2RF2B

Hiv reverse transcriptase in complex with inhibitor 7e (nnrti)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7
publication title Novel indole-3-sulfonamides as potent HIV non-nucleoside reverse transcriptase inhibitors (NNRTIs).
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 109
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rf2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2B04
2UUWA 1S9EA 4H4MA 3RB4A 2JC0A 3JYTB 3ITHB 1J5OB 1RT2A 3QGHA 4Y34A 4HKQA 1TKTB 4KE5A 5KFVA 4KKOA 4QWEA 2FJVA 4R5PB 1S10A 2V9WA 3M8PA 2ALZA 2WCXA 3DRSB 1XR7A 5KFWA 3DMJB 4KFBB 4F50A 5J1EA 3EZUA 2ASLA 5I42B 2EC0A 1HYSB 3E51A 4F4YA 1JLBA 3MECB 2DPJA 4TY9A 2XWYA 4ZVEA 4QPXA 3M9OB 4DL3A 4YMEA 1RT7A 2OPQB 1RAJA 1BQNA 2XGPA 4J9SA 4I7FB 3N6MA 2RKIA 4KHRA 4RNNA 2W9AA 3LALA 5F8JA 3IRXA 4K4WA 5K14A 4YP3A 2C2DA 4RW4A 4ZPBA 3MEEB 3BSAA 1TV6A 2ZD1A 3TAMB 2VG5A 4ZHRA 1KHWA 1S0OA 2IC3B 1RT5B 3KNAA 4WXWA 3V81A 2BANB 2YNFA 2CJQA 4FS1A 3PR5B 2WK4A 2W7PA 2HNYA 3C6UA 2B5JA 3DRRB 3BGRA 2R2SA 2VG6B 4IKAA 4URSA 3GIJA 2YNHA 4ECRA 2B6AB 2IM1A 1XR5A 2BQUA 4LSNB 2FJWA 1REVB 4XO0A 1R0AA 3QGGA 2JLEA 2JEFA 1SV5B 1S1VA 2I5JA 4X2BA 3DYAA 5F9LA 4O3OA 3EPGA 4J9PA 1C0UA 3KJVA 3BREA 2VA2A 3KLVA 4EO8A 3GV7B 2D3UA 1RT4A 1HQEB 1NHUA 3BQ0A 1LWEA 4EYIB 3I0RB 1DTQA 2FVRA 4K4TA 2R8JA 1C0TA 3V4IB 2YKNA 1S48A 5KT7A 3NAHA 5KT3A 4H54A 5L1KA 1S1TB 1N6QB 1JKHA 3Q8RB 4ECWA 1XR6A 5DG8A 2XGQA 4K4XA 1LW0B 3VQSA 5KFUA 3IGVA 4WFZA 3PZPA 3PR4A 3PVXA 3HVTA 1KLMA 1SUQA 2FVSA 5J2PB 5KG0A 1N5YA 4O44A 5HP1A 5EWEA 2AQ4A 3RB6A 1DTTB 4PWDA 4NLOA 4WE1A 4G1QB 3CDWA 3LP2B 5F8LA 3DOKA 1IKYB 2J6SA 1IKWA 2OPRA 3KMSA 3RAQA 4EEYA 4O4RA 5EWFA 1RT1A 3DRPA 3DLKA 4IG3B 3KK3B 3V6HA 4MFBB 3HVWA 3CVKA 5KT5A 4RW6A 2HWIA 3PW0A 4IR9A 5C25B 3KLHB 1N4LA 5KFCA 4RUCA 1S0NA 2QV6A 4ZMMA 3MEGA 2OPSA 4EBEA 2IMWP 1RTIB 3JYTA 1JIHA 2WONA 3KK2B 4ZP6A 4DL4A 2HMIB 1TL3A 4KO0B 1TP7A 1FKPA 3MR3A 1TKZB 1S1UB 1QAJA 4WFYA 4WXOA 1JLAA 2GC8A 4MIBA 3RBEA 4EBDA 1LWFB 1MU2A 1S1XA 2OPPB 5F8IA 4ICLB 1FK9B 4URQU 1CSJA 2R2TA 5I42A 5L9XA 5KT6A 4PQUB 1C1CB 1TVRA 4K50A 1UWBB 2GIRA 3MECA 4F4XA 4WYWA 2FJXA 4QWBA 1RYRA 4ZVGA 4R8UB 3MEDA 3BJYA 4NLVA 4ZPAA 4ED0A 3NBPB 5KG6A 1S6PB 4DG1A 5J2MB 4QWCA 2R8IA 2AGQA 1HPZA 5KFQA 5KFHA 3BSNA 2J6TA 3KK1B 1JLEA 3DOLA 4TLRA 5F8MA 1JLGA 3TAMA 1RT3A 2BE2B 3V6DA 1VRTB 3FDSA 3BSCA 5DG9A 3G6XA 2UVRA 2BANA 2IAJB 1JLFA 2WOMA 3IS9B 1LW2B 2IJFA 4ED7A 5KFFA 3QIPA 3MR2A 1S9GA 5J2QB 4K4YA 4ED8A 3MR5A 2YNIA 3DRRA 2VG6A 3ICLA 2XC9A 1HARA 4RW7B 1HNIB 3ISNC 2E9RX 3DLEB 2WB4A 2B6AA 1S49A 5KG5A 5EDWA 2R8HA 1HQUA 2JEGA 1HNVA 4K4ZA 1VRUB 4TN2A 2RDJA 3I0SA 5I3UB 1LWCB 4Q0BB 4NCGA 3KLGB 2UVUA 5J2NB 4JUZA 3NMAA 4MK9A 5CYMB 1JLQA 4PUOB 4YR2A 3GIKA 4RNOA 2HNZA 2WHOA 1QE1B 3IG1A 4I2PA 5C5JA 1DLOA 5DQIA 2D3ZA 4K4UA 1NHVA 2WRMA 3NKYA 2BRLA 5KFGA 1MMLA 4ZP8A 4U6PA 4ID5A 1JLCB 2YNGB 1KHVA 1N6QA 4OL8A 1W25A 3GV5B 3KLIB 5HBMB 1EETA 1T94A 3T5JA 2ILZA 1T05B 3CJ2A 5KG1A 1RTHB 1EP4A 1DTTA 3DLGB 2AU0A 1S6QB 4H4OB 3NAIA 4MKBA 3V6JA 4IH7A 2VA3A 2XCPA 2W8KA 3E01B 4B3OA 2FVCA 5JUMA 5CYQA 5KT2A 3BQ2A 4QWAA 4DL6A 3RB0A 1RTJB 2VG7A 3C6TB 4IG3A 5DQHA 4NLQA 1YVFA 3MR6A 3G6YA 2B43A 1D0EA 3LP0B 5FDLB 3MFHA 4Q8EA 1OS5A 1K1SA 4IFVB 4NLXA 4IFYA 5C24B 1C1BA 1BQMB 4I2QA 4TYAA 3HVAA 5KFIA 3QLHB 2V4RA 1FKOB 3PW5A 1T03B 3FRZA 3FQLA 1QUVA 3TQ1A 4IG0B 5HROB 4QW8A 3DI6A 3HKWA 1RT6A 4RW9B 1SH2A 4M94A 4NLPA 2W9BB 5KFJA 4IDKB 4WFXA 1FK9A 5HLFB 4EYHB 1IKXB 5C42B 4PQUA 4RW8B 3FQKA 3PJWA 5KFLA 1S1WA 2O5DA 4Q44A 4JV1A 2YKMA 5JXSA 4QW9A 5J2MA 4LQ3A 4ECSA 3H2LA 3SFUA 4M95A 2JEJA 4IOBA 2FLPA 1RTDA 4NRUA 4R0EA 3CJ3A 4FS2A 1RYSA 5L1IA 3UR0A 2IA6A 3FFIB 3CO9A 4NRTA 4RZRA 3OLAA 4FBUA 1IKVB 2IJNA 2AX0A 2IAJA 2D7SA 4KHMA 3IS9A 3M8QB 2ILYA 3H98A 4TY8B 3T5HA 3OL7A 4TYBA 3H5XA 3BR9A 5EUHA 4ECTA 1TL1B 3KLEB 4O3NA 3QYYA 4YQWA 4TQSA 5KFEA 2C28A 3DLEA 3LP1B 4LSLA 5D3GA 3H40A 1VRUA 2HNDB 3M8PB 3KLFB 4RU9A 3OL8A 2W7OA 4K4SA 1S9EB 4H4MB 3KLGA 3PW7A 5CYMA 1RT2B 2W9CA 1TKXA 4KV8B 3BSOA 3QO9A 4KKOB 4RNFA 4ZP9A 4TXSA 2R2UA 2XI2A 3QZ7A 3KLFA 3ITHA 1J5OA 3CWJA 3CJ5A 1TKTA 3N6NA 4MKAA 3PHEA 2OH2A 4R5PA 3KHLA 2ASJA 1I6JA 4K4VA 3EPIA 1JLBB 3UPFA 3ISND 3T19A 3V6KA 3DRSA 5KFOA 5F9NA 3DMJA 4KFBA 1RTHA 4O4GB 1RT7B 1HYSA 4ZPDA 1BQNB 4YR0A 2RKIB 3N6LA 1S97A 2OPQA 3IRXB 3UDLA 4DL5A 1JXLA 3QGIA 4ECUA 5K14B 3QIDA 4RW4B 1RTJA 1TV6B 2ZD1B 4I7FA 2VG5B 4ZHRB 2AGPA 3KMQA 3KHGA 4IQXA 1T3NA 3HHKA 3IGNA 5DLGA 2YNFB 3CDUA 4WZQA 3MEEA 2HNYB 3KHRA 3C6UB 4IFVA 2IC3A 1BQMA 2B5JB 2UUTA 4IH5A 1RT5A 3BGRB 1T03A 2YNHB 5DLFA 2BQRA 3OSNA 3KOAA 2ZE2B 5KG3A 4NZ0A 2R2RA 3PW4A 4ZP7A 1S1VB 2I5JB 4MK8A 1GX5A 1C0UB 3KJVB 4LSNA 4FBTA 1REVA 3OL9A 4ECZA 5DGAA 3OSPA 1RT4B 1SV5A 1RA6A 5L1LA 1LWEB 3T5LA 1DTQB 5DQGA 3Q8QB 1C0TB 3RBDA 2YKNB 4IRDA 3CJ4A 3JSMB 3UQSA 2IM3A 4TQRA 1JKHB 1HQEA 4Q8FA 3I0RA 3V4IA 2FLNA 5F8HA 3HVTB 1SUQB 1S1TA 3FFIA 4NLTA 1N5YB 3GIMA 4J9NA 5HP1B 1IKVA 4DL7A 5DG7A 2BRKA 1LW0A 4PWDB 4O3SA 3M8QA 3GV8B 1SH0A 5KG2A 5J2PA 3GIIA 4ECYA 1IKWB 2OPRB 1Z4UA 2GIQA 2D41A 3TVKA 1RT1B 3DRPB 3DLKB 4G1QA 