1I51B

Crystal structure of caspase-7 complexed with xiap
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of caspase-7 inhibition by XIAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-7 SUBUNIT P20
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1i51B00
3GJSB 1I51B 1RHUB 3R6LB 2H4YB 4ZVUB 1QTNB 4DCOB 3RJMB 2XZDB 2CDRB 1ICEB 2H5JB 3EDQB 2H54B 1RWPB 2XYPB 1RWKB 2C2OB 2C1EB 3R5JB 3EDRB 3GJQB 1RWVB 3KJFB 2CNKB 1BMQB 3P45B 2H5IB 2QLJB 2QLBB 2C2MB 3GJTB 1I3OB 3D6HB 1PAUB 1RHQB 2XYHB 3NS7B 4DCJB 2C2ZB 2HBQB 4ZVRB 2QL7B 3KJNB 3P4UB 4ZVOB 2DKOB 5IC4B 1RHMB 3D6MB 3SIPB 1RWNB 1PYOB 3IBFB 4ZVPB 1RE1B 3R7SB 2HBZB 2QL5B 1RWXB 2CNNB 2H4WB 1RWMB 2CJYB 1SC3B 1IBCB 1RHRB 2CNLB 1RHKB 1QDUB 2H48B 1SC4B 1GFWB 2XZTB 2C2KB 4LSZB 2QL9B 4ZVQB 2H51B 3KJQB 2HBRB 2Y1LB 1NMEB 2HBYB 3GJRB 1F9EB 5K20B 3QNWB 4JB8B 2FQQB 3R7NB 2QLFB 2CNOB 1RWWB 3R7BB 1RWOB 2H65B 3IBCB 1RHJB 5IC6B 4ZVSB 2XYGB 2Y0BB 3R6GB 2P2CB 1SC1B 4DCPB 3D6FB 2CJXB 4ZVTB
chains in the Genus database with same CATH superfamily
4CLFA 4I2PA 1S76D 2CAJA 4Q43A 2E5GA 1QAXA 1S59A 1OQ6A 1G3OA 1RADB 4CRJA 2DJWA 2PI5A 1VJWA 2QRRA 3M8RA 2KZZA 1CJUA 3MEDB 4NZ6A 4ECUA 4USWA 2MKHA 3CUNA 3H98A 4LRBA 4A8FA 4LFCF 4RJVA 3CJRA 3FUYA 2QA1A 5M2UA 2L9DA 1OSDA 3GIKA 4C8ZA 3IO1A 3HHEA 1U0HA 3K5NA 1SV5B 5LMNJ 2DNKA 3L4BC 4GMKA 4MMOA 1WEXA 4X64F 2QA2A 4X65F 2B5JA 3NEKA 2EFGA 3UR0A 4P52A 1KOOA 1SQGA 3V6HA 1T05A 2QLJB 3FBFA 3FCVA 1TMJA 3M7VA 4UOHA 4QU6A 1J5OB 4UF4A 4N56A 1JLFA 2A2DA 3HCXA 3H90A 1Q81T 2NCKL 3DGVA 2QEXS 4B9LA 5GAHU 4BLGA 2L41A 3OTEA 1IXKA 1KBRA 2Y0SD 3GFHA 3TQ1A 2OTLS 3O1LA 4C8MA 3MR2A 2IFXA 4B17A 1WHVA 2HBQB 5DZ7A 5KFPA 1XR5A 1U45A 2J0XA 2Z56B 1WI8A 4Q2LA 3ZZZA 4C2MA 2MJNA 3HHDA 3MM9B 2OPRA 5JMNA 2VDHA 1PBAA 1QE1B 2I5JA 3C6TB 3MFHA 1F3VA 3VAFA 2NQPA 5AXKA 3P4UB 4CLSA 1R27B 1WSRA 3KXDA 3EZ5A 5J2QB 1S1TB 4UY85 4B3SF 4V19X 1PC4A 3JXOA 1WHWA 5E3PA 2LQ8A 1Q0NA 1WOSA 4OV1A 1S7HA 4N41A 2UU9J 1SJ4P 3N0VA 1FRHA 1H3DA 4Q8EA 2VFUA 1U2FA 1FJGJ 4FVCA 3DLHA 1XN9A 1PJ6A 1C0UA 5H9FJ 4RU9A 2EKNA 1VQ9S 1YJWS 3OTBA 3MPDA 2BJEA 1N48A 1WKLA 2EBEA 1ULRA 4JBCA 2FLOA 1UJ5A 2G2YA 1EP4A 2XG8A 1UFLA 4USVA 1ZA2B 3LA0A 4X4RA 4QW9A 5H9EJ 4CLPA 3OVAA 5L1LA 3CDBA 1U7LA 5HAOA 2GVZA 4RW9B 1X4CA 4Z2XA 1PYTA 4H4KA 2XCAA 4AQYJ 2AJQA 1ZAWA 1ZETA 1RBLA 1TELA 3TX8A 1KLNA 1N33J 1TKXA 2E29A 4Y65A 4BC9A 2DR7A 3CDAA 4OQJA 1LWEA 2C2EA 1BQXA 2RH3A 2W25A 2W1BA 2HVEA 2XBPA 4KV8B 1NDCA 4I2QA 3OLAA 1RKIA 2HQGA 1HNIB 4X62F 3TUZC 5E3QA 3THVA 1UVNA 1N5SA 2KI2A 2BACA 1F60B 2W4CA 1TU0B 2WHOA 3W5XA 4ECQA 5EX0A 5JUMA 1APSA 2MHNA 2B4PA 1FEHA 3CD6S 4I56A 5HROB 1U1OA 2Y1LB 5GADU 1S9EA 1NMEB 2HBYB 3VGVA 1SH3A 4HT7A 4TQRA 3CCZA 4BWJA 5HL7Q 1FKOA 2VU5A 1IKYA 2BBEA 4CO3A 4DN0A 1QSYA 2V4JA 3M8WA 1QLNA 2KYZA 4DU7A 1NJIT 1IKVA 1FKPA 5J1EB 1R8BA 1YLXA 2QLXA 1GQEA 3I9V9 2CWXA 3GQCA 4OI2A 1S6PB 2GV1A 2HQFA 1RZMA 4ZA1A 3TJ9A 3LP1B 2BKPA 4O3QA 1RTHB 4NPOA 4Y2CA 2JVOA 4TLRA 2IMWP 3LP0B 1BD6A 5D0RA 2W9CA 2HIYA 3IS9A 1QUVA 3VZHA 2Z2LA 2JH3A 3GJSB 2F4FA 3LP0A 5IFMA 1HNZJ 3EM1A 2AYMA 2EFOA 2BRKA 3CIZA 1TV6B 3RJMB 5JJBA 5KFSA 4PPZA 1S0NA 1I6JA 3G6YA 3I0SB 4UOFA 3MURP 2CJAA 2W2NP 1VQ8S 1KSPA 4JV5J 5AXLA 2MKYA 2J6UA 3D5MA 1WTFA 2OKQA 1RU2A 4BCAA 4YDXA 1NPKA 5IQQA 1P9QC 2FZCB 4ED5A 1FO1A 4OYAA 3RAXA 1FDAA 4HHJA 5CYQA 1B7YB 3ZZ0A 4UTGA 4TY9A 2E5IA 2KT3A 1HHQA 5DGBA 4XIUA 3GIIA 2ADBA 2KFNA 2JVRA 1JNZB 1NHVA 5KG6A 3PYFA 2R7VA 1HIYA 2R8JA 5HBMB 1PJ7A 3CCWA 4QR2A 2DK2A 4CTAB 4LFBF 3G82B 2O5DA 5CCLA 1UAWA 3DOMB 2JLGA 1HNIA 4IQXA 4OI0A 4AL5A 2ZDPA 4ZVRB 2L9WA 2YKOA 3PG9A 2P5VA 1CJTB 3CWJA 3M32B 5DM7Q 2Q3PA 3HVWA 2HHHJ 3TWZA 1TK8A 1TVRA 3DGPB 2LQBA 1YZ6A 2YWEA 2ZOFA 3JTPA 4USMA 2QL7B 2VA2A 4LIWA 3KJNB 2V63A 4K2JA 1BUXA 3VV2B 4OYMA 3RBZA 4DQRA 2ZKTA 2BOPA 2W2MP 2V8PA 2OSRA 2X3GA 1EB0A 3O3LA 1CSJA 2AX1A 1IR1A 4P7VA 5LOQA 5H1SV 2VICA 4Q0BB 3JAMU 1FWPA 3GFZA 1GMWA 3ZFVA 2CQIA 3W8GA 4AXIA 4WTOB 5DQGA 2YNGB 3GG0A 2B0GA 3QQCD 2DTJA 4OMFG 5B7WA 4CLUA 1KFDA 2XLJA 1D8YA 2QA4G 2DNLA 5KFWA 1HPZA 3ET6B 1VQLS 2R8KA 1OY6A 1QAYA 2NYHA 5AXNA 3K17A 2MQQA 9RUBA 4A8MP 2G4BA 2ZNZA 2PDAA 2KFZA 4DS4A 4NA3A 2MY8A 4EU0A 1YK9A 3MMAA 1Q8IA 5B09A 2AF6A 3N5FA 1UETA 5E2QA 3MAQA 1X31C 3UVJA 1SUQB 2EC2A 1Y3JA 4DUYJ 3ILLA 5IV4A 3K5LA 4RNMA 4DR6J 3BKUA 3KUHA 2IYGA 4ZJOA 3C6TA 2YKMB 1IBCB 4FXWA 4YR2A 4DFMA 2C22A 1JJ4A 3CCSS 3KDOA 3IRXA 3MPVA 1WOOA 2CPFA 1PSDA 5DGAA 2FGOA 1WDTA 1N6QB 5GAGI 3EICA 5AJ3J 3IRXB 3NGSA 1SKWA 3DXBA 1Z2ZA 3QAEA 4JI8J 4PPDA 1ZPVA 4LREA 2AEJA 2YKMA 3QAUA 1VBXA 1S6UA 2KXHA 2GS8A 4QIVA 3EPGA 1WC1A 1L3TA 1HA1A 1H98A 2E66A 5B0AA 4CDIA 3DHXA 2RIJA 4ZMMA 3MEEB 1U24A 2FJAB 5EHHA 2CRLA 1PO6A 4ED8A 1DTQB 2D9OA 2ASYA 3O5TB 4ECWA 2H65B 2OI2A 2RHSB 4CH1A 1SIZA 2BABA 1JIHA 2LQ9A 2RJZA 3HHLA 5GADI 2OFHX 1VQ4S 3J81Y 2VFVA 5LMUF 1TFWA 3G8QA 5K8OA 4EK2A 5C25A 3G6VA 2CJBA 2CQ4A 1DQ8A 1TL4A 3W2WA 4K50A 3Q8VA 5HMZA 2LVWA 2VC1A 2RRNA 3AJ2A 1NBEB 3FBBA 2BJDA 3CD0A 3R3TA 3THPA 4CM0A 4JI5F 1AW0A 2VKRA 4FF4A 2CWKA 3LGNA 2ZEJA 3CO0P 2PEHA 1RAGB 1KOHA 1Z4UA 2FJEB 2LQ5A 2CPHA 3M8PA 4I6AA 3RGIA 4DV2J 4DR7J 2N3LA 2DGXA 3RG6A 2Z30B 3EUNA 4XPEA 2ZZMA 3BYRA 2AKWB 3NGUA 3LP2B 3B82A 3DRYA 2ZHOA 2EI5A 3U27A 3W2VA 3UPFA 1WG4A 4IOAQ 2DY1A 5A76A 2QZ8A 3LGHA 5DDRC 1O51A 1VC5A 4FF3A 1RISA 2D69A 1Q53A 4A47A 3GV8B 1S10A 1CQMA 3DRRB 1FNXH 1TQLA 3ILOA 1OYEA 2KKHA 4C3LA 5HBMA 3CSKA 2AP6A 2XLIA 3J7ZT 2ADCA 1RT6B 3BH7B 5L38A 4Q5VA 1RSCA 2CUYA 1VHFA 2M0GB 1YX2A 2Q1LA 2NXNA 2QLBB 1FRKA 3B8HA 3F56A 2EBGA 4PWWA 4QJVA 1FWKA 2K7JA 3OFHA 4EI2A 3KLHA 4DSEA 1FJEB 5HP1B 1JJCB 1RT3A 3M8QA 2J0WA 3SCJE 4ETXA 1IBKJ 3FK4A 3HSGA 2RVJA 1GMVA 1ZM4A 4YP3A 3H4BA 1C2PA 4OYXA 3JSYA 4R5PA 2DB1A 2W7PA 2YX4A 3TI0A 3PO4A 3TP2A 5ETKA 3K5MA 4MH8A 2HRYA 1K1SA 3D0GE 3VF0B 2DGWA 4RW7A 4CLLA 1SJ3P 1FJGF 2YNIB 2FZKB 4IYQA 1ZYQA 3ZXWA 4GKKJ 3IC1A 3KJVB 1ITPA 4OI3A 5MAOA 2N4DA 1YJ9S 1NU4A 1RDRA 5CHCB 3KLEB 4XTTA 3PX0A 4IG3B 1QTMA 3NNHA 3KLIB 3OTOJ 5D4OA 4K4UA 3QLHB 2LDYA 3H8YA 2R8GA 1SJRA 4KO0A 4NWBA 5M2RA 1VJQA 2AJ4A 2ZM6F 3AD7C 4LF9F 4E8UA 4RWWA 3OUYB 3D6MB 5JVHQ 4KJIA 4FYDA 4ZS6A 1C1BA 2J8AA 2XNQA 3TNVA 4CT8A 5ETOA 4DN9A 3MUMP 2G2OA 1GH8A 5CA5A 2UVVA 4DV5J 3O6QA 2GMJA 3ITHA 4ZVPB 2JEFA 3MXHP 4DV0J 2CJKA 2IA6A 3AXKA 2G0IA 3IXQA 3QMQA 4O3OA 5A2QU 3W60A 1FRXA 1S9EB 1MN7A 3KWMA 4MTPA 3TW0A 1HHTP 1ROFA 1J5EF 1JQGA 2W9BA 1M0SA 5IM0B 1AFIA 4JP8A 3T1YF 3DLBA 4F2RA 3EXCX 1RHRB 4JI1J 2OTJS 3CMAS 2WAQD 1OJ4A 2B6AB 3ZZPA 1NK7A 1JLQB 3UD4P 1NO8A 4LF2A 2K8GA 3KMSA 3KLFA 3UD3P 1B0VA 3FRZA 1BXNA 1N5QA 2DNMA 1F9FA 3A8KA 4QIEA 1N36F 5M2PA 2VODA 5ETRA 4NXMF 1N0VC 1TKXB 4ZCIA 4C9DA 1KVJA 1K8AT 1TAUA 5G0RB 4CCHA 4NEYA 3LAKA 2GVDB 1MN9A 2AJFE 2X1BA 4KKOA 4O4GB 4DEZA 3SCIE 2VHGA 2V9WA 2DO0A 5LT5A 2XGQA 4JI0J 1URNA 2R7SA 5FJ4A 4U8YA 1UCNA 4UUWA 5L1IA 4JB8B 3OR1B 3BQ2A 4J9NA 3VTIA 4U9RA 3A8EA 2FHKA 1BWEA 3MDFA 4ANCA 3MF5A 4OYWA 3KG1A 4ALZA 2DIUA 4BS2A 4OHYA 1S9FA 2MHEA 3HDSA 1F0XA 4P9SA 1TKTB 4U7CA 2KTQA 3N4WA 3QIPB 3R6GB 3B4DA 3PKYA 2CPDA 4OYOA 4DCPB 1Y7PA 4F3QA 1LWFB 1HD1A 2AQ4A 4M5KA 4K4ZA 2UXCJ 3AXMA 2E5JA 4MKVA 4D3HA 5J2QA 3HX9A 1ZBTA 4DU8A 3UN3A 2ZD1A 5I3UB 5IWAJ 2J9CA 3A3PB 3KLGA 3MR6A 4C0OC 3R6LB 3HXMA 2PEBA 4JI5J 1QTNB 4H54A 2GVDA 1ZOTA 2XS7A 2XZDB 2HRTA 1RYRA 3ISND 2N7CA 1GK8A 3UNGC 1ICEB 2AU0A 1XNRJ 3PCOB 4PXDA 3S01A 3SQOP 4FYXB 2BANA 2CYYA 1RWPB 3K2YA 5DJBA 2G2ZA 1BHNA 4ZVGA 3AFGA 2XCPA 2H9ZA 1LW2B 3MTKA 1RWVB 2VQFJ 2CDQA 4TKTA 2NXCA 1PJ5A 3Q2SC 3AOCA 3T19A 5IM0A 4CM2A 4N7TA 5GMKa 2HAIA 4Q45A 2XHWA 3SEOA 4YN3B 1R0AA 2WRMA 1HNXF 2RNEA 3SSRA 1IM4A 1G7CB 1PC5A 2DR6A 3TA1A 3HPOA 1KLMB 1TZ0A 3W66A 2ATCB 2I0XA 3M2VA 2F8EX 2ZJRQ 4X2BA 5K9FA 4W92B 1KN6A 4WYWA 4X4NA 4HH1A 1VLOA 1YJ7A 4UUXA 4DR3J 2EK1A 2Z4PA 3M2UB 2ILYA 1JLBB 1X5TA 3E01B 1XMOF 3PX4A 2N4CA 3R9LA 3W65A 4ILMA 1HKAA 2C3MA 4X4QA 8RUCA 1MMNA 3Q8YA 1QM9A 4JI6F 5U47A 2ZH3A 2IJFA 4Z7CA 3Q8PB 2NS1B 1LK5A 4IRCA 1R89A 2HNDB 3IBFB 2FJDB 4M5JA 3BEGB 3V4MA 3HHKA 3PJWA 3D1QA 1Y0HA 4EO6A 2GIFA 4MAKA 2P6TA 4EYHB 1KD1T 5F8NA 1D9AA 1RE1B 1T9XA 1DJ0A 2ROEA 4NI2A 3FEZA 5HP1A 4P2FA 3CJ8A 2YXLA 1XBWA 1CC7A 3HF5A 5KFDA 4DG1B 1RT6A 2V2ZA 4R8UB 4KT0C 3DCAA 1QDUB 2CJQA 2DH7A 4QWAA 1WHXA 3GV5B 5AE3A 2VD3A 4HEA9 3BBFA 2RE1A 5E0OA 3OJSA 2W8KA 2C2KB 2MGZB 1HLWA 2CZ9A 2MLYA 5DZ6A 2LMIA 2R7QA 3MUTP 3OXLA 1TK0A 4WE1B 1JNRB 1KWMA 4LIRA 4RW8A 3SQGB 2VOOA 1Q8KA 1YBUA 1U0SA 3B54A 4ZVFA 3RRHA 4WFZA 3V2UC 4N47A 3OL6A 2PE8A 3W5YA 2F7VA 3KK3A 3RBDA 1NDPA 2DHSA 3RBXA 2RKIB 3UDLA 4NLWA 1VCTA 4FS2A 3TAQA 2QLFB 4EUVA 4JV2A 4YHHF 2CNOB 1RWWB 2EG2A 3MCOA 2B4VA 4KR0B 5DQHA 1PKUA 3QJJA 4PQUA 2F63A 3J81U 4IH7A 3H20A 4J9UE 5L39A 1HQEA 2DNYA 4OYIA 2VBXA 1Y9OA 4M5DA 3K59A 3ADAC 3CCLS 1N8RT 1KEKA 2RU3A 2W4PA 2AYGA 3BDPA 1RQ0A 3R1HA 2EKYA 1SC1B 1Q4RA 1NB2A 3M30A 3NKYA 4HKQA 2W9AA 2Z58B 1LNQA 1LWXA 1MWYA 2E7WA 3LANA 3BGRA 4DFJA 4OJ1A 4B9TA 3NAHA 4B3MF 1VMBA 3ZZYA 1S1XB 1IWAA 3T3FA 3T5HA 3J7A1 3ZO7A 1UVMA 1UWBB 3X1LB 4DCOB 1GEHA 2D3ZA 1H72C 2V6AA 4LQ3A 4JYAJ 4K7QA 1HQUB 5A6WA 4CH0S 1UEKA 4WP9A 2KYXA 2WVCA 1EHWA 1U6FA 2V34A 3MAAB 5KG2A 3PR5B 1OS5A 1TL5A 3KYLA 2AYBA 3W63A 4ANDA 3TZXA 1IM6A 3VHQA 2P9GA 1JLAB 2XMJA 2ZHAA 1WEYA 2EK6A 2KN4A 2ZOMA 3GYNA 3MAAA 4DX5A 3R1LA 1AUSL 2DT9A 4TXSA 1JLCB 2M2BA 4Y2AA 2XO7A 3VAMA 3M1VA 2GAGC 2GHWA 1Y5NB 2MYFA 2B56A 1SUQA 2YTCA 2XMUA 4L73A 2CVEA 5L8RC 1VRTA 2GQQA 3UVJB 5HMXA 3CCVS 1S97A 1LWCB 2HZVA 1DURA 1X9WA 4H4OB 1FFGB 5D4PA 4UQGA 4F67A 4GC7A 3G96A 1Q8BA 2WONA 2QYGA 2JL9A 4Y00A 2RQ4A 3Q8QB 1ZM9A 1UP1A 4FYWB 2JC0A 1C4CA 4NL5A 1HPZB 2X51A 3ET6A 1Q86T 1XJWB 1MW7A 3BM7A 3ICLA 1VQKS 2MZSA 1TL3B 4QWCA 4RNHA 2BEFA 4WFAQ 3T1HF 4M5DB 1NSAA 4Q8FA 1VS3A 3JB9k 2FJVA 1S9GA 1FX2A 4O23A 4FNIA 2WVBA 1SB6A 1UL3A 1SVDA 2XY7A 4PRFA 3BV8A 4DUZJ 5F9NA 4LR9A 3N9UC 3I0RB 3AOBA 2CJ9A 2QT7A 2Z2MA 3S1TA 3FJ2A 4ES2A 4DL4A 4B9NA 5KFBA 3BSCA 4DMZA 2P6SA 3DOKA 2APOA 1H73A 4QWDA 2YH1A 1N36J 2WCXA 1HNZF 4KY3A 2IHR1 4FBTA 1NJWA 3CF5Q 1BLUA 2AJ1A 5F41A 3MEKA 4HTIA 3DOMA 1VI7A 1RABB 1BQMB 1D8ZA 1MNEA 1WACA 2P9EA 2RMLA 3T1AA 1FHTA 1QAIA 4FVMA 1F1BB 1WF1A 2CPIA 3GR0A 4RW6B 1IQTA 4B3MJ 2MQMA 4KE5A 3M2RB 1FXDA 3M6VA 2U2FA 1FX4A 2NSBA 5EWEA 1PG5B 4GO7X 4MJKA 2UUAJ 5BYRA 4L74A 4O0IA 5HQMA 1EKRA 1T9TA 1SL1A 3QT6A 2FVQA 1Q8LA 1YRUA 1XMQJ 2WB4A 1KVIA 4AL7A 1JLGB 4KTQA 1DQAA 2UZAA 1K1QA 4L3NA 4X84A 3ULHA 1UA1A 2DHAA 1HBOB 3P8BB 2HNDA 4ZVQB 4WU2A 