5ETQA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.96 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
156
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEELHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 43
structure length 156
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etqA00
2QX0A 2F65A 5ETKA 3ILJA 5ETPA 3HCXA 2CG8A 5ETSA 3IP0A 3HT0A 3QBCA 1Q0NA 3HSDA 1RU1A 4M5NA 5ETQA 5ETVA 3UDEA 2BMBA 3HSZA 4CRJA 3HD2A 5ETLA 1TMMA 5ETNA 4M5GA 5ETOA 1RAOA 1F9HA 3MCNA 3ILLA 4M5KA 4PZVA 4CWBA 5ETMA 3KUHA 3HD1A 1HQ2A 4M5JA 5ETTA 1RU2A 3KUEA 1CBKA 4F7VA 1EX8A 3HSJA 1EQ0A 1TMJA 1DY3A 3ILIA 1G4CA 4M5HA 3UD5A 1RB0A 1KBRA 3MCMA 4CYUB 2F63A 1EQMA 3UDVA 1IM6A 1RTZA 4AD6A 3ILOA 4CYUA 1HKAA 3KUGA 3MCOA 3HSGA 4M5MA 4M5LA 4M5IA 5ETRA
chains in the Genus database with same CATH superfamily
3Q8SB 3HHLB 4UZBA 4DR3J 5CCMA 2C2KB 3LW5C 2LA4A 1TMMA 3QSIA 5LOQA 2FQQB 3BQ2A 4PG8A 2IJNA 1NJZA 2VOOA 1HWJA 1FRJA 2XLJA 1R43A 2ZEJA 2IC3A 3V2UC 3K0JA 5IXUA 1U1PA 3QAUA 1MWQA 2JH3A 4K5SA 2AHOB 2KG0A 2LFVA 2XMKA 2OIHA 2DD8S 2RUGA 1GXUA 3IS9A 3PNIA 4RNOA 1VK8A 3T5LA 2XYPB 4O44B 3RB0A 2W4DA 1LOUA 4IUFA 2MQQA 2KHCA 2EPIA 3ZXWA 2KFNA 1SJRA 3QZ8A 1LW0B 2MGZB 1F9FA 5DLGA 1VK3A 1FXLA 1RXOB 2MZTA 2PT0A 4IOAQ 5CXTA 4KGMA 1QAXA 4R0EA 2Y9HA 4DX5A 4XTTA 2MZRA 1VRUB 1ZZFA 2LA6A 3ZZZA 3IM9A 1FO1A 1R0AA 2E7XA 1B64A 4OLPA 3UR0A 1X31C 4X4PA 1VLOA 2IM3A 3TEHB 4WCEQ 1CJVB 3M2VA 1HQ2A 2BKOA 2HWHA 3D3CJ 3CJKB 3KHGA 1D9DA 4WIQA 4NCBA 1HPZB 1TL7B 4Q2LA 2UU9J 1P1TA 3T1AA 3I0RA 1TUWA 3ILLA 1T9TA 1J5OA 4CLTA 3WZ0A 4F25A 3SQGA 3FRZA 1YITS 1PBAA 4NASA 1U2RA 3MM9B 2LQ9A 1GXLA 4YY3J 1V3ZA 2E9RX 3TA2A 4DFKA 1JJ2R 2EBGA 2GHWA 1SUQA 4FBUA 1PYOB 1VRTB 3Q86A 1EIYB 3HKWA 3T5HA 1X5OA 2RIJA 3N6MA 5C24B 1LXJA 2OD6A 2K3KA 2RKIB 3SSRA 2EI5A 4LRDA 2ZH8A 2DTJA 5IQ6A 3GV8B 1UEVA 3GIKA 4CCHA 4Q45A 3FNNA 4B3SJ 3KMSA 3KNGA 3HSJA 1UP1A 2NS1B 4NLTA 3VAHA 3MZIA 1DRZA 2FGOA 3BDPA 2YNIB 1JMTA 1P9QC 4IH6A 3DKDA 2F9JA 4USVA 1RWWB 2HVZA 3W9JA 2E66A 1VBYA 1HQUA 4X65F 1VYAA 4ETZA 4KHRA 4RW6A 4GVBA 1M90T 2OEKA 3VWSA 4LF2A 3UDCA 2V4JA 4EO8A 2HPUA 1CC8A 3CJ0A 5E3AA 3VGSA 4TY8A 4F67A 2RQMA 1WG5A 5CCLA 4ED7A 2BE9B 3PRVA 4UQTA 5F8MA 4MK9A 5IWAJ 2KG1A 4OZ3A 1W7WA 5EX0A 2KDOA 1KFDA 5C7PA 1LWEB 1RT1B 5D4LA 4ZJLA 1L3SA 2I5JB 3HJVA 1JNZB 1CQNA 3HP6A 4DI6A 1S1TA 1RE1B 3N5FA 4CLKA 3RRGA 1HWIA 2LQJA 1HMVA 4JOUA 3H2VE 3ET6B 1R8CA 1EETA 3FBBA 1MLAA 1LXNA 2OD4A 3OR2A 1WOOA 1G3OA 2H51B 3DRRB 1NEEA 2U1AA 2BABA 2A1BA 4EUVA 2KZZA 2CQ1A 1FKOB 4KV8B 3FGVA 5J2MA 4MFBB 1LKZA 2RF2A 2HMIA 3EE3A 4PCQA 3C15A 2W9CB 1WDDA 2RJZA 2BZ2A 4JV0A 4CLWA 1HD1A 3DRSA 4UZCA 3FQKA 4OYIA 2QLFB 2C28A 3LP0B 2AEMA 4ECWA 4TY9A 3M6VA 2XS5A 2EBEA 2E1MC 1XNRJ 3K5LA 5KFIA 4A8OA 4ZIVA 4DG1A 4USJC 4ED8A 3L9ZA 2OAUA 2H1YA 4BLGA 1OSCA 1PILA 5E3CA 4WZMA 4GC6A 2DCLA 4O3QA 1WOPA 1U1OA 3BSNA 3HK2A 2CRLA 1Y11A 3UVJB 1RU2A 5A8RA 2W9BA 1UWBB 4L72B 4LF5J 2EFOA 5DQGA 3GONA 3P49B 3PFOA 2B9EA 3LAKA 4NLDA 2DH7A 2J0WA 2RU3A 2HVIA 2MQ8A 4V19J 4U7UD 2HBQB 1RT4A 3Q89A 3U7JA 3BREA 5A8KB 4IQXA 3CO0P 4C8OA 2KT2A 3ZZOA 2E1CA 1S0NA 3TVYA 1WSRA 4DSIA 2G0JA 1FEHA 2V8GA 3HKZD 5DDQC 4WJBA 5HBMA 3WDOA 4OLOA 3GYGA 3TQ1A 1N88A 2UXCJ 3MUVP 3PRDA 3W5YA 3NAIA 2HGNA 4IRDA 4MKYA 4LRBA 3G6ES 3KLGA 1QAJA 4OQJA 2J9DE 2YNHB 1K1SA 2DRDA 4DL5A 3MCOA 3VALA 1UL3A 3W1YC 1WI8A 2CJXB 2LQ8A 2MHEA 3T5JA 2P2CB 4JI5J 4UUXA 5KFWA 3M2UB 4MIBA 2Z2ZA 2PEBA 3I9ZA 3SYZA 1XQIA 2P6TA 1YJTA 4DZ6A 2OO4A 3AXMA 2PFDA 2X3DA 4ZN1A 4QQBA 4QYZK 3DM2B 4I56A 2K06A 3GPAA 1DQ9A 3MHYA 3N5BA 4FPRA 1S1UA 4IR9A 1KOHA 1Q8BA 2BANA 2QLJB 1VI7A 3ENAA 4KE5A 4J9RA 4G1IA 1DJ0A 1Y9OA 4I4BA 1TL4A 4OMFG 2M8DB 2RILA 5FIIA 3QJJA 3NS6A 3I4HX 3EYZA 3MMCA 2QLWA 2HURA 2RQCA 3WIUA 4DV3J 2AGPA 1H2VZ 4QYRA 1TKTB 3RAQA 4AQYJ 3QT6A 1X4EA 1E6YA 5M2PA 3MM6A 3DMJB 1GX5A 4Y2KA 2KVIA 3ZTQA 4HVZA 4OX9F 5LMNF 4WU3A 3H2UB 3AA9A 5CYQA 2EFGA 4DF8A 2XMMA 3MM8A 3VAIA 2BUNA 2XULA 2HHSA 2BE7D 1VQ5S 1UJ6A 4J91A 2XB2D 4HH1A 1S1WA 3M6WA 1HNVA 3R5JB 4IG0B 2XI2A 3OBIA 3TAMB 3W63A 3CO9A 2HWIA 3ISNC 1YRUA 1KSPA 4A47A 2HVEA 1YJUA 3H40A 2FVSA 3ZFVA 2DNZA 5KT5A 3JSMB 1AUSL 1U1LA 4Z37A 4HT5A 1TV6A 1XIQA 2ABYA 5AXLA 4HYKA 4ZVEA 3V4IB 4MIWA 4RKUC 2HRTA 4N76A 3LTOA 3ZNUA 3K2YA 1IWGA 2O67A 2MB0B 2ZBCA 2QL9B 5B08A 3H5XA 3NGUA 3T1YJ 2WOMA 2IBOA 1Q5YA 3KTQA 4P73A 4MKBA 3CCSS 2M70A 1N34F 3NEKA 3R1HA 2Z0GA 4ZIWA 2VJUA 3RTVA 2RU9A 3MM7A 2BJDA 2NPFA 2HAFA 1S1XB 1RWNB 3SI8A 2XMTA 2K1RA 4WZQA 4O0IA 3MWBA 4X62F 1R6VA 1Q7YT 1UJ4A 2MEWA 3BGRA 3JSBA 3CC7S 4F0HA 3IGVA 1YIJS 3HFVA 4K4VA 1WSVA 1C1CB 3V6DA 3PIOQ 1SKRA 3O5TB 2FDNA 2HG4A 3I0SA 2GJFA 1DTQB 1JX4A 1YJVA 4NPOA 2MKCA 3P5TL 3KLEA 1UA1A 4JV1A 2K2PA 2B5JA 4DPXA 5HMYA 2FLPA 3D0GE 2G4BA 1RWXB 2PMZD 1RCXB 1RAHB 4LBPA 3ZZ0A 4ED4A 5ETOA 4PXCA 5C2CA 2LVWA 1HNXJ 2CZ9A 1C0TB 3OJUA 1GEHA 2XM3A 3IWLA 2BJ1A 1BD6A 5L8RC 4EBCA 3DHWC 3CIMA 2HFOA 3CXCR 4KGXB 2C3MA 4C3MA 2QT7A 2SXLA 2V8VA 2QTWA 3S01A 2XMAA 4HEA9 2DBBA 4IDKB 1DQAA 2RRBA 1KQSR 5AXKA 1DZ5A 3F56A 5M2RA 3PV8A 2DNLA 2Q3PA 4W92B 3AJ2A 2R7WA 3GILA 4NEZA 1PO6A 2B9XA 2GAGC 4P52A 1RDRA 2WONA 2ZH5A 2NXJA 5DG8A 3OL8A 1HI0P 3W2VA 5IZHA 4EGLA 4N5SA 5LT5A 4P71A 3S7RA 5BR8F 1FXDA 1EHWA 2CPFA 1TAQA 3FDSA 3D1QA 4MJKA 4ZPAA 4LVNP 1U09A 2PMHA 2Q6BA 5LMNJ 5GAHI 2NYHA 2L08A 3PEJA 3K8VA 4F2SA 2BV3A 3WX8A 3N6LA 4ZVHA 1TZ0A 4ANDA 4AUKA 2XC9A 1HLWA 2K8GA 2B43A 1W26A 2EWHA 4DHVA 1TUVA 1YRTA 5J2QA 1D8YA 2DT9A 4BWJA 3MPVA 4O3PA 1EQMA 4WKRA 4LSNA 3FFIB 1ZA2B 1AFJA 3W2WA 2VPWB 1RJJA 2QLXA 3P96A 1S6UA 3MAQA 4ID5A 4LF6F 2VBWA 2PA3A 3ZZYA 4PYAA 3SCLE 1R0AB 1RBLA 1RTIB 3NOCA 1SL2A 3B4DA 5HP1A 5F41A 3DGVA 4TU7A 4C7QA 2D3OR 3C6TB 3R6GB 1X4HA 1NHKL 3HVAA 5E5NA 4LRFA 3E01A 5K14A 4PEOA 1O6XA 3M2VB 4XPCA 4QU7A 2KTQA 4KGVB 3SDEA 5ETMA 1K73T 4G1PA 1DY3A 1LWFA 4B3RJ 4C8MA 2J8SA 4QPXA 1HBMB 2RRNA 4RO0A 4CM0A 1ROFA 3I0RB 2CVIA 4IH5A 1J5OB 3MPWA 1OO0B 1H6KX 1HR0J 4ZCIA 3SQGB 4N41A 4EK2A 3BGUA 4OHVA 2W2OP 3US5A 3PVXA 1BMQB 2IRYA 4WE1B 2CG4A 3RU0A 1QE1B 4C0BA 3DLJA 1VQYA 4PG7A 3QGGA 1J2VA 2JX2A 1AT1B 3N01A 1DLOB 4CO1A 2WK4A 2I8EA 2Y0BB 3TYTA 2PSZA 2VODA 1YQHA 3DLGA 3KYLA 3OLBA 1AUDA 1GXTA 2FVPA 4DSJA 3H4BA 3O3LA 2V69A 1VC5A 2CAJA 1SI9A 5LMUJ 1NKBA 4DQPA 2C3YA 1YKWA 5B0FA 1EARA 3E2EA 2D69A 3QWPA 3H98A 4LR8A 1X4BA 3M2RA 2JHEA 5ETTA 3Q22A 2R7OA 2GGPA 5A0YB 3PKMA 5HN0A 4LIRA 1Q1KA 1I3OB 1RA6A 4J9QA 1QSLA 3R5GA 3AJ1A 1S1VA 2FHKA 2FVQA 4GVBB 3MF5A 2V4RA 4PRFA 1H7XA 2ZKTA 4ECXA 2XZDB 1J5EJ 2MMYA 4M63A 2HHVA 1NZ8A 2E5LF 1IR1A 4F04B 2ATLA 5CD4A 1RWVB 1EP4B 4PXEA 3CE8A 3FUYA 4JI2J 2CQ4A 4KPYA 2CPXA 4ZITA 1U4BA 2V8PA 2HNYA 3G82B 1UVJA 1S1TB 2DXDA 1VJQA 1RTHB 3NCPA 1IBKJ 2KRRA 4Y3CA 2QX0A 3MEGA 3TJ8A 4FNIA 2V68A 4WK1A 3OR2B 1RAGB 4H54A 3OL7A 2EK6A 1IQTA 5DZ7A 4FF3A 2UVVA 3SCJE 3AHPA 2HMIB 3A12A 1IM4A 4X66J 5JJBA 1UVLA 2UUAJ 2RHQB 1ZPVA 2JC0A 4NLYA 2ROGA 5KG3A 1XK8A 3MCMA 2JSXA 4YR0A 5KOWA 1YG0A 3ICLA 4JV2A 1IKXA 1I6JA 4DXLA 1RB0A 4ZCKA 2CZVC 4DOZA 2D41A 4QIFA 5KFPA 2FVRA 5B0EA 2P8IA 2K7KA 1JLAA 2ADCA 2YH1A 5B0AA 4Q5VA 3M8RA 3LP1A 3C14B 1VFJA 4ED3A 1X9WA 1UETA 2D3UA 3A8JA 3HHLC 2FZGB 2V94A 3O6QA 2YNFA 1HNWJ 4FF1A 2DGUA 3DLKB 4LF9F 3PZPA 1BQNB 2L9WA 2B9WA 5A8RB 5HVGA 2NUUG 3DHXA 1B99A 1WKLA 3QLHA 3K8WA 1JLCA 4ALZA 2CA9A 2OPRB 2JLEA 3BKFA 3NMAA 3V4MA 1ZOTA 2XY7A 3GFYA 1F6TA 4WU2A 4E0DA 3J7AN 4CP5A 4LF4F 1HL6A 2BKNA 2VB6A 1RT4B 4YDXA 2XY6A 3GFHA 3T6BA 4FN5A 5IS2A 3D68A 3GFXA 3RZAA 4ZPTR 4F3QA 1R0BG 2HQCA 1RAIB 2E9TA 1S4EA 2BE2A 2B4VA 4KT0C 4R5PA 1Y10A 2AWZA 4ES2A 4WKYA 1T95A 1OSDA 2GJ2A 1C1BB 2UVRA 2Z57B 3PYEA 4JV5J 3ELHA 2DR7A 3SV4A 2ZHOA 3RBXA 2J0QD 4K4UA 3PKYA 3Q8PB 3Q8QB 2AGOA 1YRXA 3C8YA 3PEHA 2KB2A 1N36F 4AD6A 2NCKL 1QSSA 1K9MT 1WF0A 1N5TA 4OJ3A 2ZBRA 2PN6A 5HMXA 2HQ3A 2J6UA 5A8WA 4ECSA 2XYGB 1VC0A 1KTVA 4YUDA 4USIA 5HQMA 3UW1A 3QATA 3CT9A 4NI2B 3RW7A 1UEKA 4OI3A 3CC2S 4Y00A 3HM9A 2F8MA 4RW9B 1YWXA 4ICLA 4DR6J 2BANB 3NAHA 5J2PB 1N5SA 3VF0B 4O4GA 2KJWA 3CWJA 2KYXA 4ZP9A 5KFZA 1FNOA 1X4GA 1GQEA 2J9DA 3M6XA 2G2ZA 2XMUA 2ZZNA 5HQLA 5KAKA 4JI7J 5D4PA 2HHTA 3KWMA 1ZM9A 4DV2J 2EKYA 3CDWA 4IFVB 2H54B 1S0MA 3Q2TC 4UOHA 2ASDA 1JLQB 4C4WA 4JI1J 3MM6B 2IJRA 2ZJQQ 4OZ0A 2AZ3A 2VG7B 1L3KA 5ETSA 3K58A 1H38A 4CI0B 5HATA 2I38A 4YR2A 5BYRA 3PR4A 4QIWD 1ZM3A 3MM8B 1TKDA 1SJ1A 2OFHX 3F41A 5L9NA 1O5JA 4CIOA 2R7UA 5IT0A 3RRKA 1SB6A 2JEIA 4RW8A 3VAFA 2IM1A 3IA0A 1OYEA 1HNVB 3TO8A 2HRUA 1CC7A 1WC0A 3HHNB 2FC9A 2QFJA 3ZNJ1 4CLYA 4MK7A 4JI4J 1UZHA 3IGNA 2E5IA 4IFYB 1RAJA 2DNHA 1TV6B 1B3TA 1NSAA 1NK6A 2NZCA 2VDHA 1RT3A 4PUOB 3BM7A 5C2GA 4TQSA 3CC4S 5ETKA 4DPYA 3R3TA 3T9ZA 4X4NA 1GAOA 5CAAA 2VPYB 2ZWPA 1F5BA 4U8VA 2BXJA 2DJWA 3ZZTA 4DX7A 2ZZTA 5LSRA 2HLTA 4CZCA 2KVQE 4W98A 4WP9A 2C3OA 2DPJA 4QWAA 4NXMJ 1T05B 2JZ5A 3Q8UA 1OS5A 1IBLF 2V2QA 3VZIA 3X3UA 3W8PA 2DH9A 3HZEA 3DRYA 2BJ9A 3F0NA 5B7WA 3GTYX 3OD2A 4PZVA 2VBXA 2L9NA 1CBKA 4AFFA 2ZOGA 1PAEX 1T3OA 2ALZA 4NZ0A 1QTMA 2D74B 3LP2A 3TUZC 3QRQA 4OZLA 3V6DB 1VGYA 2E29A 3QAEA 1F2GA 2RH3A 4I6AA 3D6TB 4BHQA 2WAQD 1LFPA 3R5AA 2B5JB 4ZVUB 4ZPBA 3PTWA 1SBRA 4RPFA 1M5HA 2QA4G 4KHPJ 4OYOA 3A4TA 2UV8A 4PXBA 1TVRA 3NS7B 4LF1A 4J9MA 1JLGA 3PW2A 3RBZA 4IYQA 1ITPA 3OXLA 4XDCA 4B3MJ 2G0CA 4M5MA 1HIYA 2W7PA 1JLFA 2XI3A 1IQZA 3KLFA 2WVFA 4LFBF 4A8SA 1BQMB 4ZLJA 5C25A 3OL6A 1TQLA 2DISA 5I3UA 4CYUB 1E6VB 3OFFA 1RTZA 2HS0A 4U8YA 2R8KA 2FZCB 3TX8A 2XO6A 3TEGA 4JI8F 3VGUA 1GMUA 3KG1A 3QGHA 3I55S 5T7LA 3N9UC 2VQEJ 3BV8A 2D1CA 3NOGA 4DPUA 3C6UB 5ADZA 3W2VB 3TNVA 2IAJB 2YX4A 3AB4B 4OX8A 4FPIA 4F4KA 4O3RA 1KNZA 3J7YI 4Y2AA 2KXHA 1DAXA 2LECA 3MMJA 2IRXA 1D0EA 1U7LA 4KSEB 1R7IA 4DUYJ 2B6AB 1PYTA 2KXNB 3HT3A 1AYEA 4LFAJ 2B9YA 3M6UA 3DC2A 5JXSA 2PE8A 2UUBF 2R8JA 3G4SS 1MSWD 3CJ5A 3W64A 3H90A 5D6GA 1SC3B 3LGNA 1TK8A 3FRYA 1IKWA 3CULA 2BOPA 2E44A 3BS9A 5DM7Q 4OZJA 5J2QB 2XLIA 4MH8A 1YJRA 4H4MA 2OLWA 1KLMA 3V6JA 3EZ5A 5HMWA 1NDPA 3GJTB 3BKTA 2VBZA 4MTPA 1CS4A 1NCLA 2VDIA 1NU4A 4P10A 3U1MA 3UE2A 3W2WB 1L3VA 1T7PA 4DR7F 3R7SB 4K0KF 3HHLA 1OYDA 2FJDB 4ID5B 3D54A 2ZZMA 3I31A 4F50A 1WG4A 5EUHA 1SV5A 5HJXA 4Y65A 1TL3B 1FJEB 5HP1B 1FKAF 1FFSB 3CDUA 2DHXA 1NH7A 2I1RA 1KD1T 1PAUB 3EICA 1UVNA 4OI0A 4WFBQ 5K14B 2HNZB 2JVRA 5GMDA 1NXIA 4A8XA 1IBMF 4O44A 2CQ3A 2R7TA 5H9EK 2NSBA 3CCZA 