1I51B

Crystal structure of caspase-7 complexed with xiap
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-7 SUBUNIT P20
publication title Structural basis of caspase-7 inhibition by XIAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1i51B00
2CJXB 2HBRB 2Y1LB 3KJNB 2XZTB 2CNOB 2XYGB 3EDQB 2QLFB 2DKOB 2H54B 1RHUB 5IC6B 1RWPB 4ZVTB 2QL9B 3GJRB 1SC3B 4ZVUB 1NMEB 1BMQB 2H48B 3RJMB 3GJQB 2CDRB 3D6MB 2C2KB 3R6GB 2C2OB 1F9EB 1RWXB 2XZDB 1I51B 5IC4B 1RWMB 3R5JB 1RWKB 1PAUB 2HBYB 3SIPB 3R7SB 2Y0BB 2H51B 3R7NB 1GFWB 4JB8B 4ZVOB 2H4YB 3KJFB 2C1EB 2XYHB 2H65B 1RWVB 4DCPB 2CNNB 4DCOB 4ZVPB 1RWWB 2CNKB 3GJSB 3D6HB 1RHQB 2CJYB 4ZVRB 1I3OB 1RHMB 2CNLB 1RHRB 2QL7B 3EDRB 2FQQB 4ZVSB 1RWOB 3IBFB 3KJQB 2XYPB 4ZVQB 1QTNB 2HBZB 2H5IB 1RHJB 1PYOB 5K20B 2H4WB 4DCJB 2C2MB 3IBCB 2HBQB 2C2ZB 1SC1B 2H5JB 1QDUB 3QNWB 3R6LB 3NS7B 3GJTB 1ICEB 1RWNB 1RE1B 2QL5B 3D6FB 4LSZB 1IBCB 3P4UB 1RHKB 2QLJB 1SC4B 3R7BB 3P45B 2P2CB 2QLBB
chains in the Genus database with same CATH superfamily
5K14A 4AYBD 1AT1B 4W4MA 4USVA 1U0HB 4IFYB 2IMWP 2YPZA 2G0IA 3LAKA 4HEA9 2WTFA 2J0WA 4U67Q 2J9DA 3QGIA 2PFDA 3AHPA 1VRUB 2DH8A 2B4PA 3PEHA 1VDHA 2G2YA 2A2DA 5K14B 2C2OB 1Q82T 3GSIA 1Z2ZA 3JSMA 5ETQA 4ELVA 3FZ2A 3W60A 2HHWA 2QZ8A 1UZDA 1U09A 1KC8T 5J2NA 5LT5A 3GCXP 2DK2A 4PG8A 5HJXA 3JSMB 1KVJA 1P6TA 3BYRA 1WORA 2DGSA 5IFMA 2PA8D 1MG7A 3OPKA 1RTIB 5EWEA 2N7CA 5SUHA 4ANCA 2J6TA 2P9CA 1D9DA 1VBYA 2HMIA 4ZIVA 3ONQA 1RZMA 5ADZA 2ZC4A 3BQ1A 3KHRA 4EK2A 4P10A 4CLTA 1PJ6A 4LR8A 1FNOA 3NGDA 1UAWA 1S12A 2HMIB 1RJJA 2YWEA 3GFZA 3M9OB 3EGZA 3S6EA 3OTEA 1OQ6A 4TY9A 3G2XA 2PEBA 3D7SB 4DMZA 4YB5A 4CI0B 1XC9A 4KBIA 3ZZ0A 2X1FA 3PIPQ 3WC2A 1ZAVA 4F3MA 5KG1A 2B0GA 4DR6J 4OV1A 4JBCA 4X4RA 5B0BA 3J81j 7FD1A 2L9NA 3H42A 4GC7A 2ZH5A 1VISA 3I32A 4NPOA 1M0SA 2YBVA 3HHEA 4DLGA 1BHNA 1YHQS 2NXCA 2DNPA 1FJGF 4L76A 5DGBA 2B7CB 4LRFA 2FB0A 2P8IA 2MGZA 2R8IA 4M5GA 1VBKA 4Y2IA 3H4DA 2YVSA 3DDKA 5E5NA 2BA9A 1C1CA 3DRRA 3HKWA 1FFSB 1WG4A 1JLQB 3LWMA 4J9MA 1LW0A 1PCAA 2OSQA 2UXCJ 4EZ6A 2GAHC 3QFWA 4RLEA 2AJFE 2DXFA 2OTLS 4AD6A 5HVFA 1UWAA 1S49A 3DRRB 3W5XA 5E3QA 3SIPB 3UDEA 1LW0B 4O23A 3M8PB 3CJ5A 4DSLA 2Z56B 4NZ7A 1U2RA 5AXMA 2ZM6F 2QX0A 3KNGA 3N5FA 3WBZA 1NKBA 3PFEA 2CXEA 3GQCA 1UJ4A 1N36F 1Q8IA 1RHJB 4HI2A 1VJQA 1CQMA 1C1BA 4NYOA 4DV6J 1AROP 2W9BB 3NNHA 3NCPA 2PE8A 1F5CA 1RYRA 2VQFJ 1S6QB 1MWYA 2IAJB 3D54A 4K2JA 2DHAA 1C1BB 2CRLA 1IM4A 5A8KB 2QLXA 1S1VA 2KH9A 1RISA 2OEKA 4BWMA 1KVKA 2OPQA 2DHSA 1T95A 4WFZA 6FDRA 2K1RB 4PAAA 1S1VB 2DHGA 2QEXS 4TLQA 2E9ZA 4U7CA 4H54A 2JDJA 1I94J 1WEXA 1Q1KA 4AT1B 4PRFA 3H20A 2K06A 3HPOA 4LSLA 4HL9A 1W2BR 1UFWA 2VQEJ 4I2PB 5KT4A 3HVTA 1K0VA 3PW0A 3CE8A 4RX6A 2I1RA 4DQQA 5FD1A 4OJ1A 4ECXA 4TU7A 5CAAA 3Q23A 2B4UA 2IJFA 5E3RA 2QLJB 1IBKJ 4F0HA 2CG8A 4LSLB 5HK4A 4F4ZA 3TJ8A 1VK8A 2DNMA 5EX3A 1Z4UA 5I4MA 3D66A 5ETPA 2EKNA 3V4MA 2BJEA 2J9DE 4ED1A 5HVGA 5BJRA 2EEYA 1RKIA 2JLEA 4DPYA 5C2CA 2BZ2A 2J6SA 4CT8A 1YRUA 2AWZA 2DBBA 5HAOA 2KT3A 1K8AT 5KFQA 4JI1F 1R0BG 1ZM9A 2N3LA 1JXEA 3AB4B 1YTYA 5A8RA 2BABA 3VGUA 2DT9A 2IRUA 1C4CA 3O2IA 1PGZA 2UXDJ 4M5DA 1W2IA 4OYMA 5JMNA 2PDAA 1U1RA 3KJQB 2EWHA 3H25A 4CDIA 2FJAB 2ZBIA 4H4MA 2XY5A 3JYTA 1YRTA 2W4PA 2CQ1A 2KZZA 4WCEQ 3C46A 4RPFA 4E98A 3MTJA 4PABA 4M5DB 3P4UB 1NLKL 2OJ3A 1ZOTA 3JTPA 4CTAA 3KHGA 4RWWA 3ZZYA 2FC9A 3JYTB 2LCWA 3Q0AA 1NKCA 3OFGA 4B3RF 1V3RA 2GZOA 3MCMA 3CT9A 2F65A 3H2VE 3TRGA 1SJFA 1S10A 3NLCA 4UUXA 4RU2A 4CTAB 4IR1A 3M2RB 2XLKA 3K5LA 3R1LA 1IN0A 2AQ4A 2L3MA 4KGMA 4GKKJ 2XMWA 4P75A 3G6VA 3FEYB 1SJ4P 3CDUA 2COLA 2Q3PA 4DR2F 1C4AA 2GS8A 2CJYB 4KRWA 4S0MA 2IYGA 1LQ9A 2XSJA 2M4MA 1FKPB 3A8IA 1AYEA 2UU9J 4F36A 5EWGA 3IGVA 3LH2S 3HMJG 3ET6A 4RW4A 1PAEX 4HDHA 4ECYA 2GFFA 4A8SA 4NLRA 3L95X 4X64J 2XSJB 3KMQA 1FE4A 2MKYA 2D3OR 3GMGA 2DD8S 2I8EA 4JOUA 4P9SA 3H2LA 3VGTA 2WSEC 5KOXA 4RW4B 4CRJA 3TZXA 1NJXA 4JI3J 4FXDA 4C8YA 1OO0B 3LGNA 3ZZZA 4DQPA 1Q78A 4OIXA 5KT5A 3DC2A 4ES1A 4I6YA 2NXUA 4K4UA 4RNHA 2AEFA 5MLCV 3PRVA 2KZMA 2C2KB 4PXBA 3ZZOA 2KYZA 2XZDB 4IOBA 1UJ6A 3W7BA 1SUQA 4LBPA 1R89A 4DR7F 1EB0A 5HQLA 4ZVPB 1VQ5S 3UD5A 4OZJA 2XLIA 2QL7B 4F4KA 1R31A 1LNQA 3JQMA 1HBNB 4JV1A 1UKUA 5ETNA 3QRRA 4NLSA 3SCLE 4UOGA 4JV5F 1QE1A 2ZH1A 2JVOA 4NEYA 4OHXA 1NDPA 2PMHA 2IVYA 3OT9A 2WVDA 1UVIA 2UXBF 2YWWA 2BKNA 1OYDA 3V6JA 2CJBA 5J1EA 1WTFA 3UFCX 1N5YA 1QE1B 2HNZA 2D9OA 4C0OC 2LECA 2AV5A 4WZQA 4M5IA 1TELA 4FYDA 4ZVUB 3MEEA 4Q8FA 2BMBA 1NJYA 5IM0A 1APSA 5J1EB 5HVHA 1XNRJ 3Q86A 1N5YB 1WEYA 2HNZB 1TK0A 4C8NA 4ZVFA 3U7JA 3R5DA 2O1PA 2XO7A 1KR4A 2IBOA 4LF7F 4ZJLA 1RWVB 2OO4A 3GR0A 4EBEA 1NB7A 4XAKA 5C2GA 1X9MA 3I0SA 2CQ3A 2OKQA 4LFAF 3R3TA 4OJGA 4DL5A 3J7ZT 1DQAA 1HMVB 1H7XA 4IUFA 5JVHQ 1NPKA 1TK8A 4CYUA 1H73A 1MLAA 2N4DA 3K2YA 4OYXA 2XC9A 2CJXB 3TO8A 1E6VB 4DF8A 4CLZA 2HFSA 1S9GA 3K7RA 2G0JA 1U26A 1RHUB 2CVEA 1L5UA 1EHWA 1U1MA 3KLEB 4CYUB 1VRQC 4IDKB 5IWAF 4LF9F 3Q8PB 3VGVA 2LMIA 2XHWA 1YI2S 3C6UA 1H2TZ 1S9GB 1FE0A 1N6QA 1SKSA 4DEZA 2YH0A 3OXFA 4MFBA 1ZM4A 2H65B 1TZ0A 1RWWB 4FDFA 4JYAJ 5C42A 1HNZF 2XY6A 2KXHA 1U6BA 1FI4A 1VHFA 5KFDA 1XWLA 3MHYA 3SBMA 1F3VA 3C8YA 4ZA1A 1RAIB 3C6UB 3RW7A 4CO1A 3SDEA 2JFDA 1N6QB 2Z2LA 4YR0A 1B64A 5KFNA 3PRDA 2BE9B 3T9ZA 5C42B 4X4OA 4ECUA 3BN4A 1VQ4S 1U1KA 2VJUA 2Z8QA 3CEDA 3SDEB 3CJ4A 2HHQA 4G1QA 4QWAA 5E3AA 3THPA 3MAAB 3VWSA 4N41A 3UD3P 2FVSA 3A1YG 3H5SA 5IS2A 5CD4A 3SEOA 4HT7A 4N8NA 4HLBA 1S6OA 2CPJA 3HULA 5LMUJ 5J2PA 4G1QB 1HBMA 1IBLF 2R7WA 4UF4A 1S77D 3DLLQ 3H59A 5GAHU 1VBXA 1HHTP 3RB6A 2G4BA 4Q43A 3NEKA 1GTHA 1RTDB 1O6XA 2VPYB 2X3DA 1SIWB 3B8HA 2J6UA 5J2PB 5D8HB 1TKXA 2KG0A 3IAM9 3M1VA 1HBMB 3K8WA 2ZD1B 4PG6A 3OTOF 1QTNB 2XB2D 1PBAA 3DLGA 4LBHA 1U2CA 4GVLA 1R0CB 4RZRA 2A3JA 4KFBA 3BSCA 3FCWA 1OY9A 2VDIA 3LPEA 3BO3A 1TKXB 4RJVA 3M1VB 4HR2A 3W9JA 3LA0A 4KGXB 2PC6A 3DLGB 2D7SA 3GILA 4DN0A 4KFBB 4J9LA 4QIWD 4OZ0A 4BC7A 2H54B 3UVJA 2ZH2A 3IXQA 1U4BA 4DR1F 3B6BA 3QO9A 1XK8A 4YN3B 2QL9B 2CPZA 5HI7A 1FWPA 1NEEA 4K0KF 4O44B 4CT9A 4ZLNA 1IKWA 1X9WA 4B3TF 3IS9A 4DPWA 4URQU 1HWLA 2M0GB 2EW9A 3UVJB 3JS9A 2R2UA 2B6AB 4DL6A 1FJGJ 3QO9B 2OGUA 3D9BA 1RAHB 4YOEA 4ZIWA 2ROGA 4GC6A 2DB1A 5D6GA 3IS9B 5KTQA 4ZOSA 5E41A 4U7UD 3KK3A 5D0HA 3LALA 2RUSA 4LIWA 1YJUA 2ZE2B 4TXSA 1TK5A 2FPHX 1EETA 4NYZA 1J5EJ 3TX8A 2QA2A 4DQIA 3MF5A 1MSWD 4NLOA 3T1YJ 4PCQA 1YJ9S 5KFUA 3QLHA 1HNXF 4JI8J 1BLUA 1HWIA 4O3OA 1X5PA 3KK3B 4GRSA 1Q53A 1T9VA 4A47A 3W63A 5H1SV 1LWCA 2HRYA 3PO4A 4UW2A 2HK2A 2VZ9A 3QAEA 3QLHB 4NA3A 5KFTA 3TQ1A 1N5VA 2IM1A 3AXMA 2B3TB 4MIWA 2VC0A 2DNRA 4LFBF 4LF8F 2ATCB 2UVWA 2GHWA 1LWCB 4Y0FA 3MZIA 1KFDA 3BH6B 5DO2A 1FRKA 4DJBA 4ZLLA 4B3MF 1IVZA 2CJKA 2ZHOA 4P2XA 3J7YU 2Q43A 4N76A 2BOPA 2VF3A 3MMCA 2ZH7A 5T7LA 4ZP6A 4X4QA 1UVJA 2QGFB 1FX4A 5HN0A 4XDDA 4ZVSB 4Y28C 3MOZA 1ZA1B 1FT8A 4DLEA 1VCTA 4QJVA 1ULRA 4M5HA 3MMCB 3KK1A 3VZIA 4O3QA 2EG1A 1OSDA 4UZBA 4K4ZA 4WKYA 2HS3A 4EO8A 2N3OA 2V68A 2LA4A 1K0TA 2VU5A 3ZZPA 4XDCA 3JXOA 5LM7E 3KLHA 1N52B 3M8WA 1ZM2A 2JRSA 2J0XA 2UZAA 3CJ2A 1GTEA 3KK1B 2MJNA 4X4UA 2WW8A 1HWUA 2AU0A 2KVQE 2CA9A 4XTTA 3IR5B 3EVOA 2V8PA 2OSRA 2I6WA 4ECRA 3CWJA 1WACA 2VPXB 1F60B 2OD6A 2V63A 4IG3A 3BKTA 3KLHB 3EYZA 1G2EA 2ZHAA 3QIDA 3AJ2A 2FZGB 2DH9A 1UVMA 3B54A 2G13A 4KYZA 3MXHP 1RAAB 4ZITA 3JAMY 2J8AA 3EUNA 4G6VB 5E0OA 2AP6A 2P6TA 4CH1A 3GV7B 4ILMA 3D1QA 3FJ2A 4ID5A 5DM7Q 1WWHA 4JI1J 2ZDOA 2OP5A 3VV2B 2FHKA 3PW7A 2CQ2A 3V81B 1NK8A 4YY3F 1T9UA 4Q7AA 2DGWA 2JEIA 4MYTA 1C0UA 4QIEA 3VVTA 3PW4A 2ROPA 4LVNP 3R6GB 1VC6A 1RU2A 1AXQA 2IFXA 2RF2A 3G4SS 2XZWA 2V9KA 2OPSB 5CABA 3NP5A 2NXJA 3KJFB 2PMZD 3MUTP 2YQ1A 3GV8B 3TOQA 1C0UB 1HPZA 4GKJJ 2AJ1A 4MK7A 2HQDA 2ZH6A 2RF2B 4B3RJ 2HRTA 3HFZB 1YDLA 4KHPF 3W8GA 2QC3A 1Y5NB 1X60A 1IKVB 3BF4A 1HPZB 3NCRA 4OHVA 3GYGA 3FSXA 2PI5A 2R7UA 1U02A 2IVMA 1NK0A 1EARA 3CDBA 5AE2A 4ZCIA 5FDLA 4LRBA 1IJEB 3AB2B 1QSYA 5ETTA 3HF5A 3HFVA 3NNCA 1SI9A 3TYTA 2XLJA 4DSKA 1GK8A 3M9NB 3D6MB 2MLZA 1R27B 1QLNA 1EKSA 3BBCA 1L3UA 3VAMA 2R7RA 5FDLB 4UZCA 4YP3A 2LFVA 2F8EX 4ICLA 5CA5A 1U7LA 3QWPA 1NJZA 2MXYA 3DU5A 3VAHA 2P9GA 2F9JA 1RTZA 2VICA 5B09A 3HM9A 1TUVA 2ZC3A 5KG6A 5JJBA 2EI5A 2HVDA 4C3KA 4O4RA 5A2QU 4ICLB 2EFQA 5BR8F 3MAHA 1FNMA 3FBEA 4DSIA 4ES2A 2Q1LA 1UA0A 5AJ3F 2ZUAA 2V50A 1KFSA 2Y9HA 1RTJA 2HYIB 3WDOA 4L74A 2JEFA 4PPDA 3M7VA 2FDNA 2OLWA 1BQNB 4DR7J 1XR6A 4NI2A 2HWHA 2HZAA 3EPIA 2XI2A 5GAEU 2G2ZA 2MLXA 4KJIA 4DPXA 2AX0A 5EDWA 2M9KA 2XMMA 2RQ4A 5KT2A 2HQGA 3CJSA 1IBMF 3BGOP 4I69A 3FFIB 4NI2B 4JV5J 5JUMA 4M5KA 1SC6A 2E5JA 4NLYA 3OL9A 4F02A 3B4DA 2E5LF 4JI2J 2UXBJ 2F40A 3O5TB 4KV8A 1RT4A 2KL8A 3TQEA 3U27A 2MKJA 1K1SA 5DLGA 4F0KA 2O3DA 5KFBA 1FDNA 2WBRA 5C25A 3RU0A 2XGPA 3JAMU 2DNHA 1SQEA 4KO0A 3BBFA 3MR5A 5C24A 4ZN1A 2LXUA 4KV8B 1RT4B 3MFHA 4OQJA 1QVGR 5C25B 2DNQA 2DRBA 1SPBP 1JKHA 1OWXA 4M5MA 2FGOA 5C24B 3G96A 4ITSA 2DNNA 4OJ3A 1RTHB 3ETOA 2QLFB 5B0GA 4CCHA 1H2VZ 1UVKA 3N79A 3D1OA 3PFOA 4F04B 3HT0A 1KDNA 2MZQA 1JKHB 5IV3A 1YJVA 2QYGA 4K4WA 2OEJA 2VODA 2CWXA 4PXCA 3NWRA 1IR1A 2ACMA 1EX8A 4NEZA 5J2MA 1RT7A 1U6FA 4ED7A 5F8JA 4B3SF 2WVFA 4Z2XA 4UQGA 8AT1B 3PX6A 1LXNA 4DX8H 1RABB 3BREA 3B78A 5DG7A 1OQ3A 3BKFA 1WSRA 1S6PA 3CO0P 3OUYA 1AW0A 2DR9A 1WEZA 2HIYA 5J2MB 3TA0A 3PY8A 4KPCA 1FKAF 3RBDA 1D09B 3OFEA 4ED4A 5HLFB 5ETLA 1S6PB 3TZWA 2UVRA 5EHHA 4ECZA 3OUYB 5J1NA 2A0FB 2G2OA 3MMBB 4W92B 1RA7A 4LR9A 2BVZA 3AAWB 5IT9Y 1HNZJ 3D0IE 2MQOA 3QMQA 1YQHA 5DQHA 2W2MP 1HD1A 2M2BA 4DUYF 3LO3A 2B51A 2E29A 3HCXA 2RILA 1JMTA 4DL2A 1HLWA 4IRKA 1N33J 2C3OA 5FLXY 1JJHA 2B4OA 3BV8A 3SSSA 2V2VA 2RRNA 4F2RA 2X1AA 4ES3A 5MAOA 2XS2A 1Y4ZB 4G1IA 3G8SA 4DSFA 2WONB 1V9OA 3EM1A 3C14A 3V6KA 1GQEA 5KFLA 2WK4A 1JLEB 1FFWB 4DXLA 3R1HA 1S1XB 2K8GA 1CULB 2JWNA 1UWBB 1PBUA 5EX0A 4YMEA 2XMVA 1RT1A 2EVZA 1IBLJ 1S48A 2MMYA 2AT1B 2GCFA 2R7TA 4L3NA 2RDIA 2CYYA 4RUBA 4X65F 3KLFB 2XMKA 5A6PA 3P5TL 3UPFA 4QBUA 2HKEA 2Y1LB 1NUEA 2JZ5A 3ILJA 1DARA 2DNKA 1XMBA 2YXLA 2WOMB 1RT1B 3D68A 2AGOA 2VL1A 2WSFC 1PO6A 3NOCA 1YK9A 3R97A 1MMNA 3R5GA 2ZH3A 2DRDA 2MZRA 2CQDA 3MEGA 2RB7A 5ETKA 4DSJA 2PEHA 1CPZA 3ZZUA 3MPYA 3PV8A 1ZAWA 4U96A 3KYLA 1LFPA 5KG5A 4YR3A 5KAKA 3R7SB 3HVWA 1YBTA 3FBFA 1VLOA 3J80Y 3VAIA 4DV4F 4KIAA 1NPRA 4DCOB 4JI0F 2GAGC 3MEGB 2DCUB 1NJWA 2ZVSA 2W01A 1Q5VA 3EDRB 2XYPB 2ZFHA 2VPWB 5L46A 4DR3F 3P96A 4K0KJ 1M1KT 3Q2SC 2MLYA 2NXEA 4MIAA 2UUCF 4LF4F 2GIFA 4WTYA 3TAPA 4CNZA 3I5AA 2DITA 1WOPA 3LGHA 4FF3A 1M5PC 2B5JA 