2ACMA

Solution structure of the sea domain of human mucin 1 (muc1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
SFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mucin-1
publication title Autoproteolysis coupled to protein folding in the SEA domain of the membrane-bound MUC1 mucin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 10
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.960 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits SEA domain 2acmA00
2E7VA 1IVZA 2ACMA
chains in the Genus database with same CATH superfamily
2JJ4D 4IFYB 2QV6A 4YY3F 3KNGA 2DNKA 2AIRB 3NGSA 1KR4A 1H7XA 5H9EJ 4NLVA 1GH8A 4WP3A 1V9OA 2MZ1A 2M0GB 2ZFHA 4I2PB 2CQDA 1VRUB 4EZ6A 2KFNA 3E2EA 4OHYA 8AT1B 2C2EA 4WFXA 1SKSA 5E3CA 2ZNZA 1X0PA 3QRRA 3DLBA 2EPIA 3T5KA 5CHCB 1W26A 3IS9A 5DQGA 3NRBA 2XBPA 4CRJA 1JKHA 2VFSA 3VAMA 2FGOA 4AL7A 3AFGA 3T19A 3ZTPA 2KI2A 2R42A 4DV4F 3P49B 2QMXA 2J0XA 4Q8EA 4ZLNA 2Z56B 4EU0A 4OZNA 3PYFA 4DF4A 3MM9B 4MKAA 1IQTA 5DS7A 1M5OC 3P96A 3W2VB 6FDRA 1R3NA 3ENVA 4GVBB 4M5JA 2HHWA 2GGPB 2OEJA 2QSWA 2ZZMA 2HLUA 1NAQA 1SBRA 3O2IA 4EBDA 4CI0B 2UUBJ 5KFEA 1FNOA 2F7VA 1X4HA 2UUCJ 1O5JA 4USKA 2IC3B 3DLGB 1TL3A 2NREA 2KL8A 3LPYA 3L4BC 4UUWA 1WORA 1XERA 3M8RA 4G1QA 2FC9A 2RD5C 1H0HB 2ZH8A 3R1HA 2AX1A 2OAUA 4DX8H 1S5ZA 2FZCB 2J8SA 4XAKA 1KD1T 4P75A 1NLKL 3PIPQ 1VQLS 4FNIA 4ZVFA 1T9VA 1FRLA 1U6BA 3H25A 4RBUA 2O1PA 4X4RA 3TAQA 2Q43A 4J9PA 3CCZA 1R0AB 4EO6A 4PWUA 1PJ6A 1N54B 3IGNA 4U7CA 1VS3A 3DRPA 4ZPTR 4AD6A 1VC5A 3EM1A 2DH9A 4K4XA 1H38A 2OEKA 1RT2B 5HSPA 5CYQB 2DXEA 2RH3A 1XR7A 1JLAB 4OZ1A 4NEYA 2KHCA 4WIQA 2M3DA 3I4HX 2EG2A 4JI0J 5BYSA 3OSNA 1N52B 3GIJA 4OYBA 2XHCA 2ZBIA 3T5LA 5KFYA 4UW2A 2D74B 3D66A 3N5BA 3PW7A 2Y0BB 4NXNF 3NMAA 3O5TB 4QU6A 1VHFA 1YRXA 2CPHA 4HR2A 4PXEA 2Q79A 1REVA 2JHEA 1QE1B 5E0OA 2YKPA 1ZZFA 3TEGA 2XCPA 1OS5A 2XWXA 4B3RF 2Q1LA 5A8KB 4YHHJ 2EEYA 3PFEA 1LNQA 3C6UA 2DGOA 1ZM2A 2V94A 4GKJJ 5C42B 2HQIA 4DG1B 3FKBA 2DNQA 3HLUA 3NGTA 4KB7A 3AQOA 3QAEA 4KT0C 1T95A 3AQPA 4N8OA 2IJFA 1T9WA 4YDXA 3SQGA 3R5BA 1XNRJ 4OQJA 1LXNA 1MMNA 3JSMA 4X62F 2RS8A 1MROA 2H5JB 2VJUA 3GJRB 2KH9A 2ZNYA 2HVHA 8RUCA 4LIRA 3OL7A 3HP6A 3DOKA 1DY3A 1U2RA 1NK4A 1SUQB 4ELTA 1P27B 4F8RA 3MHYA 2FLNA 2MY7A 3BREA 2AU0A 4OHWA 3OR2A 4MYTA 1HMVB 4CTAB 1OY6A 2CQ3A 1GXLA 1UEVA 1KQKA 2YKAA 2CZ4A 2W9CB 3G8SA 1B7FA 2C2MB 2JEJA 1Z2ZA 2CUYA 1W2BR 4CLPA 1CJKB 3WBZA 3HHLD 1IBLJ 3M8PB 4X84A 3IP0A 3NOCA 4FN5A 3D5MA 4X64F 1FRHA 1B64A 1OY8A 2MEWA 3VAJA 1L3UA 2DNOA 2MZQA 2XYPB 4JB8B 1FNXH 1R43A 3GU0A 1SJ1A 4WYWA 4PG6A 4LFBF 3N28A 1S4EA 5I3QA 3CE8A 3QNWB 2EFGA 4UY8T 2P6SA 5GAGI 3BEGB 2DNYA 1GTEA 5E7OB 2R8HA 1HWJA 2IDEA 3DDKA 5KG6A 4U8YA 3QAUA 1GEHA 1CSJA 2NPFA 1SJRA 1BQNB 2UXBJ 1EJ7L 2EKNA 2R8JA 3EPGA 2LEPA 2AJ0A 3I56S 2DIUA 3QPIA 3GFZA 1FI4A 1NSKL 3I5AA 4XTTA 2DBBA 4OI3A 2A3JA 2W2NP 1EQMA 3FEXB 4ZPWR 3F0NA 3RBZA 3O1LA 4KGKA 2FQQB 1TK0A 1KDNA 2G1DA 1NU4A 1C0UA 2X1GA 2HHVA 4F0HA 3FBFA 3UCGA 2WZ1A 3LGMA 1ZYQA 2VBWA 3D6MB 3WZ0A 3DFEA 2DO0A 1WTBA 3FFIB 2XTJP 4IH7A 5ETNA 1OSDA 1FFWB 4ES3A 1S9GA 1HBOB 3MEDA 4ERDA 5IM0B 2IRYA 5KFRA 3ONQA 2YQ0A 3Q2SC 2CJYB 5KAKA 5I42B 5HVGA 3DLHA 4DMZA 1HKAA 3UD4P 2IVYA 4RNOA 4LR9A 3UNYA 3IRXA 4CLTA 1TFYA 3D6FB 5J2QB 1KFSA 2VG5B 4AE5A 1R8BA 4WZMA 4K5RA 2D1CA 4CH7A 2CQCA 1EP4A 3MM7A 1PC5A 3TA0A 2MLYA 4LFCJ 5KFGA 3DU6A 3PW2A 1IBCB 5KFOA 2AJQA 2HNZB 1VBZA 3M9OB 3UDCA 1T05B 1LWEB 4A46A 2LU2A 1PG5B 1IKYA 2AZ1A 2KG1A 4I6AA 1PBUA 1JLCB 1Q95G 2P9CA 4P2MA 1FKPB 3UW1A 3AA9A 1XR6A 2VPYB 1BQXA 4U7UD 3N6LA 4DOZA 1KEKA 1KLMB 1U24A 3HDSA 2A18A 1QD1A 4CO4A 2MZRA 1Y9OA 4ANDA 1TL4A 2J9EA 2GJFA 4F3OA 2QLWA 3DLJA 4GKKF 4Y65A 3GFYA 3IR5B 2PGCA 1CQMA 3MPVA 2AF6A 2IFXA 4U96A 1TUWA 3ICLA 3M2UB 3MEKA 5HP1B 2OHDA 3CCVS 1TKZA 1RWWB 4LF2A 1XMOJ 2ZH9A 2J9DE 1RWMB 4K4WA 3KLIB 4OX7A 4IFVA 3G9CA 4E98A 1UVJA 4JI5F 2YWWA 4M8LA 1H3DA 2YX1A 1YLXA 1TV6B 1KSPA 3EJMA 1X4EA 3TA1A 2DHGA 3EZ5A 2W2PP 4QPXA 4C11A 1YJRA 3O3LA 1BWVA 4HL9A 2GO9A 4FYDA 1RT5B 3HX9A 4LFAJ 1NRKA 3LPEA 4ZKAA 5CYMA 5DM6Q 1TL7B 3KK1B 3MZIA 4JV0A 2GVZA 5B09A 2GX8A 1EX8A 1LEOA 1D9FA 4RU2A 4B3OB 3VGTA 4F26A 3G82A 4NA3A 5ETSA 1TKDA 2UUWA 5A0YA 1QJHA 4ZPDA 3UDLA 2N7YA 1RAGB 2SXLA 1R8PA 4TLRA 3TZWA 2Z0GA 4WIIA 2DEIA 3BPSP 3BO3A 2CNKB 2COLA 3SCJE 3V4MA 2Y1IA 2HVDA 4YP3A 2XMAA 1F5CA 1RWVB 1GXTA 2HS0A 1CJVA 4OLPA 4I69A 1FX4A 2HLTA 2YKMA 2DKOB 1V3SA 2B4PA 4WFYA 1X9SA 1HD0A 2H54B 4O4GA 1UAWA 2PO4A 3RR7A 4JV5J 2DH7A 2F63A 1U1MA 3BO2A 3K5OA 2B9XA 4KGMA 2LQ5A 1HI8A 4DR6F 1Q7YT 3KK2A 2YBVA 1IKWB 5HBMB 2W4DA 1DLOA 2HQCA 3IAS9 2ASJA 4DV6J 4FF1A 1U4BA 4NYPA 5JVGQ 4BLGA 2QYCA 4ED4A 2W2OP 2X1FA 2B5JA 2FHOB 4HDGA 1CVJA 4WKYA 3CMQA 2A10A 4R5PA 5E41A 4KHPJ 2V2QA 3OTEA 2PSZA 3PX4A 2VPZB 3QGHA 1WC6A 2HNYB 3OW2R 1R0CB 1G1XA 4KSEB 4C98A 3LALA 1P1TA 2XO6A 4QBUA 4LF4F 2DIVA 2LQBA 1RT3B 2BANA 3FCHA 1HBNA 1C2PA 2VC1A 1M5SA 4CQ1A 4OYXA 2R2TA 2VODA 1N32F 1IJFB 3J7AN 3PR5B 4U9RA 4PQAA 5L9XA 3CCQS 1X4BA 3C2PA 2GNKA 5KFBA 1TQLA 4OHZA 5C25A 2G0JA 3B82A 4PG7A 4Y2MA 3RAXA 1KC8T 1MMLA 2FD2A 1ICEB 4K59A 2YNFA 1Q4RA 5B0FA 2UUTA 1LWFA 2DPIA 3RU0A 1N33F 4USJC 3DM2B 4K2XA 1P1LA 1BLUA 2JRSA 3U1MA 5JMNA 1VQYA 1A6LA 1CJUB 2JVOA 3GFXA 2Z2ZA 4ALZA 3M2VA 2P9EA 2DRDA 2B0GA 3CO9A 2HAFA 3I87A 4N77A 2C2DA 2MTLA 4DL4A 3OQ2A 1HBUA 1HYSB 3HHLA 3KJQB 2QMWA 5KFCA 2DCUB 3BH7B 2BM1A 2RHSB 2ZJRQ 5L39A 2U1AA 2C28A 1DTTB 1XMQJ 2JEFA 1HWIA 1SL1A 7AT1B 4G1IA 5F9LA 2NQPA 1WDDA 3GZ7A 2FDNA 2CQHA 2OLWA 2RKIA 3PV8A 1S0NA 4LT6A 2DCLA 2LLZA 3M1VA 4RU9A 3QJPA 3DKDA 2HIQA 4DV3F 2ZH2A 1CLFA 2K7JA 1RCOB 5GAGU 2W4CA 2FVPA 2P6TA 4MFBB 3JSYA 2YKNB 3R7NB 1J27A 1JX4A 1V3ZA 1SQFA 2XEXA 2W2QP 3HM9A 1VJWA 1LFWA 4JI6J 4ECUA 1IKXB 5HLFB 2E9RX 2MZJA 2XYGB 3BYPA 2HHHF 3L9ZA 3AAWB 1U8WA 2K2PA 3OJSA 3ZC4A 1UVIA 3UE2A 1NDLA 4U6PA 3KHRA 3TAMA 1FVSA 3MR3A 2J0WA 2MGZA 4WK1A 4DF8A 3H20A 3QO9A 4PWDA 4JOUA 3TUPA 4PG5A 4UZCA 3TYTA 3D6TB 1KRPA 5J2MB 2X3GA 4EWTA 1VQOS 4NLWA 4KR0B 4OHXA 2GC8A 1SC1B 4I2QA 4OZ5A 1NKCA 4DR3J 3KNAA 3I0SA 5E3QA 1CPZA 4F3MA 1TKXB 1NNDA 2CQ2A 2XMMA 2DNLA 4QR2A 2AGOA 5LJ5Y 4YR3A 5C24A 3PW4A 1FJGF 4RNFA 1U1LA 3M6VA 5KFQA 1Y00A 4DL7A 1RWUA 3MD3A 4HHJA 1HWLA 1B99A 4NLXA 1FKOB 4NMXA 3C66A 4F3QA 4N7TA 3L7OA 2ATCB 3LP1A 3M6WA 4J90A 1RJJA 2R7OA 3LWLA 4A8KA 3JQJA 2G4BA 5KFFA 1RTHA 4NLRA 4WTOB 1RTDB 5BYRA 2HS3A 2W7OA 1VK8A 1NM2A 2BEFA 5K5MA 1VR6A 4OJ3A 2BE9B 4PXCA 1GMWD 1MWZA 3UDVA 4EK2A 2VZ9A 2H4YB 5THWA 4NLUA 2M4MA 1DZ5A 4YN3B 4HLBA 1UFKA 2CDQA 4KFBA 4ETZA 1N5VA 2HZCA 1WOOA 3MMCA 4ZS6A 1N5SA 4YR2A 4P72A 2Z58B 2PIIA 1T9TA 3VAFA 2HWHA 1HHSA 2VBZA 1D3WA 1FWKA 1RHQB 3BBBA 2A1BA 5GMKa 5KFJA 2KVQE 1WHWA 4CH0S 2J5AA 4ZMMA 3FMBA 4OX9J 1T0TV 4UQTA 3OXGA 2XNQA 1SH0A 1IQZA 2Y1LB 3KLGA 2BE2B 3HVTB 3UNGC 5ETKA 3M8WA 5KFDA 2LQ8A 3J81U 2VIHA 1JLBA 2V8GA 4K4VA 2QRRA 3AXMA 4MIAA 1F9EB 4DUZJ 1TL1A 1SJ4P 4PABA 2F40A 2ZD1A 3HO1A 3KDNA 1NZAA 4USVA 2O3DA 3W8PA 3W5ZA 2MKKA 1WOSA 4LF5F 4CO1A 1FRMA 2FPHX 5IV3A 1AROP 3HVAA 5DG9A 4XIUA 4FDFA 1WKLA 4O3SA 1UA1A 2EFNA 2WVCA 2QLFB 2AWZA 1D9AA 3AY0A 1LWCA 3PEJA 4B3SJ 4WE1B 2BXJA 4GC7A 2KT3A 5A8RB 2VFRA 2MQLA 1HD1A 2BACA 3F56A 4Q0BB 4WBFA 3LGHA 4RW9B 3BYRA 2XS7A 3FDSA 1YRTA 2IAJA 1QM9A 5KFSA 1UFLA 2K1RB 2DT9A 2W01A 4LF1A 1QLNA 1TUVA 5ETMA 4DPXA 5E2QA 5KOWA 1X0FA 1HPZA 3DRXA 2YY3A 1NK0A 5J1EA 2MQMA 2V34A 3THVA 4KPYA 4CNYA 4MK9A 3CDAA 4F4ZA 2Y0SD 3K89A 5I4MA 4ZP9A 1KHWA 3BN7A 4K2JA 1UP1A 1YJTA 4RWXA 3HF5A 4Y2CA 2G2OA 2HK2A 2E7XA 3BJYA 4K0KF 4KPCA 2HNDA 1ACMB 1RACB 4OX6A 2ZBPA 3T1HF 1M1HA 2VASA 3W2WB 2VFUA 4A8OA 1HR0F 3IN5A 3GP9A 1SC6A 4Q44A 2QGFB 1N48A 2DNHA 4LVOP 5L1LA 1HA1A 3HHLC 4EBCA 3R2DJ 5KFWA 2N7CA 3LUYA 4O4RA 2ABYA 1RWKB 3R5CA 3EYZA 1VFJA 3KLHA 3MURP 1YBAA 1RT4B 2XG8A 1XTZA 2HW3A 4JI4F 1HQUB 4DUYF 3VQSA 1HQEB 3IO1A 3V81A 4X4SA 3VVUA 2G13A 3GIIA 5B0CA 4DEZA 1BE4A 2I8EA 1N6QA 3LGNA 3H59A 4IO9Q 1JNZB 4CLUA 3IR6B 2YNHB 3VCDA 3GJQB 3KMSA 4CP5A 3KFWX 1S0MA 4ZVSB 1H72C 4HACB 4LF9F 3DOMA 1PAEX 4OYZA 3HKZD 3OL8A 1N5YA 5L9NA 3SXLA 3OTBA 1IJEB 3A8EA 2BVZA 2WHOA 1U6ZA 3C46A 2KM8C 1OY9A 2PMHA 4QWCA 3Q24A 4L3KA 2MY8A 3M7VA 5IWAF 4EYIB 2WRMA 3NG8A 4DR7J 4DV1F 3QZ8A 4N41A 1HNWF 1OSCA 5K20B 2VG7B 4DV0F 3CIZA 5ETLA 1RQ0A 1U26A 4C0HA 3GWCA 1FF2A 1JLQA 3Q0AA 1RT1B 4OIXA 1F9HA 5K14B 1K0VA 4RNNA 4L72B 4C0BA 2Y8YA 3EGWB 2XLIA 3K17A 3SI8A 3CDWA 1NDPA 5GADI 1C4CA 2EW9A 3IG1A 2HHUA 3H90A 5FDLB 4PQUA 5LOQA 3GCWP 4AFFA 5D0GA 3DLEA 4ED0A 2CG4A 1MWQA 4EEYA 5KG5A 4MAKA 1YJWS 2FLLA 4YFUA 3IBFB 1Q1KA 4ICLB 4U8VA 2DGVA 4V1Ak 1KNZA 1DTQA 3MCNA 2NSBA 4Q43A 1TMJA 4AXJA 3OV7A 1C0TA 2CZVC 2PN6A 4HI2A 1F6TA 2YWGA 3R5GA 4IR1A 3KK3A 3L3CA 1K47A 5F3ZA 1RKIA 2KFYA 4IDKB 2RU9A 1B0PA 3DRYA 3C16B 5DGBA 4ETXA 3VVTA 1PSDA 3TX8A 1X4DA 3CCMS 1R6VA 3MM6A 5AE1A 3PKYA 2HVIA 2MZSA 2HMIA 1SV5A 2XI3A 2DYAA 2G2YA 4CLLA 3UR3C 4RW6A 3A12A 1HNVB 1MG7A 3CJ4A 2AEFA 3Q2TC 3MMJA 2YKQA 4TYAA 4FS2A 3DLKB 2APOA 1PJ5A 2IM1A 1M5VC 4USIA 2PEBA 2EG1A 3AA8A 5GAEI 1U1KA 1EZZB 1RT7A 3MPDA 5I3UA 4Y6IA 1HNIA 3B54A 2UUBF 1GMWA 3FZBA 3D6HB 3BR8A 2DRAA 2UUCF 4J9QA 1IR0A 4DL2A 2ILZA 5F8GA 3FMWA 3V5RA 6FD1A 2AYEA 2UUAJ 4IFYA 2MKYA 1JJ2R 1HL6A 2RE1A 3QFWA 2H3EB 5K8PA 2BV3A 4RL1A 1FA0A 4DDFA 3HKWA 2VG6B 3V6JA 1F2GA 4GO7X 4BHQA 4TY9A 5ETPA 1QVFR 1WC4A 4C8OA 3FNNA 2UVUA 1NK7A 3JYTB 2YH1A 3B6BA 1RAJA 1G3OA 1X8DA 3J80Y 2VICA 1E6YA 2F8MA 2MSSA 1YJNS 4G6VB 4UOCA 4NWBA 4PUOA 1Q5VA 3GYNA 2XSFA 3MOJB 4LSNB 2IBKA 2KZZA 2FJXA 1TTHB 2MPUA 2GVDB 1B7YB 1WHVA 3BQ0A 3D28A 5CABA 1VISA 2RVJA 2NYIA 4JI0F 4USUA 5HMWA 1RBAA 5HROA 4O0NA 5T14A 5G0RA 3RRKA 5HN0A 1C1CA 3FC9A 5JVHQ 1X5OA 4CDIA 5GAHI 1URRA 2J8AA 3W2VA 1WUUA 4LIWA 3I9V9 2D3OR 2J7WA 1VQ5S 4GVBA 2KVIA 2GGPA 1FXDA 1RWPB 1RAAB 2LQ9A 3OXFA 2L08A 3AD7C 3J80U 2ZOGA 3MR2A 3H98A 2OTJS 4CM2A 2H1YA 4KO0A 2RILA 2IC3A 2LA4A 1KTVA 1T9YA 3CUNA 3MMBA 1WEYA 2XULA 1S1UA 2KRBA 4CT9A 1V5VA 2QA1A 3JQKA 2IJNA 3CJKB 3S1TA 4YHHF 4LVNP 3ITHA 1BUXA 4GKJF 2KXHA 4DV2J 1ZAWA 4H54A 5KT2A 2JLGA 4B9LA 1HWUA 