4A4JA

Crosstalk between cu(i) and zn(ii) homeostasis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
69
structure length
69
Chain Sequence
AQTINLQLEGMDCTSCASSIERAIAKVPGVQSCQVNFALEQAVVSYHGETTPQILTDAVERAGYHARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the Role of Zinc and Copper Binding Motifs of Trafficking Sites in the Cyanobacterium Synechocystis Pcc 6803.
pubmed doi rcsb
source organism Synechocystis
molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE PACS
total genus 17
structure length 69
sequence length 69
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a4jA00
2XMTA 3CJKB 4YEAA 2XMUA 1YRXA 1FE0A 2GO8A 2VV5A 4ZA1A 1R6YA 1JK9B 2VH7A 4OJ3A 3TOQA 2BJDA 2K1RB 2LQ9A 4HL9A 2W4CA 3I9ZA 1TL5A 2AJ0A 1YJVA 3HHLA 2K7KA 1P8GA 3LGNA 3LGMA 4Y2KA 2OAUA 1KVIA 4YDXA 5T7LA 1OPZA 3CJKA 2ROGA 4EFAC 1XBWA 1JWWA 3T9NA 2FTRA 1ULRA 3MZIA 2FHMA 2L3MA 3E8OA 3BGUA 2N7YA 3GZ7A 1SI9A 2IYIA 1Q53A 2ROEA 4F67A 1K0VA 1V3ZA 2K2PA 2XMJA 1X8DA 1N5SA 5KAKA 2LQBA 2IFXA 1Q8BA 2JDJA 2RILA 2RU9A 4QOTA 3QGPA 5B0CA 1Q8LA 2N4CA 1U7LA 2OD4A 3IWLA 3KKFA 4OIXA 5B0FA 5A6PA 2OFGX 1AW0A 1KVJA 3DXSX 2K1RA 2RSQA 4DL0C 1X7VA 2HLTA 1CC8A 2XMVA 3HDSA 1SQEA 1SB6A 2OP5A 1YG0A 3HFKA 1OSDA 1S6UA 4Q2MA 2BJEA 2ZDOA 1MWZA 2GGPA 4OJHA 1OQ3A 1Y3JA 4ZOSA 2XMKA 2W4PA 2AP6A 1FE4A 2BYCA 2XMMA 1WD6A 4FNIA 1FEEA 5A6WA 3HHLB 2KT3A 1RJJA 1Y3KA 2HFOA 2HFNA 1FVSA 2OKQA 4A47A 3DCAA 2IYGA 1AFIA 4HI1A 5B0BA 1YJRA 1S6OA 2BBEA 1AFJA 5F0UA 3IWXA 3KNGA 1Y0HA 2QLWA 4FNHA 5F0WA 3FRYA 3LO3A 2QLXA 1Q4RA 4DPOA 5B0GA 1VQSA 3HX9A 1FESA 2OMOA 1W2IA 2GGPB 4Y2MA 1CPZA 2FIUA 1TL4A 2LDIA 3HHLD 2CRLA 4Y2IA 2K7JA 1TZ0A 2ROPA 4HI2A 4OJGA 5B0EA 4NPOA 3BM7A 1YJUA 2QIFA 2FB0A 2GFFA 2ZDPA 5B0DA 2HIQA 2KYZA 1IUJA 1KQKA 1N5VA 3BB5A 3BF4A 1APSA 2GA7A 2HLUA 2W4DA 2OD6A 2GV1A 2PD1A 3KG1A 1GXUA 1TR0A 2N4DA 2GCFA 5B0AA 1Y9OA 5B09A 3BDEA 4OJ1A 1MWYA 3BR8A 4HH0A 5B08A 2OFHX 3FMBA 2RMLA 1GXTA 4A4JA 3BN7A 2ACYA 5K9FA 3QMQA 2ASYA 2KT2A 4A48A 3UDCA 1FVQA 1QUPA 3FGVA 1FD8A 3TRGA 3TNVA 3HF5A 1CC7A 1YJTA 4A46A 1N5QA 4HH1A 2QYCA 3WDOA 2KKHA 1X0PA 2HQIA 4Q2LA 1P6TA 2AW0A 2LXFA 2Q3PA 2PGCA 2XMWA 5T7LB 1URRA 2G9OA 2BUNA 3K7RA 4NL5A 3VTIA 3HHLC 5IXUA 2EW9A 4U9RA 1N5TA 3MCSA 3KG0A 1LQ9A 3F44A 1TUVA 1OQ6A 1VQYA 4DN9A 2AJ1A
chains in the Genus database with same CATH superfamily
3CCWA 1V5VA 1NSKL 4AXJA 4LF5J 4RNHA 5KFQA 3TOQA 4DV0J 2W01A 3GIIA 2DHSA 2LQ9A 3UNYA 1JJ2R 4PWDA 3I9ZA 1Q0NA 3Q8YA 4RU9A 1N33F 1EKSA 4MH8A 3J81j 2GMJA 4DUYF 1VDHA 5KOXA 1FDDA 1L3SA 4RW8B 3CIMA 4NA3A 2GW8A 5U47A 4CNZA 3C14B 3K5PA 4CRJA 1W2BR 2BQ3A 2ZJRQ 3IR7B 4KB7A 5ETRA 4C0BA 4NX9A 4FS1A 3HI9A 1GT8A 3TARA 2J0WA 4FZVA 3OVBA 4J90A 1FA0A 4MT1A 1FRIA 1X60A 2HSEB 3EXYA 3MUTP 3Q23A 5EUHA 4IDKA 1U47A 4RW7B 4HKQA 5A8RA 1TKXB 1P9QC 1FKPB 1GMWD 2RU9A 5HLFB 1RK8A 3NY0A 1DQAA 2MTLA 5MLCV 3NGTA 3G2XA 4YB5A 2FC8A 1V9OA 4KGVB 5D4PA 1S1UB 3OL8A 3SZ2A 4DV2J 1WDTA 2V4RA 2Y8YA 5KG7A 2KI2A 3M8PB 4FVCA 3NS5A 4PUOB 1VR6A 2BRKA 5I3UB 4DG1A 4DBQA 3H98A 2NSCA 1QJHA 1HA1A 3MECB 4OX7A 4OZJA 5C5JA 2XGPA 3O5TB 5L39A 2DISA 5CH7B 2QG9B 4DR4J 5J2NB 4ES2A 2ZH9A 1XR7A 4Q8FA 2ZBRA 1FDAA 1FF2A 2LVWA 3EDQB 1CVJA 2I8EA 2VKRA 4X64F 4MIBA 4UY8T 1YVFA 3IS9B 3ENQA 1WHYA 1NKBA 4JI1J 2XI3A 4PZVA 2VICA 4IRCA 3O8WA 1J5EF 2ZNYA 4DL4A 2V8GA 3V6DA 1NJYA 4NCBA 4NCGA 2MQQA 1CJKB 1FO1A 4UTGA 4NA1A 1C0TB 1RT5A 3DOKB 4FKXA 5HMYA 3SCLE 3RAQA 1HW8A 1HKAA 2HFSA 3LP0B 1U0HA 2X3GA 2AYMA 4ZPDA 1YZ6A 2FGOA 4F0HA 2GJIA 4USJC 1FDNA 5G0RB 3KJVA 3ILJA 4QYRA 4YB7A 2ZH6A 2VG5B 2E5LF 3CCTA 4P74A 5D8HB 4ANEA 4J37A 3D6TB 3R6LB 1EARA 3P45B 4C97A 2K7JA 2MY8A 3CD7A 1RXOB 3DNCA 1RT2A 3BH7B 5B0DA 2VQEJ 1E6YA 1RAJA 2EPIA 4NWBA 2FD2A 3TAMB 2BM0A 2J9CA 1QE1B 3QZ8A 1RWPB 4ECQA 2AD9A 2X7IA 3IBCB 4KV8A 1YQHA 1SPBP 2LEPA 1XK8A 2QSWA 1T9YA 4RW4A 3M9NB 1JLQB 2XGQA 1JLBA 4LRAA 1KD1T 4CP5A 3BPDA 2ACYA 1T7PA 2XS7A 2WB1D 3MHYA 1DAXA 3PACA 3DLHA 2QA1A 1C4AA 1YJTA 5E3QA 4ZVHA 4AUKA 3SFUA 3SV4A 4RW4B 2I1RA 2DNLA 2HNYB 4LVNP 1FFWB 3VF0B 5AE2A 5LOQA 1T0TV 3DDKA 4TYAA 5C25B 1WC5A 1Q1KA 2EVZA 2DNMA 2O3DA 3DRYA 1RWOB 4YN3B 4MKVA 3SXLA 1RCXB 1N5TA 2FHOB 4ZDNA 3A8KA 4C8KA 3NNAA 2VOOA 3LP2A 1TK0A 2V63A 2R7QA 3TVZA 1SL1A 4BS2A 4A8QA 1RAFB 1TL7B 2OUGA 1UPPA 4QW8A 2HHPA 2KL8A 2MKHA 5I42B 4NCAA 1U2CA 5LJ5Y 2AT1B 3Q0AA 2UXDJ 3OHAA 2AJ0A 3CCMS 2HURA 2JNJA 1SQGA 2K7KA 4H4OB 5IZHA 2E29A 3GIMA 3EZ5A 4FYWB 4B9MA 3Q2TC 5M2RA 1K73T 5HO4A 3DLGB 4OX6A 1N32F 2QL9B 4KBIA 4KRWA 2VQEF 2BOPA 2EFGA 3MEDB 1EHWA 5FLXY 5KFEA 1S1WB 2MQ8A 3UDLA 2LKZA 4WP3A 2VQFJ 1HNVB 4N8NA 2OSQA 2ZJQQ 2IVFB 5LM7E 3IMQJ 5GAEI 4ILMA 5BJRA 1UWBB 1Q5YA 1WF0A 2RS2A 1IBKF 3FSYA 3T1AA 5B0FA 3TZWA 3WX4A 3D3CJ 3H4BA 3PO4A 4FKYA 4PG6A 4IRKA 3QBCA 2HHSA 4CH1A 1F6TA 4PAAA 2U2FA 4UW2A 5ETOA 5T41A 8RUCA 1UAWA 4DV4F 2NYIA 3UD5A 3BYPA 5ITHA 3OSPA 3MPWA 2QL7B 3NCPA 4LFBF 3A12A 1FJ7A 3KLFB 1RBLA 2VPZB 3D3BJ 5MAOA 3MFHA 3D1QA 3K57A 1DFDA 1JNZB 5EX0A 5KFVA 4FP9A 4AE5A 4ECZA 3C6TA 1KTQA 1VI7A 2AP6A 2F5GA 4ANDA 3TW0A 3FCHA 3HULA 4RUAA 1RJJA 4J9QA 1G6BA 2HFNA 3G6XA 2VPXB 3MM5A 4LF7J 1X4EA 1YJWS 2BR0A 1AFIA 2P8IA 2QX0A 