1I51B

Crystal structure of caspase-7 complexed with xiap
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-7 SUBUNIT P20
publication title Structural basis of caspase-7 inhibition by XIAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1i51B00
3R5JB 2C2MB 2HBZB 1RHRB 3P45B 2CNKB 1RHQB 4ZVRB 1QTNB 3RJMB 2HBQB 1RHUB 2CNNB 2H65B 1GFWB 2QL9B 1PYOB 2CJYB 2C2ZB 4ZVQB 2XYHB 3D6HB 2CDRB 5IC4B 3KJQB 1RHKB 1RWPB 1SC3B 1SC1B 3GJTB 2XZTB 1IBCB 2XZDB 2CJXB 2C2OB 3GJSB 2QLFB 2H48B 4ZVSB 2H5JB 3SIPB 1RHJB 4JB8B 1F9EB 3R7NB 3GJRB 1ICEB 2H51B 2HBYB 2P2CB 4LSZB 2QLJB 5K20B 2DKOB 1RWKB 2CNLB 4ZVOB 3P4UB 3KJFB 3EDRB 2XYGB 3QNWB 2HBRB 3R7BB 4DCOB 2CNOB 5IC6B 2H5IB 4DCJB 1RWVB 1I3OB 2Y0BB 3D6MB 2Y1LB 3D6FB 2H4YB 4ZVUB 3IBFB 2FQQB 2C2KB 3NS7B 3R6GB 3GJQB 1RHMB 1PAUB 1BMQB 1NMEB 3R6LB 3EDQB 3R7SB 1RWNB 3KJNB 2H4WB 2H54B 1RE1B 4DCPB 1I51B 2C1EB 2XYPB 1RWXB 2QLBB 4ZVTB 1SC4B 1RWOB 1QDUB 2QL5B 1RWMB 1RWWB 4ZVPB 3IBCB 2QL7B
chains in the Genus database with same CATH superfamily
1YBTA 4DX8H 2CAJA 3UCZP 1RHQB 4J91A 2YNHA 4RW7A 1PJ7A 2P9EA 1XMOF 2MHNA 2L9NA 2BJ1A 2IVMA 3ITHA 1QAIA 3MR6A 2XULA 3WHIA 3RRKA 3FSIA 3I6PA 4I2QA 2KHDA 2BRLA 3HZGA 4UZBA 1YZ7A 3LF0A 3W63A 4WE1A 4UW2A 4ZA1A 3DC2A 5A8WB 2DH7A 5I3UB 3QZ7A 4F26A 5CZXA 1X5SA 4QPTA 1V3RA 5KFSA 4ECQA 1WHWA 1JWWA 2Y0SD 1WC0A 4K0KF 1BQNB 3G87A 3ZNUA 4RNMA 2R7OA 2AIRB 4WU2A 4Y34A 4YB5A 1R89A 3M4XA 1BLUA 2VFRA 2VQEJ 2OSRA 1Q7LB 3SXLA 5M2RA 1C1CB 4HHUA 1HNXJ 4UOGA 4ZP8A 4DQIA 4ES3A 3GIMA 1XC9A 5HROA 3DRRA 2A2DA 1JLQA 3QIPA 3MFIA 2V8DA 4AYBD 1VRUB 3J7YI 4NCGB 2IC3B 2E5JA 2IIHA 4ZJQA 2HBQB 2NUUG 3BF4A 1QAYA 3WDOA 3RB0A 4YFUA 2D41A 1RT4B 2BW2A 4WTOB 4F0KA 2PA8D 2QO3A 4KHMA 2BQ3A 1EZZB 4GC6A 4IFYB 5AXMA 3EICA 5F8JA 4ZOSA 3RTVA 4KHPF 3TJ9A 4B3OA 5A0YB 1U49A 4WFNQ 2K3IA 2YPZA 5F8NA 4JI1F 4JV1A 2HHTA 3W1YC 2EFOA 2ZBPA 2MSSA 3OVBA 2MQQA 2VD3A 2DCUB 2R2SA 2HRUA 5AT1B 3POTB 2PFFB 1IBLJ 1TKTB 2P9GA 4DG1A 1VGYA 2MQLA 3FZBA 4OZJA 2HNDA 1KP6A 2YVSA 2UXCF 1BQMB 3M2VB 3I4HX 4EO8A 1U6ZA 4URGA 5HMXA 2O67A 1N0VC 1SPBP 3QJPA 3TAQA 1RT5A 3CJKA 2UXDJ 4Y00A 4ZP6A 4H4MB 3ET6B 4DZDA 4GO5X 1J27A 4QIFA 2C2MB 3TRGA 2KB2A 4D3HA 2YNFA 2V68A 3M9MB 2ZJQQ 1WI8A 1DLOB 2XS5A 4USMA 2COLA 3DDIA 1RAOA 4K4SA 2ZVSA 1KQSR 5KG0A 4DX5A 3VQTA 4RW6B 5IQQA 4OV1A 3JQMA 2WVCA 2HYIB 3T9NA 5E3QA 3W5ZA 4Q5VA 3MR7A 5HN0A 3IRXA 3GFYA 1IJFB 3RG6A 2GQQA 4NA3A 3J7ZT 2W2MP 1WI6A 5B0CA 5GAHU 2VG7A 3DRSB 1P6TA 1HBMB 3LO3A 1S7HA 3MAAA 1RAGB 1I1GA 1NHUA 2HFZA 2EBGA 2FYXA 4DL2A 1VBXA 5DG9A 1U09A 2IAJB 4JI6F 5IM0A 2ZM6J 3BBBA 4USKA 1FT8A 2HMIA 2W4PA 8AT1B 4QR0A 3UVJA 4Z37A 2RDIA 3G96A 3LQVA 4F02A 3HVTA 1DQ9A 1VBZA 3PV8A 3SCJE 2EXUA 2VPYB 4Q8EA 2GO8A 4XIUA 4MTPA 2OAUA 1S0MA 4XO0A 3MEGA 1S6OA 1FRIA 3GJSB 3D3CJ 1Q95G 1MWYA 3M6UA 5KG2A 4JI7F 5EX3A 3K5OA 1WUUA 5CD4A 2OPQA 5DGBA 3O8WA 1KN6A 4OJGA 2UU9F 3PDNA 4C11B 1B0VA 2HSEB 4HI1A 3MR5A 2FJBB 2BDPA 4RWWA 3O2IA 2HS3A 2DK2A 4JI2J 4N77A 2LLZA 4LBPA 1HNZF 2YWEA 3BEGB 3BYRA 3CDWA 3A3NB 2R42A 1HLWA 1WORA 4IDKB 3DMJB 1K8AT 3CSKA 4KAIA 4EZ6A 1F5BA 2PT0A 4OZ3A 3GQCA 4CYUB 2IM3A 1M5HA 2IMOA 4R5PB 4TQRA 4U67Q 1RBAA 3BPSP 3FQKA 2NXUA 3LWMA 5C42B 3BKUA 2QL5B 4NRTA 5E3AA 2FUG9 2F40A 1FKPA 3TEHB 2DNZA 4KQZA 1QTNB 4WYWA 4ECYA 4Y2AA 5HANA 3AHPA 2J9DE 1WKJA 2RQKA 4CLUA 5C2GA 3G9CA 2IPOB 3NWRA 1FVSA 2W8KA 4DV3F 2A18A 4ZLNA 3NGRA 1CS4B 1HBUB 3AQOA 2FJWA 1T9TA 2G13A 4OX9J 3PO5A 3M6WA 1J5OB 3MCSA 2ZC4A 3D2WA 5J2NA 4EBDA 2XNRA 1Y5NB 4OI6A 4OZ1A 2JOQA 2H5IB 2KT2A 4C3LA 1NSKL 2C2NA 3KNGA 4M8LA 1APSA 3KYLA 2K06A 3AH6A 2VV5A 2MGZB 3D6FB 4I6AA 4KTQA 4PAAA 4ZVUB 2KXFA 3DOMB 2GZOA 1FXDA 2J6TA 4MT1A 4ZKAA 4W92B 4OYZA 4ZS6A 3BGLA 1JLCB 5SUHA 2W4DA 4LSNB 3A4TA 1F60B 4ZVTB 4RW9A 2NXCA 4DR3J 1FO1A 2CKWA 2AF6A 5GMDA 4KE5A 2Z2ZA 1OIAA 2IRXA 3DDKA 1HBOA 5MLCV 4M5MA 3DLEB 1YRTA 2R7TA 2KTQA 3I0RB 5H9EJ 3HD2A 2RT3A 3CDAA 1D8YA 2FY8A 3CXCR 2R8HA 4IG3A 1XEZA 2AJ2A 4TLRA 2HPUA 3R7NB 4DV7F 2KM8C 2H51B 3GSDA 4F2RA 4C0HA 5FD1A 4X65J 1YKWA 1JK9B 2R4FA 1HW8A 3S01A 4DUYF 2AQ4A 5I3PA 1X0FA 4G1IA 5D4NA 4NOHA 3JB9k 3NBPB 5BYSA 2M7SA 4AXJA 3WC0A 4AXIA 4QWBA 5D15A 2A2CA 3OPKA 1LWFB 4U96A 1S6QA 3T5JA 1LWEA 4FVCA 1IM4A 3RBDA 4X4OA 2V2ZA 5B0FA 4CIOA 2EW9A 4NZ0A 3SCLE 5B08A 4PXBA 5HP1A 2QA1A 3D0HE 4ZPTR 1T3OA 2LXUA 3M2RA 3HHNB 1DQAA 2VA3A 1RTHA 2FPHX 4NYPA 1NNDA 5KG5A 3QGGA 2ZWPA 4R0EA 3ZC4A 4I2QB 2W24A 1ZA2B 3O3LA 2H1YA 3BGRA 3VQSA 3KKFA 1O51A 5CCMA 1IR1A 1FE0A 1N33J 2UVUA 3GFXA 5J1EB 4LFCF 1S79A 1MN9A 1NZ8A 1S1WA 3FC9A 1AT1B 1R0AB 1H2VZ 1UVJA 2O1PA 2FLOA 3MMBA 1CG2A 1K1SA 3OTCA 4A8FA 1RYRA 1WEXA 4MK7A 5KFHA 3TJ8A 2FZGB 3I0SB 4DQQA 3GIJA 1SC4B 4QBUA 2GA7A 2YKQA 4ZPBA 3BKTA 3J81U 5KFMA 4MMOA 4ZVRB 1E6VB 1S72S 4CLYA 2P8IA 2FHJD 5C25B 1XMQJ 2JX2A 1Q78A 1TELA 3MEDA 4DV4J 4JI8F 4IQXA 3MM6B 5LSRA 2CJBA 4OZLA 3HJFA 2NSBA 1YQHA 3HT0A 5KT3A 1WC4A 4I2PB 2AEMA 1FEEA 2DIUA 2J0WA 1WG1A 2UZAA 4HT5A 2AD9A 3AD8C 3ICLA 1IUJA 3HJVA 3GE9A 3M8SA 4ZCLA 4M5DA 1SJRA 2QMUB 2AJ4A 4ECWA 2ZNYA 1SJFA 3SDEB 1IN0A 4DPUA 4DX7A 3GG0A 2OI2A 1KLNA 3UW1A 1KTQA 3R27A 3UDEA 3UDVA 3M8PA 1CPZA 4OLPA 3TUIC 2PSZA 4TY9A 2BR0A 3HHKA 4DSIA 1B7YB 4DCPB 1FFGB 2OEMA 4WK3A 1JX4A 2VFUA 4YY3F 1IKWB 4QOTA 3CPWR 1YBAA 2LEAA 4OHZA 1YK9A 2PMWA 1AA1B 5CXTA 2D74B 4MH8A 2XO7A 5J1NA 3G86A 1N5TA 4LMZA 3DGPA 3CCMS 5DDRC 2GW8A 3H5XA 4RPFA 2MZ1A 2PGCA 3LGNA 2U1AA 1UFWA 5A2QU 3DM2A 5HO4A 3M8ZA 1TK0A 3T41A 3LH2S 1FK9A 3W61A 3N6MA 3OL8A 4ZHRA 2Z2MA 2MKSA 4DZ6A 2XC9A 4RW4A 3GR0A 5HATA 2L3MA 2L41A 3HT3A 3G8TA 1RT6A 2VG7B 4WCEQ 1LFWA 1QSSA 3LAKA 4CLKA 3TYTA 2FHKA 3OTEA 1CC8A 3OV7A 1FFSB 1UVNA 4XTTA 1VOMA 2IM1A 1SH0A 5CYQB 4LUBA 2HVIA 1H7WA 1HQEB 1NDPA 4ANCA 2AGQA 4FKYA 3MPUB 1SUQA 1UFLA 1WKLA 5LL6d 1M1GA 1U24A 3KHLA 3HVTB 4LF8J 2MQOA 4DR2F 2FVPA 4OIXA 3MEGB 4OLOA 4DX6A 1D09B 1KBRA 3DXBA 1TL7B 3CCJS 3M30A 4LQ3A 5HJYA 2IA6A 2WRMA 4QQBA 4OX8A 2DNMA 3IAS9 3ZZRA 5HAOA 2WSEC 1U1KA 4UZCA 4KGMA 4OI0A 2DGUA 4ANEA 3HXMA 2VBYA 3V81B 3EXYA 1B3TA 4CDIA 1IXKA 1ZM3A 5FDLB 4PXDA 2ZZTA 5J2MA 2PDAA 4BBYA 1RU2A 3BQ1A 2ZOFA 1S1XA 2CZVC 3TA0A 3DLKA 3GJQB 2IYIA 3T5HA 2CQ4A 1TVRA 1K0VA 1S6PA 2KZMA 2BJDA 2ATCB 4EBEA 4NX9A 4G3IA 3C14B 4GMKA 2CYYA 3R5JB 5A8KA 5DQHA 2G1DA 2HNZB 1WOSA 2O01C 3NGSA 2V0NA 2HS4A 2DNHA 2E1CA 4WPAA 4LFAJ 2RKIB 2IBKA 5L9NA 4DUZF 1JNRB 4X4RA 1YJNS 2JEIA 1ZA1B 2QLFB 2ZDOA 3MCOA 3W62A 2LDIA 2MMYA 3FVYA 3GONA 3H8YA 2FVRA 1WKKA 2C3PA 2LU1A 3WZ0A 3L7OA 5J2QA 1N6QA 3BSOA 3NGDA 3NCRA 1R3NA 1WC5A 1O0PA 2CQ1A 1XR6A 2DNNA 2R8JA 2PI5A 5AJ3J 3N28A 4NPOA 5KFOA 4GKJF 4Z7CA 3QAEA 2YKMA 1I94F 2DHHA 3L7PA 1U1QA 3HFVA 1RAEB 4Q7AA 4LF1A 2XMVA 2MKIA 2MJNA 2QTWA 2G2YA 4ELTA 5HVFA 5H9FK 5D0EA 3MM8B 2MY7A 4BWMA 2KVQE 1JLAA 2J8AA 4J9KA 4NLGA 1S77D 3S8SA 3RW7A 1NSQA 2OFHX 4RNHA 2LQ8A 1YJTA 3KG1A 3OBIA 4ZN1A 4AFFA 4K59A 2FHJA 5J2PA 5M2PA 2YPYA 3CE8A 2CG8A 2VPXB 4YEAA 4ZLJA 3A3PB 3FSXA 3OTOJ 3GV7B 3V6HA 2BJ9A 1K73T 2R7UA 3MM5B 1U1NA 3AT1B 2LECA 2GNKA 2VG6B 3H90A 1RAFB 4L73A 4B3TJ 4LF4J 3W9HA 5T7LB 3AY0A 1EQMA 3RBXA 2PFDA 4F2SA 1E6YA 5IS2A 1F2HA 3OL6A 1TQLA 1V3ZA 2DISA 2E66A 3QAUA 3IMQJ 4M95A 2KH9A 1NJXA 1R31A 1WOPA 4IQMA 2KRRA 1G3OA 4RX6A 2X1GA 3M2RB 3FFIA 3W2VB 3N6LA 5KAKA 1T94A 3DU5A 4W98A 3FRZA 4BLGA 1NPRA 5KFVA 4K4ZA 3FRYA 3QGIA 1G2EA 5F8HA 1GXTA 2X1BA 1ZAVA 3TW0A 3CW2C 2XI3A 2R2UA 4MK8A 4DFKA 2BE9B 4J90A 3GCWP 1S1UB 2FJAB 3OFGA 4M5GA 4WFAQ 2V5HG 3K7RA 4F4ZA 2U2FA 4DR7F 1O6XA 2Q66A 4KFBB 3CCRS 5GADI 1HNWF 1B0PA 3OXLA 1NUEA 2DR6A 2QA4S 5IC6B 1Q8KA 3OUYB 4KO0A 4ZDNA 2RJZA 4LSLA 2LVWA 1PO6A 1T7PA 1XWLA 3CD6S 2QMWA 4ID5A 2YNIB 3OTBA 3W9JA 2E1AA 4X4TA 2HZVA 4R25A 3VAHA 4ZMMA 3IGVA 1WG4A 1JLFA 3KWMA 1D0EA 2W2PP 1FVQA 3UQSA 4ECUA 2OJ3A 2OGUA 4F0HA 1CULA 3UNYA 3R5GA 4LJMA 3DLGA 1MWZA 4Y2MA 4Q43A 3SMZA 1FJGF 4UT4A 1R7IA 2ZJPQ 1HARA 3GSIA 1ZM9A 1KD1T 3AXKA 4MIBA 2E9ZA 5ETNA 2EPIA 1YZ6A 5ADZA 2M8DB 2ACMA 5B0EA 1UVKA 2YWGA 2UVRA 2DGVA 1IQZA 1KTVA 4A8XA 4KH1B 3BREA 2AZ3A 1GMUA 2J7UA 5DM7Q 5G0RA 1FRMA 4ZCMA 1OMSA 2B4VA 4F67A 2EI5A 2OIHA 2DO4A 4NLUA 3QWUA 2B0GA 5E41A 3BSCA 3G71S 3D6TB 5KG1A 1RHRB 4MFBB 2NXJA 3BR8A 2F4VJ 2XB2D 2V8VA 1GFWB 5LXRA 3TZXA 2JLFA 1FX2A 2HHPA 3DGPB 3TAPA 1CJKA 4CO1A 3CMES 4PWWA 1S76D 1N88A 2Q43A 2XHCA 4DI6A 3DM2B 4EMDA 3SSRA 4DR4F 3T5LA 3AOCA 1S9EB 3PEHA 2UXBJ 2A0FB 2HBRB 2FVQA 1G7CB 4USIA 2AT1B 3JYTA 3PYDA 2G1HA 3R9LA 1NH8A 5CHCB 3W64A 2RVJA 2VL1A 4U95A 2ZOGA 3DLLQ 2OMOA 2ZZNA 3NCQA 4BWJA 2B43A 1U1LA 1SUQB 1EETA 2CNNB 4Z7YA 5D0HA 3FEYB 1VHFA 1V5IB 2OKQA 2ZUAA 4NLDA 2W8LA 3IS9A 1VS3A 1ZOTA 4RBVA 2CQ2A 1VCTA 1B64A 1G6BA 2YKAA 1UJ6A 1UA0A 2CZ9A 3M30B 3ULHA 3SCIE 1URRA 2JLGA 3OFHA 4BC7A 2LDYA 1QY7A 1CJTA 2KFNA 2WONB 4WFYA 4A8WA 2PC6A 3K0JA 1SI9A 2BJ7A 3C15A 2VQEF 2AYGA 5HBMA 2RU9A 1HNXF 4YB1P 1JQGA 5J2MB 3MM9B 1J5EJ 1IKXB 1VQMS 4F4KA 1D9FA 5GVQA 2DVIA 3VGVA 2B3TB 3KK1A 3MM7B 1JXLA 2FDNA 3DU6A 2ADCA 4BCAA 2CDQA 4C0OC 1U6BA 2DXEA 4ZPAA 4EI2A 4O3NA 5IWAJ 3MMCB 4PQUA 1ZBTA 3LP2A 4RW8A 4NE9C 1HYSA 2GV1A 3M8QB 1R8CA 4YDDB 1AXQA 4JI0J 3QJJA 2F9JA 2ASLA 2HURA 2HAIA 5D78A 3J7Z5 4CO3A 3VAGA 2D3UA 1RU1A 3UCUP 4PWUA 1NAQA 1R8HA 4F50A 4DHVA 2FJXA 3AB4B 2DNOA 4FF3A 2IJNA 3I5AA 3CCES 5GAGU 2RD5C 1Y4ZB 4O3SA 4N8NA 2BJ8A 3I9ZA 1NJWA 1VJWA 1IVZA 2LQ5A 4P72A 3KLEA 1QVGR 1IBKJ 4HH0A 2LYVA 2HHUA 2KU7A 2PA3A 2KXNB 1GNKA 1RA7A 1TFWA 2F9DA 3JQJA 2VHGA 4RU2A 2UXDF 4Q2LA 2B6AA 3JSRA 4QIGA 4ANDA 4DJBA 5HQMA 3CD7A 4BS2A 1Y10A 3HF5A 4I4BA 2MQNA 1X4HA 4DV1J 3CF5Q 3QIDA 2ALYB 3EGVA 4M5NA 2KKHA 1LWXA 2MXYA 3ILOA 1X5OA 3T1AA 2ZJRQ 2OFGX 1VC6A 2K3KA 4DV5J 5ETPA 2CVIA 1RT7A 1SB6A 1T9WA 4KKOA 4WFXA 2R2RA 1N5QA 2JZ5A 1GMWD 3IO1A 1UTAA 2WVDA 3QATA 1PYOB 3K8VA 1ZETA 3MECA 3PYEA 3N01A 4LR7A 3ZTPA 3B54A 3THVA 1QAJA 2J6UA 1K47A 2QGFB 1EKRA 4Q8FA 2F8MA 2XHWA 3QGPA 2MKCA 4K2JA 1RB0A 2BKPA 4F3OA 2DY1A 4ES2A 1FJCA 2OSQA 4ED3A 2ZUGA 2OPRB 1WDDA 4OYBA 2HW3A 2BJEA 3J7AN 3EJMA 2ZM6F 4G1QA 2QLXA 1FWPA 2X51A 2AJ1A 2NYIA 1RLCL 3EPGA 3OVSA 2A6OA 2KJVA 4Q0BA 3BSNA 2HQIA 1BD6A 3LWLA 4JYAF 4DV0J 5AXLA 2HHQA 3Q8UA 1NDCA 2V8PA 1EQ0A 3Q83A 4FVMA 1TAUA 3OXGA 1WEZA 2UVWA 4FF1A 2DH8A 5BJRA 4PR6A 1N32J 5C2CA 1S1VA 1ZPVA 4L3NA 2GMLA 2QSFA 3PR4A 4JP8A 4PABA 1HNIA 4Y65A 2WB1D 1JLGA 3NP5A 4F0MA 4FKXA 1HIYA 4M5LA 2KDOA 5AE1A 1D3WA 3CCTA 3EYZA 1Q81T 3ADAC 1HNVA 1U6FA 1TUVA 3EGNA 1U1OA 4JI2F 5GAHI 5F8GA 4HDGA 3TAMA 2HWTA 3SYZA 1SC6A 2ZE2A 1L3KA 2NREA 2GQ2A 4LF7J 4O23A 2V4JA 5KFQA 3ZZTA 