2ACMA

Solution structure of the sea domain of human mucin 1 (muc1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
SFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mucin-1
publication title Autoproteolysis coupled to protein folding in the SEA domain of the membrane-bound MUC1 mucin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 10
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.960 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits SEA domain 2acmA00
1IVZA 2ACMA 2E7VA
chains in the Genus database with same CATH superfamily
1B0TA 5T7LB 2BRKA 2F9JA 1VBYA 5J2QB 2DEJA 1RT2A 1MU2A 2H5JB 4ILLA 3MM8B 3G8TA 4O4GA 2C2NA 4NEZA 4JI6F 5C42A 2BACA 1N5YB 3PNIA 2BJ3A 2KRBA 1QAYA 1F9HA 2HBRB 3CJSA 2RE1A 2E66A 5KFOA 2YKMA 2UVWA 4JBCA 1XMOJ 3RYLA 4Z2XA 3C16B 2VH7A 4OHWA 3K57A 1RTIA 2UXCF 3IWXA 3Q86A 2AJ2A 4ZVUB 3OFHA 4Q8EA 2FHJA 1S1XB 2CJBA 1X4DA 2ZOFA 3TZWA 4OZNA 4PZVA 3R1LA 5ETSA 2GJFA 4MIBA 3H0PA 3KK1B 1IVZA 2DY1A 1LFWA 2V4RA 5KFLA 3DLKB 5AT1B 3F56A 3TJ9A 3MM9A 5CYMA 1RWVB 4C8OA 4GMKA 3NLCA 2E1RA 2DRDA 2QSFA 1KWMA 4HTJA 3W66A 1N36J 4X62F 4AL7A 2SXLA 2PT0A 2GO8A 2QC3A 1DBDA 3NOGA 5IXUA 3V81B 3BYRA 5KFKA 1U1PA 1XERA 2WK4A 5L38A 4JI0F 3TWZA 1PCAA 5C24B 4HL9A 3GILA 3B6BA 1BQMA 1NCLA 2DCUB 5KFZA 2ZD1A 1AYEA 2IJFA 4WFAQ 2M88A 3TO8A 1KS2A 2GQQA 4HHHA 2RDIA 1YKWA 3ENQA 3FCWA 1RBOB 1FRHA 3G6VA 3TW0A 1EETA 1RBAA 2BJEA 5D3GA 2V2QA 2HPUA 5G4DA 5F41A 4TY8B 3G4SS 3UR3C 4F0MA 3G6YA 1SL1A 4HH0A 4EFAC 3VZHA 2MSTA 2OHDA 4DX6A 1B4SA 4DR1F 1KKHA 3W3SA 1X4AA 2KDOA 3D6MB 4OMFG 4JI3J 2PMHA 4FPRA 1RP5A 2ZNYA 3CMQA 5IV4A 5F9LA 2CNOB 2VFRA 1LWCA 4J90A 1B64A 1RT5B 4P7VA 3PTWA 1CJUA 2GA7A 2XQCA 3CCRS 4DFKA 2EC2A 4CLZA 1W2IA 2ZH7A 1QM9A 2C3OA 1RAEB 3WIUA 1WELA 4PWDB 5F8JA 4ECRA 4NZ6A 4HDGA 3MR7A 2RHQB 1HQEA 4P9SA 3WC2A 4RJVA 4DS4A 2OFGX 1HW8A 3QJLA 3M4XA 5A0YB 3OJUA 1ZAWA 1MMDA 2V9KA 3G8QA 5KFEA 3R9LA 1ITPA 5IWAJ 1GMWD 2J0XA 1U2FA 4LSNB 3CDWA 3NS5A 2IVMA 2CNNB 2QYGA 5L1KA 3IS9B 1HPZA 3LP0A 1X4BA 4CO0A 2R7RA 1S0MA 2CPHA 1UJ6A 3L7PA 1GMUA 5LJ3Y 3P6YC 5RUBA 5ETMA 1YJVA 3ZZPA 1WDDA 3KNAA 5GVQA 3NAIA 3R2CJ 1RWUA 5KFNA 1R6YA 2MZJA 4XK8C 4CO5A 4HACB 3C46A 2KG1A 1Q0NA 4O3SA 3UD4P 2FJAB 4FP9A 2YKAA 2U2FA 2AF6A 4IOAQ 3U27A 2R2TA 2P2CB 1SL0A 5DO2A 4RR5A 2AP6A 3Q0AA 3UD3P 2CQ4A 4TU7A 2GIQA 1TL5A 3QLHA 3MTKA 4K4XA 3GCXP 4FS1A 2E5GA 4B3MJ 1Z1ZA 2XHWA 3PFOA 5HMXA 2AGOA 2QL5B 1NMEB 4FYYB 2ZITA 2EKYA 5DETA 3T3FA 2QFJA 2IRXA 2OTJS 1VRTA 1KOOA 1EP4A 1PILA 5HVFA 1K0VA 1ZM3A 2GGPA 2GNKA 4UQGA 1HBUA 3B78A 1YJTA 2PC6A 3D66A 2WSCC 4USKA 2XWXA 3BJYA 1H7XA 1X4HA 4YY3F 2XYGB 1SC3B 3CJTA 2NR0A 2XLIA 4LJMA 2OEKA 1PIEA 2XYHB 3AB2B 2CKWA 2R3VA 4B3SF 2WBMA 3HD2A 1EX8A 1RT3A 3I0RA 4BCAA 3PCOB 3TAPA 2MY8A 3U02A 2BE9B 2WONA 1CULB 4DG1A 1OQ6A 1WG5A 2W4DA 2YH1A 3E01B 2B56A 3GV5B 3V6KA 4ZLNA 4OZ2A 1S9GB 5HQMA 2RDDA 3M1VA 3TYTA 4B3MF 1M5SA 2Z2LA 1CPZA 4MFBA 3FFIB 1SJRA 3E3XA 4FXVA 3VVTA 2DO4A 2EWHA 3PEJA 1RLCL 2CQPA 2BOPA 2V4JA 5BXIA 1LW0B 2ZC4A 3IM9A 1NDLA 1WKKA 3OUYB 2QA2A 5IZHA 4OYOA 1AFJA 4U9RA 4OZLA 1S6QA 4AL6A 4Q45A 3RR7A 3W63A 1RYSA 1BQNA 3FBFA 4DL4A 4LF1A 2P9EA 1RAOA 3POTB 1HI0P 2W01A 4IYQA 3HI9A 4WXWA 3KLHB 2KU7A 2DH9A 2XMMA 4RPFA 4LSLB 3M8PA 4N56A 2G4BA 2BZ2A 3L7UA 4P2SA 1FDNA 2YQ3A 4J7CA 5T41A 2VHGA 1CJKB 3QFHA 2OTLS 4ZVGA 2IM2A 5ITHA 3ZTRA 1TP7A 4BC9A 2JH3A 1UVKA 2W2MP 6AT1B 4L3NA 4C3LA 1VI7A 1HNXJ 3R7SB 4C3MA 2FJDB 1YLXA 5KTQA 1HWKA 3NWGA 1S59A 2IIHA 3KJVA 4DR3J 2DGXA 1RJJA 4B9MA 3P45B 2Q6BA 5B0DA 3QNWB 3WBZA 3GJTB 3UDCA 3SV3A 2G2OA 2ZDOA 1Q86T 2DNPA 2MPUA 1FRJA 1RWWB 4OI6A 1ZZNA 1UFLA 2DGVA 4WBFA 2B8QA 2EG1A 3QAUA 3ZTOA 1EZZB 2XGPA 3DNCA 3D6FB 5CYJA 4M5IA 2BJ7A 4PCQA 1UWAA 3H59A 2XB2D 4G6VB 2E9RX 3DLEA 1D8YA 2XMKA 4DSKA 4HT5A 2NREA 1IBKF 1HI8A 5HK4A 4CO4A 2N3OA 4XIUA 2CAJA 1WI8A 1WD6A 2XMUA 5LSOA 5K20B 4RW9A 1U09A 4DSIA 4U7CA 2W9CB 4Q2LA 5HBMA 3VGVA 1REVB 3JQJA 1SKRA 3THVA 5B0GA 2XHCA 2XCAA 3EMTA 2BW7A 3MPVA 1B70B 4IQXA 1HNXF 1PC5A 2K3KA 3BGLA 3VV2B 2H4WB 1RAHB 4DR7J 3NNHA 3DMJB 2BV3A 1O0PA 1VBXA 3X3UA 1WF0A 2GHVC 3ILLA 4DR3F 2LU1A 2WVDA 2E9ZA 1RZMA 4IH7A 2OKQA 2AJ1A 2M70A 1U0SA 1TFYA 5ETRA 2CYYA 2OMOA 1RU2A 2MTLA 1DRZA 1NLKL 4DR6J 3VHQA 1RB0A 1IR1A 4J37A 2QMXA 5J2PA 1VLOA 3T5HA 4A8QA 2H4YB 1SCJB 1R8PA 3GFXA 4CCHA 2AYEA 4FXWA 4K5RA 2MQOA 1C2PA 4B08A 2Y1IA 2ZZTA 2XBPA 1AZSA 3MPWA 4M5KA 3KK3B 2LXIA 3BSOA 5CZXA 3PDNA 2O5DA 4LBIA 4P2FA 1JLBA 4JI8J 4DQRA 2VA2A 3PG9A 4FKXA 3MD3A 2H48B 3G82A 5HMZA 4RNHA 3GG0A 2OO4A 1OY6A 2Z8QA 4DR7F 3MM7A 5CD4H 2GJ2A 1M5OC 3QGHA 4B9LA 4QW8A 2XSJA 4LRDA 3BS9A 1VLYA 1XMBA 4HR2A 4OLOA 3ZO7A 3OHAA 4IR1A 4N41A 2B9EA 5HROA 4HI1A 1EJ7L 2VC0A 1FEHA 3P4UB 3KUGA 2F8HA 4DL3A 1UKUA 3KLIB 2MZRA 3MMCA 2HRUA 2H5EA 3W1YC 2WW8A 2ZH6A 2VA3A 1HW9A 2WRMA 4NE9C 5FLXY 2HWTA 4AQYJ 2MY7A 2HEKA 4DCJB 3KHRA 3KLGA 1T02A 3DI6A 1IBCB 4F67A 3UQSA 4KE5A 4M8LA 5D4NA 1JLGB 1VQ9S 1N6QB 4OZ0A 5DM7Q 3DYAB 3SDEA 2X1BA 2VQFJ 2M8DB 4F4KA 1UP1A 2ZJPQ 1J2VA 3BO3A 3MFHA 2JC1A 1WJ9A 4OFZA 4PKDB 4A8WA 2FY8A 4JI8F 4J9QA 1I94F 4WF9Q 1OMSA 2IM3A 3R5BA 1N4LA 2FLNA 4NRTA 1Y5LB 3PJWA 3CJ2A 3DDKA 3LF0A 3T1YF 3W5ZA 1GMWA 4F36A 4UZCA 3W9HA 4YDXA 4CI0B 5I3UB 4N8OA 3PFEA 3HMJG 4IG3A 4PXEA 2WB4A 1MMNA 3AJDA 1T95A 2QGFB 3CDEA 4WP9A 2VG6A 4Q8FA 1HWIA 2DO0A 3I31A 1H2TZ 3OBIA 1LNQA 1E6YA 4I2QB 4Q7AA 4ZJOA 3N6MA 5L1JA 2EC0A 1NJZA 3QAEA 2R2SA 4NMXA 2FGOA 5CABA 2ZH9A 1NDKA 3VAIA 3HULA 4YMEA 1JJCB 2MQLA 1NH8A 2JSXA 4AQYF 2OPSA 4B3OA 1OYDA 4KGXB 1U47A 4I6AA 4K4ZA 3A13A 2VDHA 4FF4A 4B3TJ 4IDKA 1ZH5A 1TMJA 3AAWB 3SMZA 3G96A 4QIVA 2B6AA 3IP0A 2HQDA 3K7RA 1OSCA 4X4SA 3ZZTA 2VQFF 3WQPA 2FHKA 3MOZA 1YDLA 3OSNA 5AXMA 1JLEB 2JZ5A 2CPDA 4U7UK 3BQ0A 2MHNA 5KG2A 1IKXA 1DURA 1HD1A 3BO2A 1MG7A 5C25B 1D1UA 1H38A 2IJRA 2JLGA 1FKPB 4JV0A 4NLOA 2QLWA 5LMUF 4Y2CA 2QTWA 1U1OA 1WC5A 2VG5A 1ELOA 3I5CA 1FDAA 2KYZA 4H4KA 2YWFA 4F4AA 2N7CA 4ID5B 1N54B 4Y6IA 5D77A 2OGUA 4CQ1A 4J9LA 4JV5J 2FVSA 4ID8A 4JB8B 5HQ8A 3RB6A 3BPDA 1FX4A 5E41A 5F0WA 4NLGA 1TAQA 1LOUA 3KK2A 3QT6A 4H54A 3Q8RB 4H4OB 3BO4A 1YBUA 2DGTA 1PBAA 2DISA 3C19A 1DTTA 4NL5A 1OO0B 2DGWA 3HO1A 2BE2A 3A3OB 1FJEB 2MKJA 4KKOA 2RHSB 1VRUB 3BB5A 5E3PA 4X4PA 4B3TF 4AXJA 4CLTA 1YG0A 4KQZA 3PW5A 3J7AN 1DHMA 1C1BB 3M9OB 5E3RA 3Q23A 1Q8LA 4DCOB 4IFVA 1W25A 5A8WB 1Q81T 5DG8A 4Y2IA 3JAMU 4PQUA 2EFQA 2PDAA 5I3QA 2DB1A 1NK5A 1Q95G 2QYCA 3DRRA 3ZXWA 2V0NA 3FRZA 3HVTB 2XNRA 4JOUA 4NXNJ 3S01A 2R7WA 1DJ0A 4KFBB 5KG7A 1SKSA 1OIAA 3GB0A 2XMJA 4DJBA 1RTDB 4PYDA 2ATCB 4K0KJ 4GC6A 2M4MA 3FJ2A 4OJGA 4ZPDA 2YWEA 2EFVA 3RBXA 4ECVA 2HHHJ 3AQOA 2FZGB 3GMGA 3NGSA 4OI1A 1FERA 4F4WA 2LQ5A 2HRTA 2C2MB 4EMDA 1IXKA 3H5XA 4JP8A 5L8RC 4F25A 1QTMA 4AE5A 2V2ZA 2ZH5A 3ENVA 3GJRB 4M94A 1HBMA 2BJ9A 2KYXA 1UFKA 2C2ZB 2VL1A 1JLFA 4OJ1A 2DXDA 4IH6A 2VDIA 3TQEA 1JJHA 1F3FA 4E98A 2MKCA 1RI7A 3BBBA 3C6UA 5J1EB 3DLGA 3JSMB 1IBMJ 2EFPA 3VGTA 2EBEA 3CSKA 3GU0A 3UE2A 1KFSA 1QE1B 4M5LA 3CCTA 3DDIA 2CPEA 2AU0A 4LF7F 1FD2A 1QSYA 3ISNC 4Y65A 5F3ZA 4ANEA 3M8QB 3UNYA 1N0UA 2HHSA 2HURA 3BF4A 1TK8A 4NXNF 3EGNA 1EQMA 2HLTA 2P9CA 3OXGA 1HNVB 4K5SA 2A0FB 3EPIA 1V5VA 3BSAA 1Q5YA 4OYMA 1ACMB 4U67Q 5IT9U 2IRUA 1FXDA 4NXMJ 2R8IA 3CCWA 3W5XA 2MQPA 1O51A 3ZTSA 3HT0A 3OXLA 2F5GA 3TP2A 2PGCA 1PYTA 2KJVA 3LQVA 1VBKA 2F8EX 3OL7A 4RW4B 3BSCA 2IHR1 2JNJA 2WOMB 5EN1A 3HKZD 4F8RA 1PG5B 1FKOB 4I67A 3LANA 5KG0A 1QVFR 3EYZA 1UMJA 4TYBA 2N3LA 1D9FA 4KR0B 2F3JA 1DLOA 3FZBA 2HVDA 5DDRC 1ZOTA 4ZVRB 2B4OA 3BBFA 4FVCA 2QLFB 4LFCJ 4WU3A 4F3MA 1CJVB 2X1GA 5KFSA 4CLKA 1RT4B 2LLZA 3P8BB 4QIEA 3DLLQ 3MMJA 2BKPA 5IOLA 5KFFA 5IM0B 1WWHA 1DQAA 2HVZA 3BGRB 4MH8A 3US5A 2GMLA 5DM6Q 2ZJRQ 4AUKA 2DH7A 4YFUA 4BBYA 3M2UA 3DFEA 4R5PA 5A6WA 1PBUA 5DLFA 7FDRA 1UPMB 2F63A 4NXMF 2HWIA 2XLJA 2DR8A 2J0QD 1K44A 2QO3A 1LWEB 3HHLD 2JEFA 5KT2A 4LQ9A 3JYTA 5J2MA 3R5CA 4RU9A 3MAHA 2XZWA 4ZVPB 2L9WA 4FVMA 1BHNA 3GFHA 2Z2MA 3UCZP 1BD6A 3TUJC 4LQ3A 3VCDA 4JI2J 4EWTA 4TVAB 1CC7A 4ZLLA 1S57A 4BWJA 1N33J 3ICLA 1OPZA 3PXGa 1Q8IA 2JLFA 1VIXA 4EYIB 1UJ5A 1XTZA 1YRUA 2W7OA 1JXLA 4AXIA 1TVRB 2PE8A 2Y1RI 4ZP9A 4QYZK 3D3BJ 3OR2A 2YKNB 4K4SA 4KO0B 3FNNA 1H7WA 3KHHA 3M32A 3FSIA 1VQ4S 4LFCF 4OYAA 1CEZA 2A6OA 3T5LA 4X4VA 2OUGA 1WOSA 1RT7A 1GXTA 2LXFA 2J6SA 2X3DA 1O6XA 2L9NA 2CPFA 4O3NA 4DF8A 2FYXA 2NYIA 3GSIA 1E6VB 1S97A 4NI2A 1U24A 2GMHA 3VQSA 1R8BA 4X4UA 3SFUA 2KT2A 3HJVA 4TLQA 2FHMA 2B9YA 1F3VA 2X1FA 3N5BA 3NAHA 3G87A 4DFPA 3Q83A 5IT9Y 2M2BA 3BPSP 4ES3A 2W2QP 2HWHA 3MM9B 4C98A 1S6OA 4JI2F 2KXNB 3F73A 1ZAXA 1N33F 1Y5NB 2J9EA 3SBMA 4R8UA 3KUHA 2IAJB 2ZM6J 4ZPVR 2D9PA 3GIRA 1KTQA 2AQ4A 1XWLA 3OFEA 1CG2A 3BR8A 3MR2A 2B0GA 1JX4A 1B99A 3W2VA 4F4YA 3MCMA 5B7WA 2ZFHA 2DIUA 1Q8KA 2G2ZA 2MJUA 2AJQA 2DNRA 4MYUA 2B5JA 3LPEA 1K0TA 2PEBA 2Y8WA 3TJ8A 5DDOC 3CJRA 1LWFB 3HKWA 2PMZD 3VR1A 1BQMB 5K8NA 5ETVA 4KBIA 4CO2A 4ES2A 3IMQJ 2ADBA 3M8ZA 2VPXB 4MK9A 2K1RA 2LKZA 2D3UA 3GV7B 1YJ9S 1S12A 3K0JA 2WB1D 3L7OA 3MD1A 3ZC4A 1EETB 5D3GB 3HSDA 3DGPB 1P1LA 2GVDA 2RDJA 2AJ0A 2CG4A 3LP1A 4FXDA 1HL6A 5IQ6A 1FK9A 3QT5A 1VCTA 4QWDA 1IQZA 1FNOA 2HK3A 3AA9A 4ECYA 5EGYA 2F1FA 2V50A 1HYSA 1JKHA 3HVWA 4DR5J 4MKBA 3GG1A 4B9UA 4RWWA 2C1EB 4KGZB 1XBWA 2HZVA 1TKXB 3NRBA 2B7BB 1LWCB 2Z2ZA 1P6TA 5KFBA 1XR6A 1YQHA 3TI0A 5D0EA 2VQEJ 2FVRA 2ZM6F 4DX8H 3NGRA 4DX5A 1CJUB 1SH0A 3MPDA 1O8BA 2GX8A 2CJKA 1U1RA 3D54A 1TUGB 2Z0GA 4H4MB 3EUNA 2DGQA 2HQGA 5CZVA 1KNZA 3WHIA 3T19A 3N4WA 3QGPA 1HQEB 2BE7D 2H3EB 2LDIA 3DRXA 4C2MA 1S9EA 2A10A 2EXUA 4P2XA 4M5MA 1H3DA 4FYVB 4MYTA 1D09B 4ZVSB 3C6TA 4YEAA 2XZDB 1S9FA 5F8HA 3R97A 1FA0A 2RS8A 2Q43A 1HPZB 2OI2A 3LP0B 5SZTA 1MWQA 3H2UB 2Q3PA 1KTVA 1HQUB 4LF5J 1A6LA 2UUBJ 4NLPA 4RBTA 1PGZA 4PG5A 3T9ZA 1GXLA 2VBWA 3RZAA 3CC7S 2FUG9 1YITS 2XM3A 3K2YA 2J9CA 4OYPA 1VQSA 2ZOMA 4KB7A 1S0VA 2VQEF 3HX9A 4OI3A 4QYZJ 4CLPA 2RT3A 1J5EF 4UW2A 4ICLA 3QIDA 3WDOA 1MN9A 3CTRA 2NUUG 3MI7X 2J76E 3PYGA 2HIYA 3DRPB 4URSA 1O5JA 3QJJA 1SI9A 3ETMA 2Y0SD 2HZCA 4ITSA 3UN3A 1WTBA 1WORA 5E3CA 1LV5A 4EGLA 3RU0A 3J7Z5 5GADU 