5T14A 3LP2A 4U7CA 1IKYA 4RW6B 2FLLA 4ED3A 3OHAA 3RAXA 2AGOA 3KK3A 3MEGB 2OPSB 5EWGA 5KFKA 4MFBA 2V4QA 4MH8A 2WONB 2ZKUA 3I5AA 4KV8A 4Y2CA 3KHHA 1TL3B 5C25A 3KLHA 4IRCA 4ECQA 1FKPB 2RF2B 1ZTTA 5KFYA 3MTKA 5L1JA 3MFIA 3NL0A 4O3QA 2J6UA 2UVVA 1RTIA 1JLAB 3H59A 3KK2A 4KAIA 3DDKA 4F4ZA 1MU2B 2HMIA 1U09A 1S1XB 4KO0A 3D28A 3PJXA 4RNHA 4QWDA 1JX4A 3LAKA 1TKZA 1S1UA 4ED1A 1TVRB 3LANA 1S4FA 1SH3A 4MIAA 2UVWA 1LWFA 1TQLA 4NYZA 5KFXA 2OPPA 3G6VA 5KG7A 4ICLA 4O4GA 3MEDB 1N56A 2WTFA 2FVPA 1C1CA 3T1AA 1UWBA 4DG1B 4YR3A 1HPZB 5KFDA 1GX6A 4NLRA 4R8UA 2IBKA 5KFSA 2DPIA 4ED6A 3NBPA 2CKWA 1JLEB 1S6PA 3DOLB 3H5SA 4J9QA 4J9LA 3H5YA 1JLGB 4J9KA 1RT3B 3V6DB 3H5UA 3T5KA 3KK1A 2WOMB 1JLFB 3DM2B 3QIPB 1S9GB 3GQCA 3I5CA 2BE2A 2YNIB 1VRTA 4LQ9A 1HMVB 2C2RA 5KFNA 1LW2A 4ECVA 2ZE2A 4XPEA 5J2QA 4NLWA 3Q8PB 5DGBA 4Q45A 4KB7A 1HQUB 1S0MA 1HNVB 1K1QA 2I1RA 3GYNA 5KFTA 3I0SB 4JV0A 4NCGB 4RW7A 1HNIA 4IH6A 4WZMA 1JLQB 2IM0A 4DL2A 5I3UA 2HNZB 1LWCA 4Q0BA 3IG1B 4I2PB 1DLOB 5KT4A 5J2NA 4PUOA 2ATLA 4ID5B 3JSMA 4GC6A 2QE5A 1QE1A 3OLBA 1EETB 4NLUA 1RA7A 1C2PA 4DEZA 1JLCA 2YNGA 4Y3CA 2ASDA 5J1EB 4G3IA 1EP4B 4WYLA 3KLIA 5HBMA 4EO6A 3OL6A 4F4WA 1RDRA 4ZVHA 3SI8A 5F8NA 5KFAA 3M9MB 1T05A 1S9FA 4HYKA 2C22A 4ZPCA 2F8EX 2FVQA 4MK7A 1ZETA 4B3OB 2RDIA 5CYQB 5F8GA 3DLGA 4O3PA 1S6QA 2VG7B 4H4OA 4KSEB 4JV2A 3E01A 2AX1A 4EBCA 2BQ3A 4URGA 2AWZA 3C6TA 2HAIA 4O3RA 4IFYB 1C1BB 4I2QB 4ED2A 4RNMA 3FSIA 3V81B 4KBIA 3LP0A 5FDLA 2RF2A 3SFGA 1N48A 4NLDA 5C24A 3DI6B 4Q43A 1RT6B 3QLHA 2R8KA 1FKOA 1ZTWA 4ECXA 2R8GA 4Y2AA 3M9NB 4IG0A 5HROA 2XI3A 4ZVFA 4XPCA 2HWHA 4RW9A 2IM2A 3CDEA 5KFMA 5KFBA 3QZ8A 1R0AB 2W9BA 2E9ZA 3D5MA 1S1WB 4IDKA 5KG4A 3DYAB 5HLFA 2YKMB 3H4BA 4J9MA 4GC7A 1IKXA 5C42A 4IRKA 2E9TA 4RW8A 3G86A 5KFZA 2JEIA 3BQ1A 1RTDB 2V0NA 3CJ0A 1QAIA 3RB3A 3LAMA 4IR1A 3GILA 4J9RA 4NLGA 1NNDA 3DM2A 1D1UA 3IN5A 1KLMB 2JC1A 5KFRA 2XCAA 4O44B 2C2EA 4J9OA 3OHBA 1HMVA 4NLSA 5KFPA 4TY8A 3CIZA 4WE1B 1WNEA 4LSLB 3DOKB 5D3GB 3Q8SB 3I5BA 3MF5A 4RUAA 1IM4A 1TL1A 3KLEA 2W8LA 3LP1A 4NLYA 3H4DA 3NGDA 2W9CB 1TKXB 2BR0A 2HNDA 3QO9B 3PW2A
chains in the Genus database with same CATH superfamily
1ZM4A 1VISA 5AT1B 2HLTA 2V9WA 2ZUAA 1SC4B 2ZITA 3D67A 1AROP 4J7CA 2ZZTA 4C8NA 1D8YA 1HWLA 2VG5A 3AT1B 3HKZD 4I6WA 2JLFA 3V4MA 2VH7A 2ZDPA 2IPOB 4LF6F 2HZVA 2V5HG 4OHZA 4UOCA 4BC9A 4O3OA 4HR2A 1XWLA 1SVDA 4ZPWR 3CJTA 2Z30B 2HYIB 2XWXA 4K4TA 2ZOMA 1G4CA 1BMQB 1R43A 5GAHU 2WW8A 2MLYA 2MQPA 4K2XA 4CT8A 4HHHA 4B3MF 4FPRA 3CTRA 1WF1A 4RW6A 4J91A 3TAPA 1GXUA 3MEGA 4GKJJ 1FDAA 1FXLA 4N7TA 1GK8A 1S1UB 4DV3J 4RBTA 4MIBA 3RAMA 3T9ZA 1FTRA 3A8EA 4K50A 1KC8T 3W65A 4X64J 1W26A 2AJFE 3N5BA 5D8HB 5T7LB 1DJ0A 3M2VB 1R27B 4MKVA 3G6XA 2IJFA 3R8YA 2HFOA 1HARA 4FXWA 3BBBA 4TN2A 3LUYA 4PXDA 2ZNYA 3GZ7A 3BGFA 5DQIA 2D3ZA 1Y3JA 4LFCJ 3ILLA 2L9WA 5HK4A 2ZM6J 5GMKa 1U0HB 4H4OB 4FF4A 4B9TA 4FF3A 5JUMA 1WG4A 3BQ2A 4DL6A 1FE4A 2NCKL 3W66A 3G6YA 5HI7A 3TAQA 3LP0B 3R2CJ 3R5BA 1OS5A 2YX4A 4QW8A 3HKWA 2VOPA 5HVGA 3M32B 2UUCF 3WZ0A 3GG1A 1KONA 4FVCA 1MWQA 3BO4A 3TA1A 5JXSA 4QW9A 1CULA 6AT1B 4A46A 4Y6IA 4LQ3A 4OHXA 1SJFA 2VHGA 4LSZB 3MM7A 5CYJA 2WAQD 3UD3P 5IFMA 5DDRC 4EFAC 2IVMA 2R2UA 2XI2A 3UPFA 1EX8A 1UW9A 5AXKA 5B0CA 4DL5A 4TVAB 4ZHRB 3KHGA 2MTLA 2HNYB 2Q6CA 4CYUB 5D4LA 1T02A 4NZ0A 1X9MA 4ZP7A 2KT3A 3BZQA 2O67A 2I38A 1C0UB 3BDEA 5E2QA 1SV5A 2B4VA 4FPIA 3CD0A 5L1LA 5DQGA 2DO4A 3Q8QB 3RBDA 2XY7A 1R8HA 1QY7A 2RIJA 4YUDA 2CQBA 1CJVB 1KEKA 5IQ6A 1SUQB 1IKVA 4FKYA 3R2DJ 3GIIA 1UPMB 2Z8QA 3KJFB 2NXNA 1RT1B 4G1QA 3G9CA 1RWPB 4F0MA 5EWGA 2ZHOA 2V4QA 5HANA 4U95A 1HHSA 4ED1A 1BQXA 2CYYA 4ICLA 4QIFA 1CJKB 1V3SA 2JLGA 3DM2B 3GQCA 3I5CA 3OTOF 1X4FA 4LF2A 4NLWA 4RL1A 1AT1B 3AJ1A 4BC7A 1JLQB 2B4UA 3NS7B 1E6YB 5J2NA 2ZVIA 3I9ZA 2BVZA 1NKCA 2QE5A 1EETB 3AQOA 3TP2A 5F8NA 5KFAA 2C22A 4A8XA 2LQ8A 2Q43A 1MN9A 2XMJA 4JV2A 4ATNA 4BLGA 1B70B 4FXDA 3VGUA 2F4VF 1BLUA 1BD6A 2GJ2A 1T0TV 1BE4A 1DBDA 1PSDA 3QLHA 2F4FA 2E9ZA 4PPZA 4RW8A 1WWHA 2MYFA 3M8YA 1L3KA 4UOFA 3BEGB 2OLWA 3FCWA 2QLJB 2CPJA 4KC5A 1SQFA 3R5GA 1EKRA 3CIZA 1SKUB 1RK8A 1IM4A 4ZVUB 2CQ2A 4PXCA 4D3HA 1B7YB 3H2UB 2W9CB 3KLFA 3M8PA 3TUPA 3ITHB 1S99A 1OIAA 1Q53A 3DRSB 3IAS9 3ZZRA 3DMJB 1BHNA 1VQOS 4XDCA 4LF1A 3W60A 3VHQA 2DB1A 3LALA 3ENVA 4ZPBA 3BSAA 5IS2A 2Y0SD 2CJQA 4ZCKA 2LMIA 1CQNA 4LSNB 1X31C 2E5GA 3UD5A 4X2BA 4Z37A 1J5EF 4MTPA 1LFPA 1FNMA 1UVMA 2D3UA 1G1XA 1HQEB 1HW9A 2BJDA 3ZXWA 3O6QA 4I67A 2VUGA 5HAOA 1JJ4A 1TUGB 1KP6A 5EWEA 4K0KF 4DFKA 3UD4P 4HVZA 3DRPA 2X3DA 4G1PA 4OHYA 3X3UA 3HFZB 1NXIA 2ZEJA 3JB9k 4OJ3A 2CQDA 3GJRB 1WG5A 2CQ3A 3N4WA 4QYRA 2BEFA 2NXEA 3NBPB 1X4DA 2KYXA 3G8QA 3W5XA 2YWHA 1CG2A 2XG8A 3KKFA 2BE2B 4ED7A 1LW2B 5J2QB 2C3OA 4K5SA 2V94A 4RLEA 3G2XA 1H2UX 2OEJA 5DETA 5C5JA 4F25A 5KFGA 1Y0HA 3NS5A 2VC1A 1A9NB 4DV0J 2XCPA 3CCSS 1ZYQA 3RB0A 2MZ1A 2FDNA 2J9DA 1M5OC 1P1LA 5C24B 3K59A 2VQEJ 2CNLB 2ZJPQ 1LQ9A 2ZH9A 4RW9B 4IDKB 3WIVA 3R3TA 2E1CA 1ZZNA 4UUXA 2OTJS 3G8TA 3H2LA 2C2ZB 3HD1A 3CO9A 3OLAA 1IKVB 5DJBA 2ZH7A 3PEHA 5EUHA 3IR6B 2C28A 1PAUB 4LSLA 2IYIA 1H73A 4RU9A 1N52B 2M70A 3BSOA 4ZP9A 