2UU9J 5B0EA 3VAGA 2RT3A 3WC2A 4OZ3A 1D1UA 2AYGA 2G2ZA 4B3TJ 3G71S 1XNRF 1A9NB 1R0AA 1DAXA 4DR4F 3T6BA 1MWYA 3DRRA 2JC0A 1F0XA 1RXOB 4DR5J 2X1BA 4KGXB 2IDLA 2RQCA 4DCPB 1AUSL 2G0IA 1KVJA 4HT7A 1RT2A 4ED5A 5DDQC 5CYQA 1WC3A 1M90T 2VUGA 4XDDA 1EARA 1UETA 2RJZA 2ZVIA 1ZM9A 4WP9A 4ZVHA 1T03B 4DSEA 1GX6A 4CNZA 2A0FB 3MGJA 4OYMA 3BKFA 4H4MA 4EFAC 1NO8A 4RUCA 3CJSA 3W60A 2KO1A 1Q8IA 2GMHA 4JV2A 3OBIA 1JJCB 2YPYA 3NGKA 2ROPA 4JI7J 2ACMA 3HI9A 1IBLF 2MJNA 1VQ7S 4DN9A 3MM5A 5J2PB 1Q7LB 1WEXA 5LMUJ 3CVKA 4N8NA 4EBEA 2WVBA 5KT5A 3M05A 2ZH6A 3MR6A 4RKUC 2E1CA 4TU7A 4OI1A 4X4UA 3MCOA 3I5CA 1RAEB 2HHQA 5IFMA 1U2FA 4I68A 5KFKA 4DSJA 5A8WA 5HVHA 3EDQB 3BKTA 1M5PC 4CLWA 3KOAA 2DR7A 3VR1A 3AD8C 2LXIA 3LWMA 4ECXA 3C6TB 1WC5A 1GFWB 2M2BA 2XGQA 3QWPA 3MEGA 2UXBF 4DZ6A 1KOOA 3HPOA 3OFHA 4CYUB 3TUIC 2GFFA 4G1QB 4HHUA 4M5KA 3NXZA 1C1BA 3OL9A 3ZXWA 4DZDA 4IG0B 2B51A 2XZDB 4LQ9A 4QR1A 1FRJA 1FD2A 1XNQJ 5A2QY 2HZAA 4IOBA 3M6XA 2ZHOA 4NRUA 2KT2A 4OZ2A 1RT6B 2JOQA 5GADU 1OO0B 3UFCX 2ROGA 3WX8A 4DQRA 5LSOA 4LF6J 5FD1A 1TKTB 2W9CA 1VRTB 1EKRA 3T1YJ 4A8XA 1CJTB 3DRPB 1T8EA 2I5JA 4UOGA 1FJEB 2XY7A 3PIOQ 3R7BB 1SJQA 2DXFA 1APSA 1U6FA 5EDWA 1B4SA 3EZOA 2KJVA 3D68A 1T9UA 1RUSA 3GFHA 4LFCF 1I94J 4DL0C 5F9NA 4IYQA 3LP2A 4O3QA 3GPAA 2DO4A 4F2RA 5DM7Q 4L3NA 2QA4S 2V50A 3LOUA 2XLKA 1BQNA 2O67A 4HHHA 3KUEA 3K7RA 2NS1B 3QFHA 3QSYB 3SMZA 3NL0A 1Q86T 4FXVA 3JAMU 3RTVA 1FRXA 2VONA 1FE4A 3SFUA 3VWSA 5AXNA 2JC1A 2JEGA 2XGPA 3KJVB 4WU3A 2R2UA 2R2SA 2BZ2A 3FCVA 2Z2MA 5EWEA 2EKYA 2LMIA 2LFVA 2QL9B 5KG4A 4K4ZA 4Z7YA 3NKYA 2VBXA 1JK9B 3QYYA 3FRYA 3I5BA 3FBBA 3SQGB 3DNCA 3ZZUA 1XMOF 1NXIA 4CLKA 4HH0A 2LQJA 5GAEU 3JSMB 2GQ2A 4Q7AA 4LR8A 3OXLA 3FFIA 4ZCIA 4ZP7A 3AH6A 1DHMA 3AJ2A 1HBOA 3MCSA 5IM0A 4DPWA 1NMEB 3S6EA 5I42A 1HI0P 3NGDA 3EGNA 2OPQB 1S1VB 5DDRC 3IWXA 2Q3PA 4OYOA 5IS2A 4LFAF 3ETMA 2R7TA 4QIEA 1VLYA 5D77A 3P6YC 2W7AA 2XSJA 1DARA 2IRUA 1S6QA 4KBIA 2WB1D 3ET6A 2DRBA 1N0UA 4NE9C 2MQPA 5CD4A 5HQLA 2QT7A 3Q8QB 2HNZA 4O3NA 2ZH1A 4ZLPA 2F9DA 2V8HA 2JNJA 1I51B 2L41A 3UDEA 3H0PA 1JLCA 2DPJA 1L3TA 2NZ4A 5A6WA 2Y1JA 1ZZNA 1U02A 3J81j 3FSXA 4MKYA 1KLMA 2CKWA 2QTWA 1P8GA 4AT1B 3OVBA 3CDUA 3U1NA 2LU1A 2RF2A 5L1IA 5BJRA 4B9SA 3T9NA 4NLPA 5GAHU 4X2BA 1S1WB 5B0BA 4JV5F 2HG4A 2EWHA 4ID8A 3M2UA 4M1KA 1O0PA 3A3NB 3OUYA 3SFGA 4I4BA 3HJVA 1LXJA 3EGVA 2MB0B 4NLYA 2DK2A 1EAYC 5KT6A 4DV6F 3SSSA 1TV6A 2HGMA 3CCWA 2M5YA 3BGUA 3OSPA 1JLFB 3TX0A 2RNEA 3N4WA 1WHXA 1NPKA 3IA0A 1JXLA 4LUBA 3KDOA 2H5IB 5BR8J 2PMWA 4WCEQ 4KHPF 4M5HA 1RT5A 1IKVA 3CJTA 3M6UA 5AT1B 1TL7A 3KK1A 4QYZJ 4DS5A 1IBKJ 2F3JA 1C0UB 4P2FA 1Y5NB 2E5HA 5G4DA 1TZ0A 2D3O1 4WFBQ 2WK4A 3GILA 1S4FA 2KXNB 2J0QD 2ROEA 4B3OA 3HHEA 4ZVQB 4URGA 1SKUB 4DQIA 3O8WA 1R8AA 3W9IA 1ZPVA 3CMAS 1RTZA 3AXKA 3UD5A 4KYZA 2C2RA 3IRXB 2C2ZB 2F9JA 3KLFB 3SSQA 1HFEL 2R9LA 1GXUA 2AMCB 1VBXA 1UPMB 3FBCA 4KGVB 3MM7B 1B0VA 3L7UA 4TVAB 3U02A 2CQPA 4TU9A 4ZIWA 3LAKA 5EX3A 1KKHA 2IPOB 3TUZC 3C19A 2O01C 4ID5A 1F3FA 5D15A 4MMOA 2BQ3A 5EUHA 2ZOMA 2GCFA 4OLOA 2RQ4A 1R31A 2WTFA 2GIRA 3U1LA 4FNHA 4IO1A 1X5SA 1IKWA 3MXHP 1ULRA 4A48A 4D3GA 3CXCR 3NS5A 2Y1RI 1BY9A 3MEEB 4C3LA 1XMQF 2QL7B 1SQEA 1VMBA 1FVQA 2XYHB 4BWMA 2ZITA 2IA6A 4LJMA 3W7BA 5C2CA 1Z4UA 4UQGA 3MPYA 4ECRA 2MQNA 2HNYA 4EZ9A 3DHXA 3TA2A 3NEKA 3T9ZA 2UXCJ 5LXYA 3GV7B 2R8IA 4IFVB 1RT3A 1NCLA 4CLSA 2V9WA 1FK9A 3P3DA 2CPYA 2GMJA 2KYXA 3PRVA 2HZVA 4HKQA 2X1AA 4AL6A 2KB2A 5E3RA 1NKEA 4C11B 3ISND 3N0VA 3M30A 3QATA 1RISA 4JI6F 3TZZA 4UZBA 2XMVA 1XK8A 5E3AA 1EHWA 2K3IA 1BQMB 2XY6A 1SIZA 3DU5A 1MU2A 3DM2A 3OHBA 1FJCA 1FEHA 3V2UC 2D9PA 4WK3A 3ZNUA 4QYRA 1D09B 4ZK7M 4DX6A 1MLAA 1RB0A 4GRSA 3OVSA 1CJUA 2B9WA 2JH3A 5CH7B 1OPIA 1H2TZ 4DR3F 3ELHA 5E33A 2A6OA 4LRBA 2Z57B 4KQZA 1YDLA 5ETRA 1UVKA 4IUFA 4NOHA 4OZLA 1CULA 1YG0A 2YKMB 4F25A 4ED2A 4OMFG 4O4GB 1RTJB 3C15A 4FXWA 1UJ4A 2RQKA 1GX5A 3PACA 2PFDA 4DHVA 2YQ1A 3NLCA 3PKMA 5IC4B 2VFTA 1WSRA 1FERA 4OYAA 3PTWA 3CD5A 2F8HA 2CWKA 2YKNA 2B8PA 4X4PA 3HMJG 3Q23A 2B5JB 4LMZA 3BSCA 4C6AA 4R5PB 4ECWA 3J7YI 2Q6BA 4UOHA 4PAAA 1IKXA 5HLFA 1YJ9S 1NK9A 5CD4H 2W9AA 4L74A 2MXYA 3W5XA 2BANB 4I0WA 1QDUB 2QA4G 4RW4B 3ULHA 2F4VJ 1NEEA 1KN6A 4OX9F 2RUGA 5J2MA 4AXIA 3MF5A 1X9MA 5E3PA 3DRSA 1Y5IB 3D1QA 3DN9A 1X4CA 4X4VA 4DXLA 2CJXB 5DG7A 2YNFB 5DO2A 4LBPA 2XMJA 4DUZF 1M1GA 1WJ9A 4ZDNA 5T7LB 4A8MP 3I4PA 1HLWA 1B0TA 4DV7J 4DWIA 3GB0A 2AZ3A 1VK3A 3UI3A 1D0EA 3KLEA 1K73T 2G9OA 1CQNA 5F8JA 2FGCA 3M2VB 3LQVA 3KUHA 4W4MA 1D9DA 4FBUA 1CEZA 4IKAA 4A8QA 1SL0A 2JZ5A 3HHLB 1K8AT 1RTDA 3QLHA 2AGQA 2FJWA 2A6MA 5L46A 4DSKA 2FLPA 1R27B 2LA6A 1KP6A 4B3SF 4DPUA 5IC6B 2ZJPQ 3EPIA 1QVGR 3JS9A 1IM4A 1GMUA 4IRCA 3I9ZA 1S76D 2CIMA 3SCKE 2OPRB 3M4XA 1ELOA 3RB0A 4BWJA 2OO4A 3SV4A 1OQ6A 3CJ2A 3M1VB 3G8QA 1KFDA 4WZQA 1SI9A 2C3UA 3W9JA 3TVYA 1RKJA 2ZVSA 4IG3B 2OP5A 3FSIA 3PX6A 3KHGA 3AB4B 3RZAA 2V4QA 2OPPB 4QR0A 1GK8A 1KWMA 3DGPA 4DR4J 2V8VA 4QOTA 3FSYA 4QWAA 3UO0A 1FNMA 4Q45A 1FDAA 4A8YA 1SJ3P 2QO3A 2ZWOA 2EBGA 3K5MA 2KM8B 1YGYA 3BBFA 2FHKA 3US5A 4H4KA 3W8GA 4CO0A 2AX0A 3NY0A 3QT5A 3GIMA 1U1RA 3TJ9A 3D3CJ 2V9KA 1GQEA 2XQCA 3GCXP 2MGZB 1ZTWA 1T9XA 4PWDB 4R25A 4J7CA 3C8YA 1NHUA 1TP7A 4ELUA 2Q66A 3I82A 2DHSA 2BQUA 1UWBA 5D4PA 1S12A 1M5KC 2R4FA 4DX7A 3V4IB 4M5NA 2ZM6J 1PC4A 5C24B 2XS5A 4QWDA 4WE1A 4ATNA 2KU7A 1O6XA 3CJ3A 3RUBL 3SEOA 4Q0BA 2QMUB 2BJ1A 3I55S 1H74A 4NL5A 2MKHA 2OELA 4JP8A 4ZA1A 2K1RA 3EICA 3FVYA 4RR5A 3QZ7A 5H9EK 5KFUA 1FHTA 2MZTA 3CDBA 1RZMA 2C42A 1RTHB 2W2MP 4QWEA 5IV4A 2W9BA 2CWXA 4P9SA 4C8KA 1VYAA 1I5OB 4LF7J 2HRTA 1SC4B 4OI6A 4DBQA 1JJHA 4C8ZA 4FPIA 3GSDA 5KTQA 3QSIA 3UCZP 3TRGA 2LEBA 1XN9A 4KFBB 2R7WA 4NI2B 3MMCB 3BZQA 3PX0A 1IR2A 1A0OB 1RLDA 3POTB 1S48A 4DR7F 2ZZTA 3U27A 2LDIA 1WI6A 4DS4A 3FCWA 3GSIA 3W62A 4PRFA 2C3YA 2OMOA 3N6MA 2WSCC 2AQ4A 1HNZJ 2P9GA 2CDRB 3ZTOA 4OYIA 2J7UA 5IT0A 1GNKA 1XQIA 2DR8A 3K58A 2B3TB 2P8IA 3MTKA 1NH8A 4NA2A 3PJXA 2DB1A 3KLGB 3RB4A 2NUHA 3R2CJ 2CA9A 4M5IA 1S1TB 4WXWA 3Q22A 3EWGA 3C14A 2KG0A 4RBVA 4FXDA 3SCIE 1YWXA 3M8QA 1RE1B 3W9HA 5AE2A 2D69A 2Y9HA 1TL1B 4CLZA 1ZAXA 3G87A 1HQUA 4J9VA 1HQEA 4EI2A 3IBWA 3T6JA 4CT8A 2DEJA 2FHJD 3IM8A 5F8LA 4F4YA 4ES2A 2ZD1B 1HW9A 3ENWA 3RJMB 2QC3A 4PEOA 1KQGB 3G6ES 1FTRA 2J6TA 3H2VE 1NJYA 3D4JA 1LK5A 5J2NB 1E6VA 2BA9A 2FIUA 3P8BB 1UA0A 3VAIA 2RRBA 2M7SA 4HACA 4J9LA 1GT8A 3JSRA 5ETQA 4NPOA 3QRPA 2ZUGA 4JI8J 3EUNA 3HSJA 2OD4A 1NHVA 2LP4A 2HBRB 2NXEA 5LJ3Y 4AQYJ 3QIPA 3A3PB 3DGVA 4DR2J 2W24A 1OQ3A 4NZ7A 3NOGA 2J0SD 5KT4A 2MQ8A 4F4XA 2LXFA 2QLXA 2DY9A 2CXEA 4YS2A 3M32A 3R8YA 2XI2A 1JWWA 2VG7A 1WG4A 1S99A 1AXQA 3CJ0A 4P2XA 5K14A 1RU1A 3MECB 2XMUA 1ZA1B 5CAAA 1HPZB 3CWJA 5AXMA 5J1EB 2IBOA 4LRCA 1SL2A 3K5LA 5DJBA 4NYOA 2RUSA 2GV1A 3KJNB 1HQ2A 4WP8A 4C4WA 2ZEJA 4DLEA 2UUAF 3J7YU 4DFJA 4KH1B 4ICLA 3CCTA 2UZAA 3M2RA 3QT6A 1KHVA 1X60A 2FYXA 4E8UA 1RYRA 5K9FA 2UVRA 2KRRA 2AJ4A 4JYAJ 1UVMA 1LW2A 5BYQA 2FJAB 2YWKA 3GV5B 2VKZG 3VHQA 3PFOA 2LYVA 3EMTA 5AXLA 5M2PA 4LBHA 2EK1A 4IDKA 1U1PA 3V81B 3RBEA 3C16A 2CQIA 5F8IA 4YDDB 5KFMA 3Q8RB 2DHXA 5F8MA 1RBOB 1JXVA 1N6QB 2CQ4A 3DI6A 3J7Z5 3MD1A 4R8UA 1ZETA 1AZSB 1H6KX 3MAHA 4OYWA 5EWFA 2DGQA 2FVSA 3NBPA 1M1KT 3M9NB 2DD8S 5LXRA 2KDOA 3LAMA 4K50A 1VQPS 1VDHA 3WHIA 1IN0A 1TVRB 3NAIA 4R0EA 2ASYA 2HQ3A 5L38A 3MMAB 2Z2YB 1N5YB 4DJBA 3UVJB 2HURA 4CIOA 4ECYA 5HMZA 3PHTA 3QIDA 2IM3A 1FXRA 5I3PA 4FKXA 2GMLA 3R5DA 1BMQB 4H4KC 3TOQA 4I67A 2DNGA 3OT9A 5HANA 3RRGA 2NCKL 1RABB 3M9MB 2E9TA 1NKBA 2BJ3A 5T41A 4P2SA 4WXOA 3VQTA 4DL6A 1R8HA 4DQQA 1IR1A 4PG8A 1DFDA 3PM9A 3MPWA 3TWZA 2RRNA 1VC0A 2N4DA 2OEMA 2ADCA 2CFXA 4P71A 3AJ1A 1TMMA 2YH0A 2ZOFA 4DV2F 5C5JA 2HHTA 3VZHA 2ZJQQ 1N56A 2UU9F 3HVRA 4TU8A 4B3TF 2MLZA 1YIJS 2X7IA 3JYTA 4OZJA 4Y2AA 1H2VZ 4PXBA 4USHA 1Y0HA 2VDHA 3P5BP 4JI1J 2DGSA 3RBXA 5FJ4A 2W7PA 1KVKA 1VJQA 2YQ3A 4DR5F 1IM6A 1KONA 3R7SB 5DLFA 2YWEA 5CCMA 2B7CB 1T02A 1QAYA 4NLQA 3PNIA 3PW5A 1DTQB 5RUBA 2HHPA 3BGFA 3LANA 4KKOB 3D0IE 1LW0B 3KHLA 3K5NA 3EVOA 1VQMS 3GIKA 2FJDB 3KK3B 1J5EJ 3T41A 1W2IA 5IT9Y 4R0JA 1IWAA 3FQLA 2NZCA 3CCUS 3K8WA 1QTNB 4W90B 1JB0C 1PYTA 2HBYB 4NCAA 2DNMA 4YB6A 1QY7A 4RZRA 4HYKA 1AW0A 1HNXJ 1AT1B 2QLJB 3TVZA 2MDAA 4JI7F 2WOMB 3S7RA 5LMUF 2RDDA 2GJIA 4DN0A 2VOOA 1SV5B 5ITHA 2Q6CA 2HFVA 5B0AA 4K4YA 3G96A 2FC8A 3FUYA 4KC5A 3MM8A 4ILLA 2IY5B 4TXSA 1YBTA 1N5QA 2E5GA 1JLGA 2ZWPA 3QMQA 3IRWP 2C3MA 3BN4A 3TO8A 5IT9U 2NPIA 3HHNB 3MTJA 1YJ7A 3OFGA 4OI4A 1RT7B 1WC1A 4OHVA 2B4OA 1S10A 3DCAA 2BQRA 4LRAA 3OTCA 3ISNC 3THTA 3VALA 4PG4A 1S7IA 3MAAB 1RLCL 1S49A 2H65B 1FX2A 2YWHA 3PEHA 4ECZA 1JQGA 1N5TA 4M5LA 4Y28C 3DYAB 1F5BA 1PYOB 1X4FA 2GW8A 2G0CA 3RBDA 4L75A 3P45B 5IXUA 4E0DA 2B56A 3W66A 1XNQF 4Q5VA 3Q8SB 5KFHA 2BE7D 1Q78A 4EO8A 4P7TA 4ZHRB 5C2GA 3T3FA 4U67Q 3OL6A 3BDPA 2VH7A 4M95A 5KFLA 1UL3A 2XM3A 1T03A 2B9EA 1JLEA 1U7LA 3BDEA 4LF6F 3BO4A 1XBWA 4WPAA 1CBKA 3FJ2A 3T1YF 5IQQA 3RG6A 1E6YB 1L3KA 1G4CA 1WD6A 4M5DA 4PUOB 1X9WA 2VV5A 5JXSA 4MTPA 4RJVA 4J5OA 3ZZ0A 1XMBA 3BSAA 2J6SA 4DL5A 2KZMA 1VLOA 2UXDJ 2CZ9A 5J2PA 4ZVGA 2VKRA 2K3KA 2FHJA 3P5TL 2BOPA 3W3SA 4OYPA 2RDIA 1XJWB 5HROB 4B17A 4HT5A 5G0RB 1C1CB 2J76E 2JSXA 1I94F 3MCMA 4IRKA 2PMZD 2E9ZA 3E3XA 5LMNF 3CJ5A 4Y34A 2ZC3A 1O8BA 3QGIA 4K7QA 5D6GA 3O6QA 2VQFJ 1KVIA 4OJHA 3BSOA 1OYDA 4ZCKA 4CO5A 3C6TA 1GTHA 2EC0A 1HWKA 1IUJA 2CNNB 1S7HA 3L7PA 1TFWA 5M2UA 4KO0B 4C9DA 4NRTA 3ILJA 2MKSA 1H7WA 2E1RA 3MMBB 1VIOA 1S1UB 2RS2A 4CYUA 3PY8A 1SIWB 3LH2S 3CO0P 4IH5A 1S9FA 1U45A 4IG0A 3CEDA 3ITHB 1DQ9A 3CDEA 3HD1A 2OGUA 2QLBB 2B43A 1OIAA 4Q2MA 2FJBB 3VGSA 1IBMJ 1RT6A 3HK2A 1N36J 2CJQA 2CJBA 4FYVB 4WF9Q 3PXGa 1TKTA 1VRTA 4RNHA 2XC9A 3DRRB 1T7PA 3CC2S 1CJTA 3R6LB 4ZLLA 3EXYA 2KXFA 3K0JA 7FD1A 3JB9k 2HFZA 3EE3A 1VI7A 2NYHA 4MT1A 2I6WA 1QSYA 4YR0A 5AJ3J 5LT5A 2FZKB 5MAOA 2AYMA 5B08A 4LRFA 4CWBA 4CLFA 2MYFA 2ZH5A 3V6HA 4DSFA 2VHGA 2HS4A 4ZVPB 4O44A 4ZN1A 4H4MB 4RUBA 1S1XB 4QIVA 4PXDA 2JFDA 4W98A 1Q5YA 2OSRA 3K5PA 3CJ8A 4RO0A 5KFTA 3AD9C 3V6KA 4HVZA 3TP2A 2A2CA 1PBAA 3N6NA 2L3MA 4IQXA 1FE0A 4LSLA 