5ETQA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.96 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
156
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEELHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 43
structure length 156
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etqA00
3MCNA 3QBCA 5ETLA 3MCMA 5ETVA 3HSJA 1F9HA 1RU1A 5ETNA 4M5MA 1IM6A 3UDVA 5ETOA 1RAOA 2F63A 3ILOA 1DY3A 4M5JA 2QX0A 4M5HA 2F65A 3ILJA 3ILIA 3KUGA 3IP0A 5ETQA 1RU2A 3KUEA 5ETKA 5ETRA 3UDEA 4CYUA 4CYUB 4M5KA 1G4CA 1EX8A 1KBRA 3HD2A 3HSGA 1CBKA 4M5IA 1TMMA 3HD1A 3MCOA 3UD5A 4M5LA 1RB0A 4PZVA 4M5GA 3HT0A 1TMJA 3HSZA 5ETTA 1EQ0A 4CWBA 5ETMA 4AD6A 5ETSA 3ILLA 3KUHA 1RTZA 1HKAA 3HCXA 1EQMA 2CG8A 1HQ2A 1Q0NA 5ETPA 4F7VA 4M5NA 2BMBA 3HSDA 4CRJA
chains in the Genus database with same CATH superfamily
2IM0A 5E3QA 3CE8A 3H59A 3DU5A 3KDNA 4ZIVA 2PEHA 4H4KC 3PIOQ 2DHHA 3G8SA 1IBMF 5M2PA 2FLNA 1RDRA 4LF7F 3PTWA 5JMNA 2CVEA 2HNDA 5J2PA 3KK1A 4ETZA 1RKIA 2CQ3A 3JS9A 5HVGA 3NKYA 3D9BA 1ZA2B 2DD8S 4HHJA 2PSZA 5I4MA 5FDLB 5A2QU 1Q53A 4ZPDA 2LECA 4EMDA 4GKJJ 1X4GA 3TAMA 3Q8VA 2AHOB 4EYHB 4BHQA 1U45A 1HNZF 3P8BB 5DG7A 4PQUA 2NLWA 3I0SB 3KFWX 5K8NA 5LSLA 1NHUA 4PG4A 3KLGA 1YBUA 4DL6A 1R0CB 1RAGB 4AD6A 1FVQA 4EBDA 3IBCB 4DV5F 1X4AA 5G4DA 2MQQA 1FJGJ 2CZVC 3H5SA 3IXQA 2AW0A 1TELA 3TUJC 2VG6B 2VFUA 1RTHA 4DF8A 4C98A 4JI6J 2Z2LA 1N0VC 2H5JB 2W24A 3I0RA 4V19J 8RUCA 1S0OA 1X4BA 5AXNA 3G6XA 1HHTP 4NWBA 4J9UE 3H42A 4MK8A 1X4HA 5EWFA 4UZBA 3RW7A 2IBKA 2QL5B 2RQCA 4I4BA 2F40A 4RNHA 2CUYA 3LQVA 4CLTA 4LBHA 1F60B 3T5KA 2BJ8A 4FVCA 4PZVA 4X4PA 5IQQA 3RRGA 1WEYA 1UWAA 3IWLA 1ULRA 3DLLQ 1MMNA 2ZE2A 2DPJA 4HVZA 3HJFA 2YKAA 2W4DA 3BJYA 3WHIA 1SKUB 1KR4A 2LQ9A 3C14A 2GVZA 4X2BA 2AYBA 1EQMA 1ZM2A 2MQOA 4Y3CA 2XLKA 2K3IA 1WF1A 2PMWA 2ROPA 3QIPB 4QOTA 5C24A 1B7FA 3BS9A 2FHJA 2WONA 5IV3A 3M9MB 4DPUA 1DZ5A 1TKTA 3D1HA 2DNQA 2HVEA 2W25A 2UXBF 4JI6F 1Q8BA 1R3NA 3HVTB 4NYZA 4OJ3A 4WKYA 2HYIB 1FXDA 4PXEA 4ANCA 3ILJA 4EO6A 1P27B 3IP0A 1QUPA 2GV1A 4OLOA 5KG0A 4RR5A 4DX8H 4DZ6A 5KG7A 1PAEX 3D28A 1GTHA 2C2ZB 3OFHA 5KFGA 4GC6A 2XM3A 2GVDA 2KH9A 3UFCX 4USHA 3QT6A 1TL7B 2F5GA 2RILA 3FZ2A 4QR0A 4OHXA 1NDCA 4RL1A 3LP2B 1HQEB 2XMKA 3ZFVA 5C25A 1SI9A 3M7VA 1SL0A 3H8YA 3HVRA 4R5PA 1J5OA 5D0EA 1HNXJ 1HPZA 2LXIA 1C1BA 3KG4A 1L3TA 4ZVSB 4RJVA 4XTTA 4H4KA 3W2WA 1S1XB 3IO1A 3KTQA 2HFNA 3MAAA 1UW9A 3JSYA 4P52A 1ZH5A 1RABB 3KUEA 1RHRB 2ROGA 3KG1A 3FCHA 3IN5A 1QAYA 1TL3A 2E66A 1HR0F 4TQSA 3D0IE 1LW2A 2AJ0A 2FDNA 2CQPA 5IS2A 3JYTB 3GV7B 2XSFA 5BR8J 2M8HA 3TA1A 1JLAB 2NUHA 3PHTA 4ZJOA 4A8QA 1RBLA 1EHWA 1OQ6A 1M1KT 3QGIA 3CJ2A 3M6WA 1EP4A 3MEDA 2RHSB 1LW0B 1QM9A 1VISA 3OTDA 4J9LA 3CVKA 3M8QB 3R5JB 2A6OA 4ZDNA 2L3MA 2O01C 4F7VA 1Z2ZA 1MWQA 4ID5B 1M5VC 4C8YA 2IIHA 1RCXB 3HSDA 1CEZA 2Z2MA 1FRJA 4OZ2A 4E98A 2QLWA 4M5MA 3TAQA 3BM7A 4X4OA 1T02A 3POTA 2ZEJA 5CA5A 2AF6A 1UVIA 5LMNJ 5KFHA 1EX8A 1HWIA 3HD2A 3NWRA 3W60A 8AT1B 5LXYA 4ZHRA 3GU0A 4IH6A 1VQ8S 2XEXA 2NYHA 2E9RX 4JV5F 4F0MA 1RAJA 4DPOA 1YBTA 1O5JA 1N5SA 4ZVOB 4DCJB 3HT0A 4FS2A 3UCUP 1K9MT 1CVJA 3QSIA 5D77A 5KFWA 4LQ9A 2AYGA 2BX6A 2MMYA 3MF5A 2XULA 2J5AA 3OFFA 2NPFA 4A8MP 1U6BA 2JLEA 3HXMA 2XYGB 1N33J 1BQMA 2CJYB 1Q8KA 2V50A 1S97A 3WZ0A 3N5FA 1RAAB 1VFJA 2C3UA 4URSA 1JKHA 1TV6A 1LW0A 2RUGA 3UCGA 4OI0A 2Y8YA 1K1SA 1RHQB 2FUG9 4IOBA 5F9LA 3TEGA 3VAGA 2CA9A 3O5TB 1TK5A 1M5KC 4EZ6A 2E5JA 2HVZA 4TNOA 5MLCV 4QPTA 3RR8A 3HF5A 1XBWA 2EFOA 2OD4A 1RYRA 2MLYA 1Y5IB 3I6PA 4IO1A 2XCPA 1MN9A 2GZOA 3MOZA 4KV8A 2W2PP 2E7WA 2PIIA 2Z56B 3G4SS 1AUDA 4Y2CA 4FP9A 2M0GB 1YJTA 2QZ8A 4PYDA 1RWNB 4ED6A 4OI4A 5I3UB 2KU7A 2L08A 2ZOGA 3PG9A 3RYLA 3ZZRA 3OV7A 1HPZB 4ECSA 1OY9A 1D9AA 2KTQA 3T5JA 3ZTOA 4B3SJ 2H4WB 1HNVA 4WE1A 1NRKA 1M5HA 4KTQA 2M52A 4QBUA 4L3KA 1AFJA 1Y3KA 3EYZA 1OMSA 3PJWA 4LFBF 2FVPA 1K1QA 4TLRA 3Q2TC 4EUVA 2VZ9A 2GO8A 2E5HA 2LU2A 4RUCA 1WI8A 4ZLNA 1SQFA 2V2VA 3QPIA 3OXFA 1Q86T 2V8VA 3MM5B 2I5JB 2HS4A 4F26A 2C2EA 1N32F 1LXNA 4UOFA 3TA0A 3UR3C 1CJTB 4Q0BA 1O6XA 1RSCA 3AY0A 5LJ5Y 6AT1B 1NKBA 2KXFA 4DXLA 3C3LA 1G1XA 4DQQA 2GMJA 4B02A 3RUBL 2ZDPA 1TKTB 4G1QA 2W9BB 3D3BJ 2CQ2A 2AD9A 2Y9HA 4WYLA 4DF4A 2QEXS 1N36F 5MAOA 1FRKA 2HNYB 1S6PA 4O0NA 2UVUA 2KFNA 3AJ2A 1VQMS 3IS9A 4RX6A 1XR6A 2B9WA 4B3SF 1F5BA 1XTZA 2VKZG 3AA9A 3DC2A 2NXEA 4JP8A 1FDBA 1R7IA 4NRUA 2ZE2B 4RUHA 1DTTB 3L95X 2W2OP 1U1PA 1U09A 3M8QA 3BO4A 4JI2J 1RU1A 3GG1A 5AJ3F 4DSKA 4DR3F 3DRPA 1S9FA 4F0HA 1QTMA 4B3TJ 4UY85 3ILOA 3TUZC 5A76A 2JDJA 2QX0A 2W4CA 1GEHA 2MB0B 1WKLA 2N4DA 3GSDA 4P7VA 1V3SA 1C0TA 1PYTA 2NSBA 3UDEA 3K5LA 5D4NA 4KBIA 2VBYA 1T05A 2VG5B 1PBAA 2DNYA 1YZ7A 5HLFB 4QIFA 2X1BA 1DHMA 3AA8A 3Q8YA 1UVNA 2WVCA 2CPJA 2OO4A 3RRKA 3I0RB 5E0OA 3FBFA 1M5SA 4AFFA 2MHEA 2CPDA 1WG4A 2YKNA 1S4FA 3EWGA 2OP5A 1N4LA 1I6JA 2QMWA 1QVFR 4J7CA 4R5PB 4FYDA 1VLOA 3W2VA 4FPRA 1NO8A 5LSRA 2V4RA 4DFKA 2DR5A 3KUHA 4LR9A 5CD4A 3HFZB 4HACA 2XY6A 5I42A 4ERDA 1FJGF 1T9XA 1SL2A 4OIXA 5ETLA 3SBMA 1RUSA 4C0BA 3KLVA 2OGUA 2RUSA 3GWCA 4ECYA 1FI4A 4DUYF 2AEFA 1UCNA 5D0RA 2R9LA 1S6UA 2UVVA 3TAMB 1UVJA 3WX4A 4DEZA 1HQEA 2VA3A 2XS2A 3FDSA 2RB7A 3MM9A 2XB2D 4ZJLA 2IYIA 4CYUA 3BO3A 1K47A 2V8DA 4G65A 1KKHA 2YWGA 2ZVSA 5HQLA 3VVTA 3P45B 2HG4A 2KI2A 2YKPA 5EX0A 1SC1B 4HHUA 3CXCR 2NR0A 3M32A 2PDAA 1UVKA 1BQNB 5FLXY 4BLGA 4QIVA 2XI2A 2MLXA 1L3VA 1VQLS 2C2OB 1MW7A 5F3ZA 2PA3A 4ZIWA 1R0BG 3OLBA 3HCXA 1VRQC 3QIPA 4DSLA 2OEKA 3CJTA 5KFYA 2FJVA 2JEFA 1HARA 3CUNA 5HROA 2GVZB 4ZLJA 2DR8A 3W64A 3P49B 3W1YC 4FPIA 4ZLPA 4JI1J 4G1PA 4LF5F 3QT5A 3PX4A 1RWKB 1JLAA 2CQHA 2RH3A 3D54A 3GYXB 3HVWA 4ZVFA 4Y00A 1KTVA 4ED1A 5ETRA 2HFZA 2PFDA 2N4CA 2IVMA 3LGHA 5F0UA 1UEUA 1NK7A 1AROP 2OELA 3PYDA 3CJ5A 3ENVA 1T94A 3QATA 3MCOA 1UZDA 5HMWA 3Q22A 4H4MA 3KK2B 1RLCL 2RE1A 4IFVA 4JI0F 2X3GA 1TAQA 3DDNA 4M95A 2CIMA 2VU5A 2YWKA 3DGPB 4K4UA 4LVOP 4P72A 4KGMA 1YI2S 1RAEB 4P73A 2EG1A 1VQKS 3T19A 2VV5A 4MJKA 1LWEB 5HAOA 4C8LA 2CDQA 3VGVA 3CDEA 1YTYA 3GB0A 1DQ9A 5D8HB 1Y7PA 3CGIA 2D3OR 5D3GA 2IM3A 4WIQA 1KD1T 2RMLA 3DRSA 1FCAA 1RAHB 2RS2A 1PJ5A 2VG7A 4GRSA 4RUBA 5U47A 2W4PA 1JIHA 1R8AA 2F7VA 4P6QA 4QU6A 1I3OB 1O8BA 4PUOB 1TMMA 3KMSA 2DNPA 5IZHA 5DLGA 2ZDOA 2EFPA 1CQNA 2LA4A 2QLBB 1TKZA 2HHWA 3L3CA 2CZ9A 2AGOA 4KHPJ 1UWBB 2HRYA 1U47A 3EXCX 3QO9B 3MURP 4MT1A 1FEEA 1W26A 4KO0A 4AXIA 2YX1A 3MTKA 2G13A 1RWMB 3QNWB 5T14A 4URQU 5J2QA 1KSPA 2UUBJ 1DAXA 2CG8A 5K9FA 4IRCA 2ZH8A 1JB0C 1VRUA 3FC9A 5F8HA 3PW0A 4B3TF 2OTJS 5CH7B 1K8AT 2DEIA 2NXNA 1CC7A 4H4MB 4C8MA 4CLFA 3KK2A 1B7YB 1DURA 3QT8A 4F67A 1NJYA 2AP6A 2H3EB 3CO9A 2XGQA 4EZ9A 1HQUA 3GR0A 4I6YA 4PWUA 3OHBA 4DSJA 5EN1A 3PYFA 2VBWA 3K58A 4DV7J 3NGTA 4ZN1A 4B9LA 3U1MA 4GO5X 4KHPF 5AE2A 3EGZA 4LJMA 4OV1A 4I7FA 3FEZA 4USJC 1P8GA 1IJFB 1FRMA 4YS2A 2KXNB 4DR5F 4LF4F 4DR7J 1P6TA 3R6GB 4ITSA 4P10A 2CQ1A 1NDLA 4P75A 4RKUC 4RW6A 3W66A 2CJXB 3MXHP 4JI2F 3RAMA 2W2MP 4KB7A 1HD0A 3T1HF 2B5JB 2K06A 2ZHBA 4BC9A 2HLUA 4C48A 3KLGB 3D6TB 4ILRA 1MROA 3DOLB 3KWMA 3OQ2A 3SDEA 2HQDA 4TY8B 9ATCB 1SJ4P 1R8HA 4NOHA 4NA1A 4ANDA 2JJ4D 2QG9B 2I6WA 4DU7A 5KFOA 1B99A 1OWXA 1WACA 3RAXA 2CPEA 2LKZA 3W7BA 4CYUB 1G4CA 1S7IA 3DOMA 2ERRA 4UUXA 2IRUA 2YWWA 2CJBA 4HH0A 5HBMB 5IC4B 1B70B 2EXUA 3RBZA 4JI0J 2G0JA 1OJ4A 3OTOJ 1RK8A 5DQGA 4XPEA 3GILA 3EPIA 2I38A 3C2PA 2XS5A 2IC3A 2V8GA 3K89A 3NY0A 2L9NA 3MPUB 3NBPB 3R6LB 2FGCA 3M4XA 1WC3A 2ZD1B 3DDIA 3QGPA 2ZKUA 3PDNA 1U0HA 4KRWA 4JI1F 3PACA 4DOZA 3CB4A 1U02A 3CWJA 2JC0A 4L3NA 3RAQA 2N3LA 4LF8F 1PYSB 1QSSA 1VHFA 1WJ9A 2HRTA 2YQ0A 2DNHA 2WVEA 2F65A 3MZIA 4ZPWR 4JI8F 3J7YI 1HWUA 4OFZA 2ZJPQ 2KM8B 2B6AB 5LJ3Y 2DGUA 3VAKA 3NAIA 3RB3A 3KJQB 2EVZA 5D0GA 2J8AA 4YOEA 3DHXA 5FIIA 2P2CB 2RDJA 3R5CA 3FSIA 1RT1A 3CC4S 1IN0A 4EWTA 3CCUS 4QJVA 2BRKA 1LFWA 2MLZA 3EICA 7FD1A 2UUCJ 1LK7A 2OPQA 1FERA 1HHSA 5IT4A 3GG0A 4NZ6A 2CJKA 2RIJA 2L9WA 4B3OA 2BA9A 3L09A 3MUTP 3MFHA 2ZH1A 4U9RA 2G2OA 1S6QA 2CQ4A 4XIUA 2MKIA 5DLFA 2ZJRQ 1U1OA 2FPHX 3IR6B 3VQTA 2C3OA 5LSOA 2NYIA 1HNXF 1F6TA 1WSVA 2G1HA 2CQIA 3FQLA 5J1PA 2OPQB 3GFZA 4NZ0A 4DUZJ 2O5DA 2P5VA 3AD8C 5CYQB 5BR8F 4O3RA 3LPEA 4CP5A 3BKFA 3B4DA 4ED3A 4IOCQ 3N6NA 2F8HA 3DXSX 2DNNA 5ETKA 4K2XA 1SH2A 2H54B 2MZRA 3U02A 2PA8D 1RA7A 3VGSA 2POKA 2DY9A 4M5DB 3V6JA 5J2NA 4V19X 2IDLA 3SCJE 1HWKA 4OJHA 2BJ1A 1DBDA 3AOBA 4NEZA 3J7Z5 4DS4A 4OZ5A 4O3NA 1RT3B 2A6MA 1T7PA 3DN9A 4U7UK 2R8GA 5HSPA 2BJDA 5E33A 1VRTA 3QJPA 1FK9A 1GNKA 1RTZA 4NLXA 5D4PA 4HYKA 3V6HA 1KFSA 4KKOB 3PRVA 2BACA 5L8RC 5DM6Q 5IV4A 3MCNA 2A0FB 2CVIA 3R5BA 4HT5A 1XMQF 1S7HA 3FEYB 2JX2A 1RAOA 2IC3B 1F5CA 4U67Q 1SKSA 4B9VA 2FY1A 2R7RA 2C3PA 3NCRA 4URGA 3MEKA 1B0TA 3L7OA 1RU2A 2YBVA 5DDQC 3GSIA 5G0RA 1JLGB 5L9NA 1G7CB 2QA2A 3DRPB 2YXLA 1OIAA 1X5SA 4LR8A 2C22A 1RWUA 2IAJB 1A0OB 1GXUA 4WFXA 2M2BA 2HS3A 2MKKA 3QLHA 2YNHB 3R5AA 5AE3A 2D69A 5F8IA 5DGBA 3LP1B 4R25A 2IY5B 3H5YA 2FJEB 2QGFB 1S59A 3KG0A 3GONA 1R8CA 3M8WA 4KH0B 1FFSB 1T03B 4RW7A 3QFHA 1XNRF 1URRA 1BMQB 3MMCB 4EFAC 3LH2S 1KQSR 1CLFA 4ZVGA 1GXTA 5KFVA 4WCEQ 3Q8QB 3E2EA 5GMKa 3IC1A 3N28A 3NRBA 4MK9A 3BDEA 4X65F 1SQGA 1NK0A 2XWXA 2DRAA 1IM6A 2GFFA 2OMOA 3TAPA 4LSNA 4NYOA 3KJFB 2FJAB 1RQ0A 5IM0B 1U7LA 3OL8A 3V6DB 1YG0A 2HGLA 4CLKA 1TZ0A 2M9KA 1HWJA 5CCLA 2WW4A 2A2CA 3KK3B 4A8SA 1U48A 3EGVA 2XMTA 3I87A 3UE2A 3TO8A 3A8KA 2HW3A 3KLIA 1HNIB 4MKVA 1WHWA 2HBQB 3IM9A 1Y11A 2B51A 3D6FB 4X62F 2XI3A 1MLAA 1TUWA 2DGOA 4IQXA 4DR5J 4DR7F 2IYGA 2MKCA 3TEHB 1HKAA 4OYAA 4BDPA 1RAIB 4X4VA 2DO4A 1KWMA 3UCZP 2EFGA 2VONA 3CJKB 2CNLB 1N34F 4LF9F 2H4YB 4G6VB 4O4RA 3QO9A 3HHNB 1IBKF 2I9SA 1HL6A 3NAHA 3FK4A 2BQRA 2DR9A 4F8RA 2XCAA 3HHLD 4O0IA 1IQZA 2YNFB 3DKDA 2R7WA 4WKRA 1S9EB 1IBLF 4MKYA 2H5IB 3K7RA 1FRIA 2ZHOA 4RW4A 4ZPBA 5D6GA 4WFZA 1YRXA 1F9EB 2P9CA 4NCGA 1MU2B 2IM2A 3MPWA 4K4VA 3TARA 3MPDA 4JV2A 3DRSB 1HIYA 4AYBD 1WTFA 3TRGA 1B0PA 3MPVA 1VIXA 3R27A 3DMJA 5C25B 1CJVB 2NSCA 4U96A 4A8KA 3NCQA 4I2QB 4KGVB 5KG2A 2DHAA 3E01B 2GHWA 1IBCB 1WI6A 2Y0BB 3LW5C 2J0XA 3A3NB 5ETNA 1H2VZ 3DGPA 5A6WA 4UQGA 5LMUJ 1S10A 1EIYB 1FRHA 2H48B 1UFLA 4FBUA 1BC6A 1NXIA 4YB1P 1HW8A 3QSYB 1DTQA 3L9ZA 1GX5A 3LWMA 1XR7A 4GKJF 2GS8A 1KVKA 3HVTA 2HVHA 1CS4A 5KFIA 1A7GE 1YJVA 3M30A 2CQBA 4F4ZA 1RWWB 3IWNC 2XNQA 2DRBA 1T8EA 1HBUB 2GGPA 4RUAA 2Z2ZA 2XSJA 4CH0S 1KLMB 