5G4DA

Crystal structure of the cas2 in t.onnurineus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
b'AMDMYVVIVYDVAVERVNRVKKFLRRHLHWVQNSVFEGEVTLAEFERIKAGLLDLIDEDEDSVVIYKLRSMPKREVLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-ASSOCIATED ENDORIBONUCLEASE CAS2
publication title Structural Features of Cas2 from Thermococcus Onnurineus in Crispr-Cas System Type Iv.
pubmed doi rcsb
molecule tags Immune system
total genus 17
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5g4dA01
1P9QC 2BM1A 2BM0A 3EXCX 3B82A 1KTVA 1ZM9A 3ZZTA 4ZCMA 1T95A 1FNMA 4TNOA 2BV3A 2KDOA 2E1RA 5G4DA 1N0VC 4ES2A 1U2RA 1ZM4A 4M1KA 4ZCIA 3OQ2A 2I8EA 2WBMA 1DARA 4MYUA 2IVYA 3LH2S 4QR1A 1ELOA 3UI3A 4ZCKA 1ZM3A 1VI7A 2I0XA 4ZCLA 4ES1A 3ZZ0A 4QR2A 3ZZUA 3B78A 3E3XA 2NPFA 3B8HA 1N0UA 1ZPWX 2CVEA 1ZM2A 2ZITA 4FN5A 4QR0A 4ES3A 2J7KA 4MYTA 2XEXA 2L9NA 2EFGA 4MAKA
chains in the Genus database with same CATH superfamily
2FLOA 2NPIA 1DQ9A 1RAAB 3J7AN 3PFOA 2D1CA 1J5OA 4RX6A 4ZLPA 1U1NA 3PV8A 4DV0F 3MECB 2KRRA 5KFIA 2BV3A 5K20B 1J5EJ 1RHUB 4DR1F 3I0SB 3OXFA 2CNNB 3ZZPA 2ZE2A 2ATLA 1FRKA 5J2MA 2HFVA 1RZMA 2AJ2A 1FT8A 2AJQA 3G82A 1SJQA 2JVOA 4I68A 1VBKA 3R6LB 3UDCA 4O3NA 1WF1A 3J81Y 4O0IA 4P2SA 3HHLD 4RBUA 5GMEA 1LWEA 1EP4A 2ZH8A 3SMZA 4K4WA 1SV5B 1NJYA 4C2MA 4MKAA 4K4TA 4CQ1A 2CPFA 2LYVA 1KN6A 1V6HA 4PXDA 4CO3A 3CSKA 1HNXF 3R1LA 4BLGA 2DGXA 5GADI 5J2NB 1HHSA 2KFNA 2DCLA 4F7VA 2F8EX 3FFIA 4MJKA 3BREA 5IC6B 1H7WA 4DR5F 1DFDA 1FXDA 3OW2R 2BJ1A 2ZKUA 4OHYA 2H48B 1ICEB 4RNNA 3R97A 3OVSA 1N48A 3M6WA 1RCXB 1NK0A 4J9RA 3MR3A 2XTJP 2XMUA 2HG4A 4ENOA 2WRMA 1KFDA 2YNIA 2R2UA 5BR8J 5ETTA 1WC4A 2FB0A 5B0FA 5D0EA 2LQJA 3HVTB 2VQEF 4DPYA 2YWHA 3D0HE 4LF7J 1U7LA 2OPSB 2KFZA 3LAMA 1HQEB 4M8LA 2D3UA 1SBRA 1RT6B 4WP3A 1T03A 4QW8A 3SBMA 4PAAA 1WHWA 2A1BA 5ETSA 4L3NA 2RE1A 3ZZTA 4LIRA 1EX8A 1I94F 2VPWB 1NH8A 3M6XA 5L39A 4CM2A 3CC2S 3H5XA 3TZWA 4YR3A 2VOOA 1S0MA 3AOBA 1FFGB 1HBUB 3UNYA 4YY3F 2KN4A 1FJCA 1S1WB 4B9TA 2BOAA 1SUQA 2RVJA 3VR1A 3LGMA 3HZEA 1SKWA 4WCEQ 1XWLA 1B70B 1P6TA 2RHQB 4TYBA 3QSYB 1KONA 3MPWA 3DFEA 2B7CB 2UUBJ 3RR8A 1RQ0A 4OJ1A 1U26A 2K3KA 5CYMA 4LSNB 1J5EF 1NAQA 1U1MA 2H5EA 5IV3A 3UFCX 1IR1A 2GJIA 5CAAA 3RJMB 4ZCIA 3CDEA 5EWFA 4CH7A 1KVIA 2HHWA 1HR0J 3KDOA 3CB4A 4DQQA 1VQMS 2HURA 1SJRA 3NGRA 4WYWA 1S4FA 2E66A 1X4HA 2JEGA 4DBQA 3KJNB 4OZ2A 4NLVA 3TEGA 1WUUA 3MAAA 3ZZUA 3LUYA 2BDPA 3LTOA 2XCAA 2QT7A 1J27A 5KOWA 4LSZB 4GVBB 4PYAA 3R8YA 3RRGA 1X4DA 2JEJA 3THTA 2MQQA 1TUGB 2XNRA 1BGXT 3NNCA 2Z4PA 1RABB 3PW2A 4PXEA 4LF5F 4KKOB 2J0XA 2B6AA 3GIMA 3KDNA 2IVYA 5K14A 1IVZA 2CXEA 2E5LJ 2HQCA 9RUBA 3ZTQA 2A0FB 4TU7A 3D1OA 5GAHI 2LFVA 4NRTA 3NS5A 2E1MC 4OZ5A 4DL2A 3J7Z5 4DUYF 2X51A 3MMCA 3MHYA 4QYZJ 4OZ3A 4U8VA 5BR8F 5GAEU 4IG3B 1S48A 5F8HA 4I4BA 4WFXA 2M4MA 3HD2A 1IBMJ 3CIZA 1C1BA 2MKHA 1FCAA 2XS2A 2JFKA 2O67A 3DLEB 3K7RA 3Q8YA 5E41A 1F2HA 2HNZB 1S99A 1FKOA 2XZDB 2XZTB 2FJVA 1BHNA 3CMAS 2ZH3A 1S72S 2N82B 4OI0A 3KUHA 3H2UB 2VKZG 3OR1A 4LF1A 4F4XA 4ZPWR 1MG7A 2G2OA 5E3RA 4MH8A 4Y2CA 2R8HA 2LQ5A 3OJSA 4C3LA 3ET6A 5H9EJ 5LMUJ 2FJAB 4HKQA 4N5SA 1JLEB 1RBAA 3QNWB 4DMZA 3JSRA 1OWXA 2WAQD 1Q1KA 5T7LA 4DUZJ 4OHWA 1HNVB 3GWCA 4IO9Q 3BYRA 3KG4A 3DLGB 2FJBB 2RHSB 4YB5A 5D15A 2Q43A 3D1QA 2J6SA 5K8NA 3D6HB 5KFNA 3LOUA 2MHEA 1ULRA 3IS9A 1TL7A 2UUBF 2NXCA 4X4NA 2GO9A 2M52A 1EKSA 3KOAA 1YRTA 1UTAA 4B3OA 2QA4S 5IC4B 2BQUA 4F4WA 1CULA 4DV7J 3DHXA 4FXDA 2NUHA 4CCHA 2AYGA 1WC6A 3A12A 3P49B 8AT1B 4ED8A 2BRLA 3HHLC 1FK9A 1X5SA 1HR0F 4ZIVA 2WB4A 1GNKA 2XY6A 2HNYB 2M3DA 1S4EA 2HHQA 1X9SA 4DV6J 1CPZA 2GC8A 2CJBA 3VV2B 4GO5X 1PILA 3EX7B 3K89A 3L3CA 1LXNA 3Q83A 5AE2A 2YX7A 5ETKA 1TKXB 2D3O1 2MKJA 3CTRA 4OYXA 1V3ZA 3GJRB 2DBBA 3QT6A 2VQFF 1N5TA 5K9FA 2PDAA 4JV2A 4O0NA 2DNKA 3B6BA 1XBWA 3HJFA 3BDEA 1M1KT 2LU2A 2HQDA 2HNDB 3FBFA 2L3MA 3A3OB 5KFJA 4H4KA 1KLMA 4TLRA 1N36F 2XZWA 3QJLA 3UR0A 5CYQB 3AFGA 3IRWP 1VC0A 5ETPA 4IRCA 5KG3A 2E5LF 2DNLA 3Q86A 4LBPA 5KT6A 3ISND 5GAGI 4PKDB 4QPXA 3IR6B 3CCLS 2IIHA 1WELA 3M1VB 4TLQA 1IBMF 4ZP8A 2ZOGA 3AAWB 4Q0BA 1EHWA 2BKNA 4R8UA 5KFLA 2QMXA 1TUVA 1NPKA 1YJVA 1VQ9S 4PZVA 4HT7A 5CCLA 4NA1A 4RW4A 4ED4A 2V34A 5T14A 2OJ3A 3Q24A 4F2RA 1SH0A 1LNQA 5CXTA 2IVMA 3JB9k 1FXLA 4DV1F 1WTBA 2LKZA 3B8HA 4ICLA 5C2GA 2KM8C 1X4GA 2GO8A 5HMZA 3MEEB 5K8OA 5DG9A 3D68A 1RWVB 4IOBA 1HA1A 1WORA 4FYYB 4A8XA 1EB0A 3BO2A 3EVOA 3AD9C 3A1YG 4DUZF 5FLXU 4KAIA 1BMQB 1SL2A 5IT0A 3CJ4A 3IC1A 5M2UA 4OHXA 2KYXA 2AD9A 3HM9A 1TL1A 4IG0B 2XLKA 1FWPA 4O44A 2SXLA 2EXUA 1TK5A 2V9WA 1SQEA 4UT4A 4C8YA 4WK1A 3MDFA 3GQCA 4ILRA 2GVZB 5DQIA 2JNJA 4DV7F 4WE1B 1U1RA 4UZBA 1RA7A 2ASYA 4Y0FA 3CJ3A 4W92B 3WIUA 4YB7A 3VAFA 4I56A 2DNGA 3HHDA 1NJXA 3KTQA 1X31C 2EK1A 4TNOA 1E6VA 5KG0A 4CH1A 1N56A 1S59A 4LFBJ 1JIHA 3M7VA 3FK4A 4DV6F 4CDIA 1S9EB 4GC6A 1M1HA 2VPYB 1YWXA 2EBEA 3EGNA 3CDBA 3KLHA 5KFPA 3US5A 5IXUA 2QRRA 4RW6B 4HH0A 3GJSB 2OP5A 3QRRA 2XHWA 1UWBB 2R2RA 3LALA 4RKUC 1TVRA 4DFKA 4DPXA 2XMAA 5LJ3Y 1REGX 4MMOA 1TV6B 1KD1T 2BANB 4A8SA 4IFYB 3DYAB 3G96A 4LF9F 1M0SA 3V6DB 1CJUB 4LF2A 4K4UA 3QYYA 4G65A 4WXOA 2IMWP 3MR5A 2ZNYA 1S10A 