2RF2B

Hiv reverse transcriptase in complex with inhibitor 7e (nnrti)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7
publication title Novel indole-3-sulfonamides as potent HIV non-nucleoside reverse transcriptase inhibitors (NNRTIs).
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 109
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rf2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2B04
2DPIA 3DRSB 3EZUA 1JLFB 2HWIA 5J2PB 4RW9A 3NMAA 1FK9B 4K4UA 3DM2A 1U09A 4KFBB 4Q44A 5DG7A 3BGRA 4LSNB 1K1QA 1IKYB 2ZD1A 5F9NA 4NYZA 4F50A 4GC7A 3C6TB 3FSIA 3TVKA 4ECSA 4K4SA 3GV8B 2RDJA 1DTQA 1VRUA 4ED8A 2R2UA 2IA6A 2JEIA 4HKQA 3DRRA 5F8LA 4LSLA 5I42B 1C2PA 1TL1B 2W8LA 4FBUA 1UWBB 5KFMA 3GIIA 1VRTA 4X2BA 4URSA 1FKOA 2BQ3A 2XCAA 4OL8A 1S1UA 1EP4B 2WOMB 5FDLB 3IS9A 5DLFA 4YMEA 5KFJA 2XC9A 2UVWA 3H5YA 1S1WB 3DI6A 3CO9A 3I5CA 2YKMB 2R8HA 3M8QA 1TP7A 5CYMB 2J6TA 1RTJB 1S0MA 5KG0A 2IM3A 2FJVA 4JV1A 4IFVB 4ZVHA 5KT5A 4F4XA 2GIQA 4ZP8A 3MR6A 4DL6A 2E9RX 2AGPA 2JLEA 2YKNA 1SH3A 3OL7A 4Q8FA 3V4IA 4NCGB 1HQUA 3NBPA 3IRXA 4EO6A 4EBCA 1JLAB 1XR7A 4G1QA 4KSEB 2ILYA 2C2EA 2IJFA 3KHRA 1JKHA 3T5HA 1DLOB 3DLEA 5CYQA 1C0UA 4K4WA 1S1XA 2B5JB 2WCXA 4IKAA 4I7FB 3DRSA 4K4XA 1JLFA 3T5JA 1JXLA 5J2PA 4IH6A 3KK2A 1FK9A 4TY8B 4QWBA 4KFBA 3LAKA 3UR0A 3IG1B 4LSNA 4ED1A 1IKYA 3KHLA 3C6TA 1RYRA 3LALA 4QWAA 5J1EB 2BANB 1HPZA 1T05B 3KK1B 4ZPAA 1BQMB 2YNFB 2XI2A 3ITHB 5I42A 1UWBA 1IM4A 3PW2A 1RTIB 2W7PA 4MKAA 4FS2A 3I0SB 1S6QB 1EP4A 2WOMA 2R8JA 3DYAB 3LANA 3T19A 1REVB 1RA7A 4I2QB 2C22A 3KLFB 1S1WA 3E51A 4WE1B 1HQEB 2FVCA 5CYMA 2WHOA 2D7SA 1RTJA 2D3UA 4MFBB 3FQLA 4RW7B 4DL7A 4IFVA 5F8IA 4O3NA 1JLEB 4RUCA 3KK3A 3CJ0A 5DQIA 3NGDA 3KHHA 2UVRA 3JSMB 4JUZA 4RW4B 4NCGA 1S9EB 1JX4A 2IJNA 1QE1B 1JLAA 2OH2A 1HNIB 1S6PB 1K1SA 3FQKA 2GC8A 1MMLA 3BR9A 3PR5B 1HPZB 2HNDB 1DLOA 3D5MA 4I7FA 3G6XA 3MF5A 3IN5A 2W9AA 4WYWA 3QIPA 3OHAA 2UUWA 4ECYA 4HYKA 4TY8A 1MU2B 3MR2A 1SV5B 4QWEA 1YVFA 4NLWA 3IG1A 1IKXA 4KBIA 4ZPCA 2CJQA 3D28A 1T3NA 1DTQB 3M9OB 3UPFA 5J1EA 3TQ1A 1Z4UA 3PJWA 1T05A 1JLGB 3KK1A 1KHVA 1BQMA 4U6PA 3ITHA 4RU9A 5C24B 5EUHA 2AX0A 3M9MB 1RTIA 3LP1B 2FJWA 4KHRA 1S1UB 3I0SA 1S6QA 3PJXA 1SH0A 3DYAA 4NLSA 4ECWA 1QAJA 2QE5A 3UQSA 1REVA 3KOAA 4I2QA 2VA2A 3KLFA 5JXSA 3GILA 4WZQA 4WE1A 1HQEA 3OL9A 4MK9A 2WONA 5KFCA 4MFBA 4RW7A 3V81B 3QGIA 1JLEA 3EPIA 2HWHA 2YNHA 2J6UA 4J9QA 3NBPB 3JSMA 4ED3A 4IRDA 4RW4A 3V6DB 4MK7A 4K4TA 3RB0A 1QE1A 5KFUA 3FDSA 5JUMA 1HNIA 4DEZA 2CKWA 5KG6A 5EDWA 4ECVA 3T5KA 2J6SA 4QW9A 1D0EA 5CYQB 2HNDA 3DLKB 3ISNC 2VG7B 3HHKA 1LW0B 4YR3A 4H4MB 2ATLA 3H2LA 4ZVGA 3UDLA 4IQXA 1RT4B 4YQWA 3BSAA 3KMSA 3KK2B 1S97A 2BE2B 3HVAA 5KFSA 2R8GA 2IC3B 3BQ1A 4DL4A 2I5JA 3FRZA 1MU2A 5KFAA 1SV5A 5DQGA 4NLUA 4K4ZA 4IOBA 2AWZA 1C1CB 5KFPA 5KT6A 4WFZA 5HBMB 4RZRA 4YR0A 3BREA 1RT3B 5DG9A 4DL5A 4IFYB 3MEDA 4J9MA 3QO9B 2XCPA 1S9FA 1JLGA 4ED7A 3PR4A 3QZ7A 5C24A 1N5YB 2IM2A 5KFDA 3BJYA 3OSPA 3LP1A 4URGA 3HVTB 2XWYA 1ZTWA 1T94A 4IG3B 3CDWA 1RA6A 4O44B 2AU0A 3V6KA 3KNAA 4XPCA 5KT7A 4O3RA 4NRUA 4B3OB 5EWFA 3BQ2A 2XGPA 4ECXA 1RTHA 5J2QB 3V81A 4O4RA 4ED2A 3KK3B 3MEEB 2RDIA 4WYLA 4DL3A 4TQRA 2D41A 4O3SA 1S0NA 1J5OB 4NLVA 2FVPA 2R8KA 3G6VA 2B6AB 3H5UA 5KG2A 5HP1B 1NHUA 3V6DA 1LWFB 2WRMA 1LWEB 3G86A 5DGAA 2E9ZA 1RAJA 3BQ0A 4J9KA 2OPRA 3DLKA 4ID5B 2VG7A 1LW2B 1LW0A 4H4MA 5DQHA 4ECTA 1RT4A 4NLGA 1N6QB 3QIPB 3CJ3A 2BE2A 4O3PA 2IC3A 1GX5A 2IAJA 2ZE2B 4RUAA 4IRCA 5L1LA 1I6JA 2FVRA 5KG1A 3N6NA 1S49A 1IKXB 2W9CB 3RB3A 1C1CA 4KE5A 5HBMA 5KG7A 1FKPB 1RT3A 5KFQA 4IFYA 3QGHA 3QO9A 4QWCA 2BR0A 5J2NB 4EYHB 5KFLA 1N5YA 2V4RA 5C42B 4ZP7A 4NLDA 5KFFA 5L1KA 4KHMA 5L1IA 3RAQA 2JC1A 3HVTA 4H54A 4IG3A 5HLFB 4O44A 3ISND 2FVQA 4IG0B 5KFYA 5L9XA 2AGOA 4B3OA 5KFVA 5KFEA 4TYAA 3I0RB 2WONB 3QYYA 4NRTA 2VG6B 4LQ3A 5J2QA 3IGVA 4RNFA 5F8HA 2YNHB 4Y34A 5KG5A 3PW5A 3MEEA 2WB4A 3OL8A 4NLTA 5F8JA 3GIMA 2OPSB 2R2RA 1J5OA 3H40A 5F8NA 2B6AA 3FFIB 3CVKA 5HP1A 4NLRA 3N6LA 1LWFA 1XR5A 1LWEA 4RNNA 5KFBA 4IRKA 4WXOA 2D3ZA 2VA3A 3IGNA 2HNZB 1EETB 3QLHB 5J2MB 1QAIA 3ICLA 4ID5A 5HROB 1RT7B 4WXWA 1LW2A 1HMVB 3NKYA 4R5PB 2FLNA 2FLLA 3QIDA 3H98A 4TQSA 5D3GB 1N6QA 4IR1A 2I5JB 3N6MA 3OLAA 4H4OB 2WTFA 2ZE2A 3PW7A 5DGBA 2W9CA 4WFXA 5L1JA 1SH2A 4ECQA 4K4YA 1FKPA 3MEDB 1S48A 4EYIB 2AGQA 3KLEB 1S4FA 1S0OA 1TKTB 3BSCA 3OL6A 1JLQB 2UVVA 5J2NA 1RDRA 4ZP9A 2W8KA 1IKWB 4KKOB 3M8PB 5C42A 2C28A 3E01B 4O3QA 3MFHA 4NLQA 4G3IA 1WNEA 5HLFA 5KFIA 4U7CA 1D1UA 1T03B 4IG0A 3DRPB 1TKZB 2E9TA 3C6UB 1C0TA 2FVSA 1RTHB 3I0RA 4RW6B 4K4VA 2VG6A 3GV5B 4PUOB 4EBEA 2BQRA 1IKVB 1N48A 1S1VB 5KG4A 5C5JA 4NLYA 2OPSA 1BQNB 2B43A 2HMIB 2QV6A 4RNOA 3FFIA 4J9PA 1RT6A 4MH8A 4KAIA 2RF2B 4RW8A 4ECZA 2IM1A 1C1BA 2OPRB 1S1TB 1EETA 2HNZA 3QLHA 3KJVA 5J2MA 5KFWA 4Q45A 5HROA 1RT7A 2W9BB 4J9SA 1HMVA 1TV6B 4R5PA 3MEGB 4Q0BB 1ZTTA 2FJXA 5D3GA 5KFNA 2IAJB 3CJ4A 4TLRA 5F8GA 4H4OA 3KMQA 1TVRB 3H4BA 4LQ9A 3JYTB 1N4LA 4TYBA 3Q8SB 3DOKB 2AX1A 4PWDB 3KLEA 1JLBB 1TKTA 1NHVA 1JLQA 3CJ2A 4ZPBA 5KFTA 2JC0A 1JIHA 4F4ZA 2HNYB 4YP3A 4R0EA 1IKWA 4KKOA 3M8PA 3CJ5A 1KLMB 1GX6A 