5ETQA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.96 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
156
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEELHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 43
structure length 156
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etqA00
3HD2A 1F9HA 4CWBA 4CYUB 1EQMA 3HSJA 2F65A 4AD6A 1G4CA 1KBRA 2BMBA 5ETSA 3HSDA 4M5HA 3HT0A 3KUEA 1HQ2A 5ETQA 3KUGA 3KUHA 3UDVA 1EQ0A 4PZVA 1RU2A 3ILLA 4CRJA 1RTZA 4M5IA 3MCOA 5ETVA 1IM6A 4CYUA 1EX8A 3HCXA 3MCNA 4M5JA 3HD1A 5ETTA 4F7VA 5ETOA 5ETMA 3ILOA 1TMJA 3ILJA 3QBCA 4M5MA 5ETKA 3MCMA 4M5NA 1CBKA 3IP0A 1HKAA 2CG8A 5ETPA 5ETLA 5ETNA 1RAOA 4M5LA 2F63A 3UD5A 3UDEA 1Q0NA 5ETRA 3HSZA 2QX0A 4M5GA 3HSGA 1RB0A 4M5KA 1TMMA 1RU1A 1DY3A 3ILIA
chains in the Genus database with same CATH superfamily
3MURP 5L1IA 3LP0B 1Y11A 1OPIA 2KXFA 1UP1A 3T1HF 2J9CA 1IVZA 1U09A 4OV1A 2JVOA 1Q5VA 1GEHA 2DTJA 1C0TB 4LSLA 1WC5A 4EWTA 5A0YA 4F26A 5H9EK 2X1FA 3RR7A 3EXCX 1F3VA 4NZ0A 5HANA 2UVUA 4IFVB 3LP2A 3R2DJ 1JKHA 3I0RB 2HWTA 3ZZ0A 4OJ3A 3GIKA 1W7WA 4K2XA 2FLLA 1X9WA 2F65A 1VQ7S 3NGSA 3UPFA 4H4OB 4ZVRB 2HRYA 3MAAB 2RUGA 3JSRA 3PRVA 3ENQA 3IFEA 2DHGA 2IRYA 2KYZA 5ITHA 2YKPA 2XB2D 3UVJA 2DVIA 4WKRA 2C2OB 1UJ4A 2PEBA 3GIRA 3IBFB 4OZLA 1JLCA 2HFOA 2W25A 2XZDB 2E5LJ 1QUVA 4CTAA 2UXDF 5HVGA 4ECRA 2FDNA 3BR8A 4WFBQ 2ALZA 1U0HA 4LT6A 5HBMA 3AH6A 2I2YA 4QWDA 4QIEA 2PT0A 4LRDA 3RAMA 1K44A 3I56S 4QIGA 2XHCA 1UWBB 1PBAA 4I2PA 2NS1B 2Z58B 4OZNA 1NK0A 3BDPA 3EVWA 1YVFA 1QAJA 1T8EA 1RBLA 2XYHB 3OHBA 1YTYA 4ER8A 4ZP7A 4ED8A 4QW8A 3EJMA 5DZ7A 3RBEA 1QE1A 2V8DA 4ECSA 3I31A 4ZA1A 4AE5A 2CQIA 4KIAA 3AJ2A 4M5DB 3EX7B 3SSRA 2XTJP 1VQPS 3QO9A 2YX4A 3VALA 3UCUP 3M7VA 5IV3A 2V2QA 2M88A 4RLEA 1SJ4P 2J8SA 1C0UA 4USTA 4WXOA 5D4PA 4LBHA 4I6YA 3RJMB 1REVA 3OTBA 1K0VA 1IBKJ 4DUYF 1WORA 1XNRJ 2DGWA 5I4MA 2R4FA 3W1YC 1VC5A 5H9FK 2CYYA 3PZPA 3M1VA 2R8KA 2OPQB 3IMQJ 3GJTB 1MSWD 1BHNA 2QT7A 3O6QA 2D1CA 5J1EB 3KJFB 3MECA 2J6TA 1HQ2A 4DV0F 1LFPA 1UVMA 4F8RA 2CQDA 3A8IA 4FS2A 3MEDA 3ZZZA 1VHIA 2A6MA 3CGIA 2Y1RI 4IH7A 1C1CA 3QWPA 4TY8B 1N0VC 2GAGC 1SUQA 4RW7B 3N5FA 2CAJA 1IR1A 2B7CB 4ELUA 1VQ5S 4B9VA 2HS0A 3W9HA 1FERA 4UF4A 3PNIA 2B43A 4KGKA 4WK1A 2E44A 1RHRB 4IFYB 2MZTA 2V2ZA 3PHTA 2G0JA 4OHXA 5F8HA 4YDDB 3AFGA 2CPEA 3GYXB 1XC9A 4P72A 1XJWB 2KKHA 1YJ9S 4QQBA 1N36F 5L1JA 4WKYA 1TKTA 1PCAA 1S99A 3EDRB 4RBVA 2QA4S 3T5LA 3DCAA 4B08A 5FIIA 5F8IA 2UXDJ 2QLWA 4QU6A 4YR3A 1NDPA 4M5GA 3EGVA 1TUGB 3GG1A 4R25A 2R2SA 2VPZB 2ZZMA 2BJ1A 2GGPA 2YWKA 4OX6A 1U2RA 1FT8A 2A10A 2HHXA 2K1RA 2CJ9A 3OHAA 1S6QB 4JI3F 4NLSA 4ZCMA 3FEXB 2MHNA 2DXDA 2D3O1 2QRRA 2MZQA 3MEGA 2IVYA 3HMJG 3C2PA 1CC8A 2QZ8A 3GYNA 1RAGB 3JXOA 2RRBA 5T7LA 1R7IA 5KT6A 3JSMB 4O44A 4DI6A 2DRBA 3PG9A 2AX1A 4WTYA 1UJ5A 4J9VA 4OMFG 2H3EB 2GIQA 2AJQA 4EUVA 3LGMA 2JFKA 2WONB 4DUYJ 3LGHA 3FGVA 1MROA 3BSCA 3LW5C 4EEYA 2E1PA 4TQSA 4C2MA 1T9TA 4B9TA 2H4YB 4PQAA 4YHHF 4DF8A 1P8GA 1BQMB 1FO1A 2W7PA 2D9PA 1WTBA 4C8OA 4CNZA 5LXYA 3Q89A 1KVKA 3OR2B 3GLJA 2DO0A 2V4JB 3ZZOA 4TKTA 2QGFB 1IQTA 3K17A 2YWFA 1GT8A 4UQGA 3R5CA 3QIPB 3L09A 1QUPA 1HWIA 4XPCA 1A7GE 3SDEA 3KLIA 2AMCB 4ZPCA 2VIHA 2XCPA 4EBDA 5K8NA 1GTHA 2XMTA 3M9MB 1JJHA 3R5GA 1I6JA 3RGIA 3B4DA 4KY3A 3HFVA 2A3JA 5E7OB 4OZJA 3LAKA 2HFUA 1VDHA 4LSNB 4C48A 2RF2B 3QLHB 3C6TA 3S01A 4ZHRA 5D77A 3KK2A 2KHCA 4F67A 3JAMY 5AT1B 2ZH5A 1N36J 2OEMA 3QSYB 3QRPA 4N77A 2CNOB 4TLQA 2J5AA 4RNFA 2HRUA 2HVDA 3VQTA 3MM7A 4FP9A 2VB6A 4F3QA 1SJQA 5HROB 1RCXB 4DQRA 1WF1A 1VLYA 5KT3A 2CPIA 3H25A 5GMEA 2EVZA 4QYRA 4QWBA 2BABA 1C4CA 1TP7A 1U02A 4TYAA 4JP8A 5U47A 1TL7B 3R5DA 2R42A 4FBUA 2GCFA 1RK8A 5ETOA 4IQXA 3O3LA 4P2XA 4JI3J 1Y3KA 4H4KC 3AD7C 5CYMB 2RDIA 3QAUA 3QJJA 3LALA 4MK8A 3ZTRA 4NXNF 5CHCB 4DV7F 4ZJLA 1TR0A 2YQ3A 3GIIA 4Q8EA 5HVFA 1G1XA 3KMQA 2W7OA 5AJ3J 2DNRA 2JEIA 1FESA 1WHVA 2IM2A 3M30B 2QL9B 3GR0A 1S6PB 4ID8A 1IBMJ 2JC1A 4LF7F 5IC4B 1DZ5A 1R31A 1VRUB 5HO4A 4F50A 3DGPB 4GO5X 2A6OA 2G13A 1M0SA 2VG7B 1DLOA 4PXEA 4DDFA 3T41A 2JOQA 4KH1B 1LW0A 2CZ4A 1EX8A 2YTCA 3NMRA 1TKZB 1Y4ZB 2ZOGA 2VH7A 3I5AA 1RXOB 3MPVA 1CJVB 1WF0A 3QJPA 2FJEB 3DYAA 1J5EF 1NDLA 3DMJA 1TL3B 3CB4A 5GAEI 2Q43A 4HLBA 4YB7A 1WKKA 2OAUA 2YBVA 3HHEA 1WUUA 4I4BA 2Z0GA 1ZBTA 2WB1D 1IQZA 5J2MA 4KKOB 2LEPA 4CM0A 3B4MA 2G0IA 2XGQA 2GS8A 2E1RA 2VFUA 2V69A 2VJVA 2VOPA 2C2KB 1N54B 1WJ9A 2MLXA 1RCOB 4C9DA 4MAKA 1IKXA 2KFYA 1TK8A 1IXKA 5KFOA 3GV8B 3NCQA 3IP0A 2UXBF 2HFVA 1C4AA 3DHXA 1G6BA 3C15B 1HA1A 1CQMA 1BWEA 2B9WA 3J7AN 1WC3A 3KHLA 4MIBA 4LRAA 2HQ3A 2WOMA 2E29A 3QRQA 3FQKA 1D9DA 2W2NP 3A8KA 1SKSA 4DZDA 2YVSA 2CA9A 1Y5LB 3K5NA 4NXNJ 4DV7J 3PYEA 3CDUA 1OY6A 3M8PB 3TAPA 2BYCA 1QY7A 4ICLA 2WVEA 2DGVA 2IM1A 3RB6A 2BM1A 2EI5A 2WCXA 3P8BB 4O3NA 2BQRA 1HMVB 1CVJA 3AD9C 1JLBB 4LF7J 3TR5A 1NK4A 2R7TA 3E8OA 2C2EA 5RUBA 1UFKA 2W2OP 1RHQB 2Z8QA 5DJBA 1KVJA 3L4BC 1N4LA 4DN9A 1Q81T 3MM9A 4M5KA 3PR5B 2RRAA 4K4TA 4ZLNA 1VQ8S 2HQDA 1T94A 2GO9A 4OI3A 2CQCA 2NSCA 5BXIA 1RTHA 2CG8A 3A3NB 3KNGA 1D09B 5HMWA 2FY8A 1JLGA 3HHDA 5F3TA 2CVIA 2CVEA 2OH2A 1YJTA 4MJKA 4K4SA 5E3RA 2BA9A 1J5EJ 3VAIA 5DRKA 4J9UE 1CJUA 5KT2A 4FF2A 3LTOA 3ILIA 1YJUA 1SC6A 2Q6BA 1U6BA 4RNHA 5B0CA 2FY1A 2LYVA 1S77D 2BV3A 2PMZD 4CLPA 1ZM4A 2XEXA 3HVAA 1C1BB 2MKJA 2O01C 3GONA 1NJIT 3BYRA 1ULRA 3BKUA 1VFJA 5KFRA 1VK8A 4X66F 1U1QA 4K8RA 1MN7A 3AOAA 3SV3A 2FQQB 2V34A 1JLEB 1FRKA 1S1XB 2FIUA 4GKKJ 3TAMB 4CM2A 4OHYA 4DN0A 1DHMA 3LGNA 1WI6A 1RYSA 4IR1A 3VGUA 4P2FA 3BPSP 3D54A 4CNYA 4I7FB 3WC2A 4F0KA 1FHTA 4ED4A 3LAMA 1S7IA 4ZK7M 5IV4A 3PHEA 2HHVA 1RT2B 2LU2A 4WU3A 4ENOA 4X4NA 1YBTA 5HMXA 1RT6B 3HKZD 3SSSA 3VF0B 1NM2A 5IM0B 3ILJA 1ZM9A 5KFSA 2MZJA 1JJ4A 3KHHA 3HO1A 2ADBA 1OY9A 5HQ8A 2L9DA 4TN2A 4CH1A 3IAS9 4E98A 5A8KA 1N33F 2DR9A 4YOEA 1WI8A 2CFXA 1Q95G 1D8YA 1BD6A 1YGYA 2B9EA 4NLXA 3UN2A 1R8CA 2KG1A 2ZJQQ 4CRJA 2OIHA 4DLGA 2F1FA 3IR5B 3K8VA 2FJXA 4MFBA 3DM2B 2HNZA 4LIRA 4X4OA 4ED3A 1TL5A 2ZE2A 2BUNA 4Q43A 3PV8A 5KFFA 1HQEB 4B17A 2G1DA 4NLDA 2F4FA 3WIVA 7FDRA 3O44A 4HT7A 5LSLA 3OBIA 4B9NA 2KZZA 1S5ZA 5H1SV 4LQ9A 1T95A 2VQEF 3PO4A 4HH0A 2Y0SD 4CQ1A 2UVVA 3BZQA 3ZXWA 1HWLA 2HFZA 1FF2A 3JS9A 2YNFA 2RQ4A 4LSLB 4LF1A 3HLUA 5A0YB 4USVA 2HBQB 4Q7AA 5GAGI 5EUHA 3AY0A 5LMNF 1DQ8A 3LP2B 3CXCR 1JKHB 3CCUS 3I87A 1QDUB 2IDEA 3TX8A 1U8SA 1FRJA 2ZKUA 2I38A 3RB0A 3U7JA 2MY7A 1HPZA 3MR6A 3OXLA 1RTIB 5KG0A 5K8PA 4C3MA 4Z7YA 1HNVA 2YNIA 4OHZA 1NRKA 1RWVB 1X4AA 4CLZA 2AIRB 3I9V9 1TVRA 4LFBF 1JLFA 3C46A 3OL7A 3JTPA 2HGLA 3G71S 3TZYA 8RUCA 2GHWA 4MKVA 1O51A 1K73T 2GVDA 3IG1A 2W8KA 1N5VA 4U67Q 3CCTA 2P9CA 1JLCB 1P1TA 4O4GA 3CJ5A 3SBMA 4UQTA 1UWAA 4CTAB 2G1HA 2BXJA 2RKIB 5EWGA 2C3OA 4LBIA 1U0HB 4C8NA 3V4IB 2R7SA 1ITPA 2OMOA 2U1AA 2CG4A 2XS2A 4K0KJ 2AWZA 4I2PB 4X84A 4XK8C 3D66A 3CIZA 2UXCJ 3A13A 5F8NA 3MM8A 1F2HA 3G87A 5CYQA 3M32A 3FC9A 1D9FA 1VQOS 1UEUA 4LF4F 1X5OA 1CQNA 2IBOA 1N33J 4IKAA 4NMXA 3N0VA 1QE1B 3RRKA 2EFQA 2PMHA 2HWIA 4BC7A 2JL9A 3KKFA 2YNHB 2VBWA 1HHTP 3L7UA 3J7YI 1TUVA 4WP8A 3OW2R 2ZH7A 3WZ0A 4B9LA 4OJHA 2XS5A 2ZM6F 2RQMA 5THWA 5GAHI 2X1GA 1C0UB 1REVB 3CCWA 3N28A 2BQUA 3TJ9A 2CJAA 2E5GA 3OFFA 4EMDA 5DM6Q 3CO0P 1LWFB 4ZVGA 3CDBA 2ZBRA 3M1VB 2YKOA 3OFEA 4RW6A 1RTDA 1FFSB 1RWMB 4KHPF 2DK2A 4NWBA 3Q2SC 4MIWA 4NCGA 3U27A 2DGQA 1DQAA 4AL7A 4X65J 2VC0A 2MQLA 3KG4A 4E0DA 1R6YA 3MEDB 4TU8A 1Q78A 1CG2A 1YWXA 1OJ4A 5LMNJ 1SL0A 1SUQB 3CCJS 4DU8A 3BGUA 2G2OA 4Y00A 5AXNA 1AFIA 3OQ2A 5IT9Y 2H51B 3HT3A 2ZHAA 1IKYA 4OI4A 4QZVB 2ZH4A 5DO2A 4YR0A 2BR0A 4QW9A 4WK3A 2M3DA 3F44A 2RNEA 2IY5B 1X7VA 3QT6A 2VZ9A 2V68A 1B99A 4JV2A 4DR3J 1S4FA 3QQCD 4LFBJ 2IVMA 1RI7A 4GVBA 2ADCA 5GAEU 1AB8A 3SMZA 4LIWA 4NZ6A 3HFZB 1TKTB 1S1UA 1YX2A 4ZKAA 3HD2A 2VD3A 4F2SA 2QMWA 2QLFB 4DX8H 3MFHA 5KTQA 4YUDA 3CJQA 3VHQA 1VCTA 2MKHA 1XMBA 3M2UA 2MKCA 3DXBA 1XMOJ 4KGZB 5ETQA 4WP9A 2B3TB 5A8WA 1N32F 3A1YG 2G0CA 3NAIA 1RADB 1NDKA 4ANEA 4DSIA 1HNIA 3W9JA 2GIFA 4R0JA 4QU7A 2ZFHA 1YSJA 2PEHA 2MPUA 4LF4J 1NXIA 4EO6A 5CA5A 4C11A 2QN6B 2E7WA 2AZ3A 2R2RA 3MMAB 3A8JA 4O44B 2P2CB 1FK9B 3KHRA 2XMWA 3MUTP 3M9NB 2POKA 1RJJA 1O5JA 2VKRA 2R3VA 2AF6A 1D3WA 2VJUA 4GC7A 3K59A 5B0DA 2C3UA 3UR3C 4NYOA 1SB6A 3IRXB 1BWVA 4BHQA 4J7CA 1EETA 2EFGA 4KHPJ 3DU5A 2IM0A 2MHEA 1LW2B 4M5HA 1Y0HA 1T05A 1YJWS 2UP1A 3PKYA 3UWTA 2AEMA 3TQ1A 3DFEA 3IGNA 5KFEA 3CJ3A 1NPKA 1KRPA 3FK4A 4DSEA 2F8HA 4ZPAA 5EX3A 4X4PA 1RISA 2D74B 5J2PB 1KTVA 3SDEB 3KLIB 4JV5F 1NJYA 1TV6B 2LKZA 1XK8A 2K06A 2HGNA 4ZPDA 3G9CA 4A8KA 4A46A 2QV6A 1HR0F 1UFLA 2VL1A 3QRRA 4WP3A 1NPRA 3ZC4A 4FNIA 4O3OA 4DR1F 4DV2F 4DL6A 2ACYA 2RS8A 1V5IB 2MLZA 2R7OA 3WQPA 2N3LA 2YH0A 2Z2ZA 3KK2B 2MQMA 4K4YA 3RBDA 4C8ZA 1SI9A 1IR2A 2W4PA 1R8PA 1U48A 4C6AA 4NCBA 3EE3A 3CCRS 2CZ9A 4B3SF 4N47A 3OL9A 1RBAA 2Y8WA 1M1HA 1IKWA 2LFVA 3H5UA 4B02A 3DNCA 3UD4P 3M2VA 4N56A 2GV1A 5ETPA 1VRTA 2CUYA 1N32J 3A8EA 4AXJA 1U1MA 3G86A 2KXNB 2QA2A 1HFEL 2MQPA 1PYSB 3OLBA 2V8HA 4U7UK 1GTEA 4FKXA 2GQ2A 4XDDA 4EBCA 1RWPB 2CADA 3GFYA 4PRFA 2OSRA 2EFPA 1QVFR 1A6LA 2XSJA 5E3CA 2OFGX 4ZS6A 3SZ2A 3VGSA 3HCXA 2HIQA 3HHLA 4YEAA 2CNNB 2EFOA 3OSNA 4DPOA 3W62A 4ETXA 1H2TZ 3I0SA 1U2CA 2GVZA 1WSVA 2H5IB 3V4MA 4C0BA 1GXTA 3US5A 4HTIA 3TVYA 4QIFA 1N56A 2NYIA 4RNNA 1NHKL 1DLOB 3M8YA 4R5PB 1TK5A 2AGOA 4IOBA 2J7WA 4N41A 3JQKA 1VR6A 1N48A 1FNOA 2V5HG 3HT0A 1FWPA 4MKBA 1EB0A 1NEEA 4AFFA 1UAWA 3F56A 3CJ4A 1WC0A 2RIJA 5HL7Q 1RKJA 4I6WA 4DS4A 4OI2A 3BB5A 3U1NA 4O4RA 4F25A 4ELTA 2DR7A 1GMUA 1OSDA 3NS6A 3G8TA 3DYAB 2VQFJ 2BDPA 2DKOB 1RT5A 3KLEA 2EPIA 4JV5J 1L3VA 1YI2S 2LQ8A 3ISZA 3ETMA 5LJ3Y 2NUUG 4ECZA 1JMTA 4BWMA 4M5IA 3MCOA 1HR0J 2HHPA 1RAIB 3IAM9 2KTQA 3ZZUA 3DLKA 4DR1J 4DV2J 1KQFB 5J2MB 1ZOTA 3TVZA 2W7AA 1X5PA 2RH3A 4Q0BA 2HG4A 4ZP8A 5GAGU 2HLTA 1RT7A 3BSOA 1UVIA 4WCEQ 3WDOA 3EYZA 3MCSA 3PYGA 3QNWB 2V8GA 5A8RB 3SXLA 4M63A 4CT8A 1KR4A 4WJBA 1T9UA 5I42A 1JXLA 4B3SJ 1NK9A 1IKXB 4RW4B 2FC9A 4WFXA 5C24A 3OUYB 4F3OA 3HJFA 1YBAA 8ATCB 3GYGA 2JLEA 5B08A 5EWFA 2KRBA 4R0EA 3T6BA 1SBRA 3MR5A 4KJIA 3MMCA 4W92B 1FTCA 2BJEA 4PUOA 2BBEA 1LWCB 2QJ3A 1U24A 3TA0A 1YRXA 3FSXA 4KFBA 4YP3A 2XI2A 2B6AB 2KM8C 2V8PA 1TUWA 2HVEA 4L74A 2DNYA 3Q8VA 3G82A 3P3DA 4NI2A 3ENVA 4P75A 5DGBA 1R3NA 3BBFA 1X31C 3TEHB 4DL7A 1Q0NA 3GILA 5CCMA 2C2NA 3SYZA 3BKFA 5D15A 