2AGQA 4LQ3A 3KJFB 2M9KA 5KFBA 2OPSB 2MGZA 3MM5B 2E5JA 4NOHA 4V19X 2GQ2A 2OMOA 4KY3A 2VG5A 1VRUA 5JMNA 2WVEA 3MPDA 2RS8A 3ADAC 4UF4A 1CSJA 1IR2A 1JB0C 3AFGA 1NKEA 2EVZA 2YKNB 3CMES 5IM0B 3T1HF 3EGWB 3VTIA 3NNCA 5F8JA 4ZK7M 1KEKA 3R9LA 4CO4A 4KFBA 3IAM9 2ERRA 1HHTP 4FNHA 4GKJF 1CJVA 2HVDA 1KVKA 4PG5A 3Q8YA 4Y34A 4X4TA 2VFSA 1NUEA 3CJKA 1YTYA 1OWXA 2ZDPA 4J5OA 2ZM6F 1HPZA 1TL7A 2LKZA 5LM7E 2VKZG 1LFWA 2M0GB 4DV4F 4WBFA 2H9ZA 1LV5A 2BJ3A 3MM9A 3M2RB 1AROP 4MMOA 1FCAA 1IKVB 1VRTA 3EVMA 5K20B 1X0PA 5C24A 1S1VB 4ZN3A 2FJVA 2AJ0A 2XZWA 1QDUB 2RKIA 2P9EA 3ENQA 1N52B 1TFWA 4ZVRB 2OP5A 2ZH7A 4J9UE 1SC4B 3DLEA 4DBQA 2HBZB 2NYIA 1N0UA 1PC4A 5DETA 2QMUB 1SH3A 1XMQJ 3V81B 1ZH5A 1U25A 2OPQA 2LQBA 5B0GA 4DR2J 3KHLA 1TKZA 2V2VA 5J2NA 4I67A 1HWUA 2YNIA 1P6TA 2AJ4A 5D4NA 2HFVA 4KH1B 1Q82T 2M3DA 5CD4H 3AT1B 4OI1A 2KT3A 1UW4A 5H9FK 3M8WA 4J90A 2C3PA 3IXQA 1NLKL 1T9UA 4FXDA 3AA8A 2HVHA 3GP9A 4WFXA 1DARA 3C16B 3D2WA 1L5UA 5KFTA 4C9DA 4NCAA 3OHBA 3W5ZA 1WC5A 4YB6A 3TAQA 3PO5A 1NK8A 3HPOA 1T02A 3LO3A 4QIEA 1RT1A 5EN1A 4NLXA 4M5HA 2I5JA 1VJWA 2RRAA 2JVOA 4A4JA 4CO3A 5MAOA 3DRXA 4QR2A 3ET6A 1IKXB 2R4FA 2R9LA 1BC6A 5JVGQ 2XWYA 2MY7A 3RRHA 3LOUA 4CO0A 3DRRA 3CVKA 3PACA 2XMWA 1IN0A 1FKOA 4KV8A 1GTEA 4B9TA 3LP1B 4MFBA 3PIPQ 2A3JA 4NMLA 3G96A 5AJ3J 2G2YA 1ZAXA 3CCES 1KQGB 4I6WA 2W9CA 3CMQA 3TZYA 4JUZA 1HQEA 1VRQC 4YP3A 4U7CA 1VISA 4X64J 3B6BA 1OIAA 1UCNA 2KN4A 2G1DA 3MFIA 1PGZA 5SZTA 1PIEA 1T03A 3POTB 2V2ZA 3EGVA 3OTOF 3HSDA 2WB4A 4ELVA 1TFYA 4B3TF 2QYGA 4EI2A 4FKYA 5AE3A 3QFHA 2GIFA 5KFGA 1N33F 1RAAB 2RUSA 1DFDA 4H4KC 4URQU 3N0VA 3R5CA 3FBEA 3W61A 3BR8A 3MEKA 4OZ2A 3PW0A 1FX2A 3UVJA 4Q44A 1VBXA 4EZ6A 1UWBA 3VAMA 4O3SA 1RYSA 2VF3A 4BS2A 3PM9A 3SMZA 1IJFB 4ZDNA 3O44A 4GKKJ 1FJGF 3SCKE 4L75A 2XSFA 3Q23A 2V9KA 2Q43A 2HQIA 4X4SA 2V4QA 3N28A 3GIIA 2YNGB 1QVGR 4ZVQB 4ES1A 2JLFA 5A8KA 5A8WB 1HBNB 4DQQA 2WHOA 4FS1A 3LWMA 1FRXA 2BEFA 2JNJA 4K59A 1JNRB 3GJRB 4C8LA 2NQPA 3CCRS 3LPYA 4EYHB 2EC0A 2ASJA 2B51A 2QA1A 4IQMA 4ICLB 2R2UA 3BPDA 1Q79A 3DYAB 3QRRA 1WKKA 1IM6A 1NSQA 4DR5F 3MTKA 1YBTA 2CWXA 2P6SA 1Q16B 3WC0A 2V9WA 2I0XA 3RGIA 1T9VA 4LQ9A 5KG1A 2W2PP 2W9AA 3M2UA 1AXQA 3QIPB 4M5KA 2NZ4A 3ZZUA 4QW9A 1F1BB 3GIJA 3AODA 4P75A 1U2CA 2A0FB 2XO7A 3E8OA 4IO9Q 1IWAA 4F3MA 3FEZA 4QYZJ 4NLUA 2DK2A 3PRBA 4UY8T 3RAXA 4I7FB 5KFCA 1RAOA 1FTRA 1UJ5A 1GT8A 1TP7A 1GK8A 3OUYA 1AFIA 1WDTA 4LMZA 5DG9A 3PX0A 2RNEA 3UFCX 3Q2SC 1S0OA 4K2JA 1SQEA 2DR9A 2XSJB 1NK4A 1WTFA 2W4CA 4OHYA 2W1BA 3NP5A 5CYMB 3QNWB 3DI6B 3OW2R 2N4CA 5I42B 4RW8B 3OV7A 4DPWA 1UAWA 3SXLA 4NLPA 1H2UX 2BMBA 3HZGA 4QW8A 1S59A 2QG9B 1FEEA 1U6BA 4A8QA 2R8HA 1TKTA 4F8RA 1RTJA 2AEJA 1WEXA 2MJNA 3BH7B 1ZM2A 3VQSA 3N6NA 4K2XA 2P9GA 4KB7A 4M5GA 2MZQA 3PFEA 5FD1A 1NPPA 4RWWA 2MQMA 2MLXA 5KT2A 1LEOA 1VIXA 3FMBA 4WIIA 4DN0A 1I94J 3WIVA 1VCTA 3LH2S 3RBEA 4AT1B 1NMEB 1BLUA 2BM0A 2MZJA 3TAMA 3JTOA 3IR7B 4DMZA 5DZ6A 2R8IA 2HHWA 2WSCC 1S12A 1RAFB 2OEJA 2DNMA 4HKQA 2ZE2B 1A7GE 2COLA 3JSMA 2MLYA 1VBZA 2D3O1 3I5AA 4TU8A 4KGKA 3CJ8A 3V4IA 1KQKA 4YN3B 2CIMA 1B7FA 1XNQJ 4I6YA 4I2PA 5L1KA 5K8MA 2LQ5A 3KDNA 1FRMA 3TWZA 2C2NA 2J0SD 2UVUA 3QT7A 1RQ0A 3QFWA 2R2TA 2ZOMA 1VHFA 1C0UB 3P8BB 4OV1A 1F60B 1K47A 3MD1A 3KG0A 1NJXA 2RDDA 1TVRB 2X3GA 5F9NA 2F4VF 3O2IA 3KXDA 4N56A 1S6OA 4M5NA 2E9ZA 4KPCA 1S1XA 1Z4UA 4XIUA 4MKAA 2PFFB 2FC8A 1M0SA 1S6QB 2QA2A 2XEXA 2GZOA 3KUEA 2VA2A 2J7WA 4CLZA 1RBOB 3UWTA 3BGLA 5F0WA 2W24A 5D77A 1C1CA 4LIWA 4J7CA 2WSFC 2N4DA 1SJQA 2DNOA 4WP8A 4JI3F 3VV2B 2HQGA 1CULA 1HKAA 2MQNA 2YWKA 1WOSA 4J9NA 2IMOA 4K4YA 1NSPA 2HZAA 4HLBA 2F7VA 3D9BA 2DR8A 3EGZA 5I4MA 3AQOA 2CJBA 4JB8B 2KI2A 2XGQA 2Y1RI 5E2QA 1P1LA 2ZH2A 2DITA 4P74A 3J81Y 2DHHA 5T41A 1WG1A 1WC4A 4DR1F 4KR0B 2OPPB 5IOLA 2PI4A 5KFUA 3L7PA 1BY9A 4NYOA 4RWXA 1QM9A 4ELTA 4PQUB 2CQHA 1NKCA 1YI2S 3PCOB 2CPZA 4UOFA 4YB7A 3GCWP 3CUNA 4IOCQ 4DV5F 2UUCF 3MR6A 1IKWB 1FT8A 5J1NA 2EC2A 3UN2A 2WVBA 4ECQA 2YKPA 2UXDF 5EDWA 3MUTP 5KFMA 3HSZA 4UTGA 2DPIA 2DIVA 2D9OA 2W8KA 2RS2A 4HHUA 5E7OB 1RHKB 3THTA 3OFEA 5E3PA 1KRPA 4L73A 3VVUA 3UDLA 1SV5B 2Z8QA 1ZZNA 2G2OA 2O1PA 1K0TA 4C97A 4K4WA 4DV0J 4DS5A 1FNXH 1UMJA 3TA0A 3QMQA 2Z56B 1TK5A 4UQGA 4ILRA 3MPYA 3EXYA 3UN3A 4LSZB 1NNDA 1BE4A 3MGJA 3FFIA 4XPEA 1IVZA 3JYTB 1RP5A 1FJCA 4EWTA 3K59A 1N5YA 5KFHA 1VOMA 2MHNA 1F5AA 2VG5B 3OHAA 4ECVA 3UCUP 4I2QA 1RT6B 4FZVA 1RTIA 4JI0J 2NSCA 3MR2A 2AJ1A 3C6TA 1KBRA 5D0GA 3IWXA 4BC7A 1ZETA 3L7UA 4KFBB 2LEPA 3C46A 3UNGC 4G1QB 5KFYA 4LF7J 1IR0A 1B7YB 4USWA 3AH6A 3VAGA 2AEFA 1SVDA 1U8SA 2LEBA 2HFUA 1MN7A 1WHWA 3JSYA 1HBMA 2VC0A 3R1LA 1D9AA 1FX4A 2XTJP 1MN9A 1S77D 2KHDA 1EB0A 3DRPA 2B7BB 5L1JA 8RUCA 3PJXA 1N32F 5HROA 1A6LA 2EFQA 2KO1A 4WE1A 1QE1A 2DRBA 4ANCA 5D0EA 4BC9A 4C48A 5K8NA 2FY1A 3WBZA 1DLOA 3EZUA 2ZHAA 2FHJA 4DUTA 1XMOJ 4CLSA 1BWVA 4OZ5A 2AIRB 4HTJA 4DQSA 1SJ3P 1Q4RA 1ZTTA 4R25A 4NXNJ 1JIHA 4NE9C 1FRHA 3DLEB 2KM8B 3MR5A 2J7UA 1WELA 2AW0A 3GR1A 4I64A 2QV6A 2Y1JA 3JTPA 6FDRA 2OPQB 3LAMA 1WHYA 2DXFA 2FYXA 1V3RA 1TKZB 4CDIA 3KMQA 2V8DA 3UO0A 5B0CA 5J2NB 1S7IA 2YWEA 5A0YA 2JEGA 3BDEA 2B56A 2UXBF 3BSAA 3A1YG 4JI6F 3KHHA 4OHZA 3OSPA 4F0KA 8AT1B 4LFCF 3I96A 4I68A 4DR4J 3AOCA 3NGTA 4RW4B 5KG4A 2OI2A 1EP4A 3V6HA 3EVOA 2JL9A 2EFNA 4ZVOB 3RYLA 4ED6A 5I3QA 2KT5A 2JDJA 3C2PA 2CFXA 3M4XA 2IHR1 5FJ4A 2MKKA 2HNDA 2QGFB 1XTZA 2Y8WA 3G82A 2O3DA 3TA1A 2AP6A 1ACMB 1RTHA 5GVQA 2VC1A 1RSCA 4FYVB 5DG7A 1AZSB 2VUGA 2FLOA 4LF8F 3DDNA 2W2QP 2B7CB 2OHDA 1NZAA 4C3LA 3EPIA 4Y2CA 3M8SA 1FERA 2RDIA 2X1GA 3ZTPA 2E1RA 4YHHF 2W4PA 1R3NA 1UEUA 2WSEC 3IO1A 2PEHA 4JYAF 2OEMA 1KWMA 4NYPA 3CCVS 2VICA 1HQEB 1O51A 3TJAA 2OMLA 3CD0A 1FHTA 4IR1A 2KZMA 2YQ1A 4WFAQ 3AXKA 2LMIA 4HR2A 2FVCA 2WW8A 3QRPA 1MG7A 3ETOA 1N48A 4C98A 2V34A 1T03B 1LWCA 1VQPS 4PAAA 1FKPB 5EGYA 1Y4ZB 4AXIA 5KOXA 5BYSA 3SSQA 4WTYA 3C14A 3AD7C 2UVWA 1S9EB 2WTFA 1NK7A 1WTBA 3PW4A 4YS2A 5D78A 2WBRA 5ETRA 2CPIA 5LJ3Y 5F3ZA 1RWUA 3TX0A 4L3NA 4DV6F 2V6AA 3DLKA 2BR0A 5KFRA 1YVFA 1VR6A 1BQNA 2V2KA 5IFMA 4C11B 1DHMA 1UPPA 3HVTA 4KYZA 2DNPA 2A6MA 4U67Q 1FFGB 2OPRA 2R7QA 5KT3A 2EK1A 1H0HB 4DSKA 2Z2MA 4M5DA 4BDPA 1KONA 3R2CJ 3ILIA 2F8HA 5H1SV 2RHSB 2H4WB 5HO4A 4IG3B 4WP3A 2J7KA 3HCXA 4CT8A 1REVB 4DU7A 4C8KA 2YXLA 2EG2A 1MU2B 3CNQP 1C1BA 2ZDOA 1HBUB 1WC6A 3M32B 1PJ5A 5E41A 1RHMB 4LR9A 2R7RA 1V5IB 1XMBA 3CCLS 2DVIA 1PBUA 2HQDA 2VV5A 3JSRA 4A48A 4IO1A 4X65J 4L74A 3MCSA 1RACB 3MMBA 2VG6B 1RLCL 1XEZA 3K5NA 2RD5C 4LUBA 4DSLA 5HAOA 4OX6A 4FYXB 1QAIA 7FDRA 5KFNA 1CJKB 4NI2A 2VQFF 4M1KA 3A13A 2D7SA 4DL2A 2BW2A 3OFHA 2W2NP 4RW9A 1FDNA 3H8YA 5LJ5Y 3BF4A 4DL7A 3RBDA 3VR1A 2F8EX 3OUYB 4QBUA 3M9NB 5J2PA 2DB1A 2FIUA 4NLWA 5L9XA 3FBCA 3IBWA 1U1NA 3D7SB 2ZD1B 2QL5B 2AJ2A 2GX8A 3OLAA 4K50A 3QO9A 3FSIA 1RT7B 3G8TA 1JKHA 2IA0A 2C1EB 1SJ4P 3GSIA 2XLKA 2Y1IA 4NRTA 3NGSA 4XDDA 4ED2A 1JLEA 3FSYA 2KXFA 1TAUA 1F9EB 4IFVA 1RTJB 7FD1A 1JLQA 4LVOP 2ZJRQ 1QSYA 3AJDA 3UI3A 1V3SA 3E3XA 2A2CA 4PPZA 2MZSA 2VG7A 2HFZA 3QIDA 3GYXB 1QJHA 2GIQA 1Z2ZA 2EFPA 4QWCA 2CPHA 2EKNA 4DLGA 2R7VA 1KC8T 3T3FA 3RR7A 1HYSA 4QIVA 4ER8A 2QE5A 5A6PA 2AX0A 2ZH3A 4KJIA 3NWGA 4L3KA 2A18A 4N47A 1K8AT 2F5GA 2N3OA 1D8ZA 1GMWD 1JK9B 2Z58B 2CDQA 1IKYA 4IRCA 2XCAA 3BBFA 4A8MP 4IFYA 2PA8D 1SL0A 4PUOA 3BGOP 3NNHA 4I2PB 3DDIA 2BVZA 3TUJC 4D3GA 4UOCA 3F73A 4DUZF 4USHA 1U0SA 1S99A 3TARA 2X51A 4RZRA 3R8YA 2CQIA 4DV7F 2YKAA 1Z2LA 2CNLB 3BEGB 3TI0A 3KK1A 3EPGA 1N6QB 2FGCA 4EEYA 4EZ9A 4O23A 1T05A 3Q83A 5ETPA 2XMVA 4RU9A 2VFVA 2HBRB 2GW8A 3CJ4A 4E2FB 3I9V9 5KG7A 1RWKB 2O66A 1TL1A 1U6FA 2Q6CA 2W2MP 1NO8A 2GVZA 3ILOA 3BB5A 1FNMA 2GHVC 2HGMA 2FZKB 1LK5A 1FE4A 4XO0A 3H5SA 4KTQA 1FRLA 2H5IB 3KUHA 2YBVA 2MLZA 1CULB 2DYAA 2FHMA 4RBUA 1MMLA 3SCIE 1G6BA 3OXGA 5DGAA 1HNZF 2VPZB 3CJSA 2JFKA 1T9WA 2J9EA 5DO2A 5IC4B 4USUA 2IPOB 1H7WA 4PWDB 3U02A 3RB4A 2ZNYA 1WWHA 3FQLA 2MZ1A 3R27A 1UZDA 4DR3F 2OJ3A 4OYPA 2NREA 2DXEA 4NZ7A 4K7QA 4H4OA 1ULRA 2XCPA 3MEEB 2DHGA 2PC6A 4Q8FA 5D3GB 2B0GA 1BQMA 5DJBA 2QMXA 4IOBA 3NNAA 4CYUA 2DGTA 1UW9A 4DL3A 1E6VA 3NL0A 5EHHA 1MW7A 2HZVA 1BWEA 5GAGI 2GVDA 1R8AA 2MSTA 2ZH9A 1VQMS 4X4UA 4C3KA 3C6UA 4A8KA 4F0MA 2IAJA 4GO5X 1B0VA 1D1UA 2HW3A 3HDSA 1R6YA 3R2DJ 2JFDA 4OX9J 2G0IA 2HAIA 2HS4A 1SH0A 2J0XA 4TQRA 4DL6A 4OYWA 4UW2A 3H4DA 1MMDA 2B6AA 3MECB 1GX6A 1U2FA 2RDJA 4ZPDA 4U96A 3MDFA 2ZHBA 2MKYA 3NLCA 1TTHB 1MWYA 2GNKA 4Q0BB 3KG4A 1VDHA 3S1TA 1BQXA 4ZJQA 2AYGA 1U8WA 4M5JA 3GSDA 1Q78A 2E5HA 2UU9F 2DHAA 2BYCA 1VQSA 1ZAWA 1N4LA 1ZA1B 4QIGA 4M95A 4RR5A 4UUWA 4ZP7A 2KKHA 4A8YA 3CD5A 3HXMA 1N5YB 2J5AA 4XAKA 4A8FA 3GIMA 4YY3F 2ZUGA 4WYWA 4IRKA 2Q1LA 4M94A 4I2QB 4P7VA 5HK4A 2UV8G 1NB2A 4ZVFA 1TL3A 3QJPA 3MAAB 3KJVB 2R2RA 4AYBD 1U1QA 1RABB 2V50A 2UP1A 3OJSA 3L7OA 2M4MA 4R8UB 1N34J 2XHCA 2HNZA 4F4XA 3X1LB 3C66A 4DPOA 2KH9A 5H9EJ 2GFFA 3KLIB 3JQMA 3TZXA 4NEYA 3DGPB 2LDIA 2OPSA 1YGYA 5L38A 2C2RA 1R8BA 3MM5A 4X62J 2X1FA 1SH2A 1BHNA 2ADBA 2QZ8A 1X4FA 3DRPB 3JQJA 3I5BA 4B17A 2YKNA 5IM0A 4HHJA 4QR0A 4OJ1A 5HROB 5CYJA 1IUJA 3NCQA 1WF2A 4MKVA 1Q8LA 3OTCA 3U1NA 3EDQB 4ZP6A 1G7CB 2V67A 3JTNA 1NAQA 2OKQA 4D3HA 3NGKA 2DR5A 5IWAF 4FBTA 1PC5A 3TZWA 1U6ZA 4ZVPB 5KFFA 4UOGA 2CQCA 5IQQA 4CRJA 1NPRA 2J9CA 2X1BA 5EWFA 2QRRA 2HGLA 4L6V3 3FJ2A 2HHUA 4XK8C 4IH7A 3V6KA 2HRYA 4NLOA 2J6TA 3EUNA 3PYDA 1IKVA 3WC2A 2ZBPA 5KFSA 5D0HA 3D0IE 3SIPB 5BR8J 2IYIA 1X5SA 4ZLLA 4LSLA 4EO6A 4CQ1A 2VASA 2BKPA 1HD0A 5AE1A 2ROPA 3BZQA 2J6SA 3PYGA 3MAHA 7AT1B 5DDRC 2RMLA 2YTCA 4J9SA 1RTDB 3CJRA 2H4YB 3V81A 6FD1A 4LR7A 3J7A1 3P3DA 3HSGA 1OMSA 4M5IA 2GC8A 4Y2IA 3G6VA 1NDKA 3GB0A 3L3CA 2HNDB 1RKIA 5CABA 1XNRF 4DPTA 4TKTA 3BGFA 1CLFA 5H9FJ 3MOJB 3DNCA 2R42A 4CLUA 1OQ6A 4NYZA 3QJLA 2WVCA 3ZTSA 1UVKA 3C16A 1KN6A 5BXIA 5EX3A 3IRXB 3H2LA 2C2ZB 3FCVA 4AE5A 4LF6J 1NK5A 1NJIT 3BPSP 3W62A 2GMJA 2CDRB 4LF5F 1OY6A 4CWBA 3KKFA 3TAPA 3PHEA 5E3QA 5DQIA 4O3OA 1GH8A 1LNQA 3AQPA 3A8IA 2KU7A 3THVA 5F3TA 3M30B 2ZUAA 2YPYA 3W5XA 1FK9A 1LWCB 2M5YA 3UDVA 2GA7A 3M9OB 1DTTB 3NY0A 3RR8A 3EX7B 1H3DA 1Q5VA 2JEJA 1RUSA 3EM1A 2UXCF 2CUYA 2J8AA 1HI1A 1EAYC 3UD4P 2QL7B 5AE2A 2F65A 3GZ7A 2YH0A 3OTBA 2LYVA 1UVMA 4DCPB 2ATCB 4QWBA 4NX9A 1S79A 2EG1A 4OYZA 3HVTB 3ITHB 3FEXB 4OHXA 4JI5F 2MKSA 2LU1A 4B3OB 3KUGA 1URRA 5HVFA 1HNIB 3POTA 2XGPA 2KFYA 1QUPA 4J9KA 2Q79A 4M5DB 1UA0A 1XWLA 