1YJ9S

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yj9S00
1M90T 3SMZA 3G96A 2KM8B 1ZH5A 3S01A 1HD0A 2LEAA 2XNRA 1WG1A 3TO8A 5IQQA 2D9OA 2KHCA 1X0FA 4Y0FA 1IQTA 1X4HA 2U1AA 5IM0B 2M4MA 3MD3A 2MZJA 5BJRA 2DNPA 1WI6A 3CCQS 2ZJRQ 5GAHU 2DGOA 2KVIA 1WF1A 1NJIT 1R8HA 3SDEB 4W90B 2MJNA 2MZTA 1JJHA 2MY8A 2KH9A 5CXTA 1RK8A 4WFBQ 1KOHA 3RW7A 2YH0A 2CQPA 4QQBA 4LJMA 2ERRA 2N82B 3CCUS 2KU7A 2CJKA 1YJ9S 2L41A 1UFWA 2CPFA 1VQ4S 3I55S 2EK1A 1VC0A 2K8GA 2MKKA 4IOAQ 1D9AA 1YITS 3CMAS 3CCVS 2YTCA 2FHOB 2OSQA 1S79A 1M5OC 1UW4A 2I2YA 4QU7A 2LA6A 5D78A 4Y00A 2RVJA 4ZKAA 1U6FA 1U1PA 2OTJS 3MXHP 2E5JA 2M88A 2RS2A 2HZCA 1SJ4P 2OSRA 2B0GA 3G8TA 2DB1A 3HI9A 3P3DA 2MQNA 2ZJPQ 1FNXH 2MQOA 2CPXA 4C4WA 5DDQC 1OWXA 3D2WA 5GVQA 2HYIB 4M5DB 2EK6A 3H2VE 2NZ4A 1DZ5A 2DH8A 2VOOA 1WEYA 2GHPA 2M70A 2RQCA 3PIOQ 4C7QA 2DH9A 1U1RA 1KD1T 2CPEA 2RRAA 2N3OA 3R1HA 2FY1A 3P6YC 4C0OC 2LCWA 2KXFA 2KXNB 2M52A 3THTA 2MZQA 2PEHA 1YJNS 2F3JA 3DLLQ 1X4AA 2DHGA 2DIUA 1VBXA 2BZ2A 3US5A 1SJQA 2G4BA 4PRFA 4WKRA 1SXLA 3J7ZT 3CCES 2DNYA 3IRWP 3G6ES 2A3JA 5MLCV 2RS8A 3CCMS 2E5IA 2D3OR 3JB9k 1FJEB 2YH1A 2E44A 4TU9A 2CQ1A 2CQCA 2LKZA 5GMKa 2L08A 1VQ6S 1JMTA 1X4GA 1WG5A 3G71S 1X5PA 1S72S 3UD3P 2JX2A 1YWXA 2CPIA 2KG1A 3UWTA 2Q79A 1ZZNA 2DNZA 3S6EA 2N3LA 3FEXB 5LJ3Y 4PR6A 1YI2S 3S8SA 1ZZFA 2LQ5A 1QM9A 1WEXA 5DDOC 3NS6A 2MKHA 1HL6A 1VC6A 3B4MA 2MKSA 2HVZA 4Z2XA 2XS5A 1VQ5S 1VQOS 3CCJS 2SXLA 3G9CA 5LSLA 4TU7A 4BS2A 3SDEA 2AD9A 2AYMA 2MPUA 5D77A 5DDRC 4IO9Q 4CQ1A 2GO9A 5LSOA 2MZRA 1N52B 1CVJA 1WEZA 2LA4A 1B7FA 3TP2A 5CYJA 2D9PA 3MD1A 3PIPQ 1W2BR 1VBZA 1VQ9S 2JWNA 5GAGU 1JJ2R 3B4DA 1U1KA 2O3DA 3H2UB 4PKDB 2DO0A 3UD4P 1DRZA 1UAWA 4TLQA 2MKCA 1XN9A 2KN4A 2MZSA 1VC5A 2X1AA 1WWHA 2QEXS 2DHSA 2KYXA 2X1BA 2M0GB 2MXYA 3ULHA 3I56S 2LXUA 1X4EA 1WI8A 1M1KT 3CULA 1U1QA 1QVGR 2VONA 1VBYA 2MMYA 2DO4A 1L3KA 2JVOA 1WHXA 4YB1P 1WHWA 2M9KA 5JVGQ 5LXRA 1YJWS 2I38A 4UQTA 2FC9A 4P6QA 2MHNA 1VQ7S 1U1LA 5DETA 2MY7A 3ZZZA 2RNEA 3MDFA 2MGZB 2DNNA 3CCRS 3BEGB 2LEBA 2E5GA 2AYGA 1VQNS 2MGZA 1WELA 1SJRA 1G2EA 2DK2A 4J5OA 3S7RA 3CCSS 3OW2R 4ED5A 3BS9A 4WCEQ 4TU8A 2DH7A 5H1SV 2MKIA 2MZ1A 1M5PC 1K73T 5DM7Q 2N7CA 5LJ5Y 2CQ2A 2X1GA 1WF0A 2CPZA 2JVRA 2M2BA 3L3CA 2XB2D 1Q7YT 1Q82T 2ZJQQ 3R1LA 2XS7A 2FC8A 3TYTA 5JVHQ 1KQSR 4RU2A 2DGVA 2NLWA 2LXIA 3CD6S 4ERDA 1P27B 5HL7Q 2QFJA 1FT8A 2LECA 3NMRA 4CH0S 2DNHA 2KI2A 1N8RT 2M8DB 3MURP 2MKJA 1WG4A 2KXHA 3VAMA 3U1LA 2CPJA 1Q86T 4CIOA 2MYFA 2RQ4A 1DHMA 3VAIA 2ADCA 1N54B 1PO6A 5ITHA 2PE8A 1KC8T 3P49B 3NS5A 3MUTP 4WF9Q 2CPDA 3R27A 2DIVA 2LMIA 2RUGA 5CA5A 2HGMA 2MQPA 2HGLA 2M8HA 1PGZA 2DNOA 2DHAA 4FXVA 3NNAA 2OJ3A 2CQ0A 3EGZA 1AUDA 1A7GE 1M5VC 1WTBA 2CQ4A 4OZ0A 3V4MA 3CPWR 4IUFA 3N9UC 2YWKA 1WHVA 2DGQA 2L9WA 4QPTA 1SJFA 1D8ZA 1A9NB 4CH1A 3CUNA 2KT5A 4W92B 1BY9A 5DM6Q 4LIRA 1FXLA 1U1MA 2DNGA 1HA1A 3K0JA 1KOOA 3G4SS 1VQMS 1VQPS 3CF5Q 3CXCR 4OZ1A 5DDPC 2E5HA 3BO4A 1H2UX 1H2TZ 3P5TL 4A8XA 2OTLS 3LPYA 2XS2A 2FPHX 3MUVP 3VAFA 1VQLS 3EX7B 3VAJA 2WBRA 3UCGA 2ADBA 3RW6A 2CPYA 1HD1A 1NU4A 1RKJA 1U1NA 3VAHA 3CMES 2CQDA 3ZZYA 2VODA 2DGWA 1OO0B 2DNMA 2UP1A 2J0SD 1FHTA 2CQGA 2MJUA 1DBDA 3BO2A 3UCUP 3MOJB 5FJ4A 2CQHA 5GADU 2DHXA 1U6BA 2CQIA 1X4CA 1URNA 4U67Q 2F9JA 3VF0B 5GAEU 3Q2TC 2VOPA 1UP1A 3NNCA 2J76E 1WF2A 2KRBA 2CPHA 1FJ7A 2G1DA 1OPIA 5LXYA 3CC2S 4F26A 3CC4S 2BOPA 2J8AA 2DGXA 2K3KA 1VQ8S 2J0QD 2MSSA 5EN1A 1H2VZ 5HO4A 3U1MA 4LMZA 4YOEA 2M7SA 1X5SA 2DGSA 5IM0A 2KFYA 3IWNC 1O0PA 2DNQA 2DNRA 4F02A 2HGNA 1X4BA 3CC7S 3MUMP 2MB0B 2V94A 2XNQA 1FO1A 2DNKA 3VAGA 2DITA 1M5KC 2DNLA 3FEYB 2X1FA 3VAKA 2LYVA 1Q81T 2CQBA 4YUDA 2RU3A 3CCLS 3VALA 1YTYA 1VQKS 3G8SA 2KM8C 2QA4S 3LQVA 4V19X 1X5OA 2AYBA 2MSTA 3DXBA 4EGLA 1YIJS 1U1OA 3UE2A 1WHYA 3THPA 1R8PA 1H6KX 1F9FA 1QVFR 4FXWA 5IFMA 1N88A 2AYEA 1FJCA 4WFAQ 2KG0A 2OIHA 2RRBA 2KRRA 2MQLA 3HHNB 1X4FA 1K9MT 2RT3A 1JJ4A 4WIIA 2DGUA 3J7YU 2DISA 2DGTA 4UY8T 3CTRA 1SJ3P 2U2FA 3MI7X 3SXLA 3NNHA 1OIAA 2G0CA 1X4DA 2JRSA 2XSFA 2F9DA 4IOCQ 2MQMA 1YHQS 1X5TA 2CQ3A 3EGNA 1K8AT 4WFNQ 3UCZP 4F25A 3BO3A 1P1TA 2YKAA 1U2FA 3Q2SC 4QU6A 2MQQA 1NO8A 2EVZA
chains in the Genus database with same CATH superfamily
1TELA 4ECVA 4CO5A 3OFFA 2DJWA 4YR3A 3Q0AA 4DDFA 1C2PA 4Q43A 1D8YA 1EZZB 7AT1B 1IJEB 5DLFA 3D28A 2DPJA 4U7UK 3BGRB 3CO0P 1QY7A 5D0RA 4EMDA 1RT2B 1TKTB 4P9SA 2Z30B 1F9HA 4TVAB 4DV3J 2EC2A 4ECTA 3BSAA 2GJFA 3ITHB 1HD0A 1GXTA 1QAIA 3AXKA 3C6UA 3MHYA 5ETLA 3KNAA 1TV6B 2LEAA 2ZVSA 3NCQA 3DKDA 2A0FB 4IFYA 2XYPB 5B0GA 2XNRA 4NL5A 2E9ZA 2ALZA 3M8PA 3KLHB 4C6AA 1WC5A 2ZC4A 2RDJA 2ZH4A 3TO8A 4LSNA 1T05A 2BYCA 2D9OA 2KHCA 2RUSA 1X31C 3QGIA 4OYIA 4TY8B 2XMVA 1X0FA 1UVMA 2IY5B 1X4HA 4NLPA 1UL3A 3Q89A 3KLFB 1UMJA 4ICLB 1V3SA 2M4MA 1XNRJ 3BBBA 5BJRA 5I3PA 5CYQA 4KQZA 5JUMA 5KFCA 4X4TA 1RWUA 4KKOB 3VHQA 2R2SA 2DCUB 1DQ9A 2AMCB 4LSLA 4BC9A 1S77D 3NOCA 4USJC 3O5TB 1YBTA 1PBAA 4Y2MA 5GAHU 2B9WA 2DD8S 2DGOA 1S9GA 1JLBB 2LQBA 2E9RX 4X4SA 1S12A 4U8YA 5GMEA 4RW7B 1NJIT 4LF7J 5F8JA 4W90B 2XY5A 1UVIA 2MJNA 1APSA 1UKUA 4PQAA 3KUGA 1KBRA 5CXTA 3PO4A 2CVEA 