3BV8A 2E1PA 2OELA 4MKAA 1UA0A 2CNOB 3Q22A 3QT6A 4AXIA 3MDFA 1YBTA 1NRKA 5IXUA 4ID8A 5CCLA 4RW4B 4DN9A 1XK8A 4IQXA 2CWKA 2DRBA 2J8AA 3BGRB 2BQRA 3THPA 4F02A 1HNXJ 1KNZA 3MM8B 3PW4A 1TK0A 2G9OA 4MYTA 1VMBA 2DNPA 5HMWA 4IRDA 1R89A 4FZVA 4N56A 3V4IA 3QPIA 3FFIA 4OYAA 4J9NA 4DUYF 4USTA 4M8LA 2NXUA 1PCAA 2OPRB 1U1PA 1KVKA 2CUYA 4UY8T 3DU6A 2OD6A 2A18A 1U4BA 2BJ8A 3UO0A 4ETXA 2WONB 2ZKUA 5FJ4A 1Y7PA 4O3QA 4LUBA 2LU1A 1HWUA 4PG8A 1UAWA 4LF6J 1D09B 3D6TB 2DGSA 1H7XA 2C3PA 3JTPA 1S6PA 4DV1J 3QIPB 2G4BA 4A8KA 5HJYA 2PMHA 2G13A 2SXLA 1MWZA 3RR7A 1FWPA 1FX4A 3MMAB 4F2SA 2ACMA 2P2CB 3PCOB 5FIIA 4DL2A 3VAKA 4I2PB 3OJUA 2CPHA 5D0RA 4MT1A 3ZO7A 1YKWA 1Y9OA 2QMUB 3D7SB 1JLCA 3OL6A 4OZJA 4HYKA 3TNVA 4DR2J 4B3OB 1DARA 2HBYB 4ALZA 3W5ZA 1HWJA 1KQFB 3E01A 2VPZB 3CSKA 4U7UK 1U47A 1U2FA 1ZAVA 1RT6B 2Z2MA 3IM9A 4AT1B 2HWHA 4OYXA 3BF4A 2P8IA 3KXDA 2L48A 2JNJA 4P73A 1LK7A 2B0GA 2UU9F 1SIWB 2CZVC 4NLSA 4TY8A 1TL1A 4NLYA 3NGDA 1NPPA 5E5NA 1S10A 1Y11A 1UMJA 2I2YA 1U1NA 2W9AA 3Q83A 4DOZA 1RT5B 1WOOA 3A8KA 2NSBA 1RHQB 1XMBA 4IKAA 3RW6A 3ET6B 3PYGA 1S1VA 4CIOA 8ATCB 1M1GA 1BWEA 1DTQA 2MMYA 2XZWA 2UUBF 4IO1A 1RWKB 5D0HA 4PWDA 2ZH6A 3CCMS 2D74B 2NXCA 4DQSA 4MFBB 1DURA 2IBOA 3D66A 2R7TA 3VF0B 4DJBA 3MR3A 3PRVA 2CZ9A 2KXNB 5BYRA 3JTNA 1S1XA 3ILOA 3K2YA 4F04B 1F3VA 4FYYB 3H90A 2VBZA 4GKKF 1WC4A 3OTBA 2DNMA 2X1GA 4B9UA 3ZTRA 4Q7AA 4K4YA 1FI4A 1X4HA 2VG6A 5KG5A 4QBUA 4ES1A 1ZA1B 2PO4A 2HNZA 2YNGB 5D77A 2KO1A 4YDXA 5F3TA 2AU0A 3NAIA 3UWTA 1KDNA 4C8KA 2QO3A 3NCPA 2RRAA 2OKQA 2ZH4A 5D78A 2DH9A 3N01A 4U8YA 4QCLA 2B3TB 3TQ1A 1G6BA 3IAM9 1DZ5A 2QMWA 2W9BB 5SZTA 4WFXA 1UVKA 2VF3A 4EYHB 3GFYA 2BE9B 5GAEI 3THVA 2JEJA 1OJ4A 3NGRA 3UR0A 2IA6A 3FFIB 1H7WA 4FBUA 4M5DB 3OVSA 1AXQA 4DZDA 2Y1JA 4C48A 1OO0B 4LRFA 2B8QA 3K5PA 4WIQA 5DM6Q 3MCSA 2D9PA 4RBVA 2F4VJ 4X4PA 1AA1B 2EXUA 3N6NA 3L09A 4CM0A 3EPIA 3DLHA 1PYOB 5LM7E 3W2WA 1RT7B 4KY3A 3EDRB 4QOTA 1SJ4P 1UJ6A 3W1YC 3KMQA 4I69A 3PYDA 2HHPA 3HHKA 2XS5A 2AT1B 3MEEA 2IC3A 2PT0A 3VAGA 3BPSP 3ZZOA 4OI0A 4CLKA 5CH7B 3J7YI 2I5JB 2V69A 3NCQA 3OL9A 2XMUA 1UVIA 1RT4B 1HKAA 2HRYA 2R9LA 2Y3YA 1NU4A 3N28A 5J2PA 3M6XA 4DPUA 2GIQA 3TVKA 1U8WA 4LF5F 2DTJA 3TA0A 2CA9A 4ED3A 4DV6J 1XNQF 2AGOA 3KK3A 2DYAA 3BBCA 2MQLA 3ZZ0A 1TL3B 1X8DA 3OQ2A 4ZIVA 3MUMP 2UVVA 3SV3A 2DNYA 3QRPA 1AFIA 5KFXA 3NWRA 4ZK7M 1HBUA 3R1HA 1AZSB 2DPIA 1MG7A 3H5UA 1YK9A 4PKDB 1SCJB 2XM3A 5KFNA 2ZBIA 4DR6J 4JV0A 2IDLA 4NCGB 5HO4A 1QJHA 1DLOB 2NYHA 2I6WA 2AJ1A 4P71A 2PI4A 1OPIA 1M5PC 2R7RA 3E8OA 1K44A 3RJMB 1SL2A 3SSQA 3P6YC 4YOEA 4F4WA 5HBMA 1U26A 2GS8A 2DRAA 4M5IA 2RH3A 4OZLA 4O3PA 2VG7B 4DUZJ 2BQ3A 5T41A 3C6TA 4O3RA 4IFYB 4KBIA 1D9AA 2KRBA 3I31A 3MCMA 3DI6B 1Q7YT 1O51A 1EJ7L 6FDRA 5JVGQ 2AD9A 3CDEA 4OLPA 3D5MA 3TZYA 5ETSA 3OXGA 2HFSA 5KFZA 2CQIA 1NLKL 2N7CA 2LFVA 1QM9A 1RABB 1OYEA 2Z2LA 4RJVA 4A47A 3DNCA 1W2BR 3M2RB 2KXFA 3I5BA 1RHKB 4RUAA 1U0SA 4FVMA 4BDPA 4B3RJ 2AW0A 3THTA 1Z2ZA 3K5NA 2KG1A 1S9EA 2KRRA 3CMQA 1J5OB 3HDSA 1RT2A 2BBEA 2OHDA 4PG4A 4AQYF 4I6YA 4LREA 3AA8A 1U6BA 2RAQA 1JLBA 5CD4A 4TY9A 4DL3A 2U1AA 4ELVA 4DR4J 2CJAA 2V2VA 1Q16B 2VG6B 4ED5A 3K5MA 3CUNA 2UXDF 2DISA 5LMUF 3BREA 2M0GB 4EYIB 1VC6A 5KT3A 1S1TB 4WTOB 5KFUA 1EQ0A 4C8MA 5EWFA 1X4AA 3HULA 3DLKA 4DR7J 3D6HB 2H5JB 4DV7F 1RTIB 3JYTA 2G2OA 1TP7A 1F60B 1M1HA 5AJ3F 2M9KA 1TFWA 1FNOA 3J7AN 3R5AA 1TL7A 2EBEA 1REGX 4NYOA 5MAOA 4CH7A 2CJXB 2HKEA 3MR2A 1NSPA 3CJRA 4I1TA 4LFAF 2KH9A 2A2CA 1RAGB 2RDJA 3NEKA 1JK9B 4KJIA 2DGQA 1WTFA 4RNOA 1N36F 2XS2A 2X1FA 1MMLA 1IJFB 4DSFA 4IH7A 2GHPA 2X7IA 3ILJA 2NYIA 3DXBA 1Z1ZA 1L3VA 5KFIA 4E98A 3R97A 4USIA 3TOQA 1XNRJ 3H25A 5K5MA 3SQGA 3HPOA 4A4JA 4DCOB 2OD4A 3PJWA 1RAHB 2O5DA 4Q44A 4CQ1A 1HNZJ 3CJ3A 3HHLA 2EFQA 1W7WA 2AKWB 4ZN3A 4GVBA 4PG5A 3OL7A 4LMZA 3BR9A 3UCGA 1XMQF 3DLEA 1KTQA 2UP1A 1I1GA 2NUUG 3HX9A 3MHYA 1EQMA 5E7OB 2GGPA 3L7UA 1FFGB 2DT9A 3CJ5A 4R5PA 2GNKA 4RUBA 1K9MT 3V6KA 1HYSA 2CPYA 3N6LA 3TUIC 2V2QA 4I7FA 1KR4A 1RB0A 1T3NA 5DLGA 3SDEA 2F8HA 3T1YJ 3B8HA 2QRRA 3GCXP 3KHRA 2B5JB 4DSEA 2RUGA 3KOAA 2R7OA 2R2RA 5JMNA 2E44A 2C2MB 4JOUA 4YB7A 3HZEA 2N4CA 4LFBJ 3CJ4A 4USKA 3MWBA 1V5IB 1WI6A 1OMSA 2B7BB 3SZ2A 2KG0A 2FHOB 1SH0A 4L3KA 2BUNA 5KG2A 1KRPA 3RAXA 4WF9Q 1GH8A 4Y2CA 3KHHA 2LDYA 2J9EA 4ECQA 3TEGA 2LXFA 1MU2B 4DSIA 2F65A 4OX7A 1SH3A 3DGPA 3ZNJ1 3CDAA 1GXTA 2WTFA 2NZ4A 4AL6A 2IBKA 2L9NA 4ENOA 3OVAA 2E7VA 1GXLA 1ZA2B 2DJWA 4XAKA 2FGOA 1KKHA 1HQUB 2JFDA 4DV2J 4ER8A 4A8FA 5ETOA 3N0VA 4CLLA 4G65A 2RS8A 1WJ9A 4B3TF 2BOPA 5BYQA 3MPDA 4ZLPA 1Q82T 4DQQA 3Q0AA 4PQAA 4DCPB 1QTMA 4CDIA 2N82B 2AX1A 1RCOB 1PGZA 2RF2A 1N48A 4E8UA 2HBQB 4KIAA 1KLNA 5K9FA 2XI3A 4H4KA 2AF6A 2RQKA 3DOMA 3BPDA 3G86A 5DZ7A 1VQ4S 2WVBA 4ZVQB 1FRXA 2BM0A 2D3OR 2XCAA 4J9OA 5A6WA 4LF8J 5K8PA 2DH8A 1Q81T 2W01A 2DNKA 4YN3B 1RI7A 2CQ1A 3JYTB 4P9SA 2QFIA 4CO4A 2L3MA 4F50A 2PSZA 3W2VA 2FZGB 1SIZA 1FJGJ 2HGMA 1RAJA 2OPQB 1BQNA 3M8SA 2F1FA 3W62A 2XB2D 3FSYA 5F8JA 3I96A 2VFRA 4FS1A 2KJVA 4C2MA 1H3DA 5IWAF 2YNHA 2Z2YB 2FLOA 2YVSA 4NXMJ 5AXMA 3PACA 1HBMB 3VV2B 5LMNF 3DYAA 5F9LA 2JWNA 3MM5A 1DHMA 5E3PA 5IV4A 