3W60A 4DLEA 2RUGA 4M5HA 4X66J 4ID5B 4WWSA 2DCLA 4P71A 5JUMA 1WWHA 3QMQA 2N3LA 3OW2R 4K4WA 3CVKA 5I4MA 1F1BB 2NZCA 3EGZA 3TZWA 2M0GB 3Q22A 4X4VA 3H0PA 1AW0A 4J37A 2XGQA 3JAMY 5KFWA 2JC1A 5DG7A 3MUVP 5F8MA 3KMSA 1UJ5A 4C9DA 4JUZA 1KLMB 4JV5J 2BM0A 3O6QA 1SC3B 4B9UA 4OX9F 2AYMA 2O5DA 4DV2J 2B9WA 4R8UB 4C98A 1RTJB 2BKNA 3KLFB 2EC0A 5IXUA 1BWVA 1TL1A 4RZRA 3NNHA 3SI8A 5K5MA 4U7UK 2PIIA 1QD1A 1RBOB 1Q16B 4Q44A 1ACMB 2HQFA 3QGHA 2QJ3A 2BQUA 3IWNC 5DETA 1UMJA 1B7FA 5KFBA 1PBAA 4I64A 2C2KB 4ENOA 4DR3F 3D4JA 3OL7A 1YRUA 2AZ1A 2DPJA 5D8HB 4IRDA 3G8SA 3ENWA 4H4OA 5I42B 1LK7A 2XMJA 2CZ4A 3ZZ0A 3BGUA 4DEZA 1S0OA 4WZMA 1LEOA 1JLBA 3L95X 5KOXA 4KSEB 4RR5A 3BB5A 1M1KT 1K9MT 2RRAA 2V34A 4M94A 2DIVA 5DJBA 4CRJA 3SFUA 5CD4H 1T8EA 3T19A 4OYIA 4DR5J 2DEIA 1GMVA 3JTPA 2KHCA 5ETOA 2C2OB 5F9LA 2GMJA 1U0SA 2BACA 2IDLA 4X65F 1SVDA 1EP4B 4ES1A 1RAJA 3K8WA 5JJBA 1HI0P 1T03A 5BYQA 4PXEA 1WD6A 2W7PA 2E1PA 2P9CA 1NH7A 4OYWA 4RNFA 2FQQB 5LMUJ 2HGLA 3NY0A 4P6QA 2QRRA 3EDQB 2YBVA 2DGTA 4XDCA 4OYAA 2QT7A 4WIQA 2HHHJ 1T05B 3OL9A 4NI2B 1FCAA 1TZ0A 4ECTA 4BHQA 2MKHA 3WX8A 4NLPA 3KUHA 4CT8A 3I82A 1IQTA 2GVDB 5A8WA 3ONQA 2B7CB 1DHMA 2CJYB 4L3KA 5I3UA 4Z2XA 1HD0A 1N33F 1YBUA 1WF2A 4LFBJ 1M5VC 4ZIWA 3GJTB 4ZVFA 1FXRA 1F0XA 1TUWA 3ZZPA 2FC8A 3TP2A 3SV3A 4HT7A 1BQNA 4NMLA 3GYXB 2D1CA 2XY6A 4OHXA 1X60A 1GMWA 4B3MJ 2JVOA 3C16B 2WW4A 4ZP7A 1OYEA 2X7IA 4TVAB 1C1CA 3W7BA 2WVBA 1BXNA 2VOOA 4DL0C 3V2UC 2B4OA 4CH0S 2L9WA 1SL2A 7FD1A 4B3SJ 1VRUA 2DD8S 3P49B 3TJAA 2X3GA 4NCGA 2WVFA 4CM0A 3C8YA 2IC3A 3VR1A 4G65A 4JI4J 1HMVB 3HHDA 4MAKA 3Q8SB 5KFKA 2B4PA 2GVZB 2NQPA 3W65A 2JVRA 1WC3A 3MMAB 1RT4A 3DI6B 2ZBQA 1XMQF 2X1FA 4PQUB 4DL5A 4IFYA 2HHXA 4DV4F 5KG4A 3N79A 3GR1A 3LP2B 1IM6A 6FDRA 3A8JA 1NU4A 4J9PA 5H9EK 4AD6A 3HHLB 1YRXA 3NAHA 1H2TZ 1ZTTA 4WXOA 3POTA 1TKTA 3HULA 4NL5A 1PYSB 4B02A 1BQMA 4UQGA 3M2VA 3AOAA 3OFFA 3KJFB 2WTFA 4NCBA 1VQOS 3R7BB 4FYWB 4DPWA 4DV6J 3KLEB 3OR2B 5DDPC 1S6UA 3F41A 4H4MA 5K8PA 4O44B 5D0RA 3ET6A 2PD1A 1FXLA 1LW0B 4ZJOA 2OO4A 1T02A 1NJIT 1NXIA 3ZO7A 3CCVS 1R0BG 1DLOA 4FS2A 3QZ8A 4ECZA 3BBCA 2CADA 1FRLA 2DPIA 4K5SA 2RNEA 2DNPA 4RW6A 1UVMA 1IWGA 3LP1B 3TX0A 1DARA 2GIFA 2ZH7A 3UN5A 3GCXP 4NYOA 1VRTB 1U48A 1LWCB 2BZ2A 3AA9A 3KK2B 4DQPA 4JBCA 4PKDB 3MD1A 2W2QP 3DRSA 4LREA 1HBMA 4J9UE 3ZTQA 3NEKA 2WZ1A 1Y7PA 4F04B 1DJ0A 2IAJA 4LF6J 3ZTSA 3ILLA 3MCNA 4N47A 3TUJC 3OR1B 4ILMA 4G1QB 2P6SA 3PX6A 1WSVA 2EG1A 2EKNA 2ZDPA 2ZBRA 3NNCA 2FGCA 4KHPJ 3QFWA 4RL1A 1NPPA 4Q0BB 5KG6A 2DHGA 2MB0B 3G6ES 4IRKA 2WB4A 2FZKB 1LXJA 1KFSA 4DQRA 3IWXA 2G2ZA 2XWYA 5LMNJ 3Q8PB 4LF8F 3NXZA 4NEZA 2XNQA 3HHEA 4NLQA 3OXFA 5CA5A 3MPVA 2W01A 3KJVB 3GU0A 2D69A 2LKZA 1Q5YA 2UXCJ 1PJ5A 4C11A 5KG3A 2GAGC 2C2ZB 1KWMA 3A8EA 5IC4B 4J9QA 3IGNA 5KFPA 3GPAA 1UW4A 6AT1B 1ELOA 3MDFA 3WX4A 2JC0A 4IDKA 3DMJA 1VQ7S 3VV2B 3KLGB 1RZMA 2Z56B 1U2CA 3DKDA 2AMCB 4NZ7A 4G1PA 4CYUA 4DCOB 1GTHA 2E9RX 4R5PA 4U8YA 3HK2A 1LOUA 1HPZB 5C42A 4KPCA 4FYVB 3HKZD 3VZHA 1N54B 1BMQB 1JLEB 1M5KC 3DGVA 2IY5B 4YQWA 1X4AA 2E5LJ 3VGSA 4X62F 1X7VA 2QL7B 4LFAF 3PG9A 3DOLB 3PCOB 3PY8A 3NS6A 2J9EA 2A1BA 1CS4A 1HBUA 3CMAS 2QEXS 2A3JA 2DRAA 3UO0A 1H98A 1TFYA 1J5OA 2EBEA 4JI6J 3C3LA 4KB7A 1SCJB 4C8OA 5FLXY 4QYRA 4DSJA 3SSQA 3ZZYA 4NEYA 3GB0A 4FDFA 2MGZA 8ATCB 1S57A 5T14A 2ILZA 3DOMA 2QZ8A 1N5SA 4N56A 3S1TA 2R7XA 1IR2A 2BQRA 1JLCA 5AJ3F 4LSNA 3GZ7A 3P96A 3IXQA 3FEZA 2GX8A 1LKZA 4EWTA 2UV8G 4QW8A 3Q8VA 1RHMB 4JI7J 3EWGA 5E3PA 2VJUA 1RWUA 3F0NA 3IA0A 3DLEA 2MTLA 2HZCA 1DTTB 2HK2A 3WQPA 4PWDB 3I0RA 3THTA 2V9WA 3ZXWA 3HVAA 2ERRA 4DS4A 3E01B 3G2XA 3M8RA 3MPDA 4FBUA 2VASA 2BABA 1FEHA 5L9XA 1N34J 4BC9A 5JMNA 2XMKA 4FXWA 3KFWX 2VOPA 4GC7A 1OQ3A 1Z2LA 4KH0B 4N8OA 2VJVA 1HWKA 1TK5A 1Y9OA 3PIPQ 2RF2B 3KHRA 5E2QA 3F73A 3NCPA 4P2MA 1V5VA 1S9GB 2XM3A 3OTOF 3GIIA 3TX8A 3FNNA 2HFSA 4HI2A 1LWFA 2Y3YA 5FJ4A 2C3MA 2KFZA 4ZP9A 1YG0A 4B3TF 4LF4F 2GGPB 3CJQA 2EKYA 4CLLA 3F44A 2JHEA 2XWXA 1Y5LB 2V69A 2DXFA 4RU9A 2HWHA 2HHVA 4HH1A 3K5MA 2LFVA 1HA1A 3TNVA 2Q79A 2OD4A 3IWLA 3OVAA 1QE1B 3FSYA 1U1PA 1GTEA 1JJCB 4HTIA 2HIYA 3BYPA 2FHMA 4K4XA 2R7VA 2IA0A 3K2YA 5J1EA 2WSCC 3CJ8A 1VQ4S 4FYXB 1H73A 2XCPA 1TL3B 4GVBB 2EFPA 3EE3A 1R0AA 2CDRB 4JI3F 3VF0B 4CWBA 4OHVA 4UOCA 3CGIA 4O4GB 2ASYA 2C2DA 4TU9A 3S6EA 1KC8T 2YX4A 3H59A 1A7GE 5HL7Q 4HR2A 5CQGA 2ZD1B 4EYIB 2EEYA 2J76E 3L4BC 3PW2A 2XZWA 3OSNA 1Q5VA 4M5JA 1SQEA 2BANB 3MAQA 3HCXA 2F8EX 4DR1J 3I0SA 5IT0A 1F6TA 1TR0A 1UEKA 2GIRA 2IVYA 4AUKA 3N6NA 5K9FA 2J7WA 1NDLA 2IFXA 2N7YA 4ED2A 2BXJA 3QSYB 4G6VB 2HFVA 4AQYF 1O8BA 3KMQA 1E6VA 2IDEA 5C25A 4IG0B 1Y11A 1VQKS 1RWXB 3RRHA 2J0QD 3KNAA 3MM6A 2DGWA 2EFNA 4ZCKA 2HHSA 2PO4A 1X0PA 2GJFA 2HBZB 1Y3JA 4I2PA 2MQPA 3FDSA 2ZEJA 5KFXA 2NPFA 5EX0A 2F8HA 1PCAA 5JVHQ 3JXOA 3BR9A 2IBOA 2XYHB 3MI7X 2CPYA 2ALZA 4OI2A 2HVEA 1FDDA 1S4FA 2XZTB 2G0JA 2YQ1A 3RZAA 1MROB 1S99A 3SDEA 1RYSA 3AOBA 3SIPB 5E33A 2QN6B 1KQFB 1SKRA 1U0HB 5U47A 3FBFA 4HDHA 2Z2YB 2V4QA 2BA9A 3AJDA 5CAAA 2ZBIA 4AT1B 4RUBA 2MYFA 4B9VA 3T3FA 3UDLA 2ZKUA 1PJ6A 2XSJB 5F3TA 1IKWA 1NK7A 2FD2A 2QYGA 1TV6B 1VHIA 5B0BA 2E9TA 4KBIA 4DSKA 4X84A 2E5HA 2F4VF 3OFEA 1C4AA 2RS8A 3ETOA 5HLFB 1C0TB 2VDIA 3EZUA 2CPXA 2HQCA 1RAHB 1VQYA 4S0MA 1CBKA 4B9LA 4K4VA 1WG5A 2LQ9A 2Z58B 3UI3A 5LSLA 4W90B 4CO0A 3BZQA 3Q8RB 1C0UA 4CLWA 2V2KA 5L46A 3IN5A 4I6YA 2H5JB 2UXBF 3VVTA 1F9EB 1WHYA 1RAAB 1MU2B 2FC9A 1WC6A 1QSLA 2RQMA 4OYMA 3CIMA 1DURA 1YWXA 2I6WA 1U1MA 5IZHA 5CYQA 3VAFA 3MTJA 3CCSS 1HQEA 2KYZA 3CB4A 4CZCA 4K4YA 1HHQA 5E5NA 2C42A 3ZZUA 3FBEA 4WFBQ 4CP5A 3H2UB 2KJWA 5KT4A 3W2WB 3TQEA 3C6UB 5KFTA 1C1BB 3FBBA 2YH1A 4AL6A 1X4BA 4B9TA 4M5KA 2HWIA 1N0UA 4LIRA 4H54A 1B4SA 4NLSA 4YR2A 2OPSB 1TL5A 2EWHA 3LTOA 4A8QA 2Z2LA 1TL7A 3W8PA 1SJ4P 2HVDA 2XMAA 4ZJLA 1JKHB 1NEEA 3K59A 1RK8A 2B9YA 4DN0A 1FE4A 1L5UA 1S12A 3C6TB 2V2QA 2ACYA 3UPFA 3TA2A 2RILA 3BJYA 4ELVA 3V81A 4OX6A 5FDLA 1U4BA 2OEJA 2FJVA 2CG4A 3B6BA 2M70A 1AUSL 2BOPA 3LW5C 3A12A 4HEA9 5AXNA 5L1LA 2RHSB 5JVGQ 2V9KA 3SBMA 4CNZA 5B09A 1J5EF 1YDLA 3MUTP 1RT3B 4OQJA 5EDWA 3GYGA 1L3SA 1Q8BA 2VF3A 3TR5A 1RWVB 3AJ2A 5F3ZA 3CEDA 2F1FA 1R8PA 3C14A 1VC0A 4C8KA 1GXLA 2HNZA 1VK3A 2G4BA 1MW7A 3BV8A 1I5OB 2RKIA 4F4AA 1KOOA 4WP9A 3NOGA 4Q2MA 3DLHA 4ZVPB 1CC7A 4JI0F 3M9OB 3MGJA 1S10A 3FCHA 5ETTA 1S1TB 2CPJA 2YKPA 2H65B 1WNEA 4QW9A 2VKZG 3DLBA 2L08A 2PEBA 1S48A 2O3DA 1FNXH 2XZDB 1T95A 3KG0A 2J7KA 2LCWA 2QYCA 4DPOA 3P5BP 3TARA 3G82B 3H5UA 4K4TA 4KGXB 3UN2A 4P74A 2ASDA 1RT2B 1IBKF 3BO4A 2L9DA 1FD2A 4Y2KA 2WCXA 4PG4A 4EYHB 4C8YA 4WBFA 3A8IA 4DV1F 3HP6A 4MYUA 2WW8A 3Q89A 4M5IA 4ZVEA 3U1MA 1HR0F 1FJEB 4YDXA 3GWCA 2K8GA 2LU2A 4ECRA 1OSDA 3MM8A 5K14B 3HSGA 2ZITA 1RWOB 1HWUA 3DYAB 4EK2A 1YI2S 4FZVA 4LQ9A 4OZ2A 5B7WA 3CWJA 1FKAF 1F2GA 2YNGB 5DDOC 2OTLS 3D1OA 5GAGI 1WDTA 4KYZA 2XGPA 1MWQA 1RHKB 1RJJA 5HMYA 2VFSA 2BMBA 3B4DA 3FEXB 2EK6A 2DR5A 1IKYB 4DSEA 1YLXA 1XQIA 2UUAJ 3GJRB 3MM5A 4YUDA 3EZ5A 2VG6A 5T7LA 4RWXA 3H2VE 2N82B 1RT1B 3OQ2A 2RSQA 3TVYA 3I4PA 1FERA 3CCZA 3MAHA 2GHVC 2AGOA 2B5JB 3G6YA 1RACB 1T9YA 3PKMA 4CLTA 4DV0F 2Y9HA 3CJTA 3T9ZA 5C24B 2JSXA 1TTHB 2RQ4A 4K7QA 5B0DA 3BQ2A 4ID8A 2W25A 2F3JA 3ENVA 2ROPA 3UE2A 1KRPA 5IT4A 3W2VA 6FD1A 3DHWC 3IBWA 2H54B 4OJ1A 2VFTA 1SL1A 5KFUA 3Q2TC 1UP1A 2LEBA 3P45B 4AE5A 1YJVA 1S1UA 1RTDB 5IT9Y 2Z30B 4KFBA 2UUCJ 3C46A 1YJ9S 1Q8LA 5HVGA 1B70B 3QO9B 2ABYA 1S7IA 3OUYA 2ATLA 3AODA 1TL4A 4LF7F 2BE2A 1P9YA 2QG9B 5D4PA 1X4GA 2HBYB 1S5ZA 1U26A 4C0BA 2YXLA 1VMBA 4EO6A 1GH8A 2YNIA 2ZFHA 4CTAB 3VGUA 4WP3A 3KTQA 4P7TA 5D3GB 1S0VA 3W3SA 3NGKA 1TK8A 3E3XA 1URNA 2LXFA 2X3DA 4I7FA 3CJRA 3HSZA 1KVKA 1Q7YT 4WXWA 2CRLA 4CLSA 1AB8A 2KZZA 3V6DB 2CPEA 1I51B 3CCQS 1EHWA 1QDUB 3KLIB 2GCFA 2PMHA 2QLWA 1NB2A 3CJ5A 3R5DA 3NMAA 4JV5F 2YH0A 4L75A 4ED5A 3CUNA 3HZEA 3U27A 1PKUA 1QM9A 3GIKA 2DTJA 2I9SA 2AWZA 3SSSA 5K8MA 1DFDA 2MZRA 2OUGA 3AB2B 1UAWA 5HI7A 3R2DJ 3MWBA 2RB7A 5T41A 3NL0A 1BHNA 2Z0GA 3IG1A 3A3OB 1KONA 1VI7A 1UA1A 4NXNJ 2PMZD 4DF8A 2UUBJ 4I68A 4C2MA 4ZK7M 1VQ9S 2GO9A 1L3UA 1LV5A 4IUFA 3CO0P 1X5PA 3PM9A 2VUGA 1DRZA 2KVIA 2M52A 3AA8A 3AJ1A 3NS7B 4MFBA 2AEJA 3BS9A 3K57A 3GLJA 4ZPCA 2DO0A 4Q45A 1XJWB 2H4WB 1UWBB 2MSTA 2HZAA 1Q86T 5KFDA 2Q6BA 2MPUA 2E5GA 2MDAA 7AT1B 4OJ3A 2FVSA 2KYXA 1VFJA 2QA2A 4RLEA 2H3EB 3HDSA 1NPKA 3L09A 1KR4A 4DR5F 4KV8B 1JJHA 3J80Y 1X4EA 4X4QA 2ZKTA 4PUOB 1SKUB 1S9EA 2YTCA 3HVRA 4LF5J 3RAQA 1MMDA 3CDEA 1NCLA 1C0UB 4LVOP 1KSPA 2F5GA 4IFVB 3MCMA 2LP4A 3T6BA 4MIAA 4GRSA 1NK4A 1OY6A 2OEKA 2FVCA 2DNQA 4HVZA 3EVOA 5ETMA 4YS2A 4PEOA 3D0IE 1PAEX 4ITSA 3Q23A 5LMUF 5AE3A 1UKUA 3N5BA 3HHLC 2VQFJ 1TKDA 4L74A 1XBWA 3NGTA 2J9DA 1DTQB 2HHHF 2ZVIA 1M0SA 5DDQC 2QFJA 3PHEA 1O5JA 3MUMP 2RIJA 1P8GA 5L8RC 4E2FB 3T1HJ 3B78A 2K7JA 2C22A 5CYMA 4ICLB 2YX1A 3RBZA 4Y2CA 3D6HB 2WONA 2DNRA 4B3MF 1T9UA 1RQ0A 4E8UA 2XQCA 4ZVSB 3PO4A 4A8OA 2HGMA 4KY3A 3UCGA 1MMNA 4NLVA 1CJVB 3MM9A 1IKXA 1OS5A 4B3SF 2XYGB 1T11A 3H4BA 5A76A 3MM7A 1A0OB 2MHEA 4LF2A 4DDFA 2VC0A 3CT9A 2E7XA 3QLHB 3KOAA 2XMMA 3MMCA 1KOHA 1ZTWA 1IWAA 1H7XA 2AEFA 3M8QA 1VLOA 2FY1A 1EKSA 2OP5A 4U7UD 3GFZA 3PIOQ 2CQBA 3N4WA 2O66A 3D66A 1CEZA 1G1XA 5HMWA 2YY3A 1RHUB 3QT8A 3HD1A 5J1PA 1W7WA 2YKNB 4N41A 2V6AA 2DGQA 3TZZA 4CLPA 2CJXB 3VAJA 1Q0NA 1XIQA 4J9NA 2B9XA 4K4UA 2MLYA 4DFJA 4RUCA 2X1AA 3MEKA 2R9LA 4DV6F 4W4MA 5C5JA 5EUHA 1VQSA 4OHYA 3LOUA 3I5CA 4ED0A 2XMUA 1PGZA 4FXDA 3K5PA 1Y3KA 3R3TA 4RUAA 4IOCQ 1FNOA 1KQKA 3BPDA 4X4PA 1AYEA 2GJIA 3ETMA 1PYTA 2J8SA 1IBMJ 4CM2A 1EJ7L 2KI2A 3QRQA 3DNCA 4V19X 4O3OA 1TKXB 2HRTA 2KXHA 4CLFA 4B9SA 3JS9A 2XSFA 1NHKL 1MLAA 4WF9Q 2NCKL 3E51A 3PXGa 1G4CA 4TYBA 3MD3A 2FJDB 3LA0A 5HMZA 3CJ4A 2CJQA 3KJQB 3LANA 2Z8QA 4PRFA 2W2OP 2OPRA 4QWDA 3NKYA 4LF6F 2W9CB 4YHHF 1YSJA 1JXVA 3GFHA 4MKYA 3D3BJ 2DY9A 2WOMB 1P27B 4L6V3 1F3FA 2HNYB 5KTQA 4CT9A 4J9SA 3DRPB 1LW2B 3HHLD 1V6HA 2AJ0A 3T1YF 4QU6A 3PX0A 3V4IB 5LMNF 5L38A 4HL9A 1JJ2R 4OJHA 3ZZOA 1LNQA 3UD5A 1TU0B 3U1LA 1UL3A 2B8PA 3M32B 1REVB 4OV6A 1ZZNA 1RKIA 3PTWA 4IOBA 1U45A 4TXSA 2MKYA 4CH7A 2QL9B 1TKZB 2GS8A 2FLLA 4LRBA 2Q6CA 1R27B 4RNOA 3QJLA 3SQGB 1P9QC 1SV5B 5EWFA 2NLWA 3LGMA 1FKOB 5DO2A 4V19J 5DLGA 4UF4A 2JDJA 5L1IA 3UR0A 2BE2B 1S4EA 2C28A 5A8RA 2KG0A 3OD2A 1IJEB 3MTKA 4DLGA 3HMJG 4C8LA 4YN3B 4TQSA 4IO9Q 3TA1A 4JI5J 3FCWA 3HFKA 2KN4A 3FGVA 2ZH9A 2E5LF 4XPEA 4I7FB 2V94A 3VVUA 1PG5B 4EBCA 3SZ2A 2QIFA 2Y1JA 3TO8A 1T3NA 4NLOA 3CC7S 4JV2A 4P73A 3GILA 3VGTA 1KLMA 3UN3A 