4A4JA

Crosstalk between cu(i) and zn(ii) homeostasis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
69
structure length
69
Chain Sequence
AQTINLQLEGMDCTSCASSIERAIAKVPGVQSCQVNFALEQAVVSYHGETTPQILTDAVERAGYHARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE PACS
publication title Investigating the Role of Zinc and Copper Binding Motifs of Trafficking Sites in the Cyanobacterium Synechocystis Pcc 6803.
pubmed doi rcsb
source organism Synechocystis
total genus 17
structure length 69
sequence length 69
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a4jA00
1K0VA 2XMVA 1FEEA 1LQ9A 5B0CA 2K1RB 4EFAC 1Y3KA 1GXUA 2ZDOA 3BGUA 3KG1A 3HHLB 1FESA 2AJ1A 5T7LA 4A48A 2KT2A 4FNIA 1IUJA 2Q3PA 4HI1A 4OJHA 2K7KA 1TZ0A 1SI9A 2GGPA 2PGCA 5B0BA 2AJ0A 2QYCA 4HH1A 2HLUA 1AFJA 4QOTA 4YDXA 5T7LB 3MZIA 1WD6A 2FHMA 1Q4RA 2K1RA 2LQBA 2XMUA 4YEAA 1CPZA 3WDOA 3K7RA 2GGPB 3QGPA 2XMWA 1N5TA 2FTRA 2W4DA 3LGMA 5B0EA 5B08A 2IYIA 1XBWA 3I9ZA 5A6WA 3VTIA 4U9RA 2QLXA 4OIXA 1Q8LA 4F67A 1MWYA 1N5SA 2OAUA 2W4PA 3BDEA 1W2IA 3IWLA 3CJKA 2LQ9A 2ACYA 1CC7A 2OFGX 2RMLA 4Q2LA 2RSQA 2GCFA 3GZ7A 5K9FA 2AW0A 2KYZA 3LGNA 4HI2A 2OD6A 2IFXA 2GO8A 4OJ1A 2HFNA 1OPZA 1KQKA 2OMOA 2ROPA 1APSA 2HIQA 2RU9A 3TRGA 1FVSA 2L3MA 2XMKA 3HHLC 2HLTA 4HL9A 3CJKB 2K7JA 2QIFA 2RILA 4OJGA 5F0WA 1OSDA 1S6UA 1OQ6A 3DXSX 3FMBA 4ZA1A 3TOQA 3HX9A 3KG0A 1YJUA 3HHLD 3KKFA 4DL0C 2ROEA 3BR8A 2HFOA 5KAKA 2BJDA 4DPOA 1RJJA 1N5VA 4FNHA 2OD4A 2GFFA 5B09A 2GV1A 1CC8A 1GXTA 1X8DA 3BN7A 1QUPA 2CRLA 2HQIA 2VV5A 4HH0A 2BUNA 1FD8A 1FVQA 1TL4A 2K2PA 3F44A 1TUVA 2XMTA 1FE0A 3BM7A 1U7LA 2LDIA 3QMQA 2KT3A 4OJ3A 1V3ZA 5B0GA 1AW0A 4Y2KA 1MWZA 4ZOSA 1Y0HA 2IYGA 2AP6A 1ULRA 2QLWA 1TR0A 1OQ3A 3LO3A 1Q8BA 3HDSA 2BBEA 1P6TA 2LXFA 3MCSA 4NPOA 4A46A 5B0FA 2N7YA 3T9NA 2FB0A 2XMMA 1VQYA 1R6YA 2VH7A 2W4CA 3KNGA 1VQSA 1S6OA 2KKHA 2ZDPA 3BF4A 2ROGA 4DN9A 4Y2IA 1JK9B 5B0AA 3HFKA 1X7VA 3FGVA 1Y9OA 4A4JA 1SB6A 1YJVA 4Q2MA 2N4DA 1Q53A 2ASYA 5IXUA 5F0UA 4NL5A 2GA7A 5A6PA 1AFIA 1SQEA 1P8GA 2JDJA 1TL5A 1YRXA 2XMJA 3DCAA 3E8OA 1Y3JA 1YJTA 5B0DA 3UDCA 3HF5A 2FIUA 2N4CA 2OP5A 4A47A 1JWWA 1FE4A 3TNVA 1X0PA 2OFHX 3IWXA 1N5QA 2BYCA 1YG0A 2G9OA 2BJEA 1URRA 3HHLA 2OKQA 3BB5A 1KVIA 2PD1A 2EW9A 1KVJA 1YJRA 3FRYA 4Y2MA
chains in the Genus database with same CATH superfamily
2XWXA 1TKXB 4TXSA 1UL3A 2CDQA 3OTDA 3P5TL 3ETMA 2E29A 2BJ3A 3M4XA 2XS5A 3JAMY 3UVJB 1H6KX 4EBCA 3HT0A 1RCXB 4DR2J 2HHUA 2A0FB 4ECYA 2CPXA 2RRNA 2EBGA 3TX0A 3M2VA 2OFGX 4P74A 4I64A 2DXFA 3PYDA 3DOLA 2KHDA 2BJDA 1ZPVA 3CDAA 3V5RA 2HHTA 1YX2A 4NA1A 1E6YA 1D8ZA 2XYHB 4KGZB 3HVTA 1JJ2R 4ZPTR 4Z7YA 2VOPA 2IJRA 2AD9A 1R6YA 4Y3CA 1X4FA 1DLOB 1NHKL 2ALZA 4PYAA 3G6XA 4CZCA 2B5JA 1TL5A 2DR5A 1TQLA 3CD5A 2MKKA 1YJ7A 4IOCQ 4HKQA 2Z8QA 2M4MA 3BGOP 4M5DA 5IQ6A 2EI5A 2XLIA 1TKDA 2PGCA 4ED5A 4NXMJ 8RUCA 1RT5A 2RT3A 3MZIA 3NOGA 4ECSA 3BPDA 2ZE2A 2QX0A 2W2NP 1RK8A 3PACA 3NY0A 1W2IA 2PT0A 3ZTRA 2CPHA 4IRCA 2MKSA 3QPIA 3M9NB 1H74A 3QT5A 4JOUA 4BDPA 1RBLA 4ECVA 2D3OR 4DPWA 4LR9A 3ILJA 4WYLA 2HGNA 3OLBA 3M2RB 4NLWA 2N82B 3VGSA 2FJXA 2KJVA 4DFMA 1MROB 4NL5A 2OEJA 2CPDA 1UKUA 3JTNA 3OHAA 4ZK7M 1FJ7A 3RR7A 1ZZNA 1YBTA 2DHSA 3AH6A 3Q8RB 1XR5A 2HS0A 2NZ4A 1P27B 2GVDA 3C2PA 4ZCLA 4JV5J 2QGFB 2Z2YB 2BJ7A 1NJZA 1RT3B 4MYUA 3LGMA 2JOQA 2XHCA 4ER8A 1WEYA 1QE1B 2RMLA 4Q2LA 3GILA 2FVPA 3SQGA 1EP4B 4ZLPA 1NSQA 3K5PA 2IJFA 2QIFA 4M8LA 4WE1B 1ZAXA 4ELUA 3BH6B 2FZGB 2CJBA 2Z0GA 3IN5A 1NK0A 1I51B 3LP2B 2FLPA 5KFQA 1R6VA 1UP1A 4IG0B 2E9TA 5KFJA 4DN0A 5F8LA 4J9NA 2HQ3A 2LXFA 3P96A 3Q22A 3KNGA 4MK9A 1BQNB 3K17A 2F4VF 1NSPA 2DT9A 4O3RA 5HMZA 2HEKA 4OI6A 2UUTA 1H2UX 1P1LA 3LP0B 1RAGB 3GPAA 4CLWA 1FRKA 4Y2AA 4C0OC 5C7PA 3HP6A 4WWSA 2C22A 4ZCKA 4LR8A 1S77D 3GQCA 1EKRA 4ZS6A 1U1NA 2RS2A 1K1SA 3DXBA 3D5MA 1FD2A 3NCPA 4TQSA 3QIPB 2AWZA 5C24B 1OYDA 4IO9Q 1U02A 5ETVA 2HNDA 1IVZA 2FPHX 4G1QA 4RU2A 1S9GB 3HJFA 2X1FA 3TR5A 1HPZA 1M5VC 1XR6A 4YB7A 2P9CA 3AJDA 1IBMJ 3BS9A 3FQLA 4CO4A 3IAS9 4X2BA 3AT1B 2PSZA 1KVKA 2LKZA 4X4SA 1MWZA 3ZZYA 4H4OA 2HS3A 3I4PA 3M6WA 4DUTA 2XI2A 4IKAA 3Q83A 5GAHI 3MXHP 2UP1A 1IKXB 3MF5A 3UDLA 3I0RA 3PYFA 4F3MA 2BJEA 3TZWA 4J9VA 3UE2A 1DJ0A 2MZTA 1CLFA 2XMVA 4ES1A 2DNYA 3PG9A 3IWNC 3ETOA 3RTVA 1B7FA 3R5CA 2I8EA 1X5OA 2R8GA 2FLOA 1VBXA 3ISND 1RKJA 5CYMA 3GIIA 1M5KC 4NCAA 3I96A 4X84A 4XTTA 3ZZ0A 4B9LA 1KS2A 3GZ7A 3A8EA 5J2MB 2G0CA 2KYZA 1N52B 1N33J 1RDRA 2K7JA 2X1AA 5F0WA 1ZM9A 1Q82T 3UCUP 1GXTA 4URQU 4Y00A 4ZN3A 2ASDA 3QSYB 5KG4A 1YK9A 3CC4S 1RWWB 2OUGA 3SXLA 3R2CJ 1KC8T 1K0TA 4DN9A 3V6DB 3NMAA 5IXUA 2DY9A 4BWJA 5K14A 5IT4A 1KONA 4G6VB 3JSMA 4P71A 3BBFA 5K20B 3PCOB 1YRUA 5J2PA 1WTBA 3FSYA 3BN4A 3R8YA 2BANB 2AJ1A 3THVA 2J0XA 4FNIA 4X64J 2CJYB 4DSFA 4KFBB 4W4MA 3JXOA 3M8YA 3TJ8A 2OPPA 1FDAA 1XR7A 3TUPA 3BH7B 5CD4A 4RUBA 3PKMA 3CJKA 4DV1J 1R0BG 3KTQA 2IMOA 1RUSA 2M7SA 4JI6J 2OEMA 3BJYA 2C2DA 4WYWA 4O23A 4ZA1A 2ZUGA 4LF4F 1LWFB 4DL0C 1S6QB 2XZDB 4N8OA 1Q5YA 2DCLA 2M8DB 1S0OA 5IS2A 2YKNA 2AEMA 4R5PB 2PE8A 4WXOA 3SDEA 4DV6J 1VRQC 4KB7A 1NPRA 1S9EA 4QIEA 1I94F 2AEFA 3DI6B 1B70B 5KFTA 1RSCA 2ATCB 2MKJA 4CIOA 5J1EB 4O3OA 