2YKNA 2BOAA 3JAMY 1XR6A 5DG8A 1O8BA 3IGVA 4EZ6A 4O44A 4W98A 4CLWA 2J6SA 1IKWA 3KMSA 1VQKS 3MUVP 2DNHA 3HVWA 2MKIA 3O8WA 5C25B 1N4LA 2HFZA 3KK2B 1Q8LA 1CVJA 1QUPA 1QAJA 2ACYA 4HTIA 1I94F 3QJJA 1TVRA 1H2VZ 2FJXA 1VBXA 5G0RB 4R8UB 1B7FA 2Z0GA 3NNHA 3V6DA 1VRTB 2BANA 2WOMA 4Q2MA 3TJAA 4DX7A 2CJYB 4AL7A 1HNIB 1YJ7A 3DLEB 2K3IA 1HD0A 4OZ1A 4Q0BB 4NPOA 1AYEA 1QE1B 1ZPWX 4BHQA 2GGPB 3OFEA 2VFUA 3NKYA 1F5BA 4UUWA 3SMZA 3HD2A 3AD8C 3LTOA 3KUHA 2DHAA 1FDBA 5A8WB 5HN0A 1RHRB 4JI8J 5KT2A 3I55S 3I56S 3DRYA 1NO8A 4C0OC 2B43A 1IJEB 1HD1A 1X60A 2OSQA 4NLXA 4DXLA 3CXCR 1WC6A 1N32F 3W9HA 1MROA 2MKSA 1IKXB 1SQGA 2MKJA 3FQKA 3SBMA 5CZXA 3VCDA 5E3CA 2XMMA 2FHJD 2FHKA 4I4BA 3IS9A 3DDIA 1L3TA 4TYBA 2RHSB 4CLFA 4JI5J 4UQTA 2W7OA 1VYAA 3WDOA 3R1LA 1E6VA 3QO9A 3PXGa 3AXKA 3V2UC 1I5OB 4Y2IA 4DI6A 1VQPS 2JH3A 1RTHA 5K8OA 3LQVA 2DKOB 2QJ3A 1PC4A 1JXLA 5K14B 2CPEA 1RISA 3QFHA 3U02A 3U1MA 3N9UC 4EZ9A 5CA5A 2X51A 3TX8A 1XEZA 2VJVA 1RWOB 1WKKA 2CQ4A 5CQGA 4M5NA 5DGAA 2FB0A 2MHEA 1Q78A 5LXRA 4P72A 4DPYA 2DNGA 3OJSA 1N5YB 4JI7J 4DPTA 2B8PA 2XSJB 1U45A 2KB2A 2FLLA 3J81j 3L95X 3MD1A 1XQIA 1F9HA 3KLHA 1FKPB 2RF2B 1YHQS 3MTKA 4QWDA 3PJXA 1MWYA 4DR5J 1LWFA 3UDVA 5LMUJ 1C1CA 3IBCB 3RRGA 4YR3A 5ETMA 5KFDA 5KFSA 4J9KA 1SL1A 2PMZD 4OJ1A 1TAQA 5IM0B 4V19X 3O5TB 1HNWF 3OV7A 1HA1A 5L46A 3FEYB 3MM6A 4DV7J 3TRGA 1O5JA 3EXYA 2Y1RI 3AHPA 3UVJA 2CQPA 1BY9A 3EXCX 3PFEA 4RNMA 2KFYA 4DX8H 3Q2SC 4J90A 1FKOA 4Y2AA 4IG0A 2OMLA 5THWA 3H42A 2UUAF 4HDGA 3DYAB 4WK1A 4F4AA 3PFOA 3AXMA 2CQCA 3PX6A 3GPAA 2RU3A 4C8LA 1U1MA 4O44B 5ETVA 1GNKA 1UTAA 2X1AA 2ADBA 4A8YA 2HNDA 4X66J 3MAHA 1ZZFA 1Z2LA 2CXEA 3B78A 4RUHA 4M5MA 1XR7A 2IJRA 3A8JA 2QEXS 2ASLA 2ROGA 1WHXA 2IA0A 2N7YA 1ACMB 2X1BA 4ZLNA 2VASA 5BYSA 4ZLJA 3IRXA 1NK4A 3V81A 2BANB 3DFEA 2W7PA 1Q7LB 1F0XA 2HVHA 1WKJA 1OSDA 1VHIA 1D9FA 2JLEA 2MPUA 1MMDA 3QGPA 1X7VA 5GADI 3BQ0A 3I0RB 2FVRA 5KT7A 3J81Y 3PZPA 3PR4A 1U1OA 2J9DE 2MLXA 3VGVA 3E2EA 1VQNS 5CD4H 5RUBA 1VCTA 1VIOA 4OX6A 3D1QA 1ZH5A 5A8RB 3AODA 1UJ4A 4DL4A 1TKZB 1FKAF 4N76A 3UR3C 4EBDA 1IWGA 5F8IA 1MROB 2AV5A 1CSJA 2MY8A 2FJBB 1UWBB 1YSJA 1RYRA 3PYEA 4ED0A 3CC7S 4GKJF 2J8SA 2RU9A 3TAMA 1UFWA 4DV3F 1MSWD 3IS9B 4ED8A 1IN0A 1NH7A 2VPWB 5CZVA 1G7CB 5D6GA 3B4MA 3QT5A 4X64F 3I0SA 2ZUGA 4FF2A 2HZAA 1E6VB 4YR2A 5H9FK 2YKPA 1S6UA 2FJDB 1RTHB 2IDEA 1M1KT 2QG9B 1Q86T 3MEKA 3FMWA 2KT2A 1NK8A 3K5OA 3TZXA 1HWIA 3MR6A 9RUBA 3F0NA 2HW3A 1D0EA 3MFHA 1K1SA 1C1BA 4I2QA 3HVAA 3BDPA 4ZIWA 4NXNJ 2XS7A 2YWFA 5HROB 1PAEX 2XLIA 2XBPA 4M94A 3K0JA 1ZOTA 3WX4A 5C42B 2YKMA 2DD8S 5A0YB 4WFNQ 1P6TA 2Z57B 3C14A 4TU9A 3IR7B 2ILYA 3H98A 3HT0A 1VIXA 1IR1A 3ZZYA 3IWNC 4ETZA 4H4MB 8RUCA 2N3OA 1PG5B 2LEPA 1TKXA 4KKOB 4TXSA 1X0FA 3DKDA 2G2YA 3GCWP 4KGMA 2OH2A 3U1LA 3KHLA 1TMJA 3T19A 5C7PA 3W8GA 3NNCA 3MI7X 2E29A 2EK1A 4ZPDA 4YR0A 1SKSA 1YBAA 1CC8A 5BR8J 2HHQA 1S97A 1MMNA 3NY0A 3IWXA 1R3NA 3OPKA 1RBOB 2E1RA 4IFVA 3TUJC 3CC2S 4IQMA 2NR0A 2ZZNA 3MMBA 1NZ8A 1WHYA 4YHHJ 1Q4RA 3OFFA 4YY3J 4OIXA 3VGSA 4OYBA 3TA2A 5B0EA 2L08A 2PGCA 2V8HA 2FLNA 3MOZA 4MKYA 4DL7A 5DG7A 4OI4A 2BJ1A 3M8RA 1IKYA 2MB0B 3UVJB 2CFXA 1VI7A 2LA4A 2APOA 2LECA 2GHWA 4OZ2A 2DK2A 2IVYA 3H59A 3VAIA 5HQ8A 1JX4A 4L3NA 2JVOA 3HHDA 4C0HA 5IWAJ 2BYCA 4DZ6A 1N56A 3WQPA 3I87A 4DG1B 1UW4A 3NXZA 1RT3B 2ZC4A 2DHHA 4MYUA 2AHOB 5ADZA 2ZE2A 1JJCB 3UW1A 1HNVB 3QWUA 2I1RA 3CULA 3AOAA 3ZNUA 2QC3A 4X62J 2BW7A 2ZH5A 1LWCA 4CLZA 2ATLA 2MQNA 3D4JA 4K2JA 3F56A 4WP3A 2B9EA 4URGA 2AWZA 1NB7A 4DWIA 1IBCB 1GMVA 3V81B 4CH0S 5FDLA 1U24A 2UXCJ 3HXMA 4Q43A 4CT9A 5KFBA 1S1WB 5HL7Q 4GC7A 1IUJA 1X5PA 2JEIA 2F40A 1UFLA 4WP8A 3WX8A 1RHUB 4GVLA 4WPAA 3P96A 1NNDA 3K17A 5KFRA 1DRZA 4X84A 4JYAJ 1HMVA 2O01C 2E1AA 3ETOA 2NPIA 3D6MB 1L3UA 2F63A 3D3CJ 3DDNA 2BKNA 1FEHA 2OSRA 5KFWA 2RS2A 2CNNB 2MQMA 4QPXA 3EM1A 4M5JA 4KHPF 2XGPA 3N6MA 3KG0A 3HK2A 1HHQA 2YXLA 3OUYA 1U1LA 1MLAA 5ETPA 2ZD1A 3TAMB 1U2RA 1S57A 1OWXA 2HHWA 1YJWS 2JX2A 1ZM9A 3HM9A 2L41A 1RKJA 3QSYB 3BGOP 4ZCIA 2GO8A 3KJVA 1P9QC 1LWEA 2R8JA 2DGTA 3BKUA 3IP0A 1JKHA 4ECWA 4CI0B 1LW0B 3VAHA 5KG0A 1WEXA 3MM9B 2AQ4A 1F2GA 3LP2B 3DOKA 4QQBA 1LFWA 3MMCB 3X1LB 2RB7A 2HHVA 3T9NA 5DZ6A 4ANDA 1RWVB 2HMIB 4PCQA 1VBZA 3AOBA 1U1KA 2W2PP 2V8DA 1CJTA 3MEDA 1PYSB 2LEBA 1Q8IA 1B0TA 2J6TA 5D0GA 1JLEA 1X4BA 2J7UA 1FO1A 2G0CA 3CCUS 2UVRA 4Y2KA 2AYGA 1S7HA 2HQCA 2B6AA 4LT6A 3B4DA 2CNKB 5A76A 3GIKA 5EHHA 2CJ9A 4ZP8A 4ID5A 3R7BB 3C3LA 3O3LA 1T05B 3CJ2A 3NOGA 5GVQA 1LXJA 4PXEA 2XY5A 3OR2B 4N8OA 2ASYA 1S6QB 4MKBA 1PJ7A 2M52A 4PPDA 4IG3A 4NLQA 4P2XA 1C4CA 3DLJA 1KD1T 4IFVB 4NCBA 4J9UE 4DV0F 5KFJA 1IR2A 1HNWJ 4X4SA 4LBHA 5J2MA 3GMGA 4UTGA 3UN3A 5A8KA 4ZN1A 1SJ1A 3H7HB 2VQEF 2H9ZA 4CO0A 2V4JA 2J7WA 2ZZMA 2V2KA 4IOAQ 3OFGA 4F26A 1SC3B 1TKTA 3BYPA 1X9WA 3W9IA 4K4VA 1NBEB 2V6AA 1JJ2R 4TU8A 4KFBA 3FSXA 2EFGA 2RKIB 1M0SA 2XHCA 4MJKA 1TV6B 2AGPA 4OJGA 9ATCB 2R3VA 2ZE2B 2DNQA 2J5AA 1QAYA 1DQAA 4F36A 4X4OA 1REVA 3HHNB 1C0TB 4USJC 5A2QU 4TQRA 1NEEA 2XMWA 3AJDA 2G1HA 2ZJQQ 1HNXF 1HFEL 3GV8B 4C8YA 3KWMA 4ZLLA 3GFXA 3AD7C 5KFKA 1HBOB 4GO5X 3MPWA 1N5TA 4OHWA 3PO4A 5KFYA 1ZTTA 