2GQCA 4A8QA 5IT9Y 2EG1A 3JSRA 3G6XA 1JJ2R 2CADA 1IKXB 2JZ5A 3ZZRA 3QNWB 1AYEA 1P27B 3IS9B 2VZ9A 4YB7A 1M1HA 5GVQA 2DCLA 3M9OB 3KOAA 2UUAF 2LQJA 2BR0A 1Q95G 1B0PA 3AJDA 2BA9A 3R7BB 1DZ5A 1RTHA 5DDQC 4LRFA 5A8WB 4QZVB 1DY3A 2HNYB 3FZ2A 5I42B 1Y10A 4L6V3 1FJ7A 4KQZA 4HACA 4LJMA 1XC9A 3RU0A 3H42A 3CCUS 1S6QA 1A7GE 1U47A 4J9RA 3V81A 3O44A 2VJUA 2PIIA 2HAFA 3UCZP 3C14B 5CYMA 4G1IA 1N54B 3GYXB 4LBIA 4B3OA 1UVIA 2OH2A 3JYTA 4WPAA 2Z2ZA 3DLKB 4ED2A 2F9JA 3IR6B 4ZVUB 1CS4A 3OL9A 1HBMB 5F8JA 1X60A 1JX4A 4B9MA 1FD2A 4KC5A 1UMJA 4OV6A 4P2SA 4OYBA 4TYBA 4P6QA 1NH8A 2NLWA 5KG3A 4DUZF 4LR7A 2FLNA 3ZTPA 3CCMS 1LW2A 2L08A 4YQWA 1JKHA 4IH6A 2UV8G 4L76A 4TN2A 4WCEQ 1ZTTA 2EFQA 1KDNA 2GGPA 1CULB 3DU5A 1VIXA 4RUAA 4F4YA 1CC8A 3IN5A 2CNKB 4ZLPA 4YB1P 1HNWJ 4QYZJ 4C0HA 3Q23A 3PHTA 3GG1A 2KHCA 2JJ4D 4ELTA 3IG1A 5L1KA 1B4SA 5IV3A 4AT1B 3KLGB 3CXCR 2KXFA 1EP4B 3H0PA 4DCJB 1VC6A 2F3JA 4MFBB 1F5AA 3D0HE 4PABA 2XNRA 1RAJA 5MLCV 3AB4B 3DN9A 3FEYB 2IDEA 2IM3A 3N01A 3QSIA 4MFBA 1YJUA 2I6WA 5K8MA 3OLBA 2V94A 4J9KA 2D3OR 2KDOA 3HVAA 1JMTA 5A8KA 2XQCA 2F9DA 2DEIA 3LO3A 3VAJA 3N6NA 5AE1A 1TFYA 3CULA 1FESA 2GX8A 4RPFA 2PO4A 4YB6A 4K0KF 4F02A 4OI4A 1D0EA 1I1GA 1XWLA 2QE5A 1WG5A 2KVIA 2CZVC 3TUJC 4ZPVR 2YX7A 5FDLB 3CJQA 4ZLNA 3VAKA 1EKSA 2KM8B 4K4SA 4WFNQ 1U2CA 3GIJA 1LW0A 4F3MA 3CD5A 3BBCA 4ID5B 4AUKA 2OGUA 3EVOA 1L3VA 1GNKA 1C4AA 4LRCA 3H25A 1CULA 1HBMA 2LYVA 2UUCF 4LF6J 4KIAA 4K4WA 2FYXA 1JKHB 3AJ1A 3IR7B 1J5OA 1JLQA 1SC3B 4MIWA 2WSCC 3JYTB 3LPYA 2HS0A 4RBTA 5HJXA 1PCAA 4KH0B 4NZ7A 4DV6F 4DLGA 1DTTA 1FT8A 3M6XA 1XNRF 2W9BB 1VQ6S 1B99A 2LEPA 3UCGA 4LF1A 5C2CA 5HVHA 3V81B 4DL2A 4L3KA 4MK8A 3PW4A 1R8AA 1HHSA 1CS4B 3B78A 3CJ3A 3L7PA 4B08A 3PEHA 1W26A 4DL3A 3DNCA 3QGIA 2JEJA 1U48A 2E7XA 3A3OB 2R7RA 5CYMB 1M5KC 1RWUA 4DFKA 4J9OA 4OL8A 2LU2A 3S6EA 4DPOA 3T1HJ 5CD4H 3ZTSA 5B0DA 4MK9A 2VV5A 1UA0A 1K0VA 4A8XA 2ZBRA 4GRSA 5D4NA 3UDCA 4JI0F 2KG0A 2UXDJ 3IP0A 4OLPA 2VQEJ 5HK4A 1Q5YA 2GMLA 3W9IA 2XC9A 3JSMB 3KLIA 4RNFA 3TQEA 1UWAA 3IBCB 1QSLA 4NASA 4Z7YA 2D41A 3BSNA 1HWKA 2RRBA 4QBUA 3FFIB 4EYIB 1M5SA 2IBKA 2UV8A 2OPQA 3ILJA 1RAOA 4NLSA 3T41A 2B3TB 5SZTA 2R9LA 4J7CA 2HS4A 1D3WA 2HHVA 1A9NB 2FHMA 4JI4F 1D1UA 3N79A 2CQPA 2Q66A 3FNNA 3I31A 3IAS9 2QN6B 4KB7A 4PXBA 4ZN3A 2JX2A 1G4CA 3OL8A 5EWFA 3RR8A 3NRBA 1RI7A 3VAGA 3M8QB 4LQ9A 3H4DA 2WSEC 4ZPTR 2GJIA 3HKZD 5HANA 3GLJA 1VRQC 3J81j 3Q22A 5JVGQ 4DV1J 2AX0A 1F2GA 3VVUA 4F4XA 4NCAA 4UW2A 1CG2A 2VG6A 4GVLA 3EDQB 4ZVEA 4I6WA 3L3CA 2NR0A 1LEOA 2BJ1A 3I96A 4ECYA 3CO9A 1EIYB 1B0TA 5FIIA 1EAYC 2K3IA 3BGUA 3F44A 4JV5F 3BGLA 3DXSX 2HZCA 3CJKA 1H38A 3EDRB 1NJYA 3DRRA 1N32F 2OSQA 4C8NA 2OIHA 2A18A 2J7KA 2HGLA 2V2KA 4P73A 3LP2A 4J9QA 3W2VB 2OEMA 4A46A 2C2MB 3HM9A 2QMUB 2VBYA 5HI7A 4G3IA 1I3OB 1FA0A 2QSFA 2QO3A 2XYHB 4G1QB 2A3JA 1H2UX 2C2ZB 5ETTA 4QIWD 3GFYA 1VQOS 1FXLA 1DLOA 3DI6B 1W2BR 2FHOB 3H2UB 1QJHA 4LT6A 4N8OA 3MM7B 1S0MA 4H4OA 3MAHA 2WOMB 1X4HA 2MQNA 3NOCA 1MMDA 4M5LA 3SFUA 4U95A 2CQGA 3FRYA 4ED7A 2C3PA 3SFGA 1WWHA 1DTQA 2HWIA 2MSTA 4G65A 1S77D 4PWDB 3CCRS 2UXBF 2CG8A 2NYIA 1DHMA 2E1PA 3C15B 3DLLQ 1FDNA 3TAMB 4EMDA 1IKWB 5E5NA 3EYZA 2XEXA 3R27A 3SIPB 3QBCA 1RAEB 5T14A 1RWNB 3SV4A 3KNAA 4ZHRA 1HL6A 4KFBA 4NYPA 1KTQA 4WYLA 1XMQF 1OY9A 1RT5A 1UKUA 3BF4A 1N34F 3MOZA 3Q86A 1MROA 2VIHA 1JLCA 2DEJA 4E2FB 2JEGA 2CQ3A 3RYLA 4O3SA 4MIAA 3MMCA 2WBRA 3UN5A 2XMTA 2XI2A 5KAKA 3DHWC 4ILLA 4CO1A 3G8TA 4ERDA 2GO8A 3VALA 4USIA 2B4OA 1UWBA 2FDNA 1AT1B 2D74B 2IBOA 4NCGA 1S1XA 5F8IA 4C0BA 2OAUA 4GVBA 4QQBA 1DRZA 1IKWA 4FF1A 3TAMA 4DL5A 4TVAB 2F8MA 3MM5B 4EGLA 3OVBA 4KAIA 2L9NA 3IWNC 3J80Y 2J9DA 1MG7A 2XMWA 3UE2A 4WFYA 2RDDA 2NPIA 3H2VE 3M30B 4HI2A 2CQDA 2OMLA 2Z57B 5GAEI 3T5JA 1OMSA 2A1BA 2WOMA 4NLGA 2DY9A 5B0EA 2J0SD 2RQMA 1G6BA 5KT6A 3MM7A 5DM6Q 1YITS 4JI6J 3DI6A 2BKNA 3QGPA 2M9KA 2QL9B 5F0UA 4YS2A 5KFEA 1NDKA 3GILA 3TUPA 2RKIA 3HFZB 3KJQB 1KR4A 2PT0A 3MPWA 1F9EB 3GPAA 3U1LA 4RUCA 1UW9A 2HURA 4RNNA 2VBZA 1LQ9A 4A8WA 1T95A 4G1PA 5HMYA 3OL7A 3AQOA 3HSZA 2YPZA 2ASLA 2FC9A 3C6UA 3MCNA 4ZCLA 4Q0BA 2FGCA 4QCLA 2UUBJ 3NP5A 4PXEA 4M63A 3US5A 2R7OA 5GMEA 1CJKA 2MGZA 4C8OA 3M6WA 4F2SA 3FEXB 1Q79A 4QR0A 2LCWA 2YWFA 4HR2A 1WI6A 3PZPA 4IR9A 4IFVA 2ZNYA 5KT7A 5L1JA 2D3O1 5T7LA 1NZ8A 2DH9A 2FUG9 2JRSA 3DMJA 3M32A 4NA2A 2VQFF 5J2MA 3RW6A 2E5HA 4BDPA 2GQ2A 4DG1A 4DV6J 1R6YA 3IM8A 3GFXA 3NAIA 5GAHI 5IXUA 3MOJB 5AE2A 4PZVA 3LOUA 2ZH8A 4CTAA 2H4YB 1YIJS 1KHVA 2J9EA 2R42A 2W24A 1YBTA 1EJ7L 2KVQE 3IMQJ 5ETPA 4ETZA 1MWZA 2VJVA 1HR0F 4LF7J 3Q2TC 1G2EA 3IAM9 2H54B 2R3VA 4C97A 4WFXA 1P8GA 4CO2A 4C8LA 3CCTA 3BO3A 1RGVA 2HLTA 4C3MA 3GIRA 1P6TA 1FI4A 4OZ2A 4LF4F 5ADZA 2DHGA 2GMHA 2XWXA 4V1Ak 2IJNA 1T9WA 2PGCA 1SC6A 3EVWA 4NI2B 4LF8F 2HHHF 4LF9J 2DIVA 3UDVA 3A3NB 1BGXT 3PW5A 2DGVA 2XZWA 4IDKB 4FXDA 2E1AA 2YNHB 3QZ8A 3L7UA 3M9MB 4DV4F 1BQNB 2YBVA 2UXCF 3M8ZA 2H1YA 1NEEA 2ACYA 4DPXA 2J6SA 4GKKF 1VLYA 3PACA 5KOXA 2OPPB 3J7AN 1A0OB 5D77A 4OX9J 4C48A 2E1RA 4WZQA 1OPZA 1RTIB 3ISZA 3MPUB 4P71A 4ZPAA 2HNZB 2HPUA 4ZP6A 1UW4A 3UI3A 4YY3F 3DYAA 4CLKA 1S6PA 3AD8C 1IUJA 1S57A 4YHHJ 4HDHA 1TK5A 2CPYA 3FCWA 4N8NA 1RK8A 2RS8A 1FRMA 4RUBA 5EX3A 4ED0A 2DNOA 1V6HA 1KC8T 4KRWA 2W7AA 1U6ZA 3M2VB 2HVHA 1NNDA 4OZLA 4KHRA 1Z2LA 1DTTB 2IIHA 2V4JB 3GP9A 3KFWX 2VFRA 5I3PA 4NZ0A 4Q2MA 3MM6B 3QATA 1RHMB 5BR8F 4O0NA 3POTA 2B4UA 3TZZA 2ZBQA 1U1PA 5CABA 5KG7A 4K4XA 3TYTA 2ZH1A 1N5YA 1NKBA 1TUVA 4N5SA 5KFZA 2XGPA 3R2DJ 1ELOA 3OSPA 1SKSA 5B08A 2E1MC 4YUDA 4ZLJA 2ZUGA 1AZSA 3ZNJ1 4EBEA 1NHUA 1U1QA 1WUUA 1RKJA 4H4MA 2BE7D 4JV0A 2NXJA 3BPDA 2OELA 3T1YJ 1RWXB 1UEUA 2HLUA 4F26A 2O67A 3TVYA 4BBYA 1K73T 5KFLA 1LWEB 2HGMA 1NRKA 1N34J 5HO4A 3RBEA 1WD6A 1PIEA 1EZZB 3AA8A 3CDEA 3U7JA 2DBBA 2POKA 4D3GA 1NK9A 3K7RA 1T8EA 1EETB 4OLOA 1WC0A 1TTHB 3BO2A 1J27A 1KS2A 1H7XA 2JNJA 5CQGA 2QTWA 3R8YA 2CPEA 2MTLA 5IQ6A 4LF5J 4O3RA 4CI0B 4A8KA 2OMOA 1BC6A 2PFFB 3FQKA 1Q1KA 4KGMA 2WK4A 1M5OC 4O3NA 4WZMA 4M5MA 4M94A 3QO9B 4DBQA 1X4GA 3ENWA 5DS7A 2BM1A 3UWTA 5AJ3F 1LXJA 5LSOA 2GAHC 2KRBA 1YJRA 3HHLD 3IG1B 1T02A 3OFGA 1GMUA 2CVIA 1HMVB 3C16B 1SJFA 1RWOB 4ES3A 3NWGA 1S1VB 2V4RA 1NJXA 2JLEA 2ZWOA 3T5LA 3OR1A 2OPSB 2PA3A 1H7WA 2DHXA 4JI2J 5KFXA 4RKUC 4AYBD 2GGPB 1QE1A 2XYGB 1NLKL 1UEVA 3L7OA 2P2CB 3CCES 4LVNP 4LSLB 2N7YA 1EQMA 1DBDA 3D6FB 2HQIA 5HQ8A 3IM9A 5G0RA 4DOZA 3RUBL 2W8LA 1RT2A 1YG0A 4B9UA 1N32J 2GW8A 5IOLA 3ZZUA 4DUTA 3CTRA 1I51B 1N33F 3OXFA 4F0MA 1HYSB 3G87A 3MTJA 3D1HA 3NXZA 2DO4A 3I82A 4KGZB 3K8WA 3KLFB 1HI8A 2C2RA 2VBWA 3DLKA 1JWWA 3W64A 4RU2A 2B6AA 2M70A 2G0CA 4AFFA 1U8SA 3ITHB 4CQ1A 1YJTA 1S49A 3G2XA 3HMJG 4LFAF 2HVDA 2F5GA 1KQGB 5CYQB 4K4VA 2ZJPQ 3WDOA 4WTYA 2C2OB 1FFWB 1VDHA 4P2XA 2B43A 4WBFA 4Y3CA 2MQOA 1VC0A 3NS5A 4NCBA 3ETOA 1YRXA 3D66A 3GB0A 3KJFB 1RCOB 2R7TA 1BMQB 3DYAB 3ZZOA 3OHAA 1IBMJ 5KFOA 1V3SA 2E5LF 4X4OA 5DG8A 1UVJA 2E9ZA 5E3RA 2EPIA 1CJUB 3KK1B 1KKHA 2CQ2A 3KLHB 2XS2A 2MQ8A 4QW8A 3KLEA 2B8PA 4WXOA 1C1BB 1WHYA 3FSXA 2CQ1A 1U2RA 4I2PB 4ZJLA 4NX9A 1ZAVA 4R25A 1AUDA 3MCSA 4KO0B 5LJ3Y 3UD5A 3I87A 2YNHA 4EBDA 3EVMA 3QLHA 1HBOA 4C11B 3BN7A 3GE9A 5ETVA 3R2CJ 2B9EA 1Y5IB 3MZIA 2X1GA 1AROP 3EX7B 1TAQA 4F0KA 1HBNA 4FP9A 4B02A 2DKOB 4RW7B 1MMLA 3N5BA 3WIVA 4I7FB 5KFMA 3VGTA 1HFEL 2DGTA 1WC3A 2DNNA 2G0JA 3DRPB 2C28A 4M5IA 1RAIB 3M2RA 2NZ4A 3R5BA 1TL7A 4LBPA 3PYGA 3NCPA 1JB0C 4X4UA 2Y9HA 2XWYA 3OVSA 1HI1A 4PEOA 5A8RA 3TRGA 2VKZG 1NK8A 4YR0A 1RT3B 2AD9A 4A48A 4ZITA 1UVLA 4P75A 3LW5C 2K2PA 2B9XA 3VQTA 4C3KA 1KQFB 2BE2A 2JHEA 3LTOA 1NK5A 4DUYF 5L9XA 4ZCMA 1K44A 5J2MB 2HBZB 2RU9A 4WU3A 4DXLA 2MXYA 2AZ1A 3LF0A 3MR5A 1I94J 4OZNA 1RLCL 3BJYA 1RWMB 5K14B 3FSYA 3PYEA 3J80U 2RS2A 2OO4A 1FTCA 1L3KA 4NLUA 5DLGA 3FKBA 2UUCJ 2VUGA 1F3FA 4WFBQ 4O4RA 2HHTA 4G6VB 3CD7A 2Y1RI 3W1YC 4DV0F 4ECVA 3IRWP 2I8EA 4WIQA 4DV5F 2DGQA 3M8PB 4DHVA 2RRAA 2MDAA 3OTCA 2J7UA 4AXJA 1N5TA 4DL7A 3DRXA 3P3DA 1KQSR 4ZK7M 3CEDA 1U6BA 3EMTA 1S48A 3DLGB 4OHVA 2Y1IA 1R0BG 2GA7A 4MKAA 1T9VA 1GX6A 3L95X 1XMBA 1M5HA 2BYCA 4J37A 2FY8A 4OIXA 5E3AA 5KFHA 2MLZA 1AB8A 1UPMB 3QT5A 1VRTB 3QWPA 3T5KA 3SBMA 1R31A 2ZVIA 3DFEA 2IRUA 4IO1A 2EFVA 5ETMA 5C42B 2XMKA 4F4ZA 5KT2A 2JOQA 3SYZA 1RB0A 1WSVA 2M3DA 4CIOA 2YKQA 4IG0A 1U1NA 1X9MA 2J5AA 4ZP9A 4OHZA 1SCJB 3ZTOA 4YOEA 3MEEA 1RA6A 1JLAA 1GT8A 2WB1D 3AOAA 4ZVSB 3BQ1A 4NCGB 2HK3A 2RT3A 4IOCQ 2BQUA 2BX6A 1ZPWX 4IH5A 5B0CA 1WNEA 3G86A 3H2LA 1Q78A 4XAKA 2XMAA 3MMCB 3GIMA 4NXMJ 5CCMA 1VOMA 4DQQA 2HW3A 4UZBA 2KO1A 1A6LA 1JXVA 2R7XA 2AT1B 2COLA 1N6QA 2AW0A 1WC4A 2LKZA 4CLYA 2AJ0A 4NXNJ 3OBIA 4OX7A 5DDOC 2MKKA 2UU9F 5D0HA 4B3TF 4F3OA 2L3MA 4DV4J 2G1HA 4DQSA 2NXUA 4PWDA 3BGOP 2P8IA 3DRSB 4J91A 2M7SA 4DSKA 1LFWA 1S72S 4QR1A 6FDRA 3AD9C 1MU2A 2R4FA 1Y5LB 3QRRA 1FVSA 3R5JB 3HFVA 2HK2A 4NLYA 2HFNA 1MLAA 4J9PA 2OJ3A 5KG5A 2BUNA 3MMAB 1HQEB 2RD5C 3RB6A 2QG9B 3P45B 3VGUA 4CLZA 3RAQA 1HWUA 3AY0A 4MKBA 4PQUB 4LFAJ 1W25A 3N6MA 5F9LA 3MECB 3ENVA 3W62A 4TU9A 2XI3A 3DGPA 3MD3A 2PMHA 3RB3A 4WXWA 2IM1A 3D3CJ 5J2NA 1B64A 3OTOF 5HVFA 2HFOA 1QY7A 1CVJA 4CNYA 3VWSA 3H40A 4ZCKA 4ZVHA 4EO8A 3O8WA 3QGGA 1NK6A 4FYYB 4QOTA 3FMWA 3RZAA 2XMMA 1HWJA 3PIPQ 1O5JA 2BVZA 4ZVOB 1X5OA 3CJKB 1TVRB 4OI1A 3NOGA 4OYZA 1WC5A 3V4IA 1RAFB 2KB2A 4HHUA 4ZIVA 3OXGA 4KHMA 4PKDB 1QAJA 2IM0A 1X9SA 1HNXJ 4K5RA 2P9CA 4LFCJ 1F5CA 2XM3A 2LP4A 4F4AA 3D1OA 2DVIA 1XNQJ 3NBPB 1ZH5A 1FE4A 4UOCA 2HRUA 3QYYA 1RA7A 1YDLA 2MKSA 4USKA 2RF2B 1FDDA 3H5YA 1S12A 2MPUA 3AHPA 3N28A 4URGA 2UUWA 2ROGA 3H5UA 2HQ3A 2V8HA 3LWLA 3HHNB 1DARA 1TL7B 3A4TA 2WVEA 1C1CB 3RB4A 3DRPA 2GIQA 4PYDA 4RW4B 2XHCA 2H4WB 1N56A 3IR5B 4ELVA 2CJYB 1B3TA 4ECZA 4KPCA 4OJGA 1GMWD 2CKWA 3TEGA 2W9CB 3PX6A 2AGQA 2CNLB 4P7TA 1AXQA 2J9DE 2OD6A 4FPRA 3BSOA 4IO9Q 2DNPA 2CPJA 2EEYA 3EZUA 3LP1A 2DNQA 3P49B 1TV6A 3K5OA 4ED1A 3M6UA 2HWHA 2IRXA 4JI3F 2WVDA 2KG1A 1FTRA 3C46A 1FNMA 3EWGA 3QFWA 4LSNA 3TVZA 5J1PA 2FIUA 3ENAA 2LFVA 3KK1A 1KLMA 1RUSA 3K89A 5FD1A 4A4JA 1FKOB 3KG0A 4QPXA 1YJNS 4U7UK 3CJ0A 1Y3KA 4RW4A 2C42A 3M4XA 4ED4A 2HKEA 1R0AB 2LXFA 1R6VA 1TUWA 3EGVA 2EVZA 2ZZNA 5J1EA 5F8MA 2D1CA 2YY3A 2YWWA 4IOBA 5CAAA 4DWIA 5K8PA 2WZ1A 2OEJA 1RCXB 4OYPA 1OPIA 1FF2A 4QU7A 2ACMA 4HLBA 4Y6IA 4C7QA 5HJYA 5KT3A 4I2QB 2EWHA 1YRTA 2QFJA 4J9MA 3CC4S 4IRDA 4F4KA 1X5SA 4XDDA 4B9SA 2LDIA 3A12A 3CT9A 2B9WA 2A10A 4ITSA 4Y0FA 3DDIA 4DZDA 3V4IB 4JI4J 1GAOA 4OZ1A 1FK9B 4JI1F 1GX5A 3NGTA 3SCLE 1FXRA 3UN2A 2YQ3A 4FZVA 2W2OP 4LSLA 1JJHA 