3T1HF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1hF00
1RISA 1QJHA 4DUZF 4YHHF 1CQNA 1IBMF 4KHPF 4JI0F 4LFCF 1N36F 1J5EF 4JYAF 4NXMF 4JI4F 2E5LF 4GKJF 1G7CB 5LMNF 1N33F 2UUCF 1N34F 2UU9F 4JI3F 2UXCF 1VMBA 2BXJA 4DR3F 4B3RF 4JI7F 4K0KF 4DR1F 2B7BB 4B3MF 4X66F 4X62F 4LF5F 2VQEF 1I94F 4LFAF 1LOUA 4JI2F 1B64A 1FJGF 1XNRF 4JI1F 1F60B 4DV2F 1HNXF 2UXBF 2UXDF 3R3TA 4JI6F 2VQFF 1HNWF 4DV1F 4LF7F 1XMOF 2UUAF 2YY3A 4OX9F 4X65F 2UUBF 4JI8F 2KJWA 3T1HF 1IJEB 2BVZA 3T1YF 4DR5F 1HNZF 5IWAF 4DV0F 1FKAF 5AJ3F 4B3TF 2KJVA 4JI5F 3ZZPA 1XNQF 5LMUF 4DV6F 4DV3F 4DR4F 4DV4F 4DR2F 1IBKF 1GH8A 4DUYF 1IBLF 4GKKF 3OTOF 1HR0F 4X64F 2B7CB 1XMQF 4LF6F 2J5AA 4DR7F 1N32F 4YY3F 2RJZA 4LF9F 2HHHF 1G1XA 4LFBF 4AQYF 5BR8F 1CQMA 4DR6F 4JV5F 4DV7F 4DV5F 2F4VF 2ZM6F 4NXNF 4LF4F 1IJFB 4B3SF 4LF8F
chains in the Genus database with same CATH superfamily
1UMJA 3MMBA 4X64J 1YIJS 3OTBA 3WHIA 1U1KA 2WBRA 4UT4A 1CLFA 5KFIA 1PYOB 1RAEB 5ETVA 1LFPA 3I0SB 4KO0A 4RZRA 5HO4A 1O8BA 1C0UA 3KMSA 1FI4A 1QD1A 3A13A 1QAJA 4DS4A 4RUHA 1DLOA 5D4PA 4ECRA 2BM0A 4WFBQ 1F9FA 2EKYA 1VHFA 4WBFA 5B09A 2R7XA 5KFWA 2HNDB 3ZTOA 2K7JA 3T1YF 5E41A 3UDCA 1FE0A 2I5JB 4NRTA 3OUYB 5HP1A 5L9NA 4WZMA 2HVDA 1IBLF 2YPZA 2GMLA 1TVRB 4U9RA 2O3DA 3DRPA 2D3OR 5D6GA 4RUCA 4L75A 2ROGA 3I0RB 2MKIA 1UZDA 4DV7F 4ED0A 3Q0AA 5C24B 1V3RA 4O3NA 4XDDA 3M7VA 1M5SA 2P8IA 1RTJA 4YR2A 2XMVA 4KH0B 3M30A 1CEZA 2RS8A 4X65J 1WEZA 4B9MA 5L46A 1JX4A 5KFQA 4WYWA 3BKFA 1ZH5A 3SEOA 4QR2A 1S57A 1KSPA 4KYZA 2U1AA 3WQPA 1I5OB 1B3TA 2MKYA 4DQIA 3OR2B 2FYXA 2CQ4A 1MN7A 1I94F 2RU3A 3NL0A 3MGJA 4G1IA 2HHHJ 2AWZA 3BO2A 3FSXA 3W8GA 4WIIA 4DQQA 4ETZA 1RAAB 4IUFA 5HLFA 3T19A 3DYAA 2OGUA 2MXYA 2RF2A 2W4PA 5KFXA 2HKEA 4N47A 3L7UA 3H5SA 4RW6A 2LLZA 4JOUA 1T05B 3W5XA 3MFIA 4UZCA 2KG1A 1TKTA 2YKNB 1JLFB 5HMYA 1UTAA 1R3NA 4J91A 3SDEB 1DQ9A 3FDSA 2J5AA 2C2RA 3A8IA 4B3MJ 1D8YA 3OTCA 4IH6A 4MK7A 4BBYA 2AV5A 2ABYA 4IFYA 3JTPA 1JNZB 3EXCX 1N48A 3CDAA 4A47A 4F02A 4C3KA 3NXZA 4WP8A 1KQSR 1FD2A 3QGGA 3M2RB 3EUNA 4XIUA 4LBPA 2QLBB 2CNOB 3LO3A 1K9MT 5HMXA 1XIQA 2I2YA 3NKYA 2HHTA 4CH0S 3TUJC 1SQEA 3PHTA 2XMKA 3I32A 5IT9Y 2XTJP 4QW9A 3CJ0A 3QGHA 4ZLNA 4QYZJ 4DR5F 1SH2A 3SFGA 1CJVB 1HBMB 1FRLA 4ID5A 4CH1A 1E6VA 4JBCA 4CLTA 2R7UA 2ZH8A 3BGFA 4NRUA 3PRVA 3AB4B 2ROEA 5A8WA 3N4WA 2I1RA 3KXDA 2NSCA 2DNNA 3UN2A 3Q2SC 3DRRB 2Q6CA 4M5JA 3CMQA 1AFIA 4FS2A 1UVJA 3U1MA 1PIEA 1BWVA 1HPZA 1RCOB 1DQAA 3B82A 4DG1B 1GEHA 2FB0A 3MMCA 3MEGB 5ETNA 3R5CA 1WC5A 1RDRA 2CDRB 3RR7A 4DR1F 3KOAA 1Q8KA 2MZTA 1B7YB 2G4BA 1LWEA 3G82A 3GYXB 3TNVA 1YJUA 2Z0GA 3AOBA 2ZWOA 3MECA 3DGVA 1QAIA 4UOHA 2BR0A 1S1VB 3MPDA 2YPYA 3EJMA 1S6PA 3PJWA 2AJ0A 2IHR1 5KT7A 3KK1B 4ELVA 3OXFA 3GIRA 1HI8A 2J9EA 3FCVA 2HFUA 5GAHU 4L73A 4O3RA 4CLUA 4PWDB 1X9WA 1UW9A 4LR9A 2CQPA 3CNQP 1RAOA 3RBDA 2M5YA 3IR7B 3N01A 1ACMB 1HNIB 1SVDA 1NKCA 3N5FA 2FDNA 1TL1A 2DHGA 3LF0A 1FHTA 1FRKA 4PCQA 1FX4A 1HQUB 5IWAJ 3KLHA 3R6LB 4NCGB 1CULA 4LRBA 2XI2A 3NMAA 4PG7A 4KGMA 1KOHA 7FDRA 1BD6A 1R0CB 2XBPA 2POKA 1HHSA 2R7OA 1LWCB 4Q0BB 4ZMMA 1RKJA 3WX4A 3NEKA 2AQ4A 1YX2A 2HPUA 4KKOB 1KQKA 3G8SA 4RNMA 3A12A 4YDXA 4AUKA 2V9WA 2V8PA 4KB7A 4USMA 5K14B 3KKFA 1RKIA 4RU2A 4IH5A 2HK2A 3K58A 1NSQA 5J2NB 2AGPA 2KM8B 1IBKF 3VQSA 1S6QA 4ZPAA 5E2QA 8RUCA 1RTDA 4EO6A 5I3UA 1IR0A 2JLEA 3W9JA 1C4CA 2DNQA 2ZH5A 3C6TA 4I7FB 4RJVA 1T3NA 2KH9A 3R2DJ 2HHVA 4FVMA 2OD6A 4DWIA 2QA1A 1ZPWX 2WVCA 1JXVA 4B3OA 4WF9Q 3CD7A 3M2UA 1QSYA 4XO0A 4ZCLA 2IMOA 2G0CA 2IMWP 5T14A 1IR2A 2RDIA 3M8QB 4C11A 3MMBB 4USHA 2PC6A 5AXKA 3J7YU 5CXTA 3D0IE 3LP1A 4KO0B 4RLEA 5GADU 1VBXA 3W62A 2NYHA 1K1QA 1Q0NA 5EUHA 1SC6A 1C0UB 2A0FB 2OP5A 4PXCA 3HSJA 1NEEA 1SCJB 3NNCA 1I3OB 1XEZA 2BKNA 1JJ4A 4KC5A 3CEDA 1UJ6A 2QX0A 4GVLA 4FF1A 4LBHA 3W65A 3HSDA 2V8DA 2CA9A 1NJIT 2MKHA 2QO3A 1C1CA 4P72A 5HP1B 3QBCA 2JEJA 3RBXA 3OHAA 2IRUA 1JXLA 2HAFA 4ZPBA 3PJ9A 1DY3A 3NP5A 3QMQA 2B4VA 2OJ3A 3NS6A 5KFEA 3IBCB 4LREA 4Y28C 3E2EA 2LQ8A 2YX4A 5ETSA 1RTJB 2OPPA 3Q8YA 2LA6A 4UTGA 3M30B 4J9RA 4DJBA 3GU0A 3V6JA 4TLQA 1VISA 1Q7LB 3VR1A 3BKUA 1N33F 1YZ7A 3E51A 4TYBA 3PXGa 3GCXP 2ACYA 4ZVFA 4OI4A 2F3JA 1YVFA 3UNYA 1AW0A 1RWPB 4ZP9A 2NYIA 4LF7F 5CYJA 4K59A 3FSYA 1CS4A 3GZ7A 4USJC 5KFTA 5KFNA 3SV3A 3QSIA 2NXEA 2H4WB 1FK9B 2V50A 2OAUA 4EZ6A 1R8BA 4Y0FA 4UZBA 4KV8B 3CIMA 4OHWA 1W2BR 5HLFB 1Y0HA 3DYAB 1WF2A 4Q5VA 2RF2B 3GILA 3LAKA 3RZAA 3T5JA 1MROB 4RW6B 3CIZA 1TKTB 5CZXA 5D0GA 2UUBJ 1VGYA 3BKTA 1JIHA 2VHGA 2ZKTA 5J1NA 1OQ3A 2WB4A 1H2UX 3FQKA 3R9LA 3CJKA 3IAM9 2XULA 1O5JA 3MOJB 1TR0A 1L3SA 2BKPA 4IFYB 1CBKA 4I1TA 4ED7A 1QAXA 2HGLA 1F2GA 4LFCF 2RQKA 2AKWB 4ZVGA 2AJQA 3RAQA 4KAIA 5JUMA 1ZTTA 4ILLA 5LSOA 2UU9F 2K1RB 3V2UC 1B0TA 2J0XA 3V5RA 2BYCA 2IM0A 3DDNA 3CB4A 5HK4A 2W8KA 2B5JA 2F4VJ 4CM2A 1JLQB 1T9TA 4FBTA 2RD5C 5D4LA 3J7AN 2WONA 2WAQD 2YQ1A 4TNOA 1WF0A 4FP9A 2EBEA 4TXSA 2HFSA 3HI9A 4ID5B 2GFFA 1U48A 1E6VB 3RW6A 2JLFA 4AE5A 1DBDA 2HWTA 3LA0A 4QYRA 1B99A 5C25B 1VQ8S 2J8AA 2KT3A 3BSNA 4DL5A 3O5TB 1P9YA 3IS9A 3SV4A 4N56A 2ZHOA 5A8WB 1RHRB 5KFJA 4GMKA 1U1LA 2F1FA 5F3ZA 