3MFIA 2GVZB 1JLAB 3R5DA 3R7SB 2V34A 3LANA 4JI6F 2CQ0A 2ZBRA 1SI9A 1VFJA 3S8SA 3H5SA 3H5YA 1JLGB 1JLFB 4GRSA 3ZTOA 4ZCMA 4NA2A 3RBXA 1HMVB 3SCIE 1K1QA 3T6JA 4RW7A 5IT9U 4LRAA 2PDAA 5I3UA 3IG1B 3G4SS 2JZ5A 4DV1F 1CEZA 4GC6A 3OLBA 4P7TA 4TKTA 1EP4B 2AYMA 3KLIA 1YJVA 3AAWB 4EO6A 4HACB 2RRNA 2YTCA 3J80U 2F8EX 3IM8A 4JI4F 3OR1B 3OUYB 1B0VA 2QZ8A 4C11A 5LT5A 5B0DA 4A8OA 2LXIA 2R7WA 3SFGA 1FFSB 4AUKA 3K5LA 3AJ2A 2R8KA 3EZ5A 2R8GA 4DR2F 4OV1A 5HLFA 1B0PA 1ULRA 1Q1KA 2C2KB 3NGKA 3KDOA 1T11A 3TARA 3MTJA 3S1TA 3CDBA 3LOUA 3PYFA 1TK5A 3DOKB 4J5OA 2XZTB 4ZVPB 1GT8A 3HHLC 4F8RA 4HTJA 2BR0A 4NMLA 2GX8A 3VAJA 1Q95G 4NI2A 4EK2A 1TFYA 4KE5A 4OYMA 1RBLA 5J1EA 4YB5A 3GONA 3LH2S 3GTYX 2DHXA 2RUSA 1S59A 4WJBA 2DPJA 2NS1B 3M9OB 4HI2A 3VVUA 3KJNB 4LF4J 2HIYA 2H5EA 4FF1A 1KHWA 3G8SA 4USVA 1TUWA 3KNAA 4WXWA 4DQRA 3C6UA 2ZH3A 2B6AB 2FJWA 1JXVA 3BBFA 1WDDA 2P9GA 3KLVA 1FVQA 3CCVS 1HL6A 3MCOA 3NAHA 3MUTP 5AE2A 1UJ5A 3HVTA 1Q0NA 2M5YA 3FUYA 1Y4ZB 4NEYA 2R4FA 2DNRA 2HWTA 4IG3B 3CVKA 3QNWB 1S12A 2KZZA 4CZCA 3RUBL 2KU7A 1P27B 3CMAS 2IMWP 2OPSA 4WK3A 1N5SA 4J37A 2OPPB 2VFTA 4GO7X 2BABA 2VU5A 2K7JA 2Q1LA 4WYWA 2Y9HA 4ZVGA 1BWVA 5J2MB 3A3NB 1HPZA 4RPFA 3ZZUA 1CS4A 3M1VA 3DOLA 4TLRA 2MQ8A 1N33F 5DG9A 4NA1A 1T8EA 2AJQA 4N47A 1S9GA 2PE8A 3ICLA 4Z7CA 2LQ5A 2J0XA 1Y5IB 4LBIA 3NCRA 3NMAA 3UN2A 3JQKA 3ZTSA 1C4AA 1KTVA 1FD8A 3OVBA 3CCZA 5KG1A 1T9YA 3GYGA 2K1RB 2Q3PA 3PNIA 3H20A 1A0OB 2LQJA 4HT5A 4QWAA 2HS0A 2PMWA 2ZNZA 1OY6A 2MQOA 5HSPA 4ILMA 1YWXA 4NLPA 2VDIA 1FK9A 3EGVA 2DRDA 2HQ3A 4L6V3 3AH6A 2HVIA 2CPFA 4ECSA 1NSKL 4IOBA 4ES3A 4CWBA 1RAIB 1VQ5S 4H4KC 4FYXB 3G82B 1KWMA 3VTIA 4OZ3A 4A8MP 3LP1B 3L9ZA 2DH7A 4CCHA 3PW7A 2VZ9A 3T1HJ 3MZIA 5J1PA 5LSOA 4DR1J 4PXBA 2R7VA 4B9MA 3GJTB 4LF9F 4K59A 2YWEA 2GAGC 3P49B 4PWUA 5E3QA 1NHKL 2LKZA 2VG5B 2PA8D 4A48A 3QT7A 4IUFA 3T41A 1H2TZ 2K3KA 2WBMA 2OO4A 1ROFA 5KTQA 2CRLA 2DXEA 1FWKA 1KQGB 5HMXA 4KGKA 3VAFA 2M8DB 3D0HE 3QQCD 2XLJA 1CJUA 4BWJA 2L9DA 4ZPVR 1APSA 4PYDA 3PX4A 5B0BA 4ECYA 4OZNA 1Z4UA 2OMOA 3MD3A 1NJXA 5T14A 2GMLA 1VLYA 4KHPJ 4RW6B 3PM9A 3RW7A 3MEGB 3HJVA 4OI3A 2ZWOA 4ELUA 4OYZA 4C3MA 4F7VA 4IRCA 2V67A 5IC4B 1NDLA 1OQ3A 5ETTA 4KO0A 3ONQA 2CVEA 1HI8A 4NYZA 3AD9C 2B56A 2DR5A 4J9VA 4DV6F 4JBCA 3KK1A 1NKBA 2N4DA 3M6VA 5GMEA 2VDHA 2YWGA 2OJ3A 1U1QA 1YG0A 4CLYA 3NGUA 3O1LA 4PUOA 1FESA 4JV5J 1U02A 1YDLA 3DC2A 5J1EB 4G3IA 4DR6F 3A1YG 4OYWA 2H48B 3DLGA 3W5YA 2CVIA 3CEDA 1LXNA 3HSGA 1W2IA 2YWKA 4WKRA 3WIUA 1M5SA 3IXQA 3Q8UA 3SSRA 1LOUA 3BO2A 1CULB 1UCNA 4DUZF 2OTLS 3SCKE 3POTA 4RR5A 5CHCB 4DFPA 3NRBA 3FCVA 3MM7B 3J7ZT 1YIJS 4NX9A 2C42A 5E0OA 3MR7A 4OX9J 3LF0A 2DR7A 3MF5A 3DU5A 3KLEA 4CP5A 3KUGA 3R6GB 2ZH1A 2MLZA 1VLOA 3L7PA 3J7A1 2WCXA 4TNOA 5L8RC 5L39A 4CM2A 2EC0A 5FLXU 1GAOA 1NMEB 4FKXA 4B3RF 2ZKTA 2FJAB 4OZ5A 4JI3J 4X4RA 4FYVB 4YP3A 4EI2A 2YNFA 3R9LA 3PR5B 2WK4A 3SEOA 1FNXH 2R2SA 4ZJLA 4DR3J 2IM1A 4JI0J 1SV5B 2CPXA 1BUXA 2BX6A 4P74A 1NHUA 4DR4F 3ENAA 4H54A 5HJXA 4ZDNA 5HP1A 5DRKA 4F3QA 4AE5A 4G1QB 5BXIA 3RAQA 2M3DA 3PJ9A 2IFXA 5KFCA 5AXLA 3ZC4A 2VFVA 5LL6d 4LF7F 1V9OA 2XQCA 4WXOA 4HL9A 3PKMA 4ICLB 1FK9B 4OHVA 3HHLD 3VQTA 3BJYA 2ZJRQ 4ZPAA 4DR7F 5KG6A 2W2QP 4ANCA 3SCLE 4CRJA 3SQOP 4P7VA 5B0FA 2UXBJ 3MR5A 1RWUA 2YNIA 1RSCA 2XC9A 3ISNC 4Y0FA 4M1KA 2E66A 2MJUA 2MZSA 4K4ZA 2KKHA 3R6LB 3TQEA 5J2NB 3HFKA 4WKYA 3PKYA 2DHGA 3KDNA 1NSQA 3LPYA 4CLPA 1W25A 3A3PB 3QWPA 2MHNA 1URNA 4JI6J 1F2HA 4P52A 2W8KA 5CYQA 3QAUA 2RNEA 7AT1B 5DQHA 2V9KA 2YBVA 1N34J 5ITHA 3QLHB 4L74A 1UPPA 4N5SA 2GQQA 3I4PA 4DPXA 5FD1A 2B51A 2OFGX 4RW8B 4KPYA 4QR0A 1MW7A 2NXJA 3QSIA 2W4CA 1RTDA 5E3AA 1YJTA 1VBKA 4YEAA 1OY9A 2PEHA 2XO7A 2E5LF 1XNRF 5D4OA 3QMQA 3T5HA 2MKYA 3TZWA 4OYPA 4ECTA 2FC8A 2DR6A 3AFGA 5D3GA 2RD5C 5LJ5Y 3KLFB 3M8PB 3OL8A 4K4SA 4JI4J 2JVRA 3HCXA 1HNZF 4N41A 2QSWA 2B9YA 3QZ7A 2KM8C 2VQFF 5I3PA 3HMJG 4XDDA 3O2IA 2GA7A 3MAQA 2XO6A 5LOQA 2BDPA 4R0JA 1S5ZA 3IGNA 3CDUA 2J0QD 3JS9A 1U25A 3VAMA 4EGLA 4QR1A 4FBTA 2YWWA 1PJ6A 1PC5A 1RWWB 2AMCB 3T1YF 4Q8FA 3TYTA 3RYLA 2CPDA 2KTQA 1S76D 4ZA1A 3NNAA 3O44A 2CDRB 3MURP 3DRPB 1JNZB 2KHDA 4KQZA 2EG1A 4LFBF 3OHAA 4QPTA 4DFMA 2J76E 2WVCA 3BR8A 2J6UA 4L73A 1U09A 4RNHA 1S1UA 2UVWA 3HSZA 5GAGI 1RZMA 1T3OA 2LP4A 4DV4J 1X5OA 2CPIA 4OI1A 5T7LA 2G1DA 1SC1B 3M2VA 4LQ9A 3NG8A 1KQKA 2RILA 5MLCV 3GYNA 2CQHA 4DQPA 4WZMA 3US5A 2W25A 2AYBA 3PRDA 3D54A 4DEZA 2I8EA 2KFNA 3QT8A 4TU7A 1VQ6S 2GMJA 2R7XA 4DCJB 4DV2F 4OI2A 1SXLA 3U27A 1U0HA 2W1BA 4H4OA 2VOOA 2MSSA 4HDHA 4EBCA 2HEKA 2D1CA 5GAEU 3M05A 2FJEB 1S6OA 3BH7B 2E7WA 3AB4B 3LP0A 4WWSA 3NLCA 3TVYA 1N33J 4L76A 4NLDA 4ITSA 5CAAA 3KG4A 3ZZTA 2C3UA 2O3DA 1VRQC 2RT3A 2DGXA 4IRKA 3OXLA 4M5GA 2BM1A 4C6AA 2Z2ZA 6FD1A 4PYAA 2W2MP 2RHQB 3D68A 4LSLB 1VJWA 1M5VC 1YJ9S 4PRFA 3P5TL 2CG4A 5E33A 2UUWA 5IOLA 2LQ9A 4KYZA 5KFVA 2ALZA 4P6QA 4LF8F 2HVZA 4F4YA 1UWAA 3SSSA 1HLWA 1VQMS 3L4BC 2I9SA 3J7YU 2KVQE 3EGZA 2C2DA 4UT4A 3GR1A 4ZHRA 3RRHA 2HNYA 2UZAA 4DX6A 4CYUA 4ECRA 1FJGF 2ZHBA 3IBWA 1XR5A 3SXLA 4WIIA 1RXOB 1J2VA 2QN6B 2Q6BA 1C0UA 4EO8A 3GV7B 1KBRA 4EWTA 3V4IB 5JVHQ 1CJVA 3PVXA 3MGJA 