3T1HF

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t1hF00
4JI3F 1CQNA 1HNZF 4LF9F 4DUZF 4K0KF 5AJ3F 1CQMA 1J5EF 5IWAF 1N33F 4B3MF 4OX9F 4B3SF 1XNQF 4JI4F 4LF7F 2KJVA 1IBLF 2BXJA 3T1HF 4DR3F 1IBKF 1F60B 2YY3A 2B7CB 4JI0F 4DV5F 2UUCF 4LF4F 2VQEF 2ZM6F 4NXNF 4X66F 4DR4F 3T1YF 4LF6F 4GKJF 2UXDF 2VQFF 2UUAF 4X62F 1QJHA 1FJGF 4NXMF 4LFAF 1LOUA 3R3TA 4DV0F 2UU9F 1N36F 2UXCF 2B7BB 2BVZA 4DR5F 4X65F 4DV4F 4JYAF 4B3TF 4DV6F 4DV1F 4DUYF 2E5LF 4GKKF 5LMUF 4KHPF 1N32F 1HNXF 2J5AA 1HR0F 1XNRF 1IJEB 1GH8A 3ZZPA 1N34F 4DV7F 4DR1F 4JI2F 4JI6F 1I94F 4LF5F 1VMBA 4JI5F 2UUBF 1G7CB 4JV5F 2KJWA 4YHHF 4AQYF 4JI7F 2RJZA 4DR2F 4DV3F 2HHHF 4LFBF 1G1XA 1IBMF 4JI8F 2UXBF 4DV2F 1B64A 1RISA 1HNWF 4YY3F 2F4VF 5BR8F 1FKAF 3OTOF 4DR7F 4LFCF 5LMNF 1IJFB 4B3RF 1XMQF 4X64F 4LF8F 1XMOF 4DR6F 4JI1F
chains in the Genus database with same CATH superfamily
1A6LA 1JLBA 1NXIA 2EBEA 1LFWA 1FXDA 1S6OA 2K2PA 3UPFA 2M4MA 3F73A 3RAQA 2XLJA 2DTJA 1HNZF 4B9NA 2R7UA 1CLFA 1JKHB 2I5JB 4YR3A 2DCUB 3GFHA 4ECWA 2LA6A 4K0KJ 1H2TZ 1O51A 2IA0A 1BQNB 1HQ2A 1IKWB 1LXNA 1Y5IB 2COLA 2RF2A 1NPPA 2YKOA 1RTJB 2LXFA 3DRRA 3KLIB 4DJBA 1UZDA 5K9FA 2B43A 4R25A 5CCMA 1XNQF 3HVRA 4ZOSA 2DGOA 1H73A 1PSDA 1QDUB 2CQ2A 2GVZB 2BZ2A 4CLPA 4LIWA 4ELUA 1GMUA 2XWYA 2MEWA 4ZS6A 4XAKA 3DI6A 1TAQA 2YY3A 3PNIA 3OL7A 2RS8A 2R2UA 1S0OA 3GCXP 4PG6A 3R9LA 2QZ8A 2RB7A 2E5IA 3BREA 4U67Q 1S72S 3CD7A 2JEJA 5MAOA 3U27A 4C8OA 3IGNA 4IG3A 3GYGA 1NMEB 1T05A 4LF6J 4GKJJ 4JOUA 2PDAA 3MPUB 3EJMA 2RU9A 1FFSB 1XERA 4IDKA 1SV5A 2UUCJ 1RWPB 2BX6A 1HKAA 4LF6F 4GKJF 2DHXA 3IWLA 5KTQA 1FNXH 2UXDF 1F5CA 2KFZA 3GPAA 2CQCA 1U6BA 4U7UD 1CC7A 3G8QA 3KNAA 1WDTA 2DCLA 3M30B 3W2VB 1P9YA 2O66A 4MK9A 2UXDJ 1YBUA 4B17A 2UUAJ 4HHJA 3AD9C 2EEYA 2KG1A 3C14A 2XZTB 4M5IA 4FNIA 4DUTA 2E1CA 1Y4ZB 3D4JA 3MHYA 2MQOA 2WSEC 4YQWA 3QGGA 1R8HA 1Q16B 3AFGA 3AD7C 3DDKA 3I5BA 3P96A 4WJBA 3POTB 3MPYA 1S1WB 3SXLA 2UXCF 1JNZB 4ZKAA 2KHCA 3D66A 3I4HX 1WDDA 2VOPA 1IKVA 1X4DA 1T9VA 1HARA 2XM3A 1SKRA 5D8HB 2MDAA 3SQGA 4DV6F 3DOKB 2ZJPQ 2ATLA 1X9WA 5JUMA 4UUXA 2CG4A 1TL4A 2V2QA 1E6VB 2ADCA 1SQGA 1Q95G 2QIFA 3LP2B 3M7VA 4Y2MA 4AFFA 4USKA 4ZITA 1U1PA 1TUWA 1PAUB 3J7ZT 3DYAB 1TZ0A 2Y0BB 1YKWA 1UTAA 2CFXA 2AKWB 4URGA 2XMAA 1M5OC 5IT9Y 2VB6A 1HBOA 2FVCA 5SUHA 3LW5C 4ECUA 2PA8D 1MW7A 3G2XA 3BBCA 1SV5B 4CH1A 1R6YA 2CQPA 1L3UA 3IWNC 3NKYA 2VFTA 3GYNA 2WAQD 3DU6A 3CJKA 1O6XA 4IFVB 1RBAA 4M63A 3CJ5A 1ZM4A 4W4MA 4WYLA 3BSOA 4ZCKA 3OVAA 5DLFA 1OS5A 1RB0A 2C3UA 4P2XA 1U25A 4DU7A 2JSXA 5I4MA 5EWGA 2K1RB 4FVMA 1DHMA 7AT1B 4AQYJ 4GRSA 1P1TA 3R7BB 1V3SA 3TI0A 3KLGB 3NOCA 3QFWA 1S77D 4USHA 4RBUA 1Z2ZA 2DGQA 2CVIA 4C0HA 4RNOA 2YH1A 1XIQA 2CYYA 2HIYA 3KJNB 3HCXA 5CCLA 4DFJA 5KT5A 4NLXA 1WC1A 1KOHA 1RT3B 2JEIA 3FRYA 1JKHA 2I5JA 2X3DA 2YXLA 3FEXB 1S9GB 2JDJA 3JSBA 4N5SA 2ZVIA 3KUGA 1HBMB 1Q53A 4I6WA 3ZTPA 1OSDA 6FD1A 3QNWB 2V68A 3OSNA 2ZE2B 3C15B 4LFCF 3BZQA 5IC4B 3JAMU 3X1LB 1TKTB 4KKOB 4PWUA 1TL1B 5LOQA 2BKPA 3TA1A 4M5KA 5LMNJ 3T9NA 4JI3F 4TY8A 2E9TA 5BXIA 2BUNA 2XY5A 3K0JA 1D9DA 2LP4A 1HBNA 3Q8YA 5J1EB 1DTTB 1G4CA 2EFNA 4ZVFA 1FTCA 1NSPA 1S6PB 2GQCA 2KT2A 4NCAA 3IA0A 5CYJA 3GIIA 3CSKA 1RAHB 2VFSA 5H9FJ 3EZUA 1PILA 2MKCA 2YPZA 2YWGA 3BPSP 3VGSA 3NBPB 5A6PA 5KFBA 3OL9A 2DNRA 2FC9A 3UQSA 1HMVB 2UVVA 1NB2A 3O2IA 4G3IA 3US5A 2VJUA 4EO6A 5IT0A 3LO3A 1KD1T 2EWHA 1IQTA 4X4NA 1VBKA 2Y1RI 4PAAA 3S01A 1IBKJ 4ZVPB 3H7HB 3CDBA 3M1VB 3PEHA 1V9OA 4ZVSB 5DQGA 3BBFA 3M05A 4QYZK 2M88A 2VG7B 2UV8A 3F0NA 4CLZA 4NMXA 2FHJD 4ZJOA 1QD1A 4QWAA 1OO0B 3CCES 2XY6A 3QJPA 4DXLA 2AJ0A 2N4CA 4QIWD 4C3MA 4E98A 5KFXA 1RKJA 1Q5YA 3AJDA 4TXSA 4DQPA 4WYWA 3VAIA 4NXMJ 4O3OA 2DK2A 9RUBA 2XMKA 2VQFF 4X62F 4MK7A 3L3CA 3AJ1A 3K8VA 2HQIA 3W7BA 4AXIA 2VPYB 3TVYA 1S97A 5G4DA 2CJKA 4NXMF 3QRRA 3RJMB 2V8HA 1W26A 1KTQA 2CJXB 1P8GA 5K14A 2CDQA 3QT5A 4KV8A 3ZNJ1 4ID5B 1BHNA 1KEKA 2JZ5A 2YBVA 3H59A 3MDFA 5AXNA 1N36F 1JXLA 3PCOB 4KGVB 4ECXA 3VTIA 2FJAB 2CXEA 3W66A 3AODA 3N5BA 1UEKA 3FEZA 3HFVA 5A6WA 2ZH4A 1BWVA 4X4SA 4DV4F 4ER8A 1OY9A 3MZIA 3LALA 4B3TF 1BQXA 2OPPA 2FHKA 3JSRA 4RJVA 4UZCA 5J2PB 1DURA 3ZNUA 4RZRA 1U24A 1AT1B 2DNZA 1SH2A 4DG1A 1N6QB 3CDEA 2YKMB 1SCJB 2FLOA 2JRSA 4DBQA 4J9VA 4N47A 2IDEA 5DO2A 3JYTB 3DOMB 3GV5B 2EFOA 3FCHA 1F6TA 4ZJLA 3U1NA 4PPZA 3CDWA 3ENWA 2HFNA 5L1IA 4F67A 3PG9A 1HR0F 1MROB 5FIIA 2MKKA 1X5TA 4P6QA 3O8WA 1B3TA 3W60A 4RX6A 3FSXA 1RAAB 5GMDA 4JI5J 3M8RA 2FZCB 2E5GA 1FVQA 3QT7A 3RRKA 5IXUA 3THVA 5ETKA 4IRDA 2HFOA 2BOAA 4U7CA 1FXRA 3V6DB 3EGZA 4DF4A 3DLHA 3SSQA 3DM2B 2B9YA 4GVBB 4WP8A 3KUEA 3KLHA 3BGRA 3DOLA 1U8WA 3C6TB 3TR5A 3AT1B 1T8EA 1CULB 2R8KA 4JI8J 5I3UA 3R7SB 5LSLA 3Q2SC 4C8NA 1RT6A 1SQFA 3PY8A 4DWIA 1JWWA 1Z2LA 2B9XA 2CRLA 2F4VJ 2CKWA 3I96A 2CZ4A 4L6V3 3Q24A 4IKAA 4B08A 1NSAA 2AU0A 5J1EA 1R8PA 5HMWA 3E2EA 2LQBA 2VDHA 3S8SA 3LANA 3RGIA 3DFEA 3ETMA 4M5LA 4DFMA 1HWKA 4OYAA 3VF0B 4RW4B 1RUSA 1UL3A 3EVMA 3ZFVA 5KFHA 5KFPA 1E6YB 3CUNA 5HP1A 3IR6B 3B54A 4RBTA 2KH9A 1TR0A 5HQMA 2CQ4A 2PMHA 4LF8F 2BE2A 1MWZA 1S1XA 2O67A 4F2SA 1M5HA 4B3OB 1FWPA 4QW9A 