4ZVGA

Crystal structure of ggdef domain of the e. coli dosc - form iii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
MDVLTKLLNRRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNVRSSDYVFRYGGDEFIIVLTEASENETLRTAERIRSRVEKTKLKAANGEDIALSLSIGAAMFNGHPDYERLIQIADEALYIAKRRGRNRVELWKASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Diguanylate cyclase DosC
publication title Structural analysis of an oxygen-regulated diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Signaling protein
total genus 53
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zvgA00
3DLEA 4PUOB 4WXWA 3DRPA 3LAKA 4IR9A 4MK8A 1IKYB 1S10A 4IG0B 3BSOA 5HROB 3MEEB 5KG6A 4FBUA 1QE1A 2CKWA 1QUVA 4O44A 3GV8B 2D3ZA 4J9NA 2IC3A 1S0MA 4M94A 2FVPA 1C0UA 3QIDA 2HWHA 5KG7A 3KLHA 4KFBB 4KV8B 2W8LA 3PJXA 3MECA 3KLIB 4IOBA 2E9ZA 3PR5B 1TQLA 1MU2A 3OL9A 2DPJA 1D0EA 3KLGB 1XR7A 3NBPA 3NKYA 5KT2A 5KFHA 4K4VA 3G6VA 4RW8B 4KBIA 4ICLA 4KE5A 3M9OB 5J2NA 3H5XA 1HPZB 2IAJB 2HNDA 4Y34A 3NMAA 5K14B 3TVKA 3QLHA 1JLBA 2UUTA 4TY9A 1S1UA 3PW4A 4KSEB 2OPRB 1S1WA 2BE2B 5KG3A 4IQXA 5CYMA 2OPPA 2OPSA 4PUOA 4KB7A 2R2UA 4J9PA 5KFBA 1N6QB 1IKYA 5HBMA 2E9TA 2BANB 1RT4B 2AQ4A 4PWDB 1RT6B 5F8MA 2XWYA 5F8GA 2FLNA 4O3PA 3SFUA 3ISND 5F8NA 2XI2A 4NLSA 4KFBA 3KHHA 3RB3A 4PQUA 3UR0A 2QE5A 4ZVHA 3MFIA 2ZD1B 3T1AA 4TYAA 2ASDA 1S0OA 4G3IA 2WB4A 1T3NA 3KLGA 1R0AA 4ZP8A 1NHVA 4DG1A 2YKNA 3UQSA 1S9EA 2R8KA 4F4ZA 3PW2A 1RT5A 2IAJA 2FLPA 2IM2A 4B3OA 4RUCA 4IDKB 4KHMA 2ASJA 5I3UB 5EWFA 4MH8A 2I5JB 3N6LA 4IFYB 4O4GA 4KKOA 2IJNA 1S9GB 2W9BA 3DOKA 3KK2A 3G6XA 5KFSA 3E01A 1C2PA 3LAMA 1JX4A 3RAXA 3V4IB 3SI8A 4O3OA 3CVKA 4NLRA 4RW6A 3TAMB 2R2TA 4DL2A 4GC7A 3H5UA 1GX5A 2BANA 1RT4A 3FDSA 3HVWA 4TY8B 4URGA 1RT6A 4QPXA 4EYIB 3PZPA 4WZMA 4DL7A 1RT1A 2VG7A 3OL8A 3BSCA 3BJYA 1JLAB 2HNYA 3C6TA 3GIMA 3EPGA 4NZ0A 3HHKA 1LWCA 4ECWA 2JEIA 1NNDA 1S6QB 3CDUA 3KK1B 1HNIB 4H4MB 2YNFA 4NLYA 5J1EB 3KHLA 1RYRA 2YKMB 3NL0A 5KFLA 3KK3B 2B6AA 3NGDA 3CDEA 5KFXA 3KNAA 2HWIA 1C0TB 1N48A 2FVSA 3IG1B 1ZETA 3JSMA 2FLLA 1TVRB 4RW4B 1IKVB 3QZ8A 4MK7A 2JLEA 4X2BA 4URSA 4IG3B 1UWBA 4EBEA 1JXLA 4K50A 3LP1B 5KFRA 3QO9B 4QWEA 2WONA 5C24A 4O3QA 1BQMB 1FKPA 3QYYA 1S97A 3KOAA 3GQCA 4YMEA 4I2QA 1T94A 1S48A 4TYBA 1REVB 3V4IA 1EETA 3RB0A 5L1IA 4IRKA 4LQ9A 5L1JA 5C25B 5DG7A 2ASLA 3BGRA 3GV7B 5KFVA 4FS2A 2DPIA 5KG0A 4YQWA 1TKXB 3CDWA 3QIPA 1RT7A 5F8HA 4TN2A 2HMIB 2JC1A 1JLEB 4R8UA 2AGPA 3IS9B 1JLGA 4URQU 5J1EA 5KT3A 2YKMA 3CJ2A 4QW8A 1S0NA 1LW2A 2BQRA 1DLOA 2V0NA 3BQ2A 1S1VA 1T05A 3C6UB 2AX0A 3D28A 3IG1A 2UVUA 1LW0B 4ZP7A 1DTTB 1IKVA 2FJVA 1LWFB 4IG3A 5EWEA 3LP1A 2B43A 3QO9A 1HYSA 2W9CA 3Q8SB 1SH0A 4JUZA 5KFUA 4K4TA 2IBKA 1IKXA 4QWAA 4U6PA 3I0SB 4MKAA 4LSNA 3OL6A 1HNVB 1REVA 3QGIA 4ECXA 3CJ4A 3DMJA 4WFXA 1TKTA 2WTFA 1TKXA 4ZPDA 3H4BA 3PHEA 4M95A 5L1LA 2C2EA 3I5BA 1IKWA 3UDLA 3DYAA 1TL3B 1SUQA 4KHRA 1FK9B 4O4RA 4R5PB 3FFIA 3HVTB 4MK9A 1RTIA 2FVCA 2D7SA 5KFCA 4Y2CA 2IM3A 5T14A 5EDWA 3GILA 4F50A 4JV1A 4K4YA 2XC9A 2GC8A 5C42B 4RNHA 5KT5A 2OPQB 3KMQA 5F8IA 1DTTA 4NCGA 2BRLA 3Q8QB 1VRUB 3DM2A 1T03A 3PVXA 3OSNA 3KJVB 4TQSA 3V6JA 2VA3A 3H4DA 3V6HA 3IRXB 3T5LA 2C22A 5KFDA 5KG1A 1IM4A 1RTHA 5DQGA 3H5YA 1JKHB 3EZUA 3V81B 4NLGA 4Q0BB 3DLGB 1JLCB 4NYZA 1HNVA 3M8PB 4IG0A 4ECVA 5HROA 4GC6A 3MEEA 4EBDA 2GIQA 4J9OA 4KV8A 2B5JB 4FBTA 5KG4A 4HKQA 3T5KA 2UVWA 3KLIA 5F8JA 2YNIB 4ED2A 3M9NB 1RT2B 5KFWA 4IRDA 1RTJB 3MFHA 4RW8A 5EWGA 2VG6B 4O3NA 3M8QB 4ZPBA 4F4YA 5D3GB 4XPEA 1JLFB 4DL3A 2F8EX 3FSIA 1HPZA 2JEJA 3UPFA 5KFNA 2D41A 5K14A 2IJFA 4ECZA 3DLKB 3FQKA 4RNNA 3IRXA 1TV6B 2BE2A 2OPRA 4XO0A 3Q8PB 1HARA 1RA6A 4ZVGA 1BQNB 5KG5A 1KLMB 1MMLA 3H2LA 3LP2B 4EYHB 1VRTB 3GYNA 1TKZB 1JKHA 2R8IA 3V81A 4Q0BA 4IKAA 1I6JA 3DLGA 5FDLB 5HLFB 2GIRA 2WK4A 2OH2A 3MR6A 2BQUA 3CWJA 1N6QA 4ZPAA 4QW9A 4J9KA 5KFTA 3VQSA 1S9FA 3PJWA 4EO8A 4MFBB 3N6MA 4NLQA 4IFVB 4YR3A 4RW9B 4DEZA 1N5YB 4G1QB 4I2PB 1SV5B 5HP1B 1N56A 2ZD1A 3I5AA 4J9RA 4ECUA 3KLEB 2R8JA 4EBCA 3ISNC 2YNHB 4WZQA 3FQLA 1LWEB 2C2DA 2WOMB 1C1BB 4NLTA 3I0RB 2VG5B 4IH5A 4ED6A 5J2PB 3V6KA 4IDKA 3MEGB 5KFGA 4MKBA 1SH2A 5I3UA 2I5JA 4IFYA 4RZRA 2ZE2B 3LANA 3GIIA 1TL1B 1J5OB 1S9GA 3LALA 1BQNA 3NAIA 1KLMA 3LP2A 4NLOA 2IM1A 1VRTA 3PW0A 4ZVFA 4ZVEA 1SH3A 3NAHA 5HLFA 3FRZA 3TAMA 4ECRA 4NRUA 4IR1A 2WRMA 3KLFB 1HQUB 4DL5A 2W7OA 4TY8A 2RF2B 3MEDB 2XI3A 1KHWA 3EPIA 1EP4B 4F4WA 4JV0A 1JLAA 2RKIB 4MFBA 3BSAA 4ED1A 5DGAA 1S6QA 3KK1A 3LP0B 1SV5A 1HNIA 4H4MA 1ZTWA 4PWDA 2AGQA 1FKOB 2FJWA 3KK3A 3BR9A 1HMVB 5JUMA 4KO0B 3KLEA 3N6NA 4RW7B 1C0TA 1DTQB 2CJQA 2YNHA 4ZP6A 2YNGB 3DLEB 1NHUA 3OHBA 3DRPB 1TVRA 4RW4A 4O3SA 2VG5A 3OLBA 3KHRA 4TLRA 3CO9A 4O44B 2UUWA 4Q45A 1BQMA 1C0UB 2R2SA 2BQ3A 4O3RA 3KLHB 5DG8A 2UVRA 2AX1A 4F4XA 3RAQA 3MECB 4H54A 3KHGA 1RT3B 5KFQA 1OS5A 5EUHA 4JV2A 5C25A 2ILYA 5KFEA 2R2RA 5DLFA 3KLFA 3NBPB 4DL6A 3H59A 3HKWA 5J2QB 3RBEA 2E9RX 4MIAA 4J9LA 3CJ0A 1EP4A 4ICLB 4LSLB 4K4ZA 3GIJA 1RDRA 2HMIA 4IH6A 3RBDA 3D5MA 1JLEA 3CIZA 3LP0A 3IS9A 3QLHB 4RUAA 3MR2A 3HVAA 4J9MA 1S1WB 2V9WA 2IM0A 3MF5A 5C5JA 3C6UA 5CYMB 2OPPB 3PR4A 2OPSB 1LW0A 4DL4A 4Q43A 3DRSB 1LWFA 3RB4A 5HBMB 