1KLMA 3I9ZA 1HPZB 1HWLA 4YY3J 4L3NA 2GMJA 1N36F 1VBKA 4G1QA 4ZVHA 3UDLA 4M5KA 4RW8A 3MMCB 2NCKL 3IFEA 1N6QB 3VGVA 3ET6B 3CJ8A 4F67A 2DXDA 2X3DA 5KG1A 2C3MA 1WHVA 3PHEA 1RWOB 3G82B 4ED1A 3O1LA 2DJWA 2W25A 1HW9A 2CPJA 4A46A 4YR3A 3CULA 2VICA 1V3SA 2JVOA 1OYEA 2GVDB 4NXNJ 2FJDB 5E3RA 2JJ4D 1UAWA 2Z4PA 3FCWA 3DXBA 1F5BA 1S6PB 3ISND 1NO8A 3W9IA 4QWCA 2VQFJ 4F2RA 4DDFA 4C8NA 4D3GA 2DTJA 4K4VA 1FESA 4CLZA 2B0GA 3HHEA 5CAAA 1VBYA 4JI5J 2QTWA 1VLOA 1SXLA 2ZM6F 3EYZA 5A2QU 2Z2YB 2IIHA 2AJ1A 4DL7A 2HFVA 2UV8A 2DHSA 3KMQA 3OL8A 1IKXA 1LEOA 2VKRA 3KLHB 3DKDA 2R4FA 2E5LF 2FC8A 5J2QB 3UO0A 2EPIA 4QCLA 4LFAF 4PWWA 4PXDA 4A8WA 1FFSB 2GIQA 1LW0A 2QC3A 2GW8A 2UUAF 2W7OA 3R6GB 3MR5A 2Z57B 4I2QA 4B9LA 3VCDA 3QIDA 3OD2A 3BBBA 5DZ7A 4DV4F 3TUPA 4N7TA 3I56S 4ES2A 4GKKF 2MQQA 1S6QB 1RTDB 5I3UB 2MHEA 1XMQF 5CZVA 2FHJD 4CO1A 3ZO7A 1GFWB 2GJFA 1UVIA 3CXCR 3OLBA 2J9DE 4J9KA 3MAHA 1O6XA 1FKOA 2VFSA 3WIUA 1UEKA 3K5PA 4NZ6A 3CJSA 2DRAA 4IDKB 5JVHQ 4DUZF 4B3OB 3M2UB 2HSEB 3ZZUA 3LGHA 2K8GA 4JV2A 4C11B 4OFZA 1WC3A 2MMYA 2MSSA 3O8WA 1N54B 3DDIA 4Q44A 2XSFA 3H42A 1HNVA 3E01A 1V5VA 1EKSA 2YKAA 5BR8J 2A10A 5D77A 2UXCJ 5B0AA 4QYZK 3K17A 4IG3B 2RUGA 1DHMA 1RBAA 1IKYA 4DFMA 3C19A 3G8TA 1D1UA 3MURP 1U6FA 1S6UA 4H4MA 4JI0J 1HR0F 3R5AA 3ICLA 1NDCA 5C5JA 3H2VE 3H90A 3D66A 3ZZOA 3MM5A 3CCUS 5IV3A 1R8AA 2KTQA 2GC8A 4IO9Q 3PX6A 2KKHA 2XYPB 3V6DA 1KLNA 1EZZB 3IN5A 4LSZB 1HI0P 2B43A 1QDUB 3KHLA 3KYLA 2OPPB 4IOCQ 4FXVA 1Z2ZA 1BXNA 4Z37A 3BM7A 2HWHA 5SUHA 4C3LA 3HO1A 3R1LA 1QSLA 2DEJA 3GIKA 4BCAA 4PPDA 4IRDA 1L3TA 2DO0A 3BSCA 4USWA 3CPWR 2PO4A 3F56A 4DPUA 4AQYJ 4X4NA 1FVSA 2DNOA 1FTRA 2H1YA 2W7PA 2WCXA 4ZDNA 3OVBA 3ZNUA 2UVUA 1CJUB 1FA0A 2MHNA 3B4MA 1W2IA 2PIIA 4FNHA 3UN3A 3NBPA 2VFUA 3G6VA 2YNIA 3MM6A 3QJJA 2C3OA 4QIVA 3NWRA 4F8RA 3AXKA 1RB0A 3GCWP 4J9MA 2Y1LB 1U49A 1ITPA 4DR6F 2MQOA 3SSSA 2ZZTA 4Z7YA 4PRFA 2VFTA 4ECWA 1T3OA 4RNOA 3MEDA 4BS2A 2HS0A 2V5HG 1SH3A 4PQAA 2HQGA 2VBZA 1N8RT 2QSWA 4KPCA 4G6VB 3I5AA 1N34F 3IM8A 2GQCA 3OTEA 3QWPA 1RT6B 3EZ5A 1YBAA 1S48A 5KG3A 3H5YA 2XO6A 2W7AA 3MOZA 4NLVA 2UXDF 4WE1A 1JNRB 3Q24A 1Q53A 3IAS9 5CQGA 2MZJA 4ZVUB 4ZVRB 3LTOA 2B5JB 2D74B 3TA0A 4FDFA 3NNHA 2V4RA 3GPAA 1JMTA 2VA2A 1YKWA 5EWEA 3UDEA 3IM9A 2FJVA 1JLAA 3RU0A 4I6WA 2RAQA 2UVVA 4FBUA 2AX0A 3ZZZA 4ETXA 3LAMA 4NLYA 2W2NP 1VRUA 5LXYA 1YJRA 3OHBA 3ILIA 2A18A 3G96A 1PO6A 1IM6A 4OMFG 1U47A 5IV4A 4U7CA 3W5YA 1U25A 3EMTA 3PM9A 1UPMB 4DR4J 2N3OA 1IWAA 2GHVC 4JI7F 4TY8B 4WP9A 4X66F 3JXOA 3R5JB 2JSXA 2GZOA 1UA1A 2ADBA 2EI5A 1ZM4A 3MCNA 4DQPA 4A8SA 4YB5A 4JI8F 1UEVA 1YJVA 5AJ3F 2XWYA 3LOUA 1RZMA 1S72S 4GC7A 4NMLA 4DR2F 1S1UB 1Z2LA 4C98A 1IXKA 5KFDA 1JJHA 4PR6A 3OTOF 1LKZA 1NDKA 4GKJJ 4DPWA 2MDAA 2QL9B 1URNA 4LIWA 1FRXA 1R6VA 1HNZJ 3AA9A 2X51A 1YJ7A 3ISNC 4UY85 4X4RA 2LXFA 4HL9A 2YH1A 3D54A 2MQLA 5HROA 5KFGA 1ZBTA 1FDNA 5L1LA 2JVRA 4P52A 5EX3A 2H5JB 2XYGB 1RWMB 2BJEA 2QMWA 4OX6A 3GSDA 4U6PA 4YQWA 1IKXB 2C2NA 1K1SA 3VAKA 2VZ9A 1NJZA 1C2PA 1LW0B 3HF5A 4OZJA 1YJWS 1RJJA 2AJ2A 4I2QB 2RILA 4QWBA 3ENVA 5AE2A 4ZKAA 1MMLA 2MTLA 3NAIA 3R27A 1RA7A 1J5EJ 2J7WA 2OTLS 3BDPA 1KHWA 2MZQA 3K0JA 1NK4A 4PEOA 1YZ6A 4NLXA 5DM7Q 2YX1A 3VF0B 4NLPA 1HBNA 3MTKA 4WTYA 1FKOB 3VGTA 4NWBA 3QPIA 1MWZA 2GJ2A 2BACA 1K44A 3RRGA 1PILA 2XI3A 3PRDA 5FDLB 1QUPA 2ZZNA 1A0OB 1LWFA 1QE1A 3SSRA 4X4VA 2AMCB 3TJAA 4O4GA 1K0VA 4UW2A 2NPFA 2XC9A 1KHVA 1U6BA 4DR7J 3HHKA 4DCOB 3FBEA 4ZIWA 3BO4A 3Q22A 1EKRA 1HNVB 2OEKA 1PAEX 4QIWD 4OYWA 3MUVP 1NM2A 2HEKA 4K2XA 4DL0C 4EK2A 2VUGA 1NDPA 4Z7CA 2CFXA 5KG4A 2E29A 3MD3A 1PYSB 5H9EJ 4TYAA 3C3LA 2ZE2B 3TZZA 4X64F 3K8WA 3QZ8A 2KXFA 2AX1A 1XMOJ 2KT2A 4E0DA 1Q1KA 4ZVOB 3OFEA 1KVKA 4D3HA 2YWFA 2BZ2A 2C3PA 2OIHA 3MM5B 4DSJA 4ZP7A 3QRQA 2Y1RI 1KOOA 3DFEA 3IO1A 2C2OB 2KZMA 4LRFA 3AODA 3TJ9A 1UW4A 1UVKA 4C7QA 4OI1A 2IC3A 3V6DB 2MZ1A 2ZVIA 1D8ZA 4G1PA 2HHUA 3IGNA 1L3KA 1RWKB 2YWGA 1VK3A 3HHLB 3KHGA 1WG1A 1YJ9S 4O3PA 3W9HA 2P6TA 4JI1F 2RU9A 3TOQA 2V94A 1IKWA 2R7WA 3EGWB 4RW4B 3I5BA 4CTAB 3TZYA 3PW5A 1NK7A 1KVJA 2BE7D 3MDFA 1S10A 5KFUA 3KDOA 1N5QA 2AZ1A 3IWXA 4NOHA 3AFGA 2BOPA 4ECVA 3MUMP 1H38A 1GX5A 4I0WA 1VQ4S 3NBPB 1T0TV 2YNIB 3QWUA 3ZXWA 4IRCA 2JEIA 3M8ZA 5L1JA 1ZAWA 3MZIA 1Y5NB 4ANDA 2AGQA 2FZGB 2R9LA 3ZZYA 5M2UA 2Q6BA 2LECA 4YHHF 3MM8A 5A2QY 4K4UA 3HLUA 3MEDB 2KFNA 2AJFE 4ZP8A 3GWCA 4LF1A 2ZH9A 2EK1A 2R2UA 4LSNA 3NGUA 5L1KA 4IOAQ 2CQIA 4ZPDA 2XHCA 3B54A 2AP6A 2UXBF 2DNKA 1U7LA 3GJSB 3VAIA 3QZ7A 4JI4J 3OT9A 4CO2A 4IOBA 4WE1B 1Q78A 4A8FA 2WSCC 2VBWA 4LVOP 4YB7A 4Q8FA 3P5BP 4NPOA 4C9DA 3UW1A 2PEHA 4CP5A 5HQMA 5DO2A 3S6EA 2V8VA 4DOZA 2GVZA 3LW5C 4EI2A 1JLAB 1OS5A 3LH2S 2CQGA 1FF2A 4C8OA 3HJFA 3TEHB 5CD4H 1VRUB 2PSZA 1T7PA 1XERA 3R1HA 2HHWA 4OX9J 2V2KA 3QLHA 2M52A 2BQRA 2RUSA 1SPBP 2FZKB 3M6WA 3ZZTA 3TI0A 4HKQA 1U2FA 2R8JA 1FXRA 2BXJA 2P9CA 2AD9A 2JEFA 2FLLA 3NGSA 3RGIA 3CD6S 4PKDB 1F5CA 4LF4J 3UN5A 2DISA 3D9BA 2OEJA 3OV7A 2DNHA 3BDEA 2V34A 5L1IA 1RAIB 4FYDA 1TL4A 1RHUB 2RIJA 2VL1A 3F41A 4O4RA 5B7WA 4A8MP 2WK4A 2QT7A 1TP7A 2ZHAA 1KS2A 5C2GA 4JYAJ 2JEGA 4NXMJ 