4FZVA 1NCLA 2VQEJ 2WOMB 1WF2A 2JNJA 1IN0A 1U0HB 4BC7A 1KVIA 3HMJG 3HFZB 1RQ0A 2YKQA 4HACA 4K5SA 2R2SA 1DAXA 1ZAWA 4U96A 5LOQA 3G82A 1S1VB 4PXCA 3HSZA 4QOTA 2EVZA 1NJYA 1YKWA 2DR8A 2RE1A 4ATNA 3GJQB 4KKOA 2ZUAA 2DGWA 2W4DA 3PFEA 1P9QC 3GYXB 5KG6A 1LWCA 2WSEC 4USMA 3D6FB 2FHKA 5HROB 5JVHQ 3LQVA 4NZ0A 2HNYB 3MM5A 3OTCA 1C0UA 1KWMA 5LMUJ 2FY1A 1TL7A 2DGSA 3DRXA 2MJNA 4KSEB 1N54B 5DG8A 4ZP7A 4LRFA 3QFWA 1ZM2A 5HMYA 2HZVA 2B56A 2FDNA 3CJ2A 1Q8IA 4DR2F 2IJNA 5FIIA 1RT7A 4RW7A 1VRUB 5A6PA 5EUHA 3P45B 4P2MA 2CJKA 2AX0A 4NWBA 4OZJA 3VZHA 5IWAJ 1FJCA 2VC0A 4B3SJ 1WKLA 3NWGA 2O67A 2BZ2A 2Z2ZA 2AJ2A 3PHTA 4ZJQA 2IRYA 4LREA 3KJVA 1RU2A 3B4DA 5BYQA 5I42B 3DLHA 1FTCA 1F3FA 1RT6A 3Q8VA 3V4IA 2AJQA 3LPYA 2YH0A 5L9XA 4DU8A 1IR1A 3AOCA 5G4DA 3QJPA 3ZZRA 2AF6A 5A8RB 2Q6CA 3OTBA 1JX4A 5K8NA 3KG0A 3NWRA 3N28A 5D15A 2HHWA 1TL4A 1KLNA 2Z58B 5U47A 1REGX 1HYSB 2J9DA 1HBMB 4NXMF 3W2WB 3KYLA 4F0KA 4F2SA 1X9SA 3M6XA 2UVWA 1JK9B 1Y9OA 2LA4A 1ZA2B 1J2VA 1FDNA 2B7CB 1U1KA 1Y4ZB 3GG0A 1U6FA 2RF2B 1K47A 3AJ2A 3GIRA 3J7AN 2BM1A 4UZBA 4LMZA 1AT1B 4TY8B 1N36J 4HI1A 1VCTA 4F4ZA 5BXIA 2O66A 3HULA 3ILLA 2KM8C 1JLEA 3GV8B 5DG7A 2AGOA 2CJQA 3M8QA 4YMEA 1CQMA 4IRDA 2VC1A 3DLBA 1HBNA 3ZZZA 2LDYA 3ZO7A 4HTJA 3QRPA 1BC6A 2J76E 1HWIA 4QZVB 4BLGA 5D8HB 1C0TB 3GB0A 2RILA 5F41A 5KFKA 1RT4A 2CNNB 1T9WA 3S1TA 1T11A 1PIEA 3EWGA 2DGXA 2ZHAA 2YNFA 2RQCA 1QTNB 1YIJS 4KE5A 4DSKA 3QWUA 1NEEA 4JV5F 1ZYQA 1NDKA 2IM1A 3W5XA 4F4KA 2LU1A 1R43A 3DRSB 1B7YB 1N5QA 1RCOB 4B9MA 3SFGA 4A8WA 3NGSA 4NYZA 1VQ9S 2BMBA 1TL3B 1SI9A 2GGPA 4UQTA 1B4SA 4LQ3A 2LQBA 3DOKB 1S4FA 3M2UB 2FHJA 3RG6A 5H9EJ 2W9CA 5A6WA 1QM9A 2VBWA 3PXGa 3IBWA 4TYBA 1VQOS 4C8ZA 3VGUA 2UUBF 3G9CA 2ZM6J 4B02A 3DN9A 1S0VA 4U95A 3GJSB 3MPDA 3PW0A 3FFIA 4YY3J 3OVSA 1CJVA 4Y2KA 4EU0A 2ZOGA 3O2IA 5GVQA 4CLLA 3ENVA 2FJAB 3TAMA 3ENQA 3HFKA 2H4WB 3E01B 2R7RA 2FY8A 3N5FA 4PYDA 2PDAA 2DNZA 1KR4A 1IQTA 2F9DA 3UD3P 2XNRA 4QPXA 4C0HA 1JXVA 4KV8B 3CDUA 3FBBA 4YQWA 4DR3J 2K06A 3DLGA 1XEZA 1UPMB 5I3UB 5LL6d 4QYZK 3W3SA 1D9FA 1SKUB 3A3PB 3G87A 2QMXA 2MLYA 2R2RA 2CQIA 3I56S 3HVRA 2FTRA 2JLEA 2QLXA 5KOXA 2WONA 2GCFA 3ITHA 4DL3A 1JLQB 4IFVB 4O44A 1N6QA 3N0VA 1GNKA 3VAGA 3H2LA 2XGQA 4DR1J 2R8JA 2Q43A 2HBQB 4CM0A 3N6NA 5KG0A 2ZBQA 3AQOA 1RB0A 3W62A 4DI6A 5E3CA 1U2RA 4ZPCA 2P8IA 4XPCA 3GFZA 6AT1B 3PVXA 4OYWA 5FLXU 5E5NA 2W9BB 3W65A 1VFJA 2IIHA 2DRDA 2DVIA 1SKSA 5CZXA 2ZH5A 1DBDA 4L75A 5EHHA 4DV0J 1ICEB 4X4UA 2DNRA 1LWEA 2BABA 2ZJRQ 2NLWA 4OI3A 2QLFB 5D3GA 4NCBA 2QFJA 4NYPA 3VTIA 3VALA 5DM6Q 3ADAC 2CNLB 3A12A 3A3NB 3DM2A 4DL2A 1QAJA 1SC4B 4EWTA 3NAIA 2BOPA 4O3SA 1VQMS 2CVIA 3BSCA 2EFQA 1KOHA 2KXHA 4OX8A 2K2PA 3MMJA 2V69A 3D2WA 4LIRA 2JLFA 4X64F 4DG1A 5C42B 1WI6A 4KAIA 4DV5J 3V6JA 2PA8D 2GJFA 3RAMA 5F8HA 3FRZA 3R5JB 1FRXA 3HVWA 2J8AA 3D66A 2GJIA 1EQ0A 3T1HJ 4JI6F 4KTQA 3BGUA 2BX6A 3DLLQ 3IGVA 1T8EA 3WQPA 2QYCA 2XY5A 3RW6A 1WJ9A 4DV6F 4KIAA 2QSWA 2R9LA 4FS1A 9ATCB 2CFXA 2LECA 3RAXA 3RUBL 2IA0A 1RWOB 2QT7A 3KHHA 5KT6A 2L41A 3BSNA 2VQEF 1ZBTA 3M2VB 2F5GA 1DHMA 3CULA 3MUVP 3G8TA 3S8SA 1FWLA 3CF5Q 4Z7CA 3UWTA 2HHVA 3DOLB 3VAJA 1RAFB 1YBUA 1FE0A 3EVOA 3SYZA 4WFXA 5DQGA 4ANDA 2N7YA 1E6YB 3PJ9A 1U6ZA 3HVTB 2NXUA 4DX7A 3NBPA 2QTWA 3T1YJ 3RBDA 3ICLA 3TWZA 5ETTA 2L9NA 1VI7A 4RJVA 1R27B 1IKYB 2UUAJ 2B5JB 2V9WA 4NXNJ 2C2KB 1KFDA 2DGOA 2XY7A 3J7Z5 4L3NA 2GMHA 2XEXA 1ZA1B 2NXJA 2ASLA 4A8KA 2NXCA 2BOAA 2DHGA 1MNEA 4OYBA 1RLDA 4M5NA 2FC8A 4M5DB 4B3MJ 5F8MA 1Q78A 1IBLJ 1WC1A 2DEJA 3FCWA 1RT5B 4DR4J 2JLGA 4JI1J 4RWWA 4PPDA 4NOHA 2ZE2B 2CQ4A 4RUCA 2H3EB 2OTLS 1OPZA 2DHHA 5IWAF 3TO8A 2HHQA 4NMXA 4B3SF 2HAFA 2NYHA 4NLGA 1FNOA 1RTZA 2V34A 4I7FA 4NZ6A 4QQBA 1SJFA 2MQNA 2FB0A 4LSLB 3SV4A 1U6BA 3NG8A 4QWCA 1VOMA 1SQEA 2FJDB 2CIMA 3AD7C 5ETNA 1C1BA 2BW7A 5DS7A 1LXJA 1KFSA 3QQCD 4X62J 5T7LA 1N5YA 2FVRA 2Q1LA 2QL5B 3RZAA 2W7PA 3HJVA 2C3YA 4ZDNA 1RTJA 2HLUA 4U67Q 4CTAA 3FEZA 2WTFA 1WF1A 2GVDB 2KN4A 2D3O1 1FNMA 2IM3A 1RT1B 1QVGR 5HQ8A 4LBHA 3MOZA 5HBMA 3R7NB 3TVYA 2M5YA 3JSYA 2YNIA 4DQQA 2KFZA 1WHXA 3QZ8A 2DNMA 5LJ5Y 2E5LJ 1U09A 2MKHA 1ZM4A 3SQGB 1CJKA 4QR2A 2EPIA 4ZIWA 4GO7X 4A8FA 3TVKA 2HIYA 1SC1B 4NLXA 3VAHA 2B3TB 4NLPA 1N36F 4DLEA 5D4PA 2GHPA 2W01A 1N32J 4ZLNA 1GMUA 2NQPA 2E9ZA 1U8WA 3HKWA 2KH9A 2BKOA 3NRBA 1F1BB 1N4LA 2A10A 2P6TA 4WBFA 1VQ8S 2E44A 3RB4A 1CJTB 2CNKB 2C2EA 4J90A 3FRYA 4LF6J 3CJ3A 3R5DA 2GHWA 1VQKS 3GR0A 2VPYB 4UTGA 1GX5A 2YNGA 2R7QA 1ZPWX 7FDRA 2D69A 1RLCL 4DFPA 1HA1A 1RAJA 2D9PA 2LEBA 4IOAQ 2IY5B 4L3KA 2V8GA 1N56A 3M9OB 9RUBA 4A8OA 3CJSA 2W2QP 1YJ9S 3ZZUA 1FWKA 4LRAA 1FO1A 1VQPS 2BQ3A 3OXGA 2RU9A 4WK1A 4OZ2A 1BE4A 2HNDB 2Z56B 3HVAA 1YVFA 4G1QB 3Q0AA 5D0GA 4S0MA 2GFFA 2RU3A 2HFVA 3DDKA 4O3QA 4A8SA 4YR3A 1OY6A 4P10A 1UVMA 1GTEA 3GYGA 1Y5IB 2ILZA 3DDIA 1RU1A 1LV5A 4WU3A 2V8DA 3T5LA 5J2QA 2P9GA 3V4MA 4CH0S 2N4CA 4CRJA 3M8SA 2WBMA 5HP1A 3D1QA 2ZM6F 4EMDA 1ZM3A 4M5KA 3I0RB 4F04B 1M5PC 1RI7A 2MGZA 3Q2TC 4YY3F 1UEKA 3KLFA 2DHAA 1IR0A 1G6BA 3IMQJ 1CPZA 4YB5A 4ILLA 4U8VA 3MECA 4KPYA 2DNOA 2MSSA 1CC7A 4NLUA 4I6YA 4OJ1A 2VHGA 2VPWB 1WDDA 3MWBA 1NNDA 4PZVA 5CABA 5KT2A 3KK1A 4RKUC 2HHPA 2U2FA 