4KHPJ 4WFBQ 2RQMA 2XGPA 4B3SJ 4AQYJ 1JKHA 4G65A 4PPDA 2LDIA 3OJSA 5E3AA 2WOMA 3H90A 3M32B 2N82B 5ETNA 1S6QA 3MF5A 5FLXY 1CJUA 4YP3A 2CJKA 3M8SA 1YJ9S 3NGRA 5AXLA 3R5AA 2L41A 1W7WA 1RZMA 2EG1A 3N6MA 3OFEA 3KLGB 1OJ4A 2E5LJ 2IBKA 2MKKA 4IOAQ 2CG4A 1YZ7A 3KG1A 3K58A 3MPVA 2HK2A 2VFTA 2ZNYA 3CMAS 2LQJA 3GYXB 2J6TA 1RT4B 2V9KA 1M5OC 3DHXA 4IFVA 2CG8A 2YX4A 3G8QA 4P2FA 3KDOA 3AJ2A 4LREA 1KWMA 4TQRA 3GE9A 3QSIA 5D78A 2FVQA 3IG1B 3AY0A 4YMEA 3EICA 5DGBA 3BDEA 2QLXA 2E5JA 2M88A 3A8IA 4ED3A 2D3UA 5K8OA 2YQ0A 2HZCA 1YQHA 3QGGA 5ETQA 2XC9A 1S6OA 2OSRA 2Y1IA 3D7SB 2YNFA 1TZ0A 2B0GA 3IS9A 3MM5A 4L76A 3JTOA 1F5AA 1F0XA 2K7KA 2MQNA 3WX8A 4CI0B 2MQOA 2FVCA 2ZJPQ 2RILA 4OYZA 5KFUA 3MFHA 1FNXH 4C4WA 2X51A 1VBKA 1AW0A 2HFZA 2KKHA 4F4WA 2YKOA 3RB6A 1IVZA 2BJ3A 1V9OA 2EK6A 2FGOA 3H2VE 4Q0BB 4FVMA 2V8PA 2GQCA 5KT2A 1WEYA 4CT8A 2GHPA 4UTGA 3QJLA 3QRQA 5GAHI 1U1RA 4B9MA 2CWKA 3UDLA 3VVTA 3ZTRA 4ES1A 1FI4A 1FRXA 2CPEA 4KY3A 4ZPCA 5LL6d 5BR8F 3E2EA 3R1HA 3GYGA 3CDAA 2H54B 3P6YC 1RYSA 1U0HB 1FEHA 1B70B 2M5YA 2KXNB 1KR4A 3VTIA 4Y2CA 1HHQA 2XY7A 4ZMMA 3GFXA 5AJ3F 3EYZA 1X4AA 4KGKA 2VKRA 1HWJA 2DIUA 3DYAA 5K8MA 4NMXA 1WDTA 4DUZF 3A1YG 3GFYA 3IAM9 1VBXA 4V19J 1Q95G 3QRPA 2E1AA 4PRFA 4K4ZA 1ITPA 4WKRA 3JSMB 3D6HB 3U02A 3ILLA 4F4KA 3GJSB 2WSFC 4NLOA 4DV7F 3IRWP 4KT0C 3TX8A 5F8IA 5B0FA 1WNEA 2FJDB 1TL7B 2W7AA 3G6ES 4KV8A 1IJFB 4O44A 3UN2A 4DR7J 3VGTA 2A3JA 2BE9B 2RS8A 3M6VA 4KO0B 1SCJB 1HNWJ 4DJBA 2E5IA 3DDIA 3GWCA 3QPIA 1Q5YA 4LRDA 1WOOA 3L95X 3DLEA 3WBZA 2D3OR 2YH1A 2E44A 4A48A 4TU9A 1Q53A 4I0WA 2CQ1A 2CQCA 2DT9A 2ZBCA 5J1PA 1LWEB 2UUTA 5E33A 2P5VA 4N8NA 4DL4A 5ETOA 1X4GA 1WG5A 3H4BA 3LOUA 4WXWA 2VFVA 1N5YA 3DRXA 2VC1A 1IBMJ 4NLDA 5HVGA 2KZZA 4ZA1A 2B6AA 4M5HA 3AT1B 3OHAA 5LMUF 2R8JA 4IFYB 3K0JA 2GVDB 2QLJB 4M5LA 5C42A 4RJVA 4MTPA 4JI2J 2OLWA 1RBLA 1J5OB 5T7LA 1RHJB 1I3OB 4HI1A 4OV1A 1FKOB 5B0DA 1YI2S 1FF2A 2LQ5A 3IBCB 5T14A 4G1IA 1JLEB 3IM8A 3MMAA 3F56A 1HBUB 5KFVA 5MAOA 2L9NA 1S4FA 5KFFA 3AAWB 3F44A 2MKSA 1NAQA 1JNZB 2LU1A 2QO3A 3DGPA 1BQMB 3ETOA 4UF4A 2V5HG 3NRBA 2G1HA 2QA2A 3L7PA 3ET6B 2OHDA 2HLTA 3UDCA 1UVLA 3G9CA 2Z0GA 3FC9A 4EO8A 4FYXB 4DX5A 5LSLA 4J9PA 5DJBA 4B3TJ 3HXMA 2HK3A 3SDEA 4DN0A 5KFXA 1O51A 1SIWB 3HZEA 3NXZA 3VGSA 4RW6A 3T1HJ 5DG7A 3ZFVA 5ETMA 2Y8WA 2MZRA 8AT1B 5K8NA 4GRSA 4OJGA 2HRTA 4CLYA 1PILA 3KUHA 4YHHF 2I0XA 2F5GA 4D3GA 4JI8J 3M05A 4ZVPB 4URSA 4UT4A 2XY6A 2A6OA 2HNZA 5AE3A 4C8KA 1N6QB 1VBZA 3VQTA 2GX8A 3NGTA 5GAGU 2R7XA 4C48A 4A8KA 4DXLA 3I9ZA 3PYGA 4U7CA 2FTRA 3J80U 1DFDA 1PBUA 3B4DA 4WXOA 1HMVA 1YBAA 2RRNA 1QAYA 1SH0A 3OXGA 3LP1B 4DF8A 4C3KA 1IKWB 4EUVA 2JEJA 1CPZA 3KTQA 4NXMF 2C2DA 2HBRB 1X9SA 3QO9A 4NA2A 3QFHA 4ILLA 1S99A 2IM3A 3H2UB 1VK3A 2F8HA 4OI3A 2DO0A 5E41A 3IC1A 1RAOA 4DQQA 1UAWA 1DRZA 1M1GA 5SUHA 1YKWA 2B56A 4DR1J 4H4KA 4LRBA 4ANEA 2J5AA 1HI1A 2MZSA 3HD1A 4DV0F 1VLYA 4HACA 3FUYA 3HT3A 5IWAJ 1WWHA 4C0BA 3EPIA 3UW1A 5B0BA 1VC5A 2GW8A 1C1CB 2QEXS 4PXBA 3PTWA 2BA9A 2DHSA 2EW9A 2G2YA 1IXKA 2ASYA 3O8WA 4HDHA 4DCPB 3QGHA 2V2VA 3LUYA 3ULHA 2MXYA 4RW8A 1Q7LB 3NGDA 2LXUA 3I56S 1WI8A 2DXEA 4JI8F 5A2QU 3M1VB 1D9FA 4DQIA 2B5JA 5D0EA 3CULA 1QVGR 1JLQB 4H54A 3GV8B 3GR0A 4YS2A 3PV8A 1DTQA 1Z1ZA 3FDSA 1C1BB 1GXLA 4Z7YA 2BX6A 2PFFB 3TAMB 4RNOA 3I82A 5J2MA 5HLFA 2UXCJ 4QYZJ 2C3OA 4NEZA 3GP9A 4QYRA 1QSLA 4WBFA 5JVGQ 3LWLA 4UQTA 3MM9B 1H7XA 1FEEA 1D0EA 1CG2A 1VQ7S 1U1LA 3BN4A 3M2UA 5AXMA 3UN5A 5DO2A 2RNEA 3ZZZA 5DETA 4F7VA 2OEJA 2V68A 3GJRB 3MDFA 5D4PA 2YKNA 3BZQA 1CULA 4RUAA 2MGZB 2FLLA 4RLEA 4O3QA 1Y4ZB 2G0IA 3R5DA 1UZDA 2D7SA 1SPBP 1VRUA 2E5GA 1RU2A 2POKA 3BEGB 3JXOA 3P8BB 3VGVA 1VQNS 2V8VA 1SJRA 2DK2A 4CO1A 2IJFA 1HQEB 1NDCA 3QQCD 5BYRA 3S7RA 4EI2A 4WCEQ 4ED5A 2RB7A 3CDWA 2IC3A 3TZYA 3J81U 3BQ1A 4MFBA 2Z2MA 4PG6A 5H1SV 2J6SA 3D3BJ 3DOLB 3R5CA 2MZ1A 1HR0F 2OEKA 1IM6A 1QAXA 3AA8A 4QR2A 1K73T 4B9UA 3HSJA 1UVJA 2HVEA 5J2PB 1KSPA 4O3OA 1BWVA 2N7CA 4ZVFA 3MR6A 3PY8A 2UXCF 2QYGA 1B4SA 1LW2B 3GCXP 3TX0A 2HVDA 2CPZA 1JXVA 3MEKA 5CYQB 3L3CA 4CNYA 3MEGA 1Q82T 1IKVA 4R0JA 1FFWB 3OTCA 1T9TA 3DLJA 5IS2A 4I1TA 1TR0A 2W2MP 2GHWA 4GMKA 3KLEB 4ER8A 4WFYA 1RTHA 3MEDB 4QIVA 5JVHQ 1TKDA 1SKRA 1KQSR 1F6TA 4KFBA 2IBOA 4DV5F 4ERDA 5KFKA 1N32J 1HW9A 4CH0S 2DNHA 2O66A 4ZPDA 3PFOA 4EU0A 4ETZA 2M8DB 2CRLA 2GC8A 3LALA 2VU5A 4JB8B 4HHJA 2QSFA 1XMOF 4OV6A 2HAFA 1GMUA 1RABB 2DR6A 3BM7A 3KJVA 2CKWA 4IH6A 1Q86T 4CIOA 3JYTB 2FVRA 3RR8A 4DR4J 3MCSA 1DHMA 1U2CA 3ENWA 1N54B 3VAIA 1HBNA 2P2CB 5KFYA 4OI1A 4AD6A 4F2SA 2EKNA 4UOGA 2HAIA 2XZTB 3HZGA 5ITHA 4J37A 2EBGA 2MLXA 5ETRA 1HBUA 2ZC3A 3MUTP 2DBBA 3A3OB 4JV2A 4ZITA 2LMIA 4FBTA 2MEWA 3D67A 5CA5A 3KLGA 2YPZA 3TVYA 1BWEA 2HGLA 2DNOA 3ET6A 4OFZA 1FVQA 4FXVA 2W9BB 1UFKA 2W8KA 1NK7A 1NRKA 1PC4A 2B7CB 4LF1A 1YX2A 3MM8A 2FUG9 2AZ3A 2HFUA 1DQAA 3MMCA 4PQUA 5D6GA 3PHEA 1ROFA 4LBIA 4OX9F 3OVAA 3L7UA 4DUYF 3T1YF 3GIKA 2UVUA 2XBPA 5T41A 3V4MA 3HSGA 2RSQA 4FXDA 4J9QA 2YWKA 3DRRB 1WHVA 1RBAA 4QPTA 4DSEA 4UOCA 5LM7E 1YGYA 4KHRA 2W9CA 3J7A1 3NCPA 4NMLA 4M5DA 1EP4A 1YRUA 2BKPA 1RT5A 3KXDA 3PEJA 3WIVA 