3CDWA 4YY3F 2YNGB 1E6YA 3A4TA 1RHJB 4P7TA 2OMLA 3V2UC 3VVUA 4MMOA 2ZM6F 4CO1A 4A8FA 1U1LA 2HHHF 2OSRA 2ASLA 1EZZB 1NU4A 3FVYA 3Q8SB 2Q66A 2FZCB 5C7PA 2G9OA 4OLPA 2J6UA 4RNOA 4DL3A 3PX6A 4DUYJ 4ELUA 3LANA 3BH6B 1NJXA 2EFVA 2DISA 2C2MB 1QUVA 3LF0A 1U25A 4R0JA 1F1BB 1REVA 4DPTA 1N48A 8ATCB 3SQOP 5IM0A 2QC3A 2CPYA 3BREA 3MECA 3JQJA 5FD1A 3T1AA 3KHGA 4E0DA 4K4ZA 4OJGA 2BBEA 2GJIA 4PG8A 4QR1A 3T6BA 4NXMF 1FFGB 1SPBP 1ZM4A 4ZPVR 3G6VA 2FJWA 3VTIA 3ZTRA 4OYXA 1S1WB 2WVDA 4C6AA 3I56S 1T9VA 3KHHA 1H98A 2ZVIA 5KFRA 1UP1A 3DRXA 1A6LA 1TTHB 1D9FA 4WPAA 5K14A 4C4WA 4CO0A 2VJVA 2AJQA 2EPIA 4OMFG 1AT1B 1NB2A 4NLOA 2DNGA 1FE4A 4ZCMA 3T6JA 3C66A 5F41A 3OR1B 5HK4A 3UWTA 3NLCA 1KRPA 1XQIA 3R2DJ 2J7WA 3CTRA 3KK1B 1UTAA 3NGUA 2AJFE 3MFIA 2BOAA 4KGZB 3IAS9 1SIWB 4KIAA 4RZRA 1N36J 2I1RA 2ZFHA 4U7CA 4DG1B 4QR2A 1VIOA 3I5BA 3M2VB 5CYJA 3BSOA 2MXYA 2J9DA 4QZVB 1ZM9A 4ZA1A 1RTJA 2DHGA 2GQCA 2OKQA 5L38A 4DV3J 1B3TA 4F3OA 4B9SA 3H2UB 4X64J 1XNQF 3V4IB 1GQEA 2V2KA 1IWGA 3DLGA 2FGOA 4OHVA 2O67A 2DHSA 5KFMA 4DL7A 2R7SA 4C11B 3CJRA 4O3QA 1S9GB 5J1EA 1RT3A 1AUSL 2XSJB 3MEEA 3K5MA 4B9MA 2HNYA 3IR5B 3RGIA 3UDCA 1NSKL 2J8SA 4DPYA 1SKWA 2HNZA 4KAIA 2EBEA 2DNZA 1NZ8A 2AJ1A 3TZWA 3VGUA 4CT9A 2Y1JA 2M4MA 2XWYA 1HBMB 3NGDA 2MYFA 1FO1A 2MQMA 4UZCA 4JI7J 3LUYA 3MGJA 5SZTA 4JI3F 2VG6A 1KQFB 4ICLB 2MGZB 3IAM9 2HIQA 2WAQD 4R8UA 2M70A 1YHQS 4HDGA 3R7NB 2X1GA 3SXLA 4P2XA 4HT7A 5D15A 5LXRA 2W7PA 3N6LA 5GAGI 3VV2B 2YTCA 4DUTA 4PABA 4J9SA 2YNIB 3I82A 3T1YJ 2AYEA 1SCJB 2NS1B 4MFBA 3JSMB 2B8QA 2WB4A 4YP3A 4J5OA 3ET6A 3ZZ0A 2HQCA 4ECUA 1HI8A 4Y2MA 3R2CJ 2ADCA 3DM2A 2DH8A 2XZDB 3I9ZA 3D4JA 3OVBA 6FDRA 1N54B 4USMA 5H1SV 5J2PB 7AT1B 1EKRA 2JOQA 3TZYA 2GQQA 3SFUA 3TZXA 3KHRA 5GADI 4RW4B 1RWVB 3HSGA 3O6QA 4NI2A 2MKJA 3WBZA 2WSCC 1JJ4A 1Y5NB 3AB2B 4NYPA 2NXUA 5JVHQ 1I94J 4OYPA 1VK8A 2E1MC 3FFIB 5C2GA 3UQSA 2HBYB 4YR0A 1V6HA 1KHWA 2OPSB 4UOGA 4X4SA 2RRAA 1NKCA 3OFEA 1JLQB 3CC7S 3PRDA 2PFFB 3AJDA 1RBOB 2B7CB 5A0YA 5EDWA 1TV6B 3OW2R 4K50A 1NHVA 5F3TA 2N82B 5KFNA 4DV6J 4QWCA 4DLGA 4DQPA 1AZSA 2EWHA 1HYSA 4GVBB 4CO3A 2W7OA 4F2SA 4Y2AA 3FEXB 2PGCA 3MMAA 2BR0A 1NDKA 2YKQA 5J2NB 4DFMA 1SB6A 4WIIA 1IKXA 2D3ZA 3DNCA 1N52B 3Q23A 2M7SA 4MH8A 1UVMA 4DL4A 1FESA 3I4HX 2D3O1 1HNZJ 4KFBA 3TX0A 4RBVA 4P71A 2CKWA 2VPYB 1UA0A 3NNAA 3P96A 2HVIA 3E3XA 1BQXA 5DQIA 1PG5B 3AODA 3A3OB 4ZPTR 4X4TA 1VBKA 2A10A 2RSQA 3Q86A 1VQNS 5A8WA 2YY3A 3F41A 4X84A 6FD1A 2ZHAA 4J9MA 4OHYA 3G8TA 4WFYA 1H3DA 1KP6A 2ACYA 3FSXA 4B3RJ 1R31A 4UUWA 1X4DA 5K8OA 4B3RF 3KJVA 4J9KA 2W8KA 1FD8A 1XIQA 1RCOB 5GAEI 3QFWA 1RWOB 2VC0A 2MJNA 2R4FA 3LA0A 1WEXA 2RF2A 5KG1A 2LEBA 1ROFA 4DU8A 1HFEL 4K59A 3JYTA 4ECZA 3KMQA 1IKXB 1HQUB 3DCAA 1SL1A 2HURA 3EZUA 3FQKA 3RJMB 1Z2LA 2BE7D 4USUA 1N5TA 4GKKF 3BSAA 1FWLA 4N47A 5DRKA 5F9NA 2IJFA 1SJ3P 3SCKE 1D0EA 2MZSA 3WX8A 4DMZA 2C42A 3V4IA 5J1NA 5A6PA 2E1RA 4AQYF 5L1JA 4IRDA 5M2UA 1RT4A 1L3UA 1PC5A 2LFVA 4WXOA 5ETPA 4KKOA 4USVA 4ZCLA 2BMBA 4C3KA 3OVAA 2X1AA 3CDBA 1R6YA 2F9JA 5C42B 1S79A 3S8SA 4DV1J 3I4PA 4WU3A 4DS5A 3US5A 2E1PA 4OYZA 5ETOA 4ED8A 2ADBA 1T11A 3GYGA 1X4CA 3THTA 3V5RA 4M5HA 4WP8A 1X60A 5THWA 1C2PA 4ILMA 5LM7E 2WTFA 1NSPA 2GVDB 2J0WA 1ACMB 2B7BB 1BE4A 3MMJA 1RTIA 4OX7A 1KHVA 4TKTA 4FBTA 2MZTA 2X51A 1OO0B 4OX8A 2U2FA 2ZWOA 4L73A 3PJXA 4ZVRB 5KAKA 1HMVA 4RNMA 2NZCA 1NAQA 4DQRA 1OYDA 4HH1A 3B6BA 2QA1A 4U8YA 3VAFA 4CDIA 5D3GB 4LF4J 2BZ2A 1FJCA 3RBDA 1IJEB 3RBXA 5HMXA 3J80U 4AL6A 3OSPA 2QIFA 1NJIT 3F73A 3D5MA 3MUVP 1TUVA 2IHR1 1S1VA 1S6QB 3M2RB 4FXVA 2MSSA 3ZZUA 4IG0B 1Q95G 1RHKB 5KT6A 3M8SA 2G4BA 1NEEA 4R8UB 5H9FJ 1J5EJ 1REVB 4USTA 4UF4A 3GZ7A 4ZCKA 3KLFB 4B9UA 2RQKA 3W65A 3VZHA 1PAUB 1FTRA 1RT1B 4LIRA 4DL2A 5L46A 3TZZA 1HHQA 1LNQA 1RLDA 3D7SB 4PPDA 3HDSA 3ZTSA 3MMAB 2XY5A 1IM4A 4OI2A 4LRCA 3BN4A 1RB0A 2KRBA 2WBMA 1FJ7A 1KOOA 3HJVA 2XMUA 1IKWA 1S9GA 4FKXA 3FZBA 4CTAB 2E1AA 5K8MA 1Q8IA 3CMQA 5A8KA 5F8GA 1IKVB 3ZC4A 3ILLA 3D0HE 5AXMA 1RHUB 1PBUA 1TKXA 1U0HB 2MZQA 1IWAA 3FNNA 4J9QA 1ZAVA 5KT2A 2CJ9A 3UVJA 2UXDF 2CQDA 4ENOA 1C0UB 3UDLA 4JI5F 1ZZNA 3FKBA 2RNEA 4LRAA 1JLFA 1KEKA 1IBMJ 1K44A 1MWYA 4NI2B 1W25A 2RKIB 4P9SA 4RPFA 1JWWA 5B08A 3MUMP 3EE3A 3FGVA 3OTCA 5HBMA 4LFAJ 1TK8A 4FYVB 1LWFB 2GJ2A 4NMXA 4M63A 1NPPA 4LBPA 1GH8A 4EI2A 3M6XA 3MM9B 4K2JA 3SQGA 3UO0A 5KFPA 1ITPA 2PC6A 4CI0B 1RTDB 1MMDA 3ET6B 1TMJA 2ZH7A 3VAIA 4F4YA 4YEAA 1OPZA 2RJZA 2UVRA 4RBTA 2DGWA 1TKDA 2P9EA 2XMMA 2DGQA 4TY8A 3J7A1 1W2BR 1SC4B 1H72C 2JL9A 3PR5B 3QRRA 4HACB 4NLQA 3CT9A 2MY8A 3EVOA 4NCGB 5KOXA 3Q83A 1UPPA 4RW9B 4F0KA 4Q2MA 2B8PA 2LXUA 3FCWA 1NK4A 3CD6S 2JH3A 1WHYA 2QLJB 4NLUA 3TVKA 3CIMA 4DR2F 1SJ1A 4USWA 2R42A 2HWTA 3DYAB 3NCPA 4ZS6A 4F36A 3HVAA 1YWXA 2J0SD 4M94A 2EK6A 2CQGA 2MQLA 2LXFA 4IH5A 2U1AA 1X4FA 4TXSA 2OIHA 3AFGA 3BGRA 2QSWA 4XO0A 3CJKA 4X66F 2V94A 1NZAA 1JJCB 4GO7X 2ALZA 2KFZA 2DHXA 3BPSP 3MR5A 2B56A 1VK3A 4JB8B 3THVA 2C2RA 1NK9A 4J9VA 3VWSA 2VICA 4C8OA 1WDDA 5DDOC 3NWGA 4CWBA 2R7XA 3CC2S 2QA4G 1RYSA 2R7VA 2VL1A 2WK4A 2D3UA 2R7QA 1E6YB 5GVQA 2GX8A 2FTRA 2J9EA 3Q2SC 1SQEA 3O2IA 3DLBA 3I5AA 1JLBB 5KG3A 4K4TA 2MHNA 3KK3A 1Q8LA 2F63A 5CQGA 4QYRA 2PN6A 4OYBA 4CCHA 5DM7Q 2C3MA 2KVIA 3ETOA 4Y2IA 1Y10A 3W8GA 1I5OB 1KBRA 2RRBA 3OR1A 2EI5A 2I5JA 4ELVA 2DGXA 2CRLA 2C28A 2PI4A 4QWBA 4PRFA 3JAMY 1U8SA 2Y8WA 4X66J 1VR6A 1FD2A 2YWFA 2EKYA 4KY3A 1VCTA 4RLEA 3DRRA 2ZKTA 3MMCA 1Q7YT 4J90A 5I42B 1WWHA 2XZWA 1GMVA 4NXNJ 3BZQA 2CPXA 3M8PB 4OZNA 2DK2A 2ZM6J 2AQ4A 4WZQA 3GJQB 4N7TA 1CPZA 3BPDA 3ZTQA 2HHUA 3BGUA 4DV0J 2BUNA 2X3DA 3EDQB 4ZPCA 1QSYA 1MMLA 3TJAA 4Q44A 2FZGB 1UJ4A 1WG1A 2W01A 4CO5A 2JEGA 2E9TA 1UA1A 1TK0A 2D1CA 1S49A 1FDAA 3TW0A 4KT0C 3ENAA 3HHEA 4J9RA 4WTYA 2HAFA 5AE1A 5KFTA 2XO6A 1HD1A 2IA0A 1QAIA 2MQPA 2HQGA 4QW9A 4QU7A 1XMBA 2E5GA 1N0UA 1Y00A 3CCRS 5CYMA 3QWUA 1IKVA 2F4FA 3PFEA 4I2PA 1P1LA 2BKNA 2YNGA 4I6WA 5A8KB 4QWEA 3PW7A 2FLLA 3R3TA 2UUBF 1U1KA 5DDRC 1NH7A 4ANEA 1N34J 3LP0A 4O44B 1SXLA 3WDOA 4A4JA 3GV8B 1IKYA 2IVYA 4L6V3 3SEOA 1HI1A 4DV4F 1KVIA 1FWPA 1ZOTA 4GMKA 3H4BA 2YKOA 2HZAA 4OX6A 1RACB 3PIPQ 2KFYA 1D09B 1YJ9S 2BANA 1FXRA 4LT6A 1GT8A 3SSQA 3F56A 1LOUA 3A13A 3DFEA 1ZPVA 3DLJA 1QDUB 2DT9A 3OTEA 4NLSA 1FF2A 3KLFA 2HFSA 1KS2A 3EVWA 3GMGA 2KN4A 1FX2A 1BUXA 1S1TB 1E6VB 3ONQA 1NLKL 2E7VA 1S0MA 4N56A 3T5LA 2ATCB 1WDTA 3E01A 5KFCA 1X0FA 2HLTA 3BYPA 1HLWA 2ZBPA 5L9XA 4KGKA 2HK3A 1XMOF 2NQPA 5ETMA 2VD3A 2R8HA 2X7IA 3T5HA 4YQWA 4WE1B 1U4BA 1N33F 3LOUA 1TL1A 2FYXA 1G2EA 3T41A 2B4VA 3ZO7A 5I3UA 1UL3A 4LSZB 3MOJB 4ZMMA 4NLTA 2UP1A 2RDDA 4AUKA 1OSCA 3IBFB 5DZ6A 4X4UA 1S9EA 1WC4A 5KFFA 4DV2F 3HHLB 2YNFA 1GFWB 1YZ6A 2WZ1A 2QN6B 5E3PA 3G96A 3IM8A 4DCOB 3J7YU 3RBEA 2O1PA 4GKKJ 4HL9A 2I8EA 2VG5A 2RRNA 1D3WA 1HWLA 4NE9C 5EHHA 5HLFA 1RT7B 2BQ3A 4IR9A 1DQAA 3ENWA 2BM1A 3H2VE 1S1XA 3PVXA 3I31A 1J27A 3Q8RB 1CULB 4LSLA 1R0AB 1Q1KA 2DR6A 2LLZA 1FWKA 3CIZA 5GMDA 1X5PA 3FSYA 3NBPA 1OYEA 2OEMA 5F8JA 5KFUA 2P6SA 4AQYJ 5KFLA 5AXLA 2IM1A 1AB8A 2IMOA 1J5OB 3NXZA 4RWXA 2CWKA 2JEJA 4B3MJ 2FZKB 2ASYA 1C4CA 2GW8A 4F3QA 2V8HA 1NK5A 1T9UA 2K7KA 2JLGA 1H7WA 3EZOA 3GCWP 2VQFF 3EPGA 3BSCA 3LO3A 1HNWF 4NLYA 2AU0A 3EM1A 3ZZPA 1YIJS 3IGVA 4P2FA 4JYAF 1RHMB 3GFHA 1SIZA 3M05A 1LWXA 2LEPA 2VPXB 1OQ3A 2VKRA 1FDNA 2XYHB 3ADAC 2CDRB 5FLXU 4RNNA 5KT3A 3MM5A 2DXFA 4ZJQA 2VBXA 3FJ2A 2COLA 5IQ6A 1X7VA 3DOKB 4C2MA 2JVOA 4O44A 4TU9A 1JMTA 4C8ZA 4UOHA 1JNRB 2HHQA 3J81j 2XGPA 2DNKA 2Q43A 4H4OB 4WFAQ 4OX9J 1QD1A 5H9EJ 3L7PA 4DV6F 3DLEB 4MIBA 4KHRA 4USKA 2VQFJ 2FJDB 2YX4A 3VHQA 2NUUG 2N3OA 4QCLA 3D66A 1RXOB 2KKHA 3CMAS 4DV2J 4F04B 2K7JA 1VS3A 4PWWA 3LGMA 4AL5A 1BGXT 4EU0A 1LXJA 2DVIA 3HD1A 5IOLA 2QYCA 2WOMB 1RT5B 2DGVA 1YBAA 2NCKL 5KFAA 5K8PA 1WD6A 2IMWP 1XERA 5KOWA 3E8OA 2DGSA 4J9PA 2Q6BA 1D8YA 3BB5A 1H73A 1RTHB 3AD9C 1UETA 5B0DA 2ATLA 1WOOA 4X4NA 2RS8A 4A8XA 2QYGA 2GAGC 3M2UB 4PWDA 4OZLA 4IUFA 2AYMA 2Y0SD 1DLOB 3AOAA 3NNCA 2AMCB 1VC5A 2FD2A 1V3ZA 1VLYA 4C0HA 3CCJS 5JVGQ 4DR2J 5D78A 2CPZA 3TQEA 2BW7A 5FJ4A 1BWEA 1GXLA 1WF0A 3C6UA 4C3MA 4CO4A 4LFAF 5GMEA 3SFGA 3B78A 2ZBIA 1WKJA 4ECVA 2MKHA 2RU3A 4N77A 2VG7B 3AD7C 2AX0A 1S6OA 2CYYA 1P1TA 3EDRB 2VPZB 4PCQA 2XY7A 4LFCJ 4ZP7A 3CJ0A 3J7AN 1U2FA 3JTOA 1OY6A 4DSIA 1NHKL 4OZ0A 4TY9A 4OHWA 2KM8C 4JI3J 5CCMA 3ZNUA 4LIWA 2WONB 1JXLA 2UU9J 3HPOA 1ZETA 1MG7A 1L3SA 1QLNA 4X4RA 1MROB 3DOLA 3CD7A 2W2NP 3K5NA 4IFYB 1WSRA 4ECTA 2OH2A 1ZBTA 2MQNA 3C14B 3ZTPA 3MM7A 2KZMA 3MM8A 1BXNA 2H51B 4U95A 2MGZA 3TQ1A 1DQ8A 4O23A 1F9HA 4TLQA 4DR1F 3T1HJ 2P6TA 4PKDB 5D4LA 4CM2A 1X0PA 3CCMS 2QL9B 1HBMA 4ECXA 3M8ZA 4NLDA 3PYEA 3SZ2A 2LQ5A 4EO8A 3TJ9A 2M88A 4NPOA 3C6TB 4OZ1A 3TUIC 4KE5A 2FJXA 2K1RA 2GIQA 3TX8A 1B4SA 1Q5YA 5B0CA 3GTYX 4L74A 2HMIB 5B0FA 2YQ1A 3CCLS 4OYMA 4M5LA 2UUAF 2XMWA 4M5GA 3BQ2A 4JI4J 5IC6B 1LQ9A 4I0WA 4S0MA 1XMOJ 1PJ6A 1QSLA 2ZH9A 1C4AA 1X8DA 2EC2A 1V5VA 3DLKB 1ZS6A 4LRBA 4PG7A 5L39A 3PW4A 3FBCA 5B0GA 2HSEB 1HQ2A 3NEKA 2XTJP 3M2VA 1S57A 1RWXB 4LFBJ 2DNRA 2WB1D 3QBCA 2FHOB 2F1FA 4ALZA 4DL0C 3B4MA 3G87A 3ISND 4PQUB 2D74B 1QE1B 3CD5A 1UWBA 1WC0A 4OZ3A 1KC8T 5F8NA 4YHHF 1AA1B 2RHQB 1J5EF 1RTDA 2P9GA 1HBOB 5JJBA 2DEJA 2W7AA 4A8OA 3IG1A 2LP4A 4LFCF 1RTIB 2OFHX 3BGFA 1S5ZA 4YB6A 1AYEA 3C6UB 4W92B 2F4VJ 3EJMA 1RADB 2AZ3A 1HBOA 1Y4ZB 1JLFB 2MKSA 3LALA 1JNZB 3NG8A 1X9SA 1VYAA 1PO6A 4O4GB 1JX4A 5DS7A 5T7LA 4CLYA 3DI6B 3EXYA 3N01A 5C42A 1CC8A 2W2QP 2YH0A 3W3SA 1H74A 3RB6A 1N5YB 2FB0A 3RB0A 4CO2A 2YKNB 4HTJA 3MECB 5E3AA 1T3OA 1LWCA 1F3FA 3UW1A 4Z37A 3V81A 2XLIA 7FDRA 1D8ZA 2GMLA 2RDIA 4N8OA 4PEOA 2DTJA 2UV8A 4MAKA 4RO0A 3UNGC 4ZITA 5KFJA 1IQTA 1UW4A 2UZAA 4B08A 2ILZA 2DY1A 2HQIA 4DV0F 3GPAA 3R5GA 4HTIA 3VCDA 3BBBA 4Z7YA 3K8VA 3IWXA 4B9NA 2L9DA 2VH7A 4C0OC 5CABA 4G3IA 3NS5A 1DTTA 2B4PA 2C1EB 2IJNA 4QPXA 1IR1A 2GJFA 3VAJA 4H4OA 4UT4A 3KOAA 1VQ4S 3NOGA 4FNHA 2SXLA 3ICLA 2RVJA 4IG0A 1Y3JA 5I3PA 2XC9A 2J76E 3BR9A 1PCAA 1S99A 2DYAA 2KT5A 5JXSA 3BYRA 3TNVA 3DI6A 3PHEA 4G1QB 2W9BA 5A8WB 3M1VA 2JEIA 1TKZB 4IFYA 1VJWA 2QLFB 1N56A 1R8PA 2MZ1A 4A48A 3OJUA 2HHVA 1K73T 3DRYA 2B9XA 3U27A 1U49A 2B0GA 2FIUA 2ZITA 2E1CA 4EK2A 3NOCA 3QAUA 3NNHA 3WQPA 3SIPB 2PEBA 1R6VA 1T9YA 4CH7A 2H65B 4GVLA 5DETA 5A8RB 2W9CA 2Y1IA 2AZ1A 1XWLA 1YJUA 3CJ3A 3PO4A 4DI6A 4ZVHA 3R7BB 5HMYA 4USIA 4DHVA 3CCQS 2VIHA 