2ACMA

Solution structure of the sea domain of human mucin 1 (muc1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
SFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Mucin-1
publication title Autoproteolysis coupled to protein folding in the SEA domain of the membrane-bound MUC1 mucin
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.960 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits SEA domain 2acmA00
2E7VA 1IVZA 2ACMA
chains in the Genus database with same CATH superfamily
3I4PA 1YJWS 5BR8J 3E8OA 5LSOA 4ED0A 2GAHC 5FLXU 1FTRA 4DCPB 2GJFA 3MPDA 1RLCL 2IJRA 2VKRA 1RUSA 3QJPA 4Z2XA 4Y00A 1JLFB 2VQEF 2GIFA 4TVAB 4LF5F 2DK2A 1BQMB 4U8YA 5HMXA 2AGQA 1C1BB 1UW9A 2AHOB 1W2IA 5C42A 4A8FA 4XIUA 4F0HA 3G8QA 4N7TA 5EDWA 4Q2MA 3NKYA 2BE2B 4O3PA 5F8NA 4ES1A 2EVZA 4X4OA 4B3TF 3BDPA 3MM5A 4CO2A 1K0TA 2BX6A 2R2RA 4EMDA 3UCGA 3MHYA 4QWDA 2EK1A 3UDCA 3KLHB 4DV2J 2LXFA 1R8HA 1NDPA 2EW9A 3J80U 3RW6A 2IDEA 5K8NA 3VAJA 5CYJA 3ISNC 1U8WA 3LF0A 4JI8J 1YIJS 2HQCA 1IVZA 3V6KA 4WZQA 4RW6A 3J7AN 3C46A 4EWTA 3ZFVA 3BO2A 3PR5B 2CQIA 3HHEA 2E29A 2DY9A 4J37A 3KXDA 1NB7A 4O0NA 2GC8A 3DRSA 1TKTB 2QMWA 1FRMA 3BJYA 2GCFA 2YX7A 2DTJA 4N8NA 4OYBA 1X4BA 1TAUA 3GG1A 1VR6A 5HAOA 3JAMU 1C0TB 3BREA 1U1KA 3P6YC 3C19A 4IG3A 2HHPA 2QJ3A 4DUYF 1T9TA 1WHVA 4Z7CA 5LJ3Y 3M1VB 1U25A 4FVCA 4K50A 2CJKA 4ERDA 3PJ9A 2KB2A 4IRDA 3H5SA 2BM0A 5HROA 3W5YA 1IQZA 1NKBA 3UN2A 2VPXB 2DR7A 3CD6S 4DV6F 1AUSL 4G1QA 1UVKA 1A7GE 5HI7A 3MMCA 2AW0A 1C4AA 1S4EA 1S7HA 2B9EA 3JB9k 4YR3A 3V6HA 1CS4B 1JIHA 4YR0A 3DU6A 2VQFF 1Q7LB 1X31C 1LWEB 3FC9A 3HSGA 4HHJA 4P52A 1KSPA 4QIVA 4OFZA 3CUNA 3B4DA 4P9SA 1SV5B 2YKMB 4DR4J 1L3VA 4FZVA 1VDHA 1TU0B 2OPRA 1Q5VA 2VODA 1OJ4A 4DSFA 1FEEA 3IBCB 4QW9A 1B4SA 3DCAA 4Y65A 1FRJA 4RNNA 2BABA 4ZHRA 4RWWA 2W2NP 2DHAA 5AXKA 4LFCJ 3ENVA 2M3DA 3DGPA 5HQMA 4YMEA 1RAJA 2CPIA 3PRBA 1P27B 2BW2A 4DL0C 2HIQA 2R8IA 3SXLA 3HHLB 3KTQA 5JMNA 2DYAA 3ENWA 2IRUA 4Q0BA 5F8GA 2BKOA 1PKUA 1RHQB 2AX1A 3EGNA 4IKAA 1FX4A 1L3SA 2CQPA 3TNVA 5KFQA 1FFWB 4QU6A 2F40A 1BQXA 1BLUA 4GVBA 2CQ1A 5D0RA 2E9ZA 3F56A 1XR6A 2JSXA 1NH7A 2QLFB 3PO4A 3TO8A 1HWIA 2QC3A 3LGHA 5KFTA 2YXLA 2HEKA 1REGX 4FF4A 4H4KC 4JBCA 4DR1F 4YY3F 5KT5A 1RBLA 4OX9J 2ZUAA 4I2QB 2FYXA 4LF4J 1V5VA 3R5AA 8RUCA 3GSIA 5C5JA 4D3GA 2KG1A 3RRGA 3NCQA 2XI2A 2LDYA 1N56A 4JI5J 3SCJE 3G8TA 2MKIA 2HVIA 2V67A 3CC2S 2DNRA 3HD2A 1YX2A 1WKLA 3H25A 4G1PA 4USIA 2G2ZA 3NWGA 2ATLA 1HPZA 3CJ5A 1KC8T 3H5XA 1Y5LB 1DQ8A 2V94A 4KKOA 1UVNA 1VRUB 1RTHA 2NZ4A 2ZJRQ 2G1DA 2XNRA 4DPOA 5FIIA 2F8EX 4DF4A 4NZ7A 3EZUA 1YWXA 1RT4B 4ICLB 4RW6B 2VZ9A 3TRGA 3QLHA 3PKMA 1S1WB 3O5TB 3TAMB 2DNQA 1TL1B 3N5BA 1S76D 2W2OP 1EKSA 4Y28C 3AOCA 3T1YJ 4NLXA 2HFSA 1FWPA 3ETOA 1WTBA 2XO7A 5J2MA 2FJXA 5A8KA 1IR1A 2K3KA 4U7CA 4ECWA 3TQEA 3JSRA 1U6BA 4ECRA 4RW4B 3PYGA 4K5RA 2NXJA 4DR6F 3M8QA 4GO5X 2N82B 3KK3A 2MQ8A 3TW0A 4NA2A 3TVZA 2EC0A 1R8PA 2RRAA 4DQQA 2L9WA 2OLWA 3D3BJ 3C14A 1CJKA 3CDBA 1Q0NA 1AT1B 1S1VB 1OIAA 1RBOB 1IBLJ 2Z2MA 2W9CA 2XHWA 1PYOB 2H5IB 1VQ8S 3BSAA 2XB2D 4KHRA 4KO0A 1VIXA 1RADB 3RU0A 4QW8A 3P5BP 3I5BA 3VAKA 1M1GA 2ZBRA 5CD4H 2ZZMA 1S7IA 1DLOB 4O3RA 4QR1A 4P72A 5I3PA 3EGWB 1Q8BA 4IH7A 2CQ0A 2HHTA 3M2RA 5E3AA 1GTEA 1C4CA 1WF0A 1G2EA 4EFAC 3M2VB 4Q2LA 3UFCX 2ZE2B 3HP6A 1GMVA 3UPFA 4DL6A 2A18A 4DN0A 5K8PA 1XMBA 3FCVA 4QR0A 3U1NA 4K8RA 1S5ZA 4ZHRB 1YDLA 3GPAA 4ZIVA 3PW0A 1Y00A 5T7LB 1X4GA 4K0KF 2YVSA 3RR8A 1GEHA 2QX0A 2AU0A 1HBMB 1S9GB 2OPPA 4LSNA 2XLKA 1KR4A 1JLQB 1WSRA 2UUTA 5FD1A 3T9NA 5I42B 3N79A 3TARA 1TUVA 3ZTOA 1LWCB 2R7WA 5DM6Q 4JI3F 4X65F 2POKA 3J81Y 2ZH5A 2J0SD 3KG0A 3UD5A 1WEZA 3K8WA 1L3TA 4DCOB 4HDHA 4CZCA 3TJ8A 1EQMA 1SPBP 4GKJF 3CJKB 4Y2MA 3A8EA 2BOPA 4LJMA 2GVDA 1N48A 3D1OA 5HJXA 3M4XA 1VQ9S 1B7FA 4KSEB 1I3OB 1NZ8A 1OSDA 2KYXA 1TL3B 1TKXB 4YUDA 3H2LA 1I6JA 3CDAA 4I2PB 1VK3A 4F4KA 3SMZA 2E5HA 1RU2A 2LA4A 1FRLA 3HVTB 2ZOMA 1DARA 1VQ6S 4HI2A 1VMBA 3NGRA 4IH6A 1ZOTA 2IA0A 3VZIA 2MZJA 2FHMA 2XMTA 4A8YA 2WVCA 3GIMA 1JLBB 2IJNA 5IV4A 1SJ4P 1QSLA 2B4VA 1NDLA 5H9EJ 2EEYA 3MM6A 2QFIA 3WBZA 1CC7A 2D9OA 2JEIA 3QMQA 4TY8A 2J7KA 3AHPA 5KFZA 4DPXA 3CCTA 3NY0A 2LP4A 2PI5A 4DV4J 1T0TV 2DO4A 4O4GA 3GE9A 1FDAA 4PYDA 2LDIA 1RWVB 4X4UA 2VQEJ 1LV5A 5HBMB 4LF5J 4OZNA 1YJNS 4ITSA 2QYCA 3R6LB 3CULA 1K47A 2OAUA 2LQJA 2OPSA 3T5LA 1TP7A 3JSBA 3BGOP 4Q8EA 2WOMB 1HNIB 3G82A 3N28A 4DG1A 3DRPA 4B3TJ 4MK7A 3RR7A 3NOCA 4PXCA 3C6UA 1U49A 4B9TA 3B6BA 5AE3A 1RT6A 2KO1A 2ILYA 4RO0A 4I7FA 3OFEA 3R1HA 2FLLA 4WK3A 3G6ES 2OH2A 3MTKA 2W4PA 1W25A 2EC2A 2PGCA 4OI0A 1RT5A 1J2VA 2W9CB 3DOKB 2ZH2A 3P3DA 2VC0A 4PCQA 3TUZC 2GGPA 4WPAA 1F9HA 3EXCX 2C3MA 1PAUB 2CPJA 1SC6A 3GV5B 5EGYA 3QT6A 4KRWA 4P71A 3WC0A 3HFZB 3E01B 5DQIA 4USHA 3LAMA 4BBYA 3TP2A 1HNZF 2WCXA 1DFDA 1F5BA 1RACB 3POTB 4I1TA 2FVSA 3PEJA 4DX8H 4KJIA 2AEMA 1IKVB 1E6VA 3IP0A 1U0SA 3LALA 1UVMA 2XSJA 3BF4A 4X4NA 3LH2S 4M8LA 1I5OB 2VBWA 4NE9C 2LU1A 3S8SA 2VBZA 1U26A 4CO5A 3DOLB 4CO1A 3UW1A 4NLSA 4F4YA 4V19X 4DUYJ 3OPKA 2K7JA 5KFGA 3B78A 1RP5A 2M2BA 3ILLA 2OGUA 4JI6F 4CNZA 3HK2A 3MD1A 5C2CA 1X9WA 3LOUA 1U2RA 2GO8A 3I55S 1Q86T 4QQBA 1SUQB 2C28A 1CJUA 2KFZA 3BH7B 2B56A 3TA0A 4B9UA 1U8SA 3GIJA 4CTAA 3W5XA 3J81j 2VD3A 3SI8A 5GMDA 1QLNA 1FXRA 5MAOA 5D4NA 3IXQA 1IBMF 3OUYB 2KN4A 4DR3F 4DPWA 1Q78A 2OP5A 1QUVA 2IM0A 5KFWA 2K8GA 3GR0A 2I9SA 1RZMA 4HEA9 2B4PA 3V6DA 3AA9A 2IM2A 3LTOA 1VIOA 4TNOA 4URGA 4ECVA 2V68A 4MFBA 5D0EA 1OY8A 2NSCA 1TV6B 3JYTA 3ZTRA 3HHKA 4AQYJ 3KJVB 1AFIA 1YTYA 4YN3B 4V1Ak 1WWHA 4NX9A 2BJDA 3ZZ0A 2CVEA 3LAKA 2GQQA 3IG1B 2CPHA 2KXHA 1KVIA 4RUAA 1URNA 1ZAVA 5KFRA 4DZ6A 4M5LA 3BV8A 1NK7A 2ZITA 3NLCA 1JXLA 2FVRA 1UVLA 2PA8D 5KFKA 3DRXA 4WIQA 2HGMA 3I82A 1N34J 2MGZB 1UW4A 2C3OA 1RHJB 4FKYA 2B5JB 2VFTA 3BKUA 2XGQA 4DR1J 2N4CA 4DFKA 2N3OA 2HHHF 2HGLA 5JJBA 4B3OA 2XI3A 1IR2A 3GFHA 5J1NA 2HFZA 3PDNA 5K9FA 5ETVA 1NSPA 2WONB 4NASA 1HBOB 4RW8B 3E2EA 4C3MA 1X60A 2VUGA 4NL5A 3R9LA 3DI6B 2P8IA 2UXBF 4WE1B 1QE1B 3Q8SB 2DJWA 1M5PC 2R7QA 2HZCA 4LFBF 3D68A 4DU8A 1YVFA 5LXRA 3U02A 1UFKA 2GJ2A 2FZCB 2GO9A 3MAAA 4M95A 3BGUA 4ZOSA 2GAGC 1S0OA 2HHVA 3MECA 2DNYA 2YWKA 3V2UC 1IXKA 4URSA 2XYHB 1U09A 3HKZD 3GCXP 4H4OA 3W8GA 1OQ6A 5C25A 4F4ZA 1FKAF 1XTZA 1X9SA 5F8JA 3CJQA 2JFKA 2XYPB 2UXDF 2LQ5A 1WD6A 1SXLA 4OX6A 2HNZB 4KGZB 1IBKF 1F60B 2AEFA 4NYOA 3P45B 1O8BA 3MD3A 4BCAA 3QT8A 4P2SA 2HHQA 1NKCA 2NPFA 4N47A 5ETOA 3QGIA 3SDEA 2O01C 2KT5A 1GMWD 1HWJA 2HNYB 2VJUA 1DQ9A 2AGOA 4J9LA 2HVHA 1IR0A 1XBWA 4HTIA 3NAIA 1SJQA 2KM8B 2HWHA 2JLFA 5HVGA 3EUNA 3GFYA 3A3NB 1F2GA 4MMOA 2CG8A 2QMXA 2GFFA 1P1TA 1TVRA 1FXLA 3DDNA 4B9SA 4CLYA 4CQ1A 5F9NA 3CXCR 3B54A 5HK4A 4PAAA 3IM9A 2PC6A 2J9CA 2HYIB 5T41A 2YKPA 3D5MA 5GAGU 3Q0AA 1XIQA 1MN7A 2VBXA 2F4FA 4KGKA 3BQ2A 3J7YU 3I87A 3I6PA 1M1HA 4CLTA 3PJWA 2HS0A 1U0HB 3KUHA 2DVIA 2YNFA 4FXVA 3G9CA 4DI6A 4IQMA 2CJQA 4DCJB 2YY3A 5HMYA 3AXKA 1NK9A 3AY0A 4B3SF 3OR1A 3HF5A 3V6DB 2QLBB 5IFMA 3OR2B 4K0KJ 2VHGA 3DHWC 1HBNA 4MT1A 2V69A 4LRAA 4EYHB 1IUJA 1JJ4A 2A2DA 4MIWA 4M5HA 2F1FA 2AJ2A 5ETRA 3ETMA 2HS4A 3IWXA 3M6VA 4GO7X 4NA3A 4ZVFA 4KTQA 1QTNB 4BC9A 1SQEA 4JI3J 4F02A 3PXGa 2FPHX 1HBUA 4RLEA 2KM8C 2OFHX 1SL1A 4C8KA 1VHIA 2MZ1A 4C4WA 2DHXA 1DHMA 2Q1LA 1C1CA 2D3O1 5D78A 1N36F 4ZLLA 4XAKA 2AJ1A 1NBEB 3SV3A 2DRAA 1AYEA 2NXCA 2QG9B 3EZ5A 1UVJA 1E6YB 2HFVA 1U6ZA 3J81U 2RDIA 1EHWA 4FBTA 2XEXA 1UZHA 4FYYB 4A8MP 2FLNA 3NGUA 4PZVA 4XO0A 2I0XA 2CPXA 2Y8YA 1S6QB 3F41A 1KD1T 1HNWJ 4LIWA 4J90A 1HNXF 1S9EA 4C8MA 5CZVA 4PUOB 3GFXA 2IM1A 4LVNP 1SKSA 5KFFA 3UQSA 1NXIA 3FBCA 2QE5A 2V9WA 2YNHA 3TAPA 4WYLA 3NAHA 1WELA 2MHNA 1QSYA 4DXLA 4QIFA 1RA7A 1YK9A 4C6AA 1WC4A 3WX4A 2H1YA 4CO3A 2W9BA 2H5JB 2NZCA 4LF1A 5E3RA 5C25B 2QRRA 3M05A 1BQNA 3V4IA 4DLGA 3CCVS 3ZNJ1 1IBCB 1FNOA 3AD7C 2CQCA 4N8OA 3CJ3A 3GV8B 1NSKL 3TAQA 3H40A 5I3UB 4K4UA 1S0NA 3UNYA 2Q3PA 2ZH4A 3W60A 5DDOC 2X1FA 2BA9A 3CCZA 1TL5A 4JI2F 3IR5B 4ZCIA 1DTQB 1APSA 1YBUA 1TZ0A 4PPDA 2C3PA 3BGRA 3VAGA 3PW7A 1JLGA 2KVQE 4XTTA 3Q2SC 2UV8G 3H7HB 4YR2A 4O3OA 2DHSA 2J0QD 1UPMB 3PHEA 4NI2A 1T03A 1WI8A 3R7NB 2Y8WA 1RT1B 4X84A 1VI7A 1SKWA 4OJ3A 3V4MA 2VJVA 2PMWA 3LP2A 5B7WA 2XHCA 3T5HA 4ZP9A 3L4BC 3PW5A 4IG0A 3L9ZA 2W8LA 4RNMA 1HNZJ 5J2QA 1M5KC 5L8RC 4DL5A 1BY9A 2MQLA 3HO1A 2EWHA 3KOAA 1RAOA 4ZLNA 3EX7B 3OR1B 1MMDA 4JI0F 1Q95G 3OHBA 1LXJA 4IFYA 4FF1A 2Z2ZA 1KEKA 4Q8FA 2OEJA 4ZDNA 1AROP 2HK3A 4WF9Q 3QYYA 3E51A 3MCSA 2Y1RI 2NCKL 4MYTA 4JI6J 3DYAA 1LW0A 2M0GB 2QZ8A 1VRTB 2FLOA 1N5SA 3KG1A 3ONQA 2QN6B 4J9SA 2CNKB 2DH8A 3VAIA 2BOAA 3OXLA 3UDEA 4C11B 1F6TA 4A4JA 3P96A 1T05A 4C8ZA 3BEGB 3SEOA 3UD4P 4KAIA 2AV5A 4ED6A 3PW2A 2MXYA 4DR3J 1X4HA 2RF2A 1B0PA 2V4QA 4YHHF 3MMAA 2F65A 3GJSB 3CEDA 3CMQA 1K73T 1QAYA 1JNRB 4OHYA 4USUA 4X66F 1U6FA 3G87A 1WDTA 5DGBA 1F3FA 1RWWB 2FZGB 2R3VA 1JB0C 4MYUA 4X4RA 1CG2A 2YKQA 1S9FA 2HVZA 2AP6A 5KOXA 2ZH7A 4BDPA 1RKIA 4HYKA 2VOPA 2QYGA 5BYSA 2FJDB 2KXNB 3CF5Q 2DPJA 4GC7A 2BJ8A 2V9KA 2FJBB 1JJCB 5RUBA 4C7QA 3JQKA 3AB4B 4P6QA 4Q45A 1RWPB 1GX6A 3MTJA 4CH0S 2HZAA 2XMUA 4IOAQ 1YJUA 3DLGB 3CDEA 2PO4A 2EFOA 2ZHOA 9RUBA 3V4IB 1N4LA 3OVAA 4OX8A 1M5HA 3MEDA 3QSIA 1CQMA 3HCXA 1S1XA 5H9FK 5D0HA 4OI2A 1FRIA 2CAJA 4GRSA 1TKZA 1MROB 3JS9A 4Y6IA 2HHHJ 2CJ9A 2MLYA 2B4OA 4E2FB 1RB0A 2ZNYA 5J2NB 3OW2R 5CCLA 3RB0A 1NSAA 1D0EA 4DL4A 3BGRB 3UI3A 1JLGB 2HWTA 3MGJA 3MURP 3VF0B 3VQSA 1WORA 1VQPS 1T03B 3GMGA 3CIZA 4MKAA 1HLWA 1QTMA 4WTYA 3QGHA 2C3YA 3OHAA 3PYFA 4ZLJA 3TUJC 3OSPA 1RTDA 1HMVA 2MPUA 3IRXA 2FLPA 2RMLA 4DN9A 2CDQA 3D2WA 4J9PA 1HL6A 1KN6A 4DS4A 3KMSA 4C0HA 1AUDA 4J9NA 1IBKJ 3FKBA 4OZLA 4NYZA 3HT3A 2ZZTA 3ET6B 2A2CA 3PCOB 7FD1A 2Z8QA 3PX0A 3MR2A 3N6MA 2W24A 1GX5A 1JWWA 2RT3A 3KFWX 4AXIA 3MUTP 2J8AA 2XZTB 4EI2A 5DS7A 3I0RB 1FESA 5E3CA 2QA2A 2XG8A 2ZD1B 2CQ4A 4USVA 3TUIC 2KG0A 4JP8A 3RW7A 1B99A 3F0NA 3NNAA 1IN0A 4E8UA 3R97A 1KTVA 3D54A 6AT1B 3FEZA 3DLJA 1RLDA 5GAEI 1S10A 2GIQA 3LPYA 1N6QA 2RSQA 2J76E 2QSWA 1SH0A 1XC9A 2KDOA 4KC5A 5DLGA 3TR5A 4NCAA 2KTQA 4Y34A 5IT4A 4JV0A 1W2BR 