4URSA 1MU2A 1FERA 1YZ6A 4RL1A 3GSDA 4KTQA 3AQOA 2GA7A 2YX1A 1TL4A 4DZDA 1N32F 2LQ8A 4LSNA 3ENAA 1XMOF 4E0DA 2LDIA 2J7KA 3OR1A 1D3WA 1KLMA 4TYBA 3QWUA 2HIQA 2MB0B 3R2CJ 4X62F 1HNXJ 2B5JB 1Q5YA 1MU2B 3JTNA 4RW7A 2MQ8A 4O3SA 3C3LA 4FPIA 1VR6A 3MCOA 1UVNA 4USMA 2MY8A 3A3NB 2RHQB 2NZCA 4LSNB 3GJSB 3H7HB 1N4LA 1TKDA 3LGMA 4U8YA 2QSFA 1TKTA 4L6V3 2E1PA 2RNEA 2VBYA 5DJBA 2VH7A 5I42A 2DNLA 4RW7B 1PG5B 4USJC 2BM0A 3CC7S 4RUAA 1A9NB 3D2WA 1F9HA 4TQSA 2EFGA 4HACA 3CGIA 1TKTB 3QT7A 4GO7X 4O4GA 3OJSA 4B3MJ 2R7OA 2UVUA 2MZJA 2RD5C 2XWYA 2AJ2A 4DUZF 2XYGB 4RUCA 3VALA 2QFIA 2YNIA 1U1PA 2VKRA 2AMCB 4LVOP 5IQQA 1LK7A 2DPIA 4DX5A 4K4SA 2BJ9A 2QG9B 2DNOA 4F2SA 4J9NA 2BE2B 4MKVA 4NLXA 1D1UA 1YLXA 4QWEA 2AZ3A 2VFVA 2W8LA 3J81Y 2J0SD 5FLXU 4C8MA 4JB8B 3CJQA 1T05A 4M5NA 5D4NA 3KUGA 2Y1RI 3FGVA 3FNNA 5C7PA 2YWFA 3S1TA 4OMFG 2XCAA 3UQSA 1FRJA 3KLVA 4J9SA 1ELOA 1Y3KA 3RZAA 3R8YA 4HTJA 1NB2A 5LSRA 1T05B 5IT4A 2F4VF 3MM8A 5D77A 2V94A 3GTYX 5CZXA 3SV3A 3SXLA 3UR0A 2EBGA 3PX4A 2YWHA 2IM3A 2CWKA 4Y65A 5I3PA 1AB8A 2CUYA 3CO9A 2C3PA 5BYSA 4P72A 1JX4A 3NL0A 4B9NA 2V0NA 1JNZB 2GVDB 3AXKA 1RB0A 3G6YA 3RAQA 2OH2A 3QIPA 2B7BB 4ELTA 3MMJA 3SV4A 4FYWB 3HJFA 2FLPA 2HFNA 2BDPA 2ZITA 4PPZA 1R8CA 1BMQB 1FXDA 2YQ0A 4PYAA 3ENWA 2QMUB 3QIPB 1WC4A 3QPIA 3H90A 2HPUA 2KTQA 4KKOA 4Q45A 1N88A 2ZWOA 3ISZA 2O01C 2KYXA 5T41A 1VQPS 2V4JA 4QWCA 2RUGA 2VFRA 4OYBA 2BRKA 3IC1A 1FTCA 3GB0A 1WKKA 5GMDA 5DGAA 2V4QA 2H4WB 3H0PA 1NK9A 5KG0A 1R6YA 4PEOA 2BX6A 4IRDA 3R9LA 2AGPA 4N5SA 1ZAXA 2LVWA 2M8DB 4ZP9A 4WF9Q 2V4JB 2W2OP 2QMWA 2DEJA 4PQUA 2XHCA 2WB4A 2RE1A 2V8HA 2NSBA 2ZBQA 3OJUA 3O6QA 3I6PA 3IFEA 2XS7A 3CCRS 2KFNA 3GPAA 4WYLA 9RUBA 1FRHA 2RS2A 4C3MA 3PJ9A 2K3IA 3GJRB 4PQUB 4BBYA 1RK8A 4B02A 3RJMB 3KK2B 3R5AA 4YDDB 2HHSA 4MKYA 2I5JA 4RU9A 1KHVA 3HHLD 4NZ6A 2E7WA 2VG7A 4LF6F 4Y6IA 2PSZA 3OLBA 3OR2A 1TUWA 2R7SA 5EWFA 4DV2J 3DMJA 3CXCR 1IKYA 2DXDA 3G87A 1SQFA 1RAGB 3DLKA 2HNYA 2I5JB 1F6TA 2X51A 4URGA 4DZ6A 2VG7B 1FRIA 3F73A 3OFHA 1XMQJ 2MZTA 4NASA 3OR2B 1S6UA 4DFMA 4X66F 1M90T 3DMJB 2PA3A 4FYYB 2A10A 7FDRA 1X31C 2HNYB 1HBUA 2CQPA 3CVKA 1G7CB 3MURP 4OJHA 3CC2S 5A8WA 4DFJA 3PRBA 2UP1A 3GE9A 5CYJA 8RUCA 5BYQA 5FJ4A 4DS4A 4ZDNA 3G71S 4NLPA 2NREA 2VB6A 3R5BA 3CDAA 3O44A 2LEBA 1N34J 4FZVA 5U47A 4TKTA 2MHNA 4WP3A 2EK6A 4DR4F 1DTTA 4AQYF 5IOLA 3L4BC 3R5CA 4IG0A 3DCAA 3GIMA 4UOHA 4K2XA 4LRDA 4J5OA 4NOHA 3C6TB 1HI0P 2DGQA 1HD0A 2U2FA 1Y5IB 2FQQB 3EZOA 4I7FA 1TUGB 2YKQA 3G82B 1CVJA 2O67A 2VC1A 3KMSA 4DCJB 2ABYA 2LP4A 2EC2A 3CJRA 4IG0B 3W66A 4K4XA 1RLCL 3UR3C 1NXIA 2WHOA 4F4YA 4PWDB 4YR2A 2OD4A 3A3PB 4ZLPA 4MT1A 2HVEA 5J1PA 1TAQA 3M2UB 1KQFB 4I7FB 1IWGA 4CLLA 3OVBA 2E5LJ 4EYIB 4CZCA 2UUBJ 2DHXA 2BUNA 1RA6A 3PKYA 4UTGA 5RUBA 1KOOA 1KN6A 2KM8C 4OX9F 5F3TA 9ATCB 2HHXA 2DNYA 3J7A1 4NCBA 2XI3A 4MH8A 3D28A 5F41A 3W1YC 3PDNA 4O3RA 2FYXA 3KLIA 4M1KA 2RQCA 5HQMA 4IR9A 2AJQA 1PYTA 1GT8A 3KXDA 2W25A 4FYXB 2HHHJ 3PHTA 2B43A 1LKZA 4JI6F 1AFIA 4DI6A 2CNLB 3LWLA 3GIRA 4MIBA 1SKWA 2AEMA 3FMBA 1W7WA 2MSTA 5B0FA 2R7QA 2CAJA 1X9SA 1RT6A 3RBZA 1TKZA 5JXSA 2FY8A 3T6JA 4UY8T 1ICEB 1FRMA 5ETOA 3AH6A 3W2VB 4I2QB 1U1LA 1YVFA 1YSJA 2YNFA 3LP2B 3TUZC 4B3SJ 4D3GA 2CQGA 2ZKUA 5KT3A 1WDTA 2EPIA 1R8BA 1H72C 2H1YA 2Z0GA 1RT6B 1RWPB 1TKZB 1HR0J 1CEZA 3SQGA 4B9MA 1GMVA 2LDYA 2DY9A 2YNFB 3RBEA 1JLFA 3K59A 4P73A 2LU2A 3FVYA 2JEJA 4FYVB 1K73T 4OV6A 4DR5F 1UTAA 1YZ7A 4NXMF 3SQGB 5KFPA 2RU9A 2D74B 4QPXA 2AEJA 3QT5A 5EUHA 1JLFB 4OFZA 3IM9A 1VK3A 4ECWA 4WU2A 1VQSA 2MQMA 1RGVA 4NWBA 3OV7A 2GO9A 4ED3A 4DUYJ 3V5RA 2A6MA 3BGRA 3HDSA 3CD6S 1DFDA 2KT2A 2V8DA 1B0VA 5L1JA 1UEKA 1VQ7S 1RHKB 2D69A 3DRSB 1R6VA 3W8PA 1L3SA 4TLRA 4LQ3A 1F3FA 4YUDA 4Q44A 1QUVA 3OSNA 1SJRA 3KJNB 2XZTB 3EDQB 2DPJA 3GONA 1SXLA 1XERA 1HYSA 1WC3A 1LWEA 3TUPA 1IR2A 4YHHF 3N28A 2GC8A 1JLAA 3I5CA 3BBBA 3DHWC 4UT4A 2GHPA 4DX7A 2CQBA 3EWGA 1AZSA 5E2QA 5KFJA 1H7WA 2BE7D 4JI5F 2EKYA 3CJ0A 2W4DA 1HYSB 2ZEJA 4WK1A 1LWEB 4IFVB 2FGCA 4F7VA 2OPPA 3QSIA 2ZUGA 3OHAA 4DDFA 1TL5A 1JLAB 4B9UA 4U6PA 2VUGA 5KFAA 2RMLA 1AZSB 2BQUA 3CMQA 2MEWA 4DV1F 1W26A 2FLNA 3AD8C 1WKLA 5T14A 3PXGa 5LMNJ 1Q95G 1VQYA 2OPPB 3BKUA 1RBLA 5D3GA 4LRCA 1JXLA 3L7UA 3MEKA 2XCPA 4PQAA 4WIIA 4C8KA 3IWXA 3OVSA 1JQGA 3HT3A 2QA4G 4ERDA 2MDAA 5KG4A 3NAHA 1TL1A 3BQ2A 3FQKA 3AJ1A 4DV4J 2GMHA 5D3GB 3D67A 3O1LA 3HLUA 3IO1A 3UDCA 2FZKB 4PG7A 1N48A 2WW4A 3VTIA 5H9EK 3LQVA 3MM9A 5A0YA 3T1HF 3B82A 5L1LA 1TL1B 1N0UA 1OY8A 4I6WA 2QIFA 5KFIA 3MM6A 1FO1A 4LF4J 3QT8A 2H51B 2BACA 2H4YB 1NH8A 1MWQA 3MM9B 2L08A 4X4SA 4A8MP 5A0YB 2IPOB 2ZDPA 4OLOA 5F8NA 2SXLA 5J2NB 4FBTA 2GV1A 3MM6B 3I9V9 1T0TV 5JVGQ 3SCJE 1N32J 1CC7A 4I4BA 1X4EA 1GMUA 4ZP8A 1RWNB 2MJUA 2VKZG 2XTJP 1N8RT 1RT5A 1V6HA 4FXVA 4DV0F 4QR1A 4Z7CA 4ED6A 2BJ1A 3THVA 2CADA 5DDQC 4LFCF 1SIZA 4Q0BA 3N01A 3AOBA 5B0EA 3SFUA 1L3TA 1RT5B 2CDQA 1WNEA 2E9TA 1NK5A 2UUTA 3JSBA 1JK9B 1EKRA 3OSPA 3TUIC 5IC4B 4EWTA 4C7QA 2A18A 1TV6A 3L09A 2KHCA 2E7XA 2YKMA 3CCTA 1CBKA 4IH6A 2BEFA 3MPWA 2W9CA 1H74A 2BV3A 4Y2AA 1R0AA 1U6ZA 2YKMB 4HVZA 2B56A 4A8YA 3OBIA 1KOHA 4DU7A 4WJBA 4R25A 3RUBL 4D3HA 2W9CB 3CDEA 3FK4A 4J91A 3T9NA 2P2CB 4DV3F 1R0AB 2MGZB 3PACA 1H3DA 3LW5C 3D3CJ 1X4HA 2R2SA 4EO6A 1S72S 1C1CB 2RQMA 1WC5A 1FJEB 1T8EA 4EGLA 2GJFA 4ZMMA 1NMEB 5AE3A 1M5SA 1FRXA 4J9OA 1G6BA 3RRHA 1L3KA 2DNZA 3KDOA 1U47A 2HLTA 3F41A 1HW9A 2DRAA 1FVQA 1QAXA 4Y2MA 4CM0A 2JSXA 2JLFA 3D6HB 1WG5A 4FKXA 1CQNA 3E8OA 4DN9A 1SJQA 3JSYA 1A7GE 3NAIA 5AE1A 3M6VA 1X7VA 5D4PA 3Q83A 5IV4A 1NSKL 5DG8A 3BH7B 1C0TA 2ASYA 1WKJA 2FJWA 4K5RA 4KSEB 1IJFB 1EJ7L 3A8EA 2C22A 5A6WA 1H98A 4ER8A 3LP1A 2PGCA 4AE5A 2X1GA 4JI4F 1C0TB 2DIVA 2DR7A 1X4FA 3THTA 3C16A 1X5OA 4DUTA 2V9WA 2W7OA 3MFIA 2JNJA 5BXIA 2QN6B 1AUDA 1U0SA 5F0UA 3TJAA 5DZ7A 3GJQB 2C42A 5D15A 2OPQB 3LP1B 4RWXA 1EP4A 1SL1A 4CLUA 2YKAA 3SMZA 3G6XA 4ZP7A 1KS2A 3C16B 4LF2A 4DL4A 4MAKA 3PM9A 5HMXA 4KH0B 3RGIA 3G9CA 6FD1A 1KP6A 2QTWA 1OY6A 3BM7A 3HVTB 3M9MB 4F3QA 2IIHA 4E8UA 1T94A 2UXCF 1TMMA 1O8BA 3SSQA 3DNCA 1LV5A 4WK3A 2V34A 2V67A 1UMJA 3CCWA 4BHQA 2JC1A 3BZQA 2Z58B 3NNAA 1CJTA 1Y11A 2VOOA 4U9RA 2BKPA 4C48A 1QSSA 3CW2C 3AD7C 2E1AA 2N82B 1FDAA 1Q7YT 4MMOA 3FKBA 3H8YA 4B9SA 1VYAA 2RHSB 1TL3A 5EGYA 1CJTB 2B9WA 4DV6F 1NH7A 5KOWA 2K3KA 2XBPA 1UEVA 2W2NP 5A8RB 5GADI 2V4RA 2D3UA 2LA6A 4ZK7M 1HNWF 4IRCA 1FNXH 5K8MA 2BXJA 1LEOA 3S8SA 5CH7B 1F2HA 2K7JA 4H4MB 4TU8A 1W25A 1S99A 2GMJA 1DURA 2EG2A 2XULA 2JVRA 2MQPA 1R8HA 4F26A 5HO4A 1YBAA 2HQ3A 1VOMA 3DXSX 3U1NA 2LEPA 2ZJRQ 4ANEA 4EBCA 4PWWA 1FCAA 3GG0A 3RBXA 3I55S 4QCLA 4J9KA 4KB7A 2M70A 4DHVA 2W9AA 3BSNA 1Y0HA 4OHZA 2RU3A 3BPDA 4K4VA 4NE9C 2ASDA 3MEDA 1RWMB 3R7NB 3CJTA 2L48A 3AY0A 4EU0A 3CULA 4MK8A 2DR5A 2VQEF 3H40A 1SVDA 1U45A 3LANA 4CQ1A 2ZH8A 2VV5A 1SH2A 1TQLA 3IN5A 4QQBA 3NRBA 3G6ES 3MEDB 1IBKF 1NHVA 4HH1A 2CPHA 3GV5B 3HSZA 1WC1A 2JX2A 3ET6B 1S9EA 5DZ6A 1K44A 4WXWA 3IR7B 3DDNA 3MOJB 2OEMA 4C98A 1LXJA 4RUHA 2VA3A 1CS4A 4JI6J 1WC6A 4M5JA 4ECSA 1RT2A 4WP8A 1SL0A 4WP9A 3CJ8A 3DOKA 3MR6A 4J9RA 3VCDA 2I2YA 2CDRB 4A8FA 4B9TA 2UXDF 4WFAQ 4DX6A 1CS4B 1VBZA 4ED0A 3GLJA 2NZ4A 1SUQB 4KT0C 1KRPA 1LOUA 1Y3JA 2F5GA 4Z37A 2NPFA 4R0JA 3L7PA 4J9PA 5F8MA 3UCUP 1WJ9A 1VJWA 1R7IA 5HBMA 3DN9A 4NXNF 1PJ7A 1NO8A 4I68A 3L7OA 1S1WA 2C2MB 2ZZTA 1WF1A 2HWTA 2IY5B 3TZZA 3WHIA 3K5OA 2YNGA 3EGWB 3JSRA 1UVLA 5M2RA 1H6KX 3W5ZA 1Q81T 3RRGA 2MQNA 1MMLA 3Q8UA 1S1WB 3DGPA 2Y3YA 2VFTA 3KHLA 2DKOB 3FCHA 3UN3A 2AYEA 4NLUA 2E44A 2DO0A 4EBDA 1NHUA 4F4AA 2YNGB 5HATA 5KFWA 4P71A 4OI4A 3MEEB 2HG4A 1S0MA 4DPTA 4OZLA 1SL2A 4IO1A 5IM0B 3LP0A 4LREA 4NCAA 4ZCLA 2OMOA 1I51B 2ADCA 4LF5J 1SJ1A 1OSCA 3P49B 2UU9F 4NRTA 5K5MA 1EAYC 5IXUA 4XPCA 2MKCA 2GIQA 1M5OC 1CC8A 1RHQB 2W1BA 2HHVA 2Y1JA 3LP0B 3GP9A 3I0SB 4X64F 5B7WA 3UE2A 3EGNA 3TEGA 3HHLA 2KRRA 3OTDA 1RXOB 3N6MA 4XO0A 3IRXA 2Y0SD 5CCLA 4JI3F 2WVBA 2HAIA 3MPVA 4Q2LA 2FTRA 2KO1A 1UPPA 2QL5B 4JI5J 2WVCA 3HHLB 4EI2A 3T1AA 1B7YB 3TARA 2R2RA 4DF4A 1CJUA 5D78A 2JC0A 3IRXB 3Q8QB 1D9FA 2KI2A 1VI7A 1Y7PA 5D0RA 1JLBA 4Y2CA 3T5HA 2JH3A 2RDJA 1J2VA 1X4DA 1GX5A 2ILYA 4BWJA 1RU1A 4LR7A 5G0RA 2LLZA 4R8UA 3Q8RB 2LQJA 2KXFA 1U49A 3NMRA 5KFOA 1DLOA 4MFBB 2WCXA 3MECA 3C19A 1DJ0A 2C2RA 1YJNS 1XR5A 1X4CA 2ROEA 2IMOA 4NCGA 4WFNQ 4DPOA 5G0RB 5K9FA 4R8UB 2BYCA 4H4KA 4LBIA 1Q8BA 4PUOA 1DLOB 1PILA 5LXYA 4FF1A 1SC1B 3MECB 3T6BA 4PYDA 3S7RA 1RE1B 1JB0C 4Y3CA 4DOZA 2AJ4A 3S01A 1NCLA 2HBRB 3CMAS 1XNRF 4PUOB 3KG0A 1IQTA 2Q79A 2A2CA 4M94A 5D0EA 2JJ4D 5L8RC 4KC5A 2BJDA 4AL5A 2VD3A 4WZMA 1KQSR 4BC9A 1IKXA 3E2EA 2NYIA 1GXLA 1S0VA 2ZNZA 4ELUA 5DETA 1Q16B 5B0DA 2IC3A 3R5JB 3CIMA 2MQQA 2C2EA 2NPIA 1ZPWX 4ZVOB 4B08A 4NLGA 3BJYA 2AGQA 4G1PA 2HHTA 1DY3A 3GFHA 1S1UA 3NXZA 5KFFA 1JNRB 1TU0B 1SH0A 3RB0A 3E01A 3SYZA 2FJBB 3T19A 1FEHA 2G0CA 3NKYA 3AFGA 2ERRA 3GWCA 1ZETA 5E3PA 4K7QA 1S1UB 3HKZD 4IO9Q 1O51A 1WF2A 4K59A 3E01B 2V2KA 3D5MA 3K17A 1WF0A 2AIRB 2QLBB 4F4XA 3HSJA 4BLGA 1O0PA 4HYKA 2HHUA 4OZ5A 1U0HA 2LU1A 3I4PA 2W24A 1M5VC 2KN4A 1VRUA 1SC3B 2KDOA 3AA9A 3DDIA 2CG4A 3R2DJ 1ZBTA 3DM2A 5KFGA 3BDEA 5DDRC 4JYAF 3AD9C 1IKWB 1R43A 2YKPA 2BRLA 5L1IA 2HFOA 2VJVA 2ALYB 4C11A 2F63A 1FK9A 2APOA 4DV3J 3Q8VA 3DM2B 1V5IB 3ZTRA 2FHOB 2R8GA 1Z2LA 5GMKa 1ZTWA 1BWEA 2CPYA 4BCAA 4N7TA 1VGYA 4C11B 2XY7A 1EETB 4USTA 5KG2A 3L3CA 2JEGA 2OFGX 1FK9B 2ZM6J 1RTIA 4OHWA 2R7VA 1NK4A 2V6AA 4QWDA 2IA6A 2ASJA 3CSKA 1QVFR 5LMUF 5K8OA 4J90A 1N36J 2IA0A 3A4TA 4C8LA 4ZPVR 4A8OA 2EFVA 3FBCA 3CCES 3KG1A 4CWBA 3MDFA 4L3KA 2J7UA 1HWJA 2QT7A 4P7TA 2RH3A 1LK5A 2R42A 5LOQA 3Q2TC 1VMBA 2U1AA 2BM1A 5KFHA 2KVIA 2W7AA 1Y10A 3AODA 2G1HA 3PCOB 4ECTA 3ISND 1FD8A 3BQ0A 5A2QY 2NR0A 1DQ9A 2YWKA 2LKZA 4Y2KA 1F2GA 1FX2A 2C2DA 2YPYA 3FQLA 3M4XA 5T7LB 1SH3A 1TTHB 3HFKA 3LF0A 4JI4J 3NMAA 3IBFB 3IG1A 1YX2A 3PYGA 3ISNC 3J7Z5 1KLNA 1ZM3A 3HHDA 1U8WA 4C8OA 3CCSS 1QAYA 1FVSA 4AL7A 5H9EJ 1X0FA 3IG1B 4ZHRA 2OTJS 1ZYQA 2RIJA 2F3JA 3CUNA 5HMYA 2CPDA 4ZCKA 1JLQA 3IBWA 2DJWA 1UFKA 3MI7X 2HRUA 1WDDA 2XS5A 1Z1ZA 5F8HA 3NOGA 4ZHRB 2C2NA 1HQEA 1VQNS 1WI6A 4IG3B 4QOTA 4G65A 3UCZP 4YB1P 1ROFA 3A13A 5EN1A 3SFGA 2ASLA 3M8PA 1J5EF 4Q8EA 2Z57B 1FDBA 3KG4A 1WHVA 1YKWA 3L9ZA 3T1YF 5HANA 1KTVA 1GEHA 1UW4A 1Q86T 4JI8F 3CC4S 3Q89A 2MKHA 1HQEB 4PG4A 1UFLA 5BYRA 5C5JA 2M8HA 2H5EA 2UUWA 1I1GA 2ZOGA 3TJ9A 3HZEA 1HKAA 1P9QC 2W9BA 4AXIA 2WAQD 3K5MA 2E1CA 2AD9A 1S0OA 3PW5A 3N5BA 2IRYA 3D4JA 1ITPA 2FJVA 1S6QA 2IAJA 2J9EA 2E9RX 3NS5A 3RRKA 