2ASJA 3E01A 5KG3A 3TAMB 3NAHA 2W7OA 3I5AA 3LP0B 1T03A 3VQSA 2RKIB 1TKZA 3DRPA 5KFGA 3C6UA 2V4QA 3MECB 4URQU 3G6YA 4EBDA 4RW6A 5C25B 3PHEA 3LAMA 4IH5A 3PVXA 1XR6A 4PUOA 1IKVA 3SFUA 4ZMMA 1S1VA 4ED6A 3DLGB 4ECUA 1BQNA 4JV0A 3CDEA 3KLHB 2HMIA 4EO8A 4YR2A 2ILZA 4TXSA 4IDKB 4ZP6A 5I3UA 2RF2A 1LWCB 4RNMA 3EPGA 1JLCB 1S1TA 4KB7A 4DG1B 1KHWA 2W9BA 4MIAA 5KT2A 3RBDA 5EWGA 3OLBA 1TV6A 1R0AB 2UUTA 1TKXB 2OPQB 3MEGA 4Q0BA 5KFKA 2DPJA 2JEJA 4J9RA 1RT5B 2JEGA 1TVRA 3NAIA 3MR3A 4J9OA 4PQUB 4XO0A 3JYTA 3RB4A 3DOKA 5KFOA 3H4DA 4ZHRB 4PWDA 4FS1A 3PZPA 2XI3A 2YNIB 1RT1B 4I2PB 1JLBA 4O4GB 3KLIB 5F9LA 2IMWP 3HVWA 2OPPB 2HNYA 2JEFA 3GV7B 2VG5B 5KFXA 1KLMA 1W25A 4WFYA 5F8MA 4GC6A 3TAMA 3DMJB 3LP0A 5DG8A 1CSJA 2RKIA 4QW8A 3LP2B 1C0TB 2GIRA 4ZPDA 3MECA 3QZ8A 3MFIA 5C25A 5KFHA 4K50A 2I1RA 4Q8EA 2YNGB 5K14B 4R8UB 3DOLB 3DDKA 3I5BA 2BRLA 5DLGA 4F4WA 3SI8A 3DLGA 2C2DA 1SUQB 5EWEA 1TL1A 3KLHA 1RT6B 4FBTA 4IDKA 1N56A 1S9GB 4RW8B 2HAIA 1C1BB 1LWCA 5FDLA 3KJVB 1TL3B 4NZ0A 4Y3CA 1JLCA 4DG1A 1HNVB 3MR5A 4Y2AA 2C2RA 1RT2B 2YKMA 1R0AA 1TKXA 2OPQA 2IBKA 4J9LA 3OSNA 2BQUA 3MTKA 4ZVFA 1RT5A 1HARA 1HYSB 4TN2A 4TY9A 4QPXA 3RBEA 4PQUA 3OHBA 4DL2A 2BRKA 2ASLA 4ECRA 2R8IA 1DTTB 4XPEA 4ZHRA 1NNDA 4NLOA 4ICLB 5KFZA 1QUVA 4O3OA 2YNIA 1RT1A 2R2TA 4I2PA 4KV8B 4O4GA 3KLIA 2F8EX 3V6HA 3KLGB 2OPPA 3HKWA 3H5SA 4ED0A 2O5DA 2AQ4A 5KT3A 1S10A 1RTDB 2VG5A 3PW4A 4KO0B 4Y2CA 2B5JA 3CIZA 3Q8RB 4RW9B 4WZMA 3DMJA 3DM2B 2V0NA 2XGQA 3LP2A 3BGRB 3GYNA 4ZVEA 4QWDA 3NL0A 3CWJA 2ZD1B 4Q43A 5KT4A 3SFGA 3KLVA 3T5LA 4MIBA 2YNGA 1VRUB 4M94A 4NLPA 5K14A 3V6JA 4R8UA 4NLXA 3RB6A 3DOLA 2BANA 3DRRB 4LSLB 5KFRA 3Q8QB 3CDUA 2YNFA 3GIJA 1SUQA 3KHGA 3RAXA 1VRTB 2ASDA 1FKOB 1ZETA 5I3UB 1S9GA 5T14A 4F4YA 3PW0A 2ALZA 3H59A 1TL3A 3IS9B 1TQLA 3T1AA 4RNHA 1RYSA 4IH7A 3M9NB 1HNVA 3DI6B 3M8QB 2WK4A 1RT2A 2R2SA 2FLPA 3GQCA 2UVUA 1HYSA 2YKNB 2EC0A 4MK8A 3QGGA 3BSOA 1DTTA 3GIKA 4EEYA 3V4IB 3H5XA 4ICLA 1HQUB 3Q8PB 3IRXB 2V9WA 4IR9A 4KV8A 1S9EA 4J9NA 4G1QB 3KLGA 4M95A 1S6PA 2ZKUA 4MKBA 3BSNA 4JV2A 2IM0A 1JKHB 3DLEB 1C0UB 1OS5A 1RTDA 1S1XB 4KO0A
chains in the Genus database with same CATH superfamily
1UW9A 2HWIA 4B3SF 3NGKA 3PJ9A 5D0EA 2POKA 2E7XA 3GV8B 1DTQA 2G0JA 3EVWA 5F8LA 3DLLQ 3W5ZA 3GIIA 3F44A 4X2BA 1VIOA 4OL8A 2RB7A 2P5VA 5LMUJ 1Q8LA 1OYEA 2H54B 2R7VA 2IM3A 1MMDA 2NXJA 2JLEA 1NSQA 3V4IA 3DHWC 1JLAB 2C2EA 2IJFA 2VBZA 2MHNA 4QR1A 1TMJA 4CT8A 3BGFA 4B17A 2DIVA 4Y65A 2U2FA 3RTVA 4J9VA 3ITHB 3QJLA 3KNGA 2DXDA 3HLUA 1EP4A 1BUXA 4JOUA 3CMQA 4F0KA 5CYMA 2F9DA 3AA9A 3O2IA 3N01A 4DU7A 3BO3A 4X4UA 3KK3A 1Y5NB 4DX5A 2XNRA 2DK2A 1Y3KA 2W2OP 3NGUA 1GNKA 1E6VA 3UVJB 2LCWA 2DGTA 1SV5B 4CLPA 4ZPCA 3KG1A 2KG0A 1JLGB 4NZ6A 1X60A 3HSGA 1U0HA 3H2VE 1NH7A 1FWLA 4ECWA 3UQSA 3P6YC 2WONA 1CQMA 3QWPA 4UZBA 4DOZA 1URNA 4JI1F 4GKJJ 5DDPC 1QE1A 3RW6A 2E5IA 3VAFA 3DLKB 4L72B 1X5PA 5BR8J 1T9XA 2DXFA 4NWBA 5IC6B 5KFPA 2K1RA 3MEDA 3QO9B 2RHSB 2XCPA 3PDNA 1T9UA 3OSPA 2Q43A 3I9ZA 3HVTB 2RU9A 4A46A 4DN0A 4OLPA 2HAFA 3GU0A 5A0YB 4CLSA 4LR9A 2RDIA 2EWHA 3HULA 2R8KA 2W8LA 4BBYA 4X4OA 3E2EA 2KO1A 4DV4J 4GVLA 3R1HA 1LW0A 2QN6B 1A6LA 2I0XA 4IRCA 2C1EB 4DR7F 5L1LA 4G1PA 2CXEA 2MDAA 4QWCA 1IBLJ 1PILA 4EYHB 2KG1A 4NLDA 1OY9A 1BXNA 3VGSA 1YWXA 2FVQA 1EZZB 1IBMF 5KFEA 5J2QA 4NLTA 3DDNA 2CQ4A 5HP1A 2K3IA 3UN2A 3HSZA 3GJTB 4ED4A 5D3GB 4X62J 2AGQA 1OJ4A 3CCSS 2WVDA 2M9KA 3M8PB 2VPYB 3H20A 3K5OA 3X3UA 2B0GA 2HFUA 1U49A 1RTHB 3G4SS 1P9QC 3OR1B 1FF2A 3IAM9 4RUBA 6FDRA 4Q45A 1FDAA 2WVFA 3VALA 1TV6B 3MEGB 2DNMA 1ZTTA 2PGCA 1ZM9A 4KGXB 1WDDA 1Z2ZA 1JLQA 4F4ZA 2OELA 5KG3A 1AA1B 5T7LB 1WSVA 1RCOB 3I5AA 2N3OA 2CVIA 4NA2A 1HR0J 3KG4A 2C3OA 4OHXA 4HDGA 4IDKB 3PYGA 1XC9A 1X4BA 3D9BA 2RF2A 3EPGA 3W9IA 3ZZPA 4DG1B 2W9BA 4MIAA 4PABA 1SIZA 5BYRA 4Y2IA 3W5YA 2JEGA 1PAEX 1UETA 5T41A 2OGUA 3BKUA 2DEJA 2HNYA 1KTQA 4GC6A 5C2GA 1O8BA 3QZ8A 3G8QA 4UQTA 2ATCB 1WC4A 2XSFA 2QLBB 1YBTA 4DR6J 2VDHA 2HAIA 3M8WA 1DFDA 1I1GA 4TN2A 3OHBA 3W2WA 4C0BA 4FKXA 4NA1A 4I67A 4LF4F 2EEYA 3PW4A 2JHEA 1AW0A 4IO1A 2AYGA 2OEMA 4DSFA 3RZAA 3K0JA 1VRTB 3POTB 5IC4B 2FD2A 1DQ8A 3K89A 3DI6B 4P9SA 2B3TB 3PTWA 1S99A 4CLWA 4AXJA 5GMEA 3B8HA 4M8LA 3FCVA 5B0EA 3D1HA 1JKHB 2DPIA 1RISA 3H0PA 3GYGA 2V8PA 1DQAA 3MDFA 4NYZA 1X4AA 2LQBA 4ED8A 1WHYA 2HEKA 3FC9A 1WF0A 4DZ6A 1GEHA 2QSWA 4Z2XA 1AT1B 4EI2A 2FJVA 2H65B 2RVJA 2KFNA 2YKNA 3HHLC 2VKRA 3MCMA 4LVNP 2DCUB 2G2OA 3DLEA 3L7OA 1S1XA 4K4XA 1CJVA 2A6MA 4NI2B 1WF1A 1FK9A 5SZTA 1EKSA 1YJ9S 2X3GA 2COLA 1RYRA 5J1EB 3W65A 3WIVA 1TL4A 4FS2A 4CZCA 3Q2SC 1R3NA 1REVB 4DCPB 1M5PC 3FQLA 3CC4S 3KUEA 1K0VA 1SBRA 3SV4A 2IJNA 2KL8A 3EWGA 3K2YA 1HL6A 2HNDB 2GJFA 4OJGA 4I7FA 3G6XA 4I1TA 4RUHA 5E3PA 2AHOB 2AX0A 1PSDA 3PJXA 2LDIA 3B6BA 1TK5A 3R2DJ 1RAGB 1FO1A 2XHCA 5ETKA 2QA4G 3QGIA 3NBPB 1IWGA 5DO2A 3QAUA 4ECVA 2UVVA 1HNIA 2ZZNA 4YQWA 1SC6A 2GGPA 2IC3B 4K4ZA 2AWZA 2CPFA 4J9MA 1GMVA 1NKCA 2LECA 3BJYA 4JI6J 4ZVPB 3PRBA 2YWWA 4X65F 4UUXA 3CC7S 5B09A 1PYTA 4ENOA 4DQQA 3C19A 3OT9A 4QOTA 1PGZA 2MKCA 4CO4A 1YX2A 1RLDA 4NLGA 1N6QB 4EZ9A 1G4CA 4NOHA 2QRRA 3GTYX 1R7IA 1C1CA 2B4PA 