3T1HF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1hF00
3R3TA 2B7CB 4LF4F 5LMNF 4B3MF 1IBMF 2RJZA 4LF6F 1CQMA 5LMUF 1IBLF 4NXMF 4DV2F 4X66F 3ZZPA 2UXBF 4JI8F 2UUAF 4JI5F 1J5EF 2YY3A 1FJGF 1XNQF 4JI2F 4DR5F 1VMBA 4GKJF 4DV7F 4AQYF 4LF5F 1G7CB 2J5AA 4B3SF 4LF7F 1XMOF 4JI7F 2F4VF 1N33F 5IWAF 4DV5F 1IJFB 1XNRF 4LFBF 4JI0F 4DUYF 4LFAF 4DR1F 4JI1F 4DR4F 2KJWA 2BXJA 4K0KF 4YY3F 4LF9F 1QJHA 1G1XA 1CQNA 5AJ3F 4X65F 2UU9F 1I94F 2ZM6F 2UXDF 4LFCF 4OX9F 2VQFF 4JI3F 2UUCF 1B64A 1XMQF 2UUBF 4DR2F 4DR3F 1HNXF 4DUZF 1IJEB 1RISA 4JV5F 1LOUA 3T1HF 4DV3F 4NXNF 3T1YF 4B3TF 4B3RF 4JI4F 1HNZF 4YHHF 1N32F 2HHHF 2E5LF 4DR7F 4DV0F 1N36F 2BVZA 2UXCF 2KJVA 5BR8F 2VQEF 4X64F 4JYAF 1IBKF 1FKAF 4DV1F 4JI6F 4X62F 2B7BB 4DR6F 1GH8A 1HR0F 1N34F 1HNWF 1F60B 4LF8F 4DV4F 4GKKF 3OTOF 4DV6F 4KHPF
chains in the Genus database with same CATH superfamily
2XWXA 1QSSA 3MTJA 2CNLB 1S9EB 4F67A 2J7KA 2KVIA 2ZE2A 1WG5A 2HQ3A 1D09B 4N77A 3MR7A 1R8HA 3MHYA 1AA1B 1XMOJ 2HHXA 2V4RA 4LQ9A 4PG4A 2CG4A 3DRSB 2V50A 3NGKA 5I3PA 2IM0A 3BH6B 1S1WA 1HWLA 3BSAA 1O6XA 3ILOA 1I94J 1FJ7A 5J2MA 3OTEA 4WFBQ 3W5XA 3PG9A 2HHHJ 2OIHA 4P7TA 4CP5A 3OVBA 4FNIA 4NX9A 2VDHA 3EICA 2VBYA 2MKCA 3H25A 4RUCA 3SQGB 3OR1B 1ZETA 3FKBA 4NLQA 1UPPA 4GKKF 4ECZA 3W65A 3Q89A 4EMDA 2BQUA 1KP6A 4Y6IA 2LEBA 3HO1A 2HNZA 5BYRA 5CAAA 1H72C 1KLMA 3N9UC 4RKUC 2NCKL 3CE8A 4OYPA 4E2FB 2GW8A 4PUOB 4WU2A 3ETOA 2MJNA 5I4MA 3BF4A 1GX6A 1T9YA 1KOOA 2HZAA 2J9DA 1PILA 1XMQJ 4ED8A 2RQMA 5A8RA 1RHRB 1G1XA 3HJFA 1S6PB 1T0TV 1KLNA 3SZ2A 5DQHA 4B3TF 4DV1J 4MT1A 4ILMA 1QM9A 3CULA 2LXIA 2FHJD 1T3NA 3CD7A 4H4OA 2L48A 4DV3J 2Q1LA 3R6GB 1S12A 1L3TA 3FBEA 5KFWA 1YK9A 3H20A 1Q53A 1W2IA 2D3ZA 3GLJA 2YNFA 5BXIA 2XGPA 4F8RA 3AFGA 1LWFA 1YX2A 2VASA 5E2QA 3G96A 2CG8A 2FC9A 1KN6A 3LO3A 4RW9B 3MM8B 1WEZA 2YKAA 3QGHA 2L08A 3GYXB 2BMBA 4FBTA 3HT0A 1TKXA 4ER8A 4ZCLA 4Y28C 3MEEA 1L3SA 5F8IA 3DDNA 3EGNA 4I4BA 5K20B 4AUKA 3K5LA 2F9JA 3BO2A 4IH6A 2ZBIA 2LP4A 3C16A 3HSGA 3I87A 4HHUA 1ZPVA 1XK8A 4ILRA 3M2VA 5AXLA 5JMNA 2Y1IA 4FKYA 4KTQA 2VG7A 3KJFB 2UUTA 2NXUA 1UEKA 3EYZA 3KJVB 3M8PB 2HNYA 2R9LA 3GFXA 1S6OA 3CD0A 1NB2A 1UW4A 2A18A 1MMNA 3M30A 3M32A 1RTJB 1FKPA 4F4ZA 2EG1A 3O44A 1D8ZA 4X66J 1WORA 2XSJA 3BBBA 4ZLJA 4J9KA 3K7RA 3BQ2A 4Q5VA 2VKRA 3WC2A 3D3CJ 3TVYA 1M90T 1NU4A 2PEHA 2E5IA 3V6DB 4RU2A 1S9GA 4DPWA 1RACB 2I5JA 3TYTA 3UDLA 4K4YA 4QCLA 1B64A 4HEA9 1SJ3P 2N3OA 1MWYA 1VHIA 4IFVA 3MMJA 3FCWA 4JV2A 1X5SA 3C6TA 1TUVA 1FI4A 1QY7A 2GJ2A 2CNNB 3GB0A 3ZZTA 1VRUA 3IRXB 4JV1A 3HKWA 2ACMA 1IR0A 1FRMA 1TVRB 3MUTP 1T05A 3SEOA 3AB2B 4O3PA 1P6TA 5HVHA 5EWFA 2HRTA 3OJUA 3MM9B 4RU9A 4J9SA 4ZVSB 1AZSB 5B0GA 4Q0BA 3TA1A 3OD2A 1JLQA 3ILLA 1BY9A 3PYGA 1U45A 4ZHRA 2AHOB 3WIUA 4DR1J 3HM9A 1AUDA 4WFNQ 5GAEI 2ZOFA 2DT9A 4JB8B 4NEZA 2W9CA 4KGZB 1XC9A 2ZVIA 2HMIA 3W9HA 2GZOA 3X3UA 4HI1A 4ZPAA 1QAYA 1RAAB 5L1LA 4Y65A 2FLOA 1FRKA 1TKDA 2QMUB 2GO9A 4HR2A 3EXYA 4NLYA 4WFXA 5C7PA 2HVZA 5A0YA 1U2RA 3GIJA 3NGTA 2QZ8A 2K3IA 3VGTA 3MWBA 5KG3A 2EC0A 3BPSP 1WKJA 1SUQA 4OYXA 4NLXA 1WF1A 2ZD1A 4MIWA 4PG7A 5L38A 2JDJA 1DJ0A 1OQ6A 4DU8A 2CQGA 4DQPA 1I5OB 3ILJA 5F8LA 2UVVA 5C5JA 4NEYA 4C3LA 2WOMA 4FF2A 1F2GA 1UWAA 3NS6A 1HBMB 4K4XA 3NAHA 4ID5B 2BEFA 3LW5C 2DD8S 3IC1A 2ROEA 1S7HA 2W24A 4F04B 2CQ2A 3RAXA 5E3PA 3M8SA 2A6MA 3MMCB 1RCOB 1RT1A 3MZIA 1BQXA 1X4CA 2HS4A 2R8JA 3ET6A 1HARA 4DV5F 1X4BA 4DUYF 3J7Z5 3DM2B 4DL6A 4MH8A 1V3ZA 2HBZB 4X65J 4BHQA 1U1OA 1YBTA 1K73T 1KS2A 2OGUA 2MQNA 2NPFA 5T41A 4QPXA 4FPRA 4J91A 5F8JA 4JI4J 4DR7J 2E7VA 4CO2A 1Q5VA 1FKOB 2G2YA 2YKNB 3NNAA 1NK8A 4LJMA 1CC8A 1X9SA 3IBWA 2DGQA 4DV6J 1FNMA 4B9VA 5L9XA 1V3RA 1FWPA 4QJVA 4JOUA 1GH8A 3EVOA 1OPZA 3CJRA 3C6UB 4DV2J 1OS5A 1FX4A 2WK4A 1UP1A 1F2HA 3L3CA 1FTCA 2KT5A 2GV1A 1DBDA 1NKBA 1YJRA 5U47A 3QWPA 3N79A 1X4DA 2XS7A 1YIJS 3OL8A 2XGQA 2GNKA 1K9MT 5E33A 2DO4A 2QC3A 2FGOA 1RWOB 4OQJA 4KO0A 2A3JA 1DLOA 2AYGA 3L4BC 6AT1B 4DSKA 4ECTA 4OV1A 2RDDA 4UUXA 1CLFA 4MTPA 4B9NA 4KYZA 1RLCL 1LV5A 3PNIA 5A2QY 5KFRA 1SPBP 2QFJA 5KFTA 1RISA 4C4WA 4M5DB 1S49A 1N52B 2CPFA 2KZMA 2Y9HA 4PXEA 5FDLB 4HVZA 4M5HA 5D0HA 3QRQA 2YX7A 3I32A 1XEZA 5JVGQ 4DS4A 2JFDA 3OXFA 2KXHA 2J76E 2BJ9A 3IN5A 3NBPB 2PSZA 4ECQA 2FD2A 3CCRS 1RLDA 1RWMB 3VALA 4DFKA 3KFWX 2C3YA 4AL6A 2ASJA 3H98A 4G1IA 1XBWA 4JI7F 5IFMA 3HVTB 1YKWA 4U7UD 3IRWP 5KG1A 4B02A 2R7UA 1TL1B 1VK3A 3IS9B 2ATCB 2AU0A 2XG8A 2LVWA 4ED7A 1U1KA 4ZP9A 3KK1A 2EPIA 5K8OA 3D3BJ 3QGGA 2VG7B 1SL0A 2CQ0A 3UDVA 3TI0A 5J2PA 3ZO7A 3US5A 2N3LA 4DQSA 1VQLS 3B6BA 1UJ5A 2KRRA 1RAOA 2PFDA 3D6FB 1NHUA 4RW8A 3RR7A 1NKEA 4WE1A 3W7BA 3MTKA 1JWWA 5KFEA 4YB6A 2EC2A 1U2FA 4RNHA 2D9OA 2DNLA 4Q8EA 2Z30B 2HVHA 4DPXA 2MKJA 2CQHA 2AV5A 1IKYA 1KHWA 1MLAA 4Y2MA 3KDNA 2E1CA 2MZRA 5KAKA 2IVMA 4FF3A 4ZJOA 2FUG9 3J7YI 1U1NA 1UL3A 2HBYB 4F3OA 1F9FA 2COLA 3IAS9 1ZH5A 3W2WB 1T94A 4P2SA 4RL1A 4AYBD 4DR2J 1XR5A 3QLHB 4IFVB 2HHQA 2KFYA 1AYEA 4OZ5A 3TAMB 4GC7A 3GR1A 1F6TA 5F8MA 1JNRB 2V68A 3OT9A 4N76A 4EBDA 1ZZNA 1VRUB 5T7LA 3DLKA 2CJQA 1FDAA 1RJJA 5CYJA 2ZJRQ 3U27A 4WK1A 2KH9A 1F3VA 1ACMB 