3GYGA 4B3SF 4OI3A 1OMSA 4C9DA 1A0OB 2HQIA 1RE1B 5KFDA 2JC1A 3CCVS 2NSBA 2OPQB 1RWMB 2FZCB 1UETA 4O4RA 4ZPCA 4DX5A 2MPUA 1JLCB 2ZBPA 4O4GA 1DJ0A 5GADU 4NEYA 2UXDJ 2UUCF 1D8ZA 2E7XA 5HQMA 3RBDA 3DGPB 2RAQA 1HBMA 4WFBQ 2KL8A 2GA7A 4LVOP 3VAHA 1C0UB 3WIVA 3EM1A 2NXUA 4PG7A 4H4KC 4J9KA 4WKYA 4K50A 4WZMA 5CZXA 2DGQA 3J7ZT 3CD5A 4LF4J 2J9DA 2MMYA 3JAMY 3BDPA 4RW8A 1LWCA 2VG5A 2Z8QA 1RTJB 1XNRJ 4CLTA 3PJXA 1R8PA 3M8QA 2MQOA 3H90A 2CQCA 1VLYA 4B3RJ 1HBNA 4JI8J 5F8LA 1D9FA 1HHQA 3DOMB 4CT9A 2AEJA 2CNKB 3T1AA 4DCJB 2B0GA 1D3WA 4Z2XA 4F26A 1OQ3A 1H2TZ 2QYGA 3NRBA 3QATA 4P9SA 3M6UA 5HSPA 5B09A 1WTFA 3ITHB 3D9BA 3VVUA 3H2LA 2W8KA 1Q16B 3EVMA 1YI2S 2HRTA 1U1OA 2CVIA 3MMAB 2RSQA 3IA0A 2RQCA 5JMNA 4RUHA 1Z1ZA 2HBZB 4TKTA 2ZBCA 4PWDB 3NOCA 3TAMB 4CO5A 1YVFA 1KFSA 1VS3A 3DOLA 1WSVA 1LK7A 2Q79A 1G1XA 4K7QA 2DH8A 4PWWA 4DOZA 1UP1A 1DTQA 3ZFVA 2XO6A 5HLFB 3GCWP 1K0TA 3TX0A 4X4RA 4IR9A 2MHNA 4F3QA 4LT6A 4USWA 1U48A 4PRFA 1S7IA 1H2VZ 1TMMA 3ETOA 4WJBA 3R7NB 2LQBA 4WWSA 5J1NA 4Q8EA 3CDWA 2AMCB 2VJUA 2JWNA 2OIHA 1R89A 2E9TA 3QSIA 4JYAJ 2F63A 4P71A 2DKOB 1DQAA 1SH2A 1AUSL 2UXDF 4DG1A 1F3FA 2XSJB 1GT8A 2H9ZA 2WVFA 1X0PA 3LP2A 4RW7A 3QJJA 2XC9A 4DPTA 2GHPA 1PYSB 1U49A 2GQCA 4LUBA 1IKVA 4XIUA 1RGVA 3F73A 3CCWA 1FESA 2GGPB 2C2EA 2XI2A 1YJ7A 1HW9A 4M5MA 3OT9A 2MB0B 1CS4A 1WF0A 3D6MB 2L9WA 2O1PA 2VG6B 4LF4F 2CA9A 1WNEA 4Y34A 1HL6A 3HVRA 3CXCR 1H38A 4K5SA 1M5SA 4C8KA 4LQ9A 3UDVA 3DLKB 1XNRF 3LP1A 2WSCC 1T9VA 3OPKA 3DI6A 1S7HA 1HPZA 4JI8F 3BN7A 1JLBA 3PYFA 1T9YA 4L76A 3GONA 1LWFB 3MPUB 4NLTA 1VQNS 1G6BA 3FSIA 1NK4A 2EBGA 2ZD1A 2FJXA 4L3KA 3HT3A 3KG1A 3AHPA 3BB5A 1T05A 4A8QA 4Q2LA 3VGUA 2IM1A 1R8BA 4DPOA 3VGSA 3Q89A 3ENAA 5A2QY 1G4CA 2MJNA 3BGUA 2GV1A 2MQLA 1RTHA 1XK8A 4QPTA 4B9MA 3NS6A 4HT5A 3AD7C 2D3ZA 2YWGA 1Y5NB 3ICLA 3CJTA 4CYUB 2V4JA 3W63A 3W2VB 3CMES 4RU9A 1S6QA 1B0VA 2DGOA 1FE4A 3V6JA 2VG7B 3MPVA 3TZYA 4R5PA 6FD1A 3EMTA 2WONB 2R7UA 4QR2A 1EETB 4O3RA 1MROB 4IH5A 1VK8A 4DHVA 2AJ1A 3OTCA 4CTAB 3QO9B 1OY6A 2OKQA 4YMEA 3MFIA 1ZH5A 3G86A 4CRJA 4ZLJA 2DGUA 3LF0A 2BE9B 3RAXA 1R8HA 3IP0A 2DCUB 1RA6A 2B5JA 4Q45A 3RYLA 1TKTA 4K2JA 4MK8A 2OMOA 3W2WB 3BO4A 2J9EA 1W2BR 4OYWA 4PQUA 3EPIA 4CLUA 2ZITA 5IM0B 1NKCA 1JWWA 1UVKA 2MLXA 3T9ZA 4XPEA 4OLOA 3VZHA 4ES2A 4JV1A 4EZ6A 4DSIA 1YLXA 1VQ6S 4MYTA 2LVWA 4CIOA 3FCHA 2HHVA 2HQGA 4X2BA 4GKJF 1O5JA 1IKXA 1CG2A 1NK6A 2R7SA 4JI1J 1JNZB 2MSSA 4TY8B 1U47A 4U9RA 3UD3P 5A8RB 4ERDA 1K1SA 3AA9A 5B0DA 4I6AA 3BR8A 4ZLNA 3K57A 4Z7YA 1UVLA 2DEJA 1H0HB 5GAGU 1UJ6A 3N9UC 4ECUA 3OSPA 2GW8A 2N7YA 1ZAXA 4ECWA 1SJ4P 2YY3A 1ZBTA 4LJMA 1BWEA 1X9WA 2L41A 4W90B 3FJ2A 3C14A 4CH0S 1SKSA 3I5AA 2GZOA 1UPMB 4M5DA 3JSMA 4GKKJ 2W7PA 1QD1A 3UN3A 2HVZA 2XEXA 3PACA 2BA9A 4LBIA 2ALZA 2YKAA 3HSJA 1WG5A 1JLFB 2VA3A 3WZ0A 2M2BA 4A8FA 3QQCD 2VASA 2HVEA 2J7KA 4YB6A 4ED3A 2FHJA 3TOQA 2E5IA 3B54A 2MZ1A 4AFFA 3R2CJ 3KK3A 3CIMA 2NCKL 4EYHB 1NK8A 3W62A 2GFFA 1ZPWX 3VAGA 4DV5J 1MMLA 5L1KA 1B0PA 1IWGA 4CO0A 1HWLA 2EFQA 1QY7A 5HANA 2DD8S 2CPEA 1F60B 4FXVA 1IKWA 4QCLA 2KHDA 4CLPA 3ZNJ1 5L1LA 3VF0B 2O5DA 2WVCA 2I2YA 4NRUA 3IG1B 2CQBA 2XULA 2J6TA 2KXHA 1FRIA 3X3UA 2QV6A 1S6PA 2YNFA 1NJWA 4IDKA 1JKHB 3V81A 2E9ZA 4I2PB 3MEGB 3NBPB 3RB4A 2QN6B 5L9XA 1CJVB 3ENVA 5JJBA 1WOOA 2K1RB 3F44A 1FRXA 3ISZA 3S01A 3C6TB 2BJ8A 4IUFA 3CCUS 1L3UA 1T3NA 1ZPVA 2W7OA 2BE7D 2IAJA 1YBAA 3O44A 1VQLS 5J1EA 2CQ1A 1CJKB 1EJ7L 3JQJA 3MFHA 4MTPA 3OXLA 3OD2A 3PEJA 2ZJRQ 4X4PA 4NASA 3MCOA 5F3ZA 4X65F 1RT5B 2OAUA 3H5YA 4JI1F 3OR2A 2B9YA 3WHIA 3HPOA 1N6QA 2Y8WA 2JDJA 3PO4A 2YPZA 2LCWA 4KRWA 3MECA 4X64J 3Q8VA 5KFKA 3CJ0A 1OIAA 2BE2B 2DGVA 2XYGB 1PYOB 5RUBA 1Z4UA 1VR6A 2F65A 1ACMB 3OJUA 4L74A 1P8GA 1RWKB 2VONA 2NXEA 4CO4A 2ZJQQ 2ZOFA 1U0HA 2MZRA 3LH2S 1L3TA 2EEYA 3E2EA 4ED2A 3P96A 1IM6A 1M5HA 2X1FA 2PC6A 4QZVB 1EQMA 2IYGA 2V2ZA 2KO1A 4XAKA 4GKKF 2HQ3A 1YSJA 1RAEB 1SV5A 4FBUA 4NYOA 1RYRA 3RW6A 2A3JA 1QVFR 3G4SS 1T9WA 4ZS6A 4BHQA 2C2OB 5JVHQ 1CC7A 4NLSA 4YS2A 2A6MA 2XB2D 4OX6A 1RXOB 4QWBA 5HP1A 2Z2YB 1KQFB 4BC9A 1CQMA 5KFCA 2PFFB 2XWXA 2AV5A 4P6QA 2GQQA 4ZP6A 2ZZTA 1YJTA 3PRBA 4J9VA 4OFZA 5FDLA 3HHKA 1X4BA 2IRYA 3TUJC 5IT9Y 3MEDB 4RR5A 1WI8A 4DV5F 2HVDA 1JXLA 1O8BA 4ZVQB 4A4JA 1KSPA 1RAIB 2CQ4A 1BWVA 1N88A 1K47A 1G3OA 3E3XA 3UNGC 1KS2A 2NLWA 3HLUA 3GSDA 2Z57B 2IBKA 2DNOA 3CCQS 1A6LA 2K7KA 4KHMA 3PXGa 3GMGA 2ZDOA 1TR0A 3M9MB 2MLZA 4CP5A 1R8CA 2H3EB 5IOLA 3IMQJ 4KTQA 1CLFA 3HVTA 4ITSA 1FX2A 2JX2A 2AGOA 1SQGA 3HVWA 2OPSA 1RHRB 1HQEA 3NGUA 3HD1A 1RT6A 1QAIA 3HDSA 1HD0A 1SJ1A 1SIZA 3IFEA 2M9KA 1RWNB 4C4WA 4JV5J 1RTIB 2Y1LB 2R7WA 2HWIA 5LT5A 3BKUA 3QRPA 2DNNA 4IQMA 1FD2A 1KHWA 4DS4A 1F3VA 1NDKA 4ID5B 1JLGB 1FXRA 1P1TA 2UU9J 2HK3A 2F3JA 3K59A 2W9AA 1VHFA 3P3DA 4DV4F 2G13A 2UUAJ 3G6ES 5EWGA 1IQZA 1S1WA 4UUWA 4V19J 3UDLA 4OZLA 4HL9A 2PT0A 3M2RA 3SSSA 1LK5A 2QZ8A 2BM1A 2QYCA 4OYOA 1TK0A 3RUBL 2DXFA 4HDGA 1ZM4A 3PTWA 2ZH7A 3SIPB 3M2VB 4V1Ak 1K73T 3GG0A 3GR0A 4X64F 2HKEA 1W26A 4M5HA 3MM8B 3H4BA 2GHVC 3R5JB 1Q82T 2YPYA 2IJNA 4ZVTB 2AX0A 1Q95G 3OL9A 2DR8A 3MTJA 3NLCA 5ITHA 4I69A 1LW0A 2D69A 2HS4A 2ADCA 3FQKA 2ZDPA 2AU0A 2BMBA 