1FE4A 3G9CA 2DGOA 3FEXB 2PEBA 3Q8QB 1PJ5A 2OSRA 2J76E 4GVBB 4GRSA 4ENOA 1MU2A 1CQMA 5GAEU 2LQBA 1JLBA 4XPEA 1T95A 4DFKA 4WXWA 3I96A 5HROB 5KFPA 3G2XA 1SC4B 2NLWA 2MJNA 2ZBRA 3MR3A 3ZNJ1 2YWHA 1KWMA 1HFEL 2EEYA 3FBCA 3QIPA 4B9TA 2DYAA 3NG8A 2DY1A 1WOSA 3LWMA 4V19X 1SJ1A 1FNMA 3PY8A 3W2WA 4DV2F 4FYXB 1HNXF 4X2BA 4LRDA 5DDQC 3D2WA 5GAHI 4HTIA 1ZZNA 3GJRB 5DQHA 4JI3J 1WNEA 2P6SA 4Y6IA 2JL9A 2OHDA 2DNRA 2XY7A 2VKZG 1Y5LB 5EHHA 4KY3A 3NY0A 4IQXA 3LANA 4B3RJ 2EW9A 3NGKA 1B0PA 4MKBA 2XSJB 2DHAA 1HBNB 4RBUA 1XN9A 2IPOB 1IUJA 4ZPTR 2MZSA 2VF3A 4KJIA 1V5IB 1TL3A 3NLCA 2KXNB 5E3QA 4ZCIA 3MEKA 1WTBA 4C0HA 5MAOA 1FVQA 3G71S 1GXUA 2VQEF 2F7VA 1LWFB 1QE1B 4K4ZA 4O4GB 3MEEA 2A3JA 2IA6A 2C2DA 4ZJLA 1SJ4P 4JV5J 5IT4A 3T1HF 1U02A 5ETTA 2HLTA 1XNQF 3CCLS 2J6SA 2VA3A 5BYRA 3IWNC 3DDKA 2FQQB 2X7IA 3AOCA 2LDIA 4LF9F 4Y2AA 4B17A 4NL5A 5IXUA 1VQ5S 3TA2A 2MPUA 2FLPA 2IRXA 4KGXB 2FTRA 4O3QA 3DN9A 5GADI 2LEBA 2C1EB 3M2VA 1VHIA 3PYDA 2W9CA 2C28A 3PW7A 4OJHA 1NU4A 1ZAXA 2IC3B 3JTNA 3OL6A 4NI2A 3V81A 4LIRA 5J1PA 3NOCA 1RWUA 3RRHA 2LU1A 1R0BG 1PKUA 5CCMA 2YWEA 1DRZA 4U7UK 3H98A 2Q3PA 2VDIA 3H8YA 1IKWB 1H2VZ 5KFLA 1FKAF 5B0DA 1SKUB 4OLOA 3WZ0A 2HRUA 2ZITA 1RT5A 2KDOA 1VR6A 3BN4A 4AT1B 2VPYB 4CO3A 4W92B 5K9FA 1EHWA 3BSOA 5ETLA 2VG5A 2A2DA 5A6PA 4R5PA 1Y10A 3QT7A 5HN0A 1BWEA 3POTA 1KQFB 3MCSA 1IJFB 3MR6A 4M5MA 4DFJA 5IQQA 1LWXA 1QJHA 4RKUC 3EPIA 3T1YJ 4NLQA 5CHCB 3FNNA 3ENQA 2HNDA 2VPXB 5ETOA 2K06A 3D3CJ 4ECQA 2UUCF 1IBLJ 3OUYA 4WYLA 4F0HA 4LMZA 2VD3A 3K59A 4LSNB 1WWHA 3FUYA 2CDQA 3M8WA 3PDNA 5B0BA 5L39A 3U7JA 3D6FB 3EM1A 2JDJA 2UUBF 4DV7J 5JJBA 2L3MA 2BDPA 2XM3A 5G0RB 2PI4A 4DLEA 5KFKA 4FS1A 1QY7A 4AL6A 2V4JA 3OJSA 3CD0A 3BN7A 2HGMA 3OJUA 3K8VA 2XCAA 3BSAA 2Y9HA 2KZZA 3QT8A 3LP0A 3LQVA 4CH7A 3Q83A 4TLRA 4TU7A 2GO8A 1I94J 2MZRA 2JC0A 3ELHA 4Y2CA 3VVTA 3OR2A 4DPOA 5DJBA 4ZCMA 5IT0A 1SQGA 4USTA 3TEGA 2CADA 2ZWPA 4ECZA 1SC3B 2B51A 3T9ZA 1SJRA 2KT5A 2W1BA 1S1XB 3QLHB 2FHJA 3PIOQ 4OL8A 1Y11A 1WEXA 3PYEA 3ZTSA 4C2MA 4S0MA 4EEYA 2DRBA 2FHKA 1C4AA 3BH6B 4K5RA 2CWKA 3ETOA 2F65A 1JLFA 2OELA 1R7IA 4C0BA 1SKRA 4JI6F 3NGTA 1U1RA 4F4YA 2EFPA 2QFJA 5HMZA 1H73A 2Q43A 4ZJOA 5HAOA 1JLEA 1AT1B 4GC6A 2LEAA 1NKEA 2AYMA 4P75A 2NPIA 4P7TA 2DPIA 1ELOA 3L4BC 1FCAA 2HFNA 4FVCA 5H9EK 5AE3A 3JQKA 4QWAA 4ECUA 2UVWA 3CCSS 5HVHA 4CNYA 4I69A 4YY3F 4B3TJ 3QAEA 3HMJG 1KDNA 1OYDA 2M8HA 1FEEA 3PW0A 4DV3J 1MU2B 5D0HA 1JLBB 4KBIA 4WU2A 5HJXA 1VFJA 2ACMA 1U45A 1F6TA 1NLKL 2OPSA 2F8MA 2X3GA 5E0OA 2GJIA 2KU7A 2MQ8A 9RUBA 1MG7A 5FLXU 2M9KA 1GXLA 3BQ0A 2L9DA 1KP6A 4LBIA 4ECYA 2MY8A 1WI6A 2VJUA 1AUDA 4I67A 2VQFF 3W2WB 4F36A 2CPXA 4DX5A 2CPHA 1O0PA 5F8LA 2F9JA 1HARA 3CWJA 4JI5F 2LXUA 3I4PA 4DL3A 2KHCA 4HI2A 3BB5A 3DRRA 3HX9A 2KL8A 4MKYA 3OR1A 1F5AA 1X4DA 3CGIA 3PRBA 4ZOSA 2HNZB 5CABA 1QSSA 3FGVA 2BANA 3Q23A 4WXOA 1LNQA 2ZEJA 1ULRA 2VASA 4PXEA 4V1Ak 3BGRB 5M2PA 4IR9A 2DR9A 1HL6A 1NK8A 4HR2A 4M5LA 4KSEB 4DUYJ 2H9ZA 3O6QA 3U02A 1TUWA 2W01A 4FF4A 3CCWA 3GFHA 1FDAA 2N7YA 5EN1A 5F8HA 3QYYA 1S1VA 3G8QA 1A9NB 4WK1A 4ALZA 1TL3B 1T94A 3KK1A 1F2HA 4ED3A 1Q5VA 1HHQA 1KQGB 3TO8A 1SL1A 3D6TB 1RA6A 2BBEA 5BYQA 1IR1A 1S1TB 1FX2A 2ZKUA 3L3CA 3BJYA 4Y00A 2QL7B 3IXQA 2OD4A 1WKJA 2XNRA 1HNIA 2AEJA 1B7FA 1DJ0A 1H0HB 2QYCA 1RADB 1RCXB 3DHXA 3BGOP 2AGOA 1AUSL 4RWXA 2LEPA 3WDOA 4YN3B 3GV8B 1UJ4A 2R8KA 4QU6A 3KG0A 2V8GA 1RLCL 4DQRA 2E44A 1LWCA 1SBRA 4CQ1A 3QGPA 2IA0A 3UCZP 4F3OA 1AZSB 2EG2A 3HPOA 3M2VB 2W9CB 3TW0A 4B9VA 4LFBJ 1PJ6A 1HWIA 4OYZA 1IBKJ 1DZ5A 5HBMA 2UXCF 1X5PA 1TFWA 2AJ4A 1U2CA 2PD1A 4I56A 3A8KA 3SCKE 4OYIA 1T9VA 4FYWB 4NI2B 2VODA 3V81B 1VQLS 4I7FA 3FMBA 3L7PA 3IBWA 1PCAA 4ICLA 4LRAA 4DL6A 5D4OA 3K5LA 3AXMA 3C15B 3G6ES 2FLOA 2V68A 1IQTA 1RHQB 1UZHA 4A8XA 3KHHA 4F04B 5A8RA 1X4CA 3C66A 2HIYA 1VYAA 2XMWA 4FF3A 1RT5B 1TMMA 2R2RA 1N32F 3VZIA 2YKQA 3OFFA 2DNZA 2HK3A 2EFVA 2VG5B 3OXGA 2M3DA 4R5PB 3EGNA 2HQFA 3LGNA 1WUUA 3POTB 4Y2MA 1BLUA 1NPPA 3NOGA 2VBXA 1UA0A 1VQOS 1XBWA 1FD8A 3C2PA 2CWXA 4ZA1A 4OYBA 2NZ4A 2MLYA 2V8HA 5B0FA 4AYBD 2B8QA 5GVQA 3M6VA 2RRAA 1YHQS 3PVXA 3GIJA 2HBRB 2CPZA 4L72B 4MIBA 3UQSA 2EFGA 4YB1P 2W2QP 2V4JB 3OBIA 3F73A 3KJFB 1N0UA 2AIRB 1N33J 2DCLA 2HHSA 1M0SA 2HYIB 5K8NA 3H2UB 3LP0B 5LMUJ 2P9EA 1M1KT 1D9AA 2FVCA 2XS2A 4M94A 3ETMA 2FIUA 5KFVA 4LF7J 4ECXA 1S1WA 1T9UA 4K4XA 3HVTB 4CO5A 1ZAVA 1XR6A 4F3QA 3VWSA 1FK9A 3S01A 3GIIA 4KV8A 4I4BA 4HH0A 4TQSA 3LALA 4QJVA 2DEIA 1FJCA 2DK2A 1MROA 3DU6A 1F0XA 4WZQA 5DETA 2HIQA 5KT5A 4J9SA 1OPZA 1DTTB 2ZJPQ 4NLRA 2RQMA 3GP9A 2BW2A 2FVQA 4IFVA 5KFFA 3P3DA 4DV0F 2HVIA 2W2PP 2BUNA 2KYZA 3NCPA 2FY1A 1HQEA 1JLEB 3CC2S 2EWHA 1KN6A 2BRLA 4O0IA 4LFCJ 3VVUA 1YRXA 4EGLA 3B78A 2PFDA 2IYGA 2KRRA 1YK9A 3HFKA 2WSFC 3K5OA 1VRTB 4M5IA 1TMJA 1BQMA 4AFFA 1U4BA 1M5PC 2K1RA 3CMAS 3QRPA 3BGLA 1GTEA 1KKHA 4C6AA 4Q43A 3C46A 5KTQA 3UR3C 3TQEA 2B9YA 3MR2A 1RGVA 2J7KA 2X1AA 1QAYA 3M32A 1JLQA 4ELUA 2ASJA 2MJUA 2OPSB 4H4KC 5A0YA 2RRBA 3KK3B 3LPEA 2IY5B 2AT1B 3Q8SB 2JLGA 2IVMA 4WKYA 1WTFA 4P10A 2ZHBA 2EBGA 4ANCA 1XC9A 3M6UA 1GAOA 4RUBA 1RACB 5C25A 1N5YB 