2AEFA 2G9OA 2G1DA 4LVOP 4PAAA 3BO4A 2ATLA 3BSAA 3HT0A 1ZA1B 1N52B 2GHVC 1VQSA 3ZNUA 3AH6A 2Q79A 2H5JB 3DU6A 1NDLA 3A8JA 5J2NB 2MZQA 2QGFB 5ITHA 1KVKA 3B6BA 3I56S 1J5EJ 4U8VA 1S1VA 3CC7S 2PC6A 2H5EA 1LWFA 1HMVA 2KT5A 3C16A 3PIOQ 2KM8C 2C1EB 4RW9A 1T9UA 4P74A 2VFSA 3IWLA 1TKTA 2DNHA 2OP5A 2VC0A 1NXIA 4ZPWR 5FLXU 3QSYB 4DL6A 2DRDA 1U25A 2HHPA 1CJVB 1R8CA 1VGYA 2ZH2A 4WP3A 3SXLA 5SUHA 4CZCA 2E9RX 2AV5A 2XTJP 5LL6d 3UW1A 2ZJQQ 3C19A 4KGKA 2ERRA 2AWZA 4WKRA 1F2HA 4WKYA 2ZM6J 2I5JB 1GXUA 1FD8A 1P1TA 2J0QD 2OPRB 3UDEA 1IN0A 1EETA 3HKWA 1L3SA 1CEZA 3O2IA 2DNZA 4ECTA 1RLDA 5KG1A 3KK2B 1IR2A 1OO0B 3UO0A 4DLEA 4WF9Q 1S1TA 2CA9A 2ZWPA 1NUEA 2GHPA 4P72A 4KPYA 5HLFA 3NS6A 3AAWB 1IBKF 3OJUA 3M8SA 3Q89A 3NMAA 1WKJA 3MM9A 1FDBA 5AT1B 4U6PA 2ZBIA 3BBBA 2NSCA 1T05B 1QVGR 2FLLA 2UVRA 2DR8A 3HVTA 4RX6A 1NJZA 1H74A 1S79A 3GCXP 3PFEA 3QPIA 5KFGA 3WZ0A 2KHDA 1WELA 4M8LA 1N5YB 1U0HB 3I5AA 5E3CA 4DQIA 2F4VF 4IG0B 1NPRA 1JLFB 2M4MA 2QSWA 5K5MA 5A2QY 3POTB 1J2VA 4USTA 3CW2C 1VBYA 3MM6A 4RZRA 4ECXA 4ECRA 4CNZA 3HHLC 4UOGA 3QZ7A 2HFUA 2R2SA 2BW2A 3W8PA 1H2TZ 2UXBJ 3WC0A 1LFPA 2V68A 2BW7A 1S6QB 3PHEA 3OFFA 3HZEA 4NLQA 1RYSA 2DCUB 3TANA 1CLFA 1TKDA 4X4PA 4CT9A 1L5UA 5KFTA 5E33A 3FCHA 3FVYA 2Q6CA 3BREA 5A8WA 1Y00A 2K7KA 4F25A 5F8GA 2KT2A 3M8YA 4USHA 4I68A 3IBWA 3CPWR 2DPJA 5EDWA 2XLKA 2GJ2A 1KFSA 3TUIC 5K8NA 2IRYA 1SQFA 1FNOA 1E6YB 3TO8A 1Y11A 2K1RA 4O3PA 3R5DA 3J7Z5 4UQTA 3HT3A 4WIIA 2X1AA 4IDKA 5HMWA 1S0VA 1TL1A 1HBUB 1AFJA 3ILIA 5H9FK 3WQPA 5IT4A 3V6DB 4DSJA 2HBRB 3QFHA 1SL2A 3PTWA 4WP8A 2LEBA 1HNVB 2UP1A 4LF5F 3HFKA 3MD1A 5EWGA 8ATCB 4DSIA 3FQLA 2FY1A 1R7IA 3CJ4A 3DOLB 2F65A 2W4DA 1OWXA 3FC9A 4MYUA 4QYRA 4BWMA 5KFUA 2V2QA 4QWEA 2VH7A 1CQNA 4W4MA 5DO2A 1NKCA 1FFSB 1HW8A 2V69A 2C3UA 2KU7A 4RW6A 2BQRA 1E6VA 5I3QA 4CO0A 1SJQA 1U1MA 2BQ3A 3HD2A 4JI2F 2YNFA 3NGRA 4W98A 1NKEA 1BQMA 3H5XA 1T9YA 3D0IE 2LA6A 5KFKA 1PBUA 1SXLA 1NM2A 4I7FA 1C0TB 2IM2A 2WW8A 4OJHA 2ASJA 1RU1A 5KTQA 2M5YA 1M5PC 5D3GB 1O6XA 2VPWB 1UVKA 1S4EA 3I4PA 4DR6F 2BJ9A 4YB5A 5ETQA 1HD0A 4ER8A 2JEIA 1FJCA 2X7IA 4N76A 3I4HX 2NREA 3QWUA 1E6YA 1YJVA 2F1FA 2YKAA 3CB4A 3EZOA 6AT1B 1TMMA 4NMLA 4AQYF 1F9HA 2DXFA 2XYPB 3H7HB 1OSCA 3W2WB 4CYUB 2ZH5A 3NMRA 3VR1A 3ZZTA 5IWAF 3JQMA 2YX1A 3QJPA 4E98A 2E44A 3W3SA 3GJQB 2ZE2A 2ABYA 2QLWA 3DLEB 1KNZA 2BJ3A 3HHLB 5D15A 2HYIB 4TY8A 3OR2A 1KTVA 1VQPS 5C7PA 2UXDF 2BMBA 3PJXA 3NWRA 4W90B 3HZGA 3C66A 2WONB 3OPKA 3U1MA 1S0OA 1X5PA 3NCRA 1R8PA 2GO9A 3D6HB 1PAUB 1RHQB 2SXLA 3NCQA 3I32A 4NEZA 5HSPA 1SJ1A 3VAHA 2HG4A 4P2MA 1VQ5S 3D68A 4FKXA 1IVZA 2HHWA 2ZH9A 3EGZA 3UQSA 5I4MA 3EGNA 3OFEA 4NLXA 2J7WA 3QIDA 2M52A 1U8WA 2EW9A 2PSZA 2W2PP 4Y2MA 3SCKE 2XO6A 2KZMA 4OX8A 3MM5A 3PXGa 2DPIA 2JDJA 4C4WA 1NK4A 5J2PA 3MCMA 5DETA 2PMWA 1JK9B 3Q8SB 4X66F 4DR1J 4FNHA 1MSWD 2HHQA 5F3TA 1X8DA 3GR1A 3HJFA 3J7YI 4RO0A 1UPPA 4B3SJ 2BJ7A 2PA8D 1TUGB 1PGZA 1YVFA 2IC3A 1F5BA 1YBAA 2JLFA 4ICLA 1ZAXA 3WHIA 1HQUA 3ZTQA 4DL0C 5LSRA 1RT5B 3F73A 4EBCA 4FPIA 2CG4A 3PJ9A 3JS9A 4DR2F 1NAQA 3MHYA 3EPIA 4DI6A 7AT1B 2V9KA 4RLEA 3ENQA 3C15A 5KFYA 2KRRA 3BGRB 2MY7A 3P96A 4MIBA 2DXDA 2NUHA 4PG4A 5ETLA 3K57A 1REGX 4I69A 1VQMS 1X0PA 4F4WA 3QO9A 3PRVA 1T03B 4TQSA 2V2VA 4K0KJ 3MEGB 2IPOB 3I6PA 1KHWA 2YNGA 1NCLA 4QIFA 4UT4A 3FSIA 2L48A 1CJVA 3PEJA 1PAEX 4QPTA 1LV5A 3P6YC 1DLOB 2BDPA 1UZDA 4LF8J 4RL1A 3KKFA 2MEWA 2H48B 2VOPA 3R5AA 2VG7A 3PYDA 4G1QA 3TEHB 1X7VA 4XO0A 1PILA 1GFWB 2RSQA 3NG8A 2Y3YA 4KSEB 3FMBA 1NZAA 1W2IA 3KHGA 1SPBP 5F0WA 2CIMA 1RT7A 3SSQA 2E7VA 4DDFA 4URSA 2XB2D 3M9NB 1CJTA 4NOHA 3HO1A 2MMYA 2HFVA 2H51B 1QUPA 3Q8UA 5C24A 3BR9A 3GU0A 4PR6A 4H4MB 5IZHA 3G82A 1AZSB 3QGHA 2RDJA 2XS5A 3UNYA 2YKNA 1FK9A 3TX0A 5C2GA 2W7OA 4CLWA 2BRLA 4X4SA 4DF4A 1Q82T 1L3UA 5E7OB 4WJBA 2H3EB 3G8SA 2DR5A 4P10A 1X4FA 3L9ZA 2WSFC 3LALA 2LLZA 2GJFA 2VG5B 2C3YA 1P1LA 3A13A 1S7IA 4ECSA 3GSDA 2XSJB 7FDRA 2VONA 5GAEU 1IJEB 4O44A 3THTA 3HLUA 1Q16B 4DJBA 4F50A 2ZHBA 2CJXB 3BH6B 1D9FA 1HW9A 1YKWA 4JI7F 2C2DA 1GTEA 3VZIA 4JOUA 2ZFHA 3CMQA 3WX4A 4KYZA 2PMZD 1T7PA 1WDDA 2FTRA 4DR5F 1KRPA 1RTIA 5HQLA 4K4YA 2B7CB 3LQVA 1NSPA 3I9ZA 2M8HA 1RAAB 4ZOSA 4F36A 2GC8A 4LSNB 3T6JA 3SZ2A 2A6MA 4M95A 5LSLA 3QRQA 2ZH4A 1K0TA 2BM0A 5FLXY 3BQ0A 5T41A 4F04B 3JSMA 1BQNA 1FRJA 4J5OA 2YPYA 2FVCA 4LUBA 4F8RA 1K9MT 3HSJA 1JLBA 1KQKA 2YVSA 1X0FA 1SL0A 2R8HA 3D7SB 3D2WA 2H5IB 3I5CA 1SH2A 3V6JA 3JQKA 1CBKA 4IKAA 4PG5A 4R0EA 5KFFA 3HVRA 3SI8A 3TARA 3GCWP 1VFJA 4OZ5A 5D6GA 3TA0A 2IVFB 1RTDB 5B0BA 2FJXA 4RWXA 3WX8A 4C8KA 1REVB 3K58A 2M88A 1S1UA 4DR4J 5RUBA 5J1NA 2B9YA 4O44B 3NNCA 2HIQA 1UTAA 2I1RA 2BXJA 4UZCA 4L75A 4CO5A 5BJRA 3MFIA 2RF2A 2ZDOA 3TZYA 5CH7B 1ZM2A 1HI0P 3BYPA 1Z1ZA 4FDFA 4ZP8A 1FRIA 3KG4A 3NBPA 3VAIA 3PO5A 1P9YA 2I38A 2KJWA 4B3RJ 5KFCA 3V6KA 2Y8WA 1VHIA 5A0YA 4L72B 2Y1JA 4DV3F 4KV8A 1U26A 5GAGU 1M1KT 4LR8A 3DMJB 4C98A 2EC0A 4HVZA 1I94F 2VF3A 3MM8B 1LW0B 3OV7A 4AL6A 1VQNS 4DR3F 3VQSA 4DPUA 4QYZK 1CJKB 2VL1A 3OTDA 3OT9A 2ILZA 4XK8C 2FHJD 5DLFA 3HULA 2R2TA 1XIQA 3C6UB 1IJFB 1WF0A 3MWBA 5E41A 5KFNA 1ZZNA 1YZ7A 4DR2J 4HDGA 4Q7AA 4IR1A 3QT8A 1AA1B 1JXEA 2JC1A 4PCQA 4USJC 4DX8H 2O01C 1DQ9A 5BXIA 3MUVP 1QVFR 3CIMA 1JLEA 1ZZFA 3BGFA 2N82B 1GXLA 3IA0A 3HD1A 2FVPA 1OIAA 4ZN1A 4DFPA 3IWXA 3U02A 3GSIA 4JI7J 2Q6BA 1S1WA 2O1PA 3BKTA 2LEAA 4U96A 2CQHA 3KHHA 2ZH6A 3BZQA 4DPYA 1YHQS 2FVRA 3P5BP 1MU2B 2JFDA 2MZRA 1NPPA 1T03A 1RTJB 4YY3J 1G1XA 2FJWA 3DRSA 4ID8A 3C3LA 2XZTB 4OX9F 3V5RA 5D8HB 4DPTA 4M1KA 1R8HA 4Q44A 4MK7A 2DYAA 4O4GA 4ILRA 4OFZA 4LSZB 4GVBB 4XPCA 1K47A 2D3UA 4DV1F 1VBKA 3CDUA 4R0JA 2EFPA 2KJVA 5F8LA 3QJLA 2DH8A 4FN5A 4ZJQA 5KG0A 3DDKA 2OLWA 3BR8A 4I4BA 3WC2A 2ZBPA 2R2RA 2RILA 4DSFA 3S7RA 3VGSA 3CCQS 1OY8A 2CQCA 4LF4J 4KFBB 1RT4B 1URRA 2RHQB 2Y8YA 2B5JB 4JUZA 4FXVA 5J2PB 2FB0A 2WBMA 3D9BA 3H59A 3WIUA 2BKOA 2DISA 4ES1A 4X4VA 5D78A 4LF6F 1FWLA 2G13A 2XSFA 3K8VA 4KHPJ 4NE9C 3ZC4A 4IRKA 1RAHB 2Q43A 2PD1A 1IWGA 3BB5A 4F7VA 3UFCX 4A8YA 4ZVTB 3LAMA 2MZ1A 4QWBA 3FGVA 3JAMY 2V0NA 3C14A 3Q0AA 3KUEA 4GKJF 2RDIA 2AGPA 1WORA 4Y34A 2IYIA 3F41A 1LOUA 1S6OA 4OHWA 2XY5A 2OEKA 2FZGB 3KNGA 4S0MA 3FZBA 1VRUA 5LXRA 4DQPA 2ZE2B 3DLEA 1RWKB 3IFEA 3JTNA 4IG3A 1T0TV 3OSNA 4HHHA 1YWXA 1FRLA 3MMJA 4WK3A 3U1NA 3KJVA 3LWMA 3JQJA 4CYUA 5L9NA 3BKFA 1IKXA 3FBEA 3ZTRA 1VBZA 4ENOA 2VA3A 3CMES 2J8SA 3KHRA 2X1FA 3MMBA 3D3BJ 2EFNA 2ZC3A 5LJ5Y 1FE0A 1N88A 1HWIA 3NGKA 1WC6A 2V5HG 1MWQA 2D9PA 4I6YA 3PVXA 4R5PB 2ZKUA 2IAJA 4J9SA 4K59A 1JLGA 4X66J 4DR1F 1T94A 3RTVA 1R3NA 2AMCB 3NS7B 4J9VA 3A8IA 4M5HA 3KLVA 2DGSA 4ZPDA 2YQ1A 1XR7A 1SKUB 1EQ0A 1NB7A 1T11A 5DQIA 5LM7E 3W5ZA 2GIRA 4IQMA 4OJ3A 4YMEA 4OZ0A 4DR4F 2OD4A 2C2NA 1HNWF 5CZVA 1UJ6A 2MQPA 2WW4A 3ELHA 1E6VB 4N77A 3KMQA 2V50A 1D9DA 1VISA 4NMXA 3G9CA 4YR3A 4IFYA 4MT1A 2ZZTA 3MMBB 1PYSB 4X62J 2E1CA 4JI3J 1HBNB 2O66A 3FFIA 5DDPC 3EJMA 1HNVA 4NLDA 3TVKA 4DX7A 4NLOA 1VK8A 3MGJA 4ZDNA 4HT5A 3IGNA 5DG7A 4PQAA 1PYOB 5ETNA 1TL1B 5C5JA 5CXTA 2RUGA 5AXMA 2CQBA 1IBLJ 1Q7LB 4NLRA 2F4VJ 2RQKA 6FD1A 5KFJA 3KTQA 1H0HB 2DD8S 3EE3A 2C3OA 4A8OA 5BR8J 3HK2A 3LH2S 4GO5X 2CNNB 3BPSP 2RAQA 5C25B 3NL0A 3CVKA 2YKPA 5A6PA 1HWLA 2CQ0A 1TL3A 4ZIWA 1VRUB 3E8OA 3GMGA 1XMOJ 1BE4A 1WF2A 2DGUA 1O0PA 3PDNA 1FVQA 2DR9A 1QD1A 1XTZA 2MJUA 3AT1B 3Q8RB 2AEMA 3RW7A 2K3KA 2ZITA 1U1LA 1V3ZA 3MI7X 4J90A 4FYVB 4K8RA 4NLVA 1BY9A 3T6BA 4CLTA 1SI9A 2IA0A 4LRAA 2LECA 1RT4A 3OD2A 9ATCB 4DV3J 2BOAA 1ZTWA 5B0FA 3MR3A 2RQCA 2X3DA 1DAXA 3D4JA 4I64A 5HVGA 4CWBA 1HYSA 2HQCA 4DV7F 2KL8A 1I5OB 2FHJA 3GJRB 3ETMA 4AE5A 1V9OA 4ID5A 1U49A 2PI4A 3HVTB 1YI2S 1RT2B 3BS9A 1YGYA 2FQQB 1WJ9A 2MZTA 5ETSA 3CCJS 4K4TA 2HQDA 4UY8T 5KFRA 2GZOA 4NLTA 4ATNA 5FDLA 2Z2YB 5EN1A 3NLCA 1RHJB 5EGYA 2AJ2A 3PY8A 5HLFB 2IY5B 1F6TA 1VQYA 2BJ8A 3GZ7A 2AZ3A 5IC6B 3W7BA 2Y0BB 4HTJA 4Y28C 2OPSA 3FDSA 2MKIA 4DSLA 2K06A 3NY0A 4PG7A 2VFTA 3KK2A 2ZVSA 5GMDA 3SDEA 5KFIA 3R5CA 2CZ4A 1TKZB 2FD2A 1S4FA 5A8KB 1M5VC 4M5GA 2UVUA 2KFYA 3T9NA 1JLEB 1KONA 1RHUB 1UFKA 3Q83A 2IDLA 1RTJA 4YFUA 3JSBA 4LBHA 2A6OA 1SIWB 2OUGA 4I67A 1D09B 4YDDB 4B3TJ 1JXLA 4ZPBA 3K5PA 5KFAA 5KOWA 4GC6A 1S1WB 3AODA 2W01A 3GYGA 3D67A 1OYDA 2ALYB 2V8VA 2ZOGA 4GKJJ 1WTBA 4QIGA 4I0WA 3VVTA 4USUA 4CH7A 2XMVA 3MM8A 4M5NA 4I1TA 2B51A 1IBLF 1UJ4A 2XY6A 4WE1A 3VCDA 1X4DA 1U02A 2HVZA 1TP7A 2W2QP 2V67A 3TJ8A 3Q24A 1SQEA 2E9TA 2DXEA 3X3UA 4DV2F 3RRKA 4MKYA 2DRAA 2JFKA 2MZJA 1RT1B 4TYAA 5KG4A 4DR7F 1NK0A 4NLPA 4R8UA 2HVIA 3D54A 1GTHA 3DM2A 1S5ZA 1IBMF 2E5LJ 3K0JA 5A0YB 2QJ3A 1RTDA 1T3NA 4OZ3A 1CPZA 1LXNA 4B3OB 1BWVA 4TNOA 3W9JA 4TU8A 1N5VA 1WKKA 2CPZA 2EXUA 4OZJA 5D0EA 2J76E 3H5SA 2HMIB 5IC4B 5LMUJ 4E0DA 2DGOA 2HFSA 3QRPA 4DPWA 1S1UB 1REVA 2VPXB 2MKCA 1FEEA 3I0SA 4HACB 3KUGA 3R97A 3CDWA 1HR0J 2LU1A 2HNYA 3P5TL 5G4DA 5I42A 2D7SA 2LA4A 4OI6A 2HNZA 3N6LA 3PFOA 5L46A 4AD6A 2Z0GA 2I9SA 1VK3A 4RBVA 4JYAF 2ROPA 2UVWA 2OPPA 3AQPA 4KH1B 2MB0B 5IS2A 2YQ0A 4NRTA 4LF7F 4URQU 4U7UD 3HSDA 3R7SB 4HL9A 2QL5B 1VR6A 3A1YG 3NNAA 4WWSA 1HARA 1FCAA 3M2UA 4JI8F 2LXIA 2KH9A 4BC7A 2GCFA 2MQLA 3CGIA 1WOPA 2LXUA 2JWNA 2ZC4A 5BYQA 1B70B 4ZP7A 1IKVB 1FKPB 3BDEA 3FBCA 3ONQA 3I55S 1RHKB 2CFXA 2ZBCA 5D4LA 1XR6A 2FJBB 3SMZA 4DZ6A 2HMIA 2XSJA 1X4EA 4J9LA 2V8GA 1IKYB 1SC4B 3G6ES 3M05A 2VG5A 8AT1B 2DNRA 2QIFA 4X4TA 1C1CA 4OHXA 2HHXA 3DDNA 1RBOB 2VPYB 4ELUA 2FPHX 4PYAA 3MR7A 5HROA 1YTYA 1EARA 1UFWA 3DM2B 4KHPF 3OHBA 3GWCA 3EGWB 1N4LA 2UUBF 1RT1A 1Q7YT 4FF2A 2VASA 4YEAA 4EZ6A 1WG1A 1R0CB 2CPXA 2YKNB 1SKRA 3PKMA 5EUHA 5KFVA 3TAPA 4ZPCA 2QMWA 3HP6A 3G71S 3R7NB 1VYAA 1VIOA 2FC8A 2OHDA 5KFQA 1H6KX 1NHKL 3BN4A 4ED6A 2ALZA 5T7LB 4JV1A 2BANB 3DOKB 4KGXB 1B7FA 3PRDA 3W9HA 4IFVB 2HEKA 2HHUA 4LMZA 5D0GA 3J7YU 4PWUA 1RBAA 1NSKL 3CNQP 2BE9B 3I0RA 4DV7J 1M90T 2VG7B 3RB0A 1SH0A 1O8BA 2HFZA 2GVZB 2VDIA 2Z8QA 3AB2B 3E51A 2RUSA 3KDNA 5C24B 4ZKAA 2DNGA 4F0HA 5IT0A 1UZHA 1S9GB 1W7WA 1RT7B 2ZD1B 5I3UA 4C6AA 4V19J 3L09A 2HGNA 3T9ZA 3W61A 2M8DB 4IUFA 3MECA 1IR0A 1C0UB 2NZCA 3LGMA 4NYZA 3TR5A 1QSSA 3QIPA 4K2XA 4C8YA 2HWTA 1RP5A 2CDRB 2B7BB 3TJAA 2V8DA 4HI1A 3AA9A 1U4BA 2NUUG 1TKZA 4DR5J 2YH0A 2MKJA 4U67Q 2FVSA 3RR7A 1LWCA 4OX6A 1ACMB 3SDEB 5KT5A 3OW2R 3G4SS 1FERA 3CJ5A 2ZH7A 3ISNC 4RUHA 5LXYA 1EX8A 3MEGA 3DKDA 4CP5A 3M1VB 5DG9A 4Y2KA 3HJVA 1RXOB 2I2YA 3UCUP 3GTYX 2IC3B 4ICLB 1XNQF 1R43A 3PM9A 3TA2A 2CXEA 4KBIA 2OFGX 4KKOB 3PW2A 5IT9U 4ANEA 3CE8A 4TU7A 1Y4ZB 3PV8A 3GJTB 2QC3A 5HN0A 3D6TB 1V5VA 4RNOA 4WK1A 1LKZA 2YWHA 3SV3A 2MSSA 1GXTA 5JXSA 4HYKA 4BHQA 1MROB 3E3XA 4DF8A 3LUYA 5F8HA 4B9VA 3D28A 3I5BA 3RAMA 2WVFA 1VQ7S 3RRGA 4FBUA 4ZHRB 1IQZA 1SBRA 4B3RF 2R2UA 5F3ZA 3IGVA 1FKAF 3TZWA 2A0FB 2QV6A 1T3OA 1SV5A 1NH7A 2DHHA 2IVYA 4RBUA 1X4AA 2BV3A 1V3RA 3B4MA 2AHOB 1RTZA 3C8YA 4TY8B 5HATA 3SSSA 5C42A 2F40A 2QYCA 4TLQA 4HH0A 3MEDA 2XULA 1X4BA 4NRUA 3CJSA 4XDCA 4PG6A 7FD1A 2QA4S 5H9EK 4LRDA 4Z37A 3C2PA 1ZS6A 1ZM3A 2QFIA 3DLGA 3LPEA 3OUYA 2R8IA 3OR2B 4X65J 4PXCA 2RB7A 2JSXA 4NYOA 3KK3B 4X64J 4DS5A 4EWTA 5LMNF 1U1RA 2J6TA 1RJJA 1OQ3A 2B8QA 2IMOA 4RW8B 3DLJA 1N0UA 4Y2IA 3SQGA 5THWA 2KXNB 2ASDA 2AGOA 2U1AA 2VPZB 3CJTA 2YNIA 5CZXA 2V4QA 1XQIA 3WBZA 1C0TA 2IVMA 1S99A 2GFFA 4K5SA 4FKYA 2BZ2A 4IFYB 4MYTA 2FLPA 4NXNF 3R5GA 1H2VZ 5K14A 2VQEF 1KP6A 1WEZA 2HHSA 1U09A 4FS1A 2PN6A 2YNFB 3F0NA 2GNKA 4KGVB 3PW7A 4DX6A 3PW0A 2HS3A 4H4KC 3GV7B 4PUOA 5CD4A 2QX0A 1TR0A 4NA1A 5D3GA 2VG6B 2O3DA 5BYSA 2BE2B 2R7WA 3CC2S 1NSQA 2N3OA 1XK8A 2HZAA 5B0GA 2NPFA 1HQ2A 1XEZA 4A8SA 3UR3C 3KHLA 1XERA 4ZLLA 2VB6A 4PUOB 1RACB 1DFDA 2NXEA 5A8RB 5K20B 3NGDA 2DRBA 2IAJB 3PNIA 3V6DA 3PR4A 2R7UA 1U1KA 1HBUA 3MPYA 2QMXA 4PG8A 1Q5VA 3HI9A 5KT4A 4EZ9A 3OQ2A 3TOQA 1YSJA 2YWGA 5CYJA 3DOLA 1M1GA 2OPQB 3DC2A 3GONA 4RR5A 5DRKA 2A2CA 2WTFA 2UUTA 1V5IB 3E2EA 2YWKA 3CJ2A 2IJRA 4EFAC 4LFBJ 2F8HA 2DITA 1LK7A 4ED3A 3S8SA 1YQHA 2MLXA 3QT7A 3JTOA 4C11A 4EEYA 2HSEB 4CO4A 2AIRB 2PFDA 2ZUAA 2K1RB 3EXYA 3E01A 2AYEA 3PRBA