2ILZA 3AOBA 1M5KC 3ISZA 4DZDA 2DR6A 2X1AA 2ZVIA 2GO9A 3W9HA 4ZA1A 5C42B 1TKXA 3DN9A 2E1AA 1KOOA 3CD6S 3M8QB 3KK3B 3J7Z5 1HARA 4ECUA 2JLGA 3LWLA 3NS5A 3N4WA 5KFEA 4USKA 3LGMA 3RAMA 4QPTA 2IM0A 3D6MB 3CJ3A 2PO4A 2YKMB 2R2SA 2VFTA 2BRLA 2Y1LB 4DV3F 5L39A 1T94A 4F4AA 3MMBB 2YNGA 3BH6B 5B09A 2HLUA 4AQYF 4B9MA 1P9YA 2ZNZA 4CH7A 1HBNA 2JOQA 2YWWA 3FC9A 2BRKA 3MMAA 1VQLS 3FSXA 2E5LJ 4DFJA 1VQKS 4DFMA 1BUXA 2IDEA 2CQ2A 2VD3A 3CGIA 1PCAA 2W7AA 4Z7YA 1S6PA 4OZNA 1YLXA 3DYAA 4YB5A 3CCMS 1SXLA 1XBWA 1RWOB 4ZKAA 3D1OA 3QO9B 4DS4A 3I32A 3QIPA 3L95X 1JKHB 2HBYB 2HWTA 1EKRA 4DQIA 6AT1B 1SC6A 4C8NA 2FLNA 1JLEB 1FA0A 5FDLB 4UY85 1WEYA 1WC3A 1YZ7A 3N79A 4FP9A 2CJKA 2DEIA 3DU5A 3T6JA 2P9CA 2KM8C 4C6AA 2ACMA 2IVMA 4I7FA 3JB9k 1RWMB 3BSOA 3PHTA 1SQFA 2AJFE 2UZAA 3HJFA 4J37A 5F9LA 2I6WA 4PABA 3T1YF 3FCWA 2XSJA 1FDBA 3P6YC 2HIYA 1XR5A 1FD8A 1RT5B 5CYMA 3DI6A 1HYSB 3G6XA 5I42A 4KQZA 4G65A 3M1VB 3K7RA 1R27B 4FKXA 4P6QA 2M7SA 3BBCA 3HLUA 3EWGA 4ECRA 2DGQA 3CB4A 2MYFA 4B9UA 1IKYB 1U49A 4WXWA 2AF6A 5T14A 4LF9J 3QT8A 4B9NA 2VONA 3LF0A 1U24A 1U0HB 5KT6A 1RHRB 1JJCB 3MD3A 4DCJB 2IVFB 5IC6B 3LA0A 1SJFA 2B8PA 2AMCB 5KFVA 3A3NB 3GG1A 4W4MA 1DURA 2QSWA 5KG2A 4LF4J 3FVYA 3KK1B 4DJBA 3OTEA 3GU0A 3HHDA 2CG8A 4ZPWR 1FI4A 2WCXA 2CPYA 1FF2A 3TVKA 1HNXF 2ZE2A 1M5PC 3GIRA 3MR3A 2GCFA 4M5LA 2IJFA 3CDAA 2BA9A 2QJ3A 2R3VA 1TUGB 3CCTA 1Y00A 3H5YA 5GADU 4ECTA 3G6YA 3MTJA 1TL1B 1NB7A 2GVZB 4URGA 1V5VA 3MEDB 2NR0A 2MQLA 5E0OA 3TUIC 3QT5A 3D5MA 1C0UA 1N36J 1WNEA 5HLFB 3ZZPA 1NJYA 3UPFA 2QO3A 3M8PB 4DV1F 1Q53A 3KLHB 1H72C 3DXSX 2G13A 3B4MA 2N3LA 2YQ3A 1UTAA 2LEAA 3HVWA 1CJTB 1RA7A 2IIHA 3KJQB 1S6QA 4YB1P 4NCGB 2YKQA 4H4OB 5DLFA 4RNMA 2HKEA 4ZVSB 1Y3JA 3ULHA 2V8HA 5BJRA 2IA6A 1ZAVA 1QAYA 3RG6A 4ZLPA 3DOMB 1S48A 4PXDA 1W2BR 1KVIA 3OVAA 5KFJA 3EJMA 2L3MA 4ZCMA 1M5OC 1RHUB 2ZH1A 2GVDB 1IBCB 2FLLA 1FE0A 4F3OA 3G2XA 3OL9A 2LXFA 4DX8H 1GTHA 3K5MA 2N82B 4GVLA 1D3WA 2HQFA 2JEFA 3NBPB 5A2QY 3JXOA 2VBYA 2ZKUA 4NLQA 4MYUA 4NL5A 2DO0A 2DNQA 4USTA 3BQ1A 2GO8A 2DCUB 2E7WA 3IG1B 5F8LA 2OPPA 3ENVA 1UFLA 1KKHA 4S0MA 2IRUA 4CTAA 1YJ9S 1O8BA 2BQ3A 4PQUA 2GIRA 4ZPCA 2Y8YA 4DSFA 5CZVA 3MURP 4FYYB 3Q8RB 1F3VA 1S49A 2B8QA 3EZOA 4AL6A 5A76A 2PD1A 3NGDA 2DRAA 1R8HA 4KKOB 3TR5A 2IFXA 4WPAA 4B3RF 1FESA 1CVJA 2XY5A 2E7VA 2LLZA 1NK0A 2G1HA 3DLHA 2I9SA 4C0HA 2YWHA 5KFQA 1HR0F 2CXEA 4J9PA 1RKJA 5CH7B 1S4FA 4UT4A 3K89A 2AV5A 1VC6A 1EKSA 4F36A 3BO3A 3T19A 1VQ4S 1FWPA 2DGOA 4DDFA 1PYSB 1K44A 1ZTWA 5K8PA 3PX6A 1FWLA 4KO0B 4TVAB 1IXKA 4MT1A 1OPIA 3FBFA 4HL9A 1S9GB 2E1PA 2IVYA 3J7YU 3V5RA 2HS3A 9ATCB 1IBLJ 4X2BA 5ETQA 2DIUA 1NJWA 5LL6d 3JYTA 5LMUF 4DCOB 2Q66A 4P2FA 4YDDB 4F4ZA 1RHJB 3KOAA 4CNYA 5B0BA 3SQOP 4W90B 4NRUA 2H5EA 4HDGA 3RUBL 4MK8A 1C2PA 1RT6A 1M1HA 1TK0A 3FK4A 2MKHA 3R6LB 1X4CA 1T0TV 3QYYA 4OL8A 1AB8A 2A2DA 5F8GA 2ZVSA 3KK2A 3Q8VA 2ASYA 2BJ8A 2C42A 4KGZB 4QR1A 5KFXA 1RISA 5KFDA 4G1QA 4DV1J 3E51A 4GC7A 4O4RA 1LW2B 2IDLA 1WORA 1J5EF 3BQ0A 1SIZA 5J1EA 3ISND 3QGPA 2KL8A 4ETXA 2PMWA 1YJWS 3PJ9A 2M52A 1G2EA 4JI2F 2BQRA 3OVSA 1KS2A 4LBIA 4LFBJ 3G8QA 1K0VA 3HHKA 1FVQA 2YQ0A 2IC3B 2LXIA 3JS9A 1F0XA 3ETMA 2B4PA 3NCRA 5L1IA 4MYTA 4JI8J 3IS9B 1IBKF 3GR0A 4ITSA 3QQCD 1UFKA 2AQ4A 1CPZA 3IR6B 1T11A 1MWZA 1NH8A 2C2EA 4EBEA 2C22A 1NK9A 5KTQA 5CQGA 2MDAA 4LSLB 4X66F 4J9VA 3DOKA 2UUAF 3R7NB 1S0VA 2BDPA 2AYBA 4OI4A 1JLBA 2UUBJ 4GMKA 5KG5A 3M9MB 4ED1A 1JXLA 2DGVA 3G71S 4CO5A 3GV7B 1HWKA 2QN6B 3KJNB 4U9RA 3DOLA 1WHXA 2BM1A 1VHIA 3UD5A 1ZM4A 3GYNA 1UWAA 1MROA 1YJ7A 4ED0A 4K4ZA 4NLSA 5D0RA 3W3SA 4LRCA 2DNGA 3T5KA 5KG6A 3CPWR 4DR7J 4RW4A 4K0KJ 3AB2B 1HNWF 2FJEB 1I51B 4PQAA 3MFHA 2ASLA 5E3RA 3IC1A 1SL1A 4WK3A 3OR1A 1UPMB 2CQPA 4J9LA 1EZZB 1RT2A 2L41A 1SUQB 4ID8A 5F8NA 2NXUA 2RAQA 3B8HA 1Y5NB 3Q0AA 2FB0A 3EDRB 1Y0HA 3CCWA 4J9OA 3W66A 5THWA 1JQGA 1ZYQA 1AZSA 1IBMJ 1FK9B 1B0PA 2BACA 2EFVA 2W25A 4K4SA 2YKOA 3AAWB 1CJUA 4FF4A 3CCUS 4P2MA 1L3UA 4Y6IA 2MKIA 2QA4S 4NWBA 4C8ZA 3MPUB 2EXUA 1MNEA 4OX7A 3P4UB 3RJMB 1NSKL 3C3LA 4JV5F 2IM2A 1FXRA 2ZH4A 4RUAA 3TOQA 1PSDA 2CPDA 5DDPC 4ZHRA 2YWFA 1N5QA 2ZOFA 3KLVA 4DFPA 3T1HJ 1R8PA 1HQUB 4YFUA 3D3BJ 5BYQA 3D66A 4RW6B 4YOEA 1CQMA 1B0TA 3P45B 4FVMA 4NA1A 4E8UA 1UKUA 4GKJJ 2V4JB 5IV3A 4C2MA 1FKPA 4TY8B 3P5BP 1KHVA 3HFZB 4B02A 4HACA 2VZ9A 2ZM6J 4TYBA 3CD7A 3O8WA 3K17A 1S9EA 4O0NA 4DV4J 2WW4A 1TKXB 4DR6F 3IP0A 5K9FA 2FD2A 4GRSA 1KLNA 3G86A 5IV4A 5AXNA 3IWNC 1U47A 4RUCA 3PY8A 1X8DA 1RZMA 4C11A 4DL0C 4NLVA 3UCZP 2ZJPQ 3L09A 1HMVB 3LUYA 4OJGA 2NLWA 4K4XA 4F4WA 3OQ2A 1EETB 2I2YA 1T9YA 3SSSA 2DGWA 1NHVA 4JI7F 3DLLQ 4CNZA 4HI1A 3CTRA 3W8GA 1VQ7S 2PDAA 4DV2F 5U47A 2IY5B 3DCAA 1B70B 5J2MB 3U1LA 4IG3A 2RF2B 1XR6A 2E5GA 1FD2A 1NDCA 4JI1F 2HK2A 1REVA 3R5BA 1RWPB 3MMAB 3W60A 3C15B 4EFAC 2XBPA 3LALA 1MU2A 3ENWA 3I4PA 2J76E 1MMNA 3DRSB 3NGRA 5E33A 3A8EA 2VU5A 2NUHA 1HBUA 3M32A 1YK9A 4OJHA 3K5PA 1SCJB 2ACYA 1TELA 3HD2A 1S6PB 2HHXA 1N5VA 3ZTRA 2AZ1A 2FPHX 2JC1A 5HSPA 2ZBIA 5C5JA 5A2QU 2C2MB 4DG1B 2YY3A 3TVZA 2VG6A 1J27A 4LT6A 2MKJA 1W25A 3BKUA 4JI4F 3CEDA 2A6OA 5JUMA 1JXEA 3PX4A 3EXCX 1FJ7A 3PG9A 1CJKA 2XHWA 5MLCV 5GMEA 3VAKA 4OIXA 4B9LA 5IT9Y 4LBHA 2FJWA 3OVBA 2AU0A 3RB3A 4RNFA 2W9BB 3BSCA 4EYIB 1Y3KA 2BX6A 4NLRA 1H74A 1HHQA 4FDFA 4ZJOA 1H98A 2ILYA 3RW6A 3F44A 1XR7A 2MTLA 2FJBB 4TXSA 2ZD1A 3UR3C 1ELOA 2QMWA 4QU6A 2DNNA 5G0RA 1Y5LB 2NPIA 5I3PA 3BO4A 4BCAA 1RT7A 1VLYA 4NXMF 3UDEA 3UN5A 2FY8A 2K3IA 2XG8A 4ERDA 1RAEB 3SFGA 5HBMB 3W7BA 5DGBA 4Q8EA 1X5PA 2OELA 3QBCA 1X7VA 3HX9A 2QEXS 3KLGB 3WQPA 4KRWA 2LU2A 2XWXA 2H48B 1PG5B 1H73A 3BN7A 1X9MA 4OHWA 5HL7Q 2YX7A 2CQBA 3IR5B 4KHPF 3BN4A 3OTOJ 4ELUA 4B3TJ 1P27B 4ED5A 2Z2YB 3NG8A 4PWWA 3NMRA 2O5DA 2RT3A 2AYEA 1YBAA 1N33J 2CQ0A 3ZC4A 1F5CA 4B3MF 1S1UB 2MSSA 2VFUA 1H2TZ 1G4CA 3TW0A 3NKYA 3BJYA 2BOAA 1NBEB 3FKBA 2XYHB 3ONQA 2Y3YA 3ILJA 4TYAA 5ETNA 3MMCB 4X4QA 2DEJA 3B82A 4F02A 3AD9C 3H25A 1FJGJ 4RW7A 1UVIA 1T8EA 2XQCA 5DS7A 1T3NA 1TL5A 2LCWA 2VQEF 2R7XA 3D67A 1BXNA 1VBKA 3THPA 3JQKA 4R0JA 3IBFB 3WX4A 2ZC4A 1HA1A 1N6QA 4G6VB 1E6YB 1VQNS 5FLXY 4JBCA 2CVEA 3CCJS 3SV3A 2MJUA 2KFZA 3B78A 4DSEA 4KIAA 5CYQB 5LSOA 3FZ2A 3IFEA 3A3OB 3HHLD 1WD6A 4DUYF 3KDOA 1RADB 4EMDA 4LFAF 3OTDA 4CLFA 5GADI 3QWUA 2HK3A 1XERA 2W8LA 2CJQA 5ETVA 1S1WB 1K1QA 4DR5J 3MUMP 3HF5A 3CJQA 1R89A 1YHQS 4KBIA 3GCXP 1SKWA 1N0VC 2HFSA 4PKDB 4RU2A 1REGX 1ZS6A 4AXJA 3SFUA 2W01A 2DY1A 1AW0A 4CM2A 4PWDA 1B4SA 4ZOSA 5B0DA 2GAHC 2RB7A 5A6WA 3O1LA 1GNKA 4LRAA 3H42A 2CPEA 5DDOC 4I69A 3MEEA 3A3PB 1KR4A 5D3GA 1S9FA 2DKOB 1RBAA 1EX8A 4CTAB 4WXOA 2NXEA 1I1GA 2WOMB 3C19A 3A8KA 1X4AA 2QC3A 2ZC3A 1SC1B 2JJ4D 5ETLA 1ICEB 1NPKA 3DU6A 1IJEB 3HULA 3LQVA 3VGVA 4TU9A 3MM7B 4ILMA 2K1RB 2OSRA 4I1TA 1X5TA 5GAEU 4BBYA 1D9FA 3T9NA 2RQ4A 3BGRB 4V1Ak 4ZVTB 2M2BA 2B3TB 3OPKA 1N8RT 1U1MA 1S57A 3MECA 2AYMA 1ZBTA 3I0SB 3GG0A 3KLEB 4HT7A 4WFYA 3K57A 1XJWB 4N8OA 3G87A 3VHQA 3TP2A 4L76A 2IMWP 2GQCA 2GQQA 3ZTOA 1P8GA 3TQEA 4Q0BA 2DNRA 1RHQB 2DO4A 2ZFHA 3CJ2A 2F4FA 2AT1B 3HO1A 3SBMA 3HHEA 1SQGA 3SZ2A 3B54A 2XS2A 3BYPA 3I56S 4H4KA 3BR9A 3R5DA 4LREA 2HZCA 4NA3A 3R97A 1HBOA 3D6HB 4CH0S 2LP4A 2M8HA 1SKSA 1X4DA 4QOTA 5HQ8A 1CG2A 3MAAA 3KJVA 2WONB 4NMXA 2HFNA 2N7YA 4Z2XA 3KK2B 4WTOB 4R8UA 3GWCA 5M2UA 2OUGA 2IYGA 1U1KA 5D8HB 3DLBA 2POKA 2HHPA 2DHSA 3WHIA 5HMZA 3MOZA 4HI2A 2OTLS 3UD3P 3IN5A 2F4VJ 3L4BC 5LXYA 3KLIA 3H7HB 4KAIA 1V9OA 3EVWA 4CO2A 4DLEA 3DGPA 5J1EB 4DN9A 2FHOB 4FF2A 1LQ9A 4P72A 3JAMY 4X4VA 3BBBA 1XMQF 2GHPA 3HI9A 2GMHA 3M8ZA 1FVSA 2FJAB 4X4RA 4DR2F 2VFRA 3PYFA 3NXZA 4TLRA 1JWWA 3M05A 3FEYB 3DXBA 2VA3A 2OGUA 4CT9A 4RNNA 3GLJA 4PG4A 4JI3J 1WUUA 3KHRA 1WEZA 2BJ7A 2H65B 2W7OA 4LSNB 4K8RA 4P9SA 2APOA 5ITHA 2NXNA 1RLDA 3NRBA 1WI6A 2ALYB 4URSA 4PYDA 3FCHA 2N7CA 4B9SA 3DOKB 1KDNA 4DR1J 1S72S 1U26A 4KH0B 3OXFA 1KHWA 2HIQA 2VL1A 4TNOA 3D0HE 1JLBB 4OI2A 3J81j 4A8WA 3E01B 5KT4A 1KVJA 2ZBQA 4DV5J 2UUCJ 3HVRA 5EWGA 2PGCA 1RK8A 1FDAA 4ZP8A 3I87A 3DOLB 2WB1D 5KG0A 3SDEB 2UXDJ 1YBUA 4Y0FA 3TUPA 5IT9U 1LWFB 1LW0A 1VQ6S 1MROB 5AT1B 3QZ7A 2O01C 1XC9A 4MIAA 5AJ3F 5HI7A 5J1PA 5F8IA 2HYIB 2Z4PA 4RUHA 1JJHA 1HFEL 3GFZA 4U7UK 1HWLA 3D28A 2QIFA 4OYBA 1RTDA 4N8NA 5KFKA 9RUBA 2ZWOA 3OR1B 4X64F 3J80Y 1RT2B 1Q81T 1WC1A 5IT4A 4DEZA 1M1GA 1JXVA 2G9OA 5DQHA 1AA1B 3CCQS 3MI7X 2R8GA 4OV6A 2RVJA 4KHMA 2GS8A 2VH7A 4M8LA 3OSNA 2DH8A 4Q2MA 4DL4A 2XS7A 1U02A 3DLGB 3PJWA 2XNRA 2RSQA 1NDLA 4G3IA 4HH0A 2HSEB 1CJUB 1QUVA 1PJ7A 3IRXA 2Y0SD 4Q7AA 1C4CA 4DQRA 3MR7A 5LSLA 4ECYA 1QY7A 2GGPB 4Q43A 1HI8A 4ZHRB 2F63A 5KT7A 3FZBA 4GKKF 2DGSA 2LXUA 1WACA 5HANA 4E98A 2KJVA 2YPZA 2UUTA 3M30A 1SIWB 1VQ8S 1PKUA 3M7VA 3EMTA 2WZ1A 2QLBB 3GJQB 1DTTA 1U48A 4HACB 1X0FA 5L46A 1RCOB 3G8SA 4QCLA 3RB6A 1JJ4A 4X4OA 4ZCLA 4RBVA 1M1KT 4PWUA 3VGTA 3AOAA 4HTIA 2HNYB 3LANA 1NM2A 1N32J 4F4YA 5LXRA 1APSA 4C8YA 2ZH6A 2OFGX 3ITHA 5FLXU 2VHGA 4OI6A 2KYZA 4B3OA 3W9IA 3AD8C 3KNAA 3MEGB 4WF9Q 1HNIA 3CMAS 1RU1A 1BGXT 4HDHA 3FMWA 3TJ9A 2QFIA 2H3EB 3IAS9 4IKAA 3PW7A 2C3UA 2QSFA 4O3NA 1Q86T 4FYWB 4WFZA 3AY0A 4RBTA 5C42A 2F40A 1OY8A 2JRSA 1LWEA 2IBKA 3M8QA 3KK3A 1RYRA 1R0CB 1XN9A 4EBDA 4WWSA 3VQTA 1HW8A 2B4UA 2YKMA 1S76D 2UXBJ 4ILLA 1HHSA 3IMQJ 1ZPWX 3I5CA 3M8YA 3H5UA 4RNHA 1GFWB 4JI6J 1JLAB 1WHVA 3CW2C 4QWEA 3J81U 1HW9A 5GMKa 1M5SA 4LFCJ 2BJEA 4DU8A 3QPIA 2YNFB 4A46A 3ZZRA 4F2RA 1V6HA 3GMGA 3CSKA 3LGHA 1U45A 1Q7LB 2OSQA 1X9SA 2CJAA 3LP0A 1QTNB 4KC5A 1FFWB 3QLHB 2MPUA 1JLCB 3OFGA 1VS3A 1I94F 2HEKA 3D4JA 2GV1A 1UFWA 4YEAA 5G0RB 2FJXA 2CKWA 4ES3A 2XMJA 4F7VA 1M5VC 4LF8J 3GE9A 5EWEA 4PPDA 5K5MA 2HHHF 2YX1A 1S10A 2GJIA 1OQ3A 2BE2B 2PIIA 4RX6A 4AL7A 2GMLA 1WKJA 5FDLA 4R5PB 4FVCA 3I82A 2RE1A 4YHHJ 1KTQA 1N56A 3NWRA 4Y28C 1X60A 1PJ6A 2PI5A 1FRKA 1D09B 1EQ0A 3J7ZT 1XNQF 4EU0A 5G4DA 1Q95G 2V5HG 4B9VA 1SPBP 4YR3A 3MXHP 4JYAJ 1Y5IB 1VQOS 1TR0A 1VIOA 2CNOB 3IM8A 1Q0NA 1LWXA 3ZO7A 4N7TA 5CA5A 3VAJA 5DM6Q 3S8SA 1CEZA 1GMVA 3GV5B 1TMJA 1Q8IA 1DBDA 4P2SA 1RT5A 4FXVA 2CNKB 5F8HA 2CJ9A 4U95A 3M1VA 4K4TA 5CZXA 4ATNA 2EEYA 1YZ6A 4OYAA 3CDEA 4QZVB 1LK7A 1A9NB 1QVFR 2L9DA 2XZTB 1Z1ZA 1URNA 4CH1A 2ROEA 2CJYB 8ATCB 1F9HA 4DV6J 4O4GB 2EW9A 3W65A 2OTJS 2JWNA 2CADA 2YNHA 3D6FB 4NLGA 1U0HA 1L3TA 4F26A 3CJTA 2CPJA 3PO4A 2BW7A 2K7JA 1U1RA 5KFAA 2XNQA 4RW7B 2HHQA 4WYLA 4DF4A 2WBMA 1QD1A 