3R6GB 1RISA 3N0VA 3OUYA 3VTIA 3RW7A 3TI0A 4X84A 1FA0A 2KT5A 2DNQA 3G8SA 1YTYA 5D3GB 1R7IA 3MM5B 3IBCB 3L09A 4AL5A 1DTTA 1JJHA 2BZ2A 3WDOA 1QLNA 2AP6A 3O5TB 1RP5A 4GVBA 1WDTA 4PQAA 3CEDA 3I31A 2AYEA 3DOKB 3HVAA 1UAWA 2K3IA 4X66J 4KKOA 1SPBP 3P5BP 2NQPA 5DETA 2Z56B 1TL3B 5A76A 4WU3A 4NEZA 4I0WA 2FLPA 2A2DA 2KZMA 1QE1B 1VFJA 3HFVA 3KLVA 3LP0B 3RG6A 4DR4F 1PGZA 2PI4A 4RNFA 3MEKA 5B0BA 1MWQA 2XMKA 4ZVGA 2L48A 4IG3A 4I6WA 4ECVA 2NZ4A 1X5PA 1HWUA 1YKWA 3GCXP 3HULA 4MYUA 3KMQA 1Z2ZA 1MW7A 1RCOB 4ZN1A 2HFOA 3M8WA 3MCMA 2LEAA 4X4VA 3M30B 3DLEA 2CFXA 1KEKA 1NXIA 2W24A 1SH3A 2M5YA 1RAFB 2PA8D 1RT1A 3SCKE 1VIOA 1YIJS 2MSTA 1FDDA 5CHCB 2WOMA 3CCRS 1A7GE 1S77D 1VBXA 3J80U 3THPA 1OPZA 4C8NA 4G1PA 2CPZA 2OFHX 3OFHA 5D78A 1JLEA 3W5XA 5KT3A 2I0XA 2UUAF 4OX7A 1YJNS 5C25A 2GIRA 5KG2A 3HF5A 3S7RA 1FEEA 3SEOA 3DLGA 4B3TF 4X4OA 3PHTA 2OSRA 3ENWA 4F0KA 2PI5A 2R7QA 5IS2A 1QSSA 2V5HG 2XQCA 2IY5B 3N6LA 4J37A 5MLCV 4OYAA 2XI3A 2WTFA 2HHHJ 4NOHA 3RAMA 3MCSA 3UVJA 4Y28C 5C24B 3J81U 3PX4A 5A6PA 4MIAA 4OJ3A 2Q1LA 3R7BB 3P45B 3FEYB 4IKAA 3EXCX 1F5BA 2FVRA 2HGLA 4B17A 2P6TA 5G4DA 2MQPA 2HHUA 1C1CA 3QPIA 3ZTOA 2HNYA 5KOXA 3NCRA 5J2PA 3C6UB 5HQ8A 3H5SA 4HHJA 2DR7A 3ZC4A 2W7AA 2HQFA 5FIIA 1NCLA 5KG5A 4G6VB 4ILMA 2VD3A 2CJ9A 1RT4B 4QR1A 3GSIA 3MURP 2PMWA 4ANCA 1UVJA 4OJHA 3KK1A 2V94A 2E7WA 3M8ZA 1X4AA 2W25A 1QAYA 3P6YC 3RRHA 3VQSA 1J5OB 2GMLA 4MK7A 2C22A 3V5RA 2D9PA 4ZVFA 1CVJA 4DS5A 1TK8A 1QTMA 2YKMA 5CYQA 1VOMA 4EBDA 5I42B 2CJAA 2KJWA 5KT5A 4JI4J 3EJMA 2UUTA 2W01A 2B4OA 2V6AA 5ETQA 2ZE2B 4C0HA 3SQGA 1H73A 1FWLA 5J2MB 2HHSA 3B4DA 3HO1A 1YRXA 1UW4A 4K5RA 4U6PA 2LQ9A 3G82B 3PKYA 2D9OA 3VGVA 1GTHA 3NGSA 3M1VA 3UD4P 3QAEA 1VQOS 1LWEB 4UY85 2HBQB 4H4MB 2DR9A 5EWEA 5ETMA 1U09A 2KT3A 1X60A 1VRTA 3CULA 2YWKA 2DHHA 1H7XA 4NMLA 3MM9A 2D3OR 2LA4A 3MUVP 2Y3YA 1FRMA 5F8MA 2KYZA 4W98A 3ILIA 1KP6A 2CQDA 4MT1A 3MM7B 4OHZA 1FRJA 3FFIB 3NOGA 1N5SA 1XMOF 1REVA 1RU2A 4F04B 2H4YB 2KVQE 3GV5B 5BYSA 3DLJA 3IGNA 4ZN3A 4I2QB 1QAXA 1T02A 3FMWA 3IGVA 5D0RA 5CQGA 4UW2A 1RB0A 1QTNB 3T41A 4EUVA 2V9KA 3TZXA 4L75A 3KJVB 3OL7A 4GMKA 2ZM6J 3W9IA 3KJQB 2NXNA 1U6FA 2Q66A 2FPHX 1R0AA 2DGTA 1AROP 3TVKA 2K8GA 2YNIB 1QUVA 4ZPDA 3A8KA 5B0GA 4QW9A 4ZPAA 2HS3A 2W2MP 3C3LA 1OYEA 1OSCA 2Y0BB 2GVZA 3FDSA 3M9OB 5THWA 1WACA 4WE1A 1I51B 1MWYA 2IHR1 2B4VA 4IYQA 4DJBA 3GP9A 5CCMA 4F50A 1VQ4S 4LBHA 2LXIA 3C19A 5LXRA 1E6YB 4DL5A 1AFIA 2B8PA 4DZ6A 2AJ4A 1R8AA 2GX8A 4RBTA 5DDRC 2VDIA 2B7BB 2J5AA 1UWBA 2B56A 2FJWA 2HBYB 2G9OA 1F1BB 4UQTA 3NWGA 3H25A 1XR7A 2HFUA 3NKYA 1ZA2B 4IFYA 5KG7A 3TA1A 4ZK7M 4NCGA 3V6DA 3BGOP 1NSAA 5CYMB 1VQ5S 4NCAA 2YX1A 2GMJA 4KYZA 2FVSA 2JFDA 3BGRA 5HN0A 2ZUAA 4JI4F 4YFUA 3SYZA 5F8NA 3DMJB 1RSCA 2BYCA 1OQ6A 1YBTA 1O6XA 2IRXA 4JI5J 3PY8A 1ZTTA 4J9LA 1JJ2R 2YWEA 1JJ4A 1VC5A 1Y5IB 4B9LA 3HI9A 2J7UA 4K4SA 1UMJA 3ILOA 3DGPA 2HIQA 3IM8A 4DN9A 2F8HA 1PAEX 4HACA 4ZVHA 1MLAA 1WG4A 1CEZA 1FWKA 1GXLA 2FHKA 2GHWA 1GMUA 3L7OA 2BXJA 2HEKA 5K8MA 5E3QA 1Q81T 5KAKA 4DR6J 1WEXA 1R6YA 1RLDA 4B02A 1XMQF 1K9MT 5HMYA 3RZAA 4UZCA 2B4PA 1PKUA 5K14B 2O01C 4JI3J 3NS7B 3NAIA 4J9PA 2RRBA 4PR6A 1ZOTA 4AL6A 4LR8A 3QMQA 5AXNA 5B0AA 2VKRA 1Y3KA 2E1PA 1HNIB 1N34J 5A8KA 3MMCB 3MM6A 5HBMB 1RADB 4LF8J 3FC9A 4KV8B 4IOAQ 3HKWA 3GJQB 4QOTA 1C1BB 1RUSA 8RUCA 4LFAF 3NCQA 4NL5A 1QUPA 2F8MA 4EWTA 1L3SA 3O1LA 4ANEA 4TXSA 3W8GA 4LSLB 1RLCL 3ITHA 4A8KA 1KQGB 1TU0B 4C0BA 3CT9A 4P73A 4YHHF 3MMAA 4C3MA 1VQ8S 1H74A 1SCJB 1HWJA 4LVNP 4C8MA 1FJEB 2XNQA 3SV4A 2IFXA 2NYHA 1Q5VA 1WDDA 3TAMA 2FDNA 3MMBA 1D9DA 1GMWD 3BBFA 5T7LB 2NUUG 5H9FK 3QIDA 2I6WA 4CNZA 3BQ0A 1WD6A 1S1VA 3NG8A 1YRUA 4USKA 3UCZP 3X1LB 1W7WA 4NZ6A 3I32A 4KO0B 4WP8A 1U4BA 1FHTA 1AW0A 1S0VA 1YGYA 1TL7B 5HLFA 4FVCA 4ZVEA 1NKEA 3VWSA 3W66A 2RDDA 4UUXA 3GE9A 5IV4A 2HMIB 2N4CA 2XLIA 4ZVOB 4OYPA 3BGFA 4B3OB 2CJXB 3AQPA 3G71S 4YDDB 4QYZK 1XC9A 4A48A 2ADBA 4JI0F 2JH3A 1IBLJ 4JI5F 4OMFG 3JXOA 1T9TA 3KYLA 1UA1A 1WOSA 1S79A 2XYPB 1OYDA 1N54B 2R2TA 4IQXA 1GK8A 5IQ6A 4J9NA 2R8KA 3QT5A 3SFGA 2OPPB 4NXMF 3G8TA 4C6AA 4Q8FA 2VBXA 2Q6BA 4A47A 2ZBIA 4RUCA 4C8ZA 2BUNA 3BSNA 3I5BA 4M5LA 4NCBA 1DLOA 5H9EK 3T1HJ 3BH6B 1N32J 3LGNA 2VH7A 5DS7A 1T8EA 3PJ9A 2RDJA 2CIMA 1KLMB 2DEIA 2DK2A 2AX1A 1NSPA 4UY8T 4ZPTR 5E3CA 3DLKA 5G0RB 2XY7A 1Q5YA 1NZAA 3DRRB 4ZOSA 1LOUA 1Q78A 5AJ3J 1IM4A 1N34F 2HRYA 4QWDA 4NA2A 1JXEA 3PYEA 4LF8F 3GFHA 4KGMA 3HMJG 3PZPA 3UCGA 1N0VC 4C98A 3S1TA 1N5YA 3KHRA 4CWBA 5H1SV 2XGPA 1U1KA 4NLDA 4O3OA 1NBEB 4WIIA 4RW4B 3V6HA 3EXYA 3KHLA 4KE5A 1YZ7A 1K0VA 3TJAA 2GVDA 4C8LA 4HI2A 2F7VA 1UZHA 1WEYA 4ICLB 3U7JA 1D1UA 2R7XA 2RQ4A 3L95X 2V50A 4CYUA 4WPAA 3W2VA 2BR0A 2YH1A 2DITA 4Y2KA 3ETMA 2HWTA 3KXDA 3AT1B 1HYSA 2EFPA 2Z2LA 1NHUA 2DXEA 2QSWA 1VQPS 1EETA 1MROA 3RBZA 4CTAA 3I0RA 3KJFB 2ZVSA 4BC7A 3IAS9 3T6BA 2ABYA 3WBZA 4IR1A 1L3VA 2H65B 4NYZA 1Y3JA 1YJWS 2GJ2A 4O44B 4NI2A 1U24A 3W65A 1U8SA 3HHLA 1M5PC 1P9QC 1DARA 1K8AT 4KH1B 4YR0A 4ZITA 2VC0A 3W2WA 1B0TA 4DLGA 1ZM3A 2C3PA 1R27B 3TP2A 2UVUA 3EDRB 1TQLA 3PJWA 4ECTA 3CO0P 3DHWC 7AT1B 4F2SA 5IM0A 3O8WA 1FNMA 2XMWA 5IZHA 1VHIA 3RB0A 3ULHA 4H54A 4LRCA 4M94A 1BQNA 