2QFJA 2VG6B 1PG5B 2PT0A 4N77A 4DR2F 3D1HA 1IQTA 2C2KB 3MM8A 1HQUB 4R0JA 4Z7YA 4WIIA 3PY8A 2BM1A 2H48B 1X9MA 3W2VA 3Q83A 3KLGA 1BC6A 1KQKA 5HLFB 2YQ0A 2LVWA 1BXNA 2HFUA 3FEXB 1DZ5A 2GHVC 1FEHA 2FUG9 3LP1B 2JX2A 4ELVA 1OY6A 4A47A 5CH7B 2A10A 4MKBA 4B3SJ 1DQAA 2UVWA 4M5KA 4USWA 2NUHA 4K2XA 1J27A 4DV2F 2PSZA 1X4CA 2ASYA 4F4WA 5KFPA 1FK9A 1PSDA 3GJQB 2I5JA 2BE9B 5BYQA 5B0CA 2VU5A 1R8AA 2ASJA 4K4YA 4JI8F 4C3LA 2HZVA 2E5IA 8ATCB 1AB8A 1Q1KA 4NLUA 3JSMA 1OMSA 4FNHA 2VFSA 3K5LA 2H3EB 1K8AT 2JFDA 4UQGA 3KJFB 1ZS6A 2HBZB 1U1NA 3OXFA 2LXIA 4P10A 3NNCA 5A76A 1ZA1B 1FVSA 1NM2A 2P5VA 1U1OA 4X2BA 2YWEA 3IWLA 2ZVIA 1CPZA 2JOQA 1N36J 2BR0A 4JV1A 5D15A 1IKYA 1ZZFA 4ZS6A 1TKZB 2CQ3A 3T1HF 1UJ6A 1LW2A 3DDKA 2AYBA 1JQGA 2MTLA 4EO8A 4KH0B 2JVOA 1F5AA 1T94A 3DNCA 2L9NA 3N6LA 2Y1JA 4AD6A 2ZDOA 2LXUA 1YGYA 1C0UA 3B4MA 1HNXJ 2YWGA 1PBUA 2HVDA 1CQNA 1LWFA 1NDCA 5KG3A 5D4LA 2J9DE 2DR8A 1TL7A 4EBCA 1WKKA 4WP8A 2VONA 1RXOB 1DRZA 3ISND 1FNMA 1UWBA 3EGZA 2B6AA 3AD9C 2EBGA 2C2RA 1HWKA 3BZQA 4ZP7A 2DCLA 3HSDA 2HURA 1RTDB 1HMVB 2VKZG 2B3TB 2FTRA 2J0XA 4DSLA 1CJVA 3MEEB 3W5ZA 4DR4F 2FZKB 2DNKA 1H0HB 3R8YA 1RAFB 2HRYA 3K5PA 2HMIB 2Y1IA 2VV5A 3O1LA 2NXNA 3OVBA 1TMMA 5HO4A 2M52A 2WBRA 5A8WB 3KG4A 4FS2A 1U4BA 2Z0GA 3D1QA 2LECA 3W9JA 4N56A 4R5PA 4QPXA 5GADU 3RAQA 4KFBB 5EWFA 1S6PB 1VBZA 1KDNA 4JI2J 1H2VZ 2CQDA 5K8OA 1FWLA 1HARA 4Q5VA 2NUUG 3IA0A 2JLEA 4X62F 3DMJB 1H72C 4PQUB 5KFEA 3Q22A 2C2EA 3R5BA 3ULHA 2HLUA 1VFJA 3R7SB 4WP3A 7FDRA 3HJVA 1BD6A 5ADZA 4LBIA 1YJ7A 3R5GA 4OX9F 3EDQB 2R9LA 2FC8A 3LWMA 4LF4F 2OEMA 4F3QA 1YHQS 2XM3A 3CJ8A 1SL2A 3MEGA 1JJ2R 2XSFA 1S1TB 4ZVSB 4NLRA 5A2QU 5CD4A 1BGXT 3HHDA 3CCUS 2V8VA 4LR7A 6FD1A 2B0GA 5L39A 2KI2A 2HRTA 4BWJA 2CPYA 3QJJA 3R27A 3LP0A 3CD5A 4ETZA 4CDIA 4U7UK 2E1PA 2FD2A 3I0SA 2RUGA 1PC4A 4ZJQA 2VA2A 1SCJB 1UA1A 1UKUA 4JI0J 3W61A 2ZH6A 1LWXA 2D7SA 5KAKA 2ZH8A 5K14A 1RT2B 2GQCA 1VLOA 1N5YA 4LRDA 4ECUA 3D6HB 2ZOFA 4NLVA 1JLCB 3R6GB 2I6WA 5KT7A 1EARA 4YB1P 1RSCA 5KG4A 3CCLS 5AXMA 4PRFA 3M7VA 1S1UA 4DSJA 4ID8A 5AXNA 3KLEA 1Z2ZA 4ED3A 3C16A 1GMWA 1YBTA 4K59A 1VBYA 4CYUB 2RD5C 4DHVA 2OTLS 3GV7B 1FKPB 1KQSR 2L48A 4L6V3 1W26A 5B0DA 4YHHJ 5IQ6A 2W7PA 4AL6A 4NA1A 1RTJB 1TK8A 1U1MA 1Y11A 3QBCA 2QLXA 4P7VA 2AJQA 4WFBQ 5D77A 1LW2B 4X66J 3H2VE 3I32A 3RGIA 1IBLF 3K17A 3IS9A 5CABA 1RISA 2BKPA 3KDOA 2HHXA 2KH9A 2GIRA 4OLOA 4OHWA 4O3NA 4ANEA 2DB1A 3PACA 4I6YA 3ZC4A 4ES2A 2H51B 4A46A 1FKOB 2X1BA 5A8RB 4QYRA 3ZZOA 1N33F 4U8VA 2VL1A 3SSSA 3UNGC 3OTOF 2JEGA 3OJSA 1T95A 3HHLD 2VG5B 4WU2A 4UUXA 2B8PA 1NJIT 3CTRA 2FB0A 3PO5A 3FZ2A 2DNHA 3SIPB 1FTCA 1QSSA 1F3VA 4OZJA 3M30A 4LSLB 1JLAA 5EHHA 2XMAA 3FK4A 4ZA1A 5H9EK 2G0CA 1QY7A 2FHOB 4O44A 5L1KA 1HI0P 1CC8A 4YB5A 5DG8A 1AA1B 4RW7A 1UETA 3M6UA 1D1UA 3A8IA 5E41A 2A6OA 1NB2A 4M5GA 5CQGA 1Q81T 4DV5F 4ILLA 2YH1A 1K44A 2ZJPQ 2VPYB 4RW9B 3Q8RB 2M8DB 1ELOA 4DJBA 3G4SS 3NGKA 4IDKA 5B08A 3LGMA 3FFIA 3QNWB 4I4BA 1Q8LA 5HP1B 1XR7A 1LFPA 1SC3B 2XMKA 2BQ3A 3IAS9 4DV1F 1RU1A 3CGIA 2DIUA 2HNDB 1RE1B 1WG1A 4NEYA 1NPPA 3D6TB 4ZVEA 1HHQA 3AQOA 5F8LA 3SCKE 5FDLA 1H73A 2CIMA 4QPTA 3MMBA 2R7OA 2XS5A 2F7VA 3JTOA 4ENOA 3N5FA 3KLFA 2R7XA 2IYIA 3PKYA 2F4VJ 3AAWB 2ACMA 4IFVB 3KLIA 3PYDA 1Q4RA 3ZNUA 1XK8A 2I2YA 1IKWA 4KE5A 4PXEA 3EVOA 2Y0SD 2KZZA 3THTA 1UP1A 4DEZA 1R27B 2BBEA 4TKTA 3ZXWA 1JK9B 4ALZA 3KLVA 1FWKA 5JVGQ 3TYTA 2MKHA 1VHFA 3OTEA 2P6SA 3NS5A 3ZZPA 4MJKA 5CYMA 3OLBA 4C8LA 2OFGX 2JHEA 2JNJA 1P9YA 4J9QA 3DKDA 4PG5A 2OELA 3UN3A 3DOMA 4QOTA 4DV0J 2ACYA 5C24A 4AYBD 5DQGA 2HAFA 2ASLA 2IVYA 3RBXA 2IMWP 2XGPA 1NK0A 3FMBA 4DV4F 3ZTSA 2V4JA 4YOEA 3ILJA 2CQGA 5E3PA 3CJSA 2GX8A 4ZPBA 2FIUA 4HH1A 2QEXS 3KDNA 4L72B 4Q44A 4DR2J 1NDKA 1S1UB 4QZVB 2V2ZA 3PRVA 4LF7F 2VDIA 4XK8C 1RA6A 4LQ3A 1ITPA 3LPEA 1EB0A 3W1YC 2YNGB 4LF6F 2ZJQQ 1KWMA 1S6UA 2B8QA 2K1RA 1R6VA 2VB6A 3AJDA 3V81A 5G0RA 1EZZB 5MLCV 4ZITA 1R8BA 5KFSA 3VALA 1HHTP 3DM2B 2ZC3A 3P4UB 3NBPB 3BR9A 1AZSB 4DQSA 3M32B 2PDAA 2OPQB 2DGUA 5BXIA 3FEYB 1U1RA 4AL7A 2MHEA 2RDJA 4ED2A 3QIPA 5E3QA 3J7ZT 1IKXB 4YQWA 4RBVA 3GONA 2R8GA 3OL8A 1KKHA 4FKXA 4Q43A 2IC3A 3C3LA 4X4TA 4RR5A 5IZHA 1A9NB 2FJVA 3KMQA 4EZ6A 5EWGA 2W9AA 3BN4A 1RT7A 3C15A 3M8PB 1MWYA 3EE3A 1TUGB 1HD1A 4MH8A 2AJFE 1R0AA 2PI4A 4JOUA 4WU3A 1TK5A 1W7WA 2EI5A 3NXZA 3MXHP 4ED1A 1S79A 1TAQA 1S97A 1V5IB 4ZP6A 2RKIB 5IM0B 2IYGA 3KHLA 2V4RA 3D6FB 4KV8A 4ED4A 4ZPTR 4F50A 1BMQB 3T1HJ 1AXQA 4ELUA 3S1TA 1EIYB 3EWGA 3NG8A 2VPWB 5FJ4A 4ZCLA 3ITHB 1EETB 5B0FA 3P49B 3KWMA 2JEJA 2YQ3A 1F2HA 5GAHI 3M2UB 2XO6A 1IM6A 3DLEB 4C0OC 3IRWP 4WCEQ 2KHDA 2L08A 1VQSA 1VQKS 3L7PA 4DSEA 1PJ6A 5F0UA 1WJ9A 3CJRA 2NR0A 1BHNA 2HRUA 3HFVA 4K4VA 3DRRA 4JYAF 2RHSB 1LK5A 1KFDA 1YI2S 4ZLPA 4OJ1A 1UJ4A 2MKKA 4NXMF 3T41A 2VOOA 3KK2B 1YQHA 1QJHA 3O3LA 3PFOA 2GMJA 4PWDB 3QZ7A 1KNZA 3LQVA 1S4FA 1VLYA 1X0PA 3T9ZA 1OSCA 4PG8A 4FPIA 4CO0A 3WC2A 2IPOB 1U48A 3TJAA 2AJ4A 3IR7B 2YWHA 1URRA 5D4OA 2NREA 4F7VA 1PO6A 3BSCA 3DLLQ 4CNYA 4BHQA 2BANB 1P9QC 3W64A 3R2DJ 2O66A 5LL6d 4OYMA 4CT8A 4WJBA 3C6TA 5A6PA 1IJEB 1UTAA 2E5JA 3FSYA 4AQYF 1L3KA 3SQGB 4K7QA 3KYLA 4DS5A 1FD2A 1MU2B 3MCNA 2CQHA 2HBRB 1KFSA 2E7XA 3QAUA 1TK0A 5DDRC 5KFDA 1DURA 2JDJA 2R8JA 4X62J 3FBBA 4C2MA 4KPYA 2MKSA 2V4JB 1N34F 1JXEA 3LA0A 2Z30B 3FGVA 4Q7AA 4WFNQ 1DTTA 3O44A 3AH6A 3V5RA 4HL9A 1K0VA 5C42B 5CZXA 1KQFB 2ZFHA 1ZAXA 4F26A 2E9TA 2VIHA 3UO0A 2F63A 1RTIA 3I9V9 3CCSS 2DISA 2Z56B 1T7PA 3FUYA 5L9NA 2GJIA 2HHWA 3MM5B 2YKNA 4BLGA 1YZ7A 3QIDA 2MKCA 5HL7Q 2EBEA 2XQCA 5A0YA 5BJRA 3NCRA 2Y0BB 3DFEA 4E0DA 3DGVA 3D28A 4OYXA 4OJHA 5EX3A 4TU8A 2WZ1A 1B64A 4ED7A 1V3SA 2MLXA 2B9WA 1YITS 2C2NA 1Y0HA 3L95X 3MUMP 3GYXB 3H42A 1NHUA 1UWAA 1V3RA 1M90T 3LO3A 3HVRA 2IAJA 1YLXA 3OD2A 3MPVA 4HH0A 1ZM4A 1RGVA 4HTJA 1M5OC 4ZPAA 1KHVA 4KH1B 3DRSB 3MAQA 1JLEA 3OT9A 2FY8A 3RYLA 1H3DA 3AODA 5LSRA 2OMLA 4N5SA 3Q2TC 5J2PA 1ZTTA 4L74A 2R4FA 4FVMA 1VJQA 3CD7A 5KG0A 2MQOA 2DH9A 2DR5A 2KJVA 1RCOB 3O6QA 4IG3B 2DGTA 2J6SA 3SSQA 2HQGA 2G2YA 5F9LA 4I0WA 3DLKA 3A8KA 1JKHA 5HVHA 3EPIA 2ZWPA 4LF8F 4XPEA 1QM9A 1SKUB 3QO9A 4V19J 1DY3A 5HROB 3CVKA 5L1JA 1OO0B 5CYQA 2E1AA 1WKJA 4H4MA 2VC1A 4IRKA 4G1QB 4P2FA 2P9GA 2QLJB 1I94F 3FJ2A 4RKUC 3MMCB 5KT6A 4NRTA 1N88A 1OYDA 2R7UA 4LT6A 1N33J 3BPDA 5HMWA 3W8PA 5DZ7A 1TUWA 3SV4A 3C66A 4JI4F 3OTOJ 2CKWA 2D1CA 2K06A 3HVAA 2OSRA 3BQ0A 1R3NA 3HZGA 3N01A 2OPRB 3OTCA 2DNGA 2E9RX 1HD0A 2UUAF 3H5UA 3K8VA 3D6MB 2XCAA 3DGPB 4FBUA 3KK1A 1VGYA 2CQ2A 2IBOA 1N5TA 2RJZA 3K5NA 3R7BB 4EZ9A 1X4DA 1S48A 2P2CB 4DV5J 2WVBA 2OD4A 1CVJA 2D74B 4Q0BB 2YTCA 3BR8A 1T9UA 1VQLS 1DJ0A 2ZKTA 1VRQC 4KGMA 3U1LA 5KFYA 1NJYA 1S57A 3MM9A 1RAAB 3MR3A 4GVBB 4MKYA 1T9YA 4G65A 4URQU 2ZBQA 2ZH1A 4GC6A 3OLAA 4DV1J 2JVRA 3D0GE 3B8HA 3D67A 4J5OA 2QLWA 2W2QP 3K5MA 1NPRA 4LRCA 3WX8A 3GILA 3MM7A 4K4TA 1WSVA 3KHGA 2CNNB 1HHSA 2H4YB 2RUSA 3HZEA 4PKDB 2UUCJ 3J7A1 1T9VA 1KP6A 3BYRA 1UEUA 2R7TA 4PR6A 2EG2A 4B9NA 2KRRA 2DNMA 4Y2IA 3GJTB 1RT3A 3W2WA 2MSSA 4EUVA 2NXEA 2DITA 2NSBA 4OIXA 1N32F 5HQ8A 5L1IA 1IJFB 1FJEB 2KVIA 1HNWF 2ROGA 3RTVA 2AKWB 3SQOP 4ES3A 1GXLA 3OV7A 1UA0A 3CSKA 4UUWA 4F25A 2LQ8A 4F4XA 2D3UA 1HPZB 2WTFA 3IC1A 4KKOB 4OHZA 2BZ2A 1D8ZA 2Y1LB 4ID5A 2CYYA 4FF2A 1RTHB 2OJ3A 2RU9A 1SL0A 1NHVA 2RU3A 3BGLA 2LQBA 1CJTA 2VG7A 1EP4A 5LMNF 2E66A 2DNZA 1T3OA 3QLHB 2E7VA 5L46A 2JWNA 1VC0A 3MCOA 1PJ5A 4I68A 3HXMA 1U45A 4NCBA 1JLFA 1LQ9A 1S72S 4IR9A 2OO4A 2YH0A 5AXLA 3V6JA 4FXDA 3NMRA 3G96A 1BQMA 2JC0A 3T1AA 5J2MB 4LF7J 2DXEA 3A12A 5A8KB 2Y9HA 4LF6J 3SYZA 2PD1A 2HQIA 1FFGB 2DGVA 3VR1A 1B3TA 3M8QB 3KK3B 3IBWA 4K4XA 5B0EA 2HIYA 3JTNA 2FJAB 2BE2A 4R25A 3EVMA 3C14B 1U02A 1GQEA 1B0TA 1CJKB 2DEIA 1N5VA 5CHCB 3FCWA 5DRKA 2ZH3A 1QUPA 5DQHA 3X3UA 1WF1A 3KLHA 2IMOA 3I96A 3QO9B 4KO0B 1RHRB 5DGAA 2VASA 4B9VA 4OI3A 5C7PA 2CJBA 3JXOA 5CYQB 3M8RA 1AW0A 3EICA 2V2VA 3NNHA 4ECXA 4QCLA 2V50A 4FS1A 3N6NA 2BRLA 3UDLA 4F04B 3S6EA 4DX7A 1RAHB 1T9WA 3OBIA 3AXMA 3M2RB 1SH2A 3NWRA 1WDDA 1HQ2A 2ZC4A 4M5MA 2W25A 2L41A 4XDCA 1FHTA 2DPIA 2LA6A 3MI7X 1IWAA 1CEZA 2Q79A 1WC3A 3OL9A 2V2QA 4WK1A 1D9FA 2KU7A 4PXBA 1C0TA 5KTQA 2ALYB 2OMOA 2C22A 1V3ZA 4ZPCA 2MZRA 2GQ2A 4CLFA 2OPPB 4LSNB 2DD8S 4KHPF 5DLFA 2EFVA 3G6YA 1SJRA 2QA4S 5KT3A 2NLWA 4JI1J 1G6BA 3MR7A 2W2MP 3GYNA 9ATCB 4F2SA 1M5VC 2XY7A 2PEHA 2X1AA 4FYXB 4OYOA 4X64F 3QJLA 4TQSA 4KB7A 2JEFA 2I8EA 3BM7A 3G6VA 2MLZA 2PN6A 1HI8A 4LBHA 4CIOA 3UWTA 4ZVOB 3PNIA 4JYAJ 3H20A 1X5OA 3EXYA 4M5DA 1SJ3P 3BYPA 4NXMJ 4OYAA 2E7WA 3KUGA 1LWEA 2GVDB 4NRUA 3BH6B 3W7BA 1ZTWA 4FPRA 2AT1B 2M88A 2XWXA 4IOCQ 1SI9A 4C3KA 4FNIA 2V6AA 1GFWB 1RT3B 1SV5A 2E1RA 1HWUA 3W2WB 2YKMA 4OI4A 5DG7A 2M9KA 1YKWA 4C98A 1Q82T 5D8HB 1DAXA 4PPZA 4B02A 1ZM9A 1KBRA 2EFQA 3K2YA 4Y2KA 4N41A 2OEKA 2X1GA 3GR1A 3OL7A 2C1EB 5KFOA 1YRXA 3MPYA 4DFJA 2KL8A 2AZ3A 3HHLA 3IGVA 4S0MA 5KFVA 2G4BA 1NLKL 1WACA 3MM6B 3ILIA 2V0NA 3L7UA 4DV3J 1XJWB 3BPSP 2VICA 2UU9F 2RQCA 1FFSB 1WOPA 4TY8B 3UN5A 2IVFB 4G3IA 1CJTB 2VG7B 2RAQA 2K3IA 3P5TL 4O4GB 1SC4B 4NZ6A 2CUYA 2SXLA 5IOLA 4I64A 3THPA 4RNFA 4CP5A 5KFBA 1KOHA 2XZWA 1WHXA 2EFNA 4EBDA 1HKAA 4PG4A 3VVTA 2DT9A 4A8XA 5B09A 3PFEA 2OPSB 3BB5A 4NXNJ 1XMOF 2CQBA 1G4CA 4I2QA 4NEZA 5J1EA 3QT7A 2K7KA 3G82B 2KZMA 4DG1B 3DRPB 3D3CJ 5JUMA 4IO9Q 2F8HA 1OQ3A 2FJEB 4ZJOA 3RBEA 3PW4A 1X7VA 4EO6A 3C6UB 2FC9A 4I6WA 1TTHB 1RT6B 2ADBA 4KT0C 4I7FB 3K0JA 1PILA 3RJMB 4DWIA 3THVA 3T5KA 2BJ1A 1RT5B 3GTYX 4ZVTB 4J9VA 3BKTA 2GGPB 1VRUA 2E5LF 2C2DA 2L9DA 5IWAF 2KFNA 3M9NB 4FN5A 4OZ0A 3W63A 1XNRF 1UZDA 5DZ6A 3AFGA 4QWCA 4ANCA 1RT4A 4ICLA 2CG4A 1S1WA 4NLTA 1LEOA 3TAMA 4YP3A 4H54A 2CZVC 1RHUB 2AX0A 2N3LA 3NGTA 3MR5A 4IR1A 1X4EA 1KLNA 1TL1A 1SKRA 3ZZZA 4U95A 4L76A 3TUPA 1VJWA 1VOMA 4G6VB 1LNQA 1E6VB 2MKYA 1VBXA 4LVOP 2LFVA 1H38A 2XSJB 1PCAA 3DU5A 3KKFA 1HW9A 1OWXA 4A8OA 5JVHQ 1IM4A 3RRKA 4RW4A 2KXFA 1R43A 3DLBA 4RU2A 2EFPA 4ECQA 1EX8A 2UXCF 1X0FA 4LQ9A 3W65A 1PC5A 3UDVA 5HANA 4W98A 4IRCA 5H1SV 5F3ZA 4EEYA 4LF8J 2BV3A 3F73A 1KONA 1S1VA 1X5TA 1S99A 3VZHA 1VQMS 4CT9A 1CJUB 3NMAA 4O3QA 5E7OB 2BJ9A 