1K0TA 3VZHA 2P2CB 1HNZF 4OHXA 2Z2MA 3PACA 1GMWA 2C3UA 3D28A 5J1EA 2WSEC 2KVQE 1HIYA 3HHLC 3DU5A 2LXIA 1U1MA 3FKBA 2E9TA 3OR1B 2YNHA 3PFOA 4HT5A 3NWGA 3G86A 5LOQA 3RR8A 3MM9A 1GT8A 1VQ9S 4ILRA 4L3KA 1UKUA 4IO1A 5LL6d 2BANB 2F9DA 5MLCV 1N6QA 5E3CA 1VDHA 3ET6A 2FGCA 2HAIA 2BE2A 3QAUA 2GA7A 3CJ4A 5JMNA 4UUXA 2I9SA 3LP2A 1BQXA 1ICEB 1RHKB 2GVDA 3QT5A 5KG7A 1VS3A 2WVDA 4NEYA 2DNYA 1RTZA 4DSLA 3EDQB 1Q4RA 3WC2A 4H54A 1WHXA 2VBYA 4USVA 1EX8A 3T5LA 2RHQB 1UVMA 4DV6F 3C6UA 2BJ9A 5HSPA 4MJKA 2ZH4A 3NNAA 2DY9A 3AQPA 4ZLLA 1HNWJ 2G13A 3I6PA 1X7VA 4C4WA 4PPZA 1UCNA 1T9XA 5I3QA 3DRSA 3THPA 5KFMA 2CQ3A 5J2QA 1H98A 4X4UA 2OPRA 3MXHP 2UUAJ 1WF1A 5B0EA 2DXFA 3C8YA 4ZITA 4NMXA 1SKSA 2J0SD 1X9MA 5HJYA 4USKA 3CJTA 3PFEA 4DV4J 2CPIA 2HVHA 3BGUA 2GNKA 4GKKJ 5HBMB 1TQLA 3US5A 2KFYA 4LF5F 1M1HA 2D3UA 5KFCA 1HI1A 1XMOF 2C2EA 4NLDA 3NCRA 3LWLA 1WHWA 3CJQA 4G65A 2LQ5A 4N8NA 1T03B 4RBVA 4ICLB 2F40A 4DUZJ 1GH8A 5B08A 1R8PA 4U96A 2X1BA 5A8RB 1RABB 2QZ8A 4IDKA 5EX0A 3RBEA 3JYTA 3RG6A 4XDCA 4MK8A 3GYNA 4RWWA 3W2VA 1URRA 4U95A 2C2ZB 2Q1LA 4LR7A 3R97A 3I9V9 2AYEA 4KGZB 5KG6A 2HRYA 3KG1A 4YFUA 1RTIA 1DAXA 2DH7A 3GB0A 3MCMA 1H72C 4OI3A 1S77D 4N5SA 4DF8A 3K89A 3DLJA 1SJFA 2NQPA 4IG3A 3R7SB 5U47A 2ZC4A 3FSIA 4J9PA 4NE9C 3V4IA 4CLLA 5FLXY 1RWNB 3KJVA 1NUEA 3CJ2A 4IQMA 5F9LA 1L5UA 2IJNA 4DN0A 6FD1A 2YXLA 1YBTA 2GV1A 1FNXH 1WC4A 2XMUA 1TL5A 1B0VA 2Z56B 5CH7B 4HHJA 1M5OC 4JUZA 1EP4A 4DMZA 3DLKA 2RKIA 3ONQA 3HT3A 1EARA 2W9BB 3V6HA 4IYQA 2HQ3A 2G0IA 1W7WA 2CYYA 2XYHB 4ZPCA 4DV5F 3FK4A 4R25A 1TAQA 2B9WA 2WHOA 2YNGB 3MPWA 3PW2A 1FO1A 1U8WA 4MMOA 1NK9A 3OSPA 2MKCA 4JI4F 5LSRA 1S1WB 2DGSA 1U26A 1CJUA 3THTA 4K0KF 3HVAA 4ATNA 1S6OA 1VIXA 4ZVTB 2QGFB 4OI2A 1S7HA 5T7LA 2QMUB 4BC7A 1OY9A 3N6MA 4DR6J 3H4DA 1G2EA 3ITHA 2W2MP 1Q79A 2EFQA 4IFVB 3CC4S 1T9WA 4Q8EA 2BEFA 2LDYA 5C42A 2SXLA 3GR1A 1QVGR 2FJBB 2GQ2A 2YKMA 4DCJB 1HQEB 4X4PA 3AQOA 3DM2A 1X4HA 2V2VA 1T02A 3TRGA 2JX2A 3TA1A 1N34J 3L7OA 2IYIA 1EB0A 4RNNA 4PQUA 2BX6A 2RVJA 1ZM2A 1BUXA 2KRBA 2KO1A 4BC9A 2OUGA 3HXMA 2R42A 3BS9A 1ZZFA 1BQMB 3JTOA 2MLZA 3I5CA 1RT6A 3B4DA 2FHMA 4LF4F 4OZ2A 1RISA 1S76D 3H5XA 5DZ6A 3VAGA 1Q82T 5LSLA 4WKRA 3TUZC 1X5OA 4ER8A 3HSGA 3LUYA 1LFWA 2E1AA 3UPFA 3M32B 4LUBA 4QPXA 3MM7A 1SIWB 4B3SJ 2UUWA 5A0YB 2CVEA 4FKXA 5IS2A 2CPFA 4M8LA 2VIHA 1FXLA 2ZNZA 1NHUA 2XLKA 1B70B 3D4JA 3QATA 1G3OA 3FRZA 4AXJA 4A8YA 2DIVA 3D0HE 1B4SA 3BPSP 2LA4A 1VQNS 1XR7A 5K8OA 3MR7A 3N28A 1ZS6A 4NLSA 5J1EB 2QJ3A 1VC5A 3OQ2A 1JLGA 2HQDA 3EDRB 3KTQA 5DM6Q 4JI7J 2WVBA 2YNHB 1MNEA 2QFIA 1NB2A 4QQBA 4X66J 2CQBA 2Y0SD 2CXEA 2LU2A 2FD2A 4TY8A 3MM9B 4FZVA 3UD5A 4EO8A 4L76A 3TJ8A 2RDJA 2P5VA 1T11A 4CZCA 4M5DA 1LK7A 3CC7S 2BE2B 2D41A 5AJ3J 2H54B 3MMAB 4F0MA 2ZH2A 1RYSA 1FRJA 3JQJA 3LP2B 4JI3F 1RK8A 1WELA 2RH3A 3QGIA 5F8NA 3OTOJ 2IFXA 1Y7PA 3PEJA 2CJKA 1S1UA 2JHEA 2YVSA 4CLFA 4JI2F 1VOMA 3EWGA 4LQ9A 4ZHRA 3A3NB 1J27A 2BJ3A 2H5EA 4Q2MA 1LW2A 5HL7Q 3RJMB 1V3ZA 2YWWA 2XLIA 2G2YA 2QRRA 3IR6B 2XY6A 1S7IA 3MPYA 1RI7A 2QLFB 2W2OP 2HNYA 3C6UB 1YBUA 2DNMA 1U8SA 1TK8A 2A6OA 1S12A 2LMIA 2CNKB 5A76A 3P45B 4LF6F 3ENWA 3UI3A 2DNLA 1I51B 3N6LA 5B0GA 1PSDA 3DRSB 3BBCA 3D7SB 2RE1A 1GNKA 2NR0A 2HRTA 3SI8A 1HBOB 3E8OA 1M5KC 2OPRB 1SJQA 1XMBA 2J9CA 1V9OA 4OYPA 2XMAA 1RBOB 1RT4A 1X4GA 4ED8A 2K3IA 2J0WA 5I4MA 2GHPA 5F8IA 2OSQA 4J9OA 2F5GA 1NH7A 4XTTA 1NPRA 3UD4P 1D0EA 1TKZA 1R0AA 3DGPA 1LOUA 1SIZA 1RT3A 1V6HA 2L48A 1CG2A 4OI0A 3W5ZA 2YY3A 3I82A 3HVRA 2ZH7A 2GCFA 4UY8T 4F4ZA 3L95X 3D3BJ 3RB6A 2X1GA 2ZNYA 1BE4A 1FJGJ 5DRKA 4OZ0A 4KGKA 3SXLA 4DLGA 5KG2A 3IG1B 3NGDA 3GV5B 1OWXA 1F9EB 3UD3P 3J7Z5 1RAJA 3GLJA 2YQ0A 2HVZA 4CO4A 2C2MB 4PWUA 5LT5A 4U8VA 4ED5A 3JYTB 3A3PB 1WC0A 5FDLA 2CAJA 2QA2A 3W2VB 2D3ZA 4CLWA 2AU0A 5KFHA 3M8SA 1EIYB 3BYRA 4OZ1A 1VJQA 1K73T 5GAGU 4CLPA 1RTIB 3VAHA 2VB6A 4K4WA 2F8EX 4ILMA 3UCGA 3VGUA 2WW4A 1M90T 2RDDA 1S49A 2WVFA 4DR3F 2E5HA 4DU7A 2EC0A 2HMIA 3VAJA 1UEUA 5D0EA 2ZE2A 3W64A 3HK2A 3H59A 4H4KA 3V4IB 5IFMA 1TK5A 3HHNB 2ZOMA 3KJVB 3EGVA 1KVIA 1E6YA 1TKDA 4X62J 4TKTA 3ADAC 4RX6A 5RUBA 1EP4B 3W8PA 1UETA 3B6BA 3N6NA 3DLKB 2RKIB 3DOKA 2J8SA 2DVIA 4ZK7M 4ZN3A 4IR1A 3HHLA 5IQ6A 3SSQA 3IMQJ 4JI1J 4XAKA 3W3SA 1S4EA 3A1YG 1RP5A 2CQHA 1N5TA 1SB6A 4MKVA 4ZN1A 4RW4A 1R8CA 3M8PA 5ETQA 1WSVA 4CTAA 3DMJB 1S9EA 4ES1A 3JAMU 3CO0P 5K5MA 4W4MA 2CG8A 1RT7A 2VPWB 2WW8A 3IGVA 2ZJRQ 3BZQA 3ZTQA 2XB2D 1TZ0A 5T7LB 2LKZA 2BV3A 4FYVB 1YJNS 2G2ZA 2HFZA 2DR7A 3ZZPA 2DGTA 3TVKA 2R7RA 1X9SA 3ITHB 2GGPB 5HATA 2GMHA 4OX7A 1VI7A 2YNFA 1IBCB 3H0PA 4YHHJ 1BQNA 5C42B 3B8HA 4WFYA 2YKMB 3DM2B 3S7RA 4J9UE 2OMLA 4F0KA 3J80U 4QU7A 2N4DA 2W4CA 1S0NA 1HA1A 4O44A 7FD1A 4PQUB 4X4SA 2G9OA 5E5NA 2UXBJ 5D0RA 2FC9A 3M9NB 1NKBA 3H7HB 1S9FA 2CJBA 4P2XA 4F4AA 2IVFB 2VONA 4NCAA 3SFUA 4MTPA 1S97A 4J5OA 3Q2TC 5CD4A 4NZ0A 3RW7A 5DDPC 1SL0A 5KFBA 1FFWB 3VGSA 5K8PA 4EUVA 1XNRF 3MM7B 3TX0A 4OIXA 4KT0C 3FVYA 3PG9A 2YTCA 2IBKA 2W4DA 3HJVA 4MFBA 4FXDA 4B3TF 2HBYB 5E3AA 1CPZA 2YWKA 3T1AA 2CQ2A 2RB7A 4P9SA 1RLDA 3R7NB 2F8HA 4DV3F 2V0NA 3TZWA 1TKXA 1KONA 4ECSA 