3M9NB 3BKFA 2H3EB 1R0AB 4C8LA 4Q0BB 1C0TB 1JLQB 5KFGA 1CSJA 4HT5A 2HZVA 3JSBA 2BZ2A 3MEGB 4FXDA 3R97A 2W1BA 3BKUA 3FSYA 5LMUF 1UW9A 2NZ4A 3T41A 1R8PA 3D0IE 1HBUA 3AA9A 2A6OA 1T9TA 4BLGA 3VVTA 1S59A 1XN9A 2B56A 5LXYA 1SXLA 3ZXWA 4OX8A 1TV6A 5CCMA 4EFAC 3LOUA 1NDLA 4JI1F 3D4JA 2IBOA 2D74B 2XY5A 1IXKA 1FWKA 5I3UB 3KLHB 2EW9A 5K8PA 4C8ZA 1WACA 4KGVB 4MAKA 2OSRA 2VFVA 1Q82T 4G1PA 3KUEA 3N0VA 3J81j 3FJ2A 5CYMB 1U49A 3GWCA 2UVUA 3OL7A 4HDHA 1HNXJ 2GVDB 2CZ4A 1PAEX 1OMSA 2HG4A 3MUVP 5DM6Q 1SH3A 1TKZA 2X51A 2OTJS 3MMBA 3E51A 1HNWF 1NSPA 2XZTB 1AUSL 1GTEA 5DDPC 2AEFA 4ZVUB 2R7SA 3D6TB 1HYSB 2CQ3A 2W9BA 4IDKB 2MMYA 1HD1A 3C8YA 2BW2A 3PCOB 3DRYA 5D0RA 4FYXB 3BYPA 2EWHA 4CM2A 2AT1B 1FJGF 3SXLA 4ZVGA 4UOHA 2OPPA 4AXIA 2ILZA 4V19X 3H5UA 2HURA 4PWDB 1WC0A 2FVRA 1P1LA 3SSSA 3KHRA 3TEHB 2HLUA 3DGVA 3OXGA 3DXBA 4FKXA 4N8OA 2L3MA 2OO4A 4LSLA 1KVJA 4DX5A 2RMLA 2W4PA 2YWHA 3UW1A 3NY0A 4DL0C 2H5JB 3Q0AA 3IGVA 1EQ0A 5E0OA 5DG8A 4MKYA 4TYAA 2HFUA 2ZC4A 4TQRA 3M05A 1R89A 1JLAA 2M70A 3C3LA 2PIIA 3GG0A 3KDOA 3CJQA 4L72B 1REVB 4NXMF 5KFBA 1UPMB 3GU0A 1WHXA 1URRA 4JI5F 4O4RA 3F44A 4O0NA 1N6QA 2VFUA 1EKSA 2LQJA 1FNXH 5C42A 1XJWB 3NGSA 2XLKA 4LF5J 2LMIA 1FK9A 5KFOA 1RT3B 5KG6A 4WBFA 4F2SA 2GCFA 2HIQA 3MCOA 3E2EA 4ZCIA 3I55S 3Q22A 4WFAQ 4ED4A 2YXLA 1S1VA 2E1RA 2W25A 3CJ2A 4TY8A 5FLXY 5GMKa 4F3QA 1S0MA 4YB7A 1Q8IA 5D4OA 3G9CA 1U8SA 3UD4P 4JUZA 3I9ZA 1D9FA 2Z2YB 1HNZF 4O3SA 4OYOA 2YTCA 1HQEA 3DLEA 3GR0A 2CAJA 4O44A 5KG4A 3AB4B 1IR1A 2M8HA 4RW7A 2DY9A 2DJWA 5L8RC 2C3UA 3D66A 1SL2A 2ADBA 4QZVB 4TKTA 3MM7A 1S76D 4KKOB 1E6YA 2QA1A 4X4UA 5M2UA 2B5JA 4K4SA 1BD6A 3W63A 1J2VA 1REGX 2RF2B 3P4UB 2RUGA 3WDOA 1T9UA 3W1YC 1EKRA 2DNNA 1PO6A 1M0SA 4ENOA 3MGJA 4PWWA 4ERDA 5J1EB 3TR5A 2ZEJA 1KFDA 2EFQA 2MZJA 2IM2A 3L7OA 3UNYA 3TX0A 3WQPA 2DXFA 4CLPA 3T5LA 3CSKA 8RUCA 4IH5A 1U24A 4RLEA 4DOZA 5D4PA 4OI4A 2B8QA 2XYGB 3D0GE 4PXCA 4CNYA 3ISND 3POTB 4O0IA 2XLIA 1DQ9A 3G2XA 2QTWA 2F3JA 3N01A 2PD1A 2IHR1 4X62F 1RWNB 3VAKA 4WPAA 2ZJQQ 3M1VA 3DOKA 3MR6A 4C98A 4MIAA 1HQ2A 2V8HA 5B0DA 3M9MB 1IQTA 3ONQA 2PMHA 3ZTSA 3TZWA 3E01A 4RJVA 2ALZA 1YJUA 2LEAA 2PGCA 2XZWA 2AW0A 3SCLE 2NXEA 5C25B 1QE1B 1S57A 1Z2LA 4GVBB 3KLVA 1JK9B 4FZVA 1MSWD 1KR4A 1VJWA 3BGRB 4YR3A 1NK5A 1NSAA 1SQFA 2RQCA 3FZ2A 3RB6A 1BMQB 2LXFA 4NASA 2MLZA 4KGMA 4EBCA 1FA0A 2DRDA 3D28A 4NE9C 5F0UA 4DFJA 1SKWA 3PO4A 4B3TJ 1FRLA 3PYFA 2HWHA 2GIFA 2DNGA 4U95A 3K5NA 3UR3C 1K44A 4C48A 4A8OA 1QAXA 3AD9C 2OI2A 3H2VE 2VQEF 2CDQA 4BDPA 2QEXS 1WDTA 4OZ0A 3IAM9 4K8RA 4AD6A 2W7AA 2PC6A 2BJ3A 1S79A 3FUYA 1UVIA 3NLCA 4OHZA 2ZNYA 2W2MP 1VC5A 2CADA 4K7QA 2H9ZA 3T5JA 1GMUA 1J27A 5KFAA 5MAOA 3UCGA 2JC0A 1QUPA 4ES1A 2KZZA 1U1RA 1T9XA 1BQMA 5IWAJ 5KFYA 1HFEL 4OX7A 1S99A 2DRAA 2VOOA 4DS5A 4F36A 1H98A 3CVKA 1KD1T 2I2YA 2DHGA 3CMQA 4MFBB 2XY6A 4IRKA 4TU8A 4G6VB 4CYUA 2NREA 2B4PA 3PJXA 4A8WA 4ZVQB 2ILYA 4G3IA 3RW7A 1VC6A 4RBVA 2MPUA 2VHGA 1M5OC 4PKDB 2QSFA 2VG6A 1SKUB 5KFXA 3BBCA 3FCVA 3MM5B 4ZOSA 3RRKA 2BYCA 2IFXA 4KQZA 1D9DA 4IFYB 5EDWA 2OMLA 3D1HA 2M5YA 3TW0A 2V8DA 3PZPA 1N5TA 2POKA 1RA6A 2Y1RI 4ELTA 2MLXA 5GADI 4M5KA 1WI8A 4DXLA 3Q2TC 2HWIA 1N33F 1JLEB 3S01A 1BGXT 2RRBA 3MM6A 2ZUAA 3NCQA 4PPZA 2JLGA 1WELA 4M8LA 3BBFA 3CEDA 4B3OB 2MDAA 4H4KA 4QU6A 4LFCF 4LF9J 4LSNB 2J0QD 1GMWA 2OPSA 4YHHF 4M5IA 2X1BA 5HMYA 2ZNZA 4ANDA 2F8MA 1WTBA 2HNDA 4A8QA 1IBKF 1WF2A 3L09A 3PJ9A 2ZH5A 2ZDOA 2VPXB 3CJKA 1T02A 4MK8A 4A8SA 5EX0A 1SBRA 5L46A 2HWTA 2RVJA 4PAAA 2Z57B 1X4HA 1N6QB 4C3MA 3MMAA 4I56A 1KTQA 1JJ4A 1KOHA 4A46A 4WKYA 2X1FA 3MAHA 2B6AB 1DFDA 1B0TA 1GX5A 3TQ1A 1S0OA 2KFZA 4BWJA 1VBXA 1UMJA 3KLFA 1NK7A 4ZLLA 2Q6CA 3Q2SC 2XLJA 4NA1A 2LEPA 3ZZZA 2MZ1A 2CPXA 1Z1ZA 5DJBA 3ETMA 1KKHA 3KHHA 3DC2A 3KLGB 5ETVA 1D3WA 3NG8A 2Z2ZA 2HEKA 3KMQA 4GVLA 5KT4A 4Y2AA 3GV8B 4DV3F 3GP9A 5G4DA 3AA8A 2XI3A 2BVZA 3RBEA 4K5RA 3HZGA 2AKWB 3OVAA 3W60A 2V8VA 2IM1A 2B5JB 4YB1P 1F60B 2H65B 1FX2A 2CRLA 1N48A 2V2KA 3DRRB 2HQGA 2W2OP 4QW8A 4GC6A 1NHKL 4FPIA 1XQIA 3B78A 1EJ7L 2CIMA 4UQTA 2HLTA 4OHXA 1YJ7A 3RTVA 2MLYA 3IA0A 4DV5J 4ZVFA 3J7AN 3VZIA 3MR2A 3BN7A 1X4GA 3AD7C 4S0MA 4UY85 5ETNA 4BC9A 4HHHA 1DHMA 2OFGX 2Z8QA 1QSLA 1KFSA 1NJZA 4K0KF 5HAOA 3HFVA 2RDJA 4LVOP 5IT9U 2VBWA 3B4DA 3LP0A 4HDGA 4DEZA 3A8IA 3DDKA 5C24B 2LQBA 2DGOA 4ZP6A 2OELA 2XO7A 2V34A 3ADAC 1UWBA 2DR9A 1S5ZA 4CQ1A 2DCLA 3IG1A 4DMZA 1CPZA 1SIWB 1VRTB 4DV4F 3R9LA 2CJAA 5DQGA 3F0NA 1JLBA 2AMCB 2XMMA 3KK2A 5KFPA 2R3VA 5KFHA 1SKRA 1CS4A 1JLGB 3G82B 3FGVA 1LKZA 3KHGA 2D69A 4R8UA 3KOAA 3M8QB 4X66F 1TELA 4X4RA 5DS7A 4HTJA 2HQFA 4R5PA 4U67Q 4RWXA 3RB0A 4IRCA 1NAQA 3NWGA 2AYBA 4M5NA 3OW2R 1OSCA 4KGKA 1UVLA 3DLGA 1TKTB 5LXRA 2F8HA 1RWXB 3NCPA 5HMWA 4P74A 3VAGA 1LW0A 2C2EA 2FJXA 2VJVA 3QFWA 3ZZRA 4R0JA 4EYIB 4C2MA 4CWBA 1M5VC 1UTAA 3MAAB 2Z0GA 4U96A 3DLLQ 2HVIA 3MI7X 2HAFA 2QT7A 9RUBA 1RCXB 1LK7A 2JX2A 4L3NA 3T6JA 3ZNUA 5F3ZA 3MF5A 4K5SA 4EU0A 3QIDA 1RA7A 2LCWA 1EETB 2YPYA 3DRPA 4P2MA 5KFIA 4KE5A 1B7FA 3H59A 2Y8YA 1H2TZ 1GQEA 1BLUA 5CYQB 2JSXA 1EP4A 4FYDA 4JI7J 3SV4A 3RU0A 1V5VA 4I67A 3QGPA 