4ID5B 3FC9A 5A8KA 2IYIA 1YWXA 4IH7A 3M8SA 3TAQA 5LSOA 1HNWJ 3QGHA 2D41A 2BJ3A 1R3NA 4LT6A 3MUMP 3GIJA 3BB5A 5CXTA 1VQMS 2GQQA 1SBRA 1UJ5A 2R4FA 1SV5A 3MTKA 1H2UX 1B0TA 2K1RA 2DIUA 3E3XA 3DU6A 1RUSA 4OZNA 4LF1A 4RBVA 2X7IA 1HARA 1B4SA 1NDKA 3WIVA 4OZ2A 2AYMA 3DYAA 3ZNJ1 4KY3A 2Y1IA 1SV5B 1X0PA 1OS5A 2HFVA 3HSGA 4I2PA 2DNGA 3TEHB 4USUA 2AF6A 3KHHA 2Q66A 1QDUB 4DR2J 4X84A 1TAUA 4KE5A 1P1LA 3KNAA 2LQ9A 4CLYA 4MYUA 3DYAB 5F8LA 2XMTA 2VBWA 4F3OA 1OIAA 1C2PA 1YITS 3ILIA 1U1NA 2GO8A 2Z2MA 2F4FA 1IM6A 1GH8A 3GCWP 5KFCA 4IOCQ 1KQGB 4RKUC 1R8PA 2GJIA 3MCNA 3V2UC 3MGJA 4NZ0A 2KRBA 2CQHA 4Z7YA 3U1LA 2BKOA 3M8YA 1T9TA 1ZPVA 3HVAA 2HW3A 3N4WA 3OD2A 1K9MT 4WYWA 2MZSA 3QSYB 1QSLA 3P5BP 4RR5A 1J5OA 3TX0A 2RS8A 2L9DA 2OI2A 1S5ZA 2H5IB 1HW8A 3PNIA 4DWIA 3HSDA 4WWSA 3M6XA 2ZZNA 2IRXA 4L72B 4JV2A 1J5OB 1RTJB 3IMQJ 4EEYA 4JI7F 5HMWA 4EUVA 3ZZTA 1RBAA 3DXBA 2CPIA 4P74A 2NCKL 2Z4PA 2BJ7A 1BUXA 5AT1B 4YB7A 2M3DA 1NZAA 4NXNJ 3HO1A 1Q79A 5CZVA 2HZCA 3K5PA 3UNGC 3DLJA 3M2RA 3Q22A 4GKJF 3N0VA 1YJ7A 4DBQA 3US5A 4EZ9A 4ZPCA 3I0RA 2PT0A 4IOAQ 1N56A 2M5YA 4I64A 2AHOB 2AYGA 2P5VA 1WD6A 3HI9A 4A48A 4WPAA 2CNNB 4CLKA 1Q0NA 4A8KA 3H98A 1XEZA 3H2UB 1HWKA 1I3OB 1S7IA 1FKPA 1RAFB 3K89A 4WBFA 3I0RB 3GIIA 1WUUA 1S1TA 1Q8LA 4DS5A 2W4CA 4NMXA 4KO0B 4LF7J 4HTIA 1ZH5A 2MQLA 3ILLA 2HQCA 2MHEA 3OW2R 2XNRA 5KFEA 5HP1A 2PFFB 3HX9A 4G3IA 3TANA 1Y00A 1MN7A 4LFAJ 1S1TB 1JIHA 2G1DA 5DDPC 3JQKA 2M7SA 2E5GA 3DRYA 3IWNC 4LUBA 3BEGB 3QJJA 3GZ7A 4DV5F 4K50A 2EFOA 3QGPA 1YG0A 2E66A 5HP1B 2DGTA 3QATA 2Y8YA 1BQMA 1CG2A 2FUG9 3CB4A 2KB2A 2ZOFA 4DSEA 1G1XA 3EPGA 1RT7B 3PVXA 2GX8A 5K8PA 5KFXA 2KFYA 1N0VC 5IWAJ 2F9DA 2K7KA 4FXWA 2AX1A 4LF9J 5HMZA 1BQMB 1Q8KA 1Q4RA 4QIGA 2RKIA 3ITHA 1MWZA 1HBNA 3M05A 3SI8A 2DR6A 2HVZA 4QR2A 2CPFA 3NG8A 1PSDA 4X4VA 5CD4H 3JB9k 2QMXA 1VQLS 4OX6A 3T3FA 3TVKA 3VZHA 3PO5A 1SKRA 2POKA 1NAQA 3BGLA 4AL6A 2ZBRA 5M2UA 3WX8A 2UUAF 2RKIB 4DL7A 3ITHB 4GO5X 1T9YA 2E5IA 1T11A 4P2SA 3K5NA 5D4OA 1CSJA 2W2QP 3CTRA 2HGLA 3TVZA 4XPEA 2GMLA 2OPRA 3F44A 2WSCC 2ZWPA 4JI2F 3WIUA 4ALZA 1WELA 2Z2ZA 3V4IA 1XTZA 3ZTSA 2ZHBA 4ATNA 1DQ8A 1HBOA 3D0HE 1UETA 4O0NA 2LXIA 3LTOA 1DAXA 4NLQA 1UEUA 3D6TB 2HBYB 2OPRB 3HD2A 1IR0A 3EE3A 1S0NA 5F0WA 3FDSA 2HURA 2PD1A 4CNYA 2BW2A 3KLGA 1AUSL 2HFZA 5THWA 2WB1D 1A6LA 3V4IB 4FNIA 1HHQA 2FHMA 3CMES 1HBOB 4DV7F 3GFYA 3C14B 5B0CA 4ZLJA 2IDEA 4L75A 2HGNA 1TFYA 2DGUA 1HMVA 2I38A 3KLGB 3A12A 1YIJS 3QNWB 4TN2A 3OQ2A 3TUJC 2EK1A 3QJLA 1F1BB 1BQXA 4Q2MA 3DHXA 1FESA 3OTOJ 2F1FA 4UUWA 3I87A 1E6VA 4MKAA 1U24A 3QGGA 4FVMA 1IXKA 2ADBA 3QQCD 2NYHA 1X4AA 2CQ0A 4TY8A 1TVRA 2OUGA 2CQCA 2VA2A 1E6YA 3GYXB 1HIYA 3KLEA 5CYMA 4IDKA 2FJDB 2J5AA 2GQCA 1XN9A 4ZPTR 3CD5A 4DR1J 4TY8B 8ATCB 1TVRB 5DQGA 4N77A 3TI0A 1PC5A 1E6YB 1KNZA 3RG6A 3TR5A 5CYMB 4TYAA 4B3TJ 5GAHI 3EJMA 2E5HA 3OL7A 3IM8A 4JP8A 3MPDA 1H38A 1HFEL 4F25A 2LYVA 1TFWA 1SJ3P 1M1HA 4WTOB 3PKMA 1PYOB 1TP7A 2H3EB 4EMDA 2IJNA 2C2ZB 3AQPA 1HL6A 4ED5A 1U1QA 4EFAC 4DQRA 4B9LA 1VS3A 4I6AA 4NL5A 2XSFA 4FF4A 1S4FA 2CPEA 2MSSA 3DGVA 5ITHA 3M8QA 3UD4P 3A3OB 4IKAA 3MAAA 2J8SA 5IQ6A 1SCJB 2RRBA 4FKYA 1N33F 3D1HA 2CPXA 1MMDA 4YQWA 3MPUB 2KFZA 2QJ3A 2IM2A 4E2FB 2FD2A 1KVIA 2HGMA 3M8QB 2KHDA 4ETZA 5F3ZA 4FS2A 5HQ8A 3OR1B 1KLMB 1D8YA 3DLHA 1DRZA 1RTDA 2Y0BB 1B70B 2VFSA 1NPPA 1NZ8A 4J9QA 3A8JA 5SZTA 1NJIT 3QAUA 4OI0A 4PXDA 4OI3A 1T7PA 3T5KA 3FCVA 4LFBJ 4LF8J 2HZVA 2ZD1A 1FDDA 4QZVB 1NK7A 3RYLA 3UI3A 1XNQF 5I42B 1OJ4A 1UP1A 5K8NA 2FJEB 4OYOA 3C66A 3MR7A 2O66A 4OYPA 4CIOA 2GW8A 4NYPA 4HACB 1YRXA 1YJWS 4FNHA 2QO3A 3HD1A 4M8LA 1REVA 4O4GB 3N6LA 3W9HA 4QYZK 1S97A 2YNIB 3UN2A 2W2PP 4O44A 4JUZA 3LUYA 2XWXA 4ETXA 1REVB 1YJTA 2M88A 4F4WA 3CDWA 1JLCA 3FZBA 2F8MA 4PXEA 1FWLA 2B6AA 4B3OA 2XNQA 4ILLA 4YEAA 4RW8A 1X5SA 2CZ4A 3VAJA 7AT1B 1RHMB 1RHRB 3W5YA 1JLCB 1QTMA 3ELHA 2GGPA 1IUJA 4YFUA 3PIOQ 2ZE2A 3K8VA 3ZTOA 3J7YI 5H9FK 2D1CA 4R0EA 1JJ2R 4B3OB 2QFJA 3C2PA 4PKDB 2VHGA 1TR0A 4RW8B 1NSPA 2RAQA 1HHSA 3MM8B 3HHKA 1HI8A 5L39A 2DISA 4M95A 4RBTA 2ZKTA 4RO0A 3MR2A 1SB6A 2V5HG 2GGPB 3AT1B 3MCSA 4K4TA 1GXTA 2QLWA 4RW6A 3OXGA 5D4LA 2R7XA 4QWBA 1NKEA 3TA2A 3VR1A 2RQKA 2BQ3A 3DFEA 2A1BA 4CP5A 1GMWD 1LFWA 4W98A 4I0WA 4N56A 2FLLA 3ZNUA 4RW6B 1U8SA 3EZ5A 3FMWA 1RWKB 3W62A 4MTPA 1X4BA 4YY3J 2KU7A 4U8VA 3VHQA 1PIEA 1OMSA 3PJWA 3FRYA 4H4OA 1J27A 4X4TA 4KKOB 4JV0A 1KONA 2YKOA 3V6HA 4QIVA 2FIUA 2P6SA 4UQTA 2FVRA 2XEXA 3W9IA 3J7AN 4PG5A 5ETMA 2GQ2A 3CD0A 4KAIA 5L1KA 4H4OB 1GXUA 3ULHA 4C6AA 1FF2A 3G8QA 4WIQA 2XG8A 4X4NA 3DRPA 4OYIA 4KHPJ 1XIQA 5KFMA 3MD1A 3TP2A 3H4BA 2P9EA 4QU7A 4ECQA 4NRUA 1NK6A 3DRPB 3MM5A 4YS2A 5ETRA 3K58A 1FRLA 2QYCA 3QRPA 3MAQA 3NGKA 3ZTQA 1RWXB 1BY9A 3UDLA 2VOPA 2OFHX 1EQMA 3F56A 3PTWA 3F0NA 3VAGA 1NRKA 2QE5A 4WKRA 6AT1B 3DOLA 3MM5B 1IKYB 1EIYB 1RYSA 4ZVRB 4J7CA 3DLKB 5HSPA 3ZC4A 4XIUA 1XQIA 2OIHA 2CJ9A 1CJKA 2DGVA 2FC8A 4K4YA 4KH1B 1JJ4A 2ATLA 4ZJOA 3DOLB 4IQXA 1PC4A 4AFFA 3QRQA 3D6FB 1HBUB 3TZYA 1CJKB 1DZ5A 2NQPA 5BR8J 2ZOMA 5A8WB 1GNKA 2W8KA 4ZJQA 5LJ3Y 3V81A 2DVIA 3CCMS 5AJ3J 2ACYA 4KQZA 2FZCB 2VFUA 2D3ZA 2DEIA 2M52A 2YY3A 2B8PA 5D0GA 3KUEA 1S59A 2O5DA 1UZHA 2NUUG 4QR0A 2YWGA 4USHA 4KPYA 4P7VA 4NLWA 2OPSA 4F50A 4DPUA 1EQ0A 1DTTB 2B8QA 2CKWA 1N54B 2L9WA 4JI7J 3G8TA 1BGXT 1T03A 3IRWP 1IBMJ 1ZTTA 4AUKA 3GU0A 3K0JA 2JOQA 1QY7A 1V3ZA 5LSLA 2A6OA 2UV8G 3OTCA 4AXJA 1CLFA 4OI6A 1AA1B 3JTOA 3WZ0A 1RSCA 2HBQB 1T03B 1IKVA 5KT7A 5IT0A 1GAOA 1WSVA 1IWAA 5B08A 3T5JA 3KDNA 2NSCA 3B4MA 3MM7A 5AXLA 5KFRA 1UCNA 3CCLS 3HHNB 4P52A 3X1LB 1T9WA 4ED2A 2DCLA 4DL0C 4CO4A 4FN5A 4OZ3A 3IR6B 3M6WA 3T5LA 3D3BJ 4DV2F 1RKJA 5GAEI 3PW2A 2VG5A 1S9FA 3GYNA 1KHWA 3M8RA 1KTQA 3MM7B 2R2TA 3OHBA 2I9SA 4OYZA 2YQ3A 3M6UA 1M5KC 5DRKA 3MUVP 5G4DA 3FEXB 3KLIB 1XMQF 2FHJD 2B4VA 1HA1A 1VQ6S 2J0QD 2R9LA 2C28A 3KKFA 2G9OA 3BGUA 2VG5B 3FUYA 3FSYA 3CD7A 2E7VA 5DG9A 3RTVA 4DV5J 3D0GE 4OYAA 4FP9A 3NBPA 2EBEA 2KT5A 1FFGB 3R6LB 2BANA 4RNNA 4LMZA 3QFHA 5DS7A 2AKWB 3UNYA 1BQNA 5HL7Q 5GAGU 4WFBQ 3Q8SB 4CLSA 2MKKA 2DYAA 3ADAC 1U1OA 1YGYA 1N34F 3W61A 2MKSA 2X3GA 3NBPB 5CYQA 3KTQA 5J2QA 3Q8YA 2OMLA 2BANB 3FEZA 3RB3A 2HVHA 1D8ZA 4M63A 3NGRA 4HI1A 5M2PA 2IM0A 4ID8A 5ETSA 3BYPA 3GG1A 4A46A 5GMEA 4NX9A 3CNQP 2DO4A 3FFIA 1WTBA 3EGVA 4LRAA 4FPRA 1O5JA 3TAMA 3U1MA 1F9EB 3I96A 5CYQB 5J2QB 1FEEA 1G3OA 4CLFA 2E1RA 2UUAJ 2C3UA 2DGOA 2VPZB 2UV8A 2GVZA 1VQKS 4B17A 3CCJS 3TAMB 4LQ9A 1QJHA 5LXRA 2FJXA 2HNDA 2YKNA 3CCZA 2FVCA 3ZXWA 3MD3A 2UUBF 3BR9A 1AFJA 4C9DA 3MWBA 1F5BA 2ZH9A 1KEKA 2HSEB 2PN6A 4R5PA 2GVZB 2EC0A 2ILZA 3RR8A 3LAMA 3BGRB 4MK9A 3I9ZA 3DLBA 3WC0A 4GMKA 2NXNA 2HNDB 4K5SA 2YKNB 1RI7A 1FJ7A 4ZVEA 2HWIA 1SQGA 1NM2A 3KUHA 2CNOB 2WVEA 1RTHA 3IA0A 3VGSA 3UWTA 5I3QA 1FXRA 3FBBA 4R5PB 2ZJQQ 1FKOA 4NA2A 4DV7J 4Y00A 5DM6Q 2C3MA 3IAS9 2HHHF 4X65J 3H5YA 1HQ2A 1F5AA 4KGKA 2RT3A 3UO0A 3WX4A 1KD1T 1FKOB 4KHMA 1KWMA 1N5SA 2PIIA 2JL9A 5DDOC 1URNA 1REGX 1QD1A 4ZPBA 2Z2YB 2ZBCA 2XMJA 1JXVA 2GJ2A 1QAJA 1V5VA 3VF0B 2HQFA 1WI8A 4JI0J 1VLYA 3EVMA 4TVAB 1PJ5A 5HROA 5HLFA 1HR0F 3CIZA 4NLTA 4OI2A 4UOFA 4F8RA 4ZPAA 2V8VA 3FSIA 3PR4A 1UL3A 3MMBA 4DR3J 1KQKA 4HDGA 1URRA 2UUCJ 3DRXA 4QU6A 2YTCA 5HROB 3EVWA 2LQ5A 3ZFVA 2VBXA 4N8OA 1TMJA 1DBDA 4C0BA 4X4PA 2W7PA 5L38A 1NHKL 3BSOA 4RNFA 2Q6CA 4QIFA 5FIIA 2AJ0A 2VG6A 2WRMA 2WZ1A 2K2PA 1CJVA 3KJVA 1LWXA 1D0EA 2WONA 1HNIA 1XMOJ 2NLWA 3TVYA 4DQSA 1JLEA 1WHXA 1VC0A 4X62J 1RBOB 1S1XA 4TNOA 1CULA 2VG6B 4WXOA 1OYEA 1UWBA 4RNOA 1KBRA 1IQZA 1M5HA 4ZVHA 2GNKA 1CJVB 3KJVB 4DG1A 3NS7B 1HNIB 2IDLA 3U02A 1ZS6A 3KLFA 4USKA 4BDPA 5CCMA 4J9VA 4C3LA 3WQPA 2WOMA 2LXFA 4DG1B 1PKUA 2FVPA 1I6JA 4K8RA 1DTQA 4A4JA 1S7HA 3RR7A 1PYSB 3AA8A 2J9CA 1NBEB 4Q0BB 4GVBA 3CF5Q 1XNQJ 3N6NA 3ENQA 1WG1A 4DUZJ 1NDCA 1PAUB 4L73A 4NLDA 5LMNF 4O0IA 3JQJA 1DTQB 1TV6B 2VONA 4YDXA 2JHEA 2HHPA 3W65A 2CQ4A 3TW0A 1VQOS 4GVBB 1MROA 1U2FA 3SSRA 2KG1A 3OL6A 1QAIA 2ALZA 4ZVQB 4CM2A 2HBZB 1YBUA 5LJ5Y 4B9VA 3VVUA 2V2QA 3PX0A 5DLFA 4CO3A 3O3LA 1ZA2B 1MROB 2UVVA 4U95A 3GJTB 3AOAA 4C0HA 2HAFA 4KGVB 4UY85 1B7FA 3BS9A 4FVCA 3SQOP 5CHCB 5KFYA 3T41A 2GHVC 3P6YC 2HQIA 2NUHA 4DFKA 2F4VJ 4M5LA 4CO2A 1X5TA 1WHWA 2IHR1 1NDLA 1RWUA 4RW9A 3GFXA 3K57A 2B9XA 2CVIA 2H48B 3C15A 1UA1A 1F0XA 4O3NA 3CCQS 2VIHA 3EX7B 4RW9B 2J76E 1P8GA 2XYHB 1VHIA 3RW6A 4DCPB 3PYDA 2CZ9A 2PI4A 2KJWA 3C15B 3QJPA 3HXMA 1BC6A 4UOCA 5E3CA 5K20B 2FVQA 2HS4A 3OTBA 1XR7A 2XMAA 2QA1A 3M8ZA 2XO6A 2R8JA 2MPUA 3BR8A 4LSZB 1K1QA 1FXLA 3BDPA 5KG3A 1H0HB 3PJXA 4ZCMA 4I67A 2N4CA 4HHHA 1RAEB 2CZVC 3M2VA 4OZ1A 3OFFA 1FTRA 4DR6F 3HJVA 4FS1A 1RT3A 1T9XA 1B99A 2XM3A 2BJ8A 1B3TA 2BE2A 4HHJA 1Q7LB 1WOSA 3OLAA 3KOAA 3QBCA 5IT9U 4DU8A 4V19X 3M2VB 3O8WA 1EP4B 2IBKA 4KHRA 4C2MA 3UW1A 1LWFA 2JFKA 2GIRA 4PWUA 2HEKA 1RT3B 2C1EB 1ZZNA 2DR8A 1FJCA 1FD2A 5DQIA 3LOUA 3NGTA 3DLEA 4N47A 3G86A 4LF6J 1LWFB 2XQCA 2HLUA 1LW2A 3NCQA 1RP5A 2BBEA 2XGQA 3BPSP 3DLEB 4C8ZA 4PZVA 1SC4B 2HVIA 4A8WA 1BE4A 4QYRA 3SCIE 3A8KA 1NSAA 4ED8A 2I0XA 2GVDA 4ZVGA 1QM9A 2RSQA 3PG9A 4X66J 3QZ8A 2EFNA 2FY1A 3DOMA 1LW2B 5L9NA 5AXNA 3RAMA 2PO4A 3OVAA 1VIXA 2Y8WA 2EXUA 2QRRA 3M32A 4USIA 5B0AA 2QV6A 4CH0S 1X8DA 4EYHB 1JLGA 4NLVA 1MNEA 2VQFF 3DOMB 4P2MA 4QPTA 4A8QA 1TL3B 2ZJPQ 3M32B 3QT6A 3HZGA 1RCOB 1HQUA 2DH7A 2CIMA 2OHDA 3H5XA 1JLGB 3KFWX 1KSPA 3NGUA 3J80U 4DR4J 1OPIA 4AQYJ 1JJCB 4CO0A 4DFPA 2OAUA 4QYZJ 1VRTA 2CJQA 1U48A 2BW7A 2D9PA 1HQUB 2YX4A 3IGNA 1S57A 2QA4S 4W90B 3GIKA 2OELA 2QSWA 1I94F 2AYBA 5F9NA 2VDHA 4XK8C 1G4CA 1F9FA 2DTJA 1SKUB 1VRTB 4WU3A 3CPWR 3UCGA 3I5BA 2ZVIA 3VQSA 3BN7A 1M1GA 1WOOA 3RB4A 4MKBA 3ZO7A 2MKIA 4C4WA 3KK2A 1UPMB 1FA0A 4ZKAA 1XJWB 1GX6A 3DKDA 1EZZB 4OYWA 3OL8A 5GADU 1K47A 4LJMA 4RBUA 1RLDA 2DGXA 3FRZA 4ZPWR 5H9FJ 4OX9J 3PYEA 5GVQA 3UDVA 3IWLA 3I56S 3NS6A 4IYQA 3CCVS 4A8XA 1T3NA 2YNHA 4OI1A 2B9YA 3ILOA 3QYYA 1RACB 3P3DA 3NY0A 2CQIA 3RAXA 4WFYA 4YB6A 1BWVA 1S9EB 4HKQA 4IH5A 2EFPA 3HHLC 1I5OB 3EZUA 5KFVA 2YNHB 2R8HA 3R7BB 5F8IA 2N7YA 3SCKE 1BD6A 5AXKA 2H9ZA 1RAOA 2R8KA 2KJVA 4ZVTB 5A76A 5L9XA 1RT2B 3BSAA 4WFXA 2BQRA 4HH0A 3SZ2A 3DOKB 4LIRA 5I3UA 1B0PA 4NA1A 3V6DA 4MJKA 1XBWA 1VC5A 5HJYA 2CFXA 3EICA 3P8BB 4RNMA 3BO4A 1GMWA 3C6TA 1Y5LB 3HK2A 5I3UB 1ZZFA 3J81U 1P9YA 3V6DB 1V3SA 2MZ1A 4KGZB 1U25A 5HBMB 4CLWA 3G82A 1S76D 1HI1A 3POTA 4P6QA 3H5UA 4OLPA 4DR5J 2ZNYA 4NXMJ 4PWDA 1VFJA 2BOAA 2DHHA 2YX7A 3OXLA 3TWZA 4ECVA 3VAKA 4H4KC 4GKKF 3M2UA 3I82A 3PHEA 4OX8A 4HHUA 2AZ1A 3CJ3A 3POTB 3W3SA 4QW9A 2V8GA 3DGPB 5KFSA 3AJDA 3CCUS 3W64A 2KXNB 2D3O1 2PMWA 1NNDA 1FWKA 1UW9A 3DI6A 2LEAA 4F67A 2Q6BA 3R27A 3NWGA 5F9LA 1N5QA 4IQMA 4FBUA 3TNVA 2VBZA 4V19J 4TQRA 5GAGI 4YHHJ 3BO2A 1N5TA 2DY1A 4DL3A 3PR5B 3DI6B 2MY7A 5ETVA 5KFKA 3KWMA 1BXNA 4OL8A 2RRAA 4J37A 2VASA 1RWOB 1NU4A 4I1TA 1JWWA 3EXCX 2IJRA 1RDRA 2B9EA 3HVRA 3CJKA 1OPZA 4Y34A 1Y9OA 1VQ9S 1KKHA 4HT5A 4ZN3A 1P27B 4DV1J 4USWA 3W2VA 1RADB 1IBCB 4I2QA 3LP2A 3P45B 3PEJA 3LPYA 4PR6A 1DHMA 1P1TA 3MMAA 3TA1A 2WBMA 3UN5A 1CJUB 4KR0B 1MN9A 2MYFA 3CJKB 5IC6B 4ENOA 2Z30B 2YH1A 3BGFA 2HS0A 2NS1B 1JLBB 4V1Ak 4FF2A 3ENVA 2IVFB 3PYFA 3MMAB 1R8AA 1T02A 1NSQA 2J7WA 2LQBA 3E51A 4P2FA 4ZPDA 2L41A 2KKHA 1GFWB 1VIOA 3VAFA 2XMUA 4ZS6A 3T1HJ 1YJRA 2HFUA 2DXEA 1A0OB 3W2WA 3IP0A 2R3VA 3ETMA 2F8HA 5E7OB 2AW0A 4ANDA 1HNVA 4NCGB 4J9UE 3I31A 3N9UC 5IZHA 1L3VA 2BR0A 1RCXB 2H5JB 3W2WB 5LL6d 4WE1A 2CJAA 1HNVB 3DRSA 3M30A 3NGSA 4CO5A 3HP6A 5E33A 5KT6A 1TL7A 3X3UA 2V2ZA 1WHYA 2RJZA 1X4GA 3I4HX 5F8GA 4LF5F 4U7UK 2V69A 3ICLA 3Q24A 3EXYA 4WE1B 4O3PA 3ZZRA 2KM8B 3M30B 4DV0J 1IKXB 1TL7B 2C3YA 2JLGA 2RVJA 4F0MA 3PZPA 4CH7A 2RDDA 4BS2A 5CQGA 3EMTA 2IC3B 4IFVA 1VQ8S 2HK3A 2F7VA 2ZH4A 5KG7A 3ZTPA 4LFCJ 3AOCA 4QW8A 2ZBPA 4ILRA 2CNKB 2E1MC 2ZZMA 4Q5VA 4OX7A 4I56A 2FLOA 1WC0A 1S79A 1FHTA 1T3OA 3GR1A 4CLPA 4TU9A 5KFZA 1D9AA 3IBCB 2FHJA 4NMLA 3QZ7A 4C97A 4X2BA 4IFYA 1MW7A 3MR3A 1RQ0A 3VQTA 1ACMB 2MTLA 1S4EA 2X1BA 1QUPA 4OHYA 1RAJA