1I6JA 1C0UA 5U47A 3N4WA 1VK8A 4ZLLA 3W5YA 3IBFB 1U48A 2ZBCA 1HW9A 4FF4A 1CJKA 2O5DA 4MIWA 4TYAA 5A76A 2QEXS 4OX9J 1ZPVA 2ZOGA 5BYRA 1NPKA 1RACB 1JLFA 1KFDA 2HAFA 2MKJA 1NJZA 1UFWA 3T6JA 1J5OB 4MKYA 4OX9F 2F8MA 2YX7A 4RNNA 4Q2MA 4J9QA 3KKFA 5D4NA 2OAUA 2WVFA 3CJ8A 3B82A 4YP3A 3BQ0A 4ECTA 2BXJA 1SL0A 3L09A 3O3LA 2MQ8A 2FC8A 4TYBA 5E33A 3NNAA 1S9EB 3FCVA 3JS9A 1U02A 4XTTA 4DPUA 2BJ8A 3DXSX 1FRJA 4O44B 2V67A 2ZH3A 4HDHA 1S1TA 1RAJA 4J91A 2KRBA 3VVTA 2JLGA 1K0VA 3RUBL 1WC0A 2GW8A 1X4AA 3L7PA 3CMAS 2GS8A 1X9SA 2VKRA 4OL8A 2QE5A 4KB7A 3ZZ0A 5A2QU 1G6BA 1XC9A 2K3KA 1L3TA 2X1FA 4QU7A 2EW9A 1TKZA 3D1OA 3DRRB 4PG7A 2VQEJ 4NXNJ 1NK6A 1RA7A 2EPIA 2KXNB 5C24A 4QYRA 1J5OA 1MLAA 2EC0A 2BW7A 2VF3A 2ASLA 2W2MP 4K4TA 1QVGR 5HMYA 1FCAA 3EDRB 4ZLNA 2RHQB 4PZVA 5EGYA 3SI8A 2Q6BA 2HBYB 2Y1LB 1JLBB 2DR9A 3FMBA 4RW8A 4IOCQ 1FRHA 3W2WB 3M2VA 1SBRA 3UD3P 2N7CA 3L4BC 2J6SA 3QAEA 3BYPA 3MMCA 4N8OA 4LR9A 4OQJA 4U7UK 4I56A 3P8BB 3C3LA 5M2PA 4IG0A 5HBMB 2IAJA 2RT3A 4I2QB 2VHGA 1SC1B 5LMUJ 3EVOA 3VAMA 2DR6A 1S5ZA 2AGPA 5FLXU 3KMSA 2IHR1 2MLYA 2QYCA 3V81A 4WTYA 3BR8A 4O4GA 5KT2A 4J9OA 2C28A 1AFIA 1B99A 2AP6A 1X4EA 2D74B 3SDEB 3U1MA 3D3BJ 2MQPA 3CCQS 4B9TA 5HROA 4L76A 3E01A 4OZ3A 4DPWA 2XMMA 1CJVB 1URRA 4AYBD 2IM1A 5J2NB 1YQHA 4DI6A 3IM9A 3MR3A 3M1VA 4Y0FA 2J9DE 1RTIA 5F8IA 3QZ7A 3G71S 5E3AA 4JI2F 3KK1B 2A2CA 1I94F 4DSIA 3GJTB 1TFYA 1VQ4S 2ZOMA 3H2UB 1FDAA 4G1QA 4DV7J 2UUBF 2XLKA 3NNCA 3UCGA 4O4RA 1VIXA 3TEHB 2YQ3A 3RRGA 2HMIA 3MUVP 4LSLA 4DSLA 5LJ5Y 1FRIA 4M5DB 1Y10A 1YSJA 2CNOB 1L3KA 2FZGB 3AB4B 4F0KA 2HK3A 2J0XA 3IWXA 3PFOA 3ZTSA 2A6MA 2HGNA 2WOMA 3OFFA 3P3DA 4GVLA 3PIOQ 4RU2A 1TL7A 1WNEA 4UUWA 1VK3A 4G1PA 1RI7A 1EP4B 2IJRA 1FWKA 1YZ6A 1H6KX 2H5JB 3H8YA 3MPDA 1T11A 4OYIA 4I2QA 5E3CA 3OFHA 2XO7A 1Q82T 4DCOB 3OTOF 4BDPA 4HHUA 3TAPA 5IZHA 1M5VC 1M1HA 3I0SB 1FD2A 1GMWD 3I6PA 3P5BP 3OTOJ 2QC3A 2B9EA 3QT8A 1DLOA 4K7QA 1FTRA 3G96A 1S76D 2R7OA 4NLWA 3M4XA 4Q44A 2W9BA 1U47A 2IMWP 3D6MB 4EZ6A 4WIQA 2QMUB 1YRUA 4PCQA 3CULA 2XNRA 4AL6A 1FVSA 2BQRA 2FB0A 2RRBA 4KRWA 1TKXA 3I55S 1SB6A 3ZTOA 5KG1A 4Q2LA 2BABA 1B0PA 5IWAF 1EP4A 3H5YA 4WU3A 1T9YA 3CIMA 5DJBA 2VIHA 1U1KA 2HURA 2F65A 1REVA 1U1LA 3OXFA 5D6GA 3HD2A 3MR7A 1TKZB 2HWTA 4F4AA 1TFWA 1YJTA 1QAXA 1SL1A 4UF4A 3JTNA 3Q8PB 4DR3F 2AT1B 3H0PA 2HQCA 2YWWA 3UD4P 4CCHA 1TV6B 4ICLA 8ATCB 4TQRA 1LXJA 2IC3B 1U1RA 3HP6A 2WSCC 3M8PA 5HLFB 4CO1A 4IRCA 3OLBA 4DOZA 2O3DA 1T0TV 4TLQA 3CJKB 4RW6B 2ZM6F 4QPTA 4UZBA 2E1AA 3DOLB 4NZ7A 5EHHA 1ZPWX 2FJWA 3D67A 2FD2A 1R0AB 2GGPB 2ZM6J 1UETA 1KDNA 1SIZA 3R1LA 1XJWB 2ZITA 3CMQA 2YWKA 3SCLE 5CYMA 1XR6A 1GXTA 1HHTP 4OFZA 1FD8A 1TL5A 2APOA 4WZMA 3FC9A 2BANA 3IRXA 1SJ1A 2OFGX 2RRNA 3HHLB 4CO0A 4ZIVA 2UU9F 4O3SA 1UWAA 5B0BA 5EX0A 3GIRA 3SFGA 3ZZYA 4BWJA 3GU0A 4F4WA 2JWNA 4FF2A 2AEFA 2AMCB 2M0GB 3I82A 1HI1A 2WRMA 3ISND 1B4SA 1F9FA 1S1WA 4H4MA 4NLQA 4EFAC 3QGIA 4CIOA 1APSA 4F3QA 4LBIA 1I1GA 3BPDA 1M5SA 2QGFB 4FBTA 4KYZA 2A1BA 2JLFA 4DUYF 4TLRA 5IV4A 3M2UA 3B6BA 4DV6J 3H40A 2P5VA 4M95A 4AXJA 1JLGB 2E5LJ 1JLAB 1F3FA 4GVBA 2PI5A 2GV1A 4X4QA 2RQ4A 3IG1B 1C4AA 3QT6A 5CH7B 2DR7A 2V69A 2DH9A 1U26A 2NXNA 4K2JA 5FD1A 1UWBB 2HNDA 3BGLA 2W24A 1VC5A 1HYSB 3UO0A 4YUDA 2H1YA 2V50A 1GH8A 1NSQA 1GMWA 4CT8A 1T95A 2UUTA 5C25A 4JV1A 5L46A 1K8AT 1VMBA 3OLAA 2CAJA 1Q8BA 2MZ1A 1KQSR 3WX4A 1G7CB 1R8BA 2A10A 4L74A 1Q86T 2HHQA 3PTWA 3F41A 1S9EA 2LQ8A 4UQTA 4USUA 2BJ3A 1JJHA 2DNPA 2GVZA 2NXCA 3H5UA 1F2HA 4OI2A 4DDFA 3MFIA 2FJXA 2V9WA 3H5XA 1Q8LA 3H2LA 1SJQA 5IOLA 5C42B 4RR5A 3ET6A 2W01A 3TEGA 2IIHA 3IG1A 3RYLA 3SFUA 4DEZA 4EUVA 2KRRA 1ELOA 2B4PA 1FX4A 1OYEA 3M2RB 4P10A 3M9MB 2JC0A 1GXLA 1P9QC 3LF0A 1Q5VA 4D3HA 4NLDA 5RUBA 1UA1A 2GJ2A 3L9ZA 2LXIA 2IM3A 2OPPB 4C7QA 4NWBA 2ZD1B 3F44A 4HL9A 3EZ5A 1AZSB 3MF5A 1MMLA 5DDOC 2Y8YA 1IJFB 4MKBA 3MMBA 4S0MA 2HFVA 5KG7A 1DZ5A 4KAIA 2XYPB 3HVWA 3TNVA 3KHGA 2UZAA 3Q23A 2U1AA 1U1MA 4PWDA 1RTDB 1YG0A 1RLCL 2IM2A 4IQXA 5A8KB 2M52A 2YQ1A 1WI8A 4KO0A 2IA6A 1S99A 4C6AA 1Q7YT 3TVZA 4U95A 5DM6Q 2YNHA 4LF1A 2QO3A 1VRUA 2QLXA 1YTYA 2WBMA 3Q86A 3RRHA 2RVJA 1NKEA 1FJEB 4LQ3A 5CZVA 1TKTA 1J5EJ 1FFWB 1V3RA 1QSLA 1T94A 2ZDOA 5DZ6A 2W2QP 1PC5A 2GIFA 3MAAB 3BDPA 1Q8IA 3Q89A 4QWCA 3MD1A 1F60B 2WVCA 2IVFB 4AL7A 2LFVA 3N5FA 4Y00A 3LWLA 3H4BA 4GC7A 1RT4B 2E1MC 2QG9B 2HYIB 1UJ4A 1ZZFA 3THTA 3KLHB 4PRFA 3HKWA 4DV5F 3NWGA 1WEXA 4USJC 3ZO7A 2OD6A 3CPWR 5E2QA 4X66F 2MHEA 2XI3A 3G8SA 3UWTA 2LQ5A 4LF4J 2NQPA 6FDRA 1T9WA 1YRTA 3N9UC 4OJHA 3LUYA 2P8IA 1XBWA 4UTGA 5L1KA 1VRUB 2MJNA 3K8WA 5DQIA 3BEGB 2QV6A 4H4KA 4JBCA 3VCDA 4O0IA 1RTHB 4RUHA 1NH7A 2R8GA 3UNGC 2Z0GA 2DIUA 4OYMA 2HVIA 3QIPB 2GAGC 5T7LA 1U6FA 2AZ1A 2YKQA 3D68A 1VRTA 2KFYA 2B5JB 4HH0A 4USIA 2CNKB 3R1HA 2PO4A 4LSNA 3QIDA 2HRYA 1C0TA 3D1QA 3CCRS 4WTOB 3PX6A 1VCTA 3M6WA 2ZC4A 2W4DA 3NWRA 2XSJB 5T14A 2E7WA 1LWCB 1IBLJ 2KZMA 2RKIB 2VG5A 1VQSA 3H5SA 3QO9A 2W7PA 1ZTWA 2GIRA 1C1CA 3LGNA 1JLEA 1S9GA 4ELTA 2FIUA 4DV4J 2BM1A 2W7OA 1HI0P 4C8KA 4H4KC 4PEOA 2J7UA 2F3JA 5K14B 5KG2A 1X0PA 2B8QA 3TAMB 3PVXA 1FKOA 2ASYA 2BE7D 3NGTA 