3H2LA 3M8RA 3A12A 4P2MA 3JAMU 3GFYA 1UZHA 3TI0A 4OI1A 1MWZA 2V68A 3W5ZA 5KFBA 5K5MA 4ETXA 2P8IA 2ZUGA 3SV3A 1YJ7A 1VQPS 5E41A 4F3MA 3UR0A 3W2VB 3M9NB 1PIEA 5IWAJ 1Q16B 3D6MB 4NLPA 2FY8A 1S76D 3SCLE 3P6YC 4PXDA 4G1IA 1MSWD 4WWSA 3BKUA 3FFIA 2OPPA 2BV3A 3QGGA 3OTBA 3B82A 4KGXB 4ES1A 5IT9U 4LQ3A 1IXKA 4KR0B 4QQBA 2VBZA 2ZUAA 5HL7Q 3H5XA 1XEZA 1C0TB 1WHXA 4B17A 5BYQA 3PKYA 5B7WA 2EW9A 1NSAA 4I67A 3HSZA 1DFDA 1Y0HA 2KJVA 3BR8A 5HROB 4I69A 1TFYA 2MZJA 1Y9OA 1EB0A 1U24A 2DGTA 4DV3F 1I94F 1BQMB 3EGWB 3IR7B 3MR7A 1UEKA 1AXQA 3J81U 3HHDA 3MM7B 1HW9A 4TQRA 4ED2A 3CCZA 5GAGU 5IWAF 2DJWA 4X65J 3KLIB 1BQNA 1SJRA 2J9DE 2J9CA 5HVFA 1PGZA 3N9UC 5DGAA 4NRTA 2DB1A 3W63A 1IBKJ 2UXCJ 3H90A 1E6VA 4ZHRB 1SBRA 1WC1A 3TVYA 4DDFA 3AAWB 2V0NA 1PILA 3P4UB 1RAFB 3WIVA 4NLWA 3PRBA 2GC8A 2YPYA 1CJUB 2AT1B 2HHTA 4KHMA 2E9ZA 3BKTA 2EFNA 2FC8A 2V67A 2DNMA 1JLEA 1SV5A 4YN3B 2PO4A 1KN6A 5KT4A 5KFDA 4ID5A 2DBBA 3V6KA 3KYLA 3PX0A 1W7WA 4IG3A 4CM0A 1VQOS 4NCBA 2BE2B 1EQ0A 1F0XA 1LKZA 3O3LA 1GMWA 1XNQJ 3CJSA 5J1EB 4I6AA 1L3KA 4MKBA 5CAAA 1UJ6A 2MQ8A 4LVNP 3GJTB 4I2PB 2BABA 4LSLB 1BY9A 4DWIA 1XMQJ 4ZVPB 3DU6A 5HP1B 1OY8A 3D6HB 3MI7X 2JLFA 2CXEA 3CULA 4JBCA 5GAHU 3QMQA 5G0RB 1KQGB 4FXWA 3DHWC 4DG1A 4Y28C 2GAHC 4IH7A 5HQMA 1IUJA 4A8WA 3W5XA 3BQ0A 2HFVA 2MTLA 2C3YA 1G6BA 1WC6A 2EG2A 5LT5A 4XAKA 4ED7A 3R9LA 1C1BB 3DM2B 2A1BA 3C15B 2UV8G 2ASJA 1WNEA 1NPRA 4XDDA 4MFBB 2CFXA 3MR3A 4C3LA 2XS7A 1CSJA 5A2QY 3CJ8A 1VQSA 1JKHB 3HULA 3IS9B 4ZVQB 4O3OA 3SMZA 3DDKA 3EMTA 1Z4UA 1TL7A 3OVSA 1S1WA 4J37A 5B0BA 4Q7AA 3ISZA 1IR0A 1S1TA 3FBBA 3S1TA 2VJUA 2YX7A 3UD4P 3RB4A 2HQFA 3D67A 1SV5B 2F8EX 2DR7A 3KDOA 2IRYA 2QRRA 1X9MA 3GIMA 4ICLA 5GADU 1WC5A 1T0TV 1CJTA 2BANB 1FKOB 2D9PA 3FBEA 3HZGA 4NEYA 1YDLA 3QWPA 4NX9A 2FLPA 1HNWJ 1FKPB 3UNYA 3PEJA 2KVQE 3BBFA 3ITHB 1IKYB 2ACMA 3N6MA 3ZNJ1 1HR0J 2VHGA 3K8WA 3OFGA 1Q81T 2EFQA 2V63A 4U7UD 2E5IA 5KFEA 2BDPA 5CHCB 1FVSA 2VOPA 2OSQA 1WTBA 2WCXA 3PR4A 2WW8A 4Q8EA 2HHXA 4C9DA 2VC1A 2X1FA 1Q4RA 1SJFA 5KG4A 2BE9B 4OQJA 1Q0NA 3C15A 1CQMA 2ZBCA 2WHOA 2JVRA 2LCWA 3M9OB 1EP4B 3MEDB 1X31C 2HBRB 2QV6A 4K4XA 3VAMA 5CXTA 5KFKA 1PSDA 2XHWA 3CPWR 3GE9A 3HMJG 1VQ7S 1NH8A 2B6AA 3PM9A 4JV0A 2VFVA 4KV8B 3JXOA 5KFXA 1TUGB 4WFNQ 1RT6A 3MAQA 1UVLA 4DSFA 4LREA 4QIWD 1R27B 2HWIA 2JSXA 3M6VA 1NJWA 2ZH2A 2RQ4A 1BLUA 2R7OA 2GHVC 3T9ZA 2KDOA 3VAHA 1HA1A 2AGPA 2NXCA 2IDEA 4IR1A 4AXJA 4FYYB 3W2WB 2XO7A 3IMQJ 4HKQA 3W9JA 5CZVA 4FDFA 4DX7A 1VC0A 4WBFA 5K14B 4X4QA 2WBRA 2Q3PA 2QSFA 2UVWA 2DNLA 4HDHA 1VHIA 2GQ2A 2PMHA 1M1HA 4MYUA 4KQZA 5E5NA 4YHHJ 2HGNA 1TL5A 3C19A 3MCSA 2XMAA 4EYIB 3QZ7A 2YKMB 3LP2A 4LF8J 3SQGB 2IRXA 1K0TA 2DH9A 4M5JA 4U8VA 1PJ7A 1FNMA 3IGNA 3EVMA 1WOPA 3R8YA 3ZZYA 5RUBA 4IO9Q 4MYTA 4MK7A 2F4VF 2LA6A 2CNNB 4M1KA 3U7JA 3GQCA 4E8UA 1JLBA 4HLBA 2XLJA 5EWGA 3T9NA 3HI9A 4CLSA 1I1GA 4N41A 3GFXA 1IVZA 2H5EA 4BWJA 4A46A 2QTWA 1VOMA 2HS0A 5IT0A 4HR2A 4X64F 1RJJA 2E5LJ 3OT9A 3MD1A 4BWMA 3QJJA 2B3TB 1ZPWX 2DNOA 2G0IA 1FE0A 1NUEA 3CJ4A 4DFPA 2BJ3A 4CTAA 3CJQA 1U1MA 4DV5J 1KLMA 3Q24A 2E29A 2GGPB 3WC0A 2EK1A 2W1BA 3TWZA 4DPXA 2R2UA 4ED0A 1N5VA 2DO0A 2YQ3A 3HM9A 4DR1J 4LF6F 3AXKA 1T95A 2OEJA 2UUAJ 2CNKB 3GV5B 1LW2B 2VDIA 5HMZA 4C7QA 1HNIA 1GAOA 2FJBB 1NMEB 2RU9A 4F4AA 3MR2A 3EUNA 1OS5A 2J7UA 2Z0GA 2BJEA 2IPOB 2YH1A 1H7XA 4D3HA 3MAAB 5E3CA 1BD6A 1T9TA 1I51B 2AEJA 3QAEA 3QQCD 4V1Ak 1O51A 3ZZOA 2KB2A 4LSNB 3V6DA 1KOHA 1N6QA 2NREA 2G2ZA 2VFTA 3QRPA 1S1VB 3M2RA 4I2QA 1N5YA 2LEAA 4NXMJ 4NA3A 3GIIA 3Q8PB 5ETSA 2KRRA 3RRHA 2ZNYA 3JTNA 2UUWA 1RT2A 2RD5C 4LRDA 4DJBA 3JTPA 1WKKA 5IT9Y 4EEYA 1J2VA 3MMBA 1M5PC 3NP5A 3GIRA 3ELHA 4DFJA 2W9CB 2HBZB 3MD3A 3AHPA 4IDKB 3R7SB 3GJRB 3KNGA 4HI1A 2BVZA 1ELOA 2YNHA 4Y6IA 4ZOSA 4CZCA 2HPUA 5F8MA 2RKIA 4IYQA 1ZA1B 2AGQA 1C1CB 3JQMA 1FDDA 4IQMA 4M5KA 1BWVA 1LV5A 1CBKA 1PC4A 2VOOA 1FRXA 2FVQA 3OHAA 1RT6B 3MHYA 4DN9A 1U26A 1NK8A 1SH0A 1QTNB 2LQ8A 2ZOMA 4UQTA 4HI2A 4WK3A 3WIUA 2QMUB 1TKXB 3TVZA 5C24B 1XJWB 2V69A 1RGVA 2VFSA 5GAHI 2ZH4A 4IOAQ 5D0HA 2AV5A 2GNKA 2OUGA 3RU0A 3UN5A 3KLHB 3OJSA 3IBWA 2B4UA 3AQPA 4IFVB 1FK9B 2HFUA 2Q6CA 4TYAA 3RZAA 4ZP6A 3SSRA 2Z57B 1RBAA 2DPIA 3W8PA 2BQUA 3MWBA 4DN0A 3GLJA 9RUBA 2ZH5A 1ZM3A 2ZZTA 3TA2A 3NMAA 3L7UA 1YQHA 2BXJA 3GP9A 1TQLA 4KH1B 4JYAJ 2OD6A 1NDPA 1QAXA 2ZC3A 4M5IA 4WK1A 4YR2A 4P74A 4UTGA 2CPIA 4Q43A 2XHCA 4M5DA 3GIJA 3TANA 1RKJA 4K5RA 2IVFB 1H6KX 1FKOA 3V81B 3P3DA 2Q79A 5BXIA 1Y5LB 3K57A 5B0AA 1FHTA 2KT3A 1EARA 2JNJA 1UKUA 3R1LA 2KZZA 3MM8B 1S12A 3FUYA 4RW9A 1FXLA 1U1NA 2QLXA 4PG6A 5T7LB 3H4DA 4I1TA 2L48A 3QT7A 4OX9F 3VF0B 5IFMA 2M3DA 4K0KJ 4N8NA 3I0SA 2BKPA 4LF5J 3HFVA 3KHLA 1KNZA 1EETA 2W9AA 5KG6A 4ECQA 2R7UA 2IJRA 3P5TL 3N4WA 3LAKA 3O8WA 5LMUF 4LF6J 3K59A 3QLHB 1DY3A 5JUMA 3WC2A 1S1UB 5J2MA 4LF1A 1HMVB 1TVRB 2DRDA 4JI8J 1W2IA 4QWAA 2R2RA 2BJ7A 4PQAA 4FF1A 1LWFA 1NCLA 4QWDA 4F4KA 2BM0A 1SC3B 4FF2A 3PFOA 3GR1A 2JHEA 2O66A 3OXGA 4DSEA 1VBYA 1F2GA 2CJAA 1WORA 2V9WA 3VZIA 3CW2C 1RP5A 4KSEB 1FTCA 3RG6A 3UVJB 2Z30B 4X62J 4OV6A 1QY7A 3CCSS 4DR4F 1KONA 2CPFA 4PWDB 1KFDA 2OFGX 2VODA 1NK6A 5F0WA 2B9EA 3B8HA 3CCWA 4TU8A 2APOA 3MAHA 2HHSA 4HHHA 2HMIA 1G3OA 2E7XA 2DKOB 2HGMA 3OUYB 2BE2A 1ZTWA 4LF9J 2WOMA 3X1LB 4RWWA 4DZDA 4F4WA 1X9WA 3KNAA 2F9DA 1XR5A 2BW2A 1JLEB 2FLOA 3BGLA 3OR2B 3GCXP 2KJWA 3AXMA 4RW8A 3DOMB 5ITHA 1M0SA 3EZ5A 1CJUA 4I56A 3KJVB 1S1UA 2KYZA 2ZOFA 3THPA 4R0EA 2PT0A 3K5PA 5J2MB 3D0GE 4L75A 2ASDA 1YK9A 5DQHA 1F9FA 1ZAXA 2V2QA 1VQ5S 3O1LA 2YNIA 3HX9A 4DQSA 4XPCA 3H40A 2L41A 4W98A 4B9TA 4DR4J 3CEDA 3MM6A 1YX2A 3ZZZA 1NPKA 2B5JA 4Z2XA 4Q8FA 2J7KA 4QIEA 3RTVA 2I0XA 4MIAA 2AX1A 4BC7A 2MJUA 3OBIA 4DR3J 3PKMA 2CJQA 1F2HA 2D7SA 3MDFA 4WZMA 1WG5A 2OJ3A 2HAIA 1GMUA 4Q0BB 3NS7B 3HLUA 1Q7LB 3S7RA 3QRQA 4WXWA 4DR6F 1RI7A 5BYSA 4ELTA 4NLGA 2BKOA 2F8MA 2V5HG 3D68A 2HKEA 2HZCA 2N7CA 1YJNS 2CADA 2A2DA 4BS2A 3JB9k 3W5YA 1M90T 2G0CA 3PNIA 4GVBA 4GC7A 3RW6A 4PAAA 4TN2A 2WSFC 1APSA 2YWHA 2XG8A 2HZVA 2NPIA 2HEKA 2HIYA 2H9ZA 3M2UA 4C11A 4K5SA 1XC9A 1H2TZ 1HNVB 2E44A 3PXGa 3DLGB 2XZTB 1AZSB 3TP2A 1VRUB 4Q5VA 4Q45A 4NZ7A 3KLHA 2QT7A 1JJ2R 2ZZMA 5C2CA 2W8LA 2VA2A 2YWEA 1R0AA 2M5YA 1CJKB 5SUHA 2CAJA 5L1IA 4DLEA 1VGYA 1PKUA 3HZEA 1U1QA 2WSEC 3W9HA 1GK8A 4HEA9 4NASA 3R97A 2GCFA 2FHJD 3H5UA 3UI3A 1VQ9S 1AW0A 4NMLA 5C5JA 2B9YA 2VQEF 3QYYA 1U2RA 4BBYA 5H9EK 1TAUA 1TVRA 1UPMB 2DIUA 2ZC4A 4H54A 5DZ7A 3A1YG 4CLUA 3RR7A 3TYTA 4PUOA 5HO4A 4JV5J 3QZ8A 4FF3A 3QIDA 1RWPB 2HVDA 3DLEA 3P5BP 4ZKAA 5E3RA 2WRMA 3OPKA 2LDYA 3VGTA 2ABYA 2AIRB 2OPRA 3SV4A 2FVRA 5ADZA 1S0VA 2CPHA 2RQMA 4L76A 3Q0AA 4ES3A 4TYBA 2KT2A 4RNFA 3JSMA 3PW5A 2KO1A 2R7TA 1WHVA 4LUBA 5ETVA 4K7QA 4TVAB 4PXBA 5DG8A 4TU7A 2AWZA 1DARA 5CD4H 3PZPA 2MY7A 4I7FB 4E2FB 1EKSA 5EWEA 4F2RA 3S01A 1MNEA 3O44A 1P9QC 1FX4A 1UAWA 1WEZA 2N7YA 3FCVA 3Q8UA 3UN2A 4RW8B 2MEWA 2EC0A 3CO0P 3SSSA 2UUCF 3PCOB 2YVSA 1VJQA 3K5OA 2HNZB 4XDCA 3GJSB 3IRXB 4ED4A 4K4YA 4KPYA 1ZZFA 2CWXA 3NGRA 1YGYA 2XYPB 3LP0B 4ES2A 1YLXA 1HYSB 3ZZTA 2ALYB 3LPYA 4ZP8A 5DDPC 1YJWS 1OSDA 1DJ0A 1LEOA 5A0YB 3MR6A 4B3MF 3OSNA 4A8YA 1VI7A 3UD3P 5CYMB 4U6PA 5J2QB 1HBUA 4JI5J 2CNOB 2F3JA 3AQOA 4KO0B 1TU0B 1S4EA 2HFOA 2K2PA 1Q82T 3HSJA 5BJRA 4F02A 3M30B 2PD1A 1UFWA 2EBGA 2XBPA 4YUDA 3CMES 5L1LA 4ZLLA 2Y1LB 3I9V9 2VQEJ 3C8YA 2KL8A 4CNYA 3ILIA 4DUZF 2PI5A 2FHMA 4Z7CA 1DTQB 2GMHA 3F0NA 2D41A 1A9NB 2VPWB 1YVFA 3CSKA 1KVJA 3IG1B 2QE5A 5DG9A 4O3PA 1CG2A 3Q89A 3HKWA 4MIWA 3G82B 3NL0A 3MMBB 3OTOF 4JI4F 3DMJB 3M8PA 4OHZA 2J6TA 2KYXA 1KLNA 3H0PA 4UOCA 1V5IB 3J7ZT 5AT1B 5M2RA 3SYZA 3CF5Q 1FKAF 3LAMA 1NM2A 3R5DA 4OL8A 3BSNA 4ECRA 4W90B 2ROEA 5AJ3J 2BYCA 1F5AA 1N6QB 1JXEA 3DLKA 3UDVA 4WP3A 1ICEB 1TL4A 4P2SA 4F4XA 3EGNA 4Y65A 3C16A 2FVCA 3NS6A 3BEGB 2RT3A 4FYXB 3KJNB 4F25A 1IBLJ 2J6SA 1X4EA 3N5BA 4RU2A 3G6YA 2K1RB 4K4SA 4PG5A 3BGOP 5KT7A 2V4JB 2VASA 2E5LF 4Y34A 4ILLA 5DO2A 3PY8A 1JLCB 2V4QA 1P9YA 5KG5A 4F50A 1SH3A 4ZVEA 2FVSA 2IA6A 2C2NA 2EKNA 1XN9A 2GO9A 2VF3A 1F3VA 2ZNZA 4I68A 3KXDA 1N8RT 3H25A 1FT8A 2ZH6A 3IRWP 3FMBA 5KT5A 3IRXA 4WU2A 4CLLA 3F44A 1CS4B 1JLCA 3I32A 2VUGA 3M32B 3AOCA 5KTQA 2CG4A 3KKFA 1R43A 1DRZA 5LL6d 2DXEA 1D9DA 3DYAA 4DL5A 3PJ9A 4AL7A 4DX5A 4DR6J 3W62A 3UPFA 4WTOB 3C16B 2JC1A 3SI8A 1C1CA 1OPIA 3TJ8A 3CD0A 3HHLC 1NJZA 2CQCA 3VQSA 2DITA 4FZVA 4ZPAA 3U1LA 2JFKA 1EAYC 4CH1A 3PW2A 2UU9F 1H0HB 4L72B 1R89A 5F8LA 3DRRB 3PEHA 4YDXA 4K8RA 5HANA 1VBZA 1CJVA 1X5OA 4RBUA 1DLOA 3ISNC 1TP7A 5HJXA 1T03A 1RT2B 2BOPA 4UW2A 5HATA 4NXNF 4YB5A 3D3CJ 5B0EA 3HK2A 2DCLA 3D1OA 5GAEU 2RAQA 5LMNF 4N76A 2OLWA 1LK5A 4FXDA 1RE1B 1H38A 2OAUA 1MU2A 3W61A 3C46A 4NA2A 4QYZK 5AXKA 2LMIA 1RT5A 3A8IA 4Y2KA 2ZWPA 4YFUA 5I3QA 1T05B 3HHKA 4CLZA 1QVGR 1FRLA 3A8EA 2J0QD 3K2YA 4ZP9A 2GIRA 3UD5A 1CJKA 2GHPA 4EGLA 3X3UA 2HWHA 4CLPA 2ZH3A 3BF4A 5HP1A 2VFRA 1D1UA 1RZMA 3OXLA 2I2YA 1URNA 2V6AA 1T9WA 5E2QA 2EEYA 4KPCA 1UEVA 1NBEB 4DBQA 4YY3J 2B43A 2NXJA 2R2SA 4M5NA 3BBCA 5EGYA 1V3RA 1S6PB 3VR1A 2GIFA 2V4JA 4IKAA 5B09A 1XK8A 1YRUA 3NGSA 2DXDA 3DOKA 1S77D 3H7HB 2Y1RI 1ZAWA 2A3JA 3H20A 3JSRA 4I64A 4OZJA 4LBIA 4CLWA 3OLAA 2NZ4A 1FKPA 1SC6A 5LOQA 2B4OA 2KG0A 2AJ2A 2PMZD 1SUQB 5HI7A 4JUZA 2G1DA 3CCVS 1VBXA 3CDAA 3GIKA 1ZTTA 3A8JA 2FHKA 2QA4S 1R8BA 1U1RA 5D4OA 2OI2A 1FNOA 2D9OA 2OHDA 3AJ1A 3KLEA 4N5SA 4JOUA 4LRFA 4K4WA 2CZ4A 3TR5A 1VDHA 1V9OA 2ZBRA 4FKYA 1N88A 3FRYA 2YKMA 2KHCA 3D1QA 3PYGA 1JJHA 1T3NA 1K0VA 3CDUA 5IXUA 4C8NA 3LP1A 1JK9B 1Q79A 4WJBA 1O0PA 4CRJA 2MDAA 3N0VA 2IAJA 2V2ZA 3G82A 1L5UA 2OPRB 4KJIA 1SVDA 1WELA 1CULA 3OR2A 1WOSA 4FS1A 1TFWA 4ZCIA 4ZVUB 2LDIA 2YPZA 2QO3A 4LR7A 2Z58B 4PYAA 3J80Y 1RT7A 4EBEA 3BDPA 3BO2A 4QIGA 1RISA 3NMRA 3TOQA 2R2TA 1N5QA 4OJ1A 1VC6A 2R3VA 4CNZA 2H1YA 1C0UA 5HN0A 4C97A 3HHLA 3BH7B 5T41A 1U6ZA 3GYNA 1KQKA 3V4MA 4EBCA 2DIVA 4RU9A 5ETTA 3FRZA 4BCAA 3HT3A 3G8QA 2V9KA 4FF4A 3HKZD 1UMJA 1HI0P 3VALA 5KFZA 3CCTA 3NGKA 4NLVA 1IKWB 2UXDJ 1U0SA 1GMWD 1S0NA 3IFEA 3AT1B 1TL1B 4DCPB 2JRSA 2QFIA 1U6FA 4IG3B 5K20B 1NNDA 4LF2A 4ATNA 3D2WA 1YRTA 4OYOA 4PXCA 4DV4J 1B0VA 5BYRA 4A47A 1WUUA 5ETQA 1M5OC 3KUGA 1H2UX 1FNXH 4JI7F 2QJ3A 3ITHA 1S48A 2RF2B 4J9NA 3N79A 4OI6A 2QL7B 1FEHA 1M1GA 4C8KA 5KFSA 1SJQA 3B54A 1RA6A 3M8YA 3MEGA 3POTB 2QMXA 4KYZA 3L4BC 3OL7A 3LGNA 2Q1LA 4WP9A 1S72S 2LQBA 3DGVA 3U1NA 3M1VB 