5ETQA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.96 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
156
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEELHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 43
structure length 156
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etqA00
3HD1A 4M5HA 1HKAA 4M5IA 1F9HA 4PZVA 5ETVA 1HQ2A 5ETLA 3ILOA 5ETMA 5ETPA 4AD6A 2F63A 4CYUB 1RAOA 3ILIA 1RU1A 3HSJA 4M5LA 4M5NA 2QX0A 3ILJA 3MCMA 5ETSA 4CYUA 1TMMA 3HSDA 5ETTA 4M5MA 5ETNA 1RU2A 1DY3A 3HSZA 5ETRA 5ETQA 3HT0A 1EX8A 3HD2A 3UDEA 2BMBA 1G4CA 5ETKA 2F65A 1IM6A 4M5KA 2CG8A 3UD5A 5ETOA 3HSGA 3KUGA 1KBRA 4F7VA 4CRJA 3KUEA 1Q0NA 1EQMA 1CBKA 1RB0A 3IP0A 3KUHA 3MCOA 1RTZA 1EQ0A 3HCXA 4CWBA 4M5GA 3UDVA 3MCNA 3QBCA 1TMJA 4M5JA 3ILLA
chains in the Genus database with same CATH superfamily
3F41A 3ICLA 3IGNA 1P9QC 2H5IB 2K06A 4IO1A 2ZJPQ 2LECA 3C15A 3OL9A 2P2CB 3FC9A 3ZZRA 4ETZA 4J9KA 2ADBA 5FJ4A 2GA7A 3ZZZA 3V81A 2YWFA 1G7CB 1UWAA 2YKNB 2HQ3A 4QIVA 2OPQA 1S79A 4RJVA 2CQ2A 3T9ZA 3BKFA 4C0OC 1ZAVA 4BCAA 2YNGB 2VFTA 4FXWA 3TI0A 1PCAA 3DGVA 4DV4F 3D6HB 1N4LA 2MKIA 1HBUB 5KTQA 1H72C 4P2FA 2HFSA 3MEDA 1S0OA 1F1BB 2FHJD 2L9WA 3AD7C 1FTCA 2HNZA 4HL9A 4I7FA 4IOBA 4QW8A 3D3CJ 4KIAA 2ZM6J 3K58A 3MXHP 1T7PA 1S7HA 4RW4B 1G3OA 1UVNA 1V3RA 2D69A 3L09A 5A6WA 3WDOA 1R8CA 3ZNJ1 3H4BA 2LEPA 3FUYA 2VQFJ 1TAUA 3B54A 3NAIA 2H4YB 2DB1A 2D3OR 2YXLA 1NB7A 2WTFA 4G65A 4QW9A 1E6YA 3DRSA 1VC5A 4GO7X 3W5XA 2DRDA 3VALA 3CC7S 3IXQA 4HTIA 4LF9F 1G1XA 5J2PB 5EN1A 1HWLA 3GP9A 2XYGB 2BJ7A 2JVOA 4OZ0A 4UF4A 1IVZA 2VQEJ 3O5TB 1PBUA 1GTHA 4IOAQ 3OBIA 3NGSA 4ILRA 2KRBA 3D0IE 1YJ9S 1NPRA 1T9YA 1HBMA 2DHAA 3DLGB 4LUBA 1L3SA 1H38A 5F8NA 4WFZA 1RWPB 3MDFA 5IWAJ 2ERRA 1SC6A 3QIPB 3PYEA 4A8KA 2DPIA 4YDDB 1DQ9A 1O0PA 1YIJS 1UFLA 3R8YA 1WHVA 2GJ2A 1N33J 3FKBA 5C25A 2LFVA 3NWRA 3QGGA 1L3KA 3TJ9A 5HROB 3E8OA 3N4WA 4E98A 2DJWA 2DY9A 4FF1A 3DDNA 4KKOA 3BO4A 1MN9A 3OTOF 1V3ZA 4NLWA 3D0GE 3M32A 3HSZA 3VTIA 3V6KA 1OSCA 1NLKL 4KV8B 2L9DA 1HWJA 2O5DA 1NZ8A 2QSWA 4JI7F 1OYDA 3QT7A 1UFWA 5KFGA 4C3MA 2AQ4A 2FLLA 1U2RA 3TVYA 3I32A 2R3VA 5ETOA 5K20B 4KHPJ 3FCWA 2DGUA 3K5OA 1ZOTA 2WB1D 4CO1A 1UA1A 1U09A 2GHPA 5KFAA 4I68A 5E3CA 4FYXB 1NK9A 1M5PC 1TFWA 1QD1A 3CCES 2KTQA 3PYGA 2DY1A 1H2VZ 4KFBA 3I4PA 1U6ZA 3NCPA 3V5RA 3W61A 5F9LA 4B9LA 4J9LA 1M0SA 4NRTA 2MQ8A 3CMAS 4DF4A 1R0AB 3O2IA 2DNRA 1TL3B 4UY85 3U1MA 3K17A 1XC9A 1S9GA 2PMWA 3W65A 4RU9A 2N4DA 4IFVB 3JAMU 2OEMA 4QWAA 3ENQA 2DH7A 7FD1A 4DG1A 1Y9OA 2HS0A 1JIHA 3AD9C 2BUNA 2BMBA 1YJUA 1Q16B 5F8HA 4ILMA 3TJ8A 2F65A 5GAEI 1R43A 1U1OA 1RHUB 4F4XA 4RR5A 2RUSA 4NL5A 2IM2A 4O0NA 2GMHA 4FN5A 4ZP7A 3DMJA 1SUQA 4GMKA 1ZM3A 4O4GA 1FRXA 3T41A 5GAHU 2HRTA 3MM8B 2EKYA 3CC4S 3W3SA 3K8VA 4OYAA 1FHTA 1BC6A 1UCNA 1F9EB 1YRUA 3KJVB 3BGLA 2X7IA 3BREA 2I6WA 1AZSA 5HROA 3DOLA 1OSDA 3OSPA 4WZQA 1GX5A 2Y1LB 1LV5A 2HZVA 1RTDA 1PKUA 2CUYA 3CO9A 4AUKA 2PEHA 2UP1A 2I1RA 1X8DA 1O5JA 3AJDA 1QE1A 1NK8A 3H8YA 1N48A 4ZVEA 3MR5A 4Q0BB 1R8BA 3TP2A 2AYEA 3ZZPA 2BVZA 2OELA 1HBMB 1VCTA 2Z0GA 1EP4B 3UD5A 4ZIWA 4RBTA 2D9OA 3BSCA 3MFHA 4GC6A 4DL6A 2GO8A 4WWSA 3OSNA 2E5LF 4TQRA 5JMNA 3DRPA 4WP9A 3D6TB 4J9OA 2Q6CA 2W24A 4LF9J 2DXFA 4NCBA 1RTZA 2J9EA 1FF2A 1VHFA 2VOOA 1SJQA 1C0TB 3MECA 1Z2LA 2ZVSA 3GFHA 3VQTA 2NREA 4B3OB 2FC8A 1SL1A 1URRA 3HZGA 3T5HA 3HF5A 3CCQS 2MHNA 3V81B 1BD6A 2DYAA 4PWDA 3MM6B 3QT8A 3UFCX 3VV2B 3MF5A 3E3XA 4W90B 5B0CA 4NLPA 3NMRA 1AFJA 1WNEA 2B5JB 4F4AA 5I3UA 4CP5A 1LWEB 1TUGB 3BBCA 4WCEQ 2JDJA 4IQXA 2ZH9A 2R2UA 1HBUA 1F2HA 3CJ4A 1LK5A 1IKYB 1RADB 1FX2A 4OZLA 4F4WA 3EXCX 2RAQA 3Q8SB 2ZH1A 2JL9A 4ED2A 1HR0F 3RZAA 9RUBA 3OJSA 3AA9A 2W2PP 5GAHI 4OYWA 3EDRB 1OWXA 1R31A 4DSFA 4WP3A 4KT0C 4EO8A 4WIQA 2HHVA 2HHHJ 3LGHA 1EB0A 5M2UA 3K5MA 2FVCA 4JV5J 1ZAXA 5FLXY 3TX0A 4UTGA 2CXEA 2PMZD 1S6PB 2HMIB 2KFZA 1XQIA 4KAIA 2HLUA 4OI4A 4MMOA 4ANDA 1PC4A 2HNDB 1FRHA 3T5LA 2C3UA 2LLZA 3ENVA 5KFVA 1FDNA 2XI3A 2DHSA 1SC1B 3ISNC 4U8VA 4DCJB 3LP0B 5K8MA 1FXRA 1XNQF 4K5SA 2W9BB 1NKCA 3BH6B 1RCXB 3NCQA 5GAGI 4J9NA 3PW5A 4WXOA 1B3TA 4WFYA 5D4LA 2YY3A 1R8AA 1VQOS 1LW0B 1NJYA 4LF8J 3IM8A 1U2CA 1Z1ZA 2ZBCA 4OX9J 2V8HA 1HFEL 2XC9A 2M3DA 2X3GA 4J9VA 2VC0A 3ENWA 2LQ9A 1VQMS 2B4UA 1IWAA 2C3YA 1XMBA 4K4XA 4LJMA 4ZPVR 4UZBA 1UZHA 1RAIB 2IJFA 4RW8B 4KKOB 5DDQC 3J80U 3DGPA 4HACA 5GADU 4Q8EA 4X64J 2FZCB 5GMEA 2BKPA 2MGZB 3RTVA 1JXEA 2W9CA 3MPVA 3KNAA 1BGXT 1PYTA 4Y2CA 2B56A 1KEKA 2BACA 3PYDA 3OUYA 2V4RA 1C0UA 3P49B 4QWCA 2BM1A 1QAJA 1ZZFA 3PNIA 1Q79A 4W98A 1H6KX 5F0WA 4OZ3A 3MAQA 2O3DA 2HFNA 3J81U 2H3EB 1KBRA 4ZPBA 2KG0A 1KTVA 3M2RA 5LT5A 4K0KJ 4F2SA 2XMJA 1IR0A 2GV1A 2XMVA 1S9EB 2XZDB 2YQ3A 3HCXA 1HWUA 3PO5A 2FJBB 3Q22A 1WOSA 2CQPA 1VQ6S 2XMAA 2OUGA 2KN4A 4ALZA 3G2XA 3ILOA 3TVKA 4Q43A 1NK7A 2HHXA 1K1SA 3CD7A 4MTPA 4FP9A 1SIZA 2Z2YB 1NHUA 4B3RJ 4KGZB 4RBUA 3C6TB 5DM6Q 4ELTA 5J1PA 2FLPA 1FDDA 4NEZA 4FXDA 1HI1A 3UDEA 2HQDA 4BLGA 1FWPA 4HLBA 1C2PA 3VVTA 2EC2A 4DQIA 2PI4A 2JX2A 3OR2B 2HWHA 4MFBA 4OYXA 2J6TA 5HLFA 3D0HE 3FSIA 4FVMA 4Z7CA 4Y28C 2JEIA 2I5JA 3HFVA 3IS9B 2YVSA 1TL3A 2XMUA 3G87A 4P10A 4RWXA 3TJAA 5CD4A 4KE5A 4ZVUB 2OJ3A 5E5NA 1TKTA 2GO9A 4YR3A 4TU8A 4DN0A 1VC0A 3DGPB 4HHHA 5I3QA 2R2RA 5F3ZA 3VAGA 2GIFA 2R42A 4LR9A 2JEFA 4LF5J 4CM2A 5IV4A 5HI7A 2GVDB 1VQKS 3A8KA 1T9UA 3M8QB 1S0MA 1PO6A 4WXWA 1YSJA 5KFCA 4PPDA 5L9NA 3G6YA 3J81Y 2RIJA 2HAIA 5B7WA 2KM8C 1X31C 1R89A 4LSNA 4Z37A 4XK8C 2MKJA 3MMBA 2XGPA 1J5EJ 2ZZNA 3M8RA 2JSXA 2CWXA 3VGSA 3DM2B 2MJUA 2DNQA 2JZ5A 3Q8RB 3T1HJ 3OTBA 5D6GA 2R7WA 1HA1A 2NSCA 2B9YA 1VRUB 2PO4A 5I4MA 2KU7A 3SSSA 3IP0A 4IYQA 1RT5A 3MPYA 4F36A 3D66A 1FKPA 5KFHA 2AGPA 2B4VA 2JLFA 2QMWA 5IQQA 2LXIA 2HWIA 2QTWA 3IRWP 4C8OA 3LPEA 3RR8A 4Y0FA 1QJHA 1TKTB 1RWVB 3VF0B 3TX8A 2AIRB 3PX6A 2NQPA 1MW7A 2E1AA 2A18A 2ZUGA 4DZDA 2RU3A 3PFOA 4OX8A 1WC6A 3Q0AA 4J9QA 4AL7A 1RU2A 2G2YA 3VAKA 4C97A 1B99A 5DG7A 2F9DA 1QTMA 2K8GA 2LDYA 2OMOA 3UCZP 2BM0A 3ZZYA 3CIZA 2V4JA 3UVJB 1TUWA 3GJSB 3HPOA 3NCRA 2VD3A 4F3QA 3FMBA 2J7WA 2AJFE 4DN9A 1XK8A 1SJ3P 3LWLA 4FBUA 4USJC 2O1PA 1RB0A 1TV6A 2RDIA 3D3BJ 3IRXB 3UR0A 2L08A 3P45B 4DUTA 2CG4A 2FJVA 1BWVA 2E5HA 3W5ZA 1HWKA 2HFZA 1U1PA 2JWNA 4AT1B 5IXUA 1FWKA 5H9EJ 3LUYA 4B9SA 5CYQB 2E9TA 1U0HA 3MEKA 4ED6A 3DRRB 4K8RA 1ZA1B 3LP1A 2W01A 1ZM4A 4ZPTR 1TKXA 1HQUB 1E6VA 4TQSA 2AJQA 3UQSA 2CWKA 2MZTA 1FI4A 4RW7A 4X4SA 1FFWB 2JFDA 3LO3A 4O23A 3J7ZT 1WG4A 2LKZA 1U6BA 1N6QB 1U2FA 5KFRA 1HYSB 3UN5A 5IT4A 2FJXA 2O66A 2XS5A 1KVKA 5D3GB 2RB7A 1WTFA 2CZVC 1MWYA 1SKUB 4KB7A 3W60A 5J2MA 4WKRA 4KH1B 1U1NA 3HFKA 3ZTOA 1J27A 4C8KA 4JI4F 2QLBB 3OHBA 4PG7A 4DV7F 3TAMB 2PA8D 1WSVA 4LF6J 4JI6J 4HDHA 5DM7Q 4U95A 3KLGA 1HNZF 2P5VA 4MFBB 3LALA 4LRBA 1CVJA 4WFAQ 1M5SA 2Y0BB 4USTA 2HHTA 3HDSA 4B9VA 1WD6A 2JOQA 4TYBA 3GCXP 1N34J 4ZVQB 4K4VA 3GTYX 5ADZA 3BGUA 4DV6J 2HGNA 3VGTA 4IRCA 4OZ1A 3O8WA 3SCIE 2ZZMA 1H73A 2AZ1A 1TK5A 3Q8UA 1OYEA 3GCWP 3MMAA 3D4JA 3HD2A 3JSRA 1TKXB 3N5BA 4FVCA 3S01A 5KFBA 5KT4A 3MUTP 2R7TA 1WOOA 4QPXA 3K57A 2CQCA 3S8SA 2N3OA 7AT1B 2BBEA 4RL1A 1F3VA 5DGBA 1SJ4P 2ZH8A 2E9RX 2XQCA 1HHQA 2ZBRA 2ZOGA 4XIUA 2HBRB 3OFFA 1TVRA 3P4UB 2CQIA 3CPWR 5CYMA 2IPOB 2BE2B 3MZIA 2BXJA 1HD0A 3T6BA 4PABA 5C25B 3VAIA 1T03A 1SH0A 2J5AA 5LXRA 5LMUF 3HJFA 2DNMA 2OD4A 2Z57B 5HJYA 3UPFA 4ZHRB 5KFQA 5KFJA 3C14B 1JMTA 2V0NA 2AYBA 2HHHF 5BJRA 3PDNA 4DS4A 3G9CA 2LU2A 1TK8A 4JYAJ 3FFIB 3GIRA 2DXEA 2F1FA 1WC4A 1A7GE 1ZPWX 3R27A 4OZ2A 2F3JA 2QO3A 1T9XA 2V67A 2HNDA 2JLEA 1FA0A 4RW9A 4Z2XA 4I4BA 3GQCA 2OEJA 4EBDA 3JAMY 4IDKB 1HARA 2QA4S 1IBKF 3EGZA 1RXOB 3FBFA 1OPIA 4GC7A 3FJ2A 4YY3J 2DNPA 5CA5A 2BANB 4J5OA 1UKUA 4K4TA 3PX0A 1R6VA 4WFNQ 1FKPB 2GHVC 2VU5A 3MM6A 2P6SA 3EGNA 1JLEA 4I67A 3MMJA 4H4MB 1V6HA 3NG8A 1HKAA 4PWWA 3S1TA 1DLOA 4RZRA 4H4OB 4PWUA 4E2FB 2KXNB 1VMBA 3HVWA 1FJGF 3IBCB 3BQ2A 2FVSA 4AQYJ 4BC7A 1KHVA 4DWIA 5BYQA 1RCOB 5DS7A 4XO0A 3IN5A 2PEBA 3I82A 4DR1J 2Y8YA 1FJCA 4M5MA 1RBAA 1S6UA 2QMXA 4JI4J 3NOCA 5A6PA 1OY9A 1RKJA 4F2RA 3IWNC 4C9DA 2LA6A 2WSCC 4GRSA 1HIYA 2EPIA 1Z4UA 2YNGA 4KH0B 1YJRA 3HLUA 1DTTB 5IM0A 4ATNA 2CPIA 2DCLA 3HVRA 1CJTB 4FPRA 4LRFA 4NE9C 3OXLA 3SFUA 2ZH3A 3OLBA 2KVIA 4GVBB 1DAXA 2ZM6F 1LFPA 5CZXA 3MD3A 5J1NA 4KJIA 4URGA 1SV5A 2HAFA 1IBMJ 4LMZA 3C16A 5KFOA 4OL8A 4YR0A 5D15A 2RS8A 3CW2C 2QLJB 3MCSA 3NRBA 5CQGA 4FDFA 5D0EA 3WIVA 4OHZA 5ETPA 2IVMA 4NPOA 5JXSA 3FK4A 3P5TL 5F3TA 5FIIA 3RU0A 3MEGA 3WQPA 1U1KA 1QUVA 4D3GA 5H9EK 1N33F 4GO5X 5AT1B 4JI6F 2W8KA 2PIIA 2YWEA 1QE1B 3QZ8A 3MUMP 1D9DA 4C8ZA 1C0UB 1U8WA 3HT0A 2DCUB 2ZWPA 2UXDJ 4WYLA 3RRKA 1WKLA 1T9VA 2MQNA 3AOBA 1PBAA 2LU1A 2YNHB 1N52B 4NRUA 4HR2A 4U7UD 2A10A 2MQMA 1KQKA 1GMWD 1YK9A 4NA2A 4E8UA 1MU2A 3RB6A 4HTJA 1UPPA 2GQQA 2Q66A 5KFFA 3EUNA 5CCLA 3L3CA 3BSAA 4UOHA 2AGQA 1CULA 2ZH7A 2ATCB 3LTOA 2QIFA 3DOKA 2YQ1A 4I56A 4I6WA 4N47A 3M8YA 4R5PA 3OTOJ 1XR6A 4F3OA 2RUGA 4A8OA 1BY9A 2WVEA 2ZE2B 2V63A 4K59A 2AT1B 1F60B 4MJKA 1X9MA 2YBVA 1VISA 3C6UB 4ZJOA 3PEHA 3CNQP 1URNA 1SQFA 4IFVA 4KPCA 1R0BG 4NMLA 4TLRA 2WOMB 4EK2A 4ZCMA 4R5PB 1ITPA 3UCGA 2BA9A 1VBXA 2YKMB 1IM6A 1CPZA 3HHDA 1GQEA 3MR3A 4C0HA 4EU0A 3BO2A 3NNAA 1FD2A 4GKJJ 2R7OA 3B82A 2LA4A 1AW0A 1S6QB 1NK0A 2UZAA 3G6VA 2XNQA 5DDRC 3MMCA 1XWLA 2ZBQA 2IC3A 3VHQA 1Y3JA 3LA0A 4NXMF 3QATA 4HI2A 3M8PB 4PXBA 2MPUA 1U47A 1YKWA 3PRBA 3ZZ0A 4PQAA 4FYDA 1V3SA 3MCMA 2E7WA 3A12A 4X4UA 2F9JA 4MIAA 2XMTA 3K89A 3HHEA 3CT9A 4MIBA 4ECVA 1SL0A 1UVKA 4A8FA 2V9KA 3DOKB 4OYPA 1DFDA 5HBMA 3TO8A 1EX8A 2HK2A 4ID5A 1MWQA 2I2YA 4QPTA 2ZC4A 3NS7B 3ZXWA 7FDRA 4C4WA 3UI3A 1K47A 4RBVA 4EZ9A 4QWEA 4NCAA 2M70A 2VV5A 3H5XA 3KLHA 4ZVHA 4KFBB 1SV5B 4IFYA 3SSRA 2JVRA 2LEBA 1HD1A 1Q53A 3KUHA 3IAM9 3X1LB 5KT5A 1EQ0A 2JEGA 4LF4J 1KS2A 4A8MP 2C3PA 3JQKA 2E66A 2LP4A 1JLGA 4LIWA 2G9OA 4NX9A 2FHMA 2CDQA 2P9GA 3JS9A 3I0SA 4KSEB 1APSA 3OJUA 3QT6A 2PFFB 2BQ3A 1X4HA 4F26A 4F50A 3O1LA 2A2DA 4L6V3 2BABA 5KG2A 2G13A 2X51A 3L95X 3SFGA 2YH1A 1T05B 2CNLB 3RBEA 2NCKL 2VFUA 4AXJA 1HQUA 3Q8QB 3BSNA 3M6XA 3MEGB 2B5JA 3DRRA 3I87A 3RBZA 5AJ3J 2W25A 4TY9A 3KG1A 3PVXA 2UUCF 1WC1A 1GXUA 3RAQA 2KKHA 1YX2A 1W2BR 2XWXA 2YNHA 2V8PA 2HVHA 3EZOA 2GW8A 1HPZB 5J2QB 1S77D 5IFMA 4DL0C 3U7JA 5CCMA 1TV6B 3IRXA 4NLDA 5KFTA 3I55S 1RYRA 1CC8A 2NPFA 2FLNA 4ECRA 1FRLA 1S5ZA 