4B9NA 3PHEA 1VQ8S 2J7UA 4KV8A 4ZPBA 3KLEA 1KP6A 4NEYA 4IRCA 4ED3A 3DM2A 3AB4B 4ZJLA 1VRTB 3FMBA 1EP4B 2VOOA 3HLUA 1GAOA 2CPZA 2GGPB 2VD3A 1HBUB 5HAOA 5MLCV 3ET6A 4ZVFA 2F4VF 2IC3B 4O44B 1JNRB 3F44A 3N28A 2K7KA 4LF5F 4OV1A 3C66A 5FD1A 2UUBF 1I3OB 5HL7Q 1HHSA 2AW0A 1GT8A 1B0VA 2HZAA 2D74B 4EO8A 2KM8C 3PO5A 2CADA 4G1QB 5D78A 2BJDA 2RQMA 1IWGA 5E0OA 1ZM2A 2IDEA 2RILA 4GKKF 1NJXA 3TA2A 3MAAB 1S6UA 3AH6A 4NCAA 5DJBA 1I1GA 1S1VB 1D9AA 4LIRA 3OTDA 3QO9A 3LO3A 3MM6A 1QTNB 2J9DA 4LFAF 2CPJA 4MIAA 1NDCA 5HJYA 2ALZA 1IBLJ 4C8MA 5BR8J 2W2OP 4C8YA 4DFMA 3C15B 2W4CA 2N82B 4EU0A 1XK8A 4RW8A 1A0OB 1CQMA 2E7XA 2PI5A 4D3GA 3OVSA 1WF2A 3LAMA 1RT6A 5A2QY 4JI4J 3UVJA 2V4JB 3RUBL 1X9WA 1G2EA 4HDHA 4WIQA 3VAHA 2IM1A 1PKUA 1U0HB 5LOQA 4C0HA 2OMLA 1Z2LA 2RRNA 2ROPA 5LJ5Y 2CQ3A 3EGZA 1S6QB 3IAS9 2BKNA 1BXNA 4H4KC 2GZOA 2BUNA 4A8XA 3T1HJ 3TVYA 3NEKA 3W61A 2HKEA 3TA1A 3CD7A 2G1HA 4M95A 1HD0A 1TUWA 1U2RA 1P27B 3ELHA 2AWZA 2KN4A 2BW2A 1FXRA 1YBAA 2ZOGA 5T7LA 4J91A 4J9PA 3THTA 5KT3A 1N52B 1SJFA 2KJWA 2JRSA 1RTJB 5J2QA 3FKBA 4A4JA 1NZ8A 3NGUA 2FVPA 3BKTA 5E2QA 4HVZA 1TL1A 1T03A 2AJ4A 1JJ4A 2HSEB 1IBLF 4FPIA 5BR8F 2B9XA 9ATCB 4IQMA 3K59A 2RQ4A 4B9SA 3R5GA 5D6GA 3C16A 1HWJA 2ZNZA 4V19J 1HNIB 2BM0A 3GV8B 4ZPAA 4C4WA 5F8LA 2G1DA 4ECQA 1HQ2A 1X8DA 1RKJA 4ECTA 4X66J 2EK1A 4WP8A 3KK1A 1T9TA 2ALYB 2PSZA 2FC9A 3QZ7A 5K8OA 1TKTA 4USMA 2Y0BB 1WOOA 4MAKA 3T1HF 3E2EA 2QA4G 2MZSA 3DLEB 3OR1A 2CQ2A 3KG1A 3HP6A 4NLSA 5K14A 5GAGU 4B02A 3G71S 2RS2A 1ZTWA 4P74A 1S7HA 1KDNA 4DN0A 2DR9A 1T11A 3CO0P 1U48A 2AJFE 3SZ2A 3V81A 3SYZA 1AT1B 2AX0A 3M6UA 5IT4A 2DH8A 4QU7A 5HBMB 5THWA 1JJ2R 2ADCA 1EB0A 1M90T 5C24A 2ATLA 1S1UA 3J7A1 1HNWJ 2DBBA 3MEEB 2EFOA 1RUSA 2L08A 3DHWC 3D2WA 3U1MA 1SUQB 5HN0A 5HMWA 4PXCA 3SIPB 4DV7F 1H0HB 4MJKA 5FDLA 1VQOS 4R0EA 4C8NA 4CP5A 2DHGA 4PUOA 5E3AA 4MTPA 3S8SA 4Y2AA 4BC7A 4DR4J 2LQ9A 5GMKa 2HHVA 2OD4A 4FN5A 1QAXA 4QW9A 1CJTB 4DR2J 1Q78A 4RX6A 4J9NA 4TQRA 4RNMA 2V9WA 1QUVA 1KQFB 2HHWA 5J2PB 3LH2S 1IM6A 4LR9A 2QZ8A 1UEKA 3CT9A 2HVEA 1D8ZA 4O3OA 4RW6A 3CCUS 3JXOA 2V2KA 1NSPA 3UCGA 1CLFA 2O3DA 2FQQB 2P8IA 1SIWB 4P71A 4UQTA 3TEHB 1RT5A 1UVNA 1AZSB 3UPFA 4WFNQ 1Z4UA 3RTVA 3VQTA 1F1BB 1YVFA 4RUBA 3G86A 1NEEA 3VTIA 3D9BA 4EYHB 2EW9A 4FNIA 1HNWF 4PWDA 3G82B 3FSYA 3BN7A 4J9OA 4ZPTR 4HHUA 1FJ7A 4MKAA 2MXYA 2A2DA 4OYBA 3OHBA 2CZVC 2IBOA 1RAIB 3MM7B 5GMDA 4LR8A 3HD1A 1HMVB 5A0YA 3NCPA 3PYFA 8RUCA 5F0UA 2FJEB 4B3RF 4ED0A 1AXQA 4A8YA 3E8OA 1VQPS 3VAFA 4YN3B 1LK5A 2B9WA 3PZPA 5HROB 5I3PA 4K50A 3HFZB 1XC9A 3HVAA 1UZDA 1FRIA 4LSZB 3IBCB 2AT1B 4EZ9A 3SCKE 2VPWB 3LGHA 4JI5J 3SFGA 2VG7A 3TEGA 1T9WA 3JSYA 1S48A 3DI6B 4HACA 3B4DA 4CWBA 4NMLA 3H5UA 4Q0BB 1U1QA 4ILRA 5KT4A 3SCIE 2OH2A 1K47A 5AE2A 4C48A 4V1Ak 1LFPA 4NLUA 4PYAA 3H8YA 3KUEA 2M0GB 4ILMA 4P72A 1FNMA 2ERRA 1U8WA 1NSQA 5CQGA 1TK5A 1G3OA 3J7YU 2R9LA 1VYAA 4LFBJ 1LK7A 4CM0A 1NPRA 1PAUB 4RNFA 4F3OA 4V19X 2Q66A 3QRPA 4IG3B 3KMSA 1FT8A 2CQ0A 1NHUA 2VFSA 2XMWA 1NHVA 1NO8A 2RJZA 1RWXB 3A3PB 1F0XA 4KAIA 3R5JB 2CZ9A 2XS7A 2V68A 5EWEA 3J80Y 1V3SA 2VFTA 1E6YB 1WEXA 4RUAA 3GIJA 2V8HA 2L3MA 1EQ0A 4NPOA 1U45A 2ZJQQ 2R8JA 2DHXA 2FDNA 3NXZA 5D0HA 1KLNA 3M9MB 3ISZA 2AX1A 3K5PA 2FPHX 4X64J 1XR5A 3RBDA 2OPPB 3O3LA 2ASLA 2UXCJ 2NXNA 4UOHA 3MEDA 3QATA 2YH0A 3HHNB 2XEXA 4OHZA 3W62A 2EK6A 2CPXA 1UZHA 5HVHA 2XO7A 3W9IA 4C8ZA 4N77A 4ZCIA 3UR0A 4QOTA 4X65F 1JXVA 4AL5A 2N7YA 4WFYA 3DOKB 2X3GA 1X4FA 4ECXA 4C11A 2BYCA 1XEZA 1IKXB 1VQ6S 3BM7A 3E01A 4X62J 4Q44A 2KTQA 5EX3A 4QWCA 3U7JA 3MF5A 3ILOA 1V3RA 1N32F 1GK8A 3RB4A 4DL0C 4N5SA 2K8GA 2ZKUA 1FWLA 1RADB 2M9KA 2ZBQA 3FFIA 2OELA 1AA1B 4Q43A 1UA1A 4LRAA 2OD6A 4J5OA 1CC8A 5A8RA 4I6WA 2YY3A 2OEMA 2ZBPA 2BKOA 2ACMA 4WKYA 3OUYA 3HHLB 1S4EA 2YKQA 3AT1B 1OS5A 2LP4A 2KZZA 2YWKA 2ZZNA 2MKIA 1M1GA 1SJ4P 2HGLA 4F04B 1ZYQA 4DQSA 5KG4A 1AFIA 2NYHA 2Q1LA 4X64F 2VONA 4R25A 1C1CA 3HSZA 2BE2B 1TL4A 4KKOB 4DR1J 1CS4B 4UOGA 1KEKA 5U47A 5HATA 5BYQA 1CJKA 4FNHA 1LWXA 2YNHA 4HLBA 4C8LA 4NLVA 2R2UA 2QN6B 2YXLA 5ETPA 4GRSA 3QGGA 2WCXA 1ZA1B 5MAOA 2ZBCA 4BHQA 4PQUB 2DNOA 2OAUA 4P52A 4DV0J 3FQLA 1ZPWX 5DS7A 3DRYA 2NUHA 1NJIT 3DRRB 1R8AA 4LBPA 2R8GA 4ZS6A 3J81Y 2J6UA 4PRFA 2IMWP 4ZVQB 1LEOA 3TR5A 1Q5VA 1JQGA 2Z30B 3Q8YA 4DSEA 4QBUA 3T41A 3EVMA 3FC9A 2FLLA 3KG0A 3A3NB 5DZ7A 4QWAA 2AGPA 3PW4A 2D9OA 1N5TA 5I42A 1HBMB 4LIWA 2DYAA 2ZH2A 1UAWA 3H40A 1I6JA 4FYDA 1JLFB 2BABA 4LVOP 5LM7E 1X4EA 2JFKA 4ED2A 1UWBB 1Y7PA 1FFSB 3DRSA 4DPWA 1C0TA 2MKKA 1S76D 3MMBB 3VVUA 1C4CA 2V34A 4ANDA 2AEJA 1SV5B 1WEZA 1XNQJ 2ASDA 4LVNP 4PPDA 1PAEX 2K7JA 3CCES 1G6BA 4DV0F 1HHTP 4U8YA 5KT6A 4XO0A 1FWPA 5L39A 1WNEA 2ZE2A 2YNIB 4G1PA 4MK8A 4WZMA 4NCGB 3H90A 2OPQA 3R1HA 3EDRB 3NP5A 1SQEA 3QFWA 3CJ4A 5HSPA 5KFCA 1K73T 3J7ZT 2H54B 2CZ4A 1UW4A 3NBPA 2YTCA 2MB0B 5A8KA 3KDNA 2HQFA 2QLXA 1ZBTA 1VQLS 2ASJA 3KLFB 2FJXA 3HCXA 2VKRA 2VB6A 2JVOA 5D15A 2B3TB 2CPIA 1OQ3A 2FJBB 2JFDA 2HS4A 2LEPA 4YY3J 2NXEA 2HMIB 1U4BA 4WP3A 3KK3A 4N8NA 1YWXA 2VBYA 4U96A 3P5TL 1UFWA 4B3SJ 2QEXS 1U7LA 4FF3A 2PFFB 4DU7A 4PR6A 1NNDA 1XNQF 3CD6S 4ZJQA 4N76A 2MZQA 1OSDA 3UCUP 2J0SD 1LW2B 1FHTA 2EVZA 3H98A 3B4MA 2C2KB 4ZIVA 3EGWB 3PIOQ 3VAJA 4R5PB 3IGNA 2RD5C 3LPYA 4EI2A 2CNKB 5KFUA 4LF4J 1RDRA 3KLIA 2V8GA 1JNZB 4Y3CA 5DDPC 3QIPB 4EEYA 3M6WA 2RQCA 2H9ZA 2XSFA 2DCLA 4LF9J 2VPZB 4RNOA 5T14A 3DOMA 3JQMA 2KT3A 2I8EA 1L5UA 1S1WA 1VFJA 5AXKA 8ATCB 2W7AA 1IJFB 4USJC 2FHJD 3BQ1A 4N7TA 1N6QA 1LXNA 3DYAA 2JLEA 3OD2A 4M63A 2RUGA 2RH3A 5KFRA 1HBNB 2EEYA 1XN9A 1H6KX 4EK2A 3PY8A 1VQMS 3ITHB 1TFWA 4DPYA 1NKCA 3A12A 4CH7A 2FTRA 4A48A 1DFDA 1C0UA 4ZCMA 3CGIA 2YVSA 3D5MA 3EVOA 4LR7A 1RT7B 2CA9A 3M2VB 5CYQA 2RU3A 3GP9A 1R0AA 3H4BA 4ZKAA 4IG0A 2YNFA 1Y10A 2VUGA 2ZVSA 4PWUA 2CIMA 1X9MA 1KRPA 4RBVA 5EDWA 2MLZA 3Q89A 1YJRA 3MM5B 4NLDA 1VGYA 2ROGA 2DNLA 1S72S 1NZAA 2U1AA 3KYLA 4X4RA 4LF4F 2BQUA 1WC6A 3I0SB 2YQ1A 2MQNA 3LW5C 2R2RA 2UUAF 1WC1A 1KBRA 2C2OB 1TELA 4LF9F 1S1TB 5H9EK 1GH8A 3S1TA 2AD9A 4OI0A 3GIKA 4QR1A 2AYBA 2N4CA 3CJKB 1APSA 2DNQA 1HFEL 2A1BA 2NSBA 4R8UB 3OLAA 1Y3KA 5GADI 2J8AA 3OW2R 3MFIA 3R3TA 4P75A 4O23A 4QWBA 4CTAA 2POKA 3VWSA 3FK4A 4FYWB 1K8AT 2ZHOA 2W2NP 3U1LA 1JLEA 2DT9A 3HDSA 3W2VB 1IBKJ 1Q7YT 3M6VA 4NOHA 4DZ6A 4HTIA 3KFWX 3MAQA 3IAM9 4PPZA 2C28A 1S6PB 5C25A 2B5JB 1SC6A 4DV1F 3LA0A 1NK6A 1WF1A 1TAUA 3BREA 4LF8F 3Q8SB 1BQXA 2G0IA 4A8MP 4OYZA 1IKWA 3RAXA 4ID5A 5CD4A 1KSPA 4CNZA 3FUYA 2MGZA 2CQDA 2E44A 4WWSA 5B0CA 2GFFA 2NXUA 3AQPA 4EUVA 3TUIC 3TANA 2GVDB 1FFGB 2RF2B 2MLYA 3MXHP 2BMBA 1YSJA 5FLXU 4AFFA 2B8PA 1FK9B 4OQJA 3LTOA 2GQCA 2GIFA 4P10A 2BX6A 4NRUA 2W4PA 1PYOB 2V6AA 4TLRA 1X5SA 2A2CA 3NOCA 1SJQA 3GFYA 4ZDNA 3EXCX 1IKYA 1VRUA 2LYVA 5KFJA 3QPIA 1NSAA 3PHTA 4L72B 5M2PA 3V2UC 1RWPB 2MEWA 5KFVA 1D0EA 3TZXA 3DDNA 2FVQA 1FJGJ 2VBZA 5DRKA 3GCWP 4CLSA 5A8WA 3BYPA 1HLWA 4I0WA 1TMMA 3I55S 4PG6A 3KLVA 4PWWA 4ZLJA 1WC0A 1TV6A 3EJMA 2YPZA 4KGKA 3VAMA 2I2YA 1T05B 5B0FA 2CJQA 1RWOB 1VJQA 3NGKA 4WTYA 4TQSA 4KFBA 1V5IB 3RRGA 2DGUA 1IQTA 1S9EB 4QQBA 1RTDA 2RIJA 2GV1A 3H42A 1RT1A 3CDUA 3TA0A 2V8VA 2GAHC 1WI6A 3CB4A 4ZVOB 3AA8A 5E5NA 2JC0A 1VQKS 1J5OA 2ZWPA 3UN2A 1C4AA 2JOQA 4HH1A 2EBGA 3VGUA 5DDQC 3C2PA 4BLGA 3HJFA 1FO1A 3M8YA 1SH3A 2CQCA 4KJIA 3U1NA 2YNGA 2E5LF 3ZZUA 1KOHA 4DL6A 2MSSA 5SUHA 2QX0A 5IT0A 3H5SA 2ZHAA 1FVSA 3QJPA 5KG1A 4K2XA 4M5DB 2MZTA 3LALA 2IFXA 2JEIA 3TAMA 1MN7A 4CM2A 4OZ3A 2BEFA 1FJGF 2CVEA 4W92B 8AT1B 3WZ0A 4ICLB 4GO5X 1F9FA 3TVZA 4K8RA 3SEOA 1R43A 4UT4A 5M2UA 5KFTA 4IR9A 2RKIA 1PJ7A 3L9ZA 1M5HA 2VFVA 1P9QC 2JDJA 1X9SA 5JVHQ 5F8NA 4LUBA 2NPIA 5IFMA 1I94J 3H2VE 3MGJA 1WG4A 3RRKA 5GAGI 3T1YJ 5H9FK 3KLEB 3QRRA 4KHPF 4XDCA 2BJ8A 4S0MA 4DUTA 5HLFA 3DCAA 3V4IA 1L3TA 1KN6A 1FFWB 2HHXA 3ENWA 2Z57B 3V6JA 1EAYC 3ET6B 2DIVA 3HVRA 5B0BA 3RW7A 3VAKA 2DNZA 4CYUB 1RHRB 1Q16B 3K17A 3CE8A 2WOMA 5H9EJ 2LFVA 1S0NA 3K5MA 4LREA 3LUYA 3AHPA 4G65A 2XO6A 3CNQP 4CLFA 3AJ1A 5AJ3F 4A47A 4WYWA 4YHHF 3DLHA 3EDQB 3NNCA 1JLQA 4F0KA 3NKYA 1B7YB 3SQGA 3S6EA 5C7PA 2YWHA 5HO4A 2VIHA 4DWIA 1ZTTA 2DPJA 4BWMA 3P5BP 3H2LA 4K59A 3VF0B 5C2GA 3I9V9 3UWTA 1YTYA 4C6AA 1UEVA 2O67A 1KHWA 2I6WA 2IDLA 4YB7A 1AROP 4I64A 1JB0C 2B4PA 3QO9B 3KTQA 1YI2S 4DHVA 2C3PA 3IG1B 3Q22A 2V63A 4IFYA 2A6MA 4XAKA 4QR0A 3BGRA 1F2GA 3K8WA 2IJNA 3FGVA 4I7FB 1Y4ZB 4RW8B 1RA7A 1NSKL 5LMUJ 1WG1A 2UV8G 3ONQA 1LWEA 2HGMA 4DV5J 2R8KA 4WFBQ 3EWGA 1XJWB 3HF5A 3WC0A 3UVJB 1RQ0A 1V3ZA 2V67A 1UA0A 2RNEA 3C14A 4USIA 2XY6A 1FVQA 2IA6A 2HVIA 5LMNJ 3N6LA 4CLUA 4MKVA 4A46A 2X7IA 2ACYA 5JJBA 5DQHA 1FD8A 3IRXB 1X4CA 3CJ3A 2YPYA 3OFGA 4I6YA 3IM8A 5J2NA 1RHMB 3K58A 2VOPA 4KHMA 4ELUA 3ZNUA 4KIAA 3LP2A 3NG8A 2QSWA 1TVRA 1VC6A 2AYMA 4CH1A 2ZHBA 4WFXA 3TQ1A 1BUXA 5F8GA 3D6TB 1N48A 2LQ8A 3EZOA 2JHEA 3I5BA 1WSRA 2UV8A 3A8JA 1PO6A 1ZPVA 4KH1B 2KFZA 4DF4A 4CLYA 5GAEU 2VICA 1TL7A 3BDEA 2LDYA 4A8FA 1TL1B 3Q8PB 1T03B 1B7FA 3C3LA 1VQ5S 2R7TA 1E6VA 2ZH1A 2E29A 3TARA 2VJUA 2KL8A 4RWXA 3FQKA 4W98A 3T5JA 1IKVB 4YB5A 2HNYB 1R0CB 3W7BA 3FBCA 3OSPA 4DV5F 2HK2A 1TUVA 5HP1A 1KLMB 3CPWR 2EPIA 4RUCA 4WTOB 1RAGB 5LMNF 2UUCJ 4BS2A 4JYAJ 2DNNA 4QZVB 2MLXA 3BGOP 3VGSA 1TKTB 3GZ7A 3OR1B 1WKLA 1ZA2B 2AHOB 2WVCA 2R7QA 3J7YI 1MWYA 4C0BA 2OSRA 5K14B 1RWKB 2IAJA 1WEYA 4X4TA 2DVIA 2DRAA 4WPAA 1HARA 3MTJA 1FX2A 2YX1A 1AUDA 1MWZA 2V8PA 3A8EA 3IWLA 4B9TA 1EHWA 4NA3A 4HKQA 2W9BB 1S1UB 3GFZA 5JXSA 1LWFA 1F5AA 4F50A 2LECA 2HG4A 3NMAA 3IA0A 4EBEA 4NASA 4K7QA 4LF7J 4LBHA 1NPKA 5J1PA 5FDLB 3PYDA 5D4OA 2JEJA 4PUOB 3O5TB 1FRXA 5H9FJ 2YQ0A 3CJ8A 2KFNA 1T3NA 3DGPA 2W7PA 2WW4A 4J9MA 1XMOF 3KWMA 5F8IA 2HBYB 2CJ9A 4N47A 4NLWA 2HFOA 1TL3A 4ZOSA 3PIPQ 2UXBJ 1SPBP 2V8DA 3G2XA 1KVJA 1NK7A 3H5YA 2UUCF 2CVIA 4JYAF 2HLUA 4KH0B 2XNQA 2I5JB 4ATNA 2QG9B 1RU1A 4ETXA 5IS2A 3A8KA 4RW6B 1TKXA 2XYPB 2D41A 1V6HA 5AXNA 2DR7A 4KPCA 3BKFA 3PW7A 1FDBA 4GO7X 2VU5A 1JK9B 2GAGC 1NXIA 1N36F 5KFMA 2DXFA 2M3DA 3O2IA 4WJBA 4OI4A 1OY9A 5LXYA 4TNOA 4CO1A 3GWCA 5EX0A 2QLJB 4CLWA 1TK0A 4H4MA 4M5HA 4KPYA 2R7XA 2XMTA 2F8MA 4NA2A 5BYRA 4A8OA 1SC4B 1I51B 3CMES 