3T1HF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1hF00
4LFAF 4JI3F 1XMOF 2B7CB 2B7BB 4X65F 4DR3F 4LF4F 1XNRF 2UXDF 5LMUF 1J5EF 3T1YF 4X62F 4X64F 4DV6F 4LF5F 2KJVA 2UXCF 4JI0F 4JI4F 2VQFF 4JI8F 2UUCF 2F4VF 4DUYF 4GKJF 2J5AA 4JI1F 1CQNA 4DV4F 1IJEB 3ZZPA 1HR0F 5AJ3F 2BXJA 4NXNF 1N32F 4JI6F 2UUAF 4DV5F 1IBKF 4DUZF 5LMNF 4LF8F 4JI2F 1IBLF 4YY3F 4JYAF 1GH8A 4DR7F 4X66F 1F60B 3R3TA 1FJGF 2BVZA 4K0KF 4LF7F 1I94F 2YY3A 4GKKF 4DV0F 1LOUA 2VQEF 5BR8F 4DR6F 2UXBF 1G7CB 4DV2F 1N34F 4DV3F 1FKAF 1IJFB 4DR5F 2ZM6F 2E5LF 1IBMF 5IWAF 1HNWF 2KJWA 4NXMF 4DR2F 4DV1F 1XNQF 1HNXF 4KHPF 2RJZA 1G1XA 2UUBF 4B3MF 1HNZF 4OX9F 2HHHF 4LF6F 1RISA 2UU9F 1N33F 1QJHA 4B3RF 1CQMA 1VMBA 4DV7F 4DR1F 3OTOF 1B64A 4LFCF 1XMQF 4YHHF 4JV5F 4JI7F 4LFBF 4AQYF 4LF9F 4JI5F 3T1HF 4B3TF 1N36F 4DR4F 4B3SF
chains in the Genus database with same CATH superfamily
2CKWA 2HNDA 2MJNA 1TU0B 1Z1ZA 3IR6B 1YBTA 4RUCA 3LO3A 4RR5A 4B3OA 3FSXA 2OAUA 5F8IA 2HVIA 1S9EB 3DFEA 1BMQB 4RKUC 3H5XA 3GV8B 1RWMB 4BS2A 1Q78A 1P9YA 5KG7A 3K17A 1AYEA 3M6WA 1W7WA 1Q1KA 2LXFA 2GJIA 3H5UA 2B9WA 5G0RA 4I56A 3FCVA 2DXFA 4NXNJ 2JEGA 2QO3A 3J7Z5 3W3SA 1NJWA 1RE1B 1ZA1B 3IGNA 3CCSS 1YVFA 3HJVA 4PWDB 3LW5C 1N6QB 4WU3A 2M0GB 3IRXB 1LEOA 3HPOA 2DGWA 2LP4A 1RKJA 4D3GA 3T6JA 3J81Y 2HS4A 2ZD1A 3CJ3A 3UDCA 1WF2A 2OHDA 1WC0A 1LWXA 1VIOA 3Q8PB 4Q2MA 4A46A 5J2MB 4CNZA 3QRRA 4NLTA 2COLA 4G6VB 3BKTA 3ILLA 4DJBA 4UZCA 2PT0A 3AJDA 5K5MA 2HLUA 2C3YA 2JL9A 5L1IA 2PSZA 4PEOA 2QSFA 2LQJA 4J9SA 4QBUA 3VGUA 2CQ0A 2F4FA 2JEIA 2I9SA 2HK2A 3Q83A 5IV4A 2PMZD 1VBXA 1DHMA 4E2FB 3AD8C 4GKJJ 4IRDA 1P27B 5BYSA 2MHNA 1VRQC 2W9AA 4WU2A 3NGDA 2HHQA 2C22A 4KAIA 3CD7A 2CXEA 3GG0A 1NO8A 1YIJS 4UTGA 1AB8A 2P8IA 4DSLA 4DG1A 3M8ZA 2DNYA 5THWA 3RR8A 1Y10A 4Y0FA 4DR2J 2BJ1A 3KLHB 3LWLA 3M2VB 4ZLPA 2HVZA 1L3SA 2I5JB 4JI5J 5ETQA 4I2QA 1HBNB 3TARA 2D1CA 1AXQA 1GFWB 2PDAA 3CDEA 4AL7A 5EGYA 2UUWA 2FC8A 2C28A 3QIPA 4FNIA 4KV8A 4ZN3A 3M2UA 2K3KA 1WEYA 1JLFA 2DXDA 2JDJA 2C2OB 2EWHA 1EKSA 5D0EA 3OL7A 3CDUA 4C3LA 2XEXA 3G87A 2MKKA 1S10A 1TK8A 2KJWA 5CYJA 2FGCA 2RDDA 4KHPF 1YQHA 3KLEA 4WFBQ 1RT1A 3MGJA 1QUVA 3LH2S 2CQPA 2R9LA 3D68A 4PG4A 3D4JA 1OQ3A 2GHWA 2H65B 2HQ3A 2G0CA 2ZHAA 1WOOA 2HHHJ 2NXJA 5DDQC 3DYAA 1NXIA 4IH5A 3CNQP 3D1QA 5HJXA 3EJMA 2R42A 2FJDB 5F3ZA 1VOMA 4CLPA 1EP4B 1RWUA 2CQ1A 3VAMA 2CPHA 3M1VA 1HR0F 2QYGA 4YDXA 3DKDA 3T5LA 4L73A 1X60A 1VQKS 5FIIA 4YR0A 5JVHQ 3FZ2A 5RUBA 3HZEA 3TJ8A 2V5HG 2R4FA 3T6BA 1ZZFA 1OY8A 3ET6B 4R0JA 1RTJA 3NNCA 4U9RA 3ZZZA 3BSOA 2HURA 3DRXA 3E3XA 1RI7A 4O3SA 3BGFA 4DV0J 4RW9A 1H73A 2V4QA 1NSKL 3TO8A 3NMAA 1ZAWA 2WOMA 3GJQB 2QLFB 1T11A 3GWCA 3VR1A 4DR1F 4YFUA 5ETTA 3KJVA 4JI7F 4ED5A 4ZVSB 2IC3A 4M5LA 4P10A 2XY6A 1J5OB 1WORA 4CWBA 2C3OA 1U26A 3SDEA 2WCXA 4XIUA 2YWFA 3ZFVA 4ED1A 2PMHA 4RBUA 1MN7A 3D0IE 5AXMA 2BM1A 2QA2A 5B7WA 1VHFA 4CO5A 4J9UE 1UCNA 1IR1A 3QYYA 2IJRA 4MKYA 4RNHA 1IQTA 1RA6A 5D15A 1YJNS 1FJGF 1QAYA 2RRBA 4J9PA 3M6VA 4ED3A 3OLBA 2YQ0A 2HNZA 3PO4A 3KMQA 3GIJA 5KFCA 3A1YG 2VQFJ 1DRZA 1E6VA 3ZZYA 2J9DE 3I5AA 4MK7A 1HBOB 3PKMA 3C15A 3UD4P 4CLWA 4ZPVR 2YTCA 4ERDA 4JV0A 2IMOA 3H90A 2E7XA 3UCZP 2MKJA 5C7PA 1UTAA 2YX1A 3UVJB 5T7LA 4ZITA 2E1CA 2QZ8A 5DRKA 2FLNA 1IKWA 1RUSA 5B0EA 1VDHA 3CJQA 1Q81T 4OX7A 2CVIA 1MNEA 3KHHA 3UD3P 3I4PA 1K1QA 2ACYA 4TY9A 3AY0A 3B78A 3TW0A 4WFNQ 2VQEF 3KDNA 2W2OP 1OMSA 4QYZK 5BYQA 2LQ9A 4B3OB 3ISZA 2HHVA 3K5OA 1HHSA 1T9XA 1FDAA 1FTCA 5I3UA 1Y5NB 4DI6A 3OTBA 3OFFA 1WOPA 2RJZA 2DHHA 2QV6A 1RAFB 4WXWA 1RGVA 2RAQA 3M8QA 3CULA 1YBUA 5KOXA 1SH2A 5G0RB 3R9LA 2W2QP 2K06A 2A1BA 4Y34A 3VF0B 1IM6A 5B08A 1VK3A 2XMVA 2VG7A 2Q3PA 4L76A 3QGHA 2W8LA 1RXOB 5HP1A 4NLRA 1SC1B 3NLCA 2C1EB 1K73T 1UVIA 1UWAA 3CC4S 2YNIA 3U7JA 3UWTA 4DX5A 4DUZF 4Z7YA 1FJEB 4DR7F 2CG8A 4IFYA 4I2PB 1YJTA 4C0OC 4NYZA 3CJ4A 2AYGA 3TJAA 2XYGB 4JP8A 1QDUB 3H25A 2ZBQA 1T9TA 1AUSL 3BBCA 4MKBA 4IKAA 4P9SA 3C16A 6FD1A 1T7PA 4R5PB 2DH8A 4KR0B 2AEMA 3OFEA 4KHRA 4LF6F 3OQ2A 4DZ6A 2N3OA 1Y11A 4P75A 3G71S 3NGRA 4OZ3A 2ROPA 2AQ4A 4M5JA 4F36A 4CZCA 2NS1B 4W92B 2C2KB 2N4DA 2MMYA 1WJ9A 1K1SA 3CF5Q 4ES3A 4AYBD 4X64F 4RO0A 2KHDA 3H7HB 5MAOA 2POKA 3EE3A 5KT6A 4EBEA 4OHZA 3SSSA 5CABA 1URNA 2CQ4A 2ZH8A 1IVZA 5C42A 2Z4PA 4DG1B 5CYMB 3HKZD 4FBUA 3JQMA 3OTEA 1WUUA 3IS9A 3K2YA 3B4DA 1ZAVA 1NPPA 2AYMA 2BW7A 4GC6A 5HN0A 3O6QA 4GKKF 1KQSR 4MMOA 2P9EA 5HMXA 2VG6A 1SJQA 1O0PA 3DRRA 4TLQA 4I2QB 1B99A 2GAHC 2EI5A 4WF9Q 3DLEA 1U1QA 4MT1A 1RHUB 4BC9A 3QIPB 4KKOB 2AYEA 4KV8B 2G1HA 1SKSA 3M2UB 1JLFB 1UFWA 1S1XA 4LFAF 4NZ7A 3CIZA 4DV7J 5J1NA 2M5YA 2G1DA 4TY8A 4LR7A 3V4MA 4MFBA 3SYZA 2VFSA 5HVGA 1TQLA 2E29A 4RWXA 1ZA2B 3PJ9A 4PKDB 2CYYA 2A0FB 3KLEB 3KLVA 1RT1B 4OYBA 1T3NA 1KTVA 1NJYA 1HW9A 2AWZA 4N8OA 1ITPA 1TKTA 4FXWA 2G13A 4JI2F 3PX4A 3KYLA 2AJ0A 3A4TA 1SJ1A 1Y0HA 2RRNA 3DYAB 1RWVB 3N79A 2PA8D 4I64A 2XSFA 4TNOA 1I6JA 4YY3J 2F1FA 4O3PA 4DV3F 3AOBA 4X4NA 3PFOA 2VFUA 1X4GA 5KT3A 3M1VB 4USUA 1HNXF 3DXSX 2Q6CA 2N3LA 5ETOA 4PG6A 2XLJA 2VU5A 2YWWA 4MTPA 1RWOB 1EIYB 4LSLA 2ZFHA 4YHHF 1UPPA 4Q45A 2MZRA 2V2ZA 1RTJB 1WACA 