4ZVGA

Crystal structure of ggdef domain of the e. coli dosc - form iii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
MDVLTKLLNRRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNVRSSDYVFRYGGDEFIIVLTEASENETLRTAERIRSRVEKTKLKAANGEDIALSLSIGAAMFNGHPDYERLIQIADEALYIAKRRGRNRVELWKASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Diguanylate cyclase DosC
publication title Structural analysis of an oxygen-regulated diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 53
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zvgA00
3M8PA 4NZ0A 4LQ9A 4IRDA 3QO9A 4ZPAA 3TQ1A 4OL8A 1C1BA 4H4MA 5EWFA 5J2PA 1DLOA 2YKMA 1S1UA 3RBEA 3N6LA 2VA3A 4MK9A 3V4IB 1RTHB 4JUZA 4I2PB 3TAMB 4M95A 2BANA 1JLCA 1KHVA 5KG3A 4TQSA 2W9CB 3OHBA 4ECSA 1HPZA 1RT6A 1S1VB 5D3GA 2ATLA 2UVRA 1D1UA 4RW7B 1RAJA 4IG3B 4F50A 3DOLB 4WFXA 3MFIA 3T5JA 1TVRB 4ED8A 3V4IA 1RTHA 3SI8A 3QLHB 2JEIA 4Y3CA 4I2PA 3TAMA 4ECYA 2D3UA 3ISND 2W9CA 3PR4A 1QE1B 1S1VA 3BQ1A 4DG1B 3FDSA 4IDKB 4RW7A 2B5JB 4K4YA 1RTDB 3RB3A 4IG3A 2XCPA 1IKVB 1SH2A 3DOLA 5F8JA 2OPQB 5L1JA 3H5UA 1S6PB 2ZE2B 1RT7B 1TVRA 5KFWA 2R2UA 5J2QB 3QLHA 2C28A 2R8JA 4TYAA 1S1WA 4EO6A 5KG1A 1RA7A 5KFDA 2UVVA 1QE1A 5KFRA 5F8NA 2ILZA 4DG1A 3IRXB 4IDKA 5DGAA 1RTDA 3BQ0A 1IKVA 5DLGA 2OPQA 1U09A 3E51A 1D0EA 4KKOB 3V81B 1S6PA 2ZE2A 3QGGA 1RT7A 2GIQA 1EETB 3I5CA 4J9MA 5J2QA 2ASDA 4NLXA 4MK7A 4G3IA 1S1TB 3PHEA 4QWEA 3H5XA 3MTKA 3IRXA 3PJWA 4K4SA 3KOAA 3DOKA 1C0UB 3SFUA 4RW4B 4KKOA 3V81A 1S10A 4I7FB 4RW8B 4Q45A 1GX6A 4NLWA 4URQU 5F8IA 2OPRB 1S1TA 4KV8B 3CO9A 3MR6A 3G6YA 1IKXB 5KFBA 3M9NB 3H2LA 2R2SA 2V9WA 5JXSA 4R5PB 2HWHA 5L1LA 1C0UA 5DQGA 4RUAA 4K4XA 1WNEA 4NCGB 3DM2B 4RW4A 1YVFA 3QIDA 2YNGB 4ED3A 4ED6A 