3PW5A 4X64J 4RNNA 4EU0A 3RJMB 4R8UA 3HX9A 3FMWA 3HKWA 3HI9A 3L3CA 4UUWA 1RTJA 3KLFA 1BWEA 2W2NP 4JYAJ 3HFZB 2PI4A 2VKRA 3RYLA 3IG1B 1FRKA 1XERA 1KKHA 2AHOB 3BDPA 2P5VA 4DPYA 5GMEA 2EC2A 5IV4A 3JAMU 4Y3CA 5D4LA 4USTA 2DR8A 1X31C 4MK9A 5I42A 3GYNA 1FDBA 2Y0BB 4K50A 4H4KC 4MJKA 2R2TA 3RBEA 1N4LA 4Y6IA 4DF4A 1U2RA 5A6WA 2QA4G 1X4FA 1D1UA 3D7SB 3KK3B 1NM2A 1FESA 1RE1B 1N5VA 1KEKA 3W5XA 9ATCB 1N34F 3CC4S 1Q82T 1F5CA 1PC5A 3IP0A 4A8YA 3K17A 5GAEU 2CWKA 1OWXA 2CJ9A 3AXMA 3OLBA 4OFZA 4K5RA 1Y5IB 4ILLA 4P10A 1W2BR 1EP4A 3CCUS 4O0NA 4U9RA 4NASA 2ZNZA 2W9BB 1EIYB 5MAOA 4WTYA 4PQAA 5JXSA 2BKOA 2PE8A 4WFZA 1XNQJ 4B3RJ 2WHOA 2H48B 1M5SA 1GX6A 3Q86A 5H1SV 2KO1A 1ZAWA 2YWFA 4LSZB 1Q53A 4K8RA 3MURP 2CNLB 1N5YA 4QPXA 1SJ3P 1FHTA 2DHXA 2CUYA 4TYAA 5DQIA 1MSWD 1JNZB 1K1QA 2ILYA 1T05A 3H7HB 2H4YB 4NI2A 3QQCD 2MZSA 1BY9A 1JJ4A 2BM1A 4DL6A 2LMIA 4KRWA 3D67A 4NYZA 3C2PA 4F7VA 5DG8A 3M6VA 2GVDA 1K0TA 3PEJA 1VISA 1R6YA 2QLBB 4YOEA 4GKKJ 2M88A 3JSMB 4TY8B 3IBCB 1WELA 5CYMB 3PNIA 1OPIA 8RUCA 3I56S 4PPZA 3SEOA 4KT0C 1FD8A 3OHAA 2EFQA 3H42A 3C16A 2AJQA 2UP1A 2M8HA 2VG5B 2CA9A 5LSOA 2M9KA 3PFOA 1NZAA 2D3O1 1NK9A 2R7QA 2EK1A 3NLCA 3MOJB 4JB8B 4DR1F 3SFGA 1IKVB 1H38A 3PJ9A 1HMVA 2D9PA 4OX7A 3K89A 3LP0B 3ZZZA 2MEWA 2H5EA 1JMTA 1C2PA 3ZTRA 2GVZA 1UFKA 4ZPDA 5M2UA 3MMAA 1H72C 4P9SA 4NMXA 1KDNA 3DI6A 1HBNB 4ILRA 2VDHA 1ITPA 2W7AA 2OPPB 3R8YA 4HLBA 3R7SB 4TN2A 3BO2A 5CCLA 1NSAA 2CWXA 3M8WA 3BH7B 4YR3A 3OJSA 3HHLA 2V63A 1XR7A 5KFCA 2GMHA 4DFPA 2JEGA 2MKJA 3UFCX 2CNKB 2I0XA 3X3UA 2CJAA 1VK8A 2F65A 4KGVB 1RADB 4PYDA 1UVLA 3HSJA 1IBLF 3D9BA 1RWPB 2AYBA 2E1MC 4KIAA 1P1LA 4E98A 4CQ1A 5HQLA 2E29A 2YNHB 4C8NA 4RW7B 2VH7A 2ZHBA 3OR2A 5F9NA 2I1RA 3PW4A 2DNLA 4O44A 1U7LA 5KT6A 5D77A 3ITHB 1LW0A 4HACA 1U2FA 1QVFR 1GT8A 2ZH1A 3R5BA 1AROP 1SBRA 4WE1B 1WEYA 2NZ4A 2UVVA 5EN1A 3VALA 4OL8A 1RTIA 2M2BA 3KUGA 2R8KA 5ETVA 4QR2A 2HKEA 3LP1A 1X5TA 2NS1B 2CJKA 3UD4P 1VRTA 1GX5A 1LWCA 2K1RA 2CXEA 4KR0B 3KK2A 1ZAXA 1UCNA 2BV3A 1XK8A 3G6VA 2V2VA 4NLTA 4F36A 5HROB 3DRRB 3QWPA 4A48A 3CNQP 1JLQB 3QIPB 3J81j 4DN9A 3SCKE 3CIZA 2XCAA 2B8QA 1CLFA 4ECXA 3OR1A 1N56A 4A8KA 4QYZJ 2R7SA 2LA4A 1RWKB 1VIXA 2BE7D 2W7OA 3K58A 3TOQA 4LRAA 2JL9A 3PYFA 4DCJB 5ETLA 5KT5A 2ZHAA 3I32A 4B3OB 1QAXA 4O3QA 4C97A 2JLEA 4A4JA 3I55S 4QWCA 1RI7A 1R6VA 1PAUB 3KJVA 3PW0A 3KHGA 5LJ3Y 2FB0A 4HTJA 4DG1B 2QV6A 1SH2A 2BUNA 2HNDB 1CQMA 1ZM2A 3CDBA 3ILIA 4N5SA 1SXLA 2DR9A 1NK8A 1KVIA 3UNGC 5KT2A 2B56A 1YJWS 2RRNA 4NLWA 5ETKA 5L39A 1RT5B 4LT6A 3CJKB 5D0GA 3CD5A 4LRFA 4B9MA 4DR6J 3KLGA 1BUXA 1M90T 3IM8A 3Q24A 1ZS6A 5THWA 4I67A 2YNFB 1HPZA 2NPIA 4J9VA 3IR7B 2E1RA 4LF9J 3M1VA 5A8RB 2M3DA 2R7RA 1RA6A 2MKKA 1JLEA 1NHVA 1U8SA 3I5BA 2ROEA 3AQPA 3NG8A 3M7VA 3GV5B 3FQLA 3DOLA 3VAIA 5SZTA 4OZNA 2VICA 1HQUA 4M1KA 3IRXB 3WIUA 1U1RA 3EPIA 3ISNC 3RAXA 2HQ3A 2I5JA 3I31A 3O5TB 2JRSA 2HVZA 1D9AA 5CABA 3MAAB 4ATNA 3KLHA 3M2UA 3PW7A 4RO0A 1KHWA 5IM0B 3DRXA 2HMIB 4P75A 5KFAA 4NXMJ 4FBTA 4CCHA 4ZVQB 1SQFA 2ZH2A 3UVJB 5CZVA 2K2PA 2ZH4A 5IOLA 4CO5A 3HLUA 1YITS 4KGKA 3HPOA 1NSPA 3P4UB 5ITHA 2N4CA 4ALZA 4IH7A 5KFYA 1UW9A 3KDNA 1CQNA 1DTTA 2XS7A 4PWDA 4C3MA 1VQ5S 2OPQB 1W2IA 4DMZA 1SJ1A 3TUPA 3IBFB 4URSA 5IQ6A 5KFLA 3E01A 3R6GB 2XS2A 5FLXU 3L7UA 1GK8A 4ETXA 3NS5A 3UD3P 4K2XA 3MHYA 3A13A 2C1EB 1RCOB 1WACA 2ADBA 3H2LA 2RF2A 4USWA 2GHPA 1S9GA 2FLNA 4WKRA 3KXDA 2VIHA 1UZHA 4ELUA 4TLQA 2RH3A 1SC1B 2UUAF 1F5AA 1KFDA 3TEGA 1FKPB 2JH3A 1SKWA 4X4SA 2GGPA 4PYAA 2B4UA 4UQTA 4X62J 5B0AA 1HHSA 3CCLS 5KFJA 1HWJA 4CO4A 2EG2A 1RBLA 4QCLA 1N5YB 2R8GA 2ASJA 4IRCA 1VRQC 4RKUC 5RUBA 1QE1A 2Y8WA 1FA0A 3QRPA 1NB7A 1NRKA 1GAOA 3BKFA 3WIVA 1V3SA 2PN6A 4L76A 5J2NB 3R5AA 2BVZA 3MZIA 4UY8T 4DPXA 4CI0B 1QUPA 4CLZA 3LGHA 3LUYA 2F63A 2RUSA 1TL3A 4GVBA 5HK4A 4H4KA 1WTBA 3MFHA 2IJFA 1NKBA 4U6PA 2CQGA 1XNRJ 4O4GA 5DZ6A 2CQPA 2UUCF 2G9OA 3NOCA 4ZLLA 3N5FA 3LPYA 1RUSA 2WAQD 2ZD1A 3ENQA 5I3QA 4C3KA 1NBEB 2K7KA 4RW9B 4GVLA 1PSDA 3CD0A 5LM7E 2V67A 1QTMA 5KFZA 2RRBA 2AYEA 2BANA 1JB0C 1HW9A 5DRKA 4HYKA 3R5CA 2VZ9A 1HBOB 4ZVGA 4C4WA 1ZM4A 4RBUA 3SV4A 3NRBA 1N36J 3VWSA 1EB0A 2MJUA 3ZNJ1 1W25A 2V50A 4IG0A 2YQ0A 3DCAA 5A6PA 4IG3B 1HFEL 2N7CA 3RRGA 4KGZB 4YR0A 1HWIA 4L72B 2W1BA 1SH3A 4O3PA 3ISND 5LOQA 1S9FA 2VC1A 3CJSA 4EFAC 4CO2A 1AFIA 1BC6A 2GHWA 2N3OA 3QFHA 1RDRA 2VA2A 2J9CA 1YVFA 2QE5A 2RU3A 4FPRA 5BR8J 2YKOA 1FI4A 1MROA 2SXLA 1ROFA 1S6QB 2ROGA 3DOKA 1LWEB 2XG8A 3J7YU 2AP6A 4LBIA 1YHQS 1U0HA 1OYDA 1UJ4A 1X9SA 1T9XA 2NXNA 4NXNF 5HP1B 1XMOJ 2UUBF 3ENAA 1A9NB 1PILA 2VODA 1RTHB 5HSPA 1MN7A 2IRYA 3MR3A 1L3VA 4N7TA 2XSJA 3PRVA 2VPZB 3J81Y 1TV6A 2V8GA 1LK5A 2DB1A 2WBRA 3PACA 1IR0A 3BGRB 4HACB 2VPWB 3EDRB 1ZZFA 3TVKA 2MZJA 2OHDA 2I38A 2MQ8A 2MLZA 1X9MA 4JI3J 4ED7A 2G0CA 1RCXB 3DDNA 1FF2A 1S1WB 5HLFA 1RTIB 4A46A 4K0KJ 3QBCA 1C0TA 2AKWB 2L48A 3G4SS 3N9UC 3BM7A 3H5SA 2AJFE 1BGXT 2HHWA 1DQ8A 3MMBB 2XO6A 1UPMB 5EWEA 4QJVA 3BN7A 2E5IA 1JXEA 3D1QA 2DNKA 2F4FA 1RWWB 2M5YA 2K1RB 4LF5F 4Y0FA 3IR5B 3OJUA 4DWIA 3EVWA 4FS1A 2DH9A 3IC1A 1S59A 4AQYJ 1VBYA 1PBUA 3QPIA 3NAIA 3FJ2A 2J6SA 1MU2A 5D4OA 2DNGA 2Q3PA 4P2FA 3M9NB 2Z57B 2D7SA 3BBFA 4I6WA 3W9IA 2EFVA 2G0IA 3HVWA 2C3YA 2W9AA 5HJXA 2DRDA 3MEDB 3CJ2A 2VQFF 3H20A 4ZVOB 1PC4A 2RMLA 1ULRA 4WU3A 3RW6A 2JJ4D 1FJ7A 3W2WA 1NK6A 1HL6A 4QIWD 4JI1J 1P1TA 5GMKa 3C6UA 4ETZA 1C1BA 3PRDA 3V5RA 4DS5A 3CJ0A 1KNZA 4J9LA 2OPSA 2XI2A 4M5DB 1R8BA 2BW7A 2POKA 3R1LA 2CQHA 3CCWA 2BOAA 2P6TA 1JKHA 4FNHA 2ZOMA 3OHBA 3T1HF 1KHVA 2CVEA 3RUBL 1B99A 4DFMA 5HVHA 3WC2A 3G8QA 5A2QY 1UEVA 3C6TA 3JQKA 1Q4RA 3H25A 2IM0A 3M8PB 4OYOA 1VDHA 4M63A 4PG8A 4DL7A 1WC1A 2LQBA 4EUVA 4IO1A 4EEYA 3AD9C 3BGOP 4XPCA 3V6JA 3KDOA 1RT3A 3MMJA 5AXKA 2KFYA 2MZTA 2DYAA 2KL8A 2WBMA 2CQ0A 4J9RA 3M1VB 1RABB 2GIQA 5KFIA 2E7VA 3QNWB 2C2EA 3EM1A 4DL4A 4USJC 1N48A 4DQSA 1U47A 4OYPA 4R0JA 1FK9B 1S1TA 1HQUB 4ECVA 4Y2IA 1H2UX 4ZHRB 3TUZC 2I5JB 4RW4B 1WHXA 2CQDA 4NA2A 4DPTA 1RT6B 1K44A 2GAHC 1KVJA 2KT5A 1M1HA 2ZC3A 7FDRA 3D0GE 3ISZA 5C7PA 3KLHB 3M2UB 1EAYC 3R2CJ 2KRBA 3G82A 4TKTA 2DR7A 1RXOB 1VIOA 3I87A 1RT2A 2YQ3A 2GJ2A 3W5YA 3ZFVA 2FHOB 3PX4A 5KFEA 2F7VA 1B0TA 1UETA 1RSCA 2IYGA 2IJRA 2APOA 2BEFA 2RAQA 2VB6A 2HQGA 1NJYA 1FFWB 4OI3A 2CNOB 3FCVA 2UU9J 5KT7A 3TZYA 5K14A 4BDPA 4DL3A 1IBMF 3DYAA 4USVA 1SL0A 2XTJP 3RB6A 3R6LB 1HNZJ 2YNGA 1GEHA 4DOZA 2HRYA 2HFNA 4FYDA 4IYQA 2J5AA 3K5NA 2J0SD 1PIEA 1S1XB 2VU5A 3DLKB 1IKYA 1Q1KA 3RR7A 2ZZMA 4RBTA 4PG7A 1TVRB 4F8RA 2Y1RI 1HWLA 2HIQA 4PG5A 1S6PB 1X8DA 4KPYA 4XAKA 4B17A 2D3OR 3RB3A 2A6MA 2CPHA 3OTDA 5F8LA 2XY7A 1RT1A 5A8KB 5L1JA 3Q8QB 3E8OA 2DHSA 2B5JA 1NJZA 2ZH6A 1M5PC 1R0CB 1AZSA 3MEEA 4DV3J 3IAM9 5L1KA 2UUWA 5C24A 4NLYA 2OD6A 3MXHP 5KG7A 3H40A 3M05A 1V9OA 3RR8A 3I9V9 3P3DA 2A10A 2AU0A 2JWNA 3DFEA 4USHA 4EGLA 2IMWP 4NA1A 2YWHA 2PEHA 1DAXA 1CJUA 1H0HB 2H9ZA 4F4XA 5J2QB 2IHR1 1RTDA 1N6QB 2N4DA 3GG1A 3H98A 3DLJA 4ZCIA 3FKBA 5F0UA 5CH7B 2C2RA 4NZ6A 1DZ5A 2B51A 4E0DA 4ED6A 2CQCA 3L9ZA 3QO9A 4NWBA 1YIJS 4NLRA 1H6KX 3FZ2A 3IR6B 3D5MA 1LFPA 2HS0A 3R1HA 1VC5A 1NKEA 4WJBA 2CQ3A 2YKMB 4ZN3A 3RB4A 2LQJA 1HR0J 2ZH8A 3VAMA 1AUDA 1UWAA 3MPYA 5BXIA 5DGAA 1X9WA 4CTAA 4J7CA 4IOAQ 1JIHA 1NO8A 5D3GA 4FPIA 1S49A 1ICEB 2RE1A 1JLAB 1VLYA 4JI5F 2QLJB 3PVXA 2DKOB 3LALA 4DV7J 1I6JA 4WYLA 4ED4A 2JEFA 3UDCA 5IT9U 3V6DA 2Q1LA 3U1NA 1S0NA 1VR6A 1EX8A 3KLIA 5J2PB 4OYXA 5LT5A 2C3UA 4DUYJ 4NRUA 4D3GA 2AX0A 4PCQA 2CFXA 4ECSA 2E7WA 1T0TV 4X64F 3QT7A 1D8ZA 5F41A 3CC2S 4DXLA 1EARA 2I2YA 3ILJA 3PJWA 3LPEA 5CYJA 1WSRA 2R3VA 3RAMA 1Q79A 3QYYA 2WVEA 2DT9A 4FF2A 3H4DA 3OLAA 3DOKB 4A8SA 2DHAA 1E6YB 4CNYA 1NDKA 2DITA 2OMLA 1Z4UA 4DSFA 5E3RA 3H5YA 2Y8YA 2J0XA 5IV3A 4DBQA 3GIRA 3EXCX 1QLNA 3FFIB 3F56A 2P2CB 1HI1A 3M6XA 5FIIA 5E7OB 3O1LA 3QT5A 4FYYB 2C3OA 4LFCJ 5IFMA 3B8HA 3HO1A 1UWBA 2E44A 3NNAA 1XN9A 2YX7A 1LQ9A 1H74A 3EMTA 2XLJA 1BE4A 4OI4A 2CPIA 4HHHA 4KV8A 4KO0B 4OZ0A 2LA6A 4UUXA 4LSLB 2MZQA 4PUOA 3QRRA 2KM8B 2HVHA 3Q8YA 2MLXA 3DHXA 3U7JA 4KC5A 4HHJA 2RDDA 4IFVA 3M8YA 4LR8A 1QJHA 1U02A 4LVNP 1XNQF 2Z4PA 4B3RF 2HGNA 3ZTOA 1GXUA 3JTOA 1JLFB 1OO0B 2FIUA 4U8VA 5KFFA 1OPZA 2M4MA 5EWGA 1SJQA 1CULB 4JI8J 3WBZA 3K5LA 1YJRA 3DLGB 5DM6Q 4FP9A 4X4NA 5K20B 1DTQA 3N0VA 2G2OA 1OY8A 2HAFA 2WK4A 3J80U 3ELHA 2WSFC 2ZHOA 1OSCA 3US5A 4TU8A 4I0WA 4RJVA 3I96A 2NSCA 4F4WA 5ETQA 4GKKF 4IH6A 3B4MA 1XR5A 2VBXA 4XK8C 5GAEI 4O0IA 4V1Ak 1CVJA 4ICLA 2HLUA 1SKSA 1UPPA 1Q8IA 2DEJA 5G0RB 1C4CA 4C8MA 3FMBA 1Z1ZA 4ZVHA 5LXYA 4FN5A 4YY3J 4MKVA 2AX1A 1CJVA 4ZLPA 4WKYA 1VQ6S 1RAIB 3BQ0A 4WZQA 3PZPA 1MG7A 1NK5A 4C8ZA 2DBBA 2HG4A 4P7VA 1TMJA 4U7CA 1T9VA 5K8OA 3KG4A 3HM9A 1U25A 3VZIA 3J7A1 5LJ5Y 2QC3A 1VQPS 4DU8A 3QLHA 1M5OC 4LBHA 4KHRA 2CPFA 2IM2A 3O44A 2KT3A 3CTRA 3FUYA 4LRDA 2B7BB 4HKQA 5IWAF 1CJKB 1WJ9A 4ER8A 2LXIA 4QR1A 1W26A 3D1HA 1HKAA 4OZ5A 2HEKA 3DXSX 2Y1LB 4NCAA 1TUGB 2HQDA 3BH6B 1FX4A 3DRYA 1R43A 3A1YG 1KQGB 5KFRA 2DJWA 3QT6A 3EGWB 5DZ7A 1KS2A 3CMQA 1AFJA 2DNYA 3NMRA 1UVIA 3T6JA 4QZVB 1N52B 2YKNA 2AGPA 1NKCA 4NLXA 1FWLA 4F3MA 3JYTB 3T5KA 2FJEB 4YP3A 1HI8A 4A8MP 1TAQA 1ZPWX 2CPDA 3PRBA 3LAMA 5HQ8A 4TNOA 5H9FJ 2QX0A 2QSWA 2YWWA 1OJ4A 3UR3C 1A6LA 1EETB 1RTZA 4DR2J 3P8BB 1SIZA 4OI1A 3BDEA 3IS9B 4GO7X 3W66A 4AL5A 2ZWOA 1FWKA 2RS2A 2BYCA 4FXVA 4ZIVA 2UV8A 3PYGA 1N8RT 4C7QA 3TANA 3TQ1A 3D54A 1FRHA 4DV5F 4YB7A 1OY9A 4OMFG 1VQLS 5B0GA 1OQ6A 2FGOA 1TKXA 1R8AA 2BBEA 1CJTB 5K8NA 4X2BA 1F9HA 4J5OA 1TP7A 2OLWA 1NMEB 4MKBA 3PR5B 3VCDA 3PKYA 1RWNB 3C15B 1WTFA 1SIWB 5HBMB 2XEXA 5EGYA 1XMBA 2I8EA 4FNIA 1LXNA 3EX7B 4UOHA 1TMMA 5G4DA 4YB6A 2UUTA 3C66A 3KK1B 2CQIA 2W9CA 3TVZA 1ZYQA 2BX6A 2XMWA 5KFGA 2WOMA 1YGYA 4PG6A 2DGXA 4KJIA 2HNYA 1L3TA 3DRPA 3SQOP 1LW2A 2MQMA 4RW8B 1HYSB 5A0YA 3D28A 1AZSB 4DUZJ 1BQXA 1MMLA 3MEEB 4DU7A 5AE2A 3DN9A 1J2VA 2XLKA 3JTNA 3V4IA 2ZH5A 4IR1A 1SQGA 3RU0A 1VBKA 1DY3A 1U8WA 3M32A 4O3RA 1N32F 3D6MB 2DXDA 1REVA 1CJUB 3KUEA 5DQGA 1TKZA 5KFNA 3CJ3A 1GQEA 2XYPB 4PPDA 2ZH3A 4IR9A 2VFVA 2KG1A 3SQGA 2B6AB 1SV5A 4GKJJ 1YJ7A 3B82A 4I69A 1FKOA 4DR6F 3W8GA 1I94J 4CH1A 2NXEA 3OSPA 2DGOA 4PXCA 3NWGA 3BO3A 1RT7B 4Y28C 4LF9F 2OELA 3V4MA 4KKOB 4QIVA 3X1LB 3A8KA 2RDJA 4X66F 5ETRA 2Y1IA 2YWKA 3MECB 1QUVA 4QWEA 1RKJA 1FDNA 3E2EA 4B9NA 4ZPVR 4URQU 4OHWA 2JNJA 3CDUA 2B9EA 2DGSA 2NUHA 3EZOA 1UZDA 1CSJA 1QSYA 1UEUA 5GADU 4X4UA 2ZBCA 2FLPA 3EVMA 4XDDA 2HFOA 1Y00A 4FF4A 5E0OA 2VBWA 1FNMA 4N76A 4P52A 4YHHJ 4DUTA 4WK1A 1REGX 3KJNB 2OH2A 5F0WA 5DLFA 1YTYA 3R97A 2JFKA 5F8IA 4DV2F 4I56A 4QIEA 3D68A 3AFGA 2CIMA 4NXMF 4ZITA 1XTZA 4ED1A 4AL7A 3T1YJ 3MF5A 3P6YC 2AV5A 1H3DA 1DBDA 4F4YA 4C48A 3Q2SC 3C19A 2NYHA 3AAWB 3QSIA 2R7WA 1NLKL 1S1VB 1RGVA 4QYZK 4UY85 4JV0A 1HNIB 1F9FA 1JLGB 2FZCB 2NR0A 1HD1A 1NK0A 1WF0A 4A47A 4JOUA 3GP9A 3U02A 4LIWA 1X4CA 3KK3A 3TI0A 5DS7A 4DR7J 5EHHA 2BJ3A 3TWZA 1HNVB 1HNWJ 4ED8A 3P5TL 3TAMB 2V4RA 3IRWP 2ZE2B 3GTYX 3BSAA 3MPWA 4J9MA 4WIIA 3CULA 2V4JB 2EVZA 4DSLA 2AW0A 2QFIA 4P2XA 1FDAA 1MNEA 1X4DA 2W9BA 1FRXA 2D9OA 3RGIA 2GFFA 3FBCA 2JFDA 2VONA 1S97A 3PJXA 1YX2A 4MKAA 4UTGA 3BN4A 4MYTA 2GQCA 4EZ9A 3CO9A 5KOWA 4ERDA 2XLIA 1FTRA 1VQ8S 3IM9A 3KLVA 2XBPA 9RUBA 3S7RA 2HLTA 2XY5A 1FJGJ 1F3VA 3VTIA 2IVFB 4C6AA 4P2SA 1Z2ZA 2CPZA 5ETSA 4PZVA 2GC8A 3JSMA 4TY8A 3BGFA 4LRCA 4IH5A 1TL1B 4USUA 3JSBA 4LFBF 3EUNA 4IKAA 1XNRF 5E3CA 2RQCA 2JEJA 3HSDA 2OTJS 4UOFA 2QMXA 4QU7A 3OT9A 2W4CA 2RHQB 3Q0AA 1RWMB 2VG5A 2LEPA 4QWAA 2BRKA 2VBZA 3IFEA 4I1TA 2IRUA 4YMEA 4J9OA 4ZPWR 4H4OB 1HHTP 2R8IA 3V6KA 3MOZA 3NGUA 1RP5A 1FRJA 1JLBB 1IKVA 1YJUA 5D6GA 1RLDA 3G6XA 1IBCB 3LP0A 1N36F 2HK3A 1VJQA 4MIWA 2DRBA 2XMTA 4JI4F 1WHVA 1RHJB 1D9DA 4RUHA 1VYAA 1HBNA 5BYRA 1HQ2A 3GMGA 4O4RA 2D3ZA 2OPPA 3VHQA 4F25A 3THPA 4LR9A 2V8HA 3FK4A 3PFEA 4TU7A 1FTCA 3GV8B 4DR4J 1ZH5A 1I3OB 2FTRA 3NBPA 3MR2A 3UWTA 3VAKA 1VQNS 1WOOA 1T03B 3KHHA 3AD7C 3PHTA 5BR8F 2HFUA 4B08A 4WP8A 2MY8A 1Y0HA 3JSYA 2EFGA 4F3QA 1WF1A 1RISA