3R7NB 1F3FA 4LIRA 4B3TJ 1R7IA 1V6HA 4RW9B 4Y2CA 3PJXA 4DPYA 2WOMB 3HD1A 5DG9A 3BGLA 1SB6A 1LK7A 3W5ZA 2JLGA 5CD4H 3KJVB 5BYRA 2N82B 4WP8A 2IC3B 2HRUA 1RT6A 2YNGA 4P7VA 1VC5A 3C66A 3SDEB 2PC6A 4LF2A 1H7WA 4DV2F 3L7OA 1C4CA 2HPUA 2D9PA 2W2NP 2DY1A 3AHPA 3T9ZA 3S1TA 1RT5B 3P49B 3U1MA 1PJ5A 1URRA 2BKOA 5U47A 3N28A 4Q7AA 4EWTA 1SJRA 4ZCKA 4I69A 2BW2A 4LREA 4LVOP 2RT3A 2QL5B 3FZBA 4MYTA 4KRWA 3MMCA 4EUVA 4DV1J 4K2XA 4WFYA 3KK2A 1ZETA 4BLGA 4K4YA 4OYMA 4XDCA 1ZH5A 2HNZB 4ECVA 5D8HB 1K47A 2DRBA 4KYZA 1E6VB 4CLUA 3MEKA 4DFPA 5C24A 2VH7A 2BABA 4DR4J 3C15B 1NK9A 1VQ5S 2SXLA 3ZZPA 1LW2A 2FDNA 2ASYA 4CIOA 2QRRA 2LCWA 5E7OB 2HSEB 3UN2A 5B0AA 1I1GA 5T7LB 3PW2A 2KU7A 3H8YA 3US5A 4ZVTB 3FCHA 3VAJA 1RABB 3OBIA 3UNGC 1IKWB 5F3TA 4F02A 1UAWA 1WG4A 1KC8T 1UWBA 3GILA 3QJLA 2FVPA 4JBCA 1GK8A 1IR2A 4PPZA 2V8HA 1HWUA 1VBZA 2FJXA 4J9QA 1Y5LB 1KP6A 1VC0A 2RILA 5KFLA 1AA1B 2O66A 3RW6A 2MQNA 5DZ7A 4QIFA 4ER8A 1KR4A 3ZTOA 1A7GE 1N5QA 2YKAA 3DLKA 5GMKa 3KFWX 2KG1A 4JOUA 4KE5A 4IQXA 2NPFA 3D7SB 4NEZA 5I3UB 4YMEA 3P5BP 1NK4A 3D1HA 2YWHA 1WKKA 4EBCA 3K7RA 3M8QB 1CJTA 5L1JA 1NPKA 2MGZA 4DUYJ 3CCLS 3LWMA 2MZ1A 2C42A 4OZ1A 2GGPA 3EWGA 2VG7B 3GYNA 3PYEA 2ZKUA 1Z2LA 2E5IA 4HDGA 1D9AA 1OYEA 2LVWA 4URGA 5HP1B 3NAIA 3BH6B 1MROA 3HSZA 2CQ3A 2F40A 3NAHA 5L8RC 2YNIB 3AQOA 3OTCA 4IFYB 1WD6A 2DITA 2B4UA 4J91A 3D5MA 4NE9C 3KLIA 4A8YA 1U45A 3PX6A 2KRBA 3NNHA 2HBYB 4NX9A 4NZ6A 3ULHA 3GE9A 3M32A 3PG9A 4PUOA 3TRGA 3C16B 1TUVA 4J37A 2ZJPQ 5KFOA 2OFGX 3CCTA 3DGVA 1ICEB 4ELTA 4X62J 1DTTA 4C8LA 1VC6A 3JSMA 1RTZA 3P8BB 1ZM3A 4A47A 2OEJA 4UQTA 5IQ6A 1H2VZ 4Y6IA 2PN6A 1IN0A 3CCES 3OW2R 4KIAA 3QJPA 3J7A1 1T9WA 2YH0A 3BBBA 2XMJA 1NPRA 4DBQA 1KVJA 2GCFA 3POTA 4NXMF 5C42B 3CO0P 3HCXA 3VTIA 4WJBA 4DR5J 1HNZF 4NLDA 3OL6A 1RISA 2CIMA 5D3GB 2XMAA 3QZ8A 1SC6A 3IS9B 2NQPA 2M8DB 1FWKA 3FQLA 4ZMMA 2HVDA 5KFXA 3WC2A 1X4EA 4OYIA 1HQUA 4DSKA 5CZVA 2ALYB 3ILIA 2VG6B 4UF4A 5B0CA 2IM2A 2XO6A 3PEHA 4FF2A 4LFBJ 3MM5A 2AF6A 1U1RA 1UMJA 4NZ0A 5M2RA 1XWLA 3DLEB 2JFKA 4OI2A 3IMQJ 4ECTA 4QZVB 4YR3A 3ZZRA 3TAPA 5DM6Q 3EXYA 1TKXA 4C98A 4NXNF 4TU9A 3A3OB 5M2UA 2YQ3A 4O4RA 3Q8YA 3K58A 1LQ9A 5F8NA 2IRUA 1S9GA 1WF1A 4C0HA 1LWEA 4F4AA 3QAEA 3G86A 4TY8B 1VQ9S 4F26A 2KXFA 5CD4A 2HFNA 2Z8QA 3M9OB 1HI0P 1CJUA 1JLQA 4Y2MA 2GIQA 3VVUA 2GJFA 2J9DA 2NXUA 3EYZA 3Q2SC 4UUWA 3CCQS 3EZ5A 4Z2XA 1V5VA 5LT5A 4J9MA 1R89A 1TKTB 2CQBA 4ECSA 3OHAA 3TA0A 2VFTA 5KFYA 2PFDA 1RU2A 2OP5A 1JB0C 1RQ0A 1UL3A 2PIIA 2KZMA 3GPAA 2OIHA 1MW7A 3L09A 1F3VA 1XJWB 1FI4A 5JXSA 1WWHA 1U2CA 3CWJA 3FMWA 1D9DA 1KKHA 2XO7A 1YJVA 1S6OA 4LVNP 4DF8A 3MR3A 4CT9A 3RTVA 4GKJF 3AAWB 1Q8LA 2AX1A 1U8SA 2H5JB 1Q7YT 4CT8A 1KFSA 4WCEQ 3Q8UA 4LSLB 1OYDA 2F4VJ 4M63A 2X1BA 1S0MA 3C6UA 4WBFA 3CCWA 2EG2A 1NB7A 2QE5A 3N6MA 4ZVFA 5KFKA 3VGSA 1IQZA 3CJKA 2XZWA 4I68A 2CZVC 4IFVA 1S5ZA 5AE3A 4ZVEA 2V2KA 2CFXA 3HVAA 4OYAA 4DR2F 1DLOA 2QIFA 5CAAA 2EW9A 3CT9A 3TUJC 2CDQA 5D4OA 2DH9A 8AT1B 2XLKA 3Q0AA 2R8GA 4BBYA 4JI5F 1RT6B 2YNGB 4F8RA 2HQGA 1NDPA 4B3RJ 1HNVA 2ZVIA 3H5SA 2KRRA 5ETSA 1S9FA 2DGTA 1IBMJ 4UOFA 1FJCA 1OY9A 4A8XA 5HQMA 4O23A 3GFXA 1RKIA 3FCWA 4Y00A 2RKIA 4UOHA 2AV5A 2AJ2A 2IM3A 3R5GA 4CH7A 3DCAA 1DQAA 3MMCB 2UUCJ 3MF5A 2IIHA 2DXEA 3KK2B 1QSYA 1IR0A 3I0SA 5AJ3J 3CCVS 3M7VA 4J9LA 4OZ0A 4ZS6A 5K8MA 2DNHA 4L72B 1IBLJ 3HKWA 3KUHA 1WSRA 1FK9A 2X51A 2LEBA 1RAAB 2ZH3A 3HHLC 5BR8J 1LW2B 3PRDA 2J9EA 1GNKA 2HNYB 4OZ2A 2ZUGA 5KFGA 2HHHF 2MPUA 2KTQA 2RDJA 1X9WA 1UFKA 4RPFA 3JB9k 1HQ2A 2L9WA 1S59A 3M8WA 2UUBJ 2VKRA 3NGSA 3W7BA 4NWBA 1RJJA 2Q1LA 2BDPA 1UWBB 1FE4A 3GB0A 1H74A 2C2DA 2AYBA 5HJYA 4USJC 2PEHA 3VQTA 4X65J 1D0EA 4DPXA 1NK7A 2B9XA 3GIKA 2VOOA 3A8IA 2EC0A 3M9MB 3BV8A 4DPWA 1H72C 2UVUA 3GFZA 3OFGA 1F5BA 2E66A 1IWAA 3DLKB 2ILYA 4XK8C 3NNAA 2HFVA 3R5BA 1K9MT 2B4VA 4FYDA 4Q0BB 3A3PB 3GP9A 4DV0F 1UEVA 4DV5J 2XBPA 3W2WA 2BMBA 4IR9A 5GAHI 1YRUA 1NDCA 4EYIB 4NCAA 2MYFA 3W61A 4HDHA 3ZC4A 3ILOA 1U6ZA 3L7UA 3NS6A 1F5CA 1C1CA 1YITS 4ZP9A 1CJTB 4RLEA 2MGZB 3TEHB 3TAQA 4IQMA 1N5TA 4USWA 1HWLA 5AXNA 1SJFA 1PIEA 1EX8A 1FWLA 3D6FB 4O3NA 3MWBA 2H48B 3FBEA 2GGPB 4ED2A 2LA4A 1BQNA 1CC7A 1IBCB 2B6AA 5FLXU 3X3UA 2IJNA 1KBRA 5M2PA 4IO9Q 1MROB 2Z56B 4ELVA 1PC4A 2RD5C 1ULRA 2LFVA 1K0VA 3WC0A 5EX3A 1RDRA 2IRXA 4K4SA 1L3UA 1O51A 1K0TA 4NLVA 5LSRA 3TVKA 1RBLA 1DFDA 1S0NA 1JJ2R 3M32B 3D9BA 3W5YA 4PUOB 1WEXA 2FHOB 4X66J 3C6TA 2W9CA 4F3MA 5C25B 3M8PA 4LF7J 3B6BA 4YB1P 3D28A 1X5TA 1HIYA 1N54B 1XERA 2DK2A 4ZHRA 1WEZA 1DTTB 4OJ3A 4P2FA 3LAMA 2ZJQQ 3JSMB 5F8LA 3QFHA 2AKWB 1SQGA 1NK8A 1XMQF 1XN9A 1UVLA 4ZPWR 2GV1A 1GMWD 1S6PA 1I3OB 3QRPA 1WHWA 2W7PA 3RR7A 1Y00A 1V9OA 3POTB 1M5KC 2C2RA 4H54A 4OJHA 2WVFA 3K0JA 1XNRJ 4OZNA 1GXLA 3DU6A 5KFZA 4RUBA 5J2QA 4UY8T 3Q8RB 3MM6A 3MDFA 4PXDA 1HQUB 2OH2A 2LQ8A 2HS3A 4K5SA 3PO5A 1RCXB 4DL2A 3MM5B 1GQEA 2B9YA 3D6HB 3MI7X 2HW3A 1H6KX 4ZVHA 1F1BB 4Z37A 2B9EA 3NY0A 1TKXB 5LJ5Y 4LR9A 4HVZA 3J7AN 1NK5A 2OPPB 3PTWA 2DRDA 1NH7A 2ZWPA 2P5VA 1LWEB 2QT7A 2V4JA 1ZTTA 4DHVA 1RTDA 1ZM9A 1T9YA 3S01A 3T5JA 1KN6A 2V69A 1D9FA 1CJUB 3IFEA 1MWZA 