4PXEA 1SKUB 4YHHF 1NM2A 2C2ZB 2JVOA 3HKWA 4KQZA 1DQ9A 4LSNA 3BEGB 5HSPA 4MKYA 2NSBA 3LP1A 4P72A 4JP8A 1RLCL 2QSFA 3I31A 3OTEA 2Z2ZA 3QT5A 4FF3A 2NLWA 4LREA 2FZGB 1TFYA 1F5AA 3NP5A 2W8LA 2FGCA 1WACA 3UN2A 4ZIVA 2N7CA 3PEHA 2R7WA 2ZD1A 1BQNA 3PX0A 1RAHB 4ED0A 4FXVA 1NUEA 2CRLA 2D41A 4OFZA 1MU2A 1T11A 1HBNB 1WDDA 2CJBA 2CQIA 1RHUB 3GYGA 3ITHA 5B0EA 1YJUA 4DF8A 2HMIA 4YOEA 1VRTA 3HP6A 3BKUA 3DLEB 4NOHA 4I6WA 4P73A 2ZDPA 3QIPA 2MKIA 1UVMA 4WXOA 4WTOB 4DV3F 3ENAA 2OIHA 2QRRA 3RTVA 1JJCB 2PO4A 4DSFA 1SC3B 4KT0C 2M8HA 3W2WA 2W4DA 5KFWA 4AL7A 2ASJA 4NLGA 4DR6J 4K4VA 3QGGA 2HAFA 2HQDA 1HIYA 1P1LA 1ZM3A 2YX7A 3D4JA 2AZ3A 3M9MB 2OFHX 4CQ1A 2VA3A 3IA0A 2VC1A 1S5ZA 4UY85 4MMOA 1BY9A 2B56A 2J9EA 1RHMB 5H1SV 4DR3J 2HKEA 2GZOA 5IWAF 1T05A 3IG1A 3P4UB 4DN0A 4LF8J 3VHQA 4X84A 1IKVA 3HVAA 3PY8A 3R5BA 5IC4B 2WVEA 2HVZA 4USKA 3W8PA 1LWFB 2LQJA 4LF2A 4ES3A 4X66F 2RH3A 3FEYB 1KFSA 4OI2A 3K7RA 4DLEA 1O5JA 3M8ZA 1SJ1A 4LF6J 3LPEA 2FJAB 3EVMA 4MKAA 4WXWA 4Z37A 4J9RA 1HBUA 2VFUA 3TA1A 4TU8A 4ZCIA 3MMAA 1UTAA 2L9DA 2H4YB 3HLUA 3V5RA 4Q7AA 3JAMU 4IQMA 5L1KA 4G6VB 4CLFA 2VONA 4NASA 2CPJA 3EZOA 2K1RB 5HN0A 1MLAA 1S4FA 1TL3B 5GMKa 2ZZMA 3A4TA 3FDSA 3ZFVA 4DR1F 1JLGA 2JJ4D 2ALYB 2E1MC 2PMHA 2QN6B 1IKWA 2C3YA 4M5IA 4Y0FA 2DNOA 1RT1A 4WIQA 1TFWA 1KHWA 4WPAA 3GJTB 5LL6d 3HJVA 2FHJD 4IG0B 4ZCMA 3RB4A 1OPZA 2W2OP 3GMGA 2YNIA 2E1PA 3I5AA 4J7CA 3ZNJ1 4EFAC 3OJUA 1RGVA 1IN0A 4H4KA 5L1LA 2XSJA 2Z4PA 5HBMB 2CA9A 4I7FB 3ELHA 3K59A 4OI0A 1QDUB 1NJZA 2XMJA 1UVNA 2VBWA 3OTDA 2D3ZA 3M8SA 2C2RA 4MFBB 2YPZA 1X5SA 3BSAA 1NDKA 1N5YB 5I4MA 1SL2A 2BJ1A 2D69A 2HWHA 1RAAB 4OIXA 2AQ4A 4UF4A 4B3SF 2XB2D 4LSLA 1N34J 4FYDA 2EC0A 2WTFA 3QT6A 1X7VA 3A8JA 3MOJB 4O3NA 3IP0A 3JAMY 3MEEA 1EZZB 5D6GA 4ED5A 1PSDA 1NMEB 1XERA 4IO1A 3PR4A 4Q2MA 2FVSA 3C16B 4EU0A 2LQ8A 1HWJA 3HVTB 2W4PA 4JOUA 4DG1B 1YSJA 3PW4A 2UUTA 2XZWA 3G6ES 2ATCB 3E3XA 1DTQA 4H4MA 3S8SA 3DOLB 2XO6A 1UWBA 1S72S 5IV4A 3M8WA 5LMNF 2QJ3A 3RGIA 5DJBA 4P7VA 2IDEA 3C8YA 2GJ2A 1I5OB 4ZPWR 2PSZA 1U1NA 1AT1B 2DD8S 2HS4A 4L3NA 5RUBA 2OPRB 1J27A 1NH7A 3TYTA 1HNIA 2DIUA 4DS5A 4LF5F 2C2EA 4AXIA 5F8HA 2GO9A 2A18A 5DGBA 1B7FA 3W5XA 2NREA 3OPKA 2ZH3A 2IRYA 2XLKA 2OEMA 2P9CA 1OIAA 2OPSB 2FIUA 4Y2IA 1NK5A 1YRUA 1TVRA 2ROPA 1R7IA 1CJTB 1TZ0A 3BKTA 2JFDA 1RWNB 3QQCD 1YBTA 5IS2A 1DRZA 2FLNA 3NKYA 5ETKA 3NRBA 1PAUB 3FUYA 3X3UA 5FDLB 4ECVA 2MQMA 1I1GA 4Y6IA 4LVOP 3GIJA 3ICLA 3THVA 1UEVA 3HSZA 3M8QA 3BB5A 4CIOA 3A3OB 1FNOA 4R25A 4JI2F 1LNQA 3KG1A 3MURP 1JIHA 3IBWA 1K9MT 2JRSA 4RW6A 4C48A 2RQCA 4DV0F 2QLFB 3TEHB 2OH2A 1CS4A 4J5OA 4ELUA 4JV5J 5F8JA 1HPZB 2O01C 1NDPA 3FMBA 3PXGa 1UVLA 2KG1A 1K0TA 2C42A 2ZHOA 2CNKB 1AA1B 1MW7A 5K9FA 3TP2A 4CLZA 5CYJA 2XY6A 3TVYA 2X1GA 4EBCA 2PIIA 1VQ5S 2XTJP 2FY1A 4DQSA 1KKHA 2AEMA 2AU0A 4GKKF 2KO1A 3ET6B 2CQCA 1U6ZA 4FYXB 4NLPA 2XLIA 1S97A 1S7HA 4PRFA 2XO7A 4I6YA 3OXFA 2MGZA 1HR0J 4G1PA 2M5YA 3ISND 5HQMA 4JYAJ 4IH6A 2QFJA 3ET6A 4YR3A 4AL5A 3MMCB 4Q44A 2BE9B 3WIVA 1S57A 2NCKL 3DHWC 5KG1A 3M4XA 3W5YA 3ZZUA 4CTAA 1CLFA 2YH1A 3MCSA 2AYGA 2IDLA 1EQMA 4X65J 5JJBA 1F9EB 4LQ3A 4PQUB 4Q0BB 1S48A 1GQEA 1P9YA 3I5BA 4F04B 4W92B 1WJ9A 3KLVA 3M8RA 2CJKA 1WOOA 2JEFA 2L48A 2GO8A 4P2SA 3VZIA 2M70A 4DZ6A 4RNFA 3RBDA 4V19X 1QSSA 2BJDA 1ZOTA 2GIRA 2ZEJA 1T03A 1HNVA 3LP2B 2A0FB 5JVGQ 1IJEB 1KVIA 2CPDA 5D4OA 5L8RC 2WBRA 1SBRA 1ZS6A 1M0SA 3D54A 1NCLA 1WEYA 2IYIA 3ETOA 3F0NA 4QWBA 4DR1J 3NMAA 4LF8F 2XSFA 3VALA 3LQVA 2D7SA 2NQPA 1RAIB 1KVJA 1HLWA 1S9EB 2VG6B 2CDRB 1SV5B 3OSNA 2E1AA 2FLOA 3KWMA 4BC9A 4DWIA 2IFXA 1BD6A 2V4QA 2C22A 3CSKA 2MKYA 3KUEA 2N4CA 1S6QB 3QPIA 2ERRA 1WC3A 2Z8QA 2B4OA 4F3MA 5A6PA 3IS9A 4LF6F 1R6VA 1NPKA 1AW0A 4BWJA 5C42B 3WHIA 3DOLA 4ZCKA 2MDAA 4N77A 4K5SA 5KFHA 2IJNA 4NLVA 3M32B 2CVEA 2OO4A 2IIHA 2Y8WA 3CCUS 1EKRA 3VR1A 2DVIA 1HQEA 2GGPA 3IR6B 2GHPA 4LRFA 1OQ3A 2PEHA 3CEDA 3EE3A 1DHMA 2CZ9A 4YB6A 3H5XA 2F4FA 2BYCA 4K0KF 1K1SA 1KSPA 1FEEA 1AZSB 2DXFA 3R97A 3TO8A 4DFJA 4NE9C 2JWNA 4GKJF 1X9WA 4KC5A 1FD2A 1RB0A 2M52A 4Q8EA 1M5KC 2Q43A 2JEGA 1HQUB 1YJ7A 4O3OA 4DQIA 3CCZA 3D1OA 4XDCA 4MYTA 2H1YA 3TWZA 5B0BA 3MM9B 2BQRA 1AFJA 2L9NA 2Z2LA 3TUJC 4FS2A 2F3JA 3PX4A 3SFGA 1Y00A 5AXLA 3MEEB 4DV3J 1IKYA 1PBAA 2W7PA 2CJYB 5DDPC 1FESA 3J80U 4GVBA 2NZCA 1HD0A 1WI8A 2RNEA 3EVWA 4K5RA 2HG4A 4PWUA 5C2CA 5EHHA 2MZJA 3GJSB 2NXNA 4K4XA 1H6KX 2BANB 1UJ5A 2XEXA 3OW2R 5KFCA 5EN1A 3A13A 3EICA 3F56A 1VBZA 4KJIA 2UXBJ 4O4GB 4Y2CA 1RBAA 5K14A 5KG0A 1RWMB 4N7TA 1SJRA 1UL3A 2V69A 3PIOQ 2MHEA 1KQKA 1PBUA 2RF2A 2JFKA 3HZEA 3RBXA 4B02A 2W1BA 3W5ZA 5J1EB 3CJ5A 2ZVIA 4YFUA 1KFDA 2V6AA 3DOKA 4DHVA 5DGAA 2VPYB 1VHIA 2ZC3A 4Y65A 5HP1B 4A8FA 1G4CA 4OJ1A 5F8MA 3BR8A 3NGRA 5EDWA 4C2MA 1D1UA 1VQLS 1VJWA 2M0GB 2RRAA 3PHTA 3MGJA 1WG5A 1JLGB 5CAAA 3AOAA 5KFXA 3UDCA 1HMVA 3FGVA 3BQ1A 5M2UA 4ZLNA 1O8BA 2KJWA 5E3RA 1A7GE 1RA7A 2PT0A 3HF5A 3MAAA 3TNVA 4AD6A 3D28A 2PEBA 4GC6A 4OYWA 3VAGA 4KSEB 4DDFA 2X1FA 2DK2A 1WF2A 4QIFA 3FBCA 4ZN3A 2K06A 4DSLA 3CDAA 3EGNA 2FLPA 1U09A 2AJ4A 3CC4S 4LUBA 1R0AB 3TX8A 2IAJB 4G65A 4ANCA 2PN6A 1U1MA 4DQRA 2V9KA 1NJIT 2OJ3A 5CCLA 2DPJA 2PMZD 5SZTA 1QAXA 3KJFB 4TU7A 