4BCAA 1BY9A 2C2RA 4WFZA 4LIRA 1QE1B 4ZVGA 1BHNA 1R6VA 2GZOA 3IS9B 3MMBB 3MM5B 9RUBA 2ZH9A 4DQPA 4IR9A 1XR7A 4PG8A 2EWHA 2CUYA 3G4SS 1WC4A 4GVBA 4I7FB 5KT6A 3GV5B 3PW2A 1VQMS 3P45B 3PZPA 1S4EA 2AEFA 2AJ4A 2E5HA 2FHJA 4USMA 4JI7F 2NS1B 3UVJB 4M94A 4A8XA 1ZOTA 1FX2A 2XULA 4JI1J 3LPYA 1VCTA 3VAFA 5HSPA 3QO9B 1D9DA 3CJ8A 2W25A 2YWHA 4N8OA 5KFSA 5A6WA 3F0NA 4MIBA 3TZWA 3RW6A 4NPOA 5F9LA 1FTCA 4P10A 1U1NA 4X65J 2QRRA 4ECUA 3LAMA 4CO3A 4DHVA 2KVQE 2QL9B 5L1LA 1HNXJ 3CMES 2BJ1A 1JIHA 2CQDA 2Y1LB 5ETTA 1GX6A 3SQOP 3CNQP 2DNMA 1HQUB 2QIFA 3H59A 3OLAA 3OL7A 2J0SD 1FHTA 2CQGA 2MJUA 3I32A 4CTAB 5A0YA 1DBDA 3BO2A 2V2ZA 2B5JB 5KG5A 3U7JA 3UCUP 1UZHA 2XMWA 3PVXA 3K5LA 5AE1A 1JLQA 3QT7A 4DV1J 1BE4A 1VHIA 5FD1A 9ATCB 3MR2A 3ZNUA 3W2VA 2H65B 1XERA 1RDRA 1GMWD 2HFOA 1TL7A 1S1XB 1X4CA 4I2QB 4RW4B 3K17A 2NZCA 1BMQB 5J2NB 3GIJA 3SI8A 1URNA 3NKYA 5J1EA 3QBCA 1KDNA 2WRMA 1BC6A 4QIFA 3Q2TC 3L4BC 3HM9A 1UP1A 2XLJA 3C46A 2RF2B 1SH2A 1WF2A 4NCGB 2B43A 1NK0A 3BGLA 2F4VF 2J9CA 3HJFA 5HMZA 4F26A 4F4AA 3CC4S 1LFPA 1Q78A 3DLHA 3R6GB 2BOPA 1KHVA 2J8AA 1N5YB 3GZ7A 2ZUAA 1I51B 3SSRA 4B3OA 2Z4PA 3FBEA 2A18A 2MSSA 4K4UA 5EN1A 2HHUA 4P72A 3IWLA 4OZJA 2HWHA 2VBZA 3A3NB 5KFLA 3HK2A 2DGSA 2IIHA 4DR4F 2GAHC 1O0PA 4L3NA 2HGNA 4ZN1A 1VGYA 3CEDA 4OQJA 3CC7S 3MUMP 1U2RA 2XLKA 1HWKA 2H5EA 1HNIB 1EAYC 1KP6A 1XMBA 2V94A 3MMAB 3ZZUA 1FO1A 4ZLJA 4KRWA 1MW7A 1LW2A 1RCOB 2DITA 4H4MA 1SV5A 3HHLB 4DR2J 3VAKA 3IMQJ 4F3OA 4DR6F 2HFSA 1S9GB 1Q81T 2GMHA 4JI6F 5BXIA 4X4VA 3CCLS 1NK6A 4RW7A 4J9RA 4PWWA 4JI0J 3QAEA 3DRPA 3H8YA 5I4MA 3G8SA 1RBOB 5CCMA 2VJVA 3ZTQA 2OPQA 3J7YI 4V19X 4WE1B 3DFEA 1KQKA 4EGLA 2QZ8A 1YIJS 4TYAA 3MAHA 1NSAA 3LP2A 4PG7A 3FFIB 5F8LA 2HHSA 1FDDA 5FIIA 5GAGI 2BJDA 3THPA 1M5SA 3PW5A 1S97A 1LV5A 4FNHA 3D54A 4WP9A 3M8QA 4FXWA 3WC0A 2ZH1A 1X9MA 2UUWA 4JOUA 2J7WA 1VIOA 2F8MA 2NSCA 1RT7B 1LWFB 1WDDA 2AYEA 2W4DA 1FDNA 3HVWA 5I42B 3K57A 3TANA 1DARA 1ZS6A 2MQLA 2RRBA 8ATCB 1NHUA 2P8IA 3HHNB 2RMLA 4OYPA 4FYDA 5CYMA 2CIMA 4RZRA 2UUAJ 3GFZA 2BE7D 1EQ0A 1BXNA 1U0HA 2PEBA 4DR2F 4RU9A 2VPZB 2XMKA 1JK9B 2K2PA 2ZVIA 3RZAA 4MKYA 2QL5B 3NNHA 3HVTA 1R3NA 2XI2A 2G0CA 2BJ8A 2AGQA 2VG6A 4CM2A 2QYCA 4OI6A 2MQMA 4I6WA 3W63A 2CQ3A 2EFVA 5KG7A 1N0VC 1U8SA 1FK9A 1YVFA 4HACB 4WFNQ 1QSYA 1HNXF 3UCZP 2OPRA 3TUZC 1EX8A 1Y7PA 3A4TA 3I0RB 4KV8B 4ETXA 3G2XA 2ZOGA 3H5SA 4LRCA 3LW5C 2FC9A 3T5LA 4QU6A 1RB0A 1IBMF 4WF9Q 1E6VA 3CJ5A 1TAQA 2JC1A 2C2OB 3Q86A 2E1RA 2FYXA 4PZVA 3G96A 3RB3A 1DTQB 3PM9A 4NASA 5DG8A 2KM8B 3GPAA 5D4OA 4ZVRB 1TV6A 2DXFA 2HQFA 4FDFA 3HP6A 1CJTA 4LRAA 2PGCA 3QWPA 2HIQA 1YJUA 3KK1A 4BHQA 3ZC4A 3CJTA 4MIWA 5CD4H 1DY3A 2VKZG 4NEYA 3R2DJ 1LW0B 4USTA 2MTLA 2WHOA 5C42B 2HHVA 4J90A 2XI3A 3DOKA 3QT5A 1YJTA 3GTYX 3Q8QB 1GEHA 1ZA2B 2BE2A 3EVOA 4KSEB 1XR6A 1IQTA 1MMDA 4DPOA 3JSMA 4FS2A 3T5HA 3THVA 3HJVA 5IM0B 5DRKA 2HQCA 1GK8A 4DLEA 2MZJA 2FLNA 3AOBA 4K59A 1NM2A 2Q1LA 1QDUB 3DGPB 4DUTA 3PX6A 2HZVA 2F1FA 4DSFA 2IC3B 3DLKA 4MFBB 4MK9A 3B54A 4A8FA 5CH7B 4LF5J 4RW4A 2KVIA 4I2QA 2E7VA 2KJVA 6FD1A 3KYLA 1OY9A 3NWRA 1FXDA 1PYOB 2W2PP 3SDEB 4ID5B 2NPFA 4DR3F 2R7TA 3RG6A 1JJHA 2HS0A 3JQJA 3PX4A 1YRTA 2MY8A 4ELUA 3UDVA 2KJWA 2KH9A 3KHHA 1IKVB 4KGMA 1NZ8A 1P6TA 2DY1A 2W1BA 3OR2B 3R5JB 5CQGA 4USVA 3RW7A 3OSNA 1MROA 3RBEA 2J6UA 1AFJA 2PA3A 4OJHA 2OFGX 3GV7B 2GVDA 1VK8A 2C1EB 3PG9A 2ERRA 2GNKA 1VHFA 1NB2A 2A10A 4NI2A 4YN3B 5IV3A 2HRYA 2BJ7A 2BOAA 4OYMA 4FBUA 4AXIA 4M8LA 2CPFA 1GMVA 4OHZA 1CJVB 4DSJA 1S49A 1T9WA 3MPUB 1YITS 2BEFA 4HVZA 1HBNB 2P9EA 5HMWA 1QUPA 1EETB 4YY3F 3Q8RB 1UVNA 4PWDB 1B7YB 3JSYA 3NOGA 5F41A 4C98A 4QBUA 3SQGB 4N56A 1TUWA 1LXNA 2YNIA 3RB0A 1LK5A 3TW0A 2I2YA 4QU7A 2LA6A 4LR8A 1SKSA 1Q5VA 4TY9A 4M5IA 2RVJA 4EK2A 4ZKAA 3MXHP 2ZZTA 2EFPA 1HBMB 1QJHA 2IVMA 4Y28C 3QJPA 3HD2A 1JLAA 2CXEA 2C42A 1XJWB 1XTZA 4GVLA 4CLUA 2ZEJA 4XDCA 1FWPA 3U27A 3WC2A 1TFWA 1FWKA 2DB1A 1F5BA 1Y00A 3MPYA 4N41A 2B7BB 3FSXA 4C8NA 4JV5J 4I6YA 5DDQC 5IOLA 1M5HA 2HBQB 3LTOA 3NLCA 1YSJA 4I56A 4F0MA 1SKWA 1IKYB 3HVRA 3QRRA 4M5DB 1S10A 2F8EX 5HLFB 3T9ZA 4OX7A 3W1YC 1VQSA 5A8KB 2XGQA 2DH8A 3QLHB 2RQCA 3BSCA 4C7QA 2YNHA 2DH9A 2EPIA 3BV8A 1IKWA 3PRVA 1KD1T 1GNKA 4YOEA 1UA1A 1NXIA 3GCWP 5E2QA 3W62A 5IT9Y 1V3RA 3PKYA 2FJBB 4AFFA 2IAJA 4H4OA 2R7VA 1RT1A 3KWMA 1NKBA 2M52A 2IM0A 4HT5A 3CIMA 3FRYA 3I5BA 1FRJA 1TL3B 2CZ4A 2PEHA 1LWCA 2WONB 5HROB 1R0AB 2DHGA 3IR6B 2EFGA 2DR8A 1U09A 4PUOA 1Y5NB 1KKHA 2IA0A 2Z56B 3IBFB 3CJ3A 3US5A 2JLGA 1QLNA 3MWBA 2GVZB 3PRDA 3J7ZT 4F4ZA 5EHHA 1Q16B 4X62F 1U24A 2V8DA 3NL0A 3OT9A 3PW0A 2Q6BA 4LQ3A 2EC0A 4ZPWR 1LKZA 1D09B 1RQ0A 2G13A 1UWAA 2VPXB 5CHCB 4CLLA 2VQFJ 2GIFA 3UNGC 4IOBA 4ZPAA 4L73A 4O4GB 3HF5A 2RJZA 4DL2A 4DR7F 2V8HA 2ZHAA 1C0UB 1C0TB 4KFBB 2XYGB 1JMTA 4KAIA 3C15B 1X5PA 4AL6A 4K2XA 2JX2A 1S72S 3DC2A 4FZVA 3JTPA 2ACYA 1TL1B 3FQLA 2BXJA 4X66F 2Q79A 3GIMA 2IHR1 3S6EA 2JEFA 3KOAA 2WTFA 1JQGA 1FFGB 3FEXB 4ZLLA 2B4PA 1QAJA 1BGXT 1PKUA 1S0NA 3IP0A 4NA3A 1KTVA 4ECXA 4LF7F 2O01C 2HRUA 3S8SA 4TKTA 5LMUJ 1MMLA 1YBUA 1JB0C 2W4CA 4FF3A 2CNOB 1T3OA 3T1YJ 1HIYA 2MKHA 