2O3DA 1SKRA 3CCES 4UY8T 1VQ6S 1YITS 2FC9A 4OYIA 3ETMA 4KC5A 4YB7A 4CIOA 4DPWA 1XNRJ 5KFQA 4OI3A 1Q5VA 4CQ1A 1FFWB 3TUPA 1REGX 4AE5A 4RW7B 3MEGB 2A18A 2PE8A 3T1YF 2FQQB 2V8PA 2MPUA 3BV8A 2IFXA 2C2DA 1YJRA 2XNRA 2OTLS 1IR2A 2UXBJ 4FNIA 4LF7J 3G71S 3LTOA 1FJEB 2R8KA 3AH6A 3G6ES 4XK8C 2AEMA 3QGHA 4MKAA 3T3FA 1JLGA 4DV7F 2M8DB 4WYWA 1TL3B 2CQ0A 3I5CA 1ZYQA 2AJ4A 2LQJA 2OPPB 4YMEA 4YR3A 4WFBQ 1WF2A 2R8JA 3J81Y 3A3PB 1X5TA 2KG1A 4J9OA 3PV8A 4JV1A 3OUYA 4ID8A 1GTEA 2QFJA 1RT4B 3HFKA 4OYWA 2ZJQQ 3W9IA 5H9FK 4ZVTB 4J91A 4M8LA 4NLRA 4ECWA 2Z8QA 4NL5A 1FA0A 4MTPA 1NB7A 1Z1ZA 1TR0A 1UFKA 2IBOA 2LYVA 2Z4PA 3CNQP 1VRTB 3OD2A 3LWLA 3R1HA 1NKEA 4K0KF 2ZD1A 3E51A 5DJBA 2ILYA 2HHHJ 4O4GA 3S6EA 3G86A 4PR6A 3SCIE 1N32J 2LVWA 5A8RA 2UXCF 1QJHA 1MN7A 2DH7A 4Q2LA 1JQGA 4ZN3A 1Q78A 3AB4B 1EJ7L 4ZK7M 5HQ8A 2UUTA 4IDKA 1AFIA 3MPYA 1BHNA 5FDLA 3PO5A 2WVBA 2C2KB 3I55S 2R8IA 3JQKA 3MTJA 1U8WA 3SDEB 5EUHA 5CYQA 2VB6A 1VQYA 2V34A 4FYWB 2HNDB 5CZXA 4D3GA 2AKWB 1QE1A 1LFPA 1B64A 1EETB 2HK2A 2Y3YA 3JSBA 4W4MA 1KDNA 3ULHA 1U2CA 2JFDA 1LWEA 2GA7A 1KTQA 2KXHA 2MSTA 3MM6B 4DX6A 3OL6A 3DXBA 2XMVA 2Z2YB 5HJYA 4NCAA 2ZBQA 3BN7A 4WF9Q 1YSJA 2BRLA 4CT8A 1NSQA 2VDHA 3BQ1A 4DV1F 3KLEB 4B3OB 1YKWA 2JWNA 2BJ9A 3MCMA 5EX3A 4RW6B 3ENQA 4KFBB 4QW8A 4Y0FA 3HP6A 1UJ5A 2WVFA 2K3KA 2LU1A 1HBNB 1JXVA 1SUQA 5E7OB 3ZXWA 5HVHA 3QJLA 3G2XA 2K8GA 3BGRB 2HRUA 4PPZA 2ZZNA 3HO1A 3M6UA 2JZ5A 3C6TA 3IA0A 5L1KA 4O3SA 3UN3A 2XQCA 3FMWA 3EX7B 1QAJA 4IRKA 3K0JA 4YDDB 4DQIA 2MKYA 3I96A 2HHPA 3K17A 3MEEB 2HQ3A 1LWCB 1HBNA 2BEFA 4LMZA 1PYOB 1JLQA 4ER8A 2G2YA 2DCUB 2XMJA 4FN5A 3DLHA 3G9CA 3OL9A 2KHDA 1GX6A 1VMBA 3H98A 4QYZJ 4FVMA 2OPSA 4ED5A 4AT1B 1RTJB
chains in the Genus database with same CATH topology
3MCNA 3QBCA 5ETLA 3MCMA 5ETVA 3HSJA 1F9HA 1RU1A 5ETNA 4M5MA 1IM6A 3UDVA 5ETOA 1RAOA 2F63A 3ILOA 1DY3A 4M5JA 2QX0A 4M5HA 2F65A 3ILJA 3ILIA 3KUGA 3IP0A 5ETQA 1RU2A 3KUEA 5ETKA 5ETRA 3UDEA 4CYUA 4CYUB 4M5KA 1G4CA 1EX8A 1KBRA 3HD2A 3HSGA 1CBKA 4M5IA 1TMMA 3HD1A 3MCOA 3UD5A 4M5LA 1RB0A 4PZVA 4M5GA 3HT0A 1TMJA 3HSZA 5ETTA 1EQ0A 4CWBA 5ETMA 4AD6A 5ETSA 3ILLA 3KUHA 1RTZA 1HKAA 3HCXA 1EQMA 2CG8A 1HQ2A 1Q0NA 5ETPA 4F7VA 4M5NA 2BMBA 3HSDA 4CRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCN A;  3QBC A;  5ETL A;  3MCM A;  5ETV A;  3HSJ A;  1F9H A;  1RU1 A;  5ETN A;  4M5M A;  1IM6 A;  3UDV A;  5ETO A;  1RAO A;  2F63 A;  3ILO A;  1DY3 A;  4M5J A;  2QX0 A;  4M5H A;  2F65 A;  3ILJ A;  3ILI A;  3KUG A;  3IP0 A;  5ETQ A;  1RU2 A;  3KUE A;  5ETK A;  5ETR A;  3UDE A;  4CYU A;  4CYU B;  4M5K A;  1G4C A;  1EX8 A;  1KBR A;  3HD2 A;  3HSG A;  1CBK A;  4M5I A;  1TMM A;  3HD1 A;  3MCO A;  3UD5 A;  4M5L A;  1RB0 A;  4PZV A;  4M5G A;  3HT0 A;  1TMJ A;  3HSZ A;  5ETT A;  1EQ0 A;  4CWB A;  5ETM A;  4AD6 A;  5ETS A;  3ILL A;  3KUH A;  1RTZ A;  1HKA A;  3HCX A;  1EQM A;  2CG8 A;  1HQ2 A;  1Q0N A;  5ETP A;  4F7V A;  4M5N A;  2BMB A;  3HSD A;  4CRJ A; 
#chains in the Genus database with same CATH topology
 2IM0 A;  5E3Q A;  3CE8 A;  3H59 A;  3DU5 A;  3KDN A;  4ZIV A;  2PEH A;  4H4K C;  3PIO Q;  2DHH A;  3G8S A;  1IBM F;  5M2P A;  2FLN A;  1RDR A;  4LF7 F;  3PTW A;  5JMN A;  2CVE A;  2HND A;  5J2P A;  3KK1 A;  4ETZ A;  1RKI A;  2CQ3 A;  3JS9 A;  5HVG A;  3NKY A;  3D9B A;  1ZA2 B;  2DD8 S;  4HHJ A;  2PSZ A;  5I4M A;  5FDL B;  5A2Q U;  1Q53 A;  4ZPD A;  2LEC A;  4EMD A;  4GKJ J;  1X4G A;  3TAM A;  3Q8V A;  2AHO B;  4EYH B;  4BHQ A;  1U45 A;  1HNZ F;  3P8B B;  5DG7 A;  4PQU A;  2NLW A;  3I0S B;  3KFW X;  5K8N A;  5LSL A;  1NHU A;  4PG4 A;  3KLG A;  1YBU A;  4DL6 A;  1R0C B;  1RAG B;  4AD6 A;  1FVQ A;  4EBD A;  3IBC B;  4DV5 F;  1X4A A;  5G4D A;  2MQQ A;  1FJG J;  2CZV C;  3H5S A;  3IXQ A;  2AW0 A;  1TEL A;  3TUJ C;  2VG6 B;  2VFU A;  1RTH A;  4DF8 A;  4C98 A;  4JI6 J;  2Z2L A;  1N0V C;  2H5J B;  2W24 A;  3I0R A;  4V19 J;  8RUC A;  1S0O A;  1X4B A;  5AXN A;  3G6X A;  1HHT P;  4NWB A;  4J9U E;  3H42 A;  4MK8 A;  1X4H A;  5EWF A;  4UZB A;  3RW7 A;  2IBK A;  2QL5 B;  2RQC A;  4I4B A;  2F40 A;  4RNH A;  2CUY A;  3LQV A;  4CLT A;  4LBH A;  1F60 B;  3T5K A;  2BJ8 A;  4FVC A;  4PZV A;  4X4P A;  5IQQ A;  3RRG A;  1WEY A;  1UWA A;  3IWL A;  1ULR A;  3DLL Q;  1MMN A;  2ZE2 A;  2DPJ A;  4HVZ A;  3HJF A;  2YKA A;  2W4D A;  3BJY A;  3WHI A;  1SKU B;  1KR4 A;  2LQ9 A;  3C14 A;  2GVZ A;  4X2B A;  2AYB A;  1EQM A;  1ZM2 A;  2MQO A;  4Y3C A;  2XLK A;  2K3I A;  1WF1 A;  2PMW A;  2ROP A;  3QIP B;  4QOT A;  5C24 A;  1B7F A;  3BS9 A;  2FHJ A;  2WON A;  5IV3 A;  3M9M B;  4DPU A;  1DZ5 A;  1TKT A;  3D1H A;  2DNQ A;  2HVE A;  2W25 A;  2UXB F;  4JI6 F;  1Q8B A;  1R3N A;  3HVT B;  4NYZ A;  4OJ3 A;  4WKY A;  2HYI B;  1FXD A;  4PXE A;  4ANC A;  3ILJ A;  4EO6 A;  1P27 B;  3IP0 A;  1QUP A;  2GV1 A;  4OLO A;  5KG0 A;  4RR5 A;  4DX8 H;  4DZ6 A;  5KG7 A;  1PAE X;  3D28 A;  1GTH A;  2C2Z B;  3OFH A;  5KFG A;  4GC6 A;  2XM3 A;  2GVD A;  2KH9 A;  3UFC X;  4USH A;  3QT6 A;  1TL7 B;  2F5G A;  2RIL A;  3FZ2 A;  4QR0 A;  4OHX A;  1NDC A;  4RL1 A;  3LP2 B;  1HQE B;  2XMK A;  3ZFV A;  5C25 A;  1SI9 A;  3M7V A;  1SL0 A;  3H8Y A;  3HVR A;  4R5P A;  1J5O A;  5D0E A;  1HNX J;  1HPZ A;  2LXI A;  1C1B A;  3KG4 A;  1L3T A;  4ZVS B;  4RJV A;  4XTT A;  4H4K A;  3W2W A;  1S1X B;  3IO1 A;  3KTQ A;  2HFN A;  3MAA A;  1UW9 A;  3JSY A;  4P52 A;  1ZH5 A;  1RAB B;  3KUE A;  1RHR B;  2ROG A;  3KG1 A;  3FCH A;  3IN5 A;  1QAY A;  1TL3 A;  2E66 A;  1HR0 F;  4TQS A;  3D0I E;  1LW2 A;  2AJ0 A;  2FDN A;  2CQP A;  5IS2 A;  3JYT B;  3GV7 B;  2XSF A;  5BR8 J;  2M8H A;  3TA1 A;  1JLA B;  2NUH A;  3PHT A;  4ZJO A;  4A8Q A;  1RBL A;  1EHW A;  1OQ6 A;  1M1K T;  3QGI A;  3CJ2 A;  3M6W A;  1EP4 A;  3MED A;  2RHS B;  1LW0 B;  1QM9 A;  1VIS A;  3OTD A;  4J9L A;  3CVK A;  3M8Q B;  3R5J B;  2A6O A;  4ZDN A;  2L3M A;  2O01 C;  4F7V A;  1Z2Z A;  1MWQ A;  4ID5 B;  1M5V C;  4C8Y A;  2IIH A;  1RCX B;  3HSD A;  1CEZ A;  2Z2M A;  1FRJ A;  4OZ2 A;  4E98 A;  2QLW A;  4M5M A;  3TAQ A;  3BM7 A;  4X4O A;  1T02 A;  3POT A;  2ZEJ A;  5CA5 A;  2AF6 A;  1UVI A;  5LMN J;  5KFH A;  1EX8 A;  1HWI A;  3HD2 A;  3NWR A;  3W60 A;  8AT1 B;  5LXY A;  4ZHR A;  3GU0 A;  4IH6 A;  1VQ8 S;  2XEX A;  2NYH A;  2E9R X;  4JV5 F;  4F0M A;  1RAJ A;  4DPO A;  1YBT A;  1O5J A;  1N5S A;  4ZVO B;  4DCJ B;  3HT0 A;  4FS2 A;  3UCU P;  1K9M T;  1CVJ A;  3QSI A;  5D77 A;  5KFW A;  4LQ9 A;  2AYG A;  2BX6 A;  2MMY A;  3MF5 A;  2XUL A;  2J5A A;  3OFF A;  2NPF A;  4A8M P;  1U6B A;  2JLE A;  3HXM A;  2XYG B;  1N33 J;  1BQM A;  2CJY B;  1Q8K A;  2V50 A;  1S97 A;  3WZ0 A;  3N5F A;  1RAA B;  1VFJ A;  2C3U A;  4URS A;  1JKH A;  1TV6 A;  1LW0 A;  2RUG A;  3UCG A;  4OI0 A;  2Y8Y A;  1K1S A;  1RHQ B;  2FUG 9;  4IOB A;  5F9L A;  3TEG A;  3VAG A;  2CA9 A;  3O5T B;  1TK5 A;  1M5K C;  4EZ6 A;  2E5J A;  2HVZ A;  4TNO A;  5MLC V;  4QPT A;  3RR8 A;  3HF5 A;  1XBW A;  2EFO A;  2OD4 A;  1RYR A;  2MLY A;  1Y5I B;  3I6P A;  4IO1 A;  2XCP A;  1MN9 A;  2GZO A;  3MOZ A;  4KV8 A;  2W2P P;  2E7W A;  2PII A;  2Z56 B;  3G4S S;  1AUD A;  4Y2C A;  4FP9 A;  2M0G B;  1YJT A;  2QZ8 A;  4PYD A;  1RWN B;  4ED6 A;  4OI4 A;  5I3U B;  2KU7 A;  2L08 A;  2ZOG A;  3PG9 A;  3RYL A;  3ZZR A;  3OV7 A;  1HPZ B;  4ECS A;  1OY9 A;  1D9A A;  2KTQ A;  3T5J A;  3ZTO A;  4B3S J;  2H4W B;  1HNV A;  4WE1 A;  1NRK A;  1M5H A;  4KTQ A;  2M52 A;  4QBU A;  4L3K A;  1AFJ A;  1Y3K A;  3EYZ A;  1OMS A;  3PJW A;  4LFB F;  2FVP A;  1K1Q A;  4TLR A;  3Q2T C;  4EUV A;  2VZ9 A;  2GO8 A;  2E5H A;  2LU2 A;  4RUC A;  1WI8 A;  4ZLN A;  1SQF A;  2V2V A;  3QPI A;  3OXF A;  1Q86 T;  2V8V A;  3MM5 B;  2I5J B;  2HS4 A;  4F26 A;  2C2E A;  1N32 F;  1LXN A;  4UOF A;  3TA0 A;  3UR3 C;  1CJT B;  4Q0B A;  1O6X A;  1RSC A;  3AY0 A;  5LJ5 Y;  6AT1 B;  1NKB A;  2KXF A;  4DXL A;  3C3L A;  1G1X A;  4DQQ A;  2GMJ A;  4B02 A;  3RUB L;  2ZDP A;  1TKT B;  4G1Q A;  2W9B B;  3D3B J;  2CQ2 A;  2AD9 A;  2Y9H A;  4WYL A;  4DF4 A;  2QEX S;  1N36 F;  5MAO A;  1FRK A;  2HNY B;  1S6P A;  4O0N A;  2UVU A;  2KFN A;  3AJ2 A;  1VQM S;  3IS9 A;  4RX6 A;  1XR6 A;  2B9W A;  4B3S F;  1F5B A;  1XTZ A;  2VKZ G;  3AA9 A;  3DC2 A;  2NXE A;  4JP8 A;  1FDB A;  1R7I A;  4NRU A;  2ZE2 B;  4RUH A;  1DTT B;  3L95 X;  2W2O P;  1U1P A;  1U09 A;  3M8Q A;  3BO4 A;  4JI2 J;  1RU1 A;  3GG1 A;  5AJ3 F;  4DSK A;  4DR3 F;  3DRP A;  1S9F A;  4F0H A;  1QTM A;  4B3T J;  4UY8 5;  3ILO A;  3TUZ C;  5A76 A;  2JDJ A;  2QX0 A;  2W4C A;  1GEH A;  2MB0 B;  1WKL A;  2N4D A;  3GSD A;  4P7V A;  1V3S A;  1C0T A;  1PYT A;  2NSB A;  3UDE A;  3K5L A;  5D4N A;  4KBI A;  2VBY A;  1T05 A;  2VG5 B;  1PBA A;  2DNY A;  1YZ7 A;  5HLF B;  4QIF A;  2X1B A;  1DHM A;  3AA8 A;  3Q8Y A;  1UVN A;  2WVC A;  2CPJ A;  2OO4 A;  3RRK A;  3I0R B;  5E0O A;  3FBF A;  1M5S A;  4AFF A;  2MHE A;  2CPD A;  1WG4 A;  2YKN A;  1S4F A;  3EWG A;  2OP5 A;  1N4L A;  1I6J A;  2QMW A;  1QVF R;  4J7C A;  4R5P B;  4FYD A;  1VLO A;  3W2V A;  4FPR A;  1NO8 A;  5LSR A;  2V4R A;  4DFK A;  2DR5 A;  3KUH A;  4LR9 A;  5CD4 A;  3HFZ B;  4HAC A;  2XY6 A;  5I42 A;  4ERD A;  1FJG F;  1T9X A;  1SL2 A;  4OIX A;  5ETL A;  3SBM A;  1RUS A;  4C0B A;  3KLV A;  2OGU A;  2RUS A;  3GWC A;  4ECY A;  1FI4 A;  4DUY F;  2AEF A;  1UCN A;  5D0R A;  2R9L A;  1S6U A;  2UVV A;  3TAM B;  1UVJ A;  3WX4 A;  4DEZ A;  1HQE A;  2VA3 A;  2XS2 A;  3FDS A;  2RB7 A;  3MM9 A;  2XB2 D;  4ZJL A;  2IYI A;  4CYU A;  3BO3 A;  1K47 A;  2V8D A;  4G65 A;  1KKH A;  2YWG A;  2ZVS A;  5HQL A;  3VVT A;  3P45 B;  2HG4 A;  2KI2 A;  2YKP A;  5EX0 A;  1SC1 B;  4HHU A;  3CXC R;  2NR0 A;  3M32 A;  2PDA A;  1UVK A;  1BQN B;  5FLX Y;  4BLG A;  4QIV A;  2XI2 A;  2MLX A;  1L3V A;  1VQL S;  2C2O B;  1MW7 A;  5F3Z A;  2PA3 A;  4ZIW A;  1R0B G;  3OLB A;  3HCX A;  1VRQ C;  3QIP A;  4DSL A;  2OEK A;  3CJT A;  5KFY A;  2FJV A;  2JEF A;  1HAR A;  3CUN A;  5HRO A;  2GVZ B;  4ZLJ A;  2DR8 A;  3W64 A;  3P49 B;  3W1Y C;  4FPI A;  4ZLP A;  4JI1 J;  4G1P A;  4LF5 F;  3QT5 A;  3PX4 A;  1RWK B;  1JLA A;  2CQH A;  2RH3 A;  3D54 A;  3GYX B;  3HVW A;  4ZVF A;  4Y00 A;  1KTV A;  4ED1 A;  5ETR A;  2HFZ A;  2PFD A;  2N4C A;  2IVM A;  