1NEEA 3K8WA 2ZZMA 1WJ9A 4EK2A 1FDNA 4DPUA 3JTOA 3BZQA 1T7PA 4QU6A 2DR5A 2VFSA 1TVRB 1V5IB 3DNCA 2R7VA 3SDEB 3CE8A 4TY8A 5A8RA 4P75A 3PKMA 3IWNC 1N32F 4P74A 3JAMU 4AYBD 3GIIA 1HARA 4E2FB 1JB0C 4QYRA 2PMZD 3E01A 3G9CA 2V2QA 2CAJA 4G1IA 3L4BC 2ASJA 3AA8A 4L72B 2W4CA 3M8PA 1YJUA 2M7SA 4B9NA 1RK8A 1GX5A 2H51B 2DISA 3BH7B 2DGWA 2WK4A 3PM9A 5AJ3F 2ASLA 4DSJA 3DRSB 3IM9A 2ZJPQ 2VHGA 4P7VA 3NXZA 2R8JA 4O4GB 4U96A 3Q2TC 2LXUA 1JLFA 4NZ0A 3T9NA 2VA2A 5MAOA 5H9FJ 5DRKA 4I7FB 2CPJA 3EGVA 2DNRA 3CF5Q 1B7FA 2MQMA 4LQ3A 4CLZA 4K59A 2GQ2A 1MU2A 2CPDA 3S6EA 4EYIB 4QR0A 4AE5A 5ETNA 3M2UA 4KBIA 4XDDA 2UXCJ 4F67A 2C2KB 1M5OC 4DLEA 1P1LA 2VFTA 3UI3A 3BSAA 4RW8B 1NM2A 2RIJA 2VG5B 1GTEA 4OI6A 4LIWA 1FJ7A 4CZCA 1RAOA 4KPYA 3MD3A 2QL9B 3CCSS 4LF7F 3IG1A 4UOFA 3CJSA 3JSBA 1C4AA 2PEBA 3OLAA 1FKAF 1HBNB 1X4CA 2AHOB 3WC0A 3UN2A 3ZZRA 4HVZA 2AWZA 3A8JA 3BM7A 4M5NA 3NL0A 4ZKAA 2YNHB 3MCNA 1R6VA 3PW4A 4I2PA 3MEGA 3NBPA 3DXBA 4PG5A 3BSOA 2ASDA 4NWBA 2IVFB 3N4WA 2CZ4A 2PO4A 3ENQA 4QIEA 2ZHOA 3M8YA 3UO0A 1QM9A 4WFAQ 1ZTWA 4GVLA 1CJKA 3MGJA 3TRGA 4HEA9 1PJ6A 3D7SB 3OFGA 1D0EA 3SCJE 3JYTB 1YJRA 1LFWA 1KHVA 1GX6A 5FD1A 2IM3A 3KLFA 1U25A 2FHMA 4RW9A 2B3TB 2WBMA 4DF4A 4IFVA 1QSYA 1DTQB 4ZPBA 2IYIA 1RWWB 2ZWPA 1UVIA 4MIBA 2BE2A 2XO7A 2EK6A 4ZHRA 4B9UA 3QWUA 2CRLA 1PG5B 2JVRA 3MXHP 3R5DA 2YH0A 3CCJS 1FTCA 4YOEA 2E44A 3FBCA 4M63A 5DQHA 4XPCA 4XK8C 4F3OA 2V8HA 4DEZA 4CO2A 5J2QB 1RHMB 3KLIA 1TELA 2EG1A 2W2OP 1RDRA 4QIGA 5E5NA 3CJ8A 5KFGA 3KLEA 1N33J 1F5AA 4M5GA 3TO8A 3TZZA 2LQ8A 2IA0A 3QIPB 3W7BA 3W1YC 1RKIA 3OL6A 2I38A 1YG0A 4YEAA 2HGMA 1EAYC 3LP2B 3CCMS 4RW7B 2CZ9A 2R7TA 3V4MA 4O3PA 2DNZA 2FYXA 2MZJA 1JMTA 1SC6A 2AYBA 3ILLA 1ZM2A 2DHGA 4YUDA 2BEFA 4DDFA 1F9EB 1BLUA 1FD8A 1NLKL 5LOQA 3KMSA 1CS4B 3C15B 2XG8A 2RH3A 2UXCF 3FNNA 4NXNJ 2H5IB 4H4OB 2DNHA 3EZOA 1S9GA 1UKUA 2E9RX 2AT1B 3T5JA 2F40A 3DC2A 1FX4A 5HJXA 5HVFA 5HK4A 2E1AA 2QTWA 2MGZA 3LP1B 1ROFA 4FVMA 3P8BB 4DV3J 3O2IA 3DI6B 5HROA 2MQNA 3NAHA 4K4VA 3EICA 1DQ8A 4OX9J 2UV8G 1MNEA 2LP4A 5D6GA 1T95A 2RU3A 4DX6A 4J9OA 3J81j 2UXBJ 2WW4A 5GVQA 1S12A 2J7WA 5D4LA 3Q8QB 1Y4ZB 1NDPA 5CA5A 3ZO7A 5EGYA 3IWXA 3BJYA 1PSDA 3C16B 1WHYA 2R7OA 3Q22A 4G1QA 5KFYA 1T05B 2KXFA 1KOOA 3C46A 1D09B 3SSQA 3RB6A 1TKZB 1SQFA 5LMUF 4U95A 1YJ9S 1H72C 4LMZA 4MK9A 3W5ZA 2FZGB 2WHOA 1RTHB 1IKYB 4ID5A 2OEJA 4USUA 3PX0A 3SI8A 2C1EB 2V4JB 4DCPB 3BV8A 4JB8B 1NB7A 1WHXA 3TJ8A 4K4XA 4WFZA 4N56A 1IBCB 1UEVA 1U8WA 4FPRA 3BQ1A 4S0MA 4WP9A 1PAUB 3LWMA 2VPZB 3CMQA 3G6XA 4USJC 5CD4A 4P2MA 3VHQA 4D3HA 3M2VA 3N6NA 3I82A 2QGFB 4MKBA 4MKVA 3TA2A 4FNIA 3VALA 2IBOA 4BDPA 2CQ3A 3ZTRA 1NUEA 4MIWA 2B9WA 2ATCB 1ZETA 3VZIA 2Z2ZA 5KFBA 1TKTB 2BOPA 2FJEB 2QL5B 4ED0A 4E0DA 2DPIA 2IJRA 4PQUB 2OD6A 3AQOA 2L08A 3CDAA 4FF4A 2IC3A 3KUGA 5D3GA 1WKLA 3LANA 2Z0GA 3U1MA 2V2KA 2J0WA 1Q86T 2C2NA 3BGLA 2MY7A 3PR4A 2HVIA 1NO8A 3H7HB 3DOKA 5F41A 5D4PA 1IKXB 4BS2A 1PCAA 4OI1A 4PEOA 3G6YA 2CQIA 2V63A 4Y2AA 3UR3C 2JZ5A 5C42A 4DV0J 1IWAA 2BABA 3AB4B 3BQ2A 3DM2B 2KFYA 2JL9A 2OPRA 1PO6A 4R25A 4DR1J 3NGTA 3N79A 1QE1A 3LP0A 1T9UA 1BUXA 2QA4G 2DXDA 3CCES 3HX9A 2HZCA 4DV3F 1LXJA 3C14B 2X3GA 9ATCB 3FCWA 1FVSA 4N8OA 3ZNUA 4F0MA 4XTTA 4M5DB 5D4OA 3KUEA 3JSMB 3MWBA 2J8AA 1ZYQA 2AZ1A 4C11A 2UXBF 2HK2A 3NMRA 3E51A 3D0IE 3DDKA 1U2RA 1WSRA 2MEWA 2LA6A 4RNMA 1SXLA 1HNXJ 2YKPA 4DX8H 1RTDA 1C4CA 5DM7Q 2ROGA 4NA3A 2XS5A 1AA1B 2K7JA 3ONQA 4DR5J 3HJVA 1RT7B 3R3TA 2EFOA 2CUYA 4Y65A 4Q5VA 3M05A 4NLOA 3PR5B 2L9NA 1S1XB 3VCDA 1UEKA 3DRPB 1IKWB 4JBCA 2E1RA 3OQ2A 4WK3A 2VFUA 3LPYA 2HWHA 3IO1A 2HHXA 4RWXA 3JTPA 4WKRA 5T41A 2KT2A 2MKSA 1BD6A 4CM0A 4URSA 4KGXB 1FF2A 1VBZA 4LFBF 4HTJA 4IDKB 2C2RA 3RB3A 3H40A 1P9YA 4LRDA 3H4DA 1KNZA 3D3CJ 2FQQB 1WF2A 3I5CA 1FNOA 4ZMMA 4EBCA 1I94J 3QZ8A 4LREA 2IAJB 4ZVSB 1VQ7S 4KGVB 1R3NA 4WFYA 3L7PA 1ZAVA 5ETOA 2P8IA 3PW0A 3DLLQ 3FRYA 4DFJA 1SJ3P 3UCUP 3VAKA 3T6JA 5EUHA 3KWMA 5IT9U 2ZUGA 5AT1B 1ELOA 3ISNC 3OR2B 2POKA 1GQEA 5FJ4A 2MYFA 4Q43A 1N6QB 2YBVA 4EZ9A 2AQ4A 1NKBA 4NYPA 2MKCA 3FZBA 2QMUB 4Q44A 2VODA 4I67A 5I42A 2HPUA 2AF6A 3HHEA 5JXSA 5E33A 1FVQA 2AJ0A 1UJ5A 4NLUA 1XEZA 4USIA 1HBOA 1KLNA 4ETXA 2RKIA 3QLHA 4CLSA 1N0UA 2NSCA 5KFHA 1U0HB 2DO0A 1DURA 4OHVA 3VVTA 2RF2B 3CNQP 5HQLA 1PC4A 2XYHB 1S57A 3AB2B 1TUWA 4ZJLA 1VGYA 4H4MA 5J1PA 3R5BA 4DXLA 2GIQA 3MD1A 1JJCB 5LSLA 3H98A 2LU1A 5KFUA 5K5MA 2KG1A 4N47A 3W60A 2QE5A 1WC1A 5HP1B 1S1TA 1SVDA 2V4RA 3MM7A 3T5HA 4DZDA 3TUZC 1ZM9A 4DSKA 1KQSR 4EO8A 2AEMA 4DQSA 5LMNJ 5A6WA 5AE3A 5I3UB 2BJ9A 4LF5J 4I2QA 5FDLB 1RWOB 3TAPA 3BR9A 2FVPA 2YX4A 1NJZA 5A8WA 3M8SA 4B3RF 3KNGA 2OLWA 5F0WA 3KJVA 3CJ2A 1DZ5A 3BEGB 2J9DE 3F41A 3A4TA 3F0NA 5KFAA 4YP3A 3BYPA 4B9SA 1UVMA 3M32B 1B64A 4KB7A 4DUYJ 4K2XA 1NJIT 1B4SA 2BJ7A 3JS9A 3K8VA 3DU5A 5DQGA 1Y7PA 3VAIA 3CJKB 1SL0A 2EWHA 1ZS6A 2KG0A 1SL1A 3L9ZA 4JUZA 4USVA 3W5YA 5F3TA 3C66A 1V3SA 2Y8YA 4N7TA 1BQXA 1AFJA 4L73A 1WWHA 2DY1A 1E6YA 4A8YA 2BQRA 3I9ZA 4FS2A 3HHNB 2I1RA 2EW9A 2VICA 3EZ5A 1AZSB 1WHVA 3D2WA 2J8SA 3V4IB 1L3KA 1UCNA 3FSYA 2CADA 5KFTA 4EI2A 3D0GE 2DIVA 1FTRA 4NLGA 4TQRA 4B3MJ 2Y1RI 4HLBA 1AT1B 2UVRA 3M2RB 2U1AA 2YKNA 