4WJBA 2MHNA 3A1YG 3SV3A 2NPIA 1T9VA 1N5VA 3DKDA 2V67A 3LGMA 3ENWA 3V4IA 1BQNA 3AODA 3BDPA 1M5SA 2VPYB 4U9RA 1Q8KA 2DK2A 2IDLA 1HQUA 1G6BA 2J7WA 4DFPA 2GMLA 4CLLA 4I2PB 1I51B 2UXDJ 3QRRA 5LSRA 3OUYB 4F4XA 4C3KA 1HPZA 3MECA 4J9PA 2BM1A 1VLYA 4CNZA 2IRXA 2HQCA 5LT5A 4FBUA 3NKYA 4TU9A 4FS1A 2YPZA 4WYWA 5KOXA 4UF4A 3DLBA 5HI7A 4R0EA 4J9MA 1GMWD 5HBMA 1U09A 3VHQA 2CYYA 1TAUA 4KV8A 4PG8A 1VQKS 1GEHA 1PJ6A 3Q8QB 3B82A 4ETZA 3KYLA 4WCEQ 2E9ZA 3HSZA 5IC6B 4WIQA 1SVDA 3GIKA 3I4PA 4P2XA 4C0HA 1RAFB 2ZKUA 2MHEA 3A13A 4IR1A 1VQYA 4AT1B 1VGYA 2EG2A 1HMVA 3NAIA 2G0IA 1WKLA 1UEUA 1IM4A 1CULA 3QGIA 2NYIA 1C1BA 1DTTA 2CZVC 1D8YA 2QLXA 3W5ZA 5AXNA 4CDIA 2UVRA 1YJWS 3CJKB 1E6VA 2CJKA 1KDNA 2YH1A 3DOMA 5H9EJ 4Q8FA 2CQDA 1ZAVA 1S1TA 2DNPA 1HR0F 2RQKA 3TA2A 2KVQE 5LMUJ 3DMJB 1LWEA 1FERA 3NWRA 1WG4A 2U1AA 1RQ0A 1CG2A 3J81U 2D41A 1S6UA 2JL9A 2GIRA 2YWGA 2B9EA 4QYZJ 1GT8A 3GONA 2E7XA 2RHQB 1NSKL 2Q43A 2WVEA 3RJMB 4JI1J 4QIWD 3FFIA 2BX6A 4M1KA 1TTHB 2BV3A 3C66A 2MQMA 1VQOS 3HD2A 4NRUA 3EX7B 3IGNA 1OY6A 2H5IB 5DGBA 3DI6A 4CZCA 1ZA1B 3UVJA 4QR1A 1U4BA 1T3OA 2BM0A 1MU2A 4KFBB 3QO9A 2AJ4A 3Q23A 2AD9A 1RU1A 2UUCF 3CXCR 3CCTA 3VQTA 1RBOB 3LAMA 4NLPA 1BUXA 2V9KA 1O5JA 1HW8A 2GQQA 3JS9A 2MQOA 1RWUA 4P6QA 2W4CA 4B3RJ 1VBKA 4V19J 4IUFA 3HJVA 4FXWA 4F3MA 5C2CA 5BR8J 3DOLB 2DISA 2VD3A 1UZDA 4OYAA 4ES2A 3RYLA 3QPIA 1FJGJ 1RT4A 4I64A 2A2CA 4F2RA 3BQ1A 2PI5A 4EGLA 1XIQA 4U7UK 2NXNA 3TEGA 3AD8C 1KQGB 1RAHB 1OSDA 3RBXA 4ZPWR 4DLEA 2FJEB 4YB5A 3M6VA 4KGXB 3JSMA 4ZA1A 1SJQA 2DHHA 4DX6A 2JZ5A 3MCMA 4CT9A 2W8LA 1N5YB 4URGA 4EI2A 2GX8A 1RT7A 1R8BA 3CIMA 3Q8VA 4OLOA 3K5OA 4A8FA 1Z4UA 4USHA 2YWEA 1WDDA 3Q8SB 1LOUA 3GJQB 2DPIA 3UCZP 2YNIA 2JEGA 2Z2MA 4NXNJ 3HVAA 1RU2A 2K1RA 5E3AA 2IVYA 4DX7A 1CS4B 3F56A 1J5OB 4NXMJ 1FE0A 3JSRA 3QFHA 4JI5J 2F65A 2YNHA 4CH0S 2CPJA 5K8MA 1ZZFA 3T9ZA 3RBDA 1FTRA 1WHYA 2J9EA 3MEDA 3MFHA 3UD3P 3DLJA 3I0RB 1TFWA 1IKVA 2XYPB 5HLFB 1RTDB 2GAGC 1H0HB 4DL4A 5IC4B 2B0GA 4HH1A 5ETRA 1TU0B 4RUBA 4JI0F 4ICLB 1TL7B 5K14B 1NUEA 5E3QA 1BC6A 1RHMB 4EZ9A 1GFWB 2R7RA 4Y2KA 1X4FA 4YEAA 3HPOA 2VUGA 2FJWA 2Y0BB 3NCRA 5K5MA 3C14A 1SJ1A 4CH1A 3I4HX 4ED0A 3GG1A 2YKMB 1QLNA 1N8RT 2K8GA 3B4MA 4OZ3A 5CD4H 3FK4A 1YVFA 1LWCA 1PYSB 1CJTB 4OYBA 1A0OB 2MGZA 4LF8J 2ZH8A 1HWKA 2JEIA 3HVRA 6FD1A 1WSRA 3PYEA 4FVMA 1VQNS 3B8HA 1QAIA 3Q86A 2ZH6A 4DCJB 3NGDA 3N28A 4X2BA 4K50A 4PRFA 2G0JA 2IY5B 4LBIA 5ETKA 1NNDA 3CCJS 2HRYA 5GAHU 3WBZA 4KRWA 1NJYA 5D78A 3QT6A 4LFBF 2IC3B 1G2EA 1C4CA 2FZKB 4GMKA 3PEJA 4DPOA 4FYVB 2R2UA 3PJWA 4I7FA 1WOPA 1RTHA 1WHWA 3PIOQ 1H6KX 1HPZB 4LRAA 5THWA 4RNNA 1TQLA 2OPRB 1HNXF 4DCOB 2MY8A 2G9OA 2CJYB 2YNGA 1SQEA 5EN1A 4H4MA 3MR5A 4QWCA 3RB3A 1RTIA 2IM3A 3EPIA 3R7NB 4NLWA 3FCHA 1CJKA 2B7BB 1RT5B 2C2RA 1DQ8A 1RP5A 4P9SA 1HI8A 1JLFB 4ZCMA 1TK8A 4NLVA 3LP1A 1FCAA 1IM6A 3SYZA 1RAEB 1JJ2R 3PYDA 2VFSA 1NLKL 2HZCA 2X7IA 4DSLA 2D3O1 4F4WA 2IRYA 1N0UA 4ANEA 4DV7F 3CCSS 2G1DA 3CO9A 3TAPA 4UZBA 3UN2A 2UUWA 3J80Y 3IWNC 2HVDA 1NPKA 3I0SA 1Z2ZA 4CLTA 1R43A 3AOAA 2QLJB 2BXJA 4C11B 4OI6A 2B9YA 3ZZOA 3T1AA 1HNIB 4PQUA 1RT2A 2BJ7A 2I1RA 3M2RA 2AGOA 4DL3A 4OYWA 2UP1A 3QJJA 2JLFA 4USUA 2VQEJ 3DU6A 1S1TB 2NYHA 5M2RA 2GS8A 5ETTA 5B0EA 3VWSA 2KN4A 3MPWA 2YX4A 1NH8A 2BOAA 1H2VZ 1X60A 3M8WA 3MOZA 4ECUA 2YH0A 3I56S 1Y0HA 4CO0A 2B7CB 2PI4A 3FSIA 2YKQA 2Z2LA 3RG6A 4C8OA 3RBZA 1RADB 2V94A 1DTQA 4OZJA 3U1LA 4WIIA 4Q7AA 2IA0A 2OKQA 2H48B 4TU7A 3AT1B 3W9JA 4X84A 1DAXA 4WU3A 4F4AA 1Q5YA 4J9RA 4LF5F 1NCLA 2VG5A 2GVZB 4QIFA 2ALYB 4NCGA 3G86A 3KJQB 1EZZB 1ZYQA 3QO9B 4KHRA 3ZTRA 4MMOA 4NLDA 1U6BA 1ZBTA 1S4FA 4QR0A 1KTVA 4M5LA 5ETLA 1FVSA 2GQ2A 1AFJA 4LBPA 4EUVA 3JYTB 1UVNA 1DARA 1MWZA 2JJ4D 2N4CA 3JXOA 3SMZA 2ZM6J 1QVGR 5I42A 2QLBB 2R8HA 2VL1A 5KFKA 2PT0A 3ILIA 2DGXA 2RB7A 3DYAA 4TVAB 2KKHA 2PO4A 1UVKA 5KG0A 2OSQA 5EWGA 4ECRA 5H9EK 3DGPA 5ADZA 3DDIA 3SDEA 1UJ4A 2O5DA 4OHYA 3KLEB 3CDUA 1YLXA 3IWLA 5B08A 4ITSA 1I6JA 2MKKA 2E44A 2AJFE 4DU7A 4JI8F 1IBLJ 1N33J 3IO1A 4DG1B 2YKPA 4QYZK 2HHUA 5HQ8A 4P52A 4MKBA 3EMTA 2LU2A 1YBUA 1IJFB 1S6QB 5EX3A 3AJ2A 4OMFG 4LFCJ 5AE2A 4WZQA 5ETOA 5IXUA 2W2PP 3OXLA 1GAOA 1FEEA 4YHHJ 3ITHA 4B17A 3H42A 1XERA 2BE7D 3GIRA 3PHTA 5GMDA 2FLPA 3LP2B 1KHVA 2AGQA 1IBKJ 3PKMA 3I96A 4DR3J 2LECA 3PY8A 1A9NB 4MYTA 3DHWC 1C0UB 1WC4A 5A8KB 3KNGA 2YNHB 5HROB 3MEDB 2XI2A 4RW6B 2RKIB 3PW5A 2BRLA 4NLTA 3PX4A 1YJVA 2P6SA 4DL5A 1VIXA 3CGIA 2E1MC 3AXMA 3IXQA 3KLIA 3KUGA 1OWXA 3OBIA 3HCXA 4KAIA 2J5AA 1BXNA 4DR5J 2XM3A 1DY3A 3TUIC 1KSPA 3JAMY 5HL7Q 2C2ZB 5CZXA 3C14B 3R6LB 2GGPA 2O01C 4ZVEA 3HSJA 1VBYA 3LPYA 2HK2A 3QIPA 4O3QA 5C2GA 3R5JB 8ATCB 3L7UA 2QL7B 5G0RA 2M9KA 3BO3A 2PMZD 1RUSA 2OAUA 2R7VA 1JKHB 1N32J 2BANA 2CXEA 3V6HA 5LSLA 3K0JA 2G2ZA 4IG3B 4DHVA 2MQPA 3CC7S 2XULA 1P27B 2EKYA 1OPIA 3OL9A 3HHNB 3K5PA 3OR2A 3BKTA 3R7BB 3OLAA 5HQMA 2DKOB 1CJVA 3FEYB 3QAEA 4NLGA 1KVKA 1R6YA 1A7GE 4K0KJ 2OP5A 1PCAA 3GCXP 5IWAF 2WONA 1FFSB 1U0HA 3OPKA 4N56A 3FNNA 1T03A 4OZ1A 1JIHA 2IRUA 2V4JB 4ZVRB 5FJ4A 3MDFA 2EK6A 2F7VA 4F4YA 5D8HB 2AX0A 2BE2B 2HRUA 4DV4J 1Q95G 2GFFA 