1N4LA 2ZKUA 4ZP9A 4ECSA 4R0EA 2AU0A 2RDJA 4I7FB 2XCPA 4PQUB 4WE1B 4ECQA 1RYSA 1YVFA 1QAIA 3I0SA 4WYWA 2D3UA 4XPCA 1RT3A 3GIKA 2HNZB 4K4XA 5KG2A 5I42B 3H5SA 2V4QA 3RB6A 3ITHB 4NRTA 5J2QA 1GX6A 4DG1B 3DRRB 2W8KA 1R0AB 2YKNB 1KHVA 1S9EB 2JEFA 3KMSA 4LSLA 1QAJA 3MR5A 3G6YA 1RT5B 1JLQB 1TP7A 5F9NA 4ED0A 4B3OB 1TL3A 2IMWP 4ID5B 4R5PA 1FK9A 4NLVA 4WXOA 4O4GB 3HVTA 3V6DB 4KKOB 4ECTA 2W9BB 3DOKB 3KK2B 3MTKA 4ED3A 3E01B 1RA7A 4TQRA 5C42A 3M9MB 4NLDA 4Y3CA 2OPQA 1C1CB 4ECYA 2AGOA 2FVRA 2V4RA 3DRSA 1RTDB 4RW6B 4K4WA 1VRUA 3I5CA 3DOLB 3KJVA 2R8HA 5DG9A 1RT1B 2VG7B 2FVQA 2VA2A 4EO6A 2HNYB 3C6TB 4I7FA 5JXSA 2C28A 1HQEB 1LWCB 4J9SA 2W9AA 4WE1A 2C2RA 2YNFB 2R8GA 1JLCA 4ZHRB 5KT7A 1S4FA 2HNZA 2B6AB 1XR5A 3M8PA 5I42A 4K4UA 5KFMA 5J2MB 3ITHA 3IN5A 4Y2AA 3T5JA 4EEYA 4Q8EA 3DRRA 4YR2A 3JSMB 2FJXA 3JYTB 3OLAA 3KLVA 1S6PB 5DQHA 4WFYA 5KFJA 3QGHA 2B5JA 4Q8FA 2XCAA 3E51A 1JLQA 1UWBB 4ZMMA 3IGNA 2ILZA 2YNIA 4ID5A 3CJ3A 3Q8RB 2J6TA 2WONB 5C24B 3V6DA 1RT2A 3QGGA 1FKPB 5KFZA 1RTJA 3DDKA 5KT4A 5KFAA 4RNOA 5KFPA 2VG6A 3M8QA 4I2QB 5D3GA 1JLFA 4WYLA 1C1CA 1EETB 4MIBA 2ATLA 1RTDA 5CYQB 3PW7A 4K4SA 3OHAA 3BGRB 3BQ0A 3DOLA 3DLKA 4YR0A 1S1TB 3OSPA 1TV6A 1RT7B 2JC0A 3BREA 3QIPB 2EC0A 5KT6A 5DGBA 5F8LA 1HQEA 4RU9A 2ALZA 2BR0A 4LQ3A 4R8UB 1TKZA 5L1KA 2JEGA 1JLGB 1S1XB 5FDLA 3PW5A 4ZHRA 3TQ1A 1RAJA 1Z4UA 1LW2B 4NLUA 4FS1A 2WHOA 1DLOB 5J2MA 1T05B 1S1VB 4ED8A 3DI6B 1CSJA 3JYTA 2I1RA 4IFVA 4RW9A 1S6PA 5DLGA 3G86A 1ZTTA 1N5YA 4NLWA 3QZ7A 3OL7A 4G1QA 3IGVA 4I2PA 5DQIA 4U7CA 1K1SA 5HP1A 1HYSB 2BRKA 2W9CB 4RNMA 4TXSA 1JIHA 3H98A 4H4OB 1U09A 4YP3A 1WNEA 1IKXB 3ICLA 2W7PA 5KFIA 1LWEA 4QWBA 5KFKA 2WOMA 1C1BA 3BQ1A 3I0RA 4LSNB 2UVVA 2J6SA 5CYQA 3CJ5A 5J2PA 3MEGA 3DMJB 1QE1B 1TKTB 4ZPCA 2XGPA 2IC3B 1S1TA 2ZE2A 1TL1A 1J5OA 4KAIA 4QWDA 4QWCA 4NLXA 4IRCA 1IKWB 3DYAB 1S49A 3MR3A 2AWZA 4RNFA 2IA6A 3T5HA 1SUQB 1S1XA 1W25A 5KFYA 2RDIA 5L9XA 1MU2B 2O5DA 3H40A 3FFIB 4ED7A 5F9LA 1HQUA 2WCXA 1RTIB 3GV5B 1XR6A 2RF2A 4Q44A 3MEDA 3BSNA 4IH7A 2J6UA 4OL8A 3DI6A 1D1UA 2RKIA 4WFZA 2HAIA 4NCGB 5J2NB 2XGQA 2HNDB 1T03B 3DM2B 2QV6A 1JLBB 1FKOA 1S1UB 4HYKA 1K1QA 1HMVA 4KO0A 5KFFA 4H4OA 4RW7A 3T19A 1DTQA 4NLPA 5KFOA 4J9QA 3SFGA 2YNGA 1RTHB
chains in the Genus database with same CATH superfamily
4PUOB 2XHWA 1U2CA 1G2EA 2Z30B 1QE1A 3R8YA 2D69A 2J9DE 1X4BA 1OY6A 1LNQA 4KBIA 3M9OB 4NXNF 5K14B 1S1UA 5LXRA 1KS2A 2MQNA 5CYMA 1VQPS 4LF5F 3LTOA 4J9PA 3HX9A 1TU0B 2G2YA 1JJHA 2AQ4A 3OW2R 2E5LJ 3IWXA 3HD2A 3MFIA 3NGUA 1X0FA 3FEXB 1NPKA 1N36F 3J81Y 4MH8A 3CT9A 3N6LA 1U1KA 1UA0A 2W9BA 3M32A 1NK9A 3M30A 3PYEA 1EQMA 4FXWA 1RP5A 1R3NA 1PJ6A 2EKNA 3UFCX 3C6TA 3W64A 3GIMA 2A6MA 1S6QB 3NL0A 4UQTA 2B6AA 1R43A 2QYCA 4FKYA 1N48A 3IG1B 2CA9A 2FLLA 4X2BA 4URSA 3PDNA 1VC5A 1MROA 3HT0A 2V69A 4PXEA 4CRJA 1RCXB 3BGRA 5KG0A 4JI8J 3HPOA 2DKOB 2HMIB 2J0XA 4XDCA 3EICA 3HFZB 1Q81T 5AE2A 4W90B 2NXJA 4DU7A 3T1HJ 4J5OA 2FJVA 2NUHA 1RK8A 1RJJA 5ETMA 1U0HA 2F1FA 2LU2A 1NK8A 1IKXA 3PFOA 2BJ8A 2MQMA 3RRHA 2NR0A 4I0WA 4WFXA 1N34F 4AQYF 1SUQA 4MK9A 2FVCA 5EDWA 4Y2CA 2IM3A 1M5OC 2FZKB 1FE0A 5CZXA 2ALYB 2DR8A 1T03A 2EFGA 5IM0A 2XMTA 7FD1A 1AZSB 3DLGB 4NYOA 4IG0A 3AFGA 4ED5A 4IO1A 3X1LB 1VQ4S 4OIXA 1IJEB 3BBBA 5F8JA 4ED2A 2GHWA 3OTDA 1WDDA 3TUZC 2CQIA 1OJ4A 4ECZA 2XHCA 5IC4B 4LRCA 5HATA 4EYHB 2XULA 4X4QA 2MKSA 2O01C 3UDVA 4MFBB 3N6MA 3C15B 2OSRA 3C14B 2K2PA 4Z2XA 1OQ3A 1SL1A 3GJSB 5KFGA 7AT1B 4NI2B 4ANCA 4YS2A 1VQ8S 2J7KA 2IM1A 2BKNA 4Q2MA 3NEKA 2XG8A 1I94F 1N32J 1OIAA 3TOQA 1HQUB 3O1LA 2RUGA 2MZSA 4OZ3A 1URNA 2LP4A 4KO0B 3N6NA 1C0TA 2B8PA 3GONA 4QU6A 4OV6A 5L8RC 1RWKB 2QMXA 2J0QD 1TR0A 2UVRA 2YPZA 4A48A 2U1AA 1SL2A 2BEFA 2NREA 2VD3A 1VQYA 4ZPWR 1RAHB 2H48B 3PJ9A 1AFIA 3TANA 4I68A 1UW9A 4PQUB 1YVFA 4WYWA 1Q7LB 3MM8A 4B3SJ 1UP1A 4PYDA 1FNXH 3CC2S 2KT5A 1NB7A 4B3OB 4NEZA 1XN9A 2CPZA 1BMQB 1RWXB 2E7VA 3MTKA 4ED3A 4C98A 2RS8A 3TZZA 2R8HA 4CO4A 2C28A 1PKUA 3PO5A 3X3UA 4CLPA 1DAXA 4ZHRB 2ZBRA 1KVJA 1FF2A 5DQHA 2GIFA 1Z2LA 4JI8F 1UA1A 2BOPA 4QCLA 4WYLA 2QG9B 2V4JA 1UETA 2F7VA 2EC0A 1EHWA 2PT0A 3D1OA 3ENQA 2CFXA 1Z4UA 2N7YA 2HRUA 4C8YA 5HP1A 4QIVA 1JIHA 4CNYA 3RAMA 4PXBA 2YKAA 1RADB 2W25A 1J5OA 2QGFB 4RNFA 3G87A 4QIWD 2RDIA 2GS8A 3MEDA 4OL8A 3GB0A 1NLKL 2MZJA 1M90T 2R7OA 1DTQA 2ZBPA 5IZHA 2GFFA 3ONQA 4KGVB 3BN7A 4FYWB 3KLHA 4KV8B 3BKFA 3KLIB 3B78A 3M2UB 3QLHA 4YHHJ 1W26A 1DQAA 2BE2B 2OPRB 5B0BA 2OPSA 1WORA 4KB7A 4USTA 4P75A 1VHIA 1LEOA 3QSYB 4LF6J 2LEBA 2P6TA 1P8GA 2YWWA 1YTYA 2GHVC 4LF4J 2ZD1B 3AODA 5JJBA 1S0OA 2RJZA 4DG1A 3UQSA 4Z7CA 2IAJA 2MJNA 1HD0A 2FZCB 6AT1B 2LQJA 1N32F 3TA1A 3UNYA 3ZZOA 1JXEA 2IBOA 5HJYA 4WZMA 2VG7A 2HNYA 3MMAB 3CGIA 4P71A 3CDEA 1X60A 4Q2LA 1B0PA 1HWIA 1IKVB 2CPEA 3CCWA 4ZLNA 4O3QA 1BQMB 3TARA 3W5YA 3UDEA 4TYBA 2HFZA 1H2VZ 4CLSA 2RVJA 2XMUA 2J9CA 3TZYA 2LXIA 2V8GA 2KB2A 4TN2A 4LR7A 4LRDA 4H4KA 4WBFA 3DLJA 4QW8A 2BQRA 2F4VJ 1T05A 2AYMA 2MLYA 4L73A 3SDEB 3ADAC 5THWA 4ELTA 1Q5YA 3NOGA 4B3SF 2YKPA 1FXDA 1NB2A 3J7YI 1H6KX 3FJ2A 4LF9J 1NAQA 5HVFA 1YBTA 3KUGA 3A3OB 5FLXY 2BX6A 1KQFB 3I9V9 3RRGA 1VISA 2GC8A 1FD2A 4JI1J 1GMWA 4UY8T 1FNOA 2YWKA 1BWVA 1VQNS 5KG1A 2HZAA 