4I7FA 4RW8A 4ZPDA 2IJFA 4IKAA 5HBMB 2OPSB 2OPRA 3I5BA 4R8UB 1QAIA 1S0OA 4KV8A 1LWCB 2XGQA 1S49A 3UPFA 4RNHA 1IKXA 1DTTB 3IG1B 4R5PA 4MFBB 5K14B 2R8IA 3PZPA 4NCGA 3DM2A 5KFFA 1HQEB 2WONB 2YNGA 2E9TA 3GV8B 4PWDB 3BJYA 4RNMA 2OPSA 5KG5A 4R8UA 3Q8SB 3OHAA 2VA2A 3IGVA 2R2TA 1LWCA 4ZPCA 5KFXA 3DI6B 4EEYA 1FK9B 5KFTA 1DTTA 4RUCA 4TYBA 1NHVA 3H4BA 3IG1A 3GIMA 3EPGA 2FJXA 5K14A 1RT2B 4ZMMA 1HQEA 2I5JB 2WONA 4WYWA 4EO8A 4U6PA 4GC7A 4EBEA 4PWDA 2WTFA 3BQ2A 1N5YB 4KHMA 3DI6A 4O44B 4KFBB 3UR0A 2D41A 1FK9A 3CVKA 1JLFB 1LWFB 1NHUA 1C1CB 4URGA 4DEZA 5KFPA 1SV5B 1RT2A 5KFAA 5HROB 1FKOB 2I5JA 1ZETA 1UWBB 3FQLA 4NLUA 3CJ3A 2IM2A 5CYMB 4WZQA 1XR6A 4LSLB 4ECRA 1TKZB 2D3ZA 3JYTB 3PR5B 5HP1B 1DTQB 1JLCB 1N5YA 5L9XA 4O44A 3NBPB 1S9FA 1JLFA 1LWFA 1C0TB 3MFHA 3RBDA 1C1CA 1SV5A 2CKWA 2VG7B 1T05B 3QIPB 2W7PA 5J1EB 4K4TA 3GYNA 1FKOA 3I5AA 4WE1B 1UWBA 3CJ0A 3TVKA 5HROA 4Y34A 1TP7A 5CYMA 3BGRB 4ZPBA 1JXLA 3KHHA 4LSLA 3VQSA 1TKZA 4TLRA 3JYTA 3NAHA 5HP1A 2FVPA 1DTQA 3KMQA 1LWEB 5KT6A 3T1AA 3NBPA 1C0TA 2YNFB 4Q0BB 2UVWA 2IM1A 3IS9A 4EYHB 3MECB 2VG7A 4FBUA 1T05A 3C6UB 3QIPA 4NLVA 4YP3A 1JLEB 5J1EA 3CJ4A 3D28A 5KFQA 4WE1A 3BSNA 3KNAA 2F8EX 3BGRA 4ED0A 4MH8A 3PW0A 2R8GA 3PW2A 2E9ZA 1S1WB 3OL6A 4EBCA 5C25B 2WOMB 1LWEA 5KT7A 4NLYA 3OLAA 2YNFA 3H98A 4Q0BA 2AQ4A 4RW6B 1RT5B 3MECA 2BQRA 5EDWA 1I6JA 3C6UA 1VRTB 4NLOA 2V4QA 3IN5A 1JLEA 5L1IA 4ICLB 3KLVA 1VRUB 5F8HA 5T14A 3GV5B 2JEJA 4TN2A 2WCXA 1K1QA 1S48A 5C5JA 5F8GA 4FS2A 5C25A 2WOMA 1T03B 2RDIA 2BRKA 2IJNA 3DOKB 4LQ3A 4RW6A 1RT5A 1S9EB 3LAKA 4QW9A 3SFGA 2ALZA 1VRTA 3NAIA 2FVRA 2BRLA 5KFEA 1NNDA 4ICLA 1RT3B 3OLBA 3RB6A 1VRUA 2IM3A 1S0MA 3DRRB 3I0SB 4ZVGA 1JLGB 1S6QB 1TKXB 5DQIA 2B6AB 3UDLA 1JLQB 4J9PA 3NL0A 2YNHB 