2JC0A 1N36J 1FNMA 3W5XA 4QIWD 1Q95G 2W2PP 1VJQA 2AP6A 5A76A 1O6XA 2E9ZA 1SKWA 3OUYA 1T8EA 4C7QA 3V81B 5A2QU 2RHQB 1CS4A 2GVZB 2DR6A 3R2CJ 3RBDA 1T3OA 3KHLA 4OL8A 4U8VA 1VQ4S 1RLDA 4F4WA 2AJQA 4CO3A 3A8KA 2XHCA 2OGUA 2BE2A 1BHNA 2YNFA 2MDAA 3BO3A 5KFBA 4OLOA 3AA9A 4EO8A 2KH9A 1QE1A 1SPBP 1GTEA 4QW9A 5D4PA 2X3GA 4DXLA 3R7SB 2OSQA 2Y1RI 1JXEA 3JTNA 2BQUA 2YBVA 2J6TA 4RU9A 5J1PA 3EGNA 2K8GA 2VODA 4DCPB 3RUBL 5IOLA 3CJKB 1P1LA 5JUMA 2N7YA 4DLGA 3RBEA 4IFVB 1UVMA 3Q89A 2GQCA 4WFXA 5AXLA 2R8HA 3T1HJ 2NYHA 2DISA 2AGOA 1XMOJ 1KOHA 5KG6A 5L39A 4DR3J 3QBCA 2Z57B 2DRAA 4NLOA 3FBFA 2OJ3A 4PXBA 3GV5B 3DRYA 1FXRA 3KK3A 4USIA 3CCJS 1ROFA 4B9MA 2VBXA 2Q66A 2BEFA 2ADCA 1HNVB 3H2UB 2AU0A 4HEA9 3AFGA 2Y9HA 3MPDA 4RW7A 3MXHP 1T95A 4FYVB 3KJFB 3RJMB 2LEAA 1JJCB 2B8PA 3IWXA 2F8HA 4K4XA 2VG5A 1UP1A 1GTHA 4Y28C 5JVGQ 3TZXA 2RKIB 4CH0S 3S7RA 3RYLA 1NDLA 1N34J 1RWNB 4DV7F 5J2PA 4G1QA 2L9NA 3VWSA 5T41A 3I0SB 4LRDA 1IKYA 3CCUS 1TTHB 4DR6J 3LOUA 5E41A 2HQDA 4HACA 2ZH7A 3MAAA 2MQQA 1FK9B 5IQQA 5K8OA 2GA7A 3D0GE 1FXLA 3PXGa 1SIZA 3CDWA 3G6VA 5B0DA 1RTIB 1KS2A 4ZPBA 4ZIVA 4EYHB 4Y65A 2CJ9A 3LA0A 4YY3F 2GS8A 3ONQA 3MUTP 3QJJA 3AA8A 4FYWB 1H98A 2L08A 2DR8A 2WVDA 5SUHA 1KLNA 1UVNA 4TU8A 3EDRB 3O3LA 2P9CA 4ANCA 2QTWA 4LMZA 1HMVA 2P6SA 2VDIA 2X7IA 9RUBA 4CDIA 4WTOB 3P4UB 1Q8KA 1OSDA 1JKHA 2IBKA 2FUG9 4E98A 4B3TF 2CQDA 4I1TA 2HK3A 3CEDA 2OMLA 3K8WA 4WKRA 1S7IA 3W2WB 1B0PA 3DHXA 3EXCX 3CD0A 1WNEA 4QIEA 3R5AA 4ZPCA 3RAQA 2V8VA 3G9CA 2JLFA 2HZCA 1ZS6A 1C1CB 2BV3A 4DSFA 3KK1A 1UZDA 5FLXY 3AB2B 2CADA 3Q23A 4FNHA 2UVRA 3DRPA 3Q8SB 2VZ9A 2HQFA 2K7JA 4JI8J 2A2DA 2J6SA 4K5RA 3J81U 2CWKA 3K5MA 1JJHA 2CWXA 3BSCA 2FLLA 1AFJA 1BQNB 2E1MC 2E9TA 2B6AB 4KQZA 3PW7A 1DARA 3MFHA 2YWGA 2EPIA 1FESA 3MAHA 1OIAA 3EVOA 1GMWA 3BPSP 4DV1F 2B43A 3TX0A 4F2RA 4DN9A 3TVZA 1N33F 4ZJOA 2ZH9A 3B4MA 5DJBA 3D66A 4GVLA 1FT8A 5D78A 1XNQJ 4DR4F 1TKZA 4U7UK 2FB0A 3HT3A 2CJAA 3C6TB 1LWFB 1X5PA 3M8PB 5AXKA 2DGOA 2PA3A 2W4PA 4ZHRB 5GAGI 2R7VA 1XEZA 3N0VA 2J7UA 2MKIA 3IXQA 1FXDA 4Y2IA 2KXHA 1S6PB 5L46A 2G0JA 3SIPB 4ENOA 2GW8A 1T9UA 5E3CA 1TL1A 3OVBA 3GCXP 2AT1B 2NXCA 2DNPA 1R8BA 4ZP6A 4PQUA 5KFEA 1L3TA 4NYOA 2FVRA 1SC3B 3EPGA 4ICLA 5J2QB 3TUPA 2LQ5A 2CQ2A 3MM6B 2P2CB 3NGUA 1SC4B 3KLFB 3EGWB 4X4UA 1JJ4A 1A6LA 4NLPA 2FVQA 1K8AT 5GVQA 4WPAA 3NGTA 2DEIA 4DSEA 2Y3YA 3H0PA 4LBHA 2O5DA 2VC1A 2RRAA 3VAHA 2OEMA 4UQGA 2XQCA 4DX8H 4DU7A 1HKAA 5BJRA 2XHWA 1YRTA 4DUYF 4USTA 3I4HX 2M70A 2XC9A 2QGFB 4UOGA 3HHDA 4F4KA 2Z58B 2R8KA 1B7YB 4NYPA 3T9NA 2XWYA 5A2QY 3BB5A 2V4JB 1RTDB 4ZIWA 4X4SA 3NCQA 4HHHA 3MR7A 1FFSB 5A0YA 7FDRA 3HX9A 4EZ6A 4I6AA 5IT4A 2M3DA 1VQLS 3T3FA 3QT8A 1I94J 2M9KA 1RK8A 3NOCA 2WSEC 5J2NA 4QPTA 4J9VA 2ZVSA 3OUYB 3KNAA 3IG1A 1CS4B 3W8PA 3MEEA 1NJXA 2FJEB 1VRTA 4F67A 4Q8EA 4FYYB 3TJ9A 1Y5IB 2Z0GA 2IHR1 3JTOA 3LALA 4O4GA 3EZOA 2RQCA 4QR0A 2CNNB 1VLOA 4CO2A 2NR0A 1WHVA 5D6GA 3AQPA 2YNFB 4ETXA 1HBUA 3BQ1A 4X62F 3TP2A 3HXMA 1RAJA 1FX2A 1QE1B 3UN5A 2LECA 1NKBA 6FDRA 4F25A 1PILA 1FF2A 1WOSA 3VZIA 2DGXA 3LQVA 4XDDA 3MUVP 2HFZA 1RB0A 1BUXA 4JV2A 2GX8A 1U8WA 3BPDA 1NMEB 2YY3A 1PG5B 3QLHB 4QWCA 1NCLA 5IV3A 3CJ5A 3PYFA 4DR5F 1EHWA 2ABYA 4EI2A 4OHWA 1KHVA 3HK2A 1HW8A 4C8YA 1VQSA 2F7VA 4HHJA 3HJFA 3KK3B 2HFUA 4PR6A 5EUHA 4LFBF 5A8WA 4FVMA 2OELA 2JSXA 1M0SA 4LBIA 4TXSA 3W64A 4RW7B 1VQ8S 5JJBA 4DQSA 3FGVA 2VG5B 4ZLJA 5IC4B 3TI0A 4DL5A 5F9LA 4MKAA 1U24A 3KOAA 1ELOA 5E33A 1MMLA 3NWGA 3G6XA 3B82A 3EUNA 3VHQA 3DXBA 4G1QB 4OI6A 1IKYB 3PYDA 2EK1A 2QJ3A 2XMUA 4MIBA 3BQ2A 3KJQB 2HBZB 4F4XA 1RYSA 2XMKA 1UPMB 4HACB 1RSCA 4TVAB 2BZ2A 3NG8A 3MAAB 4ES1A 5DQGA 3HMJG 1YDLA 1SQEA 4M94A 2H4WB 2VUGA 3H42A 3C3LA 2BANA 3GONA 1UKUA 1EQMA 2LXIA 3BYRA 2OTJS 4QU6A 4GRSA 4WFAQ 1HPZB 1C0UB 2HAFA 5DLGA 1VQNS 2UU9J 5G4DA 3JQKA 5KFPA 4IRCA 5HL7Q 3CCMS 2A6MA 4FS1A 3G6ES 2VICA 2NUUG 1HMVB 5E3QA 4DDFA 2ZE2A 2F4VF 3IAS9 2BBEA 3OSPA 1JKHB 5HMWA 4USVA 3DLJA 1NEEA 3R5JB 2L9DA 4X84A 4DEZA 4DCJB 2DNGA 2ZH4A 5HAOA 1X4CA 1TUWA 1VQYA 1QAJA 2I1RA 1MU2B 5KT2A 2C2NA 5DGBA 1YWXA 2WHOA 4YP3A 1Y3JA 4J9OA 2MLXA 3IWNC 3TNVA 1S1TA 4UW2A 3KK1B 3AB4B 3I5BA 2D74B 1FDNA 3VCDA 5LSOA 4QWAA 3JSRA 3GJTB 3R5DA 1DQ9A 2DIVA 4KBIA 1S4FA 2VA3A 4LIWA 4B3RF 2CJKA 2O67A 5LM7E 3FEXB 3HVTA 3K5NA 1HD1A 3O8WA 3EGVA 4K50A 1RT2A 2FYXA 2VKZG 3TZZA 4RU2A 5F0WA 1U7LA 3D2WA 4OQJA 2EC2A 2IYIA 2E9RX 3JYTA 2JVOA 3ISND 3IM8A 3NRBA 1DTQA 3A3NB 2UUCF 3TOQA 4DS5A 1X4DA 5AJ3F 2YKMB 3PEJA 2ROGA 2A2CA 2LA6A 4PG7A 4OJ1A 1RTHA 5KFWA 1YI2S 3PIPQ 1IBLF 4Z7CA 3Q24A 1SV5A 2ZH2A 2XNQA 3MCNA 3QRQA 5BR8F 3MTKA 1XIQA 2D9OA 3ETOA 2FC9A 2WONB 3ADAC 4NL5A 3L4BC 2BQ3A 4GVBA 2VPXB 4IDKA 4CO1A 4M5KA 2BOPA 2VPWB 4DS4A 2RNEA 4IH7A 2UUBF 1RHRB 3T5HA 2XB2D 2XI2A 3GIMA 2XS2A 4AL5A 3RRHA 4A8MP 2QL9B 1REGX 1CVJA 2MZJA 4UUXA 2EKNA 1TL1B 2YWKA 3IP0A 4X65F 1VHIA 1VS3A 2NZ4A 1NZAA 4TN2A 4ZVUB 4PQUB 4IRKA 4XPCA 4YB5A 3PHEA 4ICLB 5MLCV 5AE1A 2ZC3A 1WKJA 1TUGB 1ZOTA 5KT7A 1VCTA 4KHMA 2ZHOA 1HA1A 3RB4A 1TAUA 1U2FA 4DV5F 1UFLA 2X1GA 1S0VA 2MZQA 3ENVA 2YWEA 2QMWA 1T0TV 1CG2A 3BF4A 6AT1B 4F3OA 