1UVJA 3SFUA 4CTAA 1ZA2B 2KTQA 3CJ4A 2FY8A 4RW4A 3AOBA 4XIUA 1KNZA 2XNRA 5J2QB 2R2TA 2MSSA 2WB1D 3K59A 2OLWA 4ZK7M 2DR5A 5HP1A 1S0VA 4QIEA 4IO9Q 2CJBA 2YQ1A 1S1XB 3C15A 1UFKA 4G1QA 5K9FA 3FC9A 2CVIA 4ZMMA 4NPOA 1IKWA 2HS3A 3ICLA 2K7JA 1HNVB 4OI3A 4B3SF 3LGHA 3WC0A 4RUHA 1MNEA 2XHWA 4C8YA 2ZZMA 3KHLA 5D3GA 1B70B 4LF9F 3CDEA 5L1IA 1RT6B 4RO0A 1VQ7S 4QWDA 2EFNA 2P6TA 2DR8A 3CCLS 3CCUS 3I82A 4HL9A 3EZUA 1BWVA 2JRSA 4ED1A 2IYIA 4DF8A 3H5XA 4X4VA 2RE1A 1VCTA 3ZZ0A 2NUHA 3PDNA 1WC5A 1P8GA 3KK3A 3GYGA 1CJUA 2MZSA 4LUBA 1S1UB 1RHQB 1FXRA 1H7WA 4A48A 2HFZA 1FO1A 5RUBA 1R31A 3ISNC 4TN2A 1ZTTA 3ZTQA 4K4ZA 3OVSA 2BJ1A 4BS2A 2IPOB 3R5BA 1HKAA 4KIAA 2VA3A 3S7RA 3SCKE 2OTLS 2DH9A 4LIRA 1KBRA 7FDRA 2BDPA 4I0WA 5HANA 3V81A 1IKXB 1X5TA 5KFDA 4U7CA 1SV5A 3OTCA 1U0SA 2HHTA 2IAJA 4YY3J 3ENQA 2XMVA 2CQ4A 4LR9A 1Q7YT 2V2VA 3RAMA 2B51A 2ZE2B 3G87A 1IJEB 2RQ4A 4J7CA 2P9CA 4RNOA 2MY7A 4YQWA 1ZM2A 1DQAA 4IH7A 5A2QU 3RRHA 4ZPCA 1NZAA 2DYAA 2KJVA 4OV6A 2DIUA 3QATA 1IR2A 4DV0J 2FY1A 4F4KA 3BSNA 4IG0A 4CRJA 1S1WB 3GFHA 2RHSB 4Y3CA 4N8NA 5J2MB 3TZYA 3DU5A 2EBGA 2VPWB 4CIOA 3W62A 3OSPA 4N7TA 2BE9B 2XS5A 1VS3A 1J5EJ 4B9SA 4LF7F 1TL3A 4OZ2A 3QBCA 4N5SA 4LRFA 2FVQA 2ZZTA 4LFAF 3G8QA 1NB7A 1S9EA 4J9NA 4Z7CA 4PABA 1QJHA 4D3GA 1Y10A 1Y9OA 3BZQA 2AQ4A 4A8XA 3OHBA 5L1KA 3QYYA 3FEXB 2JVOA 4TQSA 2YWKA 5KFSA 3DRSA 5H9FJ 2HNZB 2NR0A 1APSA 2VKZG 1KLMB 2UUBJ 1HR0J 3TWZA 1PG5B 1KWMA 2D7SA 2AYMA 4QPTA 2DXEA 1H38A 3M8YA 3KG0A 3N6LA 2Z58B 2AJQA 4L6V3 2CQBA 4F0MA 1VDHA 5BYSA 4X64J 2M8DB 1EX8A 4UZCA 3H7HB 1VQSA 1N34J 3DXSX 1Y5IB 1JMTA 3CJTA 1DURA 2XMUA 5A8RB 2ZH7A 4IOBA 2NZCA 1IBMJ 2NLWA 3NMRA 4DX8H 3W9IA 3DNCA 3J81Y 3LAKA 4AQYF 1YHQS 3SQGA 2DGTA 2L9DA 3TJ8A 3OR1A 1S9FA 2H4WB 5FIIA 4H4OB 4EO6A 2C2KB 4DSFA 5HMZA 3VR1A 2XMWA 2DGUA 2UUCJ 2FB0A 3IM8A 1N0VC 3MPUB 2IMWP 4X4SA 3W8PA 3PW7A 1QVFR 1MROA 1L5UA 1CQNA 2YNFB 3H5SA 1LWFB 4OLPA 2CQCA 3ZNJ1 1RKIA 3HX9A 3W5YA 2NQPA 4HHJA 4CLYA 4PUOA 3Q24A 4ED5A 3ENVA 3NNHA 3PXGa 5HN0A 4N41A 1UA1A 2AZ1A 3P96A 2WVCA 1TKXB 3MEEB 4L74A 4ALZA 1CJVB 4MKAA 2RRAA 2ZBPA 1S6PA 3ZFVA 3CF5Q 3ZZUA 2HAIA 3UO0A 4F7VA 1B3TA 2FYXA 3H90A 3ISZA 4ETXA 3C16B 3M2UA 2BACA 1QTMA 2MQQA 2MTLA 2ADCA 3OTBA 3PRVA 1DZ5A 2E5GA 3K8WA 3M2VB 2ZOMA 1XNRF 3D5MA 4OJ3A 2HNYB 4DJBA 2OFHX 3CDBA 4EBEA 2FHKA 2UXDF 3M30B 1RB0A 3M32B 1FKPB 4A8YA 4RW9A 1JXLA 3MM8A 1HA1A 4ECVA 1RKJA 4OX9J 4E0DA 2GA7A 1XTZA 3R7SB 3HF5A 3CO0P 2XSJB 3NRBA 4P73A 2KG1A 2NXJA 4AE5A 1LW2A 2HIYA 2E5HA 2ZBCA 2G4BA 2E7WA 1UFWA 3SCIE 1KONA 3W66A 3ELHA 3OHAA 4LF6F 2EFOA 2L9WA 2DY1A 1S9GB 2OD4A 2QE5A 2I5JB 1Y7PA 1D0EA 2R7TA 2DNOA 5IV3A 4JI0J 2J7UA 1SI9A 5HJYA 5B7WA 2WVFA 4ZPVR 2GHVC 5DRKA 5KFMA 3C6TB 3KJVA 2QA4G 2KYXA 5E7OB 1M1HA 2Z4PA 4IRDA 3OJSA 2KT2A 2KJWA 3FBCA 2E5JA 3DCAA 1T05B 1X9WA 5GAGU 9ATCB 3NGUA 4LF2A 3AOCA 4I68A 1CC7A 3H2LA 1W7WA 4ZHRB 4CO5A 2P5VA 2JVRA 4L3KA 4HACA 2IMOA 2GAHC 4DZ6A 2W9CB 1CJUB 2PMWA 2ZHBA 1YRXA 2HMIB 1LWXA 3V6DA 3IBFB 2JFKA 3R5AA 2Y8WA 1JX4A 4JBCA 1N5QA 1TUGB 3FVYA 5CA5A 4QYRA 4XAKA 4B3MJ 3WZ0A 2VBZA 4KC5A 3Q8YA 2ZH2A 1HI0P 1Y4ZB 4LFBJ 5A0YB 3PR5B 2UXBJ 1NHVA 4J9UE 3IRXA 3SQOP 1NKCA 1TVRA 1SUQB 4NCAA 2ZD1B 3MM9A 2C28A 3TX8A 1M5PC 1IWAA 1AZSA 3FEZA 2WB4A 3KJNB 5KT5A 4C8MA 3PEHA 2WOMB 2BJ8A 4NCBA 3BDEA 1RABB 4Q2MA 3BS9A 4B3RF 1TP7A 4NMLA 2KHCA 1WG1A 2Q6BA 3A3OB 1TK0A 4RX6A 4JV5J 2QMXA 5BR8F 2Y0SD 5FD1A 2J0SD 4DSIA 3HSDA 2SXLA 1RT1B 3JTPA 1Q8LA 1SJ4P 3ET6B 2EKNA 4WZMA 1NK4A 4Y0FA 3GV5B 1YG0A 1U7LA 3W2VA 3PX0A 2AGPA 3JB9k 1WC6A 3VQSA 1HHTP 4DV7J 3ENAA 1QSYA 2FZCB 4UTGA 1NM2A 1RYSA 3WX4A 4J90A 1P1TA 5AXMA 5B0BA 1QDUB 2K3KA 3CC4S 4ZP8A 3DFEA 1NJXA 5DDQC 4ZPBA 2RILA 5ETMA 1HLWA 1JLCA 2XB2D 2LQ8A 4K2XA 1IWGA 2DGWA 1RHUB 1HBMA 4ZN1A 1K47A 4ID5A 4USJC 1VQ4S 2HVEA 4NZ7A 3LQVA 2FJBB 2QLFB 2OPQA 4GO5X 3V6JA 5DGAA 5F3TA 4NXNF 2IJRA 2VF3A 2QA4S 2HFVA 2BUNA 3T6BA 1FJCA 3MMCA 3IR6B 2BKPA 5D4NA 2B8PA 3DM2A 1FFWB 4KO0B 3NXZA 2AZ3A 2RIJA 2W7PA 1FHTA 2DR6A 5JJBA 1RXOB 5LL6d 1DLOB 1X7VA 3CJ8A 2V63A 1Y5NB 2KXFA 4ECSA 1FKOA 1D9AA 2PN6A 2YKNA 3D0HE 3PKYA 3E8OA 3MPYA 1QTNB 5HATA 1N5SA 1SL1A 2B43A 4CLKA 3NS5A 4V1Ak 1WWHA 4ZJLA 1LEOA 3THTA 4C7QA 1K1SA 2EK1A 4P7VA 2XWYA 1M1KT 1TFYA 3HHLC 2VODA 3I5BA 5A8WA 1VQ9S 4Z2XA 2B3TB 1MROB 1FDBA 3MR3A 4IQMA 5L39A 3U7JA 1MMDA 3C6UA 5KFFA 1S48A 5K8NA 4I6YA 3TUZC 4BBYA 1CBKA 4H4KC 2GHPA 2KYZA 1PGZA 3PRBA 1NDCA 2W7OA 5F41A 2AJ1A 2GMHA 2LA6A 3I5CA 2V8PA 3M6XA 2IBKA 1TAQA 4Z37A 2GC8A 1S0NA 2E5LF 5H9FK 2J6SA 1HBOA 2V4QA 4M95A 5AE1A 3GQCA 2UVWA 4ES3A 1VC0A 4LF8F 1NDKA 2BA9A 3NOGA 2DHSA 2CDRB 4B08A 3H40A 3M2UB 1K0VA 2DNQA 3R5CA 1U1PA 4JI8J 2KHDA 4ZVPB 4Q43A 4B9LA 1IQZA 3VZHA 3UI3A 2EFPA 4MJKA 3N6MA 3KK1B 4Z7YA 3C46A 4URSA 2DO0A 5J2PB 4M5DA 3OLBA 1R6VA 3VAMA 1JB0C 3QWUA 3EVWA 4XPCA 1R3NA 4EEYA 5FDLA 1I3OB 5HVFA 3TZXA 2BKOA 4BCAA 4RW8B 3SI8A 1OIAA 2FHMA 5M2PA 4WE1B 4LREA 4ZCKA 2QV6A 5BYQA 2VQFF 1PJ5A 3NBPA 3VV2B 1ICEB 1Q0NA 1RBAA 2FJDB 5EUHA 1IKYB 2XBPA 1LW2B 3HVTA 3GJRB 1K1QA 1U1LA 2XEXA 1WOOA 2BOPA 1TL1A 3IS9A 2C2NA 3HMJG 4OYMA 2G1HA 2I6WA 