chains in the Genus database with same CATH topology
3GJSB 1I51B 1RHUB 3R6LB 2H4YB 4ZVUB 1QTNB 4DCOB 3RJMB 2XZDB 2CDRB 1ICEB 2H5JB 3EDQB 2H54B 1RWPB 2XYPB 1RWKB 2C2OB 2C1EB 3R5JB 3EDRB 3GJQB 1RWVB 3KJFB 2CNKB 1BMQB 3P45B 2H5IB 2QLJB 2QLBB 2C2MB 3GJTB 1I3OB 3D6HB 1PAUB 1RHQB 2XYHB 3NS7B 4DCJB 2C2ZB 2HBQB 4ZVRB 2QL7B 3KJNB 3P4UB 4ZVOB 2DKOB 5IC4B 1RHMB 3D6MB 3SIPB 1RWNB 1PYOB 3IBFB 4ZVPB 1RE1B 3R7SB 2HBZB 2QL5B 1RWXB 2CNNB 2H4WB 1RWMB 2CJYB 1SC3B 1IBCB 1RHRB 2CNLB 1RHKB 1QDUB 2H48B 1SC4B 1GFWB 2XZTB 2C2KB 4LSZB 2QL9B 4ZVQB 2H51B 3KJQB 2HBRB 2Y1LB 1NMEB 2HBYB 3GJRB 1F9EB 5K20B 3QNWB 4JB8B 2FQQB 3R7NB 2QLFB 2CNOB 1RWWB 3R7BB 1RWOB 2H65B 3IBCB 1RHJB 5IC6B 4ZVSB 2XYGB 2Y0BB 3R6GB 2P2CB 1SC1B 4DCPB 3D6FB 2CJXB 4ZVTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJS B;  1I51 B;  1RHU B;  3R6L B;  2H4Y B;  4ZVU B;  1QTN B;  4DCO B;  3RJM B;  2XZD B;  2CDR B;  1ICE B;  2H5J B;  3EDQ B;  2H54 B;  1RWP B;  2XYP B;  1RWK B;  2C2O B;  2C1E B;  3R5J B;  3EDR B;  3GJQ B;  1RWV B;  3KJF B;  2CNK B;  1BMQ B;  3P45 B;  2H5I B;  2QLJ B;  2QLB B;  2C2M B;  3GJT B;  1I3O B;  3D6H B;  1PAU B;  1RHQ B;  2XYH B;  3NS7 B;  4DCJ B;  2C2Z B;  2HBQ B;  4ZVR B;  2QL7 B;  3KJN B;  3P4U B;  4ZVO B;  2DKO B;  5IC4 B;  1RHM B;  3D6M B;  3SIP B;  1RWN B;  1PYO B;  3IBF B;  4ZVP B;  1RE1 B;  3R7S B;  2HBZ B;  2QL5 B;  1RWX B;  2CNN B;  2H4W B;  1RWM B;  2CJY B;  1SC3 B;  1IBC B;  1RHR B;  2CNL B;  1RHK B;  1QDU B;  2H48 B;  1SC4 B;  1GFW B;  2XZT B;  2C2K B;  4LSZ B;  2QL9 B;  4ZVQ B;  2H51 B;  3KJQ B;  2HBR B;  2Y1L B;  1NME B;  2HBY B;  3GJR B;  1F9E B;  5K20 B;  3QNW B;  4JB8 B;  2FQQ B;  3R7N B;  2QLF B;  2CNO B;  1RWW B;  3R7B B;  1RWO B;  2H65 B;  3IBC B;  1RHJ B;  5IC6 B;  4ZVS B;  2XYG B;  2Y0B B;  3R6G B;  2P2C B;  1SC1 B;  4DCP B;  3D6F B;  2CJX B;  4ZVT B; 
#chains in the Genus database with same CATH topology
 4CLF A;  4I2P A;  1S76 D;  2CAJ A;  4Q43 A;  2E5G A;  1QAX A;  1S59 A;  1OQ6 A;  1G3O A;  1RAD B;  4CRJ A;  2DJW A;  2PI5 A;  1VJW A;  2QRR A;  3M8R A;  2KZZ A;  1CJU A;  3MED B;  4NZ6 A;  4ECU A;  4USW A;  2MKH A;  3CUN A;  3H98 A;  4LRB A;  4A8F A;  4LFC F;  4RJV A;  3CJR A;  3FUY A;  2QA1 A;  5M2U A;  2L9D A;  1OSD A;  3GIK A;  4C8Z A;  3IO1 A;  3HHE A;  1U0H A;  3K5N A;  1SV5 B;  5LMN J;  2DNK A;  3L4B C;  4GMK A;  4MMO A;  1WEX A;  4X64 F;  2QA2 A;  4X65 F;  2B5J A;  3NEK A;  2EFG A;  3UR0 A;  4P52 A;  1KOO A;  1SQG A;  3V6H A;  1T05 A;  2QLJ B;  3FBF A;  3FCV A;  1TMJ A;  3M7V A;  4UOH A;  4QU6 A;  1J5O B;  4UF4 A;  4N56 A;  1JLF A;  2A2D A;  3HCX A;  3H90 A;  1Q81 T;  2NCK L;  3DGV A;  2QEX S;  4B9L A;  5GAH U;  4BLG A;  2L41 A;  3OTE A;  1IXK A;  1KBR A;  2Y0S D;  3GFH A;  3TQ1 A;  2OTL S;  3O1L A;  4C8M A;  3MR2 A;  2IFX A;  4B17 A;  1WHV A;  2HBQ B;  5DZ7 A;  5KFP A;  1XR5 A;  1U45 A;  2J0X A;  2Z56 B;  1WI8 A;  4Q2L A;  3ZZZ A;  4C2M A;  2MJN A;  3HHD A;  3MM9 B;  2OPR A;  5JMN A;  2VDH A;  1PBA A;  1QE1 B;  2I5J A;  3C6T B;  3MFH A;  1F3V A;  3VAF A;  2NQP A;  5AXK A;  3P4U B;  4CLS A;  1R27 B;  1WSR A;  3KXD A;  3EZ5 A;  5J2Q B;  1S1T B;  4UY8 5;  4B3S F;  4V19 X;  1PC4 A;  3JXO A;  1WHW A;  5E3P A;  2LQ8 A;  1Q0N A;  1WOS A;  4OV1 A;  1S7H A;  4N41 A;  2UU9 J;  1SJ4 P;  3N0V A;  1FRH A;  1H3D A;  4Q8E A;  2VFU A;  1U2F A;  1FJG J;  4FVC A;  3DLH A;  1XN9 A;  1PJ6 A;  1C0U A;  5H9F J;  4RU9 A;  2EKN A;  1VQ9 S;  1YJW S;  3OTB A;  3MPD A;  2BJE A;  1N48 A;  1WKL A;  2EBE A;  1ULR A;  4JBC A;  2FLO A;  1UJ5 A;  2G2Y A;  1EP4 A;  2XG8 A;  1UFL A;  4USV A;  1ZA2 B;  3LA0 A;  4X4R A;  4QW9 A;  5H9E J;  4CLP A;  3OVA A;  5L1L A;  3CDB A;  1U7L A;  5HAO A;  2GVZ A;  4RW9 B;  1X4C A;  4Z2X A;  1PYT A;  4H4K A;  2XCA A;  4AQY J;  2AJQ A;  1ZAW A;  1ZET A;  1RBL A;  1TEL A;  3TX8 A;  1KLN A;  1N33 J;  1TKX A;  2E29 A;  4Y65 A;  4BC9 A;  2DR7 A;  3CDA A;  4OQJ A;  1LWE A;  2C2E A;  1BQX A;  2RH3 A;  2W25 A;  2W1B A;  2HVE A;  2XBP A;  4KV8 B;  1NDC A;  4I2Q A;  3OLA A;  1RKI A;  2HQG A;  1HNI B;  4X62 F;  3TUZ C;  5E3Q A;  3THV A;  1UVN A;  1N5S A;  2KI2 A;  2BAC A;  1F60 B;  2W4C A;  1TU0 B;  2WHO A;  3W5X A;  4ECQ A;  5EX0 A;  5JUM A;  1APS A;  2MHN A;  2B4P A;  1FEH A;  3CD6 S;  4I56 A;  5HRO B;  1U1O A;  2Y1L B;  5GAD U;  1S9E A;  1NME B;  2HBY B;  3VGV A;  1SH3 A;  4HT7 A;  4TQR A;  3CCZ A;  4BWJ A;  5HL7 Q;  1FKO A;  2VU5 A;  1IKY A;  2BBE A;  4CO3 A;  4DN0 A;  1QSY A;  2V4J A;  3M8W A;  1QLN A;  2KYZ A;  4DU7 A;  1NJI T;  1IKV A;  1FKP A;  5J1E B;  1R8B A;  1YLX A;  2QLX A;  1GQE A;  3I9V 9;  2CWX A;  3GQC A;  4OI2 A;  1S6P B;  2GV1 A;  2HQF A;  1RZM A;  4ZA1 A;  3TJ9 A;  3LP1 B;  2BKP A;  4O3Q A;  1RTH B;  4NPO A;  4Y2C A;  2JVO A;  4TLR A;  2IMW P;  3LP0 B;  1BD6 A;  5D0R A;  2W9C A;  2HIY A;  3IS9 A;  1QUV A;  3VZH A;  2Z2L A;  2JH3 A;  3GJS B;  2F4F A;  3LP0 A;  5IFM A;  1HNZ J;  3EM1 A;  2AYM A;  2EFO A;  2BRK A;  3CIZ A;  1TV6 B;  3RJM B;  5JJB A;  5KFS A;  4PPZ A;  1S0N A;  1I6J A;  3G6Y A;  3I0S B;  4UOF A;  3MUR P;  2CJA A;  2W2N P;  1VQ8 S;  1KSP A;  4JV5 J;  5AXL A;  2MKY A;  2J6U A;  3D5M A;  1WTF A;  2OKQ A;  1RU2 A;  4BCA A;  4YDX A;  1NPK A;  5IQQ A;  1P9Q C;  2FZC B;  4ED5 A;  1FO1 A;  4OYA A;  3RAX A;  1FDA A;  4HHJ A;  5CYQ A;  1B7Y B;  3ZZ0 A;  4UTG A;  4TY9 A;  2E5I A;  2KT3 A;  1HHQ A;  5DGB A;  4XIU A;  3GII A;  2ADB A;  2KFN A;  2JVR A;  1JNZ B;  1NHV A;  5KG6 A;  3PYF A;  2R7V A;  1HIY A;  2R8J A;  5HBM B;  1PJ7 A;  3CCW A;  4QR2 A;  2DK2 A;  4CTA B;  4LFB F;  3G82 B;  2O5D A;  5CCL A;  1UAW A;  3DOM B;  2JLG A;  1HNI A;  4IQX A;  4OI0 A;  4AL5 A;  2ZDP A;  4ZVR B;  2L9W A;  2YKO A;  3PG9 A;  2P5V A;  1CJT B;  3CWJ A;  3M32 B;  5DM7 Q;  2Q3P A;  3HVW A;  2HHH J;  3TWZ A;  1TK8 A;  1TVR A;  3DGP B;  2LQB A;  1YZ6 A;  2YWE A;  2ZOF A;  3JTP A;  4USM A;  2QL7 B;  2VA2 A;  4LIW A;  3KJN B;  2V63 A;  4K2J A;  1BUX A;  3VV2 B;  4OYM A;  3RBZ A;  4DQR A;  2ZKT A;  2BOP A;  2W2M P;  2V8P A;  2OSR A;  2X3G A;  1EB0 A;  3O3L A;  1CSJ A;  2AX1 A;  1IR1 A;  4P7V A;  5LOQ A;  5H1S V;  2VIC A;  4Q0B B;  3JAM U;  1FWP A;  3GFZ A;  1GMW A;  3ZFV A;  2CQI A;  3W8G A;  4AXI A;  4WTO B;  5DQG A;  2YNG B;  3GG0 A;  2B0G A;  3QQC D;  2DTJ A;  4OMF G;  5B7W A;  4CLU A;  1KFD A;  2XLJ A;  1D8Y A;  2QA4 G;  2DNL A;  5KFW A;  1HPZ A;  3ET6 B;  1VQL S;  2R8K A;  1OY6 A;  1QAY A;  2NYH A;  5AXN A;  3K17 A;  2MQQ A;  9RUB A;  4A8M P;  2G4B A;  2ZNZ A;  2PDA A;  2KFZ A;  4DS4 A;  4NA3 A;  2MY8 A;  4EU0 A;  1YK9 A;  3MMA A;  1Q8I A;  5B09 A;  2AF6 A;  3N5F A;  1UET A;  5E2Q A;  3MAQ A;  1X31 C;  3UVJ A;  1SUQ B;  2EC2 A;  1Y3J A;  4DUY J;  3ILL A;  5IV4 A;  3K5L A;  4RNM A;  4DR6 J;  3BKU A;  3KUH A;  2IYG A;  4ZJO A;  3C6T A;  2YKM B;  1IBC B;  4FXW A;  4YR2 A;  4DFM A;  2C22 A;  1JJ4 A;  3CCS S;  3KDO A;  3IRX A;  3MPV A;  1WOO A;  2CPF A;  1PSD A;  5DGA A;  2FGO A;  1WDT A;  1N6Q B;  5GAG I;  3EIC A;  5AJ3 J;  3IRX B;  3NGS A;  1SKW A;  3DXB A;  1Z2Z A;  3QAE A;  4JI8 J;  4PPD A;  1ZPV A;  4LRE A;  2AEJ A;  2YKM A;  3QAU A;  1VBX A;  1S6U A;  2KXH A;  2GS8 A;  4QIV A;  3EPG A;  1WC1 A;  1L3T A;  1HA1 A;  1H98 A;  2E66 A;  5B0A A;  4CDI A;  3DHX A;  2RIJ A;  4ZMM A;  3MEE B;  1U24 A;  2FJA B;  5EHH A;  2CRL A;  1PO6 A;  4ED8 A;  1DTQ B;  2D9O A;  2ASY A;  3O5T B;  4ECW A;  2H65 B;  2OI2 A;  2RHS B;  4CH1 A;  1SIZ A;  2BAB A;  1JIH A;  2LQ9 A;  2RJZ A;  3HHL A;  5GAD I;  2OFH X;  1VQ4 S;  3J81 Y;  2VFV A;  5LMU F;  1TFW A;  3G8Q A;  5K8O A;  4EK2 A;  5C25 A;  3G6V A;  2CJB A;  2CQ4 A;  1DQ8 A;  1TL4 A;  3W2W A;  4K50 A;  3Q8V A;  5HMZ A;  2LVW A;  2VC1 A;  2RRN A;  3AJ2 A;  1NBE B;  3FBB A;  2BJD A;  3CD0 A;  3R3T A;  3THP A;  4CM0 A;  4JI5 F;  1AW0 A;  2VKR A;  4FF4 A;  2CWK A;  3LGN A;  2ZEJ A;  3CO0 P;  2PEH A;  1RAG B;  1KOH A;  1Z4U A;  2FJE B;  2LQ5 A;  2CPH A;  3M8P A;  4I6A A;  3RGI A;  4DV2 J;  4DR7 J;  2N3L A;  2DGX A;  3RG6 A;  2Z30 B;  3EUN A;  4XPE A;  2ZZM A;  3BYR A;  2AKW B;  3NGU A;  3LP2 B;  3B82 A;  3DRY A;  2ZHO A;  2EI5 A;  3U27 A;  3W2V A;  3UPF A;  1WG4 A;  4IOA Q;  2DY1 A;  5A76 A;  2QZ8 A;  3LGH A;  5DDR C;  1O51 A;  1VC5 A;  4FF3 A;  1RIS A;  2D69 A;  1Q53 A;  4A47 A;  3GV8 B;  1S10 A;  1CQM A;  3DRR B;  1FNX H;  1TQL A;  3ILO A;  1OYE A;  2KKH A;  4C3L A;  5HBM A;  3CSK A;  2AP6 A;  2XLI A;  3J7Z T;  2ADC A;  1RT6 B;  3BH7 B;  5L38 A;  4Q5V A;  1RSC A;  2CUY A;  1VHF A;  2M0G B;  1YX2 A;  2Q1L A;  2NXN A;  2QLB B;  1FRK A;  3B8H A;  3F56 A;  2EBG A;  4PWW A;  4QJV A;  1FWK A;  2K7J A;  3OFH A;  4EI2 A;  3KLH A;  4DSE A;  1FJE B;  5HP1 B;  1JJC B;  1RT3 A;  3M8Q A;  2J0W A;  3SCJ E;  4ETX A;  1IBK J;  3FK4 A;  3HSG A;  2RVJ A;  1GMV A;  1ZM4 A;  4YP3 A;  3H4B A;  1C2P A;  4OYX A;  3JSY A;  4R5P A;  2DB1 A;  2W7P A;  