4RUCA 2HIYA 2DXEA 2N3LA 2G2ZA 3N6NA 4F4YA 2FHJA 1MROA 2K3IA 2YNHB 2VQFF 4EMDA 2B6AB 3NGDA 1ZA2B 1W7WA 4OZ3A 4ZVFA 1TL5A 3H2VE 4ID5A 5A8KB 5F3ZA 3KYLA 4CLTA 4CO3A 1MMDA 2BRLA 1F3VA 1AUSL 2AF6A 4Z7CA 3PG9A 2HK2A 4JI3J 2IY5B 1XNRJ 2X1AA 4KO0B 4RR5A 2DGUA 3W2WB 1VBKA 4TKTA 2Q6BA 1SV5A 5DQIA 2ZH4A 1EQ0A 1MG7A 4DUYJ 3VQTA 4C4WA 1S0VA 4CO4A 2CPEA 3ZC4A 2DO4A 4CLYA 1K8AT 4DJBA 3A8EA 4QOTA 2AGOA 5K8OA 3DM2B 1PAEX 4DR6F 1RTJB 2OPQB 1HBOA 4M5NA 4OI6A 2E5IA 2YNFA 3KMQA 2YBVA 4DUTA 2HLTA 3B6BA 2IM0A 3EZUA 3N6LA 3CF5Q 1SQEA 3BGRA 4JI0J 2QA2A 2Q66A 3J7A1 4FXWA 1H7XA 1SUQB 3AOCA 3N6MA 3G96A 1HI0P 1RU1A 3KLFA 3SEOA 4OZ1A 2R9LA 4Q5VA 3MM5B 3NWRA 3GFZA 1FCAA 2W9BB 1DTTA 4RU2A 3AXMA 4YP3A 3HKZD 4DV6J 5H9EJ 1HARA 3MMBB 2BV3A 4ER8A 4GO7X 3CO9A 4PXDA 2C2DA 2Z56B 4OYZA 2F7VA 3H59A 2RDIA 2AHOB 3M05A 3M2RA 5ETTA 1YBUA 5LXRA 1RT3A 4NYOA 1HWIA 2QLWA 3HT3A 1FWLA 3C6UB 3DI6B 4M5KA 2MKCA 5A8WA 1BMQB 2EFOA 2MKSA 4DZDA 4F7VA 2XYGB 1N56A 1FNXH 4C8LA 4K2JA 3JSYA 3R5JB 2COLA 1JJHA 1S77D 2CQGA 2YVSA 5HP1A 1JLFA 2CVIA 1RHKB 1TUWA 4OHVA 4WBFA 4ATNA 4PG5A 4CYUB 3EYZA 3V6KA 1SJ3P 1CPZA 4JV5F 1XR6A 2VBXA 1IR0A 1ZTTA 3I32A 1RTHB 3D9BA 4K8RA 3EDRB 3W8GA 2XWXA 2XWYA 4A8XA 2G2OA 2W25A 4PXBA 1FDBA 3MD1A 1ZM2A 1FTRA 1RAEB 3THTA 4WU3A 5KFMA 2QEXS 3CXCR 3UD3P 1SKWA 4I2QA 2HW3A 2CQ2A 3CCLS 2HZCA 1PJ5A 1U2FA 2C3OA 3V6DB 1HWLA 2AKWB 5J1NA 3OVSA 1TR0A 1TVRB 2VDIA 2WCXA 3H25A 3AJDA 1RYRA 2B3TB 5B08A 2ZFHA 3F73A 2BXJA 1NRKA 2NPIA 1JKHA 2QA4S 5DDQC 5HL7Q 1WOSA 4JV1A 3D66A 4H4KC 1HD1A 1FVQA 5J2NA 3LH2S 1I94F 2E9RX 4C7QA 1S1XA 2VC0A 1FXRA 3OFHA 3BO2A 2E5GA 2FZCB 2UUBF 1CC7A 2VDHA 2JEIA 1SCJB 2MKKA 2QA4G 4QYZK 5T7LB 4NRUA 1M5PC 1URRA 2G9OA 2VIHA 1IBMJ 3HHLC 2Y1IA 3PJWA 2VA2A 5J2MA 1PYTA 3EGWB 1GMWA 3Q8SB 4FPRA 1RWXB 4UOHA 5CD4A 1VQKS 3W61A 3HSGA 3CJKB 4KY3A 3OUYB 1F1BB 3BS9A 5KFIA 1FE0A 4F4ZA 3P6YC 2IMOA 4BBYA 2KM8B 2ZHAA 1TL1A 2F63A 5C42A 1Z2LA 2E5HA 5KOWA 3R2DJ 1FXDA 4PXCA 2MB0B 1UFKA 1B0VA 2Y1RI 2IJFA 2FVRA 3J81U 4IKAA 2VG6A 2H54B 3EM1A 3PRDA 1VK3A 2DGXA 3UCGA 1MSWD 5F8IA 3TUPA 2A2CA 4PQAA 5ETQA 1RCOB 2F4VF 2YKAA 3NWGA 2CJ9A 3KJQB 4X4RA 4O4GA 1WC0A 3LUYA 1L3KA 5HAOA 4DFMA 2KXFA 2RILA 1JLFB 4BCAA 4CYUA 1PJ6A 2CG4A 4ILRA 2R2TA 3MAHA 2ALZA 1RADB 4B3TJ 1GH8A 1U7LA 3IAM9 4IG0A 3H2LA 4RL1A 3OFGA 3O6QA 4TXSA 4DL0C 3A3PB 2UV8G 4ELVA 1EIYB 3GQCA 1S9EA 4PG8A 5KT3A 1T94A 4ZITA 2GC8A 4DSJA 4JI5F 1MNEA 4C3MA 2NS1B 4Q43A 4H54A 5F9LA 2A6OA 2XM3A 1RT5B 5LMUJ 1S6UA 2D1CA 2HPUA 1U25A 3BREA 3MI7X 3MM9A 4CTAB 5KFDA 1I6JA 3BDPA 2UXCJ 2YQ3A 3EVOA 3NL0A 4I4BA 1RT7A 2WOMA 3VVTA 5E41A 4J9LA 2MXYA 1VQ4S 3FCWA 1Z2ZA 5JXSA 1RHJB 3FBFA 1VOMA 1FVSA 3OD2A 1C4CA 4USTA 5A2QY 4X4OA 1U4BA 2OTLS 4OHWA 5IM0B 5IT9U 3M1VA 4MK9A 5DS7A 2D3O1 1LK5A 4USWA 3AQOA 4M5MA 5J1PA 3QAEA 2IJRA 3HFVA 5AJ3J 1KS2A 1TV6B 4ZVPB 2NXJA 3MECA 2ZBPA 1UJ4A 1KONA 4WE1B 5F0WA 3VAJA 2CYYA 2QLXA 4DV7J 2UXDF 3L3CA 4NLUA 1AUDA 5IQ6A 5HANA 1V6HA 3OFFA 4A8OA 2WZ1A 1RTDA 1YX2A 2DNYA 3MPYA 2JEJA 3I87A 3T19A 3AFGA 2G0CA 1X4HA 4O3SA 4TLQA 2DNHA 4C8YA 1Y5LB 2VFVA 4O3PA 3QJJA 3MF5A 3SSRA 3BM7A 3TA0A 1E6VB 1IJFB 4B9NA 3WIUA 3RU0A 5GAGU 2YKMB 4CLPA 1L3TA 1F9FA 2UUCF 6AT1B 4LF4F 4P2MA 3TI0A 2OPRA 4K4TA 1UWAA 4HHUA 5CZXA 1Q7YT 4LMZA 5FJ4A 3KLEB 3MXHP 3M30B 2RD5C 3KLIB 1X4BA 3ITHB 4W4MA 4ITSA 1S0NA 2H51B 1VCTA 4HH0A 1U24A 2UUWA 4RW6B 3CMES 1F5CA 4PYDA 4ETXA 3KLEA 1N33J 1Q7LB 1IXKA 1XN9A 5BYSA 3RRHA 2R7XA 2UP1A 2LCWA 4DQPA 1FD8A 3TA2A 4K4ZA 4WFZA 1X4DA 3D0IE 4XO0A 4CDIA 3ZZRA 3M2RB 5LSOA 4RPFA 1SH0A 2QV6A 1LFPA 4GC7A 2CQPA 2HQFA 3CJ8A 4NLYA 3MM7B 4LF7F 2DR8A 1FT8A 3AOBA 3CDUA 4ZVSB 4JV0A 3C46A 2M4MA 2VBZA 5KFRA 1U1OA 4C8MA 3BQ0A 4OZ0A 1MROB 4KKOA 3L7UA 4FYYB 4L6V3 1CQNA 4FPIA 3UN3A 4DN9A 4USVA 4LBIA 2R7VA 4QPTA 1GX6A 3QLHA 4CO0A 3QIDA 2A6MA 3QO9B 5IT0A 1YTYA 4WKYA 2IAJA 2BDPA 2XSJB 2ZH7A 1CULB 1WSRA 3AB4B 3R7BB 2W4CA 3B8HA 2W2NP 1HBMA 2HBYB 4P9SA 1M5SA 3KK2B 1NLKL 4ZJQA 4NLWA 2FHKA 2DGOA 2V5HG 5H9FK 4FBUA 2E9ZA 2WBMA 3C16A 2PA8D 1S4EA 3DRSB 2C3UA 3MR7A 1VRUB 1ICEB 3HHKA 3CPWR 1Q53A 4F67A 1K0VA 4ZPTR 4FF4A 1SXLA 2YNGB 3FSIA 3BBBA 4P2XA 2Y0SD 2WSFC 1TMJA 4IH7A 3BYRA 2HNZB 2CFXA 2F9DA 2LQBA 1VQ9S 2VOPA 3PKMA 5HATA 3CJ2A 3E01B 4USUA 2LDYA 4JI0F 3MUMP 3FFIA 3IGNA 3QFWA 4DV1F 3OT9A 4WU2A 4DL2A 2DYAA 3IWLA 1R0AA 5HROB 2CPXA 3PW2A 2M2BA 4KHPF 3MR5A 2K1RA 4ZP8A 3OTOJ 1X5PA 1NH8A 2QL5B 4K2XA 4J9OA 1ZZNA 4X4UA 3HDSA 3IC1A 1JLAA 1KNZA 5F9NA 2OP5A 4OZNA 4WYWA 5BXIA 3GPAA 5DG7A 4WTYA 5KFLA 1OSDA 2J0XA 3KNAA 3P3DA 1MWZA 1R8BA 2GVZB 3M8PA 4OYPA 4C0OC 5CCMA 4B3RJ 1AZSA 1UW9A 3PJ9A 3GILA 4JI8J 2C3PA 2XMMA 1W26A 4OLPA 4ZCLA 5IC6B 3SQOP 3KHGA 2IM2A 4IQXA 2CKWA 2BABA 2KT3A 2J7KA 4L76A 4QIEA 5JUMA 2YX1A 1JLCB 1PC5A 1NK8A 2KT5A 3O1LA 4QCLA 2V94A 4A47A 1R0BG 1G3OA 2B4VA 2DT9A 2J7WA 3I6PA 5KG5A 3MR3A 4HLBA 2R2UA 1YJ9S 1HQ2A 1FKPA 1UJ6A 1T05B 1OYEA 2RT3A 2JLFA 3GR0A 1VIXA 3IWXA 3IAS9 4OZLA 3RW7A 1IBLF 1HYSB 1R89A 2CPHA 4IFYA 1QAJA 5D4LA 2HRTA 4M1KA 1JLCA 3EWGA 4CH7A 3UR3C 3RRGA 3C14A 3IWNC 2RRNA 4XIUA 4MIWA 2G13A 4OZ5A 4TQRA 1NSAA 4F4XA 1OJ4A 1L5UA 2LDIA 4MK8A 4JI6J 1OY6A 4YMEA 3M2UB 4UOFA 2MZ1A 3G9CA 