3BO3A 1U0HA 2ZBPA 2ZZMA 1Q7YT 4I68A 4NLTA 1JLGB 4LVNP 2HG4A 4XPCA 4Q7AA 1MMDA 2ZDPA 2MKJA 2A1BA 2GHWA 4XK8C 1TUGB 2PE8A 3AD8C 3KUGA 2QN6B 2GAHC 4KTQA 2DGQA 3VV2B 3N79A 2ATLA 8ATCB 4M5DB 3ZTPA 1S9GA 1O51A 2WVEA 3KK2A 4PYDA 2Y3YA 1FRMA 1P27B 2V69A 1RT2A 2MKKA 5C7PA 4B9NA 3J81j 2DR6A 2J0QD 2V67A 5EWGA 3OPKA 2Y1JA 4ZHRB 2BVZA 1LW2B 4HDHA 4GVBA 2YBVA 1D9DA 3DOMA 3TANA 4HTJA 4P6QA 2CPDA 4DUYF 1APSA 1VK8A 2HNYB 3M1VB 1VC0A 2IDEA 1GX6A 2JFKA 3TWZA 2A6MA 2H65B 3QFWA 4DV2J 2XEXA 1HNXJ 3C16B 5F8GA 4PG4A 5L9XA 2DR5A 1YRTA 2G1HA 3CDUA 3TARA 3IBFB 3WC0A 3UVJB 2VDHA 2XY5A 3P5TL 1OQ6A 3FMWA 4B9SA 3TZXA 1LXNA 3R7BB 4U8YA 1HWJA 1SI9A 4C0OC 1RT4B 4F4KA 3V4MA 3PJXA 2VG6A 2ASLA 2XG8A 4IG0A 1TKZB 3J81U 1R0AB 3DGPB 1RT3B 3PNIA 2BQ3A 5KFSA 1Y4ZB 3MPVA 3HT0A 2RMLA 3MPUB 2AZ3A 4J9LA 1QUVA 1H74A 1R43A 4KFBA 2XSJA 2Y1IA 2XWXA 1UWBA 4P74A 4WU3A 2P9GA 3Q89A 1N5VA 4RL1A 1F3VA 3N0VA 1MMNA 2V4QA 1DARA 3CO9A 2CZVC 4LFBF 4I2PB 4RNHA 2VQEJ 3ZFVA 4DZ6A 1AYEA 3DI6A 4LF8F 4BWMA 2ZUAA 3A8JA 2C2KB 3T1HJ 1IBMF 2KG0A 1HWUA 2CRLA 8AT1B 4TU9A 1XNQJ 2K2PA 3EZOA 5D3GA 5DGAA 2FPHX 1G6BA 1WG5A 2YH0A 2XZDB 5KT3A 5H1SV 2HURA 3P96A 4ID8A 3CCQS 3M05A 2HMIB 1R6YA 2E7WA 2GO9A 4LF9J 3UFCX 1U0SA 4HACA 4RPFA 2GAGC 1Y3KA 3VALA 1TAUA 4ZVSB 5F0UA 1E6YB 2GS8A 1RU2A 3OLAA 3KNGA 5J2MA 2DIUA 1DLOB 4W98A 1YG0A 1IKVA 2R3VA 5HI7A 4DUTA 2E5GA 2ZH1A 3AB2B 3HD1A 3CW2C 5EWFA 4J9QA 4JB8B 3DOKB 4QIEA 2R7TA 2MLXA 5DG9A 5KG5A 5A8KA 1KR4A 2R2TA 3HDSA 3DRYA 4M1KA 4NA1A 3D1HA 2XCPA 3DRPB 3M8PB 2ALZA 3D1OA 2R7QA 3DLLQ 1YRUA 1WJ9A 5D8HB 3T41A 3R5BA 3KLIA 1S9EB 2W24A 3CCMS 1H6KX 3VHQA 5BYSA 4HYKA 2EVZA 5CYMA 3Q8VA 4TQRA 4YP3A 2ZD1A 1RT7B 3KLVA 4X65F 2D3O1 1RHJB 2B3TB 4KE5A 4HLBA 3OTDA 2DGWA 3K2YA 5LMUF 1TL7A 1GK8A 5KFZA 1VC6A 3EXYA 4NZ7A 2CJXB 2WB1D 2YNFB 4ZP6A 2DKOB 1BQNB 2LQJA 2UUCJ 1VQMS 4M95A 5IC6B 2RT3A 2HHHF 2QA4S 2PT0A 3HM9A 4ZPVR 1JWWA 2V2ZA 3CDBA 4O44B 3ILJA 4DEZA 2AEMA 2HQIA 2LYVA 4WFXA 3IWLA 3JS9A 3DOLA 3I4HX 4P7VA 4WFAQ 1PBUA 4ZVQB 5G0RA 1RTHA 3PCOB 4B3MF 3HVWA 1BC6A 1B64A 2CUYA 4NLGA 4C8MA 4J9NA 2ZFHA 3UDVA 2NSBA 2DGXA 4A4JA 2MSTA 2JRSA 3DHWC 3AHPA 3OXLA 5LMNJ 4P73A 1Z1ZA 4U7UD 5CCLA 1SV5A 4MFBB 3AT1B 3M4XA 2XGQA 2B6AA 2CKWA 2FY8A 4DFPA 2PMHA 1TKXB 4DV1J 3UCUP 4OYMA 1D09B 1U0HB 5IC4B 1S1XA 4ZLJA 3N9UC 1R31A 1IN0A 1RT1A 3RAXA 5F0WA 4PABA 4X4QA 3VAFA 3JSMA 4JI6J 3KJNB 2IDLA 2GIRA 1TK0A 2JNJA 2FGOA 1KTQA 3MWBA 1W26A 1NHVA 2E1PA 3HFVA 5EDWA 2QE5A 1G4CA 4P71A 3CJ3A 1S9GB 3BQ2A 4CYUA 3KK2B 1FRHA 4LRCA 3TVYA 1RT2B 4URGA 2HHQA 2K3KA 4FN5A 3JSBA 4KHPJ 2N82B 4KHRA 3KDNA 4DXLA 3TVZA 1YJTA 3WIVA 3AAWB 5JVGQ 5BJRA 3QFHA 1D3WA 1PJ7A 5CA5A 4I6AA 1YITS 2O01C 4OJ1A 2BJ8A 1LWEB 2QV6A 5E3PA 3DOMB 2L9NA 1RWXB 2Q79A 4FF2A 4K7QA 3MECB 5DG7A 4C8ZA 4DX7A 4J9VA 5FD1A 1P8GA 1N5SA 2DHHA 4TY9A 3W63A 2RS2A 5GMEA 4DPYA 5AT1B 3H40A 4G3IA 1ZTWA 5LJ3Y 4NA2A 4EU0A 1NXIA 1PGZA 2RQ4A 3DNCA 4CT9A 3BF4A 2N3LA 1RU1A 2AYGA 2V63A 4LQ3A 2ZDOA 4N76A 4C3MA 1X5SA 5D78A 2B7BB 2LFVA 1RQ0A 2Y0BB 4ANEA 2VG6B 4Y3CA 1TL1B 4DSFA 2VG7A 3RBZA 1Q8BA 2HS3A 2OPQA 4M5GA 3JAMY 1HNWF 1MW7A 1HWKA 4IG0B 1CULB 2HNZA 2OI2A 2BQUA 2XMTA 2YX7A 5IWAF 4ITSA 3EICA 1ZPVA 4AL7A 3BGRA 3BR8A 3BYPA 3EE3A 4KFBB 4PG5A 1YGYA 3HCXA 1UWBB 3MCOA 1GMVA 3SCIE 2HW3A 5L8RC 2ZJQQ 3X1LB 1KRPA 2CNNB 3FZBA 1VQPS 4X4OA 2BW7A 3OVSA 5J2PA 3TYTA 1J5OA 1HYSA 1P1TA 3J80Y 4WWSA 3MI7X 5DS7A 4ZPWR 2WOMA 3FFIA 2DNPA 2HHPA 3DI6B 2OFHX 1FKPA 3VAMA 4NYZA 3T5KA 3C6TB 1S1TA 3OVAA 3PYFA 3FEZA 3BV8A 5D3GB 4F3MA 6AT1B 3QT6A 4PG6A 1HKAA 4ZS6A 3CJ5A 4WP3A 5KG0A 4YUDA 1L3UA 2V2QA 1I1GA 4CWBA 4EZ9A 3K57A 4B9UA 3CCRS 3GYGA 3KJQB 5LXRA 4HACB 3LP1B 1F3FA 4FPRA 2DB1A 2HZVA 4HHUA 5KOWA 4NX9A 3J7YI 1AZSA 1WOOA 1OSDA 1AA1B 5J2MB 1IKVB 3AJDA 3IRXA 1FDDA 2ASDA 1WI8A 4J90A 3G6YA 1FJ7A 1X4FA 1CVJA 3HFZB 1C1CB 1YLXA 1AFJA 2CIMA 1IM4A 5A8KB 3PO4A 2ALYB 1OMSA 1AB8A 5KT6A 3LPYA 2CVIA 1NK6A 4BHQA 3ENAA 3C15A 2J7UA 3CF5Q 5GMKa 3PIPQ 1WSRA 4KPYA 2KB2A 4AXIA 2E9ZA 1KC8T 2HBQB 1GTHA 1ZM3A 4HI1A 3ILOA 3PR4A 2BMBA 3KLIB 2Z2ZA 2QYGA 1N32J 3GR0A 4WTOB 5A6WA 1PC5A 4F26A 2UUTA 5CYMB 1OJ4A 1WC1A 4OYAA 3F0NA 3CCVS 2M0GB 4C97A 2ZD1B 3SQGA 3MTJA 2CQCA 4CLSA 5DGBA 1TELA 3GMGA 4LR8A 1K8AT 4CI0B 2FLNA 2M8DB 1NSKL 1TL7B 3P8BB 4OYXA 1RSCA 1CS4B 1SUQA 3MUTP 3ZTRA 2IJFA 1FRIA 1TU0B 3FCHA 2CJQA 3L09A 3DC2A 1NSPA 2KN4A 2PA3A 1Y3JA 1KNZA 1KEKA 2DNGA 1REGX 3WBZA 1WEYA 5I3PA 3O3LA 4DSEA 2DPJA 2O66A 5KFYA 3M6XA 3NCQA 2IM3A 1OIAA 5F8JA 2JOQA 2CZ4A 3DOLB 3CJKB 3LGMA 2IVYA 2DBBA 2Q66A 4K4TA 1RTHB 2BABA 2XHWA 2VH7A 4KGVB 2WZ1A 3OFHA 3SCLE 4DCPB 3KLGA 2B9XA 4QBUA 2H4YB 3P49B 2NXNA 3GJQB 4Y2KA 3J81Y 5DDRC 1RAHB 1SKWA 2HZAA 4N41A 2M70A 2E1RA 2N4CA 2QIFA 3X3UA 2YKOA 4C8KA 4ERDA 5KFOA 4ZVEA 2QLXA 1SV5B 2H3EB 4OZ5A 4OZNA 2IAJA 3FQLA 2HZCA 2B6AB 4EBDA 2ZVSA 3D68A 3G87A 3HVTA 2HVEA 1OY6A 2NXCA 4NASA 4B02A 4E2FB 1X4EA 2L08A 1QTNB 4OQJA 3S8SA 4WJBA 1M1GA 1WACA 2KVIA 5KAKA 2AHOB 4UUWA 3BR9A 2F4VF 2WONB 1RT1B 3MAAA 1IQZA 2G0JA 4LT6A 4B3SF 1F1BB 3PR5B 1S59A 3JSMB 3UNGC 4YS2A 1NMEB 4FXWA 2ZBIA 5C2CA 2HWIA 1DTTA 1L3VA 