4LF8J 3U1NA 4YEAA 3BF4A 2DRBA 2XMWA 4F04B 3HZGA 2LU1A 2RT3A 3MMCB 1MSWD 4PWUA 5HVGA 5IV4A 1MWZA 2QLJB 3R5AA 4RW8A 1X9SA 5BYSA 3OXGA 3WDOA 2JEJA 4EWTA 3IRXA 2NUUG 2EW9A 2XY6A 2V2VA 1BQNB 3CXCR 2CPHA 4WP8A 5LSLA 2R8IA 5ETKA 5D0RA 2ZUGA 4KJIA 4DV3F 5L46A 2JVOA 2V6AA 3RR8A 2YNHB 2NPFA 2DISA 2ZHBA 4IH5A 3V6KA 1WTFA 4N7TA 2HQ3A 3M05A 2YQ1A 2Z4PA 2HK2A 3TAMA 1SKWA 1NKBA 5ETRA 1JLAA 4OYPA 1X9MA 5ETPA 3OVSA 1PAEX 3QRQA 2BA9A 5JUMA 3C19A 4ZP6A 2YNGB 1NHUA 4DPXA 1M5KC 1W2IA 2MEWA 3R2CJ 3HT3A 1BD6A 4KHPJ 3TUJC 1LOUA 2HAFA 4N41A 2VH7A 3H59A 1HBMB 1RBAA 4YHHF 2GA7A 3RBDA 1T9XA 2KZMA 4HACA 2KHCA 1AA1B 3WX8A 2KRBA 2E29A 1IJFB 5CYMB 1RU2A 1H2UX 3HI9A 1O0PA 4KC5A 2XSJA 4UQGA 4U7UK 2B9WA 2BXJA 3MD1A 2GJFA 1IUJA 3DRRB 1QTMA 4LSLA 3TEHB 3QWUA 1NPRA 4NLVA 3BGUA 1SJQA 1LV5A 2W9BB 3M32B 3ZNUA 3M30B 2XQCA 1Q7YT 3VAGA 3AQPA 1HWKA 3ZZ0A 2H9ZA 3C6TB 1APSA 2HURA 1YSJA 3MD3A 2B6AB 3NXZA 5E5NA 3IN5A 4NE9C 1S6PB 1A0OB 1WSVA 1MROB 2VU5A 3CD5A 5KT4A 1KTQA 3PKMA 1MMDA 3BGRB 3BQ0A 2FLOA 3VAMA 1Y11A 2F4VF 2SXLA 5F8LA 1HQEA 2QTWA 2KN4A 2E1AA 4LFAJ 2RD5C 3CC4S 4KQZA 1YWXA 4ED8A 5MAOA 3CSKA 1ZAXA 2DNOA 2CPXA 2M70A 5LM7E 2DRAA 1U0HB 3H98A 1N54B 2MKKA 3KJQB 1IKXB 3BR8A 4LF9F 3SV3A 2OFGX 1RWUA 2VBWA 2BABA 4LF1A 2AKWB 2KH9A 3EJMA 3EVMA 4OYMA 2FPHX 1WDTA 1SUQB 5KFYA 2R4FA 1D1UA 1MW7A 1HI1A 1T03B 4JI2J 4HYKA 5IM0B 4M63A 4LF8F 2L08A 2ZH2A 2A6OA 4A8MP 3MM5A 3LAKA 4HR2A 1DARA 4MK8A 4IG0B 7FDRA 2VOPA 3D67A 4M94A 1WKJA 2V94A 3QGPA 4OJHA 3OR1B 5BXIA 2EK6A 3DGVA 5DZ7A 1UPMB 1YJRA 2UXCJ 2CNNB 1Y3JA 1M0SA 2ZBQA 2BANB 1DJ0A 5F8MA 2H1YA 2BM1A 1DHMA 1WG1A 3KG0A 3TEGA 2MTLA 1WSRA 3H2UB 3T1AA 4DV0J 2PEHA 1KQSR 3K58A 2HPUA 2K7KA 3G71S 3BYPA 3RRKA 6FD1A 3G6XA 3LAMA 4CTAA 3PXGa 3CVKA 2ZH4A 2JX2A 1FESA 5A8WB 1RT6A 1RT1A 3BJYA 4ECWA 4NZ0A 2E7XA 3M6UA 5J1EB 5KFLA 1C0TB 4KHPF 3G8QA 5KFRA 1OPIA 3R5DA 2CPDA 4K7QA 2ZM6F 2L3MA 3MGJA 4CH1A 3W7BA 3L7OA 2E1MC 4ANDA 1HBNA 2GGPA 1S1VA 2LXUA 1SB6A 2XO6A 3G4SS 2CQ3A 2H65B 4ID8A 2YY3A 2B43A 4KH0B 3GFHA 3FMBA 4KYZA 4X4OA 1KVIA 2KI2A 4HDHA 1RUSA 3D54A 3LPEA 3I5BA 2PO4A 4FZVA 4DJBA 5K5MA 2LQBA 2DRDA 5K8NA 2RU9A 3UO0A 2H3EB 2Z8QA 1DTTA 4NCGA 4DPUA 2OTLS 5GMDA 1CVJA 2ZZTA 1YIJS 4K59A 4NYZA 4P72A 2FYXA 1JJCB 1UVMA 1WELA 4FBTA 1OO0B 4USVA 4HT7A 4QIEA 4ZPBA 1IQTA 1RZMA 5KFNA 2V4JB 4LFAF 4XO0A 5DRKA 3KG1A 2L48A 5D0EA 5HLFB 3DHXA 2E1PA 1S9FA 2CG8A 2J76E 1YJTA 1RABB 2ZH3A 1SV5B 3D0IE 5HP1B 2XZWA 1VQKS 2B9XA 4OLPA 3PEHA 1CPZA 4NLTA 4UOCA 1H7WA 4MKBA 1SH2A 2I5JA 4PQAA 2V34A 1J5OB 3MDFA 1GXLA 3FRZA 4NA3A 2CNLB 3MEDB 4JI2F 2CPYA 5E41A 4HL9A 4XTTA 2VC1A 3LP0B 4PWDA 2F9JA 1QSYA 4CYUA 1DTQB 2YVSA 4X65J 1FXRA 2GVZA 3A12A 3KHRA 3D6TB 2OI2A 3KLHB 1SJRA 5C25A 2CJKA 3CJ0A 2BJ1A 2NPIA 4DU8A 3QLHB 3MR2A 1IBMF 4I69A 3CCRS 2OPSB 3FCVA 1T0TV 4DQSA 2NCKL 3T1YF 4DV0F 1LKZA 1TZ0A 2RRNA 3FBEA 1WC6A 1RYSA 2D3UA 2DGQA 3CDBA 1FA0A 3DHWC 2R7VA 3MUVP 2V4QA 1ZBTA 4DG1B 4MKYA 1Q8LA 4WWSA 1R0BG 2B3TB 3W8GA 4NCBA 1W7WA 3J80U 3Q23A 3M9MB 2FVRA 2VG7B 4DR7J 2VA2A 2HNYB 1MN7A 2W9AA 2F3JA 2FC9A 3NY0A 1J5EJ 3DRXA 4OI4A 3O5TB 4LBIA 3KLVA 3NMRA 3TO8A 2UV8G 2J6TA 4QPTA 3NLCA 1UL3A 2AJ2A 3OFFA 2XYHB 3MM7B 2ATLA 3PW7A 5HMYA 3OSPA 2V5HG 3IBFB 2J8AA 1H98A 1ZA2B 4NLUA 1T05B 5A8RA 1IBCB 2B7CB 2UXDJ 2CIMA 2CUYA 4TXSA 3AJ2A 4ZN3A 4DV4F 3CJ5A 3SQOP 5AJ3F 1YRXA 1VRQC 1VJQA 2AWZA 4LF2A 1OWXA 2YKQA 4Q44A 3GMGA 3MM6A 5J2NB 2VFTA 1FKOA 2JZ5A 2UUCJ 4NLPA 1F9HA 2HHQA 2M7SA 2M8HA 1JWWA 4B3RJ 4J9NA 5K8PA 2DY1A 4HDGA 2HWHA 3AH6A 3SCKE 3PR5B 2QA2A 1OYDA 4RW8B 2HHXA 4DSEA 3IO1A 5HN0A 2RRBA 3TVKA 1KD1T 4P2FA 2Q6BA 3FGVA 2PI4A 2LDIA 4OHZA 4USMA 2E9TA 1Y9OA 2UZAA 4O3PA 3UW1A 4N5SA 5GAHU 4TYAA 2ZH8A 3RW7A 4YY3J 1LK7A 1NHVA 4ELUA 3R9LA 1F9FA 1EJ7L 1RAFB 4USKA 3CJKA 1PO6A 5EWFA 2HVIA 1WACA 2YQ0A 5KFSA 1RSCA 3RAXA 2OO4A 4KIAA 3TAMB 2JFKA 3FDSA 1RT4A 3W9HA 1JLAB 1UTAA 1FFWB 3GFYA 1R7IA 5HQ8A 3WZ0A 2YNFA 4X4VA 3NGDA 2FVSA 2EFVA 1HNXJ 3QZ8A 3TWZA 3LF0A 2RAQA 4IG3B 1JXLA 2MZRA 3HFVA 4WF9Q 3QPIA 4L75A 4Z37A 4I2QA 3PACA 3V4IA 1IBLJ 2XB2D 3HD1A 5F8HA 2HBRB 1VGYA 1PYOB 1AXQA 4HACB 1TMMA 3NGTA 1X4AA 4ZVPB 3NG8A 1NEEA 4IOCQ 4OZNA 2ZHAA 4R0JA 3D4JA 1CS4A 3UD3P 4E2FB 2GZOA 2XSJB 4QWAA 2W4CA 1FWKA 4X66J 3V5RA 2X7IA 4DV5J 1S5ZA 1EQ0A 4OYZA 3ZZUA 4FKXA 3NS6A 4KGMA 1YBAA 2OTJS 4DR2J 4DR7F 5F8IA 2BRLA 1KTVA 1L3SA 2FD2A 3H0PA 4DSFA 2HRYA 1HWUA 4WIIA 1GTHA 1KC8T 2DY9A 4Q0BB 1R8HA 1CG2A 3GP9A 4Y2IA 4DFPA 3TQEA 1NJXA 3I56S 4ZCMA 3M9NB 4B9MA 2OEKA 1FRXA 2HHPA 1IQZA 5KG5A 1VRTB 1KN6A 2VONA 1FTRA 3I32A 1VIXA 1N6QA 2UXDF 3UCGA 4QW9A 4RJVA 2LDYA 2PMZD 4CO1A 1BUXA 1NK4A 3FQLA 2W2PP 2VQEJ 3NCRA 3HMJG 1NJYA 3LP2A 2R7RA 3ENAA 2ZZMA 2F5GA 2D74B 1EP4B 3CCLS 5FJ4A 2UUCF 3KK1A 2Q6CA 3P6YC 5IT0A 4B3RF 2G2ZA 3MM5B 2KVIA 1FVQA 5DG8A 3EWGA 1R31A 1RAIB 3Q2SC 2H54B 1RDRA 4E0DA 1B0TA 4C3LA 4IQMA 3HM9A 1XNQJ 3W61A 5MLCV 4DL4A 3PTWA 1M5PC 3EGWB 1SC1B 5HSPA 4R0EA 2YX7A 5C7PA 4I7FB 4YY3F 4WE1B 2GQQA 8RUCA 1UEUA 3J81U 1VC0A 1P9YA 3RB6A 2NSCA 3ELHA 1RHJB 3B4DA 1ZAVA 1CJTA 4R5PA 3A8IA 4JV5J 2OPQA 5LMNJ 4CTAB 1TTHB 1JB0C 3KJVA 1RT1B 4B17A 3J7AN 2QSWA 4C9DA 4QR1A 1WOOA 5KFMA 1WC1A 4WK3A 3EVWA 2FJXA 