1IKVB 1JNRB 2VFRA 5KFKA 1HNZJ 4LFCF 4Y34A 4N41A 4DR5F 3D0GE 1IBLJ 4FVMA 3TUZC 2YQ0A 1WHVA 2KYZA 3NBPA 1RTHA 4BC7A 1I94J 3HHEA 5EGYA 1J2VA 1NDLA 2YQ1A 1L3VA 4URSA 2ILYA 1BWEA 4K4UA 4QWEA 7AT1B 1GXUA 5DZ7A 2ZD1B 4OYBA 2QYGA 1M90T 1JLEB 1TKTA 2L08A 5B09A 2MZQA 1S9GA 2MHNA 9ATCB 2OPPA 4LJMA 3VGUA 5KFOA 3KK1A 4KGKA 1HI1A 3DI6A 2RMLA 1GXTA 1D09B 2B9EA 2PC6A 3EUNA 1GTEA 2GQCA 4GO5X 1U0SA 3QSIA 1X4AA 3T1YF 2CQ1A 3Q8RB 3VAKA 1ZETA 4TN2A 5ETVA 4OYOA 4IR9A 2HVHA 4USHA 3H0PA 3AJ1A 3UD4P 4ES1A 4NXNF 5K8NA 3C19A 3WDOA 2KTQA 4PG4A 2VU5A 3BBFA 4URQU 4WFBQ 4HTIA 2DO0A 2XMWA 2GAHC 2PGCA 3PCOB 4F26A 4OV1A 2BUNA 2BJ8A 5GAEU 2AWZA 2J0QD 1YJNS 4X64J 3ZXWA 2BMBA 3VVUA 4OMFG 3C6UA 3R8YA 3DRSA 4NLSA 4ED3A 4B3OB 2I0XA 3QLHB 4M5GA 2LP4A 4KTQA 1G2EA 2KRRA 2RHSB 3LWMA 1R6YA 5J2QB 4JI7J 4OYIA 1VQPS 1S1WA 3HD2A 3VGTA 4CT9A 5DDRC 1MMNA 2QLBB 1HNXJ 5GMDA 2HWTA 1YJVA 2Z57B 4R0JA 2LEAA 4F0MA 5DETA 4G3IA 2F1FA 1C1CB 1WUUA 3PJXA 4M5DA 3TJAA 4TY8B 3W9JA 3OHBA 2DGWA 1T8EA 3D0HE 4KPYA 2OEJA 3DKDA 3I5CA 4GKJJ 2CDQA 2IPOB 3D5MA 4LF4J 2XMAA 2CPIA 3H8YA 3FRZA 3CCQS 2ZKUA 1N36F 4DR7J 3DC2A 2GNKA 3GIRA 4OLOA 1HW9A 3M9OB 3M7VA 3MPUB 3K58A 1S9GB 4TLRA 4U7UK 1PJ7A 4I64A 1BHNA 3DLEA 3FVYA 2EKNA 3T41A 1RTIB 1XMBA 2Y0BB 3G87A 3ZTOA 4X4PA 3K2YA 4KR0B 3DRRA 4FN5A 5B0CA 4ILLA 3P8BB 2AJQA 3M6VA 3K5OA 3Q8VA 3SBMA 2RB7A 3SSQA 4MK7A 1PC4A 3V81B 3W9IA 3NS7B 3K5NA 3PX6A 1FKAF 1XIQA 4C11B 3QT8A 5FD1A 1YITS 3L4BC 2KN4A 3K8VA 4HT5A 4ZPCA 4KO0A 1KLMA 2QTWA 2B0GA 2CNNB 3DRRB 3H20A 4LSNB 3R7SB 2HAIA 2HS0A 1UFLA 2MY7A 5D4NA 2ZWOA 4DCPB 1WEZA 2F40A 2C2MB 3B82A 4Q0BA 4EK2A 4DSKA 1RABB 2HFOA 2V68A 3R27A 5JVHQ 3N79A 3OLAA 1FX4A 2CG8A 2MZTA 3C6TB 5GADU 4EBEA 2BKNA 4ZHRA 1GMUA 2G4BA 1CBKA 1QE1A 2C2NA 2ZUGA 2YKNA 3DU5A 2BE2A 1ZZFA 3LW5C 1CQMA 5F0UA 5FIIA 4IOCQ 1Y0HA 1IQZA 3M1VB 2V8DA 3ZTSA 1HNXF 4I56A 1UEKA 4OQJA 1EX8A 1JLBB 1HWUA 4M63A 2M3DA 1JXVA 3HX9A 2MJNA 3VWSA 2CPFA 4DPXA 2ZH2A 4QW9A 3OXLA 4K7QA 4WE1A 3QGHA 3LF0A 4J9SA 3HHLD 1B0PA 4YS2A 4WP9A 1S1XB 4F4WA 1SVDA 2XLJA 4NEZA 2ZNZA 1XMQJ 3TANA 4V19J 4G1QA 2O5DA 1VQ7S 3PEJA 3NLCA 4YQWA 1NU4A 1XMOJ 4LFCJ 3HJFA 3R2CJ 4XAKA 1S0OA 2H5EA 1QTNB 4J91A 4HYKA 1S6QA 3EJMA 3E51A 3HHDA 4OYAA 4BWMA 4WK3A 5C24B 2PD1A 5KT2A 4F4KA 4B9VA 3DMJB 4GKKJ 5M2PA 3BBCA 3UN5A 1Y5IB 1S0MA 3HPOA 4B3TF 2QT7A 1KHVA 3W66A 4MFBA 2FJXA 4K4SA 2VJUA 2JC1A 5C7PA 2V2VA 1RKIA 4QWCA 4LRBA 2HHHJ 2Y1LB 4QZVB 1GK8A 4HACB 4QJVA 4OHYA 5KT4A 2V2ZA 1SJQA 1QUVA 2DGQA 1HBUB 2KHDA 2LA4A 4NMLA 3FC9A 4DOZA 1GTHA 2C28A 2KJVA 1RAGB 3UI3A 3PVXA 4AL6A 2ABYA 1FRXA 3GE9A 4I69A 5KFAA 4ENOA 1FI4A 3KDOA 1XC9A 2VG5A 1FK9A 2AMCB 1ZM9A 4M5HA 1VK8A 4ZVGA 3VGSA 3CJ3A 4U9RA 4OI1A 4UZBA 2BE2B 2D3OR 3QJPA 3JSMA 4DL7A 3M2UA 3SDEA 1R3NA 3DRPB 3JTPA 4F3QA 2DNRA 1C1BB 1RQ0A 2BW2A 2I5JA 1RYSA 2FVPA 2DTJA 2KFZA 2DHAA 2F4VJ 2ZVSA 3BZQA 3HZGA 2HQ3A 3BSNA 2LECA 1ZH5A 3A8IA 2I5JB 3SSSA 5F3TA 3TX0A 3ZZYA 5A8RB 1JLQA 5T7LA 2CNOB 1R8HA 3CCRS 4C9DA 2CIMA 4P71A 3RAXA 3GJQB 2HZAA 3OTBA 1LW0B 3FQKA 1BQMB 2RUSA 5CA5A 3HK2A 2R3VA 4B9TA 2BZ2A 2C2KB 3BGLA 2GS8A 4BHQA 5JMNA 3CTRA 3OVAA 4E98A 1S1VB 2F8MA 2EFPA 3AT1B 4NYZA 3CE8A 2VASA 2C1EB 1NEEA 2ZE2B 3M8QB 4DSEA 2E7WA 2ACMA 2AIRB 2OFGX 3D1HA 2OMLA 4LSZB 1K44A 3V6JA 3FNNA 2ZM6F 4PCQA 4V1Ak 4PABA 4O23A 3D7SB 2B5JB 4MIAA 5AE1A 2HHHF 1S76D 4U6PA 1RWVB 1SH3A 1D9FA 2UUAF 2A1BA 4RBVA 4RW9B 4FF1A 3Q24A 1RTDB 2CZ4A 3BGOP 3VZHA 2ZH5A 2BJ7A 5ETNA 2G0IA 2ASLA 2FQQB 4ZOSA 2XMKA 3KLGA 4ZLPA 2J6SA 3K8WA 1WC4A 4KHPJ 1BQNB 3L9ZA 3D67A 4LFAF 1SUQA 2YWGA 2H48B 4HTJA 2JSXA 8AT1B 4R5PB 5E5NA 4DV4J 2BJ9A 1VYAA 4ZLJA 3TJ9A 1KN6A 1PCAA 2ZBCA 3IGVA 2CAJA 2Z2MA 3MMBA 5CZVA 3T1YJ 3A1YG 2DRAA 1BE4A 2Z2YB 4ZVQB 4WFYA 4RNMA 1IBKJ 2C2OB 2PI4A 1BXNA 1UKUA 4A8KA 2JLEA 4TQSA 2APOA 4EYIB 3AQPA 2AV5A 2I6WA 4R5PA 4DMZA 5DM6Q 4WK1A 4K4YA 2AGPA 1URNA 3EGZA 2I9SA 5KFPA 5G4DA 4QYZJ 2MGZB 5CXTA 4HI2A 4KFBA 3SI8A 1ZBTA 1NJXA 1EP4A 3BPSP 2RQ4A 4IDKB 5KFTA 1M1HA 3TAQA 3JB9k 4NEYA 2DB1A 3RG6A 3CIZA 4ZJLA 3H7HB 2O1PA 2W9BA 1VMBA 2R8IA 1VQNS 3UO0A 3MM7A 2HNDA 3T5JA 4R8UA 4N76A 1G1XA 2OPSA 4O0NA 5AJ3F 1Q5VA 2FC9A 3HD1A 3OJSA 2UVVA 3NNHA 3KG4A 2YH0A 2R8JA 2B5JA 4RW8A 2GIQA 3I56S 3W9HA 2ZM6J 2EEYA 4DV2F 5ADZA 3PNIA 1TL7A 1YRTA 2RQKA 2HZVA 3CMAS 5IV3A 2XY7A 2JL9A 3J80Y 4ZVEA 2EFNA 2VB6A 2W7OA 1NKEA 3OR2A 1FJCA 4J9MA 2L9WA 2YPYA 3L95X 5DZ6A 2MMYA 3KLGB 1B7YB 2HRUA 4OX8A 5D78A 3CCES 3ILOA 2R7TA 4HH1A 1DTQB 3CJ4A 4LRDA 2HHWA 3A3NB 3U1MA 1P6TA 3G8QA 4JB8B 3V6HA 3GFXA 2Y1JA 2DJWA 2HRYA 3JSBA 1SC6A 4DV5F 3NG8A 3ZZOA 3KLHB 3OBIA 2BKOA 5F41A 2XBPA 1T02A 2BACA 2XQCA 3UCZP 3T5HA 1D9AA 1X9SA 2GVDA 4NLTA 3PTWA 1HNIB 2KDOA 1IUJA 2QFIA 3NS6A 5AXKA 5K5MA 2PMWA 3S6EA 3LAKA 3ZNUA 1HL6A 4ZA1A 4TU9A 3AD9C 4ID8A 3ZO7A 1R8CA 2OEKA 1PGZA 2OTJS 5A8KA 2FJDB 3SCIE 4HL9A 1TTHB 4YDDB 2V2QA 4CO5A 4D3HA 2B8PA 2DGTA 3CJRA 1S49A 2JX2A 4HR2A 5D3GA 2FVQA 3UVJB 2DH9A 5IT9Y 1B64A 5HQLA 1XBWA 3MEGA 2HNYA 3I55S 1O6XA 3FEXB 1Q16B 1FK9B 4EWTA 5HBMA 1FWKA 3G4SS 2N7YA 1LXJA 2EBGA 5D0GA 5L1IA 5E3CA 3QRRA 1UMJA 1HMVB 4X4TA 1YGYA 4I67A 3AA8A 2GHVC 5DDOC 1DBDA 1JB0C 4L3KA 4RO0A 3N5BA 3MEDA 4AFFA 