1CG2A 3ILLA 3HD1A 1VI7A 2ZJRQ 4XTTA 3PRVA 4WIIA 3RW6A 2RF2B 4QQBA 1GNKA 2V34A 1UPMB 1DQAA 3E51A 3GE9A 1N0UA 4ZLNA 1P8GA 5BR8F 4YB7A 2W7PA 3E2EA 2UVUA 3EM1A 4C6AA 4JV5F 3I0SB 3UWTA 1F5BA 3DFEA 3V6DA 1NB2A 3I5BA 1VRQC 2EBEA 2ASJA 2HYIB 1PJ7A 2YKNA 1RWNB 3UN2A 1S1WB 2BJ9A 1RWKB 4ZHRA 3KHRA 4HYKA 1BXNA 2CJKA 4B9MA 2CADA 2ZITA 3CMQA 3PR4A 3SQOP 4DL3A 2LCWA 1UEUA 1D9FA 3MD1A 1AT1B 3CDUA 4PR6A 4UT4A 3BF4A 4RNHA 1FTRA 1L3VA 3WC2A 4DUYJ 2RU9A 1UA0A 4OX9F 1ZBTA 2FY8A 4NLOA 2N7CA 4YP3A 3G86A 5KOWA 2J6SA 2AYGA 2HNZB 3T3FA 3JQMA 4PXDA 4BS2A 4O3PA 3IAS9 2ZBPA 4H54A 1S6OA 4WFXA 3BJYA 4DUZJ 2AJ0A 1NSAA 1HNXF 4OYMA 3TZYA 4TY8B 1VRTA 5LSOA 3RB3A 1X4CA 2AEFA 4CH7A 2R7VA 2DHXA 2V50A 4U6PA 5KFEA 2WZ1A 2DH8A 1C4AA 1UW4A 1S49A 3HKZD 3MAAB 5D4PA 3BZQA 4YN3B 4NWBA 3C14A 1B7YB 4OZJA 2E1MC 3UDCA 2A2CA 4JYAF 2R8JA 3NP5A 4IFYB 2R9LA 1TAQA 5CD4H 2VG7B 3JSBA 1AA1B 4OZ5A 3BKTA 3RBDA 3T1AA 1GTEA 1TP7A 2UUAF 3R5BA 3HT3A 4LQ9A 3P3DA 4Y34A 2H54B 3TAMA 4NXNF 4YEAA 1SL2A 4LT6A 5IC4B 4IOCQ 3PV8A 1UJ6A 4C3LA 2IM0A 3EDQB 5C24B 1HYSA 2BJDA 3RJMB 1WHYA 4JI1F 2VBXA 2W9AA 4IG3A 4ZS6A 2G1DA 2ZWOA 1EAYC 3FRZA 1JQGA 2B7CB 4CYUB 4ZLLA 4IRDA 2VZ9A 4HKQA 4CI0B 3M05A 2N4CA 1JLBB 2EFOA 4C8NA 4PUOA 2KDOA 2K1RB 3PTWA 4QYRA 5HQMA 3TYTA 1U48A 3SQGA 5LJ3Y 1AFIA 4F0MA 1RHQB 1IR2A 3FNNA 2VFVA 2LDIA 2HBZB 4MKVA 4OI2A 3SSQA 5IT0A 5J2PA 3P8BB 3KHLA 3MTKA 2KZMA 2V2VA 5J1EA 1FX4A 3H20A 2MZSA 3M8WA 2AYMA 3ZTSA 3O44A 4NZ7A 4RNMA 3Q2SC 4ZPCA 3W7BA 1U1RA 1PJ5A 1NK4A 2B4PA 2RILA 3EICA 5IV3A 2HFVA 2EG1A 2RDDA 2XI2A 1LK7A 4PCQA 5F8LA 2MEWA 2YTCA 2GX8A 3PCOB 3LAMA 1P27B 1S1TB 2LEAA 2D7SA 3OXFA 1Q95G 1NSQA 2W8LA 3OD2A 2R7QA 3Q8YA 2COLA 3LOUA 3FMWA 4G1PA 4ITSA 1S1XA 1IUJA 2A0FB 2RQKA 1REVA 2XSFA 3NBPB 3WHIA 4RW6A 3SV4A 3KLVA 5F8GA 1LXJA 4IR9A 4DX7A 2R7UA 1WEYA 3CSKA 4GVLA 1X4GA 1N88A 1WDDA 5BYSA 3G4SS 5THWA 4F25A 3KLGB 2XS7A 4L75A 4OV6A 4OZNA 1WOPA 4P7TA 3I9V9 3ITHB 1Q8BA 5JJBA 3M1VA 3QGIA 5CH7B 2RDJA 2HHUA 2QC3A 3SDEA 2XSJB 2DGVA 2NXJA 3E01B 4ZJLA 2DO4A 1NH8A 2CPEA 4AE5A 8RUCA 2CQHA 1CJTA 2PGCA 4FYWB 3W64A 1AUSL 2BW7A 4KHMA 1L3UA 3CJRA 2XY7A 4DR7J 3EGVA 2I9SA 3MCOA 2EWHA 1S4EA 4ZVRB 2UXCF 5LM7E 1OQ3A 1Y0HA 3N9UC 3QO9A 4I6AA 4C3KA 1S1UA 1REGX 2DEJA 2BW2A 3D5MA 3GJRB 2KZZA 4C0BA 3NGTA 3H4DA 3AA8A 3CDBA 4B3OA 5M2RA 4FF3A 1SJ1A 3IG1A 4M5LA 4CDIA 2WHOA 2ZDPA 3QT5A 3PY8A 3ZZTA 1Q7LB 2KJVA 3GIIA 2DNKA 4IH7A 3QRPA 4K4ZA 1S48A 3H40A 1V9OA 3KDOA 2Z4PA 4DPUA 2RD5C 1TL5A 4L3NA 1F2GA 1KR4A 2MY7A 3PG9A 1LWCA 2YKOA 4KYZA 4O3OA 2VASA 3ET6A 3W2WA 6FDRA 5ETKA 5IWAF 2MJNA 1NXIA 2VB6A 2C2ZB 4JI0J 2Z2ZA 2M0GB 2F4VJ 1PAEX 4DX6A 3CCMS 2G2ZA 5KG3A 3GYNA 5IZHA 2GCFA 2MZJA 4WU3A 5IS2A 4K4SA 3GV7B 4DR2F 4B02A 1B0PA 3A3PB 3GIKA 4J90A 4M5JA 2GMJA 4OYBA 4ZKAA 1IKVA 3TUJC 3JSMB 2DNYA 4PZVA 4P7VA 4CTAB 4O44A 2AEMA 2F63A 2OEKA 2FJEB 3NOGA 3KLFB 4EUVA 1RBOB 2XWYA 4ED8A 4QJVA 2A6MA 2OHDA 1RAFB 1VLOA 2YNIA 2E7VA 3AH6A 2VPWB 4DPWA 1JLEB 3OL7A 1H0HB 2CPXA 2YX4A 4P52A 2CJ9A 3D6MB 1VJQA 2RT3A 3QLHB 5LMUJ 4DR3J 4QYZK 2VOPA 2VPYB 4JI3J 6AT1B 4C2MA 1KFDA 2BV3A 4IH6A 1NZAA 1CJKB 2DXDA 2J9DE 2M88A 4LFAJ 4CO3A 3J7AN 2R8IA 1VRUA 2KT5A 3MPUB 5FD1A 1LKZA 1NDLA 3DDIA 1P1TA 4CLFA 4EEYA 1WF1A 2MLXA 5DRKA 2DGSA 5HLFB 1KOHA 1Q5YA 3N28A 2W2MP 2CJBA 2BRKA 4YOEA 1QSLA 3B8HA 1CSJA 2AJ2A 3HP6A 3M2UB 4K2XA 3T9NA 2WSFC 2WSEC 1FNOA 2C3MA 2ZE2A 3I31A 2LMIA 3GWCA 5J2NB 1F9HA 4P74A 3KK2B 1VGYA 3GILA 2QLXA 5ETMA 4NA3A 2M8HA 3G82B 2GC8A 4M5NA 3TA2A 3CC2S 2Q1LA 2DD8S 1GK8A 1AXQA 2BQRA 3I4HX 3GB0A 2YNFB 2JH3A 4ZPDA 2DHHA 2XTJP 3TUPA 4B9UA 2KM8B 4JB8B 3U27A 1NK5A 3V6JA 1WTBA 2Y8WA 3CCTA 1JKHB 1HMVA 4B3MJ 1YDLA 2FLOA 3IM9A 3KK1B 5J1EB 1RTHB 4OI3A 5G0RA 5KOXA 1HI0P 3MR6A 1C0TA 3MECB 3NXZA 1X4FA 2ZKUA 1IN0A 2P6TA 3KXDA 5A0YA 2J8AA 5J2MB 1U26A 3JYTA 2QV6A 2C28A 1EARA 2UU9J 1P9YA 1KN6A 3DMJB 3RRGA 5HVFA 9ATCB 2ZOFA 3BBFA 3KK3A 2VJVA 1JLBA 3QIDA 3CGIA 2KT2A 4PXCA 3OHAA 2U2FA 1I3OB 3TQEA 4LFCF 5ETVA 3DN9A 4QIEA 1M5KC 1NPKA 3LP1B 3PJ9A 3VWSA 4F0KA 3K8WA 4X62J 5C42B 1QLNA 2IDLA 4O0IA 2GJFA 2JEJA 4TLQA 2H48B 4DV4J 1ELOA 1ZZNA 2D3ZA 3CJKA 4AL5A 1FKAF 3LP2B 3RYLA 3A4TA 2MGZA 2PE8A 3BSOA 4EBEA 1AZSB 1XTZA 5L1IA 5K8PA 1DHMA 3H90A 4LVOP 2EG2A 5B09A 5A2QY 4DFMA 2WVFA 3C19A 2MKSA 2VG5A 1H98A 3TA0A 5DQGA 1HW8A 3K5LA 4ED3A 3T5JA 2F40A 1N5SA 2H5JB 4JI8F 4LF2A 3MAAA 4CLYA 4DI6A 1Q82T 4X66J 3GYGA 1HNIB 1NAQA 4YB1P 3W2VB 2ZEJA 4JV2A 1R3NA 1YQHA 4B3SJ 4PUOB 3M6UA 4N56A 4ZA1A 2ZH6A 3H0PA 1Y00A 3TAPA 3BQ1A 4O44B 2KFYA 4LQ3A 2FD2A 2GAGC 2CVEA 2QG9B 4WF9Q 3LP0A 1LFWA 1RA6A 2AJ1A 4ERDA 1X5TA 2XHWA 2Z8QA 1UFKA 2MTLA 4F4YA 4DR1F 5DG8A 2J76E 2IHR1 1RAHB 4FNHA 3W9IA 2IA6A 2N3LA 3A13A 2R2SA 2N82B 2YKPA 1S72S 3THTA 3L7UA 3EZUA 4EMDA 3R5JB 5J2NA 4OIXA 3GJTB 5CABA 1V5VA 2NR0A 3H5UA 3CE8A 1WELA 2Q3PA 3IG1B 2C22A 4PRFA 5LJ5Y 1FNMA 4NCGA 3S6EA 2XCAA 1VBYA 1UEKA 1N56A 2AF6A 4ANCA 4AYBD 4ED5A 3GV8B 2RHQB 2UXCJ 3J7A1 1PIEA 2PDAA 4Q0BA 1X0PA 1PJ6A 1Q5VA 4CT9A 1RA7A 2CQ0A 2ACYA 2GJIA 3PHTA 5KFSA 4A8YA 1IBKJ 3I0RA 1KONA 1LWCB 4USUA 3VR1A 1Q78A 4ED0A 4ES2A 4NZ6A 3FEXB 4PKDB 5C5JA 4NXMJ 2UU9F 3ZZUA 3D1HA 2BKNA 2Z58B 4LSZB 3DOLB 1U8SA 2BKOA 4CQ1A 1CJVB 2FC9A 1HBOA 1CLFA 2EFNA 2DR7A 2RQMA 3NGUA 2YWHA 3FEZA 1KQGB 5SZTA 1IKVB 3H59A 4X62F 1IJFB 4FKXA 3MMAB 4NLVA 4C98A 1RHJB 2YX1A 4Y2MA 1BQNB 2KH9A 3TZZA 4R0EA 2M5YA 3UR3C 1M5VC 2FJWA 2MLYA 2VHGA 1T8EA 1B0VA 5HSPA 2J0QD 4K2JA 2DRAA 3D54A 1RAOA 4X65J 2Y0SD 1VHIA 4MK9A 3FCHA 4JI2J 8AT1B 1X9SA 3CULA 2OI2A 4N8OA 2OPSA 2EK6A 1S9GB 4WZMA 1SJFA 4USHA 3B6BA 2ZHBA 3WX4A 1XMQF 1QUPA 1NBEB 2HRUA 2XMKA 5EWGA 4M8LA 5KG0A 3M9MB 1N32J 2E9ZA 1X60A 2CG8A 4C48A 4YUDA 2MKHA 4M1KA 1EP4A 2UVWA 1Y5IB 4QR1A 4A46A 2HZCA 1FD8A 2DT9A 3CDAA 4J9UE 5LSRA 2IRUA 5DGAA 1L3TA 4K4UA 2V69A 1QAXA 1S1TA 1C1BA 4N8NA 4DV2J 2FVRA 4YMEA 3OR1A 2XHCA 4TVAB 4QYZJ 3N6NA 4J9RA 1KVJA 5AXKA 3EE3A 2ZC3A 5C24A 4X4PA 4P2XA 3AY0A 2Y1IA 2FVPA 3AODA 2WW8A 3ZTRA 1UZDA 1SJRA 1ZA2B 1UWBA 2JC0A 3PFEA 3POTA 4K4WA 3MM7A 4NYOA 1U4BA 2DGQA 3LPYA 5EGYA 2DRBA 4F02A 2UXDF 3LH2S 5DLFA 2DEIA 4BWJA 4OX6A 4J9PA 3DYAB 3N6LA 1UVIA 1RABB 4DHVA 2BJEA 1SC3B 4I2QB 1RGVA 3R9LA 2K2PA 3RW7A 3I9ZA 2A1BA 2D9PA 2K3KA 2WBRA 2Y3YA 3T5KA 2MB0B 3DHWC 2D74B 2E5JA 4DV5F 4E0DA 2D1CA 1CULB 2HZAA 1I1GA 4NOHA 2KHDA 2J8SA 5DG9A 4RUCA 4DV0J 4GKKF 2HHQA 3PJXA 2V4QA 4DR5F 1DBDA 1TL7A 1S12A 1X4BA 3LQVA 3TUZC 3BQ0A 2AWZA 1R6YA 4ZN1A 1Q8KA 3BS9A 4LFCJ 3W9JA 3JQJA 2OD6A 2YH0A 4EWTA 4ZJQA 3J81j 3IA0A 1KTQA 2YKMA 1W26A 1IQTA 2YNIB 3DXBA 4A4JA 3DLEB 3KG0A 1B0TA 5B08A 4RO0A 3C2PA 2KFNA 2K3IA 2RRNA 1TU0B 5EHHA 2CJQA 1VJWA 2DGWA 3QQCD 3CUNA 2IFXA 2X1GA 1SH2A 4L74A 3RAMA 4DR6F 1WF0A 1XBWA 3P5BP 3MMBB 4B08A 1JWWA 3GR0A 3MEDB 2ABYA 2Z30B 3JTOA 3R5GA 2NUUG 2YKQA 4K7QA 4O4RA 2E5IA 2HURA 3MFIA 2ZUAA 2C2EA 1HHTP 4PG5A 1X5SA 3PR5B 2NXUA 1RUSA 4O3SA 2HMIA 5AE2A 4YS2A 1VOMA 2VG7A 4QZVB 3VGVA 1J5OA 3RUBL 1FE0A 1DJ0A 3QJPA 4ED7A 3MM5B 2LVWA 1O6XA 2DR5A 3OTCA 3G6XA 3Q8PB 1WF2A 1RT1B 3OFHA 1XNRF 3PKMA 2ZHAA 2XLKA 5ETQA 2EKNA 1I94J 4FYYB 4HHJA 4NASA 1WEXA 2VPZB 3PW0A 4HI1A 5GAGU 4M94A 1HW9A 3DI6A 4B3MF 2VC1A 4LREA 2VQFF 4OYZA 3PW7A 2ASYA 3OL6A 1K73T 2KI2A 3DLLQ 4OI1A 3OVSA 3PYFA 4I64A 3VAFA 2GGPA 3ZNUA 2R7SA 3CVKA 4DR4J 3QWPA 2OFHX 3FSXA 1SKWA 1FT8A 2R8KA 5E2QA 1D9AA 4I69A 2Y1RI 1JXLA 2OO4A 4A47A 1EZZB 2OPQB 3CJ3A 3ILIA 3RBXA 3QSYB 1T3NA 1B7FA 5LMNJ 1GMWA 1SCJB 2XSJA 3KJQB 3SIPB 4CCHA 1UL3A 3DXSX 5KFIA 1CS4B 2B7BB 2DTJA 1HHSA 2AX1A 2GVZA 4QBUA 1IKXB 3ADAC 1SH3A 5F0UA 4BHQA 3DLKA 3H42A 5DLGA 1U6FA 3UD3P 2Y9HA 4I2PA 1GFWB 4I7FB 2CIMA 5AJ3F 4RW9B 4U9RA 5K14B 2AEJA 4K4YA 3RGIA 3OT9A 4JI5J 4G3IA 1BLUA 1D3WA 1YBAA 2B43A 2QFIA 2WBMA 2DGXA 5E3PA 3RB4A 1RKIA 1HNZJ 4EZ6A 4OLPA 4IO9Q 3KJNB 1JLQA 4AXIA 2CFXA 1RAGB 2ILYA 4OJ3A 4OHWA 4TN2A 3MR7A 4LF7F 2GMLA 4K50A 3M8PA 2V94A 2XULA 4RNNA 2M9KA 2CPJA 4MH8A 4OHVA 5AE1A 3D68A 3CCWA 4MYTA 3KLHB 2VBZA 1GMVA 5KAKA 5AE3A 2RKIA 1JNRB 2FHOB 4LRCA 1FFGB 3HHKA 4NYZA 3LF0A 2OPPA 1EKSA 3DLJA 1EKRA 3KJFB 2PD1A 4PPZA 4WYWA 5HBMB 3TANA 4DFPA 3W5YA 1VQ7S 4DR6J 3M6WA 1RWWB 2LYVA 4OQJA 2MZRA 3I56S 3AT1B 2DR6A 1Y7PA 1OO0B 1LWXA 2L9NA 2OPRB 3DHXA 3GJQB 3ULHA 4H4KA 5GADI 1LW0A 4Q2MA 4NZ0A 4A8QA 2HQFA 1FVSA 4ED1A 5KFLA 3MM9B 3MWBA 1RAAB 4DF8A 3Q24A 1HNIA 3CCZA 2BRLA 5B0BA 1SXLA 2EFPA 3AOAA 4DPTA 3D28A 4N41A 4IQMA 3DRYA 5L1KA 1EHWA 1YWXA 3ZZOA 3N5FA 2HVIA 5E3AA 3EMTA 3HK2A 3S7RA 4N76A 1YRTA 1RSCA 3MOZA 1RJJA 4NLRA 4FXVA 5JVGQ 2FZKB 1EETB 2FZGB 4DOZA 3O6QA 2ROEA 5KT6A 1VS3A 2HSEB 3OR2A 1VQLS 1U1QA 2HVEA 3HMJG 2VBYA 3QIPA 4EFAC 2NS1B 3OR1B 4DL4A 3AOCA 3AJ1A 3AQPA 4DR3F 3NWGA 5EUHA 4ENOA 2CPDA 2IA0A 1IXKA 4NLYA 3W2VA 3I96A 3L7PA 4XPCA 3AQOA 3L9ZA 4KPYA 4XDCA 5I3UB 2VQEF 1W25A 3CEDA 3B4MA 5B0AA 1MU2B 1ZM9A 4WK3A 1HNXJ 3CTRA 3MCNA 3AB4B 1UWBB 1NK6A 3FQKA 1KKHA 1H7XA 1F3FA 1RT3A 3CJ8A 1U45A 4PEOA 1ZS6A 4DSEA 1XNQJ 1KLMB 5D0HA 1RT4B 2KL8A 5SUHA 5HQLA 1LW2A 1RBLA 4P75A 1S9EA 3FGVA 2E29A 4ZCKA 4LF8F 4ZVOB 3MI7X 4AFFA 4FS1A 1OQ6A 1OPZA 4YB5A 5HMXA 2CPZA 2IVFB 3OLAA 1NSPA 1TELA 2HRYA 2GNKA 2VUGA 5GVQA 4RWWA 4CLKA 3C3LA 5AXLA 1HNVB 3HVTB 1SPBP 4D3HA 1CQNA 2VFRA 1B64A 1RWMB 1TL1A 2HS3A 1GXTA 2RH3A 1VIXA 3KUGA 1Y4ZB 2DH9A 3OXGA 3W1YC 1IBLF 2ALYB 3MPWA 4I2PB 4RUBA 4JI1J 3BH7B 1RTJA 4C11B 1TKZA 3V6HA 1A6LA 2HHPA 1YHQS 1S9FA 2JRSA 4DV2F 1MROA 4KHPF 5IQ6A 4XDDA 5HP1B 4H4OA 4FNIA 5IOLA 2DNHA 2PC6A 3MM5A 1MNEA 4RUAA 4HACB 4IG0B 4WTOB 2GIQA 4DX5A 1RLCL 4ECTA 4G1QB 4CT8A 4NLUA 4DSKA 4LFBF 2RNEA 2UVRA 3GG0A 2XYHB 2ATLA 2CQBA 4LF7J 1NNDA 3QPIA 1OY8A 2DIUA 3KLFA 1SUQB 3BYPA 5F8MA 4DL5A 3UVJA 2IBKA 2QL7B 3Q89A 5H1SV 4B3TF 1HI8A 2FY1A 1LEOA 2XLJA 2BJ1A 1AB8A 1VQNS 3SXLA 3D6FB 1WI8A 2IC3B 2FHJA 1Q0NA 2NXEA 2RRBA 4LF4F 1Q7YT 3C16B 1QM9A 1YJ7A 3G71S 2CPHA 1WC0A 5HATA 2Z2MA 2AKWB 3GIMA 4ZIVA 2MKCA 5KG7A 4DSLA 2FJDB 3TEHB 2MHEA 3L4BC 3GSDA 1FEHA 1K8AT 3C15B 3O3LA 4X84A 4DPXA 4JV1A 1D8ZA 2PFDA 2OAUA 4KHRA 3L7OA 5F9NA 2VL1A 4DR4F 3OQ2A 5MLCV 3SZ2A 5KFXA 2W4PA 3DOMA 4X4VA 4KQZA 4UOGA 1HL6A 4NI2B 4QOTA 4CLTA 2PI5A 1BHNA 3VGUA 2H4WB 2HVDA 1IKYA 4QWBA 4WKYA 3A1YG 3D7SB 1N36J 3A3OB 3DKDA 2B4OA 5E0OA 4DR7F 4O3NA 1KC8T 5L1JA 2IIHA 4ZVGA 2KO1A 1PYSB 1IR1A 3C6TA 1FEEA 1JLFA 4YHHJ 4USMA 5A8KB 1D1UA 3R5CA 2OLWA 4LF5F 5A76A 5CYMB 3GG1A 3KWMA 1K1QA 