2YWFA 4KE5A 2IPOB 2BABA 4CO4A 4PXEA 4ZCIA 4ECQA 2HVZA 1YJVA 2FGCA 1VQ5S 1FDAA 2PFDA 1HFEL 4L75A 4USKA 4G3IA 4UY85 4DQSA 3J7AN 2E7XA 2YX1A 3ETMA 4QCLA 3M9MB 4A8WA 3RBDA 3M2RB 4P73A 2SXLA 3PJWA 2QJ3A 1WJ9A 3MEGB 2NYHA 2ZWOA 2XZWA 3TA2A 2DVIA 4Q8FA 1PCAA 2E9TA 3C14A 5HAOA 4LR7A 3TZXA 2GCFA 4X4OA 3KHGA 3IBWA 3W66A 1VS3A 1RHUB 2EI5A 5D77A 3PR4A 1FERA 1XQIA 2ZBQA 5HMYA 5E3RA 2GO9A 4B3MJ 1FNMA 2H51B 5LSOA 2ZBRA 4YFUA 2AEMA 4TNOA 2Z2ZA 4JI7J 3OR2A 4EYHB 2LA4A 2VPWB 1NK5A 1B7FA 1FXRA 2IRXA 1RHRB 2C2ZB 2WVDA 1T3NA 2OI2A 3ENVA 4YR2A 3KKFA 5CYJA 2ZFHA 2ATCB 4P7TA 2BQRA 1X60A 3DI6A 3PR5B 3K8VA 2JNJA 3KG4A 3LP2B 2ZE2B 3O2IA 3QYYA 3FFIA 5C25A 5KG2A 2K1RB 3OVSA 3M9OB 4ECZA 1RYRA 4OYWA 2VA2A 3FCWA 4J9OA 4FN5A 4NA1A 1IR1A 3MM7B 4KB7A 1MWYA 4C97A 2KTQA 2JFDA 4FF4A 4FP9A 3ADAC 3OTDA 4DV0J 3CIZA 2UU9F 1R43A 3SQGA 2YKMB 4DZ6A 2ATLA 1RWMB 4TQSA 4TLQA 1XN9A 2NXEA 3PEHA 2V50A 1S1UA 3SIPB 2COLA 5B09A 1TL5A 1VJWA 2LU2A 3RBXA 5ETVA 2NXCA 5C24A 2MQ8A 4JYAF 3MAAB 4LF9J 5A8RA 4PAAA 4NLQA 2M0GB 1JJCB 3GSDA 5K5MA 3UI3A 4CTAA 5ETKA 1X4EA 3KK2A 1AROP 5J2QA 3HFZB 2HHTA 1WSVA 2VONA 3AA9A 4Q44A 4KGZB 1VBYA 4IO1A 2DO4A 4U95A 3NEKA 4N76A 2KT3A 2MLZA 3M30A 4ZVEA 5L1JA 1L3KA 1RHMB 3W5XA 4C8YA 4YB1P 1FKAF 1VOMA 1OYEA 1IBKJ 5EX3A 3EUNA 3QLHA 3TEHB 3GILA 5GMDA 3KUEA 2VZ9A 1RT3B 4NZ6A 4IR1A 3FGVA 4K2JA 2JLEA 4IH7A 4I6AA 3IR5B 1N34F 2IYGA 2MY7A 2RF2A 3D1HA 4U7UD 3JSRA 3LP0A 1ZBTA 3KNGA 2ZH2A 1RT2A 1TKTA 5ETSA 3PRBA 1RAJA 3R9LA 2HFVA 2FVPA 4B9LA 5H9FJ 4PPZA 1WELA 4DG1B 3O3LA 4RUHA 2BUNA 1FVSA 3POTB 1V5VA 3OW2R 2OPPB 3BS9A 4ALZA 3SV3A 1N48A 4EBCA 2GGPB 2HBYB 4IG3A 3CO9A 4OI4A 2MKIA 5B0CA 2W8LA 1SQEA 1HW8A 1NSKL 4P74A 3QATA 4ZIWA 1R0AA 1S7IA 2XCPA 3EGWB 2BKOA 1IUJA 2J0WA 4DV2J 4CO2A 4A8QA 5LJ5Y 5DM7Q 2X1GA 3ISNC 4EEYA 2VDIA 3W64A 2XB2D 2QLBB 1Q7YT 1S1XA 4CCHA 2Z2YB 1JLGB 3K7RA 2CADA 2ZM6J 2CJAA 1HNZF 2PC6A 4OZ2A 4PYDA 3BGUA 2XMAA 2XS7A 4IYQA 2OPSA 2OMOA 1E6YB 3CW2C 3JTNA 3CD6S 5HL7Q 2XSJB 1JLBA 2UXDJ 1SC3B 2DEIA 2VFRA 2Q3PA 1SQFA 3E51A 2JC0A 2Q66A 3NAIA 1Z2ZA 4RR5A 3BYPA 2HNDB 2MKJA 2KXHA 2PMWA 5L38A 2FLPA 3VAMA 1SH3A 4ED8A 2CPJA 2HURA 2R7SA 1Q1KA 2HSEB 4WP3A 2GQ2A 5IC6B 2PO4A 2Y0SD 3PACA 1PO6A 3EXYA 1LWXA 3R5BA 4Y2IA 2LEPA 1ICEB 2PE8A 2XTJP 1T02A 2HHQA 2A2CA 3ZXWA 4F0HA 2RHSB 1YRXA 2QGFB 3IFEA 3GFHA 2DIVA 4DSKA 4OJ1A 3TZZA 3GMGA 3KFWX 3AJDA 2MQPA 4DFKA 3OTBA 1PGZA 1NJYA 2B4VA 2CNNB 1RTIA 4DZDA 1AUDA 1A7GE 2NXUA 4KGVB 1P9YA 2N4DA 1M5VC 3QT8A 2HG4A 2L3MA 4F8RA 5H9EJ 3M2VA 1AXQA 5KFDA 1N33F 2DEJA 2YNIB 3K5OA 5IV4A 4DV4F 4OZ5A 2WVCA 3GR1A 1WKLA 3OXFA 1CLFA 1AZSB 1N5TA 3AXMA 1A9NB 4OX9J 1NDKA 1HBMA 3HX9A 2ZKUA 3RJMB 4HYKA 4L6V3 4JI4J 2KT5A 1ZAVA 2Z58B 5K14A 4ES3A 1RGVA 2XQCA 2WCXA 3J81j 4M95A 3KLIA 4ZJOA 4QR0A 3TUPA 2A6MA 1PG5B 3PYEA 4NLWA 5F0WA 3UQSA 3BGFA 5M2UA 1VQPS 1KVKA 3CF5Q 1G6BA 1OY6A 3L09A 4OZ1A 5DDPC 3CXCR 5DZ7A 3V81A 1LFWA 1XC9A 3B82A 1H2UX 4E0DA 3N6NA 2HHXA 4C8MA 4C11A 2FIUA 2XS2A 1SBRA 5EDWA 1NDLA 5I3QA 2GMLA 2QFIA 1IBKF 1IKXB 4K50A 3EZUA 4XIUA 3V6DA 2X7IA 2KYZA 3LGMA 3IGNA 2VH7A 3RU0A 3KK3B 1HQUA 1HD1A 1S1UB 1NJXA 2VJUA 4K4VA 4P7VA 4CT9A 5A0YB 4LF6F 3BKFA 3QZ7A 2VODA 3ZZYA 2CJ9A 4HHHA 4LRFA 4IRDA 1LK7A 2DGWA 3GU0A 5HJYA 5LT5A 4WU2A 4P2XA 1XR5A 2P9GA 3SCLE 5KFTA 4URQU 3BGOP 2C2EA 1UPPA 4A47A 4JI3F 4DWIA 3C2PA 2FJXA 3V4IB 5F3ZA 4OYBA 4U96A 2OP5A 1FCAA 1E6VB 1FKPA 3JAMY 1FE4A 4G6VB 3SEOA 4BC7A 1UEKA 2CQIA 1T0TV 2OD6A 3NP5A 4LBPA 3OL8A 1MG7A 3Q8UA 2EKYA 4KO0A 4LF8J 2X3GA 3BGRA 1RT3A 3JAMU 2J8SA 3I6PA 1RTJB 3DLGA 4M1KA 3VF0B 3JS9A 1MN9A 1NPPA 3N01A 5B7WA 5GAEU 4QZVB 3NNCA 1W25A 3HHLD 2AQ4A 4ED4A 2AJ1A 1U6ZA 2CPHA 1KHWA 2ZHBA 4USIA 1OPIA 3MECA 4HH1A 2I5JA 1SL1A 1YLXA 3NGSA 4RBUA 4WK3A 2LQ9A 5D15A 4NZ0A 3BQ2A 1B64A 1XMQF 3QGPA 5EGYA 2J0QD 4LSNB 4MYTA 1R8CA 1OQ3A 5C5JA 5EWEA 3LWMA 1TQLA 3T5JA 2OPPA 3PJ9A 3D0IE 4C8OA 4LMZA 3M6UA 2HMIB 1IM4A 2CA9A 4ES2A 2KFYA 1S59A 3WZ0A 5IXUA 3Q23A 2BRKA 4G1QA 4A8YA 3J7Z5 2YWEA 4XAKA 2WB4A 1Y0HA 4OHWA 4JI6J 3G6XA 3ICLA 4QWDA 2LFVA 3WX4A 2MB0B 3BH7B 3FEZA 4QYZK 3I87A 2HHWA 5F8MA 4PG4A 3FEYB 2C3YA 3MCOA 2X1FA 2LYVA 4OZNA 2EG2A 2RU3A 1YTYA 3OVBA 1K1SA 4ID5A 5C2GA 4QJVA 3GJQB 3NBPA 2KM8C 3ELHA 3MEEB 3LQVA 5L46A 3KG0A 4B9NA 4LBHA 5KG3A 4MKAA 5A76A 1HLWA 2JLFA 3EJMA 4JI0F 1TKXB 1OYDA 5DS7A 4OX8A 1NLKL 1TKZA 4ZVSB 1U1OA 4CO0A 4DV4J 3I0SA 1NHVA 1SB6A 5LOQA 3ZTPA 5L1IA 1CJUB 7FD1A 1H6KX 1F9FA 2D74B 2FLOA 1FWLA 5IFMA 1L5UA 4XPCA 5IZHA 3OHBA 2UUAF 1ZM9A 2AJFE 4YEAA 1N88A 1G3OA 1F9EB 4DPUA 4TXSA 4WFAQ 2KG0A 5HATA 4F4YA 2LLZA 3OV7A 2H1YA 3RRHA 1X4FA 2YNHB 5KFIA 4GC6A 2ZE2A 1JLCA 1FRIA 1LEOA 3BB5A 4WIIA 4CLZA 3J7YU 2DISA 2IAJB 4H4OB 5C7PA 2VG6B 4DV6F 1HMVB 4UY8T 3MI7X 5CABA 1GH8A 1RAIB 4CLPA 4NLRA 2HS3A 5KG0A 1X4DA 1QUVA 2JRSA 2F9DA 4X2BA 3IO1A 4I67A 3C8YA 2WZ1A 2YKMA 2Z2LA 2W4PA 3V5RA 4ZP8A 4R5PB 1MSWD 3ISZA 1HPZB 4JV1A 5U47A 1CQMA 5G0RA 6AT1B 3CSKA 3EGNA 4IQXA 4CNZA 1NH7A 5HVFA 3ZTSA 1K8AT 2QLFB 1MN7A 3R7SB 1XNRF 1EJ7L 3N0VA 3PW7A 2E1CA 2V4JB 3CCZA 3FVYA 2YKAA 2ZH3A 2H5IB 2V6AA 2VIHA 1SJ4P 4PG5A 1T03B 4NCBA 