1Y4ZB 2JDJA 1C1BA 3UQSA 1OPIA 2D3UA 4JI4J 3TR5A 1R31A 2QMXA 2BKPA 2YWHA 5J1EA 3BO4A 4O44B 3CMQA 2E1CA 2RSQA 4C8ZA 4U96A 1P1TA 1KTVA 2Z30B 4PEOA 1VRUA 2XMVA 3IFEA 2KRBA 2YKOA 5HROA 1UPMB 3GIKA 2QLJB 5I42A 1E6YB 4NCGB 1U48A 3LGHA 1J5EJ 1SJ4P 3HFKA 1T9VA 2M7SA 5DRKA 3CJTA 4CI0B 4JI1F 2CQHA 1WSVA 2Z58B 1SL0A 4RZRA 2CPZA 2YNGA 2KM8C 3SIPB 3T6BA 2DEJA 3PV8A 3CDBA 3M6WA 3UFCX 5AXMA 3CB4A 2ZOFA 5HVGA 3LP1B 3DCAA 2LU2A 1KOOA 1FRLA 4URGA 4I68A 3DLLQ 1TKDA 1BLUA 1HWKA 1S6OA 2BANA 1EJ7L 5HI7A 4RKUC 1RLDA 4B3MF 1DURA 1YDLA 2PE8A 1MN7A 1GNKA 4ALZA 2H5IB 3CWJA 2VD3A 2DHGA 3KXDA 4P75A 4Y3CA 4Y2MA 1IBCB 5BYQA 4WCEQ 2OLWA 2F8HA 3DGPB 1RUSA 2CJXB 4DS4A 4DQQA 3CJ0A 3JQKA 3L09A 2GFFA 2HQCA 4HDHA 3WX8A 1D0EA 1HHQA 3OLBA 1WC1A 2EK1A 1YKWA 3TUIC 4JI8F 3OV7A 1S1TA 2GA7A 3R5GA 4K4WA 3R5CA 2IMWP 2GV1A 3OL7A 1OS5A 1U6BA 1MMLA 4ZVOB 2EC2A 2W24A 3POTA 1Y5NB 1UETA 4DXLA 5J2PB 1MWYA 2UUBJ 3AA9A 3IRXA 4F2SA 2DHXA 3C3LA 1TKXA 1TMMA 5HLFA 1FX2A 4EEYA 2VG7B 5LMNJ 1V5IB 2V9WA 4DSIA 5C2GA 4DL3A 2EG2A 4N47A 3MMJA 2AX0A 2RUGA 4X4SA 2EKYA 3TRGA 4DX6A 3UPFA 1CSJA 1RWKB 4QU6A 2EBEA 4RWWA 2V67A 2LA6A 4QIGA 3W2VA 5IFMA 1HBNA 2AYBA 4DR7F 3LA0A 2HQIA 5A76A 2E7VA 2R8GA 1TAUA 1NPPA 2RKIB 3CJSA 2YKMA 2VG7A 2YNHA 3VTIA 1F5BA 4QIWD 3MM8B 1LFWA 3T6JA 4NZ6A 3KG0A 4CO1A 3F44A 5LT5A 5HVHA 3FEZA 3EPGA 4W98A 4EZ6A 2G2YA 1NK0A 1UA1A 2XMTA 3J7YI 3JSRA 4ECWA 3D6FB 3QZ7A 2VV5A 3M8YA 4C3LA 2UXBF 1JK9B 4OJ3A 3KK2A 1D9DA 1M5VC 1C0UA 5DQGA 1SKSA 4C0HA 3ULHA 2HNDB 1HNWF 2IRXA 3ENWA 4X65F 1IQTA 1UZDA 2CQ3A 2FY8A 2Q79A 4Y2KA 5I3QA 1P8GA 5A8WB 2C3MA 3DYAB 3KJNB 1YHQS 1PO6A 4NI2A 2HHXA 4BDPA 3DGVA 3TZZA 3O3LA 2NPFA 2FTRA 3EX7B 1FFSB 1RT4B 4ZHRB 2BE7D 3AH6A 4I0WA 4TY8A 3BGUA 1NPRA 4RW7A 1OY8A 4IRDA 3DYAA 4WJBA 2WVFA 2F9JA 2DR9A 3MR6A 1YZ7A 4NXNJ 3GFHA 1XQIA 2J76E 4O3RA 4UUWA 1HFEL 1G7CB 5LSRA 2W9CA 5HQ8A 1QVFR 3UR0A 4ZIWA 2DKOB 3D6MB 3UE2A 4YY3F 6FDRA 3R1LA 5ETLA 4PUOA 1HI8A 3W63A 1SQFA 4DR3F 3Q22A 2PI5A 4ELTA 4PWDB 1YK9A 1NJWA 1EAYC 2AJ2A 1F2HA 3GV8B 2HVEA 1GXLA 1CEZA 4LF9F 2RKIA 3RYLA 4LR8A 1H3DA 1S1TB 2DNNA 5E7OB 5IQQA 4GVBB 4QPXA 1CJTA 4H4MB 3DOMB 5EWFA 3KLIA 1FRHA 2XYHB 5KFYA 2ZH1A 4ZLLA 1MN9A 1Y3JA 2QGFB 3G6VA 2MQNA 1L3UA 2UU9F 1WD6A 3I0RA 3DLKA 3SMZA 1SC4B 2RIJA 3PRBA 2G0JA 2B7BB 2KFYA 4DR2F 1GFWB 2CADA 5KG2A 2IYGA 2EXUA 2RHQB 3UWTA 2EK6A 2WRMA 3EGVA 4ZN1A 3NAIA 4PG7A 3KHLA 2GX8A 2YWFA 5CYQA 1HQUA 4DPTA 2BBEA 4HVZA 1NKCA 2HVIA 4UUXA 1Z1ZA 1DY3A 2E9TA 3NMRA 1FXLA 3QRQA 1H38A 4K0KJ 2W2PP 2WW8A 3RRKA 3NBPB 4N56A 2MSSA 2P6TA 2OMOA 4CH0S 4CCHA 2GGPB 5HMZA 5GAHI 1KRPA 4HDGA 4OHXA 3JSMB 1VJQA 3WZ0A 3FZBA 3NCQA 2VPWB 1UP1A 3TAMA 4FXDA 1VS3A 4NPOA 1WG4A 4NMXA 1N36J 5CYMA 2J0SD 1YI2S 1N0VC 2FB0A 2ILZA 3S1TA 4LQ9A 1R8AA 1JKHB 3VAIA 2D9PA 4ED2A 2H5JB 4B9LA 1B70B 2HIQA 3FJ2A 4LF9J 4B3RF 2AEJA 5SUHA 3SCJE 1H72C 4M5JA 1N5VA 3D6HB 1I3OB 5DM7Q 1N32J 2V8HA 3BKFA 4U8VA 2ZWPA 2O66A 4ECXA 3BDEA 4CLLA 1IKXA 3OTOF 3SDEB 4DR2J 3ETMA 4OHZA 3W60A 3H42A 5B7WA 4JBCA 4X62F 4NYPA 1VRTB 2W2MP 1NB2A 3U7JA 4IFVA 4A48A 3KFWX 1NK9A 3MMAB 1MU2B 3DDIA 2WB4A 4J9VA 2DY9A 3EXCX 4ETZA 1JLEA 1F60B 1TKTB 1OSCA 2QE5A 3CW2C 1U1LA 1T9TA 3RBZA 2M9KA 3GLJA 4K50A 4NLDA 1QSLA 1SIWB 2GHWA 2V34A 4L75A 4M94A 1RT1B 1LWFA 1RE1B 2IHR1 2EW9A 2JVRA 4IFVB 2ASDA 4B3SJ 4O3QA 4AYBD 5BR8J 2BJ3A 3WQPA 2DPIA 3Q8PB 1S79A 1HR0F 1RT6B 3GYNA 4KHRA 4X4VA 3FSXA 3V4IB 5LXYA 3VCDA 4DX7A 3DXBA 4YEAA 2FLLA 3PO5A 4DU8A 2FYXA 3KDNA 2X1BA 3E01A 1CULA 3IO1A 2VH7A 4DEZA 2XS5A 2ADBA 1H7WA 4E2FB 1IKWB 2HNZA 3QO9A 1TK5A 1S59A 4UQTA 4HT7A 1H98A 3P5TL 3HM9A 1TL3A 3DN9A 4KFBB 5KFUA 3GV5B 1HHSA 1LWEB 1WEXA 3DDNA 2OAUA 5HJYA 4DX8H 2F8EX 2V4JA 1MWQA 2CZVC 4YDXA 3CJKA 1RWWB 1JWWA 5HMWA 4ZPVR 2MZRA 1SI9A 2GMLA 2DNZA 4IH5A 1XWLA 2VKZG 2JC0A 1QM9A 4EUVA 1RA6A 2P6SA 1N52B 1V3ZA 4USMA 2HMIB 2HFZA 5KAKA 3DM2A 4CWBA 1GX5A 1UZHA 3BH6B 3KK3A 2WVBA 1FERA 2E5JA 3PYEA 3ONQA 3OL6A 4JI3F 3CCVS 4JI2J 1HQEB 1T9WA 1WKLA 2YKNB 3OR2B 3QGPA 4OZ2A 3GV7B 3VAHA 4KGMA 1NXIA 2DCUB 3M32A 3AAWB 1H73A 2YNFB 3OR1A 2J8AA 1CC8A 2BA9A 4DL5A 1SB6A 1LWCB 2P5VA 1H74A 1RTIA 4P2FA 1K1QA 1ZPWX 2ZKTA 4PKDB 1NSQA 3NOCA 4J9PA 1S10A 3TZYA 2CQBA 4U67Q 1JXLA 3G8SA 3DLBA 4X4NA 3I4HX 4OJHA 2IBOA 1NHVA 2B6AA 3I9V9 1T95A 4LIRA 4WKRA 4N8OA 1U8WA 2XHCA 1VIOA 1LEOA 1RACB 5D0HA 4CZCA 4QWDA 3QSYB 2DRBA 4DL6A 3W64A 5CHCB 3T5LA 3SQGB 2OGUA 1Z4UA 1CG2A 4LR7A 4DUZJ 4JV2A 1BQMA 3FRYA 2IVYA 3I96A 4DPYA 5L46A 5A2QU 2UZAA 1KWMA 2AZ1A 4DLGA 2UU9J 1H2VZ 3O2IA 1NO8A 5LJ3Y 1W2IA 3AJ2A 4YY3J 1PG5B 3Q86A 1NZ8A 4K59A 1EP4B 1AXQA 5ETPA 1XNQF 4Z2XA 4AQYF 4Y00A 4FF2A 2LXIA 5HMXA 1B3TA 3ISZA 5BR8F 3SYZA 1RT7B 2WOMB 3BQ2A 2YWWA 3OQ2A 2WSCC 4ICLA 1KVKA 4ED6A 1N4LA 2NZ4A 4EGLA 3MMCA 2SXLA 2HGMA 3BF4A 3GJRB 3GP9A 4ZVTB 3IRWP 2HLUA 2ZITA 1WC6A 2KFNA 2W8KA 1UCNA 1VC5A 1RBOB 3MCNA 3L7PA 2GCFA 2HGLA 4HHHA 2FDNA 3B78A 3HMJG 4J9NA 3CC2S 1N88A 2VFTA 5KFGA 2J6UA 4E0DA 2P2CB 1REGX 2CQ4A 2DY1A 2D9OA 2OPPB 1JX4A 2R2RA 3QMQA 2JLGA 2ASYA 1T9UA 2KT2A 2ZE2A 3MM8A 3QT7A 3JS9A 1KLNA 1TP7A 2V8PA 5T14A 2I2YA 3RR8A 2NYHA 4IR1A 2YWKA 1Q86T 2FUG9 1S6PB 3ZTQA 4TY9A 4LFBJ 1BC6A 3TEGA 4TVAB 2GJFA 