4OZ0A 4OHVA 4DS4A 1XNRJ 2D9OA 1L5UA 4DFKA 2M5YA 2O1PA 4OJGA 1HWIA 3GONA 2HHUA 1XR7A 4O3RA 4ANCA 4F36A 3BQ1A 2XY7A 2I6WA 5HL7Q 1S49A 2XO6A 1N34F 1Q7LB 2CWKA 3EGVA 1WORA 1UVLA 4XIUA 1X4GA 3KLFA 4IO9Q 2NLWA 1SQEA 1MWQA 3IXQA 5KG3A 1HL6A 4RW9B 3V81B 1HPZA 2KO1A 2NPIA 2RHSB 3CO0P 4HI2A 2GC8A 2OP5A 3ADAC 2N4DA 1CJTB 4OZNA 5I3PA 1WOPA 4UT4A 1NH8A 5HQLA 4DV3J 3P5TL 1K73T 2FJDB 4B9VA 1S59A 3I32A 3DLKB 5CQGA 1GXUA 4IFYB 4C0BA 2J8AA 4DR2F 1MSWD 4MYUA 4QU6A 3LP0B 3TUIC 1RSCA 2HZCA 4NZ6A 1ZTTA 1C1CB 4B9SA 4DR2J 4I0WA 1EHWA 4LT6A 2EKYA 3SQGB 3NGDA 4D3GA 3CW2C 1FA0A 1NPRA 1RP5A 1Z1ZA 2ZBRA 5J1NA 1VIOA 9ATCB 2KB2A 3JAMY 2FJEB 5KFMA 8AT1B 2I9SA 2DHGA 1MU2A 2SXLA 4LR8A 3TUZC 1WKLA 1RT7A 1WC4A 4Q7AA 1N5VA 5DETA 3KK2B 1HNZJ 2IYGA 3IRXB 3QWPA 1PJ5A 5IS2A 2MZTA 3KLEA 4IO1A 1VFJA 1Q79A 2WOMB 4LF9F 4AL5A 2CPFA 4DQRA 1JMTA 5AJ3F 1N33J 2P9CA 3PW4A 5D3GA 2ILYA 1PC4A 3FFIA 5BJRA 3ISNC 1LV5A 3CB4A 3LP1B 2HVDA 3RB0A 3HSJA 2MZSA 3GWCA 3DMJB 2WZ1A 2R9LA 3EPGA 2ATCB 3GTYX 4JI4F 1HPZB 2IRXA 4ANDA 4FS1A 3TANA 2DIVA 4F0HA 3DLKA 4TU9A 1R89A 5IFMA 2HK2A 3KHHA 1CJUA 1KLNA 1JB0C 5D77A 2C2NA 4K4SA 2JJ4D 3TJ9A 3KMQA 1JLCB 2J7WA 1QUVA 4RBVA 3GB0A 1RWNB 4WPAA 5K20B 2KM8B 4A8SA 1FKPA 2KVQE 1SC4B 2RUSA 5LSOA 3DHWC 2AYGA 3IS9B 1LW2A 2VPWB 4MIBA 3CC7S 2UUWA 3DLEA 1HNIA 2PFFB 3H98A 3T1AA 4L3KA 1CEZA 2D69A 1LWEA 2V9KA 2R7QA 4M94A 2P9EA 2UUAF 3K5NA 1QJHA 4AT1B 2FYXA 3D6FB 4IYQA 4QQBA 4X4VA 3RG6A 4Z2XA 4TU7A 3PHTA 2JLEA 4BLGA 1J2VA 1ZM2A 1KQGB 4CYUA 4I67A 1KVJA 1LWXA 5LJ3Y 4HR2A 2ZH7A 3MAHA 2YWHA 3PRDA 2KN4A 5C2GA 1LWCA 2C42A 3NGKA 2NREA 3RW6A 1IKVB 4NLRA 4Q45A 2QLJB 2V4QA 4DF8A 1N54B 2G0IA 1TVRA 2NXUA 1VS3A 4FPIA 4HT5A 3ISZA 4I4BA 1ACMB 5F9NA 3V6KA 3HPOA 2RS2A 1M0SA 3MM7B 2GCFA 4EBDA 3C8YA 3RB6A 2OELA 1E6YA 4L75A 1N32F 4EBEA 2A18A 1NHVA 4RW4A 2Y1JA 3FBBA 3AOAA 3HSZA 4I2PA 4KH1B 1GX6A 3PW7A 2MY8A 1WD6A 3A8IA 2ZH2A 5M2RA 4WXOA 1OIAA 4CZCA 1IR0A 4TY9A 1S0NA 3BSNA 3H20A 1LW2B 3TWZA 1LKZA 5HJXA 3ZZTA 4C48A 1BUXA 2W9CA 5LM7E 4FF1A 4PG5A 1T05B 1U4BA 1TK0A 1WSVA 3DGVA 4J5OA 4LIRA 4ITSA 4ES3A 3GV7B 3G9CA 3R2CJ 4DPOA 2XGQA 2J7KA 1CJTA 2D41A 3ELHA 4F3MA 2BKOA 3H4DA 2KJWA 4C8LA 3FSIA 4OX6A 1C1BA 3GCWP 8RUCA 5I42A 4JB8B 2XMVA 1Y5NB 4BC9A 4GC6A 4ZMMA 2UVUA 2RJZA 1TMMA 4KGXB 1O5JA 5GAEU 3K17A 2E5HA 3MM5A 1S1TB 4F3OA 1Q8KA 2W4CA 1LEOA 2J0SD 3SV3A 3MPVA 4HKQA 2V8PA 4H4MB 1KNZA 1PYTA 3DRPA 3AOCA 4P7TA 4KR0B 5K8OA 3KLIA 1MU2B 4EYIB 5ADZA 4DU8A 1CVJA 2MKSA 2AX0A 1IQZA 2KT5A 2ZKUA 5L1LA 1WTBA 4F4KA 1KVKA 5LMNF 2QJ3A 3DOMA 4CO4A 1VOMA 3W3SA 3OTEA 4WK1A 3HX9A 3OHBA 1JLGA 4DR6F 1Y11A 5DDQC 1VRQC 3M9OB 2JOQA 3KG1A 4K4VA 2PN6A 3K58A 1NEEA 3C6TA 2EG1A 1FDBA 3G87A 1VJQA 1ZAXA 4RNFA 4UQGA 2HBQB 3PV8A 2AQ4A 1NK9A 4B3MJ 2RQMA 4OZJA 4C8YA 4NLVA 2C3PA 1X8DA 1RU1A 1ZAVA 2Q3PA 2F7VA 2GHPA 3WC2A 2W2PP 3TUPA 1S12A 4CRJA 1N5YA 1WJ9A 2HGMA 2LDIA 3T5LA 3ZXWA 2MLZA 3ITHA 2DEIA 4KQZA 1T3OA 2M7SA 1TTHB 4A8WA 5ETSA 3T1HF 2AW0A 1HLWA 3CCTA 5KFTA 3RW7A 4W98A 3OL8A 3K5LA 4DMZA 3T1HJ 4U8VA 2XHCA 2R2RA 2JNJA 4F4XA 5DG8A 3SDEA 2ZH9A 4DS5A 2MGZB 5LXRA 4RUCA 3T1YJ 1EX8A 5E41A 4Y3CA 2PMZD 1YHQS 3DLGA 1B0VA 2O01C 3MCMA 3B4DA 1OMSA 3D3CJ 4IH5A 4O3QA 5HMXA 1YGYA 2D3OR 4N56A 4U9RA 5LSRA 1UVNA 4X62J 4PUOB 2R7VA 3I87A 4FYWB 2LLZA 3FK4A 3JQJA 4GMKA 1MWYA 1NRKA 1RHJB 3GYXB 3NCPA 3PW2A 1H74A 1E6VA 2GX8A 5D15A 3DGPA 5SZTA 1TQLA 2V4RA 3CIZA 4KSEB 3VAGA 4J37A 2AYBA 4LFAF 2J9CA 2DNYA 3GJRB 2X1BA 3QPIA 3O6QA 2CQBA 4FVCA 2CADA 4ZPVR 2ZHBA 1D0EA 4G6VB 4YR0A 2K7KA 2AYEA 2XS7A 2Z57B 5ETRA 5F9LA 2HZVA 3KK2A 4CWBA 2QA4S 1KKHA 3Q0AA 2DGSA 4ZVTB 4M5HA 2B7BB 2UU9J 4NLYA 1M1KT 5D4LA 2XBPA 3QGHA 2H54B 3W5ZA 3NMAA 1AB8A 1W2IA 1BY9A 3W9IA 2XS2A 1N8RT 1IM6A 2OSRA 5G0RA 5CHCB 3GG1A 3O44A 3TZYA 2EFQA 3R97A 4PWDB 4RL1A 4J9MA 4UOCA 3TW0A 4H4OA 4DCJB 3RAXA 3U1LA 4ZVRB 2UV8G 4DZ6A 1UPMB 4C97A 4DL0C 3ENQA 3T5JA 1SJRA 4MFBA 4CTAA 3MCNA 3QBCA 4A4JA 5KG4A 2WVEA 3R5GA 2M8DB 4W92B 4K4UA 1C1BB 1KR4A 1N5QA 3LP0A 2DRAA 2OD4A 2NR0A 3QRQA 1GFWB 2K8GA 1D3WA 1SKUB 4I6YA 3B78A 5H1SV 4K4XA 2CQDA 1U1OA 3MAAA 1MN9A 4F04B 5LL6d 1B70B 3JTOA 4ZPBA 4PQUB 2FLLA 2AX1A 5C25B 4IH6A 3G4SS 2GFFA 4OYWA 1VQ7S 1YJ9S 2VG6B 3BKFA 3OTBA 1TK8A 2ACYA 1K9MT 4YHHF 3G6ES 5I42B 3OR1B 3GFXA 4MTPA 3C19A 4R5PB 1Q81T 2HHHJ 3RBZA 4X4OA 2C2KB 3JB9k 1YJWS 1JLCA 1W7WA 2L9WA 3HHLC 3GSIA 1K1SA 4GO7X 2VG7A 1FNOA 1N48A 2HHHF 2VONA 4IUFA 4JI7J 3PRBA 1HA1A 5DGAA 3WIUA 3TZXA 3UD5A 2V5HG 4ZA1A 2ZDPA 1WHXA 3LGMA 5KFFA 5MLCV 1NU4A 1T02A 4LFBJ 1NBEB 4FDFA 4DR7F 3FZBA 1XMOF 3D9BA 3GG0A 4KH0B 1HMVA 1Y5LB 2CJ9A 2JVOA 4WXWA 4BWMA 2Z2YB 3C16B 4WZQA 3EICA 3LP2A 5KFJA 5HROB 1C0TB 1A9NB 3TX0A 3PDNA 4PYDA 1WHVA 3BKTA 1AXQA 3POTA 4X64F 1F9HA 1FE4A 2K06A 2LEAA 2IVYA 3GR1A 5HQ8A 2BE9B 5J2MB 2C22A 1S0MA 2AD9A 3HHLA 2DHAA 1WEYA 2DXDA 3D0GE 3I0RA 4K4YA 2BANB 3TARA 4YFUA 5A8KA 5IT9U 1KSPA 4RO0A 2C2MB 2MSTA 4KBIA 2CIMA 3W62A 4YB1P 2V2VA 4C9DA 1G2EA 2C3YA 3VGTA 1Q0NA 1WHWA 3AJ2A 2KHDA 3FVYA 2XS5A 1LWEB 4ZPDA 4ZP9A 2HMIB 1RHRB 2QX0A 1VI7A 3DC2A 2Y1IA 2IJFA 4Q0BA 5IV3A 1IUJA 2IFXA 2H4YB 2FQQB 