5G4DA

Crystal structure of the cas2 in t.onnurineus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
AMDMYVVIVYDVAVERVNRVKKFLRRHLHWVQNSVFEGEVTLAEFERIKAGLLDLIDEDEDSVVIYKLRSMPKREVLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CRISPR-ASSOCIATED ENDORIBONUCLEASE CAS2
publication title Structural Features of Cas2 from Thermococcus Onnurineus in Crispr-Cas System Type Iv.
pubmed doi rcsb
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5g4dA01
4FN5A 4QR2A 3ZZTA 1ZM9A 2ZITA 2EFGA 4ES1A 2WBMA 1N0VC 4ES3A 2NPFA 4ZCIA 2IVYA 3UI3A 5G4DA 2I8EA 4MAKA 1T95A 4ZCLA 2KDOA 3EXCX 3ZZUA 4ZCMA 2XEXA 3OQ2A 2E1RA 2CVEA 2BM1A 1VI7A 3B78A 2I0XA 4QR1A 4TNOA 3ZZ0A 2J7KA 1P9QC 1U2RA 1N0UA 3LH2S 4M1KA 2L9NA 4QR0A 1ELOA 1ZPWX 3B82A 1FNMA 2BM0A 4ZCKA 1ZM2A 3E3XA 1DARA 1ZM3A 3B8HA 4MYTA 4ES2A 4MYUA 1KTVA 1ZM4A 2BV3A
chains in the Genus database with same CATH superfamily
3FMBA 1W25A 4URGA 3CXCR 3VHQA 3CCES 4O23A 4LF6J 3V81B 1Q82T 2R2RA 2RILA 3FGVA 1DTQA 1WHYA 5ETKA 5JMNA 3ENVA 3C2PA 3Q24A 4C8LA 3Q22A 1UVMA 3OTEA 3CUNA 1XMBA 4DN9A 1QLNA 1DQ8A 3O3LA 4ILLA 3SSQA 1HFEL 2R8GA 3ILJA 1RT1A 2V9KA 3C19A 5HANA 3HVTA 2RDDA 1S6PA 5J2QB 1RBOB 4HT7A 4QR2A 2V2ZA 1PJ6A 3AA9A 3E8OA 2CUYA 3WDOA 4B17A 3T19A 4QU7A 2GAHC 3NWRA 4ZPAA 3JAMU 1HNWF 3TAMB 3Q83A 4USWA 4AE5A 3DXBA 1IBCB 3SI8A 2V8HA 1FEEA 5A0YA 2C1EB 2FUG9 4CDIA 4F50A 4L76A 5HQLA 1ZYQA 1VQKS 4OJ3A 1O6XA 2WVCA 3QMQA 4DZ6A 3V81A 2RUSA 3M4XA 3TA1A 1LW2B 3G86A 4KGVB 5AE3A 1UVKA 1KBRA 2E1PA 4ANDA 3DRXA 2DGUA 4FXVA 1YQHA 2VOPA 2ZOGA 4Y2KA 1KSPA 4C7QA 1DFDA 3IFEA 5M2RA 2CZ9A 3EGZA 5KG3A 4JYAF 5CZXA 2POKA 2V6AA 1EX8A 3N6LA 4LFAF 2HZAA 1W2BR 2AV5A 3LALA 3TWZA 2PI5A 1MU2B 3W3SA 3I87A 3KLIB 3BBBA 2CJQA 2HW3A 3SQOP 3DRPA 3KJVB 5A6PA 4O3OA 4QOTA 2HVHA 3OL9A 3KG0A 4DCOB 2YKNB 4FS2A 3CJ8A 2XZWA 3H4DA 2I2YA 5HAOA 4A8FA 2HGMA 4Q8FA 1BQMA 1WC1A 2ZNZA 3D54A 3KFWX 4NRTA 1WG4A 1UFWA 1E6YA 3A3PB 1APSA 2WTFA 1FESA 3NNAA 1JLCA 1SV5A 3NGUA 3NBPA 4HR2A 4I1TA 3THVA 2YWEA 4AQYJ 4E2FB 2FYXA 3PO5A 2J9DA 4LSZB 3Q89A 1VQ7S 4NXMF 2VKRA 2O5DA 2MZ1A 4P72A 3QPIA 2AW0A 3MTKA 2PMZD 5C25A 3KLEB 1RAIB 1W7WA 1KTVA 3DM2A 3GIRA 2ERRA 1VFJA 1T3OA 4MAKA 1MU2A 4IOAQ 2KYXA 1JLEB 1FTRA 2DY9A 3CO9A 2YPYA 1ZM3A 2YKNA 4QWCA 5HVGA 4MFBB 4OI0A 1YBAA 3J7ZT 2W2OP 3ELHA 4A4JA 1FVQA 2B3TB 4X4QA 4DFPA 3TANA 1VIOA 2QLFB 3OFFA 1IKXB 1U6FA 2WZ1A 2FGOA 4OX7A 4CWBA 2ROEA 3QIPA 2GO8A 3M8PA 4YB7A 3QJPA 2C3UA 1F9FA 2R8KA 3CTRA 3EWGA 5B0BA 1LEOA 3I5BA 1R31A 2L9WA 2DVIA 4LBHA 3R7NB 4Y00A 2EPIA 3GSDA 4F2SA 7AT1B 1SC4B 1RWXB 1BGXT 3KMSA 5DGBA 5E5NA 2GNKA 2QL7B 3G6YA 4CRJA 1RLCL 1EP4B 2NSCA 4N8OA 4R0EA 3QWPA 3M2VA 4ZIVA 3GR0A 2ABYA 3ZO7A 2DXFA 3D0HE 2VODA 4MFBA 1RE1B 1X4CA 3OVBA 3DYAA 4XDCA 2PMHA 1TTHB 4RWWA 1BWVA 3N5BA 3PX4A 5KG0A 2J6UA 3BSAA 2FIUA 2JLEA 2ZH1A 2B4PA 2Z57B 2VKZG 5I4MA 1FCAA 2K1RB 4X62F 3W65A 1B0VA 3GJQB 4Y2IA 5AT1B 1NU4A 1FKOB 2WB4A 2BJ7A 4ZN3A 1IR2A 1RHRB 3EDRB 3Q2TC 3ISNC 1UW9A 1MWYA 3I31A 4OYZA 1O5JA 2R7XA 4YR2A 4MT1A 1RHKB 3GFXA 3CGIA 1N5QA 1DLOA 2CZ4A 4R8UB 5T14A 1FD8A 4LRCA 2MQQA 5GAGU 1JXEA 4B3OA 1SJ4P 1UPPA 2IVMA 3AH6A 1RT4A 2DITA 1S79A 1I1GA 2GQ2A 4J91A 1QDUB 3HXMA 3IBWA 3GLJA 2E5LF 1EP4A 4ITSA 1AZSB 2MKHA 1RT5B 1RTJA 1JIHA 2VG6B 2F8HA 1YJNS 4P7TA 2ZUGA 5J2PA 4GKJJ 1FDBA 4PWWA 1XQIA 5HQ8A 2HS4A 2WW4A 2DR8A 2VOOA 2QMUB 3UN2A 3HJFA 3FDSA 1FKOA 2RSQA 4I2PA 2OSRA 3EVMA 3W5YA 1WKKA 4YB6A 5GVQA 4ZOSA 4EZ9A 2LQJA 4JP8A 5HVHA 5G0RA 3OQ2A 4QWEA 3A12A 4F25A 2KJWA 4USTA 4C8KA 5C2GA 1HNIB 1HBOA 4C0HA 4S0MA 4A46A 4I0WA 2XSJB 4CLKA 2X3GA 1RTDA 1E6VB 2DHSA 4RUBA 3SDEB 4Q0BB 2DNPA 4P74A 5F41A 4NXNF 3M30B 1ICEB 4EGLA 4NLSA 1WI8A 2FJBB 2MJNA 2UU9J 1FFGB 1A0OB 4IFVA 1IKWA 1IKVB 3PEJA 2PFDA 1B64A 3JXOA 1I51B 3UD4P 2H4YB 1KQSR 1VQ6S 1Y11A 5HLFB 2BX6A 2RQMA 4NLOA 3TARA 5L9NA 4ZJOA 4QU6A 2FZKB 3FNNA 3TAPA 1C4CA 3POTA 3QBCA 3UDEA 2O1PA 4FYYB 3IO1A 1RWVB 1HMVB 1SIZA 4B9LA 1Q8KA 1D8YA 2MZTA 3CNQP 3CJKA 3PW0A 1JXLA 1HNIA 2AZ1A 3D4JA 4I69A 2Z0GA 4DR3F 2J7KA 3TVYA 1E6VA 1JLAB 1HBUB 3T41A 3BB5A 3SDEA 4Q0BA 3TOQA 1HI0P 3DLKB 3H4BA 3M7VA 2N7YA 1IJEB 3RAMA 4ZLJA 3HHLC 3M30A 4NEYA 1R8HA 2UVWA 3AA8A 4DEZA 4PWUA 3UDLA 1RYSA 1N56A 5EGYA 3M9NB 4L73A 1EAYC 4HTIA 1AT1B 1A6LA 2RRBA 3V2UC 4NLGA 1PILA 1CULA 1XMOJ 3T1YJ 3W66A 3D1HA 4AL5A 1R8BA 2HQ3A 4OYIA 2EFPA 3FRYA 4QIGA 4OLPA 5HMWA 2FJAB 3EXCX 2CVIA 4CT9A 3MEDA 4I64A 4WKYA 4DV6J 4CO0A 5KT5A 1VJWA 4WYWA 1SJ1A 2HLUA 5GAEI 4DF4A 1FJCA 4J37A 1RWWB 4L3NA 2MQLA 2B0GA 3HFZB 4DQSA 2R7WA 1DTTB 4F0HA 3UWTA 1NZ8A 1QD1A 1HBUA 3FCHA 4XK8C 3GU0A 2KU7A 3CCZA 1NDLA 4RW6B 2D9PA 2HRYA 3BR9A 2LLZA 4NLTA 4KGKA 5HQMA 4ANCA 2FTRA 4KQZA 4XTTA 3F0NA 1U47A 4JI4F 1RCOB 2AGPA 2QSWA 1UP1A 3J7A1 1KKHA 1NPPA 5CYJA 4U67Q 3UR0A 2NQPA 3RAQA 4KKOB 1T95A 4TU7A 1NDCA 1IJFB 1OY6A 2FZCB 1VBYA 1CJUA 1H3DA 1HNXJ 3I9V9 1FNXH 1M90T 3PYGA 1TL4A 3DOKA 2X1FA 4DV1J 5KT4A 2RQKA 2B9YA 1YBTA 5CAAA 4IFYB 4LRBA 4OMFG 1UAWA 4CO3A 2K2PA 2XBPA 4JI7F 2OFGX 3EICA 1GXTA 5E0OA 2XMVA 5BR8J 3NNHA 4DJBA 3DRRB 2M2BA 3CJ4A 2YTCA 4DI6A 3MM9B 1XNQJ 3MR6A 3GFYA 4IR1A 5GADI 4KTQA 2X1BA 1AA1B 1L3SA 2DH7A 