1YJ9S

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yj9S00
5LXRA 2DGUA 5CYJA 2DITA 4YOEA 1VBXA 2AYGA 1O0PA 2DGOA 1WG4A 2M7SA 2CPFA 2LXIA 1KQSR 1OIAA 1YWXA 2YH1A 4LMZA 3CPWR 2KFYA 3CCRS 2LEAA 1WELA 5D77A 1WEZA 3BO2A 2EK6A 5IM0B 1HD1A 3G6ES 1JJ2R 1WEYA 5DDPC 2DNKA 2NLWA 2MQLA 3CULA 1VQ9S 1JJ4A 2LXUA 4C0OC 5IFMA 5ITHA 2ERRA 3MI7X 2D9PA 2MQPA 3K0JA 2MQOA 2GHPA 3I56S 1X4BA 2KM8B 1VQ4S 2K8GA 2ADBA 3MUVP 2FPHX 4C7QA 1DRZA 2YKAA 1DZ5A 2LYVA 4PRFA 2N7CA 1M5KC 3EGNA 2QFJA 3S01A 1QM9A 3B4MA 1A9NB 4YB1P 1A7GE 2J76E 2FHOB 2RNEA 4IOAQ 1W2BR 2RS8A 2MZJA 2DK2A 1WTBA 2KRBA 2MKIA 3L3CA 2DGTA 1X4DA 4A8XA 2CQDA 4IUFA 1H2UX 2XNQA 2GO9A 2XNRA 2MY7A 1D8ZA 1R8PA 5GADU 2VOOA 3CC4S 4M5DB 4UY8T 4F25A 2MY8A 2JVRA 1U2FA 1K73T 1HA1A 2DGXA 3CCUS 4ED5A 3ZZYA 2UP1A 2G1DA 3BO3A 1VC5A 2BOPA 1VQ6S 1WG5A 3U1MA 3CMAS 1Q81T 1OPIA 1WHYA 1X5SA 3CC7S 2MKKA 1FJCA 2DGWA 2CQIA 3CCMS 3EGZA 3VF0B 2F3JA 3UCZP 5D78A 4WFNQ 1WWHA 2DH8A 2OIHA 4UQTA 2DGSA 1FJ7A 3G8TA 2ZJQQ 1Q82T 2MHNA 1D9AA 3ZZZA 5HL7Q 1YHQS 5CXTA 1M5OC 2NZ4A 3JB9k 4IOCQ 1OWXA 4FXVA 2BZ2A 3N9UC 2CQ1A 5GAGU 3G71S 1N88A 2CPDA 3VAFA 2D3OR 2KRRA 2MGZA 1K9MT 2CPYA 2MB0B 2I38A 2ADCA 3UE2A 2MKHA 1URNA 1F9FA 3VAIA 2KT5A 2L41A 3THTA 1NJIT 1M1KT 2N82B 2MZ1A 1QVFR 2MQMA 2X1FA 1YJWS 3LPYA 3J7YU 1VQ7S 2DNHA 2VOPA 3IWNC 1PO6A 2XSFA 2DHAA 5DDRC 2X1GA 3CCSS 5IQQA 4J5OA 2LQ5A 1JMTA 2WBRA 3B4DA 2DIUA 2OTLS 4PKDB 4F26A 1VQNS 3TYTA 2MSSA 1IQTA 3I55S 2KI2A 4OZ1A 3NNAA 3VAKA 4W92B 2KH9A 3UD4P 2LMIA 2PE8A 2PEHA 1UAWA 2KXFA 2KXHA 1DHMA 4TU9A 2MKSA 2M8DB 3MD1A 5HO4A 1VBYA 2DNOA 3NMRA 2KG0A 2E5JA 1FO1A 3LQVA 1WF1A 2DGQA 1XN9A 1X4GA 4BS2A 4WIIA 3MUMP 2CQ4A 3BEGB 2CPHA 2X1BA 2KVIA 2DNRA 2M2BA 2MQNA 2E5HA 2KM8C 3CCLS 4CH1A 5JVHQ 2K3KA 1X4EA 1VQ8S 2FC8A 3P5TL 2EK1A 3HHNB 1SJ4P 5EN1A 1X4AA 1VQOS 2M52A 2MKCA 4CH0S 1S72S 2JVOA 1U1QA 3R1LA 4C4WA 2MGZB 1U1MA 2JRSA 2MZQA 3UCGA 5GMKa 4QU6A 2LECA 1WHWA 1ZZNA 3NS5A 3CTRA 3J7ZT 2KG1A 2XB2D 2Q79A 2DHSA 2RVJA 1VC0A 4P6QA 1B7FA 5LSLA 2D9OA 2DNMA 1KOHA 2HGNA 1WHXA 2DNYA 3G96A 2HGLA 3MURP 4FXWA 1FHTA 2AYMA 2CQ3A 3VAJA 3H2UB 2MZTA 2MJUA 1UFWA 1SXLA 1VQKS 4OZ0A 2M9KA 5DETA 1VBZA 2KU7A 1WF0A 1M90T 4Z2XA 2J8AA 2YTCA 4W90B 3HI9A 1S79A 3VAMA 3P49B 1KC8T 3S7RA 1FT8A 2RU3A 2KN4A 2MYFA 3SDEA 1HL6A 1YTYA 2HYIB 3IRWP 4F02A 1H6KX 1VQ5S 1VQPS 1U6BA 1WG1A 3THPA 2ZJPQ 1PGZA 4WKRA 2DNPA 1YJNS 2CQ2A 2G0CA 3BO4A 5GAEU 2DNQA 3CUNA 5H1SV 1JJHA 2O3DA 2LA6A 3P3DA 2E5GA 2U1AA 1VC6A 5GAHU 3CC2S 2YH0A 1YI2S 1WI8A 2KYXA 3CCJS 1ZH5A 2DHXA 1FJEB 4Y00A 2MZRA 3Q2SC 2LEBA 3R1HA 4IO9Q 4LIRA 1RK8A 1U1OA 3UCUP 1VQMS 2J0SD 2MXYA 3MXHP 2V94A 5LJ3Y 2CPIA 1WHVA 1M5PC 1N54B 1HD0A 1X5OA 2MSTA 4Y0FA 3NNHA 2CPXA 1OO0B 3PIOQ 2MZSA 4CQ1A 2MMYA 1SJRA 2I2YA 3CMES 2U2FA 1UP1A 2M0GB 1Q7YT 3TO8A 1N8RT 2VODA 3ULHA 2B0GA 2M88A 2QA4S 1SJFA 2CJKA 4V19X 2MPUA 2CQ0A 4ERDA 3VALA 3RW7A 1K8AT 1X4CA 5LJ5Y 2OTJS 3OW2R 2E44A 2JX2A 5FJ4A 2J0QD 3CCES 2X1AA 1VQLS 2DNLA 3SDEB 4WFBQ 1SJ3P 2F9DA 1X0FA 2CQCA 2ZJRQ 1U1PA 2KHCA 1P1TA 3S6EA 2M8HA 4YUDA 1X5TA 5GVQA 4WCEQ 2RRAA 4PR6A 3H2VE 2OJ3A 3FEXB 2DH9A 1H2TZ 2YWKA 1R8HA 3PIPQ 4TU8A 2MQQA 3VAGA 2RS2A 1N52B 4TU7A 2HZCA 2RQ4A 3EX7B 1H2VZ 2MKJA 4WFAQ 1RKJA 5DM7Q 1G2EA 3DLLQ 2FY1A 3D2WA 3CD6S 5DDOC 1L3KA 3NS6A 1AUDA 1ZZFA 3VAHA 4RU2A 1BY9A 2M4MA 2G4BA 3Q2TC 3NNCA 2KXNB 4EGLA 3MUTP 3SMZA 2FC9A 1NU4A 1QVGR 1YJ9S 2DISA 1KOOA 1M5VC 2F9JA 4QU7A 2OSQA 3S8SA 5DDQC 2CQBA 4QQBA 3SXLA 2CPEA 3V4MA 1X4FA 2CQHA 5BJRA 2DNZA 4TLQA 1UW4A 2M70A 2DB1A 3G8SA 2XS2A 3TP2A 2RRBA 3P6YC 3MD3A 4LJMA 1CVJA 5LXYA 5IM0A 3FEYB 3CCQS 2E5IA 2HVZA 2LCWA 1YITS 2RUGA 3CF5Q 4WF9Q 3CCVS 2AYEA 2DO4A 1Q86T 2CQPA 2HGMA 1YIJS 3R27A 2DNGA 3UWTA 2JWNA 2MJNA 4ZKAA 3US5A 3CXCR 1FXLA 2DGVA 1WF2A 5DM6Q 2XS7A 2SXLA 1WI6A 3U1LA 3G4SS 1SJQA 2L08A 1U1LA 2EVZA 5MLCV 5CA5A 4QPTA 2DNNA 1FNXH 2CQGA 1KD1T 3G9CA 1U1NA 3UD3P 2CPJA 2LKZA 3RW6A 3BS9A 1U6FA 1U1KA 5LSOA 1X4HA 4CIOA 2QEXS 2DO0A 1WEXA 2DH7A 2VONA 2AYBA 2OSRA 2N3OA 2RT3A 2A3JA 2DHGA 2XS5A 3MOJB 2AD9A 1NO8A 2RQCA 2N3LA 5JVGQ 1DBDA 2DIVA 1U1RA 2L9WA 1P27B 1X5PA 3DXBA 2CPZA 4U67Q 2LA4A 3MDFA
chains in the Genus database with same CATH superfamily
3IM9A 3W7BA 1PILA 1O0PA 2DGOA 1QTMA 4C97A 1YZ6A 3CPWR 3NG8A 3FFIA 3EGVA 2ZBPA 3OV7A 4R5PB 2GGPB 2DNKA 1U47A 2HVIA 1SQGA 2IFXA 3BPSP 3NMAA 4F0HA 1NRKA 5AXLA 5ETSA 1UA0A 3C19A 3BQ0A 2D41A 4QBUA 2IY5B 3SCLE 3C14A 4IOAQ 5BR8J 2HHHF 4YN3B 1T3OA 2HLTA 1H2UX 1K0TA 2HHXA 3QT8A 3CMAS 1RT4B 4E98A 4KKOB 2VFVA 1FJ7A 4UQTA 3AD8C 1M5OC 4C8LA 4ICLB 5BYRA 3MZIA 1NB2A 4X4PA 3GV5B 5C25B 2I38A 2NPFA 2B7BB 1VJQA 2HLUA 1RTJB 3UN5A 3JSMA 3AD9C 4UUWA 2VC1A 2MQMA 5HMXA 3A13A 2C1EB 2D3ZA 2ZBQA 5L1JA 2W8KA 2C3UA 2J7UA 5M2RA 1HBMB 3B4DA 4OX8A 3A8EA 3D6TB 3TUIC 4WYWA 4YY3F 3BQ1A 1VQNS 1KONA 2ZH8A 4FPIA 4USMA 1UETA 2QMWA 3LP0B 5J2NA 1O8BA 1RAEB 1YBTA 1KP6A 3DYAB 3PACA 5HO4A 1DTQB 3IAS9 1S1WA 2PC6A 4RKUC 4S0MA 3MMAB 2BKOA 2ZBCA 5B0EA 1PC4A 3FKBA 4R8UB 2XCAA 1X4AA 3FZ2A 1RTIB 4KB7A 3R1LA 2MGZB 1R8CA 3DLEA 4LFBF 5DRKA 2W8LA 2J6SA 3WX8A 1RT3A 1WSVA 2YPZA 1UCNA 