4K0KJ 4B3RJ 5EWGA 4QPXA 1ACMB 4OYXA 4TLRA 5A8WB 4ENOA 4JI3J 1Q79A 1AUSL 2RAQA 2N7YA 2BW2A 4YDXA 3TJ9A 3W61A 2PIIA 1IN0A 3W9JA 5J2MB 1NK9A 2H5JB 1RWXB 2GAGC 3D6FB 1B3TA 2I9SA 4DUZJ 1ZH5A 2AIRB 2C2KB 2D69A 3C15A 5CZVA 3S01A 3NS7B 2IM1A 4XK8C 4M5MA 3KLHA 3MM9A 3H5XA 3W7BA 2VB6A 2ZDPA 4HTIA 2G9OA 3DM2B 1TL3A 7FDRA 4KH1B 2XMMA 3CB4A 2BQ3A 1HHSA 3OL9A 2EFOA 2PDAA 3CE8A 5IQQA 3W65A 1CJKA 2XWYA 4DEZA 4NRTA 2WVBA 4Y0FA 2GVZA 3G82A 2U1AA 1VRUB 1UVKA 4ANCA 5D3GA 2FVSA 3CJQA 4QWBA 1HARA 2RU9A 4PWUA 4OI0A 1HQEA 3H5YA 2GJ2A 3A8EA 1EKSA 2UV8A 2JL9A 1S9EB 4B08A 1LQ9A 4IG3B 3TWZA 2WVEA 4UUXA 2VL1A 3LH2S 3H2LA 2YX7A 3HFVA 2R7RA 4UOHA 3VZIA 4ZIVA 4ZLNA 4L3KA 3DDNA 1WF1A 3OUYA 4QR1A 4WU3A 2FZGB 1F60B 1R8HA 4NCAA 1C0UA 1RA7A 4NLUA 4EBDA 1MROB 1PYTA 1FRKA 3SFUA 4DV3F 3RB4A 4RBTA 3CJKA 1CBKA 1JLGA 5JXSA 3D68A 1RK8A 2V69A 3UR3C 4ANDA 3CGIA 3HT0A 2YH0A 2CQPA 2RD5C 1TMJA 3HSZA 1QD1A 2Z8QA 4QQBA 3CCWA 3TA1A 2XYHB 4A8OA 2UU9J 2BANA 1OMSA 2F4FA 5D4NA 2KU7A 2AW0A 3I9V9 5ADZA 1U45A 4O4RA 3GG1A 4DFMA 1J5OA 3DNCA 3R7NB 4LFCF 2HNDA 3P4UB 3ZZOA 1UFWA 3PDNA 3I55S 4LFBF 1HWLA 1SIZA 1KVJA 2KL8A 1D9AA 5FDLB 1UETA 2ZH7A 3CCVS 2BACA 2H4YB 3M8RA 3GSIA 4FNIA 2YTCA 3UD5A 2FHOB 1F5CA 5HQMA 1BQMA 4M5GA 1S79A 2NUUG 1RWPB 1RACB 3TUJC 1DQ8A 4IG0A 2A2DA 3D1QA 4ED6A 3LF0A 1FRHA 2Y1JA 4GKKF 4DFPA 3IAS9 3QZ8A 2YNGB 4L72B 4WZMA 4FKYA 2J0XA 2V2QA 1WSRA 5BYSA 8RUCA 5KFPA 1U1PA 4CM0A 2R2TA 5AJ3J 2RIJA 2YVSA 3Q8YA 1TK0A 4DV6J 1M0SA 4X4NA 4RWWA 5HANA 4KHPF 2RDDA 2YWWA 2ZDOA 3IG1A 4XPEA 3BJYA 4EBEA 1ZETA 5L8RC 4EFAC 1U1KA 3G8TA 3HI9A 1IKYA 3P3DA 3W9HA 3QAUA 1QTMA 3AJ1A 1VI7A 4ZPBA 2JSXA 3K5PA 4UZBA 2HNYB 5ETPA 1OWXA 3VGUA 3BBFA 3D2WA 5GVQA 5HP1B 1XEZA 2YKQA 3D6MB 1C4CA 2HYIB 2OH2A 4AT1B 3M8YA 2F7VA 4Y34A 1DZ5A 4YQWA 2NZ4A 5K14B 3AB4B 1CC8A 3CJSA 1FJGJ 2CJQA 4OZ3A 1VR6A 2BV3A 1NKEA 1T9UA 2UVRA 3RR7A 2VG5B 2VOOA 5E3QA 3SSQA 2WVFA 2FD2A 2VFSA 2QSWA 3HHEA 1U0SA 3EM1A 4I2PB 2RRAA 4U8VA 1Y11A 3W2WB 2FY1A 3K59A 4NE9C 2H4WB 3DYAB 4Q7AA 2LCWA 3V81B 2KXFA 3BKUA 2MZQA 4CLKA 2DKOB 1FA0A 1MNEA 1YJNS 3DLLQ 2F3JA 4X62J 2VDHA 2HHPA 5L9NA 2YXLA 1T05B 3DRSB 1C1CA 1NBEB 3KK3A 4LSZB 4I4BA 2NQPA 3QSYB 2P6TA 4FPRA 5HJXA 2WK4A 2DNYA 3QFWA 4H4KC 2ALYB 3M1VA 4ICLA 1NB7A 3PX0A 2R7QA 2YBVA 3AOAA 5DQGA 3GB0A 3T6BA 3Q24A 4DX8H 2F65A 1MU2A 3MPDA 4DCOB 3TAMA 5JJBA 3MAQA 4HKQA 3EZOA 2HWTA 1AT1B 3DU5A 2VA3A 4M63A 2XO7A 3JB9k 1FJEB 1T11A 2AZ1A 4ZCMA 4ZCKA 2LKZA 5GMKa 3KJQB 2L08A 2R9LA 4ECRA 4B9VA 2B4UA 4KYZA 4AYBD 2XMTA 4ILMA 3M2UB 3G71S 2OO4A 5BYQA 2ASJA 5L1KA 5LMNF 4WIQA 3OFGA 5K8PA 3D66A 3CT9A 3K5NA 1RADB 2Y9HA 2N3LA 5LJ3Y 2ZZMA 2Y0BB 3TRGA 2KDOA 1SJ1A 3TVKA 2KO1A 1S48A 3VCDA 4FYYB 4DG1A 1S0VA 4DF4A 4HLBA 3SSSA 1S7HA 3MECB 1QM9A 3SCKE 1OSDA 3N5BA 3X1LB 5DDOC 3LAKA 1UA0A 1HL6A 2C2MB 1VC6A 5F8GA 5D4LA 4KHMA 3LANA 2ZITA 4FKXA 1B0VA 2ZH8A 4Z2XA 3BKTA 2QMXA 1VQYA 4N7TA 1N33J 1FRMA 3TA0A 3H5UA 1N56A 3HHLC 2UV8G 3CCJS 1DLOB 1U02A 3PKMA 4DU8A 3TI0A 5KOXA 3ZTOA 1IBCB 1HNIA 2GA7A 1HNVB 3MMJA 4BS2A 3FKBA 3AB2B 3KLEA 2AD9A 2AYMA 2MPUA 1O5JA 3A3PB 3L9ZA 4HI2A 3K2YA 3S1TA 1SV5B 5KOWA 5DDRC 5IWAF 2UVWA 2K06A 4CQ1A 2RQKA 4MK7A 1IBLF 1N52B 1TMMA 2HNZB 2IMWP 1N6QA 4E2FB 5K9FA 1CVJA 1X8DA 3PFEA 2MKYA 3TP2A 3SCIE 4MK8A 4JI2F 3AHPA 5IQ6A 4F04B 2BDPA 4BDPA 3KJNB 1UFLA 3MD1A 1W2BR 1S6PA 2BJ9A 2J7UA 3D5MA 3KJFB 4BWJA 4MYUA 1TKZB 1WORA 4JV0A 4XO0A 2VUGA 2QN6B 4WKYA 3TUIC 5DLGA 4PABA 4I64A 2HQDA 1R0BG 1KLMA 2EFQA 5LSRA 4RX6A 1NNDA 1SC4B 1NK4A 2QC3A 1VLOA 1RT7A 4PEOA 4DCJB 4EO6A 4IG0B 4C0HA 4PKDB 3UD4P 4N77A 4DFJA 3FZ2A 2MKCA 2RKIB 3OD2A 4ZS6A 3D3CJ 4QWEA 1XBWA 1REVA 2YQ1A 4RBVA 2OAUA 4JP8A 3CJ0A 2KYXA 1VMBA 3Q8PB 2X1BA 3OR1A 4YY3J 3TARA 3EVMA 1AZSA 1TP7A 1C1BA 5HBMA 2PMZD 3UNYA 1I5OB 1XWLA 2RH3A 3UPFA 4DSIA 5F8NA 1L3TA 2FDNA 4ZVUB 3R5GA 3RAXA 3V4IA 2MMYA 3N4WA 1FK9B 4CH1A 3R8YA 1RU1A 1LOUA 1TUGB 3PNIA 4ZP7A 3TAPA 3KMSA 2M9KA 2HPUA 3AQOA 1ZAWA 3H40A 5LXRA 2V34A 2I38A 2XCAA 2OD4A 3ITHA 2AU0A 5HI7A 2QA1A 3T3FA 1T03A 1BQNB 2CNLB 1RAAB 1DJ0A 5KG4A 2XMUA 4OHXA 1ZTWA 2HZAA 3W2WA 2HBZB 1RT6A 4CLTA 1S9FA 2HWIA 2BVZA 2NSBA 3N5FA 4OZLA 4Y2KA 2PA8D 3I96A 3ZZTA 2XO6A 1SUQB 3DOMB 3N6LA 1S6UA 1YDLA 3POTA 4USHA 4Y65A 1YG0A 3FSYA 4ZJLA 3CCRS 3V6DB 4OL8A 3K5MA 1N34J 2LEBA 2CDRB 3KLFA 2MGZA 4K4SA 2AWZA 3G6YA 5LMNJ 1G2EA 3DRSA 2FQQB 4J5OA 4W98A 4KKOA 3CCSS 2J9EA 2EFNA 3DHWC 4TU8A 2DH7A 2AGOA 4O0NA 1AFIA 3U1NA 3N79A 2GHVC 4A8SA 2AX1A 1R6YA 4DS4A 3KMQA 2NR0A 5DGAA 3W9IA 3KHRA 4ZVTB 1HNZJ 4DLGA 2R4FA 3TVZA 2AJ0A 3W2VB 2JVRA 2BMBA 3C16A 4MH8A 4Q45A 2CZ9A 3EXCX 5IT4A 1RWNB 3MM6B 4KC5A 3P96A 3T41A 5J2PA 3P5BP 4DV2F 1CS4B 3R1LA 4WZQA 1ZTTA 3ZZ0A 4J9KA 3CD5A 2NLWA 4NLTA 2XG8A 2KT2A 3CJRA 3MEEA 4RW6B 3H42A 2B3TB 5DZ6A 2LECA 3NMRA 2J9DA 1S6QB 5KFEA 1C4AA 2KI2A 4NCGA 1N8RT 1P8GA 1R7IA 2ILYA 2W2OP 3MURP 1ZAXA 4Q2LA 1RTHB 1WG4A 3MEDA 4ZP9A 2HKEA 4P71A 1EIYB 3U1LA 2IJNA 3CVKA 3T1HF 2RQ4A 1H38A 2VD3A 4DU7A 2ADCA 3GLJA 1NJWA 2ILZA 5SZTA 1GT8A 1EARA 3D0HE 2BANB 2IDEA 3E01A 4Q5VA 2D3ZA 3JYTA 1KC8T 1HR0J 3HMJG 3HDSA 4DR6J 2CPDA 