1F60B 3UNGC 1HARA 3J81Y 3HD1A 3HHLD 4TVAB 1NUEA 2BE9B 2JNJA 3MCMA 1D8ZA 4BWJA 1S1WB 2NZCA 1P1LA 1OY8A 2HBYB 2VFRA 1Z4UA 1W2BR 1U47A 2DHAA 1JJ2R 5JXSA 4D3GA 3SSQA 5KG1A 5IXUA 1NK7A 1B7FA 3OVBA 3J7YU 1I5OB 3CJRA 2AHOB 4AL6A 1RABB 4N7TA 5HP1B 2DD8S 3L3CA 3D6FB 5GAHU 4P2MA 4FYDA 3VR1A 2ZNZA 2H5EA 1JLGB 3ONQA 4HI2A 1AT1B 4B3TF 1R0AA 3BPDA 2HAIA 4Z2XA 4ZVPB 1EP4A 1YDLA 2LA6A 1S1TB 2IM3A 1CJUB 2HQCA 2BE7D 2BE2B 4ECYA 4DV5F 2MQNA 1NKCA 1WG4A 3PX4A 2XWYA 1FRMA 4KR0B 2L48A 2MSTA 2DNPA 3W2VA 1SJRA 3JTOA 5FJ4A 2MLYA 5KG5A 2YQ1A 4ALZA 1T9VA 3VVUA 4ZVEA 2Q1LA 2Z56B 4PYDA 3I4HX 3PFOA 3W2WA 2APOA 3HZEA 4HDHA 3NNAA 2HHQA 2MY8A 3B6BA 4EYHB 4CCHA 2HQGA 2OFHX 3EZ5A 1IJFB 2OELA 3HJVA 4ERDA 4ES1A 3I5CA 2NXUA 2ZC3A 2W9BB 3BGRA 1HKAA 1SV5B 3IM9A 3GSIA 2LA4A 4ECWA 4DHVA 2CJXB 3MMJA 3JTNA 3QATA 3BBBA 3CIMA 2BRLA 2VDHA 2F40A 3SCLE 4LF2A 2ZOMA 4YN3B 4I6AA 1R0BG 4IQMA 2SXLA 3IBWA 5A8KB 5G0RA 5KFBA 2OMLA 2FJDB 4W98A 1FVQA 3GFHA 1Y00A 4CLWA 4R8UA 3EXYA 4RNMA 2W9CA 2RE1A 2HNZB 2OI2A 4IRCA 4E2FB 2ZOFA 3QZ8A 3OTDA 3KXDA 1HIYA 3MOJB 3Q8PB 1VRQC 1XMQF 2VPYB 4UUXA 2UU9F 1KFSA 1P6TA 2ATLA 1BGXT 5JMNA 4DX6A 2JEFA 1OQ3A 3S6EA 4F4XA 3I96A 4G6VB 5C25A 4NOHA 3DOMA 4P6QA 3RYLA 3PO5A 3MWBA 5D0EA 4P10A 3R2CJ 2HPUA 2YNFB 4B3TJ 1RAFB 1RTJA 3C14B 2E9TA 5BR8F 1X5SA 2EG2A 5C5JA 2LXUA 2Y1LB 4DV5J 5D4NA 2VASA 4P71A 3KG1A 3IWLA 1PYOB 4FPRA 2BANA 2ZHBA 5ETMA 2QLXA 5D0RA 2MEWA 3MGJA 2YNIB 4KYZA 3R7SB 4F02A 2J0WA 1NB7A 3G4SS 1TVRB 5K14A 4EZ6A 3E51A 3IG1B 1X4EA 1X5TA 1YJNS 1NNDA 4NXMF 1XNQF 2IBKA 2H54B 2KB2A 3I82A 2OJ3A 3T9NA 2R7RA 2GQQA 1L5UA 1S0VA 4IRDA 4DSFA 4KH0B 3DLGB 1Q8KA 3EZUA 1GX6A 4WPAA 1I51B 1E6VA 2Z2MA 4X4UA 2R7VA 5K20B 1BQNB 4Y2KA 1R0CB 2R7XA 3QT7A 3H8YA 2CDRB 1YJVA 3GG0A 4NLTA 3R8YA 3M32B 2HFSA 4OL8A 2XY5A 3H2VE 2I9SA 4M5MA 4M1KA 1H7WA 3JB9k 3B8HA 3FFIA 5CD4H 1HBOA 5GADI 2UUBF 3A3OB 2I1RA 1RT3B 1KBRA 3DLHA 4J90A 4DR5F 1KP6A 4JI4F 2C3MA 5D0HA 1UETA 4TQRA 3HVTB 2ZZTA 5I3UB 4FNHA 4ZN1A 1F5BA 2VBYA 2X51A 2X1AA 4OI1A 1U6FA 5FLXU 4YMEA 2YKMA 2KDOA 4DL3A 1ZAWA 2VUGA 1D1UA 4YQWA 2UU9J 1J5OA 3H40A 1MG7A 3RUBL 5HMZA 2JC0A 3QMQA 3RG6A 4CLSA 1H6KX 4RW6B 1CEZA 1RTDB 2YPZA 3OV7A 3IS9A 3PX6A 3TZWA 4NCGB 5KFPA 1FX2A 1WEZA 2F9DA 4NEYA 4Y2IA 2C22A 3QFWA 4QWCA 3W9IA 2P6SA 2HVZA 2NREA 1WHXA 2H9ZA 1G7CB 2Z30B 3HSZA 5AE1A 5BR8J 4NRTA 4DXLA 4CH0S 4HYKA 4KPYA 3TOQA 1HI8A 1F1BB 1CJTB 2A1BA 1NJXA 1AZSA 1RP5A 2JX2A 1B4SA 2NYHA 3FCHA 1WNEA 1M90T 1IKYB 4DEZA 5HLFB 4HACA 2M70A 4MK9A 4MKAA 2QFJA 2P9GA 4F2RA 1RHMB 3DC2A 4OHWA 2IC3A 1S9EB 5C2GA 2BRKA 3D3BJ 1O0PA 4KHRA 2MKIA 4F3MA 4PXCA 4WYWA 4NLGA 2ROEA 1T9WA 2WVDA 2CZVC 4ANCA 1HYSA 4GVBB 1U0SA 1JLAA 1SKWA 2AYBA 2BACA 1H38A 1F9EB 1S1UB 4C0OC 3KLGA 1UVKA 2YKAA 3T1AA 5D0GA 3GJQB 5T41A 3NMAA 3H5YA 1CPZA 1GX5A 2QLBB 4C8KA 3N6LA 4J9KA 3M2UB 4LF9F 4A48A 5KFVA 2LU1A 2KFZA 3CC2S 1HWUA 2GO8A 3POTA 5A8WB 3KK1A 3K5PA 1UA1A 5BYSA 1ZPVA 2VBXA 2X1BA 1HNIB 4UOHA 3Q86A 4ZVQB 3CMQA 2VF3A 1P27B 5LOQA 2DCLA 1KQGB 5J2QA 2AP6A 2UUBJ 1IKVA 3K57A 4J5OA 2BJ9A 4C11B 4NLQA 1Y5IB 4K4XA 4RL1A 4G65A 3AAWB 1S9FA 1QLNA 4J9RA 4EYIB 1VJWA 4TXSA 3CJTA 4P2SA 3RRHA 5E5NA 3QGPA 3W5YA 4GO7X 1S0NA 4OI0A 2B7BB 4P9SA 5KFAA 2HBRB 3BM7A 2DIVA 1HQUB 1FJGJ 1TMMA 1UZDA 1TKXA 2XCAA 2F9JA 2AGQA 2NPFA 2IMWP 5KFZA 1XBWA 1EETB 1HNXJ 2YX1A 2W2QP 3MM6B 4ZN3A 1W25A 4PG4A 4JI6F 3LPYA 4FF1A 2N7CA 1YHQS 3W64A 2EK6A 4YB6A 1RLCL 2FJVA 1SIWB 5KFKA 5KFUA 2QYGA 2XY6A 1V5VA 3MMBB 2OTLS 2IRXA 4USIA 2OD6A 4ECTA 3R5AA 2CQPA 2CJKA 5E0OA 2OGUA 4N8NA 3D6MB 3MR2A 1CULA 3FMWA 4OYMA 4U7CA 2DPJA 3MM5A 4N76A 2GQCA 4CLFA 2IYGA 3V81A 2IRUA 3G96A 4C4WA 4UTGA 1F9FA 5K5MA 4QIVA 1N88A 4WFAQ 1CC7A 1VJQA 4ELVA 2QE5A 1S59A 4ZDNA 2YKNA 2GX8A 4JI1J 3IXQA 4UY8T 4NLOA 3W63A 4X4SA 3FCVA 2ZHOA 4QR2A 3NBPA 1WKJA 2VA3A 3T5KA 2OO4A 5E3QA 1N5YA 3PACA 4WIQA 1GQEA 2WHOA 1NU4A 2HHSA 1UJ6A 2Y0BB 3BSNA 2QSFA 1RQ0A 4LF9J 1VQYA 4X4RA 2KH9A 1IKWB 2AYGA 3Q8UA 3M2VB 1B70B 1C0TA 4J9SA 3P45B 2QEXS 2DR6A 3BQ1A 4CYUB 3I0RA 1NJWA 3KLHB 4ED5A 5DLFA 2HVIA 3ENAA 1H72C 2C2RA 3UI3A 1FWLA 3SQGA 4H4OA 1KONA 2CPDA 3CJ0A 3DDIA 4Z7CA 1UVLA 1HNWF 2ZNYA 3HHLB 3U1LA 3QWUA 4LRFA 4XO0A 4A8WA 1WSRA 5A6WA 2R9LA 3I0SB 1KSPA 2FD2A 4OZ2A 2GVZB 3K5OA 1PAEX 5KFXA 1FRIA 5E33A 1K8AT 2EW9A 4CO5A 4JI7F 1VQKS 3HHKA 3CJKA 2NR0A 3PEHA 1HD1A 1KWMA 5A2QY 4A4JA 2AJ4A 3GIMA 5KFDA 1HBNB 1VMBA 1EQMA 3AT1B 2MKYA 3PW4A 4Q8FA 2FLOA 4P7TA 1U8WA 2WSEC 1VIOA 2VFTA 2M8HA 3SQOP 3DRSA 3M6WA 5L9XA 5D3GA 2EFNA 5CZVA 3DRYA 1WC1A 2AYMA 1MNEA 5F9LA 3VWSA 2J6SA 1WKLA 1RT5B 3KLEB 5F8MA 4I0WA 2J6UA 5AXKA 1SH2A 2AT1B 4JYAJ 1S49A 4F04B 1GMVA 3HDSA 3CO9A 3R3TA 4QYZK 2MJUA 1LQ9A 2OSQA 2H65B 2GC8A 3PR4A 3DLKB 2DEJA 4C8MA 3C8YA 1RHJB 3DOLB 2M4MA 3PYFA 1T03B 3T9ZA 3ZTOA 3H90A 4KTQA 1NHUA 4TYBA 4ZVUB 4B3OA 5L1LA 4KRWA 1S6OA 4ECQA 3EVOA 3HP6A 3CCLS 2W2PP 2IVFB 1SKUB 3WIUA 2AEFA 2IYIA 4RNOA 1MN9A 2OPQA 3AODA 4UOGA 3R9LA 3H5SA 1IBCB 1EAYC 3T1HJ 1FNMA 3J7Z5 1Q8IA 3R6GB 3DXSX 3UD3P 3T6JA 4WYLA 5CD4A 1JX4A 5G4DA 2ZH3A 1LKZA 3PW7A 2DXEA 3P96A 1NSKL 3JSBA 4HHHA 4DU7A 3DRPA 4E8UA 2WW4A 3QAEA 4KFBB 3AQOA 5KT4A 1HW9A 3PJWA 4OYIA 1YJ7A 4EGLA 4IG3B 5HAOA 4NI2B 3MOZA 4IOCQ 1HNWJ 3UQSA 2H1YA 3CUNA 4IFYA 2PFDA 1T3OA 4PAAA 1MWQA 4KBIA 3G6YA 3GE9A 2MSSA 1S79A 2J0XA 3AHPA 3W5ZA 2FTRA 3C16B 2U2FA 3TARA 4JI7J 1DTTB 1MU2B 1NKEA 3ZZRA 3VAFA 2FVRA 3PIPQ 5GADU 2DY1A 3FZBA 3AJDA 3D67A 3ISND 4FYXB 4A8MP 3MR3A 1YLXA 2OUGA 4PQUB 2EG1A 4OYWA 3IR6B 1S6QA 4FKYA 1XR6A 2UUCF 4DCJB 3GMGA 1X4BA 1KN6A 4DUZF 9RUBA 3S7RA 3OXGA 1URNA 3ADAC 2DRDA 5L9NA 3TNVA 1FNXH 1VQ4S 3HVWA 2DH8A 1H2UX 3EWGA 4H4MB 3EMTA 1TFWA 4DR7F 2YQ0A 3JSMA 1ACMB 1LWXA 1F0XA 1SC1B 3TI0A 2JEJA 3BN7A 1FXLA 2PN6A 3OFHA 4C98A 3MAHA 2R2TA 3L7PA 1BLUA 4DR4F 1XTZA 3Q0AA 1P9YA 4C8LA 4NX9A 3OTOF 4EI2A 3NRBA 1YG0A 1HD0A 1BXNA 3QFHA 2HNDB 2FLPA 4X4VA 3FRZA 4KE5A 4NZ7A 1BQMA 5GMDA 2AU0A 4WFZA 2D69A 1N0UA 2J8AA 2MZRA 3WX4A 3HFKA 1OSCA 4P7VA 2E5HA 2XMVA 3Q8YA 1NBEB 3AXMA 1HL6A 3MEEA 2HHWA 2WVFA 3LF0A 1F6TA 2HZAA 4I2QB 2V4JA 4A8SA 3C3LA 2L9NA 3CTRA 2LQ5A 4DV0J 3MTKA 2XGPA 2BVZA 4K2JA 3QIPA 3CDAA 2ZH6A 2AKWB 3UDLA 3OXFA 1ZAVA 2IPOB 2JEGA 4UZCA 3KUEA 2D7SA 5M2RA 5JUMA 1FFWB 4X2BA 3MCNA 2NQPA 2CQ1A 4UW2A 2ZUAA 1TZ0A 2CQ2A 4AYBD 1KLNA 2NXNA 5KFNA 1KTQA 3JQMA 5L1KA 2DHXA 5G0RB 3H4DA 4LSNA 1RHUB 1XR5A 4KSEB 1Y9OA 1RDRA 3AA8A 3H2LA 4O0IA 3CNQP 2ZH9A 2LXIA 4LF5F 1YIJS 2AZ1A 2K3KA 3OTCA 2QMUB 4BC9A 3PCOB 4OZ3A 2B8PA 3MEKA 1RWNB 4RU2A 1UEVA 3PYDA 3BQ0A 4WFYA 4ETZA 4DL0C 3K8WA 1TL7A 3U1MA 1VQNS 3DOMB 2DNQA 2OEJA 2ASJA 2FJBB 1HNZF 2OPSA 1H73A 2DY9A 4URSA 4C7QA 5CYMA 2UUCJ 1RTJB 2LEBA 4MTPA 4L76A 4DUZJ 2LCWA 3MTJA 1HBUB 1KKHA 1WEXA 1YK9A 4RW8B 5DGAA 2BANB 3ELHA 1ROFA 2MDAA 1SXLA 2DH7A 2XZTB 2B4VA 1Q86T 1T0TV 2XYPB 4DR4J 3M30A 3T5JA 3CC7S 1S6PA 4USMA 1NSQA 3OTOJ 4PG6A 4B9MA 1CS4A 5M2UA 1U45A 2RD5C 1VRUA 3DGPA 3P49B 1X9SA 5ETVA 4Y65A 2J7KA 1CBKA 4WE1A 4ZMMA 3NLCA 1TKZA 3SCIE 4ZLPA 2GFFA 4YHHJ 3KDOA 4TY9A 4KHMA 3LQVA 1Z1ZA 5DQHA 2LQJA 4YDXA 1BC6A 2XZWA 1HHSA 3SIPB 2X7IA 1D0EA 1FRLA 3N01A 1IWAA 4B9UA 4IOAQ 1RB0A 1CJVA 2O66A 5LMUF 2ERRA 1E6VB 2X3DA 4DV6F 5E3PA 3WC0A 1TL3A 2V4RA 2PDAA 3G6ES 3VZHA 3UFCX 4QBUA 3BQ2A 4Y2MA 2DNNA 1WHYA 2LP4A 4L72B 4JI0F 5J2NA 7FD1A 2NXEA 3BO4A 4IYQA 1HBOB 3EDQB 4KKOA 3NCPA 1TU0B 5HI7A 3DN9A 3UO0A 3W61A 2N82B 3EGNA 4PG8A 4PXBA 4LF5J 2EBGA 2G4BA 4A8FA 2HHTA 2BW2A 1VISA 3OVAA 2DHHA 4OYBA 3Q23A 4LR7A 1H3DA 4USWA 1SCJB 5EDWA 4GVLA 1F3FA 2K8GA 3G6VA 1U26A 5KFWA 1R8AA 4DR2F 4Y3CA 3D0IE 3C15A 2B4PA 2LQBA 1NH7A 4PWDB 1LK7A 2CQGA 3AJ1A 4ES2A 3SEOA 5A76A 1ZPWX 1JJCB 1JB0C 2M52A 2AD9A 4GMKA 1GMWA 3M2RA 4HDGA 1L3TA 4OJGA 4ID5A 4UOCA 5D8HB 2IJNA 1YITS 1L3UA 3M8QB 2ZJPQ 2ZDPA 2CJBA 4AUKA 3D1HA 2C1EB 5KG4A 2M9KA 3RR8A 1AZSB 4PWUA 1LFWA 3QGHA 4Y6IA 2VG5B 2DRAA 5LT5A 2J9EA 4KGXB 1WACA 1FI4A 3NP5A 5ETRA 1EARA 1V3RA 2YWGA 3C6UA 4HACB 3W8PA 1HMVA 1LV5A 2IJFA 4OV6A 2IC3B 3FUYA 3UR0A 2HNYA 1JLBA 2N3OA 4L73A 2WVBA 4WXWA 2MZ1A 2PA3A 4HEA9 2O1PA 2LQ9A 2R8GA 3PKMA 1CSJA 5C42A 1U1KA 2ZVSA 3KLGB 2EXUA 1YZ6A 4RWXA 2HAFA 1SQEA 1B0PA 4TU7A 6AT1B 3KYLA 3BJYA 2OKQA 1S1VA 1F9HA 4H4KA 4KPCA 1U1LA 1OIAA 2VC1A 1U7LA 2VBZA 5KG6A 4X62F 3D2WA 3ULHA 3A4TA 1WOPA 5LMUJ 1Z2LA 4K50A 4DV6J 4O3SA 2QFIA 2VOOA 1ZM3A 4LJMA 3IBCB 4KC5A 1GH8A 2FPHX 3QIDA 2QA4G 2XG8A 1NSPA 2Z2YB 2RHSB 2CXEA 3JAMU 2P9EA 2ZH2A 2HW3A 3ZTQA 1RBOB 1PSDA 3E01A 1RT1A 4WF9Q 1C1BA 2NSBA 4K5SA 4HT5A 1TELA 3BSAA 4ATNA 5LXRA 4ZVSB 2JZ5A 1OO0B 2I5JB 3QGIA 1MMDA 1URRA 5DETA 4LMZA 5EGYA 4V19X 4FBTA 4DZ6A 5AE2A 2P6TA 1JLEA 1M5SA 1S1XA 3TAMA 2PE8A 2DGSA 4RBTA 2W9AA 2WB4A 3I4PA 1PC5A 4HVZA 4LVOP 3O5TB 3R5BA 4MMOA 1DJ0A 1KOOA 4I7FA 4KO0B 4JV1A 2QL5B 3FBBA 4RZRA 2UXBJ 1RT2A 1NZ8A 3ET6B 1IBLF 5F0UA 2FJAB 4YS2A 3CCMS 3M8SA 2DNZA 5IM0A 1SL1A 4NLWA 1G4CA 3R27A 1GMWD 1HHQA 1TMJA 1MLAA 5CH7B 4ZLJA 3MXHP 2ZH1A 1A0OB 3V2UC 3GIJA 3DI6A 2O67A 1E6YB 2E9RX 1CJKB 1HLWA 4CO0A 1WTFA 2NCKL 2NUHA 4I1TA 2ZD1A 3D6TB 2HMIA 2YKNB 1FD8A 3DM2A 4OLPA 3KUGA 2KZMA 4PZVA 4G1QB 4ZP6A 4K59A 3K0JA 1FWKA 4FF3A 4NASA 4B3RF 4DG1B 1N5YB 4IO1A 1L3KA 2VHGA 1B0TA 4ZIWA 5FD1A 4C3LA 3RBXA 1UVJA 2OHDA 4ES3A 4O3PA 2HHHF 3NOCA 4AXIA 2FHMA 1IUJA 2GMHA 1GK8A 4DPUA 1MW7A 4DF4A 4XPEA 1FKOB 4X62J 3BH7B 1M1GA 1RA7A 3HZGA 4XIUA 4PCQA 2IA6A 4RX6A 4NEZA 1AW0A 1UW4A 2DIUA 1AFJA 1M5VC 2BM0A 2V50A 3SV4A 2MGZA 4B9SA 3SQGB 4M5JA 4J9PA 1U25A 2B4OA 4HHUA 1SQFA 3BYPA 1RTIA 2QLJB 2HEKA 3Q8SB 3TUZC 2BZ2A 4DQSA 2PSZA 3MF5A 4X66J 2D41A 2ZVIA 3CJKB 3S1TA 2CQ4A 1UVNA 2HZVA 3UVJB 2YY3A 2XMJA 3OFGA 1S0MA 3R7NB 2RQCA 4Q5VA 2KI2A 5K8MA 3H0PA 2RKIA 4ZIVA 2CPZA 2QO3A 1LOUA 1NCLA 1P9QC 3V4IA 2KVQE 1VK3A 2GIRA 3UDCA 1IBLJ 1HWJA 1OS5A 2VICA 4FVCA 3ZZTA 1SC3B 5HBMB 5SUHA 2KL8A 3DRSB 2O5DA 4DFMA 1N34F 5D3GB 4ZPVR 3TEGA 3QJLA 1LWEA 5ETLA 1KLMA 3KK3A 4ED1A 4X64F 1WD6A 1B0VA 1Q8BA 2GAHC 1T02A 1RSCA 3R1HA 3MD3A 1EKRA 2BKPA 1QSSA 2GZOA 3UN5A 4PR6A 1ZZFA 3FEZA 1DTQA 5B0BA 1QSLA 2XULA 2YNHA 2KFNA 3L7OA 4ITSA 2FVQA 1FE0A 5D6GA 1FDNA 3GFXA 3KTQA 4OI6A 2PA8D 3AOCA 3QO9B 4LREA 5KOXA 3EICA 2L9WA 4B3OB 4B3RJ 3LOUA 2CQBA 3E2EA 1LWFA 1U1PA 2P5VA 2HHHJ 2J9DA 4HL9A 1K47A 4DBQA 1RKIA 2MQ8A 1BE4A 4CO1A 2ALYB 3ILLA 5L38A 2VQEJ 1U4BA 1N6QA 4S0MA 1Q16B 4Y34A 2OPRA 3MECB 2FC8A 2YX7A 3BGOP 1ZM2A 3W8GA 