1RI7A 3HVTA 4H4OB 4LF5F 1Q78A 4UOFA 1VBZA 4PXCA 1FDDA 4LF6J 3QJJA 3KFWX 3TX8A 4O0IA 3ISZA 3BKTA 5ETPA 4DPXA 3MOZA 1HARA 2DRAA 3ZZPA 1RT5B 5IZHA 4DV0F 1HPZB 3WZ0A 4LR9A 3P3DA 5EHHA 4B3TF 5CH7B 5GAHU 3ZFVA 3HVWA 2ZWPA 3ETMA 4ZLLA 3HP6A 3B54A 2Y9HA 1NDKA 3LAMA 2MZRA 1NK9A 2E1AA 4X62J 2A10A 1YK9A 2V94A 4DSJA 5KT6A 3L95X 3K8WA 4KYZA 4DF4A 4A8SA 3AJDA 2VFRA 2I2YA 4F2SA 4ZN3A 1CJUB 2YBVA 4MAKA 3GV8B 1TMMA 1JLQB 4DEZA 1LKZA 4MKVA 4NCGB 4Z37A 3OL8A 2GJ2A 1FKAF 1RHMB 1M1HA 4WCEQ 3RAXA 4O44B 3ITHB 3IBWA 4KHRA 1EKSA 3DLLQ 4DL5A 2RAQA 2FGCA 4TQSA 4JYAF 2M4MA 2KXNB 1KTVA 3D54A 5A6PA 2KDOA 4CO2A 1YJVA 2P9EA 2VICA 4OL8A 4H4MB 1JNZB 3IN5A 3AOAA 1WC4A 1FNMA 2YKNB 5GMDA 1TKZA 1FJGJ 1LFWA 2RE1A 3LP1A 3PDNA 4PUOA 3DXSX 5F8MA 2AJQA 1CULB 2AYEA 3QATA 1RISA 3G8QA 5HI7A 1JJCB 2BW2A 1FXLA 1WF2A 5KFHA 2HIQA 4B3RJ 1XMOJ 1VQYA 5CA5A 5AXMA 4FF4A 1RT2B 3D66A 5LSOA 2VPYB 3R7SB 2ZH5A 1E6VB 4L73A 2NXNA 2P9GA 4DR1J 2A3JA 4LF8J 5G0RB 2DITA 4IR9A 3OR1A 2DY1A 4DZDA 1C4AA 4DFPA 1WEZA 3N79A 3ZTQA 5BXIA 4ZN1A 4J91A 4UQGA 3DGPA 1RT7A 2FPHX 4NX9A 5KFUA 4QIGA 3W63A 1L3UA 5A6WA 4JI6J 3HHEA 2DR8A 2H5IB 4YB1P 4PQUB 4LRFA 2VQEJ 2KVQE 1F1BB 3KNGA 1RA7A 2GO9A 2V4RA 1MSWD 2GW8A 3HZEA 2K1RB 2ZDOA 1K73T 1T7PA 1T9VA 4N5SA 3BO3A 2HZVA 1W7WA 5I3QA 3CC7S 2MKKA 4RNHA 5D78A 4KTQA 2R3VA 2ZJQQ 1Q82T 2OP5A 1QJHA 4DV3F 2AMCB 3JB9k 5GAGU 2IM2A 4PG8A 4KJIA 2AZ1A 3NY0A 2CJAA 2D3O1 4NWBA 1NNDA 3J7Z5 2QRRA 2HHQA 1M1KT 3CDBA 4CLSA 5GMEA 1CG2A 2VKZG 4DZ6A 5LT5A 5F8GA 2B4PA 1JMTA 3OXFA 1WDTA 3TYTA 3PRVA 1C1CA 1D1UA 1F5AA 3RBZA 2V0NA 2XSJA 1JLAB 2KT2A 4NXNF 2L9NA 4EBDA 3VHQA 2UXDF 3L7PA 4NI2B 5KG7A 3KKFA 1TL7A 3L4BC 3R7BB 4WIIA 2CQ4A 5ETMA 1Q79A 3NL0A 2K3KA 4OYAA 2DJWA 1YBAA 1SUQA 2BKPA 4Y2IA 1EQ0A 2QTWA 4KGKA 2HVEA 3H5XA 1V6HA 5KFZA 3CTRA 5HK4A 4A8MP 4AE5A 1U49A 4NA3A 4F4AA 4NLWA 2UUBF 3H2UB 5HQ8A 2OLWA 4K0KF 5DG9A 3D6HB 1I3OB 2G2ZA 4OHXA 4FP9A 2E7WA 1JLEB 3AJ1A 3HCXA 4F3QA 4QR0A 3QJPA 4DR3J 4DG1B 3IR5B 1CJTA 3V6KA 4K4UA 1N34J 3HFVA 3KUEA 4U7UK 4C8YA 2BJEA 1NZAA 4K5RA 4UTGA 1S77D 2ASDA 1FF2A 3LUYA 4Y00A 4NASA 4AL6A 1TQLA 3UCUP 1Q7LB 2NXEA 3BGRA 1N0UA 1FFWB 4OX7A 1U2RA 2MZSA 1Q16B 4PWDA 2PI4A 4ES1A 3TO8A 5CYQA 3M8QA 2B0GA 4QIEA 3NWGA 2J0QD 3VGSA 4WJBA 3M2VA 3NGSA 1VQLS 3MEKA 5KG2A 1U1PA 1FRXA 2B56A 4OZ5A 5ETNA 1JNRB 2DH9A 1H2TZ 5K9FA 2VG6B 3PJXA 4F0MA 1HW9A 1IBMJ 2RS2A 1KFDA 4TU7A 2HZCA 4DSKA 3CJTA 4DUTA 4DV4F 2CJXB 2XLJA 2W2QP 3Q2TC 1UJ4A 3HHLB 1KLNA 1UVJA 3KLFA 1IBLJ 1WSRA 3S8SA 1HNWF 2CQBA 2CQHA 4FVMA 3DGVA 4AXIA 2XMVA 2DXFA 3MD3A 2WHOA 5IM0A 2XULA 2IBOA 1TKTA 1FXDA 2VQFJ 3CF5Q 2FZGB 3CJ4A 3WIVA 3LGNA 1KVKA 4ECYA 3A8KA 1Q86T 1KRPA 1XTZA 3UDCA 2DNGA 3V81B 2R8GA 2QO3A 3TRGA 3SSRA 2POKA 4ZVOB 3RBDA 2L08A 2XI3A 2OI2A 3PVXA 3GU0A 4CTAA 2J9DA 3DRSA 1ITPA 3H98A 4Q43A 3CJSA 2VONA 2O1PA 5IT0A 1RCXB 2P9CA 4LRCA 4PG6A 5IV4A 2PT0A 2G9OA 1QSLA 2M7SA 4N7TA 2W01A 3A3NB 5AE3A 4FF2A 2KFYA 4G1QB 3CO9A 5D77A 2XQCA 2J6UA 1YX2A 2OPQB 1NK8A 1NK5A 2LDYA 2MQOA 4JI0J 4CYUB 2XTJP 2I1RA 3B6BA 1PCAA 1M5KC 1M5HA 3D1QA 3R5CA 4TY8A 1H3DA 2YWHA 1S1UA 2J76E 3FEZA 3HKZD 4F04B 3K8VA 4A8XA 4HH1A 2CQDA 2N4DA 3UR3C 4UOGA 2W1BA 3W9HA 2ZUGA 4OYWA 4Y28C 4RPFA 3TW0A 5F8NA 2DHHA 3IRXA 1BWVA 1MROA 1WG5A 1A0OB 1LWFA 2HAFA 3QWPA 2K06A 3E3XA 4N76A 4MH8A 4PCQA 1U7LA 3U1NA 3TA2A 4DL3A 4ZCLA 4ZJLA 4IOCQ 2D69A 4C8ZA 5K14B 4MYTA 5HJYA 1L3TA 1XQIA 2H48B 5HVHA 3JTPA 2Z8QA 2CPYA 4NLQA 3MEDA 4GVBA 3TAPA 2AGQA 3J80Y 2MKHA 2EXUA 1URNA 3VAIA 3UN2A 4LSLB 2L41A 4TNOA 3QT5A 3MECA 1JXEA 4P2SA 1NJIT 5K20B 1MLAA 5SZTA 2BJ1A 4LRBA 3R97A 4UZCA 2ATCB 4LF9J 5CZVA 3GR1A 2EG2A 3GPAA 4RBUA 2KJVA 1NUEA 1Q95G 2B4OA 3W5YA 4NE9C 3CJ8A 4OZ1A 4L72B 5HROB 1FRKA 3PEJA 4JV5J 1DQ9A 4EO6A 2F8EX 1RAHB 1JX4A 4BS2A 1S1XA 2X1BA 1J27A 4QYZK 1EJ7L 2HHSA 3GE9A 2HNYB 4BWJA 3EGWB 4C4WA 3EM1A 5HVGA 2Q3PA 4X66F 1BC6A 1GFWB 2GAGC 1TK0A 4B3MJ 3Q8YA 2D9OA 1RAJA 3CJ2A 1ELOA 4LQ9A 2JEFA 2V8GA 3RB4A 1UA1A 2MZTA 1RYSA 2NQPA 3M1VB 3Q24A 4X64J 2V8VA 2WONB 3DHWC 1WF0A 2VJVA 1J5OB 5T14A 2E29A 1N32J 4W90B 2V9KA 5FLXU 1HMVA 4WP9A 1GTEA 1JIHA 1I94F 5C7PA 2UXBF 1PAEX 3R8YA 3HSZA 4TKTA 1AA1B 5KG5A 3PYDA 2P6SA 2CDRB 4ZCIA 4ECQA 1C0TB 5DLGA 3CCJS 3K5PA 2ASLA 3JQMA 2VF3A 5FDLB 1HNXF 2CG4A 4ZITA 5HQMA 4NLVA 2MSTA 5CHCB 5D4OA 1XK8A 4CWBA 1V3SA 4Y0FA 2QLXA 4DI6A 5B0BA 1MMLA 4X4VA 3FK4A 3MR3A 3CDWA 1J5EF 2VODA 1AFIA 4QR2A 1SJFA 1C0UA 2MPUA 1RBAA 3D28A 1NDLA 3NGRA 2NR0A 3CW2C 2BVZA 4I2QA 2VDIA 3GG1A 1S6QA 1CJVA 2ZD1B 1HYSA 1Q4RA 4EFAC 4IDKA 4FVCA 2HHWA 4LREA 4Q5VA 1T05A 5I3UA 5D0RA 2ZUAA 1PJ6A 3HHDA 2ZKTA 2FVPA 3NS6A 4KV8B 2B6AB 4QWBA 4DR4F 4LIWA 5B08A 2W2PP 1P9YA 3M8PB 4RUAA 5KFKA 4H54A 2Z2ZA 5BJRA 2M70A 3NS7B 1LWEB 2QLFB 3GMGA 4B9MA 3CD7A 4C9DA 1UVLA 3CT9A 4PXDA 1GMWA 1Q8BA 2MLZA 1B0PA 3G4SS 4OYMA 3J81Y 4GKKF 1SJQA 4JI3J 5D0GA 1HHTP 1EARA 1GXLA 3I5BA 4NLTA 1UZHA 3LW5C 4LBHA 1U1NA 3C46A 4OX6A 2OH2A 2LKZA 5EGYA 4WKYA 5G4DA 2XZDB 5GAHI 3B82A 4DU7A 5HBMB 4UY85 1RKIA 1LW0A 2Y0SD 5CYJA 2HQIA 1XMQF 2YKPA 2K3IA 4K4VA 3KLGA 1LWXA 4LMZA 3QBCA 4ZMMA 2LEAA 1N6QB 3MEEB 2W9BA 