5JVGQ 2D74B 4KR0B 2O66A 3EZUA 3CCZA 2W9BA 2FIUA 3DGVA 2HHTA 4FP9A 3AY0A 1LW2A 4OV1A 4PABA 1C2PA 4LFCJ 1IR2A 2I5JB 1FO1A 5HO4A 2CG8A 2IM0A 4JYAF 2F4VJ 3DMJA 5BJRA 5I3PA 3GJTB 1LW0B 1MMDA 3RTVA 2YNGB 2JC0A 5ETVA 2XMMA 3OUYB 3FSXA 2M8HA 2RMLA 2BACA 4O3QA 2KI2A 2V8VA 3H20A 4JV0A 1NK9A 1VMBA 2M0GB 3QGPA 2KVIA 2NZCA 2DRDA 5SZTA 1JLQB 1IQTA 2FVCA 2X1BA 4ED6A 2HRUA 1N5QA 2DNMA 1DTTB 3PEHA 2EC2A 5KFQA 3ZTSA 3GB0A 2CNLB 6FDRA 1RWUA 2VQFJ 2W1BA 1LQ9A 4GC7A 2WSFC 4YDXA 5LMNF 2JJ4D 1VRUB 2LDYA 3KK2B 1UW9A 3TQEA 3A3NB 5F9LA 1N36J 3GIKA 2PN6A 4Q2MA 2VJVA 4FKYA 3OHAA 1NH7A 3EGZA 3R5CA 3O6QA 5KG6A 2JEIA 4CT8A 3CVKA 2UVVA 4KPCA 1J2VA 2R4FA 4QWCA 2RS2A 2IJFA 4QU7A 1HMVB 2OH2A 1HNIA 2P5VA 1R0CB 5HBMA 3CO9A 3NGDA 1PJ5A 4KV8A 2G2YA 4YB1P 3DRXA 4OYZA 1UA0A 1FDBA 2VB6A 1S6UA 4DCOB 2KJVA 3LA0A 4DL6A 5KG1A 2EG2A 3RU0A 3PNIA 4BWJA 2C2ZB 2G0IA 3LPEA 2CJKA 1BQMB 1RT1B 4LSLA 1UJ4A 2G4BA 2AW0A 1NDLA 3MPDA 3A3PB 2WOMB 1RWPB 2QL7B 2KB2A 3OTDA 4DV1J 4P2XA 4DWIA 3Q23A 3IWLA 3BKTA 3IBFB 1PIEA 1U1QA 1FERA 4WIQA 4ZLLA 1XJWB 2Q3PA 2QJ3A 4RUBA 5KT4A 4WYLA 1G7CB 3UW1A 2E29A 5C25B 3PIOQ 4B3MF 4ZP9A 1O0PA 2CYYA 1XERA 4ELVA 3DRYA 2N3OA 3EGWB 4Z7CA 1B7YB 5L1JA 3AODA 4KO0A 3TR5A 2H1YA 8ATCB 1GAOA 4P52A 2G2ZA 1RBLA 3D6FB 3ZZOA 3AXMA 4LFCF 2HMIA 3MOJB 1TTHB 3GFYA 4KHRA 2BM0A 2KXNB 1A9NB 3UVJB 2F4VF 3EE3A 4KC5A 2EKNA 1GH8A 1Y0HA 3EVWA 4J9MA 4M5KA 4J9SA 2JLGA 4AQYJ 2I9SA 1T0TV 1RT2A 3ZZZA 2C3OA 1C1CB 2IDLA 1IBKJ 2YVSA 1HD1A 4HH1A 5J2PB 5KFWA 4ECRA 3OTBA 4FNHA 2MZTA 2DPJA 3QAUA 2OPPA 5LL6d 5SUHA 3BO3A 4ECXA 4RNHA 1VQKS 2CZVC 4DQRA 1HNZJ 1EIYB 2AIRB 3J7YI 3Q2SC 3KK1B 1SKRA 3I0SA 2YQ1A 4DL0C 2H5JB 2OO4A 4LF9J 1Q8BA 4FF2A 1Q8LA 3SSRA 2W2QP 2YKMB 5M2RA 4XO0A 3CD6S 3FGVA 1HFEL 2N4DA 4IRDA 2QIFA 1TAUA 5E3AA 4PG8A 2VBZA 4B3SJ 3RBEA 4NZ7A 5G0RA 3UWTA 3SQGB 1B99A 1RT3B 3DRRA 1NRKA 5HI7A 3EYZA 4ZCKA 1D8YA 4KFBB 4QWEA 2QLFB 1BE4A 3IRXB 2XS7A 3D66A 1KWMA 1VDHA 2EFGA 2HYIB 4J90A 2FVQA 5J2NA 1Q4RA 2HS0A 2OTJS 1TFWA 1NZ8A 1S97A 2X1AA 4ED5A 3QGGA 3AOCA 2UUCJ 3GG1A 3UQSA 5I3QA 1VRTB 2DIUA 2F9JA 3D67A 3MM9B 5EX3A 4RWWA 3HXMA 7FD1A 1VCTA 2J9CA 2HHPA 3NP5A 1UZDA 2MTLA 5HATA 1NPPA 3U1NA 4MKYA 1REVB 4P7TA 2G1DA 4OZ0A 2MJUA 4IH7A 3W61A 4DU7A 4R0EA 3TA0A 2W9CB 3FMBA 2B43A 2ZFHA 2HFNA 1X9MA 1HQUB 5DO2A 2O3DA 1JLAB 1QSLA 3CJ5A 1RI7A 1BXNA 3HZGA 2RS8A 1R0AB 4DSLA 2FY1A 1QDUB 1GMVA 2VUGA 2QX0A 2YTCA 3PHEA 3SCLE 3FEXB 1X4EA 1KC8T 4Y00A 5KTQA 4MFBB 3VAMA 3FEZA 5ADZA 1HHTP 3IBWA 2KRBA 2CPIA 4DQIA 2R42A 2Y1JA 2QEXS 1NMEB 3CUNA 2LEPA 2C2DA 3GTYX 3M6VA 2VOPA 3MTKA 3CJRA 4AQYF 1X5TA 4ZVRB 2A18A 1HBUA 4OI2A 1HWKA 2E1CA 3GR1A 2DVIA 1CBKA 1Q7LB 1IBKF 2BJDA 2DO4A 4UF4A 1DHMA 3GIRA 4ECSA 3OFFA 3TARA 4U7CA 2C2MB 2A6OA 1HKAA 4M5IA 3R1HA 5CZVA 5DGBA 1HQ2A 2OSQA 3H8YA 2F1FA 1QAJA 1HNZF 4AD6A 4ELTA 3I96A 2ROEA 1AB8A 1GEHA 2AGQA 5K8PA 2ROPA 3TWZA 2RT3A 3K58A 4LSNA 4ER8A 3IXQA 3SDEA 3N5FA 4HHHA 1KBRA 2ZVIA 1X5OA 5BXIA 2HFZA 3SCIE 1KKHA 1N4LA 4RNOA 2P6SA 3R7SB 2KHCA 1B3TA 4NCGB 2XBPA 4EGLA 2COLA 2E5GA 1X8DA 4RU2A 2UP1A 4ED7A 5A0YB 3IR5B 1SJFA 2VPXB 1LFPA 3BGRB 4DN0A 2OUGA 2DHSA 4JP8A 3P5TL 5LM7E 3GPAA 2GS8A 5KFFA 1TZ0A 2DRBA 4C0OC 2DJWA 4ELUA 3DRSA 1C0TB 3FRZA 1X4FA 5HAOA 2G1HA 2V8GA 4OZJA 4OYIA 4F4ZA 2QC3A 2VC1A 4B08A 5L9NA 2BJ3A 4I1TA 2B8QA 2NREA 4I7FA 4KGKA 4HACB 3A13A 3PW7A 4AXJA 2GCFA 2YQ3A 3AJDA 4C7QA 1TL4A 1ZA1B 1CQNA 3T1YJ 2J0SD 3TQ1A 1X0FA 4FKXA 3I6PA 1ITPA 1RAGB 2LLZA 1WI6A 2Z30B 2AEFA 2ERRA 2HVHA 2VU5A 4CO1A 3GU0A 2ALYB 4ANDA 5JUMA 2QLJB 1R0BG 1CJTB 3SXLA 4LRFA 4U7UD 4ALZA 2ZHAA 5A8KB 2HNZA 2ZBQA 3MM6B 1VBYA 2FTRA 1UFKA 3O3LA 3PRVA 4JV5F 3DCAA 2HZVA 1FFWB 5M2PA 4M5JA 3H5UA 1YHQS 1NHVA 2RRNA 4WF9Q 4DFMA 4P72A 3RBXA 1LEOA 3H42A 3D3BJ 1RYSA 2YNHA 2R8IA 4RBVA 4ZP7A 3TW0A 3D54A 2HBRB 2UU9F 1KTQA 4PUOB 2HLTA 2MQ8A 3CC4S 3OVAA 4FYVB 4J9UE 3KLGB 1P27B 5F8GA 1L5UA 4C48A 1S1UB 1TP7A 3VQTA 3WQPA 1HNVA 1XN9A 1U02A 2W4DA 1VYAA 3LAKA 1YX2A 2Z2MA 1VJWA 1FKPB 4DV2J 1R31A 4DPWA 2LDIA 3PIPQ 4DUTA 4JI2J 4DX7A 3JYTA 3MMBB 4FYDA 1LKZA 5B08A 5AXMA 1Q79A 3VGTA 1H98A 3RGIA 1U2CA 3H2VE 1PBUA 1O51A 1S1VB 1VIXA 1EARA 2X1GA 3I56S 2Y1IA 3FVYA 2CJYB 2WZ1A 3HFZB 1KVJA 4KGZB 2VBWA 4PPDA 1F5CA 2L9DA 5F8JA 4QQBA 1M90T 4PG6A 1SB6A 3HSZA 1YBUA 1ZZFA 3G8QA 1FDAA 1EQ0A 2GNKA 3T3FA 2V8PA 2XM3A 1VISA 3POTB 3QT8A 3K5MA 5J2QA 4RO0A 1TKXA 2FGCA 2FJDB 1I5OB 1IUJA 2DHXA 2HNDA 3QIPA 4HHUA 4X66F 2QLBB 1H3DA 2HSEB 1PBAA 4OYBA 4J5OA 3QGIA 4F25A 3B78A 3OTOJ 3TYTA 2JSXA 4GKJJ 2NYIA 2PEHA 3T1YF 5KFRA 1DLOB 2LECA 4OIXA 2WVBA 3F56A 2PSZA 2QO3A 3C15A 5GAHU 4E8UA 4J7CA 1NHKL 4H4OA 3SQOP 3Q8RB 3MF5A 3IAM9 2K2PA 1SI9A 3OXGA 1EP4B 1QVGR 4NX9A 5AE1A 3EUNA 4HI1A 3OHBA 4IH6A 2V0NA 5DLFA 1XR5A 1OJ4A 3D1HA 1DY3A 1FRHA 1NB2A 2NXJA 5GMKa 4F4YA 2C3MA 5EX0A 1EZZB 1S6OA 2UVWA 2OGUA 3N28A 3EDQB 1Y11A 4HDHA 1UWAA 2NPFA 1HIYA 3N5BA 4KHPJ 4AXIA 3QFHA 3AH6A 2BW2A 3DN9A 2FUG9 2FC9A 2YWWA 3C16A 1N5YB 4DFPA 1PJ7A 3MEEA 5D77A 1I6JA 3CPWR 1Y10A 1TKZA 3OLBA 1U45A 4UOGA 1H2UX 1JK9B 2GVDB 1IKYA 2DGSA 2CWKA 4ETZA 2VFRA 4EBEA 3MAHA 1Z2LA 2DH7A 2R2SA 4RL1A 4DV2F 4ES1A 1HI1A 3CWJA 2F9DA 4JI2F 5KFXA 