2ZBQA 3PM9A 3K5MA 2UV8A 2Y9HA 2ASYA 1EQ0A 2FHKA 4ZVFA 4DWIA 1C1CB 1S10A 2PFFB 3DRPB 2FZCB 1YJRA 3N5BA 3R6LB 3ITHA 1X4FA 3T3FA 2RMLA 4CZCA 1FXDA 2NZ4A 3IWXA 3VTIA 3C19A 4ECVA 1JQGA 3NGKA 3M8ZA 2E5JA 2Y3YA 4EBEA 1DFDA 1RU1A 3HSGA 3TZXA 1F5AA 2ZC4A 3HF5A 3H4BA 2R8HA 2J7UA 2HSEB 1QAXA 3GB0A 3NS5A 3QYYA 3CC4S 3GCXP 1NJZA 1O6XA 2V63A 1FEHA 1FDDA 5DG8A 1KQSR 4DL5A 5L8RC 2CQHA 2I0XA 2RHQB 2JLFA 3PXGa 3TO8A 2JDJA 2QIFA 3KJVA 1NKBA 1IR0A 2YNGA 3KJNB 2W1BA 3OJSA 4EFAC 1XERA 2B0GA 3I6PA 1N34J 3Q83A 4JI5F 1IM4A 1OYDA 2GGPB 4X64J 2DYAA 2NXJA 2ROGA 1CLFA 2B9YA 2DNGA 3TQEA 3MUMP 2K1RB 4J9LA 3MI7X 1WC6A 3FSIA 2NLWA 4ZCKA 3KFWX 3W7BA 2ZEJA 3MMAA 4C0HA 1FD2A 1RUSA 1FK9A 5AJ3F 3ZTSA 2HYIB 1HWKA 3MEGB 5IQQA 3THPA 2K3IA 8AT1B 9ATCB 3B82A 5T7LB 2XMAA 3L95X 1JIHA 1IBMF 2AJFE 2IMOA 3M8WA 4DUTA 2ZM6J 4DSJA 1FFGB 2V94A 2FHJA 5HSPA 2Y1JA 3OJUA 3DDKA 3NGTA 3IRXA 1MROB 1NK6A 2WW8A 2DNKA 1I3OB 1FKAF 1LW2A 3D0HE 3D5MA 2RU9A 3GP9A 3N6MA 3MEEB 2CPXA 4A8YA 3M05A 4NE9C 4QPTA 3N4WA 4NCAA 4USUA 2FHOB 4ILMA 3J80U 2BEFA 2R7WA 2CNLB 3F0NA 1JLQA 2FZKB 3CCSS 3OSPA 3HHNB 5J2PA 1TV6A 1FEEA 3Q24A 1VQMS 2GJIA 2XMKA 5D78A 1AUDA 5M2PA 3OR1A 4OJ1A 1RTZA 5KAKA 1V9OA 3ETOA 4J91A 2RDJA 3BV8A 3QT5A 4CIOA 4RW9A 5HN0A 4OX7A 2V9WA 2DXFA 2JJ4D 1VQ9S 1RAAB 2M5YA 3E3XA 4ZPBA 2HQIA 2HWHA 3AOBA 4MKYA 2XY7A 5J1NA 5HMYA 3C6TB 2Y1IA 4ZHRB 4DOZA 4WU2A 2QA1A 3P5BP 2ZBIA 2XM3A 2XLJA 3MM7B 2ZITA 1TFYA 1RHKB 3KNAA 3EGZA 3RW6A 4YY3F 2CQ0A 2HBZB 4ZLLA 2ILZA 3LP1A 3FMBA 2ASDA 4DLEA 2BKNA 3I55S 5AXMA 1RT4A 1VI7A 4MYUA 1TQLA 1T11A 3PW2A 4JI5J 2MB0B 4L3KA 2OPSB 4ZPTR 4UT4A 3CDWA 4NA1A 5DS7A 2OPPA 1BUXA 3PRBA 1VBKA 1RAHB 4H54A 1TL4A 4IDKA 3HK2A 3I9ZA 3MAQA 5K8OA 4BLGA 2MMYA 2C2DA 1DY3A 5BYRA 3BR9A 5F0WA 1MMLA 1UMJA 2ZKTA 2H5JB 2B8QA 3UDVA 2FVCA 3MPYA 4DQQA 3KLVA 5EHHA 4ZCLA 3EVMA 2VU5A 1CS4B 1R89A 2FB0A 2DNLA 1GXUA 2E7XA 2BQ3A 4R5PA 2F3JA 3M6UA 3MD1A 3TP2A 4WE1B 3ILOA 3DU6A 3LO3A 3NWGA 4A8OA 3CD7A 1XWLA 1KFDA 1LW0B 3RTVA 2FHJD 1WG1A 2I8EA 3V6DA 3IA0A 2EBEA 1FX4A 4WIIA 2W24A 3JQJA 5IS2A 4HKQA 4ECUA 2KT5A 3K89A 3FVYA 2VDIA 5IT9U 3TJ8A 4RPFA 1F5CA 2DJWA 4PEOA 5MAOA 3VAGA 4OFZA 2BMBA 3DGVA 3CMES 3MHYA 1W2IA 2XS7A 3LH2S 2YXLA 3PFEA 1WEYA 3DMJB 1S9GA 2VONA 1KDNA 3PW5A 1QTMA 1UKUA 5J2NB 1H98A 3HSDA 4QWAA 3BS9A 4XTTA 5LSOA 1RWKB 1TTHB 2DGXA 4K4ZA 1S48A 3M4XA 1S4EA 3HX9A 4YR2A 2DNHA 5BJRA 1Y7PA 2R8JA 5A8RA 3CT9A 1RWOB 1LK5A 1T7PA 3H59A 3F41A 4TU9A 3OTEA 3R1LA 4OZ0A 4JUZA 1NLKL 4GKKF 2HRTA 4RW4A 4W90B 1WELA 5ETNA 2UUTA 2OEKA 1PJ5A 4MYTA 4QIWD 1O8BA 3KOAA 3OUYA 4YY3J 4DV4F 3VAKA 4DPTA 2FLNA 1IJEB 1V3ZA 4NYZA 1OYEA 4EZ9A 4QWEA 3M2RB 1LWCA 3P5TL 4CWBA 1G2EA 1VQLS 4ID5B 4RUBA 2J0QD 2WOMB 4DR6F 2HURA 2BOAA 1JNRB 3LWMA 2B6AA 1X60A 1YKWA 2D3UA 1YBUA 1WOSA 2W4DA 5F8JA 2K2PA 1PGZA 1ICEB 1QD1A 3TJAA 3TW0A 1HI0P 1DBDA 3DRRA 2QMXA 3B54A 4ICLB 5DG7A 4FN5A 3C6UB 2VG6A 1A9NB 4WBFA 1EKSA 3JSYA 4LFAF 3FNNA 4KGMA 2HNYB 3IN5A 1S1WA 3FBCA 5B0AA 5KFHA 4DL4A 3NGDA 5CABA 1UPPA 1R8BA 3IR7B 3EUNA 5KT5A 5KG3A 5J1PA 4OQJA 5C42B 1EHWA 4KGVB 2QG9B 2L08A 2G2YA 2DT9A 3H2UB 1ZETA 1FTRA 3KG0A 5HP1A 3KLFA 3MM9B 2GMJA 1KNZA 1S1VB 2UUWA 4PABA 1AXQA 3EPGA 3DHWC 3X3UA 3TYTA 1H7XA 1N5QA 1S12A 5E2QA 1FJEB 1RU2A 1RTHB 1Y3JA 4LR9A 1U6ZA 2ZWPA 2ZZNA 4K7QA 1S1TA 4CI0B 3V5RA 1AA1B 4TLRA 1SQGA 1TAQA 1UW9A 1FDBA 2ZDOA 2BE2A 2ZJRQ 3O1LA 2A0FB 3R5JB 4K4VA 1REGX 2EKNA 1YRTA 3E01B 2KT2A 1RT1B 1SVDA 1RGVA 1R8HA 3MUVP 2MKKA 3X1LB 2IFXA 3GU0A 3TX0A 4ZP9A 3T5HA 4DFPA 3V6KA 3BF4A 3BH6B 3JYTA 4AT1B 4ZOSA 2XI3A 1SH3A 4DV4J 1Y10A 2F8MA 4FDFA 1EJ7L 4IRKA 3HPOA 3THTA 4XAKA 1TL1A 3A3PB 2W9BA 2CJYB 2OLWA 5DQIA 1SV5A 3MPDA 3BN4A 1RWWB 5F3ZA 5LL6d 4K0KF 2VFSA 1XEZA 4DR6J 4MK7A 4MH8A 3KWMA 2GMLA 3TANA 2UXCF 5CQGA 2LMIA 1UZHA 2LDYA 3D28A 5LSRA 2EFVA 2FZGB 1FE4A 2G9OA 2KJWA 3QSIA 1L3SA 3T19A 3BO3A 4UZBA 2J76E 3DI6B 3M6VA 3DLEA 2JRSA 2KHDA 1S72S 2V2KA 3FQLA 2ZD1B 5DQGA 2UZAA 4LFAJ 4IH5A 2BKOA 3VCDA 2HMIB 1S7HA 2CJQA 3KHGA 2PC6A 2E9ZA 1XN9A 2CPYA 2HIYA 2ROPA 4L3NA 1Q7LB 4AQYF 4JI2F 2MQOA 4RO0A 1N8RT 4MFBB 3TUPA 5ADZA 1WC4A 4ED0A 2IAJA 4LVNP 1UTAA 2L41A 1K1SA 1BMQB 2ZE2B 4MT1A 2AJ2A 4CLYA 3QZ7A 1RZMA 2GHVC 1FDAA 2WSCC 5IFMA 4O0NA 3LUYA 2RRNA 1HBMA 3WHIA 4RWWA 4X65F 3EPIA 2UUAF 2L3MA 3C14A 1U1OA 2DO4A 4KQZA 4PPDA 2JVRA 5B0FA 3ZO7A 4G1IA 3H20A 1X8DA 2MGZB 3D9BA 3J80Y 2FGOA 2AQ4A 1N5TA 4IG0A 2WZ1A 3DOKA 4DMZA 2XO7A 1HPZB 1I1GA 3C66A 4LQ3A 4DR3F 3VAHA 1HNVB 4M95A 3EM1A 2RDDA 3H98A 1Z2ZA 1JLFB 4W4MA 1JNZB 1MWYA 3PDNA 1K0TA 2HVHA 3FCWA 1VHFA 1H0HB 1G3OA 2GVDB 4KV8A 2B51A 4O4GB 3DLGA 4Q2LA 5SZTA 4X4TA 4ECXA 4DSLA 1XMOF 3PIOQ 1QM9A 5KFCA 3H7HB 5EN1A 2X3GA 1BQNA 3VZIA 3RZAA 1NMEB 1LWEB 1KLMB 3KK3B 1RWUA 1TK0A 2C42A 2EC0A 3J81U 1S0OA 2E5IA 2YWEA 3NKYA 4IO9Q 3P6YC 3DLLQ 1TKDA 3MM8B 3DLJA 2MTLA 5CYQB 1RT3A 4G3IA 3N6NA 4QR0A 1DTQB 3NGUA 4WZMA 3KDNA 1QVGR 2ZH8A 3AA9A 3HVTA 5I3UA 2HK2A 3DKDA 3N9UC 3MFIA 3HVRA 1XIQA 4AQYJ 4JI2J 4IH6A 3UW1A 2FGCA 2Z2LA 5HJXA 2R8IA 4FYVB 4RUCA 2RQKA 5KFTA 2B5JA 4U8YA 3MZIA 3QPIA 2VFVA 1KD1T 1XMQJ 4JBCA 3ENWA 2KXHA 2CWKA 3DLBA 2PGCA 3W60A 4FYYB 2XNRA 4M5LA 2E1AA 4ED6A 4D3HA 3S8SA 1EZZB 4ZPWR 4I64A 5E41A 2CIMA 2UUAJ 3OVSA 1N6QB 1SJ1A 2RU3A 4OHVA 5C7PA 3LA0A 2XO6A 6FDRA 3GFZA 4Z37A 2OPRB 4Q45A 3FBEA 3QBCA 1CJTA 3EZOA 4DPYA 1NSAA 2C28A 4DX5A 4U6PA 1Q7YT 4Y28C 2XMUA 4FF4A 5FDLA 3BGLA 3OLAA 3CJ8A 2VPWB 4LF6F 3ITHB 5HLFA 2LEAA 3CEDA 1ZA2B 2A2DA 1S9EA 5KFJA 5HATA 5ETSA 2FVPA 3D68A 2XMMA 4F4AA 2JLGA 1VQ6S 1JK9B 1FKPA 4MIAA 2RB7A 2LXFA 4HH1A 2N4CA 4N8OA 3HHLC 3RU0A 2QYCA 6FD1A 4K5RA 4EU0A 2LLZA 2DEIA 3D1QA 4CO2A 2MQQA 3W5XA 3QT8A 1FRHA 4NXMJ 1XNQJ 2PO4A 4F4YA 3KJVB 3IO1A 2V67A 4HHJA 1PG5B 4FYWB 2YNGB 3CCES 2M7SA 2W8LA 3L9ZA 3K7RA 1NK8A 1SIZA 3O8WA 2ZUGA 3OL6A 3UD5A 1GFWB 1SC4B 1KEKA 2ZBCA 2NPIA 3KUHA 4DQIA 2DNMA 3BO2A 2RSQA 3OD2A 2KT3A 1X0FA 4Y2AA 1KHVA 4BCAA 5D4OA 2AW0A 3CJSA 4C8YA 5IWAF 3TVKA 3CE8A 1JXVA 3OL8A 1NAQA 2Y8YA 3I5BA 4LRCA 2DHSA 2DISA 4CT9A 2HS4A 4X4QA 4DR5J 4ZVOB 4JI4J 4QYZJ 4YB1P 3G6XA 4F4ZA 2EC2A 3D7SB 4BDPA 1WHWA 2EK1A 1HQUA 4DX7A 1S97A 1XQIA 4M8LA 2BOPA 4CLUA 1R6VA 2AV5A 5IT4A 3RW7A 2IHR1 1X0PA 3MM6A 3AQPA 1AYEA 4PPZA 5EWEA 3MMBA 4C97A 1ZAXA 5KOWA 1T05B 5JVHQ 1ZH5A 1N52B 2CRLA 2KYXA 3RRGA 4NLVA 1JLQB 3M9OB 2VQFF 1R27B 1PJ7A 2Z4PA 4LF6J 3OR1B 3D3CJ 2W4CA 4ED2A 3TAQA 4V19J 3THVA 3IWNC 4NRUA 2FJWA 4F36A 2PMWA 4CO3A 4RW9B 4OX9F 4PYAA 2LECA 5DM7Q 4F4WA 2FUG9 4ZJQA 1Q53A 1WG5A 1X4DA 4FPIA 2XLKA 3UE2A 2KG0A 1SH0A 1FVSA 4GC6A 1WF2A 5ETKA 1RWXB 2F7VA 3RB4A 4ZJOA 3J81j 5GVQA 2CQ3A 3CPWR 3FDSA 1KS2A 3CVKA 2ABYA 3LP0A 1IM6A 4RJVA 1M5PC 3RBZA 3LP1B 1WOOA 4CP5A 2RS2A 1PC4A 5DZ6A 1VIXA 1RT4B 2EEYA 4NLPA 2DPIA 4I56A 1VRTB 4YFUA 1RLDA 2JH3A 4CYUA 4BS2A 1M5KC 3NL0A 2K7JA 2DGOA 1T3NA 3NCRA 3KLHA 1FCAA 2OPPB 2KN4A 3MDFA 4URQU 4IFVA 3PEJA 4IDKB 3FZ2A 4CO4A 1KQKA 2DR8A 2AX0A 4JI8F 1W26A 1GAOA 4N5SA 5IWAJ 5LJ5Y 2QC3A 4ZCIA 1YZ7A 4O3QA 3VAJA 3K2YA 5AE3A 1M1KT 3NEKA 3VGTA 3SCKE 2F63A 2XSJB 3MAAA 4P52A 4NLRA 2W2MP 2GW8A 3VGVA 1V6HA 2GHPA 1ELOA 1Q1KA 5KFQA 2WTFA 1UCNA 1Q5YA 4KT0C 2MKSA 1X4HA 3CULA 1HBNA 1PO6A 5I3PA 4PG7A 4F0HA 1Q8LA 3Q8QB 3V6DB 3MPWA 1T9YA 4JI6J 3NS7B 2Q3PA 2E7VA 1NB2A 5LM7E 3VVTA 3GJSB 1SJFA 2EWHA 2PD1A 4OYOA 1UWBA 5CZXA 2DGUA 5CCLA 1KHWA 1I94F 1PBUA 2ACMA 1PJ6A 4O3RA 2BJ7A 3IM8A 4DJBA 2HZCA 2HQFA 2DH9A 2V9KA 2J0SD 2OD4A 2XQCA 1S9GB 5HK4A 2CPFA 2YWHA 5JJBA 1QSYA 5KG7A 1ZYQA 1FJ7A 3W3SA 4OX9J 2DR5A 2R7UA 4JB8B 1ZZNA 3DOLA 1T03A 1DARA 1Q4RA 4M5DA 2M8DB 2N4DA 4F7VA 1BY9A 4XDCA 4Q0BB 1N5SA 1XR7A 3HI9A 2CPJA 1RT7B 3UN3A 5EX0A 5F9NA 1UPMB 1R43A 3CD6S 2BJ3A 5DDQC 4DV1F 5I42B 2GA7A 4L75A 1FJCA 2RAQA 2B9XA 3TUIC 4F0MA 5AXLA 4KAIA 5J1EA 4QR1A 5C24B 2G2ZA 4OYZA 2DB1A 4PKDB 2WAQD 2ATCB 2IDLA 1RE1B 3GCWP 4HR2A 4NYPA 2N7YA 3MMCB 4TY8A 4DV3F 4DL2A 4PUOB 3D6HB 4RW7A 1KVIA 2HK3A 3J7A1 5KT7A 4JI8J 3W65A 4IG3A 3NNCA 3H42A 4FS1A 4OX8A 3R7BB 2QX0A 1S57A 2V2VA 3DRRB 3G82B 3CSKA 2VG6B 2EKYA 4LFCF 3C16A 2P8IA 4USHA 1SPBP 1AROP 2C3YA 3NY0A 3D0GE 3AD8C 1DTTA 2MXYA 7AT1B 1MU2A 1LEOA 4J37A 5HQLA 2KU7A 3IGVA 4DCOB 1FRXA 2M0GB 4I68A 5CAAA 5HVHA 4U96A 2DGTA 5KFYA 2IIHA 1C2PA 3MR7A 4ZITA 3G8SA 4USJC 2RILA 3TUJC 2PI4A 4PQUA 2LDIA 1JXEA 2AJ0A 3KLFB 2CWXA 4PG5A 4DSKA 2F5GA 2VKZG 5GMKa 4UUWA 4EK2A 2WRMA 5FLXY 4GKJF 3LPEA 3BEGB 2AJ1A 1D9AA 2MZSA 3GJRB 2MJNA 4EO8A 4RBUA 1NPPA 4RKUC 1I94J 3V6HA 4ILLA 3A12A 3G8QA 4ILRA 1R0AB 4V1Ak 2ZBPA 1VBZA 4H4MA 5IQ6A 1EP4B 2B4UA 2E1CA 3R97A 4RUAA 2JSXA 3W66A 4FVMA 1KC8T 4YB5A 1LXJA 4NLUA 2AGPA 4A8XA 2FVSA 1VQSA 3TZZA 4OLOA 3D4JA 4JOUA 4OYAA 2V8VA 3HXMA 1OPZA 4NA3A 5E3AA 4RR5A 3W2VB 2W01A 2E1MC 1F2GA 4DS5A 2HNDA 2COLA 5D4LA 2WONA 1WDTA 3FKBA 3CWJA 3F73A 4JV0A 3ZFVA 5BYQA 3JYTB 3MPUB 2XHWA 2HS3A 3PJ9A 4DV1J 3AXKA 3ZNUA 3GZ7A 3W2WB 2D3ZA 3K58A 2GJFA 4K4WA 2E66A 3GV5B 1TL1B 4I2QA 2D3OR 2Q79A 1VOMA 2ASLA 3BDEA 3OR2A 4GRSA 3WX8A 1PYTA 5DDPC 2YPYA 5C2CA 3PVXA 3UNYA 1NH8A 3BGRB 2F4VF 1PAUB 4DV3J 1RACB 2XNQA 2K7KA 2WBRA 3TA1A 1EIYB 2RUSA 2A2CA 4LBPA 1J27A 1NO8A 3J7ZT 3KMSA 3DLEB 3CW2C 4M5NA 4U8VA 2DBBA 5A2QU 2Q6CA 4Q2MA 5K9FA 4LFCJ 3M6XA 2VA2A 4Y2CA 4WZQA 3CCQS 4IUFA 5HJYA 4I69A 3GSDA 2RF2A 3QLHA 4R8UB 5B0EA 3ZZYA 1OMSA 3AB4B 3GPAA 1WDDA 2W9CB 5KG2A 3Q8RB 3LANA 2IAJB 3BREA 3AB2B 4CLLA 4OYXA 5HROA 4QJVA 3FSYA 3T1YF 3HULA 2VODA 1DURA 3PW0A 1HBMB 2BW7A 1B64A 4GKJJ 1ZTWA 2V6AA 5IT0A 2KM8B 4P74A 5C25B 2HKEA 3GTYX 1X4CA 1S6UA 2R7QA 4LSZB 1Q82T 2Z57B 3FEYB 1HBUA 2WVCA 1VLOA 5CXTA 2R2UA 3OT9A 1DQ9A 2YWWA 1QAYA 4RW8A 1J2VA 1GNKA 2CPHA 2D9OA 3QGGA 2ZWOA 2Q66A 2OTJS 1PIEA 2XLIA 4FXDA 3BBCA 2H4WB 3NOGA 1VBYA 4DR7J 2V0NA 4IG0B 2PI5A 2V4QA 3WBZA 2GNKA 3DOKB 4HTJA 4B3MF 4NMLA 3PRDA 2BX6A 5IC6B 4J9NA 3PTWA 1PKUA 1NDCA 4DPWA 3G2XA 3NWRA 3GQCA 2VG7A 5DG9A 5K14B 2C3PA 1Q79A 2RJZA 2C2MB 4CLTA 4NPOA 4KV8B 2DCUB 4NL5A 1K1QA 1TAUA 4LRBA 2M2BA 1VC6A 3CCZA 3CJ2A 2XBPA 2WK4A 3GWCA 4LF8F 1M5HA 4HI1A 2F4VJ 1VS3A 4J9OA 1HI1A 4DPXA 4U9RA 3U02A 5B09A 5MLCV 3NXZA 2UVWA 3H5XA 4USKA 1YRUA 2KRRA 3ZNJ1 3EGWB 3FFIB 4PWWA 3NNHA 2I6WA 2WBMA 2HFNA 4CDIA 2DITA 4RU9A 2IJRA 2LVWA 1ZTTA 4J9MA 1AUSL 1FJGF 1QTNB 1RA6A 3NGRA 5DLGA 4C3KA 3CF5Q 2B5JB 4IR9A 2YKMB 5KFLA 1OWXA 3HKWA 4PWDA 4P73A 4QPXA 3DRXA 3T1YJ 1HNXF 1J5OB 3FJ2A 4CLKA 3ZTPA 3IS9B 