1YJ9S

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule keywords 23S Ribosomal RNA
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yj9S00
3BEGB 5GAEU 2AYBA 4LMZA 1JJ2R 2X1AA 4WF9Q 2PE8A 2MQLA 3MI7X 3VAJA 4ERDA 4V19X 1YJWS 1R8PA 2MYFA 1BY9A 3MUTP 2N3LA 3ULHA 3CMAS 2DNYA 1U6FA 3CPWR 3G71S 2DGTA 2RS8A 2UP1A 2KXNB 3DLLQ 2XS7A 5LXYA 1PO6A 2KRBA 2CPFA 2X1BA 3L3CA 3NS5A 1K9MT 5HO4A 1R8HA 3UE2A 1Q86T 1UAWA 1X4DA 2DIVA 3PIOQ 3MURP 2HGMA 4PR6A 3VALA 5DDRC 2DGWA 1M5KC 1H6KX 3R27A 2I2YA 1X4BA 2GHPA 2JWNA 2RQ4A 1VQMS 1N88A 1U2FA 3N9UC 3CCES 2XS5A 1WI8A 1HL6A 2J76E 1QM9A 2MKSA 3CC4S 4M5DB 2KHCA 2M8DB 1OPIA 2DGQA 3JB9k 5IM0A 2KM8B 4CIOA 1YJNS 2YH0A 4OZ1A 2DGUA 1QVFR 3P49B 2KRRA 5LSOA 2AYGA 1U1OA 2M9KA 2DGSA 3CD6S 2JX2A 1WWHA 2VONA 1ZZNA 3RW6A 1AUDA 2CQCA 3VAKA 1WG5A 3CF5Q 2X1FA 1JJHA 5DDQC 3CCMS 1HA1A 3Q2TC 2DNZA 1U1PA 4TU7A 2DH9A 3VAMA 2LQ5A 3CULA 2MY7A 1N8RT 1W2BR 4BS2A 1X5OA 2ZJQQ 3BO2A 2AD9A 1WG1A 4F26A 1VQ8S 1X4HA 2KU7A 3UWTA 4PRFA 2FHOB 3CCJS 1WF0A 2DH7A 2EK1A 2E5GA 2FC8A 4QU7A 3SXLA 5GAGU 2BZ2A 2KXFA 2O3DA 2LEAA 4ZKAA 3UCGA 2DB1A 5GADU 1X5TA 2D3OR 4QU6A 3BO4A 1VQ7S 1X4GA 3TP2A 2DIUA 2U1AA 1JJ4A 3SMZA 3LPYA 4FXWA 2ZJPQ 2CQDA 2BOPA 3EX7B 2LYVA 2E5IA 2B0GA 2KFYA 2X1GA 2CQ1A 1M5OC 2J0SD 1FJ7A 4WKRA 4UY8T 1P1TA 1WEYA 1M90T 3BO3A 4IOAQ 3VAGA 4C7QA 2CQBA 2MKCA 5LJ3Y 1SJ3P 3MUMP 4LJMA 1FNXH 2RRBA 1YJ9S 2ADCA 1YHQS 4J5OA 3R1HA 1KOHA 2M70A 1M1KT 1B7FA 4TLQA 2DNNA 4UQTA 2MPUA 2CQ2A 2EVZA 2RUGA 3LQVA 3THPA 1Q82T 2KG1A 3B4DA 2CPXA 2M0GB 2DNPA 2RVJA 5EN1A 5IFMA 3P6YC 1U1RA 3G4SS 2FC9A 2J8AA 1OWXA 2XS2A 2CPYA 4CH1A 2KT5A 1ZH5A 1YI2S 1VQOS 1A9NB 3BS9A 5LSLA 1D8ZA 1WHWA 2DHAA 2PEHA 2OIHA 2M2BA 2MZ1A 5D78A 2M4MA 4WFBQ 3CCLS 2ADBA 2MJNA 4IUFA 1ZZFA 1N54B 4EGLA 2MXYA 3MXHP 4TU8A 2CQ3A 1S79A 1NU4A 5GMKa 2J0QD 1YITS 2NLWA 3CCUS 3I56S 1U1NA 3CCVS 3CC7S 3UCUP 2RU3A 1P27B 2OSQA 2KG0A 2QA4S 2KXHA 1UW4A 2M8HA 2DGOA 4YOEA 3DXBA 1X5PA 1HD1A 1WTBA 1WF1A 3G6ES 4Z2XA 2I38A 2CQIA 2FPHX 2MY8A 1VQPS 3I55S 1KD1T 1DBDA 2MKJA 2Q79A 2L41A 2RRAA 2XNQA 2DHGA 2MZTA 4QQBA 3IRWP 2M7SA 1WI6A 2MKKA 2WBRA 1KC8T 5DM7Q 3MDFA 1VQKS 3H2VE 2DNOA 3EGNA 1U1KA 1WG4A 2D9PA 2MZRA 2DO4A 2DHXA 2DISA 3HHNB 3VAFA 2RNEA 2D9OA 1SJFA 4WIIA 5ITHA 3TO8A 5LJ5Y 1HD0A 1SJQA 2L9WA 2JRSA 2QFJA 2F3JA 2E5JA 2DNLA 2LCWA 4RU2A 5LXRA 2LECA 4OZ0A 2DGXA 2MHNA 2MKIA 3ZZYA 1NJIT 2MSTA 2MZJA 2LMIA 2CPHA 3US5A 1YIJS 1SJ4P 2JVOA 2KVIA 3MD3A 2CPZA 4F02A 1VC5A 2LKZA 5BJRA 3D2WA 1U1QA 2XB2D 4TU9A 3UCZP 1L3KA 1QVGR 2G1DA 2OTJS 1FHTA 1WEXA 4P6QA 2DNQA 2LA6A 3P3DA 2F9JA 1WEZA 5DETA 2MQQA 4WFAQ 3G8SA 2MQMA 3CTRA 4YB1P 1F9FA 4W90B 2KN4A 1FO1A 3UD4P 2MGZB 3ZZZA 2RT3A 3NS6A 2AYMA 1VBZA 2KYXA 1CVJA 3P5TL 1KOOA 2FY1A 2RQCA 1X0FA 2LA4A 2MZSA 1YWXA 4WFNQ 1Q7YT 2N7CA 1UFWA 2XSFA 1H2VZ 2N3OA 3H2UB 1UP1A 2CQPA 2VODA 5CXTA 1SXLA 3CMES 2EK6A 2JVRA 1D9AA 2K3KA 2SXLA 3VF0B 2MQPA 2DNMA 2YH1A 3J7YU 1FJEB 3Q2SC 3SDEB 3TYTA 2DNHA 1K73T 2DO0A 5GAHU 1DZ5A 2AYEA 1VQLS 3U1LA 1URNA 3MD1A 5H1SV 2LXIA 2YWKA 3CC2S 1WHXA 3K0JA 3V4MA 3CCQS 1IQTA 3MUVP 2YTCA 2OJ3A 1U1LA 1WHYA 1X4EA 2V94A 2VOPA 1NO8A 4Y00A 3CXCR 4W92B 2G0CA 2CQGA 2DGVA 3S7RA 1X4CA 2HGNA 2DHSA 2CPDA 2ERRA 3THTA 5DDPC 2KM8C 1WELA 3NNCA 3UD3P 1DHMA 2OTLS 5FJ4A 1K8AT 2L08A 1WF2A 2CPJA 2MB0B 3EGZA 1X5SA 3G8TA 2CPIA 3PIPQ 4C4WA 3VAIA 2F9DA 1U6BA 4IO9Q 2MZQA 1PGZA 1OO0B 2XNRA 1OIAA 5IM0B 2KH9A 5JVGQ 2MKHA 1VQ5S 2LXUA 1FT8A 5D77A 2U2FA 1VQ9S 2DK2A 1O0PA 2GO9A 5HL7Q 2G4BA 1VQ6S 1SJRA 3S6EA 1WHVA 3R1LA 2CJKA 2CQ4A 4YUDA 1RK8A 2HVZA 1JMTA 5IQQA 1VC6A 1Q81T 1S72S 1VQNS 2N82B 5DM6Q 5CYJA 3NNHA 1M5PC 5DDOC 3IWNC 2NZ4A 4QPTA 2E44A 3OW2R 4CQ1A 2HYIB 3NNAA 4CH0S 2OSRA 1VC0A 2YKAA 3B4MA 3NMRA 2E5HA 3CUNA 1H2UX 3S8SA 2MQOA 1A7GE 2HGLA 1X4FA 1X4AA 2MMYA 1G2EA 2MSSA 2MGZA 3CCRS 3RW7A 2RS2A 2HZCA 1KQSR 2CQ0A 1VBXA 1VQ4S 4F25A 5MLCV 3VAHA 3G9CA 3FEYB 3G96A 1DRZA 2M52A 1XN9A 1M5VC 2MJUA 2DNGA 2DH8A 3U1MA 5CA5A 1FJCA 4WCEQ 1H2TZ 1U1MA 2ZJRQ 2CQHA 5GVQA 3FEXB 5JVHQ 1RKJA 2VOOA 2M88A 1FXLA 2DNRA 4FXVA 3MOJB 2QEXS 2MQNA 1N52B 2A3JA 4ED5A 3S01A 4C0OC 4LIRA 4Y0FA 3HI9A 4PKDB 2DITA 1VBYA 4A8XA 3CCSS 4U67Q 4IOCQ 2K8GA 3SDEA 2LEBA 2DNKA 1YTYA 2KI2A 3J7ZT 2CPEA
chains in the Genus database with same CATH superfamily
3BEGB 3DHWC 4DV4F 1YVFA 1TKTA 2DR7A 3MI7X 3MEGA 2QA1A 1WOPA 4KSEB 4ZVEA 4K4UA 4WP9A 4LF6J 5LXYA 4UW2A 3X1LB 2RF2A 1VRQC 3BDEA 4DFJA 2I2YA 1PIEA 1HNXF 2VPYB 5ETTA 2DXDA 1RT7B 2LQ9A 2ZDPA 4FKYA 2YX7A 2CNLB 1FI4A 2CIMA 2IA0A 4ENOA 2BW7A 4A47A 1KQKA 3MR7A 2W9BA 4HHHA 4BCAA 1MN7A 2X7IA 2LQ5A 1IXKA 5A6PA 1TAUA 3UR0A 2F8HA 2BRKA 2FC8A 3OFGA 2D3OR 4QU6A 3BO4A 5EWEA 2B5JA 1R0AA 3LPYA 3ITHB 2YX4A 2AGQA 4MFBB 1Y7PA 1HWJA 5LJ3Y 3GCWP 3T5KA 3MUMP 3W7BA 1SV5A 4J5OA 1CG2A 3TX0A 4KH0B 2HSEB 4YY3F 3DLBA 2AJQA 2NYHA 1D8ZA 5LT5A 1WNEA 5LMNF 1WSVA 3HFVA 3LGHA 3K5NA 3M1VA 4B02A 1S1VA 3GFXA 4ZP9A 4IFYB 3TZWA 4NCGA 5F8MA 5HP1B 4USMA 4LRAA 1VIOA 5B0EA 2RRNA 3OXFA 3D4JA 1WTBA 2C2MB 2UUAJ 4Z2XA 1RWMB 2G9OA 4NA1A 5J2QB 4RNHA 2VPZB 2Q79A 1T03A 4E0DA 1TKDA 2R8GA 1S1TA 1PAUB 2NXJA 2VQEF 