2A6MA 1XR7A 3R2DJ 3NAHA 2GJFA 2JFKA 3MPDA 3BGLA 2UUWA 1KFSA 1R3NA 3CCZA 3E2EA 3G82B 3NGDA 1DZ5A 1RWWB 3UI3A 1TL4A 5KOXA 3UNYA 4OZJA 4QWCA 3C6TA 2FHOB 2FVSA 8AT1B 2F4VF 4DSFA 4UOHA 4ZPWR 2BRLA 4QIFA 4DR7J 5ETLA 2Y8YA 1VRQC 5E3CA 2H5JB 3CCUS 3AJ2A 1VC5A 4NA1A 4URGA 5IWAF 1WHYA 2BJ9A 4NCAA 4C6AA 3T1HJ 4ANCA 4Y2KA 1VLOA 1HI0P 1S1TB 2R7TA 3SYZA 3DOKB 2V4JA 4FNIA 1AYEA 5IT9Y 1RJJA 4CRJA 1Y0HA 3RAQA 1EB0A 4OJGA 2FTRA 4LF4F 3M2RA 4UF4A 1KSPA 2V8PA 3CCWA 3GIMA 3PX6A 5I4MA 4I56A 3PJWA 4DHVA 2FDNA 2XGPA 2AX1A 2WBRA 1QSSA 2MSSA 2W4PA 2E5JA 2NXJA 2RU9A 1XN9A 1NZ8A 1MU2B 1YRUA 3M8RA 3C6UB 2E5LF 5CCMA 2E5HA 5A0YA 3WQPA 2IC3A 2HZAA 6AT1B 2ZH4A 2B4VA 1SIWB 4B9SA 4X4QA 5F3ZA 1U2CA 3GFXA 3HULA 4OLPA 1V3RA 3TEHB 2IHR1 2VU5A 4DFJA 2GVDB 3W64A 1WHXA 4B9LA 1RT6B 2B3TB 3TVZA 5DGBA 2ACMA 1HW8A 1RWVB 1VQKS 4NPOA 2ZH9A 4DUZJ 3KMSA 3U27A 1A6LA 4DPOA 5MAOA 4A8WA 2VV5A 1PYTA 3S7RA 2BJ8A 4HI1A 3OL7A 2YXLA 2HYIB 1VRUB 1K1SA 1WOSA 2GIQA 4OJHA 3BDEA 1JLCB 2JH3A 3TUJC 4MFBA 3GB0A 1FKPA 2W24A 3S1TA 3CO0P 4IH7A 5GAGI 3KHLA 4K5SA 1GT8A 1PYSB 3DRYA 4DQIA 2IJNA 2CPIA 2VG5A 1HD0A 1TUWA 5DS7A 1EP4A 3NBPA 4O3NA 2OFGX 1RZMA 4OZLA 4PWWA 3AOCA 1BQMA 1AROP 1K8AT 4KHPJ 2C2RA 1V9OA 2MTLA 3CCES 1X0FA 3Q8VA 1BUXA 2KHCA 1BXNA 2IRUA 3PIPQ 4DFKA 4X84A 2CKWA 1RHKB 3LP2A 3V6DA 2XYHB 1Y9OA 2QFIA 4P72A 2V50A 1S1VB 4QW9A 1UVNA 1W2IA 1S0NA 4HT5A 5HMWA 3M9OB 5F8LA 2ZHBA 1U0HA 2OUGA 2QMXA 4A8KA 3ZZUA 2QL9B 2A2CA 3QWUA 4YB7A 1FVSA 1X9WA 3K89A 3R27A 5D4PA 2FIUA 3IM8A 1SC3B 4ID5B 1UPPA 1SL1A 2AT1B 5MLCV 4HEA9 5KFDA 1FK9A 1XEZA 3HSGA 2FYXA 2OEJA 2YVSA 5L9NA 3I5AA 4QWEA 2F4FA 2KFNA 2VPZB 2AJ0A 2K2PA 4FYYB 5F41A 4I64A 2C2MB 1RT1B 5L38A 1XR5A 2MKYA 4O3SA 1EQMA 4QW8A 1RCOB 1RUSA 3MR5A 4X2BA 4LF6F 2RF2B 2VZ9A 1H38A 4NLPA 2QL7B 2XYGB 3UDVA 1NH8A 3ZC4A 2BM1A 2FHJA 1V3ZA 2ERRA 3W3SA 2GMJA 5F3TA 4TXSA 2QIFA 5CD4H 5U47A 1NSQA 4CLZA 4U8YA 3TQEA 3BSOA 1YRXA 2RS8A 1GAOA 3C15B 2IM1A 2BE2B 2XM3A 2DGTA 2M5YA 1T9TA 5FD1A 4JI1J 2XZWA 4X62F 4J9LA 1U2FA 1SL0A 4I6YA 3I0SA 3QLHB 3K59A 1VS3A 3M6WA 3U1MA 5EX0A 3EPGA 2HPUA 4Q8EA 2CQIA 4EWTA 2V9WA 2VFSA 3IG1B 4WFNQ 1SI9A 4CLYA 4OHVA 3ZZZA 5HL7Q 4U7UD 4DS5A 1L5UA 4OV1A 1BQNA 1NMEB 3DMJB 3KJVB 4I7FB 1CJKB 3KLIA 1FWPA 5J2MA 1WD6A 3LGHA 3I96A 3D6MB 1Q0NA 2DHAA 3IR7B 3GP9A 5F9NA 2COLA 4B3SJ 1AW0A 4GO5X 4OJ3A 2HG4A 3HX9A 1QAJA 2BANB 2OPSA 1HBUA 1N5SA 1TTHB 3WC0A 3NAIA 2LVWA 4N8NA 3VVUA 3PW5A 2DNOA 1RAAB 1FO1A 2V67A 1EETB 3D5MA 2EEYA 1L3SA 3D0GE 1IUJA 2EK1A 4NL5A 2DR5A 4TY9A 4FYVB 1XMOF 4DPUA 4O3OA 1HBOB 3SV4A 2LECA 2V5HG 4RNFA 3J7ZT 2XB2D 2WRMA 2DNMA 2QT7A 2ZM6J 4DL4A 1G4CA 3HFZB 1NSAA 3VAJA 4DR1F 1KHWA 3OXLA 4L3KA 5HAOA 4RL1A 4G1PA 5CABA 3LPEA 2OELA 3T3FA 2PGCA 3GJSB 3CJQA 3V6HA 6FD1A 3MCOA 5F0WA 2WB1D 4RW6A 4ANDA 2LA6A 2V6AA 4ECTA 4OHWA 1ZETA 2HK3A 2YH0A 4ZVQB 4Y3CA 5IQ6A 1XBWA 2QSWA 2O5DA 2XMMA 4N41A 5A8KB 3GIJA 4JI6F 3V4IB 4RW4A 4WPAA 3FRYA 3H5UA 1N54B 2D1CA 5J2QB 1X5OA 3DLKA 2FJBB 2WOMA 3DDKA 4JI4F 1TL3B 2Z56B 1Y00A 1N8RT 2CQ0A 3WBZA 2YNGB 1N4LA 3SDEB 4DQSA 4G65A 4YQWA 1JLBA 2YWKA 4X4OA 2Q6CA 4OZNA 3VAGA 3IAM9 1GQEA 3FJ2A 4IFVA 1G2EA 4LFCJ 4KPYA 3BYRA 3QZ8A 3N6LA 1KN6A 4EUVA 3OVAA 4K7QA 4CO1A 2XMUA 3EPIA 4IO1A 3BSAA 1TR0A 4R5PA 2B9EA 2HBYB 2VPWB 3H8YA 3Q8SB 3FEYB 5J2NB 2GGPA 1AFJA 1NEEA 3O5TB 4AD6A 1IKYB 3ILOA 3US5A 2WVFA 3TZYA 5LL6d 1WI6A 3U1LA 5L46A 4DBQA 3TZZA 2ROPA 4L6V3 1HBNA 2QC3A 4RNMA 1KD1T 3GTYX 3W8GA 3DLEB 2QZ8A 4FNHA 4EBEA 1PJ7A 3UVJB 3VQSA 1FDAA 1VR6A 3MM9A 5ETTA 2W2MP 1NO8A 4EZ9A 3LANA 4YR3A 2CPZA 3AA9A 3JTNA 4XAKA 4YOEA 3D3CJ 3UW1A 2UUCF 2Q6BA 1RT4A 3OR2B 2PSZA 2ZE2B 4C8MA 5DGAA 4M8LA 4ICLA 1D9DA 2AX0A 4JP8A 4USIA 2LXUA 2FY8A 2IVMA 4RW9B 4M1KA 3FBBA 4LQ3A 2KM8B 5C25A 1DRZA 1RTJA 2N7CA 1IQZA 3S01A 2RNEA 2ZZTA 3KK3B 4GC6A 2GAHC 4ZVUB 2HRTA 3RGIA 3SV3A 4FYDA 4KR0B 4UT4A 1HBMA 1NHKL 1UFLA 1EHWA 3QQCD 1ZAWA 2RMLA 4P7TA 4RLEA 1FKOB 2UVRA 2UP1A 3FSXA 5AJ3F 1H98A 1TAUA 3TAMB 1BQXA 1DTQA 2AJFE 1RWNB 1FJCA 2HRUA 3TJ8A 1RB0A 4WK1A 1T9WA 1H73A 1WWHA 4OYZA 4U7CA 4Y34A 3MMAA 3E01A 2XMTA 4R8UA 3SQGB 1VQSA 1RTIA 1N88A 4W4MA 3NP5A 2MGZA 5L1LA 3TUZC 3J80U 4GKJJ 4XK8C 5KOWA 1I51B 4ENOA 3N6NA 1PAUB 2E7XA 1IBMF 3DRPB 7FDRA 4CM0A 2VL1A 2DYAA 3IBFB 2DNHA 4H4OA 2VOPA 3NLCA 4PYDA 4FS2A 3K5LA 4JI7J 2ROGA 2DIUA 2Y1IA 2LDIA 1S7HA 3IS9B 3JSRA 4FZVA 2KT3A 4KT0C 3NNAA 1VK3A 4PUOB 1FRIA 2QLBB 2MKSA 3HLUA 4MMOA 3MMJA 3VR1A 1RT5A 1HPZA 4B9TA 1MMNA 4CH1A 1G6BA 1R0BG 3GYNA 2J5AA 1KVJA 1DJ0A 3ILJA 2BQ3A 3HHLC 3T9ZA 2XO7A 2GA7A 4K4TA 3O44A 4MYUA 3ET6B 5LSLA 1KOHA 4PABA 4J9UE 1KS2A 3ISNC 3NGKA 3W5ZA 5DETA 1CJUA 3DLGB 2YTCA 1FWLA 3CE8A 4DLGA 3P49B 2GZOA 2BQUA 4KQZA 4NCGA 4AQYF 4OZ3A 1YTYA 4USWA 5B7WA 2AF6A 1VQPS 1HQEB 1GXUA 2ZHOA 3OSNA 2JLEA 3DGPB 5GAEU 4O44A 3CUNA 1F9EB 1FRMA 3ITHA 3T5KA 2O3DA 3HFKA 4LF7J 1HHQA 1OJ4A 3VGVA 3RZAA 2AJ1A 4ZLJA 2LP4A 2E1RA 3ZZ0A 3JS9A 4MIAA 1OSDA 1NLKL 3MHYA 2OPRB 4YDDB 4OYPA 1REGX 2L9DA 3B8HA 4H4MA 4G1IA 3TJAA 2E1PA 2PMHA 4CQ1A 1RBLA 4LUBA 4BWMA 2UVUA 2QE5A 3FBEA 1CULA 2ASJA 2M88A 4CLPA 3BPDA 2C3YA 3R5AA 4ZK7M 3MWBA 