1T03A 1TL3B 4ZHRB 2IAJB 4KAIA 3N6NA 2D7SA 2JC1A 4RW9B 2AGPA 4RNNA 1BQMB 1S9EA 4RU9A 1TV6B 2AWZA 4EBDA 2FVSA 3DLGB 1S9GB 4TQRA 4IRKA 2HNDB 3UQSA 2HNYB 1RT3A 4ZVHA 3GIKA 2C2DA 5KFUA 3DRRA 3CDEA 3I0SA 4XPCA 4F4ZA 1JLGA 1S6QA 1TKXA 2FJWA 2HMIB 4WFYA 3KHRA 2B6AA 4FS1A 2UVUA 1JLQA 4J9OA 4G1QB 2YNHA 5I3UB 4K4WA 1TL3A 4ZHRA 2IAJA 5D3GB 2FVQA 4IR1A 3MEGB 4RW9A 5KFCA 3Q8RB 4ZP6A 1BQMA 1TV6A 2ZD1B 4IH5A 1RT4B 1S9GA 2QV6A 3DLGA 4DL5A 2E9RX 2HNDA 2W9AA 4K4VA 2HNYA 2ZKUA 4KB7A 3NKYA 4ECZA 3CDUA 3T5HA 2HMIA 3FSIA 5JUMA 2C2EA 3KLFB 1RA6A 4KBIA 4G1QA 5I3UA 5J2NA 2R8KA 4DL7A 3MEGA 3QGHA 4R0EA 3NMAA 2IM0A 2C22A 2ZD1A 4B3OB 1RT4A 4H54A 4ED7A 3LP1B 4J9QA 2WHOA 3JSMB 2XGPA 2C2RA 2J6UA 1JIHA 2W8KA 4QWBA 3GIIA 5L1KA 1T3NA 3DLEB 5KFVA 3KLFA 4NLSA 3BSOA 4J9RA 4Y2CA 3DDKA 4Q43A 4IH6A 5EWEA 4O3PA 3G6VA 2W8LA 4ECXA 4IR9A 3OL9A 1S4FA 3OSPA 3RB0A 1TQLA 2J6SA 4B3OA 4NLPA 3LP1A 4WXOA 4HYKA 4K4UA 3JSMA 4DL4A 3ISNC 4JV1A 1RT1A 4EYIB 2VG5B 1RYRA 2JEFA 3CJ2A 3KK2B 1LW0B 4NLRA 5J2MB 3QGIA 3DLEA 3OL8A 3GILA 3G86A 3H5YA 4J9NA 3RAXA 4ECWA 1S0NA 3OSNA 4GC6A 2RKIB 4KHRA 4J9SA 2IA6A 1XR5A 3PW7A 5DQHA 2XI2A 4NRTA 4JV0A 4IFYB 3CWJA 2J6TA 2VG5A 3BSCA 4KO0B 4ED1A 3KK2A 1LW0A 1N56A 1Z4UA 5J2MA 3I0RB 5KFYA 5KG2A 2YKNB 4NLDA 5KFNA 2BE2B 1JLBA 4TY9A 3HVTA 5KFMA 3IS9B 3QYYA 2RKIA 1RTJB 4ZP9A 3PW4A 3H5SA 3D5MA 3MEDB 2HAIA 3RB4A 1N4LA 2AGOA 3BREA 5KFSA 4IFYA 4JV2A 2V0NA 2ASJA 4KO0A 1HARA 2GIRA 4F4YA 3I0RA 1QUVA 1K1SA 3KLIB 1SH3A 2YKNA 1J5OB 1S97A 2BE2A 2GC8A 4URSA 1JX4A 5C24B 3MR2A 1RTJA 1MU2B 4RZRA 1SH0A 4ECVA 1ZTWA 5EUHA 2XI3A 3MEDA 4ID5B 4QW8A 1MMLA 3ITHB 4KSEB 2W7OA 4IQXA 1IKYA 2EC0A 4O4RA 2UUTA 4ZVFA 4LSNB 3KK3B 3G6XA 1QAJA 3KLIA 1HMVB 1J5OA 1BQNB 2WRMA 5C24A 3FFIA 