4O0IA 4XDDA 3OVBA 2BANA 4PXBA 4CT9A 3A4TA 1MLAA 2R7OA 3W8PA 1FJCA 4USWA 4DL7A 3L95X 4MT1A 1T9XA 2JL9A 2YKOA 2BDPA 3AFGA 5GAHU 4GC7A 4CNYA 3OL8A 1X4GA 4G3IA 2LA4A 1VHIA 3V6DB 3HFVA 1DAXA 1YJ7A 4M5GA 3WX8A 2MZ1A 4MMOA 1RWMB 5L1IA 1HQUA 2UXBF 3VZIA 2AIRB 4IRKA 3ZZRA 3NWRA 4Y28C 4JI3F 1RACB 1YGYA 3H7HB 3UN5A 2YBVA 1WHVA 1BLUA 2XCPA 2VG7B 2WVFA 4OYIA 3TJAA 3B54A 4YQWA 4GVLA 4I2PB 2KKHA 3A8IA 4ZPWR 4JI1J 4MK7A 2G9OA 1URRA 1NK8A 3PRBA 1VR6A 1W2BR 2OPRB 1RABB 2HNZA 2WSFC 2D3OR 5H1SV 1NM2A 2Z58B 4W90B 2CPYA 2RRAA 5L46A 3EM1A 5KFHA 1S49A 4C9DA 1TKZA 3DRPA 1RLDA 3UNGC 1UW9A 2GVZB 2EFNA 4WIIA 3NCRA 2J7KA 2GJIA 1Y00A 2AV5A 1UCNA 2W1BA 4HYKA 2HNDB 3FZ2A 4HEA9 4KY3A 4DEZA 2QRRA 1FEEA 5EHHA 4TXSA 2FJVA 1N5VA 3G6ES 2Y1LB 2F7VA 5IWAF 2IM0A 4JUZA 3MDFA 5KFXA 4DLGA 3UO0A 3MMAA 2FLPA 3RRHA 2BVZA 4LMZA 1WTFA 3B8HA 2IC3A 4O44A 5C5JA 1OPIA 4Q5VA 4KRWA 5DQIA 4U95A 1WSVA 2DHAA 3KDOA 1T3OA 4UZBA 1G4CA 3KG4A 2HYIB 1RISA 3CCZA 3KJFB 1AW0A 4G1QA 3T1AA 5KFQA 3MEDB 1NU4A 2FZCB 2XULA 3M30A 5KFAA 2Q6CA 1Q4RA 5GMEA 3PR5B 3AJ2A 3HZGA 4JI1F 1RHUB 3G8SA 3D1OA 2NCKL 4K4TA 3O44A 4EBDA 3RAMA 2RSQA 3TZYA 5CXTA 3MAAA 3M2RA 1JMTA 4E0DA 3TAQA 3RBEA 3QYYA 2JEGA 1JLAB 2O01C 5CAAA 2G0CA 3BZQA 4C11B 3NNAA 3CJ5A 3IN5A 4TY9A 1S1VA 1RAJA 3IR5B 4DMZA 1U1LA 1YJNS 3UI3A 3QRQA 3R8YA 1G1XA 1WHYA 1RHQB 1MROB 3GONA 4TU8A 3PACA 1Q53A 2C3YA 3AXMA 4WK3A 1VQ7S 1H2VZ 3C15A 2KVQE 2YKPA 2MKSA 2WSEC 2E5HA 1H73A 5ETQA 3L3CA 2LU2A 3NS6A 4HT7A 4DOZA 5A8RB 3OTOJ 1RT2B 1MU2B 3TVKA 3PVXA 3OFFA 1N34J 1NJWA 2J8SA 1UEUA 1U0HA 5D4LA 4O4GB 3KJNB 5C42B 1RTHA 1Y11A 1HWUA 2VC1A 1WKJA 1NKEA 2ZH4A 2VODA 4ZVTB 3Q2TC 3RW6A 2UZAA 3FEYB 3FVYA 2DRBA 2YKMB 3DOLA 2VKZG 4DXLA 3WIVA 3ZZ0A 3I4HX 1C1CB 3IGVA 4DS5A 4QPXA 1RTIB 2D1CA 3K5OA 2HGNA 4ELTA 4DPXA 1DTQA 4BDPA 4ZVEA 1HBOA 2YNHB 4OZ5A 4U6PA 2LQJA 4OJ3A 1CQNA 3SCJE 2APOA 4P2MA 3JTNA 1GX5A 2C3MA 4I1TA 5CYMB 2FJWA 2CXEA 4F2SA 1KVKA 3KKFA 1M5VC 5KFWA 1RTJA 1RAAB 3D7SB 4ALZA 2GCFA 3EE3A 5LL6d 3ZZOA 3D3CJ 3I5AA 3W9JA 1X0FA 1J27A 4J9KA 4IO9Q 1GMVA 2H51B 3OTOF 1A7GE 3TRGA 2KXHA 1HNIA 2ZD1B 4ZHRA 3W2WA 1N34F 1PYSB 4L3KA 3MR6A 4OI2A 4UOCA 2MMYA 3NS7B 2MKYA 4Z37A 1Y0HA 3ZZYA 2EFGA 3GE9A 5HMYA 5I42B 1FRMA 3TX8A 2ILYA 4OIXA 2JX2A 2Y8YA 3DRSB 3BQ2A 3D1HA 1C0TB 2LMIA 1TKDA 2IA0A 4OJHA 3GQCA 1A9NB 4ZITA 4KTQA 2PO4A 3D0HE 1RKIA 1S4FA 1KR4A 4OX8A 5DG7A 4ECUA 2BJ1A 3MEEA 4WXOA 4DN9A 1FNXH 1X0PA 5LXRA 1BMQB 2RAQA 3IRWP 1J5EJ 3EVWA 5KT7A 1SUQA 2QIFA 2BA9A 2ZE2B 2I9SA 2DXEA 3UFCX 3NY0A 2OPQB 2CDQA 4J9UE 5A2QU 3DU5A 4ELVA 3I82A 1YHQS 3JSRA 2FB0A 1K9MT 3BN4A 3KHGA 2FIUA 1ZM9A 1NDPA 3NBPB 2CWXA 3IR6B 4B9VA 2QA1A 1CJTA 1P1TA 3FBEA 5D0RA 5A8KB 1OYEA 1RSCA 3OJSA 3N9UC 2KB2A 3FMWA 5ETOA 3AD7C 1VIOA 2VZ9A 2RUSA 1BWEA 5FIIA 2F4VJ 3IBWA 3I56S 1X31C 2O66A 2DITA 1RAFB 2VPYB 1MMLA 1R0BG 1SJ3P 2I1RA 1K1SA 5A76A 2HHQA 1WOPA 3FRYA 1N5QA 4UF4A 2XS2A 5D0GA 4C3KA 2Y9HA 3EZUA 2OSQA 2E9TA 5IC6B 1L3SA 4GKKJ 5KOXA 4ECWA 4AYBD 1SKUB 4EZ6A 3AOAA 1SBRA 1HMVA 2VASA 2NQPA 3R5DA 1NAQA 2LQBA 1HNZJ 1NK9A 2W8LA 1WC3A 1B3TA 3I9ZA 3QLHB 2XGQA 2KG0A 2M5YA 2YWWA 3CCQS 1ZETA 4LFAJ 2XMAA 1MSWD 4PAAA 1Y9OA 4WFZA 1QD1A 3CULA 1SQFA 1U49A 2DPIA 5HI7A 3W65A 4DR6F 4DCPB 4DSLA 4DV3J 1NBEB 3K8VA 5HANA 1NRKA 1D3WA 4MKYA 3ILJA 3DOMB 2PN6A 4D3HA 1FXLA 3MECA 1U2CA 2AMCB 1S1WB 5ETKA 1XMQJ 1IN0A 2IPOB 4Q0BA 1PSDA 3JTPA 5I4MA 1UTAA 3MR5A 2XI3A 1U6FA 4OHVA 3K5LA 4NLYA 2MQQA 1HHQA 1S77D 2AGQA 1N0VC 5L1LA 4ZLPA 2QT7A 3PRDA 1VOMA 4HHJA 4ED7A 1BE4A 1ROFA 1VISA 2EKNA 2W25A 2D7SA 2IYIA 1C0UB 1W7WA 4IH5A 1SQGA 4PQAA 3HM9A 3IWNC 1RT3B 1B0PA 1YRXA 3I0RB 1SH2A 3M9NB 1NB7A 4ECZA 5CYQB 4NLQA 4TKTA 3LAKA 2ZUGA 3TUZC 2WONB 1R0AB 1YRTA 4DG1B 3T6BA 4IG0B 1HNZF 2YNFB 3NCQA 1Q79A 2FHOB 4ZCKA 5DGAA 1WHWA 1F2HA 3UD5A 4ERDA 1T9UA 2DK2A 4O3RA 1YIJS 2K3IA 2E1PA 1SKWA 4YR0A 2R42A 3SSRA 1L3KA 3M1VB 4Z7YA 2J9DE 4Y0FA 4FBTA 1UVIA 1TR0A 4MFBB 3CDBA 3MEGA 1T0TV 5G0RA 2HFVA 4DV3F 1OJ4A 5DG9A 5K8PA 2OPPA 2E1CA 1VC5A 3KOAA 4X2BA 5IV3A 2W2PP 1XMQF 3QWPA 3T9NA 2OIHA 3D0GE 1JLCA 4TYAA 5IC4B 4XPCA 2CFXA 3IXQA 1BQNB 4CTAB 2W24A 4E2FB 3BEGB 2ASYA 3DOKA 1U02A 4WE1A 1QDUB 4GVBA 4WKRA 5KFPA 3M8PB 5ETLA 3Q24A 3UDEA 3GR1A 4DQIA 1VS3A 3GJQB 4ZIWA 1I5OB 3MR3A 3BH7B 4CO3A 4ED6A 4J9VA 4QU6A 1KHVA 4FKYA 2JWNA 2VV5A 3CD0A 2C42A 4U7UD 1NH7A 2B4VA 4C0OC 3NMRA 4RW7A 2ZBIA 1LQ9A 1HKAA 1RYRA 1IKWB 2G0JA 3GLJA 3D67A 2DD8S 3S7RA 4YS2A 2MGZB 1RBLA 1CBKA 1KC8T 4R0JA 4C97A 2HFSA 2QLBB 4ZP7A 4KT0C 1RGVA 3KJVB 3MM8A 2F65A 2UVUA 4QJVA 4DV7J 3CD5A 3HHLA 1N5YA 3MCSA 1SJ1A 2Z2YB 2A3JA 1RK8A 4ED4A 3HSGA 1FE0A 4IKAA 2NSCA 1M5KC 1QLNA 1H72C 3D4JA 2CQ1A 2A18A 4ZCLA 1SIZA 2XI2A 2PA3A 1IKYB 1CS4A 1S1XA 5KFGA 3OTBA 3Q2SC 2HFUA 3R6LB 5IQQA 1NK0A 3BBCA 2B7CB 3AD9C 2F9DA 3VALA 2JJ4D 2GO9A 1P8GA 2HFNA 3MPYA 2KXFA 1GX6A 3DLKA 3M05A 4YR2A 4RKUC 1LKZA 2DKOB 1TV6B 4OZ1A 1S7IA 2CG8A 1GNKA 3V4MA 4RW9B 3CVKA 3L09A 2JVRA 3D0IE 5KG3A 2ZEJA 1QSLA 1FE4A 1WUUA 1HIYA 2CQHA 5KFDA 3A1YG 2DNHA 2X51A 5ADZA 5HQLA 4WK1A 2LA6A 4UY85 3J80U 1RT1B 5KAKA 4JV5F 1FI4A 1VQNS 1R31A 2W9AA 4UTGA 2I0XA 3F41A 3T5KA 3GYGA 1UETA 4RLEA 3CCMS 1J5OB 4B3RJ 4HI2A 5J1NA 2FGCA 5AXLA 4DUYJ 1T8EA 3OL9A 3PEHA 2L48A 2FC8A 5HJXA 2CQGA 1LXJA 2P9GA 3D28A 1N56A 2GS8A 4TY8A 2BM1A 2YNGB 1ZAVA 2L41A 3THPA 3O8WA 4OLPA 4DLEA 2UXDJ 3CCJS 1F5CA 1QSSA 1X5TA 4AD6A 3TX0A 1UWBA 3MUTP 4W4MA 5GAEI 3QT8A 3OLBA 3MMBA 2ZC3A 3N79A 3TAMB 4P6QA 2EG2A 3CC4S 2NZCA 2HS3A 2H1YA 3QSYB 1SV5A 3FEXB 4LRBA 2N4DA 4RU2A 1RTZA 5KT5A 1R6VA 2WTFA 2O1PA 3I6PA 2V4QA 5B0AA 3EXYA 4NYZA 4K4WA 4PG8A 2RKIB 2DR6A 3MUVP 1HR0J 3FDSA 2YNIA 4ED8A 4NCGA 2MKHA 2NS1B 4I69A 1JLBB 4XTTA 4ETZA 5BJRA 1FTRA 1YZ7A 1IJEB 3C8YA 5K5MA 2V69A 4L6V3 4K0KF 1RWNB 1VDHA 5HLFB 3V4IB 2L9DA 1KFDA 1T9YA 2NXCA 2HHHF 4QR2A 2XSJB 2G13A 4DUYF 2XLKA 2ZZMA 3RB3A 1TU0B 2PMWA 4LSNA 3HHKA 4Y34A 3KLFA 5FJ4A 2BOAA 2F40A 3IS9A 4NLXA 4USUA 2UXDF 2QJ3A 2IVFB 3CCLS 2CNLB 3MMCB 4OX7A 3E51A 2HHUA 4ECSA 4NCBA 1JLQB 3MCNA 2HMIA 1XNRJ 4YDDB 2ZKTA 2ABYA 1VK8A 3ETOA 3SQGB 1IBMF 4K4VA 4LF2A 2HIQA 3KLGB 2PI4A 4ZK7M 2ROEA 3D68A 1R27B 2Y3YA 5F9NA 5KG6A 2MYFA 4OYXA 2YX4A 3SDEB 1ULRA 1R3NA 4X65J 1LW2A 4PEOA 3J81U 4O3QA 3PW0A 1HR0F 1WDTA 2D3O1 3PX0A 4IFYB 2MHEA 1F9EB 1ZM4A 2E1AA 2WBRA 1MW7A 3OPKA 3JAMY 4QPTA 1N32J 1Q1KA 3UDLA 4L75A 3NGDA 4PABA 5K8MA 4X4QA 5DGBA 2XMVA 4RNNA 3QIPA 3C14B 3JS9A 1YJUA 3RB0A 3V5RA 3EPGA 2LXUA 1K1QA 4A8KA 4OZJA 2KM8B 2VG6B 2WZ1A 1VBZA 5E33A 4ES1A 2B43A 3G6XA 4F2RA 5J2NB 1S99A 4F4XA 3SSQA 5D4PA 3RAQA 2C2RA 2KRRA 5CCMA 4YB6A 4ED5A 4C8KA 2FD2A 1QAIA 4DBQA 1HBNA 3LGNA 3LP2B 2V2VA 1XNRF 3FEZA 3IO1A 5DZ6A 3CF5Q 2HBQB 2E7WA 3ITHA 4B17A 2OPSB 4B3OB 2PFDA 3PR4A 1NB2A 1P9YA 2F4FA 4Y00A 5GAHI 2GIRA 1FESA 4USVA 1IUJA 2XTJP 5ETNA 4IDKB 3ZZZA 5LSRA 2CWKA 3MOJB 2FVCA 2LEBA 4LRCA 2B6AB 2M8HA 3QWUA 3HXMA 5LSLA 3M2VA 2AZ1A 4WZQA 4L76A 1TTHB 2DGOA 1TL7B 1CULA 4OHYA 2CQIA 3MWBA 4OV6A 4M5JA 1S79A 3TUPA 2XS5A 3MM5A 3ULHA 2P5VA 1M0SA 1S9GA 3H4DA 4NWBA 3D1QA 1DARA 2W8KA 4F0HA 2VG5B 4DV2J 3CUNA 5HP1B 3I0SA 2D69A 2P6SA 4IOCQ 3LWMA 2MQ8A 2IYGA 1VHFA 3NGTA 1S1TA 4CIOA 4C7QA 5JVGQ 2J6TA 3OL6A 1LW0A 4CLLA 5CHCB 1U6BA 5C2CA 3I32A 3CJKA 1AUSL 3NL0A 1SVDA 2BR0A 1S0OA 3SCLE 2GHWA 1N88A 3DKDA 3KK2B 4ZN1A 2E5JA 3M8RA 5JUMA 1U25A 4ED1A 3POTA 3H20A 1URNA 1DTTB 1KQGB 3KLHA 4TU9A 4OX9J 3RJMB 3HHDA 2CQBA 2VBXA 4G1IA 1FRKA 3MPUB 4LSLA 1S6PA 2HRYA 4QIGA 1QY7A 4FZVA 1CVJA 1U8SA 2CJXB 2Z4PA 4EBCA 4IFVB 4IRDA 1KONA 1PJ5A 3M7VA 4ZPCA 1WACA 4KHRA 1DQ8A 4Q2MA 5DLGA 4NZ7A 4K2JA 5M2RA 4FF1A 3ILIA 5EWFA 3AXKA 5AE1A 3GSDA 3FCHA 3L4BC 2R4FA 4Y2MA 5KG5A 1TZ0A 1F6TA 4WYLA 2NZ4A 4KGMA 2RVJA 4DQQA 2RF2A 2GMJA 4OHXA 4UOFA 3MCOA 2KZMA 5B08A 4DV2F 2YWGA 5CA5A 1TL3B 3M6XA 4ZN3A 1V9OA 2HHTA 1U6ZA 2V94A 4DL2A 5E7OB 2IVYA 4DV6J 3BSNA 4QIFA 4PXDA 2NXJA 3O1LA 4QCLA 1UVMA 1IWAA 3G9CA 3I87A 3I96A 3QGIA 4O4RA 3DU6A 2Y1JA 4CZCA 4ENOA 3GTYX 3GR0A 2QFIA 5E3QA 1YK9A 2DNYA 3AOBA 3DLBA 1GTEA 4OX9F 3PJXA 4KYZA 1M1HA 4X84A 1PJ6A 3B82A 1OWXA 3CEDA 3BV8A 3BGFA 4CH0S 1T05A 2BQRA 1KQSR 2HAIA 3C6UB 3DLGB 4DPUA 2W9CA 1MNEA 1REVA 2BANB 2C2EA 1FRLA 2QMUB 3CXCR 4CT8A 2H65B 3HPOA 2VJVA 2IMOA 3JSBA 4F7VA 3DMJA 1FWKA 1G7CB 1R89A 2UUWA 3PV8A 4I56A 1Q7LB 2QL9B 2BXJA 4TN2A 3VAGA 2HHPA 3IBFB 2ZH3A 3W60A 1T7PA 3ENAA 4DV6F 3MEKA 3ZFVA 5EUHA 2UUTA 2KO1A 4DR5F 3BH6B 2R7SA 2NPFA 3BKUA 2CJAA 1X7VA 3KMQA 2UU9J 3P49B 2VFUA 3PX4A 4M5DA 3DGVA 3N5FA 3UW1A 4DQPA 3PW2A 3R7NB 4QIWD 3HSJA 2PA8D 1R8HA 3UDVA 2HNZB 2DHSA 5K9FA 2QV6A 2BRLA 4Y2KA 2EI5A 7AT1B 1TKZB 1U1KA 3SV4A 1RCOB 1DLOB 1YJWS 4UUWA 4IOBA 1QJHA 1D9DA 1VJWA 1YZ6A 4K4UA 4YP3A 2LEAA 3W8GA 5LT5A 2HQCA 1FDDA 4P73A 1KD1T 2H5IB 4ZMMA 1N5SA 3MMAB 2J5AA 4NYOA 4FBUA 4ZVHA 4I4BA 3R2DJ 4QWEA 1NPPA 2UVVA 1SL2A 4CYUA 3M2UB 2RQKA 2OP5A 3N6NA 5AE3A 4O3PA 1AB8A 4FS2A 3PKYA 4PG4A 2PD1A 9RUBA 2HQIA 4J9RA 3CJ0A 1H2UX 5L9NA 2C22A 2UU9F 3JYTB 5J2MB 2UUAJ 2Z56B 4IO1A 3M30B 7FD1A 4IUFA 3RG6A 2B4UA 1NKBA 2DY9A 2AEFA 1H74A 3DN9A 5BYSA 2UVRA 3JQKA 1QUPA 2E5IA 3M2RB 2DJWA 1JLGA 1EKRA 4XPEA 1U1MA 3QSIA 1VQYA 2KHDA 3CCSS 2YX7A 3BDPA 1RHKB 1XQIA 2R7VA 3IG1A 3J81j 3PM9A 4RBUA 4DPOA 3OR2B 1BGXT 5ETTA 4F3QA 3OTCA 3CJQA 4I7FA 1HI1A 3M32B 4DV1J 4LT6A 5KOWA 1R7IA 3LOUA 3JB9k 3GYNA 1ZS6A 4DSJA 1UJ4A 3F0NA 1RHJB 1Q82T 2B51A 1F60B 4LF8J 1Y5IB 2M52A 4GKJJ 4M5NA 5I3UA 3GIMA 1GEHA 2ZWOA 3Q8QB 2IBKA 4MIWA 1RTHB 3R7BB 1W26A 2J0WA 4DX7A 4YB1P 2GQ2A 4KSEB 4NI2B 5EWGA 1DY3A 3DOLB 3GYXB 3IRXA 2XY5A 4I2QA 4DV4J 1EKSA 1RA6A 3EGVA 3HFKA 3K89A 4CDIA 1HWLA 3HT3A 2FZKB 2WHOA 4EO6A 3TZZA 1DTQB 3HHLC 1HBOB 3CDAA 3ZNJ1 3MHYA 1YX2A 3AD8C 4FYXB 4E8UA 5F3TA 3DXSX 2HFZA 3K5NA 3HZEA 3R27A 1S5ZA 4YUDA 1QAJA 4L73A 1JWWA 1R8CA 4YOEA 1UVJA 2XWYA 2ZBRA 3GIIA 4DPTA 2ZDPA 2WAQD 1GTHA 1ICEB 4LRFA 3OVAA 5B09A 1L3UA 1VRQC 3PX6A 3DHXA 2DEIA 2DGSA 4NX9A 3FCVA 4K4YA 1FKPA 3PO4A 3P3DA 1IKVA 3RR8A 2HNYA 3CC2S 4DDFA 3TNVA 1KLMA 4JI4F 3KJQB 4ZHRB 2MDAA 3W2WB 4GKJF 2K1RB 3P96A 4UY8T 4L74A 3OT9A 3EZ5A 1EIYB 2DHHA 3MUMP 2LVWA 2HS0A 3I4PA 