1RA7A 4DR3F 3GIJA 1J5OA 3NGDA 1QUPA 1NH8A 2CPEA 3TAPA 3CCES 1RT2A 1VBYA 1Q7LB 4O3NA 2DNQA 4H4KA 4WFNQ 1T05A 4KHRA 3DGPA 3OUYA 2B4VA 1U1QA 2MQLA 2FIUA 2O01C 4MK7A 3UD4P 4P2SA 1KTQA 5K14B 2JC1A 4C0BA 2JWNA 3JSMB 1G4CA 1Q16B 1RAOA 2E1MC 2CADA 3GIKA 3RGIA 3MDFA 5J2PB 3L95X 2J7KA 2AYMA 7AT1B 4WKYA 4JV0A 4DR1F 4YDDB 2RD5C 4CO3A 1WELA 3M6VA 1N8RT 2R42A 1X60A 4KY3A 4KGKA 3TARA 2OPPB 5KT5A 4DUYJ 2GO8A 1EB0A 3TRGA 4LJMA 3U1NA 3CJKB 4WP8A 1RBOB 2IPOB 1VQ7S 4ZJOA 2VBZA 3UI3A 4LF2A 2E5IA 4OYPA 1UCNA 4Q45A 1G2EA 4GVBA 4DV0F 4QPTA 4Q7AA 3S6EA 3O6QA 2YKNB 1B0VA 4L6V3 1S1TB 3SDEB 5KG3A 2WVEA 2ZHBA 3MHYA 3B6BA 4OV1A 4DQIA 1S9EB 3BSAA 2MLZA 5KFUA 5HVFA 3PZPA 2HVHA 3R9LA 3PRBA 1K44A 4DMZA 5KFIA 5KFSA 1K1QA 2AYBA 3DOMA 2B9YA 4F4AA 3GV5B 1HWUA 4ZVEA 1RTHA 4DL6A 1HFEL 4B9SA 2ZHOA 4LF8J 4CLFA 1FK9A 1NO8A 3I5AA 3MEGA 1U48A 1TL1A 3G82B 3H5UA 4NCGA 3K57A 4DV5F 1JXLA 5FD1A 2QRRA 3VQSA 4UY85 1KKHA 4KKOB 2RS8A 1LWCB 4AD6A 1M0SA 1IR2A 4I2PA 3OV7A 3T1HF 2JL9A 4FYYB 1C2PA 3MM5B 1C0UB 3SCKE 1IBKJ 5L8RC 1U49A 3X3UA 2I6WA 1SV5A 3MM6A 2KYXA 3IG1A 2BBEA 4NPOA 2D1CA 4ZLLA 2R2UA 3X1LB 1I5OB 4PWUA 2C2OB 3T1AA 2DR7A 4Q2MA 3KNAA 2APOA 1NSKL 2DPIA 1RT7B 4RW7B 1NHUA 3PW5A 1F5CA 1DRZA 4ES3A 1Q7YT 2M52A 3P8BB 2IDEA 3M1VA 5HQMA 2CQCA 2KVIA 2G13A 4CLKA 2HAIA 5D4NA 4K2JA 2XGPA 1N0VC 4P7VA 4P2FA 3KJVB 1Y7PA 3VF0B 4WK3A 2GAGC 5KFMA 3N6LA 3T1YF 3DU5A 1R8HA 4Q5VA 1RT6B 3HFVA 3JQKA 5KT7A 1HNXJ 3V4IB 2EK6A 2HQFA 2CXEA 3MAHA 5BJRA 2UUAF 2GNKA 4YHHJ 4NXNF 4FYXB 1N5VA 5F8GA 2DNLA 4EBDA 1H98A 1EARA 2VV5A 2ACMA 1MMLA 2KO1A 4TN2A 3UO0A 4ED4A 2VQFJ 2GQQA 1GTHA 4B3MF 2LQ8A 3C8YA 1RABB 1VQSA 1IBLF 5GADI 4V19J 3IBFB 4DR4F 4L74A 4KO0A 4JI1F 2JVOA 3AA9A 4OHYA 2YPZA 1LK7A 2FLLA 5AXKA 4H4MA 2A6MA 4FVMA 3DYAA 5ETKA 4FP9A 3FZ2A 2DR6A 1FESA 3EZUA 4X66J 4CT8A 4Y2CA 3GFYA 4X4NA 3O8WA 4Y28C 2B4OA 5DG9A 1BXNA 1RADB 3UN2A 4K4ZA 1U24A 2B8QA 3V6KA 1JLEB 3I5CA 4OLPA 5DRKA 3RAQA 1DQ8A 3M8QB 2J0WA 1REVA 3PW7A 4Y0FA 3BKFA 1HBNB 4KQZA 2XO6A 4P9SA 4WFYA 4ED7A 2CQDA 1YSJA 2HNZA 5B7WA 5E3RA 1ZS6A 1X9WA 4CLYA 1F3VA 3IM8A 3CJQA 4NLQA 4X62F 1RT4B 2CKWA 2K3IA 2IYGA 4PXBA 2RDJA 2YNFB 5KT3A 1NJWA 3GLJA 2Q79A 3BBCA 3MAQA 1FF2A 4IFYA 2F8EX 3PJWA 4WTOB 1WKKA 1OYEA 3I4HX 4EO6A 2FQQB 3GJRB 4LF9J 2ATLA 5A2QY 1X0FA 2VFRA 4P7TA 3BPSP 2V8PA 1URRA 2GHVC 2OKQA 2AJ4A 3K5NA 1NXIA 2V6AA 3N4WA 2E5LF 2W2MP 3W9HA 4OHXA 2HBRB 2CQHA 1XIQA 2QA4S 1S59A 1SKWA 1N32F 2PMHA 2GGPB 4C4WA 4KJIA 4DSJA 2DITA 5B08A 2CA9A 2ZC4A 3P49B 4AUKA 2LYVA 1KD1T 2W9CB 3EE3A 3HM9A 1U1MA 3ULHA 3SBMA 3D68A 4X4OA 2HFZA 1XK8A 1XC9A 3C19A 1A6LA 3VZIA 3CIMA 3BR8A 3KLGA 4LF6F 4DR6F 5K8OA 4QYRA 4F2RA 2R2TA 5C25A 1UFWA 4M95A 3Q23A 2UVVA 3QMQA 2CPFA 3OPKA 3M30A 1CJVB 3PJXA 5L39A 1J27A 4E98A 3DLJA 3FVYA 5MLCV 4HTIA 4EYIB 2VFVA 4DV3F 1UW4A 4JI2J 3KJNB 2L48A 2QMUB 2IC3A 2CG8A 2VKRA 4EO8A 1SH2A 3I55S 4P6QA 1FRHA 3PDNA 3K2YA 3LAKA 4LF7F 2YKAA 2H1YA 1M1KT 3R2DJ 3ILIA 4PXEA 3KLIA 1Q81T 2A6OA 2JC0A 4Q44A 3W8GA 3MAAA 4OI4A 3DLGB 1UTAA 1SH0A 3MD1A 2DNHA 5L38A 1HBUA 4JI8J 2J0SD 2PEHA 4PG6A 5KFWA 2POKA 5EWFA 5KG7A 3MPWA 3UD5A 3OL9A 2EEYA 1HR0J 3V81A 2JEIA 1TUWA 1VR6A 1QUVA 1NKCA 5A0YA 2WONB 3ITHB 1SJQA 3D3CJ 3HX9A 4J9KA 5C5JA 3BBBA 2OELA 4O44B 4A8MP 1YHQS 1N6QB 1AYEA 1Y0HA 1HQ2A 1IKWA 3FSIA 4U6PA 3T9NA 2CNOB 2VH7A 4EGLA 1SB6A 2KM8B 1SBRA 5AE3A 2L08A 2X3GA 1F9HA 1LFWA 4TKTA 2R7VA 1HIYA 4RBVA 3BB5A 1AUDA 2DBBA 3CCJS 1TFYA 4M5GA 4RNOA 2ZH6A 2ERRA 3D1OA 3HT3A 2Y1LB 2ZWOA 3FNNA 1Y5LB 2OPRA 4KPCA 3S7RA 2BJ8A 5KOWA 1XBWA 1LWEB 1RWKB 2V2ZA 5D3GB 4F67A 1Q8KA 2QSFA 4JV2A 1AXQA 4USVA 4CLPA 3IA0A 3ZNUA 1BLUA 3DM2B 4ECUA 2I0XA 1K8AT 3G8SA 1KOOA 3ZFVA 3Q8QB 4ZLJA 2W7AA 3PFOA 1JKHA 2I38A 2CZ9A 2IVFB 4IH5A 3OSPA 3M32A 4RW6A 1EZZB 1EHWA 2YKPA 5F3TA 4DG1B 1HKAA 1BWEA 1RHUB 4NX9A 2ZH1A 4DUYF 1NK5A 1FT8A 2VONA 3H42A 4DUZJ 2QA1A 4OLOA 1K0VA 4EUVA 4CNYA 3Q89A 3IXQA 4G65A 4DCOB 4ECWA 1S0NA 4JP8A 2Y1JA 3G8QA 5LSOA 5LXRA 2MYFA 1R8AA 4C8KA 3C14A 4USTA 5HAOA 1VS3A 4WFZA 1RE1B 3T6BA 4NA2A 3NS7B 4ZVOB 4QIVA 5HVHA 2M3DA 2AV5A 3CCVS 1FRIA 2W2PP 3LW5C 4USHA 3DHXA 1QY7A 2V94A 3EGNA 3J80U 1L3TA 4K2XA 3R6GB 1HD0A 4F0HA 1D3WA 5LJ3Y 2Y0BB 5IFMA 2V2QA 2R7UA 4FYWB 2E5JA 1S99A 3CW2C 1CSJA 1U0SA 1BY9A 1FI4A 1HI8A 4LF8F 5E0OA 1N88A 3G96A 1PO6A 4C3LA 2XSJA 2BKNA 2P6SA 3SMZA 2X51A 2RHQB 1DTTA 2DD8S 1C1CA 2DO4A 3NBPB 4C11A 1SJ4P 3QGHA 3QZ7A 2DEIA 2QFIA 2ZKUA 3OJSA 1S7HA 1X4AA 3GFHA 2AHOB 4ID8A 1IBKF 2LQJA 4IDKA 4NLDA 2C2MB 3E2EA 3HO1A 3R5BA 4K4TA 4FF2A 3OW2R 3AXKA 1L3SA 5CH7B 3CVKA 2X1BA 4CO5A 1ITPA 4J37A 3HXMA 2RH3A 1M5OC 3PO5A 4ED6A 4ZPBA 4ZMMA 1B64A 4K7QA 4GRSA 3SZ2A 2WVBA 1DTQA 5FDLB 1XMOJ 1P1TA 1T03A 3A13A 5CHCB 1O0PA 1KN6A 2KJWA 2AJFE 2NYIA 4X4TA 1JJ4A 2WZ1A 1JB0C 4ECQA 2V68A 3QLHA 1IM4A 3GYNA 3MTJA 2Y8YA 4I7FB 3GIMA 2WSFC 2ILYA 1VJQA 2B9EA 2OMLA 3OR2A 4WTYA 5M2PA 2HRUA 2BJ9A 2DGQA 2H5JB 1JLFB 1RXOB 4DDFA 2IAJA 5KT4A 4LIWA 1X4EA 1HNXF 2BE7D 3BKTA 4IG3A 2Z4PA 4O4GA 3WX8A 3OTOJ 3FDSA 1HWLA 4YHHF 2BRLA 3EICA 1C1BB 1HARA 1U2CA 4YOEA 5DGAA 5T14A 2KFNA 2YH1A 1LFPA 5T7LB 3N9UC 1N5YB 1L3UA 2VQFF 3AXMA 1RTJB 4CTAB 2XB2D 4QW9A 5KG5A 1F9EB 3BYRA 