4BC7A 3FQKA 3MM5B 2HEKA 2NR0A 2B6AB 2Z30B 2HBQB 2KN4A 3G2XA 2W8KA 4GO5X 4RW8A 3G6XA 4PKDB 1WOPA 2ZE2B 2HPUA 4N56A 4AL5A 3ZZRA 4B9UA 1K1QA 2BYCA 5A8WB 3Q8YA 3HFZB 3KJVA 1FTCA 2EFOA 2UVWA 4YUDA 3UWTA 2K8GA 5E5NA 3MEGB 4B08A 5SUHA 3W5YA 1J5OA 4F02A 1NHKL 2BJEA 2BR0A 4RPFA 2BKPA 3I96A 1EQ0A 1U25A 2FTRA 4N5SA 4ED3A 2YWFA 1K9MT 2VBYA 1C1BB 2YNIB 2HFSA 1HHQA 2D41A 2OPQA 4ED6A 1Y5LB 1S1VA 3T1AA 5K8MA 5BR8F 1YK9A 3QRQA 3EDRB 1UZHA 5DG8A 4NLDA 1IBKF 4E2FB 3H4DA 1W7WA 5D0HA 2RRAA 3PYEA 1YX2A 3SV3A 3RR8A 4M94A 2ATLA 2FHMA 4UF4A 3X1LB 2R8KA 2I5JB 1RA6A 3IM9A 2ADBA 1Q8LA 1HBMB 1QSSA 1RTIB 3CIMA 2CJAA 5MLCV 1TAQA 3ZZYA 3CSKA 1ZAVA 3UD3P 4ZVEA 4B3MJ 3KG4A 1FRIA 1K0TA 3RW7A 1I6JA 4TY8A 4NZ0A 4I7FB 5KG2A 2KTQA 1PAUB 4USWA 1MN7A 3AOAA 5F8NA 2LCWA 3DHWC 3D9BA 2YX4A 1WACA 1JMTA 3HFKA 3LP2B 1S1WA 5CQGA 3J7ZT 2AJ1A 2NXJA 4WU2A 3G6YA 4QW9A 3CMES 4DR1J 5ETVA 3PJWA 2R7RA 1SPBP 3HT0A 1UJ6A 4J9RA 2QSFA 2YVSA 1C4AA 3TZXA 4RUHA 2BUNA 2WVEA 3TARA 4DPOA 4F4AA 1I1GA 1JLFA 2OSQA 3DMJB 1PGZA 1VQKS 1ROFA 4Z37A 4X65J 4I56A 5HMYA 1S59A 1N8RT 1PO6A 3V6DB 2CQGA 3N01A 3I0RB 2V5HG 4NXMJ 3H4BA 3R3TA 4OJGA 1B3TA 2UXCF 4YOEA 3T5HA 4F7VA 2FVRA 2Z2LA 3R97A 4MK8A 3PYDA 1NH7A 4JI2J 3A3OB 4KJIA 4QJVA 4WKRA 4H4OB 3LW5C 5HQ8A 3LP0A 3BS9A 1SCJB 4CO2A 1U0HB 2E5LJ 3BGRB 3OHAA 3KLFA 3HHDA 1NJZA 3R6GB 2KT5A 2XS2A 2IMWP 1S6PA 1NDKA 3WX4A 1AA1B 2XSJB 1S6QB 3NGRA 3ET6B 2JWNA 1D8ZA 3M8YA 4L76A 2G1HA 1FJ7A 1FT8A 3FGVA 2YKOA 1RCXB 2VQEJ 2BW2A 4NCGA 2WONA 2H48B 1T94A 1CS4B 3GR1A 2BMBA 1RHKB 2UVVA 2YNGA 4KV8B 4N47A 2Z4PA 3OR1B 1NK6A 1O51A 2OIHA 2V68A 2FJVA 1X31C 3MEEA 2Y8WA 4G3IA 1OYEA 2AW0A 3TJ8A 4LF8J 3E8OA 5L1JA 2RF2B 1WNEA 2F5GA 2PDAA 2GJ2A 3K59A 2MSTA 5GMDA 3GJTB 4MH8A 2V4JA 2GHPA 4OL8A 2BOAA 5KFXA 2LEAA 3OUYB 2VOPA 1IVZA 5F0UA 1EETB 5F0WA 3TZYA 3F73A 4MKVA 2ASDA 3K57A 1VQNS 1V3RA 1KS2A 4FPRA 3E01B 5IOLA 3DLLQ 2ZHAA 4V19X 1QAXA 1N4LA 4LRDA 4ZPAA 4PWWA 2M8DB 3UR0A 3EX7B 2HK3A 4YQWA 2OFHX 2HQFA 1YQHA 5EN1A 2OPSB 1IKVB 1B70B 1Y3JA 3GIRA 1F5AA 3ZTQA 1RBLA 1BQMA 3QWUA 2ZBQA 4DLGA 2BM0A 3EVMA 2AKWB 2YX7A 4I64A 1UVLA 4JI3J 1RWXB 4I2PA 4C8MA 1VQSA 3DC2A 3EXCX 2CJKA 1X4GA 4ZN3A 1VRUA 3A8KA 2F4VF 2MQQA 1Q82T 4W92B 1TELA 4FKYA 4ZP8A 1YJVA 4IH6A 4XO0A 2VJVA 4A8FA 2RMLA 1S9EB 3ILIA 1P6TA 1X4AA 2MJUA 4DV5J 1YI2S 4OFZA 2E1AA 4RW7B 2VB6A 4UTGA 4F50A 3CD6S 1L5UA 5IQ6A 5DGAA 4ECVA 5KG3A 4CCHA 3DOLB 4O23A 4ID5B 1RTJA 4FS1A 3MUTP 4DV7F 2FLOA 2DHAA 1S0OA 3NWGA 1VOMA 3TVKA 3MM9A 4D3HA 4ZLJA 5EHHA 3D0GE 3BR9A 2J9DA 3R27A 2V0NA 1QSLA 2MHEA 2HHXA 1L3VA 3NCQA 1U1NA 4ECSA 1NDCA 4L73A 3AJDA 4ZVUB 4PPZA 2UP1A 3BH6B 3GYXB 1RYSA 5D4OA 3O44A 1UW4A 3SYZA 5D3GB 3DLGA 4LBIA 3GV8B 1MSWD 3NAHA 1XC9A 5H1SV 3SDEB 1HHTP 3NS7B 3OTDA 4G1PA 3DXBA 2CPIA 2P5VA 5IZHA 2OMLA 4P52A 3JSBA 2BX6A 2QYGA 3CD7A 3B4DA 4XPEA 4PYDA 4I6YA 3AHPA 3D3BJ 4XPCA 1M5HA 1FK9B 1H2UX 4RW4A 5C7PA 4J9SA 3PCOB 3BKUA 1NPRA 4U7UK 3WIUA 4ZVTB 4MIWA 4DCOB 2HVZA 1FDDA 1U0SA 3M30B 4DCJB 5HL7Q 3AODA 2JDJA 3H5YA 4JBCA 5F41A 4K5SA 2W8LA 3Q8UA 2MHNA 3H2UB 1FWPA 3F41A 2XCAA 3CC4S 5DDPC 1JLAA 4CM0A 2CVEA 3D2WA 3PO5A 1MU2B 5T7LA 4C0OC 5HK4A 4MJKA 3W1YC 4TQSA 4MK7A 3BBCA 2HRUA 1TAUA 1H73A 1NSQA 2Z8QA 3IS9B 1FEEA 3BPDA 4KH0B 3MWBA 1NK5A 4AYBD 1JKHB 2ZM6F 1QE1A 4J9NA 4QQBA 1CULB 1KQFB 1PCAA 3Q86A 2BRLA 9ATCB 1RAHB 1UMJA 5KG7A 2DISA 1JIHA 1QTMA 3C15B 4P7VA 4WFAQ 4GMKA 4ZPVR 1RHJB 4URQU 3MFHA 3LF0A 4NLSA 1CG2A 2OPRA 5A8KA 2BJDA 4EUVA 3OJUA 3TR5A 1WI8A 2HAIA 5C42A 1YZ6A 1RDRA 4DG1A 4QCLA 2CJ9A 1AUDA 3ISZA 3H5SA 3SBMA 1RHMB 4OI0A 3RRHA 3A8IA 4IG3A 3QJJA 3RB6A 1RA7A 4LF7F 5B0GA 1FD8A 1N34J 2OPPA 4KIAA 2HYIB 5LSLA 3GYGA 1TL3B 1U1QA 4KE5A 4P73A 1LQ9A 2CPDA 2FZGB 3HT3A 4YB7A 3OTOF 1Y11A 1FXLA 4YY3J 2CPEA 1WF2A 2IYIA 1WG1A 1SUQA 2XO7A 2WBMA 3VF0B 2OKQA 3MUVP 3QGPA 1WEZA 1HNZF 2D3UA 4ED8A 4B02A 2LVWA 2RU3A 3SCLE 2PC6A 1HMVA 4FF3A 4CTAA 1Y4ZB 1FDBA 1JJ4A 3G8TA 2BRKA 1VQ8S 3RYLA 3GQCA 1FKAF 2F1FA 2M70A 1RK8A 3DRSB 1SXLA 1SC3B 4NZ6A 1VBKA 2DHHA 3OD2A 4V19J 3HSDA 1WDTA 4ED7A 2HFOA 4KHMA 1CJKA 2M9KA 3H2LA 3IBCB 5HJXA 3QT8A 1Q8KA 3V4IA 1XR5A 3NNAA 1U09A 4Q8FA 1OJ4A 2EC2A 3CPWR 3M8PA 3HD2A 5M2RA 4ED1A 2GZOA 4DV4J 4DI6A 3B78A 4NASA 5A2QU 4B9NA 1LWXA 3MR5A 3KLEB 5H9FJ 5JUMA 2RAQA 4Y0FA 3C3LA 3IMQJ 5LMNJ 2V2ZA 4C8NA 1YITS 4EMDA 3PO4A 2BJ9A 2XZTB 2QIFA 2MMYA 1I3OB 3QLHB 4JI8F 4YEAA 1REVB 2O5DA 2E5IA 2ZDPA 2FJEB 3GLJA 1YKWA 3CJRA 3J81Y 2R7SA 4X66F 4AQYF 4ZITA 4DR2F 4NI2A 2PFFB 2F65A 3AT1B 3GJSB 3POTA 3KXDA 4WFNQ 3OLBA 3K8VA 2DVIA 3C6UB 5DQHA 3QT7A 2DGUA 3CW2C 1R89A 1NPPA 2CG8A 3HSZA 4LREA 2CYYA 1ZM3A 1YBUA 3ZO7A 2HQDA 2H4WB 1YZ7A 4MKBA 2C2OB 1BXNA 3CB4A 1PIEA 2B9YA 2AHOB 1MROB 3DGPB 3RW6A 5KG1A 4RLEA 1ZTTA 4K4UA 4ILMA 4NEZA 9RUBA 1S1TA 4ZVOB 5KFIA 4TNOA 4DPTA 2HGLA 2VPXB 2IIHA 3H42A 3DOKB 2GS8A 2FY1A 5KFVA 1YHQS 2XB2D 3N5FA 4I1TA 1VIXA 5J2QA 2B4UA 2VG5A 3KKFA 1LOUA 4O3RA 4NMLA 2JL9A 4JV1A 4HDHA 3IWLA 2C1EB 2BKNA 2DJWA 3OR2B 2HQGA 2NXCA 4WJBA 5L8RC 1BWEA 1R7IA 1R0BG 5J2NA 4KRWA 4JYAF 4IRDA 1PJ7A 2JLEA 1ZM4A 2EXUA 3D0HE 4NXNJ 1UWBB 1S79A 1LWEA 1T05A 1PYSB 5D4LA 4QWBA 4GVLA 2VL1A 1J2VA 4L6V3 1Q53A 3QGGA 3A4TA 1FKPA 2BJ7A 4HEA9 1FFGB 2DNRA 3T5JA 4NA1A 1MNEA 4B3RJ 5B7WA 4F0KA 5KG0A 1N0VC 1U47A 1VC6A 4QIWD 4OX8A 3Q8PB 3MI7X 3TANA 2W25A 1VBYA 1XEZA 4IOAQ 2KYZA 4IQMA 4F36A 4RNMA 5FIIA 3NCPA 1AB8A 1G6BA 2V2VA 2D7SA 3MECA 2OFGX 2JLFA 4ECTA 1R8CA 1WELA 2W9BB 2LXUA 1Q81T 5HP1A 2XWYA 1QUVA 2K06A 4B9TA 5LL6d 4DQSA 4Q2LA 3GE9A 3RAMA 3CT9A 3KLIA 4X62J 1F9FA 4USTA 1KQSR 3W61A 7FDRA 2R7UA 2MQOA 2E7WA 2C22A 1WTFA 4PPDA 1BD6A 4USMA 2HSEB 4B9VA 2VFVA 3UN2A 1GAOA 2ERRA 5D78A 4C48A 3A1YG 1FWLA 3KWMA 3H5UA 2CVIA 2R7XA 4A8SA 1NB2A 3HCXA 3LA0A 1F60B 3CGIA 3W64A 3PHEA 2OTLS 4PR6A 1KTQA 2GIQA 4CLYA 1VQ4S 2XNRA 2V69A 3OLAA 3CD0A 5LM7E 3IAM9 4ZVRB 1S9GB 4F67A 3D67A 2X51A 3MEDB 1OMSA 3C14B 4FYXB 4ITSA 1SVDA 3HSGA 1F1BB 1NJIT 4GC6A 1JNRB 3M8QB 2E5JA 4JI1F 1CC7A 4ZJOA 3CC7S 4X64J 2BJ8A 1EP4B 2J6UA 1L3SA 2QJ3A 1EIYB 1FDNA 4J9MA 1VCTA 1YSJA 1AZSA 2ZKTA 2YTCA 3D7SB 1E6VB 3N79A 2CRLA 2HWTA 2V8DA 2VPWB 1WKJA 2E29A 2LKZA 1TR0A 1J5EF 4LFBJ 1QAJA 4C7QA 1TVRA 5IT4A 1IKYB 2IM2A 2GA7A 3MMAA 2JFKA 4F4KA 4BCAA 3UVJA 1MW7A 2F8EX 2N3OA 5J1PA 1HNXF 1D8YA 5HBMA 3LTOA 3QIPB 5KT7A 1HARA 4FBTA 2B7BB 3ZZOA 4BDPA 2HRYA 1OWXA 3TI0A 2MKJA 4K4SA 3M32B 3VV2B 1PKUA 4LQ3A 4DQPA 3ZTRA 1U48A 4KAIA 2P2CB 1SH3A 5KOXA 2IVMA 1UEKA 4F0MA 2BBEA 3FEZA 3X3UA 3OVAA 1NSPA 1TKZB 1VQ6S 1FESA 3AOCA 3JTPA 5H9FK 3VGUA 2VU5A 2HKEA 1IWGA 3TNVA 4FVMA 2NSCA 5DRKA 3HZGA 4B9MA 3PRBA 4C8YA 5GVQA 3ETOA 3MOZA 4OJ1A 3MUMP 2ZUAA 2WSFC 1A7GE 4F4WA 4ECQA 2KKHA 1RAIB 3SIPB 2M52A 2RQMA 2CPZA 2C3PA 5CYMB 3M2RB 1T11A 3HULA 3NGUA 2GVZB 2C2NA 1U1OA 2E44A 2PI4A 3NNHA 4KKOA 1UW9A 1LW2B 3G82B 1LW0A 1RWNB 1BC6A 1NB7A 3N9UC 5KFAA 5A0YB 1QAIA 5A76A 3TAPA 4C8LA 2EVZA 5CCLA 3UCUP 4ES1A 3CJQA 5CZVA 2QX0A 4MIBA 5J1NA 1HYSA 1RADB 2FVCA 4A47A 5DZ7A 2UXDF 2WOMA 3ZNJ1 2AJ2A 2LECA 3DI6B 4X4TA 2I2YA 2DTJA 1DTTA 5HJYA 4R8UB 1CJVB 1F2HA 4P10A 1SQGA 2KHDA 4G65A 4A8WA 4OV6A 3FBEA 3BM7A 3FRZA 3NBPB 4GKKJ 2NUUG 2IJRA 4TN2A 2XY5A 4C97A 3G6VA 1X5TA 2OD6A 2QFJA 3EZUA 1AFJA 2IM0A 1HIYA 1V6HA 3TW0A 3J7A1 5F8HA 3R1LA 2E1MC 3KK2B 2Y3YA 5ETOA 2DR9A 2VQFF 2VD3A 4MFBA 2CNOB 3I31A 2UV8G 1DLOB 4JI5J 3CCES 3NNCA 4J91A 4PCQA 3GONA 3MAAA 5EWGA 1MN9A 1Y3KA 3CF5Q 1RHRB 5HQMA 2KFZA 3VAKA 4YB5A 4F04B 3VAHA 3DYAA 1UVNA 3HHKA 4UT4A 4Z2XA 2V6AA 1WF0A 3UPFA 2QEXS 4HTIA 2FB0A 3I6PA 4ZPBA 4O3PA 4UOFA 2RHQB 4ZHRA 1RAFB 1WHYA 3PRDA 3BQ1A 4BS2A 1HBNB 2QA2A 3TQ1A 1NZ8A 1IBMF 2HGNA 1N36F 2R8GA 3D54A 2AT1B 5DETA 3FZ2A 3TQEA 1HW8A 2PA8D 2QN6B 1DQ8A 3L09A 4LSZB 5DQIA 2CQ1A 5C25B 3H5XA 5HATA 4EYHB 1IXKA 1S6OA 1RWOB 1TKXA 4M5MA 1PILA 5HI7A 1XWLA 3ILLA 1LWFB 3UN5A 4YMEA 4O0IA 1DBDA 1FCAA 3F44A 2V8PA 2XZWA 5AJ3F 2ASLA 2KJWA 4ZPCA 3VGVA 1WF1A 1FKOA 4ZCMA 2R7QA 2EFPA 2WW4A 1T3NA 4IOCQ 3KJFB 4OZ0A 4QYZK 3B8HA 4S0MA 2ZHBA 3PW0A 4DR6J 4TKTA 5CA5A 4NYZA 1HBUB 5ETTA 2V4RA 2QG9B 4NX9A 2L48A 4F2SA 2DGWA 1WKKA 2WSEC 3BV8A 3CCRS 1WC0A 3CTRA 3HFVA 4KHRA 3MM8B 3MR7A 4CO3A 4P6QA 2RKIB 5F3TA 2ZBCA 1KOHA 5JJBA 2BABA 1JLGB 1RAOA 3BB5A 5L1KA 2DR5A 2N3LA 1VHIA 3ZZPA 1FRKA 4M63A 2ILYA 1K1SA 1U8SA 4LF4J 4O3OA 1Y7PA 2DNPA 1M0SA 2OUGA 2L9WA 5CYJA 4OI2A 1N32J 2AYBA 2WVDA 2DNZA 5D8HB 4U95A 1JXEA 1UPPA 1FFSB 4C3KA 1TK5A 2U2FA 2BE2A 3HVTA 2DNNA 4FYWB 3TJAA 2F4FA 2I0XA 2DY1A 2GHVC 4Y2IA 4OV1A 2NXUA 1RHUB 3TEHB 4DU7A 2MKCA 3Q83A 3JQMA 1N33J 2ZDOA 3D1OA 4WFZA 2VF3A 2NLWA 5A6PA 3TAMB 3OFFA 4C2MA 2E7VA 3ENAA 1KLNA 3QO9B 4QW8A 1JLEB 3K2YA 2AP6A 2WW8A 1S1XA 2HIYA 3GR0A 1U49A 3EVWA 1VGYA 4ZCLA 4I2QB 3PR4A 2EBEA 1Q8BA 4M5DB 5KFPA 1WWHA 3I0SB 2AD9A 4HI1A 1NK8A 1DQAA 4ENOA 2QZ8A 2D9OA 3JTNA 4UUXA 1VQ9S 3IR7B 3I32A 3QJLA 3THPA 3PJ9A 2POKA 1KBRA 5KFNA 4X4OA 2QE5A 2B6AA 4B3MF 1YRUA 1VRQC 3HXMA 5A8RA 4DFMA 3E51A 1CC8A 3MDFA 3ENQA 2YPZA 1S97A 2GAGC 3JXOA 2WB4A 4RW9A 3JTOA 2ZE2A 4DSLA 3LP1B 2RSQA 2RDJA 1DRZA 3QQCD 1MMDA 8ATCB 2YXLA 2O66A 2X3DA 3OPKA 4DV3J 3KUGA 3ZFVA 4DR1F 3KG1A 2IYGA 2EFVA 4BC9A 2I9SA 2ZBRA 1RP5A 3TUJC 2IVFB 1ZPWX 3BGOP 5K8OA 1UZDA 3OTOJ 3WC0A 3PYGA 3W65A 3QBCA 2YNIA 3IWNC 2HHHJ 4X65F 4DPYA 3CCSS 2JX2A 3AB2B 2JVRA 1H98A 2HFUA 1Q79A 4NXMF 1G2EA 4WWSA 3W2WA 2EFQA 5EGYA 1P9QC 4ER8A 4QU7A 1S57A 4NLOA 4CH1A 1X5PA 3RGIA 3M8ZA 3H40A 4JI2F 5DDOC 1LK7A 1W25A 4RX6A 3EGZA 1HBMA 4WTYA 1JLBB 1RTIA 2E5LF 1RT4A 1F3VA 1V5IB 2RIJA 5KT3A 1BGXT 1FJGJ 2BKOA 2GQQA 3JAMY 4RWWA 2E66A 3HVWA 1RSCA 5K8NA 1ZH5A 2PI5A 3VTIA 1UWAA 2B4VA 4I7FA 2OJ3A 3KMQA 4EGLA 4O44B 3GTYX 4QIFA 5KFZA 4FVCA 1K44A 2YNHA 4FYYB 5HVFA 4J37A 4QIGA 2HHSA 2WVFA 5CXTA 3WQPA 3W63A 1NSAA 1YTYA 4LSLB 1EKSA 3P4UB 4RBTA 1LWCB 2VQEF 2DGTA 1ZOTA 5D4NA 3CCLS 2BDPA 1NJXA 4N76A 2CAJA 4X66J 1ITPA 4PZVA 5SZTA 3D1HA 3ILOA 4RW8B 2J7KA 2HBZB 1HI1A 3HZEA 2FUG9 2AV5A 1X7VA 2IAJB 2L9NA 3KLVA 3DMJA 4LF8F 2PE8A 1YVFA 1LV5A 2N82B 3IFEA 1Q16B 1RI7A 3V6DA 3I0RA 1RT1A 4IR9A 2IRXA 2BW7A 4DFKA 5U47A 3KHHA 1TL5A 4ZP6A 3KTQA 1J5OB 1FO1A 