4HDGA 2BA9A 2CZVC 2F8EX 3I31A 4NEZA 3J7Z5 1YITS 1F2GA 1VGYA 3CC4S 4J9NA 5HN0A 3OQ2A 1IKYA 3NG8A 3QSIA 3C66A 2DNKA 4C0OC 5L9NA 5HVFA 5KT7A 3OJSA 1NLKL 2HLTA 4K4ZA 2OPRA 3HZEA 1IXKA 7FDRA 1S7IA 4UW2A 3Q8QB 3D5MA 4A8MP 4X4RA 4KGKA 4YR2A 3FFIB 4OZLA 4ILLA 1UWBA 2HWIA 3MECA 1JLQA 3Q8RB 4TQSA 4FXVA 3DN9A 5GVQA 4ZCIA 4X66J 2VFUA 3MEDA 3DHXA 1U0HA 1DLOB 5GAGU 3VAHA 3DI6B 2PA3A 4NMLA 3RBXA 4K5SA 3IO1A 5GAHU 3PW0A 4DX5A 3PFEA 1CJUB 2WW4A 2RU3A 3PR4A 4ILRA 4PXBA 4QWEA 4OI3A 5L39A 1VRTB 1GMVA 1PCAA 3KLEB 2HNDB 2OFHX 3T41A 3N6MA 2Q79A 4K8RA 3A12A 1ZZNA 4HYKA 2IRUA 1YVFA 5HBMA 3VQTA 5GMKa 2DRBA 3HDSA 3EE3A 3N79A 4UY85 3OUYB 2YNGA 3M30A 1TL3B 2YNFA 3BM7A 3MECB 3W2VA 4X65J 2ZNZA 4H4OB 1JLEB 2H4WB 3DU5A 2XEXA 4DV1F 1LW0B 1U8SA 2G2YA 2YKNB 2F9DA 2DGXA 5AE2A 1XN9A 2PT0A 1ZOTA 2Z56B 4AUKA 4DV1J 2DEJA 3V6DA 3PXGa 4P73A 4CYUB 1F1BB 2BJ9A 3NEKA 4O23A 2CWXA 3CGIA 1NDCA 1JK9B 2GMHA 1RHKB 1WKKA 2WONA 3F56A 3N6LA 4FP9A 2CVEA 3QZ8A 5E7OB 5J2NA 4DR1J 3CCVS 1FF2A 5KAKA 4JI2J 2R3VA 2R7XA 4WE1B 4NASA 1TL7B 5AXLA 2BOPA 1SC3B 2WBRA 2DGWA 1U0HB 1FHTA 3QLHA 2HBZB 3IC1A 1Y0HA 3ITHB 1WOOA 2BMBA 2VG6A 3N01A 3PO4A 5JJBA 4XDCA 4BS2A 3MM6B 1RTJA 3UN5A 5EWFA 4X4PA 4A8YA 3TA0A 1X9MA 2MZJA 1RCOB 1ZAWA 5E3PA 4A8XA 3IAM9 4NCGA 5JXSA 4XPCA 4EK2A 3MUTP 3JXOA 2FGCA 3MCOA 3MEGB 4C2MA 4PXDA 5GAGI 3SYZA 4EI2A 2W9BB 1G1XA 4B9UA 3ENAA 3EM1A 4DL4A 5BR8F 1RT5B 1MG7A 2P2CB 3I0SA 4ZVQB 3WX8A 1VQKS 1YLXA 1KFSA 2EXUA 3CNQP 3M2UB 4LREA 5C7PA 1N4LA 2DYAA 4CI0B 4KV8B 3I5AA 1REVB 2LQ9A 3CJQA 4MH8A 3CO9A 2AIRB 3FMWA 5ETNA 1BQMA 1AFJA 1R3NA 1TL1A 3SIPB 4ZP6A 1PIEA 2XYHB 5ETVA 5KFEA 3C14B 2D1CA 2IJNA 4YOEA 2EFPA 1FJ7A 1B0TA 2EBGA 2R7RA 2POKA 2FVSA 1N52B 4OZ5A 2B5JA 1TVRB 1CQMA 1R0BG 4NX9A 3R8YA 3HFKA 5KFUA 3BO3A 1XMQJ 4FBUA 3LAKA 3EYZA 4EMDA 3GSDA 5C5JA 1B7FA 1VJWA 1N33F 4KC5A 2HBRB 5CAAA 2N3OA 4LF7J 3MXHP 2VFVA 2XC9A 2HHWA 3KG4A 1HQEA 4DR3J 5KG5A 1NM2A 2H5EA 2Z30B 1RT2A 1IBLF 4FPRA 1NZAA 3AHPA 3JQKA 1VHFA 1AYEA 4NCGB 3X3UA 5DQHA 3TAQA 2XB2D 4ILMA 1N0VC 5F8NA 2F1FA 5HLFA 4X2BA 2AV5A 5F8HA 3M32B 1HD1A 4CLKA 3FEYB 1WUUA 4ECQA 4DL6A 1JNRB 2MQNA 3DYAA 5AT1B 2BACA 2VPZB 2DY1A 2ZHAA 2HHVA 3OBIA 2OUGA 3BH7B 1FI4A 3GILA 1RK8A 1FKPB 6AT1B 3SCKE 2FLNA 1GEHA 2YNHB 3DOKA 3C6UA 4QR1A 5KFLA 5D0HA 3D2WA 4PQUA 1H7XA 3NRBA 4DQSA 4IFVA 1GTHA 3WDOA 1PYOB 4PXEA 2HQGA 4G1QB 3W61A 4WKYA 4QR0A 3J81j 3AXKA 5KT6A 1P1LA 4O0NA 5GAEI 2L9NA 3FSYA 4ZN1A 5B0CA 2UXCJ 4V1Ak 5C2CA 4MFBB 1YZ7A 2DRDA 4CTAB 1WF0A 1N56A 1C0UB 1CJVA 3O1LA 1K47A 3BDEA 2YKAA 2LVWA 1H7WA 2XMUA 3K89A 4CO5A 4DR5F 2B0GA 2PIIA 3DLLQ 2FVPA 2V8VA 3OT9A 4JYAF 2EG2A 3VV2B 5KOXA 4QIGA 3W5XA 4JV2A 1QAJA 2MHNA 2FJVA 3D6TB 2FLPA 1ZYQA 5A8WB 2IVMA 4CM2A 5DZ7A 3KLGA 1RT7B 4ID5A 2ASDA 3OR1A 4R5PA 4QYZJ 1Q4RA 4NRUA 2FUG9 3EGWB 1FESA 3SSSA 1X7VA 1H98A 3QIPA 5T7LB 5E3RA 4WK3A 2BM0A 3UR3C 4CP5A 3Q8UA 2KM8C 4HEA9 3MOZA 1P27B 2GNKA 1RYRA 4ED4A 2OHDA 4IR1A 4MT1A 4WE1A 2KVIA 2ZZMA 4EWTA 4OYPA 4ECVA 1KONA 4IDKB 1JJ2R 1IR2A 3UCUP 4M5GA 3OFGA 2IBOA 3CC2S 5ITHA 3R5BA 3DMJA 3R5AA 5D4OA 5L9XA 2ZH6A 5C24B 2DNMA 4OZ1A 3BKUA 5A0YB 4G65A 5KFQA 4JV5F 1VR6A 2B8PA 3CTRA 5F41A 3PR5B 3CJ0A 3IN5A 2HFUA 1KQKA 2IBKA 1ICEB 1MROA 2ILZA 5KT4A 2AGQA 1X5OA 2ZZTA 2KFNA 3A8JA 2IMOA 1KBRA 4NPOA 4DV2J 2RKIA 3QO9B 4PQAA 2W2NP 3QMQA 3PJ9A 3W8PA 3JTPA 3OR2B 1UAWA 1B64A 4N7TA 1M5PC 1BLUA 4ENOA 3R6GB 1VISA 5A8WA 1DQ8A 1YJUA 1DBDA 2VV5A 3DRPB 3KNGA 5G0RB 2Q66A 4B02A 1IKWA 4R0JA 3BO2A 5BYSA 4RUBA 1RBLA 3WZ0A 3OL6A 2R2SA 2I38A 3KWMA 4LVNP 1Y3JA 4HHHA 1NUEA 4LJMA 3S1TA 5HP1B 3RR8A 1ZS6A 1FERA 1LW0A 3W8GA 4CT9A 3MMAA 3RB4A 3K5PA 3IMQJ 2QLFB 3MMCB 1RLDA 2A0FB 1WC5A 1VQ9S 3KTQA 2LU1A 4DUZF 2VODA 4KT0C 1S57A 4OJ3A 4RWXA 2VBZA 3HI9A 1RT1B 3M6XA 1HHQA 2LCWA 2X7IA 2ADBA 3I56S 1RT3A 3SZ2A 4B3MF 2ROGA 3TA2A 1CBKA 1YJVA 3HT3A 3GIJA 2HVZA 1M90T 1FDDA 2K1RA 3PX4A 3N28A 3V4IB 4CDIA 1IBKF 3MR5A 4WFYA 3TQEA 1RTHA 2LKZA 3MM6A 3NGSA 2CJAA 3QQCD 4H54A 3W1YC 3W63A 4DSJA 4I2PB 3GIMA 4NLGA 2E5JA 2HVEA 2MMYA 3ULHA 4U6PA 2DGUA 4LF4F 5IC6B 2QMXA 3QWUA 2FGOA 4ZVOB 1N32J 5GADI 4CNZA 2EVZA 2ABYA 4DR4F 3T1YF 2DR8A 3HT0A 4DSFA 3GQCA 3DKDA 1AUSL 4K4WA 4C3LA 1EZZB 2G0CA 1RT1A 4E8UA 2H48B 5ETTA 5D0EA 3NGUA 1KHWA 4OV6A 3RU0A 3C16A 4OHWA 4QWBA 4Y2AA 1U09A 1S9FA 1IBCB 5DGBA 1N36J 3P49B 3BJYA 3LPYA 1SUQB 1ZA1B 3VVUA 4NCBA 1R8CA 1WG1A 2CNNB 2DNQA 3BV8A 3GP9A 3GJQB 4LRAA 3PX0A 4ZP7A 3N6NA 2FY8A 1T9UA 4BHQA 1C4CA 1GNKA 4A46A 5AE3A 5KFKA 2JVRA 3L95X 2AYMA 1YBTA 4X4UA 4HI1A 3KG0A 2G1HA 1REGX 3ICLA 3HSDA 1WELA 1CPZA 1QM9A 3LQVA 1HNIB 1T9XA 2V2KA 1RU2A 4IG0B 4X84A 4ED7A 2W2OP 2H9ZA 3K59A 2KXFA 3DRSA 2ZBIA 3T19A 3R2DJ 2CPIA 1EETA 2XCPA 2HLUA 1Y9OA 1I5OB 1VQMS 1BC6A 3AA9A 4P71A 4RW8B 1R31A 3QAUA 3T5KA 3JSMB 3V4MA 1HNXF 3GFYA 1N34J 3KXDA 2C2RA 1SIWB 2QTWA 4J9LA 1PJ6A 4IFYA 3M2RA 2V63A 4V19X 3W9JA 2VBXA 4URSA 3UN2A 1VBYA 4RNHA 3HLUA 2W8KA 1NKBA 1X4HA 2P9GA 2VFRA 2DNLA 1JLFB 2WB1D 2P6SA 3M6VA 2U2FA 3LH2S 2RUGA 3NS5A 4L72B 4P2FA 5IM0A 2MKIA 1BGXT 3MEEA 2A6OA 2BKNA 3A8EA 1F5BA 4TNOA 1UW9A 4OMFG 3UDVA 4ZHRA 