2E66A 1HNIA 3WZ0A 2OPQA 5HBMB 3EGZA 1LKZA 3J81j 2YNIB 1G1XA 1CBKA 2EKNA 4YN3B 5D4OA 3I5BA 5H9FJ 2MKCA 5GAHU 1TAQA 1CJKB 1U7LA 5B0GA 1V5VA 3H7HB 4TQRA 3KK3A 4ZP8A 4MFBA 4ECZA 2MKYA 1GK8A 5F0UA 3D6HB 1WI8A 2I2YA 4NEYA 3M2RA 4X65F 4DX5A 1X0PA 2UUWA 4NASA 2DIVA 5CYJA 1M1GA 1R0CB 2H5IB 3CDWA 1G7CB 4J9UE 2JFKA 3CCTA 2MTLA 4QR1A 4ETXA 4FDFA 5DLGA 3WDOA 4GKKJ 2HGMA 1NLKL 4RNMA 2P2CB 4JBCA 3JQMA 2F3JA 1EKSA 4EEYA 3ISZA 3C15A 3N01A 4LF9F 4O0NA 4B3OA 4JI5J 1U1PA 1FJEB 4UQGA 3I0SA 1S1XA 2L9DA 3U27A 5HK4A 4M63A 2OD4A 5ETPA 5BYSA 3F44A 2QLWA 3M8WA 2XCPA 2ZD1B 2E1CA 4B9NA 2COLA 5MAOA 3VGTA 3EM1A 2Y9HA 4ILMA 2HVZA 3FBEA 1X7VA 4PQUA 2OSQA 3O3LA 1X4GA 2KU7A 1AFIA 3QSIA 1BWVA 2R7OA 3DU6A 4MKYA 5CCMA 1XNRJ 1YI2S 5CYQA 1RHQB 5J2QB 2LXUA 2YPYA 1FEEA 3CSKA 5E33A 1JLGA 4F4XA 1R3NA 5HP1B 1XTZA 3EDRB 3KMQA 5DQHA 5HL7Q 1RAIB 2MGZB 2FHMA 3MFHA 4WIQA 3TEGA 1VRTA 4AT1B 4PWWA 3KLFB 4R25A 4CO2A 2PEBA 4ILRA 2FGCA 2VFTA 3SV3A 4DS4A 4OL8A 4JI2F 7FD1A 2GMLA 1FRMA 4K8RA 3MECB 2F8HA 2QZ8A 2G4BA 3G6VA 3FMBA 5BYRA 4MKVA 4MMOA 5T41A 1EQMA 1S9GA 4KR0B 2CRLA 3KK1B 4DFJA 3AOBA 4ED1A 2RUSA 3HKZD 3MM7A 2G2YA 2AZ3A 4JI8F 5IV3A 2HFUA 3FEYB 1RT2B 2CG4A 4PCQA 5KFHA 3M05A 3M7VA 2DO0A 3US5A 1S10A 3DGPB 3OUYB 2ASJA 1HR0F 2ZOMA 2ZOFA 4B3TJ 4KHPJ 4G1IA 4F7VA 5J2NA 3T5HA 4U7UK 3KG1A 2KG0A 4NE9C 4DQPA 2ABYA 1AFJA 3T3FA 4DV4J 3EGWB 3J7ZT 4ERDA 3D1HA 1O6XA 2XHWA 3AB4B 4ZPAA 2K8GA 2ZH9A 2H48B 3R97A 1DFDA 2XNQA 2FVQA 3HHLC 2U1AA 3TEHB 2R8KA 5H9FK 5EGYA 4ZVRB 4PG7A 1T9UA 2UUBJ 1XNQJ 4FYVB 3JQJA 1ELOA 2FZCB 3KHGA 2MHEA 5F3ZA 2OI2A 2B6AA 4GVBB 4BBYA 2CPJA 1X9MA 2QG9B 1TELA 4OX9J 1TMMA 2ZNYA 1WC0A 3E8OA 4I67A 1SKRA 1S6PA 1C4AA 4DX8H 4B08A 1QSSA 1FA0A 2ZDOA 3JSBA 4PG8A 2BDPA 2C28A 4C3KA 3PHEA 4TLQA 4UOCA 3W63A 3DOMB 4OYZA 3PIPQ 3ZTPA 3K7RA 1RTHB 1RAAB 4E8UA 5B0EA 5DDOC 4RW4A 1M5HA 1FK9B 2FVCA 2VU5A 1TL1B 2B51A 1PBUA 4NCGB 3RR8A 2E7VA 5K9FA 2OJ3A 4UUWA 1BHNA 3PIOQ 4OI0A 3SIPB 2CQPA 3Q8PB 3W60A 4OZ5A 1D1UA 1QSYA 4DUZF 4B9UA 4I2PB 1VC0A 4XO0A 4CLZA 1FD8A 1UFKA 1UJ4A 3BREA 1SV5B 3MM6B 1NDCA 3IG1B 1VC5A 2RQKA 1RWNB 3FKBA 1RYRA 2YXLA 4B3RJ 2C3OA 3MMBA 4FF4A 1SUQA 3L09A 1SJRA 4A8YA 3IR5B 2ZBPA 1M90T 2WRMA 4IR9A 4WIIA 1IUJA 2GMJA 2AJ0A 3ILOA 3M1VB 2DISA 4OYMA 1LK5A 4OMFG 1WHYA 2CAJA 2WBRA 4CO1A 1S57A 2VODA 1T9TA 4RU9A 5IT9U 2G0JA 4XPEA 4N7TA 2MLXA 4ELTA 1FWPA 4WP3A 3SCLE 2HLTA 5KFOA 1T7PA 2ROEA 3B54A 3LWLA 2RB7A 5ETLA 5CZVA 2VG5A 1X8DA 2FUG9 2O5DA 3W8PA 3BM7A 2DGUA 2V5HG 2YQ0A 2QYGA 2YWFA 1GT8A 1FKOA 4F0MA 1RTDA 4URGA 1SJ1A 1UWAA 4Y2IA 2GZOA 3KWMA 4P73A 4EBEA 1NMEB 2ASYA 3K59A 1RTIA 5ITHA 4PAAA 2LVWA 4ANCA 2CWKA 1VJWA 2H51B 3K0JA 2M2BA 1CS4A 4KO0B 3JSRA 2VD3A 3HHLA 2EFPA 1FCAA 2AGQA 1XMOF 3UR3C 4H4MB 3DYAB 4J91A 2VBYA 5E3PA 2KB2A 3HZEA 1R0AA 3AAWB 3RBEA 5DGBA 4M5MA 1RYSA 2J6SA 1ZTTA 4NRTA 5E2QA 4AL6A 2VG7A 3TYTA 4OHZA 2GIQA 2M8HA 1FERA 2V8HA 1DARA 3CD7A 3QT8A 4XK8C 2MQQA 4LBIA 2ZVIA 1FNXH 1REVB 2KHCA 3OTOF 3PY8A 4ZPDA 5ETMA 2DY1A 4A46A 3H5SA 1WEXA 4DLGA 1RGVA 1FX4A 3BF4A 3AOAA 1H72C 3DRPA 1HYSA 1LWXA 2MB0B 1GXLA 1QAXA 4IFYB 2Z2MA 2J9EA 3PX4A 2NREA 5L1JA 2RF2A 2ZNZA 5K8PA 2K7KA 3H4BA 3GTYX 3KUGA 1UA0A 1EIYB 5EX3A 2QA2A 2C2ZB 3T5KA 2YWEA 2E1PA 1QLNA 1BQXA 1IKVA 1FFWB 2XMWA 2E5GA 1S5ZA 1VDHA 3OHBA 4TU7A 3K8VA 2J7WA 4ZCMA 3MOJB 4FYDA 1VBKA 4HT7A 1PILA 2H9ZA 3B82A 4FXWA 5FLXY 3DRRA 3KLHA 4FPRA 3KKFA 5KFAA 3B78A 1KTVA 2PA3A 2KI2A 1HW8A 5AXNA 3KK2A 2HYIB 4EZ6A 4OJ3A 3KLGB 2CJAA 2CZVC 2VOOA 2EWHA 3CC7S 3P6YC 3MR6A 3QWPA 4IR1A 4HDGA 2R3VA 4GKKF 4Y65A 4YB1P 4U7UD 2NXNA 4DFKA 4B9VA 3IR7B 1OPIA 5KFEA 1QVFR 1P8GA 1RWMB 1SCJB 1CEZA 3CCQS 2NR0A 2GAHC 3D54A 2IC3B 1ZAVA 3C6TA 2CQBA 2MQMA 1UVNA 4QYZJ 4JI5F 4NLVA 4DHVA 2K1RB 4I2QA 1GXUA 2GVZA 5EX0A 3NNHA 1PJ6A 2RNEA 5KFRA 3MR7A 1TAUA 2D41A 3KLIB 2FYXA 1RAEB 3EPIA 5EWGA 4OYOA 1VISA 5C2GA 1UWBA 4LT6A 5ETRA 3K89A 1HBUB 3IWLA 3M2UA 1WC4A 2VJVA 1SIZA 4RX6A 3FBCA 1XNRF 3FQKA 2J5AA 3V81B 2RRAA 1W2BR 4UY8T 5KAKA 4FNHA 5A0YB 2UV8A 4WFBQ 4ES2A 2BUNA 2NSCA 4A8QA 1QD1A 3PYGA 3LO3A 4DF4A 2UXCJ 4LVNP 3H8YA 2PN6A 4R0EA 4N8NA 1JLAA 4QWDA 4DS5A 4R0JA 1IKWB 1RKIA 1NZ8A 2GA7A 1WSRA 1U25A 2G0IA 3FJ2A 2KFYA 4UOGA 3HSGA 1U8SA 2HQCA 5LSRA 5ETQA 2XLKA 3D0GE 4J9SA 3MUMP 4NLOA 1CQNA 2ZH2A 2D9OA 3U7JA 2QJ3A 2YNHA 3CD0A 4MAKA 2OPRB 2VZ9A 1X31C 4ZVUB 2JEFA 3U02A 3OFGA 1V3SA 3N5BA 4QJVA 3RJMB 4HHUA 2KZMA 3QGIA 2DRBA 2LCWA 3AODA 5F9NA 5ADZA 5M2RA 5AXMA 2SXLA 3IM9A 4KHPF 4B3TF 4WKRA 2Y3YA 3W1YC 2HWTA 2KVQE 2MXYA 1FDBA 3G86A 1RWUA 4DR7J 3OL8A 1QAYA 1VIXA 4RW8A 2DHXA 2PFDA 3HDSA 1SH3A 4DV2J 4DV4F 1JKHB 3QO9A 1BQMA 4C3MA 3M32B 4C8LA 2IMWP 4KYZA 4RW6B 5LT5A 2O3DA 5B0DA 3CDBA 1NK9A 4UOFA 3CWJA 4L72B 4WFAQ 4LSNA 4JYAF 2A18A 3JS9A 2W9BA 3D0IE 1IM6A 1WDTA 2Z57B 3Q8YA 1TZ0A 3WIVA 5JUMA 4QIWD 2R7XA 3M8RA 4YEAA 1XNQF 3OVBA 4EZ9A 1PC5A 2FC9A 3C14B 5DETA 4C8OA 4OX9F 3PRVA 5LM7E 1UEVA 1HD1A 4IH7A 4UOHA 1VQ6S 5BR8J 2A2DA 3VAMA 1MWQA 1FKPB 4QIGA 1I6JA 1WOPA 4CH7A 3PR5B 4P75A 2XCAA 3LOUA 2QL7B 4DX6A 1DY3A 2DTJA 2GIFA 2NPIA 1YZ6A 4WZMA 3O44A 4U8YA 1DQ9A 3SSSA 1J5EJ 5K8MA 2QV6A 4OV6A 2Y8WA 5CCLA 3A8IA 2XSJB 1DTTB 1C1CB 3I9V9 