4OYAA 4KO0B 1CS4A 3QGPA 1ZZFA 4OZNA 3MM8B 4PG4A 1L5UA 4R5PA 3PYEA 3VCDA 3N28A 1TV6B 2BJDA 2I6WA 1N34J 2IHR1 4DV2J 2KZMA 3ZZUA 4DFJA 4NLYA 5LMUF 2MKCA 4NZ6A 4MK9A 1N5SA 3RW6A 2DNLA 4DLEA 3ITHB 2DEIA 3M8QB 4O3QA 4YHHJ 2XMWA 5A8RB 3I0RA 2VJVA 3M32A 3FK4A 4KKOA 1NSPA 4LR9A 3U7JA 4NLUA 8RUCA 4C11A 1CSJA 2OPSA 3M6VA 4WJBA 2LQ5A 7FD1A 2BRKA 2Q6BA 3BQ2A 4OI1A 1FRHA 2X7IA 4OI2A 3RRGA 2P2CB 5KFIA 3FC9A 4C8YA 2ILZA 5DRKA 4MTPA 3DI6B 5K8OA 3W2VB 3QWUA 4DL7A 1TFYA 1VLOA 4ZVOB 4RU2A 3KLGB 4IG3B 4M5JA 2W4CA 4DUTA 3FCWA 3BKUA 3KK1B 4KO0A 1V3RA 3RB4A 5D4OA 4WWSA 3FSXA 5F8JA 2DGWA 4L6V3 4B3RF 2JEIA 4TKTA 3PNIA 4OYBA 3CULA 1XR7A 3IXQA 2UXBJ 3DOLB 3HZGA 1VK3A 3KWMA 2E66A 1FWPA 5A8RA 3OVAA 1Y5NB 5LJ5Y 3UFCX 4YB5A 2RRAA 2N3LA 3IP0A 5AJ3F 3ZC4A 3M2UB 3W9JA 4BHQA 5A76A 3Q8PB 3PW2A 1HBNB 2Z2LA 2H5EA 4WE1B 3RBDA 1UWAA 1TK8A 3O5TB 1H7WA 3MMBB 3AD8C 4WFAQ 1FRJA 3MURP 2JHEA 1KVKA 1FERA 1M0SA 3OFEA 3IWXA 3C15A 4IG3A 2HNZA 3M1VB 1L3TA 1UVNA 1YRUA 3HO1A 3KK1A 5AE2A 5RUBA 2HGLA 4GMKA 1QVGR 3AJDA 2FJDB 4NCGB 1Y5LB 4DQIA 5EWGA 1C2PA 1I3OB 3D1QA 3DNCA 2UUWA 5LMNF 5F3TA 4BWMA 1YZ6A 3L7PA 3H2UB 3AY0A 1UFLA 9RUBA 2HFVA 2KHDA 5KFXA 4CLUA 3M2UA 3CCWA 1M1GA 4EEYA 3I0SB 4DL2A 2PMWA 3KK3A 3ILLA 3Q8RB 4W98A 2WK4A 1Q0NA 2BZ2A 4USHA 4O4RA 4M5DB 1WTFA 4Q44A 5IT9Y 2OTJS 5KFEA 4Z7CA 2W8KA 5L1IA 3ETMA 3S6EA 4F4WA 4JI8F 2LP4A 3M6UA 3N9UC 2ZZNA 4XAKA 3M1VA 1H7XA 5LSRA 4HDGA 1FWKA 4LIRA 4ENOA 2AYMA 4DL5A 3VWSA 4CTAA 4RNNA 3L3CA 6FDRA 2MHEA 4K4TA 4BWJA 2V4RA 1FK9A 3G8QA 3R5GA 3J7Z5 3V4IB 3NS7B 2W2NP 5CYQA 1HWIA 4UOCA 3CMQA 1UCNA 1MN9A 2EK6A 4NI2A 3TUPA 2DNRA 4DPYA 1KHWA 4K0KF 3RB3A 2WBRA 5FLXU 3UDVA 3DU6A 1HQUA 3S8SA 2ZJPQ 3M8RA 4Q8EA 1VISA 5FDLB 4XO0A 3JS9A 3NCQA 1Z2ZA 2KRBA 3QRRA 3I0SA 4EO8A 4LF5J 4IQXA 2K3IA 2J5AA 3CIZA 2AGOA 2OD4A 4U8YA 1IM4A 6AT1B 1J5OB 2CQGA 4OI6A 3HI9A 4M5DA 2CNOB 3FBBA 1HKAA 3CCLS 4PR6A 4V1Ak 1IUJA 2FLLA 5CD4H 2D74B 1X0FA 4JV1A 2ZDPA 4RW8A 3CD5A 4IRDA 3ET6B 2C2EA 3HHNB 4G1QB 3R5DA 4DR6F 4ZDNA 1RT2A 1XIQA 1GQEA 1S0MA 5IQ6A 4OJGA 5BYQA 3FBFA 3MM5B 1LFPA 3EE3A 3G6VA 2OKQA 3FEXB 2V8PA 2HFUA 3O44A 3K17A 1R8AA 3K5NA 1EZZB 1LWFB 3GSIA 4C97A 4Y28C 3DKDA 1B70B 5J1NA 2ADCA 4ZCLA 1IR1A 4PRFA 1V5VA 3M2RA 2ZBPA 5DDOC 4ECVA 4NMLA 5KFGA 2X1GA 3QJLA 2ZWOA 2LU1A 4MKYA 4P73A 2BBEA 3D9BA 3NY0A 2XB2D 2EEYA 2XZDB 5B0CA 1M5PC 3PDNA 1URNA 2EK1A 2AHOB 5DLGA 2V4JB 2XI3A 4DQRA 4LUBA 3D0GE 2OO4A 2RS8A 3AFGA 5ETNA 3DLLQ 2ASJA 3VAKA 3ET6A 4G1QA 4WFBQ 4XDDA 2NLWA 2R9LA 4O44A 3MAHA 4DR1J 2LQBA 3TP2A 4ILMA 2UXCF 5DDRC 3OTOJ 1F3VA 1H98A 1H6KX 3OPKA 4ZVFA 3SCIE 2QTWA 1HYSB 3VAIA 3KOAA 4DV0J 4B9SA 1S1VA 2R8IA 3FQKA 1PC5A 2HRUA 1YJ7A 4CT8A 1B3TA 4P71A 1U6BA 4QR1A 5DDQC 1AW0A 2WOMA 2JX2A 3N6NA 3TUJC 3LW5C 4HEA9 4DR4J 4LMZA 2HHTA 3AOCA 4JB8B 3RGIA 4RX6A 4ZPTR 2DR5A 4CLYA 2RHQB 4LSLA 3PYFA 5ETSA 3SMZA 1T8EA 1Y3JA 4HI2A 1AUSL 2J7WA 1OYEA 1JJHA 2XS5A 4OHXA 3AB4B 2V50A 2Z2YB 1N4LA 2DGVA 2DR7A 4GC6A 3D68A 1FXRA 2V8GA 4RWXA 4X64J 4ZMMA 3IRWP 4ZVEA 2IDLA 2GJIA 3H5UA 3NRBA 3R2CJ 3CC7S 3OL8A 1OQ6A 3MOZA 4B3SF 3TEHB 1SCJB 4DV4F 4JI0F 4LQ9A 4U7UD 4C3MA 2Y0BB 4USJC 2IRYA 3HHLB 4J9LA 1KQFB 1WC5A 3R97A 1JLBA 3LAKA 3PRBA 2B7BB 1KN6A 4KR0B 2DGXA 3CO0P 4PXBA 1VC0A 2C2DA 3FBCA 2OUGA 4A8KA 2VBYA 4PPDA 5D4LA 1PJ5A 1CLFA 4DL4A 1C0UA 4U9RA 2K7KA 5ETQA 1S6QA 4X4OA 2K8GA 2E9RX 4NPOA 1S9GA 4FYDA 4QW9A 4N5SA 1X5SA 4RO0A 2VQFJ 1IWAA 3SIPB 4LR8A 4TQRA 2ZC4A 4FYXB 4KGXB 1N48A 2CPHA 3C14B 3Q8YA 1FX4A 3BPDA 1Q5YA 1K1SA 1N5TA 3F56A 4DFKA 4L75A 3L7OA 3BKFA 1KVJA 1N6QA 2UXDJ 2ZM6J 5C42A 1MLAA 2GFFA 4O3SA 2P6TA 3QT6A 1K47A 3PTWA 4P7VA 2VDHA 2VZ9A 3P5BP 4EWTA 5D6GA 3C6UB 4FBTA 4J9UE 1W26A 2IVYA 3FUYA 4CM0A 1N32F 2MSSA 2W9CB 2HHQA 2CRLA 2GQQA 4C48A 2Y3YA 3D1OA 1B7YB 3C6TB 3PACA 2ZDOA 4LVOP 1M5SA 1PG5B 4LR7A 2HBZB 3ZFVA 4NLQA 4QIWD 5J1EA 2JC0A 3GIIA 4C6AA 3CCVS 1T94A 3Q2SC 2RS2A 2BKNA 3C14A 2BJ9A 4UW2A 3QFWA 1K73T 3HPOA 2YH0A 1HNVA 3K59A 1FRMA 1Q7LB 3W8GA 3IR7B 2IMWP 1D8ZA 1HD1A 3AD7C 4IDKA 1Q53A 3K89A 3P8BB 2DD8S 3P6YC 2W9AA 1KFDA 1FDNA 1KR4A 4ZHRB 2KT2A 1G2EA 2R7QA 1RWKB 4WFZA 4ES2A 5HROA 2H51B 3F73A 4IH5A 3I56S 1WJ9A 2MZSA 4HHHA 4NZ0A 1Q1KA 1HARA 1KONA 2X1AA 1HHTP 4Y2MA 5KFSA 2R8JA 3TZYA 3DGPA 3MMCB 2P9GA 4ZPDA 5DGAA 4QPXA 2KI2A 3RRKA 5D0EA 1KC8T 2F4FA 2VPWB 2AX0A 3K58A 1SUQB 4HHJA 2IBOA 4IRCA 2BE7D 4X65J 1QSLA 3KHHA 4WCEQ 3K2YA 3LGHA 2IM2A 5K9FA 1XEZA 3CDWA 1YTYA 3K5OA 2XYGB 2H4WB 4TY8B 3I55S 1QJHA 4KSEB 1X4GA 2BA9A 3QGIA 1LXNA 3BPSP 4LF8F 1K0TA 5D0GA 1HWKA 3AQPA 3GWCA 1YJTA 2OD6A 1Y4ZB 2OPQB 1C1BB 2EKYA 4N56A 2MTLA 4MKBA 2PEHA 1TKXA 3E01B 1HW8A 3CC2S 1JLQB 1MMLA 1HWLA 2MHNA 1P9QC 1RAAB 2XY6A 4M5MA 5A8KB 1AFJA 4OZ2A 1FJGF 3BDPA 2QA1A 1YG0A 1VI7A 4G1IA 2R7UA 3CD7A 3VGVA 2MLXA 1FJEB 2DKOB 1YHQS 4ES3A 2Q1LA 2U1AA 1X5TA 2RMLA 5KT3A 1DQAA 2CQBA 3UCGA 4TY8A 4P9SA 4K7QA 1SC6A 1ACMB 3F44A 2B7CB 1GEHA 4GVBB 3ZTRA 1L3UA 3MEEB 2RF2B 2V8DA 2CZVC 2AJFE 2GIFA 2XQCA 1DY3A 2L41A 2OPPB 1PYSB 2CVEA 3EJMA 2XHWA 2ZH4A 1P1TA 2DNZA 1KNZA 1SJRA 1F2HA 4OLOA 4FXDA 4MK7A 2NCKL 4DCPB 4EI2A 4JI5J 4G65A 2V2VA 2KN4A 1U0HB 4JYAJ 4CH7A 4YUDA 2CPJA 1T05A 2LEPA 