5F8LA 2HGMA 3FRYA 5F41A 1VGYA 3M8QA 5CYJA 3HSJA 3IRWP 3OPKA 3UCZP 1V3SA 3Q2TC 1HNZJ 4LUBA 4UY85 1Y5NB 3PX0A 4OIXA 4Y0FA 4WTOB 1U2FA 4DQPA 3K5LA 5FDLB 5H9EJ 3P4UB 2H48B 1ZA1B 1QAIA 3CDEA 2VG5A 3M8PA 4FZVA 4O23A 4M94A 3ZZPA 2QL7B 3CD5A 3GR1A 4QOTA 4BBYA 2KO1A 1HW8A 4NA2A 2CDQA 2A18A 3BKTA 1U49A 4Q44A 1H74A 5B7WA 4B3MJ 3IC1A 4JI1F 2RVJA 3RAQA 1FKPB 1NZAA 3M8RA 1MWZA 1YQHA 2JFDA 2UVRA 5DDOC 3FBFA 1FXRA 3CMAS 1MMNA 3I32A 4DFJA 1HYSB 4URGA 4ANDA 1JLAB 5KFMA 3O2IA 1VYAA 4A47A 1QJHA 2XSFA 1APSA 4U7UD 1ZS6A 2ILYA 3VAMA 1FA0A 2RT3A 4RUHA 2OP5A 4L6V3 4ZVHA 3TA2A 3D1OA 1PILA 3ISNC 1K9MT 3VQSA 4WWSA 4LF8J 3V6JA 4WFNQ 2CKWA 1T9XA 5IZHA 2UV8G 5I3QA 3B78A 1UFWA 3POTB 5B0GA 1UEKA 3KK1B 1DAXA 2C2ZB 3TRGA 4DCPB 5KFIA 2J9DE 4AD6A 4K4UA 4UOFA 5L46A 2WSFC 1X4GA 3PY8A 3ICLA 4CH7A 1LNQA 3DDNA 4FXWA 4JI0J 3SFGA 5J2QB 5IOLA 1M5OC 1IKVB 2I5JA 3GV7B 4LR8A 2XYGB 4FXVA 2AYEA 4I67A 3RAXA 1SJ3P 3Q22A 4TNOA 1NHVA 2NXCA 2O3DA 2BJDA 1H2VZ 5HQMA 4PXDA 3BGFA 4U95A 1UL3A 3NAHA 1X9MA 2KVIA 5A6PA 4KO0A 2MYFA 2XC9A 1GXLA 1B3TA 4OZ1A 1S76D 2PIIA 1DRZA 2CNKB 3KJQB 4DR2J 1TKXB 3ET6A 2E5LF 1U1NA 4G1PA 4A8QA 4OYPA 5H9FJ 2F8EX 1UA0A 1RAJA 3TWZA 3HM9A 5F8GA 3SCJE 1RAEB 1JWWA 3PJXA 2YH1A 3UCGA 2KJVA 1B7YB 1RT6A 2DNOA 4QCLA 3UDEA 5KFGA 1OQ6A 4J9QA 1IN0A 1U1RA 1WWHA 2YKQA 4ED7A 1VC0A 1KOHA 3RB3A 2VV5A 1SL2A 1RYRA 4F4KA 2AEJA 4JYAF 3NG8A 2QSWA 2FYXA 5JVGQ 1CULB 2QTWA 1IWGA 1E6YA 4NLYA 1CJKA 5DDRC 3MM5B 3V81B 3N79A 1LXNA 3VV2B 4OZ5A 2HLUA 5ETTA 4KB7A 2BJ8A 3CD0A 3CCVS 4G1QA 5T14A 5L39A 1RAOA 4ZVTB 3SI8A 2IA0A 2XWXA 4DG1A 4AL5A 1NK5A 2JHEA 3LWLA 1VBXA 3NBPB 3SFUA 2JWNA 2HHUA 2VPXB 1IBKF 1HQEA 1XNRF 4DFKA 1SKRA 2GJ2A 2B56A 1BQXA 1FKOA
chains in the Genus database with same CATH topology
3HD2A 1F9HA 4CWBA 4CYUB 1EQMA 3HSJA 2F65A 4AD6A 1G4CA 1KBRA 2BMBA 5ETSA 3HSDA 4M5HA 3HT0A 3KUEA 1HQ2A 5ETQA 3KUGA 3KUHA 3UDVA 1EQ0A 4PZVA 1RU2A 3ILLA 4CRJA 1RTZA 4M5IA 3MCOA 5ETVA 1IM6A 4CYUA 1EX8A 3HCXA 3MCNA 4M5JA 3HD1A 5ETTA 4F7VA 5ETOA 5ETMA 3ILOA 1TMJA 3ILJA 3QBCA 4M5MA 5ETKA 3MCMA 4M5NA 1CBKA 3IP0A 1HKAA 2CG8A 5ETPA 5ETLA 5ETNA 1RAOA 4M5LA 2F63A 3UD5A 3UDEA 1Q0NA 5ETRA 3HSZA 2QX0A 4M5GA 3HSGA 1RB0A 4M5KA 1TMMA 1RU1A 1DY3A 3ILIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD2 A;  1F9H A;  4CWB A;  4CYU B;  1EQM A;  3HSJ A;  2F65 A;  4AD6 A;  1G4C A;  1KBR A;  2BMB A;  5ETS A;  3HSD A;  4M5H A;  3HT0 A;  3KUE A;  1HQ2 A;  5ETQ A;  3KUG A;  3KUH A;  3UDV A;  1EQ0 A;  4PZV A;  1RU2 A;  3ILL A;  4CRJ A;  1RTZ A;  4M5I A;  3MCO A;  5ETV A;  1IM6 A;  4CYU A;  1EX8 A;  3HCX A;  3MCN A;  4M5J A;  3HD1 A;  5ETT A;  4F7V A;  5ETO A;  5ETM A;  3ILO A;  1TMJ A;  3ILJ A;  3QBC A;  4M5M A;  5ETK A;  3MCM A;  4M5N A;  1CBK A;  3IP0 A;  1HKA A;  2CG8 A;  5ETP A;  5ETL A;  5ETN A;  1RAO A;  4M5L A;  2F63 A;  3UD5 A;  3UDE A;  1Q0N A;  5ETR A;  3HSZ A;  2QX0 A;  4M5G A;  3HSG A;  1RB0 A;  4M5K A;  1TMM A;  1RU1 A;  1DY3 A;  3ILI A; 
#chains in the Genus database with same CATH topology
 3MUR P;  5L1I A;  3LP0 B;  1Y11 A;  1OPI A;  2KXF A;  1UP1 A;  3T1H F;  2J9C A;  1IVZ A;  1U09 A;  4OV1 A;  2JVO A;  1Q5V A;  1GEH A;  2DTJ A;  1C0T B;  4LSL A;  1WC5 A;  4EWT A;  5A0Y A;  4F26 A;  5H9E K;  2X1F A;  3RR7 A;  3EXC X;  1F3V A;  4NZ0 A;  5HAN A;  2UVU A;  4IFV B;  3LP2 A;  3R2D J;  1JKH A;  3I0R B;  2HWT A;  3ZZ0 A;  4OJ3 A;  3GIK A;  1W7W A;  4K2X A;  2FLL A;  1X9W A;  2F65 A;  1VQ7 S;  3NGS A;  3UPF A;  4H4O B;  4ZVR B;  2HRY A;  3MAA B;  2RUG A;  3JSR A;  3PRV A;  3ENQ A;  3IFE A;  2DHG A;  2IRY A;  2KYZ A;  5ITH A;  2YKP A;  2XB2 D;  3UVJ A;  2DVI A;  4WKR A;  2C2O B;  1UJ4 A;  2PEB A;  3GIR A;  3IBF B;  4OZL A;  1JLC A;  2HFO A;  2W25 A;  2XZD B;  2E5L J;  1QUV A;  4CTA A;  2UXD F;  5HVG A;  4ECR A;  2FDN A;  3BR8 A;  4WFB Q;  2ALZ A;  1U0H A;  4LT6 A;  5HBM A;  3AH6 A;  2I2Y A;  4QWD A;  4QIE A;  2PT0 A;  4LRD A;  3RAM A;  1K44 A;  3I56 S;  4QIG A;  2XHC A;  1UWB B;  1PBA A;  4I2P A;  2NS1 B;  2Z58 B;  4OZN A;  1NK0 A;  3BDP A;  3EVW A;  1YVF A;  1QAJ A;  1T8E A;  1RBL A;  2XYH B;  3OHB A;  1YTY A;  4ER8 A;  4ZP7 A;  4ED8 A;  4QW8 A;  3EJM A;  5DZ7 A;  3RBE A;  1QE1 A;  2V8D A;  4ECS A;  3I31 A;  4ZA1 A;  4AE5 A;  2CQI A;  4KIA A;  3AJ2 A;  4M5D B;  3EX7 B;  3SSR A;  2XTJ P;  1VQP S;  3QO9 A;  2YX4 A;  3VAL A;  3UCU P;  3M7V A;  5IV3 A;  2V2Q A;  2M88 A;  4RLE A;  1SJ4 P;  2J8S A;  1C0U A;  4UST A;  4WXO A;  5D4P A;  4LBH A;  4I6Y A;  3RJM B;  1REV A;  3OTB A;  1K0V A;  1IBK J;  4DUY F;  1WOR A;  1XNR J;  2DGW A;  5I4M A;  2R4F A;  3W1Y C;  1VC5 A;  5H9F K;  2CYY A;  3PZP A;  3M1V A;  2R8K A;  2OPQ B;  3IMQ J;  3GJT B;  1MSW D;  1BHN A;  2QT7 A;  3O6Q A;  2D1C A;  5J1E B;  3KJF B;  3MEC A;  2J6T A;  1HQ2 A;  4DV0 F;  1LFP A;  1UVM A;  4F8R A;  2CQD A;  3A8I A;  4FS2 A;  3MED A;  3ZZZ A;  1VHI A;  2A6M A;  3CGI A;  2Y1R I;  4IH7 A;  1C1C A;  3QWP A;  4TY8 B;  1N0V C;  2GAG C;  1SUQ A;  4RW7 B;  3N5F A;  2CAJ A;  1IR1 A;  2B7C B;  4ELU A;  1VQ5 S;  4B9V A;  2HS0 A;  3W9H A;  1FER A;  4UF4 A;  3PNI A;  2B43 A;  4KGK A;  4WK1 A;  2E44 A;  1RHR B;  4IFY B;  2MZT A;  2V2Z A;  3PHT A;  2G0J A;  4OHX A;  5F8H A;  4YDD B;  3AFG A;  2CPE A;  3GYX B;  1XC9 A;  4P72 A;  1XJW B;  2KKH A;  1YJ9 S;  4QQB A;  1N36 F;  5L1J A;  4WKY A;  1TKT A;  1PCA A;  1S99 A;  3EDR B;  4RBV A;  2QA4 S;  3T5L A;  3DCA A;  4B08 A;  5FII A;  5F8I A;  2UXD J;  2QLW A;  4QU6 A;  4YR3 A;  1NDP A;  4M5G A;  3EGV A;  1TUG B;  3GG1 A;  4R25 A;  2R2S A;  2VPZ B;  2ZZM A;  2BJ1 A;  2GGP A;  2YWK A;  4OX6 A;  1U2R A;  1FT8 A;  2A10 A;  2HHX A;  2K1R A;  2CJ9 A;  3OHA A;  1S6Q B;  4JI3 F;  4NLS A;  4ZCM A;  3FEX B;  2MHN A;  2DXD A;  2D3O 1;  2QRR A;  2MZQ A;  3MEG A;  2IVY A;  3HMJ G;  3C2P A;  1CC8 A;  2QZ8 A;  3GYN A;  1RAG B;  3JXO A;  2RRB A;  5T7L A;  1R7I A;  5KT6 A;  3JSM B;  4O44 A;  4DI6 A;  2DRB A;  3PG9 A;  2AX1 A;  4WTY A;  1UJ5 A;  4J9V A;  4OMF G;  2H3E B;  2GIQ A;  2AJQ A;  4EUV A;  3LGM A;  2JFK A;  2WON B;  4DUY J;  3LGH A;  3FGV A;  1MRO A;  3BSC A;  3LW5 C;  4EEY A;  2E1P A;  4TQS A;  4C2M A;  1T9T A;  4B9T A;  2H4Y B;  4PQA A;  4YHH F;  4DF8 A;  1P8G A;  1BQM B;  1FO1 A;  2W7P A;  2D9P A;  1WTB A;  4C8O A;  4CNZ A;  5LXY A;  3Q89 A;  1KVK A;  3OR2 B;  3GLJ A;  2DO0 A;  2V4J B;  3ZZO A;  4TKT A;  2QGF B;  1IQT A;  3K17 A;  2YWF A;  1GT8 A;  4UQG A;  3R5C A;  3QIP B;  3L09 A;  1QUP A;  1HWI A;  4XPC A;  1A7G E;  3SDE A;  3KLI A;  2AMC B;  4ZPC A;  2VIH A;  2XCP A;  4EBD A;  5K8N A;  1GTH A;  2XMT A;  3M9M B;  1JJH A;  3R5G A;  1I6J A;  3RGI A;  3B4D A;  4KY3 A;  3HFV A;  2A3J A;  5E7O B;  4OZJ A;  3LAK A;  2HFU A;  1VDH A;  4LSN B;  4C48 A;  2RF2 B;  3QLH B;  3C6T A;  3S01 A;  4ZHR A;  5D77 A;  3KK2 A;  2KHC A;  4F67 A;  3JAM Y;  5AT1 B;  2ZH5 A;  1N36 J;  2OEM A;  3QSY B;  3QRP A;  4N77 A;  2CNO B;  4TLQ A;  2J5A A;  4RNF A;  2HRU A;  2HVD A;  3VQT A;  3MM7 A;  4FP9 A;  2VB6 A;  4F3Q A;  1SJQ A;  5HRO B;  1RCX B;  4DQR A;  1WF1 A;  1VLY A;  5KT3 A;  2CPI A;  3H25 A;  5GME A;  2EVZ A;  4QYR A;  4QWB A;  2BAB A;  1C4C A;  1TP7 A;  1U02 A;  4TYA A;  4JP8 A;  5U47 A;  1TL7 B;  3R5D A;  2R42 A;  4FBU A;  2GCF A;  1RK8 A;  5ETO A;  4IQX A;  3O3L A;  4P2X A;  4JI3 J;  1Y3K A;  4H4K C;  3AD7 C;  5CYM B;  2RDI A;  3QAU A;  3QJJ A;  3LAL A;  4MK8 A;  3ZTR A;  4NXN F;  5CHC B;  4DV7 F;  4ZJL A;  1TR0 A;  2YQ3 A;  3GII A;  4Q8E A;  5HVF A;  1G1X A;  3KMQ A;  2W7O A;  5AJ3 J;  2DNR A;  2JEI A;  1FES A;  1WHV A;  2IM2 A;  3M30 B;  2QL9 B;  3GR0 A;  1S6P B;  4ID8 A;  1IBM J;  2JC1 A;  4LF7 F;  5IC4 B;  1DZ5 A;  1R31 A;  1VRU B;  5HO4 A;  4F50 A;  3DGP B;  4GO5 X;  2A6O A;  2G13 A;  1M0S A;  2VG7 B;  1DLO A;  4PXE A;  4DDF A;  3T41 A;  2JOQ A;  4KH1 B;  1LW0 A;  2CZ4 A;  1EX8 A;  2YTC A;  3NMR A;  1TKZ B;  1Y4Z B;  2ZOG A;  2VH7 A;  3I5A A;  1RXO B;  3MPV A;  1CJV B;  1WF0 A;  3QJP A;  2FJE B;  3DYA A;  1J5E F;  1NDL A;  3DMJ A;  1TL3 B;  3CB4 A;  5GAE I;  2Q43 A;  4HLB A;  4YB7 A;  1WKK A;  2OAU A;  2YBV A;  3HHE A;  1WUU A;  4I4B A;  2Z0G A;  1ZBT A;  2WB1 D;  1IQZ A;  5J2M A;  4KKO B;  2LEP A;  4CM0 A;  3B4M A;  2G0I A;  2XGQ A;  2GS8 A;  2E1R A;  2VFU A;  2V69 A;  2VJV A;  2VOP A;  2C2K B;  1N54 B;  1WJ9 A;  2MLX A;  1RCO B;  4C9D A;  4MAK A;  1IKX A;  2KFY A;  1TK8 A;  1IXK A;  5KFO A;  3GV8 B;  3NCQ A;  3IP0 A;  2UXB F;  2HFV A;  1C4A A;  3DHX A;  1G6B A;  3C15 B;  1HA1 A;  1CQM A;  1BWE A;  2B9W A;  3J7A N;  1WC3 A;  3KHL A;  4MIB A;  4LRA A;  2HQ3 A;  2WOM A;  2E29 A;  3QRQ A;  3FQK A;  1D9D A;  2W2N P;  3A8K A;  1SKS A;  4DZD A;  2YVS A;  2CA9 A;  1Y5L B;  3K5N A;  4NXN J;  4DV7 J;  3PYE A;  3CDU A;  1OY6 A;  3M8P B;  3TAP A;  2BYC A;  1QY7 A;  4ICL A;  2WVE A;  2DGV A;  2IM1 A;  3RB6 A;  2BM1 A;  2EI5 A;  2WCX A;  3P8B B;  4O3N A;  2BQR A;  1HMV B;  1CVJ A;  3AD9 C;  1JLB B;  4LF7 J;  3TR5 A;  1NK4 A;  2R7T A;  3E8O A;  2C2E A;  5RUB A;  1UFK A;  2W2O P;  1RHQ B;  2Z8Q A;  5DJB A;  1KVJ A;  3L4B C;  1N4L A;  4DN9 A;  1Q81 T;  3MM9 A;  4M5K A;  3PR5 B;  2RRA A;  4K4T A;  4ZLN A;  1VQ8 S;  2HQD A;  1T94 A;  2GO9 A;  4OI3 A;  2CQC A;  2NSC A;  5BXI A;  1RTH A;  2CG8 A;  3A3N B;  3KNG A;  1D09 B;  5HMW A;  2FY8 A;  1JLG A;  3HHD A;  5F3T A;  2CVI A;  2CVE A;  2OH2 A;  1YJT A;  4MJK A;  4K4S A;  5E3R A;  2BA9 A;  1J5E J;  3VAI A;  5DRK A;  4J9U E;  1CJU A;  5KT2 A;  4FF2 A;  3LTO A;  3ILI A;  1YJU A;  1SC6 A;  2Q6B A;  1U6B A;  4RNH A;  5B0C A;  2FY1 A;  2LYV A;  1S77 D;  2BV3 A;  2PMZ D;  4CLP A;  1ZM4 A;  2XEX A;  3HVA A;  1C1B B;  2MKJ A;  2O01 C;  3GON A;  1NJI T;  3BYR A;  1ULR A;  3BKU A;  1VFJ A;  5KFR A;  1VK8 A;  4X66 F;  1U1Q A;  4K8R A;  1MN7 A;  3AOA A;  3SV3 A;  2FQQ B;  2V34 A;  1JLE B;  1FRK A;  1S1X B;  2FIU A;  4GKK J;  3TAM B;  4CM2 A;  4OHY A;  4DN0 A;  1DHM A;  3LGN A;  1WI6 A;  1RYS A;  4IR1 A;  3VGU A;  4P2F A;  3BPS P;  3D54 A;  4CNY A;  4I7F B;  3WC2 A;  4F0K A;  1FHT A;  4ED4 A;  3LAM A;  1S7I A;  4ZK7 M;  5IV4 A;  3PHE A;  2HHV A;  1RT2 B;  2LU2 A;  4WU3 A;  4ENO A;  4X4N A;  1YBT A;  5HMX A;  1RT6 B;  3HKZ D;  3SSS A;  3VF0 B;  1NM2 A;  