2YX4 A;  3TI0 A;  3PO4 A;  3TP2 A;  5ETK A;  3K5M A;  4MH8 A;  2HRY A;  1K1S A;  3D0G E;  3VF0 B;  2DGW A;  4RW7 A;  4CLL A;  1SJ3 P;  1FJG F;  2YNI B;  2FZK B;  4IYQ A;  1ZYQ A;  3ZXW A;  4GKK J;  3IC1 A;  3KJV B;  1ITP A;  4OI3 A;  5MAO A;  2N4D A;  1YJ9 S;  1NU4 A;  1RDR A;  5CHC B;  3KLE B;  4XTT A;  3PX0 A;  4IG3 B;  1QTM A;  3NNH A;  3KLI B;  3OTO J;  5D4O A;  4K4U A;  3QLH B;  2LDY A;  3H8Y A;  2R8G A;  1SJR A;  4KO0 A;  4NWB A;  5M2R A;  1VJQ A;  2AJ4 A;  2ZM6 F;  3AD7 C;  4LF9 F;  4E8U A;  4RWW A;  3OUY B;  3D6M B;  5JVH Q;  4KJI A;  4FYD A;  4ZS6 A;  1C1B A;  2J8A A;  2XNQ A;  3TNV A;  4CT8 A;  5ETO A;  4DN9 A;  3MUM P;  2G2O A;  1GH8 A;  5CA5 A;  2UVV A;  4DV5 J;  3O6Q A;  2GMJ A;  3ITH A;  4ZVP B;  2JEF A;  3MXH P;  4DV0 J;  2CJK A;  2IA6 A;  3AXK A;  2G0I A;  3IXQ A;  3QMQ A;  4O3O A;  5A2Q U;  3W60 A;  1FRX A;  1S9E B;  1MN7 A;  3KWM A;  4MTP A;  3TW0 A;  1HHT P;  1ROF A;  1J5E F;  1JQG A;  2W9B A;  1M0S A;  5IM0 B;  1AFI A;  4JP8 A;  3T1Y F;  3DLB A;  4F2R A;  3EXC X;  1RHR B;  4JI1 J;  2OTJ S;  3CMA S;  2WAQ D;  1OJ4 A;  2B6A B;  3ZZP A;  1NK7 A;  1JLQ B;  3UD4 P;  1NO8 A;  4LF2 A;  2K8G A;  3KMS A;  3KLF A;  3UD3 P;  1B0V A;  3FRZ A;  1BXN A;  1N5Q A;  2DNM A;  1F9F A;  3A8K A;  4QIE A;  1N36 F;  5M2P A;  2VOD A;  5ETR A;  4NXM F;  1N0V C;  1TKX B;  4ZCI A;  4C9D A;  1KVJ A;  1K8A T;  1TAU A;  5G0R B;  4CCH A;  4NEY A;  3LAK A;  2GVD B;  1MN9 A;  2AJF E;  2X1B A;  4KKO A;  4O4G B;  4DEZ A;  3SCI E;  2VHG A;  2V9W A;  2DO0 A;  5LT5 A;  2XGQ A;  4JI0 J;  1URN A;  2R7S A;  5FJ4 A;  4U8Y A;  1UCN A;  4UUW A;  5L1I A;  4JB8 B;  3OR1 B;  3BQ2 A;  4J9N A;  3VTI A;  4U9R A;  3A8E A;  2FHK A;  1BWE A;  3MDF A;  4ANC A;  3MF5 A;  4OYW A;  3KG1 A;  4ALZ A;  2DIU A;  4BS2 A;  4OHY A;  1S9F A;  2MHE A;  3HDS A;  1F0X A;  4P9S A;  1TKT B;  4U7C A;  2KTQ A;  3N4W A;  3QIP B;  3R6G B;  3B4D A;  3PKY A;  2CPD A;  4OYO A;  4DCP B;  1Y7P A;  4F3Q A;  1LWF B;  1HD1 A;  2AQ4 A;  4M5K A;  4K4Z A;  2UXC J;  3AXM A;  2E5J A;  4MKV A;  4D3H A;  5J2Q A;  3HX9 A;  1ZBT A;  4DU8 A;  3UN3 A;  2ZD1 A;  5I3U B;  5IWA J;  2J9C A;  3A3P B;  3KLG A;  3MR6 A;  4C0O C;  3R6L B;  3HXM A;  2PEB A;  4JI5 J;  1QTN B;  4H54 A;  2GVD A;  1ZOT A;  2XS7 A;  2XZD B;  2HRT A;  1RYR A;  3ISN D;  2N7C A;  1GK8 A;  3UNG C;  1ICE B;  2AU0 A;  1XNR J;  3PCO B;  4PXD A;  3S01 A;  3SQO P;  4FYX B;  2BAN A;  2CYY A;  1RWP B;  3K2Y A;  5DJB A;  2G2Z A;  1BHN A;  4ZVG A;  3AFG A;  2XCP A;  2H9Z A;  1LW2 B;  3MTK A;  1RWV B;  2VQF J;  2CDQ A;  4TKT A;  2NXC A;  1PJ5 A;  3Q2S C;  3AOC A;  3T19 A;  5IM0 A;  4CM2 A;  4N7T A;  5GMK a;  2HAI A;  4Q45 A;  2XHW A;  3SEO A;  4YN3 B;  1R0A A;  2WRM A;  1HNX F;  2RNE A;  3SSR A;  1IM4 A;  1G7C B;  1PC5 A;  2DR6 A;  3TA1 A;  3HPO A;  1KLM B;  1TZ0 A;  3W66 A;  2ATC B;  2I0X A;  3M2V A;  2F8E X;  2ZJR Q;  4X2B A;  5K9F A;  4W92 B;  1KN6 A;  4WYW A;  4X4N A;  4HH1 A;  1VLO A;  1YJ7 A;  4UUX A;  4DR3 J;  2EK1 A;  2Z4P A;  3M2U B;  2ILY A;  1JLB B;  1X5T A;  3E01 B;  1XMO F;  3PX4 A;  2N4C A;  3R9L A;  3W65 A;  4ILM A;  1HKA A;  2C3M A;  4X4Q A;  8RUC A;  1MMN A;  3Q8Y A;  1QM9 A;  4JI6 F;  5U47 A;  2ZH3 A;  2IJF A;  4Z7C A;  3Q8P B;  2NS1 B;  1LK5 A;  4IRC A;  1R89 A;  2HND B;  3IBF B;  2FJD B;  4M5J A;  3BEG B;  3V4M A;  3HHK A;  3PJW A;  3D1Q A;  1Y0H A;  4EO6 A;  2GIF A;  4MAK A;  2P6T A;  4EYH B;  1KD1 T;  5F8N A;  1D9A A;  1RE1 B;  1T9X A;  1DJ0 A;  2ROE A;  4NI2 A;  3FEZ A;  5HP1 A;  4P2F A;  3CJ8 A;  2YXL A;  1XBW A;  1CC7 A;  3HF5 A;  5KFD A;  4DG1 B;  1RT6 A;  2V2Z A;  4R8U B;  4KT0 C;  3DCA A;  1QDU B;  2CJQ A;  2DH7 A;  4QWA A;  1WHX A;  3GV5 B;  5AE3 A;  2VD3 A;  4HEA 9;  3BBF A;  2RE1 A;  5E0O A;  3OJS A;  2W8K A;  2C2K B;  2MGZ B;  1HLW A;  2CZ9 A;  2MLY A;  5DZ6 A;  2LMI A;  2R7Q A;  3MUT P;  3OXL A;  1TK0 A;  4WE1 B;  1JNR B;  1KWM A;  4LIR A;  4RW8 A;  3SQG B;  2VOO A;  1Q8K A;  1YBU A;  1U0S A;  3B54 A;  4ZVF A;  3RRH A;  4WFZ A;  3V2U C;  4N47 A;  3OL6 A;  2PE8 A;  3W5Y A;  2F7V A;  3KK3 A;  3RBD A;  1NDP A;  2DHS A;  3RBX A;  2RKI B;  3UDL A;  4NLW A;  1VCT A;  4FS2 A;  3TAQ A;  2QLF B;  4EUV A;  4JV2 A;  4YHH F;  2CNO B;  1RWW B;  2EG2 A;  3MCO A;  2B4V A;  4KR0 B;  5DQH A;  1PKU A;  3QJJ A;  4PQU A;  2F63 A;  3J81 U;  4IH7 A;  3H20 A;  4J9U E;  5L39 A;  1HQE A;  2DNY A;  4OYI A;  2VBX A;  1Y9O A;  4M5D A;  3K59 A;  3ADA C;  3CCL S;  1N8R T;  1KEK A;  2RU3 A;  2W4P A;  2AYG A;  3BDP A;  1RQ0 A;  3R1H A;  2EKY A;  1SC1 B;  1Q4R A;  1NB2 A;  3M30 A;  3NKY A;  4HKQ A;  2W9A A;  2Z58 B;  1LNQ A;  1LWX A;  1MWY A;  2E7W A;  3LAN A;  3BGR A;  4DFJ A;  4OJ1 A;  4B9T A;  3NAH A;  4B3M F;  1VMB A;  3ZZY A;  1S1X B;  1IWA A;  3T3F A;  3T5H A;  3J7A 1;  3ZO7 A;  1UVM A;  1UWB B;  3X1L B;  4DCO B;  1GEH A;  2D3Z A;  1H72 C;  2V6A A;  4LQ3 A;  4JYA J;  4K7Q A;  1HQU B;  5A6W A;  4CH0 S;  1UEK A;  4WP9 A;  2KYX A;  2WVC A;  1EHW A;  1U6F A;  2V34 A;  3MAA B;  5KG2 A;  3PR5 B;  1OS5 A;  1TL5 A;  3KYL A;  2AYB A;  3W63 A;  4AND A;  3TZX A;  1IM6 A;  3VHQ A;  2P9G A;  1JLA B;  2XMJ A;  2ZHA A;  1WEY A;  2EK6 A;  2KN4 A;  2ZOM A;  3GYN A;  3MAA A;  4DX5 A;  3R1L A;  1AUS L;  2DT9 A;  4TXS A;  1JLC B;  2M2B A;  4Y2A A;  2XO7 A;  3VAM A;  3M1V A;  2GAG C;  2GHW A;  1Y5N B;  2MYF A;  2B56 A;  1SUQ A;  2YTC A;  2XMU A;  4L73 A;  2CVE A;  5L8R C;  1VRT A;  2GQQ A;  3UVJ B;  5HMX A;  3CCV S;  1S97 A;  1LWC B;  2HZV A;  1DUR A;  1X9W A;  4H4O B;  1FFG B;  5D4P A;  4UQG A;  4F67 A;  4GC7 A;  3G96 A;  1Q8B A;  2WON A;  2QYG A;  2JL9 A;  4Y00 A;  2RQ4 A;  3Q8Q B;  1ZM9 A;  1UP1 A;  4FYW B;  2JC0 A;  1C4C A;  4NL5 A;  1HPZ B;  2X51 A;  3ET6 A;  1Q86 T;  1XJW B;  1MW7 A;  3BM7 A;  3ICL A;  1VQK S;  2MZS A;  1TL3 B;  4QWC A;  4RNH A;  2BEF A;  4WFA Q;  3T1H F;  4M5D B;  1NSA A;  4Q8F A;  1VS3 A;  3JB9 k;  2FJV A;  1S9G A;  1FX2 A;  4O23 A;  4FNI A;  2WVB A;  1SB6 A;  1UL3 A;  1SVD A;  2XY7 A;  4PRF A;  3BV8 A;  4DUZ J;  5F9N A;  4LR9 A;  3N9U C;  3I0R B;  3AOB A;  2CJ9 A;  2QT7 A;  2Z2M A;  3S1T A;  3FJ2 A;  4ES2 A;  4DL4 A;  4B9N A;  5KFB A;  3BSC A;  4DMZ A;  2P6S A;  3DOK A;  2APO A;  1H73 A;  4QWD A;  2YH1 A;  1N36 J;  2WCX A;  1HNZ F;  4KY3 A;  2IHR 1;  4FBT A;  1NJW A;  3CF5 Q;  1BLU A;  2AJ1 A;  5F41 A;  3MEK A;  4HTI A;  3DOM A;  1VI7 A;  1RAB B;  1BQM B;  1D8Z A;  1MNE A;  1WAC A;  2P9E A;  2RML A;  3T1A A;  1FHT A;  1QAI A;  4FVM A;  1F1B B;  1WF1 A;  2CPI A;  3GR0 A;  4RW6 B;  1IQT A;  4B3M J;  2MQM A;  4KE5 A;  3M2R B;  1FXD A;  3M6V A;  2U2F A;  1FX4 A;  2NSB A;  5EWE A;  1PG5 B;  4GO7 X;  4MJK A;  2UUA J;  5BYR A;  4L74 A;  4O0I A;  5HQM A;  1EKR A;  1T9T A;  1SL1 A;  3QT6 A;  2FVQ A;  1Q8L A;  1YRU A;  1XMQ J;  2WB4 A;  1KVI A;  4AL7 A;  1JLG B;  4KTQ A;  1DQA A;  2UZA A;  1K1Q A;  4L3N A;  4X84 A;  3ULH A;  1UA1 A;  2DHA A;  1HBO B;  3P8B B;  2HND A;  4ZVQ B;  4WU2 A;  2GQC A;  4A8Q A;  5IT9 Y;  2EG1 A;  3JSR A;  3G6X A;  1JJ2 R;  2CAD A;  1IKX B;  2JZ5 A;  3ZZR A;  3QNW B;  1AYE A;  1P27 B;  3IS9 B;  2VZ9 A;  4YB7 A;  1M1H A;  5GVQ A;  2DCL A;  3M9O B;  3KOA A;  2UUA F;  2LQJ A;  2BR0 A;  1Q95 G;  1B0P A;  3AJD A;  2BA9 A;  3R7B B;  1DZ5 A;  1RTH A;  5DDQ C;  4LRF A;  5A8W B;  4QZV B;  1DY3 A;  2HNY B;  3FZ2 A;  5I42 B;  1Y10 A;  4L6V 3;  1FJ7 A;  4KQZ A;  4HAC A;  4LJM A;  1XC9 A;  3RU0 A;  3H42 A;  3CCU S;  1S6Q A;  1A7G E;  1U47 A;  4J9R A;  3V81 A;  3O44 A;  2VJU A;  2PII A;  2HAF A;  3UCZ P;  3C14 B;  5CYM A;  4G1I A;  1N54 B;  3GYX B;  4LBI A;  4B3O A;  1UVI A;  2OH2 A;  3JYT A;  4WPA A;  2Z2Z A;  3DLK B;  4ED2 A;  2F9J A;  3IR6 B;  4ZVU B;  1CS4 A;  3OL9 A;  1HBM B;  5F8J A;  1X60 A;  1JX4 A;  4B9M A;  1FD2 A;  4KC5 A;  1UMJ A;  4OV6 A;  4P2S A;  4OYB A;  4TYB A;  4P6Q A;  1NH8 A;  2NLW A;  5KG3 A;  4DUZ F;  4LR7 A;  2FLN A;  3ZTP A;  3CCM S;  1LW2 A;  2L08 A;  4YQW A;  1JKH A;  4IH6 A;  2UV8 G;  4L76 A;  4TN2 A;  4WCE Q;  1ZTT A;  2EFQ A;  1KDN A;  2GGP A;  1CUL B;  3DU5 A;  1VIX A;  4RUA A;  4F4Y A;  1CC8 A;  3IN5 A;  2CNK B;  4ZLP A;  4YB1 P;  1HNW J;  4QYZ J;  4C0H A;  3Q23 A;  3PHT A;  3GG1 A;  2KHC A;  2JJ4 D;  4ELT A;  3IG1 A;  5L1K A;  1B4S A;  5IV3 A;  4AT1 B;  3KLG B;  3CXC R;  2KXF A;  1EP4 B;  3H0P A;  4DCJ B;  1VC6 A;  2F3J A;  4MFB B;  1F5A A;  3D0H E;  4PAB A;  2XNR A;  1RAJ A;  5MLC V;  3AB4 B;  3DN9 A;  3FEY B;  2IDE A;  2IM3 A;  3N01 A;  3QSI A;  4MFB A;  1YJU A;  2I6W A;  5K8M A;  3OLB A;  2V94 A;  4J9K A;  2D3O R;  2KDO A;  3HVA A;  1JMT A;  5A8K A;  2XQC A;  2F9D A;  2DEI A;  3LO3 A;  3VAJ A;  3N6N A;  5AE1 A;  1TFY A;  3CUL A;  1FES A;  2GX8 A;  4RPF A;  2PO4 A;  4YB6 A;  4K0K F;  4F02 A;  4OI4 A;  1D0E A;  1I1G A;  1XWL A;  2QE5 A;  1WG5 A;  2KVI A;  2CZV C;  3TUJ C;  4ZPV R;  2YX7 A;  5FDL B;  3CJQ A;  4ZLN A;  3VAK A;  1EKS A;  2KM8 B;  4K4S A;  4WFN Q;  1U2C A;  3GIJ A;  1LW0 A;  4F3M A;  3CD5 A;  3BBC A;  4ID5 B;  4AUK A;  2OGU A;  3EVO A;  1L3V A;  1GNK A;  1C4A A;  4LRC A;  3H25 A;  1CUL A;  1HBM A;  2LYV A;  2UUC F;  4LF6 J;  4KIA A;  4K4W A;  2FYX A;  1JKH B;  3AJ1 A;  3IR7 B;  1J5O A;  1JLQ A;  1SC3 B;  4MIW A;  2WSC C;  3JYT B;  3LPY A;  2HS0 A;  4RBT A;  5HJX A;  1PCA A;  4KH0 B;  4NZ7 A;  4DV6 F;  4DLG A;  1DTT A;  1FT8 A;  3M6X A;  1XNR F;  2W9B B;  1VQ6 S;  1B99 A;  2LEP A;  3UCG A;  4LF1 A;  5C2C A;  5HVH A;  3V81 B;  4DL2 A;  4L3K A;  4MK8 A;  3PW4 A;  1R8A A;  1HHS A;  1CS4 B;  3B78 A;  3CJ3 A;  3L7P A;  4B08 A;  3PEH A;  1W26 A;  4DL3 A;  3DNC A;  3QGI A;  2JEJ A;  1U48 A;  2E7X A;  3A3O B;  2R7R A;  5CYM B;  1M5K C;  1RWU A;  4DFK A;  4J9O A;  4OL8 A;  2LU2 A;  3S6E A;  4DPO A;  3T1H J;  5CD4 H;  3ZTS A;  5B0D A;  4MK9 A;  2VV5 A;  1UA0 A;  1K0V A;  4A8X A;  2ZBR A;  4GRS A;  5D4N A;  3UDC A;  4JI0 F;  2KG0 A;  2UXD J;  3IP0 A;  4OLP A;  2VQE J;  5HK4 A;  1Q5Y A;  2GML A;  3W9I A;  2XC9 A;  3JSM B;  3KLI A;  4RNF A;  3TQE A;  1UWA A;  3IBC B;  1QSL A;  4NAS A;  4Z7Y A;  2D41 A;  3BSN A;  1HWK A;  2RRB A;  4QBU A;  3FFI B;  4EYI B;  1M5S A;  2IBK A;  2UV8 A;  2OPQ A;  3ILJ A;  1RAO A;  4NLS A;  3T41 A;  2B3T B;  5SZT A;  2R9L A;  4J7C A;  2HS4 A;  1D3W A;  2HHV A;  1A9N B;  2FHM A;  4JI4 F;  1D1U A;  3N79 A;  2CQP A;  2Q66 A;  3FNN