1N36J 1FFSB 3EUNA 2GZOA 1VRQC 4HVZA 4J9MA 4QIVA 3BGRB 3H5XA 4JI3J 5A8WA 2HIQA 5EDWA 4K5RA 1UVLA 1BXNA 2ATCB 2CPFA 1HA1A 4UZBA 5L39A 2E1MC 5DQGA 3IWNC 2KO1A 2MLZA 3UD3P 5F9NA 3LO3A 2IJFA 4IUFA 1HBMB 2IDEA 2ZH6A 1TKDA 1NH8A 3R5AA 4D3HA 4YY3J 2J7UA 2M4MA 2LDYA 3OR1A 2UUTA 2VUGA 1WC4A 3MM6B 1OPZA 4P52A 1RGVA 5IT9U 1X60A 5F8NA 3QLHA 1NLKL 1DRZA 1T9YA 4ZCKA 1OSCA 4FN5A 5J2MA 5JXSA 2WBMA 2OMLA 5KFKA 2ADBA 3QZ7A 2XGQA 1NJYA 4BDPA 5J1PA 2W7AA 1NPRA 1FEHA 3S7RA 4W90B 4TVAB 1D9FA 5KFVA 2EXUA 2GVZA 4PUOB 1KS2A 5IC6B 1Z4UA 1LNQA 3I82A 1TU0B 3FZBA 2BMBA 2QE5A 2BE2B 3CW2C 2KXHA 4Q7AA 2B8QA 2RNEA 4PG8A 2RVJA 1KLNA 2MLYA 2PGCA 1MWZA 3BS9A 2JRSA 2PA8D 3MAAB 2J76E 4X2BA 5IWAJ 4ZVUB 1AB8A 1QY7A 1X0PA 3R3TA 1FVSA 2EWHA 3I5CA 1IR0A 2V4QA 3HJVA 1UA1A 3HK2A 2MYFA 1N8RT 4ID5B 3MM6A 5IQQA 3UO0A 1JMTA 2CA9A 4HACA 1FNOA 1JLFB 2PT0A 4LF6F 3PJWA 2CJYB 1JLGB 2B4VA 2DJWA 2M70A 2A2DA 2C3YA 3MPWA 2FLNA 3KK2B 2NR0A 4RBVA 1M5HA 3PM9A 1FDAA 3TVKA 1V3SA 4UY8T 2V5HG 1R8CA 1SQFA 2A2CA 2WB1D 2QG9B 2DGQA 2CQ0A 1YJ9S 1MG7A 3HHKA 3FKBA 1F0XA 2DY1A 1SQGA 2UUAJ 2BQ3A 4X4VA 2ZKUA 3TX0A 3M6WA 1PGZA 3NNCA 3GV7B 4QYZJ 4JV0A 3UNYA 3G6ES 4PQUA 1S7HA 1WOSA 5K5MA 2VASA 3FFIA 3N6MA 1RHJB 4NLPA 1TAUA 3PJ9A 1R7IA 4AYBD 1SL1A 2CAJA 3EVWA 4BLGA 1NK0A 2DGOA 3HDSA 3MHYA 1LWEA 2QMWA 4DN0A 1X9SA 2CFXA 1TL3B 1UZDA 2YNHB 1FD2A 3H5SA 4CCHA 3KLVA 1X9MA 3OV7A 3K5LA 4I2QA 2VBWA 4CP5A 4ECYA 2HK2A 2FVSA 2V68A 1RT7A 2L48A 4CLPA 2W4DA 3H2LA 3HSGA 1S9FA 5HBMB 4IG0B 2E7WA 2NXCA 1YKWA 1IKYA 3K5MA 1FE4A 3KG4A 1B0TA 1YK9A 4AD6A 4E98A 3NKYA 4DSJA 5EX3A 3DMJA 1JKHB 1HNZJ 5CXTA 3M9MB 3QIDA 3D66A 2NZCA 3CDEA 3MPVA 1U25A 3KYLA 2HNDA 2HHWA 1NK6A 3P4UB 2FLOA 2VFTA 4LF1A 2Z4PA 1U49A 2RE1A 4P2XA 2H3EB 3JSMB 1Q8LA 2B51A 4AQYF 1WELA 1U26A 4FDFA 4FBUA 1RAFB 1ELOA 3CDUA 2YBVA 4YR3A 3LQVA 2OEMA 3GPAA 1OQ3A 5HMZA 1WC6A 1RTIB 4CNYA 1RAHB 3NGKA 2KDOA 3DOMA 1IVZA 1VYAA 4NXNJ 2RU3A 4ED0A 3SQGB 2NREA 3IS9B 1VRUA 5E3QA 3QO9A 1VS3A 3I4HX 1WC3A 4L3KA 3P3DA 5L38A 2BDPA 3CVKA 5B7WA 3G82B 4LSNA 3UN5A 4FYWB 2J9DE 1Q79A 2DH9A 2KT3A 2RKIB 4F02A 2L9DA 1XR6A 4IRKA 1XBWA 4FPRA 2J9EA 1JQGA 2JH3A 1FDDA 1P9YA 3RG6A 1BQNB 1SC1B 2MZJA 2BOPA 5KG1A 4J9NA 1VCTA 2PN6A 1NHKL 5LJ3Y 3AD9C 2JEJA 4GKKF 3JSRA 3MM7B 4DR3J 3LP1B 2HURA 2AWZA 2OPRB 4IOCQ 1YJWS 2E9ZA 3QT7A 4DSFA 1GTEA 2FD2A 3OW2R 1HQEB 2GCFA 3SQGA 1ZAVA 3V6DB 1EETB 2HHPA 1CJTB 2E7XA 4N7TA 1FRXA 4L74A 3E3XA 3RUBL 1MROB 2BEFA 2XLIA 3EGVA 4J5OA 1HPZB 3O2IA 5AXKA 4CLTA 2M88A 2DRAA 1TKTA 5KOWA 2HS0A 3QAEA 3VF0B 4TU8A 1N5YB 1DZ5A 2DXEA 1LKZA 3X3UA 1OPIA 3A13A 4IR9A 1FXDA 4FXWA 2IM1A 5C7PA 3KJFB 3BEGB 2R7OA 4OYWA 4F8RA 2ZFHA 3EGNA 4DSIA 3RZAA 2QYCA 4FF4A 2RB7A 5F9LA 5KG4A 4BC7A 1M1KT 2EFVA 3OUYB 1CVJA 4ZP7A 3LP1A 2E44A 4ECTA 2RJZA 2IBKA 2MQMA 2XWYA 2OJ3A 4EBCA 1UWBA 3V6DA 4YOEA 4P2SA 2FDNA 1T03B 2P9CA 2VPZB 3PRVA 3PIPQ 3RBEA 4EBEA 1PJ7A 4MJKA 5HN0A 3PZPA 2B43A 1LWCA 4GKJF 2CJ9A 2YH1A 3NGDA 1GTHA 3NL0A 2HNYB 1T9VA 3EZUA 3C16B 2F1FA 2RD5C 4ZP8A 3FEZA 4LJMA 4CO4A 3BGFA 3N79A 2PC6A 3DFEA 4JI7J 3CPWR 2PSZA 2NPFA 1PYOB 2QRRA 2QSFA 3PJXA 3OVSA 5LM7E 3OR2B 2KYZA 3HULA 2I5JB 3MR3A 4JI1J 3P45B 3PKYA 3DHXA 3T5JA 2GC8A 3TI0A 2B56A 4E8UA 4AXIA 1BQXA 4DU8A 2N4DA 4NRUA 4OYXA 5KOXA 4C8OA 1QAIA 3NS6A 3OSPA 1CG2A 4J90A 1X4AA 2YX1A 3C8YA 3DRSB 4MKAA 4DR5J 1KP6A 3GJSB 1S1TA 2C2ZB 4ZCMA 4YMEA 4WFYA 1UEKA 8ATCB 2HK3A 4JV2A 5DM7Q 4NYZA 3CJTA 4ERDA 4EK2A 2UU9F 4WIQA 2DR9A 1C1CB 4DR7J 2IA6A 3DDIA 2FPHX 4YDDB 2R42A 4K4ZA 4RW4A 3R2DJ 5H1SV 2MZQA 4RL1A 1HHQA 2DHXA 2VG7A 3T9NA 1TVRB 1U4BA 1WF2A 2UVRA 2NPIA 2NYHA 2N82B 4OZ0A 4B9NA 2IC3B 1GNKA 3GYXB 4FF1A 1VQPS 4XIUA 5AXMA 1VC6A 2CQPA 3MFIA 1JXVA 1UTAA 1JX4A 4QWDA 1N52B 4KHPJ 2IYIA 1RWPB 2M5YA 4LF4J 5MLCV 2M0GB 1DHMA 2EKNA 4FKXA 2ZVIA 4RW9A 5HMYA 1GH8A 1KLMB 5ETOA 5CCLA 2MMYA 3LF0A 1RAGB 2Z56B 5KT7A 2VG5A 3V4MA 4P2FA 4LF2A 1XMOF 2BW7A 2RAQA 1Y7PA 1I94J 1TVRA 2R7RA 1H74A 4O4GB 3MEGB 2B9EA 3WQPA 4MIWA 1WD6A 3BREA 1ZAXA 1T9TA 3MPDA 3IG1A 5DG7A 2DHAA 4DV6F 1K44A 4FP9A 2AU0A 1WKLA 4KGMA 2MZRA 2EC2A 5H9EJ 2VH7A 3R1HA 2Y1RI 2HBQB 1EJ7L 2JFKA 5K8NA 3MMAA 1Q8IA 5IV3A 3JYTB 2H9ZA 4WXWA 3CCSS 4ED6A 5T7LB 2F65A 3WX4A 1SKWA 3A8EA 4CO1A 4LVNP 1F9EB 5HP1B 1REVB 3CMAS 2CQ3A 4JI2J 1D0EA 4ETZA 3PFEA 3NS5A 4F26A 5GAHI 2XO7A 1Z2LA 2EVZA 4OHZA 2D7SA 2ZH5A 5B0GA 2XS7A 4WXOA 5IC4B 4KAIA 4Q5VA 4PG6A 3CT9A 1DARA 4ZJLA 1HNXF 4J9KA 4ED8A 2E5HA 1X7VA 4DV1F 4O3NA 4NA2A 2BE9B 2DRDA 2MKYA 3MCOA 4YR0A 2GS8A 4PZVA 5IM0A 3KLFB 3CCMS 4LRDA 4JUZA 2QT7A 4I6AA 4ED4A 2EC0A 4F3OA 5BR8F 3MPUB 2OP5A 3VGSA 2H5JB 2KL8A 1YGYA 1XNQF 1HW9A 3LH2S 2M8DB 2DNOA 2V69A 3GCWP 4DXLA 2MQ8A 1NSQA 3NGTA 2XMUA 2YQ3A 3SCLE 5T7LA 2LVWA 3I96A 2W7PA 4DUZF 3ZNUA 5GAHU 4BBYA 4RLEA 3AB2B 1N34F 3VTIA 1WF0A 5SZTA 2XYHB 3CC4S 3MI7X 1RTHB 5J2QA 3NEKA 4OL8A 1RWUA 1KTQA 2MXYA 5HL7Q 1LQ9A 3T5LA 3AODA 3I9ZA 1WTBA 4YHHF 2OAUA 4OZ1A 3TAMA 2IAJB 1M5KC 3P96A 4KIAA 1BLUA 3JTPA 4WK1A 1H72C 4ZK7M 1S0OA 1EHWA 1RISA 3T6BA 3UCUP 3OTDA 3MD3A 3ZZOA 1IBLJ 4LFCF 4J9VA 4AFFA 4K2JA 4N47A 1QSYA 5L1JA 4A8WA 3KNAA 1BD6A 2HEKA 1TK5A 1SH3A 3EX7B 1VQ8S 4UY85 1LW2A 2ZUAA 