4O3QA 5CYQB 1JLAB 1MU2A 2AX0A 3KMSA 4ID5A 3HVWA 1IKWB 3V6HA 1HNIB 2HWIA 2UUWA 2FLLA 3ITHA 4XPEA 4IFVB 4TY8B 4WFZA 3LANA 4LSNA 4YMEA 3IGNA 5F8LA 4O3NA 4XO0A 4YR2A 4O4GB 3KK3A 3H4DA 1HMVA 2AGQA 2FJVA 3QZ7A 3MEEB 1KLMB 1BQNA 1GX5A 3BR9A 4U7CA 4Q8FA 3Q8QB 4TXSA 5CYQA 1TL1B 1JLAA 4Y2AA 2HNZB 5KFOA 3T5LA 2OH2A 1RTIB 2R8HA 4MKBA 1IKWA 3M9OB 1HNIA 1CSJA 4O3SA 3CIZA 4PUOB 5KG6A 3M8QB 2IBKA 4QPXA 1IM4A 4IFVA 4TY8A 5HLFB 3KJVB 2IC3B 5KG0A 4O4GA 5I42B 4DL2A 3MEEA 1KLMA 3EZUA 5KFGA 3BSAA 3LP0B 4X2BA 5DG8A 3V6DB 1TL1A 2HNZA 1EP4B 3PVXA 1RTIA 2I1RA 1N6QB 5KFZA 1REVB 4QWCA 4QWDA 3MF5A 3RAQA 5F9NA 1HQUB 4PUOA 2B5JA 3M8QA 4WYLA 3CDWA 4O3RA 2XCAA 3DLKB 3QZ8A 3KLHB 3GQCA 3KJVA 2IC3A 5HLFA 2FLPA 4RNFA 5J2NB 2O5DA 3CJ5A 5I42A 4WXWA 4ZP8A 3KLEB 2BR0A 1R0AB 2YNIB 4YQWA 5EWGA 2R2RA 3LP0A 4YR3A 4Q8EA 4MK8A 3V6DA 1EP4A 1N6QA 1OS5A 2RF2B 1REVA 4YR0A 4F4XA 5KFLA 1RYSA 1HQUA 4IH7A 4NLTA 3LP2B 4ZVEA 4F4WA 3HKWA 4ECUA 1T94A 3V6JA 3DLKA 4PQUB 3C6TB 3KLHA 5DG9A 3FQKA 3KHGA 4J9KA 1LW2B 3KK1B 2WB4A 3ICLA 5C42B 4ECQA 4FBTA 3KLEA 1R0AA 1JKHB 2YNIA 1EETA 3FRZA 1TKTB 4H4OB 2XC9A 2RDJA 3LAMA 5KFJA 2DPIA 1KHWA 2ASLA 3N6MA 2RF2A 3KHLA 1HNVB 1RT1B 3DRPB 3LP2A 3EPIA 4IG0B 4ED2A 4IRCA 3NGDA 4K50A 4PQUA 3C6TA 5F8MA 3OL7A 2JLEA 1ZTTA 1LW2A 3KK1A 5C42A 1JKHA 2IMWP 3MR3A 1TKTA 5KT4A 2W9BB 5FDLB 3HVAA 4H4OA 4NLGA 2JC0A 3E01B 1HNVA 3KLGB 4ECTA 3DRSB 2AX1A 2XWYA 3PW5A 4K4ZA 3DRPA 4Q44A 4IG0A 5KT3A 4NRUA 5DLFA 4M94A 2VG6B 2B43A 2OPPB 3HHKA 3V6KA 5KG7A 4MKAA 1SUQB 4ZP7A 4QWAA 1JLBB 4I2QB 1HYSB 2V4RA 5DGBA 1W25A 3HVTB 5HBMA 2W9BA 2BQ3A 5FDLA 1FKPB 3GV7B 2BQUA 3H40A 3E01A 4NYZA 3KLGA 1S1XB 3DRSA 2FLNA 4HKQA 2ILYA 3T19A 5KG4A 3DYAB 4MFBA 4J9LA 4RNOA 3PJXA 5KFKA 2WK4A 2AU0A 