1YSJA 3IR6B 2E1MC 4CTAB 5D6GA 4F0MA 2EG1A 1H98A 3CCMS 3CCWA 5G4DA 1I94J 1FRHA 3Q86A 4HLBA 2R8KA 2N7CA 4ILMA 5F8HA 1RHKB 5LMUF 2MZTA 1DLOA 2NYIA 4JI4J 4M5DB 4UY85 2Z58B 1ZM2A 2EXUA 2WBMA 2RILA 4RX6A 4F36A 3QRPA 2JRSA 4TU9A 4LF9J 3M2VA 3ENQA 2CRLA 2ZE2A 2BJ7A 4USKA 1C2PA 2XMVA 3O2IA 4LRBA 4YDDB 1FX2A 3RAMA 3UCZP 3JQJA 2UUAJ 1Q16B 4BC7A 1WUUA 2KFYA 2IJFA 5LJ5Y 3CT9A 2RVJA 2UP1A 4MFBB 5T7LA 1WEYA 3TA1A 4YB7A 3CCRS 3JYTB 1JJHA 1N54B 1YJVA 2NYHA 3B82A 3CCJS 2Z4PA 1SC1B 2ABYA 1HBMA 2APOA 1S9GA 3GP9A 5B0AA 1JLQA 2BDPA 2W8KA 3FSXA 4B3RJ 1RWNB 5I42A 1KQGB 1LWCA 3TVYA 2RIJA 2KT2A 4Y2AA 4F0KA 1HA1A 2BKNA 4FP9A 1V9OA 3NS7B 4QJVA 2HBYB 1SIZA 4CM2A 3O8WA 4NLPA 4OJGA 2HVEA 5HJYA 3CJKA 3WIUA 4PEOA 2F9JA 2CDRB 4B3OB 4L75A 3US5A 2CA9A 1TL3A 1TKXA 2LU2A 5A6WA 5J1EB 2E1CA 1N32J 4I2PA 2AYGA 4HVZA 4QU7A 2CPFA 3HVTA 4MKVA 4DUTA 3NL0A 2JH3A 3PEHA 2HQDA 7AT1B 4DOZA 4BWMA 3KNGA 3HKWA 2RRBA 3WIVA 5KT2A 4CLWA 1A6LA 3MAAB 1JLBA 4OYZA 2XMMA 3VTIA 1MMLA 3MECB 2LYVA 1M1KT 2H65B 4WFAQ 2XWYA 2R7VA 4H4OB 1RYRA 1QAIA 5LMNJ 1WG5A 2LCWA 4QWAA 2QT7A 3VAMA 3BO4A 5B0BA 2C2ZB 3HHLC 3T5JA 3RG6A 2FHJD 5HBMA 5LT5A 3KJNB 1HNVA 2ILZA 1KVJA 3L7OA 3VAHA 4F2RA 3RRHA 3HMJG 5KFNA 4HACA 1YBAA 3BSNA 2EK6A 3SDEB 3OFHA 3PIPQ 1ZPWX 4HT7A 4J9UE 2VF3A 2WOMA 5F3TA 4AXJA 1HNIA 4NCGA 1RK8A 3ZZUA 2J6TA 4IOBA 1TKDA 1NKEA 1BUXA 4EU0A 2MKJA 2MMYA 4Y0FA 3OTDA 1TVRB 1RKJA 2IRXA 4WBFA 4MTPA 4I56A 3ILOA 3QFWA 4WTOB 3HT0A 1Y5IB 2MY8A 2QA1A 3DOKA 1PGZA 2DY1A 5L1LA 1MN9A 3SFGA 3KHRA 3CO9A 3DN9A 4LBPA 1FDBA 3GQCA 2BUNA 3AJ1A 4HKQA 2ZKUA 3FSIA 3E01A 1U1PA 3G71S 2MJUA 1Y10A 2QGFB 2BMBA 2ZDPA 2GMHA 2YNFB 3POTA 4P7TA 3GSDA 4CWBA 1WTFA 5GMEA 2J9EA 1XN9A 2RS8A 4DSIA 4M5JA 1IKVA 4ZVRB 5E5NA 3RB4A 1D9AA 3K57A 2JLGA 2X3GA 2VH7A 3RB6A 3JQMA 4J7CA 1RAEB 3PX4A 1HBNB 3R1LA 4OYPA 1G1XA 2GA7A 2R42A 3DOLA 1NU4A 2UZAA 3TJ9A 1B70B 3A3OB 4P73A 1YG0A 4ELTA 4KHPJ 3CC7S 5HMZA 2YX4A 4K4SA 4DDFA 1FJGJ 4W90B 4EK2A 4B08A 4IH5A 2GHPA 5KFIA 4X64J 4DQIA 4YB6A 2RH3A 3MOJB 3OQ2A 1FRKA 2FJWA 2VDHA 4NWBA 1SUQA 1XMQF 1U24A 1HBUB 3RZAA 1HWLA 4Z37A 3BN7A 3HHNB 3PHTA 1YRUA 2CNLB 4KHMA 1C1CB 3IMQJ 3FQLA 1CULA 3MPWA 3TEGA 2KT3A 2BJEA 1Q5YA 4C0BA 2QL5B 3GG0A 3OUYA 2F5GA 4PYAA 2ZM6J 1U1LA 2AYEA 1F1BB 1JMTA 3OXGA 3DHXA 1T9XA 2WVEA 4QYZJ 2ZEJA 2UVVA 1WC1A 2DR9A 1LOUA 2YNIA 2A1BA 1KLMA 2O3DA 1S9EB 3MEKA 1L5UA 4K5SA 3TOQA 3QATA 2D9PA 3IO1A 1J5EJ 2IA6A 4B3MF 4WXOA 1TV6A 1MNEA 2B4UA 2YNHB 3WDOA 3KJVA 4YEAA 4DR5F 2WHOA 3TX8A 3A13A 4DQRA 3IG1A 1RHMB 2UVRA 2HW3A 3ZO7A 2UU9J 1H2TZ 4WFZA 1LK7A 2W9BB 1FI4A 1F5CA 2ZH9A 3BBBA 2Z2YB 3EPGA 4NZ0A 1BQNB 4EYIB 2AQ4A 4R8UA 4OL8A 5AE1A 2MGZA 5HSPA 4EGLA 4OYWA 3OSNA 3K7RA 1RJJA 1HNVB 2U1AA 2Q6CA 2B5JA 5ITHA 2W01A 2FHKA 1XMOJ 4HI1A 3SFUA 4UOGA 4HACB 2UUBF 2NS1B 2RNEA 5M2RA 4IYQA 3H4BA 4M1KA 1MW7A 1SIWB 1BWVA 2RE1A 1TMJA 2DGSA 4O0IA 2IM3A 3QGGA 1RWOB 2WONA 4M5NA 4NCGB 3W9IA 1HBOA 4RW8A 4MK9A 3DI6A 4WE1A 1NO8A 4TLRA 1QE1A 5DO2A 3FRZA 2FVQA 4NI2B 2ZWOA 4TXSA 1NHKL 2PMZD 1TELA 1NJZA 4TLQA 2CFXA 4ZP8A 1NCLA 3ENAA 3CJ2A 3FZBA 3GB0A 4OV6A 2E5LJ 5KFUA 5IWAJ 1UFWA 4UZCA 4ZMMA 4UQTA 1VK8A 1XNRJ 1Z4UA 3LP2B 2IBKA 3MPUB 2F4VF 4IG0B 3W3SA 3TQ1A 1EKRA 4K2JA 2W4CA 5J2QB 4M94A 3DLHA 2A0FB 3CMAS 3ELHA 2HNZA 4L73A 3BDEA 3CIMA 2KRBA 2XY5A 4ECSA 3QFHA 4O3SA 1VQ4S 3HULA 1DBDA 1REVA 1PYTA 2U2FA 4NOHA 3CNQP 3NEKA 1JXVA 1WOOA 1ZAWA 3G2XA 1SBRA 4IFYB 3VVUA 5IXUA 2UXCJ 3CO0P 2HNYA 1P1LA 2M7SA 4DV0F 3ISZA 4JV2A 2Q66A 3RBZA 2HAIA 2J7UA 1RQ0A 3DYAB 1LW0B 4NLDA 4J9MA 5K8MA 3NP5A 4JV5F 4UOHA 1H6KX 4X4SA 3SCLE 2B7CB 1TFYA 4DV6J 2F9DA 1T05B 1ZH5A 1Y4ZB 4P75A 3Q8PB 5LMUJ 4HT5A 1WF2A 3ZZYA 5ETQA 4ECYA 1CULB 2N4DA 2RF2B 3HSJA 2VQFJ 4F8RA 3TX0A 1AFJA 5JXSA 4R0EA 1U0HA 3MMAB 1RWXB 2ZUGA 3FVYA 2AGPA 1VQYA 2DNOA 3D0IE 4DPUA 1Y7PA 4USJC 1MMNA 4G1IA 2YNIB 3ADAC 3N4WA 1YJ9S 1KLMB 1ICEB 4ZN3A 1A0OB 3OR2A 4LRFA 1S77D 2D69A 5F41A 2BJ3A 1S12A 2ALZA 2M5YA 3D7SB 3DXBA 1NZAA 3MMJA 2XMWA 3PG9A 2HHSA 1XERA 3R5JB 3FQKA 4PG6A 3JTPA 3P8BB 1KVKA 2WSEC 4J9RA 4ETXA 3C2PA 2G0IA 1G3OA 3Q24A 3TI0A 4AE5A 3MEDB 4R8UB 5GAEU 5EWEA 1S1XB 2HFOA 2P9EA 2XMJA 2W7OA 3FDSA 1XNQF 3J7Z5 3OTBA 2ZHAA 2VPZB 4ZVGA 4YY3J 1E6YA 2DRDA 2CNOB 1M5SA 1HYSA 1UEVA 4C48A 5IC4B 4PABA 5GAGI 2DHGA 2LEAA 3GFZA 5AJ3F 1S6QA 2GV1A 1FT8A 1SJ1A 2DXDA 3J7YI 5KG7A 4PUOA 3I5AA 2CWXA 4OI6A 1FDDA 4RBTA 4X4VA 2HG4A 3E3XA 4CLUA 1S6OA 1FO1A 1FDNA 1R0BG 5EUHA 3CDUA 2GMLA 3IRXB 4A8KA 2WVFA 2PE8A 3RAXA 3HDSA 4F3OA 3GZ7A 1OYEA 4LF2A 1F0XA 1VISA 1FF2A 3I5CA 3S01A 2QL9B 1RDRA 4ILRA 2GHWA 4P74A 1FE0A 3LW5C 2RQ4A 2IRYA 4KY3A 4FYWB 4E98A 2XS7A 4WYWA 1X5SA 4USMA 5I3UA 1REVB 1O6XA 5HN0A 5U47A 4F4AA 2QSFA 4O23A 2FGOA 4C97A 1Y3KA 4DR6J 4KR0B 3PRDA 4KYZA 2RB7A 1KRPA 1DTQA 2L3MA 1J5OA 3D9BA 2FVCA 3FNNA 2C2MB 1NUEA 4PXDA 1N6QB 4RNHA 2DGXA 2Z2LA 3T3FA 1XQIA 4QWBA 2JL9A 2DKOB 3QPIA 1I1GA 1RT1A 4UW2A 2AMCB 3MM8B 4OZ5A 3RBDA 4RWXA 3EDRB 3NCPA 3W2VB 3KLGB 3M6WA 3KJQB 4RUCA 3OFFA 3UR0A 3QRRA 2IY5B 3PYEA 1O51A 2XLJA 2GNKA 4CLPA 2O67A 2RHQB 1X4AA 2GVZA 4KPCA 4RPFA 2D3OR 1NRKA 1Y9OA 3LGNA 1TL4A 4DQPA 3AOBA 1TQLA 1QAJA 2RS2A 2VFRA 1FK9B 1R89A 2BRKA 2I5JB 2WK4A 5KG2A 3CB4A 3G86A 2FDNA 3ICLA 3FCHA 4DLEA 1FRXA 2NXUA 2F3JA 4F67A 1FCAA 1T02A 3JSMB 1RWKB 4DFMA 2XLIA 3QQCD 4WKYA 4NLYA 1U2CA 2WW8A 2V8DA 1MG7A 4ZN1A 3AA8A 5E33A 1VRTA 4UOCA 1VQOS 3TVKA 1XMQJ 2ZNZA 4HHHA 1UPPA 4ZJLA 4X65J 2G13A 5GMKa 4C11A 1VCTA 1WHYA 5KFHA 1SQGA 4ZPDA 3MWBA 2H54B 4LR8A 4DPTA 3X1LB 4GKJJ 1IKYB 3U27A 3VHQA 3Q23A 1ZM3A 4ZVHA 4HDGA 1NJXA 2Q43A 4ZKAA 5LOQA 3VV2B 1QVFR 2R2TA 4OZ3A 2YKAA 4ZVPB 1RAIB 1I51B 1HYSB 2Q6BA 2DR6A 5D4PA 1CSJA 1C0UB 1LWFB 3N9UC 4CRJA 2KHCA 4NLOA 4B3MJ 1TL7B 1UWBB 2ERRA 3UD3P 2QA4G 4FF3A 2B6AB 4DR5J 2X7IA 3A1YG 5IQQA 3OL6A 3PZPA 1GTHA 5CXTA 3IAM9 4HR2A 3CDWA 4HHUA 4WXWA 2BQRA 1RCXB 1CJVB 1ROFA 3H0PA 3SBMA 3IN5A 5ETKA 3DLGA 3CWJA 2XZDB 1YZ6A 4CM0A 4RU9A 2CPDA 4U96A 4ZVUB 4DL7A 2G2OA 4OI1A 3BBCA 1D3WA 3OVSA 4DUZF 4X4PA 2PFFB 1MROA 1RAGB 1NH8A 4K4ZA 2UUBJ 2IHR1 5ETMA 4R5PB 5J2NA 2DEJA 2E44A 2R2SA 3M8SA 1RWUA 2IFXA 1J5OB 5DETA 4GKKF 4MK8A 4OMFG 3MFHA 1XEZA 4RL1A 3U7JA 3C8YA 1N5QA 2R8HA 5A2QY 1UCNA 1TFWA 2ZZNA 2B9YA 2J0WA 3L09A 2W2PP 2UUCF 3SSRA 3Q8QB 3CCQS 1ZZNA 2FQQB 3R2CJ 2MB0B 4RNOA 4EBEA 2R7RA 3HI9A 3HSZA 4YS2A 1WC5A 3MEGB 1SH3A 2QV6A 3R5CA 4L3NA 5KG1A 4CO4A 5KFAA 1V6HA 4KGVB 5KFMA 2I1RA 5SZTA 5IT9Y 3BSOA 3ET6A 3HX9A 1QAXA 2GVZB 3DC2A 1SJFA 1WC6A 2BE7D 2QL7B 4OQJA 3LP0B 4CLSA 3I0SB 4C8NA 1MLAA 2JJ4D 3I0RA 1H7XA 3PVXA 4I67A 4NLGA 6FDRA 4DR7F 2ZD1A 3EMTA 5K14B 4LFAF 4AUKA 1FD8A 3A8JA 1WG4A 1N5YB 4I69A 2WVDA 5D3GA 5KFCA 5KFJA 2HWIA 1N0VC 2B43A 2DGQA 2AIRB 2HLTA 2FHJA 1T8EA 3GWCA 2MJNA 3DRYA 3TWZA 3QRQA 2V2KA 4UT4A 5F0WA 4JV5J 4WZMA 4DL2A 3BS9A 3EJMA 2VG6A 1YJRA 3MZIA 5SUHA 3KLEB 2HGNA 3AJ2A 3IFEA 3C16B 3CJ4A 3EVWA 1HQUA 4M63A 5CA5A 3FRYA 3EM1A 2LEBA 3PJXA 2PEBA 2MQMA 4JI7F 3TANA 5HLFA 1IBMJ 1ZA2B 1U2FA 1GXTA 4C8YA 2ZOGA 3Q8VA 3LP1A 2DHHA 3WZ0A 4QWEA 4TYAA 3NS6A 3WHIA 3QWUA 4DSKA 3W66A 2Y3YA 4CH7A 1Q7YT 1Q79A 3IS9B 1WC0A 1KS2A 1XWLA 4NMLA 2CXEA 1VQ7S 2RQKA 1O0PA 2B51A 4ZIWA 4OX7A 3VGUA 4UF4A 2ZHBA 2D3ZA 2LKZA 2FY1A 3GJRB 1BE4A 4ED5A 5KFLA 2CJAA 2XC9A 2W4DA 2HQFA 2YWFA 2EKNA 2V8PA 4DPYA 3NRBA 4IQXA 1GMUA 2MZQA 2YPZA 2VA3A 4FYVB 3M6XA 1L3UA 2A3JA 1WHWA 1ZBTA 2J9DA 1NAQA 1NK4A 3N0VA 3WQPA 3M30B 5ETNA 2GW8A 1PJ7A 4CLKA 3HFKA 1JLAB 3U1MA 1O5JA 3PM9A 2A6MA 1ZYQA 4IO1A 4O44B 5M2UA 4J9KA 3OFGA 1XNQJ 1R31A 2O1PA 1D09B 4RW7B 4LIRA 3NGSA 4LUBA 1VBKA 3S7RA 4YFUA 4DV7F 5IC6B 3ZZRA 3PTWA 3M9OB 4JI1F 1R7IA 4IDKB 2CZ9A 5AJ3J 4D3HA 1HI1A 1PYSB 3FFIB 3PIOQ 2ROPA 3AOAA 4DFPA 4ER8A 1S0MA 1QVGR 2UXBJ 1RBAA 4OLPA 1EJ7L 1FXDA 2HBQB 3AD8C 3RB3A 4LFBJ 3MR6A 1SQFA 4QIWD 4XDDA 2DGOA 5IS2A 5FDLB 1JNZB 3AT1B 4QBUA 2Z57B 5KOWA 1IWGA 3CJTA 3MMBB 1YRTA 1F9EB 4MAKA 4OHVA 2DGWA 4XPCA 2VFUA 3MEEA 3KLFB 2MY7A 2DO0A 2D41A 2KKHA 4IUFA 2HMIA 3KLIB 2UXDJ 1IKWB 5ETTA 3RUBL 4ZPWR 3TZWA 2IIHA 1K1SA 3HM9A 1S59A 1HR0F 2WSCC 2MZSA 4RUBA 3LUYA 5FLXY 1Y3JA 1YJTA 5A8WA 2J6UA 2XULA 3M8WA 2E5GA 3FBEA 1VC6A 2EKYA 1S49A 3MAHA 5CYMB 1GK8A 4WKRA 5J1PA 4KFBA 1S6PA 1UEKA 3QSYB 2AYMA 4DV3F 4UY8T 3DOMB 1EAYC 1SVDA 2X51A 1LKZA 3CJ0A 5C24B 3BO3A 1H2UX 1JX4A 2V8GA 5D3GB 1Z1ZA 2YBVA 1KTQA 4RZRA 1WEXA 1ULRA 3SZ2A 2QIFA 1QDUB 1PIEA 5BR8F 5HQLA 3DMJA 4CLZA 2IDLA 4PQUA 4I6AA 2DBBA 4DBQA 4ECTA 3Q89A 2MYFA 4KIAA 1QD1A 3TZZA 2OKQA 4GVLA 1UAWA 2G1HA 2YX1A 3MCMA 3QAEA 3T6BA 2ZBIA 2ZBPA 5GAHU 2AEJA 4NXNF 4LREA 5LXYA 3AB2B 4PWUA 3EGVA 3J80Y 4CCHA 4DU7A 1ZETA 3NGDA 2C42A 1HIYA 1S1TA 3BBFA 2ROEA 2K1RB 3V81B 5G0RB 2BVZA 2H9ZA 2CPEA 3CW2C 5KG6A 1WI6A 2OTJS 4U7UD 4K4WA 1MWZA 2N7YA 3CC4S 2M8HA 2JC1A 3TA2A 2HKEA 5ETPA 1SB6A 2EFGA 1T3NA 2PA3A 1RT2A 2KYZA 1VQNS 3QIPB 3Q8UA 3K59A 2PFDA 1RI7A 1UL3A 3GU0A 2P9CA 2CJXB 2WB1D 2CZ4A 1JLCA 4B17A 2IC3B 3FMWA 1G7CB 4ECZA 3JAMY 2LEPA 4JB8B 1RT7B 3C15B 4ANDA 2QO3A 5HATA 1Y5NB 2H4WB 4ATNA 1R0CB 4DX5A 1MSWD 5K5MA 2BACA 1CLFA 5GADI 1R0AB 1NK8A 4ZPVR 5I4MA 2HPUA 3PR4A 3GIKA 1PBAA 2OIHA 2JZ5A 2CWKA 1Q8KA 4CYUA 1D9DA 1R8CA 1FKPA 3M8ZA 2PMHA 1N52B 1HQEA 4J9OA 1UMJA 4B9LA 4TU7A 2XBPA 4KV8B 1R6YA 3W62A 1Z2LA 5I3QA 2YWWA 1RTJA 5AE2A 2OI2A 1TR0A 5D0GA 2M4MA 1NMEB 4J91A 3TZYA 3H8YA 3MF5A 3MDFA 2R2UA 3VAFA 2OUGA 2MQPA 4OV1A 1KOOA 4O4RA 2AZ1A 2CADA 4RUHA 1UFLA 1FKOA 3DRRB 2MQQA 2DCUB 1S0VA 5KFXA 3QZ8A 1X8DA 4FXWA 5A8RA 3I4HX 1F9FA 2WB4A 3OJUA 5E2QA 3R3TA 4UTGA 2IVMA 2VG5A 4LF9F 5LM7E 4NLWA 2BYCA 5C2GA 4RJVA 3VQTA 2AWZA 4AL5A 3BQ1A 4LSLA 3VGTA 2HFNA 3NOGA 4CLLA 3GCWP 3UR3C 1RABB 3DXSX 2RRNA 4U9RA 1WOSA 2DH7A 4DUZJ 2UVUA 1FE4A 4LFCF 2DNLA 4BS2A 1U1QA 3C6TB 2G0JA 2ZVSA 4AT1B 1XR5A 3H90A 4USTA 2W1BA 1K9MT 4A8WA 4U6PA 3HVWA 2FVPA 4WFYA 3UVJA 4C9DA 4QIGA 4TY9A 3K58A 3CPWR 3VGVA 2C3UA 4RW9A 4B3RF 1FJ7A 3MFIA 5IV3A 4U67Q 4GKKJ 2R7SA 2WRMA 3ZTPA 2XY6A 2V5HG 1NPKA 5LSLA 5HP1A 2AF6A 3HLUA 3CD0A 1FVQA 5KG5A 1NNDA 4PG7A 1GXUA 2LQ9A 1FA0A 4QR2A 2HNDA 3KHHA 3H5YA 3W9HA 4DF8A 2GS8A 1NK5A 1H7WA 4F3MA 1N8RT 