1VDHA 3H5XA 2D9PA 1QAYA 1T9VA 3QATA 2D41A 2ASYA 4YHHJ 1RHMB 2F3JA 4LUBA 2DNLA 2KKHA 3DLJA 5K8PA 5LXRA 1FXDA 4LR8A 4X84A 1Q1KA 1L3SA 2B56A 5FLXY 1KVJA 2JVOA 3IR6B 1LFPA 1TMMA 1RT4A 3LP1A 3F41A 2HPUA 2XB2D 4F36A 5H9EJ 1ZTWA 1HNZF 2CNNB 1CJVA 2AJ1A 3GLJA 1NSAA 4ZPVR 2Y8WA 1CVJA 2QJ3A 1XMOJ 9RUBA 4F4KA 2HQ3A 2L48A 4UTGA 2BM1A 2QO3A 1NJXA 3VR1A 1NJZA 2NXNA 3SDEB 4FF2A 5KFPA 3HVRA 3DDKA 3C15A 5IC6B 4DV2F 2J5AA 3PO4A 3MUVP 2WVBA 1NH7A 2VFTA 2B4OA 4W92B 3M8QA 2UU9F 1UKUA 5LL6d 3UD3P 3D7SB 1MNEA 4TKTA 3HT0A 2YNFB 2HAFA 3LF0A 2P2CB 2XSJB 3SQGA 2ZH4A 1KQFB 4DOZA 2B9XA 3MMAB 2V4QA 1ZAVA 3P5BP 3G6XA 1X9SA 3TI0A 4NASA 4Y65A 1VQNS 2X3DA 1Y0HA 2NZ4A 3HMJG 2K7KA 3NMRA 1SH0A 4ILRA 1CPZA 1SH2A 2OFGX 3T6BA 2CQ0A 4F25A 3BQ2A 2OAUA 4C3KA 2QL9B 4LRFA 3KJFB 4I6AA 3I4PA 1T9WA 4F7VA 1BWVA 1WC6A 1VBYA 3QWUA 4DV3F 4PQUA 1RE1B 5FDLB 3UVJA 4M95A 2CPEA 4QR0A 4LFAJ 2X1AA 4KQZA 5HBMB 1HW8A 5BR8J 2Z30B 2L9DA 3CDUA 2HLUA 3IS9B 3OTDA 1RHRB 1JNZB 3DLGA 4UUXA 4TYAA 1S10A 4CYUA 1YJ7A 3DC2A 2JWNA 3E8OA 2DJWA 4BWMA 2BABA 4PUOB 1X0PA 3HLUA 2QYGA 2G2OA 1IJFB 2UXCJ 3HVAA 5LSOA 1QUVA 3CD6S 2FVQA 4KFBA 4Q8EA 3RW6A 5KFQA 3CJ3A 4WYLA 5DDQC 2JLGA 4KV8A 2LLZA 4P7VA 2VA2A 3UDCA 2AV5A 2ROPA 1FWPA 2MY7A 2XM3A 4F26A 3DRSA 4JI5J 1AZSB 4NLWA 5D3GB 3PHEA 2G1HA 1S97A 1KNZA 3DU6A 2DIUA 2HVHA 1R0CB 3SMZA 1F3VA 2W4CA 6FDRA 3TA1A 3CD0A 3BZQA 1PJ5A 3DI6A 2IRYA 3M05A 5KG0A 4LJMA 4DR6F 3JAMU 4WFYA 1R6YA 2CRLA 3THPA 1Q82T 3B4DA 1FE4A 1Q8KA 3T5HA 1HBMA 4GVLA 1ZH5A 1LFWA 4DZ6A 4UF4A 1KRPA 1F0XA 3SSQA 1TL7A 1RHQB 1N5QA 1RABB 1S79A 3SSSA 2H9ZA 5GMKa 1RT7A 5K8OA 1JLGB 2QSWA 1AB8A 1RSCA 4ED7A 2O01C 2ASDA 1SVDA 1XIQA 2K06A 3JXOA 3MR5A 4ZN1A 1IBMF 2HBZB 1LWCA 1Z2LA 4U7CA 1KLMB 1DBDA 1NSKL 3H40A 2A10A 2DHGA 2D3O1 2CADA 3VZHA 3MDFA 2HFUA 1XTZA 5I3PA 2DO4A 4DU7A 3ITHA 2NUUG 5THWA 3OUYB 2XGPA 4RKUC 3GIKA 1BGXT 3MD3A 5DG9A 1K1SA 3L7UA 3UN5A 3Q8RB 1L3VA 3D2WA 5C2CA 4URSA 2COLA 1QVGR 1MWYA 2OTJS 3RZAA 1GXLA 3NMAA 3UD4P 2QFIA 3C8YA 2GHWA 2BANA 2R3VA 4KGMA 4LREA 3AHPA 4WU2A 2O1PA 4BBYA 3LP0B 1XC9A 1GMWD 4JV5J 3H2UB 3ENQA 1Q95G 1DTQB 3W61A 2K3KA 3M6UA 2CDQA 3OL9A 3THVA 2R4FA 2EBGA 1FDNA 3RG6A 2CAJA 2HS0A 4R5PB 1RWVB 2H48B 4IFYA 3CCQS 5E3AA 3PR5B 5HP1A 1X4EA 3NS7B 1DURA 5T7LA 1RWUA 3MEEB 2RAQA 1C1CB 3DKDA 3R9LA 2HGNA 5AJ3J 3KMSA 2DHSA 4DCJB 2CKWA 5J2QA 4DQIA 3THTA 4ZP6A 5DZ6A 2A2CA 2P9EA 3EPIA 3LGNA 3UD5A 2XI2A 4DHVA 1RISA 2NSCA 4C4WA 2UXDF 3BN7A 4D3HA 5DJBA 4LRDA 4OJ3A 1GT8A 2KT2A 3AH6A 1VQ6S 4ZS6A 4IOBA 4LF1A 1H7XA 5DQHA 4C0BA 4FP9A 3MPVA 4URQU 4U7UK 4OHVA 2OGUA 1JX4A 4V19J 1HR0J 3BPDA 1RBAA 3JQKA 4C2MA 1JLBA 2AJ0A 4P72A 5IT9U 3BR9A 2G0JA 3GU0A 1RT5A 3RRGA 1NJYA 4KIAA 3KUHA 1FNMA 4X62F 2ZE2A 2VOOA 5KFGA 2QEXS 4DR7F 2Z57B 1EIYB 4IH5A 4Y0FA 1HNWJ 5ETPA 1MMLA 3EZOA 3JS9A 1J5EF 1EKSA 3SDEA 2ZH3A 4X64J 3HVTB 3SYZA 2AYBA 4LMZA 4DUYJ 3LAKA 3C14A 4WF9Q 2PE8A 1S7IA 5D6GA 3OXLA 3NOGA 2J7UA 1N32F 3TEGA 2HVEA 5HMYA 2E5LJ 2UUBJ 3QGHA 1U6FA 2J9DE 2NR0A 4OJHA 3KJQB 1UA0A 2VZ9A 1UVMA 2X1BA 1ZM9A 4C8NA 2FJEB 3PXGa 4M5DA 1JKHA 2JLEA 4Q2MA 1ZYQA 2XSJA 5D4NA 2VA3A 2PT0A 1XQIA 2OPRA 2V4RA 4DMZA 2VBYA 3P49B 1Y9OA 2XEXA 2M9KA 1ICEB 1RWNB 1WWHA 3ZZOA 2GNKA 2ZHAA 4RWWA 2HW3A 1F60B 3O5TB 4CLZA 4CLLA 1U2CA 3CULA 4ED0A 2V9KA 3MWBA 1TL1B 3FQLA 4QYRA 2IM0A 3M30B 3SXLA 4HTJA 4H4OB 3H8YA 2O66A 5E5NA 3O6QA 1JJ4A 3CD5A 1BWEA 1FCAA 4FNHA 1DFDA 5FLXU 5DG8A 4JI2F 4EK2A 3RB0A 1OS5A 1LWEB 2ZBQA 1OPZA 3D0IE 5HATA 3ZZUA 4ZP7A 1YJRA 2RRBA 1DQAA 1AT1B 4FZVA 1APSA 1R89A 5HBMA 3TX8A 4DUZF 4ZVFA 4WPAA 1Z4UA 4DPXA 2V5HG 4OLPA 4ZIWA 4IRDA 1FE0A 2XS2A 4K0KF 2ZH2A 1IM4A 4ZCIA 3DXSX 2XI3A 2FZGB 5D78A 3CCLS 2QL7B 2BE9B 2NXUA 4EGLA 1K47A 1S49A 8RUCA 2HIQA 3D0GE 2GC8A 3JYTA 3CCVS 1HHQA 1MSWD 2QA4S 3MMCB 5IT4A 2W9CA 4QWEA 1SIWB 4A48A 2LP4A 4Q45A 4I0WA 3AQOA 3VWSA 1Z1ZA 2PSZA 3DDNA 2CQIA 4M5MA 1KD1T 4UY85 2FJDB 3QAEA 4J9VA 4FF1A 1JXVA 1JB0C 2YPYA 3ILLA 1UWAA 1FJGF 2HVIA 3M8PB 5D3GA 3EGNA 2GMLA 4OL8A 4FYDA 3GJTB 3LANA 3DLHA 2DHXA 4WIIA 4ZVQB 1BE4A 2O67A 1HD0A 1ZM2A 2DGXA 3PNIA 1HWKA 1IBKJ 2MZJA 5D0EA 1SJ4P 2CPZA 2CNOB 1R8AA 4IG0A 2I8EA 2WOMB 4OHWA 2PDAA 1RBOB 3V4IB 1NPPA 4MKVA 1F9FA 1UPPA 3P5TL 2KJWA 4MJKA 1S4EA 3M7VA 4DL5A 2YWFA 5DS7A 3Q86A 2PIIA 3NY0A 4DQQA 4JI3J 4ZCKA 4YB7A 3J7YU 2V0NA 3IN5A 1URNA 2NUHA 2YWKA 4F50A 4KHMA 4LSZB 4UT4A 1JLGA 2R8HA 4FPIA 3AB4B 4L76A 4ES1A 1URRA 2GCFA 5FD1A 1Q53A 1I94F 5HANA 4ZMMA 1C0TB 1REGX 2CPDA 1KLMA 2QLFB 3I82A 3M4XA 5IV3A 5AXNA 3M8YA 1QSSA 4JI6F 2F9DA 2IAJB 1OYDA 3DN9A 3ICLA 1WORA 4IG3B 4ED3A 4JI1F 1SJRA 2BMBA 2V8DA 3MECB 3BJYA 4ZVPB 4IRKA 3OUYA 4DSJA 1RA7A 4J9OA 1Q5VA 3E2EA 3PYGA 2RSQA 3NNHA 3IWNC 3DM2B 4NOHA 2MDAA 4B3RJ 2WVDA 3M9MB 4GKJJ 3BKFA 2ZVSA 1XNQF 4XK8C 3TRGA 1DRZA 2DH8A 2R7OA 3DYAB 2ZJRQ 1YX2A 5F8HA 4FXVA 1SKUB 1S99A 2OPPB 3L7OA 4A8XA 2Q66A 2LDIA 4I4BA 2R2SA 4R8UB 2MLYA 1IR2A 1OY9A 1XMQF 3ILOA 1MROA 2BE7D 4V19X 3W2WB 3TUIC 3R5GA 3CJ0A 3B6BA 3H59A 2DT9A 5LMNJ 2VFSA 2CZ4A 1UW9A 2RIJA 3PW4A 5KFJA 4B3MF 1HL6A 2J76E 3UNYA 4DV7J 2M8DB 4YR0A 3PJWA 3QRPA 3B8HA 5I4MA 4J9PA 1N56A 4PXEA 2IY5B 