1N6QA 1J5OB 3V4MA 3DLGA 1R27B 1HHTP 2I38A 1LW0A 2MPUA 4NLQA 5K14B 1HNWJ 1GMVA 4H4OA 5C25A 2R7UA 5IXUA 3E2EA 2PFFB 1LOUA 1WHWA 1WOPA 4A8YA 4CLSA 3I4PA 4JI4F 2HFUA 3RAMA 3QWUA 5E2QA 2HBQB 2MZSA 4KH0B 5J2PA 2CQ0A 5E33A 3NEKA 3O44A 1AB8A 1TELA 1NBEB 3DRXA 3N28A 1H2UX 4C3KA 3GSIA 5KT7A 1IR2A 4MYUA 4YB1P 2JHEA 4PPZA 1KOHA 4P6QA 1PKUA 2HVDA 3NOGA 3HHLA 1YLXA 4KGZB 5D77A 3ISNC 4ZVRB 3G71S 1WKJA 1ROFA 1TK8A 1XJWB 5DLFA 2G1DA 3IN5A 2XYPB 4ERDA 3WC2A 2ROGA 1NSPA 3T9NA 1WNEA 2CPYA 2OHDA 3GR1A 2L3MA 3MM6A 2KVQE 4ED7A 1NDCA 2HBZB 2R7OA 2KH9A 3BJYA 4F2RA 3IM8A 4ZP6A 2Z0GA 1VQMS 1BWVA 1S12A 1Q8KA 2ZH8A 3CULA 4FBTA 1N54B 3SCKE 4I2PB 4ECRA 2XS2A 3PYDA 1N0UA 1T9XA 1ZAVA 2OD4A 1WWHA 2V4JB 9RUBA 3T3FA 1OYDA 4P7TA 4EZ9A 4WFXA 1U0HB 4I2PA 3HVRA 3CCJS 1ITPA 1X31C 3J7ZT 1TAQA 2PA3A 3MDFA 4UZCA 1J5OA 3R6GB 2VF3A 1OMSA 1YG0A 4LSLB 1U8SA 2KVIA 1WTBA 3N9UC 4DCOB 1XR5A 3PW5A 1B4SA 3R1HA 2HHQA 2CWKA 1RKJA 2MLXA 2P9EA 2M8DB 5GVQA 3NXZA 1FKOA 2GQ2A 1X4CA 4XK8C 1NHUA 1R43A 1A6LA 3PM9A 4U7CA 1JLAB 2W2QP 1R8PA 2EWHA 3KJVB 2JH3A 2E5LJ 1FHTA 5LMUF 1BUXA 3MPVA 4O4RA 1D8YA 4LT6A 3G8TA 2NUUG 2OI2A 1Y7PA 4LIWA 1UA0A 3W3SA 4A8SA 3K17A 1ZAWA 1WF1A 3HSJA 4XPCA 3R5AA 3OFEA 2F65A 5DQHA 2B4UA 2Q6CA 3DMJA 4FNHA 4ICLB 3U02A 3LO3A 1QAYA 3T5KA 1JQGA 3ZZTA 3QJLA 2LU1A 3V2UC 1BGXT 3LWLA 1VHFA 1YWXA 2DHHA 2LXUA 5F8LA 4JYAF 1IKYB 3I82A 2IC3A 1OY9A 1TL1B 5H9EK 2DH8A 5GAHU 4BLGA 5E3PA 4RLEA 3X1LB 2KYXA 3T1HF 1CJKA 2ZOGA 3HCXA 3VAMA 3GU0A 3J7AN 1YIJS 4DF4A 1QVGR 2UVWA 2HEKA 5D3GB 1WELA 3RUBL 4X62J 4ZS6A 2UUAJ 2XNQA 3THPA 3MD3A 2J5AA 3MPDA 5J2MB 1HPZA 3K89A 4PPDA 1KLMB 4QU7A 3GB0A 2FPHX 2XZTB 1S1UA 4OI3A 4B3OA 2V0NA 3UDEA 4IUFA 4XTTA 1Y9OA 1P27B 5KG3A 4AT1B 5K8MA 2MQPA 2DGSA 4FYVB 3J81Y 1IM4A 1CJUA 3GWCA 2A3JA 3R9LA 4PYAA 3BN4A 3DFEA 4DUZF 3CVKA 3FMWA 3NAHA 4X66J 1CS4B 1TU0B 1U26A 3IXQA 3W2VB 2NXEA 4Y28C 4F50A 4ECSA 3CDEA 1Q82T 2ATLA 2V8VA 4IYQA 5EX3A 1QAIA 4NLOA 1RTZA 3Q8UA 5LSLA 2GMHA 1X0PA 4Q2LA 1PYSB 4CLUA 1TKZB 2GVDB 2LXFA 4YR2A 4JI6F 2R2SA 1LKZA 1RDRA 1WHXA 1RHRB 5KFZA 3CDWA 5KT5A 5DG8A 2RU3A 3EMTA 4KYZA 1U02A 3B4MA 3ENVA 2MJUA 3POTB 3CCSS 4Q45A 1TUVA 4KIAA 3UCUP 4Y2AA 4B9SA 2NR0A 4EI2A 3M6XA 2H3EB 4PR6A 3CJQA 2H9ZA 2HHTA 3HSDA 3JYTA 3PIPQ 3B4DA 2DH7A 1O51A 4QIVA 1CJUB 3G86A 4NA2A 1VC0A 1KR4A 1NHKL 1TV6A 1UEUA 1V3SA 1VRQC 1X5TA 3TQEA 3VGVA 5KTQA 1U1QA 3LGMA 3LPYA 4B08A 1VC6A 2XNRA 2DXDA 5K8PA 1X9MA 2KZZA 1O0PA 3DLJA 4RUBA 4CM0A 1LK7A 4CT8A 2FHMA 2VHGA 1CJVA 3DU6A 4X2BA 3QNWB 4R8UB 3GZ7A 4RBTA 1FNMA 2HS3A 4QR2A 1R0CB 1N34F 2PDAA 2NXUA 2KB2A 2NUHA 1X8DA 3RW6A 4CLWA 4L72B 4B3MJ 4EO8A 5L1JA 3AD8C 3LOUA 2DRDA 1RT6A 4JI5J 4QQBA 4WZMA 5EWEA 1RP5A 4ZP7A 4NI2B 1V3RA 1ZM4A 1VLOA 3DXSX 1LXNA 4M8LA 2ZBIA 5L38A 3BGRB 2E7XA 1NB7A 2UVUA 2ADCA 1U1RA 1ZTWA 2YKPA 3GG0A 2YX4A 5IT4A 4QWAA 4RJVA 2ZJPQ 3AODA 1WI6A 2XULA 3MTJA 4DV6F 1XMOF 3M2VB 4IG3B 4X4QA 4KE5A 1IVZA 2BVZA 4HACA 5H9FJ 4I7FA 4USIA 1WORA 2HFVA 2HK3A 5G0RA 3SQGA 3MAAB 3RBEA 1FE4A 2G1HA 2MYFA 4FNIA 2IC3B 1ZYQA 1F3FA 1RSCA 3Q8QB 3H90A 2IA6A 3H5YA 2OKQA 4N5SA 1VBYA 2NXCA 3FFIB 3QFHA 3P49B 2DNQA 4R0EA 4A8WA 3MWBA 4DR4F 3AB2B 3CO0P 1YJRA 1LV5A 4O0IA 2DR5A 2R8KA 2N82B 4UQGA 1OO0B 4IFYB 1Y11A 1WG1A 2GAGC 1LWXA 3QWPA 3H4DA 2OELA 1Q4RA 4G1QB 2CUYA 4WIIA 4U7UD 2J7UA 3ILLA 3AY0A 5KFJA 3B54A 2WVCA 2XHWA 1T3NA 2UVRA 1SIZA 1FJGF 3GCXP 1RZMA 2QMWA 4CO2A 3U27A 3AXKA 1KQGB 1S9FA 4DPUA 1H2TZ 2DR6A 3GCWP 3PFEA 2DNGA 5CYMB 1FWPA 5FLXU 1DJ0A 3MCOA 3SV3A 2RJZA 3QGIA 4DPWA 2E1RA 2DCLA 2VODA 4I1TA 3KOAA 3RR7A 3C15B 1I51B 5ETSA 1D8ZA 3HT0A 4WP8A 2OSRA 1LW2A 2IA0A 5B0AA 2UV8A 2ZHBA 1IWGA 4DU7A 4WFNQ 1U49A 4P10A 3Q2SC 3KLHA 3KUHA 5AE3A 3GG1A 2K3KA 3QIPB 5KT6A 1N8RT 1Q79A 4OL8A 3ZTPA 4IOAQ 3K0JA 1NZAA 2B7CB 4FDFA 4DFPA 4KH1B 8ATCB 3TAPA 4F8RA 3N01A 1QLNA 3PYGA 1N5QA 2GQQA 2J9DA 3DRPA 4ZJOA 3W65A 3KMSA 1XEZA 2AW0A 4RWXA 2YXLA 3N4WA 4KAIA 3MR2A 1FJGJ 3P5BP 4TYBA 2D74B 1M5HA 3FZ2A 2K8GA 1U2RA 2H65B 3T1HJ 4QR1A 2AYEA 4UOGA 1FKOB 4LBHA 4NZ7A 2LEBA 1DLOA 1VQYA 3M30A 2Y9HA 3ZTRA 2XC9A 5A6WA 2IM3A 4YHHJ 1D3WA 2JZ5A 2YNIB 2B51A 3CGIA 4DX5A 1SH2A 2XMUA 1YRXA 5F8GA 2DGVA 2DBBA 2J8SA 2R7SA 2ZZTA 1FFGB 2H4WB 3JQMA 2JOQA 1KDNA 4F25A 4ED8A 2W9AA 1TUGB 1ACMB 1TKZA 1ZAXA 3FKBA 3W1YC 4ECTA 1RT4A 4CM2A 3LP0A 4KHMA 3PHEA 4KKOB 3ILIA 4ECUA 3RJMB 2YY3A 1F9HA 3DOMA 3QYYA 4C6AA 4OX9J 1ULRA 2HHUA 3E8OA 4QBUA 3M2VA 4IG3A 4W90B 2QMUB 3F41A 5GAGI 2MSTA 2P9GA 1Q95G 1NK6A 5CD4H 4EYHB 5J2QA 1HBMB 3I0SA 2BQUA 2WONA 1M1KT 1N5SA 5I3PA 1N48A 5E3AA 1UVIA 4IO9Q 3PDNA 1Q8BA 2V2KA 3JXOA 5IM0A 1NK4A 3FQLA 1Q8LA 2W7AA 1Q81T 5HK4A 1WKKA 2MQOA 5AXNA 5I3UA 3L7OA 3TJ8A 5KFBA 4PQUA 3GYXB 1Q78A 2MLZA 4NLRA 1DTTB 2IVMA 2OPQA 3PYFA 2CJQA 5D15A 5D0RA 2POKA 1CJVB 4NXMF 2BJEA 2ZDOA 3WC0A 4WYLA 3OXGA 1VQ6S 1REVA 2E66A 2DIVA 5KFSA 5A0YB 1UVJA 2MLYA 2YWEA 4MJKA 3TVKA 1KQSR 2X3DA 5D0EA 1JMTA 4CNYA 3KHHA 3WBZA 3LALA 5DG9A 1XNRF 1E6VA 1ZPVA 1DZ5A 1Y3KA 1REVB 1U6FA 1WTFA 2RS8A 1IWAA 1RISA 5A0YA 3ZZ0A 2O67A 1FRJA 2WHOA 3K5MA 2FVCA 1A9NB 1ZA1B 1S1VA 1F2GA 1LWCA 1EB0A 4GMKA 1RTJA 1S6PA 4LRCA 4RX6A 1PIEA 2R42A 3KNGA 3OR1B 3PW7A 3FCVA 4GRSA 