4QJVA 2Z56B 2IHR1 1SUQA 4NXMF 4P2FA 3HLUA 4LF9J 4QR2A 2A6OA 4O4RA 1RT1A 3V6HA 2GCFA 5AXNA 4F0HA 4CO5A 2HLUA 3WBZA 5M2RA 2ATCB 2WSEC 2B4PA 3IO1A 1HQ2A 3C16A 1WG1A 1YJUA 1S6PB 2XMAA 1CJKA 4KPCA 2WB1D 4DFJA 3PG9A 4E2FB 3U1NA 1OQ6A 2E9RX 3PX0A 2BJ7A 1QLNA 1VJQA 2MEWA 4JUZA 1JLQA 3RR8A 1RBAA 2WHOA 4O0NA 1E6YA 4CLUA 4K4UA 2WRMA 1JLCB 1EETA 4WU2A 2ILZA 1HW8A 5K8NA 1F6TA 1QAXA 3D0GE 3E01B 4A8SA 2IVFB 2EKNA 2W2NP 4XTTA 3EUNA 5ETQA 2FD2A 5F0UA 3BYRA 4OMFG 1SH2A 3LA0A 4QIGA 2UV8A 4JI8F 4ZPTR 3VGTA 3IR5B 4NRUA 1NZAA 1YZ7A 4FS2A 2HAFA 2D69A 2NSCA 4LRBA 4RZRA 3W7BA 2QX0A 1PIEA 2IJNA 2W24A 4TY8B 3P4UB 4USMA 3H0PA 1H0HB 2EFOA 4OQJA 1TL1B 2HRTA 4QYZK 3K58A 1VRUA 4XK8C 4OZ0A 3MMJA 2QLWA 5CYMA 1EKSA 2W9CA 5A6PA 3I9V9 2CJBA 3ITHA 2P5VA 3P8BB 3ISND 2AZ1A 3DRSA 4W92B 3DMJA 1Q5YA 1NJWA 4JI5F 2EK6A 3QGIA 1RTJA 1VS3A 1BQMA 3GFHA 3UCUP 5DLFA 2DEIA 3OSNA 2HHSA 3MOJB 1S1VB 2YPYA 4LSNA 2RSQA 5E3RA 3NGSA 1DTQB 2XYPB 1HQEA 3FCHA 4PG7A 2W4DA 3EWGA 4NLTA 3GSDA 4PWDB 5D0EA 4Y65A 1TK8A 1AB8A 4BBYA 2V2ZA 4P10A 5GAHI 1WELA 4KV8A 4JI7F 1S1XB 3D28A 2KI2A 3MPYA 3OT9A 5KG7A 5H9FJ 4P75A 5K8MA 3F41A 2B4OA 3TW0A 3NBPA 3T5KA 4FDFA 2VL1A 2BE2A 1PBAA 4DR5F 1LW2A 5J2QA 1ZS6A 3BGLA 1S0MA 2RRBA 1VOMA 2HNZB 3FJ2A 1YJNS 4FYWB 1D3WA 2QFJA 3A4TA 4LF7J 2QIFA 3M9MB 3TR5A 1WACA 2XHWA 2GQ2A 2RDIA 1WDTA 2BV3A 2HIQA 5IQQA 1M90T 2R7UA 5C24A 2KDOA 2N3LA 2J0SD 3CC4S 3LGNA 4ZVFA 4RW9A 3ETMA 1RLDA 4IDKA 3FNNA 1UVNA 3RB3A 1WF0A 2AZ3A 3K8WA 3IN5A 2JC1A 3EX7B 4U67Q 2XTJP 2G2ZA 1R0BG 1XC9A 2VJUA 1VK3A 4JI2J 2WSFC 4W90B 4YB1P 1JQGA 4RX6A 1NKEA 3QGHA 4HKQA 4DL0C 5ETNA 2FJVA 1P9YA 1U2CA 3W2WB 2A1BA 2Q79A 1O6XA 3DHXA 1NK0A 3C16B 5KOXA 1IVZA 1K8AT 2MZQA 4CNYA 4B3SJ 4KHRA 4B9SA 4X66F 4X4VA 1UVJA 4K4WA 1ZAXA 1P1TA 4RW4A 3MEEB 1S0OA 2IC3B 3FKBA 2E5LJ 2NZCA 1I51B 2EC2A 4F3MA 3BGRA 4B9VA 3G71S 4FP9A 1UL3A 1KN6A 3MM8A 4Q2LA 3C15A 3EPGA 4FXVA 2M7SA 2IY5B 1B64A 4ZJOA 2EW9A 1S48A 2YX1A 3HFVA 5L1KA 3Q8RB 1PILA 1KSPA 3VQSA 4NCAA 2VQFJ 5J2PB 1T7PA 2V50A 2PD1A 4U96A 1WHVA 1FFWB 2OPRA 1FDNA 4F0KA 3KK3B 3AA9A 1FTCA 1DAXA 3HF5A 4WCEQ 3PY8A 3EGNA 2WONA 4ZP6A 4TLQA 3EJMA 3BH6B 1IBKJ 2WZ1A 1PBUA 2G0IA 1YRXA 2DGWA 1HBUB 1RLCL 3RGIA 4QWBA 3GG0A 4IOCQ 4NYPA 4G6VB 2X3GA 1SQEA 4ZITA 3GB0A 2Y1IA 3JSRA 2C2NA 3QIPA 1SC6A 1R31A 4KTQA 2AEFA 2VV5A 1WTBA 3MMAA 5EX3A 1FJEB 1VRUB 2KHCA 2R7SA 1QD1A 4MK9A 5CYMB 4QU6A 5H1SV 4I2PA 4U6PA 1ZPVA 1N6QA 5HBMB 1B3TA 3SV4A 1WSRA 2ZOFA 3VZHA 2VA3A 4B3OA 1RTJB 3C6TB 1RWMB 3LGMA 4WFBQ 2IRXA 1BQMB 4BS2A 3FQLA 1QUVA 1FVSA 4ES2A 1RT6A 3NP5A 3ZFVA 2M2BA 4DSLA 5HQMA 5KFLA 2KL8A 3RG6A 2Y1LB 3MPUB 4N8NA 3AY0A 4OX8A 2FLPA 4AYBD 1RYSA 2EWHA 4NXNF 1NK5A 2HBRB 3JSBA 3H5XA 4O3NA 5KFEA 1WUUA 5H9EK 3W3SA 1X4CA 2GMHA 1S9EB 1NCLA 1RT2B 4KV8B 4C0BA 1ZBTA 4MIWA 3C66A 1N0UA 2ASJA 1JLBB 3CE8A 5KFOA 2ZH8A 4X65J 4LRCA 4ECUA 2XMTA 2EI5A 1NK9A 2GFFA 2XYGB 1RT5A 3TJ8A 1XMOJ 2RDDA 3LGHA 3ILIA 3PHTA 2BXJA 1WKLA 5AE1A 5BR8F 3ET6A 3Q24A 1RA6A 4LJMA 4RKUC 3KYLA 3P45B 1SL0A 3BO3A 4Z7YA 4ZOSA 2KYZA 2D9OA 1FX2A 1BXNA 2WBRA 2BRKA 1WC0A 4YHHF 1NB2A 2RQ4A 3DLKB 4YY3F 3LWMA 5F0WA 4MFBA 5F3ZA 4F4ZA 1SKWA 3G6VA 4MAKA 1TL7B 3E3XA 2BACA 3FEXB 1IBMJ 1M5KC 2H4WB 4J9LA 1TMMA 2HVDA 1PKUA 3DN9A 3JTOA 4XPEA 5DGBA 4KB7A 4KGXB 4IH6A 3Q2TC 1KVIA 3DLLQ 4JI1J 1YITS 3GE9A 5M2UA 1Y00A 2YNGA 4JP8A 4X62F 2VIHA 3D0IE 4QU7A 2VKRA 2HFUA 2MSTA 3UNGC 2HHHJ 1RE1B 2DNLA 2HQGA 4I0WA 1VR6A 3JSYA 3SQGB 5CABA 3M9NB 4XPCA 4N77A 2QL7B 2W9BA 3C15B 5ETRA 4ED4A 4P2SA 4ZJQA 1IBLJ 1NDCA 3AOCA 4CO1A 3HHLB 1SJ3P 1QAIA 4IR1A 2XSFA 2F9JA 2UXCF 4GVBB 3M4XA 4K8RA 2H4YB 3OHBA 4M5DA 3C2PA 5E41A 1FDDA 2AJ0A 2YQ0A 4QWEA 4R5PB 2MKKA 4RU2A 4JYAF 2RVJA 1HYSB 3E51A 1X9SA 2H51B 1RT7A 2B9WA 4I7FB 4RNNA 3SDEB 4KT0C 3I32A 3MAAA 3HZGA 2B9XA 3R27A 1R6VA 2CJKA 2FYXA 1O0PA 4DDFA 4XO0A 2JEFA 3QGGA 2I5JA 2Y8WA 3FZBA 1H98A 4UQGA 4B3MJ 1RT4A 1EHWA 4PEOA 4FNIA 1N6QB 2XGQA 4K4XA 4WFZA 4DQIA 3D6FB 2EFNA 3KUEA 1CPZA 4WE1A 2QA4S 3CDWA 1FXDA 5B0AA 1TL5A 1K0TA 1SJQA 4DF8A 3PW0A 2E1MC 4ZVRB 4EBEA 1TL3A 2GC8A 3DGPB 2JOQA 1TUVA 4URQU 1VBYA 1FJCA 3D1HA 3ELHA 1UFKA 2PC6A 4QWCA 3F73A 2R8IA 1AZSA 3ULHA 2FTRA 2XMKA 4NEZA 1XJWB 1LV5A 3BSCA 3RTVA 1ZAWA 3CJ8A 2IMOA 1FRKA 1IXKA 2ZC3A 2WB4A 3CIMA 4NCGA 2OGUA 3I82A 2YKOA 2QSFA 3HSDA 2IIHA 2AJ2A 1DLOA 1X0PA 1NHVA 2D3O1 3LW5C 3GLJA 2BE7D 2OP5A 2NQPA 4NMXA 3HSJA 3F44A 3AQPA 3A8IA 2UUCJ 4FYDA 3QJLA 1FF2A 7FDRA 1R7IA 2VG7A 4Q8EA 1WF2A 4IFYA 3PW5A 3G96A 2KN4A 2VODA 3DGVA 3DI6A 1GFWB 2MY7A 3DOMB 4PQUA 2FC9A 5LXYA 3M8ZA 4UZCA 4NA3A 2MGZA 2CPZA 3UNYA 4DSKA 4DX5A 4HH1A 1RUSA 1UEKA 1FHTA 4C3LA 1NH8A 3HVRA 3M2RA 3H40A 3PIPQ 2JDJA 4YDDB 4Z2XA 4RNFA 1J5OA 3W2VB 2AIRB 2K7KA 1BQNB 3I6PA 1R0CB 2HFNA 1YRUA 1XERA 4CTAA 4LBPA 4UZBA 5K20B 1SJRA 5U47A 2VFSA 5GADU 1VQLS 1X5TA 1T03A 2YNHB 2HBZB 4U9RA 1T9VA 4EUVA 3W61A 2QYGA 1EARA 2XNRA 3MM5B 1OPZA 1GX5A 5KOWA 2LEAA 4HHJA 1KOHA 4USWA 1KFDA 2YKNB 4RBUA 1KVJA 1VQ9S 1UZHA 4K7QA 3CCES 2QT7A 1S1TA 2FUG9 2MXYA 5B7WA 1R8AA 1IKWB 5C2GA 1F9EB 1XBWA 3C19A 2QL9B 5ETKA 1N88A 4MH8A 2YH0A 1RTIA 2HHTA 4EU0A 1RAFB 3LAKA 3OTOJ 1TVRB 