3JYTB 1JLAA 3QGHA 1KP6A 4M5HA 1I5OB 1RI7A 2DNGA 4IG0A 2RKIB 2QA2A 1X4AA 1H74A 1RT2A 5LOQA 3M1VB 1T94A 3EX7B 2UXBF 4U67Q 4PQUB 5HQ8A 5DQIA 2NZ4A 2YNFA 2ZH4A 1S59A 1QSSA 1XMOJ 3GYXB 1CEZA 2AX0A 2BE9B 3M30B 4PYDA 5C42A 1U1LA 4ZVTB 3B78A 3CXCR 4ECWA 3IO1A 3DYAA 1VR6A 1KQFB 3PZPA 1VQ9S 2CQGA 1WSRA 2OTJS 1U02A 1X5OA 1SIWB 1KD1T 1XNRJ 2UUCJ 5KFPA 4CLWA 1U0SA 2OGUA 3QO9B 3M2UA 1T9WA 4DR2J 1FXDA 1T03B 2E1PA 3DLKB 4HEA9 1MN7A 2F8MA 1KFSA 2IJRA 4M5DB 4F04B 3OFEA 2QA4G 2JNJA 4KY3A 4DUZF 2VIHA 2CVIA 4MAKA 4M5IA 5CYQA 3U02A 5EWFA 1N5YB 4GVBA 1KLNA 1NDCA 2WONA 2EEYA 2KYZA 1LXNA 1Q8IA 2RE1A 4Q44A 4UQGA 2X1AA 2DGTA 4PG6A 4B3TJ 3QRRA 1U1MA 3RG6A 4CLSA 1LWFB 4A8XA 2CPFA 3M2VB 1MMLA 4X4QA 2GAHC 5ETNA 2J0SD 1R8HA 4USVA 3W8GA 1FDBA 2QMUB 5MAOA 1REVB 1AUDA 2IY5B 4IR1A 2B3TB 4DL2A 4ZCIA 4F8RA 1HLWA 2KJWA 2U1AA 3DI6B 4HH1A 3EWGA 1HQEA 2C2DA 1WG5A 3ZTQA 4DG1B 4ZVFA 3EZ5A 1M1HA 1XMQJ 3FEYB 5I42B 3QJLA 2MSTA 2V68A 3BGFA 3QFHA 4JI5F 2W9CB 4QR2A 2BOAA 5K9FA 1NU4A 4KR0B 1EIYB 3D67A 3OTDA 1VBKA 5DQHA 3K7RA 2AZ3A 3F44A 1YJTA 2FDNA 3SV3A 3I5AA 1N36F 1TK0A 4I1TA 1TR0A 3EVMA 4USWA 5B0GA 2B51A 1MMNA 5B0DA 3AJ2A 1NO8A 3HSDA 1GAOA 2W7OA 5CHCB 4J9SA 3H98A 2FVQA 3FZ2A 1PSDA 3FZBA 5EX0A 1VQ8S 2XCPA 1C1CB 1WKKA 3HFZB 1UJ4A 3NLCA 4WFBQ 4KC5A 1PAUB 3K0JA 1OIAA 1Y11A 4ZCLA 4X4RA 2B9XA 1S7IA 4ZLJA 2J6UA 4MKBA 3CCUS 2QL9B 4NI2A 1RTIA 1HBOB 5JUMA 1DLOB 3SBMA 1KVIA 4WJBA 3NKYA 3R7NB 1GX6A 2YWKA 5A2QU 1BE4A 1FWLA 2G2OA 2GVDA 3KG4A 3Q2TC 4G1QA 2DBBA 1SKSA 3BKUA 3DC2A 2UUAJ 1Y10A 1M90T 5DZ6A 5IT9U 1H7WA 3W62A 3TQ1A 1D0EA 2G4BA 5D77A 1RAJA 3HSJA 4DSIA 2C3OA 2QX0A 3P96A 2C2MB 3D9BA 2V9WA 4L72B 2J7UA 2OMLA 2R8GA 1IBLJ 4ZVPB 4RNOA 4EI2A 4X4NA 5E33A 3FVYA 4MK8A 5HMYA 1KSPA 2IYGA 3AB2B 2CJAA 2DNZA 2YWWA 4K5RA 4X66F 3CIMA 1CJUA 3V4IA 5D8HB 2V2QA 1FRJA 1U24A 1NRKA 4CLUA 1DRZA 2APOA 4LR8A 2RMLA 1ZM2A 2W7AA 2W2NP 1Q1KA 1JK9B 1KWMA 2F5GA 1RHMB 4CO4A 4M5GA 1NHKL 3GR1A 1M1KT 2WONB 4J7CA 4LF1A 2PSZA 2FGCA 3HI9A 4MT1A 3TEGA 3NS5A 3X3UA 3T1YF 4IH5A 2NUHA 4WU2A 5K8OA 3VAHA 1S76D 3ITHA 5KG1A 4DV1F 3K2YA 2YPZA 1MLAA 2P9EA 1KNZA 5T14A 2W1BA 4OJ1A 3SQGB 2AW0A 1QY7A 2ZBIA 3KHHA 3FRYA 1HNWJ 4LSNB 4RW7B 2XMMA 2MQOA 2IMOA 3PACA 5IC6B 2Z2LA 5F8IA 1NKBA 2ZDOA 2XNRA 3M8QA 3EYZA 4JI0F 4CLPA 4KO0B 2EXUA 3M9NB 2LQJA 2OKQA 1DTQB 4JUZA 4ZITA 3KLEA 2RS2A 1ZYQA 1BQMB 2LQBA 3ZO7A 3W9HA 3QRQA 3T1HF 1JKHA 1HMVB 2RSQA 3KKFA 3V2UC 5KFUA 3V4MA 3ZC4A 4EYHB 3MTJA 4M5DA 1X0FA 1SKRA 3QWUA 1KQSR 1FVQA 1UP1A 3I5CA 3AXKA 2ADCA 2UUBF 4WK1A 4KGXB 4HVZA 2CPYA 1BUXA 2EBGA 2EW9A 2PT0A 3CJQA 4YHHF 4RLEA 1VK3A 1SI9A 2QRRA 4QWDA 3BR9A 4C8YA 4MIWA 3JB9k 3ISND 3LAKA 3RRHA 2FGOA 3FQLA 4FF2A 2P8IA 3N79A 4Y2AA 3KK2A 4DQPA 1HBNA 2CKWA 5L39A 2CQ3A 2LXFA 3GFXA 2E7XA 4UY8T 2GS8A 1VK8A 1YRXA 4JOUA 4C8MA 4CNYA 2GHWA 1WUUA 2VG6B 5T7LB 1UW9A 1YZ6A 2CNKB 2OTLS 4CH1A 3BN7A 5KFKA 1F0XA 2HQGA 3MMCB 1XR5A 1GT8A 1Z2ZA 1RTHA 4KGVB 2D41A 2IJNA 4LBPA 3GONA 3IC1A 4P2MA 5DJBA 5G0RB 3T19A 3CJ0A 1EQMA 4OJGA 3SI8A 1S0VA 2J9DA 3I6PA 4DV0F 4DV3F 4GKKJ 2HQCA 2KXHA 3I0RB 4CNZA 4P73A 3OL8A 1W2IA 1UAWA 2ROPA 2YX7A 4ECXA 1RWOB 5GMKa 2BOPA 3G82A 2CQ1A 3R7BB 1RDRA 1FJ7A 2CAJA 2KRRA 4ID8A 3VAJA 1S1VA 3C6UA 1X4DA 5EDWA 3SMZA 1IQZA 3MPDA 3M8ZA 2W9BA 3KYLA 3OUYB 2MKYA 1QSYA 1T02A 4JI7J 1YBTA 2HGMA 2AD9A 1WC5A 2JC1A 3UDLA 4LFAF 3ZTPA 3ONQA 4DMZA 1I94F 3OVAA 4IUFA 2XG8A 3BPDA 3KTQA 1TUVA 3CWJA 2GVZB 4V1Ak 4CRJA 2EC0A 2KVQE 1FE4A 2AMCB 2IM1A 1ULRA 3KDNA 3BN4A 3H2LA 2NYHA 3M6VA 2I5JB 3IS9A 3HHLA 3SEOA 3CCLS 1OMSA 2RJZA 1HNWF 1NMEB 1R0CB 3ZFVA 3NGDA 1UTAA 3ISZA 1NSKL 4LSLB 2ASLA 2VONA 1DZ5A 4JV0A 3MUVP 1VRTB 3G96A 2GGPB 1TTHB 4DPOA 4DR5J 8ATCB 1A9NB 1C1CA 1YI2S 3DRPB 1TZ0A 1JJHA 5LMNF 4X4TA 1RT7B 1TFYA 2OFGX 3U1NA 1ZTWA 2JLGA 1YBUA 2C1EB 1L5UA 1M5OC 3TWZA 1ZPVA 4FZVA 3CDWA 1BWEA 1FJGJ 2VG5B 1IKWB 4DDFA 5A8WA 3K59A 3NGKA 4UOFA 2AP6A 2ZOMA 3UO0A 4CZCA 3FBBA 4Y6IA 2FIUA 1FK9A 1V5IB 3MEEB 5KG4A 2HVZA 3VCDA 2H5EA 3GIJA 4DV5J 2UUWA 2WVBA 1NEEA 5L9XA 4LRDA 1NJIT 3R2CJ 2W2OP 3JTPA 5K8NA 4DLEA 1PYOB 3V6DB 3JXOA 4OX7A 4N5SA 4DXLA 4ZOSA 1U49A 3HHNB 3TARA 2AGOA 5KFZA 4DS5A 1FRIA 1IBMF 4J9MA 3PM9A 2EFVA 4LF6F 2B8QA 4DU8A 1RT6B 1OY6A 4P6QA 1UMJA 2QYCA 3IR5B 1QDUB 3KNGA 3M30A 4ICLA 4X64F 3RAXA 2BEFA 3CD6S 4U96A 2AHOB 2ZHOA 1WACA 2MY8A 1IJEB 2XZWA 2Q6BA 1XERA 4WTYA 1M5HA 4H4MA 2QT7A 1LNQA 1EETA 4ZP9A 2DNNA 3AD8C 3FBEA 3QSIA 3WBZA 4JI8J 3CJ2A 1JLAB 2BYCA 3FBCA 2DR8A 4NMXA 2IM3A 2VH7A 5E3QA 2FJAB 2IRYA 3GLJA 4IDKA 4BWMA 5KG5A 4W92B 2QJ3A 4UQTA 4A8WA 4RW6B 4Y2IA 2J7KA 3NBPA 3KMQA 2ZD1B 2HHSA 3F0NA 1Y5LB 2MSSA 1FFSB 2ZVIA 1C4CA 4NEYA 3T1YJ 2E1CA 1G2EA 2QSFA 4I6YA 4NLQA 3T6JA 4F4KA 1WHWA 5CXTA 4ZPWR 4NA1A 1JX4A 2VA3A 5E7OB 4PQUA 1G4CA 1LW2B 3OTEA 4PG4A 1EJ7L 5A8RA 1J2VA 2LQ5A 2V6AA 4F3MA 3UN3A 2QGFB 2E5LJ 3KJVA 3HM9A 4QU7A 4TU9A 1DQ8A 4WP8A 3UCUP 4M95A 3NNCA 5D0RA 4UUWA 3R1LA 5A8RB 1TMJA 4KGKA 1UJ5A 1KHWA 5EWEA 5ETLA 4BDPA 3R2DJ 2CQDA 4Q5VA 2BR0A 2RQ4A 2LXUA 3W66A 1C1BB 4I2QA 5KFWA 1VDHA 4BC9A 2Y1JA 2GQCA 4X2BA 2IAJA 1XEZA 2XLIA 2ZNZA 1S99A 2IDEA 3NGRA 2BDPA 3G6ES 3HVAA 2CJYB 5CYJA 3R5AA 4A48A 3GV5B 3BDEA 4DQRA 2IRXA 2MZQA 3QYYA 2B6AB 3IMQJ 1FKOA 4KGMA 3PHEA 3H2UB 1CS4A 4OYOA 2HHWA 1RQ0A 6FD1A 3TUIC 1FJEB 2SXLA 3OV7A 4URQU 2G0CA 3SCJE 1LQ9A 4CLLA 2VODA 1KOOA 3H7HB 4MKAA 2MZ1A 4OV1A 1D8YA 2KG1A 1BMQB 1WKJA 2B0GA 2X1BA 1O8BA 2P9CA 3UD4P 4ED4A 4JI3F 2ILZA 2OH2A 2VG6A 1KRPA 4TY8A 2FYXA 3US5A 2POKA 2ZD1A 1H2TZ 5HANA 4RU2A 5LSLA 1ZTTA 3VZHA 2RF2A 3DLHA 1RT6A 3OVBA 3PJWA 1HWIA 3W63A 3J7Z5 2CA9A 2GFFA 2VDHA 5DDOC 2N7YA 3M4XA 5ETRA 1RYSA 2QEXS 4Y3CA 4DSJA 2X1FA 1MSWD 2YWGA 1WI6A 5CZVA 4UUXA 4NXNJ 1NPPA 1W7WA 2G0JA 3OPKA 4OI6A 4B3RF 3K5NA 1RP5A 2V8GA 2O01C 3BGRA 2ZH2A 3C66A 1RTDB 4DV6F 4LIRA 3RR7A 4RUHA 4USIA 1ROFA 4ZK7M 5M2PA 2BJ8A 1PILA 1RT3B 3EXYA 2I8EA 5HO4A 3PO4A 1DARA 2V2ZA 3PX4A 1DTQA 2ACMA 3HJVA 4TNOA 3PW4A 1MG7A 1N5VA 2XO7A 4G1IA 5C7PA 1JB0C 1RLDA 4N77A 1T05A 3BR8A 1RT7A 3MAHA 3U1LA 2F8EX 5K14A 3C8YA 1HNVA 5JVHQ 1Q86T 1P6TA 3FFIA 4PXEA 2HFOA 1JXVA 3GU0A 2L3MA 3H5SA 4ES3A 2EFGA 3PEJA 3DRXA 5HVHA 4DUYF 1U0HB 5D4NA 3QNWB 5EX3A 2DNLA 4Q7AA 1QVFR 3ELHA 5KT7A 4DCOB 2QZ8A 4DFJA 1FKOB 3BGOP 1GMUA 2DISA 3BGRB 1DTTA 2H51B 5IM0B 4P9SA 2C2RA 1TVRB 1X4EA 5BYRA 2CQ4A 2D3UA 4RW4A 1UETA 4ID5B 4C7QA 1YLXA 3G8QA 1OS5A 3V4IB 1PG5B 2QLWA 4DPYA 2ROGA 1CQMA 1YJWS 3R7SB 2IAJB 2F4FA 4J37A 4MKYA 1UVMA 1N5TA 1F6TA 5ITHA 3CO0P 4CYUA 2FTRA 2OPRA 5E41A 1XR7A 2AU0A 2VPXB 2CNNB 2WRMA 3DLEA 2XMWA 1HBNB 1JLGB 3R3TA 4IG3B 2WW4A 1S1VB 1YGYA 3HHLB 1GEHA 4YB6A 4ETXA 1NJZA 2HFUA 1X9WA 1ZETA 3BO3A 1JJ2R 5KFDA 3CCSS 2R7RA 1N54B 2BX6A 5C2GA 2AJ4A 2L41A 1AYEA 2CYYA 3IFEA 2BE2A 2DPJA 4QIWD 3MOJB 2HGLA 2DR9A 3POTB 1S97A 1S10A 1S0NA 3UE2A 4NYPA 3CMES 4HH0A 1UEVA 1I51B 1WHXA 2HQIA 2VKZG 3GPAA 4JI2F 1R7IA 1FNXH 3TOQA 2NLWA 1IM4A 2F8HA 3N6MA 2NPIA 4R8UA 3KOAA 3MM9A 5LL6d 1HQ2A 1JJ4A 4DQQA 3QMQA 3EVWA 4ZLPA 2C2NA 2NSBA 1PC5A 4DU7A 4QIFA 4ER8A 2I0XA 3HZEA 2HBQB 4OI0A 1N32F 1IBCB 1H2UX 4Z7YA 1K9MT 2PN6A 1LWFA 1P1LA 2HEKA 2M7SA 1IKXA 2W4CA 4M63A 4OLOA 4ZDNA 4XPEA 4ELVA 5IT9Y 1GH8A 4DEZA 3NNHA 2UV8A 4ELUA 3HO1A 3NY0A 2YQ0A 2G0IA 3KK1A 3N0VA 2VDIA 1VQSA 3SDEB 4DX8H 3F73A 3CCVS 2VA2A 1H3DA 1VC6A 5HL7Q 2ZKTA 2FPHX 2HW3A 3WIUA 2WOMA 4CO5A 4TKTA 1WWHA 2UUTA 1ACMB 1XJWB 4XAKA 2XBPA 1HQEB 1HR0J 4OHXA 3QBCA 4KO0A 3SCLE 3R97A 3Q83A 2V5HG 2UV8G 3IWXA 4FF4A 1JJCB 1S1XB 2DITA 3MGJA 2E1RA 3OFGA 1O51A 4AD6A 1FESA 3KMSA 2UVVA 1BQNA 1WJ9A 1F9FA 2DVIA 3CD5A 1N5QA 4DL7A 2WVCA 3LANA 2JJ4D 4WBFA 1R8PA 2QFJA 2YKAA 3QJJA 1CC7A 3LGMA 1RT1A 2IVYA 4HHUA 2NXCA 4F67A 3QZ7A 4TXSA 4OFZA 1XMOF 2VBWA 1VFJA 2JHEA 2PMHA 2CZ4A 1CJVA 2OPSB 3QGPA 4PG8A 5AXNA 1NJWA 1J5OB 3BPSP 1BQMA 3DCAA 1VYAA 3NEKA 5B0FA 3CB4A 2J0XA 5A8WB 1IKWA 5LXYA 3PKYA 3LWMA 3AFGA 5D3GA 4CLZA 2VJUA 3QLHA 1X7VA 2HIYA 4L73A 5FDLB 4F4ZA 3M2RB 4G6VB 1NKEA 1QAYA 2K1RA 3BM7A 1RTIB 4I0WA 2UXBJ 2MMYA 1RE1B 2OSQA 4R0JA 4U7CA 1PGZA 1UVLA 1TL4A 4O3RA 4LBIA 2NYIA 3JSMA 3BYRA 3VAMA 1NM2A 1SB6A 1ZH5A 1FCAA 3DU6A 4LRAA 2XB2D 3TRGA 1FRMA 2HK3A 2UUBJ 3BBBA 4OMFG 2L48A 1WDTA 5AXMA 2A6OA 2QL5B 4PAAA 3R5DA 3FDSA 4DQSA 1FK9B 3MEEA 2XY5A 3R1HA 3ET6B 5G4DA 3PXGa 4B17A 4EO6A 2VICA 1FO1A 4ZP8A 2V8VA 3QFWA 5GMDA 1UVJA 1F5CA 1YJVA 1RAEB 4YQWA 5H9FK 3M9OB 4C8LA 1SQGA 1T11A 1ZAWA 2R7XA 3A3NB 5HAOA 2MDAA 3D1QA 4LBHA 3BDPA 4V19J 4K0KF 3HHLC 1A0OB 1Q4RA 2MQQA 3ETMA 3R6GB 4YY3F 2XM3A 3DLBA 1YTYA 3GZ7A 3HXMA 2HIQA 2WCXA 1RHKB 2XEXA 3J7YU 5F41A 2ZNYA 1RHRB 2FQQB 1FRKA 2OIHA 5ETTA 1YVFA 2MQPA 2R8HA 1VQ4S 2YPYA 1S4FA 1N0VC 1T95A 2M8DB 2F7VA 3CF5Q 4R25A 3G8TA 1NDPA 1WORA 2B9WA 3VZIA 1NCLA 1IWGA 3ENAA 4Y00A 3VQSA 4OYIA 4Q8FA 1NDKA 4USKA 3IR6B 2M52A 2WB4A 3KFWX 3LP2A 2R4FA 1I6JA 4FBTA 4V19X 2QA1A 3DM2A 3QAUA 4C11A 4EGLA 1RTJB 1B70B 4NCGB 5I42A 4NLTA 3NS6A 2OP5A 5HMZA 1JLCB 2MXYA 1JNZB 3CJSA 4UZCA 4WE1B 2HS4A 4YDXA 5KFYA 4KTQA 5RUBA 4QU6A 1Q8LA 4GKJF 3A8JA 3KLIA 2J9CA 1MMDA 4AQYF 2HBYB 3JSYA 4HT5A 3JTNA 1F5AA 1NUEA 3G8SA 1N34F 4ZVSB 4LR7A 2KB2A 3EGWB 4P2SA 2XYPB 2GZOA 2HG4A 4X4OA 4JP8A 1QTNB 2FUG9 1N8RT 1K44A 2PA3A 4FKYA 1Q81T 4QIGA 3TR5A 3CD0A 3DU5A 2CZ9A 3SCKE 3LGNA 5H9FJ 4ZMMA 4P72A 1VIOA 1MROB 3KLEB 3HSGA 5BXIA 3OW2R 3BB5A 1TKZB 2H9ZA 4DFKA 3BEGB 2E5GA 2DK2A 4O4GB 3EVOA 4KRWA 3TA1A 2Q79A 3TNVA 1N6QA 3TW0A 2G1HA 3FCVA 4CWBA 3KK3B 5U47A 2H1YA 2KHCA 4F7VA 4Y65A 3NL0A 4Q2LA 2F4VF 3WC0A 3P6YC 1YG0A 5B0EA 3THPA 2R2TA 3FSYA 3GSIA 2EK1A 1T9TA 1TQLA 1YZ7A 2KXFA 3H2VE 1JLCA 1MWZA 3IGVA 5L38A 3J7YI 4YFUA 3THVA 4U8YA 2C2OB 2EI5A 3KHGA 1FXLA 1N5YA 3Q23A 3MURP 1RT2B 2FB0A 2DHGA 2W4DA 5KT2A 1U25A 2B6AA 4B3SF 5E3RA 1CJKA 2V2KA 5T41A 3H5YA 2ASDA 3IR7B 2C2KB 4RW8A 3M7VA 1CJUB 4ES1A 5C2CA 1SC4B 2E44A 1AROP 1JLFB 2B9EA 2LQ8A 3CJ5A 4IKAA 4X65F 4ZP6A 5L1LA 4NLGA 4ILLA 2CRLA 3IWLA 4DV1J 3UNGC 4LVNP 5HN0A 2B8PA 1K0TA 5DO2A 3IBWA 5KG6A 5KFNA 1VQ5S 1FDAA 3QAEA 1T0TV 4ECYA 1B4SA 3DNCA 4KV8A 2W2QP 2XZTB 3ILJA 3K5PA 2VKRA 2XY6A 2JFKA 3DOMB 2D3O1 3M32B 3UNYA 1NJXA 2HWTA 2K7JA 2X3DA 4FPIA 3H25A 2ZH5A 3UW1A 3RB0A 4W4MA 2EVZA 2HLTA 4FYVB 5HK4A 1RACB 3PIPQ 2BANA 1S57A 1SQEA 1Y3KA 2HKEA 3C46A 5GAEU 2KYXA 1G6BA 2O67A 1XIQA 2QYGA 2V4JB 2GIRA 2NZCA 2OSRA 2Z56B 2BJ3A 4TYAA 1QAIA 4WE1A 3LW5C 2M4MA 2DNOA 2K7KA 