4JV5J 3MMAA 1CJKB 1YJUA 4LT6A 4AT1B 5L1IA 2D9PA 4KH0B 3T1YJ 5L9XA 2AGOA 4N5SA 4LIRA 1N0UA 3AOBA 3OTCA 4Y34A 5KG5A 3PW5A 3H40A 3MCNA 2HNZB 3C15A 1RT7B 1LW2A 2OUGA 3R9LA 2IY5B 2NXNA 5DGBA 2VKZG 2F7VA 5L8RC 2Q6BA 5G0RB 3MMBA 4DPWA 3MGJA 1RACB 4X4PA 1T03B 3DRPB 3KKFA 2E9TA 4K4VA 2FHJD 3V4MA 2QL5B 1S1VB 1GH8A 2XMVA 1RT6A 4ECZA 3Q23A 3QLHA 4ZS6A 2V2VA 1F3FA 4XK8C 5M2PA 3H8YA 3KLEA 1EHWA 3QJPA 2VBYA 1BY9A 4YY3F 1CULA 3NCPA 4DI6A 4Q2MA 4A8MP 2GVDB 4DV0F 4QIFA 3UE2A 1LQ9A 1NPKA 2CZ4A 1KOOA 1OWXA 1UZDA 5KFKA 2DPJA 3C8YA 2JEJA 1RAIB 4FS1A 1F5BA 4USVA 1PJ6A 5A8KA 3PEHA 5E3QA 2BACA 1W25A 2QFIA 4NXNJ 1QLNA 1CSJA 5IT9U 3JAMY 2L9NA 1T3OA 2DNYA 1SKUB 4R8UB 3SI8A 5DLGA 3HHLA 1SUQB 1N56A 4L76A 1F60B 3N5FA 1HARA 2BQUA 3CTRA 4HI2A 1HBMB 4J9UE 2XG8A 3QJJA 2W2MP 1RHMB 2AQ4A 2YWHA 1GXUA 1RTDB 3DLBA 2Z2LA 3C2PA 2EPIA 2G0CA 3BGRB 4QWDA 2Q66A 3IM8A 3RB6A 5K14A 1LXNA 5KFRA 5IM0B 3HP6A 3WQPA 1KR4A 3IS9B 2KHDA 3AJ2A 3MM6B 1PJ7A 5D4OA 3RG6A 4YS2A 1H0HB 3QRRA 4ICLA 1WKJA 1WSRA 2HVZA 4J9NA 4XDDA 3PM9A 4HTJA 4C2MA 2GO9A 3IM9A 4WCEQ 3NWRA 1MLAA 1QTNB 4ZIVA 2XCAA 4LJMA 1FHTA 2NZ4A 3W1YC 4B9MA 4X64J 2ZUGA 3SYZA 3GJRB 3MR6A 2AGPA 3ADAC 2X3DA 3IRXA 4M63A 3PO4A 3J7Z5 1C0UA 3A3NB 3AJ1A 2B5JB 1WUUA 1VCTA 2MQMA 2FQQB 4P74A 4DV1J 2XNQA 2QYCA 1RZMA 3Q89A 1WG5A 2RMLA 1UWBA 2AIRB 4QYRA 4B3MJ 3DYAB 3LANA 3A4TA 3HD2A 1RAEB 1HQEB 4L74A 4HR2A 2HHVA 3CJ0A 4NCGA 1XMQF 3JTNA 1U24A 3TZYA 1DLOA 3B4MA 2F4VF 2DNQA 3DU5A 2YQ0A 2LQ5A 4D3HA 1KWMA 2ZOFA 3UPFA 2AW0A 2XY5A 2WVCA 4U6PA 3ZTSA 1T9TA 3M9MB 1SH0A 3SBMA 3PX4A 2B51A 4I2QA 2VA2A 3GILA 4WZQA 4WE1A 1U7LA 3M2RB 2RHQB 3DOMA 3TAPA 4RW7A 1S77D 2FYXA 5JUMA 2OSQA 4DEZA 3AY0A 1V3RA 4P6QA 2EFNA 4ZVGA 1ZAXA 1T0TV 3HVAA 4PXBA 1RBLA 4DXLA 2K7KA 4BC7A 4DZDA 2VC0A 5B0DA 3CDWA 2VDIA 4XPCA 1U1PA 3BQ2A 1LWXA 2XGPA 1RTHA 3V81A 4ETZA 4TQRA 4MYTA 2B6AB 1JJ4A 2RNEA 4BDPA 1C4AA 5HO4A 1Y00A 3HMJG 2BE2A 2PI4A 4GVBA 1I6JA 2W9CB 3EJMA 2YPZA 4M5GA 2L9WA 1KONA 1FTRA 3MMJA 4ES1A 4LRAA 5MAOA 5KFFA 2BM0A 3KWMA 4JI4J 3CGIA 5KFYA 5HVGA 2LP4A 2PFDA 4AQYJ 2YNHB 2LQ8A 4FPIA 5U47A 4RNNA 3T6JA 3G96A 5HMWA 1AYEA 2VODA 4H4OB 3CT9A 4EYIB 1S0OA 2P9EA 3DLJA 4ANDA 3UNGC 3JSRA 2W8KA 1NB2A 1TKZB 1B0TA 1AUSL 4RWWA 4ZN1A 1T9VA 3N9UC 1UFKA 2IFXA 4OJ3A 2NS1B 1NK6A 3GCWP 2DNKA 1EETA 5HROA 2MZJA 5KFNA 2HYIB 3JYTB 4PWDB 1Q95G 2D74B 4OX9F 1H2TZ 5HN0A 1NXIA 1GMWD 1HWIA 2HLTA 3MECB 2DNPA 1FCAA 3JB9k 1MSWD 7FD1A 1BLUA 1UEVA 1S1TA 2HQ3A 3I87A 4WU2A 4NEYA 2A18A 1CJTA 3PO5A 5H9FK 4PQUB 4KHPF 3MPVA 1XK8A 2FHOB 3DOKA 2NPFA 3MPYA 2OPPB 3M2VB 1IN0A 2V68A 2CJYB 1HWUA 4WWSA 4X4NA 1ELOA 3BM7A 3LP2B 2VU5A 1HNZJ 4AL5A 2GO8A 4ZJQA 2W24A 4DL0C 4Y3CA 2P9CA 2VD3A 3RRHA 4Y2AA 1LOUA 5B7WA 1R0CB 4ECRA 2QX0A 1VGYA 3V6HA 4NZ7A 5K5MA 4M5HA 1Q5VA 2VG5A 2DHXA 5A76A 5AXNA 2Y1RI 3MR7A 5DM7Q 5GADU 3TUZC 3MZIA 3GMGA 1HBUB 1PKUA 4U8VA 3DRRB 5LMNF 2OMOA 5I3UB 1XNRJ 3AOAA 3MAHA 1Q8IA 2X1FA 4ELVA 2R2SA 1EQMA 3CSKA 2OTJS 2ADBA 3BKTA 2XYHB 3GYXB 1OY6A 1FESA 4DFJA 3O8WA 2CQCA 1HNXF 1W26A 3TWZA 4QU6A 4UOFA 4F50A 3C6TB 1VRUA 2ZZTA 2CNOB 1R8AA 3GIRA 2VQFJ 3SIPB 4Z7CA 4OYWA 2YKMB 4IOAQ 1HWLA 1RK8A 2R7UA 3NBPA 4OV6A 1WEYA 2MZ1A 3FKBA 2V63A 2NYIA 1CBKA 4TY8B 2KHCA 3TVYA 4OYMA 3QT7A 2DH9A 1RHQB 4ZPAA 1BQMB 1IM4A 5HANA 2ACMA 4DV5J 3CNQP 4LF7F 2BJ3A 1KEKA 3MM9A 2AJ4A 2ZOMA 3QSIA 3PR5B 1HPZB 4DR1F 3NOCA 9ATCB 2LXFA 1RAHB 2FJBB 4WYWA 3GFYA 2CQBA 2LU2A 5D77A 2VFRA 3QRPA 1LKZA 2HIYA 1Z4UA 2PE8A 1KHVA 2CJBA 1S1UB 4X84A 4ANEA 4RL1A 2V2KA 4FF2A 1Q0NA 5KFCA 3CCUS 4PG5A 1JLEA 1ZZFA 3TZWA 3CJRA 5EDWA 5A2QU 2H48B 3VHQA 1V3SA 6AT1B 3NP5A 1S5ZA 2A1BA 3ZTPA 4L3NA 2IDLA 4NCBA 1X9SA 4QQBA 2PN6A 2DR5A 3UD3P 2ZBRA 4ATNA 2KFYA 2W2QP 1VQNS 1X4GA 5EX0A 4J90A 2ZDOA 2L48A 2E66A 1AZSB 4FN5A 3GFZA 4NLVA 3H5UA 1NHUA 4FYYB 1RAJA 3W3SA 3W2VB 1UFLA 4ID5B 2VG7A 3HHDA 3FBEA 3CJ3A 4PWUA 2ZE2B 1NDCA 4K2XA 1N36F 5HAOA 1S49A 2PEHA 4ZDNA 4IFYA 2KT3A 2W7AA 5GVQA 4I0WA 2JFDA 3CCWA 4R0JA 1I94J 3ZFVA 3D6HB 4B3OA 3ETOA 4TYAA 2V8HA 2B8PA 4LFBF 3OR2A 4OZNA 3MEEA 4ZJLA 4C98A 2CQIA 2VFTA 1KFSA 4YDXA 3TO8A 3M32B 4R5PB 1N52B 2VL1A 3OLAA 5LL6d 3L4BC 5L1JA 1NB7A 1S59A 5J2NA 2CNLB 4KKOB 2PMWA 4A8YA 1DY3A 2C28A 7FDRA 3MFHA 4NLQA 5KFIA 3OXGA 1OQ3A 4OYBA 2DHSA 5K8NA 3MOJB 4LF8J 2BMBA 3J7A1 3N0VA 4P73A 2HFNA 3QAEA 5HQMA 3CJ4A 5F8GA 2VV5A 2DGVA 2Z2MA 2AX1A 1VBYA 2CG8A 4OX6A 2GMLA 3LF0A 1TKTA 4ZPBA 2VZ9A 2JC0A 1O5JA 5A6PA 2ASJA 3E01A 4DV7F 3J80Y 2G9OA 1RKJA 4F36A 1HBOB 1IKVA 4UOCA 2KH9A 5D0RA 4ECUA 1FFSB 4KGKA 1X0PA 2BZ2A 5M2RA 5E3CA 1TVRA 4CLFA 5B08A 2LVWA 3H4DA 5RUBA 3AH6A 2GMHA 1RT1B 4OLOA 5E3RA 2HFOA 1V9OA 4WU3A 1TUWA 3GV7B 1H74A 4YHHJ 4ZPDA 1HR0F 2W25A 3ZZZA 5HVHA 4C11A 2HG4A 4W92B 2V8DA 3I5BA 5IS2A 4F4WA 3DLGA 2BM1A 4S0MA 3MMCB 4DS4A 3EYZA 2FLOA 2IBKA 1YK9A 1RT5A 2YPYA 1Q4RA 2EFOA 3EDQB 5AT1B 3MM5B 4ZOSA 4WTYA 2B5JA 4WZMA 2KKHA 2XB2D 4F25A 4WP9A 3SFGA 2AYEA 4LSLB 1FRMA 4MT1A 3T1AA 3I32A 3L7PA 5CZXA 3Q8PB 4JI0J 3LH2S 5BYQA 4G1QB 4M95A 2ZKUA 5AE3A 1U2FA 3EX7B 2QZ8A 4PPZA 2RIJA 2YBVA 3S6EA 2ZD1A 1WEXA 4DF4A 1NO8A 3BYRA 2IA6A 3TJ9A 1F5CA 1TL1B 1YKWA 1DARA 2BJ9A 