1I51B

Crystal structure of caspase-7 complexed with xiap
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
b'KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-7 SUBUNIT P20
publication title Structural basis of caspase-7 inhibition by XIAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1i51B00
3EDQB 2CJXB 1SC1B 2C1EB 1NMEB 3IBFB 2XYGB 2H65B 2P2CB 1BMQB 3KJNB 3GJTB 2H5JB 1RWPB 3SIPB 2CNKB 1RHJB 1RHKB 1QTNB 4ZVRB 4DCPB 3R7NB 2QLJB 1RE1B 4ZVOB 1RWXB 1RWNB 1RHUB 1RWWB 2QLFB 3QNWB 1ICEB 1RWMB 2DKOB 2CNNB 5IC6B 1RHMB 4DCJB 1QDUB 3D6MB 1RWVB 1IBCB 1SC4B 2Y1LB 3R6LB 4ZVTB 2CNOB 2QL9B 3KJQB 2QL5B 2C2ZB 2C2KB 2FQQB 4ZVPB 1PYOB 2CNLB 2XZTB 2H4YB 3GJQB 1F9EB 2CJYB 4ZVUB 1RWOB 3RJMB 1RHRB 4ZVQB 1GFWB 3NS7B 2QL7B 5K20B 3R6GB 4ZVSB 2CDRB 3KJFB 1PAUB 3R7BB 3P45B 3IBCB 5IC4B 3P4UB 3D6FB 3D6HB 4DCOB 4JB8B 2C2OB 3GJSB 1I3OB 3R5JB 2C2MB 1RWKB 2H51B 1RHQB 2XYPB 2XYHB 2QLBB 2H54B 1SC3B 2Y0BB 2H4WB 3R7SB 3GJRB 2HBZB 2H5IB 1I51B 2H48B 2HBQB 3EDRB 2XZDB 2HBYB 4LSZB 2HBRB
chains in the Genus database with same CATH superfamily
2D41A 1R8PA 2QYCA 1AFJA 2FVCA 2MKJA 3G9CA 1DFDA 3GIRA 3OTDA 4DLGA 4WFYA 4OFZA 1V5IB 3HO1A 1QAXA 2I8EA 4I64A 1D8ZA 3TR5A 5GAHI 1S9GB 1Y5IB 3MM8B 4YQWA 3MMBA 3M9MB 4B9UA 1JKHA 4CLTA 5KG4A 3IO1A 2EFPA 2XMMA 3GSDA 2VA3A 3D4JA 1YJTA 4GMKA 2V67A 4DPUA 4B3OA 1Y00A 3MOJB 3D1OA 3RRHA 3KHGA 3ULHA 3CMAS 3PR4A 1QY7A 3RBEA 2IM1A 4JV0A 4F2RA 1WDTA 3FC9A 4CTAA 4X4SA 1FKAF 3AB2B 2KFZA 3OR2A 1WWHA 3ZZUA 2J9CA 2GVZA 4J9KA 3KG0A 2NSBA 2UU9F 2UP1A 2OMLA 3M2VB 3HHNB 3ZZPA 3T3FA 2CQPA 4PR6A 4ECRA 2HNZA 3HF5A 1ZM3A 4ZLNA 4O44A 3R1LA 3JQMA 1T3OA 1F2HA 1UA0A 3OLAA 2KB2A 1CQMA 4KHPJ 5LMUJ 4LREA 3S1TA 4DDFA 2MGZB 3IP0A 1XQIA 4CLUA 4GC7A 1X5SA 4TLQA 2HS0A 3CCMS 3UCUP 1YJVA 4LF7F 1UVKA 2DY9A 4ID8A 4ZVSB 3TZYA 1TV6B 2CZ4A 3BSOA 2HHWA 1KLMA 1O6XA 3GG1A 1PSDA 3RAQA 4J9RA 2HKEA 4LF5F 1P1TA 4M5HA 3HKZD 3AJ2A 4C11B 3TYTA 3FCHA 3QYYA 1J5OA 3GJRB 1FRJA 3HX9A 2PMHA 3M30B 1JK9B 1TFYA 1CG2A 2NREA 3T1HJ 2AKWB 2HVDA 1U1PA 1WORA 1FVSA 3VALA 2HBRB 1SC1B 3IBFB 1VQKS 1U1NA 4OYIA 1FE4A 1H98A 1P6TA 5LSOA 2CQ0A 4LRCA 4JI0J 1UW9A 4QWBA 3H2UB 3ET6A 3FEXB 2IJNA 1RDRA 2G9OA 4X64F 3OW2R 4NEYA 2BQ3A 1VQSA 3W7BA 2ILYA 4K4SA 4ZDNA 5KFAA 1WEYA 1GEHA 5GAEI 1X7VA 2IM3A 5FIIA 4RBVA 4DR1F 1PC4A 2N4CA 4ZVQB 4KE5A 3VAGA 4K4VA 1IR2A 4TYBA 5J2PA 4OI1A 1S0OA 2B9XA 3GIKA 1T9VA 3J80Y 2QA1A 4PZVA 3A8JA 1JWWA 4WJBA 3K5MA 4HACB 1H3DA 1TKDA 2UU9J 4F4WA 1UJ4A 2VA2A 2KN4A 2IC3B 2E1CA 1CC8A 3WC2A 2W2NP 4HHJA 4K4ZA 1IM4A 4RU2A 3CD0A 4QIEA 2BW2A 1J2VA 3UDEA 3NNCA 2V8VA 2AJFE 1DQ8A 3CWJA 4ZPTR 1RI7A 3MPUB 4IOAQ 1R31A 2UVVA 1FX4A 4UOHA 2BJ3A 1C1CA 1SKWA 1TK5A 1RK8A 1WC1A 3BF4A 2IHR1 4PWDA 3SSSA 1JLQA 1VBXA 1RT1A 4O4RA 1S5ZA 4K8RA 4C8NA 3QIPA 2HNDB 2LQBA 1TAUA 3EVMA 1X9MA 3UW1A 5IWAF 2LKZA 3E01A 4E0DA 1NK9A 2VB6A 1O51A 1TKXB 1XNRJ 3MFHA 1PYSB 3EPGA 1RAOA 5KFKA 2ZOMA 2OI2A 2KU7A 1XIQA 2K06A 2JX2A 4IRCA 4USIA 3SI8A 2CQ1A 4ECUA 1VQ6S 1EX8A 3HM9A 2GVDA 3U7JA 5D15A 1J5EJ 2R2UA 3UD4P 1TP7A 2DPIA 4B08A 3BDPA 3MPYA 4J9LA 4PG8A 2GIFA 4WP3A 4IR9A 1UJ6A 2DNRA 1KDNA 3DOMA 1S12A 1JXEA 3ISZA 5AXNA 1E6VA 1ZM2A 3RR8A 2ZE2A 2WVDA 3KJQB 4DOZA 4K0KJ 2G0JA 1VFJA 1BGXT 3SQGA 1ZS6A 4OX7A 1TU0B 1YI2S 5B0GA 2G2OA 3MUVP 2CWXA 3NS6A 5KFMA 1GMVA 3LANA 2QT7A 1HQ2A 2DGUA 4G1PA 1HWJA 5EDWA 3BQ1A 3CGIA 1FFSB 3BGOP 2HFZA 3AB4B 3MUMP 3CCES 2O1PA 3SFGA 3CCTA 1PBAA 1TK8A 3JSMA 1NKEA 2D3ZA 2C3MA 5DGAA 1WOSA 4IG0A 3H4BA 4PG4A 4KC5A 3IN5A 2B6AA 3NKYA 1IUJA 2HQ3A 3B78A 3GQCA 4OHWA 4MK8A 3KLFA 3KK1B 1KHVA 1RWXB 1T11A 3P8BB 2JEIA 1X4CA 3RRGA 1B0VA 3WIUA 1TZ0A 4P2XA 1BHNA 4ZVPB 1T9TA 3MAAA 3N6NA 1XNQJ 1XBWA 2MQNA 1WC6A 1S1UA 2LU2A 1IM6A 3EZ5A 2G0IA 4ZCKA 1KBRA 1N6QB 4LF9F 1VLOA 2CPZA 2VBXA 1WSRA 1EP4B 1CPZA 3OL6A 2CQDA 1Q8BA 3S8SA 4DR6F 2GHVC 1C2PA 4C8OA 1NDPA 3VV2B 1NBEB 4OHZA 2FJXA 2I5JA 4DL4A 2VZ9A 4YMEA 5FDLA 4A46A 3D1QA 2K1RA 2F8HA 1NZAA 4ANEA 3M9OB 1BY9A 3LA0A 3MMBB 1JKHB 1IBMJ 3G2XA 1IQTA 3KDOA 4Y0FA 2YNHB 2QYGA 4IFYB 1B7FA 3PW2A 1D3WA 1PG5B 1X8DA 2DIVA 3O8WA 4V1Ak 3EGWB 2MB0B 1OYDA 1K8AT 2FHMA 4B3OB 3H7HB 1PCAA 2LP4A 3IRXA 2XSJA 1WTFA 2R7RA 1EARA 4U7CA 2ACMA 4J9VA 2ZJRQ 3FZ2A 2AGOA 3ZTRA 1VQYA 4CTAB 3P5TL 4DN9A 3MUTP 2Q1LA 2FQQB 5I3UB 3OR2B 2I2YA 1RQ0A 5A2QU 3FK4A 1B7YB 2VFUA 4C8MA 5J2NA 3M8QA 2FHOB 1T9YA 3OTCA 3TWZA 4NXNF 1LXJA 5DQIA 1UWBA 2DR7A 1F3FA 3BV8A 3IM9A 2J0XA 4WIIA 4S0MA 2SXLA 2R8KA 1FNOA 3Q8QB 1L5UA 5C42A 4WP9A 1XK8A 6FD1A 1S1XB 5CAAA 1BE4A 1H7XA 3T6BA 1LFPA 3IC1A 2DEIA 2CPHA 2FUG9 3V6JA 4N47A 3QZ8A 1QVFR 1S59A 1OQ6A 3SIPB 3ZZYA 1R27B 4EWTA 1XERA 1DBDA 3QQCD 5T7LA 2WVEA 1KLMB 2FHJA 1VHIA 1RLDA 1RWVB 1G3OA 3S7RA 4MK7A 4UQGA 2YTCA 2A10A 2CQ4A 3MM9A 3BS9A 2ZM6J 2E5GA 1RT4B 1UCNA 2ZHBA 1K73T 3POTA 4OHVA 2XS2A 3ITHA 4A8YA 3RB4A 1FRIA 5JMNA 2C2NA 1J5OB 2N4DA 1RHRB 5L46A 1S99A 3AOAA 4ELTA 1TL1A 4DR6J 1S1TA 2XWXA 5E3QA 8AT1B 1WOOA 5A8KA 2FTRA 3V6DB 1W25A 1HQEA 1TELA 4YB7A 2AW0A 2MLZA 3UN5A 4Z7YA 2WTFA 3ET6B 5GADI 4DXLA 2MKCA 2RB7A 1WELA 2FJEB 4ZP9A 4HKQA 3A4TA 1VRUA 4WK1A 1CQNA 4JI7J 2UUWA 4NZ0A 1PJ7A 1RKJA 3H2VE 4DG1B 2HRYA 3PHTA 1HHTP 3UDVA 3CJRA 5H9FJ 3NS5A 3HHLC 4ED5A 2CIMA 3QIDA 3B4MA 4YB6A 5J2PB 2Q3PA 2K7KA 2AEJA 2FVPA 4W90B 6AT1B 4FF3A 3ZZOA 1HD0A 3OTEA 5E5NA 1MU2A 4ATNA 4D3GA 5B0EA 2NXUA 5GAHU 4FPIA 1UFLA 1O0PA 1RSCA 1T0TV 1D1UA 1N5YB 2ZWOA 4FBTA 1WKLA 3C16A 3KK3B 1Q81T 2ASJA 2GX8A 2ZH7A 3Q86A 2YY3A 1VQ7S 2CFXA 1CJUA 4B3SF 2J76E 2LA4A 2JFDA 3BYRA 1F6TA 2VF3A 3M4XA 4ZPAA 4K7QA 4Q44A 2HQDA 1VISA 1CVJA 2PD1A 1N32F 3X3UA 1C1CB 2RH3A 2BKPA 1TUWA 1FK9A 3P96A 2XB2D 2DNNA 1MROA 5KFGA 5EWFA 4MIWA 2RUSA 3QIPB 2X1BA 1H73A 5HMWA 3M2UA 3F56A 1SXLA 3QJLA 1JLGA 4O4GA 3SCJE 1X0FA 4ZPWR 2HBYB 3WZ0A 3E01B 3GIJA 2NXNA 1U1LA 1U49A 3TJAA 2ZKTA 2RS8A 3EGZA 4DR7F 2B51A 5EX3A 3NP5A 3CCRS 5BXIA 1I94F 3O1LA 1U6FA 1ICEB 4W92B 2FY8A 3VCDA 3LAKA 2X1AA 1S10A 4PYDA 3W8GA 2HWIA 5CCMA 2BABA 2DGSA 1NK4A 3CIZA 3VR1A 3D7SB 2W1BA 1XEZA 4DL2A 4CO1A 2KXNB 4LRFA 2GHPA 2W2QP 2GVDB 4CLYA 4DV4F 5AXMA 3TAPA 4UQTA 4X62F 4QBUA 2AX0A 2Y9HA 4ALZA 2IY5B 3CD5A 3QRQA 3AQOA 3THVA 3FSXA 3QRPA 4M95A 3VGSA 2F4VJ 4NYZA 4ECVA 4RW6A 1H2VZ 2RD5C 2PMZD 2ZE2B 3NY0A 2GJIA 5F8IA 1FJGJ 4C97A 4O3NA 1JNRB 2V2KA 3QSYB 4KPYA 3AFGA 3MM7B 1RWPB 3CCSS 3IR5B 2K7JA 1RP5A 3CO9A 4ECZA 3GP9A 3HHKA 1SH2A 1JLBB 2HFSA 4M94A 5HK4A 2QFIA 3TARA 3GE9A 4TU7A 3M1VB 3Q8SB 5GAEU 4USWA 1FE0A 2W4PA 3KJVA 2VG7A 5M2PA 3FNNA 3QFHA 1CJVB 3UN2A 4IG0B 9ATCB 3EWGA 5ETSA 1OY9A 2DGTA 3R7BB 3PIPQ 2B6AB 4CWBA 3RBXA 2OHDA 2BQRA 1IKXA 1X0PA 2WONA 3IAM9 4ZPBA 3KLFB 1VC0A 2GFFA 1S6UA 4F0HA 4Y28C 2YWWA 4WPAA 2YX4A 1DJ0A 4JI4J 3PHEA 1RACB 4QZVB 4PUOB 1FVQA 2ZOGA 2N7YA 2OLWA 3QO9A 2XQCA 4DR7J 4GC6A 3FVYA 2RU3A 1TKZB 2HVEA 3K2YA 4DI6A 3DGPB 3DLGA 4QWEA 4EFAC 4RKUC 5HMYA 4H54A 2HK2A 1U1RA 2E29A 3PY8A 1YZ6A 3AJ1A 4DCJB 2IAJA 5H9EJ 2GC8A 2C3UA 3AA9A 2I5JB 4X62J 1C4CA 5FDLB 1RWOB 3TANA 2V2VA 3NS7B 2ZC4A 2R7WA 3CDBA 2XCPA 3ISNC 1OWXA 2VUGA 1NSPA 4F3MA 4RW7B 3MR2A 1N34F 2HQFA 1Q7LB 1KHWA 2ZHAA 4I68A 4ZKAA 3MR7A 4P72A 2GMJA 1OPIA 2RSQA 1NEEA 4U9RA 2NUUG 2Q66A 2Y1IA 4QPTA 2I6WA 2BACA 1QAYA 3RBDA 4NCGA 4ZP8A 1SJ3P 3W66A 3R8YA 2DRBA 3JAMY 1X9SA 1SV5A 2J0SD 3FRYA 1RXOB 2Q6BA 3KDNA 4Y00A 2ZBRA 1PYTA 3H40A 1MN7A 4KGMA 3GZ7A 5KFQA 5J2NB 3J81U 3M8QB 3VVTA 4ZVOB 5DS7A 2WK4A 1RHUB 1UWBB 3CJQA 1YZ7A 3ILIA 3LQVA 3NBPB 4URSA 3CCZA 4W4MA 4CNZA 2ZNYA 3NEKA 3IBWA 3CDWA 2DGVA 1OY8A 5HVFA 4M5DB 2RAQA 5C42B 2J0QD 1WD6A 5F41A 2PEBA 2E9ZA 2WVBA 5HQLA 5L9XA 5HLFA 2YKQA 1IR0A 3I5BA 1N5QA 2F65A 4OYPA 2LA6A 1SH0A 8ATCB 2FLOA 1G7CB 2KM8C 1AT1B 1JLEA 2DCLA 3R5BA 4DR5F 3T6JA 3HHLB 3MM9B 4IO9Q 3ITHB 2XZDB 5MAOA 4YR2A 2HLUA 3ISND 3DHWC 4G1IA 4X4PA 3CJ2A 4Y3CA 1H72C 3GJTB 1TL1B 2NXJA 3TZXA 5L1KA 1S1TB 4ZVRB 3SEOA 5DQGA 5A8KB 3F73A 3CPWR 1IJFB 1HQEB 1Y5LB 1SIWB 4RU9A 5J1PA 1NHUA 4KR0B 2VASA 1N54B 2YX7A 2IRUA 2IA0A 2WB4A 2AIRB 5CD4H 2AHOB 4QYRA 2NZCA 3KLEA 4WYLA 4LFAJ 2HMIA 3FMWA 3NAHA 5KT6A 2YQ0A 3NWGA 4N7TA 2AYMA 1EKRA 3BREA 3MMCB 3BBBA 5EN1A 2ZZNA 2HWHA 2XY7A 5B08A 3CMES 3UDLA 1YRXA 4NI2A 2UXBF 4CDIA 3KUGA 4M5IA 4C9DA 3GYXB 2FVRA 1MU2B 4Y2AA 2AGQA 1S6PA 2OPPA 3TI0A 3K7RA 1I51B 4A8KA 1IBKF 4NMLA 1UEKA 2P9GA 1BXNA 4RWXA 1NKCA 3N01A 5KAKA 2Y0SD 1VC6A 1S1VB 1BMQB 2BBEA 2EWHA 3OFFA 2XMJA 3MCMA 4C0HA 1CJUB 4LSNA 2DHXA 3S01A 3F0NA 3CJSA 4NLPA 3C14B 3D3CJ 8RUCA 2MY8A 2IMOA 4HYKA 4TY9A 3DLBA 1QAIA 3CJ0A 1MROB 3HXMA 3BM7A 4FYXB 3JSBA 3CD7A 3M2UB 2G4BA 4ECTA 4O4GB 2GS8A 1KOOA 2HFVA 3EZUA 4DPWA 4AT1B 5E0OA 3T5HA 4ES1A 2GQCA 2OEMA 4F67A 4DR2F 4A8WA 4FF2A 1F5AA 1IKVB 4NLWA 5ETRA 1AYEA 2X3GA 4CLWA 3W62A 4K5SA 4JV2A 4NXMF 1NSKL 1FRHA 1LOUA 2DHAA 2CQHA 2Z4PA 5CZXA 3DGVA 3LAMA 4KPCA 4OV1A 5HBMA 2VBZA 1YG0A 3OVAA 4ED8A 3OVBA 3D28A 1Y10A 2RHSB 1UVIA 1N56A 1DTQA 2CNNB 3R5AA 2BRKA 2IRXA 3GV8B 4KV8B 5A8WA 4DF8A 1R0AA 2APOA 4UZCA 2EKYA 4TU9A 3O2IA 5IS2A 3KLVA 1NPKA 2R4FA 5IV4A 2R42A 1YTYA 1YWXA 4OI4A 1L3KA 2G2YA 1OPZA 1U6ZA 5F9NA 2XNQA 4M5NA 4J9UE 1U4BA 4ZN1A 2GQQA 4DZDA 3PKMA 4CCHA 1HBNA 4AE5A 5GADU 3DLLQ 1IBKJ 2OD4A 4PCQA 2Y1RI 5HP1A 2DGOA 4PXEA 3PV8A 4GVBA 2HZAA 2H5IB 4HHUA 1HQUB 4CLFA 1YJ9S 1PJ6A 3GFYA 4OX6A 2VG7B 4M5LA 3GR0A 2HWTA 2RQCA 5HSPA 4M8LA 2VICA 4D3HA 4WE1A 2ZH5A 1HD1A 1YRUA 4JI1J 2CJ9A 4OYZA 3C6TB 2WONB 3T5JA 4DQQA 5B7WA 4FKYA 1YGYA 2BJ7A 2KVQE 3ZO7A 2DNPA 2C2KB 5HL7Q 5DLGA 4HL9A 3BPDA 4FF1A 1MSWD 2HGLA 4ZVUB 4RUCA 4ED2A 3HDSA 3N0VA 5LOQA 3QO9B 3RAMA 4QR2A 3QBCA 4O3RA 5D4PA 2FLNA 2B5JA 4BBYA 4PG5A 2NPFA 2B4VA 3N6LA 3BKTA 4NXMJ 2I9SA 2GIQA 3H20A 2CVEA 1SQFA 2B9YA 2IAJB 2EFNA 1BD6A 4N8OA 3MXHP 2VOPA 4P2FA 2YPYA 2DIUA 2O3DA 3HHEA 2HAFA 2DEJA 5C2GA 2UXDF 3BPSP 2KG0A 2CJXB 3TA0A 3LP1A 2IJRA 1T03B 1AB8A 4FNIA 1RTJA 2KT3A 2FGCA 1SBRA 2P6TA 4Z37A 3SBMA 5BYSA 1QDUB 1Q1KA 3N28A 4E98A 2GGPA 5GAGI 2J6SA 4UT4A 4A8XA 2GMHA 2EBGA 4K4TA 2XI3A 4N41A 3M7VA 1ZAWA 4YR0A 2DT9A 1QD1A 3I9V9 5HATA 2KXHA 2IA6A 2XLKA 1SV5B 2KM8B 5RUBA 4AFFA 1FKPB 3H5XA 4LR9A 2R3VA 2XULA 4OZ3A 2JEGA 2E7VA 4I6AA 1YX2A 2YQ3A 2DD8S 2IPOB 1VI7A 3RAXA 3RB0A 5KFWA 5B0CA 1JNZB 2VJUA 2KJWA 3NRBA 1ZA2B 3DRSA 3FFIA 5F8MA 1P9YA 2YPZA 4NLXA 4EBEA 4IOBA 2KZZA 5AE3A 2GZOA 2FDNA 3M2RB 1REGX 4RX6A 3V81A 3CCLS 2BM0A 4DUYJ 4CYUB 1EIYB 1NH8A 4FYWB 1Y7PA 2MKYA 2YWEA 2BZ2A 3TZZA 2MHNA 2WHOA 4ETXA 3KYLA 3CF5Q 3MWBA 3U1LA 1JLEB 3EXYA 2YKMB 1KWMA 1U8WA 2M8DB 1YBUA 1U1KA 4DPXA 1ZAVA 2QL7B 1HNWJ 