3AY0A 4RUHA 6FD1A 3ADAC 2E7VA 4YR3A 4NZ0A 2WVEA 3LP1B 4DV4F 1VK3A 2OEJA 2ZUAA 4U8VA 2NLWA 5CH7B 2QMWA 1S10A 2RB7A 4H4OA 2E5LJ 2D3ZA 2OJ3A 1HYSB 1JKHB 3MZIA 1WC4A 2KVIA 1DQ9A 1X60A 1BWVA 2DNGA 3IR7B 2AYGA 1TQLA 2LCWA 2OLWA 3CWJA 3FBBA 2W9BA 3PRVA 1RCXB 3AOCA 4F02A 4WCEQ 1C1BA 2CJYB 1X5PA 2BBEA 3Q8VA 2WVBA 1GFWB 4OYWA 2J7WA 2KT5A 4QYRA 2ILZA 3LWLA 3ISND 1SB6A 3OV7A 1PC4A 1DZ5A 2UP1A 1Z2ZA 2KHCA 1M5PC 3ZTQA 2KH9A 2MQMA 2R7UA 3CW2C 5JMNA 3DXBA 4ZP6A 2K2PA 3HVTA 3HK2A 4X4NA 2DNKA 3RGIA 4O0NA 4OX6A 3RBZA 4DL5A 2ZVIA 3O6QA 4NYPA 3QT7A 2OFHX 4X66F 4KHPJ 5HVGA 3PKMA 5KFYA 4JV2A 2CRLA 3C6TB 2I5JA 2FLOA 2GHPA 2AEMA 4ZA1A 4OL8A 2HQ3A 1Q8BA 2ZH8A 2C3UA 3DC2A 1SXLA 2GW8A 4NA1A 3CO9A 3X1LB 3PJ9A 3OQ2A 1L3VA 4LF6J 1GXUA 1HA1A 3ZTPA 3LGMA 3R6GB 2HBZB 3WX4A 1T94A 5L9XA 2IY5B 2PIIA 5AJ3J 4YHHJ 1JIHA 4JI7J 4Z7CA 1XIQA 1FTCA 3N01A 4USTA 3KHLA 2KI2A 5J1EA 3JSMA 3AODA 2X1AA 3EX7B 2I38A 3QQCD 2HVHA 1QE1A 6FDRA 3M8SA 2CUYA 1UL3A 4I68A 3FSXA 3TOQA 1JXEA 1Y3JA 3W5YA 4RL1A 3IC1A 2DR5A 3M8QA 1U26A 4DR4F 2E1MC 2DTJA 1HNVA 4DSFA 2C2DA 3V6DA 4URQU 1OY8A 3OXFA 4RZRA 3H25A 1IR2A 1U1NA 3MURP 4DR2F 4KV8B 3SSSA 1ZZFA 5F8MA 1CSJA 4DFJA 3JTOA 3T6JA 3BR9A 1F5BA 3DM2B 3N0VA 3MECB 3V6HA 1IR0A 3CIZA 2XG8A 1KQKA 4I2PA 3PYEA 2VF3A 3QZ8A 3M8WA 3R5AA 1BC6A 1BY9A 1T9VA 2RMLA 4RW4A 4DUZJ 3KNGA 1GQEA 4DI6A 1WHXA 4NLTA 4LF6F 1IM4A 3BGUA 1EARA 2OPRA 1FKOA 4J9SA 2K06A 2QA4S 4DZDA 4JI7F 1FF2A 2RRBA 5DQGA 2COLA 2M7SA 4JV1A 1NJYA 2GVZA 3QMQA 1N8RT 2DNMA 1UVLA 4F4ZA 4KC5A 1VMBA 4A8SA 1FKAF 2HNDA 3DLJA 4F26A 3D6HB 5CCLA 3CMAS 2RU9A 1VC0A 3SQOP 1CJVA 2P6TA 1RT4A 2Q79A 2CDRB 2AZ3A 1UPPA 1YBTA 3MM6B 1XR7A 2XC9A 5IM0A 3GJSB 3W64A 2KFYA 4JI6J 2V5HG 4P7TA 3GPAA 3QBCA 5B0EA 4PG7A 3HHEA 4ANCA 4AT1B 4RO0A 3MEGB 1NUEA 5G0RB 4USHA 1RXOB 1RT6B 4JI5F 4X4OA 2PEHA 2XY7A 1H98A 2G2YA 4FDFA 4KGVB 2QL7B 3EICA 1JLCB 4M1KA 5D8HB 2R8HA 4DUZF 4DU8A 5A6PA 5KFIA 1M1KT 4ER8A 3OTEA 3CCVS 4FF2A 1QVGR 1JLAA 4WE1B 1REGX 2MJNA 1FCAA 4URGA 2HAFA 1X5OA 4GVBB 3CIMA 2FY1A 4UUXA 2BQ3A 4NLRA 1SC1B 2IRYA 3KXDA 1MROA 3SXLA 1RE1B 2GC8A 2HW3A 2YKNA 1KVIA 4CRJA 1NK4A 2XZTB 2AKWB 4LFBF 4JI0J 3Q8UA 1NHKL 2QE5A 4RW7B 4KO0A 3SI8A 4ZP8A 3IFEA 4WU2A
chains in the Genus database with same CATH topology
1IVZA 2ACMA 2E7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IVZ A;  2ACM A;  2E7V A; 
#chains in the Genus database with same CATH topology
 1B0T A;  5T7L B;  2BRK A;  2F9J A;  1VBY A;  5J2Q B;  2DEJ A;  1RT2 A;  1MU2 A;  2H5J B;  4ILL A;  3MM8 B;  3G8T A;  4O4G A;  2C2N A;  4NEZ A;  4JI6 F;  5C42 A;  2BAC A;  1N5Y B;  3PNI A;  2BJ3 A;  2KRB A;  1QAY A;  1F9H A;  2HBR B;  3CJS A;  2RE1 A;  2E66 A;  5KFO A;  2YKM A;  2UVW A;  4JBC A;  1XMO J;  3RYL A;  4Z2X A;  3C16 B;  2VH7 A;  4OHW A;  3K57 A;  1RTI A;  2UXC F;  3IWX A;  3Q86 A;  2AJ2 A;  4ZVU B;  3OFH A;  4Q8E A;  2FHJ A;  1S1X B;  2CJB A;  1X4D A;  2ZOF A;  3TZW A;  4OZN A;  4PZV A;  3R1L A;  5ETS A;  2GJF A;  4MIB A;  3H0P A;  3KK1 B;  1IVZ A;  2DY1 A;  1LFW A;  2V4R A;  5KFL A;  3DLK B;  5AT1 B;  3F56 A;  3TJ9 A;  3MM9 A;  5CYM A;  1RWV B;  4C8O A;  4GMK A;  3NLC A;  2E1R A;  2DRD A;  2QSF A;  1KWM A;  4HTJ A;  3W66 A;  1N36 J;  4X62 F;  4AL7 A;  2SXL A;  2PT0 A;  2GO8 A;  2QC3 A;  1DBD A;  3NOG A;  5IXU A;  3V81 B;  3BYR A;  5KFK A;  1U1P A;  1XER A;  2WK4 A;  5L38 A;  4JI0 F;  3TWZ A;  1PCA A;  5C24 B;  4HL9 A;  3GIL A;  3B6B A;  1BQM A;  1NCL A;  2DCU B;  5KFZ A;  2ZD1 A;  1AYE A;  2IJF A;  4WFA Q;  2M88 A;  3TO8 A;  1KS2 A;  2GQQ A;  4HHH A;  2RDI A;  1YKW A;  3ENQ A;  3FCW A;  1RBO B;  1FRH A;  3G6V A;  3TW0 A;  1EET A;  1RBA A;  2BJE A;  5D3G A;  2V2Q A;  2HPU A;  5G4D A;  5F41 A;  4TY8 B;  3G4S S;  3UR3 C;  4F0M A;  3G6Y A;  1SL1 A;  4HH0 A;  4EFA C;  3VZH A;  2MST A;  2OHD A;  4DX6 A;  1B4S A;  4DR1 F;  1KKH A;  3W3S A;  1X4A A;  2KDO A;  3D6M B;  4OMF G;  4JI3 J;  2PMH A;  4FPR A;  1RP5 A;  2ZNY A;  3CMQ A;  5IV4 A;  5F9L A;  2CNO B;  2VFR A;  1LWC A;  4J90 A;  1B64 A;  1RT5 B;  4P7V A;  3PTW A;  1CJU A;  2GA7 A;  2XQC A;  3CCR S;  4DFK A;  2EC2 A;  4CLZ A;  1W2I A;  2ZH7 A;  1QM9 A;  2C3O A;  1RAE B;  3WIU A;  1WEL A;  4PWD B;  5F8J A;  4ECR A;  4NZ6 A;  4HDG A;  3MR7 A;  2RHQ B;  1HQE A;  4P9S A;  3WC2 A;  4RJV A;  4DS4 A;  2OFG X;  1HW8 A;  3QJL A;  3M4X A;  5A0Y B;  3OJU A;  1ZAW A;  1MMD A;  2V9K A;  3G8Q A;  5KFE A;  3R9L A;  1ITP A;  5IWA J;  1GMW D;  2J0X A;  1U2F A;  4LSN B;  3CDW A;  3NS5 A;  2IVM A;  2CNN B;  2QYG A;  5L1K A;  3IS9 B;  1HPZ A;  3LP0 A;  1X4B A;  4CO0 A;  2R7R A;  1S0M A;  2CPH A;  1UJ6 A;  3L7P A;  1GMU A;  5LJ3 Y;  3P6Y C;  5RUB A;  5ETM A;  1YJV A;  3ZZP A;  1WDD A;  3KNA A;  5GVQ A;  3NAI A;  3R2C J;  1RWU A;  5KFN A;  1R6Y A;  2MZJ A;  4XK8 C;  4CO5 A;  4HAC B;  3C46 A;  2KG1 A;  1Q0N A;  4O3S A;  3UD4 P;  2FJA B;  4FP9 A;  2YKA A;  2U2F A;  2AF6 A;  4IOA Q;  3U27 A;  2R2T A;  2P2C B;  1SL0 A;  5DO2 A;  4RR5 A;  2AP6 A;  3Q0A A;  3UD3 P;  2CQ4 A;  4TU7 A;  2GIQ A;  1TL5 A;  3QLH A;  3MTK A;  4K4X A;  3GCX P;  4FS1 A;  2E5G A;  4B3M J;  1Z1Z A;  2XHW A;  3PFO A;  5HMX A;  2AGO A;  2QL5 B;  1NME B;  4FYY B;  2ZIT A;  2EKY A;  5DET A;  3T3F A;  2QFJ A;  2IRX A;  2OTJ S;  1VRT A;  1KOO A;  1EP4 A;  1PIL A;  5HVF A;  1K0V A;  1ZM3 A;  2GGP A;  2GNK A;  4UQG A;  1HBU A;  3B78 A;  1YJT A;  2PC6 A;  3D66 A;  2WSC C;  4USK A;  2XWX A;  3BJY A;  1H7X A;  1X4H A;  4YY3 F;  2XYG B;  1SC3 B;  3CJT A;  2NR0 A;  2XLI A;  4LJM A;  2OEK A;  1PIE A;  2XYH B;  3AB2 B;  2CKW A;  2R3V A;  4B3S F;  2WBM A;  3HD2 A;  1EX8 A;  1RT3 A;  3I0R A;  4BCA A;  3PCO B;  3TAP A;  2MY8 A;  3U02 A;  2BE9 B;  2WON A;  1CUL B;  4DG1 A;  1OQ6 A;  1WG5 A;  2W4D A;  2YH1 A;  3E01 B;  2B56 A;  3GV5 B;  3V6K A;  4ZLN A;  4OZ2 A;  1S9G B;  5HQM A;  2RDD A;  3M1V A;  3TYT A;  4B3M F;  1M5S A;  2Z2L A;  1CPZ A;  4MFB A;  3FFI B;  1SJR A;  3E3X A;  4FXV A;  3VVT A;  2DO4 A;  2EWH A;  3PEJ A;  1RLC L;  2CQP A;  2BOP A;  2V4J A;  5BXI A;  1LW0 B;  2ZC4 A;  3IM9 A;  1NDL A;  1WKK A;  3OUY B;  2QA2 A;  5IZH A;  4OYO A;  1AFJ A;  4U9R A;  4OZL A;  1S6Q A;  4AL6 A;  4Q45 A;  3RR7 A;  3W63 A;  1RYS A;  1BQN A;  3FBF A;  4DL4 A;  4LF1 A;  2P9E A;  1RAO A;  3POT B;  1HI0 P;  2W01 A;  4IYQ A;  3HI9 A;  4WXW A;  3KLH B;  2KU7 A;  2DH9 A;  2XMM A;  4RPF A;  4LSL B;  3M8P A;  4N56 A;  2G4B A;  2BZ2 A;  3L7U A;  4P2S A;  1FDN A;  2YQ3 A;  4J7C A;  5T41 A;  2VHG A;  1CJK B;  3QFH A;  2OTL S;  4ZVG A;  2IM2 A;  5ITH A;  3ZTR A;  1TP7 A;  4BC9 A;  2JH3 A;  1UVK A;  2W2M P;  6AT1 B;  4L3N A;  4C3L A;  1VI7 A;  1HNX J;  3R7S B;  4C3M A;  2FJD B;  1YLX A;  5KTQ A;  1HWK A;  3NWG A;  1S59 A;  2IIH A;  3KJV A;  4DR3 J;  2DGX A;  1RJJ A;  4B9M A;  3P45 B;  2Q6B A;  5B0D A;  3QNW B;  3WBZ A;  3GJT B;  3UDC A;  3SV3 A;  2G2O A;  2ZDO A;  1Q86 T;  2DNP A;  2MPU A;  1FRJ A;  1RWW B;  4OI6 A;  1ZZN A;  1UFL A;  2DGV A;  4WBF A;  2B8Q A;  2EG1 A;  3QAU A;  3ZTO A;  1EZZ B;  2XGP A;  3DNC A;  3D6F B;  5CYJ A;  4M5I A;  2BJ7 A;  4PCQ A;  1UWA A;  3H59 A;  2XB2 D;  4G6V B;  2E9R X;  3DLE A;  1D8Y A;  2XMK A;  4DSK A;  4HT5 A;  2NRE A;  1IBK F;  1HI8 A;  5HK4 A;  4CO4 A;  2N3O A;  4XIU A;  2CAJ A;  1WI8 A;  1WD6 A;  2XMU A;  5LSO A;  5K20 B;  4RW9 A;  1U09 A;  4DSI A;  4U7C A;  2W9C B;  4Q2L A;  5HBM A;  3VGV A;  1REV B;  3JQJ A;  1SKR A;  3THV A;  5B0G A;  2XHC A;  2XCA A;  3EMT A;  2BW7 A;  3MPV A;  1B70 B;  4IQX A;  1HNX F;  1PC5 A;  2K3K A;  3BGL A;  3VV2 B;  2H4W B;  1RAH B;  4DR7 J;  3NNH A;  3DMJ B;  2BV3 A;  1O0P A;  1VBX A;  3X3U A;  1WF0 A;  2GHV C;  3ILL A;  4DR3 F;  2LU1 A;  2WVD A;  2E9Z A;  1RZM A;  4IH7 A;  2OKQ A;  2AJ1 A;  2M70 A;  1U0S A;  1TFY A;  5ETR A;  2CYY A;  2OMO A;  1RU2 A;  2MTL A;  1DRZ A;  1NLK L;  4DR6 J;  3VHQ A;  1RB0 A;  1IR1 A;  4J37 A;  2QMX A;  5J2P A;  1VLO A;  3T5H A;  4A8Q A;  2H4Y B;  1SCJ B;  1R8P A;  3GFX A;  4CCH A;  2AYE A;  4FXW A;  4K5R A;  2MQO A;  1C2P A;  4B08 A;  2Y1I A;  2ZZT A;  2XBP A;  1AZS A;  3MPW A;  4M5K A;  3KK3 B;  2LXI A;  3BSO A;  5CZX A;  3PDN A;  2O5D A;  4LBI A;  4P2F A;  1JLB A;  4JI8 J;  4DQR A;  2VA2 A;  3PG9 A;  4FKX A;  3MD3 A;  2H48 B;  3G82 A;  5HMZ A;  4RNH A;  3GG0 A;  2OO4 A;  1OY6 A;  2Z8Q A;  4DR7 F;  3MM7 A;  5CD4 H;  2GJ2 A;  1M5O C;  3QGH A;  4B9L A;  4QW8 A;  2XSJ A;  4LRD A;  3BS9 A;  1VLY A;  1XMB A;  4HR2 A;  4OLO A;  3ZO7 A;  3OHA A;  4IR1 A;  4N41 A;  2B9E A;  5HRO A;  4HI1 A;  1EJ7 L;  2VC0 A;  1FEH A;  3P4U B;  3KUG A;  2F8H A;  4DL3 A;  1UKU A;  3KLI B;  2MZR A;  3MMC A;  2HRU A;  2H5E A;  3W1Y C;  2WW8 A;  2ZH6 A;  2VA3 A;  1HW9 A;  2WRM A;  4NE9 C;  5FLX Y;  2HWT A;  4AQY J;  2MY7 A;  2HEK A;  4DCJ B;  3KHR A;  3KLG A;  1T02 A;  3DI6 A;  1IBC B;  4F67 A;  3UQS A;  4KE5 A;  4M8L A;  5D4N A;  1JLG B;  1VQ9 S;  1N6Q B;  4OZ0 A;  5DM7 Q;  3DYA B;  3SDE A;  2X1B A;  2VQF J;  2M8D B;  4F4K A;  1UP1 A;  2ZJP Q;  1J2V A;  3BO3 A;  3MFH A;  2JC1 A;  1WJ9 A;  4OFZ A;  4PKD B;  4A8W A;  2FY8 A;  4JI8 F;  4J9Q A;  1I94 F;  4WF9 Q;  1OMS A;  2IM3 A;  3R5B A;  1N4L A;  2FLN A;  4NRT A;  1Y5L B;  3PJW A;  3CJ2 A;  3DDK A;  3LF0 A;  3T1Y F;  3W5Z A;  1GMW A;  4F36 A;  4UZC A;  3W9H A;  4YDX A;  4CI0 B;  5I3U B;  4N8O A;  3PFE A;  3HMJ G;  4IG3 A;  4PXE A;  2WB4 A;  1MMN A;  3AJD A;  1T95 A;  2QGF B;  3CDE A;  4WP9 A;  2VG6 A;  4Q8F A;  1HWI A;  2DO0 A;  3I31 A;  1H2T Z;  3OBI A;  1LNQ A;  1E6Y A;  4I2Q B;  4Q7A A;  4ZJO A;  3N6M A;  5L1J A;  2EC0 A;  1NJZ A;  3QAE A;  2R2S A;  4NMX A;  2FGO A;  5CAB A;  2ZH9 A;  1NDK A;  3VAI A;  3HUL A;  4YME A;  1JJC B;  2MQL A;  1NH8 A;  2JSX A;  4AQY F;  2OPS A;  4B3O A;  1OYD A;  4KGX B;  1U47 A;  4I6A A;  4K4Z A;  3A13 A;  2VDH A;  4FF4 A;  4B3T J;  4IDK A;  1ZH5 A;  1TMJ A;  3AAW B;  3SMZ A;  3G96 A;  4QIV A;  2B6A A;  3IP0 A;  2HQD A;  3K7R A;  1OSC A;  4X4S A;  3ZZT A;  2VQF F;  