4ANCA 2ACYA 4Y00A 3NCRA 5FDLA 2N4CA 3S01A 4DFPA 4H4OA 4DU8A 1ZBTA 3FK4A 3GMGA 4ANEA 1P9YA 1U0HA 2WCXA 2GAHC 2ZH4A 1UEUA 2DGXA 4AUKA 6AT1B 2PA3A 3BGRA 3IXQA 4ZIVA 4ZJLA 3R5JB 2HNDB 2DITA 3BQ2A 3KG0A 3G4SS 2ZH3A 2QFIA 2WAQD 4XDCA 3U7JA 1RGVA 2PT0A 2VC0A 1UFWA 4LF5J 1SH2A 2OI2A 3BSNA 4JI3F 2GO8A 1GMVA 4Y2KA 1LFPA 1S77D 2GQCA 2J9CA 5LSRA 2CPXA 5CZXA 4I6WA 2EK6A 4FP9A 3KLHB 3UQSA 2H9ZA 4URSA 5FLXY 2ZZNA 2ALZA 5B0DA 1Z1ZA 2L9DA 1REGX 2H51B 1CS4A 3IGVA 3DDIA 2WBRA 4X4QA 4J9OA 4DV5F 2V67A 2LDYA 5HAOA 4KV8A 4LR7A 5D0EA 2AGPA 1NUEA 4TY8B 3OR1A 4Z7CA 1QUPA 4UY85 1S0VA 2FY8A 1G7CB 1SKWA 2W4PA 5HO4A 2PD1A 4DL3A 4KY3A 2ZC4A 3A13A 3FEYB 2OH2A 2XMTA 2R2RA 5D0RA 2HVEA 3AOBA 3DOMB 2NXNA 1HNVA 1UKUA 3OFEA 5BXIA 3DLKA 3LO3A 2JEIA 3NMRA 1EETA 3DDNA 4J9UE 5DLGA 5FLXU 3B4MA 1N88A 2XHWA 1AYEA 2I1RA 2W1BA 3SZ2A 1S72S 2IMOA 3E01A 1XIQA 2VDIA 1TUGB 1Z2LA 2XMWA 3H7HB 2CQ0A 4X4NA 4K8RA 3NP5A 3SSRA 4CZCA 2AEJA 3ADAC 3R9LA 1WSVA 3WDOA 2H5EA 2ZKUA 4RUAA 5HMXA 4KGZB 2E1PA 4K0KJ 4NLTA 4FF2A 1JLQB 2CQBA 2OPSA 2ALYB 3NWRA 4ELVA 2R3VA 3L95X 4MYUA 3T1HJ 2QL5B 4NLGA 3MPUB 1HR0J 2MKIA 3BF4A 3DXSX 3IG1B 2CADA 1Q0NA 2VA3A 3PG9A 2MLXA 2VG6A 3CCJS 4PQUB 1UCNA 3SQOP 1AFIA 3DLEB 4KTQA 2RB7A 3LP0B 2FVQA 1LKZA 1T3OA 2B8QA 3MAQA 1EB0A 1SB6A 1S9EA 1URNA 2AJFE 2HFNA 4JI4J 2GHWA 3A8JA 4DUYJ 3CNQP 5AXKA 3PDNA 4LSNA 4RW7A 2R7VA 3ZZZA 1S6PB 4QPTA 2DR6A 3VZIA 4TLQA 4XK8C 4NCBA 2GVDA 3NS6A 3WIVA 1TK8A 2DXDA 4DUTA 4M5GA 2XMKA 4BBYA 2M8HA 1C0TB 3DOLA 1ZA2B 1ZS6A 4YB1P 1DJ0A 3PZPA 4LF9J 1UTAA 5ADZA 1DURA 2CPJA 2VA2A 3G86A 2V2KA 3Q89A 3RAQA 4NCGB 2WONB 3KYLA 3CULA 2GIFA 1S6UA 3R5AA 4Y3CA 2ZH7A 1SKRA 3ZZTA 2DH8A 3MFIA 2PEHA 2YNGB 3PVXA 4K4TA 1BHNA 2V63A 5IWAJ 2IA0A 2EI5A 5DZ6A 3MM6B 3M8SA 4ZJQA 4HTJA 3GG1A 1WG5A 2K7KA 2HMIB 5D3GA 4DV1J 1HNWJ 1YJUA 4P74A 3Q8VA 2AEMA 1NBEB 4PYAA 4DV0J 4TQRA 4ILRA 4JUZA 3SDEA 4DX5A 3RB3A 4RW6B 2M88A 3CJKA 2V4JB 4HH1A 3BGLA 1U2CA 1R6YA 2A2DA 2C3OA 4ZOSA 5AE3A 1UJ5A 1RU2A 4FZVA 4TYBA 4DSIA 2C2KB 4WYLA 2CPFA 4QZVB 1TU0B 4A4JA 1OPZA 4J9KA 5GMEA 4C3MA 5I3UB 2XLJA 3HJFA 1HNIB 1Y10A 3ZTSA 5EX0A 1N34F 1SJFA 1NJWA 4FF4A 2I38A 2HWIA 3UN3A 2IHR1 3S8SA 2UV8A 3H8YA 3GG0A 2CNLB 2D3ZA 3IC1A
chains in the Genus database with same CATH topology
2E7VA 1IVZA 2ACMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7V A;  1IVZ A;  2ACM A; 
#chains in the Genus database with same CATH topology
 2JJ4 D;  4IFY B;  2QV6 A;  4YY3 F;  3KNG A;  2DNK A;  2AIR B;  3NGS A;  1KR4 A;  1H7X A;  5H9E J;  4NLV A;  1GH8 A;  4WP3 A;  1V9O A;  2MZ1 A;  2M0G B;  2ZFH A;  4I2P B;  2CQD A;  1VRU B;  4EZ6 A;  2KFN A;  3E2E A;  4OHY A;  8AT1 B;  2C2E A;  4WFX A;  1SKS A;  5E3C A;  2ZNZ A;  1X0P A;  3QRR A;  3DLB A;  2EPI A;  3T5K A;  5CHC B;  1W26 A;  3IS9 A;  5DQG A;  3NRB A;  2XBP A;  4CRJ A;  1JKH A;  2VFS A;  3VAM A;  2FGO A;  4AL7 A;  3AFG A;  3T19 A;  3ZTP A;  2KI2 A;  2R42 A;  4DV4 F;  3P49 B;  2QMX A;  2J0X A;  4Q8E A;  4ZLN A;  2Z56 B;  4EU0 A;  4OZN A;  3PYF A;  4DF4 A;  3MM9 B;  4MKA A;  1IQT A;  5DS7 A;  1M5O C;  3P96 A;  3W2V B;  6FDR A;  1R3N A;  3ENV A;  4GVB B;  4M5J A;  2HHW A;  2GGP B;  2OEJ A;  2QSW A;  2ZZM A;  2HLU A;  1NAQ A;  1SBR A;  3O2I A;  4EBD A;  4CI0 B;  2UUB J;  5KFE A;  1FNO A;  2F7V A;  1X4H A;  2UUC J;  1O5J A;  4USK A;  2IC3 B;  3DLG B;  1TL3 A;  2NRE A;  2KL8 A;  3LPY A;  3L4B C;  4UUW A;  1WOR A;  1XER A;  3M8R A;  4G1Q A;  2FC9 A;  2RD5 C;  1H0H B;  2ZH8 A;  3R1H A;  2AX1 A;  2OAU A;  4DX8 H;  1S5Z A;  2FZC B;  2J8S A;  4XAK A;  1KD1 T;  4P75 A;  1NLK L;  3PIP Q;  1VQL S;  4FNI A;  4ZVF A;  1T9V A;  1FRL A;  1U6B A;  3H25 A;  4RBU A;  2O1P A;  4X4R A;  3TAQ A;  2Q43 A;  4J9P A;  3CCZ A;  1R0A B;  4EO6 A;  4PWU A;  1PJ6 A;  1N54 B;  3IGN A;  4U7C A;  1VS3 A;  3DRP A;  4ZPT R;  4AD6 A;  1VC5 A;  3EM1 A;  2DH9 A;  4K4X A;  1H38 A;  2OEK A;  1RT2 B;  5HSP A;  5CYQ B;  2DXE A;  2RH3 A;  1XR7 A;  1JLA B;  4OZ1 A;  4NEY A;  2KHC A;  4WIQ A;  2M3D A;  3I4H X;  2EG2 A;  4JI0 J;  5BYS A;  3OSN A;  1N52 B;  3GIJ A;  4OYB A;  2XHC A;  2ZBI A;  3T5L A;  5KFY A;  4UW2 A;  2D74 B;  3D66 A;  3N5B A;  3PW7 A;  2Y0B B;  4NXN F;  3NMA A;  3O5T B;  4QU6 A;  1VHF A;  1YRX A;  2CPH A;  4HR2 A;  4PXE A;  2Q79 A;  1REV A;  2JHE A;  1QE1 B;  5E0O A;  2YKP A;  1ZZF A;  3TEG A;  2XCP A;  1OS5 A;  2XWX A;  4B3R F;  2Q1L A;  5A8K B;  4YHH J;  2EEY A;  3PFE A;  1LNQ A;  3C6U A;  2DGO A;  1ZM2 A;  2V94 A;  4GKJ J;  5C42 B;  2HQI A;  4DG1 B;  3FKB A;  2DNQ A;  3HLU A;  3NGT A;  4KB7 A;  3AQO A;  3QAE A;  4KT0 C;  1T95 A;  3AQP A;  4N8O A;  2IJF A;  1T9W A;  4YDX A;  3SQG A;  3R5B A;  1XNR J;  4OQJ A;  1LXN A;  1MMN A;  3JSM A;  4X62 F;  2RS8 A;  1MRO A;  2H5J B;  2VJU A;  3GJR B;  2KH9 A;  2ZNY A;  2HVH A;  8RUC A;  4LIR A;  3OL7 A;  3HP6 A;  3DOK A;  1DY3 A;  1U2R A;  1NK4 A;  1SUQ B;  4ELT A;  1P27 B;  4F8R A;  3MHY A;  2FLN A;  2MY7 A;  3BRE A;  2AU0 A;  4OHW A;  3OR2 A;  4MYT A;  1HMV B;  4CTA B;  1OY6 A;  2CQ3 A;  1GXL A;  1UEV A;  1KQK A;  2YKA A;  2CZ4 A;  2W9C B;  3G8S A;  1B7F A;  2C2M B;  2JEJ A;  1Z2Z A;  2CUY A;  1W2B R;  4CLP A;  1CJK B;  3WBZ A;  3HHL D;  1IBL J;  3M8P B;  4X84 A;  3IP0 A;  3NOC A;  4FN5 A;  3D5M A;  4X64 F;  1FRH A;  1B64 A;  1OY8 A;  2MEW A;  3VAJ A;  1L3U A;  2DNO A;  2MZQ A;  2XYP B;  4JB8 B;  1FNX H;  1R43 A;  3GU0 A;  1SJ1 A;  4WYW A;  4PG6 A;  4LFB F;  3N28 A;  1S4E A;  5I3Q A;  3CE8 A;  3QNW B;  2EFG A;  4UY8 T;  2P6S A;  5GAG I;  3BEG B;  2DNY A;  1GTE A;  5E7O B;  2R8H A;  1HWJ A;  2IDE A;  3DDK A;  5KG6 A;  4U8Y A;  3QAU A;  1GEH A;  1CSJ A;  2NPF A;  1SJR A;  1BQN B;  2UXB J;  1EJ7 L;  2EKN A;  2R8J A;  3EPG A;  2LEP A;  2AJ0 A;  3I56 S;  2DIU A;  3QPI A;  3GFZ A;  1FI4 A;  1NSK L;  3I5A A;  4XTT A;  2DBB A;  4OI3 A;  2A3J A;  2W2N P;  1EQM A;  3FEX B;  4ZPW R;  3F0N A;  3RBZ A;  3O1L A;  4KGK A;  2FQQ B;  1TK0 A;  1KDN A;  2G1D A;  1NU4 A;  1C0U A;  2X1G A;  2HHV A;  4F0H A;  3FBF A;  3UCG A;  2WZ1 A;  3LGM A;  1ZYQ A;  2VBW A;  3D6M B;  3WZ0 A;  3DFE A;  2DO0 A;  1WTB A;  3FFI B;  2XTJ P;  4IH7 A;  5ETN A;  1OSD A;  1FFW B;  4ES3 A;  1S9G A;  1HBO B;  3MED A;  4ERD A;  5IM0 B;  2IRY A;  5KFR A;  3ONQ A;  2YQ0 A;  3Q2S C;  2CJY B;  5KAK A;  5I42 B;  5HVG A;  3DLH A;  4DMZ A;  1HKA A;  3UD4 P;  2IVY A;  4RNO A;  4LR9 A;  3UNY A;  3IRX A;  4CLT A;  1TFY A;  3D6F B;  5J2Q B;  1KFS A;  2VG5 B;  4AE5 A;  1R8B A;  4WZM A;  4K5R A;  2D1C A;  4CH7 A;  2CQC A;  1EP4 A;  3MM7 A;  1PC5 A;  3TA0 A;  2MLY A;  4LFC J;  5KFG A;  3DU6 A;  3PW2 A;  1IBC B;  5KFO A;  2AJQ A;  2HNZ B;  1VBZ A;  3M9O B;  3UDC A;  1T05 B;  1LWE B;  4A46 A;  2LU2 A;  1PG5 B;  1IKY A;  2AZ1 A;  2KG1 A;  4I6A A;  1PBU A;  1JLC B;  1Q95 G;  2P9C A;  4P2M A;  1FKP B;  3UW1 A;  3AA9 A;  1XR6 A;  2VPY B;  1BQX A;  4U7U D;  3N6L A;  4DOZ A;  1KEK A;  1KLM B;  1U24 A;  3HDS A;  2A18 A;  1QD1 A;  4CO4 A;  2MZR A;  1Y9O A;  4AND A;  1TL4 A;  2J9E A;  2GJF A;  4F3O A;  2QLW A;  3DLJ A;  4GKK F;  4Y65 A;  3GFY A;  3IR5 B;  2PGC A;  1CQM A;  3MPV A;  2AF6 A;  2IFX A;  4U96 A;  1TUW A;  3ICL A;  3M2U B;  3MEK A;  5HP1 B;  2OHD A;  3CCV S;  1TKZ A;  1RWW B;  4LF2 A;  1XMO J;  2ZH9 A;  2J9D E;  1RWM B;  4K4W A;  3KLI B;  4OX7 A;  4IFV A;  3G9C A;  4E98 A;  1UVJ A;  4JI5 F;  2YWW A;  4M8L A;  1H3D A;  2YX1 A;  1YLX A;  1TV6 B;  1KSP A;  3EJM A;  1X4E A;  3TA1 A;  2DHG A;  3EZ5 A;  2W2P P;  4QPX A;  4C11 A;  1YJR A;  3O3L A;  1BWV A;  4HL9 A;  2GO9 A;  4FYD A;  1RT5 B;  3HX9 A;  4LFA J;  1NRK A;  3LPE A;  4ZKA A;  5CYM A;  5DM6 Q;  1TL7 B;  3KK1 B;  3MZI A;  4JV0 A;  2GVZ A;  5B09 A;  2GX8 A;  1EX8 A;  1LEO A;  1D9F A;  4RU2 A;  4B3O B;  3VGT A;  4F26 A;  3G82 A;  4NA3 A;  5ETS A;  1TKD A;  2UUW A;  5A0Y A;  1QJH A;  4ZPD A;  3UDL A;  2N7Y A;  1RAG B;  2SXL A;  1R8P A;  4TLR A;  3TZW A;  2Z0G A;  4WII A;  2DEI A;  3BPS P;  3BO3 A;  2CNK B;  2COL A;  3SCJ E;  3V4M A;  2Y1I A;  2HVD A;  4YP3 A;  2XMA A;  1F5C A;  1RWV B;  1GXT A;  2HS0 A;  1CJV A;  4OLP A;  4I69 A;  1FX4 A;  2HLT A;  2YKM A;  2DKO B;  1V3S A;  2B4P A;  4WFY A;  1X9S A;  1HD0 A;  2H54 B;  4O4G A;  1UAW A;  2PO4 A;  3RR7 A;  4JV5 J;  2DH7 A;  2F63 A;  1U1M A;  3BO2 A;  3K5O A;  2B9X A;  4KGM A;  2LQ5 A;  1HI8 A;  4DR6 F;  1Q7Y T;  3KK2 A;  2YBV A;  1IKW B;  5HBM B;  2W4D A;  1DLO A;  2HQC A;  3IAS 9;  2ASJ A;  4DV6 J;  4FF1 A;  1U4B A;  4NYP A;  5JVG Q;  4BLG A;  2QYC A;  4ED4 A;  2W2O P;  2X1F A;  2B5J A;  2FHO B;  4HDG A;  1CVJ A;  4WKY A;  3CMQ A;  2A10 A;  4R5P A;  5E41 A;  4KHP J;  2V2Q A;  3OTE A;  2PSZ A;  3PX4 A;  2VPZ B;  3QGH A;  1WC6 A;  2HNY B;  3OW2 R;  1R0C B;  1G1X A;  4KSE B;  4C98 A;  3LAL A;  1P1T A;  2XO6 A;  4QBU A;  4LF4 F;  2DIV A;  2LQB A;  1RT3 B;  2BAN A;  3FCH A;  1HBN A;  1C2P A;  2VC1 A;  1M5S A;  4CQ1 A;  4OYX A;  2R2T A;  2VOD A;  1N32 F;  1IJF B;  3J7A N;  3PR5 B;  4U9R A;  4PQA A;  5L9X A;  3CCQ S;  1X4B A;  3C2P A;  2GNK A;  5KFB A;  1TQL A;  4OHZ A;  5C25 A;  2G0J A;  3B82 A;  4PG7 A;  4Y2M A;  3RAX A;  1KC8 T;  1MML A;  2FD2 A;  1ICE B;  4K59 A;  2YNF A;  1Q4R A;  5B0F A;  2UUT A;  1LWF A;  2DPI A;  3RU0 A;  1N33 F;  4USJ C;  3DM2 B;  4K2X A;  1P1L A;  1BLU A;  2JRS A;  3U1M A;  5JMN A;  1VQY A;  1A6L A;  1CJU B;  2JVO A;  3GFX A;  2Z2Z A;  4ALZ A;  3M2V A;  2P9E A;  2DRD A;  2B0G A;  3CO9 A;  2HAF A;  3I87 A;  4N77 A;  2C2D A;  2MTL A;  4DL4 A;  3OQ2 A;  1HBU A;  1HYS B;  3HHL A;  3KJQ B;  2QMW A;  5KFC A;  2DCU B;  3BH7 B;  2BM1 A;  2RHS B;  2ZJR Q;  5L39 A;  2U1A A;  2C28 A;  1DTT B;  1XMQ J;  2JEF A;  1HWI A;  1SL1 A;  7AT1 B;  4G1I A;  5F9L A;  2NQP A;  1WDD A;  3GZ7 A;  2FDN A;  2CQH A;  2OLW A;  2RKI A;  3PV8 A;  1S0N A;  4LT6 A;  2DCL A;  2LLZ A;  3M1V A;  4RU9 A;  3QJP A;  3DKD A;  2HIQ A;  4DV3 F;  2ZH2 A;  1CLF A;  2K7J A;  1RCO B;  5GAG U;  2W4C A;  2FVP A;  2P6T A;  4MFB B;  3JSY A;  