5AT1B 5E0OA 1RTIB 2DR7A 1SL2A 2R42A 2DRBA 4WP8A 4X66J 2QX0A 2LVWA 1UTAA 2QT7A 3MPWA 2JDJA 4L74A 4P2MA 5M2RA 2DHAA 2IVYA 2CWXA 2LXFA 2W2NP 2IRUA 3AOCA 5KG6A 3EDQB 2OJ3A 2CQ0A 4HT7A 3NNAA 3A13A 4ELTA 1B99A 4DSLA 3DRRA 5KT4A 1NSQA 4PWDA 4X4PA 2FB0A 3GIRA 1HNVA 4DS5A 3W8GA 1S1WB 5M2PA 3RAQA 2DPIA 4MKBA 4X65F 4HR2A 4DV5J 1EP4B 2ZOFA 3CPWR 2HHHF 1RAEB 1N32F 4IUFA 5E7OB 3N9UC 3MM8B 1LXJA 3WHIA 2DGQA 2OELA 1GQEA 4WYLA 1SJFA 3O44A 3FSIA 1XMOJ 1RAFB 1KEKA 3O1LA 3SBMA 5DG9A 4W92B 4IRKA 3VR1A 4WFXA 3OL6A 2FHJD 4I68A 2AX0A 4KBIA 2W9CB 4ED1A 2DNGA 1CEZA 1PJ7A 1KOOA 4JI4F 3GG0A 2RDIA 4C11B 5THWA 3OJUA 2EEYA 2HNYA 4MJKA 3QIPB 4OHVA 4UZCA 5A6PA 2UUCF 4KR0B 2NPIA 2NXJA 3R7BB 1TVRB 1ZPWX 4AXJA 3P5TL 2QL7B 5CYMB 2KFZA 2FPHX 3MUVP 5CAAA 1S1VB 2OEMA 2VPYB 5GADI 5CCLA 3EX7B 2G0JA 3HO1A 5AXNA 3H20A 1KN6A 1SC6A 3GQCA 4WYWA 2D1CA 2HVHA 3SYZA 1KVIA 4NYPA 3TR5A 2JH3A 1VISA 1KS2A 1Y9OA 2E66A 4K8RA 4CLWA 1DTTA 1ZM4A 2WSCC 3G87A 1HI0P 3VAHA 1PC5A 1VRTB 1DURA 2Q6CA 1SVDA 2ZKTA 1CJKB 4W4MA 3ZZRA 4R5PA 2Y8YA 1OO0B 5C2CA 3OR1B 2HLUA 3M6XA 1KONA 5D0GA 2UP1A 4LVOP 3HULA 2HQGA 1S1TB 3W5ZA 3LGHA 2XMJA 2DHHA 2LP4A 4GKJF 2PT0A 3ZZPA 1X0PA 2G2OA 3NWGA 4D3HA 1UJ5A 2ZHOA 2CQHA 4QW9A 2LQ8A 1K47A 4HEA9 4OI2A 1RTJA 3D6TB 3DLGB 5EWFA 1U6BA 5DQHA 4LF9F 4MMOA 1PYSB 5HK4A 3IXQA 2DTJA 4A46A 2F63A 4F50A 3V2UC 1FTRA 3CDUA 3HFKA 1OSCA 4CWBA 4NYOA 2ZBPA 3I5AA 4OYOA 5GAEI 1RT6B 4JUZA 1K44A 2J76E 3NY0A 4NRUA 3ZO7A 4A8MP 1WOPA 4LIWA 1WACA 1FJ7A 1TUVA 1FKOA 3V6KA 2G1DA 3BR8A 5LXYA 3LA0A 4XTTA 4HH0A 3I4PA 5F0UA 1AA1B 3DM2A 1BD6A 3GONA 3BDPA 1D3WA 4IDKB 3HKZD 3AFGA 2ZD1A 2K3KA 1AYEA 3B78A 4F3MA 2D3O1 1RLCL 2DRAA 3TQ1A 4I69A 2FJAB 1Q0NA 1RXOB 3U1MA 1T9YA 2M7SA 1UW9A 3J81Y 4F4XA 2QTWA 5IM0A 4M5NA 4QWCA 2ZWPA 4ZLPA 3J80Y 4CLFA 4GKJJ 2I6WA 3PHTA 1X4BA 4RNFA 4DL7A 1R8BA 2V2KA 4OHYA 2XNQA 5KFJA 3H7HB 1UEUA 3VAGA 4DR3J 4X4UA 1XNQF 4S0MA 1CC7A 2D41A 3NBPB 1RWOB 2DNLA 4O3NA 2BBEA 2C3MA 3HPOA 2XWXA 4DR5F 1T94A 2ROGA 3WDOA 2OUGA 3VALA 2FZKB 2OKQA 1VQKS 3M4XA 3MZIA 1TKXA 3QNWB 2VG7A 4Y6IA 2RE1A 2QA4S 2PD1A 3FNNA 1RAHB 2UVVA 1WC6A 1XIQA 3M8QB 4NXNJ 2ZH5A 4IH5A 4UOFA 4DUYJ 3AH6A 2PI4A 4B9SA 4CYUA 3PO5A 2OPQB 3RBZA 4UUWA 3M9NB 3D4JA 4ECWA 1R8PA 1NUEA 2NUHA 2ZM6F 3EE3A 5B08A 3FBCA 1QVFR 2E1PA 3BH6B 3MTKA 4I7FA 2GS8A 5HVHA 3ILIA 1JLCB 4J9MA 2CZVC 2JEGA 1UWBA 2WW4A 2VG5A 2OIHA 5FDLA 2QLWA 3RRKA 2AP6A 5KFAA 3UVJA 2RT3A 1EETA 3HVTB 3MFIA 3WIUA 3BBCA 4CZCA 1VIXA 1FESA 2Q43A 2DGTA 4Q2MA 2UUCJ 1GFWB 1SJ3P 3BPDA 3SXLA 2X3DA 4DX6A 1OIAA 2I8EA 4Z7CA 1X7VA 4OIXA 4Y2AA 2R7WA 1A6LA 2ZBIA 2XSFA 1HNWF 1S1WA 2C3PA 1Q8BA 1RTZA 1U7LA 1WOSA 3W5YA 4JV5F 2OPRB 3I0RA 1YHQS 1X5TA 2V4JA 3EMTA 3CD0A 2IM2A 3E8OA 4ZVQB 2ZUGA 3T6JA 4CLSA 1P1LA 1REVB 4ZCLA 3X3UA 4YDDB 4F25A 2PSZA 1N0UA 1FRLA 3FCVA 4FPIA 4JBCA 3DMJB 5KFMA 1RWVB 5D8HB 1HWIA 4DV1F 3GYNA 5HBMB 2MQQA 1CQNA 2FHKA 3CJ2A 4ZK7M 4LF4F 2DXDA 1F2HA 4USWA 4N5SA 3QIPA 3SMZA 5J2NA 2AEJA 1T9XA 4FS1A 1T8EA 1M90T 4LF5F 5B0EA 3C3LA 1R89A 3C66A 3BSOA 2IVFB 1TVRA 2CVIA 5KFBA 2JFKA 1V6HA 2VFUA 4GO7X 1WKJA 3TOQA 4B02A 4J9UE 3ZNJ1 4F67A 1TK8A 4K4TA 2QG9B 2PN6A 1F3VA 3SZ2A 5H9EK 5AXKA 1H74A 4ZP6A 3PYFA 2R2RA 1EB0A 1TTHB 2P9CA 3LO3A 4DX7A 4OLOA 1UJ6A 2CJYB 1DTTB 3H0PA 4J9LA 3ONQA 2IMOA 4P52A 3UFCX 2R8HA 1VRTA 1WG1A 5D3GB 4CP5A 4B3OB 1NZAA 1LW0A 4LFAF 1S9EA 1TU0B 4YB5A 3DN9A 4TN2A 2VQFF 2GV1A 2M3DA 5A2QY 3MD3A 2BE2B 2JEIA 1V5IB 2DNPA 3KDNA 1WI6A 1F3FA 1T9VA 3OUYB 2ZJRQ 3CCQS 2R7OA 5CD4A 4YHHJ 1H73A 1RKIA 3UR0A 4LF4J 1MU2B 1RTDA 2UUBF 2ZZNA 5KG1A 4PYAA 4J9VA 1BQXA 3HHLA 3PCOB 5KT5A 1TAUA 2L9DA 1RP5A 1U47A 1RAGB 1NPRA 1ZM3A 4ZPVR 1MMNA 3DLKB 4B3SF 3I31A 1Q8IA 2W01A 4KIAA 1R27B 1SI9A 2MZTA 1ULRA 3KJVB 3FCHA 4NI2B 4ZJQA 1VYAA 4WE1A 3CDBA 1KOHA 4G1PA 4DBQA 1TL1A 4CH7A 1L3SA 4LJMA 4R8UA 2E5LF 4USUA 4Y3CA 1NEEA 3CCUS 2GJIA 3IRXA 4DL5A 3DDKA 3HSDA 1WC3A 1JKHB 4OLPA 4X64F 3C6TA 2W7PA 4DR1F 4DPTA 1I94J 5I42A 3FBBA 1VQ4S 1P9QC 2EK1A 5KFWA 1VC0A 2K8GA 4ELVA 4PXDA 1PJ6A 1NMEB 1VDHA 3RUBL 2I1RA 2V67A 2ZOMA 4AL5A 4ZHRB 4DPYA 2FY8A 3DXSX 1TK5A 3H98A 2OSQA 4K4YA 1H72C 3MCNA 3MMCB 4KPYA 3E01B 4LFBJ 1UW4A 2BW7A 4R0EA 1DLOA 3NGUA 1YZ6A 5KTQA 3I5CA 2BRLA 5CZXA 3W8PA 4A4JA 2QA4G 4O3RA 2APOA 2C2NA 3I4HX 4Y00A 4NLGA 4AUKA 3C19A 1U6FA 1GTEA 2B51A 2CNKB 4O23A 4WTOB 1J5EF 4JI5F 2RS2A 3FMBA 2OTJS 5G4DA 1YJ7A 5I3UB 2GIRA 3A8JA 2Y1RI 2HIYA 4FVCA 2VBXA 3D9BA 2XZDB 5F8HA 4RNHA 4YR0A 3DU6A 2CPXA 2FZCB 1VFJA 4DOZA 4ITSA 3B8HA 5A8KA 1G1XA 2BR0A 4J9NA 4NX9A 1VRQC 4AE5A 3CJ4A 2BQUA 3K8WA 1G4CA 1K1QA 2CYYA 2FJEB 2GFFA 2GQQA 4I2PA 4LUBA 3W3SA 2M70A 3LGNA 5JMNA 1RT1B 1WUUA 3AD8C 3PIOQ 2R2UA 2BM0A 3QWUA 1CJTB 2N3OA 1HYSB 4NWBA 5FLXU 4KPCA 3PXGa 3M7VA 4C0OC 3OLBA 3BPSP 3FBFA 1SUQA 3DOMA 2WSEC 3THTA 4ED2A 1FD2A 5BR8J 4JI5J 2Z57B 3DGVA 3EVWA 4NZ7A 4MIAA 2ASLA 1IKXA 2IJRA 3JQMA 4KTQA 2BZ2A 5C24B 3MAAA 1A0OB 2G4BA 1SJQA 4LT6A 3VVUA 1SXLA 1S5ZA 2IDLA 2YKPA 1LWCB 1NDPA 2WONA 5EUHA 3CCES 5HROA 5J2QB 4QW8A 3CDEA 4J7CA 1I1GA 3DMJA 1RISA 3TNVA 5J1EB 5MLCV 3LPEA 3CCMS 2V4RA 3PW4A 4DV7J 3IR7B 2UXBF 