2IA6A 1UJ5A 4C11B 3J7YU 2M70A 1H3DA 2IM0A 4ALZA 5GAEU 5F9LA 4NEZA 3VR1A 4OZ3A 4DCJB 2HRYA 4PWDA 3MPUB 1SIWB 2BQRA 3AA8A 4BS2A 2PMWA 4R8UA 1MU2A 4YUDA 2GJ2A 4G3IA 2LFVA 3NGKA 4IDKB 3CTRA 2YWGA 3AHPA 5KFPA 4J9RA 1Q8LA 1YITS 2ZBRA 2HHHJ 4I6AA 4IRKA 4P72A 2F8MA 3CMAS 4B3RF 5LSLA 3I32A 2EFOA 2MZJA 2PIIA 3J81U 2AYGA 3CO0P 3M8PA 1DTQB 2LA6A 3RBXA 2RDIA 1T03B 4V19X 1Z2LA 1R31A 3UW1A 3PKYA 4LF5J 1TKZA 3GV7B 4GMKA 3QLHB 4ID5A 4JUZA 3HD2A 4OHWA 3DC2A 5F8NA 3MR2A 3H98A 3OR2B 3PTWA 2DIUA 3QBCA 4IOBA 2V4JA 2BYCA 1F0XA 2IAJB 1B3TA 2ZJQQ 5KFNA 3ZTSA 3SFUA 4LRDA 2YX4A 4EFAC 2DCUB 2UUCF 3OLAA 1HHTP 3EDQB 4RZRA 3G6YA 4IG3B 2HMIA 4O4GB 1IKYA 3BZQA 4D3GA 3D67A 4URSA 1ZOTA 4NLSA 1D0EA 1JLBA 3TA2A 3EVWA 1Z2ZA 1GQEA 4K4WA 2CQ2A 1X5PA 3MEEA 3L7PA 1TV6A 2HFNA 3QT7A 2XMKA 1X4DA 2B9XA 3DXSX 2LLZA 1HNIB 4QIFA 5HO4A 1S79A 4RUAA 2OPQB 3PX0A 4RNNA 1CJUA 2V4RA 1V3ZA 3JYTA 2WCXA 2QLBB 2HHXA 4CH1A 4JI3J 1HW9A 2J9DE 4RR5A 1VQNS 2XS7A 3HZGA 3KK3B 4MFBB 4OZ0A 3EGVA 1Q79A 3HD1A 2XMJA 1U4BA 4LSLA 1W25A 5IC6B 3UDCA 5A8WA 1FE4A 3MUTP 3N6MA 2YY3A 2LMIA 3MD3A 3LAMA 1H2VZ 2HSEB 2H5EA 2O1PA 3OT9A 4NZ7A 4HHHA 2RJZA 1XN9A 3RRKA 1OWXA 2MZ1A 1XERA 5LMNJ 5CXTA 3CGIA 1VLYA 4USUA 1PG5B 4KH0B 1U47A 1P9YA 2B7BB 1MN7A 3BQ0A 2BM0A 1T94A 1YBAA 1QTMA 1W26A 1FX2A 3NS6A 1RT1A 3C15B 1YJNS 2EFNA 4MIWA 4W92B 1XMBA 1HMVA 3QRRA 2J0QD 4B3OB 3I0SB 1S1XB 1EJ7L 1AROP 2UVRA 5KFFA 3CCLS 5DQIA 2YWWA 3MCNA 4NLTA 1IJFB 1S72S 4F50A 1WG4A 2VKZG 1X4BA 1JLCA 1AB8A 2XO7A 3DNCA 4PQUB 2I5JA 3TJAA 3L7OA 4KC5A 2JFDA 4MJKA 3CJ4A 1KRPA 1T9YA 1LW0A 1YZ7A 3IAM9 1WG5A 2XMAA 5CYQB 1CJTA 3VVUA 3SQOP 1JLGB 2VJUA 3FMWA 3WC2A 2V63A 1SJ3P 1NK7A 4PQAA 5KFDA 4J7CA 2ZZTA 1CG2A 1VRTB 2W4PA 5HN0A 4MYTA 3LGNA 4M1KA 2JEGA 1A9NB 1KLMA 1JNZB 1WC5A 1MG7A 3C16A 2CZ4A 5DLFA 1T3NA 2IBKA 2AZ1A 2Y1IA 2YTCA 1XMQJ 1HI0P 5L1KA 3TANA 1A7GE 3MMAA 4NYOA 1WACA 5D0HA 2LXIA 4ZVGA 2DPJA 3BO4A 2JRSA 2BKPA 1UAWA 3MM7B 1YQHA 2R4FA 2XM3A 1R7IA 3Q86A 2BE2A 4RLEA 2YKOA 4ZJLA 5A76A 4ED3A 4N41A 3K5LA 3DMJA 1G3OA 1L3VA 3J7YI 3MMCA 4ECTA 3QAUA 5GAEI 5IZHA 1L5UA 4JI7J 3NL0A 1TP7A 2KT2A 1F2HA 3EPGA 1WC6A 1ZTWA 4ICLA 5J2NB 2EFGA 2GX8A 3J7A1 5IV4A 3DFEA 2UXCF 4K59A 4BC9A 2X3DA 2RVJA 3BDEA 2EBEA 4F36A 2KXFA 3KJQB 2WAQD 2OMOA 4KGMA 5KG2A 4IO1A 3PNIA 4USJC 2MZSA 2DXDA 3AFGA 1B0TA 3BV8A 3IP0A 2HQIA 3JAMU 2ZBCA 2HZCA 4DCPB 2EG2A 4PXDA 3H5XA 2AYEA 2HKEA 1S1WA 2EC2A 4C8NA 2HVDA 4WPAA 4DR6J 4HEA9 4A4JA 2B9WA 2GQCA 3RBZA 2EXUA 4YFUA 2B6AB 2VF3A 2VBXA 4F25A 3ZTQA 2YX7A 3MR3A 1GMVA 2MQPA 2Z2LA 1FDDA 2CQ1A 3QJJA 5SZTA 1T9VA 4DV3J 3VWSA 2KTQA 4K4SA 3KJFB 1WSVA 4PG4A 4WU2A 2WK4A 1S6PB 2AKWB 5THWA 1N48A 1VMBA 4DR7F 4TU8A 1Q4RA 1LEOA 4LF7J 4QU6A 3H2UB 4DV2F 3HHNB 2RKIA 2VICA 1HPZB 4F26A 4QR0A 4FF3A 2NCKL 4UW2A 2ZH3A 2MSTA 4RW4B 3BO3A 2V0NA 4OJGA 3ZZOA 1OQ6A 2NZCA 8AT1B 2WVFA 1U2FA 4H4OB 3H5YA 4NLYA 5GADU 3F56A 3W2VA 2XQCA 3TX8A 3RB3A 3OD2A 1Z1ZA 3LP1A 1TFWA 5B0AA 4NLRA 3K8WA 1PC4A 1SC6A 3TW0A 1YRXA 1JWWA 1S1TA 4EYHB 5BR8F 5IT0A 5CYMB 4KHMA 2NPFA 3HHKA 3W64A 4LFBJ 1ZETA 2KRRA 5HI7A 3MMBB 2F40A 1SUQB 1S76D 2VDHA 5HJXA 1JMTA 2OGUA 2JH3A 1SQGA 3UPFA 3LALA 1H2TZ 1PJ5A 3QNWB 4TNOA 2CWXA 1J5EF 3TI0A 2Y0SD 4CNZA 1FVSA 2L3MA 2UXBJ 1JJHA 5KTQA 4OI2A 2RAQA 3CMES 2XI3A 2BR0A 3LTOA 1MSWD 1TK0A 4CDIA 3D4JA 3SI8A 1Y00A 5LXYA 1UZHA 4IQXA 4LRBA 2VG5B 4F3QA 3QFHA 2FVSA 2XS2A 3S01A 1FKOB 1RTDB 3PW4A 3TUIC 3CCUS 1SL0A 2FHOB 1K73T 1Y3JA 2HHHF 3VHQA 3OJUA 1RTIB 4FBTA 1GH8A 4FXDA 2MZQA 1S4EA 1VQ5S 4Y2MA 2HG4A 1CS4B 3CCMS 1Y3KA 3HHLB 4A48A 4CLTA 1EAYC 3FCHA 2DKOB 2VFUA 1PBAA 5DDPC 2GC8A 5AXLA 3HI9A 1H7XA 1FFGB 2DXEA 4FBUA 1WOSA 1R0AB 4LF5F 2HQGA 4BWMA 4IUFA 1OO0B 2LP4A 3L9ZA 1KQSR 2ZH4A 3CJ8A 3B8HA 4USIA 2OD6A 4NA3A 3VQTA 4AFFA 3HHEA 2VG7B 5A8KA 3CJTA 2VDIA 1OSDA 3GE9A 3WBZA 3HHLD 2R7TA 2XYPB 2XC9A 1HNVA 4RW9A 4N5SA 3JB9k 1EETA 3BN7A 4JI4J 3GU0A 1CULA 5F8JA 1S9FA 1EX8A 1OQ3A 2CPZA 1NHVA 5ETOA 5H1SV 4CWBA 5L9NA 3BEGB 3OFHA 1HWKA 1YJVA 2YKMA 4DOZA 1NM2A 1F5AA 5J1NA 4HACB 3DRPB 1F60B 2CJXB 4I4BA 4FS2A 2DH8A 3OSNA 2FJVA 4C8YA 3D0HE 1BGXT 1NJXA 2BXJA 1KBRA 4PUOA 4ETZA 1OSCA 4J9QA 1HQUA 5G0RA 4MKBA 2YQ3A 1FXRA 4RNHA 3CDEA 2DNNA 2JEJA 1FTRA 1KDNA 4JI3F 2MQ8A 4B9TA 1NDPA 3CUNA 3LH2S 3ET6A 2BW2A 3UQSA 3IRXA 1TL7B 1IKVB 1LW2A 4DSLA 2N7CA 4OX6A 2IHR1 1JIHA 2ROPA 1WC3A 3SSQA 4ZVQB 5IM0A 2HK3A 4B17A 5D77A 3CC2S 2GV1A 1CC8A 2IVYA 3DRRB 1UEUA 3KLHB 2D3ZA 3A8KA 3HSDA 5KFXA 1ULRA 3KK2B 2ZBIA 3SEOA 3RYLA 3H90A 5LMNF 2JHEA 1TUGB 1GMWD 1NKEA 2N3OA 3EXYA 3UCGA 3H25A 1KHVA 1WF0A 3H40A 3CPWR 3L4BC 5ETSA 2OFHX 4FKYA 4GKJJ 3UFCX 2QEXS 2HVEA 1S7IA 4ED0A 3F73A 1YJRA 5E3AA 2Y1RI 1TKTA 4ED8A 4K4UA 1ZZFA 3C6TB 1IWGA 1Q95G 2HVIA 2HRTA 2XLJA 4I2QB 1RHJB 3PX6A 2GVZB 4IH6A 3UDEA 1S1UA 2VB6A 1Y5NB 3QIDA 2V50A 2LEPA 2HZAA 1HNZJ 5JXSA 3FK4A 4TVAB 3DRYA 1C4CA 5EWEA 2BE9B 2DRAA 3OL7A 1UWBB 3QGGA 4A8XA 4XDCA 1QAIA 4PG5A 2H4YB 4LUBA 4HVZA 4M5IA 3UN5A 4RL1A 1MMDA 4RBUA 3BGRA 3OR1A 4NI2A 2QN6B 3EVMA 1S6OA 2ZITA 2YQ1A 2KT5A 3DCAA 1JLAB 2MPUA 4A47A 3HHDA 3VAIA 1KEKA 1VYAA 2P9EA 3DLEA 1IQZA 5HLFA 4FVCA 3J80Y 1RACB 1XMQF 4LVOP 2HWHA 4X65J 1D09B 2F1FA 4J9LA 