2YKN B;  3R7N B;  1J27 A;  1JX4 A;  1V3Z A;  1SQF A;  2XEX A;  2W2Q P;  3HM9 A;  1VJW A;  1LFW A;  4JI6 J;  4ECU A;  1IKX B;  5HLF B;  2E9R X;  2MZJ A;  2XYG B;  3BYP A;  2HHH F;  3L9Z A;  3AAW B;  1U8W A;  2K2P A;  3OJS A;  3ZC4 A;  1UVI A;  3UE2 A;  1NDL A;  4U6P A;  3KHR A;  3TAM A;  1FVS A;  3MR3 A;  2J0W A;  2MGZ A;  4WK1 A;  4DF8 A;  3H20 A;  3QO9 A;  4PWD A;  4JOU A;  3TUP A;  4PG5 A;  4UZC A;  3TYT A;  3D6T B;  1KRP A;  5J2M B;  2X3G A;  4EWT A;  1VQO S;  4NLW A;  4KR0 B;  4OHX A;  2GC8 A;  1SC1 B;  4I2Q A;  4OZ5 A;  1NKC A;  4DR3 J;  3KNA A;  3I0S A;  5E3Q A;  1CPZ A;  4F3M A;  1TKX B;  1NND A;  2CQ2 A;  2XMM A;  2DNL A;  4QR2 A;  2AGO A;  5LJ5 Y;  4YR3 A;  5C24 A;  3PW4 A;  1FJG F;  4RNF A;  1U1L A;  3M6V A;  5KFQ A;  1Y00 A;  4DL7 A;  1RWU A;  3MD3 A;  4HHJ A;  1HWL A;  1B99 A;  4NLX A;  1FKO B;  4NMX A;  3C66 A;  4F3Q A;  4N7T A;  3L7O A;  2ATC B;  3LP1 A;  3M6W A;  4J90 A;  1RJJ A;  2R7O A;  3LWL A;  4A8K A;  3JQJ A;  2G4B A;  5KFF A;  1RTH A;  4NLR A;  4WTO B;  1RTD B;  5BYR A;  2HS3 A;  2W7O A;  1VK8 A;  1NM2 A;  2BEF A;  5K5M A;  1VR6 A;  4OJ3 A;  2BE9 B;  4PXC A;  1GMW D;  1MWZ A;  3UDV A;  4EK2 A;  2VZ9 A;  2H4Y B;  5THW A;  4NLU A;  2M4M A;  1DZ5 A;  4YN3 B;  4HLB A;  1UFK A;  2CDQ A;  4KFB A;  4ETZ A;  1N5V A;  2HZC A;  1WOO A;  3MMC A;  4ZS6 A;  1N5S A;  4YR2 A;  4P72 A;  2Z58 B;  2PII A;  1T9T A;  3VAF A;  2HWH A;  1HHS A;  2VBZ A;  1D3W A;  1FWK A;  1RHQ B;  3BBB A;  2A1B A;  5GMK a;  5KFJ A;  2KVQ E;  1WHW A;  4CH0 S;  2J5A A;  4ZMM A;  3FMB A;  4OX9 J;  1T0T V;  4UQT A;  3OXG A;  2XNQ A;  1SH0 A;  1IQZ A;  2Y1L B;  3KLG A;  2BE2 B;  3HVT B;  3UNG C;  5ETK A;  3M8W A;  5KFD A;  2LQ8 A;  3J81 U;  2VIH A;  1JLB A;  2V8G A;  4K4V A;  2QRR A;  3AXM A;  4MIA A;  1F9E B;  4DUZ J;  1TL1 A;  1SJ4 P;  4PAB A;  2F40 A;  2ZD1 A;  3HO1 A;  3KDN A;  1NZA A;  4USV A;  2O3D A;  3W8P A;  3W5Z A;  2MKK A;  1WOS A;  4LF5 F;  4CO1 A;  1FRM A;  2FPH X;  5IV3 A;  1ARO P;  3HVA A;  5DG9 A;  4XIU A;  4FDF A;  1WKL A;  4O3S A;  1UA1 A;  2EFN A;  2WVC A;  2QLF B;  2AWZ A;  1D9A A;  3AY0 A;  1LWC A;  3PEJ A;  4B3S J;  4WE1 B;  2BXJ A;  4GC7 A;  2KT3 A;  5A8R B;  2VFR A;  2MQL A;  1HD1 A;  2BAC A;  3F56 A;  4Q0B B;  4WBF A;  3LGH A;  4RW9 B;  3BYR A;  2XS7 A;  3FDS A;  1YRT A;  2IAJ A;  1QM9 A;  5KFS A;  1UFL A;  2K1R B;  2DT9 A;  2W01 A;  4LF1 A;  1QLN A;  1TUV A;  5ETM A;  4DPX A;  5E2Q A;  5KOW A;  1X0F A;  1HPZ A;  3DRX A;  2YY3 A;  1NK0 A;  5J1E A;  2MQM A;  2V34 A;  3THV A;  4KPY A;  4CNY A;  4MK9 A;  3CDA A;  4F4Z A;  2Y0S D;  3K89 A;  5I4M A;  4ZP9 A;  1KHW A;  3BN7 A;  4K2J A;  1UP1 A;  1YJT A;  4RWX A;  3HF5 A;  4Y2C A;  2G2O A;  2HK2 A;  2E7X A;  3BJY A;  4K0K F;  4KPC A;  2HND A;  1ACM B;  1RAC B;  4OX6 A;  2ZBP A;  3T1H F;  1M1H A;  2VAS A;  3W2W B;  2VFU A;  4A8O A;  1HR0 F;  3IN5 A;  3GP9 A;  1SC6 A;  4Q44 A;  2QGF B;  1N48 A;  2DNH A;  4LVO P;  5L1L A;  1HA1 A;  3HHL C;  4EBC A;  3R2D J;  5KFW A;  2N7C A;  3LUY A;  4O4R A;  2ABY A;  1RWK B;  3R5C A;  3EYZ A;  1VFJ A;  3KLH A;  3MUR P;  1YBA A;  1RT4 B;  2XG8 A;  1XTZ A;  2HW3 A;  4JI4 F;  1HQU B;  4DUY F;  3VQS A;  1HQE B;  3IO1 A;  3V81 A;  4X4S A;  3VVU A;  2G13 A;  3GII A;  5B0C A;  4DEZ A;  1BE4 A;  2I8E A;  1N6Q A;  3LGN A;  3H59 A;  4IO9 Q;  1JNZ B;  4CLU A;  3IR6 B;  2YNH B;  3VCD A;  3GJQ B;  3KMS A;  4CP5 A;  3KFW X;  1S0M A;  4ZVS B;  1H72 C;  4HAC B;  4LF9 F;  3DOM A;  1PAE X;  4OYZ A;  3HKZ D;  3OL8 A;  1N5Y A;  5L9N A;  3SXL A;  3OTB A;  1IJE B;  3A8E A;  2BVZ A;  2WHO A;  1U6Z A;  3C46 A;  2KM8 C;  1OY9 A;  2PMH A;  4QWC A;  3Q24 A;  4L3K A;  2MY8 A;  3M7V A;  5IWA F;  4EYI B;  2WRM A;  3NG8 A;  4DR7 J;  4DV1 F;  3QZ8 A;  4N41 A;  1HNW F;  1OSC A;  5K20 B;  2VG7 B;  4DV0 F;  3CIZ A;  5ETL A;  1RQ0 A;  1U26 A;  4C0H A;  3GWC A;  1FF2 A;  1JLQ A;  3Q0A A;  1RT1 B;  4OIX A;  1F9H A;  5K14 B;  1K0V A;  4RNN A;  4L72 B;  4C0B A;  2Y8Y A;  3EGW B;  2XLI A;  3K17 A;  3SI8 A;  3CDW A;  1NDP A;  5GAD I;  1C4C A;  2EW9 A;  3IG1 A;  2HHU A;  3H90 A;  5FDL B;  4PQU A;  5LOQ A;  3GCW P;  4AFF A;  5D0G A;  3DLE A;  4ED0 A;  2CG4 A;  1MWQ A;  4EEY A;  5KG5 A;  4MAK A;  1YJW S;  2FLL A;  4YFU A;  3IBF B;  1Q1K A;  4ICL B;  4U8V A;  2DGV A;  4V1A k;  1KNZ A;  1DTQ A;  3MCN A;  2NSB A;  4Q43 A;  1TMJ A;  4AXJ A;  3OV7 A;  1C0T A;  2CZV C;  2PN6 A;  4HI2 A;  1F6T A;  2YWG A;  3R5G A;  4IR1 A;  3KK3 A;  3L3C A;  1K47 A;  5F3Z A;  1RKI A;  2KFY A;  4IDK B;  2RU9 A;  1B0P A;  3DRY A;  3C16 B;  5DGB A;  4ETX A;  3VVT A;  1PSD A;  3TX8 A;  1X4D A;  3CCM S;  1R6V A;  3MM6 A;  5AE1 A;  3PKY A;  2HVI A;  2MZS A;  2HMI A;  1SV5 A;  2XI3 A;  2DYA A;  2G2Y A;  4CLL A;  3UR3 C;  4RW6 A;  3A12 A;  1HNV B;  1MG7 A;  3CJ4 A;  2AEF A;  3Q2T C;  3MMJ A;  2YKQ A;  4TYA A;  4FS2 A;  3DLK B;  2APO A;  1PJ5 A;  2IM1 A;  1M5V C;  4USI A;  2PEB A;  2EG1 A;  3AA8 A;  5GAE I;  1U1K A;  1EZZ B;  1RT7 A;  3MPD A;  5I3U A;  4Y6I A;  1HNI A;  3B54 A;  2UUB F;  1GMW A;  3FZB A;  3D6H B;  3BR8 A;  2DRA A;  2UUC F;  4J9Q A;  1IR0 A;  4DL2 A;  2ILZ A;  5F8G A;  3FMW A;  3V5R A;  6FD1 A;  2AYE A;  2UUA J;  4IFY A;  2MKY A;  1JJ2 R;  1HL6 A;  2RE1 A;  3QFW A;  2H3E B;  5K8P A;  2BV3 A;  4RL1 A;  1FA0 A;  4DDF A;  3HKW A;  2VG6 B;  3V6J A;  1F2G A;  4GO7 X;  4BHQ A;  4TY9 A;  5ETP A;  1QVF R;  1WC4 A;  4C8O A;  3FNN A;  2UVU A;  1NK7 A;  3JYT B;  2YH1 A;  3B6B A;  1RAJ A;  1G3O A;  1X8D A;  3J80 Y;  2VIC A;  1E6Y A;  2F8M A;  2MSS A;  1YJN S;  4G6V B;  4UOC A;  4NWB A;  4PUO A;  1Q5V A;  3GYN A;  2XSF A;  3MOJ B;  4LSN B;  2IBK A;  2KZZ A;  2FJX A;  1TTH B;  2MPU A;  2GVD B;  1B7Y B;  1WHV A;  3BQ0 A;  3D28 A;  5CAB A;  1VIS A;  2RVJ A;  2NYI A;  4JI0 F;  4USU A;  5HMW A;  1RBA A;  5HRO A;  4O0N A;  5T14 A;  5G0R A;  3RRK A;  5HN0 A;  1C1C A;  3FC9 A;  5JVH Q;  1X5O A;  4CDI A;  5GAH I;  1URR A;  2J8A A;  3W2V A;  1WUU A;  4LIW A;  3I9V 9;  2D3O R;  2J7W A;  1VQ5 S;  4GVB A;  2KVI A;  2GGP A;  1FXD A;  1RWP B;  1RAA B;  2LQ9 A;  3OXF A;  2L08 A;  3AD7 C;  3J80 U;  2ZOG A;  3MR2 A;  3H98 A;  2OTJ S;  4CM2 A;  2H1Y A;  4KO0 A;  2RIL A;  2IC3 A;  2LA4 A;  1KTV A;  1T9Y A;  3CUN A;  3MMB A;  1WEY A;  2XUL A;  1S1U A;  2KRB A;  4CT9 A;  1V5V A;  2QA1 A;  3JQK A;  2IJN A;  3CJK B;  3S1T A;  4YHH F;  4LVN P;  3ITH A;  1BUX A;  4GKJ F;  2KXH A;  4DV2 J;  1ZAW A;  4H54 A;  5KT2 A;  2JLG A;  4B9L A;  1HWU A;  2UU9 J;  5B0E A;  3VAG A;  2RT3 A;  3WC2 A;  4OZ3 A;  1D1U A;  2AYG A;  2G2Z A;  4B3T J;  3G71 S;  1XNR F;  1A9N B;  1R0A A;  1DAX A;  4DR4 F;  3T6B A;  1MWY A;  3DRR A;  2JC0 A;  1F0X A;  1RXO B;  4DR5 J;  2X1B A;  4KGX B;  2IDL A;  2RQC A;  4DCP B;  1AUS L;  2G0I A;  1KVJ A;  4HT7 A;  1RT2 A;  4ED5 A;  5DDQ C;  5CYQ A;  1WC3 A;  1M90 T;  2VUG A;  4XDD A;  1EAR A;  1UET A;  2RJZ A;  2ZVI A;  1ZM9 A;  4WP9 A;  4ZVH A;  1T03 B;  4DSE A;  1GX6 A;  4CNZ A;  2A0F B;  3MGJ A;  4OYM A;  3BKF A;  4H4M A;  4EFA C;  1NO8 A;  4RUC A;  3CJS A;  3W60 A;  2KO1 A;  1Q8I A;  2GMH A;  4JV2 A;  3OBI A;  1JJC B;  2YPY A;  3NGK A;  2ROP A;  4JI7 J;  2ACM A;  3HI9 A;  1IBL F;  2MJN A;  1VQ7 S;  4DN9 A;  3MM5 A;  5J2P B;  1Q7L B;  1WEX A;  5LMU J;  3CVK A;  4N8N A;  4EBE A;  2WVB A;  5KT5 A;  3M05 A;  2ZH6 A;  3MR6 A;  4RKU C;  2E1C A;  4TU7 A;  4OI1 A;  4X4U A;  3MCO A;  3I5C A;  1RAE B;  2HHQ A;  5IFM A;  1U2F A;  4I68 A;  5KFK A;  4DSJ A;  5A8W A;  5HVH A;  3EDQ B;  3BKT A;  1M5P C;  4CLW A;  3KOA A;  2DR7 A;  3VR1 A;  3AD8 C;  2LXI A;  3LWM A;  4ECX A;  3C6T B;  1WC5 A;  1GFW B;  2M2B A;  2XGQ A;  3QWP A;  3MEG A;  2UXB F;  4DZ6 A;  1KOO A;  3HPO A;  3OFH A;  4CYU B;  3TUI C;  2GFF A;  4G1Q B;  4HHU A;  4M5K A;  3NXZ A;  1C1B A;  3OL9 A;  3ZXW A;  4DZD A;  4IG0 B;  2B51 A;  2XZD B;  4LQ9 A;  4QR1 A;  1FRJ A;  1FD2 A;  1XNQ J;  5A2Q Y;  2HZA A;  4IOB A;  3M6X A;  2ZHO A;  4NRU A;  2KT2 A;  4OZ2 A;  1RT6 B;  2JOQ A;  5GAD U;  1OO0 B;  3UFC X;  2ROG A;  3WX8 A;  4DQR A;  5LSO A;  4LF6 J;  5FD1 A;  1TKT B;  2W9C A;  1VRT B;  1EKR A;  3T1Y J;  4A8X A;  1CJT B;  3DRP B;  1T8E A;  2I5J A;  4UOG A;  1FJE B;  2XY7 A;  3PIO Q;  3R7B B;  1SJQ A;  2DXF A;  1APS A;  1U6F A;  5EDW A;  1B4S A;  3EZO A;  2KJV A;  3D68 A;  1T9U A;  1RUS A;  3GFH A;  4LFC F;  1I94 J;  4DL0 C;  5F9N A;  4IYQ A;  3LP2 A;  4O3Q A;  3GPA A;  2DO4 A;  4F2R A;  5DM7 Q;  4L3N A;  2QA4 S;  2V50 A;  3LOU A;  2XLK A;  1BQN A;  2O67 A;  4HHH A;  3KUE A;  3K7R A;  2NS1 B;  3QFH A;  3QSY B;  3SMZ A;  3NL0 A;  1Q86 T;  4FXV A;  3JAM U;  3RTV A;  1FRX A;  2VON A;  1FE4 A;  3SFU A;  3VWS A;  5AXN A;  2JC1 A;  2JEG A;  2XGP A;  3KJV B;  4WU3 A;  2R2U A;  2R2S A;  2BZ2 A;  3FCV A;  2Z2M A;  5EWE A;  2EKY A;  2LMI A;  2LFV A;  2QL9 B;  5KG4 A;  4K4Z A;  4Z7Y A;  3NKY A;  2VBX A;  1JK9 B;  3QYY A;  3FRY A;  3I5B A;  3FBB A;  3SQG B;  3DNC A;  3ZZU A;  1XMO F;  1NXI A;  4CLK A;  4HH0 A;  2LQJ A;  5GAE U;  3JSM B;  2GQ2 A;  4Q7A A;  4LR8 A;  3OXL A;  3FFI A;  4ZCI A;  4ZP7 A;  3AH6 A;  1DHM A;  3AJ2 A;  1HBO A;  3MCS A;  5IM0 A;  4DPW A;  1NME B;  3S6E A;  5I42 A;  1HI0 P;  3NGD A;  3EGN A;  2OPQ B;  1S1V B;  5DDR C;  3IWX A;  2Q3P A;  4OYO A;  5IS2 A;  4LFA F;  3ETM A;  2R7T A;  4QIE A;  1VLY A;  5D77 A;  3P6Y C;  2W7A A;  2XSJ A;  1DAR A;  2IRU A;  1S6Q A;  4KBI A;  2WB1 D;  3ET6 A;  2DRB A;  1N0U A;  4NE9 C;  2MQP A;  5CD4 A;  5HQL A;  2QT7 A;  3Q8Q B;  2HNZ A;  4O3N A;  2ZH1 A;  4ZLP A;  2F9D A;  2V8H A;  2JNJ A;  1I51 B;  2L41 A;  3UDE A;  3H0P A;  1JLC A;  2DPJ A;  1L3T A;  2NZ4 A;  5A6W A;  2Y1J A;  1ZZN A;  1U02 A;  3J81 j;  3FSX A;  4MKY A;  1KLM A;  2CKW A;  2QTW A;  1P8G A;  4AT1 B;  3OVB A;  3CDU A;  3U1N A;  2LU1 A;  2RF2 A;  5L1I A;  5BJR A;  4B9S A;  3T9N A;  4NLP A;  5GAH U;  4X2B A;  1S1W B;  5B0B A;  4JV5 F;  2HG4 A;  2EWH A;  4ID8 A;  3M2U A;  4M1K