T9NA 1WI8A 3GJQB 2R7XA 5DS7A 1RABB 3FC9A 3FEYB 3GCXP 4RLEA 1JWWA 3P5BP 4EU0A 3MUVP 2OEMA 4P7TA 3EJMA 2DIVA 4R0JA 5D6GA 3CMQA 1FE4A 1HHTP 1CBKA 4DR7J 4ATNA 2MLXA 1WKLA 1GXUA 2WW8A 2Y9HA 4JI5F 3BO2A 2DNRA 5FDLB 1ZPVA 5KFUA 1IUJA 2HVZA 2VF3A 4MJKA 7FDRA 4F25A 4L76A 4B9UA 4P2FA 4J9VA 3SZ2A 2XY7A 2W9BB 2EPIA 4X4NA 1DQ8A 3I5BA 1RKJA 4CRJA 4NCAA 3TZXA 4K5SA 4RUAA 2E5LJ 1UPMB 4RWWA 3QFHA 1Q53A 2BXJA 2RUSA 3QT5A 4DDFA 4C11B 1B0TA 3E01A 1P9QC 4WFAQ 5H9EK 2RSQA 4CO2A 5BXIA 3G86A 2LQ8A 2ADBA 4GRSA 1NB7A 1P1LA 3MMAA 4RUHA 2XWYA 1DHMA 1RWUA 3M05A 3KK3A 3H0PA 2HRUA 3HJVA 3W8PA 1SQFA 1FCAA 3IN5A 4CT9A 3QRPA 5D4OA 4ZPWR 1UWBA 2RIJA 1TAQA 3SV3A 4USIA 2QMUB 2F4VJ 1TKZA 2QSFA 4FNHA 4NLYA 3RAMA 4UTGA 3VWSA 3QWUA 4AFFA 2F8HA 1IKXB 1F3FA 3GFZA 5HN0A 3RRGA 5M2RA 1N88A 4DUTA 3H20A 3DRYA 2GMJA 2ADCA 1LWCB 5F0UA 4FBUA 3T6BA 3TQ1A 1FDNA 4W4MA 2GGPB 4LQ3A 2G2YA 2VG6A 4RX6A 2H51B 3BH7B 3OV7A 3CJKB 4GKJF 4DV6F 3LQVA 1DAXA 1FNOA 3TVKA 4LQ9A 3Q8PB 1NKBA 1N33J 1RT3A 4J9LA 1AUSL 4BC7A 2VQFF 1RLCL 3CC2S 2DH9A 4ZVPB 2AJQA 4QW8A 4YB7A 3THPA 1PG5B 1WG1A 1XR6A 1LW0A 1PKUA 2IFXA 4E98A 4M5IA 1X4DA 3FVYA 1JJCB 2RQMA 2XMAA 1E6VA 1SQGA 2AJFE 2U2FA 1BQNA 5DZ6A 5KFPA 4X4QA 4WYLA 3CPWR 3NNAA 3Q2SC 3OHBA 1WNEA 1QUVA 2MXYA 3TANA 1YGYA 2DGXA 3M8QA 3ITHA 2BABA 4FVCA 4C2MA 2A3JA 3J80U 3OHAA 2W4DA 2AGPA 1RHQB 2DRAA 1RTZA 1L3TA 2CA9A 4M94A 2V0NA 1HMVB 3OR2B 2QA1A 3CJ3A 4ZVTB 2G2OA 4FPIA 1KTVA 2BW7A 2H9ZA 2IRUA 3TVYA 3W61A 3OTOJ 3OL9A 4DL2A 1S12A 4TYAA 1HQ2A 2NYIA 3HHLC 1RBOB 2Z2MA 4DQIA 1S9GB 1XMOJ 1VI7A 2ZWOA 2JC1A 4LJMA 3P3DA 4HLBA 1L3UA 1HI1A 3N9UC 4H4KA 3I56S 1YQHA 2Q79A 2ZE2B 1L5UA 1PYTA 4DUZJ 2ZZNA 1FFWB 5EGYA 2DKOB 3H59A 5F8HA 4DR2F 4X4UA 1PIEA 2RD5C 2GW8A 1YVFA 2HZVA 2ZUGA 4HACA 4ZS6A 1VISA 1P1TA 3BSCA 2IC3A 1FKPA 2YNHA 3NEKA 4DFMA 4CCHA 4ECYA 5KFYA 5J2QB 2BR0A 5EHHA 1Q7YT 3Q83A 5HMZA 2ZM6F 2VU5A 2WW4A 5KFXA 3I31A 4HACB 5ETVA 1F3VA 1URRA 5F3TA 3UO0A 3GIJA 1HARA 4DX7A 1KTQA 2C2RA 2IYGA 2W25A 3GZ7A 4FYVB 4DMZA 3JSMA 2LQ5A 1JB0C 2ZFHA 4DR6J 1O5JA 3C66A 4DR4J 2EFGA 6AT1B 1FO1A 4J37A 2HW3A 4DV2F 1WC1A 5AJ3J 5AJ3F 1TKTA 4KC5A 2YWWA 3CJKA 2ZH5A 4KGXB 4KO0B 3OQ2A 2XYHB 2JLFA 5GMEA 4HI2A 3K59A 1U24A 2B5JA 3NLCA 4ZPTR 1YBAA 3DDNA 1XNRF 2M3DA 4X4SA 1FWLA 1P9YA 5LSRA 3PHEA 4ES2A 1KVIA 5KFDA 3ZNJ1 3MXHP 2R8IA 4LFBJ 4DR4F 3JQMA 3VGUA 2CXEA 4F2RA 2B56A 2DNPA 3JAMY 1HWJA 4Z37A 4ZLNA 3VAJA 2AX0A 2WZ1A 2BANA 5SZTA 2DGTA 4NYZA 3W5YA 4ZITA 3V6HA 2H4YB 1CQNA 2DR7A 4WKRA 2R7QA 1GH8A 2JSXA 3R9LA 1RJJA 1W26A 4IH7A 1NK9A 3QO9B 1U1RA 1X4CA 4AQYF 1HMVA 1RHKB 2E7WA 4ES3A 2HPUA 1Z4UA 2P9CA 2Z30B 4KQZA 3S01A 3SCKE 3U1MA 5IZHA 3AA9A 2RILA 3T1HJ 2FLNA 1CSJA 1JQGA 2MEWA 2V94A 2PT0A 2ROPA 3D0IE 1EP4B 3I96A 4Y6IA 4ZVRB 1XWLA 5F9NA 3HHLB 4ZVGA 5IM0B 2B9EA 3M32B 4KB7A 5LT5A 4JI5J 4C9DA 4MK8A 4KHRA 1FF2A 1ZM2A 2B4PA 4RO0A 2E1PA 4PYAA 4EO6A 3MUMP 3T3FA 1WHWA 2B51A 2WSEC 2Z2YB 2DJWA 3TUJC 3N6LA 1U6FA 1U7LA 2XGPA 3HPOA 1ZTTA 5T7LA 5HQLA 2Y1JA 1N54B 1IKXA 2DRDA 2CPHA 2OGUA 5CYQA 2GHPA 2HRTA 3FCWA 1FI4A 1AFIA 4JI2J 1R3NA 4S0MA 2D9OA 3U7JA 3G8TA 1NK5A 1RGVA 2PE8A 4URSA 2CVEA 2R7TA 1I3OB 1FJCA 2K1RB 2PDAA 2B7CB 2VHGA 3SDEA 2LA6A 4NOHA 3I5AA 2JX2A 2PFDA 3BYPA 4Q7AA 3OVSA 2VICA 4FF3A 1ZTWA 4JI4F 2GC8A 2R3VA 3CJ2A 5IC6B 2CFXA 3C6UB 3I4PA 3IR7B 2OMLA 1LW2A 4USVA 3VQSA 1S0MA 4ZA1A 3BO4A 4K5RA 5KFIA 4DR6F 3D6FB 1BY9A 3TA2A 3TA0A 2QG9B 5HSPA 4X65F 3TX0A 4F4KA 1ULRA 3HI9A 1S1TB 3R7BB 4I64A 3G96A 3QBCA 4V19X 2VOOA 2ZDPA 2VV5A 3CSKA 3MPDA 1PJ5A 3HFZB 4ZP9A 2NYHA 4ELVA 1D3WA 2W9CB 2J7UA 2P8IA 1FK9A 2B0GA 2O66A 5KG4A 4ZLPA 2QFIA 3EDRB 1W2IA 3IA0A 4AXIA 4EYHB 1LWFA 3J81j 4NX9A 2KKHA 4OYIA 1JJ4A 4X2BA 2J8AA 1JLEA 3HVWA 1KP6A 3M1VB 4UZCA 5HI7A 4ETZA 3KLHB 4AUKA 3MM5B 5GAEU 1KFSA 4WCEQ 1YRXA 4O3OA 3THTA 2DHAA 2OFGX 4PYDA 1XJWB 2HBRB 3W5ZA 1VQMS 4QJVA 2EFPA 2JOQA 2J6UA 3QGGA 3T19A 1WELA 1RWNB 3CJRA 3Q89A 4IFVB 2FLOA 2RF2B 4NPOA 5AT1B 3GMGA 4C98A 4OX9F 4DFKA 3PO5A 1FK9B 4DQPA 3LALA 2M2BA 1RB0A 4KTQA 1UMJA 3I32A 5KFGA 4RKUC 1VQSA 5A8WA 1R7IA 2OTLS 1QY7A 1TZ0A 3DLKB 1JLBA 3OTDA 3QJJA 1K1QA 3DRPB 2KT5A 3DOKB 5AE3A 4ZIWA 2MQQA 2IMOA 3CCRS 1WOSA 1NMEB 4Q45A 2UUAF 3TEHB 3KNGA 2HGLA 2DHGA 2VFTA 5HMWA 3ICLA 4NA3A 5D0GA 8ATCB 4A8KA 4KSEB 3AXMA 3BKFA 4PG8A 2AF6A 3H5YA 3RB4A 1JJ2R 1DZ5A 3CC4S 4G1PA 1F9FA 1K47A 2MZRA 2W24A 3CNQP 4HDGA 4ECWA 5DLFA 2XZTB 2FJXA 3L95X 4KH1B 2MKCA 2NZCA 2E44A 2OPRA 3LOUA 5IT4A 2Q1LA 5DDRC 3DU6A 2W7OA 2B3TB 4O3QA 1N5YA 4ELTA 2OIHA 5K14B 4HEA9 2G1DA 4ZMMA 4N76A 3MAAB 4IG3A 2ZH9A 1OIAA 2HSEB 3WC2A 1HBUA 3P6YC 3FCHA 3RBDA 2QYGA 2HHTA 2CDRB 2UUCJ 3P96A 3MF5A 1GNKA 3NGTA 3MECA 4I68A 4IYQA 2IJFA 5GAHI 3NGRA 4OFZA 1T9TA 4O44A 2VIHA 4EWTA 4F50A 1SCJB 2CPDA 2KHDA 1V5IB 3N4WA 4RW8B 1NSQA 4AQYJ 1F5BA 1RT2B 2HGMA 5G0RB 1ACMB 2CQCA 4FN5A 4CO5A 3JAMU 4NZ7A 4CLLA 2WRMA 3D0HE 6FD1A 5FLXU 3PW2A 1QSSA 2YWHA 5B0FA 2BE2A 1BQXA 4U67Q 1KQGB 4BLGA 1DQAA 3B4MA 4P75A 1NLKL 1T3OA 3TEGA 4IG0A 3BS9A 2VDHA 1S49A 3FQKA 3DDIA 4PXBA 2VFRA 3NS6A 1VIOA 2G9OA 1KQKA 3AAWB 3MEGB 3CDAA 1I5OB 2X1AA 2W1BA 3W65A 4ERDA 1HWKA 5KT4A 1B7FA 1G6BA 4AYBD 1JLEB 1MU2B 3O1LA 3DYAB 3KLHA 4TVAB 2DY1A 3RRKA 4P52A 3C6TB 1NJZA 4CNZA 5C5JA 2AKWB 1FERA 4XIUA 1G4CA 1OWXA 2O3DA 3BN4A 3DKDA 5IXUA 4CLZA 3MR5A 4ICLA 1C0TB 1YRTA 1HWLA 4LIRA 3SQOP 1RWVB 3ZZRA 3HP6A 3NWGA 1GMVA 2QJ3A 3E51A 2C1EB 3D66A 4RW4B 4YFUA 4IR1A 1DURA 2GVZB 2LDIA 4TKTA 5J2MB 1SC4B 1TR0A 2UXCF 1J5OB 2B43A 3IR5B 4KJIA 2MJUA 5JMNA 4DQSA 5AXKA 4GO5X 2HNDA 2U1AA 4Y2CA 2OLWA 4HVZA 4USWA 5C25B 4N5SA 3MEEA 2KDOA 3PR4A 3HT3A 2DB1A 5K20B 3MR6A 3BGFA 4CP5A 5BYSA 2I2YA 4N41A 2CJKA 3MUTP 3UCZP 1C0TA 5BYQA 1ZETA 2I1RA 1IM4A 2BW2A 3EVOA 2FB0A 2HKEA 1RTHB 3A4TA 4ZJLA 4DQRA 2HFZA 3OLBA 1U1KA 1S6PA 3CGIA 2DR6A 3UN5A 3NMRA 2W4CA 1HNXJ 3CTRA 3IWNC 4B3MJ 2ATCB 4MKAA 4NL5A 4UOFA 3M9OB 4CQ1A 2UXDF 4CYUA 2XZWA 2A1BA 2BX6A 2JLEA 3JSBA 1N36J 2ASLA 2CWXA 3IC1A 4ECZA 3K17A 5E3RA 5SUHA 2VODA 2QLFB 3C8YA 1KS2A 2EWHA 2RS8A 3MCNA 5C2GA 5HLFB 4X4TA 3MMBB 1U8SA 2YKNB 2EKYA 1RKIA 4F7VA 3D28A 3OSNA 2MMYA 2AEFA 1QAIA 3SSSA 1IKWA 1OY9A 5CYMB 4JI8J 2DISA 2BBEA 3IWLA 2L08A 3CDWA 1JLQA 3IGVA 5K9FA 1WF2A 1GX5A 3LO3A 3AOBA 3K0JA 2F65A 2OH2A 3D0GE 1X4GA 2ZUAA 1HNVA 4IG0B 2XZDB 4YDDB 4LIWA 1NRKA 1YDLA 2GAHC 2ZH3A 5ETQA 1Q86T 2R42A 3LP0B 4USMA 1CJTB 1O6XA 2Y1LB 4QYZJ 3OTEA 3TW0A 4YS2A 1T7PA 2JEGA 1JLFA 4PXCA 4URQU 5DGAA 4O4RA 4M95A 2XS5A 4F4YA 4PQAA 2XLKA 5FJ4A 5AXLA 4LRDA 4TLQA 1VLYA 2D41A 2MGZA 5KFAA 2VQEJ 2HBQB 4B08A 2D3O1 1TL3B 4URGA 1JXVA 4QU6A 1IBMF 2RT3A 4QPTA 3B4DA 4OYWA 4LFCF 2C2KB 2E1CA 1NEEA 2CNKB 3C3LA 1UEKA 2G0IA 2LEPA 4ZN1A 3MAAA 4IG3B 3W63A 1OYDA 2XYPB 3PYGA 4DCOB 1KRPA 4NI2A 3TJ8A 3MEEB 5LJ5Y 4ZCKA 4LSLB 5ITHA 1IKVA 2Q6BA 1DFDA 3C14B 1S99A 1CLFA 1NSPA 4XPCA 1SH0A 3IBWA 1NJWA 1TU0B 1FDAA 3BDEA 5F8GA 1RWKB 1YX2A 2DITA 1B0VA 2HS3A 5E3AA 2QEXS 1Y11A 4IR9A 4DPWA 3O3LA 1SJ4P 1YRUA 1T9VA 1JK9B 3L3CA 2OTJS 3AOAA 2R7VA 1XK8A 4LF6J 3M6XA 2N7YA 3C15A 5GAEI 2OPPB 4JP8A 4L73A 5DQHA 4A46A 1R89A 1FX2A 3LPYA 1S0VA 1FJEB 1CJKB 3PNIA 3PZPA 2J5AA 2NPIA 1K44A 2C3PA 2PGCA 4M5DA 4WFNQ 4FS2A 2IA6A 1N33F 4HT7A 4DZ6A 2QSWA 4LSLA 4AE5A 5ETPA 5L9NA 2GZOA 3N6MA 2W2MP 4PXDA 2CPXA 2RS2A 1U2CA 5AXNA 4ZCLA 4WP3A 3WBZA 2OSQA 1Y3JA 2QYCA 2ROGA 3ZZZA 2NR0A 3MPYA 3MR3A 4BWJA 1U09A 4ITSA 2EC0A 4JYAJ 2IM1A 4IDKB 4DS4A 5KFBA 4DUYJ 1FNXH 2UUCF 1MWYA 2BJDA 4GC7A 5HQ8A 1TUWA 1Q1KA 1TV6A 1ZOTA 1EIYB 1X7VA 4NLVA 1J5EF 4PWDB 6FDRA 4ED4A 2HHWA 3QNWB 1RZMA 3LP0A 4Z7YA 1RBAA 1FKAF 3FRYA 2FZCB 2HNYB 8RUCA 2XY6A 2GAGC 5HBMB 4CH7A 3CCWA 2LYVA 4CO3A 4G65A 5CD4A 3W62A 1D9DA 1JKHA 4O3RA 1IKVB 2FVPA 4CZCA 4ZPBA 4USUA 2BJ1A 3VR1A 1R43A 1RHRB 1R0BG 1LNQA 4JI2F 4FYXB 2YQ0A 1H6KX 2JH3A 2GHVC 1JKHB 1F6TA 2M7SA 3PRDA 4OX7A 3TZYA 3FSIA 3EVMA 3RBZA 4DQQA 1XR5A 1AFJA 1GMWD 5KTQA 4RNNA 1TFYA 1PYSB 4NRTA 1S79A 3PJWA 2C2OB 3O6QA 4H4KC 4MTPA 3MEDA 1KOHA 4DF4A 1LV5A 3M32A 4MYTA 2V9WA 4C8MA 1N8RT 1X60A 3O2IA 4Q44A 3BZQA 3PDNA 4P71A 1TMMA 2DNQA 2EG2A 3N5FA 5J1EA 3A12A 4ZLLA 3HF5A 3DFEA 3MURP 1RISA 4DL3A 4JI7F 1N0UA 5CYQB 4I56A 3NRBA 1FNMA 3OUYA 1NDLA 3LA0A 5I3PA 3DLLQ 4DR1F 1RSCA 3DGPA 4NRUA 3NGSA 2QFJA 1T3NA 4NXMJ 2OPSA 2D3OR 3EVWA 1TL5A 2M9KA 2ZHOA 3KMQA 1RAHB 1XMBA 2FPHX 1VBXA 3I9ZA 4IOBA 4WFXA 1M90T 3E2EA 5A76A 1VQ8S 2I0XA 1TELA 2HWTA 2OO4A 3JS9A 2H65B 4IH6A 2GQ2A 3QIDA 5CYJA 1ZYQA 4LFAJ 4NCGA 3U1LA 2E5JA 2YKMB 3CW2C 5E5NA 3BGLA 4O0IA 4Q8EA 4QR0A 4QZVB 4ED0A 5I42A 2ZD1B 5I3UB 4MKYA 2J9DE 4PCQA 1RE1B 5ETMA 3NS7B 2AEJA 3RB0A 1X4HA 1UA1A 5KFEA 1HQEB 3NOGA 3KG0A 2Q3PA 2IAJA 4M8LA 4NYPA 3FGVA 4YQWA 2WOMB 3SQGA 1T03B 5F8MA 4OZ3A 5JVGQ 1B99A 2LXFA 2NSCA 2RQKA 2WSFC 2F9DA 1WHXA 2X51A 3CJTA 3DI6A 2I5JA 3NCQA 4OJGA 4CLYA 4UW2A 4NLGA 4DSFA 2VFSA 5BR8J 1KSPA 3GV8B 2VPYB 4XK8C 4K0KJ 1R6VA 2AEMA 1HI8A 4YOEA 3Q8VA 4FXWA 3GFHA 3GR1A 3IGNA 