1JX4A 2E9ZA 2MQLA 3HO1A 2VKZG 1ZETA 1SJ3P 4C8MA 1F9EB 1YX2A 1TK5A 1I3OB 4LSLB 2C2DA 2QSFA 2GHWA 2PEBA 2N3LA 3HXMA 3GMGA 1NHUA 2V6AA 2WONB 3BB5A 4O44A 4FXDA 1YIJS 2BYCA 2L48A 2QL9B 3IM8A 5ETQA 5IT4A 4ELVA 3HJFA 3EXYA 4JI8F 2L08A 3MCSA 4QWDA 3OSPA 2ZBQA 3G86A 5DM7Q 3EMTA 1HBNB 4NE9C 1BQNA 2FDNA 2NSCA 2RDJA 4ZLPA 1X4CA 2PGCA 4OI6A 3C15A 2BQUA 1BWEA 4FYVB 1NSKL 2XYGB 3LP1A 1OQ6A 2YKMA 1RWVB 1XNQJ 4LF8J 1WEZA 1S48A 2KYZA 3NBPA 1UKUA 2AJ4A 3PIPQ 4ED0A 3MEKA 4FYYB 4ZK7M 3CCJS 2QT7A 3ETOA 4WU2A 4USWA 2BR0A 4LF9J 1ZH5A 1RHMB 2FJBB 2JX2A 4EO8A 1YRXA 1KC8T 4A8OA 5C42A 4U96A 2QL7B 5HAOA 5LXYA 2DT9A 2OSQA 4Y2CA 2RRAA 4PG4A 1RQ0A 1T03B 1CS4B 1OQ3A 2B4OA 3UCZP 3FRZA 2CQ3A 5DLGA 3BR9A 3D28A 4YDDB 2DBBA 3PZPA 4MK8A 2GIQA 4FKYA 4EZ9A 3MWBA 4N77A 4ZPWR 4CH0S 3CE8A 2YVSA 4ZPCA 4OJ1A 4KHMA 4B3SJ 2W25A 2JC1A 4M1KA 3A13A 4K2XA 3NLCA 4IR9A 3EUNA 3KJVB 3S6EA 1NK5A 3ET6B 3BQ2A 2OPRB 2X3GA 4UOHA 2GJFA 3MUMP 1VLYA 2VQEF 2ZJRQ 4HTJA 3AB2B 2HIQA 2OEJA 3QYYA 3OVSA 2R42A 3RB3A 4KPYA 3Q8VA 4W90B 1U1NA 4Q0BB 3CDAA 3R5JB 4J9PA 4C4WA 1HQEB 1RYSA 2QA2A 5HSPA 2PSZA 3OW2R 3VAJA 2MYFA 2RNEA 4O4GB 2DO4A 4ICLB 2BJ1A 2DXEA 1RWUA 2BE2B 3EDQB 3CCLS 3P45B 1URNA 2XHWA 1NJWA 3DRSB 1P6TA 3LWMA 3CCUS 4MKVA 3A1YG 2HFZA 1Y3KA 1NDKA 2QLBB 1CG2A 2HQFA 2LEPA 2XTJP 2X1AA 4OHYA 1NDLA 1X4FA 2B4UA 4KO0B 1OPZA 3TJAA 3Q8SB 4YB7A 3OV7A 2B6AA 4PG8A 1RZMA 4LQ9A 1DARA 4K50A 3WHIA 2QYGA 3MEDB 1DTQB 1N0UA 2GO8A 1HBMA 1VC0A 2K7JA 1KLMA 2CG8A 3RBEA 2KI2A 5CYMB 2ZUAA 3ILJA 3J7YU 3KYLA 4ETXA 2CJYB 1ROFA 2WB4A 2VH7A 1U49A 4JV0A 3VWSA 1V5VA 2OPQB 2VU5A 3R5CA 1XWLA 3CF5Q 2C3OA 2BW2A 4DZDA 2BRLA 2RIJA 1EAYC 1LWFB 1X60A 3LOUA 2HRTA 2RSQA 4LR7A 2ZFHA 5KFGA 3G8TA 1VQ5S 4KHPJ 3LGHA 3DM2A 5KFZA 2ZJQQ 3CJRA 4WCEQ 4ES2A 1GT8A 2MSSA 4QR2A 2VJVA 1LFPA 2NUHA 3JQMA 4ALZA 5B0EA 2HQDA 4JYAJ 4DV7F 2OI2A 1TELA 1VLOA 4WFXA 4UOGA 2KG0A 2PE8A 2V8DA 3QFHA 2MQMA 1F3VA 3IS9A 5HK4A 3J7A1 5I3QA 3HMJG 4LF5F 3QLHB 2V0NA 1AUDA 3B8HA 3GZ7A 2R7WA 2AJQA 3M32A 3VQSA 2AEMA 2GJIA 1S10A 3E8OA 2KZZA 1GAOA 4LF5J 4QIVA 3VZIA 1JIHA 4ES1A 3B4MA 5B0DA 1L3SA 3VHQA 1HI8A 2CPYA 3I5CA 2G9OA 1UZHA 2AHOB 3CJ2A 3SSRA 1D9FA 1LWFA 1HBUB 4B9MA 3PJWA 4N8NA 1IBMF 4ZDNA 4KFBB 3PM9A 2PC6A 2Y9HA 2ZH8A 1VYAA 3CD0A 4J7CA 4K59A 1IBMJ 1FKAF 1CJKB 3GV8B 2OIHA 2XZWA 1PYSB 2F40A 3O5TB 2VBWA 3DNCA 3TP2A 1VQOS 1R0CB 2R2TA 1QSSA 3CD6S 4DR6J 1PAEX 2I8EA 4FNHA 4LUBA 2HAIA 4QIEA 2OJ3A 3PYEA 2OMOA 2AZ3A 4B3RF 4B3OA 2VUGA 2D3ZA 2DGTA 3DRXA 3BGFA 3DXBA 2JL9A 4XO0A 3MFHA 3CXCR 4XPEA 1RTDA 3KOAA 3MM9B 1KS2A 3HHKA 1HFEL 1U6ZA 3FKBA 4I64A 4KE5A 2WCXA 2XLIA 2HHSA 4WFNQ 1RT5A 1XR5A 2C1EB 3MMJA 4ECYA 2ZD1A 3M8WA 4ED6A 1FRLA 4OYBA 5IWAJ 1RAIB 4FYDA 2B9WA 4LF7F 1XMBA 2W4PA 1S1VA 1FXLA 2YWEA 5CXTA 3HSGA 1YJNS 1OYDA 2HSEB 4OX7A 2XZDB 4MKAA 3PYDA 3UDEA 4V19J 1HBOB 5B08A 1SL2A 2BJDA 3J81U 1HBUA 5K5MA 3VAFA 1NK4A 1VDHA 1RT4A 2FVRA 4JI0F 4NYZA 1HWLA 4DX7A 4DSEA 4MYTA 2NXJA 3KLFB 3R7NB 2OPSB 4NLPA 4A8FA 3PKYA 4QCLA 4ZCLA 4C98A 2UP1A 5CD4H 4LRBA 3DCAA 1LK7A 3RR7A 3CJ3A 4IOBA 1HQUA 2FZKB 4ZHRB 7FD1A 1M5KC 2BDPA 3NCRA 1YI2S 2NZ4A 4DX6A 2ZWPA 4DV0J 1RAGB 2GZOA 2RILA 1PG5B 5KFDA 2XCAA 3MR6A 2DVIA 2ZZNA 1K44A 3I0RB 2Z2LA 4PPDA 4P74A 2RAQA 3W2WA 2CPEA 5FDLA 1TKXB 2DKOB 1N5TA 3EGNA 4TY8B 2XG8A 3SCIE 4EEYA 3I4PA 5F8JA 1VQ6S 4YN3B 3HVAA 4IH7A 2GMJA 2XSFA 2HWHA 1DTQA 3E01B 4QJVA 4QBUA 4WFBQ 1HIYA 3ENVA 1RHQB 4R8UB 1A7GE 2VPXB 3PO5A 4DUYJ 3T6BA 4M5NA 3NGRA 4CLFA 2ALZA 1RHUB 3IAS9 2ROPA 5A8RB 4ZJQA 3UR0A 3SV4A 4LRFA 2OMLA 4N41A 2Y8WA 4LMZA 3TJ8A 5B0FA 2E5LF 3E3XA 3FJ2A 3J81Y 2VC1A 1NKCA 4GKKF 3AOBA 4F25A 3MGJA 3RBDA 1I51B 2I0XA 2E1PA 3GJSB 1FDNA 4GKKJ 3M8PB 4ZVHA 5B09A 1YJRA 4F2RA 2XI2A 3J80Y 3KDNA 2HRUA 4KGMA 4CM0A 1LK5A 2ZNYA 3MM5B 1SI9A 4USMA 5JMNA 1UW4A 1Q78A 4JI6J 3T9ZA 1TMJA 2G2OA 1S7HA 2CUYA 1JLQB 4NL5A 2EK1A 3P6YC 2GQQA 2DGVA 2ZWOA 1S6QA 3UVJA 5LT5A 2RF2B 3BBBA 5DDRC 2GAHC 1WI6A 2BEFA 3HVTB 1JXVA 1X31C 2ZOFA 1RT2B 3CD5A 4NYOA 4WFZA 4CNYA 3JYTA 3NCQA 2I2YA 5B0GA 2UUBJ 4RW9A 1X4BA 2XWXA 5HMZA 4BBYA 3CCZA 5CZXA 4AQYF 5HVHA 4M5JA 3NNHA 4NA3A 3PACA 5ETMA 2PMWA 1DAXA 4OLPA 4CLYA 2HQ3A 3DLBA 4LFBF 2J6UA 2HNYA 5EWEA 2CJQA 2W9AA 3FZ2A 3MM9A 1RWOB 4JP8A 1UJ6A 4DV2F 3H25A 1HNVB 1HNWF 4RW7B 1KQFB 2R7TA 2ZH5A 1QVFR 1U7LA 1FK9A 4KIAA 3GR0A 2H51B 2HS0A 3LA0A 2OTJS 4Y6IA 1FEHA 3BGOP 1RA6A 4Y65A 5J2QA 4X64J 5GMEA 2G4BA 2AGOA 1N88A 2ZE2A 2BBEA 2LA4A 3EX7B 2IM0A 5THWA 4ED5A 4CQ1A 3HKZD 4LFCJ 3ONQA 3CJTA 5JVHQ 1V6HA 3K7RA 2XMJA 3UE2A 4NLSA 3FQLA 4NRTA 4RWWA 1IN0A 2VBYA 3HZGA 3N0VA 3M2VB 1ITPA 1RWWB 4A8QA 4JI3J 3G82A 2J8SA 2XSJA 2RE1A 1J5EF 4DUZJ 3H42A 1NHKL 4LBHA 2MXYA 4OI4A 4ZIWA 4IRKA 2OH2A 1FRXA 5FLXY 3UI3A 1H72C 1R27B 3G6YA 5CYQB 3M8ZA 2GGPA 1FRKA 2YPYA 1EKSA 3HHNB 2IC3A 1KTVA 3IGVA 3RZAA 4BCAA 4PWWA 2B7CB 4CLUA 5J1PA 4FXWA 1VQNS 3VR1A 4TU8A 3OPKA 2HNYB 2LQJA 1UVJA 1IM4A 1NO8A 1RAOA 3Q22A 2BV3A 1OPIA 1S6PA 3IR5B 1KP6A 4ZVGA 4CH7A 5I3UB 2D3O1 1LNQA 3MM8B 1CSJA 3KFWX 2YKPA 2KT3A 4OYZA 3HF5A 3NY0A 1W25A 3SCJE 1NJXA 2JFKA 2YNIB 4NI2A 4OIXA 1RDRA 2IAJB 2MLXA 1WWHA 