3LGH A;  5F0U A;  1UEU A;  1NK7 A;  1ARO P;  2OEL A;  3PYD A;  3CJ5 A;  3ENV A;  1T94 A;  3QAT A;  3MCO A;  1UZD A;  5HMW A;  3Q22 A;  4H4M A;  3KK2 B;  1RLC L;  2RE1 A;  4IFV A;  4JI0 F;  2X3G A;  1TAQ A;  3DDN A;  4M95 A;  2CIM A;  2VU5 A;  2YWK A;  3DGP B;  4K4U A;  4LVO P;  4P72 A;  4KGM A;  1YI2 S;  1RAE B;  4P73 A;  2EG1 A;  1VQK S;  3T19 A;  2VV5 A;  4MJK A;  1LWE B;  5HAO A;  4C8L A;  2CDQ A;  3VGV A;  3CDE A;  1YTY A;  3GB0 A;  1DQ9 A;  5D8H B;  1Y7P A;  3CGI A;  2D3O R;  5D3G A;  2IM3 A;  4WIQ A;  1KD1 T;  2RML A;  3DRS A;  1FCA A;  1RAH B;  2RS2 A;  1PJ5 A;  2VG7 A;  4GRS A;  4RUB A;  5U47 A;  2W4P A;  1JIH A;  1R8A A;  2F7V A;  4P6Q A;  4QU6 A;  1I3O B;  1O8B A;  4PUO B;  1TMM A;  3KMS A;  2DNP A;  5IZH A;  5DLG A;  2ZDO A;  2EFP A;  1CQN A;  2LA4 A;  2QLB B;  1TKZ A;  2HHW A;  3L3C A;  2CZ9 A;  2AGO A;  4KHP J;  1UWB B;  2HRY A;  1U47 A;  3EXC X;  3QO9 B;  3MUR P;  4MT1 A;  1FEE A;  1W26 A;  4KO0 A;  4AXI A;  2YX1 A;  3MTK A;  2G13 A;  1RWM B;  3QNW B;  5T14 A;  4URQ U;  5J2Q A;  1KSP A;  2UUB J;  1DAX A;  2CG8 A;  5K9F A;  4IRC A;  2ZH8 A;  1JB0 C;  1VRU A;  3FC9 A;  5F8H A;  3PW0 A;  4B3T F;  2OTJ S;  5CH7 B;  1K8A T;  2DEI A;  2NXN A;  1CC7 A;  4H4M B;  4C8M A;  4CLF A;  3KK2 A;  1B7Y B;  1DUR A;  3QT8 A;  4F67 A;  1NJY A;  2AP6 A;  2H3E B;  3CO9 A;  2XGQ A;  4EZ9 A;  1HQU A;  3GR0 A;  4I6Y A;  4PWU A;  3OHB A;  4DSJ A;  5EN1 A;  3PYF A;  2VBW A;  3K58 A;  4DV7 J;  3NGT A;  4ZN1 A;  4B9L A;  3U1M A;  4GO5 X;  4KHP F;  5AE2 A;  3EGZ A;  4LJM A;  4OV1 A;  4I7F A;  3FEZ A;  4USJ C;  1P8G A;  1IJF B;  1FRM A;  4YS2 A;  2KXN B;  4DR5 F;  4LF4 F;  4DR7 J;  1P6T A;  3R6G B;  4ITS A;  4P10 A;  2CQ1 A;  1NDL A;  4P75 A;  4RKU C;  4RW6 A;  3W66 A;  2CJX B;  3MXH P;  4JI2 F;  3RAM A;  2W2M P;  4KB7 A;  1HD0 A;  3T1H F;  2B5J B;  2K06 A;  2ZHB A;  4BC9 A;  2HLU A;  4C48 A;  3KLG B;  3D6T B;  4ILR A;  1MRO A;  3DOL B;  3KWM A;  3OQ2 A;  3SDE A;  2HQD A;  4TY8 B;  9ATC B;  1SJ4 P;  1R8H A;  4NOH A;  4NA1 A;  4AND A;  2JJ4 D;  2QG9 B;  2I6W A;  4DU7 A;  5KFO A;  1B99 A;  1OWX A;  1WAC A;  3RAX A;  2CPE A;  2LKZ A;  3W7B A;  4CYU B;  1G4C A;  1S7I A;  3DOM A;  2ERR A;  4UUX A;  2IRU A;  2YWW A;  2CJB A;  4HH0 A;  5HBM B;  5IC4 B;  1B70 B;  2EXU A;  3RBZ A;  4JI0 J;  2G0J A;  1OJ4 A;  3OTO J;  1RK8 A;  5DQG A;  4XPE A;  3GIL A;  3EPI A;  2I38 A;  3C2P A;  2XS5 A;  2IC3 A;  2V8G A;  3K89 A;  3NY0 A;  2L9N A;  3MPU B;  3NBP B;  3R6L B;  2FGC A;  3M4X A;  1WC3 A;  2ZD1 B;  3DDI A;  3QGP A;  2ZKU A;  3PDN A;  1U0H A;  4KRW A;  4JI1 F;  3PAC A;  4DOZ A;  3CB4 A;  1U02 A;  3CWJ A;  2JC0 A;  4L3N A;  3RAQ A;  2N3L A;  4LF8 F;  1PYS B;  1QSS A;  1VHF A;  1WJ9 A;  2HRT A;  2YQ0 A;  2DNH A;  2WVE A;  2F65 A;  3MZI A;  4ZPW R;  4JI8 F;  3J7Y I;  1HWU A;  4OFZ A;  2ZJP Q;  2KM8 B;  2B6A B;  5LJ3 Y;  2DGU A;  3VAK A;  3NAI A;  3RB3 A;  3KJQ B;  2EVZ A;  5D0G A;  2J8A A;  4YOE A;  3DHX A;  5FII A;  2P2C B;  2RDJ A;  3R5C A;  3FSI A;  1RT1 A;  3CC4 S;  1IN0 A;  4EWT A;  3CCU S;  4QJV A;  2BRK A;  1LFW A;  2MLZ A;  3EIC A;  7FD1 A;  2UUC J;  1LK7 A;  2OPQ A;  1FER A;  1HHS A;  5IT4 A;  3GG0 A;  4NZ6 A;  2CJK A;  2RIJ A;  2L9W A;  4B3O A;  2BA9 A;  3L09 A;  3MUT P;  3MFH A;  2ZH1 A;  4U9R A;  2G2O A;  1S6Q A;  2CQ4 A;  4XIU A;  2MKI A;  5DLF A;  2ZJR Q;  1U1O A;  2FPH X;  3IR6 B;  3VQT A;  2C3O A;  5LSO A;  2NYI A;  1HNX F;  1F6T A;  1WSV A;  2G1H A;  2CQI A;  3FQL A;  5J1P A;  2OPQ B;  3GFZ A;  4NZ0 A;  4DUZ J;  2O5D A;  2P5V A;  3AD8 C;  5CYQ B;  5BR8 F;  4O3R A;  3LPE A;  4CP5 A;  3BKF A;  3B4D A;  4ED3 A;  4IOC Q;  3N6N A;  2F8H A;  3DXS X;  2DNN A;  5ETK A;  4K2X A;  1SH2 A;  2H54 B;  2MZR A;  3U02 A;  2PA8 D;  1RA7 A;  3VGS A;  2POK A;  2DY9 A;  4M5D B;  3V6J A;  5J2N A;  4V19 X;  2IDL A;  3SCJ E;  1HWK A;  4OJH A;  2BJ1 A;  1DBD A;  3AOB A;  4NEZ A;  3J7Z 5;  4DS4 A;  4OZ5 A;  4O3N A;  1RT3 B;  2A6M A;  1T7P A;  3DN9 A;  4U7U K;  2R8G A;  5HSP A;  2BJD A;  5E33 A;  1VRT A;  3QJP A;  1FK9 A;  1GNK A;  1RTZ A;  4NLX A;  5D4P A;  4HYK A;  3V6H A;  1KFS A;  4KKO B;  3PRV A;  2BAC A;  5L8R C;  5DM6 Q;  5IV4 A;  3MCN A;  2A0F B;  2CVI A;  3R5B A;  4HT5 A;  1XMQ F;  1S7H A;  3FEY B;  2JX2 A;  1RAO A;  2IC3 B;  1F5C A;  4U67 Q;  1SKS A;  4B9V A;  2FY1 A;  2R7R A;  2C3P A;  3NCR A;  4URG A;  3MEK A;  1B0T A;  3L7O A;  1RU2 A;  2YBV A;  5DDQ C;  3GSI A;  5G0R A;  1JLG B;  5L9N A;  1G7C B;  2QA2 A;  3DRP B;  2YXL A;  1OIA A;  1X5S A;  4LR8 A;  2C22 A;  1RWU A;  2IAJ B;  1A0O B;  1GXU A;  4WFX A;  2M2B A;  2HS3 A;  2MKK A;  3QLH A;  2YNH B;  3R5A A;  5AE3 A;  2D69 A;  5F8I A;  5DGB A;  3LP1 B;  4R25 A;  2IY5 B;  3H5Y A;  2FJE B;  2QGF B;  1S59 A;  3KG0 A;  3GON A;  1R8C A;  3M8W A;  4KH0 B;  1FFS B;  1T03 B;  4RW7 A;  3QFH A;  1XNR F;  1URR A;  1BMQ B;  3MMC B;  4EFA C;  3LH2 S;  1KQS R;  1CLF A;  4ZVG A;  1GXT A;  5KFV A;  4WCE Q;  3Q8Q B;  3E2E A;  5GMK a;  3IC1 A;  3N28 A;  3NRB A;  4MK9 A;  3BDE A;  4X65 F;  1SQG A;  1NK0 A;  2XWX A;  2DRA A;  1IM6 A;  2GFF A;  2OMO A;  3TAP A;  4LSN A;  4NYO A;  3KJF B;  2FJA B;  1RQ0 A;  5IM0 B;  1U7L A;  3OL8 A;  3V6D B;  1YG0 A;  2HGL A;  4CLK A;  1TZ0 A;  2M9K A;  1HWJ A;  5CCL A;  2WW4 A;  2A2C A;  3KK3 B;  4A8S A;  1U48 A;  3EGV A;  2XMT A;  3I87 A;  3UE2 A;  3TO8 A;  3A8K A;  2HW3 A;  3KLI A;  1HNI B;  4MKV A;  1WHW A;  2HBQ B;  3IM9 A;  1Y11 A;  2B51 A;  3D6F B;  4X62 F;  2XI3 A;  1MLA A;  1TUW A;  2DGO A;  4IQX A;  4DR5 J;  4DR7 F;  2IYG A;  2MKC A;  3TEH B;  1HKA A;  4OYA A;  4BDP A;  1RAI B;  4X4V A;  2DO4 A;  1KWM A;  3UCZ P;  2EFG A;  2VON A;  3CJK B;  2CNL B;  1N34 F;  4LF9 F;  2H4Y B;  4G6V B;  4O4R A;  3QO9 A;  3HHN B;  1IBK F;  2I9S A;  1HL6 A;  3NAH A;  3FK4 A;  2BQR A;  2DR9 A;  4F8R A;  2XCA A;  3HHL D;  4O0I A;  1IQZ A;  2YNF B;  3DKD A;  2R7W A;  4WKR A;  1S9E B;  1IBL F;  4MKY A;  2H5I B;  3K7R A;  1FRI A;  2ZHO A;  4RW4 A;  4ZPB A;  5D6G A;  4WFZ A;  1YRX A;  1F9E B;  2P9C A;  4NCG A;  1MU2 B;  2IM2 A;  3MPW A;  4K4V A;  3TAR A;  3MPD A;  4JV2 A;  3DRS B;  1HIY A;  4AYB D;  1WTF A;  3TRG A;  1B0P A;  3MPV A;  1VIX A;  3R27 A;  3DMJ A;  5C25 B;  1CJV B;  2NSC A;  4U96 A;  4A8K A;  3NCQ A;  4I2Q B;  4KGV B;  5KG2 A;  2DHA A;  3E01 B;  2GHW A;  1IBC B;  1WI6 A;  2Y0B B;  3LW5 C;  2J0X A;  3A3N B;  5ETN A;  1H2V Z;  3DGP A;  5A6W A;  4UQG A;  5LMU J;  1S10 A;  1EIY B;  1FRH A;  2H48 B;  1UFL A;  4FBU A;  1BC6 A;  1NXI A;  4YB1 P;  1HW8 A;  3QSY B;  1DTQ A;  3L9Z A;  1GX5 A;  3LWM A;  1XR7 A;  4GKJ F;  2GS8 A;  1KVK A;  3HVT A;  2HVH A;  1CS4 A;  5KFI A;  1A7G E;  1YJV A;  3M30 A;  2CQB A;  4F4Z A;  1RWW B;  3IWN C;  2XNQ A;  2DRB A;  1T8E A;  1HBU B;  2GGP A;  4RUA A;  2Z2Z A;  2XSJ A;  4CH0 S;  1KLM B;  3CDW A;  4YY3 F;  2YNG B;  1E6Y A;  3A4T A;  1RHJ B;  4P7T A;  2OML A;  3V2U C;  3VVU A;  4MMO A;  2ZM6 F;  4CO1 A;  4A8F A;  1U1L A;  2HHH F;  2OSR A;  2ASL A;  1EZZ B;  1NU4 A;  3FVY A;  3Q8S B;  2Q66 A;  2FZC B;  5C7P A;  2G9O A;  4OLP A;  2J6U A;  4RNO A;  4DL3 A;  3PX6 A;  4DUY J;  4ELU A;  3LAN A;  3BH6 B;  1NJX A;  2EFV A;  2DIS A;  2C2M B;  1QUV A;  3LF0 A;  1U25 A;  4R0J A;  1F1B B;  1REV A;  4DPT A;  1N48 A;  8ATC B;  3SQO P;  5IM0 A;  2QC3 A;  2CPY A;  3BRE A;  3MEC A;  3JQJ A;  5FD1 A;  3T1A A;  3KHG A;  4E0D A;  4K4Z A;  4OJG A;  2BBE A;  2GJI A;  4PG8 A;  4QR1 A;  3T6B A;  4NXM F;  1FFG B;  1SPB P;  1ZM4 A;  4ZPV R;  3G6V A;  2FJW A;  3VTI A;  3ZTR A;  4OYX A;  1S1W B;  2WVD A;  4C6A A;  3I56 S;  1T9V A;  3KHH A;  1H98 A;  2ZVI A;  5KFR A;  1UP1 A;  3DRX A;  1A6L A;  1TTH B;  1D9F A;  4WPA A;  5K14 A;  4C4W A;  4CO0 A;  2VJV A;  2AJQ A;  2EPI A;  4OMF G;  1AT1 B;  1NB2 A;  4NLO A;  2DNG A;  1FE4 A;  4ZCM A;  3T6J A;  3C66 A;  5F41 A;  3OR1 B;  5HK4 A;  3UWT A;  3NLC A;  1KRP A;  1XQI A;  3R2D J;  2J7W A;  3CTR A;  3KK1 B;  1UTA A;  3NGU A;  2AJF E;  3MFI A;  2BOA A;  4KGZ B;  3IAS 9;  1SIW B;  4KIA A;  4RZR A;  1N36 J;  2I1R A;  2ZFH A;  4U7C A;  4DG1 B;  4QR2 A;  1VIO A;  3I5B A;  3M2V B;  5CYJ A;  3BSO A;  2MXY A;  2J9D A;  4QZV B;  1ZM9 A;  4ZA1 A;  1RTJ A;  2DHG A;  2GQC A;  2OKQ A;  5L38 A;  4DV3 J;  1B3T A;  4F3O A;  4B9S A;  3H2U B;  4X64 J;  1XNQ F;  3V4I B;  1GQE A;  2V2K A;  1IWG A;  3DLG A;  2FGO A;  4OHV A;  2O67 A;  2DHS A;  5KFM A;  4DL7 A;  2R7S A;  4C11 B;  3CJR A;  4O3Q A;  1S9G B;  5J1E A;  1RT3 A;  1AUS L;  2XSJ B;  3MEE A;  3K5M A;  4B9M A;  2HNY A;  3IR5 B;  3RGI A;  3UDC A;  1NSK L;  2J8S A;  4DPY A;  1SKW A;  2HNZ A;  4KAI A;  2EBE A;  2DNZ A;  1NZ8 A;  2AJ1 A;  3TZW A;  3VGU A;  4CT9 A;  2Y1J A;  2M4M A;  2XWY A;  1HBM B;  3NGD A;  2MYF A;  1FO1 A;  2MQM A;  4UZC A;  4JI7 J;  3LUY A;  3MGJ A;  5SZT A;  4JI3 F;  2VG6 A;  1KQF B;  4ICL B;  2MGZ B;  3IAM 9;  2HIQ A;  2WAQ D;  4R8U A;  2M70 A;  1YHQ S;  4HDG A;  3R7N B;  2X1G A;  3SXL A;  4P2X A;  4HT7 A;  5D15 A;  5LXR A;  2W7P A;  3N6L A;  5GAG I;  3VV2 B;  2YTC A;  4DUT A;  4PAB A;  4J9S A;  2YNI B;  3I82 A;  3T1Y J;  2AYE A;  1SCJ B;  2NS1 B;  4MFB A;  3JSM B;  2B8Q A;  2WB4 A;  4YP3 A;  4J5O A;  3ET6 A;  3ZZ0 A;  2HQC A;  4ECU A;  1HI8 A;  4Y2M A;  3R2C J;  2ADC A;  3DM2 A;  2DH8 A;  2XZD B;  3I9Z A;  3D4J A;  3OVB A;  6FDR A;  1N54 B;  4USM A;  5H1S V;  5J2P B;  7AT1 B;  1EKR A;  2JOQ A;  3TZY A;  2GQQ A;  3SFU A;  3TZX A;  3KHR A;  5GAD I;  4RW4 B;  1RWV B;  3HSG A;  3O6Q A;  4NI2 A;  2MKJ A;  3WBZ A;  2WSC C;  1JJ4 A;  1Y5N B;  3AB2 B;  4NYP A;  2NXU A;  5JVH Q;  1I94 J;  4OYP A;  1VK8 A;  2E1M C;  3FFI B;  5C2G A;  3UQS A;  2HBY B;  4YR0 A;  1V6H A;  1KHW A;  2OPS B;  4UOG A;  4X4S A;  2RRA A;  1NKC A;  3OFE A;  1JLQ B;  3CC7 S;  3PRD A;  2PFF B;  3AJD A;  1RBO B;  2B7C B;  5A0Y A;  5EDW A;  1TV6 B;  3OW2 R;  4K50 A;  1NHV A;  5F3T A;  2N82 B;  5KFN A;  4DV6 J;  4QWC A;  4DLG A;  4DQP A;  1AZS A;  2EWH A;  1HYS A;  4GVB B;  4CO3 A;  2W7O A;  4F2S A;  4Y2A A;  3FEX B;  2PGC A;  3MMA A;  2BR0 A;  1NDK A;  2YKQ A;  5J2N B;  4DFM A;  1SB6 A;  4WII A;  1IKX A;  2D3Z A;  3DNC A;  1N52 B;  3Q23 A;  2M7S A;  4MH8 A;  1UVM A;  4DL4 