1Q8LA 1MMLA 3UFCX 4NMXA 4RWWA 1HNVA 4L75A 4JYAJ 3BYPA 1NO8A 3MPDA 3IGVA 2WAQD 3GYNA 3L4BC 2A6MA 3HFZB 4I7FA 1SUQA 1GAOA 3UCZP 1ROFA 4KHRA 3CDUA 1X9WA 1LKZA 1V5VA 1ACMB 1X5TA 2XLIA 1CULB 2GO9A 1RT2B 1QE1A 4WK3A 3OUYA 2O67A 3OXGA 5DDOC 4OZJA 2R7VA 3W63A 4FS2A 5GMKa 3Q2TC 4KKOB 2EI5A 4C0OC 1M5OC 1WI6A 2UV8G 1YHQS 2XMVA 2AMCB 4WTYA 2X1GA 2DH8A 2F8EX 2WW4A 4YS2A 2PA3A 2CJBA 1T05B 3W3SA 4U67Q 2JSXA 5DRKA 2MLYA 5J1EA 1JLCA 4PQAA 2OPPB 2E9TA 1Z2ZA 2DH9A 3R27A 4E2FB 2A2CA 3DLKB 4DSJA 1Q16B 3MECB 2AWZA 3SV3A 4KYZA 3GJSB 4J7CA 4OLPA 3LP0B 3NMAA 3K57A 5J2MA 3CUNA 2PI4A 5HVGA 2ADCA 5IV3A 3HK2A 4A8SA 2Z56B 2W9BA 1Q79A 4JI8F 2JLFA 4GKJF 1N0VC 3CCQS 4A8FA 2XNRA 1RT5B 3Q8VA 2H48B 4HLBA 4I6YA 4JI6J 2FHJD 5K8NA 3U02A 4NLTA 2HFNA 5C25A 1LWFB 5DQHA 3OHBA 4ZA1A 1AUSL 2KH9A 2Q6CA 3BEGB 1WI8A 1WC0A 2M9KA 5DETA 3CO0P 1Y9OA 1E6YA 2IM0A 5JVGQ 5F9LA 1SJQA 2VQEF 1C0TA 2GMLA 3TVKA 4J9PA 2PGCA 1HL6A 1U24A 2OMOA 4F04B 2MJUA 4Y2KA 3Q0AA 1GXUA 1GMWD 2PC6A 2YKOA 1LW0A 5K20B 1VRTA 4DQPA 3TUZC 4NLDA 2L9NA 2FVSA 2R8IA 1Q8IA 1UTAA 1UP1A 5HBMB 1R6YA 3D6HB 3DM2B 2WB1D 5LT5A 1IVZA 3W2WB 3KHLA 4FYVB 4U6PA 2FZKB 1DTQB 1HBMA 1UVMA 1T02A 2ZH2A 2XS5A 5A8WB 2FLPA 4ZITA 3KMSA 1DZ5A 1MW7A 5C7PA 4IR1A 2PI5A 2K3KA 2EBEA 3OR1A 3NNHA 2VDIA 1WF0A 2RHQB 3KTQA 4ITSA 4CT8A 5J1NA 2HFUA 1UZHA 3NGKA 1VHFA 1NZ8A 5D0EA 4PG7A 4QWCA 1VJQA 4N5SA 1WG4A 4DHVA 2BKNA 4LF6F 5HP1B 1RYSA 4XDCA 1N8RT 3BO4A 1KP6A 1Q86T 4GVBB 1JXVA 5EWEA 1S9GA 2NCKL 5A2QY 3MM8A 2UUAF 2UXCJ 4HT5A 2YWHA 3TNVA 1VIXA 1S97A 4YB5A 3A8IA 1NPRA 2FPHX 1VQ8S 2E44A 1CSJA 2WOMA 3B6BA 3CC7S 3MMAA 1RTIB 2MPUA 4LIRA 4DFKA 2VKRA 1KOHA 2BDPA 5C2CA 1WHVA 5KFFA 2YNGB 2VFSA 4DX6A 3TQ1A 2B8PA 3I4HX 4BHQA 3A13A 3SCIE 4MKBA 2B0GA 1WKKA 4NE9C 1S49A 1LK7A 4WFNQ 2XG8A 2VQEJ 5DDQC 3OL7A 4TQSA 1VCTA 3NMRA 1F5CA 3NCRA 4X4VA 3FRZA 4WU2A 4RNNA 2DNLA 4X65F 1VR6A 3PZPA 3WX4A 4I67A 3A8KA 4JOUA 4RO0A 2IBOA 5DM7Q 1FDBA 4KFBB 4FN5A 4RBUA 4WFXA 2Q43A 5B0FA 2V63A 3KNGA 2DNHA 2JEJA 4IFVB 1JJCB 3IBCB 3T9NA 2UUBJ 3LP1B 3M8SA 3GCWP 4USTA 1TV6A 3ZNJ1 4Q8FA 2HFOA 4B9LA 4OX9F 1IKWA 5L39A 4AL7A 3A1YG 3A3OB 4GKKF 2GGPB 4WWSA 4FS1A 1J27A 4Q5VA 1ZYQA 2V2ZA 4NWBA 3MEGB 2J6UA 3AT1B 4FXWA 3DU5A 4C11A 3FBBA 2CG8A 5F0WA 2L48A 2CVIA 3M30A 1NCLA 2DRDA 1KVIA 3QJPA 2PN6A 4C8ZA 3IGNA 2E5LJ 5K8PA 4RNMA 1M0SA 1VC5A 4ZPDA 4M1KA 4PXCA 2C2DA 2ZDPA 2XCAA 4CRJA 2OSQA 3V4MA 3V5RA 4RW8A 1SVDA 1OSCA 4K5RA 5CD4A 3DRSB 2BOAA 3I56S 4Y2IA 4DR3J 1HARA 5T41A 2KG1A 3AH6A 4FXDA 3EMTA 4C7QA 5KG5A 2PMWA 4PWUA 5E41A 3BGUA 4C4WA 1I5OB 3JSRA 2CQBA 2MKSA 1U8SA 2DR5A 1FF2A 4EMDA 1SKSA 1UVNA 2RDIA 4TY8A 2BJ1A 3DLHA 1R7IA 4NA1A 1FDDA 4J90A 3DDKA 2XMKA 4J37A 1ZAXA 3JYTA 2RE1A 4IQXA 2BJ9A 1RUSA 3MGJA 4NA2A 2IC3A 3ZXWA 2MZ1A 5KFPA 3R2CJ 1WUUA 2FC9A 1FD2A 4PPZA 2WVCA 1HMVB 1CBKA 1CS4B 3BSNA 3MOZA 2QLXA 4RPFA 4YY3J 5E33A 4X65J 3PVXA 4BDPA 1HNVB 4B02A 3EXCX 3TW0A 3SXLA 1SPBP 2DJWA 1M1KT 4U7UK 3PTWA 3JTNA 1HI8A 2DXFA 2M0GB 1SKRA 3MHYA 3NAIA 2F3JA 3BN7A 2WBMA 2YH0A 5FD1A 1D9FA 1RWUA 1AUDA 3GCXP 2O01C 1LK5A 2BYCA 5A76A 4TVAB 5BR8J 5B0AA 3HFVA 4LF8F 1FXLA 1GT8A 3I82A 4ECWA 2C2MB 3MFIA 2JRSA 3SFUA 2KZMA 1TKXA 2B4UA 4IH7A 4A8OA 5H1SV 1JQGA 2NXCA 3UWTA 3C46A 4OZ5A 3AY0A 4P2MA 2LQ9A 4IYQA 2LCWA 2KFNA 3H4DA 3DC2A 5CZVA 2V9WA 5J1EB 2CPDA 4J9QA 1MNEA 2VFTA 3QT6A 2JLEA 1U47A 3M8ZA 4J5OA 4PPDA 1BUXA 1TUGB 1RU1A 1FJEB 1N88A 1T9WA 4DV1F 1JIHA 2AX1A 3CD6S 3HT3A 1XMBA 5KT7A 5GAGU 5KFOA 1WEZA 4F26A 1V3RA 3PW0A 4IUFA 2ZZTA 3TJ8A 2CJYB 2ZUGA 1XR7A 4ECYA 1G2EA 2XHWA 4OIXA 3NWRA 3EM1A 3MURP 2IVYA 4CLPA 3B4DA 3G8TA 3H0PA 5C25B 3ZZRA 2JC1A 3M6UA 3FUYA 3A12A 1ZM4A 1FT8A 4B9TA 1WHYA 4A47A 1WSVA 5D3GA 4DSKA 2IBKA 4DL0C 3I55S 5KFXA 4I69A 3OXFA 3J7Z5 4WZMA 2XY6A 3RR7A 3FZBA 5K8OA 4DV6J 2DR9A 5LSLA 1NJWA 3SYZA 1X4DA 4QWDA 3UR0A 1LW0B 1VRTB 1Q0NA 2GQ2A 1NSAA 2LEAA 5LMNF 2ZITA 4FXVA 4OHXA 2CG4A 2VL1A 2EG2A 3BGFA 5I3QA 3AOBA 2JVOA 3KK1A 1NRKA 1C1BA 1FRXA 1HBMB 1U02A 3GJQB 3FBEA 4TQRA 3G8SA 2WSCC 4LF1A 5EWGA 3ZTPA 3GFZA 2F1FA 4LFCF 3I31A 4OYMA 3OR1B 1QUVA 3GYGA 2RRBA 3D6FB 2CUYA 3GILA 4B3TF 1WHXA 4HEA9 2ZH1A 3Q24A 1N6QA 3LH2S 1EP4A 3TA2A 4GO5X 4OYBA 1CC7A 2B8QA 2Y8WA 1ZOTA 1QVGR 4WTOB 1B64A 4JI5J 3H8YA 1RGVA 2P6SA 1X4AA 3AXMA 2DGQA 4LBIA 2JZ5A 1U1MA 4NRUA 2YNHA 4F3OA 4IFYA 3J81Y 3LTOA 1GMUA 2GW8A 2WOMB 1HR0F 3VZIA 3MMAB 3ENQA 3QAEA 3I0RB 2DNKA 2FD2A 2BEFA 2XBPA 3M05A 3RUBL 2PO4A 1GFWB 3DOKB 4ES2A 3H90A 2FLLA 5I3UA 2DO4A 3MPWA 5D0GA 4LUBA 3Q2SC 4LJMA 1H74A 3CCJS 2UVWA 3HCXA 1YBAA 4PEOA 3BO3A 2E9RX 2WVFA 3T19A 1Z4UA 2RUGA 5A6PA 1FJCA 3C15B 4LF4J 2QA2A 4RNOA 2QSWA 1WC3A 1SIZA 3C66A 2R2SA 4QOTA 3H5SA 3IS9A 4O0NA 3CVKA 3TJ9A 3PM9A 1S1XA 4CI0B 1A6LA 1DHMA 5KFYA 2LYVA 4UF4A 2JH3A 3AHPA 3AJDA 1K0TA 2CJQA 1OYEA 3W1YC 3KG4A 5IT0A 4C3KA 2RVJA 4RW4A 2EC2A 4IRDA 3ONQA 3GWCA 4EGLA 4QIFA 3O44A 1IKWB 3THPA 2X7IA 2VPZB 2QA4G 4CT9A 3UNGC 5AE1A 1XR5A 3RTVA 4M63A 1BWVA 1RT4A 2MQPA 1M5PC 3OFEA 2GCFA 2UUTA 3RZAA 4J9OA 1HBUB 2ZJPQ 3G82B 2DB1A 2Y8YA 4UZBA 1I1GA 5LM7E 1HNIA 4O3SA 3TAMA 1S79A 5SZTA 3V6DA 1U7LA 1KSPA 1A0OB 4KY3A 3M8WA 2YQ1A 1RABB 3M8YA 4N8NA 4RW8B 3R5GA 2HBQB 2E66A 2HRUA 2AV5A 2NS1B 1VQOS 2JWNA 4Z2XA 4LBHA 5DG8A 4ZCIA 1V3ZA 3VWSA 3OL8A 3E3XA 1UVLA 2J9EA 4DG1A 1HR0J 1IXKA 4H4OA 2N7CA 4WU3A 4X84A 4MYUA 4TY8B 1QLNA 3HSJA 2CJKA 3FMBA 2D3O1 1B4SA 3FSYA 3G6VA 5IFMA 3D0HE 3PACA 2R2RA 3CSKA 1P9QC 2CPJA 3GFXA 2OO4A 3JYTB 2C3OA 2ZUAA 4NYPA 2N3OA 2VC0A 1N5YA 1ZZNA 4RUAA 4CO0A 3KK3A 2F4FA 1G4CA 3G86A 4KIAA 5CA5A 2XHCA 1RU2A 1T9UA 1Q7YT 4MKYA 1OJ4A 5L9NA 4HDHA 1RLCL 1HA1A 4AQYF 5D78A 3LW5C 1M90T 4V19J 4ECSA 5HQ8A 4ZPVR 4JI3F 1CEZA 3PJ9A 3GB0A 5KFZA 4ZCLA 3VQSA 1X4BA 3TX8A 3T1YF 3LGNA 4ZS6A 1R8BA 1Q8KA 4P73A 4Y34A 1NNDA 4LF7J 3VTIA 1JMTA 3R7NB 2PIIA 2XMTA 3NGTA 1SCJB 1RWMB 4I56A 4PWWA 1GNKA 5KFBA 1OS5A 1PIEA 4KH0B 4NZ7A 4LF5J 1ZH5A 3MD3A 1LWCA 4LQ3A 3CJ5A 1RA6A 1S72S 3QGIA 1RAIB 3TO8A 3WQPA 4JV1A 1WACA 1WOPA 1O5JA 5F8GA 4F4XA 3W9HA 4HH0A 4ED7A 1HI1A 3P45B 1KC8T 5E3CA 3N79A 2V4RA 1K1SA 3IXQA 3PRDA 3EVOA 2UVRA 3IAS9 4CH0S 4K59A 3J7AN 6FDRA 5B0BA 3CCWA 4X64J 2GAGC 5JJBA 2HHVA 3QWUA 2OFHX 4DL5A 3U1NA 1KFDA 1F9FA 2JC0A 4MAKA 4MMOA 4ZLLA 4TU8A 3T5KA 2Z2LA 2DNYA 4DV3F 3W5XA 1XMOF 1DQAA 3R5DA 4HI1A 3ILLA 2AQ4A 1UKUA 1JXLA 2DGWA 4C8KA 4DR1J 1BQMB 3I0SA 1FEEA 3CTRA 3G71S 2H65B 3HZGA 2ASYA 4DX8H 2H5JB 3PCOB 1DURA 3H5YA 2V8HA 2VPXB 1MWQA 2UVUA 1H38A 2E5HA 3CDEA 3OPKA 1LV5A 1IQZA 4YB1P 2GA7A 4URQU 3MM7A 2GHWA 4DQSA 2Z2MA 4KQZA 4USJC 3KFWX 4F2SA 4JV5F 4ES3A 5D3GB 3P3DA 7AT1B 1KVKA 2V34A 1JLBA 2MKKA 2P8IA 3G96A 4JUZA 1NJXA 2XLJA 2QZ8A 3M1VA 5ETQA 5HMZA 4P6QA 1WF2A 2YWFA 4K4XA 4WXOA 3VVUA 1CJVA 4C98A 4RJVA 5KG6A 2AYGA 1Z2LA 5HANA 5F0UA 4JI3J 1QUPA 4J9SA 3RW6A 5KFSA 3BR9A 2O66A 3M6XA 2BM1A 4YHHF 1C1BB 4KHMA 1WF1A 2KKHA 3QSIA 3LWLA 3EDRB 5IWAJ 4PUOA 2ALYB 4ER8A 1X5OA 2Z0GA 1YJ7A 4L3NA 4CNYA 2JVRA 1ZETA 3D54A 1WNEA 1TKZA 2NXEA 1DTTA 3DGPA 3PO4A 1NDCA 2OKQA 1B3TA 2VG5A 2IYGA 2MSTA 2HGMA 1QTMA 3I5AA 3H25A 1S9EA 2D3UA 5F8HA 3PEHA 2ALZA 3L9ZA 4ICLB 1NSQA 2VJVA 3MAHA 3FSIA 3HT0A 2IVFB 4WFAQ 1HPZA 1RT7B 5ETLA 2VU5A 1KQFB 5DDRC 3TQEA 2FJAB 4RW7A 4K50A 5B09A 4WFBQ 1CJTA 2LEBA 3PR5B 2UZAA 4EK2A 3IM8A 2YKNA 3JB9k 5E3PA 3V2UC 1Q82T 3D0GE 3L95X 1RHKB 2MQOA 2BW7A 3NGDA 2B4OA 3DOLB 2WSFC 2OUGA 4NX9A 2J7KA 1H2UX 5D6GA 1KEKA 1HW9A 4K4UA 4Q0BA 2CNOB 2KDOA 3MEDB 2J5AA 4WF9Q 2BJDA 2CZ9A 2QC3A 3NBPA 2DR6A 1Q5YA 1M1HA 1XMQF 2VC1A 1V3SA 1DARA 3BKUA 4C8YA 3Q83A 4L76A 4M5DA 3X1LB 2EEYA 3IS9B 3MR3A 3HD2A 2NPIA 5KFEA 3VGTA 4IKAA 1CLFA 4OYXA 2RT3A 4OJGA 4HTIA 4F02A 4LFBF 3THTA 4RW4B 2EK1A 3W5YA 4KJIA 3I87A 1S4EA 1TUVA 3GIIA 2C42A 2BKOA 1L3TA 3HHLA 5F8JA 1TMMA 3DFEA 2ZH3A 3SV4A 5G4DA 2F63A 3ILOA 3PJWA 2LXFA 3DRPB 3HPOA 1RTHB 1RWWB 4LF9J 2MHEA 2VG6A 1VQ4S 3WC0A 2NUHA 4XPEA 2W7OA 1OMSA 4I0WA 3MM5B 1X4HA 1HNIB 5D0RA 1FNMA 1Q95G 1T8EA 1FRKA 3E8OA 3TAMB 3CJ8A 2J9DE 3M32A 3TUJC 2DCUB 2OP5A 2CNLB 1NHKL 2F8MA 2QV6A 3HMJG 1HWKA 2HIYA 5KT5A 4C2MA 1K1QA 1FXRA 1QSLA 2EKNA 3K58A 1ZPWX 1TL7B 4Y2CA 2PE8A 2FJDB 1MMDA 4CH1A 2HHPA 3BO2A 2E7XA 1C0UB 1BQNA 2E1AA 3H42A 3MMCA 2XTJP 1H6KX 4H4OB 5K8MA 1QSSA 4R8UA 3AOCA 2DRAA 3BH6B 3OTOF 3G6YA 3PX4A 2K8GA 4DU8A 1N0UA 1MG7A 1EQ0A 3OHAA 1NMEB 4H4MB 2P2CB 5DLFA 2GJFA 4NXNJ 1D9AA 3G6ES 1NHVA 3I9ZA 3O3LA 1S1VA 1W26A 4KO0B 1XMQJ 1EJ7L 3OJUA 3DXBA 3PEJA 5IZHA 1KQKA 2JFKA 3OQ2A 3PFEA 3C14A 2PFFB 1TFWA 3KUEA 5KFLA 2LXUA 4RLEA 5C24B 2R9LA 3DYAB 1U0SA 2DBBA 2R7OA 1M5SA 4OZNA 4LFBJ 4FVMA 2JNJA 3LP2A 3ENVA 1TKTB 2MZRA 3U27A 1RWKB 2KTQA 4LBPA 4YR3A 5DJBA 2ZH6A 4DSIA 1FTRA 2WCXA 2GIRA 2EXUA 1SB6A 1LWCB 1IKVA 3I4PA 1OSDA 2IDLA 4XTTA 4A48A 4XIUA 4HI2A 3HSDA 1VQPS 2NLWA 3UVJB 1VQLS 4R25A 4DFJA 4K4YA 2ZH4A 2QEXS 1RWNB 1U0HB 3Q89A 3GG0A 1HWIA 2DPJA 4ZJLA 1WHWA 4YEAA 4IRKA 5CQGA 4QW9A 1S7HA 4OJHA 2KHDA 4OYOA 4KV8A 1BC6A 3LF0A 5J2QA 3TP2A 5ADZA 1XN9A 5D8HB 1KLNA 1YLXA 3I0SB 4OL8A 1WEXA 4OZ2A 1GXLA 1SL0A 1FX2A 4L3KA 1RBLA 1G6BA 2OEJA 2PEHA 1CJKA 4IG3B 2KJVA 1DRZA 1NKBA 2HVIA 4I4BA 5IM0B 4ELVA 2EC0A 2HBZB 2RRAA 4DL7A 4BC9A 2KL8A 3LPYA 3LGHA 3TUIC 2HIQA 3EDQB 2N82B 2V8DA 3D68A 2OD6A 1VBKA 4MFBA 2CRLA 1HQUA 4X4OA 4FYDA 4EUVA 3PYEA 1VQMS 4B3SJ 2DNMA 1LFWA 2KYZA 4YDDB 1NM2A 3MI7X 3RW7A 1LW2B 3DU6A 1N32J 1APSA 2PSZA 4UOGA 3K5OA 1FDNA 3HFKA 4FF4A 2B56A 3C6TA 2XZTB 3T1HF 5AXKA 4DPTA 2M88A 1RT6A 5CH7B 2QSFA 2YX1A 4ED0A 3NGRA 5U47A 3DLEA 2G1HA 4USVA 1R89A 4JI0F 2XO6A 2B43A 3FDSA 4ILLA 1HW8A 4XK8C 2QO3A 3MCSA 1I6JA 5CYMA 3TRGA 1KTVA 4Y6IA 2MKHA 1I94J 3VGUA 3CXCR 3KXDA 4B3RF 4OJ3A 1DTTB 4NA3A 3N5FA 2VG5B 3A8EA 3GR1A 3QZ7A 1RT3B 1S9EB 2VPYB 4U8YA 4DZ6A 4YUDA 3KLIB 4DV4J 4CLSA 3HVAA 4LR8A 3MEEA 3VAIA 1HPZB 1IN0A 1T03A 1NPPA 3NOCA 1UETA 2Y1JA 3M6VA 4U95A 2AYEA 1CJTB 4TLRA 1LEOA 4P9SA 4ZIVA 2JOQA 2YKNB 1RCOB 4U96A 3UPFA 3UD3P 3CJTA 3RBZA 4LT6A 4DWIA 4Q2MA 4EYIB 1FKPA 4NASA 4F0KA 3DHXA 4NL5A 3ICLA 2HHTA 4KRWA 2NYIA 1U45A 1TK0A 4Q0BB 1S7IA 4NLOA 3W5ZA 3PDNA 5HROB 4OX8A 3RG6A 4P7VA 2VV5A 4X66F 2DKOB 2ZWPA 1XNRF 2C22A 3RGIA 2ZNZA 1KNZA 2L41A 3M2RA 4PQUB 3MD1A 2RRNA 4P74A 2QX0A 3DN9A 3Q8YA 4P75A 1MWYA 1Y11A 4CYUA 3CB4A 3ZZ0A 1S1WB 3FCVA 2CA9A 4WP8A 4Q7AA 2JEFA 1J5EF 4MYTA 5IXUA 1RAJA 3D67A 4U7UD 4DX7A 4C3LA 2HHXA 1VLYA 2YKMA 2B9WA 5KG0A 4NLUA 4ZLJA 4CQ1A 5L1IA 2HZCA 1MWZA 4B3RJ 5HVHA 4XO0A 3Q23A 1KKHA 3I32A 4DR4F 2OPRB 5HI7A 3UD5A 2VG6B 4K0KF 2VHGA 1UPPA 1U26A 4XDDA 2HHUA 2V50A 2Z57B 3HVTA 5C5JA 