1SPBP 1UEVA 2LYVA 8AT1B 2K06A 4O4GA 2KZMA 2FVPA 2E7XA 5IT4A 4NLRA 2HGNA 1QTNB 1UETA 2FQQB 3V6DB 2WOMB 1NPKA 1TKDA 2VONA 1RU2A 3Q23A 4Q45A 1U1RA 2HURA 5I3QA 1IQTA 3IRWP 4YFUA 5KT4A 3JSMA 1UP1A 3L7OA 4NOHA 5HMZA 1LKZA 1LNQA 1HI1A 2YX7A 4KGVB 1ITPA 3UDCA 2MDAA 2VBWA 4ED2A 2H65B 3MAAB 3FSIA 4OI6A 1VDHA 3FZ2A 3QFWA 1OSCA 2H5IB 3QZ8A 1NJZA 3QRRA 1NDPA 1H38A 2K8GA 3KJQB 3M6WA 2ZHAA 4NLGA 1VC5A 1VGYA 1BGXT 2XYHB 2P9EA 5KFPA 4WE1B 3RBZA 3Q8SB 3EVOA 1UVLA 1QVGR 2C1EB 4DU8A 4X4UA 3EE3A 3QO9B 1WI8A 3CMES 2HVEA 4ANEA 2DR9A 2A10A 3EZUA 3M6UA 4Y00A 1S72S 4F67A 1JNRB 1J5EJ 2AEJA 2J7KA 2VBXA 4KR0B 4LR9A 1FD2A 4ZKAA 2B5JA 1RJJA 4URSA 3GIJA 2M8HA 1RKIA 2BQUA 1R0AA 4K0KJ 4LF4F 2FPHX 2VA2A 1NK6A 1CLFA 1UKUA 3JQMA 2QA2A 2KT5A 2HQIA 1DQ8A 2HHXA 1XTZA 4DU7A 4ZVTB 3GYXB 1NJIT 4YB6A 4NLOA 5F8LA 2H54B 1R8BA 3KFWX 1ZM2A 3RU0A 5KT5A 3KLHB 4ZMMA 3VALA 3PV8A 3CCLS 1QSLA 1LWFB 1MU2A 3HI9A 1PJ5A 3Q86A 4PQUB 1C1CB 4I64A 2MGZB 2RQMA 3WHIA 3NGTA 1M5HA 2MKHA 3I4HX 4KGZB 5F8MA 3HT3A 4ZVSB 3K8VA 3W8PA 3D1OA 2P6SA 1G2EA 1TAUA 3DRRA 2BKPA 2XY6A 1HQUA 1S0VA 3CJKA 1WC5A 3V5RA 2V8GA 1IWAA 4HLBA 2EBGA 3MM6B 7FD1A 3JQJA 1MN7A 4KH1B 2ZWPA 2AJ4A 3UDEA 3B54A 1T94A 3CW2C 3S6EA 1DTTA 3PO5A 4CTAB 4QIEA 1YVFA 4C97A 2V4RA 1FKOB 4WBFA 1T03B 2RMLA 4IG0B 1JJHA 2WVEA 1S4EA 2P9CA 4USHA 3TZZA 2YY3A 3SFUA 3DXSX 4W4MA 4NWBA 5L1IA 4KHMA 2KM8B 1WEYA 3QYYA 4YQWA 2HNDB 3G87A 2CIMA 3LO3A 4CH1A 1RHJB 2E5JA 4WU3A 2F9DA 5B0GA 2MQQA 1LEOA 4O4GB 3CCJS 3GP9A 3NOCA 2OPQA 3IRXB 3M30A 5C2CA 1XIQA 1T9UA 3T1HF 4B17A 2A2DA 2EEYA 3ADAC 2UUTA 4IH5A 1RP5A 4DR1F 2LQBA 4DUYJ 1R8CA 2FGCA 1QSYA 4GMKA 3UE2A 4L75A 3J7Z5 3CCRS 1NPRA 1NAQA 1HBMA 3T5LA 1NSAA 3JSMB 1D8ZA 2IM3A 2HQFA 5D4PA 4E0DA 1KQSR 3GIMA 2E5IA 2VKZG 1EIYB 1FA0A 3FGVA 1HI0P 2KVIA 1LK5A 5SUHA 2D41A 1L5UA 4PWWA 4C8ZA 4HH0A 2HPUA 2LA6A 3OBIA 2POKA 5C25A 1K47A 3KK2A 4DHVA 4MIAA 2UV8G 5HVFA 3RRKA 4O23A 3UFCX 3OTDA 4AXJA 5G0RA 4R8UA 4J9QA 1U6FA 3IBFB 2DITA 1A6LA 3UCZP 2G0JA 1VRTA 2C2RA 3I0SB 4CO2A 1HNIA 4B08A 4LRDA 2IM0A 4Q0BA 2ERRA 1ELOA 1L3SA 3OTCA 4QIWD 2WVDA 1QE1A 3VR1A 4NLUA 2QYCA 5LSLA 1RDRA 4ERDA 3SI8A 1HIYA 1ZETA 5F8GA 5JJBA 1GMWD 3NMRA 5A8WA 2NPFA 4LVNP 2HAIA 1C1BB 4I2QB 4JV5F 2UU9J 4EMDA 2DNOA 4Y28C 2KJWA 5DM7Q 1R0AB 4J9MA 2YKMB 1IKXA 3DCAA 3U7JA 3A12A 1SBRA 3D9BA 3PRBA 2V0NA 4XIUA 2PIIA 4J9RA 1JWWA 5ETLA 3C14B 2HQDA 3JAMU 2C2EA 4OV6A 1RHMB 2A6MA 1RADB 2HRUA 1N0VC 2KXHA 2W8LA 4CNZA 1TKXB 2R42A 4UY85 3PW2A 2DIUA 4Y2MA 3OTEA 3ZTPA 4Y34A 4BWMA 1HR0F 2IRYA 4PR6A 2CWXA 4OX9F 4D3GA 2DCUB 1RWXB 1FE0A 1RAOA 2LDIA 1FRJA 3M2UA 2FY8A 5K14A 4WP9A 1R6YA 2UUBJ 4UW2A 1NJYA 3MMBB 4U8VA 3DRRB 3CJKB 1Q79A 2E5HA 3EZOA 3Q89A 2C3MA 4JI3F 3BN4A 4Q5VA 2HHUA 4P2MA 2VICA 3EVWA 1KLMA 2FVSA 1JXEA 1N5YA 1P8GA 4DR3F 3RB6A 1DTTB 4JI0F 1IKYB 2K2PA 2XSJA 4QZVB 2HWIA 2JJ4D 1KFSA 1JIHA 3CJSA 4GKKJ 2DNNA 1FKPA 4F4KA 4LIWA 4WFYA 1KOOA 4LIRA 2WVFA 3RBEA 1WOSA 5L9XA 2R2TA 5I42A 2FZKB 3MECA 3DHWC 1V3RA 4ILRA 2V8VA 1H6KX 3Q8VA 5KFQA 3BSNA 1NDKA 4KRWA 4ZS6A 1H72C 5KFFA 1CQMA 3FBCA 5IT0A 5IM0A 1TTHB 1S49A 1F3FA 3BN7A 1LWCB 1Q8KA 1RCXB 2O66A 1KHVA 2UXBF 3T5JA 1GEHA 1FEEA 2P6TA 5B09A 2MZTA 2COLA 3CNQP 3T3FA 3M30B 3ENQA 1T9XA 3SCJE 1YGYA 5FDLB 1WEZA 5HVHA 2DY9A 3FRZA 2IYGA 4C4WA 3BGUA 3TEHB 3QAEA 1FRIA 1NUEA 2FHMA 4DV5F 1N34F 2FZCB 4M63A 2OFHX 2AX0A 2IAJA 4NZ6A 4TQSA 2GHVC 3S7RA 3R7NB 4HT7A 3MCNA 3G6ES 2XEXA 3KLGA 3N5FA 3HJFA 3OFHA 1VQYA 3OXFA 4I6AA 4DF4A 3PHEA 2V63A 2VC0A 3TI0A 5F9NA 1X5SA 1FCAA 4FNHA 4I68A 3QIDA 2ZD1B 2EVZA 3AB2B 2GJIA 2YPZA 4WZQA 1F1BB 1KS2A 1X4EA 3GWCA 1RGVA 3KJVB 1V6HA 4ECZA 1XN9A 2HSEB 1LWEB 4LF5J 1XNQJ 1JKHB 3I0RA 2MKCA 4RO0A 5DS7A 4OLOA 2IRUA 5HQLA 4X4QA 4O3SA 4L72B 2ROEA 2HK3A 2YQ1A 5D15A 1IR0A 3B82A 5A8RA 1N8RT 4WTYA 3LPEA 2HGLA 3FVYA 1TKZA 2J9CA 1S4FA 3GFZA 5IV3A 4DLGA 1TQLA 3A13A 1CJTB 3MEDB 1UWBA 4I56A 1GX6A 4ED6A 2I0XA 2CKWA 1JLEB 3CD5A 4LVOP 2DGOA 4B9NA 2DR8A 2DHSA 4DV4F 2LCWA 4KH0B 2A3JA 5A2QY 3P5BP 3KG1A 2HS4A 5EN1A 3SIPB 3D3BJ 4ID5B 3N79A 1S7IA 1U6ZA 4IYQA 4USUA 2BZ2A 1N5VA 1RA7A 4Y3CA 4QIVA 2ASDA 4ZVHA 4M5KA 3M2UB 3FBEA 4FN5A 3EICA 4QYZJ 4DBQA 5HROA 5KFMA 3WC0A 3RZAA 2E9TA 5C42A 2YQ3A 3TWZA 5A8KB 5DO2A 1QSSA 3GU0A 2V4JB 2DO0A 1KLMB 5A0YA 4AQYJ 5IT9Y 2VD3A 3J81U 4IO9Q 4C3KA 3TX0A 5EX0A 3H4DA 3KNGA 2OI2A 3UN5A 4H4MA 2OIHA 2JC0A 2PEBA 4ZVOB 1TKTB 1FWLA 4KKOA 4AD6A 2GO9A 2DEJA 4DS4A 3J80Y 3C8YA 3PTWA 4KFBB 5I42B 3EMTA 3MECB 3CD6S 2XWYA 3EGWB 1IQZA 1R8PA 2UXDJ 1Q5VA 4DSJA 1RAEB 4J9SA 2PFFB 4DPWA 2YKAA 2GW8A 3L3CA 2FIUA 3W64A 1YBUA 1REVB 2XZDB 3GJQB 3QATA 3HHEA 1VQ7S 1GMUA 2CQGA 3FRYA 1WOPA 2QL5B 3MXHP 2U2FA 1YX2A 3W9JA 5AJ3J 5BJRA 2LVWA 4EEYA 3CT9A 3K57A 1YZ6A 2GQCA 2QGFB 2GVDA 4RUCA 2QV6A 4RWWA 2Q66A 3CCWA 3CB4A 1SKRA 3M8WA 2YKQA 4LFAJ 5KT6A 1VK8A 3CF5Q 2LLZA 4NLVA 4DG1A 2AGQA 2BJEA 5KFHA 2H3EB 1N36J 1I3OB 1RT3A 3FDSA 2IAJB 4R25A 3HO1A 1F5CA 3FBFA 4AFFA 4RW7B 1QDUB 5EDWA 2R8HA 1HNVA 3ENWA 2XULA 5I3UB 1HHTP 3KLGB 2UVUA 2DBBA 3NS6A 1GTEA 2RQCA 2BRLA 4OL8A 4CLSA 3KLIB 3TVZA 1U8SA 4M5LA 5F41A 5CXTA 2XMVA 5M2PA 2DNZA 4C11B 1K0VA 2DCLA 5L38A 