5IM0 B;  3ILJ A;  1ZM9 A;  5KFS A;  2MZJ A;  1JJ4 A;  3KHH A;  3HO1 A;  2ADB A;  1OY9 A;  5HQ8 A;  2L9D A;  4TN2 A;  4CH1 A;  3IAS 9;  4E98 A;  5A8K A;  1N33 F;  2DR9 A;  4YOE A;  1WI8 A;  2CFX A;  1Q95 G;  1D8Y A;  1BD6 A;  1YGY A;  2B9E A;  4NLX A;  3UN2 A;  1R8C A;  2KG1 A;  2ZJQ Q;  4CRJ A;  2OIH A;  4DLG A;  2F1F A;  3IR5 B;  3K8V A;  2FJX A;  4MFB A;  3DM2 B;  2HNZ A;  4LIR A;  4X4O A;  4ED3 A;  1TL5 A;  2ZE2 A;  2BUN A;  4Q43 A;  3PV8 A;  5KFF A;  1HQE B;  4B17 A;  2G1D A;  4NLD A;  2F4F A;  3WIV A;  7FDR A;  3O44 A;  4HT7 A;  5LSL A;  3OBI A;  4B9N A;  2KZZ A;  1S5Z A;  5H1S V;  4LQ9 A;  1T95 A;  2VQE F;  3PO4 A;  4HH0 A;  2Y0S D;  4CQ1 A;  2UVV A;  3BZQ A;  3ZXW A;  1HWL A;  2HFZ A;  1FF2 A;  3JS9 A;  2YNF A;  2RQ4 A;  4LSL B;  4LF1 A;  3HLU A;  5A0Y B;  4USV A;  2HBQ B;  4Q7A A;  5GAG I;  5EUH A;  3AY0 A;  5LMN F;  1DQ8 A;  3LP2 B;  3CXC R;  1JKH B;  3CCU S;  3I87 A;  1QDU B;  2IDE A;  3TX8 A;  1U8S A;  1FRJ A;  2ZKU A;  2I38 A;  3RB0 A;  3U7J A;  2MY7 A;  1HPZ A;  3MR6 A;  3OXL A;  1RTI B;  5KG0 A;  5K8P A;  4C3M A;  4Z7Y A;  1HNV A;  2YNI A;  4OHZ A;  1NRK A;  1RWV B;  1X4A A;  4CLZ A;  2AIR B;  3I9V 9;  1TVR A;  4LFB F;  1JLF A;  3C46 A;  3OL7 A;  3JTP A;  2HGL A;  3G71 S;  3TZY A;  8RUC A;  2GHW A;  4MKV A;  1O51 A;  1K73 T;  2GVD A;  3IG1 A;  2W8K A;  1N5V A;  4U67 Q;  3CCT A;  2P9C A;  1JLC B;  1P1T A;  4O4G A;  3CJ5 A;  3SBM A;  4UQT A;  1UWA A;  4CTA B;  2G1H A;  2BXJ A;  2RKI B;  5EWG A;  2C3O A;  4LBI A;  1U0H B;  4C8N A;  3V4I B;  2R7S A;  1ITP A;  2OMO A;  2U1A A;  2CG4 A;  2XS2 A;  4K0K J;  2AWZ A;  4I2P B;  4X84 A;  4XK8 C;  3D66 A;  3CIZ A;  2UXC J;  3A13 A;  5F8N A;  3MM8 A;  1F2H A;  3G87 A;  5CYQ A;  3M32 A;  3FC9 A;  1D9F A;  1VQO S;  1UEU A;  4LF4 F;  1X5O A;  1CQN A;  2IBO A;  1N33 J;  4IKA A;  4NMX A;  3N0V A;  1QE1 B;  3RRK A;  2EFQ A;  2PMH A;  2HWI A;  4BC7 A;  2JL9 A;  3KKF A;  2YNH B;  2VBW A;  1HHT P;  3L7U A;  3J7Y I;  1TUV A;  4WP8 A;  3OW2 R;  2ZH7 A;  3WZ0 A;  4B9L A;  4OJH A;  2XS5 A;  2ZM6 F;  2RQM A;  5THW A;  5GAH I;  2X1G A;  1C0U B;  1REV B;  3CCW A;  3N28 A;  2BQU A;  3TJ9 A;  2CJA A;  2E5G A;  3OFF A;  4EMD A;  5DM6 Q;  3CO0 P;  1LWF B;  4ZVG A;  3CDB A;  2ZBR A;  3M1V B;  2YKO A;  3OFE A;  4RW6 A;  1RTD A;  1FFS B;  1RWM B;  4KHP F;  2DK2 A;  4NWB A;  3Q2S C;  4MIW A;  4NCG A;  3U27 A;  2DGQ A;  1DQA A;  4AL7 A;  4X65 J;  2VC0 A;  2MQL A;  3KG4 A;  4E0D A;  1R6Y A;  3MED B;  4TU8 A;  1Q78 A;  1CG2 A;  1YWX A;  1OJ4 A;  5LMN J;  1SL0 A;  1SUQ B;  3CCJ S;  4DU8 A;  3BGU A;  2G2O A;  4Y00 A;  5AXN A;  1AFI A;  3OQ2 A;  5IT9 Y;  2H51 B;  3HT3 A;  2ZHA A;  1IKY A;  4OI4 A;  4QZV B;  2ZH4 A;  5DO2 A;  4YR0 A;  2BR0 A;  4QW9 A;  4WK3 A;  2M3D A;  3F44 A;  2RNE A;  2IY5 B;  1X7V A;  3QT6 A;  2VZ9 A;  2V68 A;  1B99 A;  4JV2 A;  4DR3 J;  1S4F A;  3QQC D;  4LFB J;  2IVM A;  1RI7 A;  4GVB A;  2ADC A;  5GAE U;  1AB8 A;  3SMZ A;  4LIW A;  4NZ6 A;  3HFZ B;  1TKT B;  1S1U A;  1YX2 A;  4ZKA A;  3HD2 A;  2VD3 A;  4F2S A;  2QMW A;  2QLF B;  4DX8 H;  3MFH A;  5KTQ A;  4YUD A;  3CJQ A;  3VHQ A;  1VCT A;  2MKH A;  1XMB A;  3M2U A;  2MKC A;  3DXB A;  1XMO J;  4KGZ B;  5ETQ A;  4WP9 A;  2B3T B;  5A8W A;  1N32 F;  3A1Y G;  2G0C A;  3NAI A;  1RAD B;  1NDK A;  4ANE A;  4DSI A;  1HNI A;  3W9J A;  2GIF A;  4R0J A;  4QU7 A;  2ZFH A;  1YSJ A;  2PEH A;  2MPU A;  4LF4 J;  1NXI A;  4EO6 A;  5CA5 A;  4C11 A;  2QN6 B;  2E7W A;  2AZ3 A;  2R2R A;  3MMA B;  3A8J A;  4O44 B;  2P2C B;  1FK9 B;  3KHR A;  2XMW A;  3MUT P;  3M9N B;  2POK A;  1RJJ A;  1O5J A;  2VKR A;  2R3V A;  2AF6 A;  1D3W A;  2VJU A;  4GC7 A;  3K59 A;  5B0D A;  2C3U A;  3UR3 C;  4NYO A;  1SB6 A;  3IRX B;  1BWV A;  4BHQ A;  4J7C A;  1EET A;  2EFG A;  4KHP J;  3DU5 A;  2IM0 A;  2MHE A;  1LW2 B;  4M5H A;  1Y0H A;  1T05 A;  1YJW S;  2UP1 A;  3PKY A;  3UWT A;  2AEM A;  3TQ1 A;  3DFE A;  3IGN A;  5KFE A;  3CJ3 A;  1NPK A;  1KRP A;  3FK4 A;  4DSE A;  2F8H A;  4ZPA A;  5EX3 A;  4X4P A;  1RIS A;  2D74 B;  5J2P B;  1KTV A;  3SDE B;  3KLI B;  4JV5 F;  1NJY A;  1TV6 B;  2LKZ A;  1XK8 A;  2K06 A;  2HGN A;  4ZPD A;  3G9C A;  4A8K A;  4A46 A;  2QV6 A;  1HR0 F;  1UFL A;  2VL1 A;  3QRR A;  4WP3 A;  1NPR A;  3ZC4 A;  4FNI A;  4O3O A;  4DR1 F;  4DV2 F;  4DL6 A;  2ACY A;  2RS8 A;  1V5I B;  2MLZ A;  2R7O A;  3WQP A;  2N3L A;  2YH0 A;  2Z2Z A;  3KK2 B;  2MQM A;  4K4Y A;  3RBD A;  4C8Z A;  1SI9 A;  1IR2 A;  2W4P A;  1R8P A;  1U48 A;  4C6A A;  4NCB A;  3EE3 A;  3CCR S;  2CZ9 A;  4B3S F;  4N47 A;  3OL9 A;  1RBA A;  2Y8W A;  1M1H A;  1IKW A;  2LFV A;  3H5U A;  4B02 A;  3DNC A;  3UD4 P;  3M2V A;  4N56 A;  2GV1 A;  5ETP A;  1VRT A;  2CUY A;  1N32 J;  3A8E A;  4AXJ A;  1U1M A;  3G86 A;  2KXN B;  2QA2 A;  1HFE L;  2MQP A;  1PYS B;  3OLB A;  2V8H A;  4U7U K;  1GTE A;  4FKX A;  2GQ2 A;  4XDD A;  4EBC A;  1RWP B;  2CAD A;  3GFY A;  4PRF A;  2OSR A;  2EFP A;  1QVF R;  1A6L A;  2XSJ A;  5E3C A;  2OFG X;  4ZS6 A;  3SZ2 A;  3VGS A;  3HCX A;  2HIQ A;  3HHL A;  4YEA A;  2CNN B;  2EFO A;  3OSN A;  4DPO A;  3W62 A;  4ETX A;  1H2T Z;  3I0S A;  1U2C A;  2GVZ A;  1WSV A;  2H5I B;  3V4M A;  4C0B A;  1GXT A;  3US5 A;  4HTI A;  3TVY A;  4QIF A;  1N56 A;  2NYI A;  4RNN A;  1NHK L;  1DLO B;  3M8Y A;  4R5P B;  1TK5 A;  2AGO A;  4IOB A;  2J7W A;  4N41 A;  3JQK A;  1VR6 A;  1N48 A;  1FNO A;  2V5H G;  3HT0 A;  1FWP A;  4MKB A;  1EB0 A;  1NEE A;  4AFF A;  1UAW A;  3F56 A;  3CJ4 A;  1WC0 A;  2RIJ A;  5HL7 Q;  1RKJ A;  4I6W A;  4DS4 A;  4OI2 A;  3BB5 A;  3U1N A;  4O4R A;  4F25 A;  4ELT A;  2DR7 A;  1GMU A;  1OSD A;  3NS6 A;  3G8T A;  3DYA B;  2VQF J;  2BDP A;  2DKO B;  1RT5 A;  3KLE A;  2EPI A;  4JV5 J;  1L3V A;  1YI2 S;  2LQ8 A;  3ISZ A;  3ETM A;  5LJ3 Y;  2NUU G;  4ECZ A;  1JMT A;  4BWM A;  4M5I A;  3MCO A;  1HR0 J;  2HHP A;  1RAI B;  3IAM 9;  2KTQ A;  3ZZU A;  3DLK A;  4DR1 J;  4DV2 J;  1KQF B;  5J2M B;  1ZOT A;  3TVZ A;  2W7A A;  1X5P A;  2RH3 A;  4Q0B A;  2HG4 A;  4ZP8 A;  5GAG U;  2HLT A;  1RT7 A;  3BSO A;  1UVI A;  4WCE Q;  3WDO A;  3EYZ A;  3MCS A;  3PYG A;  3QNW B;  2V8G A;  5A8R B;  3SXL A;  4M63 A;  4CT8 A;  1KR4 A;  4WJB A;  1T9U A;  5I42 A;  1JXL A;  4B3S J;  1NK9 A;  1IKX B;  4RW4 B;  2FC9 A;  4WFX A;  5C24 A;  3OUY B;  4F3O A;  3HJF A;  1YBA A;  8ATC B;  3GYG A;  2JLE A;  5B08 A;  5EWF A;  2KRB A;  4R0E A;  3T6B A;  1SBR A;  3MR5 A;  4KJI A;  3MMC A;  4W92 B;  1FTC A;  2BJE A;  4PUO A;  2BBE A;  1LWC B;  2QJ3 A;  1U24 A;  3TA0 A;  1YRX A;  3FSX A;  4KFB A;  4YP3 A;  2XI2 A;  2B6A B;  2KM8 C;  2V8P A;  1TUW A;  2HVE A;  4L74 A;  2DNY A;  3Q8V A;  3G82 A;  3P3D A;  4NI2 A;  3ENV A;  4P75 A;  5DGB A;  1R3N A;  3BBF A;  1X31 C;  3TEH B;  4DL7 A;  1Q0N A;  3GIL A;  5CCM A;  2C2N A;  3SYZ A;  3BKF A;  5D15 A;  1F60 B;  3UNG C;  1HAR A;  3J81 Y;  3HD1 A;  3HHL D;  4TVA B;  1NUE A;  2BE9 B;  2JNJ A;  3MCM A;  1D8Z A;  4BWJ A;  1S1W B;  2NZC A;  1P1L A;  1OY8 A;  2HBY B;  2VFR A;  1Z4U A;  1W2B R;  1U47 A;  2DHA A;  1JJ2 R;  5JXS A;  4D3G A;  3SSQ A;  5KG1 A;  5IXU A;  1NK7 A;  1B7F A;  3OVB A;  3J7Y U;  1I5O B;  3CJR A;  2AHO B;  4AL6 A;  1RAB B;  4N7T A;  5HP1 B;  2DD8 S;  3L3C A;  3D6F B;  5GAH U;  4P2M A;  4FYD A;  3VR1 A;  2ZNZ A;  2H5E A;  1JLG B;  3ONQ A;  4HI2 A;  1AT1 B;  4B3T F;  1R0A A;  3BPD A;  2HAI A;  4Z2X A;  4ZVP B;  1EP4 A;  1YDL A;  2LA6 A;  1S1T B;  2IM3 A;  1CJU B;  2HQC A;  2BE7 D;  2BE2 B;  4ECY A;  4DV5 F;  2MQN A;  1NKC A;  1WG4 A;  3PX4 A;  2XWY A;  1FRM A;  4KR0 B;  2L48 A;  2MST A;  2DNP A;  3W2V A;  1SJR A;  3JTO A;  5FJ4 A;  2MLY A;  5KG5 A;  2YQ1 A;  4ALZ A;  1T9V A;  3VVU A;  4ZVE A;  2Q1L A;  2Z56 B;  4PYD A;  3I4H X;  3PFO A;  3W2W A;  2APO A;  3HZE A;  4HDH A;  3NNA A;  2HHQ A;  2MY8 A;  3B6B A;  4EYH B;  4CCH A;  2HQG A;  2OFH X;  3EZ5 A;  1IJF B;  2OEL A;  3HJV A;  4ERD A;  4ES1 A;  3I5C A;  2NXU A;  2ZC3 A;  2W9B B;  3BGR A;  1HKA A;  1SV5 B;  3IM9 A;  3GSI A;  2LA4 A;  4ECW A;  4DHV A;  2CJX B;  3MMJ A;  3JTN A;  3QAT A;  3BBB A;  3CIM A;  2BRL A;  2VDH A;  2F40 A;  3SCL E;  4LF2 A;  2ZOM A;  4YN3 B;  4I6A A;  1R0B G;  4IQM A;  2SXL A;  3IBW A;  5A8K B;  5G0R A;  5KFB A;  2OML A;  2FJD B;  4W98 A;  1FVQ A;  3GFH A;  1Y00 A;  4CLW A;  4R8U A;  3EXY A;  4RNM A;  2W9C A;  2RE1 A;  2HNZ B;  2OI2 A;  4IRC A;  4E2F B;  2ZOF A;  3QZ8 A;  3OTD A;  3KXD A;  1HIY A;  3MOJ B;  3Q8P B;  1VRQ C;  1XMQ F;  2VPY B;  4UUX A;  2UU9 F;  1KFS A;  1P6T A;  2ATL A;  1BGX T;  5JMN A;  4DX6 A;  2JEF A;  1OQ3 A;  3S6E A;  4F4X A;  3I96 A;  4G6V B;  5C25 A;  4NOH A;  3DOM A;  4P6Q A;  3RYL A;  3PO5 A;  3MWB A;  5D0E A;  4P10 A;  3R2C J;  2HPU A;  2YNF B;  4B3T J;  1RAF B;  1RTJ A;  3C14 B;  2E9T A;  5BR8 F;  1X5S A;  2EG2 A;  5C5J A;  2LXU A;  2Y1L B;  4DV5 J;  5D4N A;  2VAS A;  4P71 A;  3KG1 A;  3IWL A;  1PYO B;  4FPR A;  2BAN A;  2ZHB A;  5ETM A;  2QLX A;  5D0R A;  2MEW A;  3MGJ A;  2YNI B;  4KYZ A;  3R7S B;  4F02 A;  2J0W A;  1NB7 A;  3G4S S;  1TVR B;  5K14 A;  4EZ6 A;  3E51 A;  3IG1 B;  1X4E A;  1X5T A;  1YJN S;  1NND A;  4NXM F;  1XNQ F;  2IBK A;  2H54 B;  2KB2 A;  3I82 A;  2OJ3 A;  3T9N A;  2R7R A;  2GQQ A;  1L5U A;  1S0V A;  4IRD A;  4DSF A;  4KH0 B;  3DLG B;  1Q8K A;  3EZU A;  1GX6 A;  4WPA A;  1I51 B;  1E6V A;  2Z2M A;  4X4U A;  2R7V A;  5K20 B;  1BQN B;  4Y2K A;  1R0C B;  2R7X A;  3QT7 A;  3H8Y A;  2CDR B;  1YJV A;  3GG0 A;  4NLT A;  3R8Y A;  3M32 B;  2HFS A;  4OL8 A;  2XY5 A;  3H2V E;  2I9S A;  4M5M A;  4M1K A;  1H7W A;  3JB9 k;  3B8H A;  3FFI A;  5CD4 H;  1HBO A;  5GAD I;  2UUB F;  3A3O B;  2I1R A;  1RT3 B;  1KBR A;  3DLH A;  4J90 A;  4DR5 F;  1KP6 A;  4JI4 F;  2C3M A;  5D0H A;  1UET A;  4TQR A;  3HVT B;  2ZZT A;  5I3U B;  4FNH A;  4ZN1 A;  1F5B A;  2VBY A;  2X51 A;  2X1A A;  4OI1 A;  1U6F A;  5FLX U;  4YME A;  2YKM A;  2KDO A;  4DL3 A;  1ZAW A;  2VUG A;  1D1U A;  4YQW A;  2UU9 J;  1J5O A;  3H40 A;  1MG7 A;  3RUB L;  5HMZ A;  2JC0 A;  3QMQ A;  3RG6 A;  4CLS A;  1H6K X;  4RW6 B;  1CEZ A;  1RTD B;  2YPZ A;  3OV7 A;  3IS9 A;  3PX6 A;  3TZW A;  4NCG B;  5KFP A;  1FX2 A;  1WEZ A;  2F9D A;  4NEY A;  4Y2I