2B5JB 1MROA 2L9DA 1RAFB 2O1PA 1RT6B 2QL7B 1RT7B 2KVQE 3MM9A 3UFCX 3SMZA 4TU9A 2OFHX 4DPYA 3OW2R 4ECVA 4I2PA 1O8BA 1UJ5A 3K57A 1SJFA 4PUOA 1MN7A 1X4EA 2E7VA 3M8ZA 5U47A 4EGLA 4TQSA 2C2NA 2RKIA 3BBFA 2GJ2A 1KQFB 3RW7A 3NL0A 3GSIA 1NUEA 2E5LF 1RT1B 3KG1A 5GMDA 4I2PB 5EWEA 2F3JA 4AXJA 5KG0A 2M70A 4DV4F 4P10A 4IOCQ 1WEXA 1YZ7A 2IDEA 2ASDA 3EXCX 1IKYA 4LRBA 1REVA 4QIWD 4ZP7A 4UY8T 4OYBA 2GJFA 4TXSA 2IC3B 4C3LA 5E33A 4DPTA 1S9FA 1X4FA 2YH0A 1GQEA 2FLLA 3CCLS 2CUYA 3BGUA 4JI8F 3S6EA 5DDQC 1FJGJ 2FHKA 1SV5A 1N48A 2M0GB 3Q24A 4EZ6A 3QJPA 1LWEA 2KRRA 2E9TA 1VGYA 4CT8A 5J2PA 2C28A 3R6LB 2DNGA 1FKPB 2YNHB 4F3MA 1S72S 4IRCA 2DEIA 1IM6A 2AJ4A 1NSKL 1ZM4A 2MQLA 5LMNJ 4MH8A 2DPJA 3HXMA 4NCGB 3BKUA 2V34A 3POTB 4WKYA 1JXLA 3A8KA 3OR2A 5HP1B 2YKOA 1RBLA 1Q78A 1IWGA 2I5JB 5H9FJ 1TL4A 2WVFA 2YWGA 3FRZA 4W92B 2QN6B 2J9DA 2HRYA 1PO6A 1D9FA 2G1HA 1FRIA 5FIIA 3H5XA 2RQ4A 4B9SA 3N01A 3J7Z5 3M6VA 1U1PA 1HQUB 1ICEB 3LWMA 2UU9J 2YVSA 3FBEA 4DUYF 1X0FA 3RB3A 2GCFA 3OFEA 5HK4A 1RHMB 1T03A 1RTDA 1KLMB 1VRUB 1MSWD 2RRAA 2EBGA 3LAKA 2KFZA 2ZH4A 2YH1A 3I82A 3QWPA 4I69A 4KGKA 4QIVA 4ZJOA 2F4VF 4JI0F 4WFBQ 3VV2B 1D09B 2LDYA 1JMTA 2CADA 3QSYB 2V8GA 3ZZYA 5KFZA 3OR1A 2IJNA 4MMOA 2DNNA 1LW0B 4WJBA 1Q82T 4J91A 1BQMB 4LSNB 3J7YU 3UQSA 1CEZA 2ACMA 3ZTQA 1SJ3P 2JEJA 3H42A 1YBUA 1IJEB 5LXYA 1NDCA 1R8HA 2HURA 3CJ8A 4DN0A 1H2UX 1LEOA 1SIWB 1Y9OA 3GIIA 1RHJB 3BQ0A 1SJ1A 1QE1A 4Y0FA 1VBKA 1M5SA 1FRHA 1S6QA 1HHQA 5AE1A 3KJNB 5IWAJ 2IDLA 3AXKA 3CIMA 4A8XA 5RUBA 1TAUA 2K1RA 1QE1B 1PBAA 1WKJA 3EWGA 4E8UA 4HYKA 2W2QP 2UXCJ 2ZOMA 1JLFB 4ILRA 3A8IA 4ED7A 3W8GA 3BF4A 3HFKA 3G8SA 4OIXA 2AJ1A 4IFYB 1DY3A 2OD6A 1Y5NB 3KFWX 2DBBA 2R8JA 1NZ8A 3MGJA 2CQ0A 2OD4A 4IDKA 4DEZA 1I94F 1FRLA 2XNQA 1TKDA 3POTA 4DR5J 2R8KA 5IS2A 3GV5B 3K5OA 1WTFA 2L9WA 3M8PB 3PKMA 1GTEA 2MSTA 3ENQA 3JTOA 2CZ4A 1EHWA 2CG8A 4DOZA 5JJBA 4ED1A 1YJUA 5G4DA 3UNGC 2VONA 5E3QA 4B02A 4I7FB 1RDRA 4RW6B 3KMSA 1L3VA 2F63A 1VC0A 3MMBA 3UR3C 2XYGB 4FKYA 4WE1B 3TUZC 3FFIA 3SYZA 5HVFA 3EMTA 1OSCA 1NK7A 3HZGA 1WDTA 2BJ9A 3MM7A 1Q5VA 2QLBB 4HHJA 1X9MA 2DVIA 2J9CA 1RWOB 2DGWA 4LF1A 4WIQA 5CABA 2KB2A 4DSKA 1EETB 1OQ6A 2CRLA 4WWSA 3QZ8A 1SL2A 4CTAB 1VBZA 5CXTA 2WONB 1S6PB 3DHXA 3MCSA 5D4LA 2E66A 4XDCA 4RUBA 4DR3F 4Q0BB 4NLWA 4WU2A 1ZAXA 3PW5A 1GAOA 2AJ0A 3ILLA 1EETA 2CJQA 5L8RC 2N82B 4C97A 3BPDA 5HMXA 4DV7F 3HHLD 3W66A 1XNRJ 2NSBA 5LMNF 1UZDA 1XTZA 5B7WA 4OV1A 4FKXA 4I2QB 5IM0A 3KOAA 3PIPQ 3O8WA 5B09A 1S10A 1TL3A 1YK9A 1XMOF 3AHPA 3TA1A 2YX4A 1HLWA 5KFVA 4EFAC 1H73A 1L3SA 5LSLA 3X1LB 3GYXB 2R8GA 3GJTB 1L3KA 2HNZA 4A8WA 2HVHA 1D9AA 2R2TA 3PTWA 3MMJA 3VGVA 4LFCJ 3LP1B 4C0HA 5J2QA 1FEHA 2YKNA 3IMQJ 2MY7A 1FRJA 1HNVB 2JNJA 1RCXB 5B0GA 2IYIA 4USHA 3PFEA 2OJ3A 4FS1A 3CJ4A 3V81A 1YKWA 3H40A 3ISNC 1S9EB 2NREA 1KD1T 1DTQA 4PWWA 2KM8B 4DX5A 4WU3A 4YB1P 2BE7D 3D5MA 4LREA 3HM9A 3GYGA 2FC8A 3X3UA 2MJNA 1XMQF 1HR0J 4A48A 3NGDA 1T8EA 2Z58B 4JOUA 4KO0A 4ECTA 1QUPA 2V67A 3HDSA 3M7VA 2JL9A 1NCLA 3IS9A 4M5MA 2LU2A 4GVBA 1YWXA 2IPOB 3IBFB 4KE5A 2V69A 2YKPA 1EB0A 2GQQA 4I67A 1S9EA 1KOOA 2CJ9A 4QOTA 1RXOB 1CC7A 2EW9A 3UE2A 2GO8A 1DBDA 1TUVA 3GILA 1X5OA 3TP2A 3U1NA 2YWKA 5LOQA 1PGZA 4NCBA 3PVXA 1BQNB 1HBOB 3QQCD 3D1QA 1LFWA 1Q8IA 2Z57B 2B4VA 3NAHA 1WC6A 3V5RA 2X1FA 5DQIA 2RU3A 2EXUA 4LF7F 1CJUA 5CA5A 2X3GA 2OHDA 3H7HB 3C6TA 3UN3A 3KLVA 4L72B 4DX8H 1H2VZ 4UQGA 1UW4A 3EDQB 2JVOA 5E3CA 2XI3A 3SFUA 2ZD1A 3M8RA 4QYRA 5I3UA 2Z2ZA 3TUPA 4ECQA 2PA3A 4NA2A 2UXBF 4DR1J 1NHUA 4KBIA 3HSJA 4CO0A 4C8ZA 1DLOA 1HHSA 1UZHA 3KLEA 4ALZA 3M2UB 4FBTA 3HLUA 3DRSA 2HIQA 5A8WB 2EI5A 2XO6A 1VQOS 3SI8A 5EUHA 2POKA 1RUSA 3WDOA 1Z2LA 4PXEA 1TFWA 1ZZNA 3OXFA 3HSZA 4HT5A 2VFVA 1NH8A 4ID5A 2W01A 2CQBA 2LU1A 3IS9B 1GXLA 4F0KA 5IWAF 4PPZA 3BPSP 3DOMB 5GADU 3K5PA 5EDWA 1RA7A 1RHUB 1S76D 2W2NP 3NY0A 3RAXA 1OY8A 2MQOA 3KLIB 2GV1A 4RJVA 1FXDA 1FRKA 2RRNA 4WP9A 4JV0A 3CXCR 2HHHF 1ZBTA 5DZ7A 3BYRA 4YB5A 2R4FA 3KXDA 3SXLA 3GE9A 2LQ9A 1UA0A 1URNA 2UUTA 3UN2A 1QVFR 3TARA 1XR7A 3L7OA 3D2WA 4DJBA 4K4VA 4GVLA 4OI4A 1C1CB 2EEYA 2PEBA 3G82A 4HL9A 5DM6Q 1UEUA 4N47A 5LMUF 3N6NA 1RT2A 3MEGA 4PPDA 3CUNA 3LP2A 3VALA 3DLEB 1FRMA 5HMYA 3BQ1A 3PRBA 2XHWA 3CD5A 1JXEA 3E8OA 3MCOA 4LF9F 1GMWA 2GX8A 3C16A 3UD3P 1IQTA 2XB2D 1KVJA 1VC5A 1S1VA 1K9MT 1LWCA 2KXNB 4FPRA 2DO0A 4LBHA 2H1YA 1S6UA 3FCVA 4TN2A 4C11A 3BJYA 2H5IB 2BACA 5KFQA 4K50A 1C4AA 2MY8A 1VRTA 4RNMA 3DOKA 2BMBA 2MKKA 4JV1A 2C3OA 1WJ9A 3FNNA 3RGIA 1C1CA 1LKZA 3G82B 5HBMA 4ECXA 1U1MA 1HR0F 4DF8A 5KFJA 3ENWA 4DL7A 1EQMA 5F0WA 2DNYA 1HNWF 1WWHA 1WC0A 2VB6A 3EICA 2XEXA 1FD2A 3BSNA 1FHTA 4WFZA 1E6VB 2CAJA 2MPUA 1VQ4S 1U4BA 5L1IA 3UD5A 2DH8A 4YR2A 3PJ9A 4ID8A 2E9ZA 3H4DA 3K5MA 3W64A 2IVMA 2C3MA 4YUDA 1U0HA 3DNCA 2ATLA 4CLSA 3CULA 1V9OA 1OO0B 2UUWA 2XWXA 1FDBA 2F8MA 5GMKa 1K1SA 1MW7A 3K8VA 5GAGI 4RL1A 1YLXA 4WBFA 5FD1A 2VG6B 3D67A 3BSOA 3V6JA 2VPWB 2ZBIA 4XAKA 1HWUA 2KO1A 2VASA 4LSNA 5K8PA 4Y65A 3T1HF 3DXBA 3ENAA 4DZDA 1C1BA 4GC6A 4OHZA 3T5KA 3M9MB 3THVA 4Y2AA 2A2DA 3FZ2A 1PC5A 1GK8A 3W9JA 1R8CA 4R8UB 2HQIA 3PG9A 5J1EB 3EYZA 3MR2A 4JI7J 3MI7X 3CCTA 5DDPC 4X62J 2CQ2A 4ZKAA 2MZ1A 2CPYA 2FTRA 1R0CB 1IBCB 1XQIA 1NHKL 4WTOB 2RDDA 2V2VA 3W2WB 4BWMA 4CLUA 2EFNA 2HVEA 2VC0A 2DGSA 3KHHA 2RQCA 4ZVEA 2O67A 1QLNA 4DV6J 1T02A 2QLWA 4LRFA 3OJSA 3MM5A 1HNZJ 4LF6F 1XNQF 4GKJJ 4TNOA 1DTTA 3LGHA 2XMMA 2LA4A 4F02A 3EPIA 2HK2A 3JQKA 2AGOA 1TK8A 1IKWB 4QCLA 2M5YA 4G1QA 2XMUA 1SKRA 1VBYA 4LF9J 2VL1A 5K8MA 2ZHBA 2AD9A 1IJFB 2R9LA 1OY6A 3OTCA 4HHUA 3CF5Q 3GB0A 1SC6A 2HNYA 1FXRA 3BR8A 4I6WA 1S48A 2IHR1 2XS2A 1XN9A 4ZPDA 3JSYA 3GQCA 3UDCA 2KI2A 3CJQA 1SV5B 1WC4A 3BO3A 3DRRA 1Z1ZA 1PAEX 3KDNA 3M8WA 4HH0A 3PY8A 2ZWPA 3O44A 2ALZA 2BJ7A 4U7CA 1XMQJ 2CQGA 4NI2B 4ES1A 4C8LA 1NJIT 1UKUA 1UTAA 2LEAA 4K2JA 2LP4A 1U25A 5HAOA 1C0UB 1NK0A 3Q8SB 4J9SA 5C42A 4I0WA 3EX7B 3IM8A 4ECSA 1YHQS 4OHYA 2EFOA 4QWBA 3SSQA 2Y1IA 3ITHB 5DG7A 4OZ0A 2CPEA 2Y3YA 7AT1B 2GNKA 4QWAA 2AU0A 3DM2B 2V5HG 3AY0A 1BMQB 1FKOA 1HIYA 1CJKA 1LWXA 2BV3A 4P74A 3TWZA 1S1XB 3KKFA 1KVKA 4OX9J 3WIVA 4Z2XA 2F8EX 2N3OA 2YPYA 4OZLA 1REVB 4O3PA 1SBRA 3OPKA 2QL5B 4BDPA 1TKTB 4JYAF 2E5IA 3HJFA 2DXFA 1HBMB 1O51A 3IRXA 4DV0F 4DN9A 4DV1J 4UUWA 4ZVFA 1NK8A 5EX3A 2LFVA 2VG5A 5HANA 4C7QA 3FBFA 2DIUA 3SQGB 2F4FA 1FXLA 5L9XA 3BKTA 1DJ0A 4OI1A 3R5BA 3LAMA 2GVDB 4MFBB 3LP1A 3NCRA 4QWEA 2E5GA 4B9VA 1UFKA 2RE1A 2DO4A 2HMIB 2J8SA 1TKZB 1SKWA 1BXNA 4YDXA 1Q8BA 5D3GA 4O3NA 2AGQA 1CULA 1RWXB 4EMDA 4B3OB 3QGIA 5CCLA 3VAFA 1S0OA 2ZE2A 1RAGB 5BJRA 4IOAQ 5JXSA 3DI6B 4C6AA 2MLYA 1ZH5A 4PUOB 1FTRA 4PQUB 2CG4A 3LANA 4OYPA 1U48A 1NO8A 3VAHA 5F8IA 4KGZB 1CQMA 2K3KA 3VGTA 1C0UA 4U6PA 4UF4A 2FZKB 2J0WA 4D3GA 4YN3B 4UT4A 2JJ4D 1VHIA 4UQTA 5GAGU 1XIQA 2YNIB 1JLAA 3Q8QB 1W2BR 2R7UA 3A13A 5K14A 2AX1A 3A3PB 2UP1A 2LVWA 5HROA 1RP5A 4YB6A 2AYEA 4PWUA 2L48A 2W7PA 2OEJA 4DSEA 2B4UA 1Z2ZA 2JVRA 1FWKA 3EUNA 3ZC4A 1GXTA 4A47A 4QWDA 3VVUA 1I94J 4TU7A 3UR0A 4OYOA 5DLGA 1HQEA 2WVCA 3AD9C 2R7OA 5CZXA 3JXOA 5D4NA 3PW7A 2UXBJ 1YSJA 2X7IA 3MPUB 1VQPS 4G6VB 1HNWJ 1H72C 1GX6A 3D68A 1M5PC 1UVKA 4K4SA 3FJ2A 4YR3A 5KT3A 2C42A 2QE5A 4EBEA 3CE8A 3CO9A 2V8VA 5D0HA 4CYUB 3QT8A 1JLBB 1QAJA 4X64F 2A18A 2HWIA 2OELA 4JI6J 4ZVHA 2NS1B 3MM9B 4KFBA 3S1TA 3PO4A 4KYZA 1CS4B 1KONA 4DL4A 4HTJA 2AJ2A 2AZ3A 3DGPB 1YIJS 3I0SB 3KK1B 2MKHA 2XMJA 3DLEA 2KJVA 4C3KA 2A0FB 3RB6A 4GKKF 3HFVA 2NXEA 1ZAVA 2KM8C 3CCUS 5DJBA 4F8RA 3CC7S 1FJ7A 4RW7B 4TU8A 1TV6B 3H90A 3P49B 1U47A 1Y00A 5CQGA 1E6YA 1EAYC 4DV3F 4OLPA 3I4HX 2DNOA 2LQBA 2G13A 5KFFA 4XO0A 3U27A 4BCAA 2OPQA 3KK3B 4JI0J 4V1Ak 5CHCB 1T95A 2R7SA 1TVRB 4DR5F 5I42B 4MIAA 1PYOB 1YJRA 3HVRA 2OEKA 2YPZA 3IAS9 4LF4F 1X9WA 5C24A 2KYZA 4ZJQA 3HKZD 5HROB 2AIRB 3CCZA 3KLIA 4UY85 3MCMA 3T1AA 4LVOP 4JV2A 2CNNB 2QMXA 3KJFB 1VOMA 3CWJA 3RTVA 1M5VC 2KXHA 2C2EA 1N34F 1EZZB 3IR6B 2LXUA 2OPQB 3QO9A 4ZPAA 4F4AA 2XCAA 4DS5A 5F8NA 1UJ4A 2XMWA 2FJWA 1QTMA 3RJMB 1NSAA 1NDPA 2V6AA 3I87A 3MTKA 3UPFA 2BANB 4DV3J 2BEFA 1KBRA 3N5BA 2ZH7A 2HFUA 4P73A 5KFNA 4Y2MA 2Q66A 1MMDA 1HA1A 2CZ9A 1P27B 2W2OP 1KWMA 1Y5IB 1WSRA 1KKHA 1F1BB 2XSFA 3PACA 4HI1A 1C1BB 1RWPB 4CNYA 2CPJA 3OLAA 3CJSA 1U49A 4O44B 2P6SA 2O5DA 2RHSB 3VQTA 3R1LA 3HX9A 2N4CA 1U1QA 3MMCB 2BZ2A 5KT2A 3K2YA 2QX0A 4M5NA 3ZNUA 3UCGA 2RF2A 5J2NA 1JLQB 2WK4A 1VK8A 4DXLA 5J2PB 4MKBA 2PI5A 1SKSA 1NPKA 1PILA 4JI6F 2RH3A 1U1NA 3HKWA 3AOCA 4NWBA 1RQ0A 3CD0A 1VCTA 5D8HB 4B9TA 4K59A 1XEZA 3QAUA 4NA1A 2L9NA 2DR5A 1A7GE 4WPAA 2WB4A 2ZBRA 3CDUA 2VH7A 3B6BA 2EVZA 4Y34A 1SL1A 3PEHA 1R0AB 3A3NB 2ROEA 3ADAC 4CLFA 5GADI 1AW0A 4ZP8A 3VAIA 1PSDA 1SXLA 2X1BA 1V6HA 1QVGR 2ASJA 1GEHA 3R6GB 1T11A 2DY9A 1F2HA 1LXNA 1SUQB 3DLKA 1RT5A 3IP0A 3VF0B 4DG1A 4K0KF 4IO9Q 2GMLA 1NPPA 2E5HA 3ILJA 5BR8F 2IVYA 2YQ1A 2RAQA 4NLSA 2PO4A 1UPPA 2ZH1A 4JI1F 1M1GA 3KLGB 3P8BB 1RT6A 5ETSA 5HLFA 1VQNS 