1X4FA 3TA1A 3OL9A 2AHOB 3PM9A 3AH6A 3SV3A 2HEKA 3SQOP 4TLRA 2VPYB 5CCLA 4F3QA 3J7ZT 1Q82T 4AXIA 3MUMP 3DDNA 1RT7A 4MJKA 1MMDA 3K59A 1Q0NA 3QMQA 4OX9J 4ILRA 4A48A 5A0YB 1U6FA 5KFFA 3PV8A 3IN5A 2DVIA 1BWVA 1VYAA 4QOTA 3OD2A 4CLZA 3LPEA 4BC7A 4KC5A 4CQ1A 5J2NB 3LP1A 4OZ5A 3IG1B 2OEKA 2CNOB 2UP1A 2XMTA 4C0BA 3NMRA 1E6YA 3MEEB 1WF0A 1Y4ZB 2U2FA 1KDNA 1VRTB 1TZ0A 3CE8A 1A0OB 3N4WA 2Y1LB 4NLSA 1MWYA 1NKCA 4X66F 4O4GB 2OPRA 4USHA 5DZ6A 4LF7F 3OVAA 3CJRA 3VAIA 4NA2A 1LW0A 1S6UA 3TUZC 4NEYA 3KNGA 2R8JA 1WC1A 2HZVA 4CCHA 1LWCA 3I32A 1JLAB 2KXNB 1L5UA 1H2UX 3OJSA 1IXKA 3HT0A 2K1RA 4AD6A 4Q5VA 1B64A 1AZSA 1KWMA 2IAJA 1R8AA 2LXUA 1PBAA 1WG5A 4C8KA 2LLZA 1M90T 1RHJB 3HHLD 5LOQA 3OTOJ 4YB6A 2JHEA 3HFVA 1XNRF 4DSJA 1R43A 1RHMB 4ED8A 1H7XA 2DEJA 3CSKA 3HZGA 2HIQA 3UR3C 3MTJA 3Q2TC 4KFBA 4NI2A 5KG0A 2QC3A 5EN1A 1ZM2A 5KFJA 4F0MA 2OLWA 5A8WB 2YX4A 4D3HA 1XR6A 1VBKA 3MOJB 3ELHA 2NXNA 2CA9A 4WZQA 2R3VA 2BE9B 4WP3A 3MD1A 4CP5A 2B56A 2HWHA 4AXJA 4ATNA 3K57A 4ITSA 1FE0A 1RACB 5D77A 3WQPA 3WX8A 2NREA 2MZSA 3UR0A 4ZOSA 2E1PA 2G9OA 4K4WA 1N4LA 1N36F 4C8OA 5KG5A 4L74A 4I4BA 4GC7A 4IYQA 3W9HA 3MURP 3JTPA 1F5AA 1TK0A 3JS9A 3KUGA 3RBZA 2BANB 2VBYA 2HNDB 4IUFA 1CEZA 2XY5A 1RHQB 2E7VA 4ETZA 2R7RA 3GR1A 1HWKA 5AT1B 1RYRA 3R3TA 1IKXA 5IZHA 1NSPA 2UUAJ 5LMNJ 4ZKAA 4LF8J 4JYAJ 1R3NA 2EBEA 3E2EA 2HHXA 4NMLA 1G3OA 4LQ9A 2ZE2B 1VQ6S 3BSAA 4OYXA 1OY6A 2WRMA 1EARA 3BR8A 3BBFA 4MKVA 1TKDA 1NAQA 3V6DA 4RX6A 3QT7A 3ZZTA 2VL1A 3WBZA 3TANA 4RZRA 4FBTA 3PX0A 4DFMA 1Q86T 3T1HF 2H1YA 1NB2A 2GAGC 3VAKA 2CDRB 1HQEA 1XMOF 4DR3F 2ZD1B 5CQGA 5KFHA 2KO1A 4ED6A 4MIWA 1S1TB 1SKUB 3VAFA 3IWLA 3I9ZA 1B7FA 2D3OR 2ACMA 3P5TL 2Z2YB 5HANA 1M5HA 1UJ5A 2KN4A 1FERA 2R7XA 3G8SA 3HVTB 2J0SD 1NRKA 2WZ1A 1F60B 1HD0A 2HWIA 1RT2B 2W8KA 3KG1A 4RNMA 1R0AA 3V2UC 2ZDOA 4TYBA 1IKVA 3HLUA 1N34F 3H20A 3JYTB 2V68A 1DTQB 2GIRA 1UW9A 2W4DA 4RJVA 2BJDA 1S99A 4FVCA 3J7YI 4DL3A 2LEPA 1RTHB 4LBPA 4U6PA 1PJ6A 2VPZB 3UN3A 2ATCB 2HGMA 1SV5B 1U1PA 5DS7A 2EFVA 1KTQA 3I82A 3MPWA 4B3MJ 3IBCB 1WI6A 2BM0A 3KG0A 2W9BA 1S12A 5H9EJ 4LFCJ 1RWPB 4ZA1A 2E5JA 4GVBB 4IDKB 3L9ZA 2MKYA 4RNFA 3EDQB 1KHWA 3JSYA 2LKZA 5B09A 4FKXA 3EGZA 1FDDA 5FDLA 2AJ4A 5D0RA 3S6EA 1KNZA 2RQ4A 3GJSB 3PACA 4A8SA 3NCPA 1NKEA 1FRMA 2W7AA 3WDOA 4ZPTR 2VA2A 1S0OA 2HRYA 3RG6A 1S76D 3W66A 4JI6J 4HI1A 4OYWA 2RU9A 4URSA 2MQPA 4K7QA 1R8HA 4P7TA 4K2JA 4OV1A 2OSRA 1WC5A 1IWGA 3PR5B 2RF2A 1CJKA 4NPOA 4DQPA 4P74A 2J0QD 1W25A 4V1Ak 5A6WA 2EFNA 4CH1A 2KM8C 2MEWA 5IS2A 4USMA 2XNRA 3D6TB 1S6QA 1ZAXA 3M9NB 1Q8IA 2LU1A 4MIAA 1REVA 1S77D 2C2ZB 2K7KA 3DOLA 1MLAA 2QMUB 3AD9C 2EEYA 4G1IA 1YLXA 1QAIA 2I0XA 4PCQA 2XLIA 4LF9J 1C0TA 3CO9A 4Y3CA 5FJ4A 1BQMA 4JI8F 1RBAA 1BGXT 4FF1A 3GU0A 5LMUJ 2DGUA 2J6UA 4NA1A 5E3PA 1WI8A 1ZTWA 3OHBA 1M5SA 3NL0A 3VVTA 5GMEA 3RRKA 4JI0J 2RE1A 1RT7B 5DQIA 4I67A 2DD8S 2YPZA 1PBUA 1U49A 3F0NA 3R6GB 1CSJA 1NSAA 1VR6A 2JZ5A 1Q5VA 2LQBA 4RWWA 2IYGA 4HYKA 1VK8A 3NP5A 3KWMA 3ZZUA 3MHYA 1GMVA 3UPFA 3LP1B 4X4QA 3K89A 1E6YB 3D3BJ 1CJVA 1XNQF 2HHUA 3HHLA 5KFMA 2DTJA 1HNWJ 2ZH1A 5D4NA 2EVZA 3FK4A 2L41A 1N8RT 2OD6A 2IFXA 2OPRB 3SFGA 2AD9A 1WHYA 3BO2A 1LW0B 1SH3A 2GC8A 2IM0A 3GJRB 2N4CA 1LWCB 3LP2A 5GAEI 2FTRA 2Y1JA 2NSCA 2VJVA 4WYWA 1DBDA 1RAEB 4ANEA 2R7SA 1LK5A 3QAUA 2MZTA 1QUPA 2HHWA 5LXRA 2MQLA 3I0RA 2K1RB 2M8HA 3NGKA 5EWEA 1AZSB 2GJ2A 3GFHA 2IAJB 3IGVA 1XBWA 2LMIA 4WP9A 2DNOA 4DQRA 5K8PA 4PG5A 2GMHA 3R27A 4B9TA 3N5BA 3DU5A 2ADBA 4ES2A 3EX7B 1WC6A 3RBXA 4O0NA 2NLWA 4HH0A 2Y8WA 2XMMA 4JB8B 2E1AA 4KFBB 1Q79A 3CDAA 5K14A 1TV6A 2UXBJ 3W62A 4HHUA 2KFZA 1FTRA 8RUCA 1XR5A 5KFVA 1R8CA 3JSBA 4TKTA 2R2SA 3H2VE 2YVSA 3KKFA 4B9NA 1J27A 2F9JA 1X0PA 3OPKA 3TUIC 4OFZA 3FMBA 2RHSB 1BY9A 2IVMA 3IR5B 1NSQA 1QSLA 4TYAA 1RAOA 4KH1B 2FGOA 3C46A 4H4KC 2HRTA 5HSPA 1EZZB 2IBOA 4FXVA 1M1HA 2DR5A 1GXTA 5HROA 4URQU 2ZOGA 3VV2B 3DI6A 3BGUA 2W24A 1I5OB 4LSZB 4DUTA 1N5SA 2GQQA 1LKZA 2Y8YA 3MMAA 2DNLA 1I94F 3V6KA 3I56S 1B0VA 3SZ2A 4KO0A 2LU2A 1JMTA 1SCJB 4NLXA 4V19J 4CLYA 3QO9A 4KB7A 4ZPAA 5KAKA 1SL0A 4ED7A 4F7VA 1GX5A 4HH1A 2C3UA 2L3MA 4LSNA 5K9FA 2WTFA 4HKQA 1IKXB 4UT4A 2HMIA 2QX0A 1GMUA 4WK3A 3D6MB 2D3UA 2JEJA 5B0FA 2V9WA 1UEUA 5DG7A 2E5GA 3W1YC 3V6DB 3OSNA 3O2IA 2HHSA 2EFGA 1NZ8A 4I2PA 2BJEA 1F2GA 3ENQA 4KPYA 5FD1A 2BJ9A 4QWDA 4C4WA 1R6YA 2OFHX 3EZUA 4PWUA 1Y7PA 2F9DA 3NS7B 1ZM4A 1HQEB 4M5NA 4R5PA 3MOZA 1N32J 1JLCA 1PC5A 2A10A 4OMFG 1IBKJ 1RWKB 2GMJA 3R1LA 3N5FA 3BYPA 2DNKA 2FJWA 1M1GA 1FCAA 4YR2A 3OLAA 2DGVA 4FF3A 5J1EA 1NH8A 2MQMA 4OZLA 2DR7A 2YQ1A 1LFWA 4ELUA 1YTYA 1QM9A 4OV6A 5IFMA 3HULA 1XR7A 3MM7A 2CZ9A 3HVRA 1PYOB 2MSTA 3A8EA 2DGSA 1FNXH 4QCLA 1PKUA 2OI2A 1R0AB 2JC1A 3SEOA 4WK1A 3I5CA 1IKVB 2B7CB 2UV8A 4X4OA 2Z2ZA 1U47A 5CYMA 4YS2A 1EJ7L 1M1KT 1KSPA 4B3SJ 2V8DA 1YJ9S 1KLMA 3LGMA 1NHUA 2EKYA 2HVEA 4N47A 3ZNUA 5KFAA 4HTIA 3ZZOA 1FDBA 2HG4A 1AW0A 4AUKA 3RB6A 3OR2A 4ZCLA 2X3DA 2PMWA 2W9BB 2ZH5A 2VV5A 4C97A 1VGYA 2GQ2A 5F8JA 1UA1A 4NLUA 1IJFB 2ZEJA 3BREA 4F4ZA 1S72S 4WIQA 4P72A 2RUSA 4IG0A 5F41A 4KKOA 5FDLB 5ETVA 4WTYA 2RS2A 1X9MA 