3N6NA 3LA0A 1SC3B 2WAQD 4F25A 3M6WA 5KOWA 2J6TA 3HHDA 4ZPTR 3B54A 2RU3A 1FEHA 1QUVA 3MD1A 2ZZNA 1P9QC 3H2UB 3EXCX 1UVMA 5IQQA 4DUTA 5T7LB 3DLKB 5HO4A 2BABA 1T7PA 1G7CB 3AY0A 1MG7A 3K57A 4DN0A 4IKAA 3BGFA 2RDIA 4LT6A 3X1LB 3RW6A 2GIQA 3P5BP 1Y3KA 4ZP7A 1T11A 4HT7A 3VAFA 2U2FA 2AJ2A 4HACB 1EQMA 5GAEU 1VJQA 2VOPA 4E98A 1HBUB 1V5IB 1VQ5S 3CD5A 4KH0B 3NGRA 1F5BA 4H54A 3R1HA 3W2WA 2AEMA 4DR6F 1TV6B 2FJAB 3QLHA 2QL9B 4CI0B 2C2MB 4J5OA 3FBBA 3TAMA 4CLWA 5D77A 1H73A 2Q66A 1O51A 1HL6A 3CJ5A 2ZITA 5J1NA 3GFYA 2RUSA 2XMKA 4I2QA 4YR2A 2ZC3A 2RSQA 3FQKA 2HFSA 4OIXA 1I1GA 4YS2A 3HXMA 4XTTA 1S97A 3KWMA 7AT1B 2C1EB 1R0AA 4Y34A 4OHWA 3TUJC 1C0TA 3HI9A 2RU9A 3AH6A 2O67A 1TKZB 4I69A 3MMBB 3MEGA 4C8NA 4UOCA 3F41A 2HGLA 3THVA 3PM9A 1YTYA 4J9QA 2ZM6F 5CABA 2OEKA 2W9BB 1NEEA 2ZBQA 4NZ6A 2MKSA 1ZPWX 2LQ5A 1VLOA 4IO1A 1T8EA 1YZ7A 3EWGA 2QYCA 1NK6A 3Q8UA 2WHOA 1UCNA 1LK5A 2OPPB 3W2VB 1R0BG 1WOSA 4K4WA 4NYOA 5I3UA 3GJSB 3KLHA 2QMWA 4LF4F 3VTIA 3EPGA 2LLZA 4HH0A 1IBLF 2VFTA 1RAIB 2IJFA 2C2DA 3HHLA 4LSLB 5CYMA 5HSPA 4B3SJ 3VGSA 4ELUA 3HLUA 2GVDA 1JLCB 2FLNA 4JI2F 3IFEA 4NZ0A 1P9YA 2FHOB 1YDLA 1RAJA 3A3NB 3G4SS 3CTRA 2VJUA 1ELOA 4F0KA 2I0XA 5EWEA 1XWLA 2L41A 2OPQB 1HYSA 3P5TL 1JLAB 4IDKA 2DB1A 2XHCA 3BYRA 4O4GA 2LKZA 5AJ3F 2QRRA 1XMBA 2LDIA 5F9LA 3GCWP 4DR3F 4CCHA 2WVBA 5KT2A 2CPDA 4PG6A 4RNFA 2K06A 3NP5A 1PYTA 1YBAA 2J0XA 4PWDA 3GE9A 3VCDA 3W61A 4RWWA 4JYAF 1M5HA 4HLBA 5C42B 1NJWA 4NMXA 4QR2A 2BJEA 1FK9B 3O8WA 4NA3A 4OL8A 1PBAA 4UOFA 5ITHA 2VC1A 5DDOC 4U8YA 4KHMA 3UD5A 5LMNF 2A10A 1EB0A 2YVSA 3ZZYA 1S1VB 4YN3B 4TY8B 5A8WB 2V5HG 3HVWA 5ETSA 4CO4A 1R0CB 4DR5F 5DETA 2C22A 2QLWA 2XMJA 1HQEB 3BR9A 3DLEB 1R7IA 4DWIA 4O44B 2ZUGA 3O5TB 4USMA 3CCVS 3CUNA 3TARA 4RW7B 2LU1A 4ZVTB 2WTFA 2G0CA 3U02A 4TXSA 1YGYA 1REVA 3KG4A 3T5HA 2YBVA 1H3DA 3TA0A 3MM7B 1NPRA 2KT3A 3LTOA 1E6YB 1HBOB 1X8DA 4FN5A 4PYAA 1Q7LB 2L9NA 3A12A 1N32F 4Y2IA 5ETPA 2JEFA 2HBQB 4A8KA 1RT3A 3BGLA 1NDPA 1PBUA 1N56A 2J9DE 4KPYA 4NLOA 4ECXA 4WTYA 2M7SA 2KFNA 5AE3A 4ED2A 2E9TA 4ED3A 4LF7J 1SQGA 1NK0A 3OTDA 4DN9A 4ATNA 2QGFB 2RD5C 4DPUA 2HSEB 2FGCA 2DH8A 4LFAJ 2XQCA 3PRDA 2DNHA 5CQGA 2W2QP 4K4TA 2HFNA 1FESA 2F4VF 3SSRA 2CNOB 1RZMA 3OSNA 4UUWA 5HVGA 2N7YA 3GSDA 4QQBA 4Q44A 4WXOA 1YITS 3RR8A 4KKOA 3R27A 3M1VB 3DOKB 2ZFHA 1ZS6A 5KT7A 2VZ9A 2H5EA 1HW9A 2VBXA 2F4FA 2RF2A 3E01B 4ELVA 2XYHB 4ZITA 4DUZF 3J7YU 1HBNA 4WP3A 4PYDA 2HQDA 1O0PA 3IM9A 2V6AA 5KG7A 2BRKA 3RZAA 2IJNA 4J37A 4EWTA 2FVCA 2C3MA 5J2NA 1KVIA 3BN4A 5J1EA 1F5AA 2R8KA 1KEKA 4GO7X 4K2JA 2OHDA 2OD6A 2RNEA 2RT3A 3I6PA 1IUJA 2B4VA 1SC1B 3M8ZA 3DRXA 3PFEA 1FRIA 5DDRC 2F8EX 3A4TA 3LH2S 4AQYJ 3BB5A 3L7PA 3U1MA 4CLZA 2JLEA 3O1LA 3POTA 2AX1A 2UUAF 2UV8G 4DSJA 5J1PA 1WJ9A 4C0BA 2DPJA 1N4LA 3NL0A 3CCMS 2CFXA 1AT1B 3N5BA 2JWNA 3UDEA 1SCJB 4OFZA 4KH1B 1DRZA 3C19A 3K2YA 1L3UA 4CO3A 4DCPB 2DITA 3V4MA 4X4QA 1JQGA 2R2RA 1RK8A 2BBEA 2XY7A 1SJRA 2XMAA 2JOQA 3BR8A 2CKWA 5C25A 4USIA 4DPTA 1N36F 2UXCF 1QE1A 4GVBA 2R7OA 1FDDA 4WF9Q 5A6PA 3BGRA 4KJIA 5B0CA 4WP8A 5IZHA 5DZ7A 3ZTPA 1C1CA 2CQPA 1BQMB 1TMJA 3OFEA 2DRBA 4I2QB 4C8KA 4OZNA 2VA2A 2XSFA 1SH2A 2RJZA 1WTFA 5DO2A 2HKEA 2W9AA 3FQLA 1T9WA 5F8NA 2YY3A 1GMVA 1XNRJ 2V9WA 4ZKAA 1VMBA 3BGUA 5CCLA 4CYUB 1WD6A 1OY8A 3QSYB 1SKSA 4LMZA 1VI7A 3WX8A 2ZJPQ 2CPIA 1D1UA 4YY3F 1OYEA 3HHLD 3BM7A 3CIZA 4OI1A 3R2DJ 3G8TA 4NLRA 3D6HB 2VG6B 2V0NA 4E8UA 3TO8A 1X4AA 4WKRA 1WEXA 2F9DA 3N5FA 2AWZA 3SFGA 1WHVA 2DNZA 3V6KA 4DV0F 4DFMA 1JXVA 5CXTA 1JXEA 2VONA 1KQSR 3FRZA 5KT3A 4L76A 1S77D 4R25A 1HIYA 4LF6J 3HHLB 1RWKB 3MM6B 3R3TA 3D6MB 3LUYA 3K8VA 3FDSA 4YOEA 3RRGA 4FP9A 5KG2A 4MFBA 4JV0A 4IQXA 3QMQA 3ZZPA 2FPHX 2VDIA 3Q83A 4WFYA 3FMWA 3A8EA 1J5EF 1R8AA 4X4PA 2AEJA 2OPSB 3IR5B 2ZOGA 2CNKB 4FS2A 4AXJA 2MEWA 5L1JA 3QZ8A 1WNEA 1A6LA 4O4GB 2HNDB 1FNOA 4X4NA 1K8AT 3WHIA 4OYIA 3MM5A 5ETQA 4IFYA 2UUBF 3MMAB 4LR8A 1GXLA 2HK3A 3SCJE 4CLSA 3W8GA 2MYFA 3QAUA 3P49B 1VRQC 2JC1A 1JLEA 1X0PA 4X64F 4USWA 3KLFB 2DCUB 3G6YA 1N34F 3GPAA 2HGMA 4B3OA 5DLFA 4KHPF 5KFNA 3LGNA 2ZH3A 3HK2A 5E3CA 4LRCA 5CD4A 1IBMF 1X9MA 4LSNA 4W4MA 5CH7B 5F8HA 3IR7B 4ZPDA 4DI6A 2OUGA 3C2PA 3MCSA 3KTQA 1WC3A 2KL8A 4B9MA 2DNMA 4ZIVA 5EHHA 2P9EA 4DL7A 1W26A 1Y00A 2DXDA 2HHSA 2H51B 2WSFC 1RI7A 1HD0A 1FRHA 3BGOP 4UW2A 4YDDB 4WTOB 1EAYC 2V69A 4EK2A 1YWXA 4YDXA 3A3PB 3J7ZT 4W98A 5GMEA 2GJFA 2RAQA 1YQHA 2YWFA 2UU9F 2B6AA 4EZ6A 4Q2LA 3T1HF 4JI3J 2QX0A 4M63A 3PIPQ 1N88A 2X1GA 1SH0A 2KRBA 2KI2A 1IBCB 3AHPA 3PX6A 4QW9A 2HHVA 1SC6A 1HWIA 3QRPA 1TUWA 3CNQP 3JTOA 4LVNP 3KLGA 3LPEA 1B0VA 1HWUA 3H4BA 3PW0A 1NH7A 4PXBA 2PEBA 5A76A 2E29A 3LP0B 1VHFA 3DHXA 4DSEA 1U6ZA 1WEYA 2O66A 2EI5A 5KFLA 4YUDA 2FIUA 1OYDA 4OI0A 2BQ3A 4DF4A 2P9GA 1U1QA 1UWBB 1MMLA 4A8MP 4DR4F 3DRRA 3IG1B 1GTHA 4NLUA 1JLBB 1HBNB 4B9TA 3KK2B 4QIVA 3EGVA 4OX9F 2R7QA 4R8UB 3A8JA 3TVZA 3PW2A 5J2NB 1ZOTA 4IOAQ 1VISA 4X4TA 3HULA 2JHEA 3RAQA 2C42A 5EGYA 4R5PB 3CWJA 4XDDA 3G8SA 2EBEA 3PACA 5JUMA 2AP6A 3UR0A 3DLGB 3QSIA 2ZHAA 2YQ3A 5HMXA 2RRNA 1ZM3A 1H2UX 2K7KA 1VBZA 4LRBA 4CLUA 3PV8A 4GKKJ 4Q45A 1LW0B 