3UCUP 1DTTB 1GH8A 3FBFA 2GZOA 3A3PB 1RWMB 5BYRA 4A8SA 4DMZA 3LWLA 1T11A 3GIRA 3QT5A 1RTIB 2MSTA 3EYZA 4JUZA 4IFVA 3GLJA 2YKNB 3IM8A 1N0UA 4JI5F 5L9XA 5CCMA 1OPZA 1Q8IA 3TEHB 1D8YA 5A0YB 5F8MA 4QIEA 2VFVA 4DR7J 4M5IA 1X4FA 3SCIE 2DIVA 4NPOA 3EZOA 1GNKA 4LFAJ 2I38A 1NEEA 3M8YA 4RBUA 3D4JA 4WWSA 2BQUA 2QTWA 3ZTQA 2KJWA 4TN2A 2PIIA 3KUEA 2XS2A 1EQ0A 3VGSA 4TQRA 1K1QA 5IT9U 4A8QA 2AD9A 3H59A 2O5DA 3Q8YA 3HJFA 4NMXA 1OPIA 4C8OA 2IAJB 4WFXA 2QMUB 4TYBA 2XYGB 3DDIA 3T19A 4P2MA 3HPOA 2NQPA 2AJ0A 2HS3A 1JLEB 2BXJA 1CBKA 3D0HE 1RTZA 4OZ2A 1C1BA 4ZK7M 3T1YF 2DRBA 3IWNC 3PX6A 5J2PB 4P2XA 1FNXH 2OD6A 4UZBA 2HQ3A 3A4TA 4A48A 4FDFA 4JI7J 4DZDA 4YDXA 2YNGA 4CH1A 3BKFA 1HQEB 2MQNA 1ACMB 4LMZA 4NYPA 3VWSA 1VS3A 1FJCA 1U47A 3H98A 3DM2A 5GVQA 1H74A 2W7AA 1OY9A 5DM7Q 3DLKB 1NK6A 3F44A 2B9XA 3NBPA 4KQZA 1JKHB 1PAEX 2RQMA 4DL3A 1AZSA 2FGCA 3TZXA 2V34A 3BGFA 3M32A 2OPQA 2DXFA 2J7WA 5AT1B 4MIBA 3R5DA 5F8IA 1Q53A 5DDPC 4H4MB 1IKXA 3UE2A 1HFEL 4NLQA 4ZCMA 1B7YB 4QYZK 2ZBCA 1VQ5S 5T14A 2J5AA 4Y2CA 3GIIA 2RDDA 3JSYA 3AQPA 1OS5A 2K2PA 1GAOA 3H2UB 3G8SA 4ZVQB 2OSQA 4ED8A 1UVIA 2WAQD 3M9MB 3M8PA 2ADCA 1TKTA 5THWA 2XCPA 2CVIA 3QWPA 5DJBA 4ZCKA 3VCDA 2H5EA 3KNAA 4GMKA 4AFFA 1P6TA 4W4MA 4MIAA 3I56S 5EN1A 2J8SA 2P6TA 3KK1B 5L38A 2RKIA 5IM0A 1FERA 1NSQA 5KT4A 1GT8A 2V8HA 4CI0B 3GYGA 2CPZA 2F8MA 2OHDA 4DV7J 3UVJB 1FJGF 4LSZB 3M1VA 3ITHA 2WSFC 2XTJP 5IT0A 1EETA 1VYAA 2V63A 1ZPVA 2BW7A 5K20B 2COLA 2EPIA 3MM9B 3M2UA 4H4KA 3DLEA 2BEFA 1MWQA 5EX0A 4FYDA 2M70A 4X4QA 5ETLA 1HW8A 1LFWA 4KGXB 2DNNA 3T6JA 4UOFA 4B9MA 4Y3CA 1LXNA 3IGNA 1CS4A 3MM7B 2HSEB 2YPYA 3K5OA 4OHXA 1X5PA 3HD1A 1VC5A 1M0SA 2ZM6F 2X3DA 3KK2A 4WP9A 5E0OA 2G9OA 2YQ1A 4PWDA 1BWEA 2HK2A 2NPIA 3MOZA 4OYIA 3G6XA 3CMES 3IBFB 2ATCB 3L3CA 3K89A 1RYSA 4OZ1A 3CE8A 2LLZA 3CCES 2UV8A 5CAAA 4N76A 4PWWA 1HR0J 2DNPA 2BANA 2C2OB 3MUVP 8AT1B 1P8GA 3LANA 2HHUA 2CJYB 1KHWA 3H4DA 1NJWA 4DX6A 5DG9A 2ASDA 1J5EF 3QGPA 2MEWA 1U7LA 1B0VA 2LMIA 5DDQC 4W92B 2B7BB 5B0GA 3SQGA 1WNEA 5ETSA 5HVFA 4L3KA 4LR9A 4ID5B 1MU2A 3PV8A 2UUWA 3D66A 2VBYA 3ZZTA 3I31A 2MDAA 3I9ZA 2WW4A 2YKOA 2XNQA 5H9FJ 5M2PA 1UJ5A 4KBIA 1EP4B 4PQAA
chains in the Genus database with same CATH topology
2E7VA 1IVZA 2ACMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7V A;  1IVZ A;  2ACM A; 
#chains in the Genus database with same CATH topology
 3I4P A;  1YJW S;  5BR8 J;  3E8O A;  5LSO A;  4ED0 A;  2GAH C;  5FLX U;  1FTR A;  4DCP B;  2GJF A;  3MPD A;  1RLC L;  2IJR A;  2VKR A;  1RUS A;  3QJP A;  4Z2X A;  4Y00 A;  1JLF B;  2VQE F;  2GIF A;  4TVA B;  4LF5 F;  2DK2 A;  1BQM B;  4U8Y A;  5HMX A;  2AGQ A;  1C1B B;  1UW9 A;  2AHO B;  1W2I A;  5C42 A;  4A8F A;  4XIU A;  4F0H A;  3G8Q A;  4N7T A;  5EDW A;  4Q2M A;  3NKY A;  2BE2 B;  4O3P A;  5F8N A;  4ES1 A;  2EVZ A;  4X4O A;  4B3T F;  3BDP A;  3MM5 A;  4CO2 A;  1K0T A;  2BX6 A;  2R2R A;  4EMD A;  3UCG A;  3MHY A;  4QWD A;  2EK1 A;  3UDC A;  3KLH B;  4DV2 J;  2LXF A;  1R8H A;  1NDP A;  2EW9 A;  3J80 U;  3RW6 A;  2IDE A;  5K8N A;  3VAJ A;  5CYJ A;  3ISN C;  1U8W A;  3LF0 A;  4JI8 J;  1YIJ S;  2HQC A;  1IVZ A;  3V6K A;  4WZQ A;  4RW6 A;  3J7A N;  3C46 A;  4EWT A;  3ZFV A;  3BO2 A;  3PR5 B;  2CQI A;  3HHE A;  2E29 A;  2DY9 A;  4J37 A;  3KXD A;  1NB7 A;  4O0N A;  2GC8 A;  3DRS A;  1TKT B;  2QMW A;  1FRM A;  3BJY A;  2GCF A;  2YX7 A;  2DTJ A;  4N8N A;  4OYB A;  1X4B A;  1TAU A;  3GG1 A;  1VR6 A;  5HAO A;  3JAM U;  1C0T B;  3BRE A;  1U1K A;  3P6Y C;  3C19 A;  4IG3 A;  2HHP A;  2QJ3 A;  4DUY F;  1T9T A;  1WHV A;  4Z7C A;  5LJ3 Y;  3M1V B;  1U25 A;  4FVC A;  4K50 A;  2CJK A;  4ERD A;  3PJ9 A;  2KB2 A;  4IRD A;  3H5S A;  2BM0 A;  5HRO A;  3W5Y A;  1IQZ A;  1NKB A;  3UN2 A;  2VPX B;  2DR7 A;  3CD6 S;  4DV6 F;  1AUS L;  4G1Q A;  1UVK A;  1A7G E;  5HI7 A;  3MMC A;  2AW0 A;  1C4A A;  1S4E A;  1S7H A;  2B9E A;  3JB9 k;  4YR3 A;  3V6H A;  1CS4 B;  1JIH A;  4YR0 A;  3DU6 A;  2VQF F;  1Q7L B;  1X31 C;  1LWE B;  3FC9 A;  3HSG A;  4HHJ A;  4P52 A;  1KSP A;  4QIV A;  4OFZ A;  3CUN A;  3B4D A;  4P9S A;  1SV5 B;  2YKM B;  4DR4 J;  1L3V A;  4FZV A;  1VDH A;  1TU0 B;  2OPR A;  1Q5V A;  2VOD A;  1OJ4 A;  4DSF A;  1FEE A;  3IBC B;  4QW9 A;  1B4S A;  3DCA A;  4Y65 A;  1FRJ A;  4RNN A;  2BAB A;  4ZHR A;  4RWW A;  2W2N P;  2DHA A;  5AXK A;  4LFC J;  3ENV A;  2M3D A;  3DGP A;  5HQM A;  4YME A;  1RAJ A;  2CPI A;  3PRB A;  1P27 B;  2BW2 A;  4DL0 C;  2HIQ A;  2R8I A;  3SXL A;  3HHL B;  3KTQ A;  5JMN A;  2DYA A;  3ENW A;  2IRU A;  4Q0B A;  5F8G A;  2BKO A;  1PKU A;  1RHQ B;  2AX1 A;  3EGN A;  4IKA A;  1FX4 A;  1L3S A;  2CQP A;  3TNV A;  5KFQ A;  1FFW B;  4QU6 A;  2F40 A;  1BQX A;  1BLU A;  4GVB A;  2CQ1 A;  5D0R A;  2E9Z A;  3F56 A;  1XR6 A;  2JSX A;  1NH7 A;  2QLF B;  3PO4 A;  3TO8 A;  1HWI A;  2QC3 A;  3LGH A;  5KFT A;  2YXL A;  2HEK A;  1REG X;  4FF4 A;  4H4K C;  4JBC A;  4DR1 F;  4YY3 F;  5KT5 A;  1RBL A;  4OX9 J;  2ZUA A;  4I2Q B;  2FYX A;  4LF4 J;  1V5V A;  3R5A A;  8RUC A;  3GSI A;  5C5J A;  4D3G A;  2KG1 A;  3RRG A;  3NCQ A;  2XI2 A;  2LDY A;  1N56 A;  4JI5 J;  3SCJ E;  3G8T A;  2MKI A;  2HVI A;  2V67 A;  3CC2 S;  2DNR A;  3HD2 A;  1YX2 A;  1WKL A;  3H25 A;  4G1P A;  4USI A;  2G2Z A;  3NWG A;  2ATL A;  1HPZ A;  3CJ5 A;  1KC8 T;  3H5X A;  1Y5L B;  1DQ8 A;  2V94 A;  4KKO A;  1UVN A;  1VRU B;  1RTH A;  2NZ4 A;  2ZJR Q;  2G1D A;  2XNR A;  4DPO A;  5FII A;  2F8E X;  4DF4 A;  4NZ7 A;  3EZU A;  1YWX A;  1RT4 B;  4ICL B;  4RW6 B;  2VZ9 A;  3TRG A;  3QLH A;  3PKM A;  1S1W B;  3O5T B;  3TAM B;  2DNQ A;  1TL1 B;  3N5B A;  1S76 D;  2W2O P;  1EKS A;  4Y28 C;  3AOC A;  3T1Y J;  4NLX A;  2HFS A;  1FWP A;  3ETO A;  1WTB A;  2XO7 A;  5J2M A;  2FJX A;  5A8K A;  1IR1 A;  2K3K A;  4U7C A;  4ECW A;  3TQE A;  3JSR A;  1U6B A;  4ECR A;  4RW4 B;  3PYG A;  4K5R A;  2NXJ A;  4DR6 F;  3M8Q A;  4GO5 X;  2N82 B;  3KK3 A;  2MQ8 A;  3TW0 A;  4NA2 A;  3TVZ A;  2EC0 A;  1R8P A;  2RRA A;  4DQQ A;  2L9W A;  2OLW A;  3D3B J;  3C14 A;  1CJK A;  3CDB A;  1Q0N A;  1AT1 B;  1S1V B;  1OIA A;  1RBO B;  1IBL J;  2Z2M A;  2W9C A;  2XHW A;  1PYO B;  2H5I B;  1VQ8 S;  3BSA A;  2XB2 D;  4KHR A;  4KO0 A;  1VIX A;  1RAD B;  3RU0 A;  4QW8 A;  3P5B P;  3I5B A;  3VAK A;  1M1G A;  2ZBR A;  5CD4 H;  2ZZM A;  1S7I A;  1DLO B;  4O3R A;  4QR1 A;  4P72 A;  5I3P A;  3EGW B;  1Q8B A;  4IH7 A;  2CQ0 A;  2HHT A;  3M2R A;  5E3A A;  1GTE A;  1C4C A;  1WF0 A;  1G2E A;  4EFA C;  3M2V B;  4Q2L A;  3UFC X;  2ZE2 B;  3HP6 A;  1GMV A;  3UPF A;  4DL6 A;  2A18 A;  4DN0 A;  5K8P A;  1XMB A;  3FCV A;  4QR0 A;  3U1N A;  4K8R A;  1S5Z A;  4ZHR B;  1YDL A;  3GPA A;  4ZIV A;  3PW0 A;  1Y00 A;  5T7L B;  1X4G A;  4K0K F;  2YVS A;  3RR8 A;  1GEH A;  2QX0 A;  2AU0 A;  1HBM B;  1S9G B;  2OPP A;  4LSN A;  2XLK A;  1KR4 A;  1JLQ B;  1WSR A;  2UUT A;  5FD1 A;  3T9N A;  5I42 B;  3N79 A;  3TAR A;  1TUV A;  3ZTO A;  1LWC B;  2R7W A;  5DM6 Q;  4JI3 F;  4X65 F;  2POK A;  3J81 Y;  2ZH5 A;  2J0S D;  3KG0 A;  3UD5 A;  1WEZ A;  3K8W A;  1L3T A;  4DCO B;  4HDH A;  4CZC A;  3TJ8 A;  1EQM A;  1SPB P;  4GKJ F;  3CJK B;  4Y2M A;  3A8E A;  2BOP A;  4LJM A;  2GVD A;  1N48 A;  3D1O A;  5HJX A;  3M4X A;  1VQ9 S;  1B7F A;  4KSE B;  1I3O B;  1NZ8 A;  1OSD A;  2KYX A;  1TL3 B;  1TKX B;  4YUD A;  3H2L A;  1I6J A;  3CDA A;  4I2P B;  1VK3 A;  4F4K A;  3SMZ A;  2E5H A;  1RU2 A;  2LA4 A;  1FRL A;  3HVT B;  2ZOM A;  1DAR A;  1VQ6 S;  4HI2 A;  1VMB A;  3NGR A;  4IH6 A;  1ZOT A;  2IA0 A;  3VZI A;  2MZJ A;  2FHM A;  2XMT A;  4A8Y A;  2WVC A;  3GIM A;  1JLB B;  2IJN A;  5IV4 A;  1SJ4 P;  1QSL A;  2B4V A;  1NDL A;  5H9E J;  2EEY A;  3MM6 A;  2QFI A;  3WBZ A;  1CC7 A;  2D9O A;  2JEI A;  3QMQ A;  4TY8 A;  2J7K A;  3AHP A;  5KFZ A;  4DPX A;  3CCT A;  3NY0 A;  2LP4 A;  2PI5 A;  4DV4 J;  1T0T V;  2DO4 A;  4O4G A;  3GE9 A;  1FDA A;  4PYD A;  2LDI A;  1RWV B;  4X4U A;  2VQE J;  1LV5 A;  5HBM B;  4LF5 J;  4OZN A;  1YJN S;  4ITS A;  2QYC A;  3R6L B;  3CUL A;  1K47 A;  2OAU A;  2LQJ A;  2OPS A;  3T5L A;  1TP7 A;  3JSB A;  3BGO P;  4Q8E A;  2WOM B;  1HNI B;  3G82 A;  3N28 A;  4DG1 A;  3DRP A;  4B3T J;  4MK7 A;  3RR7 A;  3NOC A;  4PXC A;  3C6U A;  1U49 A;  4B9T A;  3B6B A;  5AE3 A;  1RT6 A;  2KO1 A;  2ILY A;  4RO0 A;  4I7F A;  3OFE A;  3R1H A;  2FLL A;  4WK3 A;  3G6E S;  2OH2 A;  3MTK A;  2W4P A;  1W25 A;  2EC2 A;  2PGC A;  4OI0 A;  1RT5 A;  1J2V A;  2W9C B;  3DOK B;  2ZH2 A;  3P3D A;  2VC0 A;  4PCQ A;  3TUZ C;  2GGP A;  4WPA A;  1F9H A;  3EXC X;  2C3M A;  1PAU B;  2CPJ A;  1SC6 A;  3GV5 B;  5EGY A;  3QT6 A;  4KRW A;  4P71 A;  3WC0 A;  3HFZ B;  3E01 B;  5DQI A;  4USH A;  3LAM A;  4BBY A;  3TP2 A;  1HNZ F;  2WCX A;  1DFD A;  1F5B A;  1RAC B;  3POT B;  4I1T A;  2FVS A;  3PEJ A;  4DX8 H;  4KJI A;  2AEM A;  1IKV B;  1E6V A;  3IP0 A;  1U0S A;  3LAL A;  1UVM A;  2XSJ A;  3BF4 A;  4X4N A;  3LH2 S;  4M8L A;  1I5O B;  2VBW A;  4NE9 C;  2LU1 A;  3S8S A;  2VBZ A;  1U26 A;  4CO5 A;  3DOL B;  4CO1 A;  3UW1 A;  4NLS A;  4F4Y A;  4V19 X;  4DUY J;  3OPK A;  2K7J A;  5KFG A;  3B78 A;  1RP5 A;  2M2B A;  3ILL A;  2OGU A;  4JI6 F;  4CNZ A;  3HK2 A;  3MD1 A;  5C2C A;  1X9W A;  3LOU A;  1U2R A;  2GO8 A;  3I55 S;  1Q86 T;  4QQB A;  1SUQ B;  2C28 A;  1CJU A;  2KFZ A;  3BH7 B;  2B56 A;  3TA0 A;  4B9U A;  1U8S A;  3GIJ A;  4CTA A;  3W5X A;  3J81 j;  2VD3 A;  3SI8 A;  5GMD A;  1QLN A;  1FXR A;  5MAO A;  5D4N A;  3IXQ A;  1IBM F;  3OUY B;  2KN4 A;  4DR3 F;  4DPW A;  1Q78 A;  2OP5 A;  1QUV A;  2IM0 A;  5KFW A;  2K8G A;  3GR0 A;  2I9S A;  1RZM A;  4HEA 9;  2B4P A;  3V6D A;  3AA9 A;  2IM2 A;  3LTO A;  1VIO A;  4TNO A;  4URG A;  4ECV A;  2V68 A;  4MFB A;  5D0E A;  1OY8 A;  2NSC A;  1TV6 B;  3JYT A;  3ZTR A;  3HHK A;  4AQY J;  3KJV B;  1AFI A;  1YTY A;  4YN3 B;  4V1A k;  1WWH A;  4NX9 A;  2BJD A;  3ZZ0 A;  2CVE A;  3LAK A;  2GQQ A;  3IG1 B;  2CPH A;  2KXH A;  1KVI A;  4RUA A;  1URN A;  