1TZ0A 4TYAA 1UEUA 2AEMA 2EFVA 3TO8A 5KAKA 3CGIA 5HLFB 4PZVA 1XMQJ 2XLKA 1S1WA 1FJ7A 1EB0A 1RWNB 3IMQJ 3IA0A 4R0EA 3BB5A 1VQSA 4NL5A 2QA4G 2D7SA 1WC3A 1U48A 2ABYA 5HMYA 5IZHA 2ZFHA 1YRTA 2EKYA 4NI2B 4OJHA 2B7CB 2HS3A 1S77D 4K5RA 3CWJA 4A8QA 2DGUA 2JHEA 1CBKA 1V5VA 1FT8A 3NWGA 1AW0A 3MPVA 3PDNA 1FRLA 3UDLA 2PN6A 2DIVA 2DGVA 3CD7A 4DN0A 2Z58B 4CO3A 2XNQA 3C6UB 2WW4A 3BM7A 2JL9A 3FC9A 1TELA 2PFDA 2QA1A 3EVMA 5KG3A 1AUDA 1ICEB 4ILLA 1Y5NB 3UQSA 2PA3A 1DFDA 1HR0J 2CG8A 1JB0C 4DLEA 3HVTB 2QLXA 1LW0A 2JFKA 3M8QA 3MM9A 1HBNA 4U7CA 3LP2A 3MMCA 2OPSB 3I5AA 2BW2A 2GV1A 5L1JA 4LFCF 3NL0A 4KAIA 2HMIA 2ZM6F 3IC1A 3GSIA 2ROPA 1QVFR 4B02A 3K7RA 1OYDA 1RQ0A 3T1AA 3QRQA 1HPZB 1CS4B 3M1VB 1EAYC 1PYTA 3DOLB 1J27A 1GMWA 2F3JA 4U7UD 4NZ7A 1S9GB 4B3TJ 5G4DA 4ECVA 1U49A 3Q8PB 1Y5LB 3DLBA 2QLBB 5KFTA 1F9FA 4OYOA 1N54B 2Z4PA 3BS9A 1H74A 1AFJA 1F5AA 1VQ8S 1C2PA 4WYLA 4G1IA 4S0MA 1D9DA 1T05A 1S9FA 3H8YA 1T9WA 4ZPCA 3OR2A 2FVQA 3FBBA 2HZCA 4MK7A 2W7AA 2ZBCA 1S6QA 2OUGA 3T6BA 3D2WA 2MZJA 1YI2S 5H9EJ 2VPXB 1ZTWA 4ECXA 5DDOC 2ZOGA 2IM2A 5L9NA 3QJPA 3IFEA 2Y0BB 3DRXA 2NUHA 3BQ1A 3CJ0A 2ADCA 3LAMA 3GILA 2J0WA 2KFZA 3UI3A 1D1UA 4OFZA 1WD6A 1B99A 4C8OA 1WNEA 2EG2A 4LR7A 2GJFA 2ZH2A 4HHUA 2GVDB 4DMZA 3RB4A 4HEA9 4A8WA 1TU0B 2W2OP 5DDPC 2Y8YA 2ALYB 2W4PA 4JI2F 4ZVEA 4YMEA 3ZZPA 4B9LA 2O1PA 5LMNJ 2RKIA 4DV5J 1K73T 4CLTA 1TV6A 3TUZC 3VWSA 2OEMA 2ZVSA 4O0IA 2BMBA 1FRMA 2HG4A 4V19J 4B3SF 4J9PA 1TR0A 1VC0A 2GZOA 2QLFB 3GR0A 1CJUB 1C0TA 5IC6B 5DDQC 1FERA 1PO6A 2LU2A 1I94J 3R5CA 3CJQA 3S01A 5GAGU 4PAAA 3M7VA 2F7VA 4IR9A 2M4MA 1S0NA 3IWLA 1HBOA 4KO0B 1GTHA 1YLXA 5FLXY 2GVZA 1JLAA 4DPOA 1WHWA 2MZRA 3HP6A 2OAUA 2GIRA 2CADA 4F4XA 1TL4A 4C98A 2WSCC 4PG6A 1GQEA 1MNEA 5HATA 2OEKA 3KK1B 2C3YA 1JLGA 2BKOA 1IBKF 4HI1A 1JLFA 2DY1A 2RE1A 1LWXA 1Y10A 2JEGA 5D4NA 1A7GE 1NK7A 4PUOB 3W63A 3IG1A 3ISZA 4UOGA 2DVIA 2AP6A 3H2VE 1SB6A 4NASA 3GV5B 2CAJA 4UF4A 2PI5A 3ZTQA 4F2RA 1EP4A 1N32J 4HACA 4WFAQ 3DLGB 3BKFA 3V6JA 3TJ9A 2FVCA 4F3OA 1T9TA 3OR1A 1WC1A 2VBYA 5KG4A 1IM6A 4ZCLA 1YJRA 2DXDA 3GJSB 2EFPA 2V8PA 3POTB 4JV1A 3VZIA 2F5GA 4M95A 1S79A 5GMDA 3GIRA 4DS5A 4ELTA 2JSXA 3PEJA 4NRTA 4UOHA 3M8QB 3B6BA 5CCMA 4X4TA 1UA1A 1HBNB 1FRHA 3KLEB 5LJ3Y 4MMOA 1VHFA 2V68A 1Y3KA 4C7QA 1RAAB 3FEZA 1X4GA 2RJZA 4LR8A 1I6JA 4RWXA 3C46A 2QMXA 3TANA 1ZM3A 1CC7A 2YH1A 1RU1A 3R5JB 5LSRA 1EZZB 4AL5A 2YNFB 2NLWA 2CZ4A 3BKTA 1FXRA 1T95A 3OW2R 3M32A 4X65F 3VVTA 2HK2A 4MK8A 3EYZA 2EPIA 2VPYB 1WSVA 2NREA 4DUTA 1AUSL 3OSPA 2A0FB 5F8HA 2ZBQA 2DXFA 5HP1B 1XMOF 2FHJA 2CDQA 3LWLA 1DQ9A 2VB6A 2ZDOA 3ZZZA 5EGYA 1G3OA 2MJNA 3CO0P 3DDKA 5B08A 2QTWA 2GIFA 2OPPA 1RACB 1BC6A 1UZDA 3CCQS 1DY3A 2F8MA 4JB8B 2C2OB 1V3ZA 4X4NA 1N5QA 3Q8YA 2YNIB 2H1YA 3QBCA 3EDQB 1B4SA 3CCTA 2BA9A 2R7QA 1IBMF 1JMTA 1HWKA 2BJ9A 4YS2A 5J1NA 3CPWR 4V1Ak 5CYQB 2UUAJ 2HFVA 4KSEB 4PABA 1Q8BA 4JI1F 5I4MA 2K1RA 3SYZA 1YQHA 1U7LA 3JXOA 5AE3A 2ZBPA 3A3OB 1NM2A 1URRA 2M88A 1YTYA 3H4BA 1RTZA 2FY1A 3P3DA 2HHHF 1RTDB 4M5HA 3FK4A 3KTQA 4C9DA 4OYIA 3DM2A 3FMBA 3WC2A 3OD2A 4BCAA 4NE9C 1WORA 3G82A 5D3GB 1OY8A 2LXUA 2JRSA 1IBLF 3PIOQ 3LP1A 2BJ3A 3K89A 2GAHC 2AYEA
chains in the Genus database with same CATH topology
2DNKA 1RI7A 1ZM4A 2CQ1A 3JYTB 1WI8A 2HLTA 2V9WA 4CO4A 2L3MA 3L7PA 3CMES 3J7A1 2DR9A 2WCXA 4TNOA 5L8RC 5L39A 4F50A 2A10A 3EZUA 3M6UA 2EC0A 2PSZA 4Y00A 2ZITA 3W2VA 1S72S 1SIZA 1GAOA 1AROP 4F67A 1JNRB 2HGMA 4B3RF 1RAJA 2OPQB 2ZKTA 1BQNA 3M8SA 2FJAB 2F1FA 2XB2D 3FSYA 2J7KA 2VBXA 4C8NA 5F8JA 1D8YA 4OZ5A 3I96A 4KR0B 4X4RA 4YP3A 1HWLA 1FD2A 2VG5A 3HKZD 2VFRA 2YNFA 4I6WA 4FS1A 2KJVA 4ZKAA 3PR5B 2WK4A 2JLFA 3V4MA 2VH7A 3SEOA 2ZDPA 2B5JA 1H3DA 4C2MA 1RJJA 4URSA 2R2SA 5IWAF 1FNXH 3GIJA 4LF6F 2YNHA 2M8HA 2FLOA 2YVSA 1RKIA 2V5HG 2IM1A 4OHZA 5AXMA 2BQUA 3PACA 1HBMB 1R0AA 1SV5B 5LMNF 3DYAA 5F9LA 4UOCA 2CPXA 2JWNA 4O3OA 4BC9A 3MM5A 4LF4F 1DHMA 2FPHX 2VA2A 1XWLA 4ZPWR 5E3PA 1NK6A 1NHUA 1UKUA 4DR4F 1CLFA 2HYIB 2XWXA 2QA2A 4K4TA 2KT5A 2YKNA 3JAMY 2ZOMA 4H54A 2HQIA 1DQ8A 1R43A 1XR6A 5DG8A 5GAHU 2HHXA 1XTZA 1O8BA 2WW8A 3IGVA 4ZDNA 3GYXB 2MQPA 4O44A 5HP1A 4K2XA 5DRKA 4F3QA 1NJIT 4AE5A 4YB6A 4EZ6A 4NLOA 4G1QB 5F8LA 2J6SA 1IKWA 3KMSA 3RAQA 1R8BA 3KFWX 4CT8A 1VQKS 3MUVP 4B3MF 2M3DA 1ZM2A 4FPRA 3RU0A 2DNHA 3HVWA 3CTRA 2MKIA 1WF1A 5KT5A 4RW6A 3TAPA 3O8WA 5C25B 3KLHB 1N4LA 2IFXA 5KFCA 5AXLA 1GXUA 3ZC4A 4ZMMA 3MEGA 3VALA 2HFZA 1FDAA 2VFVA 3PV8A 3KK2B 1Q8LA 1FXLA 1CVJA 1QUPA 1S1UB 5LL6d 4LF7F 1QAJA 1V9OA 4RBTA 4WXOA 3CCLS 4MIBA 3RAMA 1QSLA 1LWFB 1MU2A 2ACYA 4HL9A 4HTIA 1I94F 3PKMA 4ICLB 1FK9B 3HI9A 3T9ZA 3QJJA 1FTRA 4PQUB 1C1CB 1TVRA 1H2VZ 3A8EA 4I64A 4OHVA 4K50A 2MGZB 1KC8T 2FJXA 3HHLD 3VQTA 1VBXA 5G0RB 4R8UB 3BJYA 2ZJRQ 4ZPAA 4DR7F 1B7FA 5KG6A 2RQMA 2AJFE 1M5HA 2MKHA 3N5BA 3I4HX 2Z0GA 5D8HB 3NNHA 5T7LB 3SCLE 5F8MA 1DJ0A 3M2VB 1R27B 3HT3A 3V6DA 1VRTB 3K8VA 4P7VA 3D1OA 3G6XA 2BANA 2WOMA 2IJFA 2P6SA 4Q2MA 5B0FA 1G2EA 3MR5A 1TAUA 1RWUA 2YNIA 2HFOA 3DRRA 4AL7A 2XC9A 1HARA 4FXWA 1HNIB 3ISNC 2XY6A 3DLEB 4Y0FA 2K3IA 1HD0A 4M1KA 1HQUA 2E66A 2MJUA 1S0VA 2MZSA 4OZ1A 4K4ZA 3CJKA 4TN2A