chains in the Genus database with same CATH topology
3R5JB 2C2MB 2HBZB 1RHRB 3P45B 2CNKB 1RHQB 4ZVRB 1QTNB 3RJMB 2HBQB 1RHUB 2CNNB 2H65B 1GFWB 2QL9B 1PYOB 2CJYB 2C2ZB 4ZVQB 2XYHB 3D6HB 2CDRB 5IC4B 3KJQB 1RHKB 1RWPB 1SC3B 1SC1B 3GJTB 2XZTB 1IBCB 2XZDB 2CJXB 2C2OB 3GJSB 2QLFB 2H48B 4ZVSB 2H5JB 3SIPB 1RHJB 4JB8B 1F9EB 3R7NB 3GJRB 1ICEB 2H51B 2HBYB 2P2CB 4LSZB 2QLJB 5K20B 2DKOB 1RWKB 2CNLB 4ZVOB 3P4UB 3KJFB 3EDRB 2XYGB 3QNWB 2HBRB 3R7BB 4DCOB 2CNOB 5IC6B 2H5IB 4DCJB 1RWVB 1I3OB 2Y0BB 3D6MB 2Y1LB 3D6FB 2H4YB 4ZVUB 3IBFB 2FQQB 2C2KB 3NS7B 3R6GB 3GJQB 1RHMB 1PAUB 1BMQB 1NMEB 3R6LB 3EDQB 3R7SB 1RWNB 3KJNB 2H4WB 2H54B 1RE1B 4DCPB 1I51B 2C1EB 2XYPB 1RWXB 2QLBB 4ZVTB 1SC4B 1RWOB 1QDUB 2QL5B 1RWMB 1RWWB 4ZVPB 3IBCB 2QL7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R5J B;  2C2M B;  2HBZ B;  1RHR B;  3P45 B;  2CNK B;  1RHQ B;  4ZVR B;  1QTN B;  3RJM B;  2HBQ B;  1RHU B;  2CNN B;  2H65 B;  1GFW B;  2QL9 B;  1PYO B;  2CJY B;  2C2Z B;  4ZVQ B;  2XYH B;  3D6H B;  2CDR B;  5IC4 B;  3KJQ B;  1RHK B;  1RWP B;  1SC3 B;  1SC1 B;  3GJT B;  2XZT B;  1IBC B;  2XZD B;  2CJX B;  2C2O B;  3GJS B;  2QLF B;  2H48 B;  4ZVS B;  2H5J B;  3SIP B;  1RHJ B;  4JB8 B;  1F9E B;  3R7N B;  3GJR B;  1ICE B;  2H51 B;  2HBY B;  2P2C B;  4LSZ B;  2QLJ B;  5K20 B;  2DKO B;  1RWK B;  2CNL B;  4ZVO B;  3P4U B;  3KJF B;  3EDR B;  2XYG B;  3QNW B;  2HBR B;  3R7B B;  4DCO B;  2CNO B;  5IC6 B;  2H5I B;  4DCJ B;  1RWV B;  1I3O B;  2Y0B B;  3D6M B;  2Y1L B;  3D6F B;  2H4Y B;  4ZVU B;  3IBF B;  2FQQ B;  2C2K B;  3NS7 B;  3R6G B;  3GJQ B;  1RHM B;  1PAU B;  1BMQ B;  1NME B;  3R6L B;  3EDQ B;  3R7S B;  1RWN B;  3KJN B;  2H4W B;  2H54 B;  1RE1 B;  4DCP B;  1I51 B;  2C1E B;  2XYP B;  1RWX B;  2QLB B;  4ZVT B;  1SC4 B;  1RWO B;  1QDU B;  2QL5 B;  1RWM B;  1RWW B;  4ZVP B;  3IBC B;  2QL7 B; 
#chains in the Genus database with same CATH topology
 1YBT A;  4DX8 H;  2CAJ A;  3UCZ P;  1RHQ B;  4J91 A;  2YNH A;  4RW7 A;  1PJ7 A;  2P9E A;  1XMO F;  2MHN A;  2L9N A;  2BJ1 A;  2IVM A;  3ITH A;  1QAI A;  3MR6 A;  2XUL A;  3WHI A;  3RRK A;  3FSI A;  3I6P A;  4I2Q A;  2KHD A;  2BRL A;  3HZG A;  4UZB A;  1YZ7 A;  3LF0 A;  3W63 A;  4WE1 A;  4UW2 A;  4ZA1 A;  3DC2 A;  5A8W B;  2DH7 A;  5I3U B;  3QZ7 A;  4F26 A;  5CZX A;  1X5S A;  4QPT A;  1V3R A;  5KFS A;  4ECQ A;  1WHW A;  1JWW A;  2Y0S D;  1WC0 A;  4K0K F;  1BQN B;  3G87 A;  3ZNU A;  4RNM A;  2R7O A;  2AIR B;  4WU2 A;  4Y34 A;  4YB5 A;  1R89 A;  3M4X A;  1BLU A;  2VFR A;  2VQE J;  2OSR A;  1Q7L B;  3SXL A;  5M2R A;  1C1C B;  4HHU A;  1HNX J;  4UOG A;  4ZP8 A;  4DQI A;  4ES3 A;  3GIM A;  1XC9 A;  5HRO A;  3DRR A;  2A2D A;  1JLQ A;  3QIP A;  3MFI A;  2V8D A;  4AYB D;  1VRU B;  3J7Y I;  4NCG B;  2IC3 B;  2E5J A;  2IIH A;  4ZJQ A;  2HBQ B;  2NUU G;  3BF4 A;  1QAY A;  3WDO A;  3RB0 A;  4YFU A;  2D41 A;  1RT4 B;  2BW2 A;  4WTO B;  4F0K A;  2PA8 D;  2QO3 A;  4KHM A;  2BQ3 A;  1EZZ B;  4GC6 A;  4IFY B;  5AXM A;  3EIC A;  5F8J A;  4ZOS A;  3RTV A;  4KHP F;  3TJ9 A;  4B3O A;  5A0Y B;  1U49 A;  4WFN Q;  2K3I A;  2YPZ A;  5F8N A;  4JI1 F;  4JV1 A;  2HHT A;  3W1Y C;  2EFO A;  2ZBP A;  2MSS A;  3OVB A;  2MQQ A;  2VD3 A;  2DCU B;  2R2S A;  2HRU A;  5AT1 B;  3POT B;  2PFF B;  1IBL J;  1TKT B;  2P9G A;  4DG1 A;  1VGY A;  2MQL A;  3FZB A;  4OZJ A;  2HND A;  1KP6 A;  2YVS A;  2UXC F;  1BQM B;  3M2V B;  3I4H X;  4EO8 A;  1U6Z A;  4URG A;  5HMX A;  2O67 A;  1N0V C;  1SPB P;  3QJP A;  3TAQ A;  1RT5 A;  3CJK A;  2UXD J;  4Y00 A;  4ZP6 A;  4H4M B;  3ET6 B;  4DZD A;  4GO5 X;  1J27 A;  4QIF A;  2C2M B;  3TRG A;  2KB2 A;  4D3H A;  2YNF A;  2V68 A;  3M9M B;  2ZJQ Q;  1WI8 A;  1DLO B;  2XS5 A;  4USM A;  2COL A;  3DDI A;  1RAO A;  4K4S A;  2ZVS A;  1KQS R;  5KG0 A;  4DX5 A;  3VQT A;  4RW6 B;  5IQQ A;  4OV1 A;  3JQM A;  2WVC A;  2HYI B;  3T9N A;  5E3Q A;  3W5Z A;  4Q5V A;  3MR7 A;  5HN0 A;  3IRX A;  3GFY A;  1IJF B;  3RG6 A;  2GQQ A;  4NA3 A;  3J7Z T;  2W2M P;  1WI6 A;  5B0C A;  5GAH U;  2VG7 A;  3DRS B;  1P6T A;  1HBM B;  3LO3 A;  1S7H A;  3MAA A;  1RAG B;  1I1G A;  1NHU A;  2HFZ A;  2EBG A;  2FYX A;  4DL2 A;  1VBX A;  5DG9 A;  1U09 A;  2IAJ B;  4JI6 F;  5IM0 A;  2ZM6 J;  3BBB A;  4USK A;  1FT8 A;  2HMI A;  2W4P A;  8AT1 B;  4QR0 A;  3UVJ A;  4Z37 A;  2RDI A;  3G96 A;  3LQV A;  4F02 A;  3HVT A;  1DQ9 A;  1VBZ A;  3PV8 A;  3SCJ E;  2EXU A;  2VPY B;  4Q8E A;  2GO8 A;  4XIU A;  4MTP A;  2OAU A;  1S0M A;  4XO0 A;  3MEG A;  1S6O A;  1FRI A;  3GJS B;  3D3C J;  1Q95 G;  1MWY A;  3M6U A;  5KG2 A;  4JI7 F;  5EX3 A;  3K5O A;  1WUU A;  5CD4 A;  2OPQ A;  5DGB A;  3O8W A;  1KN6 A;  4OJG A;  2UU9 F;  3PDN A;  4C11 B;  1B0V A;  2HSE B;  4HI1 A;  3MR5 A;  2FJB B;  2BDP A;  4RWW A;  3O2I A;  2HS3 A;  2DK2 A;  4JI2 J;  4N77 A;  2LLZ A;  4LBP A;  1HNZ F;  2YWE A;  3BEG B;  3BYR A;  3CDW A;  3A3N B;  2R42 A;  1HLW A;  1WOR A;  4IDK B;  3DMJ B;  1K8A T;  3CSK A;  4KAI A;  4EZ6 A;  1F5B A;  2PT0 A;  4OZ3 A;  3GQC A;  4CYU B;  2IM3 A;  1M5H A;  2IMO A;  4R5P B;  4TQR A;  4U67 Q;  1RBA A;  3BPS P;  3FQK A;  2NXU A;  3LWM A;  5C42 B;  3BKU A;  2QL5 B;  4NRT A;  5E3A A;  2FUG 9;  2F40 A;  1FKP A;  3TEH B;  2DNZ A;  4KQZ A;  1QTN B;  4WYW A;  4ECY A;  4Y2A A;  5HAN A;  3AHP A;  2J9D E;  1WKJ A;  2RQK A;  4CLU A;  5C2G A;  3G9C A;  2IPO B;  3NWR A;  1FVS A;  2W8K A;  4DV3 F;  2A18 A;  4ZLN A;  3NGR A;  1CS4 B;  1HBU B;  3AQO A;  2FJW A;  1T9T A;  2G13 A;  4OX9 J;  3PO5 A;  3M6W A;  1J5O B;  3MCS A;  2ZC4 A;  3D2W A;  5J2N A;  4EBD A;  2XNR A;  1Y5N B;  4OI6 A;  4OZ1 A;  2JOQ A;  2H5I B;  2KT2 A;  4C3L A;  1NSK L;  2C2N A;  3KNG A;  4M8L A;  1APS A;  3KYL A;  2K06 A;  3AH6 A;  2VV5 A;  2MGZ B;  3D6F B;  4I6A A;  4KTQ A;  4PAA A;  4ZVU B;  2KXF A;  3DOM B;  2GZO A;  1FXD A;  2J6T A;  4MT1 A;  4ZKA A;  4W92 B;  4OYZ A;  4ZS6 A;  3BGL A;  1JLC B;  5SUH A;  2W4D A;  4LSN B;  3A4T A;  1F60 B;  4ZVT B;  4RW9 A;  2NXC A;  4DR3 J;  1FO1 A;  2CKW A;  2AF6 A;  5GMD A;  4KE5 A;  2Z2Z A;  1OIA A;  2IRX A;  3DDK A;  1HBO A;  5MLC V;  4M5M A;  3DLE B;  1YRT A;  2R7T A;  2KTQ A;  3I0R B;  5H9E J;  3HD2 A;  2RT3 A;  3CDA A;  1D8Y A;  2FY8 A;  3CXC R;  2R8H A;  4IG3 A;  1XEZ A;  2AJ2 A;  4TLR A;  2HPU A;  3R7N B;  4DV7 F;  2KM8 C;  2H51 B;  3GSD A;  4F2R A;  4C0H A;  5FD1 A;  4X65 J;  1YKW A;  1JK9 B;  2R4F A;  1HW8 A;  3S01 A;  4DUY F;  2AQ4 A;  5I3P A;  1X0F A;  4G1I A;  5D4N A;  4NOH A;  3JB9 k;  3NBP B;  5BYS A;  2M7S A;  4AXJ A;  3WC0 A;  4AXI A;  4QWB A;  5D15 A;  2A2C A;  3OPK A;  1LWF B;  4U96 A;  1S6Q A;  3T5J A;  1LWE A;  4FVC A;  1IM4 A;  3RBD A;  4X4O A;  2V2Z A;  5B0F A;  4CIO A;  2EW9 A;  4NZ0 A;  3SCL E;  5B08 A;  4PXB A;  5HP1 A;  2QA1 A;  3D0H E;  4ZPT R;  1T3O A;  2LXU A;  3M2R A;  3HHN B;  1DQA A;  2VA3 A;  1RTH A;  2FPH X;  4NYP A;  1NND A;  5KG5 A;  3QGG A;  2ZWP A;  4R0E A;  3ZC4 A;  4I2Q B;  2W24 A;  1ZA2 B;  3O3L A;  2H1Y A;  3BGR A;  3VQS A;  3KKF A;  1O51 A;  5CCM A;  1IR1 A;  1FE0 A;  1N33 J;  2UVU A;  3GFX A;  5J1E B;  4LFC F;  1S79 A;  1MN9 A;  1NZ8 A;  1S1W A;  3FC9 A;  1AT1 B;  1R0A B;  1H2V Z;  1UVJ A;  2O1P A;  2FLO A;  3MMB A;  1CG2 A;  1K1S A;  3OTC A;  4A8F A;  1RYR A;  1WEX A;  4MK7 A;  5KFH A;  3TJ8 A;  2FZG B;  3I0S B;  4DQQ A;  3GIJ A;  1SC4 B;  4QBU A;  2GA7 A;  2YKQ A;  4ZPB A;  3BKT A;  3J81 U;  5KFM A;  4MMO A;  4ZVR B;  1E6V B;  1S72 S;  4CLY A;  2P8I A;  2FHJ D;  5C25 B;  1XMQ J;  2JX2 A;  1Q78 A;  1TEL A;  3MED A;  4DV4 J;  4JI8 F;  4IQX A;  3MM6 B;  5LSR A;  2CJB A;  4OZL A;  3HJF A;  2NSB A;  1YQH A;  3HT0 A;  5KT3 A;  1WC4 A;  4I2P B;  2AEM A;  1FEE A;  2DIU A;  2J0W A;  1WG1 A;  2UZA A;  4HT5 A;  2AD9 A;  3AD8 C;  3ICL A;  1IUJ A;  3HJV A;  3GE9 A;  3M8S A;  4ZCL A;  4M5D A;  1SJR A;  2QMU B;  2AJ4 A;  4ECW A;  2ZNY A;  1SJF A;  3SDE B;  1IN0 A;  4DPU A;  4DX7 A;  3GG0 A;  2OI2 A;  1KLN A;  3UW1 A;  1KTQ A;  3R27 A;  3UDE A;  3UDV A;  3M8P A;  1CPZ A;  4OLP A;  3TUI C;  2PSZ A;  4TY9 A;  2BR0 A;  3HHK A;  4DSI A;  1B7Y B;  4DCP B;  1FFG B;  2OEM A;  4WK3 A;  1JX4 A;  2VFU A;  4YY3 F;  1IKW B;  4QOT A;  3CPW R;  1YBA A;  2LEA A;  4OHZ A;  1YK9 A;  2PMW A;  1AA1 B;  5CXT A;  2D74 B;  4MH8 A;  2XO7 A;  5J1N A;  3G86 A;  1N5T A;  4LMZ A;  3DGP A;  3CCM S;  5DDR C;  2GW8 A;  3H5X A;  4RPF A;  2MZ1 A;  2PGC A;  3LGN A;  2U1A A;  1UFW A;  5A2Q U;  3DM2 A;  5HO4 A;  3M8Z A;  1TK0 A;  3T41 A;  3LH2 S;  1FK9 A;  3W61 A;  3N6M A;  3OL8 A;  4ZHR A;  2Z2M A;  2MKS A;  4DZ6 A;  2XC9 A;  4RW4 A;  3GR0 A;  5HAT A;  2L3M A;  2L41 A;  3HT3 A;  3G8T A;  1RT6 A;  2VG7 B;  4WCE Q;  1LFW A;  1QSS A;  3LAK A;  4CLK A;  3TYT A;  2FHK A;  3OTE A;  1CC8 A;  3OV7 A;  1FFS B;  1UVN A;  4XTT A;  1VOM A;  2IM1 A;  1SH0 A;  5CYQ B;  4LUB A;  2HVI A;  1H7W A;  1HQE B;  1NDP A;  4ANC A;  2AGQ A;  4FKY A;  3MPU B;  