4UOCA 2MEWA 4DPOA 1Y10A 6FD1A 2R8HA 2RE1A 1HNZF 2HQGA 4G1IA 2J9DE 3TQ1A 4C8OA 5F8NA 2WW4A 2YTCA 3DGPA 1JJ4A 3MOZA 1IBMF 1DARA 3PKYA 4GVLA 1TL4A 3MTKA 4B9UA 2HHVA 3LANA 1PILA 1QY7A 3I0SB 4OYMA 4YUDA 4ZPBA 4JUZA 3BSOA 4NXMJ 2W9CB 1C1CA 1NNDA 2ZUAA 4M5DB 4UT4A 2R4FA 2EI5A 5GMEA 1K47A 3AHPA 2WSEC 5AT1B 3M6UA 2KU7A 4OYXA 3NGSA 3G82B 2B43A 1APSA 2HWIA 1LW2B 1PYOB 4OV6A 3NGUA 1FRKA 2WAQD 4L74A 3U1LA 1F0XA 3IRXB 3C15A 1KEKA 2RQMA 1RHQB 3FK4A 3FBEA 2VBYA 4HEA9 2ZC4A 1KQFB 3TZXA 2CWXA 2XCAA 2KG0A 3G6YA 2VUGA 2CNLB 2GIFA 1S99A 3KK3B 1X4GA 3Q89A 3EPIA 1X0FA 3BN7A 1RWUA 3R7NB 2DITA 1AROP 2EG1A 5HVFA 2GVZA 1RI7A 3C66A 4ED4A 3N5FA 3PRVA 3AD7C 2R7RA 1VQ8S 3KTQA 2RDJA 3HVTA 2BX6A 3VV2B 1T3OA 2RF2B 1U1PA 3ZZPA 4F0KA 5L9NA 4MAKA 2QZ8A 5BYRA 3W62A 2UXCF 4U95A 4E8UA 4Z7YA 4NL5A 1RT2B 2VJVA 4LFAJ 4F3OA 4IOBA 3RB0A 5IOLA 3S7RA 3D68A 2RRBA 5FDLA 4JI7F 2BM1A 2IRUA 1XNQJ 1C0TA 1M1GA 5E0OA 3CC7S 4MKBA 3CNQP 2LLZA 1KBRA 2MQLA 3CD6S 2FJBB 2MKJA 2B4PA 2CJAA 2AJ1A 3BSCA 3CUNA 2HBRB 4RW9A 4DFKA 1VQOS 1N5YA 1AYEA 1W25A 3BO3A 2XY5A 4QR0A 3MEKA 3PW0A 2DR7A 3OL9A 4B17A 1FJEB 2IM1A 2YKQA 3NGKA 1C2PA 2KXNB 3PR5B 4XPEA 3OUYA 3LGNA 3D2WA 3RZAA 2AGQA 4TNOA 2EFQA 2LYVA 3CD0A 4ZVUB 1IM6A 5HJXA 3MZIA 1DLOB 4AQYJ 2BEFA 4ED1A 3Q83A 1UFWA 1X4FA 2B9YA 2ROEA 4ECYA 1UVKA 3MM6B 2KZMA 1QD1A 4PWWA 2K2PA 2LMIA 1VFJA 3JTOA 5CABA 2DNKA 3MEGB 3H2UB 4DR5J 3RB6A 2LFVA 3HVWA 1SJFA 2ZBQA 4O44A 1X5OA 1YBAA 2E44A 4RUHA 1B0TA 4A8MP 2WVDA 4P52A 1VBXA 2LQ5A 1B99A 3KKFA 4KGXB 3S01A 2FJWA 5ETMA 2M88A 1SC1B 3DHXA 2VL1A 1H0HB 5DO2A 2RVJA 5THWA 4MTPA 5KG6A 7FDRA 2KHCA 2RDDA 2VFSA 1TQLA 3PZPA 1HYSA 7FD1A 2BOAA 5CYQB 4DV1J 2IBKA 1UW4A 2KXHA 4RNOA 1QSYA 3IR5B 2UUCJ 1DQ8A 4I2QB 2XZDB 4L73A 4NLXA 3MAQA 1U1KA 4J9KA 4KV8B 4C11A 3CT9A 2XCPA 2QO3A 4DV5J 3DLKB 1SKRA 3C2PA 2U1AA 3V81A 3JTNA 2DNPA 3HHLB 1Q8IA 2B9XA 3ZZZA 3H5UA 2HGNA 3OTCA 5KFNA 1NK7A 1VLYA 4C98A 4CLKA 3JYTB 3H5SA 2PFDA 2B9WA 3QRPA 1BQXA 2AEFA 2AJFE 4HI1A 1QTMA 3R3TA 4DCJB 4WFAQ 3VQSA 1GAOA 1FEHA 3QATA 2L41A 4EBDA 1T03B 3H40A 3MFIA 3NNCA 3BV8A 4NRTA 3R5DA 3HXMA 1FRMA 2RAQA 4RBUA 3CD5A 4WWSA 4ZK7M 2FZKB 2XG8A 5B0GA 3J7Z5 2J6TA 1VQSA 2DEIA 3P96A 4F36A 1M5OC 3K5LA 4WF9Q 1ELOA 3I0RB 2AX1A 2Q1LA 3IM9A 3KUGA 4LBPA 4D3GA 1U45A 3QAUA 2ZZNA 1IKXB 4F02A 5L9XA 4XDDA 1OWXA 1XTZA 2ZOMA 1N6QB 4ID5B 4OJGA 2QIFA 4NZ0A 3RB3A 1NAQA 5C24A 4M95A 4OI4A 3GONA 3LAMA 4DV7F 2WK4A 4ZP9A 3J7YU 4KPCA 2A10A 3HHNB 1S7IA 1RAOA 4I6AA 1KP6A 4J9UE 1IR1A 4C8NA 2X51A 2OD6A 1A0OB 3GSDA 1RU2A 1RT3B 2A2DA 2N4DA 3BGFA 3GTYX 4U8YA 1EETA 2FJVA 2WONB 3UVJA 3W7BA 2B8QA 2XI2A 3NCRA 3HFZB 2BW7A 3IG1B 4HHJA 1C0UB 3US5A 1GEHA 3MCMA 4A4JA 2Y3YA 1VGYA 2N3OA 1HBOB 2CXEA 1EETB 3N0VA 3UW1A 1QUPA 3ADAC 4ZKAA 3T9ZA 5EWGA 1JXEA 4RNNA 2V50A 4OX9F 2QC3A 3IBFB 3UDVA 2EFVA 4YR0A 5K20B 1KC8T 3PFOA 3BR9A 4A46A 1LWEA 1VISA 2QYCA 4M5LA 3U1NA 3VAFA 1XMQF 2KKHA 4LF1A 2HYIB 3MUVP 2Q3PA 4LR9A 3JQJA 4S0MA 3UNGC 2CQDA 3G82A 2VZ9A 5KFFA 4EO6A 4ZPAA 4ZMMA 3FBBA 3KK1B 3GFYA 5CQGA 3LTOA 1LQ9A 5KG4A 3KHRA 3HO1A 1FTCA 5DLGA 2FJEB 4DI6A 5GADI 5IWAJ 1OQ6A 3V4IA 4WZQA 4F4AA
chains in the Genus database with same CATH topology
3CCWA 4AXJA 4RNHA 5KFQA 3TOQA 3GIIA 2DHSA 2LQ9A 1JJ2R 4PWDA 3I9ZA 1N33F 4RU9A 4MH8A 4DUYF 2GMJA 5KOXA 1FDDA 1L3SA 4RW8B 3CIMA 4NA3A 2GW8A 5U47A 4CNZA 3K5PA 1W2BR 2BQ3A 2ZJRQ 3IR7B 4KB7A 4C0BA 4NX9A 4FS1A 3HI9A 1GT8A 3TARA 2J0WA 4FZVA 3OVBA 1FA0A 1FRIA 3EXYA 3Q23A 3MUTP 5EUHA 4IDKA 1U47A 4RW7B 4HKQA 5A8RA 1TKXB 1P9QC 1FKPB 2RU9A 5HLFB 1RK8A 1DQAA 5MLCV 4YB5A 2FC8A 1V9OA 5D4PA 3OL8A 1S1UB 3SZ2A 2V4RA 5KG7A 2KI2A 3M8PB 4FVCA 3NS5A 2BRKA 5I3UB 4DG1A 4DBQA 3H98A 2NSCA 1QJHA 1HA1A 3MECB 4OX7A 4OZJA 5C5JA 2XGPA 3O5TB 5L39A 2DISA 5CH7B 5J2NB 4ES2A 2ZH9A 1XR7A 4Q8FA 1CVJA 1FDAA 1FF2A 2LVWA 2I8EA 2VKRA 4X64F 4MIBA 4UY8T 1YVFA 3IS9B 3ENQA 1WHYA 1NKBA 2XI3A 4IRCA 3O8WA 1J5EF 2ZNYA 4DL4A 2V8GA 3V6DA 1NJYA 4NCGA 2MQQA 1FO1A 4NA1A 1C0TB 1RT5A 3DOKB 5HMYA 3RAQA 3SCLE 1QVGR 1HW8A 3LP0B 2X3GA 2AYMA 4ZPDA 2FGOA 1X0FA 2GJIA 4USJC 1FDNA 5G0RB 3KJVA 4QYRA 4YB7A 2ZH6A 2VG5B 2E5LF 3CCTA 5D8HB 4J37A 4C97A 2K7JA 2MY8A 3CD7A 3DNCA 1RT2A 5B0DA 1E6YA 1RAJA 2EPIA 4NWBA 2FD2A 3TAMB 2BM0A 2J9CA 1QE1B 3QZ8A 4ECQA 2AD9A 4KV8A 1YQHA 2LEPA 1XK8A 2QSWA 4RW4A 3M9NB 1JLQB 2XGQA 1JLBA 1KD1T 2ACYA 1T7PA 2XS7A 2WB1D 3MHYA 1DAXA 3PACA 3DLHA 2QA1A 1C4AA 1YJTA 5E3QA 4ZVHA 4AUKA 3SFUA 3SV4A 4RW4B 2I1RA 2DNLA 2HNYB 4LVNP 3VF0B 5AE2A 5C25B 3DDKA 4TYAA 1Q1KA 2EVZA 2DNMA 2O3DA 3DRYA 3SXLA 1N5TA 2FHOB 4ZDNA 4C8KA 3NNAA 2VOOA 3LP2A 1TK0A 2R7QA 3TVZA 1SL1A 4BS2A 4A8QA 4QW8A 2HHPA 2MKHA 5I42B 4NCAA 5LJ5Y 3Q0AA 3OHAA 2AJ0A 3CCMS 2K7KA 4H4OB 4B9MA 5IZHA 2E29A 3GIMA 3EZ5A 3Q2TC 5M2RA 1K73T 5HO4A 3DLGB 4OX6A 4KBIA 4KRWA 2VQEF 2BOPA 2EFGA 3MEDB 5FLXY 5KFEA 1S1WB 3UDLA 2LKZA 1HNVB 4N8NA 2OSQA 2ZJQQ 2IVFB 5GAEI 4ILMA 5BJRA 1UWBB 1WF0A 2RS2A 1IBKF 3FSYA 3T1AA 5B0FA 3WX4A 3H4BA 3PO4A 4PG6A 4IRKA 2HHSA 4CH1A 2U2FA 4UW2A 5T41A 1UAWA 4DV4F 2NYIA 5ITHA 3OSPA 3MPWA 3NCPA 4LFBF 1FJ7A 3KLFB 2VPZB 5MAOA 3MFHA 3D1QA 3K57A 1DFDA 1JNZB 5EX0A 5KFVA 4FP9A 4AE5A 4ECZA 3C6TA 1KTQA 1VI7A 