2WHOA 2NS1B 2DNGA 1H2VZ 1QAIA 1HHSA 1RAEB 3BO4A 1VQ8S 1NZ8A 2XNQA 2M8HA 3NS6A 2DNHA 3TAMA 3RTVA 1R6VA 1ZBTA 2X1GA 4NYPA 2VQFJ 3ZZZA 1UEVA 2DNNA 4WF9Q 5CABA 1PO6A 2XMTA 4DLGA 3G82B 3QRPA 3TZWA 1SJFA 3NMRA 1U45A 5KFAA 1R43A 3PEJA 2PEHA 4MAKA 2IY5B 2L9DA 1S79A 4X65F 5KOWA 1KRPA 2QL5B 4EU0A 4WKRA 1T03A 4HACA 2VICA 3EWGA 4I6AA 1QAYA 3AA8A 4DCPB 2YNIA 5GADU 1X0FA 3AQOA 4B3TJ 1QLNA 3UNYA 4RKUC 2HHPA 1PJ7A 1SUQA 2L3MA 4KKOA 3SEOA 1TUVA 1C2PA 2EK6A 5KFIA 2M9KA 1UVIA 2Z8QA 1FT8A 2E29A 3KK3A 1YK9A 2BRKA 2HS3A 3G6XA 4Q5VA 3EPIA 3BF4A 4URQU 4NI2B 5E3QA 3J7YI 4NLOA 2I1RA 2OEKA 4CLSA 5JVGQ 1HNXJ 1XNRF 1D09B 3U02A 1H0HB 1SKSA 2NXEA 4RU9A 1HR0J 2ZVSA 3AY0A 3D1HA 4RW6A 1U1QA 1MMDA 4J9SA 4I68A 5DRKA 2W9CB 4DSKA 5HJYA 1WF2A 4JI5F 1UVMA 5KFRA 3MTKA 2WW8A 1FJCA 1TV6A 3CVKA 2E66A 3K5MA 3V2UC 5BYQA 1F0XA 5KFWA 3TVKA 4Y28C 3V4IA 3DLJA 5ETPA 3OHAA 2UVWA 1D1UA 1RGVA 2LXUA 2FHMA 2OLWA 2RH3A 4FZVA 3NL0A 2J0WA 5F8LA 2VDIA 1FWLA 5F0UA 5K8MA 4ED3A 2FPHX 1NDPA 4KHRA 2EI5A 4M8LA 2AJ1A 4ZCMA 4YY3F 3R6LB 1FK9B 2W8LA 1RE1B 3FUYA 4WFAQ 1RTZA 1DRZA 1D8YA 2CPZA 1MMNA 4RUAA 1NK7A 2DO0A 1JJ4A 3PKMA 4YY3J 4I1TA 5AXKA 4TVAB 2Z2ZA 3OUYA 4GO5X 4QPXA 5KFNA 3KK3B 3OFEA 3M8QB 2J9DA 1CULA 1SVDA 3CDUA 2E44A 1UA0A 4DQIA 2CPXA 3NAIA 5D78A 4Z37A 1DFDA 2R7SA 3A8KA 1RADB 3R5DA 4OZ2A 2ERRA 2KKHA 4KJIA 4K0KF 2HG4A 1QUPA 3WIVA 4OI0A 2BJ7A 3L7OA 2M70A 4ZP8A 1XK8A 5B7WA 3A4TA 1ZA2B 5AJ3J 3K57A 1UCNA 3TQ1A 2HHXA 5IQQA 1K0TA 5E5NA 2NPFA 3T5HA 5F8GA 3C6UB 5K8PA 2KJVA 2YH0A 1Y7PA 4UY8T 3A3PB 3T3FA 1NJYA 2CPDA 4BC7A 5DDPC 3NP5A 1S0VA 2GVDA 1GK8A 1XQIA 3ZZRA 4F26A 4JI4J 4FF3A 2HVHA 4M5DA 2J6TA 3HVTA 4FKXA 3U7JA 2OGUA 3RAMA 2WK4A 2R8IA 2KXHA 2NZCA 4E0DA 2DD8S 2UUCF 4ATNA 2CQIA 3R27A 2M3DA 4IQMA 3EVWA 4KTQA 4Q8EA 3KK1A 2LDYA 1VBZA 1RCXB 2DITA 3VGVA 4R0EA 2L41A 2RQKA 2HNZA 2D9PA 2C2ZB 3MI7X 5A8RA 1BMQB 1EJ7L 3OXGA 3OTCA 2MB0B 3M8YA 1UVKA 1KN6A 3M8QA 4DPYA 1EETB 3BSAA 1OWXA 1BD6A 4CLWA 5DG7A 1SH3A 2JFDA 3CEDA 2R8HA 4LSNB 4WBFA 2LEBA 3J7AN 2RDDA 2A3JA 1WHYA 4DLEA 2ZEJA 1DTTA 3VALA 5EDWA 4ZVUB 3CJ4A 4DR5J 5J2MA 1WC3A 2Z4PA 1UP1A 1RABB 5H9EK 3G6VA 5F3TA 3TRGA 2W7AA 2ZUGA 1PBAA 2FY1A 3LPEA 3HM9A 2BVZA 4Q8FA 2Z2MA 1RKIA 2F63A 4ID8A 4ZPAA 2V94A 2C2OB 2D7SA 2FHJA 2NUUG 3EXCX 4LVOP 5D4PA 3W65A 3OTDA 2PI4A 2FTRA 2ZH1A 2G2ZA 5EUHA 3ZZUA 4C11A 2H5IB 3KJQB 1AZSA 1VQYA 2Y3YA 1S1UB 2Z58B 3D54A 1WACA 2FHOB 5LMUF 2DNOA 1GTEA 4EYHB 1QTNB 4DPXA 3UN3A 2YQ0A 1AROP 3QGPA 3K2YA 4EBCA 5EN1A 3I9ZA 3FBCA 4F8RA 2VASA 1RWKB 1FE0A 2EKNA 3MD3A 1S4EA 4Z7CA 5HVGA 4DL3A 3QJJA 3FGVA 2WSFC 4P2SA 1TKDA 3DLEB 2IPOB 2JEGA 1IJEB 2OEMA 4XK8C 3TX8A 3BSCA 3GE9A 4I69A 4USVA 5F3ZA 2R8JA 4P75A 4JV5J 2N82B 3GFZA 1WOSA 3MURP 4ECRA 2J0QD 3TZZA 1IWGA 5CA5A 5EX3A 1YDLA 3W64A 2P6TA 3UW1A 3KJFB 1I94J 3BH6B 3IBWA 2QFJA 2JEFA 1IVZA 1Q1KA 2F9JA 4DL7A 1FX2A 2QLWA 1RWXB 2C2EA 1DY3A 2MTLA 2QMWA 1CC8A 3I9V9 4IG3B 1BE4A 4ZVEA 4NLTA 5HATA 1RTIB 1VHIA 4Z7YA 1RAFB 3OVBA 3LTOA 1MNEA 2PFDA 1GX5A 4R8UA 4CO2A 2LU2A 2DPIA 1D9AA 2AF6A 3H2VE 4PYAA 4CLTA 2E1RA 1T9TA 2WVBA 2F4VF 5J2PA 3D0HE 3V5RA 1TL3A 2YNFB 2VG5B 1U2FA 4A48A 4F4ZA 3IR7B 1NB7A 1EQMA 1AW0A 2IRYA 3FBEA 2V4JA 2CJBA 1KOOA 1S4FA 1NAQA 2GHVC 5GAHI 1DQAA 4DL2A 1QE1B 1XTZA 4JI1F 3HD1A 2ZBPA 3NAHA 4PXCA 4F50A 4CLLA 4JI1J 4OHXA 3MM8A 4OLOA 2DY9A 1F5AA 1DJ0A 1U2CA 2NYHA 1K1QA 2QRRA 5KT3A 2CPJA 4RW7A 1WG4A 1UEUA 2V34A 4HTIA 4Q43A 1OY6A 1TU0B 3MEEB 5L38A 2HZAA 4PKDB 1S6UA 3UDLA 1DQ9A 5ETLA 2XQCA 4ED1A 2WVDA 4WIIA 4HLBA 4C3KA 4ZLJA 1ULRA 1J27A 3BGRB 2F8HA 3NS7B 4M5MA 3VGUA 2KTQA 3QSYB 3D6HB 4DN9A 1Y00A 3CCMS 2ALYB 1JQGA 3M6UA 3JSYA 1PKUA 3WQPA 1NK0A 1HD0A 3MEGA 1R7IA 2NYIA 2Q43A 1D8ZA 1V5IB 3L7UA 4I7FB 4DR4J 1NCLA 4KPCA 2CA9A 4J9KA 2AWZA 2GQ2A 1SPBP 3UVJB 1UPPA 3DDIA 2VOOA 2B4VA 2J9EA 3VAKA 4LSZB 5HANA 5HO4A 4JI0J 3K5OA 3W9HA 1Z4UA 3AH6A 4QW8A 3P4UB 2VA2A 1CS4A 1HW8A 2NCKL 3GLJA 4QIFA 5CYQA 4LFAJ 1UJ5A 1N5YB 4NA2A 2RD5C 2MKYA 2F5GA 2VZ9A 4LF2A 4ANEA 1QE1A 4JUZA 5J2QB 3HK2A 3SBMA 2VL1A 3OXLA 2ROEA 1WTFA 4USTA 1LOUA 2RDIA 1BQMB 3MM7A 1FKOB 3ZC4A 2PD1A 3QJLA 2YTCA 3HULA 2HW3A 3HHDA 4WP9A 4DV0F 4YB5A 4P52A 2CQGA 3J80U 1QY7A 1JJCB 2CQHA 1FEEA 3V6HA 1H2UX 1QSYA 3KHLA 4A47A 3BN7A 3AXMA 2E7VA 1KVIA 4KFBA 2MJUA 5AXMA 4O3PA 4C11B 1QTMA 4G1IA 1W2BR 2H3EB 4DPTA 5D3GB 3KHRA 2YNGB 2WTFA 4OYOA 4J9UE 3ILOA 2VA3A 2HKEA 1WC6A 3M9NB 3KJVA 4DN0A 2BJEA 1WG5A 2MZQA 1AA1B 3KUHA 3DLGB 4DL5A 2DPJA 2D3UA 5KFCA 2Q6CA 4A8KA 3FNNA 3IBCB 3ZTQA 2DB1A 3VZHA 4ETZA 5ETOA 4RNMA 3OR2A 5H9FK 2DHHA 3C2PA 2CQ0A 1RT6B 4RLEA 3ZZPA 1JXEA 4F4YA 1UMJA 4MJKA 5D0GA 5KFSA 3ZZOA 4JI6F 4LRDA 3UDCA 4YS2A 1R8AA 3DGPB 1HWUA 4LRCA 4YHHJ 3CCSS 1EIYB 3A3OB 4NZ0A 2OTLS 3E51A 3CCWA 4LBPA 1S1VB 1O8BA 4PR6A 3AQPA 3DDNA 2N7YA 4HT7A 3H90A 2V8GA 2Y0SD 3QATA 5KFOA 1WSRA 2B3TB 4CO3A 4JI7F 2OKQA 2R4FA 1IKYB 3TOQA 4Y2IA 2QA1A 1ZM9A 1FFGB 4TN2A 2F4FA 3M8SA 2EFGA 1RISA 1RWMB 4DR7J 4ECZA 1OY8A 3CWJA 4MIAA 2ASJA 4ERDA 2OO4A 1H3DA 3LAMA 3PRVA 4HACB 4P7VA 1WF1A 2QN6B 1VC6A 1RJJA 1HNWJ 4U8YA 3OD2A 4IOAQ 2E9RX 2HHTA 4AD6A 4YEAA 4ZN3A 1XMOJ 