4FYDA 2B4OA 2MQOA 4ZPVR 4BWMA 3JAMU 4P2XA 4CLLA 1Q8KA 2X7IA 2L48A 4NZ6A 3UCGA 3DM2A 3QSYB 2MQPA 4ENOA 4PG6A 3GJSB 3HMJG 4U6PA 2YVSA 1R31A 1RI7A 2P5VA 2AKWB 2VOPA 2AJQA 4OYMA 3H59A 4NA2A 3TANA 1W2IA 4DX6A 3LPEA 3MEDA 2DGXA 3IBCB 3HT0A 5D15A 1NHUA 4AL5A 5HLFA 2LDYA 1FRIA 3M8PA 3HFKA 3KLHA 3DMJA 3PDNA 3PW5A 4I0WA 2VQFJ 2OH2A 3MCNA 1VQ9S 1CJTA 3VCDA 1RT3B 4QJVA 3T41A 3TZZA 2H5JB 1T9XA 3QGIA 4NCGA 2BBEA 1TU0B 2BQUA 3KFWX 5RUBA 4LJMA 5D4OA 5L1LA 1G1XA 2CZ4A 3VZHA 2DNYA 4CLPA 3DOMA 4C0OC 5HVHA 4DV0F 4MAKA 2MXYA 2VPXB 3GQCA 4IG0A 2VJVA 2CYYA 2HHHJ 3EGNA 2RQKA 2M88A 2C2DA 1NRKA 1EJ7L 3SEOA 1DQ8A 4B08A 1YJNS 1RGVA 3CDBA 3CIZA 3U27A 3CF5Q 2F9DA 2CNNB 4TLQA 5SUHA 3PXGa 1FTCA 4HHHA 4GO7X 4PR6A 3NBPA 4K5RA 4QWDA 2D9PA 2A10A 3BO2A 5F0UA 3J80U 2NXCA 4ZLNA 3IG1A 3I6PA 3LP2B 4ECZA 1KFSA 3Q24A 4JI0F 1OY9A 2VIHA 3UNYA 5DRKA 1FDDA 1I5OB 2V63A 2ZITA 1F3FA 1OJ4A 3K5OA 1Y7PA 1KQFB 2D3ZA 3DDKA 2Z30B 1N54B 3HD1A 3OT9A 2KRBA 3H20A 4RL1A 4ZVGA 4LF7F 3BYRA 4JP8A 4P7TA 4KKOA 2Z2LA 1WJ9A 4YMEA 1F2HA 1JLGB 1KP6A 2F3JA 2FHJD 1WF1A 4ANEA 3H0PA 2YWGA 2FUG9 4WFNQ 1S97A 1JLFB 5GAEI 1YDLA 5KFOA 2R7SA 3KLFB 2UUWA 3DFEA 2AX1A 2WRMA 5C25B 3VVTA 5I3UB 1HBOB 1DTQA 5GAGU 1S5ZA 4DUZJ 1YX2A 5CHCB 5T7LB 4DV7J 4ZS6A 4RUBA 1OPZA 2DY9A 2V0NA 2CQGA 2CQDA 4OYXA 4KO0A 1GMWA 1XMOF 3G9CA 1S9GA 4YQWA 4X84A 1C0TA 4NXNF 5GAHU 4OZ1A 4USMA 2FTRA 5KFLA 4RLEA 3PR5B 3IRWP 1O0PA 4Y2MA 2C2OB 2U2FA 4B3SF 4IDKA 4ZMMA 3TRGA 4TN2A 4FXWA 4DWIA 1SKUB 1C4AA 4Z7CA 1QLNA 5HJYA 1A0OB 2CWKA 4RJVA 1VMBA 3D1HA 2F1FA 4H4MB 1YSJA 2QYCA 1HNZJ 2VKRA 2DNKA 1KLMB 4FS2A 4N77A 2WVDA 5AXMA 2MY8A 3S6EA 5JVHQ 2AD9A 1CS4B 3UQSA 1S7HA 1LW2A 1FWKA 4DR4F 4OFZA 3R7BB 5K8OA
chains in the Genus database with same CATH topology
2QX0A 2F65A 5ETKA 3ILJA 5ETPA 3HCXA 2CG8A 5ETSA 3IP0A 3HT0A 3QBCA 1Q0NA 3HSDA 1RU1A 4M5NA 5ETQA 5ETVA 3UDEA 2BMBA 3HSZA 4CRJA 3HD2A 5ETLA 1TMMA 5ETNA 4M5GA 5ETOA 1RAOA 1F9HA 3MCNA 3ILLA 4M5KA 4PZVA 4CWBA 5ETMA 3KUHA 3HD1A 1HQ2A 4M5JA 5ETTA 1RU2A 3KUEA 1CBKA 4F7VA 1EX8A 3HSJA 1EQ0A 1TMJA 1DY3A 3ILIA 1G4CA 4M5HA 3UD5A 1RB0A 1KBRA 3MCMA 4CYUB 2F63A 1EQMA 3UDVA 1IM6A 1RTZA 4AD6A 3ILOA 4CYUA 1HKAA 3KUGA 3MCOA 3HSGA 4M5MA 4M5LA 4M5IA 5ETRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QX0 A;  2F65 A;  5ETK A;  3ILJ A;  5ETP A;  3HCX A;  2CG8 A;  5ETS A;  3IP0 A;  3HT0 A;  3QBC A;  1Q0N A;  3HSD A;  1RU1 A;  4M5N A;  5ETQ A;  5ETV A;  3UDE A;  2BMB A;  3HSZ A;  4CRJ A;  3HD2 A;  5ETL A;  1TMM A;  5ETN A;  4M5G A;  5ETO A;  1RAO A;  1F9H A;  3MCN A;  3ILL A;  4M5K A;  4PZV A;  4CWB A;  5ETM A;  3KUH A;  3HD1 A;  1HQ2 A;  4M5J A;  5ETT A;  1RU2 A;  3KUE A;  1CBK A;  4F7V A;  1EX8 A;  3HSJ A;  1EQ0 A;  1TMJ A;  1DY3 A;  3ILI A;  1G4C A;  4M5H A;  3UD5 A;  1RB0 A;  1KBR A;  3MCM A;  4CYU B;  2F63 A;  1EQM A;  3UDV A;  1IM6 A;  1RTZ A;  4AD6 A;  3ILO A;  4CYU A;  1HKA A;  3KUG A;  3MCO A;  3HSG A;  4M5M A;  4M5L A;  4M5I A;  5ETR A; 
#chains in the Genus database with same CATH topology
 3Q8S B;  3HHL B;  4UZB A;  4DR3 J;  5CCM A;  2C2K B;  3LW5 C;  2LA4 A;  1TMM A;  3QSI A;  5LOQ A;  2FQQ B;  3BQ2 A;  4PG8 A;  2IJN A;  1NJZ A;  2VOO A;  1HWJ A;  1FRJ A;  2XLJ A;  1R43 A;  2ZEJ A;  2IC3 A;  3V2U C;  3K0J A;  5IXU A;  1U1P A;  3QAU A;  1MWQ A;  2JH3 A;  4K5S A;  2AHO B;  2KG0 A;  2LFV A;  2XMK A;  2OIH A;  2DD8 S;  2RUG A;  1GXU A;  3IS9 A;  3PNI A;  4RNO A;  1VK8 A;  3T5L A;  2XYP B;  4O44 B;  3RB0 A;  2W4D A;  1LOU A;  4IUF A;  2MQQ A;  2KHC A;  2EPI A;  3ZXW A;  2KFN A;  1SJR A;  3QZ8 A;  1LW0 B;  2MGZ B;  1F9F A;  5DLG A;  1VK3 A;  1FXL A;  1RXO B;  2MZT A;  2PT0 A;  4IOA Q;  5CXT A;  4KGM A;  1QAX A;  4R0E A;  2Y9H A;  4DX5 A;  4XTT A;  2MZR A;  1VRU B;  1ZZF A;  2LA6 A;  3ZZZ A;  3IM9 A;  1FO1 A;  1R0A A;  2E7X A;  1B64 A;  4OLP A;  3UR0 A;  1X31 C;  4X4P A;  1VLO A;  2IM3 A;  3TEH B;  4WCE Q;  1CJV B;  3M2V A;  1HQ2 A;  2BKO A;  2HWH A;  3D3C J;  3CJK B;  3KHG A;  1D9D A;  4WIQ A;  4NCB A;  1HPZ B;  1TL7 B;  4Q2L A;  2UU9 J;  1P1T A;  3T1A A;  3I0R A;  1TUW A;  3ILL A;  1T9T A;  1J5O A;  4CLT A;  3WZ0 A;  4F25 A;  3SQG A;  3FRZ A;  1YIT S;  1PBA A;  4NAS A;  1U2R A;  3MM9 B;  2LQ9 A;  1GXL A;  4YY3 J;  1V3Z A;  2E9R X;  3TA2 A;  4DFK A;  1JJ2 R;  2EBG A;  2GHW A;  1SUQ A;  4FBU A;  1PYO B;  1VRT B;  3Q86 A;  1EIY B;  3HKW A;  3T5H A;  1X5O A;  2RIJ A;  3N6M A;  5C24 B;  1LXJ A;  2OD6 A;  2K3K A;  2RKI B;  3SSR A;  2EI5 A;  4LRD A;  2ZH8 A;  2DTJ A;  5IQ6 A;  3GV8 B;  1UEV A;  3GIK A;  4CCH A;  4Q45 A;  3FNN A;  4B3S J;  3KMS A;  3KNG A;  3HSJ A;  1UP1 A;  2NS1 B;  4NLT A;  3VAH A;  3MZI A;  1DRZ A;  2FGO A;  3BDP A;  2YNI B;  1JMT A;  1P9Q C;  4IH6 A;  3DKD A;  2F9J A;  4USV A;  1RWW B;  2HVZ A;  3W9J A;  2E66 A;  1VBY A;  1HQU A;  4X65 F;  1VYA A;  4ETZ A;  4KHR A;  4RW6 A;  4GVB A;  1M90 T;  2OEK A;  3VWS A;  4LF2 A;  3UDC A;  2V4J A;  4EO8 A;  2HPU A;  1CC8 A;  3CJ0 A;  5E3A A;  3VGS A;  4TY8 A;  4F67 A;  2RQM A;  1WG5 A;  5CCL A;  4ED7 A;  2BE9 B;  3PRV A;  4UQT A;  5F8M A;  4MK9 A;  5IWA J;  2KG1 A;  4OZ3 A;  1W7W A;  5EX0 A;  2KDO A;  1KFD A;  5C7P A;  1LWE B;  1RT1 B;  5D4L A;  4ZJL A;  1L3S A;  2I5J B;  3HJV A;  1JNZ B;  1CQN A;  3HP6 A;  4DI6 A;  1S1T A;  1RE1 B;  3N5F A;  4CLK A;  3RRG A;  1HWI A;  2LQJ A;  1HMV A;  4JOU A;  3H2V E;  3ET6 B;  1R8C A;  1EET A;  3FBB A;  1MLA A;  1LXN A;  2OD4 A;  3OR2 A;  1WOO A;  1G3O A;  2H51 B;  3DRR B;  1NEE A;  2U1A A;  2BAB A;  2A1B A;  4EUV A;  2KZZ A;  2CQ1 A;  1FKO B;  4KV8 B;  3FGV A;  5J2M A;  4MFB B;  1LKZ A;  2RF2 A;  2HMI A;  3EE3 A;  4PCQ A;  3C15 A;  2W9C B;  1WDD A;  2RJZ A;  2BZ2 A;  4JV0 A;  4CLW A;  1HD1 A;  3DRS A;  4UZC A;  3FQK A;  4OYI A;  2QLF B;  2C28 A;  3LP0 B;  2AEM A;  4ECW A;  4TY9 A;  3M6V A;  2XS5 A;  2EBE A;  2E1M C;  1XNR J;  3K5L A;  5KFI A;  4A8O A;  4ZIV A;  4DG1 A;  4USJ C;  4ED8 A;  3L9Z A;  2OAU A;  2H1Y A;  4BLG A;  1OSC A;  1PIL A;  5E3C A;  4WZM A;  4GC6 A;  2DCL A;  4O3Q A;  1WOP A;  1U1O A;  3BSN A;  3HK2 A;  2CRL A;  1Y11 A;  3UVJ B;  1RU2 A;  5A8R A;  2W9B A;  1UWB B;  4L72 B;  4LF5 J;  2EFO A;  5DQG A;  3GON A;  3P49 B;  3PFO A;  2B9E A;  3LAK A;  4NLD A;  2DH7 A;  2J0W A;  2RU3 A;  2HVI A;  2MQ8 A;  4V19 J;  4U7U D;  2HBQ B;  1RT4 A;  3Q89 A;  3U7J A;  3BRE A;  5A8K B;  4IQX A;  3CO0 P;  4C8O A;  2KT2 A;  3ZZO A;  2E1C A;  1S0N A;  3TVY A;  1WSR A;  4DSI A;  2G0J A;  1FEH A;  2V8G A;  3HKZ D;  5DDQ C;  4WJB A;  5HBM A;  3WDO A;  4OLO A;  3GYG A;  3TQ1 A;  1N88 A;  2UXC J;  3MUV P;  3PRD A;  3W5Y A;  3NAI A;  2HGN A;  4IRD A;  4MKY A;  4LRB A;  3G6E S;  3KLG A;  1QAJ A;  4OQJ A;  2J9D E;  2YNH B;  1K1S A;  2DRD A;  4DL5 A;  3MCO A;  3VAL A;  1UL3 A;  3W1Y C;  1WI8 A;  2CJX B;  2LQ8 A;  2MHE A;  3T5J A;  2P2C B;  4JI5 J;  4UUX A;  5KFW A;  3M2U B;  4MIB A;  2Z2Z A;  2PEB A;  3I9Z A;  3SYZ A;  1XQI A;  2P6T A;  1YJT A;  4DZ6 A;  2OO4 A;  3AXM A;  2PFD A;  2X3D A;  4ZN1 A;  4QQB A;  4QYZ K;  3DM2 B;  4I56 A;  2K06 A;  3GPA A;  1DQ9 A;  3MHY A;  3N5B A;  4FPR A;  1S1U A;  4IR9 A;  1KOH A;  1Q8B A;  2BAN A;  2QLJ B;  1VI7 A;  3ENA A;  4KE5 A;  4J9R A;  4G1I A;  1DJ0 A;  1Y9O A;  4I4B A;  1TL4 A;  4OMF G;  2M8D B;  2RIL A;  5FII A;  3QJJ A;  3NS6 A;  3I4H X;  3EYZ A;  3MMC A;  2QLW A;  2HUR A;  2RQC A;  3WIU A;  4DV3 J;  2AGP A;  1H2V Z;  4QYR A;  1TKT B;  3RAQ A;  4AQY J;  3QT6 A;  1X4E A;  1E6Y A;  5M2P A;  3MM6 A;  3DMJ B;  1GX5 A;  4Y2K A;  2KVI A;  3ZTQ A;  4HVZ A;  4OX9 F;  5LMN F;  4WU3 A;  3H2U B;  3AA9 A;  5CYQ A;  2EFG A;  4DF8 A;  2XMM A;  3MM8 A;  3VAI A;  2BUN A;  2XUL A;  2HHS A;  2BE7 D;  1VQ5 S;  1UJ6 A;  4J91 A;  2XB2 D;  4HH1 A;  1S1W A;  3M6W A;  1HNV A;  3R5J B;  4IG0 B;  2XI2 A;  3OBI A;  3TAM B;  3W63 A;  3CO9 A;  2HWI A;  3ISN C;  1YRU A;  1KSP A;  4A47 A;  2HVE A;  1YJU A;  3H40 A;  2FVS A;  3ZFV A;  2DNZ A;  5KT5 A;  3JSM B;  1AUS L;  1U1L A;  4Z37 A;  4HT5 A;  1TV6 A;  1XIQ A;  2ABY A;  5AXL A;  4HYK A;  4ZVE A;  3V4I B;  4MIW A;  4RKU C;  2HRT A;  4N76 A;  3LTO A;  3ZNU A;  3K2Y A;  1IWG A;  2O67 A;  2MB0 B;  2ZBC A;  2QL9 B;  5B08 A;  3H5X A;  3NGU A;  3T1Y J;  2WOM A;  2IBO A;  1Q5Y A;  3KTQ A;  4P73 A;  4MKB A;  3CCS S;  2M70 A;  1N34 F;  3NEK A;  3R1H A;  2Z0G A;  4ZIW A;  2VJU A;  3RTV A;  2RU9 A;  3MM7 A;  2BJD A;  2NPF A;  2HAF A;  1S1X B;  1RWN B;  3SI8 A;  2XMT A;  2K1R A;  4WZQ A;  4O0I A;  3MWB A;  4X62 F;  1R6V A;  1Q7Y T;  1UJ4 A;  2MEW A;  3BGR A;  3JSB A;  3CC7 S;  4F0H A;  3IGV A;  1YIJ S;  3HFV A;  4K4V A;  1WSV A;  1C1C B;  3V6D A;  3PIO Q;  1SKR A;  3O5T B;  2FDN A;  2HG4 A;  3I0S A;  2GJF A;  1DTQ B;  1JX4 A;  1YJV A;  4NPO A;  2MKC A;  3P5T L;  3KLE A;  1UA1 A;  4JV1 A;  2K2P A;  2B5J A;  4DPX A;  5HMY A;  2FLP A;  3D0G E;  2G4B A;  1RWX B;  2PMZ D;  1RCX B;  1RAH B;  4LBP A;  3ZZ0 A;  4ED4 A;  5ETO A;  4PXC A;  5C2C A;  2LVW A;  1HNX J;  2CZ9 A;  1C0T B;  3OJU A;  1GEH A;  2XM3 A;  3IWL A;  2BJ1 A;  1BD6 A;  5L8R C;  4EBC A;  3DHW C;  3CIM A;  2HFO A;  3CXC R;  4KGX B;  2C3M A;  4C3M A;  2QT7 A;  2SXL A;  2V8V A;  2QTW A;  3S01 A;  2XMA A;  4HEA 9;  2DBB A;  4IDK B;  1DQA A;  2RRB A;  1KQS R;  5AXK A;  1DZ5 A;  3F56 A;  5M2R A;  3PV8 A;  2DNL A;  2Q3P A;  4W92 B;  3AJ2 A;  2R7W A;  3GIL A;  4NEZ A;  1PO6 A;  2B9X A;  2GAG C;  4P52 A;  1RDR A;  2WON A;  2ZH5 A;  2NXJ A;  5DG8 A;  3OL8 A;  1HI0 P;  3W2V A;  5IZH A;  4EGL A;  4N5S A;  5LT5 A;  4P71 A;  3S7R A;  5BR8 F;  1FXD A;  1EHW A;  2CPF A;  1TAQ A;  3FDS A;  3D1Q A;  4MJK A;  4ZPA A;  4LVN P;  1U09 A;  2PMH A;  2Q6B A;  5LMN J;  5GAH I;  2NYH A;  2L08 A;  3PEJ A;  3K8V A;  4F2S A;  2BV3 A;  3WX8 A;  3N6L A;  4ZVH A;  1TZ0 A;  4AND A;  4AUK A;  2XC9 A;  1HLW A;  2K8G A;  2B43 A;  1W26 A;  2EWH A;  4DHV A;  1TUV A;  1YRT A;  5J2Q A;  1D8Y A;  2DT9 A;  4BWJ A;  3MPV A;  4O3P A;  1EQM A;  4WKR A;  4LSN A;  3FFI B;  1ZA2 B;  1AFJ A;  3W2W A;  2VPW B;  1RJJ A;  2QLX A;  3P96 A;  1S6U A;  3MAQ A;  4ID5 A;  4LF6 F;  2VBW A;  2PA3 A;  3ZZY A;  4PYA A;  3SCL E;  1R0A B;  1RBL A;  1RTI B;  3NOC A;  1SL2 A;  3B4D A;  5HP1 A;  5F41 A;  3DGV A;  4TU7 A;  