chains in the Genus database with same CATH topology
2CJXB 2HBRB 2Y1LB 3KJNB 2XZTB 2CNOB 2XYGB 3EDQB 2QLFB 2DKOB 2H54B 1RHUB 5IC6B 1RWPB 4ZVTB 2QL9B 3GJRB 1SC3B 4ZVUB 1NMEB 1BMQB 2H48B 3RJMB 3GJQB 2CDRB 3D6MB 2C2KB 3R6GB 2C2OB 1F9EB 1RWXB 2XZDB 1I51B 5IC4B 1RWMB 3R5JB 1RWKB 1PAUB 2HBYB 3SIPB 3R7SB 2Y0BB 2H51B 3R7NB 1GFWB 4JB8B 4ZVOB 2H4YB 3KJFB 2C1EB 2XYHB 2H65B 1RWVB 4DCPB 2CNNB 4DCOB 4ZVPB 1RWWB 2CNKB 3GJSB 3D6HB 1RHQB 2CJYB 4ZVRB 1I3OB 1RHMB 2CNLB 1RHRB 2QL7B 3EDRB 2FQQB 4ZVSB 1RWOB 3IBFB 3KJQB 2XYPB 4ZVQB 1QTNB 2HBZB 2H5IB 1RHJB 1PYOB 5K20B 2H4WB 4DCJB 2C2MB 3IBCB 2HBQB 2C2ZB 1SC1B 2H5JB 1QDUB 3QNWB 3R6LB 3NS7B 3GJTB 1ICEB 1RWNB 1RE1B 2QL5B 3D6FB 4LSZB 1IBCB 3P4UB 1RHKB 2QLJB 1SC4B 3R7BB 3P45B 2P2CB 2QLBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJX B;  2HBR B;  2Y1L B;  3KJN B;  2XZT B;  2CNO B;  2XYG B;  3EDQ B;  2QLF B;  2DKO B;  2H54 B;  1RHU B;  5IC6 B;  1RWP B;  4ZVT B;  2QL9 B;  3GJR B;  1SC3 B;  4ZVU B;  1NME B;  1BMQ B;  2H48 B;  3RJM B;  3GJQ B;  2CDR B;  3D6M B;  2C2K B;  3R6G B;  2C2O B;  1F9E B;  1RWX B;  2XZD B;  1I51 B;  5IC4 B;  1RWM B;  3R5J B;  1RWK B;  1PAU B;  2HBY B;  3SIP B;  3R7S B;  2Y0B B;  2H51 B;  3R7N B;  1GFW B;  4JB8 B;  4ZVO B;  2H4Y B;  3KJF B;  2C1E B;  2XYH B;  2H65 B;  1RWV B;  4DCP B;  2CNN B;  4DCO B;  4ZVP B;  1RWW B;  2CNK B;  3GJS B;  3D6H B;  1RHQ B;  2CJY B;  4ZVR B;  1I3O B;  1RHM B;  2CNL B;  1RHR B;  2QL7 B;  3EDR B;  2FQQ B;  4ZVS B;  1RWO B;  3IBF B;  3KJQ B;  2XYP B;  4ZVQ B;  1QTN B;  2HBZ B;  2H5I B;  1RHJ B;  1PYO B;  5K20 B;  2H4W B;  4DCJ B;  2C2M B;  3IBC B;  2HBQ B;  2C2Z B;  1SC1 B;  2H5J B;  1QDU B;  3QNW B;  3R6L B;  3NS7 B;  3GJT B;  1ICE B;  1RWN B;  1RE1 B;  2QL5 B;  3D6F B;  4LSZ B;  1IBC B;  3P4U B;  1RHK B;  2QLJ B;  1SC4 B;  3R7B B;  3P45 B;  2P2C B;  2QLB B; 
#chains in the Genus database with same CATH topology
 5K14 A;  4AYB D;  1AT1 B;  4W4M A;  4USV A;  1U0H B;  4IFY B;  2IMW P;  2YPZ A;  2G0I A;  3LAK A;  4HEA 9;  2WTF A;  2J0W A;  4U67 Q;  2J9D A;  3QGI A;  2PFD A;  3AHP A;  1VRU B;  2DH8 A;  2B4P A;  3PEH A;  1VDH A;  2G2Y A;  2A2D A;  5K14 B;  2C2O B;  1Q82 T;  3GSI A;  1Z2Z A;  3JSM A;  5ETQ A;  4ELV A;  3FZ2 A;  3W60 A;  2HHW A;  2QZ8 A;  1UZD A;  1U09 A;  1KC8 T;  5J2N A;  5LT5 A;  3GCX P;  2DK2 A;  4PG8 A;  5HJX A;  3JSM B;  1KVJ A;  1P6T A;  3BYR A;  1WOR A;  2DGS A;  5IFM A;  2PA8 D;  1MG7 A;  3OPK A;  1RTI B;  5EWE A;  2N7C A;  5SUH A;  4ANC A;  2J6T A;  2P9C A;  1D9D A;  1VBY A;  2HMI A;  4ZIV A;  3ONQ A;  1RZM A;  5ADZ A;  2ZC4 A;  3BQ1 A;  3KHR A;  4EK2 A;  4P10 A;  4CLT A;  1PJ6 A;  4LR8 A;  1FNO A;  3NGD A;  1UAW A;  1S12 A;  2HMI B;  1RJJ A;  2YWE A;  3GFZ A;  3M9O B;  3EGZ A;  3S6E A;  3OTE A;  1OQ6 A;  4TY9 A;  3G2X A;  2PEB A;  3D7S B;  4DMZ A;  4YB5 A;  4CI0 B;  1XC9 A;  4KBI A;  3ZZ0 A;  2X1F A;  3PIP Q;  3WC2 A;  1ZAV A;  4F3M A;  5KG1 A;  2B0G A;  4DR6 J;  4OV1 A;  4JBC A;  4X4R A;  5B0B A;  3J81 j;  7FD1 A;  2L9N A;  3H42 A;  4GC7 A;  2ZH5 A;  1VIS A;  3I32 A;  4NPO A;  1M0S A;  2YBV A;  3HHE A;  4DLG A;  1BHN A;  1YHQ S;  2NXC A;  2DNP A;  1FJG F;  4L76 A;  5DGB A;  2B7C B;  4LRF A;  2FB0 A;  2P8I A;  2MGZ A;  2R8I A;  4M5G A;  1VBK A;  4Y2I A;  3H4D A;  2YVS A;  3DDK A;  5E5N A;  2BA9 A;  1C1C A;  3DRR A;  3HKW A;  1FFS B;  1WG4 A;  1JLQ B;  3LWM A;  4J9M A;  1LW0 A;  1PCA A;  2OSQ A;  2UXC J;  4EZ6 A;  2GAH C;  3QFW A;  4RLE A;  2AJF E;  2DXF A;  2OTL S;  4AD6 A;  5HVF A;  1UWA A;  1S49 A;  3DRR B;  3W5X A;  5E3Q A;  3SIP B;  3UDE A;  1LW0 B;  4O23 A;  3M8P B;  3CJ5 A;  4DSL A;  2Z56 B;  4NZ7 A;  1U2R A;  5AXM A;  2ZM6 F;  2QX0 A;  3KNG A;  3N5F A;  3WBZ A;  1NKB A;  3PFE A;  2CXE A;  3GQC A;  1UJ4 A;  1N36 F;  1Q8I A;  1RHJ B;  4HI2 A;  1VJQ A;  1CQM A;  1C1B A;  4NYO A;  4DV6 J;  1ARO P;  2W9B B;  3NNH A;  3NCP A;  2PE8 A;  1F5C A;  1RYR A;  2VQF J;  1S6Q B;  1MWY A;  2IAJ B;  3D54 A;  4K2J A;  2DHA A;  1C1B B;  2CRL A;  1IM4 A;  5A8K B;  2QLX A;  1S1V A;  2KH9 A;  1RIS A;  2OEK A;  4BWM A;  1KVK A;  2OPQ A;  2DHS A;  1T95 A;  4WFZ A;  6FDR A;  2K1R B;  4PAA A;  1S1V B;  2DHG A;  2QEX S;  4TLQ A;  2E9Z A;  4U7C A;  4H54 A;  2JDJ A;  1I94 J;  1WEX A;  1Q1K A;  4AT1 B;  4PRF A;  3H20 A;  2K06 A;  3HPO A;  4LSL A;  4HL9 A;  1W2B R;  1UFW A;  2VQE J;  4I2P B;  5KT4 A;  3HVT A;  1K0V A;  3PW0 A;  3CE8 A;  4RX6 A;  2I1R A;  4DQQ A;  5FD1 A;  4OJ1 A;  4ECX A;  4TU7 A;  5CAA A;  3Q23 A;  2B4U A;  2IJF A;  5E3R A;  2QLJ B;  1IBK J;  4F0H A;  2CG8 A;  4LSL B;  5HK4 A;  4F4Z A;  3TJ8 A;  1VK8 A;  2DNM A;  5EX3 A;  1Z4U A;  5I4M A;  3D66 A;  5ETP A;  2EKN A;  3V4M A;  2BJE A;  2J9D E;  4ED1 A;  5HVG A;  5BJR A;  2EEY A;  1RKI A;  2JLE A;  4DPY A;  5C2C A;  2BZ2 A;  2J6S A;  4CT8 A;  1YRU A;  2AWZ A;  2DBB A;  5HAO A;  2KT3 A;  1K8A T;  5KFQ A;  4JI1 F;  1R0B G;  1ZM9 A;  2N3L A;  1JXE A;  3AB4 B;  1YTY A;  5A8R A;  2BAB A;  3VGU A;  2DT9 A;  2IRU A;  1C4C A;  3O2I A;  1PGZ A;  2UXD J;  4M5D A;  1W2I A;  4OYM A;  5JMN A;  2PDA A;  1U1R A;  3KJQ B;  2EWH A;  3H25 A;  4CDI A;  2FJA B;  2ZBI A;  4H4M A;  2XY5 A;  3JYT A;  1YRT A;  2W4P A;  2CQ1 A;  2KZZ A;  4WCE Q;  3C46 A;  4RPF A;  4E98 A;  3MTJ A;  4PAB A;  4M5D B;  3P4U B;  1NLK L;  2OJ3 A;  1ZOT A;  3JTP A;  4CTA A;  3KHG A;  4RWW A;  3ZZY A;  2FC9 A;  3JYT B;  2LCW A;  3Q0A A;  1NKC A;  3OFG A;  4B3R F;  1V3R A;  2GZO A;  3MCM A;  3CT9 A;  2F65 A;  3H2V E;  3TRG A;  1SJF A;  1S10 A;  3NLC A;  4UUX A;  4RU2 A;  4CTA B;  4IR1 A;  3M2R B;  2XLK A;  3K5L A;  3R1L A;  1IN0 A;  2AQ4 A;  2L3M A;  4KGM A;  4GKK J;  2XMW A;  4P75 A;  3G6V A;  3FEY B;  1SJ4 P;  3CDU A;  2COL A;  2Q3P A;  4DR2 F;  1C4A A;  2GS8 A;  2CJY B;  4KRW A;  4S0M A;  2IYG A;  1LQ9 A;  2XSJ A;  2M4M A;  1FKP B;  3A8I A;  1AYE A;  2UU9 J;  4F36 A;  5EWG A;  3IGV A;  3LH2 S;  3HMJ G;  3ET6 A;  4RW4 A;  1PAE X;  4HDH A;  4ECY A;  2GFF A;  4A8S A;  4NLR A;  3L95 X;  4X64 J;  2XSJ B;  3KMQ A;  1FE4 A;  2MKY A;  2D3O R;  3GMG A;  2DD8 S;  2I8E A;  4JOU A;  4P9S A;  3H2L A;  3VGT A;  2WSE C;  5KOX A;  4RW4 B;  4CRJ A;  3TZX A;  1NJX A;  4JI3 J;  4FXD A;  4C8Y A;  1OO0 B;  3LGN A;  3ZZZ A;  4DQP A;  1Q78 A;  4OIX A;  5KT5 A;  3DC2 A;  4ES1 A;  4I6Y A;  2NXU A;  4K4U A;  4RNH A;  2AEF A;  5MLC V;  3PRV A;  2KZM A;  2C2K B;  4PXB A;  3ZZO A;  2KYZ A;  2XZD B;  4IOB A;  1UJ6 A;  3W7B A;  1SUQ A;  4LBP A;  1R89 A;  4DR7 F;  1EB0 A;  5HQL A;  4ZVP B;  1VQ5 S;  3UD5 A;  4OZJ A;  2XLI A;  2QL7 B;  4F4K A;  1R31 A;  1LNQ A;  3JQM A;  1HBN B;  4JV1 A;  1UKU A;  5ETN A;  3QRR A;  4NLS A;  3SCL E;  4UOG A;  4JV5 F;  1QE1 A;  2ZH1 A;  2JVO A;  4NEY A;  4OHX A;  1NDP A;  2PMH A;  2IVY A;  3OT9 A;  2WVD A;  1UVI A;  2UXB F;  2YWW A;  2BKN A;  1OYD A;  3V6J A;  2CJB A;  5J1E A;  1WTF A;  3UFC X;  1N5Y A;  1QE1 B;  2HNZ A;  2D9O A;  4C0O C;  2LEC A;  2AV5 A;  4WZQ A;  4M5I A;  1TEL A;  4FYD A;  4ZVU B;  3MEE A;  4Q8F A;  2BMB A;  1NJY A;  5IM0 A;  1APS A;  5J1E B;  5HVH A;  1XNR J;  3Q86 A;  1N5Y B;  1WEY A;  2HNZ B;  1TK0 A;  4C8N A;  4ZVF A;  3U7J A;  3R5D A;  2O1P A;  2XO7 A;  1KR4 A;  2IBO A;  4LF7 F;  4ZJL A;  1RWV B;  2OO4 A;  3GR0 A;  4EBE A;  1NB7 A;  4XAK A;  5C2G A;  1X9M A;  3I0S A;  2CQ3 A;  2OKQ A;  4LFA F;  3R3T A;  4OJG A;  4DL5 A;  3J7Z T;  1DQA A;  1HMV B;  1H7X A;  4IUF A;  5JVH Q;  1NPK A;  1TK8 A;  4CYU A;  1H73 A;  1MLA A;  2N4D A;  3K2Y A;  4OYX A;  2XC9 A;  2CJX B;  3TO8 A;  1E6V B;  4DF8 A;  4CLZ A;  2HFS A;  1S9G A;  3K7R A;  2G0J A;  1U26 A;  1RHU B;  2CVE A;  1L5U A;  1EHW A;  1U1M A;  3KLE B;  4CYU B;  1VRQ C;  4IDK B;  5IWA F;  4LF9 F;  3Q8P B;  3VGV A;  2LMI A;  2XHW A;  1YI2 S;  3C6U A;  1H2T Z;  1S9G B;  1FE0 A;  1N6Q A;  1SKS A;  4DEZ A;  2YH0 A;  3OXF A;  4MFB A;  1ZM4 A;  2H65 B;  1TZ0 A;  1RWW B;  4FDF A;  4JYA J;  5C42 A;  1HNZ F;  2XY6 A;  2KXH A;  1U6B A;  1FI4 A;  1VHF A;  5KFD A;  1XWL A;  3MHY A;  3SBM A;  1F3V A;  3C8Y A;  4ZA1 A;  1RAI B;  3C6U B;  3RW7 A;  4CO1 A;  3SDE A;  2JFD A;  1N6Q B;  2Z2L A;  4YR0 A;  1B64 A;  5KFN A;  3PRD A;  2BE9 B;  3T9Z A;  5C42 B;  4X4O A;  4ECU A;  3BN4 A;  1VQ4 S;  1U1K A;  2VJU A;  2Z8Q A;  3CED A;  3SDE B;  3CJ4 A;  2HHQ A;  4G1Q A;  4QWA A;  5E3A A;  3THP A;  3MAA B;  3VWS A;  4N41 A;  3UD3 P;  2FVS A;  3A1Y G;  3H5S A;  5IS2 A;  5CD4 A;  3SEO A;  4HT7 A;  4N8N A;  4HLB A;  1S6O A;  2CPJ A;  3HUL A;  5LMU J;  5J2P A;  4G1Q B;  1HBM A;  1IBL F;  2R7W A;  4UF4 A;  1S77 D;  3DLL Q;  3H59 A;  5GAH U;  1VBX A;  1HHT P;  3RB6 A;  2G4B A;  4Q43 A;  3NEK A;  1GTH A;  1RTD B;  1O6X A;  2VPY B;  2X3D A;  1SIW B;  3B8H A;  2J6U A;  5J2P B;  5D8H B;  1TKX A;  2KG0 A;  3IAM 9;  3M1V A;  1HBM B;  3K8W A;  2ZD1 B;  4PG6 A;  3OTO F;  1QTN B;  2XB2 D;  1PBA A;  3DLG A;  4LBH A;  1U2C A;  