1ZM4A 1GXLA 5DLFA 4YMEA 1RUSA 4F3OA 1S1WB 2J6TA 4IFVB 5CA5A 1HBNB 1P9YA 1T9WA 3U1MA 4N8NA 4CH7A 3SDEB 1JLFA 5J2PA 4IH6A 4RO0A 3HZGA 4KYZA 1X5TA 3QT6A 1WWHA 1NAQA 4B3TJ 2Y9HA 2BANB 3Q8YA 5EX3A 2V2ZA 1RWNB 3W9JA 5F8IA 1TUGB 1VQYA 2JVOA 3JSMB 4HACB 4QIVA 4ZPWR 5IT0A 1K1SA 1MMLA 3NGTA 1KQSR 4CO0A 2X7IA 4HYKA 4OZ1A 3IRWP 3IG1A 2LMIA 3ZZRA 3KK1A 4AD6A 1RTIA 2NUHA 2J0XA 1CPZA 3ETMA 2DEIA 2RU3A 5HQLA 3RRGA 2YNHA 1N32F 2CQDA 3FGVA 2V6AA 1KBRA 1RU2A 3IFEA 3HXMA 1R8CA 2G0IA 1F2HA 2QIFA 2ZWOA 4JI8F 5C24A 4PKDB 1FNXH 1FEEA 4B3RF 4NRUA 1RAAB 3P49B 5LM7E 1XNQF 1PIEA 8AT1B 3WX8A 3G6VA 4JI7F 4Q5VA 4OI4A 1ZYQA 3QWUA 2MHEA 2NSBA 2G2ZA 1UPMB 1GX5A 3FEXB 5KG7A 2C3YA 4DSJA 3HHEA 1KQFB 1MG7A 3O6QA 3D67A 3KG0A 2MSSA 2XSJB 1BMQB 3I0RB 4LQ3A 2VG6B 3I4HX 1M5KC 3N28A 1EB0A 2XZDB 2DH8A 1W2BR 1RHJB 5IFMA 3UD5A 2F4FA 2B4UA 1S0VA 1OMSA 1FWKA 1TL7B 2KXHA 3N6MA 2CJKA 4DR5F 4O3QA 4ZCIA 3W61A 1D1UA 4IG0A 2CYYA 3R1LA 3GV5B 2M88A 4HT5A 3VV2B 5L39A 3MM7A 1SC1B 4KAIA 4UY8T 3CPWR 5IQQA 4C8OA 2Y3YA 1SKSA 2BDPA 3PX6A 2MKHA 1K9MT 2HHWA 2F8HA 4LF5J 1XIQA 1BHNA 1NLKL 3TAMB 4KY3A 3LP0B 4YFUA 4PYAA 2V4JB 4NYPA 4USKA 3K7RA 1HBUA 3HT3A 2DHGA 3OFFA 5I3UA 1LWCB 4DUYF 2JJ4D 3R5AA 2B9YA 4J9RA 5I4MA 3P4UB 1F6TA 3BH6B 3TW0A 1IBKJ 2RKIA 5E5NA 5HSPA 2F8MA 5C25A 5KFHA 1VQSA 2ZC4A 2CQ1A 3AFGA 1S9GB 4LFAJ 3KJVB 2DGXA 1VQ7S 3RBXA 3QBCA 2WW4A 2YKMA 5F3ZA 3L3CA 4KTQA 1NRKA 1VBZA 4TY9A 4A8OA 4PYDA 2CPXA 1OSDA 4ED0A 3OUYB 3Q8RB 1QAYA 2VF3A 1RSCA 3KLVA 5I3QA 3HKZD 4QR2A 3UCGA 3KHGA 3TQEA 2BW7A 4KGMA 4M5KA 3DHXA 4QZVB 2Q79A 1RT2A 5DDQC 1AFIA 1ZA2B 3M8ZA 3V4IB 1R6VA 4H4KA 5B0GA 4FXDA 3BSNA 1YG0A 4DV3J 1HPZA 1S57A 4RW9A 2KB2A 5J1NA 4CYUA 4DSEA 2QSFA 1WG4A 1PC5A 3CJQA 1SL0A 2HPUA 1S1UA 1EP4B 3OFEA 2IA0A 3MAAA 4LF6J 2UVWA 3H5YA 5K8OA 5CYMB 4JV1A 2E9RX 3W64A 2AJ2A 3TEHB 3J81U 1EIYB 2DNGA 4B08A 1E6VB 4K4WA 4JI2J 3A8JA 2UUAJ 2BA9A 5GMKa 1ZS6A 4KFBA 2MTLA 1E6YA 1IKYA 4NL5A 4BCAA 1NJIT 3NS6A 1IXKA 1WI8A 1U0HB 3T19A 4DR3J 2KTQA 5ETNA 2CJ9A 3HCXA 1QE1B 3W63A 3FQKA 2DITA 1Q8BA 3MR2A 3D28A 4LF9F 2K1RB 4DFMA 1X7VA 2FJWA 1N34F 1X5OA 3M8RA 2KU7A 4ED3A 3LOUA 3TANA 4MK7A 3D7SB 1K0TA 2W2PP 3EVOA 4QW9A 1VQ6S 2E7WA 1LW0B 3ILOA 2ATLA 2EVZA 3QQCD 3BQ1A 1P8GA 1F9EB 2G1DA 3R6GB 3FCHA 1SL1A 4RZRA 1X31C 5DG9A 2E29A 2EG1A 2CJAA 4KRWA 1PO6A 3EGNA 5KT7A 2J8AA 3QT8A 3FRYA 5J2QB 4EFAC 3K57A 2HSEB 1MN9A 1CVJA 4RX6A 2NLWA 3N4WA 1UAWA 2FVPA 1N33J 2CWKA 2FB0A 5HP1B 1HW9A 1IQTA 1R0BG 1SI9A 4ZCKA 1RT4A 2CPHA 5KAKA 1SJ3P 1KKHA 4PG4A 3UWTA 1N5YA 4QCLA 2DNHA 4O44A 3ULHA 4A4JA 1QAXA 2DYAA 2AF6A 4DHVA 1PC4A 1R43A 2GQQA 1J5OA 1OPZA 5B0FA 4ZN3A 4X66F 2GQ2A 2FLNA 2O66A 3H98A 2QTWA 2V69A 3PW7A 2IRYA 2XY6A 5ETMA 4X4TA 2JWNA 2ZNYA 4DPXA 2R7XA 2A10A 4KPYA 1BC6A 1JLQB 3A8KA 4MYUA 5C42A 2ZBQA 2UV8A 3I82A 3NXZA 1RCXB 2QL7B 3I9V9 4N41A 2NYHA 1U1LA 1WEZA 2HHHJ 3A1YG 1OQ6A 4RNOA 1G1XA 2RF2B 4ETXA 1YJ7A 1WJ9A 1I3OB 2W9BB 3E3XA 1J5EF 4DR4J 3AB2B 2DGSA 2B7BB 3CCRS 2HNYB 1F3VA 2QC3A 3CCQS 3G6YA 2JNJA 1VC6A 2QT7A 5HQ8A 4U7UK 2E44A 4B9NA 2BVZA 4TXSA 2YXLA 1RHRB 4DN9A 4ZITA 3IP0A 3J7YU 1Y5IB 4FVCA 3NAIA 3MR3A 2MJNA 3W2WB 2W01A 5C7PA 1RWWB 3MTJA 3UO0A 2MXYA 1HW8A 2A2DA 3SV3A 1EQ0A 3VAGA 4QBUA 1SKWA 2VQEF 4QW8A 2GIRA 5AE1A 5HI7A 4K50A 3G9CA 2UUCJ 1TL1A 3JTPA 4F0MA 1PBUA 4W98A 2DGUA 2ZVSA 1HKAA 4CDIA 2XHWA 2OPQA 5C2CA 1XMOJ 4FDFA 2HHPA 4I2PA 3H90A 4O4GA 2F8EX 2CPJA 2I9SA 3A8IA 3DMJA 2Z0GA 1PYOB 1NKEA 2QMXA 3OD2A 2V8GA 4WKYA 2BANA 4N77A 4GKKF 2LQ9A 2R7TA 4PWWA 2VFSA 4NYOA 1B7FA 3D68A 2YKNB 2EC0A 1HWJA 2BJDA 2V9KA 4HACA 5SUHA 3NRBA 2O67A 2KM8C 3DLEB 3PFEA 1S1XB 1CJVB 1ICEB 4OMFG 5AXKA 3ZNUA 2R42A 4DSKA 1FK9B 2HBQB 3JTOA 2HBRB 3A12A 3TR5A 2Y0BB 1K1QA 3EXYA 2H4YB 4OFZA 4FKYA 1QVGR 1AB8A 4FNHA 3QFWA 3BR8A 3UCUP 1X9MA 5A6WA 2N7CA 2DRBA 3J81j 3DN9A 2FY8A 5AXLA 4DPUA 4ZLPA 3HHNB 3R7NB 4I7FB 2YY3A 3ONQA 2EI5A 3GONA 4ED1A 2GA7A 3C14A 3KHLA 4HL9A 3BH7B 4CLYA 2J7UA 2YNFB 1HLWA 3WC0A 2W7PA 4ILRA 3KXDA 1N54B 2WOMA 1BE4A 2EG2A 1S6UA 3HM9A 4C8KA 3WC2A 2L08A 4OI3A 2F3JA 1KVKA 1S9EB 1HNIB 3BR9A 5K9FA 1Q7LB 3IN5A 1KVIA 2GGPB 3VZIA 5HMZA 4QWEA 4B3SJ 3EM1A 2YVSA 3FBBA 1T3NA 4FNIA 1X4FA 3HHLD 4DV5F 4OZ3A 3CCES 1WDTA 1B0VA 4NXMF 4CNYA 3G87A 2Y8YA 4J91A 2QGFB 2J9DA 4OZ2A 3GSDA 2CIMA 3OVBA 3T5KA 2K3KA 5CYQB 3QRQA 2Y8WA 2RS8A 4HT7A 2HGLA 1VC0A 1MU2A 5KFAA 4B9TA 1YJNS 1C1CB 2B4OA 4L6V3 4R25A 1SQGA 4E8UA 2XULA 3BBBA 3LP1A 4O0IA 2AU0A 3HFKA 1AUDA 3LPYA 2CPZA 4M5DA 3G6ES 4EGLA 1SCJB 1IR2A 1FRKA 4RKUC 5KG2A 4JI3F 3V6DA 3UFCX 1Y3JA 3X1LB 3C15B 1LW2B 2DNRA 1RE1B 3D1QA 1KNZA 2PDAA 1RT3A 5IV3A 3SXLA 1LXJA 4ITSA 2CZ9A 3MMBB 2YX7A 4DV6F 1U6FA 3CF5Q 2BX6A 3FEYB 4M5IA 3SQGA 5F8HA 3CW2C 5LXRA 2ZDPA 3CD0A 1LWFA 1XR5A 1LWEA 2MSTA 2ZBPA 4JI1J 5HJYA 2GV1A 3QLHB 5CXTA 4RWXA 2BW2A 5IZHA 2AJ1A 5M2UA 1VLYA 5E41A 3HPOA 4ECQA 3KLEB 2PFFB 4ZP9A 2YQ1A 2QLXA 2M52A 1SVDA 1Q81T 1U2CA 1UVLA 2RJZA 5L38A 1R6YA 2FVSA 4C97A 2HBYB 2XZTB 2UP1A 4KIAA 4WFAQ 1U1NA 2OPSA 2VBXA 3D66A 5H9FJ 3KJVA 4FF4A 4J9SA 3LQVA 3HD1A 4NX9A 4DR7J 5A8KB 2FUG9 2L9DA 3NG8A 3OUYA 3NAHA 3VQSA 3RUBL 1IBMJ 2MQLA 4OZJA 3HHLB 3CDEA 