A;  2C22 A;  3QFW A;  4QWC A;  3W9I A;  2P6S A;  2HVZ A;  2NRE A;  1WHX A;  2H9Z A;  1G7C B;  2Z30 B;  3HSZ A;  5AE1 A;  5BR8 J;  4NRT A;  4DXL A;  4CH0 S;  4HYK A;  4KPY A;  3TOQ A;  1HI8 A;  1F1B B;  1CJT B;  2A1B A;  1NJX A;  1AZS A;  1RP5 A;  2JX2 A;  1B4S A;  2NYH A;  3FCH A;  1WNE A;  1M90 T;  1IKY B;  4DEZ A;  5HLF B;  4HAC A;  2M70 A;  4MK9 A;  4MKA A;  2QFJ A;  2P9G A;  4F2R A;  1RHM B;  3DC2 A;  4OHW A;  2IC3 A;  1S9E B;  5C2G A;  2BRK A;  3D3B J;  1O0P A;  4KHR A;  2MKI A;  4F3M A;  4PXC A;  4WYW A;  4NLG A;  2ROE A;  1T9W A;  2WVD A;  2CZV C;  4ANC A;  1HYS A;  4GVB B;  1U0S A;  1JLA A;  1SKW A;  2AYB A;  2BAC A;  1H38 A;  1F9E B;  1S1U B;  4C0O C;  3KLG A;  1UVK A;  2YKA A;  3T1A A;  5D0G A;  3GJQ B;  5T41 A;  3NMA A;  3H5Y A;  1CPZ A;  1GX5 A;  2QLB B;  4C8K A;  3N6L A;  4J9K A;  3M2U B;  4LF9 F;  4A48 A;  5KFV A;  2LU1 A;  2KFZ A;  3CC2 S;  1HWU A;  2GO8 A;  3POT A;  5A8W B;  3KK1 A;  3K5P A;  1UA1 A;  5BYS A;  1ZPV A;  2VBX A;  2X1B A;  1HNI B;  4UOH A;  3Q86 A;  4ZVQ B;  3CMQ A;  2VF3 A;  1P27 B;  5LOQ A;  2DCL A;  1KQG B;  5J2Q A;  2AP6 A;  2UUB J;  1IKV A;  3K57 A;  4J5O A;  2BJ9 A;  4C11 B;  4NLQ A;  1Y5I B;  4K4X A;  4RL1 A;  4G65 A;  3AAW B;  1S9F A;  1QLN A;  4J9R A;  4EYI B;  1VJW A;  4TXS A;  3CJT A;  4P2S A;  3RRH A;  5E5N A;  3QGP A;  3W5Y A;  4GO7 X;  1S0N A;  4OI0 A;  2B7B B;  4P9S A;  5KFA A;  2HBR B;  3BM7 A;  2DIV A;  1HQU B;  1FJG J;  1TMM A;  1UZD A;  1TKX A;  2XCA A;  2F9J A;  2AGQ A;  2NPF A;  2IMW P;  5KFZ A;  1XBW A;  1EET B;  1HNX J;  2YX1 A;  2W2Q P;  3MM6 B;  4ZN3 A;  1W25 A;  4PG4 A;  4JI6 F;  3LPY A;  4FF1 A;  2N7C A;  1YHQ S;  3W64 A;  2EK6 A;  4YB6 A;  1RLC L;  2FJV A;  1SIW B;  5KFK A;  5KFU A;  2QYG A;  2XY6 A;  1V5V A;  3MMB B;  2OTL S;  2IRX A;  4USI A;  2OD6 A;  4ECT A;  3R5A A;  2CQP A;  2CJK A;  5E0O A;  2OGU A;  4N8N A;  3D6M B;  3MR2 A;  1CUL A;  3FMW A;  4OYM A;  4U7C A;  2DPJ A;  3MM5 A;  4N76 A;  2GQC A;  4CLF A;  2IYG A;  3V81 A;  2IRU A;  3G96 A;  4C4W A;  4UTG A;  1F9F A;  5K5M A;  4QIV A;  1N88 A;  4WFA Q;  1CC7 A;  1VJQ A;  4ELV A;  2QE5 A;  1S59 A;  4ZDN A;  2YKN A;  2GX8 A;  4JI1 J;  3IXQ A;  4UY8 T;  4NLO A;  3W63 A;  4X4S A;  3FCV A;  2ZHO A;  4QR2 A;  3NBP A;  1WKJ A;  2VA3 A;  3T5K A;  2OO4 A;  5E3Q A;  1N5Y A;  3PAC A;  4WIQ A;  1GQE A;  2WHO A;  1NU4 A;  2HHS A;  1UJ6 A;  2Y0B B;  3BSN A;  2QSF A;  1RQ0 A;  4LF9 J;  1VQY A;  4X4R A;  2KH9 A;  1IKW B;  2AYG A;  3Q8U A;  3M2V B;  1B70 B;  1C0T A;  4J9S A;  3P45 B;  2QEX S;  2DR6 A;  3BQ1 A;  4CYU B;  3I0R A;  1NJW A;  3KLH B;  4ED5 A;  5DLF A;  2HVI A;  3ENA A;  1H72 C;  2C2R A;  3UI3 A;  1FWL A;  3SQG A;  4H4O A;  1KON A;  2CPD A;  3CJ0 A;  3DDI A;  4Z7C A;  1UVL A;  1HNW F;  2ZNY A;  3HHL B;  3U1L A;  3QWU A;  4LRF A;  4XO0 A;  4A8W A;  1WSR A;  5A6W A;  2R9L A;  3I0S B;  1KSP A;  2FD2 A;  4OZ2 A;  2GVZ B;  3K5O A;  1PAE X;  5KFX A;  1FRI A;  5E33 A;  1K8A T;  2EW9 A;  4CO5 A;  4JI7 F;  1VQK S;  3HHK A;  3CJK A;  2NR0 A;  3PEH A;  1HD1 A;  1KWM A;  5A2Q Y;  4A4J A;  2AJ4 A;  3GIM A;  5KFD A;  1HBN B;  1VMB A;  1EQM A;  3AT1 B;  2MKY A;  3PW4 A;  4Q8F A;  2FLO A;  4P7T A;  1U8W A;  2WSE C;  1VIO A;  2VFT A;  2M8H A;  3SQO P;  3DRS A;  3M6W A;  5L9X A;  5D3G A;  2EFN A;  5CZV A;  3DRY A;  1WC1 A;  2AYM A;  1MNE A;  5F9L A;  3VWS A;  2J6S A;  1WKL A;  1RT5 B;  3KLE B;  5F8M A;  4I0W A;  2J6U A;  5AXK A;  1SH2 A;  2AT1 B;  4JYA J;  1S49 A;  4F04 B;  1GMV A;  3HDS A;  3CO9 A;  3R3T A;  4QYZ K;  2MJU A;  1LQ9 A;  2OSQ A;  2H65 B;  2GC8 A;  3PR4 A;  3DLK B;  2DEJ A;  4C8M A;  3C8Y A;  1RHJ B;  3DOL B;  2M4M A;  3PYF A;  1T03 B;  3T9Z A;  3ZTO A;  3H90 A;  4KTQ A;  1NHU A;  4TYB A;  4ZVU B;  4B3O A;  5L1L A;  4KRW A;  1S6O A;  4ECQ A;  3EVO A;  3HP6 A;  3CCL S;  2W2P P;  2IVF B;  1SKU B;  3WIU A;  2AEF A;  2IYI A;  4RNO A;  1MN9 A;  2OPQ A;  3AOD A;  4UOG A;  3R9L A;  3H5S A;  1IBC B;  1EAY C;  3T1H J;  1FNM A;  3J7Z 5;  1Q8I A;  3R6G B;  3DXS X;  3UD3 P;  3T6J A;  4WYL A;  5CD4 A;  1JX4 A;  5G4D A;  2ZH3 A;  1LKZ A;  3PW7 A;  2DXE A;  3P96 A;  1NSK L;  3JSB A;  4HHH A;  4DU7 A;  3DRP A;  4E8U A;  2WW4 A;  3QAE A;  4KFB B;  3AQO A;  5KT4 A;  1HW9 A;  3PJW A;  4OYI A;  1YJ7 A;  4EGL A;  4IG3 B;  5HAO A;  4NI2 B;  3MOZ A;  4IOC Q;  1HNW J;  3UQS A;  2H1Y A;  3CUN A;  4IFY A;  2PFD A;  1T3O A;  4PAA A;  1MWQ A;  4KBI A;  3G6Y A;  3GE9 A;  2MSS A;  1S79 A;  2J0X A;  3AHP A;  3W5Z A;  2FTR A;  3C16 B;  2U2F A;  3TAR A;  4JI7 J;  1DTT B;  1MU2 B;  1NKE A;  3ZZR A;  3VAF A;  2FVR A;  3PIP Q;  5GAD U;  2DY1 A;  3FZB A;  3AJD A;  3D67 A;  3ISN D;  4FYX B;  4A8M P;  3MR3 A;  1YLX A;  2OUG A;  4PQU B;  2EG1 A;  4OYW A;  3IR6 B;  1S6Q A;  4FKY A;  1XR6 A;  2UUC F;  4DCJ B;  3GMG A;  1X4B A;  1KN6 A;  4DUZ F;  9RUB A;  3S7R A;  3OXG A;  1URN A;  3ADA C;  2DRD A;  5L9N A;  3TNV A;  1FNX H;  1VQ4 S;  3HVW A;  2DH8 A;  1H2U X;  3EWG A;  4H4M B;  3EMT A;  1TFW A;  4DR7 F;  2YQ0 A;  3JSM A;  1ACM B;  1LWX A;  1F0X A;  1SC1 B;  3TI0 A;  2JEJ A;  3BN7 A;  1FXL A;  2PN6 A;  3OFH A;  4C98 A;  3MAH A;  2R2T A;  3L7P A;  1BLU A;  4DR4 F;  1XTZ A;  3Q0A A;  1P9Y A;  4C8L A;  4NX9 A;  3OTO F;  4EI2 A;  3NRB A;  1YG0 A;  1HD0 A;  1BXN A;  3QFH A;  2HND B;  2FLP A;  4X4V A;  3FRZ A;  4KE5 A;  4NZ7 A;  1BQM A;  5GMD A;  2AU0 A;  4WFZ A;  2D69 A;  1N0U A;  2J8A A;  2MZR A;  3WX4 A;  3HFK A;  1OSC A;  4P7V A;  2E5H A;  2XMV A;  3Q8Y A;  1NBE B;  3AXM A;  1HL6 A;  3MEE A;  2HHW A;  2WVF A;  3LF0 A;  1F6T A;  2HZA A;  4I2Q B;  2V4J A;  4A8S A;  3C3L A;  2L9N A;  3CTR A;  2LQ5 A;  4DV0 J;  3MTK A;  2XGP A;  2BVZ A;  4K2J A;  3QIP A;  3CDA A;  2ZH6 A;  2AKW B;  3UDL A;  3OXF A;  1ZAV A;  2IPO B;  2JEG A;  4UZC A;  3KUE A;  2D7S A;  5M2R A;  5JUM A;  1FFW B;  4X2B A;  3MCN A;  2NQP A;  2CQ1 A;  4UW2 A;  2ZUA A;  1TZ0 A;  2CQ2 A;  4AYB D;  1KLN A;  2NXN A;  5KFN A;  1KTQ A;  3JQM A;  5L1K A;  2DHX A;  5G0R B;  3H4D A;  4LSN A;  1RHU B;  1XR5 A;  4KSE B;  1Y9O A;  1RDR A;  3AA8 A;  3H2L A;  4O0I A;  3CNQ P;  2ZH9 A;  2LXI A;  4LF5 F;  1YIJ S;  2AZ1 A;  2K3K A;  3OTC A;  2QMU B;  4BC9 A;  3PCO B;  4OZ3 A;  2B8P A;  3MEK A;  1RWN B;  4RU2 A;  1UEV A;  3PYD A;  3BQ0 A;  4WFY A;  4ETZ A;  4DL0 C;  3K8W A;  1TL7 A;  3U1M A;  1VQN S;  3DOM B;  2DNQ A;  2OEJ A;  2ASJ A;  2FJB B;  1HNZ F;  2OPS A;  1H73 A;  2DY9 A;  4URS A;  4C7Q A;  5CYM A;  2UUC J;  1RTJ B;  2LEB A;  4MTP A;  4L76 A;  4DUZ J;  2LCW A;  3MTJ A;  1HBU B;  1KKH A;  1WEX A;  1YK9 A;  4RW8 B;  5DGA A;  2BAN B;  3ELH A;  1ROF A;  2MDA A;  1SXL A;  2DH7 A;  2XZT B;  2B4V A;  1Q86 T;  1T0T V;  2XYP B;  4DR4 J;  3M30 A;  3T5J A;  3CC7 S;  1S6P A;  4USM A;  1NSQ A;  3OTO J;  4PG6 A;  4B9M A;  1CS4 A;  5M2U A;  1U45 A;  2RD5 C;  1VRU A;  3DGP A;  3P49 B;  1X9S A;  5ETV A;  4Y65 A;  2J7K A;  1CBK A;  4WE1 A;  4ZMM A;  3NLC A;  1TKZ A;  3SCI E;  4ZLP A;  2GFF A;  4YHH J;  3KDO A;  4TY9 A;  4KHM A;  3LQV A;  1Z1Z A;  5DQH A;  2LQJ A;  4YDX A;  1BC6 A;  2XZW A;  1HHS A;  3SIP B;  2X7I A;  1D0E A;  1FRL A;  3N01 A;  1IWA A;  4B9U A;  4IOA Q;  1RB0 A;  1CJV A;  2O66 A;  5LMU F;  2ERR A;  1E6V B;  2X3D A;  4DV6 F;  5E3P A;  3WC0 A;  1TL3 A;  2V4R A;  2PDA A;  3G6E S;  3VZH A;  3UFC X;  4QBU A;  3BQ2 A;  4Y2M A;  2DNN A;  1WHY A;  2LP4 A;  4L72 B;  4JI0 F;  5J2N A;  7FD1 A;  2NXE A;  3BO4 A;  4IYQ A;  1HBO B;  3EDQ B;  4KKO A;  3NCP A;  1TU0 B;  5HI7 A;  3DN9 A;  3UO0 A;  3W61 A;  2N82 B;  3EGN A;  4PG8 A;  4PXB A;  4LF5 J;  2EBG A;  2G4B A;  4A8F A;  2HHT A;  2BW2 A;  1VIS A;  3OVA A;  2DHH A;  4OYB A;  3Q23 A;  4LR7 A;  1H3D A;  4USW A;  1SCJ B;  5EDW A;  4GVL A;  1F3F A;  2K8G A;  3G6V A;  1U26 A;  5KFW A;  1R8A A;  4DR2 F;  4Y3C A;  3D0I E;  3C15 A;  2B4P A;  2LQB A;  1NH7 A;  4PWD B;  1LK7 A;  2CQG A;  3AJ1 A;  4ES2 A;  3SEO A;  5A76 A;  1ZPW X;  1JJC B;  1JB0 C;  2M52 A;  2AD9 A;  4GMK A;  1GMW A;  3M2R A;  4HDG A;  1L3T A;  4OJG A;  4ID5 A;  4UOC A;  5D8H B;  2IJN A;  1YIT S;  1L3U A;  3M8Q B;  2ZJP Q;  2ZDP A;  2CJB A;  4AUK A;  3D1H A;  2C1E B;  5KG4 A;  2M9K A;  3RR8 A;  1AZS B;  4PWU A;  1LFW A;  3QGH A;  4Y6I A;  2VG5 B;  2DRA A;  5LT5 A;  2J9E A;  4KGX B;  1WAC A;  1FI4 A;  3NP5 A;  5ETR A;  1EAR A;  1V3R A;  2YWG A;  3C6U A;  4HAC B;  3W8P A;  1HMV A;  1LV5 A;  2IJF A;  4OV6 A;  2IC3 B;  3FUY A;  3UR0 A;  2HNY A;  1JLB A;  2N3O A;  4L73 A;  2WVB A;  4WXW A;  2MZ1 A;  2PA3 A;  4HEA 9;  2O1P A;  2LQ9 A;  2R8G A;  3PKM A;  1CSJ A;  5C42 A;  1U1K A;  2ZVS A;  3KLG B;  2EXU A;  1YZ6 A;  4RWX A;  2HAF A;  1SQE A;  1B0P A;  4TU7 A;  6AT1 B;  3KYL A;  3BJY A;  2OKQ A;  1S1V A;  1F9H A;  4H4K A;  4KPC A;  1U1L A;  1OIA A;  2VC1 A;  1U7L A;  2VBZ A;  5KG6 A;  4X62 F;  3D2W A;  3ULH A;  3A4T A;  1WOP A;  5LMU J;  1Z2L A;  4K50 A;  4DV6 J;  4O3S A;  2QFI A;  2VOO A;  1ZM3 A;  4LJM A;  3IBC B;  4KC5 A;  1GH8 A;  2FPH X;  3QID A;  2QA4 G;  2XG8 A;  1NSP A;  2Z2Y B;  2RHS B;  2CXE A;  3JAM U;  2P9E A;  2ZH2 A;  2HW3 A;  3ZTQ A;  1RBO B;  1PSD A;  3E01 A;  1RT1 A;  4WF9 Q;  1C1B A;  2NSB A;  4K5S A;  4HT5 A;  1TEL A;  3BSA A;  4ATN A;  5LXR A;  4ZVS B;  2JZ5 A;  1OO0 B;  2I5J B;  3QGI A;  1MMD A;  1URR A;  5DET A;  4LMZ A;  5EGY A;  4V19 X;  4FBT A;  4DZ6 A;  5AE2 A;  2P6T A;  1JLE A;  1M5S A;  1S1X A;  3TAM A;  2PE8 A;  2DGS A;  4RBT A;  2W9A A;  2WB4 A;  3I4P A;  1PC5 A;  4HVZ A;  4LVO P;  3O5T B;  3R5B A;  4MMO A;  1DJ0 A;  1KOO A;  4I7F A;  4KO0 B;  4JV1 A;  2QL5 B;  3FBB A;  4RZR A;  2UXB J;  1RT2 A;  1NZ8 A;  3ET6 B;  1IBL F;  5F0U A;  2FJA B;  4YS2 A;  3CCM S;  3M8S A;  2DNZ A;  5IM0 A;  1SL1 A;  4NLW A;  1G4C A;  3R27 A;  1GMW D;  1HHQ A;  1TMJ A;  1MLA A;  5CH7 B;  4ZLJ A;  3MXH P;  2ZH1 A;  1A0O B;  3V2U C;  3GIJ A;  3DI6 A;  2O67 A;  1E6Y B;  2E9R X;  1CJK B;  1HLW A;  4CO0 A;  1WTF A;  2NCK L;  2NUH A;  4I1T A;  2ZD1 A;  3D6T B;  2HMI A;  2YKN B;  1FD8 A;  3DM2 A;  4OLP A;  3KUG A;  2KZM A;  4PZV A;  4G1Q B;  4ZP6 A;  4K59 A;  3K0J A;  1FWK A;  4FF3 A;  4NAS A;  4B3R F;  4DG1 B;  1N5Y B;  4IO1 A;  1L3K A;  2VHG A;  1B0T A;  