2VG6A 2OPPA 3GIJA 1HYSA 1SUQA 4I2QA 4DL3A 5KFIA 1RT6B 2QE5A 3DMJB 5DG7A 1FKPA 5KT2A 4MIBA 3T5KA 1DLOB 3Q8PB 1S1XA 2JEGA 1XR7A 5F9LA 3M9MB 4WZMA 5KFHA 3M8PB 2DPJA 1IKYB 1C2PA 3DYAA 3MR5A 4MIAA 3QO9B 1RDRA 2CJQA 2FVCA 1C1BB 4H4MB 4KE5A 1N48A 5J2PB 4DL6A 2YKMB 1S1UB 4NLQA 3DMJA 3FFIB 2BANB 3H59A 3LALA 5KT5A 4KFBA 1HPZB 4IOBA 4O3OA
chains in the Genus database with same CATH superfamily
3J81Y 4LQ9A 2F4VJ 1U1PA 2XY7A 2M9KA 1K44A 4DU7A 2DNRA 1RTHB 2O67A 1U45A 5LOQA 2DKOB 1D1UA 1RAJA 3OTCA 2ZBQA 2DXFA 3UDCA 5F8JA 3R6GB 2GIFA 3VAHA 3MCOA 1YKWA 3CEDA 3CO0P 5IT9U 4DV3F 1QE1A 1M90T 2HFVA 2H65B 1UEVA 3OQ2A 1NO8A 1RT7A 3AT1B 1KEKA 1WWHA 5THWA 1G3OA 3EUNA 2BE7D 4HTJA 2XMKA 1S10A 2QIFA 4RW8B 2I6WA 1S1TA 3MCSA 3CD0A 2F65A 1WI6A 3MR6A 3KUHA 3R5BA 2R2SA 4Q5VA 5L1LA 2B9EA 2DH7A 1WNEA 2M7SA 4DSJA 2GV1A 1GNKA 5CYJA 4R8UB 1QAIA 2HGMA 3ZZ0A 3US5A 2P9CA 4QU6A 4MFBB 4B9NA 5CZVA 1UPMB 5KG5A 2LU1A 1LWCA 2PA3A 2CNKB 2DCLA 4OJGA 3W8GA 1UWAA 4BDPA 2DISA 1WC5A 4PYAA 2CVIA 2ZVIA 2C3UA 2ACMA 5KFPA 1TK8A 3B78A 1WG5A 1SKUB 4JP8A 3AD8C 5HROA 1WF1A 3KMQA 4Q2LA 4DR5F 1NSPA 3D0GE 4Q0BB 2P6SA 5D4LA 4ZITA 2G2ZA 4X65J 3G71S 1M1KT 5LSOA 1YSJA 1Y5LB 4TN2A 3LTOA 1RKIA 3UCGA 2RILA 5F8GA 4DCPB 2WOMA 3PEJA 3RZAA 2VHGA 1S9EB 3NGSA 1RISA 1MMDA 1KRPA 2OP5A 3I0SB 2EFQA 4JI6F 3UDLA 3M2RB 5L8RC 2RS2A 2ZWPA 5AE3A 2FVSA 1TV6B 3AHPA 3AQOA 3QGPA 3QRRA 1RT3A 3VAKA 2N4DA 3A4TA 3AODA 2XLIA 2XQCA 4ZP6A 1BQMA 4USIA 2XBPA 1KQFB 1DBDA 3FSIA 1Y7PA 4DL7A 4B3OB 3GCXP 2QYGA 5K9FA 3DNCA 2HQCA 2ASYA 3MM6B 3EXYA 1UAWA 2YWGA 3BYRA 3OL8A 2HG4A 3CW2C 3PYEA 1XR5A 1N36J 2XI2A 3JAMU 4ED1A 1HI8A 1LW0A 4USTA 3U7JA 1TFYA 5CZXA 3BREA 1X9MA 1HARA 3KKFA 4QIGA 4LREA 3TZWA 1J5OB 5L38A 4C0BA 3QJJA 4ECVA 