2ASYA 3CCWA 3MCNA 5GVQA 4LSZB 4M5MA 4I1TA 5H1SV 1X5OA 2XCPA 5C24A 3BQ0A 1Q81T 2W01A 1FF2A 1XNQF 3TUPA 4GKJF 4DBQA 3EGZA 3CCES 1S4EA 3TJAA 3R5DA 4ZJQA 1VRTA 3D67A 3K17A 2F1FA 2M52A 5DLGA 2D9PA 4QIGA 3EZ5A 3DRPB 3J80U 2EFVA 2C3PA 1JLGA 3G82A 4FF4A 3R8YA 3M8QA 2E5LJ 2LQ9A 4C6AA 2APOA 4GRSA 4YP3A 4DLGA 3T1YF 1Q86T 3BREA 1EP4B 1N54B 3EGWB 1C1CB 2WZ1A 1YZ6A 4HTIA 1TKTA 1B99A 3OQ2A 3FMBA 4JI6F 3ZTOA 1V9OA 2CPHA 2ZVSA 3V4IB 1QAJA 1BQNB 3OTOF 2YX1A 4K4VA 4OX6A 2MJUA 3BPDA 2WRMA 4G65A 1AXQA 4USVA 3O6QA 4B3MF 1TK5A 2HHPA 4WFZA 3MAAA 5AT1B 1JJCB 1Q8BA 4IOCQ 1RHKB 1YJTA 1R8CA 2UXBF 1H74A 5DG7A 1HQUB 1Q16B 3W3SA 2V2QA 1EETA 3FZBA 3MECB 3PR4A 2B4UA 4DPYA 4P10A 1U47A 3R2CJ 2VQFJ 3HFZB 2DIVA 2ZBRA 3GJTB 4WYLA 2HFOA 1YRUA 2E1AA 3GTYX 3CJ3A 5CYQA 2EXUA 3G71S 5HBMB 4IR9A 2VU5A 4PWUA 2D3OR 5GADU 4JV5F 4KV8B 3TAQA 1YJ9S 2WCXA 3QJPA 2HBRB 4DQRA 3MXHP 3CJSA 4LQ3A 3PW4A 1XR6A 4CH7A 1FKAF 1BHNA 3GSIA 1L3KA 2FVPA 3BV8A 4RUAA 3BSCA 5GAHI 3QZ7A 3NMAA 1XR7A 3L95X 3D68A 1GNKA 1HHQA 4I2PA 5IS2A 1HMVB 4TLQA 3OUYA 1CULB 2G13A 1C1BB 1S72S 1DTTB 3BH7B 1ZM4A 3TANA 4PEOA 1AROP 1XMOF 1E6VB 3FSXA 3CC2S 2IA6A 2MXYA 4HI2A 2MZQA 3H4DA 1EIYB 3D1QA 3DOMB 4QWAA 2LA4A 3LF0A 4OJ1A 4ANCA 4NL5A 2QN6B 1LWEB 3IBCB 3TRGA 3AAWB 1ROFA 1I94F 4USTA 4TNOA 1HWJA 2ZH4A 4DR6J 2DH7A 2HHHF 1GXUA 2OH2A 2ZH9A 2NSBA 2C3OA 2EVZA 2ZWPA 3FFIB 2R2SA 3HZEA 2F40A 1PJ7A 5CHCB 2LYVA 4K59A 1VQMS 1NMEB 4O23A 4KSEB 1WSVA 4Y00A 1GXTA 2B9XA 4O3OA 3DI6B 3R1LA 2M3DA 1RTZA 3UVJB 1KC8T 2J8SA 1MU2B 2Z56B 5KFJA 2LXUA 4QWEA 3HHEA 2DVIA 3MPDA 2JEJA 2X1AA 3BJYA 3TNVA 1U2CA 2ZHOA 3D7SB 1VQPS 1LFPA 3DMJA 3QQCD 4M94A 2HPUA 5KFUA 2LFVA 2BQRA 4LF1A 1S10A 2XMTA 1ZTWA 3UQSA 1RWWB 2FZGB 2KG0A 3JAMU 2MKYA 3JQKA 2BW7A 2CQIA 3KKFA 5D4LA 7FD1A 3QJLA 2BJDA 2M2BA 3CMES 1RT4B 1XMQF 2CPEA 5KT6A 2QO3A 3MOJB 3GYNA 1U48A 2YWWA 2WSEC 3UPFA 3HKZD 4NI2A 3PO5A 2QFIA 3AQOA 4LF4J 1Q78A 4DV1F 1MN9A 5KFCA 1G3OA 2DNRA 1AFIA 3KG1A 4D3HA 3GZ7A 3VAIA 3EVMA 2KU7A 3JSMB 3UWTA 2QL5B 3D2WA 3VVUA 2H4YB 4KFBA 3QT7A 4JI2J 2Q3PA 2EFGA 1RT7B 3UNGC 4K4UA 4LRDA 1FWLA 2CPZA 2IVFB 2A1BA 3D54A 4C9DA 2PE8A 3HDSA 2YNIB 3P6YC 4I6WA 1WKKA 2D1CA 3M8RA 3LWLA 4NA2A 4USKA 4L75A 2K1RB 3DOLA 2VV5A 5AJ3J 1Q1KA 2GMJA 4O3NA 4ECYA 4FDFA 2QA2A 4P75A 3O2IA 1WF0A 4DUYJ 4P71A 2OEMA 1AW0A 3P45B 1ZAWA 2IDEA 3I31A 1NO8A 3CD6S 4KY3A 3GILA 4NYZA 2XCAA 2J0WA 4I6AA 1RAGB 1TZ0A 4JYAJ 2MQLA 4EYHB 3HT3A 1TR0A 2DGSA 4LR7A 1IKVB 4ID8A 2QJ3A 1FRXA 1ITPA 4WWSA 4ZIWA 1JJHA 5LMNJ 3M4XA 3MUMP 5T14A 1TMMA 2N82B 1LXJA 2XZDB 1N5YA 3QT8A 5IOLA 2M4MA 3UCUP 3KXDA 3AJDA 3K89A 3QT5A 4U8VA 1SJFA 5KFVA 2WW8A 5LSOA 2R42A 3CDWA 3LWMA 1RHJB 5JXSA 3TJ9A 2ZDPA 2E66A 2ASDA 2ROPA 4OHVA 2KM8C 4PPDA 4M5GA 1J5OA 5B09A 1LNQA 3VAJA 3UN3A 5A6WA 4AFFA 1FE4A 1LWCB 5DG9A 1EHWA 5MLCV 1RGVA 2MGZB 3TQEA 2QIFA 1ULRA 2W2NP 3P3DA 3I0RA 2GO8A 2R7XA 5HLFA 3PFOA 1RTDA 3K58A 3NOCA 4FYWB 4KT0C 1ZM9A 3MPVA 4C0OC 3TVKA 4UOGA 4DL2A 2IYGA 1TL7A 4ICLA 5K14A 3G6VA 1YSJA 4MK7A 4NOHA 1IN0A 3SIPB 3TP2A 5B0FA 8AT1B 3CDAA 4I7FB 3JTNA 2FDNA 2QG9B 2RS8A 2VIHA 2DGVA 1RTHB 5BJRA 5F9NA 1VQ8S 2PA8D 1SB6A 2F4VJ 4P2FA 2YKMA 1RSCA 1Y5LB 1FDNA 1F3FA 2RH3A 4QU7A 1LFWA 2V2ZA 3CT9A 2YNGB 4H4MB 4YFUA 2WVDA 4NRTA 3KUHA 1RTIB 4B9UA 5IT9Y 4DR1F 5LJ5Y 1CJTA 2CJXB 1U02A 1CJKB 2AYEA 5LM7E 1CVJA 1RWVB 4DUZJ 4CO1A 3RGIA 1G4CA 3VGUA 2DHXA 1VOMA 3WIVA 1YI2S 3ULHA 1FD2A 5KG5A 3LP1B 4F0HA 2NXCA 1X5PA 4IYQA 2KB2A 3MURP 5IT4A 3T5KA 4RPFA 2DR7A 3BEGB 2IC3A 3HHKA 3I0SB 3LANA 2IIHA 4DZDA 2HS0A 2FQQB 2UUAJ 4PQUB 1F0XA 2OPRA 1SIZA 1RT2B 2Q79A 3M2RB 1B0PA 1VFJA 2M0GB 2FTRA 5B0AA 4M5JA 1TL5A 2CWXA 1VQ6S 5IM0A 2MKIA 3H8YA 2E1PA 1X31C 1RT5A 2KO1A 5IV4A 4QBUA 4ZS6A 1JLFA 2ABYA 3W64A 2GHWA 1FVQA 4OZLA 3OFFA 5LJ3Y 1OO0B 4MK9A 4X65F 4J9VA 1FD8A 1RYRA 2A0FB 1N36J 2NS1B 2UXCJ 3EM1A 3R5GA 1PC4A 1KQFB 3FRYA 2N7CA 1DTQB 4JI4F 1UJ6A 4DR7F 2VPZB 1CEZA 1HI1A 5LOQA 2MQ8A 2BR0A 4KR0B 1S7IA 1U6FA 3NNCA 1B7YB 2VG5B 2F63A 5HQLA 4C11A 2DTJA 2E9RX 1F9EB 3CPWR 4NCGB 1HNIA 4DV6F 4HYKA 2VB6A 1MW7A 2X3DA 4TLRA 5D15A 1VR6A 1FRJA 1GK8A 5HK4A 4J9LA 3DLHA 4DV2F 3JQJA 1WUUA 4PQAA 2P8IA 2F5GA 3MEKA 2ACYA 2DEJA 3GIIA 3M6UA 4N47A 3VF0B 2HHWA 5I42B 1NJIT 2KXNB 4MIBA 2R4FA 2ATLA 1C2PA 3DYAB 2PDAA 1U26A 5SUHA 2FVSA 1NPPA 3DGPB 5E3RA 1URNA 3QNWB 3KMSA 3F73A 3SDEB 2HQIA 1W2BR 1WI6A 2OMOA 4NI2B 4XK8C 2ERRA 2HYIB 3CMAS 5HJXA 1FXLA 2Y1JA 2CPYA 2GVZA 4F26A 4ED6A 3KNAA 4KB7A 2H1YA 4TY9A 2MSTA 4UT4A 1BE4A 1NZ8A 3S8SA 2XS2A 4EO8A 4NYPA 3GMGA 4XO0A 2KDOA 2W8KA 1HNWJ 3NEKA 4A47A 3JYTA 3EJMA 5DQIA 5IT0A 4DDFA 3ITHB 2CJ9A 2ROGA 4CT8A 2NUUG 3V2UC 1OQ3A 2J8AA 3CW2C 2V8GA 1X0FA 2ZKTA 4XPEA 5F8GA 1O8BA 2XNQA 4NWBA 1SC4B 5DZ6A 3OV7A 3CJ0A 3CB4A 2BKNA 3OFGA 3KLEA 2QYGA 4RBUA 1PYOB 4PG5A 4JP8A 4FNHA 4C97A 3M9OB 4ZDNA 4NLSA 4UQGA 5D0EA 3M7VA 4FXVA 4DG1A 3SBMA 3P8BB 2G2OA 1VYAA 4MYUA 3T9NA 2MKHA 2OJ3A 2UV8A 3GV7B 1Q4RA 2YQ0A 4DQQA 2VC0A 3KLIB 1BWEA 4KHPJ 4BC7A 1S6QA 3PHEA 2CQ1A 1KRPA 3RUBL 2FC8A 1U1MA 1FJEB 3VGVA 3EDRB 3U1NA 2DHAA 3RB4A 3AJ1A 4PXDA 4U6PA 1FXDA 2GGPB 4XDCA 4ZVOB 