4C7Q A;  2D3O R;  3C6T B;  3R6G B;  1X4H A;  1NHK L;  3HVA A;  5E5N A;  4LRF A;  3E01 A;  5K14 A;  4PEO A;  1O6X A;  3M2V B;  4XPC A;  4QU7 A;  2KTQ A;  4KGV B;  3SDE A;  5ETM A;  1K73 T;  4G1P A;  1DY3 A;  1LWF A;  4B3R J;  4C8M A;  2J8S A;  4QPX A;  1HBM B;  2RRN A;  4RO0 A;  4CM0 A;  1ROF A;  3I0R B;  2CVI A;  4IH5 A;  1J5O B;  3MPW A;  1OO0 B;  1H6K X;  1HR0 J;  4ZCI A;  3SQG B;  4N41 A;  4EK2 A;  3BGU A;  4OHV A;  2W2O P;  3US5 A;  3PVX A;  1BMQ B;  2IRY A;  4WE1 B;  2CG4 A;  3RU0 A;  1QE1 B;  4C0B A;  3DLJ A;  1VQY A;  4PG7 A;  3QGG A;  1J2V A;  2JX2 A;  1AT1 B;  3N01 A;  1DLO B;  4CO1 A;  2WK4 A;  2I8E A;  2Y0B B;  3TYT A;  2PSZ A;  2VOD A;  1YQH A;  3DLG A;  3KYL A;  3OLB A;  1AUD A;  1GXT A;  2FVP A;  4DSJ A;  3H4B A;  3O3L A;  2V69 A;  1VC5 A;  2CAJ A;  1SI9 A;  5LMU J;  1NKB A;  4DQP A;  2C3Y A;  1YKW A;  5B0F A;  1EAR A;  3E2E A;  2D69 A;  3QWP A;  3H98 A;  4LR8 A;  1X4B A;  3M2R A;  2JHE A;  5ETT A;  3Q22 A;  2R7O A;  2GGP A;  5A0Y B;  3PKM A;  5HN0 A;  4LIR A;  1Q1K A;  1I3O B;  1RA6 A;  4J9Q A;  1QSL A;  3R5G A;  3AJ1 A;  1S1V A;  2FHK A;  2FVQ A;  4GVB B;  3MF5 A;  2V4R A;  4PRF A;  1H7X A;  2ZKT A;  4ECX A;  2XZD B;  1J5E J;  2MMY A;  4M63 A;  2HHV A;  1NZ8 A;  2E5L F;  1IR1 A;  4F04 B;  2ATL A;  5CD4 A;  1RWV B;  1EP4 B;  4PXE A;  3CE8 A;  3FUY A;  4JI2 J;  2CQ4 A;  4KPY A;  2CPX A;  4ZIT A;  1U4B A;  2V8P A;  2HNY A;  3G82 B;  1UVJ A;  1S1T B;  2DXD A;  1VJQ A;  1RTH B;  3NCP A;  1IBK J;  2KRR A;  4Y3C A;  2QX0 A;  3MEG A;  3TJ8 A;  4FNI A;  2V68 A;  4WK1 A;  3OR2 B;  1RAG B;  4H54 A;  3OL7 A;  2EK6 A;  1IQT A;  5DZ7 A;  4FF3 A;  2UVV A;  3SCJ E;  3AHP A;  2HMI B;  3A12 A;  1IM4 A;  4X66 J;  5JJB A;  1UVL A;  2UUA J;  2RHQ B;  1ZPV A;  2JC0 A;  4NLY A;  2ROG A;  5KG3 A;  1XK8 A;  3MCM A;  2JSX A;  4YR0 A;  5KOW A;  1YG0 A;  3ICL A;  4JV2 A;  1IKX A;  1I6J A;  4DXL A;  1RB0 A;  4ZCK A;  2CZV C;  4DOZ A;  2D41 A;  4QIF A;  5KFP A;  2FVR A;  5B0E A;  2P8I A;  2K7K A;  1JLA A;  2ADC A;  2YH1 A;  5B0A A;  4Q5V A;  3M8R A;  3LP1 A;  3C14 B;  1VFJ A;  4ED3 A;  1X9W A;  1UET A;  2D3U A;  3A8J A;  3HHL C;  2FZG B;  2V94 A;  3O6Q A;  2YNF A;  1HNW J;  4FF1 A;  2DGU A;  3DLK B;  4LF9 F;  3PZP A;  1BQN B;  2L9W A;  2B9W A;  5A8R B;  5HVG A;  2NUU G;  3DHX A;  1B99 A;  1WKL A;  3QLH A;  3K8W A;  1JLC A;  4ALZ A;  2CA9 A;  2OPR B;  2JLE A;  3BKF A;  3NMA A;  3V4M A;  1ZOT A;  2XY7 A;  3GFY A;  1F6T A;  4WU2 A;  4E0D A;  3J7A N;  4CP5 A;  4LF4 F;  1HL6 A;  2BKN A;  2VB6 A;  1RT4 B;  4YDX A;  2XY6 A;  3GFH A;  3T6B A;  4FN5 A;  5IS2 A;  3D68 A;  3GFX A;  3RZA A;  4ZPT R;  4F3Q A;  1R0B G;  2HQC A;  1RAI B;  2E9T A;  1S4E A;  2BE2 A;  2B4V A;  4KT0 C;  4R5P A;  1Y10 A;  2AWZ A;  4ES2 A;  4WKY A;  1T95 A;  1OSD A;  2GJ2 A;  1C1B B;  2UVR A;  2Z57 B;  3PYE A;  4JV5 J;  3ELH A;  2DR7 A;  3SV4 A;  2ZHO A;  3RBX A;  2J0Q D;  4K4U A;  3PKY A;  3Q8P B;  3Q8Q B;  2AGO A;  1YRX A;  3C8Y A;  3PEH A;  2KB2 A;  1N36 F;  4AD6 A;  2NCK L;  1QSS A;  1K9M T;  1WF0 A;  1N5T A;  4OJ3 A;  2ZBR A;  2PN6 A;  5HMX A;  2HQ3 A;  2J6U A;  5A8W A;  4ECS A;  2XYG B;  1VC0 A;  1KTV A;  4YUD A;  4USI A;  5HQM A;  3UW1 A;  3QAT A;  3CT9 A;  4NI2 B;  3RW7 A;  1UEK A;  4OI3 A;  3CC2 S;  4Y00 A;  3HM9 A;  2F8M A;  4RW9 B;  1YWX A;  4ICL A;  4DR6 J;  2BAN B;  3NAH A;  5J2P B;  1N5S A;  3VF0 B;  4O4G A;  2KJW A;  3CWJ A;  2KYX A;  4ZP9 A;  5KFZ A;  1FNO A;  1X4G A;  1GQE A;  2J9D A;  3M6X A;  2G2Z A;  2XMU A;  2ZZN A;  5HQL A;  5KAK A;  4JI7 J;  5D4P A;  2HHT A;  3KWM A;  1ZM9 A;  4DV2 J;  2EKY A;  3CDW A;  4IFV B;  2H54 B;  1S0M A;  3Q2T C;  4UOH A;  2ASD A;  1JLQ B;  4C4W A;  4JI1 J;  3MM6 B;  2IJR A;  2ZJQ Q;  4OZ0 A;  2AZ3 A;  2VG7 B;  1L3K A;  5ETS A;  3K58 A;  1H38 A;  4CI0 B;  5HAT A;  2I38 A;  4YR2 A;  5BYR A;  3PR4 A;  4QIW D;  1ZM3 A;  3MM8 B;  1TKD A;  1SJ1 A;  2OFH X;  3F41 A;  5L9N A;  1O5J A;  4CIO A;  2R7U A;  5IT0 A;  3RRK A;  1SB6 A;  2JEI A;  4RW8 A;  3VAF A;  2IM1 A;  3IA0 A;  1OYE A;  1HNV B;  3TO8 A;  2HRU A;  1CC7 A;  1WC0 A;  3HHN B;  2FC9 A;  2QFJ A;  3ZNJ 1;  4CLY A;  4MK7 A;  4JI4 J;  1UZH A;  3IGN A;  2E5I A;  4IFY B;  1RAJ A;  2DNH A;  1TV6 B;  1B3T A;  1NSA A;  1NK6 A;  2NZC A;  2VDH A;  1RT3 A;  4PUO B;  3BM7 A;  5C2G A;  4TQS A;  3CC4 S;  5ETK A;  4DPY A;  3R3T A;  3T9Z A;  4X4N A;  1GAO A;  5CAA A;  2VPY B;  2ZWP A;  1F5B A;  4U8V A;  2BXJ A;  2DJW A;  3ZZT A;  4DX7 A;  2ZZT A;  5LSR A;  2HLT A;  4CZC A;  2KVQ E;  4W98 A;  4WP9 A;  2C3O A;  2DPJ A;  4QWA A;  4NXM J;  1T05 B;  2JZ5 A;  3Q8U A;  1OS5 A;  1IBL F;  2V2Q A;  3VZI A;  3X3U A;  3W8P A;  2DH9 A;  3HZE A;  3DRY A;  2BJ9 A;  3F0N A;  5B7W A;  3GTY X;  3OD2 A;  4PZV A;  2VBX A;  2L9N A;  1CBK A;  4AFF A;  2ZOG A;  1PAE X;  1T3O A;  2ALZ A;  4NZ0 A;  1QTM A;  2D74 B;  3LP2 A;  3TUZ C;  3QRQ A;  4OZL A;  3V6D B;  1VGY A;  2E29 A;  3QAE A;  1F2G A;  2RH3 A;  4I6A A;  3D6T B;  4BHQ A;  2WAQ D;  1LFP A;  3R5A A;  2B5J B;  4ZVU B;  4ZPB A;  3PTW A;  1SBR A;  4RPF A;  1M5H A;  2QA4 G;  4KHP J;  4OYO A;  3A4T A;  2UV8 A;  4PXB A;  1TVR A;  3NS7 B;  4LF1 A;  4J9M A;  1JLG A;  3PW2 A;  3RBZ A;  4IYQ A;  1ITP A;  3OXL A;  4XDC A;  4B3M J;  2G0C A;  4M5M A;  1HIY A;  2W7P A;  1JLF A;  2XI3 A;  1IQZ A;  3KLF A;  2WVF A;  4LFB F;  4A8S A;  1BQM B;  4ZLJ A;  5C25 A;  3OL6 A;  1TQL A;  2DIS A;  5I3U A;  4CYU B;  1E6V B;  3OFF A;  1RTZ A;  2HS0 A;  4U8Y A;  2R8K A;  2FZC B;  3TX8 A;  2XO6 A;  3TEG A;  4JI8 F;  3VGU A;  1GMU A;  3KG1 A;  3QGH A;  3I55 S;  5T7L A;  3N9U C;  2VQE J;  3BV8 A;  2D1C A;  3NOG A;  4DPU A;  3C6U B;  5ADZ A;  3W2V B;  3TNV A;  2IAJ B;  2YX4 A;  3AB4 B;  4OX8 A;  4FPI A;  4F4K A;  4O3R A;  1KNZ A;  3J7Y I;  4Y2A A;  2KXH A;  1DAX A;  2LEC A;  3MMJ A;  2IRX A;  1D0E A;  1U7L A;  4KSE B;  1R7I A;  4DUY J;  2B6A B;  1PYT A;  2KXN B;  3HT3 A;  1AYE A;  4LFA J;  2B9Y A;  3M6U A;  3DC2 A;  5JXS A;  2PE8 A;  2UUB F;  2R8J A;  3G4S S;  1MSW D;  3CJ5 A;  3W64 A;  3H90 A;  5D6G A;  1SC3 B;  3LGN A;  1TK8 A;  3FRY A;  1IKW A;  3CUL A;  2BOP A;  2E44 A;  3BS9 A;  5DM7 Q;  4OZJ A;  5J2Q B;  2XLI A;  4MH8 A;  1YJR A;  4H4M A;  2OLW A;  1KLM A;  3V6J A;  3EZ5 A;  5HMW A;  1NDP A;  3GJT B;  3BKT A;  2VBZ A;  4MTP A;  1CS4 A;  1NCL A;  2VDI A;  1NU4 A;  4P10 A;  3U1M A;  3UE2 A;  3W2W B;  1L3V A;  1T7P A;  4DR7 F;  3R7S B;  4K0K F;  3HHL A;  1OYD A;  2FJD B;  4ID5 B;  3D54 A;  2ZZM A;  3I31 A;  4F50 A;  1WG4 A;  5EUH A;  1SV5 A;  5HJX A;  4Y65 A;  1TL3 B;  1FJE B;  5HP1 B;  1FKA F;  1FFS B;  3CDU A;  2DHX A;  1NH7 A;  2I1R A;  1KD1 T;  1PAU B;  3EIC A;  1UVN A;  4OI0 A;  4WFB Q;  5K14 B;  2HNZ B;  2JVR A;  5GMD A;  1NXI A;  4A8X A;  1IBM F;  4O44 A;  2CQ3 A;  2R7T A;  5H9E K;  2NSB A;  3CCZ A;  2AGQ A;  4LQ3 A;  3KJF B;  2M9K A;  5KFB A;  2OPS B;  2MGZ A;  3MM5 B;  2E5J A;  4NOH A;  4V19 X;  2GQ2 A;  2OMO A;  4KY3 A;  2VG5 A;  1VRU A;  5JMN A;  2WVE A;  3MPD A;  2RS8 A;  3ADA C;  4UF4 A;  1CSJ A;  1IR2 A;  1JB0 C;  3AFG A;  1NKE A;  2EVZ A;  2YKN B;  3CME S;  5IM0 B;  3T1H F;  3EGW B;  3VTI A;  3NNC A;  5F8J A;  4ZK7 M;  1KEK A;  3R9L A;  4CO4 A;  4KFB A;  3IAM 9;  2ERR A;  1HHT P;  4FNH A;  4GKJ F;  1CJV A;  2HVD A;  1KVK A;  4PG5 A;  3Q8Y A;  4Y34 A;  4X4T A;  2VFS A;  1NUE A;  3CJK A;  1YTY A;  1OWX A;  2ZDP A;  4J5O A;  2ZM6 F;  1HPZ A;  1TL7 A;  2LKZ A;  5LM7 E;  2VKZ G;  1LFW A;  2M0G B;  4DV4 F;  4WBF A;  2H9Z A;  1LV5 A;  2BJ3 A;  3MM9 A;  3M2R B;  1ARO P;  4MMO A;  1FCA A;  1IKV B;  1VRT A;  3EVM A;  5K20 B;  1X0P A;  5C24 A;  1S1V B;  4ZN3 A;  2FJV A;  2AJ0 A;  2XZW A;  1QDU B;  2RKI A;  2P9E A;  3ENQ A;  1N52 B;  1TFW A;  4ZVR B;  2OP5 A;  2ZH7 A;  4J9U E;  1SC4 B;  3DLE A;  4DBQ A;  2HBZ B;  2NYI A;  1N0U A;  1PC4 A;  5DET A;  2QMU B;  1SH3 A;  1XMQ J;  3V81 B;  1ZH5 A;  1U25 A;  2OPQ A;  2LQB A;  5B0G A;  4DR2 J;  3KHL A;  1TKZ A;  2V2V A;  5J2N A;  4I67 A;  1HWU A;  2YNI A;  1P6T A;  2AJ4 A;  5D4N A;  2HFV A;  4KH1 B;  1Q82 T;  2M3D A;  5CD4 H;  3AT1 B;  4OI1 A;  2KT3 A;  1UW4 A;  5H9F K;  3M8W A;  4J90 A;  2C3P A;  3IXQ A;  1NLK L;  1T9U A;  4FXD A;  3AA8 A;  2HVH A;  3GP9 A;  4WFX A;  1DAR A;  3C16 B;  3D2W A;  1L5U A;  5KFT A;  4C9D A;  4NCA A;  3OHB A;  3W5Z A;  1WC5 A;  4YB6 A;  3TAQ A;  3PO5 A;  1NK8 A;  3HPO A;  1T02 A;  3LO3 A;  4QIE A;  1RT1 A;  5EN1 A;  4NLX A;  4M5H A;  2I5J A;  1VJW A;  2RRA A;  2JVO A;  4A4J A;  4CO3 A;  5MAO A;  3DRX A;  4QR2 A;  3ET6 A;  1IKX B;  2R4F A;  2R9L A;  1BC6 A;  5JVG Q;  2XWY A;  2MY7 A;  3RRH A;  3LOU A;  4CO0 A;  3DRR A;  3CVK A;  3PAC A;  2XMW A;  1IN0 A;  1FKO A;  4KV8 A;  1GTE A;  4B9T A;  3LP1 B;  4MFB A;  3PIP Q;  2A3J A;  4NML A;  3G96 A;  5AJ3 J;  2G2Y A;  1ZAX A;  3CCE S;  1KQG B;  4I6W A;  2W9C A;  3CMQ A;  3TZY A;  4JUZ A;  1HQE A;  1VRQ C;  4YP3 A;  4U7C A;  1VIS A;  4X64 J;  3B6B A;  1OIA A;  1UCN A;  2KN4 A;  2G1D A;  3MFI A;  1PGZ A;  5SZT A;  1PIE A;  1T03 A;  3POT B;  2V2Z A;  3EGV A;  3OTO F;  3HSD A;  2WB4 A;  4ELV A;  1TFY A;  4B3T F;  2QYG A;  4EI2 A;  4FKY A;  5AE3 A;  3QFH A;  2GIF A;  5KFG A;  1N33 F;  1RAA B;  2RUS A;  1DFD A;  4H4K C;  4URQ U;  3N0V A;  3R5C A;  3FBE A;  3W61 A;  3BR8 A;  3MEK A;  4OZ2 A;  3PW0 A;  1FX2 A;  3UVJ A;  4Q44 A;  1VBX A;  4EZ6 A;  1UWB A;  3VAM A;  4O3S A;  1RYS A;  2VF3 A;  4BS2 A;  3PM9 A;  3SMZ A;  1IJF B;  4ZDN A;  3O44 A;  4GKK J;  1FJG F;  3SCK E;  4L75 A;  2XSF A;  3Q23 A;  2V9K A;  2Q43 A;  2HQI A;  4X4S A;  2V4Q A;  3N28 A;  3GII A;  2YNG B;  1QVG R;  4ZVQ B;  4ES1 A;  2JLF A;  5A8K A;  5A8W B;  1HBN B;  4DQQ A;  2WHO A;  4FS1 A;  3LWM A;  1FRX A;  2BEF A;  2JNJ A;  4K59 A;  1JNR B;  3GJR B;  4C8L A;  2NQP A;  3CCR S;  3LPY A;  4EYH B;  2EC0 A;  2ASJ A;  2B51 A;  2QA1 A;  4IQM A;  4ICL B;  2R2U A;  3BPD A;  1Q79 A;  3DYA B;  3QRR A;  1WKK A;  1IM6 A;  1NSQ A;  4DR5 F;  3MTK A;  1YBT A;  2CWX A;  2P6S A;  1Q16 B;  3WC0 A;  2V9W A;  2I0X A;  3RGI A;  1T9V A;  4LQ9 A;  5KG1 A;  2W2P P;  2W9A A;  3M2U A;  1AXQ A;  3QIP B;  4M5K A;  2NZ4 A;  3ZZU A;  4QW9 A;  1F1B B;  3GIJ A;  3AOD A;  4P75 