2BX6A 2KT3A 5AE3A 2KHDA 5L39A 1KFDA 3RR7A 2VQEJ 3AOAA 4RUCA 4DZDA 2AD9A 3ZTSA 2N4CA 4EMDA 2VUGA 2FHOB 5KFHA 4MYTA 2Z56B 3QO9B 2LEAA 3BQ1A 1VCTA 4P2SA 3VGSA 3VHQA 1RACB 3GFZA 2IC3B 1VK8A 2JHEA 1U8WA 3PRBA 4YB5A 4Q43A 1ZM4A 4NLQA 2ZOMA 4UY8T 5KFBA 3O8WA 4JYAJ 1LXNA 5AE2A 2ZM6F 2OPQB 1T9TA 5KFWA 3HVTA 4YP3A 1W2IA 1B7FA 2YXLA 3PW5A 1ZA2B 4CLWA 2CPXA 4HDGA 4A8KA 1R8BA 4EU0A 2FJXA 1EAYC 1EETB 2HS3A 1JLEA 3W9HA 4ZCMA 1GTHA 5K5MA 2DHAA 4KBIA 2E7VA 3KJVB 2BQUA 1RT1B 5IOLA 1V5IB 2VB6A 3FGVA 4TQRA 1T11A 2IVMA 1VYAA 2A2DA 5T41A 3J81U 2M8HA 3I32A 2XO6A 3POTB 3EICA 3MCMA 5I42A 1Q8IA 3I55S 1NZ8A 1IQZA 3HDSA 1LNQA 4MTPA 1FF2A 1XR7A 4RNMA 2W9AA 4H4OA 4CLUA 1U0SA 2HK3A 1HWLA 1TKZA 4K4YA 5KFTA 4USJC 4XTTA 4DL2A 4X65F 3OPKA 4RU2A 3ILJA 2MKIA 3ZZYA 3KHHA 2UV8G 3Q24A 1KHVA 4MMOA 4NXMJ 4F02A 3C16B 3MFHA 5BJRA 3N0VA 4TU9A 4FYYB 3OD2A 1FHTA 1K0VA 4P6QA 1DQ9A 2WTFA 4YB1P 1NZAA 3JSYA 2KN4A 2W4PA 2FJAB 1EQ0A 3ISNC 1WJ9A 1KSPA 4HI2A 2Y0BB 3ISND 4DV3J 3PFEA 1IJEB 5LOQA 1H3DA 4K2JA 1SXLA 3HKZD 1D9AA 2DNMA 2R42A 2Z58B 2PI4A 5HJXA 1KDNA 3RTVA 2AYEA 2EI5A 1HNVB 4QYZK 5A8KA 3KHGA 3F0NA 1LOUA 3QGIA 1RCOB 2CQGA 3EVWA 1EARA 4NWBA 4HR2A 3NGTA 1MWQA 2ASJA 4ED6A 1WF2A 2C3YA 4NL5A 1X5SA 3G8TA 2YNGB 3M8PA 5F9LA 4PG8A 4ILLA 2MZQA 1PGZA 3D1OA 2LXUA 2F63A 4NYZA 2BKOA 1T3OA 2G2ZA 4PZVA 1VRUA 1MN9A 4FDFA 2N82B 1TFWA 2YKOA 2WBMA 2FHKA 2VBWA 2DBBA 4X4PA 2W2MP 3OR1B 4K2XA 2C2RA 3TZXA 5J2NB 3CJKA 3CUNA 2MQOA 1JIHA 2HZCA 2R2TA 2NZCA 1VQ4S 1EX8A 3EWGA 5H9FK 2MTLA 3FEXB 4YR2A 5L38A 3FBBA 3QJLA 5IZHA 3JTPA 1V6HA 4OX6A 2DITA 1YSJA 2J7KA 4DLGA 5H9EK 2GVDB 5ETKA 4YDDB 4ILMA 2HZAA 3PVXA 3LP2B 1MW7A 2UVUA 2EBEA 3DLLQ 1KHWA 3H5SA 4DL4A 4CT8A 2VPWB 1S1XA 2Y9HA 2H4YB 2XY7A 1OJ4A 2QE5A 3C6TB 1VQMS 3SFGA 2IAJA 2VDIA 3TJ8A 3T9ZA 3MF5A 5LMUJ 3MM7B 4IG3A 2Q6CA 1TV6B 3MECA 1NK8A 1B64A 4I1TA 3BH7B 5DQIA 4TVAB 4PXDA 4D3GA 1X7VA 3BGRB 2Y1RI 3TZYA 1UJ5A 3W62A 2XCPA 2DH9A 4URGA 4WJBA 5KOXA 5IXUA 3PEHA 2ALYB 2KU7A 2WB1D 4NX9A 4EFAC 1NK5A 2BZ2A 2XLKA 3EMTA 2QLBB 1X5TA 3QLHA 3FCVA 2PGCA 3TZZA 1RHKB 2E66A 3T1YF 2HMIB 1N36J 2KFNA 5K20B 3IA0A 4XPCA 2PC6A 3A8IA 4O0IA 3GFYA 4OYAA 4P71A 2VD3A 2QLXA 3MM9B 2HHQA 4G1IA 1KTQA 3W2WA 4NLSA 1RAJA 2B51A 1IKYA 1SKSA 1IVZA 4B3SF 4EEYA 4DV5J 3PCOB 1UETA 2XHWA 5J1NA 1YI2S 3ETOA 2WVCA 1P9YA 1C0UB 4RW9A 4DR1F 1M1GA 4KPYA 2PEHA 3KMQA 4IUFA 2QLJB 3KKFA 2YWWA 3RAMA 3MAAB 3WX4A 4RU9A 4OZLA 3CC7S 2EFGA 1HNIB 4YOEA 3R2CJ 4AXJA 4X4NA 1GK8A 4HI1A 4PPDA 2UXDJ 4UQGA 4U9RA 2RDJA 1SUQB 3UFCX 2ZHBA 2MKKA 1PC5A 2WBRA 1KC8T 4ID8A 5AXKA 2DNOA 2UZAA 4N8NA 1TTHB 3MMBB 1SJFA 4U96A 2JEJA 3TO8A 1FK9B 1CC8A 1FKOB 2LECA 2ASLA 1NJIT 2CG4A 1DAXA 2ZBPA 3TVKA 2OPQA 1MWZA 3ADAC 1JXLA 1MLAA 3GP9A 1G3OA 3FZ2A 4ZJOA 4UZCA 2F9JA 4WFAQ 3DOKA 2GAGC 2KB2A 2K3IA 5KFRA 1UVJA 5C42A 1K44A 2FY1A 4DR7J 2N7YA 2B7BB 1KVKA 4EI2A 4CH7A 1EETA 2H5IB 1N33J 5E33A 2VODA 5CXTA 3HZGA 1NUEA 2FVRA 1TK0A 3TA2A 2E1MC 1SBRA 1TMJA 4RBVA 3WC2A 1YJVA 5A8RA 2BVZA 4JI4J 2F4VJ 2IBOA 1H74A 4I69A 1SC1B 4H4MB 2YKNA 1U49A 3DLEA 3POTA 4NA3A 2Y0SD 5KFNA 5J2PB 3TVZA 3KLEB 2PEBA 1FDAA 1BUXA 4WZQA 2JL9A 5EX0A 4K50A 1UFLA 2CWKA 4F4ZA 3PIPQ 4LVNP 1OQ3A 1WSRA 4IH6A 1LKZA 4WP3A 2KH9A 2AGPA 3KG0A 5KOWA 2DK2A 1O0PA 2BJ7A 3NP5A 1VLOA 3OLAA 2ZKUA 3L9ZA 1TP7A 4H54A 1RK8A 3LWMA 3SIPB 2HBQB 1DTTB 4I6YA 3MR6A 3C16A 4QJVA 2E44A 4KGXB 2FVSA 1MMDA 2C2KB 4L74A 1B0PA 2HFNA 1X4AA 2MMYA 3H5UA 2RS2A 3BQ0A 4OYOA 1UTAA 3U1MA 2Z2YB 2ZITA 3W1YC 3DCAA 5T14A 1CBKA 2A3JA 2WHOA 3HHEA 4C0OC 3LGMA 2P9GA 2BV3A 3HJFA 3NRBA 3RAXA 4LQ3A 5F8LA 3EPGA 2WSFC 2ZH8A 1HNVA 3EDRB 1JJ2R 2EW9A 2V63A 4RL1A 3FQKA 1S48A 2IRXA 3W65A 2FJVA 1SB6A 2I0XA 1QTMA 2XMJA 5A76A 4U8YA 5A8WB 1BMQB 2NYIA 3HM9A 3HHLA 5AXMA 4OJGA 2VBZA 2FGCA 4JI7F 3B82A 3GIJA 1RT3B 3VALA 2XC9A 1H6KX 1X8DA 4A8OA 3HF5A 3DOMB 2A6MA 4N8OA 1U2FA 4OLOA 4ZLJA 1QM9A 2YWGA 3R5JB 1WKLA 2DGQA 3CB4A 3MAHA 2KM8B 2IM2A 1R3NA 2AYGA 3Q83A 1GH8A 3IG1B 3GV7B 2XULA 2JX2A 1Y5IB 3M8RA 2VONA 3V6JA 4KHPF 5E41A 4PG6A 2FLOA 3PW0A 5KFMA 2PMHA 4KYZA 3BSOA 4C11B 3OR1A 2QT7A 1GNKA 1I3OB 3N01A 3BO2A 4CO5A 3OBIA 2ZNYA 4LFBF 4JI8J 2HNZA 2KFYA 5CD4A 1K1QA 2V9WA 1RKIA 2MQ8A 4U8VA 2CZVC 3WDOA 2GVDA 2HVDA 4TLQA 2DNNA 3LQVA 1QE1A 1RGVA 3LP2A 4ZVRB 5CABA 4B3TJ 5CAAA 3PTWA 4KH1B 2V4JB 2IJFA 1HQEB 2UXBF 2R7TA 1NEEA 4H4KC 1R27B 5KFXA 2OIHA 1CJUA 3HPOA 1TVRB 1U6ZA 5JUMA 1D9FA 3MXHP 2HS4A 1UMJA 3MM7A 1TV6A 4JP8A 2V67A 4QIEA 2DRAA 2EFNA 2DGOA 4FYWB 3L95X 4DUTA 3BYRA 1YJUA 1FRJA 1U47A 3F73A 2FPHX 4QWCA 3GB0A 2WSEC 4PCQA 2A6OA 2HZVA 4DQPA 3UI3A 3RAQA 3W66A 4ZK7M 2YY3A 3FSYA 3D3BJ 4JI1J 3OLBA 4GVBB 3TJAA 4MAKA 2D9OA 1G4CA 3MEKA 2L9WA 2K1RB 1HW9A 2MHNA 2V8PA 3N79A 2KTQA 4K5RA 2CPHA 4WWSA 3H98A 4LSLB 1L3KA 3SCJE 1NK0A 3ZTOA 1FKPA 3G8SA 4NYOA 1UPMB 2F4FA 4K59A 2KYXA 4DV6F 3FBFA 4ZVHA 1HKAA 2MZSA 1HHSA 2HQFA 3PZPA 1Y5LB 3UW1A 2BJ8A 4N47A 2SXLA 3CDBA 1GEHA 1FJEB 1R0BG 3MAAA 4OZ5A 1XNRJ 4L75A 1GFWB 1IKXB 4DL3A 4C6AA 4OHYA 4Y2KA 1HNIA 2YTCA 1U1LA 1FXRA 3UR3C 1RWOB 1LWXA 5B0DA 2ZVIA 1X60A 1P8GA 1V3SA 3AOBA 4DR3J 2C3PA 2V8HA 1EJ7L 3P45B 