3M32B 9RUBA 1DLOB 2LLZA 2R7XA 1R0BG 1RAAB 1F0XA 2V5HG 2W7AA 2C1EB 4R0EA 2FZCB 1RE1B 2DTJA 3MR6A 1CULA 4RUHA 1RT2A 5L1JA 4G1QA 2RKIB 1N34J 3DI6A 4EO6A 2W4DA 1TQLA 1TR0A 3D6MB 2H1YA 1A7GE 4ZVTB 4KKOA 1BQNB 3CULA 2R7QA 1EETA 2ACYA 3C8YA 4R8UB 5HO4A 3LWMA 3DRYA 4DEZA 2V68A 1LWEA 1Q78A 4ID5A 1T05A 1M5VC 2CYYA 4USKA 1HIYA 2EK6A 2V4JB 4DSFA 3MM6A 3DXSX 3K0JA 3TOQA 4QYZK 3DLKA 4NCBA 3VF0B 2W9CA 1PGZA 3MECA 2IJFA 4AXIA 4X66J 1XNQF 3LP0A 1AROP 3K5NA 5ETKA 1TL3A 4X2BA 3MZIA 3KKFA 4NPOA 4YN3B 2LU1A 2F7VA 4NLQA 5ETNA 1RT5A 1YJWS 4EEYA 1N5VA 4PABA 1LWXA 5K14A 3LP2B 1Y4ZB 2VONA 1HLWA 1LWFA 2O5DA 2W2MP 2HHQA 1FFWB 2RS2A 3IG1B 5AJ3F 1PC5A 3CNQP 2V8GA 4C6AA 1IBMF 4CO5A 3D2WA 4DR5J 2DITA 3GU0A 3BB5A 4HHHA 2MDAA 4DR4J 2V2QA 1VQNS 1ZPVA 3HVWA 1FWKA 3PIOQ 2VOOA 5D4OA 3HP6A 3DDNA 4CLZA 1NK5A 3PYDA 1YVFA 3J7A1 1KFSA 2W7PA 2DXEA 3R5CA 3GV7B 2CQGA 4NLVA 2DNQA 3DM2A 5THWA 2M7SA 4DV7F 3W2WA 2WW8A 3R7SB 5ETTA 4FP9A 3PX0A 4ZVGA 3EE3A 3US5A 2MKIA 5M2UA 3CT9A 4ZVFA 1W7WA 2Z8QA 2RILA 3EX7B 1ZM9A 4FVCA 4LSZB 2A0FB 2CZVC 5J2QB 1RKIA 1VRQC 4QJVA 2X51A 3FKBA 2OPSA 1FERA 1QM9A 2HPUA 4AYBD 4BC7A 3RYLA 2FVQA 3MF5A 2HSEB 5LJ5Y 2QL9B 3EGNA 2UXBJ 1VBZA 5ETPA 4ELUA 1CJKB 4ED4A 1IJEB 2HHHF 3Q8UA 1H0HB 5KTQA 3RJMB 1DQ9A 1U1QA 3GMGA 2HLTA 2IRYA 3P5BP 3FEYB 5KFRA 4M5GA 1S0VA 3F41A 1PILA 5L1LA 2LEPA 2Q79A 2W2PP 4O3OA 2C2RA 1GTEA 4MFBB 3M8PB 3FGVA 1YK9A 3JSYA 5ETMA 3DMJB 2ZM6F 5D4LA 2Z2ZA 2ROGA 4NLRA 2RNEA 3GSIA 1Y3KA 4DS5A 1BLUA 1UAWA 1SC6A 1RTIA 2K2PA 2QN6B 2Z30B 4MH8A 4R0JA 1RT6B 4L73A 4UUXA 3OLBA 2ZBIA 1PAEX 4F25A 2YNGA 2B3TB 4RNHA 2DH7A 3DLEB 4UOCA 2RJZA 3UNYA 4OZ1A 3V4IA 3ZTOA 5AJ3J 5F3ZA 3MCNA 2L9WA 1BWEA 5CYMB 4BLGA 1Y0HA 4DR2J 5D0HA 1UFWA 4JI7F 3FCWA 3QT5A 4WZQA 1V9OA 2ASLA 1D09B 4MK9A 2N3LA 4C0BA 2CDRB 4DJBA 2B7CB 2A3JA 3BGRA 4I6WA 4KFBA 1P27B 3PYGA 1UPMB 1XC9A 4QCLA 4RBTA 4DV7J 3R5JB 2FC8A 2GVZB 5LJ3Y 4PYAA 2X1FA 4F4KA 4IFVA 5D4NA 2LMIA 3MEEB 1RZMA 3UN3A 3G4SS 3I96A 1OY6A 1YQHA 2VIHA 4DL3A 2HNZB 1S6QA 2ZBCA 3SDEA 2DHGA 1N4LA 2LDIA 2V9KA 1VOMA 4O44B 3CIMA 3V6KA 2WZ1A 2YVSA 2BOPA 3Q8PB 1W2IA 3UQSA 3SQOP 3KK2A 1SQEA 4F4ZA 4ZVHA 5I4MA 2I0XA 3MEGA 3K5PA 3L7UA 2EPIA 4KTQA 2HHHJ 1NJZA 4RNFA 3PO5A 2DNZA 3EJMA 4ECQA 2HEKA 2R8GA 2IVMA 1U2FA 2E5JA 2COLA 2P5VA 2RDJA 3HLUA 1FFGB 4ZCMA 3NGUA 4ANCA 2OTLS 3WIVA 1S77D 3TZWA 1WKJA 2ASDA 1S48A 2LFVA 1B99A 4F50A 1X4FA 3LUYA 1HHQA 2BA9A 1LQ9A 4DBQA 1FJ7A 1GMWA 4K2JA 5LL6d 2ZKUA 2HK3A 2OFGX 3BQ0A 1GX5A 4YFUA 4LSLA 3KG1A 1SJFA 1HNZF 1VGYA 5HQMA 5KFUA 3MR5A 1EB0A 2XWYA 4LMZA 1HMVA 4QW8A 2F4VF 3C3LA 1CS4A 2DO0A 1UW4A 2E1MC 1F5BA 2GNKA 1FJGF 1T7PA 4RL1A 1AXQA 3AD9C 1KQSR 4X4NA 3NL0A 1YSJA 1EQMA 2L9DA 3HVTB 5EHHA 5HMXA 2HVHA 3ZC4A 2UXDJ 1Q4RA 3PYFA 2W8LA 3HKWA 1FWPA 1ELOA 2C2OB 4EBDA 4ETZA 2U2FA 2DXDA 1TMJA 1YDLA 1P1LA 1NU4A 3DKDA 2XI2A 4NLGA 4G1QB 2CJAA 3DI6B 1RAFB 2PA8D 2QIFA 2ZVIA 3GPAA 4WBFA 1FCAA 1LXNA 1X31C 1EETB 5DGBA 2YNIA 2RDDA 2QRRA 2XYGB 1LWEB 4PWDB 1Q53A 1JLQB 3FBFA 1S0MA 1RT1B 4ID5B 2BMBA 3NG8A 3GIMA 4PAAA 4A4JA 2MQQA 3MM6B 1RHMB 3JQJA 4JI4F 3JS9A 1XR6A 2W9CB 3Q8RB 2EFOA 3B8HA 3PKYA 3GFHA 3HJVA 2E5IA 1JLFA 1IWGA 3KHHA 1RYRA 5A8RA 2RQ4A 3K59A 2EFVA 1PJ5A 1SKUB 1TL3B 1A9NB 4I2PA 3EICA 3BBFA 2C28A 1FEHA 1HFEL 2AJ1A 4DV5F 4HT7A 2BX6A 2LDYA 4PRFA 4L6V3 3N9UC 3WBZA 1U1OA 1S76D 1WTBA 2V8PA 5K14B 5I3PA 1K9MT 3HHLD 5I42A 2FHKA 1MN9A 2BR0A 5F3TA 5FLXU 2HQIA 1QAJA 1HNZJ 5F8NA 2X3DA 2POKA 1ZZFA 2CQ2A 2HURA 4IDKA 3DOMB 1O8BA 1E6VB 4ZN3A 2XO7A 4DCPB 1N52B 3JQKA 1HWLA 4P7TA 3G6XA 2HGNA 3SQGB 4DV2F 4XAKA 2C2ZB 3OSNA 1S57A 1R8AA 3BSAA 3ENAA 3PW5A 2EG1A 2JDJA 2KHCA 5GMEA 4CM2A 4DU7A 2DHSA 4MTPA 1VBYA 1X5PA 1H2TZ 1XTZA 3KJFB 2ROPA 3C2PA 3AXKA 1SI9A 5IC4B 3QPIA 4MJKA 2W01A 3JSMB 2OPSB 1NK6A 4NEZA 3FJ2A 3DDIA 1JX4A 5CYQA 2ZJQQ 2IDEA 1SC3B 1JLAA 1XJWB 4ENOA 5L38A 4FZVA 2RF2A 4PXDA 3CW2C 2W9AA 4U8VA 5K9FA 3OFHA 3IR6B 3T9ZA 2NR0A 5A0YA 5FJ4A 2CPXA 4Q43A 3H5UA 1VQ9S 4WCEQ 3CEDA 2ATLA 4DL6A 2KO1A 1KN6A 3HJFA 1NDLA 5IQ6A 2QMXA 1FI4A 3N4WA 2MXYA 2FIUA 3MAAB 2BQUA 2OJ3A 1S1UB 2VD3A 3QJJA 5BYRA 1U2CA 1YJNS 3PX6A 5BYQA 1SL1A 4ILMA 3OL9A 5CYJA 3W8PA 4JI8J 3KWMA 3HD1A 4DV5J 5BJRA 5LXYA 4GKJJ 3OTBA 2YWGA 1T9XA 3OT9A 2ZBQA 4ED1A 4WIQA 2G13A 3I0RA 4B9NA 5IT9U 3DOKA 1RTDA 1X4GA 3V4IB 3OBIA 2K1RB 4OYAA 3KNAA 1RHQB 1KQGB 4OJ1A 3TA1A 2NQPA 3KHRA 4DSEA 4F0MA 1K47A 4MT1A 3MEKA 4LIWA 4URGA 2V69A 4LFAF 4B9MA 3IFEA 2CPIA 1AZSA 3C15A 3VAFA 1L3UA 2HHSA 1OQ3A 3IRXB 2XSJB 3MAQA 4FPRA 2MZJA 4IQMA 3R97A 3B54A 2A18A 2OSRA 3D6TB 3UE2A 4DV2J 3W60A 3BGRB 2UV8A 1DAXA 1L3VA 3HZEA 1SJ1A 2VDHA 3AD8C 1IBCB 1SC4B 4DN0A 3D5MA 1TL5A 2QL5B 2RQMA 2W24A 2D9OA 1YRTA 3C6UA 4X4RA 4DUTA 1S6QB 3SDEB 1ULRA 3OJSA 2VODA 3IMQJ 4OI2A 4C8LA 4LVNP 4QPXA 1IWAA 1PAUB 3KK2B 2ZC3A 2HQGA 1WDDA 3TAQA 2ILZA 2XMAA 4F4YA 4MIBA 1RJJA 1U48A 1VK3A 1L3SA 3PNIA 1IR1A 4ZK7M 1HBUA 3G82A 1RAEB 1N48A 3H98A 3T41A 1F1BB 1URRA 4LF6J 4ZOSA 2CQ3A 2V94A 1SL2A 2HYIB 2C3YA 2ZBPA 5T7LB 4UUWA 4OLOA 3PJXA 3M9NB 2W4CA 1HWUA 4OI3A 4OZ0A 2NYHA 2CXEA 4O0IA 2UUAJ 3VAMA 4GO7X 2IIHA 2YNFA 4GVLA 3POTB 3SMZA 2LQ8A 2M3DA 2GJ2A 1FESA 2XY5A 1U2RA 1UA1A 2D9PA 4WKRA 5ETVA 2HAIA 2OPQA 4H4KA 1NXIA 3UCGA 1FWLA 4CO3A 1AA1B 3R2DJ 4DFPA 2IFXA 3E51A 5EUHA 5KFJA 5KFHA 4DCOB 2BE2A 3SCKE 4LSLB 1T94A 1JJ2R 2DISA 5DZ6A 1VRUB 2ZOFA 4R5PA 4UW2A 1H7WA 1KONA 2VFVA 2YKAA 1NK0A 1HYSA 1TTHB 4HTJA 5G0RA 4G6VB 1NJYA 3K8VA 1FXDA 4OYWA 2NSCA 1NB7A 1Y5NB 1RISA 1NH7A 2HRTA 1QTNB 4B9SA 1YIJS 4TXSA 3E2EA 4ECXA 4CLKA 3PFOA 2E7WA 3QRRA 4DS4A 2JL9A 1NK7A 2G1DA 2D3OR 5AE2A 3C16B 1AW0A 4OX9J 3TEGA 4ZIWA 3SCLE 2LECA 3ZZTA 3M8RA 4GKKJ 2FJBB 2XM3A 4P2SA 2C2EA 3D3BJ 2ZD1A 3S6EA 3J80U 1VQ5S 1N5SA 2DGXA 2YNIB 4JI1F 3LALA 1Q5VA 1FK9B 3WX8A 1PKUA 5KFDA 2R7UA 1R0CB 2OELA 1GTHA 2H51B 2J9DA 2VH7A 3BGLA 1JLGB 4ZP7A 1WJ9A 1EHWA 2Y0BB 4ZP6A 1F3VA 3JXOA 2DNGA 3IRWP 2MQMA 2MZSA 1JLFB 1UEUA 2QA4S 3A3PB 5A8RB 2FJVA 2F9DA 1TVRA 2G2ZA 4YP3A 1KTQA 2XGPA 1P8GA 4CIOA 3VQTA 1GK8A 2BUNA 3PG9A 2HVZA 2CNKB 1RHJB 4I2PB 2A1BA 4EU0A 5MLCV 4USHA 2GV1A 3QNWB 2D7SA 1BQMA 3EYZA 4TNOA 2QFJA 4CZCA 3D1HA 3ZTSA 2JHEA 5IC6B 4TYAA 4WYWA 5CHCB 2Y1LB 3HSZA 2ZDOA 2BE7D 2PDAA 4BWMA 2A6OA 5KG2A 2M52A 3KLHA 3J7YI 2WBRA 4LVOP 1D9DA 5I42B 4KAIA 1KS2A 3NNAA 1WG5A 2BXJA 2IMWP 2V0NA 4X4QA 2W25A 4BCAA 4DUZF 4KB7A 4IDKB 2QTWA 4CO2A 2H3EB 1VJWA 4KGZB 1PBUA 4RW6B 5B0DA 2JLGA 5EGYA 2BJEA 1K44A 5IQQA 3QFWA 2PT0A 2QLBB 3H2LA 4HVZA 5E3RA 4OQJA 1R6VA 2M5YA 2MY7A 3PRBA 4QWAA 1YITS 1FTCA 5CXTA 4TN2A 4NZ6A 4FNHA 2P9EA 3TUPA 3CC2S 4OV6A 2B4PA 4J9MA 3QGGA 4NCAA 1KVJA 3LOUA 3DNCA 4LF8J 1PO6A 2M8HA 4JP8A 4JI2F 1B0TA 3ZNUA 1R8CA 5DG7A 1VK8A 5HJYA 3KJVB 2J7WA 3BZQA 5KG1A 1S6OA 2OGUA 2I1RA 4A8QA 5CYQB 1JLAB 4ZLPA 1C4AA 3PXGa 2OH2A 3C19A 2RF2B 1IKXB 4ZJOA 3CC4S 1NAQA 4DUYF 2AJ0A 1M5HA 3FEZA 1N5TA 2AU0A 2CWKA 2QLWA 3LO3A 3KLGA 2HS3A 4ICLA 5A0YB 2BRLA 2MTLA 3P49B 2YBVA 4YOEA 3EGVA 1U6BA 1N33F 1X4EA 1EZZB 1RT7A 3CDAA 4N77A 4DV1J 3GTYX 3DRXA 2KT2A 2HNYA 3UDCA 4NYOA 1YBTA 4O3QA 2F40A 3DLGB 2EFGA 2HW3A 1HNWF 2VPWB 3HSGA 4Y2MA 4CLLA 3PW7A 3SZ2A 4JYAF 1RADB 3KJNB 3A3NB 1TL4A 2AF6A 3CCUS 2QLJB 1D8YA 4FKXA 4RZRA 4KGVB 4P10A 1RTDB 3QATA 4J91A 1U25A 3OFGA 5KFNA 4M5MA 3DOLA 1HNXF 4RW9A 4DUZJ 2A2DA 1F9EB 3HVRA 3DRRA 2J6TA 3MEDA 1FA0A 4OMFG 3TVZA 5JVHQ 2KVIA 5KOWA 1AZSB 4ZHRA 1V6HA 1GH8A 4NLSA 2EFQA 4NCGB 1KR4A 5E2QA 5LMNJ 4DFMA 1ZTTA 2QGFB 2M4MA 2JJ4D 5DG9A 1OO0B 3CJKA 4KGKA 2XYHB 3NXZA 5KFTA 5AT1B 4ERDA 1KD1T 4WKYA 5EX0A 1MMNA 4K4WA 3C6UB 1F60B 3QT7A 1REVA 3O6QA 2UUCF 3ZZZA 4LFCJ 2ROEA 4JI2J 1ZBTA 3VGVA 5D77A 4KH1B 3EVWA 4B3TJ 1GX6A 3R3TA 3DRPA 1JJ4A 1RTHA 7FDRA 2H5EA 2MEWA 5HLFB 2MYFA 4CM0A 3MM5A 4JI6F 3ZFVA 3W61A 3BN4A 3ETOA 1N33J 2OTJS 3RU0A 1UZDA 5HN0A 2ERRA 2J8SA 1FD8A 3J7ZT 1UMJA 4HR2A 3QGHA 1FHTA 5JXSA 4USMA 3I6PA 4AL6A 4GRSA 2YNFB 1F2GA 4OZLA 1TL7A 2J7UA 4DPYA 3CE8A 4DQRA 4AD6A 1C0UA 5E3AA 2OPQB 2FJWA 2AEFA 2CDQA 1X60A 3NGSA 4DPOA 3CCVS 1RA7A 3G87A 1HHSA 2YKPA 2AGPA 5H9FK 4KGXB 1U09A 4ZMMA 4V19X 4G3IA 2PFDA 2BE2B 7FD1A 1HNXJ 4H4MA 3CMQA 4YDXA 3VAKA 4R5PB 4Q45A 2FYXA 3HULA 1W2BR 3KLEB 2HMIB 1YJRA 1HYSB 4KO0A 4AL5A 3W2VA 5E7OB 5G0RB 3BH7B 1EAYC 5KT2A 2RMLA 2E1PA 1NLKL 2AD9A 1RB0A 1YKWA 4NI2B 1URNA 4KT0C 4QYZJ 3KOAA 2MQLA 3PW4A 2D69A 2AP6A 4F4AA 5C24A 2ABYA 2XZWA 2ZEJA 3DYAA 1T95A 4QU6A 3AODA 3MMJA 1S6PB 4JBCA 3P6YC 1S0NA 4UTGA 1JB0C 3UI3A 4AXJA 1KRPA 2H54B 4LQ9A 4ZVEA 1TKTA 1TAQA 2AJ2A 1ZTWA 4LRAA 2GAHC 2UUCJ 3L7OA 3SSRA 4UY85 2QJ3A 1B0PA 3BDEA 3EZOA 4LSNB 2UXCF 3KUHA 2BJ8A 3DCAA 2ZD1B 4HH1A 2XS7A 2OIHA 5GVQA 2BANA 5KOXA 3U1MA 1M1GA 2AJ4A 1NJIT 5SUHA 2CQIA 2QLFB 2KFYA 1NDKA 2AT1B 1UWAA 2LXIA 2RQKA 3UVJA 4J9NA 2LQ5A 2LVWA 4F7VA 3ELHA 1G1XA 1U0HA 2VFRA 3TX0A 2YH1A 3L09A 3NLCA 1FKOA 4RUBA 2DYAA 2QG9B 1VDHA 2J0WA 1TVRB 2FY1A 5DM6Q 4A8MP 1IBLF 3VZHA 4IH5A 3ENWA 5M2RA 4PG6A 5KG3A 2KYXA 2YWKA 3IWXA 4ZJQA 3NOGA 3VAJA 3QLHA 3NCPA 3FQKA 3K17A 1SH3A 4I2QA 1RAGB 1UFKA 1ZA1B 3KLHB 4LR7A 3R1HA 4IG3A 4ANDA 4Q8EA 3K5LA 2ZH8A 4C3MA 2LQJA 2I38A 3H59A 5IM0A 2UUBF 4KSEB 2XMWA 1IKYA 2ZZMA 5CCLA 3QAUA 4MKAA 1RAHB 2MSSA 2H9ZA 1DY3A 5KT3A 3BSCA 1WC4A 2M2BA 1R0AB 2IYIA 5KG7A 4IO1A 2HQCA 4EO8A 2Y3YA 2Z58B 2G0CA 4O23A 1JJHA 1HBOA 1XWLA 1RTZA 2XGQA 4AQYJ 3FBCA 3TEHB 1SJRA 3D9BA 1WC5A 4QIGA 1LW2A 2ATCB 2YXLA 2R7SA 4TKTA 4NRTA 3BBCA 1VYAA 1HBNB 3T1YJ 2R2TA 5JUMA 4I1TA 4CP5A 2W8KA 2DY1A 5GMDA 2E5LF 3GLJA 4O3PA 2D74B 2R8JA 2FZGB 3IWNC 5AXLA 2E1RA 4PXBA 3BJYA 3B82A 2RU9A 3W64A 1R3NA 3OSPA 5IT4A 4ED6A 4DR3F 1SQGA 2ADBA 4P71A 4KBIA 1YJUA 4WE1B 2DHHA 1Z1ZA 1QJHA 5DDPC 1RT3A 3MPVA 3G8QA 4QR1A 3TVYA 5KFVA 3KLGB 2CPFA 3KLIA 2M70A 3L7PA 5HJXA 4ED3A 2CKWA 3WDOA 5H9EK 3M2VA 4USUA 1PYOB 2H4YB 3V6HA 2B7BB 2B5JB 2HNYB 5CABA 3F44A 3RRKA 4DV3J 1XMOJ 1FNXH 2XMUA 2KRBA 2BE9B 1IBLJ 3WHIA 3IR7B 4EZ6A 4MKVA 4PKDB 4YY3F 2GO8A 2KT5A 3PRVA 1BQXA 3OV7A 2MGZA 3W9JA 2OAUA 3ADAC 3D0IE 1R8HA 2VBYA 2DR8A 3BKFA 1LNQA 2EW9A 2R7TA 2MMYA 2L08A 5LXRA 5A6WA 4JV5J 1EKSA 3BR8A 4DMZA 4ILRA 2L3MA 4UY8T 4RW9B 4BS2A 1RTJB 3MCOA 4WFZA 3DRRB 5BR8F 4ZPCA 3QT8A 2V6AA 1WG1A 4E8UA 5HROA 3BQ2A 3K89A 2V4QA 2HZVA 4ZHRB 2MZTA 4L72B 3VAHA 3MTJA 4FBUA 1HI0P 1SJ4P 3ILJA 4PQUA 3T5LA 3CJKB 3J7YU 2C3PA 3OD2A 5L8RC 1N36F 4UOFA 3VHQA 4YHHJ 3AQPA 3EUNA 2WRMA 4F3QA 1FDAA 1S1WA 3ZTQA 3KMQA 3FQLA 1Y3JA 1REVB 1VIOA 3P4UB 1RBOB 3UO0A 2Z2YB 3FFIB 2D1CA 3L3CA 1QSYA 3JAMU 2VQFF 3GV5B 4F8RA 3RB3A 2MQ8A 3V81B 2P9CA 1NUEA 2OPRA 2DNOA 1S4FA 3OVSA 3N5BA 2XC9A 3W65A 4F36A 4X4TA 4X4UA 4QQBA 4FDFA 1NB2A 4B17A 2J8AA 2QMWA 1M5KC 5DO2A 1DLOA 4L74A 2K3IA 4HACA 1VMBA 1UVJA 1MLAA 1OIAA 1ITPA 4N76A 4B3MF 2WSEC 2VKZG 3AD7C 1GQEA 2AJQA 5DZ7A 4CO4A 2B9EA 2RKIA 2ZHOA 4DV6F 2VBWA 4EI2A 1RCXB 3GONA 2CPEA 1R43A 3R6GB 5T14A 4LRBA 2F9JA 4I7FB 1D0EA 1SUQB 3OXLA 4RR5A 2CADA 4IH6A 4H4KC 5HAOA 3MDFA 2FGOA 2HNDA 1UEVA 2V4JA 2XYPB 3QMQA 4DQIA 2QMUB 2CAJA 1QE1B 4Y65A 3MTKA 4BWJA 3OUYB 3Q22A 4XPCA 3NCQA 2HG4A 2AYBA 4LF2A 4DX5A 3W2VB 4W98A 4IOCQ 2F5GA 5FLXY 1FRLA 3AA8A 3O5TB 3N6MA 5ITHA 1NK8A 3W9IA 4OI0A 4DV0F 4LRDA 3RB6A 2ZFHA 3R9LA 1FO1A 2HS4A 2R8HA 2FB0A 1UJ5A 3LPEA 1N36J 3EPIA 4NOHA 1JLCB 4NLYA 4B9VA 2U1AA 4G65A 4JI5F 2OEKA 2RIJA 4M5KA 2MJNA 1AFIA 2CQCA 3IG1A 2KI2A 5KFIA 4DF4A 5J2MB 2VQFJ 4CH7A 2DVIA 2W9BB 2BANB 1I3OB 1B70B 4Q2LA 2MLXA 1FRMA 2AEMA 4EBCA 3HHDA 1GXTA 5LSRA 3CJ3A 4C48A 2IM2A 3AAWB 1VS3A 5KFCA 3D66A 3UR3C 5ETOA 2W2OP 3ETMA 1T3NA 4DLEA 1FKOB 2KXFA 4P52A 4HDGA 3JTPA 2AZ1A 1E6YB 4OI6A 4N56A 4B3MJ 2QE5A 4WXWA 1C0TB 2ZVSA 4DSLA 4EYHB 3HI9A 2AZ3A 5KT4A 4QR0A 3IA0A 4LF4F 3JTOA 3IWLA 2MZQA 3R6LB 5K5MA 4EZ9A 4M5JA 2DK2A 3M6WA 2XEXA 1UL3A 3CJ4A 5LMUF 4KHPF 5IOLA 3QLHB 3J81j 4I2QB 2NZ4A 4AUKA 4MIAA 4K2XA 3OTOJ 2EVZA 3T1AA 4FYYB 1F9HA 2XSFA 4JB8B 1IKYB 2BV3A 2ZH9A 3DLJA 4Z7CA 1HKAA 1K0VA 5IT9Y 2CPYA 4QIVA 2BVZA 3K8WA 3QWPA 4QU7A 3QGPA 2H4WB 3M8PA 1RBAA 4QIWD 3LGMA 3SSQA 1HBOB 2KRRA 3DMJA 1S9FA 4DV0J 5F8LA 4OHYA 3I5CA