3P5TL 2JNJA 3ZZYA 3RW6A 1RT2A 2KHDA 1RTJA 2DEIA 4EK2A 1JLFA 4P74A 2MKHA 1HI8A 3U27A 4DCOB 4C11A 1PG5B 4PKDB 3P8BB 3TQ1A 4FS1A 1HBNB 2GGPB 1S1VB 9RUBA 1X5PA 4IFVA 4RW9A 2W7AA 1GH8A 2K1RA 3IGVA 4U7CA 3A3NB 2DXEA 3QJPA 2XBPA 4X66F 4DV5F 4C8MA 4N8NA 2Q79A 3AB4B 2XMJA 1S1TA 2ZE2A 5DZ6A 2XMVA 3C8YA 1YJNS 2IA6A 3A13A 1F5CA 4DUZF 3BSNA 3GV5B 2RF2A 4ZVSB 1ZM2A 2HFUA 4G65A 4NCGB 2Y0BB 5BR8J 1TK5A 1UJ6A 4FPRA 4IR9A 4TKTA 5A2QU 2CKWA 1YZ6A 2W8LA 3KDOA 4FPIA 2VPWB 4KE5A 3H5XA 5G0RA 1WUUA 1B99A 1O8BA 1RB0A 4DDFA 4UOFA 3CUNA 5FIIA 5B0DA 1IKYA 3ZNJ1 1NDPA 1T02A 3VTIA 2AP6A 3SFUA 4DV1J 2X3DA 3RB3A 2GHPA 1U26A 2CAJA 2VQEF 5EX0A 2YWGA 1T3NA 2EVZA 3RYLA 1YBUA 2HRTA 2IMOA 3W5ZA 4RUCA 2I5JB 4O4GA 1T3OA 4KKOA 4QU7A 2MKIA 1N8RT 2ROEA 2RNEA 4WIQA 3MWBA 4K8RA 3GR1A 2UXBJ 4PWDB 1XMQJ 4QJVA 4CYUB 1ZETA 3OTEA 1F5BA 1G6BA 4QYRA 4FF2A 1F3VA 1UWBA 1VQOS 1PCAA 4DX7A 4J37A 5C24A 3L95X 3KOAA 4ZKAA 3R7BB 4IRKA 5C25B 3NRBA 4OHVA 1RT7A 2JVRA 1XNQF 4EGLA 1UJ5A 2DEJA 2QA4G 2O67A 4RWXA 2OAUA 3D28A 2AX0A 3B82A 4ZVUB 3QO9A 4JI0J 1SH0A 1HR0J 3BO2A 3D68A 3CJ4A 5BJRA 2XTJP 2Q66A 1RACB 2RU3A 2NXUA 1R0CB 1VOMA 2E1RA 1NRKA 3FFIA 5LMNF 1DQ8A 1NK6A 2Y8WA 2QZ8A 4F50A 3PX0A 4DFJA 3DLBA 1NK5A 3BM7A 2GO8A 1WJ9A 1KRPA 2AEJA 4C8NA 4P73A 4A8KA 2UV8A 4N8OA 1HW9A 2HWTA 1RE1B 4LUBA 2VQFJ 4DI6A 3TI0A 3K8VA 1WEYA 1KDNA 4DL3A 3CC7S 5IWAJ 2IJFA 4BDPA 2VBZA 5HMXA 1OY8A 5IFMA 2BM0A 3Q8YA 2CPJA 2GIRA 4LF7J 2WK4A 2OH2A 4FXDA 4FNIA 4ZPAA 1E6VA 4DUTA 4UT4A 2H5IB 5HAOA 4EO8A 5CHCB 1QAYA 2MGZA 2RH3A 2LFVA 3V2UC 2V9KA 3I5AA 4G1PA 4EBCA 5F0UA 3ISNC 3F0NA 5IQQA 3LALA 1WEZA 2E66A 3FBCA 3UDCA 1X9WA 1P6TA 3PW0A 4PXDA 3PIPQ 2M2BA 1SIWB 2MQOA 1G3OA 5BR8F 1HIYA 3MM6B 1Z2ZA 3BPSP 5DDOC 1ZTWA 1FKOB 1RAGB 1FKAF 1OQ6A 3QT7A 4FVCA 2VG5A 3UD4P 4O3SA 1FDBA 4JI3J 2Z2LA 2BQ3A 4C4WA 3BH7B 4C0HA 4H54A 1FX2A 5EUHA 1DY3A 2DNYA 3RBEA 2QX0A 4FYYB 4LBPA 4QIGA 4IH6A 1JLEA 1U45A 4OQJA 3IS9A 4OZJA 4F26A 1H7XA 3EYZA 3VAJA 1UCNA 3D66A 2QA1A 2ZEJA 2DBBA 2ABYA 4QOTA 3HHLC 4OZ2A 3DFEA 2AJQA 2EFNA 4XPCA 3GIKA 1N5VA 5J2QA 4P10A 1KHVA 3MM9B 3W2VA 1JLQB 3CJKB 1RBLA 4CLKA 2EEYA 2QLWA 4S0MA 1ZM4A 4OI2A 3CCQS 1FT8A 1RA7A 1C4CA 4F2SA 4NMLA 1NK7A 2UXBF 2MLXA 1KBRA 1XMQF 2YNFB 2HNZA 4K4UA 2AJ1A 3ITHA 1YJVA 4JB8B 3JYTB 3OLAA 4HLBA 2B5JA 3E51A 2ADBA 2YNIA 3P45B 1I5OB 2RUSA 1NJWA 1Q79A 1REGX 5KFZA 4KGKA 4KTQA 5H9EK 4I2QB 3E3XA 1C1CA 4XK8C 2BACA 3NWGA 3DOLA 3ENVA 2HHSA 2MSSA 1S1XB 4NWBA 5LSRA 4ZCIA 2WB1D 5I3PA 2MQPA 5BYQA 4JI0F 2AHOB 3IC1A 1HR0F 4NLWA 3OL7A 4G1QA 3NGRA 3D1HA 1TL4A 2M3DA 1K1SA 1XIQA 1CS4B 2HS4A 1RHQB 1VI7A 1CQMA 2W7PA 5KFIA 3DXSX 2WOMA 1C1BA 4ITSA 3UCZP 2UUBJ 4CLZA 2MQLA 3RG6A 4AE5A 2ZOMA 3TA2A 4BBYA 4ED7A 1QY7A 2C2ZB 3L4BC 4NMXA 4WFZA 3PCOB 4AYBD 2RDDA 2BV3A 1JLBB 4B3TF 3T19A 5KFOA 4B08A 2GW8A 1XC9A 2VPXB 3W5XA 2PEBA 3LW5C 2VQFF 3RBXA 4O44A 1YKWA 2IC3A 2KXNB 2E7WA 2J7WA 4ES1A 2DYAA 1N52B 4DR5J 4OI3A 1F0XA 3N79A 4ICLA 3G8SA 1U2FA 1JXVA 1OMSA 3NMAA 2QC3A 2CG4A 2KU7A 4F0KA 2DGXA 4ENOA 4LF7F 2OGUA 1N5SA 4PUOA 4EUVA 4EU0A 4C0OC 2EFQA 1N6QB 3W9JA 3J7ZT 2DHXA 4PWWA 1T9WA 4I1TA 4DR1J 4ZCKA 2WB4A 3CMES 1S9EA 3P3DA 2FTRA 2DGOA 4AXIA 2QLXA 4RX6A 1D09B 3CNQP 1WEXA 4OYOA 3K57A 3E01A 1C2PA 2MZTA 1XBWA 1FCAA 5E3PA 4DL2A 2OLWA 3KK1B 2YKMB 4JI3F 1F3FA 3WX4A 2BUNA 2ZC3A 1HWLA 1UVNA 2MDAA 1YLXA 5LXYA 1S48A 4O0IA 5L1IA 3O6QA 5LSOA 3CDWA 5DDQC 1X31C 2HS0A 3I4HX 2AGPA 5J1PA 2YQ3A 3S6EA 2CWXA 4A8WA 3IG1A 3NGKA 4USUA 1WKKA 1TMJA 3VZHA 5E3AA 3HLUA 2I2YA 3MCMA 4U6PA 1Q53A 2E5IA 1TKTA 2NXEA 2WTFA 4IOAQ 3IR6B 4R5PB 3THTA 1FJGF 3I55S 2RB7A 5D8HB 4RNHA 1S79A 2OPQB 3KMQA 5HVHA 3KJVB 2C22A 3POTA 1JKHB 3SBMA 4RR5A 9ATCB 1YQHA 4F0MA 2V68A 3HXMA 2LEPA 8AT1B 1WWHA 2VDHA 1RT2B 1RTJB 4F4YA 2XLIA 1JLFB 3M4XA 4BC9A 4ILMA 2KRRA 4X4SA 1WD6A 1TAQA 4C11B 3GYNA 1AZSA 1I6JA 3DLGA 1X4GA 2BQUA 4M5GA 1M1KT 1IR1A 2KFZA 2IRYA 4IFVB 4RW9B 2MKCA 2HLTA 4RUBA 4X4PA 4C97A 2K1RB 2VFSA 2XS5A 4WZQA 4IDKA 4JI5F 4HI1A 2ZE2B 1S9GA 1YHQS 4DWIA 3I87A 2WVFA 3THPA 2IRUA 2R7XA 2RF2B 4CNZA 2HHTA 2ZUAA 3K5MA 4MFBA 3C14A 1IWAA 3M6XA 3BKTA 4JI6F 1NH7A 3CO9A 2W24A 4EFAC 3G9CA 4J91A 4X62J 4JV2A 4RUHA 5CCMA 3HKWA 2BJ7A 5GAHI 1K9MT 1K44A 2Z58B 1N4LA 2ZKUA 5M2PA 4DR1F 4OJ3A 2IYGA 2RDJA 2R9LA 3G96A 3GSDA 3PV8A 4DX5A 2VFRA 1VQSA 2QMWA 5I42B 4NRTA 1GX6A 3WQPA 1K0TA 5B0AA 3TJ9A 1SPBP 4PYAA 4O4GB 1QLNA 1DURA 4KKOB 3ETMA 4JP8A 5C42A 4JOUA 4F2RA 1BQXA 4J9SA 5DDRC 4EEYA 2X1BA 2XCAA 1UWBB 3EZOA 1AW0A 3VAKA 3CJ3A 4F3OA 5C24B 3PKYA 3BBFA 1H2TZ 2ZH9A 2OP5A 3OHAA 1UW4A 2GJIA 1RT7B 2KJVA 2POKA 2Z2ZA 4ZHRA 3E8OA 4WCEQ 4ZJQA 2NXNA 3Q8VA 5CAAA 3G82B 4WTYA 4QWBA 2J6SA 3MEGA 5E3CA 1HBUA 4QZVB 2FHOB 3OTCA 1FRIA 4IRCA 1JNZB 1NO8A 3JAMU 3FFIB 3A3PB 4Q5VA 2G2OA 1ROFA 1IBKJ 2CJXB 3HSGA 3J7A1 2W2OP 3VV2B 1TUGB 3DLEA 4WFNQ 1FDDA 3QIDA 1RBOB 3L7UA 3GSIA 5E3QA 3NKYA 5KFHA 4DPYA 4DF4A 4DQRA 2ZVIA 3M8WA 2GCFA 3TRGA 3E2EA 2GO9A 4DLEA 5HJXA 4C8LA 5L38A 3N5FA 2JLGA 4Y65A 4MMOA 1Y7PA 2AIRB 1SJ3P 3IR7B 4OZ1A 1XTZA 2MGZB 2X1GA 2JFDA 3MR7A 2YKNA 1ITPA 3KFWX 2KM8C 2IM2A 5I3QA 2PIIA 1N0UA 3KK2A 1HBOB 1KWMA 2ZFHA 2CQ4A 1JX4A 1WHWA 4M5JA 1ICEB 2W2QP 3PZPA 2KG0A 1PBAA 