1MU2B 1AXQA 1SUQA 3OTBA 2DCLA 1QY7A 1WDDA 2Z2LA 5F3TA 1TUVA 3ONQA 1AA1B 1U6BA 3K8VA 5GAEI 3D66A 5CYQB 3AJDA 1PYTA 2LQBA 3NG8A 5JVGQ 2GA7A 2BOAA 4YS2A 1FK9A 5L1KA 1WHVA 3GYGA 4OZJA 2F7VA 3JSMB 4F2SA 1S72S 4AE5A 4QR1A 4G1QB 3G82B 4X4TA 2GW8A 1CQNA 4NLGA 3NWGA 1Y3JA 4KGZB 1N5YB 4AFFA 1X4FA 3EJMA 1XK8A 1IBLF 4HHJA 4A46A 4DWIA 1RCXB 4DBQA 1EP4B 2CQHA 2DNRA 5L1IA 2EKYA 1DJ0A 1YRXA 2UVWA 3C19A 4ETZA 3K89A 4M5KA 3CCSS 2YBVA 1JK9B 2LEBA 3I0RA 3MOZA 2JZ5A 5KFZA 2FQQB 3FFIB 3PHTA 4DR5J 1LWFA 4Y2AA 3D6MB 3WZ0A 4H4MA 4KO0B 3ZO7A 2H4WB 1KLNA 4NMXA 1IWGA 1UJ6A 2F8EX 5K9FA 5J2PA 2PMWA 4DR2F 3NS5A 1UAWA 3W2VB 2ROEA 4ZPTR 2HGMA 2ZFHA 5ETLA 2JEFA 2IM1A 3RUBL 1N88A 3K5MA 4PG5A 2YKQA 3NCRA 4DV1J 2L3MA 1C4AA 3JB9k 1O6XA 1RLCL 1CSJA 2DGUA 2VFVA 2NPFA 4WKYA 2BE2B 4FN5A 2DHHA 2E9TA 3AB2B 4LR9A 3WQPA 1C1BB 1NB2A 2HRYA 4W4MA 2VJUA 1RDRA 2KXFA 3C2PA 2HHHJ 4P74A 3EYZA 4A8WA 4EBCA 2CQDA 4P52A 3CMQA 2CQ1A 2C42A 1M5OC 1WEYA 3T41A 2KFZA 2KDOA 2MKCA 3JAMY 3I0SA 4B3OA 3JTOA 2IMWP 5B0BA 1LW0A 4PYDA 1B99A 5KFDA 3OHAA 1Y11A 3R1HA 3CDEA 2DR8A 4Q0BB 4UQTA 2MPUA 3D6HB 5E7OB 3T1HJ 4B17A 2M0GB 5EN1A 4EO6A 4PQAA 5A8WA 4C48A 3P6YC 2EC2A 1OWXA 4DDFA 4P75A 4U95A 3OJUA 2BBEA 1RT3A 4QW8A 2HQCA 2PN6A 3HX9A 2JOQA 1LK7A 4J9NA 3OTCA 2V6AA 4AL7A 1YKWA 4CRJA 3KLGB 4OX9F 1VQYA 5JMNA 3UCUP 5EWGA 4Z7YA 2GIQA 2AHOB 2HQDA 4IYQA 4ZA1A 2EFOA 3D1QA 1KQGB 3AXKA 1X5PA 4N77A 1U0HB 3CSKA 5HQLA 4F3QA 1MG7A 3AJ2A 5A2QU 4LF4F 3LO3A 2RRAA 4RZRA 2VQFJ 1LEOA 1SC3B 2CVEA 3CJRA 1HWIA 3H2VE 3O2IA 1WDTA 1AUSL 3BB5A 4GC6A 2YNHA 1UVKA 1NSQA 4UOHA 3FRYA 3RBEA 4F4WA 3DRPB 5L1JA 1SKRA 1TQLA 1FVSA 2E9ZA 2PFFB 3MM5B 1NDKA 2KVIA 2DR9A 1NXIA 1B70B 3H5YA 5RUBA 2G1DA 2DNQA 1FO1A 3ZTPA 1RTZA 4DSFA 3A3OB 3M6XA 1HQEA 2LFVA 2XSFA 3GSIA 1QJHA 3CCTA 1X9MA 3A12A 2JNJA 1YGYA 1TVRA 4CP5A 3C66A 3CIZA 1RTHB 4AD6A 1S0VA 2DNHA 2HNDB 4LF6F 1LW2B 3JSRA 3N28A 2QIFA 2H5EA 1RTJA 4DL6A 1RU1A 1YBAA 4NRUA 1S0NA 5KFSA 4QWBA 5B08A 1CJKA 4ZJLA 3JQJA 1WELA 4HL9A 4GKKJ 2VG6B 3U02A 2MB0B 1Y10A 4DX5A 1N5VA 1M5HA 3LA0A 4GVBA 4ECZA 4K4VA 2EKNA 3C3LA 4RX6A 1FT8A 3IAM9 4FNIA 4N56A 5HL7Q 2IDEA 1RB0A 1PJ7A 3OXGA 5ETOA 4ATNA 4QPXA 4N5SA 1N5SA 5KFCA 1JMTA 2I6WA 1Q81T 2CJBA 1AYEA 4F4YA 4LSLA 5IT9Y 3MPUB 3D6TB 3CCZA 1NK9A 3B4MA 4X4RA 2HGLA 3W60A 4KTQA 1G2EA 3CCRS 1GTEA 3RW7A 3SV4A 2KO1A 2DNGA 2AEJA 1JLCA 1L5UA 2VG7B 3W9IA 2C28A 2IFXA 5GVQA 2C2OB 3BR8A 1RKJA 2E1AA 4FS1A 1N52B 4ED5A 3S01A 4JV1A 4NXNJ 5D0GA 4AUKA 2XZDB 3R7NB 2AJFE 2P6SA 4KRWA 2RKIA 4NEZA 3M2RB 3GILA 1YZ6A 4ZPWR 4ERDA 4P2MA 3MUTP 4RW8B 2FJBB 4NCAA 3Q8PB 1Q7LB 4ED4A 3L3CA 2VF3A 4DLEA 1NK4A 2Y1IA 5I3QA 4KGVB 1S6UA 3N9UC 4CM0A 1F5AA 2UUAF 5C25B 5CYQA 1OPIA 2C2EA 1TK8A 1TU0B 4OZ1A 2KL8A 2C3UA 5DZ7A 4K4WA 4QIFA 2BXJA 1KFSA 3UDLA 4K4SA 2B8PA 4TY9A 3JSMA 3VAKA 4L72B 4ICLB 5KT6A 4G1QA 2X1FA 4NLXA 1T05B 4YHHF 3J7YI 5D4PA 1U1PA 3VAMA 4C8OA 1N5YA 2OHDA 2LQ8A 3J7Z5 3DHXA 2RE1A 1WF0A 3W8GA 2YWHA 5ETQA 1RYRA 2DB1A 2ZWOA 2GGPB 3GCXP 1BQMB 1L3TA 2P5VA 4RNNA 1EP4A 3PDNA 2IJRA 1WKJA 3R5BA 4Q44A 3IC1A 2B0GA 1J2VA 1XMOF 4IOAQ 3VAGA 4XPEA 3KK2B 3FFIA 3R7BB 4PG7A 3GV5B 4R0JA 4ZPCA 4AXIA 2D1CA 1RWPB 2C1EB 3KUEA 4KO0A 2EFVA 1UJ4A 1LK5A 4UOCA 1S0MA 3BREA 1F6TA 3ZZRA 1RADB 4OYZA 2ZBIA 2KT5A 1NAQA 3V81A 3W2VA 1R6VA 2MJNA 1NHKL 4QIVA 1RAEB 3UN2A 1E6VB 2W01A 1F9HA 1TELA 4XDDA 3PEJA 3GG0A 2POKA 2NLWA 3NGSA 4IDKB 1VJQA 2OSQA 2DPIA 3FEZA 4KHRA 3CEDA 3DXBA 3PR4A 1D8YA 3TAQA 5M2PA 4X4OA 2MY8A 2JLFA 1U24A 3RYLA 4CO4A 4DV0J 4OI6A 4FXDA 2JJ4D 4P2FA 3FJ2A 3FVYA 3FDSA 1N0VC 3GWCA 3CT9A 2OEKA 2ZZMA 3BV8A 1T9YA 1VISA 2QFJA 1PBUA 1REVB 2MSTA 1F5BA 4IFVB 1YIJS 4OYBA 5L1LA 3SV3A 3BBBA 1M0SA 1U1QA 4YR3A 1GMWA 2GQCA 3LAMA 2J9EA 4CLSA 2HK2A 2MQQA 1UEVA 1JWWA 3IWLA 4IH7A 3ZZZA 4PXCA 2RT3A 4LF2A 5KFIA 1E6YB 1N34J 1KOOA 3TAPA 3ZTQA 4HT7A 1M5SA 4LFAF 1NK6A 2N7CA 4G6VB 5ETMA 4OMFG 4JV0A 5BR8F 1NMEB 3CDWA 1SJ1A 4FPRA 2RDIA 3W63A 1K73T 3MR2A 1HQUA 5GAHU 4DPTA 3I87A 1VQLS 4U6PA 3MD1A 4HACB 2J6TA 4EUVA 1JLQB 1Q16B 2BJEA 4PPZA 1WTFA 2K2PA 4X2BA 2J6SA 3FKBA 1U09A 1RA6A 5IC4B 4ECTA 1TUWA 4ECRA 2Y1LB 1UWBB 1U0HA 3S7RA 2UXCF 2ZZNA 2I5JA 1UZHA 2KZMA 3DLKB 3NGRA 1XBWA 2BKPA 1OY6A 2VASA 5EGYA 5M2UA 2V50A 4WE1A 1JLFA 4ZVSB 1CULB 3NXZA 3N6MA 5IS2A 1RZMA 2F5GA 3WX8A 3DRPA 4JI5F 2RH3A 3PKMA 3MM5A 2E7XA 1FWLA 1HBUA 4LR7A 3GJRB 2D7SA 3K17A 2KZZA 4ZDNA 3GQCA 2GIFA 2H3EB 1FA0A 3J7A1 3BSNA 5MLCV 3OR2B 5ETSA 2CDRB 6AT1B 4DI6A 3J80Y 2DD8S 1ROFA 1V9OA 3BF4A 4LF7J 4LIRA 1W7WA 4Z7CA 4OI3A 3LW5C 2FHJA 2RD5C 2KI2A 1LW2A 3J7ZT 2ZNZA 4DPOA 5GAEU 4RBUA 4YEAA 3M9NB 2OD4A 2MQLA 4F0KA 2UVRA 4L73A 1TKTB 3TARA 1SC6A 3MEGB 4LF5J 4QIWD 1B0VA 2XS7A 4R25A 5D4OA 4G65A 1YQHA 3Q22A 3UE2A 2VBXA 4K7QA 1WC0A 3C6UB 1S12A 4C98A 3G6VA 1FEHA 5EDWA 5HAOA 5EUHA 3MPYA 4E8UA 2W2QP 1PBAA 1YJNS 3BGLA 3OSPA 4O3RA 5E3CA 1FRKA 4IRCA 5KT4A 4ZHRB 4QIGA 8ATCB 3DRXA 2CXEA 2W9BB 4TU7A 4WIQA 3TWZA 3GJSB 1YLXA 3TNVA 2ZJQQ 1RQ0A 4DR4J 3BSAA 3KLIB 3CJQA 3CVKA 3VGUA 3O3LA 3UDEA 2U1AA 4OZ2A 4MFBA 2MLZA 1UVLA 1HARA 2B5JB 3OVBA 1R0AB 1EKRA 2C3MA 1IUJA 4J9KA 1P1TA 3NL0A 3BO3A 