5AXKA 2CQCA 5KFOA 2ZJRQ 2GC8A 2AEMA 4QR1A 4FYWB 1TL1B 2I9SA 3H2VE 1RT2A 4IOBA 3P5BP 4OHYA 4RWWA 4DV1J 4HT7A 4HDGA 1E6VA 2RQ4A 1VIOA 3IGNA 4YR2A 3POTA 5KG0A 4LSZB 1L3KA 3ZZRA 4A8YA 4NLXA 3HSDA 1BGXT 5G0RA 2JC1A 1RQ0A 2QLWA 3RB3A 2F9JA 1IR1A 3SXLA 3V4MA 4PEOA 4LF9F 2XS2A 1C1CB 3M2UB 5IXUA 2XSJB 1LXNA 2VPXB 4FKXA 1SPBP 4Z7YA 4JV5F 3J81U 2DGVA 3D67A 2R2UA 4FXDA 1S6OA 1RGVA 1S0OA 2MQ8A 3O1LA 2HHHJ 2EVZA 3TJ9A 1RWKB 2X3DA 4PQUA 2OPPB 4M5LA 2VG7B 1RTHB 3IC1A 3QMQA 1CS4B 3HF5A 2FLOA 5JVGQ 2K1RA 2L9WA 1ZA2B 5D0HA 4KY3A 4XO0A 3MFIA 4FBTA 2DGUA 7FD1A 1XJWB 2AYGA 2Y1LB 2ZNZA 2LXIA 3KXDA 5HP1B 4UW2A 4DN9A 4C3LA 4RR5A 3OFGA 4X64F 2B9WA 1S4FA 2FJDB 2Q66A 2W7AA 4KIAA 2ATLA 4PG7A 4JI8F 5IFMA 3IWXA 1CJTB 3Q8QB 5IC6B 2R2SA 1F0XA 2XY6A 3R5DA 2LQ9A 1U09A 3SBMA 2CAJA 2GV1A 3L7UA 3L3CA 1FRJA 4CLTA 1I6JA 3JTOA 1FFSB 2GNKA 2XNRA 3C3LA 1E6YB 4UY8T 5KG6A 1Y3KA 3CMQA 1HR0J 3DOMA 3T5LA 3ZZYA 2G1DA 4OX9F 1JLAA 3I4HX 3M8QB 3AD7C 1X5SA 4OI2A 2DGWA 3CCMS 1K47A 4NI2A 3G8TA 5FLXY 3IP0A 5IT9U 4LFBJ 3IWLA 3CSKA 2CQ1A 2CNNB 3G71S 1ZM2A 3PW4A 3TQ1A 8ATCB 2J8SA 5SUHA 2RDJA 2ZH2A 4ZPCA 3FVYA 3WX4A 3FCVA 1F9FA 2XC9A 1OYDA 3OTCA 2HMIB 1CC8A 2ZOMA 3KK2B 1PIEA 1D0EA 4DU8A 1URRA 3E8OA 4ZHRA 3TZXA 4ECUA 3OL9A 3I9ZA 5E2QA 4ECXA 1OYEA 2KL8A 4DJBA 2YQ0A 4ZP8A 1JLEA 1TKTB 5T7LB 3OT9A 3U02A 4J37A 3LQVA 3O8WA 4DR2F 2KVIA 2R7QA 4Q0BB 4A8OA 3P5TL 4ZIVA 2B7CB 2KB2A 2O66A 3DRSB 1U1QA 1CSJA 3FC9A 1U1MA 4IR1A 5KT2A 5GMKa 1X9SA 2XMWA 4JI3F 2GQQA 1WHWA 2P2CB 4N77A 1FD2A 2GCFA 2V2KA 1SBRA 4FXWA 1S0MA 1HIYA 2IYGA 4C8KA 3CB4A 4K8RA 3PFEA 2HHTA 3A3OB 3H7HB 2RRNA 4ZCMA 3JAMY 1M0SA 1WG1A 2W9CB 2IVFB 4WKRA 2DNPA 2JOQA 2XCPA 3CDEA 2VG6A 4JYAJ 1R7IA 4AUKA 1MW7A 1NAQA 2Z2YB 1YI2S 1WI8A 4ED0A 2YNIB 3EYZA 3QSYB 1FJEB 3HHLA 1F3FA 4LIRA 2Z30B 1M5PC 2Y0BB 1PG5B 1Q1KA 3PX4A 3TVYA 2HVHA 3GJTB 1MROB 1M5SA 2HQFA 4P2XA 4WE1B 5I42A 6FDRA 1X4CA 3V81A 1S49A 3CJ0A 2B5JB 1KQGB 2F8HA 3T1HF 5RUBA 3J7AN 1ZM3A 1P1TA 4DR6F 4ZP6A 2MDAA 5A8WB 1UJ5A 1ZPVA 2YWGA 3SCIE 2W4CA 3IR6B 5KG1A 4X4RA 1N52B 4DSIA 1H2VZ 2BQRA 1Y5LB 2XBPA 3CD0A 1SKRA 3KLHB 3VCDA 4CT9A 3HKWA 3QIDA 2G4BA 3I9V9 3HJVA 1ICEB 1NU4A 4E2FB 4B3OB 2EFNA 4ZJOA 4FF1A 1MMDA 3HK2A 4NZ6A 2VBZA 2DB1A 3G6VA 2JL9A 3P8BB 2AZ3A 1U6ZA 1CVJA 3LWLA 1HWUA 3CCQS 3O3LA 4CYUA 5C2CA 4LVNP 2F40A 3K5NA 1TV6B 3AB4B 2QYGA 2IMWP 2GJIA 4M5HA 3CGIA 2HQDA 3UD5A 2AYBA 3P96A 1RWOB 1UVKA 1SJ1A 3SSQA 1Q8KA 2RUSA 1UPMB 2YWEA 3JQJA 3D4JA 4PPDA 5F0UA 1SC6A 4NYZA 3HM9A 5J1PA 3MTJA 4DV3J 3DCAA 1YWXA 1XNRJ 2YH1A 3OFEA 1BE4A 1H74A 3ZNUA 3W2WA 3QIPB 2FHKA 4N56A 5K14A 4GC7A 4D3GA 4I0WA 5ETQA 3JYTB 1ACMB 3I87A 4DCJB 3GG0A 3GZ7A 1OY6A 3KDNA 4HTIA 2JZ5A 4LSLA 2CJBA 2YKOA 4A4JA 3AHPA 2H4WB 4YEAA 3UPFA 4XDDA 2HHPA 3AQPA 2KRBA 3Q22A 4ED8A 2MY7A 4Q44A 1GK8A 5DQGA 2IYIA 4OQJA 4M5DB 3DDNA 2WSEC 4NXNJ 2UXDJ 3RTVA 1LK7A 4DV2F 5HMZA 5HROA 3BREA 2OMOA 2VB6A 4R25A 3MR2A 1UWBB 2VHGA 3KJQB 1MWZA 3VF0B 2F3JA 2HQ3A 2DH8A 2PN6A 5L39A 3PNIA 1S6QB 4DQPA 1HWIA 1HYSB 4GRSA 4PWUA 3M4XA 4ZLNA 4RWXA 4X65F 2HNYA 1IJFB 4WZQA 4QZVB 4DX7A 3DRRA 2CNKB 3EE3A 1B3TA 5HANA 3ETOA 1NKEA 2GMHA 2N82B 1QUVA 2HK2A 1VHFA 2ZZMA 1S9EB 5EWGA 3M1VA 2HFSA 3IWNC 2OEKA 2R42A 1U48A 1FDBA 2WONA 3KHRA 4J5OA 1J5OA 1JLGB 4MIWA 3D6FB 1AUSL 3TARA 3I55S 2KI2A 4W92B 3BH6B 2V69A 1DLOB 9ATCB 3BB5A 1XIQA 2F63A 2BUNA 1IBKJ 3MPUB 3BDPA 3CCLS 2OD4A 2YKMB 4XDCA 5JVHQ 4OZ2A 2W4DA 1SVDA 3M8SA 2NS1B 4CI0B 1RAIB 2PFDA 1R6VA 3T5HA 2XMAA 1YJUA 3L7OA 2BV3A 1FCAA 2DHSA 2RVJA 4FKYA 2GVZB 1FD8A 1Z2LA 2HGLA 2FD2A 1T03A 2MJUA 1NBEB 4M5NA 3BM7A 2UVWA 2CRLA 2RDIA 1RHRB 2DRBA 3KLGB 5C5JA 4RZRA 5KFMA 2BACA 4PXEA 5IOLA 3ENWA 4ZVHA 4PAAA 1FT8A 2I6WA 3W60A 4CH7A 4EYHB 3BKUA 2ZD1A 1P6TA 1HL6A 1DURA 2FHJD 4U95A 4X4NA 3GIIA 4K4WA 1QE1B 4JV0A 2ZJPQ 2HBZB 3Q89A 1B99A 3BO4A 1WUUA 1C1BB 4FF3A 5EDWA 4TN2A 2FJWA 2C42A 1TZ0A 3MM7B 1ZH5A 3EZ5A 2B6AA 1HNWJ 3I32A 2BJ7A 1P8GA 2XI2A 3I31A 1HQ2A 3M8PA 4ZDNA 2V68A 4ED2A 3NNHA 2CPXA 3PIOQ 3A4TA 2HNZB 1LWEA 4KFBA 2PI5A 2CNOB 1VMBA 3SZ2A 5ETKA 4JI1F 5KT7A 2AKWB 1UWAA 1AZSA 2WSFC 4CLKA 5HSPA 2VFUA 5H9FJ 2OGUA 5ETVA 3OJSA 3VALA 3N0VA 4P75A 3MMBB 3GQCA 3KTQA 2Y3YA 1N0VC 4P73A 1D3WA 5GVQA 3KG4A 3W61A 2BABA 4MJKA 2MQQA 2NSBA 5IV3A 1YJRA 5DDOC 2ZC4A 3HT3A 3G87A 5HBMA 4K4XA 3BV8A 4EGLA 3JXOA 4B02A 5AT1B 2V2VA 1RABB 2OSQA 2AGPA 3ENVA 1TKDA 4EYIB 3CVKA 1R43A 2FVCA 3H5SA 1N6QA 1IKVA 2C3OA 3MEEA 2CVEA 4EO8A 2LQJA 2H51B 3BGUA 4WF9Q 4LFAJ 2JNJA 1CBKA 3G82A 2IC3B 3OHBA 2EFVA 3NOCA 2JFDA 4QYRA 5JXSA 1OY8A 4ELTA 4KE5A 3DOLB 5HATA 2YQ1A 4YDXA 3UDEA 1U1KA 5GAEI 2C2OB 4JB8B 3MFHA 2DH7A 2KFZA 1Q53A 4M63A 4U6PA 4OYXA 5J1EB 1F2GA 4ELVA 1NDPA 3RRKA 5B0DA 2ZM6F 1K0VA 2JC0A 2CPFA 4NA2A 1Z1ZA 1Q5YA 3EVWA 4URSA 3BN7A 4CCHA 2EK6A 5DDPC 1X8DA 3FBCA 5AE2A 2B43A 3FNNA 4YMEA 2AW0A 2G13A 4OYOA 3C66A 4ECWA 4C7QA 3BR9A 5H9EJ 2PMZD 3RB6A 5K5MA 3MM6B 1NK4A 2GIRA 1QM9A 2RD5C 4HL9A 1QTNB 4WXWA 4WFXA 1YSJA 4CLUA 1W2BR 2HWTA 4M5KA 3KK1A 1H72C 2WTFA 3W2VB 3R5JB 1FX2A 2XNQA 4PZVA 1NHVA 2QGFB 4F4ZA 1RTDB 2MY8A 1S9GA 4Y2AA 1NM2A 1GXTA 4RNNA 2E9ZA 