1SUQ A;  1UFL A;  1WKL A;  5LL6 d;  1M1G A;  1U24 A;  3KHL A;  3HVT B;  4LF8 J;  2MQO A;  4DR2 F;  2FVP A;  4OIX A;  3MEG B;  4OLO A;  4DX6 A;  1D09 B;  1KBR A;  3DXB A;  1TL7 B;  3CCJ S;  3M30 A;  4LQ3 A;  5HJY A;  2IA6 A;  2WRM A;  4QQB A;  4OX8 A;  2DNM A;  3IAS 9;  3ZZR A;  5HAO A;  2WSE C;  1U1K A;  4UZC A;  4KGM A;  4OI0 A;  2DGU A;  4ANE A;  3HXM A;  2VBY A;  3V81 B;  3EXY A;  1B3T A;  4CDI A;  1IXK A;  1ZM3 A;  5FDL B;  4PXD A;  2ZZT A;  5J2M A;  2PDA A;  4BBY A;  1RU2 A;  3BQ1 A;  2ZOF A;  1S1X A;  2CZV C;  3TA0 A;  3DLK A;  3GJQ B;  2IYI A;  3T5H A;  2CQ4 A;  1TVR A;  1K0V A;  1S6P A;  2KZM A;  2BJD A;  2ATC B;  4EBE A;  4NX9 A;  4G3I A;  3C14 B;  4GMK A;  2CYY A;  3R5J B;  5A8K A;  5DQH A;  2G1D A;  2HNZ B;  1WOS A;  2O01 C;  3NGS A;  2V0N A;  2HS4 A;  2DNH A;  2E1C A;  4WPA A;  4LFA J;  2RKI B;  2IBK A;  5L9N A;  4DUZ F;  1JNR B;  4X4R A;  1YJN S;  2JEI A;  1ZA1 B;  2QLF B;  2ZDO A;  3MCO A;  3W62 A;  2LDI A;  2MMY A;  3FVY A;  3GON A;  3H8Y A;  2FVR A;  1WKK A;  2C3P A;  2LU1 A;  3WZ0 A;  3L7O A;  5J2Q A;  1N6Q A;  3BSO A;  3NGD A;  3NCR A;  1R3N A;  1WC5 A;  1O0P A;  2CQ1 A;  1XR6 A;  2DNN A;  2R8J A;  2PI5 A;  5AJ3 J;  3N28 A;  4NPO A;  5KFO A;  4GKJ F;  4Z7C A;  3QAE A;  2YKM A;  1I94 F;  2DHH A;  3L7P A;  1U1Q A;  3HFV A;  1RAE B;  4Q7A A;  4LF1 A;  2XMV A;  2MKI A;  2MJN A;  2QTW A;  2G2Y A;  4ELT A;  5HVF A;  5H9F K;  5D0E A;  3MM8 B;  2MY7 A;  4BWM A;  2KVQ E;  1JLA A;  2J8A A;  4J9K A;  4NLG A;  1S77 D;  3S8S A;  3RW7 A;  1NSQ A;  2OFH X;  4RNH A;  2LQ8 A;  1YJT A;  3KG1 A;  3OBI A;  4ZN1 A;  4AFF A;  4K59 A;  2FHJ A;  5J2P A;  5M2P A;  2YPY A;  3CE8 A;  2CG8 A;  2VPX B;  4YEA A;  4ZLJ A;  3A3P B;  3FSX A;  3OTO J;  3GV7 B;  3V6H A;  2BJ9 A;  1K73 T;  2R7U A;  3MM5 B;  1U1N A;  3AT1 B;  2LEC A;  2GNK A;  2VG6 B;  3H90 A;  1RAF B;  4L73 A;  4B3T J;  4LF4 J;  3W9H A;  5T7L B;  3AY0 A;  1EQM A;  3RBX A;  2PFD A;  4F2S A;  1E6Y A;  5IS2 A;  1F2H A;  3OL6 A;  1TQL A;  1V3Z A;  2DIS A;  2E66 A;  3QAU A;  3IMQ J;  4M95 A;  2KH9 A;  1NJX A;  1R31 A;  1WOP A;  4IQM A;  2KRR A;  1G3O A;  4RX6 A;  2X1G A;  3M2R B;  3FFI A;  3W2V B;  3N6L A;  5KAK A;  1T94 A;  3DU5 A;  4W98 A;  3FRZ A;  4BLG A;  1NPR A;  5KFV A;  4K4Z A;  3FRY A;  3QGI A;  1G2E A;  5F8H A;  1GXT A;  2X1B A;  1ZAV A;  3TW0 A;  3CW2 C;  2XI3 A;  2R2U A;  4MK8 A;  4DFK A;  2BE9 B;  4J90 A;  3GCW P;  1S1U B;  2FJA B;  3OFG A;  4M5G A;  4WFA Q;  2V5H G;  3K7R A;  4F4Z A;  2U2F A;  4DR7 F;  1O6X A;  2Q66 A;  4KFB B;  3CCR S;  5GAD I;  1HNW F;  1B0P A;  3OXL A;  1NUE A;  2DR6 A;  2QA4 S;  5IC6 B;  1Q8K A;  3OUY B;  4KO0 A;  4ZDN A;  2RJZ A;  4LSL A;  2LVW A;  1PO6 A;  1T7P A;  1XWL A;  3CD6 S;  2QMW A;  4ID5 A;  2YNI B;  3OTB A;  3W9J A;  2E1A A;  4X4T A;  2HZV A;  4R25 A;  3VAH A;  4ZMM A;  3IGV A;  1WG4 A;  1JLF A;  3KWM A;  1D0E A;  2W2P P;  1FVQ A;  3UQS A;  4ECU A;  2OJ3 A;  2OGU A;  4F0H A;  1CUL A;  3UNY A;  3R5G A;  4LJM A;  3DLG A;  1MWZ A;  4Y2M A;  4Q43 A;  3SMZ A;  1FJG F;  4UT4 A;  1R7I A;  2ZJP Q;  1HAR A;  3GSI A;  1ZM9 A;  1KD1 T;  3AXK A;  4MIB A;  2E9Z A;  5ETN A;  2EPI A;  1YZ6 A;  5ADZ A;  2M8D B;  2ACM A;  5B0E A;  1UVK A;  2YWG A;  2UVR A;  2DGV A;  1IQZ A;  1KTV A;  4A8X A;  4KH1 B;  3BRE A;  2AZ3 A;  1GMU A;  2J7U A;  5DM7 Q;  5G0R A;  1FRM A;  4ZCM A;  1OMS A;  2B4V A;  4F67 A;  2EI5 A;  2OIH A;  2DO4 A;  4NLU A;  3QWU A;  2B0G A;  5E41 A;  3BSC A;  3G71 S;  3D6T B;  5KG1 A;  1RHR B;  4MFB B;  2NXJ A;  3BR8 A;  2F4V J;  2XB2 D;  2V8V A;  1GFW B;  5LXR A;  3TZX A;  2JLF A;  1FX2 A;  2HHP A;  3DGP B;  3TAP A;  1CJK A;  4CO1 A;  3CME S;  4PWW A;  1S76 D;  1N88 A;  2Q43 A;  2XHC A;  4DI6 A;  3DM2 B;  4EMD A;  3SSR A;  4DR4 F;  3T5L A;  3AOC A;  1S9E B;  3PEH A;  2UXB J;  2A0F B;  2HBR B;  2FVQ A;  1G7C B;  4USI A;  2AT1 B;  3JYT A;  3PYD A;  2G1H A;  3R9L A;  1NH8 A;  5CHC B;  3W64 A;  2RVJ A;  2VL1 A;  4U95 A;  2ZOG A;  3DLL Q;  2OMO A;  2ZZN A;  3NCQ A;  4BWJ A;  2B43 A;  1U1L A;  1SUQ B;  1EET A;  2CNN B;  4Z7Y A;  5D0H A;  3FEY B;  1VHF A;  1V5I B;  2OKQ A;  2ZUA A;  4NLD A;  2W8L A;  3IS9 A;  1VS3 A;  1ZOT A;  4RBV A;  2CQ2 A;  1VCT A;  1B64 A;  1G6B A;  2YKA A;  1UJ6 A;  1UA0 A;  2CZ9 A;  3M30 B;  3ULH A;  3SCI E;  1URR A;  2JLG A;  3OFH A;  4BC7 A;  2LDY A;  1QY7 A;  1CJT A;  2KFN A;  2WON B;  4WFY A;  4A8W A;  2PC6 A;  3K0J A;  1SI9 A;  2BJ7 A;  3C15 A;  2VQE F;  2AYG A;  5HBM A;  2RU9 A;  1HNX F;  4YB1 P;  1JQG A;  5J2M B;  3MM9 B;  1J5E J;  1IKX B;  1VQM S;  4F4K A;  1D9F A;  5GVQ A;  2DVI A;  3VGV A;  2B3T B;  3KK1 A;  3MM7 B;  1JXL A;  2FDN A;  3DU6 A;  2ADC A;  4BCA A;  2CDQ A;  4C0O C;  1U6B A;  2DXE A;  4ZPA A;  4EI2 A;  4O3N A;  5IWA J;  3MMC B;  4PQU A;  1ZBT A;  3LP2 A;  4RW8 A;  4NE9 C;  1HYS A;  2GV1 A;  3M8Q B;  1R8C A;  4YDD B;  1AXQ A;  4JI0 J;  3QJJ A;  2F9J A;  2ASL A;  2HUR A;  2HAI A;  5D78 A;  3J7Z 5;  4CO3 A;  3VAG A;  2D3U A;  1RU1 A;  3UCU P;  4PWU A;  1NAQ A;  1R8H A;  4F50 A;  4DHV A;  2FJX A;  3AB4 B;  2DNO A;  4FF3 A;  2IJN A;  3I5A A;  3CCE S;  5GAG U;  2RD5 C;  1Y4Z B;  4O3S A;  4N8N A;  2BJ8 A;  3I9Z A;  1NJW A;  1VJW A;  1IVZ A;  2LQ5 A;  4P72 A;  3KLE A;  1QVG R;  1IBK J;  4HH0 A;  2LYV A;  2HHU A;  2KU7 A;  2PA3 A;  2KXN B;  1GNK A;  1RA7 A;  1TFW A;  2F9D A;  3JQJ A;  2VHG A;  4RU2 A;  2UXD F;  4Q2L A;  2B6A A;  3JSR A;  4QIG A;  4AND A;  4DJB A;  5HQM A;  3CD7 A;  4BS2 A;  1Y10 A;  3HF5 A;  4I4B A;  2MQN A;  1X4H A;  4DV1 J;  3CF5 Q;  3QID A;  2ALY B;  3EGV A;  4M5N A;  2KKH A;  1LWX A;  2MXY A;  3ILO A;  1X5O A;  3T1A A;  2ZJR Q;  2OFG X;  1VC6 A;  2K3K A;  4DV5 J;  5ETP A;  2CVI A;  1RT7 A;  1SB6 A;  1T9W A;  4KKO A;  4WFX A;  2R2R A;  1N5Q A;  2JZ5 A;  1GMW D;  3IO1 A;  1UTA A;  2WVD A;  3QAT A;  1PYO B;  3K8V A;  1ZET A;  3MEC A;  3PYE A;  3N01 A;  4LR7 A;  3ZTP A;  3B54 A;  3THV A;  1QAJ A;  2J6U A;  1K47 A;  2QGF B;  1EKR A;  4Q8F A;  2F8M A;  2XHW A;  3QGP A;  2MKC A;  4K2J A;  1RB0 A;  2BKP A;  4F3O A;  2DY1 A;  4ES2 A;  1FJC A;  2OSQ A;  4ED3 A;  2ZUG A;  2OPR B;  1WDD A;  4OYB A;  2HW3 A;  2BJE A;  3J7A N;  3EJM A;  2ZM6 F;  4G1Q A;  2QLX A;  1FWP A;  2X51 A;  2AJ1 A;  2NYI A;  1RLC L;  3EPG A;  3OVS A;  2A6O A;  2KJV A;  4Q0B A;  3BSN A;  2HQI A;  1BD6 A;  3LWL A;  4JYA F;  4DV0 J;  5AXL A;  2HHQ A;  3Q8U A;  1NDC A;  2V8P A;  1EQ0 A;  3Q83 A;  4FVM A;  1TAU A;  3OXG A;  1WEZ A;  2UVW A;  4FF1 A;  2DH8 A;  5BJR A;  4PR6 A;  1N32 J;  5C2C A;  1S1V A;  1ZPV A;  4L3N A;  2GML A;  2QSF A;  3PR4 A;  4JP8 A;  4PAB A;  1HNI A;  4Y65 A;  2WB1 D;  1JLG A;  3NP5 A;  4F0M A;  4FKX A;  1HIY A;  4M5L A;  2KDO A;  5AE1 A;  1D3W A;  3CCT A;  3EYZ A;  1Q81 T;  3ADA C;  1HNV A;  1U6F A;  1TUV A;  3EGN A;  1U1O A;  4JI2 F;  5GAH I;  5F8G A;  4HDG A;  3TAM A;  2HWT A;  3SYZ A;  1SC6 A;  2ZE2 A;  1L3K A;  2NRE A;  2GQ2 A;  4LF7 J;  4O23 A;  2V4J A;  5KFQ A;  3ZZT A;  3W60 A;  4DLE A;  2RUG A;  4M5H A;  4X66 J;  4ID5 B;  4WWS A;  2DCL A;  4P71 A;  5JUM A;  1WWH A;  3QMQ A;  2N3L A;  3OW2 R;  4K4W A;  3CVK A;  5I4M A;  1F1B B;  2NZC A;  3EGZ A;  3TZW A;  2M0G B;  3Q22 A;  4X4V A;  3H0P A;  1AW0 A;  4J37 A;  2XGQ A;  3JAM Y;  5KFW A;  2JC1 A;  5DG7 A;  3MUV P;  5F8M A;  3KMS A;  1UJ5 A;  4C9D A;  4JUZ A;  1KLM B;  4JV5 J;  2BM0 A;  3O6Q A;  1SC3 B;  4B9U A;  4OX9 F;  2AYM A;  2O5D A;  4DV2 J;  2B9W A;  4R8U B;  4C98 A;  1RTJ B;  2BKN A;  3KLF B;  2EC0 A;  5IXU A;  1BWV A;  1TL1 A;  4RZR A;  3NNH A;  3SI8 A;  5K5M A;  4U7U K;  2PII A;  1QD1 A;  1RBO B;  1Q16 B;  4Q44 A;  1ACM B;  2HQF A;  3QGH A;  2QJ3 A;  2BQU A;  3IWN C;  5DET A;  1UMJ A;  1B7F A;  5KFB A;  1PBA A;  4I64 A;  2C2K B;  4ENO A;  4DR3 F;  3D4J A;  3OL7 A;  1YRU A;  2AZ1 A;  2DPJ A;  5D8H B;  4IRD A;  3G8S A;  3ENW A;  4H4O A;  5I42 B;  1LK7 A;  2XMJ A;  2CZ4 A;  3ZZ0 A;  3BGU A;  4DEZ A;  1S0O A;  4WZM A;  1LEO A;  1JLB A;  3L95 X;  5KOX A;  4KSE B;  4RR5 A;  3BB5 A;  1M1K T;  1K9M T;  2RRA A;  2V34 A;  4M94 A;  2DIV A;  5DJB A;  4CRJ A;  3SFU A;  5CD4 H;  1T8E A;  3T19 A;  4OYI A;  4DR5 J;  2DEI A;  1GMV A;  3JTP A;  2KHC A;  5ETO A;  2C2O B;  5F9L A;  2GMJ A;  1U0S A;  2BAC A;  2IDL A;  4X65 F;  1SVD A;  1EP4 B;  4ES1 A;  1RAJ A;  3K8W A;  5JJB A;  1HI0 P;  1T03 A;  5BYQ A;  4PXE A;  1WD6 A;  2W7P A;  2E1P A;  2P9C A;  1NH7 A;  4OYW A;  4RNF A;  2FQQ B;  5LMU J;  2HGL A;  3NY0 A;  4P6Q A;  2QRR A;  3EDQ B;  2YBV A;  2DGT A;  4XDC A;  4OYA A;  2QT7 A;  4WIQ A;  2HHH J;  1T05 B;  3OL9 A;  4NI2 B;  1FCA A;  1TZ0 A;  4ECT A;  4BHQ A;  2MKH A;  3WX8 A;  4NLP A;  3KUH A;  4CT8 A;  3I82 A;  1IQT A;  2GVD B;  5A8W A;  3ONQ A;  2B7C B;  1DHM A;  2CJY B;  4L3K A;  5I3U A;  4Z2X A;  1HD0 A;  1N33 F;  1YBU A;  1WF2 A;  4LFB J;  1M5V C;  4ZIW A;  3GJT B;  4ZVF A;  1FXR A;  1F0X A;  1TUW A;  3ZZP A;  2FC8 A;  3TP2 A;  3SV3 A;  4HT7 A;  1BQN A;  4NML A;  3GYX B;  2D1C A;  2XY6 A;  4OHX A;  1X60 A;  1GMW A;  4B3M J;  2JVO A;  3C16 B;  2WW4 A;  4ZP7 A;  1OYE A;  2X7I A;  4TVA B;  1C1C A;  3W7B A;  2WVB A;  1BXN A;  2VOO A;  4DL0 C;  3V2U C;  2B4O A;  4CH0 S;  2L9W A;  1SL2 A;  7FD1 A;  4B3S J;  1VRU A;  2DD8 S;  3P49 B;  3TJA A;  2X3G A;  4NCG A;  2WVF A;  4CM0 A;  3C8Y A;  2IC3 A;  3VR1 A;  4G65 A;  4JI4 J;  1HMV B;  3HHD A;  4MAK A;  3Q8S B;  5KFK A;  2B4P A;  2GVZ B;  2NQP A;  3W65 A;  2JVR A;  1WC3 A;  3MMA B;  1RT4 A;  3DI6 B;  2ZBQ A;  1XMQ F;  2X1F A;  4PQU B;  4DL5 A;  4IFY A;  2HHX A;  4DV4 F;  5KG4 A;  3N79 A;  3GR1 A;  3LP2 B;  1IM6 A;  6FDR A;  3A8J A;  1NU4 A;  4J9P A;  5H9E K;  4AD6 A;  3HHL B;  1YRX A;  3NAH A;  1H2T Z;  1ZTT A;  4WXO A;  3POT A;  1TKT A;  3HUL A;  4NL5 A;  1PYS B;  4B02 A;  1BQM A;  4UQG A;  3M2V A;  3AOA A;  3OFF A;  3KJF B;  2WTF A;  4NCB A;  1VQO S;  3R7B B;  4FYW B;  4DPW A;  4DV6 J;  3KLE B;  3OR2 B;  5DDP C;  1S6U A;  3F41 A;  4H4M A;  5K8P A;  4O44 B;  5D0R A;  3ET6 A;  2PD1 A;  1FXL A;  1LW0 B;  4ZJO A;  2OO4 A;  1T02 A;  1NJI T;  1NXI A;  3ZO7 A;  3CCV S;  1R0B G;  1DLO A;  4FS2 A;  3QZ8 A;  4ECZ A;  3BBC A;  2CAD A;  1FRL A;  2DPI A;  4K5S A;  2RNE A;  2DNP A;  4RW6 A;  1UVM A;  1IWG A;  3LP1 B;  3TX0 A;  1DAR A;  2GIF A;  2ZH7 A;  3UN5 A;  3GCX P;  4NYO A;  1VRT B;  1U48 