4ZIW A;  5FD1 A;  4C3L A;  3RBX A;  1UVJ A;  2OHD A;  4ES3 A;  4O3P A;  2HHH F;  3NOC A;  4AXI A;  2FHM A;  1IUJ A;  2GMH A;  1GK8 A;  4DPU A;  1MW7 A;  4DF4 A;  4XPE A;  1FKO B;  4X62 J;  3BH7 B;  1M1G A;  1RA7 A;  3HZG A;  4XIU A;  4PCQ A;  2IA6 A;  4RX6 A;  4NEZ A;  1AW0 A;  1UW4 A;  2DIU A;  1AFJ A;  1M5V C;  2BM0 A;  2V50 A;  3SV4 A;  2MGZ A;  4B9S A;  3SQG B;  4M5J A;  4J9P A;  1U25 A;  2B4O A;  4HHU A;  1SQF A;  3BYP A;  1RTI A;  2QLJ B;  2HEK A;  3Q8S B;  3TUZ C;  2BZ2 A;  4DQS A;  2PSZ A;  3MF5 A;  4X66 J;  2D41 A;  2ZVI A;  3CJK B;  3S1T A;  2CQ4 A;  1UVN A;  2HZV A;  3UVJ B;  2YY3 A;  2XMJ A;  3OFG A;  1S0M A;  3R7N B;  2RQC A;  4Q5V A;  2KI2 A;  5K8M A;  3H0P A;  2RKI A;  4ZIV A;  2CPZ A;  2QO3 A;  1LOU A;  1NCL A;  1P9Q C;  3V4I A;  2KVQ E;  1VK3 A;  2GIR A;  3UDC A;  1IBL J;  1HWJ A;  1OS5 A;  2VIC A;  4FVC A;  3ZZT A;  1SC3 B;  5HBM B;  5SUH A;  2KL8 A;  3DRS B;  2O5D A;  4DFM A;  1N34 F;  5D3G B;  4ZPV R;  3TEG A;  3QJL A;  1LWE A;  5ETL A;  1KLM A;  3KK3 A;  4ED1 A;  4X64 F;  1WD6 A;  1B0V A;  1Q8B A;  2GAH C;  1T02 A;  1RSC A;  3R1H A;  3MD3 A;  1EKR A;  2BKP A;  1QSS A;  2GZO A;  3UN5 A;  4PR6 A;  1ZZF A;  3FEZ A;  1DTQ A;  5B0B A;  1QSL A;  2XUL A;  2YNH A;  2KFN A;  3L7O A;  4ITS A;  2FVQ A;  1FE0 A;  5D6G A;  1FDN A;  3GFX A;  3KTQ A;  4OI6 A;  2PA8 D;  3AOC A;  3QO9 B;  4LRE A;  5KOX A;  3EIC A;  2L9W A;  4B3O B;  4B3R J;  3LOU A;  2CQB A;  3E2E A;  1LWF A;  1U1P A;  2P5V A;  2HHH J;  2J9D A;  4HL9 A;  1K47 A;  4DBQ A;  1RKI A;  2MQ8 A;  1BE4 A;  4CO1 A;  2ALY B;  3ILL A;  5L38 A;  2VQE J;  1U4B A;  1N6Q A;  4S0M A;  1Q16 B;  4Y34 A;  2OPR A;  3MEC B;  2FC8 A;  2YX7 A;  3BGO P;  1ZM2 A;  3W8G A;  2ZBQ A;  3PM9 A;  3K5M A;  2UV8 A;  2Y9H A;  2ASY A;  1EQ0 A;  2FHK A;  4ZVF A;  4DWI A;  1C1C B;  1S10 A;  2PFF B;  3DRP B;  2FZC B;  1YJR A;  3N5B A;  3R6L B;  3ITH A;  1X4F A;  3T3F A;  2RML A;  4CZC A;  1FXD A;  2NZ4 A;  3IWX A;  3VTI A;  3C19 A;  4ECV A;  1JQG A;  3NGK A;  3M8Z A;  2E5J A;  2Y3Y A;  4EBE A;  1DFD A;  1RU1 A;  3HSG A;  3TZX A;  1F5A A;  2ZC4 A;  3HF5 A;  3H4B A;  2R8H A;  2J7U A;  2HSE B;  1QAX A;  3GB0 A;  3NS5 A;  3QYY A;  3CC4 S;  3GCX P;  1NJZ A;  1O6X A;  2V63 A;  1FEH A;  1FDD A;  5DG8 A;  1KQS R;  4DL5 A;  5L8R C;  2CQH A;  2I0X A;  2RHQ B;  2JLF A;  3PXG a;  3TO8 A;  2JDJ A;  2QIF A;  3KJV A;  1NKB A;  1IR0 A;  2YNG A;  3KJN B;  2W1B A;  3OJS A;  4EFA C;  1XER A;  2B0G A;  3I6P A;  1N34 J;  3Q83 A;  4JI5 F;  1IM4 A;  1OYD A;  2GGP B;  4X64 J;  2DYA A;  2NXJ A;  2ROG A;  1CLF A;  2B9Y A;  2DNG A;  3TQE A;  3MUM P;  2K1R B;  4J9L A;  3MI7 X;  1WC6 A;  3FSI A;  2NLW A;  4ZCK A;  3KFW X;  3W7B A;  2ZEJ A;  3MMA A;  4C0H A;  1FD2 A;  1RUS A;  1FK9 A;  5AJ3 F;  3ZTS A;  2HYI B;  1HWK A;  3MEG B;  5IQQ A;  3THP A;  2K3I A;  8AT1 B;  9ATC B;  3B82 A;  5T7L B;  2XMA A;  3L95 X;  1JIH A;  1IBM F;  2AJF E;  2IMO A;  3M8W A;  4DUT A;  2ZM6 J;  4DSJ A;  1FFG B;  2V94 A;  2FHJ A;  5HSP A;  2Y1J A;  3OJU A;  3DDK A;  3NGT A;  3IRX A;  1MRO B;  1NK6 A;  2WW8 A;  2DNK A;  1I3O B;  1FKA F;  1LW2 A;  3D0H E;  3D5M A;  2RU9 A;  3GP9 A;  3N6M A;  3MEE B;  2CPX A;  4A8Y A;  3M05 A;  4NE9 C;  4QPT A;  3N4W A;  4NCA A;  4USU A;  2FHO B;  4ILM A;  3J80 U;  2BEF A;  2R7W A;  2CNL B;  3F0N A;  1JLQ A;  2FZK B;  3CCS S;  3OSP A;  3HHN B;  5J2P A;  1TV6 A;  1FEE A;  3Q24 A;  1VQM S;  2GJI A;  2XMK A;  5D78 A;  1AUD A;  5M2P A;  3OR1 A;  4OJ1 A;  1RTZ A;  5KAK A;  1V9O A;  3ETO A;  4J91 A;  2RDJ A;  3BV8 A;  3QT5 A;  4CIO A;  4RW9 A;  5HN0 A;  4OX7 A;  2V9W A;  2DXF A;  2JJ4 D;  1VQ9 S;  1RAA B;  2M5Y A;  3E3X A;  4ZPB A;  2HQI A;  2HWH A;  3AOB A;  4MKY A;  2XY7 A;  5J1N A;  5HMY A;  3C6T B;  2Y1I A;  4ZHR B;  4DOZ A;  4WU2 A;  2QA1 A;  3P5B P;  2ZBI A;  2XM3 A;  2XLJ A;  3MM7 B;  2ZIT A;  1TFY A;  1RHK B;  3KNA A;  3EGZ A;  3RW6 A;  4YY3 F;  2CQ0 A;  2HBZ B;  4ZLL A;  2ILZ A;  3LP1 A;  3FMB A;  2ASD A;  4DLE A;  2BKN A;  3I55 S;  5AXM A;  1RT4 A;  1VI7 A;  4MYU A;  1TQL A;  1T11 A;  3PW2 A;  4JI5 J;  2MB0 B;  4L3K A;  2OPS B;  4ZPT R;  4UT4 A;  3CDW A;  4NA1 A;  5DS7 A;  2OPP A;  1BUX A;  3PRB A;  1VBK A;  1RAH B;  4H54 A;  1TL4 A;  4IDK A;  3HK2 A;  3I9Z A;  3MAQ A;  5K8O A;  4BLG A;  2MMY A;  2C2D A;  1DY3 A;  5BYR A;  3BR9 A;  5F0W A;  1MML A;  1UMJ A;  2ZKT A;  2H5J B;  2B8Q A;  3UDV A;  2FVC A;  3MPY A;  4DQQ A;  3KLV A;  5EHH A;  4ZCL A;  3EVM A;  2VU5 A;  1CS4 B;  1R89 A;  2FB0 A;  2DNL A;  1GXU A;  2E7X A;  2BQ3 A;  4R5P A;  2F3J A;  3M6U A;  3MD1 A;  3TP2 A;  4WE1 B;  3ILO A;  3DU6 A;  3LO3 A;  3NWG A;  4A8O A;  3CD7 A;  1XWL A;  1KFD A;  1LW0 B;  3RTV A;  2FHJ D;  1WG1 A;  2I8E A;  3V6D A;  3IA0 A;  2EBE A;  1FX4 A;  4WII A;  2W24 A;  3JQJ A;  5IS2 A;  4HKQ A;  4ECU A;  2KT5 A;  3K89 A;  3FVY A;  2VDI A;  5IT9 U;  3TJ8 A;  4RPF A;  1F5C A;  2DJW A;  4PEO A;  5MAO A;  3VAG A;  4OFZ A;  2BMB A;  3DGV A;  3CME S;  3MHY A;  1W2I A;  2XS7 A;  3LH2 S;  2YXL A;  3PFE A;  1WEY A;  3DMJ B;  1S9G A;  2VON A;  1KDN A;  3PW5 A;  1QTM A;  1UKU A;  5J2N B;  1H98 A;  3HSD A;  4QWA A;  3BS9 A;  4XTT A;  5LSO A;  1RWK B;  1TTH B;  2DGX A;  4K4Z A;  1S48 A;  3M4X A;  1S4E A;  3HX9 A;  4YR2 A;  2DNH A;  5BJR A;  1Y7P A;  2R8J A;  5A8R A;  3CT9 A;  1RWO B;  1LK5 A;  1T7P A;  3H59 A;  3F41 A;  4TU9 A;  3OTE A;  3R1L A;  4OZ0 A;  4JUZ A;  1NLK L;  4GKK F;  2HRT A;  4RW4 A;  4W90 B;  1WEL A;  5ETN A;  2UUT A;  2OEK A;  1PJ5 A;  4MYT A;  4QIW D;  1O8B A;  3KOA A;  3OUY A;  4YY3 J;  4DV4 F;  3VAK A;  4DPT A;  2FLN A;  1IJE B;  1V3Z A;  4NYZ A;  1OYE A;  4EZ9 A;  4QWE A;  3M2R B;  1LWC A;  3P5T L;  4CWB A;  1G2E A;  1VQL S;  4ID5 B;  4RUB A;  2J0Q D;  2WOM B;  4DR6 F;  2HUR A;  2BOA A;  1JNR B;  3LWM A;  2B6A A;  1X60 A;  1YKW A;  2D3U A;  1YBU A;  1WOS A;  2W4D A;  5F8J A;  2K2P A;  1PGZ A;  1ICE B;  1QD1 A;  3TJA A;  3TW0 A;  1HI0 P;  1DBD A;  3DRR A;  2QMX A;  3B54 A;  4ICL B;  5DG7 A;  4FN5 A;  3C6U B;  2VG6 A;  1A9N B;  4WBF A;  1EKS A;  3JSY A;  4LFA F;  3FNN A;  4KGM A;  2HNY B;  3IN5 A;  1S1W A;  3FBC A;  5B0A A;  5KFH A;  4DL4 A;  3NGD A;  5CAB A;  1UPP A;  1R8B A;  3IR7 B;  3EUN A;  5KT5 A;  5KG3 A;  5J1P A;  4OQJ A;  5C42 B;  1EHW A;  4KGV B;  2QG9 B;  2L08 A;  2G2Y A;  2DT9 A;  3H2U B;  1ZET A;  1FTR A;  3KG0 A;  5HP1 A;  3KLF A;  3MM9 B;  2GMJ A;  1KNZ A;  1S1V B;  2UUW A;  4PAB A;  1AXQ A;  3EPG A;  3DHW C;  3X3U A;  3TYT A;  1H7X A;  1N5Q A;  1S12 A;  5E2Q A;  1FJE B;  1RU2 A;  1RTH B;  1Y3J A;  4LR9 A;  1U6Z A;  2ZWP A;  2ZZN A;  4K7Q A;  1S1T A;  4CI0 B;  3V5R A;  1AA1 B;  4TLR A;  1SQG A;  1TAQ A;  1UW9 A;  1FDB A;  2ZDO A;  2BE2 A;  2ZJR Q;  3O1L A;  2A0F B;  3R5J B;  4K4V A;  1REG X;  2EKN A;  1YRT A;  3E01 B;  2KT2 A;  1RT1 B;  1SVD A;  1RGV A;  1R8H A;  3MUV P;  2MKK A;  3X1L B;  2IFX A;  3GU0 A;  3TX0 A;  4ZP9 A;  3T5H A;  4DFP A;  3V6K A;  3BF4 A;  3BH6 B;  3JYT A;  4AT1 B;  4ZOS A;  2XI3 A;  1SH3 A;  4DV4 J;  1Y10 A;  2F8M A;  4FDF A;  1EJ7 L;  4IRK A;  3HPO A;  3THT A;  4XAK A;  1TL1 A;  3A3P B;  2W9B A;  2CJY B;  2OLW A;  5DQI A;  1SV5 A;  3MPD A;  3BN4 A;  1RWW B;  5F3Z A;  5LL6 d;  4K0K F;  2VFS A;  1XEZ A;  4DR6 J;  4MK7 A;  4MH8 A;  3KWM A;  2GML A;  3TAN A;  2UXC F;  5CQG A;  2LMI A;  1UZH A;  2LDY A;  3D28 A;  5LSR A;  2EFV A;  2FZG B;  1FE4 A;  2G9O A;  2KJW A;  3QSI A;  1L3S A;  3T19 A;  3BO3 A;  4UZB A;  2J76 E;  3DI6 B;  3M6V A;  3DLE A;  2JRS A;  2KHD A;  1S72 S;  2V2K A;  3FQL A;  2ZD1 B;  5DQG A;  2UZA A;  4LFA J;  4IH5 A;  2BKO A;  3VCD A;  2HMI B;  1S7H A;  2CJQ A;  3KHG A;  2PC6 A;  2E9Z A;  1XN9 A;  2CPY A;  2HIY A;  2ROP A;  4L3N A;  1Q7L B;  4AQY F;  4JI2 F;  2MQO A;  4RO0 A;  1N8R T;  4MFB B;  3TUP A;  5ADZ A;  1WC4 A;  4ED0 A;  2IAJ A;  4LVN P;  1UTA A;  2L41 A;  1K1S A;  1BMQ B;  2ZE2 B;  4MT1 A;  2AJ2 A;  4CLY A;  3QZ7 A;  1RZM A;  2GHV C;  1FDA A;  2WSC C;  5IFM A;  4O0N A;  3LUY A;  2RRN A;  1HBM A;  3WHI A;  4RWW A;  4X65 F;  3EPI A;  2UUA F;  2L3M A;  3C14 A;  1U1O A;  2DO4 A;  4KQZ A;  4PPD A;  2JVR A;  5B0F A;  3ZO7 A;  4G1I A;  3H20 A;  1X8D A;  2MGZ B;  3D9B A;  3J80 Y;  2FGO A;  2AQ4 A;  1N5T A;  4IG0 A;  2WZ1 A;  3DOK A;  4DMZ A;  2XO7 A;  1HPZ B;  1I1G A;  3C66 A;  4LQ3 A;  4DR3 F;  3VAH A;  1HNV B;  4M95 A;  3EM1 A;  2RDD A;  3H98 A;  1Z2Z A;  1JLF B;  4W4M A;  1JNZ B;  1MWY A;  3PDN A;  1K0T A;  2HVH A;  3FCW A;  1VHF A;  1H0H B;  1G3O A;  2GVD B;  4KV8 A;  2B51 A;  4O4G B;  3DLG A;  4Q2L A;  5SZT A;  4X4T A;  4ECX A;  4DSL A;  1XMO F;  3PIO Q;  1QM9 A;  5KFC A;  3H7H B;  5EN1 A;  2X3G A;  1BQN A;  3VZI A;  3RZA A;  1NME B;  1LWE B;  1KLM B;  3KK3 B;  1RWU A;  1TK0 A;  2C42 A;  2EC0 A;  3J81 U;  1S0O A;  2E5I A;  2YWE A;  3NKY A;  4IO9 Q;  3P6Y C;  3DLL Q;  1TKD A;  3MM8 B;  3DLJ A;  2MTL A;  5CYQ B;  1RT3 A;  4G3I A;  3N6N A;  4QR0 A;  1DTQ B;  3NGU A;  4WZM A;  3KDN A;  1QVG R;  2ZH8 A;  3AA9 A;  3HVT A;  5I3U A;  2HK2 A;  3DKD A;  3N9U C;  3MFI A;  3HVR A;  1XIQ A;  4AQY J;  4JI2 J;  4IH6 A;  3UW1 A;  2FGC A;  2Z2L A;  5HJX A;  2R8I A;  4FYV B;  4RUC A;  2RQK A;  5KFT A;  2B5J A;  4U8Y A;  3MZI A;  3QPI A;  2VFV A;  1KD1 T;  1XMQ J;  4JBC A;  3ENW A;  2KXH A;  2CWK A;  3DLB A;  2PGC A;  3W60 A;  4FYY B;  2XNR A;  4M5L A;  2E1A A;  4ED6 A;  4D3H A;  3S8S A;  1EZZ B;  4ZPW R;  4I64 A;  5E41 A;  2CIM A;  2UUA J;  3OVS A;  1N6Q B;  1SJ1 A;  2RU3 A;  4OHV A;  5C7P A;  3LA0 A;  2XO6 A;  6FDR A;  3GFZ A;  4Z37 A;  2OPR B;  4Q45 A;  3FBE A;  3QBC A;  1CJT A;  3EZO A;  4DPY A;  1NSA A;  2C28 A;  4DX5 A;  4U6P A;  1Q7Y T;  4Y28 C;  2XMU A;  4FF4 A;  5FDL A;  3BGL A;  3OLA A;  3CJ8 A;  2VPW B;  4LF6 F;  3ITH B;  5HLF A;  2LEA A;  3CED A;  1ZA2 B;  2A2D A;  1S9E A;  5KFJ A;  5HAT A;  5ETS A;  2FVP A;  3D68 A;  2XMM A;  4F4A A;  2JLG A;  1VQ6 S;  1JK9 B;  1FKP A;  4MIA A;  2RB7 A;  2LXF A;  4HH1 A;  2N4C A;  4N8O A;  3HHL C;  3RU0 A;  2QYC A;  6FD1 A;  4K5R A;  4EU0 A;  2LLZ A;  2DEI A;  3D1Q A;  4CO2 A;  2MQQ A;  3W5X A;  3QT8 A;  1FRH A;  4NXM J;  1XNQ J;  2PO4 A;  4F4Y A;  3KJV B;  3IO1 A;  2V67 