2W8KA 3FCVA 1SQFA 2DNKA 4YDXA 2CQ0A 2BA9A 1WD6A 1PCAA 3IS9A 2VIHA 1NZAA 1E6VA 1IBMF 4OIXA 3VVTA 4KRWA 5D4LA 1K9MT 4WZQA 1XWLA 2YNHB 2XZWA 1HBOA 1VQ4S 1TVRA 3R5GA 4GC6A 2RIJA 4XAKA 3V2UC 3QATA 4PABA 1N0UA 4JI7F 2KT3A 3A8JA 3EUNA 3IBCB 1CVJA 3KHLA 1RISA 4ELVA 4LFAJ 3HCXA 4RW8B 3WX4A 2W1BA 1OY9A 4NRUA 1T95A 3UR0A 1S0MA 2XZTB 4I56A 4KGXB 1AZSA 3QO9B 1BQMB 3NGRA 3GCXP 4KT0C 4C48A 1F9FA 5CA5A 4HYKA 2UXDJ 4QWAA 3C6UA 4G1PA 1RHRB 2H65B 4LSNB 4M5JA 3OTEA 2D7SA 3FBFA 5L1IA 4OJHA 1H38A 5B0BA 2B43A 2V2KA 3MM8A 1UVLA 1BUXA 4LF1A 4OQJA 5KFZA 1N33F 3P4UB 4V1Ak 1WNEA 4ZHRA 2OPSA 1H0HB 1D9AA 3KDNA 1R89A 4CT9A 3NGTA 2I1RA 4Q0BA 3NNCA 3TP2A 4CYUA 3FFIB 5JMNA 5AJ3J 3U1LA 3CO9A 4K0KJ 1HLWA 1V5IB 2HQDA 4UUXA 3KUEA 3TAMB 4XIUA 1SPBP 1UETA 1AW0A 3V6HA 1TR0A 1I3OB 4E0DA 4HDHA 3D6TB 3Q2SC 4YR0A 1RZMA 3K5OA 1OMSA 3DLKA 1KP6A 2OHDA 4ZP6A 3ENWA 4C7QA 1HHSA 3KOAA 4CM2A 1N34J 3FC9A 1KVJA 4OI1A 2JVRA 4AYBD 3MEDA 3G71S 2KRBA 5HQLA 3CT9A 4DV1F 1WHVA 2BV3A 4Q8FA 3N79A 1A0OB 3H20A 1HWJA 3WHIA 3T5JA 4PWDB 4DL7A 2AEJA 4R8UB 4OZNA 1MU2B 3QAEA 1WOOA 4RBTA 4ZPVR 3CB4A 3Q24A 1RWVB 3LF0A 2C3MA 1NRKA 5H9EK 3L3CA 3ZZPA 1T3OA 1NH7A 2VG6A 4DV7J 2IVMA 4LFBF 3MI7X 2PMZD 3M8PB 3I6PA 5B0FA 2XMMA 4FXVA 3TA1A 1MMNA 1Q53A 2R8HA 1NB7A 1X5SA 3KLVA 1TKZB 3RW7A 5DM7Q 1QDUB 2E1AA 3RB0A 4ID5B 3OBIA 2ALYB 3IGNA 2HK2A 3FEXB 4C6AA 3ZNJ1 2UXBF 2OTJS 2PD1A 3Q8UA 4NMLA 5KFCA 2V4JB 1VK3A 2XWYA 2PFFB 3O5TB 3FUYA 3PM9A 3MURP 4M94A 3UCZP 5J1PA 3NEKA 2HMIB 3SCIE 1L3KA 5LMUF 4F8RA 3LANA 4OYIA 2DNPA 4JI0J 1QSLA 5HMXA 5C2CA 2PI4A 1JLBB 1D8YA 1XQIA 1FJGJ 3BQ2A 1APSA 3POTA 1S6UA 4USWA 1V9OA 3MEEB 1VK8A 1TV6B 2R7WA 2ZWPA 8ATCB 2QL9B 4LRCA 3NKYA 4ENOA 5B09A 1NPKA 2E7WA 1FRJA 5FDLA 4DJBA 1WTFA 1CJUB 4PEOA 3D7SB 1NK8A 4ZVPB 1B99A 3JYTB 2BVZA 3GSDA 4KGVB 2W2OP 2V9KA 2WB4A 1YJTA 2J7UA 3BKUA 2G9OA 1GEHA 3TQ1A 4MIBA 5JVGQ 5A8WB 1JLFA 5B0CA 2V4QA 1Y10A 1YGYA 4JI4F 3WC0A 1VLOA 4QWBA 4UT4A 4C9DA 1UW9A 2W24A 4K4VA 1NUEA 3AB2B 1YRTA 2AT1B 4U9RA 3NXZA 3LGHA 5GMDA 1Q0NA 4C8MA 3KLEA 3TA0A 2A1BA 4KH1B 1V6HA 2AMCB 4H4KC 3GR1A 1UVKA 3NGUA 2KDOA 3OFFA 3I82A 3CMQA 3CIZA 1MLAA 2LQ5A 2WHOA 1HMVB 2LDIA 1NPPA 2MMYA 2VASA 3NOCA 4WP9A 1HQEA 4GO5X 4TYAA 2ZFHA 3NNAA 1S49A 3H59A 2CYYA 3MM9A 2QC3A 5GMEA 2DJWA 4IYQA 1JJCB 1TKXA 3EMTA 1JLCB 2WVDA 3OXLA 2BACA 4WJBA 2CQGA 2I5JB 2NUUG 1GX6A 4M5HA 3Q8SB 3UVJA 4USKA 1S12A 3KFWX 1LW0B 4OYXA 3OXFA 4RNFA 4HHJA 2J6UA 1OJ4A 4C97A 3KHRA 2XYGB 1X4HA 4UZCA 2CPYA 4EI2A 1YWXA 1AA1B 3DDNA 4OZLA 3CCSS 1UVIA 2EK1A 3VV2B 1LXNA 2G2ZA 1T02A 1H7WA 3QJLA 3AD8C 2ZC3A 1JNRB 4GKJF 3TOQA 4GC7A 4J9MA 1U1OA 1KLMB 3MPVA 1UPPA 4JV1A 3C16B 3I87A 3R5AA 1DQAA 4MKAA 4ZITA 1HNWJ 1DLOA 4ANEA 3M6UA 2HS4A 2W7OA 4DSEA 1M1HA 1M5SA 3QRQA 1HNZF 3MMAB 4OX7A 3TQEA 2ZD1A 1OS5A 3QYYA 3R1LA 1UFLA 3E3XA 2KXNB 3VCDA 2UV8G 5KFLA 3MCMA 3GJTB 1OIAA 3ONQA 2BE2B 1PKUA 4I0WA 2MHNA 4N77A 3TVZA 3DMJB 3TJ9A 3ELHA 3T6JA 5I3PA 3ISNC 3MMCB 4O0IA 2VPZB 2DNGA 2C2RA 2F65A 4F4WA 4ZP9A 4HT5A 4ICLB 2JX2A 3I9ZA 3R7SB 1DURA 1MWYA 2OAUA 2MDAA 2RQ4A 1RHMB 2B0GA 4HI2A 3RRGA 2E9RX 4C98A 2XG8A 2Z30B 2NS1B 2PO4A 2E5HA 4K50A 4LBPA 2FLNA 2GW8A 2KL8A 3GFXA 3K5MA 5GMKa 4DL5A 1ROFA 2MY8A 2DB1A 3I31A 3MEKA 2CJ9A 2NUHA 3F41A 1MROA 3HK2A 4F02A 4X4PA 3CJ0A 3H2VE 3NP5A 1HHQA 5FJ4A 5HSPA 1S1WB 2JDJA 2QO3A 3U1MA 5EN1A 5IOLA 3IWXA 3OL6A 3RRHA 2YNGB 3RU0A 3E51A 5IT9Y 1RAHB 1UZDA 4CQ1A 1WORA 2BJ1A 4DWIA 3NMRA 1Q5VA 2CQ3A 2WVCA 1RT3A 2HHSA 3OVAA 1FRLA 2AIRB 2KZZA 3KXDA 1QE1A 1R8PA 3D3BJ 4LFAF 4Y34A 2YWKA 3L7UA 1EP4A 3TUZC 2FZKB 4MH8A 4WE1A 2RKIB 1SVDA 2IFXA 2MEWA 2VFSA 1KQKA 3UNGC 2Q66A 2W9AA 2DGVA 2YBVA 4DL4A 2J9CA 2MJUA 4AQYJ 1YJUA 2CDRB 3LP2A 4IG0A 2UXDF 5AE2A 2CPIA 1U45A 1IXKA 3BGLA 4JB8B 3BQ1A 3BO2A 1BQNA 3CE8A 3MCSA 3W2VB 2AX1A 1I1GA 3LP1B 3GWCA 2DR9A 1ZH5A 3JTPA 3C66A 2FJEB 3LP0A 2DGTA 4TU9A 3UDVA 1NJIT 5AJ3F 3W7BA 1IBCB 4DPTA 2VUGA 4LQ9A 1FFSB 4K0KF 2UU9J 5DZ7A 1VQLS 2EC0A 2JJ4D 1KSPA 2OLWA 1NB2A 3QIPA 2ZKTA 1YLXA 5C24A 2E1RA 2B8PA 5GAGU 3VGVA 3C46A 5I3QA 1N5TA 2ZVSA 2F63A 4DZ6A 1WG1A 2ZEJA 4ZIVA 3D6MB 4RUHA 1GFWB 1J5OB 2D74B 1D9DA 4QBUA 1WEZA 2VPXB 5KFYA 1YDLA 2XULA 1N34F 1RJJA 1TTHB 2NXEA 2ADCA 2NSBA 3GSIA 1T05B 2PC6A 4ZCIA 2AGPA 2QE5A 1WWHA 1Q1KA 3ZXWA 2KKHA 4ZPWR 1IKXA 3R6LB 2N4DA 5D78A 4DPYA 4N56A 2MZRA 2F4FA 4FN5A 1SXLA 5DDQC 2OIHA 4XDDA 2DYAA 1PYTA 3NAHA 3KUHA 2EW9A 5M2UA 1VBZA 4CLUA 2IBOA 4ZVFA 2Q6BA 4DV7F 4M5LA 3G2XA 2WW8A 3F0NA 4F3OA 4LFCJ 1MN9A 3CCZA 4K4YA 4GVLA 3PR4A 4IQMA 4JYAJ 3EZ5A 2VL1A 5J2MA 4TY9A 1RHKB 1Y11A 1URNA 2AW0A 1Q86T 3T19A 4P52A 1UMJA 4ZVHA 2HURA 4HR2A 5KG1A 2L9WA 4DPOA 4Z37A 2N3LA 5A8KB 1TU0B 2YX1A 1PGZA 2KG1A 3MCOA 4HH0A 3IO1A 3KMSA 1HNVB 2IDLA 4RW9B 4AL5A 3V6DA 2V2VA 1Q8BA 1EETB 1P6TA 1CULB 2ROGA 3CJRA 4DPXA 2DK2A 1U1RA 1BD6A 4JI0F 5L1LA 6FD1A 2BEFA 2YKMB 3W61A 1NBEB 1FJGF 3PYEA 2BANA 4LSZB 1B0PA 2VA3A 4X4QA 3MEGB 1UVJA 4KFBA 2Q3PA 2G1DA 1MW7A 4OYAA 4PUOB 2H54B 1HQUB 2C42A 5G0RB 4KBIA 4DF8A 1YJWS 1VHIA 3NS5A 3C3LA 3QGPA 2IYIA 3R3TA 3BSOA 2LU2A 4W90B 3D9BA 2B4PA 1LNQA 1LWFA 4RPFA 4DR5J 1S6QA 3THPA 3ET6B 3IRXB 4HL9A 3FSXA 1LW2B 2I9SA 3IRWP 4YS2A 4R5PA 