A;  1O0P A;  3A3N B;  3OUY A;  3SFG A;  4I4B A;  3HJV A;  1LXJ A;  3EGV A;  2MB0 B;  4NLY A;  2DK2 A;  1EAY C;  5KT6 A;  4DV6 F;  3SSS A;  1TV6 A;  2HGM A;  3CCW A;  2M5Y A;  3BGU A;  3OSP A;  1JLF B;  3TX0 A;  2RNE A;  3N4W A;  1WHX A;  1NPK A;  3IA0 A;  1JXL A;  4LUB A;  3KDO A;  2H5I B;  5BR8 J;  2PMW A;  4WCE Q;  4KHP F;  4M5H A;  1RT5 A;  1IKV A;  3CJT A;  3M6U A;  5AT1 B;  1TL7 A;  3KK1 A;  4QYZ J;  4DS5 A;  1IBK J;  2F3J A;  1C0U B;  4P2F A;  1Y5N B;  2E5H A;  5G4D A;  1TZ0 A;  2D3O 1;  4WFB Q;  2WK4 A;  3GIL A;  1S4F A;  2KXN B;  2J0Q D;  2ROE A;  4B3O A;  3HHE A;  4ZVQ B;  4URG A;  1SKU B;  4DQI A;  3O8W A;  1R8A A;  3W9I A;  1ZPV A;  3CMA S;  1RTZ A;  3AXK A;  3UD5 A;  4KYZ A;  2C2R A;  3IRX B;  2C2Z B;  2F9J A;  3KLF B;  3SSQ A;  1HFE L;  2R9L A;  1GXU A;  2AMC B;  1VBX A;  1UPM B;  3FBC A;  4KGV B;  3MM7 B;  1B0V A;  3L7U A;  4TVA B;  3U02 A;  2CQP A;  4TU9 A;  4ZIW A;  3LAK A;  5EX3 A;  1KKH A;  2IPO B;  3TUZ C;  3C19 A;  2O01 C;  4ID5 A;  1F3F A;  5D15 A;  4MMO A;  2BQ3 A;  5EUH A;  2ZOM A;  2GCF A;  4OLO A;  2RQ4 A;  1R31 A;  2WTF A;  2GIR A;  3U1L A;  4FNH A;  4IO1 A;  1X5S A;  1IKW A;  3MXH P;  1ULR A;  4A48 A;  4D3G A;  3CXC R;  3NS5 A;  2Y1R I;  1BY9 A;  3MEE B;  4C3L A;  1XMQ F;  2QL7 B;  1SQE A;  1VMB A;  1FVQ A;  2XYH B;  4BWM A;  2ZIT A;  2IA6 A;  4LJM A;  3W7B A;  5C2C A;  1Z4U A;  4UQG A;  3MPY A;  4ECR A;  2MQN A;  2HNY A;  4EZ9 A;  3DHX A;  3TA2 A;  3NEK A;  3T9Z A;  2UXC J;  5LXY A;  3GV7 B;  2R8I A;  4IFV B;  1RT3 A;  1NCL A;  4CLS A;  2V9W A;  1FK9 A;  3P3D A;  2CPY A;  2GMJ A;  2KYX A;  3PRV A;  2HZV A;  4HKQ A;  2X1A A;  4AL6 A;  2KB2 A;  5E3R A;  1NKE A;  4C11 B;  3ISN D;  3N0V A;  3M30 A;  3QAT A;  1RIS A;  4JI6 F;  3TZZ A;  4UZB A;  2XMV A;  1XK8 A;  5E3A A;  1EHW A;  2K3I A;  1BQM B;  2XY6 A;  1SIZ A;  3DU5 A;  1MU2 A;  3DM2 A;  3OHB A;  1FJC A;  1FEH A;  3V2U C;  2D9P A;  4WK3 A;  3ZNU A;  4QYR A;  1D09 B;  4ZK7 M;  4DX6 A;  1MLA A;  1RB0 A;  4GRS A;  3OVS A;  1CJU A;  2B9W A;  2JH3 A;  5CH7 B;  1OPI A;  1H2T Z;  4DR3 F;  3ELH A;  5E33 A;  2A6O A;  4LRB A;  2Z57 B;  4KQZ A;  1YDL A;  5ETR A;  1UVK A;  4IUF A;  4NOH A;  4OZL A;  1CUL A;  1YG0 A;  2YKM B;  4F25 A;  4ED2 A;  4OMF G;  4O4G B;  1RTJ B;  3C15 A;  4FXW A;  1UJ4 A;  2RQK A;  1GX5 A;  3PAC A;  2PFD A;  4DHV A;  2YQ1 A;  3NLC A;  3PKM A;  5IC4 B;  2VFT A;  1WSR A;  1FER A;  4OYA A;  3PTW A;  3CD5 A;  2F8H A;  2CWK A;  2YKN A;  2B8P A;  4X4P A;  3HMJ G;  3Q23 A;  2B5J B;  4LMZ A;  3BSC A;  4C6A A;  4R5P B;  4ECW A;  3J7Y I;  2Q6B A;  4UOH A;  4PAA A;  1IKX A;  5HLF A;  1YJ9 S;  1NK9 A;  5CD4 H;  2W9A A;  4L74 A;  2MXY A;  3W5X A;  2BAN B;  4I0W A;  1QDU B;  2QA4 G;  4RW4 B;  3ULH A;  2F4V J;  1NEE A;  1KN6 A;  4OX9 F;  2RUG A;  5J2M A;  4AXI A;  3MF5 A;  1X9M A;  5E3P A;  3DRS A;  1Y5I B;  3D1Q A;  3DN9 A;  1X4C A;  4X4V A;  4DXL A;  2CJX B;  5DG7 A;  2YNF B;  5DO2 A;  4LBP A;  2XMJ A;  4DUZ F;  1M1G A;  1WJ9 A;  4ZDN A;  5T7L B;  4A8M P;  3I4P A;  1HLW A;  1B0T A;  4DV7 J;  4DWI A;  3GB0 A;  2AZ3 A;  1VK3 A;  3UI3 A;  1D0E A;  3KLE A;  1K73 T;  2G9O A;  1CQN A;  5F8J A;  2FGC A;  3M2V B;  3LQV A;  3KUH A;  4W4M A;  1D9D A;  4FBU A;  1CEZ A;  4IKA A;  4A8Q A;  1SL0 A;  2JZ5 A;  3HHL B;  1K8A T;  1RTD A;  3QLH A;  2AGQ A;  2FJW A;  2A6M A;  5L46 A;  4DSK A;  2FLP A;  1R27 B;  2LA6 A;  1KP6 A;  4B3S F;  4DPU A;  5IC6 B;  2ZJP Q;  3EPI A;  1QVG R;  3JS9 A;  1IM4 A;  1GMU A;  4IRC A;  3I9Z A;  1S76 D;  2CIM A;  3SCK E;  2OPR B;  3M4X A;  1ELO A;  3RB0 A;  4BWJ A;  2OO4 A;  3SV4 A;  1OQ6 A;  3CJ2 A;  3M1V B;  3G8Q A;  1KFD A;  4WZQ A;  1SI9 A;  2C3U A;  3W9J A;  3TVY A;  1RKJ A;  2ZVS A;  4IG3 B;  2OP5 A;  3FSI A;  3PX6 A;  3KHG A;  3AB4 B;  3RZA A;  2V4Q A;  2OPP B;  4QR0 A;  1GK8 A;  1KWM A;  3DGP A;  4DR4 J;  2V8V A;  4QOT A;  3FSY A;  4QWA A;  3UO0 A;  1FNM A;  4Q45 A;  1FDA A;  4A8Y A;  1SJ3 P;  2QO3 A;  2ZWO A;  2EBG A;  3K5M A;  2KM8 B;  1YGY A;  3BBF A;  2FHK A;  3US5 A;  4H4K A;  3W8G A;  4CO0 A;  2AX0 A;  3NY0 A;  3QT5 A;  3GIM A;  1U1R A;  3TJ9 A;  3D3C J;  2V9K A;  1GQE A;  2XQC A;  3GCX P;  2MGZ B;  1ZTW A;  1T9X A;  4PWD B;  4R25 A;  4J7C A;  3C8Y A;  1NHU A;  1TP7 A;  4ELU A;  2Q66 A;  3I82 A;  2DHS A;  2BQU A;  1UWB A;  5D4P A;  1S12 A;  1M5K C;  2R4F A;  4DX7 A;  3V4I B;  4M5N A;  2ZM6 J;  1PC4 A;  5C24 B;  2XS5 A;  4QWD A;  4WE1 A;  4ATN A;  2KU7 A;  1O6X A;  3CJ3 A;  3RUB L;  3SEO A;  4Q0B A;  2QMU B;  2BJ1 A;  3I55 S;  1H74 A;  4NL5 A;  2MKH A;  2OEL A;  4JP8 A;  4ZA1 A;  2K1R A;  3EIC A;  3FVY A;  4RR5 A;  3QZ7 A;  5H9E K;  5KFU A;  1FHT A;  2MZT A;  3CDB A;  1RZM A;  2C42 A;  1RTH B;  2W2M P;  4QWE A;  5IV4 A;  2W9B A;  2CWX A;  4P9S A;  4C8K A;  1VYA A;  1I5O B;  4LF7 J;  2HRT A;  1SC4 B;  4OI6 A;  4DBQ A;  1JJH A;  4C8Z A;  4FPI A;  3GSD A;  5KTQ A;  3QSI A;  3UCZ P;  3TRG A;  2LEB A;  1XN9 A;  4KFB B;  2R7W A;  4NI2 B;  3MMC B;  3BZQ A;  3PX0 A;  1IR2 A;  1A0O B;  1RLD A;  3POT B;  1S48 A;  4DR7 F;  2ZZT A;  3U27 A;  2LDI A;  1WI6 A;  4DS4 A;  3FCW A;  3GSI A;  3W62 A;  4PRF A;  2C3Y A;  2OMO A;  3N6M A;  2WSC C;  2AQ4 A;  1HNZ J;  2P9G A;  2CDR B;  3ZTO A;  4OYI A;  2J7U A;  5IT0 A;  1GNK A;  1XQI A;  2DR8 A;  3K58 A;  2B3T B;  2P8I A;  3MTK A;  1NH8 A;  4NA2 A;  3PJX A;  2DB1 A;  3KLG B;  3RB4 A;  2NUH A;  3R2C J;  2CA9 A;  4M5I A;  1S1T B;  4WXW A;  3Q22 A;  3EWG A;  3C14 A;  2KG0 A;  4RBV A;  4FXD A;  3SCI E;  1YWX A;  3M8Q A;  1RE1 B;  3W9H A;  5AE2 A;  2D69 A;  2Y9H A;  1TL1 B;  4CLZ A;  1ZAX A;  3G87 A;  1HQU A;  4J9V A;  1HQE A;  4EI2 A;  3IBW A;  3T6J A;  4CT8 A;  2DEJ A;  2FHJ D;  3IM8 A;  5F8L A;  4F4Y A;  4ES2 A;  2ZD1 B;  1HW9 A;  3ENW A;  3RJM B;  2QC3 A;  4PEO A;  1KQG B;  3G6E S;  1FTR A;  2J6T A;  3H2V E;  1NJY A;  3D4J A;  1LK5 A;  5J2N B;  1E6V A;  2BA9 A;  2FIU A;  3P8B B;  1UA0 A;  3VAI A;  2RRB A;  2M7S A;  4HAC A;  4J9L A;  1GT8 A;  3JSR A;  5ETQ A;  4NPO A;  3QRP A;  2ZUG A;  4JI8 J;  3EUN A;  3HSJ A;  2OD4 A;  1NHV A;  2LP4 A;  2HBR B;  2NXE A;  5LJ3 Y;  4AQY J;  3QIP A;  3A3P B;  3DGV A;  4DR2 J;  2W24 A;  1OQ3 A;  4NZ7 A;  3NOG A;  2J0S D;  5KT4 A;  2MQ8 A;  4F4X A;  2LXF A;  2QLX A;  2DY9 A;  2CXE A;  4YS2 A;  3M32 A;  3R8Y A;  2XI2 A;  1JWW A;  2VG7 A;  1WG4 A;  1S99 A;  1AXQ A;  3CJ0 A;  4P2X A;  5K14 A;  1RU1 A;  3MEC B;  2XMU A;  1ZA1 B;  5CAA A;  1HPZ B;  3CWJ A;  5AXM A;  5J1E B;  2IBO A;  4LRC A;  1SL2 A;  3K5L A;  5DJB A;  4NYO A;  2RUS A;  2GV1 A;  3KJN B;  1HQ2 A;  4WP8 A;  4C4W A;  2ZEJ A;  4DLE A;  2UUA F;  3J7Y U;  4DFJ A;  4KH1 B;  4ICL A;  3CCT A;  2UZA A;  3M2R A;  3QT6 A;  1KHV A;  1X60 A;  2FYX A;  4E8U A;  1RYR A;  5K9F A;  2UVR A;  2KRR A;  2AJ4 A;  4JYA J;  1UVM A;  1LW2 A;  5BYQ A;  2FJA B;  2YWK A;  3GV5 B;  2VKZ G;  3VHQ A;  3PFO A;  2LYV A;  3EMT A;  5AXL A;  5M2P A;  4LBH A;  2EK1 A;  4IDK A;  1U1P A;  3V81 B;  3RBE A;  3C16 A;  2CQI A;  5F8I A;  4YDD B;  5KFM A;  3Q8R B;  2DHX A;  5F8M A;  1RBO B;  1JXV A;  1N6Q B;  2CQ4 A;  3DI6 A;  3J7Z 5;  3MD1 A;  4R8U A;  1ZET A;  1AZS B;  1H6K X;  3MAH A;  4OYW A;  5EWF A;  2DGQ A;  2FVS A;  3NBP A;  1M1K T;  3M9N B;  2DD8 S;  5LXR A;  2KDO A;  3LAM A;  4K50 A;  1VQP S;  1VDH A;  3WHI A;  1IN0 A;  1TVR B;  3NAI A;  4R0E A;  2ASY A;  2HQ3 A;  5L38 A;  3MMA B;  2Z2Y B;  1N5Y B;  4DJB A;  3UVJ B;  2HUR A;  4CIO A;  4ECY A;  5HMZ A;  3PHT A;  3QID A;  2IM3 A;  1FXR A;  5I3P A;  4FKX A;  2GML A;  3R5D A;  1BMQ B;  4H4K C;  3TOQ A;  4I67 A;  2DNG A;  3OT9 A;  5HAN A;  3RRG A;  2NCK L;  1RAB B;  3M9M B;  2E9T A;  1NKB A;  2BJ3 A;  5T41 A;  4P2S A;  4WXO A;  3VQT A;  4DL6 A;  1R8H A;  4DQQ A;  1IR1 A;  4PG8 A;  1DFD A;  3PM9 A;  3MPW A;  3TWZ A;  2RRN A;  1VC0 A;  2N4D A;  2OEM A;  2ADC A;  2CFX A;  4P71 A;  3AJ1 A;  1TMM A;  2YH0 A;  2ZOF A;  4DV2 F;  5C5J A;  2HHT A;  3VZH A;  2ZJQ Q;  1N56 A;  2UU9 F;  3HVR A;  4TU8 A;  4B3T F;  2MLZ A;  1YIJ S;  2X7I A;  3JYT A;  4OZJ A;  4Y2A A;  1H2V Z;  4PXB A;  4USH A;  1Y0H A;  2VDH A;  3P5B P;  4JI1 J;  2DGS A;  3RBX A;  5FJ4 A;  2W7P A;  1KVK A;  1VJQ A;  2YQ3 A;  4DR5 F;  1IM6 A;  1KON A;  3R7S B;  5DLF A;  2YWE A;  5CCM A;  2B7C B;  1T02 A;  1QAY A;  4NLQ A;  3PNI A;  3PW5 A;  1DTQ B;  5RUB A;  2HHP A;  3BGF A;  3LAN A;  4KKO B;  3D0I E;  1LW0 B;  3KHL A;  3K5N A;  3EVO A;  1VQM S;  3GIK A;  2FJD B;  3KK3 B;  1J5E J;  3T41 A;  1W2I A;  5IT9 Y;  4R0J A;  1IWA A;  3FQL A;  2NZC A;  3CCU S;  3K8W A;  1QTN B;  4W90 B;  1JB0 C;  1PYT A;  2HBY B;  4NCA A;  2DNM A;  4YB6 A;  1QY7 A;  4RZR A;  4HYK A;  1AW0 A;  1HNX J;  1AT1 B;  2QLJ B;  3TVZ A;  2MDA A;  4JI7 F;  2WOM B;  3S7R A;  5LMU F;  2RDD A;  2GJI A;  4DN0 A;  2VOO A;  1SV5 B;  5ITH A;  2Q6C A;  2HFV A;  5B0A A;  4K4Y A;  3G96 A;  2FC8 A;  3FUY A;  4KC5 A;  3MM8 A;  4ILL A;  2IY5 B;  4TXS A;  1YBT A;  1N5Q A;  2E5G A;  1JLG A;  2ZWP A;  3QMQ A;  3IRW P;  2C3M A;  3BN4 A;  3TO8 A;  5IT9 U;  2NPI A;  3HHN B;  3MTJ A;  1YJ7 A;  3OFG A;  4OI4 A;  1RT7 B;  1WC1 A;  4OHV A;  2B4O A;  1S10 A;  3DCA A;  2BQR A;  4LRA A;  3OTC A;  3ISN C;  3THT A;  3VAL A;  4PG4 A;  1S7I A;  3MAA B;  1RLC L;  1S49 A;  2H65 B;  1FX2 A;  2YWH A;  3PEH A;  4ECZ A;  1JQG A;  1N5T A;  4M5L A;  4Y28 C;  3DYA B;  1F5B A;  1PYO B;  1X4F A;  2GW8 A;  2G0C A;  3RBD A;  4L75 A;  3P45 B;  5IXU A;  4E0D A;  2B56 A;  3W66 A;  1XNQ F;  4Q5V A;  3Q8S B;  5KFH A;  2BE7 D;  1Q78 A;  4EO8 A;  4P7T A;  4ZHR B;  5C2G A;  3T3F A;  4U67 Q;  3OL6 A;  3BDP A;  2VH7 A;  4M95 A;  5KFL A;  1UL3 A;  2XM3 A;  1T03 A;  2B9E A;  1JLE A;  1U7L A;  3BDE A;  4LF6 F;  3BO4 A;  1XBW A;  4WPA A;  1CBK A;  3FJ2 A;  3T1Y F;  5IQQ A;  3RG6 A;  1E6Y B;  1L3K A;  1G4C A;  1WD6 A;  4M5D A;  4PUO B;  1X9W A;  2VV5 A;  5JXS A;  4MTP A;  4RJV A;  4J5O A;  3ZZ0 A;  1XMB A;  3BSA A;  2J6S A;  4DL5 