A;  1LWC B;  2BZ2 A;  3AA9 A;  3KK2 B;  4DQP A;  4JBC A;  4PKD B;  3MD1 A;  2W2Q P;  3DRS A;  4LRE A;  1HBM A;  4J9U E;  3ZTQ A;  3NEK A;  2WZ1 A;  1Y7P A;  4F04 B;  1DJ0 A;  2IAJ A;  4LF6 J;  3ZTS A;  3ILL A;  3MCN A;  4N47 A;  3TUJ C;  3OR1 B;  4ILM A;  4G1Q B;  2P6S A;  3PX6 A;  1WSV A;  2EG1 A;  2EKN A;  2ZDP A;  2ZBR A;  3NNC A;  2FGC A;  4KHP J;  3QFW A;  4RL1 A;  1NPP A;  4Q0B B;  5KG6 A;  2DHG A;  2MB0 B;  3G6E S;  4IRK A;  2WB4 A;  2FZK B;  1LXJ A;  1KFS A;  4DQR A;  3IWX A;  2G2Z A;  2XWY A;  5LMN J;  3Q8P B;  4LF8 F;  3NXZ A;  4NEZ A;  2XNQ A;  3HHE A;  4NLQ A;  3OXF A;  5CA5 A;  3MPV A;  2W01 A;  3KJV B;  3GU0 A;  2D69 A;  2LKZ A;  1Q5Y A;  2UXC J;  1PJ5 A;  4C11 A;  5KG3 A;  2GAG C;  2C2Z B;  1KWM A;  3A8E A;  5IC4 B;  4J9Q A;  3IGN A;  5KFP A;  3GPA A;  1UW4 A;  6AT1 B;  1ELO A;  3MDF A;  3WX4 A;  2JC0 A;  4IDK A;  3DMJ A;  1VQ7 S;  3VV2 B;  3KLG B;  1RZM A;  2Z56 B;  1U2C A;  3DKD A;  2AMC B;  4NZ7 A;  4G1P A;  4CYU A;  4DCO B;  1GTH A;  2E9R X;  4R5P A;  4U8Y A;  3HK2 A;  1LOU A;  1HPZ B;  5C42 A;  4KPC A;  4FYV B;  3HKZ D;  3VZH A;  1N54 B;  1BMQ B;  1JLE B;  1M5K C;  3DGV A;  2IY5 B;  4YQW A;  1X4A A;  2E5L J;  3VGS A;  4X62 F;  1X7V A;  2QL7 B;  4LFA F;  3PG9 A;  3DOL B;  3PCO B;  3PY8 A;  3NS6 A;  2J9E A;  2A1B A;  1CS4 A;  1HBU A;  3CMA S;  2QEX S;  2A3J A;  2DRA A;  3UO0 A;  1H98 A;  1TFY A;  1J5O A;  2EBE A;  4JI6 J;  3C3L A;  4KB7 A;  1SCJ B;  4C8O A;  5FLX Y;  4QYR A;  4DSJ A;  3SSQ A;  3ZZY A;  4NEY A;  3GB0 A;  4FDF A;  2MGZ A;  8ATC B;  1S57 A;  5T14 A;  2ILZ A;  3DOM A;  2QZ8 A;  1N5S A;  4N56 A;  3S1T A;  2R7X A;  1IR2 A;  2BQR A;  1JLC A;  5AJ3 F;  4LSN A;  3GZ7 A;  3P96 A;  3IXQ A;  3FEZ A;  2GX8 A;  1LKZ A;  4EWT A;  2UV8 G;  4QW8 A;  3Q8V A;  1RHM B;  4JI7 J;  3EWG A;  5E3P A;  2VJU A;  1RWU A;  3F0N A;  3IA0 A;  3DLE A;  2MTL A;  2HZC A;  1DTT B;  2HK2 A;  3WQP A;  4PWD B;  3I0R A;  3THT A;  2V9W A;  3ZXW A;  3HVA A;  2ERR A;  4DS4 A;  3E01 B;  3G2X A;  3M8R A;  3MPD A;  4FBU A;  2VAS A;  2BAB A;  1FEH A;  5L9X A;  1N34 J;  4BC9 A;  5JMN A;  2XMK A;  4FXW A;  3KFW X;  2VOP A;  4GC7 A;  1OQ3 A;  1Z2L A;  4KH0 B;  4N8O A;  2VJV A;  1HWK A;  1TK5 A;  1Y9O A;  3PIP Q;  2RF2 B;  3KHR A;  5E2Q A;  3F73 A;  3NCP A;  4P2M A;  1V5V A;  1S9G B;  2XM3 A;  3OTO F;  3GII A;  3TX8 A;  3FNN A;  2HFS A;  4HI2 A;  1LWF A;  2Y3Y A;  5FJ4 A;  2C3M A;  2KFZ A;  4ZP9 A;  1YG0 A;  4B3T F;  4LF4 F;  2GGP B;  3CJQ A;  2EKY A;  4CLL A;  3F44 A;  2JHE A;  2XWX A;  1Y5L B;  2V69 A;  2DXF A;  4RU9 A;  2HWH A;  2HHV A;  4HH1 A;  3K5M A;  2LFV A;  1HA1 A;  3TNV A;  2Q79 A;  2OD4 A;  3IWL A;  3OVA A;  1QE1 B;  3FSY A;  1U1P A;  1GTE A;  1JJC B;  4HTI A;  2HIY A;  3BYP A;  2FHM A;  4K4X A;  2R7V A;  2IA0 A;  3K2Y A;  5J1E A;  2WSC C;  3CJ8 A;  1VQ4 S;  4FYX B;  1H73 A;  2XCP A;  1TL3 B;  4GVB B;  2EFP A;  3EE3 A;  1R0A A;  2CDR B;  4JI3 F;  3VF0 B;  4CWB A;  4OHV A;  4UOC A;  3CGI A;  4O4G B;  2ASY A;  2C2D A;  4TU9 A;  3S6E A;  1KC8 T;  2YX4 A;  3H59 A;  1A7G E;  5HL7 Q;  4HR2 A;  5CQG A;  2ZD1 B;  4EYI B;  2EEY A;  2J76 E;  3L4B C;  3PW2 A;  2XZW A;  3OSN A;  1Q5V A;  4M5J A;  1SQE A;  2BAN B;  3MAQ A;  3HCX A;  2F8E X;  4DR1 J;  3I0S A;  5IT0 A;  1F6T A;  1TR0 A;  1UEK A;  2GIR A;  2IVY A;  4AUK A;  3N6N A;  5K9F A;  2J7W A;  1NDL A;  2IFX A;  2N7Y A;  4ED2 A;  2BXJ A;  3QSY B;  4G6V B;  2HFV A;  4AQY F;  1O8B A;  3KMQ A;  1E6V A;  2IDE A;  5C25 A;  4IG0 B;  1Y11 A;  1VQK S;  1RWX B;  3RRH A;  2J0Q D;  3KNA A;  3MM6 A;  2DGW A;  2EFN A;  4ZCK A;  2HHS A;  2PO4 A;  1X0P A;  2GJF A;  2HBZ B;  1Y3J A;  4I2P A;  2MQP A;  3FDS A;  2ZEJ A;  5KFX A;  2NPF A;  5EX0 A;  2F8H A;  1PCA A;  5JVH Q;  3JXO A;  3BR9 A;  2IBO A;  2XYH B;  3MI7 X;  2CPY A;  2ALZ A;  4OI2 A;  2HVE A;  1FDD A;  1S4F A;  2XZT B;  2G0J A;  2YQ1 A;  3RZA A;  1MRO B;  1S99 A;  3SDE A;  1RYS A;  3AOB A;  3SIP B;  5E33 A;  2QN6 B;  1KQF B;  1SKR A;  1U0H B;  5U47 A;  3FBF A;  4HDH A;  2Z2Y B;  2V4Q A;  2BA9 A;  3AJD A;  5CAA A;  2ZBI A;  4AT1 B;  4RUB A;  2MYF A;  4B9V A;  3T3F A;  3UDL A;  2ZKU A;  1PJ6 A;  2XSJ B;  5F3T A;  1IKW A;  1NK7 A;  2FD2 A;  2QYG A;  1TV6 B;  1VHI A;  5B0B A;  2E9T A;  4KBI A;  4DSK A;  4X84 A;  2E5H A;  2F4V F;  3OFE A;  1C4A A;  2RS8 A;  3ETO A;  5HLF B;  1C0T B;  2VDI A;  3EZU A;  2CPX A;  2HQC A;  1RAH B;  1VQY A;  4S0M A;  1CBK A;  4B9L A;  4K4V A;  1WG5 A;  2LQ9 A;  2Z58 B;  3UI3 A;  5LSL A;  4W90 B;  4CO0 A;  3BZQ A;  3Q8R B;  1C0U A;  4CLW A;  2V2K A;  5L46 A;  3IN5 A;  4I6Y A;  2H5J B;  2UXB F;  3VVT A;  1F9E B;  1WHY A;  1RAA B;  1MU2 B;  2FC9 A;  1WC6 A;  1QSL A;  2RQM A;  4OYM A;  3CIM A;  1DUR A;  1YWX A;  2I6W A;  1U1M A;  5IZH A;  5CYQ A;  3VAF A;  3MTJ A;  3CCS S;  1HQE A;  2KYZ A;  3CB4 A;  4CZC A;  4K4Y A;  1HHQ A;  5E5N A;  2C42 A;  3ZZU A;  3FBE A;  4WFB Q;  4CP5 A;  3H2U B;  2KJW A;  5KT4 A;  3W2W B;  3TQE A;  3C6U B;  5KFT A;  1C1B B;  3FBB A;  2YH1 A;  4AL6 A;  1X4B A;  4B9T A;  4M5K A;  2HWI A;  1N0U A;  4LIR A;  4H54 A;  1B4S A;  4NLS A;  4YR2 A;  2OPS B;  1TL5 A;  2EWH A;  3LTO A;  4A8Q A;  2Z2L A;  1TL7 A;  3W8P A;  1SJ4 P;  2HVD A;  2XMA A;  4ZJL A;  1JKH B;  1NEE A;  3K59 A;  1RK8 A;  2B9Y A;  4DN0 A;  1FE4 A;  1L5U A;  1S12 A;  3C6T B;  2V2Q A;  2ACY A;  3UPF A;  3TA2 A;  2RIL A;  3BJY A;  4ELV A;  3V81 A;  4OX6 A;  5FDL A;  1U4B A;  2OEJ A;  2FJV A;  2CG4 A;  3B6B A;  2M70 A;  1AUS L;  2BOP A;  3LW5 C;  3A12 A;  4HEA 9;  5AXN A;  5L1L A;  2RHS B;  5JVG Q;  2V9K A;  3SBM A;  4CNZ A;  5B09 A;  1J5E F;  1YDL A;  3MUT P;  1RT3 B;  4OQJ A;  5EDW A;  3GYG A;  1L3S A;  1Q8B A;  2VF3 A;  3TR5 A;  1RWV B;  3AJ2 A;  5F3Z A;  3CED A;  2F1F A;  1R8P A;  3C14 A;  1VC0 A;  4C8K A;  1GXL A;  2HNZ A;  1VK3 A;  2G4B A;  1MW7 A;  3BV8 A;  1I5O B;  2RKI A;  4F4A A;  1KOO A;  4WP9 A;  3NOG A;  4Q2M A;  3DLH A;  4ZVP B;  1CC7 A;  4JI0 F;  3M9O B;  3MGJ A;  1S10 A;  3FCH A;  5ETT A;  1S1T B;  2CPJ A;  2YKP A;  2H65 B;  1WNE A;  4QW9 A;  2VKZ G;  3DLB A;  2L08 A;  2PEB A;  1S48 A;  2O3D A;  1FNX H;  2XZD B;  1T95 A;  3KG0 A;  2J7K A;  2LCW A;  2QYC A;  4DPO A;  3P5B P;  3TAR A;  3G82 B;  3H5U A;  4K4T A;  4KGX B;  3UN2 A;  4P74 A;  2ASD A;  1RT2 B;  1IBK F;  3BO4 A;  2L9D A;  1FD2 A;  4Y2K A;  2WCX A;  4PG4 A;  4EYH B;  4C8Y A;  4WBF A;  3A8I A;  4DV1 F;  3HP6 A;  4MYU A;  2WW8 A;  3Q89 A;  4M5I A;  4ZVE A;  3U1M A;  1HR0 F;  1FJE B;  4YDX A;  3GWC A;  2K8G A;  2LU2 A;  4ECR A;  1OSD A;  3MM8 A;  5K14 B;  3HSG A;  2ZIT A;  1RWO B;  1HWU A;  3DYA B;  4EK2 A;  1YI2 S;  4FZV A;  4LQ9 A;  4OZ2 A;  5B7W A;  3CWJ A;  1FKA F;  1F2G A;  2YNG B;  5DDO C;  2OTL S;  3D1O A;  5GAG I;  1WDT A;  4KYZ A;  2XGP A;  1MWQ A;  1RHK B;  1RJJ A;  5HMY A;  2VFS A;  2BMB A;  3B4D A;  3FEX B;  2EK6 A;  2DR5 A;  1IKY B;  4DSE A;  1YLX A;  1XQI A;  2UUA J;  3GJR B;  3MM5 A;  4YUD A;  3EZ5 A;  2VG6 A;  5T7L A;  4RWX A;  3H2V E;  2N82 B;  1RT1 B;  3OQ2 A;  2RSQ A;  3TVY A;  3I4P A;  1FER A;  3CCZ A;  3MAH A;  2GHV C;  2AGO A;  2B5J B;  3G6Y A;  1RAC B;  1T9Y A;  3PKM A;  4CLT A;  4DV0 F;  2Y9H A;  3CJT A;  3T9Z A;  5C24 B;  2JSX A;  1TTH B;  2RQ4 A;  4K7Q A;  5B0D A;  3BQ2 A;  4ID8 A;  2W25 A;  2F3J A;  3ENV A;  2ROP A;  3UE2 A;  1KRP A;  5IT4 A;  3W2V A;  6FD1 A;  3DHW C;  3IBW A;  2H54 B;  4OJ1 A;  2VFT A;  1SL1 A;  5KFU A;  3Q2T C;  1UP1 A;  2LEB A;  3P45 B;  4AE5 A;  1YJV A;  1S1U A;  1RTD B;  5IT9 Y;  2Z30 B;  4KFB A;  2UUC J;  3C46 A;  1YJ9 S;  1Q8L A;  5HVG A;  1B70 B;  3QO9 B;  2ABY A;  1S7I A;  3OUY A;  2ATL A;  3AOD A;  1TL4 A;  4LF7 F;  2BE2 A;  1P9Y A;  2QG9 B;  5D4P A;  1X4G A;  2HBY B;  1S5Z A;  1U26 A;  4C0B A;  2YXL A;  1VMB A;  4EO6 A;  1GH8 A;  2YNI A;  2ZFH A;  4CTA B;  3VGU A;  4WP3 A;  3KTQ A;  4P7T A;  5D3G B;  1S0V A;  3W3S A;  3NGK A;  1TK8 A;  3E3X A;  1URN A;  2LXF A;  2X3D A;  4I7F A;  3CJR A;  3HSZ A;  1KVK A;  1Q7Y T;  4WXW A;  2CRL A;  4CLS A;  1AB8 A;  2KZZ A;  3V6D B;  2CPE A;  1I51 B;  3CCQ S;  1EHW A;  1QDU B;  3KLI B;  2GCF A;  2PMH A;  2QLW A;  1NB2 A;  3CJ5 A;  3R5D A;  3NMA A;  4JV5 F;  2YH0 A;  4L75 A;  4ED5 A;  3CUN A;  3HZE A;  3U27 A;  1PKU A;  1QM9 A;  3GIK A;  2DTJ A;  2I9S A;  2AWZ A;  3SSS A;  5K8M A;  1DFD A;  2MZR A;  2OUG A;  3AB2 B;  1UAW A;  5HI7 A;  3R2D J;  3MWB A;  2RB7 A;  5T41 A;  3NL0 A;  1BHN A;  2Z0G A;  3IG1 A;  3A3O B;  1KON A;  1VI7 A;  1UA1 A;  4NXN J;  2PMZ D;  4DF8 A;  2UUB J;  4I68 A;  4C2M A;  4ZK7 M;  1VQ9 S;  2GO9 A;  1L3U A;  1LV5 A;  4IUF A;  3CO0 P;  1X5P A;  3PM9 A;  2VUG A;  1DRZ A;  2KVI A;  2M52 A;  3AA8 A;  3AJ1 A;  3NS7 B;  4MFB A;  2AEJ A;  3BS9 A;  3K57 A;  3GLJ A;  4ZPC A;  2DO0 A;  4Q45 A;  1XJW B;  2H4W B;  1UWB B;  2MST A;  2HZA A;  1Q86 T;  5KFD A;  2Q6B A;  2MPU A;  2E5G A;  2MDA A;  7AT1 B;  4OJ3 A;  2FVS A;  2KYX A;  1VFJ A;  2QA2 A;  4RLE A;  2H3E B;  3HDS A;  1NPK A;  3L09 A;  1KR4 A;  4DR5 F;  4KV8 B;  1JJH A;  3J80 Y;  1X4E A;  4X4Q A;  2ZKT A;  4PUO B;  1SKU B;  1S9E A;  2YTC A;  3HVR A;  4LF5 J;  3RAQ A;  1MMD A;  3CDE A;  1NCL A;  1C0U B;  4LVO P;  1KSP A;  2F5G A;  4IFV B;  3MCM A;  2LP4 A;  3T6B A;  4MIA A;  4GRS A;  1NK4 A;  1OY6 A;  2OEK A;  2FVC A;  2DNQ A;  4HVZ A;  3EVO A;  5ETM A;  4YS2 A;  4PEO A;  3D0I E;  1PAE X;  4ITS A;  3Q23 A;  5LMU F;  5AE3 A;  1UKU A;  3N5B A;  3HHL C;  2VQF J;  1TKD A;  4L74 A;  1XBW A;  3NGT A;  2J9D A;  1DTQ B;  2HHH F;  2ZVI A;  1M0S A;  5DDQ C;  2QFJ A;  3PHE A;  1O5J A;  3MUM P;  2RIJ A;  1P8G A;  5L8R C;  4E2F B;  3T1H J;  3B78 A;  2K7J A;  2C22 A;  5CYM A;  4ICL B;  2YX1 A;  3RBZ A;  4Y2C A;  3D6H B;  2WON A;  2DNR A;  4B3M F;  1T9U A;  1RQ0 A;  4E8U A;  2XQC A;  4ZVS B;  3PO4 A;  4A8O A;  2HGM A;  4KY3 A;  3UCG A;  1MMN A;  4NLV A;  1CJV B;  3MM9 A;  1IKX A;  1OS5 A;  4B3S F;  2XYG B;  1T11 A;  3H4B A;  5A76 A;  3MM7 A;  1A0O B;  2MHE A;  4LF2 A;  4DDF A;  2VC0 A;  3CT9 A;  2E7X A;  3QLH B;  3KOA A;  2XMM A;  3MMC A;  1KOH A;  1ZTW A;  1IWA A;  1H7X A;  2AEF A;  3M8Q A;  1VLO A;  2FY1 A;  1EKS A;  2OP5 A;  4U7U D;  3GFZ A;  3PIO Q;  2CQB A;  3N4W A;  2O66 A;  3D66 A;  1CEZ A;  1G1X A;  5HMW A;  2YY3 A;  1RHU B;  3QT8 A;  3HD1 A;  5J1P A;  1W7W A;  2YKN B;  4N41 A;  2V6A A;  