2NYIA 2LQ8A 3ZZTA 1MU2A 4GO7X 2EC2A 1U26A 2MHNA 1D9AA 2HFZA 1IR0A 2BE9B 2APOA 3J81j 2R8IA 4LBPA 2NZ4A 3PYEA 1TFYA 3F73A 1S12A 3N9UC 2NPIA 4L3NA 2R2RA 1S7IA 3OVSA 2E9RX 2BJDA 5KFQA 5T41A 3EXCX 4XPEA 2V34A 3R2CJ 5CYMA 1N5QA 3D68A 2O67A 1QVFR 4G3IA 1RT6A 2OHDA 4ZPAA 2X1FA 4ZIWA 2H54B 4LFCF 1PO6A 2XSFA 3EDQB 1S6PB 1B4SA 1LWCB 4BC7A 2V4QA 1I94J 1WKLA 2OTLS 4PKDB 2HBRB 3MTKA 3M32A 5IC4B 4CNZA 5D0EA 3AT1B 4HACB 2GQ2A 3UD4P 2EWHA 4IH6A 3HJFA 2KHDA 1KQFB 4ZPBA 1VBYA 1CEZA 4XPCA 4K50A 1JLCA 1UZDA 2WK4A 1Z4UA 2AU0A 2JVOA 5F9LA 5KFBA 4Y6IA 1UEUA 1H7WA 1U02A 4EK2A 5DG7A 4ZPVR 3UFCX 2HQGA 1VC0A 1EX8A 1UEKA 3K5MA 1RLDA 3E51A 2ZH6A 1SCJB 1FE4A 4TYBA 3EUNA 1O5JA 2BJ3A 5C24A 3V2UC 1FNOA 3CIZA 3CEDA 1KC8T 2RU3A 3KLEB 4BLGA 1I5OB 3T6JA 1FFGB 1U6BA 3BF4A 4I2PB 4C2MA 1R89A 3OBIA 3CC2S 4FBUA 3PO5A 4UUXA 1NK6A 2YNFB 2AIRB 4DR5J 1S1VA 3FSYA 3KJFB 4IO9Q 2HFUA 3MAHA 4P2FA 1ZOTA 2A6OA 1F3VA 1HWJA 4DV5J 2NCKL 3BSNA 3QGHA 2CJKA 2IJFA 3W66A 4GKKJ 1RAOA 1DY3A 2YPYA 3OW2R 4HLBA 1DFDA 1TUVA 4ID5A 4B17A 2IAJA 3S6EA 4MKAA 4O3PA 2D74B 2V8HA 1R8HA 3WIUA 3EX7B 2DD8S 3KLIB 2H4YB 5J2MB 2FY1A 4MIBA 3NKYA 2NUHA 1XMQJ 7AT1B 3FMBA 2W7OA 1RT1A 1QVGR 1C2PA 1NJXA 1ZTWA 4U8VA 1FESA 3NCPA 2EFQA 5B09A 3GFZA 1JKHB 4HDHA 3G8SA 5IT4A 1WKKA 1BHNA 2BBEA 4JI7F 2RF2A 1HNZF 3QPIA 1U4BA 4B9NA 4MKYA 3WC2A 3MAAA 5LMUF 2IM0A 4HR2A 5AXNA 1ZBTA 1YIJS 1ROFA 2ALZA 2RKIB 1P1LA 3UDLA 2F4VJ 1XNQF 2GHWA 3PZPA 1ZAXA 3BQ2A 1SKUB 3G9CA 5J2PB 1SC1B 5E41A 1PBAA 3B78A 3C15A 2BE2A 4CIOA 1OPZA 3IBCB 3LAKA 5E3AA 4ANEA 4V1Ak 2IA0A 4WTOB 3VQTA 4TYAA 1QAIA 2PA8D 2KZMA 3KOAA 2L48A 1NH7A 1Y11A 4O4GB 3EZOA 3QLHA 4LSNB 3TR5A 4YHHF 2R7UA 1JLFB 3LOUA 2G1HA 3IG1A 2CJ9A 1WELA 3A12A 3OTOJ 2VA2A 1P9QC 1ULRA 3ADAC 3CULA 1VLYA 4LF4J 2ZH7A 2F65A 4M5IA 3KJVA 2C2NA 3MUVP 4I7FA 1YJTA 5HLFA 1OS5A 1MG7A 3KDOA 1CJKA 2C3PA 2HS0A 1LEOA 2C2EA 2CJYB 4RW7A 1YGYA 1OY9A 2W2NP 1SQEA 1WTBA 2MKIA 4RW4B 1L3VA 4E0DA 3W62A 1K1QA 1X4DA 2AHOB 3N5FA 1HNVA 3DLKB 2J7WA 3CC4S 2QA1A 3H0PA 1N36J 2JVRA 1ZYQA 2DGXA 2BANA 1S48A 2UVVA 5HVFA 3GLJA 2BOPA 2E5LJ 5ADZA 2QL5B 1EETA 4F4KA 4HHUA 3VGTA 2NXCA 4FXVA 2UU9F 1D9FA 2CPDA 4ZS6A 3AOBA 2BMBA 1S59A 1RLCL 3BKFA 1HBOA 4J9NA 2X3GA 1IWGA 3MGJA 4DV1F 2MZ1A 2EKYA 4OI0A 1VYAA 5C42B 1LW2A 4KHMA 4Q2MA 3LPYA 4UZBA 1UW9A 2X1GA 3RYLA 3FZBA 3LA0A 1NK7A 2Z4PA 2L3MA 2NREA 2HNDB 3HXMA 4RUHA 1WKJA 4R0EA 2D3UA 1UEVA 3IMQJ 2LFVA 4KO0A 3K17A 4ED7A 5C2GA 1Y7PA 3GJRB 4O4RA 2HKEA 3DU6A 2R7RA 4LBIA 4TLRA 2QV6A 4C48A 1U45A 4USHA 2DVIA 1HBNB 1HI8A 1S72S 2UUAF 5A8KA 4KAIA 3V4IA 2DR7A 4J9PA 3TX0A 1SV5B 1ZM9A 2Q79A 3MM9B 5J2QA 3HT0A 3GJQB 1TMJA 1T0TV 3BBFA 3G96A 3MURP 4KC5A 1TL3A 3PJ9A 4OMFG 4OZ0A 1MN9A 4PG4A 3OXGA 4DPYA 3JAMU 2YNGA 1DQ8A 3EXYA 3I0RB 5L1KA 2J0XA 2C2KB 3SDEA 4ED1A 2BM0A 4J9MA 2HRYA 3J7A1 1YJNS 4KGVB 2U1AA 4DSLA 3OFHA 4YP3A 2QA2A 2WVBA 4LRAA 2R2TA 4DUYF 3G2XA 1SKSA 4NYOA 1RK8A 2J0SD 2MXYA 4DL6A 1UJ6A 3TI0A 1SKWA 4IG0B 5D8HB 1LQ9A 2MMYA 2VDHA 4YB6A 1SB6A 1HR0F 1DQAA 2QA4S 2N4CA 1IKYA 3I5CA 2QX0A 2OAUA 3M05A 3E01B 3MR6A 3OD2A 4U96A 2BYCA 4JI2J 1HWKA 3DM2A 5DG8A 4PR6A 1DAXA 5HQLA 2NXUA 2Y8WA 2A2DA 3LH2S 4DL2A 3UVJA 3EZUA 5LMNF 2MKJA 4C11B 4Y65A 4IYQA 3C8YA 4A46A 5A76A 3NNCA 3KNAA 3M30A 1YJ9S 1K44A 1YLXA 5AE1A 5E0OA 3C16A 5L8RC 3MEGA 4QQBA 2CPEA 2ZWOA 3OR2A 1VI7A 1UW4A 2DCUB 3SIPB 2ZE2A 4AL7A 3KG1A 3ICLA 3K5OA 2HVZA 1LV5A 2JJ4D 3T5JA 1JB0C 4JBCA 4RW9A 3CXCR 5KFCA 3BZQA 2NSCA 3M8ZA 3KK3A 3KMQA 1MWYA 4JI5J 2B8QA 1U6FA 3QZ7A 2HWHA 2DO0A 1T11A 5DZ6A 1KBRA 3MCNA 2RT3A 3FCHA 1XC9A 3IGVA 2N3LA 2BE7D 1KLMB 2BW7A 1FKOA 5THWA 1LNQA 2EKNA 1B70B 3TAMA 1SH2A 4ECZA 3K58A 2ILZA 2I0XA 3G6ES 3AXMA 2GIFA 2CIMA 2FZCB 5A8RB 3SQGA 1JJ4A 4WTYA 4DCOB 3P4UB 3PXGa 2MQPA 1X4BA 2IVYA 2WBMA 3RBXA 2LYVA 2AQ4A 4DQQA 1A9NB 2A0FB 1N48A 4I6AA 3HHLD 1REVB 2GQCA 3DRPA 1TVRB 2FHMA 5L1IA 3FCWA 5KFGA 5EWFA 2ASYA 3PHEA 4ZVSB 2CWKA 2R7XA 3ISND 2HAIA 2EW9A 3IS9A 1GX5A 1TKXB 2HS4A 1B7YB 2VC0A 2QG9B 1OPIA 3PYFA 1EAYC 4B08A 1UL3A 2DGSA 5JJBA 5K8OA 3OJUA 2WVEA 3MMCB 3ENQA 3ZNJ1 2BZ2A 2LQBA 2IMOA 3W5XA 3DI6B 3KJNB 4F4WA 2F7VA 1IKWB 2WVDA 3POTB 2KT5A 3I6PA 3TNVA 3ET6A 4I1TA 1LXJA 1N5YB 3RB0A 3AFGA 4IRKA 3RU0A 1YJWS 3PX0A 1VRTB 4DFMA 5BR8F 3DLGA 4DDFA 2HW3A 2FVQA 4LR7A 3OSPA 2PE8A 1UAWA 2R8JA 2CNLB 1R27B 2DR6A 2C2ZB 3KLVA 3NMRA 1HQEA 3VV2B 1WF1A 3UNGC 4L75A 1FE0A 1NPPA 4K2JA 2R4FA 4O3QA 1Y10A 3ELHA 5KFAA 2M52A 2WZ1A 2W9AA 2I5JB 3UN3A 3SCJE 2JRSA 3UCGA 1YQHA 2OPRA 2XO6A 3L9ZA 1ZZNA 4JI4J 4ES3A 1R31A 3OTBA 1TL5A 4P6QA 1B7FA 1JXVA 1CLFA 4W98A 4IQXA 3M9MB 1W25A 3TVKA 1TP7A 2DNYA 3WDOA 1NKBA 5KFIA 1FHTA 2CQ3A 1HQUB 2G2YA 1PBUA 2V63A 1F6TA 4ZPTR 3TA0A 2FJEB 4HHHA 3NOGA 2KN4A 2FLNA 3D7SB 1R0AB 1XNRF 3OQ2A 2MHEA 3HSJA 4HYKA 2BA9A 1TL1A 1PGZA 3K7RA 1JQGA 4IRDA 2EBGA 3H59A 3R6GB 4OJ1A 4NRTA 4OHZA 1YG0A 4ZVGA 2J0WA 2WAQD 5F8JA 3OUYB 2LEBA 3PTWA 2UXCJ 3BBBA 1MNEA 2BR0A 4PXBA 1W26A 1T95A 3DOMB 1RU2A 2GO8A 3M2UA 1SJRA 2U2FA 1UP1A 4V19X 3N28A 2MLXA 2E44A 4I69A 5FJ4A 2DNLA 1SJ3P 1GMUA 3FDSA 4Y2CA 1B0VA 4IH5A 4ETZA 3R5BA 5D4LA 3FEXB 