4Q8FA 2G2ZA 2ZBPA 4HT7A 3DHWC 1CULA 3DRRB 4MYUA 1RBOB 4DL0C 5KTQA 1RCOB 2K3IA 1P1TA 2UU9F 3UI3A 5CA5A 2DO0A 2XTJP 1R0CB 3DDKA 3CCZA 2IJFA 1SUQA 1WSVA 3SFUA 1NLKL 3HP6A 3VALA 3RB0A 1Z2ZA 2UZAA 4ZN1A 1P8GA 2V67A 1F2HA 1SJ4P 2O3DA 5IXUA 2RF2B 5F0UA 4K4ZA 1A9NB 1CJKB 2DNNA 5HBMA 2YKNA 3NOGA 4DF4A 1S1XB 2PE8A 2WW8A 2IDEA 3GQCA 2BOAA 3EPIA 1YBAA 4ILLA 4GO5X 4MFBB 2BXJA 1S6QB 4QWBA 3H40A 3HSJA 3K5LA 1REVB 5ADZA 5D0GA 5CCMA 3DOLB 1N5YA 2VDHA 3CUNA 3SMZA 1GT8A 1PO6A 1YK9A 4DMZA 3OFHA 4L6V3 4A8QA 2QA4G 1C0TB 1SL2A 3F44A 3PCOB 1HFEL 1BQMB 2G4BA 1KQGB 3D3CJ 2BKPA 3D54A 2GIFA 2W01A 2CNKB 4AFFA 1CC8A 3ETMA 4U8YA 3ZO7A 5C2GA 3I31A 3ILJA 3MEGA 1F6TA 1TFYA 3FUYA 3BKUA 1D8ZA 4CLTA 2VC0A 2VOPA 2V9KA 2AEJA 4ECYA 1Y9OA 3N9UC 1QSSA 2CQGA 2QLJB 2JH3A 4XO0A 2VF3A 1LXJA 4P71A 3BKFA 4N7TA 3BR9A 4EZ9A 2R2TA 2DBBA 2LYVA 5ETKA 4XTTA 1KFDA 3AOAA 4B08A 2IY5B 3DMJA 3RZAA 1CJVB 4LF4J 2OO4A 3QWUA 3HHLB 2MHEA 3LGHA 3O1LA 5CYQA 2QA1A 2D41A 2HS0A 4NLQA 4ECRA 4DV6J 5EWFA 3GSDA 3FDSA 1WKLA 2FQQB 2ZZTA 1HLWA 1FRIA 3UQSA 2IVFB 2JLEA 4O3RA 3SQGA 2AJFE 2J0XA 4NRTA 2VB6A 3LP2B 1RT5A 3HVWA 2M2BA 3MECA 2XYPB 2VFRA 3GV7B 1QTMA 1VJWA 1Y3KA 4NCGA 4N8NA 3OR1A 5C2CA 4IR1A 4KGZB 2A18A 3I0RB 4PYDA 3VGTA 2XM3A 5HLFA 1AT1B 1AUDA 4LRCA 2DYAA 2MKCA 2FPHX 1P9QC 2AZ1A 4ED0A 2GFFA 4OI3A 1R0BG 2BJ3A 3JXOA 3EMTA 1SJ3P 1BQXA 3P3DA 1RAGB 3QT5A 1X9SA 3IRWP 1H2TZ 4QYZJ 4EFAC 3K5PA 3L3CA 1CPZA 4CLSA 2XMWA 4JI3J 5K14B 1TV6B 3R2DJ 1QY7A 3MEDA 1RHKB 3J81j 1AROP 2UXDJ 4DCOB 4JUZA 2ZNYA 2ZWOA 1N5VA 1SIWB 3CXCR 5C24B 1XMQJ 4WIIA 1FEEA 4R8UA 2MQ8A 3TVYA 4IO1A 4PZVA 4N5SA 5HK4A 5LJ3Y 5GADI 2ERRA 1S57A 2MB0B 3QSYB 3BEGB 3K8VA 1TAQA 1N0VC 1U6BA 4ID5A 3F56A 1U1MA 4N76A 1GX6A 3CB4A 5HROB 2VONA 3DI6B 4KT0C 4OX9F 2IPOB 2MJUA 2DGQA 5ETNA 1LNQA 4HLBA 4M5HA 3UDEA 5HMZA 5I42A 4U95A 1XTZA 4LRBA 3MMAB 2V0NA 2N7CA 1BXNA 2V34A 4KO0B 5KG1A 3KUEA 4QU7A 3CMQA 3H98A 1N48A 1WTBA 3QO9B 3W63A 2IMWP 4B17A 1Q53A 1U02A 2B5JA 4PWWA 4ZP8A 4HL9A 3ICLA 5JMNA 4M5MA 4HI2A 3OXFA 4LSNB 2CPDA 2KHCA 2XCPA 2BJ7A 4KPCA 2BKNA 2ZH6A 2G2YA 2HMIB 3UNYA 1PYTA 2LDIA 1YX2A 8ATCB 1MSWD 2M88A 4L3NA 1APSA 1N88A 2H3EB 4OHXA 5KT4A 3CMAS 2DHAA 4ZVGA 3BM7A 4C3KA 1TFWA 4WXOA 3BN4A 2EBGA 4RNNA 3IM9A 2O1PA 3OTOF 1TL3A 1JNZB 1RT3A 3WHIA 3M4XA 4DSIA 2CVEA 4IH6A 1JLCB 1XC9A 2DO4A 3LAKA 4OJGA 3Q8VA 4LR8A 2VBWA 3UO0A 1TL7A 1RAHB 5L38A 1X31C 1G6BA 2BRLA 1JIHA 4Q43A 5J1EB 2DB1A 3KLIB 2VQFF 4ZVOB 1VI7A 1C4AA 4C6AA 3GMGA 2FD2A 5KG4A 1HI1A 4LF5J 1FWPA 3CVKA 3MM7B 1FEHA 4BDPA 3GIIA 2DKOB 3AJ2A 2Y1IA 1B4SA 4M5GA 2BVZA 1WDTA 2DR9A 4E0DA 1DURA 3OXLA 1KLMB 2NPIA 5D3GA 4K0KJ 3HF5A 2CPZA 1H3DA 2MY8A 1HYSA 3D0HE 2DNZA 1XK8A 1BWEA 2D69A 4CLFA 2VJUA 3OR2B 2YNHA 1SH0A 2P9GA 2DPIA 1RU1A 4QJVA 2DCLA 1JLEA 1ZPWX 4MK9A 4IG0B 4ECWA 1HNIA 4NLYA 3IR7B 4C8NA 3IO1A 1D3WA 2B0GA 2FZGB 1ZPVA 1NHKL 1CULB 3LANA 3ZTQA 2FIUA 2R2UA 1JLGA 2XWXA 2UUAF 1SUQB 5LMNF 2JX2A 4LF8F 4JYAF 4ECZA 3G8TA 1NK0A 4NOHA 4QW8A 1S4EA 2CNLB 4ZP7A 1SI9A 2XYHB 1G4CA 3RW7A 4MH8A 4KY3A 3KMSA 4PXCA 1FFGB 5HBMB 2YKNB 2KB2A 1S9GB 4PQAA 2RMLA 5ETMA 3AODA 2AX0A 2APOA 2KZZA 5DQHA 2MXYA 1NNDA 1OWXA 1OJ4A 3HFKA 3UFCX 3MFIA 1YJUA 3V5RA 2MKSA 1CQMA 1JLQB 3DLHA 2KFNA 5KFQA 1N5YB 1FHTA 3QT6A 3CPWR 2I8EA 1T02A 2E5HA 2WBRA 3OXGA 2PGCA 4AQYJ 5E3RA 1X5SA 3CC2S 4G3IA 3KHGA 1RADB 3UDLA 1TL4A 3MEGB 5DDRC 1F9HA 3AD7C 4OHYA 5E2QA 3BJYA 3NXZA 1X4AA 1YSJA 4NRUA 5B0BA 2C3PA 4NLWA 3WIUA 1GH8A 4OI0A 2RS8A 2W1BA 1GEHA 3GIRA 2I2YA 4X2BA 5H9FJ 3TEGA 1B3TA 3AXKA 3PVXA 3DMJB 2DNRA 2DPJA 3C6UB 1KVKA 2HHPA 5KFDA 1UA0A 2JOQA 5CYQB 3DOMA 2NUHA 3W60A 4J7CA 5ETRA 4B3MF 2E5LJ 2JJ4D 4OZJA 4C8ZA 4NLGA 2V6AA 4LFCF 1U1NA 1VISA 3SCIE 3SQGB 3C2PA 1DLOB 4G65A 1L3VA 3MECB 3G96A 4F0KA 3S8SA 3HO1A 1SBRA 2W7OA 4NCGB 3OR1B 2CPXA 2ZNZA 4WE1A 3CJSA 3J7YU 5HLFB 5DM7Q 2HIYA 5IT0A 1N33J 3C8YA 3BN7A 5D0HA 2UXCJ 5H9FK 4EO6A 4JI6F 2B4OA 3G2XA 3R5CA 3FBBA 4JI1J 3O5TB 1KONA 4P6QA 4DV4J 4RW8A 5L1LA 1G2EA 1OS5A 5K20B 2HNYA 2WSFC 4RUHA 5IM0A 2FJBB 3TWZA 5L1KA 2HGNA 3MEDB 3J80U 3U02A 4EEYA 2F63A 5ETLA 2EG1A 2ZM6J 4R8UB 3KTQA 4C8MA 3MD3A 3HD2A 1YJ7A 1QVGR 1EKRA 2FLOA 3BGRA 2DY9A 4LF9F 1UEKA 3SSRA 5DDOC 3ZNJ1 4LF1A 3G6YA 4LJMA 1TK5A 2WVBA 3G82A 3TZWA 2ZC4A 3MR2A 4EGLA 5LMUF 4JV5J 2J8SA 3NEKA 2B51A 2WVEA 2CPFA 4ID5B 4JI0F 3RU0A 2XSJA 5EWGA 4Q0BA 5HATA 5I4MA 3DC2A 5I42B 3V6HA 2EFPA 4JI4J 2IVYA 2GO9A 3QATA 2R2RA 3FC9A 3H59A 1FD2A 1T03A 2QFJA 1TR0A 2F3JA 2Q43A 3U27A 2H5IB 1FKAF 4LRFA 7FD1A 4X4TA 1HNWF 2B5JB 4Y2KA 1TMMA 2XZTB 1V3ZA 1FO1A 2BX6A 4MK8A 2J8AA 3E01A 3PKYA 1HHQA 3FFIA 2IA6A 5A8KA 3LGNA 1OSCA 2PO4A 1D1UA 4ID8A 2HFOA 2V94A 4DL4A 4F50A 1FRJA 2ZITA 4W4MA 3BGOP 2B7BB 1DQ8A 4O44A 1L3KA 1CLFA 4YB7A 5SZTA 3WZ0A 3TQ1A 4J90A 1N52B 2WB1D 4X4VA 4ZJQA 3QPIA 2UVVA 1C1BA 1J5EJ 2MY7A 1HARA 4YDDB 1TL3B 1NUEA 2A3JA 2J9CA 1UETA 1RT3B 5ITHA 5EX0A 2ZBCA 5C25A 2OPSA 4OYZA 3H2LA 2PFFB 2QL7B 3H4DA 5GAEU 1TL7B 2ILZA 2UXBF 3IBFB 2AMCB 3LPYA 3FVYA 1G7CB 3KJNB 2WK4A 2DNMA 4DU8A 2HQIA 2HBRB 4ZVRB 3RAMA 2CZ4A 5IWAJ 2FHMA 2W9CB 4Q2LA 1S7HA 2PEBA 3M6XA 4UZBA 