4A8SA 1Y5NB 1WG1A 4HT7A 4J91A 1VLYA 2RVJA 3WX8A 4S0MA 1S1UB 2BE7D 2DGOA 3ETOA 1VBZA 3PRDA 1S6PA 1RU1A 3B4DA 1NH7A 3IBFB 1VQPS 3NMAA 3A8EA 4PYAA 4WPAA 4JBCA 1HPZA 5J2QA 1DY3A 2WVDA 4CH0S 1D09B 1NHVA 1KLMA 1WEZA 4FS2A 2ALZA 3E01A 2ZZTA 4YR2A 5CAAA 1S1WA 2VFSA 2IMWP 4DJBA 5KFMA 4ECQA 1JLQB 4O3QA 1M1GA 3MM8A 3TZXA 4AL6A 1GXLA 1RISA 1RZMA 3KUEA 4DV3J 4EBCA 2DKOB 3CDEA 2GQ2A 5K5MA 3CCJS 1YJNS 4IRKA 3EPGA 1TL1B 2IYIA 3M2VA 4URSA 1RWUA 2J0WA 3D1OA 1TKDA 4RKUC 2V8DA 4PWDB 3PW2A 2AV5A 5ETSA 4DZ6A 1E6YB 2CNOB 3DRSB 1QVGR 5D78A 2RRAA 2EFQA 5HP1A 3PIOQ 2ZFHA 5HJXA 1RT4A 2NXNA 3CJKB 3J80Y 2CJXB 4U7UK 4OHYA 5D0GA 2RHSB 4RPFA 5KT3A 2MLZA 4Q45A 5DETA 5I3PA 2KT3A 3KLIB 1X5PA 3HVTA 4NLSA 4CM0A 4UOCA 5L8RC 3D2WA 4L76A 2HPUA 3GFYA 4Y2KA 3EPIA 1T3OA 5FDLA 3UDVA 4QCLA 5D4OA 1E6VB 2DO0A 4B9TA 1VQYA 4LSLA 5A0YB 3Q8VA 5HMWA 4CIOA 2BZ2A 4KBIA 4NLXA 1J5EF 1LOUA 1OJ4A 3WZ0A 2XS2A 3HX9A 2MKKA 1ICEB 5FLXU 4B9NA 2OPPB 4ECSA 2WAQD 3A8IA 1RWXB 2MYFA 1TL7B 2FHKA 2I38A 2DIVA 4N7TA 5A8KA 4CO2A 1WC3A 2BQUA 4M5KA 2HNYA 2VF3A 4DV7J 4L3KA 4DLGA 2A3JA 3R6LB 4ECUA 4RNFA 1SBRA 1CBKA 3TZWA 4LFBJ 4ZN3A 2ZJQQ 2MQLA 5DDPC 3NAHA 4ECZA 3DLGA 4UW2A 1K0VA 2HNYB 3GFZA 2M2BA 4QR0A 4P71A 4H4KC 2C42A 1XN9A 2WK4A 3F56A 3CJTA 3HULA 3MHYA 1DURA 4F0HA 2Q43A 3HKWA 5HVGA 3SYZA 3AAWB 1R0AA 3N01A 3MM7B 3DDKA 1S6QA 3W2WB 1U7LA 2QE5A 1TMMA 3TVZA 2XO6A 3MR2A 2H65B 3CCRS 5BR8J 2IBOA 1R27B 3AXMA 4DBQA 3HHLD 5L46A 4EYIB 4MK7A 3TAQA 1FERA 2QLFB 1BQXA 3GMGA 1RT5B 3M8SA 3AHPA 1RK8A 4CO0A 1YITS 3W8PA 1KDNA 4OJHA 5T7LA 4ZPAA 5DZ7A 3VVUA 4CTAA 2CDRB 4ICLB 4R8UB 2QN6B 4MYUA 2XGQA 3BV8A 4HDGA 1LWEA 4BBYA 5F8JA 4RX6A 4ANEA 1SVDA 2RQCA 4DCPB 3EJMA 3Q86A 4TU7A
chains in the Genus database with same CATH topology
3HD1A 4M5HA 1HKAA 4M5IA 1F9HA 4PZVA 5ETVA 1HQ2A 5ETLA 3ILOA 5ETMA 5ETPA 4AD6A 2F63A 4CYUB 1RAOA 3ILIA 1RU1A 3HSJA 4M5LA 4M5NA 2QX0A 3ILJA 3MCMA 5ETSA 4CYUA 1TMMA 3HSDA 5ETTA 4M5MA 5ETNA 1RU2A 1DY3A 3HSZA 5ETRA 5ETQA 3HT0A 1EX8A 3HD2A 3UDEA 2BMBA 1G4CA 5ETKA 2F65A 1IM6A 4M5KA 2CG8A 3UD5A 5ETOA 3HSGA 3KUGA 1KBRA 4F7VA 4CRJA 3KUEA 1Q0NA 1EQMA 1CBKA 1RB0A 3IP0A 3KUHA 3MCOA 1RTZA 1EQ0A 3HCXA 4CWBA 4M5GA 3UDVA 3MCNA 3QBCA 1TMJA 4M5JA 3ILLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD1 A;  4M5H A;  1HKA A;  4M5I A;  1F9H A;  4PZV A;  5ETV A;  1HQ2 A;  5ETL A;  3ILO A;  5ETM A;  5ETP A;  4AD6 A;  2F63 A;  4CYU B;  1RAO A;  3ILI A;  1RU1 A;  3HSJ A;  4M5L A;  4M5N A;  2QX0 A;  3ILJ A;  3MCM A;  5ETS A;  4CYU A;  1TMM A;  3HSD A;  5ETT A;  4M5M A;  5ETN A;  1RU2 A;  1DY3 A;  3HSZ A;  5ETR A;  5ETQ A;  3HT0 A;  1EX8 A;  3HD2 A;  3UDE A;  2BMB A;  1G4C A;  5ETK A;  2F65 A;  1IM6 A;  4M5K A;  2CG8 A;  3UD5 A;  5ETO A;  3HSG A;  3KUG A;  1KBR A;  4F7V A;  4CRJ A;  3KUE A;  1Q0N A;  1EQM A;  1CBK A;  1RB0 A;  3IP0 A;  3KUH A;  3MCO A;  1RTZ A;  1EQ0 A;  3HCX A;  4CWB A;  4M5G A;  3UDV A;  3MCN A;  3QBC A;  1TMJ A;  4M5J A;  3ILL A; 
#chains in the Genus database with same CATH topology
 3F41 A;  3ICL A;  3IGN A;  1P9Q C;  2H5I B;  2K06 A;  4IO1 A;  2ZJP Q;  2LEC A;  3C15 A;  3OL9 A;  2P2C B;  3FC9 A;  3ZZR A;  4ETZ A;  4J9K A;  2ADB A;  5FJ4 A;  2GA7 A;  3ZZZ A;  3V81 A;  2YWF A;  1G7C B;  1UWA A;  2YKN B;  2HQ3 A;  4QIV A;  2OPQ A;  1S79 A;  4RJV A;  2CQ2 A;  3T9Z A;  3BKF A;  4C0O C;  1ZAV A;  4BCA A;  2YNG B;  2VFT A;  4FXW A;  3TI0 A;  1PCA A;  3DGV A;  4DV4 F;  3D6H B;  1N4L A;  2MKI A;  1HBU B;  5KTQ A;  1H72 C;  4P2F A;  2HFS A;  3MED A;  1S0O A;  1F1B B;  2FHJ D;  2L9W A;  3AD7 C;  1FTC A;  2HNZ A;  4HL9 A;  4I7F A;  4IOB A;  4QW8 A;  3D3C J;  4KIA A;  2ZM6 J;  3K58 A;  3MXH P;  1T7P A;  1S7H A;  4RW4 B;  1G3O A;  1UVN A;  1V3R A;  2D69 A;  3L09 A;  5A6W A;  3WDO A;  1R8C A;  3ZNJ 1;  3H4B A;  2LEP A;  3FUY A;  2VQF J;  1TAU A;  3B54 A;  3NAI A;  2H4Y B;  2DB1 A;  2D3O R;  2YXL A;  1NB7 A;  2WTF A;  4G65 A;  4QW9 A;  1E6Y A;  3DRS A;  1VC5 A;  4GO7 X;  3W5X A;  2DRD A;  3VAL A;  3CC7 S;  3IXQ A;  4HTI A;  4LF9 F;  1G1X A;  5J2P B;  5EN1 A;  1HWL A;  3GP9 A;  2XYG B;  2BJ7 A;  2JVO A;  4OZ0 A;  4UF4 A;  1IVZ A;  2VQE J;  3O5T B;  1PBU A;  1GTH A;  4IOA Q;  3OBI A;  3NGS A;  4ILR A;  2KRB A;  3D0I E;  1YJ9 S;  1NPR A;  1T9Y A;  1HBM A;  2DHA A;  3DLG B;  4LUB A;  1L3S A;  1H38 A;  5F8N A;  4WFZ A;  1RWP B;  3MDF A;  5IWA J;  2ERR A;  1SC6 A;  3QIP B;  3PYE A;  4A8K A;  2DPI A;  4YDD B;  1DQ9 A;  1O0P A;  1YIJ S;  1UFL A;  3R8Y A;  1WHV A;  2GJ2 A;  1N33 J;  3FKB A;  5C25 A;  2LFV A;  3NWR A;  3QGG A;  1L3K A;  3TJ9 A;  5HRO B;  3E8O A;  3N4W A;  4E98 A;  2DJW A;  2DY9 A;  4FF1 A;  3DDN A;  4KKO A;  3BO4 A;  1MN9 A;  3OTO F;  1V3Z A;  4NLW A;  3D0G E;  3M32 A;  3HSZ A;  3VTI A;  3V6K A;  1OSC A;  1NLK L;  4KV8 B;  2L9D A;  1HWJ A;  2O5D A;  1NZ8 A;  2QSW A;  4JI7 F;  1OYD A;  3QT7 A;  1UFW A;  5KFG A;  4C3M A;  2AQ4 A;  2FLL A;  1U2R A;  3TVY A;  3I32 A;  2R3V A;  5ETO A;  5K20 B;  4KHP J;  3FCW A;  2DGU A;  3K5O A;  1ZOT A;  2WB1 D;  4CO1 A;  1UA1 A;  1U09 A;  2GHP A;  5KFA A;  4I68 A;  5E3C A;  4FYX B;  1NK9 A;  1M5P C;  1TFW A;  1QD1 A;  3CCE S;  2KTQ A;  3PYG A;  2DY1 A;  1H2V Z;  4KFB A;  3I4P A;  1U6Z A;  3NCP A;  3V5R A;  3W61 A;  5F9L A;  4B9L A;  4J9L A;  1M0S A;  4NRT A;  2MQ8 A;  3CMA S;  4DF4 A;  1R0A B;  3O2I A;  2DNR A;  1TL3 B;  4UY8 5;  3U1M A;  3K17 A;  1XC9 A;  1S9G A;  2PMW A;  3W65 A;  4RU9 A;  2N4D A;  4IFV B;  3JAM U;  2OEM A;  4QWA A;  3ENQ A;  2DH7 A;  7FD1 A;  4DG1 A;  1Y9O A;  2HS0 A;  1JIH A;  3AD9 C;  2BUN A;  2BMB A;  1YJU A;  1Q16 B;  5F8H A;  4ILM A;  3TJ8 A;  2F65 A;  5GAE I;  1R43 A;  1U1O A;  1RHU B;  4F4X A;  4RR5 A;  2RUS A;  4NL5 A;  2IM2 A;  4O0N A;  2GMH A;  4FN5 A;  4ZP7 A;  3DMJ A;  1SUQ A;  4GMK A;  1ZM3 A;  4O4G A;  1FRX A;  3T41 A;  5GAH U;  2HRT A;  3MM8 B;  2EKY A;  3CC4 S;  3W3S A;  3K8V A;  4OYA A;  1FHT A;  1BC6 A;  1UCN A;  1F9E B;  1YRU A;  3KJV B;  3BGL A;  2X7I A;  3BRE A;  2I6W A;  1AZS A;  5HRO A;  3DOL A;  1OSD A;  3OSP A;  4WZQ A;  1GX5 A;  2Y1L B;  1LV5 A;  2HZV A;  1RTD A;  1PKU A;  2CUY A;  3CO9 A;  4AUK A;  2PEH A;  2UP1 A;  2I1R A;  1X8D A;  1O5J A;  3AJD A;  1QE1 A;  1NK8 A;  3H8Y A;  1N48 A;  4ZVE A;  3MR5 A;  4Q0B B;  1R8B A;  3TP2 A;  2AYE A;  3ZZP A;  2BVZ A;  2OEL A;  1HBM B;  1VCT A;  2Z0G A;  1EP4 B;  3UD5 A;  4ZIW A;  4RBT A;  2D9O A;  3BSC A;  3MFH A;  4GC6 A;  4DL6 A;  2GO8 A;  4WWS A;  3OSN A;  2E5L F;  4TQR A;  5JMN A;  3DRP A;  4WP9 A;  3D6T B;  4J9O A;  2Q6C A;  2W24 A;  4LF9 J;  2DXF A;  4NCB A;  1RTZ A;  2J9E A;  1FF2 A;  1VHF A;  2VOO A;  1SJQ A;  1C0T B;  3MEC A;  1Z2L A;  2ZVS A;  3GFH A;  3VQT A;  2NRE A;  4B3O B;  2FC8 A;  1SL1 A;  1URR A;  3HZG A;  3T5H A;  3HF5 A;  3CCQ S;  2MHN A;  3V81 B;  1BD6 A;  2DYA A;  4PWD A;  3MM6 B;  3QT8 A;  3UFC X;  3VV2 B;  3MF5 A;  3E3X A;  4W90 B;  5B0C A;  4NLP A;  3NMR A;  1AFJ A;  1WNE A;  2B5J B;  4F4A A;  5I3U A;  4CP5 A;  1LWE B;  1TUG B;  3BBC A;  4WCE Q;  2JDJ A;  4IQX A;  2ZH9 A;  2R2U A;  1HBU A;  1F2H A;  3CJ4 A;  1LK5 A;  1IKY B;  1RAD B;  1FX2 A;  4OZL A;  4F4W A;  3EXC X;  2RAQ A;  3Q8S B;  2ZH1 A;  2JL9 A;  4ED2 A;  1HR0 F;  3RZA A;  9RUB A;  3OJS A;  3AA9 A;  2W2P P;  5GAH I;  4OYW A;  3EDR B;  1OWX A;  1R31 A;  4DSF A;  4WP3 A;  4KT0 C;  4EO8 A;  4WIQ A;  2HHV A;  2HHH J;  3LGH A;  1EB0 A;  5M2U A;  3K5M A;  2FVC A;  4JV5 J;  1ZAX A;  5FLX Y;  3TX0 A;  4UTG A;  2CXE A;  2PMZ D;  1S6P B;  2HMI B;  2KFZ A;  1XQI A;  4KAI A;  2HLU A;  4OI4 A;  4MMO A;  4AND A;  1PC4 A;  2HND B;  1FRH A;  3T5L A;  2C3U A;  2LLZ A;  3ENV A;  5KFV A;  1FDN A;  2XI3 A;  2DHS A;  1SC1 B;  3ISN C;  4U8V A;  4DCJ B;  3LP0 B;  5K8M A;  1FXR A;  1XNQ F;  4K5S A;  2W9B B;  1NKC A;  3BH6 B;  1RCX B;  3NCQ A;  5GAG I;  4J9N A;  3PW5 A;  4WXO A;  1B3T A;  4WFY A;  5D4L A;  2YY3 A;  1R8A A;  1VQO S;  1LW0 B;  1NJY A;  4LF8 J;  3IM8 A;  1U2C A;  1Z1Z A;  2ZBC A;  4OX9 J;  2V8H A;  1HFE L;  2XC9 A;  2M3D A;  2X3G A;  4J9V A;  2VC0 A;  3ENW A;  2LQ9 A;  1VQM S;  2B4U A;  1IWA A;  2C3Y A;  1XMB A;  4K4X A;  4LJM A;  4ZPV R;  4UZB A;  1UZH A;  1RAI B;  2IJF A;  4RW8 B;  4KKO B;  5DDQ C;  3J80 U;  3DGP A;  4HAC A;  5GAD U;  4Q8E A;  4X64 J;  2FZC B;  5GME A;  2BKP A;  2MGZ B;  3RTV A;  1JXE A;  2W9C A;  3MPV A;  3KNA A;  1BGX T;  1PYT A;  4Y2C A;  2B56 A;  1KEK A;  2BAC A;  3PYD A;  3OUY A;  2V4R A;  1C0U A;  3P49 B;  4QWC A;  2BM1 A;  1QAJ A;  1ZZF A;  3PNI A;  1Q79 A;  4W98 A;  1H6K X;  5F0W A;  4OZ3 A;  3MAQ A;  2O3D A;  2HFN A;  3J81 U;  2H3E B;  1KBR A;  4ZPB A;  2KG0 A;  1KTV A;  3M2R A;  5LT5 A;  4K0K J;  4F2S A;  2XMJ A;  1IR0 A;  2GV1 A;  2XMV A;  1S9E B;  2XZD B;  2YQ3 A;  3HCX A;  1HWU A;  3PO5 A;  2FJB B;  3Q22 A;  1WOS A;  2CQP A;  1VQ6 S;  2XMA A;  2OUG A;  2KN4 A;  4ALZ A;  3G2X A;  3ILO A;  3TVK A;  4Q43 A;  1NK7 A;  2HHX A;  1K1S A;  3CD7 A;  4MTP A;  4FP9 A;  1SIZ A;  2Z2Y B;  1NHU A;  4B3R J;  4KGZ B;  4RBU A;  3C6T B;  5DM6 Q;  4ELT A;  5J1P A;  2FLP A;  1FDD A;  4NEZ A;  4FXD A;  1HI1 A;  3UDE A;  2HQD A;  4BLG A;  1FWP A;  4HLB A;  1C2P A;  3VVT A;  2EC2 A;  4DQI A;  2PI4 A;  2JX2 A;  3OR2 B;  2HWH A;  4MFB A;  4OYX A;  2J6T A;  5HLF A;  3D0H E;  3FSI A;  4FVM A;  4Z7C A;  4Y28 C;  2JEI A;  2I5J A;  3HFV A;  3IS9 B;  2YVS A;  1TL3 A;  2XMU A;  3G87 A;  4P10 A;  4RWX A;  3TJA A;  5CD4 A;  4KE5 A;  4ZVU B;  2OJ3 A;  5E5N A;  1TKT A;  2GO9 A;  4YR3 A;  4TU8 A;  4DN0 A;  1VC0 A;  3DGP B;  4HHH A;  5I3Q A;  2R2R A;  5F3Z A;  3VAG A;  2GIF A;  2R42 A;  4LR9 A;  2JEF A;  4LF5 J;  4CM2 A;  5IV4 A;  5HI7 A;  2GVD B;  1VQK S;  3A8K A;  1T9U A;  3M8Q B;  1S0M A;  1PO6 A;  4WXW A;  1YSJ A;  5KFC A;  4PPD A;  5L9N A;  3G6Y A;  3J81 Y;  2RIJ A;  2HAI A;  5B7W A;  2KM8 C;  1X31 C;  1R89 A;  4LSN A;  4Z37 A;  4XK8 C;  2MKJ A;  3MMB A;  2XGP A;  1J5E J;  2ZZN A;  3M8R A;  2JSX A;  2CWX A;  3VGS A;  3DM2 B;  2MJU A;  2DNQ A;  2JZ5 A;  3Q8R B;  3T1H J;  3OTB A;  5D6G A;  2R7W A;  1HA1 A;  2NSC A;  2B9Y A;  1VRU B;  2PO4 A;  5I4M A;  2KU7 A;  3SSS A;  3IP0 A;  4IYQ A;  1RT5 A;  3MPY A;  4F36 A;  3D66 A;  1FKP A;  5KFH A;  2AGP A;  