1RLDA 2OSQA 5F8MA 1F5AA 1R27B 3MTJA 4TLRA 1S72S 4DR6J 1CJVB 2DEJA 3US5A 2UUCJ 3SSSA 4LF9J 1RI7A 2VQEJ 4EO6A 2FJXA 2W9BB 1VRTB 1S97A 4CLFA 4X4NA 2YNFB 1RCXB 2KFZA 3KLIA 3VQSA 3KJVA 2RH3A 4DL0C 2C2MB 1ITPA 5KFHA 2UXBF 2YWKA 1U1KA 3KLHB 2DO0A 2EFGA 2M52A 2J0WA 1CJKB 2G1DA 3DLGB 2Y8WA 2GA7A 3KDNA 2FY8A 3HD2A 2FHOB 3B4DA 1RTZA 3CIMA 1JWWA 1H0HB 1PSDA 1FKPB 2VPXB 3ILOA 4PYAA 2PDAA 2F40A 3PV8A 2BANB 3MR7A 2HMIB 3HMJG 4YP3A 5I3QA 2BM0A 1VQ5S 4XPCA 5E3PA 2LDIA 2EI5A 5I3UB 1CJVA 3QZ8A 4OJ1A 1JK9B 3NMRA 1BC6A 2QL9B 1XNRF 3ZZ0A 3KLEA 2AX1A 2IPOB 3LGNA 4ZLPA 1RA6A 5GAGI 3VAGA 1M5VC 1S1UB 2CQ2A 5KFLA 5DLFA 1H2TZ 1JLEA 5G4DA 2JL9A 3GCXP 2XWXA 4ELTA 3T9ZA 1J5EJ 2ZD1B 2D41A 1ZTTA 1IBMJ 2OH2A 2GGPB 2XMAA 2OTLS 2DHGA 5DETA 2W2PP 2YQ1A 4A8SA 2Q79A 1IKXA 1YZ7A 4Q45A 4YEAA 3BGLA 5U47A 2QX0A 2WONB 2MEWA 2NS1B 3OT9A 1RT3B 3WC2A 4HH1A 2C2OB 3HT0A 3PW5A 1TKZB 3RB0A 3QGGA 5F0UA 2HMIA 1SH2A 1XTZA 3UVJB 1M5OC 4N8NA 3H0PA 1SJQA 1P27B 2DXDA 3MAQA 3SEOA 4QWBA 2WSFC 5J2NB 3TA2A 5C5JA 1S1WB 5KFRA 4LRFA 2WRMA 4ZPCA 4MIBA 3W64A 2QL5B 2ACMA 1S1UA 2DGSA 3QT8A 2H48B 2IFXA 2O01C 2F4VJ 3QRPA 2NXUA 4QYRA 4YS2A 3O6QA 5KTQA 3W63A 5HJXA 4DX6A 2AEFA 4DUYJ 4USKA 4B9MA 5BJRA 4OX9J 1ZS6A 4ICLB 2CPEA 2OI2A 1RK8A 2BACA 3J7AN 2K1RA 2RRNA 4LF5F 2RUGA 2P8IA 3MECB 4Q43A 2FZGB 3Q8QB 4ZLLA 4K5SA 2HFSA 1S1XB 4N77A 2GVDB 1R0CB 2LCWA 1YJRA 2VONA 1OYDA 2AEJA 5LT5A 1OY8A 4HYKA 4F3QA 4R8UA 3K8VA 1ZOTA 3NG8A 1S1WA 3MPYA 3T5KA 2YWHA 2RQCA 4DPUA 3OTCA 1F60B 4QYZK 4PKDB 5KAKA 3K57A 3K0JA 2OEKA 4ATNA 4LF7J 3E2EA 1FE0A 1AZSA 1NRKA 1RT5A 5HVFA 4BC9A 2VG6A 5F8LA 1U1MA 5EUHA 4BS2A 4M8LA 4PWDB 2E1CA 3EYZA 3PX6A 4K8RA 1Q95G 2M7SA 4DF8A 4PG7A 2IA0A 1MNEA 5DQIA 1CQNA 4F4YA 1TELA 5LOQA 3PW4A 4H54A 2HKEA 2J6SA 2R8HA 3UPFA 2BJ8A 3W7BA 3LP2B 2GVDA 1Q7YT 4NCBA 3OFGA 1CBKA 2N4CA 4UF4A 1OIAA 3T1HJ 3QATA 4UUXA 4NL5A 3ZZZA 4ECWA 1DURA 2A0FB 2BJ1A 3HHEA 3N0VA 1R0AB 1RP5A 3L09A 2FJWA 1VQLS 1GFWB 2QLWA 3MF5A 2XLJA 1N0UA 3OHAA 4M5KA 2E5GA 2XSJA 1KHVA 4DR1F 2MGZB 2G9OA 1C0TB 2E1AA 4OHWA 1KOOA 3MOJB 3VQTA 5C24B 3OTOF 1NPKA 2Y0SD 3OSNA 2ZH7A 4A8OA 4QR0A 2ZZTA 5HSPA 1SJFA 4EBDA 3RJMB 2ZOMA 5KFWA 2ZE2B 3RTVA 4ZLNA 3RYLA 1IKVA 3ENQA 4DV0F 2KXFA 2ZOFA 3VV2B 4M5GA 1NK7A 1U1OA 3VAMA 3B82A 2HZVA 1CEZA 5HLFA 4KGZB 4FKYA 2DIVA 2UV8A 1BE4A 3MUTP 3KXDA 2Y1JA 3LP2A 3MMJA 3J81j 3W60A 3BSOA 1HMVA 2BYCA 4ZS6A 4WP8A 2KJVA 3RBZA 2DNHA 1JJCB 1VQNS 9ATCB 4RBUA 4P2MA 5F8HA 1JLAA 2LYVA 2LU2A 5D77A 2AJ0A 1TUGB 1TQLA 1QTNB 3TA0A 1C0TA 2YX7A 3DLKA 4RNOA 1Y5IB 5E3RA 4Y2CA 4OV1A 4X64F 2H5IB 3WIUA 2ZH3A 4CZCA 3PG9A 2HQFA 2G2OA 4AUKA 4NA1A 2CPYA 4J9RA 1IWGA 2YKQA 4OZJA 4K4SA 5AXNA 1GAOA 1S4FA 4WK3A 2F5GA 1IQTA 4AL6A 1NJIT 3KMQA 2RU9A 5KFOA 4H4KA 2C28A 5EHHA 4KPYA 2ILYA 2KFYA 2XM3A 2HVIA 2J8AA 4NLVA 2AD9A 2XEXA 4CLSA 5CCMA 3NOGA 2V2QA 1GMWA 3HM9A 1RHQB 4C8MA 3IRXB 2BABA 4DL3A 3UCZP 2Q43A 2B8PA 4IH6A 1DTTA 3HHLD 3IMQJ 1EB0A 3TZZA 1RWOB 3Q8VA 2VD3A 2M3DA 1K9MT 2HAIA 3CSKA 4RJVA 4QCLA 3DXSX 4RW6A 1QE1B 5B0EA 1XK8A 2V2KA 1FA0A 1U45A 1DAXA 3J7YU 4OV6A 5DQHA 3ETOA 4ED3A 1S59A 5KFJA 1WC0A 2EBGA 1G1XA 1M1HA 4X4SA 2B5JB 3CJ0A 2K3KA 1G6BA 2N3OA 2N7CA 4Y3CA 3I32A 1MWQA 3UDCA 4ZVRB 2ZM6F 2BKPA 4ZJQA 4IFYA 1YDLA 4C3KA 2RDJA 3PYDA 3A3NB 1NK5A 3J81Y 1LOUA 3IRXA 3G8SA 3DRRA 2XMTA 2HQDA 2YPZA 2DPIA 1S9EB 1EKRA 1BMQB 3MM9A 1WDTA 2J8SA 4F67A 2E5JA 5KG5A 3H5YA 3BH6B 4ZP9A 2Y8YA 3RR7A 4B9VA 2MB0B 2P5VA 1U8SA 5D15A 3MM8A 4H4OB 4KFBB 5HK4A 5I42B 3MGJA 4J9PA 4DBQA 1TV6A 1SKSA 2DNYA 4AT1B 2UVUA 4DWIA 3OXLA 4FPIA 4RNFA 4FF3A 2DIUA 3ITHA 3M8QA 1UPMB 1EIYB 2GHWA 4DLGA 3R8YA 1Y00A 4WFXA 1U0SA 3W5ZA 3V6KA 4ANEA 3ZZTA 2GV1A 2B6AB 2ZKTA 4HLBA 4QWAA 5T41A 3BBFA 3R5BA 1HR0J 1SKUB 2YNIB 4DSEA 2LEBA 2A3JA 3QGHA 1P6TA 2V67A 2YNGB 4NYPA 2VDIA 3GFHA 4HTJA 4DX5A 2Q66A 1VBXA 2CG8A 1U6ZA 1RJJA 4CI0B 5E3CA 5D4NA 3BJYA 3DI6A 3W2VA 4RPFA 3KLGA 1DTQB 1UEUA 4G3IA 4KRWA 3AJ1A 1JJ4A 2ZITA 1V6HA 4K59A 3DU5A 1YLXA 4DV7J 1Y3KA 2UVVA 3FVYA 4W4MA 2HG4A 4X66J 2ZHAA 1WORA 2RDIA 3DOLA 1ZM9A 3CWJA 5ADZA 1RQ0A 3HVTB 5GMDA 2D9OA 1S6PB 2H1YA 3M8ZA 1SH0A 2EG2A 1S5ZA 1YVFA 3TUZC 4X65F 2Y1LB 3MCNA 2LEAA 5F0WA 1R0BG 3F41A 4DS4A 2AJQA 3TNVA 4DQQA 5IT4A 3IGVA 1HBNA 2YNIA 1WI6A 2E7VA 4M5LA 4WE1A 1YI2S 5A0YB 3HSZA 5L1KA 2Z30B 2HWIA 1VIXA 2UUBF 1RBAA 3ZTPA 3MMBA 1AYEA 3JQMA 1UVIA 3R6GB 2CJBA 4V19X 4OHVA 4FYVB 2AYGA 1YBUA 4MK8A 3H98A 3LUYA 3L4BC 1VQMS 1HLWA 2V34A 3VVUA 2HVZA 3V6HA 4KBIA 2C22A 4USIA 3IAS9 2M8HA 2F8EX 3V5RA 2CQ4A 1VHFA 4NCGA 2GX8A 2BJEA 1GK8A 4Y6IA 2HIYA 4UZCA 2DNNA 5EN1A 3PR4A 3VGUA 1XMQJ 2HHHJ 2F7VA 3RU0A 4Z2XA 2LKZA 5HI7A 1V5IB 4USUA 2XS2A 2YKOA 4MYUA 4OIXA 4CLZA 3RB6A 3DRPB 2ACYA 4RKUC 4WZMA 1SB6A 3O8WA 2GMHA 3ZTSA 1GMVA 2AZ3A 2YWWA 4DR2J 5H9EK 1BQMB 1E6YB 1NXIA 3HP6A 3PRDA 2HGNA 1JLCB 3ILIA 1SV5B 3MR2A 5FD1A 2OMOA 3D67A 1YITS 3NBPB 2VC0A 1DBDA 3BO4A 4PXDA 3A8IA 1KVIA 1F9HA 2AEMA 4JI5F 1C4AA 3MUMP 2CQCA 4B3TJ 1NUEA 4DV5J 4C9DA 1DJ0A 2DPJA 5C25B 2AKWB 7FDRA 1QAYA 1ZA2B 3DM2B 3V4IA 1N36F 3CF5Q 3VAFA 5K8PA 4CLLA 4BCAA 1XN9A 4JI3F 3CD0A 1QTMA 1FRIA 1D1UA 1X5PA 2LA6A 5FDLA 4WTYA 2XTJP 2DGTA 3W9HA 5H9FJ 