chains in the Genus database with same CATH topology
3EDQB 2CJXB 1SC1B 2C1EB 1NMEB 3IBFB 2XYGB 2H65B 2P2CB 1BMQB 3KJNB 3GJTB 2H5JB 1RWPB 3SIPB 2CNKB 1RHJB 1RHKB 1QTNB 4ZVRB 4DCPB 3R7NB 2QLJB 1RE1B 4ZVOB 1RWXB 1RWNB 1RHUB 1RWWB 2QLFB 3QNWB 1ICEB 1RWMB 2DKOB 2CNNB 5IC6B 1RHMB 4DCJB 1QDUB 3D6MB 1RWVB 1IBCB 1SC4B 2Y1LB 3R6LB 4ZVTB 2CNOB 2QL9B 3KJQB 2QL5B 2C2ZB 2C2KB 2FQQB 4ZVPB 1PYOB 2CNLB 2XZTB 2H4YB 3GJQB 1F9EB 2CJYB 4ZVUB 1RWOB 3RJMB 1RHRB 4ZVQB 1GFWB 3NS7B 2QL7B 5K20B 3R6GB 4ZVSB 2CDRB 3KJFB 1PAUB 3R7BB 3P45B 3IBCB 5IC4B 3P4UB 3D6FB 3D6HB 4DCOB 4JB8B 2C2OB 3GJSB 1I3OB 3R5JB 2C2MB 1RWKB 2H51B 1RHQB 2XYPB 2XYHB 2QLBB 2H54B 1SC3B 2Y0BB 2H4WB 3R7SB 3GJRB 2HBZB 2H5IB 1I51B 2H48B 2HBQB 3EDRB 2XZDB 2HBYB 4LSZB 2HBRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDQ B;  2CJX B;  1SC1 B;  2C1E B;  1NME B;  3IBF B;  2XYG B;  2H65 B;  2P2C B;  1BMQ B;  3KJN B;  3GJT B;  2H5J B;  1RWP B;  3SIP B;  2CNK B;  1RHJ B;  1RHK B;  1QTN B;  4ZVR B;  4DCP B;  3R7N B;  2QLJ B;  1RE1 B;  4ZVO B;  1RWX B;  1RWN B;  1RHU B;  1RWW B;  2QLF B;  3QNW B;  1ICE B;  1RWM B;  2DKO B;  2CNN B;  5IC6 B;  1RHM B;  4DCJ B;  1QDU B;  3D6M B;  1RWV B;  1IBC B;  1SC4 B;  2Y1L B;  3R6L B;  4ZVT B;  2CNO B;  2QL9 B;  3KJQ B;  2QL5 B;  2C2Z B;  2C2K B;  2FQQ B;  4ZVP B;  1PYO B;  2CNL B;  2XZT B;  2H4Y B;  3GJQ B;  1F9E B;  2CJY B;  4ZVU B;  1RWO B;  3RJM B;  1RHR B;  4ZVQ B;  1GFW B;  3NS7 B;  2QL7 B;  5K20 B;  3R6G B;  4ZVS B;  2CDR B;  3KJF B;  1PAU B;  3R7B B;  3P45 B;  3IBC B;  5IC4 B;  3P4U B;  3D6F B;  3D6H B;  4DCO B;  4JB8 B;  2C2O B;  3GJS B;  1I3O B;  3R5J B;  2C2M B;  1RWK B;  2H51 B;  1RHQ B;  2XYP B;  2XYH B;  2QLB B;  2H54 B;  1SC3 B;  2Y0B B;  2H4W B;  3R7S B;  3GJR B;  2HBZ B;  2H5I B;  1I51 B;  2H48 B;  2HBQ B;  3EDR B;  2XZD B;  2HBY B;  4LSZ B;  2HBR B; 
#chains in the Genus database with same CATH topology
 2D41 A;  1R8P A;  2QYC A;  1AFJ A;  2FVC A;  2MKJ A;  3G9C A;  1DFD A;  3GIR A;  3OTD A;  4DLG A;  4WFY A;  4OFZ A;  1V5I B;  3HO1 A;  1QAX A;  2I8E A;  4I64 A;  1D8Z A;  3TR5 A;  5GAH I;  1S9G B;  1Y5I B;  3MM8 B;  4YQW A;  3MMB A;  3M9M B;  4B9U A;  1JKH A;  4CLT A;  5KG4 A;  3IO1 A;  2EFP A;  2XMM A;  3GSD A;  2VA3 A;  3D4J A;  1YJT A;  4GMK A;  2V67 A;  4DPU A;  4B3O A;  1Y00 A;  3MOJ B;  3D1O A;  3RRH A;  3KHG A;  3ULH A;  3CMA S;  3PR4 A;  1QY7 A;  3RBE A;  2IM1 A;  4JV0 A;  4F2R A;  1WDT A;  3FC9 A;  4CTA A;  4X4S A;  1FKA F;  3AB2 B;  2KFZ A;  3OR2 A;  1WWH A;  3ZZU A;  2J9C A;  2GVZ A;  4J9K A;  3KG0 A;  2NSB A;  2UU9 F;  2UP1 A;  2OML A;  3M2V B;  3HHN B;  3ZZP A;  3T3F A;  2CQP A;  4PR6 A;  4ECR A;  2HNZ A;  3HF5 A;  1ZM3 A;  4ZLN A;  4O44 A;  3R1L A;  3JQM A;  1T3O A;  1F2H A;  1UA0 A;  3OLA A;  2KB2 A;  1CQM A;  4KHP J;  5LMU J;  4LRE A;  3S1T A;  4DDF A;  2MGZ B;  3IP0 A;  1XQI A;  4CLU A;  4GC7 A;  1X5S A;  4TLQ A;  2HS0 A;  3CCM S;  3UCU P;  1YJV A;  4LF7 F;  1UVK A;  2DY9 A;  4ID8 A;  4ZVS B;  3TZY A;  1TV6 B;  2CZ4 A;  3BSO A;  2HHW A;  1KLM A;  1O6X A;  3GG1 A;  1PSD A;  3RAQ A;  4J9R A;  2HKE A;  4LF5 F;  1P1T A;  4M5H A;  3HKZ D;  3AJ2 A;  4C11 B;  3TYT A;  3FCH A;  3QYY A;  1J5O A;  3GJR B;  1FRJ A;  3HX9 A;  2PMH A;  3M30 B;  1JK9 B;  1TFY A;  1CG2 A;  2NRE A;  3T1H J;  2AKW B;  2HVD A;  1U1P A;  1WOR A;  1FVS A;  3VAL A;  2HBR B;  1SC1 B;  3IBF B;  1VQK S;  1U1N A;  4OYI A;  1FE4 A;  1H98 A;  1P6T A;  5LSO A;  2CQ0 A;  4LRC A;  4JI0 J;  1UW9 A;  4QWB A;  3H2U B;  3ET6 A;  3FEX B;  2IJN A;  1RDR A;  2G9O A;  4X64 F;  3OW2 R;  4NEY A;  2BQ3 A;  1VQS A;  3W7B A;  2ILY A;  4K4S A;  4ZDN A;  5KFA A;  1WEY A;  1GEH A;  5GAE I;  1X7V A;  2IM3 A;  5FII A;  4RBV A;  4DR1 F;  1PC4 A;  2N4C A;  4ZVQ B;  4KE5 A;  3VAG A;  4K4V A;  1IR2 A;  4TYB A;  5J2P A;  4OI1 A;  1S0O A;  2B9X A;  3GIK A;  1T9V A;  3J80 Y;  2QA1 A;  4PZV A;  3A8J A;  1JWW A;  4WJB A;  3K5M A;  4HAC B;  1H3D A;  1TKD A;  2UU9 J;  4F4W A;  1UJ4 A;  2VA2 A;  2KN4 A;  2IC3 B;  2E1C A;  1CC8 A;  3WC2 A;  2W2N P;  4HHJ A;  4K4Z A;  1IM4 A;  4RU2 A;  3CD0 A;  4QIE A;  2BW2 A;  1J2V A;  3UDE A;  3NNC A;  2V8V A;  2AJF E;  1DQ8 A;  3CWJ A;  4ZPT R;  1RI7 A;  3MPU B;  4IOA Q;  1R31 A;  2UVV A;  1FX4 A;  4UOH A;  2BJ3 A;  1C1C A;  1SKW A;  1TK5 A;  1RK8 A;  1WC1 A;  3BF4 A;  2IHR 1;  4PWD A;  3SSS A;  1JLQ A;  1VBX A;  1RT1 A;  4O4R A;  1S5Z A;  4K8R A;  4C8N A;  3QIP A;  2HND B;  2LQB A;  1TAU A;  3EVM A;  1X9M A;  3UW1 A;  5IWA F;  2LKZ A;  3E01 A;  4E0D A;  1NK9 A;  2VB6 A;  1O51 A;  1TKX B;  1XNR J;  3MFH A;  1PYS B;  3EPG A;  1RAO A;  5KFK A;  2ZOM A;  2OI2 A;  2KU7 A;  1XIQ A;  2K06 A;  2JX2 A;  4IRC A;  4USI A;  3SI8 A;  2CQ1 A;  4ECU A;  1VQ6 S;  1EX8 A;  3HM9 A;  2GVD A;  3U7J A;  5D15 A;  1J5E J;  2R2U A;  3UD4 P;  1TP7 A;  2DPI A;  4B08 A;  3BDP A;  3MPY A;  4J9L A;  4PG8 A;  2GIF A;  4WP3 A;  4IR9 A;  1UJ6 A;  2DNR A;  1KDN A;  3DOM A;  1S12 A;  1JXE A;  3ISZ A;  5AXN A;  1E6V A;  1ZM2 A;  3RR8 A;  2ZE2 A;  2WVD A;  3KJQ B;  4DOZ A;  4K0K J;  2G0J A;  1VFJ A;  1BGX T;  3SQG A;  1ZS6 A;  4OX7 A;  1TU0 B;  1YI2 S;  5B0G A;  2G2O A;  3MUV P;  2CWX A;  3NS6 A;  5KFM A;  1GMV A;  3LAN A;  2QT7 A;  1HQ2 A;  2DGU A;  4G1P A;  1HWJ A;  5EDW A;  3BQ1 A;  3CGI A;  1FFS B;  3BGO P;  2HFZ A;  3AB4 B;  3MUM P;  3CCE S;  2O1P A;  3SFG A;  3CCT A;  1PBA A;  1TK8 A;  3JSM A;  1NKE A;  2D3Z A;  2C3M A;  5DGA A;  1WOS A;  4IG0 A;  3H4B A;  4PG4 A;  4KC5 A;  3IN5 A;  2B6A A;  3NKY A;  1IUJ A;  2HQ3 A;  3B78 A;  3GQC A;  4OHW A;  4MK8 A;  3KLF A;  3KK1 B;  1KHV A;  1RWX B;  1T11 A;  3P8B B;  2JEI A;  1X4C A;  3RRG A;  1B0V A;  3WIU A;  1TZ0 A;  4P2X A;  1BHN A;  4ZVP B;  1T9T A;  3MAA A;  3N6N A;  1XNQ J;  1XBW A;  2MQN A;  1WC6 A;  1S1U A;  2LU2 A;  1IM6 A;  3EZ5 A;  2G0I A;  4ZCK A;  1KBR A;  1N6Q B;  4LF9 F;  1VLO A;  2CPZ A;  2VBX A;  1WSR A;  1EP4 B;  1CPZ A;  3OL6 A;  2CQD A;  1Q8B A;  3S8S A;  4DR6 F;  2GHV C;  1C2P A;  4C8O A;  1NDP A;  3VV2 B;  1NBE B;  4OHZ A;  2FJX A;  2I5J A;  4DL4 A;  2VZ9 A;  4YME A;  5FDL A;  4A46 A;  3D1Q A;  2K1R A;  2F8H A;  1NZA A;  4ANE A;  3M9O B;  1BY9 A;  3LA0 A;  3MMB B;  1JKH B;  1IBM J;  3G2X A;  1IQT A;  3KDO A;  4Y0F A;  2YNH B;  2QYG A;  4IFY B;  1B7F A;  3PW2 A;  1D3W A;  1PG5 B;  1X8D A;  2DIV A;  3O8W A;  4V1A k;  3EGW B;  2MB0 B;  1OYD A;  1K8A T;  2FHM A;  4B3O B;  3H7H B;  1PCA A;  2LP4 A;  3IRX A;  2XSJ A;  1WTF A;  2R7R A;  1EAR A;  4U7C A;  2ACM A;  4J9V A;  2ZJR Q;  3FZ2 A;  2AGO A;  3ZTR A;  1VQY A;  4CTA B;  3P5T L;  4DN9 A;  3MUT P;  2Q1L A;  2FQQ B;  5I3U B;  3OR2 B;  2I2Y A;  1RQ0 A;  5A2Q U;  3FK4 A;  1B7Y B;  2VFU A;  4C8M A;  5J2N A;  3M8Q A;  2FHO B;  1T9Y A;  3OTC A;  3TWZ A;  4NXN F;  1LXJ A;  5DQI A;  1UWB A;  2DR7 A;  1F3F A;  3BV8 A;  3IM9 A;  2J0X A;  4WII A;  4S0M A;  2SXL A;  2R8K A;  1FNO A;  3Q8Q B;  1L5U A;  5C42 A;  4WP9 A;  1XK8 A;  6FD1 A;  1S1X B;  5CAA A;  1BE4 A;  1H7X A;  3T6B A;  1LFP A;  3IC1 A;  2DEI A;  2CPH A;  2FUG 9;  3V6J A;  4N47 A;  3QZ8 A;  1QVF R;  1S59 A;  1OQ6 A;  3SIP B;  3ZZY A;  1R27 B;  4EWT A;  1XER A;  1DBD A;  3QQC D;  5T7L A;  2WVE A;  1KLM B;  2FHJ A;  1VHI A;  1RLD A;  1RWV B;  1G3O A;  3S7R A;  4MK7 A;  4UQG A;  2YTC A;  2A10 A;  2CQ4 A;  3MM9 A;  3BS9 A;  2ZM6 J;  2E5G A;  1RT4 B;  1UCN A;  2ZHB A;  1K73 T;  3POT A;  4OHV A;  2XS2 A;  3ITH A;  4A8Y A;  3RB4 A;  1FRI A;  5JMN A;  2C2N A;  1J5O B;  2N4D A;  1RHR B;  5L46 A;  1S99 A;  3AOA A;  4ELT A;  1TL1 A;  4DR6 J;  1S1T A;  2XWX A;  5E3Q A;  8AT1 B;  1WOO A;  5A8K A;  2FTR A;  3V6D B;  1W25 A;  1HQE A;  1TEL A;  4YB7 A;  2AW0 A;  2MLZ A;  3UN5 A;  4Z7Y A;  2WTF A;  3ET6 B;  5GAD I;  4DXL A;  2MKC A;  2RB7 A;  1WEL A;  2FJE B;  4ZP9 A;  4HKQ A;  3A4T A;  1VRU A;  4WK1 A;  1CQN A;  4JI7 J;  2UUW A;  4NZ0 A;  1PJ7 A;  1RKJ A;  3H2V E;  4DG1 B;  2HRY A;  3PHT A;  1HHT P;  3UDV A;  3CJR A;  5H9F J;  3NS5 A;  3HHL C;  4ED5 A;  2CIM A;  3QID A;  3B4M A;  4YB6 A;  5J2P B;  2Q3P A;  2K7K A;  2AEJ A;  2FVP A;  4W90 B;  6AT1 B;  4FF3 A;  3ZZO A;  1HD0 A;  3OTE A;  5E5N A;  1MU2 A;  4ATN A;  4D3G A;  5B0E A;  2NXU A;  5GAH U;  4FPI A;  1UFL A;  1O0P A;  1RSC A;  1T0T V;  1D1U A;  1N5Y B;  2ZWO A;  4FBT A;  1WKL A;  3C16 A;  3KK3 B;  1Q81 T;  2ASJ A;  2GX8 A;  2ZH7 A;  3Q86 A;  2YY3 A;  1VQ7 S;  2CFX A;  1CJU A;  4B3S F;  2J76 E;  2LA4 A;  2JFD A;  3BYR A;  1F6T A;  2VF3 A;  3M4X A;  4ZPA A;  4K7Q A;  4Q44 A;  2HQD A;  1VIS A;  1CVJ A;  2PD1 A;  1N32 F;  3X3U A;  1C1C B;  2RH3 A;  2BKP A;  1TUW A;  1FK9 A;  3P96 A;  2XB2 D;  2DNN A;  1MRO A;  5KFG A;  5EWF A;  4MIW A;  2RUS A;  3QIP B;  2X1B A;  1H73 A;  5HMW A;  3M2U A;  3F56 A;  1SXL A;  3QJL A;  1JLG A;  4O4G A;  3SCJ E;  1X0F A;  4ZPW R;  2HBY B;  3WZ0 A;  3E01 B;  