2FB0A 4DF4A 1VOMA 5A6WA 3I96A 4FYVB 4IQMA 2HBYB 1S57A 3EZUA 4JV5F 2B9WA 3OL7A 1ELOA 2W2NP 4J9UE 3BDPA 1F5CA 4RW8A 3G4SS 2GZOA 1NK7A 2B43A 3V6KA 4O3NA 5KFOA 2ADBA 5A0YB 2GV1A 4O3QA 3KK1B 1LQ9A 5C25A 5AJ3F 3TW0A 2YNIB 3ET6B 3HHLC 1YITS 1WC5A 5HSPA 4B9MA 3J81Y 1Y5NB 3MGJA 3LTOA 3HHLD 1HMVB 3M1VB 1S1VB 1UW4A 3GG1A 4DX7A 4RW6B 5HLFB 1U48A 2RILA 4ICLA 2QTWA 3MAQA 3IR7B 3ENWA 2ZH9A 2C22A 2XNQA 4RO0A 3VZIA 5DGBA 5CZXA 2R7UA 1HR0F 1WG4A 1BQMA 1S1TB 3KLVA 4ZLLA 3BGUA 5D0HA 2P8IA 2AIRB 4F4XA 1CQMA 4AYBD 2FJWA 2HQGA 5IWAF 2FLLA 3KK2A 2CNKB 1IBLJ 3Q23A 2LA6A 7FDRA 1HNWF 2MQMA 3CTRA 5F9NA 3BSCA 1VMBA 3E51A 1ZA1B 2G0IA 3NS6A 2V68A 1CJVB 4X64F 4YMEA 2FVPA 2XQCA 1U4BA 4X66J 1PILA 3N5FA 1UP1A 2ZKTA 4QZVB 4DN9A 2E5LF 2XYHB 2J6UA 2XHCA 2OP5A 1TZ0A 3I4HX 4IDKA 2GIRA 3M2UB 3W3SA 1T8EA 1NRKA 3GIMA 2AX0A 4LF9J 3AODA 2RQMA 3H7HB 1X4CA 4Y28C 2ERRA 3M8QB 5B0CA 4LBIA 1DHMA 5BYSA 2YNFA 1KVIA 2L08A 2LVWA 4A8SA 2YQ1A 2UUCF 2J0XA 1GXUA 2XLIA 3MMAA 4PG4A 4AQYJ 3SZ2A 2VFUA 2ZDOA 4ZIVA 3W5ZA 3PV8A 4Y3CA 3RGIA 1UCNA 3R1LA 1QLNA 3IR5B 1REVA 3W5XA 4HTIA 1RP5A 1NCLA 2B4VA 4OHXA 1NLKL 2ZEJA 2V8GA 1R8CA 1ZAWA 2AP6A 2W4DA 5CYJA 2YKMB 2CYYA 1VC0A 2BYCA 1VBXA 4OYPA 3G96A 4LFCJ 1FJCA 2FZKB 1WC4A 3MOJB 5FDLA 1SI9A 4OYXA 3ETMA 3K7RA 3QRRA 2K8GA 4B9NA 2OKQA 4PWDB 1VJWA 4PQUB 3UVJB 3IS9A 3FSXA 4ECQA 2IRUA 4RLEA 3M6WA 2IIHA 4I2PB 3DRRB 1UWBA 2DGTA 2UP1A 1UFKA 1C2PA 2YQ3A 3G86A 1R8HA 1Q86T 3DLGB 2DIVA 2B6AB 3EZ5A 2IMOA 1FD8A 3MURP 2DGWA 3R27A 5HN0A 4PUOA 3CCES 5KFEA 1WI8A 4CYUB 1V3ZA 1BD6A 1CULA 1D3WA 2Y3YA 4ID5B 3W64A 2H1YA 1W26A 2YH0A 2BUNA 1QVFR 3L09A 1Q4RA 1Y3KA 1S76D 4I67A 1KWMA 2DGSA 4Y34A 3FZBA 3GZ7A 1BXNA 2Y1JA 4J9LA 3HSGA 2ZOGA 4N41A 2DNZA 1AZSA 3KG4A 3T5JA 1W2BR 3V2UC 4KV8B 5EWFA 1PC4A 4JI0J 1X4HA 4WBFA 2DH7A 1A6LA 3OR2A 3DRSB 4DSKA 3EE3A 2DR6A 2C2ZB 2JEIA 4DPUA 1H7WA 2FVCA 2JDJA 2J0WA 2HHTA 4A8MP 1FRIA 1SJ3P 2PI5A 3OT9A 3KJNB 3HVWA 2NQPA 1FESA 3MM6B 3V6HA 3GSDA 4JI3F 3OVAA 1T9UA 4KR0B 3ZZPA 1VGYA 3QYYA 4X4QA 3S1TA 3OSNA 3CJSA 1R7IA 1U1RA 4DJBA 2Q43A 2ZC3A 2CPYA 3EXCX 1VQOS 1HBMB 2UUWA 2MZ1A 4DV4J 1PSDA 1VHIA 3C6UA 2WB4A 4ZLPA 4TU8A 1TL7B 4HVZA 4M5IA 3EGVA 5KTQA 1FEEA 3CJTA 4M63A 3U27A 3I56S 1ZS6A 1U1NA 4TN2A 5L9NA 5D8HB 2KXHA 2OMLA 3QT7A 2R2UA 3K59A 4ZHRA 1HNXJ 4J9RA 1P6TA 4I56A 1RTDB 3MCSA 3KNAA 1LWCB 2MKJA 1I6JA 4FBUA 1ZM3A 1F9EB 3KLIA 2PO4A 2MZRA 3DDIA 2FDNA 3HHNB 4B3RF 2RNEA 4GKJF 1VHFA 2PD1A 4Q7AA 2E5JA 1PKUA 3RR8A 4ECXA 2LDYA 1S9EB 3PM9A 4O3PA 5BXIA 1VC5A 3OFFA 1DARA 2WONB 4ZN3A 3BGFA 2VL1A 5DO2A 2HIYA 2AU0A 4M94A 1RAGB 3LP0A 2V8VA 2BANB 4QYZJ 5E2QA 1YWXA 3J80U 1DTQA 1FRMA 5DLGA 2DRDA 1H2VZ 4ANEA 2DTJA 1T3NA 3RB6A 1KONA 3D5MA 2J9DA 3I5BA 5L8RC 3R7SB 5A0YA 2MQPA 1RAAB 1TL3B 1JNRB 4R5PA 3KK1A 5KFAA 4B9SA 4UZBA 4YY3J 4CDIA 4EYIB 2YNIA 3ET6A 1ZPWX 4F0MA 1FDBA 2LXIA 4ZJQA 4Y2IA 3MEEA 1HMVA 1C1CA 4LQ9A 2V94A 3Q8SB 1NHVA 4RW6A 5HLFA 4DV7F 1U2RA 3AT1B 3D68A 5T7LB 1HIYA 1FERA 2XGQA 2R8IA 1S1WB 5U47A 3WC0A 4TQSA 2KM8C 2HHWA 3NGUA 1PYOB 4CTAB 1J5OB 4C0HA 4DG1B 3GIRA 3VVTA 3N5BA 4IO9Q 2X51A 1SQFA 3SFUA 2CWXA 1VQ5S 2XCAA 5D77A 2IJNA 1VLYA 3HD1A 2BKNA 4YUDA 3I9ZA 5IQQA 4WFXA 1M5PC 5H9FJ 5K8MA 3CGIA 2QG9B 2YKAA 5AE1A 1WKKA 3IRXB 1H2UX 3S8SA 2G13A 8AT1B 3FC9A 4JYAF 1JLBB 3ZZTA 4M5GA 4Y2CA 1FDDA 3K58A 1N6QB 3K5OA 1RT5B 4WCEQ 1U1MA 4J9QA 4A8QA 1BQXA 2OUGA 1HNZJ 2OFHX 2ZE2B 3DU5A 4RW7B 1VRTB 2DNKA 5JXSA 5SZTA 4KGKA 1ZOTA 5D4LA 3M2UA 2JFDA 3C14B 5GADI 3OTOF 4O44B 1NDCA 5G4DA 3BYPA 1H73A 5SUHA 4DV2J 1K9MT 5HO4A 3OFHA 3G2XA 3QBCA 2XWXA 2RQ4A 4DCOB 3GYNA 3R5CA 2XS5A 4OV1A 4L3KA 4M5DB 3GV8B 1JKHB 3CD7A 1RI7A 3IO1A 5E3RA 2UU9J 5HK4A 3U1NA 4V1Ak 4NI2B 5D15A 2UUTA 2OPRB 4ED8A 2WW8A 2QA2A 1QAXA 3LALA 2YKMA 2GQ2A 2ZH6A 1VK3A 1TL1A 4JB8B 1FTCA 3SSRA 1YRUA 4PEOA 1IR1A 1N8RT 3M30A 5KG7A 4RWXA 4NXMF 2D3UA 4QU7A 5M2RA 2HFZA 1WC1A 3SCIE 2BOPA 4DF8A 1TR0A 1LWEA 3MTKA 1OSCA 2J0SD 4CZCA 2C2DA 3CCWA 2HFVA 4X4UA 1HPZB 2WRMA 1FRLA 4PWDA 2AKWB 5E0OA 3GR0A 1YHQS 4OZ3A 1KOHA 5EX3A 1VFJA 2CQ2A 1NM2A 2RUGA 3VQTA 2QZ8A 3A8JA 4I2PA 4K4XA 3DRRA 4GC7A 4WYWA 1FX4A 1QAJA 3QNWB 2F40A 1TL4A 2B6AA 2M2BA 1T94A 2HHPA 4JUZA 2CQ3A 1SQEA 3TANA 4ID5A 5K8NA 4HH1A 2J0QD 3MMCA 4FYXB 4LVOP 3A8KA 2M5YA 4ER8A 4FS2A 3CJ4A 1XERA 3UQSA 4OI2A 2IA6A 3JYTB 1P1LA 4WTYA 5MAOA 2AF6A 2HKEA 3GJQB 1DLOB 3GPAA 5D0RA 2W9CB 1NBEB 4ZPAA 3DOLB 3R8YA 4C8LA 3VTIA 1P9QC 2A18A 3UO0A 4PWWA 2X3GA 2Y8YA 1RWWB 2PA8D 2AJ4A 2D74B 2LU2A 1N0UA 4CT9A 1NPKA 5CD4H 2JRSA 2NCKL 3Q8UA 5AT1B 2WOMA 5F0UA 4ANDA 2ZBCA 3V4IA 2XG8A 5EHHA 3PJ9A 2ACMA 5KT3A 4IG0B 1WEXA 1TKXB 1VQSA 1Z2ZA 3MM6A 2FD2A 3O44A 4NRTA 3HULA 4IQXA 5F8IA 3OFEA 1XR6A 1FFWB 2V2QA 3HHDA 2ZWPA 3KNGA 4DR6J 2N3OA 2XMKA 3IMQJ 3V6DB 3CMES 2JVRA 7AT1B 4ECWA 2XO7A 2YH1A 1RYSA 3HSDA 3I9V9 1L3UA 2QRRA 3JTNA 3QQCD 1Q78A 1NKEA 4DN0A 2DRBA 2HHVA 1IQTA 4DX8H 1H98A 1WHYA 3RJMB 3RBZA 3M8ZA 1C0TA 2BQRA 3CXCR 2XMWA 4EBEA 2QMXA 4MKYA 2R9LA 2FZCB 5LMUF 1RTDA 1ITPA 2LQJA 4MKAA 2OTLS 1A0OB 3QRQA 3WHIA 2NXCA 4QOTA 1IN0A 4K5SA 3QJPA 1LV5A 2EPIA 1IBMJ 1Q5YA 3H4DA 2ZZTA 4C97A 3CJ8A 