5D0GA 4IG0A 2ZH4A 2GIFA 4Q7AA 1NK5A 3TNVA 2HHHF 1HYSB 4C3KA 4ECYA 5KFZA 2CQHA 4I6YA 4AUKA 4A8MP 4TYAA 5EDWA 3NGKA 3I0RB 2LMIA 2RB7A 1T03B 5KT7A 3RR7A 4NLQA 1TFYA 2UZAA 4NI2B 4URQU 2AKWB 3HHLB 5DZ6A 2CVEA 1RWXB 4NLRA 3D28A 3H59A 1S9EA 4HTIA 2BX6A 1F9FA 1S0NA 2AZ3A 5HVGA 2ZH1A 4YN3B 4RW6A 5B0EA 5HJYA 5DDOC 1S9FA 1RJJA 1OO0B 2FHJD 3G2XA 1HWIA 1SUQB 3J7YU 2MY8A 1N52B 2BRKA 1TV6A 2E5JA 2BANA 1BQNB 1SC4B 3DYAA 1V3RA 3U02A 5FLXY 3R9LA 3JQMA 1CJUA 3CD7A 2BW7A 2CPYA 3OTOF 4X65J 1F9HA 2I8EA 3SZ2A 5DG8A 4UOCA 6AT1B 2PE8A 4G3IA 4QBUA 1GXTA 4RJVA 3DM2A 4DI6A 4ZCMA 3E01B 2OPQA 3MI7X 3MR7A 2HAIA 3M8RA 4C97A 3SFUA 2JEFA 4NE9C 3IN5A 3M8PB 5D0HA 1APSA 3Q8PB 1JLCA 2PD1A 4CLWA 3W8PA 2V69A 4WZQA 4JI7J 1N5VA 3GILA 2J0QD 3MAAB 3Q8UA 4NLYA 2IMOA 3OV7A 2ZH2A 1C0UA 3LO3A 4CLLA 1SKUB 1YITS 3D6TB 4BCAA 2CKWA 4L6V3 2QSFA 1T3OA 1AXQA 1RU1A 4KHPF 1NSKL 3ZXWA 1FE0A 4PWUA 2XCPA 4WFNQ 4LR9A 2EFVA 1NSQA 2B6AB 3BF4A 5DG7A 2KM8B 2KU7A 5L8RC 3TAQA 5KFVA 2ZM6F 3DLBA 1MU2B 1RTJA 1N8RT 1RT7A 1EKRA 5KFOA 4TY9A 3M2UB 2ZOMA 4KJIA 2DNYA 4K4YA 2H54B 3BBCA 1R43A 5DM6Q 2HIYA 3A8EA 2CDRB 2HGNA 1JNRB 3EWGA 4A8OA 1S1XA 3DDNA 4NLWA 3TANA 4DR3J 3DRPA 3DOMA 3NCPA 4WBFA 4R0JA 4UQGA 1WG1A 2MKKA 1ZAWA 4OZ1A 4JOUA 4QWAA 3B82A 1AUDA 3T5KA 2VBYA 2XHCA 4DR7J 1MN9A 1FKOB 2FC8A 4F3MA 4WTOB 2CPXA 2RNEA 1IN0A 3VAJA 5LXYA 3OR1B 4OQJA 1KTVA 2P9EA 5KFMA 2MKIA 2R8GA 2PA3A 4ZVUB 2FLLA 1OPIA 2F4FA 5DGAA 1PYTA 3JSYA 3ET6B 4PWDA 1LWXA 3PX6A 2JLEA 4PG4A 3L7UA 1NNDA 2J76E 1WC5A 1UVNA 2MLYA 3UN5A 2YKQA 1K1QA 3G6VA 4QJVA 1NK7A 4ZCLA 3HCXA 4USMA 4DV4J 4PXCA 5E3PA 2EVZA 3IS9B 3V6KA 2RUSA 5CH7B 4LR7A 1UL3A 4Y3CA 3HP6A 3KLFB 3PYGA 2FY8A 2IPOB 3UD5A 4ES3A 1CULB 2RD5C 4DSEA 2Q6CA 4RW9B 3OTEA 4N41A 4KIAA 3TEHB 4OZNA 3T19A 2VIHA 4IFVB 2VFVA 2ZH6A 2BVZA 1ZZNA 1FK9B 2GAGC 5D8HB 2W2NP 4ZHRB 3KHHA 4FYXB 2APOA 2KZZA 4MAKA 3FQLA 4JI7F 2Z58B 3FBBA 2XSJA 2R7RA 3K5NA 4HYKA 3D4JA 2RF2A 1CC8A 1Q53A 2IM2A 3QZ7A 3KLIB 2DT9A 4Z37A 1G2EA 3C8YA 1CSJA 3KLEB 2ZHBA 1VRQC 4YR2A 4BWMA 3M4XA 2GGPA 5HL7Q 1S5ZA 3NEKA 4ECZA 4A46A 3E8OA 1TKDA 4DR6F 4P2FA 4FYWB 2VG6A 2K06A 2QFIA 5CYJA 1XNQJ 2V67A 3MZIA 1OY8A 4PYDA 3N01A 1GMWA 2CQ0A 2OD4A 1SC3B 4JI3F 5I3UA 2RRAA 4ED1A 4M95A 2CNOB 2VDHA 2ZEJA 3G87A 2UUWA 1S9GB 1D9AA 3THVA 2RILA 1LWFA 3NY0A 2GMHA 4DR3F 3U1LA 1NPRA 2LEBA 1V9OA 1Q7YT 2MGZB 4DR4J 4FF1A 3MUMP 3NMAA 4Q0BB 3M32A 4R8UB 4OX8A 5HROB 2DTJA 1S49A 4RZRA 2JRSA 2DY9A 2PGCA 4DR7F 1Q8KA 3CJKA 1H6KX 1TAQA 5AXLA 1VJQA 2VZ9A 2C28A 1JXVA 3PFEA 3BKFA 2NS1B 4G1QB 4FDFA 5E7OB 1JX4A 2PMHA 3PG9A 3TUIC 2HLUA 3QGHA 2VG7A 2N3LA 3ZZYA 4RUAA 3K17A 3CJQA 5KFEA 4OI4A 2WONA 3CC7S 2M70A 3R2DJ 1AZSA 3FZ2A 3QO9A 3W9JA 2XMVA 3V4IA 4WTYA 4DU8A 1URRA 2EC0A 3DU6A 3FUYA 4O23A 2WBRA 1TL1B 4ZDNA 1HI0P 1U2FA 3ELHA 3W64A 1KRPA 4B3TJ 4X4SA 4EU0A 2MZQA 3R27A 3Q0AA 4ID8A 3BPDA 3BPSP 1JQGA 2CQPA 4DL4A 2RU9A 3BN4A 5ETLA 1IBLF 3HK2A 2CG4A 2FLNA 2QLXA 1XIQA 2I5JA 1K44A 4DL7A 2ZNZA 1E6VB 4KT0C 2HFSA 1OS5A 3OL8A 3W9HA 4CI0B 3GYXB 2YNGA 5AXKA 4QIWD 3KLHB 3K5LA 1Q0NA 4IRKA 2V68A 1F0XA 1JLQA 2V8DA 2BJEA 2IC3B 2G0JA 2GJFA 3I4PA 3T1HF 1FNXH 2AGPA 2ZH5A 2B51A 4FXWA 1Y9OA 1VLOA 1IJEB 2X3DA 1XNQF 1MSWD 1HNWJ 1LV5A 1SIWB 5I4MA 1RBOB 2ACYA 3Q8SB 3BS9A 4DF8A 1VRUA 4RLEA 3KK2A 3C2PA 2WVEA 2B9XA 4OJGA 1WC3A 3GFXA 2RUGA 5C42B 1VQYA 4UOHA 1VI7A 2M8DB 2OPRB 3FCVA 3PYDA 2DHAA 2AYMA 2OTLS 1RHKB 4ZIWA 5DJBA 1WKJA 4QIVA 2CWXA 5F9NA 3LWLA 1HMVA 2R3VA 4NMXA 4U7UK 3ZTPA 2W8LA 3HT0A 2G0CA 3BBBA 1HBMB 3ADAC 5IFMA 3ILJA 2EPIA 1RAJA 3MR2A 2DYAA 1XTZA 4C11B 1T11A 2IDEA 4N8NA 4PCQA 2P9GA 3T5LA 3PRDA 1DRZA 5LJ5Y 2BKOA 4OYMA 1WEZA 5F8IA 3CGIA 4TU9A 1BQMA 1FFSB 1OSDA 2P2CB 5DLGA 1RTDB 1VK3A 2FGOA 1DAXA 1XMOJ 2J6UA 1LWCB 5E2QA 1Q8IA 1I1GA 3TVZA 4K0KJ 2VF3A 2LXFA 5EHHA 3QRQA 3H0PA 3M8QB 3GFZA 1RACB 1YK9A 1FRLA 2ZH9A 1UFLA 2WB1D 3QT7A 5KG4A 4O3SA 1UEUA 4CNYA 1FEHA 4TVAB 1JKHA 4NLPA 2QMWA 3MR6A 4F8RA 4ZA1A 2RJZA 1CJVA 5KT2A 3TVYA 3KNAA 2K1RA 3C6TA 4EEYA 4W4MA 2XGQA 4FF3A 3NNHA 5IT4A 4TQSA 3UE2A 1T94A 3UPFA 5CD4H 1FJGJ 4F4KA 3KG0A 2XSFA 4OL8A 1M5KC 2DH9A 2C3YA 2RQMA 5BYRA 3HSDA 3DOLB 1RT5A 4NPOA 2QG9B 3I9V9 1U6BA 2RDIA 1IXKA 3CDUA 1M5VC 2OMLA 1U0SA 3KHGA 2BBEA 3V2UC 4WU2A 1BC6A 2ZWOA 1HNWF 3W3SA 4DL3A 4FN5A 3U27A 4A8WA 1RHQB 2D41A 2DR6A 2E7VA 4LF6J 2ZBRA 3MOZA 1XQIA 1Y00A 1S0OA 4EFAC 5DDPC 5BYQA 3DDIA 5HMXA 2W4PA 2X7IA 2N7CA 3PDNA 2FHOB 3PCOB 3K0JA 2WW8A 2MDAA 2FZKB 2DNPA 4ZJQA 1HBOB 4X4TA 2JOQA 2B4UA 4FZVA 3LW5C 2RKIB 3QLHB 2PFDA 4ILLA 1RT3A 4DG1B 1DBDA 4KFBA 1NU4A 1YQHA 3R5AA 2PIIA 5A2QU 3S8SA 3IRXA 2RQKA 4ZVPB 3HFKA 4N77A 2ZC4A 4KSEB 3PW5A 3MPYA 1IKVB 3UDEA 2IA6A 4FS1A 3WX8A 3SV3A 3JTNA 1AYEA 3MEDA 3NWRA 2ZKTA 2A10A 2ZZNA 1S1TB 2B9EA 4AL7A 4K8RA 4X4UA 4EO6A 4J9QA 3AXKA 3P4UB 4IO1A 2C3UA 2UV8A 1W2IA 4P10A 1TL5A 3TX8A 3WX4A 5LSOA 2W9CA 4F02A 4K0KF 2JLFA 1XMQJ 5A8WB 1IJFB 1HQUA 1HPZB 2EFNA 1JLBB 3DLHA 1JLAA 3HKZD 2MZSA 4LRBA 3GLJA 2M88A 1MMNA 5HVHA 2NR0A 2XMJA 4LRAA 2HW3A 3AOAA 2OI2A 2ZD1B 2ACMA 2E5HA 4N76A 1YZ6A 2WCXA 5C5JA 5GAEI 4CLKA 2ILYA 2EKYA 1RTIA 4JI6J 2V4QA 4USHA 4F4AA 4MFBA 4ZJOA 4LFAJ 3GV8B 1KOHA 4XDCA 1JLGA 