4ILMA 1TMJA 4OX8A 2BR0A 2R7QA 1NDKA 2CQIA 3EM1A 4FKYA 3MM9A 4OHVA 2QLXA 3ISNC 3EVWA 1NBEB 2GO8A 1HYSB 3W65A 1U1KA 4ZK7M 2FHKA 4GO7X 3KLGA 3T1YJ 2HKEA 9ATCB 3NCRA 2NSBA 2QN6B 1HBMA 4N77A 5T14A 3G8QA 2YNHB 4AE5A 1SXLA 3E8OA 2V63A 1O5JA 3C14A 4IOCQ 2XS7A 1JLEB 1KOOA 3L7PA 1HNIB 2ZZMA 1WC4A 2WW4A 2JRSA 2OPPA 3MR6A 5DGAA 2BYCA 1K44A 4CTAA 2CPIA 3M8RA 5F8HA 3OVSA 1OPZA 4ED4A 1PCAA 2K2PA 4DX7A 1JLGB 5DETA 1EQ0A 4J9RA 1N56A 4FS2A 3T1AA 2XULA 3P96A 1KQFB 4OI1A 3GG1A 2I6WA 1S49A 2FZKB 2R7WA 4KGKA 3TYTA 3QNWB 1FRHA 4J9NA 1X8DA 1NHVA 2DHSA 3Q8QB 1RWXB 4FN5A 1J2VA 3V81A 4BWMA 2GZOA 2GVZA 3RRGA 1U48A 4BHQA 1YJRA 2HZAA 2ZKTA 4FP9A 1U4BA 1W2IA 3DN9A 3F41A 5E3AA 1JX4A 3PR4A 4FXDA 3VGVA 4RBTA 4QIGA 3ENAA 2A6OA 1N32F 1VRUA 5K8NA 1IBKF 5LSLA 4DL6A 1H38A 5IT9U 4E8UA 4A4JA 3KG4A 2ZZNA 2QFIA 3BDPA 3BO4A 1VFJA 2R7OA 1EETA 3F73A 2V4RA 2EFQA 4J5OA 1KVIA 2HQCA 3CJTA 3FNNA 5KFTA 4CNYA 3BS9A 2ASDA 3N6LA 3P45B 3GYXB 2HVHA 2BE2B 4RBVA 3SI8A 4PRFA 1B0TA 3ZTPA 4CLLA 2CQCA 2KI2A 3TX8A 4B3SF 4WWSA 3IC1A 2ZHBA 3M8SA 3DGPA 4F2SA 2Z2MA 4IG3A 2KYZA 3CCRS 2QLBB 2H54B 1QAXA 1Z4UA 3DOMB 2E44A 2NYIA 3LF0A 3OV7A 5H1SV 4F0HA 1SQFA 3QGGA 1DY3A 3M2RA 5LL6d 4EU0A 3NWRA 3CDBA 1SKRA 2CPJA 3PFEA 4HR2A 1W2BR 1Q8BA 4O3OA 3UDVA 3OTDA 2OMOA 4C9DA 3MZIA 5DLFA 3BH7B 1V3RA 1HI8A 3B54A 2MLZA 1FX4A 2XG8A 3BSNA 1YHQS 4B9UA 4WE1B 1GXUA 3HHEA 3KDOA 3HHNB 2FLPA 3HSDA 1TP7A 1UZHA 3FEZA 1HL6A 2NZCA 3J80Y 4ZLLA 1X4HA 4AT1B 3D1OA 1FA0A 3QQCD 4I6YA 5KFSA 1BE4A 3R8YA 2RQMA 4I6WA 4N56A 4DL7A 4RW8B 4B02A 4K4UA 4UY85 2DHXA 1YG0A 2P6TA 4FDFA 5J2PB 2AZ3A 5IM0B 2XS5A 4MAKA 3DRSA 5HVFA 2GVDA 1RTIA 3NS5A 2FY8A 3FQKA 4DWIA 4W98A 3KXDA 1HWJA 1KEKA 1YKWA 3HI9A 3HSGA 3W9JA 2G2OA 4DZDA 1FJ7A 3R6LB 3DOKA 1WG1A 2QYCA 2CJBA 1Q5YA 1YZ7A 3BGRB 5HO4A 2ZJRQ 1VBYA 3FRZA 4P2SA 1MMNA 2IRYA 2RB7A 3G82B 4DLEA 3FEYB 1U1OA 2F8MA 1YRXA 3Q86A 5HQ8A 1D8YA 3GTYX 4O3QA 1R8PA 2XSJB 1IM4A 5DO2A 1OO0B 1NJIT 3V4IA 3GLJA 2RH3A 4USKA 2OKQA 4L75A 2HAIA 4PPDA 5KG3A 4M5IA 1S1UA 4KHPJ 1T03B 4KGVB 3DNCA 4EBDA 4LF4F 3N6NA 2ASLA 3CD5A 1FKPA 3OT9A 1XQIA 4QPXA 3U1LA 4DV6F 3PJWA 4B9LA 5KFRA 1U1LA 2CG4A 2W4CA 3DM2A 3E01B 2E1RA 3DLGA 2J5AA 3UD5A 4CRJA 2B8QA 4CYUA 3SBMA 4DPUA 2M4MA 3FFIB 4OYOA 5A8KB 2EK6A 3IAM9 2UVWA 4BWJA 2OPQA 1W26A 4XAKA 4KGMA 2ZDPA 1FD8A 4CM0A 3UCGA 4CO4A 1HR0J 4JV1A 4FZVA 3DRPB 2AIRB 4O44B 3SCKE 3RAXA 2ZUAA 3CC7S 4P2MA 3ITHA 1JXVA 4O0IA 1IBMF 2W2MP 2FHJD 4WKYA 1ZBTA 4ZJLA 1C1BB 2JFDA 2PD1A 4DPTA 4B9SA 3MCSA 5DG8A 4F4YA 3G4SS 2U1AA 2ATLA 1LWFA 3W8GA 3HDSA 2OPSB 4ZCIA 3A8JA 3O44A 4JI3F 4DR1J 2UXDF 2CPEA 4JI7J 3Q22A 2W25A 5KFIA 5KG2A 3NBPA 2PI4A 4EK2A 1JLBA 3JQJA 3QFWA 1TKZB 4ECQA 2WVCA 5GMDA 2FY1A 4QWEA 4H4MA 3N01A 3TQEA 2BJ8A 4H4OA 1SL1A 3MMJA 4NMXA 2GHVC 2CAJA 2KT2A 2YKOA 4RW6A 1LOUA 3MM9B 4P73A 3H5YA 4I7FA 2B3TB 1FJGJ 3TAMA 3KLFA 5CHCB 2QG9B 2ZOFA 3KLGB 4K8RA 5C5JA 2DHGA 1V5IB 1HBMB 3MM8A 1QVFR 3T41A 1S1WA 3GR0A 1DJ0A 3PW4A 3C14B 1S97A 3QWPA 5GADU 4PAAA 1ZYQA 4OI4A 4ZVQB 1WDDA 1RWWB 4DPOA 4ZPDA 4B9VA 3PDNA 3H4BA 1TVRA 4CTAB 3ENWA 2OD4A 2ROEA 3PRBA 1VQ7S 3CJ0A 2FVSA 3MPYA 3DLBA 3THTA 2NCKL 1RA7A 3D67A 3MMBA 1U25A 1F0XA 2VHGA 3BDEA 4XPEA 2B4PA 3CMES 3CW2C 2EFOA 3FSIA 4LQ3A 1NK6A 5IT9Y 4DQQA 3SCLE 3HFZB 4M1KA 1YGYA 2D7SA 4C11A 1EB0A 1MN9A 1WHXA 2VQEJ 4BCAA 2FJVA 4Y2AA 1NJZA 1S79A 1OQ6A 2IDLA 5GAHU 2YKPA 2XY7A 1VRUB 3GZ7A 2RQKA 2KKHA 2D3ZA 4FPRA 4S0MA 1C2PA 2J7WA 2R7UA 2DIUA 3I96A 1T94A 1X4BA 2Y0BB 4LT6A 2Z2LA 3M30A 5A8RA 2KL8A 5IC6B 4U67Q 1EETB 4M95A 2FVCA 2GMLA 3I87A 5B0GA 4LF5F 3T5KA 1LV5A 3PHTA 1PAUB 4NASA 1QD1A 1WELA 3LP0A 1BC6A 4H4KA 2RUGA 1HBUB 2BE7D 3GFYA 4CM2A 1R31A 4DQIA 4N41A 4HTJA 5L9NA 3QLHA 3MR5A 4PG8A 2YKQA 2YPYA 3U1NA 2UUTA 4A8WA 4PABA 3W9IA 3QIDA 1T05A 4K0KF 3PZPA 1FRKA 1RAIB 1DAXA 2IM1A 1WTFA 3DGPB 3PNIA 3FBCA 4DUZJ 4IG3B 1OPIA 4NA3A 5CZXA 4DR7J 2V8PA 1IUJA 2XZDB 4ECUA 3DDIA 3SSQA 2BA9A 1PGZA 2MSSA 1S1VA 4IOAQ 4CLKA 4KJIA 1UVKA 1FRXA 1F9EB 3HHKA 3W2VA 4X4RA 3M2RB 5KOWA 4V19X 1UJ6A 4ZCMA 2MLYA 4U7CA 5L9XA 4KH0B 3WX4A 2C2MB 1HHTP 4ALZA 2ASJA 3I6PA 1VIXA 2QMXA 3KHRA 4M5DA 3A12A 4LF6J 2KYXA 2MTLA 3CD6S 4ANDA 5F8GA 1F9FA 1FKOA 4RW4A 1U2RA 3QGIA 1RT4A 3QGPA 1UVJA 3VAGA 3HM9A 4TQRA 4KGXB 2M7SA 1NM2A 4OX6A 3NKYA 1U0HA 4I0WA 1MG7A 4X64J 4P52A 2WB4A 4R25A 2HFSA 3C19A 2VASA 2Y0SD 4RUAA 5E0OA 2WSCC 2VBZA 4QIVA 3JAMU 4K4VA 1FVSA 3AXMA 1PJ7A 3R7BB 3ZZ0A 4DOZA 2PI5A 3DRSB 2GVDB 2VIHA 1KRPA 3AJ1A 5A6PA 2KT5A 2V8GA 3PRVA 3I9V9 4ECXA 2AGPA 4GKKJ 4LUBA 1HPZA 2DNQA 1C0UA 3DOKB 1S9EA 5D4LA 3M05A 1M5OC 2X1FA 4CI0B 3TR5A 2QA4S 1JK9B 5HI7A 4G1PA 2QLWA 3AT1B 5BXIA 2BUNA 4YUDA 3OJUA 5DDPC 2IA0A 2VD3A 4OYPA 4AQYF 3R97A 1SVDA 2XI3A 2XGQA 4C3MA 1Q7LB 2YXLA 4TQSA 3LTOA 4LFAJ 7AT1B 4PWDA 2YH1A 5ETPA 3PY8A 1X5OA 2HLTA 2Z30B 1LFPA 2E7WA 4M8LA 1N6QA 1YJWS 1IJEB 5CXTA 3V4IB 3IRXA 3P6YC 2KT3A 1KQKA 1MU2A 1H0HB 1JWWA 1S1UB 4HT5A 2FHJA 3I55S 3QZ7A 3EICA 3IBWA 2Q79A 2ZBIA 1VQPS 4YQWA 1FRLA 1FKPB 1RP5A 5J2MA 4OIXA 4JI2J 3GYGA 2E5LF 2FJAB 2V50A 4DX6A 5F8MA 3DM2B 2L48A 1V3SA 3DLGB 4CYUB 2C2EA 3MCMA 