2KZMA 2F5GA 3CVKA 3BBBA 4K4WA 4KH0B 3P5TL 1TKXA 3F0NA 3TZZA 2KN4A 2WVBA 1RWWB 3J80Y 2CJAA 3V6KA 3G8QA 1KHWA 3R5GA 1NAQA 3M8SA 4BC9A 2H3EB 3OVAA 3C15B 2OMOA 3VAGA 2UV8A 2I9SA 2DNKA 3F56A 4MYUA 3PIOQ 1Y5LB 3G2XA 4NZ0A 1S97A 4ZPVR 1JNRB 1FEEA 3FKBA 3M30A 4N56A 1AB8A 1MWZA 4DX6A 4EO8A 1S1XA 4G3IA 1RT4A 2B9XA 2J6SA 1DTTB 5A2QY 1UVLA 2YNGB 1A9NB 3ULHA 2Y8WA 2RU9A 3TJ9A 3GG0A 4RBUA 1WEZA 3ETMA 2QLXA 1NPRA 5DG9A 4ZP6A 4PAAA 4R0EA 4CH1A 3H25A 3L4BC 4JBCA 4ZVSB 2B9YA 2GQCA 2YKQA 5B0AA 5DQGA 4X4OA 1UVMA 4B3RJ 1S57A 1V3RA 2FGCA 2W8KA 2XG8A 2HQCA 4HTIA 1WD6A 2ZJQQ 1RLDA 1VDHA 3C2PA 1WOPA 3HSGA 4J90A 2FJEB 4NZ6A 2V68A 3DYAA 2ILZA 1N34J 2LQJA 4ED2A 4DSJA 4J9NA 4F4XA 2XM3A 2PN6A 4UOGA 3UCUP 1CJVA 2KJWA 4H4MB 3UWTA 2VZ9A 3GV7B 2JLGA 1M5OC 2J7WA 5IT9Y 5A6PA 1S1WB 3IXQA 1VJWA 1WC5A 3FFIB 3HZEA 3Q8YA 5HJYA 5DG8A 3DLGB 1YITS 1WI6A 2MZJA 3W60A 3SV4A 5ADZA 1UVJA 2DNMA 1OYEA 1S1UA 2VOPA 4OQJA 3V4IA 2W4PA 3KUHA 3NAIA 4WFYA 2XQCA 5D0EA 3PX6A 2FC9A 4QR2A 2KZZA 2ZDOA 1TL1A 4P9SA 2RRBA 5HATA 4K4ZA 2VG7A 2WHOA 3CMES 1VC6A 2HBYB 2Q6CA 4KKOA 2V4QA 4NXMF 3SCJE 4OJ1A 3BB5A 4P2MA 2XMTA 1CJVB 4H4MA 5C2CA 2FVRA 3D4JA 1EKRA 2XSJB 3W2VB 2NUHA 3T6JA 2JRSA 4EEYA 4AL5A 3OVBA 1K0VA 3GR0A 3MM6A 1X0PA 4OYXA 1RT1A 2GFFA 5DRKA 1VLOA 3TRGA 3PX4A 3DLHA 3NNCA 2RDJA 2D74B 2DD8S 3MOJB 2FYXA 3MD3A 3WIUA 4U8VA 2WBRA 4FNIA 1N36F 3TAMB 2QA2A 3TQEA 2DGUA 3R8YA 3RW6A 3TO8A 1S6QB 5JVHQ 4A8SA 2HHUA 2UVRA 4JI4J 1SC1B 4J9PA 4FYYB 2DNHA 3MMAB 2RNEA 1X8DA 2VJUA 1S77D 2FGOA 2HWHA 3QYYA 3MOZA 2GIRA 1HI0P 2MZTA 4OZNA 1Q0NA 2NQPA 1LOUA 3MM6B 5H9FK 3ISND 1N0VC 3EZ5A 3CCES 1T9YA 3V81B 3BGRA 2WCXA 3TZWA 4UZBA 4WYWA 4Q8FA 1PC4A 4RNHA 4WK1A 2DHHA 1I1GA 4ANCA 2IRYA 3ZO7A 3BBCA 1B70B 1XERA 1D8ZA 1FA0A 3JB9k 3GFYA 3GP9A 4IH5A 4QIEA 2DT9A 4K4XA 3QMQA 3H8YA 1JLCA 3D9BA 4MIWA 3WX8A 2XCPA 4PWDA 5IT0A 4NXNF 3IBCB 1S4EA 4QPXA 1ZM3A 3PEJA 5KAKA 1ZZFA 2BJ3A 3HCXA 3M6UA 4DLGA 1RAJA 4QIGA 2NPFA 3M9NB 4KY3A 3TR5A 1UVNA 1S1WA 4ZOSA 3NS5A 1JLCB 1MWQA 4CLTA 1HQUA 3NGUA 2OUGA 4CO4A 4PRFA 3NCPA 3IFEA 2HGNA 1I6JA 2GGPA 2HQFA 3AD7C 1D1UA 1M0SA 3WC0A 4ZVOB 3LGNA 3E01B 4OZ2A 3SIPB 2QC3A 2M8HA 1S5ZA 4P2SA 4R8UA 1QTNB 1YJTA 1M5KC 3R2DJ 1YJ7A 1Y4ZB 3IG1A 5EX0A 4J9RA 2CPIA 2UZAA 3NMAA 3EXYA 3MPVA 4DCJB 1F5CA 1SH2A 1WACA 2KXFA 2YY3A 2ZBCA 4OX6A 1X31C 3TNVA 1MNEA 1C2PA 3L9ZA 4EYIB 4BS2A 1QAYA 5KFTA 3R1HA 3FZBA 2XI2A 4M5DB 4ZK7M 2FJBB 3TAMA 5DM7Q 2VBZA 4CO1A 3FSXA 1YI2S 4WXWA 2FJAB 2ZH6A
chains in the Genus database with same CATH topology
4ZVSB 2CNKB 4DCOB 2XYPB 2H5JB 1PYOB 2CDRB 2QL7B 1SC3B 1GFWB 2FQQB 1RHUB 1RWKB 2XYGB 2HBZB 2Y0BB 2H4YB 2CJYB 4LSZB 3GJSB 2QLBB 2CNNB 3KJFB 1RWOB 1RHKB 2CNLB 4ZVQB 3D6MB 4ZVRB 1BMQB 3RJMB 2CJXB 2HBYB 2C2MB 2QL5B 1RWPB 3R6LB 2CNOB 1RWVB 1I3OB 2C1EB 3GJTB 2H51B 2H4WB 3QNWB 1SC4B 2H5IB 1PAUB 3R7NB 1RWMB 1SC1B 5IC6B 4ZVPB 3KJQB 3P45B 3D6FB 5K20B 2H54B 1RWXB 1QDUB 1RHRB 3R7BB 1ICEB 4DCPB 1RHMB 3D6HB 3R7SB 1RHQB 3EDRB 2C2OB 3R6GB 4ZVTB 2P2CB 3IBFB 2QLFB 3IBCB 4ZVUB 4JB8B 2QLJB 2HBRB 1I51B 1RWNB 1RWWB 1F9EB 2DKOB 1RHJB 4ZVOB 3SIPB 5IC4B 1IBCB 3R5JB 1QTNB 2C2ZB 2XZDB 3KJNB 2H65B 1NMEB 3P4UB 2Y1LB 3EDQB 4DCJB 1RE1B 2H48B 3NS7B 3GJQB 2HBQB 3GJRB 2XZTB 2XYHB 2QL9B 2C2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVS B;  2CNK B;  4DCO B;  2XYP B;  2H5J B;  1PYO B;  2CDR B;  2QL7 B;  1SC3 B;  1GFW B;  2FQQ B;  1RHU B;  1RWK B;  2XYG B;  2HBZ B;  2Y0B B;  2H4Y B;  2CJY B;  4LSZ B;  3GJS B;  2QLB B;  2CNN B;  3KJF B;  1RWO B;  1RHK B;  2CNL B;  4ZVQ B;  3D6M B;  4ZVR B;  1BMQ B;  3RJM B;  2CJX B;  2HBY B;  2C2M B;  2QL5 B;  1RWP B;  3R6L B;  2CNO B;  1RWV B;  1I3O B;  2C1E B;  3GJT B;  2H51 B;  2H4W B;  3QNW B;  1SC4 B;  2H5I B;  1PAU B;  3R7N B;  1RWM B;  1SC1 B;  5IC6 B;  4ZVP B;  3KJQ B;  3P45 B;  3D6F B;  5K20 B;  2H54 B;  1RWX B;  1QDU B;  1RHR B;  3R7B B;  1ICE B;  4DCP B;  1RHM B;  3D6H B;  3R7S B;  1RHQ B;  3EDR B;  2C2O B;  3R6G B;  4ZVT B;  2P2C B;  3IBF B;  2QLF B;  3IBC B;  4ZVU B;  4JB8 B;  2QLJ B;  2HBR B;  1I51 B;  1RWN B;  1RWW B;  1F9E B;  2DKO B;  1RHJ B;  4ZVO B;  3SIP B;  5IC4 B;  1IBC B;  3R5J B;  1QTN B;  2C2Z B;  2XZD B;  3KJN B;  2H65 B;  1NME B;  3P4U B;  2Y1L B;  3EDQ B;  4DCJ B;  1RE1 B;  2H48 B;  3NS7 B;  3GJQ B;  2HBQ B;  3GJR B;  2XZT B;  2XYH B;  2QL9 B;  2C2K B; 
#chains in the Genus database with same CATH topology
 1IBL J;  4OX8 A;  1T9W A;  1VRT B;  2AYM A;  2B8P A;  2ZHA A;  3T5L A;  1JLA B;  3ONQ A;  1K73 T;  3GSD A;  2I8E A;  4PKD B;  4Y28 C;  4KHP J;  4F04 B;  4LR8 A;  4PG5 A;  4YP3 A;  3GIM A;  2ZM6 J;  4DV4 J;  2FIU A;  3RG6 A;  5KT5 A;  2FQQ B;  1U6Z A;  3MZI A;  4U8Y A;  2MSS A;  5B0D A;  1HPZ A;  1FFS B;  4IFY A;  2MGZ B;  1PBU A;  3LP2 B;  3GU0 A;  3I0R B;  2MQP A;  1OPZ A;  5LJ3 Y;  2QZ8 A;  4ED6 A;  2HHH J;  2NUU G;  3LF0 A;  1RA6 A;  2KG0 A;  4D3H A;  1WOO A;  3D6T B;  3TJA A;  1S1V B;  1NXI A;  3HD1 A;  2WSC C;  1J27 A;  2IRX A;  5L1L A;  1RTJ A;  2V50 A;  3DDK A;  2HMI A;  2ZNY A;  3DC2 A;  4JUZ A;  2B6A A;  4LF8 J;  4TYB A;  2VPX B;  1W7W A;  3QGH A;  2HQD A;  3ET6 B;  3HHK A;  3SDE B;  2P9G A;  3R5A A;  4B3O A;  2VG7 B;  4LMZ A;  1Q4R A;  2EC2 A;  3AB2 B;  4HHH A;  4KT0 C;  3LW5 C;  4C0O C;  3Q2T C;  3A8J A;  1U26 A;  1IBK F;  1PJ6 A;  1IN0 A;  4Q2L A;  1CG2 A;  5HJX A;  2IAJ B;  4M5H A;  2CVI A;  4F67 A;  4PG6 A;  2WOM A;  3FEX B;  2JZ5 A;  2CDQ A;  3KJV A;  2DGO A;  1FWP A;  5I3Q A;  1N4L A;  2HHS A;  5KFL A;  2VQE F;  1UW9 A;  2APO A;  2CJB A;  1SIZ A;  2XS7 A;  4O4G B;  5B0B A;  5D15 A;  2UVW A;  1TQL A;  2J76 E;  2FJD B;  2YBV A;  2V4J B;  3HVT A;  4FDF A;  5D78 A;  4LBI A;  1G3O A;  5FDL A;  4YY3 F;  1H38 A;  3IRW P;  1EP4 A;  1ZS6 A;  2HYI B;  4LF8 F;  1BWV A;  3CDE A;  8AT1 B;  1B4S A;  1IXK A;  4EBD A;  2BOA A;  3IM9 A;  3PKY A;  2HVI A;  2JEF A;  4RZR A;  2DXE A;  2MKY A;  2V4J A;  3HVT B;  4PAB A;  4DBQ A;  1NK6 A;  1TUG B;  3MM8 A;  2VBY A;  3ISZ A;  4DHV A;  1B64 A;  5T41 A;  4LR9 A;  5DET A;  3I6P A;  4NEY A;  3OUY B;  4Q43 A;  5KFS A;  2WBM A;  3H2U B;  2BQR A;  1SJR A;  3MM8 B;  3MPW A;  4O0N A;  2CQ4 A;  4HR2 A;  5H9E J;  2XY5 A;  5BYR A;  2NXJ A;  5CCM A;  3FMB A;  1YZ6 A;  3R7S B;  3KLF A;  2LEC A;  3G6E S;  4GMK A;  5AXM A;  5C42 B;  1ELO A;  4ECU A;  2VC1 A;  5EN1 A;  4RWX A;  2JFD A;  2J0X A;  1R6Y A;  2G0J A;  1B0P A;  2HS0 A;  2BVZ A;  3M4X A;  4IQM A;  1HD1 A;  1TMJ A;  2UXD J;  4FYW B;  4RW9 B;  1IBM J;  1MML A;  4CLW A;  1FDD A;  1MRO B;  1LWE B;  5A6W A;  4CLP A;  1RK8 A;  3L7U A;  1NK4 A;  2DTJ A;  4FXV A;  4K4Y A;  1N5V A;  2FJV A;  4G1Q B;  4DWI A;  2HFV A;  1EJ7 L;  4KHP F;  2G0C A;  1KLN A;  9RUB A;  5KFH A;  1REG X;  4USK A;  1V3Z A;  2ZOF A;  1UFW A;  3ET6 A;  3BM7 A;  3IRX B;  3PM9 A;  1BLU A;  3V6D B;  2IY5 B;  2YNI A;  2FY8 A;  3H2L A;  2IM0 A;  2MZS A;  3FBC A;  4W98 A;  2A2C A;  3Q8R B;  2AZ1 A;  3ZFV A;  2R8H A;  2FLP A;  2B6A B;  4WK3 A;  1UJ6 A;  3MD1 A;  5D0R A;  2OAU A;  3UW1 A;  3VAM A;  2AW0 A;  1UL3 A;  1S6O A;  2JDJ A;  2NXU A;  3GTY X;  4L75 A;  1H3D A;  3SBM A;  3KHR A;  1UWA A;  1TK0 A;  1Y0H A;  1J2V A;  2AP6 A;  2Y0S D;  1S0N A;  2LLZ A;  4X4V A;  4RW8 A;  2ZKT A;  3I0S A;  3OL6 A;  2VQF J;  2G2Z A;  2YNF A;  1S7H A;  2V8P A;  1CS4 A;  4WII A;  4PEO A;  2QL9 B;  3PX0 A;  4EBC A;  1A0O B;  2HAF A;  2XUL A;  3MTJ A;  4FZV A;  3MMC A;  5D77 A;  3K5N A;  4IFV A;  3OL7 A;  2XNR A;  2ZZT A;  3B8H A;  4OHV A;  3FBB A;  4DG1 B;  3KTQ A;  1TP7 A;  2F7V A;  1T9X A;  2DPI A;  2B4O A;  4DV1 F;  4U7U K;  4DSI A;  3ZTR A;  3WZ0 A;  2FUG 9;  5HL7 Q;  1WSV A;  4F3O A;  1SC3 B;  3EGN A;  1SH3 A;  4NLQ A;  2HBZ B;  3FEZ A;  2PC6 A;  3UVJ A;  3AH6 A;  5DDO C;  4ER8 A;  4LSZ B;  3R5C A;  3TVZ A;  2BM0 A;  2HZC A;  4NLT A;  3MAQ A;  3QIP A;  2AYG A;  1RI7 A;  2DXD A;  1F0X A;  2DCU B;  3FSY A;  1RTI A;  1U2R A;  3JYT B;  2W7A A;  3IO1 A;  2SXL A;  2XMV A;  1P8G A;  4RPF A;  3WX4 A;  3CCV S;  1DRZ A;  4ZVQ B;  3VHQ A;  2CIM A;  1AUD A;  2QA4 S;  1G2E A;  1R8P A;  1O0P A;  4LF2 A;  2EBE A;  4Y3C A;  3WQP A;  1OPI A;  5KFC A;  3M8P A;  1WG4 A;  2R7R A;  4XDD A;  5I4M A;  3ETO A;  2R2U A;  3AJD A;  3KUE A;  1HFE L;  2DGV A;  2UV8 G;  1N32 F;  1X4A A;  1KDN A;  4TY8 B;  5A8K B;  2KFY A;  4U96 A;  1RCO B;  2H5E A;  2J7K A;  4K8R A;  4OI6 A;  1BHN A;  3EZU A;  3W1Y C;  1WHV A;  2DR9 A;  4M5J A;  1SJQ A;  2MKS A;  3F41 A;  3QT7 A;  2BYC A;  3M8Q B;  4WXO A;  3R2C J;  4WF9 Q;  1YJN S;  2R2S A;  3GLJ A;  2N4D A;  2H4W B;  3I9V 9;  1BUX A;  1MN9 A;  3EGW B;  4RNF A;  2GS8 A;  4J9O A;  2QTW A;  4LF5 J;  1M5H A;  2CQD A;  2DK2 A;  2D1C A;  3VZI A;  1V3S A;  1HD0 A;  3KJQ B;  4YME A;  3W3S A;  1AZS B;  2KH9 A;  2CKW A;  2JWN A;  4NYO A;  2H54 B;  