A;  1U2C A;  2A0F B;  2XO7 A;  3E8O A;  4IO9 Q;  1IWA A;  4F3M A;  3FEZ A;  4QYZ J;  4NLU A;  2DK2 A;  3PRB A;  4UY8 T;  3RAX A;  4I7F B;  5KFC A;  1RAO A;  1FTR A;  1UJ5 A;  1GT8 A;  1TP7 A;  1GK8 A;  3OUY A;  1AFI A;  1WDT A;  4LMZ A;  5DG9 A;  3PX0 A;  2RNE A;  3UFC X;  3Q2S C;  1S0O A;  4K2J A;  1SQE A;  2DR9 A;  2XSJ B;  1NK4 A;  1WTF A;  2W4C A;  4OHY A;  2W1B A;  3NP5 A;  5CYM B;  3QNW B;  3DI6 B;  3OW2 R;  2N4C A;  5I42 B;  4RW8 B;  3OV7 A;  4DPW A;  1UAW A;  3SXL A;  4NLP A;  1H2U X;  2BMB A;  3HZG A;  4QW8 A;  1S59 A;  2QG9 B;  1FEE A;  1U6B A;  4A8Q A;  2R8H A;  1TKT A;  4F8R A;  1RTJ A;  2AEJ A;  1WEX A;  2MJN A;  3BH7 B;  1ZM2 A;  3VQS A;  3N6N A;  4K2X A;  2P9G A;  4KB7 A;  4M5G A;  2MZQ A;  3PFE A;  5FD1 A;  1NPP A;  4RWW A;  2MQM A;  2MLX A;  5KT2 A;  1LEO A;  1VIX A;  3FMB A;  4WII A;  4DN0 A;  1I94 J;  3WIV A;  1VCT A;  3LH2 S;  3RBE A;  4AT1 B;  1NME B;  1BLU A;  2BM0 A;  2MZJ A;  3TAM A;  3JTO A;  3IR7 B;  4DMZ A;  5DZ6 A;  2R8I A;  2HHW A;  2WSC C;  1S12 A;  1RAF B;  2OEJ A;  2DNM A;  4HKQ A;  2ZE2 B;  1A7G E;  2COL A;  3JSM A;  2MLY A;  1VBZ A;  2D3O 1;  3I5A A;  4TU8 A;  4KGK A;  3CJ8 A;  3V4I A;  1KQK A;  4YN3 B;  2CIM A;  1B7F A;  1XNQ J;  4I6Y A;  4I2P A;  5L1K A;  5K8M A;  2LQ5 A;  3KDN A;  1FRM A;  3TWZ A;  2C2N A;  2J0S D;  2UVU A;  3QT7 A;  1RQ0 A;  3QFW A;  2R2T A;  2ZOM A;  1VHF A;  1C0U B;  3P8B B;  4OV1 A;  1F60 B;  1K47 A;  3MD1 A;  3KG0 A;  1NJX A;  2RDD A;  1TVR B;  2X3G A;  5F9N A;  2F4V F;  3O2I A;  3KXD A;  4N56 A;  1S6O A;  4M5N A;  2E9Z A;  4KPC A;  1S1X A;  1Z4U A;  4XIU A;  4MKA A;  2PFF B;  2FC8 A;  1M0S A;  1S6Q B;  2QA2 A;  2XEX A;  2GZO A;  3KUE A;  2VA2 A;  2J7W A;  4CLZ A;  1RBO B;  3UWT A;  3BGL A;  5F0W A;  2W24 A;  5D77 A;  1C1C A;  4LIW A;  4J7C A;  2WSF C;  2N4D A;  1SJQ A;  2DNO A;  4WP8 A;  4JI3 F;  3VV2 B;  2HQG A;  1CUL A;  1HKA A;  2MQN A;  2YWK A;  1WOS A;  4J9N A;  2IMO A;  4K4Y A;  1NSP A;  2HZA A;  4HLB A;  2F7V A;  3D9B A;  2DR8 A;  3EGZ A;  5I4M A;  3AQO A;  2CJB A;  4JB8 B;  2KI2 A;  2XGQ A;  2Y1R I;  5E2Q A;  1P1L A;  2ZH2 A;  2DIT A;  4P74 A;  3J81 Y;  2DHH A;  5T41 A;  1WG1 A;  1WC4 A;  4DR1 F;  4KR0 B;  2OPP B;  5IOL A;  2PI4 A;  5KFU A;  3L7P A;  1BY9 A;  4NYO A;  4RWX A;  1QM9 A;  4ELT A;  4PQU B;  2CQH A;  1NKC A;  1YI2 S;  3PCO B;  2CPZ A;  4UOF A;  4YB7 A;  3GCW P;  3CUN A;  4IOC Q;  4DV5 F;  2UUC F;  3MR6 A;  1IKW B;  1FT8 A;  5J1N A;  2EC2 A;  3UN2 A;  2WVB A;  4ECQ A;  2YKP A;  2UXD F;  5EDW A;  3MUT P;  5KFM A;  3HSZ A;  4UTG A;  2DPI A;  2DIV A;  2D9O A;  2W8K A;  2RS2 A;  4HHU A;  5E7O B;  1RHK B;  3THT A;  3OFE A;  5E3P A;  1KRP A;  4L73 A;  3VVU A;  3UDL A;  1SV5 B;  2Z8Q A;  1ZZN A;  2G2O A;  2O1P A;  1K0T A;  4C97 A;  4K4W A;  4DV0 J;  4DS5 A;  1FNX H;  1UMJ A;  3TA0 A;  3QMQ A;  2Z56 B;  1TK5 A;  4UQG A;  4ILR A;  3MPY A;  3EXY A;  3UN3 A;  4LSZ B;  1NND A;  1BE4 A;  3MGJ A;  3FFI A;  4XPE A;  1IVZ A;  3JYT B;  1RP5 A;  1FJC A;  4EWT A;  3K59 A;  1N5Y A;  5KFH A;  1VOM A;  2MHN A;  1F5A A;  2VG5 B;  3OHA A;  4ECV A;  3UCU P;  4I2Q A;  1RT6 B;  4FZV A;  1RTI A;  4JI0 J;  2NSC A;  3MR2 A;  2AJ1 A;  3C6T A;  1KBR A;  5D0G A;  3IWX A;  4BC7 A;  1ZET A;  3L7U A;  4KFB B;  2LEP A;  3C46 A;  3UNG C;  4G1Q B;  5KFY A;  4LF7 J;  1IR0 A;  1B7Y B;  4USW A;  3AH6 A;  3VAG A;  2AEF A;  1SVD A;  1U8S A;  2LEB A;  2HFU A;  1MN7 A;  1WHW A;  3JSY A;  1HBM A;  2VC0 A;  3R1L A;  1D9A A;  1FX4 A;  2XTJ P;  1MN9 A;  1S77 D;  2KHD A;  1EB0 A;  3DRP A;  2B7B B;  5L1J A;  8RUC A;  3PJX A;  1N32 F;  5HRO A;  1A6L A;  2EFQ A;  2KO1 A;  4WE1 A;  1QE1 A;  2DRB A;  4ANC A;  5D0E A;  4BC9 A;  4C48 A;  5K8N A;  2FY1 A;  3WBZ A;  1DLO A;  3EZU A;  2ZHA A;  2FHJ A;  4DUT A;  1XMO J;  4CLS A;  1BWV A;  4OZ5 A;  2AIR B;  4HTJ A;  4DQS A;  1SJ3 P;  1Q4R A;  1ZTT A;  4R25 A;  4NXN J;  1JIH A;  4NE9 C;  1FRH A;  3DLE B;  2KM8 B;  3MR5 A;  2J7U A;  1WEL A;  2AW0 A;  3GR1 A;  4I64 A;  2QV6 A;  2Y1J A;  3JTP A;  6FDR A;  2OPQ B;  3LAM A;  1WHY A;  2DXF A;  2FYX A;  1V3R A;  1TKZ B;  4CDI A;  3KMQ A;  2V8D A;  3UO0 A;  5B0C A;  5J2N B;  1S7I A;  2YWE A;  5A0Y A;  2JEG A;  3BDE A;  2B56 A;  2UXB F;  3BSA A;  3A1Y G;  4JI6 F;  3KHH A;  4OHZ A;  3OSP A;  4F0K A;  8AT1 B;  4LFC F;  3I96 A;  4I68 A;  4DR4 J;  3AOC A;  3NGT A;  4RW4 B;  5KG4 A;  2OI2 A;  1EP4 A;  3V6H A;  3EVO A;  2JL9 A;  2EFN A;  4ZVO B;  3RYL A;  4ED6 A;  5I3Q A;  2KT5 A;  2JDJ A;  3C2P A;  2CFX A;  3M4X A;  2IHR 1;  5FJ4 A;  2MKK A;  2HND A;  2QGF B;  1XTZ A;  2Y8W A;  3G82 A;  2O3D A;  3TA1 A;  2AP6 A;  1ACM B;  1RTH A;  5GVQ A;  2VC1 A;  1RSC A;  4FYV B;  5DG7 A;  1AZS B;  2VUG A;  2FLO A;  4LF8 F;  3DDN A;  2W2Q P;  2B7C B;  2OHD A;  1NZA A;  4C3L A;  3EPI A;  4Y2C A;  3M8S A;  1FER A;  2RDI A;  2X1G A;  3ZTP A;  2E1R A;  4YHH F;  2W4P A;  1R3N A;  1UEU A;  2WSE C;  3IO1 A;  2PEH A;  4JYA F;  2OEM A;  1KWM A;  4NYP A;  3CCV S;  2VIC A;  1HQE B;  1O51 A;  3TJA A;  2OML A;  3CD0 A;  1FHT A;  4IR1 A;  2KZM A;  2YQ1 A;  4WFA Q;  3AXK A;  2LMI A;  4HR2 A;  2FVC A;  2WW8 A;  3QRP A;  1MG7 A;  3ETO A;  1N48 A;  4C98 A;  2V34 A;  1T03 B;  1LWC A;  1VQP S;  4PAA A;  1FKP B;  5EGY A;  1Y4Z B;  4AXI A;  5KOX A;  5BYS A;  3SSQ A;  4WTY A;  3C14 A;  3AD7 C;  2UVW A;  1S9E B;  2WTF A;  1NK7 A;  1WTB A;  3PW4 A;  4YS2 A;  5D78 A;  2WBR A;  5ETR A;  2CPI A;  5LJ3 Y;  5F3Z A;  1RWU A;  3TX0 A;  4L3N A;  4DV6 F;  2V6A A;  3DLK A;  2BR0 A;  5KFR A;  1YVF A;  1VR6 A;  1BQN A;  2V2K A;  5IFM A;  4C11 B;  1DHM A;  1UPP A;  3HVT A;  4KYZ A;  2DNP A;  2A6M A;  4U67 Q;  1FFG B;  2OPR A;  2R7Q A;  5KT3 A;  2EK1 A;  1H0H B;  4DSK A;  2Z2M A;  4M5D A;  4BDP A;  1KON A;  3R2C J;  3ILI A;  2F8H A;  5H1S V;  2RHS B;  2H4W B;  5HO4 A;  4IG3 B;  4WP3 A;  2J7K A;  3HCX A;  4CT8 A;  1REV B;  4DU7 A;  4C8K A;  2YXL A;  2EG2 A;  1MU2 B;  3CNQ P;  1C1B A;  2ZDO A;  1HBU B;  1WC6 A;  3M32 B;  1PJ5 A;  5E41 A;  1RHM B;  4LR9 A;  2R7R A;  1V5I B;  1XMB A;  3CCL S;  2DVI A;  1PBU A;  2HQD A;  2VV5 A;  3JSR A;  4A48 A;  4IO1 A;  4X65 J;  4L74 A;  3MCS A;  1RAC B;  3MMB A;  2VG6 B;  1RLC L;  1XEZ A;  3K5N A;  2RD5 C;  4LUB A;  4DSL A;  5HAO A;  4OX6 A;  4FYX B;  1QAI A;  7FDR A;  5KFN A;  1CJK B;  4NI2 A;  2VQF F;  4M1K A;  3A13 A;  2D7S A;  4DL2 A;  2BW2 A;  3OFH A;  2W2N P;  4RW9 A;  1FDN A;  3H8Y A;  5LJ5 Y;  3BF4 A;  4DL7 A;  3RBD A;  3VR1 A;  2F8E X;  3OUY B;  4QBU A;  3M9N B;  5J2P A;  2DB1 A;  2FIU A;  4NLW A;  5L9X A;  3FBC A;  3IBW A;  1U1N A;  3D7S B;  2ZD1 B;  2QL5 B;  2AJ2 A;  2GX8 A;  3OLA A;  4K50 A;  3QO9 A;  3FSI A;  1RT7 B;  3G8T A;  1JKH A;  2IA0 A;  2C1E B;  1SJ4 P;  3GSI A;  2XLK A;  2Y1I A;  4NRT A;  3NGS A;  4XDD A;  4ED2 A;  1JLE A;  3FSY A;  2KXF A;  1TAU A;  1F9E B;  4IFV A;  1RTJ B;  7FD1 A;  1JLQ A;  4LVO P;  2ZJR Q;  1QSY A;  3AJD A;  3UI3 A;  1V3S A;  3E3X A;  2A2C A;  4PPZ A;  2MZS A;  2VG7 A;  2HFZ A;  3QID A;  3GYX B;  1QJH A;  2GIQ A;  1Z2Z A;  2EFP A;  4QWC A;  2CPH A;  2EKN A;  4DLG A;  2R7V A;  1KC8 T;  3T3F A;  3RR7 A;  1HYS A;  4QIV A;  4ER8 A;  2QE5 A;  5A6P A;  2AX0 A;  2ZH3 A;  4KJI A;  3NWG A;  4L3K A;  2A18 A;  4N47 A;  1K8A T;  2F5G A;  2N3O A;  1D8Z A;  1GMW D;  1JK9 B;  2Z58 B;  2CDQ A;  1IKY A;  4IRC A;  2XCA A;  3BBF A;  4A8M P;  4IFY A;  2PA8 D;  1SL0 A;  4PUO A;  3BGO P;  3NNH A;  4I2P B;  3DDI A;  2BVZ A;  3TUJ C;  4D3G A;  4UOC A;  3F73 A;  4DUZ F;  4USH A;  1U0S A;  1S99 A;  3TAR A;  2X51 A;  4RZR A;  3R8Y A;  2CQI A;  4DV7 F;  2YKA A;  1Z2L A;  2CNL B;  3BEG B;  3TI0 A;  3KK1 A;  3EPG A;  1N6Q B;  2FGC A;  4EEY A;  4EZ9 A;  4O23 A;  1T05 A;  3Q83 A;  5ETP A;  2XMV A;  4RU9 A;  2VFV A;  2HBR B;  2GW8 A;  3CJ4 A;  4E2F B;  3I9V 9;  5KG7 A;  1RWK B;  2O66 A;  1TL1 A;  1U6F A;  2Q6C A;  2W2M P;  1NO8 A;  2GVZ A;  3ILO A;  3BB5 A;  1FNM A;  2GHV C;  2HGM A;  2FZK B;  1LK5 A;  1FE4 A;  4XO0 A;  3H5S A;  4KTQ A;  1FRL A;  2H5I B;  3KUH A;  2YBV A;  2MLZ A;  1CUL B;  2DYA A;  2FHM A;  4RBU A;  1MML A;  3SCI E;  1G6B A;  3OXG A;  5DGA A;  1HNZ F;  2VPZ B;  3CJS A;  2JFK A;  1T9W A;  2J9E A;  5DO2 A;  5IC4 B;  4USU A;  2IPO B;  1H7W A;  4PWD B;  3U02 A;  3RB4 A;  2ZNY A;  1WWH A;  3FQL A;  2MZ1 A;  3R27 A;  1UZD A;  4DR3 F;  2OJ3 A;  4OYP A;  2NRE A;  2DXE A;  4NZ7 A;  4K7Q A;  4H4O A;  1ULR A;  2XCP A;  3MEE B;  2DHG A;  2PC6 A;  4Q8F A;  5D3G B;  2B0G A;  1BQM A;  5DJB A;  2QMX A;  4IOB A;  3NNA A;  4CYU A;  2DGT A;  1UW9 A;  4DL3 A;  1E6V A;  3NL0 A;  5EHH A;  1MW7 A;  2HZV A;  1BWE A;  5GAG I;  2GVD A;  1R8A A;  2MST A;  2ZH9 A;  1VQM S;  4X4U A;  4C3K A;  3C6U A;  4A8K A;  4F0M A;  2IAJ A;  4GO5 X;  1B0V A;  1D1U A;  2HW3 A;  3HDS A;  1R6Y A;  3R2D J;  2JFD A;  4OX9 J;  2G0I A;  2HAI A;  2HS4 A;  1SH0 A;  2J0X A;  4TQR A;  4DL6 A;  4OYW A;  4UW2 A;  3H4D A;  1MMD A;  2B6A A;  3MEC B;  1GX6 A;  1U2F A;  2RDJ A;  4ZPD A;  4U96 A;  3MDF A;  2ZHB A;  2MKY A;  3NLC A;  1TTH B;  1MWY A;  2GNK A;  4Q0B B;  3KG4 A;  1VDH A;  3S1T A;  1BQX A;  4ZJQ A;  2AYG A;  1U8W A;  4M5J A;  3GSD A;  1Q78 A;  2E5H A;  2UU9 F;  2DHA A;  2BYC A;  1VQS A;  1ZAW A;  1N4L A;  1ZA1 B;  4QIG A;  4M95 A;  4RR5 A;  4UUW A;  4ZP7 A;  2KKH A;  4A8Y A;  3CD5 A;  3HXM A;  1N5Y B;  2J5A A;  4XAK A;  4A8F A;  3GIM A;  4YY3 F;  2ZUG A;  4WYW A;  4IRK A;  2Q1L A;  4M94 A;  4I2Q B;  4P7V A;  5HK4 A;  2UV8 G;  1NB2 A;  4ZVF A;  1TL3 A;  3QJP A;  3MAA B;  3KJV B;  2R2R A;  4AYB D;  1U1Q A;  1RAB B;  2V50 A;  2UP1 A;  3OJS A;  3L7O A;  2M4M A;  4R8U B;  1N34 J;  2XHC A;  2HNZ A;  4F4X A;  3X1L B;  3C66 A;  4DPO A;  2KH9 A;  5H9E J;  2GFF A;  3KLI B;  3JQM A;  3TZX A;  4NEY A;  3DGP B;  2LDI A;  2OPS A;  1YGY A;  5L38 A;  2C2R A;  1R8B A;  3MM5 A;  4X62 J;  2X1F A;  1SH2 A;  1BHN A;  2ADB A;  2QZ8 A;  1X4F A;  3DRP B;  3JQJ A;  3I5B A;  4B17 A;  2YKN A;  5IM0 A;  4HHJ A;  4QR0 A;  4OJ1 A;  5HRO B;  5CYJ A;  1IUJ A;  3NCQ A;  1WF2 A;  4MKV A;  1Q8L A;  3OTC A;  3U1N A;  3EDQ B;  4ZP6 A;  1G7C B;  2V67 A;  3JTN A;  1NAQ A;  2OKQ A;  4D3H A;  3NGK A;  2DR5 A;  5IWA F;  4FBT A;  