1XJWB 4DV0J 1YSJA 2W9AA 3M8RA 4A8OA 2PMZD 3J7A1 3IS9B 1NDLA 4J37A 5L38A 4CYUB 1S0VA 5SZTA 1U6ZA 2VPZB 1KLMB 1OPIA 3KNAA 4RW7A 4U67Q 1RWVB 4G1QB 2FVPA 5EGYA 2I38A 2I0XA 4P2FA 1VRTA 3MMJA 4RW8B 3U1LA 3CDEA 1U2RA 4I6YA 2B8PA 3KLFA 4F50A 3I31A 1SL2A 1WKKA 4H4OA 2ZUGA 2HHXA 3MHYA 2NUHA 4DR5J 1DURA 3TAMA 3R5DA 2HS4A 1S99A 3QO9A 1EQ0A 3I55S 3KK3A 4NXNF 4DX6A 1UL3A 4UF4A 3PEHA 3GTYX 1P6TA 3PZPA 2JC1A 4FYYB 4AL5A 5K8MA 4DHVA 1FFGB 2DH9A 4CLKA 2DT9A 4HT7A 1UVNA 1N5YA 3VTIA 3M8YA 1K47A 1X4AA 4OZ3A 1EAYC 1WDDA 5DQIA 1LQ9A 4ZVPB 2VG7B 2OPQB 1H7XA 2HFOA 2I8EA 1CSJA 1UP1A 3DCAA 4LF2A 1JB0C 4EBEA 4E8UA 2JFDA 3RB0A 4DR1J 3L9ZA 4MH8A 5GMDA 5ETPA 1PG5B 1HBUA 2DITA 5T41A 1VBZA 1NZ8A 2MQPA 3HULA 2NREA 4NYOA 3GONA 2CJ9A 3V6KA 2R8IA 1ZETA 3EX7B 2XS7A 2EXUA 1BMQB 2EC2A 2RHSB 2GX8A 2GQQA 4OJGA 1JK9B 3H25A 2VOOA 5J2PB 4A8QA 2J9DA 1J5OB 1HYSB 1RBLA 2OLWA 3IRWP 3GIMA 5I42A 2WOMB 3FFIB 3K5MA 3C14A 2X1FA 1FKPB 4DV6J 1NK0A 1KFSA 3AY0A 4DL4A 4Y65A 1ZM9A 1YTYA 2KI2A 1WD6A 3T6BA 2K7KA 1FJGF 3UR0A 2M4MA 4DF4A 4K4SA 1WDTA 1VQKS 2B4PA 5F41A 4TVAB 4QR0A 2Z58B 3RB3A 1JLCA 3MD1A 1S0OA 4WPAA 3GJTB 1JQGA 3MFHA 2DRDA 2ADCA 3Q8UA 3GSIA 3BH7B 2G2OA 4NEZA 2WBMA 5HVGA 1R8HA 1U1NA 1CJKA 3KUEA 3E01B 2DO4A 4JV1A 4UQTA 2FJEB 4MYUA 1X5TA 1YDLA 5GAGI 2B4UA 3GQCA 4C48A 1HQ2A 3EVWA 4LJMA 5AXNA 2NS1B 4LF5J 1LXJA 1OO0B 5HQLA 3IRXB 5BR8F 3HD2A 3RUBL 3IA0A 1RXOB 3NS5A 4E98A 1IKYB 2G1DA 4KH1B 1UPPA 1S4FA 1XK8A 3CVKA 4H4MB 4DZDA 1S79A 3HKWA 1AROP 1NCLA 4JI0F 5H9FJ 2D7SA 2M7SA 2FVRA 2E1MC 1LK5A 2DXEA 3CCJS 3CCES 4WIQA 3TQ1A 4CIOA 1T03A 2ZOFA 2Z8QA 3PO5A 4X62F 5ETRA 1X0FA 1BY9A 4Z2XA 2VV5A 2Y8YA 2D1CA 4YOEA 3HHDA 1GMWD 1IJEB 3M9MB 2N7CA 1HHTP 3GFYA 4WCEQ 2UZAA 1WC6A 4R0JA 4EBCA 2OMOA 1TV6A 3SQGB 4X84A 5HANA 1U1OA 5B0CA 5ETKA 1VIOA 1WOPA 2J6TA 1XQIA 4QPTA 4ZCKA 1D9FA 1KFDA 4F25A 4EYHB 3KLEA 4LSLA 3NMRA 5HVFA 2CQDA 2H51B 1ZA1B 1VQ7S 3SMZA 2EG1A 5ITHA 3GG0A 4AQYF 2MEWA 2Z2LA 3TX8A 1SUQB 3JSYA 1NZAA 2CPEA 3PX0A 4GO5X 2VC1A 3U1NA 3OL9A 5DQGA 5K20B 2OKQA 3MF5A 4AD6A 3MM6B 1C1BA 4GO7X 2B9EA 4RBTA 3EVOA 4HDGA 4MK9A 3ISZA 5IM0A 2DHXA 3H20A 2BE9B 4UOFA 4C8YA 2ILYA 1VRQC 2BOAA 3ZZRA 3PX4A 2R2SA 2PFFB 2W9BA 3KLGB 1MWYA 1NHKL 4HH1A 1MLAA 2U2FA 2KJWA 4UQGA 4K50A 4DV5J 3AOAA 4X4TA 5D4NA 4N77A 1NJWA 2QL5B 2QA4G 2RNEA 1BGXT 4YB6A 5LM7E 2OEMA 2YQ3A 4DI6A 2YNGA 3AJ1A 2R7VA 2BJ1A 2IAJB 1C0TA 2IJRA 4K0KJ 1JKHA 1Q16B 2Z30B 2C22A 2ASYA 1XTZA 2JH3A 2CQ0A 4L74A 4MIAA 4F7VA 1FWLA 1NNDA 2QLJB 1HMVA 1ROFA 3MAAB 4KIAA 2XO7A 3TAQA 2MQNA 4M5HA 1JJ2R 4OJ3A 3R5GA 4PZVA 2PDAA 1T8EA 3F44A 3SYZA 2KYXA 4O23A 3A3OB 2AF6A 2MGZA 1P9QC 3N5BA 2E7XA 2UP1A 3D5MA 4W90B 2KXHA 4RU9A 2KM8C 4I64A 3IC1A 1NSAA 3Q8RB 3A8EA 4YDDB 4RW7B 5JXSA 2UU9J 2KJVA 3RAMA 5E7OB 4K2JA 1NBEB 9ATCB 4DR4F 4V19J 2W8LA 3CSKA 1MWQA 5ETMA 3KLFB 1Q8IA 3H5UA 2IM2A 3W66A 3DLEA 1DTQA 4YEAA 4RNFA 4H4OB 2DR8A 3K7RA 2VFVA 1YQHA 4F2SA 3PTWA 2COLA 3TAMB 4RO0A 2DD8S 4DSKA 2CNLB 3NS7B 1AXQA 3CMES 2A2CA 3QO9B 3W7BA 2XGPA 1IVZA 5DLFA 2BJ7A 5KFAA 2RQCA 1Q86T 2PMWA 3RTVA 4EMDA 4L6V3 1JXEA 1N52B 4OZLA 4K5SA 5FJ4A 3PKMA 3GE9A 3PYGA 4HHHA 4GKJF 4MKAA 1OY8A 2ZH3A 3D1QA 4P2MA 3SCJE 1OSCA 5HMWA 3JQMA 2NXJA 5IOLA 2JZ5A 1X0PA 3D6HB 4OHVA 4KQZA 3TAPA 3AD7C 1N36J 1WORA 2KHDA 3DRXA 4ED6A 3KWMA 2BRKA 4OV1A 4WFNQ 1H7WA 3FBFA 3CUNA 2FUG9 2MYFA 3EGZA 4RUAA 5IZHA 1FXDA 5F3TA 2Y8WA 2C42A 1NK5A 2FVSA 1UFWA 3SQOP 1KTVA 1HBUB 3MMAA 3OFGA 2AW0A 2QEXS 1GMUA 3ZC4A 1EETA 5AE1A 4JI2J 3DLGA 1FT8A 4PUOA 4EYIB 4DL2A 5AXLA 2M2BA 3G4SS 1DQ8A 1M5VC 5G4DA 4DSIA 5I42B 3HZGA 1J5EF 3C14B 4NLOA 3TR5A 2L9WA 4RW9A 2ZM6J 4UOCA 4QIFA 4O0NA 2QMXA 2QSFA 3VQTA 3QNWB 1U24A 3FRYA 4LF6J 1ZYQA 2HLUA 3M9OB 3R3TA 2KFZA 1U1QA 4NLUA 5AXMA 2E5LJ 3H4BA 4HEA9 1EQMA 2HQCA 1CJTA 3SZ2A 1YI2S 1JLCB 1S5ZA 2DH8A 2B56A 3FEYB 2PI5A 3UWTA 3W61A 1NPKA 4LFAJ 1HBOA 1FWPA 3RRKA 4Q45A 3HKZD 4NYPA 1WG4A 1IWGA 4DR7F 2RSQA 1Q8LA 1U09A 3SBMA 2RJZA 1CJKB 3KFWX 2YKPA 2ILZA 4J7CA 3CD5A 1FDBA 3THVA 4N8OA 4MYTA 4ECTA 4R8UA 3GFXA 3Q86A 3MAQA 1Y5IB 1CQNA 3P4UB 1XMQJ 2CZ9A 1MSWD 1MN9A 1REVA 4FNIA 4PYAA 1RHMB 2BM1A 4F4WA 3Q8PB 2E66A 2BKOA 3ZZ0A 2LVWA 5IT9U 1N88A 2IBOA 1F60B 2EK6A 3IG1A 3HZEA 4IRKA 2O5DA 4DQSA 1EJ7L 1WKLA 2O1PA 3KG4A 5CYQA 2R8GA 1T9YA 6FDRA 3DLHA 4JP8A 1SJ3P 7AT1B 1TV6B 4YMEA 1R89A 2M88A 2H48B 4IH7A 3R2CJ 2NXUA 1TFYA 3P6YC 3AH6A 1RE1B 4DR3J 3JSRA 3FZ2A 5F8MA 4LSLB 3KLEB 4WFZA 3OW2R 4DU8A 2UVRA 3BEGB 2ZOGA 3EVMA 1KD1T 3OL7A 2XMJA 2E5IA 1HR0J 3BQ1A 1QVFR 1VQSA 3I0SA 4RR5A 2UV8G 4OX8A 1C1BB 1UVLA 3BBFA 2LCWA 1FJEB 2PN6A 1BHNA 2ROPA 3AD9C 1P1LA 1FERA 1PAUB 5IM0B 4OYOA 4URQU 3MM8B 3NGRA 3J7ZT 2D9PA 1GQEA 2E7VA 4DX8H 2I5JA 2WTFA 2ZC3A 3QJLA 2V9KA 4KR0B 4ED4A 3WX8A 2F4FA 1UFKA 1X8DA 4K4YA 4QOTA 2DGVA 2IRYA 1TVRA 4DPXA 1R27B 5ADZA 4BDPA 3I0RA 3T3FA 5KT2A 1C0TB 5C24A 4NLWA 3DMJA 2VJVA 3QJPA 2D69A 1VQ6S 1JKHB 4K8RA 3RB4A 2CJYB 4R0EA 3CCZA 1PBAA 3BREA 1SQFA 2CPYA 4NA3A 1NRKA 4ES3A 2VOPA 4ZIVA 4BLGA 1HMVB 2ZBQA 5DLGA 1I6JA 2MQMA 2GVZB 3T5HA 5BXIA 2VFRA 5D15A 1SH0A 1H3DA 1RAFB 5LMNF 4M5NA 4FKYA 2F63A 