2OPPA 1OMSA 2VG7A 1RBOB 4BC9A 1RTHA 4LF2A 2DBBA 1TUGB 5DM7Q 2P8IA 4NZ0A 3W9JA 4ZVFA 1CS4A 1YDLA 1ZZFA 4OYBA 5H9FK 2UUCJ 1ZS6A 4ZHRB 1N33J 4K4ZA 2YNHB 4RW8B 1H0HB 3CJKB 2E1CA 2JLFA 5HP1A 3TP2A 2ZOGA 2N7YA 3PG9A 4WFZA 3ZZOA 2LCWA 1Q5VA 2EI5A 2EBEA 1NK0A 4ZLPA 1DTTB 2HGMA 1FRLA 3D0HE 4OI4A 3DFEA 3H42A 3QGIA 1NPRA 3PY8A 2Z2MA 1IBKF 4EI2A 4KRWA 2B9XA 1FNXH 3QO9B 1KHVA 1HLWA 3KYLA 2CPJA 5KFVA 1UVIA 4IFYB 3R6LB 2V2ZA 3MM5B 4NLUA 1B64A 2EPIA 3TANA 2AP6A 5AJ3J 1E6YA 3T1YJ 3MM8B 4C0BA 3MDFA 4DMZA 5LXRA 2EFOA 4DN0A 4B9VA 3HD2A 4L76A 1IKXB 1OIAA 3CCRS 4F3MA 2ZBIA 1F2HA 1AT1B 4NZ7A 1SQFA 1FJGF 2G0JA 5HJXA 3CDAA 2RDDA 3SI8A 3EVMA 4F7VA 2DT9A 1VQ4S 2K8GA 2OD6A 2UV8G 2RILA 3PHTA 4E8UA 3SFUA 1QY7A 3GWCA 3NCRA 2HMIA 2BKNA 4KBIA 4ER8A 3AXKA 2RIJA 2CXEA 4IG3B 5KTQA 1D09B 3KK2A 4B3RF 5D3GA 1RA6A 3QT6A 4O3RA 2CADA 1QD1A 3QSIA 1OSCA 3QAUA 1PSDA 2PEBA 1D8ZA 1R8PA 1TAQA 1FI4A 2XMJA 1RAGB 1VK8A 3GONA 5T7LA 5H9EK 4LF8F 3M8YA 4DX8H 5I42B 5F8IA 3GCWP 3FFIB 4M5MA 2DTJA 5CXTA 4O0NA 2W25A 4Q0BA 3BJYA 3KWMA 3CNQP 1QSYA 1IBCB 4AFFA 1HNIA 2KRRA 2H5EA 4WFYA 2MB0B 2QN6B 3WHIA 1R0CB 3QT7A 3C14B 2E66A 5D15A 2AWZA 4C3MA 4EU0A 3H40A 2XWXA 1RHJB 4USKA 3CCSS 1WNEA 2VQEF 4AQYJ 1IN0A 4ED4A 4XIUA 3ILIA 4F26A 2YY3A 3L09A 2RSQA 3GYGA 1RADB 2LMIA 2PEHA 3OL6A 1DHMA 4DPTA 3QJLA 3GSIA 2W9CA 1OQ6A 5E3RA 4MK8A 2ZBRA 3MUMP 2WW4A 1RWMB 3ZTRA 4LFAF 2RH3A 2HURA 2W2OP 3HHNB 1SJ4P 2XHCA 4QWAA 2YNIA 2MZQA 1SH0A 3LWMA 4QU6A 3JSMB 3NS5A 4JUZA 1NSPA 2ZC3A 3PRBA 2HGNA 2JDJA 2IDEA 2VASA 2HWIA 1APSA 4OIXA 1SH3A 3JQKA 4LT6A 3BH7B 1HWLA 1R6YA 1FVQA 5HMYA 1M90T 4DX5A 4Z2XA 4J90A 4DL0C 3HI9A 2OMLA 4WE1A 2Q43A 4NEYA 3NWRA 2B5JA 3M8WA 1FTCA 2FQQB 3W2WB 4F02A 1H6KX 2HSEB 1TFWA 3TAQA 1T9YA 3TZWA 3LGMA 1QUPA 1KEKA 2G0CA 1S1WB 3HVRA 2ILYA 5A8WA 5L9XA 5EX3A 2KJWA 2BRKA 3DRXA 2KYXA 3KLHA 1BMQB 2DHXA 2E7VA 4WK3A 3K57A 3MPVA 3Q2SC 4B3OA 5D6GA 5LJ3Y 1WHVA 1RT3B 3FUYA 1Y5IB 2RHQB 3HVTB 3DU5A 4P52A 3A8IA 3D9BA 3ULHA 1Z2ZA 1UTAA 4KKOA 4OYIA 5KFYA 2R8HA 3NCQA 3ZTSA 1Q8IA 3N01A 3CCTA 1U24A 2F9DA 1GEHA 1TV6A 3TUPA 2VD3A 1RTZA 2GMLA 4ID8A 2FJVA 4NXMJ 2V8DA 4A47A 3DRRB 5KFJA 4TU8A 3MPYA 4DR3F 3KG0A 3CD6S 1NDCA 2CUYA 1N34F 3GIKA 3SMZA 2DRDA 2XGQA 1KR4A 2VJUA 4FS1A 2B8PA 3VVTA 3T1AA 1VBKA 3IO1A 3PEHA 3IXQA 1NB7A 1X4FA 1WOOA 5JUMA 5IS2A 1ZM4A 2BDPA 2RRBA 3H25A 4JI8J 1EKRA 3PM9A 3EDRB 3LP0A 2FGOA 1YITS 3QIPA 3DYAA 3RUBL 5JMNA 5CAAA 3DLBA 4OV6A 2XHWA 3M7VA 2CQPA 1YBUA 4CLLA 3UWTA 3JYTA 4I68A 2MJNA 4EBCA 4I4BA 2XYPB 2J9EA 2SXLA 3Q0AA 1IVZA 3A8JA 1GH8A 1AB8A 2DNNA 2CQGA 4ATNA 1WEXA 1QAXA 1H7XA 2OSRA 4WP8A 2N3OA 4M5DA 4OX9J 2KZZA 1T03B 1RXOB 2DEIA 4J9OA 4NLDA 1UWBA 2VKRA 1WC0A 4ALZA 3AODA 2HEKA 1GX6A 1IBLF 1TKZB 1QAYA 3LP1B 3BO2A 2AEJA 3HVAA 2NZCA 2ZEJA 2FJXA 2IM3A 2KTQA 3K0JA 4QWDA 2GHPA 1RSCA 2O01C 2VQFF 1VGYA 3DKDA 4Z7CA 2YKAA 1KQKA 4PRFA 4YFUA 4KH1B 2DK2A 5A2QU 1S9EA 4DV7J 1YRTA 5LM7E 4PYAA 5GADU 4DR5F 3RRGA 3OLAA 3AA8A 1JLGA 3ENAA 3R7NB 4QIWD 4KFBB 2GS8A 3OVBA 4NOHA 1DLOA 1AZSB 3H4BA 4DR2J 3X1LB 2IDLA 3OR1B 3VTIA 4YR0A 3MF5A 3R9LA 4DV5F 2J7KA 1UFKA 1JLQA 3A1YG 5CD4A 4NMXA 4KH0B 2YKMA 3D1OA 2Z2LA 5B0CA 2XEXA 3VZHA 2ZOFA 2DKOB 3EICA 4B9UA 1RT7B 4J7CA 2ADCA 5KAKA 3KHGA 4JI0F 2DEJA 2C28A 2ROEA 2GVZA 2XG8A 4BHQA 3J7YU 2QSFA 4N8OA 4DV6J 3M6UA 1S10A 4X4SA 2JEIA 2GX8A 3N6MA 2QLJB 2YKNA 1CPZA 1IQTA 2C22A 2DPIA 1IKVB 1ZTTA 4WZMA 3FQKA 2M8DB 2G0IA 3FMWA 1G3OA 4AYBD 1QE1A 3D1HA 2DGQA 2HBQB 3QNWB 2M2BA 3BEGB 2DNRA 5DZ7A 4RJVA 1C1BA 3F56A 1VQ8S 5EN1A 1VQOS 3MM7A 5B0FA 2AV5A 5CQGA 1NPKA 2CA9A 4M5JA 2YWFA 3AB2B 4LVOP 4HVZA 1I1GA 2XZTB 4DL7A 1BWEA 3C2PA 4F4XA 4GVLA 2HNZA 8RUCA 2AYMA 3I4PA 4CM2A 4MTPA 2ZVSA 2PD1A 1RWXB 5KG4A 4X4UA 1GMVA 3DN9A 4DR6J 4RUCA 3MMBA 4KGXB 4ZVPB 1CQNA 1VQ5S 2JLGA 3OTOF 1TL7B 2AJ4A 2DNQA 2CWXA 4LRDA 2J6TA 3MPWA 1XWLA 2E5GA 3TOQA 4F4YA 1KNZA 5K8MA 1FX4A 1WACA 4CT8A 1SUQB 1AXQA 4NLGA 3KK1B 4I6WA 4P74A 3R1HA 4DWIA 1VQMS 2LXFA 4CDIA 3N5BA 4DQRA 2I8EA 1U0SA 2Q1LA 2DXEA 1S9GB 1M1GA 4B3MF 3M9NB 2M0GB 2FJAB 1N36F 1Q7YT 4A8FA 3T6BA 4CZCA 4ERDA 2YWWA 4USVA 4DXLA 3F0NA 5LJ5Y 3PO4A 4CO3A 2FZKB 2OTJS 1N5VA 1N32F 1WTFA 3UR0A 4OFZA 2M8HA 1NXIA 3DOLA 3RR7A 3ZTOA 2JEJA 4K2XA 1NJWA 3ZO7A 4BCAA 1RKJA 3D2WA 5CYMB 2DY9A 5J1EA 2XLKA 1X9MA 1TK8A 3PRDA 3O2IA 1S57A 4YY3J 1KOOA 3BGRB 5DDQC 1IR2A 2ALYB 2DXDA 2QMUB 2VFTA 2DNZA 4TLQA 3PKMA 1S6UA 3M32B 4ELUA 1O6XA 5J1NA 2HVDA 3DDIA 4PWDB 4M94A 1PC5A 5CYQB 2ZHAA 4PQAA 2ABYA 4QJVA 5DM6Q 3M2VB 2R8KA 3MM6A 4RX6A 3F44A 4MKBA 4P71A 3UD3P 2CYYA 3PR5B 2HHVA 3G6YA 3W2VA 1X4HA 4DV2J 4LF5J 2DHGA 3EVOA 5F8HA 1RTDA 2RQCA 3PW7A 2P6TA 2LA4A 2Y1RI 3KLFB 3M6VA 3IFEA 2X7IA 1NSKL 3AY0A 4MK7A 5C24B 2ZVIA 1KQSR 1SC4B 2Z0GA 2H1YA 4X65J 4J9KA 4DV0J 5IM0B 1HD1A 4ZP7A 1JJ2R 1WEYA 4BBYA 2NLWA 2V2QA 4B3TJ 5DO2A 5ITHA 1S5ZA 2B9YA 4DG1A 2ADBA 4CO0A 1F60B 2ZDPA 3FRZA 3EGNA 3UO0A 5KG3A 1S76D 2QFJA 4HKQA 4C8OA 1BLUA 4CTAB 3SEOA 4ILLA 1IWAA 1TU0B 2MZJA 1ZAVA 4YB5A 1O51A 2YQ3A 1S6PA 1LWCA 3O6QA 2VOOA 4JOUA 4CNYA 4F25A 4M95A 4ED5A 4HACA 4RBVA 5B0GA 1G1XA 1Q81T 5ETRA 3I82A 1T02A 