4MTPA 2XI3A 3PRBA 1RWKB 3NNAA 2XMJA 3SYZA 3AJ1A 3KLIA 2WRMA 3H90A 2V6AA 4KGKA 2YKQA 3U1NA 3TNVA 2UUWA 3VVTA 3M1VB 4YMEA 1X0FA 4MKYA 3CJKB 1GX5A 4ZK7M 2R9LA 2HNZB 1AFIA 2CPXA 3M9OB 1NKCA 3M8QB 3EICA 5HLFB 3THPA 5KG0A 1XNRJ 3S8SA 4HHHA 3EZUA 3BSAA 2VPYB 2XWXA 3OFFA 4GVLA 4P2FA 4PUOA 5GAHI 4O3RA 1RADB 4QIFA 5H9FJ 1HQUA 3K5PA 3FQKA 2K2PA 3EGVA 3PO5A 2XC9A 3GCWP 2RD5C 4OHYA 4PQUA 3EE3A 3L7PA 3KK1A 1WHWA 1VJQA 3UE2A 2Z30B 4C3LA 3I96A 5HSPA 5AXNA 5BR8J 5H1SV 4NRUA 2VODA 2QO3A 4QWAA 2Q79A 2V4RA 3M8WA 4MKVA 4MMOA 3KLGA 2PA8D 3SIPB 1PSDA 3IFEA 1V3ZA 4X65F 1MNEA 5BYSA 3IBCB 5FJ4A 1E6YA 4WTOB 1S1XA 5HK4A 2HHWA 1H74A 1XJWB 2NYIA 3PRVA 2V94A 3FEXB 3O5TB 1VJWA 1UPPA 1DLOA 2IYGA 2W4DA 1Q81T 4O3OA 2NSBA 4IRDA 4ZPAA 1X4AA 4UQTA 2YKMA 1S1UA 2ZUGA 3K59A 2W9CB 1XIQA 1TR0A 4ECSA 2UVRA 4RW7B 4UOCA 4OI6A 2MY8A 4L74A 3B4MA 1WORA 4DG1B 4F26A 2XCPA 4BC9A 3ZFVA 4L3KA 2E5LJ 3OXFA 1RUSA 1TAQA 3OTEA 2ZVSA 4TKTA 1D0EA 3QAEA 2KFYA 4KHPJ 6FDRA 3PHEA 4KIAA 1HI0P 1V5VA 3K0JA 3V81A 2V5HG 1KQKA 4ES1A 4X62J 1N36F 4KGVB 2V9WA 4NCGB 4ED3A 4ED6A 1WEYA 1SXLA 4QBUA 2DNQA 5D4NA 4HT5A 1FRMA 4EEYA 3FK4A 5D15A 2OAUA 4RUCA 1T7PA 1RT2B 3IM8A 5ITHA 1FNOA 1YBUA 2FZKB 5AT1B 4CZCA 1LWFB 1WI8A 2LEPA 2VFUA 2MKKA 1N33F 1FXLA 1UW4A 2MKJA 4GKKF 4LSLB 4U95A 1JLCB 2M8HA 2Y1RI 1C0TB 5BYRA 3D1QA 1UWBA 1HR0J 1NK7A 5CYMA 4ZPBA 1UVMA 2P9EA 2KHCA 1NDCA 3T1AA 3IS9A 2ZHOA 3CJ4A 3SDEB 4WE1A 2IRYA 3VWSA 1MROB 3UN2A 1U0HB 1QAYA 4BWJA 3T9ZA 1VS3A 4Q2MA 1ZZFA 3MECA 4DSFA 1YITS 2AJ0A 2LFVA 5KOWA 1KC8T 2HBRB 2LMIA 1VISA 1HI1A 3GMGA 2V2KA 2EFOA 4M63A 1S0MA 3RB6A 3MM7A 4EI2A 2FUG9 1VBXA 1TKXB 2HVDA 3RUBL 3NL0A 2KT5A 5BR8F 3MPWA 3QSYB 4ZVHA 5KFUA 2ZH7A 2V8PA 2HHHJ 3RBXA 3Q8RB 5KFCA 3OVAA 2R8KA 