1ZAV A;  5KFR A;  4DZ6 A;  4M5L A;  3BV8 A;  1NK7 A;  2ZIT A;  3NLC A;  1JXL A;  2FVR A;  1UVL A;  2PA8 D;  5KFK A;  3DRX A;  4WIQ A;  2HGM A;  3I82 A;  1N34 J;  2MGZ B;  1UW4 A;  2C3O A;  1RHJ B;  4FKY A;  2B5J B;  2VFT A;  3BKU A;  2XGQ A;  4DR1 J;  2N4C A;  4DFK A;  2N3O A;  2HHH F;  2HGL A;  5JJB A;  4B3O A;  2XI3 A;  1IR2 A;  3GFH A;  5J1N A;  2HFZ A;  3PDN A;  5K9F A;  5ETV A;  1NSP A;  2WON B;  4NAS A;  1HBO B;  4RW8 B;  3E2E A;  4C3M A;  1X60 A;  2VUG A;  4NL5 A;  3R9L A;  3DI6 B;  2P8I A;  2UXB F;  4WE1 B;  1QE1 B;  3Q8S B;  2DJW A;  1M5P C;  2R7Q A;  2HZC A;  4LFB F;  3D68 A;  4DU8 A;  1YVF A;  5LXR A;  3U02 A;  1UFK A;  2GJ2 A;  2FZC B;  2GO9 A;  3MAA A;  4M95 A;  3BGU A;  4ZOS A;  2GAG C;  1S0O A;  2HHV A;  3MEC A;  2DNY A;  2YWK A;  3V2U C;  1IXK A;  4URS A;  2XYH B;  1U09 A;  3HKZ D;  3GCX P;  4H4O A;  3W8G A;  1OQ6 A;  5C25 A;  4F4Z A;  1FKA F;  1XTZ A;  1X9S A;  5F8J A;  3CJQ A;  2JFK A;  2XYP B;  2UXD F;  2LQ5 A;  1WD6 A;  1SXL A;  4OX6 A;  2HNZ B;  4KGZ B;  1IBK F;  1F60 B;  2AEF A;  4NYO A;  3P45 B;  1O8B A;  3MD3 A;  4BCA A;  3QT8 A;  4P2S A;  2HHQ A;  1NKC A;  2NPF A;  4N47 A;  5ETO A;  3QGI A;  3SDE A;  2O01 C;  2KT5 A;  1GMW D;  1HWJ A;  2HNY B;  2VJU A;  1DQ9 A;  2AGO A;  4J9L A;  2HVH A;  1IR0 A;  1XBW A;  4HTI A;  3NAI A;  1SJQ A;  2KM8 B;  2HWH A;  2JLF A;  5HVG A;  3EUN A;  3GFY A;  3A3N B;  1F2G A;  4MMO A;  2CG8 A;  2QMX A;  2GFF A;  1P1T A;  1TVR A;  1FXL A;  3DDN A;  4B9S A;  4CLY A;  4CQ1 A;  5F9N A;  3CXC R;  3B54 A;  5HK4 A;  4PAA A;  3IM9 A;  2PC6 A;  2J9C A;  2HYI B;  5T41 A;  2YKP A;  3D5M A;  5GAG U;  3Q0A A;  1XIQ A;  1MN7 A;  2VBX A;  2F4F A;  4KGK A;  3BQ2 A;  3J7Y U;  3I87 A;  3I6P A;  1M1H A;  4CLT A;  3PJW A;  2HS0 A;  1U0H B;  3KUH A;  2DVI A;  2YNF A;  4FXV A;  3G9C A;  4DI6 A;  4IQM A;  2CJQ A;  4DCJ B;  2YY3 A;  5HMY A;  3AXK A;  1NK9 A;  3AY0 A;  4B3S F;  3OR1 A;  3HF5 A;  3V6D B;  2QLB B;  5IFM A;  3OR2 B;  4K0K J;  2VHG A;  3DHW C;  1HBN A;  4MT1 A;  2V69 A;  4LRA A;  4EYH B;  1IUJ A;  1JJ4 A;  2A2D A;  4MIW A;  4M5H A;  2F1F A;  2AJ2 A;  5ETR A;  3ETM A;  2HS4 A;  3IWX A;  3M6V A;  4GO7 X;  4NA3 A;  4ZVF A;  4KTQ A;  1QTN B;  4BC9 A;  1SQE A;  4JI3 J;  4F02 A;  3PXG a;  2FPH X;  1HBU A;  4RLE A;  2KM8 C;  2OFH X;  1SL1 A;  4C8K A;  1VHI A;  2MZ1 A;  4C4W A;  2DHX A;  1DHM A;  2Q1L A;  1C1C A;  2D3O 1;  5D78 A;  1N36 F;  4ZLL A;  4XAK A;  2AJ1 A;  1NBE B;  3SV3 A;  2DRA A;  1AYE A;  2NXC A;  2QG9 B;  3EZ5 A;  1UVJ A;  1E6Y B;  2HFV A;  1U6Z A;  3J81 U;  2RDI A;  1EHW A;  4FBT A;  2XEX A;  1UZH A;  4FYY B;  4A8M P;  2FLN A;  3NGU A;  4PZV A;  4XO0 A;  2I0X A;  2CPX A;  2Y8Y A;  1S6Q B;  3F41 A;  1KD1 T;  1HNW J;  4LIW A;  4J90 A;  1HNX F;  1S9E A;  4C8M A;  5CZV A;  4PUO B;  3GFX A;  2IM1 A;  4LVN P;  1SKS A;  5KFF A;  3UQS A;  1NXI A;  3FBC A;  2QE5 A;  2V9W A;  2YNH A;  3TAP A;  4WYL A;  3NAH A;  1WEL A;  2MHN A;  1QSY A;  4DXL A;  4QIF A;  1RA7 A;  1YK9 A;  4C6A A;  1WC4 A;  3WX4 A;  2H1Y A;  4CO3 A;  2W9B A;  2H5J B;  2NZC A;  4LF1 A;  5E3R A;  5C25 B;  2QRR A;  3M05 A;  1BQN A;  3V4I A;  4DLG A;  3CCV S;  3ZNJ 1;  1IBC B;  1FNO A;  3AD7 C;  2CQC A;  4N8O A;  3CJ3 A;  3GV8 B;  1NSK L;  3TAQ A;  3H40 A;  5I3U B;  4K4U A;  1S0N A;  3UNY A;  2Q3P A;  2ZH4 A;  3W60 A;  5DDO C;  2X1F A;  2BA9 A;  3CCZ A;  1TL5 A;  4JI2 F;  3IR5 B;  4ZCI A;  1DTQ B;  1APS A;  1YBU A;  1TZ0 A;  4PPD A;  2C3P A;  3BGR A;  3VAG A;  3PW7 A;  1JLG A;  2KVQ E;  4XTT A;  3Q2S C;  2UV8 G;  3H7H B;  4YR2 A;  4O3O A;  2DHS A;  2J0Q D;  1UPM B;  3PHE A;  4NI2 A;  1T03 A;  1WI8 A;  3R7N B;  2Y8W A;  1RT1 B;  4X84 A;  1VI7 A;  1SKW A;  4OJ3 A;  3V4M A;  2VJV A;  2PMW A;  3LP2 A;  5B7W A;  2XHC A;  3T5H A;  4ZP9 A;  3L4B C;  3PW5 A;  4IG0 A;  3L9Z A;  2W8L A;  4RNM A;  1HNZ J;  5J2Q A;  1M5K C;  5L8R C;  4DL5 A;  1BY9 A;  2MQL A;  3HO1 A;  2EWH A;  3KOA A;  1RAO A;  4ZLN A;  3EX7 B;  3OR1 B;  1MMD A;  4JI0 F;  1Q95 G;  3OHB A;  1LXJ A;  4IFY A;  4FF1 A;  2Z2Z A;  1KEK A;  4Q8F A;  2OEJ A;  4ZDN A;  1ARO P;  2HK3 A;  4WF9 Q;  3QYY A;  3E51 A;  3MCS A;  2Y1R I;  2NCK L;  4MYT A;  4JI6 J;  3DYA A;  1LW0 A;  2M0G B;  2QZ8 A;  1VRT B;  2FLO A;  1N5S A;  3KG1 A;  3ONQ A;  2QN6 B;  4J9S A;  2CNK B;  2DH8 A;  3VAI A;  2BOA A;  3OXL A;  3UDE A;  4C11 B;  1F6T A;  4A4J A;  3P96 A;  1T05 A;  4C8Z A;  3BEG B;  3SEO A;  3UD4 P;  4KAI A;  2AV5 A;  4ED6 A;  3PW2 A;  2MXY A;  4DR3 J;  1X4H A;  2RF2 A;  1B0P A;  2V4Q A;  4YHH F;  3MMA A;  2F65 A;  3GJS B;  3CED A;  3CMQ A;  1K73 T;  1QAY A;  1JNR B;  4OHY A;  4USU A;  4X66 F;  1U6F A;  3G87 A;  1WDT A;  5DGB A;  1F3F A;  1RWW B;  2FZG B;  2R3V A;  1JB0 C;  4MYU A;  4X4R A;  1CG2 A;  2YKQ A;  1S9F A;  2HVZ A;  2AP6 A;  5KOX A;  2ZH7 A;  4BDP A;  1RKI A;  4HYK A;  2VOP A;  2QYG A;  5BYS A;  2FJD B;  2KXN B;  3CF5 Q;  2DPJ A;  4GC7 A;  2BJ8 A;  2V9K A;  2FJB B;  1JJC B;  5RUB A;  4C7Q A;  3JQK A;  3AB4 B;  4P6Q A;  4Q45 A;  1RWP B;  1GX6 A;  3MTJ A;  4CH0 S;  2HZA A;  2XMU A;  4IOA Q;  1YJU A;  3DLG B;  3CDE A;  2PO4 A;  2EFO A;  2ZHO A;  9RUB A;  3V4I B;  1N4L A;  3OVA A;  4OX8 A;  1M5H A;  3MED A;  3QSI A;  1CQM A;  3HCX A;  1S1X A;  5H9F K;  5D0H A;  4OI2 A;  1FRI A;  2CAJ A;  4GRS A;  1TKZ A;  1MRO B;  3JS9 A;  4Y6I A;  2HHH J;  2CJ9 A;  2MLY A;  2B4O A;  4E2F B;  1RB0 A;  2ZNY A;  5J2N B;  3OW2 R;  5CCL A;  3RB0 A;  1NSA A;  1D0E A;  4DL4 A;  3BGR B;  3UI3 A;  1JLG B;  2HWT A;  3MGJ A;  3MUR P;  3VF0 B;  3VQS A;  1WOR A;  1VQP S;  1T03 B;  3GMG A;  3CIZ A;  4MKA A;  1HLW A;  1QTM A;  4WTY A;  3QGH A;  2C3Y A;  3OHA A;  3PYF A;  4ZLJ A;  3TUJ C;  3OSP A;  1RTD A;  1HMV A;  2MPU A;  3IRX A;  2FLP A;  2RML A;  4DN9 A;  2CDQ A;  3D2W A;  4J9P A;  1HL6 A;  1KN6 A;  4DS4 A;  3KMS A;  4C0H A;  1AUD A;  4J9N A;  1IBK J;  3FKB A;  4OZL A;  4NYZ A;  3HT3 A;  2ZZT A;  3ET6 B;  2A2C A;  3PCO B;  7FD1 A;  2Z8Q A;  3PX0 A;  3MR2 A;  3N6M A;  2W24 A;  1GX5 A;  1JWW A;  2RT3 A;  3KFW X;  4AXI A;  3MUT P;  2J8A A;  2XZT B;  4EI2 A;  5DS7 A;  3I0R B;  1FES A;  5E3C A;  2QA2 A;  2XG8 A;  2ZD1 B;  2CQ4 A;  4USV A;  3TUI C;  2KG0 A;  4JP8 A;  3RW7 A;  1B99 A;  3F0N A;  3NNA A;  1IN0 A;  4E8U A;  3R97 A;  1KTV A;  3D54 A;  6AT1 B;  3FEZ A;  3DLJ A;  1RLD A;  5GAE I;  1S10 A;  2GIQ A;  3LPY A;  1N6Q A;  2RSQ A;  2J76 E;  2QSW A;  1SH0 A;  1XC9 A;  2KDO A;  4KC5 A;  5DLG A;  3TR5 A;  4NCA A;  2KTQ A;  4Y34 A;  5IT4 A;  4JV0 A;  1W2B R;  2QFJ A;  2VG6 B;  1PG5 B;  2PT0 A;  4N77 A;  4DR2 F;  3D1H A;  1IQT A;  2C2K B;  3MM8 A;  1HQU B;  4R0J A;  4Z7Y A;  4WII A;  3PY8 A;  2BM1 A;  2H48 B;  1X9M A;  3W2V A;  3Q83 A;  3KLG A;  1BC6 A;  1KQK A;  5HLF B;  2YQ0 A;  2LVW A;  1BXN A;  2HFU A;  3FEX B;  1DZ5 A;  2GHV C;  1FEH A;  2FUG 9;  3LP1 B;  2JX2 A;  4ELV A;  1OY6 A;  4A47 A;  5CH7 B;  2A10 A;  4MKB A;  4B3S J;  1DQA A;  2UVW A;  4M5K A;  4USW A;  2NUH A;  4K2X A;  1J27 A;  4DV2 F;  2PSZ A;  1X4C A;  2ASY A;  4F4W A;  5KFP A;  1FK9 A;  1PSD A;  3GJQ B;  2I5J A;  2BE9 B;  5BYQ A;  5B0C A;  2VU5 A;  1R8A A;  2ASJ A;  4K4Y A;  4JI8 F;  4C3L A;  2HZV A;  2E5I A;  8ATC B;  1AB8 A;  1Q1K A;  4NLU A;  3JSM A;  1OMS A;  4FNH A;  2VFS A;  3K5L A;  2H3E B;  1K8A T;  2JFD A;  4UQG A;  3KJF B;  1ZS6 A;  2HBZ B;  1U1N A;  3OXF A;  2LXI A;  4P10 A;  3NNC A;  5A76 A;  1ZA1 B;  1FVS A;  1NM2 A;  2P5V A;  1U1O A;  4X2B A;  2YWE A;  3IWL A;  2ZVI A;  1CPZ A;  2JOQ A;  1N36 J;  2BR0 A;  4JV1 A;  5D15 A;  1IKY A;  1ZZF A;  4ZS6 A;  1TKZ B;  2CQ3 A;  3T1H F;  1UJ6 A;  1LW2 A;  3DDK A;  2AYB A;  1JQG A;  2MTL A;  4EO8 A;  4KH0 B;  2JVO A;  1F5A A;  1T94 A;  3DNC A;  2L9N A;  3N6L A;  2Y1J A;  4AD6 A;  2ZDO A;  2LXU A;  1YGY A;  1C0U A;  3B4M A;  1HNX J;  2YWG A;  1PBU A;  2HVD A;  1CQN A;  1LWF A;  1NDC A;  5KG3 A;  5D4L A;  2J9D E;  2DR8 A;  1TL7 A;  4EBC A;  1WKK A;  4WP8 A;  2VON A;  1RXO B;  1DRZ A;  3ISN D;  1FNM A;  1UWB A;  3EGZ A;  2B6A A;  3AD9 C;  2EBG A;  2C2R A;  1HWK A;  3BZQ A;  4ZP7 A;  2DCL A;  3HSD A;  2HUR A;  1RTD B;  1HMV B;  2VKZ G;  2B3T B;  2FTR A;  2J0X A;  4DSL A;  1CJV A;  3MEE B;  3W5Z A;  4DR4 F;  2FZK B;  2DNK A;  1H0H B;  3R8Y A;  1RAF B;  2HRY A;  3K5P A;  2HMI B;  2Y1I A;  2VV5 A;  3O1L A;  2NXN A;  3OVB A;  1TMM A;  5HO4 A;  2M52 A;  2WBR A;  5A8W B;  3KG4 A;  4FS2 A;  1U4B A;  2Z0G A;  3D1Q A;  2LEC A;  3W9J A;  4N56 A;  4R5P A;  4QPX A;  5GAD U;  3RAQ A;  4KFB B;  5EWF A;  1S6P B;  1VBZ A;  1KDN A;  4JI2 J;  1H2V Z;  2CQD A;  5K8O A;  1FWL A;  1HAR A;  4Q5V A;  2NUU G;  3IA0 A;  2JLE A;  4X62 F;  3DMJ B;  1H72 C;  4PQU B;  5KFE A;  3Q22 A;  2C2E A;  3R5B A;  3ULH A;  2HLU A;  1VFJ A;  3R7S B;  4WP3 A;  7FDR A;  3HJV A;  1BD6 A;  5ADZ A;  4LBI A;  1YJ7 A;  3R5G A;  4OX9 F;  3EDQ B;  2R9L A;  2FC8 A;  3LWM A;  4LF4 F;  2OEM A;  4F3Q A;  1YHQ S;  2XM3 A;  3CJ8 A;  1SL2 A;  3MEG A;  1JJ2 R;  2XSF A;  1S1T B;  4ZVS B;  4NLR A;  5A2Q U;  5CD4 A;  1BGX T;  3HHD A;  3CCU S;  2V8V A;  4LR7 A;  6FD1 A;  2B0G A;  5L39 A;  2KI2 A;  2HRT A;  4BWJ A;  2CPY A;  3QJJ A;  3R27 A;  3LP0 A;  3CD5 A;  4ETZ A;  4CDI A;  4U7U K;  2E1P A;  2FD2 A;  3I0S A;  2RUG A;  1PC4 A;  4ZJQ A;  2VA2 A;  1SCJ B;  1UA1 A;  1UKU A;  4JI0 J;  3W61 A;  2ZH6 A;  1LWX A;  2D7S A;  5KAK A;  2ZH8 A;  5K14 A;  1RT2 B;  2GQC A;  1VLO A;  1N5Y A;  4LRD A;  4ECU A;  3D6H B;  2ZOF A;  4NLV A;  1JLC B;  3R6G B;  2I6W A;  5KT7 A;  1EAR A;  4YB1 P;  1RSC A;  5KG4 A;  3CCL S;  5AXM A;  4PRF A;  3M7V A;  1S1U A;  4DSJ A;  4ID8 A;  5AXN A;  3KLE A;  1Z2Z A;  4ED3 A;  3C16 A;  1GMW A;  1YBT A;  4K59 A;  1VBY A;  4CYU B;  2RD5 C;  4DHV A;  2OTL S;  3GV7 B;  1FKP B;  1KQS R;  2L48 A;  4L6V 3;  1W26 A;  5B0D A;  4YHH J;  5IQ6 A;  2W7P A;  4AL6 A;  4NA1 A;  1RTJ B;  1TK8 A;  1U1M A;  1Y11 A;  3QBC A;  2QLX A;  4P7V A;  2AJQ A;  