4GVL A;  1R0C B;  4RZR A;  2A3J A;  4KFB A;  3BSC A;  3FCW A;  1OY9 A;  2VDI A;  3LPE A;  3BO3 A;  1TKX B;  4RJV A;  3M1V B;  4HR2 A;  3W9J A;  3LA0 A;  4KGX B;  2PC6 A;  3DLG B;  2D7S A;  3GIL A;  4DN0 A;  4KFB B;  4J9L A;  4QIW D;  4OZ0 A;  4BC7 A;  2H54 B;  3UVJ A;  2ZH2 A;  3IXQ A;  1U4B A;  4DR1 F;  3B6B A;  3QO9 A;  1XK8 A;  4YN3 B;  2QL9 B;  2CPZ A;  5HI7 A;  1FWP A;  1NEE A;  4K0K F;  4O44 B;  4CT9 A;  4ZLN A;  1IKW A;  1X9W A;  4B3T F;  3IS9 A;  4DPW A;  4URQ U;  1HWL A;  2M0G B;  2EW9 A;  3UVJ B;  3JS9 A;  2R2U A;  2B6A B;  4DL6 A;  1FJG J;  3QO9 B;  2OGU A;  3D9B A;  1RAH B;  4YOE A;  4ZIW A;  2ROG A;  4GC6 A;  2DB1 A;  5D6G A;  3IS9 B;  5KTQ A;  4ZOS A;  5E41 A;  4U7U D;  3KK3 A;  5D0H A;  3LAL A;  2RUS A;  4LIW A;  1YJU A;  2ZE2 B;  4TXS A;  1TK5 A;  2FPH X;  1EET A;  4NYZ A;  1J5E J;  3TX8 A;  2QA2 A;  4DQI A;  3MF5 A;  1MSW D;  4NLO A;  3T1Y J;  4PCQ A;  1YJ9 S;  5KFU A;  3QLH A;  1HNX F;  4JI8 J;  1BLU A;  1HWI A;  4O3O A;  1X5P A;  3KK3 B;  4GRS A;  1Q53 A;  1T9V A;  4A47 A;  3W63 A;  5H1S V;  1LWC A;  2HRY A;  3PO4 A;  4UW2 A;  2HK2 A;  2VZ9 A;  3QAE A;  3QLH B;  4NA3 A;  5KFT A;  3TQ1 A;  1N5V A;  2IM1 A;  3AXM A;  2B3T B;  4MIW A;  2VC0 A;  2DNR A;  4LFB F;  4LF8 F;  2ATC B;  2UVW A;  2GHW A;  1LWC B;  4Y0F A;  3MZI A;  1KFD A;  3BH6 B;  5DO2 A;  1FRK A;  4DJB A;  4ZLL A;  4B3M F;  1IVZ A;  2CJK A;  2ZHO A;  4P2X A;  3J7Y U;  2Q43 A;  4N76 A;  2BOP A;  2VF3 A;  3MMC A;  2ZH7 A;  5T7L A;  4ZP6 A;  4X4Q A;  1UVJ A;  2QGF B;  1FX4 A;  5HN0 A;  4XDD A;  4ZVS B;  4Y28 C;  3MOZ A;  1ZA1 B;  1FT8 A;  4DLE A;  1VCT A;  4QJV A;  1ULR A;  4M5H A;  3MMC B;  3KK1 A;  3VZI A;  4O3Q A;  2EG1 A;  1OSD A;  4UZB A;  4K4Z A;  4WKY A;  2HS3 A;  4EO8 A;  2N3O A;  2V68 A;  2LA4 A;  1K0T A;  2VU5 A;  3ZZP A;  4XDC A;  3JXO A;  5LM7 E;  3KLH A;  1N52 B;  3M8W A;  1ZM2 A;  2JRS A;  2J0X A;  2UZA A;  3CJ2 A;  1GTE A;  3KK1 B;  2MJN A;  4X4U A;  2WW8 A;  1HWU A;  2AU0 A;  2KVQ E;  2CA9 A;  4XTT A;  3IR5 B;  3EVO A;  2V8P A;  2OSR A;  2I6W A;  4ECR A;  3CWJ A;  1WAC A;  2VPX B;  1F60 B;  2OD6 A;  2V63 A;  4IG3 A;  3BKT A;  3KLH B;  3EYZ A;  1G2E A;  2ZHA A;  3QID A;  3AJ2 A;  2FZG B;  2DH9 A;  1UVM A;  3B54 A;  2G13 A;  4KYZ A;  3MXH P;  1RAA B;  4ZIT A;  3JAM Y;  2J8A A;  3EUN A;  4G6V B;  5E0O A;  2AP6 A;  2P6T A;  4CH1 A;  3GV7 B;  4ILM A;  3D1Q A;  3FJ2 A;  4ID5 A;  5DM7 Q;  1WWH A;  4JI1 J;  2ZDO A;  2OP5 A;  3VV2 B;  2FHK A;  3PW7 A;  2CQ2 A;  3V81 B;  1NK8 A;  4YY3 F;  1T9U A;  4Q7A A;  2DGW A;  2JEI A;  4MYT A;  1C0U A;  4QIE A;  3VVT A;  3PW4 A;  2ROP A;  4LVN P;  3R6G B;  1VC6 A;  1RU2 A;  1AXQ A;  2IFX A;  2RF2 A;  3G4S S;  2XZW A;  2V9K A;  2OPS B;  5CAB A;  3NP5 A;  2NXJ A;  3KJF B;  2PMZ D;  3MUT P;  2YQ1 A;  3GV8 B;  3TOQ A;  1C0U B;  1HPZ A;  4GKJ J;  2AJ1 A;  4MK7 A;  2HQD A;  2ZH6 A;  2RF2 B;  4B3R J;  2HRT A;  3HFZ B;  1YDL A;  4KHP F;  3W8G A;  2QC3 A;  1Y5N B;  1X60 A;  1IKV B;  3BF4 A;  1HPZ B;  3NCR A;  4OHV A;  3GYG A;  3FSX A;  2PI5 A;  2R7U A;  1U02 A;  2IVM A;  1NK0 A;  1EAR A;  3CDB A;  5AE2 A;  4ZCI A;  5FDL A;  4LRB A;  1IJE B;  3AB2 B;  1QSY A;  5ETT A;  3HF5 A;  3HFV A;  3NNC A;  1SI9 A;  3TYT A;  2XLJ A;  4DSK A;  1GK8 A;  3M9N B;  3D6M B;  2MLZ A;  1R27 B;  1QLN A;  1EKS A;  3BBC A;  1L3U A;  3VAM A;  2R7R A;  5FDL B;  4UZC A;  4YP3 A;  2LFV A;  2F8E X;  4ICL A;  5CA5 A;  1U7L A;  3QWP A;  1NJZ A;  2MXY A;  3DU5 A;  3VAH A;  2P9G A;  2F9J A;  1RTZ A;  2VIC A;  5B09 A;  3HM9 A;  1TUV A;  2ZC3 A;  5KG6 A;  5JJB A;  2EI5 A;  2HVD A;  4C3K A;  4O4R A;  5A2Q U;  4ICL B;  2EFQ A;  5BR8 F;  3MAH A;  1FNM A;  3FBE A;  4DSI A;  4ES2 A;  2Q1L A;  1UA0 A;  5AJ3 F;  2ZUA A;  2V50 A;  1KFS A;  2Y9H A;  1RTJ A;  2HYI B;  3WDO A;  4L74 A;  2JEF A;  4PPD A;  3M7V A;  2FDN A;  2OLW A;  1BQN B;  4DR7 J;  1XR6 A;  4NI2 A;  2HWH A;  2HZA A;  3EPI A;  2XI2 A;  5GAE U;  2G2Z A;  2MLX A;  4KJI A;  4DPX A;  2AX0 A;  5EDW A;  2M9K A;  2XMM A;  2RQ4 A;  5KT2 A;  2HQG A;  3CJS A;  1IBM F;  3BGO P;  4I69 A;  3FFI B;  4NI2 B;  4JV5 J;  5JUM A;  4M5K A;  1SC6 A;  2E5J A;  4NLY A;  3OL9 A;  4F02 A;  3B4D A;  2E5L F;  4JI2 J;  2UXB J;  2F40 A;  3O5T B;  4KV8 A;  1RT4 A;  2KL8 A;  3TQE A;  3U27 A;  2MKJ A;  1K1S A;  5DLG A;  4F0K A;  2O3D A;  5KFB A;  1FDN A;  2WBR A;  5C25 A;  3RU0 A;  2XGP A;  3JAM U;  2DNH A;  1SQE A;  4KO0 A;  3BBF A;  3MR5 A;  5C24 A;  4ZN1 A;  2LXU A;  4KV8 B;  1RT4 B;  3MFH A;  4OQJ A;  1QVG R;  5C25 B;  2DNQ A;  2DRB A;  1SPB P;  1JKH A;  1OWX A;  4M5M A;  2FGO A;  5C24 B;  3G96 A;  4ITS A;  2DNN A;  4OJ3 A;  1RTH B;  3ETO A;  2QLF B;  5B0G A;  4CCH A;  1H2V Z;  1UVK A;  3N79 A;  3D1O A;  3PFO A;  4F04 B;  3HT0 A;  1KDN A;  2MZQ A;  1JKH B;  5IV3 A;  1YJV A;  2QYG A;  4K4W A;  2OEJ A;  2VOD A;  2CWX A;  4PXC A;  3NWR A;  1IR1 A;  2ACM A;  1EX8 A;  4NEZ A;  5J2M A;  1RT7 A;  1U6F A;  4ED7 A;  5F8J A;  4B3S F;  2WVF A;  4Z2X A;  4UQG A;  8AT1 B;  3PX6 A;  1LXN A;  4DX8 H;  1RAB B;  3BRE A;  3B78 A;  5DG7 A;  1OQ3 A;  3BKF A;  1WSR A;  1S6P A;  3CO0 P;  3OUY A;  1AW0 A;  2DR9 A;  1WEZ A;  2HIY A;  5J2M B;  3TA0 A;  3PY8 A;  4KPC A;  1FKA F;  3RBD A;  1D09 B;  3OFE A;  4ED4 A;  5HLF B;  5ETL A;  1S6P B;  3TZW A;  2UVR A;  5EHH A;  4ECZ A;  3OUY B;  5J1N A;  2A0F B;  2G2O A;  3MMB B;  4W92 B;  1RA7 A;  4LR9 A;  2BVZ A;  3AAW B;  5IT9 Y;  1HNZ J;  3D0I E;  2MQO A;  3QMQ A;  1YQH A;  5DQH A;  2W2M P;  1HD1 A;  2M2B A;  4DUY F;  3LO3 A;  2B51 A;  2E29 A;  3HCX A;  2RIL A;  1JMT A;  4DL2 A;  1HLW A;  4IRK A;  1N33 J;  2C3O A;  5FLX Y;  1JJH A;  2B4O A;  3BV8 A;  3SSS A;  2V2V A;  2RRN A;  4F2R A;  2X1A A;  4ES3 A;  5MAO A;  2XS2 A;  1Y4Z B;  4G1I A;  3G8S A;  4DSF A;  2WON B;  1V9O A;  3EM1 A;  3C14 A;  3V6K A;  1GQE A;  5KFL A;  2WK4 A;  1JLE B;  1FFW B;  4DXL A;  3R1H A;  1S1X B;  2K8G A;  1CUL B;  2JWN A;  1UWB B;  1PBU A;  5EX0 A;  4YME A;  2XMV A;  1RT1 A;  2EVZ A;  1IBL J;  1S48 A;  2MMY A;  2AT1 B;  2GCF A;  2R7T A;  4L3N A;  2RDI A;  2CYY A;  4RUB A;  4X65 F;  3KLF B;  2XMK A;  5A6P A;  3P5T L;  3UPF A;  4QBU A;  2HKE A;  2Y1L B;  1NUE A;  2JZ5 A;  3ILJ A;  1DAR A;  2DNK A;  1XMB A;  2YXL A;  2WOM B;  1RT1 B;  3D68 A;  2AGO A;  2VL1 A;  2WSF C;  1PO6 A;  3NOC A;  1YK9 A;  3R97 A;  1MMN A;  3R5G A;  2ZH3 A;  2DRD A;  2MZR A;  2CQD A;  3MEG A;  2RB7 A;  5ETK A;  4DSJ A;  2PEH A;  1CPZ A;  3ZZU A;  3MPY A;  3PV8 A;  1ZAW A;  4U96 A;  3KYL A;  1LFP A;  5KG5 A;  4YR3 A;  5KAK A;  3R7S B;  3HVW A;  1YBT A;  3FBF A;  1VLO A;  3J80 Y;  3VAI A;  4DV4 F;  4KIA A;  1NPR A;  4DCO B;  4JI0 F;  2GAG C;  3MEG B;  2DCU B;  1NJW A;  2ZVS A;  2W01 A;  1Q5V A;  3EDR B;  2XYP B;  2ZFH A;  2VPW B;  5L46 A;  4DR3 F;  3P96 A;  4K0K J;  1M1K T;  3Q2S C;  2MLY A;  2NXE A;  4MIA A;  2UUC F;  4LF4 F;  2GIF A;  4WTY A;  3TAP A;  4CNZ A;  3I5A A;  2DIT A;  1WOP A;  3LGH A;  4FF3 A;  1M5P C;  2B5J A;  4URS A;  1MU2 A;  1FER A;  1YZ6 A;  4RL1 A;  3GSD A;  4KTQ A;  3AQO A;  2GA7 A;  2YX1 A;  1TL4 A;  4DZD A;  1N32 F;  2LQ8 A;  4LSN A;  3ENA A;  1XMO F;  4E0D A;  2LDI A;  2J7K A;  3OR1 A;  1D3W A;  1KLM A;  4TYB A;  3QWU A;  2HIQ A;  2MB0 B;  3R2C J;  4X62 F;  1HNX J;  2B5J B;  1Q5Y A;  1MU2 B;  3JTN A;  4RW7 A;  2MQ8 A;  4O3S A;  3C3L A;  4FPI A;  1VR6 A;  3MCO A;  1UVN A;  4USM A;  2MY8 A;  3A3N B;  2RHQ B;  2NZC A;  4LSN B;  3GJS B;  3H7H B;  1N4L A;  1TKD A;  3LGM A;  4U8Y A;  2QSF A;  1TKT A;  4L6V 3;  2E1P A;  2RNE A;  2VBY A;  5DJB A;  2VH7 A;  5I42 A;  2DNL A;  4RW7 B;  1PG5 B;  4USJ C;  2BM0 A;  3CC7 S;  4RUA A;  1A9N B;  3D2W A;  1F9H A;  4TQS A;  2EFG A;  4HAC A;  3CGI A;  1TKT B;  3QT7 A;  4GO7 X;  4O4G A;  3OJS A;  4B3M J;  2R7O A;  2UVU A;  2MZJ A;  2RD5 C;  2XWY A;  2AJ2 A;  4DUZ F;  2XYG B;  4RUC A;  3VAL A;  2QFI A;  2YNI A;  1U1P A;  2VKR A;  2AMC B;  4LVO P;  5IQQ A;  1LK7 A;  2DPI A;  4DX5 A;  4K4S A;  2BJ9 A;  2QG9 B;  2DNO A;  4F2S A;  4J9N A;  2BE2 B;  4MKV A;  4NLX A;  1D1U A;  1YLX A;  4QWE A;  2AZ3 A;  2VFV A;  2W8L A;  3J81 Y;  2J0S D;  5FLX U;  4C8M A;  4JB8 B;  3CJQ A;  1T05 A;  4M5N A;  5D4N A;  3KUG A;  2Y1R I;  3FGV A;  3FNN A;  5C7P A;  2YWF A;  3S1T A;  4OMF G;  2XCA A;  3UQS A;  1FRJ A;  3KLV A;  4J9S A;  1ELO A;  1Y3K A;  3RZA A;  3R8Y A;  4HTJ A;  1NB2 A;  5LSR A;  1T05 B;  5IT4 A;  2F4V F;  3MM8 A;  5D77 A;  2V94 A;  3GTY X;  5CZX A;  3SV3 A;  3SXL A;  3UR0 A;  2EBG A;  3PX4 A;  2YWH A;  2IM3 A;  2CWK A;  4Y65 A;  5I3P A;  1AB8 A;  2CUY A;  3CO9 A;  2C3P A;  5BYS A;  4P72 A;  1JX4 A;  3NL0 A;  4B9N A;  2V0N A;  1JNZ B;  2GVD B;  3AXK A;  1RB0 A;  3G6Y A;  3RAQ A;  2OH2 A;  3QIP A;  2B7B B;  4ELT A;  3MMJ A;  3SV4 A;  4FYW B;  3HJF A;  2FLP A;  2HFN A;  2BDP A;  2ZIT A;  4PPZ A;  1R8C A;  1BMQ B;  1FXD A;  2YQ0 A;  4PYA A;  3ENW A;  2QMU B;  3QIP B;  1WC4 A;  3QPI A;  3H90 A;  2HPU A;  2KTQ A;  4KKO A;  4Q45 A;  1N88 A;  2ZWO A;  3ISZ A;  2O01 C;  2KYX A;  5T41 A;  1VQP S;  2V4J A;  4QWC A;  2RUG A;  2VFR A;  4OYB A;  2BRK A;  3IC1 A;  1FTC A;  3GB0 A;  1WKK A;  5GMD A;  5DGA A;  2V4Q A;  2H4W B;  3H0P A;  1NK9 A;  5KG0 A;  1R6Y A;  4PEO A;  2BX6 A;  4IRD A;  3R9L A;  2AGP A;  4N5S A;  1ZAX A;  2LVW A;  2M8D B;  4ZP9 A;  4WF9 Q;  2V4J B;  2W2O P;  2QMW A;  2DEJ A;  4PQU A;  2XHC A;  2WB4 A;  2RE1 A;  2V8H A;  2NSB A;  2ZBQ A;  3OJU A;  3O6Q A;  3I6P A;  3IFE A;  2XS7 A;  3CCR S;  2KFN A;  3GPA A;  4WYL A;  9RUB A;  1FRH A;  2RS2 A;  4C3M A;  3PJ9 A;  2K3I A;  3GJR B;  4PQU B;  4BBY A;  1RK8 A;  4B02 A;  3RJM B;  3KK2 B;  3R5A A;  4YDD B;  2HHS A;  4MKY A;  2I5J A;  4RU9 A;  1KHV A;  3HHL D;  4NZ6 A;  2E7W A;  2VG7 A;  4LF6 F;  4Y6I A;  2PSZ A;  3OLB A;  3OR2 A;  1TUW A;  2R7S A;  5EWF A;  4DV2 J;  3DMJ A;  3CXC R;  1IKY A;  2DXD A;  3G87 A;  1SQF A;  1RAG B;  3DLK A;  2HNY A;  2I5J B;  1F6T A;  2X51 A;  4URG A;  4DZ6 A;  2VG7 B;  1FRI A;  3F73 A;  3OFH A;  1XMQ J;  2MZT A;  4NAS A;  3OR2 B;  1S6U A;  4DFM A;  4X66 F;  1M90 T;  3DMJ B;  2PA3 A;  4FYY B;  2A10 A;  7FDR A;  1X31 C;  2HNY B;  1HBU A;  2CQP A;  3CVK A;  1G7C B;  3MUR P;  4OJH A;  3CC2 S;  5A8W A;  4DFJ A;  3PRB A;  2UP1 A;  3GE9 A;  5CYJ A;  8RUC A;  5BYQ A;  5FJ4 A;  4DS4 A;  4ZDN A;  3G71 S;  4NLP