3GIJ A;  2NXN A;  1U1L A;  1U49 A;  3TJA A;  2ZKT A;  2RS8 A;  3EGZ A;  4DR7 F;  2B51 A;  5EX3 A;  3NP5 A;  3CCR S;  5BXI A;  1I94 F;  3O1L A;  1U6F A;  1ICE B;  4W92 B;  2FY8 A;  3VCD A;  3LAK A;  2X1A A;  1S10 A;  4PYD A;  3W8G A;  2HWI A;  5CCM A;  2BAB A;  2DGS A;  1NK4 A;  3CIZ A;  3VR1 A;  3D7S B;  2W1B A;  1XEZ A;  4DL2 A;  4CO1 A;  2KXN B;  4LRF A;  2GHP A;  2W2Q P;  2GVD B;  4CLY A;  4DV4 F;  5AXM A;  3TAP A;  4UQT A;  4X62 F;  4QBU A;  2AX0 A;  2Y9H A;  4ALZ A;  2IY5 B;  3CD5 A;  3QRQ A;  3AQO A;  3THV A;  3FSX A;  3QRP A;  4M95 A;  3VGS A;  2F4V J;  4NYZ A;  4ECV A;  4RW6 A;  1H2V Z;  2RD5 C;  2PMZ D;  2ZE2 B;  3NY0 A;  2GJI A;  5F8I A;  1FJG J;  4C97 A;  4O3N A;  1JNR B;  2V2K A;  3QSY B;  4KPY A;  3AFG A;  3MM7 B;  1RWP B;  3CCS S;  3IR5 B;  2K7J A;  1RP5 A;  3CO9 A;  4ECZ A;  3GP9 A;  3HHK A;  1SH2 A;  1JLB B;  2HFS A;  4M94 A;  5HK4 A;  2QFI A;  3TAR A;  3GE9 A;  4TU7 A;  3M1V B;  3Q8S B;  5GAE U;  4USW A;  1FE0 A;  2W4P A;  3KJV A;  2VG7 A;  5M2P A;  3FNN A;  3QFH A;  1CJV B;  3UN2 A;  4IG0 B;  9ATC B;  3EWG A;  5ETS A;  1OY9 A;  2DGT A;  3R7B B;  3PIP Q;  2B6A B;  4CWB A;  3RBX A;  2OHD A;  2BQR A;  1IKX A;  1X0P A;  2WON A;  3IAM 9;  4ZPB A;  3KLF B;  1VC0 A;  2GFF A;  1S6U A;  4F0H A;  4Y28 C;  2YWW A;  4WPA A;  2YX4 A;  1DJ0 A;  4JI4 J;  3PHE A;  1RAC B;  4QZV B;  4PUO B;  1FVQ A;  2ZOG A;  2N7Y A;  2OLW A;  3QO9 A;  2XQC A;  4DR7 J;  4GC6 A;  3FVY A;  2RU3 A;  1TKZ B;  2HVE A;  3K2Y A;  4DI6 A;  3DGP B;  3DLG A;  4QWE A;  4EFA C;  4RKU C;  5HMY A;  4H54 A;  2HK2 A;  1U1R A;  2E29 A;  3PY8 A;  1YZ6 A;  3AJ1 A;  4DCJ B;  2IAJ A;  5H9E J;  2GC8 A;  2C3U A;  3AA9 A;  2I5J B;  4X62 J;  1C4C A;  5FDL B;  1RWO B;  3TAN A;  2V2V A;  3NS7 B;  2ZC4 A;  2R7W A;  3CDB A;  2XCP A;  3ISN C;  1OWX A;  2VUG A;  1NSP A;  4F3M A;  4RW7 B;  3MR2 A;  1N34 F;  2HQF A;  1Q7L B;  1KHW A;  2ZHA A;  4I68 A;  4ZKA A;  3MR7 A;  4P72 A;  2GMJ A;  1OPI A;  2RSQ A;  1NEE A;  4U9R A;  2NUU G;  2Q66 A;  2Y1I A;  4QPT A;  2I6W A;  2BAC A;  1QAY A;  3RBD A;  4NCG A;  4ZP8 A;  1SJ3 P;  3W66 A;  3R8Y A;  2DRB A;  3JAM Y;  1X9S A;  1SV5 A;  2J0S D;  3FRY A;  1RXO B;  2Q6B A;  3KDN A;  4Y00 A;  2ZBR A;  1PYT A;  3H40 A;  1MN7 A;  4KGM A;  3GZ7 A;  5KFQ A;  5J2N B;  3J81 U;  3M8Q B;  3VVT A;  4ZVO B;  5DS7 A;  2WK4 A;  1RHU B;  1UWB B;  3CJQ A;  1YZ7 A;  3ILI A;  3LQV A;  3NBP B;  4URS A;  3CCZ A;  4W4M A;  4CNZ A;  2ZNY A;  3NEK A;  3IBW A;  3CDW A;  2DGV A;  1OY8 A;  5HVF A;  4M5D B;  2RAQ A;  5C42 B;  2J0Q D;  1WD6 A;  5F41 A;  2PEB A;  2E9Z A;  2WVB A;  5HQL A;  5L9X A;  5HLF A;  2YKQ A;  1IR0 A;  3I5B A;  1N5Q A;  2F65 A;  4OYP A;  2LA6 A;  1SH0 A;  8ATC B;  2FLO A;  1G7C B;  2KM8 C;  1AT1 B;  1JLE A;  2DCL A;  3R5B A;  4DR5 F;  3T6J A;  3HHL B;  3MM9 B;  4IO9 Q;  3ITH B;  2XZD B;  5MAO A;  4YR2 A;  2HLU A;  3ISN D;  3DHW C;  4G1I A;  4X4P A;  3CJ2 A;  4Y3C A;  1H72 C;  3GJT B;  1TL1 B;  2NXJ A;  3TZX A;  5L1K A;  1S1T B;  4ZVR B;  3SEO A;  5DQG A;  5A8K B;  3F73 A;  3CPW R;  1IJF B;  1HQE B;  1Y5L B;  1SIW B;  4RU9 A;  5J1P A;  1NHU A;  4KR0 B;  2VAS A;  1N54 B;  2YX7 A;  2IRU A;  2IA0 A;  2WB4 A;  2AIR B;  5CD4 H;  2AHO B;  4QYR A;  2NZC A;  3KLE A;  4WYL A;  4LFA J;  2HMI A;  3FMW A;  3NAH A;  5KT6 A;  2YQ0 A;  3NWG A;  4N7T A;  2AYM A;  1EKR A;  3BRE A;  3MMC B;  3BBB A;  5EN1 A;  2ZZN A;  2HWH A;  2XY7 A;  5B08 A;  3CME S;  3UDL A;  1YRX A;  4NI2 A;  2UXB F;  4CDI A;  3KUG A;  4M5I A;  4C9D A;  3GYX B;  2FVR A;  1MU2 B;  4Y2A A;  2AGQ A;  1S6P A;  2OPP A;  3TI0 A;  3K7R A;  1I51 B;  4A8K A;  1IBK F;  4NML A;  1UEK A;  2P9G A;  1BXN A;  4RWX A;  1NKC A;  3N01 A;  5KAK A;  2Y0S D;  1VC6 A;  1S1V B;  1BMQ B;  2BBE A;  2EWH A;  3OFF A;  2XMJ A;  3MCM A;  4C0H A;  1CJU B;  4LSN A;  2DHX A;  3S01 A;  3F0N A;  3CJS A;  4NLP A;  3C14 B;  3D3C J;  8RUC A;  2MY8 A;  2IMO A;  4HYK A;  4TY9 A;  3DLB A;  1QAI A;  3CJ0 A;  1MRO B;  3HXM A;  3BM7 A;  4FYX B;  3JSB A;  3CD7 A;  3M2U B;  2G4B A;  4ECT A;  4O4G B;  2GS8 A;  1KOO A;  2HFV A;  3EZU A;  4DPW A;  4AT1 B;  5E0O A;  3T5H A;  4ES1 A;  2GQC A;  2OEM A;  4F67 A;  4DR2 F;  4A8W A;  4FF2 A;  1F5A A;  1IKV B;  4NLW A;  5ETR A;  1AYE A;  2X3G A;  4CLW A;  3W62 A;  4K5S A;  4JV2 A;  4NXM F;  1NSK L;  1FRH A;  1LOU A;  2DHA A;  2CQH A;  2Z4P A;  5CZX A;  3DGV A;  3LAM A;  4KPC A;  4OV1 A;  5HBM A;  2VBZ A;  1YG0 A;  3OVA A;  4ED8 A;  3OVB A;  3D28 A;  1Y10 A;  2RHS B;  1UVI A;  1N56 A;  1DTQ A;  2CNN B;  3R5A A;  2BRK A;  2IRX A;  3GV8 B;  4KV8 B;  5A8W A;  4DF8 A;  1R0A A;  2APO A;  4UZC A;  2EKY A;  4TU9 A;  3O2I A;  5IS2 A;  3KLV A;  1NPK A;  2R4F A;  5IV4 A;  2R42 A;  1YTY A;  1YWX A;  4OI4 A;  1L3K A;  2G2Y A;  1OPZ A;  1U6Z A;  5F9N A;  2XNQ A;  4M5N A;  4J9U E;  1U4B A;  4ZN1 A;  2GQQ A;  4DZD A;  3PKM A;  4CCH A;  1HBN A;  4AE5 A;  5GAD U;  3DLL Q;  1IBK J;  2OD4 A;  4PCQ A;  2Y1R I;  5HP1 A;  2DGO A;  4PXE A;  3PV8 A;  4GVB A;  2HZA A;  2H5I B;  4HHU A;  1HQU B;  4CLF A;  1YJ9 S;  1PJ6 A;  3GFY A;  4OX6 A;  2VG7 B;  4M5L A;  3GR0 A;  2HWT A;  2RQC A;  5HSP A;  4M8L A;  2VIC A;  4D3H A;  4WE1 A;  2ZH5 A;  1HD1 A;  1YRU A;  4JI1 J;  2CJ9 A;  4OYZ A;  3C6T B;  2WON B;  3T5J A;  4DQQ A;  5B7W A;  4FKY A;  1YGY A;  2BJ7 A;  2KVQ E;  3ZO7 A;  2DNP A;  2C2K B;  5HL7 Q;  5DLG A;  4HL9 A;  3BPD A;  4FF1 A;  1MSW D;  2HGL A;  4ZVU B;  4RUC A;  4ED2 A;  3HDS A;  3N0V A;  5LOQ A;  3QO9 B;  3RAM A;  4QR2 A;  3QBC A;  4O3R A;  5D4P A;  2FLN A;  2B5J A;  4BBY A;  4PG5 A;  2NPF A;  2B4V A;  3N6L A;  3BKT A;  4NXM J;  2I9S A;  2GIQ A;  3H20 A;  2CVE A;  1SQF A;  2B9Y A;  2IAJ B;  2EFN A;  1BD6 A;  4N8O A;  3MXH P;  2VOP A;  4P2F A;  2YPY A;  2DIU A;  2O3D A;  3HHE A;  2HAF A;  2DEJ A;  5C2G A;  2UXD F;  3BPS P;  2KG0 A;  2CJX B;  3TA0 A;  3LP1 A;  2IJR A;  1T03 B;  1AB8 A;  4FNI A;  1RTJ A;  2KT3 A;  2FGC A;  1SBR A;  2P6T A;  4Z37 A;  3SBM A;  5BYS A;  1QDU B;  1Q1K A;  3N28 A;  4E98 A;  2GGP A;  5GAG I;  2J6S A;  4UT4 A;  4A8X A;  2GMH A;  2EBG A;  4K4T A;  2XI3 A;  4N41 A;  3M7V A;  1ZAW A;  4YR0 A;  2DT9 A;  1QD1 A;  3I9V 9;  5HAT A;  2KXH A;  2IA6 A;  2XLK A;  1SV5 B;  2KM8 B;  5RUB A;  4AFF A;  1FKP B;  3H5X A;  4LR9 A;  2R3V A;  2XUL A;  4OZ3 A;  2JEG A;  2E7V A;  4I6A A;  1YX2 A;  2YQ3 A;  2DD8 S;  2IPO B;  1VI7 A;  3RAX A;  3RB0 A;  5KFW A;  5B0C A;  1JNZ B;  2VJU A;  2KJW A;  3NRB A;  1ZA2 B;  3DRS A;  3FFI A;  5F8M A;  1P9Y A;  2YPZ A;  4NLX A;  4EBE A;  4IOB A;  2KZZ A;  5AE3 A;  2GZO A;  2FDN A;  3M2R B;  1REG X;  4RX6 A;  3V81 A;  3CCL S;  2BM0 A;  4DUY J;  4CYU B;  1EIY B;  1NH8 A;  4FYW B;  1Y7P A;  2MKY A;  2YWE A;  2BZ2 A;  3TZZ A;  2MHN A;  2WHO A;  4ETX A;  3KYL A;  3CF5 Q;  3MWB A;  3U1L A;  1JLE B;  3EXY A;  2YKM B;  1KWM A;  1U8W A;  2M8D B;  1YBU A;  1U1K A;  4DPX A;  1ZAV A;  2QL7 B;  1HNW J;  1Q8L A;  1MML A;  3UFC X;  4NMX A;  4RWW A;  1HNV A;  4L75 A;  4JYA J;  3BYP A;  1NO8 A;  3MPD A;  3IGV A;  2WAQ D;  3GYN A;  3L4B C;  2A6M A;  3HFZ B;  4I7F A;  1SUQ A;  1GAO A;  3UCZ P;  1ROF A;  4KHR A;  3CDU A;  1X9W A;  1LKZ A;  1V5V A;  1ACM B;  1X5T A;  2XLI A;  1CUL B;  2GO9 A;  1RT2 B;  1QE1 A;  4WK3 A;  3OUY A;  2O67 A;  3OXG A;  5DDO C;  4OZJ A;  2R7V A;  3W63 A;  4FS2 A;  5GMK a;  3Q2T C;  4KKO B;  2EI5 A;  4C0O C;  1M5O C;  1WI6 A;  2UV8 G;  1YHQ S;  2XMV A;  2AMC B;  4WTY A;  2X1G A;  2DH8 A;  2F8E X;  2WW4 A;  4YS2 A;  2PA3 A;  2CJB A;  1T05 B;  3W3S A;  4U67 Q;  2JSX A;  5DRK A;  2MLY A;  5J1E A;  1JLC A;  4PQA A;  2OPP B;  2E9T A;  1Z2Z A;  2DH9 A;  3R27 A;  4E2F B;  2A2C A;  3DLK B;  4DSJ A;  1Q16 B;  3MEC B;  2AWZ A;  3SV3 A;  4KYZ A;  3GJS B;  4J7C A;  4OLP A;  3LP0 B;  3NMA A;  3K57 A;  5J2M A;  3CUN A;  2PI4 A;  5HVG A;  2ADC A;  5IV3 A;  3HK2 A;  4A8S A;  2Z56 B;  2W9B A;  1Q79 A;  4JI8 F;  2JLF A;  4GKJ F;  1N0V C;  3CCQ S;  4A8F A;  2XNR A;  1RT5 B;  3Q8V A;  2H48 B;  4HLB A;  4I6Y A;  4JI6 J;  2FHJ D;  5K8N A;  3U02 A;  4NLT A;  2HFN A;  5C25 A;  1LWF B;  5DQH A;  3OHB A;  4ZA1 A;  1AUS L;  2KH9 A;  2Q6C A;  3BEG B;  1WI8 A;  1WC0 A;  2M9K A;  5DET A;  3CO0 P;  1Y9O A;  1E6Y A;  2IM0 A;  5JVG Q;  5F9L A;  1SJQ A;  2VQE F;  1C0T A;  2GML A;  3TVK A;  4J9P A;  2PGC A;  1HL6 A;  1U24 A;  2OMO A;  4F04 B;  2MJU A;  4Y2K A;  3Q0A A;  1GXU A;  1GMW D;  2PC6 A;  2YKO A;  1LW0 A;  5K20 B;  1VRT A;  4DQP A;  3TUZ C;  4NLD A;  2L9N A;  2FVS A;  2R8I A;  1Q8I A;  1UTA A;  1UP1 A;  5HBM B;  1R6Y A;  3D6H B;  3DM2 B;  2WB1 D;  5LT5 A;  1IVZ A;  3W2W B;  3KHL A;  4FYV B;  4U6P A;  2FZK B;  1DTQ B;  1HBM A;  1UVM A;  1T02 A;  2ZH2 A;  2XS5 A;  5A8W B;  2FLP A;  4ZIT A;  3KMS A;  1DZ5 A;  1MW7 A;  5C7P A;  4IR1 A;  2PI5 A;  2K3K A;  2EBE A;  3OR1 A;  3NNH A;  2VDI A;  1WF0 A;  2RHQ B;  3KTQ A;  4ITS A;  4CT8 A;  5J1N A;  2HFU A;  1UZH A;  3NGK A;  1VHF A;  1NZ8 A;  5D0E A;  4PG7 A;  4QWC A;  1VJQ A;  4N5S A;  1WG4 A;  4DHV A;  2BKN A;  4LF6 F;  5HP1 B;  1RYS A;  4XDC A;  1N8R T;  3BO4 A;  1KP6 A;  1Q86 T;  4GVB B;  1JXV A;  5EWE A;  1S9G A;  2NCK L;  5A2Q Y;  3MM8 A;  2UUA F;  2UXC J;  4HT5 A;  2YWH A;  3TNV A;  1VIX A;  1S97 A;  4YB5 A;  3A8I A;  1NPR A;  2FPH X;  1VQ8 S;  2E44 A;  1CSJ A;  2WOM A;  3B6B A;  3CC7 S;  3MMA A;  1RTI B;  2MPU A;  4LIR A;  4DFK A;  2VKR A;  1KOH A;  2BDP A;  5C2C A;  1WHV A;  5KFF A;  2YNG B;  2VFS A;  4DX6 A;  3TQ1 A;  2B8P A;  3I4H X;  4BHQ A;  3A13 A;  3SCI E;  4MKB A;  2B0G A;  1WKK A;  4NE9 C;  1S49 A;  1LK7 A;  4WFN Q;  2XG8 A;  2VQE J;  5DDQ C;  3OL7 A;  4TQS A;  1VCT A;  3NMR A;  1F5C A;  3NCR A;  4X4V A;  3FRZ A;  4WU2 A;  4RNN A;  2DNL A;  4X65 F;  1VR6 A;  3PZP A;  3WX4 A;  4I67 A;  3A8K A;  4JOU A;  4RO0 A;  2IBO A;  5DM7 Q;  1FDB A;  4KFB B;  4FN5 A;  4RBU A;  4WFX A;  2Q43 A;  5B0F A;  2V63 A;  3KNG A;  2DNH A;  2JEJ A;  4IFV B;  1JJC B;  3IBC B;  3T9N A;  2UUB J;  3LP1 B;  3M8S A;  3GCW P;  4UST A;  1TV6 A;  3ZNJ 1;  4Q8F A;  2HFO A;  4B9L A;  4OX9 F;  1IKW A;  5L39 A;  4AL7 A;  3A1Y G;  3A3O B;  4GKK F;  2GGP B;  4WWS A;  4FS1 A;  1J27 A;  4Q5V A;  1ZYQ A;  2V2Z A;  4NWB A;  3MEG B;  2J6U A;  3AT1 B;  4FXW A;  3DU5 A;  4C11 A;  3FBB A;  2CG8 A;  5F0W A;  2L48 A;  2CVI A;  3M30 A;  1NCL A;  2DRD A;  