A;  4HHJ A;  1PG5 B;  4FYW B;  2YNG B;  3CCE S;  2M7S A;  2W8L A;  3L9Z A;  3K7R A;  1NK8 A;  1SIZ A;  3O8W A;  2ZUG A;  3OL6 A;  3UD5 A;  1GFW B;  1SC4 B;  1KEK A;  2ZBC A;  2NPI A;  3KUH A;  4DQI A;  2DNM A;  3BO2 A;  2RSQ A;  3OD2 A;  2KT3 A;  1X0F A;  4Y2A A;  1KHV A;  4BCA A;  5D4O A;  2AW0 A;  3CJS A;  4C8Y A;  5IWA F;  3TVK A;  3CE8 A;  1JXV A;  3OL8 A;  1NAQ A;  2Y8Y A;  3I5B A;  4LRC A;  2DHS A;  2DIS A;  4CT9 A;  2HS4 A;  4X4Q A;  4DR5 J;  4ZVO B;  4JI4 J;  4QYZ J;  4YB1 P;  3G6X A;  4F4Z A;  2EC2 A;  3D7S B;  4BDP A;  1WHW A;  2EK1 A;  1HQU A;  4DX7 A;  1S97 A;  1XQI A;  4M8L A;  2BOP A;  4CLU A;  1R6V A;  2AV5 A;  5IT4 A;  3RW7 A;  2IHR 1;  1X0P A;  3MM6 A;  3AQP A;  1AYE A;  4PPZ A;  5EWE A;  3MMB A;  4C97 A;  1ZAX A;  5KOW A;  1T05 B;  5JVH Q;  1ZH5 A;  1N52 B;  2CRL A;  2KYX A;  3RRG A;  4NLV A;  1JLQ B;  3M9O B;  2VQF F;  1R27 B;  1PJ7 A;  2Z4P A;  4LF6 J;  3OR1 B;  3D3C J;  2W4C A;  4ED2 A;  3TAQ A;  4V19 J;  3THV A;  3IWN C;  4NRU A;  2FJW A;  4F36 A;  2PMW A;  4CO3 A;  4RW9 B;  4OX9 F;  4PYA A;  2LEC A;  5DM7 Q;  4F4W A;  2FUG 9;  4ZJQ A;  1Q53 A;  1WG5 A;  1X4D A;  4FPI A;  2XLK A;  3UE2 A;  2KG0 A;  1SH0 A;  1FVS A;  4GC6 A;  1WF2 A;  5ETK A;  1RWX B;  2F7V A;  3RB4 A;  4ZJO A;  3J81 j;  5GVQ A;  2CQ3 A;  3CPW R;  3FDS A;  1KS2 A;  3CVK A;  2ABY A;  3LP0 A;  1IM6 A;  4RJV A;  1M5P C;  3RBZ A;  3LP1 B;  1WOO A;  4CP5 A;  2RS2 A;  1PC4 A;  5DZ6 A;  1VIX A;  1RT4 B;  2EEY A;  4NLP A;  2DPI A;  4I56 A;  1VRT B;  4YFU A;  1RLD A;  2JH3 A;  4CYU A;  4BS2 A;  1M5K C;  3NL0 A;  2K7J A;  2DGO A;  1T3N A;  3NCR A;  3KLH A;  1FCA A;  2OPP B;  2KN4 A;  3MDF A;  4URQ U;  4IFV A;  3PEJ A;  4IDK B;  3FZ2 A;  4CO4 A;  1KQK A;  2DR8 A;  2AX0 A;  4JI8 F;  1W26 A;  1GAO A;  4N5S A;  5IWA J;  5LJ5 Y;  2QC3 A;  4ZCI A;  1YZ7 A;  4O3Q A;  3VAJ A;  3K2Y A;  5AE3 A;  1M1K T;  3NEK A;  3VGT A;  3SCK E;  2F63 A;  2XSJ B;  3MAA A;  4P52 A;  4NLR A;  2W2M P;  2GW8 A;  3VGV A;  1V6H A;  2GHP A;  1ELO A;  1Q1K A;  5KFQ A;  2WTF A;  1UCN A;  1Q5Y A;  4KT0 C;  2MKS A;  1X4H A;  3CUL A;  1HBN A;  1PO6 A;  5I3P A;  4PG7 A;  4F0H A;  1Q8L A;  3Q8Q B;  3V6D B;  3MPW A;  1T9Y A;  4JI6 J;  3NS7 B;  2Q3P A;  2E7V A;  1NB2 A;  5LM7 E;  3VVT A;  3GJS B;  1SJF A;  2EWH A;  2PD1 A;  4OYO A;  1UWB A;  5CZX A;  2DGU A;  5CCL A;  1KHW A;  1I94 F;  1PBU A;  2ACM A;  1PJ6 A;  4O3R A;  2BJ7 A;  3IM8 A;  4DJB A;  2HZC A;  2HQF A;  2DH9 A;  2V9K A;  2J0S D;  2OD4 A;  2XQC A;  1S9G B;  5HK4 A;  2CPF A;  2YWH A;  5JJB A;  1QSY A;  5KG7 A;  1ZYQ A;  1FJ7 A;  3W3S A;  4OX9 J;  2DR5 A;  2R7U A;  4JB8 B;  1ZZN A;  3DOL A;  1T03 A;  1DAR A;  1Q4R A;  4M5D A;  2M8D B;  2N4D A;  4F7V A;  1BY9 A;  4XDC A;  4Q0B B;  1N5S A;  1XR7 A;  3HI9 A;  2CPJ A;  1RT7 B;  3UN3 A;  5EX0 A;  5F9N A;  1UPM B;  1R43 A;  3CD6 S;  2BJ3 A;  5DDQ C;  4DV1 F;  5I42 B;  2GA7 A;  4L75 A;  1FJC A;  2RAQ A;  2B9X A;  3TUI C;  4F0M A;  5AXL A;  4KAI A;  5J1E A;  4QR1 A;  5C24 B;  2G2Z A;  4OYZ A;  2DB1 A;  4PKD B;  2WAQ D;  2ATC B;  2IDL A;  1RE1 B;  3GCW P;  4HR2 A;  4NYP A;  2N7Y A;  3MMC B;  4TY8 A;  4DV3 F;  4DL2 A;  4PUO B;  3D6H B;  4RW7 A;  1KVI A;  2HK3 A;  3J7A 1;  5KT7 A;  4JI8 J;  3W65 A;  4IG3 A;  3NNC A;  3H42 A;  4FS1 A;  4OX8 A;  3R7B B;  2QX0 A;  1S57 A;  2V2V A;  3DRR B;  3G82 B;  3CSK A;  2VG6 B;  2EKY A;  4LFC F;  3C16 A;  2P8I A;  4USH A;  1SPB P;  1ARO P;  2C3Y A;  3NY0 A;  3D0G E;  3AD8 C;  1DTT A;  2MXY A;  7AT1 B;  1MU2 A;  1LEO A;  4J37 A;  5HQL A;  2KU7 A;  3IGV A;  4DCO B;  1FRX A;  2M0G B;  4I68 A;  5CAA A;  5HVH A;  4U96 A;  2DGT A;  5KFY A;  2IIH A;  1C2P A;  3MR7 A;  4ZIT A;  3G8S A;  4USJ C;  2RIL A;  3TUJ C;  2PI4 A;  4PQU A;  2LDI A;  1JXE A;  2AJ0 A;  3KLF B;  2CWX A;  4PG5 A;  4DSK A;  2F5G A;  2VKZ G;  5GMK a;  4UUW A;  4EK2 A;  2WRM A;  5FLX Y;  4GKJ F;  3LPE A;  3BEG B;  2AJ1 A;  1D9A A;  2MZS A;  3GJR B;  2MJN A;  4EO8 A;  4RBU A;  1NPP A;  4RKU C;  1I94 J;  3V6H A;  4ILL A;  3A12 A;  3G8Q A;  4ILR A;  1R0A B;  4V1A k;  2ZBP A;  1VBZ A;  4H4M A;  5IQ6 A;  1EP4 B;  2B4U A;  2E1C A;  3R97 A;  4RUA A;  2JSX A;  3W66 A;  4FVM A;  1KC8 T;  4YB5 A;  1LXJ A;  4NLU A;  2AGP A;  4A8X A;  2FVS A;  1VQS A;  3TZZ A;  4OLO A;  3D4J A;  4JOU A;  4OYA A;  2V8V A;  3HXM A;  1OPZ A;  4NA3 A;  5E3A A;  4RR5 A;  3W2V B;  2W01 A;  2E1M C;  1F2G A;  4DS5 A;  2HND A;  2COL A;  5D4L A;  2WON A;  1WDT A;  3FKB A;  3CWJ A;  3F73 A;  4JV0 A;  3ZFV A;  5BYQ A;  3JYT B;  3MPU B;  2XHW A;  2HS3 A;  3PJ9 A;  4DV1 J;  3AXK A;  3ZNU A;  3GZ7 A;  3W2W B;  2D3Z A;  3K58 A;  2GJF A;  4K4W A;  2E66 A;  3GV5 B;  1TL1 B;  4I2Q A;  2D3O R;  2Q79 A;  1VOM A;  2ASL A;  3BDE A;  3OR2 A;  4GRS A;  3WX8 A;  1PYT A;  5DDP C;  2YPY A;  5C2C A;  3PVX A;  3UNY A;  1NH8 A;  3BGR B;  2F4V F;  1PAU B;  4DV3 J;  1RAC B;  2XNQ A;  2K7K A;  2WBR A;  3TA1 A;  1EIY B;  2RUS A;  2A2C A;  4LBP A;  1J27 A;  1NO8 A;  3J7Z T;  3KMS A;  3DLE B;  3CW2 C;  4M5N A;  4U8V A;  2DBB A;  5A2Q U;  2Q6C A;  4Q2M A;  5K9F A;  4LFC J;  3M6X A;  2VA2 A;  4Y2C A;  4WZQ A;  3CCQ S;  4IUF A;  5HJY A;  4I69 A;  3GSD A;  2RF2 A;  3QLH A;  4R8U B;  5B0E A;  3ZZY A;  1OMS A;  3AB4 B;  3GPA A;  1WDD A;  2W9C B;  5KG2 A;  3Q8R B;  3LAN A;  2IAJ B;  3BRE A;  3AB2 B;  4CLL A;  4OYX A;  5HRO A;  4QJV A;  3FSY A;  3T1Y F;  3HUL A;  2VOD A;  1DUR A;  3PW0 A;  1HBM B;  2BW7 A;  1B64 A;  4GKJ J;  1ZTW A;  2V6A A;  5IT0 A;  2KM8 B;  4P74 A;  5C25 B;  2HKE A;  3GTY X;  1X4C A;  1S6U A;  2R7Q A;  4LSZ B;  1Q82 T;  2Z57 B;  3FEY B;  1HBU A;  2WVC A;  1VLO A;  5CXT A;  2R2U A;  3OT9 A;  1DQ9 A;  2YWW A;  1QAY A;  4RW8 A;  1J2V A;  1GNK A;  2CPH A;  2D9O A;  3QGG A;  2ZWO A;  2Q66 A;  2OTJ S;  1PIE A;  2XLI A;  4FXD A;  3BBC A;  2H4W B;  3NOG A;  1VBY A;  4DR7 J;  2V0N A;  4IG0 B;  2PI5 A;  2V4Q A;  3WBZ A;  2GNK A;  3DOK B;  4HTJ A;  4B3M F;  4NML A;  3PRD A;  2BX6 A;  5IC6 B;  4J9N A;  3PTW A;  1PKU A;  1NDC A;  4DPW A;  3G2X A;  3NWR A;  3GQC A;  2VG7 A;  5DG9 A;  5K14 B;  2C3P A;  1Q79 A;  2RJZ A;  2C2M B;  4CLT A;  4NPO A;  4KV8 B;  2DCU B;  4NL5 A;  1K1Q A;  1TAU A;  4LRB A;  2M2B A;  1VC6 A;  3CCZ A;  3CJ2 A;  2XBP A;  2WK4 A;  3GWC A;  4LF8 F;  1M5H A;  4HI1 A;  2F4V J;  1VS3 A;  4J9O A;  1HI1 A;  4DPX A;  4U9R A;  3U02 A;  5B09 A;  5MLC V;  3NXZ A;  2UVW A;  3H5X A;  4USK A;  1YRU A;  2KRR A;  3ZNJ 1;  3EGW B;  3FFI B;  4PWW A;  3NNH A;  2I6W A;  2WBM A;  2HFN A;  4CDI A;  2DIT A;  4RU9 A;  2IJR A;  2LVW A;  1ZTT A;  4J9M A;  1AUS L;  1FJG F;  1QTN B;  1RA6 A;  3NGR A;  5DLG A;  4C3K A;  3CF5 Q;  2B5J B;  4IR9 A;  2YKM B;  5KFL A;  1OWX A;  3HKW A;  4PWD A;  4P73 A;  4QPX A;  3DRX A;  3T1Y J;  1HNX F;  1J5O B;  3FJ2 A;  4CLK A;  3ZTP A;  3IS9 B;  5F8L A;  2HGM A;  3FRY A;  5F41 A;  1VGY A;  3M8Q A;  5CYJ A;  3HSJ A;  3IRW P;  3OPK A;  3UCZ P;  1V3S A;  3Q2T C;  1HNZ J;  4LUB A;  4UY8 5;  1Y5N B;  3PX0 A;  4OIX A;  4Y0F A;  4WTO B;  1U2F A;  4DQP A;  3K5L A;  5FDL B;  5H9E J;  3P4U B;  2H48 B;  1ZA1 B;  1QAI A;  3CDE A;  2VG5 A;  3M8P A;  4FZV A;  4O23 A;  4M94 A;  3ZZP A;  2QL7 B;  3CD5 A;  3GR1 A;  4QOT A;  4BBY A;  2KO1 A;  1HW8 A;  4NA2 A;  2CDQ A;  2A18 A;  3BKT A;  1U49 A;  4Q44 A;  1H74 A;  5B7W A;  4B3M J;  3IC1 A;  4JI1 F;  2RVJ A;  3RAQ A;  1FKP B;  1NZA A;  3M8R A;  1MWZ A;  1YQH A;  2JFD A;  2UVR A;  5DDO C;  3FBF A;  1FXR A;  3CMA S;  1MMN A;  3I32 A;  4DFJ A;  1HYS B;  4URG A;  4AND A;  1JLA B;  5KFM A;  3O2I A;  1VYA A;  4A47 A;  1QJH A;  2XSF A;  1APS A;  4U7U D;  1ZS6 A;  2ILY A;  3VAM A;  1FA0 A;  2RT3 A;  4RUH A;  2OP5 A;  4L6V 3;  4ZVH A;  3TA2 A;  3D1O A;  1PIL A;  3ISN C;  1K9M T;  3VQS A;  4WWS A;  4LF8 J;  3V6J A;  4WFN Q;  2CKW A;  1T9X A;  5IZH A;  2UV8 G;  5I3Q A;  3B78 A;  1UFW A;  3POT B;  5B0G A;  1UEK A;  3KK1 B;  1DAX A;  2C2Z B;  3TRG A;  4DCP B;  5KFI A;  2J9D E;  4AD6 A;  4K4U A;  4UOF A;  5L46 A;  2WSF C;  1X4G A;  3PY8 A;  3ICL A;  4CH7 A;  1LNQ A;  3DDN A;  4FXW A;  4JI0 J;  3SFG A;  5J2Q B;  5IOL A;  1M5O C;  1IKV B;  2I5J A;  3GV7 B;  4LR8 A;  2XYG B;  4FXV A;  2AYE A;  4I67 A;  3RAX A;  1SJ3 P;  3Q22 A;  4TNO A;  1NHV A;  2NXC A;  2O3D A;  2BJD A;  1H2V Z;  5HQM A;  4PXD A;  3BGF A;  4U95 A;  1UL3 A;  3NAH A;  1X9M A;  2KVI A;  5A6P A;  4KO0 A;  2MYF A;  2XC9 A;  1GXL A;  1B3T A;  4OZ1 A;  1S76 D;  2PII A;  1DRZ A;  2CNK B;  3KJQ B;  4DR2 J;  1TKX B;  3ET6 A;  2E5L F;  1U1N A;  4G1P A;  4A8Q A;  4OYP A;  5H9F J;  2F8E X;  1UA0 A;  1RAJ A;  3TWZ A;  3HM9 A;  5F8G A;  3SCJ E;  1RAE B;  1JWW A;  3PJX A;  2YH1 A;  3UCG A;  2KJV A;  1B7Y B;  1RT6 A;  2DNO A;  4QCL A;  3UDE A;  5KFG A;  1OQ6 A;  4J9Q A;  1IN0 A;  1U1R A;  1WWH A;  2YKQ A;  4ED7 A;  1VC0 A;  1KOH A;  3RB3 A;  2VV5 A;  1SL2 A;  1RYR A;  4F4K A;  2AEJ A;  4JYA F;  3NG8 A;  2QSW A;  2FYX A;  5JVG Q;  1CUL B;  2QTW A;  1IWG A;  1E6Y A;  4NLY A;  1CJK A;  5DDR C;  3MM5 B;  3V81 B;  3N79 A;  1LXN A;  3VV2 B;  4OZ5 A;  2HLU A;  5ETT A;  4KB7 A;  2BJ8 A;  3CD0 A;  3CCV S;  4G1Q A;  5T14 A;  5L39 A;  1RAO A;  4ZVT B;  3SI8 A;  2IA0 A;  2XWX A;  4DG1 A;  4AL5 A;  1NK5 A;  2JHE A;  3LWL A;  1VBX A;  3NBP B;  3SFU A;  2JWN A;  2HHU A;  2VPX B;  1IBK F;  1HQE A;  1XNR F;  4DFK A;  1SKR A;  2GJ2 A;  2B56 A;  1BQX A;  1FKO A; 
#chains in the Genus database with same CATH homology
 3HD2 A;  1F9H A;  4CWB A;  4CYU B;  1EQM A;  3HSJ A;  2F65 A;  4AD6 A;  1G4C A;  1KBR A;  2BMB A;  5ETS A;  3HSD A;  4M5H A;  3HT0 A;  3KUE A;  1HQ2 A;  5ETQ A;  3KUG A;  3KUH A;  3UDV A;  1EQ0 A;  4PZV A;  1RU2 A;  3ILL A;  4CRJ A;  1RTZ A;  4M5I A;  3MCO A;  5ETV A;  1IM6 A;  4CYU A;  1EX8 A;  3HCX A;  3MCN A;  4M5J A;  3HD1 A;  5ETT A;  4F7V A;  5ETO A;  5ETM A;  3ILO A;  1TMJ A;  3ILJ A;  3QBC A;  4M5M A;  5ETK A;  3MCM A;  4M5N A;  1CBK A;  3IP0 A;  1HKA A;  2CG8 A;  5ETP A;  5ETL A;  5ETN A;  1RAO A;  4M5L A;  2F63 A;  3UD5 A;  3UDE A;  1Q0N A;  5ETR A;  3HSZ A;  2QX0 A;  4M5G A;  3HSG A;  1RB0 A;  4M5K A;  1TMM A;  1RU1 A;  1DY3 A;  3ILI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...