4QR2A 5I3QA 2RDIA 4DV3J 2H51B 3SCJE 3CIMA 4L3KA 1FFWB 1P6TA 2OPQB 5E5NA 3AOCA 1QJHA 1GAOA 2MQOA 1B70B 2R8IA 1XMBA 1HNXJ 2JNJA 3X1LB 3L95X 1R6VA 2F65A 3ITHB 3PYGA 4YHHJ 2YKMA 2JWNA 3TZYA 4FYXB 3R1HA 2HBQB 2UXCF 1UJ4A 2XGPA 3QSIA 2CUYA 1CBKA 4JI1F 4UOCA 4DV4F 4CO0A 2KM8B 1S48A 2WAQD 3E51A 1KD1T 5KFNA 2WONA 3VZHA 2CPYA 3GSIA 3KLHA 4QR1A 4DR6F 3CGIA 4W90B 1PYSB 3M2VA 2CQHA 1ZZNA 2QEXS 2ZM6F 3NBPB 1AFIA 2JVRA 2I5JA 1JLBB 3EVMA 1M5VC 3B8HA 4PYAA 1HBNA 3WIVA 1PAEX 1R27B 2ZOMA 4FPIA 4DV2J 5HQLA 4H4MB 3ZTRA 4DFJA 4RL1A 1X0FA 4C2MA 2RIJA 2DH7A 4H4OB 4IOBA 2KVIA 3M8YA 4JV5F 1Q4RA 3IA0A 1VQMS 4RW6B 3SV4A 2DCUB 2DT9A 4K59A 1TL5A 4PXEA 4QQBA 1BLUA 4QYRA 4I7FB 2BACA 2C3MA 3TAMB 2OUGA 2XCAA 1RLCL 2KJVA 4JI4F 3THPA 2HHTA 3TA2A 4F04B 3MM8B 1M5PC 4YOEA 1S1WB 2J0WA 2V2VA 2FZCB 2M52A 1JQGA 4RNOA 1I51B 3CJ8A 1MWQA 1Q16B 3DLLQ 2CJQA 1EAYC 5H9EK 2JEFA 3UE2A 2KFYA 1TVRB 2H4YB 3MPVA 4OLPA 2LDYA 2EXUA 3MAQA 3CJ2A 3BQ0A 1EP4A 3THVA 3RB3A 2O01C 4C48A 3MMBB 2UV8G 3MCOA 2AJ1A 1N0UA 4TU7A 2I38A 1D09B 1JXLA 1YZ6A 4YEAA 2MKHA 3A13A 3SXLA 3ET6A 1DZ5A 1J5EF 3MPUB 5I3PA 4ZVPB 3LUYA 4C11B 3ZXWA 2VFVA 2RVJA 2X1AA 4U7UD 4R0EA 1LXNA 2RSQA 3PIOQ 5AE2A 3M6UA 2WBMA 5CH7B 4WZMA 4AL6A 2F8EX 2HGLA 4Q44A 2D3O1 2H9ZA 4GMKA 4DFKA 2GNKA 1WC3A 1JLAA 1TELA 5LXYA 2QSWA 4FF4A 3M30B 5A8RB 3OL8A 1RZMA 3FKBA 2J76E 2GHPA 1U09A 3RGIA 1J5OA 3UW1A 3BZQA 4ZDNA 5KT5A 2G0IA 3T19A 5HMYA 3V6JA 4LRAA 2F5GA 2KDOA 2R7TA 5IWAF 2CJXB 1X7VA 2HYIB 2KVQE 3LP0B 3GCWP 1G1XA 2CJYB 2ALZA 3PW0A 2V2QA 1QLNA 1T05B 2CRLA 2YX7A 2BQRA 2H5EA 3UCUP 2HWTA 4A8OA 4ZLNA 1FVQA 4J9KA 4KSEB 3T1YF 1UW4A 4WYLA 2BRKA 3PW5A 1ACMB 2NXEA 1VQOS 4K4TA 1S1VB 2RU3A 3W2VB 1O8BA 1CQNA 1HBOA 4NCBA 3CTRA 3FJ2A 1PSDA 4U96A 3FRYA 5EHHA 1NU4A 5F9NA 2KG0A 4M5DB 4WFZA 5GAGU 4NI2B 1QTNB 4DN0A 3VQSA 3UVJA 1BD6A 5EDWA 1T9VA 1FKOB 4RW4B 4EMDA 1RT4B 3JAMY 2AEFA 2J7KA 2Q6BA 3FSYA 3ZTSA 4A8KA 1HWIA 4A8FA 1U0HB 2OTLS 5HVHA 1VLYA 2AW0A 4KTQA 1FNOA 1VMBA 4P2XA 1U0SA 2AGQA 4YN3B 4X4PA 4NXMJ 1JNRB 5KFUA 2ZBRA 2DJWA 1HNZJ
chains in the Genus database with same CATH topology
5KG5A 4I4BA 4GC7A 4IYQA 3W7BA 2ZC4A 4NWBA 3MR2A 1RJJA 2CKWA 2Q1LA 4EGLA 2BDPA 2HNDA 3MURP 2MJNA 3JTPA 1Z1ZA 1UWBB 1F5AA 5LMUF 3IR6B 1FE4A 1TK0A 2B51A 4RUCA 3LO3A 4B3OA 3FSXA 3GB0A 2CPFA 2C2DA 2AYBA 4ID5B 2OAUA 4JI0F 4USJC 5F8IA 2BANB 2HVIA 2PEHA 3VQTA 1S9EB 3RU0A 1D0EA 3DFEA 2VBYA 4RKUC 1NK7A 3H5XA 2XSJA 3GV8B 2B9XA 2HNDB 4IUFA 3GIKA 5EWGA 1CEZA 2VOOA 2XY5A 4BS2A 1Q78A 4Q0BA 2EC0A 5I4MA 3DC2A 5I42B 3M9MB 3V6HA 2UVUA 2EFPA 4ETZA 5KG7A 3GFZA 3OFGA 2R7RA 1F5BA 3GR1A 2IVYA 1HWKA 2GO9A 3M6WA 1Q1KA 2E66A 2LXFA 2GJIA 3H5UA 2B9WA 2R2RA 1RYRA 3DLKB 2ILYA 3R3TA 4XK8C 5G0RA 1IKXA 3NNAA 3R5BA 4I56A 1K9MT 3H59A 2B4VA 1FD2A 4FYDA 4Q0BB 1T03A 5IZHA 2JEGA 2QO3A 4DV0F 2QFJA 1TR0A 1UEVA 2XBPA 3W2WA 3J7Z5 3W3SA 1NJWA 4IR9A 2F3JA 2Q43A 5GAHI 1YRUA 4ZKAA 3U27A 1R3NA 1FKAF 2EBEA 3IGNA 3CCSS 7FD1A 4EYIB 1YVFA 2MYFA 4X4TA 4NCAA 3E2EA 4HDHA 2HHXA 4NMLA 1G3OA 3ZC4A 1HNWF 4LQ9A 4PWDB 2ZE2B 1VQ6S 2B5JB 3BSAA 4Y2KA 3LW5C 2WRMA 1U6ZA 3NS6A 1N6QB 1V3ZA 1FO1A 4WU3A 2M0GB 1F5CA 1C1CA 3BR8A 1TKDA 4MK8A 1YITS 1NAQA 4ZP9A 2J8AA 3E01A 3IRXB 4RX6A 3V6DA 3HPOA 3ZZTA 4RLEA 3PKYA 2DGWA 2VL1A 2MGZB 3TAQA 4IQMA 1RKJA 4D3GA 1N5TA 3T6JA 3J81Y 1HWLA 5AXNA 2HS4A 3FFIA 3WBZA 5A8KA 3TANA 2ZD1A 3LGNA 1OSCA 4RZRA 2IA6A 4FBTA 2PO4A 3CJ3A 1SJFA 1D1UA 3UDCA 4ID8A 2HFOA 2V94A 3PX0A 4DL4A 4F50A 1WF2A 4O3NA 3MWBA 4DFMA 1FRJA 1Q86T 3T1HF 1VIOA 3Q8PB 2GGPB 2ZITA 4Q2MA 3VAKA 4A46A 1HQEA 5J2MB 4ED2A 1XMOF 2B7BB 4DR3F 2LA4A 1DQ8A 2ZD1B 1BQNA 1CC7A 4O44A 5CQGA 1L3KA 4CNZA 4NLTA 2B6AA 2COLA 4G6VB 4YB7A 1CLFA 5KFHA 5SZTA 4DJBA 3WZ0A 2KO1A 4ED6A 3X3UA 4MIWA 1S1TB 2IJNA 3TQ1A 5M2PA 2PT0A 1N52B 5K5MA 2HLUA 4IO9Q 2C3YA 3VAFA 3IWLA 2WB1D 3I9ZA 1B7FA 4X4VA 1MROB 2D3OR 2JL9A 5L1IA 3QPIA 3P5TL 1PC4A 2UVVA 2RD5C 2PSZA 1C1BA 2QSFA 1ULRA 2LQJA 4ELVA 4J9SA 4QBUA 2MY7A 2CQ0A 1HARA 4YDDB 2JEIA 2I9SA 1K0VA 3WC0A 5EX3A 1M5HA 1RDRA 2IRXA 2PMZD 1TL3B 1UJ5A 2KN4A 1VBXA 1DHMA 2A3JA 1FERA 2R7XA 2J9CA 1UETA 3G8SA 3HVTB 1RT3B 4K4SA 2J0SD 5ITHA 4IRDA 1NRKA 5EX0A 2ZBCA 1P27B 1L3UA 1O51A 5BYSA 1F60B 1HD0A 2MHNA 5C25A 2OPSA 1K0TA 4NLVA 2W9AA 2HWIA 1RT2B 4WU2A 5LSRA 3KG1A 2W8KA 3TVKA 3H2LA 4RNMA 3NGDA 2PFFB 1R0AA 3H4DA 5GAEU 2HHQA 1DFDA 1S0NA 1JJ2R 2ILZA 3M32B 3V2UC 2UXBF 2C22A 4KAIA 2ZDOA 1IKVA 3HLUA 3CD7A 3FVYA 1G7CB 3LPYA 2WK4A 4TYBA 1N34F 1WEXA 4PUOB 3H20A 2DNMA 2FHOB 3GG0A 3JYTB 3C6TA 2W9CA 4F3MA 1DTQB 2HQIA 5C25B 1NO8A 3M8PA 1YIJS 2GIRA 2W4DA 4YB1P 3D28A 1X5TA 1N54B 1XERA 2BJDA 1S99A 2DK2A 4FVCA 4ZHRA 3J7YI 3RAMA 1WEZA 4DL3A 1DTTB 2CZ4A 4OJ3A 3LAMA 2ZJQQ 3JSMB 5F8LA 4DSLA 2LEPA 1RTHB 2FHMA 4DG1A 2W9CB 4Q2LA 1S7HA 2DNYA 4U6PA 5THWA 3RR8A 2VPZB 1NK8A 1XMQF 1XN9A 3M6XA 1UVLA 4Y0FA 4ZPWR 2HGMA 2GV1A 4ILMA 1SV5B 1U1PA 5DS7A 2EFVA 1KTQA 3I82A 3MPWA 4OX8A 3KLHB 1S6PA 2BR0A 2R7QA 1WI6A 3LWLA 2BM0A 3KG0A 2W9BA 2CQIA 3M2VB 5H9EJ 4ZLPA 1WHWA 2HVZA 4ZA1A 2W7PA 2E5JA 1L3SA 3MM9A 2I5JB 4OHVA 2QLXA 3ISNC 4IDKB 3RR7A 1Y00A 1V9OA 2GO8A 