A;  2NRE A;  2VB6 A;  3R5B A;  3CDA A;  3O44 A;  2LEB A;  1N34 J;  4FZV A;  5U47 A;  4TKT A;  2MHN A;  4WP3 A;  2EK6 A;  4DR4 F;  1DTT A;  4AQY F;  5IOL A;  3L4B C;  3R5C A;  4IG0 A;  3DCA A;  3GIM A;  4UOH A;  4K2X A;  4LRD A;  4J5O A;  4NOH A;  3C6T B;  1HI0 P;  2DGQ A;  1HD0 A;  2U2F A;  1Y5I B;  2FQQ B;  3EZO A;  4I7F A;  1TUG B;  2YKQ A;  3G82 B;  1CVJ A;  2O67 A;  2VC1 A;  3KMS A;  4DCJ B;  2ABY A;  2LP4 A;  2EC2 A;  3CJR A;  4IG0 B;  3W66 A;  4K4X A;  1RLC L;  3UR3 C;  1NXI A;  2WHO A;  4F4Y A;  4PWD B;  4YR2 A;  2OD4 A;  3A3P B;  4ZLP A;  4MT1 A;  2HVE A;  5J1P A;  1TAQ A;  3M2U B;  1KQF B;  4I7F B;  1IWG A;  4CLL A;  3OVB A;  2E5L J;  4EYI B;  4CZC A;  2UUB J;  2DHX A;  2BUN A;  1RA6 A;  3PKY A;  4UTG A;  5RUB A;  1KOO A;  1KN6 A;  2KM8 C;  4OX9 F;  5F3T A;  9ATC B;  2HHX A;  2DNY A;  3J7A 1;  4NCB A;  2XI3 A;  4MH8 A;  3D28 A;  5F41 A;  3W1Y C;  3PDN A;  4O3R A;  2FYX A;  3KLI A;  4M1K A;  2RQC A;  5HQM A;  4IR9 A;  2AJQ A;  1PYT A;  1GT8 A;  3KXD A;  2W25 A;  4FYX B;  2HHH J;  3PHT A;  2B43 A;  1LKZ A;  4JI6 F;  1AFI A;  4DI6 A;  2CNL B;  3LWL A;  3GIR A;  4MIB A;  1SKW A;  2AEM A;  3FMB A;  1W7W A;  2MST A;  5B0F A;  2R7Q A;  2CAJ A;  1X9S A;  1RT6 A;  3RBZ A;  1TKZ A;  5JXS A;  2FY8 A;  3T6J A;  4UY8 T;  1ICE B;  1FRM A;  5ETO A;  3AH6 A;  3W2V B;  4I2Q B;  1U1L A;  1YVF A;  1YSJ A;  2YNF A;  3LP2 B;  3TUZ C;  4B3S J;  4D3G A;  2CQG A;  2ZKU A;  5KT3 A;  1WDT A;  2EPI A;  1R8B A;  1H72 C;  2H1Y A;  2Z0G A;  1RT6 B;  1RWP B;  1TKZ B;  1HR0 J;  1CEZ A;  3SQG A;  4B9M A;  1GMV A;  2LDY A;  2DY9 A;  2YNF B;  3RBE A;  1JLF A;  3K59 A;  4P73 A;  2LU2 A;  3FVY A;  2JEJ A;  4FYV B;  1K73 T;  4OV6 A;  4DR5 F;  1UTA A;  1YZ7 A;  4NXM F;  3SQG B;  5KFP A;  2RU9 A;  2D74 B;  4QPX A;  2AEJ A;  3QT5 A;  5EUH A;  1JLF B;  4OFZ A;  3IM9 A;  1VK3 A;  4ECW A;  4WU2 A;  1VQS A;  2MQM A;  1RGV A;  4NWB A;  3OV7 A;  2GO9 A;  4ED3 A;  4DUY J;  3V5R A;  2A6M A;  3BGR A;  3HDS A;  3CD6 S;  1DFD A;  2KT2 A;  2V8D A;  1B0V A;  5L1J A;  1UEK A;  1VQ7 S;  1RHK B;  2D69 A;  3DRS B;  1R6V A;  3W8P A;  1L3S A;  4TLR A;  4LQ3 A;  1F3F A;  4YUD A;  4Q44 A;  1QUV A;  3OSN A;  1SJR A;  3KJN B;  2XZT B;  3EDQ B;  2DPJ A;  3GON A;  1SXL A;  1XER A;  1HYS A;  1WC3 A;  1LWE A;  3TUP A;  1IR2 A;  4YHH F;  3N28 A;  2GC8 A;  1JLA A;  3I5C A;  3BBB A;  3DHW C;  4UT4 A;  2GHP A;  4DX7 A;  2CQB A;  3EWG A;  1AZS A;  5E2Q A;  5KFJ A;  1H7W A;  2BE7 D;  4JI5 F;  2EKY A;  3CJ0 A;  2W4D A;  1HYS B;  2ZEJ A;  4WK1 A;  1LWE B;  4IFV B;  2FGC A;  4F7V A;  2OPP A;  3QSI A;  2ZUG A;  3OHA A;  4DDF A;  1TL5 A;  1JLA B;  4B9U A;  4U6P A;  2VUG A;  5KFA A;  2RML A;  1AZS B;  2BQU A;  3CMQ A;  2MEW A;  4DV1 F;  1W26 A;  2FLN A;  3AD8 C;  1WKL A;  5T14 A;  3PXG a;  5LMN J;  1Q95 G;  1VQY A;  2OPP B;  3BKU A;  1RBL A;  5D3G A;  4LRC A;  1JXL A;  3L7U A;  3MEK A;  2XCP A;  4PQA A;  4WII A;  4C8K A;  3IWX A;  3OVS A;  1JQG A;  3HT3 A;  2QA4 G;  4ERD A;  2MDA A;  5KG4 A;  3NAH A;  1TL1 A;  3BQ2 A;  3FQK A;  3AJ1 A;  4DV4 J;  2GMH A;  5D3G B;  3D67 A;  3O1L A;  3HLU A;  3IO1 A;  3UDC A;  2FZK B;  4PG7 A;  1N48 A;  2WW4 A;  3VTI A;  5H9E K;  3LQV A;  3MM9 A;  5A0Y A;  3T1H F;  3B82 A;  5L1L A;  1TL1 B;  1N0U A;  1OY8 A;  4I6W A;  2QIF A;  5KFI A;  3MM6 A;  1FO1 A;  4LF4 J;  3QT8 A;  2H51 B;  2BAC A;  2H4Y B;  1NH8 A;  1MWQ A;  3MM9 B;  2L08 A;  4X4S A;  4A8M P;  5A0Y B;  2IPO B;  2ZDP A;  4OLO A;  5F8N A;  2SXL A;  5J2N B;  4FBT A;  2GV1 A;  3MM6 B;  3I9V 9;  1T0T V;  5JVG Q;  3SCJ E;  1N32 J;  1CC7 A;  4I4B A;  1X4E A;  1GMU A;  4ZP8 A;  1RWN B;  2MJU A;  2VKZ G;  2XTJ P;  1N8R T;  1RT5 A;  1V6H A;  4FXV A;  4DV0 F;  4QR1 A;  4Z7C A;  4ED6 A;  2BJ1 A;  3THV A;  2CAD A;  5DDQ C;  4LFC F;  1SIZ A;  4Q0B A;  3N01 A;  3AOB A;  5B0E A;  3SFU A;  1L3T A;  1RT5 B;  2CDQ A;  1WNE A;  2E9T A;  1NK5 A;  2UUT A;  3JSB A;  1JK9 B;  1EKR A;  3OSP A;  3TUI C;  5IC4 B;  4EWT A;  4C7Q A;  2A18 A;  1TV6 A;  3L09 A;  2KHC A;  2E7X A;  2YKM A;  3CCT A;  1CBK A;  4IH6 A;  2BEF A;  3MPW A;  2W9C A;  1H74 A;  2BV3 A;  4Y2A A;  1R0A A;  1U6Z A;  2YKM B;  4HVZ A;  2B56 A;  4A8Y A;  3OBI A;  1KOH A;  4DU7 A;  4WJB A;  4R25 A;  3RUB L;  4D3H A;  2W9C B;  3CDE A;  3FK4 A;  4J91 A;  3T9N A;  2P2C B;  4DV3 F;  1R0A B;  2MGZ B;  3PAC A;  1H3D A;  3LW5 C;  3D3C J;  1X4H A;  2R2S A;  4EO6 A;  1S72 S;  1C1C B;  2RQM A;  1WC5 A;  1FJE B;  1T8E A;  4EGL A;  2GJF A;  4ZMM A;  1NME B;  5AE3 A;  1M5S A;  1FRX A;  4J9O A;  1G6B A;  3RRH A;  1L3K A;  2DNZ A;  3KDO A;  1U47 A;  2HLT A;  3F41 A;  1HW9 A;  2DRA A;  1FVQ A;  1QAX A;  4Y2M A;  4CM0 A;  2JSX A;  2JLF A;  3D6H B;  1WG5 A;  4FKX A;  1CQN A;  3E8O A;  4DN9 A;  1SJQ A;  3JSY A;  1A7G E;  3NAI A;  5AE1 A;  3M6V A;  1X7V A;  5D4P A;  3Q83 A;  5IV4 A;  1NSK L;  5DG8 A;  3BH7 B;  1C0T A;  2ASY A;  1WKJ A;  2FJW A;  4K5R A;  4KSE B;  1IJF B;  1EJ7 L;  3A8E A;  2C22 A;  5A6W A;  1H98 A;  4ER8 A;  3LP1 A;  2PGC A;  4AE5 A;  2X1G A;  4JI4 F;  1C0T B;  2DIV A;  2DR7 A;  1X4F A;  3THT A;  3C16 A;  1X5O A;  4DUT A;  2V9W A;  2W7O A;  3MFI A;  2JNJ A;  5BXI A;  2QN6 B;  1AUD A;  1U0S A;  5F0U A;  3TJA A;  5DZ7 A;  3GJQ B;  2C42 A;  5D15 A;  2OPQ B;  3LP1 B;  4RWX A;  1EP4 A;  1SL1 A;  4CLU A;  2YKA A;  3SMZ A;  3G6X A;  4ZP7 A;  1KS2 A;  3C16 B;  4LF2 A;  4DL4 A;  4MAK A;  3PM9 A;  5HMX A;  4KH0 B;  3RGI A;  3G9C A;  6FD1 A;  1KP6 A;  2QTW A;  1OY6 A;  3BM7 A;  3HVT B;  3M9M B;  4F3Q A;  2IIH A;  4E8U A;  1T94 A;  2UXC F;  1TMM A;  1O8B A;  3SSQ A;  3DNC A;  1LV5 A;  4WK3 A;  2V34 A;  2V67 A;  1UMJ A;  3CCW A;  4BHQ A;  2JC1 A;  3BZQ A;  2Z58 B;  3NNA A;  1CJT A;  1Y11 A;  2VOO A;  4U9R A;  2BKP A;  4C48 A;  1QSS A;  3CW2 C;  3AD7 C;  2E1A A;  2N82 B;  1FDA A;  1Q7Y T;  4MMO A;  3FKB A;  3H8Y A;  4B9S A;  1VYA A;  2RHS B;  1TL3 A;  5EGY A;  1CJT B;  2B9W A;  4DV6 F;  1NH7 A;  5KOW A;  2K3K A;  2XBP A;  1UEV A;  2W2N P;  5A8R B;  5GAD I;  2V4R A;  2D3U A;  2LA6 A;  4ZK7 M;  1HNW F;  4IRC A;  1FNX H;  5K8M A;  2BXJ A;  1LEO A;  3S8S A;  5CH7 B;  1F2H A;  2K7J A;  4H4M B;  4TU8 A;  1W25 A;  1S99 A;  2GMJ A;  1DUR A;  2EG2 A;  2XUL A;  2JVR A;  2MQP A;  1R8H A;  4F26 A;  5HO4 A;  1YBA A;  2HQ3 A;  1VOM A;  3DXS X;  3U1N A;  2LEP A;  2ZJR Q;  4ANE A;  4EBC A;  4PWW A;  1FCA A;  3GG0 A;  3RBX A;  3I55 S;  4QCL A;  4J9K A;  4KB7 A;  2M70 A;  4DHV A;  2W9A A;  3BSN A;  1Y0H A;  4OHZ A;  2RU3 A;  3BPD A;  4K4V A;  4NE9 C;  2ASD A;  3MED A;  1RWM B;  3R7N B;  3CJT A;  2L48 A;  3AY0 A;  4EU0 A;  3CUL A;  4MK8 A;  2DR5 A;  2VQE F;  3H40 A;  1SVD A;  1U45 A;  3LAN A;  4CQ1 A;  2ZH8 A;  2VV5 A;  1SH2 A;  1TQL A;  3IN5 A;  4QQB A;  3NRB A;  3G6E S;  3MED B;  1IBK F;  1NHV A;  4HH1 A;  2CPH A;  3GV5 B;  3HSZ A;  1WC1 A;  2JX2 A;  3ET6 B;  1S9E A;  5DZ6 A;  1K44 A;  4WXW A;  3IR7 B;  3DDN A;  3MOJ B;  2OEM A;  4C98 A;  1LXJ A;  4RUH A;  2VA3 A;  1CS4 A;  4JI6 J;  1WC6 A;  4M5J A;  4ECS A;  1RT2 A;  4WP8 A;  1SL0 A;  4WP9 A;  3CJ8 A;  3DOK A;  3MR6 A;  4J9R A;  3VCD A;  2I2Y A;  2CDR B;  4A8F A;  4B9T A;  2UXD F;  4WFA Q;  4DX6 A;  1CS4 B;  1VBZ A;  4ED0 A;  3GLJ A;  2NZ4 A;  1SUQ B;  4KT0 C;  1KRP A;  1LOU A;  1Y3J A;  2F5G A;  4Z37 A;  2NPF A;  4R0J A;  3L7P A;  4J9P A;  5F8M A;  3UCU P;  1WJ9 A;  1VJW A;  1R7I A;  5HBM A;  3DN9 A;  4NXN F;  1PJ7 A;  1NO8 A;  4I68 A;  3L7O A;  1S1W A;  2C2M B;  2ZZT A;  1WF1 A;  2HWT A;  2IY5 B;  3TZZ A;  3WHI A;  3K5O A;  2YNG A;  3EGW B;  3JSR A;  1UVL A;  5M2R A;  1H6K X;  3W5Z A;  1Q81 T;  3RRG A;  2MQN A;  1MML A;  3Q8U A;  1S1W B;  3DGP A;  2Y3Y A;  2VFT A;  3KHL A;  2DKO B;  3FCH A;  3UN3 A;  2AYE A;  4NLU A;  2E44 A;  2DO0 A;  4EBD A;  1NHU A;  4F4A A;  2YNG B;  5HAT A;  5KFW A;  4P71 A;  4OI4 A;  3MEE B;  2HG4 A;  1S0M A;  4DPT A;  4OZL A;  1SL2 A;  4IO1 A;  5IM0 B;  3LP0 A;  4LRE A;  4NCA A;  4ZCL A;  2OMO A;  1I51 B;  2ADC A;  4LF5 J;  1SJ1 A;  1OSC A;  3P49 B;  2UU9 F;  4NRT A;  5K5M A;  1EAY C;  5IXU A;  4XPC A;  2MKC A;  2GIQ A;  1M5O C;  1CC8 A;  1RHQ B;  2W1B A;  2HHV A;  2Y1J A;  3LP0 B;  3GP9 A;  3I0S B;  4X64 F;  5B7W A;  3UE2 A;  3EGN A;  3TEG A;  3HHL A;  2KRR A;  3OTD A;  1RXO B;  3N6M A;  4XO0 A;  3IRX A;  2Y0S D;  5CCL A;  4JI3 F;  2WVB A;  2HAI A;  3MPV A;  4Q2L A;  2FTR A;  2KO1 A;  1UPP A;  2QL5 B;  4JI5 J;  2WVC A;  3HHL B;  4EI2 A;  3T1A A;  1B7Y B;  3TAR A;  2R2R A;  4DF4 A;  1CJU A;  5D78 A;  2JC0 A;  3IRX B;  3Q8Q B;  1D9F A;  2KI2 A;  1VI7 A;  1Y7P A;  5D0R A;  1JLB A;  4Y2C A;  3T5H A;  2JH3 A;  2RDJ A;  1J2V A;  1X4D A;  1GX5 A;  2ILY A;  4BWJ A;  1RU1 A;  4LR7 A;  5G0R A;  2LLZ A;  4R8U A;  3Q8R B;  2LQJ A;  2KXF A;  1U49 A;  3NMR A;  5KFO A;  1DLO A;  4MFB B;  2WCX A;  3MEC A;  3C19 A;  1DJ0 A;  2C2R A;  1YJN S;  1XR5 A;  1X4C A;  2ROE A;  2IMO A;  4NCG A;  4WFN Q;  4DPO A;  5G0R B;  5K9F A;  4R8U B;  2BYC A;  4H4K A;  4LBI A;  1Q8B A;  4PUO A;  1DLO B;  1PIL A;  5LXY A;  4FF1 A;  1SC1 B;  3MEC B;  3T6B A;  4PYD A;  3S7R A;  1RE1 B;  1JB0 C;  4Y3C A;  4DOZ A;  2AJ4 A;  3S01 A;  1NCL A;  2HBR B;  3CMA S;  1XNR F;  4PUO B;  3KG0 A;  1IQT A;  2Q79 A;  2A2C A;  4M94 A;  5D0E A;  2JJ4 D;  5L8R C;  4KC5 A;  2BJD A;  4AL5 A;  2VD3 A;  4WZM A;  1KQS R;  4BC9 A;  1IKX A;  3E2E A;  2NYI A;  1GXL A;  1S0V A;  2ZNZ A;  4ELU A;  5DET A;  1Q16 B;  5B0D A;  2IC3 A;  3R5J B;  3CIM A;  2MQQ A;  2C2E A;  2NPI A;  1ZPW X;  4ZVO B;  4B08 A;  4NLG A;  3BJY A;  2AGQ A;  4G1P A;  2HHT A;  1DY3 A;  3GFH A;  1S1U A;  3NXZ A;  5KFF A;  1JNR B;  1TU0 B;  1SH0 A;  3RB0 A;  3E01 A;  3SYZ A;  2FJB B;  3T19 A;  1FEH A;  2G0C A;  3NKY A;  3AFG A;  2ERR A;  3GWC A;  1ZET A;  5E3P A;  4K7Q A;  1S1U B;  3HKZ D;  4IO9 Q;  1O51 A;  1WF2 A;  4K59 A;  3E01 B;  2V2K A;  3D5M A;  3K17 A;  1WF0 A;  2AIR B;  2QLB B;  4F4X A;  3HSJ A;  4BLG A;  1O0P A;  4HYK A;  2HHU A;  4OZ5 A;  1U0H A;  2LU1 A;  3I4P A;  2W24 A;  1M5V C;  2KN4 A;  1VRU A;  1SC3 B;  2KDO A;  3AA9 A;  3DDI A;  2CG4 A;  3R2D J;  1ZBT A;  3DM2 A;  5KFG A;  3BDE A;  5DDR C;  4JYA F;  3AD9 C;  1IKW B;  1R43 A;  2YKP A;  2BRL A;  5L1I A;  2HFO A;  2VJV A;  2ALY B;  4C11 A;  2F63 A;  1FK9 A;  2APO A;  4DV3 J;  3Q8V A;  3DM2 B;  1V5I B;  3ZTR A;  2FHO B;  