1KVI A;  3QJP A;  2PN6 A;  4C8Z A;  3IGN A;  2E5L J;  5K8P A;  4RNM A;  1M0S A;  1VC5 A;  4ZPD A;  4M1K A;  4PXC A;  2C2D A;  2ZDP A;  2XCA A;  4CRJ A;  2OSQ A;  3V4M A;  3V5R A;  4RW8 A;  1SVD A;  1OSC A;  4K5R A;  5CD4 A;  3DRS B;  2BOA A;  3I56 S;  4Y2I A;  4DR3 J;  1HAR A;  5T41 A;  2KG1 A;  3AH6 A;  4FXD A;  3EMT A;  4C7Q A;  5KG5 A;  2PMW A;  4PWU A;  5E41 A;  3BGU A;  4C4W A;  1I5O B;  3JSR A;  2CQB A;  2MKS A;  1U8S A;  2DR5 A;  1FF2 A;  4EMD A;  1SKS A;  1UVN A;  2RDI A;  4TY8 A;  2BJ1 A;  3DLH A;  1R7I A;  4NA1 A;  1FDD A;  4J90 A;  3DDK A;  2XMK A;  4J37 A;  1ZAX A;  3JYT A;  2RE1 A;  4IQX A;  2BJ9 A;  1RUS A;  3MGJ A;  4NA2 A;  2IC3 A;  3ZXW A;  2MZ1 A;  5KFP A;  3R2C J;  1WUU A;  2FC9 A;  1FD2 A;  4PPZ A;  2WVC A;  1HMV B;  1CBK A;  1CS4 B;  3BSN A;  3MOZ A;  2QLX A;  4RPF A;  4YY3 J;  5E33 A;  4X65 J;  3PVX A;  4BDP A;  1HNV B;  4B02 A;  3EXC X;  3TW0 A;  3SXL A;  1SPB P;  2DJW A;  1M1K T;  4U7U K;  3PTW A;  3JTN A;  1HI8 A;  2DXF A;  2M0G B;  1SKR A;  3MHY A;  3NAI A;  2F3J A;  3BN7 A;  2WBM A;  2YH0 A;  5FD1 A;  1D9F A;  1RWU A;  1AUD A;  3GCX P;  2O01 C;  1LK5 A;  2BYC A;  5A76 A;  4TVA B;  5BR8 J;  5B0A A;  3HFV A;  4LF8 F;  1FXL A;  1GT8 A;  3I82 A;  4ECW A;  2C2M B;  3MFI A;  2JRS A;  3SFU A;  2KZM A;  1TKX A;  2B4U A;  4IH7 A;  4A8O A;  5H1S V;  1JQG A;  2NXC A;  3UWT A;  3C46 A;  4OZ5 A;  3AY0 A;  4P2M A;  2LQ9 A;  4IYQ A;  2LCW A;  2KFN A;  3H4D A;  3DC2 A;  5CZV A;  2V9W A;  5J1E B;  2CPD A;  4J9Q A;  1MNE A;  2VFT A;  3QT6 A;  2JLE A;  1U47 A;  3M8Z A;  4J5O A;  4PPD A;  1BUX A;  1TUG B;  1RU1 A;  1FJE B;  1N88 A;  1T9W A;  4DV1 F;  1JIH A;  2AX1 A;  3CD6 S;  3HT3 A;  1XMB A;  5KT7 A;  5GAG U;  5KFO A;  1WEZ A;  4F26 A;  1V3R A;  3PW0 A;  4IUF A;  2ZZT A;  3TJ8 A;  2CJY B;  2ZUG A;  1XR7 A;  4ECY A;  1G2E A;  2XHW A;  4OIX A;  3NWR A;  3EM1 A;  3MUR P;  2IVY A;  4CLP A;  3B4D A;  3G8T A;  3H0P A;  5C25 B;  3ZZR A;  2JC1 A;  3M6U A;  3FUY A;  3A12 A;  1ZM4 A;  1FT8 A;  4B9T A;  1WHY A;  4A47 A;  1WSV A;  5D3G A;  4DSK A;  2IBK A;  4DL0 C;  3I55 S;  5KFX A;  4I69 A;  3OXF A;  3J7Z 5;  4WZM A;  2XY6 A;  3RR7 A;  3FZB A;  5K8O A;  4DV6 J;  2DR9 A;  5LSL A;  1NJW A;  3SYZ A;  1X4D A;  4QWD A;  3UR0 A;  1LW0 B;  1VRT B;  1Q0N A;  2GQ2 A;  1NSA A;  2LEA A;  5LMN F;  2ZIT A;  4FXV A;  4OHX A;  2CG4 A;  2VL1 A;  2EG2 A;  3BGF A;  5I3Q A;  3AOB A;  2JVO A;  3KK1 A;  1NRK A;  1C1B A;  1FRX A;  1HBM B;  1U02 A;  3GJQ B;  3FBE A;  4TQR A;  3G8S A;  2WSC C;  4LF1 A;  5EWG A;  3ZTP A;  3GFZ A;  2F1F A;  4LFC F;  3I31 A;  4OYM A;  3OR1 B;  1QUV A;  3GYG A;  2RRB A;  3D6F B;  2CUY A;  3GIL A;  4B3T F;  1WHX A;  4HEA 9;  2ZH1 A;  3Q24 A;  1N6Q A;  3LH2 S;  1EP4 A;  3TA2 A;  4GO5 X;  4OYB A;  1CC7 A;  2B8Q A;  2Y8W A;  1ZOT A;  1QVG R;  4WTO B;  1B64 A;  4JI5 J;  3H8Y A;  1RGV A;  2P6S A;  1X4A A;  3AXM A;  2DGQ A;  4LBI A;  2JZ5 A;  1U1M A;  4NRU A;  2YNH A;  4F3O A;  4IFY A;  3J81 Y;  3LTO A;  1GMU A;  2GW8 A;  2WOM B;  1HR0 F;  3VZI A;  3MMA B;  3ENQ A;  3QAE A;  3I0R B;  2DNK A;  2FD2 A;  2BEF A;  2XBP A;  3M05 A;  3RUB L;  2PO4 A;  1GFW B;  3DOK B;  4ES2 A;  3H90 A;  2FLL A;  5I3U A;  2DO4 A;  3MPW A;  5D0G A;  4LUB A;  3Q2S C;  4LJM A;  1H74 A;  3CCJ S;  2UVW A;  3HCX A;  1YBA A;  4PEO A;  3BO3 A;  2E9R X;  2WVF A;  3T19 A;  1Z4U A;  2RUG A;  5A6P A;  1FJC A;  3C15 B;  4LF4 J;  2QA2 A;  4RNO A;  2QSW A;  1WC3 A;  1SIZ A;  3C66 A;  2R2S A;  4QOT A;  3H5S A;  3IS9 A;  4O0N A;  3CVK A;  3TJ9 A;  3PM9 A;  1S1X A;  4CI0 B;  1A6L A;  1DHM A;  5KFY A;  2LYV A;  4UF4 A;  2JH3 A;  3AHP A;  3AJD A;  1K0T A;  2CJQ A;  1OYE A;  3W1Y C;  3KG4 A;  5IT0 A;  4C3K A;  2RVJ A;  4RW4 A;  2EC2 A;  4IRD A;  3ONQ A;  3GWC A;  4EGL A;  4QIF A;  3O44 A;  1IKW B;  3THP A;  2X7I A;  2VPZ B;  2QA4 G;  4CT9 A;  3UNG C;  5AE1 A;  1XR5 A;  3RTV A;  4M63 A;  1BWV A;  1RT4 A;  2MQP A;  1M5P C;  3OFE A;  2GCF A;  2UUT A;  3RZA A;  4J9O A;  1HBU B;  2ZJP Q;  3G82 B;  2DB1 A;  2Y8Y A;  4UZB A;  1I1G A;  5LM7 E;  1HNI A;  4O3S A;  3TAM A;  1S79 A;  5SZT A;  3V6D A;  1U7L A;  1KSP A;  1A0O B;  4KY3 A;  3M8W A;  2YQ1 A;  1RAB B;  3M8Y A;  4N8N A;  4RW8 B;  3R5G A;  2HBQ B;  2E66 A;  2HRU A;  2AV5 A;  2NS1 B;  1VQO S;  2JWN A;  4Z2X A;  4LBH A;  5DG8 A;  4ZCI A;  1V3Z A;  3VWS A;  3OL8 A;  3E3X A;  1UVL A;  2J9E A;  4DG1 A;  1HR0 J;  1IXK A;  4H4O A;  2N7C A;  4WU3 A;  4X84 A;  4MYU A;  4TY8 B;  1QLN A;  3HSJ A;  2CJK A;  3FMB A;  2D3O 1;  1B4S A;  3FSY A;  3G6V A;  5IFM A;  3D0H E;  3PAC A;  2R2R A;  3CSK A;  1P9Q C;  2CPJ A;  3GFX A;  2OO4 A;  3JYT B;  2C3O A;  2ZUA A;  4NYP A;  2N3O A;  2VC0 A;  1N5Y A;  1ZZN A;  4RUA A;  4CO0 A;  3KK3 A;  2F4F A;  1G4C A;  3G86 A;  4KIA A;  5CA5 A;  2XHC A;  1RU2 A;  1T9U A;  1Q7Y T;  4MKY A;  1OJ4 A;  5L9N A;  4HDH A;  1RLC L;  1HA1 A;  4AQY F;  5D78 A;  3LW5 C;  1M90 T;  4V19 J;  4ECS A;  5HQ8 A;  4ZPV R;  4JI3 F;  1CEZ A;  3PJ9 A;  3GB0 A;  5KFZ A;  4ZCL A;  3VQS A;  1X4B A;  3TX8 A;  3T1Y F;  3LGN A;  4ZS6 A;  1R8B A;  1Q8K A;  4P73 A;  4Y34 A;  1NND A;  4LF7 J;  3VTI A;  1JMT A;  3R7N B;  2PII A;  2XMT A;  3NGT A;  1SCJ B;  1RWM B;  4I56 A;  4PWW A;  1GNK A;  5KFB A;  1OS5 A;  1PIE A;  4KH0 B;  4NZ7 A;  4LF5 J;  1ZH5 A;  3MD3 A;  1LWC A;  4LQ3 A;  3CJ5 A;  1RA6 A;  1S72 S;  3QGI A;  1RAI B;  3TO8 A;  3WQP A;  4JV1 A;  1WAC A;  1WOP A;  1O5J A;  5F8G A;  4F4X A;  3W9H A;  4HH0 A;  4ED7 A;  1HI1 A;  3P45 B;  1KC8 T;  5E3C A;  3N79 A;  2V4R A;  1K1S A;  3IXQ A;  3PRD A;  3EVO A;  2UVR A;  3IAS 9;  4CH0 S;  4K59 A;  3J7A N;  6FDR A;  5B0B A;  3CCW A;  4X64 J;  2GAG C;  5JJB A;  2HHV A;  3QWU A;  2OFH X;  4DL5 A;  3U1N A;  1KFD A;  1F9F A;  2JC0 A;  4MAK A;  4MMO A;  4ZLL A;  4TU8 A;  3T5K A;  2Z2L A;  2DNY A;  4DV3 F;  3W5X A;  1XMO F;  1DQA A;  3R5D A;  4HI1 A;  3ILL A;  2AQ4 A;  1UKU A;  1JXL A;  2DGW A;  4C8K A;  4DR1 J;  1BQM B;  3I0S A;  1FEE A;  3CTR A;  3G71 S;  2H65 B;  3HZG A;  2ASY A;  4DX8 H;  2H5J B;  3PCO B;  1DUR A;  3H5Y A;  2V8H A;  2VPX B;  1MWQ A;  2UVU A;  1H38 A;  2E5H A;  3CDE A;  3OPK A;  1LV5 A;  1IQZ A;  4YB1 P;  2GA7 A;  4URQ U;  3MM7 A;  2GHW A;  4DQS A;  2Z2M A;  4KQZ A;  4USJ C;  3KFW X;  4F2S A;  4JV5 F;  4ES3 A;  5D3G B;  3P3D A;  7AT1 B;  1KVK A;  2V34 A;  1JLB A;  2MKK A;  2P8I A;  3G96 A;  4JUZ A;  1NJX A;  2XLJ A;  2QZ8 A;  3M1V A;  5ETQ A;  5HMZ A;  4P6Q A;  1WF2 A;  2YWF A;  4K4X A;  4WXO A;  3VVU A;  1CJV A;  4C98 A;  4RJV A;  5KG6 A;  2AYG A;  1Z2L A;  5HAN A;  5F0U A;  4JI3 J;  1QUP A;  4J9S A;  3RW6 A;  5KFS A;  3BR9 A;  2O66 A;  3M6X A;  2BM1 A;  4YHH F;  1C1B B;  4KHM A;  1WF1 A;  2KKH A;  3QSI A;  3LWL A;  3EDR B;  5IWA J;  4PUO A;  2ALY B;  4ER8 A;  1X5O A;  2Z0G A;  1YJ7 A;  4L3N A;  4CNY A;  2JVR A;  1ZET A;  3D54 A;  1WNE A;  1TKZ A;  2NXE A;  1DTT A;  3DGP A;  3PO4 A;  1NDC A;  2OKQ A;  1B3T A;  2VG5 A;  2IYG A;  2MST A;  2HGM A;  1QTM A;  3I5A A;  3H25 A;  1S9E A;  2D3U A;  5F8H A;  3PEH A;  2ALZ A;  3L9Z A;  4ICL B;  1NSQ A;  2VJV A;  3MAH A;  3FSI A;  3HT0 A;  2IVF B;  4WFA Q;  1HPZ A;  1RT7 B;  5ETL A;  2VU5 A;  1KQF B;  5DDR C;  3TQE A;  2FJA B;  4RW7 A;  4K50 A;  5B09 A;  4WFB Q;  1CJT A;  2LEB A;  3PR5 B;  2UZA A;  4EK2 A;  3IM8 A;  2YKN A;  3JB9 k;  5E3P A;  3V2U C;  1Q82 T;  3D0G E;  3L95 X;  1RHK B;  2MQO A;  2BW7 A;  3NGD A;  2B4O A;  3DOL B;  2WSF C;  2OUG A;  4NX9 A;  2J7K A;  1H2U X;  5D6G A;  1KEK A;  1HW9 A;  4K4U A;  4Q0B A;  2CNO B;  2KDO A;  3MED B;  2J5A A;  4WF9 Q;  2BJD A;  2CZ9 A;  2QC3 A;  3NBP A;  2DR6 A;  1Q5Y A;  1M1H A;  1XMQ F;  2VC1 A;  1V3S A;  1DAR A;  3BKU A;  4C8Y A;  3Q83 A;  4L76 A;  4M5D A;  3X1L B;  2EEY A;  3IS9 B;  3MR3 A;  3HD2 A;  2NPI A;  5KFE A;  3VGT A;  4IKA A;  1CLF A;  4OYX A;  2RT3 A;  4OJG A;  4HTI A;  4F02 A;  4LFB F;  3THT A;  4RW4 B;  2EK1 A;  3W5Y A;  4KJI A;  3I87 A;  1S4E A;  1TUV A;  3GII A;  2C42 A;  2BKO A;  1L3T A;  3HHL A;  5F8J A;  1TMM A;  3DFE A;  2ZH3 A;  3SV4 A;  5G4D A;  2F63 A;  3ILO A;  3PJW A;  2LXF A;  3DRP B;  3HPO A;  1RTH B;  1RWW B;  4LF9 J;  2MHE A;  2VG6 A;  1VQ4 S;  3WC0 A;  2NUH A;  4XPE A;  2W7O A;  1OMS A;  4I0W A;  3MM5 B;  1X4H A;  1HNI B;  5D0R A;  1FNM A;  1Q95 G;  1T8E A;  1FRK A;  3E8O A;  3TAM B;  3CJ8 A;  2J9D E;  3M32 A;  3TUJ C;  2DCU B;  2OP5 A;  2CNL B;  1NHK L;  2F8M A;  2QV6 A;  3HMJ G;  1HWK A;  2HIY A;  5KT5 A;  4C2M A;  1K1Q A;  1FXR A;  1QSL A;  2EKN A;  3K58 A;  1ZPW X;  1TL7 B;  4Y2C A;  2PE8 A;  2FJD B;  1MMD A;  4CH1 A;  2HHP A;  3BO2 A;  2E7X A;  1C0U B;  1BQN A;  2E1A A;  3H42 A;  3MMC A;  2XTJ P;  1H6K X;  4H4O B;  5K8M A;  1QSS A;  4R8U A;  3AOC A;  2DRA A;  3BH6 B;  3OTO F;  3G6Y A;  3PX4 A;  2K8G A;  4DU8 A;  1N0U A;  1MG7 A;  1EQ0 A;  3OHA A;  1NME B;  4H4M B;  2P2C B;  5DLF A;  2GJF A;  4NXN J;  1D9A A;  3G6E S;  1NHV A;  3I9Z A;  3O3L A;  1S1V A;  1W26 A;  4KO0 B;  1XMQ J;  1EJ7 L;  3OJU A;  3DXB A;  3PEJ A;  5IZH A;  1KQK A;  2JFK A;  3OQ2 A;  3PFE A;  3C14 A;  2PFF B;  1TFW A;  3KUE A;  5KFL A;  2LXU A;  4RLE A;  5C24 B;  2R9L A;  3DYA B;  1U0S A;  2DBB A;  2R7O A;  1M5S A;  4OZN A;  4LFB J;  4FVM A;  2JNJ A;  3LP2 A;  3ENV A;  1TKT B;  2MZR A;  3U27 A;  1RWK B;  2KTQ A;  4LBP A;  4YR3 A;  5DJB A;  2ZH6 A;  4DSI A;  1FTR A;  2WCX A;  2GIR A;  2EXU A;  1SB6 A;  1LWC B;  1IKV A;  3I4P A;  1OSD A;  2IDL A;  4XTT A;  4A48 A;  4XIU A;  4HI2 A;  3HSD A;  1VQP S;  2NLW A;  3UVJ B;  1VQL S;  4R25 A;  4DFJ A;  4K4Y A;  2ZH4 A;  2QEX S;  1RWN B;  1U0H B;  3Q89 A;  3GG0 A;  1HWI A;  2DPJ A;  4ZJL A;  1WHW A;  4YEA A;  4IRK A;  5CQG A;  4QW9 A;  1S7H A;  4OJH A;  2KHD A;  4OYO A;  4KV8 A;  1BC6 A;  3LF0 A;  5J2Q A;  3TP2 A;  5ADZ A;  1XN9 A;  5D8H B;  1KLN A;  1YLX A;  3I0S B;  4OL8 A;  1WEX A;  4OZ2 A;  1GXL A;  1SL0 A;  1FX2 A;  4L3K A;  1RBL A;  1G6B A;  2OEJ A;  2PEH A;  1CJK A;  4IG3 B;  2KJV A;  1DRZ A;  1NKB A;  2HVI A;  4I4B A;  5IM0 B;  4ELV A;  2EC0 A;  2HBZ B;  2RRA A;  4DL7 A;  4BC9 A;  2KL8 A;  3LPY A;  3LGH A;  3TUI C;  2HIQ A;  3EDQ B;  2N82 B;  2V8D A;  3D68 A;  2OD6 A;  1VBK A;  4MFB A;  2CRL A;  1HQU A;  4X4O A;  4FYD A;  4EUV A;  3PYE A;  1VQM S;  4B3S J;  2DNM A;  1LFW A;  2KYZ A;  4YDD B;  1NM2 A;  3MI7 X;  3RW7 