3J7A1 1CQMA 2WBRA 3LP2A 3QIPB 2OEJA 3PTWA 3I9V9 5AXKA 4RZRA 4L73A 5G0RB 5IQ6A 4QWBA 3T3FA 1RWPB 1C0UA 3DN9A 2B4OA 5A8KA 1U25A 1L3VA 5KFZA 4AL7A 2MZTA 5HROA 2D3UA 4W92B 2GJIA 2BANB 2UU9J 1OJ4A 3K5MA 2J6UA 4PR6A 2AF6A 4UY8T 1PC5A 3Q8PB 2CUYA 4RW6A 2RKIA 4HKQA 2R7WA 1V6HA 2XO6A 3T1HJ 4RBTA 1JNZB 1MN7A 3TOQA 2I9SA 4ILLA 4ZLPA 1YJNS 4DR2F 4ZLNA 4X4OA 4YMEA 4RR5A 3OR2B 1NSQA 1QD1A 4LBHA 2CA9A 2CVEA 1PKUA 3OL6A 2W4DA 1HNZJ 1V3SA 1NRKA 3IWXA 1NXIA 1RDRA 3A8KA 2WONB 2WBMA 4FVCA 3HFKA 1U0HB 3D9BA 2HGNA 2XC9A 1NK9A 3EZOA 4PZVA 3JQMA 4YR0A 1HHSA 3MFIA 1T03B 1Y3JA 3BO4A 3CCQS 2NSCA 1VK8A 1IVZA 5L9NA 1Y11A 1JKHA 6FDRA 2Y3YA 4DR4J 1OY9A 2H54B 3OFHA 1PIEA 1F5CA 2FHJA 4CTAB 2WW4A 4IG3A 3LALA 3V5RA 4CM0A 3VAHA 1F9HA 4RW4B 1UKUA 2UZAA 2M88A 5F0WA 4O3RA 3MAQA 2N4DA 4F50A 1MWQA 5HP1B 3T19A 4ECWA 1UA0A 4LIWA 2X3GA 4PCQA 3TZZA 2C2OB 4CLFA 1UAWA 3C15B 4G1QB 4URQU 2FJVA 1IKWB 2MB0B 1AB8A 3G6XA 4RNMA 2I8EA 1H7XA 2CWKA 2B9WA 3EE3A 1K0TA 4WP9A 4X62J 1RBLA 2PFFB 3FBFA 5D3GB 3UE2A 3L9ZA 3HD1A 2V4JA 2AJ0A 1XNQJ 3M8PA 4GKJJ 5IM0B 2O3DA 3UFCX 3IP0A 3AQPA 2BE2A 3CCZA 1RTJA 3BSOA 2GQCA 2PA3A 2DNKA 5DM7Q 3AXKA 4A4JA 3UDCA 5J2QA 3D1OA 1VIOA 5JVHQ 1C4AA 2DNYA 4OI2A 3PVXA 1M5KC 3I5AA 4J9OA 5I3QA 1PAUB 2YKOA 1F1BB 2P2CB 3KK3B 2DBBA 3T1YJ 2K2PA 1KQKA 3THPA 1WC1A 1X4EA 3N4WA 3SSQA 1S1XA 1EARA 4WXWA 5SZTA 4BWMA 2QSWA 3IMQJ 3S6EA 5E41A 4ZVHA 4JI6J 3S1TA 1HNVA 1W25A 3MD3A 3GFZA 4Y2CA 1YRTA 3OTOJ 4F02A 2J9CA 4KBIA 4FYYB 2A2DA 1R27B 4MKVA 2ASLA 4KPCA 4DQIA 1RT6A 1TL4A 3HP6A 1UZHA 3EDQB 3Q8RB 3H5YA 3V81B 1PSDA 5KTQA 3JSYA 1SV5B 1B4SA 4W90B 4OYZA 2IAJB 4P72A 3H0PA 2CZ9A 2I38A 1UEVA 2ZWOA 4TYBA 1UETA 5E5NA 3UN5A 1FFGB 1LXNA 5GAGI 1Q79A 5KFQA 5CZVA 4FF1A 2WSCC 1M1GA 2FLLA 2VH7A 3NS7B 1LQ9A 2Y1LB 1FT8A 1U8WA 2R8GA 3O3LA 2DEIA 5FLXU 4IG0B 5D0GA 2JNJA 1S1UA 3E3XA 5D6GA 2O1PA 4JI3F 2LDYA 2XTJP 2EEYA 4QOTA 2RS2A 4OJGA 1T95A 4ZN3A 2VICA 2HW3A 4AL5A 2VFRA 2R8IA 2AIRB 1ZAXA 4OJHA 1UFLA 3G6ES 3EUNA 3GIMA 1TL3B 1RE1B 1NBEB 2ZH1A 1IKXA 2JH3A 4WK3A 3ZC4A 2KM8B
chains in the Genus database with same CATH topology
4A8SA 2XWXA 4Y3CA 4N8NA 5J2MB 2ZH3A 1QSSA 5EX0A 1SBRA 3MTJA 5E3CA 3DU5A 3HK2A 1S9EB 2HWTA 2RVJA 2EBGA 1IBMF 4F67A 1X9MA 1X4HA 4LSNA 1N6QB 4C3MA 2J7KA 2KVIA 2ZE2A 3MMAA 5CH7B 3IR7B 5F8HA 4ZPDA 1WG5A 2HQ3A 2VPWB 4I56A 1KTQA 4N77A 1R8HA 3MHYA 1JJ4A 1KOHA 4A46A 4WKYA 4CIOA 3C2PA 2X1FA 3MAHA 2B6AB 2HHXA 1DFDA 2V4RA 4LQ9A 3OSPA 3MCSA 1B0TA 3KTQA 4PG4A 1GX5A 3TQ1A 4B9MA 2CG4A 3DRSB 1S0OA 2XS5A 2DNMA 5EHHA 2KFZA 3NGKA 2P9EA 4BWJA 4DL7A 1VBXA 1VS3A 1UMJA 3KLFA 4B9SA 1Y00A 4LF7F 5I3PA 2HHSA 1TL3A 2IM0A 1NK7A 2WSFC 4N5SA 1RI7A 1HD0A 2FVQA 1FRHA 2Q6CA 3Q2SC 1S1WA 1HWLA 4UW2A 4YDDB 3BSAA 4LFAF 2XLJA 4NA1A 2LEPA 1FJ7A 3G8QA 5J2MA 3OTEA 3ZZZA 2MZ1A 1S9EA 1YWXA 4WFBQ 2CPXA 1Z1ZA 4YDXA 4J9NA 5DJBA 3J7ZT 1QJHA 4D3GA 1Y9OA 3BZQA 1YQHA 2YWFA 2UU9F 3KHHA 3DC2A 3KLGB 2AQ4A 4A8XA 3OHBA 5L1KA 2OIHA 3QYYA 3FEXB 2B6AA 2JVOA 1D3WA 3NG8A 4TQSA 4EZ6A 4P7TA 2YWKA 5KFSA 3OVBA 3KMQA 4Q2LA 5KT4A 4Y2AA 3DRSA 3GV8B 5H9FJ 4FNIA 2HNZB 2NR0A 4NX9A 3T1HF 4DV3F 1APSA 2VKZG 1KLMB 5G4DA 3AA8A 4M63A 3PIPQ 2XI3A 1N88A 2X1GA 2BVZA 2VBYA 1SH0A 3RBEA 4K5RA 2MKCA 3H25A 2D7SA 2KRBA 3HZGA 2AYMA 4QPTA 1H38A 2KI2A 3KG0A 3OVAA 4RUCA 3N6LA 3SQGB 2AJQA 3OR1B 2V8VA 3AHPA 3PX6A 4L6V3 1ZETA 2IM1A 4NLQA 2B5JB 4YB1P 4QW9A 1F60B 2HHVA 2CQBA 5BYSA 2M8DB 1SC6A 4GKKF 2CRLA 4ECZA 1N48A 1HWIA 2V2KA 3JTOA 3DRRB 4LVNP 1VQSA 2BQUA 3DXSX 1Y5IB 1JMTA 3KLGA 4QW8A 4GC6A 4Y6IA 1DURA 2XMUA 3B78A 1B0VA 1HWUA 5A8RB 3H4BA 2LEBA 3PW0A 3HO1A 2CIMA 4UQTA 1NH7A 2ZH7A 2HLTA 2HNZA 4PXBA 5BYRA 4OHXA 2E29A 4IOBA 3LP0B 1KLMA 1VHFA 3DHXA 4DSEA 2NLWA 3N9UC 1U6ZA 3NMRA 1WEYA 2O66A 4RKUC 3RTVA 3CE8A 4DX8H 3IA0A 2EI5A 4ZVFA 3DNCA 5KFLA 3VZIA 2FIUA 4YUDA 3J81Y 4OI0A 3LAKA 3MR2A 4AQYF 3BN7A 1X4GA 2BQ3A 1YHQS 4DF4A 3SQGA 2DGTA 2L9DA 2GW8A 3OR1A 1S9FA 4PUOB 4UY85 2P9GA 4WU2A 5FIIA 3ETOA 2MJNA 4H4OB 4BC9A 5I4MA 1U1QA 1UWBB 4EO6A 1MMLA 3BF4A 1DHMA 1GX6A 2OFGX 4A8MP 4DSFA 4DR4F 1KOOA 2J9DA 3DRRA 5HMZA 3VR1A 2XMWA 1PILA 2DGUA 2FB0A 2Z8QA 1QSLA 1KFSA 1NJZA 4K0KF 3IG1B 1GTHA 1N0VC 4ED8A 2IMWP 4X4SA 3PW7A 1QVFR 4NLUA 1JLBB 1MROA 1HBNB 2RQMA 2RDJA 5A8RA 4LVOP 1L5UA 1G1XA 3HJFA 1CQNA 4B9TA 2YNFB 3KK2B 4QIVA 2VBWA 3B4DA 3H5SA 3LP0A 1LWFB 4OX9F 2R7QA 4OLPA 1S6PB 4HDGA 4R8UB 4DEZA 3TVZA 1KLNA 2CQCA 3PW2A 5J2NB 1ZOTA 4IOAQ 3SZ2A 5DQHA 4B3TF 1RKIA 3HX9A 3DDKA 5C24B 4ILMA 2LQBA 4X4TA 2NQPA 1QM9A 2DGOA 4HHJA 3CULA 2LXIA 4ZP6A 4PUOA 3Q24A 2FHJD 1T3NA 2JHEA 3CD7A 3RAQA 4ED5A 2C42A 3ENVA 4H4OA 2L48A 3NNHA 5EGYA 2Q1LA 4R5PB 2XO7A 3PXGa 1UWBA 1L3TA 3CWJA 4XDDA 3G8SA 2DR9A 5HN0A 4N41A 2EBEA 3PACA 5JUMA 5KFWA 1UA1A 4CQ1A 2DCLA 3P96A 3IG1A 2AP6A 4DMZA 1CPZA 1TKXB 1SIWB 1VRTB 3DLGB 3H20A 1Q53A 2CJAA 2YQ3A 3UR0A 5DQGA 2ZHAA 4DV4F 1JLBA 1W2IA 5HMXA 3MEEB 2RRNA 1ZM3A 2D3ZA 1H2UX 4ALZA 2XMMA 2YNFA 3KK2A 2K7KA 5KFPA 2XGPA 1VBZA 4F8RA 1LWFA 4MKAA 5KFHA 2RRAA 1SKRA 1S6PA 2VASA 1JLGB 3ZFVA 2HAIA 5E2QA 3FGVA 3ZZUA 4Q45A 3CF5Q 1LKZA 1LW0B 3KHGA 2ASYA 4R8UA 3G96A 