3WQP A;  2FHK A;  3MOZ A;  1YDL A;  3OSN A;  5AXM A;  1JLE B;  2JZ5 A;  2CPD A;  4U7U K;  3BQ0 A;  2MHN A;  5KG2 A;  1IKX A;  1DUR A;  1HD1 A;  3BO2 A;  1MG7 A;  5C25 B;  1D1U A;  1H38 A;  2IJR A;  2JLG A;  1FKP B;  4JV0 A;  4NLO A;  2QLW A;  5LMU F;  4Y2C A;  2QTW A;  1U1O A;  1WC5 A;  2VG5 A;  1ELO A;  3I5C A;  1FDA A;  2KYZ A;  4H4K A;  2YWF A;  4F4A A;  2N7C A;  4ID5 B;  1N54 B;  4Y6I A;  5D77 A;  2OGU A;  4CQ1 A;  4J9L A;  4JV5 J;  2FVS A;  4ID8 A;  4JB8 B;  5HQ8 A;  3RB6 A;  3BPD A;  1FX4 A;  5E41 A;  5F0W A;  4NLG A;  1TAQ A;  1LOU A;  3KK2 A;  3QT6 A;  4H54 A;  3Q8R B;  4H4O B;  3BO4 A;  1YBU A;  2DGT A;  1PBA A;  2DIS A;  3C19 A;  1DTT A;  4NL5 A;  1OO0 B;  2DGW A;  3HO1 A;  2BE2 A;  3A3O B;  1FJE B;  2MKJ A;  4KKO A;  2RHS B;  1VRU B;  3BB5 A;  5E3P A;  4X4P A;  4B3T F;  4AXJ A;  4CLT A;  1YG0 A;  4KQZ A;  3PW5 A;  3J7A N;  1DHM A;  1C1B B;  3M9O B;  5E3R A;  3Q23 A;  1Q8L A;  4DCO B;  4IFV A;  1W25 A;  5A8W B;  1Q81 T;  5DG8 A;  4Y2I A;  3JAM U;  4PQU A;  2EFQ A;  2PDA A;  5I3Q A;  2DB1 A;  1NK5 A;  1Q95 G;  2QYC A;  3DRR A;  3ZXW A;  2V0N A;  3FRZ A;  3HVT B;  2XNR A;  4JOU A;  4NXN J;  3S01 A;  2R7W A;  1DJ0 A;  4KFB B;  5KG7 A;  1SKS A;  1OIA A;  3GB0 A;  2XMJ A;  4DJB A;  1RTD B;  4PYD A;  2ATC B;  4K0K J;  4GC6 A;  2M4M A;  3FJ2 A;  4OJG A;  4ZPD A;  2YWE A;  2EFV A;  3RBX A;  4ECV A;  2HHH J;  3AQO A;  2FZG B;  3GMG A;  3NGS A;  4OI1 A;  1FER A;  4F4W A;  2LQ5 A;  2HRT A;  2C2M B;  4EMD A;  1IXK A;  3H5X A;  4JP8 A;  5L8R C;  4F25 A;  1QTM A;  4AE5 A;  2V2Z A;  2ZH5 A;  3ENV A;  3GJR B;  4M94 A;  1HBM A;  2BJ9 A;  2KYX A;  1UFK A;  2C2Z B;  2VL1 A;  1JLF A;  4OJ1 A;  2DXD A;  4IH6 A;  2VDI A;  3TQE A;  1JJH A;  1F3F A;  4E98 A;  2MKC A;  1RI7 A;  3BBB A;  3C6U A;  5J1E B;  3DLG A;  3JSM B;  1IBM J;  2EFP A;  3VGT A;  2EBE A;  3CSK A;  3GU0 A;  3UE2 A;  1KFS A;  1QE1 B;  4M5L A;  3CCT A;  3DDI A;  2CPE A;  2AU0 A;  4LF7 F;  1FD2 A;  1QSY A;  3ISN C;  4Y65 A;  5F3Z A;  4ANE A;  3M8Q B;  3UNY A;  1N0U A;  2HHS A;  2HUR A;  3BF4 A;  1TK8 A;  4NXN F;  3EGN A;  1EQM A;  2HLT A;  2P9C A;  3OXG A;  1HNV B;  4K5S A;  2A0F B;  3EPI A;  1V5V A;  3BSA A;  1Q5Y A;  4OYM A;  1ACM B;  4U67 Q;  5IT9 U;  2IRU A;  1FXD A;  4NXM J;  2R8I A;  3CCW A;  3W5X A;  2MQP A;  1O51 A;  3ZTS A;  3HT0 A;  3OXL A;  2F5G A;  3TP2 A;  2PGC A;  1PYT A;  2KJV A;  3LQV A;  1VBK A;  2F8E X;  3OL7 A;  4RW4 B;  3BSC A;  2IHR 1;  2JNJ A;  2WOM B;  5EN1 A;  3HKZ D;  4F8R A;  1PG5 B;  1FKO B;  4I67 A;  3LAN A;  5KG0 A;  1QVF R;  3EYZ A;  1UMJ A;  4TYB A;  2N3L A;  1D9F A;  4KR0 B;  2F3J A;  1DLO A;  3FZB A;  2HVD A;  5DDR C;  1ZOT A;  4ZVR B;  2B4O A;  3BBF A;  4FVC A;  2QLF B;  4LFC J;  4WU3 A;  4F3M A;  1CJV B;  2X1G A;  5KFS A;  4CLK A;  1RT4 B;  2LLZ A;  3P8B B;  4QIE A;  3DLL Q;  3MMJ A;  2BKP A;  5IOL A;  5KFF A;  5IM0 B;  1WWH A;  1DQA A;  2HVZ A;  3BGR B;  4MH8 A;  3US5 A;  2GML A;  5DM6 Q;  2ZJR Q;  4AUK A;  2DH7 A;  4YFU A;  4BBY A;  3M2U A;  3DFE A;  4R5P A;  5A6W A;  1PBU A;  5DLF A;  7FDR A;  1UPM B;  2F63 A;  4NXM F;  2HWI A;  2XLJ A;  2DR8 A;  2J0Q D;  1K44 A;  2QO3 A;  1LWE B;  3HHL D;  2JEF A;  5KT2 A;  4LQ9 A;  3JYT A;  5J2M A;  3R5C A;  4RU9 A;  3MAH A;  2XZW A;  4ZVP B;  2L9W A;  4FVM A;  1BHN A;  3GFH A;  2Z2M A;  3UCZ P;  1BD6 A;  3TUJ C;  4LQ3 A;  3VCD A;  4JI2 J;  4EWT A;  4TVA B;  1CC7 A;  4ZLL A;  1S57 A;  4BWJ A;  1N33 J;  3ICL A;  1OPZ A;  3PXG a;  1Q8I A;  2JLF A;  1VIX A;  4EYI B;  1UJ5 A;  1XTZ A;  1YRU A;  2W7O A;  1JXL A;  4AXI A;  1TVR B;  2PE8 A;  2Y1R I;  4ZP9 A;  4QYZ K;  3D3B J;  3OR2 A;  2YKN B;  4K4S A;  4KO0 B;  3FNN A;  1H7W A;  3KHH A;  3M32 A;  3FSI A;  1VQ4 S;  4LFC F;  4OYA A;  1CEZ A;  2A6O A;  3T5L A;  4X4V A;  2OUG A;  1WOS A;  1RT7 A;  1GXT A;  2LXF A;  2J6S A;  2X3D A;  1O6X A;  2L9N A;  2CPF A;  4O3N A;  4DF8 A;  2FYX A;  2NYI A;  3GSI A;  1E6V B;  1S97 A;  4NI2 A;  1U24 A;  2GMH A;  3VQS A;  1R8B A;  4X4U A;  3SFU A;  2KT2 A;  3HJV A;  4TLQ A;  2FHM A;  2B9Y A;  1F3V A;  2X1F A;  3N5B A;  3NAH A;  3G87 A;  4DFP A;  3Q83 A;  5IT9 Y;  2M2B A;  3BPS P;  4ES3 A;  2W2Q P;  2HWH A;  3MM9 B;  4C98 A;  1S6O A;  4JI2 F;  2KXN B;  3F73 A;  1ZAX A;  1N33 F;  1Y5N B;  2J9E A;  3SBM A;  4R8U A;  3KUH A;  2IAJ B;  2ZM6 J;  4ZPV R;  2D9P A;  3GIR A;  1KTQ A;  2AQ4 A;  1XWL A;  3OFE A;  1CG2 A;  3BR8 A;  3MR2 A;  2B0G A;  1JX4 A;  1B99 A;  3W2V A;  4F4Y A;  3MCM A;  5B7W A;  2ZFH A;  2DIU A;  1Q8K A;  2G2Z A;  2MJU A;  2AJQ A;  2DNR A;  4MYU A;  2B5J A;  3LPE A;  1K0T A;  2PEB A;  2Y8W A;  3TJ8 A;  5DDO C;  3CJR A;  1LWF B;  3HKW A;  2PMZ D;  3VR1 A;  1BQM B;  5K8N A;  5ETV A;  4KBI A;  4CO2 A;  4ES2 A;  3IMQ J;  2ADB A;  3M8Z A;  2VPX B;  4MK9 A;  2K1R A;  2LKZ A;  2D3U A;  3GV7 B;  1YJ9 S;  1S12 A;  3K0J A;  2WB1 D;  3L7O A;  3MD1 A;  3ZC4 A;  1EET B;  5D3G B;  3HSD A;  3DGP B;  1P1L A;  2GVD A;  2RDJ A;  2AJ0 A;  2CG4 A;  3LP1 A;  4FXD A;  1HL6 A;  5IQ6 A;  1FK9 A;  3QT5 A;  1VCT A;  4QWD A;  1IQZ A;  1FNO A;  2HK3 A;  3AA9 A;  4ECY A;  5EGY A;  2F1F A;  2V50 A;  1HYS A;  1JKH A;  3HVW A;  4DR5 J;  4MKB A;  3GG1 A;  4B9U A;  4RWW A;  2C1E B;  4KGZ B;  1XBW A;  2HZV A;  1TKX B;  3NRB A;  2B7B B;  1LWC B;  2Z2Z A;  1P6T A;  5KFB A;  1XR6 A;  1YQH A;  3TI0 A;  5D0E A;  2VQE J;  2FVR A;  2ZM6 F;  4DX8 H;  3NGR A;  4DX5 A;  1CJU B;  1SH0 A;  3MPD A;  1O8B A;  2GX8 A;  2CJK A;  1U1R A;  3D54 A;  1TUG B;  2Z0G A;  4H4M B;  3EUN A;  2DGQ A;  2HQG A;  5CZV A;  1KNZ A;  3WHI A;  3T19 A;  3N4W A;  3QGP A;  1HQE B;  2BE7 D;  2H3E B;  2LDI A;  3DRX A;  4C2M A;  1S9E A;  2A10 A;  2EXU A;  4P2X A;  4M5M A;  1H3D A;  4FYV B;  4MYT A;  1D09 B;  4ZVS B;  3C6T A;  4YEA A;  2XZD B;  1S9F A;  5F8H A;  3R97 A;  1FA0 A;  2RS8 A;  2Q43 A;  1HPZ B;  2OI2 A;  3LP0 B;  5SZT A;  1MWQ A;  3H2U B;  2Q3P A;  1KTV A;  1HQU B;  4LF5 J;  1A6L A;  2UUB J;  4NLP A;  4RBT A;  1PGZ A;  4PG5 A;  3T9Z A;  1GXL A;  2VBW A;  3RZA A;  3CC7 S;  2FUG 9;  1YIT S;  2XM3 A;  3K2Y A;  2J9C A;  4OYP A;  1VQS A;  2ZOM A;  4KB7 A;  1S0V A;  2VQE F;  3HX9 A;  4OI3 A;  4QYZ J;  4CLP A;  2RT3 A;  1J5E F;  4UW2 A;  4ICL A;  3QID A;  3WDO A;  1MN9 A;  3CTR A;  2NUU G;  3MI7 X;  2J76 E;  3PYG A;  2HIY A;  3DRP B;  4URS A;  1O5J A;  3QJJ A;  1SI9 A;  3ETM A;  2Y0S D;  2HZC A;  4ITS A;  3UN3 A;  1WTB A;  1WOR A;  5E3C A;  1LV5 A;  4EGL A;  3RU0 A;  3J7Z 5;  5GAD U;  4B9N A;  3PHE A;  1VQ8 S;  2J7U A;  4KV8 A;  4ZPB A;  3KLE A;  1KP6 A;  4NEY A;  4IRC A;  4ED3 A;  3DM2 A;  3AB4 B;  4ZJL A;  1VRT B;  3FMB A;  1EP4 B;  2VOO A;  3HLU A;  1GAO A;  2CPZ A;  2GGP B;  2VD3 A;  1HBU B;  5HAO A;  5MLC V;  3ET6 A;  4ZVF A;  2F4V F;  2IC3 B;  4O44 B;  1JNR B;  3F44 A;  3N28 A;  2K7K A;  4LF5 F;  4OV1 A;  3C66 A;  5FD1 A;  2UUB F;  1I3O B;  5HL7 Q;  1HHS A;  2AW0 A;  1GT8 A;  1B0V A;  2HZA A;  2D74 B;  4EO8 A;  2KM8 C;  3PO5 A;  2CAD A;  4G1Q B;  5D78 A;  2BJD A;  2RQM A;  1IWG A;  5E0O A;  1ZM2 A;  2IDE A;  2RIL A;  4GKK F;  1NJX A;  3TA2 A;  3MAA B;  1S6U A;  3AH6 A;  4NCA A;  5DJB A;  1I1G A;  1S1V B;  1D9A A;  4LIR A;  3OTD A;  3QO9 A;  3LO3 A;  3MM6 A;  1QTN B;  2J9D A;  4LFA F;  2CPJ A;  4MIA A;  1NDC A;  5HJY A;  2ALZ A;  1IBL J;  4C8M A;  5BR8 J;  2W2O P;  4C8Y A;  4DFM A;  3C15 B;  2W4C A;  2N82 B;  4EU0 A;  1XK8 A;  4RW8 A;  1A0O B;  1CQM A;  2E7X A;  2PI5 A;  4D3G A;  3OVS A;  1WF2 A;  3LAM A;  1RT6 A;  5A2Q Y;  4JI4 J;  3UVJ A;  2V4J B;  3RUB L;  1X9W A;  1G2E A;  4HDH A;  4WIQ A;  3VAH A;  2IM1 A;  1PKU A;  1U0H B;  5LOQ A;  4C0H A;  2OML A;  1Z2L A;  2RRN A;  2ROP A;  5LJ5 Y;  2CQ3 A;  3EGZ A;  1S6Q B;  3IAS 9;  2BKN A;  1BXN A;  4H4K C;  2GZO A;  2BUN A;  4A8X A;  3T1H J;  3TVY A;  3NEK A;  3W61 A;  2HKE A;  3TA1 A;  3CD7 A;  2G1H A;  4M95 A;  1HD0 A;  1TUW A;  1U2R A;  1P27 B;  3ELH A;  2AWZ A;  2KN4 A;  2BW2 A;  1FXR A;  1YBA A;  2ZOG A;  5T7L A;  4J91 A;  4J9P A;  3THT A;  5KT3 A;  1N52 B;  1SJF A;  2KJW A;  2JRS A;  1RTJ B;  5J2Q A;  3FKB A;  4A4J A;  1NZ8 A;  3NGU A;  2FVP A;  3BKT A;  5E2Q A;  4HVZ A;  1TL1 A;  1T03 A;  2AJ4 A;  1JJ4 A;  2HSE B;  1IBL F;  4FPI A;  5BR8 F;  2B9X A;  9ATC B;  4IQM A;  3K59 A;  2RQ4 A;  4B9S A;  3R5G A;  5D6G A;  3C16 A;  1HWJ A;  2ZNZ A;  4V19 J;  1HNI B;  2BM0 A;  3GV8 B;  4ZPA A;  4C4W A;  5F8L A;  2G1D A;  4ECQ A;  1HQ2 A;  1X8D A;  1RKJ A;  4ECT A;  4X66 J;  2EK1 A;  4WP8 A;  3KK1 A;  1T9T A;  2ALY B;  2PSZ A;  2FC9 A;  3QZ7 A;  5K8O A;  1TKT A;  4USM A;  2Y0B B;  1WOO A;  4MAK A;  3T1H F;  3E2E A;  2QA4 G;  2MZS A;  3DLE B;  3OR1 A;  2CQ2 A;  3KG1 A;  3HP6 A;  4NLS A;  5K14 A;  5GAG U;  4B02 A;  3G71 S;  2RS2 A;  1ZTW A;  4P74 A;  1S7H A;  1KDN A;  4DN0 A;  2DR9 A;  1T11 A;  3CO0 P;  1U48 A;  2AJF E;  3SZ2 A;  3V81 A;  3SYZ A;  1AT1 B;  2AX0 A;  3M6U A;  5IT4 A;  2DH8 A;  4QU7 A;  5HBM B;  5THW A;  1JJ2 R;  2ADC A;  1EB0 A;  1M90 T;  5C24 A;  2ATL A;  1S1U A;  3J7A 1;  1HNW J;  2DBB A;  3MEE B;  2EFO A;  1RUS A;  2L08 A;  3DHW C;  3D2W A;  3U1M A;  1SUQ B;  5HN0 A;  5HMW A;  4PXC A;  3SIP B;  4DV7 F;  1H0H B;  4MJK A;  5FDL A;  1VQO S;  4R0E A;  4C8N A;  4CP5 A;  2DHG A;  4PUO A;  5E3A A;  4MTP A;  3S8S A;  4Y2A A;  4BC7 A;  4DR4 J;  2LQ9 A;  5GMK a;  2HHV A;  2OD4 A;  4FN5 A;  1QAX A;  4QW9 A;  1CJT B;  4DR2 J;  1Q78 A;  4RX6 A;  4J9N A;  4TQR A;  4RNM A;  2V9W A;  1QUV A;  1KQF B;  2HHW A;  5J2P B;  3LH2 S;  1IM6 A;  4LR9 A;  2QZ8 A;  1UEK A;  3CT9 A;  2HVE A;  1D8Z A;  4O3O A;  4RW6 A;  3CCU S;  3JXO A;  2V2K A;  1NSP A;  3UCG A;  1CLF A;  2O3D A;  2FQQ B;  2P8I A;  1SIW B;  4P71 A;  4UQT A;  3TEH B;  1RT5 A;  1UVN A;  1AZS B;  3UPF A;  4WFN Q;  1Z4U A;  3RTV A;  3VQT A;  1F1B B;  1YVF A;  4RUB A;  3G86 A;  1NEE A;  3VTI A;  3D9B A;  4EYH B;  2EW9 A;  4FNI A;  1HNW F;  4PWD A;  3G82 B;  3FSY A;  3BN7 A;  4J9O