3WIVA 2OHDA 4DPXA 4OZ3A 2EBEA 4B3MJ 4YY3F 4ALZA 1J5OA 3DRYA 4WBFA 4OI3A 3BH7B 3PX0A 2CPDA 3QIPB 1D9AA 5KFBA 1EARA 3M8PB 2XULA 1VGYA 3IR5B 4IKAA 4OX8A 1NBEB 4NYOA 3GZ7A 3U27A 1NCLA 3HVWA 4ID8A 2NUUG 3HCXA 4B9TA 4EU0A 3CCJS 5DG8A 5CH7B 3MM5A 4EYHB 5MAOA 3GE9A 4LFBJ 2XMKA 4NA3A 5DJBA 5DM6Q 2M9KA 2G1HA 4KHRA 3QJJA 4RUAA 1LWFA 2KH9A 5FLXY 3M2VB 5GMKa 4GRSA 1Q78A 1X4HA 3X1LB 3DYAB 2FJEB 4XPEA 2HSEB 1P1LA 1QVFR 2NSBA 4Y65A 4YB1P 1WG5A 1FO1A 5IWAF 2D3OR 3IR6B 2BJ3A 3R9LA 1R8PA 3QFHA 2ZBIA 3SYZA 3LWMA 2V4JA 2PD1A 1SL0A 4UOHA 1HWUA 3OTBA 4M94A 4ZPVR 2OGUA 4GKKJ 5D0HA 1ZAWA 2BV3A 3B8HA 4Q2LA 5IFMA 4QPTA 1H2UX 5L1LA 1V3ZA 1B0PA 1DLOB 4NWBA 3KHRA 3N5FA 4B3OB 5IOLA 3WBZA 5E33A 2BM1A 1RT4B 3THTA 3LPEA 2GIRA 1UW4A 2PFFB 3MDFA 3FMWA 4U7CA 1YSJA 3TX8A 1R3NA 3TVZA 4EUVA 5SUHA 1CC8A 3RBXA 4TY9A 1HYSA 2NXEA 1RTJB 2YX4A 2C2RA 2CPZA 1NKBA 2PO4A 3BV8A 3VGTA 5J2PB 5D0RA 2UUAF 4GO5X 1X4FA 2Z2MA 1BHNA 4GVLA 1FF2A 5HO4A 4ECZA 2DB1A 1QM9A 1XR5A 3VAJA 3HZEA 4I4BA 4RNHA 4I2PB 3FRZA 1URRA 1S10A 1Q86T 2ZJRQ 3GG1A 5G0RB 4DDFA 2V63A 3AOBA 3W9IA 3SFGA 5ETRA 1UMJA 1HBOB 2NXJA 2QJ3A 5EWFA 3CCQS 2HVDA 3GTYX 2LFVA 4ER8A 3P49B 5KFTA 1VBZA 5BXIA 4RUHA 4C8NA 1RTDB 2W2MP 4QIFA 3BKTA 3GIKA 1NKCA 4F4KA 5THWA 4X4TA 4B9UA 4PG5A 5LXRA 3W5XA 2QIFA 5IT0A 1KWMA 2W24A 4IFVB 1IKWB 4HHUA 2LXIA 3AOAA 3ZNJ1 2YWGA 2HHXA 4F04B 3HHLA 4AL7A 5F8IA 1O0PA 3HFKA 1HNZF 3HF5A 4FVCA 1NHVA 1KRPA 1JB0C 4WYLA 3H2VE 3KJNB 1EQMA 2VPYB 3R7SB 3HT3A 2C3PA 1YWXA 3D3BJ 1OMSA 4X84A 2MSTA 3POTB 4LQ3A 2VL1A 4MKVA 2HQIA 4FVMA 3M8YA 1GX5A 2JVOA 1X4DA 4OZ5A 2CQDA 2RIJA 3ZZPA 1PCAA 3CJKB 4ECUA 1FJ7A 4DL6A 4C8ZA 2F9JA 2J9CA 3TJ9A 2COLA 1X9WA 4FZVA 2F8MA 3LOUA 4O0IA 4JI6J 3NOCA 3BSCA 1TL1B 3DDKA 3LWLA 2AJ1A 2KXNB 4NLDA 3BYPA 4WP3A 1S4EA 1TFWA 1KFSA 2YKMB 3GYGA 2CPXA 5KFFA 4DU7A 3KKFA 3KDOA 1S76D 1TP7A 2E9TA 1MMDA 4DV3J 3KHLA 1NEEA 2O3DA 1N33J 1CULB 1ZH5A 3QT5A 1SVDA 4ZVTB 2FHJA 4NMXA 2HLTA 2HYIB 2AIRB 4JV5J 3MEDB 3C6UA 1WF1A 4J9SA 3TR5A 2GJFA 2FVPA 3W1YC 4EMDA 2CQIA 2W9CA 3D6TB 2FC8A 4IOBA 3C6TA 2VHGA 1FHTA 4CNZA 2DYAA 2VB6A 2KHCA 4NCAA 2KTQA 2GIQA 1RZMA 4UT4A 5BYSA 1TL1A 3ENAA 1X31C 3T3FA 3PHTA 4E0DA 2CWXA 2GAGC 2KM8C 2YKMA 4KPCA 3BGUA 2HAFA 2KKHA 3OXFA 1T9WA 2YY3A 4A8XA 2IM0A 2VJUA 3PY8A 3SXLA 4LT6A 2VU5A 1CJUB 3HD1A 3JSBA 1NM2A 3M6XA 4MYTA 4PPZA 3DOKB 1RAEB 3T1AA 4ZHRA 3BF4A 2P9EA 4C2MA 4CO5A 3A8JA 5JJBA 1NSKL 2XGPA 2W25A 2Y9HA 2DNMA 3J81U 1LW0B 3JTOA 2AJ4A 2ZNYA 2E5IA 2YVSA 2G0JA 2VBXA 2EG1A 1RYRA 2RHSB 3JB9k 1ZBTA 2AYBA 1WOOA 4ZITA 4PQAA 2MJUA 1T9XA 1CS4B 3C46A 1D9DA 3MMCA 4R5PB 1UJ5A 3PKMA 1VR6A 1RACB 2ZBCA 2W01A 5B09A 1K0VA 1T0TV 1SUQA 2DH8A 3H42A 1QAJA 5D8HB 3QNWB 2R2TA 3I0RB 3M32B 3SBMA 5ETLA 1HNWJ 2LXFA 2CKWA 4K4XA 1U2CA 2G13A 3CB4A 6FD1A 4C11B 2CJXB 2OPSB 4LBIA 2Z58B 4X4PA 2CNLB 5GAEU 4YN3B 5FIIA 1L3VA 1WHXA 4M5IA 1RBLA 1PBUA 1P8GA 1PKUA 5JUMA 4P10A 1LW0A 2X51A 2OPQA 3R1LA 1C1BA 4M1KA 3PHEA 1D09B 2GJ2A 2DNQA 3D6MB 1IBKF 4B02A 3E01A 1JLQA 4JI1F 4F36A 2FLPA 1UEVA 2GO9A 3G96A 2G2YA 2JLGA 3ONQA 5A8KA 1U1RA 4LFAJ 4F4ZA 3QRQA 4HDHA 4TYAA 4DUZJ 3E51A 2XMMA 4DR5F 2FHKA 3HSDA 1IQZA 2L9NA 2PE8A 1G7CB 3UNGC 3QQCD 3Q8UA 2V0NA 4ECQA 2FVQA 4DR7F 4FF2A 1YX2A 2WVDA 1T9UA 1X4EA 3HVAA 4F0KA 2AP6A 3HVRA 1U24A 3L9ZA 4GVBA 1FNMA 3MEEA 4LFCJ 2RF2A 4OI4A 1SPBP 1SI9A 2ZHBA 3LPYA 2YKAA 2IVFB 3H90A 2OPPA 4IH7A 1WEXA 1IXKA 3OL6A 1SKRA 2KRRA 5CD4A 2L3MA 4K4YA 3DCAA 3R7BB 2E29A 1WSRA 3LP0B 1ZPWX 1WOPA 1ULRA 5GADU 2JDJA 4DX8H 1B4SA 4N41A 4I67A 4D3GA 4NXMJ 3C15B 3DN9A 2K06A 2I1RA 3ULHA 2W1BA 2HNZB 1U0HA 5DG9A 4G6VB 1U48A 2HBYB 1S7IA 4CO2A 1XWLA 4J7CA 2VIHA 2ZBRA 3HFVA 4U95A 3BGRA 4KHPF 1Z1ZA 2WSEC 2V94A 3CDAA 4LF4F 5HJYA 1LXJA 2WAQD 3TUIC 2R7VA 2YWFA 1DQ9A 5DDPC 1UZHA 2ZH8A 3FZ2A 4NEZA 1HBMA 3FSYA 3NAHA 4O3PA 3BGOP 4MMOA 4QJVA 3R5CA 3AXKA 4EZ6A 2HHVA 1UJ6A 2W2QP 3KK3B 4PYDA 1MN7A 5KFPA 3DC2A 1I94F 1Y10A 2DNGA 2QLJB 3GV8B 4O0NA 3H59A 1YIJS 1WACA 3KNGA 1RHUB 1HI1A 3Q0AA 4CH0S 3LP0A 2Q6CA 2JVRA 4NOHA 2IJNA 2ATLA 2YQ0A 2OEJA 2RQ4A 3ZZYA 2CWKA 4ZVHA 2I38A 1F5BA 1XNRJ 4NASA 3Q86A 2HVEA 4CTAB 3NMAA 3G71S 1U02A 2D1CA 4NLXA 1XJWB 3AT1B 2ZC3A 1FK9B 5C2CA 2FVCA 4LRAA 3D6HB 4PUOA 5CYQB 2BQUA 4U96A 4JI2F 3A1YG 4NI2B 1GMUA 1NHUA 2BE2A 4J9QA 1RABB 1HQUB 3MUVP 2JEFA 3MAAA 2MQPA 4X62J 2XZTB 4ZN1A 3W62A 3TJ8A 3U1MA 1LV5A 3BYRA 4TLQA 5DS7A 1A7GE 2ASDA 4ID5A 5L9XA 4I6YA 5E2QA 1PC4A 1ROFA 4LREA 2F3JA 1JLFA 5IXUA 5M2UA 1D3WA 1JLGA 4RW8B 4GC7A 3ENWA 3PFOA 3KK2A 1ZTWA 5JVGQ 4A8YA 3OJUA 2GMLA 2DRBA 2QYGA 2MKIA 1RT2B 4TN2A 2E5LJ 3U02A 1ZA1B 4UOGA 2IRUA 5B0FA 5D4PA 1MSWD 3AJ2A 4A8QA 5A2QY 2XSFA 2C2KB 1T3NA 4DMZA 1NJWA 4WP9A 1S48A 4C98A 3UW1A 3M2RB 2JFDA 3VZHA 1ZPVA 2DNKA 5L8RC 2CXEA 1KD1T 3ISZA 2EW9A 4JBCA 3D7SB 2PI4A 1IBLF 1NDPA 2IIHA 4OQJA 3SFUA 4P6QA 1FTCA 1CQMA 4KT0C 1S0NA 2SXLA 3GP9A 2C3OA 2AMCB 3CJ5A 4F4XA 1A9NB 1TL3A 2YNHA 2PA3A 4X4RA 3MCMA 2QFIA 2GMJA 3ICLA 4O44B 1BY9A 4UOFA 3GMGA 1R6VA 2UUCF 2JNJA 4LF9F 2JJ4D 2VQEF 4Z7YA 4ZVPB 4P75A 1RHMB 4V19J 1N88A 1X5OA 5KFCA 3GONA 1U2FA 5HBMA 4IG0A 3CJ2A 1SJ3P 4FNIA 1YRXA 1S12A 2A6MA 1S1VB 2DR6A 4KC5A 1V9OA 1JKHA 