4EO8A 4YR2A 4U67Q 1YRXA 4RNMA 2HLUA 2AJFE 1O6XA 1IBCB 2N4CA 1S79A 4TU9A 1DRZA 1NPRA 4EU0A 3IBWA 5H9EJ 1UVNA 2ADCA 1KTVA 2K8GA 2W4CA 4MMOA 2DNNA 5D4NA 3ET6A 5K14B 3S01A 3CJSA 4FZVA 3MD3A 4G6VB 1S76D 4NZ0A 2GNKA 2J0SD 3BEGB 3KTQA 1R0AA 1TKXA 3T6BA 4U7UD 1F0XA 2B8QA 5ETTA 1RAFB 4ICLB 3QSYB 2ZC3A 4DBQA 4WIIA 1FERA 3NCRA 4RBVA 4Y2CA 2PC6A 1FJGF 3TEGA 3NL0A 2H5EA 2YNGA 1XEZA 1Y9OA 1FJ7A 3SSRA 5LSRA 3RAXA 1SJFA 2UXCJ 3HSJA 5I3PA 1TL3A 4HVZA 4IH7A 3R5JB 5D6GA 4P71A 3AD8C 4WBFA 1D09B 2QL9B 3BSOA 5A8WA 3IRXB 3HK2A 5ETVA 1ZZNA 1ROFA 1YGYA 4A48A 1RWKB 1C0UB 5A8RA 4BS2A 4K4UA 5F9NA 4ECSA 3DC2A 5HJXA 1UWBB 5KFMA 3GG1A 2V94A 3DRXA 5KFJA 2XQCA 4ILLA 1TP7A 2FDNA 4UQGA 3D54A 4JI0F 2R7SA 4NCGB 3NY0A 2P6TA 3BV8A 1R8BA 1DLOB 3R8YA 4CQ1A 4RLEA 4C6AA 4LF4J 3GR0A 3GP9A 1NK7A 5DDOC 1I5OB 4QWBA 4IUFA 1IR0A 1SC4B 3EE3A 3M6XA 4C8MA 4TU8A 4I2QB 2CUYA 4RBUA 1KLNA 4WE1B 3DOMB 2QA1A 4RW7B 4XDCA 1JQGA 2RQ4A 2Y1JA 1SC3B 3UD4P 4CTAA 2M5YA 1ACMB 2ZFHA 2DISA 3OHAA 1C4CA 4B3TF 4Y00A 1W7WA 2IBOA 2MEWA 1K73T 2MGZA 3D4JA 4L3KA 5D15A 2JOQA 2D9OA 4KHRA 1S6QA 3KFWX 3D0IE 4DCOB 3AD7C 5ADZA 3V81B 1QTMA 1FWPA 1WC3A 4J9QA 5IXUA 1YZ7A 2CKWA 2HWTA 1ZOTA 3FMBA 3D0HE 1XN9A 3KK2B 2BE2B 1VBKA 3J7ZT 2XMWA 1F5AA 4GVBB 4JP8A 1WC1A 4DL5A 3BREA 2OTLS 1S9FA 4LRCA 4USMA 4QIWD 3W62A 4BC9A 4OI1A 4N56A 2FJDB 3R5GA 4ECXA 3K5NA 1SQEA 2DHAA 3G86A 2DIUA 2GQCA 3AXMA 3B82A 4E2FB 4RUAA 3P5TL 4KH1B 1FRJA 5HBMA 3UW1A 4OX8A 2K06A 5KFLA 3TA0A 4KHMA 5IWAF 3LUYA 2BBEA 2OEJA 2V67A 2OFGX 1YITS 2HQIA 3NGRA 1HD1A 3OW2R 4TNOA 3D6MB 1EETB 5HROB 4I56A 4IR1A 1YBUA 1EKRA 2HQFA 2J9EA 1NDKA 1Y7PA 1QVFR 1S4EA 2AYMA 1VDHA 1F9FA 2XZWA 3KYLA 3CJKB 4EBEA 3WBZA 4NE9C 4X65J 3ZZUA 2B43A 3VGUA 4V19X 3HT0A 5ETSA 3BDPA 5LSOA 2IM1A 1S1TB 4LSZB 1UW4A 1CJTB 2IAJB 4TLRA 2RT3A 4TYBA 3T1HF 3DOKB 2JDJA 4JI5F 3AOCA 1NJZA 4ZPTR 1X0FA 1VQKS 1CQNA 4URQU 2N7YA 4RW6A 4J5OA 3M30B 2UUBF 4ED6A 2HMIA 3IR5B 1V6HA 4DMZA 3VAMA 4Q0BA 4YB5A 4C8YA 3RB4A 4J9OA 3M2UB 2VFUA 1JLBA 3HVWA 4UTGA 3VCDA 1DJ0A 2JEFA 2VG5B 5KFXA 1KLMA 5F8MA 2J9CA 3S7RA 3CE8A 3K5MA 3L7UA 4UT4A 2C2DA 1GAOA 2R4FA 7AT1B 3RYLA 1FDBA 1JLCA 2VB6A 3QT5A 2GS8A 1X4EA 4ZHRA 2Q3PA 1GTEA 1GT8A 3H5SA 1RHKB 1CG2A 4YY3J 5KT4A 3FBCA 1VRUB 4LFAF 2YNFA 5GAEI 3UDCA 1Y5LB 5CHCB 1NM2A 4CNZA 5CABA 4CP5A 1XTZA 3GQCA 3H5XA 2V9WA 3F56A 4LF1A 4KV8A 1S9EA 3KDOA 3R5CA 2AYBA 1SQFA 5B0CA 1FVQA 1KQGB 3FMWA 3CDBA 2BJ1A 2AEJA 2E1AA 2U1AA 4IOCQ 1D9DA 3W8GA 2HVIA 4DDFA 4DV2F 2PMZD 1FKOA 2RD5C 2BQ3A 5FDLB 1NJWA 5FD1A 1UJ4A 1NJXA 2LEAA 4F4XA 1VFJA 4ZP8A 4DL6A 3MM9B 3FSXA 2OIHA 1M1HA 4K0KJ 1LEOA 4DR2F 2KXFA 3KHRA 1NH8A 2VFVA 4B9VA 4IYQA 5CYQA 4YOEA 4IKAA 3PFOA 4UOHA 3Q22A 3LAKA 4LSNA 5FIIA 2ZH2A 1X4CA 2A2CA 1OO0B 1RAOA 1VLOA 3ISZA 1FJEB 2FVCA 2WHOA 1MNEA 4RBTA 2DT9A 1JLEB 3NGDA 1JX4A 3OTOF 1EX8A 1KQKA 1DAXA 2BOAA 3HJVA 2W9AA 1VIXA 4QYZK 2H1YA 2XS5A 2MKSA 4ALZA 4KBIA 1T05A 1KSPA 3ZNJ1 1NEEA 3I0SA 2DXEA 1GK8A 5J1PA 4NLSA 1QAJA 1M5OC 3KLFA 2VC1A 5ETLA 3OL9A 4OV1A 2WZ1A 3IWXA 3GLJA 2MLXA 2PA8D 2VH7A 2BJ7A 2VG7B 1JJ2R 2AEMA 1VQ9S 3KMSA 2UXDJ 4ZK7M 4OZ5A 1ZPWX 1QY7A 4IFYB 3AB4B 2F63A 4ED7A 1I51B 1M1KT 5D4LA 3VAHA 4DWIA 1YTYA 4B3OB 1EAYC 3D1OA 3PHTA 1QJHA 4UOGA 3OR2B 3MEEB 4HDHA 2WRMA 3C16A 1ZM3A 1XMQJ 3CMAS 2QJ3A 2E5LF 3QIPB 2MQ8A 3OJSA 4PXEA 2AZ1A 4M5LA 5J2NB 3SSSA 2V4RA 5L1KA 3J7YI 3RAQA 4A8SA 2MZSA 1RWPB 3WIUA 3IGVA 3B4DA 1SJQA 3GFXA 3I56S 1TTHB 4WXOA 3TJ8A 1Y11A 3EZOA 1QAIA 3VZHA 4DPOA 2R7QA 2I5JB 4ZVQB 3TX0A 2ZM6F 1TKTB 4LF2A 4KGVB 3E01B 1KS2A 4HHUA 4PCQA 1UVJA 1NMEB 3MI7X 3EICA 4Z7YA 8ATCB 2BQRA 2BEFA 1IKVB 3DFEA 4LR8A 3Q8UA 4HHJA 5J2MA 5KFWA 1FXLA 4WK3A 3EGWB 1KFDA 2CFXA 1TVRB 3PX0A 4I68A 1G3OA 3TI0A 2IVYA 1IKWA 5BYSA 6FD1A 1CC7A 3R6LB 2W7OA 2V50A 2MZRA 4QPTA 2HHHF 4C11B 1WD6A 1FE0A 3DLGB 3VQTA 2MY8A 4WKRA 2APOA 4DR4F 2MY7A 4Y2MA 4A8KA 4LVOP 3OFGA 1UPPA 5CH7B 3A13A 1M5VC 1RT5B 3CJ8A 1OPIA 2HRTA 5B0BA 3NCQA 2RQKA 4DX6A 2XLKA 1L3UA 2DBBA 2GZOA 3MCSA 2I6WA 4CO5A 2BRLA 4OI6A 3KLHA 4RR5A 1F9HA 5ITHA 3LGNA 1N5VA 2K2PA 3MR5A 2WBRA 5LSLA 2Z58B 2OD6A 2BRKA 2QFJA 4O3OA 1U6BA 3JQJA 1NK4A 1TU0B 4OX9J 3LW5C 2EBGA 2EFQA 3HFZB 4JYAJ 2ZD1B 5K8PA 1GTHA 1XJWB 4NLPA 4NLXA 2ROPA 3DOLA 3Q8QB 3CDUA 2EXUA 4F4YA 2DKOB 3PW0A 2NXUA 4IQMA 1WELA 1U6ZA 1VJWA 1HNVA 5G4DA 4DUZJ 1W2IA 4WFNQ 2MKKA 1YBAA 3NNHA 1HNWJ 2DR8A 4KHPJ 1SL2A 3OVSA 2FGOA 3EZUA 1JLFB 1RGVA 4CH0S 5J2PB 4MTPA 1NK5A 4ES3A 3FSIA 4OYPA 1R31A 4HKQA 2AD9A 4M5JA 3KUGA 2Z56B 2LKZA 3LGMA 5LJ5Y 2XC9A 2JZ5A 1BD6A 1S7HA 2N3LA 4F0HA 1S0MA 4WP3A 4LBIA 1VK3A 3JS9A 2JH3A 2BOPA 3T5HA 3OBIA 1FRIA 4DX8H 2ACYA 2C2ZB 3KK2A 2UU9F 3IG1B 3GJQB 1ZAWA 2DNZA 2JX2A 1NJYA 1MWYA 3KK1B 3GZ7A 1KRPA 1RTIB 1A7GE 1UMJA 5LMNJ 3E51A 3S8SA 1RTJA 2D3UA 3LWMA 3VWSA 2HFSA 4DQIA 2UXBF 4Y28C 4BHQA 5CD4A 3NGSA 5DQIA 3BF4A 3R2CJ 4BWJA 3MD1A 5L9NA 2KDOA 2ZJPQ 1WC6A 2HHQA 4DX7A 4ECYA 1HNXJ 1XQIA 2CJQA 4P75A 3PIOQ 5C24B 4ZVSB 2ZHBA 1KVJA 5HK4A 2C2OB 3P8BB 5L46A 5EHHA 4J37A 1DBDA 2NPIA 4Y6IA 2CPDA 2J6UA 4HHHA 4RW4A 4V19J 3FDSA 3ISNC 3AJDA 2QO3A 1GFWB 1N0VC 1VQOS 1N8RT 1FT8A 4DFPA 2RQCA 3CCJS 1U8SA 