4RNFA 1KHWA 1HBNB 3JSYA 2D1CA 3POTB 4I2QA 3TARA 4H54A 2C2RA 1M5KC 1HYSB 1AXQA 2LKZA 4OJHA 5B09A 2PDAA 3EGZA 1FDDA 5FDLA 1U1KA 2AJ4A 3S6EA 4ZK7M 2FHKA 3K0JA 1KNZA 3CDEA 4OZNA 4AL7A 4GO7X 1GXLA 3KLGA 2RQ4A 3DU6A 5KFZA 5EGYA 3PACA 2UUWA 5J2QA 4A8SA 3NCRA 2FC8A 2NSBA 3NCPA 1NKEA 4UY8T 1FRMA 2C28A 2W7AA 3QIPA 1HBMA 4N77A 3Q8RB 4FNIA 5T14A 3MM6A 3G8QA 3MDFA 3WDOA 2YNHB 4KV8A 4AE5A 1SXLA 3E8OA 4PXDA 1O5JA 1HQUB 4ZPTR 2OH2A 4IOCQ 2HS3A 3M2UA 1S0OA 2VA2A 2XS7A 4K5SA 2HRYA 3PO5A 2K3KA 1WEYA 1JLFA 1S76D 1JLEB 1KOOA 2JDJA 4HI1A 2RU9A 2EWHA 3L7PA 4URSA 2MQPA 3OL7A 1HNIB 1GQEA 1R8HA 3MM5B 3CDUA 4P7TA 4C3LA 2ZZMA 2B9YA 2JRSA 2XEXA 4OV1A 2OSRA 2OPPA 2MKKA 3MI7X 1S10A 2HW3A 1TK8A 3MR6A 3PR5B 2RF2A 1H6KX 5DGAA 4ZVHA 2KJWA 2BYCA 4NPOA 4Z37A 5CYJA 4CTAA 2CPIA 4DQPA 3M8RA 5F8HA 3OVSA 2FGCA 2J0QD 1W25A 1OPZA 1TKXB 5LJ5Y 2K2PA 4KHPF 1YQHA 1JLGB 3KLEA 4WFBQ 5DETA 1RT1A 5A6WA 3MGJA 4HVZA 2EFNA 1NK5A 2OPPB 1QUVA 4CH1A 2KM8C 3LH2S 2CQPA 2R9LA 4PG4A 5IS2A 4J9RA 2XNRA 1N56A 1OQ3A 2GHWA 4FS2A 3T1AA 2XULA 1S6QA 3P96A 1NH7A 1KQFB 1ZAXA 2HQ3A 4OI1A 2G0CA 2P5VA 3GG1A 3M9NB 1LWEB 1Q8IA 2LU1A 1S49A 2R7WA 2ZHAA 4KGKA 4MIAA 3TYTA 1REVA 2QT7A 1S77D 1FRHA 2K7KA 2V4JA 3DOLA 1ZTTA 4DHVA 1RTDA 5DDQC 4J9NA 1X8DA 3DYAA 1ZM9A 4IH5A 4G1IA 1NHVA 2DHSA 3D1QA 3S01A 3T5JA 3Q8QB 1QAIA 1KN6A 2I0XA 4PCQA 1D9FA 4FN5A 2XLIA 1J2VA 3V81A 4BWMA 3IFEA 1MWZA 1C0TA 2JC0A 3RRGA 2FJDB 1FNMA 5F3ZA 1U48A 3CO9A 4Y3CA 4QIWD 1VOMA 1YJRA 4BHQA 5FJ4A 1EP4B 1BQMA 2AP6A 4JI8F 1RWUA 2ZKTA 2E9ZA 2CQ1A 3VAMA 4FP9A 1U4BA 1BGXT 1W2IA 2CPHA 3DN9A 3F41A 5E3AA 1SKWA 1JX4A 4FF1A 3M1VA 2DGUA 3PR4A 2J6UA 4NA1A 4FXDA 1HR0F 4RBTA 5E3PA 3OUYA 1WI8A 1ZTWA 4C7QA 1T8EA 3OHBA 3V81B 1M5SA 4QIGA 3NL0A 4YDXA 1N32F 3RRKA 1VRUA 5K8NA 3T5LA 3RBDA 1IBKF 1T3OA 1VQKS 2RE1A 1RT7B 5DQIA 3KHLA 4I67A 5FIIA 2DD8S 5LSLA 4YR0A 5JVHQ 4DL6A 3FZ2A 1H38A 3HZEA 1VQ4S 4OL8A 1U49A 4E8UA 2V5HG 2R4FA 1CSJA 3T6BA 4F4WA 1ZZFA 4A4JA 2AJQA 4CO3A 3KG4A 2ZZNA 2JZ5A 2LQBA 3BDPA 3BO4A 1VFJA 4RWWA 2R7OA 4J9MA 2IYGA 4R0JA 1RTJA 3NNCA 4HYKA 4U9RA 1VK8A 3ZZZA 3NP5A 3BSOA 3KWMA 3DRXA 3ZZUA 2BE2A 1EETA 3MHYA 3F73A 2YNFA 2V4RA 2EFQA 2MDAA 3UPFA 3BO3A 5KFBA 3LP1B 4J5OA 4X4QA 3E3XA 1KVIA 4OLOA 1RI7A 3AA9A 4O3SA 3BGFA 3FNNA 5KFTA 4CNYA 4EO8A 3BS9A 4RW9A 2KH9A 2V4QA 3TO8A 2ASDA 3NMAA 1ZAWA 3N6LA 2WOMA 1QE1A 1E6YB 1GTEA 4QW9A 5D4PA 1XNQF 3GYXB 2HHUA 3HHLA 5KFMA 2DTJA 2HVHA 2BE2B 2X3GA 3GWCA 4RBVA 2ZH1A 3VR1A 5D4NA 2EVZA 3SI8A 2OSQA 2L41A 4DR1F 4PRFA 1N8RT 4YFUA 2Y1RI 1JXEA 2OD6A 3JTNA 3KJVA 4JI7F 2IFXA 2OPRB 4ED5A 1B0TA 3SFGA 2BQUA 2AD9A 2J6TA 1WHYA 3BO2A 2CQCA 2KI2A 4RU9A 2IC3A 3TX8A 5J1PA 4B3SF 1LW0B 3EGNA 2XY6A 2K8GA 1J5OB 1SH3A 2GC8A 2IM0A 3IC1A 2VODA 2C3OA 1U26A 2N4CA 1LWCB 3LP2A 5GAEI 2FTRA 2ZHBA 2Y1JA 2NSCA 3M8SA 3SDEA 3CJKB 1P1LA 3DGPA 5JUMA 2WCXA 2N7YA 4DLGA 4WYWA 1DBDA 4XIUA 3RBEA 4IFVB 4F2SA 1UVMA 2Z2MA 4IG3A 2GQCA 2YWFA 4WFXA 5AXLA 2R8HA 2KYZA 3CCRS 2DISA 2AGOA 1QAXA 3ZFVA 2R7SA 4ED1A 2PMHA 1Z4UA 1KOHA 1LK5A 5KG6A 2E44A 4RBUA 3QAUA 2NYIA 5L39A 3LF0A 3D0IE 5AXMA 2MZTA 2BM1A 3OV7A 4NLOA 2DRAA 2QA2A 5H1SV 1QUPA 5B7WA 2OJ3A 4PXBA 2HHWA 5LXRA 3GV5B 2MQLA 3I0RA 2K1RB 3QGGA 1VHFA 2M8HA 3NGKA 4CO5A 3M2RA 5EWEA 2GJ2A 5LL6d 4EU0A 3GFHA 2IAJB 3DRYA 3IGVA 1XBWA 1FXRA 3CDBA 3KK3A 4USIA 1SKRA 3CCJS 1ROFA 4B9MA 2CPJA 2LMIA 3QYYA 2VBXA 2DNOA 4MKYA 3PFEA 4RNHA 2Q66A 1IQTA 2ADCA 1W2BR 1Q8BA 1RA6A 4O3OA 4DQRA 1HNVB 4PG5A 5K8PA 3H2UB 1YJNS 2GMHA 1FJGF 3OTDA 1QAYA 2OMOA 3R27A 4B9TA 2RRBA 2AU0A 4C9DA 4HEA9 3MZIA 4J9PA 5DLFA 3M6VA 1V3RA 1HI8A 3N5BA 4ED3A 3DU5A 3OLBA 2ADBA 4ES2A 4RW7A 3EX7B 2HNZA 3MXHP 3PO4A 1T95A 2NLWA 2XG8A 3BSNA 4HH0A 1YHQS 2LEAA 4B9UA 3KMQA 3GIJA 5KFCA 3A1YG 3IWXA 2F8HA 4WE1B 4K4XA 1DRZA 1E6VA 1GXUA 2VG5A 3HHEA 3ZZYA 2XMMA 3HHNB 2FLPA 1UP1A 1GTHA 4Y28C 1TP7A 2J9DE 3I5AA 2E1AA 4KFBB 4MK7A 5JVGQ 2RKIB 4CH0S 1Q79A 1HBOB 3CDAA 3RYLA 5K14A 3S7RA 1TV6A 3PKMA 3FEZA 3UD4P 4ZPVR 2YTCA 1HL6A 3J80Y 1X4HA 4ERDA 2KFZA 1FTRA 3D1OA 4JV0A 1FA0A 2IMOA 4DV7F 4I6YA 1XR5A 5KFSA 5KFVA 1R8CA 5J2PA 4G1QA 2L9NA 3JSBA 2E7XA 4TKTA 3UCZP 2MKJA 3VWSA 2RQMA 4I6WA 3I0SB 5T41A 4N56A 4DL7A 4RW8B 2R2SA 2YX1A 4B02A 4K4UA 5T7LA 3H2VE 1IKYA 2YVSA 2E1CA 3CCUS 3KKFA 2QZ8A 4B9NA 5DRKA 2F9JA 4UY85 1X0PA 3OPKA 2DHXA 3TUIC 2FLNA 4OFZA 1YG0A 3LOUA 2P6TA 3FMBA 5E41A 1BY9A 5J2PB 1IKWA 5IM0B 2XS5A 2ZH7A 4MAKA 2IVMA 3IR5B 2MQQA 1FK9B 3DRSA 1QSLA 5IQQA 1RTIA 3NS5A 5K8OA 3FQKA 4TYAA 5B0EA 4DWIA 1KEKA 1HWJA 2FGOA 2GA7A 3C46A 4H4KC 3D0GE 3HI9A 1FXLA 2IBOA 4FXVA 3PXGa 1Q81T 1FJ7A 2DR5A 1GXTA 3DOKA 1WG1A 2QYCA 5HROA 1SIZA 4URQU 2CJBA 3CDWA 4OX7A 3G6VA 2ZOGA 3DI6A 5B0DA 2CVIA 1RTIB 1KS2A 4ZPBA 3BGUA 3BGRB 5HO4A 4EYHB 2W24A 2ZJRQ 1MNEA 1VBYA 4Y65A 2CJ9A 3FRZA 4P2SA 1N5SA 3KHHA 1MMNA 4YY3F 2GQQA 2IRYA 3ONQA 3MUTP 2RB7A 3UD3P 1LKZA 3I4PA 1K1QA 2ACYA 3QJJA 4TY9A 3AY0A 3B78A 3TW0A 4DLEA 3MMAA 3AA8A 2DNLA 3FEYB 1H98A 2L08A 1U1OA 2DR8A 2F8MA 1I94F 5SUHA 3V6KA 3I56S 4WFNQ 1B0VA 1YRXA 1KLNA 3SZ2A 2VQEF 1UVNA 4KO0A 2LU2A 5HQ8A 4TU8A 1JMTA 5BYQA 2LQ9A 4B3OB 3O3LA 2P9CA