1S9FA 4KAIA 1M1HA 2W24A 1B0TA 1S9EA 3DM2A 1OY8A 4MIWA 3M8SA 2GS8A 4KKOB 4N7TA 4QPTA 2DVIA 2WONA 1Q79A 2W7AA 1N36F 2WK4A 4RNOA 3DYAA 1PJ6A 3FEYB 2OEMA 2OI2A 1U26A 1NNDA 4KC5A 4DSLA 2VC1A 2OPPA 2AZ3A 1KR4A 2GO8A 3A8EA 3NCQA 3ZTRA 4RPFA 4LBPA 3ZXWA 1TL3A 4R8UA 4U67Q 3R3TA 4DV5F 3EUNA 2QGFB 2MLXA 2HQIA 4KPCA 3DGPB 5ETVA 2FY8A 3FNNA 3TA0A 4OI1A 3M9OB 1YJWS 3UDVA 3OV7A 3CMAS 1MROB 4FF3A 4J9SA 3VGVA 2KXNB 2YVSA 2GJIA 3UPFA 4MK8A 3BGOP 1S1WA 2V2KA 4LRCA 2XBPA 4Z37A 1M5KC 4CTAA 1J5OA 2DEIA 4FF4A 4DG1A 3FBCA 1JLAB 3CC4S 1XJWB 1O8BA 3EGWB 4U7UD 1WC3A 4CIOA 2XZTB 2VPXB 1WD6A 2I9SA 5FIIA 3HFKA 3O1LA 3ISZA 4EO8A 1I1GA 3CF5Q 1YRTA 2YKPA 1WACA 2CJYB 1TFYA 2P9CA 3OHBA 4TLRA 2WZ1A 2G2YA 3KHRA 3IRXA 3MCOA 3PW7A 3QO9A 3KLFB 2QYCA 4UOFA 3AFGA 4NLOA 5GAGU 4DSIA 1T9XA 2IC3A 1N6QA 3EX7B 5IWAJ 2QLWA 3QSIA 2NXEA 4RW7A 3Q0AA 1M90T 3UN3A 2CUYA 3GONA 2BM0A 4DSEA 1VRTA 4OYWA 1PG5B 3H2LA 1N33F 3QT5A 4EWTA 1YJ9S 2V2ZA 4X62J 3IWXA 2EVZA 3H25A 3MHYA 3B54A 4YN3B 4H4KA 2ROGA 5KT7A 1O5JA 3RRKA 3WIVA 3FMWA 4O44A 2ILZA 2DNPA 2RVJA 3CO0P 1J5EJ 1UEKA 4QBUA 4O23A 5IT0A 2YPZA 4CM2A 4KT0C 4JI4F 2F4VF 2BW2A 2FHJD 2FUG9 3KJVA 1JLEB 1RT1A 3KWMA 4P2XA 1N54B 1N32J 2W2OP 2WVFA 2HBRB 3HSJA 2CZ9A 1NU4A 1KTVA 2J8SA 1T7PA 4C8MA 2ILYA 3QAUA 3OTEA 5F8GA 4ZOSA 4NI2A 4J90A 4BC9A 1HD1A 1BLUA 3EVOA 5KT2A 4ZP8A 5A2QY 2GJFA 3ZZ0A 3ILIA 1FVQA 3N6NA 2UUCJ 4MKBA 2L41A 5I42B 4PWUA 3P8BB 2M7SA 5KFLA 4YFUA 2JSXA 2VKZG 1VQKS 1IR0A 2J7WA 4DL7A 2VKRA 1U1KA 2YX1A 3K5PA 2DISA 3QT8A 3VAFA 1SJQA 1VR6A 2CG8A 2H51B 1Q0NA 2LCWA 4L6V3 4E98A 3A13A 1TKZB 1XMBA 3OL6A 4I68A 1T0TV 1HPZA 2R7WA 4M1KA 4NLYA 2CJQA 5KFKA 2MGZB 3QT6A 4NLPA 4JI2J 1VBZA 4USUA 3ELHA 5CZVA 1Q7YT 1KP6A 2W8KA 2ALZA 4Q8FA 4DEZA 4DUZJ 2OLWA 4DPYA 2QA4G 2DY1A 3RU0A 1U7LA 3AD9C 4JV2A 4AT1B 2O5DA 4J7CA 4MIBA 3H42A 3VGTA 4K0KJ 4LF8F 5A8KB 2VOPA 3NCPA 2VHGA 2OO4A 1DLOA 5KG3A 4OIXA 2B3TB 2B9YA 3DOLA 2YNGA 1U45A 5FJ4A 1K8AT 4NZ6A 4TNOA 5HROB 3D9BA 2YWEA 2MHEA 1HWUA 2APOA 2XNRA 4USHA 2U2FA 4PABA 3WIUA 3KLHB 1I5OB 5F8NA 2HVZA 2HLTA 3QGGA 1YG0A 3T3FA 3GTYX 2CA9A 2VG5B 2BQ3A 1FJGJ 4NLRA 5J2NA 3D67A 1VRUB 3CE8A 4JI8F 4QR2A 1V3RA 1TKXA 1KEKA 2NS1B 4IR1A 1NDLA 2HNYB 3T5LA 3CJKB 2W8LA 5J2MB 2OD6A 2DEJA 1R43A 4YDXA 2BDPA 5CCLA 5JVHQ 2M88A 1FXLA 1XEZA 5IQ6A 3V6DA 1ZBTA 1V5VA 3IGVA 4MH8A 4ANCA 4B3TF 1B7YB 2RUSA 4NLDA 3ZC4A 2E1CA 3F44A 3G87A 3D3CJ 3MMJA 2HG4A 3TUZC 4OYMA 1MMNA 4YB6A 2EWHA 3MEDB 3MPWA 5E3QA 3CPWR 4WXWA 4CLTA 3HKWA 3KG1A 4DCPB 5B0GA 5L46A 2C3OA 4CNYA 2AT1B 3C6TA 3HSZA 3QWPA 4PR6A 4CO2A 2V2VA 5HQMA 1S1XB 3FK4A 2F1FA 2H5JB 1I94J 3KHLA 2KRRA 1U1OA 3NBPB 4OV6A 5KG5A 1BC6A 3BGRA 1NKCA 1AUDA 4JI6J 2B9EA 4KKOA 3KK3B 3QZ8A 1JJHA 3BH6B 2OH2A 3Q2TC 2VJVA 5GAHI 3AD7C 3TUPA 3P96A 4IR9A 5G0RB 1SH3A 1N48A 4BS2A 1WG1A 3UWTA 4CO0A 2XMAA 3IBCB 4ZKAA 5DLFA 2GJ2A 5GADU 1BHNA 1GAOA 3TP2A 3A3PB 4UOGA 3HO1A 2LYVA 1VIXA 2HMIA 3QLHB 3CIMA 4ELUA 1X31C 4C7QA 3VVUA 2R7XA 1XNQJ 2GVZB 3CDAA 4I2QB 4RBTA 2GX8A 9ATCB 2NSBA 3MM9A 2ADCA 3MPDA 3DGPA 1RT6B 4RNFA 3K57A 4ES3A 4R0EA 3GE9A 4IO1A 2KVQE 1XNRF 3H4BA 1C0UA 4K4ZA 1HI8A 2FC9A 1RAFB 4DQSA 2E7WA 1YJTA 3A3NB 1IKYB 1HI1A 5LSLA 4GRSA 1XMQJ 1GX6A 4WFBQ 4RW9B 1S6QB 3E01B 3M2VB 2MXYA 1B3TA 2XZWA 4DR3F 1JLAA 1D9DA 4X4SA 3MM8B 4ZVOB 2B8QA 2QMWA 3QGPA 2BR0A 4ELTA 4B3MJ 2FLNA 2WW4A 3TQ1A 3IRWP 3KLFA 4F3OA 1JJCB 3IXQA 5DM7Q 2DXFA 3MMBA 1RUSA 3SEOA 3PRDA 5F8JA 2BJ3A 4RUAA 1FKOA 3PACA 4DFKA 2FIUA 4G3IA 3QIDA 1TL5A 3HHKA 2RHSB 2DY9A 3QPIA 2ATLA 4ELVA 4WXOA 3DRYA 1RHJB 1W25A 3MTJA 5DETA 4KE5A 3TVYA 1AFJA 2B4PA 4BWJA 2QC3A 1ULRA 4DX6A 3DOKB 1NPRA 3X3UA 4B9LA 4FVCA 5C42B 2RQCA 2ZM6J 4NYPA 1IBCB 4WFNQ 1B4SA 4DR5F 1FTRA 5CYMB 3CWJA 2BJDA 2HURA 1S4FA 2FYXA 2C2NA 2DO0A 2W7OA 2FGOA 4P7TA 4ED2A 3Q8VA 4G1PA 2EFPA 2GMHA 3OTOJ 4C9DA 2ZHOA 1CS4B 2Z8QA 5A8RB 2R2RA 5KG4A 5ETRA 1WUUA 1NO8A 1I51B 1H72C 2F8MA 4Y00A 5HMXA 2FTRA 4DV1F 3KLEA 5B0FA 4C3MA 2DGVA 4BDPA 2YKNB 3DLEB 1IKVB 3K2YA 2ZD1B 4TYBA 5CCMA 4UUWA 2PA3A 5KFFA 3PYEA 3EGZA 4M8LA 4E2FB 4HT5A 6FD1A 1R31A 2ZUAA 2OMOA 4K8RA 5IM0B 1VQ9S 3KYLA 2GO9A 3S6EA 1SIZA 4NLTA 3D28A 1DTTA 3KDNA 5ETNA 1N4LA 4ZVUB 3IM9A 3M6VA 3QFWA 3BKTA 1UZDA 3LPEA 2HHHF 1G7CB 2LXFA 4GO7X 2VC0A 4ED1A 2HYIB 2OSRA 3ZFVA 4CNZA 1YBUA 1ZETA 4X65J 2ZUGA 2MGZA 3PKYA 4F8RA 2GHVC 3R5AA 2E29A 2IHR1 4KJIA 2XMMA 1NKBA 3T1HF 3MCNA 2OPSB 2CVIA 3CJ5A 3M8WA 3T9NA 1HQ2A 4IOCQ 1GXTA 1YTYA 2HWTA 3EM1A 3KUGA 2LU1A 4PXBA 1SKWA 1QSLA 1GQEA 4TXSA 3ULHA 2QSFA 4BLGA 2BEFA 2RS8A 5KT5A 3IBWA 1PO6A 3VV2B 3IBFB 2OELA 1X4DA 3AAWB 3DOMA 3HHLB 1S6PB 5F0WA 5B0AA 3GYXB 1X4BA 1GMVA 3AOCA 5HROA 1X9WA 2KHCA 1RAHB 3AY0A 2WVEA 1S6OA 1HFEL 1O51A 3IG1A 1U8SA 2VQFF 1SQGA 4NPOA 3KLHA 3KOAA 3FCWA 5GMEA 3FBEA 5HMZA 3HP6A 4N76A 4BC7A 4C11A 4Q5VA 2VG5A 2XY6A 1S9GB 1HA1A 2EFQA 4JOUA 3OQ2A 1HYSB 5C5JA 3NKYA 1RXOB 2HHSA 2B4UA 1VQ8S 1CLFA 2HNYA 2EK1A 1PAEX 5J2MA 2MEWA 1KBRA 1OMSA 1YDLA 1SL0A 2CFXA 2NREA 1X4GA 4FXWA 3V5RA 1RHUB 3SCLE 4QCLA 3HT3A 4QWDA 5BYRA 1FJ7A 5KFVA 4J37A 3MFIA 4OZNA 4IKAA 2HNZB 2EG2A 3NGKA 4QWAA 1IKWB 1OSDA 4DFMA 1M1KT 4DQRA 