1PC5 A;  3TZW A;  1U6Z A;  4ZVP B;  5KFF A;  4UOG A;  2CQC A;  5IQQ A;  4CRJ A;  1NPR A;  2J9C A;  2X1B A;  5EWF A;  2QRR A;  2HGL A;  4L6V 3;  3FJ2 A;  2HHU A;  4XK8 C;  4IH7 A;  3V6K A;  2HRY A;  4NLO A;  2J6T A;  3EUN A;  3PYD A;  1IKV A;  3WC2 A;  2ZBP A;  5KFS A;  5D0H A;  3D0I E;  3SIP B;  5BR8 J;  2IYI A;  1X5S A;  4ZLL A;  4LSL A;  4EO6 A;  4CQ1 A;  2VAS A;  2BKP A;  1HD0 A;  5AE1 A;  2ROP A;  3BZQ A;  2J6S A;  3PYG A;  3MAH A;  7AT1 B;  5DDR C;  2RML A;  2YTC A;  4J9S A;  1RTD B;  3CJR A;  2H4Y B;  3V81 A;  6FD1 A;  4LR7 A;  3J7A 1;  3P3D A;  3HSG A;  1OMS A;  4M5I A;  2GC8 A;  4Y2I A;  3G6V A;  1NDK A;  3GB0 A;  3L3C A;  2HND B;  1RKI A;  5CAB A;  1XNR F;  4DPT A;  4TKT A;  3BGF A;  1CLF A;  5H9F J;  3MOJ B;  3DNC A;  2R42 A;  4CLU A;  1OQ6 A;  4NYZ A;  3QJL A;  2WVC A;  3ZTS A;  1UVK A;  3C16 A;  1KN6 A;  5BXI A;  5EX3 A;  3IRX B;  3H2L A;  2C2Z B;  3FCV A;  4AE5 A;  4LF6 J;  1NK5 A;  1NJI T;  3BPS P;  3W62 A;  2GMJ A;  2CDR B;  4LF5 F;  1OY6 A;  4CWB A;  3KKF A;  3TAP A;  3PHE A;  5E3Q A;  5DQI A;  4O3O A;  1GH8 A;  1LNQ A;  3AQP A;  3A8I A;  2KU7 A;  3THV A;  5F3T A;  3M30 B;  2ZUA A;  2YPY A;  3W5X A;  1FK9 A;  1LWC B;  2M5Y A;  3UDV A;  2GA7 A;  3M9O B;  1DTT B;  3NY0 A;  3RR8 A;  3EX7 B;  1H3D A;  1Q5V A;  2JEJ A;  1RUS A;  3EM1 A;  2UXC F;  2CUY A;  2J8A A;  1HI1 A;  1EAY C;  3UD4 P;  2QL7 B;  5AE2 A;  2F65 A;  3GZ7 A;  2YH0 A;  3OTB A;  2LYV A;  1UVM A;  4DCP B;  2ATC B;  4QWB A;  4NX9 A;  1S79 A;  2EG1 A;  4OYZ A;  3HVT B;  3ITH B;  3FEX B;  4OHX A;  4JI5 F;  2MKS A;  2LU1 A;  4B3O B;  3KUG A;  1URR A;  5HVF A;  1HNI B;  3POT A;  2XGP A;  2KFY A;  1QUP A;  4J9K A;  2Q79 A;  4M5D B;  1UA0 A;  1XWL A;  2ILZ A;  3AOB A;  1M5K C;  3ISZ A;  4DZD A;  2DR6 A;  2X1A A;  2ZVI A;  2GO9 A;  3W9H A;  4ZA1 A;  5C42 B;  1TKX A;  3DN9 A;  2E1A A;  1KOO A;  3CD6 S;  3M8Q B;  3KK3 B;  3J7Z 5;  1HAR A;  4ECU A;  2JLG A;  3LWL A;  3NS5 A;  3N4W A;  5KFE A;  4USK A;  3LGM A;  3RAM A;  4QPT A;  2IM0 A;  3D6M B;  3CJ3 A;  2PO4 A;  2YKM B;  2R2S A;  2VFT A;  2BRL A;  2Y1L B;  4DV3 F;  5L39 A;  1T94 A;  4F4A A;  3MMB B;  2YNG A;  3BH6 B;  5B09 A;  2HLU A;  4AQY F;  4B9M A;  1P9Y A;  2ZNZ A;  4CH7 A;  1HBN A;  2JOQ A;  2YWW A;  3FC9 A;  2BRK A;  3MMA A;  1VQL S;  3FSX A;  2E5L J;  4DFJ A;  1VQK S;  4DFM A;  1BUX A;  2IDE A;  2CQ2 A;  2VD3 A;  3CGI A;  1PCA A;  2W7A A;  4Z7Y A;  1S6P A;  4OZN A;  1YLX A;  3DYA A;  4YB5 A;  3CCM S;  1SXL A;  1XBW A;  1RWO B;  4ZKA A;  3D1O A;  3QO9 B;  4DS4 A;  3I32 A;  3QIP A;  3L95 X;  1JKH B;  2HBY B;  2HWT A;  1EKR A;  4DQI A;  6AT1 B;  1SC6 A;  4C8N A;  2FLN A;  1JLE B;  1FA0 A;  5FDL B;  4UY8 5;  1WEY A;  1WC3 A;  1YZ7 A;  3N79 A;  4FP9 A;  2CJK A;  2DEI A;  3DU5 A;  3T6J A;  2P9C A;  2KM8 C;  4C6A A;  2ACM A;  2IVM A;  4I7F A;  3JB9 k;  1RWM B;  3BSO A;  3PHT A;  1SQF A;  2AJF E;  2UZA A;  3HJF A;  4J37 A;  5F9L A;  2I6W A;  4PAB A;  3T1Y F;  3FCW A;  2XSJ A;  1FDB A;  3P6Y C;  2HIY A;  1XR5 A;  1FD8 A;  1RT5 B;  5CYM A;  3DI6 A;  1HYS B;  3G6X A;  5I42 A;  4KQZ A;  4G65 A;  3M1V B;  3K7R A;  1R27 B;  4FKX A;  4P6Q A;  2M7S A;  3BBC A;  3HLU A;  3EWG A;  4ECR A;  2DGQ A;  3CB4 A;  2MYF A;  4B9U A;  1IKY B;  1U49 A;  4WXW A;  2AF6 A;  5T14 A;  4LF9 J;  3QT8 A;  4B9N A;  2VON A;  3LF0 A;  1U24 A;  1U0H B;  5KT6 A;  1RHR B;  1JJC B;  3MD3 A;  4DCJ B;  2IVF B;  5IC6 B;  3LA0 A;  1SJF A;  2B8P A;  2AMC B;  5KFV A;  3A3N B;  3GG1 A;  4W4M A;  1DUR A;  2QSW A;  5KG2 A;  4LF4 J;  3FVY A;  3KK1 B;  4DJB A;  3OTE A;  3GU0 A;  3HHD A;  2CG8 A;  4ZPW R;  1FI4 A;  2WCX A;  2CPY A;  1FF2 A;  3TVK A;  1HNX F;  2ZE2 A;  1M5P C;  3GIR A;  3MR3 A;  2GCF A;  4M5L A;  2IJF A;  3CDA A;  2BA9 A;  2QJ3 A;  2R3V A;  1TUG B;  3CCT A;  1Y00 A;  3H5Y A;  5GAD U;  4ECT A;  3G6Y A;  3MTJ A;  1TL1 B;  1NB7 A;  2GVZ B;  4URG A;  1V5V A;  3MED B;  2NR0 A;  2MQL A;  5E0O A;  3TUI C;  3QT5 A;  3D5M A;  1C0U A;  1N36 J;  1WNE A;  5HLF B;  3ZZP A;  1NJY A;  3UPF A;  2QO3 A;  3M8P B;  4DV1 F;  1Q53 A;  3KLH B;  1H72 C;  3DXS X;  2G13 A;  3B4M A;  2N3L A;  2YQ3 A;  1UTA A;  2LEA A;  3HVW A;  1CJT B;  1RA7 A;  2IIH A;  3KJQ B;  1S6Q A;  4YB1 P;  4NCG B;  2YKQ A;  4H4O B;  5DLF A;  4RNM A;  2HKE A;  4ZVS B;  1Y3J A;  3ULH A;  2V8H A;  5BJR A;  2IA6 A;  1ZAV A;  1QAY A;  3RG6 A;  4ZLP A;  3DOM B;  1S48 A;  4PXD A;  1W2B R;  1KVI A;  3OVA A;  5KFJ A;  3EJM A;  2L3M A;  4ZCM A;  1M5O C;  1RHU B;  2ZH1 A;  2GVD B;  1IBC B;  2FLL A;  1FE0 A;  4F3O A;  3G2X A;  3OL9 A;  2LXF A;  4DX8 H;  1GTH A;  3K5M A;  2N82 B;  4GVL A;  1D3W A;  2HQF A;  2JEF A;  3NBP B;  5A2Q Y;  3JXO A;  2VBY A;  2ZKU A;  4NLQ A;  4MYU A;  4NL5 A;  2DO0 A;  2DNQ A;  4UST A;  3BQ1 A;  2GO8 A;  2DCU B;  2E7W A;  3IG1 B;  5F8L A;  2OPP A;  3ENV A;  1UFL A;  1KKH A;  4S0M A;  2IRU A;  4CTA A;  1YJ9 S;  1O8B A;  2BQ3 A;  4PQU A;  2GIR A;  4ZPC A;  2Y8Y A;  4DSF A;  5CZV A;  3MUR P;  4FYY B;  3Q8R B;  1F3V A;  1S49 A;  2B8Q A;  3EZO A;  4AL6 A;  5A76 A;  2PD1 A;  3NGD A;  2DRA A;  1R8H A;  4KKO B;  3TR5 A;  2IFX A;  4WPA A;  4B3R F;  1FES A;  1CVJ A;  2XY5 A;  2E7V A;  2LLZ A;  1NK0 A;  2G1H A;  3DLH A;  2I9S A;  4C0H A;  2YWH A;  5KFQ A;  1HR0 F;  2CXE A;  4J9P A;  1RKJ A;  5CH7 B;  1S4F A;  4UT4 A;  3K89 A;  2AV5 A;  1VC6 A;  1EKS A;  4F36 A;  3BO3 A;  3T19 A;  1VQ4 S;  1FWP A;  2DGO A;  4DDF A;  1PYS B;  1K44 A;  1ZTW A;  5K8P A;  3PX6 A;  1FWL A;  4KO0 B;  4TVA B;  1IXK A;  4MT1 A;  1OPI A;  3FBF A;  4HL9 A;  1S9G B;  2E1P A;  2IVY A;  3J7Y U;  3V5R A;  2HS3 A;  9ATC B;  1IBL J;  4X2B A;  5ETQ A;  2DIU A;  1NJW A;  5LL6 d;  3JYT A;  5LMU F;  4DCO B;  2Q66 A;  4P2F A;  4YDD B;  4F4Z A;  1RHJ B;  3KOA A;  4CNY A;  5B0B A;  3SQO P;  4W90 B;  4NRU A;  2H5E A;  4HDG A;  3RUB L;  4MK8 A;  1C2P A;  1RT6 A;  1M1H A;  1TK0 A;  3FK4 A;  2MKH A;  3R6L B;  1X4C A;  1T0T V;  3QYY A;  4OL8 A;  1AB8 A;  2A2D A;  5F8G A;  2ZVS A;  3KK2 A;  3Q8V A;  2ASY A;  2BJ8 A;  2C42 A;  4KGZ B;  4QR1 A;  5KFX A;  1RIS A;  5KFD A;  4G1Q A;  4DV1 J;  3E51 A;  4GC7 A;  4O4R A;  1LW2 B;  2IDL A;  1WOR A;  1J5E F;  3BQ0 A;  1SIZ A;  5J1E A;  3ISN D;  3QGP A;  2KL8 A;  4ETX A;  2PMW A;  1YJW S;  3PJ9 A;  2M52 A;  1G2E A;  4JI2 F;  2BQR A;  3OVS A;  1KS2 A;  4LBI A;  4LFB J;  3G8Q A;  1K0V A;  3HHK A;  1FVQ A;  2YQ0 A;  2IC3 B;  2LXI A;  3JS9 A;  1F0X A;  3ETM A;  2B4P A;  3NCR A;  5L1I A;  4MYT A;  4JI8 J;  3IS9 B;  1IBK F;  3GR0 A;  4ITS A;  3QQC D;  1UFK A;  2AQ4 A;  1CPZ A;  3IR6 B;  1T11 A;  1MWZ A;  1NH8 A;  2C2E A;  4EBE A;  2C22 A;  1NK9 A;  5KTQ A;  5CQG A;  2MDA A;  4LSL B;  4X66 F;  4J9V A;  3DOK A;  2UUA F;  3R7N B;  1S0V A;  2BDP A;  2AYB A;  4OI4 A;  1JLB A;  2UUB J;  4GMK A;  5KG5 A;  3M9M B;  4ED1 A;  1JXL A;  2DGV A;  3G71 S;  4CO5 A;  3GV7 B;  1HWK A;  2QN6 B;  3KJN B;  4U9R A;  3DOL A;  1WHX A;  2BM1 A;  1VHI A;  3UD5 A;  1ZM4 A;  3GYN A;  1UWA A;  1MRO A;  1YJ7 A;  4ED0 A;  4K4Z A;  4NLS A;  5D0R A;  3W3S A;  4LRC A;  2DNG A;  3T5K A;  5KG6 A;  3CPW R;  4DR7 J;  4RW4 A;  4K0K J;  3AB2 B;  1HNW F;  2FJE B;  1I51 B;  4PQA A;  3MFH A;  2ASL A;  5E3R A;  3IC1 A;  1SL1 A;  4WK3 A;  3OR1 A;  1UPM B;  2CQP A;  4J9L A;  1EZZ B;  1RT2 A;  2L41 A;  1SUQ B;  4ID8 A;  5F8N A;  2NXU A;  2RAQ A;  3B8H A;  1Y5N B;  3Q0A A;  2FB0 A;  3EDR B;  1Y0H A;  3CCW A;  4J9O A;  3W66 A;  5THW A;  1JQG A;  1ZYQ A;  1AZS A;  1IBM J;  1FK9 B;  1B0P A;  2BAC A;  2EFV A;  2W25 A;  4K4S A;  2YKO A;  3AAW B;  1CJU A;  4FF4 A;  3CCU S;  4P2M A;  1L3U A;  4Y6I A;  2MKI A;  2QA4 S;  4NWB A;  4C8Z A;  3MPU B;  2EXU A;  1MNE A;  4OX7 A;  3P4U B;  3RJM B;  1NSK L;  3C3L A;  4JV5 F;  2IM2 A;  1FXR A;  2ZH4 A;  4RUA A;  3TOQ A;  1PSD A;  2CPD A;  5DDP C;  4ZHR A;  2YWF A;  1N5Q A;  2ZOF A;  3KLV A;  4DFP A;  3T1H J;  1R8P A;  1HQU B;  4YFU A;  3D3B J;  5BYQ A;  3D66 A;  4RW6 B;  4YOE A;  1CQM A;  1B0T A;  3P45 B;  4FVM A;  4NA1 A;  4E8U A;  1UKU A;  4GKJ J;  2V4J B;  5IV3 A;  4C2M A;  1FKP A;  4TY8 B;  3P5B P;  1KHV A;  3HFZ B;  4B02 A;  4HAC A;  2VZ9 A;  2ZM6 J;  4TYB A;  3CD7 A;  3O8W A;  3K17 A;  1S9E A;  4O0N A;  4DV4 J;  2WW4 A;  1TKX B;  4DR6 F;  3IP0 A;  5K9F A;  2FD2 A;  4GRS A;  1KLN A;  3G86 A;  5IV4 A;  5AXN A;  3IWN C;  1U47 A;  4RUC A;  3PY8 A;  1X8D A;  1RZM A;  4C11 A;  4DL0 C;  4NLV A;  3UCZ P;  2ZJP Q;  3L09 A;  1HMV B;  3LUY A;  4OJG A;  2NLW A;  4K4X A;  4F4W A;  3OQ2 A;  1EET B;  2I2Y A;  1T9Y A;  3SSS A;  2DGW A;  1NHV A;  4JI7 F;  3DLL Q;  4CNZ A;  4HI1 A;  3CTR A;  3W8G A;  1VQ7 S;  2PDA A;  4DV2 F;  5U47 A;  2IY5 B;  3DCA A;  1B70 B;  5J2M B;  3U1L A;  4IG3 A;  2RF2 B;  1XR6 A;  2E5G A;  1FD2 A;  1NDC A;  4JI1 F;  2HK2 A;  1REV A;  3R5B A;  1RWP B;  3MMA B;  3W60 A;  3C15 B;  4EFA C;  2XBP A;  3LAL A;  1MU2 A;  3ENW A;  3I4P A;  2J76 E;  1MMN A;  3DRS B;  3NGR A;  5E33 A;  3A8E A;  2VU5 A;  2NUH A;  1HBU A;  3M32 A;  1YK9 A;  4OJH A;  3K5P A;  1SCJ B;  2ACY A;  1TEL A;  3HD2 A;  1S6P B;  2HHX A;  1N5V A;  3ZTR A;  2AZ1 A;  2FPH X;  2JC1 A;  5HSP A;  2ZBI A;  5C5J A;  5A2Q U;  2C2M B;  4DG1 B;  2YY3 A;  3TVZ A;  2VG6 A;  1J27 A;  4LT6 A;  2MKJ A;  1W25 A;  3BKU A;  4JI4 F;  3CED A;  2A6O A;  5JUM A;  1JXE A;  3PX4 A;  3EXC X;  1FJ7 A;  3PG9 A;  1CJK A;  2XHW A;  5MLC V;  5GME A;  3VAK A;  4OIX A;  4B9L A;  5IT9 Y;  4LBH A;  2FJW A;  3OVB A;  2AU0 A;  3RB3 A;  4RNF A;  2W9B B;  3BSC A;  4EYI B;  1Y3K A;  2BX6 A;  4NLR A;  1H74 A;  1HHQ A;  4FDF A;  4ZJO A;  1H98 A;  2ILY A;  3RW6 A;  3F44 A;  1XR7 A;  2MTL A;  2FJB B;  4TXS A;  2ZD1 A;  3UR3 C;  1ELO A;  2QMW A;  4QU6 A;  2DNN A;  5G0R A;  1Y5L B;  2NPI A;  5I3P A;  3BO4 A;  4BCA A;  1RT7 A;  1VLY A;  4NXM F;  3UDE A;  3UN5 A;  2FY8 A;  2K3I A;  2XG8 A;  4ERD A;  1RAE B;  3SFG A;  5HBM B;  3W7B A;  5DGB A;  4Q8E A;  1X5P A;  2OEL A;  3QBC A;  1X7V A;  3HX9 A;  2QEX S;  3KLG B;  3WQP A;  4KRW A;  2LU2 A;  2XWX A;  2H48 B;  1PG5 B;  1H73 A;  3BN7 A;  1X9M A;  4OHW A;  5HL7 Q;  2YX7 A;  2CQB A;  3IR5 B;  4KHP F;  3BN4 A;  3OTO J;  4ELU A;  4B3T J;  1P27 B;  4ED5 A;  2Z2Y B;  3NG8 