2Z2ZA 1I6JA 1SL2A 1OO0B 2WOMB 4DS5A 5AE1A 4Y0FA 1IN0A 2WCXA 5EWEA 1WEYA 1G4CA 3SCKE 2IYGA 4RUCA 5KFDA 1W2IA 5KFZA 4LSLB 1ZM2A 5LSOA 1CC7A 2WVEA 1OSDA 3JSMA 1AROP 4Y34A 2G0IA 3SSRA 2JZ5A 2EFQA 4G1PA 3BO2A 1U1QA 1RUSA 1RTIA 2FJVA 5H9FK 3IN5A 4U7UK 4K2XA 1QUVA 2QO3A 1Y9OA 5DZ6A 4J9OA 3DLJA 4NX9A 3NGRA 2GHVC 3QSIA 1S77D 3NP5A 3IS9A 4ZPBA 1OS5A 1X4BA 3HHDA 2CDQA 4PEOA 3G82A 3MWBA 3D0IE 1J5EF 1O8BA 1IBMF 4UUWA 2FB0A 1IM6A 1WNEA 5IV4A 3H40A 3GB0A 2RKIA 2VICA 1YJUA 2QEXS 4YFUA 3FCVA 5LSLA 4HKQA 1JLBB 4YQWA 2ROPA 8AT1B 1BQNA 3JSYA 3ZTQA 4ILRA 2CQ1A 2H54B 2MDAA 4KB7A 4PCQA 1TAQA 2HS3A 2B9XA 1VQOS 3FJ2A 4DPTA 2MQOA 2CNKB 4Z37A 3J80Y 2HPUA 1C0UB 3MM7A 2EFOA 1GXUA 1TL7B 1S6QB 3N01A 3CCTA 2OPRA 4USMA 2Y1IA 3THPA 1S9GB 4IQMA 3BDEA 1HQEA 3QYYA 3A8KA 1EETA 4JI4J 1CJTA 3M8WA 2F4VF 3BM7A 1HI8A 3LAMA 4LIWA 1MROA 4I68A 3OXGA 3PO4A 1TL5A 4DUYF 1HPZA 2JC1A 3NCPA 4OX9F 3G4SS 3GYNA 2X3DA 1N6QB 3BN4A 1VLYA 5ITHA 3GG0A 2VFUA 2CYYA 5C42B 2QC3A 1N5YA 5JVHQ 5E3AA 1F1BB 4PXEA 1U2RA 4ZA1A 2KM8B 1HQ2A 3I4PA 1PBAA 3MCSA 2DK2A 1FT8A 1EQ0A 3KTQA 4URQU 1B7FA 4L72B 4O3RA 3DGVA 2O67A 2ZJQQ 1UA0A 4U8VA 3OUYA 3HKWA 3Q23A 3H7HB 2ZZMA 3DLHA 1TL7A 4PXCA 1K8AT 2FQQB 5KG7A 5HMXA 1NJZA 2E1RA 4KH0B 2I0XA 2R3VA 1JNRB 2R7TA 1N54B 2KZZA 2ASYA 5J1EB 1F3FA 5LMUJ 1T7PA 3PR5B 2VA2A 2B9WA 4LF7F 1T03A 3BZQA 2DO4A 2HBRB 3KUGA 4U6PA 5E41A 1Y0HA 3UQSA 1HNVB 4K4UA 2CDRB 3TO8A 2HNYA 1PYTA 3C16A 2IRXA 4IDKB 2CNNB 1WKJA 2D69A 4RNMA 3T6JA 3IC1A 4ZP6A 4DOZA 4WFNQ 2W4PA 1MW7A 3ZZRA 2G2ZA 4AXJA 3OFHA 2KVQE 4TXSA 2DT9A 3OR2A 5HROB 2JEGA 2I5JA 1T02A 2AT1B 3IA0A 1AXQA 3VVTA 3T1HF 2WVFA 4WTOB 2VFVA 1RAJA 2VC1A 2LECA 2CQHA 1FKAF 4C0OC 3SZ2A 1SXLA 1S99A 1NMEB 2HHSA 2QV6A 3ADAC 3OLBA 4I7FB 1KQGB 4B3RJ 3DRSA 4M5HA 1U8WA 4ZIWA 3BSNA 4B08A 3DGPB 2KFNA 4NZ7A 1NZAA 4ED1A 1C1CA 3ZTOA 3D3CJ 5AJ3J 1S49A 1Q8BA 1VMBA 1H73A 2OIHA 2HRTA 3T1YF 4DSLA 1TMJA 1VDHA 2LXUA 3GILA 3EPGA 2XY5A 3NCRA 3AHPA 5B0AA 3PXGa 2ZWPA 2IC3A 4OYPA 1AUDA 1GXLA 2AYEA 3EMTA 1SBRA 2F9DA 4ZCIA 3ZXWA 3EZOA 3VALA 2ALYB 1F5CA 4ZVQB 3H25A 3B6BA 3JQKA 2JWNA 1TKXB 4IO9Q 3I6PA 2JOQA 1X8DA 2DISA 2KT5A 4ZVGA 1S57A 1OJ4A 3R5JB 2OFHX 4I7FA 2HQGA 2XMJA 4K4WA 5LMNJ 2XNRA 1WG1A 1GMWD 1RA7A 5AXLA 3MR5A 3NXZA 1G3OA 1FFWB 1KLMA 3TEGA 4UTGA 4NE9C 2HWTA 3HX9A 5ETTA 3JTNA 2DTJA 2VFSA 1GX6A 2GHPA 2R2UA 3CMES 2CIMA 1J2VA 1WEZA 3GQCA 2UP1A 2ZH9A 4O4GA 3MEGA 2BOAA 2UUBJ 1KEKA 3LANA 1VQ9S 2OLWA 2AQ4A 4ZPWR 3IWLA 1LWXA 4RW7B 4H4MB 4JI8J 2ZBQA 3C3LA 2D3ZA 3CDBA 1HD0A 4WIIA 3G6XA 3KG1A 3JYTA 1K1QA 5KFAA 1T05B 1EKSA 4TYBA 5HP1A 1REVA 2ZVSA 3LTOA 3KHGA 4ELUA 2QFJA 4TQSA 3HSJA 5A8WB 4DV2F 5IZHA 5KFMA 4K0KJ 3CD6S 3W61A 2HFNA 3BQ0A 2NYIA 3OHBA 3VZIA 1HWJA 3UI3A 2VBZA 4Y2AA 1HHSA 3CJ3A 2NXNA 1U1NA 2MY7A 3OJSA 1FRLA 3BBCA 3IBCB 1N5VA 3NLCA 2XC9A 3KLFA 3OR1B 1OY9A 2PEBA 3T5HA 3TZXA 1RU1A 4RW7A 2XCAA 4H4MA 2PIIA 3JQJA 3UE2A 3QLHB 3PIOQ 1NSAA 3IM8A 2HHUA 2B4OA 3PVXA 1UL3A 5J2MB 1R43A 2I9SA 1Q4RA 2EFNA 2KVIA 5KT6A 1Q5VA 3P5TL 3TRGA 1RT6B 1RTHA 2GVZB 2Q3PA 2HFZA 3KUHA 1BWEA 4ZVSB 4QIEA 1XC9A 4MH8A 4K4VA 3CE8A 2C3MA 3HKZD 1SQEA 2FVRA 5ETMA 3WC0A 2ALZA 4UQTA 2IAJA 1PO6A 3JAMY 4KY3A 1F2GA 4WU3A 2QA4S 1Q16B 3GJRB 2QN6B 4RBTA 2UZAA 3PCOB 1WHVA 4GO7X 1HR0F 4OYOA 3Q8SB 1HIYA 1WDDA 2XNQA 1TZ0A 2ZEJA 1UFKA 1WUUA 3AAWB 3QAUA 4HACB 5KFYA 2F63A 2P6SA 4MIAA 1SIWB 4ED5A 3L7UA 4A47A 3NGSA 1MMNA 2CG4A 3CCUS 1N0VC 2RT3A 2UXCJ 2JSXA 4R0JA 1QSSA 2MY8A 1PAEX 2GW8A 2W9BA 2A18A 3AXMA 1VRTA 1PAUB 4KV8B 3FSIA 3CCRS 5LL6d 3QSYB 4DV7F 4OX6A 1RT6A 2YNFA 3R27A 2JLFA 4CIOA 5EX0A 4X66F 2ASLA 5A2QU 2HWHA 1WWHA 4K50A 3KLHA 1NB7A 2KG1A 1CJKA 3DLGA 3FBEA 3SV3A 2IM3A 4ES1A 2WHOA 4PQUB 2HQCA 3FFIB 1VQYA 1TUWA 4I6WA 1VOMA 1NJXA 1FKPA 2A6OA 2LA4A 5B0DA 2YXLA 2Z8QA 2MKKA 2ZH2A 5KFUA 2BANA 1CPZA 4DSKA 1LWEB 4DFMA 3CJQA 5BYRA 4ELVA 5I3UA 4HT5A 3VAHA 5ETPA 2DHHA 1KQKA 4N76A 1YRTA 4I2QB 2A1BA 3L95X 4ED7A 1UETA 4KV8A 3PEHA 3C66A 2XLKA 5CHCB 1RT7B 4JOUA 2R2SA 1XMQF 3W2WB 2HHHF 1FX2A 2HZCA 3W8PA 5F3ZA 2ZD1A 1IKYB 2GGPA 2VF3A 4B3SJ 2IY5B 3BO3A 4DV4J 4JI0J 2K7JA 5CABA 3TQ1A 5D3GB 4QZVB 4F0MA 2J6TA 3DMJB 4DR2F 1T11A 4KE5A 2WONA 1RT3A 5K8MA 4WF9Q 2HNDB 2WVBA 1TKZA 5CYMB 4M63A 1J27A 3S01A 3GR1A 3WX8A 1RXOB 3UVJA 2XG8A 3H20A 5I3PA 5KG2A 4RZRA 4OFZA 5J2NA 4F2RA 3U1NA 5B08A 2QZ8A 1FI4A 1GT8A 1FWLA 1S6OA 3IGNA 2ROGA 2BW2A 1RWNB 4B3TF 4ECSA 4WZQA 3RR8A 4DV5F 5ETVA 5GMEA 3DOMB 1UKUA 3KJQB 3EPIA 3W2WA 3UR3C 1VRUB 3QO9B 4DG1B 2GQCA 3UN3A 2IJRA 2KG0A 4ICLA 4TNOA 3S1TA 2CJAA 3R6LB 2CJKA 3BR8A 1U1LA 5LXYA 1RAOA 3PW7A 4C4WA 3GFZA 5D3GA 3ISND 3EDQB 1KOHA 4LSNB 2FGCA 4B3MF 3MECA 2V9WA 1S1XA 5CYMA 4OJHA 2J0QD 2BRLA 3OD2A 2KB2A 1WSVA 3GV5B 1N32J 1B99A 1RB0A 1AFIA 3TAQA 1NKEA 3TQEA 1TK0A 5K14B 3J80U 2A10A 5KFNA 3UD5A 1ZETA 1WHWA 2CPIA 5CZVA 1QUPA 4KYZA 4KJIA 4FNHA 3BQ1A 3I5AA 4OZLA 1QAXA 2HFOA 4Q2MA 4NLRA 4WPAA 4LFBF 5FJ4A 4W92B 3B54A 1NH7A 3K5PA 3RRHA 4DG1A 2BKOA 4X4UA 2NZ4A 4F3MA 3M05A 4PWDA 5KG6A 3WZ0A 4DQPA 3N4WA 5KFQA 1S6UA 2LQ8A 3A4TA 5F8GA 1RADB 1TKTB 1NO8A 1U7LA 2MQNA 3OL7A 4DR4F 4DCJB 2LMIA 1JNZB 2G4BA 2QGFB 3H8YA 5CA5A 4ECRA 4ED2A 4URSA 