2AP6A 3TW0A 3FCHA 4RUAA 1RJJA 4J9QA 1G6BA 2HFNA 3G6XA 2VPXB 3MM5A 1X4EA 1YJWS 2BR0A 1AFIA 4PXEA 4YHHF 2JVOA 4KQZA 3HKWA 1DQ9A 4LSNA 3BEGB 4MKYA 2NSBA 3LP1A 2QSFA 3I31A 3OTEA 4FF3A 2NLWA 1TFYA 1F5AA 3NP5A 2W8LA 2FGCA 1WACA 2N7CA 3PEHA 2R7WA 2ZD1A 1BQNA 3PX0A 4ED0A 4FXVA 2CRLA 2D41A 4OFZA 1MU2A 2CJBA 1HBNB 2CQIA 3ITHA 5B0EA 4DF8A 2HMIA 4YOEA 1YJUA 1VRTA 3HP6A 4NOHA 3DLEB 4I6WA 2ZDPA 3QIPA 2MKIA 1UVMA 4WXOA 4DV3F 2OIHA 2QRRA 3RTVA 4DSFA 2PO4A 4KT0C 3W2WA 2M8HA 5KFWA 2W4DA 2ASJA 4AL7A 4NLGA 4K4VA 3QGGA 1P1LA 2YX7A 1ZM3A 3M9MB 2OFHX 4CQ1A 2VA3A 3IA0A 2VC1A 4UY85 4MMOA 1BY9A 2B56A 2J9EA 5H1SV 1T05A 5IWAF 3IG1A 4DN0A 4X84A 1IKVA 3HVAA 3PY8A 3R5BA 2HVZA 1LWFB 2LQJA 4ES3A 4X66F 1KFSA 2RH3A 3FEYB 4OI2A 3K7RA 4DLEA 1O5JA 1SJ1A 2FJAB 4MKAA 4WXWA 4Z37A 4J9RA 1HBUA 2VFUA 3TA1A 4TU8A 4ZCIA 3MMAA 2L9DA 3V5RA 3HLUA 4Q7AA 5L1KA 4IQMA 4G6VB 2VONA 2CPJA 2K1RB 5HN0A 1S4FA 1TL3B 5GMKa 2ZZMA 3FDSA 3ZFVA 4DR1F 1JLGA 2JJ4D 2E1MC 2PMHA 4Y0FA 1IKWA 2C3YA 2DNOA 1RT1A 1TFWA 1KHWA 5LL6d 3RB4A 4IG0B 2FHJD 4ZCMA 1OPZA 3GMGA 2YNIA 3I5AA 4EFAC 3OJUA 1RGVA 1IN0A 4H4KA 5L1LA 2XSJA 2Z4PA 5HBMB 4I7FB 3K59A 4OI0A 1NJZA 2XMJA 1UVNA 2VBWA 3OTDA 2D3ZA 3M8SA 2C2RA 4MFBB 1X5SA 3BSAA 1N5YB 5I4MA 1SL2A 2HWHA 4OIXA 2AQ4A 4B3SF 2XB2D 4LSLA 4FYDA 2WTFA 1X7VA 3MOJB 4O3NA 3JAMY 3MEEA 5D6GA 4ED5A 1PSDA 1XERA 4IO1A 3PR4A 4Q2MA 2FVSA 4EU0A 1HWJA 3HVTB 2W4PA 4JOUA 4DG1B 1YSJA 3PW4A 2UUTA 2XZWA 3G6ES 3E3XA 1DTQA 4H4MA 3S8SA 3DOLB 1UWBA 1S72S 5LMNF 5DJBA 4P7VA 3C8YA 1U1NA 2GJ2A 4ZPWR 2PSZA 2HS4A 2DD8S 4L3NA 2OPRB 3TYTA 1NH7A 1HNIA 2DIUA 4DS5A 4LF5F 2C2EA 4AXIA 5F8HA 2GO9A 2A18A 5DGBA 1B7FA 2XLKA 2NREA 3OPKA 2ZH3A 2IRYA 2P9CA 1OIAA 2OPSB 2FIUA 4Y2IA 1NK5A 1YRUA 1TVRA 2ROPA 1R7IA 1TZ0A 5AJ3F 1DRZA 2JFDA 2FLNA 2KFNA 5IS2A 3NKYA 3NRBA 3X3UA 5FDLB 4ECVA 2MQMA 1I1GA 4Y6IA 4LVOP 3GIJA 3ICLA 3THVA 1UEVA 3M8QA 3BB5A 4CIOA 1FNOA 4R25A 4JI2F 3KG1A 3MURP 4PUOB 1JIHA 3IBWA 1K9MT 2JRSA 4RW6A 2RQCA 4DV0F 2OH2A 4ELUA 4J5OA 5F8JA 1HPZB 2O01C 3FMBA 3PXGa 1UVLA 2KG1A 1K0TA 2C42A 2ZHOA 5K9FA 3TP2A 1MW7A 2XY6A 5CYJA 3TVYA 2X1GA 4EBCA 2PIIA 1VQ5S 2FY1A 4DQSA 4GKKF 2AU0A 2KO1A 2CQCA 1U6ZA 2XLIA 4NLPA 1S97A 1S7HA 4PRFA 2XO7A 4I6YA 3OXFA 2MGZA 4G1PA 2M5YA 3ISND 4IH6A 4YR3A 4AL5A 3MMCB 4Q44A 3DHWC 5KG1A 3ZZUA 3M4XA 4CTAA 1CLFA 2YH1A 3MCSA 2AYGA 4LQ3A 4PQUB 5JJBA 4Q0BB 1S48A 1GQEA 3I5BA 4W92B 3KLVA 3M8RA 2CJKA 2JEFA 2L48A 2GO8A 4P2SA 3VZIA 2M70A 4RNFA 3RBDA 4V19X 1QSSA 2BJDA 1ZOTA 2GIRA 1T03A 1HNVA 3LP2B 5JVGQ 1IJEB 1KVIA 2CPDA 5D4OA 5L8RC 2WBRA 1SBRA 1M0SA 3D54A 1WEYA 2IYIA 3ETOA 4QWBA 3NMAA 4LF8F 2XSFA 3VALA 3LQVA 2D7SA 2NQPA 1S9EB 2VG6B 3OSNA 1SV5B 2E1AA 2FLOA 3KWMA 4BC9A 4DWIA 2IFXA 1BD6A 2V4QA 2C22A 3CSKA 2N4CA 1S6QB 3QPIA 2ERRA 2Z8QA 2B4OA 4F3MA 5A6PA 3IS9A 4LF6F 1AW0A 4BWJA 5C42B 3DOLA 4ZCKA 2MDAA 4N77A 4K5SA 5KFHA 2IJNA 4NLVA 3M32B 2CVEA 2OO4A 3CCUS 3VR1A 2DVIA 1HQEA 2GGPA 3IR6B 2GHPA 3CEDA 1OQ3A 2PEHA 1DHMA 4YB6A 3H5XA 2BYCA 4K0KF 1K1SA 1KSPA 1FEEA 3TO8A 4DFJA 4GKJF 4KHPF 2JWNA 1X9WA 4KC5A 1FD2A 2M52A 4Q8EA 1M5KC 2Q43A 2JEGA 1HQUB 4O3OA 4DQIA 3CCZA 3D1OA 4XDCA 4MYTA 5B0BA 2BQRA 3MM9B 1AFJA 2L9NA 2Z2LA 3TUJC 4FS2A 2F3JA 3PX4A 3SFGA 1Y00A 5AXLA 3MEEB 1IKYA 2W7PA 5DDPC 1FESA 4PWUA 1HD0A 1WI8A 2RNEA 4K5RA 5EHHA 2HG4A 2MZJA 4K4XA 1H6KX 2BANB 1UJ5A 2XEXA 3OW2R 5KFCA 5EN1A 1VBZA 3F56A 4KJIA 4O4GB 4Y2CA 5K14A 5KG0A 1SJRA 1UL3A 3PIOQ 2MHEA 1KQKA 3HZEA 2RF2A 2JFKA 4B02A 5J1EB 3CJ5A 2FJWA 4YFUA 1KFDA 4DHVA 3DOKA 4A8FA 5DGAA 2VPYB 4Y65A 2ZC3A 5HP1B 4OJ1A 5F8MA 3BR8A 5EDWA 1D1UA 4C2MA 1VQLS 1VJWA 2M0GB 2RRAA 3MGJA 1WG5A 1JLGB 3UDCA 5KFXA 1HMVA 3FGVA 3BQ1A 5M2UA 1O8BA 2KJWA 5E3RA 2PT0A 1A7GE 1RA7A 3HF5A 3TNVA 4GC6A 2AYBA 3D28A 3VAGA 4KSEB 4DDFA 2X1FA 2DK2A 1WF2A 4QIFA 4DSLA 3CDAA 3EGNA 2FLPA 1U09A 2AJ4A 3CC4S 4LUBA 3TX8A 2IAJB 1U1MA 2PN6A 4DQRA 2V9KA 1NJIT 2OJ3A 5CCLA 2DPJA 2PMZD 5SZTA 1QAXA 4TU7A 4RUCA 2N3LA 3N6NA 4F4YA 2FHJA 1MROA 2K3IA 2YNHB 2VQFF 2B6AB 3NGDA 3KYLA 5F3ZA 4ZVFA 1TL5A 3H2VE 4ID5A 5A8KB 4CO3A 1MMDA 2BRLA 2AF6A 2X1AA 4KO0B 2DGUA 3W2WB 4TKTA 2Q6BA 1SV5A 5DQIA 2ZH4A 3VQTA 4C4WA 1S0VA 4CO4A 2CPEA 3ZC4A 2DO4A 1K8AT 4DJBA 3A8EA 4QOTA 2AGOA 5K8OA 3DM2B 4DR6F 1RTJB 2OPQB 1HBOA 4OI6A 2E5IA 2YNFA 3KMQA 2HLTA 3N6LA 2IM0A 3EZUA 3CF5Q 1SQEA 3BGRA 2QA2A 2Q66A 3J7A1 4FXWA 1H7XA 1SUQB 3N6MA 3G96A 1HI0P 3KLFA 3SEOA 4OZ1A 2R9LA 4Q5VA 3MM5B 3GFZA 1FCAA 2W9BB 1DTTA 4RU2A 4YP3A 3HKZD 5H9EJ 1HARA 3MMBB 2BV3A 4GO7X 3CO9A 4PXDA 2C2DA 2F7VA 3H59A 2RDIA 3M05A 3M2RA 5LXRA 1RT3A 4NYOA 1HWIA 2QLWA 3HT3A 5A8WA 3C6UB 3DI6B 1N8RT 2MKCA 1KC8T 2MKSA 2EFOA 1FNXH 1N56A 4C8LA 3JSYA 2COLA 1JJHA 1S77D 2CQGA 2YVSA 5HP1A 1JLFA 2CVIA 4OHVA 4ATNA 3EYZA 1CPZA 1SJ3P 4PG5A 3V6KA 4JV5F 1XR6A 2VBXA 1IR0A 1ZTTA 3I32A 1RTHB 4A8XA 2XWXA 2XWYA 2W25A 4PXBA 1FDBA 3MD1A 1ZM2A 1FTRA 3THTA 4WU3A 5KFMA 2QEXS 3CXCR 3UD3P 1SKWA 4I2QA 2HW3A 2CQ2A 3CCLS 2HZCA 1U2FA 2C3OA 3V6DB 1HWLA 5J1NA 3H25A 3OVSA 1TR0A 1TVRB 2WCXA 1RYRA 2B3TB 5B08A 2ZFHA 3F73A 2BXJA 1NRKA 2NPIA 1JKHA 2QA4S 5DDQC 5HL7Q 4JV1A 1HD1A 4H4KC 1FVQA 5J2NA 3LH2S 1I94F 2E9RX 4C7QA 1S1XA 2VC0A 1FXRA 3OFHA 3BO2A 2E5GA