1IWAA 1EKRA 2W1BA 4AE5A 5T41A 1HQUB 1RXOB 4NEYA 1A0OB 2VC0A 1T7PA 5M2UA 1O0PA 3MMBB 3D7SB 3HHEA 5HI7A 4DG1B 4Y2KA 1GQEA 3FQKA 4L3NA 4ECSA 4L73A 5D0RA 4OHZA 1CQNA 1IR1A 3MOJB 2UVRA 1N5SA 1M1GA 1TUGB 2MPUA 5FDLB 1NK8A 3SQOP 1L3VA 2ZKTA 1TAUA 2LYVA 2CNLB 1B7YB 2B56A 2VD3A 3BN4A 4I7FA 4J90A 4N76A 2E7XA 1YWXA 2KYXA 4YMEA 3PYGA 4F7VA 4O3NA 3TO8A 4B3SF 3WC0A 2GO9A 3FBFA 2HS4A 2QFIA 4XDDA 1T3NA 3BS9A 2RMLA 2GA7A 3PJXA 4DHVA 2G1DA 5F8MA 1U2RA 2EC2A 3DRYA 4FN5A 4TKTA 5AE1A 2MGZA 4HVZA 2HPUA 3ZTRA 1RBOB 1IKXB 1SXLA 1YBAA 2ACMA 2CQ1A 2XULA 5K8NA 1TP7A 3KDOA 1VBXA 2KL8A 2Q1LA 4OI1A 2ZHOA 5DS7A 2RQCA 1VQPS 4UOFA 4DFPA 2G0JA 4NXNF 1G3OA 1ZM3A 1EB0A 4DV5J 1HWJA 5IQ6A 3PYFA 2XGPA 3ILLA 1HYSA 2V2ZA 1FJGJ 3HFZB 1WKJA 1LQ9A 5IM0B 4ED2A 5A0YA 2AJ2A 2BQ3A 3V6JA 3EZOA 2CPHA 3FDSA 3IFEA 3OJUA 3MTJA 2G13A 1FJGF 1S6QB 1U0SA 2JH3A 1JLAA 4K5RA 2DH8A 2MKHA 4MMOA 3GIKA 3MAQA 3NXZA 2DISA 5KG0A 3R3TA 4NA1A 4OV1A 3MMAB 1XEZA 2OPQA 4QOTA 1MN7A 4FYXB 4YDXA 3JSMA 3CMES 1FRMA 2B6AB 1S1XB 1EARA 5KFVA 1KLMB 5A2QY 4P9SA 2H65B 3THPA 2AEJA 2DH7A 5KFYA 3BYRA 1HNVA 1VQLS 2HFSA 2HGLA 2M2BA 2XMWA 3SMZA 4C8ZA 4YB6A 5FJ4A 3A3NB 1NNDA 2V4JB 4KHPF 3CT9A 1YJ7A 3D0IE 4NLUA 3Q2TC 4KY3A 1IKXA 2IDLA 3Q83A 1KWMA 2LECA 4ED8A 4F02A 1FO1A 3KLVA 3HHLD 2HEKA 1KHVA 3S7RA 2EFVA 4P72A 2QSWA 4DQQA 2FVQA 1X5PA 4OX8A 1EQ0A 5L8RC 2J5AA 3TUJC 5B0AA 4WWSA 5F0WA 4EGLA 3NOGA 2YX1A 2YWFA 2OPSA 2DHSA 2DJWA 4OYXA 4PABA 3AD8C 1OSCA 2CZ9A 1R0AA 4Y34A 2JHEA 1H38A 3UFCX 1SH0A 2HNZB 4DR1F 3AAWB 1SC6A 2KU7A 4B9LA 2KDOA 3HJVA 2GVDB 1X5SA 1SJ4P 5CD4A 2C3MA 4FS2A 3IP0A 2J76E 4RPFA 4WP3A 4PUOA 1V3ZA 3MPWA 2YKNA 3BGUA 1PBUA 1SKWA 2B51A 2LMIA 2DR5A 4X4TA 4DX8H 5L1JA 2K3IA 2MZRA 1PGZA 4KGZB 2CDRB 4QZVB 3MR2A 4DV3F 2AJFE 3ILIA 5E0OA 4E2FB 5BR8J 2UXBF 1FNMA 3IRWP 5H9EJ 1UFKA 2X51A 1OJ4A 3C46A 3TYTA 2MY7A 5DG9A 2DXFA 2UXBJ 1UFLA 4P2MA 2QA4G 4B3RJ 2A2DA 2GMLA 3PHEA 4NOHA 2NSBA 4ZPTR 5KG6A 2MQQA 1NJIT 1N6QA 3FCWA 4HH1A 3PW5A 1BXNA 1S1UA 4F0MA 4J9RA 2ZC3A 2IYIA 3CJSA 2YX4A 3WBZA 1XMQF
chains in the Genus database with same CATH topology
1A6LA 1JLBA 2EBEA 1LFWA 1FXDA 1S6OA 2K2PA 3UPFA 2M4MA 3F73A 3RAQA 2XLJA 2DTJA 1HNZF 4B9NA 2R7UA 1CLFA 1JKHB 2I5JB 4YR3A 2DCUB 3GFHA 4ECWA 2LA6A 1H2TZ 1O51A 2IA0A 1BQNB 1Y5IB 1IKWB 1LXNA 2COLA 2RF2A 3DRRA 2QA4G 2YKOA 1RTJB 2LXFA 4DJBA 3KLIB 5K9FA 5CCMA 2B43A 4R25A 1XNQF 3HVRA 4ZOSA 2DGOA 1PSDA 2CQ2A 2BZ2A 4LIWA 4ELUA 2XWYA 4ZS6A 4XAKA 3DI6A 1TAQA 2YY3A 3PNIA 3OL7A 2RS8A 2R2UA 1S0OA 4PG6A 2QZ8A 2RB7A 2E5IA 3BREA 4U67Q 1S72S 3CD7A 2JEJA 5MAOA 3U27A 4C8OA 3IGNA 4IG3A 1T05A 4JOUA 2PDAA 2RU9A 4IDKA 1XERA 1SV5A 4LF6F 4GKJF 2DHXA 3IWLA 5KTQA 1FNXH 2UXDF 1F5CA 2KFZA 2CQCA 1U6BA 1CC7A 3G8QA 3KNAA 2DCLA 3M30B 3W2VB 2O66A 4MK9A 4B17A 4HHJA 2KG1A 2E1CA 4FNIA 1Y4ZB 4YQWA 3MHYA 2MQOA 2WSEC 3QGGA 1R8HA 1Q16B 3I5BA 3P96A 3DDKA 4WJBA 3POTB 3MPYA 1S1WB 3SXLA 2UXCF 1JNZB 4ZKAA 2KHCA 3I4HX 2VOPA 1IKVA 1X4DA 1HARA 1SKRA 5D8HB 2MDAA 3SQGA 4DV6F 3DOKB 2ZJPQ 2ATLA 1X9WA 5JUMA 4UUXA 2CG4A 1TL4A 2ADCA 1E6VB 2QIFA 3LP2B 4AFFA 4Y2MA 1U1PA 3J7ZT 3DYAB 1TZ0A 2CFXA 4URGA 5IT9Y 1M5OC 2VB6A 1HBOA 2FVCA 5SUHA 3LW5C 4ECUA 2PA8D 1MW7A 1SV5B 4CH1A 1R6YA 2CQPA 1L3UA 3IWNC 3NKYA 2VFTA 3GYNA 2WAQD 3DU6A 3CJKA 4IFVB 4M63A 3BSOA 3CJ5A 1ZM4A 4WYLA 5DLFA 4ZCKA 3OVAA 1OS5A 2C3UA 1U25A 2JSXA 5I4MA 5EWGA 2K1RB 4FVMA 1DHMA 1P1TA 1V3SA 3TI0A 3KLGB 1S77D 4USHA 4RBUA 1Z2ZA 2DGQA 2CVIA 4C0HA 4RNOA 2YH1A 2CYYA 4DFJA 5CCLA 5KT5A 4NLXA 1KOHA 1RT3B 2JEIA 3FRYA 1JKHA 2I5JA 3FEXB 3JSBA 1S9GB 2JDJA 4N5SA 1HBMB 1Q53A 4I6WA 1OSDA 6FD1A 3X1LB 3OSNA 2ZE2B 4LFCF 3BZQA 1TKTB 4KKOB 4PWUA 1TL1B 3TA1A 3T9NA 4JI3F 4TY8A 2E9TA 2BUNA 2XY5A 3K0JA 1D9DA 1HBNA 5J1EB 1DTTB 2EFNA 4ZVFA 1FTCA 2GQCA 1S6PB 2KT2A 4NCAA 3IA0A 5CYJA 3GIIA 3CSKA 2VFSA 5H9FJ 3EZUA 1PILA 2MKCA 5A6PA 2YWGA 5KFBA 2ZH1A 3NBPB 3WC2A 2DNRA 2FC9A 3UQSA 1HMVB 2UVVA 3O2IA 4G3IA 3US5A 4EO6A 5IT0A 3LO3A 1KD1T 2EWHA 1IQTA 4X4NA 2Y1RI 3S01A 3PEHA 3CDBA 3M1VB 5DQGA 1V9OA 3M05A 2M88A 2VG7B 2UV8A 4QWAA 2FHJD 3CCES 3QJPA 1OO0B 2XY6A 2AJ0A 2N4CA 4QIWD 4C3MA 4E98A 5KFXA 1RKJA 4TXSA 4DQPA 4WYWA 3VAIA 4O3OA 2DK2A 2XMKA 2VQFF 4X62F 4MK7A 3L3CA 3AJ1A 3K8VA 2HQIA 3W7BA 4AXIA 2VPYB 3TVYA 1S97A 5G4DA 2CJKA 4NXMF 2V8HA 1KTQA 1P8GA 5K14A 2CDQA 4KV8A 4ID5B 1KEKA 2JZ5A 3H59A 3MDFA 5AXNA 1JXLA 1N36F 4ECXA 3VTIA 2FJAB 1D1UA 2ZH4A 3N5BA 3FEZA 5A6WA 4X4SA 4DV4F 3MZIA 3LALA 4B3TF 1BQXA 2OPPA 2FHKA 3JSRA 5J2PB 1DURA 4RZRA 1U24A 2DNZA 1N6QB 1SH2A 4DG1A 3CDEA 2YKMB 2FLOA 4DBQA 2JRSA 3JYTB 3G6ES 4N47A 5DO2A 3GV5B 2EFOA 3FCHA 3U1NA 4PPZA 3CDWA 3ENWA 2HFNA 5L1IA 4F67A 1HR0F 1MROB 5FIIA 2MKKA 1X5TA 4P6QA 3O8WA 4RX6A 3FSXA 3M8RA 2E5GA 1FVQA 3RRKA 5IXUA 3THVA 4IRDA 2HFOA 4U7CA 1FXRA 3V6DB 3EGZA 4DF4A 3DLHA 3SSQA 3DM2B 2B9YA 3KLHA 3BGRA 3DOLA 3TR5A 3C6TB 1T8EA 2R8KA 5I3UA 5LSLA 3Q2SC 4C8NA 1RT6A 3PY8A 4DWIA 1JWWA 1Z2LA 2B9XA 2CRLA 2CKWA 3I96A 2CZ4A 4L6V3 3Q24A 4IKAA 4B08A 2AU0A 5J1EA 1R8PA 5HMWA 3E2EA 2LQBA 3S8SA 3LANA 3DFEA 4DFMA 1HWKA 3VF0B 4RW4B 1UL3A 3CUNA 3ZFVA 5KFHA 5KFPA 