2B4V A;  2JLF A;  2QMW A;  5IQQ A;  2LXI A;  2HWI A;  2QTW A;  3IRW P;  4C8O A;  3LPE A;  3RR8 A;  4Y0F A;  1QJH A;  1TKT B;  1RWV B;  3VF0 B;  3TX8 A;  2AIR B;  3PX6 A;  2NQP A;  1MW7 A;  2E1A A;  2A18 A;  2ZUG A;  4DZD A;  2RU3 A;  3PFO A;  4OX8 A;  1WC6 A;  3Q0A A;  4J9Q A;  4AL7 A;  1RU2 A;  2G2Y A;  3VAK A;  4C97 A;  1B99 A;  5DG7 A;  2F9D A;  1QTM A;  2K8G A;  2LDY A;  2OMO A;  3UCZ P;  2BM0 A;  3ZZY A;  3CIZ A;  2V4J A;  3UVJ B;  1TUW A;  3GJS B;  3HPO A;  3NCR A;  2VD3 A;  4F3Q A;  3FMB A;  2J7W A;  2AJF E;  4DN9 A;  1XK8 A;  1SJ3 P;  3LWL A;  4FBU A;  4USJ C;  2O1P A;  1RB0 A;  1TV6 A;  2RDI A;  3D3B J;  3IRX B;  3UR0 A;  2L08 A;  3P45 B;  4DUT A;  2CG4 A;  2FJV A;  1BWV A;  2E5H A;  3W5Z A;  1HWK A;  2HFZ A;  1U1P A;  2JWN A;  4AT1 B;  5IXU A;  1FWK A;  5H9E J;  3LUY A;  4B9S A;  5CYQ B;  2E9T A;  1U0H A;  3MEK A;  4ED6 A;  3DRR B;  4K8R A;  1ZA1 B;  3LP1 A;  2W01 A;  1ZM4 A;  4ZPT R;  1TKX A;  1HQU B;  1E6V A;  4TQS A;  2AJQ A;  3UQS A;  2CWK A;  2MZT A;  1FI4 A;  4RW7 A;  4X4S A;  1FFW B;  2JFD A;  3LO3 A;  4O23 A;  3J7Z T;  1WG4 A;  2LKZ A;  1U6B A;  1N6Q B;  1U2F A;  5KFR A;  1HYS B;  3UN5 A;  5IT4 A;  2FJX A;  2O66 A;  2XS5 A;  1KVK A;  5D3G B;  2RB7 A;  1WTF A;  2CZV C;  1MWY A;  1SKU B;  4KB7 A;  3W60 A;  5J2M A;  4WKR A;  4KH1 B;  1U1N A;  3HFK A;  3ZTO A;  1J27 A;  4C8K A;  4JI4 F;  2QLB B;  3OHB A;  4PG7 A;  4DV7 F;  3TAM B;  2PA8 D;  1WSV A;  4LF6 J;  4JI6 J;  4HDH A;  5DM7 Q;  4U95 A;  3KLG A;  1HNZ F;  2P5V A;  4MFB B;  3LAL A;  4LRB A;  1CVJ A;  4WFA Q;  1M5S A;  2Y0B B;  4UST A;  2HHT A;  3HDS A;  4B9V A;  1WD6 A;  2JOQ A;  4TYB A;  3GCX P;  1N34 J;  4ZVQ B;  4K4V A;  3GTY X;  5ADZ A;  3BGU A;  4DV6 J;  2HGN A;  3VGT A;  4IRC A;  4OZ1 A;  3O8W A;  3SCI E;  2ZZM A;  1H73 A;  2AZ1 A;  1TK5 A;  3Q8U A;  1OYE A;  3GCW P;  3MMA A;  3D4J A;  3HD2 A;  3JSR A;  1TKX B;  3N5B A;  4FVC A;  3S01 A;  5KFB A;  5KT4 A;  3MUT P;  2R7T A;  1WOO A;  4QPX A;  3K57 A;  2CQC A;  3S8S A;  2N3O A;  7AT1 B;  2BBE A;  4RL1 A;  1F3V A;  5DGB A;  1SJ4 P;  2ZH8 A;  2E9R X;  2XQC A;  1HHQ A;  2ZBR A;  2ZOG A;  4XIU A;  2HBR B;  3OFF A;  1TVR A;  3P4U B;  2CQI A;  3CPW R;  5CYM A;  2IPO B;  2BE2 B;  3MZI A;  2BXJ A;  1HD0 A;  3T6B A;  4PAB A;  5C25 B;  3VAI A;  1T03 A;  1SH0 A;  2J5A A;  5LXR A;  5LMU F;  3HJF A;  2DNM A;  2OD4 A;  2Z57 B;  5HJY A;  3UPF A;  4ZHR B;  5KFQ A;  5KFJ A;  3C14 B;  1JMT A;  2V0N A;  2AYB A;  2HHH F;  5BJR A;  3PDN A;  4DS4 A;  3G9C A;  2LU2 A;  1TK8 A;  4JYA J;  3FFI B;  3GIR A;  2DXE A;  2F1F A;  1WC4 A;  1A7G E;  1ZPW X;  3R27 A;  4OZ2 A;  2F3J A;  2QO3 A;  1T9X A;  2V67 A;  2HND A;  2JLE A;  1FA0 A;  4RW9 A;  4Z2X A;  4I4B A;  3GQC A;  2OEJ A;  4EBD A;  3JAM Y;  4IDK B;  1HAR A;  2QA4 S;  1IBK F;  3EGZ A;  1RXO B;  3FBF A;  1OPI A;  4GC7 A;  3FJ2 A;  4YY3 J;  2DNP A;  5CA5 A;  2BAN B;  4J5O A;  1UKU A;  4K4T A;  3PX0 A;  1R6V A;  4WFN Q;  1FKP B;  2GHV C;  2VU5 A;  3MM6 A;  2P6S A;  3EGN A;  1JLE A;  4I67 A;  3MMJ A;  4H4M B;  1V6H A;  3NG8 A;  1HKA A;  4PWW A;  3S1T A;  1DLO A;  4RZR A;  4H4O B;  4PWU A;  4E2F B;  2KXN B;  1VMB A;  3HVW A;  1FJG F;  3IBC B;  3BQ2 A;  2FVS A;  4AQY J;  4BC7 A;  1KHV A;  4DWI A;  5BYQ A;  1RCO B;  5DS7 A;  4XO0 A;  3IN5 A;  2PEB A;  3I82 A;  4DR1 J;  2Y8Y A;  1FJC A;  4M5M A;  1RBA A;  1S6U A;  2QMX A;  4JI4 J;  3NOC A;  5A6P A;  1OY9 A;  1RKJ A;  4F2R A;  3IWN C;  4C9D A;  2LA6 A;  2WSC C;  4GRS A;  1HIY A;  2EPI A;  1Z4U A;  2YNG A;  4KH0 B;  1YJR A;  3HLU A;  1DTT B;  5IM0 A;  4ATN A;  2CPI A;  2DCL A;  3HVR A;  1CJT B;  4FPR A;  4LRF A;  4NE9 C;  3OXL A;  3SFU A;  2ZH3 A;  3OLB A;  2KVI A;  4GVB B;  1DAX A;  2ZM6 F;  1LFP A;  5CZX A;  3MD3 A;  5J1N A;  4KJI A;  4URG A;  1SV5 A;  2HAF A;  1IBM J;  4LMZ A;  3C16 A;  5KFO A;  4OL8 A;  4YR0 A;  5D15 A;  2RS8 A;  3CW2 C;  2QLJ B;  3MCS A;  3NRB A;  5CQG A;  4FDF A;  5D0E A;  3WIV A;  4OHZ A;  5ETP A;  2IVM A;  4NPO A;  5JXS A;  3FK4 A;  3P5T L;  5F3T A;  5FII A;  3RU0 A;  3MEG A;  3WQP A;  1U1K A;  1QUV A;  4D3G A;  5H9E K;  1N33 F;  4GO5 X;  5AT1 B;  4JI6 F;  2W8K A;  2PII A;  2YWE A;  1QE1 B;  3QZ8 A;  3MUM P;  1D9D A;  4C8Z A;  1C0U B;  1U8W A;  3HT0 A;  2DCU B;  2ZWP A;  2UXD J;  4WYL A;  3RRK A;  1WKL A;  1T9V A;  2MQN A;  3AOB A;  1PBA A;  2LU1 A;  2YNH B;  1N52 B;  4NRU A;  4HR2 A;  4U7U D;  2A10 A;  2MQM A;  1KQK A;  1GMW D;  1YK9 A;  4NA2 A;  4E8U A;  1MU2 A;  3RB6 A;  4HTJ A;  1UPP A;  2GQQ A;  2Q66 A;  5KFF A;  3EUN A;  5CCL A;  3L3C A;  3BSA A;  4UOH A;  2AGQ A;  1CUL A;  2ZH7 A;  2ATC B;  3LTO A;  2QIF A;  3DOK A;  2YQ1 A;  4I56 A;  4I6W A;  4N47 A;  3M8Y A;  4R5P A;  3OTO J;  1XR6 A;  4F3O A;  2RUG A;  4A8O A;  1BY9 A;  2WVE A;  2ZE2 B;  2V63 A;  4K59 A;  2AT1 B;  1F60 B;  4MJK A;  1X9M A;  2YBV A;  1VIS A;  3C6U B;  4ZJO A;  3PEH A;  3CNQ P;  1URN A;  1SQF A;  4IFV A;  4KPC A;  1R0B G;  4NML A;  4TLR A;  2WOM B;  4EK2 A;  4ZCM A;  4R5P B;  1ITP A;  3UCG A;  2BA9 A;  1VBX A;  2YKM B;  1IM6 A;  1CPZ A;  3HHD A;  1GQE A;  3MR3 A;  4C0H A;  4EU0 A;  3BO2 A;  3NNA A;  1FD2 A;  4GKJ J;  2R7O A;  3B82 A;  2LA4 A;  1AW0 A;  1S6Q B;  1NK0 A;  2UZA A;  3G6V A;  2XNQ A;  5DDR C;  3MMC A;  1XWL A;  2ZBQ A;  2IC3 A;  3VHQ A;  1Y3J A;  3LA0 A;  4NXM F;  3QAT A;  4HI2 A;  3M8P B;  4PXB A;  2MPU A;  1U47 A;  1YKW A;  3PRB A;  3ZZ0 A;  4PQA A;  4FYD A;  1V3S A;  3MCM A;  2E7W A;  3A12 A;  4X4U A;  2F9J A;  4MIA A;  2XMT A;  3K89 A;  3HHE A;  3CT9 A;  4MIB A;  4ECV A;  1SL0 A;  1UVK A;  4A8F A;  2V9K A;  3DOK B;  4OYP A;  1DFD A;  5HBM A;  3TO8 A;  1EX8 A;  2HK2 A;  4ID5 A;  1MWQ A;  2I2Y A;  4QPT A;  2ZC4 A;  3NS7 B;  3ZXW A;  7FDR A;  4C4W A;  3UI3 A;  1K47 A;  4RBV A;  4EZ9 A;  4QWE A;  4NCA A;  2M70 A;  2VV5 A;  3H5X A;  3KLH A;  4ZVH A;  4KFB B;  1SV5 B;  4IFY A;  3SSR A;  2JVR A;  2LEB A;  1HD1 A;  1Q53 A;  3KUH A;  3IAM 9;  3X1L B;  5KT5 A;  1EQ0 A;  2JEG A;  4LF4 J;  1KS2 A;  4A8M P;  2C3P A;  3JQK A;  2E66 A;  2LP4 A;  1JLG A;  4LIW A;  2G9O A;  4NX9 A;  2FHM A;  2CDQ A;  2P9G A;  3JS9 A;  3I0S A;  4KSE B;  1APS A;  3OJU A;  3QT6 A;  2PFF B;  2BQ3 A;  1X4H A;  4F26 A;  4F50 A;  3O1L A;  2A2D A;  4L6V 3;  2BAB A;  5KG2 A;  2G13 A;  2X51 A;  3L95 X;  3SFG A;  2YH1 A;  1T05 B;  2CNL B;  3RBE A;  2NCK L;  2VFU A;  4AXJ A;  1HQU A;  3Q8Q B;  3BSN A;  3M6X A;  3MEG B;  2B5J A;  3DRR A;  3I87 A;  3RBZ A;  5AJ3 J;  2W25 A;  4TY9 A;  3KG1 A;  3PVX A;  2UUC F;  1WC1 A;  1GXU A;  3RAQ A;  2KKH A;  1YX2 A;  1W2B R;  2XWX A;  2YNH A;  2V8P A;  2HVH A;  3EZO A;  2GW8 A;  1HPZ B;  5J2Q B;  1S77 D;  5IFM A;  4DL0 C;  3U7J A;  5CCM A;  1TV6 B;  3IRX A;  4NLD A;  5KFT A;  3I55 S;  1RYR A;  1CC8 A;  2NPF A;  2FLN A;  4ECR A;  1FRL A;  1S5Z A;  1CG2 A;  3ILL A;  3HD1 A;  1VI7 A;  2ZJR Q;  4XTT A;  3PRV A;  4WII A;  3RW6 A;  2RF2 B;  4QQB A;  1GNK A;  2V34 A;  1UPM B;  1DQA A;  3E51 A;  3GE9 A;  1N0U A;  4ZLN A;  1P8G A;  5BR8 F;  4YB7 A;  2W7P A;  3E2E A;  2UVU A;  3EM1 A;  4C6A A;  4JV5 F;  3I0S B;  3UWT A;  1F5B A;  3DFE A;  3V6D A;  1NB2 A;  3I5B A;  1VRQ C;  2EBE A;  2ASJ A;  2HYI B;  1PJ7 A;  2YKN A;  1RWN B;  3UN2 A;  1S1W B;  2BJ9 A;  1RWK B;  4ZHR A;  3KHR A;  4HYK A;  1BXN A;  2CJK A;  4B9M A;  2CAD A;  2ZIT A;  3CMQ A;  3PR4 A;  3SQO P;  4DL3 A;  2LCW A;  1UEU A;  1D9F A;  3MD1 A;  1AT1 B;  3CDU A;  4PR6 A;  4UT4 A;  3BF4 A;  4RNH A;  1FTR A;  1L3V A;  3WC2 A;  4DUY J;  2RU9 A;  1UA0 A;  4OX9 F;  1ZBT A;  2FY8 A;  4NLO A;  2N7C A;  4YP3 A;  3G86 A;  5KOW A;  2J6S A;  2AYG A;  2HNZ B;  3T3F A;  3JQM A;  4PXD A;  4BS2 A;  4O3P A;  3IAS 9;  2ZBP A;  4H54 A;  1S6O A;  4WFX A;  3BJY A;  4DUZ J;  2AJ0 A;  1NSA A;  1HNX F;  4OYM A;  3TZY A;  4TY8 B;  1VRT A;  5LSO A;  3RB3 A;  1X4C A;  2AEF A;  4CH7 A;  2R7V A;  2DHX A;  2V50 A;  4U6P A;  5KFE A;  2WZ1 A;  2DH8 A;  1C4A A;  1UW4 A;  1S49 A;  3HKZ D;  3MAA B;  5D4P A;  3BZQ A;  4YN3 B;  4NWB A;  3C14 A;  1B7Y B;  4OZJ A;  2E1M C;  3UDC A;  2A2C A;  4JYA F;  2R8J A;  3NP5 A;  4IFY B;  2R9L A;  1TAQ A;  5CD4 H;  2VG7 B;  3JSB A;  1AA1 B;  4OZ5 A;  3BKT A;  3RBD A;  3T1A A;  1GTE A;  1TP7 A;  2UUA F;  3R5B A;  3HT3 A;  4LQ9 A;  3P3D A;  4Y34 A;  2H54 B;  3TAM A;  4NXN F;  4YEA A;  1SL2 A;  4LT6 A;  5IC4 B;  4IOC Q;  3PV8 A;  1UJ6 A;  4C3L A;  2IM0 A;  3EDQ B;  5C24 B;  1HYS A;  2BJD A;  3RJM B;  1WHY A;  4JI1 F;  2VBX A;  2W9A A;  4IG3 A;  4ZS6 A;  2G1D A;  2ZWO A;  1EAY C;  3FRZ A;  1JQG A;  2B7C B;  4CYU B;  4ZLL A;  4IRD A;  2VZ9 A;  4HKQ A;  4CI0 B;  3M05 A;  2N4C A;  1JLB B;  2EFO A;  4C8N A;  4PUO A;  2KDO A;  2K1R B;  3PTW A;  4QYR A;  5HQM A;  3TYT A;  1U48 A;  3SQG A;  5LJ3 Y;  1AFI A;  4F0M A;  1RHQ B;  1IR2 A;  3FNN A;  2VFV A;  2LDI A;  2HBZ B;  4MKV A;  4OI2 A;  3SSQ A;  5IT0 A;  5J2P A;  3P8B B;  3KHL A;  3MTK A;  2KZM A;  2V2V A;  5J1E A;  1FX4 A;  3H20 A;  2MZS A;  3M8W A;  2AYM A;  3ZTS A;  3O44 A;  4NZ7 A;  4RNM A;  3Q2S C;  4ZPC A;  3W7B A;  1U1R A;  1PJ5 A;  1NK4 A;  2B4P A;  2RIL A;  3EIC A;  5IV3 A;  2HFV A;  2EG1 A;  2RDD A;  2XI2 A;  1LK7 A;  4PCQ A;  5F8L A;  2MEW A;  2YTC A;  2GX8 A;  3PCO B;  3LAM A;  1P27 B;  1S1T B;  2LEA A;  2D7S A;  3OXF A;  1Q95 G;  1NSQ A;  2W8L A;  3OD2 A;  2R7Q A;  3Q8Y A;  2COL A;  3LOU A;  3FMW A;  4G1P A;  4ITS A;  1S1X A;  1IUJ A;  2A0F B;  2RQK A;  1REV A;  2XSF A;  3NBP B;  3WHI A;  4RW6 A;  3SV4 A;  3KLV A;  5F8G A;  1LXJ A;  4IR9 A;  4DX7 A;  2R7U A;  1WEY A;  3CSK A;  4GVL A;  1X4G A;  1N88 A;  1WDD A;  5BYS A;  3G4S S;  5THW A;  4F25 A;  3KLG B;  2XS7 A;  4L75 A;  4OV6 A;  4OZN A;  1WOP A;  4P7T A;  3I9V 9;  3ITH B;  1Q8B A;  5JJB A;  3M1V A;  3QGI A;  5CH7 B;  2RDJ A;  2HHU A;  2QC3 A;  3SDE A;  2XSJ B;  2DGV A;  2NXJ A;  3E01 B;  4ZJL A;  2DO4 A;  1NH8 A;  2CPE A;  4AE5 A;  8RUC A;  2CQH A;  1CJT A;  2PGC A;  4FYW B;  3W64 A;  1AUS L;  2BW7 A;  4KHM A;  1L3U A;  3CJR A;  2XY7 A;  4DR7 J;  3EGV A;  2I9S A;  3MCO A;  2EWH A;  1S4E A;  4ZVR B;  2UXC F;  5LM7 E;  1OQ3 A;  1Y0H A;  3N9U C;  3QO9 A;  4I6A A;  4C3K A;  1S1U A;  1REG X;  2DEJ A;  2BW2 