A;  4PWW A;  3NMR A;  2O5D A;  2RT3 A;  2AYE A;  1YBA A;  1N33 J;  2CQ0 A;  3ZC4 A;  1F5C A;  4B3M F;  1S1U B;  2MSS A;  2VFU A;  1H2T Z;  1G4C A;  3TW0 A;  3NKY A;  3BJY A;  2BOA A;  1NBE B;  3FKB A;  2XYH B;  3ONQ A;  2Y3Y A;  3ILJ A;  4TYA A;  5ETN A;  3MMC B;  4X4Q A;  2DEJ A;  3B82 A;  4F02 A;  3AD9 C;  3H25 A;  1FJG J;  4RW7 A;  1UVI A;  1T8E A;  2XQC A;  5DS7 A;  1T3N A;  1TL5 A;  2LCW A;  2VQE F;  2R7X A;  3D67 A;  1BXN A;  1VBK A;  3THP A;  3JQK A;  4R0J A;  3IBF B;  3WX4 A;  2ZC4 A;  1HA1 A;  1N6Q A;  4G6V B;  1E6Y B;  1VQN S;  5FLX Y;  4JBC A;  2CVE A;  3CCJ S;  3SV3 A;  2MJU A;  2KFZ A;  3B78 A;  4DSE A;  4KIA A;  5CYQ B;  5LSO A;  3FZ2 A;  3IFE A;  3A3O B;  3HHL D;  1WD6 A;  4DUY F;  3KDO A;  1RAD B;  4EMD A;  4LFA F;  3OTD A;  4CLF A;  5GAD I;  3QWU A;  2HK3 A;  1XER A;  2W8L A;  2CJQ A;  5ETV A;  1S1W B;  1K1Q A;  4DR5 J;  3MUM P;  3HF5 A;  3CJQ A;  1R89 A;  1YHQ S;  4KBI A;  3GCX P;  1SKW A;  1N0V C;  2HFS A;  4PKD B;  4RU2 A;  1REG X;  1ZS6 A;  4AXJ A;  3SFU A;  2W01 A;  2DY1 A;  1AW0 A;  4CM2 A;  4PWD A;  1B4S A;  4ZOS A;  5B0D A;  2GAH C;  2RB7 A;  5A6W A;  3O1L A;  1GNK A;  4LRA A;  3H42 A;  2CPE A;  5DDO C;  4I69 A;  3MEE A;  3A3P B;  1KR4 A;  5D3G A;  1S9F A;  2DKO B;  1RBA A;  1EX8 A;  4CTA B;  4WXO A;  2NXE A;  1I1G A;  2WOM B;  3C19 A;  3A8K A;  1X4A A;  2QC3 A;  2ZC3 A;  1SC1 B;  2JJ4 D;  5ETL A;  1ICE B;  1NPK A;  3DU6 A;  1IJE B;  3HUL A;  3LQV A;  3VGV A;  4TU9 A;  3MM7 B;  4ILM A;  2K1R B;  2OSR A;  4I1T A;  1X5T A;  5GAE U;  4BBY A;  1D9F A;  3T9N A;  2RQ4 A;  3BGR B;  4V1A k;  4ZVT B;  2M2B A;  2B3T B;  3OPK A;  1N8R T;  1U1M A;  1S57 A;  3MEC A;  2AYM A;  1ZBT A;  3I0S B;  3GG0 A;  3KLE B;  4HT7 A;  4WFY A;  3K57 A;  1XJW B;  4N8O A;  3G87 A;  3VHQ A;  3TP2 A;  4L76 A;  2IMW P;  2GQC A;  2GQQ A;  3ZTO A;  1P8G A;  3TQE A;  4Q0B A;  2DNR A;  1RHQ B;  2DO4 A;  2ZFH A;  3CJ2 A;  2F4F A;  2AT1 B;  3HO1 A;  3SBM A;  3HHE A;  1SQG A;  3SZ2 A;  3B54 A;  2XS2 A;  3BYP A;  3I56 S;  4H4K A;  3BR9 A;  3R5D A;  4LRE A;  2HZC A;  4NA3 A;  3R97 A;  1HBO A;  3D6H B;  4CH0 S;  2LP4 A;  2M8H A;  1SKS A;  1X4D A;  4QOT A;  5HQ8 A;  1CG2 A;  3MAA A;  3KJV A;  2WON B;  4NMX A;  2HFN A;  2N7Y A;  4Z2X A;  3KK2 B;  4WTO B;  4R8U A;  3GWC A;  5M2U A;  2OUG A;  2IYG A;  1U1K A;  5D8H B;  3DLB A;  2POK A;  2HHP A;  2DHS A;  3WHI A;  5HMZ A;  3MOZ A;  4HI2 A;  2OTL S;  3UD3 P;  3IN5 A;  2F4V J;  3L4B C;  5LXY A;  3KLI A;  3H7H B;  4KAI A;  1V9O A;  3EVW A;  4CO2 A;  4DLE A;  3DGP A;  5J1E B;  4DN9 A;  2FHO B;  4FF2 A;  1LQ9 A;  4P72 A;  3JAM Y;  4X4V A;  3BBB A;  1XMQ F;  2GHP A;  3HI9 A;  2GMH A;  3M8Z A;  1FVS A;  2FJA B;  4X4R A;  4DR2 F;  2VFR A;  3PYF A;  3NXZ A;  4TLR A;  1JWW A;  3M05 A;  3FEY B;  3DXB A;  2VA3 A;  2OGU A;  4CT9 A;  4RNN A;  3GLJ A;  4PG4 A;  4JI3 J;  1WUU A;  3KHR A;  1WEZ A;  2BJ7 A;  2H65 B;  2W7O A;  4LSN B;  4K8R A;  4P9S A;  2APO A;  5ITH A;  2NXN A;  1RLD A;  3NRB A;  1WI6 A;  2ALY B;  4URS A;  4PYD A;  3FCH A;  2N7C A;  4B9S A;  3DOK B;  1KDN A;  4DR1 J;  1S72 S;  1U26 A;  4KH0 B;  3OXF A;  1KHW A;  2HIQ A;  2VL1 A;  4TNO A;  3D0H E;  1JLB B;  4OI2 A;  3J81 j;  4A8W A;  3E01 B;  5KT4 A;  1KVJ A;  2ZBQ A;  4DV5 J;  2UUC J;  3HVR A;  5EWG A;  2PGC A;  1RK8 A;  1FDA A;  4ZP8 A;  3I87 A;  3DOL B;  2WB1 D;  5KG0 A;  3SDE B;  2UXD J;  1YBU A;  4Y0F A;  3TUP A;  5IT9 U;  1LWF B;  1LW0 A;  1VQ6 S;  1MRO B;  5AT1 B;  3QZ7 A;  2O01 C;  1XC9 A;  4MIA A;  5AJ3 F;  5HI7 A;  5J1P A;  5F8I A;  2HYI B;  2Z4P A;  4RUH A;  1JJH A;  1HFE L;  3GFZ A;  4U7U K;  1HWL A;  3D28 A;  2QIF A;  4OYB A;  1RTD A;  4N8N A;  5KFK A;  9RUB A;  2ZWO A;  3OR1 B;  4X64 F;  3J80 Y;  1RT2 B;  1Q81 T;  1WC1 A;  5IT4 A;  4DEZ A;  1M1G A;  1JXV A;  2G9O A;  5DQH A;  1AA1 B;  3CCQ S;  3MI7 X;  2R8G A;  4OV6 A;  2RVJ A;  4KHM A;  2GS8 A;  2VH7 A;  4M8L A;  3OSN A;  2DH8 A;  4Q2M A;  4DL4 A;  2XS7 A;  1U02 A;  3DLG B;  3PJW A;  2XNR A;  2RSQ A;  1NDL A;  4G3I A;  4HH0 A;  2HSE B;  1CJU B;  1QUV A;  1PJ7 A;  3IRX A;  2Y0S D;  4Q7A A;  1C4C A;  4DQR A;  3MR7 A;  5LSL A;  4ECY A;  1QY7 A;  2GGP B;  4Q43 A;  1HI8 A;  4ZHR B;  2F63 A;  5KT7 A;  3FZB A;  4GKK F;  2DGS A;  2LXU A;  1WAC A;  5HAN A;  4E98 A;  2KJV A;  2YPZ A;  2UUT A;  3M30 A;  1SIW B;  1VQ8 S;  1PKU A;  3M7V A;  3EMT A;  2WZ1 A;  2QLB B;  3GJQ B;  1DTT A;  1U48 A;  4HAC B;  1X0F A;  5L46 A;  1RCO B;  3G8S A;  4QCL A;  3RB6 A;  1JJ4 A;  4X4O A;  4ZCL A;  4RBV A;  1M1K T;  4PWU A;  3VGT A;  3AOA A;  4HTI A;  2HNY B;  3LAN A;  1NM2 A;  1N32 J;  4F4Y A;  5LXR A;  1APS A;  4C8Y A;  2ZH6 A;  2OFG X;  3ITH A;  5FLX U;  2VHG A;  4OI6 A;  2KYZ A;  4B3O A;  3W9I A;  3AD8 C;  3KNA A;  3MEG B;  4WF9 Q;  1HNI A;  3CMA S;  1RU1 A;  1BGX T;  4HDH A;  3FMW A;  3TJ9 A;  2QFI A;  2H3E B;  3IAS 9;  4IKA A;  3PW7 A;  2C3U A;  2QSF A;  4O3N A;  1Q86 T;  4FYW B;  4WFZ A;  3AY0 A;  4RBT A;  5C42 A;  2F40 A;  1OY8 A;  2JRS A;  1LWE A;  2IBK A;  3M8Q A;  3KK3 A;  1RYR A;  1R0C B;  1XN9 A;  4EBD A;  4WWS A;  3VQT A;  1HW8 A;  2B4U A;  2YKM A;  1S76 D;  2UXB J;  4ILL A;  1HHS A;  3IMQ J;  1ZPW X;  3I5C A;  3M8Y A;  3H5U A;  4RNH A;  1GFW B;  4JI6 J;  1JLA B;  1WHV A;  3CW2 C;  4QWE A;  3J81 U;  1HW9 A;  5GMK a;  1M5S A;  4LFC J;  2BJE A;  4DU8 A;  3QPI A;  2YNF B;  4A46 A;  3ZZR A;  4F2R A;  1V6H A;  3GMG A;  3CSK A;  3LGH A;  1U45 A;  1Q7L B;  2OSQ A;  1X9S A;  2CJA A;  3LP0 A;  1QTN B;  4KC5 A;  1FFW B;  3QLH B;  2MPU A;  1JLC B;  3OFG A;  1VS3 A;  1I94 F;  2HEK A;  3D4J A;  2GV1 A;  1UFW A;  4YEA A;  5G0R B;  2FJX A;  2CKW A;  4ES3 A;  2XMJ A;  4F7V A;  1M5V C;  4LF8 J;  3GE9 A;  5EWE A;  4PPD A;  5K5M A;  2HHH F;  2YX1 A;  1S10 A;  2GJI A;  1OQ3 A;  2BE2 B;  2PII A;  4RX6 A;  4AL7 A;  2GML A;  1WKJ A;  5FDL A;  4R5P B;  4FVC A;  3I82 A;  2RE1 A;  4YHH J;  1KTQ A;  1N56 A;  3NWR A;  4Y28 C;  1X60 A;  1PJ6 A;  2PI5 A;  1FRK A;  1D09 B;  1EQ0 A;  3J7Z T;  1XNQ F;  4EU0 A;  5G4D A;  1Q95 G;  2V5H G;  4B9V A;  1SPB P;  4YR3 A;  3MXH P;  4JYA J;  1Y5I B;  1VQO S;  1TR0 A;  1VIO A;  2CNO B;  3IM8 A;  1Q0N A;  1LWX A;  3ZO7 A;  4N7T A;  5CA5 A;  3VAJ A;  5DM6 Q;  3S8S A;  1CEZ A;  1GMV A;  3GV5 B;  1TMJ A;  1Q8I A;  1DBD A;  4P2S A;  1RT5 A;  4FXV A;  2CNK B;  5F8H A;  2CJ9 A;  4U95 A;  3M1V A;  4K4T A;  5CZX A;  4ATN A;  2EEY A;  1YZ6 A;  4OYA A;  3CDE A;  4QZV B;  1LK7 A;  1A9N B;  1QVF R;  2L9D A;  2XZT B;  1Z1Z A;  1URN A;  4CH1 A;  2ROE A;  2CJY B;  8ATC B;  1F9H A;  4DV6 J;  4O4G B;  2EW9 A;  3W65 A;  2OTJ S;  2JWN A;  2CAD A;  2YNH A;  3D6F B;  4NLG A;  1U0H A;  1L3T A;  4F26 A;  3CJT A;  2CPJ A;  3PO4 A;  2BW7 A;  2K7J A;  1U1R A;  5KFA A;  2XNQ A;  4RW7 B;  2HHQ A;  4WYL A;  4DF4 A;  2WBM A;  1QD1 A;  4FYD A;  2B4O A;  2MQO A;  4ZPV R;  4BWM A;  3JAM U;  4P2X A;  4CLL A;  1Q8K A;  2X7I A;  2L48 A;  4NZ6 A;  3UCG A;  3DM2 A;  3QSY B;  2MQP A;  4ENO A;  4PG6 A;  3GJS B;  3HMJ G;  4U6P A;  2YVS A;  1R31 A;  1RI7 A;  2P5V A;  2AKW B;  2VOP A;  2AJQ A;  4OYM A;  3H59 A;  4NA2 A;  3TAN A;  1W2I A;  4DX6 A;  3LPE A;  3MED A;  2DGX A;  3IBC B;  3HT0 A;  5D15 A;  1NHU A;  4AL5 A;  5HLF A;  2LDY A;  1FRI A;  3M8P A;  3HFK A;  3KLH A;  3DMJ A;  3PDN A;  3PW5 A;  4I0W A;  2VQF J;  2OH2 A;  3MCN A;  1VQ9 S;  1CJT A;  3VCD A;  1RT3 B;  4QJV A;  3T41 A;  3TZZ A;  2H5J B;  1T9X A;  3QGI A;  4NCG A;  2BBE A;  1TU0 B;  2BQU A;  3KFW X;  5RUB A;  4LJM A;  5D4O A;  5L1L A;  1G1X A;  2CZ4 A;  3VZH A;  2DNY A;  4CLP A;  3DOM A;  4C0O C;  5HVH A;  4DV0 F;  4MAK A;  2MXY A;  2VPX B;  3GQC A;  4IG0 A;  2VJV A;  2CYY A;  2HHH J;  3EGN A;  2RQK A;  2M88 A;  2C2D A;  1NRK A;  1EJ7 L;  3SEO A;  1DQ8 A;  4B08 A;  1YJN S;  1RGV A;  3CDB A;  3CIZ A;  3U27 A;  3CF5 Q;  2F9D A;  2CNN B;  4TLQ A;  5SUH A;  3PXG a;  1FTC A;  4HHH A;  4GO7 X;  4PR6 A;  3NBP A;  4K5R A;  4QWD A;  2D9P A;  2A10 A;  3BO2 A;  5F0U A;  3J80 U;  2NXC A;  4ZLN A;  3IG1 A;  3I6P A;  3LP2 B;  4ECZ A;  1KFS A;  3Q24 A;  4JI0 F;  1OY9 A;  2VIH A;  3UNY A;  5DRK A;  1FDD A;  1I5O B;  2V63 A;  2ZIT A;  1F3F A;  1OJ4 A;  3K5O A;  1Y7P A;  1KQF B;  2D3Z A;  3DDK A;  2Z30 B;  1N54 B;  3HD1 A;  3OT9 A;  2KRB A;  3H20 A;  4RL1 A;  4ZVG A;  4LF7 F;  3BYR A;  4JP8 A;  4P7T A;  4KKO A;  2Z2L A;  1WJ9 A;  4YME A;  1F2H A;  1JLG B;  1KP6 A;  2F3J A;  2FHJ D;  1WF1 A;  4ANE A;  3H0P A;  2YWG A;  2FUG 9;  4WFN Q;  1S97 A;  1JLF B;  5GAE I;  1YDL A;  5KFO A;  2R7S A;  3KLF B;  2UUW A;  3DFE A;  2AX1 A;  2WRM A;  5C25 B;  3VVT A;  5I3U B;  1HBO B;  1DTQ A;  5GAG U;  1S5Z A;  4DUZ J;  1YX2 A;  5CHC B;  5T7L B;  4DV7 J;  4ZS6 A;  4RUB A;  1OPZ A;  2DY9 A;  2V0N A;  2CQG A;  2CQD A;  4OYX A;  4KO0 A;  1GMW A;  1XMO F;  3G9C A;  1S9G A;  4YQW A;  4X84 A;  1C0T A;  4NXN F;  5GAH U;  4OZ1 A;  4USM A;  2FTR A;  5KFL A;  4RLE A;  3PR5 B;  3IRW P;  1O0P A;  4Y2M A;  2C2O B;  2U2F A;  4B3S F;  4IDK A;  4ZMM A;  3TRG A;  4TN2 A;  4FXW A;  4DWI A;  1SKU B;  1C4A A;  4Z7C A;  1QLN A;  5HJY A;  1A0O B;  2CWK A;  4RJV A;  1VMB A;  3D1H A;  2F1F A;  4H4M B;  1YSJ A;  2QYC A;  1HNZ J;  2VKR A;  2DNK A;  1KLM B;  4FS2 A;  4N77 A;  2WVD A;  5AXM A;  2MY8 A;  3S6E A;  5JVH Q;  2AD9 A;  1CS4 B;  3UQS A;  1S7H A;  1LW2 A;  1FWK A;  4DR4 F;  4OFZ A;  3R7B B;  5K8O A; 
#chains in the Genus database with same CATH homology
 2QX0 A;  2F65 A;  5ETK A;  3ILJ A;  5ETP A;  3HCX A;  2CG8 A;  5ETS A;  3IP0 A;  3HT0 A;  3QBC A;  1Q0N A;  3HSD A;  1RU1 A;  4M5N A;  5ETQ A;  5ETV A;  3UDE A;  2BMB A;  3HSZ A;  4CRJ A;  3HD2 A;  5ETL A;  1TMM A;  5ETN A;  4M5G A;  5ETO A;  1RAO A;  1F9H A;  3MCN A;  3ILL A;  4M5K A;  4PZV A;  4CWB A;  5ETM A;  3KUH A;  3HD1 A;  1HQ2 A;  4M5J A;  5ETT A;  1RU2 A;  3KUE A;  1CBK A;  4F7V A;  1EX8 A;  3HSJ A;  1EQ0 A;  1TMJ A;  1DY3 A;  3ILI A;  1G4C A;  4M5H A;  3UD5 A;  1RB0 A;  1KBR A;  3MCM A;  4CYU B;  2F63 A;  1EQM A;  3UDV A;  1IM6 A;  1RTZ A;  4AD6 A;  3ILO A;  4CYU A;  1HKA A;  3KUG A;  3MCO A;  3HSG A;  4M5M A;  4M5L A;  4M5I A;  5ETR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...