2CZVC 2XWYA 1ZTWA 3KNAA 2OEKA 3I31A 3ILIA 5EWFA 2QLJB 2H5IB 4LF7J 3CJKA 3LGHA 3PIPQ 4DL3A 1U02A 1TKDA 1OSCA 5HVFA 1HI0P 4DR1J 4ILMA 4UF4A 2XMKA 3VGVA 4CLZA 1ITPA 2IAJA 5AJ3F 4NA3A 1FRLA 4DUTA 2RUGA 5B0AA 2JC1A 2CQ2A 3GJSB 4IG3A 2DO4A 4IG0B 2KRRA 1YJWS 3QYYA 1NDPA 3M30A 2J8SA 4I6YA 1PCAA 2R2RA 3THVA 3MM7B 1YJTA 4WIQA 3VF0B 2VOPA 3IGNA 1IVZA 1Y4ZB 3TX8A 3TNVA 1UCNA 4OI2A 3M2UA 2ROEA 2VPXB 4LUBA 1S4FA 3BSCA 1HHQA 4U7CA 5H9EK 1X4DA 4XIUA 2ZJRQ 4ZPVR 1N48A 1FXDA 2DCLA 4J9PA 1APSA 5BXIA 2PSZA 3MCOA 2ZH3A 2Y1LB 2GAHC 1N4LA 3Q8SB 1YRUA 3RBZA 3MM8A 1N36J 2V2QA 4KR0B 4WPAA 1RABB 2LFVA 3CJ2A 2DVIA 1ZPVA 1WOOA 2VJUA 4QU7A 1XERA 2RKIB 3C6UA 4EBDA 5H1SV 5C25B 2GVZB 1RB0A 3PVXA 4PUOA 2IDEA 1L3VA 4LFBJ 3IR7B 1BQNA 1YJVA 3D3BJ 3DXSX 3ZTRA 4KC5A 2RH3A 4K59A 3M4XA 3RBDA 3W9HA 3A3OB 2HS4A 3BYPA 3GSIA 5IT9Y 4YB6A 5KFOA 1P27B 2LEBA 1JJHA 2AEFA 5F41A 2BYCA 3KJQB 2CRLA 1WG1A 4WK1A 2K7JA 2XEXA 3ENQA 4ZJOA 3DDKA 2PEBA 1LV5A 5LMUF 5FDLA 1NZ8A 3JAMU 5DM6Q 2PD1A 1RT2B 2OP5A 3K5PA 4ZVFA 2R8IA 1TZ0A 1VISA 2DGOA 2DB1A 1NUEA 1S12A 2HQCA 2W4PA 4RW9B 1DHMA 1IM6A 4CYUB 4DV7J 4M94A 2OD4A 2ASDA 4BLGA 4DU8A 4P10A 2JLFA 2HRUA 3MAAB 3M9NB 4ER8A 2VIHA 2O3DA 1HYSA 3AT1B 1UVIA 3R5BA 1DTTA 2CAJA 3GIKA 2KVIA 3H2UB 2J7WA 4TU7A 3KLGA 3QATA 1U48A 4A8FA 2OKQA 3NMAA 1GXTA 4DQRA 1S72S 1U09A 4KFBB 1E6YB 1KN6A 1IKYB 2UXCF 2R2UA 1MWQA 4FBUA 4C8ZA 2HZCA 4YB7A 1HIYA 2A0FB 4C0OC 1VR6A 3M8QA 3M7VA 3TRGA 1X9WA 3W60A 1FRHA 1CS4A 2GIQA 4LR7A 3M8SA 4GKJF 1SH3A 2FHKA 2FY1A 1YLXA 1VQ8S 4EBCA 2DR7A 3WX4A 2ILYA 1RWUA 5BR8F 1WHVA 3DRSA 1Q78A 1YI2S 1SJ4P 3ENVA 3FCWA 3TUPA 4X4VA 3M6UA 5I42A 1H2VZ 5GAGI 1RP5A 4W4MA 2DJWA 4UZCA 2D7SA 2DH7A 1UTAA 4E98A 2OJ3A 4DV4F 1ZAVA 3D5MA 5AXMA 3MF5A 1AROP 3QIPA 3EZ5A 2P6SA 2UUWA 1RWMB 3HFVA 1IBLF 1WF2A 1L3SA 2QLFB 2MKIA 3PV8A 2YKOA 1VYAA 3ZZOA 2XMMA 4MFBA 3EPIA 1NU4A 2ZHOA 2ZH6A 3TUJC 3PYDA 2C2KB 4K4TA 3RB0A 3GR1A 2GCFA 2LA6A 1H98A 2ERRA 3BGUA 4B9LA 4YR3A 1NSPA 4IQXA 1RT4B 2M4MA 4HH1A 3EUNA 2XTJP 2I5JA 4X62F 3FRZA 1U0SA 3WZ0A 1N5YB 5KFDA 1Q1KA 1T94A 4O44B 3VVTA 2XY7A 2C2MB 3MXHP 2WW8A 5CD4H 4ZLNA 4WYLA 1S0NA 1J5OB 2YTCA 4J9KA 2ZNZA 4M5MA 4H4MA 4MIWA 4U9RA 2D3O1 4OIXA 1T9YA 2ZH8A 1H72C 4C7QA 2Z8QA 5C42B 9RUBA 2LLZA 2UV8G 4F7VA 2HHUA 2WB4A 3ZXWA 1N32J 1RADB 3JSYA 3ICLA 1J2VA 4MJKA 4N47A 3GG0A 3CJTA 3QIDA 1YZ6A 2WTFA 1RBOB 5DJBA 3O3LA 1FKPA 4PPDA 3OPKA 2J76E 1PG5B 4JI8J 3QPIA 1MROA 5HLFA 1T11A 1WORA 2FGCA 3M6WA 4B3RJ 5KG4A 4P2MA 4DR6F 4NLYA 4ZVUB 2DO0A 1XNQJ 3FFIA 2GFFA 4JI7J 3IAS9 2ZH4A 3GB0A 1HMVA 4C0HA 1JJCB 3IBCB 3GFHA 4USIA 4GRSA 2RE1A 2AZ3A 2YH1A 1NHVA 2B7CB 3CD5A 2EC2A 4Y2KA 3K8WA 2I38A 2XLIA 1WACA 1Q82T 2OLWA 1Y0HA 4YEAA 4B02A 3F0NA 3FK4A 1Q79A 2VJVA 4KB7A 2UUTA 2OPQB 3ZZTA 2PI5A 3A8EA 3CC2S 4I2PB 2ASYA 4O4GB 4F3MA 5F9LA 4WFYA 4PEOA 4DR5J 3DMJB 2YX4A 2E1PA 3BPDA 1TUVA 1LK5A 3MUMP 1JB0C 3EDRB 3QMQA 2H51B 2M70A 4RW8B 3BS9A 1C1BB 2E7VA 3UN5A 1ZH5A 3Q24A 3ILLA 3NLCA 4QPXA 2M7SA 1VI7A 2YNIA 2PA3A 3DCAA 3KLIA 1VK8A 3LWLA 5GAHU 4FYXB 4P52A 1Q53A 2M3DA 4PRFA 5HATA 3MPUB 4B9SA 3GE9A 1H2UX 3GIJA 2KZZA 2CDQA 3PNIA 4DUYJ 2KYZA 2MMYA 3F73A 3QGGA 3JQMA 3ZTQA 2ALYB 2HHXA 3ZC4A 1KD1T 4D3GA 4KO0A 4LFCJ 1U1RA 4DF8A 3DM2A 3T3FA 3C14B 2HQDA 1NHKL 2IHR1 2WOMB 4ANCA 4HLBA 3D0GE 3I55S 3OTBA 1SIWB 1IR1A 2G1HA 5K8MA 2MKJA 1HQUA 4RPFA 2YX1A 5EN1A 1LNQA 1FTCA 3P45B 1SJ1A 4PZVA 1XMBA 1PYSB 1RBAA 2XI2A 4JI6F 2E5GA 1WI6A 3HJFA 2VBWA 1OYDA 5EGYA 2E1RA 2C22A 4K0KF 2GHVC 2HFZA 2YWFA 5E2QA 3AAWB 2MQQA 4K7QA 2EK1A 1ZM2A 2EBEA 2CQPA 1JLAA 2OH2A 3K5LA 1U45A 1MU2B 3QFHA 3RAMA 4NLWA 4JV5F 3P5BP 3T9ZA 4C9DA 3PJWA 1MN7A 3ITHA 2CA9A 2ZBIA 5EUHA 3T1YF 3LP1B 3PEJA 2D1CA 5A2QY 1MWZA 2BJ8A 3HI9A 5D78A 4IO9Q 4M5DB 2L3MA 1RKIA 4ZA1A 1YHQS 4NPOA 3V6DB 1VHIA 3UVJA 3UDLA 4DL4A 2J5AA 1SV5A 3RR8A 1JXVA 5KT6A 3G71S 4YR0A 1RT3B 4GO5X 1JLGA 3AQPA 2JLGA 2AT1B 4RU2A 2LXIA 2NSCA 3B54A 2IPOB 3SQGB 4ED2A 2J7KA 5ETRA 3AHPA 5DGAA 1LWFB 1LWEB 1FE4A 2KT2A 3FNNA 2GIFA 2UXDF 3D3CJ 3DLKA 2DRAA 3RB3A 1IKXB 2JL9A 2M8DB 3QO9A 1TELA 1VJQA 4LF9J 2M8HA 4ZP7A 1FD8A 4W90B 4PAAA 1D3WA 3HVTA 2LEPA 2IRUA 2VHGA 1YSJA 1N34J 2GVZA 5A0YA 2OFHX 1REGX 3ELHA 2OPSB 2ZWPA 3N6LA 2AJQA 4LBHA 3SCKE 1X8DA 1HA1A 4K4YA 1D8ZA 2YWEA 1B7YB 5CQGA 3PRVA 4F04B 2C2NA 3MUTP 4NXNF 4EZ6A 3KJFB 2LXUA 4DPTA 2FTRA 2XM3A 2F5GA 2ZH1A 4WTOB 1AXQA 2PMHA 1KP6A 4F8RA 1RWVB 3M6VA 2Q6CA 4MH8A 5LT5A 2Z30B 2KM8B 4X4RA 5D3GA 4G1IA 1V5IB 3KMQA 3UNYA 1UA1A 5KFTA 2N4DA 4ELUA 3DGPB 1VRQC 3M8PA 3H42A 3JQKA 2XMJA 3DU6A 1TFWA 3LAMA 3ET6B 3OR1A 4EUVA 1FNOA 4C3LA 3J80U 5KT2A 4ZCLA 1UA0A 1TV6A 1R0AB 1TKXB 3MEGA 4ED5A 2X1BA 1UWAA 4X66J 1Z2LA 2FZKB 1VMBA 2LU1A 1TMMA 5HMYA 3MPDA 2KXNB 1L5UA 3AODA 5ETPA 5T7LA 5DG8A 1OIAA 1GQEA 5JMNA 4GO7X 5KTQA 2EFGA 1JWWA 2YNGB 3U27A 4UUWA 3TP2A 4IDKA 2YKPA 2ZHAA 1TL3B 4X64F 4DG1A 1J5EJ 3RBEA 3OJUA 2ASLA 5KFZA 5A8WB 1QUVA 3KJNB 2XYGB 3HKWA 1G6BA 2ZOGA 5A8RB 1S10A 3D6TB 2LYVA 5GAEU 3FBFA 2MZTA 4DV1F 2R7OA 3HF5A 4ZVEA 3CWJA 3MWBA 2J0QD 2H5JB 3BN4A 1NKBA 1VQLS 3IXQA 4B3MF 3HX9A 1B4SA 1ZETA 1SB6A 2WVEA 3CCZA 1TQLA 2C42A 1U4BA 2KJVA 