A;  1LW2 B;  3DU6 A;  1N32 J;  1APS A;  2PSZ A;  4UOG A;  3K5O A;  1FDN A;  3HFK A;  4FF4 A;  2B56 A;  3C6T A;  2XZT B;  3T1H F;  5AXK A;  4DPT A;  2M88 A;  1RT6 A;  5CH7 B;  2QSF A;  2YX1 A;  4ED0 A;  3NGR A;  5U47 A;  3DLE A;  2G1H A;  4USV A;  1R89 A;  4JI0 F;  2XO6 A;  2B43 A;  3FDS A;  4ILL A;  1HW8 A;  4XK8 C;  2QO3 A;  3MCS A;  1I6J A;  5CYM A;  3TRG A;  1KTV A;  4Y6I A;  2MKH A;  1I94 J;  3VGU A;  3CXC R;  3KXD A;  4B3R F;  4OJ3 A;  1DTT B;  4NA3 A;  3N5F A;  2VG5 B;  3A8E A;  3GR1 A;  3QZ7 A;  1RT3 B;  1S9E B;  2VPY B;  4U8Y A;  4DZ6 A;  4YUD A;  3KLI B;  4DV4 J;  4CLS A;  3HVA A;  4LR8 A;  3MEE A;  3VAI A;  1HPZ B;  1IN0 A;  1T03 A;  1NPP A;  3NOC A;  1UET A;  2Y1J A;  3M6V A;  4U95 A;  2AYE A;  1CJT B;  4TLR A;  1LEO A;  4P9S A;  4ZIV A;  2JOQ A;  2YKN B;  1RCO B;  4U96 A;  3UPF A;  3UD3 P;  3CJT A;  3RBZ A;  4LT6 A;  4DWI A;  4Q2M A;  4EYI B;  1FKP A;  4NAS A;  4F0K A;  3DHX A;  4NL5 A;  3ICL A;  2HHT A;  4KRW A;  2NYI A;  1U45 A;  1TK0 A;  4Q0B B;  1S7I A;  4NLO A;  3W5Z A;  3PDN A;  5HRO B;  4OX8 A;  3RG6 A;  4P7V A;  2VV5 A;  4X66 F;  2DKO B;  2ZWP A;  1XNR F;  2C22 A;  3RGI A;  2ZNZ A;  1KNZ A;  2L41 A;  3M2R A;  4PQU B;  3MD1 A;  2RRN A;  4P74 A;  2QX0 A;  3DN9 A;  3Q8Y A;  4P75 A;  1MWY A;  1Y11 A;  4CYU A;  3CB4 A;  3ZZ0 A;  1S1W B;  3FCV A;  2CA9 A;  4WP8 A;  4Q7A A;  2JEF A;  1J5E F;  4MYT A;  5IXU A;  1RAJ A;  3D67 A;  4U7U D;  4DX7 A;  4C3L A;  2HHX A;  1VLY A;  2YKM A;  2B9W A;  5KG0 A;  4NLU A;  4ZLJ A;  4CQ1 A;  5L1I A;  2HZC A;  1MWZ A;  4B3R J;  5HVH A;  4XO0 A;  3Q23 A;  1KKH A;  3I32 A;  4DR4 F;  2OPR B;  5HI7 A;  3UD5 A;  2VG6 B;  4K0K F;  2VHG A;  1UPP A;  1U26 A;  4XDD A;  2HHU A;  2V50 A;  2Z57 B;  3HVT A;  5C5J A;  3M32 B;  9RUB A;  1DLO B;  2LLZ A;  2R7X A;  1R0B G;  1RAA B;  1F0X A;  2V5H G;  2W7A A;  2C1E B;  4R0E A;  2FZC B;  1RE1 B;  2DTJ A;  3MR6 A;  1CUL A;  4RUH A;  1RT2 A;  5L1J A;  4G1Q A;  2RKI B;  1N34 J;  3DI6 A;  4EO6 A;  2W4D A;  1TQL A;  1TR0 A;  3D6M B;  2H1Y A;  1A7G E;  4ZVT B;  4KKO A;  1BQN B;  3CUL A;  2R7Q A;  1EET A;  2ACY A;  3C8Y A;  4R8U B;  5HO4 A;  3LWM A;  3DRY A;  4DEZ A;  2V68 A;  1LWE A;  1Q78 A;  4ID5 A;  1T05 A;  1M5V C;  2CYY A;  4USK A;  1HIY A;  2EK6 A;  2V4J B;  4DSF A;  3MM6 A;  3DXS X;  3K0J A;  3TOQ A;  4QYZ K;  3DLK A;  4NCB A;  3VF0 B;  2W9C A;  1PGZ A;  3MEC A;  2IJF A;  4AXI A;  4X66 J;  1XNQ F;  3LP0 A;  1ARO P;  3K5N A;  5ETK A;  1TL3 A;  4X2B A;  3MZI A;  3KKF A;  4NPO A;  4YN3 B;  2LU1 A;  2F7V A;  4NLQ A;  5ETN A;  1RT5 A;  1YJW S;  4EEY A;  1N5V A;  4PAB A;  1LWX A;  5K14 A;  3LP2 B;  1Y4Z B;  2VON A;  1HLW A;  1LWF A;  2O5D A;  2W2M P;  2HHQ A;  1FFW B;  2RS2 A;  3IG1 B;  5AJ3 F;  1PC5 A;  3CNQ P;  2V8G A;  4C6A A;  1IBM F;  4CO5 A;  3D2W A;  4DR5 J;  2DIT A;  3GU0 A;  3BB5 A;  4HHH A;  2MDA A;  4DR4 J;  2V2Q A;  1VQN S;  1ZPV A;  3HVW A;  1FWK A;  3PIO Q;  2VOO A;  5D4O A;  3HP6 A;  3DDN A;  4CLZ A;  1NK5 A;  3PYD A;  1YVF A;  3J7A 1;  1KFS A;  2W7P A;  2DXE A;  3R5C A;  3GV7 B;  2CQG A;  4NLV A;  2DNQ A;  3DM2 A;  5THW A;  2M7S A;  4DV7 F;  3W2W A;  2WW8 A;  3R7S B;  5ETT A;  4FP9 A;  3PX0 A;  4ZVG A;  3EE3 A;  3US5 A;  2MKI A;  5M2U A;  3CT9 A;  4ZVF A;  1W7W A;  2Z8Q A;  2RIL A;  3EX7 B;  1ZM9 A;  4FVC A;  4LSZ B;  2A0F B;  2CZV C;  5J2Q B;  1RKI A;  1VRQ C;  4QJV A;  2X51 A;  3FKB A;  2OPS A;  1FER A;  1QM9 A;  2HPU A;  4AYB D;  4BC7 A;  3RYL A;  2FVQ A;  3MF5 A;  2HSE B;  5LJ5 Y;  2QL9 B;  3EGN A;  2UXB J;  1VBZ A;  5ETP A;  4ELU A;  1CJK B;  4ED4 A;  1IJE B;  2HHH F;  3Q8U A;  1H0H B;  5KTQ A;  3RJM B;  1DQ9 A;  1U1Q A;  3GMG A;  2HLT A;  2IRY A;  3P5B P;  3FEY B;  5KFR A;  4M5G A;  1S0V A;  3F41 A;  1PIL A;  5L1L A;  2LEP A;  2Q79 A;  2W2P P;  4O3O A;  2C2R A;  1GTE A;  4MFB B;  3M8P B;  3FGV A;  1YK9 A;  3JSY A;  5ETM A;  3DMJ B;  2ZM6 F;  5D4L A;  2Z2Z A;  2ROG A;  4NLR A;  2RNE A;  3GSI A;  1Y3K A;  4DS5 A;  1BLU A;  1UAW A;  1SC6 A;  1RTI A;  2K2P A;  2QN6 B;  2Z30 B;  4MH8 A;  4R0J A;  1RT6 B;  4L73 A;  4UUX A;  3OLB A;  2ZBI A;  1PAE X;  4F25 A;  2YNG A;  2B3T B;  4RNH A;  2DH7 A;  3DLE B;  4UOC A;  2RJZ A;  3UNY A;  4OZ1 A;  3V4I A;  3ZTO A;  5AJ3 J;  5F3Z A;  3MCN A;  2L9W A;  1BWE A;  5CYM B;  4BLG A;  1Y0H A;  4DR2 J;  5D0H A;  1UFW A;  4JI7 F;  3FCW A;  3QT5 A;  4WZQ A;  1V9O A;  2ASL A;  1D09 B;  4MK9 A;  2N3L A;  4C0B A;  2CDR B;  4DJB A;  2B7C B;  2A3J A;  3BGR A;  4I6W A;  4KFB A;  1P27 B;  3PYG A;  1UPM B;  1XC9 A;  4QCL A;  4RBT A;  4DV7 J;  3R5J B;  2FC8 A;  2GVZ B;  5LJ3 Y;  4PYA A;  2X1F A;  4F4K A;  4IFV A;  5D4N A;  2LMI A;  3MEE B;  1RZM A;  3UN3 A;  3G4S S;  3I96 A;  1OY6 A;  1YQH A;  2VIH A;  4DL3 A;  2HNZ B;  1S6Q A;  2ZBC A;  3SDE A;  2DHG A;  1N4L A;  2LDI A;  2V9K A;  1VOM A;  4O44 B;  3CIM A;  3V6K A;  2WZ1 A;  2YVS A;  2BOP A;  3Q8P B;  1W2I A;  3UQS A;  3SQO P;  3KK2 A;  1SQE A;  4F4Z A;  4ZVH A;  5I4M A;  2I0X A;  3MEG A;  3K5P A;  3L7U A;  2EPI A;  4KTQ A;  2HHH J;  1NJZ A;  4RNF A;  3PO5 A;  2DNZ A;  3EJM A;  4ECQ A;  2HEK A;  2R8G A;  2IVM A;  1U2F A;  2E5J A;  2COL A;  2P5V A;  2RDJ A;  3HLU A;  1FFG B;  4ZCM A;  3NGU A;  4ANC A;  2OTL S;  3WIV A;  1S77 D;  3TZW A;  1WKJ A;  2ASD A;  1S48 A;  2LFV A;  1B99 A;  4F50 A;  1X4F A;  3LUY A;  1HHQ A;  2BA9 A;  1LQ9 A;  4DBQ A;  1FJ7 A;  1GMW A;  4K2J A;  5LL6 d;  2ZKU A;  2HK3 A;  2OFG X;  3BQ0 A;  1GX5 A;  4YFU A;  4LSL A;  3KG1 A;  1SJF A;  1HNZ F;  1VGY A;  5HQM A;  5KFU A;  3MR5 A;  1EB0 A;  2XWY A;  4LMZ A;  1HMV A;  4QW8 A;  2F4V F;  3C3L A;  1CS4 A;  2DO0 A;  1UW4 A;  2E1M C;  1F5B A;  2GNK A;  1FJG F;  1T7P A;  4RL1 A;  1AXQ A;  3AD9 C;  1KQS R;  4X4N A;  3NL0 A;  1YSJ A;  1EQM A;  2L9D A;  3HVT B;  5EHH A;  5HMX A;  2HVH A;  3ZC4 A;  2UXD J;  1Q4R A;  3PYF A;  2W8L A;  3HKW A;  1FWP A;  1ELO A;  2C2O B;  4EBD A;  4ETZ A;  2U2F A;  2DXD A;  1TMJ A;  1YDL A;  1P1L A;  1NU4 A;  3DKD A;  2XI2 A;  4NLG A;  4G1Q B;  2CJA A;  3DI6 B;  1RAF B;  2PA8 D;  2QIF A;  2ZVI A;  3GPA A;  4WBF A;  1FCA A;  1LXN A;  1X31 C;  1EET B;  5DGB A;  2YNI A;  2RDD A;  2QRR A;  2XYG B;  1LWE B;  4PWD B;  1Q53 A;  1JLQ B;  3FBF A;  1S0M A;  1RT1 B;  4ID5 B;  2BMB A;  3NG8 A;  3GIM A;  4PAA A;  4A4J A;  2MQQ A;  3MM6 B;  1RHM B;  3JQJ A;  4JI4 F;  3JS9 A;  1XR6 A;  2W9C B;  3Q8R B;  2EFO A;  3B8H A;  3PKY A;  3GFH A;  3HJV A;  2E5I A;  1JLF A;  1IWG A;  3KHH A;  1RYR A;  5A8R A;  2RQ4 A;  3K59 A;  2EFV A;  1PJ5 A;  1SKU B;  1TL3 B;  1A9N B;  4I2P A;  3EIC A;  3BBF A;  2C28 A;  1FEH A;  1HFE L;  2AJ1 A;  4DV5 F;  4HT7 A;  2BX6 A;  2LDY A;  4PRF A;  4L6V 3;  3N9U C;  3WBZ A;  1U1O A;  1S76 D;  1WTB A;  2V8P A;  5K14 B;  5I3P A;  1K9M T;  3HHL D;  5I42 A;  2FHK A;  1MN9 A;  2BR0 A;  5F3T A;  5FLX U;  2HQI A;  1QAJ A;  1HNZ J;  5F8N A;  2X3D A;  2POK A;  1ZZF A;  2CQ2 A;  2HUR A;  4IDK A;  3DOM B;  1O8B A;  1E6V B;  4ZN3 A;  2XO7 A;  4DCP B;  1N52 B;  3JQK A;  1HWL A;  4P7T A;  3G6X A;  2HGN A;  3SQG B;  4DV2 F;  4XAK A;  2C2Z B;  3OSN A;  1S57 A;  1R8A A;  3BSA A;  3ENA A;  3PW5 A;  2EG1 A;  2JDJ A;  2KHC A;  5GME A;  4CM2 A;  4DU7 A;  2DHS A;  4MTP A;  1VBY A;  1X5P A;  1H2T Z;  1XTZ A;  3KJF B;  2ROP A;  3C2P A;  3AXK A;  1SI9 A;  5IC4 B;  3QPI A;  4MJK A;  2W01 A;  3JSM B;  2OPS B;  1NK6 A;  4NEZ A;  3FJ2 A;  3DDI A;  1JX4 A;  5CYQ A;  2ZJQ Q;  2IDE A;  1SC3 B;  1JLA A;  1XJW B;  4ENO A;  5L38 A;  4FZV A;  2RF2 A;  4PXD A;  3CW2 C;  2W9A A;  4U8V A;  5K9F A;  3OFH A;  3IR6 B;  3T9Z A;  2NR0 A;  5A0Y A;  5FJ4 A;  2CPX A;  4Q43 A;  3H5U A;  1VQ9 S;  4WCE Q;  3CED A;  2ATL A;  4DL6 A;  2KO1 A;  1KN6 A;  3HJF A;  1NDL A;  5IQ6 A;  2QMX A;  1FI4 A;  3N4W A;  2MXY A;  2FIU A;  3MAA B;  2BQU A;  2OJ3 A;  1S1U B;  2VD3 A;  3QJJ A;  5BYR A;  1U2C A;  1YJN S;  3PX6 A;  5BYQ A;  1SL1 A;  4ILM A;  3OL9 A;  5CYJ A;  3W8P A;  4JI8 J;  3KWM A;  3HD1 A;  4DV5 J;  5BJR A;  5LXY A;  4GKJ J;  3OTB A;  2YWG A;  1T9X A;  3OT9 A;  2ZBQ A;  4ED1 A;  4WIQ A;  2G13 A;  3I0R A;  4B9N A;  5IT9 U;  3DOK A;  1RTD A;  1X4G A;  3V4I B;  3OBI A;  2K1R B;  4OYA A;  3KNA A;  1RHQ B;  1KQG B;  4OJ1 A;  3TA1 A;  2NQP A;  3KHR A;  4DSE A;  4F0M A;  1K47 A;  4MT1 A;  3MEK A;  4LIW A;  4URG A;  2V69 A;  4LFA F;  4B9M A;  3IFE A;  2CPI A;  1AZS A;  3C15 A;  3VAF A;  1L3U A;  2HHS A;  1OQ3 A;  3IRX B;  2XSJ B;  3MAQ A;  4FPR A;  2MZJ A;  4IQM A;  3R97 A;  3B54 A;  2A18 A;  2OSR A;  3D6T B;  3UE2 A;  4DV2 J;  3W60 A;  3BGR B;  2UV8 A;  1DAX A;  1L3V A;  3HZE A;  1SJ1 A;  2VDH A;  3AD8 C;  1IBC B;  1SC4 B;  4DN0 A;  3D5M A;  1TL5 A;  2QL5 B;  2RQM A;  2W24 A;  2D9O A;  1YRT A;  3C6U A;  4X4R A;  4DUT A;  1S6Q B;  3SDE B;  1ULR A;  3OJS A;  2VOD A;  3IMQ J;  4OI2 A;  4C8L A;  4LVN P;  4QPX A;  1IWA A;  1PAU B;  3KK2 B;  2ZC3 A;  2HQG A;  1WDD A;  3TAQ A;  2ILZ A;  2XMA A;  4F4Y A;  4MIB A;  1RJJ A;  1U48 A;  1VK3 A;  1L3S A;  3PNI A;  1IR1 A;  4ZK7 M;  1HBU A;  3G82 A;  1RAE B;  1N48 A;  3H98 A;  3T41 A;  1F1B B;  1URR A;  4LF6 J;  4ZOS A;  2CQ3 A;  2V94 A;  1SL2 A;  2HYI B;  2C3Y A;  2ZBP A;  5T7L B;  4UUW A;  4OLO A;  3PJX A;  3M9N B;  2W4C A;  1HWU A;  4OI3 A;  4OZ0 A;  2NYH A;  2CXE A;  4O0I A;  2UUA J;  3VAM A;  4GO7 X;  2IIH A;  2YNF A;  4GVL A;  3POT B;  3SMZ A;  2LQ8 A;  2M3D A;  2GJ2 A;  1FES A;  2XY5 A;  1U2R A;  1UA1 A;  2D9P A;  4WKR A;  5ETV A;  2HAI A;  2OPQ A;  4H4K A;  1NXI A;  3UCG A;  1FWL A;  4CO3 A;  1AA1 B;  3R2D J;  4DFP A;  2IFX A;  3E51 A;  5EUH A;  5KFJ A;  5KFH A;  4DCO B;  2BE2 A;  3SCK E;  4LSL B;  1T94 A;  1JJ2 R;  2DIS A;  5DZ6 A;  1VRU B;  2ZOF A;  4R5P A;  4UW2 A;  1H7W A;  1KON A;  2VFV A;  2YKA A;  1NK0 A;  1HYS A;  1TTH B;  4HTJ A;  5G0R A;  4G6V B;  1NJY A;  3K8V A;  1FXD A;  4OYW A;  2NSC A;  1NB7 A;  1Y5N B;  1RIS A;  1NH7 A;  2HRT A;  1QTN B;  4B9S A;  1YIJ S;  4TXS A;  3E2E A;  4ECX A;  4CLK A;  3PFO A;  2E7W A;  3QRR A;  4DS4 A;  2JL9 A;  1NK7 A;  2G1D A;  2D3O R;  5AE2 A;  3C16 B;  1AW0 A;  4OX9 J;  3TEG A;  4ZIW A;  3SCL E;  2LEC A;  3ZZT A;  3M8R A;  4GKK J;  2FJB B;  2XM3 A;  4P2S A;  2C2E A;  3D3B J;  2ZD1 A;  3S6E A;  3J80 U;  1VQ5 S;  1N5S A;  2DGX A;  2YNI B;  4JI1 F;  3LAL A;  1Q5V A;  1FK9 B;  3WX8 A;  1PKU A;  5KFD A;  2R7U