2OH2A 1VMBA 2R7SA 2GGPA 4WK3A 2BA9A 2I6WA 2MGZB 1SC1B 1LV5A 2D9OA 2RRNA 2FHOB 4DV1F 1FWKA 3T9NA 4OX9F 1FEHA 3D6MB 3IR5B 4DN9A 3AJ2A 3QSYB 3S1TA 1GXTA 2AEFA 1VLYA 2ATCB 1NAQA 1T05A 1KBRA 2YKNA 4EFAC 3HP6A 2JWNA 3U27A 3RYLA 4IKAA 4MIWA 3NAHA 4PXBA 2E5JA 3SDEA 2UXDJ 3EZUA 4CLYA 2B7CB 2GIFA 5FIIA 1FTCA 1Y00A 1G1XA 4ZLPA 3O44A 3DLEB 1DTQB 1QTMA 3TP2A 2OO4A 1Y9OA 1XNRJ 1HW8A 2XLJA 1PC4A 1S0MA 4TU8A 2EKNA 3IP0A 2PA8D 2DGUA 1H2TZ 1UJ5A 3M2RA 3D67A 4KHPF 3I87A 1NJYA 4JYAF 4NXMF 3W1YC 4CO0A 1NH8A 3GFZA 4BWJA 1Q5YA 4YR0A 5H9FK 1G7CB 1NJXA 2V6AA 1VCTA 4CNZA 1X4BA 1XWLA 3R8YA 4CCHA 2DCUB 2ZBCA 4DPTA 2IM1A 4URSA 5DDOC 5GAEI 2APOA 3CT9A 3W60A 4QR1A 3KUHA 3QIPB 1CJVA 1HD0A 2XZWA 1HBMA 2MY7A 3G6XA 2BJDA 4NCBA 4HVZA 4P2SA 4O3OA 1ZOTA 2VC0A 4CM0A 3UE2A 2CG4A 4Y34A 2AYBA 4DBQA 3QRRA 3HHLD 4JI8J 3CCTA 3NRBA 1EETB 3ILLA 4PG8A 2R8HA 4DR2J 2FJXA 1W25A 4OLPA 3DXSX 3DLGB 4MAKA 4PUOB 3JB9k 4DS5A 1M5HA 1RWWB 1F9HA 1HLWA 4DG1A 2XNQA 1J2VA 4ED2A 1CC8A 4ZJQA 3MEGA 5KT4A 4F4XA 4UOGA 2QLWA 3KHRA 5KOXA 4USUA 4B3RF 1N4LA 3O2IA 2O67A 2WRMA 3CE8A 1JJCB 5DG8A 1RYRA 3ULHA 5THWA 4OV6A 4KRWA 1RUSA 1NB7A 4RW9B 1FNOA 4Y2IA 1YWXA 2E9RX 3M1VA 4B08A 3CDWA 4QIGA 3HSZA 4USIA 1DFDA 2MB0B 3OSNA 2NZCA 4ELTA 3FBBA 3H2LA 2XS5A 4MT1A 2C3YA 2LQ9A 2XMMA 3SIPB 4O3SA 1RAGB 1CJTB 3FJ2A 4M63A 3C16A 1UWAA 4OHYA 3CJRA 1U1PA 4PWDA 1TTHB 1Q81T 4EWTA 2NUUG 3UVJA 3MEEB 2QG9B 2XQCA 2FJAB 4JV0A 3AA8A 3K5NA 1ZA2B 4PAAA 2MKSA 4JV5F 5M2RA 3T6JA 1HQUA 4QW8A 2CQ1A 4TN2A 4NCGA 4C8LA 4A8KA 1QLNA 4R8UB 1TUVA 1X60A 3TUIC 1A6LA 1A7GE 4FPIA 4QZVB 2XZTB 1REVB 1WHYA 4Q0BA 2LP4A 3GG1A 2H5IB 4KKOA 4QWDA 3BPDA 2E1CA 4CT8A 3EPGA 5LJ5Y 3A4TA 1QM9A 1X31C 4Q2LA 2PGCA 2L41A 3CTRA 5K14A 3D0GE 3PKYA 5E33A 4CRJA 3DLBA 2B4OA 3QQCD 2VU5A 1VQYA 3GV7B 5J2NA 4I2PA 1N56A 1HD1A 3E3XA 1Z4UA 1Q95G 3PW4A 4OHZA 4LF8J 1UFLA 5CYQB 5F9NA 2FJWA 2OTJS 2EFNA 2ZH6A 1IBMJ 4CDIA 4OI6A 1PYTA 1N0VC 2FZCB 4KHMA 2CJAA 1CC7A 2EFOA 4QWEA 1VJWA 2ERRA 3PV8A 1XR5A 5KFRA 2HBZB 2J6UA 3FC9A 4A48A 2HGNA 2OFGX 5HQ8A 3M8QA
chains in the Genus database with same CATH topology
3GB0A 1UMJA 3MMBA 5A8KB 1YIJS 3OTBA 3PO4A 1UW4A 4OI3A 1S77D 1U1KA 1UVKA 2WBRA 4N5SA 4C7QA 4DF8A 1CLFA 4OI1A 2IC3A 3V6DB 5KFIA 5KT6A 2MZ1A 3LPYA 1LFPA 3DLJA 1D8ZA 4G1PA 3I0SB 4KO0A 1SJFA 2HHUA 3IGNA 2NQPA 1L3KA 2CVIA 1NK6A 4RZRA 2YWGA 5HO4A 1O8BA 1VK3A 3HHLB 4BHQA 1C0UA 2J7UA 3CF5Q 4IG3A 5GMKa 3PIPQ 5U47A 3KHGA 4KPYA 2KB2A 3KMSA 4AXIA 1WG1A 2E9ZA 2ZC4A 1KC8T 3FSIA 1GTHA 1QAJA 1ZM3A 4HI1A 4J9PA 4O3PA 3PR4A 4DS4A 1YJ9S 3KLIB 2P6TA 4RUHA 4JI1F 2RU9A 3V4IA 3GR0A 1DLOA 2V94A 5A6WA 3TOQA 1IKWA 1PC5A 5D4PA 4F26A 5FLXY 2R7WA 4ECRA 3EGWB 2BM0A 4WFBQ 4RW4B 2UUTA 3KJVA 5CYMB 1F9FA 2EKYA 1VHFA 2R7XA 5B09A 3CJ2A 5KFWA 4IQMA 2HNDB 2K7JA 5F9LA 1L5UA 3I5BA 3CCVS 2M0GB 4C97A 2IJNA 4CTAB 4DN0A 3T1YF 6FD1A 2ZD1B 2GV1A 3SQGA 3PW5A 1NK7A 1KVJA 3MTJA 1FNXH 2XMUA 1TL5A 1B0VA 5E41A 2CQCA 3MDFA 3UDCA 1S10A 5KFUA 1FE0A 2I5JB 4HHJA 5CH7B 5DGBA 1M5OC 4JUZA 4NRTA 1EP4A 3OUYB 3GMGA 5HP1A 5L9NA 1N5QA 4WZMA 3IWXA 1K8AT 4NOHA 4DMZA 4CI0B 1IBLF 2FLNA 2M8DB 2BOPA 2GMLA 3DLKA 4ECVA 2RKIA 3MUMP 3ONQA 1H38A 1GX5A 4I0WA 3HT3A 2W9BB 1VQ4S 3NBPB 3V6HA 4IYQA 1TVRB 4U9RA 2HQ3A 2O3DA 2YNIB 3DRPA 3QWUA 2D3OR 5D6GA 4RUCA 2CYYA 3RW6A 4IRCA 2JEIA 1SUQA 3MUTP 4ZPCA 2ROGA 2IJFA 3I0RB 1FRIA 5L1JA 2MKIA 1ZAWA 3FCHA 2CJQA 3L09A 3MZIA 1Y5NB 4DV7F 4ED0A 3Q0AA 5C24B 1V3RA 4DV5F 4O3NA 2AGQA 3DC2A 4XDDA 1M5SA 4R25A 2KN4A 1RTJA 2PA3A 2R9LA 1TAQA 1Y3JA 4YR2A 2XMVA 3ZZYA 2B9WA 2WHOA 2Q6BA 3M30A 5M2UA 1KNZA 2RS8A 1CEZA 1KEKA 2LECA 1WEZA 2YNGB 3MPWA 4YHHF 3MM8A 2DNGA 5A2QY 3PW2A 1FO1A 3WBZA 4B9MA 4K4UA 1WEYA 1JX4A 3HLUA 5I3PA 3O3LA 3MEDB 4MMOA 5KFQA 2O66A 4WYWA 4DSEA 1NK9A 2DPJA 2KFNA 3OSPA 2MKCA 1ZH5A 5KFYA 4JI4F 3SEOA 5LSRA 2AJFE 1S1WB 3M6XA 4ZP8A 3NCQA 4QR2A 2DGSA 2IM3A 3GWCA 1OIAA 2ZH9A 5F8JA 2JOQA 2CZ4A 1KSPA 2EK1A 3DOLB 1U26A 2U1AA 3THTA 3CJKB 4K0KF 3HVAA 3LGMA 4ATNA 2R2UA 4LSNA 2IVYA 4DQIA 1S6OA 2DBBA 2Q66A 1VIXA 3OR2B 4K4TA 1RTHB 2BABA 2XHWA 5L1KA 4IOAQ 2CQIA 2CQ4A 4OI2A 1I94F 2RU3A 3NL0A 2VH7A 1S7HA 4ZPDA 3OFHA 3SCLE 2AP6A 3KLGA 3MGJA 2UXBF 2DNKA 5T7LA 4G1IA 1U7LA 4BC7A 2B9XA 4QBUA 2AWZA 3BO2A 3FSXA 3VAIA 3P49B 3N6MA 4WIIA 3QZ7A 4Y2KA 4DQQA 4ETZA 4CO2A 4IOBA 3J81Y 4WE1B 3H4DA 1Q78A 1G2EA 3ITHA 4A8FA 5DDRC 1Q79A 4IUFA 2EFQA 4IFVB 5HLFA 3T19A 1SKWA 2WSCC 3DYAA 3CC4S 2MXYA 2VBWA 4N41A 4Q8EA 2M70A 2RF2A 4LVOP 4YB7A 4Q8FA 2E1RA 2N4CA 2QIFA 2W4PA 2YKOA 5KFXA 3X3UA 4C8KA 2LDYA 5C42A 4ERDA 5KFOA 4N47A 4ZVEA 2SXLA 3H5SA 2QLXA 4NPOA 2LLZA 4RW6A 4C9DA 4JOUA 1SV5B 2PEHA 2FJBB 3GR1A 3UW1A 1T05B 1QVGR 4OZ5A 3MFIA 2GQ2A 2YKMA 4OZNA 2KG1A 1HQEB 4X4PA 3AQOA 2IAJA 1TKTA 2YKNB 1JLFB 3DM2A 3FQLA 2HZCA 1X4HA 5DO2A 3S6EA 5HMYA 2B6AB 1T02A 4EBDA 2ZVSA 3TRGA 1R3NA 2V8VA 1DQ9A 2JX2A 3SDEB 3TA1A 3HVTA 4DOZA 3FDSA 2J5AA 3LW5C 3L7OA 2IYIA 2C2RA 1JLAB 4B02A 1OS5A 3LH2S 1X4EA 2L08A 4RNNA 4PQUA 2CQGA 1FF2A 4OQJA 3S8SA 4WJBA 1D8YA 2RVJA 4C8OA 1ZM2A 1WACA 2KVIA 3OTCA 5KAKA 2KRBA 4IH6A 2KO1A 4MK7A 4BC9A 4UUWA 4BBYA 3HXMA 