A;  1FES A;  3I4H X;  2D3O 1;  1HNZ J;  4KFB A;  3TX0 A;  4RBV A;  4P71 A;  2CKW A;  2VPY B;  1UA0 A;  3NNA A;  3P96 A;  2HVI A;  3E3X A;  1BQX A;  5DQI A;  1PG5 B;  3AOD A;  3A3O B;  4ZPT R;  4X4T A;  1VBK A;  2A10 A;  2RSQ A;  3Q86 A;  1VQN S;  5A8W A;  2YY3 A;  3F41 A;  4X84 A;  6FD1 A;  2ZHA A;  4J9M A;  4OHY A;  3G8T A;  4WFY A;  1H3D A;  1KP6 A;  2ACY A;  3FSX A;  4B3R J;  1R31 A;  4UUW A;  1X4D A;  5K8O A;  4B3R F;  3KJV A;  4J9K A;  2W8K A;  1FD8 A;  1XIQ A;  1RCO B;  5GAE I;  3QFW A;  1RWO B;  2VC0 A;  2MJN A;  2R4F A;  3LA0 A;  1WEX A;  2RF2 A;  5KG1 A;  2LEB A;  1ROF A;  4DU8 A;  1HFE L;  4K59 A;  3JYT A;  4ECZ A;  3KMQ A;  1IKX B;  1HQU B;  3DCA A;  1SL1 A;  2HUR A;  3EZU A;  3FQK A;  3RJM B;  1Z2L A;  2BE7 D;  4USU A;  1N5T A;  4GKK F;  3BSA A;  1FWL A;  4N47 A;  5DRK A;  5F9N A;  2IJF A;  1SJ3 P;  3SCK E;  1D0E A;  2MZS A;  3WX8 A;  4DMZ A;  2C42 A;  3V4I A;  5J1N A;  5A6P A;  2E1R A;  4AQY F;  5L1J A;  4IRD A;  5M2U A;  1RT4 A;  1L3U A;  1PC5 A;  2LFV A;  4WXO A;  5ETP A;  4KKO A;  4USV A;  4ZCL A;  2BMB A;  4C3K A;  3OVA A;  2X1A A;  3CDB A;  1R6Y A;  2F9J A;  5C42 B;  1S79 A;  3S8S A;  4DV1 J;  3I4P A;  4WU3 A;  4DS5 A;  3US5 A;  2E1P A;  4OYZ A;  5ETO A;  4ED8 A;  2ADB A;  1T11 A;  3GYG A;  1X4C A;  3THT A;  3V5R A;  4M5H A;  4WP8 A;  1X60 A;  5THW A;  1C2P A;  4ILM A;  5LM7 E;  2WTF A;  1NSP A;  2GVD B;  2J0W A;  1ACM B;  2B7B B;  1BE4 A;  3MMJ A;  1RTI A;  4OX7 A;  1KHV A;  4TKT A;  4FBT A;  2MZT A;  2X51 A;  1OO0 B;  4OX8 A;  2U2F A;  2ZWO A;  4L73 A;  3PJX A;  4ZVR B;  5KAK A;  1HMV A;  4RNM A;  2NZC A;  1NAQ A;  4DQR A;  1OYD A;  4HH1 A;  3B6B A;  2QA1 A;  4U8Y A;  3VAF A;  4CDI A;  5D3G B;  4LF4 J;  2BZ2 A;  1FJC A;  3RBD A;  1IJE B;  3RBX A;  5HMX A;  3J80 U;  4AL6 A;  3OSP A;  2QIF A;  1NJI T;  3F73 A;  3D5M A;  3MUV P;  1TUV A;  2IHR 1;  1S1V A;  1S6Q B;  3M2R B;  4FXV A;  2MSS A;  3ZZU A;  4IG0 B;  1Q95 G;  1RHK B;  5KT6 A;  3M8S A;  2G4B A;  1NEE A;  4R8U B;  5H9F J;  1J5E J;  1REV B;  4UST A;  4UF4 A;  3GZ7 A;  4ZCK A;  3KLF B;  4B9U A;  2RQK A;  3W65 A;  3VZH A;  1PAU B;  1FTR A;  1RT1 B;  4LIR A;  4DL2 A;  5L46 A;  3TZZ A;  1HHQ A;  1LNQ A;  1RLD A;  3D7S B;  4PPD A;  3HDS A;  3ZTS A;  3MMA B;  2XY5 A;  1IM4 A;  4OI2 A;  4LRC A;  3BN4 A;  1RB0 A;  2KRB A;  2WBM A;  1FJ7 A;  1KOO A;  3HJV A;  2XMU A;  1IKW A;  1S9G A;  4FKX A;  3FZB A;  4CTA B;  2E1A A;  5K8M A;  1Q8I A;  3CMQ A;  5A8K A;  5F8G A;  1IKV B;  3ZC4 A;  3ILL A;  3D0H E;  5AXM A;  1RHU B;  1PBU A;  1TKX A;  1U0H B;  2MZQ A;  1IWA A;  3FNN A;  4J9Q A;  1ZAV A;  5KT2 A;  2CJ9 A;  3UVJ A;  2UXD F;  2CQD A;  4ENO A;  1C0U B;  3UDL A;  4JI5 F;  1ZZN A;  3FKB A;  2RNE A;  4LRA A;  1JLF A;  1KEK A;  1IBM J;  1K44 A;  1MWY A;  4NI2 B;  1W25 A;  2RKI B;  4P9S A;  4RPF A;  1JWW A;  5B08 A;  3MUM P;  3EE3 A;  3FGV A;  3OTC A;  5HBM A;  4LFA J;  1TK8 A;  4FYV B;  1LWF B;  2GJ2 A;  4NMX A;  4M63 A;  1NPP A;  4LBP A;  1GH8 A;  4EI2 A;  3M6X A;  3MM9 B;  4K2J A;  3SQG A;  3UO0 A;  5KFP A;  1ITP A;  2PC6 A;  4CI0 B;  1RTD B;  1MMD A;  3ET6 B;  1TMJ A;  2ZH7 A;  3VAI A;  4F4Y A;  4YEA A;  1OPZ A;  2RJZ A;  2UVR A;  4RBT A;  2DGW A;  1TKD A;  2P9E A;  2XMM A;  2DGQ A;  4TY8 A;  3J7A 1;  1W2B R;  1SC4 B;  1H72 C;  2JL9 A;  3PR5 B;  3QRR A;  4HAC B;  4NLQ A;  3CT9 A;  2MY8 A;  3EVO A;  4NCG B;  5KOX A;  3Q83 A;  1UPP A;  4RW9 B;  4F0K A;  4Q2M A;  2B8P A;  2LXU A;  3FCW A;  1NK4 A;  3CD6 S;  2JH3 A;  1WHY A;  2QLJ B;  4NLU A;  3TVK A;  3CIM A;  4DR2 F;  1SJ1 A;  4USW A;  2R42 A;  2HWT A;  3DYA B;  3NCP A;  4ZS6 A;  4F36 A;  3HVA A;  1YWX A;  2J0S D;  4M94 A;  2EK6 A;  2CQG A;  2MQL A;  2LXF A;  4IH5 A;  2U1A A;  1X4F A;  4TXS A;  2OIH A;  3AFG A;  3BGR A;  2QSW A;  4XO0 A;  3CJK A;  4X66 F;  2V94 A;  1NZA A;  1JJC B;  4GO7 X;  2ALZ A;  2KFZ A;  2DHX A;  3BPS P;  3MR5 A;  2B56 A;  1VK3 A;  4JB8 B;  3THV A;  2C2R A;  1NK9 A;  4J9V A;  3VWS A;  2VIC A;  4C8O A;  1WDD A;  5DDO C;  3NWG A;  4CWB A;  2R7X A;  3CC2 S;  2QA4 G;  1RYS A;  2R7V A;  2VL1 A;  2WK4 A;  2D3U A;  2R7Q A;  1E6Y B;  5GVQ A;  2GX8 A;  2FTR A;  2J9E A;  3Q2S C;  1SQE A;  3O2I A;  3DLB A;  3I5A A;  1JLB B;  5KG3 A;  4K4T A;  2MHN A;  3KK3 A;  1Q8L A;  2F63 A;  5CQG A;  4QYR A;  2PN6 A;  4OYB A;  4CCH A;  5DM7 Q;  2C3M A;  2KVI A;  3ETO A;  4Y2I A;  1Y10 A;  3W8G A;  1I5O B;  1KBR A;  2RRB A;  3OR1 A;  2EI5 A;  2I5J A;  4ELV A;  2DGX A;  2CRL A;  2C28 A;  2PI4 A;  4QWB A;  4PRF A;  3JAM Y;  1U8S A;  2Y8W A;  4X66 J;  1VR6 A;  1FD2 A;  2YWF A;  2EKY A;  4KY3 A;  1VCT A;  4RLE A;  3DRR A;  2ZKT A;  3MMC A;  1Q7Y T;  4J90 A;  5I42 B;  1WWH A;  2XZW A;  1GMV A;  4NXN J;  3BZQ A;  2CPX A;  3M8P B;  4OZN A;  2DK2 A;  2ZM6 J;  2AQ4 A;  4WZQ A;  3GJQ B;  4N7T A;  1CPZ A;  3BPD A;  3ZTQ A;  2HHU A;  3BGU A;  4DV0 J;  2BUN A;  2X3D A;  3EDQ B;  4ZPC A;  1QSY A;  1MML A;  3TJA A;  4Q44 A;  2FZG B;  1UJ4 A;  1WG1 A;  2W01 A;  4CO5 A;  2JEG A;  2E9T A;  1UA1 A;  1TK0 A;  2D1C A;  1S49 A;  1FDA A;  3TW0 A;  4KT0 C;  3ENA A;  3HHE A;  4J9R A;  4WTY A;  2HAF A;  5AE1 A;  5KFT A;  2XO6 A;  1HD1 A;  2IA0 A;  1QAI A;  2MQP A;  2HQG A;  4QW9 A;  4QU7 A;  1XMB A;  2E5G A;  1N0U A;  1Y00 A;  3CCR S;  5CYM A;  3QWU A;  1IKV A;  2F4F A;  3PFE A;  4I2P A;  1P1L A;  2BKN A;  2YNG A;  4I6W A;  5A8K B;  4QWE A;  3PW7 A;  2FLL A;  3R3T A;  2UUB F;  1U1K A;  5DDR C;  1NH7 A;  4ANE A;  1N34 J;  3LP0 A;  4O44 B;  1SXL A;  3WDO A;  4A4J A;  3GV8 B;  1IKY A;  2IVY A;  4L6V 3;  3SEO A;  1HI1 A;  4DV4 F;  1KVI A;  1FWP A;  1ZOT A;  4GMK A;  3H4B A;  2YKO A;  2HZA A;  4OX6 A;  1RAC B;  3PIP Q;  2KFY A;  1D09 B;  1YJ9 S;  2BAN A;  1FXR A;  4LT6 A;  1GT8 A;  3SSQ A;  3F56 A;  1LOU A;  3A13 A;  3DFE A;  1ZPV A;  3DLJ A;  1QDU B;  2DT9 A;  3OTE A;  4NLS A;  1FF2 A;  3KLF A;  2HFS A;  1KS2 A;  3EVW A;  3GMG A;  2KN4 A;  1FX2 A;  1BUX A;  1S1T B;  1E6V B;  3ONQ A;  1NLK L;  2E7V A;  1S0M A;  4N56 A;  3T5L A;  2ATC B;  1WDT A;  3E01 A;  5KFC A;  1X0F A;  2HLT A;  3BYP A;  1HLW A;  2ZBP A;  5L9X A;  4KGK A;  2HK3 A;  1XMO F;  2NQP A;  5ETM A;  2VD3 A;  2R8H A;  2X7I A;  3T5H A;  4YQW A;  4WE1 B;  1U4B A;  1N33 F;  3LOU A;  1TL1 A;  2FYX A;  1G2E A;  3T41 A;  2B4V A;  3ZO7 A;  5I3U A;  1UL3 A;  4LSZ B;  3MOJ B;  4ZMM A;  4NLT A;  2UP1 A;  2RDD A;  4AUK A;  1OSC A;  3IBF B;  5DZ6 A;  4X4U A;  1S9E A;  1WC4 A;  5KFF A;  4DV2 F;  3HHL B;  2YNF A;  1GFW B;  1YZ6 A;  2WZ1 A;  2QN6 B;  5E3P A;  3G96 A;  3IM8 A;  4DCO B;  3J7Y U;  3RBE A;  2O1P A;  4GKK J;  4HL9 A;  2I8E A;  2VG5 A;  2RRN A;  1D3W A;  1HWL A;  4NE9 C;  5EHH A;  5HLF A;  1RT7 B;  2BQ3 A;  4IR9 A;  1DQA A;  3ENW A;  2BM1 A;  3H2V E;  1S1X A;  3PVX A;  3I31 A;  1J27 A;  3Q8R B;  1CUL B;  4LSL A;  1R0A B;  1Q1K A;  2DR6 A;  2LLZ A;  1FWK A;  3CIZ A;  5GMD A;  1X5P A;  3FSY A;  3NBP A;  1OYE A;  2OEM A;  5F8J A;  5KFU A;  2P6S A;  4AQY J;  5KFL A;  5AXL A;  2IM1 A;  1AB8 A;  2IMO A;  1J5O B;  3NXZ A;  4RWX A;  2CWK A;  2JEJ A;  4B3M J;  2FZK B;  2ASY A;  1C4C A;  2GW8 A;  4F3Q A;  2V8H A;  1NK5 A;  1T9U A;  2K7K A;  2JLG A;  1H7W A;  3EZO A;  3GCW P;  2VQF F;  3EPG A;  3BSC A;  3LO3 A;  1HNW F;  4NLY A;  2AU0 A;  3EM1 A;  3ZZP A;  1YIJ S;  3IGV A;  4P2F A;  4JYA F;  1RHM B;  3GFH A;  1SIZ A;  3M05 A;  1LWX A;  2LEP A;  2VPX B;  1OQ3 A;  2VKR A;  1FDN A;  2XYH B;  3ADA C;  2CDR B;  5FLX U;  4RNN A;  5KT3 A;  3MM5 A;  2DXF A;  4ZJQ A;  2VBX A;  3FJ2 A;  2COL A;  5IQ6 A;  1X7V A;  3DOK B;  4C2M A;  2JVO A;  4O44 A;  4TU9 A;  1JMT A;  4C8Z A;  4UOH A;  1JNR B;  2HHQ A;  3J81 j;  2XGP A;  2DNK A;  2Q43 A;  4H4O B;  4WFA Q;  4OX9 J;  1QD1 A;  5H9E J;  3L7P A;  4DV6 F;  3DLE B;  4MIB A;  4KHR A;  4USK A;  2VQF J;  2FJD B;  2YX4 A;  3VHQ A;  2NUU G;  2N3O A;  4QCL A;  3D66 A;  1RXO B;  2KKH A;  3CMA S;  4DV2 J;  4F04 B;  2K7J A;  1VS3 A;  4PWW A;  3LGM A;  4AL5 A;  1BGX T;  4EU0 A;  1LXJ A;  2DVI A;  3HD1 A;  5IOL A;  2QYC A;  2WOM B;  1RT5 B;  2DGV A;  1YBA A;  2NCK L;  5KFA A;  5K8P A;  1WD6 A;  2IMW P;  1XER A;  5KOW A;  3E8O A;  2DGS A;  4J9P A;  2Q6B A;  1D8Y A;  3BB5 A;  1H73 A;  1RTH B;  3AD9 C;  1UET A;  5B0D A;  2ATL A;  1WOO A;  4X4N A;  2RS8 A;  4A8X A;  2QYG A;  2GAG C;  3M2U B;  4PWD A;  4OZL A;  4IUF A;  2AYM A;  2Y0S D;  1DLO B;  3AOA A;  3NNC A;  2AMC B;  1VC5 A;  2FD2 A;  1V3Z A;  1VLY A;  4C0H A;  3CCJ S;  5JVG Q;  4DR2 J;  5D78 A;  2CPZ A;  3TQE A;  2BW7 A;  5FJ4 A;  1BWE A;  1GXL A;  1WF0 A;  3C6U A;  4C3M A;  4CO4 A;  4LFA F;  5GME A;  3SFG A;  3B78 A;  2ZBI A;  1WKJ A;  4ECV A;  2MKH A;  2RU3 A;  4N77 A;  2VG7 B;  3AD7 C;  2AX0 A;  1S6O A;  2CYY A;  1P1T A;  3EDR B;  2VPZ B;  4PCQ A;  2XY7 A;  4LFC J;  4ZP7 A;  3CJ0 A;  3J7A N;  1U2F A;  3JTO A;  1OY6 A;  4DSI A;  1NHK L;  4OZ0 A;  4TY9 A;  4OHW A;  2KM8 C;  4JI3 J;  5CCM A;  3ZNU A;  4LIW A;  2WON B;  1JXL A;  2UU9 J;  3HPO A;  1ZET A;  1MG7 A;  1L3S A;  1QLN A;  4X4R A;  1MRO B;  3DOL A;  3CD7 A;  2W2N P;  3K5N A;  4IFY B;  1WSR A;  4ECT A;  2OH2 A;  1ZBT A;  2MQN A;  3C14 B;  3ZTP A;  3MM7 A;  2KZM A;  3MM8 A;  1BXN A;  2H51 B;  4U95 A;  2MGZ A;  3TQ1 A;  1DQ8 A;  4O23 A;  1F9H A;  4TLQ A;  4DR1 F;  3T1H J;  2P6T A;  4PKD B;  5D4L A;  4CM2 A;  1X0P A;  3CCM S;  2QL9 B;  1HBM A;  4ECX A;  3M8Z A;  4NLD A;  3PYE A;  3SZ2 A;  2LQ5 A;  4EO8 A;  3TJ9 A;  2M88 A;  4NPO A;  3C6T B;  4OZ1 A;  3TUI C;  4KE5 A;  2FJX A;  2K1R A;  2GIQ A;  3TX8 A;  1B4S A;  1Q5Y A;  5B0C A;  3GTY X;  4L74 A;  2HMI B;  5B0F A;  2YQ1 A;  3CCL S;  4OYM A;  4M5L A;  2UUA F;  2XMW A;  4M5G A;  3BQ2 A;  4JI4 J;  5IC6 B;  1LQ9 A;  4I0W A;  4S0M A;  1XMO J;  1PJ6 A;  1QSL A;  2ZH9 A;  1C4A A;  1X8D A;  2EC2 A;  1V5V A;  3DLK B;  1ZS6 A;  4LRB A;  4PG7 A;  5L39 A;  3PW4 A;  3FBC A;  5B0G A;  2HSE B;  1HQ2 A;  3NEK A;  2XTJ P;  3M2V A;  1S57 A;  1RWX B;  4LFB J;  2DNR A;  2WB1 D;  3QBC A;  2FHO B;  2F1F A;  4ALZ A;  4DL0 C;  3B4M A;  3G87 A;  3ISN D;  4PQU B;  2D74 B;  1QE1 B;  3CD5 A;  1UWB A;  1WC0 A;  4OZ3 A;  1KC8 T;  5F8N A;  4YHH F;  1AA1 B;  2RHQ B;  1J5E F;  1RTD