1NNDA 1PJ7A 3HFKA 1RYRA 5A6PA 1KP6A 2PSZA 2VODA 3FNNA 4X62F 4WU2A 2AYEA 2VKRA 5B7WA 4BS2A 4F3QA 4ZDNA 1WOPA 4DQIA 3TP2A 5KFVA 1TKXB 3SCJE 1HKAA 2EXUA 1JLEB 3IS9B 4URQU 3PIOQ 2V0NA 4FYDA 1IKVA 4F36A 1TFWA 4ZCLA 2XYGB 2DGVA 2MPUA 4LFCJ 1QVGR 4I4BA 1E6YB 1YX2A 3AA9A 3MPVA 3BGFA 3SDEA 3JXOA 2XM3A 4LJMA 5K8MA 2R7WA 3OSNA 2CQBA 1VQ7S 1CJUB 3U02A 4P7TA 2AJ0A 1VBZA 3TX0A 1B3TA 3GU0A 1H74A 1Q82T 1LWXA 4HKQA 2B5JB 1U1PA 3T5KA 2YNIB 2HVDA 2VB6A 3QSIA 2WSCC 2COLA 2C1EB 1N88A 3ZC4A 2DR7A 4Z7YA 3TJAA 1KFDA 4PG6A 2IJRA 1T8EA 3VQSA 4LR8A 3GYGA 3VF0B 4YR3A 1FRHA 2HGLA 4G1QB 3MAQA 5LOQA 2W01A 3N4WA 4P6QA 4ECUA 3KLEB 2WVEA 2WW8A 5LMUJ 2ZH7A 2C2DA 2WOMB 1C1BB 1V9OA 4FF3A 1RWWB 1P9QC 3KJFB 2XNQA 1BQNA 1PAUB 1ZZNA 4XDDA 1RHRB 1EIYB 1KQKA 3JTPA 1SKUB 1VQMS 2CQ1A 2DO4A 1U4BA 2EG1A 2YNHA 3OLBA 1VCTA 4TU7A 4O44B 1WF0A 2R2SA 3QFWA 3PG9A 4GVLA 1JJ4A 1S72S 3CIMA 4ICLB 4K4ZA 2H4YB 4RBUA 3MF5A 1KONA 1S7IA 1TL7B 1NDLA 4YUDA 2B0GA 4A47A 4F8RA 2XS7A 1V3SA 1HBMA 1S9EB 4USHA 2JLFA 1TP7A 2NYHA 4DHVA 3V6DB 3E01B 4L3KA 4ECYA 3I5CA 1RWMB 1CBKA 2C2RA 3F56A 4Y2AA 3CJSA 4Q8EA 3DRRA 4WFYA 5KFJA 4CM2A 4YFUA 3CE8A 2ILZA 4MT1A 3QRPA 1FHTA 4N76A 5D3GA 3DOMA 5BYRA 3BB5A 3BREA 1Q78A 4RU9A 4UW2A 1SXLA 1GFWB 2B9EA 4GVBA 3THVA 1S6PA 2BJ3A 4KH1B 5DQIA 1WHXA 4LFCF 2LECA 3BS9A 1WNEA 2FDNA 2VC0A 4ZLLA 1TKTB 3BBCA 2BW7A 1Y4ZB 3ENWA 4QWCA 3BN4A 1ZS6A 3PRDA 3H40A 2NYIA 2D1CA 4OMFG 2MY8A 2XGQA 2X51A 2HSEB 3POTB 1HLWA 1GMVA 3TUIC 3LOUA 1PC5A 2CVIA 2DIUA 1C0UA 1B4SA 3D0GE 5RUBA 4IOBA 4IYQA 2DXDA 3OL9A 2AJ4A 1HNZJ 4K5SA 2WSFC 4PRFA 3PYGA 1J2VA 4TY9A 4KSEB 4DS5A 4YB1P 2DH9A 4NCAA 3P96A 5HBMA 5I4MA 1SKSA 5L39A 3CDAA 4DOZA 1QDUB 4Y2MA 3ISND 4NLSA 4P2SA 5LMUF 4ZVHA 1NSKL 1AT1B 4MYTA 2BJEA 2JH3A 5A2QY 3OR1A 3NGSA 2VPZB 2OKQA 4F4ZA 3PW2A 4IDKB 2BDPA 2HVHA 2IJNA 1S9GB 1PILA 2MHNA 4ER8A 4NLRA 2R2TA 3C3LA 4A8FA 4HHUA 2BANA 4QPXA 3IXQA 2DNPA 4B9TA 3KUHA 1TK8A 3MXHP 2XMAA 5ETNA 4KRWA 2GVDA 1VQLS 3P49B 2NQPA 3GQCA 2RQ4A 2XYPB 3EMTA 1Q4RA 1WG5A 5A8WA 1VJWA 2FHJD 2V2QA 5J1EA 2YWEA 5SZTA 3BQ2A 2NLWA 2P8IA 1A6LA 5HANA 3HHLD 3DLLQ 1O5JA 2P5VA 4IUFA 1U1OA 2W9CA 2I0XA 1FJ7A 4K4TA 4OFZA 3PNIA 3OXFA 1FDNA 1D8ZA 4HT5A 3DYAA 4O4RA 1X4HA 3V4MA 5T14A 2APOA 3IM8A 1FRLA 5C42B 3Q8QB 2PFFB 3CTRA 2B8QA 5DQGA 3TVYA 4KR0B 3WBZA 1WKLA 1Y0HA 5HK4A 1X8DA 1F5AA 1UWAA 3ZTPA 1F1BB 3B4MA 2GMLA 3W2WB 1G4CA 3R1HA 2QLBB 2D41A 1QSLA 2CPFA 3Q8PB 1RA6A 4IKAA 2OSQA 4PZVA 3MR6A 3CWJA 3MUTP 5HMZA 4NLQA 3UN5A 3AD8C 1KSPA 2R8JA 3HHLA 4TU9A 1S12A 3UR3C 4DBQA 3MEGB 1HBUB 2VKZG 4ZVFA 2PI5A 5HLFA 1SC4B 3KLFB 4DL5A 4DF8A 1VQ6S 1SV5A 1WC0A 1HNIA 2DCUB 4DV3J 2FJWA 3KKFA 1T9UA 2W2MP 3DLEB 3GZ7A 3BKUA 2WBRA 3RAQA 5KFQA 5D0GA 3RUBL 1HNZF 4WP3A 1NJIT 2CQGA 3D5MA 3LP0A 3C6UA 1D3WA 2EPIA 5B0CA 1UAWA 2D3OR 1FDAA 4ZP9A 5CH7B 3FUYA 2XCPA 1B7YB 5IT9Y 1K73T 5KG2A 2YKNB 2R3VA 1QAJA 3MR5A 2ZOGA 4EZ6A 4M5LA 5F9NA 3TZWA 4PG5A 4ID5B 2HHVA 1OSCA 3KK2B 2LQ5A 1N33J 4DX6A 5K8OA 2CVEA 4M1KA 3S7RA 3AXKA 4N56A 1M5SA 4KY3A 4TLQA 1JLCA 1YGYA 5KT7A 1NKCA 2QMUB 1YDLA 4YR2A 1UZHA 1YI2S 1HHTP 1V5VA 3JB9k 2P6SA 5KFPA 3M8QA 5M2UA 1XK8A 3DLKA 4X84A 3CMAS 2ALZA 1U6FA 2FJEB 5L1KA 3GJTB 2XS2A 4B9SA 2C3UA 2EKYA 4ZJOA 1V3ZA 3DLHA 2LA4A 2AEFA 3Q89A 3S1TA 4LT6A 4WFAQ 3MM7A 4I67A 2XGPA 2KT3A 1WTBA 4QWDA 3US5A 3VGVA 3K7RA 3O44A 4AL6A 3PRVA 2HNDB 2B4UA 2IRXA 3K89A 2YXLA 1FFGB 2FVPA 2FZGB 3UWTA 5ETSA 4HHHA 3QT5A 2MZ1A 2CRLA 3KLGB 1FWLA 5J2NA 1BE4A 2HGMA 4AXJA 1URRA 3FZ2A 3SSRA 2QL7B 3I82A 3J7YU 2J5AA 2OUGA 4CLTA 2XWYA 1H0HB 2XI2A 3OR2B 2ASDA 4ZP8A 4Y00A 3VGSA 4FF4A 3GIRA 4DQQA 3FRYA 2H51B 1U8WA 2DJWA 2IFXA 2IVFB 3SI8A 5B09A 3HVWA 3BSCA 5AT1B 3W9IA 2QT7A 3AY0A 1L3KA 1IM6A 1ZM3A 2DXFA 4QWEA 4UF4A 3M8RA 2NXCA 2DHAA 1S97A 4YMEA 3PYDA 1MNEA 3JQKA 1REVB 5L1JA 2A1BA 2RIJA 2K3IA 4OX7A 5KT3A 3CJ2A 2DO0A 4K0KJ 5GMEA 3IR5B 3IRWP 2CQPA 4IG3A 4NXMF 1U1LA 1GAOA 5F41A 1DFDA 1HNVB 2PE8A 5C2CA 5ETTA 1Q8BA 4M95A 2ZM6J 2ACMA 2PN6A 1NJZA 1TAUA 2L9DA 1N33F 2D7SA 5E3RA 3JTOA 4K4YA 1CEZA 4OI6A 1SQEA 3PVXA 3OTOJ 3V81B 4ED4A 5ETVA 4ECVA 1P1TA 3HULA 2GIQA 1O51A 5H9EJ 1T9YA 2N7CA 1X4CA 2KZZA 3TR5A 2MQ8A 5D3GB 3DOMB 2IA0A 1PIEA 4DCPB 3FQKA 1HARA 4ZVGA 1S6UA 1MMLA 2BOAA 2CDRB 3TNVA 1F2HA 4Q0BA 3H2VE 2ADCA 4GVBB 4B3MF 3SSQA 2AMCB 2DNGA 1I3OB 4A8XA 4MJKA 2BJDA 3HVRA 2PFDA 1XJWB 1SC3B 3UVJA 4WTOB 3MAAA 3LANA 4B9VA 3OUYB 1VRTA 3CJRA 4O23A 1GTEA 4IR1A 1BWEA 3BZQA 1KKHA 4JV0A 1NXIA 3W62A 3CPWR 2H5JB 3JQJA 2FY1A 4JYAF 3MTJA 3OHBA 4RW4A 2HHHJ 4XAKA 4UTGA 1B70B 1C0UB 2A10A 3AOAA 4JBCA 2R2RA 2ATCB 4DL6A 4MIAA 1EP4A 2K7JA 1TFYA 5DO2A 4DZ6A 1LW0A 2B7BB 4BWJA 3DRSB 5HBMB 1FWPA 3I31A 2WZ1A 2DNLA 4A8YA 4J90A 4ECQA 1QAIA 4WPAA 1RHMB 4USWA 1RAAB 2B4OA 2A18A 1UFKA 2IMWP 4C7QA 2X1FA 1IBMJ 2AZ1A 2RILA 4ALZA 4DLGA 4DV6J 5DG9A 4EO6A 4I7FA 5CYJA 5CD4A 4WE1A 1TKDA 3T1YJ 1FE4A 4OZ5A 5DETA 4NA1A 2GVDB 3K2YA 4ZMMA 4RU2A 4DR3F 2G0IA 1T11A 5KFAA 2DNHA 4KPYA 2ERRA 4K4SA 4WU3A 1TV6A 2W4PA 3CJQA 1G1XA 5AXKA 2MLZA 4K0KF 4AUKA 4AD6A 1SBRA 5GAGU 3WC2A 2XWXA 5DLGA 3CEDA 4I2PA 4CCHA 2VJVA 1RHKB 2Z56B 2BE7D 3QT8A 2W9CB 4H4OB 4U8VA 1LWEA 3IAM9 4WJBA 3PX4A 2ZITA 3OD2A 4USJC 2KTQA 