A;  3I31 A;  3IAS 9;  2QN6 B;  4KB7 A;  4PXB A;  4ZN3 A;  2JX2 A;  1G4C A;  3OL8 A;  5EWF A;  3RR8 A;  3NRB A;  1RI7 A;  3VAG A;  3M8Q B;  4LQ9 A;  3H4D A;  2WSE C;  4ZPT R;  2GJI A;  3HKZ D;  5HAN A;  3GLJ A;  1VRQ C;  3J81 j;  3Q22 A;  5JVG Q;  4DV1 J;  2AX0 A;  1F2G A;  3VVU A;  4F4X A;  4NCA A;  4UW2 A;  1CG2 A;  2VG6 A;  4GVL A;  3EDQ B;  4ZVE A;  4I6W A;  3L3C A;  2NR0 A;  1LEO A;  2BJ1 A;  3I96 A;  4ECY A;  3CO9 A;  1EIY B;  1B0T A;  5FII A;  1EAY C;  2K3I A;  3BGU A;  3F44 A;  4JV5 F;  3BGL A;  3DXS X;  2HZC A;  3CJK A;  1H38 A;  3EDR B;  1NJY A;  3DRR A;  1N32 F;  2OSQ A;  4C8N A;  2OIH A;  2A18 A;  2J7K A;  2HGL A;  2V2K A;  4P73 A;  3LP2 A;  4J9Q A;  3W2V B;  2OEM A;  4A46 A;  2C2M B;  3HM9 A;  2QMU B;  2VBY A;  5HI7 A;  4G3I A;  1I3O B;  1FA0 A;  2QSF A;  2QO3 A;  2XYH B;  4G1Q B;  2A3J A;  1H2U X;  2C2Z B;  5ETT A;  4QIW D;  3GFY A;  1VQO S;  1FXL A;  1DLO A;  3DI6 B;  1W2B R;  2FHO B;  3H2U B;  1QJH A;  4LT6 A;  4N8O A;  3MM7 B;  1S0M A;  4H4O A;  3MAH A;  2WOM B;  1X4H A;  2MQN A;  3NOC A;  1MMD A;  4M5L A;  3SFU A;  4U95 A;  2CQG A;  3FRY A;  4ED7 A;  2C3P A;  3SFG A;  1WWH A;  1DTQ A;  2HWI A;  2MST A;  4G65 A;  1S77 D;  4PWD B;  3CCR S;  2UXB F;  2CG8 A;  2NYI A;  1DHM A;  2E1P A;  3C15 B;  3DLL Q;  1FDN A;  3TAM B;  4EMD A;  1IKW B;  5E5N A;  3EYZ A;  2XEX A;  3R27 A;  3SIP B;  3QBC A;  1RAE B;  5T14 A;  1RWN B;  3SV4 A;  3KNA A;  4ZHR A;  1HL6 A;  4KFB A;  4NYP A;  1KTQ A;  4WYL A;  1XMQ F;  1OY9 A;  1RT5 A;  1UKU A;  3BF4 A;  1N34 F;  3MOZ A;  3Q86 A;  1MRO A;  2VIH A;  1JLC A;  2DEJ A;  4E2F B;  2JEG A;  2CQ3 A;  3RYL A;  4O3S A;  4MIA A;  3MMC A;  2WBR A;  3UN5 A;  2XMT A;  2XI2 A;  5KAK A;  3DHW C;  4ILL A;  4CO1 A;  3G8T A;  4ERD A;  2GO8 A;  3VAL A;  4USI A;  2B4O A;  1UWB A;  2FDN A;  1AT1 B;  2D74 B;  2IBO A;  4NCG A;  1S1X A;  5F8I A;  4C0B A;  2OAU A;  4GVB A;  4QQB A;  1DRZ A;  1IKW A;  4FF1 A;  3TAM A;  4DL5 A;  4TVA B;  2F8M A;  3MM5 B;  4EGL A;  3OVB A;  4KAI A;  2L9N A;  3IWN C;  3J80 Y;  2J9D A;  1MG7 A;  2XMW A;  3UE2 A;  4WFY A;  2RDD A;  2NPI A;  3H2V E;  3M30 B;  4HI2 A;  2CQD A;  2OML A;  2Z57 B;  5GAE I;  3T5J A;  1OMS A;  2A1B A;  2WOM A;  4NLG A;  2DY9 A;  5B0E A;  2J0S D;  2RQM A;  1G6B A;  5KT6 A;  3MM7 A;  5DM6 Q;  1YIT S;  4JI6 J;  3DI6 A;  2BKN A;  3QGP A;  2M9K A;  2QL9 B;  5F0U A;  4YS2 A;  5KFE A;  1NDK A;  3GIL A;  3TUP A;  2RKI A;  3HFZ B;  3KJQ B;  1KR4 A;  2PT0 A;  3MPW A;  1F9E B;  3GPA A;  3U1L A;  4RUC A;  1UW9 A;  2HUR A;  4RNN A;  2VBZ A;  1LQ9 A;  4A8W A;  1T95 A;  4G1P A;  5HMY A;  3OL7 A;  3AQO A;  3HSZ A;  2YPZ A;  2ASL A;  2FC9 A;  3C6U A;  3MCN A;  4ZCL A;  4Q0B A;  2FGC A;  4QCL A;  2UUB J;  3NP5 A;  4PXE A;  4M63 A;  3US5 A;  2R7O A;  5GME A;  1CJK A;  2MGZ A;  4C8O A;  3M6W A;  4F2S A;  3FEX B;  1Q79 A;  4QR0 A;  2LCW A;  2YWF A;  4HR2 A;  1WI6 A;  3PZP A;  4IR9 A;  4IFV A;  2ZNY A;  5KT7 A;  5L1J A;  2D3O 1;  5T7L A;  1NZ8 A;  2DH9 A;  2FUG 9;  2JRS A;  3DMJ A;  3M32 A;  4NA2 A;  2VQF F;  5J2M A;  3RW6 A;  2E5H A;  4BDP A;  2GQ2 A;  4DG1 A;  4DV6 J;  1R6Y A;  3IM8 A;  3GFX A;  3NAI A;  5GAH I;  5IXU A;  3MOJ B;  5AE2 A;  4PZV A;  3LOU A;  2ZH8 A;  4CTA A;  2H4Y B;  1YIJ S;  1KHV A;  2J9E A;  2R42 A;  2W24 A;  1YBT A;  1EJ7 L;  2KVQ E;  3IMQ J;  5ETP A;  4ETZ A;  1MWZ A;  2VJV A;  1HR0 F;  4LF7 J;  3Q2T C;  1G2E A;  3IAM 9;  2H54 B;  2R3V A;  4C97 A;  4WFX A;  1P8G A;  4CO2 A;  4C8L A;  3CCT A;  3BO3 A;  1RGV A;  2HLT A;  4C3M A;  3GIR A;  1P6T A;  1FI4 A;  4OZ2 A;  4LF4 F;  5ADZ A;  2DHG A;  2GMH A;  2XWX A;  4V1A k;  2IJN A;  1T9W A;  2PGC A;  1SC6 A;  3EVW A;  4NI2 B;  4LF8 F;  2HHH F;  4LF9 J;  2DIV A;  3UDV A;  3A3N B;  1BGX T;  3PW5 A;  2DGV A;  2XZW A;  4IDK B;  4FXD A;  2E1A A;  2YNH B;  3QZ8 A;  3L7U A;  3M9M B;  4DV4 F;  1BQN B;  2YBV A;  2UXC F;  3M8Z A;  2H1Y A;  1NEE A;  2ACY A;  4DPX A;  2J6S A;  4GKK F;  1VLY A;  3PAC A;  5KOX A;  2OPP B;  3J7A N;  1A0O B;  5D77 A;  4OX9 J;  4C48 A;  2E1R A;  4WZQ A;  1OPZ A;  1RTI B;  3ISZ A;  3MPU B;  4P71 A;  4ZPA A;  2HNZ B;  2HPU A;  4ZP6 A;  1UW4 A;  3UI3 A;  4YY3 F;  3DYA A;  4CLK A;  1S6P A;  3AD8 C;  1IUJ A;  1S57 A;  4YHH J;  4HDH A;  1TK5 A;  2CPY A;  3FCW A;  4N8N A;  1RK8 A;  2RS8 A;  1FRM A;  4RUB A;  5EX3 A;  4ED0 A;  2DNO A;  1V6H A;  1KC8 T;  4KRW A;  2W7A A;  1U6Z A;  3M2V B;  2HVH A;  1NND A;  4OZL A;  4KHR A;  1Z2L A;  1DTT B;  2IIH A;  2V4J B;  3GP9 A;  3KFW X;  2VFR A;  5I3P A;  4NZ0 A;  4Q2M A;  3MM6 B;  3QAT A;  1RHM B;  5BR8 F;  4O0N A;  3POT A;  2B4U A;  3TZZ A;  2ZBQ A;  1U1P A;  5CAB A;  5KG7 A;  4K4X A;  3TYT A;  2ZH1 A;  1N5Y A;  1NKB A;  1TUV A;  4N5S A;  5KFZ A;  2XGP A;  3R2D J;  1ELO A;  3OSP A;  1SKS A;  5B08 A;  2E1M C;  4YUD A;  4ZLJ A;  2ZUG A;  1AZS A;  3ZNJ 1;  4EBE A;  1NHU A;  1U1Q A;  1WUU A;  1RKJ A;  4H4M A;  2BE7 D;  4JV0 A;  2NXJ A;  3BPD A;  2OEL A;  3T1Y J;  1RWX B;  1UEU A;  2HLU A;  4F26 A;  2O67 A;  3TVY A;  4BBY A;  1K73 T;  5KFL A;  1LWE B;  2HGM A;  1NRK A;  1N34 J;  5HO4 A;  3RBE A;  1WD6 A;  1PIE A;  1EZZ B;  3AA8 A;  3CDE A;  3U7J A;  2DBB A;  2POK A;  4D3G A;  1NK9 A;  3K7R A;  1T8E A;  1EET B;  4OLO A;  1WC0 A;  1TTH B;  3BO2 A;  1J27 A;  1KS2 A;  1H7X A;  2JNJ A;  5CQG A;  2QTW A;  3R8Y A;  2CPE A;  2MTL A;  5IQ6 A;  4LF5 J;  4O3R A;  4CI0 B;  4A8K A;  2OMO A;  1BC6 A;  2PFF B;  3FQK A;  1Q1K A;  4KGM A;  2WK4 A;  1M5O C;  4O3N A;  4WZM A;  4M5M A;  4M94 A;  3QO9 B;  4DBQ A;  1X4G A;  3ENW A;  5DS7 A;  2BM1 A;  3UWT A;  5AJ3 F;  1LXJ A;  5LSO A;  2GAH C;  2KRB A;  1YJR A;  3HHL D;  3IG1 B;  1T02 A;  3OFG A;  1GMU A;  2CVI A;  1HMV B;  3C16 B;  1SJF A;  1RWO B;  4ES3 A;  3NWG A;  1S1V B;  2V4R A;  1NJX A;  2JLE A;  2ZWO A;  3T5L A;  3OR1 A;  2OPS B;  2PA3 A;  1H7W A;  2DHX A;  4JI2 J;  5KFX A;  4RKU C;  4AYB D;  2GGP B;  1QE1 A;  2XYG B;  1NLK L;  1UEV A;  3L7O A;  2P2C B;  3CCE S;  4LVN P;  4LSL B;  2N7Y A;  1EQM A;  1DBD A;  3D6F B;  2HQI A;  5HQ8 A;  3IM9 A;  5G0R A;  4DOZ A;  3RUB L;  2W8L A;  1RT2 A;  1YG0 A;  4B9U A;  1N32 J;  2GW8 A;  5IOL A;  3ZZU A;  4DUT A;  3CTR A;  1I51 B;  1N33 F;  3OXF A;  4F0M A;  1HYS B;  3G87 A;  3MTJ A;  3D1H A;  3NXZ A;  2DO4 A;  3I82 A;  4KGZ B;  3K8W A;  3KLF B;  1HI8 A;  2C2R A;  2VBW A;  3DLK A;  1JWW A;  3W64 A;  4RU2 A;  2B6A A;  2M70 A;  2G0C A;  4AFF A;  1U8S A;  3ITH B;  4CQ1 A;  1YJT A;  1S49 A;  3G2X A;  3HMJ G;  4LFA F;  2HVD A;  2F5G A;  1KQG B;  5CYQ B;  4K4V A;  2ZJP Q;  3WDO A;  4WTY A;  2C2O B;  1FFW B;  1VDH A;  4P2X A;  2B43 A;  4WBF A;  4Y3C A;  2MQO A;  1VC0 A;  3NS5 A;  4NCB A;  3ETO A;  1YRX A;  3D66 A;  3GB0 A;  3KJF B;  1RCO B;  2R7T A;  1BMQ B;  3DYA B;  3ZZO A;  3OHA A;  1IBM J;  5KFO A;  1V3S A;  2E5L F;  4X4O A;  5DG8 A;  1UVJ A;  2E9Z A;  5E3R A;  2EPI A;  1CJU B;  3KK1 B;  1KKH A;  2CQ2 A;  3KLH B;  2XS2 A;  2MQ8 A;  4QW8 A;  3KLE A;  2B8P A;  4WXO A;  1C1B B;  1WHY A;  3FSX A;  2CQ1 A;  1U2R A;  4I2P B;  4ZJL A;  4NX9 A;  1ZAV A;  4R25 A;  1AUD A;  3MCS A;  4KO0 B;  5LJ3 Y;  3UD5 A;  3I87 A;  2YNH A;  4EBD A;  3EVM A;  3QLH A;  1HBO A;  4C11 B;  3BN7 A;  3GE9 A;  5ETV A;  3R2C J;  2B9E A;  1Y5I B;  3MZI A;  2X1G A;  1ARO P;  3EX7 B;  1TAQ A;  4F0K A;  1HBN A;  4FP9 A;  4B02 A;  2DKO B;  4RW7 B;  1MML A;  3N5B A;  3WIV A;  4I7F B;  5KFM A;  3VGT A;  1HFE L;  2DGT A;  1WC3 A;  2DNN A;  2G0J A;  3DRP B;  2C28 A;  4M5I A;  1RAI B;  3M2R A;  2NZ4 A;  3R5B A;  1TL7 A;  4LBP A;  3PYG A;  3NCP A;  1JB0 C;  4X4U A;  2Y9H A;  2XWY A;  3OVS A;  1HI1 A;  4PEO A;  5A8R A;  3TRG A;  2VKZ G;  1NK8 A;  4YR0 A;  1RT3 B;  2AD9 A;  4A48 A;  4ZIT A;  1UVL A;  4P75 A;  3LW5 C;  2K2P A;  2B9X A;  3VQT A;  4C3K A;  1KQF B;  2BE2 A;  2JHE A;  3LTO A;  1NK5 A;  4DUY F;  5L9X A;  4ZCM A;  1K44 A;  5J2M B;  2HBZ B;  2RU9 A;  4WU3 A;  4DXL A;  2MXY A;  2AZ1 A;  3LF0 A;  3MR5 A;  1I94 J;  4OZN A;  1RLC L;  3BJY A;  1RWM B;  5K14 B;  3FSY A;  3PYE A;  3J80 U;  2RS2 A;  2OO4 A;  1FTC A;  1L3K A;  4NLU A;  5DLG A;  3FKB A;  2UUC J;  2VUG A;  1F3F A;  4WFB Q;  4O4R A;  2HHT A;  4G6V B;  3CD7 A;  2Y1R I;  3W1Y C;  4DV0 F;  4ECV A;  3IRW P;  2I8E A;  4WIQ A;  4DV5 F;  2DGQ A;  3M8P B;  4DHV A;  2RRA A;  2MDA A;  3OTC A;  2J7U A;  4AXJ A;  1N5T A;  4DL7 A;  3DRX A;  3P3D A;  1KQS R;  4ZK7 M;  3CED A;  1U6B A;  3EMT A;  1S48 A;  3DLG B;  4OHV A;  2Y1I A;  1R0B G;  2GA7 A;  4MKA A;  1T9V A;  1GX6 A;  3L95 X;  1XMB A;  1M5H A;  2BYC A;  4J37 A;  2FY8 A;  4OIX A;  5E3A A;  5KFH A;  2MLZ A;  1AB8 A;  1UPM B;  3QT5 A;  1VRT B;  3QWP A;  3T5K A;  3SBM A;  1R31 A;  2ZVI A;  3DFE A;  2IRU A;  4IO1 A;  2EFV A;  5ETM A;  5C42 B;  2XMK A;  4F4Z A;  5KT2 A;  2JOQ A;  3SYZ A;  1RB0 A;  1WSV A;  2M3D A;  4CIO A;  2YKQ A;  4IG0 A;  1U1N A;  1X9M A;  2J5A A;  4ZP9 A;  4OHZ A;  1SCJ B;  3ZTO A;  4YOE A;  3MEE A;  1RA6 A;  1JLA A;  1GT8 A;  2WB1 D;  3AOA A;  4ZVS B;  3BQ1 A;  4NCG B;  2HK3 A;  2RT3 A;  4IOC Q;  2BQU A;  2BX6 A;  1ZPW X;  4IH5 A;  5B0C A;  1WNE A;  3G86 A;  3H2L A;  1Q78 A;  4XAK A;  2XMA A;  3MMC B;  3GIM A;  4NXM J;  5CCM A;  1VOM A;  4DQQ A;  2HW3 A;  4UZB A;  2KO1 A;  1A6L A;  1JXV A;  2R7X A;  2AT1 B;  2COL A;  1N6Q A;  2AW0 A;  1WC4 A;  2LKZ A;  4CLY A;  2AJ0 A;  4NXN J;  3OBI A;  4OX7 A;  5DDO C;  2MKK A;  2UU9 F;  5D0H A;  4B3T F;  4F3O A;  2L3M A;  4DV4 J;  2G1H A;  4DQS A;  2NXU A;  4PWD A;  3BGO P;  2P8I A;  3DRS B;  4J91 A;  2M7S A;  4DSK A;  1LFW A;  1S72 S;  4QR1 A;  6FDR A;  3AD9 C;  1MU2 A;  2R4F A;  1Y5L B;  3QRR A;  1FVS A;  3R5J B;  3HFV A;  2HK2 A;  4NLY A;  2HFN A;  1MLA A;  4J9P A;  2OJ3 A;  5KG5 A;  2BUN A;  3MMA B;  1HQE B;  2RD5 C;  3RB6 A;  2QG9 B;  3P45 B;  3VGU A;  4CLZ A;  3RAQ A;  1HWU A;  3AY0 A;  4MKB A;  4PQU B;  4LFA J;  1W25 A;  3N6M A;  5F9L A;  3MEC B;  3ENV A;  3W62 A;  4TU9 A;  2XI3 A;  3DGP A;  3MD3 A;  2PMH A;  3RB3 A;  4WXW A;  2IM1 A;  3D3C J;  5J2N A;  1B64 A;  3OTO F;  5HVF A;  2HFO A;  1QY7 A;  1CVJ A;  4CNY A;  3VWS A;  3H40 A;  4ZCK A;  4ZVH A;  4EO8 A;  3O8W A;  3QGG A;  1NK6 A;  4FYY B;  4QOT A;  3FMW A;  3RZA A;  2XMM A;  1HWJ A;  3PIP Q;  1O5J A;  2BVZ A;  4ZVO B;  1X5O A;  3CJK B;  1TVR B;  4OI1 A;  3NOG A;  4OYZ A;  1WC5 A;  3V4I