2XMTA 3MMJA 2A2CA 2CDQA 5F0UA 2BKPA 1WC0A 1FI4A 3GIJA 1S6QB 1FJGF 2OFGX 4X62J 4U8YA 4J91A 1W25A 4Y6IA 4NLXA 3QJPA 2YWFA 4UTGA 2DB1A 2MXYA 4YHHJ 1V5VA 4R5PB 1IR0A 1RHJB 1RAHB 1HW8A 2QLWA 4CLYA 4M1KA 4DR2J 1MN7A 3LQVA 5L38A 1PC5A 2YXLA 3GYNA 4U67Q 5DDQC 3QFWA 2BQ3A 4CLFA 3MM8A 3I4HX 4TN2A 4X4QA 1YDLA 2B5JB 2YKNB 3CCTA 2KKHA 4LF6F 5LSRA 1F2GA 5L1IA 1KVKA 2W9BB 1X7VA 1U1LA 1KQKA 4URGA 4ECQA 1M1GA 3OSNA 1LW2B 3PVXA 3DXSX 2GAHC 2FD2A 4V19X 5A0YA 1BY9A 5C7PA 2QFJA 2CQ2A 1GXUA 4QIFA 3FKBA 1UFWA 1Y5LB 3PO5A 5HMWA 3RRKA 2Y9HA 5IWAJ 1U6ZA 1S76D 1N33F 2VL1A 5B0CA 4JI0J 1I3OB 1XR6A 3GV7B 2KDOA 3MM5A 3FBEA 1C0TA 2DRAA 1QJHA 2KTQA 4ZPVR 2XWYA 2R9LA 3D5MA 2Y0SD 2XLJA 5CABA 3OVBA 3AJ2A 3DKDA 2ZC3A 2YQ0A 4OV6A 1HLWA 2AJFE 4NXMJ 3K5OA 4D3GA 2IRUA 4KQZA 3HSGA 4NXNF 1TL3A 4WXWA 3NNAA 2VV5A 1MWZA 3AJ1A 2QA1A 1U1PA 4Y2MA 3N6MA 2ILZA 2JHEA 1URNA 5DZ7A 3B4MA 5GMDA 3CD0A 1KR4A 1RKJA 2HAFA 4YQWA 5EN1A 4IOCQ 3RAQA 4OX9F 3JQKA 4BBYA 2U2FA 3KKFA 2HZAA 1CJTA 3OFEA 2XY5A 2OELA 4F0HA 4RPFA 3M30A 5C2CA 1SC1B 1F6TA 4GO7X 2MKYA 2WSEC 3CW2C 4FPIA 4Y2IA 3AD8C 2F5GA 4JI6F 4F36A 2C42A 3ZZ0A 1OY9A 4EMDA 2P9CA 5D4NA 3TUPA 2V2VA 4KH0B 1VC6A 1WOPA 5B7WA 3KK3B 5L46A 4C8OA 3KFWX 4PUOA 4K4ZA 4OLPA 5KFSA 3K2YA 4PPZA 3KLGA 4X62F 2OHDA 1S1UA 2OEKA 3BSCA 1VQSA 3TJ9A 2YKOA 4HR2A 1KDNA 2QA2A 1FKPA 1WKKA 1XMBA 4DR2F 3QWPA 4ATNA 3I55S 5IQQA 3R5GA 5U47A 3GZ7A 1T9XA 7FDRA 2OEMA 4FBTA 2WVDA 4KY3A 3A8IA 3M9NB 3K5PA 3QBCA 2VQEJ 1S6PB 2CPHA 2YNFB 3J7A1 1NDCA 4B9VA 5C24A 3MAQA 4I64A 3V81B 3IR7B 1UPPA 4E98A 4TU8A 4GRSA 3MUTP 2D7SA 3OBIA 3I87A 1TMJA 1HI8A 2KH9A 4AT1B 4DSFA 2W2PP 2CQGA 3C6UA 5IWAF 2CJQA 3WC2A 3POTA 4USTA 5J1EB 3J80Y 1RTZA 4PXBA 1RT4A 2EI5A 1RT2B 5ETRA 3LGHA 4YY3J 5E0OA 4DQPA 2H4WB 3EPGA 1GFWB
chains in the Genus database with same CATH topology
2CRLA 2JDJA 2JVRA 3K5MA 3PO4A 2FLOA 3MXHP 2LCWA 3R5DA 5J2QA 2NPIA 2YH0A 1DQ9A 1TKXA 4KRWA 3MECA 3CCJS 5KFKA 3CJ0A 1FTCA 2FGCA 3PFOA 4YOEA 1OIAA 2BE2B 2DGVA 2E44A 4M63A 5DQHA 2D1CA 4XPCA 1J5OA 1Z4UA 2FJDB 4XK8C 4F3OA 2V8HA 4RX6A 4ZLPA 4DEZA 3OJUA 1U1NA 3PV8A 4DV0F 4CO2A 5J2QB 1P8GA 3MECB 2KRRA 5KFIA 3KLIA 2VONA 1IUJA 2DHXA 4CO4A 2ZJQQ 2BV3A 2ZOFA 2HNDA 2EG1A 3QIPA 1RDRA 4X66F 4QIGA 2MZRA 1H3DA 3LH2S 5E5NA 4DR1F 3I0SB 3OXFA 1L3TA 5KFGA 3KLEA 4J5OA 3ZZPA 3QGIA 4F25A 2ZE2A 3E2EA 1F5AA 4ED2A 3B78A 2ATLA 1FRKA 5J2MA 3TO8A 3P96A 1M5HA 2IA0A 2X1FA 3TYTA 1FT8A 2PC6A 2AJQA 2JSXA 3QIPB 2NYIA 4QZVB 1SJQA 2JVOA 2IYGA 2PEHA 3W7BA 2KO1A 4XAKA 4I68A 1RKIA 4GKKF 3T1YF 2HQ3A 5KFRA 3OL6A 2I38A 1YSJA 1YG0A 3UDCA 4O3NA 1DLOB 2LECA 1WF1A 3J81Y 4YEAA 4O0IA 2HGMA 3LP2B 3CCMS 4RW7B 4FBUA 1SV5A 4OIXA 3F56A 4NYOA 4P2SA 1RYRA 2PSZA 2R7TA 3V4MA 3RW6A 2QO3A 2A3JA 3HHLD 2DNZA 4RBUA 4O3PA 1LWEA 1QVFR 2MZJA 5GAHU 1EP4A 1JMTA 3G4SS 1SC6A 4ZS6A 4BHQA 2AYBA 4E8UA 2ZH8A 5JVHQ 1CC7A 1ZM2A 4NLSA 2XB2D 4H4OA 2DHGA 4OX6A 4YUDA 5HP1A 4QWBA 3SMZA 4DDFA 4K4WA 3Q8RB 3MF5A 1SV5B 3IAM9 1BLUA 1KQFB 2K2PA 4BC9A 1CQMA 1FD8A 5KFCA 1SI9A 1NJYA 3OXGA 4C2MA 3KMSA 2PFFB 2XWXA 2XG8A 1EP4B 2RH3A 4MKAA 4NX9A 1QVGR 2UXCF 2AV5A 4P6QA 5AE1A 3EUNA 3FNNA 4HI1A 4CQ1A 2GQQA 4K4TA 4ZP6A 3OHBA 2CPFA 2LYVA 1KN6A 4H4OB 2DNHA 1V6HA 1S9GA 1UKUA 2V0NA 3CSKA 4IH6A 1YJTA 4PXDA 4CO3A 5DLFA 3R1LA 1HNXF 3PRBA 2E9RX 2DGXA 3T5JA 2F40A 1XR5A 4OFZA 5FDLA 5GADI 3DC2A 5J2NB 1HHSA 3HHKA 2KFNA 1X4BA 2DCLA 3D1HA 2IRYA 2F8EX 3FFIA 3TUJC 3MEDB 4MJKA 5IT9Y 3BREA 1H7WA 1FRHA 1WI8A 4DV5F 2E1AA 1JXLA 1O8BA 2MGZA 4A4JA 5GMKa 4F4YA 4DR5F 1KSPA 2C3MA 3LP1B 1ROFA 4FVMA 5EX0A 1DFDA 1FXDA 1S6OA 3OW2R 2UVWA 2ZKUA 2CQ4A 4OHYA 3N28A 3O2IA 3DI6B 5HROA 1N88A 1G3OA 2MQNA 4HDHA 3E3XA 2NPFA 3UNGC 3N5BA 3NAHA 4K4VA 4RNNA 3OVSA 1KS2A 4AXIA 3AH6A 2NLWA 2BW2A 3DN9A 2FUG9 1DQ8A 1N48A 3M6WA 2FC9A 2UV8G 1MNEA 5D6GA 1NK0A 3HLUA 3GSDA 1N5YB 1T95A 4DFPA 3MEEA 2RU3A 5D77A 4J9RA 4J9OA 3MR3A 2IBKA 1I6JA 2DNOA 3CCQS 1A6LA 3CPWR 2K7KA 2XMUA 1TKZA 5GVQA 4KHMA 3PXGa 2J7WA 3GMGA 5D4LA 3OLBA 3Q8QB 1U45A 2ZDOA 1TR0A 2HG4A 1Y4ZB 5CA5A 5EGYA 3IWXA 3M9MB 2WRMA 1H2UX 3BJYA 1R8CA 1PSDA 1WHYA 2R7OA 1JK9B 3Q22A 4G1QA 4KTQA 1CLFA 3HVTA 5KFYA 4ITSA 1T05B 1IKYA 2KXFA 2DGSA 2JX2A 1KOOA 1KFDA 2VFRA 3SSQA 4ETZA 3C46A 3RB6A 2YNIA 3MAHA 4EBEA 2AGOA 1TKZB 1Z2LA 2DH7A 2R2SA 2R2UA 5LMUF 3HVWA 2OPSA 1YJ9S 1HQEA 4LMZA 2FB0A 5B0FA 4DV2F 4MK9A 4ES1A 1RT6A 1QAIA 3HDSA 1HD0A 2WHOA 2LQJA 1RTHB 3HVTB 1SJ1A 1IKYB 1HI1A 1SIZA 2F9DA 3CWJA 3IFEA 2VQEF 4ID5A 2M9KA 4C4WA 2YWHA 4JI2F 1RTIB 5KFXA 3PX0A 3SI8A 3D0HE 4IG0A 1U7LA 2OPSB 2ZH4A 2KFZA 3LAMA 2R7WA 2HWIA 5LT5A 1HQEB 2DNNA 4IQMA 4Q7AA 1NK5A 4M8LA 1FD2A 3TNVA 1KHWA 2D3UA 1SBRA 1RT6B 2HHHF 2V4JB 4DS4A 1HYSB 4C3KA 1T03A 4QW8A 4ECYA 4ID5B 5KFZA 1NB7A 1WHXA 2CQHA 1JLGB 4I6YA 1FXRA 1P1TA 4K4XA 4AUKA 4WFZA 4N56A 4A8MP 1UEVA 2F3JA 4TYAA 3K59A 5EDWA 1WHWA 3NGKA 3I0RB 2A1BA 2LMIA 2W9AA 4FPRA 3BQ1A 1VHFA 3P3DA 2RB7A 4L3NA 2RE1A 1T03B 3ZZTA 4DV4F 5KT7A 3RR7A 4LIRA 3LWMA 2G13A 2VPZB 3G6ES 4NLQA 5EWGA 1I94F 2VPWB 1NH8A 1TFYA 1IQZA 2UZAA 3M6XA 1S1WA 4URQU 4UUWA 4V19J 3UDLA 5L39A 3G6XA 4OZLA 4USJC 4HL9A 3CC2S 3H5XA 2PT0A 3HHLB 4D3HA 3M2RA 3SSSA 3M2VA 4YR3A 