A;  1R0C B;  2OEL A;  1GTH A;  2H51 B;  2J9D A;  2VH7 A;  3BGL A;  1JLG B;  4ZP7 A;  1WJ9 A;  1EHW A;  2Y0B B;  4ZP6 A;  1F3V A;  3JXO A;  2DNG A;  3IRW P;  2MQM A;  2MZS A;  1JLF B;  1UEU A;  2QA4 S;  3A3P B;  5A8R B;  2FJV A;  2F9D A;  1TVR A;  2G2Z A;  4YP3 A;  1KTQ A;  2XGP A;  1P8G A;  4CIO A;  3VQT A;  1GK8 A;  2BUN A;  3PG9 A;  2HVZ A;  2CNK B;  1RHJ B;  4I2P B;  2A1B A;  4EU0 A;  5MLC V;  4USH A;  2GV1 A;  3QNW B;  2D7S A;  1BQM A;  3EYZ A;  4TNO A;  2QFJ A;  4CZC A;  3D1H A;  3ZTS A;  2JHE A;  5IC6 B;  4TYA A;  4WYW A;  5CHC B;  2Y1L B;  3HSZ A;  2ZDO A;  2BE7 D;  2PDA A;  4BWM A;  2A6O A;  5KG2 A;  2M52 A;  3KLH A;  3J7Y I;  2WBR A;  4LVO P;  1D9D A;  5I42 B;  4KAI A;  1KS2 A;  3NNA A;  1WG5 A;  2BXJ A;  2IMW P;  2V0N A;  4X4Q A;  2W25 A;  4BCA A;  4DUZ F;  4KB7 A;  4IDK B;  2QTW A;  4CO2 A;  2H3E B;  1VJW A;  4KGZ B;  1PBU A;  4RW6 B;  5B0D A;  2JLG A;  5EGY A;  2BJE A;  1K44 A;  5IQQ A;  3QFW A;  2PT0 A;  2QLB B;  3H2L A;  4HVZ A;  5E3R A;  4OQJ A;  1R6V A;  2M5Y A;  2MY7 A;  3PRB A;  4QWA A;  1YIT S;  1FTC A;  5CXT A;  4TN2 A;  4NZ6 A;  4FNH A;  2P9E A;  3TUP A;  3CC2 S;  4OV6 A;  2B4P A;  4J9M A;  3QGG A;  4NCA A;  1KVJ A;  3LOU A;  3DNC A;  4LF8 J;  1PO6 A;  2M8H A;  4JP8 A;  4JI2 F;  1B0T A;  3ZNU A;  1R8C A;  5DG7 A;  1VK8 A;  5HJY A;  3KJV B;  2J7W A;  3BZQ A;  5KG1 A;  1S6O A;  2OGU A;  2I1R A;  4A8Q A;  5CYQ B;  1JLA B;  4ZLP A;  1C4A A;  3PXG a;  2OH2 A;  3C19 A;  2RF2 B;  1IKX B;  4ZJO A;  3CC4 S;  1NAQ A;  4DUY F;  2AJ0 A;  1M5H A;  3FEZ A;  1N5T A;  2AU0 A;  2CWK A;  2QLW A;  3LO3 A;  3KLG A;  2HS3 A;  4ICL A;  5A0Y B;  2BRL A;  2MTL A;  3P49 B;  2YBV A;  4YOE A;  3EGV A;  1U6B A;  1N33 F;  1X4E A;  1EZZ B;  1RT7 A;  3CDA A;  4N77 A;  4DV1 J;  3GTY X;  3DRX A;  2KT2 A;  2HNY A;  3UDC A;  4NYO A;  1YBT A;  4O3Q A;  2F40 A;  3DLG B;  2EFG A;  2HW3 A;  1HNW F;  2VPW B;  3HSG A;  4Y2M A;  4CLL A;  3PW7 A;  3SZ2 A;  4JYA F;  1RAD B;  3KJN B;  3A3N B;  1TL4 A;  2AF6 A;  3CCU S;  2QLJ B;  1D8Y A;  4FKX A;  4RZR A;  4KGV B;  4P10 A;  1RTD B;  3QAT A;  4J91 A;  1U25 A;  3OFG A;  5KFN A;  4M5M A;  3DOL A;  1HNX F;  4RW9 A;  4DUZ J;  2A2D A;  1F9E B;  3HVR A;  3DRR A;  2J6T A;  3MED A;  1FA0 A;  4OMF G;  3TVZ A;  5JVH Q;  2KVI A;  5KOW A;  1AZS B;  4ZHR A;  1V6H A;  1GH8 A;  4NLS A;  2EFQ A;  4NCG B;  1KR4 A;  5E2Q A;  5LMN J;  4DFM A;  1ZTT A;  2QGF B;  2M4M A;  2JJ4 D;  5DG9 A;  1OO0 B;  3CJK A;  4KGK A;  2XYH B;  3NXZ A;  5KFT A;  5AT1 B;  4ERD A;  1KD1 T;  4WKY A;  5EX0 A;  1MMN A;  4K4W A;  3C6U B;  1F60 B;  3QT7 A;  1REV A;  3O6Q A;  2UUC F;  3ZZZ A;  4LFC J;  2ROE A;  4JI2 J;  1ZBT A;  3VGV A;  5D77 A;  4KH1 B;  3EVW A;  4B3T J;  1GX6 A;  3R3T A;  3DRP A;  1JJ4 A;  1RTH A;  7FDR A;  2H5E A;  2MEW A;  5HLF B;  2MYF A;  4CM0 A;  3MM5 A;  4JI6 F;  3ZFV A;  3W61 A;  3BN4 A;  3ETO A;  1N33 J;  2OTJ S;  3RU0 A;  1UZD A;  5HN0 A;  2ERR A;  2J8S A;  1FD8 A;  3J7Z T;  1UMJ A;  4HR2 A;  3QGH A;  1FHT A;  5JXS A;  4USM A;  3I6P A;  4AL6 A;  4GRS A;  2YNF B;  1F2G A;  4OZL A;  1TL7 A;  2J7U A;  4DPY A;  3CE8 A;  4DQR A;  4AD6 A;  1C0U A;  5E3A A;  2OPQ B;  2FJW A;  2AEF A;  2CDQ A;  1X60 A;  3NGS A;  4DPO A;  3CCV S;  1RA7 A;  3G87 A;  1HHS A;  2YKP A;  2AGP A;  5H9F K;  4KGX B;  1U09 A;  4ZMM A;  4V19 X;  4G3I A;  2PFD A;  2BE2 B;  7FD1 A;  1HNX J;  4H4M A;  3CMQ A;  4YDX A;  3VAK A;  4R5P B;  4Q45 A;  2FYX A;  3HUL A;  1W2B R;  3KLE B;  2HMI B;  1YJR A;  1HYS B;  4KO0 A;  4AL5 A;  3W2V A;  5E7O B;  5G0R B;  3BH7 B;  1EAY C;  5KT2 A;  2RML A;  2E1P A;  1NLK L;  2AD9 A;  1RB0 A;  1YKW A;  4NI2 B;  1URN A;  4KT0 C;  4QYZ J;  3KOA A;  2MQL A;  3PW4 A;  2D69 A;  2AP6 A;  4F4A A;  5C24 A;  2ABY A;  2XZW A;  2ZEJ A;  3DYA A;  1T95 A;  4QU6 A;  3AOD A;  3MMJ A;  1S6P B;  4JBC A;  3P6Y C;  1S0N A;  4UTG A;  1JB0 C;  3UI3 A;  4AXJ A;  1KRP A;  2H54 B;  4LQ9 A;  4ZVE A;  1TKT A;  1TAQ A;  2AJ2 A;  1ZTW A;  4LRA A;  2GAH C;  2UUC J;  3L7O A;  3SSR A;  4UY8 5;  2QJ3 A;  1B0P A;  3BDE A;  3EZO A;  4LSN B;  2UXC F;  3KUH A;  2BJ8 A;  3DCA A;  2ZD1 B;  4HH1 A;  2XS7 A;  2OIH A;  5GVQ A;  2BAN A;  5KOX A;  3U1M A;  1M1G A;  2AJ4 A;  1NJI T;  5SUH A;  2CQI A;  2QLF B;  2KFY A;  1NDK A;  2AT1 B;  1UWA A;  2LXI A;  2RQK A;  3UVJ A;  4J9N A;  2LQ5 A;  2LVW A;  4F7V A;  3ELH A;  1G1X A;  1U0H A;  2VFR A;  3TX0 A;  2YH1 A;  3L09 A;  3NLC A;  1FKO A;  4RUB A;  2DYA A;  2QG9 B;  1VDH A;  2J0W A;  1TVR B;  2FY1 A;  5DM6 Q;  4A8M P;  1IBL F;  3VZH A;  4IH5 A;  3ENW A;  5M2R A;  4PG6 A;  5KG3 A;  2KYX A;  2YWK A;  3IWX A;  4ZJQ A;  3NOG A;  3VAJ A;  3QLH A;  3NCP A;  3FQK A;  3K17 A;  1SH3 A;  4I2Q A;  1RAG B;  1UFK A;  1ZA1 B;  3KLH B;  4LR7 A;  3R1H A;  4IG3 A;  4AND A;  4Q8E A;  3K5L A;  2ZH8 A;  4C3M A;  2LQJ A;  2I38 A;  3H59 A;  5IM0 A;  2UUB F;  4KSE B;  2XMW A;  1IKY A;  2ZZM A;  5CCL A;  3QAU A;  4MKA A;  1RAH B;  2MSS A;  2H9Z A;  1DY3 A;  5KT3 A;  3BSC A;  1WC4 A;  2M2B A;  1R0A B;  2IYI A;  5KG7 A;  4IO1 A;  2HQC A;  4EO8 A;  2Y3Y A;  2Z58 B;  2G0C A;  4O23 A;  1JJH A;  1HBO A;  1XWL A;  1RTZ A;  2XGQ A;  4AQY J;  3FBC A;  3TEH B;  1SJR A;  3D9B A;  1WC5 A;  4QIG A;  1LW2 A;  2ATC B;  2YXL A;  2R7S A;  4TKT A;  4NRT A;  3BBC A;  1VYA A;  1HBN B;  3T1Y J;  2R2T A;  5JUM A;  4I1T A;  4CP5 A;  2W8K A;  2DY1 A;  5GMD A;  2E5L F;  3GLJ A;  4O3P A;  2D74 B;  2R8J A;  2FZG B;  3IWN C;  5AXL A;  2E1R A;  4PXB A;  3BJY A;  3B82 A;  2RU9 A;  3W64 A;  1R3N A;  3OSP A;  5IT4 A;  4ED6 A;  4DR3 F;  1SQG A;  2ADB A;  4P71 A;  4KBI A;  1YJU A;  4WE1 B;  2DHH A;  1Z1Z A;  1QJH A;  5DDP C;  1RT3 A;  3MPV A;  3G8Q A;  4QR1 A;  3TVY A;  5KFV A;  3KLG B;  2CPF A;  3KLI A;  2M70 A;  3L7P A;  5HJX A;  4ED3 A;  2CKW A;  3WDO A;  5H9E K;  3M2V A;  4USU A;  1PYO B;  2H4Y B;  3V6H A;  2B7B B;  2B5J B;  2HNY B;  5CAB A;  3F44 A;  3RRK A;  4DV3 J;  1XMO J;  1FNX H;  2XMU A;  2KRB A;  2BE9 B;  1IBL J;  3WHI A;  3IR7 B;  4EZ6 A;  4MKV A;  4PKD B;  4YY3 F;  2GO8 A;  2KT5 A;  3PRV A;  1BQX A;  3OV7 A;  2MGZ A;  3W9J A;  2OAU A;  3ADA C;  3D0I E;  1R8H A;  2VBY A;  2DR8 A;  3BKF A;  1LNQ A;  2EW9 A;  2R7T A;  2MMY A;  2L08 A;  5LXR A;  5A6W A;  4JV5 J;  1EKS A;  3BR8 A;  4DMZ A;  4ILR A;  2L3M A;  4UY8 T;  4RW9 B;  4BS2 A;  1RTJ B;  3MCO A;  4WFZ A;  3DRR B;  5BR8 F;  4ZPC A;  3QT8 A;  2V6A A;  1WG1 A;  4E8U A;  5HRO A;  3BQ2 A;  3K89 A;  2V4Q A;  2HZV A;  4ZHR B;  2MZT A;  4L72 B;  3VAH A;  3MTJ A;  4FBU A;  1HI0 P;  1SJ4 P;  3ILJ A;  4PQU A;  3T5L A;  3CJK B;  3J7Y U;  2C3P A;  3OD2 A;  5L8R C;  1N36 F;  4UOF A;  3VHQ A;  4YHH J;  3AQP A;  3EUN A;  2WRM A;  4F3Q A;  1FDA A;  1S1W A;  3ZTQ A;  3KMQ A;  3FQL A;  1Y3J A;  1REV B;  1VIO A;  3P4U B;  1RBO B;  3UO0 A;  2Z2Y B;  3FFI B;  2D1C A;  3L3C A;  1QSY A;  3JAM U;  2VQF F;  3GV5 B;  4F8R A;  3RB3 A;  2MQ8 A;  3V81 B;  2P9C A;  1NUE A;  2OPR A;  2DNO A;  1S4F A;  3OVS A;  3N5B A;  2XC9 A;  3W65 A;  4F36 A;  4X4T A;  4X4U A;  4QQB A;  4FDF A;  1NB2 A;  4B17 A;  2J8A A;  2QMW A;  1M5K C;  5DO2 A;  1DLO A;  4L74 A;  2K3I A;  4HAC A;  1VMB A;  1UVJ A;  1MLA A;  1OIA A;  1ITP A;  4N76 A;  4B3M F;  2WSE C;  2VKZ G;  3AD7 C;  1GQE A;  2AJQ A;  5DZ7 A;  4CO4 A;  2B9E A;  2RKI A;  2ZHO A;  4DV6 F;  2VBW A;  4EI2 A;  1RCX B;  3GON A;  2CPE A;  1R43 A;  3R6G B;  5T14 A;  4LRB A;  2F9J A;  4I7F B;  1D0E A;  1SUQ B;  3OXL A;  4RR5 A;  2CAD A;  4IH6 A;  4H4K C;  5HAO A;  3MDF A;  2FGO A;  2HND A;  1UEV A;  2V4J A;  2XYP B;  3QMQ A;  4DQI A;  2QMU B;  2CAJ A;  1QE1 B;  4Y65 A;  3MTK A;  4BWJ A;  3OUY B;  3Q22 A;  4XPC A;  3NCQ A;  2HG4 A;  2AYB A;  4LF2 A;  4DX5 A;  3W2V B;  4W98 A;  4IOC Q;  2F5G A;  5FLX Y;  1FRL A;  3AA8 A;  3O5T B;  3N6M A;  5ITH A;  1NK8 A;  3W9I A;  4OI0 A;  4DV0 F;  4LRD A;  3RB6 A;  2ZFH A;  3R9L A;  1FO1 A;  2HS4 A;  2R8H A;  2FB0 A;  1UJ5 A;  3LPE A;  1N36 J;  3EPI A;  4NOH A;  1JLC B;  4NLY A;  4B9V A;  2U1A A;  4G65 A;  4JI5 F;  2OEK A;  2RIJ A;  4M5K A;  2MJN A;  1AFI A;  2CQC A;  3IG1 A;  2KI2 A;  5KFI A;  4DF4 A;  5J2M B;  2VQF J;  4CH7 A;  2DVI A;  2W9B B;  2BAN B;  1I3O B;  1B70 B;  4Q2L A;  2MLX A;  1FRM A;  2AEM A;  4EBC A;  3HHD A;  1GXT A;  5LSR A;  3CJ3 A;  4C48 A;  2IM2 A;  3AAW B;  1VS3 A;  5KFC A;  3D66 A;  3UR3 C;  5ETO A;  2W2O P;  3ETM A;  1T3N A;  4DLE A;  1FKO B;  2KXF A;  4P52 A;  4HDG A;  3JTP A;  2AZ1 A;  1E6Y B;  4OI6 A;  4N56 A;  4B3M J;  2QE5 A;  4WXW A;  1C0T B;  2ZVS A;  4DSL A;  4EYH B;  3HI9 A;  2AZ3 A;  5KT4 A;  4QR0 A;  3IA0 A;  4LF4 F;  3JTO A;  3IWL A;  2MZQ A;  3R6L B;  5K5M A;  4EZ9 A;  4M5J A;  2DK2 A;  3M6W A;  2XEX A;  1UL3 A;  3CJ4 A;  5LMU F;  4KHP F;  5IOL A;  3QLH B;  3J81 j;  4I2Q B;  2NZ4 A;  4AUK A;  4MIA A;  4K2X A;  3OTO J;  2EVZ A;  3T1A A;  4FYY B;  1F9H A;  2XSF A;  4JB8 B;  1IKY B;  2BV3 A;  2ZH9 A;  3DLJ A;  4Z7C A;  1HKA A;  1K0V A;  5IT9 Y;  2CPY A;  4QIV A;  2BVZ A;  3K8W A;  3QWP A;  4QU7 A;  3QGP A;  2H4W B;  3M8P A;  1RBA A;  4QIW D;  3LGM A;  3SSQ A;  1HBO B;  2KRR A;  3DMJ A;  1S9F A;  4DV0 J;  5F8L A;  4OHY A;  3I5C A; 
#chains in the Genus database with same CATH homology
 3EDQ B;  2CJX B;  1SC1 B;  2C1E B;  1NME B;  3IBF B;  2XYG B;  2H65 B;  2P2C B;  1BMQ B;  3KJN B;  3GJT B;  2H5J B;  1RWP B;  3SIP B;  2CNK B;  1RHJ B;  1RHK B;  1QTN B;  4ZVR B;  4DCP B;  3R7N B;  2QLJ B;  1RE1 B;  4ZVO B;  1RWX B;  1RWN B;  1RHU B;  1RWW B;  2QLF B;  3QNW B;  1ICE B;  1RWM B;  2DKO B;  2CNN B;  5IC6 B;  1RHM B;  4DCJ B;  1QDU B;  3D6M B;  1RWV B;  1IBC B;  1SC4 B;  2Y1L B;  3R6L B;  4ZVT B;  2CNO B;  2QL9 B;  3KJQ B;  2QL5 B;  2C2Z B;  2C2K B;  2FQQ B;  4ZVP B;  1PYO B;  2CNL B;  2XZT B;  2H4Y B;  3GJQ B;  1F9E B;  2CJY B;  4ZVU B;  1RWO B;  3RJM B;  1RHR B;  4ZVQ B;  1GFW B;  3NS7 B;  2QL7 B;  5K20 B;  3R6G B;  4ZVS B;  2CDR B;  3KJF B;  1PAU B;  3R7B B;  3P45 B;  3IBC B;  5IC4 B;  3P4U B;  3D6F B;  3D6H B;  4DCO B;  4JB8 B;  2C2O B;  3GJS B;  1I3O B;  3R5J B;  2C2M B;  1RWK B;  2H51 B;  1RHQ B;  2XYP B;  2XYH B;  2QLB B;  2H54 B;  1SC3 B;  2Y0B B;  2H4W B;  3R7S B;  3GJR B;  2HBZ B;  2H5I B;  1I51 B;  2H48 B;  2HBQ B;  3EDR B;  2XZD B;  2HBY B;  4LSZ B;  2HBR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...