4DSIA 2GJ2A 2UVUA 3FJ2A 3LA0A 3PYEA 1YRTA 1FA0A 4MKBA 4JV2A 3TA1A 5ETOA 2H9ZA 4JYAF 1HHTP 2NR0A 4Q44A 1FJCA 2VQEJ 4GC7A 4HH0A 2DNOA 4FVMA 2MYFA 3C66A 1VRTA 3POTA 4P7VA 2EKNA 4F26A 3CXCR 1H7WA 4CLLA 4DUZF 3VR1A 3DI6A 4M5NA 2R8HA 3GCXP 1QSSA 2YKAA 5KG0A 3N79A 1HNWF 3AD9C 2FC9A 2RQMA 1UEKA 3K17A 4CTAB 4QYZJ 1R27B 1JKHA 2WCXA 2HBZB 1JXLA 4CO1A 1RWXB 3UR0A 3BGOP 1R8PA 1M5SA 2MGZB 4QWAA 3RR7A 1KC8T 4DLGA 1S6QB 1NCLA 4GKKJ 1V5VA 2HURA 1WOPA 2KVQE 3K59A 3W66A 1VHFA 3MOZA 3DNCA 1FNMA 2KI2A 2B9EA 3CDAA 3U1LA 5MLCV 1TFYA 4I6WA 4NI2A 4C4WA 3UI3A 4LRBA 4CWBA 1Q86T 2HKEA 3VAKA 5J1EA 3BDEA 3BBCA 4RU9A 4JI4F 3VAJA 3QNWB 1REVA 3WHIA 5JXSA 2HFVA 4AQYF 4C8NA 2HWHA 5E3AA 5DS7A 4AUKA 1YJRA 3UR3C 1BWEA 1B99A 2X51A 5KFUA 3UDEA 2HNDA 1VS3A 2GW8A 3FUYA 3IR6B 2AP6A 5JVGQ 3BSAA 4QR0A 2D69A 2M0GB 2WSFC 5HBMB 4YUDA 2IVFB 2XMTA 3PR4A 3QZ7A 2IM2A 4MKYA 3V6KA 1CJUB 2M2BA 1RU1A 3L95X 4OYOA 2XMUA 2E9ZA 4PQAA 1B64A 3EXCX 3OTDA 5FLXU 1UEUA 5DQHA 4Y0FA 1HHSA 4QJVA 3IWLA 2IC3A 1UL3A 4LBPA 3R27A 2BR0A 3PG9A 4G65A 1QM9A 2CPEA 4ERDA 1J27A 1DZ5A 4ZLJA 3OVAA 4NXMJ 1WHWA 4IRKA 1Q7YT 2MB0B 5KFBA 4I6AA 5GMDA 2D3ZA 3MAQA 2RILA 3RW7A 3NKYA 2FLLA 4TQSA 1N6QA 5LXYA 1NZAA 5DRKA 4WFXA 1VBXA 2VONA 1QUPA 3OL6A 1NK8A 1NBEB 4USTA 1CJKA 2OHDA 4ZIWA 3CUNA 1LK7A 1Q8KA 1HNZF 2CWXA 3QGPA 2GAGC 2HGMA 4RW6B 2MQPA 4CI0B 4CO3A 1UJ6A 2MLZA 5C5JA 2CQGA 2HMIB 3D6FB 4U95A 2QV6A 4RW8A 1Z1ZA 1C1BA 2KRBA 2HNZA 4JI3J 1RT7A 4OYIA 2HGNA 4Q0BB 2LDYA 3Q0AA 3H4BA 5CCLA 4OHZA 3PXGa 1VOMA 1JLBB 2XO6A 1KLMB 5G0RA 2CQHA 1T03A 3DRPA 3OV7A 4ZVOB 4DV6J 1S1VA 2H3EB 2NUUG 1XNRF 2ILZA 4ELTA 1JLCB 1KHWA 2ABYA 3NNAA 4V1Ak 5CZVA 3OLBA 4FPRA 5DETA 4L73A 1XBWA 4TLQA 4ZHRB 2HS0A 4OJ1A 3BN7A 4USHA 1FD2A 1NSAA 2CQ0A 2G4BA 1N5QA 5D0GA 4F2SA 2GVDA 4K5SA 2VQFF 4P2SA 5EWEA 2HZAA 4F3QA 4OYAA 1WTBA 1YQHA 3FZ2A 2Y0SD 4FP9A 1ZA1B 1NNDA 4P2FA 2R2TA 4KV8B 2IYGA 2CG4A 2RS2A 5KT3A 2GMJA 4MAKA 1R89A 3CIZA 2FC8A 1VQ5S 2V0NA 3GYNA 3T5LA 1S6OA 1A9NB 4R8UA 3ILJA 3TZXA 4I64A 4OJHA 4OZLA 1SUQA 1URRA 1T02A 1FKOB 1HI8A 4KT0C 4ZVRB 3TYTA 4A8WA 3VGTA 4RNHA 2IVMA 1G7CB 4A8QA 2QMUB 4PG6A 4A8XA 1HBMA 4L75A 4ID8A 1RTDA 4O4RA 1HI1A 2J9DE 4QIGA 1FX4A 5DG7A 3BGRA 4LSNB 4YDDB 2YWGA 2N82B 1X5SA 4BWMA 5IM0A 1D9AA 3J81Y 1WTFA 3IS9A 2JFKA 3Q86A 3CO9A 3I5CA 3MM6A 2CQ3A 2JRSA 2CADA 2F9JA 4AL6A 3CIMA 2MZQA 4EO6A 1FXRA 3P96A 1LFPA 2CNKB 1FJGJ 2BE7D 1FEHA 1ZBTA 3VTIA 2XMAA 1T05B 2AMCB 4MKAA 3I0SB 2R8JA 2GJIA 3KLFB 4DL7A 2FHJA 2ZVIA 3WDOA 1Q16B 4OHVA 3P3DA 1BWVA 2F1FA 2HS3A 2MKYA 1S6PB 3AXKA 1A0OB 2GC8A 2OMLA 1GMUA 4X4SA 3THPA 2IMOA 2ZITA 1IKXA 4LRFA 1PBAA 3TQ1A 3U1NA 3KUHA 3PYFA 1U26A 1TR0A 5AE2A 1I94F 3GWCA 2VASA 1FFGB 3DYAA 2FZGB 3KOAA 4O0NA 4J7CA 1HQEA 3NOGA 2OI2A 4PR6A 4NCAA 3I4PA 3O5TB 1K8AT 3NEKA 3C3LA 1JMTA 3C16B 1JK9B 5KG6A 3RU0A 2J6SA 4XAKA 1NPPA 2R8GA 3T9NA 5DQGA 4NLUA 1ULRA 5D4PA 2R7WA 4TVAB 4PG8A 5BJRA 3RGIA 2BV3A 1U2RA 2NXCA 2Z2ZA 1RA6A 3W8PA 4O3RA 1QSLA 3M2RA 3SCJE 3A3PB 2QA2A 4LF8F 4ZLLA 1FDNA 4NMXA 2VICA 3I6PA 5F0WA 2FZCB 2HHTA 4OYZA 2AKWB 1UVKA 4OHWA 4ECTA 1WOSA 1X4HA 4O3PA 4EMDA 4N7TA 5KG1A 1WHXA 2QMWA 4USWA 4DCJB 2E1MC 2PIIA 3DGPA 2KZMA 1PAUB 5LJ3Y 3SMZA 2P9GA 4USUA 5KFVA 3J7AN 4NRTA 1HWKA 3Q8VA 1TK0A 5F8NA 2B6AA 4IR9A 2DTJA 5J2MB 4WXWA 2KJWA 1JNRB 3JSBA 2W9CA 4H4KC 1S48A 5IOLA 2O1PA 1IKWB 4NEZA 4YHHF 1U1QA 4G3IA 4ZCMA 4FXWA 5CYJA 4YB1P 4F67A 2ZH5A 1Y10A 4EWTA 2OPRB 5GAHI 1LFWA 4CCHA 4FYVB 4I69A 4H4OA 2ZZMA 4WFBQ 2VPWB 2R9LA 1L3KA 4C3KA 1Q5YA 4YP3A 4R0EA 1GX6A 4EK2A 4FF3A 3R97A 2V8VA 5IWAJ 1TKZA 5KFGA 4OZ0A 4RJVA 4YN3B 2V4QA 5FLXY 1T95A 3CMES 4ZMMA 2DD8S 3SEOA 3ZO7A 4F4KA 5IV4A 4JV0A 4OHYA 3KLHB 1N5TA 3B78A 2V5HG 3T41A 1WC0A 4CO2A 4JBCA 3TJAA 3M05A 4KQZA 1BQXA 3JYTA 2HW3A 4PWDA 3UCZP 2UZAA 1HQ2A 2IMWP 3TVZA 4NMLA 3LPEA 4DLEA 2DGWA 2R3VA 3I96A 1C0TB 3V5RA 3MECA 3MFIA 5E7OB 3CCMS 2OAUA 3OXLA 2KT5A 3DOLB 3W7BA 3DGVA 4WJBA 2DR9A 2EFPA 4FYWB 1FKAF 1HNVB 3BO4A 4Q2LA 2IIHA 3R7SB 1SJRA 3HDSA 3MTKA 2Q1LA 4AXIA 4PQUA 4XPEA 1MW7A 2ZEJA 3T1HJ 2A6OA 2JVRA 4JI5J 2OPPA 3M2VA 4NASA 4PXCA 2G13A 1N88A 2QYGA 4U8YA 2HRYA 3BPSP 3LP2A 1KDNA 1PJ5A 4Q43A 4MIBA 3V6JA 3PY8A 1P6TA 3EVMA 2Z4PA 2DR6A 2UUBJ 1IJFB 4DS5A 2FJEB 2WVBA 1M5HA 2XS7A 2MPUA 4CLKA 3VAIA 1RYSA 4Q7AA 3MEKA 2WK4A 2WSCC 2FLPA 1K44A 4MK8A 4EEYA 2FIUA 1M0SA 3BZQA 4WP8A 1T8EA 4C8LA 1WC5A 2PO4A 1K47A 1UVMA 3UN3A 1D9FA 3ZZYA 3TVKA 5HMXA 4K4SA 1H73A 3DRRA 1C2PA 3K8VA 3IO1A 3DRYA 4URSA 3CCTA 4X4QA 2Z57B 1RTJB 4F02A 3E8OA 4ZVHA 1UFWA 3OL7A 1TL5A 3M1VB 4DJBA 3CD6S 3M8YA 1XR7A 4KSEB 5D0HA 4LFCF 1SKRA 1TK8A 3T5JA 5GAGU 3RRKA 3OXFA 3C6TA 3LALA 3DLHA 3G82B 3PW2A 4K5RA 5KOXA 3US5A 4DQSA 3NWGA 2FPHX 3DDIA 1CJUA 2UVRA 4RW4B 4HI1A 1M90T 5E33A 2XLJA 1EARA 2EKYA 1FFWB 1U8WA 4TY8A 3KDNA 1YVFA 3BO2A 2P2CB 4CH1A 1DTQB 5HL7Q 4OYXA 3CCVS 2ROGA 1BQMA 2H4WB 1O0PA 4DV2J 4I4BA 4AE5A 2R7RA 2QE5A 1GMWA 1M1GA 2F65A 3SCIE 1U47A 4KJIA 2DNLA 2OO4A 3CULA 3CCLS 2HVDA 3NS5A 4DQPA 2MQOA 3HHKA 4DR2J 1S97A 2C3PA 1U1OA 1TAQA 4IOBA 2D3OR 4WFZA 2QA4S 3CO0P 3Q2TC 4DSLA 3BBFA 4C48A 5ETQA 4URGA 2V34A 4IG3B 5F3TA 4LMZA 2VUGA 