2HZA A;  3Q0A A;  4PZV A;  2FHJ D;  1HBM A;  1RAA B;  2MTL A;  4AL7 A;  2HEK A;  2LMI A;  5A8R B;  5C24 B;  4IUF A;  2LXI A;  2K7J A;  2Z2L A;  5CAA A;  3DLG A;  4E0D A;  3CCJ S;  4OMF G;  4QR1 A;  3KWM A;  1WDD A;  4NLR A;  1YJV A;  2RVJ A;  1TVR A;  1FFG B;  3K89 A;  1R8A A;  3R27 A;  3TI0 A;  2V2Q A;  3ZZ0 A;  4YY3 J;  2ZH8 A;  1T0T V;  4M63 A;  3M2V B;  1NHV A;  3EZO A;  2XMK A;  3CDB A;  3DRX A;  3W7B A;  2V2K A;  2IA0 A;  3JSR A;  5D3G B;  4YHH J;  2FVS A;  1T05 B;  1CJT A;  4M5K A;  3US5 A;  2ZH2 A;  3G87 A;  3M2U A;  4F26 A;  2XSJ A;  3W2V A;  3PR5 B;  2XO7 A;  1VK3 A;  5IQQ A;  4TY8 A;  4DFP A;  5ETT A;  3SFG A;  3HHN B;  1BQM A;  1F9E B;  2MZQ A;  3JTP A;  2GIF A;  2QA4 G;  2C3Y A;  5K8N A;  3GON A;  1TK5 A;  1JJH A;  1XNQ J;  4NLP A;  1NKC A;  2QGF B;  2KFN A;  3D1H A;  1N5Q A;  4RUC A;  4JV5 J;  3EGZ A;  2C2Z B;  4E2F B;  1VR6 A;  2XBP A;  3MAH A;  4J9Q A;  3RRH A;  1CJU B;  1S1U B;  3HK2 A;  4XTT A;  1EQ0 A;  5A0Y A;  1WEY A;  4IO1 A;  4TQR A;  1DTQ B;  3PJX A;  4MKV A;  1M1K T;  3H4B A;  4WZQ A;  2OI2 A;  2PSZ A;  4FYD A;  1F2G A;  2H48 B;  4R5P B;  1LFP A;  1X5S A;  2P6T A;  4I6Y A;  3QJL A;  3M30 B;  2HQ3 A;  1VRQ C;  3L09 A;  3R3T A;  1WF1 A;  1S4F A;  4NE9 C;  1WC3 A;  1KFD A;  3UNY A;  4F3Q A;  1U0S A;  3RBE A;  5KFK A;  2QV6 A;  1HNI A;  3E3X A;  1FE0 A;  2BJE A;  3MDF A;  4OJH A;  5ETO A;  4X4R A;  2BA9 A;  4KV8 A;  3G6Y A;  4L6V 3;  4DV7 J;  3V2U C;  4QW9 A;  1ZPW X;  2MDA A;  2P9E A;  3RAQ A;  4Y2K A;  1IKY B;  2CZV C;  2IBK A;  4FP9 A;  3HO1 A;  3LGM A;  4DR7 F;  2YKA A;  1CC8 A;  3CJ0 A;  4KFB B;  3EGV A;  3J81 U;  2UUB F;  4EZ9 A;  4FVM A;  4KR0 B;  5CH7 B;  2CQP A;  4V19 J;  4JV5 F;  3LH2 S;  4IQX A;  3ENV A;  4ZN3 A;  2BDP A;  1WG5 A;  2CJY B;  1VS3 A;  4ZCI A;  3H5U A;  2COL A;  5E3P A;  5G0R A;  4Y00 A;  2MKI A;  5LMU J;  4OI0 A;  1GTH A;  2NCK L;  1U45 A;  3MFH A;  3CB4 A;  1D0E A;  4OI3 A;  4B3T F;  3KNA A;  1HBN B;  4CWB A;  2JHE A;  1H74 A;  2VFU A;  1DLO B;  1VIX A;  2Z0G A;  2YQ3 A;  3RR7 A;  1F60 B;  4NLU A;  2C2D A;  4CDI A;  2B8Q A;  1NM2 A;  1HBN A;  5J1P A;  4YR0 A;  2Y8Y A;  3SCL E;  2D3U A;  2MHE A;  5IOL A;  1MU2 A;  2CJX B;  3PHT A;  1UAW A;  2BKO A;  3QPI A;  4LBP A;  4WE1 A;  3R97 A;  3M8Y A;  3N79 A;  4ED8 A;  1NJY A;  2G4B A;  2BKN A;  3MR7 A;  3HSD A;  2C2M B;  3N0V A;  4A8O A;  1NB2 A;  1IQZ A;  1DAR A;  5J1N A;  4F2S A;  3PW4 A;  1R0A A;  2LEB A;  1RAE B;  2EG1 A;  4OZ1 A;  3BDP A;  1BGX T;  3PYE A;  5CZV A;  1NND A;  3BRE A;  2BRL A;  4OYZ A;  3TX8 A;  3KK2 A;  1VQ5 S;  1RYS A;  5KG3 A;  4QBU A;  3BR9 A;  5A0Y B;  4J9K A;  1CPZ A;  3PW0 A;  1HNZ F;  3KDO A;  5H1S V;  3K5L A;  1SUQ A;  3DM2 A;  5KG7 A;  1N56 A;  4DU8 A;  2KT2 A;  1HNX F;  2GJI A;  2W2P P;  3UDV A;  4F0M A;  5HVG A;  5L1K A;  1NJX A;  1RAD B;  2GIQ A;  2VDI A;  3KLG A;  2KG1 A;  4Q2M A;  1F9H A;  3Q8U A;  1LK7 A;  3IWX A;  4LRC A;  5GVQ A;  3K7R A;  2IIH A;  3JQJ A;  2FVC A;  3W9H A;  3AT1 B;  3W5X A;  4ED3 A;  1VQ7 S;  2KTQ A;  4DCP B;  2A6O A;  4LF7 J;  2O01 C;  2OP5 A;  1H7W A;  2BE9 B;  5KG6 A;  3TAQ A;  2HK3 A;  4I4B A;  4PR6 A;  4AT1 B;  5LSO A;  1J5E J;  3GFX A;  2R2R A;  1M1H A;  3M2V A;  2GO9 A;  3U02 A;  3N28 A;  2J9E A;  4RW4 A;  2VA2 A;  2JFK A;  1WHY A;  3CJ5 A;  3T1Y J;  4PG4 A;  3KYL A;  5EWF A;  3AJ2 A;  3UDE A;  3J7A N;  2ZZM A;  2IMW P;  3H2V E;  1AT1 B;  2OPS B;  4JB8 B;  4BBY A;  1KC8 T;  2QLJ B;  4B17 A;  2K8G A;  1MLA A;  1H2T Z;  1R8B A;  1QM9 A;  2HLU A;  5ETN A;  4C8K A;  3FQL A;  1JNZ B;  2FDN A;  3NG8 A;  5E7O B;  1FT8 A;  1IBK J;  2PEH A;  3DLB A;  2X3D A;  3T9Z A;  1VQL S;  3VAK A;  3ZTO A;  4TLR A;  4EUV A;  1QJH A;  1KLM A;  1VRU A;  1JX4 A;  2ZC3 A;  4DL6 A;  4AND A;  3J7Z T;  2K3I A;  4LFA F;  2KYX A;  2YX1 A;  3QRR A;  2OSR A;  5IT9 U;  2N3L A;  3W2W A;  1RTJ B;  3VZH A;  2VUG A;  4DI6 A;  1BC6 A;  5EWG A;  1N5S A;  1KEK A;  4F0H A;  2E7X A;  2HHV A;  4I7F A;  4RW6 A;  3QAT A;  2WAQ D;  2IM3 A;  3OT9 A;  1KQS R;  4IRD A;  2D69 A;  5THW A;  5D4P A;  4MK9 A;  3IG1 B;  2L3M A;  5KOX A;  3G6V A;  2YWF A;  4DV0 J;  1H98 A;  4LR7 A;  2A6M A;  4GO7 X;  1N6Q A;  1SVD A;  2JEI A;  2QRR A;  1RAI B;  1U0H B;  5ETL A;  3GJR B;  3DMJ B;  2WVD A;  2VJV A;  1KNZ A;  4F4W A;  4OZ5 A;  2E1A A;  2XHC A;  1N6Q B;  5MAO A;  3MEK A;  3GCW P;  4B3R F;  3DHW C;  4J7C A;  3RR8 A;  3V4I B;  1IBL F;  3C46 A;  5KFR A;  1KHV A;  4H54 A;  4KIA A;  4X64 J;  4KPY A;  4C4W A;  3AA8 A;  4FXD A;  2W9B A;  1GFW B;  2HIY A;  1PCA A;  3RYL A;  1RU1 A;  3MWB A;  4WTY A;  2VBX A;  4OJ3 A;  2J0S D;  4ID5 B;  4OHX A;  2WVE A;  4N77 A;  2ZC4 A;  4ENO A;  1WOR A;  1VJQ A;  2GMH A;  2F40 A;  7FD1 A;  1JLG B;  1Q8K A;  1HW9 A;  5B08 A;  2J6T A;  2CQH A;  3M2R A;  4JI3 J;  4PQU A;  2AWZ A;  4A8M P;  4P2X A;  4DPO A;  3D6M B;  1ZA1 B;  2OKQ A;  1RAC B;  4NLD A;  5KG5 A;  3QRQ A;  2HQG A;  1WTB A;  4X66 J;  3SEO A;  2VPZ B;  2J0Q D;  3C6U A;  4Z7C A;  4QU7 A;  4X84 A;  3VCD A;  3HHD A;  3AB4 B;  2CWK A;  3VTI A;  2K7K A;  3HUL A;  1Q81 T;  1B3T A;  2AV5 A;  1NU4 A;  3QFW A;  3QGP A;  3CIZ A;  5IV4 A;  5HP1 A;  1D8Y A;  3AQO A;  2CNO B;  1YBT A;  4DPX A;  3FDS A;  2F9J A;  4HH1 A;  1K0T A;  2ZBQ A;  3NP5 A;  3IAM 9;  2DRB A;  3EM1 A;  4LUB A;  3T5J A;  1K8A T;  2KRB A;  5IV3 A;  1S7I A;  1ARO P;  2N7C A;  5LM7 E;  2XLI A;  4OI2 A;  2GVD A;  5F41 A;  3NNH A;  3R7N B;  2C22 A;  2IM2 A;  1RWM B;  3ILI A;  4LT6 A;  3PXG a;  4JI3 F;  5E41 A;  3LPE A;  3MFI A;  3OFF A;  4KKO B;  2MQ8 A;  2YXL A;  3OR1 B;  2ZVS A;  3TAP A;  2XC9 A;  1YTY A;  3P45 B;  4X62 F;  1VQ6 S;  3S8S A;  1BWE A;  1FKO B;  3G9C A;  1NBE B;  2DNL A;  2V8D A;  2C3U A;  1CUL B;  4N8N A;  4X65 J;  2DH7 A;  2EK1 A;  4FF2 A;  3FMW A;  1UEV A;  3JTN A;  1A6L A;  3KHL A;  3CD6 S;  4K2X A;  3ZTP A;  3CCM S;  2VD3 A;  3B82 A;  1HKA A;  1X5P A;  2AQ4 A;  3DOL A;  3OJU A;  2UUB J;  2PII A;  4UOH A;  4OYA A;  3OTO F;  3W9I A;  2HVD A;  1S59 A;  2IBO A;  5M2P A;  1VQK S;  1AYE A;  2V8H A;  1H0H B;  1NZA A;  1V5V A;  2HHP A;  3DCA A;  3TYT A;  1OMS A;  2VG5 B;  1OQ3 A;  2Z4P A;  3GPA A;  1G1X A;  3KLF B;  1HPZ B;  4QQB A;  2XLJ A;  2GA7 A;  2KT3 A;  3CO0 P;  4B3M F;  5A2Q U;  3AOD A;  1B7Y B;  3CD7 A;  3H5S A;  4L3N A;  2MLZ A;  2AT1 B;  2CQI A;  2LCW A;  4KGV B;  3A8E A;  1UP1 A;  2NXN A;  3DOL B;  2DHX A;  3PRV A;  2FVQ A;  3HHL A;  1Q16 B;  1OJ4 A;  3R5J B;  2E29 A;  2MQN A;  3DRR B;  3OXL A;  1RT3 B;  2KL8 A;  4EK2 A;  4L74 A;  1GT8 A;  3PFO A;  2IVF B;  4A8Y A;  5E2Q A;  1P6T A;  1YG0 A;  3B54 A;  4A8F A;  4NLO A;  3P4U B;  2ZJR Q;  1TTH B;  2PD1 A;  4RW9 A;  1SL0 A;  4B9N A;  3BSA A;  3V4M A;  3JSM B;  3Q22 A;  2NZ4 A;  1MG7 A;  1Y10 A;  3FUY A;  4NMX A;  2MHN A;  4KPC A;  3RBX A;  2B9W A;  3F44 A;  2Z8Q A;  2Y1R I;  3FK4 A;  3UI3 A;  1Q95 G;  1T9U A;  2DEJ A;  3I5C A;  1FD8 A;  2FHM A;  1HBO A;  3OXG A;  3DLJ A;  1UET A;  3NGK A;  5ETR A;  4CM0 A;  5HQM A;  2LKZ A;  2MQM A;  5HVH A;  2AMC B;  4LFB F;  4F4Z A;  4YEA A;  2RB7 A;  4J5O A;  1U1O A;  3D7S B;  1FX4 A;  1Q79 A;  4K4T A;  3B78 A;  4B3S J;  3DGV A;  4OHW A;  4CLK A;  5GAH U;  4HDH A;  3LUY A;  2ZBP A;  4F36 A;  3D1O A;  3BH6 B;  2WB1 D;  2QMW A;  4Y2I A;  3TOQ A;  1S9G A;  4NEZ A;  2XGQ A;  2VA3 A;  4B9L A;  1Y7P A;  4DLE A;  1VHF A;  3GG1 A;  2Y0B B;  2FHJ A;  2BE2 B;  2UU9 F;  2HHX A;  1QSY A;  2BM1 A;  3OFG A;  4ILM A;  3KJV B;  2FZG B;  5AE2 A;  4ETX A;  4X4P A;  3OBI A;  2V9K A;  5B0E A;  4X66 F;  2EK6 A;  2X1G A;  2DNZ A;  2OPR B;  3HD2 A;  2UUA J;  3M2R B;  2KHC A;  3R5D A;  3CCQ S;  1RTI B;  2BRK A;  2CNL B;  3PV8 A;  4U7U D;  3DN9 A;  1U6B A;  3DU5 A;  4MAK A;  5ETK A;  3DXS X;  4HKQ A;  1HW8 A;  1HBU B;  2VKR A;  4L3K A;  1PJ7 A;  3ZTS A;  4ZIV A;  3AD8 C;  2DHS A;  1UWB B;  3NBP B;  3QLH A;  4A4J A;  3HMJ G;  3SSR A;  1KN6 A;  1LW2 B;  2ZOG A;  3CMA S;  2VBW A;  3I0R A;  2E9R X;  5FLX Y;  1FRX A;  3RU0 A;  3ILO A;  1X9S A;  2HAI A;  3CT9 A;  4DUZ F;  1WKK A;  3A1Y G;  4DU7 A;  4OYM A;  2BQU A;  1N32 J;  5J2N B;  3Q86 A;  2QT7 A;  2YNF B;  3J81 Y;  1BD6 A;  4J9M A;  4Q0B A;  3EPG A;  1NDK A;  1HYS B;  4OV6 A;  1IR1 A;  1FTC A;  2D7S A;  4QWC A;  4NXN J;  5B0C A;  2ZEJ A;  2WON A;  2BKP A;  1XBW A;  3QZ7 A;  2Q43 A;  2XTJ P;  3M1V A;  2CQ3 A;  4EI2 A;  4UOC A;  4C8Y A;  3D3B J;  1FVQ A;  2VKZ G;  2HFS A;  5L46 A;  2UVU A;  1X4B A;  5KFO A;  4AL6 A;  3MM7 B;  1Q7L B;  1Q8L A;  3PCO B;  4R5P A;  4CM2 A;  2HHQ A;  3UVJ B;  5F8L A;  2DYA A;  4U95 A;  1QSL A;  4RU2 A;  1RTD B;  3WHI A;  2HLT A;  2W9A A;  2GHW A;  5KFM A;  4J9U E;  5KG1 A;  1HYS A;  3QIP B;  5L38 A;  4M5G A;  3RUB L;  3HVA A;  1LWF B;  1U2F A;  2B7B B;  2V2Z