3FK4A 2EG2A 2B56A 3EDRB 5H9FJ 3DYAB 1S49A 1U1NA 3CULA 3Q22A 1MU2B 1AYEA 5F9LA 2J6UA 3OTOF 3EGZA 2HAIA 1VYAA 2PD1A 3EVOA 4ZOSA 1WHYA 4CO3A 1PC4A 4DV4J 3TZXA 4KFBB 5AJ3J 3BYRA 5M2RA 1D0EA 2IYIA 2O3DA 3OXLA 4Y34A 3EM1A 4DSLA 3PW4A 3JAMY 3HCXA 2QL9B 1WF2A 5F8GA 2HBQB 2FLNA 2DR5A 2DR6A 1CULA 3HHLB 2BW2A 1VK3A 1IWGA 3H20A 5LJ3Y 2Q43A 3VAIA 1ZZFA 2IIHA 1S0VA 3GJRB 4B9UA 2KL8A 1GX5A 2XSFA 4YN3B 2JEIA 4ZVRB 1NDCA 1HNIB 2OMOA 2HHHF 2JLEA 2LKZA 3JSRA 1LK5A 3LP1B 2F8HA 2EC2A 2YX1A 4DR6F 2ZBIA 3UN2A 4W92B 1EETA 2F8MA 3SYZA 1FNMA 2NZ4A 4A46A 1Q0NA 1F6TA 1H38A 2I9SA 2ZNYA 3C6UB 3AXMA 3G8TA 1HYSA 2F65A 1AUSL 4V19X 1BY9A 5AE3A 4ZIWA 2K06A 2N82B 4MYUA 2CNOB 4I56A 1U02A 4ZPDA 3PHEA 5L1LA 3OT9A 1VBKA 3MCNA 5KFCA 4DV6F 3AD9C 4RBTA 3OVAA 1Q1KA 3V6JA 3H4DA 3T5LA 1WC3A 4I6YA 4ZPVR 3VAFA 3H5YA 1JLCB 4X4TA 2OEJA 4GC6A 5HROA 1YG0A 2KFNA 3BDEA 3KXDA 2HK3A 2CDQA 4IRDA 3K5PA 4QBUA 5D4PA 4O3NA 2AJFE 1YJUA 3M8QB 5FD1A 3D9BA 1HPZA 3HJVA 3UPFA 2ZH6A 3DLKB 5B0EA 1RCOB 3CCUS 3KWMA 1KLMB 4CLLA 2DCLA 2ZJRQ 2YWFA 3W8PA 3PJWA 1RLDA 1N0VC 4OX8A 2LA6A 1VK8A 2ROPA 5L9NA 2EK1A 3D0HE 4ED6A 3K5NA 5GADU 1QJHA 2I38A 3FEYB 4LIRA 1SH3A 5SUHA 4CQ1A 2CJBA 1F2GA 3ZZTA 2GQCA 4HH0A 4ZS6A 4CM0A 2W7OA 1CC8A 2P9EA 1NPPA 2OMLA 3T3FA 3CO0P 4KGXB 2WW4A 1LXNA 2VF3A 4MIWA 4PR6A 3QRRA 2E5JA 4ZPTR 4TLRA 4M8LA 3AHPA 2YX4A 1OY9A 2KYXA 2V2ZA 5DLFA 3AT1B 5IQ6A 1Y00A 1Q5VA 4Y2KA 4LMZA 3AD7C 3RB4A 2VFVA 4P7VA 3QQCD 4Q7AA 3R7NB 4ECSA 3BGLA 1HNWJ 4ZA1A 4DQPA 4OYWA 2KJWA 3KMSA 4DX8H 1TL3A 5DS7A 4WXOA 3HVTA 5A8KB 5EX3A 1FD8A 1RTDB 1UFWA 1OPZA 4DN9A 4PABA 4RBVA 1R8CA 2CQ2A 3MM9A 2FIUA 1JLQA 2G1DA 3M2RB 4LFBF 1ZPVA 5AXLA 3RBZA 3VQTA 2VG6A 3I6PA 5CYQB 1S77D 4YR0A 2F63A 4DXLA 3C16A 1TKZA 2JEGA 2V2KA 4L74A 1D9FA 1HFEL 3JYTA 2I1RA 1ZTTA 1N5YA 1VC6A 3QZ7A 2P2CB 4EMDA 2CJ9A 5DJBA 3FCHA 3FCWA 3TAQA 2BZ2A 1CQNA 1ZOTA 3I0RA 5J2PA 4NYPA 1S1XA 4UZBA 2R7TA 4NEYA 2OHDA 3QFHA 3KJNB 2L9WA 2GAGC 1X7VA 2ZNZA 2QV6A 4DS4A 3J7Z5 3SCLE 4KGZB 2JDJA 5CD4H 4RW7A 2RHQB 2E5LF 3BSOA 1QD1A 4FBUA 5HQMA 2D3ZA 1SQGA 3FBBA 1KOHA 2U2FA 3QMQA 3QAUA 2R7UA 3VAHA 2N3LA 1YJ7A 5KT2A 3NBPA 4C8OA 4CLWA 1FJCA 3TAPA 4DUZJ 3LGNA 1JLBA 3UNGC 4BLGA 1S1WA 5KG3A 5D4LA 2R2UA 1C4AA 2V8DA 4OYIA 1UMJA 2N3OA 3MMBB 1RT5A 2V8PA 3UVJB 3MAAB 2FUG9 2N4DA 3VVUA 2RQCA 3ET6A 3SQGB 1IN0A 2OEMA 1X4DA 5ETQA 4O3OA 4OX9J 1YRTA 3IMQJ 5CZVA 1ZH5A 3EZ5A 1U2RA 4FF1A 3T1HF 2UP1A 4NLYA 2JHEA 2KVQE 1HI0P 4D3GA 5D78A 4RW4B 5B0GA 4K50A 4ZJLA 4CIOA 2C2NA 2PC6A 3QYYA 3C2PA 1OYEA 5KTQA 1Y3KA 2O1PA 3PRBA 4FS2A 1U24A 3DCAA 3DDNA 1AROP 2YKMA 1PSDA 1LW0B 3M7VA 1HNWF 1HHSA 2C3YA 4I64A 4PCQA 3S01A 4LSNA 3OL6A 1XNRJ 4ECXA 1A9NB 3Q8UA 2ZDPA 2LEAA 2CNKB 1UEKA 3VGUA 4JV1A 3R5BA 5KT5A 2RE1A 3DM2A 3MPDA 4CLUA 1HA1A 5IS2A 2KXHA 4FYXB 4DV2J 5DM6Q 2RMLA 1M5VC 5KG4A 4QYZJ 1VS3A 5F3ZA 1FRKA 1GXUA 3FSIA 5IT4A 1GMWD 1RWNB 2MXYA 1TV6B 1W2BR 2IDLA 1FERA 1JKHA 2CPIA 3GTYX 3HHNB 4ZLJA 1Y5NB 3VVTA 2M88A 2F9DA 2RSQA 4I2PB 2JRSA 2OJ3A 3VHQA 3N28A 4ZITA 1MMNA 1LWEB 1SQFA 2G13A 3HF5A 2KM8B 2M5YA 1CJVA 1A7GE 3FZBA 4ZK7M 3U7JA 2DHSA 3M1VA 4ES2A 1TVRA 3OFGA 4QIFA 2HFVA 1BC6A 1NSAA 1RT3B 3OJSA 1OS5A 5KFEA 2XZTB 2E9RX 1NSQA 2QYGA 3MUMP 2ZWPA 3GIJA 3QBCA 3MPUB 3CIZA 3GPAA 1QM9A 3HVAA 1WI6A 4O0NA 2YKOA 2QEXS 3QATA 3K59A 4BCAA 2KO1A 1U1RA 2AU0A 1H73A 2ZBCA 3FBFA 5DM7Q 1CULB 4UZCA 1M1GA 3BH6B 2EFPA 2W8KA 1UVJA 2O66A 4OX9F 1YJWS 4RO0A 2AGOA 4M5NA 2Z2YB 1L3VA 3FSXA 1X0PA 4Y0FA 3CJ8A 2AYGA 3TX8A 1UVLA 2F40A 4DN0A 1GMUA 1FEHA 5I42A 5J2MB 4BWMA 4GO7X 2XLKA 1GNKA 1S99A 3OBIA 3IGNA 3U1LA 4J9UE 2K3KA 4OZLA 1G7CB 1J27A 1EETB 3P4UB 2CZ4A 3RU0A 4K2JA 1NM2A 4MKVA 3JS9A 4LQ3A 1V6HA 2YBVA 4X4RA 1R8AA 3DI6B 1CSJA 1I1GA 4EI2A 2QRRA 2ACYA 3MURP 1HYSB 4RNMA 3DU5A 1XNRF 4UUWA 1Z1ZA 3BQ1A 4N77A 1LFPA 1QE1B 4ZPCA 3VCDA 4AL5A 3MR3A 4P2XA 4PXCA 1K8AT 1FRMA 1WC4A 1S1UB 4RLEA 1FTCA 5GMKa 4BC7A 1L5UA 3G82A 4E98A 2VIHA 4LF6F 2HVEA 4DV2F 3OJUA 1XMBA 5HROB 3D6MB 1X4EA 4LF4F 1D9AA 2IVMA 2B4PA 4GKJJ 1P1LA 2G1HA 3MECA 4CI0B 5D6GA 2E9ZA 2ZOFA 5ETOA 4K4VA 2HFSA 4TVAB 1HPZB 2UUTA 2C3PA 2HQGA 1JK9B 4HVZA 2ZDOA 2ZHOA 4B3TJ 3KHHA 1WOSA 2HEKA 1UZDA 3ISZA 4G3IA 3ZZRA 2DT9A 2B4VA 2QO3A 4V1Ak 4LIWA 2QLFB 1YK9A 3N0VA 1YZ7A 1BLUA 2BKPA 3DOKA 1Q16B 2DVIA 4URGA 1NUEA 2PA8D 4NX9A 3ZO7A 2GAHC 3HHKA 1BGXT 2Y9HA 2Q1LA 4L72B 2HW3A 3IAS9 3JSMA 2YH0A 1H72C 1AUDA 1HBOA 1NCLA 1XQIA 3GYXB 4NASA 4DV7J 4YQWA 1ELOA 1U8SA 1LW2A 4JI1F 1DLOA 3L3CA 4A8SA 2F4FA 2DR9A 1FRJA 4J9VA 5IT9U 2DH8A 5D0HA 2MZQA 1VR6A 1YJ9S 5E33A 2N4CA 2HBYB 3TUPA 2GJ2A 2EBGA 2JWNA 3DMJA 2C2MB 3D2WA 1TKXA 2HFOA 1TL3B 3HVTB 4ILLA 1RTIA 1KEKA 3GILA 2XC9A 3GJQB 2J9DA 2NZCA 1CJKA 4HTIA 4I6WA 1RTHA 1QSSA 3NCPA 2DGWA 1FO1A 3R3TA 1R27B 4C3MA 1HHQA 1E6YA 4ETZA 1FFSB 3L7PA 1TUWA 1D9DA 1X5SA 1UJ4A 5KFWA 2VG6B 5GAGI 4XPEA 2F8EX 1FJGJ 1U1MA 3T6JA 1KVKA 3HK2A 5AE1A 1CJUA 4YDXA 3I4PA 3C16B 1TKZB 3GFXA 1KFSA 3VZIA 5KFTA 3NCQA 1N5YB 1N56A 3PFEA 1F60B 4P52A 2XO7A 4PPZA 3I0RB 1ZYQA 1XWLA 5J2PB 3SEOA 1RXOB 3NNCA 1X5TA 4NRUA 5ITHA 1RI7A 4LVNP 5H1SV 3EPIA 5DGAA 1YITS 2V63A 4H4MA 3KLEA 4RW7B 2P9CA 2Y1IA 4GKJF 3MMJA 4OYAA 5J1NA 4Q45A 1Q8IA 4JI5J 