3EGZA 2NYHA 3UCZP 1QDUB 1FDNA 2IAJB 3BR8A 4ECVA 4ZVTB 1IM6A 2HHUA 4NCBA 1RWPB 3QYYA 1K9MT 4JI2F 1HHSA 4TY8B 4ZCKA 4DLEA 1NHUA 3QGPA 1S1UB 3THTA 2PA3A 2ZITA 2E9TA 3UQSA 4F2RA 1VQ7S 2CJQA 4NLRA 4A48A 1XMBA 5IQQA 1NKCA 2LQ5A 3IRXB 3W9IA 3QFWA 3VAKA 5ETOA 4DR7F 2KH9A 2KXHA 3MAAB 3KLEA 3MD1A 3V5RA 1LWFB 2J9DE 2KG0A 4I2PA 2ZH3A 1X4GA 3GYXB 2CPHA 2MQNA 1LK5A 3ILLA 2C3MA 1VIXA 5D4NA 2YNFA 2FLLA 2D7SA 3MEDB 4GVBB 4C0HA 2B4UA 4NLOA 4P2MA 5KFPA 4KGMA 3NXZA 4ZVRB 5I3PA 4HHJA 4JI5F 3MECB 3SQOP 5KT4A 2FUG9 3JSYA 2XY5A 2CZ4A 4TVAB 1YJ7A 2M9KA 1PKUA 2F1FA 2KU7A 4P10A 4LR8A 1N5TA 3CJRA 2AEFA 1YZ7A 4WWSA 4BDPA 3N4WA 2YX7A 1MWQA 1KKHA 4JV2A 4MT1A 4G1QA 4P9SA 3DLHA 2MYFA 4DCPB 3D0IE 3R5GA 3IRWP 5KFXA 2OPQA 4WU3A 2OFHX 2CZ9A 5M2PA 5H1SV 1WC6A 4RUBA 1JJHA 3H2LA 5HLFB 1S1XB 2IRYA 3CJ5A 1VC6A 2KKHA 3THVA 2LEPA 4ZP9A 4RW7B 1D8YA 2IBKA 2JSXA 3OLBA 5E33A 4C3KA 4EEYA 4D3HA 2UV8A 4Q8FA 3Q8UA 1HNVB 2F5GA 1U8WA 3T41A 1JKHA 1OO0B 4ED3A 4F3OA 2EC0A 2CVIA 4CLWA 1FEHA 1WC3A 3LO3A 4OLOA 1S99A 1KWMA 1HMVB 4ECSA 3PKYA 4DUZF 2RKIA 3SCKE 4RBTA 1FRHA 4WYLA 2QJ3A 2PMWA 1PYOB 5J2PA 4WP3A 2H9ZA 2ZFHA 2KO1A 5BYQA 3OFFA 3PV8A 1LFPA 1FA0A 3Q8RB 2DPJA 3K2YA 4EZ6A 1AUDA 1G7CB 1N56A 1LW2B 4OI6A 4O4GA 5E3PA 4LSNA 4J9VA 1JLFA 4RNOA 3AAWB 3Q86A 4LJMA 2R7SA 5KFNA 1NJYA 4KO0B 2RUGA 4KPCA 1C0UB 1JK9B 2BEFA 2JWNA 4I2QB 1RAFB 2EFPA 1CJVB 1VHIA 1Q8LA 1U1LA 4KHPF 4QPTA 4IDKB 3GV7B 2RHSB 2A1BA 3BS9A 5EWEA 1T05B 3CJ3A 3GFYA 5I3UB 2UUBJ 3A3PB 1FWKA 5KFTA 3HDSA 2XS5A 4K0KJ 2AD9A 1Y4ZB 4H4KC 1T3NA 4C98A 1VCTA 5EUHA 1VBXA 3GR0A 2IJRA 4RO0A 1JXLA 1JWWA 3LF0A 4ZA1A 2MQLA 1VQ9S 3RBEA 4P7VA 3TEGA 2D9PA 2ZZNA 3I56S 4UOCA 4K59A 3NGUA 1ZPWX 1C0TA 2KYZA 1A7GE 5C42A 4NLYA 5KT3A 5FDLA 3QGGA 1J2VA 4IUFA 3MCSA 4ILRA 5LOQA 3AH6A 2UXCF 2HNDA 1VOMA 5CCLA 2UUTA 1HA1A 4G6VB 1LW0B 2AJ2A 1VQ6S 1FEEA 1UVMA 2PDAA 1S97A 5K8PA 2RQMA 3W1YC 2LU1A 2W9BB 3NGTA 4IKAA 2RQKA 3MR7A 1YKWA 2OKQA 3DHXA 2JEGA 3DM2B 4FN5A 1VFJA 3VAFA 2D3OR 4WXOA 4DV4J 4WIQA 1FERA 3MAQA 5CZXA 1SV5A 1X31C 1S9FA 2DR9A 4J9QA 4AT1B 3C6TB 1RP5A 4KV8A 3HO1A 4F8RA 2BX6A 3M30B 4DPWA 3OTDA 1XR6A 3C16B 5DDRC 2XLIA 3MEGB 4L74A 3QAEA 4HI2A 1N33F 3VZIA 4USTA 3I0RA 3U7JA 5DJBA 2KXFA 4TU9A 3R3TA 2IPOB 3Q83A 3W65A 3RAMA 2XWYA 4KSEB 2V4JB 1X4EA 3DNCA 3VWSA 3GSDA 2WW8A 3H90A 4ZOSA 4N47A 3M2RB 3T19A 2FB0A 4JV1A 3DC2A 4IG0A 2CG8A 4FPRA 2PFFB 4GMKA 3KHHA 1RHUB 2YX1A 2IA6A 3T1YF 3AQOA 4NLSA 1RU1A 2IIHA 4TQRA 2VBYA 5GADI 2JHEA 1GTHA 3VAMA 1T8EA 1UMJA 3CD5A 4EMDA 4MK9A 1X7VA 1TELA 4IQMA 1EZZB 4B3SF 3FSIA 3CIMA 3EMTA 1F5CA 4X4TA 5E5NA 3RR8A 2CQ2A 1RHQB 2WSCC 1NJZA 2YKQA 5A0YB 2FVRA 3MCMA 2VBXA 4C11A 1KTQA 5HN0A 1U1OA 2OO4A 3MXHP 4Q2LA 5KFSA 4ED6A 1HNZJ 2QA4G 5LMUJ 1XERA 3TWZA 3CMES 1YVFA 1HI1A 4ZVEA 2H3EB 3J7YI 2CZVC 1XNQJ 2A18A 1WDDA 3RW7A 3CDUA 2DCLA 1S1TA 3JSBA 2JX2A 2X1AA 3OTEA 3DOKA 4WFBQ 1Y3JA 2LLZA 2XMKA 1X5TA 2VBWA 2RRAA 2OJ3A 5KFEA 3QRPA 4K4SA 2WCXA 4MFBB 4WFAQ 4K4YA 1FKPB 4I67A 4FDFA 4RU2A 3VAHA 1X60A 2LU2A 4YHHJ 3SSSA 1KLMA 3QFHA 1M5VC 4ECRA 2VG5B 5DQHA 5BYSA 1U25A 2F8MA 5M2UA 2PIIA 1EP4B 3NBPB 4J9SA 1HFEL 3G86A 5LXYA 1QLNA 1F9HA 2E5IA 3EWGA 3F41A 5A8RA 1BQMB 3CCVS 2J9CA 3HHKA 4DX6A 3HZGA 3C6UA 3BN4A 1F5BA 4X66J 4AL5A 4F36A 2ZNYA 4DF8A 1KDNA 4Y2MA 1REVA 3RW6A 1TVRA 4CP5A 2QEXS 2BXJA 2VH7A 3G6XA 4DSEA 3BBCA 3LP2B 2MEWA 2HQCA 3V6DB 2GVDA 4A8QA 1DBDA 1WC1A 2K7KA 5DQIA 1P27B 3DXBA 4U67Q 2Z58B 2FLPA 3PW0A 1T94A 1TKXA 4OI3A 1SL2A 1WG4A 1BD6A 3NRBA 3QRQA 2C2DA 1U0HB 2R7VA 5DLFA 2UU9J 2UXBJ 1DARA 4ILMA 9RUBA 3MMCA 1GNKA 1VRUA 1R8AA 4C0OC 1VJWA 3MI7X 1UKUA 3DI6A 1VDHA 2Z57B 1IKWA 4C8NA 4AXJA 1HNXJ 4WU2A 3B4MA 1N5YA 2B51A 1FK9B 4F0KA 2CDQA 4QCLA 1VRTA 1PJ5A 4CO5A 4H4KA 4DS4A 1J5EJ 3HMJG 4HH0A 4URQU 3ZXWA 4QOTA 3M6XA 2GFFA 5E7OB 4ITSA 1SIZA 3GFHA 3QRRA 4F67A 3PFOA 2UUAJ 2OIHA 1ZA1B 1YHQS 4F50A 1V5VA 3ZTPA 4CLFA 1OWXA 1WJ9A 3Q23A 1B0TA 3GIRA 2I5JA 1IJEB 4USJC 2HS3A 2WVCA 4J9RA 2R7WA 4DOZA 4Q7AA 3RJMB 3UE2A 4DR4J 3SFGA 5E3QA 5KFLA 4NXMF 4LF1A 1X0PA 2W7PA 5LSRA 1IM4A 4QYZJ 4YS2A 1HQUA 4IRCA 5FIIA 3Q8PB 1WC5A 3D3BJ 3RRHA 1NCLA 3CWJA 3V6JA 2VUGA 3LALA 3BGOP 3I0SB 1R0AA 1RE1B 4Q45A 1C4CA 4NRUA 1S4EA 3W8PA 1Y5NB 3FQLA 2ACYA 1V5IB 2ZH1A 2KM8C 1R8BA 3H4DA 4DUYJ 1TK5A 2FC8A 2E1MC 4PPZA 2UZAA 1HKAA 2MKCA 4CH0S 1BQNB 4XTTA 3IA0A 2EG1A 3OUYA 1U8SA 2ZKUA 3TA1A 2P5VA 1RYRA 3HD1A 2KG1A 3GILA 4GKJF 4O23A 2HFVA 4OI1A 1UFWA 1SXLA 2OEMA 2M3DA 3H5YA 5KFWA 3NEKA 3BSCA 2J8AA 1S79A 1VISA 2OPSB 4ES2A 1HBUB 4NMLA 3FBFA 3OHAA 1WORA 5B0AA 4CO4A 5LMNJ 3THPA 3KUGA 2R9LA 5KFRA 1CQMA 3H20A 2PO4A 4QPXA 3EJMA 2YX4A 4WBFA 4FYXB 5D3GB 4USUA 2MLYA 1RDRA 2H65B 2K7JA 2GHVC 4KGZB 2IRXA 2QYCA 2YNHA 4RW8A 3PYGA 3CJKA 1IXKA 4DV7F 5IWAJ 4V19J 4PG5A 2NUUG 1LOUA 3T9NA 1FXRA 1EIYB 1GMWD 3LTOA 1DTTA 2WB4A 3P45B 2EFGA 4R0JA 3VGUA 5KT5A 2VA3A 3HPOA 3PW2A 1HNIB 3OPKA 4YUDA 2CFXA 3QO9A 2G2OA 3DMJA 4RW6B 3GCXP 4IFYA 2XY7A 3FGVA 4QIVA 3MM5A 2HIYA 4LF7F 1BY9A 4NEZA 3MM8A 1OQ3A 2RJZA 3MUTP 1KVIA 2FC9A 4RU9A 2DISA 1RACB 4QU7A 4HTJA 5A2QY 1IKXA 2BOAA 2Y1JA 2HFOA 2VIHA 2WOMB 3P6YC 4DV6F 3BYPA 3RG6A 3PR4A 2DO4A 4M5GA 4ZJQA 3PCOB 4NYPA 4ZKAA 3X3UA 2XS7A 1T9UA 2AGOA 3KUHA 3BGFA 4U9RA 4ZPDA 1JLBB 3DLJA 4IG3A 2RB7A 2R7OA 1CC7A 1FTRA 1WOPA 4IFVB 1T9XA 3ONQA 4ETXA 3MOJB 1RWUA 1S0VA 2HFNA 1U1RA 2DIVA 2X51A 5K8NA 5KFFA 1X5PA 1MN7A