2U2FA 4QW8A 2NUHA 3D2WA 1ZM4A 1U09A 1R0AA 3IBFB 3CJRA 4KH1B 4ETXA 4IYQA 5K14A 3EZ5A 4I56A 3CJSA 1RSCA 2MPUA 5D78A 2BXJA 5M2PA 5IS2A 1ZZNA 2MGZA 2FC9A 1RWMB 5CQGA 1RDRA 1TUVA 1VJQA 4ECXA 5C24A 1XERA 3K7RA 2APOA 4DX7A 1UWBB 2J0SD 2OELA 2ZE2A 3IM9A 3DHWC 4C3LA 5L46A 1U1PA 3SCJE 3J7YI 4TU9A 1RKIA 3AQOA 1LWCB 3TZWA 1S0VA 4F7VA 3FEYB 2AF6A 4QBUA 3DLEB 4LBPA 2QMXA 2DCLA 1NK8A 3OLAA 3GJTB 4M5NA 4LF8J 2V8VA 3GIJA 1OWXA 2L08A 1TR0A 2XI2A 4DZDA 4CM2A 2FHMA 4QQBA 2XY7A 2XYPB 4EFAC 1UVJA 4HI1A 1PIEA 1VHIA 1L3KA 1UJ4A 2AJ2A 1NK9A 4RU9A 4F4AA 2VA3A 1I5OB 1FJGJ 3M8SA 2BQRA 4YDXA 2QA2A 2FY1A 3LA0A 2W7OA 3DLBA 2UV8G 4KHMA 4OYMA 4DPOA 2IMOA 3V6JA 4IO1A 2VQFF 4OHYA 2QLBB 1VC5A 1S1TB 3TJAA 1LK7A 1KDNA 2BVZA 2O66A 1H38A 3IAM9 3WHIA 3DLEA 1O51A 4PABA 2DBBA 1TMMA 3BN7A 4FS1A 2UXDF 4RW4B 3LGMA 1FRKA 4R25A 3B4MA 1Q81T 3SV4A 2MKJA 2MKSA 2VG7B 2H65B 3A3OB 3G87A 4HL9A 3G2XA 2W8LA 3OBIA 3NAIA 1REGX 2B4UA 3DDNA 1R89A 2VFRA 4CYUB 1IBKJ 5K20B 4EYIB 2YKPA 3D5MA 3O1LA 4PAAA 2ZHOA 1YJVA 2DCUB 2R7SA 4ZKAA 1VQ4S 3VR1A 2FHJD 4WKRA 1QE1A 1NDKA 4CQ1A 3MEKA 4JI6F 1R6YA 4H4KC 3EGWB 2I8EA 1NB2A 3EVOA 2XHCA 1VK8A 4RW9B 1JJ2R 2G0CA 2B5JA 5DZ7A 2LQ9A 3EXYA 3EM1A 3RAXA 2J0XA 3K8WA 4DV3F 1VQSA 2VG5B 2CADA 1LFWA 4CLWA 5A6WA 3RW7A 1N33F 3D6FB 1NK4A 1LK5A 1F6TA 3G9CA 4C0BA 4JV5F 2BR0A 3IG1B 1BUXA 4CYUA 1NNDA 3MD1A 1S9EA 2XCPA 4WU2A 3GIMA 3B78A 3TYTA 3G8TA 2QLXA 3TW0A 3U1LA 5KT2A 4A8MP 2D3O1 3FQLA 2C2NA 3D28A 4NLWA 4H4OA 4KFBA 3MMAB 5I42A 3HLUA 2R4FA 4DPWA 4UQGA 2AGQA 4USVA 2WSCC 3KUEA 4RR5A 5E7OB 3M9OB 1RT1B 2BUNA 1HL6A 1FXLA 1RKJA 5HATA 5DO2A 2XO6A 3NWGA 4DHVA 2VV5A 1SC3B 2D3UA 2B6AA 1VBKA 3MFHA 2C42A 1RU2A 3MZIA 4CH1A 2WW8A 3MXHP 2YNGA 3CEDA 1NAQA 4A48A 1H2VZ 5IM0B 2QA4G 4HH0A 4M95A
chains in the Genus database with same CATH topology
2VG6A 3FMBA 1W25A 5F8LA 4URGA 3CXCR 2MKIA 2DD8S 3CCES 4O23A 3P6YC 1U1MA 2W9AA 1RT2B 5EUHA 3V81B 1KFDA 1Q82T 1FDNA 4TN2A 2R2RA 4BS2A 2RILA 3FGVA 1DTQA 4M8LA 4PWDB 1KR4A 4ZHRB 2E1CA 2KT2A 1G2EA 3EYZA 1WHYA 3U02A 2R7QA 2IRUA 3PX6A 2M7SA 3ENVA 4DF8A 3C2PA 5B0FA 4WFZA 4PG7A 5D4PA 3Q24A 2IA0A 4ES2A 1MNEA 5DQIA 4C8LA 3AJ2A 1CQNA 5HROA 1MSWD 4A8QA 5A2QY 3Q22A 4F4YA 1UVMA 2XSFA 3OTEA 3F73A 3CUNA 3PW4A 1XMBA 4H54A 4DN9A 1T3NA 1QLNA 1DQ8A 4IH5A 3O3LA 3I56S 2J6SA 4ILLA 4DMZA 3UPFA 2R8HA 1NJWA 1S48A 3SSQA 3W7BA 1HFEL 4C98A 3UW1A 3LP2B 2R8GA 2MZSA 4NZ0A 3M2RB 2JFDA 1Q7YT 1Q1KA 1RT1A 4NCBA 1HARA 2V9KA 3OFGA 1KONA 3VZHA 2X1AA 2N4CA 3HVTA 1S6PA 1ZPVA 2DNKA 5J2QB 5L8RC 4HT7A 4QR2A 1OIAA 1HHTP 3AA9A 1KD1T 4Y2MA 3ISZA 4UUXA 3E8OA 4NL5A 3ZZZA 4ECWA 1DURA 5KFSA 3HHEA 3N0VA 1R0AB 3WDOA 2EW9A 2R8JA 1RP5A 4JBCA 3L09A 2FJWA 2PI4A 4B17A 1IBLF 1VQLS 3DGPA 2QLWA 3T19A 3MF5A 3MMCB 4QU7A 2P9GA 4ZPDA 4OQJA 2XLJA 5DGAA 3SFUA 4ZPAA 4QPXA 1N0UA 4P6QA 3TAMB 3OHAA 1FTCA 1CQMA 1HNWF 2E5GA 4AE5A 2XSJA 2KI2A 3DXBA 3RRKA 4KT0C 1KHVA 3SI8A 1S0NA 2SXLA 2V8HA 2C3OA 1FEEA 1KC8T 5A0YA 2VPWB 3CJ5A 2AX0A 3K58A 1SUQB 4DR1F 2FUG9 2MGZB 4HHJA 4F4XA 2IBOA 4F50A 2G9OA 4IRCA 1A9NB 1C0TB 1TL3A 2E1AA 4OHWA 2YNHA 1QSLA 3KHHA 1KOOA 4WCEQ 2PA3A 3K2YA 1ZYQA 3MOJB 4X4RA 3VQTA 5C24B 3OTOF 2Y0SD 1VQKS 3OSNA 2ZH7A 4OJ3A 4A8OA 2IM2A 5K9FA 1XEZA 3CDWA 4QR0A 1YTYA 3QMQA 3K5OA 2GMJA 1SJFA 4EBDA 3ICLA 4O44B 2ZOMA 5KFWA 1BY9A 2ZE2B 3RTVA 3V81A 4TY8B 3RYLA 3I55S 3M4XA 3GMGA 1IKVA 3TA1A 1LW2B 1QJHA 3G86A 1X4GA 2BA9A 3ENQA 3QGIA 4KSEB 1LXNA 5AE3A 1UVKA 4DV0F 2UUCF 4LF9F 2JJ4D 2KXFA 2VQEF 2ZOFA 4LF8F 1K0TA 1HWKA 3DRXA 1NK7A 2DGUA 4FXVA 1YQHA 4V19J 2VOPA 1N88A 1X5OA 3AQPA 2ZOGA 5KFCA 1U1OA 3VAMA 3GWCA 1U2FA 5HBMA 3B82A 4Y2KA 1KSPA 4IG0A 4C7QA 1DFDA 1YJTA 3CJ2A 2OD6A 3IFEA 1CEZA 5M2RA 5HLFA 1SJ3P 3EGZA 4FNIA 5KG3A 1Y4ZB 4JYAF 2OPQB 1C1BB 1YRXA 2POKA 5CZXA 2DIVA 2EKYA 4N56A 2UV8A 3N6LA 4LFAF 1S1VB 4MKBA 3MUTP 2PEHA 1TKXA 1W2BR 3E01B 1HW8A 2AV5A 3LALA 3LP2A 1JLQB 3MMJA 3CC2S 2Y1JA 2PI5A 1MMLA 1MU2B 4KC5A 3W3SA 1V9OA 3I87A 1JKHA 1HWLA 3BSOA 2MHNA 1P9QC 1HMVA 3KLIB 1I6JA 2XY6A 2BYCA 2CJQA 4ZS6A 2HW3A 1SL2A 3DRPA 3KJVB 5A8KB 1AFJA 1OO0B 2WOMB 5A6PA 4O3OA 4QOTA 4DS5A 1FJGF 5AE1A 3BDPA 2HVHA 3OL9A 2KJVA 3KG0A 2YKNB 4Y0FA 2QA1A 4FS2A 2XZWA 2DNHA 3H4DA 1IN0A 2I2YA 2WCXA 5EWEA 1YG0A 4A8FA 2HGMA 1WEYA 3SCKE 4Q8FA 1VQNS 1VI7A 4RBUA 2IYGA 4RUCA 5KFDA 4G1IA 5F8HA 1W2IA 1BQMA 3D54A 1JLAA 2ZNZA 2LYVA 5KFZA 2LU2A 1ZM2A 4LSLB 3KFWX 5LSOA 1CC7A 5D77A 2AJ0A 3CD7A 2R7UA 1TQLA 4NRTA 1OSDA 3TA0A 3JSMA 1WG4A 1UFWA 1C0TA 2YX7A 1E6YA 3DLKA 1AROP 1FJEB 1APSA 2WTFA 1YHQS 4ES3A 2Q1LA 4Y34A 4RNOA 1Y5IB 2U1AA 1FESA 3NNAA 1JLCA 1X5TA 1SV5A 3SSRA 2JZ5A 2RMLA 5E3RA 3NBPA 4Y2CA 4OV1A 2EFQA 4G1PA 5KT3A 4X64F 3BO2A 1DQAA 2ZH3A 4I1TA 2CQBA 3UCGA 1U1QA 4CZCA 4TY8A 1RTIA 2FJVA 1SC6A 4AUKA 4U7UK 3IN5A 3THVA 4HH0A 3F44A 4NA1A 2B7CB 4K2XA 1QUVA 2YWEA 2QO3A 1Y9OA 1L3UA 3PO5A 4J9OA 3MEEB 3DLJA 2RF2B 2V8DA 2CZVC 4NX9A 2J9DA 2CPYA 4J9RA 2AJFE 2GHVC 1S77D 3NP5A 2YKQA 4OZJA 3IS9A 2L41A 2OPPB 5AXNA 1VQ7S 4K4SA 1GAOA 4ZPBA 2CVEA 1S4FA 2VKRA 4NXMF 2O5DA 2MZ1A 4WK3A 1OS5A 1IQTA 4AL6A 1NJIT 3KMQA 3QPIA 2AW0A 2RU9A 3MTKA 5KFOA 2PMZD 1X4BA 2XHWA 2ZH4A 4H4KA 1P1TA 5C25A 3KLEB 