2L9NA 3FCHA 2V4JA 3MEDA 5JJBA 5I3UB 1EQMA 1UVIA 1HBOB 1QE1B 5HVGA 2AMCB 4CH1A 1Q8BA 1WHWA 3Q89A 2W1BA 2BJ1A 5HMWA 1ZZFA 5KG2A 4ITSA 1CJUB 4AL6A 4NEYA 1FX2A 4GKKF 3R6GB 2RU3A 1P27B 4WP8A 2KG0A 2I1RA 3NBPA 5B7WA 1CEZA 1ZTTA 2ATCB 1RT2B 2D3ZA 2E1RA 3BM7A 3NAHA 1WF1A 3KK3A 2EEYA 4OI4A 1FWKA 4NLVA 4OHZA 2D69A 1K0TA 4O3SA 4LIWA 5G0RA 4OYIA 1WI6A 5C24B 4C8ZA 2K1RA 3G6YA 3OL8A 5ITHA 3D54A 3Q8QB 3HK2A 2LKZA 2GVZA 4I2QA 4M5JA 2JC0A 1RT6A 3JQMA 4W90B 3M32B 3KFWX 4NXNF 2R7QA 4O4GB 3HFZB 1FKPB 3W5YA 3PFOA 3T1YJ 4USIA 5BYQA 1T02A 3L4BC 1RU2A 1HBNB 4BHQA 4LSNB 3CO9A 2EK6A 2UV8A 3KXDA 1OYEA 3VF0B 1S6QA 3E01A 3J81j 3M2VA 3U7JA 4ZITA 1IKXA 5C2GA 4I7FB 4B3SJ 5DQGA 3ENAA 4I6WA 3PO5A 3IAS9 3MM8A 4DR1J 4WFZA 2HAIA 3QSYB 2DR5A 2RMLA 1KS2A 3P4UB 1JQGA 4C3LA 2CJXB 1MU2A 3QMQA 3BKUA 4YQWA 3NNCA 1IWAA 2AJ2A 5DGAA 1T95A 2JEGA 3N4WA 4CLKA 2CPIA 1JXEA 3EDQB 1QDUB 4TY8B 2MKHA 2HFSA 4ETXA 3FMBA 2G4BA 2RQKA 4F4AA 2CQ4A 2IM3A 3OVSA 4Q2LA 3G82A 5E3PA 1VC6A 4WK3A 5DM6Q 1HI0P 3BN4A 4CQ1A 1RWXB 3HCXA 3QJJA 4USKA 4B9VA 3TR5A 3RBDA 1PCAA 2JC1A 2F65A 5CA5A 1H2TZ 4F3MA 3MZIA 1Y00A 3BBFA 2MQNA 5CYMA 1QAIA 4PKDB 2Z2MA 5F41A 4HYKA 3GMGA 3L7PA 1LXJA 5J1EB 1DY3A 3I0RB 1CS4A 3C46A 1S1UB 5GMDA 2MYFA 1LWFB 2JFKA 2XLJA 2DNYA 2UVVA 4MK7A 4GMKA 2KRBA 3I5AA 1IKVA 2ZD1A 3D1HA 5DDRC 5CQGA 3NGDA 2Q3PA 3EXYA 1EHWA 2MKSA 4HH0A 5IM0A 4CO3A 3I31A 3PX0A 2RJZA 4DV0F 4A4JA 2AZ1A 3TOQA 2ZOFA 4CLFA 1SC4B 3ZNUA 2BE2A 1C4CA 4RW4B 2BA9A 4MYUA 4F67A 2NPIA 1WG5A 3H90A 3DMJB 3IFEA 1RTIB 4M5NA 2R7SA 1C1BA 2QV6A 2VIHA 2VH7A 3SQOP 3CCMS 2HFOA 1RAOA 4P73A 2GAHC 2IPOB 4I64A 3F56A 4PAAA 3K8WA 1GX5A 1QTNB 3I5CA 3UCGA 1VQ7S 1EZZB 1KN6A 1U02A 2ACYA 2Z0GA 2A0FB 2J9CA 2E5IA 2IDLA 2OPSA 3I6PA 2X1GA 1N34F 1AFIA 4WKRA 1CJTB 1UEUA 2P6TA 3N6LA 2YQ0A 2CQBA 2W7PA 2EG1A 4HHUA 2V69A 1UA1A 2A1BA 1SPBP 4Q0BA 3A1YG 1FNXH 2AWZA 1D1UA 4F0HA 3I0SB 4B3OB 2FLPA 3RRHA 1LW0B 4OX8A 3QFHA 4J91A 3LOUA 4ZVGA 2PMZD 5IFMA 2PFDA 1ZPVA 3PY8A 2N4DA 1A9NB 3BS9A 1S6PA 2DYAA 1HLWA 2ZH7A 4OJ1A 5K14B 4EZ9A 2BRLA 3KLGA 4EBDA 4ECSA 2MKYA 3TAMB 4LF8J 1VBKA 4AL5A 2RHQB 3E3XA 1D09B 4ECVA 4JI7J 3ENVA 4NCBA 2GQQA 3FRZA 2ABYA 4WZMA 4USVA 3AJ1A 2V34A 2K7JA 2IVFB 1S9GA 4NMLA 1PYSB 2DCUB 1RWKB 3TUJC 1HYSA 4QQBA 2WAQD 3BBCA 4XAKA 5HJYA 3SI8A 1SL2A 1TK5A 4KHPJ 3PYFA 2VICA 3H0PA 4B08A 2AX1A 2HWIA 3ZNJ1 2JH3A 1G1XA 2XYGB 2YNHB 4OZ0A 2XMVA 4LRBA 1Q8LA 3NWRA 4L3NA 2AEMA 3PYDA 4FVMA 4CCHA 1G6BA 4LF7F 1IKWA 1UVNA 1S7HA 2E9RX 4LFBJ 1CC7A 5F3ZA 4FBTA 2CJ9A 4MT1A 1ZAXA 5I3UA 2OEJA 1HBOA 1X0FA 2LA4A 1XWLA 4DPWA 3QIPB 2CQPA 2R8KA 1RTHA 2FHMA 2VU5A 2H54B 2HNDA 5CHCB 3RBXA 3GIIA 4LF5F 1QUPA 4B9TA 1BQNB 2Z2ZA 3U1LA 2AW0A 3V4MA 2UXBJ 4RUBA 4DS4A 2OJ3A 1RTJB 4DFPA 4ZLNA 2CJAA 2WCXA 1RT2A 3HZEA 2G0CA 4LBHA 2BACA 2AGOA 3CNQP 2ZH5A 2QL5B 2VG6A 2RF2B 5HVFA 5DDPC 2E1PA 5HI7A 1NH8A 1CJKB 5C24A 2IYIA 3RB3A 3D6FB 3VAIA 4HEA9 4WU3A 2R7RA 2HHXA 1OO0B 2XMUA 3NLCA 1YK9A 2HRTA 1RBLA 2Z4PA 3GR1A 2H65B 4FKXA 4DR4F 5KG6A 3KTQA 4DXLA 3K5LA 5DDOC 3QZ7A 3OW2R 2DXEA 1YZ7A 3NNAA 4CH0S 3W8PA 4WK1A 3MR3A 3M32A 4O4GA 2VG7A 1KQSR 3G9CA 3VAHA 1XN9A 1M5VC 1HHTP 1FNOA 4OX7A 1H0HB 2BJ9A 1HBNA 1JLCB 4GO5X 3KDOA 4LSNA 5B09A 3NOCA 3HI9A 1F1BB 2LEPA 5CH7B 3PX6A 4CLYA 4JBCA 4OQJA 4S0MA 3A4TA 4USTA 3M2RA 4DV6J 4I7FA 1FRHA 1SV5B 1DQ8A 1UL3A 2RKIB 2KYZA 3VAJA 1R8PA 1BY9A 2N3LA 1S59A 5HVHA 2XWYA 3G71S 2RB7A 2CPFA 3DNCA 3TEHB 3AA8A 4K4TA 3PIOQ 2XYPB 4F04B 4XO0A 4EYHB 2GHPA 4QW9A 1TUGB 3AA9A 1FRXA 2AQ4A 4TY8A 2R8JA 3CW2C 3LH2S 4HKQA 3DGVA 2KJVA 3OJSA 1QD1A 2HHUA 4NCGB 2QN6B 4KY3A 3B78A 1Y4ZB 1T05A 1ZZNA 1J27A 1S5ZA 1ACMB 1RAIB 2CQCA 5KFYA 2RDDA 3J7AN 2QX0A 1XR5A 3H20A 2XMTA 4Y6IA 1T03B 3W9JA 3HJVA 1NB7A 1X5OA 2GFFA 4ZCLA 2XTJP 4C8YA 4PRFA 2GGPA 3CCJS 2E5GA 3EVMA 2O3DA 4PYAA 4CWBA 3LUYA 1NJWA 3WBZA 5L9XA 2ZJPQ 4EZ6A 3LWLA 2HWHA 5AXLA 4OFZA 1KKHA 2VV5A 4ALZA 1RT4B 1F2HA 3LP1B 5J1EA 4X66F 3PW2A 1H38A 4MIAA 3T6JA 5C7PA 2M70A 3IP0A 3NAIA 1FFGB 1S1UA 4XIUA 4C8KA 5J1PA 4M5LA 2KG1A 2XY5A 4DUYF 1FD2A 2IYGA 2GMJA 4USWA 3VQSA 2J8AA 1OQ6A 5KFUA 3R6LB 2UUBF 7FD1A 4NE9C 1E6VA 2M4MA 3V81B 2R7VA 4LF9F 1N5TA 2QMUB 4RJVA 2Q6BA 3VCDA 1RJJA 3C15B 2Q1LA 3PRVA 3CCUS 3HXMA 3D0HE 4DR2J 1QSYA 2ZC4A 3HD2A 4O4RA 2IVYA 4RW4A 4AQYF 4Y2MA 1F3FA 3DMJA 1RTIA 3G6ES 3NEKA 3IGNA 3JSBA 2I38A 2IBKA 1VQPS 2M3DA 3R2DJ 4X4VA 2MZTA 4ZVTB 1NHUA 4ECYA 3RB4A 1YBTA 4O3OA 3SQGB 4DL0C 2W25A 5LJ5Y 3T1AA 4NZ7A 4IFVA 2EC0A 3TQEA 4A8FA 2AEFA 2LMIA 4DS5A 3US5A 3PX4A 1CJTA 2EXUA 4LFCF 1SCJB 4RR5A 5DRKA 4CLPA 1TAQA 3UCZP 4W98A 1RLDA 4HDHA 2VDHA 3PJXA 3P3DA 2ZH1A 1E6YA 1WEZA 3Q8YA 4B9UA 3R97A 2AYMA 1S0OA 4ZPBA 4ES2A 3G8QA 3DFEA 4P9SA 4A8YA 1UFWA 3BPSP 4RUHA 5ADZA 1IM6A 2DPJA 3Q2SC 5K14A 4HACA 3TYTA 1JLQA 3TAMA 1DZ5A 4DU8A 5H1SV 5GAGI 3CC2S 1WHXA 3K0JA 4KB7A 4F2RA 1HQUB 3SCKE 3SBMA 1WOSA 3PG9A 1AROP 4ZPDA 5KAKA 3IM8A 1VS3A 3DLKA 4CI0B 2ZBRA 1FKAF 1GMUA 4HLBA 4OX9J 3UNGC 1F2GA 2I5JB 5HQ8A 2CPJA 1NSPA 4LT6A 2HEKA 4CO1A 2VFRA 1OIAA 4XDCA 2HRUA 4WE1B 1JLFB 5DG7A 4NZ0A 4JI0F 4LF4J 2CJKA 4NLUA 5LSRA 4KFBB 4NA2A 4WTOB 3GFHA 1AW0A 1IBKF 3FUYA 2RU9A 1HBUB 4OI0A 1S77D 4ECUA 4O0NA 1VI7A 2E5HA 3AD8C 1A7GE 2MSSA 3AQPA 3AXMA 2WSCC 2W2PP 2M52A 3FSIA 3TJ9A 2MJUA 3T19A 1EB0A 1NDPA 5LM7E 1SL1A 4P10A 1WOOA 1D0EA 3QIPA 4MK9A 3R5DA 4J9MA 3CJ2A 3DI6B 1U25A 4M5HA 1FFSB 2DKOB 5IV4A 2B7CB 1BQNA 5KG1A