4WFB Q;  5D77 A;  1LW2 B;  4X66 J;  3H2V E;  3I32 A;  3RGI A;  1IBL F;  3K17 A;  3IS9 A;  5CAB A;  1RIS A;  2BKP A;  3KDO A;  2HHX A;  2KH9 A;  2GIR A;  4OLO A;  4OHW A;  4O3N A;  4ANE A;  2DB1 A;  3PAC A;  4I6Y A;  3ZC4 A;  4ES2 A;  2H51 B;  4A46 A;  1FKO B;  2X1B A;  5A8R B;  4QYR A;  3ZZO A;  1N33 F;  4U8V A;  2VL1 A;  3SSS A;  3UNG C;  3OTO F;  2JEG A;  3OJS A;  1T95 A;  3HHL D;  2VG5 B;  4WU2 A;  4UUX A;  2B8P A;  1NJI T;  3CTR A;  2FB0 A;  3PO5 A;  3FZ2 A;  2DNH A;  3SIP B;  1FTC A;  1QSS A;  1F3V A;  4OZJ A;  3M30 A;  4LSL B;  1JLA A;  5EHH A;  2XMA A;  3FK4 A;  4ZA1 A;  5H9E K;  2G0C A;  1QY7 A;  2FHO B;  4O44 A;  5L1K A;  1HI0 P;  1CC8 A;  4YB5 A;  5DG8 A;  1AA1 B;  4RW7 A;  1UET A;  3M6U A;  1D1U A;  3A8I A;  5E41 A;  2A6O A;  1NB2 A;  4M5G A;  5CQG A;  1Q81 T;  4DV5 F;  4ILL A;  2YH1 A;  1K44 A;  2ZJP Q;  2VPY B;  4RW9 B;  3Q8R B;  2M8D B;  1ELO A;  4DJB A;  3G4S S;  3NGK A;  4IDK A;  5B08 A;  3LGM A;  3FFI A;  3QNW B;  4I4B A;  1Q8L A;  5HP1 B;  1XR7 A;  1LFP A;  1SC3 B;  2XMK A;  2BQ3 A;  3IAS 9;  4DV1 F;  1RU1 A;  3CGI A;  2DIU A;  2HND B;  1RE1 B;  1WG1 A;  4NEY A;  1NPP A;  3D6T B;  4ZVE A;  1HHQ A;  3AQO A;  5F8L A;  3SCK E;  5FDL A;  1H73 A;  2CIM A;  4QPT A;  3MMB A;  2R7O A;  2XS5 A;  2F7V A;  3JTO A;  4ENO A;  3N5F A;  3KLF A;  2R7X A;  2IYI A;  3PKY A;  2F4V J;  3AAW B;  2ACM A;  4IFV B;  3KLI A;  3PYD A;  1Q4R A;  3ZNU A;  1XK8 A;  2I2Y A;  1IKW A;  4KE5 A;  4PXE A;  3EVO A;  2Y0S D;  2KZZ A;  3THT A;  1UP1 A;  4DEZ A;  1R27 B;  2BBE A;  4TKT A;  3ZXW A;  1JK9 B;  4ALZ A;  3KLV A;  1FWK A;  5JVG Q;  3TYT A;  2MKH A;  1VHF A;  3OTE A;  2P6S A;  3NS5 A;  3ZZP A;  4MJK A;  5CYM A;  3OLB A;  4C8L A;  2OFG X;  2JHE A;  2JNJ A;  1P9Y A;  4J9Q A;  3DKD A;  4PG5 A;  2OEL A;  3UN3 A;  3DOM A;  4QOT A;  4DV0 J;  2ACY A;  5C24 A;  4AYB D;  5DQG A;  2HAF A;  2ASL A;  2IVY A;  3RBX A;  2IMW P;  2XGP A;  1NK0 A;  3FMB A;  4DV4 F;  3ZTS A;  2V4J A;  4YOE A;  3ILJ A;  2CQG A;  5E3P A;  3CJS A;  2GX8 A;  4ZPB A;  2FIU A;  4HH1 A;  2QEX S;  3KDN A;  4L72 B;  4Q44 A;  4DR2 J;  1NDK A;  1S1U B;  4QZV B;  2V2Z A;  3PRV A;  4LF7 F;  2VDI A;  4XK8 C;  1RA6 A;  4LQ3 A;  1ITP A;  3LPE A;  1EB0 A;  3W1Y C;  2YNG B;  4LF6 F;  2ZJQ Q;  1KWM A;  1S6U A;  2B8Q A;  2K1R A;  1R6V A;  2VB6 A;  3AJD A;  3V81 A;  5G0R A;  1EZZ B;  5MLC V;  4ZIT A;  1R8B A;  5KFS A;  3VAL A;  1HHT P;  3DM2 B;  2ZC3 A;  3P4U B;  3NBP B;  3BR9 A;  1AZS B;  4DQS A;  3M32 B;  2PDA A;  2OPQ B;  2DGU A;  5BXI A;  3FEY B;  1U1R A;  4AL7 A;  2MHE A;  2RDJ A;  4ED2 A;  3QIP A;  5E3Q A;  3J7Z T;  1IKX B;  4YQW A;  4RBV A;  3GON A;  2R8G A;  3OL8 A;  1KKH A;  4FKX A;  4Q43 A;  2IC3 A;  3C3L A;  4X4T A;  4RR5 A;  5IZH A;  1A9N B;  2FJV A;  3KMQ A;  4EZ6 A;  5EWG A;  2W9A A;  3BN4 A;  1RT7 A;  3C15 A;  3M8P B;  1MWY A;  3EE3 A;  1TUG B;  1HD1 A;  4MH8 A;  2AJF E;  1R0A A;  2PI4 A;  4JOU A;  4WU3 A;  1TK5 A;  1W7W A;  2EI5 A;  3NXZ A;  3MXH P;  4ED1 A;  1S79 A;  1TAQ A;  1S97 A;  1V5I B;  4ZP6 A;  2RKI B;  5IM0 B;  2IYG A;  3KHL A;  2V4R A;  3D6F B;  4KV8 A;  4ED4 A;  4ZPT R;  4F50 A;  1BMQ B;  3T1H J;  1AXQ A;  4ELU A;  3S1T A;  1EIY B;  3EWG A;  3NG8 A;  2VPW B;  5FJ4 A;  4ZCL A;  3ITH B;  1EET B;  5B0F A;  3P49 B;  3KWM A;  2JEJ A;  2YQ3 A;  1F2H A;  5GAH I;  3M2U B;  2XO6 A;  1IM6 A;  3DLE B;  4C0O C;  3IRW P;  4WCE Q;  2KHD A;  2L08 A;  1VQS A;  1VQK S;  3L7P A;  4DSE A;  1PJ6 A;  5F0U A;  1WJ9 A;  3CJR A;  2NR0 A;  1BHN A;  2HRU A;  3HFV A;  4K4V A;  3DRR A;  4JYA F;  2RHS B;  1LK5 A;  1KFD A;  1YI2 S;  4ZLP A;  4OJ1 A;  1UJ4 A;  2MKK A;  4NXM F;  3T41 A;  2VOO A;  3KK2 B;  1YQH A;  1QJH A;  3O3L A;  3PFO A;  2GMJ A;  4PWD B;  3QZ7 A;  1KNZ A;  3LQV A;  1S4F A;  1VLY A;  1X0P A;  3T9Z A;  1OSC A;  4PG8 A;  4FPI A;  4CO0 A;  3WC2 A;  2IPO B;  1U48 A;  3TJA A;  2AJ4 A;  3IR7 B;  2YWH A;  1URR A;  5D4O A;  2NRE A;  4F7V A;  1PO6 A;  3BSC A;  3DLL Q;  4CNY A;  4BHQ A;  2BAN B;  1P9Q C;  3W64 A;  3R2D J;  2O66 A;  5LL6 d;  4OYM A;  4CT8 A;  4WJB A;  3C6T A;  5A6P A;  1IJE B;  1UTA A;  2E5J A;  3FSY A;  4AQY F;  1L3K A;  3SQG B;  4K7Q A;  3KYL A;  4DS5 A;  1FD2 A;  1MU2 B;  3MCN A;  2CQH A;  2HBR B;  1KFS A;  2E7X A;  3QAU A;  1TK0 A;  5DDR C;  5KFD A;  1DUR A;  2JDJ A;  2R8J A;  4X62 J;  3FBB A;  4C2M A;  4KPY A;  2MKS A;  2V4J B;  1N34 F;  1JXE A;  3LA0 A;  2Z30 B;  3FGV A;  4Q7A A;  4WFN Q;  1DTT A;  3O44 A;  3AH6 A;  3V5R A;  4HL9 A;  1K0V A;  5C42 B;  5CZX A;  1KQF B;  2ZFH A;  1ZAX A;  4F26 A;  2E9T A;  2VIH A;  3UO0 A;  2F63 A;  1RTI A;  3I9V 9;  3CCS S;  2DIS A;  2Z56 B;  1T7P A;  3FUY A;  5L9N A;  2GJI A;  2HHW A;  3MM5 B;  2YKN A;  4BLG A;  1YZ7 A;  3QID A;  2MKC A;  5HL7 Q;  2EBE A;  2XQC A;  5A0Y A;  5BJR A;  3NCR A;  2Y0B B;  3DFE A;  4E0D A;  3DGV A;  3D28 A;  4OYX A;  4OJH A;  5EX3 A;  4TU8 A;  2WZ1 A;  1B64 A;  4ED7 A;  1V3S A;  2MLX A;  2B9W A;  1YIT S;  2C2N A;  1Y0H A;  3L95 X;  3MUM P;  3GYX B;  3H42 A;  1NHU A;  1UWA A;  1V3R A;  1M90 T;  3LO3 A;  3HVR A;  2IAJ A;  1YLX A;  3OD2 A;  3MPV A;  4HH0 A;  1ZM4 A;  1RGV A;  4HTJ A;  1M5O C;  4ZPA A;  1KHV A;  4KH1 B;  3DRS B;  3MAQ A;  1JLE A;  3OT9 A;  2FY8 A;  3RYL A;  1H3D A;  3AOD A;  5LSR A;  2OML A;  4N5S A;  3Q2T C;  5J2P A;  1ZTT A;  4L74 A;  2R4F A;  4FVM A;  1VJQ A;  3CD7 A;  5KG0 A;  2MQO A;  2DH9 A;  2DR5 A;  2KJV A;  1RCO B;  3O6Q A;  4IG3 B;  2DGT A;  2J6S A;  3SSQ A;  2HQG A;  2G2Y A;  5F9L A;  4I0W A;  3DLK A;  3A8K A;  1JKH A;  5HVH A;  3EPI A;  2ZWP A;  4LF8 F;  4XPE A;  1QM9 A;  1SKU B;  3QO9 A;  4V19 J;  1DY3 A;  5HRO B;  3CVK A;  5L1J A;  1OO0 B;  5CYQ A;  2E1A A;  1WKJ A;  4H4M A;  2VC1 A;  4IRK A;  4G1Q B;  4P2F A;  2P9G A;  2QLJ B;  1I94 F;  3FJ2 A;  4RKU C;  3MMC B;  5KT6 A;  4NRT A;  1N88 A;  1OYD A;  2R7U A;  4LT6 A;  1N33 J;  3BPD A;  5HMW A;  3W8P A;  5DZ7 A;  1TUW A;  3SV4 A;  3C66 A;  4JI4 F;  3OTO J;  2CKW A;  2D1C A;  2K06 A;  3HVA A;  2OSR A;  3BQ0 A;  1R3N A;  3HZG A;  3N01 A;  2OPR B;  3OTC A;  2DNG A;  2E9R X;  1HD0 A;  2UUA F;  3H5U A;  3K8V A;  3D6M B;  2XCA A;  3DGP B;  4FBU A;  3KK1 A;  1VGY A;  2CQ2 A;  2IBO A;  1N5T A;  2RJZ A;  3K5N A;  3R7B B;  4EZ9 A;  1X4D A;  1S48 A;  2P2C B;  4DV5 J;  2WVB A;  2OD4 A;  1CVJ A;  2D74 B;  4Q0B B;  2YTC A;  3BR8 A;  1T9U A;  1VQL S;  1DJ0 A;  2ZKT A;  1VRQ C;  4KGM A;  3U1L A;  5KFY A;  1NJY A;  1S57 A;  3MM9 A;  1RAA B;  3MR3 A;  4GVB B;  4MKY A;  1T9Y A;  4G65 A;  4URQ U;  2ZBQ A;  2ZH1 A;  4GC6 A;  3OLA A;  4DV1 J;  2JVR A;  3D0G E;  3B8H A;  3D67 A;  4J5O A;  2QLW A;  2W2Q P;  3K5M A;  1NPR A;  4LRC A;  3WX8 A;  3GIL A;  3MM7 A;  4K4T A;  1WSV A;  3KHG A;  2CNN B;  1HHS A;  2H4Y B;  2RUS A;  3HZE A;  4PKD B;  2UUC J;  3J7A 1;  1T9V A;  1KP6 A;  3BYR A;  1UEU A;  2R7T A;  4PR6 A;  2EG2 A;  4B9N A;  2KRR A;  2DNM A;  4Y2I A;  3GJT B;  1RT3 A;  3W2W A;  2MSS A;  4EUV A;  2NXE A;  2DIT A;  2NSB A;  4OIX A;  1N32 F;  5HQ8 A;  5L1I A;  1IJF B;  1FJE B;  2KVI A;  1HNW F;  2ROG A;  3RTV A;  2AKW B;  3SQO P;  4ES3 A;  1GXL A;  3OV7 A;  1UA0 A;  3CSK A;  4UUW A;  4F25 A;  2LQ8 A;  4F4X A;  2D3U A;  1HPZ B;  2WTF A;  3IC1 A;  4KKO B;  4OHZ A;  2BZ2 A;  1D8Z A;  2Y1L B;  4ID5 A;  2CYY A;  4FF2 A;  1RTH B;  2OJ3 A;  2RU9 A;  1SL0 A;  1NHV A;  2RU3 A;  3BGL A;  2LQB A;  1CJT A;  2VG7 A;  1EP4 A;  5LMN F;  2E66 A;  2DNZ A;  1T3O A;  3QLH B;  2E7V A;  5L46 A;  2JWN A;  1VC0 A;  3MCO A;  1PJ5 A;  4I68 A;  3HXM A;  1U45 A;  4NCB A;  1JLF A;  1LQ9 A;  1S72 S;  4IR9 A;  2OO4 A;  2YH0 A;  5AXL A;  3V6J A;  4FXD A;  3NMR A;  3G96 A;  1BQM A;  2JC0 A;  3T1A A;  5J2M B;  4LF7 J;  2DXE A;  3A12 A;  5A8K B;  2Y9H A;  4LF6 J;  3SYZ A;  2PD1 A;  2HQI A;  1FFG B;  2DGV A;  3VR1 A;  1B3T A;  3M8Q B;  3KK3 B;  3IBW A;  4K4X A;  5B0E A;  2HIY A;  3JTN A;  2FJA B;  2BE2 A;  4R25 A;  3EVM A;  3C14 B;  1U02 A;  1GQE A;  1B0T A;  1CJK B;  2DEI A;  1N5V A;  5CHC B;  3FCW A;  5DRK A;  2ZH3 A;  1QUP A;  5DQH A;  3X3U A;  1WF1 A;  3KLH A;  2IMO A;  3I96 A;  3QO9 B;  4KO0 B;  1RHR B;  5DGA A;  2VAS A;  4B9V A;  4OI3 A;  5C7P A;  2CJB A;  3JXO A;  5CYQ B;  3M8R A;  1AW0 A;  3EIC A;  2V2V A;  3NNH A;  4ECX A;  4QCL A;  2V50 A;  4FS1 A;  3N6N A;  2BRL A;  3UDL A;  4F04 B;  3S6E A;  4DX7 A;  1RAH B;  1T9W A;  3OBI A;  3AXM A;  3M2R B;  1SH2 A;  3NWR A;  1WDD A;  1HQ2 A;  2ZC4 A;  4M5M A;  2W25 A;  2L41 A;  4XDC A;  1FHT A;  2DPI A;  2LA6 A;  3MI7 X;  1IWA A;  1CEZ A;  2Q79 A;  1WC3 A;  3OL9 A;  2V2Q A;  4WK1 A;  1D9F A;  2KU7 A;  4PXB A;  1C0T A;  5KTQ A;  2ALY B;  2OMO A;  2C22 A;  1V3Z A;  4ZPC A;  2MZR A;  2GQ2 A;  4CLF A;  2OPP B;  4LSN B;  2DD8 S;  4KHP F;  5DLF A;  2EFV A;  3G6Y A;  1SJR A;  2QA4 S;  5KT3 A;  2NLW A;  4JI1 J;  1G6B A;  3MR7 A;  2W2M P;  3GYN A;  9ATC B;  4F2S A;  1M5V C;  2XY7 A;  2PEH A;  2X1A A;  4FYX B;  4OYO A;  4X64 F;  3QJL A;  4TQS A;  4KB7 A;  2JEF A;  2I8E A;  3BM7 A;  3G6V A;  2MLZ A;  2PN6 A;  1HI8 A;  4LBH A;  4CIO A;  3UWT A;  4ZVO B;  3PNI A;  4JYA J;  3H20 A;  1X5O A;  3EXY A;  4M5D A;  1SJ3 P;  3BYP A;  4NXM J;  4OYA A;  2E7W A;  3KUG A;  1LWE A;  2GVD B;  4NRU A;  3BH6 B;  3W7B A;  1ZTW A;  4FPR A;  2AT1 B;  2M88 A;  2XWX A;  4IOC Q;  1SI9 A;  4C3K A;  4FNI A;  2V6A A;  1GFW B;  1RT3 B;  1SV5 A;  2E1R A;  1HWU A;  3W2W B;  2YKM A;  4OI4 A;  5DG7 A;  2M9K A;  1YKW A;  4C98 A;  1Q82 T;  5D8H B;  1DAX A;  4PPZ A;  4B02 A;  1ZM9 A;  1KBR A;  2EFQ A;  3K2Y A;  4Y2K A;  4N41 A;  2OEK A;  2X1G A;  3GR1 A;  3OL7 A;  2C1E B;  5KFO A;  1YRX A;  3MPY A;  4DFJ A;  2KL8 A;  2AZ3 A;  3HHL A;  3IGV A;  4S0M A;  5KFV A;  2G4B A;  1NLK L;  1WAC A;  3MM6 B;  3ILI A;  2V0N A;  3L7U A;  4DV3 J;  1XJW B;  3BPS P;  2VIC A;  2UU9 F;  2RQC A;  1FFS B;  1WOP A;  4TY8 B;  3UN5 A;  2IVF B;  4G3I A;  1CJT B;  2VG7 B;  2RAQ A;  2K3I A;  