2R8G A;  1Z2L A;  5GMK a;  1ZTW A;  1BWE A;  2CPY A;  4BCA A;  4N7T A;  1VGY A;  4C11 B;  2XY7 A;  1EET B;  4UST A;  5KG2 A;  3L3C A;  2JEG A;  2OFG X;  1FK9 B;  2ZM6 J;  1RTI A;  4OHW A;  2R7V A;  1NK4 A;  2V6A A;  4QWD A;  2IA6 A;  2ASJ A;  3CSK A;  1QVF R;  5LMU F;  5K8O A;  4J90 A;  1N36 J;  2IA0 A;  3A4T A;  4C8L A;  4ZPV R;  4A8O A;  2EFV A;  3FBC A;  3CCE S;  3KG1 A;  4CWB A;  3MDF A;  4L3K A;  2J7U A;  1HWJ A;  2QT7 A;  4P7T A;  2RH3 A;  1LK5 A;  2R42 A;  5LOQ A;  3Q2T C;  1VMB A;  2U1A A;  2BM1 A;  5KFH A;  2KVI A;  2W7A A;  1Y10 A;  3AOD A;  2G1H A;  3PCO B;  4ECT A;  3ISN D;  1FD8 A;  3BQ0 A;  5A2Q Y;  2NR0 A;  1DQ9 A;  2YWK A;  2LKZ A;  4Y2K A;  1F2G A;  1FX2 A;  2C2D A;  2YPY A;  3FQL A;  3M4X A;  5T7L B;  1SH3 A;  1TTH B;  3HFK A;  3LF0 A;  4JI4 J;  3NMA A;  3IBF B;  3IG1 A;  1YX2 A;  3PYG A;  3ISN C;  3J7Z 5;  1KLN A;  1ZM3 A;  3HHD A;  1U8W A;  4C8O A;  3CCS S;  1QAY A;  1FVS A;  4AL7 A;  5H9E J;  1X0F A;  3IG1 B;  4ZHR A;  2OTJ S;  1ZYQ A;  2RIJ A;  2F3J A;  3CUN A;  5HMY A;  2CPD A;  4ZCK A;  1JLQ A;  3IBW A;  2DJW A;  1UFK A;  3MI7 X;  2HRU A;  1WDD A;  2XS5 A;  1Z1Z A;  5F8H A;  3NOG A;  4ZHR B;  2C2N A;  1HQE A;  1VQN S;  1WI6 A;  4IG3 B;  4QOT A;  4G65 A;  3UCZ P;  4YB1 P;  1ROF A;  3A13 A;  5EN1 A;  3SFG A;  2ASL A;  3M8P A;  1J5E F;  4Q8E A;  2Z57 B;  1FDB A;  3KG4 A;  1WHV A;  1YKW A;  3L9Z A;  3T1Y F;  5HAN A;  1KTV A;  1GEH A;  1UW4 A;  1Q86 T;  4JI8 F;  3CC4 S;  3Q89 A;  2MKH A;  1HQE B;  4PG4 A;  1UFL A;  5BYR A;  5C5J A;  2M8H A;  2H5E A;  2UUW A;  1I1G A;  2ZOG A;  3TJ9 A;  3HZE A;  1HKA A;  1P9Q C;  2W9B A;  4AXI A;  2WAQ D;  3K5M A;  2E1C A;  2AD9 A;  1S0O A;  3PW5 A;  3N5B A;  2IRY A;  3D4J A;  1ITP A;  2FJV A;  1S6Q A;  2IAJ A;  2J9E A;  2E9R X;  3NS5 A;  3RRK A;  4ID5 B;  3FC9 A;  5A8K A;  2IYI A;  1YWX A;  4IH7 A;  3M8S A;  3TAQ A;  5LSO A;  1HNW J;  3QGH A;  2D41 A;  2BJ3 A;  1R3N A;  4LT6 A;  3MUM P;  3GIJ A;  3BB5 A;  5CXT A;  1VQM S;  2GQQ A;  1SBR A;  1UJ5 A;  2R4F A;  1SV5 A;  3MTK A;  1H2U X;  1B0T A;  2K1R A;  2DIU A;  3E3X A;  3DU6 A;  1RUS A;  4OZN A;  4LF1 A;  4RBV A;  2X7I A;  1HAR A;  1B4S A;  1NDK A;  3WIV A;  4OZ2 A;  2AYM A;  3DYA A;  3ZNJ 1;  4KY3 A;  2Y1I A;  1SV5 B;  1X0P A;  1OS5 A;  2HFV A;  3HSG A;  4I2P A;  2DNG A;  3TEH B;  4USU A;  2AF6 A;  3KHH A;  2Q66 A;  1QDU B;  4DR2 J;  4X84 A;  1TAU A;  4KE5 A;  1P1L A;  3KNA A;  2LQ9 A;  4CLY A;  4MYU A;  3DYA B;  5F8L A;  2XMT A;  2VBW A;  4F3O A;  1OIA A;  1C2P A;  1YIT S;  3ILI A;  1U1N A;  2GO8 A;  2Z2M A;  2F4F A;  1IM6 A;  1GH8 A;  3GCW P;  5KFC A;  4IOC Q;  1KQG B;  4RKU C;  1R8P A;  2GJI A;  3MCN A;  3V2U C;  3MGJ A;  4NZ0 A;  2KRB A;  2CQH A;  4Z7Y A;  3U1L A;  2BKO A;  3M8Y A;  1T9T A;  1ZPV A;  3HVA A;  2HW3 A;  3N4W A;  3OD2 A;  1K9M T;  4WYW A;  2MZS A;  3QSY B;  1QSL A;  3P5B P;  4RR5 A;  1J5O A;  3TX0 A;  2RS8 A;  2L9D A;  2OI2 A;  1S5Z A;  2H5I B;  1HW8 A;  3PNI A;  4DWI A;  3HSD A;  4WWS A;  3M6X A;  2ZZN A;  2IRX A;  4L72 B;  4JV2 A;  1J5O B;  1RTJ B;  3IMQ J;  4EEY A;  4JI7 F;  5HMW A;  4EUV A;  3ZZT A;  1RBA A;  3DXB A;  2CPI A;  4P74 A;  2NCK L;  2Z4P A;  2BJ7 A;  1BUX A;  5AT1 B;  4YB7 A;  2M3D A;  1NZA A;  4NXN J;  3HO1 A;  1Q79 A;  5CZV A;  2HZC A;  3K5P A;  3UNG C;  3DLJ A;  3M2R A;  3Q22 A;  4GKJ F;  3N0V A;  1YJ7 A;  4DBQ A;  3US5 A;  4EZ9 A;  4ZPC A;  3I0R A;  2PT0 A;  4IOA Q;  1N56 A;  2M5Y A;  4I64 A;  2AHO B;  2AYG A;  2P5V A;  1WD6 A;  3HI9 A;  4A48 A;  4WPA A;  2CNN B;  4CLK A;  1Q0N A;  4A8K A;  3H98 A;  1XEZ A;  3H2U B;  1HWK A;  1I3O B;  1S7I A;  1FKP A;  1RAF B;  3K89 A;  4WBF A;  3I0R B;  3GII A;  1WUU A;  1S1T A;  1Q8L A;  4DS5 A;  2W4C A;  4NMX A;  4KO0 B;  4LF7 J;  4HTI A;  1ZH5 A;  2MQL A;  3ILL A;  2HQC A;  2MHE A;  3OW2 R;  2XNR A;  5KFE A;  5HP1 A;  2PFF B;  3HX9 A;  4G3I A;  3TAN A;  1Y00 A;  1MN7 A;  4LFA J;  1S1T B;  1JIH A;  2G1D A;  5DDP C;  3JQK A;  2M7S A;  2E5G A;  3DRY A;  3IWN C;  4LUB A;  3BEG B;  3QJJ A;  3GZ7 A;  4DV5 F;  4K50 A;  2EFO A;  3QGP A;  1YG0 A;  2E66 A;  5HP1 B;  2DGT A;  3QAT A;  2Y8Y A;  1BQM A;  1CG2 A;  2FUG 9;  3CB4 A;  2KB2 A;  2ZOF A;  4DSE A;  1G1X A;  3EPG A;  1RT7 B;  3PVX A;  2GX8 A;  5K8P A;  5KFX A;  2KFY A;  1N0V C;  5IWA J;  2F9D A;  2K7K A;  4FXW A;  2AX1 A;  4LF9 J;  5HMZ A;  1BQM B;  1Q8K A;  1Q4R A;  4QIG A;  2RKI A;  3ITH A;  1MWZ A;  1HBN A;  3M05 A;  3SI8 A;  2DR6 A;  2HVZ A;  4QR2 A;  2CPF A;  3NG8 A;  1PSD A;  4X4V A;  5CD4 H;  3JB9 k;  2QMX A;  1VQL S;  4OX6 A;  3T3F A;  3TVK A;  3VZH A;  3PO5 A;  1SKR A;  2POK A;  1NAQ A;  3BGL A;  4AL6 A;  2ZBR A;  5M2U A;  3WX8 A;  2UUA F;  2RKI B;  4DL7 A;  3ITH B;  4GO5 X;  1T9Y A;  2E5I A;  1T11 A;  4P2S A;  3K5N A;  5D4O A;  1CSJ A;  2W2Q P;  3CTR A;  2HGL A;  3TVZ A;  4XPE A;  2GML A;  2OPR A;  3F44 A;  2WSC C;  2ZWP A;  4JI2 F;  3WIU A;  4ALZ A;  1WEL A;  2Z2Z A;  3V4I A;  1XTZ A;  3ZTS A;  2ZHB A;  4ATN A;  1DQ8 A;  1HBO A;  3D0H E;  1UET A;  4O0N A;  2LXI A;  3LTO A;  1DAX A;  4NLQ A;  1UEU A;  3D6T B;  2HBY B;  2OPR B;  3HD2 A;  1IR0 A;  3EE3 A;  1S0N A;  5F0W A;  3FDS A;  2HUR A;  2PD1 A;  4CNY A;  2BW2 A;  3KLG A;  1AUS L;  2HFZ A;  5THW A;  2WB1 D;  1A6L A;  3V4I B;  4FNI A;  1HHQ A;  2FHM A;  3CME S;  1HBO B;  4DV7 F;  3GFY A;  3C14 B;  5B0C A;  4ZLJ A;  2IDE A;  4L75 A;  2HGN A;  1TFY A;  2DGU A;  1HMV A;  2I38 A;  3KLG B;  3A12 A;  1YIJ S;  3QNW B;  4TN2 A;  3OQ2 A;  3TUJ C;  2EK1 A;  3QJL A;  1F1B B;  1BQX A;  4Q2M A;  3DHX A;  1FES A;  3OTO J;  2F1F A;  4UUW A;  3I87 A;  1E6V A;  4MKA A;  1U24 A;  3QGG A;  4FVM A;  1IXK A;  2ADB A;  3QQC D;  2NYH A;  1X4A A;  2CQ0 A;  4TY8 A;  1TVR A;  2OUG A;  2CQC A;  2VA2 A;  1E6Y A;  3GYX B;  1HIY A;  3KLE A;  5CYM A;  4IDK A;  2FJD B;  2J5A A;  2GQC A;  1XN9 A;  4ZPT R;  3CD5 A;  4DR1 J;  4TY8 B;  8ATC B;  1TVR B;  5DQG A;  4N77 A;  3TI0 A;  1PC5 A;  1E6Y B;  1KNZ A;  3RG6 A;  3TR5 A;  5CYM B;  4TYA A;  4B3T J;  5GAH I;  3EJM A;  2E5H A;  3OL7 A;  3IM8 A;  4JP8 A;  3MPD A;  1H38 A;  1HFE L;  4F25 A;  2LYV A;  1TFW A;  1SJ3 P;  1M1H A;  4WTO B;  3PKM A;  1PYO B;  1TP7 A;  2H3E B;  4EMD A;  2IJN A;  2C2Z B;  3AQP A;  1HL6 A;  4ED5 A;  1U1Q A;  4EFA C;  4DQR A;  4B9L A;  1VS3 A;  4I6A A;  4NL5 A;  2XSF A;  4FF4 A;  1S4F A;  2CPE A;  2MSS A;  3DGV A;  5ITH A;  3M8Q A;  3UD4 P;  3A3O B;  4IKA A;  3MAA A;  2J8S A;  5IQ6 A;  1SCJ B;  2RRB A;  4FKY A;  1N33 F;  3D1H A;  2CPX A;  1MMD A;  4YQW A;  3MPU B;  2KFZ A;  2QJ3 A;  2IM2 A;  4E2F B;  2FD2 A;  1KVI A;  2HGM A;  3M8Q B;  2KHD A;  4ETZ A;  5F3Z A;  4FS2 A;  5HQ8 A;  3OR1 B;  1KLM B;  1D8Y A;  3DLH A;  1DRZ A;  1RTD A;  2Y0B B;  1B70 B;  2VFS A;  1NPP A;  1NZ8 A;  4J9Q A;  3A8J A;  5SZT A;  1NJI T;  3QAU A;  4OI0 A;  4PXD A;  4OI3 A;  1T7P A;  3T5K A;  3FCV A;  4LFB J;  4LF8 J;  2HZV A;  2ZD1 A;  1FDD A;  4QZV B;  1NK7 A;  3RYL A;  3UI3 A;  1XNQ F;  5I42 B;  1OJ4 A;  1UP1 A;  5K8N A;  2FJE B;  4OYO A;  3C66 A;  3MR7 A;  2O66 A;  4OYP A;  4CIO A;  2GW8 A;  4NYP A;  4HAC B;  1YRX A;  1YJW S;  4FNH A;  2QO3 A;  3HD1 A;  4M8L A;  1REV A;  4O4G B;  3N6L A;  3W9H A;  4QYZ K;  1S97 A;  2YNI B;  3UN2 A;  2W2P P;  4O44 A;  4JUZ A;  3LUY A;  2XWX A;  4ETX A;  1REV B;  1YJT A;  2M88 A;  4F4W A;  3CDW A;  1JLC A;  3FZB A;  2F8M A;  4PXE A;  1FWL A;  2B6A A;  4B3O A;  2XNQ A;  4ILL A;  4YEA A;  4RW8 A;  1X5S A;  2CZ4 A;  3VAJ A;  7AT1 B;  1RHM B;  1RHR B;  3W5Y A;  1JLC B;  1QTM A;  3ELH A;  2GGP A;  1IUJ A;  4YFU A;  3PIO Q;  2ZE2 A;  3K8V A;  3ZTO A;  3J7Y I;  5H9F K;  2D1C A;  4R0E A;  1JJ2 R;  4B3O B;  2QFJ A;  3C2P A;  4PKD B;  2VHG A;  1TR0 A;  4RW8 B;  1NSP A;  2RAQ A;  1HHS A;  3MM8 B;  3HHK A;  1HI8 A;  5L39 A;  2DIS A;  4M95 A;  4RBT A;  2ZKT A;  4RO0 A;  3MR2 A;  1SB6 A;  2V5H G;  2GGP B;  3AT1 B;  3MCS A;  4K4T A;  1GXT A;  2QLW A;  4RW6 A;  3OXG A;  5D4L A;  2R7X A;  4QWB A;  1NKE A;  3TA2 A;  3VR1 A;  2RQK A;  2BQ3 A;  3DFE A;  2A1B A;  4CP5 A;  1GMW D;  1LFW A;  4W98 A;  4I0W A;  4N56 A;  2FLL A;  3ZNU A;  4RW6 B;  1U8S A;  3EZ5 A;  3FMW A;  1RWK B;  3W62 A;  4MTP A;  1X4B A;  4YY3 J;  2KU7 A;  4U8V A;  3VHQ A;  1PIE A;  1OMS A;  3PJW A;  3FRY A;  4H4O A;  1J27 A;  4X4T A;  4KKO B;  4JV0 A;  1KON A;  2YKO A;  3V6H A;  4QIV A;  2FIU A;  2P6S A;  4UQT A;  2FVR A;  2XEX A;  3W9I A;  3J7A N;  4PG5 A;  5ETM A;  2GQ2 A;  3CD0 A;  4KAI A;  5L1K A;  4H4O B;  1GXU A;  3ULH A;  4C6A A;  1FF2 A;  3G8Q A;  4WIQ A;  2XG8 A;  4X4N A;  3DRP A;  4OYI A;  4KHP J;  1XIQ A;  5KFM A;  3MD1 A;  3TP2 A;  3H4B A;  2P9E A;  4QU7 A;  4ECQ A;  4NRU A;  1NK6 A;  3DRP B;  3MM5 A;  4YS2 A;  5ETR A;  3K58 A;  1FRL A;  2QYC A;  3QRP A;  3MAQ A;  3NGK A;  3ZTQ A;  1RWX B;  1BY9 A;  3UDL A;  2VOP A;  2OFH X;  1EQM A;  3F56 A;  3PTW A;  3F0N A;  3VAG A;  1NRK A;  2QE5 A;  4WKR A;  6AT1 B;  3DOL A;  3MM5 B;  1IKY B;  1EIY B;  1RYS A;  4ZVR B;  4J7C A;  3DLK B;  5HSP A;  3ZC4 A;  4XIU A;  1XQI A;  2OIH A;  2CJ9 A;  1CJK A;  2DGV A;  2FC8 A;  4K4Y A;  4KH1 B;  1JJ4 A;  2ATL A;  4ZJO A;  3DOL B;  4IQX A;  1PC4 A;  4AFF A;  3QRQ A;  3D6F B;  1HBU B;  3TZY A;  1CJK B;  1DZ5 A;  2NQP A;  5BR8 J;  2ZOM A;  5A8W B;  1GNK A;  2W8K A;  4ZJQ A;  5LJ3 Y;  3V81 A;  2DVI A;  3CCM S;  5AJ3 J;  2ACY A;  4KQZ A;  2FZC B;  2VFU A;  2D3Z A;  2DEI A;  2M52 A;  2YY3 A;  2B8P A;  5D0G A;  3KUE A;  1S59 A;  2O5D A;  1UZH A;  2NUU G;  4QR0 A;  2YWG A;  4USH A;  4KPY A;  4P7V A;  4NLW A;  2OPS A;  4F50 A;  4DPU A;  1EQ0 A;  1DTT B;  2B8Q A;  2CKW A;  1N54 B;  2L9W A;  4JI7 J;  3G8T A;  1BGX T;  1T03 A;  3IRW P;  1IBM J;  1ZTT A;  4AUK A;  3GU0 A;  3K0J A;  2JOQ A;  1QY7 A;  1V3Z A;  5LSL A;  2A6O A;  2UV8 G;  3OTC A;  4AXJ A;  1CLF A;  4OI6 A;  1AA1 B;  3JTO A;  3WZ0 A;  1RSC A;  2HBQ B;  1T03 B;  1IKV A;  5KT7 A;  5IT0 A;  1GAO A;  1WSV A;  1IWA A;  5B08 A;  3T5J A;  3KDN A;  2NSC A;  3B4M A;  3MM7 A;  5AXL A;  5KFR A;  1UCN A;  3CCL S;  3HHN B;  4P52 A;  3X1L B;  1T9W A;  4ED2 A;  2DCL A;  4DL0 C;  4CO4 A;  4FN5 A;  4OZ3 A;  3IR6 B;  3M6W A;  3T5L A;  3D3B J;  4DV2 F;  1RKJ A;  5GAE I;  3PW2 A;  2VG5 A;  1S9F A;  3GYN A;  1KHW A;  3M8R A;  1KTQ A;  3MM7 B;  2R2T A;  3OHB A;  2I9S A;  4OYZ A;  2YQ3 A;  3M6U