A;  2KZM A;  1VLO A;  2UXD J;  2CZ9 A;  5J2P A;  4ZVG A;  2VKR A;  2K3K A;  2FHJ A;  3P5T L;  2BOP A;  3W3S A;  4OYP A;  2RDI A;  1XJW B;  5HRO B;  4B17 A;  4HT5 A;  5G0R B;  1C1C B;  2J76 E;  2JSX A;  1I94 F;  3MCM A;  4IRK A;  2PMZ D;  2E9Z A;  3E3X A;  5LMN F;  3CJ5 A;  4Y34 A;  2ZC3 A;  1O8B A;  3QGI A;  4K7Q A;  5D6G A;  3O6Q A;  2VQF J;  1KVI A;  4OJH A;  3BSO A;  1OYD A;  4ZCK A;  4CO5 A;  3C6T A;  1GTH A;  2EC0 A;  1HWK A;  1IUJ A;  2CNN B;  1S7H A;  3L7P A;  1TFW A;  5M2U A;  4KO0 B;  4C9D A;  4NRT A;  3ILJ A;  2MKS A;  1H7W A;  2E1R A;  3MMB B;  1VIO A;  1S1U B;  2RS2 A;  4CYU A;  3PY8 A;  1SIW B;  3LH2 S;  3CO0 P;  4IH5 A;  1S9F A;  1U45 A;  4IG0 A;  3CED A;  3ITH B;  1DQ9 A;  3CDE A;  3HD1 A;  2OGU A;  2QLB B;  2B43 A;  1OIA A;  4Q2M A;  2FJB B;  3VGS A;  1IBM J;  1RT6 A;  3HK2 A;  1N36 J;  2CJQ A;  2CJB A;  4FYV B;  4WF9 Q;  3PXG a;  1TKT A;  1VRT A;  4RNH A;  2XC9 A;  3DRR B;  1T7P A;  3CC2 S;  1CJT A;  3R6L B;  4ZLL A;  3EXY A;  2KXF A;  3K0J A;  7FD1 A;  3JB9 k;  2HFZ A;  3EE3 A;  1VI7 A;  2NYH A;  4MT1 A;  2I6W A;  1QSY A;  4YR0 A;  5AJ3 J;  5LT5 A;  2FZK B;  5MAO A;  2AYM A;  5B08 A;  4LRF A;  4CWB A;  4CLF A;  2MYF A;  2ZH5 A;  3V6H A;  4DSF A;  2VHG A;  2HS4 A;  4ZVP B;  4O44 A;  4ZN1 A;  4H4M B;  4RUB A;  1S1X B;  4QIV A;  4PXD A;  2JFD A;  4W98 A;  1Q5Y A;  2OSR A;  3K5P A;  3CJ8 A;  4RO0 A;  5KFT A;  3AD9 C;  3V6K A;  4HVZ A;  3TP2 A;  2A2C A;  1PBA A;  3N6N A;  2L3M A;  4IQX A;  1FE0 A;  4LSL A;  4BC7 A;  3FQK A;  3MM5 B;  2HEK A;  2NR0 A;  2B6A B;  2Z30 B;  2HBQ B;  2KN4 A;  3G2X A;  2W8K A;  4GO5 X;  4RW8 A;  3G6X A;  4PKD B;  1WOP A;  2ZE2 B;  2HPU A;  4N56 A;  4AL5 A;  3ZZR A;  4B9U A;  1K1Q A;  2BYC A;  5A8W B;  3Q8Y A;  3HFZ B;  3KJV A;  1FTC A;  2EFO A;  2UVW A;  4YUD A;  3UWT A;  2K8G A;  5E5N A;  3MEG B;  4B08 A;  5SUH A;  3W5Y A;  1J5O A;  4F02 A;  1NHK L;  2BJE A;  2BR0 A;  4RPF A;  2BKP A;  3I96 A;  1EQ0 A;  1U25 A;  2FTR A;  4N5S A;  4ED3 A;  2YWF A;  1K9M T;  2VBY A;  1C1B B;  2YNI B;  2HFS A;  1HHQ A;  2D41 A;  2OPQ A;  4ED6 A;  1Y5L B;  1S1V A;  3T1A A;  5K8M A;  5BR8 F;  1YK9 A;  3QRQ A;  3EDR B;  1UZH A;  5DG8 A;  4NLD A;  1IBK F;  4E2F B;  3H4D A;  1W7W A;  5D0H A;  2RRA A;  3PYE A;  1YX2 A;  3SV3 A;  3RR8 A;  4M94 A;  2ATL A;  2FHM A;  4UF4 A;  3X1L B;  2R8K A;  2I5J B;  1RA6 A;  3IM9 A;  2ADB A;  1Q8L A;  1HBM B;  1QSS A;  1RTI B;  3CIM A;  2CJA A;  5MLC V;  1TAQ A;  3ZZY A;  3CSK A;  1ZAV A;  3UD3 P;  4ZVE A;  4B3M J;  3KG4 A;  1FRI A;  1K0T A;  3RW7 A;  1I6J A;  4TY8 A;  4NZ0 A;  4I7F B;  5KG2 A;  2KTQ A;  1PAU B;  4USW A;  1MN7 A;  3AOA A;  5F8N A;  2LCW A;  3DHW C;  3D9B A;  2YX4 A;  1WAC A;  1JMT A;  3HFK A;  3LP2 B;  1S1W A;  5CQG A;  3J7Z T;  2AJ1 A;  2NXJ A;  4WU2 A;  3G6Y A;  4QW9 A;  3CME S;  4DR1 J;  5ETV A;  3PJW A;  2R7R A;  1SPB P;  3HT0 A;  1UJ6 A;  4J9R A;  2QSF A;  2YVS A;  1C4A A;  3TZX A;  4RUH A;  2BUN A;  2WVE A;  3TAR A;  4DPO A;  4F4A A;  1I1G A;  1JLF A;  2OSQ A;  3DMJ B;  1PGZ A;  1VQK S;  1ROF A;  4Z37 A;  4X65 J;  4I56 A;  5HMY A;  1S59 A;  1N8R T;  1PO6 A;  3V6D B;  2CQG A;  3N01 A;  3I0R B;  2V5H G;  4NXM J;  3H4B A;  3R3T A;  4OJG A;  1B3T A;  2UXC F;  4YOE A;  3T5H A;  4F7V A;  2FVR A;  2Z2L A;  3R97 A;  4MK8 A;  3PYD A;  1NH7 A;  4JI2 J;  3A3O B;  4KJI A;  4QJV A;  4WKR A;  4H4O B;  3LW5 C;  5HQ8 A;  3LP0 A;  3BS9 A;  1SCJ B;  4CO2 A;  1U0H B;  2E5L J;  3BGR B;  3OHA A;  3KLF A;  3HHD A;  1NJZ A;  3R6G B;  2KT5 A;  2XS2 A;  2IMW P;  1S6P A;  1NDK A;  3WX4 A;  1AA1 B;  2XSJ B;  1S6Q B;  3NGR A;  3ET6 B;  2JWN A;  1D8Z A;  3M8Y A;  4L76 A;  2G1H A;  1FJ7 A;  1FT8 A;  3FGV A;  2YKO A;  1RCX B;  2VQE J;  2BW2 A;  4NCG A;  2WON A;  2H48 B;  1T94 A;  1CS4 B;  3GR1 A;  2BMB A;  1RHK B;  2UVV A;  2YNG A;  4KV8 B;  4N47 A;  2Z4P A;  3OR1 B;  1NK6 A;  1O51 A;  2OIH A;  2V68 A;  2FJV A;  1X31 C;  3MEE A;  2Y8W A;  4G3I A;  1OYE A;  2AW0 A;  3TJ8 A;  4LF8 J;  3E8O A;  5L1J A;  2RF2 B;  1WNE A;  2F5G A;  2PDA A;  2GJ2 A;  3K59 A;  2MST A;  5GMD A;  3GJT B;  4MH8 A;  2V4J A;  2GHP A;  4OL8 A;  2BOA A;  5KFX A;  2LEA A;  3OUY B;  2VOP A;  1IVZ A;  5F0U A;  1EET B;  5F0W A;  3TZY A;  3F73 A;  4MKV A;  2ASD A;  3K57 A;  1VQN S;  1V3R A;  1KS2 A;  4FPR A;  3E01 B;  5IOL A;  3DLL Q;  2ZHA A;  4V19 X;  1QAX A;  1N4L A;  4LRD A;  4ZPA A;  4PWW A;  2M8D B;  3UR0 A;  3EX7 B;  2HK3 A;  4YQW A;  2OFH X;  2HQF A;  1YQH A;  5EN1 A;  2OPS B;  1IKV B;  1B70 B;  1Y3J A;  3GIR A;  1F5A A;  3ZTQ A;  1RBL A;  1BQM A;  3QWU A;  2ZBQ A;  4DLG A;  2BM0 A;  3EVM A;  2AKW B;  2YX7 A;  4I64 A;  1UVL A;  4JI3 J;  1RWX B;  4I2P A;  4C8M A;  1VQS A;  3DC2 A;  3EXC X;  2CJK A;  1X4G A;  4ZN3 A;  1VRU A;  3A8K A;  2F4V F;  2MQQ A;  1Q82 T;  4W92 B;  1TEL A;  4FKY A;  4ZP8 A;  1YJV A;  4IH6 A;  4XO0 A;  2VJV A;  4A8F A;  2RML A;  1S9E B;  3ILI A;  1P6T A;  1X4A A;  2MJU A;  4DV5 J;  1YI2 S;  4OFZ A;  2E1A A;  4RW7 B;  2VB6 A;  4UTG A;  4F50 A;  3CD6 S;  1L5U A;  5IQ6 A;  5DGA A;  4ECV A;  5KG3 A;  4CCH A;  3DOL B;  4O23 A;  4ID5 B;  1RTJ A;  4FS1 A;  3MUT P;  4DV7 F;  2FLO A;  2DHA A;  1S0O A;  3NWG A;  1VOM A;  3TVK A;  3MM9 A;  4D3H A;  4ZLJ A;  5EHH A;  3D0G E;  3BR9 A;  2J9D A;  3R27 A;  2V0N A;  1QSL A;  2MHE A;  2HHX A;  1L3V A;  3NCQ A;  1U1N A;  4ECS A;  1NDC A;  4L73 A;  3AJD A;  4ZVU B;  4PPZ A;  2UP1 A;  3BH6 B;  3GYX B;  1RYS A;  5D4O A;  3O44 A;  1UW4 A;  3SYZ A;  5D3G B;  3DLG A;  4LBI A;  3GV8 B;  1MSW D;  3NAH A;  1XC9 A;  5H1S V;  3SDE B;  1HHT P;  3NS7 B;  3OTD A;  4G1P A;  3DXB A;  2CPI A;  2P5V A;  5IZH A;  2OML A;  4P52 A;  3JSB A;  2BX6 A;  2QYG A;  3CD7 A;  3B4D A;  4XPE A;  4PYD A;  4I6Y A;  3AHP A;  3D3B J;  4XPC A;  1M5H A;  1FK9 B;  1H2U X;  4RW4 A;  5C7P A;  4J9S A;  3PCO B;  3BKU A;  1NPR A;  4U7U K;  3WIU A;  4ZVT B;  4MIW A;  4DCO B;  2HVZ A;  1FDD A;  1U0S A;  3M30 B;  4DCJ B;  5HL7 Q;  3AOD A;  2JDJ A;  3H5Y A;  4JBC A;  5F41 A;  4K5S A;  2W8L A;  3Q8U A;  2MHN A;  3H2U B;  1FWP A;  3F41 A;  2XCA A;  3CC4 S;  5DDP C;  1JLA A;  4CM0 A;  2CVE A;  3D2W A;  3PO5 A;  1MU2 B;  5T7L A;  4C0O C;  5HK4 A;  4MJK A;  3W1Y C;  4TQS A;  4MK7 A;  3BBC A;  2HRU A;  1TAU A;  1H73 A;  1NSQ A;  2Z8Q A;  3IS9 B;  1FEE A;  3BPD A;  4KH0 B;  3MWB A;  1NK5 A;  4AYB D;  1JKH B;  2ZM6 F;  1QE1 A;  4J9N A;  4QQB A;  1CUL B;  1KQF B;  1PCA A;  3Q86 A;  2BRL A;  9ATC B;  1RAH B;  1UMJ A;  5KG7 A;  2DIS A;  1JIH A;  1QTM A;  3C15 B;  4P7V A;  4WFA Q;  4GMK A;  4ZPV R;  1RHJ B;  4URQ U;  3MFH A;  3LF0 A;  4NLS A;  1CG2 A;  2OPR A;  5A8K A;  2BJD A;  4EUV A;  3OJU A;  3TR5 A;  1WI8 A;  2HAI A;  5C42 A;  1YZ6 A;  1RDR A;  4DG1 A;  4QCL A;  2CJ9 A;  1AUD A;  3ISZ A;  3H5S A;  3SBM A;  1RHM B;  4OI0 A;  3RRH A;  3A8I A;  4IG3 A;  3QJJ A;  3RB6 A;  1RA7 A;  4LF7 F;  5B0G A;  1FD8 A;  1N34 J;  2OPP A;  4KIA A;  2HYI B;  5LSL A;  3GYG A;  1TL3 B;  1U1Q A;  4KE5 A;  4P73 A;  1LQ9 A;  2CPD A;  2FZG B;  3HT3 A;  4YB7 A;  3OTO F;  1Y11 A;  1FXL A;  4YY3 J;  2CPE A;  1WF2 A;  2IYI A;  1WG1 A;  1SUQ A;  2XO7 A;  2WBM A;  3VF0 B;  2OKQ A;  3MUV P;  3QGP A;  1WEZ A;  1HNZ F;  2D3U A;  4ED8 A;  4B02 A;  2LVW A;  2RU3 A;  3SCL E;  2PC6 A;  1HMV A;  4FF3 A;  4CTA A;  1Y4Z B;  1FDB A;  1JJ4 A;  3G8T A;  2BRK A;  1VQ8 S;  3RYL A;  3GQC A;  1FKA F;  2F1F A;  2M70 A;  1RK8 A;  3DRS B;  1SXL A;  1SC3 B;  4NZ6 A;  1VBK A;  2DHH A;  3OD2 A;  4V19 J;  3HSD A;  1WDT A;  4ED7 A;  2HFO A;  4KHM A;  1CJK A;  2M9K A;  3H2L A;  3IBC B;  5HJX A;  3QT8 A;  1Q8K A;  3V4I A;  1XR5 A;  3NNA A;  1U09 A;  4Q8F A;  1OJ4 A;  2EC2 A;  3CPW R;  3M8P A;  3HD2 A;  5M2R A;  4ED1 A;  2GZO A;  4DV4 J;  4DI6 A;  3B78 A;  4NAS A;  5A2Q U;  4B9N A;  1LWX A;  3MR5 A;  3KLE B;  5H9F J;  5JUM A;  2RAQ A;  4Y0F A;  3C3L A;  3IMQ J;  5LMN J;  2V2Z A;  4C8N A;  1YIT S;  4EMD A;  3PO4 A;  2BJ9 A;  2XZT B;  2QIF A;  2MMY A;  1I3O B;  3QLH B;  4JI8 F;  4YEA A;  1REV B;  2O5D A;  2E5I A;  2ZDP A;  2FJE B;  3GLJ A;  1YKW A;  3CJR A;  3J81 Y;  2R7S A;  4X66 F;  4AQY F;  4ZIT A;  4DR2 F;  4NI2 A;  2PFF B;  2F65 A;  3AT1 B;  3GJS B;  3POT A;  3KXD A;  4WFN Q;  3OLB A;  3K8V A;  2DVI A;  3C6U B;  5DQH A;  3QT7 A;  2DGU A;  3CW2 C;  1R89 A;  1NPP A;  2CG8 A;  3HSZ A;  4LRE A;  2CYY A;  1ZM3 A;  1YBU A;  3ZO7 A;  2HQD A;  2H4W B;  1YZ7 A;  4MKB A;  2C2O B;  1BXN A;  3CB4 A;  1PIE A;  2B9Y A;  2AHO B;  1MRO B;  3DGP B;  3RW6 A;  5KG1 A;  4RLE A;  1ZTT A;  4K4U A;  4ILM A;  4NEZ A;  9RUB A;  1S1T A;  4ZVO B;  5KFI A;  4TNO A;  4DPT A;  2HGL A;  2VPX B;  2IIH A;  3H42 A;  3DOK B;  2GS8 A;  2FY1 A;  5KFV A;  1YHQ S;  2XB2 D;  3N5F A;  4I1T A;  1VIX A;  5J2Q A;  2B4U A;  2VG5 A;  3KKF A;  1LOU A;  4O3R A;  4NML A;  2JL9 A;  4JV1 A;  4HDH A;  3IWL A;  2C1E B;  2BKN A;  2DJW A;  3OR2 B;  2HQG A;  2NXC A;  4WJB A;  5L8R C;  1BWE A;  1R7I A;  1R0B G;  5J2N A;  4KRW A;  4JYA F;  4IRD A;  1PJ7 A;  2JLE A;  1ZM4 A;  2EXU A;  3D0H E;  4NXN J;  1UWB B;  1S79 A;  1LWE A;  1T05 A;  1PYS B;  5D4L A;  4QWB A;  4GVL A;  2VL1 A;  1J2V A;  4L6V 3;  1Q53 A;  3QGG A;  3A4T A;  1FKP A;  2BJ7 A;  4HEA 9;  1FFG B;  2DNR A;  3T5J A;  4NA1 A;  1MNE A;  4B3R J;  5B7W A;  4F0K A;  5KG0 A;  1N0V C;  1U47 A;  1VC6 A;  4QIW D;  4OX8 A;  3Q8P B;  3MI7 X;  3TAN A;  2W25 A;  1VBY A;  1XEZ A;  4IOA Q;  2KYZ A;  4IQM A;  4F36 A;  4RNM A;  5FII A;  3NCP A;  1AB8 A;  1G6B A;  2V2V A;  2D7S A;  3MEC A;  2OFG X;  2JLF A;  4ECT A;  1R8C A;  1WEL A;  2W9B B;  2LXU A;  1Q81 T;  5HP1 A;  2XWY A;  1QUV A;  2K06 A;  4B9T A;  5LL6 d;  4DQS A;  4Q2L A;  3GE9 A;  3RAM A;  3CT9 A;  3KLI A;  4X62 J;  1F9F A;  4UST A;  1KQS R;  3W61 A;  7FDR A;  2R7U A;  2MQO A;  2E7W A;  2C22 A;  1WTF A;  4PPD A;  1BD6 A;  4USM A;  2HSE B;  4B9V A;  2VFV A;  3UN2 A;  1GAO A;  2ERR A;  5D78 A;  4C48 A;  3A1Y G;  