chains in the Genus database with same CATH topology
4O3SA 3RRKA 4J9OA 4QW8A 5B0DA 4NLDA 3W7BA 1PILA 2ZM6F 1K0VA 1O0PA 2DGOA 3MR5A 2JC0A 1UWBA 2CPFA 4NA2A 2VKRA 1Z1ZA 4ALZA 1QTMA 4C97A 3CPWR 3NG8A 1GX6A 3FFIA 1TKZB 1IBLF 4X2BA 3OV7A 4R5PB 4URSA 1QAYA 3BN7A 3LP1B 4CCHA 3BO2A 2EK6A 4LF6F 2RF2B 2VZ9A 3HVAA 1H38A 2GGPB 4NLPA 2DNKA 5DDPC 1U47A 2HVIA 1NH8A 1X8DA 2FJXA 5AE2A 2B43A 3FNNA 2IFXA 2IM3A 3ZC4A 2BM1A 4YMEA 3NMAA 2FHJA 2AW0A 1NRKA 2G13A 1V3ZA 2ERRA 3W3SA 2KTQA 3K0JA 2GMJA 5AXLA 4QWDA 2GHPA 1UA0A 3C66A 5F3TA 4ECWA 2O01C 2VQFF 1VGYA 4TXSA 4C7QA 2QIFA 3BR9A 2YKAA 3BQ0A 1KQKA 2PMZD 5H9EJ 5CD4H 4PRFA 5U47A 3RB6A 5K5MA 2D41A 3MM6B 4QBUA 1NK4A 4YFUA 2GIRA 1QM9A 2RD5C 3SCLE 4HL9A 3BSOA 4WXWA 4WFXA 1YSJA 4IOAQ 1YRXA 1W2BR 2HWTA 2RS8A 3KK1A 2DK2A 1GAOA 2WTFA 3W2VB 2IM1A 1S9EA 2BE2B 2HHHF 1T3OA 2DGTA 1YRTA 2M5YA 2HLTA 1H2UX 2XNQA 2HHXA 1NHVA 1K0TA 4F4ZA 5FD1A 5GADU 4DR5F 2XZWA 3OLAA 3RRGA 3AA8A 1RTDB 1JLGA 4X62F 2MY8A 4J9LA 4QIWD 1U2FA 1S9GA 4KFBB 3OVBA 4NOHA 4Y2AA 1SL0A 4I6YA 1DLOA 3I0SA 3H4BA 3X1LB 3QLHB 3K59A 1VS3A 1GXTA 3M6WA 3U1MA 4RNNA 3CMAS 2E9ZA 5EX0A 3EPGA 1RT4B 2HPUA 2NYIA 3OR1B 3VTIA 4E98A 4Q8EA 4YR0A 2CQIA 3MF5A 4EWTA 4KKOB 2V9WA 2VFSA 2VFVA 3ZZTA 4DV5F 3IG1B 2J7KA 4WFNQ 1SI9A 1JLQA 1FJ7A 4UQTA 1MU2A 3A1YG 4GO7X 1U26A 4OHVA 2MHNA 1D9AA 3ZZZA 5HL7Q 2HFZA 1M5OC 1IR0A 4C8LA 2APOA 4ICLB 2YKMA 2R8IA 2NZ4A 3D1OA 2Z2LA 5B0CA 2XEXA 1TFYA 5BYRA 3VZHA 3F73A 4DS5A 3N9UC 2ZOFA 1L5UA 4OV1A 1BQNA 3MZIA 2NPIA 4L3NA 2R2RA 4X4PA 3GV5B 3OVSA 3DMJB 4B9UA 3KJVB 1RT7B 2E9RX 5C25B 2I38A 4I7FB 2NPFA 2B7BB 2BJDA 2ADCA 2HLUA 1RTJB 5KFQA 5T41A 3EXCX 4XPEA 3JSMA 5KAKA 3KHGA 3KLIA 5J2MA 4JI0F 2C28A 4UUWA 2ROEA 2VC1A 5CYMA 1N5QA 2O67A 1WD6A 2XG8A 1QVFR 2MQMA 4BHQA 5HMXA 4G3IA 1RT6A 3I96A 4ZPAA 2X1FA 2D3ZA 4LFCF 3J7YU 5L1JA 2QSFA 4N8OA 2W8KA 1PO6A 2XSFA 2DHAA 3IR7B 1S6PB 1LWCB 2C3UA 3M6UA 2J7UA 4BC7A 2V4QA 1S10A 5M2RA 4X4SA 1HBMB 5F9NA 2COLA 2JEIA 3B4DA 4OX8A 2OTLS 3A8EA 2GX8A 3N6MA 1AW0A 4PKDB 2YKNA 3TUIC 4WYWA 4YY3F 3BQ1A 1VQNS 1KONA 4GO5X 3MTKA 3M32A 4CNZA 4OJ3A 1CPZA 1IQTA 2HG4A 2ZH8A 3HX9A 2C22A 1QAJA 1IKVB 2DPIA 2BANB 1ZTTA 2OPSA 2GQ2A 3UD4P 1UETA 2QMWA 3LP0B 1HBUA 2EWHA 1O8BA 1N5SA 5J2NA 3FQKA 4IH6A 2KHDA 3WC0A 2M8DB 3HJFA 4WZMA 3DYAB 3NAIA 3PACA 3FMWA 1KQFB 5HO4A 4ZPBA 2LVWA 1DTQB 1G3OA 4N8NA 4AYBD 1QE1A 1VBYA 3PW5A 2DNOA 3IAS9 1CEZA 3D1HA 1FO1A 2DGQA 4XPCA 1S1WA 2PC6A 1EETB 4RKUC 3D5MA 1L3SA 2M2BA 3BEGB 2DNRA 4K50A 3D0GE 3MMAB 1C1BA 1JLCA 2ZBCA 3F56A 1PC4A 5B0EA 1VQ8S 1IUJA 2EK1A 4NL5A 4R8UB 2XCAA 4TY9A 1X4AA 2DR5A 5EN1A 1VQOS 3MM7A 2WK4A 1Z4UA 3FZ2A 2AU0A 2JVOA 1RTIB 4KB7A 5B0FA 3R1LA 2AV5A 5F9LA 2MGZB 5KFBA 1R8CA 5CQGA 4Y6IA 1UEUA 1H7WA 1XMOF 3DLEA 4LFBF 4O3OA 1HBOB 2YWFA 3SV4A 2LECA 2V5HG 3AB2B 5DRKA 4LVOP 5DG7A 4RNFA 4ZPVR 3J7ZT 2W8LA 2XB2D 3UFCX 4HVZA 1VC0A 1I1GA 2WRMA 2DNMA 2J6SA 1RT3A 4DL7A 3K5MA 1BWEA 3C2PA 2QT7A 4DL4A 4F4XA 1RI7A 2HNZA 3E51A 3HVTA 2AYMA 3I4PA 2ZH6A 3VAJA 4DR1F 4H4OB 4LF5F 1KHWA 1Q78A 3OXLA 1FE4A 4MTPA 4TYBA 1VBZA 2ZVSA 4PXCA 3EUNA 1FDDA 2PD1A 1O5JA 5KG4A 4G1PA 3QJJA 5C24A 3V2UC 1FNOA 4X4UA 3DN9A 3KFWX 3CIZA 3TX8A 4O0IA 3CEDA 1KC8T 3ISZA 2RU3A 4RUCA 3T3FA 3MMBA 2PGCA 1CQNA 3V6HA 3MOZA 3KLEB 1HARA 6FD1A 2DRAA 3T6JA 1VQ5S 3ZZPA 1U6BA 3BF4A 2JLGA 1RT5B 5IZHA 4DV0F 4I2PB 5F0WA 1HPZB 2WB1D 3OTOF 2AJ4A 2DNQA 3WZ0A 4C2MA 2J6TA 4RW6A 3MPWA 1XWLA 2LA6A 3P3DA 5EHHA 4ECTA 4B3TF 2E5GA 1R89A 5CH7B 3TOQA 4F4YA 1KNZA 4OHWA 1ZETA 5GAHU 3OBIA 5K8MA 3CC2S 4FBUA 2YH0A 1WACA 3ZFVA 4CT8A 4UUXA 3PO5A 4Y3CA 5IQ6A 1SUQB 1XBWA 2QSWA 2O5DA 2XMMA 3HVWA 1NK6A 1AXQA 2YNFB 3HP6A 4NLGA 4N41A 5A8KB 3LAMA 3KK1B 3GIJA 4I6WA 4JI6F 2MZRA 1NK9A 2E1AA 1S1VA 3V4IB 3R1HA 4DWIA 3FSYA 4RW4A 2A10A 4IO9Q 1VQMS 2LXFA 3FRYA 3H5UA 2V94A 3N5BA 5KT6A 4DSJA 3MAHA 4DQRA 2I8EA 2Q1LA 1N54B 2D1CA 5J2QB 3L95X 1X5OA 3DLKA 2FJBB 3K8WA 1ZOTA 4DF4A 1S9GB 4A8SA 2WOMA 3DDKA 4JI4F 1TL3B 4B3MF 1HWJA 2VFRA 2I2YA 3M9NB 4F2SA 2M0GB 2FJAB 1N36F 1Q7YT 1Y00A 3BSNA 1N8RT 4A8FA 4MAKA 3QGHA 3GV8B 2CJKA 3T6BA 4CZCA 2CQ0A 2IJFA 3WBZA 4ERDA 2YNGB 1JLQB 4DEZA 1N4LA 5LJ5Y 1LKZA 3PO4A 4CO3A 2OTJS 3OW2R 4HLBA 1DFDA 1N5VA 1TUVA 4NCGB 3SDEB 1N32F 4DQSA 1WTFA 4Z37A 3UR0A 3OL8A 4OFZA 2GJ2A 4ID5A 4B17A 2IAJA 1FKAF 3S6EA 2M8HA 4YQWA 4MKAA 4O3PA 4WCEQ 1JLBA 3DOLA 3RAXA 4O44B 2D74B 3RR7A 2V8HA 2YWKA 4X4OA 3ITHB 4K2XA 2JEJA 1R8HA 2Q6CA 4OZNA 1NJWA 3IBWA 4BCAA 3VAGA 3IAM9 4KHRA 2DD8S 1GQEA 3FJ2A 3EX7B 3KLIB 4IFVA 1RKJA 5J2MB 1G2EA 3DLLQ 4DL5A 2FY1A 3D2WA 4MIBA 3NKYA 4KPYA 5CYMB 2NUHA 3QZ8A 2FGCA 4TQSA 4JYAF 5J1EA 2XLKA 3FMBA 2M4MA 1X9MA 1TK8A 2KXNB 3N6LA 1KTVA 2W7OA 3PRDA 1RT1A 1KN6A 3D54A 3O2IA 5A6PA 2KDOA 4EUVA 1C2PA 3OVAA 1QVGR 4CO2A 1KOOA 1YJVA 2P9EA 3BGRB 4OL8A 4H4MB 4CO1A 1NJXA 1JNZB 1ZTWA 5DDQC 1FESA 2XMUA 3NCPA