A;  1M5K C;  5DRK A;  3MUV P;  5G4D A;  3FEX B;  3KLI B;  1XMQ F;  2FHJ D;  2B4V A;  1HA1 A;  1VQ6 S;  2J0Q D;  2R9L A;  2C28 A;  3KKF A;  2G9O A;  3BGU A;  2VG5 B;  3FUY A;  3FSY A;  3CD7 A;  2E7V A;  5DG9 A;  3RTV A;  4DV5 J;  3D0G E;  4OYA A;  4FP9 A;  3NBP A;  2EBE A;  2KT5 A;  1FFG B;  3R6L B;  2BAN A;  4RNN A;  4LMZ A;  3QFH A;  5DS7 A;  2AKW B;  3UNY A;  1BQN A;  5HL7 Q;  5GAG U;  4WFB Q;  3Q8S B;  4CLS A;  2MKK A;  2DYA A;  3ADA C;  1U1O A;  1YGY A;  1N34 F;  3W61 A;  2MKS A;  2X3G A;  3NBP B;  5CYQ A;  3KTQ A;  5J2Q A;  3Q8Y A;  2OML A;  2BAN B;  3FEZ A;  3RB3 A;  2HVH A;  1D8Z A;  4M63 A;  3NGR A;  4HI1 A;  5M2P A;  2IM0 A;  4ID8 A;  5ETS A;  3BYP A;  3GG1 A;  4A46 A;  5GME A;  4NX9 A;  3CNQ P;  2DO4 A;  3FFI A;  1WTB A;  3EGV A;  4LRA A;  4FPR A;  1O5J A;  3TAM A;  3U1M A;  1F9E B;  3I96 A;  5CYQ B;  5J2Q B;  1FEE A;  1G3O A;  4CLF A;  2E1R A;  2UUA J;  2C3U A;  2DGO A;  2VPZ B;  2UV8 A;  2GVZ A;  1VQK S;  4B17 A;  3CCJ S;  3TAM B;  4LQ9 A;  1QJH A;  5LXR A;  2FJX A;  2HND A;  2YKN A;  3CCZ A;  2FVC A;  3ZXW A;  3MD3 A;  2UUB F;  3BR9 A;  1AFJ A;  4C9D A;  3MWB A;  1F5B A;  2ZH9 A;  1KEK A;  2HSE B;  2PN6 A;  4R5P A;  2GVZ B;  2EC0 A;  2ILZ A;  3RR8 A;  3LAM A;  3BGR B;  4MK9 A;  3I9Z A;  3DLB A;  3WC0 A;  4GMK A;  2NXN A;  2HND B;  4K5S A;  2YKN B;  1RI7 A;  1FJ7 A;  4ZVE A;  2HWI A;  1SQG A;  1NM2 A;  3KUH A;  2CNO B;  2WVE A;  1RTH A;  3IA0 A;  3VGS A;  3UWT A;  5I3Q A;  1FXR A;  3FBB A;  4R5P B;  2ZJQ Q;  1FKO A;  4NA2 A;  4DV7 J;  4Y00 A;  5DM6 Q;  2C3M A;  3IAS 9;  2HHH F;  4X65 J;  3H5Y A;  1HQ2 A;  1F5A A;  4KGK A;  2RT3 A;  3UO0 A;  3WX4 A;  1KD1 T;  1FKO B;  4KHM A;  1KWM A;  1N5S A;  2PII A;  2JL9 A;  5DDO C;  1URN A;  1REG X;  1QD1 A;  4ZPB A;  2Z2Y B;  2ZBC A;  2XMJ A;  1JXV A;  2GJ2 A;  1QAJ A;  1V5V A;  3VF0 B;  2HQF A;  1WI8 A;  4JI0 J;  1VLY A;  3EVM A;  4TVA B;  1PJ5 A;  5HRO A;  5HLF A;  1HR0 F;  3CIZ A;  4NLT A;  4OI2 A;  4UOF A;  4F8R A;  4ZPA A;  2V8V A;  3FSI A;  3PR4 A;  1UL3 A;  3MMB A;  4DR3 J;  1KQK A;  4HDG A;  1URR A;  2UUC J;  3DRX A;  4QU6 A;  2YTC A;  5HRO B;  3EVW A;  2LQ5 A;  3ZFV A;  2VBX A;  4N8O A;  1TMJ A;  1DBD A;  4C0B A;  4X4P A;  2W7P A;  5L38 A;  1NHK L;  3BSO A;  4RNF A;  2Q6C A;  4QIF A;  5FII A;  2AJ0 A;  2VG6 A;  2WRM A;  2WZ1 A;  2K2P A;  1CJV A;  3KJV A;  1LWX A;  1D0E A;  2WON A;  1HNI A;  1XMO J;  2NLW A;  3TVY A;  4DQS A;  1JLE A;  1WHX A;  1VC0 A;  4X62 J;  1RBO B;  1S1X A;  4TNO A;  1CUL A;  2VG6 B;  4WXO A;  1OYE A;  1UWB A;  4RNO A;  1KBR A;  1IQZ A;  1M5H A;  4ZVH A;  2GNK A;  1CJV B;  3KJV B;  4DG1 A;  3NS7 B;  1HNI B;  2IDL A;  3U02 A;  1ZS6 A;  3KLF A;  4USK A;  4BDP A;  5CCM A;  4J9V A;  4C3L A;  3WQP A;  2WOM A;  2LXF A;  4DG1 B;  1PKU A;  2FVP A;  1I6J A;  4K8R A;  1DTQ A;  4A4J A;  1S7H A;  3RR7 A;  1PYS B;  3AA8 A;  2J9C A;  1NBE B;  4Q0B B;  4GVB A;  3CF5 Q;  1XNQ J;  3N6N A;  3ENQ A;  1WG1 A;  4DUZ J;  1NDC A;  1PAU B;  4L73 A;  4NLD A;  5LMN F;  4O0I A;  3JQJ A;  1DTQ B;  1TV6 B;  2VON A;  4YDX A;  2JHE A;  2HHP A;  3W65 A;  2CQ4 A;  3TW0 A;  1VQO S;  4GVB B;  1MRO A;  1U2F A;  3SSR A;  2KG1 A;  3OL6 A;  1QAI A;  2ALZ A;  4ZVQ B;  4CM2 A;  2HBZ B;  1YBU A;  5LJ5 Y;  4B9V A;  3VVU A;  2V2Q A;  3PX0 A;  5DLF A;  4CO3 A;  3O3L A;  1ZA2 B;  1MRO B;  2UVV A;  4U95 A;  3GJT B;  3AOA A;  4C0H A;  2HAF A;  4KGV B;  4UY8 5;  1B7F A;  3BS9 A;  4FVC A;  3SQO P;  5CHC B;  5KFY A;  3T41 A;  2GHV C;  3P6Y C;  2HQI A;  2NUH A;  4DFK A;  2F4V J;  4M5L A;  4CO2 A;  1X5T A;  1WHW A;  2IHR 1;  1NDL A;  1RWU A;  4RW9 A;  3GFX A;  3K57 A;  2B9X A;  2CVI A;  2H48 B;  3C15 A;  1UA1 A;  1F0X A;  4O3N A;  3CCQ S;  2VIH A;  3EX7 B;  4RW9 B;  2J76 E;  1P8G A;  2XYH B;  1VHI A;  3RW6 A;  4DCP B;  3PYD A;  2CZ9 A;  2PI4 A;  2KJW A;  3C15 B;  3QJP A;  3HXM A;  1BC6 A;  4UOC A;  5E3C A;  5K20 B;  2FVQ A;  2HS4 A;  3OTB A;  1XR7 A;  2XMA A;  2QA1 A;  3M8Z A;  2XO6 A;  2R8J A;  2MPU A;  3BR8 A;  4LSZ B;  1K1Q A;  1FXL A;  3BDP A;  5KG3 A;  1H0H B;  3PJX A;  4ZCM A;  4I67 A;  2N4C A;  4HHH A;  1RAE B;  2CZV C;  3M2V A;  4OZ1 A;  3OFF A;  1FTR A;  4DR6 F;  3HJV A;  4FS1 A;  1RT3 A;  1T9X A;  1B99 A;  2XM3 A;  2BJ8 A;  1B3T A;  2BE2 A;  4HHJ A;  1Q7L B;  1WOS A;  3OLA A;  3KOA A;  3QBC A;  5IT9 U;  4DU8 A;  4V19 X;  3M2V B;  3O8W A;  1EP4 B;  2IBK A;  4KHR A;  4C2M A;  3UW1 A;  1LWF A;  2JFK A;  2GIR A;  4PWU A;  2HEK A;  1RT3 B;  2C1E B;  1ZZN A;  2DR8 A;  1FJC A;  1FD2 A;  5DQI A;  3LOU A;  3NGT A;  3DLE A;  4N47 A;  3G86 A;  4LF6 J;  1LWF B;  2XQC A;  2HLU A;  1LW2 A;  3NCQ A;  1RP5 A;  2BBE A;  2XGQ A;  3BPS P;  3DLE B;  4C8Z A;  4PZV A;  1SC4 B;  2HVI A;  4A8W A;  1BE4 A;  4QYR A;  3SCI E;  3A8K A;  1NSA A;  4ED8 A;  2I0X A;  2GVD A;  4ZVG A;  1QM9 A;  2RSQ A;  3PG9 A;  4X66 J;  3QZ8 A;  2EFN A;  2FY1 A;  3DOM A;  1LW2 B;  5L9N A;  5AXN A;  3RAM A;  2PO4 A;  3OVA A;  1VIX A;  2Y8W A;  2EXU A;  2QRR A;  3M32 A;  4USI A;  5B0A A;  2QV6 A;  4CH0 S;  1X8D A;  4EYH B;  1JLG A;  4NLV A;  1MNE A;  2VQF F;  3DOM B;  4P2M A;  4QPT A;  4A8Q A;  1TL3 B;  2ZJP Q;  3M32 B;  3QT6 A;  3HZG A;  1RCO B;  1HQU A;  2DH7 A;  2CIM A;  2OHD A;  3H5X A;  1JLG B;  3KFW X;  1KSP A;  3NGU A;  3J80 U;  4DR4 J;  1OPI A;  4AQY J;  1JJC B;  4CO0 A;  4DFP A;  2OAU A;  4QYZ J;  1VRT A;  2CJQ A;  1U48 A;  2BW7 A;  2D9P A;  1HQU B;  2YX4 A;  3IGN A;  1S57 A;  2QA4 S;  4W90 B;  3GIK A;  2OEL A;  2QSW A;  1I94 F;  2AYB A;  5F9N A;  2VDH A;  4XK8 C;  1G4C A;  1F9F A;  2DTJ A;  1SKU B;  1VRT B;  4WU3 A;  3CPW R;  3UCG A;  3I5B A;  2ZVI A;  3VQS A;  3BN7 A;  1M1G A;  1WOO A;  3RB4 A;  4MKB A;  3ZO7 A;  2MKI A;  4C4W A;  3KK2 A;  1UPM B;  1FA0 A;  4ZKA A;  1XJW B;  1GX6 A;  3DKD A;  1EZZ B;  4OYW A;  3OL8 A;  5GAD U;  1K47 A;  4LJM A;  4RBU A;  1RLD A;  2DGX A;  3FRZ A;  4ZPW R;  5H9F J;  4OX9 J;  3PYE A;  5GVQ A;  3UDV A;  3IWL A;  3I56 S;  3NS6 A;  4IYQ A;  3CCV S;  4A8X A;  1T3N A;  2YNH A;  4OI1 A;  2B9Y A;  3ILO A;  3QYY A;  1RAC B;  3P3D A;  3NY0 A;  2CQI A;  3RAX A;  4WFY A;  4YB6 A;  1BWV A;  1S9E B;  4HKQ A;  4IH5 A;  2EFP A;  3HHL C;  1I5O B;  3EZU A;  5KFV A;  2YNH B;  2R8H A;  3R7B B;  5F8I A;  2N7Y A;  3SCK E;  1BD6 A;  5AXK A;  2H9Z A;  1RAO A;  2R8K A;  2KJV A;  4ZVT B;  5A76 A;  5L9X A;  1RT2 B;  3BSA A;  4WFX A;  2BQR A;  4HH0 A;  3SZ2 A;  3DOK B;  4LIR A;  5I3U A;  1B0P A;  4NA1 A;  3V6D A;  4MJK A;  1XBW A;  1VC5 A;  5HJY A;  2CFX A;  3EIC A;  3P8B B;  4RNM A;  3BO4 A;  1GMW A;  3C6T A;  1Y5L B;  3HK2 A;  5I3U B;  1ZZF A;  3J81 U;  1P9Y A;  3V6D B;  1V3S A;  2MZ1 A;  4KGZ B;  1U25 A;  5HBM B;  4CLW A;  3G82 A;  1S76 D;  1HI1 A;  3POT A;  4P6Q A;  3H5U A;  4OLP A;  4DR5 J;  2ZNY A;  4NXM J;  4PWD A;  1VFJ A;  2BOA A;  2DHH A;  2YX7 A;  3OXL A;  3TWZ A;  4ECV A;  3VAK A;  4H4K C;  4GKK F;  3M2U A;  3I82 A;  3PHE A;  4OX8 A;  4HHU A;  2AZ1 A;  3CJ3 A;  3POT B;  3W3S A;  4QW9 A;  2V8G A;  3DGP B;  5KFS A;  3AJD A;  3CCU S;  3W64 A;  2KXN B;  2D3O 1;  2PMW A;  1NND A;  1FWK A;  1UW9 A;  3DI6 A;  2LEA A;  4F67 A;  2Q6B A;  3R27 A;  3NWG A;  5F9L A;  1N5Q A;  4IQM A;  4FBU A;  3TNV A;  2VBZ A;  4V19 J;  4TQR A;  5GAG I;  4YHH J;  3BO2 A;  1N5T A;  2DY1 A;  4DL3 A;  3PR5 B;  3DI6 B;  2MY7 A;  5ETV A;  5KFK A;  3KWM A;  1BXN A;  4OL8 A;  2RRA A;  4J37 A;  2VAS A;  1RWO B;  1NU4 A;  4I1T A;  1JWW A;  3EXC X;  2IJR A;  1RDR A;  2B9E A;  3HVR A;  3CJK A;  1OPZ A;  4Y34 A;  1Y9O A;  1VQ9 S;  1KKH A;  4HT5 A;  4ZN3 A;  1P27 B;  4DV1 J;  4USW A;  3W2V A;  1RAD B;  1IBC B;  4I2Q A;  3LP2 A;  3P45 B;  3PEJ A;  3LPY A;  4PR6 A;  1DHM A;  1P1T A;  3MMA A;  3TA1 A;  2WBM A;  3UN5 A;  1CJU B;  4KR0 B;  1MN9 A;  2MYF A;  3CJK B;  5IC6 B;  4ENO A;  2Z30 B;  2YH1 A;  3BGF A;  2HS0 A;  2NS1 B;  1JLB B;  4V1A k;  4FF2 A;  3ENV A;  2IVF B;  3PYF A;  3MMA B;  1R8A A;  1T02 A;  1NSQ A;  2J7W A;  2LQB A;  3E51 A;  4P2F A;  4ZPD A;  2L41 A;  2KKH A;  1GFW B;  1VIO A;  3VAF A;  2XMU A;  4ZS6 A;  3T1H J;  1YJR A;  2HFU A;  2DXE A;  1A0O B;  3W2W A;  3IP0 A;  2R3V A;  3ETM A;  2F8H A;  5E7O B;  2AW0 A;  4AND A;  1HNV A;  4NCG B;  4J9U E;  3I31 A;  3N9U C;  5IZH A;  1L3V A;  2BR0 A;  1RCX B;  2H5J B;  3W2W B;  5LL6 d;  4WE1 A;  2CJA A;  1HNV B;  3DRS A;  3M30 A;  3NGS A;  4CO5 A;  3HP6 A;  5E33 A;  5KT6 A;  1TL7 A;  3X3U A;  2V2Z A;  1WHY A;  2RJZ A;  1X4G A;  3I4H X;  5F8G A;  4LF5 F;  4U7U K;  2V69 A;  3ICL A;  3Q24 A;  3EXY A;  4WE1 B;  4O3P A;  3ZZR A;  2KM8 B;  3M30 B;  4DV0 J;  1IKX B;  1TL7 B;  2C3Y A;  2JLG A;  2RVJ A;  4F0M A;  3PZP A;  4CH7 A;  2RDD A;  4BS2 A;  5CQG A;  3EMT A;  2IC3 B;  4IFV A;  1VQ8 S;  2HK3 A;  2F7V A;  2ZH4 A;  5KG7 A;  3ZTP A;  4LFC J;  3AOC A;  4QW8 A;  2ZBP A;  4ILR A;  2CNK B;  2E1M C;  2ZZM A;  4Q5V A;  4OX7 A;  4I56 A;  2FLO A;  1WC0 A;  1S79 A;  1FHT A;  1T3O A;  3GR1 A;  4CLP A;  4TU9 A;  5KFZ A;  1D9A A;  3IBC B;  2FHJ A;  4NML A;  3QZ7 A;  4C97 A;  4X2B A;  4IFY A;  1MW7 A;  3MR3 A;  1RQ0 A;  3VQT A;  1ACM B;  2MTL A;  1S4E A;  2X1B A;  1QUP A;  4OHY A;  1RAJ A; 
#chains in the Genus database with same CATH homology
 2CJX B;  2HBR B;  2Y1L B;  3KJN B;  2XZT B;  2CNO B;  2XYG B;  3EDQ B;  2QLF B;  2DKO B;  2H54 B;  1RHU B;  5IC6 B;  1RWP B;  4ZVT B;  2QL9 B;  3GJR B;  1SC3 B;  4ZVU B;  1NME B;  1BMQ B;  2H48 B;  3RJM B;  3GJQ B;  2CDR B;  3D6M B;  2C2K B;  3R6G B;  2C2O B;  1F9E B;  1RWX B;  2XZD B;  1I51 B;  5IC4 B;  1RWM B;  3R5J B;  1RWK B;  1PAU B;  2HBY B;  3SIP B;  3R7S B;  2Y0B B;  2H51 B;  3R7N B;  1GFW B;  4JB8 B;  4ZVO B;  2H4Y B;  3KJF B;  2C1E B;  2XYH B;  2H65 B;  1RWV B;  4DCP B;  2CNN B;  4DCO B;  4ZVP B;  1RWW B;  2CNK B;  3GJS B;  3D6H B;  1RHQ B;  2CJY B;  4ZVR B;  1I3O B;  1RHM B;  2CNL B;  1RHR B;  2QL7 B;  3EDR B;  2FQQ B;  4ZVS B;  1RWO B;  3IBF B;  3KJQ B;  2XYP B;  4ZVQ B;  1QTN B;  2HBZ B;  2H5I B;  1RHJ B;  1PYO B;  5K20 B;  2H4W B;  4DCJ B;  2C2M B;  3IBC B;  2HBQ B;  2C2Z B;  1SC1 B;  2H5J B;  1QDU B;  3QNW B;  3R6L B;  3NS7 B;  3GJT B;  1ICE B;  1RWN B;  1RE1 B;  2QL5 B;  3D6F B;  4LSZ B;  1IBC B;  3P4U B;  1RHK B;  2QLJ B;  1SC4 B;  3R7B B;  3P45 B;  2P2C B;  2QLB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...