2DGQ A;  3TZZ A;  4CLP A;  2CJX B;  3VAJ A;  1Q0N A;  1XIQ A;  4J9N A;  2B9X A;  4K4U A;  2MLY A;  4DFJ A;  4RUC A;  2X1A A;  3MEK A;  2R9L A;  4DV6 F;  4W4M A;  5C5J A;  5EUH A;  1VQS A;  4OHY A;  3LOU A;  3I5C A;  4ED0 A;  2XMU A;  1PGZ A;  4FXD A;  3K5P A;  1Y3K A;  3R3T A;  4RUA A;  4IOC Q;  1FNO A;  1KQK A;  3BPD A;  4X4P A;  1AYE A;  2GJI A;  3ETM A;  1PYT A;  2J8S A;  1IBM J;  4CM2 A;  1EJ7 L;  2KI2 A;  3QRQ A;  3DNC A;  4V19 X;  4O3O A;  1TKX B;  2HRT A;  2KXH A;  4CLF A;  4B9S A;  3JS9 A;  2XSF A;  1NHK L;  1MLA A;  4WF9 Q;  2NCK L;  3E51 A;  3PXG a;  1G4C A;  4TYB A;  3MD3 A;  2FJD B;  3LA0 A;  5HMZ A;  3CJ4 A;  2CJQ A;  3KJQ B;  3LAN A;  2Z8Q A;  4PRF A;  2W2O P;  2OPR A;  4QWD A;  3NKY A;  4LF6 F;  2W9C B;  4YHH F;  1YSJ A;  1JXV A;  3GFH A;  4MKY A;  3D3B J;  2DY9 A;  2WOM B;  1P27 B;  4L6V 3;  1F3F A;  2HNY B;  5KTQ A;  4CT9 A;  4J9S A;  3DRP B;  1LW2 B;  3HHL D;  1V6H A;  2AJ0 A;  3T1Y F;  4QU6 A;  3PX0 A;  3V4I B;  5LMN F;  5L38 A;  4HL9 A;  1JJ2 R;  4OJH A;  3ZZO A;  1LNQ A;  3UD5 A;  1TU0 B;  3U1L A;  1UL3 A;  2B8P A;  3M32 B;  1REV B;  4OV6 A;  1ZZN A;  1RKI A;  3PTW A;  4IOB A;  1U45 A;  4TXS A;  2MKY A;  4CH7 A;  2QL9 B;  1TKZ B;  2GS8 A;  2FLL A;  4LRB A;  2Q6C A;  1R27 B;  4RNO A;  3QJL A;  3SQG B;  1P9Q C;  1SV5 B;  5EWF A;  2NLW A;  3LGM A;  1FKO B;  5DO2 A;  4V19 J;  5DLG A;  4UF4 A;  2JDJ A;  5L1I A;  3UR0 A;  2BE2 B;  1S4E A;  2C28 A;  5A8R A;  2KG0 A;  3OD2 A;  1IJE B;  3MTK A;  4DLG A;  3HMJ G;  4C8L A;  4YN3 B;  4TQS A;  4IO9 Q;  3TA1 A;  4JI5 J;  3FCW A;  3HFK A;  2KN4 A;  3FGV A;  2ZH9 A;  2E5L F;  4XPE A;  4I7F B;  2V94 A;  3VVU A;  1PG5 B;  4EBC A;  3SZ2 A;  2QIF A;  2Y1J A;  3TO8 A;  1T3N A;  4NLO A;  3CC7 S;  4JV2 A;  4P73 A;  3GIL A;  3VGT A;  1KLM A;  3UN3 A;  3PW5 A;  4X64 J;  4RNN A;  4EU0 A;  3RJM B;  4R8U A;  3HX9 A;  3FMW A;  3HKW A;  3HI9 A;  3L3C A;  4UUW A;  1RTJ A;  3KLF A;  1BWE A;  2W2N P;  4JYA J;  3HFZ B;  2PI4 A;  2VKR A;  3RYL A;  3IG1 B;  1FRK A;  1XER A;  1KKH A;  2AHO B;  3BDP A;  2P5V A;  4DPY A;  5GME A;  2EC2 A;  5IV4 A;  3JAM U;  4Y3C A;  5D4L A;  4UST A;  2DR8 A;  1X31 C;  4MK9 A;  5I42 A;  3GYN A;  1FDB A;  2Y0B B;  4K50 A;  4H4K C;  4MJK A;  2R2T A;  3RBE A;  1N4L A;  4Y6I A;  4DF4 A;  1U2R A;  5A6W A;  2QA4 G;  1X4F A;  1D1U A;  3D7S B;  3KK3 B;  1NM2 A;  1FES A;  1RE1 B;  1N5V A;  1KEK A;  3W5X A;  9ATC B;  1N34 F;  3CC4 S;  1Q82 T;  1F5C A;  1PC5 A;  3IP0 A;  4A8Y A;  3K17 A;  5GAE U;  2CWK A;  1OWX A;  2CJ9 A;  3AXM A;  3OLB A;  4OFZ A;  4K5R A;  1Y5I B;  4ILL A;  4P10 A;  1W2B R;  1EP4 A;  3CCU S;  4O0N A;  4U9R A;  4NAS A;  2ZNZ A;  2W9B B;  1EIY B;  5MAO A;  4WTY A;  4PQA A;  5JXS A;  2BKO A;  2PE8 A;  4WFZ A;  1XNQ J;  4B3R J;  2WHO A;  2H48 B;  1M5S A;  1GX6 A;  3Q86 A;  5H1S V;  2KO1 A;  1ZAW A;  2YWF A;  4LSZ B;  1Q53 A;  4K8R A;  3MUR P;  2CNL B;  1N5Y A;  4QPX A;  1SJ3 P;  1FHT A;  2DHX A;  2CUY A;  4TYA A;  5DQI A;  1MSW D;  1JNZ B;  1K1Q A;  2ILY A;  1T05 A;  3H7H B;  2H4Y B;  4NI2 A;  3QQC D;  2MZS A;  1BY9 A;  1JJ4 A;  2BM1 A;  4DL6 A;  2LMI A;  4KRW A;  3D67 A;  4NYZ A;  3C2P A;  4F7V A;  5DG8 A;  3M6V A;  2GVD A;  1K0T A;  3PEJ A;  1VIS A;  1R6Y A;  2QLB B;  4YOE A;  4GKK J;  2M88 A;  3JSM B;  4TY8 B;  3IBC B;  1WEL A;  5CYM B;  3PNI A;  1OPI A;  8RUC A;  3I56 S;  4PPZ A;  3SEO A;  4KT0 C;  1FD8 A;  3OHA A;  2EFQ A;  3H42 A;  3C16 A;  2AJQ A;  2UP1 A;  2M8H A;  2VG5 B;  2CA9 A;  5LSO A;  2M9K A;  3PFO A;  1NZA A;  2D3O 1;  1NK9 A;  2R7Q A;  2EK1 A;  3NLC A;  3MOJ B;  4JB8 B;  4DR1 F;  3SFG A;  1IKV B;  1H38 A;  3PJ9 A;  1HMV A;  2D9P A;  4OX7 A;  3K89 A;  3LP0 B;  3ZZZ A;  2MEW A;  2H5E A;  1JMT A;  1C2P A;  3ZTR A;  2GVZ A;  1UFK A;  4ZPD A;  5M2U A;  3MMA A;  1H72 C;  4P9S A;  4NMX A;  1KDN A;  3DI6 A;  1HBN B;  4ILR A;  2VDH A;  1ITP A;  2W7A A;  2OPP B;  3R8Y A;  4HLB A;  3R7S B;  4TN2 A;  3BO2 A;  5CCL A;  1NSA A;  2CWX A;  3M8W A;  3BH7 B;  4YR3 A;  3OJS A;  3HHL A;  2V63 A;  1XR7 A;  5KFC A;  2GMH A;  4DFP A;  2JEG A;  2MKJ A;  3UFC X;  2CNK B;  2I0X A;  3X3U A;  2CJA A;  1VK8 A;  2F65 A;  4KGV B;  1RAD B;  4PYD A;  1UVL A;  3HSJ A;  1IBL F;  3D9B A;  1RWP B;  2AYB A;  2E1M C;  4KIA A;  1P1L A;  4E98 A;  4CQ1 A;  5HQL A;  2E29 A;  2YNH B;  4C8N A;  4RW7 B;  2VH7 A;  2ZHB A;  3OR2 A;  5F9N A;  2I1R A;  3PW4 A;  2DNL A;  4O44 A;  1U7L A;  5KT6 A;  5D77 A;  3ITH B;  1LW0 A;  4HAC A;  1U2F A;  1QVF R;  1GT8 A;  2ZH1 A;  3R5B A;  1ARO P;  1SBR A;  4WE1 B;  1WEY A;  2NZ4 A;  2UVV A;  5EN1 A;  3VAL A;  4OL8 A;  1RTI A;  2M2B A;  3KUG A;  2R8K A;  5ETV A;  4QR2 A;  2HKE A;  3LP1 A;  1X5T A;  2NS1 B;  2CJK A;  3UD4 P;  1VRT A;  1GX5 A;  1LWC A;  2K1R A;  2CXE A;  4KR0 B;  3KK2 A;  1ZAX A;  1UCN A;  2BV3 A;  1XK8 A;  3G6V A;  2V2V A;  4NLT A;  4F36 A;  5HRO B;  3DRR B;  3QWP A;  4A48 A;  3CNQ P;  1JLQ B;  3QIP B;  3J81 j;  4DN9 A;  3SCK E;  3CIZ A;  2XCA A;  2B8Q A;  1CLF A;  4ECX A;  3OR1 A;  1N56 A;  4A8K A;  4QYZ J;  2R7S A;  2LA4 A;  1RWK B;  1VIX A;  2BE7 D;  2W7O A;  3K58 A;  3TOQ A;  4LRA A;  2JL9 A;  3PYF A;  4DCJ B;  5ETL A;  5KT5 A;  2ZHA A;  3I32 A;  4B3O B;  1QAX A;  4O3Q A;  4C97 A;  2JLE A;  4A4J A;  3I55 S;  4QWC A;  1RI7 A;  1R6V A;  1PAU B;  3KJV A;  3PW0 A;  3KHG A;  5LJ3 Y;  2FB0 A;  4HTJ A;  4DG1 B;  2QV6 A;  1SH2 A;  2BUN A;  2HND B;  1CQM A;  1ZM2 A;  3CDB A;  3ILI A;  4N5S A;  1SXL A;  2DR9 A;  1NK8 A;  1KVI A;  3UNG C;  5KT2 A;  2B56 A;  1YJW S;  2RRN A;  4NLW A;  5ETK A;  5L39 A;  1RT5 B;  4LT6 A;  3CJK B;  5D0G A;  3CD5 A;  4LRF A;  4B9M A;  4DR6 J;  3KLG A;  1BUX A;  1M90 T;  3IM8 A;  3Q24 A;  1ZS6 A;  5THW A;  4I67 A;  2YNF B;  1HPZ A;  2NPI A;  4J9V A;  3IR7 B;  2E1R A;  4LF9 J;  3M1V A;  5A8R B;  2M3D A;  2R7R A;  1RA6 A;  2MKK A;  1JLE A;  1NHV A;  1U8S A;  3I5B A;  2ROE A;  3AQP A;  3NG8 A;  3M7V A;  3GV5 B;  3FQL A;  3DOL A;  3VAI A;  5SZT A;  4OZN A;  2VIC A;  1HQU A;  4M1K A;  3IRX B;  3WIU A;  1U1R A;  3EPI A;  3ISN C;  3RAX A;  2HQ3 A;  2I5J A;  3I31 A;  3O5T B;  2JRS A;  2HVZ A;  1D9A A;  5CAB A;  3MAA B;  4ATN A;  3KLH A;  3M2U A;  3PW7 A;  4RO0 A;  1KHW A;  5IM0 B;  3DRX A;  2HMI B;  4P75 A;  5KFA A;  4NXM J;  4FBT A;  4CCH A;  4ZVQ B;  1SQF A;  2ZH2 A;  3UVJ B;  5CZV A;  2K2P A;  2ZH4 A;  5IOL A;  4CO5 A;  3HLU A;  1YIT S;  4KGK A;  3HPO A;  1NSP A;  3P4U B;  5ITH A;  2N4C A;  4ALZ A;  4IH7 A;  5KFY A;  1UW9 A;  3KDN A;  1CQN A;  1DTT A;  2XS7 A;  4PWD A;  4C3M A;  1VQ5 S;  2OPQ B;  1W2I A;  4DMZ A;  1SJ1 A;  3TUP A;  3IBF B;  4URS A;  5IQ6 A;  5KFL A;  3E01 A;  3R6G B;  2XS2 A;  5FLX U;  3L7U A;  1GK8 A;  4ETX A;  3NS5 A;  3UD3 P;  4K2X A;  3MHY A;  3A13 A;  2C1E B;  1RCO B;  1WAC A;  2ADB A;  3H2L A;  2RF2 A;  4USW A;  2GHP A;  1S9G A;  2FLN A;  4WKR A;  3KXD A;  2VIH A;  1UZH A;  4ELU A;  4TLQ A;  2RH3 A;  1SC1 B;  2UUA F;  1F5A A;  1KFD A;  3TEG A;  1FKP B;  2JH3 A;  1SKW A;  4X4S A;  2GGP A;  4PYA A;  2B4U A;  4UQT A;  4X62 J;  5B0A A;  1HHS A;  3CCL S;  5KFJ A;  1HWJ A;  4CO4 A;  2EG2 A;  1RBL A;  4QCL A;  1N5Y B;  2R8G A;  2ASJ A;  4IRC A;  1VRQ C;  4RKU C;  5RUB A;  1QE1 A;  2Y8W A;  1FA0 A;  3QRP A;  1NB7 A;  1NRK A;  1GAO A;  3BKF A;  3WIV A;  1V3S A;  2PN6 A;  4L76 A;  5J2N B;  3R5A A;  2BVZ A;  3MZI A;  4UY8 T;  4DPX A;  4CI0 B;  1QUP A;  4CLZ A;  3LGH A;  3LUY A;  2F63 A;  2RUS A;  1TL3 A;  4GVB A;  5HK4 A;  4H4K A;  1WTB A;  3MFH A;  2IJF A;  1NKB A;  4U6P A;  2CQG A;  1XNR J;  4O4G A;  5DZ6 A;  2CQP A;  2UUC F;  2G9O A;  3NOC A;  4ZLL A;  3N5F A;  3LPY A;  1RUS A;  2WAQ D;  2ZD1 A;  3ENQ A;  5I3Q A;  4C3K A;  1NBE B;  2K7K A;  4RW9 B;  4GVL A;  1PSD A;  3CD0 A;  5LM7 E;  2V67 A;  1QTM A;  5KFZ A;  2RRB A;  2AYE A;  2BAN A;  1JB0 C;  1HW9 A;  5DRK A;  4HYK A;  3R5C A;  2VZ9 A;  1HBO B;  4ZVG A;  4C4W A;  1ZM4 A;  4RBU A;  3SV4 A;  3NRB A;  1N36 J;  3VWS A;  1EB0 A;  2MJU A;  3ZNJ 1;  1W25 A;  2V50 A;  4IG0 A;  2YQ0 A;  3DCA A;  5A6P A;  4IG3 B;  1HFE L;  2N7C A;  3RRG A;  4KGZ B;  4YR0 A;  1HWI A;  4L72 B;  2W1B A;  1SH3 A;  4O3P A;  3ISN D;  5LOQ A;  1S9F A;  2VC1 A;  3CJS A;  4EFA C;  4CO2 A;  1AFI A;  1BC6 A;  2GHW A;  2N3O A;  3QFH A;  1RDR A;  2VA2 A;  2J9C A;  1YVF A;  2QE5 A;  2RU3 A;  4FPR A;  5BR8 J;  2YKO A;  1FI4 A;  1MRO A;  2SXL A;  1ROF A;  1S6Q B;  2ROG A;  3DOK A;  1LWE B;  2XG8 A;  3J7Y U;  2AP6 A;  4LBI A;  1YHQ S;  1U0H A;  1OYD A;  1UJ4 A;  1X9S A;  1T9X A;  2NXN A;  4NXN F;  5HP1 B;  1XMO J;  2UUB F;  3ENA A;  1A9N B;  1PIL A;  2VOD A;  1RTH B;  5HSP A;  1MN7 A;  2IRY A;  3MR3 A;  1L3V A;  4N7T A;  2XSJ A;  3PRV A;  2VPZ B;  3J81 Y;  1TV6 A;  2V8G A;  1LK5 A;  2DB1 A;  2WBR A;  3PAC A;  1IR0 A;  3BGR B;  4HAC B;  2VPW B;  3EDR B;  1ZZF A;  3TVK A;  2MZJ A;  2OHD A;  2I38 A;  2MQ8 A;  2MLZ A;  1X9M A;  4JI3 J;  4ED7 A;  2G0C A;  1RCX B;  3DDN A;  1FF2 A;  1S1W B;  5HLF A;  1RTI B;  4A46 A;  4K0K J;  3QBC A;  1C0T A;  2AKW B;  2L48 A;  3G4S S;  3N9U C;  3BM7 A;  3H5S A;  2AJF E;  1BGX T;  2HHW A;  1DQ8 A;  3MMB B;  2XO6 A;  1UPM B;  5EWE A;  4QJV A;  3BN7 A;  2E5I A;  1JXE A;  3D1Q A;  2DNK A;  2F4F A;  1RWW B;  2M5Y A;  2K1R B;  4LF5 F;  4Y0F A;  3IR5 B;  3OJU A;  4DWI A;  3EVW A;  4FS1 A;  2DH9 A;  3IC1 A;  1S59 A;  4AQY J;  1VBY A;  1PBU A;  3QPI A;  3NAI A;  3FJ2 A;  2J6S A;  1MU2 A;  5D4O A;  2DNG A;  2Q3P A;  4P2F A;  3M9N B;  2Z57 B;  2D7S A;  3BBF A;  4I6W A;  3W9I A;  2EFV A;  2G0I A;  3HVW A;  2C3Y A;  2W9A A;  5HJX A;  2DRD A;  3MED B;  3CJ2 A;  2VQF F;  3H20 A;  4ZVO B;  1PC4 A;  2RML A;  1ULR A;  4WU3 A;  3RW6 A;  2JJ4 D;  1FJ7 A;  3W2W A;  1NK6 A;  1HL6 A;  4QIW D;  4JI1 J;  1P1T A;  5GMK a;  3C6U A;  4ETZ A;  1C1B A;  3PRD A;  3V5R A;  4DS5 A;  3CJ0 A;  1KNZ A;  4J9L A;  2OPS A;  2XI2 A;  4M5D B;  1R8B A;  2BW7 A;  2POK A;  3R1L A;  2CQH A;  3CCW A;  2BOA A;  2P6T A;  1JKH A;  4FNH A;  2ZOM A;  3OHB A;  3T1H F;  1KHV A;  2CVE A;  3RUB L;  1B99 A;  4DFM A;  5HVH A;  3WC2 A;  3G8Q A;  5A2Q Y;  1UEV A;  3C6T A;  3JQK A;  1Q4R A;  3H25 A;  2IM0 A;  3M8P B;  4OYO A;  1VDH A;  4M63 A;  4PG8 A;  4DL7 A;  1WC1 A;  2LQB A;  4EUV A;  4IO1 A;  4EEY A;  3AD9 C;  3BGO P;  4XPC A;  3V6J A;  3KDO A;  1RT3 A;  3MMJ A;  5AXK A;  2KFY