A;  3D5M A;  3GJR B;  2KZZ A;  4C0B A;  3NGT A;  3H4D A;  3AA8 A;  3CDB A;  4B3O A;  5M2R A;  4FF3 A;  1SJ1 A;  3IG1 A;  4M5L A;  4CDI A;  2WHO A;  2ZDP A;  3QT5 A;  3PY8 A;  3ZZT A;  1Q7L B;  2KJV A;  3GII A;  2DNK A;  4IH7 A;  3QRP A;  4K4Z A;  1S48 A;  3H40 A;  1V9O A;  3KDO A;  2Z4P A;  4DPU A;  2RD5 C;  1TL5 A;  4L3N A;  1F2G A;  1KR4 A;  2MY7 A;  3PG9 A;  1LWC A;  2YKO A;  4KYZ A;  4O3O A;  2VAS A;  3ET6 A;  3W2W A;  6FDR A;  5ETK A;  5IWA F;  2MJN A;  1NXI A;  2VB6 A;  2C2Z B;  4JI0 J;  2Z2Z A;  2M0G B;  2F4V J;  1PAE X;  4DX6 A;  3CCM S;  2G2Z A;  5KG3 A;  3GYN A;  5IZH A;  2GCF A;  2MZJ A;  4WU3 A;  5IS2 A;  4K4S A;  3GV7 B;  4DR2 F;  4B02 A;  1B0P A;  3A3P B;  3GIK A;  4J90 A;  4M5J A;  2GMJ A;  4OYB A;  4ZKA A;  1IKV A;  3TUJ C;  3JSM B;  2DNY A;  4PZV A;  4P7V A;  4CTA B;  4O44 A;  2AEM A;  2F63 A;  2OEK A;  2FJE B;  3NOG A;  3KLF B;  4EUV A;  1RBO B;  2XWY A;  4ED8 A;  4QJV A;  2A6M A;  2OHD A;  1RAF B;  1VLO A;  2YNI A;  2E7V A;  3AH6 A;  2VPW B;  4DPW A;  1JLE B;  3OL7 A;  1H0H B;  2CPX A;  2YX4 A;  4P52 A;  2CJ9 A;  3D6M B;  1VJQ A;  2RT3 A;  3QLH B;  5LMU J;  4DR3 J;  4QYZ K;  2VOP A;  2VPY B;  4JI3 J;  6AT1 B;  4C2M A;  1KFD A;  2BV3 A;  4IH6 A;  1NZA A;  1CJK B;  2DXD A;  2J9D E;  2M88 A;  4LFA J;  4CO3 A;  3J7A N;  2R8I A;  1VRU A;  2KT5 A;  3MPU B;  5FD1 A;  1LKZ A;  1NDL A;  3DDI A;  1P1T A;  4CLF A;  4EEY A;  1WF1 A;  2MLX A;  5DRK A;  2DGS A;  5HLF B;  1KOH A;  1Q5Y A;  3N28 A;  2W2M P;  2CJB A;  2BRK A;  4YOE A;  1QSL A;  3B8H A;  1CSJ A;  2AJ2 A;  3HP6 A;  3M2U B;  4K2X A;  3T9N A;  2WSF C;  2WSE C;  1FNO A;  2C3M A;  2ZE2 A;  3I31 A;  2LMI A;  3GWC A;  5J2N B;  1F9H A;  4P74 A;  3KK2 B;  1VGY A;  3GIL A;  2QLX A;  5ETM A;  4NA3 A;  2M8H A;  3G82 B;  2GC8 A;  4M5N A;  3TA2 A;  3CC2 S;  2Q1L A;  2DD8 S;  1GK8 A;  1AXQ A;  2BQR A;  3I4H X;  3GB0 A;  2YNF B;  2JH3 A;  4ZPD A;  2DHH A;  2XTJ P;  3TUP A;  4B9U A;  2KM8 B;  4JB8 B;  3U27 A;  1NK5 A;  3V6J A;  1WTB A;  2Y8W A;  3CCT A;  1JKH B;  1HMV A;  4B3M J;  1YDL A;  2FLO A;  3IM9 A;  3KK1 B;  5J1E B;  1RTH B;  4OI3 A;  5G0R A;  5KOX A;  1HI0 P;  3MR6 A;  1C0T A;  3MEC B;  3NXZ A;  1X4F A;  2ZKU A;  1IN0 A;  2P6T A;  3KXD A;  5A0Y A;  2J8A A;  5J2M B;  1U26 A;  3JYT A;  2QV6 A;  2C28 A;  1EAR A;  2UU9 J;  1P9Y A;  1KN6 A;  3DMJ B;  3RRG A;  5HVF A;  9ATC B;  2ZOF A;  3BBF A;  3KK3 A;  2VJV A;  1JLB A;  3QID A;  3CGI A;  2KT2 A;  4PXC A;  3OHA A;  2U2F A;  1I3O B;  3TQE A;  4LFC F;  5ETV A;  3DN9 A;  4QIE A;  1M5K C;  1NPK A;  3LP1 B;  3PJ9 A;  3VWS A;  4F0K A;  3K8W A;  4X62 J;  5C42 B;  1QLN A;  2IDL A;  4O0I A;  2GJF A;  2JEJ A;  4TLQ A;  2H48 B;  4DV4 J;  1ELO A;  1ZZN A;  2D3Z A;  3CJK A;  4AL5 A;  1FKA F;  3LP2 B;  3RYL A;  3A4T A;  2MGZ A;  2PE8 A;  3BSO A;  4EBE A;  1AZS B;  1XTZ A;  5L1I A;  5K8P A;  1DHM A;  3H90 A;  4LVO P;  2EG2 A;  5B09 A;  5A2Q Y;  4DFM A;  2WVF A;  3C19 A;  2MKS A;  2VG5 A;  1H98 A;  3TA0 A;  5DQG A;  1HW8 A;  3K5L A;  4ED3 A;  3T5J A;  2F40 A;  1N5S A;  2H5J B;  4JI8 F;  4LF2 A;  3MAA A;  4CLY A;  4DI6 A;  1Q82 T;  4X66 J;  3GYG A;  1HNI B;  1NAQ A;  4YB1 P;  3W2V B;  2ZEJ A;  4JV2 A;  1R3N A;  1YQH A;  4B3S J;  4PUO B;  3M6U A;  4N56 A;  4ZA1 A;  2ZH6 A;  3H0P A;  1Y00 A;  3TAP A;  3BQ1 A;  4O44 B;  2KFY A;  4LQ3 A;  2FD2 A;  2GAG C;  2CVE A;  2QG9 B;  4WF9 Q;  3LP0 A;  1LFW A;  1RA6 A;  2AJ1 A;  4ERD A;  1X5T A;  2XHW A;  2Z8Q A;  1UFK A;  2MTL A;  4F4Y A;  4DR1 F;  5DG8 A;  2J76 E;  2IHR 1;  1RAH B;  4FNH A;  3W9I A;  2IA6 A;  2N3L A;  3A13 A;  2R2S A;  2N82 B;  2YKP A;  1S72 S;  3THT A;  3L7U A;  3EZU A;  4EMD A;  3R5J B;  5J2N A;  4OIX A;  3GJT B;  5CAB A;  1V5V A;  2NR0 A;  3H5U A;  3CE8 A;  1WEL A;  2Q3P A;  3IG1 B;  2C22 A;  4PRF A;  5LJ5 Y;  1FNM A;  4NCG A;  3S6E A;  2XCA A;  1VBY A;  1UEK A;  1N56 A;  2AF6 A;  4ANC A;  4AYB D;  4ED5 A;  3GV8 B;  2RHQ B;  2UXC J;  3J7A 1;  1PIE A;  2PDA A;  4Q0B A;  1X0P A;  1PJ6 A;  1Q5V A;  4CT9 A;  1RA7 A;  2CQ0 A;  2ACY A;  2GJI A;  3PHT A;  5KFS A;  4A8Y A;  1IBK J;  3I0R A;  1KON A;  1LWC B;  4USU A;  3VR1 A;  1Q78 A;  4ED0 A;  4ES2 A;  4NZ6 A;  3FEX B;  4PKD B;  5C5J A;  4NXM J;  2UU9 F;  3ZZU A;  3D1H A;  2BKN A;  2Z58 B;  4LSZ B;  3DOL B;  1U8S A;  2BKO A;  4CQ1 A;  1CJV B;  2FC9 A;  1HBO A;  1CLF A;  2EFN A;  2DR7 A;  2RQM A;  3NGU A;  2YWH A;  3FEZ A;  1KQG B;  5SZT A;  1IKV B;  3H59 A;  4X62 F;  1IJF B;  4FKX A;  3MMA B;  4NLV A;  4C98 A;  1RHJ B;  2YX1 A;  4Y2M A;  1BQN B;  2KH9 A;  3TZZ A;  4R0E A;  2M5Y A;  3UR3 C;  1M5V C;  2FJW A;  2MLY A;  2VHG A;  1T8E A;  1B0V A;  5HSP A;  2J0Q D;  4K2J A;  2DRA A;  3D54 A;  1RAO A;  4X65 J;  2Y0S D;  1VHI A;  4MK9 A;  3FCH A;  4JI2 J;  8AT1 B;  1X9S A;  3CUL A;  2OI2 A;  4N8O A;  2OPS A;  2EK6 A;  1S9G B;  4WZM A;  1SJF A;  4USH A;  3B6B A;  2ZHB A;  3WX4 A;  1XMQ F;  1QUP A;  1NBE B;  2HRU A;  2XMK A;  5EWG A;  4M8L A;  5KG0 A;  3M9M B;  1N32 J;  2E9Z A;  1X60 A;  2CG8 A;  4C48 A;  4YUD A;  2MKH A;  4M1K A;  1EP4 A;  2UVW A;  1Y5I B;  4QR1 A;  4A46 A;  2HZC A;  1FD8 A;  2DT9 A;  3CDA A;  4J9U E;  5LSR A;  2IRU A;  5DGA A;  1L3T A;  4K4U A;  2V69 A;  1QAX A;  1S1T A;  1C1B A;  4N8N A;  4DV2 J;  2FVR A;  4YME A;  3OR1 A;  2XHC A;  4TVA B;  4QYZ J;  3N6N A;  4J9R A;  1KVJ A;  5AXK A;  3EE3 A;  2ZC3 A;  5C24 A;  4X4P A;  4P2X A;  3AY0 A;  2Y1I A;  2FVP A;  3AOD A;  2WW8 A;  3ZTR A;  1UZD A;  1SJR A;  1ZA2 B;  1UWB A;  2JC0 A;  3PFE A;  3POT A;  4K4W A;  3MM7 A;  4NYO A;  1U4B A;  2DGQ A;  3LPY A;  5EGY A;  2DRB A;  4F02 A;  2UXD F;  3LH2 S;  5DLF A;  2DEI A;  4BWJ A;  4OX6 A;  4J9P A;  3DYA B;  3N6L A;  1UVI A;  1RAB B;  4DHV A;  2BJE A;  1SC3 B;  4I2Q B;  1RGV A;  3R9L A;  2K2P A;  3RW7 A;  3I9Z A;  2A1B A;  2D9P A;  2K3K A;  2WBR A;  2Y3Y A;  3T5K A;  2MB0 B;  3DHW C;  2D74 B;  2E5J A;  4DV5 F;  4E0D A;  2D1C A;  1CUL B;  2HZA A;  1I1G A;  4NOH A;  2KHD A;  2J8S A;  5DG9 A;  4RUC A;  4DV0 J;  4GKK F;  2HHQ A;  3PJX A;  2V4Q A;  4DR5 F;  1DBD A;  1TL7 A;  1S12 A;  1X4B A;  3LQV A;  3TUZ C;  3BQ0 A;  2AWZ A;  1R6Y A;  4ZN1 A;  1Q8K A;  3BS9 A;  4LFC J;  3W9J A;  3JQJ A;  2OD6 A;  2YH0 A;  4EWT A;  4ZJQ A;  3J81 j;  3IA0 A;  1KTQ A;  2YKM A;  1W26 A;  1IQT A;  2YNI B;  3DXB A;  4A4J A;  3DLE B;  3KG0 A;  1B0T A;  5B08 A;  4RO0 A;  3C2P A;  2KFN A;  2K3I A;  2RRN A;  1TU0 B;  5EHH A;  2CJQ A;  1VJW A;  2DGW A;  3QQC D;  3CUN A;  2IFX A;  2X1G A;  1SH2 A;  4L74 A;  3RAM A;  4DR6 F;  1WF0 A;  1XBW A;  3P5B P;  3MMB B;  4B08 A;  1JWW A;  3GR0 A;  3MED B;  2ABY A;  2Z30 B;  3JTO A;  3R5G A;  2NUU G;  2YKQ A;  4K7Q A;  4O4R A;  2E5I A;  2HUR A;  3MFI A;  2ZUA A;  2C2E A;  1HHT P;  4PG5 A;  1X5S A;  3PR5 B;  2NXU A;  1RUS A;  4O3S A;  2HMI A;  5AE2 A;  4YS2 A;  1VOM A;  2VG7 A;  4QZV B;  3VGV A;  1J5O A;  3RUB L;  1FE0 A;  1DJ0 A;  3QJP A;  4ED7 A;  3MM5 B;  2LVW A;  1O6X A;  2DR5 A;  3OTC A;  3G6X A;  3Q8P B;  1WF2 A;  1RT1 B;  3OFH A;  1XNR F;  3PKM A;  2ZHA A;  2XLK A;  5ETQ A;  2EKN A;  1I94 J;  4FYY B;  4HHJ A;  4NAS A;  1WEX A;  2VPZ B;  3PW0 A;  4HI1 A;  5GAG U;  4M94 A;  1HW9 A;  3DI6 A;  4B3M F;  2VC1 A;  4LRE A;  2VQF F;  4OYZ A;  3PW7 A;  2ASY A;  3OL6 A;  1K73 T;  2KI2 A;  3DLL Q;  4OI1 A;  3OVS A;  3PYF A;  4I64 A;  3VAF A;  2GGP A;  3ZNU A;  2R7S A;  3CVK A;  4DR4 J;  3QWP A;  2OFH X;  3FSX A;  1SKW A;  1FT8 A;  2R8K A;  5E2Q A;  1D9A A;  4I69 A;  2Y1R I;  1JXL A;  2OO4 A;  4A47 A;  1EZZ B;  2OPQ B;  3CJ3 A;  3ILI A;  3RBX A;  3QSY B;  1T3N A;  1B7F A;  5LMN J;  1GMW A;  1SCJ B;  2XSJ A;  3KJQ B;  3SIP B;  4CCH A;  1UL3 A;  3DXS X;  5KFI A;  1CS4 B;  2B7B B;  2DTJ A;  1HHS A;  2AX1 A;  2GVZ A;  4QBU A;  1IKX B;  3ADA C;  1SH3 A;  5F0U A;  4BHQ A;  3DLK A;  3H42 A;  5DLG A;  1U6F A;  3UD3 P;  2Y9H A;  4I2P A;  1GFW B;  4I7F B;  2CIM A;  5AJ3 F;  4RW9 B;  4U9R A;  5K14 B;  2AEJ A;  4K4Y A;  3RGI A;  3OT9 A;  4JI5 J;  4G3I A;  1BLU A;  1D3W A;  1YBA A;  2B43 A;  2QFI A;  2WBM A;  2DGX A;  5E3P A;  3RB4 A;  1RKI A;  1HNZ J;  4EZ6 A;  4OLP A;  4IO9 Q;  3KJN B;  1JLQ A;  4AXI A;  2CFX A;  1RAG B;  2ILY A;  4OJ3 A;  4OHW A;  4TN2 A;  3MR7 A;  4LF7 F;  2GML A;  4K50 A;  3M8P A;  2V94 A;  2XUL A;  4RNN A;  2M9K A;  2CPJ A;  4MH8 A;  4OHV A;  5AE1 A;  3D68 A;  3CCW A;  4MYT A;  3KLH B;  2VBZ A;  1GMV A;  5KAK A;  5AE3 A;  2RKI A;  1JNR B;  2FHO B;  4LRC A;  1FFG B;  3HHK A;  4NYZ A;  3LF0 A;  2OPP A;  1EKS A;  3DLJ A;  1EKR A;  3KJF B;  2PD1 A;  4PPZ A;  4WYW A;  5HBM B;  3TAN A;  4DFP A;  3W5Y A;  1VQ7 S;  4DR6 J;  3M6W A;  1RWW B;  2LYV A;  4OQJ A;  2MZR A;  3I56 S;  3AT1 B;  2DR6 A;  1Y7P A;  1OO0 B;  1LWX A;  2L9N A;  2OPR B;  3DHX A;  3GJQ B;  3ULH A;  4H4K A;  5GAD I;  1LW0 A;  4Q2M A;  4NZ0 A;  4A8Q A;  2HQF A;  1FVS A;  4ED1 A;  5KFL A;  3MM9 B;  3MWB A;  1RAA B;  4DF8 A;  3Q24 A;  1HNI A;  3CCZ A;  2BRL A;  5B0B A;  1SXL A;  2EFP A;  3AOA A;  4DPT A;  3D28 A;  4N41 A;  4IQM A;  3DRY A;  5L1K A;  1EHW A;  1YWX A;  3ZZO A;  3N5F A;  2HVI A;  5E3A A;  3EMT A;  3HK2 A;  3S7R A;  4N76 A;  1YRT A;  1RSC A;  3MOZ A;  1RJJ A;  4NLR A;  4FXV A;  5JVG Q;  2FZK B;  1EET B;  2FZG B;  4DOZ A;  3O6Q A;  2ROE A;  5KT6 A;  1VS3 A;  2HSE B;  3OR2 A;  1VQL S;  1U1Q A;  2HVE A;  3HMJ G;  2VBY A;  3QIP A;  4EFA C;  2NS1 B;  3OR1 B;  4DL4 A;  3AOC A;  3AJ1 A;  3AQP A;  4DR3 F;  3NWG A;  5EUH A;  4ENO A;  2CPD A;  2IA0 A;  1IXK A;  4NLY A;  3W2V A;  3I96 A;  3L7P A;  4XPC A;  3AQO A;  3L9Z A;  4KPY A;  4XDC A;  5I3U B;  2VQE F;  1W25 A;  3CED A;  3B4M A;  5B0A A;  1MU2 B;  1ZM9 A;  4WK3 A;  1HNX J;  3CTR A;  3MCN A;  3AB4 B;  1UWB B;  1NK6 A;  3FQK A;  1KKH A;  1H7X A;  1F3F A;  1RT3 A;  3CJ8 A;  1U45 A;  4PEO A;  1ZS6 A;  4DSE A;  1XNQ J;  1KLM B;  5D0H A;  1RT4 B;  2KL8 A;  5SUH A;  5HQL A;  1LW2 A;  1RBL A;  4P75 A;  1S9E A;  3FGV A;  2E29 A;  4ZCK A;  4LF8 F;  4ZVO B;  3MI7 X;  4AFF A;  4FS1 A;  1OQ6 A;  1OPZ A;  4YB5 A;  5HMX A;  2CPZ A;  2IVF B;  3OLA A;  1NSP A;  1TEL A;  2HRY A;  2GNK A;  2VUG A;  5GVQ A;  4RWW A;  4CLK A;  3C3L A;  5AXL A;  1HNV B;  3HVT B;  