2CVEA 3N6NA 3I82A 1LK5A 2VOOA 2QZ8A 4NLRA 3D28A 3H59A 4MKBA 3TA2A 1S0MA 1S9EA 1HBUB 2BM1A 2QYCA 4FNIA 4HTIA 3VALA 4YY3F 2IBOA 2KN4A 4BDPA 1TK0A 2CQ3A 1FJCA 1S1WB 1F9FA 4HDGA 1S0NA 4B9TA 1SUQA 1ZM4A 2RVJA 2ZH7A 3VR1A 3LGMA 3HZEA 1SKWA 4WCEQ 1XWLA 4MIWA 2ZH1A 3M2VB 1K73T 3GG0A 4RW6A 2B9WA 3GR0A 4X64F 5B0EA 1ZETA 1P6TA 3VZIA 4TYBA 5DDOC 3MM8B 3H4BA 2GHVC 1S9FA 5KFBA 1RJJA 1Q82T 1TKTB 1KONA 1OO0B 2FHJD 2IJNA 2BOPA 2FJEB 3MPWA 2AX0A 3DFEA 1HWIA 1SUQB 2B7CB 3J7YU 2MY8A 3OL9A 2DR8A 1N52B 2BRKA 3RR8A 4ED0A 4E0DA 2DPIA 1TV6A 2E5JA 3MTJA 3NLCA 5ITHA 1RQ0A 4I69A 4OJ1A 1LW0A 2BANA 1U26A 2K3KA 5CYMA 1BQNB 4PQUB 2HS4A 2ADCA 2OD6A 3AQOA 4LSNB 2L08A 3DYAA 1V3RA 3U02A 5FLXY 3FQKA 1J5EF 2ZDPA 3CDAA 2AU0A 3CD7A 4FF4A 1RISA 2IC3A 3N0VA 3OUYA 3VTIA 3RW7A 3TI0A 1NAQA 1U1MA 2H5EA 5D3GA 3UFCX 4X84A 2CPYA 2GJIA 3OTOF 4ZCIA 3CDEA 5EWFA 2I8EA 1FA0A 4CH7A 2KT5A 1KVIA 2DNQA 3LANA 2Z0GA 3SZ2A 3U1MA 2HHWA 3G8SA 1YTYA 2V2KA 2J0WA 1Q86T 5DG8A 3CB4A 3BGLA 4UOCA 4DQQA 1VQMS 2PE8A 1SJRA 2MY7A 5D3GB 4G3IA 4WYWA 1S4FA 1R7IA 3PR4A 2HVIA 2E66A 1NO8A 4QBUA 1GXTA 3DOKA 3DM2A 5F41A 3MM5B 1IKXB 1X4HA 3L09A 5D4PA 4AL5A 4BS2A 4ZCMA 1DTTA 1JJHA 2JEGA 3E01B 2BZ2A 2OPQA 3MI7X 4OI1A 3WDOA 3G6YA 4DBQA 2CQIA 1QLNA 4Y2AA 3M8RA 2HAIA 3UR3C 4NLVA 4C97A 2AP6A 3SFUA 3O5TB 2JEFA 1RP5A 2JZ5A 4PQAA 3IN5A 3CEDA 3M8PB 5C42A 1APSA 2BABA 3Q8PB 3AB4B 3I31A 3LUYA 1JLCA 2AYEA 2PD1A 3ZZUA 3BQ2A 2BDPA 3DOKB 3DM2B 3HVAA 2KFYA 2XCAA 4WZQA 2JL9A 1UAWA 2OPRA 2QT7A 2K3IA 4KKOA 1N5VA 5KOWA 3GILA 1PO6A 4R25A 2J0QD 3RRGA 1X4DA 3N79A 4NLYA 2JEJA 1QE1A 2IMOA 3THTA 2MQQA 3OV7A 3LP0A 2NQPA 5DETA 2ZH2A 2XNRA 1C0UA 1BGXT 2QA4G 3NNCA 2Z4PA 3LO3A 1TL3B 3CCES 4WU3A 3HX9A 3PW2A 1YITS 2HZCA 4DV3F 4PXEA 4LF5F 4KKOB 4BCAA 2CKWA 4L6V3 2J0XA 2B6AA 4I0WA 1LXJA 2QSFA 2FLPA 2A2DA 1T3OA 1AXQA 4KHPF 2KZMA 1QE1B 1VFJA 3KLVA 3LP0B 2X3GA 1FVSA 3GIMA 4DR4F 4N8OA 1PGZA 1FE0A 4PWUA 2XCPA 2IVYA 4M5DB 5K14A 5D4OA 4WFNQ 3JSMB 2EFVA 2PI4A 4RNFA 3MEKA 3MWBA 2B6AB 5B0BA 2J8AA 2XMKA 4ZVGA 1ZYQA 4C11A 2UXBF 3BF4A 5DG7A 2KM8B 2L48A 4TU7A 3D1OA 5GAHI 3NMRA 2KU7A 5L8RC 4NRTA 3NS5A 4IG3A 4I6WA 3E51A 2E1MC 4OZ5A 4ECVA 3TAQA 3D0IE 4DL2A 3DDKA 2NZ4A 1X5PA 1HWUA 1U2RA 5KFVA 4MYUA 2ZM6F 1MU2B 1RTJA 1N8RT 3DLBA 3J7Z5 3KMQA 1Z2ZA 2X51A 2LA6A 3MMCA 3MHYA 4DUYF 1MW7A 4RNMA 1SXLA 1RT7A 4QYZJ 2HFOA 2YKPA 4DX8H 5KFOA 5BR8F 1RTDA 4TY9A 1C4CA 2ZOMA 2LEAA 2DNYA 3M2UB 5GAEU 4KJIA 4X4VA 3M30B 4IG3B 3DLEA 1S48A 4K4YA 5F8HA 4I4BA 2CFXA 1KEKA 5DM7Q 2ROGA 4NA3A 2XS5A 4WFXA 2W24A 1SH3A 1R43A 2M4MA 2M5YA 2K7JA 3ONQA 5DM6Q 3CIZA 3A8EA 2HGNA 1C1BA 1JNRB 2MKHA 2PA8D 1RT1A 4A8OA 1RT7B 3SCKE 1S1XA 3R3TA 3DDNA 4NLWA 1FCAA 1VIOA 2XS2A 1YIJS 2MSTA 3TANA 2JFKA 1FDDA 2EFOA 2O67A 3DLEB 3K7RA 5CHCB 3DRPA 2WOMA 3DOMA 3NCPA 5E41A 4Y65A 3CCRS 1A7GE 4Q5VA 3M05A 4R0JA 4UQGA 2HNZB 1S77D 4NLOA 1VBXA 1WG1A 2MKKA 1S99A 3PR5B 2L9NA 1ZAWA 1FKOA 1S1XB 4OZ1A 4JOUA 3THPA 3VCDA 4QWAA 1OPZA 3B82A 2FJVA 3CMAS 1AUDA 2ZH3A 3T5KA 4C8NA 2VBYA 1S72S 2N82B 3DRPB 1IKWB 4JBCA 4G1PA 4OI0A 2E1RA 3H2UB 2VKZG 3OR1A 2CPZA 2OFHX 3OQ2A 4WK3A 2VFUA 3LPYA 3OFHA 5D78A 1JLEA 5KT3A 4F4XA 2I0XA 4ZPWR 2UUAF 5E3RA 4MH8A 4OX7A 4Y2CA 1FKOB 2FC8A 4F3MA 2HWHA 2R8HA 2LQ5A 3IO1A 2CPXA 2RNEA 2GIRA 4RWXA 5C25A 5KG2A 3OJSA 1IN0A 1YJNS 3HF5A 4C3LA 3S7RA 3JTPA 3VAJA 5LXYA 4WKRA 5T41A 5H9EJ 1FEEA 3OR1B 4OQJA 1KTVA 2KT2A 2MKSA 2FJAB 2P9EA 3SEOA 4HKQA 5KFMA 3DLGA 4N5SA 4B3TF 4X4OA 2MKIA 2OSRA 3ENWA 1JLEB 1BD6A 4URSA 2R8GA 2PI5A 4DMZA 2PA3A 2R7QA 1OWXA 3JSRA 5IS2A 1QSSA 2WAQD 2FLLA 2V5HG 1OPIA 1Q1KA 5T7LA 1FF2A 1VBZA 5DGAA 4OHWA 1HNVB 3JSYA 4PWDA 3GWCA 3N6LA 4LFBF 4IO9Q 4HTJA 3PX6A 2JLEA 4IDKB 4PG4A 4J37A 2C2RA 1NNDA 2J76E 3KG4A 5MLCV 3DLGB 2FJBB 2XI3A 4YB5A 2Q43A 3D1QA 2J6SA 5K8NA 1UVNA 3RB3A 2WTFA 3H40A 2YKQA 5KFNA 3LOUA 2MHEA 1ULRA 4NOHA 1K1QA 3MCSA 3RAMA 3IS9A 2UUBF 3H4DA 4Y28C 4X4NA 2GO9A 2M52A 3G6VA 1KNZA 4QJVA 1NK7A 3KOAA 4ZCLA 5C24B 3PX4A 1YRTA 5A6PA 4MIAA 4OJ3A 1WF2A 3I5CA 2Q1LA 1FNOA 4ZMMA 3FEYB 4IKAA 4PXCA 5E3PA 4B3OA 2QA4S 3EXCX 2BQUA 2EVZA 1F5BA 3IS9B 4F4WA 4EBCA 2FVRA 3V6KA 2HGLA 4B17A 3QZ8A 2P6TA 3DHXA 4FXDA 5G4DA 2NUHA 2IAJB 5CH7B 2MQPA 2HHUA 1C1CA 3QPIA 2HNYA 5KOXA 4CCHA 2AYGA 1UL3A 1VQ7S 3P49B 4Y3CA 3HP6A 3KLFB 1R3NA 2BRLA 4WFYA 4ED8A 3L7PA 3HHLC 3NCRA 5J2PA 1FK9A 1X5SA 3C6UB 1HR0F 1ZAVA 4ES3A 2RD5C 5HQ8A 4DSEA 2WB4A 2Q6CA 4RW9B 1GNKA 3OTEA 3H5SA 4KIAA 4N41A 3PW0A 4OZNA 3FRYA 2XY6A 3DLLQ 2HNYB 4HHJA 3T19A 4DFJA 1SJ3P 3UCUP 2DR7A 2M3DA 3VAKA 4IFVB 2HHQA 3ZC4A 2W7AA 1X9SA 5FIIA 2VFVA 5KG5A 4G6VB 2ZH6A 3T6JA 5EUHA 4ILMA 3KWMA 2VD3A 1CPZA 2ZUGA 2CJ9A 2BVZA 1RT4B 1FK9B 4QR1A 1ELOA 3ISNC 1ZZNA 2GC8A 3OR2B 2CJBA 5D8HB 4GO5X 2POKA 3MURP 1PILA 3EX7B 1GQEA 1UVJA 4ZHRB 5FJ4A 2MYFA 3KHHA 3L3CA 4Q43A 1N6QB 4OJHA 1LXNA 3KK1A 5AE2A 4EZ9A 2V94A 2AQ4A 2E7WA 2APOA 1NKBA 2YX7A 2KZZA 1TKXB 4MAKA 1X4AA 4NYPA 2MKJA 2MKCA 2W25A 3CTRA 3FQLA 3FZBA 1QAYA 4Q44A 4JI7F 3P6YC 2VODA 4I67A 3RRHA 5I42A 1V3ZA 2XSJA 3VQSA 2HPUA 2AF6A 2GMLA 3HHEA 5E33A 1FVQA 2AJ0A 5JXSA 1UJ5A 2DBBA 1XEZA 4MK7A 4NLUA 4USIA 4HYKA 2C22A 2VQFF 1HBOA 1KLNA 1N5TA 4ETXA 3V5RA