3P5T L;  4O4G B;  1SC4 B;  4NZ6 A;  2CUY A;  2SXL A;  5IOL A;  4I64 A;  3THP A;  4RNF A;  4CP5 A;  5KFB A;  1KOH A;  2XZW A;  1WHX A;  2EFN A;  4EBD A;  1HKA A;  4PG4 A;  3VVT A;  2DT9 A;  4A8X A;  5B09 A;  3PFE A;  2OPS B;  3BB5 A;  4NXN J;  1XMO F;  2CQB A;  1G4C A;  4I2Q A;  4NEZ A;  5J1E A;  3QT7 A;  2K7K A;  3G82 B;  2KZM A;  4DG1 B;  3DRP B;  3D3C J;  5JUM A;  4IO9 Q;  2F8H A;  1OQ3 A;  2FJE B;  4ZJO A;  3RBE A;  3PW4 A;  1X7V A;  4EO6 A;  3C6U B;  2FC9 A;  4I6W A;  1TTH B;  1RT6 B;  2ADB A;  4KT0 C;  4I7F B;  3K0J A;  1PIL A;  3RJM B;  4DWI A;  3THV A;  3T5K A;  2BJ1 A;  1RT5 B;  3GTY X;  4ZVT B;  4J9V A;  3BKT A;  2GGP B;  1VRU A;  2E5L F;  2C2D A;  2L9D A;  5IWA F;  2KFN A;  3M9N B;  4FN5 A;  4OZ0 A;  3W63 A;  1XNR F;  1UZD A;  5DZ6 A;  3AFG A;  4QWC A;  4ANC A;  1RT4 A;  4ICL A;  2CG4 A;  1S1W A;  4NLT A;  1LEO A;  3TAM A;  4YP3 A;  4H54 A;  2CZV C;  1RHU B;  2AX0 A;  2N3L A;  3NGT A;  3MR5 A;  4IR1 A;  1X4E A;  1KLN A;  1TL1 A;  1SKR A;  3ZZZ A;  4U95 A;  4L76 A;  3TUP A;  1VJW A;  1VOM A;  4G6V B;  1LNQ A;  1E6V B;  2MKY A;  1VBX A;  4LVO P;  2LFV A;  1H38 A;  2XSJ B;  1PCA A;  3DU5 A;  3KKF A;  1HW9 A;  1OWX A;  4A8O A;  5JVH Q;  1IM4 A;  3RRK A;  4RW4 A;  2KXF A;  1R43 A;  3DLB A;  4RU2 A;  2EFP A;  4ECQ A;  1EX8 A;  2UXC F;  1X0F A;  4LQ9 A;  3W65 A;  1PC5 A;  3UDV A;  5HAN A;  4W98 A;  4IRC A;  5H1S V;  5F3Z A;  4EEY A;  4LF8 J;  2BV3 A;  3F73 A;  1KON A;  1S1V A;  1X5T A;  1S99 A;  3VZH A;  1VQM S;  4CT9 A;  1CJU B;  3NMA A;  4O3Q A;  5E7O B;  2BJ9 A;  1YSJ A;  3IR6 B;  2E1M C;  4CTA B;  5D6G A;  4F0M A;  2EG1 A;  1H98 A;  3CCM S;  3CCW A;  5G4D A;  1I94 J;  1FRH A;  3Q86 A;  4HLB A;  2R8K A;  2N7C A;  4ILM A;  5F8H A;  1RHK B;  5LMU F;  2MZT A;  1DLO A;  2NYI A;  4JI4 J;  4M5D B;  4UY8 5;  2Z58 B;  1ZM2 A;  2EXU A;  2WBM A;  2RIL A;  4RX6 A;  4F36 A;  3QRP A;  2JRS A;  4TU9 A;  4LF9 J;  3M2V A;  3ENQ A;  2CRL A;  2ZE2 A;  2BJ7 A;  4USK A;  1C2P A;  2XMV A;  3O2I A;  4LRB A;  4YDD B;  1FX2 A;  3RAM A;  3UCZ P;  3JQJ A;  2UUA J;  1Q16 B;  4BC7 A;  1WUU A;  2KFY A;  2IJF A;  5LJ5 Y;  3CT9 A;  2RVJ A;  2UP1 A;  4MFB B;  5T7L A;  1WEY A;  3TA1 A;  4YB7 A;  3CCR S;  3JYT B;  1JJH A;  1N54 B;  1YJV A;  2NYH A;  3B82 A;  3CCJ S;  2Z4P A;  1SC1 B;  2ABY A;  1HBM A;  2APO A;  1S9G A;  3GP9 A;  5B0A A;  1JLQ A;  2BDP A;  2W8K A;  3FSX A;  4B3R J;  1RWN B;  5I42 A;  1KQG B;  1LWC A;  3TVY A;  2RIJ A;  2KT2 A;  4Y2A A;  4F0K A;  1HA1 A;  2BKN A;  4FP9 A;  1V9O A;  3NS7 B;  4QJV A;  2HBY B;  1SIZ A;  4CM2 A;  3O8W A;  4NLP A;  4OJG A;  2HVE A;  5HJY A;  3CJK A;  3WIU A;  4PEO A;  2F9J A;  2CDR B;  4B3O B;  4L75 A;  3US5 A;  2CA9 A;  1TL3 A;  1TKX A;  2LU2 A;  5A6W A;  5J1E B;  2E1C A;  1N32 J;  4I2P A;  2AYG A;  4HVZ A;  4QU7 A;  2CPF A;  3HVT A;  4MKV A;  4DUT A;  3NL0 A;  2JH3 A;  3PEH A;  2HQD A;  7AT1 B;  4DOZ A;  4BWM A;  3KNG A;  3HKW A;  2RRB A;  3WIV A;  5KT2 A;  4CLW A;  1A6L A;  3MAA B;  1JLB A;  4OYZ A;  2XMM A;  3VTI A;  1MML A;  3MEC B;  2LYV A;  1M1K T;  2H65 B;  4WFA Q;  2XWY A;  2R7V A;  4H4O B;  1RYR A;  1QAI A;  5LMN J;  1WG5 A;  2LCW A;  4QWA A;  2QT7 A;  3VAM A;  3BO4 A;  5B0B A;  2C2Z B;  3HHL C;  3T5J A;  3RG6 A;  2FHJ D;  5HBM A;  5LT5 A;  3KJN B;  1HNV A;  2ILZ A;  1KVJ A;  3L7O A;  3VAH A;  4F2R A;  3RRH A;  3HMJ G;  5KFN A;  4HAC A;  1YBA A;  3BSN A;  2EK6 A;  3SDE B;  3OFH A;  3PIP Q;  1ZPW X;  4HT7 A;  4J9U E;  2VF3 A;  2WOM A;  5F3T A;  4AXJ A;  1HNI A;  4NCG A;  1RK8 A;  3ZZU A;  2J6T A;  4IOB A;  1TKD A;  1NKE A;  1BUX A;  4EU0 A;  2MKJ A;  2MMY A;  4Y0F A;  3OTD A;  1TVR B;  1RKJ A;  2IRX A;  4WBF A;  4MTP A;  4I56 A;  3ILO A;  3QFW A;  4WTO B;  3HT0 A;  1Y5I B;  2MY8 A;  2QA1 A;  3DOK A;  1PGZ A;  2DY1 A;  5L1L A;  1MN9 A;  3SFG A;  3KHR A;  3CO9 A;  3DN9 A;  4LBP A;  1FDB A;  3GQC A;  2BUN A;  3AJ1 A;  4HKQ A;  2ZKU A;  3FSI A;  3E01 A;  1U1P A;  3G71 S;  2MJU A;  1Y10 A;  2QGF B;  2BMB A;  2ZDP A;  2GMH A;  2YNF B;  3POT A;  4P7T A;  3GSD A;  4CWB A;  1WTF A;  5GME A;  2J9E A;  1XN9 A;  2RS8 A;  4DSI A;  4M5J A;  1IKV A;  4ZVR B;  5E5N A;  3RB4 A;  1D9A A;  3K57 A;  2JLG A;  2X3G A;  2VH7 A;  3RB6 A;  3JQM A;  4J7C A;  1RAE B;  3PX4 A;  1HBN B;  3R1L A;  4OYP A;  1G1X A;  2GA7 A;  2R42 A;  3DOL A;  1NU4 A;  2UZA A;  3TJ9 A;  1B70 B;  3A3O B;  4P73 A;  1YG0 A;  4ELT A;  4KHP J;  3CC7 S;  5HMZ A;  2YX4 A;  4K4S A;  4DDF A;  1FJG J;  4W90 B;  4EK2 A;  4B08 A;  4IH5 A;  2GHP A;  5KFI A;  4X64 J;  4DQI A;  4YB6 A;  2RH3 A;  3MOJ B;  3OQ2 A;  1FRK A;  2FJW A;  2VDH A;  4NWB A;  1SUQ A;  1XMQ F;  1U24 A;  1HBU B;  3RZA A;  1HWL A;  4Z37 A;  3BN7 A;  3HHN B;  3PHT A;  1YRU A;  2CNL B;  4KHM A;  1C1C B;  3IMQ J;  3FQL A;  1CUL A;  3MPW A;  3TEG A;  2KT3 A;  2BJE A;  1Q5Y A;  4C0B A;  2QL5 B;  3GG0 A;  3OUY A;  2F5G A;  4PYA A;  2ZM6 J;  1U1L A;  2AYE A;  1F1B B;  1JMT A;  3OXG A;  3DHX A;  1T9X A;  2WVE A;  4QYZ J;  2ZEJ A;  2UVV A;  1WC1 A;  2DR9 A;  1LOU A;  2YNI A;  2A1B A;  1KLM A;  2O3D A;  1S9E B;  3MEK A;  1L5U A;  4K5S A;  3TOQ A;  3QAT A;  2D9P A;  3IO1 A;  1J5E J;  2IA6 A;  4B3M F;  4WXO A;  1TV6 A;  1MNE A;  2B4U A;  2YNH B;  3WDO A;  3KJV A;  4YEA A;  4DR5 F;  2WHO A;  3TX8 A;  3A13 A;  4DQR A;  3IG1 A;  1RHM B;  2UVR A;  2HW3 A;  3ZO7 A;  2UU9 J;  1H2T Z;  4WFZ A;  1LK7 A;  2W9B B;  1FI4 A;  1F5C A;  2ZH9 A;  3BBB A;  2Z2Y B;  3EPG A;  4NZ0 A;  1BQN B;  4EYI B;  2AQ4 A;  4R8U A;  4OL8 A;  5AE1 A;  2MGZ A;  5HSP A;  4EGL A;  4OYW A;  3OSN A;  3K7R A;  1RJJ A;  1HNV B;  2U1A A;  2Q6C A;  2B5J A;  5ITH A;  2W01 A;  2FHK A;  1XMO J;  4HI1 A;  3SFU A;  4UOG A;  4HAC B;  2UUB F;  2NS1 B;  2RNE A;  5M2R A;  4IYQ A;  3H4B A;  4M1K A;  1MW7 A;  1SIW B;  1BWV A;  2RE1 A;  1TMJ A;  2DGS A;  4O0I A;  2IM3 A;  3QGG A;  1RWO B;  2WON A;  4M5N A;  4NCG B;  3W9I A;  1HBO A;  4RW8 A;  4MK9 A;  3DI6 A;  4WE1 A;  1NO8 A;  4TLR A;  1QE1 A;  5DO2 A;  3FRZ A;  2FVQ A;  4NI2 B;  2ZWO A;  4TXS A;  1NHK L;  2PMZ D;  1TEL A;  1NJZ A;  4TLQ A;  2CFX A;  4ZP8 A;  1NCL A;  3ENA A;  3CJ2 A;  3FZB A;  3GB0 A;  4OV6 A;  2E5L J;  5KFU A;  5IWA J;  1UFW A;  4UZC A;  4ZMM A;  4UQT A;  1VK8 A;  1XNR J;  1Z4U A;  3LP2 B;  2IBK A;  3MPU B;  2F4V F;  4IG0 B;  3W3S A;  3TQ1 A;  1EKR A;  4K2J A;  2W4C A;  5J2Q B;  4M94 A;  3DLH A;  2A0F B;  3CMA S;  3ELH A;  2HNZ A;  4L73 A;  3BDE A;  3CIM A;  2KRB A;  2XY5 A;  4ECS A;  3QFH A;  4O3S A;  1VQ4 S;  3HUL A;  1DBD A;  1REV A;  1PYT A;  2U2F A;  4NOH A;  3CNQ P;  3NEK A;  1JXV A;  1WOO A;  1ZAW A;  3G2X A;  1SBR A;  4IFY B;  3VVU A;  5IXU A;  2UXC J;  3CO0 P;  2HNY A;  1P1L A;  2M7S A;  4DV0 F;  3ISZ A;  4JV2 A;  2Q66 A;  3RBZ A;  2HAI A;  2J7U A;  1RQ0 A;  3DYA B;  1LW0 B;  4NLD A;  4J9M A;  5K8M A;  3NP5 A;  4JV5 F;  4UOH A;  1H6K X;  4X4S A;  3SCL E;  2B7C B;  1TFY A;  4DV6 J;  2F9D A;  1T05 B;  1ZH5 A;  1Y4Z B;  4P75 A;  3Q8P B;  5LMU J;  4HT5 A;  1WF2 A;  3ZZY A;  5ETQ A;  4ECY A;  1CUL B;  2N4D A;  2RF2 B;  3HSJ A;  2VQF J;  4F8R A;  3TX0 A;  1AFJ A;  5JXS A;  4R0E A;  1U0H A;  3MMA B;  1RWX B;  2ZUG A;  3FVY A;  2AGP A;  1VQY A;  2DNO A;  3D0I E;  4DPU A;  1Y7P A;  4USJ C;  1MMN A;  4G1I A;  2YNI B;  3ADA C;  3N4W A;  1YJ9 S;  1KLM B;  1ICE B;  4ZN3 A;  1A0O B;  3OR2 A;  4LRF A;  1S77 D;  2D69 A;  5F41 A;  2BJ3 A;  1S12 A;  2ALZ A;  2M5Y A;  3D7S B;  3DXB A;  1NZA A;  3MMJ A;  2XMW A;  3PG9 A;  2HHS A;  1XER A;  3R5J B;  3FQK A;  4PG6 A;  3JTP A;  3P8B B;  1KVK A;  2WSE C;  4J9R A;  4ETX A;  3C2P A;  2G0I A;  1G3O A;  3Q24 A;  3TI0 A;  4AE5 A;  3MED B;  4R8U B;  5GAE U;  5EWE A;  1S1X B;  2HFO A;  2P9E A;  2XMJ A;  2W7O A;  3FDS A;  1XNQ F;  3J7Z 5;  3OTB A;  2ZHA A;  2VPZ B;  4ZVG A;  4YY3 J;  1E6Y A;  2DRD A;  2CNO B;  1M5S A;  1HYS A;  1UEV A;  4C48 A;  5IC4 B;  4PAB A;  5GAG I;  2DHG A;  2LEA A;  3GFZ A;  5AJ3 F;  1S6Q A;  2GV1 A;  1FT8 A;  1SJ1 A;  2DXD A;  3J7Y I;  5KG7 A;  4PUO A;  3I5A A;  2CWX A;  4OI6 A;  1FDD A;  4RBT A;  4X4V A;  2HG4 A;  3E3X A;  4CLU A;  1S6O A;  1FO1 A;  1FDN A;  1R0B G;  5EUH A;  3CDU A;  2GML A;  3IRX B;  4A8K A;  2WVF A;  2PE8 A;  3RAX A;  3HDS A;  4F3O A;  3GZ7 A;  1OYE A;  4LF2 A;  1F0X A;  1VIS A;  1FF2 A;  3I5C A;  3S01 A;  2QL9 B;  1RDR A;  4ILR A;  2GHW A;  4P74 A;  1FE0 A;  3LW5 C;  2RQ4 A;  2IRY A;  4KY3 A;  4FYW B;  4E98 A;  2XS7 A;  4WYW A;  1X5S A;  4USM A;  5I3U A;  1REV B;  1O6X A;  5HN0 A;  5U47 A;  4F4A A;  2QSF A;  4O23 A;  2FGO A;  4C97 A;  1Y3K A;  4DR6 J;  4KR0 B;  3PRD A;  4KYZ A;  2RB7 A;  1KRP A;  1DTQ A;  2L3M A;  1J5O A;  3D9B A;  2FVC A;  3FNN A;  2C2M B;  1NUE A;  4PXD A;  1N6Q B;  4RNH A;  2DGX A;  2Z2L A;  3T3F A;  1XQI A;  4QWB A;  2JL9 A;  2DKO B;  3QPI A;  1I1G A;  1RT1 A;  4UW2 A;  2AMC B;  3MM8 B;  4OZ5 A;  3RBD A;  4RWX A;  3EDR B;  3NCP A;  3W2V B;  3KLG B;  3M6W A;  3KJQ B;  4RUC A;  3OFF A;  3UR0 A;  3QRR A;  2IY5 B;  3PYE A;  1O51 A;  2XLJ A;  2GNK A;  4CLP A;  2O67 A;  2RHQ B;  1X4A A;  2GVZ A;  4KPC A;  4RPF A;  2D3O R;  1NRK A;  1Y9O A;  3LGN A;  1TL4 A;  4DQP A;  3AOB A;  1TQL A;  1QAJ A;  2RS2 A;  2VFR A;  1FK9 B;  1R89 A;  2BRK A;  2I5J B;  2WK4 A;  5KG2 A;  3CB4 A;  3G86 A;  2FDN A;  3ICL A;  3FCH A;  4DLE A;  1FRX A;  2NXU A;  2F3J A;  4F67 A;  1FCA A;  1T02 A;  3JSM B;  1RWK B;  4DFM A;  2XLI A;  3QQC D;  4WKY A;  4NLY A;  1U2C A;  2WW8 A;  2V8D A;  1MG7 A;  4ZN1 A;  3AA8 A;  5E33 A;  1VRT A;  4UOC A;  1VQO S;  3TVK A;  1XMQ J;  2ZNZ A;  4HHH A;  1UPP A;  4ZJL A;  4X65 J;  2G13 A;  5GMK a;  4C11 A;  1VCT A;  1WHY A;  5KFH A;  1SQG A;  4ZPD A;  3MWB A;  2H54 B;  4LR8 A;  4DPT A;  3X1L B;  4GKJ J;  1IKY B;  3U27 A;  3VHQ A;  3Q23 A;  1ZM3 A;  4ZVH A;  4HDG A;  1NJX A;  2Q43 A;  4ZKA A;  5LOQ A;  3VV2 B;  1QVF R;  2R2T A;  4OZ3 A;  2YKA A;  4ZVP B;  1RAI B;  1I51 B;  1HYS B;  