3JSBA 2NCKL 2JJ4D 3GIIA 4C2MA 4HDGA 1VQ6S 3E3XA 2AJQA 2DCLA 1BQNA 2W2QP 3T19A 2UUBJ 2FHMA 1PSDA 2CJXB 4B3MF 3MCMA 3UD3P 3MOZA 1YWXA 1BLUA 2CPIA 2DRDA 4CDIA 2KG1A 3UWTA 4F0KA 1ZZNA 1KTQA 2DNZA 2MDAA 2WOMB 2OMLA 1TFYA 1FDBA 1N36F 4K4XA 5KFGA 3OTOJ 1NJZA 2ACMA 3ILJA 4PR6A 2B6AB 1ZZFA 2C3UA 1WEXA 2YY3A 3NS6A 2HHHJ 1NH8A 1IR2A 2NXNA 3B4MA 2IA6A 4H4MB 2XS5A 3HVAA 1PIEA 1VQOS 1HBOA 3NG8A 4B3TF 2VICA 2FJWA 1KQGB 6FDRA 2HQ3A 2XHWA 5L39A 1HKAA 2V8GA 2WBMA 2XM3A 1RWWB 2VF3A 5DQIA 2R8IA 1IBLJ 2UXBJ 1UJ4A 2WW8A 3MM6A 3MR7A 1RHQB 4TU7A 3ISND 4GO5X 1U26A 4ZVOB 5RUBA 3M2RA 1KFSA 2JOQA 4IO9Q 1JLAB 2BJEA 1FX4A 2DY9A 3OXLA 2XLIA 1T7PA 4C8LA 4JYAJ 2AKWB 1W26A 4DMZA 4O0IA 2YNFB 3DCAA 4ECSA 2CFXA 1S6PB 1WEZA 1MLAA 3OQ2A 1F1BB 4HL9A 4R8UB 1N36J 5C25B 2BKNA 3FRZA 2HVIA 3IRXB 2D9PA 4DL3A 3PIPQ 1VQ9S 2G2ZA 2JWNA 3M6WA 2IRYA 2DYAA 1RA6A 2VBWA 4Q0BA 4HTJA 1O8BA 3RYLA 1RUSA 2HS4A 5KFZA 1JJ2R 2V0NA 2B9EA 4BLGA 5HQLA 3D1OA 2QMUB 4KJIA 3DRYA 4AQYF 2P6SA 4DPWA 2O3DA 5L9XA 1S1VA 3F73A 3FK4A 2AV5A 4F3QA 1RSCA 2MLYA 3AD7C 3EDRB 3MM7A 3D0GE 4GC7A 1K0TA 4K4WA 3T9NA 1JWWA 4QIGA 1UEVA 4RUCA 4RW9B 2KN4A 2DR5A 1FNOA 2Y3YA 3FZBA 3H4DA 3KK2B 2J9DE 2X1AA 2AGPA 4PUOB 4FF1A 4R25A 4X84A 1JLFB 2KB2A 3M30B 2GO8A 1IWAA 3Q2SC 2VQEJ 1UPMB 3VZHA 1PJ5A 2V63A 4ECYA 1M1KT 2PI5A 1KNZA 3BSNA 1U1QA 3NMAA 2B4OA 3RGIA 1QSSA 4K5RA 2R7UA 1RCXB 3MGJA 3BQ0A 2JVOA 2VASA 4LVNP 1WHXA 4LF8F 3QT6A 4FYWB 1H3DA 1R31A 2B9XA 1WHWA 3BYRA 1V3ZA 3IM9A 3NAHA 3ENAA 3O6QA 3OFHA 4O4GA 3UO0A 4C3LA 5KFOA 3KK1B 5F3TA 1YJWS 1AB8A 1LWEA 4P6QA 1XNQJ 2MHNA 2HFNA 4ZPTR 1HYSA 3T1AA 1Q4RA 1GMWA 1S57A 3DOKB 5A8WA 2V4QA 2DNNA 2AT1B 3HHKA 3CD7A 4TY8A 1WKKA 2IYIA 4NYZA 4CRJA 2GGPA 2AYGA 1Y3KA 1EKRA 3LP0B 3IA0A 2B8PA 2C22A 1UCNA 4OJ3A 4NLYA 3ILOA 2GMJA 3Q8VA 1JLEA 5KFQA 2VQEF 1S1TA 2HQIA 3OTEA 4MKVA 1J27A 3C16B 1M5PC 3BF4A 4RUBA 3OTOF 4J91A 4OMFG 5KFHA 2BM1A 2F40A 3FMWA 1NKCA 2R8KA 5E3PA 3QJJA 4UQGA 1B0PA 2XEXA 1CS4A 2CQ2A 1FKPB 1T95A 1IR0A 1WF0A 2M2BA 5E3CA 1E6YA 1QTNB 1XK8A 2K7JA 3DLEB 2FJVA 2WB1D 1HQ2A 1BUXA 3Q8SB 2ZJQQ 3F41A 3C14B 2R8GA 2FC8A 4NLSA 4LF2A 4WWSA 3TYTA 4RU2A 2DGVA 3TQEA 4F2RA 2LXIA 1JX4A 1H7WA 1P27B 1WC0A 1S76D 3M32A 1XMQJ 4O3PA 2QFJA 1FT8A 1ZM2A 4Z37A 4C3MA 1MWQA 4PXCA 2O1PA 2OPSB 3R97A 4P2SA 4UW2A 2I5JB 4CYUB 3CJKB 2K3IA 1CJVA 5HMXA 2DR9A 2CAJA 3HHDA 1Q8KA 2MYFA 2EXUA 3QIDA 2ZD1B 4ID8A 4KGXB 1N5VA 3CMQA 5T7LB 5F9NA 2QV6A 5KT7A 4WPAA 1FE0A 4ZVHA 3M8WA 4U9RA 4QWAA 4C9DA 3P49B 4IFVB 5IT0A 3NS5A 1UWBB 5EX0A 1JNRB 4X4QA 4BWMA 4FF2A 1NPKA 5KFNA 4IKAA 4DN9A 3V6JA 3R27A 2H48B 2RUGA 4B9TA 2CJBA 1GAOA 3NCRA 4KH0B 3A12A 2HGMA 3RAMA 1NSPA 2M8HA 3TJ8A 3TJAA 1TL4A 1FFSB 3EGZA 4ZHRA 1F2GA 1REGX 3VV2B 2LDYA 3IWXA 1FD8A 4K7QA 1WTBA 4O3SA 2CQ4A 4QIEA 1G7CB 1CSJA 2W9BA 1SC1B 4OZ0A 4V1Ak 3G6VA 2H3EB 2ZNZA 2VG7B 1M1HA 1U48A 2YNGA 2L9WA 3OBIA 5B0AA 1JXLA 4HHUA 1D8ZA 4PQUB 3CCTA 3M8ZA 4NOHA 3WQPA 4DL0C 1OQ6A 3KLIB 2PMHA 4EZ6A 3CUNA 2KFNA 2HEKA 2W24A 4QIWD 5DM6Q 4XDDA 4RNNA 1Y5IB 3I0SB 1FXLA 1U1MA 3JQKA 1HA1A 3N28A 4DQRA 1Z4UA 4P75A 1WC1A 2E1MC 3BN7A 2C28A 1RWKB 3UDEA 2OGUA 2AF6A 4RO0A 4OYAA 1VJQA 5HP1A 3BO4A 2GIQA 1H2TZ 2OTLS 1YK9A 4GVBB 4LFAJ 4WK1A 1VQLS 3VAJA 2IFXA 2WBRA 4IQMA 2NYIA 3UCGA 4ATNA 3AQPA 2ADBA 2B9YA 2CPYA 5E5NA 3SCJE 1CULB 3C6UB 1R0CB 4RNMA 1YJRA 4JI1F 1NU4A 2RHQB 1RKJA 5KAKA 3R2CJ 4RW9A 4ZDNA 3M8PB 1PAUB 1LNQA 4NLVA 4X4RA 2B8QA 5J1NA 2R3VA 1B0TA 3AD9C 3IN5A 1JLFA 5G0RB 4TYBA 4NXMJ 2EBEA 3BR9A 1ZPVA 4LQ9A 4LR9A 2W7OA 1U4BA 3DOLA 3EWGA 1KRPA 1EQMA 4ILRA 1HI8A 1NHKL 1ZYQA 2XHCA 1X9WA 3OPKA 1EHWA 1RHKB 1Z2LA 4LSLB 3MOJB 3EPGA 5FJ4A 3FJ2A 2MHEA 5GADU 4FYVB 1RTDB 2DHXA 1U49A 5K20B 1KFDA 1C0TA 1PAEX 3KHLA 1IWGA 4EZ9A 3OSPA 2KZMA 1SKUB 2H9ZA 5IC4B 1H0HB 1H98A 1DAXA 3FQKA 4K5SA 4DI6A 3HCXA 3KLVA 4U67Q 4RL1A 2ABYA 4AL7A 2F4VJ 4RKUC 2F9JA 4F36A 3TAQA 4X64J 1I94F 4E98A 1SL0A 2VOPA 1SQGA 5H9FK 2XSJA 3RRGA 4IDKA 3B6BA 4NLXA 1R8AA 1N5QA 2KRBA 2N4CA 2E29A 1NCLA 2YKNB 4E8UA 4U6PA 3Q22A 4ZN3A 2VV5A 3CC2S 1K0VA 2AHOB 3SV4A 4Q8EA 4OX6A 2UXDF 2DGXA 4N47A 1VQ8S 5HO4A 2YWGA 4WJBA 1H2VZ 3C6TB 2ROPA 3ENQA 3VQSA 3MTJA 4BBYA 4M5KA 4URGA 3G82B 3L7OA 1X5SA 4RPFA 2ZH6A 1HHTP 1URRA 4RWXA 1MWZA 1J5EJ 3IWNC 2WAQD 1JXEA 2DNQA 2DNRA 4F02A 1RT4A 3A8KA 4EWTA 4DR5J 4MT1A 4B17A 2HMIA 2DNKA 1M5KC 5KFRA 4G1QB 2NREA 1RLDA 1HWUA 3Q83A 2L48A 3SFGA 1O6XA 4YB7A 1HBOB 2CQBA 2VBYA 1Y5LB 2A1BA 2JHEA 4PCQA 4YUDA 1OY8A 3M2VB 2V9WA 4NXNF 4WTYA 3T5KA 1J2VA 1GX5A 3W60A 1W2IA 1X5OA 1ELOA 3CWJA 2AYBA 1U25A 5AE2A 4LFCJ 2JZ5A 2VHGA 1RJJA 2MSTA 3DXBA 2O5DA 3DI6B 5HN0A 3DRPB 4EYIB 3HLUA 5IT9U 2AJ2A 2HW3A 2UZAA 3G86A 1N4LA 3K89A 4QOTA 4MAKA 2K1RA 3UE2A 3PYDA 1WHYA 1OPZA 3R3TA 3MMBA 3TEGA 1GTHA 1Q8LA 1L3VA 3LP1A 3EGVA 3QMQA 2CDQA 3NGKA 1L3UA 1ZA1B 3BREA 4ED0A 1OS5A 4GKKJ 4B3RF 4K0KF 4M5JA 1FJCA 3RTVA 1U8WA 1S0MA 2QMWA 1NK8A 1WTFA 2KRRA 3UN3A 1KLNA 1K9MT 1WD6A 2E7WA 1JJ4A 1LWFA 1N5SA 2DGUA 2YPYA 3GJTB 4ED7A 5KT3A 1Y10A 3CTRA 1KLMB 2KHDA 3PJXA 2U2FA 5D0HA 3IGVA 2J7KA 4YB6A 1KQFB 3EZ5A 3V6HA 1HPZA 5A8RB 3DLBA 3MR3A 2OFHX 1D1UA 4DPXA 3MR5A 4RW8B 1I6JA 1GXUA 4IOCQ 4C8ZA 1S0OA 2W9AA 1RE1B 3AODA 4J9SA 5I3UA 2ROEA 2RKIA 3H25A 1RI7A 2VC0A 2QE5A 4ZOSA 1IQZA 3R6LB 4IRCA 3HKWA 1FJGF 1RT5B 2O67A 2YQ3A 4LF6J 3BO3A 4DL6A 2ASDA 5HQ8A 1P1TA 4O44B 1U2FA 1Y3JA 1QE1A 3VWSA 1NO8A 2EVZA