A;  1RAF B;  2KB2 A;  4HHU A;  4ZIV A;  3OXG A;  4KHM A;  4PKD B;  1QAJ A;  2IM0 A;  1X9S A;  1HNX J;  4K5R A;  2P9C A;  4LFC J;  1F5C A;  2XM3 A;  2LP4 A;  4F4A A;  3D1O A;  2DVI A;  1XNQ J;  3NBP B;  1ZH5 A;  1FE4 A;  4UOC A;  2HRU A;  3QYY A;  1RA7 A;  1YDL A;  2MKS A;  4USK A;  2RF2 B;  1FDD A;  3H5Y A;  1S12 A;  2MPU A;  3AHP A;  3N28 A;  4URG A;  2UUW A;  2ROG A;  3H5U A;  2HQ3 A;  2V8H A;  3LWL A;  3HHN B;  1DAR A;  1TL7 B;  3A4T A;  2WVE A;  1C1C B;  3RB4 A;  3DRP A;  2GIQ A;  4PYD A;  4RW4 B;  2XHC A;  2H4W B;  1N56 A;  3IR5 B;  4ELV A;  2CJY B;  1B3T A;  4ECZ A;  4KPC A;  4OJG A;  1GMW D;  2CKW A;  3TEG A;  2W9C B;  3PX6 A;  2AGQ A;  2CNL B;  4P7T A;  1AXQ A;  2J9D E;  2OD6 A;  4FPR A;  3BSO A;  4IO9 Q;  2DNP A;  2CPJ A;  2EEY A;  3EZU A;  3LP1 A;  2DNQ A;  3P49 B;  1TV6 A;  3K5O A;  4ED1 A;  3M6U A;  2HWH A;  2IRX A;  4JI3 F;  2WVD A;  2KG1 A;  1FTR A;  3C46 A;  1FNM A;  3EWG A;  3QFW A;  4LSN A;  3TVZ A;  5J1P A;  2FIU A;  3ENA A;  2LFV A;  3KK1 A;  1KLM A;  1RUS A;  3K89 A;  5FD1 A;  4A4J A;  1FKO B;  3KG0 A;  4QPX A;  1YJN S;  4U7U K;  3CJ0 A;  1Y3K A;  4RW4 A;  2C42 A;  3M4X A;  4ED4 A;  2HKE A;  1R0A B;  2LXF A;  1R6V A;  1TUW A;  3EGV A;  2EVZ A;  2ZZN A;  5J1E A;  5F8M A;  2D1C A;  2YY3 A;  2YWW A;  4IOB A;  5CAA A;  4DWI A;  5K8P A;  2WZ1 A;  2OEJ A;  1RCX B;  4OYP A;  1OPI A;  1FF2 A;  4QU7 A;  2ACM A;  4HLB A;  4Y6I A;  4C7Q A;  5HJY A;  5KT3 A;  4I2Q B;  2EWH A;  1YRT A;  2QFJ A;  4J9M A;  3CC4 S;  4IRD A;  4F4K A;  1X5S A;  4XDD A;  4B9S A;  2LDI A;  3A12 A;  3CT9 A;  2B9W A;  2A10 A;  4ITS A;  4Y0F A;  3DDI A;  4DZD A;  3V4I B;  4JI4 J;  1GAO A;  4OZ1 A;  1FK9 B;  4JI1 F;  1GX5 A;  3NGT A;  3SCL E;  1FXR A;  3UN2 A;  2YQ3 A;  4FZV A;  2W2O P;  4LSL A;  1JJH A;  2AEF A;  2G9O A;  2G1D A;  4LVO P;  4PAA A;  3BO4 A;  2ATL A;  3BSA A;  3HT0 A;  1ZA1 B;  1N52 B;  2GHV C;  1VQS A;  3ZNU A;  3AH6 A;  2Q79 A;  2H5J B;  3DU6 A;  1NDL A;  3A8J A;  5J2N B;  2MZQ A;  2QGF B;  5ITH A;  1KVK A;  3B6B A;  3I56 S;  1J5E J;  4U8V A;  1S1V A;  3CC7 S;  2PC6 A;  2H5E A;  1LWF A;  1HMV A;  2KT5 A;  3C16 A;  3PIO Q;  2KM8 C;  2C1E B;  4RW9 A;  1T9U A;  4P74 A;  2VFS A;  3IWL A;  1TKT A;  2DNH A;  2OP5 A;  2VC0 A;  1NXI A;  4ZPW R;  5FLX U;  3QSY B;  4DL6 A;  2DRD A;  1U25 A;  2HHP A;  1CJV B;  1R8C A;  1VGY A;  2ZH2 A;  4WP3 A;  3SXL A;  5SUH A;  4CZC A;  2E9R X;  2AV5 A;  2XTJ P;  5LL6 d;  3UW1 A;  2ZJQ Q;  3C19 A;  4KGK A;  2ERR A;  2AWZ A;  4WKR A;  1F2H A;  4WKY A;  2ZM6 J;  2I5J B;  1GXU A;  1FD8 A;  1P1T A;  2J0Q D;  2OPR B;  3UDE A;  1IN0 A;  1EET A;  3HKW A;  1L3S A;  1CEZ A;  3O2I A;  2DNZ A;  4ECT A;  1RLD A;  5KG1 A;  3KK2 B;  1IR2 A;  1OO0 B;  3UO0 A;  4DLE A;  4WF9 Q;  1S1T A;  2CA9 A;  2ZWP A;  1NUE A;  2GHP A;  4P72 A;  4KPY A;  5HLF A;  3NS6 A;  3AAW B;  1IBK F;  3OJU A;  3M8S A;  3Q89 A;  3NMA A;  1WKJ A;  3MM9 A;  1FDB A;  5AT1 B;  4U6P A;  2ZBI A;  3BBB A;  2NSC A;  1T05 B;  1QVG R;  2FLL A;  2UVR A;  2DR8 A;  3HVT A;  4RX6 A;  1NJZ A;  1H74 A;  1S79 A;  3GCX P;  3PFE A;  3QPI A;  5KFG A;  3WZ0 A;  2KHD A;  1WEL A;  4M8L A;  1N5Y B;  1U0H B;  3I5A A;  5E3C A;  4DQI A;  2F4V F;  4IG0 B;  1NPR A;  1JLF B;  2M4M A;  2QSW A;  5K5M A;  5A2Q Y;  3POT B;  1J2V A;  4UST A;  3CW2 C;  1VBY A;  3MM6 A;  4RZR A;  4ECX A;  4ECR A;  4CNZ A;  3HHL C;  4UOG A;  3QZ7 A;  2HFU A;  2R2S A;  2BW2 A;  3W8P A;  1H2T Z;  2UXB J;  3WC0 A;  1LFP A;  2V68 A;  2BW7 A;  1S6Q B;  3PHE A;  3OFF A;  3HZE A;  4NLQ A;  1RYS A;  2DCU B;  3TAN A;  1CLF A;  1TKD A;  4X4P A;  4CT9 A;  1L5U A;  5KFT A;  5E33 A;  3FCH A;  3FVY A;  2Q6C A;  3BRE A;  5A8W A;  1Y00 A;  2K7K A;  4F25 A;  5F8G A;  2KT2 A;  3M8Y A;  4USH A;  4I68 A;  3IBW A;  3CPW R;  2DPJ A;  5EDW A;  2XLK A;  2GJ2 A;  1KFS A;  3TUI C;  5K8N A;  2IRY A;  1SQF A;  1FNO A;  1E6Y B;  3TO8 A;  1Y11 A;  2K1R A;  4O3P A;  3R5D A;  3J7Z 5;  4UQT A;  3HT3 A;  4WII A;  2X1A A;  4IDK A;  5HMW A;  1S0V A;  1TL1 A;  1HBU B;  1AFJ A;  3ILI A;  5H9F K;  3WQP A;  5IT4 A;  3V6D B;  4DSJ A;  2HBR B;  3QFH A;  1SL2 A;  3PTW A;  4WP8 A;  2LEB A;  1HNV B;  2UP1 A;  4LF5 F;  3HFK A;  3MD1 A;  5EWG A;  8ATC B;  4DSI A;  3FQL A;  2FY1 A;  1R7I A;  3CJ4 A;  3DOL B;  2F65 A;  2W4D A;  1OWX A;  3FC9 A;  4MYU A;  4QYR A;  4BWM A;  5KFU A;  2V2Q A;  4QWE A;  2VH7 A;  1CQN A;  4W4M A;  5DO2 A;  1NKC A;  1FFS B;  1HW8 A;  2V69 A;  2C3U A;  2KU7 A;  4RW6 A;  2BQR A;  1E6V A;  5I3Q A;  4CO0 A;  1SJQ A;  1U1M A;  2BQ3 A;  3HD2 A;  4JI2 F;  2YNF A;  3NGR A;  4W98 A;  1NKE A;  1BQM A;  3H5X A;  1T9Y A;  3D0I E;  2LA6 A;  5KFK A;  1PBU A;  1SXL A;  1NM2 A;  4I7F A;  1C0T B;  2IM2 A;  2WW8 A;  4OJH A;  2ASJ A;  1RU1 A;  5KTQ A;  2M5Y A;  1M5P C;  5D3G B;  1O6X A;  2VPW B;  1UVK A;  1S4E A;  3I4P A;  4DR6 F;  2BJ9 A;  4YB5 A;  5ETQ A;  1HD0 A;  4ER8 A;  2JEI A;  1FJC A;  2X7I A;  4N76 A;  3I4H X;  2NRE A;  3QWU A;  1E6Y A;  1YJV A;  2F1F A;  2YKA A;  3CB4 A;  3EZO A;  6AT1 B;  1TMM A;  4NML A;  4AQY F;  1F9H A;  2DXF A;  2XYP B;  3H7H B;  1OSC A;  3W2W B;  4CYU B;  2ZH5 A;  3NMR A;  3VR1 A;  3ZZT A;  5IWA F;  3JQM A;  2YX1 A;  3QJP A;  4E98 A;  2E44 A;  3W3S A;  3GJQ B;  2ZE2 A;  2ABY A;  2QLW A;  3DLE B;  1KNZ A;  2BJ3 A;  3HHL B;  5D15 A;  2HYI B;  4TY8 A;  3OR2 A;  1KTV A;  1VQP S;  5C7P A;  2UXD F;  2BMB A;  3PJX A;  3NWR A;  4W90 B;  3HZG A;  3C66 A;  2WON B;  3OPK A;  3U1M A;  1S0O A;  1X5P A;  3NCR A;  1R8P A;  2GO9 A;  3D6H B;  1PAU B;  1RHQ B;  2SXL A;  3NCQ A;  3I32 A;  4NEZ A;  5HSP A;  1SJ1 A;  3VAH A;  2HG4 A;  4P2M A;  1VQ5 S;  3D68 A;  4FKX A;  1IVZ A;  2HHW A;  2ZH9 A;  3EGZ A;  3UQS A;  5I4M A;  3EGN A;  3OFE A;  4NLX A;  2J7W A;  3QID A;  2M52 A;  1U8W A;  2EW9 A;  2PSZ A;  2W2P P;  4Y2M A;  3SCK E;  2XO6 A;  2KZM A;  4OX8 A;  3MM5 A;  3PXG a;  2DPI A;  2JDJ A;  4C4W A;  1NK4 A;  5J2P A;  3MCM A;  5DET A;  2PMW A;  1JK9 B;  3Q8S B;  4X66 F;  4DR1 J;  4FNH A;  1MSW D;  2HHQ A;  5F3T A;  1X8D A;  3GR1 A;  3HJF A;  3J7Y I;  4RO0 A;  1UPP A;  4B3S J;  2BJ7 A;  2PA8 D;  1TUG B;  1PGZ A;  1YVF A;  2IC3 A;  1F5B A;  1YBA A;  2JLF A;  4ICL A;  1ZAX A;  3WHI A;  1HQU A;  3ZTQ A;  4DL0 C;  5LSR A;  1RT5 B;  3F73 A;  4EBC A;  4FPI A;  2CG4 A;  3PJ9 A;  3JS9 A;  4DR2 F;  1NAQ A;  3MHY A;  3EPI A;  4DI6 A;  7AT1 B;  2V9K A;  4RLE A;  3ENQ A;  3C15 A;  5KFY A;  2KRR A;  3BGR B;  2MY7 A;  3P96 A;  4MIB A;  2DXD A;  2NUH A;  4PG4 A;  5ETL A;  3K57 A;  1REG X;  4I69 A;  1VQM S;  1X0P A;  4F4W A;  3QO9 A;  3PRV A;  1T03 B;  4TQS A;  2V2V A;  4K0K J;  3MEG B;  2IPO B;  3I6P A;  1KHW A;  2YNG A;  1NCL A;  4QIF A;  4UT4 A;  3FSI A;  2L48 A;  1CJV A;  3PEJ A;  1PAE X;  4QPT A;  1LV5 A;  3P6Y C;  1DLO B;  2BDP A;  1UZD A;  4LF8 J;  4RL1 A;  3KKF A;  2MEW A;  2H48 B;  2VOP A;  3R5A A;  2VG7 A;  3PYD A;  4G1Q A;  3TEH B;  1X7V A;  4XO0 A;  1PIL A;  1GFW B;  2RSQ A;  3NG8 A;  2Y3Y A;  4KSE B;  3FMB A;  1NZA A;  1W2I A;  3KHG A;  1SPB P;  5F0W A;  2CIM A;  1RT7 A;  3SSQ A;  2E7V A;  4DDF A;  4URS A;  2XB2 D;  3M9N B;  1CJT A;  4NOH A;  3HO1 A;  2MMY A;  2HFV A;  2H51 B;  1QUP A;  3Q8U A;  5C24 A;  3BR9 A;  3GU0 A;  4PR6 A;  4H4M B;  5IZH A;  3G82 A;  1AZS B;  3QGH A;  2RDJ A;  2XS5 A;  3UNY A;  2YKN A;  1FK9 A;  3TX0 A;  5C2G A;  2W7O A;  4CLW A;  2BRL A;  4X4S A;  4DF4 A;  1Q82 T;  1L3U A;  5E7O B;  4WJB A;  2H3E B;  3G8S A;  2DR5 A;  4P10 A;  1X4F A;  3L9Z A;  2WSF C;  3LAL A;  2LLZ A;  2GJF A;  2VG5 B;  2C3Y A;  1P1L A;  3A13 A;  1S7I A;  4ECS A;  3GSD A;  2XSJ B;  7FDR A;  2VON A;  5GAE U;  1IJE B;  4O44 A;  3THT A;  3HLU A;  1Q16 B;  4DJB A;  4F50 A;  2ZHB A;  2CJX B;  3BH6 B;  1D9F A;  1HW9 A;  1YKW A;  4JI7 F;  2C2D A;  1GTE A;  3VZI A;  4JOU A;  2ZFH A;  3CMQ A;  3WX4 A;  4KYZ A;  2PMZ D;  1T7P A;  1WDD A;  2FTR A;  4DR5 F;  1KRP A;  1RTI A;  5HQL A;  4K4Y A;  2B7C B;  3LQV A;  1NSP A;  3I9Z A;  2M8H A;  1RAA B;  4ZOS A;  4F36 A;  2GC8 A;  4LSN B;  3T6J A;  3SZ2 A;  2A6M A;  4M95 A;  5LSL A;  3QRQ A;  2ZH4 A;  1K0T A;  2BM0 A;  5FLX Y;  3BQ0 A;  5T41 A;  4F04 B;  3JSM A;  1BQN A;  1FRJ A;  4J5O A;  2YPY A;  2FVC A;  4LUB A;  4F8R A;  1K9M T;  3HSJ A;  1JLB A;  1KQK A;  2YVS A;  1X0F A;  1SL0 A;  2R8H A;  3D7S B;  3D2W A;  2H5I B;  3I5C A;  1SH2 A;  3V6J A;  3JQK A;  1CBK A;  4IKA A;  4PG5 A;  4R0E A;  5KFF A;  3HVR A;  3SI8 A;  3TAR A;  3GCW P;  1VFJ A;  4OZ5 A;  5D6G A;  3TA0 A;  2IVF B;  1RTD B;  5B0B A;  2FJX A;  4RWX A;  3WX8 A;  4C8K A;  1REV B;  3K58 A;  2M88 A;  1S1U A;  4DR4 J;  5RUB A;  5J1N A;  2B9Y A;  4O44 B;  3NNC A;  2HIQ A;  1UTA A;  2I1R A;  2BXJ A;  4UZC A;  4L75 A;  4CO5 A;  5BJR A;  3MFI A;  2RF2 A;  2ZDO A;  3TZY A;  5CH7 B;  1ZM2 A;  1HI0 P;  3BYP A;  1Z1Z A;  4FDF A;  4ZP8 A;  1FRI A;  3KG4 A;  3NBP A;  3VAI A;  3PO5 A;  1P9Y A;  2I38 A;  2KJW A;  4B3R J;  5KFC A;  3V6K A;  2Y8W A;  1VHI A;  5A0Y A;  4L72 B;  2Y1J A;  4DV3 F;  4KV8 A;  1U26 A;  5GAG U;  1M1K T;  4LR8 A;  3DMJ B;  4C98 A;  2EC0 A;  4HVZ A;  1I94 F;  2VF3 A;  3MM8 B;  1LW0 B;  3OV7 A;  4AL6 A;  1VQN S;  4DR3 F;  3VQS A;  4DPU A;  4QYZ K;  1CJK B;  2VL1 A;  3OTD A;  3OT9 A;  2ILZ A;  4XK8 C;  2FHJ D;  5DLF A;  3HUL A;  2R2T A;  1XIQ A;  3C6U B;  1IJF B;  1WF0 A;  3MWB A;  5E41 A;  5KFN A;  1ZZN A;  1YZ7 A;  4DR2 J;  4HDG A;  4Q7A A;  4IR1 A;  3QT8 A;  1AA1 B;  1JXE A;  2JC1 A;  4PCQ A;  4USJ C;  4DX8 H;  2O01 C;  1DQ9 A;  5BXI A;  3MUV P;  1QVF R;  3CIM A;  1JLE A;  1ZZF A;  3BGF A;  2N82 B;  1GXL A;  3IA0 A;  3HD1 A;  2FVP A;  1OIA A;  4ZN1 A;  4DFP A;  3IWX A;  3U02 A;  3GSI A;  4JI7 J;  2Q6B A;  1S1W A;  2O1P A;  3BKT A;  2LEA A;  4U96 A;  2CQH A;  3KHH A;  2ZH6 A;  3BZQ A;  4DPY A;  1YHQ S;  2FVR A;  3P5B P;  1MU2 B;  2JFD A;  2MZR A;  1NPP A;  1T03 A;  1RTJ B;  4YY3 J;  1G1X A;  2FJW A;  3DRS A;  4ID8 A;  3C3L A;  2XZT B;  4OX9 F;  3V5R A;  5D8H B;  4DPT A;  4M1K A;  1R8H A;  4Q44 A;  4MK7 A;  2DYA A;  4O4G A;  4ILR A;  4OFZ A;  4LSZ B;  4GVB B;  4XPC A;  1K47 A;  2D3U A;  4DV1 F;  1VBK A;  3CDU A;  4R0J A;  2EFP A;  2KJV A;  5F8L A;  3QJL A;  2DH8 A;  4FN5 A;  4ZJQ A;  5KG0 A;  3DDK A;  2OLW A;  3BR8 A;  4I4B A;  3WC2 A;  2ZBP A;  2R2R A;  2RIL A;  4DSF A;  3S7R A;  3VGS A;  3CCQ S;  