A;  3OTB A;  2P2C B;  4KGM A;  4USJ C;  4ZHR B;  4C48 A;  4B3S F;  4N7T A;  2BJ8 A;  2RML A;  3CED A;  1X5T A;  2D3Z A;  2Z56 B;  4M1K A;  3BGO P;  1SQE A;  3D54 A;  5L1J A;  2YWE A;  2EFV A;  4IKA A;  4KHM A;  5DGB A;  5DO2 A;  1I51 B;  2ABY A;  1IVZ A;  1E6Y B;  1T05 A;  1JLG A;  3GWC A;  1HL6 A;  4P7V A;  4QIF A;  5C7P A;  3DRS B;  5K8O A;  2F1F A;  3GIK A;  2K2P A;  2ILY A;  1RU2 A;  3C19 A;  5M2U A;  2M8D B;  3ZZT A;  1AA1 B;  1R27 B;  4UUX A;  4RR5 A;  3I55 S;  4AD6 A;  5A8K A;  2W9C A;  4W90 B;  3AQP A;  3MHY A;  5KG2 A;  2V63 A;  5CD4 H;  1SKU B;  1APS A;  3C14 A;  3OSP A;  1TL1 B;  1KR4 A;  1RT4 B;  1U8W A;  2JC0 A;  3NBP A;  4CI0 B;  1S1T A;  2AYB A;  1H7X A;  2ZIT A;  2YTC A;  1U02 A;  3KUG A;  4OLO A;  1LK5 A;  4N8O A;  5T7L B;  2PMZ D;  2GVZ A;  4RU9 A;  1TL7 A;  5J2M A;  1IR0 A;  2M4M A;  3DMJ A;  4DPU A;  4XPE A;  2KU7 A;  3V6D A;  5HO4 A;  2FY1 A;  4KAI A;  1F5A A;  1VYA A;  2PA8 D;  3HHE A;  3A3O B;  1FES A;  2HFN A;  2BQ3 A;  4IRK A;  3RZA A;  4C8N A;  4ECR A;  3QSI A;  3ZXW A;  4DR3 J;  2MKJ A;  1Y3K A;  2IJR A;  2MYF A;  2H5J B;  4RW7 A;  4RNO A;  2V4R A;  3Q23 A;  2EKN A;  3KG4 A;  4UST A;  1UFL A;  3G4S S;  4MIB A;  2EFQ A;  4DV2 J;  4DL0 C;  4NAS A;  2CYY A;  3G71 S;  3GYN A;  4A8Q A;  2ERR A;  2HS4 A;  1YJ9 S;  4QYZ K;  4DV5 J;  1LQ9 A;  3HT0 A;  3VGS A;  3KK1 A;  1XC9 A;  3NOC A;  1VQ9 S;  3T41 A;  1W25 A;  1BE4 A;  2A10 A;  3GJS B;  2FHO B;  4TY9 A;  4DV5 F;  4O23 A;  2ZVI A;  4KV8 B;  3C16 B;  2ZNZ A;  3L7P A;  4LF4 J;  4ILL A;  2D9P A;  3H98 A;  5CYM A;  4R25 A;  3BV8 A;  3KLE B;  2HFO A;  2YX7 A;  1EKS A;  2R7W A;  3BQ2 A;  3LWL A;  3JYT A;  4LRA A;  3S7R A;  3QLH B;  2HG4 A;  4LVN P;  1JIH A;  2ASY A;  2QIF A;  3F73 A;  2QO3 A;  1YJW S;  2CPF A;  2M52 A;  4ANE A;  1C4C A;  4H4O A;  1GMU A;  5F8J A;  4GKK J;  4WZM A;  1OSD A;  1ZAW A;  4WP8 A;  5KFW A;  1VQY A;  4DL5 A;  1EAR A;  5K5M A;  1HWI A;  4DFJ A;  4B9M A;  2PMW A;  1J5O A;  1FJG F;  1ITP A;  3UDL A;  2WTF A;  1N5Y B;  1VMB A;  2K06 A;  1RTH A;  1N52 B;  2NXC A;  3VVT A;  2I6W A;  4PG7 A;  5MLC V;  3CCS S;  3T1Y F;  3EE3 A;  1HNI B;  2NLW A;  2UVV A;  3K58 A;  4Q5V A;  2DGQ A;  1WUU A;  2L41 A;  4DSL A;  1PAU B;  2CQ1 A;  3QAE A;  1NKE A;  3DOM A;  2E1R A;  1VFJ A;  3NXZ A;  1RT7 A;  4RBT A;  4ZDN A;  4LF5 F;  2HND B;  2AHO B;  5C25 A;  2E1M C;  4BHQ A;  9ATC B;  2RUG A;  4FF1 A;  3OD2 A;  4ELU A;  4MT1 A;  3NKY A;  3SCI E;  1R31 A;  2PMH A;  2RKI B;  4DR2 J;  2ACY A;  1TKX B;  1QDU B;  1SB6 A;  2YNG A;  3D3C J;  3PYD A;  3KHG A;  4K4U A;  3MED B;  1IR2 A;  3NWR A;  2I38 A;  3OFH A;  1MMN A;  4I2Q A;  4O4G A;  4CTA A;  5IQ6 A;  5KT7 A;  3KK2 B;  1RAO A;  4NLX A;  1TL7 B;  4P6Q A;  3D6H B;  4CH0 S;  2RDI A;  1RYR A;  4ICL B;  3AFG A;  1FVS A;  1T94 A;  3AJ1 A;  4MK7 A;  5F3Z A;  3G6X A;  5A8R A;  3QT6 A;  4MFB A;  3T5H A;  1LXJ A;  1Q5Y A;  2M88 A;  4G1I A;  3ELH A;  2ZKU A;  4ZHR A;  4O3S A;  5KOW A;  4CIO A;  1ZA2 B;  4ZCM A;  5L39 A;  1AZS A;  2ALY B;  4ZVU B;  2DR8 A;  4ZPC A;  4RBV A;  3MEC B;  2ZJP Q;  1WF0 A;  3GIR A;  4I1T A;  2OPP A;  2RJZ A;  5IFM A;  3O5T B;  5LXR A;  4M5L A;  2KVI A;  4ZLJ A;  4YHH F;  2DCL A;  4OL8 A;  5E0O A;  4H4O B;  4JI1 J;  1G7C B;  3K8W A;  4I6A A;  3J7Y I;  3BN7 A;  2HNZ B;  3TUI C;  2W8L A;  4K7Q A;  2PI4 A;  1UVI A;  4KRW A;  5KT6 A;  2P5V A;  1EX8 A;  2YKM A;  3BEG B;  2CPZ A;  3M6W A;  5IC4 B;  4C0B A;  1QD1 A;  2MB0 B;  1RT5 B;  1ZM9 A;  1CVJ A;  1UCN A;  2BUN A;  3BGR B;  3DRP A;  4OZJ A;  5LL6 d;  3ZZP A;  1N5T A;  3PYF A;  4NML A;  3ZZO A;  5JUM A;  5T14 A;  1ROF A;  1SI9 A;  2BOP A;  3ZZU A;  5F9L A;  1OS5 A;  4FF4 A;  4B3T J;  1AXQ A;  1IWA A;  2FD2 A;  4U9R A;  4ED5 A;  2PFF B;  3LTO A;  1QAX A;  1NH7 A;  4GVB B;  3UD4 P;  1DQ9 A;  2RHQ B;  3OL8 A;  4P72 A;  4C3M A;  3J7A 1;  4C8O A;  1U1L A;  1SPB P;  3T9N A;  1WI8 A;  3GJQ B;  2R7X A;  5DS7 A;  1RAB B;  3FC9 A;  3FEY B;  3GCX P;  4RLE A;  1JWW A;  3P5B P;  4EU0 A;  3MUV P;  2OEM A;  4P7T A;  3EJM A;  2DIV A;  4R0J A;  5D6G A;  3CMQ A;  1FE4 A;  1HHT P;  1CBK A;  4DR7 J;  4ATN A;  2MLX A;  1WKL A;  1GXU A;  2WW8 A;  2Y9H A;  4JI5 F;  3BO2 A;  2DNR A;  5FDL B;  1ZPV A;  5KFU A;  1IUJ A;  2HVZ A;  2VF3 A;  4MJK A;  7FDR A;  4F25 A;  4L76 A;  4B9U A;  4P2F A;  4J9V A;  3SZ2 A;  2XY7 A;  2W9B B;  2EPI A;  4X4N A;  1DQ8 A;  3I5B A;  1RKJ A;  4CRJ A;  4NCA A;  3TZX A;  4K5S A;  4RUA A;  2E5L J;  1UPM B;  4RWW A;  3QFH A;  1Q53 A;  2BXJ A;  2RUS A;  3QT5 A;  4DDF A;  4C11 B;  1B0T A;  3E01 A;  1P9Q C;  4WFA Q;  5H9E K;  2RSQ A;  4CO2 A;  5BXI A;  3G86 A;  2LQ8 A;  2ADB A;  4GRS A;  1NB7 A;  1P1L A;  3MMA A;  4RUH A;  2XWY A;  1DHM A;  1RWU A;  3M05 A;  3KK3 A;  3H0P A;  2HRU A;  3HJV A;  3W8P A;  1SQF A;  1FCA A;  3IN5 A;  4CT9 A;  3QRP A;  5D4O A;  4ZPW R;  1UWB A;  2RIJ A;  1TAQ A;  3SV3 A;  4USI A;  2QMU B;  2F4V J;  1TKZ A;  2QSF A;  4FNH A;  4NLY A;  3RAM A;  4UTG A;  3VWS A;  3QWU A;  4AFF A;  2F8H A;  1IKX B;  1F3F A;  3GFZ A;  5HN0 A;  3RRG A;  5M2R A;  1N88 A;  4DUT A;  3H20 A;  3DRY A;  2GMJ A;  2ADC A;  1LWC B;  5F0U A;  4FBU A;  3T6B A;  3TQ1 A;  1FDN A;  4W4M A;  2GGP B;  4LQ3 A;  2G2Y A;  2VG6 A;  4RX6 A;  2H51 B;  3BH7 B;  3OV7 A;  3CJK B;  4GKJ F;  4DV6 F;  3LQV A;  1DAX A;  1FNO A;  3TVK A;  4LQ9 A;  3Q8P B;  1NKB A;  1N33 J;  1RT3 A;  4J9L A;  1AUS L;  4BC7 A;  2VQF F;  1RLC L;  3CC2 S;  2DH9 A;  4ZVP B;  2AJQ A;  4QW8 A;  4YB7 A;  3THP A;  1PG5 B;  1WG1 A;  1XR6 A;  1LW0 A;  1PKU A;  2IFX A;  4E98 A;  4M5I A;  1X4D A;  3FVY A;  1JJC B;  2RQM A;  2XMA A;  1E6V A;  1SQG A;  2AJF E;  2U2F A;  1BQN A;  5DZ6 A;  5KFP A;  4X4Q A;  4WYL A;  3CPW R;  3NNA A;  3Q2S C;  3OHB A;  1WNE A;  1QUV A;  2MXY A;  3TAN A;  1YGY A;  2DGX A;  3M8Q A;  3ITH A;  2BAB A;  4FVC A;  4C2M A;  2A3J A;  3J80 U;  3OHA A;  2W4D A;  2AGP A;  1RHQ B;  2DRA A;  1RTZ A;  1L3T A;  2CA9 A;  4M94 A;  2V0N A;  1HMV B;  3OR2 B;  2QA1 A;  3CJ3 A;  4ZVT B;  2G2O A;  4FPI A;  1KTV A;  2BW7 A;  2H9Z A;  2IRU A;  3TVY A;  3W61 A;  3OTO J;  3OL9 A;  4DL2 A;  1S12 A;  4TYA A;  1HQ2 A;  2NYI A;  3HHL C;  1RBO B;  2Z2M A;  4DQI A;  1S9G B;  1XMO J;  1VI7 A;  2ZWO A;  2JC1 A;  4LJM A;  3P3D A;  4HLB A;  1L3U A;  1HI1 A;  3N9U C;  4H4K A;  3I56 S;  1YQH A;  2Q79 A;  2ZE2 B;  1L5U A;  1PYT A;  4DUZ J;  2ZZN A;  1FFW B;  5EGY A;  2DKO B;  3H59 A;  5F8H A;  4DR2 F;  4X4U A;  1PIE A;  2RD5 C;  2GW8 A;  1YVF A;  2HZV A;  2ZUG A;  4HAC A;  4ZS6 A;  1VIS A;  1P1T A;  3BSC A;  2IC3 A;  1FKP A;  2YNH A;  3NEK A;  4DFM A;  4CCH A;  4ECY A;  5KFY A;  5J2Q B;  2BR0 A;  5EHH A;  1Q7Y T;  3Q83 A;  5HMZ A;  2ZM6 F;  2VU5 A;  2WW4 A;  5KFX A;  3I31 A;  4HAC B;  5ETV A;  1F3V A;  1URR A;  5F3T A;  3UO0 A;  3GIJ A;  1HAR A;  4DX7 A;  1KTQ A;  2C2R A;  2IYG A;  2W25 A;  3GZ7 A;  4FYV B;  4DMZ A;  3JSM A;  2LQ5 A;  1JB0 C;  2ZFH A;  4DR6 J;  1O5J A;  3C66 A;  4DR4 J;  2EFG A;  6AT1 B;  1FO1 A;  4J37 A;  2HW3 A;  4DV2 F;  1WC1 A;  5AJ3 J;  5AJ3 F;  1TKT A;  4KC5 A;  2YWW A;  3CJK A;  2ZH5 A;  4KGX B;  4KO0 B;  3OQ2 A;  2XYH B;  2JLF A;  5GME A;  4HI2 A;  3K59 A;  1U24 A;  2B5J A;  3NLC A;  4ZPT R;  1YBA A;  3DDN A;  1XNR F;  2M3D A;  4X4S A;  1FWL A;  1P9Y A;  5LSR A;  3PHE A;  4ES2 A;  1KVI A;  5KFD A;  3ZNJ 1;  3MXH P;  2R8I A;  4LFB J;  4DR4 F;  3JQM A;  3VGU A;  2CXE A;  4F2R A;  2B56 A;  2DNP A;  3JAM Y;  1HWJ A;  4Z37 A;  4ZLN A;  3VAJ A;  2AX0 A;  2WZ1 A;  2BAN A;  5SZT A;  2DGT A;  4NYZ A;  3W5Y A;  4ZIT A;  3V6H A;  2H4Y B;  1CQN A;  2DR7 A;  4WKR A;  2R7Q A;  1GH8 A;  2JSX A;  3R9L A;  1RJJ A;  1W26 A;  4IH7 A;  1NK9 A;  3QO9 B;  1U1R A;  1X4C A;  4AQY F;  1HMV A;  1RHK B;  2E7W A;  4ES3 A;  2HPU A;  1Z4U A;  2P9C A;  2Z30 B;  4KQZ A;  3S01 A;  3SCK E;  3U1M A;  5IZH A;  3AA9 A;  2RIL A;  3T1H J;  2FLN A;  1CSJ A;  1JQG A;  2MEW A;  2V94 A;  2PT0 A;  2ROP A;  3D0I E;  1EP4 B;  3I96 A;  4Y6I A;  4ZVR B;  1XWL A;  5F9N A;  3HHL B;  4ZVG A;  5IM0 B;  2B9E A;  3M32 B;  4KB7 A;  5LT5 A;  4JI5 J;  4C9D A;  4MK8 A;  4KHR A;  1FF2 A;  1ZM2 A;  2B4P A;  4RO0 A;  2E1P A;  4PYA A;  4EO6 A;  3MUM P;  3T3F A;  1WHW A;  2B51 A;  2WSE C;  2Z2Y B;  2DJW A;  3TUJ C;  3N6L A;  1U6F A;  1U7L A;  2XGP A;  3HPO A;  1ZTT A;  5T7L A;  5HQL A;  2Y1J A;  1N54 B;  1IKX A;  2DRD A;  2CPH A;  2OGU A;  5CYQ A;  2GHP A;  2HRT A;  3FCW A;  1FI4 A;  1AFI A;  4JI2 J;  1R3N A;  4S0M A;  2D9O A;  3U7J A;  3G8T A;  1NK5 A;  1RGV A;  2PE8 A;  4URS A;  2CVE A;  2R7T A;  1I3O B;  1FJC A;  2K1R B;  2PDA A;  2B7C B;  2VHG A;  3SDE A;  2LA6 A;  4NOH A;  3I5A A;  2JX2 A;  2PFD A;  3BYP A;  4Q7A A;  3OVS A;  2VIC A;  4FF3 A;  1ZTW A;  4JI4 F;  2GC8 A;  