A;  4ZPT R;  4HHU A;  1FJ7 A;  4MKA A;  2MXY A;  2A2D A;  4OYB A;  3OHB A;  2CZV C;  2IBO A;  1RAI B;  3MM7 B;  5GMD A;  4LR8 A;  3HD1 A;  1HMV B;  5A0Y A;  3NCP A;  3PYF A;  8RUC A;  5F0U A;  2FJE B;  4B3R F;  4ED0 A;  1AXQ A;  4A8Y A;  3E8O A;  1VQP S;  3VAF A;  4YN3 B;  1LK5 A;  2B9W A;  3PZP A;  5HRO B;  5I3P A;  4K50 A;  3HFZ B;  1XC9 A;  3HVA A;  1UZD A;  1FRI A;  4LSZ B;  3IBC B;  2AT1 B;  4EZ9 A;  3SCK E;  2VPW B;  3LGH A;  4JI5 J;  3SFG A;  2VG7 A;  3TEG A;  1T9W A;  3JSY A;  1S48 A;  3DI6 B;  4HAC A;  3B4D A;  4CWB A;  4NML A;  3H5U A;  4Q0B B;  1U1Q A;  4ILR A;  5KT4 A;  3SCI E;  2OH2 A;  1K47 A;  5AE2 A;  4C48 A;  4V1A k;  1LFP A;  4NLU A;  4PYA A;  3H8Y A;  3KUE A;  2M0G B;  4ILM A;  4P72 A;  1FNM A;  2ERR A;  1U8W A;  1NSQ A;  5CQG A;  1TK5 A;  1G3O A;  3J7Y U;  2R9L A;  1VYA A;  4LFB J;  1LK7 A;  4CM0 A;  1NPR A;  1PAU B;  4RNF A;  4F3O A;  4V19 X;  2Q66 A;  3QRP A;  4IG3 B;  3KMS A;  1FT8 A;  2CQ0 A;  1NHU A;  2VFS A;  2XMW A;  1NHV A;  1NO8 A;  2RJZ A;  1RWX B;  3A3P B;  1F0X A;  4KAI A;  3R5J B;  2CZ9 A;  2XS7 A;  2V68 A;  5EWE A;  3J80 Y;  1V3S A;  2VFT A;  1E6Y B;  1WEX A;  4RUA A;  3GIJ A;  2V8H A;  2L3M A;  1EQ0 A;  4NPO A;  1U45 A;  2ZJQ Q;  2R8J A;  2DHX A;  2FDN A;  3NXZ A;  5D0H A;  1KLN A;  3M9M B;  3ISZ A;  2AX1 A;  3K5P A;  2FPH X;  4X64 J;  1XR5 A;  3RBD A;  2OPP B;  3O3L A;  2ASL A;  2UXC J;  2NXN A;  4UOH A;  3MED A;  3QAT A;  2YH0 A;  3HHN B;  2XEX A;  4OHZ A;  3W62 A;  2EK6 A;  2CPX A;  1UZH A;  5HVH A;  2XO7 A;  3W9I A;  4C8Z A;  4N77 A;  4ZCI A;  3UR0 A;  4QOT A;  4X65 F;  1JXV A;  4AL5 A;  2N7Y A;  4WFY A;  3DOK B;  2X3G A;  1X4F A;  4ECX A;  4C11 A;  2BYC A;  1XEZ A;  1IKX B;  1VQ6 S;  3BM7 A;  3E01 A;  4X62 J;  4Q44 A;  2KTQ A;  5EX3 A;  4QWC A;  3U7J A;  3MF5 A;  3ILO A;  1V3R A;  1N32 F;  1GK8 A;  3RB4 A;  4DL0 C;  4N5S A;  2K8G A;  2ZKU A;  1FWL A;  1RAD B;  2M9K A;  2ZBQ A;  3FFI A;  2OEL A;  1AA1 B;  4Q43 A;  1UA1 A;  4LRA A;  2OD6 A;  4J5O A;  1CC8 A;  5A8R A;  4I6W A;  2YY3 A;  2OEM A;  2ZBP A;  2BKO A;  2ACM A;  4WKY A;  3OUY A;  3HHL B;  1S4E A;  2YKQ A;  3AT1 B;  1OS5 A;  2LP4 A;  2KZZ A;  2YWK A;  2ZZN A;  2MKI A;  1M1G A;  1SJ4 P;  2HGL A;  4F04 B;  1ZYQ A;  4DQS A;  5KG4 A;  1AFI A;  2NYH A;  2Q1L A;  4X64 F;  2VON A;  4R25 A;  1C1C A;  3HSZ A;  2BE2 B;  1TL4 A;  4KKO B;  4DR1 J;  1CS4 B;  4UOG A;  1KEK A;  5U47 A;  5HAT A;  5BYQ A;  1CJK A;  4FNH A;  1LWX A;  2YNH A;  4HLB A;  4C8L A;  4NLV A;  2R2U A;  2QN6 B;  2YXL A;  5ETP A;  4GRS A;  3QGG A;  2WCX A;  1ZA1 B;  5MAO A;  2ZBC A;  4BHQ A;  4PQU B;  2DNO A;  2OAU A;  4P52 A;  4DV0 J;  3FQL A;  1ZPW X;  5DS7 A;  3DRY A;  2NUH A;  1NJI T;  3DRR B;  1R8A A;  4LBP A;  2R8G A;  4ZS6 A;  3J81 Y;  2J6U A;  4PRF A;  2IMW P;  4ZVQ B;  1LEO A;  3TR5 A;  1Q5V A;  1JQG A;  2Z30 B;  3Q8Y A;  4DSE A;  4QBU A;  3T41 A;  3EVM A;  3FC9 A;  2FLL A;  3KG0 A;  3A3N B;  5DZ7 A;  4QWA A;  2AGP A;  3PW4 A;  2D9O A;  1N5T A;  5I42 A;  1HBM B;  4LIW A;  2DYA A;  2ZH2 A;  1UAW A;  3H40 A;  1I6J A;  4FYD A;  1JLF B;  2BAB A;  4LVO P;  5LM7 E;  1X4E A;  2JFK A;  4ED2 A;  1UWB B;  1Y7P A;  1FFS B;  3DRS A;  4DPW A;  1C0T A;  2MKK A;  1S76 D;  3MMB B;  3VVU A;  1C4C A;  2V34 A;  4AND A;  2AEJ A;  1SV5 B;  1WEZ A;  1XNQ J;  2ASD A;  4LVN P;  4PPD A;  1PAE X;  2K7J A;  3CCE S;  1G6B A;  4DV0 F;  1HHT P;  4U8Y A;  5KT6 A;  4XO0 A;  1FWP A;  5L39 A;  1WNE A;  2ZE2 A;  2YNI B;  4G1P A;  4MK8 A;  4WZM A;  4NCG B;  3H90 A;  2OPQ A;  3R1H A;  3EDR B;  3NP5 A;  1SQE A;  3QFW A;  3CJ4 A;  5HSP A;  5KFC A;  1K73 T;  3J7Z T;  2H54 B;  2CZ4 A;  1UW4 A;  3NBP A;  2YTC A;  2MB0 B;  5A8K A;  3KDN A;  2HQF A;  2QLX A;  1ZBT A;  1VQL S;  2ASJ A;  3KLF B;  2FJX A;  3HCX A;  2VKR A;  2VB6 A;  2JVO A;  5D15 A;  2B3T B;  2CPI A;  1OQ3 A;  2FJB B;  2JFD A;  2HS4 A;  2LEP A;  4YY3 J;  2NXE A;  2HMI B;  1U4B A;  4WP3 A;  3KK3 A;  4N8N A;  1YWX A;  2VBY A;  4U96 A;  3P5T L;  1UFW A;  4B3S J;  2QEX S;  1U7L A;  4FF3 A;  2PFF B;  4DU7 A;  4PR6 A;  1NND A;  1XNQ F;  3CD6 S;  4ZJQ A;  4N76 A;  2MZQ A;  1OSD A;  3UCU P;  2J0S D;  1LW2 B;  1FHT A;  2EVZ A;  3H98 A;  3B4M A;  2C2K B;  4ZIV A;  3EGW B;  3PIO Q;  3VAJ A;  4R5P B;  3IGN A;  2RD5 C;  3LPY A;  4EI2 A;  2CNK B;  5KFU A;  4LF4 J;  1RDR A;  3KLI A;  2V8G A;  1JNZ B;  4Y3C A;  5DDP C;  3QIP B;  4EEY A;  3M6W A;  2RQC A;  2H9Z A;  2XSF A;  2DCL A;  4LF9 J;  2VPZ B;  4RNO A;  5T14 A;  3DOM A;  3JQM A;  2KT3 A;  2I8E A;  1L5U A;  1S1W A;  1VFJ A;  5AXK A;  8ATC B;  2W7A A;  1IJF B;  4USJ C;  2FHJ D;  3BQ1 A;  4N7T A;  1N6Q A;  1LXN A;  3DYA A;  2JLE A;  3OD2 A;  4M63 A;  2RUG A;  2RH3 A;  5KFR A;  1HBN B;  2EEY A;  1XN9 A;  1H6K X;  4EK2 A;  3PY8 A;  1VQM S;  3ITH B;  1TFW A;  4DPY A;  1NKC A;  3A12 A;  4CH7 A;  2FTR A;  4A48 A;  1DFD A;  1C0U A;  4ZCM A;  3CGI A;  2YVS A;  3D5M A;  3EVO A;  4LR7 A;  1RT7 B;  2CA9 A;  3M2V B;  5CYQ A;  2RU3 A;  3GP9 A;  1R0A A;  3H4B A;  4ZKA A;  4IG0 A;  2YNF A;  1Y10 A;  2VUG A;  2ZVS A;  4PWU A;  2CIM A;  1X9M A;  1KRP A;  4RBV A;  5EDW A;  2MLZ A;  3Q89 A;  1YJR A;  3MM5 B;  4NLD A;  1VGY A;  2ROG A;  2DNL A;  1S72 S;  1NZA A;  2U1A A;  3KYL A;  4X4R A;  4LF4 F;  2BQU A;  1WC6 A;  3I0S B;  2YQ1 A;  2MQN A;  3LW5 C;  2R2R A;  2UUA F;  1WC1 A;  1KBR A;  2C2O B;  1TEL A;  4LF9 F;  1S1T B;  5H9E K;  1GH8 A;  3S1T A;  2AD9 A;  4OI0 A;  3GIK A;  4QR1 A;  2AYB A;  2N4C A;  3CJK B;  1APS A;  2DNQ A;  1HFE L;  2A1B A;  2NSB A;  4R8U B;  3OLA A;  1Y3K A;  5GAD I;  2J8A A;  3OW2 R;  3MFI A;  3R3T A;  4P75 A;  4O23 A;  4QWB A;  4CTA A;  2POK A;  3VWS A;  3FK4 A;  4FYW B;  1K8A T;  2ZHO A;  2W2N P;  3U1L A;  1JLE A;  2DT9 A;  3HDS A;  3W2V B;  1IBK J;  1Q7Y T;  3M6V A;  4NOH A;  4DZ6 A;  4HTI A;  3KFW X;  3MAQ A;  3IAM 9;  4PPZ A;  2C28 A;  1S6P B;  5C25 A;  2B5J B;  1SC6 A;  4DV1 F;  3LA0 A;  1NK6 A;  1WF1 A;  1TAU A;  3BRE A;  4LF8 F;  3Q8S B;  1BQX A;  2G0I A;  4A8M P;  4OYZ A;  1IKW A;  3RAX A;  4ID5 A;  5CD4 A;  1KSP A;  4CNZ A;  3FUY A;  2MGZ A;  2CQD A;  2E44 A;  4WWS A;  5B0C A;  2GFF A;  2NXU A;  3AQP A;  4EUV A;  3TUI C;  3TAN A;  2GVD B;  1FFG B;  2RF2 B;  2MLY A;  3MXH P;  2BMB A;  1YSJ A;  5FLX U;  4AFF A;  2B8P A;  1FK9 B;  4OQJ A;  3LTO A;  2GQC A;  2GIF A;  4P10 A;  2BX6 A;  4NRU A;  2W4P A;  1PYO B;  2V6A A;  4TLR A;  1X5S A;  2A2C A;  3NOC A;  1SJQ A;  3GFY A;  4ZDN A;  3EXC X;  1IKY A;  1VRU A;  2LYV A;  5KFJ A;  3QPI A;  1NSA A;  3PHT A;  4L72 B;  5M2P A;  3V2U C;  1RWP B;  2MEW A;  5KFV A;  1D0E A;  3TZX A;  3DDN A;  2FVQ A;  1FJG J;  2VBZ A;  5DRK A;  3GCW P;  4CLS A;  5A8W A;  3BYP A;  1HLW A;  4I0W A;  1TMM A;  3I55 S;  4PG6 A;  3KLV A;  4PWW A;  4ZLJ A;  1WC0 A;  1TV6 A;  3EJM A;  2YPZ A;  4KGK A;  3VAM A;  2I2Y A;  1T05 B;  5B0F A;  2CJQ A;  1RWO B;  1VJQ A;  3NGK A;  4WTY A;  4TQS A;  4KFB A;  1V5I B;  3RRG A;  2DGU A;  1IQT A;  1S9E B;  4QQB A;  1RTD A;  2RIJ A;  2GV1 A;  3H42 A;  1RT1 A;  3CDU A;  3TA0 A;  2V8V A;  2GAH C;  1WI6 A;  3CB4 A;  4ZVO B;  3AA8 A;  5E5N A;  2JC0 A;  1VQK S;  1J5O A;  2ZWP A;  3UN2 A;  1C4A A;  2JOQ A;  4HH1 A;  2EBG A;  3VGU A;  5DDQ C;  3C2P A;  4BLG A;  3HJF A;  1FO1 A;  3M8Y A;  1SH3 A;  2CQC A;  4KJI A;  3U1N A;  2YNG A;  2E5L F;  3ZZU A;  1KOH A;  4DL6 A;  2MSS A;  5SUH A;  2QX0 A;  5IT0 A;  3H5S A;  2ZHA A;  1FVS A;  3QJP A;  5KG1 A;  4K2X A;  4M5D B;  2MZT A;  3LAL A;  2IFX A;  2JEI A;  3TAM A;  1MN7 A;  4CM2 A;  4OZ3 A;  2BEF A;  1FJG F;  2CVE A;  4W92 B;  8AT1 B;  3WZ0 A;  4ICL B;  4GO5 X;  1F9F A;  3TVZ A;  4K8R A;  3SEO A;  1R43 A;  4UT4 A;  5M2U A;  5KFT A;  4IR9 A;  2RKI A;  1PJ7 A;  3L9Z A;  1M5H A;  2VFV A;  1P9Q C;  2JDJ A;  1X9S A;  5JVH Q;  5F8N A;  4LUB A;  2NPI A;  5IFM A;  1I94 J;  3H2V E;  3MGJ A;  1WG4 A;  3RRK A;  5GAG I;  3T1Y J;  5H9F K;  3KLE B;  3QRR A;  4KHP F;  4XDC A;  2BJ8 A;  4S0M A;  4DUT A;  5HLF A;  3DCA A;  3V4I A;  1L3T A;  1KN6 A;  1FFW B;  2HHX A;  3ENW A;  2Z57 B;  3V6J A;  1EAY C;  3ET6 B;  2DIV A;  3HVR A;  5B0B A;  3RW7 A;  3VAK A;  2DNZ A;  4CYU B;  1RHR B;  1Q16 B;  3K17 A;  3CE8 A;  2WOM A;  5H9E J;  2LFV A;  1S0N A;  3K5M A;  4LRE A;  3LUY A;  3AHP A;  4G65 A;  2XO6 A;  3CNQ P;  4CLF A;  3AJ1 A;  5AJ3 F;  4A47 A;  4WYW A;  4YHH F;  3DLH A;  3EDQ B;  3NNC A;  1JLQ A;  4F0K A;  3NKY A;  1B7Y B;  3SQG A;  3S6E A;  5C7P A;  2YWH A;  5HO4 A;  2VIH A;  4DWI A;  1ZTT A;  2DPJ A;  4BWM A;  3P5B P;  3H2L A;  4K59 A;  3VF0 B;  5C2G A;  3I9V 9;  3UWT A;  1YTY A;  4C6A A;  1UEV A;  2O67 A;  1KHW A;  2I6W A;  2IDL A;  4YB7 A;  1ARO P;  4I64 A;  1JB0 C;  2B4P A;  3QO9 B;  3KTQ A;  1YI2 S;  4DHV A;  2C3P A;  3IG1 B;  3Q22 A;  2V63 A;  4IFY A;  2A6M A;  4XAK A;  4QR0 A;  3BGR A;  1F2G A;  3K8W A;  2IJN A;  3FGV A;  4I7F B;  1Y4Z B;  4RW8 B;  1RA7 A;  1NSK L;  5LMU J;  1WG1 A;  2UV8 G;  3ONQ A;  1LWE A;  2HGM A;  4DV5 J;  2R8K A;  4WFB Q;  3EWG A;  1XJW B;  3HF5 A;  3WC0 A;  3UVJ B;  1RQ0 A;  1V3Z A;  2V67 A;  1UA0 A;  2RNE A;  3C14 A;  4USI A;  2XY6 A;  1FVQ A;  2IA6 A;  2HVI A;  5LMN J;  3N6L A;  4CLU A;  4MKV A;  4A46 A;  2X7I A;  2ACY A;  5JJB A;  5DQH A;  1FD8 A;  3IRX B;  1X4C A;  3CJ3 A;  2YPY A;  3OFG A;  4I6Y A;  3IM8 A;  5J2N A;  1RHM B;  3K58 A;  2VOP A;  4KHM A;  4ELU A;  3ZNU A;  4KIA A;  3LP2 A;  3NG8 A;  2QSW A;  1TVR A;  1VC6 A;  2AYM A;  4CH1 A;  2ZHB A;  4WFX A;  3TQ1 A;  1BUX A;  5F8G A;  3D6T B;  1N48 A;  2LQ8 A;  3EZO A;  2JHE A;  3I5B A;  1WSR A;  2UV8 A;  3A8J A;  1PO6 A;  1ZPV A;  4KH1 B;  2KFZ A;  4DF4 A;  4CLY A;  5GAE U;  2VIC A;  1TL7 A;  3BDE A;  2LDY A;  4A8F A;  1TL1 B;  3Q8P B;  1T03 B;  1B7F A;  3C3L A;  1VQ5 S;  2R7T A;  1E6V A;  2ZH1 A;  2E29 A;  3TAR A;  2VJU A;  2KL8 A;  4RWX A;  3FQK A;  4W98 A;  3T5J A;  1IKV B;  4YB5 A;  2HNY B;  1R0C B;  3W7B A;  3FBC A;  3OSP A;  4DV5 