2Q6B A;  2DR6 A;  5D4P A;  1CSJ A;  1C0U B;  1LWF B;  3N9U C;  4CRJ A;  2KHC A;  4NLO A;  4B3M J;  1TL7 B;  1UWB B;  2ERR A;  3UD3 P;  2QA4 G;  4FF3 A;  2B6A B;  4DR5 J;  2X7I A;  3A1Y G;  5IQQ A;  3OL6 A;  3PZP A;  1GTH A;  5CXT A;  3IAM 9;  4HR2 A;  3CDW A;  4HHU A;  4WXW A;  2BQR A;  1RCX B;  1CJV B;  1ROF A;  3H0P A;  3SBM A;  3IN5 A;  5ETK A;  3DLG A;  3CWJ A;  2XZD B;  1YZ6 A;  4CM0 A;  4RU9 A;  2CPD A;  4U96 A;  4ZVU B;  4DL7 A;  2G2O A;  4OI1 A;  3BBC A;  1D3W A;  3OVS A;  4DUZ F;  4X4P A;  2PFF B;  1MRO A;  1RAG B;  1NH8 A;  4K4Z A;  2UUB J;  2IHR 1;  5ETM A;  4R5P B;  5J2N A;  2DEJ A;  2E44 A;  2R2S A;  3M8S A;  1RWU A;  2IFX A;  1J5O B;  5DET A;  4GKK F;  4MK8 A;  4OMF G;  3MFH A;  1XEZ A;  4RL1 A;  3U7J A;  3C8Y A;  1N5Q A;  2R8H A;  5A2Q Y;  1UCN A;  1TFW A;  2ZZN A;  2B9Y A;  2J0W A;  3L09 A;  2W2P P;  2UUC F;  3SSR A;  3Q8Q B;  3CCQ S;  1ZZN A;  2FQQ B;  3R2C J;  2MB0 B;  4RNO A;  4EBE A;  2R7R A;  3HI9 A;  3HSZ A;  4YS2 A;  1WC5 A;  3MEG B;  1SH3 A;  2QV6 A;  3R5C A;  4L3N A;  5KG1 A;  4CO4 A;  5KFA A;  1V6H A;  4KGV B;  5KFM A;  2I1R A;  5SZT A;  5IT9 Y;  3BSO A;  3ET6 A;  3HX9 A;  1QAX A;  2GVZ B;  3DC2 A;  1SJF A;  1WC6 A;  2BE7 D;  2QL7 B;  4OQJ A;  3LP0 B;  4CLS A;  3I0S B;  4C8N A;  1MLA A;  2JJ4 D;  3I0R A;  1H7X A;  3PVX A;  4I67 A;  4NLG A;  6FDR A;  4DR7 F;  2ZD1 A;  3EMT A;  5K14 B;  4LFA F;  4AUK A;  1FD8 A;  3A8J A;  1WG4 A;  1N5Y B;  4I69 A;  2WVD A;  5D3G A;  5KFC A;  5KFJ A;  2HWI A;  1N0V C;  2B43 A;  2DGQ A;  2AIR B;  2HLT A;  2FHJ A;  1T8E A;  3GWC A;  2MJN A;  3DRY A;  3TWZ A;  3QRQ A;  2V2K A;  4UT4 A;  5F0W A;  4JV5 J;  4WZM A;  4DL2 A;  3BS9 A;  3EJM A;  2VG6 A;  1YJR A;  3MZI A;  5SUH A;  3KLE B;  2HGN A;  3AJ2 A;  3IFE A;  3C16 B;  3CJ4 A;  3EVW A;  1HQU A;  4M63 A;  5CA5 A;  3FRY A;  3EM1 A;  2LEB A;  3PJX A;  2PEB A;  2MQM A;  4JI7 F;  3TAN A;  5HLF A;  1IBM J;  1ZA2 B;  1U2F A;  1GXT A;  4C8Y A;  2ZOG A;  3Q8V A;  3LP1 A;  2DHH A;  3WZ0 A;  4QWE A;  4TYA A;  3NS6 A;  3WHI A;  3QWU A;  4DSK A;  3W66 A;  2Y3Y A;  4CH7 A;  1Q7Y T;  1Q79 A;  3IS9 B;  1WC0 A;  1KS2 A;  1XWL A;  4NML A;  2CXE A;  1VQ7 S;  2RQK A;  1O0P A;  2B51 A;  4ZIW A;  4OX7 A;  3VGU A;  4UF4 A;  2ZHB A;  2D3Z A;  2LKZ A;  2FY1 A;  3GJR B;  1BE4 A;  4ED5 A;  5KFL A;  2CJA A;  2XC9 A;  2W4D A;  2HQF A;  2YWF A;  2EKN A;  2V8P A;  4DPY A;  3NRB A;  4IQX A;  1GMU A;  2MZQ A;  2YPZ A;  2VA3 A;  4FYV B;  3M6X A;  1L3U A;  2A3J A;  1WHW A;  1ZBT A;  2J9D A;  1NAQ A;  1NK4 A;  3N0V A;  3WQP A;  3M30 B;  5ETN A;  2GW8 A;  1PJ7 A;  4CLK A;  3HFK A;  1JLA B;  3U1M A;  1O5J A;  3PM9 A;  2A6M A;  1ZYQ A;  4IO1 A;  4O44 B;  5M2U A;  4J9K A;  3OFG A;  1XNQ J;  1R31 A;  2O1P A;  1D09 B;  4RW7 B;  4LIR A;  3NGS A;  4LUB A;  1VBK A;  3S7R A;  4YFU A;  4DV7 F;  5IC6 B;  3ZZR A;  3PTW A;  3M9O B;  4JI1 F;  1R7I A;  4IDK B;  2CZ9 A;  5AJ3 J;  4D3H A;  1HI1 A;  1PYS B;  3FFI B;  3PIO Q;  2ROP A;  3AOA A;  4DFP A;  4ER8 A;  1S0M A;  1QVG R;  2UXB J;  1RBA A;  4OLP A;  1EJ7 L;  1FXD A;  2HBQ B;  3AD8 C;  3RB3 A;  4LFB J;  3MR6 A;  1SQF A;  4QIW D;  4XDD A;  2DGO A;  5IS2 A;  5FDL B;  1JNZ B;  3AT1 B;  4QBU A;  2Z57 B;  5KOW A;  1IWG A;  3CJT A;  3MMB B;  1YRT A;  1F9E B;  4MAK A;  4OHV A;  2DGW A;  4XPC A;  2VFU A;  3MEE A;  3KLF B;  2MY7 A;  2DO0 A;  2D41 A;  2KKH A;  4IUF A;  2HMI A;  3KLI B;  2UXD J;  1IKW B;  5ETT A;  3RUB L;  4ZPW R;  3TZW A;  2IIH A;  1K1S A;  3HM9 A;  1S59 A;  1HR0 F;  2WSC C;  2MZS A;  4RUB A;  3LUY A;  5FLX Y;  1Y3J A;  1YJT A;  5A8W A;  2J6U A;  2XUL A;  3M8W A;  2E5G A;  3FBE A;  1VC6 A;  2EKY A;  1S49 A;  3MAH A;  5CYM B;  1GK8 A;  4WKR A;  5J1P A;  4KFB A;  1S6P A;  1UEK A;  3QSY B;  2AYM A;  4DV3 F;  4UY8 T;  3DOM B;  1EAY C;  1SVD A;  2X51 A;  1LKZ A;  3CJ0 A;  5C24 B;  3BO3 A;  1H2U X;  1JX4 A;  2V8G A;  5D3G B;  1Z1Z A;  2YBV A;  1KTQ A;  4RZR A;  1WEX A;  1ULR A;  3SZ2 A;  2QIF A;  1QDU B;  1PIE A;  5BR8 F;  5HQL A;  3DMJ A;  4CLZ A;  2IDL A;  4PQU A;  4I6A A;  2DBB A;  4DBQ A;  4ECT A;  3Q89 A;  2MYF A;  4KIA A;  1QD1 A;  3TZZ A;  2OKQ A;  4GVL A;  1UAW A;  2G1H A;  2YX1 A;  3MCM A;  3QAE A;  3T6B A;  2ZBI A;  2ZBP A;  5GAH U;  2AEJ A;  4NXN F;  4LRE A;  5LXY A;  3AB2 B;  4PWU A;  3EGV A;  3J80 Y;  4CCH A;  4DU7 A;  1ZET A;  3NGD A;  2C42 A;  1HIY A;  1S1T A;  3BBF A;  2ROE A;  2K1R B;  3V81 B;  5G0R B;  2BVZ A;  2H9Z A;  2CPE A;  3CW2 C;  5KG6 A;  1WI6 A;  2OTJ S;  4U7U D;  4K4W A;  1MWZ A;  2N7Y A;  3CC4 S;  2M8H A;  2JC1 A;  3TA2 A;  2HKE A;  5ETP A;  1SB6 A;  2EFG A;  1T3N A;  2PA3 A;  1RT2 A;  2KYZ A;  1VQN S;  3QIP B;  3Q8U A;  3K59 A;  2PFD A;  1RI7 A;  1UL3 A;  3GU0 A;  2P9C A;  2CJX B;  2WB1 D;  2CZ4 A;  1JLC A;  4B17 A;  2IC3 B;  3FMW A;  1G7C B;  4ECZ A;  3JAM Y;  2LEP A;  4JB8 B;  1RT7 B;  3C15 B;  4AND A;  2QO3 A;  5HAT A;  1Y5N B;  2H4W B;  4ATN A;  1R0C B;  4DX5 A;  1MSW D;  5K5M A;  2BAC A;  1CLF A;  5GAD I;  1R0A B;  1NK8 A;  4ZPV R;  5I4M A;  2HPU A;  3PR4 A;  3GIK A;  1PBA A;  2OIH A;  2JZ5 A;  2CWK A;  1Q8K A;  4CYU A;  1D9D A;  1R8C A;  1FKP A;  3M8Z A;  2PMH A;  1N52 B;  1HQE A;  4J9O A;  1UMJ A;  4B9L A;  4TU7 A;  2XBP A;  4KV8 B;  1R6Y A;  3W62 A;  1Z2L A;  5I3Q A;  2YWW A;  1RTJ A;  5AE2 A;  2OI2 A;  1TR0 A;  5D0G A;  2M4M A;  1NME B;  4J91 A;  3TZY A;  3H8Y A;  3MF5 A;  3MDF A;  2R2U A;  3VAF A;  2OUG A;  2MQP A;  4OV1 A;  1KOO A;  4O4R A;  2AZ1 A;  2CAD A;  4RUH A;  1UFL A;  1FKO A;  3DRR B;  2MQQ A;  2DCU B;  1S0V A;  5KFX A;  3QZ8 A;  1X8D A;  4FXW A;  5A8R A;  3I4H X;  1F9F A;  2WB4 A;  3OJU A;  5E2Q A;  3R3T A;  4UTG A;  2IVM A;  2VG5 A;  4LF9 F;  5LM7 E;  4NLW A;  2BYC A;  5C2G A;  4RJV A;  3VQT A;  2AWZ A;  4AL5 A;  3BQ1 A;  4LSL A;  3VGT A;  2HFN A;  3NOG A;  4CLL A;  3GCW P;  3UR3 C;  1RAB B;  3DXS X;  2RRN A;  4U9R A;  1WOS A;  2DH7 A;  4DUZ J;  2UVU A;  1FE4 A;  4LFC F;  2DNL A;  4BS2 A;  1U1Q A;  3C6T B;  2G0J A;  2ZVS A;  4AT1 B;  1XR5 A;  3H90 A;  4UST A;  2W1B A;  1K9M T;  4A8W A;  4U6P A;  3HVW A;  2FVP A;  4WFY A;  3UVJ A;  4C9D A;  4QIG A;  4TY9 A;  3K58 A;  3CPW R;  3VGV A;  2C3U A;  4RW9 A;  4B3R F;  1FJ7 A;  3MFI A;  5IV3 A;  4U67 Q;  4GKK J;  2R7S A;  2WRM A;  3ZTP A;  2XY6 A;  2V5H G;  1NPK A;  5LSL A;  5HP1 A;  2AF6 A;  3HLU A;  3CD0 A;  1FVQ A;  5KG5 A;  1NND A;  4PG7 A;  1GXU A;  2LQ9 A;  1FA0 A;  4QR2 A;  2HND A;  3KHH A;  3H5Y A;  3W9H A;  4DF8 A;  2GS8 A;  1NK5 A;  1H7W A;  4F3M A;  1N8R T;  3UCU P;  1DTT B;  1GH8 A;  3FBF A;  2GZO A;  3A3P B;  1RWM B;  5BYR A;  4A8S A;  4DMZ A;  3LWL A;  1T11 A;  3GIR A;  3QT5 A;  1RTI B;  2MST A;  3EYZ A;  4JUZ A;  4IFV A;  3GLJ A;  2YKN B;  3IM8 A;  1N0U A;  4JI5 F;  5L9X A;  5CCM A;  1OPZ A;  1Q8I A;  3TEH B;  1D8Y A;  5A0Y B;  5F8M A;  4QIE A;  2VFV A;  4DR7 J;  4M5I A;  1X4F A;  3SCI E;  2DIV A;  4NPO A;  3EZO A;  1GNK A;  4LFA J;  2I38 A;  1NEE A;  3M8Y A;  4RBU A;  3D4J A;  4WWS A;  2BQU A;  2QTW A;  3ZTQ A;  2KJW A;  4TN2 A;  2PII A;  3KUE A;  2XS2 A;  1EQ0 A;  3VGS A;  4TQR A;  1K1Q A;  5IT9 U;  4A8Q A;  2AD9 A;  3H59 A;  2O5D A;  3Q8Y A;  3HJF A;  4NMX A;  1OPI A;  4C8O A;  2IAJ B;  4WFX A;  2QMU B;  4TYB A;  2XYG B;  3DDI A;  3T19 A;  4P2M A;  3HPO A;  2NQP A;  2AJ0 A;  2HS3 A;  1JLE B;  2BXJ A;  1CBK A;  3D0H E;  1RTZ A;  4OZ2 A;  1C1B A;  4ZK7 M;  3T1Y F;  2DRB A;  3IWN C;  3PX6 A;  5J2P B;  4P2X A;  1FNX H;  2OD6 A;  4UZB A;  2HQ3 A;  3A4T A;  4A48 A;  4FDF A;  4JI7 J;  4DZD A;  4YDX A;  2YNG A;  4CH1 A;  3BKF A;  1HQE B;  2MQN A;  1ACM B;  4LMZ A;  4NYP A;  3VWS A;  1VS3 A;  1FJC A;  1U47 A;  3H98 A;  3DM2 A;  5GVQ A;  1H74 A;  2W7A A;  1OY9 A;  5DM7 Q;  3DLK B;  1NK6 A;  3F44 A;  2B9X A;  3NBP A;  4KQZ A;  1JKH B;  1PAE X;  2RQM A;  4DL3 A;  1AZS A;  2FGC A;  3TZX A;  2V34 A;  3BGF A;  3M32 A;  2OPQ A;  2DXF A;  2J7W A;  5AT1 B;  4MIB A;  3R5D A;  5F8I A;  1Q53 A;  5DDP C;  4H4M B;  1IKX A;  3UE2 A;  1HFE L;  4NLQ A;  4ZCM A;  1B7Y B;  4QYZ K;  2ZBC A;  1VQ5 S;  5T14 A;  2J5A A;  4Y2C A;  3GII A;  2RDD A;  3JSY A;  3AQP A;  1OS5 A;  2K2P A;  1GAO A;  3H2U B;  3G8S A;  4ZVQ B;  2OSQ A;  4ED8 A;  1UVI A;  2WAQ D;  3M9M B;  3M8P A;  2ADC A;  1TKT A;  5THW A;  2XCP A;  2CVI A;  3QWP A;  5DJB A;  4ZCK A;  3VCD A;  2H5E A;  3KNA A;  4GMK A;  4AFF A;  1P6T A;  4W4M A;  4MIA A;  3I56 S;  5EN1 A;  2J8S A;  2P6T A;  3KK1 B;  5L38 A;  2RKI A;  5IM0 A;  1FER A;  1NSQ A;  5KT4 A;  1GT8 A;  2V8H A;  4CI0 B;  3GYG A;  2CPZ A;  2F8M A;  2OHD A;  4DV7 J;  3UVJ B;  1FJG F;  4LSZ B;  3M1V A;  3ITH A;  2WSF C;  2XTJ P;  5IT0 A;  1EET A;  1VYA A;  2V63 A;  1ZPV A;  2BW7 A;  5K20 B;  2COL A;  2EPI A;  3MM9 B;  3M2U A;  4H4K A;  3DLE A;  2BEF A;  1MWQ A;  5EX0 A;  4FYD A;  2M70 A;  4X4Q A;  5ETL A;  1HW8 A;  1LFW A;  4KGX B;  2DNN A;  3T6J A;  4UOF A;  4B9M A;  4Y3C A;  1LXN A;  3IGN A;  1CS4 A;  3MM7 B;  2HSE B;  2YPY A;  3K5O A;  4OHX A;  1X5P A;  3HD1 A;  1VC5 A;  1M0S A;  2ZM6 F;  2X3D A;  3KK2 A;  4WP9 A;  5E0O A;  2G9O A;  2YQ1 A;  4PWD A;  1BWE A;  2HK2 A;  2NPI A;  3MOZ A;  4OYI A;  3G6X A;  3CME S;  3IBF B;  2ATC B;  3L3C A;  3K89 A;  1RYS A;  4OZ1 A;  3CE8 A;  2LLZ A;  3CCE S;  2UV8 A;  5CAA A;  4N76 A;  4PWW A;  1HR0 J;  2DNP A;  2BAN A;  2C2O B;  3MUV P;  8AT1 B;  1P8G A;  3LAN A;  2HHU A;  2CJY B;  1KHW A;  3H4D A;  1NJW A;  4DX6 A;  5DG9 A;  2ASD A;  1J5E F;  3QGP A;  2MEW A;  1U7L A;  1B0V A;  2LMI A;  5DDQ C;  4W92 B;  2B7B B;  5B0G A;  3SQG A;  1WNE A;  5ETS A;  5HVF A;  4L3K A;  4LR9 A;  4ID5 B;  1MU2 A;  3PV8 A;  2UUW A;  3D66 A;  2VBY A;  3ZZT A;  3I31 A;  2MDA A;  3I9Z A;  2WW4 A;  2YKO A;  2XNQ A;  5H9F J;  5M2P A;  1UJ5 A;  4KBI A;  1EP4 B;  4PQA A; 
#chains in the Genus database with same CATH homology
 2E7V A;  1IVZ A;  2ACM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...