5D8HB 4K2JA 4AFFA 3KK3B 4O3SA 2BJEA 1U1MA 3EGZA 3L9ZA 1YDLA 3OTOJ 1VQMS 3ENAA 3BKFA 1N5SA 2BABA 4LRDA 3JXOA 2E5HA 2OSRA 4LF5F 4FF1A 4CT9A 2HK2A 2B9XA 1L3TA 2CDRB 3THTA 3ISND 3IC1A 2WONB 3ZZ0A 2X1AA 1IQZA 1AZSA 5F8JA 3GIMA 1O51A 3OQ2A 3CVKA 3IA0A 3CB4A 2VA3A 1UZHA 3W2VA 3NNCA 3L09A 4ID5A 1DQ9A 1H6KX 2ZE2A 2NXEA 2I2YA 2IRXA 4LIWA 3C46A 3MM8B 3MPWA 3MEDB 1CEZA 1RDRA 2G2YA 2NZCA 3CD7A 1IBKF 1KOHA 4O23A 1WNEA 3S1TA 2QLWA 3C6UB 3PCOB 1RTZA 2WBMA 1RWOB 1QDUB 4PUOB 3SQOP 2J0WA 1BQNB 4DV0J 2ZH9A 2RRBA 4UW2A 1SPBP 3M32A 4R5PA 2NREA 2FJXA 3GPAA 3CEDA 2XO7A 2E5LJ 2BXJA 3U02A 1IJEB 5DZ7A 2WAQD 4KKOA 3CJ5A 2YH0A 2KYXA 3HSDA 4FXVA 2AJ0A 2B56A 4IH5A 1T7PA 4AYBD 2A3JA 1RHUB 4ZP6A 3OTEA 3TUIC 5EWGA 5DZ6A 1BGXT 2YWKA 4HEA9 5CCMA 4OX7A 4XO0A 4FYDA 4P7TA 2CJXB 2XI3A 3PKMA 4DV3F 2NQPA 2W4DA 4MKVA 4N76A 2ZM6J 1QD1A 4HTIA 4K8RA 5FJ4A 2MJUA 4KGZB 1CLFA 3TZZA 2ZUAA 2I1RA 1HBOA 4Q8EA 3O1LA 4WF9Q 2AV5A 3MUVP 4FBTA 1F1BB 4LF6F 2HHSA 2GHWA 2GX8A 3TAQA 1HYSB 1NDLA 3MURP 1DTTB 4U96A 4NLOA 4P72A 3K58A 1RT1A 4JI2F 3KLGB 5JVHQ 2UUAF 4XTTA 2RRNA 1RLCL 3DKDA 3G2XA 2XGQA 2RSQA 4F2RA 2DGQA 3VVUA 1S7IA 1EJ7L 5LOQA 5GADI 3MMCA 4DR3F 2VPZB 3M8QB 1CS4B 2CPIA 1NK0A 2BKPA 3FSYA 1S6PA 2EK6A 2IM0A 2DHHA 3W5XA 1OS5A 3MM5A 3DRSB 2P8IA 2HVHA 2RDJA 2CVEA 4CLTA 5IQ6A 2JEIA 2YKQA 4LSLA 5I42B 3SZ2A 2W2NP 2BE9B 3UDVA 1G2EA 3G8TA 1NSKL 5KT5A 4TKTA 4Q8FA 1FRXA 4GMKA 4G1QA 2W1BA 2WSEC 4ZKAA 4P2XA 1VQ4S 3MHYA 2F4VJ 2CPYA 3PACA 4M1KA 2MLYA 1VQPS 4OQJA 2HZVA 2VOOA 3IBFB 3U7JA 3D2WA 4JB8B 1HFEL 1RA7A 1S1WA 2KN4A 2ZH7A 4MFBB 3R3TA 4IFVA 4O3NA 2EW9A 1N33F 4RUCA 1HBNA 1D8YA 3KHHA 3RJMB 4JUZA 1FI4A 1U1KA 1H7XA 2IYIA 1YIJS 1FX2A 1SXLA 3SDEA 4C3MA 1P1TA 1XWLA 2PT0A 3OFHA 1IWAA 1H38A 3M9OB 2E5JA 3R7BB 1WKKA 4CRJA 3TA2A 2ZKTA 4MK9A 2XWXA 4F4AA 1WKLA 3JSMA 5CAAA 4IRDA 2IJRA 2LQJA 5JJBA 3G8SA 3BB5A 1D0EA 5IT4A 3NS7B 4H4MB 3H2LA 1QSYA 4PG7A 4QIEA 2C3UA 5KFSA 2FHMA 3SSQA 3R5DA 1P1LA 3HVRA 2UU9J 2RRAA 4B9UA 4PXDA 1IUJA 2E1CA 2HK3A 2Z2YB 2UXBJ 4UY85 2D41A 4A47A 5DDRC 1FDDA 1UJ5A 3BQ0A 2XS2A 2OPRA 2SXLA 3SCLE 5F0UA 1DURA 2KFZA 3V2UC 2FVRA 3N6NA 4KE5A 1FVSA 1FKPB 5KFQA 3QGHA 2YQ3A 2XYPB 1VC5A 4LREA 2FJAB 2QG9B 1MROB 3Q83A 4H54A 1H3DA 2I8EA 4CIOA 1NK9A 5HLFB 3FEZA 4RNFA 2C3MA 1B3TA 3OL8A 2B9WA 2WB1D 3FFIB 4NLRA 4USJC 1JNZB 2LA4A 2RDDA 3EGVA 5THWA 1HMVB 3HO1A 4CM2A 1SH2A 1F2GA 3EMTA 2MQNA 2JSXA 3H7HB 4CLUA 2EFVA 3N5BA 3H25A 2XSJA 1C0TA 4DFKA 3I0RA 2RAQA 5E0OA 2VG6A 2UUCF 1TAUA 3DXBA 1V3ZA 4ES2A 1JXEA 2XBPA 2HVEA 1AFJA 2HIQA 1TL7A 1HD0A 1XMOF 4LQ9A 2X1GA 5AJ3J 2NCKL 3MMAB 4ZVTB 2RUSA 1JIHA 3HZEA 2ZJQQ 3PKYA 1U25A 3PHEA 1XR6A 3SFUA 4DPYA 2BUNA 2CNNB 1UKUA 1R8HA 1RJJA 4N8OA 3TOQA 2BKOA 3PZPA 1MMNA 2GHPA 1OY8A 2YNIB 3KLIB 1RI7A 2QEXS 3ZTOA 3TAMA 3LP0A 3LO3A 2L41A 1UP1A 2V4JA 5K20B 3AA8A 3O44A 3NMRA 1B70B 1RT6B 2Y1IA 4E0DA 1LWCA 2C2RA 4AL7A 3LTOA 3OSNA 8RUCA 4J9LA 1B0PA 1RXOB 4DL2A 2HQGA 2DRDA 4CM0A 3M1VA 2O5DA 1CULB 4KO0B 3AQOA 3IWNC 2DY9A 3DM2B 2O01C 3F41A 3IMQJ 3TARA 3BGLA 1CC8A 2ZBCA 3G82A 3FZBA 3FVYA 4OI0A 1RQ0A 1S9GA 5T14A 2ALZA 3PRDA 3H59A 2BKNA 2F40A 2B4VA 4KPCA 5KOWA 1HQUB 4Z37A 3ENWA 2DY1A
chains in the Genus database with same CATH topology
1FVQA 1KQGB 3FMWA 2H9ZA 2HWIA 4PPZA 4B3SF 4JYAF 1HHTP 3NGKA 3CDBA 2NR0A 4Q44A 2RIJA 3S6EA 2E1AA 1FJCA 2ZD1A 2U1AA 1WEXA 4DF4A 4GC7A 2POKA 4IOCQ 2E7XA 1NO8A 4HH0A 1DTQA 3GV8B 1D9DA 2HVIA 4DDFA 4DV2F 2IA6A 2DNOA 1F5CA 5F8LA 4FVMA 1TL1B 3DLLQ 2MYFA 3C66A 3GIIA 1VRTA 1DARA 3POTA 3F44A 4P7VA 1FKOA 1ZM4A 1VIOA 2RD5C 2PMZD 4F26A 4OL8A 1H7WA 2RB7A 3CXCR 2BQ3A 5FDLB 2P5VA 4DUZF 1NJWA 1GXLA 5FD1A 3VR1A 5DLFA 4YMEA 4F3OA 1S1WB 3DI6A 1UJ4A 1Q8LA 2R8HA 1QSSA 2J6TA 2R7VA 1NJXA 2YKAA 5KG0A 2IM3A 2LEAA 3N79A 4IFVB 1MMDA 4F4XA 1VFJA 4ZP8A 4DL6A 1HNWF 5CA5A 2FC9A 1HBNB 3MM9B 2JLEA 3FSXA 2OIHA 3V4IA 2RQMA 3DHWC 1JLAB 4DR2F 4CTAB 4QYZJ 3U1MA 1R27B 2IJFA 1NH8A 1JKHA 2KXFA 2VBZA 2MHNA 2VFVA 4IYQA 5CYQA 4QR1A 4B9VA 4YOEA 4CH7A 4CT8A 4IKAA 3BGFA 2WCXA 1JXLA 3SDEB 1JLFA 5J2PA 4IH6A 3HZGA 3PFOA 2DIVA 4B17A 4CO1A 1X5TA 3Q22A 3LAKA 4Y65A 3UR0A 4LSNA 1M5SA 1R8PA 1NAQA 1WWHA 2MGZB 5FIIA 2U2FA 2ZH2A 1X4CA 4QWAA 2A2CA 3RR7A 2BANB 3RTVA 1KC8T 3ITHB 1OO0B 3QJLA 3KNGA 4DLGA 3HLUA 5EX3A 1S6QB 3ISZA 1EP4A 1FJEB 4JOUA 2FVCA 5CYMA 2F9DA 2WHOA 1MNEA 3AA9A 3O2IA 3N01A 4RBTA 5F8IA 2DT9A 1JLEB 3BO3A 3K59A 1VHFA 3MOZA 3DNCA 4X4UA 3KK3A 3NGDA 1VQYA 1Y5NB 2JVOA 3JSMB 2XNRA 1FNMA 2KI2A 2DK2A 4QIVA 1Y3KA 4ZPWR 5IT0A 3OTOF 1JX4A 3CDAA 1KQKA 3U1LA 1K1SA 1DAXA 5MLCV 1MMLA 1GNKA 4I6WA 1TFYA 1E6VA 1KQSR 4CO0A 2LCWA 4C4WA 3UI3A 2W9AA 1VIXA 4HYKA 1Q86T 2DGTA 1SV5B 2XS5A 4OZ1A 3VAKA 2MKSA 4ALZA 3IRWP 3IG1A 4KBIA 4ZPCA 2LMIA 3ZZRA 5J1EA 3BDEA 3KG1A 2KG0A 1T05A 1JLGB 3KK1A 1KSPA 4RU9A 1NEEA 4NZ6A 4JI4F 1RTIA 2NUHA 3I0SA 3VAJA 3H2VE 1NH7A 2J0XA 5J1PA 4NLSA 4ECWA 1QAJA 3UQSA 1CPZA 1REVA 1M5OC 3KLFA 2VC1A 5JXSA 4AQYF 4C8NA 3OL9A 2RU3A 3P6YC 2WONA 4OV1A 1CQMA 3RRGA 3QWPA 2HWHA 2YNHA 3IWXA 4DOZA 1URNA 4JI1F 5E3AA 1N32F 5DS7A 4AUKA 5DDPC 1YJRA 2PA8D 2CQDA 3UR3C 2X51A 1QE1A 2VH7A 3FGVA 5KFUA 1BWEA 3RW6A 2E5IA