2ILYA 3MM8B 3NBPB 2A2CA 1MN9A 1PYTA 2V8HA 1RKJA 1ZAWA 1S1WB 2IM0A 1V3RA 2I8EA 3CCVS 4U8YA 1LXJA 2MMYA 4A4JA 4JI6J 1DZ5A 4F25A 2HZVA 4ES3A 2C3MA 4F4AA 3HHEA 4K4XA 3H5SA 3OV7A 2FGOA 4L3NA 4OLOA 1RT5B 2BVZA 1EB0A 1FK9A 2JOQA 2VBXA 3ET6B 2FJAB 2WAQD 4OHWA 4Y3CA 3M6WA 4K4WA 1VRUA 2DNMA 3IWLA 1TL7A 1K47A 2ASYA 2MYFA 4FXVA 3GCXP 2DH7A 2D3O1 2OD4A 3R7SB 3AQOA 3M8ZA 3QGHA 3R27A 2W1BA 1RWPB 1TL5A 3V6DA 3QGGA 2DNNA 4DV7F 4NPOA 2E5GA 3SXLA 2XNRA 1GXTA 3LO3A 4OI1A 3FVYA 3CMQA 3PW5A 3SMZA 2RQKA 2AV5A 2ZZNA 2LVWA 1EKSA 1VMBA 1BXNA 3MHYA 1ACMB 1SJ1A 1TUVA 4YP3A 1RISA 2Y1RI 4LSNB 5HQLA 4ZLPA 1P27B 2Y1LB 3KNGA 4CP5A 5EGYA 1W25A 3SIPB 4HHJA 5U47A 2WCXA 4YDDB 2IHR1 1S4EA 2UXCF 3DM2B 3CF5Q 1WF1A 1U49A 1HMVA 4J9QA 3KTQA 3VR1A 4PPDA 4FN5A 1Q8KA 3K5OA 2RRAA 1UKUA 1SI9A 3D3BJ 1D8YA 4LSZB 2HZCA 5H9FK 1XR7A 3G6VA 3MOJB 2LQ8A 2EBEA 3U1MA 2IAJB 4DPTA 4CH0S 4PEOA 1QUPA 1R8PA 2E44A 2DIVA 5GADI 5F8NA 4MAKA 1U6BA 5GAEU 3M2VA 4AT1B 1VLYA 3Q2TC 1SKRA 2JL9A 4FP9A 4KHMA 2C3OA 4GO5X 3H5UA 4EYIB 3ILJA 2FHMA 2A0FB 2DB1A 5AXNA 4ILRA 1CJVB 3EXCX 2HIYA 2KKHA 2Z2MA 6FDRA 3BGOP 2YPYA 2J0WA 2XMKA 2DHGA 1TK0A 2MKJA 3M1VB 1TVRB 2QFJA 3A4TA 3FKBA 3NNAA 2J7UA 2XMMA 1T94A 5E0OA 5JVGQ 4LQ9A 2HQFA 2ASLA 2DPIA 3MPYA 2JC1A 4R8UA 4PG4A 2VL1A 3AAWB 3L9ZA 3TW0A 1FVSA 3DDIA 1CC7A 3PO4A 2JJ4D 4MKAA 3TA0A 1WG4A 2C2OB 3H4BA 3LQVA 1NBEB 1N5TA 2Z0GA 1JNRB 3ILLA 3Q86A 5LT5A 3CD6S 3FMWA 4P2MA 4HTJA 4TQSA 3IRXB 4U95A 1LFWA 2DNKA 2OFHX 3CCES 1SJ4P 3MEEA 1T7PA 3D1QA 2UVWA 3R6GB 1RU1A 5EN1A 3CJTA 5K9FA 5EWGA 4C8KA 3H25A 2Y0SD 2AW0A 4ELVA 2VUGA 3PYFA 1PGZA 2ROGA 4OX6A 3EGVA 2BKOA 3GE9A 4X65F 3W2WA 2DHHA 3SSSA 4CZCA 4R25A 4DSIA 4F7VA 2RS2A 5I3UA 4IFYA 4RZRA 3EGNA 4X64J 1VFJA 4NLOA 4ZVEA 2P9GA 4PG7A 3WIVA 5HL7Q 3M8YA 2XI3A 4F4WA 5HI7A 3BSAA 3BR9A 2VDIA 4FYVB 2WBMA 3GLJA 3DU6A 3IP0A 1AFJA 3QWPA 3CCJS 2UUWA 1U25A 4O3RA 4B9LA 2AX1A 2VBYA 3MECB 4TU8A 3K0JA 3KLFA 5E7OB 2HKEA 4LSLB 3TJ8A 3DN9A 4J9MA 3HKZD 2VICA 5KOXA 2LQ9A 5D77A 8ATCB 3LWMA 1UEVA 1LWFA 2LXFA 4LBHA 2AZ3A 3GR0A 1RTZA 1J5EF 5C2GA 1TELA 3IA0A 3C66A 1Y10A 3DOKB 2X3GA 2ZH1A 2EWHA 4C0BA 2CXEA 2MJUA 5IXUA 4ETXA 3MAHA 1HQEB 4DPOA 1X5OA 1S4FA 4M5MA 4N47A 4L76A 3T5JA 4DFMA 3JSMB 2QFIA 2L41A 1DQ9A 2DGUA 4ID5A 2QA4S 3D6HB 5T7LA 4KPCA 3MCSA 2VFUA 3LGMA 4YB7A 1DBDA 4CT8A 3T41A 3L09A 3MZIA 5FDLA 1LW2B 3A8JA 1DLOB 3VGTA 5JVHQ 3AJ1A 2HBZB 2LYVA 2BJ9A 3EDQB 3LGHA 4NZ7A 2XLJA 2A3JA 2R7QA 1U1QA 4ZVOB 1U09A 2UU9J 1XERA 3EXYA 2UVVA 4C8ZA 1F9EB 4G6VB 3DMJB 4AFFA 4DZDA 1R89A 4C48A 4GKKJ 1TL1A 4X4NA 4CO2A 3DGPA 3OTBA 4NLXA 4OYXA 4OHXA 3GWCA 4YOEA 1RTIB 3ULHA 2RKIA 2DNQA 3Q24A 2KG1A 5CABA 3HJFA 2MKYA 3DRYA 1CJKB 1K1QA 3QNWB 3BV8A 3SFGA 1RTHB 3DRPA 4GRSA 5LJ5Y 1S10A 3CCSS 1KQGB 5ADZA 1S0MA 3HSZA 3LWLA 3H42A 3PM9A 4F3MA 2FJBB 3A8KA 4YB6A 1RAEB 4A8QA 2HNDA 3HSDA 4IQXA 2OPPA 3ZTRA 1U6ZA 5KFBA 2CQHA 1L3UA 4WKYA 1RT6B 2VZ9A 3QJJA 1ULRA 3K8WA 2QE5A 1HNXF 1VHFA 3JSBA 3KLGA 2YWHA 2FLPA 4X64F 3I9ZA 3LUYA 2G0JA 1IBLF 4U9RA 2Y3YA 4RW6A 1NK0A 2DGSA 4DL7A 1LWCA 3T9NA 3OR2A 4H4MB 2CWKA 3EUNA 3KNAA 3PEJA 3B54A 4MK7A 4L6V3 3T6BA 4PG8A 1HQ2A 2QSFA 2ZC4A 4M5IA 3D3CJ 3RB0A 2XY5A 1FEEA 5DG7A 1VIOA 3AOBA 1HD1A 1U47A 3CCMS 4LRFA 4DR2F 1S0NA 2HQDA 4ZP7A 5LL6d 1N5QA 1RWVB 1DTTB 1EKRA 4CWBA 2ZJPQ 1FXLA 2IBKA 3CCZA 1JMTA 1REVA 2ZKTA 2GMJA 4JI4J 1IKWA 2WSEC 1FK9B 2BE9B 3AA8A 4F02A 2V50A 2CJYB 2FQQB 2QIFA 3HO1A 4CH7A 4F4KA 1VRUB 3PHTA 5KFDA 5IOLA 3ZFVA 1IM4A 3Q0AA 4C6AA 3EZUA 4WFBQ 2DTJA 1VQ5S 2HS3A 1HNVA 2GMHA 1IR0A 2MHEA 1SVDA 3TYTA 2MY7A 3R97A 1NHKL 4WK1A 4F67A 4CLYA 1NSPA 3WIUA 5G4DA 1T95A 3OPKA 4ZVQB 3ZTOA 3V81A 3O2IA 3DC2A 1ZM9A 4QR0A 5D15A 2FHKA 4DEZA 2UU9F 2R42A 4I6AA 1B64A 3AOCA 3FEZA 4QYZK 1SJFA 3BEGB 2GVZB 4GKKF 3NOCA 1AB8A 2PDAA 4CLFA 4GMKA 4USIA 4F0HA 1NH8A 4TY8A 4M5KA 4CO0A 3KK3A 1HMVB 2G4BA 3IBWA 3CW2C 1VQ9S 1S57A 4RWWA 1KR4A 1T9VA 3N01A 3TVZA 3OUYA 3KHGA 3T9ZA 4NZ6A 4W98A 4J9LA 4JV5F 4DSJA 1QTNB 4BHQA 1O6XA 4KT0C 3PR4A 4CDIA 5KAKA 1ZPWX 2RQMA 2K8GA 3I0SA 4DPWA 1GK8A 3AB2B 3M2VB 2JEFA 3DKDA 2HG4A 2PMHA 2AF6A 3EE3A 2C2KB 2XY7A 4TQRA 4NLDA 4UUXA 3DRSA 4OI0A 2DGTA 3FSYA 5CCLA 5A0YA 3DNCA 2G9OA 4OYBA 1XR5A 3M8PA 5A8RB 3RR7A 2GNKA 1LQ9A 1MLAA 1GQEA 2DITA 4MIBA 5B08A 4DSKA 2HFNA 3A8EA 1VBYA 2JC0A 1JQGA 5DGBA 5IC6B 3JSYA 4R8UB 3MOZA 3Q83A 1Q86T 3UCUP 3C46A 4M5HA 2DNRA 4K2XA 2IY5B 4E8UA 5F3TA 4M5DA 3QAEA 3QT6A 1RWOB 5KFKA 4JI4F 4DFKA 2XEXA 1RAOA 3H7HB 3SV4A 3GG0A 5L9XA 4JI7J 5D4OA 2CZVC 3RJMB 5KFFA 4H4OA 1FJEB 1SIZA 1IXKA 3BO4A 4DV1F 3MEEB 5KG6A 1QUVA 3GV8B 1PBUA 5KG7A 1TQLA 2RHSB 1MU2A 2DPJA 1PYSB 3R5JB 4OHYA 4NOHA 2CJAA 1EAYC 3JTNA 2FGCA 2D9OA 2LCWA 2EFOA 2W2NP 1RT4B 4KFBA 4ZVTB 3UR0A 3HZEA 1R0AA 1UFLA 2AEMA 3N5BA 4DR4J 2ASJA 1WC5A 1GEHA 5I3UB 4IFYB 4IO9Q 3FC9A 3V4IB 2LMIA 4AL7A 4Y28C 3H90A 3KYLA 1QAXA 4V19J 3EPGA 1HL6A 2FHJA 3LPYA 3KHLA 3WC0A 2IDEA 2HWIA 3RTVA 5HMWA 4EBEA 4ZIVA 2WONA 3UN3A 1FKPA 2YTCA 3MCOA 1NMEB 5FLXU 5B0FA 2UUAJ 2M8DB 3QIPA 2I6WA 2YH1A 2HQCA 4LREA 1JLGA 4RKUC 1B0VA 1UVKA 3G2XA 3W63A 1LWFB 5EWEA 3LP1A 3B8HA 4JUZA 3J81j 2M9KA 2HHWA 4C2MA 3HHDA 2KXFA 2VV5A 1H3DA 2C2EA 1Y5IB 1UPPA 4FNHA 5ETLA 