2R3V A;  3CJ2 A;  5IC6 B;  2CFX A;  3C6U B;  3I4P A;  3IR7 B;  2OML A;  1LW2 A;  4USV A;  3VQS A;  1S0M A;  4ZA1 A;  3BO4 A;  4K5R A;  5KFI A;  4DR6 F;  3D6F B;  1BY9 A;  3TA2 A;  3TA0 A;  2QG9 B;  5HSP A;  4X65 F;  3TX0 A;  4F4K A;  1ULR A;  3HI9 A;  1S1T B;  3R7B B;  4I64 A;  3G96 A;  3QBC A;  4V19 X;  2VOO A;  2ZDP A;  2VV5 A;  3CSK A;  3MPD A;  1PJ5 A;  3HFZ B;  4ZP9 A;  2NYH A;  4ELV A;  1D3W A;  2W9C B;  2J7U A;  2P8I A;  1FK9 A;  2B0G A;  2O66 A;  5KG4 A;  4ZLP A;  2QFI A;  3EDR B;  1W2I A;  3IA0 A;  4AXI A;  4EYH B;  1LWF A;  3J81 j;  4NX9 A;  2KKH A;  4OYI A;  1JJ4 A;  4X2B A;  2J8A A;  1JLE A;  3HVW A;  1KP6 A;  3M1V B;  4UZC A;  5HI7 A;  4ETZ A;  3KLH B;  4AUK A;  3MM5 B;  5GAE U;  1KFS A;  4WCE Q;  1YRX A;  4O3O A;  3THT A;  2DHA A;  2OFG X;  4PYD A;  1XJW B;  2HBR B;  3W5Z A;  1VQM S;  4QJV A;  2EFP A;  2JOQ A;  2J6U A;  3QGG A;  3T19 A;  1WEL A;  1RWN B;  3CJR A;  3Q89 A;  4IFV B;  2FLO A;  2RF2 B;  4NPO A;  5AT1 B;  3GMG A;  4C98 A;  4OX9 F;  4DFK A;  3PO5 A;  1FK9 B;  4DQP A;  3LAL A;  2M2B A;  1RB0 A;  4KTQ A;  1UMJ A;  3I32 A;  5KFG A;  4RKU C;  1VQS A;  5A8W A;  1R7I A;  2OTL S;  1QY7 A;  1TZ0 A;  3DLK B;  1JLB A;  3OTD A;  3QJJ A;  1K1Q A;  3DRP B;  2KT5 A;  3DOK B;  5AE3 A;  4ZIW A;  2MQQ A;  2IMO A;  3CCR S;  1WOS A;  1NME B;  4Q45 A;  2UUA F;  3TEH B;  3KNG A;  2HGL A;  2DHG A;  2VFT A;  5HMW A;  3ICL A;  4NA3 A;  5D0G A;  8ATC B;  4A8K A;  4KSE B;  3AXM A;  3BKF A;  4PG8 A;  2AF6 A;  3H5Y A;  3RB4 A;  1JJ2 R;  1DZ5 A;  3CC4 S;  4G1P A;  1F9F A;  1K47 A;  2MZR A;  2W24 A;  3CNQ P;  4HDG A;  4ECW A;  5DLF A;  2XZT B;  2FJX A;  3L95 X;  4KH1 B;  2MKC A;  2NZC A;  2E44 A;  2OPR A;  3LOU A;  5IT4 A;  2Q1L A;  5DDR C;  3DU6 A;  2W7O A;  2B3T B;  4O3Q A;  1N5Y A;  4ELT A;  2OIH A;  5K14 B;  4HEA 9;  2G1D A;  4ZMM A;  4N76 A;  3MAA B;  4IG3 A;  2ZH9 A;  1OIA A;  2HSE B;  3WC2 A;  1HBU A;  3P6Y C;  3FCH A;  3RBD A;  2QYG A;  2HHT A;  2CDR B;  2UUC J;  3P96 A;  3MF5 A;  1GNK A;  3NGT A;  3MEC A;  4I68 A;  4IYQ A;  2IJF A;  5GAH I;  3NGR A;  4OFZ A;  1T9T A;  4O44 A;  2VIH A;  4EWT A;  4F50 A;  1SCJ B;  2CPD A;  2KHD A;  1V5I B;  3N4W A;  4RW8 B;  1NSQ A;  4AQY J;  1F5B A;  1RT2 B;  2HGM A;  5G0R B;  1ACM B;  2CQC A;  4FN5 A;  4CO5 A;  3JAM U;  4NZ7 A;  4CLL A;  2WRM A;  3D0H E;  6FD1 A;  5FLX U;  3PW2 A;  1QSS A;  2YWH A;  5B0F A;  2BE2 A;  1BQX A;  4U67 Q;  1KQG B;  4BLG A;  1DQA A;  3B4M A;  4P75 A;  1NLK L;  1T3O A;  3TEG A;  4IG0 A;  3BS9 A;  2VDH A;  1S49 A;  3FQK A;  3DDI A;  4PXB A;  2VFR A;  3NS6 A;  1VIO A;  2G9O A;  1KQK A;  3AAW B;  3MEG B;  3CDA A;  1I5O B;  2X1A A;  2W1B A;  3W65 A;  4ERD A;  1HWK A;  5KT4 A;  1B7F A;  1G6B A;  4AYB D;  1JLE B;  1MU2 B;  3O1L A;  3DYA B;  3KLH A;  4TVA B;  2DY1 A;  3RRK A;  4P52 A;  3C6T B;  1NJZ A;  4CNZ A;  5C5J A;  2AKW B;  1FER A;  4XIU A;  1G4C A;  1OWX A;  2O3D A;  3BN4 A;  3DKD A;  5IXU A;  4CLZ A;  3MR5 A;  4ICL A;  1C0T B;  1YRT A;  1HWL A;  4LIR A;  3SQO P;  1RWV B;  3ZZR A;  3HP6 A;  3NWG A;  1GMV A;  2QJ3 A;  3E51 A;  2C1E B;  3D66 A;  4RW4 B;  4YFU A;  4IR1 A;  1DUR A;  2GVZ B;  2LDI A;  4TKT A;  5J2M B;  1SC4 B;  1TR0 A;  2UXC F;  1J5O B;  2B43 A;  3IR5 B;  4KJI A;  2MJU A;  5JMN A;  4DQS A;  5AXK A;  4GO5 X;  2HND A;  2U1A A;  4Y2C A;  2OLW A;  4HVZ A;  4USW A;  5C25 B;  4N5S A;  3MEE A;  2KDO A;  3PR4 A;  3HT3 A;  2DB1 A;  5K20 B;  3MR6 A;  3BGF A;  4CP5 A;  5BYS A;  2I2Y A;  4N41 A;  2CJK A;  3MUT P;  3UCZ P;  1C0T A;  5BYQ A;  1ZET A;  2I1R A;  1IM4 A;  2BW2 A;  3EVO A;  2FB0 A;  2HKE A;  1RTH B;  3A4T A;  4ZJL A;  4DQR A;  2HFZ A;  3OLB A;  1U1K A;  1S6P A;  3CGI A;  2DR6 A;  3UN5 A;  3NMR A;  2W4C A;  1HNX J;  3CTR A;  3IWN C;  4B3M J;  2ATC B;  4MKA A;  4NL5 A;  4UOF A;  3M9O B;  4CQ1 A;  2UXD F;  4CYU A;  2XZW A;  2A1B A;  2BX6 A;  2JLE A;  3JSB A;  1N36 J;  2ASL A;  2CWX A;  3IC1 A;  4ECZ A;  3K17 A;  5E3R A;  5SUH A;  2VOD A;  2QLF B;  3C8Y A;  1KS2 A;  2EWH A;  2RS8 A;  3MCN A;  5C2G A;  5HLF B;  4X4T A;  3MMB B;  1U8S A;  2YKN B;  2EKY A;  1RKI A;  4F7V A;  3D28 A;  3OSN A;  2MMY A;  2AEF A;  1QAI A;  3SSS A;  1IKW A;  1OY9 A;  5CYM B;  4JI8 J;  2DIS A;  2BBE A;  3IWL A;  2L08 A;  3CDW A;  1JLQ A;  3IGV A;  5K9F A;  1WF2 A;  1GX5 A;  3LO3 A;  3AOB A;  3K0J A;  2F65 A;  2OH2 A;  3D0G E;  1X4G A;  2ZUA A;  1HNV A;  4IG0 B;  2XZD B;  4YDD B;  4LIW A;  1NRK A;  1YDL A;  2GAH C;  2ZH3 A;  5ETQ A;  1Q86 T;  2R42 A;  3LP0 B;  4USM A;  1CJT B;  1O6X A;  2Y1L B;  4QYZ J;  3OTE A;  3TW0 A;  4YS2 A;  1T7P A;  2JEG A;  1JLF A;  4PXC A;  4URQ U;  5DGA A;  4O4R A;  4M95 A;  2XS5 A;  4F4Y A;  4PQA A;  2XLK A;  5FJ4 A;  5AXL A;  4LRD A;  4TLQ A;  1VLY A;  2D41 A;  2MGZ A;  5KFA A;  2VQE J;  2HBQ B;  4B08 A;  2D3O 1;  1TL3 B;  4URG A;  1JXV A;  4QU6 A;  1IBM F;  2RT3 A;  4QPT A;  3B4D A;  4OYW A;  4LFC F;  2C2K B;  2E1C A;  1NEE A;  2CNK B;  3C3L A;  1UEK A;  2G0I A;  2LEP A;  4ZN1 A;  3MAA A;  4IG3 B;  3W63 A;  1OYD A;  2XYP B;  3PYG A;  4DCO B;  1KRP A;  4NI2 A;  3TJ8 A;  3MEE B;  5LJ5 Y;  4ZCK A;  4LSL B;  5ITH A;  1IKV A;  2Q6B A;  1DFD A;  3C14 B;  1S99 A;  1CLF A;  1NSP A;  4XPC A;  1SH0 A;  3IBW A;  1NJW A;  1TU0 B;  1FDA A;  3BDE A;  5F8G A;  1RWK B;  1YX2 A;  2DIT A;  1B0V A;  2HS3 A;  5E3A A;  2QEX S;  1Y11 A;  4IR9 A;  4DPW A;  3O3L A;  1SJ4 P;  1YRU A;  1T9V A;  1JK9 B;  3L3C A;  2OTJ S;  3AOA A;  2R7V A;  1XK8 A;  4LF6 J;  3M6X A;  2N7Y A;  3C15 A;  5GAE I;  2OPP B;  4JP8 A;  4L73 A;  5DQH A;  4A46 A;  1R89 A;  1FX2 A;  3LPY A;  1S0V A;  1FJE B;  1CJK B;  3PNI A;  3PZP A;  2J5A A;  2NPI A;  1K44 A;  2C3P A;  2PGC A;  4M5D A;  4WFN Q;  4FS2 A;  2IA6 A;  1N33 F;  4HT7 A;  4DZ6 A;  2QSW A;  4LSL A;  4AE5 A;  5ETP A;  5L9N A;  2GZO A;  3N6M A;  2W2M P;  4PXD A;  2CPX A;  2RS2 A;  1U2C A;  5AXN A;  4ZCL A;  4WP3 A;  3WBZ A;  2OSQ A;  1Y3J A;  2QYC A;  2ROG A;  3ZZZ A;  2NR0 A;  3MPY A;  3MR3 A;  4BWJ A;  1U09 A;  4ITS A;  2EC0 A;  4JYA J;  2IM1 A;  4IDK B;  4DS4 A;  5KFB A;  4DUY J;  1FNX H;  2UUC F;  1MWY A;  2BJD A;  4GC7 A;  5HQ8 A;  1TUW A;  1Q1K A;  1TV6 A;  1ZOT A;  1EIY B;  1X7V A;  4NLV A;  1J5E F;  4PWD B;  6FDR A;  4ED4 A;  2HHW A;  3QNW B;  1RZM A;  3LP0 A;  4Z7Y A;  1RBA A;  1FKA F;  3FRY A;  2FZC B;  2HNY B;  8RUC A;  2XY6 A;  2GAG C;  5HBM B;  4CH7 A;  3CCW A;  2LYV A;  4CO3 A;  4G65 A;  5CD4 A;  3W62 A;  1D9D A;  1JKH A;  4O3R A;  1IKV B;  2FVP A;  4CZC A;  4ZPB A;  4USU A;  2BJ1 A;  3VR1 A;  1R43 A;  1RHR B;  1R0B G;  1LNQ A;  4JI2 F;  4FYX B;  2YQ0 A;  1H6K X;  2JH3 A;  2GHV C;  1JKH B;  1F6T A;  2M7S A;  3PRD A;  4OX7 A;  3TZY A;  3FSI A;  3EVM A;  3RBZ A;  4DQQ A;  1XR5 A;  1AFJ A;  1GMW D;  5KTQ A;  4RNN A;  1TFY A;  1PYS B;  4NRT A;  1S79 A;  3PJW A;  2C2O B;  3O6Q A;  4H4K C;  4MTP A;  3MED A;  1KOH A;  4DF4 A;  1LV5 A;  3M32 A;  4MYT A;  2V9W A;  4C8M A;  1N8R T;  1X60 A;  3O2I A;  4Q44 A;  3BZQ A;  3PDN A;  4P71 A;  1TMM A;  2DNQ A;  2EG2 A;  3N5F A;  5J1E A;  3A12 A;  4ZLL A;  3HF5 A;  3DFE A;  3MUR P;  1RIS A;  4DL3 A;  4JI7 F;  1N0U A;  5CYQ B;  4I56 A;  3NRB A;  1FNM A;  3OUY A;  1NDL A;  3LA0 A;  5I3P A;  3DLL Q;  4DR1 F;  1RSC A;  3DGP A;  4NRU A;  3NGS A;  2QFJ A;  1T3N A;  4NXM J;  2OPS A;  2D3O R;  3EVW A;  1TL5 A;  2M9K A;  2ZHO A;  3KMQ A;  1RAH B;  1XMB A;  2FPH X;  1VBX A;  3I9Z A;  4IOB A;  4WFX A;  1M90 T;  3E2E A;  5A76 A;  1VQ8 S;  2I0X A;  1TEL A;  2HWT A;  2OO4 A;  3JS9 A;  2H65 B;  4IH6 A;  2GQ2 A;  3QID A;  5CYJ A;  1ZYQ A;  4LFA J;  4NCG A;  3U1L A;  2E5J A;  2YKM B;  3CW2 C;  5E5N A;  3BGL A;  4O0I A;  4Q8E A;  4QR0 A;  4QZV B;  4ED0 A;  5I42 A;  2ZD1 B;  5I3U B;  4MKY A;  2J9D E;  4PCQ A;  1RE1 B;  5ETM A;  3NS7 B;  2AEJ A;  3RB0 A;  1X4H A;  1UA1 A;  5KFE A;  1HQE B;  3NOG A;  3KG0 A;  2Q3P A;  2IAJ A;  4M8L A;  4NYP A;  3FGV A;  4YQW A;  2WOM B;  3SQG A;  1T03 B;  5F8M A;  4OZ3 A;  5JVG Q;  1B99 A;  2LXF A;  2NSC A;  2RQK A;  2WSF C;  2F9D A;  1WHX A;  2X51 A;  3CJT A;  3DI6 A;  2I5J A;  3NCQ A;  4OJG A;  4CLY A;  4UW2 A;  4NLG A;  4DSF A;  2VFS A;  5BR8 J;  1KSP A;  3GV8 B;  2VPY B;  4XK8 C;  4K0K J;  1R6V A;  2AEM A;  1HI8 A;  4YOE A;  3Q8V A;  4FXW A;  3GFH A;  3GR1 A;  3IGN A;  2B5J B;  1MRO A;  2L9D A;  1RAF B;  2O1P A;  1RT6 B;  2QL7 B;  1RT7 B;  2KVQ E;  3MM9 A;  3UFC X;  3SMZ A;  4TU9 A;  2OFH X;  4DPY A;  3OW2 R;  4ECV A;  4I2P A;  1O8B A;  1UJ5 A;  3K57 A;  1SJF A;  4PUO A;  1MN7 A;  1X4E A;  2E7V A;  3M8Z A;  5U47 A;  4EGL A;  4TQS A;  2C2N A;  2RKI A;  3BBF A;  2GJ2 A;  1KQF B;  3RW7 A;  3NL0 A;  3GSI A;  1NUE A;  2E5L F;  1RT1 B;  3KG1 A;  5GMD A;  4I2P B;  5EWE A;  2F3J A;  4AXJ A;  5KG0 A;  2M70 A;  