A;  2P9G A;  1HBO B;  5JJB A;  2DEJ A;  2W7A A;  4A8O A;  3IG1 A;  2LP4 A;  4LFC F;  1RTI B;  2OFH X;  3BGF A;  1S5Z A;  4YB6 A;  1AYE A;  3C6U B;  4W92 B;  2F4V J;  3EJM A;  1RAD B;  2AZ3 A;  1HBO A;  1Y4Z B;  1JLF B;  2MKS A;  3LAL A;  1JNZ B;  3NG8 A;  1X9S A;  1VYA A;  1PO6 A;  4O4G B;  1JX4 A;  5DS7 A;  5T7L A;  4CLY A;  3DI6 B;  3EXY A;  3N01 A;  5C42 A;  1CC8 A;  2W2Q P;  2YH0 A;  3W3S A;  1H74 A;  3RB6 A;  1N5Y B;  2FB0 A;  3RB0 A;  4CO2 A;  2YKN B;  4HTJ A;  3MEC B;  5E3A A;  1T3O A;  1LWC A;  1F3F A;  3UW1 A;  4Z37 A;  3V81 A;  2XLI A;  7FDR A;  1D8Z A;  2GML A;  2RDI A;  4N8O A;  4PEO A;  2DTJ A;  2UV8 A;  4MAK A;  4RO0 A;  3UNG C;  4ZIT A;  5KFJ A;  1IQT A;  1UW4 A;  2UZA A;  4B08 A;  2ILZ A;  2DY1 A;  2HQI A;  4DV0 F;  3GPA A;  3R5G A;  4HTI A;  3VCD A;  3BBB A;  4Z7Y A;  3K8V A;  3IWX A;  4B9N A;  2L9D A;  2VH7 A;  4C0O C;  5CAB A;  4G3I A;  3NS5 A;  1DTT A;  2B4P A;  2C1E B;  2IJN A;  4QPX A;  1IR1 A;  2GJF A;  3VAJ A;  4H4O A;  4UT4 A;  3KOA A;  1VQ4 S;  3NOG A;  4FNH A;  2SXL A;  3ICL A;  2RVJ A;  4IG0 A;  1Y3J A;  5I3P A;  2XC9 A;  2J76 E;  3BR9 A;  1PCA A;  1S99 A;  2DYA A;  2KT5 A;  5JXS A;  3BYR A;  3TNV A;  3DI6 A;  3PHE A;  4G1Q B;  2W9B A;  5A8W B;  3M1V A;  2JEI A;  1TKZ B;  4IFY A;  1VJW A;  2QLF B;  1N56 A;  1R8P A;  2MZ1 A;  4A48 A;  3OJU A;  2HHV A;  1K73 T;  3DRY A;  2B9X A;  3U27 A;  1U49 A;  2B0G A;  2FIU A;  2ZIT A;  2E1C A;  4EK2 A;  3NOC A;  3QAU A;  3NNH A;  3WQP A;  3SIP B;  2PEB A;  1R6V A;  1T9Y A;  4CH7 A;  2H65 B;  4GVL A;  5DET A;  5A8R B;  2W9C A;  2Y1I A;  2AZ1 A;  1XWL A;  1YJU A;  3CJ3 A;  3PO4 A;  4DI6 A;  4ZVH A;  3R7B B;  5HMY A;  4USI A;  4DHV A;  3CCQ S;  2VIH A;  3H2L A;  3M8R A;  3A12 A;  4P2M A;  3JAM U;  3GFY A;  1UZH A;  3TI0 A;  4OI1 A;  1MWZ A;  2V68 A;  3W5Z A;  5KFB A;  5K5M A;  4ETX A;  2P8I A;  2ZUG A;  3SV3 A;  1YJ7 A;  1VQP S;  5E41 A;  4F3M A;  3UR0 A;  3W2V B;  3M9N B;  1PIE A;  5IWA J;  1Q16 B;  3D6M B;  4NLP A;  2FY8 A;  1S76 D;  3SCL E;  3P6Y C;  4PXD A;  4G1I A;  1MSW D;  4WWS A;  3BKU A;  3FFI A;  2OPP A;  2BV3 A;  3QGG A;  3OTB A;  3B82 A;  4KGX B;  4ES1 A;  5IT9 U;  4LQ3 A;  1IXK A;  4KR0 B;  4QQB A;  2VBZ A;  2ZUA A;  5HL7 Q;  3H5X A;  1XEZ A;  1C0T B;  1WHX A;  4B17 A;  5BYQ A;  3PKY A;  5B7W A;  2EW9 A;  1NSA A;  4I67 A;  3HSZ A;  1DFD A;  1Y0H A;  2KJV A;  3BR8 A;  5HRO B;  4I69 A;  1TFY A;  2MZJ A;  1Y9O A;  1EB0 A;  1U24 A;  2DGT A;  4DV3 F;  1I94 F;  1BQM B;  3EGW B;  3IR7 B;  3MR7 A;  1UEK A;  1AXQ A;  3J81 U;  3HHD A;  3MM7 B;  1HW9 A;  4TQR A;  4ED2 A;  3CCZ A;  5GAG U;  5IWA F;  2DJW A;  4X65 J;  3KLI B;  1BQN A;  1SJR A;  2J9D E;  2J9C A;  5HVF A;  1PGZ A;  3N9U C;  5DGA A;  4NRT A;  2DB1 A;  3W63 A;  1IBK J;  2UXC J;  3H90 A;  1E6V A;  4ZHR B;  1SBR A;  1WC1 A;  3TVY A;  4DDF A;  3AAW B;  2V0N A;  1PIL A;  3P4U B;  1RAF B;  3WIV A;  4NLW A;  3PRB A;  2GC8 A;  2YPY A;  1CJU B;  2AT1 B;  2HHT A;  4KHM A;  2E9Z A;  3BKT A;  2EFN A;  2FC8 A;  2V67 A;  2DNM A;  1JLE A;  1SV5 A;  4YN3 B;  2PO4 A;  1KN6 A;  5KT4 A;  5KFD A;  4ID5 A;  2DBB A;  3V6K A;  3KYL A;  3PX0 A;  1W7W A;  4IG3 A;  4CM0 A;  1VQO S;  4NCB A;  2BE2 B;  1EQ0 A;  1F0X A;  1LKZ A;  3O3L A;  1GMW A;  1XNQ J;  3CJS A;  5J1E B;  4I6A A;  1L3K A;  4MKB A;  5CAA A;  1UJ6 A;  2MQ8 A;  4LVN P;  3GJT B;  4I2P B;  2BAB A;  4LSL B;  1BY9 A;  4DWI A;  1XMQ J;  4ZVP B;  3DU6 A;  5HP1 B;  1OY8 A;  3D6H B;  3MI7 X;  2JLF A;  2CXE A;  3CUL A;  4JBC A;  5GAH U;  3QMQ A;  5G0R B;  1KQG B;  4FXW A;  3DHW C;  4DG1 A;  4Y28 C;  2GAH C;  4IH7 A;  5HQM A;  1IUJ A;  4A8W A;  3W5X A;  3BQ0 A;  2HFV A;  2MTL A;  2C3Y A;  1G6B A;  1WC6 A;  2EG2 A;  5LT5 A;  4XAK A;  4ED7 A;  3R9L A;  1C1B B;  3DM2 B;  2A1B A;  3C15 B;  2UV8 G;  2ASJ A;  1WNE A;  1NPR A;  4XDD A;  4MFB B;  2CFX A;  3MR3 A;  4C3L A;  2XS7 A;  1CSJ A;  5A2Q Y;  3CJ8 A;  1VQS A;  1JKH B;  3HUL A;  3IS9 B;  4ZVQ B;  4O3O A;  3SMZ A;  3DDK A;  3EMT A;  1Z4U A;  1TL7 A;  3OVS A;  1S1W A;  4J37 A;  5B0B A;  4Q7A A;  3ISZ A;  1IR0 A;  1S1T A;  3FBB A;  3S1T A;  2VJU A;  2YX7 A;  3UD4 P;  3RB4 A;  2HQF A;  3D67 A;  1SV5 B;  2F8E X;  2DR7 A;  3KDO A;  2IRY A;  2QRR A;  1X9M A;  3GIM A;  4ICL A;  5GAD U;  1WC5 A;  1T0T V;  1CJT A;  2BAN B;  1FKO B;  2D9P A;  3FBE A;  3HZG A;  4NEY A;  1YDL A;  3QWP A;  4NX9 A;  2FLP A;  1HNW J;  1FKP B;  3UNY A;  3PEJ A;  2KVQ E;  3BBF A;  3ITH B;  1IKY B;  2ACM A;  3N6M A;  3ZNJ 1;  1HR0 J;  2VHG A;  3K8W A;  3OFG A;  1Q81 T;  2EFQ A;  2V63 A;  4U7U D;  2E5I A;  5KFE A;  2BDP A;  5CHC B;  1FVS A;  2VOP A;  2OSQ A;  1WTB A;  2WCX A;  3PR4 A;  2WW8 A;  4Q8E A;  2HHX A;  4C9D A;  2VC1 A;  2X1F A;  1Q4R A;  1SJF A;  5KG4 A;  2BE9 B;  4OQJ A;  1Q0N A;  3C15 A;  1CQM A;  2ZBC A;  2WHO A;  2JVR A;  2LCW A;  3M9O B;  1EP4 B;  3MED B;  1X31 C;  2HBR B;  2QV6 A;  4K4X A;  3VAM A;  5CXT A;  5KFK A;  1PSD A;  2XHW A;  3CPW R;  3GE9 A;  3HMJ G;  1VQ7 S;  1NH8 A;  2B6A A;  3PM9 A;  4JV0 A;  2VFV A;  4KV8 B;  3JXO A;  5KFX A;  1TUG B;  4WFN Q;  1RT6 A;  3MAQ A;  1UVL A;  4DSF A;  4LRE A;  4QIW D;  1R27 B;  2HWI A;  2JSX A;  3M6V A;  1NJW A;  2ZH2 A;  2RQ4 A;  1BLU A;  2R7O A;  2GHV C;  3T9Z A;  2KDO A;  3VAH A;  1HA1 A;  2AGP A;  2NXC A;  2IDE A;  4IR1 A;  4AXJ A;  4FYY B;  3W2W B;  2XO7 A;  3IMQ J;  4HKQ A;  3W9J A;  5CZV A;  4FDF A;  4DX7 A;  1VC0 A;  4WBF A;  5K14 B;  4X4Q A;  2WBR A;  2Q3P A;  2QSF A;  2UVW A;  2DNL A;  4HDH A;  1VHI A;  2GQ2 A;  2PMH A;  1M1H A;  4MYU A;  4KQZ A;  5E5N A;  4YHH J;  2HGN A;  1TL5 A;  3C19 A;  3MCS A;  2XMA A;  4EYI B;  3QZ7 A;  2YKM B;  3LP2 A;  4LF8 J;  3SQG B;  2IRX A;  1K0T A;  2DH9 A;  4M5J A;  4U8V A;  1PJ7 A;  1FNM A;  3IGN A;  3EVM A;  1WOP A;  3R8Y A;  3ZZY A;  5RUB A;  4IO9 Q;  4MYT A;  4MK7 A;  2F4V F;  2LA6 A;  2CNN B;  4M1K A;  3U7J A;  3GQC A;  4E8U A;  1JLB A;  4HLB A;  2XLJ A;  5EWG A;  3T9N A;  3HI9 A;  4CLS A;  1I1G A;  4N41 A;  3GFX A;  1IVZ A;  2H5E A;  4BWJ A;  4A46 A;  2QTW A;  1VOM A;  2HS0 A;  5IT0 A;  4HR2 A;  4X64 F;  1RJJ A;  2E5L J;  3OT9 A;  3MD1 A;  4BWM A;  3QJJ A;  2B3T B;  1ZPW X;  2DNO A;  2G0I A;  1FE0 A;  1NUE A;  3CJ4 A;  4DFP A;  2BJ3 A;  4CTA A;  3CJQ A;  1U1M A;  4DV5 J;  1KLM A;  3Q24 A;  2E29 A;  2GGP B;  3WC0 A;  2EK1 A;  2W1B A;  3TWZ A;  4DPX A;  2R2U A;  4ED0 A;  1N5V A;  2DO0 A;  2YQ3 A;  3HM9 A;  4DR1 J;  4LF6 F;  3AXK A;  1T95 A;  2OEJ A;  2UUA J;  2CNK B;  3GV5 B;  1LW2 B;  2VDI A;  5HMZ A;  4C7Q A;  1HNI A;  1GAO A;  2FJB B;  1NME B;  2RU9 A;  4F4A A;  3MR2 A;  3EUN A;  1OS5 A;  2J7U A;  2Z0G A;  2BJE A;  2IPO B;  2YH1 A;  1H7X A;  4D3H A;  3MAA B;  5E3C A;  1BD6 A;  1T9T A;  1I51 B;  2AEJ A;  3QAE A;  3QQC D;  4V1A k;  1O51 A;  3ZZO A;  2KB2 A;  4LSN B;  3V6D A;  1KOH A;  1N6Q A;  2NRE A;  2G2Z A;  2VFT A;  3QRP A;  1S1V B;  3M2R A;  4I2Q A;  1N5Y A;  2LEA A;  4NXM J;  4NA3 A;  3GII A;  3Q8P B;  5ETS A;  2KRR A;  3RRH A;  2ZNY A;  3JTN A;  2UUW A;  1RT2 A;  2RD5 C;  4LRD A;  4DJB A;  3JTP A;  1WKK A;  5IT9 Y;  4EEY A;  1J2V A;  3MMB A;  1M5P C;  3NP5 A;  3GIR A;  3ELH A;  4DFJ A;  2W9C B;  2HBZ B;  3MD3 A;  3AHP A;  4IDK B;  3R7S B;  3GJR B;  3KNG A;  4HI1 A;  2BVZ A;  1ELO A;  2YNH A;  4Y6I A;  4ZOS A;  4CZC A;  2HPU A;  5F8M A;  2RKI A;  4IYQ A;  1ZA1 B;  2AGQ A;  1C1C B;  3JQM A;  1FDD A;  4IQM A;  4M5K A;  1BWV A;  1LV5 A;  1CBK A;  1PC4 A;  2VOO A;  1FRX A;  2FVQ A;  3OHA A;  1RT6 B;  3MHY A;  4DN9 A;  1U26 A;  1NK8 A;  1SH0 A;  1QTN B;  2LQ8 A;  2ZOM A;  4UQT A;  4HI2 A;  4WK3 A;  3WIU A;  2QMU B;  1TKX B;  3TVZ A;  5C24 B;  1XJW B;  2V69 A;  1RGV A;  2VFS A;  5GAH I;  2ZH4 A;  4IOA Q;  5D0H A;  2AV5 A;  2GNK A;  2OUG A;  3RU0 A;  3UN5 A;  3KLH B;  3OJS A;  3IBW A;  2B4U A;  3AQP A;  4IFV B;  1FK9 B;  2HFU A;  2Q6C A;  4TYA A;  3RZA A;  4ZP6 A;  3SSR A;  2Z57 B;  1RBA A;  2DPI A;  3W8P A;  2BQU A;  3MWB A;  4DN0 A;  3GLJ A;  9RUB A;  2ZH5 A;  1ZM3 A;  2ZZT A;  3TA2 A;  3NMA A;  3L7U A;  1YQH A;  2BXJ A;  3GP9 A;  1TQL A;  4KH1 B;  4JYA J;  2OD6 A;  1NDP A;  1QAX A;  2ZC3 A;  4M5I A;  4WK1 A;  4YR2 A;  4P74 A;  4UTG A;  2CPI A;  4Q43 A;  2XHC A;  4M5D A;  3GIJ A;  3TAN A;  1RKJ A;  4K5R A;  2IVF B;  1H6K X;  1FKO A;  3V81 B;  3P3D A;  2Q79 A;  5BXI A;  1Y5L B;  3K57 A;  5B0A A;  1FHT A;  2KT3 A;  1EAR A;  2JNJ A;  1UKU A;  3R1L A;  2KZZ A;  3MM8 B;  1S12 A;  3FUY A;  4RW9 A;  1FXL A;  1U1N A;  2QLX A;  4PG6 A;  5T7L B;  3H4D A;  4I1T A;  2L48 A;  3QT7 A;  4OX9 F;  3VF0 B;  5IFM A;  2M3D A;  4K0K J;  4N8N A;  3I0S A;  2BKP A;  4LF5 J;  3HFV A;  3KHL A;  1KNZ A;  1EET A;  2W9A A;  5KG6 A;  4ECQ A;  2R7U A;  2IJR A;  3P5T L;  3N4W A;  3LAK A;  3O8W A;  5LMU F;  4LF6 J;  3K59 A;  3QLH B;  1DY3 A;  5JUM A;  3WC2 A;  1S1U B;  5J2M A;  4LF1 A;  1HMV B;  1TVR B;  2DRD A;  4JI8 J;  1W2I A;  4QWA A;  2R2R A;  2BJ7 A;  4PQA A;  4FF1 A;  1LWF A;  1NCL A;  4QWD A;  4F4K A;  2BM0 A;  1SC3 B;  4FF2 A;  3PFO A;  3GR1 A;  2JHE A;  2O66 A;  3OXG A;  4DSE A;  1VBY A;  1F2G A;  2CJA A;  1WOR A;  2V9W A;  3VZI A;  3CW2 C;  1RP5 A;  4KSE B;  1FTC A;  3RG6 A;  3UVJ B;  2Z30 B;  4X62 J;  4OV6 A;  1QY7 A;  3CCS S;  4DR4 F;  1KON A;  2CPF A;  4PWD B;  1KFD A;  2OFG X;  2VOD A;  1NK6 A;  5F0W A;  2B9E A;  3B8H A;  3CCW A;  4TU8 A;  2APO A;  3MAH A;  2HHS A;  4HHH A;  2HMI A;  1G3O A;  2E7X A;  2DKO B;  2HGM A;  3OUY B;  2BE2 A;  1ZTW A;  4LF9 J;  2WOM A;  3X1L B;  4RWW A;  4DZD A;  4F4W A;  1X9W A;  3KNA A;  2F9D A;  1XR5 A;  2BW2 A;  1JLE B;  2FLO A;  3BGL A;  3OR2 B;  3GCX P;  2KJW A;  3AXM A;  4RW8 A;  3DOM B;  5ITH A;  1M0S A;  3EZ5 A;  1CJU A;  4I56 A;  3KJV B;  1S1U A;  2KYZ A;  2ZOF A;  3THP A;  4R0E A;  2PT0 A;  3K5P A;  5J2M B;  3D0G E;  4L75 A;  2ASD A;  1YK9 A;  5DQH A;  1F9F A;  1ZAX A;  2V2Q A;  1VQ5 S;  3O1L A;  2YNI A;  3HX9 A;  4DQS A;  4XPC A;  3H40 A;  2L41 A;  4W98 A;  4B9T A;  4DR4 J;  3CED A;  3MM6 A;  1YX2 A;  3ZZZ A;  1NPK A;  2B5J A;  4Z2X A;  4Q8F A;  2J7K A;  4QIE A;  3RTV A;  2I0X A;  4MIA A;  2AX1 A;  4BC7 A;  2MJU A;  3OBI A;  4DR3 J;  3PKM A;  2CJQ A;  1F2H A;  