4RL1A 2Q3PA 5IWAF 3A1YG 3NS5A 1HWJA 2GX8A 1RLCL 2VA3A 1FI4A 1X4FA 3W3SA 1XEZA 4ATNA 4NXMJ 3F41A 2BMBA 4NLGA 2HVZA 4PAAA 4EBDA 4J9OA 2Y1JA 3OVBA 1KOOA 5T7LB 1S6OA 3UI3A 4HEA9 4H4KC 3O3LA 4MTPA 2CYYA 5K14A 4TNOA 4RNNA 2IVYA 3LP2B 5FDLB 5E2QA 5CXTA 4J9RA 2OELA 2ZJQQ 3DXBA 1VDHA 1EX8A 3W60A 3GIIA 1TL1B 3DGPB 1KLMA 4HI2A 4JI7F 3NS7B 2J9EA 2M0GB 1U0SA 2VJUA 3SCIE 1KHWA 5A76A 5HO4A 1XMOJ 3G6ES 2RKIB 1S6QA 3CD0A 4B3MJ 2AGQA 2M4MA 3DRPB 3M6VA 4FDFA 4WP9A 4F4XA 1UVIA 2MB0B 4LVOP 1B7FA 3KG4A 3QJLA 2VOOA 1KLNA 2HMIA 3NWRA 1CJTB 4RUAA 4CT9A 1CLFA 5GAEI 3IWNC 2WVDA 2OPPB 3HSJA 4EZ9A 4JYAJ 1FX4A 4C3KA 4NL5A 3CB4A 4DR4F 3G6YA 2HQIA 4ED0A 1WI8A 2CQ0A 4B9NA 5KOWA 4D3HA 3K17A 4RW6B 5DDPC 2KYZA 2FVQA 3MEKA 5JXSA 1LWCB 2CQDA 2R8GA 2E5HA 2XZDB 2IPOB 1MG7A 4RPFA 4W4MA 4Q8FA 2FB0A 5CA5A 2EI5A 3Q8RB 4YB5A 2UUAF 2UUBF 3W1YC 5A8KA 4X4UA 1RTDA 1S1TB 2A2DA 2J8SA 3NNHA 2WHOA 3PY8A 3C15A 3OQ2A 4OZ0A 2BRKA 3M2RA 2B51A 1U48A 1L3TA 3ICLA 1GT8A 4DR3J 5CYQA 3VALA 2PGCA 4NI2A 4DR5F 4KAIA 4HH1A 3IM9A 1IKWB 2KDOA 3WHIA 3T5HA 2O5DA 1HQUA 1NDKA 3LH2S 3P5BP 5G0RB 1QVFR 3S8SA 2OD6A 3R1LA 2R7SA 4KO0A 3SZ2A 1NU4A 1IVZA 4WXWA 4FVMA 4DUYJ 1IKYB 2QL5B 4B02A 3ILIA 3PJXA 2BYCA 4ANEA 3K5LA 3ZZZA 1M1HA 1NKEA 1VLOA 2WVCA 1SC6A 1K0VA 5D4NA 3BDPA 2Z57B 1V5IB 4PQUA 2JSXA 4LRBA 2GV1A 3D6FB 2VPYB 2R8KA 3UD5A 4B3OA 3RGIA 3ETOA 2LLZA 2J0SD 1XMOF 2V8VA 4GC7A 3MI7X 2DK2A 4TY8B 2G0CA 3OL8A 4DL0C 3J80Y 1S76D 3CDUA 3KK3B 2PA3A 5KFXA 3MMBA 4DMZA 3NP5A 3KUEA 3R5GA 3IBCB 2AT1B 3ZTSA 3QO9B 2OIHA 4QR2A 3GG1A 3SQGA 3CCTA 4OJ1A 3W65A 2C42A 3GV7B 1KNZA 2MSTA 2UVUA 2QJ3A 1EZZB 5JMNA 3Q8SB 5KFUA 3I0SB 3QGIA 4DR6J 3RZAA 2VHGA 3R5CA 1IR2A 1M5HA 3EX7B 3IFEA 3UDLA 4KHRA 3VWSA 2PMWA 3R6LB 1MWYA 3I96A 3ZXWA 2KT2A 5GVQA 5A0YB 3V6HA 1WHVA 4OV1A 1VBXA 4J7CA 2KFYA 3B6BA 2L9NA 1NZAA 3M8PB 2HGNA 1E6VB 4KV8A 3KLIA 2V67A 4CO5A 1BHNA 3MFHA 4Y6IA 3M2UA 4NA2A 3OFEA 2OPRA 2BE2A 2CADA 1RHUB 4NXNJ 1OSDA 3H2LA 1Q95G 5CQGA 2NS1B 4J9KA 3MPWA 4LF5J 4P9SA 1I51B 5A6WA 3BPDA 1RKIA 2ZD1A 3OFHA 3O8WA 2ZVSA 4M5DB 3ZTQA 2DD8S 2VG5B 4WKRA 5F0WA 4UOHA 3CD7A 1N36J 4QQBA 3NAIA 3NAHA 1EARA 4ECRA 2WRMA 1SCJB 3MMAA 2HLUA 4LRAA 4ED1A 1DRZA 3BO3A 4UY85 1YRUA 1ZA1B 4ZN1A 4DUYF 2MQQA 2HYIB 2CJQA 3N9UC 1RQ0A 1S59A 3F44A 1NZ8A 1BQMA 4XIUA 2FJDB 5J2QB 2FC8A 3W66A 3W2VB 4U7UD 4K5RA 2V9WA 3R2DJ 5C5JA 4Q43A 1SL0A 3ILOA 1T9TA 3GCWP 1JJ2R 2VASA 2CZ9A 5K20B 1RT3A 2HNZB 3ZZPA 2D9PA 3ITHB 1U7LA 1R0AB 3AJDA 3LA0A 1R6VA 4LR9A 1R8BA 1N34J 4U67Q 4ECTA 4G1IA 2CQCA 4AQYJ 1Y5LB 2AD9A 1C1CB 2V4RA 1MWQA 3DOLB 2ZWOA 1S7HA 2WVBA 3PX6A 2QN6B 5AXMA 3MMCA 5T41A 2X1AA 4OJGA 3JQMA 2WONB 1FKPB 3DDKA 4RNOA 2HIQA 1PJ5A 3HP6A 1R6YA 2FY8A 3QIPB 2E1CA 5KT6A 2BR0A 2W4DA 1IBKF 1JLGB 1RAJA 4UOGA 5J2MA 3F73A 2B9YA 3D7SB 1RGVA 3G86A 5EHHA 4U96A 2Y8YA 2NSBA 2DNZA 3KDNA 3HDSA 4A8OA 4LFBJ 3GFZA 2HHUA 2ZH5A 5IV3A 3UE2A 4ERDA 2H5EA 2IC3B 1HW8A 2M52A 2H4WB 2BBEA 1XR6A 3M8SA 4IH7A 4DCJB 3H8YA 3DI6A 1I94J 2GQ2A 2AYBA 2YNGA
chains in the Genus database with same CATH topology
4FPRA 4PUOB 2XHWA 4PPDA 4FN5A 3K5OA 4IR9A 4TKTA 1G2EA 2RRAA 5D8HB 1UKUA 1QE1A 2CKWA 1SI9A 2FVPA 3UWTA 2J9DE 2W8LA 1D8YA 2MZ1A 2HZCA 2CRLA 3KLGB 1XR7A 3G6VA 1X4BA 3MOJB 2VPWB 4KBIA 2EBEA 4KE5A 3M9OB 5J2NA 5G0RA 3U1MA 2IAJB 4NXNF 2HGMA 3H5XA 4AXJA 1URRA 3FZ2A 5K14B 1S1UA 5LXRA 1KS2A 2MQNA 4CH0S 1QUPA 1O8BA 4DDFA 5CYMA 3SSRA 1R8PA 3I82A 3CUNA 1VQPS 4LF5F 5FIIA 2E44A 3J7YU 2J5AA 5B0DA 3HX9A 4J9PA 2DIVA 1IKYA 1JJHA 2AQ4A 1T02A 2XWYA 5GADI 3OW2R 3VTIA 2AP6A 3SFUA 5F8NA 1H0HB 2XI2A 4MAKA 3IWXA 3RB3A 1U6BA 3OR2B 2GHPA 1U26A 3MFIA 5GAEU 2ASDA 2VQEF 5EX0A 2YWGA 1T3NA 1X0FA 3M2VA 3FEXB 4ZP8A 1VLYA 2EVZA 4Y00A 3Q2TC 3RYLA 1SKRA 1N36F 4FF4A 2IMOA 2JL9A 4FP9A 4RUCA 4KHMA 3J81Y 2C3OA 4MH8A 2I5JB 3CT9A 3N6LA 4DQQA 4GO5X 4O4GA 1U1KA 1T3OA 3FRYA 4KKOA 1UA0A 2MKIA 4QU7A 2W9BA 3M32A 1NK9A 3M30A 1N8RT 2DJWA 2IFXA 4FXWA 2IVFB 2ROEA 3SI8A 2RNEA 1RP5A 1R3NA 3H5UA 4EYIB 5B09A 3HVWA 3MWBA 2FHMA 2DB1A 3UFCX 3BSCA 5AXNA 4ILRA 3C6TA 3GIMA 3GR1A 1S6QB 3NL0A 3EXCX 4PWDB 2KKHA 2Z2MA 4UQTA 6FDRA 2B6AA 1R43A 2QYCA 2J0WA 2XMKA 4QJVA 2DHGA 1N48A 3IG1B 1ZETA 2QT7A 3OTEA 1F5BA 1G6BA 4QYRA 2MKJA 3AY0A 3M1VB 1TK0A 2FLLA 1TVRB 2QFJA 4FF2A 4X2BA 4URSA 1UWBA 1VQOS 3NNAA 2J7UA 3PDNA 1L3KA 2XMMA 1ZM3A 1VC5A 4QWEA 1MROA 3M8RA 4J37A 5C24A 3L95X 2DHAA 1S97A 3KOAA 4YMEA 4ZKAA 1MNEA 1T94A 4PXEA 4IRKA 1REVB 5E0OA 5JVGQ 4LQ9A 5L1JA 5C25B 2ASLA 2A1BA 3BGRA 2DPIA 5KG0A 2RIJA 3NRBA 4OHVA 3HPOA 1RT7A 2JVRA 2HMIB 3MPYA 2J0XA 2JC1A 2K3IA 4XDCA 4EGLA 4R8UA 1UJ5A 1XNQF 4PG4A 1Q81T 4OX7A 5AE2A 5KT3A 2QA4G 3CJ2A 2O67A 4RWXA 2DO0A 2VL1A 4W90B 3AAWB 2OAUA 3D28A 2AX0A 3TW0A 3B82A 4J5OA 3IR5B 3IRWP 2CQPA 1FVSA 2FJVA 1CC7A 2NUHA 1RK8A 4IG3A 1RJJA 4NXMF 3QO9A 1U1LA 3PO4A 2F1FA 2LU2A 1SH0A 1NK8A 1GAOA 1IKXA 2JJ4D 3PFOA 2MQMA 5F41A 3BO2A 4MKAA 1DFDA 3RRHA 3TA0A 1HNVB 2NR0A 4I0WA 2PE8A 3CJ4A 5BJRA 4WFXA 1Q8BA 1N34F 1WG4A 2Q66A 4M95A 3H4BA 3LQVA 2PN6A 2RU3A 1NJZA 2NXUA 1TAUA 4AQYF 1VOMA 1SUQA 2E1RA 2L9DA 1NRKA 1N5TA 1N33F 3FFIA 4MK9A 5LMNF 1DQ8A 1NK6A 2FVCA 5EDWA 2D7SA 2Z0GA 1JNRB 2IM3A 4Y2CA 2QZ8A 5E3RA 5LT5A