4DV4 F;  4P10 A;  4IOC Q;  1WEX A;  1YZ7 A;  2IDE A;  2ASD A;  3EXC X;  1IKY A;  4LRB A;  1REV A;  4QIW D;  4ZP7 A;  4UY8 T;  4OYB A;  2GJF A;  4TXS A;  2IC3 B;  4C3L A;  5E33 A;  4DPT A;  1S9F A;  1X4F A;  2YH0 A;  1GQE A;  2FLL A;  3CCL S;  2CUY A;  3BGU A;  4JI8 F;  3S6E A;  5DDQ C;  1FJG J;  2FHK A;  1SV5 A;  1N48 A;  2M0G B;  3Q24 A;  4EZ6 A;  3QJP A;  1LWE A;  2KRR A;  2E9T A;  1VGY A;  4CT8 A;  5J2P A;  2C28 A;  3R6L B;  2DNG A;  1FKP B;  2YNH B;  4F3M A;  1S72 S;  4IRC A;  2DEI A;  1IM6 A;  2AJ4 A;  1NSK L;  1ZM4 A;  2MQL A;  5LMN J;  4MH8 A;  2DPJ A;  3HXM A;  4NCG B;  3BKU A;  2V34 A;  3POT B;  4WKY A;  1JXL A;  3A8K A;  3OR2 A;  5HP1 B;  2YKO A;  1RBL A;  1Q78 A;  1IWG A;  2I5J B;  5H9F J;  1TL4 A;  2WVF A;  2YWG A;  3FRZ A;  4W92 B;  2QN6 B;  2J9D A;  2HRY A;  1PO6 A;  1D9F A;  2G1H A;  1FRI A;  5FII A;  3H5X A;  2RQ4 A;  4B9S A;  3N01 A;  3J7Z 5;  3M6V A;  1U1P A;  1HQU B;  1ICE B;  3LWM A;  2UU9 J;  2YVS A;  3FBE A;  4DUY F;  1X0F A;  3RB3 A;  2GCF A;  3OFE A;  5HK4 A;  1RHM B;  1T03 A;  1RTD A;  1KLM B;  1VRU B;  1MSW D;  2RRA A;  2EBG A;  3LAK A;  2KFZ A;  2ZH4 A;  2YH1 A;  3I82 A;  3QWP A;  4I69 A;  4KGK A;  4QIV A;  4ZJO A;  2F4V F;  4JI0 F;  4WFB Q;  3VV2 B;  1D09 B;  2LDY A;  1JMT A;  2CAD A;  3QSY B;  2V8G A;  3ZZY A;  5KFZ A;  3OR1 A;  2IJN A;  4MMO A;  2DNN A;  1LW0 B;  4WJB A;  1Q82 T;  4J91 A;  1BQM B;  4LSN B;  3J7Y U;  3UQS A;  1CEZ A;  2ACM A;  3ZTQ A;  1SJ3 P;  2JEJ A;  3H42 A;  1YBU A;  1IJE B;  5LXY A;  1NDC A;  1R8H A;  2HUR A;  3CJ8 A;  4DN0 A;  1H2U X;  1LEO A;  1SIW B;  1Y9O A;  3GII A;  1RHJ B;  3BQ0 A;  1SJ1 A;  1QE1 A;  4Y0F A;  1VBK A;  1M5S A;  1FRH A;  1S6Q A;  1HHQ A;  5AE1 A;  3KJN B;  5IWA J;  2IDL A;  3AXK A;  3CIM A;  4A8X A;  5RUB A;  1TAU A;  2K1R A;  1QE1 B;  1PBA A;  1WKJ A;  3EWG A;  4E8U A;  4HYK A;  2W2Q P;  2UXC J;  2ZOM A;  1JLF B;  4ILR A;  3A8I A;  4ED7 A;  3W8G A;  3BF4 A;  3HFK A;  3G8S A;  4OIX A;  2AJ1 A;  4IFY B;  1DY3 A;  2OD6 A;  1Y5N B;  3KFW X;  2DBB A;  2R8J A;  1NZ8 A;  3MGJ A;  2CQ0 A;  2OD4 A;  4IDK A;  4DEZ A;  1I94 F;  1FRL A;  2XNQ A;  1TKD A;  3POT A;  4DR5 J;  2R8K A;  5IS2 A;  3GV5 B;  3K5O A;  1WTF A;  2L9W A;  3M8P B;  3PKM A;  1GTE A;  2MST A;  3ENQ A;  3JTO A;  2CZ4 A;  1EHW A;  2CG8 A;  4DOZ A;  5JJB A;  4ED1 A;  1YJU A;  5G4D A;  3UNG C;  2VON A;  5E3Q A;  4B02 A;  4I7F B;  1RDR A;  4RW6 B;  3KMS A;  1L3V A;  2F63 A;  1VC0 A;  3MMB A;  3UR3 C;  2XYG B;  4FKY A;  4WE1 B;  3TUZ C;  3FFI A;  3SYZ A;  5HVF A;  3EMT A;  1OSC A;  1NK7 A;  3HZG A;  1WDT A;  2BJ9 A;  3MM7 A;  1Q5V A;  2QLB B;  4HHJ A;  1X9M A;  2DVI A;  2J9C A;  1RWO B;  2DGW A;  4LF1 A;  4WIQ A;  5CAB A;  2KB2 A;  4DSK A;  1EET B;  1OQ6 A;  2CRL A;  4WWS A;  3QZ8 A;  1SL2 A;  4CTA B;  1VBZ A;  5CXT A;  2WON B;  1S6P B;  3DHX A;  3MCS A;  5D4L A;  2E66 A;  4XDC A;  4RUB A;  4DR3 F;  4Q0B B;  4NLW A;  4WU2 A;  1ZAX A;  3PW5 A;  1GAO A;  2AJ0 A;  3ILL A;  1EET A;  2CJQ A;  5L8R C;  2N82 B;  4C97 A;  3BPD A;  5HMX A;  4DV7 F;  3HHL D;  3W66 A;  1XNR J;  2NSB A;  5LMN F;  1UZD A;  1XTZ A;  5B7W A;  4OV1 A;  4FKX A;  4I2Q B;  5IM0 A;  3KOA A;  3PIP Q;  3O8W A;  5B09 A;  1S10 A;  1TL3 A;  1YK9 A;  1XMO F;  3AHP A;  3TA1 A;  2YX4 A;  1HLW A;  5KFV A;  4EFA C;  1H73 A;  1L3S A;  5LSL A;  3X1L B;  3GYX B;  2R8G A;  3GJT B;  1L3K A;  2HNZ A;  4A8W A;  2HVH A;  1D9A A;  2R2T A;  3PTW A;  3MMJ A;  3VGV A;  4LFC J;  3LP1 B;  4C0H A;  5J2Q A;  1FEH A;  2YKN A;  3IMQ J;  2MY7 A;  1FRJ A;  1HNV B;  2JNJ A;  1RCX B;  5B0G A;  2IYI A;  4USH A;  3PFE A;  2OJ3 A;  4FS1 A;  3CJ4 A;  3V81 A;  1YKW A;  3H40 A;  3ISN C;  1S9E B;  2NRE A;  1KD1 T;  1DTQ A;  4PWW A;  2KM8 B;  4DX5 A;  4WU3 A;  4YB1 P;  2BE7 D;  3D5M A;  4LRE A;  3HM9 A;  3GYG A;  2FC8 A;  3X3U A;  2MJN A;  1XMQ F;  1HR0 J;  4A48 A;  3NGD A;  1T8E A;  2Z58 B;  4JOU A;  4KO0 A;  4ECT A;  1QUP A;  2V67 A;  3HDS A;  3M7V A;  2JL9 A;  1NCL A;  3IS9 A;  4M5M A;  2LU2 A;  4GVB A;  1YWX A;  2IPO B;  3IBF B;  4KE5 A;  2V69 A;  2YKP A;  1EB0 A;  2GQQ A;  4I67 A;  1S9E A;  1KOO A;  2CJ9 A;  4QOT A;  1RXO B;  1CC7 A;  2EW9 A;  3UE2 A;  2GO8 A;  1DBD A;  1TUV A;  3GIL A;  1X5O A;  3TP2 A;  3U1N A;  2YWK A;  5LOQ A;  1PGZ A;  4NCB A;  3PVX A;  1BQN B;  1HBO B;  3QQC D;  3D1Q A;  1LFW A;  1Q8I A;  2Z57 B;  2B4V A;  3NAH A;  1WC6 A;  3V5R A;  2X1F A;  5DQI A;  2RU3 A;  2EXU A;  4LF7 F;  1CJU A;  5CA5 A;  2X3G A;  2OHD A;  3H7H B;  3C6T A;  3UN3 A;  3KLV A;  4L72 B;  4DX8 H;  1H2V Z;  4UQG A;  1UW4 A;  3EDQ B;  2JVO A;  5E3C A;  2XI3 A;  3SFU A;  2ZD1 A;  3M8R A;  4QYR A;  5I3U A;  2Z2Z A;  3TUP A;  4ECQ A;  2PA3 A;  4NA2 A;  2UXB F;  4DR1 J;  1NHU A;  4KBI A;  3HSJ A;  4CO0 A;  4C8Z A;  1DLO A;  1HHS A;  1UZH A;  3KLE A;  4ALZ A;  3M2U B;  4FBT A;  3HLU A;  3DRS A;  2HIQ A;  5A8W B;  2EI5 A;  2XO6 A;  1VQO S;  3SI8 A;  5EUH A;  2POK A;  1RUS A;  3WDO A;  1Z2L A;  4PXE A;  1TFW A;  1ZZN A;  3OXF A;  3HSZ A;  4HT5 A;  2VFV A;  1NH8 A;  4ID5 A;  2W01 A;  2CQB A;  2LU1 A;  3IS9 B;  1GXL A;  4F0K A;  5IWA F;  4PPZ A;  3BPS P;  3DOM B;  5GAD U;  3K5P A;  5EDW A;  1RA7 A;  1RHU B;  1S76 D;  2W2N P;  3NY0 A;  3RAX A;  1OY8 A;  2MQO A;  3KLI B;  2GV1 A;  4RJV A;  1FXD A;  1FRK A;  2RRN A;  4WP9 A;  4JV0 A;  3CXC R;  2HHH F;  1ZBT A;  5DZ7 A;  3BYR A;  4YB5 A;  2R4F A;  3KXD A;  3SXL A;  3GE9 A;  2LQ9 A;  1UA0 A;  1URN A;  2UUT A;  3UN2 A;  1QVF R;  3TAR A;  1XR7 A;  3L7O A;  3D2W A;  4DJB A;  4K4V A;  4GVL A;  4OI4 A;  1C1C B;  2EEY A;  2PEB A;  3G82 A;  4HL9 A;  5DM6 Q;  1UEU A;  4N47 A;  5LMU F;  3N6N A;  1RT2 A;  3MEG A;  4PPD A;  3CUN A;  3LP2 A;  3VAL A;  3DLE B;  1FRM A;  5HMY A;  3BQ1 A;  3PRB A;  2XHW A;  3CD5 A;  1JXE A;  3E8O A;  3MCO A;  4LF9 F;  1GMW A;  2GX8 A;  3C16 A;  3UD3 P;  1IQT A;  2XB2 D;  1KVJ A;  1VC5 A;  1S1V A;  1K9M T;  1LWC A;  2KXN B;  4FPR A;  2DO0 A;  4LBH A;  2H1Y A;  1S6U A;  3FCV A;  4TN2 A;  4C11 A;  3BJY A;  2H5I B;  2BAC A;  5KFQ A;  4K50 A;  1C4A A;  2MY8 A;  1VRT A;  4RNM A;  3DOK A;  2BMB A;  2MKK A;  4JV1 A;  2C3O A;  1WJ9 A;  3FNN A;  3RGI A;  1C1C A;  1LKZ A;  3G82 B;  5HBM A;  4ECX A;  1U1M A;  1HR0 F;  4DF8 A;  5KFJ A;  3ENW A;  4DL7 A;  1EQM A;  5F0W A;  2DNY A;  1HNW F;  1WWH A;  1WC0 A;  2VB6 A;  3EIC A;  2XEX A;  1FD2 A;  3BSN A;  1FHT A;  4WFZ A;  1E6V B;  2CAJ A;  2MPU A;  1VQ4 S;  1U4B A;  5L1I A;  3UD5 A;  2DH8 A;  4YR2 A;  3PJ9 A;  4ID8 A;  2E9Z A;  3H4D A;  3K5M A;  3W64 A;  2IVM A;  2C3M A;  4YUD A;  1U0H A;  3DNC A;  2ATL A;  4CLS A;  3CUL A;  1V9O A;  1OO0 B;  2UUW A;  2XWX A;  1FDB A;  2F8M A;  5GMK a;  1K1S A;  1MW7 A;  3K8V A;  5GAG I;  4RL1 A;  1YLX A;  4WBF A;  5FD1 A;  2VG6 B;  3D67 A;  3BSO A;  3V6J A;  2VPW B;  2ZBI A;  4XAK A;  1HWU A;  2KO1 A;  2VAS A;  4LSN A;  5K8P A;  4Y65 A;  3T1H F;  3DXB A;  3ENA A;  4DZD A;  1C1B A;  4GC6 A;  4OHZ A;  3T5K A;  3M9M B;  3THV A;  4Y2A A;  2A2D A;  3FZ2 A;  1PC5 A;  1GK8 A;  3W9J A;  1R8C A;  4R8U B;  2HQI A;  3PG9 A;  5J1E B;  3EYZ A;  3MR2 A;  4JI7 J;  3MI7 X;  3CCT A;  5DDP C;  4X62 J;  2CQ2 A;  4ZKA A;  2MZ1 A;  2CPY A;  2FTR A;  1R0C B;  1IBC B;  1XQI A;  1NHK L;  4WTO B;  2RDD A;  2V2V A;  3W2W B;  4BWM A;  4CLU A;  2EFN A;  2HVE A;  2VC0 A;  2DGS A;  3KHH A;  2RQC A;  4ZVE A;  2O67 A;  1QLN A;  4DV6 J;  1T02 A;  2QLW A;  4LRF A;  3OJS A;  3MM5 A;  1HNZ J;  4LF6 F;  1XNQ F;  4GKJ J;  4TNO A;  1DTT A;  3LGH A;  2XMM A;  2LA4 A;  4F02 A;  3EPI A;  2HK2 A;  3JQK A;  2AGO A;  1TK8 A;  1IKW B;  4QCL A;  2M5Y A;  4G1Q A;  2XMU A;  1SKR A;  1VBY A;  4LF9 J;  2VL1 A;  5K8M A;  2ZHB A;  2AD9 A;  1IJF B;  2R9L A;  1OY6 A;  3OTC A;  4HHU A;  3CF5 Q;  3GB0 A;  1SC6 A;  2HNY A;  1FXR A;  3BR8 A;  4I6W A;  1S48 A;  2IHR 1;  2XS2 A;  1XN9 A;  4ZPD A;  3JSY A;  3GQC A;  3UDC A;  2KI2 A;  3CJQ A;  1SV5 B;  1WC4 A;  3BO3 A;  3DRR A;  1Z1Z A;  1PAE X;  3KDN A;  3M8W A;  4HH0 A;  3PY8 A;  2ZWP A;  3O44 A;  2ALZ A;  2BJ7 A;  4U7C A;  1XMQ J;  2CQG A;  4NI2 B;  4ES1 A;  4C8L A;  1NJI T;  1UKU A;  1UTA A;  2LEA A;  4K2J A;  2LP4 A;  1U25 A;  5HAO A;  1C0U B;  1NK0 A;  3Q8S B;  4J9S A;  5C42 A;  4I0W A;  3EX7 B;  3IM8 A;  4ECS A;  1YHQ S;  4OHY A;  2EFO A;  4QWB A;  3SSQ A;  2Y1I A;  3ITH B;  5DG7 A;  4OZ0 A;  2CPE A;  2Y3Y A;  7AT1 B;  2GNK A;  4QWA A;  2AU0 A;  3DM2 B;  2V5H G;  3AY0 A;  1BMQ B;  1FKO A;  1HIY A;  1CJK A;  1LWX A;  2BV3 A;  4P74 A;  3TWZ A;  1S1X B;  3KKF A;  1KVK A;  4OX9 J;  3WIV A;  4Z2X A;  2F8E X;  2N3O A;  2YPY A;  4OZL A;  1REV B;  4O3P A;  1SBR A;  3OPK A;  2QL5 B;  4BDP A;  1TKT B;  4JYA F;  2E5I A;  3HJF A;  2DXF A;  1HBM B;  1O51 A;  3IRX A;  4DV0 F;  4DN9 A;  4DV1 J;  4UUW