A;  2MZT A;  2DYA A;  2KL8 A;  2WBM A;  2CQ0 A;  4J9R A;  3M1V B;  1RAB B;  2GIQ A;  5KFI A;  2E7V A;  3QNW B;  2C2E A;  3EM1 A;  4DL4 A;  4USJ C;  1N48 A;  4DQS A;  1U47 A;  4OYP A;  4R0J A;  1FK9 B;  1S1T A;  1HQU B;  4ECV A;  4Y2I A;  1H2U X;  4ZHR B;  3TUZ C;  2I5J B;  4RW4 B;  1WHX A;  2CQD A;  4NA2 A;  4DPT A;  1RT6 B;  1K44 A;  2GAH C;  1KVJ A;  2KT5 A;  1M1H A;  2ZC3 A;  7FDR A;  3D0G E;  3ISZ A;  5C7P A;  3KLH B;  3M2U B;  1EAY C;  3R2C J;  2KRB A;  3G82 A;  4TKT A;  2DR7 A;  1RXO B;  1VIO A;  3I87 A;  1RT2 A;  2YQ3 A;  2GJ2 A;  3W5Y A;  3ZFV A;  2FHO B;  3PX4 A;  5KFE A;  2F7V A;  1B0T A;  1UET A;  1RSC A;  2IYG A;  2IJR A;  2APO A;  2BEF A;  2RAQ A;  2VB6 A;  2HQG A;  1NJY A;  1FFW B;  4OI3 A;  2CNO B;  3FCV A;  2UU9 J;  5KT7 A;  3TZY A;  5K14 A;  4BDP A;  4DL3 A;  1IBM F;  3DYA A;  4USV A;  1SL0 A;  2XTJ P;  3RB6 A;  3R6L B;  1HNZ J;  2YNG A;  1GEH A;  4DOZ A;  2HRY A;  2HFN A;  4FYD A;  4IYQ A;  2J5A A;  3K5N A;  2J0S D;  1PIE A;  1S1X B;  2VU5 A;  3DLK B;  1IKY A;  1Q1K A;  3RR7 A;  2ZZM A;  4RBT A;  4PG7 A;  1TVR B;  4F8R A;  2Y1R I;  1HWL A;  2HIQ A;  4PG5 A;  1S6P B;  1X8D A;  4KPY A;  4XAK A;  4B17 A;  2D3O R;  3RB3 A;  2A6M A;  2CPH A;  3OTD A;  5F8L A;  2XY7 A;  1RT1 A;  5A8K B;  5L1J A;  3Q8Q B;  3E8O A;  2DHS A;  2B5J A;  1NJZ A;  2ZH6 A;  1M5P C;  1R0C B;  1AZS A;  3MEE A;  4DV3 J;  3IAM 9;  5L1K A;  2UUW A;  5C24 A;  4NLY A;  2OD6 A;  3MXH P;  5KG7 A;  3H40 A;  3M05 A;  1V9O A;  3RR8 A;  3I9V 9;  3P3D A;  2A10 A;  2AU0 A;  2JWN A;  3DFE A;  4USH A;  4EGL A;  2IMW P;  4NA1 A;  2YWH A;  2PEH A;  1DAX A;  1CJU A;  1H0H B;  2H9Z A;  4F4X A;  5J2Q B;  2IHR 1;  1RTD A;  1N6Q B;  2N4D A;  3GG1 A;  3H98 A;  3DLJ A;  4ZCI A;  3FKB A;  5F0U A;  5CH7 B;  2C2R A;  4NZ6 A;  1DZ5 A;  2B51 A;  4E0D A;  4ED6 A;  2CQC A;  3L9Z A;  3QO9 A;  4NWB A;  1YIJ S;  4NLR A;  1H6K X;  3FZ2 A;  3IR6 B;  3D5M A;  1LFP A;  2HS0 A;  3R1H A;  1VC5 A;  1NKE A;  4WJB A;  2CQ3 A;  2YKM B;  4ZN3 A;  3RB4 A;  2LQJ A;  1HR0 J;  2ZH8 A;  3VAM A;  1AUD A;  1UWA A;  3MPY A;  5BXI A;  5DGA A;  1X9W A;  4CTA A;  4J7C A;  4IOA Q;  1JIH A;  1NO8 A;  5D3G A;  4FPI A;  1S49 A;  1ICE B;  2RE1 A;  1JLA B;  1VLY A;  4JI5 F;  2QLJ B;  3PVX A;  2DKO B;  3LAL A;  4DV7 J;  1I6J A;  4WYL A;  4ED4 A;  2JEF A;  3UDC A;  5IT9 U;  3V6D A;  2Q1L A;  3U1N A;  1S0N A;  1VR6 A;  1EX8 A;  3KLI A;  5J2P B;  4OYX A;  5LT5 A;  2C3U A;  4DUY J;  4NRU A;  4D3G A;  2AX0 A;  4PCQ A;  2CFX A;  4ECS A;  2E7W A;  1T0T V;  4X64 F;  3QT7 A;  1D8Z A;  5F41 A;  3CC2 S;  4DXL A;  1EAR A;  2I2Y A;  3ILJ A;  3PJW A;  3LPE A;  5CYJ A;  1WSR A;  2R3V A;  3RAM A;  1Q79 A;  3QYY A;  2WVE A;  2DT9 A;  4FF2 A;  3H4D A;  3OLA A;  3DOK B;  4A8S A;  2DHA A;  1E6Y B;  4CNY A;  1NDK A;  2DIT A;  2OML A;  1Z4U A;  4DSF A;  5E3R A;  3H5Y A;  2Y8Y A;  2J0X A;  5IV3 A;  4DBQ A;  3GIR A;  3EXC X;  1QLN A;  3FFI B;  3F56 A;  2P2C B;  1HI1 A;  3M6X A;  5FII A;  5E7O B;  3O1L A;  3QT5 A;  4FYY B;  2C3O A;  4LFC J;  5IFM A;  3B8H A;  3HO1 A;  1UWB A;  2E44 A;  3NNA A;  1XN9 A;  2YX7 A;  1LQ9 A;  1H74 A;  3EMT A;  2XLJ A;  1BE4 A;  4OI4 A;  2CPI A;  4HHH A;  4KV8 A;  4KO0 B;  4OZ0 A;  2LA6 A;  4UUX A;  4LSL B;  2MZQ A;  4PUO A;  3QRR A;  2KM8 B;  2HVH A;  3Q8Y A;  2MLX A;  3DHX A;  3U7J A;  4KC5 A;  4HHJ A;  2RDD A;  4IFV A;  3M8Y A;  4LR8 A;  1QJH A;  1U02 A;  4LVN P;  1XNQ F;  2Z4P A;  4B3R F;  2HGN A;  3ZTO A;  1GXU A;  3JTO A;  1JLF B;  1OO0 B;  2FIU A;  4U8V A;  5KFF A;  1OPZ A;  2M4M A;  5EWG A;  1SJQ A;  1CUL B;  4JI8 J;  3WBZ A;  3K5L A;  1YJR A;  3DLG B;  5DM6 Q;  4FP9 A;  4X4N A;  5K20 B;  1DTQ A;  3N0V A;  2G2O A;  1OY8 A;  2HAF A;  2WK4 A;  3J80 U;  3ELH A;  2WSF C;  2ZHO A;  1OSC A;  3US5 A;  4TU8 A;  4I0W A;  4RJV A;  3I96 A;  2NSC A;  4F4W A;  5ETQ A;  4GKK F;  4IH6 A;  3B4M A;  1XR5 A;  2VBX A;  4XK8 C;  5GAE I;  4O0I A;  4V1A k;  1CVJ A;  4ICL A;  2HLU A;  1SKS A;  1UPP A;  1Q8I A;  2DEJ A;  5G0R B;  1C4C A;  4C8M A;  3FMB A;  1Z1Z A;  4ZVH A;  5LXY A;  4FN5 A;  4YY3 J;  4MKV A;  2AX1 A;  1CJV A;  4ZLP A;  4WKY A;  1VQ6 S;  1RAI B;  3BQ0 A;  4WZQ A;  3PZP A;  1MG7 A;  1NK5 A;  4C8Z A;  2DBB A;  2HG4 A;  4P7V A;  1TMJ A;  4U7C A;  1T9V A;  5K8O A;  3KG4 A;  3HM9 A;  1U25 A;  3VZI A;  3J7A 1;  5LJ5 Y;  2QC3 A;  1VQP S;  4DU8 A;  3QLH A;  1M5O C;  4LBH A;  4KHR A;  2CPF A;  2IM2 A;  3O44 A;  2KT3 A;  3CTR A;  3FUY A;  4LRD A;  2B7B B;  4HKQ A;  5IWA F;  1CJK B;  1WJ9 A;  4ER8 A;  2LXI A;  4QR1 A;  1W26 A;  3D1H A;  1HKA A;  4OZ5 A;  2HEK A;  3DXS X;  2Y1L B;  4NCA A;  1TUG B;  2HQD A;  3BH6 B;  1FX4 A;  3DRY A;  1R43 A;  3A1Y G;  1KQG B;  5KFR A;  2DJW A;  3QT6 A;  3EGW B;  5DZ7 A;  1KS2 A;  3CMQ A;  1AFJ A;  2DNY A;  3NMR A;  1UVI A;  3T6J A;  4QZV B;  1N52 B;  2YKN A;  2AGP A;  1NKC A;  4NLX A;  1FWL A;  4F3M A;  3JYT B;  3T5K A;  2FJE B;  4YP3 A;  1HI8 A;  4A8M P;  1TAQ A;  1ZPW X;  2CPD A;  3PRB A;  3LAM A;  5HQ8 A;  4TNO A;  5H9F J;  2QX0 A;  2QSW A;  2YWW A;  1OJ4 A;  3UR3 C;  1A6L A;  1EET B;  1RTZ A;  4DR2 J;  3P8B B;  1SIZ A;  4OI1 A;  3BDE A;  3IS9 B;  4GO7 X;  3W66 A;  4AL5 A;  2ZWO A;  1FWK A;  2RS2 A;  2BYC A;  4FXV A;  4ZIV A;  2UV8 A;  3PYG A;  1N8R T;  4C7Q A;  3TAN A;  3TQ1 A;  3D54 A;  1FRH A;  4DV5 F;  4YB7 A;  1OY9 A;  4OMF G;  1VQL S;  5B0G A;  1OQ6 A;  2FGO A;  1TKX A;  1R8A A;  2BBE A;  1CJT B;  5K8N A;  4X2B A;  1F9H A;  4J5O A;  1TP7 A;  2OLW A;  1NME B;  4MKB A;  3PR5 B;  3VCD A;  3PKY A;  1RWN B;  3C15 B;  1WTF A;  1SIW B;  5HBM B;  2XEX A;  5EGY A;  1XMB A;  2I8E A;  4FNI A;  1LXN A;  3EX7 B;  4UOH A;  1TMM A;  5G4D A;  4YB6 A;  2UUT A;  3C66 A;  3KK1 B;  2CQI A;  2W9C A;  3TVZ A;  1ZYQ A;  2BX6 A;  2XMW A;  5KFG A;  2WOM A;  1YGY A;  4PG6 A;  2DGX A;  4KJI A;  2HNY A;  1L3T A;  3DRP A;  3SQO P;  1LW2 A;  2MQM A;  4RW8 B;  1HYS B;  5A0Y A;  3D28 A;  1AZS B;  4DUZ J;  1BQX A;  1MML A;  3MEE B;  4DU7 A;  5AE2 A;  3DN9 A;  1J2V A;  2XLK A;  3JTN A;  3V4I A;  2ZH5 A;  4IR1 A;  1SQG A;  3RU0 A;  1VBK A;  1DY3 A;  1U8W A;  3M32 A;  4O3R A;  1N32 F;  3D6M B;  2DXD A;  1REV A;  1CJU B;  3KUE A;  5DQG A;  1TKZ A;  5KFN A;  3CJ3 A;  1GQE A;  2XYP B;  4PPD A;  2ZH3 A;  4IR9 A;  2VFV A;  2KG1 A;  3SQG A;  2B6A B;  1SV5 A;  4GKJ J;  1YJ7 A;  3B82 A;  4I69 A;  1FKO A;  4DR6 F;  3W8G A;  1I94 J;  4CH1 A;  2NXE A;  3OSP A;  2DGO A;  4PXC A;  3NWG A;  3BO3 A;  1RT7 B;  4Y28 C;  4LF9 F;  2OEL A;  3V4M A;  4KKO B;  4QIV A;  3X1L B;  3A8K A;  2RDJ A;  4X66 F;  5ETR A;  2Y1I A;  2YWK A;  3MEC B;  1QUV A;  4QWE A;  1RKJ A;  1FDN A;  3E2E A;  4B9N A;  4ZPV R;  4URQ U;  4OHW A;  2JNJ A;  3CDU A;  2B9E A;  2DGS A;  2NUH A;  3EZO A;  1UZD A;  1CSJ A;  1QSY A;  1UEU A;  5GAD U;  4X4U A;  2ZBC A;  2FLP A;  3EVM A;  4XDD A;  2HFO A;  1Y00 A;  4FF4 A;  5E0O A;  2VBW A;  1FNM A;  4N76 A;  4P52 A;  4YHH J;  4DUT A;  4WK1 A;  1REG X;  3KJN B;  2OH2 A;  5F0W A;  5DLF A;  1YTY A;  3R97 A;  2JFK A;  5F8I A;  4DV2 F;  4I56 A;  4QIE A;  3D68 A;  3AFG A;  2CIM A;  4NXM F;  4ZIT A;  1XTZ A;  4ED1 A;  4AL7 A;  3T1Y J;  3MF5 A;  3P6Y C;  2AV5 A;  1H3D A;  1DBD A;  4F4Y A;  4C48 A;  3Q2S C;  3C19 A;  2NYH A;  3AAW B;  3QSI A;  2R7W A;  1NLK L;  1S1V B;  1RGV A;  4QYZ K;  4UY8 5;  4JV0 A;  1HNI B;  1F9F A;  1JLG B;  2FZC B;  2NR0 A;  1HD1 A;  1NK0 A;  1WF0 A;  4A47 A;  4JOU A;  3GP9 A;  3U02 A;  4LIW A;  1X4C A;  3KK3 A;  3TI0 A;  5DS7 A;  4DR7 J;  5EHH A;  2BJ3 A;  3TWZ A;  1HNV B;  1HNW J;  4ED8 A;  3P5T L;  3TAM B;  2V4R A;  3IRW P;  2ZE2 B;  3GTY X;  3BSA A;  3MPW A;  4J9M A;  4WII A;  3CUL A;  2V4J B;  2EVZ A;  4DSL A;  2AW0 A;  2QFI A;  4P2X A;  1FDA A;  1MNE A;  1X4D A;  2W9B A;  1FRX A;  2D9O A;  3RGI A;  2GFF A;  3FBC A;  2JFD A;  2VON A;  1S97 A;  3PJX A;  1YX2 A;  4MKA A;  4UTG A;  3BN4 A;  4MYT A;  2GQC A;  4EZ9 A;  3CO9 A;  5KOW A;  4ERD A;  2XLI A;  1FTR A;  1VQ8 S;  3IM9 A;  3KLV A;  2XBP A;  9RUB A;  3S7R A;  2HLT A;  2XY5 A;  1FJG J;  1F3V A;  3VTI A;  2IVF B;  4C6A A;  4P2S A;  1Z2Z A;  2CPZ A;  5ETS A;  4PZV A;  2GC8 A;  3JSM A;  4TY8 A;  3BGF A;  4LRC A;  4IH5 A;  1TL1 B;  4USU A;  3JSB A;  4LFB F;  3EUN A;  4IKA A;  1XNR F;  5E3C A;  2RQC A;  2JEJ A;  3HSD A;  2OTJ S;  4UOF A;  2QMX A;  4QU7 A;  3OT9 A;  2W4C A;  2RHQ B;  3Q0A A;  1RWM B;  2VG5 A;  2LEP A;  4QWA A;  2BRK A;  2VBZ A;  3IFE A;  4I1T A;  2IRU A;  4YME A;  4J9O A;  4ZPW R;  4H4O B;  1HHT P;  2R8I A;  3V6K A;  3MOZ A;  3NGU A;  1RP5 A;  1FRJ A;  1JLB B;  1IKV A;  1YJU A;  5D6G A;  1RLD A;  3G6X A;  1IBC B;  3LP0 A;  1N36 F;  2HK3 A;  1VJQ A;  4MIW A;  2DRB A;  2XMT A;  4JI4 F;  1WHV A;  1RHJ B;  1D9D A;  4RUH A;  1VYA A;  1HBN A;  5BYR A;  1HQ2 A;  3GMG A;  4O4R A;  2D3Z A;  2OPP A;  3VHQ A;  4F25 A;  3THP A;  4LR9 A;  2V8H A;  3FK4 A;  3PFE A;  4TU7 A;  1FTC A;  3GV8 B;  4DR4 J;  1ZH5 A;  1I3O B;  2FTR A;  3NBP A;  3MR2 A;  3UWT A;  3VAK A;  1VQN S;  1WOO A;  1T03 B;  3KHH A;  3AD7 C;  3PHT A;  5BR8 F;  2HFU A;  4B08 A;  4WP8 A;  2MY8 A;  1Y0H A;  3JSY A;  2EFG A;  4F3Q A;  1WF1 A;  1RIS A; 
#chains in the Genus database with same CATH homology
 3R5J B;  2C2M B;  2HBZ B;  1RHR B;  3P45 B;  2CNK B;  1RHQ B;  4ZVR B;  1QTN B;  3RJM B;  2HBQ B;  1RHU B;  2CNN B;  2H65 B;  1GFW B;  2QL9 B;  1PYO B;  2CJY B;  2C2Z B;  4ZVQ B;  2XYH B;  3D6H B;  2CDR B;  5IC4 B;  3KJQ B;  1RHK B;  1RWP B;  1SC3 B;  1SC1 B;  3GJT B;  2XZT B;  1IBC B;  2XZD B;  2CJX B;  2C2O B;  3GJS B;  2QLF B;  2H48 B;  4ZVS B;  2H5J B;  3SIP B;  1RHJ B;  4JB8 B;  1F9E B;  3R7N B;  3GJR B;  1ICE B;  2H51 B;  2HBY B;  2P2C B;  4LSZ B;  2QLJ B;  5K20 B;  2DKO B;  1RWK B;  2CNL B;  4ZVO B;  3P4U B;  3KJF B;  3EDR B;  2XYG B;  3QNW B;  2HBR B;  3R7B B;  4DCO B;  2CNO B;  5IC6 B;  2H5I B;  4DCJ B;  1RWV B;  1I3O B;  2Y0B B;  3D6M B;  2Y1L B;  3D6F B;  2H4Y B;  4ZVU B;  3IBF B;  2FQQ B;  2C2K B;  3NS7 B;  3R6G B;  3GJQ B;  1RHM B;  1PAU B;  1BMQ B;  1NME B;  3R6L B;  3EDQ B;  3R7S B;  1RWN B;  3KJN B;  2H4W B;  2H54 B;  1RE1 B;  4DCP B;  1I51 B;  2C1E B;  2XYP B;  1RWX B;  2QLB B;  4ZVT B;  1SC4 B;  1RWO B;  1QDU B;  2QL5 B;  1RWM B;  1RWW B;  4ZVP B;  3IBC B;  2QL7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...