2C28A 5EHHA 4KPYA 2DNZA 1KTVA 3DM2A 1KNZA 3HHDA 1SJRA 2CDQA 2ILYA 2ERRA 1VFJA 2KFYA 2HVIA 4OLOA 3MWBA 1T3OA 3D0IE 2J8AA 4FXDA 4MK7A 1J5EF 4MAKA 1MU2A 1O8BA 4NLVA 4IOAQ 2AD9A 1IBMF 4UUWA 2FB0A 2XEXA 2KYXA 5CCMA 1JLEB 1WNEA 2KN4A 3HM9A 1FTRA 4CH7A 3H40A 4YUDA 2CPJA 4C8MA 3GB0A 1T05A 2RKIA 3IRXB 1YJUA 2QEXS 3CO9A 4YFUA 2LEPA 1ZM3A 2YKNA 3EUNA 4QWCA 2BABA 5LSLA 4MFBB 4HKQA 1JLBB 4DL3A 4J9MA 4HVZA 4QIVA 4YQWA 3UCZP 4OI0A 2Q43A 3BGRB 1YBAA 3H5XA 2ROPA 5A8WA 4IH6A 3J7ZT 1BQNA 1DTTA 2HIQA 3HHLD 3JSYA 5EDWA 4ILRA 2CQ1A 4A4JA 4K5RA 1FVQA 1UVLA 2B3TB 4X4QA 2VD3A 2M3DA 4DFPA 3TANA 1VIOA 2MDAA 4KB7A 4PCQA 1K9MT 1TAQA 2HAIA 3CSKA 2HS3A 3OFFA 1IKXB 1U6FA 2B9XA 1VQOS 1N8RT 3FJ2A 4QCLA 2CPFA 1HA1A 3DXSX 5L39A 4RW6A 2MQOA 2FGOA 2E1MC 4OX7A 5DQGA 1QE1B 5B0EA 1XK8A 2V2KA 1FA0A 1U45A 3IWNC 1DAXA 2KO1A 4Z37A 3J80Y 2ROEA 3UD3P 5F9NA 2HPUA 1C0UB 2IJFA 3LO3A 3MM7A 2EFOA 3QIPA 3J7YU 4IUFA 1GXUA 1HBMB 2GO8A 2ZH6A 1TKDA 3M8PA 4YB7A 1S6QB 3ETOA 3N01A 5DQHA 1NH8A 3QJPA 3R5AA 3CCTA 2C3UA 2OPRA 4D3HA 1F9FA 4ED3A 2R8KA 2Y1IA 3THPA 3CTRA 2J7UA 5B0BA 5KFJA 2EBGA 1S9GB 4IQMA 3BDEA 1G1XA 2M4MA 1HQEA 3QYYA 2LDYA 4X4SA 3OR1A 2B5JB 3CJ0A 3I5BA 1R31A 2L9WA 2DVIA 2UUTA 2K3KA 1G6BA 1EETA 2VUGA 2N3OA 2N7CA 4Y3CA 3I32A 4Y00A 3UDCA 3MM6B 2EPIA 3GSDA 4F2SA 1OPZA 2F4VF 2ZM6F 1BGXT 3BM7A 1RGVA 5F8NA 1HI8A 3QLHA 3KMSA 3LAMA 4LIWA 5DGBA 1DRZA 5E5NA 2GNKA 1MROA 4I68A 4ZCKA 3OXGA 4IFYA 3PO4A 4C3KA 2RDJA 1OSCA 1TL5A 3G6YA 4DUYF 1HPZA 4FN5A 2JC1A 5J2MA 3NCPA 4OX9F 3G4SS 1EP4B 3GYNA 2WBMA 5JXSA 2OMLA 5KFKA 2ADBA 1N6QB 3BN4A 1VLYA 5ITHA 3QZ7A 2NSCA 4N8OA 3GG0A 2XGQA 1NJYA 2VFUA 4R0EA 2CYYA 5C42B 3J81Y 1NK5A 4BDPA 5J1PA 1LOUA 3IRXA 3G8SA 1N5YA 3DRRA 2W7AA 5JVHQ 2XMTA 5E3AA 3QWPA 3M2VA 4PXEA 1U2RA 3GR0A 2ABYA 4ZA1A 2DPIA 3D0HE 1S9EB 2VODA 1FEHA 4MFBA 3S7RA 4W90B 3MM9A 2KM8B 1X4CA 3OVBA 3DYAA 5KFVA 4XDCA 1D9FA 2PMHA 4RWWA 3I4PA 3N5BA 3PX4A 5KG0A 4F67A 2E5JA 3MCSA 2J6UA 3BSAA 2DK2A 5KG5A 3H5YA 4ZP9A 4PUOB 2FIUA 1FT8A 1KS2A 3RR7A 2JLEA 4B9VA 2ZH1A 2B4PA 2P5VA 2MB0B 1U8SA 1Z4UA 2VKZG 3I82A 5I4MA 3MM8A 1FCAA 2K1RB 3FZBA 4H4OB 4KFBB 4X62F 2QE5A 5I42B 3KTQA 3MGJA 4URQU 1B0VA 1B7FA 2BE2B 4L72B 4J9PA 4O3RA 2KXHA 1TV6A 4Q7AA 4Y2IA 2O67A 4DBQA 1NU4A 2ZJQQ 1UA0A 1FKOB 2WB4A 1SKSA 2RNEA 3OUYA 3HKWA 4PG8A 2DNYA 2RVJA 1KLNA 2UVUA 2PGCA 4DWIA 1MWZA 3Q23A 2ZZMA 3DLHA 3OXLA 4RNFA 4PXCA 1K8AT 3Q2TC 3BS9A 3ISNC 4FF3A 2JRSA 1MWYA 3I31A 2DIUA 5KG7A 5HMXA 2PA8D 1NJZA 3ITHA 1O5JA 2E1RA 2R7XA 3M8QA 2J76E 4YR2A 4X2BA 2I0XA 2GHWA 1JNRB 4DLGA 1QY7A 1X0PA 1N54B 3R3TA 1FVSA 2R7TA 2KZZA 2ASYA 2EWHA 3GFXA 3I5CA 1IR0A 5J1EB 3CGIA 1Y00A 4WFXA 2V4QA 3V6KA 1UA1A 1T7PA 1N5QA 1DLOA 2CZ4A 3PR5B 4R8UB 3HK2A 5T14A 2VA2A 1FD8A 2MYFA 2B9WA 4ID5B 3MM6A 5IQQA 1JXEA 2B6AB 2GV1A 3ZZTA 2ZKTA 3BZQA 2IVMA 3AH6A 1SJ4P 1T03A 1RT4A 2DO4A 1JMTA 2DITA 1S79A 4HLBA 5T41A 4QWAA 1I1GA 3R5BA 1FNOA 2GQ2A 2YNIB 4DSEA 3HXMA 4U6PA 2LEBA 3IBWA 2A3JA 3QGHA 1P6TA 1JLFB 5E41A 2YNGB 4NYPA 2PT0A 1Y0HA 3UQSA 4LF6F 3PJWA 1JLGB 3GFHA 2B4VA 2DJWA 4HTJA 2M70A 2E5LF 2A2DA 1HNVB 4K4UA 1EP4A 2C3YA 4B3OA 2Q66A 3MPWA 1VBXA 2FLNA 4ITSA 1U6ZA 3KK2B 3TO8A 2NR0A 1RJJA 4RBVA 2MKHA 1M5HA 2HNYA 1RT5B 4IDKB 2IRXA 1RTJA 4CI0B 1JIHA 2VG6B 2F8HA 3PM9A 1FDAA 1YJNS 3TVKA 4RNMA 1V3SA 4UY8T 2V5HG 5E3CA 4P7TA 3T6JA 5D4NA 1R8CA 2ZUGA 3BJYA 3IC1A 4ZP6A 4DOZA 4WFNQ 5J2PA 3DI6A 2A2CA 3W2VA 2WB1D 1FDBA 2W4PA 2DGQA 1MW7A 3KLGA 1DTQB 1UEUA 3ZZRA 4G3IA 5HQ8A 2CQ0A 2HS4A 4AXJA 1YJ9S 3OFHA 2DR8A 4KRWA 3AJ1A 1JJ4A 4TXSA 2VOOA 2ZITA 1V6HA 4K59A 2DT9A 3DU5A 3OR2A 5HROB 3HHKA 2JEGA 2I5JA 1T02A 3HJFA 3IA0A 1AXQA 3T1HF 1Y3KA 1F0XA 3FDSA 2UVVA 1FKOA 2RSQA 4I2PA 2OSRA 2BQ3A 3FVYA 4X4VA 2ZKUA 4YB6A 5GVQA 3M6WA 2HG4A 4ZOSA 4EZ9A 1PGZA 3NNCA 2VFVA 1RAJA 3GV7B 2VC1A 2ZHAA 2LECA 4JV0A 4QYZJ 2LQJA 2RDIA 3DOLA 1ZM9A 3CWJA 3G6ES 4PQUA 2CQHA 5ADZA 5G0RA 1S7HA 1FKAF 4C0OC 5K5MA 2VASA 1RQ0A 3HVTB 2D9OA 1SXLA 1S99A 1S6PB 3FFIA 3N6MA 3SZ2A 4NLPA 2HHSA 1TAUA 1SH0A 2EG2A 2QV6A 3OQ2A 4QWEA 1R7IA 4F25A 2KJWA 3OLBA 1YVFA 3TUZC 4I7FB 1KQGB 4AYBD 4C8KA 3DRSA 4X65F 1HNIB 1HBOA 4C0HA 1SL1A 3BSNA 4B08A 2LEAA 5F0WA 1NK0A 3F41A 4A46A 2KFNA 4I0WA 4DS4A 2AJQA 2DGOA 3HDSA 4NZ7A 3TNVA 4DQQA 2XSJB 5IT4A 3IGVA 1HBNA 2YNIA 1NZAA 1WI6A 4ED1A 4WE1A 3MHYA 1YI2S 1LWEA 2X3GA 1E6VB 5A0YB 1RTDA 2QMWA 4DN0A 2DHSA 1X9SA 1C1CA 5L1KA 3SDEB 4Q0BB 2CFXA 2DNPA 1TL3B 2HWIA 1VIXA 2YNHB 2UUBF 1FD2A 5F41A 1S49A 3H5SA 3MMBA 4CCHA 4NXNF 3M30B 3KLVA 1UVIA 1X9MA 1Q8BA 4EGLA 4NLSA 2CJBA 1VMBA 3OV7A 3K5LA 4I2QA 1WI8A 4V19X 2FJBB 2VBWA 2OIHA 4OHVA 3T1YF 2AYGA 4DSLA 2MJNA 4ECYA 4MK8A 3H98A 3LUYA 2LXUA 3GILA 3EPGA 4IFVA 2XY5A 2FVSA 1IKWA 1RT7A 1IKVB 3NCRA 1VQMS 3PEJA 2HVZA 3AHPA 3V6HA 5B0AA 1B64A 4KBIA 3PXGa 2C22A 2L48A 4USIA 2IC3A 3IAS9 1AUDA 2W4DA 3H2LA 2M8HA 3UD4P 2F8EX 3V5RA 1GXLA 2AYEA 2CQ4A 1VHFA 1S9FA 5HBMB 4IG0B 1SBRA 4NCGA 1KQSR 2GX8A 1VQ6S 2F9DA 2E7WA 4ZCIA 5HLFB 1IKYA 2BJEA 2RQMA 4NLOA 3K5MA 1FE4A 4Y6IA 3VALA 3KG4A 3TARA 1F5CA 5L9NA 3H25A 1B0TA 2DNNA 5EN1A 4E98A 3PR4A 4QU6A 2JWNA 3FNNA 1TKXB 3NKYA 4DSJA 2F7VA 3RU0A 4IO9Q 1C4CA 3POTA 3TAPA 4Z2XA