1ACMB 3LA0A 2EFVA 3KDOA 4K5RA 1FEHA 3TZYA 5IM0B 3BGFA 1TUVA 4MTPA 3DI6A 5IQQA 2RDDA 3AY0A 2ZZNA 5AT1B 2G2OA 5J1EA 2MKIA 4RWXA 2WOMA 2PI5A 1JXEA 1U0HA 4I69A 3NCQA 4YB6A 3IR6B 3BDPA 5D0RA 2OP5A 6FDRA 5DO2A 3PEHA 4AXJA 1S1VA 1W7WA 4I68A 1WKJA 4WXWA 5F8IA 1R8CA 4RO0A 3OQ2A 1KHWA 1TKTB 1PAUB 2ZJPQ 2J8SA 2OEKA 1XJWB 5EDWA 2ADBA 4DZDA 2XMUA 3W5ZA 4ZKAA 4BCAA 2UUCJ 1JQGA 5HROA 3DKDA 5RUBA 3BR9A 3BYPA 2HBYB 1O8BA 2FJBB 1S1UB 2HNYA 4FKXA 3WIUA 4DU7A 1SL2A 2MY7A 3T41A 1R8BA 3O1LA 3P5BP 1S97A 2W8LA 3W66A 1NK6A 2WB1D 4DQSA 2XTJP 4PPZA 1PAEX 3H0PA 3EZOA 2AP6A 2QA4G 1Z4UA 4Q43A 2R7SA 4TLRA 1VRUA 4CO0A 1HI1A 2ZDPA 4Q8EA 4E2FB 1NK4A 1RWXB 4FF1A 3BGRB 3OR1B 2QLJB 4NI2B 3IFEA 2EG1A 1NSAA 3DGVA 4DQRA 5KFVA 1LOUA 5D0EA 3CD6S 4Z2XA 2E7XA 1YG0A 1RWPB 1VGYA 2ZH8A 4WF9Q 4AE5A 3MPYA 1H73A 3DHWC 4I6WA 2P5VA 2FHJD 4BHQA 2GS8A 2HGLA 3DLEB 5I42A 5HLFB 4CP5A 4ZVTB 2JSXA 3SSRA 5GAGI 5HMWA 2K1RA 5HVGA 1HNWF 2IRUA 5SUHA 1IJEB 1NKBA 2IM2A 2BRKA 5DDRC 2VA2A 3AD9C 4L73A 5A8RA 1PYOB 4ZN1A 2HNZB 3IS9B 5HJYA 2ACYA 1TMJA 1O51A 4YP3A 1E6VB 4UF4A 2XY6A 3HSJA 3ZZTA 4OZ1A 3M8ZA 3THTA 2AQ4A 4MIAA 1HBOB 1KQGB 3UN3A 1RP5A 1TVRB 2UZAA 2DH9A 1HBMA 3W2WA 2HBZB 1HL6A 3OFEA 3PW2A 4ZOSA 3SCJE 1X5TA 3G4SS 3FGVA 2XBPA 4J9PA 2RRBA 5CQGA 2YWHA 5KFBA 2A3JA 3JTOA 4H54A 2X7IA 4DXLA 1GMWA 4TY8A 1AZSB 1IWAA 3T9ZA 2BQUA 1NDLA 2RQMA 1O5JA 1WUUA 3C6UB 2MQOA 3KG4A 3EXCX 3J81Y 3LUYA 1VC6A 2ZZMA 2K3KA 3MM8B 2G1HA 3W9JA 3TAQA 2F4VJ 5D6GA 2M0GB 1YTYA 1C0TA 4ZHRB 2LQ9A 2OPSB 3TUJC 4X4RA 3CNQP 3CXCR 2OH2A 4ECRA 2HIQA 5C25B 4Q0BB 3AJ1A 2D3UA 4CYUB 4F4YA 5I4MA 4DEZA 2HFSA 5CAAA 3M30B 2X1GA 3MR5A 3EX7B 2V8VA 4FPIA 1T9XA 1U1LA 5HATA 2FD2A 3B4MA 1RBAA 3VAKA 4N76A 2W4CA 4PRFA 2ZH7A 3DRSA 4LR7A 2HPUA 3NCRA 3EYZA 4L76A 3DLKB 4CLSA 3MAAB 3H4DA 3TZXA 1DZ5A 1TL3A 4U7CA 3M9MB 4AQYF 2C2NA 1RA6A 4DPUA 3PO4A 1T0TV 4DBQA 3A4TA 4K4XA 3DOKA 3TZZA 2CUYA 4QU7A 3MEDB 2F7VA 2XSFA 2DH7A 2IRXA 4P2XA 5DJBA 2WW4A 5CD4H 4QCLA 1SC3B 3FZBA 3LWMA 1FHTA 4I1TA 2RUGA 4CI0B 2HFOA 2AU0A 2UU9F 3GG1A 4EK2A 1TK5A 4W98A 2OSRA 4MT1A 4O4RA 1FVQA 2VG6B 1FKPA 3CJ5A 3R27A 3E01A 5HANA 3A3OB 3PRDA 1VQYA 2QMWA 1X4CA 4OFZA 2RHSB 3HPOA 4N47A 2R8IA 3GONA 4ZVSB 4KV8A 4OHVA 5E41A 2LEAA 3TNVA 3D28A 3W9IA 2YVSA 5I3UA 5IC4B 1NU4A 2FGOA 1UA1A 2V67A 1FXDA 5K5MA 1S48A 4MK8A 4PKDB 2CVEA 4AXIA 1FKAF 3NLCA 2C3PA 1PYSB 2GO9A 3CCWA 4AL7A 3R1HA 4J5OA 5A2QU 1JLQA 4IFVA 3VAFA 1F5BA 2FJWA 3RB6A 1SL1A 3MFIA 1KQFB 1V3RA 1UJ6A 2M9KA 1OY8A 3G6ES 4YR2A 3EJMA 5E7OB 4CCHA 1KNZA 1BMQB 3POTB 4WCEQ 1FXLA 3A1YG 2XMTA 2W25A 3HLUA 2OO4A 4LFCF 2C1EB 3PEJA 5JJBA 1U26A 4ITSA 3ENAA 4QW8A 2GQ2A 5E3QA 3MTKA 1F2GA 1PSDA 3IC1A 2JZ5A 4LF4J 4X4VA 4ED2A 1LQ9A 3R7BB 3ZTOA 5KFGA 3W5YA 5L46A 3LPEA 1TK8A 3UNYA 2WSCC 4HLBA 4HH1A 1QJHA 4O3PA 2HW3A 1I94J 1GAOA 4ECXA 3GP9A 4Y6IA 1N5SA 1VHFA 1VIOA 3AQPA 2RSQA 4C2MA 1NAQA 3ZC4A 4D3HA 3GCWP 2HWIA 5AE1A 2C3UA 3KLEB 1F6TA 3PV8A 2B4UA 2M88A 1PJ7A 5C42A 4PR6A 3K58A 3CCRS 2UVUA 2J6TA 4J9OA 3MGJA 1AUSL 4QWEA 1HQEB 3QT6A 4DSIA 2F9JA 4X66F 2EKYA 3HF5A 2A2CA 2GIRA 5DZ6A 4DR5F 3CEDA 3GMGA 3P3DA 3MM9B 1WHWA
chains in the Genus database with same CATH topology
2XWXA 1ZM3A 4QWAA 3C6UA 1XMOF 3I0RB 3UR3C 1TKXB 4G1PA 4H4MB 1M5PC 4LSNB 1RI7A 4TXSA 3OTEA 2MGZA 2D7SA 3DYAB 2VBYA 5E3PA 2KB2A 5L1IA 1UL3A 2CDQA 3HZEA 4OJHA 3Q2TC 4YY3F 1R0AA 1H38A 5B0BA 3KLFA 2DHAA 2B43A 3AAWB 2V2KA 3MM8A 3RBEA 1UVLA 3OTDA 5DGBA 3P5TL 1IR0A 2E29A 3M4XA 2XS5A 1RYSA 1G6BA 4OQJA 2J6SA 1ZTTA 3JAMY 1CPZA 4NRTA 5KFZA 1H6KX 4YB5A 4EBCA 1N33F 1WNEA 4ILLA 4ZHRA 2OPSA 2HHUA 1H0HB 4ECYA 1D9AA 2CPXA 1R89A 2RRNA 5E2QA 4AL6A 3MECA 4CT9A 4KPYA 2DNOA 2EBGA 2I1RA 4Q0BA 2MSSA 3NNCA 2VG7A 1CC7A 2OFGX 3M2VA 3TYTA 3TP2A 4NLUA 4OHZA 2GIQA 4I6YA 2M8HA 3FFIB 4I64A 1FERA 2V8HA 4OJ1A 1DARA 3CD7A 4XK8C 2VPWB 2MQQA 3MWBA 1NNDA 3U1LA 3CO9A 2ZM6F 1FNXH 5KT2A 3KK1A 4RKUC 3DOLA 2HHPA 2U2FA 1RA7A 1REVB 2KHDA 2KHCA 3OTOF 2BJDA 1ZPVA 3PY8A 3CDAA 4DR3F 4UUXA 3V5RA 2HHTA 3TAMB 4NA1A 3GIJA 1J5OA 3NGDA 1QUPA 1NH8A 4XIUA 2CPEA 1E6YA 3TAPA 1UETA 1D8ZA 1AW0A 3V6HA 1JJ2R 3HVTA 4ZPDA 4ZPTR 1TR0A 4A46A 2VOPA 3CCES 3H5SA 2AD9A 1RT2A 1WEXA 4DLGA 1VBYA 1R6YA 1RGVA 1Q7LB 4Y3CA 2DNQA 3BF4A 4O3NA 4H4KA 4WFNQ 1X4FA 1T05A 4HDHA 4E0DA 1DLOB 3Q2SC 4YR0A 3DRPA 2ALZA 3G6XA 4KHRA 3K5OA 1HYSA 3DGPA 3DLKA 4CZCA 3OUYA 2B4VA 2MB0B 1GXLA 2B5JA 1TL5A 4ZP6A 1U1QA 2DR5A 1QAXA 2MQLA 3ENWA 4C7QA 1TQLA 3CD5A 4IFYB 2FIUA 2Z2MA 1HHSA 3KOAA 2O01C 4MK7A 3UD4P 2MKKA 4P2SA 1KTQA 5K14B 2JC1A 4C0BA 1KVJA 2JWNA 3JSMB 1Q16B 4IOCQ 4HKQA 2Z8QA 2E1MC 2J9EA 3PX4A 4OI1A 3GIKA 2NREA 2JVRA 5L1JA 2M4MA 4M5DA 4AYBD 5IQ6A 3MDFA 2EI5A 2RF2A 2ZNZA 3MEDA 3L95X 5J2PB 3G71S 2XLIA 2J7KA 1TKDA 5K8PA 2AYMA 2K7KA 2KRBA 2PGCA 4JV0A 4WKYA 3H4BA 1UA0A 4ED5A 5EX3A 3CT9A 4DV1F 4DR1F 1RT5A 1WHVA 2BV3A 4YDDB 2QA2A 4Q8FA 2RT3A 3N79A 3MZIA 3T5KA 2YWEA 2RD5C 4ECSA 3H20A 1HWJA 4CO3A 1QLNA 1WELA 1BQXA 3T5JA 2ZE2A 1IKVA 4PWDB 4DL7A 2XMWA 2E5GA 4R8UB 4OZNA 1MU2B 3M6VA 1N8RT 3QAEA 1RK8A 4KGKA 3OHBA 4RBTA 3TARA 4TU7A 2OPPB 4ZPVR 3PACA 3K8VA 2J7WA 4ZCMA 3MOJB 1W2IA 3CB4A 4FYDA 3Q24A 2PT0A 4HT7A 1PILA 2CPHA 5KT5A 