1SPB P;  4D3H A;  1CQN A;  2VFR A;  1B64 A;  1RWM B;  1TL1 A;  2HS3 A;  1GXT A;  2RH3 A;  1VIX A;  3KUG A;  1Y4Z B;  2DH9 A;  3OXG A;  3W1Y C;  1IBL F;  2ALY B;  3MPW A;  4I2P B;  4RUB A;  4JI1 J;  3BH7 B;  1RTJ A;  4C11 B;  1TKZ A;  3V6H A;  1A6L A;  2HHP A;  1YHQ S;  1S9F A;  2JRS A;  4DV2 F;  1MRO A;  4KHP F;  5IQ6 A;  4XDD A;  5HP1 B;  4H4O A;  4FNI A;  5IOL A;  2DNH A;  2PC6 A;  3MM5 A;  1MNE A;  4RUA A;  4HAC B;  4IG0 B;  4WTO B;  2GIQ A;  4DX5 A;  1RLC L;  4ECT A;  4G1Q B;  4CT8 A;  4NLU A;  4DSK A;  4LFB F;  2RNE A;  2UVR A;  3GG0 A;  2XYH B;  2ATL A;  2CQB A;  4LF7 J;  1NND A;  3QPI A;  1OY8 A;  2DIU A;  3KLF A;  1SUQ B;  3BYP A;  5F8M A;  4DL5 A;  3UVJ A;  2IBK A;  2QL7 B;  3Q89 A;  5H1S V;  4B3T F;  1HI8 A;  2FY1 A;  1LEO A;  2XLJ A;  2BJ1 A;  1AB8 A;  1VQN S;  3SXL A;  3D6F B;  1WI8 A;  2IC3 B;  2FHJ A;  1Q0N A;  2NXE A;  2RRB A;  4LF4 F;  1Q7Y T;  3C16 B;  1QM9 A;  1YJ7 A;  3G71 S;  2CPH A;  1WC0 A;  5HAT A;  2Z2M A;  2AKW B;  3GIM A;  4ZIV A;  2MKC A;  5KG7 A;  4DSL A;  2FJD B;  3TEH B;  2MHE A;  3L4B C;  3GSD A;  1FEH A;  1K8A T;  3C15 B;  3O3L A;  4X84 A;  4DPX A;  4JV1 A;  1D8Z A;  2PFD A;  2OAU A;  4KHR A;  3L7O A;  5F9N A;  2VL1 A;  4DR4 F;  3OQ2 A;  5MLC V;  3SZ2 A;  5KFX A;  2W4P A;  3DOM A;  4X4V A;  4KQZ A;  4UOG A;  1HL6 A;  4NI2 B;  4QOT A;  4CLT A;  2PI5 A;  1BHN A;  3VGU A;  2H4W B;  2HVD A;  1IKY A;  4QWB A;  4WKY A;  3A1Y G;  3D7S B;  1N36 J;  3A3O B;  3DKD A;  2B4O A;  5E0O A;  4DR7 F;  4O3N A;  1KC8 T;  5L1J A;  2IIH A;  4ZVG A;  2KO1 A;  1PYS B;  1IR1 A;  3C6T A;  1FEE A;  1JLF A;  4YHH J;  4USM A;  5A8K B;  1D1U A;  3R5C A;  2OLW A;  4LF5 F;  5A76 A;  5CYM B;  3GG1 A;  3KWM A;  1K1Q A;  3JYT B;  1JLA A;  3QGH A;  1KP6 A;  4M5H A;  1I5O B;  1RI7 A;  2DNG A;  4IG0 A;  2RKI B;  2QA2 A;  1X4A A;  1H74 A;  1RT2 A;  5LOQ A;  3M1V B;  1T94 A;  3EX7 B;  2UXB F;  4U67 Q;  4PQU B;  5HQ8 A;  5DQI A;  2NZ4 A;  2YNF A;  2ZH4 A;  1S59 A;  1QSS A;  1XMO J;  3GYX B;  1CEZ A;  2AX0 A;  2BE9 B;  3M30 B;  4PYD A;  5C42 A;  1U1L A;  4ZVT B;  3B78 A;  3CXC R;  4ECW A;  3IO1 A;  3DYA A;  1VR6 A;  1KQF B;  3PZP A;  1VQ9 S;  2CQG A;  1WSR A;  2OTJ S;  1U02 A;  1X5O A;  1SIW B;  1KD1 T;  1XNR J;  2UUC J;  5KFP A;  4CLW A;  1U0S A;  2OGU A;  3QO9 B;  3M2U A;  1T9W A;  4DR2 J;  1FXD A;  1T03 B;  2E1P A;  3DLK B;  4HEA 9;  1MN7 A;  2F8M A;  1KFS A;  2IJR A;  4M5D B;  4F04 B;  3OFE A;  2QA4 G;  2JNJ A;  4KY3 A;  4DUZ F;  2VIH A;  2CVI A;  4MAK A;  4M5I A;  5CYQ A;  3U02 A;  5EWF A;  1N5Y B;  4GVB A;  1KLN A;  1NDC A;  2WON A;  2EEY A;  2KYZ A;  1LXN A;  1Q8I A;  2RE1 A;  4Q44 A;  4UQG A;  2X1A A;  2DGT A;  4PG6 A;  4B3T J;  3QRR A;  1U1M A;  3RG6 A;  4CLS A;  1LWF B;  4A8X A;  2CPF A;  3M2V B;  1MML A;  4X4Q A;  2GAH C;  5ETN A;  2J0S D;  1R8H A;  4USV A;  3W8G A;  1FDB A;  2QMU B;  5MAO A;  1REV B;  1AUD A;  2IY5 B;  4IR1 A;  2B3T B;  4DL2 A;  4ZCI A;  4F8R A;  1HLW A;  2KJW A;  2U1A A;  3DI6 B;  4HH1 A;  3EWG A;  1HQE A;  2C2D A;  1WG5 A;  3ZTQ A;  4DG1 B;  4ZVF A;  3EZ5 A;  1M1H A;  1XMQ J;  3FEY B;  5I42 B;  3QJL A;  2MST A;  2V68 A;  3BGF A;  3QFH A;  4JI5 F;  2W9C B;  4QR2 A;  2BOA A;  5K9F A;  1NU4 A;  4KR0 B;  1EIY B;  3D67 A;  3OTD A;  1VBK A;  5DQH A;  3K7R A;  2AZ3 A;  3F44 A;  1YJT A;  2FDN A;  3SV3 A;  3I5A A;  1N36 F;  1TK0 A;  4I1T A;  1TR0 A;  3EVM A;  4USW A;  5B0G A;  2B51 A;  1MMN A;  5B0D A;  3AJ2 A;  1NO8 A;  3HSD A;  1GAO A;  2W7O A;  5CHC B;  4J9S A;  3H98 A;  2FVQ A;  3FZ2 A;  1PSD A;  3FZB A;  5EX0 A;  1VQ8 S;  2XCP A;  1C1C B;  1WKK A;  3HFZ B;  1UJ4 A;  3NLC A;  4WFB Q;  4KC5 A;  1PAU B;  3K0J A;  1OIA A;  1Y11 A;  4ZCL A;  4X4R A;  2B9X A;  1S7I A;  4ZLJ A;  2J6U A;  4MKB A;  3CCU S;  2QL9 B;  4NI2 A;  1RTI A;  1HBO B;  5JUM A;  1DLO B;  3SBM A;  1KVI A;  4WJB A;  3NKY A;  3R7N B;  1GX6 A;  2YWK A;  5A2Q U;  1BE4 A;  1FWL A;  2G2O A;  2GVD A;  3KG4 A;  3Q2T C;  4G1Q A;  2DBB A;  1SKS A;  3BKU A;  3DC2 A;  2UUA J;  1Y10 A;  1M90 T;  5DZ6 A;  5IT9 U;  1H7W A;  3W62 A;  3TQ1 A;  1D0E A;  2G4B A;  5D77 A;  1RAJ A;  3HSJ A;  4DSI A;  2C3O A;  2QX0 A;  3P96 A;  2C2M B;  3D9B A;  2V9W A;  4L72 B;  2J7U A;  2OML A;  2R8G A;  1IBL J;  4ZVP B;  4RNO A;  4EI2 A;  4X4N A;  5E33 A;  3FVY A;  4MK8 A;  5HMY A;  1KSP A;  2IYG A;  3AB2 B;  2CJA A;  2DNZ A;  2YWW A;  4K5R A;  4X66 F;  3CIM A;  1CJU A;  3V4I A;  5D8H B;  2V2Q A;  1FRJ A;  1U24 A;  1NRK A;  4CLU A;  1DRZ A;  2APO A;  4LR8 A;  2RML A;  1ZM2 A;  2W7A A;  2W2N P;  1Q1K A;  1JK9 B;  1KWM A;  2F5G A;  1RHM B;  4CO4 A;  4M5G A;  1NHK L;  3GR1 A;  1M1K T;  2WON B;  4J7C A;  4LF1 A;  2PSZ A;  2FGC A;  3HI9 A;  4MT1 A;  3TEG A;  3NS5 A;  3X3U A;  3T1Y F;  4IH5 A;  2NUH A;  4WU2 A;  5K8O A;  3VAH A;  1S76 D;  3ITH A;  5KG1 A;  4DV1 F;  3K2Y A;  2YPZ A;  1MLA A;  2P9E A;  1KNZ A;  5T14 A;  2W1B A;  4OJ1 A;  3SQG B;  2AW0 A;  1QY7 A;  2ZBI A;  3KHH A;  3FRY A;  1HNW J;  4LSN B;  4RW7 B;  2XMM A;  2MQO A;  2IMO A;  3PAC A;  5IC6 B;  2Z2L A;  5F8I A;  1NKB A;  2ZDO A;  2XNR A;  3M8Q A;  3EYZ A;  4JI0 F;  4CLP A;  4KO0 B;  2EXU A;  3M9N B;  2LQJ A;  2OKQ A;  1DTQ B;  4JUZ A;  4ZIT A;  3KLE A;  2RS2 A;  1ZYQ A;  1BQM B;  2LQB A;  3ZO7 A;  3W9H A;  3QRQ A;  3T1H F;  1JKH A;  1HMV B;  2RSQ A;  3KKF A;  3V2U C;  5KFU A;  3V4M A;  3ZC4 A;  4EYH B;  3MTJ A;  4M5D A;  1X0F A;  1SKR A;  3QWU A;  1KQS R;  1FVQ A;  1UP1 A;  3I5C A;  3AXK A;  2ADC A;  2UUB F;  4WK1 A;  4KGX B;  4HVZ A;  2CPY A;  1BUX A;  2EBG A;  2EW9 A;  2PT0 A;  3CJQ A;  4YHH F;  4RLE A;  1VK3 A;  1SI9 A;  2QRR A;  4QWD A;  3BR9 A;  4C8Y A;  4MIW A;  3JB9 k;  3ISN D;  3LAK A;  3RRH A;  2FGO A;  3FQL A;  4FF2 A;  2P8I A;  3N79 A;  4Y2A A;  3KK2 A;  4DQP A;  1HBN A;  2CKW A;  5L39 A;  2CQ3 A;  2LXF A;  3GFX A;  2E7X A;  4UY8 T;  2GS8 A;  1VK8 A;  1YRX A;  4JOU A;  4C8M A;  4CNY A;  2GHW A;  1WUU A;  2VG6 B;  5T7L B;  1UW9 A;  1YZ6 A;  2CNK B;  2OTL S;  4CH1 A;  3BN7 A;  5KFK A;  1F0X A;  2HQG A;  3MMC B;  1XR5 A;  1GT8 A;  1Z2Z A;  1RTH A;  4KGV B;  2D41 A;  2IJN A;  4LBP A;  3GON A;  3IC1 A;  4P2M A;  5DJB A;  5G0R B;  3T19 A;  3CJ0 A;  1EQM A;  4OJG A;  3SI8 A;  1S0V A;  2J9D A;  3I6P A;  4DV0 F;  4DV3 F;  4GKK J;  2HQC A;  2KXH A;  3I0R B;  4CNZ A;  4P73 A;  3OL8 A;  1W2I A;  1UAW A;  2ROP A;  2YX7 A;  4ECX A;  1RWO B;  5GMK a;  2BOP A;  3G82 A;  2CQ1 A;  3R7B B;  1RDR A;  1FJ7 A;  2CAJ A;  2KRR A;  4ID8 A;  3VAJ A;  1S1V A;  3C6U A;  1X4D A;  5EDW A;  3SMZ A;  1IQZ A;  3MPD A;  3M8Z A;  2W9B A;  3KYL A;  3OUY B;  2MKY A;  1QSY A;  1T02 A;  4JI7 J;  1YBT A;  2HGM A;  2AD9 A;  1WC5 A;  2JC1 A;  3UDL A;  4LFA F;  3ZTP A;  3ONQ A;  4DMZ A;  1I94 F;  3OVA A;  4IUF A;  2XG8 A;  3BPD A;  3KTQ A;  1TUV A;  3CWJ A;  2GVZ B;  4V1A k;  4CRJ A;  2EC0 A;  2KVQ E;  1FE4 A;  2AMC B;  2IM1 A;  1ULR A;  3KDN A;  3BN4 A;  3H2L A;  2NYH A;  3M6V A;  2I5J B;  3IS9 A;  3HHL A;  3SEO A;  3CCL S;  1OMS A;  2RJZ A;  1HNW F;  1NME B;  1R0C B;  3ZFV A;  3NGD A;  1UTA A;  3ISZ A;  1NSK L;  4LSL B;  2ASL A;  2VON A;  1DZ5 A;  4JV0 A;  3MUV P;  1VRT B;  3G96 A;  2GGP B;  1TTH B;  4DPO A;  4DR5 J;  8ATC B;  1A9N B;  1C1C A;  1YI2 S;  3DRP B;  1TZ0 A;  1JJH A;  5LMN F;  4X4T A;  1RT7 B;  1TFY A;  2OFG X;  3U1N A;  1ZTW A;  2JLG A;  1YBU A;  2C1E B;  1L5U A;  1M5O C;  3TWZ A;  1ZPV A;  4FZV A;  3CDW A;  1BWE A;  1FJG J;  2VG5 B;  1IKW B;  4DDF A;  5A8W A;  3K59 A;  3NGK A;  4UOF A;  2AP6 A;  2ZOM A;  3UO0 A;  4CZC A;  3FBB A;  4Y6I A;  2FIU A;  1FK9 A;  1V5I B;  3MEE B;  5KG4 A;  2HVZ A;  3VCD A;  2H5E A;  3GIJ A;  4DV5 J;  2UUW A;  2WVB A;  1NEE A;  5L9X A;  4LRD A;  1NJI T;  3R2C J;  2W2O P;  3JTP A;  5K8N A;  4DLE A;  1PYO B;  3V6D B;  3JXO A;  4OX7 A;  4N5S A;  4DXL A;  4ZOS A;  1U49 A;  3HHN B;  3TAR A;  2AGO A;  5KFZ A;  4DS5 A;  1FRI A;  1IBM F;  4J9M A;  3PM9 A;  2EFV A;  4LF6 F;  2B8Q A;  4DU8 A;  1RT6 B;  1OY6 A;  4P6Q A;  1UMJ A;  2QYC A;  3IR5 B;  1QDU B;  3KNG A;  3M30 A;  4ICL A;  4X64 F;  3RAX A;  2BEF A;  3CD6 S;  4U96 A;  2AHO B;  2ZHO A;  1WAC A;  2MY8 A;  1IJE B;  2XZW A;  2Q6B A;  1XER A;  4WTY A;  1M5H A;  4H4M A;  2QT7 A;  1LNQ A;  1EET A;  4ZP9 A;  2DNN A;  3AD8 C;  3FBE A;  3QSI A;  3WBZ A;  4JI8 J;  3CJ2 A;  1JLA B;  2BYC A;  3FBC A;  2DR8 A;  4NMX A;  2IM3 A;  2VH7 A;  5E3Q A;  2FJA B;  2IRY A;  3GLJ A;  4IDK A;  4BWM A;  5KG5 A;  4W92 B;  2QJ3 A;  4UQT A;  4A8W A;  4RW6 B;  4Y2I A;  2J7K A;  3NBP A;  3KMQ A;  2ZD1 B;  2HHS A;  3F0N A;  1Y5L B;  2MSS A;  1FFS B;  2ZVI A;  1C4C A;  4NEY A;  3T1Y J;  2E1C A;  1G2E A;  2QSF A;  4I6Y A;  4NLQ A;  3T6J A;  4F4K A;  1WHW A;  5CXT A;  4ZPW R;  4NA1 A;  1JX4 A;  2VA3 A;  5E7O B;  4PQU A;  1G4C A;  1LW2 B;  3OTE A;  4PG4 A;  1EJ7 L;  5A8R A;  1J2V A;  2LQ5 A;  2V6A A;  4F3M A;  3UN3 A;  2QGF B;  2E5L J;  3KJV A;  3HM9 A;  4QU7 A;  4TU9 A;  1DQ8 A;  4WP8 A;  3UCU P;  4M95 A;  3NNC A;  5D0R A;  4UUW A;  3R1L A;  5A8R B;  1TMJ A;  4KGK A;  1UJ5 A;  1KHW A;  5EWE A;  5ETL A;  4BDP A;  3R2D J;  2CQD A;  4Q5V A;  2BR0 A;  2RQ4 A;  2LXU A;  3W66 A;  1C1B B;  4I2Q A;  5KFW A;  1VDH A;  4BC9 A;  2Y1J A;  2GQC A;  4X2B A;  2IAJ A;  1XEZ A;  2XLI A;  2ZNZ A;  1S99 A;  2IDE A;  3NGR A;  2BDP A;  3G6E S;  3HVA A;  2CJY B;  5CYJ A;  3R5A A;  4A48 A;  3GV5 B;  3BDE A;  4DQR A;  2IRX A;  2MZQ A;  3QYY A;  2B6A B;  3IMQ J;  1FKO A;  4KGM A;  3PHE A;  3H2U B;  1CS4 A;  4OYO A;  2HHW A;  1RQ0 A;  6FD1 A;  3TUI C;  1FJE B;  2SXL A;  3OV7 A;  4URQ U;  2G0C A;  3SCJ E;  1LQ9 A;  4CLL A;  2VOD A;  1KOO A;  3H7H B;  4MKA A;  2MZ1 A;  4OV1 A;  1D8Y A;  2KG1 A;  1BMQ B;  1WKJ A;  2B0G A;  2X1B A;  1O8B A;  2P9C A;  3UD4 P;  4ED4 A;  4JI3 F;  2ILZ A;  2OH2 A;  2VG6 A;  1KRP A;  4TY8 A;  2FYX A;  3US5 A;  2POK A;  2ZD1 A;  1H2T Z;  5HAN A;  4RU2 A;  5LSL A;  1ZTT A;  3VZH A;  2RF2 A;  3DLH A;  1RT6 A;  3OVB A;  3PJW A;  1HWI A;  3W63 A;  3J7Z 5;  2CA9 A;  2GFF A;  2VDH A;  5DDO C;  2N7Y A;  3M4X A;  5ETR A;  1RYS A;  2QEX S;  4Y3C A;  4DSJ A;  2X1F A;  1MSW D;  2YWG A;  1WI6 A;  5CZV A;  4UUX A;  4NXN J;  1NPP A;  1W7W