chains in the Genus database with same CATH topology
4ECVA 4CO5A 3OFFA 2DJWA 4YR3A 3Q0AA 4DDFA 1C2PA 4Q43A 1D8YA 1IJEB 5DLFA 3D28A 2DPJA 4U7UK 3BGRB 1QY7A 1RT2B 1TKTB 4ECTA 3BSAA 3ITHB 1HD0A 1GXTA 1QAIA 3C6UA 3MHYA 3KNAA 1TV6B 2LEAA 2ZVSA 3NCQA 2XNRA 4IFYA 5B0GA 4NL5A 2E9ZA 2ALZA 3M8PA 3KLHB 2ZC4A 2RDJA 2ZH4A 3TO8A 4LSNA 1T05A 2BYCA 2D9OA 2KHCA 3QGIA 1R0AB 1X0FA 4TY8B 2XMVA 1UVMA 1X4HA 4NLPA 1UL3A 3KLFB 1UMJA 4ICLB 1V3SA 2M4MA 4X4TA 5BJRA 5I3PA 5CYQA 4KQZA 5JUMA 5KFCA 2R2SA 1RWUA 4KKOB 2DCUB 1DQ9A 4LSLA 4BC9A 1S77D 4USJC 3O5TB 4Y2MA 5GAHU 2B9WA 2DD8S 2DGOA 1S9GA 1JLBB 2LQBA 2E9RX 4X4SA 4RW7B 1NJIT 4W90B 2XY5A 1UVIA 2MJNA 1APSA 1UKUA 4PQAA 5CXTA 3PO4A 2CVEA 4WFBQ 2RQMA 2XGPA 1JKHA 4PPDA 2LDIA 3OJSA 5E3AA 2WOMA 3M32B 2N82B 1S6QA 3MF5A 5FLXY 4YP3A 2CJKA 3M8SA 1YJ9S 5AXLA 3R5AA 2L41A 2EG1A 3N6MA 3OFEA 3KLGB 2IBKA 2MKKA 4IOAQ 2CG4A 3KG1A 3K58A 3MPVA 2VFTA 2ZNYA 3CMAS 2LQJA 3GYXB 2J6TA 1RT4B 2V9KA 1M5OC 3DHXA 4IFVA 2YX4A 3G8QA 3AJ2A 4TQRA 3GE9A 5D78A 2FVQA 3IG1B 3AY0A 4YMEA 5DGBA 3BDEA 2QLXA 2E5JA 2M88A 4ED3A 2D3UA 5K8OA 2XC9A 2HZCA 1YQHA 3QGGA 2Y1IA 1S6OA 2OSRA 2YNFA 1TZ0A 2B0GA 3IS9A 3MM5A 3JTOA 1F5AA 1F0XA 2K7KA 2MQNA 4CI0B 2MQOA 2ZJPQ 2FVCA 1FNXH 2RILA 5KFUA 4C4WA 3MFHA 2X51A 1AW0A 2HFZA 2KKHA 4F4WA 2YKOA 3RB6A 1V9OA 2EK6A 2FGOA 3H2VE 4Q0BB 4FVMA 2GQCA 5KT2A 1WEYA 4CT8A 2GHPA 3QJLA 5GAHI 1U1RA 4ES1A 3UDLA 3SZ2A 1T3NA 5BR8F 2CPEA 1FRXA 4ZPCA 5LL6d 3E2EA 3R1HA 3P6YC 3CDAA 1RYSA 1FEHA 2M5YA 2KXNB 1KR4A 3VTIA 4Y2CA 2XY7A 4ZMMA 3GFXA 5AJ3F 3EYZA 1X4AA 4KGKA 2VKRA 1HWJA 2DIUA 3DYAA 5K8MA 4DUZF 1VBXA 4V19J 3A1YG 3GFYA 3IAM9 4K4ZA 2E1AA 4PRFA 4WKRA 3JSMB 3U02A 4F4KA 2WSFC 4NLOA 4DV7F 3IRWP 4KT0C 3TX8A 5F8IA 5B0FA 1WNEA 2FJDB 2W7AA 3G6ES 4KV8A 1IJFB 4O44A 2A3JA 4KO0B 2RS8A 3M6VA 4DJBA 2E5IA 3GWCA 3QPIA 2D3OR 1HHTP 3L95X 3DLEA 3WBZA 2YH1A 2E44A 4A48A 4TU9A 1Q53A 4I0WA 2CQ1A 2CQCA 2DT9A 2ZBCA 5J1PA 1LWEB 2UUTA 5E33A 2P5VA 4N8NA 4DL4A 1X4GA 1WG5A 3H4BA 3LOUA 4WXWA 2VFVA 1N5YA 3DRXA 2VC1A 4NLDA 2KZZA 4ZA1A 2B6AA 3OHAA 5LMUF 2R8JA 4IFYB 5C42A 4MTPA 2OLWA 1J5OB 5T7LA 4HI1A 4OV1A 1FKOB 5B0DA 1YI2S 1FF2A 2LQ5A 5T14A 4G1IA 1JLEB 3MMAA 3F56A 1HBUB 5KFVA 5MAOA 2L9NA 1S4FA 5KFFA 3AAWB 3F44A 2MKSA 1NAQA 1JNZB 2LU1A 2QO3A 3DGPA 1BQMB 3ETOA 2V5HG 3NRBA 2QA2A 3L7PA 2HLTA 3UDCA 1UVLA 3G9CA 2Z0GA 4EO8A 5LSLA 4J9PA 5DJBA 3HXMA 3SDEA 5KFXA 1O51A 1SIWB 3HZEA 5DG7A 4RW6A 3ZFVA 2MZRA 5K8NA 4OJGA 1PILA 4YHHF 2I0XA 4D3GA 3M05A 4URSA 2XY6A 2HNZA 5AE3A 4C8KA 1N6QB 1VBZA 3VQTA 2GX8A 5GAGU 2R7XA 4A8KA 3I9ZA 4U7CA 2FTRA 1DFDA 3B4DA 4WXOA 1HMVA 1YBAA 2RRNA 1QAYA 1SH0A 3OXGA 3LP1B 4DF8A 4C3KA 1IKWB 4EUVA 2JEJA 1CPZA 3KTQA 4NXMF 2C2DA 1X9SA 3QO9A 4NA2A 4ILLA 1S99A 2IM3A 3H2UB 1VK3A 2F8HA 4OI3A 2DO0A 5E41A 3IC1A 4DQQA 1DRZA 1UAWA 5SUHA 2B56A 4H4KA 2J5AA 1HI1A 2MZSA 4DV0F 1VLYA 3HT3A 3EPIA 1VC5A 1WWHA 4C0BA 3UW1A 5B0BA 2GW8A 1C1CB 2QEXS 4PXBA 2BA9A 2DHSA 2EW9A 1IXKA 2ASYA 3O8WA 4HDHA 2MXYA 3QGHA 3LUYA 3ULHA 3NGDA 4RW8A 1Q7LB 3I56S 2LXUA 1D9FA 1WI8A 4DQIA 4JI8F 3M1VB 2B5JA 3CULA 1QVGR 1JLQB 4H54A 3GV8B 3GR0A 3PV8A 1DTQA 1Z1ZA 3FDSA 1C1BB 1GXLA 2PFFB 3TAMB 4RNOA 3I82A 5J2MA 5HLFA 4QYZJ 2C3OA 4QYRA 1QSLA 5JVGQ 3LWLA 4UQTA 3MM9B 1H7XA 1FEEA 1D0EA 1CG2A 1VQ7S 1U1LA 3BN4A 3M2UA 5AXMA 5DETA 5DO2A 2RNEA 3ZZZA 3MDFA 5D4PA 2MGZB 2FLLA 2YKNA 3BZQA 4RUAA 4RLEA 4O3QA 1Y4ZB 3R5DA 2D7SA 1VRUA 2POKA 2E5GA 3BEGB 1VQNS 2V8VA 1SJRA 2DK2A 4CO1A 2IJFA 1HQEB 5BYRA 3S7RA 4ED5A 4WCEQ 2RB7A 3CDWA 2IC3A 3BQ1A 4MFBA 2Z2MA 4PG6A 5H1SV 2J6SA 3DOLB 3R5CA 2MZ1A 1HR0F 1QAXA 3AA8A 4QR2A 1K73T 4B9UA 1UVJA 5J2PB 1KSPA 4O3OA 2N7CA 3PY8A 4ZVFA 3MR6A 2UXCF 5F8JA 1LW2B 3MEKA 2CPZA 3L3CA 5CYQB 4CNYA 3MEGA 1Q82T 1IKVA 4R0JA 3OTCA 5IS2A 1JX4A 3DLJA 4I1TA 1TR0A 3KLEB 2GHWA 4GMKA 1TKDA 4WFYA 1RTHA 3MEDB 4QIVA 5JVHQ 1SKRA 1KQSR 4KFBA 4ERDA 2IBOA 4DV5F 5KFKA 1HW9A 4CH0S 2DNHA 2O66A 4ZPDA 3PFOA 4EU0A 4ETZA 2M8DB 2CRLA 2GC8A 3LALA 1XMOF 4HHJA 2QSFA 4N76A 3BM7A 3KJVA 1Q86T 2CKWA 4IH6A 2FVRA 4CIOA 3JYTB 3RR8A 3MCSA 1DHMA 3VAIA 3ENWA 1N54B 1HBNA 5KFYA 4OI1A 4F2SA 2HAIA 3HZGA 5ITHA 4J37A 2EBGA 3MUTP 1HBUA 2ZC3A 2DBBA 4JV2A 2LMIA 4FBTA 5CA5A 3KLGA 3TVYA 1BWEA 2HGLA 2DNOA 4OFZA 1FVQA 4FXVA 2W9BB 2W8KA 1NK7A 1NRKA 1PC4A 2B7CB 3MM8A 2FUG9 4PQUA 1DQAA 3MMCA 5D6GA 3PHEA 1ROFA 4OX9F 3OVAA 4DUYF 3T1YF 2UVUA 3GIKA 2XBPA 5T41A 3V4MA 2RSQA 4FXDA 4J9QA 2YWKA 3DRRB 1WHVA 4QPTA 4DSEA 4UOCA 1YGYA 4KHRA 2W9CA 3J7A1 3NCPA 4NMLA 4M5DA 1EP4A 1YRUA 3PEJA 1RT5A 4CH1A 4BCAA 3GQCA 2C2RA 1BY9A 4WFZA 4LIRA 1QE1B 4ZVGA 3MMBB 3IS9B 3MM5B 2ZH9A 4DQPA 4IR9A 2JEIA 3K0JA 1XR7A 4PG8A 2EWHA 3G4SS 3PW2A 4I7FB 5KT6A 3GV5B 1VQMS 3PZPA 2AJ4A 2E5HA 2FHJA 4JI7F 2NS1B 4M94A 4A8XA 1ZOTA 2XULA 3LPYA 3VAFA 3QO9B 1D9DA 4N8OA 2W25A 2YWHA 5KFSA 3RW6A 5A6WA 4MIBA 4NPOA 5F9LA 1FTCA