A;  4ZVF A;  1NK8 A;  5EX3 A;  2LFV A;  2VG5 A;  5HAN A;  4C7Q A;  3FBF A;  2DIU A;  3SQG B;  2F4F A;  1FXL A;  5L9X A;  3BKT A;  1DJ0 A;  4OI1 A;  3R5B A;  3LAM A;  2GVD B;  4MFB B;  3LP1 A;  3NCR A;  4QWE A;  2E5G A;  4B9V A;  1UFK A;  2RE1 A;  2DO4 A;  2HMI B;  2J8S A;  1TKZ B;  1SKW A;  1BXN A;  4YDX A;  1Q8B A;  5D3G A;  4O3N A;  2AGQ A;  1CUL A;  1RWX B;  4EMD A;  4B3O B;  3QGI A;  5CCL A;  3VAF A;  1S0O A;  2ZE2 A;  1RAG B;  5BJR A;  4IOA Q;  5JXS A;  3DI6 B;  4C6A A;  2MLY A;  1ZH5 A;  4PUO B;  1FTR A;  4PQU B;  2CG4 A;  3LAN A;  4OYP A;  1U48 A;  1NO8 A;  3VAH A;  5F8I A;  4KGZ B;  1CQM A;  2K3K A;  3VGT A;  1C0U A;  4U6P A;  4UF4 A;  2FZK B;  2J0W A;  4D3G A;  4YN3 B;  4UT4 A;  2JJ4 D;  1VHI A;  4UQT A;  5GAG U;  1XIQ A;  2YNI B;  1JLA A;  3Q8Q B;  1W2B R;  2R7U A;  3A13 A;  5K14 A;  2AX1 A;  3A3P B;  2UP1 A;  2LVW A;  5HRO A;  1RP5 A;  4YB6 A;  2AYE A;  4PWU A;  2L48 A;  2W7P A;  2OEJ A;  4DSE A;  2B4U A;  1Z2Z A;  2JVR A;  1FWK A;  3EUN A;  3ZC4 A;  1GXT A;  4A47 A;  4QWD A;  3VVU A;  1I94 J;  4TU7 A;  3UR0 A;  4OYO A;  5DLG A;  1HQE A;  2WVC A;  3AD9 C;  2R7O A;  5CZX A;  3JXO A;  5D4N A;  3PW7 A;  2UXB J;  1YSJ A;  2X7I A;  3MPU B;  1VQP S;  4G6V B;  1HNW J;  1H72 C;  1GX6 A;  3D68 A;  1M5P C;  1UVK A;  4K4S A;  3FJ2 A;  4YR3 A;  5KT3 A;  2C42 A;  2QE5 A;  4EBE A;  3CE8 A;  3CO9 A;  2V8V A;  5D0H A;  4CYU B;  3QT8 A;  1JLB B;  1QAJ A;  4X64 F;  2A18 A;  2HWI A;  2OEL A;  4JI6 J;  4ZVH A;  2NS1 B;  3MM9 B;  4KFB A;  3S1T A;  3PO4 A;  4KYZ A;  1CS4 B;  1KON A;  4DL4 A;  4HTJ A;  2AJ2 A;  2AZ3 A;  3DGP B;  1YIJ S;  3I0S B;  3KK1 B;  2MKH A;  2XMJ A;  3DLE A;  2KJV A;  4C3K A;  2A0F B;  3RB6 A;  4GKK F;  3HFV A;  2NXE A;  1ZAV A;  2KM8 C;  3CCU S;  5DJB A;  4F8R A;  3CC7 S;  1FJ7 A;  4RW7 B;  4TU8 A;  1TV6 B;  3H90 A;  3P49 B;  1U47 A;  1Y00 A;  5CQG A;  1E6Y A;  1EAY C;  4DV3 F;  4OLP A;  3I4H X;  2DNO A;  2LQB A;  2G13 A;  5KFF A;  4XO0 A;  3U27 A;  4BCA A;  2OPQ A;  3KK3 B;  4JI0 J;  4V1A k;  5CHC B;  1T95 A;  2R7S A;  1TVR B;  4DR5 F;  5I42 B;  4MIA A;  1PYO B;  1YJR A;  3HVR A;  2OEK A;  2YPZ A;  3IAS 9;  4LF4 F;  1X9W A;  5C24 A;  2KYZ A;  4ZJQ A;  3HKZ D;  5HRO B;  2AIR B;  3CCZ A;  3KLI A;  4UY8 5;  3MCM A;  3T1A A;  4LVO P;  4JV2 A;  2CNN B;  2QMX A;  3KJF B;  1VOM A;  3CWJ A;  3RTV A;  1M5V C;  2KXH A;  2C2E A;  1N34 F;  1EZZ B;  3IR6 B;  2LXU A;  2OPQ B;  3QO9 A;  4ZPA A;  4F4A A;  2XCA A;  4DS5 A;  5F8N A;  1UJ4 A;  2XMW A;  2FJW A;  1QTM A;  3RJM B;  1NSA A;  1NDP A;  2V6A A;  3I87 A;  3MTK A;  3UPF A;  2BAN B;  4DV3 J;  2BEF A;  1KBR A;  3N5B A;  2ZH7 A;  2HFU A;  4P73 A;  5KFN A;  4Y2M A;  2Q66 A;  1MMD A;  1HA1 A;  2CZ9 A;  1P27 B;  2W2O P;  1KWM A;  1Y5I B;  1WSR A;  1KKH A;  1F1B B;  2XSF A;  3PAC A;  4HI1 A;  1C1B B;  1RWP B;  4CNY A;  2CPJ A;  3OLA A;  3CJS A;  1U49 A;  4O44 B;  2P6S A;  2O5D A;  2RHS B;  3VQT A;  3R1L A;  3HX9 A;  2N4C A;  1U1Q A;  3MMC B;  2BZ2 A;  5KT2 A;  3K2Y A;  2QX0 A;  4M5N A;  3ZNU A;  3UCG A;  2RF2 A;  5J2N A;  1JLQ B;  2WK4 A;  1VK8 A;  4DXL A;  5J2P B;  4MKB A;  2PI5 A;  1SKS A;  1NPK A;  1PIL A;  4JI6 F;  2RH3 A;  1U1N A;  3HKW A;  3AOC A;  4NWB A;  1RQ0 A;  3CD0 A;  1VCT A;  5D8H B;  4B9T A;  4K59 A;  1XEZ A;  3QAU A;  4NA1 A;  2L9N A;  2DR5 A;  1A7G E;  4WPA A;  2WB4 A;  2ZBR A;  3CDU A;  2VH7 A;  3B6B A;  2EVZ A;  4Y34 A;  1SL1 A;  3PEH A;  1R0A B;  3A3N B;  2ROE A;  3ADA C;  4CLF A;  5GAD I;  1AW0 A;  4ZP8 A;  3VAI A;  1PSD A;  1SXL A;  2X1B A;  1V6H A;  1QVG R;  2ASJ A;  1GEH A;  3R6G B;  1T11 A;  2DY9 A;  1F2H A;  1LXN A;  1SUQ B;  3DLK A;  1RT5 A;  3IP0 A;  3VF0 B;  4DG1 A;  4K0K F;  4IO9 Q;  2GML A;  1NPP A;  2E5H A;  3ILJ A;  5BR8 F;  2IVY A;  2YQ1 A;  2RAQ A;  4NLS A;  2PO4 A;  1UPP A;  2ZH1 A;  4JI1 F;  1M1G A;  3KLG B;  3P8B B;  1RT6 A;  5ETS A;  5HLF A;  1VQN S;  2KZM A;  2F5G A;  3CVK A;  3BBB A;  4K4W A;  4KH0 B;  3P5T L;  1TKX A;  3F0N A;  3TZZ A;  2KN4 A;  2WVB A;  1RWW B;  3J80 Y;  2CJA A;  3V6K A;  3G8Q A;  1KHW A;  3R5G A;  1NAQ A;  3M8S A;  4BC9 A;  2H3E B;  3OVA A;  3C15 B;  2OMO A;  3VAG A;  2UV8 A;  2I9S A;  2DNK A;  3F56 A;  4MYU A;  3PIO Q;  1Y5L B;  3G2X A;  4NZ0 A;  1S97 A;  4ZPV R;  1JNR B;  1FEE A;  3FKB A;  3M30 A;  4N56 A;  1AB8 A;  1MWZ A;  4DX6 A;  4EO8 A;  1S1X A;  4G3I A;  1RT4 A;  2B9X A;  2J6S A;  1DTT B;  5A2Q Y;  1UVL A;  2YNG B;  1A9N B;  3ULH A;  2Y8W A;  2RU9 A;  3TJ9 A;  3GG0 A;  4RBU A;  1WEZ A;  3ETM A;  2QLX A;  1NPR A;  5DG9 A;  4ZP6 A;  4PAA A;  4R0E A;  4CH1 A;  3H25 A;  3L4B C;  4JBC A;  4ZVS B;  2B9Y A;  2GQC A;  2YKQ A;  5B0A A;  5DQG A;  4X4O A;  1UVM A;  4B3R J;  1S57 A;  1V3R A;  2FGC A;  2W8K A;  2XG8 A;  2HQC A;  4HTI A;  1WD6 A;  2ZJQ Q;  1RLD A;  1VDH A;  3C2P A;  1WOP A;  3HSG A;  4J90 A;  2FJE B;  4NZ6 A;  2V68 A;  3DYA A;  2ILZ A;  1N34 J;  2LQJ A;  4ED2 A;  4DSJ A;  4J9N A;  4F4X A;  2XM3 A;  2PN6 A;  4UOG A;  3UCU P;  1CJV A;  2KJW A;  4H4M B;  3UWT A;  2VZ9 A;  3GV7 B;  2JLG A;  1M5O C;  2J7W A;  5IT9 Y;  5A6P A;  1S1W B;  3IXQ A;  1VJW A;  1WC5 A;  3FFI B;  3HZE A;  3Q8Y A;  5HJY A;  5DG8 A;  3DLG B;  1YIT S;  1WI6 A;  2MZJ A;  3W60 A;  3SV4 A;  5ADZ A;  1UVJ A;  2DNM A;  1OYE A;  1S1U A;  2VOP A;  4OQJ A;  3V4I A;  2W4P A;  3KUH A;  3NAI A;  4WFY A;  2XQC A;  5D0E A;  3PX6 A;  2FC9 A;  4QR2 A;  2KZZ A;  2ZDO A;  1TL1 A;  4P9S A;  2RRB A;  5HAT A;  4K4Z A;  2VG7 A;  2WHO A;  3CME S;  1VC6 A;  2HBY B;  2Q6C A;  4KKO A;  2V4Q A;  4NXM F;  3SCJ E;  4OJ1 A;  3BB5 A;  4P2M A;  2XMT A;  1CJV B;  4H4M A;  5C2C A;  2FVR A;  3D4J A;  1EKR A;  2XSJ B;  3W2V B;  2NUH A;  3T6J A;  2JRS A;  4EEY A;  4AL5 A;  3OVB A;  1K0V A;  3GR0 A;  3MM6 A;  1X0P A;  4OYX A;  1RT1 A;  2GFF A;  5DRK A;  1VLO A;  3TRG A;  3PX4 A;  3DLH A;  3NNC A;  2RDJ A;  2D74 B;  2DD8 S;  3MOJ B;  2FYX A;  3MD3 A;  3WIU A;  4U8V A;  2WBR A;  4FNI A;  1N36 F;  3TAM B;  2QA2 A;  3TQE A;  2DGU A;  3R8Y A;  3RW6 A;  3TO8 A;  1S6Q B;  5JVH Q;  4A8S A;  2HHU A;  2UVR A;  4JI4 J;  1SC1 B;  4J9P A;  4FYY B;  2DNH A;  3MMA B;  2RNE A;  1X8D A;  2VJU A;  1S77 D;  2FGO A;  2HWH A;  3QYY A;  3MOZ A;  2GIR A;  1HI0 P;  2MZT A;  4OZN A;  1Q0N A;  2NQP A;  1LOU A;  3MM6 B;  5H9F K;  3ISN D;  1N0V C;  3EZ5 A;  3CCE S;  1T9Y A;  3V81 B;  3BGR A;  2WCX A;  3TZW A;  4UZB A;  4WYW A;  4Q8F A;  1PC4 A;  4RNH A;  4WK1 A;  2DHH A;  1I1G A;  4ANC A;  2IRY A;  3ZO7 A;  3BBC A;  1B70 B;  1XER A;  1D8Z A;  1FA0 A;  3JB9 k;  3GFY A;  3GP9 A;  4IH5 A;  4QIE A;  2DT9 A;  4K4X A;  3QMQ A;  3H8Y A;  1JLC A;  3D9B A;  4MIW A;  3WX8 A;  2XCP A;  4PWD A;  5IT0 A;  4NXN F;  3IBC B;  1S4E A;  4QPX A;  1ZM3 A;  3PEJ A;  5KAK A;  1ZZF A;  2BJ3 A;  3HCX A;  3M6U A;  4DLG A;  1RAJ A;  4QIG A;  2NPF A;  3M9N B;  4KY3 A;  3TR5 A;  1UVN A;  1S1W A;  4ZOS A;  3NS5 A;  1JLC B;  1MWQ A;  4CLT A;  1HQU A;  3NGU A;  2OUG A;  4CO4 A;  4PRF A;  3NCP A;  3IFE A;  2HGN A;  1I6J A;  2GGP A;  2HQF A;  3AD7 C;  1D1U A;  1M0S A;  3WC0 A;  4ZVO B;  3LGN A;  3E01 B;  4OZ2 A;  3SIP B;  2QC3 A;  2M8H A;  1S5Z A;  4P2S A;  4R8U A;  1QTN B;  1YJT A;  1M5K C;  3R2D J;  1YJ7 A;  1Y4Z B;  3IG1 A;  5EX0 A;  4J9R A;  2CPI A;  2UZA A;  3NMA A;  3EXY A;  3MPV A;  4DCJ B;  1F5C A;  1SH2 A;  1WAC A;  2KXF A;  2YY3 A;  2ZBC A;  4OX6 A;  1X31 C;  3TNV A;  1MNE A;  1C2P A;  3L9Z A;  4EYI B;  4BS2 A;  1QAY A;  5KFT A;  3R1H A;  3FZB A;  2XI2 A;  4M5D B;  4ZK7 M;  2FJB B;  3TAM A;  5DM7 Q;  2VBZ A;  4CO1 A;  3FSX A;  1YI2 S;  4WXW A;  2FJA B;  2ZH6 A; 
#chains in the Genus database with same CATH homology
 4ZVS B;  2CNK B;  4DCO B;  2XYP B;  2H5J B;  1PYO B;  2CDR B;  2QL7 B;  1SC3 B;  1GFW B;  2FQQ B;  1RHU B;  1RWK B;  2XYG B;  2HBZ B;  2Y0B B;  2H4Y B;  2CJY B;  4LSZ B;  3GJS B;  2QLB B;  2CNN B;  3KJF B;  1RWO B;  1RHK B;  2CNL B;  4ZVQ B;  3D6M B;  4ZVR B;  1BMQ B;  3RJM B;  2CJX B;  2HBY B;  2C2M B;  2QL5 B;  1RWP B;  3R6L B;  2CNO B;  1RWV B;  1I3O B;  2C1E B;  3GJT B;  2H51 B;  2H4W B;  3QNW B;  1SC4 B;  2H5I B;  1PAU B;  3R7N B;  1RWM B;  1SC1 B;  5IC6 B;  4ZVP B;  3KJQ B;  3P45 B;  3D6F B;  5K20 B;  2H54 B;  1RWX B;  1QDU B;  1RHR B;  3R7B B;  1ICE B;  4DCP B;  1RHM B;  3D6H B;  3R7S B;  1RHQ B;  3EDR B;  2C2O B;  3R6G B;  4ZVT B;  2P2C B;  3IBF B;  2QLF B;  3IBC B;  4ZVU B;  4JB8 B;  2QLJ B;  2HBR B;  1I51 B;  1RWN B;  1RWW B;  1F9E B;  2DKO B;  1RHJ B;  4ZVO B;  3SIP B;  5IC4 B;  1IBC B;  3R5J B;  1QTN B;  2C2Z B;  2XZD B;  3KJN B;  2H65 B;  1NME B;  3P4U B;  2Y1L B;  3EDQ B;  4DCJ B;  1RE1 B;  2H48 B;  3NS7 B;  3GJQ B;  2HBQ B;  3GJR B;  2XZT B;  2XYH B;  2QL9 B;  2C2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...