1PC5A 3MAAB 3BPDA 4QJVA 1IXKA 4ETZA 3JSMB 1X9WA 2F9DA 2B51A 3BEGB 1TQLA 2ZH1A 2EG2A 2DEIA 2VG5B 3QGIA 1FNMA 1LK5A 1EARA 1ZM2A 5DDOC 4JI4J 2C42A 3DU6A 1VHIA 5KG2A 5A0YA 3GB0A 2BE2B 2E44A 5L46A 2Z58B 2E5LF 3D1HA 2ZITA 4C8MA 3KDOA 4OZJA 1JX4A 1RTJA 5DDQC 1FRXA 4HR2A 2PI4A 4P71A 3EGWB 1NK0A 3BH7B 1BQNB 2B9WA 1OYDA 1JLAB 1QY7A 2HZAA 3NEKA 2HWIA 3I32A 3K17A 4X62F 1R8CA 4O4GB 1X4CA 3FNNA 1K47A 3ZC4A 4TY8A 2DR8A 3FSYA 1DJ0A 2VQFF 1KLMA 1VQ4S 1Y4ZB 2A6MA 3MM5A 5KFZA 3KUGA 3OFGA 3OBIA 2PEBA 3KLHB 3Q23A 2CUYA 1QDUB 3LP0A 4Q8EA 4MK8A 2EC2A 1OS5A 2CPFA 2KL8A 4NLTA 4XDCA 3FZBA 4WK1A 4F04B 2VQEJ 3BGLA 3TWZA 4M5DB 1RT1B 3DRPB 4K50A 1AFJA 4MT1A 2CPEA 1HR0F 5EN1A 4WP9A 2Q66A 5KG7A 3HVTB 2P8IA 3M30B 4ZCMA 4F8RA 1YJWS 4WFAQ 3MPYA 1UFLA 4TU9A 1VOMA 4DF4A 3DMJB 4FVMA 2DHSA 4DCJB 5KFHA 1SKRA 1CULB 2WW4A 1F5AA 3H0PA 2UXCJ 4NLQA 1SJRA 5I3QA 5KT5A 4PWUA 2BMBA 2JHEA 3M8PA 5BJRA 1Q8BA 3W1YC 2BANA 2MZRA 3N01A 3MGJA 4CLKA 1TVRB 3T3FA 4ECYA 3D9BA 2B8PA 4I67A 4NI2A 2ZZNA 2PDAA 3R7SB 2R2UA 1C4CA 2D1CA 5KG1A 2R7XA 1VRQC 1YBAA 3D2WA 4LT6A 2FHKA 4F7VA 2RH3A 5E0OA 2ZE2A 1ZH5A 2XEXA 5J2QA 2ASDA 1IN0A 5GVQA 1W2IA 1S4EA 2M88A 3Q0AA 2LQ9A 2YKPA 3OUYB 1LWXA 2JH3A 3K58A 4R5PB 2KZMA 4WWSA 2E7VA 1CJTB 2XSJA 1WC0A 3QT7A 2POKA 2MKSA 2MLXA 2EFVA 1KTQA 4PG8A 3CCSS 5KFXA 3H4BA 2J8SA 4LF7F 1U0SA 4J37A 3W66A 2HVZA 1XEZA 2EK6A 1URNA 4I6AA 2Y1JA 1JLFB 5A2QU 4DV5J 1U7LA 1FKOB 2I5JA 2VBWA 4OYMA 4C8OA 3W5XA 1FO1A 1T05B 5FD1A 3RW7A 3NXZA 2MLYA 3R27A 2G2YA 2OKQA 4RUHA 1V3SA 2LECA 2ZWOA 1ULRA 1VI7A 1OIAA 2DGVA 4YN3B 5M2PA 1X5PA 1A7GE 4EBCA 1LWEA 2JX2A 4I1TA 5D8HB 3HHLD 2VJUA 2V4QA 2FD2A 1X4EA 4DUZJ 1S48A 2CWXA 2QLJB 3TJ8A 1GH8A 1KKHA 3DOKB 1JMTA 4LJMA 2FVRA 1NXIA 3A13A 3OLBA 