1OY8 A;  2CQC A;  4LF4 J;  4KFB B;  1RT4 B;  1URR A;  2RHQ B;  2Y8Y A;  2B5J B;  4JUZ A;  4FXV A;  5J2P B;  2FB0 A;  2WBM A;  3D9B A;  3H59 A;  3WIU A;  2BKO A;  2DIS A;  4ES1 A;  4X4V A;  5D78 A;  4LF6 F;  1FWL A;  2G13 A;  2XSF A;  3K8V A;  4KHP J;  4NE9 C;  3ZC4 A;  4IRK A;  1RAH B;  2Q43 A;  2PD1 A;  1IWG A;  3BB5 A;  4F7V A;  3UFC X;  4A8Y A;  4ZVT B;  3LAM A;  2MZ1 A;  4QWB A;  3FGV A;  3JAM Y;  2V0N A;  3C14 A;  3Q0A A;  3KUE A;  4GKJ F;  2RDI A;  2AGP A;  1WOR A;  4Y34 A;  2IYI A;  3F41 A;  1LOU A;  1S6O A;  4OHW A;  2XY5 A;  2OEK A;  2FZG B;  3KNG A;  4S0M A;  3FZB A;  1VRU A;  5LXR A;  4DQP A;  2ZE2 B;  3DLE A;  1RWK B;  3IFE A;  3JTN A;  4IG3 A;  1T0T V;  3OSN A;  4HHH A;  1YWX A;  1FRL A;  3MMJ A;  4WK3 A;  3U1N A;  3KJV A;  3LWM A;  3JQJ A;  4CYU A;  5L9N A;  3BKF A;  1IKX A;  3FBE A;  3ZTR A;  1VBZ A;  4ENO A;  2VA3 A;  3CME S;  2J8S A;  3KHR A;  2X1F A;  3MMB A;  3D3B J;  2EFN A;  2ZC3 A;  5LJ5 Y;  1FE0 A;  1N88 A;  1HWI A;  3NGK A;  1WC6 A;  2V5H G;  1MWQ A;  2D9P A;  4I6Y A;  3PVX A;  4R5P B;  2ZKU A;  2IAJ A;  4J9S A;  4K59 A;  1JLG A;  4X66 J;  4DR1 F;  1T94 A;  3RTV A;  1R3N A;  2AMC B;  3NS7 B;  4J9V A;  3A8I A;  4M5H A;  3KLV A;  2DGS A;  4ZPD A;  2YQ1 A;  1XR7 A;  1SKU B;  1EQ0 A;  1NB7 A;  1T11 A;  5DQI A;  5LM7 E;  3W5Z A;  2GIR A;  4IQM A;  4OJ3 A;  4YME A;  4OZ0 A;  4DR4 F;  2OD4 A;  2C2N A;  1HNW F;  5CZV A;  1UJ6 A;  2MQP A;  2WW4 A;  3ELH A;  1E6V B;  4N77 A;  3KMQ A;  2V50 A;  1D9D A;  1VIS A;  4NMX A;  3G9C A;  4YR3 A;  4IFY A;  4MT1 A;  2ZZT A;  3MMB B;  1PYS B;  4X62 J;  2E1C A;  4JI3 J;  1HBN B;  2O66 A;  3FFI A;  5DDP C;  3EJM A;  1HNV A;  4NLD A;  3TVK A;  4DX7 A;  4NLO A;  1VK8 A;  3MGJ A;  4ZDN A;  4HT5 A;  3IGN A;  5DG7 A;  4PQA A;  1PYO B;  5ETN A;  1TL1 B;  5C5J A;  5CXT A;  2RUG A;  5AXM A;  2CQB A;  1IBL J;  1Q7L B;  4NLR A;  2F4V J;  2RQK A;  6FD1 A;  5KFJ A;  3KTQ A;  1H0H B;  2DD8 S;  3EE3 A;  2C3O A;  4A8O A;  5BR8 J;  3HK2 A;  3LH2 S;  4GO5 X;  2CNN B;  3BPS P;  2RAQ A;  5C25 B;  3NL0 A;  3CVK A;  2YKP A;  5A6P A;  1HWL A;  2CQ0 A;  1TL3 A;  4ZIW A;  1VRU B;  3E8O A;  3GMG A;  1XMO J;  1BE4 A;  1WF2 A;  2DGU A;  1O0P A;  3PDN A;  1FVQ A;  2DR9 A;  1QD1 A;  1XTZ A;  2MJU A;  3AT1 B;  3Q8R B;  2AEM A;  3RW7 A;  2K3K A;  2ZIT A;  1U1L A;  1V3Z A;  3MI7 X;  4J90 A;  4FYV B;  4K8R A;  4NLV A;  1BY9 A;  3T6B A;  4CLT A;  1SI9 A;  2IA0 A;  4LRA A;  2LEC A;  1RT4 A;  3OD2 A;  9ATC B;  4DV3 J;  2BOA A;  1ZTW A;  5B0F A;  3MR3 A;  2RQC A;  2X3D A;  1DAX A;  3D4J A;  4I64 A;  5HVG A;  4CWB A;  1HYS A;  2HQC A;  4DV7 F;  2KL8 A;  1I5O B;  2FHJ A;  3GJR B;  3ETM A;  4AE5 A;  1V9O A;  4ID5 A;  1U49 A;  2PI4 A;  3HVT B;  1YI2 S;  1RT2 B;  3BS9 A;  1YGY A;  2FQQ B;  1WJ9 A;  2MZT A;  5ETS A;  3CCJ S;  4K4T A;  2HQD A;  4UY8 T;  5KFR A;  2GZO A;  4NLT A;  4ATN A;  5FDL A;  2Z2Y B;  5EN1 A;  3NLC A;  1RHJ B;  5EGY A;  2AJ2 A;  3PY8 A;  5HLF B;  2IY5 B;  1F6T A;  1VQY A;  2BJ8 A;  3GZ7 A;  2AZ3 A;  5IC6 B;  3W7B A;  2Y0B B;  4HTJ A;  4Y28 C;  2OPS A;  3FDS A;  2MKI A;  4DSL A;  2K06 A;  3NY0 A;  4PG7 A;  2VFT A;  3KK2 A;  2ZVS A;  5GMD A;  3SDE A;  5KFI A;  3R5C A;  2CZ4 A;  1TKZ B;  2FD2 A;  1S4F A;  5A8K B;  1M5V C;  4M5G A;  2UVU A;  2KFY A;  3T9N A;  1JLE B;  1KON A;  1RHU B;  1UFK A;  3Q83 A;  2IDL A;  1RTJ A;  4YFU A;  3JSB A;  4LBH A;  2A6O A;  1SIW B;  2OUG A;  4I67 A;  1D09 B;  4YDD B;  4B3T J;  1JXL A;  4ZPB A;  3K5P A;  5KFA A;  5KOW A;  4GC6 A;  1S1W B;  3AOD A;  2W01 A;  3GYG A;  3D67 A;  1OYD A;  2ALY B;  2V8V A;  2ZOG A;  4GKJ J;  1WTB A;  4QIG A;  4I0W A;  3VVT A;  4USU A;  4CH7 A;  2XMV A;  3MM8 A;  4M5N A;  4I1T A;  2B51 A;  1IBL F;  1UJ4 A;  2XY6 A;  4WE1 A;  3VCD A;  1X4D A;  1U02 A;  2HVZ A;  1TP7 A;  2W2Q P;  2V67 A;  3TJ8 A;  3Q24 A;  1SQE A;  2E9T A;  2DXE A;  3X3U A;  4DV2 F;  3RRK A;  4MKY A;  2DRA A;  2JFK A;  2MZJ A;  1RT1 B;  4TYA A;  5KG4 A;  4DR7 F;  1NK0 A;  4NLP A;  4R8U A;  2HVI A;  3D54 A;  1GTH A;  3DM2 A;  1S5Z A;  1IBM F;  2E5L J;  3K0J A;  5A0Y B;  2QJ3 A;  1RTD A;  1T3N A;  4OZ3 A;  1CPZ A;  1LXN A;  4B3O B;  1BWV A;  4TNO A;  3W9J A;  4TU8 A;  1N5V A;  1WKK A;  2CPZ A;  2EXU A;  4OZJ A;  5D0E A;  2J76 E;  3H5S A;  2HMI B;  5IC4 B;  5LMU J;  4E0D A;  2DGO A;  2HFS A;  3QRP A;  4DPW A;  1S1U B;  1REV A;  2VPX B;  2MKC A;  1FEE A;  3I0S A;  4HAC B;  3KUG A;  3R97 A;  3CDW A;  1HR0 J;  2LU1 A;  2HNY A;  3P5T L;  5G4D A;  5I42 A;  2D7S A;  2LA4 A;  4OI6 A;  2HNZ A;  3N6L A;  3PFO A;  5L46 A;  4AD6 A;  2Z0G A;  2I9S A;  1VK3 A;  4RBV A;  4JYA F;  2ROP A;  2UVW A;  2OPP A;  3AQP A;  4KH1 B;  2MB0 B;  5IS2 A;  2YQ0 A;  4NRT A;  4LF7 F;  4URQ U;  4U7U D;  3HSD A;  3R7S B;  4HL9 A;  2QL5 B;  1VR6 A;  3A1Y G;  3NNA A;  4WWS A;  1HAR A;  1FCA A;  3M2U A;  4JI8 F;  2LXI A;  2KH9 A;  4BC7 A;  2GCF A;  2MQL A;  3CGI A;  1WOP A;  2LXU A;  2JWN A;  2ZC4 A;  5BYQ A;  1B70 B;  4ZP7 A;  1IKV B;  1FKP B;  3BDE A;  3FBC A;  3ONQ A;  3I55 S;  1RHK B;  2CFX A;  2ZBC A;  5D4L A;  1XR6 A;  2FJB B;  3SMZ A;  4DZ6 A;  2HMI A;  2XSJ A;  1X4E A;  4J9L A;  2V8G A;  1IKY B;  1SC4 B;  3G6E S;  3M05 A;  2VG5 A;  8AT1 B;  2DNR A;  2QIF A;  4X4T A;  1C1C A;  4OHX A;  2HHX A;  3DDN A;  1RBO B;  2VPY B;  4ELU A;  2FPH X;  4PYA A;  3MR7 A;  5HRO A;  1YTY A;  1EAR A;  1UFW A;  3DM2 B;  4KHP F;  3OHB A;  3GWC A;  3EGW B;  1N4L A;  2UUB F;  1RT1 A;  1Q7Y T;  4FF2 A;  2VAS A;  4YEA A;  4EZ6 A;  1WG1 A;  1R0C B;  2CPX A;  2YKN B;  1SKR A;  3PKM A;  5EUH A;  5KFV A;  3TAP A;  4ZPC A;  2QMW A;  3HP6 A;  3G71 S;  3R7N B;  1VYA A;  1VIO A;  2FC8 A;  2OHD A;  5KFQ A;  1H6K X;  1NHK L;  3BN4 A;  4ED6 A;  2ALZ A;  5T7L B;  4JV1 A;  2BAN B;  3DOK B;  4KGX B;  1B7F A;  3PRD A;  3W9H A;  4IFV B;  2HEK A;  2HHU A;  4LMZ A;  5D0G A;  3J7Y U;  4PWU A;  1RBA A;  1NSK L;  3CNQ P;  2BE9 B;  3I0R A;  4DV7 J;  1M90 T;  2VG7 B;  3RB0 A;  1SH0 A;  1O8B A;  2HFZ A;  2GVZ B;  2VDI A;  2Z8Q A;  3AB2 B;  3E51 A;  2RUS A;  3KDN A;  5C24 B;  4ZKA A;  2DNG A;  4F0H A;  5IT0 A;  1UZH A;  1S9G B;  1W7W A;  1RT7 B;  2ZD1 B;  5I3U A;  4C6A A;  4V19 J;  3L09 A;  2HGN A;  3T9Z A;  3W61 A;  2M8D B;  4IUF A;  3MEC A;  1IR0 A;  1C0U B;  2NZC A;  3LGM A;  4NYZ A;  3TR5 A;  1QSS A;  3QIP A;  4K2X A;  4C8Y A;  2HWT A;  1RP5 A;  2CDR B;  2B7B B;  3TJA A;  2V8D A;  4HI1 A;  3AA9 A;  1U4B A;  2NUU G;  1TKZ A;  4DR5 J;  2YH0 A;  2MKJ A;  4U67 Q;  2FVS A;  3RR7 A;  1LWC A;  4OX6 A;  1ACM B;  3SDE B;  5KT5 A;  3OW2 R;  3G4S S;  1FER A;  3CJ5 A;  2ZH7 A;  3ISN C;  4RUH A;  5LXY A;  1EX8 A;  3MEG A;  3DKD A;  4CP5 A;  3M1V B;  5DG9 A;  4Y2K A;  3HJV A;  1RXO B;  2I2Y A;  3UCU P;  3GTY X;  2IC3 B;  4ICL B;  1XNQ F;  1R43 A;  3PM9 A;  3TA2 A;  2CXE A;  4KBI A;  2OFG X;  4KKO B;  3PW2 A;  5IT9 U;  4ANE A;  3CE8 A;  4TU7 A;  1Y4Z B;  3PV8 A;  3GJT B;  2QC3 A;  5HN0 A;  3D6T B;  1V5V A;  4RNO A;  4WK1 A;  1LKZ A;  2YWH A;  3SV3 A;  2MSS A;  1GXT A;  5JXS A;  4HYK A;  4BHQ A;  1MRO B;  3E3X A;  4DF8 A;  3LUY A;  5F8H A;  4B9V A;  3D28 A;  3I5B A;  3RAM A;  2WVF A;  1VQ7 S;  3RRG A;  4FBU A;  4ZHR B;  1IQZ A;  1SBR A;  4B3R F;  2R2U A;  5F3Z A;  3IGV A;  1FKA F;  3TZW A;  2A0F B;  2QV6 A;  1T3O A;  1SV5 A;  1NH7 A;  2DHH A;  2IVY A;  4RBU A;  1X4A A;  2BV3 A;  1V3R A;  3B4M A;  2AHO B;  1RTZ A;  3C8Y A;  4TY8 B;  5HAT A;  3SSS A;  5C42 A;  2F40 A;  2QYC A;  4TLQ A;  4HH0 A;  3MED A;  2XUL A;  1X4B A;  4NRU A;  3CJS A;  4XDC A;  4PG6 A;  7FD1 A;  2QA4 S;  5H9E K;  4LRD A;  4Z37 A;  3C2P A;  1ZS6 A;  1ZM3 A;  2QFI A;  3DLG A;  3LPE A;  3OUY A;  2R8I A;  3OR2 B;  4X65 J;  4PXC A;  2RB7 A;  2JSX A;  4NYO A;  3KK3 B;  4X64 J;  4DS5 A;  4EWT A;  5LMN F;  1U1R A;  2J6T A;  1RJJ A;  1OQ3 A;  2B8Q A;  2IMO A;  4RW8 B;  3DLJ A;  1N0U A;  4Y2I A;  3SQG A;  5THW A;  2KXN B;  2ASD A;  2AGO A;  2U1A A;  2VPZ B;  3CJT A;  2YNI A;  5CZX A;  2V4Q A;  1XQI A;  3WBZ A;  1C0T A;  2IVM A;  1S99 A;  2GFF A;  4K5S A;  4FKY A;  2BZ2 A;  4IFY B;  4MYT A;  2FLP A;  4NXN F;  3R5G A;  1H2V Z;  5K14 A;  2VQE F;  1KP6 A;  1WEZ A;  2HHS A;  1U09 A;  4FS1 A;  2PN6 A;  2YNF B;  3F0N A;  2GNK A;  4KGV B;  3PW7 A;  4DX6 A;  3PW0 A;  2HS3 A;  4H4K C;  3GV7 B;  4PUO A;  5CD4 A;  2QX0 A;  1TR0 A;  4NA1 A;  5D3G A;  2VG6 B;  2O3D A;  5BYS A;  2BE2 B;  2R7W A;  3CC2 S;  1NSQ A;  2N3O A;  1XK8 A;  2HZA A;  5B0G A;  2NPF A;  1HQ2 A;  1XEZ A;  4A8S A;  3UR3 C;  3KHL A;  1XER A;  4ZLL A;  2VB6 A;  4PUO B;  1RAC B;  1DFD A;  2NXE A;  5A8R B;  5K20 B;  3NGD A;  2DRB A;  2IAJ B;  3PNI A;  3V6D A;  3PR4 A;  2R7U A;  1U1K A;  1HBU A;  3MPY A;  2QMX A;  4PG8 A;  1Q5V A;  3HI9 A;  5KT4 A;  4EZ9 A;  3OQ2 A;  3TOQ A;  1YSJ A;  2YWG A;  5CYJ A;  3DOL A;  1M1G A;  2OPQ B;  3DC2 A;  3GON A;  4RR5 A;  5DRK A;  2A2C A;  2WTF A;  2UUT A;  1V5I B;  3E2E A;  2YWK A;  3CJ2 A;  2IJR A;  4EFA C;  4LFB J;  2F8H A;  2DIT A;  1LK7 A;  4ED3 A;  3S8S A;  1YQH A;  2MLX A;  3QT7 A;  3JTO A;  4C11 A;  4EEY A;  2HSE B;  4CO4 A;  2AIR B;  2PFD A;  2ZUA A;  2K1R B;  3EXY A;  3E01 A;  2AYE A;  3PRB A; 
#chains in the Genus database with same CATH homology
 3GJS B;  1I51 B;  1RHU B;  3R6L B;  2H4Y B;  4ZVU B;  1QTN B;  4DCO B;  3RJM B;  2XZD B;  2CDR B;  1ICE B;  2H5J B;  3EDQ B;  2H54 B;  1RWP B;  2XYP B;  1RWK B;  2C2O B;  2C1E B;  3R5J B;  3EDR B;  3GJQ B;  1RWV B;  3KJF B;  2CNK B;  1BMQ B;  3P45 B;  2H5I B;  2QLJ B;  2QLB B;  2C2M B;  3GJT B;  1I3O B;  3D6H B;  1PAU B;  1RHQ B;  2XYH B;  3NS7 B;  4DCJ B;  2C2Z B;  2HBQ B;  4ZVR B;  2QL7 B;  3KJN B;  3P4U B;  4ZVO B;  2DKO B;  5IC4 B;  1RHM B;  3D6M B;  3SIP B;  1RWN B;  1PYO B;  3IBF B;  4ZVP B;  1RE1 B;  3R7S B;  2HBZ B;  2QL5 B;  1RWX B;  2CNN B;  2H4W B;  1RWM B;  2CJY B;  1SC3 B;  1IBC B;  1RHR B;  2CNL B;  1RHK B;  1QDU B;  2H48 B;  1SC4 B;  1GFW B;  2XZT B;  2C2K B;  4LSZ B;  2QL9 B;  4ZVQ B;  2H51 B;  3KJQ B;  2HBR B;  2Y1L B;  1NME B;  2HBY B;  3GJR B;  1F9E B;  5K20 B;  3QNW B;  4JB8 B;  2FQQ B;  3R7N B;  2QLF B;  2CNO B;  1RWW B;  3R7B B;  1RWO B;  2H65 B;  3IBC B;  1RHJ B;  5IC6 B;  4ZVS B;  2XYG B;  2Y0B B;  3R6G B;  2P2C B;  1SC1 B;  4DCP B;  3D6F B;  2CJX B;  4ZVT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...