3KOAA 3CCWA 2FC9A 1KN6A 5GVQA 3M8QB 3ISZA 4X66F 4I1TA 5H1SV 4ETXA 3LO3A 4X4RA 1X5OA 2XCPA 5DS7A 3M2UA 5C24A 3BQ0A 4HTJA 2BACA 1Q81T 1QTMA 2MQQA 1FF2A 2ADCA 4RW9B 3MM8B 1XNQF 3OTBA 4R5PA 1WEZA 2YKAA 4GKJF 4DBQA 3QGHA 4U67Q 2E5GA 4RWXA 1DZ5A 3K8WA 3RB0A 2L08A 1NAQA 3CCES 4IRCA 3EGZA 3GYXB 3NWGA 2AYBA 3M2VB 3OW2R 1OSCA 3R5DA 4FBTA 4KGKA 1TKXA 1UVLA 1VRTA 3DLGA 1TKTB 2ZOMA 4ZCLA 5LXRA 1XNRF 2F8HA 2F1FA 2M52A 4Y28C 3MEEA 5DLGA 1L3SA 3D5MA 5F8IA 2D9PA 3NCPA 4QIGA 3DDNA 3EGNA 4I4BA 3EZ5A 3DRPB 4OJ3A 5HMWA 2HNYB 2EFVA 2C3PA 1JLGA 3VAGA 4AUKA 4FF4A 3K5LA 4DJBA 1LW0A 2OFHX 2F9JA 2C2EA 3CDBA 3BO2A 4IH6A 2ZBIA 2FJXA 3M8QA 4EBEA 2FHKA 3ZZRA 2LQ9A 4R0JA 3M30B 2UXDF 3M32B 4EYIB 4C2MA 1FKPB 4A8YA 1M5VC 2APOA 2Z0GA 3I87A 4RW9A 3MM8A 1JXLA 3DLLQ 1ZPVA 4YP3A 1HA1A 4DLGA 4ECVA 3T1YF 1RKJA 3MI7X 1Q86T 2HVIA 2QT7A 3BREA 1EP4B 1N54B 4E0DA 1XK8A 1LK7A 2JX2A 3EGWB 4L3NA 1C1CB 2GA7A 4ILRA 1XTZA 3T6JA 5F3ZA 3MF5A 3M2VA 3HF5A 4K5SA 4EU0A 5AXLA 2XSJB 3NRBA 4HTIA 1TKTA 4KTQA 2Y1IA 2VG7A 3OQ2A 3QIDA 1RA7A 3FMBA 2LCWA 4JI6F 2UUTA 2NXUA 1EETB 2KG1A 3EYZA 3KJVB 3DRPA 1V9OA 3M8PB 2CPHA 2ZVSA 4AE5A 2HNYA 1LW2A 3V4IB 5KFIA 2R9LA 1QAJA 4KE5A 2E5HA 1BQNB 3GFXA 3OTOF 2ZBCA 1S6OA 2YX1A 2G4BA 3CD0A 4K4VA 4OX6A 2E7WA 1UFWA 2MJUA 1UW4A 1B7FA 2WRMA 3H59A 3SCIE 1KONA 1AXQA 2A18A 1MMNA 3M30A 3M32A 3OHAA 3O6QA 4B3MF 4LF6F 1RTJB 1TK5A 1H2TZ 1FKPA 2EFOA 2HHPA 2L9WA 4WFZA 4F4ZA 2EG1A 1GQEA 1S9GB 2OD4A 2QE5A 3O44A 1BLUA 2I5JB 1Q8BA 4IOCQ 5CYQB 1D8ZA 2JSXA 1EP4A 4FYDA 1YJTA 1R8CA 2UXBF 3SV4A 5DG7A 1Y7PA 1HQUB 3RU0A 1D0EA 2R7TA 2DNOA 2J7UA 1SI9A 3QGPA 4I67A 4WJBA 2XSJA 1Q16B 2MHNA 5B7WA 3A1YG 3W3SA 4ZPVR 2GHVC 2NPIA 3SV3A 4J9KA 3K7RA 5DRKA 1EETA 5KFMA 3C6TB 3FZBA 3MECB 1N5VA 3KJVA 2QA4G 2KYXA 3LGMA 3ENWA 3PR4A 2B4UA 5E7OB 3BQ2A 3V4IA 2Z4PA 4IRDA 1BQNA 4Q5VA 3OJSA 1U47A 2KT2A 2KJWA 3BDPA 2VKRA 1M5SA 2E5JA 3WC2A 2DIVA 3DCAA 1T05B 3TVYA 4WYLA 1M90T 2VPYB 4U9RA 1NU4A 2PEHA 2E5IA 3V6DB 2HFOA 1X9WA 1YRUA 4RU2A 1S9GA 5GAGU 2E1AA 2I5JA 3CJ3A 5CYQA 3TYTA 3UDLA 2DK2A 4K4YA 4QCLA 1B64A 3G71S 4HEA9 5HBMB 4IR9A 1HQUA 1G6BA 4PWUA 2D3OR 2J7WA 1SJ3P 2N3OA 4DFPA 2GMLA 1MWYA 4IFVA 5GADU 4I2PB 4JV5F 4KV8B 3TAQA 5LSRA 4I68A 3OUYB 1CC7A 3MMJA 1YJ9S 4JV2A 4F4XA 4C3KA 1HPZA 2WCXA 3H2LA 3QJPA 4ZHRB 1X5SA 3C6TA 3MECA 4CO5A 4DQRA 2P5VA 3MXHP 1TUVA 1QY7A 4LQ3A 2JVRA 2GJ2A 4J9PA 3PW4A 1XR6A 3GB0A 3ZZTA 2IMOA 1VRUA 4CH7A 2BM1A 1FKAF 1VLYA 3IRXB 4JV1A 3HKWA 1L3KA 4CNZA 1IR0A 1FRMA 2W9CB 2IRXA 2FVPA 1TVRB 3MUTP 2ZHBA 1T05A 3SEOA 1YRXA 2HMIB 5LT5A 4FBUA 4RUAA 3AB2B 3BSCA 4O3PA 5GAHI 1P6TA 3NKYA 3QZ7A 3NMAA 4TU9A 4FS1A 4WYWA 5KOXA 5EWFA 3V6DA 3DLBA 2JFKA 3OJUA 1XR7A 3L95X 3MM9B 5HI7A 3R5AA 4R0EA 4RU9A 4J9MA 4J9SA 5HBMA 1GNKA 1JX4A 1U09A 4JBCA 2CYYA 5B0GA 1N5QA 3FVYA 1TAUA 4Q0BA 3TA1A 4I2PA 4QYRA 5CA5A 5IS2A 4KV8A 1HMVB 1JLQA 4PG8A 1VQKS 1BY9A 4TLQA 4XAKA 3OUYA 3Q8QB 1U45A 2G13A 1C1BB 3WZ0A 2VBZA 3B82A 4KC5A 1S72S 4ZHRA 1DTTB 4ETZA 2ZH2A 1HI0P 1Y4ZB 1ZM4A 3KYLA 4WCEQ 5A0YB 2E9ZA 3PR5B 3HM9A 3TANA 1AUDA 4WFNQ 1NHVA 1AROP 3IRXA 5GAEI 2ZOFA 2DT9A 1XMOF 1NKCA 2W9CA 1E6VB 1TVRA 3FSXA 1XC9A 3CC2S 2HMIA 3GIKA 2IA6A 2MXYA 3I4PA 4HI2A 1SUQB 2MZQA 3H4DA 3D1QA 4QWAA 4NCAA 3X3UA 2ZD1B 4C0HA 2LA4A 3LF0A 4OJ1A 3MM9A 4NL5A 2ZKUA 2MHEA 2C28A 4NLXA 3TX8A 1M5PC 4HI1A 1LWEB 4ZPAA 4IR1A 3FEZA 1VQYA 3TRGA 1QAYA 2WB4A 3AAWB 1VGYA 2EG2A 1HMVA 5KT5A 1ROFA 3NAIA 5L1LA 1I94F 4C8MA 4Y65A 3PEHA 1UEUA 1IM4A 2FLOA 1FRKA 3QGIA 2WOMB 4TNOA 2NYIA 1C1BA 1TKDA 1DTTA 2CZVC 2GO9A 4NCBA 4NLYA 3EXYA 4WFXA 1HWJA 3BDEA 1D8YA 4Q2MA 2HVZA 2QLXA 3BS9A 5A0YA 2ZH4A 1U2RA 3GIJA 5AXNA 1TP7A 4NMLA 4B3RF 2KHCA 1WG1A 2Q6BA 2UVRA 1YJWS 2DH7A 2HHHF 2QZ8A 3CJKB 2K3IA 1TK0A 4RX6A 1GXUA 2OH2A 1E6VA 3MWBA 2QMXA 2NSBA 5KG3A 2C3OA 2ZH9A 2EC0A 5BR8F 2Y0SD 2EVZA 5FD1A 1SUQA 2J0SD 2CJKA 4DSIA 2YH1A 3FFIB 3DOMA 2R2SA 5H9EJ 3HZEA 1WF1A 2CQDA 2F40A 2SXLA 2ZD1A 4MIWA 1ZAVA 1RT1B 2LYVA 1S1TA 3JTPA 5CHCB 4PG7A 1Q8LA 2DNPA 1SJ4P 1HR0F 2RQKA 3TA2A 4K59A 4WZMA 1VQMS 5L38A 3DMJB 1NK4A 2JDJA 1LWEA 1DJ0A 4Y0FA 3GV5B 1OQ6A 4O23A 1YG0A 2CQGA 4DQPA 4KSEB 1U7LA 3W2VA 3PX0A 4Y00A 1GXTA 1FERA 5F8LA 2AGPA 2UVVA 3JB9k 5C5JA 4C3LA 2B9XA 4O3OA 2WOMA 4FF2A 1WG4A 3DI6B 3VQSA 2U1AA 1HHTP 1F2GA 1RQ0A 3NS6A 3R1LA 1HBMB 1CG2A 2M3DA 4K4XA 3NAHA 4ID5B 1QSYA 1KC8T 2D41A 3LW5C 1MU2B 5KFJA 1S6UA 2DD8S 3IC1A 2LXUA 4QWEA 2JL9A 2ROEA 2GIRA 2YWGA 2W24A 1S7HA 3HHEA 2DVIA 4QYZJ 1GT8A 2CQ2A 1RYSA 3RAXA 3WX4A 2E7XA 1P1TA 2Q43A 2JEJA 5AXMA 5E3PA 3M8SA 5B0BA 2X1AA 4QIWD 2K3KA 3CC4S 4ZP8A 3FFIA 3DFEA 3BJYA 3MMCB 1NJXA 4M1KA 5DDQC 3TNVA 4ZPBA 2RILA 1RT1A 3MZIA 1BQXA 2BV3A 3C66A 2MQMA 1X4CA 2HS4A 1VQOS 2R8JA 2ZHOA 1HARA 4NRUA 4DV5F 1VQPS 1LFPA 3EX7B 3DMJA 1JLCA 1X4BA 4DUYF 3J7Z5 3DM2B 4M94A 4DL6A 2HPUA 4MH8A 1V3ZA 2XB2D 4BHQA 3IGNA 4K2XA 5KFUA 1U1OA 1K73T 2BQRA 1KS2A 1S10A 2XMTA 1ZTWA 2DGWA 2MQNA 5DGBA 3UQSA 3DI6A 2NPFA 4CZCA 1HBMA 5T41A 4QPXA 2KG0A 4FPRA 4ID5A 5F8JA 2CQIA 4QR1A 3KKFA 1T3OA 4USJC 5D4LA 7FD1A 1U4BA 3QJLA 2BM0A 1MU2A 4NZ7A 1VQ4S 2BJDA 4KFBB 3LQVA 2M2BA 3QO9A