A;  2G0J A;  3OPK A;  4OI6 A;  4B3R F;  3K5N A;  1RP5 A;  2V8G A;  2O01 C;  3BGR A;  2ZH2 A;  3C66 A;  1RTD B;  4DV6 F;  4LIR A;  3RR7 A;  4RUH A;  4USI A;  1ROF A;  4ZK7 M;  5M2P A;  2BJ8 A;  1PIL A;  1RT3 B;  3EXY A;  2I8E A;  5HO4 A;  3PO4 A;  1DAR A;  2V2Z A;  3PX4 A;  1DTQ A;  2ACM A;  3HJV A;  4TNO A;  3PW4 A;  1MG7 A;  1N5V A;  2XO7 A;  4G1I A;  5C7P A;  1JB0 C;  1RLD A;  4N77 A;  1T05 A;  3BR8 A;  1RT7 A;  3MAH A;  3U1L A;  2F8E X;  5K14 A;  3C8Y A;  1HNV A;  5JVH Q;  1Q86 T;  1P6T A;  3FFI A;  4PXE A;  2HFO A;  1JXV A;  3GU0 A;  2L3M A;  3H5S A;  4ES3 A;  2EFG A;  3PEJ A;  3DRX A;  5HVH A;  4DUY F;  1U0H B;  5D4N A;  3QNW B;  5EX3 A;  2DNL A;  4Q7A A;  1QVF R;  3ELH A;  5KT7 A;  4DCO B;  2QZ8 A;  4DFJ A;  1FKO B;  3BGO P;  1GMU A;  2DIS A;  3BGR B;  1DTT A;  2H51 B;  5IM0 B;  4P9S A;  2C2R A;  1TVR B;  1X4E A;  5BYR A;  2CQ4 A;  2D3U A;  4RW4 A;  1UET A;  4ID5 B;  4C7Q A;  1YLX A;  3G8Q A;  1OS5 A;  3V4I B;  1PG5 B;  2QLW A;  4DPY A;  2ROG A;  1CQM A;  1YJW S;  3R7S B;  2IAJ B;  2F4F A;  4J37 A;  4MKY A;  1UVM A;  1N5T A;  1F6T A;  5ITH A;  3CO0 P;  4CYU A;  2FTR A;  2OPR A;  5E41 A;  1XR7 A;  2AU0 A;  2VPX B;  2CNN B;  2WRM A;  3DLE A;  2XMW A;  1HBN B;  1JLG B;  3R3T A;  4IG3 B;  2WW4 A;  1S1V B;  1YGY A;  3HHL B;  1GEH A;  4YB6 A;  4ETX A;  1NJZ A;  2HFU A;  1X9W A;  1ZET A;  3BO3 A;  1JJ2 R;  5KFD A;  3CCS S;  2R7R A;  1N54 B;  2BX6 A;  5C2G A;  2AJ4 A;  2L41 A;  1AYE A;  2CYY A;  3IFE A;  2BE2 A;  2DPJ A;  4QIW D;  3MOJ B;  2HGL A;  2DR9 A;  3POT B;  1S97 A;  1S10 A;  1S0N A;  3UE2 A;  4NYP A;  3CME S;  4HH0 A;  1UEV A;  1I51 B;  1WHX A;  2HQI A;  2VKZ G;  3GPA A;  4JI2 F;  1R7I A;  1FNX H;  3TOQ A;  2NLW A;  1IM4 A;  2F8H A;  3N6M A;  2NPI A;  4R8U A;  3KOA A;  3MM9 A;  5LL6 d;  1HQ2 A;  1JJ4 A;  4DQQ A;  3QMQ A;  3EVW A;  4ZLP A;  2C2N A;  2NSB A;  1PC5 A;  4DU7 A;  4QIF A;  4ER8 A;  2I0X A;  3HZE A;  2HBQ B;  4OI0 A;  1N32 F;  1IBC B;  1H2U X;  4Z7Y A;  1K9M T;  2PN6 A;  1LWF A;  1P1L A;  2HEK A;  2M7S A;  1IKX A;  2W4C A;  4M63 A;  4OLO A;  4ZDN A;  4XPE A;  4ELV A;  5IT9 Y;  1GH8 A;  4DEZ A;  3NNH A;  2UV8 A;  4ELU A;  3HO1 A;  3NY0 A;  2YQ0 A;  2G0I A;  3KK1 A;  3N0V A;  2VDI A;  1VQS A;  3SDE B;  4DX8 H;  3F73 A;  3CCV S;  2VA2 A;  1H3D A;  1VC6 A;  5HL7 Q;  2ZKT A;  2FPH X;  2HW3 A;  3WIU A;  2WOM A;  4CO5 A;  4TKT A;  1WWH A;  2UUT A;  1ACM B;  1XJW B;  4XAK A;  2XBP A;  1HQE B;  1HR0 J;  4OHX A;  3QBC A;  4KO0 A;  3SCL E;  3R97 A;  3Q83 A;  2V5H G;  2UV8 G;  3IWX A;  4FF4 A;  1JJC B;  1S1X B;  2DIT A;  3MGJ A;  2E1R A;  3OFG A;  1O51 A;  4AD6 A;  1FES A;  3KMS A;  2UVV A;  1BQN A;  1WJ9 A;  1F9F A;  2DVI A;  3CD5 A;  1N5Q A;  4DL7 A;  2WVC A;  3LAN A;  2JJ4 D;  4WBF A;  1R8P A;  2QFJ A;  2YKA A;  3QJJ A;  1CC7 A;  3LGM A;  1RT1 A;  2IVY A;  4HHU A;  2NXC A;  4F67 A;  3QZ7 A;  4TXS A;  4OFZ A;  1XMO F;  2VBW A;  1VFJ A;  2JHE A;  2PMH A;  2CZ4 A;  1CJV A;  2OPS B;  3QGP A;  4PG8 A;  5AXN A;  1NJW A;  1J5O B;  3BPS P;  1BQM A;  3DCA A;  1VYA A;  3NEK A;  5B0F A;  3CB4 A;  2J0X A;  5A8W B;  1IKW A;  5LXY A;  3PKY A;  3LWM A;  3AFG A;  5D3G A;  4CLZ A;  2VJU A;  3QLH A;  1X7V A;  2HIY A;  4L73 A;  5FDL B;  4F4Z A;  3M2R B;  4G6V B;  1NKE A;  1QAY A;  2K1R A;  3BM7 A;  1RTI B;  4I0W A;  2UXB J;  2MMY A;  1RE1 B;  2OSQ A;  4R0J A;  4U7C A;  1PGZ A;  1UVL A;  1TL4 A;  4O3R A;  4LBI A;  2NYI A;  3JSM A;  3BYR A;  3VAM A;  1NM2 A;  1SB6 A;  1ZH5 A;  1FCA A;  3DU6 A;  4LRA A;  2XB2 D;  3TRG A;  1FRM A;  2HK3 A;  2UUB J;  3BBB A;  4OMF G;  2L48 A;  1WDT A;  5AXM A;  2A6O A;  2QL5 B;  4PAA A;  3R5D A;  3FDS A;  4DQS A;  1FK9 B;  3MEE A;  2XY5 A;  3R1H A;  3ET6 B;  5G4D A;  3PXG a;  4B17 A;  4EO6 A;  2VIC A;  1FO1 A;  4ZP8 A;  2V8V A;  3QFW A;  5GMD A;  1UVJ A;  1F5C A;  1YJV A;  1RAE B;  4YQW A;  5H9F K;  3M9O B;  4C8L A;  1SQG A;  1T11 A;  1ZAW A;  2R7X A;  3A3N B;  5HAO A;  2MDA A;  3D1Q A;  4LBH A;  3BDP A;  4V19 J;  4K0K F;  3HHL C;  1A0O B;  1Q4R A;  2MQQ A;  3ETM A;  3R6G B;  4YY3 F;  2XM3 A;  3DLB A;  1YTY A;  3GZ7 A;  3HXM A;  2HIQ A;  2WCX A;  1RHK B;  2XEX A;  3J7Y U;  5F41 A;  2ZNY A;  1RHR B;  2FQQ B;  1FRK A;  2OIH A;  5ETT A;  1YVF A;  2MQP A;  2R8H A;  1VQ4 S;  2YPY A;  1S4F A;  1N0V C;  1T95 A;  2M8D B;  2F7V A;  3CF5 Q;  4R25 A;  3G8T A;  1NDP A;  1WOR A;  2B9W A;  3VZI A;  1NCL A;  1IWG A;  3ENA A;  4Y00 A;  3VQS A;  4OYI A;  4Q8F A;  1NDK A;  4USK A;  3IR6 B;  2M52 A;  2WB4 A;  3KFW X;  3LP2 A;  2R4F A;  1I6J A;  4FBT A;  4V19 X;  2QA1 A;  3DM2 A;  3QAU A;  4C11 A;  4EGL A;  1RTJ B;  1B70 B;  4NCG B;  5I42 A;  4NLT A;  3NS6 A;  2OP5 A;  5HMZ A;  1JLC B;  2MXY A;  1JNZ B;  3CJS A;  4UZC A;  4WE1 B;  2HS4 A;  4YDX A;  5KFY A;  4KTQ A;  5RUB A;  4QU6 A;  1Q8L A;  4GKJ F;  3A8J A;  3KLI A;  2J9C A;  1MMD A;  4AQY F;  2HBY B;  3JSY A;  4HT5 A;  3JTN A;  1F5A A;  1NUE A;  3G8S A;  1N34 F;  4ZVS B;  4LR7 A;  2KB2 A;  3EGW B;  4P2S A;  2XYP B;  2GZO A;  2HG4 A;  4X4O A;  4JP8 A;  1QTN B;  2FUG 9;  1N8R T;  1K44 A;  2PA3 A;  4FKY A;  1Q81 T;  4QIG A;  3TR5 A;  3CD0 A;  3DU5 A;  2CZ9 A;  3SCK E;  3LGN A;  5H9F J;  4ZMM A;  4P72 A;  1VIO A;  1MRO B;  3KLE B;  3HSG A;  5BXI A;  3OW2 R;  3BB5 A;  1TKZ B;  2H9Z A;  4DFK A;  3BEG B;  2E5G A;  2DK2 A;  4O4G B;  3EVO A;  4KRW A;  3TA1 A;  2Q79 A;  3TNV A;  1N6Q A;  3TW0 A;  2G1H A;  3FCV A;  4CWB A;  3KK3 B;  5U47 A;  2H1Y A;  2KHC A;  4F7V A;  4Y65 A;  3NL0 A;  4Q2L A;  2F4V F;  3WC0 A;  3P6Y C;  1YG0 A;  5B0E A;  3THP A;  2R2T A;  3FSY A;  3GSI A;  2EK1 A;  1T9T A;  1TQL A;  1YZ7 A;  2KXF A;  3H2V E;  1JLC A;  1MWZ A;  3IGV A;  5L38 A;  3J7Y I;  4YFU A;  3THV A;  4U8Y A;  2C2O B;  2EI5 A;  3KHG A;  1FXL A;  1N5Y A;  3Q23 A;  3MUR P;  1RT2 B;  2FB0 A;  2DHG A;  2W4D A;  5KT2 A;  1U25 A;  2B6A A;  4B3S F;  5E3R A;  1CJK A;  2V2K A;  5T41 A;  3H5Y A;  2ASD A;  3IR7 B;  2C2K B;  4RW8 A;  3M7V A;  1CJU B;  4ES1 A;  5C2C A;  1SC4 B;  2E44 A;  1ARO P;  1JLF B;  2B9E A;  2LQ8 A;  3CJ5 A;  4IKA A;  4X65 F;  4ZP6 A;  5L1L A;  4NLG A;  4ILL A;  2CRL A;  3IWL A;  4DV1 J;  3UNG C;  4LVN P;  5HN0 A;  2B8P A;  1K0T A;  5DO2 A;  3IBW A;  5KG6 A;  5KFN A;  1VQ5 S;  1FDA A;  3QAE A;  1T0T V;  4ECY A;  1B4S A;  3DNC A;  4KV8 A;  2W2Q P;  2XZT B;  3ILJ A;  3K5P A;  2VKR A;  2XY6 A;  2JFK A;  3DOM B;  2D3O 1;  3M32 B;  3UNY A;  1NJX A;  2HWT A;  2K7J A;  2X3D A;  4FPI A;  3H25 A;  2ZH5 A;  3UW1 A;  3RB0 A;  4W4M A;  2EVZ A;  2HLT A;  4FYV B;  5HK4 A;  1RAC B;  3PIP Q;  2BAN A;  1S57 A;  1SQE A;  1Y3K A;  2HKE A;  3C46 A;  5GAE U;  2KYX A;  1G6B A;  2O67 A;  1XIQ A;  2QYG A;  2V4J B;  2GIR A;  2NZC A;  2OSR A;  2Z56 B;  2BJ3 A;  4TYA A;  1QAI A;  4WE1 A;  3LW5 C;  2M4M A;  2DNO A;  2K7K A;  4A8S A;  1Y5N B;  1WG1 A;  4HT7 A;  4J91 A;  1VLY A;  2RVJ A;  3WX8 A;  4S0M A;  1S1U B;  2BE7 D;  2DGO A;  3ETO A;  1VBZ A;  3PRD A;  1S6P A;  1RU1 A;  3B4D A;  1NH7 A;  3IBF B;  1VQP S;  3NMA A;  3A8E A;  4PYA A;  4WPA A;  4JBC A;  1HPZ A;  5J2Q A;  1DY3 A;  2WVD A;  4CH0 S;  1D09 B;  1NHV A;  1KLM A;  1WEZ A;  4FS2 A;  2ALZ A;  3E01 A;  2ZZT A;  4YR2 A;  5CAA A;  1S1W A;  2VFS A;  2IMW P;  4DJB A;  5KFM A;  4ECQ A;  1JLQ B;  4O3Q A;  1M1G A;  3MM8 A;  3TZX A;  4AL6 A;  1GXL A;  1RIS A;  1RZM A;  3KUE A;  4DV3 J;  4EBC A;  2DKO B;  3CDE A;  2GQ2 A;  5K5M A;  3CCJ S;  1YJN S;  4IRK A;  3EPG A;  1TL1 B;  2IYI A;  3M2V A;  4URS A;  1RWU A;  2J0W A;  3D1O A;  1TKD A;  4RKU C;  2V8D A;  4PWD B;  3PW2 A;  2AV5 A;  5ETS A;  4DZ6 A;  1E6Y B;  2CNO B;  3DRS B;  1QVG R;  5D78 A;  2RRA A;  2EFQ A;  5HP1 A;  3PIO Q;  2ZFH A;  5HJX A;  1RT4 A;  2NXN A;  3CJK B;  3J80 Y;  2CJX B;  4U7U K;  4OHY A;  5D0G A;  2RHS B;  4RPF A;  5KT3 A;  2MLZ A;  4Q45 A;  5DET A;  5I3P A;  2KT3 A;  3KLI B;  1X5P A;  3HVT A;  4NLS A;  4CM0 A;  4UOC A;  5L8R C;  3D2W A;  4L76 A;  2HPU A;  3GFY A;  4Y2K A;  3EPI A;  1T3O A;  5FDL A;  3UDV A;  4QCL A;  5D4O A;  1E6V B;  2DO0 A;  4B9T A;  1VQY A;  4LSL A;  5A0Y B;  3Q8V A;  5HMW A;  4CIO A;  2BZ2 A;  4KBI A;  4NLX A;  1J5E F;  1LOU A;  1OJ4 A;  3WZ0 A;  2XS2 A;  3HX9 A;  2MKK A;  1ICE B;  5FLX U;  4B9N A;  2OPP B;  4ECS A;  2WAQ D;  3A8I A;  1RWX B;  2MYF A;  1TL7 B;  2FHK A;  2I38 A;  2DIV A;  4N7T A;  5A8K A;  4CO2 A;  1WC3 A;  2BQU A;  4M5K A;  2HNY A;  2VF3 A;  4DV7 J;  4L3K A;  4DLG A;  2A3J A;  3R6L B;  4ECU A;  4RNF A;  1SBR A;  1CBK A;  3TZW A;  4LFB J;  4ZN3 A;  2ZJQ Q;  2MQL A;  5DDP C;  3NAH A;  4ECZ A;  3DLG A;  4UW2 A;  1K0V A;  2HNY B;  3GFZ A;  2M2B A;  4QR0 A;  4P71 A;  4H4K C;  2C42 A;  1XN9 A;  2WK4 A;  3F56 A;  3CJT A;  3HUL A;  3MHY A;  1DUR A;  4F0H A;  2Q43 A;  3HKW A;  5HVG A;  3SYZ A;  3AAW B;  1R0A A;  3N01 A;  3MM7 B;  3DDK A;  1S6Q A;  3W2W B;  1U7L A;  2QE5 A;  1TMM A;  3TVZ A;  2XO6 A;  3MR2 A;  2H65 B;  3CCR S;  5BR8 J;  2IBO A;  1R27 B;  3AXM A;  4DBQ A;  3HHL D;  5L46 A;  4EYI B;  4MK7 A;  3TAQ A;  1FER A;  2QLF B;  1BQX A;  3GMG A;  1RT5 B;  3M8S A;  3AHP A;  1RK8 A;  4CO0 A;  1YIT S;  3W8P A;  1KDN A;  4OJH A;  5T7L A;  4ZPA A;  5DZ7 A;  3VVU A;  4CTA A;  2CDR B;  4ICL B;  4R8U B;  2QN6 B;  4MYU A;  2XGQ A;  3BV8 A;  4HDG A;  1LWE A;  4BBY A;  5F8J A;  4RX6 A;  4ANE A;  1SVD A;  2RQC A;  4DCP B;  3EJM A;  3Q86 A;  4TU7 A; 
#chains in the Genus database with same CATH homology
 3HD1 A;  4M5H A;  1HKA A;  4M5I A;  1F9H A;  4PZV A;  5ETV A;  1HQ2 A;  5ETL A;  3ILO A;  5ETM A;  5ETP A;  4AD6 A;  2F63 A;  4CYU B;  1RAO A;  3ILI A;  1RU1 A;  3HSJ A;  4M5L A;  4M5N A;  2QX0 A;  3ILJ A;  3MCM A;  5ETS A;  4CYU A;  1TMM A;  3HSD A;  5ETT A;  4M5M A;  5ETN A;  1RU2 A;  1DY3 A;  3HSZ A;  5ETR A;  5ETQ A;  3HT0 A;  1EX8 A;  3HD2 A;  3UDE A;  2BMB A;  1G4C A;  5ETK A;  2F65 A;  1IM6 A;  4M5K A;  2CG8 A;  3UD5 A;  5ETO A;  3HSG A;  3KUG A;  1KBR A;  4F7V A;  4CRJ A;  3KUE A;  1Q0N A;  1EQM A;  1CBK A;  1RB0 A;  3IP0 A;  3KUH A;  3MCO A;  1RTZ A;  1EQ0 A;  3HCX A;  4CWB A;  4M5G A;  3UDV A;  3MCN A;  3QBC A;  1TMJ A;  4M5J A;  3ILL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...