3BR9A 3HJFA 3BS9A 1ZZFA 1BQMB 2ABYA 2AV5A 1RT1B 2WONB 3JTOA 4IFYA 2F4VF 3I5CA 1RT6A 1IQZA 3B4DA 5CD4H 2FHMA 3JTPA 4LF4F 1VRUB 1JNZB 3EXCX 1N48A 4LT6A 3CDAA 4B3SF 2PSZA 4A47A 1T7PA 3PR5B 1XERA 3R1HA 4F02A 2HHWA 1RISA 1S76D 4C3KA 3JSMB 3UNGC 2V2KA 3H5XA 3QLHA 2M52A 2BQRA 4FXWA 3VAGA 2ZBIA 2HWIA 1DTTA 1L3VA 1KQSR 1YSJA 5LSLA 1Q82T 2W9AA 4WKRA 1FD2A 3TUZC 3M8RA 3M6WA 3ZZTA 3TI0A 1X5OA 3QGGA 4HKQA 3M2RB 1U2FA 3EUNA 4A8OA 2PMZD 3LUYA 1LFWA 2E1AA 3UPFA 2R8JA 1FXRA 4XIUA 2BXJA 2P9CA 3J7A1 3IS9B 2AD9A 2JEFA 2FLLA 4J37A 3CD6S 3M32B 4LUBA 4PKDB 1F5CA 4QPXA 5L38A 3LO3A 3MM7A 1SIWB 1K9MT 5HMXA 2DISA 2UUWA 2I2YA 1S0VA 3NKYA 5A0YB 5SZTA 2HHTA 4CH0S 3TUJC 1SQEA 2CVEA 2DNHA 3OV7A 1U6ZA 2VPZB 1KLMB 1OPIA 2XMKA 3BDEA 3KNAA 4RW7A 5IS2A 2CPFA 3I32A 5L1IA 4M8LA 5IT9Y 4QW9A 4FYDA 1TL4A 4U67Q 1FXLA 3CJ0A 3QGHA 4G1QB 2FVPA 2ZNZA 5EGYA 1NHUA 2I38A 2XLKA 2I0XA 4QYZJ 4DR5F 1G3OA 1SH2A 1VRTA 2RIJA 3FRZA 3MMJA 4AXJA 4RW8B 3SFGA 2VL1A 3F41A 4A8YA 3U1LA 2DIVA 3D0HE 3CDEA 1HBMB 4O4RA 1U2RA 5B7WA 4A8MP 2WK4A 2LA4A 2QT7A 1TP7A 4I6YA 2ZHAA 1KS2A 1VQNS 1FRLA 4ID5A 3KLFA 1XR7A 4CH1A 5K8OA 4F50A 1E6VA 3N28A 4JBCA 2R7UA 4NLSA 5J1EB 3I31A 1SL2A 2JEGA 1VC5A 3OQ2A 2ZH8A 1FE4A 1JLGA 4H4OA 2ZUGA 3BGFA 4NRUA 2HHXA 3KTQA 3G9CA 2DGOA 3FEXB 5DM6Q 3MHYA 3Q8QB 2NUHA 3AB4B 2ROEA 1DURA 2YNHB 3TAMA 2OSRA 1MNEA 5A8WA 2J76E 3N4WA 2I1RA 2CQBA 2Y0SD 4QQBA 2NSCA 1MU2A 3R5DA 2DNNA 1CQMA 5GAEU 2LQBA 1JLBA 3Q2SC 4XPEA 2HS4A 3DRRB 2LU2A 2FD2A 4TY8A 2Q6CA 3MM9B 1S99A 1T95A 3QO9A 4FZVA 3I55S 1AFIA 3KK3A 4NXNF 1UL3A 4FS2A 1UVJA 3U1MA 4EO8A 4DFKA 3PEHA 1P6TA 2RDJA 4WXWA 2P5VA 1HPZA 3I96A 3PZPA 2JC1A 5HROB 4CZCA 4M5DA 5KFPA 4AL5A 1LK7A 5K8MA 4DHVA 2DH9A 2DT9A 1DQAA 2BE2B 2D41A 2NLWA 2MJNA 3B82A 4HT7A 3CC7S 1N5YA 3MR3A 1UVNA 4DG1B 2FB0A 3MMAB 2YWHA 3MMCA 1HFEL 2ZH2A 3QIPA 3VTIA 3MEGB 4B9TA 1RYSA 1FRJA 3R5CA 1X4AA 3LP2B 3NG8A 4JI3F 1RDRA 1RK8A 3RR7A 1WELA 2RH3A 3QGIA 5F8NA 3LWMA 4V19X 4DR1F 3KOAA 2IFXA 1Y7PA 3PEJA 1SJ1A 2CJKA 2MZTA 1FNMA 1S1UA 2JHEA 2YVSA 2G4BA 1LWEA 3GYXB 3TNVA 3PY8A 4JI2F 1VOMA 4LQ9A 5DQIA 1LQ9A 1YJUA 2Z0GA 3W2WA 4DV2F 4ZHRA 1HNXF 4X2BA 2VG7B 2H5EA 5DDQC 4Q2MA 1LW2A 1H7XA 2OPQB 5HL7Q 3MECA 3D2WA 2HFOA 2I8EA 1CSJA 1QAIA 1UP1A 3DCAA 5GAHI 1V3ZA 4HTIA 1JB0C 1ZZNA 4EBEA 2BR0A 4E8UA 2XLIA 5DQHA 1WNEA 2JFDA 1S1VB 2QRRA 3IR6B 2XY6A 1S6PA 3RB0A 2P6SA 3PJWA 2AJ0A 2IHR1 3MPYA 1RI7A 5KT7A 3KK1B 4ELVA 4Y6IA 2HNYA 4MH8A 3OXFA 2JL9A 2DNRA 3C6UB 2XY7A 2DNMA 1HI8A 2J9EA 1U8SA 1HBUA 2DITA 1TK8A 5T41A 5GAHU 2VKZG 1VBZA 2LMIA 2MQPA 4O3RA 2NREA 1Y5LB 5EHHA 4NYOA 4PWDB 4LF6F 2CJ9A 3ENWA 1X9WA 4IQXA 3V6KA 2R8IA 3UI3A 3LANA 2DNLA 1ZETA 3EX7B 2XS7A 2EW9A 3N6LA 3NGKA 2GX8A 2CQPA 1B0PA 4MKBA 2GQQA 4PUOB 5B0GA 1PSDA 1JK9B 4OJGA 3H25A 2XSJB 3DRSB 3RBDA 2M5YA 2DHAA 3IR7B 2RE1A 3N01A 1HNIB 1GNKA 1NKCA 2VOOA 2NR0A 1HBNB 3M8QA 2FDNA 3N5FA 5J2PB 3SI8A 4A8QA 1HBOB 3E8OA 1XN9A 2J9DA 4RBUA 1J5OB 1TL1A 2DHGA 3LF0A 1M5KC 1FHTA 1HYSB 1FRKA 2OPRB 1SJQA 1XMBA 2OLWA 4PCQA 3IRWP 3GIMA 1IUJA 5I42A 2J9CA 1HQUB 1V9OA 4ZPTR 2MZSA 2WOMB 3FFIB 3KLHA 3K5MA 4NCGB 1RT4A 1X4GA 2X1FA 1FKPB 2K3IA 4ED8A 4KJIA 2XI2A 1TL3A 3NMAA 1NK0A 3NLCA 2KXNB 4PG7A 2J0WA 3AY0A 1KFSA 5E3QA 4KGMA 4ZCIA 1KOHA 7FDRA 1BD6A 4DL4A 4Y65A 5I4MA 2GHPA 1ZM9A 5F8IA 2XBPA 1YTYA 2POKA 2OSQA 3MEKA 4J9OA 1HHSA 1NH7A 1WTBA 4C0HA 5MAOA 2KI2A 1WD6A 1FVQA 2R7OA 1LWCB 3T6BA 3G71S 4ZMMA 4Q0BB 1RKJA 3UD4P 3WX4A 1GXUA 2K7KA 1D0EA 1TKZA 1R0AA 2VQEF 2AQ4A 3DGPA 2HPUA 4KKOB 1KQKA 1LOUA 1SIZA 3G8SA 2F7VA 1LWFB 1QE1B 1RT3A 4RNMA 1V6HA 1FJGF 3UR0A 2M4MA 4K4ZA 2L48A 1CG2A 4YDXA 4DF4A 4O4GB 4K4SA 1VQKS 4AUKA 2V9WA 2B4PA 3MEEA 2A3JA 5F41A 4OI0A 4KB7A 2IA6A 4QR0A 5K14B 3RB3A 2YY3A 1JLCA 3KKFA 2C2DA 3MD1A 1RKIA 4RU2A 3I82A 3HVRA 1SJ4P 5IT4A 1S0OA 3T1HF 4IH5A 2ZH7A 2GCFA 3MFHA 3K58A 4UY8T 2HLTA 1XNQF 4F4ZA 5J2NB 3L95X 2ADCA 3CCLS 2AGPA 2KM8B 3RB6A 1IBKF 3VQSA 1S6QA 4ZPAA 2X1GA 5E2QA 1RTDA 2ZNYA 2J6SA 4EO6A 5I3UA 1IR0A 2VA3A 5DRKA 4OZ0A 5BYRA 4KGKA 3SXLA 3IWNC 2WBMA 4DLGA 3DDKA 5KG2A 2JLEA 1R8HA 3IG1B 1U1NA 3NGDA 3GV5B 1OWXA 3E01B 3UD3P 3J7Z5 2DO4A 2LDIA 1RAJA 1C4CA 4JV1A 2HVZA 4CO4A 2DNQA 4UQTA 2ZH5A 2FJEB 4MYUA 1X5TA 3C6TA 4PWUA 5LT5A 4ED5A 3JYTB 4I7FB 4LF9F 5GAGI 2KH9A 1T3NA 4Y2AA 4B17A 2B4UA 3GQCA 5FDLA 2QA2A 4LJMA 2D3ZA 2NS1B 4NL5A 3W2VB 5AXNA 1LXJA 5IXUA 2HHVA 1VQ5S 4FVMA 1OO0B 3IRXB 2AU0A 5BR8F 3TA2A 5KFHA 2MPUA 2FLPA 3M8SA 2IRXA 2OD6A 3IA0A 3NS5A 2FTRA 4E98A 1IKYB 2G1DA 4DWIA 2QA1A 1ZPWX 4O3QA 3DN9A 4OZ1A 1S4FA 1XK8A 5GADI 2LEBA 4B3OA 4WF9Q 3CD7A 3M2UA 3CVKA 3M2VA 4XO0A 4H4MB 2W9CA 1QSYA 4ZCLA 1S79A 1K73T 2IMOA 2G0CA 5GAGU 2IMWP 1RTIB 2C28A 5T14A 3HKWA 3VAHA 2RDIA 2VB6A 3PW7A 3M8QB 4OJHA 1AROP 4C11A 3MMBB 4JI0F 4USHA 4K4WA 2F8EX 5H9FJ 2D7SA 2PC6A 2M7SA 5AXKA 1NU4A 2FVRA 2E1MC 3J7YU 4ILMA 1LK5A 1ZAXA 2IC3B 3JTNA 3D0IE 3UCGA 5CXTA 3OL6A 3CCES 3CCJS 3TQ1A 1M90T 3LP1A 1S49A 4KO0B 4RLEA 4CIOA 4DR3F 5GADU 2E5HA 1VBXA 2EC0A 1T03A 1K1QA 2HMIA 3VAJA 3V81A 4LIRA 5J1PA 2ZOFA 2Z8QA 5EUHA 3PO5A 1SC6A 1C0UB 4X62F 1UEUA 2OP5A 1RWUA 4PXCA 3RRHA