F;  2HK2 A;  1TUV A;  5HP1 A;  1KLM B;  3CPW R;  2EPI A;  4RUC A;  4WTO B;  1RAG B;  5LMN F;  2UUC J;  4BS2 A;  4JYA J;  2DNN A;  4QZV B;  2MLX A;  3BGO P;  3VGS A;  1TKT B;  3GZ7 A;  3OR1 B;  1WKL A;  1ZA2 B;  2AHO B;  2WVC A;  2R7Q A;  3J7Y I;  1MWY A;  4C0B A;  2OSR A;  5K14 B;  1RWK B;  2IAJ A;  1WEY A;  4X4T A;  2DVI A;  2DRA A;  4WPA A;  1HAR A;  3MTJ A;  1FX2 A;  2YX1 A;  1AUD A;  1MWZ A;  2V8P A;  3A8E A;  3IWL A;  4B9T A;  1EHW A;  4NA3 A;  4HKQ A;  2W9B B;  1S1U B;  3GFZ A;  5JXS A;  1LWF A;  1F5A A;  4F50 A;  2LEC A;  2HG4 A;  3NMA A;  3IA0 A;  4EBE A;  4NAS A;  4K7Q A;  4LF7 J;  4LBH A;  1NPK A;  5J1P A;  5FDL B;  3PYD A;  5D4O A;  2JEJ A;  4PUO B;  3O5T B;  1FRX A;  5H9F J;  2YQ0 A;  3CJ8 A;  2KFN A;  1T3N A;  3DGP A;  2W7P A;  2WW4 A;  4J9M A;  1XMO F;  3KWM A;  5F8I A;  2HBY B;  2CJ9 A;  4N47 A;  4NLW A;  2HFO A;  1TL3 A;  4ZOS A;  3PIP Q;  2UXB J;  1SPB P;  2V8D A;  3G2X A;  1KVJ A;  1NK7 A;  3H5Y A;  2UUC F;  2CVI A;  4JYA F;  2HLU A;  4KH0 B;  2XNQ A;  2I5J B;  4ATN A;  2QG9 B;  1RU1 A;  4ETX A;  5IS2 A;  3A8K A;  4RW6 B;  1TKX A;  2XYP B;  2D41 A;  1V6H A;  5AXN A;  2DR7 A;  4KPC A;  3BKF A;  3PW7 A;  1FDB A;  4GO7 X;  2VU5 A;  1JK9 B;  2GAG C;  1NXI A;  1N36 F;  5KFM A;  2DXF A;  2M3D A;  3O2I A;  4WJB A;  4OI4 A;  1OY9 A;  5LXY A;  4TNO A;  4CO1 A;  3GWC A;  5EX0 A;  2QLJ B;  4CLW A;  1TK0 A;  4H4M A;  4M5H A;  4KPY A;  2R7X A;  2XMT A;  2F8M A;  4NA2 A;  5BYR A;  4A8O A;  1SC4 B;  1I51 B;  3CME S;  4O0I A;  4XDD A;  3OVB A;  2BAN A;  4PXB A;  4CT9 A;  3A4T A;  1MLA A;  2R7O A;  3W8P A;  1FJC A;  4USW A;  4DL7 A;  3L95 X;  4MT1 A;  1T9X A;  2JL9 A;  2YKO A;  2BDP A;  3AFG A;  5GAH U;  4GC7 A;  4CNY A;  3OL8 A;  1X4G A;  4G3I A;  2LA4 A;  1VHI A;  3V6D B;  3HFV A;  1DAX A;  1YJ7 A;  4M5G A;  3WX8 A;  2MZ1 A;  4MMO A;  1RWM B;  5L1I A;  1HQU A;  2UXB F;  3VZI A;  2AIR B;  4IRK A;  3ZZR A;  3NWR A;  4Y28 C;  4JI3 F;  1RAC B;  1YGY A;  3H7H B;  3UN5 A;  2YBV A;  1WHV A;  1BLU A;  2XCP A;  2VG7 B;  2WVF A;  4OYI A;  3TJA A;  3B54 A;  4YQW A;  4GVL A;  4I2P B;  2KKH A;  3A8I A;  4ZPW R;  4JI1 J;  4MK7 A;  2G9O A;  1URR A;  1NK8 A;  3PRB A;  1VR6 A;  1W2B R;  2OPR B;  1RAB B;  2HNZ A;  2WSF C;  2D3O R;  5H1S V;  1NM2 A;  2Z58 B;  4W90 B;  2CPY A;  2RRA A;  5L46 A;  3EM1 A;  5KFH A;  1S49 A;  4C9D A;  1TKZ A;  3DRP A;  1RLD A;  3UNG C;  1UW9 A;  2GVZ B;  2EFN A;  4WII A;  3NCR A;  2J7K A;  2GJI A;  1Y00 A;  2AV5 A;  1UCN A;  2W1B A;  4HYK A;  2HND B;  3FZ2 A;  4HEA 9;  4KY3 A;  4DEZ A;  2QRR A;  1FEE A;  5EHH A;  4TXS A;  2FJV A;  1N5V A;  3G6E S;  2Y1L B;  2F7V A;  5IWA F;  2IM0 A;  4JUZ A;  3MDF A;  5KFX A;  4DLG A;  3UO0 A;  3MMA A;  2FLP A;  3RRH A;  2BVZ A;  4LMZ A;  1WTF A;  3B8H A;  2IC3 A;  4O44 A;  5C5J A;  1OPI A;  4Q5V A;  4KRW A;  5DQI A;  4U95 A;  1WSV A;  2DHA A;  3KDO A;  1T3O A;  4UZB A;  1G4C A;  3KG4 A;  2HYI B;  1RIS A;  3CCZ A;  3KJF B;  1AW0 A;  4G1Q A;  3T1A A;  5KFQ A;  3MED B;  1NU4 A;  2FZC B;  2XUL A;  3M30 A;  5KFA A;  2Q6C A;  1Q4R A;  5GME A;  3PR5 B;  3AJ2 A;  3HZG A;  4JI1 F;  1RHU B;  3G8S A;  3D1O A;  2NCK L;  4K4T A;  3O44 A;  4EBD A;  3RAM A;  2RSQ A;  3TZY A;  5CXT A;  3MAA A;  3M2R A;  1JMT A;  4E0D A;  3TAQ A;  3RBE A;  3QYY A;  2JEG A;  1JLA B;  2O01 C;  5CAA A;  2G0C A;  3BZQ A;  4C11 B;  3NNA A;  3CJ5 A;  3IN5 A;  4TY9 A;  1S1V A;  1RAJ A;  3IR5 B;  4DMZ A;  1U1L A;  1YJN S;  3UI3 A;  3QRQ A;  3R8Y A;  1G1X A;  1WHY A;  1RHQ B;  1MRO B;  3GON A;  4TU8 A;  3PAC A;  1Q53 A;  2C3Y A;  3AXM A;  4WK3 A;  1VQ7 S;  1H2V Z;  3C15 A;  2KVQ E;  2YKP A;  2MKS A;  2WSE C;  2E5H A;  1H73 A;  5ETQ A;  3L3C A;  2LU2 A;  3NS6 A;  4HT7 A;  4DOZ A;  5A8R B;  3OTO J;  1RT2 B;  1MU2 B;  3TVK A;  3PVX A;  3OFF A;  1N34 J;  1NJW A;  2J8S A;  1UEU A;  1U0H A;  5D4L A;  4O4G B;  3KJN B;  5C42 B;  1RTH A;  1Y11 A;  1HWU A;  2VC1 A;  1WKJ A;  1NKE A;  2ZH4 A;  2VOD A;  4ZVT B;  3Q2T C;  3RW6 A;  2UZA A;  3FEY B;  3FVY A;  2DRB A;  2YKM B;  3DOL A;  2VKZ G;  4DXL A;  3WIV A;  3ZZ0 A;  3I4H X;  1C1C B;  3IGV A;  4DS5 A;  4QPX A;  1RTI B;  2D1C A;  3K5O A;  2HGN A;  4ELT A;  4DPX A;  1DTQ A;  4BDP A;  4ZVE A;  1HBO A;  2YNH B;  4OZ5 A;  4U6P A;  2LQJ A;  4OJ3 A;  1CQN A;  3SCJ E;  2APO A;  4P2M A;  3JTN A;  1GX5 A;  2C3M A;  4I1T A;  5CYM B;  2FJW A;  2CXE A;  4F2S A;  1KVK A;  3KKF A;  1M5V C;  5KFW A;  1RTJ A;  1RAA B;  3D7S B;  4ALZ A;  2GCF A;  3EE3 A;  5LL6 d;  3ZZO A;  3D3C J;  3I5A A;  3W9J A;  1X0F A;  1J27 A;  4J9K A;  4IO9 Q;  1GMV A;  2H51 B;  3OTO F;  1A7G E;  3TRG A;  2KXH A;  1HNI A;  2ZD1 B;  4ZHR A;  3W2W A;  1N34 F;  1PYS B;  4L3K A;  3MR6 A;  4OI2 A;  4UOC A;  2MMY A;  3NS7 B;  2MKY A;  4Z37 A;  1Y0H A;  3ZZY A;  2EFG A;  3GE9 A;  5HMY A;  5I42 B;  1FRM A;  3TX8 A;  2ILY A;  4OIX A;  2JX2 A;  2Y8Y A;  3DRS B;  3BQ2 A;  3D1H A;  1C0T B;  2LMI A;  1TKD A;  2IA0 A;  4OJH A;  3GQC A;  1A9N B;  4ZIT A;  4KTQ A;  2PO4 A;  3D0H E;  1RKI A;  1S4F A;  1KR4 A;  4OX8 A;  5DG7 A;  4ECU A;  2BJ1 A;  3MEE A;  4WXO A;  4DN9 A;  1FNX H;  1X0P A;  5LXR A;  1BMQ B;  2RAQ A;  3IRW P;  1J5E J;  3EVW A;  5KT7 A;  1SUQ A;  2QIF A;  2BA9 A;  2ZE2 B;  2I9S A;  2DXE A;  3UFC X;  3NY0 A;  2OPQ B;  2CDQ A;  4J9U E;  5A2Q U;  3DU5 A;  4ELV A;  3I82 A;  1YHQ S;  3JSR A;  2FB0 A;  1K9M T;  3BN4 A;  3KHG A;  2FIU A;  1ZM9 A;  1NDP A;  3NBP B;  2CWX A;  3IR6 B;  4B9V A;  2QA1 A;  1CJT A;  1P1T A;  3FBE A;  5D0R A;  5A8K B;  1OYE A;  1RSC A;  3OJS A;  3N9U C;  2KB2 A;  3FMW A;  5ETO A;  3AD7 C;  1VIO A;  2VZ9 A;  2RUS A;  1BWE A;  5FII A;  2F4V J;  3IBW A;  3I56 S;  1X31 C;  2O66 A;  2DIT A;  1RAF B;  2VPY B;  1MML A;  1R0B G;  1SJ3 P;  2I1R A;  1K1S A;  5A76 A;  2HHQ A;  1WOP A;  3FRY A;  1N5Q A;  4UF4 A;  2XS2 A;  5D0G A;  4C3K A;  2Y9H A;  3EZU A;  2OSQ A;  2E9T A;  5IC6 B;  1L3S A;  4GKK J;  5KOX A;  4ECW A;  4AYB D;  1SKU B;  4EZ6 A;  3AOA A;  1SBR A;  1HMV A;  2VAS A;  2NQP A;  3R5D A;  1NAQ A;  2LQB A;  1HNZ J;  1NK9 A;  2W8L A;  1WC3 A;  1B3T A;  3I9Z A;  3QLH B;  2XGQ A;  2KG0 A;  2M5Y A;  2YWW A;  3CCQ S;  1ZET A;  4LFA J;  2XMA A;  1MSW D;  4PAA A;  1Y9O A;  4WFZ A;  1QD1 A;  3CUL A;  1SQF A;  1U49 A;  2DPI A;  5HI7 A;  3W65 A;  4DR6 F;  4DCP B;  4DSL A;  4DV3 J;  1NBE B;  3K8V A;  5HAN A;  1NRK A;  1D3W A;  4MKY A;  3ILJ A;  3DOM B;  2PN6 A;  4D3H A;  1FXL A;  3MEC A;  1U2C A;  2AMC B;  1S1W B;  5ETK A;  1XMQ J;  1IN0 A;  2IPO B;  4Q0B A;  1PSD A;  3JTP A;  5I4M A;  1UTA A;  3MR5 A;  2XI3 A;  1U6F A;  4OHV A;  3K5L A;  4NLY A;  2MQQ A;  1HHQ A;  1S77 D;  2AGQ A;  1N0V C;  5L1L A;  4ZLP A;  2QT7 A;  3PRD A;  1VOM A;  4HHJ A;  4ED7 A;  1BE4 A;  1ROF A;  1VIS A;  2EKN A;  2W25 A;  2D7S A;  2IYI A;  1C0U B;  1W7W A;  4IH5 A;  1SQG A;  4PQA A;  3HM9 A;  3IWN C;  1RT3 B;  1B0P A;  1YRX A;  3I0R B;  1SH2 A;  3M9N B;  1NB7 A;  4ECZ A;  5CYQ B;  4NLQ A;  4TKT A;  3LAK A;  2ZUG A;  3TUZ C;  2WON B;  1R0A B;  1YRT A;  4DG1 B;  3T6B A;  4IG0 B;  1HNZ F;  2YNF B;  3NCQ A;  1Q79 A;  2FHO B;  4ZCK A;  5DGA A;  1WHW A;  1F2H A;  3UD5 A;  4ERD A;  1T9U A;  2DK2 A;  4O3R A;  1YIJ S;  2K3I A;  2E1P A;  1SKW A;  4YR0 A;  2R42 A;  3SSR A;  1L3K A;  3M1V B;  4Z7Y A;  2J9D E;  4Y0F A;  4FBT A;  1UVI A;  1TR0 A;  4MFB B;  3CDB A;  3MEG A;  1T0T V;  5G0R A;  2HFV A;  4DV3 F;  1OJ4 A;  5DG9 A;  5K8P A;  2OPP A;  2E1C A;  1VC5 A;  3KOA A;  4X2B A;  5IV3 A;  2W2P P;  1XMQ F;  3QWP A;  3T9N A;  2OIH A;  3D0G E;  1JLC A;  4TYA A;  5IC4 B;  4XPC A;  2CFX A;  3IXQ A;  1BQN B;  4CTA B;  2W24 A;  4E2F B;  3BEG B;  2ASY A;  3DOK A;  1U02 A;  4WE1 A;  1QDU B;  4GVB A;  4WKR A;  5KFP A;  3M8P B;  5ETL A;  3Q24 A;  3UDE A;  3GR1 A;  4DQI A;  1VS3 A;  3GJQ B;  4ZIW A;  1I5O B;  3MR3 A;  3BH7 B;  4CO3 A;  4ED6 A;  4J9V A;  4QU6 A;  1KHV A;  4FKY A;  2JWN A;  2VV5 A;  3CD0 A;  2C42 A;  4U7U D;  1NH7 A;  2B4V A;  4C0O C;  3NMR A;  4RW7 A;  2ZBI A;  1LQ9 A;  1HKA A;  1RYR A;  1IKW B;  2G0J A;  3GLJ A;  3D67 A;  2DD8 S;  3S7R A;  4YS2 A;  2MGZ B;  1RBL A;  1CBK A;  1KC8 T;  4R0J A;  4C97 A;  2HFS A;  2QLB B;  4ZP7 A;  4KT0 C;  1RGV A;  3KJV B;  3MM8 A;  2F65 A;  2UVU A;  4QJV A;  4DV7 J;  3CD5 A;  3HHL A;  1N5Y A;  3MCS A;  1SJ1 A;  2Z2Y B;  2A3J A;  1RK8 A;  4ED4 A;  3HSG A;  1FE0 A;  4IKA A;  2NSC A;  1M5K C;  1QLN A;  1H72 C;  3D4J A;  2CQ1 A;  2A18 A;  4ZCL A;  1SIZ A;  2XI2 A;  2PA3 A;  1IKY B;  1CS4 A;  1S1X A;  5KFG A;  3OTB A;  3Q2S C;  2HFU A;  3R6L B;  5IQQ A;  1NK0 A;  3BBC A;  2B7C B;  3AD9 C;  2F9D A;  3VAL A;  2JJ4 D;  2GO9 A;  1P8G A;  2HFN A;  3MPY A;  2KXF A;  1GX6 A;  3DLK A;  3M05 A;  4YR2 A;  4RKU C;  1LKZ A;  2DKO B;  1TV6 B;  4OZ1 A;  1S7I A;  2CG8 A;  1GNK A;  3V4M A;  4RW9 B;  3CVK A;  3L09 A;  2JVR A;  3D0I E;  5KG3 A;  2ZEJ A;  1QSL A;  1FE4 A;  1WUU A;  1HIY A;  2CQH A;  5KFD A;  3A1Y G;  2DNH A;  2X51 A;  5ADZ A;  5HQL A;  4WK1 A;  2LA6 A;  4UY8 5;  3J80 U;  1RT1 B;  5KAK A;  4JV5 F;  1FI4 A;  1VQN S;  1R31 A;  2W9A A;  4UTG A;  2I0X A;  3F41 A;  3T5K A;  3GYG A;  1UET A;  4RLE A;  3CCM S;  1J5O B;  4B3R J;  4HI2 A;  5J1N A;  2FGC A;  5AXL A;  4DUY J;  1T8E A;  3OL9 A;  3PEH A;  2L48 A;  2FC8 A;  5HJX A;  2CQG A;  1LXJ A;  2P9G A;  3D28 A;  1N56 A;  2GS8 A;  4TY8 A;  2BM1 A;  2YNG B;  1ZAV A;  2L41 A;  3THP A;  3O8W A;  4OLP A;  4DLE A;  2UXD J;  3CCJ S;  1F5C A;  1QSS A;  1X5T A;  4AD6 A;  3TX0 A;  1UWB A;  3MUT P;  4W4M A;  5GAE I;  3QT8 A;  3OLB A;  3MMB A;  2ZC3 A;  3N79 A;  3TAM B;  4P6Q A;  2EG2 A;  3CC4 S;  2NZC A;  2HS3 A;  2H1Y A;  3QSY B;  1SV5 A;  3FEX B;  4LRB A;  2N4D A;  4RU2 A;  1RTZ A;  5KT5 A;  1R6V A;  2WTF A;  2O1P A;  3I6P A;  2V4Q A;  5B0A A;  3EXY A;  4NYZ A;  4K4W A;  4PG8 A;  2RKI B;  2DR6 A;  3MUV P;  1HR0 J;  3FDS A;  2YNI A;  4ED8 A;  4NCG A;  2MKH A;  2NS1 B;  4I69 A;  1JLB B;  