3LF0A 2GO8A 4IRCA 2C3MA 1NRKA 4LJMA 3TRGA 3L3CA 3ZZPA 1T3OA 2MKSA 3CJKB 3U1NA 3QPIA 2H9ZA 3B82A 4FXWA 5FLXY 3M9NB 3DRRA 3KLHA 4FPRA 3KKFA 1VQ7S 1NH7A 5KFAA 3B78A 2VG6A 1KTVA 4JOUA 2PA3A 2VBZA 2KI2A 1HW8A 2IVMA 5AXNA 3UI3A 3KK2A 4BDPA 4ECVA 4LFBF 2E5IA 2HYIB 4Q45A 2D3OR 1G2EA 4DV0F 4EZ6A 4OJ3A 4QPTA 3KLGB 2CJAA 4Q7AA 3MI7X 2CZVC 2PMZD 3S6EA 2VOOA 3O6QA 2EWHA 3M8PB 3CC7S 2YKNB 3I6PA 1B0VA 3P6YC 4WYLA 5B0FA 2HGNA 3OLBA 3MR6A 3QWPA 4L6V3 2XMMA 4IR1A 3M2RB 4NLWA 4FXVA 4HDGA 1S1TB 2N82B 4GKKF 4Y65A 3TA1A 4YB1P 3SDEB 5KG3A 2FJXA 1MMNA 2KJVA 2ZHBA 3MHYA 1Q53A 2R8HA 4DFMA 1MROB 4DFKA 1NB7A 1X5SA 4NL5A 4OV1A 3IR7B 1OPIA 1S9EB 5KFEA 3KLVA 4B9VA 1P8GA 1TKZB 2CPDA 1QVFR 3RW7A 5DM7Q 2E1AA 3RB0A 3BSAA 4ID5B 5KFUA 1CEZA 3OBIA 3IGNA 3CCQS 2NR0A 1UKUA 3D54A 3FEXB 3JTNA 3PZPA 2IC3B 2HVHA 1ZAVA 3OHAA 3C6TA 2UXBF 3PRBA 2CQBA 2MQMA 2PD1A 4DMZA 1UVNA 5KFIA 4QYZJ 2OTJS 4JI5F 4NLVA 4ZK7M 1FJ7A 5KFSA 3RR7A 1K1QA 4NMLA 4DHVA 2K1RB 5KFCA 2V4JB 4I2QA 1ZZNA 1VK3A 1GXUA 2AYBA 2XWYA 2PFFB 3O5TB 3DOMA 5EX0A 2B9YA 2DHSA 3NNHA 3AH6A 3Q8RB 1XR5A 2RNEA 2HS0A 3PM9A 3MURP 3GV5B 4M94A 2NZ4A 1HWUA 4ZVEA 1P27B 5KFRA 1RTHA 3UCZP 3C2PA 4DL6A 4ZCLA 1HFEL 4B9SA 2ZHOA 5J1PA 1TAUA 2D41A 3KLIB 2HMIB 1FK9A 1NO8A 3I5AA 3MEGA 1U48A 1TL1A 3H5UA 1NJZA 3SCIE 3EPIA 5EWGA 4NCGA 1RT3B 1L3KA 4MYUA 5LMUF 3K57A 3LGMA 2JOQA 4DV5F 4F8RA 1JXLA 3LANA 5FD1A 2QRRA 2DNPA 1UWBA 4LT6A 1QSLA 5HMXA 1HBUB 3IWLA 1WEYA 2PI4A 1QE1B 2RMLA 3VQSA 4Q2LA 4UY85 1JLBB 4KKOB 1D8YA 2RS8A 3M2UA 3GILA 2FVPA 3SQGA 1SIZA 1EP4B 3BQ2A 1APSA 4ZLPA 1LWCB 3POTA 3K5PA 1M0SA 5HP1A 2IJFA 4I2PA 3OV7A 2QIFA 4M8LA 4WE1B 1ZAXA 4ELUA 1S6UA 4RX6A 1XNRF 1V9OA 3MEEB 1VK8A 1TV6B 3FQKA 2JL9A 2R7WA 3T1HF 2J5AA 3V81B 2CJBA 2Z0GA 2RRAA 1W2BR 4UY8T 5KAKA 1C2PA 4FNHA 3IN5A 3MM5B 3NKYA 5A0YB 1C0UB 2UV8A 3SCKE 5B09A 5L8RC 2E7WA 1U49A 3X3UA 4WFBQ 4ES2A 1NK0A 2BUNA 1SV5A 2NSCA 3LP2B 4A8QA 2FLPA 5KFQA 1FRJA 1UP1A 3MM6A 4IG0B 2E9TA 5KFJA 4DN0A 2KYXA 3IG1A 5F8LA 5FDLA 4DJBA 3LO3A 4DF4A 4J9NA 2HQ3A 2BBEA 2LXFA 4NPOA 2D1CA 1WTFA 4LVNP 2R2UA 3H8YA 3X1LB 1NK8A 3P96A 2PN6A 3Q22A 3KNGA 4MK9A 4PWUA 4R0EA 3JYTB 4N8NA 1BQNB 3T1AA 1JLAA 2DR7A 4QWDA 4DS5A 2F4VF 4Q2MA 4R0JA 1IKWB 2BVZA 2DT9A 3GSDA 1RKIA 4O3RA 2GA7A 2V9KA 5HMZA 1U25A 3KNAA 2WB4A 1YJTA 3FJ2A 2APOA 4OI6A 2J7UA 2DPIA 2KFYA 2UUTA 1RT7B 4RW7B 1NHUA 3PW5A 1H2UX 1F5CA 1P1LA 2G9OA 3LP0B 1DRZA 3TQ1A 4ES3A 1FRKA 4MIBA 4Y2AA 1U8SA 5JVGQ 1Q7YT 5A8WB 4C0OC 1JLFA 5B0CA 3HP6A 2M52A 5LSRA 2C22A 3M1VA 4ZCKA 2V4QA 1S77D 3GQCA 2CQCA 4ZS6A 1YGYA 1U1NA 2KVIA 2G13A 3WC0A 4JI4F 2XLKA 3D0GE 2HAIA 4QWBA 2RS2A 4J9SA 1K1SA 3DXBA 5D4NA 4NLOA 3D5MA 1FD2A 3MUMP 1CQNA 2ZH2A 2D9OA 4C9DA 3NCPA 4TQSA 2XGPA 3U7JA 1N0VC 2W24A 4P7VA 4K4VA 3QIPB 3KJVB 2AWZA 3AB2B 5C24B 1YRTA 2YNHA 1Y7PA 4U9RA 3VF0B 4IO9Q 4WK3A 3CD0A 4MAKA 2OPRB 2VZ9A 5KFMA 2HNDA 3N6LA 3T1YF 3DU5A 2FPHX 4G1QA 4C8MA 4RU2A 1R8HA 2JEFA 3U02A 4Q5VA 1RT6B 3OFGA 1S9GB 3KLEA 5KT7A 3TA0A 3HJFA 1V3SA 2A1BA 2X1FA 3TR5A 3N5BA 1HPZA 4QJVA 3V4IB 2KZMA 3QGIA 1M5VC 2EK6A 2DRBA 2LCWA 3MAHA 1V6HA 5F9NA 1XR6A 5ADZA 5M2RA 5AXMA 5BJRA 4YB7A 2UUAF 2P9CA 2SXLA 2GNKA 4H4KC 4B3TF 4KHPF 3GR1A 4WKRA 1UVKA 4NXNF 2HWTA 3BS9A 3FQLA 2KDOA 2MXYA 4CO4A 1N5VA 3OFFA 1FDBA 3IAS9 3I82A 5F8GA 2DNLA 4X2BA 3CIZA 3G86A 4EBDA 1H98A 1RWUA 2VV5A 2LQ5A 2PSZA 2WHOA 2LKZA 4X4SA 3OL8A 1HMVB 2LDIA 1QAYA 2MMYA 1MMLA 1MWZA 2VASA 3ZZYA 1VIXA 2KO1A 4RW8A 4TN2A 2DHXA 3HDSA 1SH3A 4H4OA 1HQEA 2GQQA 2HS3A 1GTHA 3I4PA 4GO5X 4DV4F 4B3MF 3C8YA 4TYAA 1VQSA 3M6WA 1IBLF 2ZFHA 5GADI 1JKHB 3QO9A 1BQMA 4V19J 4DR4F 3NNAA 4C3MA 3M32B 4C8LA 2XI2A 4IKAA 2IMWP 4KO0A 4JI1F 1S49A 4RW6B 5LT5A 5GAHI 3MXHP 2JVOA 3AA9A 2O3DA 3H59A 2UP1A 2CYYA 3MM9A 1IKXB 3CDBA 5B0DA 1NK9A 4OHYA 3MF5A 2DJWA 3CWJA 4IYQA 4L72B 3UDLA 3I0RA 1LK7A 1TKXA 5AXKA 4F3MA 2FLLA 4H4MA 2BJEA 4WFAQ 4FVMA 4LSNA 3UE2A 1DJ0A 2MZTA 1CLFA 3DYAA 1JLCB 4FP9A 2XMVA 3OXLA 2BACA 4JYAF 4WJBA 3FZ2A 2CQGA 2I5JB 4ES1A 2A18A 2DNYA 2NUUG 2W9BA 3D0IE 1FESA 3EZUA 3IWNC 1GX6A 3ETOA 3Q8SB 4CT8A 3RTVA 1B7FA 3R5CA 3KFWX 4Y2CA 1LW0B 2I8EA 1X5OA 1TZ0A 2R8GA 3OXFA 4RNFA 3GFYA 2FLOA 5JUMA 4QIWD 4HHJA 1VBXA 4X4NA 3ISND 3O8WA 1RKJA 2R7XA 3M8RA 4YEAA 2J6UA 1XNQF 4Y28C 5CYMA 4C97A 2B4OA 5DG9A 3KHRA 3OVBA 1X4HA 3GIIA 1M5KC 2CPYA 4NCAA 4K4ZA 3I96A 4EZ9A 1PC5A 1U24A 1YWXA 2FC9A 3DDNA 4X84A 3V6KA 3ZZ0A 4OZLA 1JLEB 3CCSS 3I5CA 1UVIA 2EK1A 5DETA 4OLPA 4C8OA 4OX9F 4B9LA 1KS2A 5DRKA 3RAQA 1DQ8A 3M8QB 3GZ7A 3A8EA 2J0WA 1LXNA 1UEVA 5J2MB 2G0CA 2KYZA 1HD1A 4IH7A 1T02A 1H7WA 1REVA 3QJLA 1N52B 3PW7A 4Y0FA 1HBNB 4KQZA 1RDRA 2ZC3A 1VQ6S 2A2DA 3VAMA 1JNRB 2K7JA 4WFYA 4ED7A 2X1AA 2CQDA 5F0WA 3TOQA 1FKPB 4GKJF 1YSJA 2HNZA 4QIGA 4GC7A 5B7WA 1I6JA 4J9MA 5E3RA 4CH7A 3PR5B 1U1OA 1X9WA 1ZM9A 1Q82T 1KLMB 3MPVA 2XCAA 4JV1A 3LOUA 1GXTA 4URQU 3UCUP 4Y00A 4NLQA 3I87A 4X62F 1RT4B 2ASDA 2CKWA 5KG4A 3CC4S 3R5AA 1DQAA 2K3IA 2DTJA 4MKAA 2IYGA 2NPIA 1DLOA 3SXLA 4PXBA 4WZMA 2RDJA 2YNFB 1KC8T 5KT3A 1NJWA 3O44A 3M6UA 2HS4A 2W7OA 4DSEA 1DQ9A 1M5SA 1K0TA 2Q79A 4DN9A 3V6DB 3SSSA 3MAQA 1FF2A 4IFYA 2F8EX 1HNZF 2KM8B 3PJWA 3NMAA 5IXUA 5K8MA 3MMAB 4OX7A</