2D7S A;  3MDF A;  4WZM A;  1WG5 A;  2OJ3 A;  2HAI A;  1GMU A;  4Q0B B;  3NS7 B;  3HLU A;  1Q7L B;  3S7R A;  3QRQ A;  4WXW A;  4DR6 F;  1RI7 A;  5BYS A;  4ELT A;  4NLG A;  2BKO A;  2F8M A;  2V5H G;  3D68 A;  2HKE A;  2HZC A;  2N7C A;  1YJN S;  2CAD A;  2A2D A;  4BS2 A;  3JB9 k;  3W5Y A;  1M90 T;  2G0C A;  3PNI A;  4GVB A;  4GC7 A;  3RW6 A;  4PAA A;  4TN2 A;  2WSF C;  1APS A;  2YWH A;  2XG8 A;  2HZV A;  2NPI A;  2HEK A;  2HIY A;  2H9Z A;  3M2U A;  4C11 A;  4K5S A;  1XC9 A;  1H2T Z;  1HNV B;  2E44 A;  3PXG a;  3DLG B;  2XZT B;  1AZS B;  3TP2 A;  1VRU B;  4Q5V A;  4Q45 A;  4NZ7 A;  3KLH A;  2QT7 A;  1JJ2 R;  2ZZM A;  5C2C A;  2W8L A;  2VA2 A;  2YWE A;  1R0A A;  2M5Y A;  1CJK B;  5SUH A;  2CAJ A;  5L1I A;  4DLE A;  1VGY A;  1PKU A;  3HZE A;  1U1Q A;  2WSE C;  3W9H A;  1GK8 A;  4HEA 9;  4NAS A;  3R97 A;  2GCF A;  2FHJ D;  3H5U A;  3UI3 A;  1VQ9 S;  1AW0 A;  4NML A;  5C5J A;  2B9Y A;  2VQE F;  3QYY A;  1U2R A;  4BBY A;  5H9E K;  1TAU A;  1TVR A;  1UPM B;  2DIU A;  2ZC4 A;  4H54 A;  5DZ7 A;  3A1Y G;  4CLU A;  3RR7 A;  3TYT A;  4PUO A;  5HO4 A;  4JV5 J;  3QZ8 A;  4FF3 A;  3QID A;  1RWP B;  2HVD A;  3DLE A;  3P5B P;  4ZKA A;  5E3R A;  2WRM A;  3OPK A;  2LDY A;  3VGT A;  2ABY A;  2AIR B;  2OPR A;  3SV4 A;  2FVR A;  5ADZ A;  1S0V A;  2CPH A;  2RQM A;  4L76 A;  3Q0A A;  4ES3 A;  4TYB A;  2KT2 A;  4RNF A;  3JSM A;  3PW5 A;  2KO1 A;  2R7T A;  1WHV A;  4LUB A;  5ETV A;  4K7Q A;  4TVA B;  4PXB A;  5DG8 A;  4TU7 A;  2AWZ A;  1DAR A;  5CD4 H;  3PZP A;  2MY7 A;  4I7F B;  4E2F B;  1EKS A;  5EWE A;  4F2R A;  3S01 A;  1MNE A;  3O44 A;  1P9Q C;  1FX4 A;  1UAW A;  1WEZ A;  2N7Y A;  3FCV A;  3Q8U A;  3UN2 A;  4RW8 B;  2MEW A;  2EC0 A;  3CO0 P;  3SSS A;  2UUC F;  3PCO B;  2YVS A;  1VJQ A;  3K5O A;  2HNZ B;  4XDC A;  3GJS B;  3IRX B;  4ED4 A;  4K4Y A;  4KPY A;  1ZZF A;  2CWX A;  3NGR A;  1YGY A;  2XYP B;  3LP0 B;  4ES2 A;  1YLX A;  1HYS B;  3ZZT A;  2ALY B;  3LPY A;  4ZP8 A;  5DDP C;  1YJW S;  1OSD A;  1DJ0 A;  1LEO A;  5A0Y B;  3MR6 A;  4B3M F;  3OSN A;  4A8Y A;  1VI7 A;  3UD3 P;  5CYM B;  4U6P A;  5J2Q B;  1HBU A;  4JI5 J;  2CNO B;  2F3J A;  3AQO A;  4KO0 B;  1TU0 B;  1S4E A;  2HFO A;  2K2P A;  1Q82 T;  3HSJ A;  5BJR A;  4F02 A;  3M30 B;  2PD1 A;  1UFW A;  2EBG A;  2XBP A;  4YUD A;  3CME S;  5L1L A;  4ZLL A;  2Y1L B;  3I9V 9;  2VQE J;  3C8Y A;  2KL8 A;  4CNY A;  3ILI A;  4DUZ F;  2PI5 A;  2FHM A;  4Z7C A;  1DTQ B;  2GMH A;  3F0N A;  2D41 A;  1A9N B;  2VPW B;  1YVF A;  3CSK A;  1KVJ A;  3IG1 B;  2QE5 A;  5DG9 A;  4O3P A;  1CG2 A;  3Q89 A;  3HKW A;  4MIW A;  3G82 B;  3NL0 A;  3MMB B;  3OTO F;  4JI4 F;  3DMJ B;  3M8P A;  4OHZ A;  2J6T A;  2KYX A;  1KLN A;  3H0P A;  4UOC A;  1V5I B;  3J7Z T;  5AT1 B;  5M2R A;  3SYZ A;  3CF5 Q;  1FKA F;  3LAM A;  1NM2 A;  3R5D A;  4OL8 A;  3BSN A;  4ECR A;  4W90 B;  2ROE A;  5AJ3 J;  2BYC A;  1F5A A;  1N6Q B;  1JXE A;  3DLK A;  3UDV A;  4WP3 A;  1ICE B;  1TL4 A;  4P2S A;  4F4X A;  3EGN A;  4Y65 A;  3C16 A;  2FVC A;  3NS6 A;  3BEG B;  2RT3 A;  4FYX B;  3KJN B;  4F25 A;  1IBL J;  2J6S A;  1X4E A;  3N5B A;  4RU2 A;  3G6Y A;  2K1R B;  4K4S A;  4PG5 A;  3BGO P;  5KT7 A;  2V4J B;  2VAS A;  2E5L F;  4Y34 A;  4ILL A;  5DO2 A;  3PY8 A;  1JLC B;  2V4Q A;  1P9Y A;  5KG5 A;  4F50 A;  1SH3 A;  4ZVE A;  2FVS A;  2IA6 A;  2C2N A;  2EKN A;  1XN9 A;  2GO9 A;  2VF3 A;  1F3V A;  2ZNZ A;  4I68 A;  3KXD A;  1N8R T;  3H25 A;  1FT8 A;  2ZH6 A;  3IRW P;  3FMB A;  5KT5 A;  3IRX A;  4WU2 A;  4CLL A;  3F44 A;  1CS4 B;  1JLC A;  3I32 A;  2VUG A;  3M32 B;  3AOC A;  5KTQ A;  2CG4 A;  3KKF A;  1R43 A;  1DRZ A;  5LL6 d;  2DXE A;  1D9D A;  3DYA A;  4DL5 A;  3PJ9 A;  4AL7 A;  4DX5 A;  4DR6 J;  3W62 A;  3UPF A;  4WTO B;  3C16 B;  2JC1 A;  3SI8 A;  1C1C A;  1OPI A;  3TJ8 A;  3CD0 A;  3HHL C;  1NJZ A;  2CQC A;  3VQS A;  2DIT A;  4FZV A;  4ZPA A;  3U1L A;  2JFK A;  1EAY C;  4CH1 A;  3PW2 A;  2UU9 F;  1H0H B;  4L72 B;  1R89 A;  5F8L A;  3DRR B;  3PEH A;  4YDX A;  4K8R A;  5HAN A;  1VBZ A;  1CJV A;  1X5O A;  4RBU A;  1DLO A;  3ISN C;  1TP7 A;  5HJX A;  1T03 A;  1RT2 B;  2BOP A;  4UW2 A;  5HAT A;  4NXN F;  4YB5 A;  3D3C J;  5B0E A;  3HK2 A;  2DCL A;  3D1O A;  5GAE U;  2RAQ A;  5LMN F;  4N76 A;  2OLW A;  1LK5 A;  4FXD A;  1RE1 B;  1H38 A;  2OAU A;  1MU2 A;  3W61 A;  3C46 A;  4NA2 A;  4QYZ K;  5AXK A;  2LMI A;  1RT5 A;  3A8I A;  4Y2K A;  2ZWP A;  4YFU A;  5I3Q A;  1T05 B;  3HHK A;  4CLZ A;  1QVG R;  1FRL A;  3A8E A;  2J0Q D;  3K2Y A;  4ZP9 A;  2GIR A;  3UD5 A;  1CJK A;  2GHP A;  4EGL A;  3X3U A;  2HWH A;  4CLP A;  2ZH3 A;  3BF4 A;  5HP1 A;  2VFR A;  1D1U A;  1RZM A;  3OXL A;  2I2Y A;  1URN A;  2V6A A;  1T9W A;  5E2Q A;  2EEY A;  4KPC A;  1UEV A;  1NBE B;  4DBQ A;  4YY3 J;  2B43 A;  2NXJ A;  2R2S A;  4M5N A;  3BBC A;  5EGY A;  1V3R A;  1S6P B;  3VR1 A;  2GIF A;  2V4J A;  4IKA A;  5B09 A;  1XK8 A;  1YRU A;  3NGS A;  2DXD A;  3DOK A;  1S77 D;  3H7H B;  2Y1R I;  1ZAW A;  2A3J A;  3H20 A;  3JSR A;  4I64 A;  4OZJ A;  4LBI A;  4CLW A;  3OLA A;  2NZ4 A;  1FKP A;  1SC6 A;  5LOQ A;  2B4O A;  2KG0 A;  2AJ2 A;  2PMZ D;  1SUQ B;  5HI7 A;  4JUZ A;  2G1D A;  3CCV S;  1VBX A;  3CDA A;  3GIK A;  1ZTT A;  3A8J A;  2FHK A;  2QA4 S;  1R8B A;  1U1R A;  5D4O A;  2OI2 A;  1FNO A;  2D9O A;  2OHD A;  3AJ1 A;  3KLE A;  4N5S A;  4JOU A;  4LRF A;  4K4W A;  2CZ4 A;  3TR5 A;  1VDH A;  1V9O A;  2ZBR A;  4FKY A;  1N88 A;  3FRY A;  2YKM A;  2KHC A;  3D1Q A;  3PYG A;  1JJH A;  1T3N A;  1K0V A;  3CDU A;  5IXU A;  4C8N A;  3LP1 A;  1JK9 B;  1Q79 A;  4WJB A;  1O0P A;  4CRJ A;  2MDA A;  3N0V A;  2IAJ A;  2V2Z A;  3G82 A;  1L5U A;  2OPR B;  4KJI A;  1SVD A;  1WEL A;  1CUL A;  3OR2 A;  1WOS A;  4FS1 A;  1TFW A;  4ZCI A;  4ZVU B;  2LDI A;  2YPZ A;  2QO3 A;  4LR7 A;  2Z58 B;  4PYA A;  3J80 Y;  1RT7 A;  4EBE A;  3BDP A;  3BO2 A;  4QIG A;  1RIS A;  3NMR A;  3TOQ A;  2R2T A;  1N5Q A;  4OJ1 A;  1VC6 A;  2R3V A;  4CNZ A;  2H1Y A;  1C0U A;  5HN0 A;  4C97 A;  3HHL A;  3BH7 B;  5T41 A;  1U6Z A;  3GYN A;  1KQK A;  3V4M A;  4EBC A;  2DIV A;  4RU9 A;  5ETT A;  3FRZ A;  4BCA A;  3HT3 A;  3G8Q A;  2V9K A;  4FF4 A;  3HKZ D;  1UMJ A;  1HI0 P;  3VAL A;  5KFZ A;  3CCT A;  3NGK A;  4NLV A;  1IKW B;  2UXD J;  1U0S A;  1GMW D;  1S0N A;  3IFE A;  3AT1 B;  1TL1 B;  4DCP B;  2JRS A;  2QFI A;  1U6F A;  4IG3 B;  5K20 B;  1NND A;  4LF2 A;  4ATN A;  3D2W A;  1YRT A;  4OYO A;  4PXC A;  4DV4 J;  1B0V A;  5BYR A;  4A47 A;  1WUU A;  5ETQ A;  1M5O C;  3KUG A;  1H2U X;  1FNX H;  4JI7 F;  2QJ3 A;  3ITH A;  1S48 A;  2RF2 B;  4J9N A;  3N79 A;  4OI6 A;  2QL7 B;  1FEH A;  1M1G A;  4C8K A;  5KFS A;  1SJQ A;  3B54 A;  1RA6 A;  3M8Y A;  3MEG A;  3POT B;  2QMX A;  4KYZ A;  3L4B C;  3OL7 A;  3LGN A;  2Q1L A;  4WP9 A;  1S72 S;  2LQB A;  3DGV A;  3U1N A;  3M1V B;  2O3D A;  1SKR A;  3CCE S;  4UY8 T;  1VQ6 S;  1YIT S;  2FC9 A;  4OYI A;  3ETM A;  4KC5 A;  4YB7 A;  4CIO A;  4DPW A;  1XNR J;  5KFQ A;  4OI3 A;  1Q5V A;  4CQ1 A;  1FFW B;  3TUP A;  1REG X;  4AE5 A;  4RW7 B;  3MEG B;  2A18 A;  2PE8 A;  3T1Y F;  2FQQ B;  2V8P A;  2MPU A;  3BV8 A;  2IFX A;  2C2D A;  1YJR A;  2XNR A;  2OTL S;  1IR2 A;  2UXB J;  4FNI A;  4LF7 J;  3G71 S;  3LTO A;  1FJE B;  2R8K A;  3AH6 A;  3G6E S;  4XK8 C;  2AEM A;  3QGH A;  4MKA A;  3T3F A;  1JLG A;  4DV7 F;  2M8D B;  4WYW A;  1TL3 B;  2CQ0 A;  3I5C A;  1ZYQ A;  2AJ4 A;  2LQJ A;  2OPP B;  4YME A;  4YR3 A;  4WFB Q;  1WF2 A;  2R8J A;  3J81 Y;  3A3P B;  1X5T A;  2KG1 A;  4J9O A;  3PV8 A;  4JV1 A;  3OUY A;  4ID8 A;  1GTE A;  2QFJ A;  1RT4 B;  3HFK A;  4OYW A;  2ZJQ Q;  3W9I A;  5H9F K;  4ZVT B;  4J91 A;  4M8L A;  4NLR A;  4ECW A;  2Z8Q A;  4NL5 A;  1FA0 A;  4MTP A;  1NB7 A;  1Z1Z A;  1TR0 A;  1UFK A;  2IBO A;  2LYV A;  2Z4P A;  3CNQ P;  1VRT B;  3OD2 A;  3LWL A;  3R1H A;  1NKE A;  4K0K F;  2ZD1 A;  3E51 A;  5DJB A;  2ILY A;  2HHH J;  4O4G A;  3S6E A;  3G86 A;  4PR6 A;  3SCI E;  1N32 J;  2LVW A;  5A8R A;  2UXC F;  1QJH A;  1MN7 A;  2DH7 A;  4Q2L A;  1JQG A;  4ZN3 A;  1Q78 A;  3AB4 B;  1EJ7 L;  4ZK7 M;  5HQ8 A;  2UUT A;  4IDK A;  1AFI A;  3MPY A;  1BHN A;  5FDL A;  3PO5 A;  2WVB A;  2C2K B;  3I55 S;  2R8I A;  3JQK A;  3MTJ A;  1U8W A;  3SDE B;  5EUH A;  5CYQ A;  2VB6 A;  1VQY A;  2V34 A;  4FYW B;  2HND B;  5CZX A;  4D3G A;  2AKW B;  1QE1 A;  1LFP A;  1B64 A;  1EET B;  2HK2 A;  2Y3Y A;  3JSB A;  4W4M A;  1KDN A;  3ULH A;  1U2C A;  2JFD A;  1LWE A;  2GA7 A;  1KTQ A;  2KXH A;  2MST A;  3MM6 B;  4DX6 A;  3OL6 A;  3DXB A;  2XMV A;  2Z2Y B;  5HJY A;  4NCA A;  2ZBQ A;  3BN7 A;  4WF9 Q;  1YSJ A;  2BRL A;  4CT8 A;  1NSQ A;  2VDH A;  3BQ1 A;  4DV1 F;  3KLE B;  4B3O B;  1YKW A;  2JWN A;  2BJ9 A;  3MCM A;  5EX3 A;  4RW6 B;  3ENQ A;  4KFB B;  4QW8 A;  4Y0F A;  3HP6 A;  1UJ5 A;  2WVF A;  2K3K A;  2LU1 A;  1HBN B;  1JXV A;  1SUQ A;  5E7O B;  3ZXW A;  5HVH A;  3QJL A;  3G2X A;  2K8G A;  3BGR B;  2HRU A;  4PPZ A;  2ZZN A;  3HO1 A;  3M6U A;  2JZ5 A;  3C6T A;  3IA0 A;  5L1K A;  4O3S A;  3UN3 A;  2XQC A;  3FMW A;  3EX7 B;  1QAJ A;  4IRK A;  3K0J A;  4YDD B;  4DQI A;  2MKY A;  3I96 A;  2HHP A;  3K17 A;  3MEE B;  2HQ3 A;  1LWC B;  1HBN A;  2BEF A;  4LMZ A;  1PYO B;  1JLQ A;  4ER8 A;  2G2Y A;  2DCU B;  2XMJ A;  4FN5 A;  3DLH A;  3G9C A;  3OL9 A;  2KHD A;  1GX6 A;  1VMB A;  3H98 A;  4QYZ J;  4FVM A;  2OPS A;  4ED5 A;  4AT1 B;  1RTJ B; 
#chains in the Genus database with same CATH homology
 3MCN A;  3QBC A;  5ETL A;  3MCM A;  5ETV A;  3HSJ A;  1F9H A;  1RU1 A;  5ETN A;  4M5M A;  1IM6 A;  3UDV A;  5ETO A;  1RAO A;  2F63 A;  3ILO A;  1DY3 A;  4M5J A;  2QX0 A;  4M5H A;  2F65 A;  3ILJ A;  3ILI A;  3KUG A;  3IP0 A;  5ETQ A;  1RU2 A;  3KUE A;  5ETK A;  5ETR A;  3UDE A;  4CYU A;  4CYU B;  4M5K A;  1G4C A;  1EX8 A;  1KBR A;  3HD2 A;  3HSG A;  1CBK A;  4M5I A;  1TMM A;  3HD1 A;  3MCO A;  3UD5 A;  4M5L A;  1RB0 A;  4PZV A;  4M5G A;  3HT0 A;  1TMJ A;  3HSZ A;  5ETT A;  1EQ0 A;  4CWB A;  5ETM A;  4AD6 A;  5ETS A;  3ILL A;  3KUH A;  1RTZ A;  1HKA A;  3HCX A;  1EQM A;  2CG8 A;  1HQ2 A;  1Q0N A;  5ETP A;  4F7V A;  4M5N A;  2BMB A;  3HSD A;  4CRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...