4XTT A;  4ETZ A;  5BJR A;  1FTR A;  1YZ7 A;  1IJE B;  3C8Y A;  5K5M A;  2V69 A;  4L6V 3;  4K0K F;  1RWN B;  1VDH A;  5HLF B;  3V4I B;  2L9D A;  1KFD A;  1T9Y A;  2NXC A;  2HHH F;  4QR2 A;  2XSJ B;  2G13 A;  4DUY F;  2XLK A;  2ZZM A;  3RB3 A;  1TU0 B;  2PMW A;  4LSN A;  3HHK A;  4Y34 A;  3KLF A;  5FJ4 A;  2BOA A;  2F40 A;  3IS9 A;  4NLX A;  4USU A;  2UXD F;  2QJ3 A;  2IVF B;  3CCL S;  2CNL B;  3MMC B;  4OX7 A;  3E51 A;  2HHU A;  4ECS A;  4NCB A;  1JLQ B;  3MCN A;  2HMI A;  1XNR J;  4YDD B;  2ZKT A;  2ABY A;  1VK8 A;  3ETO A;  3SQG B;  1IBM F;  4K4V A;  4LF2 A;  2HIQ A;  3KLG B;  2PI4 A;  4ZK7 M;  2ROE A;  3D68 A;  1R27 B;  2Y3Y A;  5F9N A;  5KG6 A;  2MYF A;  4OYX A;  2YX4 A;  3SDE B;  1ULR A;  1R3N A;  4X65 J;  1LW2 A;  4PEO A;  3J81 U;  4O3Q A;  3PW0 A;  1HR0 F;  1WDT A;  2D3O 1;  3PX0 A;  4IFY B;  2MHE A;  1F9E B;  1ZM4 A;  2E1A A;  2WBR A;  1MW7 A;  3OPK A;  3JAM Y;  4QPT A;  1N32 J;  1Q1K A;  3UDL A;  4L75 A;  3NGD A;  4PAB A;  5K8M A;  4X4Q A;  5DGB A;  2XMV A;  4RNN A;  3QIP A;  3C14 B;  3JS9 A;  1YJU A;  3RB0 A;  3V5R A;  3EPG A;  2LXU A;  1K1Q A;  4A8K A;  4OZJ A;  2KM8 B;  2VG6 B;  2WZ1 A;  1VBZ A;  5E33 A;  4ES1 A;  2B43 A;  3G6X A;  4F2R A;  5J2N B;  1S99 A;  4F4X A;  3SSQ A;  5D4P A;  3RAQ A;  2C2R A;  2KRR A;  5CCM A;  4YB6 A;  4ED5 A;  4C8K A;  2FD2 A;  1QAI A;  4DBQ A;  1HBN A;  3LGN A;  3LP2 B;  2V2V A;  1XNR F;  3FEZ A;  3IO1 A;  5DZ6 A;  3CF5 Q;  2HBQ B;  2E7W A;  3ITH A;  4B17 A;  2OPS B;  4B3O B;  2PFD A;  3PR4 A;  1NB2 A;  1P9Y A;  2F4F A;  4Y00 A;  5GAH I;  2GIR A;  1FES A;  4USV A;  1IUJ A;  2XTJ P;  5ETN A;  4IDK B;  3ZZZ A;  5LSR A;  2CWK A;  3MOJ B;  2FVC A;  2LEB A;  4LRC A;  2B6A B;  2M8H A;  3QWU A;  3HXM A;  5LSL A;  3M2V A;  2AZ1 A;  4WZQ A;  4L76 A;  1TTH B;  2DGO A;  1TL7 B;  1CUL A;  4OHY A;  2CQI A;  3MWB A;  4OV6 A;  4M5J A;  1S79 A;  3TUP A;  2XS5 A;  3MM5 A;  3ULH A;  2P5V A;  1M0S A;  1S9G A;  3H4D A;  4NWB A;  3D1Q A;  1DAR A;  2W8K A;  4F0H A;  2VG5 B;  4DV2 J;  3CUN A;  5HP1 B;  3I0S A;  2D69 A;  2P6S A;  4IOC Q;  3LWM A;  2MQ8 A;  2IYG A;  1VHF A;  3NGT A;  1S1T A;  4CIO A;  4C7Q A;  5JVG Q;  2J6T A;  3OL6 A;  1LW0 A;  4CLL A;  5CHC B;  1U6B A;  5C2C A;  3I32 A;  3CJK A;  1AUS L;  3NL0 A;  1SVD A;  2BR0 A;  1S0O A;  3SCL E;  2GHW A;  1N88 A;  3DKD A;  3KK2 B;  4ZN1 A;  2E5J A;  3M8R A;  5JUM A;  1U25 A;  4ED1 A;  3POT A;  3H20 A;  1URN A;  1DTT B;  1KQG B;  3KLH A;  4TU9 A;  4OX9 J;  3RJM B;  3HHD A;  2CQB A;  2VBX A;  4G1I A;  1FRK A;  3MPU B;  4LSL A;  1S6P A;  2HRY A;  4QIG A;  1QY7 A;  4FZV A;  1CVJ A;  1U8S A;  2CJX B;  2Z4P A;  4EBC A;  4IFV B;  4IRD A;  1KON A;  1PJ5 A;  3M7V A;  4ZPC A;  1WAC A;  4KHR A;  1DQ8 A;  4Q2M A;  5DLG A;  4NZ7 A;  4K2J A;  5M2R A;  4FF1 A;  3ILI A;  5EWF A;  3AXK A;  5AE1 A;  3GSD A;  3FCH A;  3L4B C;  2R4F A;  4Y2M A;  5KG5 A;  1TZ0 A;  1F6T A;  4WYL A;  2NZ4 A;  4KGM A;  2RVJ A;  4DQQ A;  2RF2 A;  2GMJ A;  4OHX A;  4UOF A;  3MCO A;  2KZM A;  5B08 A;  4DV2 F;  2YWG A;  5CA5 A;  1TL3 B;  3M6X A;  4ZN3 A;  1V9O A;  2HHT A;  1U6Z A;  2V94 A;  4DL2 A;  5E7O B;  2IVY A;  4DV6 J;  3BSN A;  4QIF A;  4PXD A;  2NXJ A;  3O1L A;  4QCL A;  1UVM A;  1IWA A;  3G9C A;  3I87 A;  3I96 A;  3QGI A;  4O4R A;  3DU6 A;  2Y1J A;  4CZC A;  4ENO A;  3GTY X;  3GR0 A;  2QFI A;  5E3Q A;  1YK9 A;  2DNY A;  3AOB A;  3DLB A;  1GTE A;  4OX9 F;  3PJX A;  4KYZ A;  1M1H A;  4X84 A;  1PJ6 A;  3B82 A;  1OWX A;  3CED A;  3BV8 A;  3BGF A;  4CH0 S;  1T05 A;  2BQR A;  1KQS R;  2HAI A;  3C6U B;  3DLG B;  4DPU A;  2W9C A;  1MNE A;  1REV A;  2BAN B;  2C2E A;  1FRL A;  2QMU B;  3CXC R;  4CT8 A;  2H65 B;  3HPO A;  2VJV A;  2IMO A;  3JSB A;  4F7V A;  3DMJ A;  1FWK A;  1G7C B;  1R89 A;  2UUW A;  3PV8 A;  4I56 A;  1Q7L B;  2QL9 B;  2BXJ A;  4TN2 A;  3VAG A;  2HHP A;  3IBF B;  2ZH3 A;  3W60 A;  1T7P A;  3ENA A;  4DV6 F;  3MEK A;  3ZFV A;  5EUH A;  2UUT A;  2KO1 A;  4DR5 F;  3BH6 B;  2R7S A;  2NPF A;  3BKU A;  2CJA A;  1X7V A;  3KMQ A;  2UU9 J;  3P49 B;  2VFU A;  3PX4 A;  4M5D A;  3DGV A;  3N5F A;  3UW1 A;  4DQP A;  3PW2 A;  3R7N B;  4QIW D;  3HSJ A;  2PA8 D;  1R8H A;  3UDV A;  2HNZ B;  2DHS A;  5K9F A;  2QV6 A;  2BRL A;  4Y2K A;  2EI5 A;  7AT1 B;  1TKZ B;  1U1K A;  3SV4 A;  1RCO B;  1DLO B;  1YJW S;  4UUW A;  4IOB A;  1QJH A;  1D9D A;  1VJW A;  1YZ6 A;  4K4U A;  4YP3 A;  2LEA A;  3W8G A;  5LT5 A;  2HQC A;  1FDD A;  4P73 A;  1KD1 T;  2H5I B;  4ZMM A;  1N5S A;  3MMA B;  2J5A A;  4NYO A;  4FBU A;  4ZVH A;  4I4B A;  3R2D J;  4QWE A;  1NPP A;  2UVV A;  1SL2 A;  4CYU A;  3M2U B;  2RQK A;  2OP5 A;  3N6N A;  5AE3 A;  4O3P A;  1AB8 A;  4FS2 A;  3PKY A;  4PG4 A;  2PD1 A;  9RUB A;  2HQI A;  4J9R A;  3CJ0 A;  1H2U X;  5L9N A;  2C22 A;  2UU9 F;  3JYT B;  5J2M B;  2UUA J;  2Z56 B;  4IO1 A;  3M30 B;  7FD1 A;  4IUF A;  3RG6 A;  2B4U A;  1NKB A;  2DY9 A;  2AEF A;  1H74 A;  3DN9 A;  5BYS A;  2UVR A;  3JQK A;  1QUP A;  2E5I A;  3M2R B;  2DJW A;  1JLG A;  1EKR A;  4XPE A;  1U1M A;  3QSI A;  1VQY A;  2KHD A;  3CCS S;  2YX7 A;  3BDP A;  1RHK B;  1XQI A;  2R7V A;  3IG1 A;  3J81 j;  3PM9 A;  4RBU A;  4DPO A;  3OR2 B;  1BGX T;  5ETT A;  4F3Q A;  3OTC A;  3CJQ A;  4I7F A;  1HI1 A;  3M32 B;  4DV1 J;  4LT6 A;  5KOW A;  1R7I A;  3LOU A;  3JB9 k;  3GYN A;  1ZS6 A;  4DSJ A;  1UJ4 A;  3F0N A;  1RHJ B;  1Q82 T;  2B51 A;  1F60 B;  4LF8 J;  1Y5I B;  2M52 A;  4GKJ J;  4M5N A;  5I3U A;  3GIM A;  1GEH A;  2ZWO A;  3Q8Q B;  2IBK A;  4MIW A;  1RTH B;  3R7B B;  1W26 A;  2J0W A;  4DX7 A;  4YB1 P;  2GQ2 A;  4KSE B;  4NI2 B;  5EWG A;  1DY3 A;  3DOL B;  3GYX B;  3IRX A;  2XY5 A;  4I2Q A;  4DV4 J;  1EKS A;  1RA6 A;  3EGV A;  3HFK A;  3K89 A;  4CDI A;  1HWL A;  3HT3 A;  2FZK B;  2WHO A;  4EO6 A;  3TZZ A;  1DTQ B;  3HHL C;  1HBO B;  3CDA A;  3ZNJ 1;  3MHY A;  1YX2 A;  3AD8 C;  4FYX B;  4E8U A;  5F3T A;  3DXS X;  2HFZ A;  3K5N A;  3HZE A;  3R27 A;  1S5Z A;  4YUD A;  1QAJ A;  4L73 A;  1JWW A;  1R8C A;  4YOE A;  1UVJ A;  2XWY A;  2ZBR A;  3GII A;  4DPT A;  2ZDP A;  2WAQ D;  1GTH A;  1ICE B;  4LRF A;  3OVA A;  5B09 A;  1L3U A;  1VRQ C;  3PX6 A;  3DHX A;  2DEI A;  2DGS A;  4NX9 A;  3FCV A;  4K4Y A;  1FKP A;  3PO4 A;  3P3D A;  1IKV A;  3RR8 A;  2HNY A;  3CC2 S;  4DDF A;  3TNV A;  1KLM A;  4JI4 F;  3KJQ B;  4ZHR B;  2MDA A;  3W2W B;  4GKJ F;  2K1R B;  3P96 A;  4UY8 T;  4L74 A;  3OT9 A;  3EZ5 A;  1EIY B;  2DHH A;  3MUM P;  2LVW A;  2HS0 A;  3I4P A;  3AY0 A;  4RUH A;  6FD1 A;  3ADA C;  2E7V A;  4YR3 A;  4NZ0 A;  2WVE A;  3LP1 B;  4DV4 F;  1VK3 A;  2OEJ A;  2ZUA A;  4U8V A;  2NLW A;  5CH7 B;  2QMW A;  1S10 A;  2RB7 A;  4H4O A;  2E5L J;  2D3Z A;  2OJ3 A;  1HYS B;  1JKH B;  3MZI A;  1WC4 A;  2KVI A;  1DQ9 A;  1X60 A;  1BWV A;  2DNG A;  3IR7 B;  2AYG A;  1TQL A;  2LCW A;  2OLW A;  3CWJ A;  3FBB A;  2W9B A;  3PRV A;  1RCX B;  3AOC A;  4F02 A;  4WCE Q;  1C1B A;  2CJY B;  1X5P A;  2BBE A;  3Q8V A;  2WVB A;  1GFW B;  4OYW A;  2J7W A;  2KT5 A;  4QYR A;  2ILZ A;  3LWL A;  3ISN D;  1SB6 A;  3OV7 A;  1PC4 A;  1DZ5 A;  2UP1 A;  1Z2Z A;  2KHC A;  1M5P C;  3ZTQ A;  2KH9 A;  2MQM A;  2R7U A;  3CW2 C;  5JMN A;  3DXB A;  4ZP6 A;  2K2P A;  3HVT A;  3HK2 A;  4X4N A;  2DNK A;  3RGI A;  4O0N A;  4OX6 A;  3RBZ A;  4DL5 A;  2ZVI A;  3O6Q A;  4NYP A;  3QT7 A;  2OFH X;  4X66 F;  4KHP J;  5HVG A;  3PKM A;  5KFY A;  4JV2 A;  2CRL A;  3C6T B;  2I5J A;  2FLO A;  2GHP A;  2AEM A;  4ZA1 A;  4OL8 A;  2HQ3 A;  1Q8B A;  2ZH8 A;  2C3U A;  3DC2 A;  1SXL A;  2GW8 A;  4NA1 A;  3CO9 A;  3X1L B;  3PJ9 A;  3OQ2 A;  1L3V A;  4LF6 J;  1GXU A;  1HA1 A;  3ZTP A;  3LGM A;  3R6G B;  2HBZ B;  3WX4 A;  1T94 A;  5L9X A;  2IY5 B;  2PII A;  5AJ3 J;  4YHH J;  1JIH A;  4JI7 J;  4Z7C A;  1XIQ A;  1FTC A;  3N01 A;  4UST A;  3KHL A;  2KI2 A;  5J1E A;  3JSM A;  3AOD A;  2X1A A;  3EX7 B;  2I38 A;  3QQC D;  2HVH A;  1QE1 A;  6FDR A;  3M8S A;  2CUY A;  1UL3 A;  4I68 A;  3FSX A;  3TOQ A;  1JXE A;  1Y3J A;  3W5Y A;  4RL1 A;  3IC1 A;  2DR5 A;  3M8Q A;  1U26 A;  4DR4 F;  2E1M C;  2DTJ A;  1HNV A;  4DSF A;  2C2D A;  3V6D A;  4URQ U;  1OY8 A;  3OXF A;  4RZR A;  3H25 A;  1IR2 A;  1U1N A;  3MUR P;  4DR2 F;  4KV8 B;  3SSS A;  1ZZF A;  5F8M A;  1CSJ A;  4DFJ A;  3JTO A;  3T6J A;  3BR9 A;  1F5B A;  3DM2 B;  3N0V A;  3MEC B;  3V6H A;  1IR0 A;  3CIZ A;  2XG8 A;  1KQK A;  4I2P A;  3PYE A;  2VF3 A;  3QZ8 A;  3M8W A;  3R5A A;  1BC6 A;  1BY9 A;  1T9V A;  2RML A;  4RW4 A;  4DUZ J;  3KNG A;  1GQE A;  4DI6 A;  1WHX A;  4NLT A;  4LF6 F;  1IM4 A;  3BGU A;  1EAR A;  2OPR A;  1FKO A;  4J9S A;  2K06 A;  2QA4 S;  4DZD A;  4JI7 F;  1FF2 A;  2RRB A;  5DQG A;  2COL A;  2M7S A;  4JV1 A;  1NJY A;  2GVZ A;  3QMQ A;  1N8R T;  2DNM A;  1UVL A;  4F4Z A;  4KC5 A;  1VMB A;  4A8S A;  1FKA F;  2HND A;  3DLJ A;  4F26 A;  3D6H B;  5CCL A;  3CMA S;  2RU9 A;  1VC0 A;  3SQO P;  1CJV A;  2P6T A;  1RT4 A;  2Q79 A;  2CDR B;  2AZ3 A;  1UPP A;  1YBT A;  3MM6 B;  1XR7 A;  2XC9 A;  5IM0 A;  3GJS B;  3W64 A;  2KFY A;  4JI6 J;  2V5H G;  4P7T A;  3GPA A;  3QBC A;  5B0E A;  4PG7 A;  3HHE A;  4ANC A;  4AT1 B;  4RO0 A;  3MEG B;  1NUE A;  5G0R B;  4USH A;  1RXO B;  1RT6 B;  4JI5 F;  4X4O A;  2PEH A;  2XY7 A;  1H98 A;  2G2Y A;  4FDF A;  4KGV B;  2QL7 B;  3EIC A;  1JLC B;  4M1K A;  5D8H B;  2R8H A;  4DUZ F;  4DU8 A;  5A6P A;  5KFI A;  1M1K T;  4ER8 A;  3OTE A;  3CCV S;  4FF2 A;  1QVG R;  1JLA A;  4WE1 B;  1REG X;  2MJN A;  1FCA A;  4URG A;  2HAF A;  1X5O A;  4GVB B;  3CIM A;  2FY1 A;  4UUX A;  2BQ3 A;  4NLR A;  1SC1 B;  2IRY A;  3KXD A;  1MRO A;  3SXL A;  1RE1 B;  2GC8 A;  2HW3 A;  2YKN A;  1KVI A;  4CRJ A;  1NK4 A;  2XZT B;  2AKW B;  4LFB F;  4JI0 J;  3Q8U A;  1NHK L;  2QE5 A;  4RW7 B;  4KO0 A;  3SI8 A;  4ZP8 A;  3IFE A;  4WU2 A; 
#chains in the Genus database with same CATH homology
 1IVZ A;  2ACM A;  2E7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...