1FWL A;  3KWM A;  3H5U A;  2CVI A;  2R7X A;  4A8S A;  1NB2 A;  3HCX A;  3LA0 A;  1F60 B;  3CGI A;  3W64 A;  3PHE A;  2OTL S;  4PR6 A;  1KTQ A;  2GIQ A;  4CLY A;  1VQ4 S;  2XNR A;  2V69 A;  3OLA A;  3CD0 A;  5LM7 E;  3IAM 9;  4ZVR B;  1S9G B;  4F67 A;  3D67 A;  2X51 A;  3MED B;  1OMS A;  3C14 B;  4FYX B;  4ITS A;  1SVD A;  3HSG A;  1F1B B;  1NJI T;  4GC6 A;  1JNR B;  3M8Q B;  2E5J A;  4JI1 F;  1CC7 A;  4ZJO A;  3CC7 S;  4X64 J;  2BJ8 A;  1EP4 B;  2J6U A;  1L3S A;  2QJ3 A;  1EIY B;  1FDN A;  4J9M A;  1VCT A;  1YSJ A;  1AZS A;  2ZKT A;  2YTC A;  3D7S B;  1E6V B;  3N79 A;  2CRL A;  2HWT A;  2V8D A;  2VPW B;  1WKJ A;  2E29 A;  2LKZ A;  1TR0 A;  1J5E F;  4LFB J;  1QAJ A;  4C7Q A;  1TVR A;  5IT4 A;  1IKY B;  2IM2 A;  2GA7 A;  3MMA A;  2JFK A;  4F4K A;  4BCA A;  3UVJ A;  1MW7 A;  2F8E X;  2N3O A;  5J1P A;  1HNX F;  1D8Y A;  5HBM A;  3LTO A;  3QIP B;  5KT7 A;  1HAR A;  4FBT A;  2B7B B;  3ZZO A;  4BDP A;  2HRY A;  1OWX A;  3TI0 A;  2MKJ A;  4K4S A;  3M32 B;  3VV2 B;  1PKU A;  4LQ3 A;  4DQP A;  3ZTR A;  1U48 A;  4KAI A;  2P2C B;  1SH3 A;  5KOX A;  2IVM A;  1UEK A;  4F0M A;  2BBE A;  3FEZ A;  3X3U A;  3OVA A;  1NSP A;  1TKZ B;  1VQ6 S;  1FES A;  3AOC A;  3JTP A;  5H9F K;  3VGU A;  2VU5 A;  2HKE A;  1IWG A;  3TNV A;  4FVM A;  2NSC A;  5DRK A;  3HZG A;  4B9M A;  3PRB A;  4C8Y A;  5GVQ A;  3ETO A;  3MOZ A;  4OJ1 A;  3MUM P;  2ZUA A;  2WSF C;  1A7G E;  4F4W A;  4ECQ A;  2KKH A;  1RAI B;  3SIP B;  2M52 A;  2RQM A;  2CPZ A;  2C3P A;  5CYM B;  3M2R B;  1T11 A;  3HUL A;  3NGU A;  2GVZ B;  2C2N A;  1U1O A;  2E44 A;  2PI4 A;  3NNH A;  4KKO A;  1UW9 A;  1LW2 B;  3G82 B;  1LW0 A;  1RWN B;  1BC6 A;  1NB7 A;  3N9U C;  5KFA A;  5A0Y B;  1QAI A;  5A76 A;  3TAP A;  4C8L A;  2EVZ A;  5CCL A;  3UCU P;  4ES1 A;  3CJQ A;  5CZV A;  2QX0 A;  4MIB A;  5J1N A;  1HYS A;  1RAD B;  2FVC A;  4A47 A;  5DZ7 A;  2UXD F;  2WOM A;  3ZNJ 1;  2AJ2 A;  2LEC A;  3DI6 B;  4X4T A;  2I2Y A;  2DTJ A;  1DTT A;  5HJY A;  4R8U B;  1CJV B;  1F2H A;  4P10 A;  1SQG A;  2KHD A;  4G65 A;  4A8W A;  4OV6 A;  3FBE A;  3BM7 A;  3FRZ A;  3NBP B;  4GKK J;  2NUU G;  2IJR A;  4TN2 A;  2XY5 A;  4C97 A;  3G6V A;  1X5T A;  2OD6 A;  2QFJ A;  3EZU A;  1AFJ A;  2IM0 A;  1HIY A;  1V6H A;  3TW0 A;  3J7A 1;  5F8H A;  3R1L A;  2E1M C;  3KK2 B;  2Y3Y A;  5ETO A;  2DR9 A;  2VQF F;  2VD3 A;  4MFB A;  2CNO B;  3I31 A;  2UV8 G;  1DLO B;  4JI5 J;  3CCE S;  3NNC A;  4J91 A;  4PCQ A;  3GON A;  3MAA A;  5EWG A;  1MN9 A;  1Y3K A;  3CF5 Q;  1RHR B;  5HQM A;  2KFZ A;  3VAK A;  4YB5 A;  4F04 B;  3VAH A;  3DYA A;  1UVN A;  3HHK A;  4UT4 A;  4Z2X A;  2V6A A;  1WF0 A;  3UPF A;  2QEX S;  4HTI A;  2FB0 A;  3I6P A;  4ZPB A;  4O3P A;  4UOF A;  2RHQ B;  4ZHR A;  1RAF B;  1WHY A;  3PRD A;  3BQ1 A;  4BS2 A;  1HBN B;  2QA2 A;  3TQ1 A;  1NZ8 A;  1IBM F;  2HGN A;  1N36 F;  2R8G A;  3D54 A;  2AT1 B;  5DET A;  3FZ2 A;  3TQE A;  1HW8 A;  2PA8 D;  2QN6 B;  1DQ8 A;  3L09 A;  4LSZ B;  5DQI A;  2CQ1 A;  5C25 B;  3H5X A;  5HAT A;  4EYH B;  1IXK A;  1S6O A;  1RWO B;  1TKX A;  4M5M A;  1PIL A;  5HI7 A;  1XWL A;  3ILL A;  1LWF B;  3UN5 A;  4YME A;  4O0I A;  1DBD A;  1FCA A;  3F44 A;  2V8P A;  2XZW A;  5AJ3 F;  2ASL A;  2KJW A;  4ZPC A;  3VGV A;  1WF1 A;  1FKO A;  4ZCM A;  2R7Q A;  2EFP A;  2WW4 A;  1T3N A;  4IOC Q;  3KJF B;  4OZ0 A;  4QYZ K;  3B8H A;  4S0M A;  2ZHB A;  3PW0 A;  4DR6 J;  4TKT A;  5CA5 A;  4NYZ A;  1HBU B;  5ETT A;  2V4R A;  2QG9 B;  4NX9 A;  2L48 A;  4F2S A;  2DGW A;  1WKK A;  2WSE C;  3BV8 A;  3CCR S;  1WC0 A;  3CTR A;  3HFV A;  4KHR A;  3MM8 B;  3MR7 A;  4CO3 A;  4P6Q A;  2RKI B;  5F3T A;  2ZBC A;  1KOH A;  5JJB A;  2BAB A;  1JLG B;  1RAO A;  3BB5 A;  5L1K A;  2DR5 A;  2N3L A;  1VHI A;  3ZZP A;  1FRK A;  4M63 A;  2ILY A;  1K1S A;  1U8S A;  4LF4 J;  4O3O A;  1Y7P A;  2DNP A;  1M0S A;  2OUG A;  2L9W A;  5CYJ A;  4OI2 A;  1N32 J;  2AYB A;  2WVD A;  2DNZ A;  5D8H B;  4U95 A;  1JXE A;  1UPP A;  1FFS B;  4C3K A;  1TK5 A;  2U2F A;  2BE2 A;  3HVT A;  2DNN A;  4FYW B;  3TJA A;  2F4F A;  2I0X A;  2DY1 A;  2GHV C;  4Y2I A;  4OV1 A;  2NXU A;  1RHU B;  3TEH B;  4DU7 A;  2MKC A;  3Q83 A;  3JQM A;  1N33 J;  2ZDO A;  3D1O A;  4WFZ A;  2VF3 A;  2NLW A;  5A6P A;  3TAM B;  3OFF A;  4C2M A;  2E7V A;  3ENA A;  1KLN A;  3QO9 B;  4QW8 A;  1JLE B;  3K2Y A;  2AP6 A;  2WW8 A;  1S1X A;  2HIY A;  3GR0 A;  1U49 A;  3EVW A;  1VGY A;  4ZCL A;  4I2Q B;  3PR4 A;  2EBE A;  1Q8B A;  4M5D B;  5KFP A;  1WWH A;  3I0S B;  2AD9 A;  4HI1 A;  1NK8 A;  1DQA A;  4ENO A;  2QZ8 A;  2D9O A;  3JTN A;  4UUX A;  1VQ9 S;  3IR7 B;  3I32 A;  3QJL A;  3THP A;  3PJ9 A;  2POK A;  1KBR A;  5KFN A;  4X4O A;  2QE5 A;  2B6A A;  4B3M F;  1YRU A;  1VRQ C;  3HXM A;  5A8R A;  4DFM A;  3E51 A;  1CC8 A;  3MDF A;  3ENQ A;  2YPZ A;  1S97 A;  2GAG C;  3JXO A;  2WB4 A;  4RW9 A;  3JTO A;  2ZE2 A;  4DSL A;  3LP1 B;  2RSQ A;  2RDJ A;  1DRZ A;  3QQC D;  1MMD A;  8ATC B;  2YXL A;  2O66 A;  2X3D A;  3OPK A;  4DV3 J;  3KUG A;  3ZFV A;  4DR1 F;  3KG1 A;  2IYG A;  2EFV A;  4BC9 A;  2I9S A;  2ZBR A;  1RP5 A;  3TUJ C;  2IVF B;  1ZPW X;  3BGO P;  5K8O A;  1UZD A;  3OTO J;  3WC0 A;  3PYG A;  3W65 A;  3QBC A;  2YNI A;  3IWN C;  2HHH J;  4X65 F;  4DPY A;  3CCS S;  2JX2 A;  3AB2 B;  2JVR A;  1H98 A;  2HFU A;  1Q79 A;  4NXM F;  1G2E A;  4WWS A;  3W2W A;  2EFQ A;  5EGY A;  1P9Q C;  4ER8 A;  4QU7 A;  1S57 A;  4NLO A;  4CH1 A;  1X5P A;  3RGI A;  3M8Z A;  3H40 A;  4JI2 F;  5DDO C;  1LK7 A;  1W25 A;  4RX6 A;  3EGZ A;  1HBM A;  4WTY A;  1JLB B;  1RTI A;  2E5L F;  1RT4 A;  1F3V A;  1V5I B;  2RIJ A;  5KT3 A;  1BGX T;  1FJG J;  2BKO A;  2GQQ A;  3JAM Y;  4RWW A;  2E66 A;  3HVW A;  1RSC A;  5K8N A;  1ZH5 A;  2PI5 A;  3VTI A;  1UWA A;  2B4V A;  4I7F A;  2OJ3 A;  3KMQ A;  4EGL A;  4O44 B;  3GTY X;  4QIF A;  5KFZ A;  4FVC A;  1K44 A;  2YNH A;  4FYY B;  5HVF A;  4J37 A;  4QIG A;  2HHS A;  2WVF A;  5CXT A;  3WQP A;  3W63 A;  1NSA A;  1YTY A;  4LSL B;  1EKS A;  3P4U B;  4RBT A;  1LWC B;  2VQE F;  2DGT A;  1ZOT A;  5D4N A;  3CCL S;  2BDP A;  1NJX A;  4N76 A;  2CAJ A;  4X66 J;  1ITP A;  4PZV A;  5SZT A;  3D1H A;  3ILO A;  4RW8 B;  2J7K A;  2HBZ B;  1HI1 A;  3HZE A;  2FUG 9;  2AV5 A;  1X7V A;  2IAJ B;  2L9N A;  3KLV A;  3DMJ A;  4LF8 F;  2PE8 A;  1YVF A;  1LV5 A;  2N82 B;  3IFE A;  1Q16 B;  1RI7 A;  3V6D A;  3I0R A;  1RT1 A;  4IR9 A;  2IRX A;  2BW7 A;  4DFK A;  5U47 A;  3KHH A;  1TL5 A;  4ZP6 A;  3KTQ A;  1J5O B;  1FO1 A;  4ANC A;  2ACY A;  4Y00 A;  3NCR A;  5FDL A;  2N4C A;  3S01 A;  4DFP A;  4H4O A;  4DU8 A;  1ZBT A;  3FK4 A;  3GMG A;  4ANE A;  1P9Y A;  1U0H A;  2WCX A;  2GAH C;  2ZH4 A;  1UEU A;  2DGX A;  4AUK A;  6AT1 B;  2PA3 A;  3BGR A;  3IXQ A;  4ZIV A;  4ZJL A;  3R5J B;  2HND B;  2DIT A;  3BQ2 A;  3KG0 A;  3G4S S;  2ZH3 A;  2QFI A;  2WAQ D;  4XDC A;  3U7J A;  1RGV A;  2PT0 A;  2VC0 A;  1UFW A;  4LF5 J;  1SH2 A;  2OI2 A;  3BSN A;  4JI3 F;  2GO8 A;  1GMV A;  4Y2K A;  1LFP A;  1S77 D;  2GQC A;  2J9C A;  5LSR A;  2CPX A;  5CZX A;  4I6W A;  2EK6 A;  4FP9 A;  3KLH B;  3UQS A;  2H9Z A;  4URS A;  5FLX Y;  2ZZN A;  2ALZ A;  5B0D A;  1Z1Z A;  2L9D A;  1REG X;  2H51 B;  1CS4 A;  3IGV A;  3DDI A;  2WBR A;  4X4Q A;  4J9O A;  4DV5 F;  2V67 A;  2LDY A;  5HAO A;  4KV8 A;  4LR7 A;  5D0E A;  2AGP A;  1NUE A;  4TY8 B;  3OR1 A;  4Z7C A;  1QUP A;  4UY8 5;  1S0V A;  2FY8 A;  1G7C B;  1SKW A;  2W4P A;  5HO4 A;  2PD1 A;  4DL3 A;  4KY3 A;  2ZC4 A;  3A13 A;  3FEY B;  2OH2 A;  2XMT A;  2R2R A;  5D0R A;  2HVE A;  3AOB A;  3DOM B;  2NXN A;  1HNV A;  1UKU A;  3OFE A;  5BXI A;  3DLK A;  3LO3 A;  2JEI A;  3NMR A;  1EET A;  3DDN A;  4J9U E;  5DLG A;  5FLX U;  3B4M A;  1N88 A;  2XHW A;  1AYE A;  2I1R A;  2W1B A;  3SZ2 A;  1S72 S;  2IMO A;  3E01 A;  1XIQ A;  2VDI A;  1TUG B;  1Z2L A;  2XMW A;  3H7H B;  2CQ0 A;  4X4N A;  4K8R A;  3NP5 A;  3SSR A;  4CZC A;  2AEJ A;  3ADA C;  3R9L A;  1WSV A;  3WDO A;  2H5E A;  2ZKU A;  4RUA A;  5HMX A;  4KGZ B;  2E1P A;  4K0K J;  4NLT A;  4FF2 A;  1JLQ B;  2CQB A;  2OPS A;  2ALY B;  3NWR A;  4ELV A;  2R3V A;  3L95 X;  4MYU A;  3T1H J;  2QL5 B;  4NLG A;  3MPU B;  1HR0 J;  2MKI A;  3BF4 A;  3DXS X;  3IG1 B;  2CAD A;  1Q0N A;  2VA3 A;  3PG9 A;  2MLX A;  2VG6 A;  3CCJ S;  4PQU B;  1UCN A;  3SQO P;  1AFI A;  3DLE B;  4KTQ A;  2RB7 A;  3LP0 B;  2FVQ A;  1LKZ A;  1T3O A;  2B8Q A;  3MAQ A;  1EB0 A;  1SB6 A;  1S9E A;  1URN A;  2AJF E;  2HFN A;  4JI4 J;  2GHW A;  3A8J A;  4DUY J;  3CNQ P;  5AXK A;  3PDN A;  4LSN A;  4RW7 A;  2R7V A;  3ZZZ A;  1S6P B;  4QPT A;  2DR6 A;  3VZI A;  4TLQ A;  4XK8 C;  4NCB A;  2GVD A;  3NS6 A;  3WIV A;  1TK8 A;  2DXD A;  4DUT A;  4M5G A;  2XMK A;  4BBY A;  2M8H A;  1C0T B;  3DOL A;  1ZA2 B;  1ZS6 A;  4YB1 P;  1DJ0 A;  3PZP A;  4LF9 J;  1UTA A;  5ADZ A;  1DUR A;  2CPJ A;  2VA2 A;  3G86 A;  2V2K A;  3Q89 A;  3RAQ A;  4NCG B;  2WON B;  3KYL A;  3CUL A;  2GIF A;  1S6U A;  3R5A A;  4Y3C A;  2ZH7 A;  1SKR A;  3ZZT A;  2DH8 A;  3MFI A;  2PEH A;  2YNG B;  3PVX A;  4K4T A;  1BHN A;  2V63 A;  5IWA J;  2IA0 A;  2EI5 A;  5DZ6 A;  3MM6 B;  3M8S A;  4ZJQ A;  4HTJ A;  3GG1 A;  1WG5 A;  2K7K A;  2HMI B;  5D3G A;  4DV1 J;  1HNW J;  1YJU A;  4P74 A;  3Q8V A;  2AEM A;  1NBE B;  4PYA A;  4DV0 J;  4TQR A;  4ILR A;  4JUZ A;  3SDE A;  4DX5 A;  3RB3 A;  4RW6 B;  2M88 A;  3CJK A;  2V4J B;  4HH1 A;  3BGL A;  1U2C A;  1R6Y A;  2A2D A;  2C3O A;  4ZOS A;  5AE3 A;  1UJ5 A;  1RU2 A;  4FZV A;  4TYB A;  4DSI A;  2C2K B;  4WYL A;  2CPF A;  4QZV B;  1TU0 B;  4A4J A;  1OPZ A;  4J9K A;  5GME A;  4C3M A;  5I3U B;  2XLJ A;  3HJF A;  1HNI B;  1Y10 A;  3ZTS A;  5EX0 A;  1N34 F;  1SJF A;  1NJW A;  4FF4 A;  2I38 A;  2HWI A;  3UN3 A;  2IHR 1;  3S8S A;  2UV8 A;  3H8Y A;  3GG0 A;  2CNL B;  2D3Z A;  3IC1 A; 
#chains in the Genus database with same CATH homology
 2E7V A;  1IVZ A;  2ACM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...