1E6YB 5HP1A 3IR6B 4RBTA 2KH9A 1TR0A 2CQ4A 2PMHA 4LF8F 2BE2A 1MWZA 1S1XA 2O67A 4F2SA 1M5HA 4B3OB 4QW9A 1I6JA 1C0UA 5U47A 3N4WA 1VK8A 1U48A 2ZBCA 1HW9A 4FF4A 2O5DA 4MIWA 4TYAA 2QEXS 1ZPVA 2ZOGA 5BYRA 1JLFA 1KFDA 2MKJA 1NJZA 1UFWA 3T6JA 1J5OB 4MKYA 4OX9F 2F8MA 2YX7A 4RNNA 4Q2MA 4J9QA 3KKFA 5D4NA 2OAUA 4ECTA 4YP3A 3B82A 3BQ0A 1SL0A 2BXJA 3L09A 3O3LA 4TYBA 2FC8A 5E33A 3NNAA 1S9EB 3DXSX 1FRJA 4O44B 2ZH3A 4HDHA 1S1TA 1RAJA 2JLGA 2KRBA 1K0VA 2GW8A 1X4AA 3L7PA 3CMAS 4OL8A 2VKRA 2QE5A 4KB7A 3ZZ0A 1L3TA 1G6BA 1XC9A 2K3KA 2X1FA 4QU7A 2EW9A 1TKZA 3D1OA 3DRRB 4PG7A 1NK6A 1RA7A 2EPIA 2KXNB 5C24A 4QYRA 1J5OA 2EC0A 2ASLA 4K4TA 1QVGR 5HMYA 1FCAA 5EGYA 3SI8A 2Q6BA 1JLBB 2DR9A 3FMBA 4RW8A 4IOCQ 1FRHA 3W2WB 3M2VA 1SBRA 3UD3P 2N7CA 2J6SA 3QAEA 3MMCA 4N8OA 4OQJA 4U7UK 4I56A 3C3LA 5M2PA 4IG0A 5HBMB 2IAJA 2RT3A 4I2QB 3VAMA 2AGPA 3KMSA 2IHR1 3V81A 2QYCA 2C28A 4WTYA 3BR8A 4O4GA 5KT2A 4J9OA 1AFIA 2AP6A 1X4EA 2D74B 3SDEB 3U1MA 2MQPA 3CCQS 4B9TA 5HROA 3E01A 2XMMA 1URRA 4AYBD 2IM1A 5J2NB 1YQHA 3MR3A 4I67A 1KVJA 3M1VA 4Y0FA 2J9DE 1RTIA 5F8IA 3QZ7A 3G71S 5E3AA 4JI2F 3KK1B 2A2CA 1I94F 4DSIA 1TFYA 1VQ4S 2ZOMA 3H2UB 1FDAA 4G1QA 2UUBF 2XLKA 3UCGA 4O4RA 1VIXA 3RRGA 2YQ3A 4DSLA 2HMIA 3MUVP 4LSLA 5LJ5Y 1FRIA 4M5DB 3AB4B 1YSJA 1L3KA 3PFOA 2J0XA 3IWXA 3PIOQ 2HGNA 3OFFA 2WOMA 3P3DA 4RU2A 1WNEA 4UUWA 1VK3A 4G1PA 1RI7A 1EP4B 1H6KX 3H8YA 4I2QA 5E3CA 3OFHA 2XO7A 1Q82T 3OTOF 4BDPA 3TAPA 5IZHA 1M5VC 3I0SB 1FD2A 3I6PA 1DLOA 1FTRA 3G96A 1S76D 2R7OA 4NLWA 3M4XA 4Q44A 2W9BA 1U47A 2IMWP 4EZ6A 1YRUA 4PCQA 3CULA 2XNRA 4AL6A 1FVSA 2BQRA 2FB0A 2RRBA 4KRWA 1TKXA 3I55S 1SB6A 5KG1A 4Q2LA 2BABA 1B0PA 5IWAF 1EP4A 3H5YA 4WU3A 3CIMA 5DJBA 1U1KA 1REVA 1U1LA 3OXFA 5D6GA 1TKZB 2HWTA 1TFWA 1YJTA 1QAXA 1SL1A 3Q8PB 3JTNA 4DR3F 4CCHA 3UD4P 1TV6B 4ICLA 1U1RA 4TQRA 1LXJA 2IC3B 3HP6A 2WSCC 3M8PA 5HLFB 4CO1A 4IRCA 4DOZA 2O3DA 3CJKB 4TLQA 4RW6B 2ZM6F 4QPTA 2E1AA 3DOLB 4NZ7A 5EHHA 1ZPWX 2FJWA 2FD2A 1R0AB 2GGPB 1UETA 1SIZA 3R1LA 2ZITA 2YWKA 3SCLE 5CYMA 1XR6A 1GXTA 1HHTP 4OFZA 1FD8A 1TL5A 2APOA 4WZMA 2BANA 3IRXA 1SJ1A 2OFGX 2RRNA 3HHLB 4CO0A 2UU9F 4O3SA 5B0BA 5EX0A 3SFGA 3ZZYA 4BWJA 4F4WA 2JWNA 4FF2A 2M0GB 3I82A 1HI1A 2WRMA 3ISND 1F9FA 1S1WA 4H4MA 4NLQA 4EFAC 4CIOA 3QGIA 1APSA 4F3QA 1I1GA 1M5SA 4FBTA 2A1BA 2JLFA 4DUYF 4TLRA 3M2UA 3H40A 2P5VA 4M95A 4AXJA 1JLGB 1JLAB 2PI5A 2GV1A 4X4QA 2RQ4A 3IG1B 1C4AA 2DR7A 5CH7B 2DH9A 1U26A 5FD1A 1UWBB 2HNDA 3BGLA 2W24A 1VC5A 1HYSB 4YUDA 1GH8A 4CT8A 1T95A 2UUTA 5C25A 4JV1A 1K8AT 1VMBA 3OLAA 1KQSR 1Q8BA 2MZ1A 3WX4A 1G7CB 1R8BA 2A10A 1Q86T 2HHQA 3F41A 1S9EA 2BR0A 4UQTA 2DNPA 1JJHA 4OI2A 3H5UA 3MFIA 4DDFA 3H5XA 2V9WA 1Q8LA 3H2LA 1SJQA 5C42B 3IG1A 3RYLA 3SFUA 4DEZA 4EUVA 2KRRA 1ELOA 2B4PA 3M9MB 3M2RB 2JC0A 1GXLA 1P9QC 3LF0A 4D3HA 4NLDA 1UA1A 2GJ2A 4C7QA 2LXIA 2IM3A 2OPPB 4NWBA 2ZD1B 3F44A 4HL9A 3EZ5A 3MF5A 1MMLA 5DDOC 1IJFB 4MKBA 3MMBA 5KG7A 1DZ5A 4KAIA 3TNVA 3HVWA 3Q23A 3KHGA 2UZAA 2U1AA 1U1MA 4PWDA 1RTDB 1YG0A 2IM2A 4IQXA 5A8KB 2M52A 1WI8A 4KO0A 2IA6A 1S99A 1Q7YT 3TVZA 5DM6Q 2YNHA 2QO3A 1VRUA 2QLXA 1YTYA 2WBMA 3RRHA 2RVJA 1NKEA 1FJEB 4LQ3A 5CZVA 1TKTA 1V3RA 1QSLA 1T94A 2ZDOA 1PC5A 3BDPA 1Q8IA 4QWCA 3MD1A 1F60B 2IVFB 4AL7A 3N5FA 4Y00A 3LWLA 3H4BA 4GC7A 1RT4B 2E1MC 2HYIB 1UJ4A 1ZZFA 3THTA 3KLHB 4PRFA 3HKWA 4DV5F 3NWGA 1WEXA 4USJC 2OD6A 3CPWR 5E2QA 4X66F 2MHEA 2XI3A 3G8SA 3UWTA 2LQ5A 2NQPA 6FDRA 1YRTA 3N9UC 4OJHA 3LUYA 1XBWA 5L1KA 1VRUB 2MJNA 3K8WA 5DQIA 3BEGB 2QV6A 4H4KA 4JBCA 3VCDA 4O0IA 1RTHB 4RUHA 1NH7A 2R8GA 3UNGC 2Z0GA 2DIUA 2HVIA 3QIPB 5T7LA 1U6FA 2YKQA 1VRTA 2KFYA 2B5JB 4HH0A 4USIA 3R1HA 2PO4A 4LSNA 3QIDA 2HRYA 1C0TA 3D1QA 3CCRS 3PX6A 3M6WA 2ZC4A 2W4DA 2XSJB 5T14A 2E7WA 1LWCB 2KZMA 2RKIB 2VG5A 1VQSA 3H5SA 3QO9A 2W7PA 1ZTWA 2GIRA 1C1CA 3LGNA 1JLEA 1S9GA 4ELTA 2FIUA 2BM1A 2W7OA 1HI0P 4C8KA 4H4KC 2J7UA 2F3JA 5K14B 5KG2A 1X0PA 3TAMB 3PVXA 1FKOA 2ASYA 4OZ0A 4OHVA 4DS4A 2D9OA 1L5UA 4DFKA 2M5YA 2O1PA 4OJGA 1HWIA 2HHUA 1XR7A 4O3RA 3BQ1A 2XY7A 5HL7Q 1S49A 1N34F 1Q7LB 1UVLA 4XIUA 1X4GA 3KLFA 4IO9Q 2NLWA 1SQEA 3IXQA 5KG3A 1HL6A 4RW9B 3V81B 1HPZA 2KO1A 2NPIA 4HI2A 4OZNA 5I3PA 2GC8A 2OP5A 3SCIE 2N4DA 1NH8A 3P5TL 1K73T 2FJDB 4B9VA 3I32A 5CQGA 3DLKB 1GXUA 4IFYB 4C0BA 2J8AA 4DR2F 1MSWD 4MYUA 4QU6A 3LP0B 3TUIC 2HZCA 4NZ6A 1ZTTA 4B9SA 1C1CB 4I0WA 4LT6A 2EKYA 3SQGB 3NGDA 4D3GA 1FA0A 1RP5A 5J1NA 1Z1ZA 5KFMA 4ECVA 1VIOA 2KB2A 3JAMY 2FJEB 2I9SA 2DHGA 1MU2A 2SXLA 3TUZC 1RT7A 4Q7AA 1N5VA 5DETA 3KK2B 2IYGA 3IRXB 3QWPA 5IS2A 2MZTA 3KLEA 4IO1A 1VFJA 1Q79A 2WOMB 4LF9F 4AL5A 2CPFA 4DQRA 1JMTA 5AJ3F 2P9CA 3PW4A 5D3GA 2ILYA 1PC4A 3FFIA 5BJRA 3ISNC 1LV5A 3CB4A 3LP1B 3RB0A 2MZSA 3GWCA 3DMJB 2R9LA 3EPGA 4JI4F 1HPZB 2IRXA 4FS1A 3TANA 2DIVA 3DLKA 4TU9A 1R89A 5IFMA 3KHHA 1KLNA 1JB0C 5D77A 4K4SA 2JJ4D 3KMQA 1JLCB 2J7WA 1QUVA 4RBVA 3GB0A 2KM8B 4A8SA 1FKPA 5LSOA 3DHWC 2AYGA 3IS9B 1LW2A 2VPWB 4MIBA 3CC7S 2UUWA 3DLEA 1HNIA 2PFFB 3H98A 3T1AA 1CEZA 1LWEA 2V9KA 2R7QA 4M94A 2P9EA 2UUAF 3K5NA 1QJHA 4QQBA 4IYQA 4X4VA 4Z2XA 4TU7A 2JLEA 1J2VA 1ZM2A 1KQGB 5LJ3Y 2ZH7A 3MAHA <