chains in the Genus database with same CATH topology
2ZNZA 3F44A 3BEGB 4DPOA 4RBUA 3DHWC 4YEAA 4YDDB 5GAEU 3MMJA 2HG4A 4ILMA 3M9NB 2OD4A 2MQLA 3TUZC 4DV4F 1YVFA 1TKTA 2UVRA 1MMNA 2DR7A 3MI7X 3PVXA 4YB6A 3MEGA 2EWHA 3MEDB 1TKTB 2QA1A 3LP2B 3TARA 3MPWA 1SC6A 5E3QA 1MW7A 4WXWA 3CPWR 3MEGB 4KSEB 2UVUA 4ZVEA 4K4UA 4QIWD 2EBEA 3HKWA 1B0VA 3KG1A 3DLLQ 2XS7A 4R25A 5LXYA 4UW2A 1KHWA 5D4OA 5B0GA 2C3OA 3H5SA 4CNYA 3X1LB 1YQHA 3Q22A 2RF2A 3UE2A 4CT8A 4DL4A 2VPWB 3C6TA 1S1XA 2VBXA 3BDEA 3QWPA 4PR6A 4CO2A 4DFJA 3C6UB 2I2YA 2XY7A 2QE5A 1HNXF 3C6TB 1VQMS 4C98A 3G6VA 3SFGA 1S1XB 1FEHA 5EDWA 2IAJA 5EUHA 3MPYA 2F1FA 4E8UA 3T9ZA 3MF5A 3KHLA 2VPYB 1RT7B 2LQ9A 2ZDPA 3MM7B 4IG3A 1YJNS 3BGLA 2KRRA 2YX7A 1U1OA 3NBPB 2Q6CA 3OSPA 4O3RA 1TV6B 3MECA 1NK8A 5E3CA 5KG5A 1B64A 2CIMA 1FRKA 2IA0A 4IRCA 1BC6A 5KT4A 4I1TA 4ZHRB 3BGRA 4A47A 1NKCA 1AUDA 5DQIA 4QIGA 1KQKA 4KKOA 2W9BA 4PXDA 3KK3B 4BCAA 4D3GA 1X7VA 3BGRB 1JJHA 2Y1RI 3QZ8A 3DRXA 2OH2A 1UJ5A 2XCPA 2W9BB 3Q2TC 5GAHI 3P96A 4TU7A 2DH9A 4URGA 4IR9A 4WJBA 2LQ5A 5G0RB 1SH3A 5KOXA 1N48A 3TNVA 1IXKA 2ZJQQ 4BS2A 5IXUA 1RQ0A 1WG1A 3PEHA 5A6PA 1TAUA 3UR0A 2KU7A 3UWTA 2WB1D 4NX9A 4CO0A 2F8HA 4EFAC 2BRKA 3BSAA 2FC8A 3OFGA 3KLIB 1NK5A 2BZ2A 4ZKAA 2XLKA 3CVKA 2GJ2A 5GADU 5DLFA 1X5TA 2D3OR 3O3LA 1GAOA 4QU6A 3BO4A 5EWEA 2B5JA 3TP2A 2U1AA 4MFBA 1R0AA 3QLHA 3LPYA 1UVLA 3HO1A 3ITHB 1HARA 2LYVA 2PGCA 2YX4A 2B5JB 1VIXA 2AGQA 2HMIA 3OVBA 4MFBB 1R0AB 3QLHB 2E66A 3CIMA 2C3MA 1IUJA 1Y7PA 4J9KA 4ELUA 1P1TA 3NL0A 1HWJA 3BO3A 3T1YF 2HMIB 4C7QA 2FB0A 4DF4A 2R7XA 1VOMA 2KFNA 5A6WA 3I96A 4IQMA 3CDAA 5LJ3Y 3T5KA 3MUMP 4I2QB 4RBTA 3EZUA 3IA0A 4XPCA 2PC6A 2GX8A 4JV5F 2NSBA 3MM9A 3W7BA 2ADCA 1SV5A 2B9WA 3DGPA 1RT6B 4J5OA 4O0IA 3GFYA 3OL7A 1CG2A 1ELOA 2QLXA 2VD3A 4ES3A 4RNFA 3K57A 3MM9B 2HHQA 3BDPA 4G1IA 1KTQA 3W2WA 1F5CA 4R0EA 3GE9A 4IO1A 4RW8A 1XNRF 4YY3F 4NLSA 1RAJA 2B51A 3H4BA 1IKYA 3DLBA 1SKSA 1C0UA 4B3SF 4K4ZA 3G4SS 1HI8A 2FC9A 4EEYA 4DQSA 2AJQA 1NK7A 2B43A 3V6KA 1UETA 2E7WA 2XHWA 1YJTA 5J1NA 4O3NA 3ETOA 1YI2S 1IKYB 1HI1A 1C0UB 4RW9A 4DR1F 5LSLA 1D8ZA 4KPYA 5LT5A 2PEHA 1WNEA 5KFOA 3KMQA 1GX6A 4WFBQ 2ADBA 4IUFA 4RW9B 5A0YB 1S6QB 3E01B 5LMNF 3KKFA 3M2VB 2MXYA 2GV1A 4O3QA 2XZWA 3RAMA 3KK1B 1LQ9A 4DR3F 5C25A 3WX4A 5AJ3F 1JLAA 3TW0A 2YNIB 4RU9A 3K5NA 1D9DA 3M1VA 3HHLC 4B02A 1S1VA 3GFXA 4OZLA 4ZP9A 1YITS 4IFYB 4X4SA 4B9MA 3CC7S 3J81Y 1Y5NB 3MGJA 2EFGA 4NCGA 1HNIB 3MM8B 5F8MA 5HP1B 3HHLD 1HMVB 3M1VB 1S1VB 1VIOA 1UW4A 5B0EA 3GG1A 2QMWA 3QGPA 2RRNA 3OXFA 4RW6B 5HLFB 1U48A 2BR0A 4ELTA 4YOEA 2RILA 4AXJA 4ICLA 3MAQA 1WTBA 2FLNA 4X4NA 3IR7B 4Z2XA 2G9OA 4HI1A 4NA1A 4PPDA 5J2QB 3TQ1A 4RNHA 2VPZB 3ENWA 4U9RA 2Q79A 4UQGA 1T03A 2ZH9A 2RDJA 2C22A 2XNQA 3IRWP 1SUQB 3UFCX 2ZHBA 4E0DA 2MKKA 1PC5A 3KLFA 1TKDA 4F3OA 3VZIA 2WBRA 1KC8T 3IXQA 5DM7Q 5DGBA 5CZXA 4ID8A 5AXKA 2DNOA 2R8GA 2R7UA 1S1TA 3MMBA 2VQEF 5F8JA 3SEOA 3PRDA 2UZAA 1WG4A 2D9PA 4N8NA 1HR0F 3H5XA 1QAYA 4RUAA 2D41A 1FKOA 2ASYA 3PACA 1BQMA 1S1TB 3MMBB 3KLVA 1SJFA 2JEJA 3BGUA 3TO8A 4DFKA 2FIUA 1FK9B 1CC8A 2F3JA 4LUBA 2DNLA 4G3IA 2KKHA 3DLJA 5K8PA 1FKOB 5LXRA 2LECA 1FXDA 4X84A 4F4XA 2CG4A 2ASLA 1CQMA 1Q1KA 3QIDA 4AYBD 1NJIT 1L3SA 2B56A 5FLXY 2FJWA 1TL5A 3HHKA 1DAXA 1KVJA 2JVOA 3IR6B 1LFPA 1RT4A 3TVKA 2OPQA 3LP1A 3F41A 5IWAF 3QPIA 2ATLA 4ELVA 2FLLA 1MWZA 2HPUA 4WXOA 2XB2D 1JXLA 3DRYA 3KK2A 1G3OA 1W25A 5H9EJ 3FZ2A 3MTJA 1ZTWA 3Q23A 2LA6A 1HNZF 2F9JA 7FDRA 5DETA 4KE5A 1HNWF 4WFAQ 3DOKA 2MQMA 3CTRA 5F9NA 2AJ1A 3TVYA 3BSCA 2KB2A 1VMBA 1AFJA 2K3IA 5KFRA 3E51A 2B4PA 4ZPVR 4BWJA 1UVJA 5C42A 3NS6A 1ULRA 1CVJA 3DOKB 4X64F 3X3UA 2FY1A 2N7YA 4B9LA 2B7BB 4FVCA 4YMEA 2FVPA 4F4KA 5C42B 2RQCA 1Q86T 4NYPA 1U4BA 2HQ3A 4WFNQ 4CH7A 1EETA 1PILA 4DR5F 3N5FA 1FTRA 2L48A 5E33A 1UP1A 2ZKTA 2VODA 5CXTA 4QZVB 3CWJA 5CYMB 3HZGA 2BM1A 2QO3A 2FVRA 4DN9A 1TK0A 3TA2A 1NJXA 2E5LF 2BJDA 2E1MC 1S4FA 1SBRA 3VR1A 1NJZA 2J6UA 3SDEB 4FF2A 2DO0A 4RBVA 2W7OA 2FGOA 4P7TA 5KFPA 3HVRA 3DDKA 4ED2A 3WC2A 4G1PA 2EFPA 2GMHA 4DV2F 2J5AA 2OP5A 1TZ0A 1YJVA 3I4HX 5A8RA 4C9DA 2BVZA 2ZHOA 4IDKA 2GIRA 2Z8QA 3PO4A 3M2UB 3MUVP 2IBOA 3W3SA 1T8EA 5A8RB 4I69A 1NH7A 5KG4A 2R2RA 1NRKA 1NO8A 2VFTA 2F8MA 4H4MB 4Y00A 5HMXA 2YKNA 2B4OA 2FTRA 3KLEA 5B0FA 4C3MA 4DV1F 1U49A 4W92B 3DLEA 3POTA 4NA3A 3GIMA 2Y0SD 2AX0A 3M8QA 5KFNA 2DGVA 5J2PB 2UU9F 4BDPA 2YKNB 3TVZA 3KLEB 2RQMA 1FDAA 1X4CA 3DLEB 4Y28C 1UKUA 1IKVB 2ERRA 3K2YA 2ZD1B 4WZQA 4TYBA 3M8QB 5B0CA 5LL6d 2JL9A 5CCMA 4UUWA 3UD3P 5EX0A 1DHMA 2PA3A 5KFFA 5BYSA 1MNEA 2YNFA 4K50A 2L08A 2LVWA 1KVIA 1UFLA 4TKTA 3EGZA 4M8LA 4A8SA 4F4ZA 4HT5A 6FD1A 3PIPQ 4LVNP 1OQ3A 2J0XA 2UUCF 1GXUA 2XLIA 2YNFB 3LF0A 3MMAA 4PG4A 2XSJB 3SZ2A 1R31A 4IH6A 3SQGA 2OMOA 2VFUA 1LKZA 2ZH4A 2ZDOA 5IM0B 2KH9A 2AGPA 3PV8A 3KG0A 5KOWA 1KQFB 4DOZA 2B9XA 1VQ9S 3MMAB