5ETPA 1LFPA 4OI2A 4J9PA 3W5ZA 4EBDA 2OEMA 3S01A 1KBRA 2HNYB 2YQ0A 2O01C 2FJAB 2IAJA 2CPIA 5F41A 1MW7A 2W9AA 3NKYA 4ECZA 2HMIA 4PXBA 1L5UA 5ETOA 4AQYF 4LRAA 2Z2ZA 4C4WA 1LQ9A 3HHEA 3I4PA 4LIRA 5EWEA 4IR9A 2V63A 5D0HA 3W61A 1PC4A 5F3ZA 4DWIA 3OSNA 2DITA 4FF4A 2IA6A 1CJVB 2OFGX 4ZVUB 5DM7Q 4USKA 1IBKF 2J0SD 2JJ4D 3W7BA 1VIXA 2RKIA 1B4SA 2LQBA 1PKUA 4I56A 1FTCA 3POTB 4F4YA 1VCTA 4N8OA 3U1MA 3K89A 1PJ6A 4QW8A 1MSWD 1GFWB 2DT9A 3KK3B 4M5KA 2QN6B 4HDHA 1PCAA 3CCLS 2QFIA 5HQ8A 2BJEA 3O6QA 1RHUB 4ETXA 4WFZA 3M6VA 4XO0A 3IGNA 4YR2A 4DR7J 2HBZB 1RBLA 3ZTPA 1VK8A 4DUYJ 3ENAA 1VQ6S 3ZZYA 3OT9A 2BJ7A 3EWGA 2E5IA 4LRBA 4IO1A 5CHCB 5AE1A 3CMQA 2CG8A 2RQCA 3ZZRA 2YNIB 2GHPA 1RP5A 3N4WA 5HMXA 2WVDA 4ZVEA 2L9NA 7FDRA 2QRRA 2ROEA 9RUBA 4CLFA 4H4OB 2RDJA 3M7VA 4P72A 8ATCB 1D9DA 3NGUA 2VDIA 3A3PB 5FDLB 2R3VA 1FJCA 4ECTA 2KI2A 2FGOA 4C8YA 2KM8B 5DGBA 1FKPB 3E01A 1U47A 2XMUA 3H2UB 3L4BC 2AU0A 2F8HA 2NXEA 1H7XA 4M5NA 5KT2A 5B0DA 1S0VA 1NBEB 3OPKA 3DYAA 5J2PB 4CO3A 3CULA 2Z56B 4FZVA 3EJMA 5HN0A 3WC2A 4IOBA 2NLWA 2KHDA 4Z2XA 3QO9A 4RO0A 4I2PB 1R6VA 3OHBA 2CA9A 3PACA 1HBMB 4IG3B 3DOLB 1SJ3P 1CS4B 3HDSA 3T5JA 2HHUA 5IWAF 3W65A 2ZZMA 1RTDB 3M4XA 3RB3A 4UW2A 1QVGR 2DNKA 1X7VA 4B9SA 4F3MA 2K8GA 3J7Z5 1UA0A 3K8VA 3NWGA 2KJWA 4RLEA 3PDNA 3C16A 1YZ6A 4CT8A 1IR0A 4I7FB 3N79A 3S7RA 3W60A 2OPRB 4PG4A 4CNYA 1NPRA 3CDAA 1IKXB 5KFBA 1U8WA 2W4PA 5IQQA 5ETNA 3U27A 2R8IA 3DHXA 3GV8B 3BJYA 2IVYA 3V4MA 3Q8YA 4ZPCA 5A6WA 1HHSA 4J90A 4UY85 2HQIA 3D0IE 5LJ5Y 1HQEA 4GC7A 2OJ3A 4O44B 3CVKA 1FK9A 4ZLLA 3RRKA 1NHUA 4QPTA 1SVDA 4ZJOA 4DUYF 3PX4A 1XN9A 3N5BA 3Q2SC 3KHHA 3RTVA 3EZ5A 2Y0SD 3VGSA 2PFFB 4F4KA 5KFQA 1FRLA 2F8EX 4FP9A 5K8OA 1S1WB 3KDNA 4ZKAA 3B8HA 5I4MA 4HH0A 2BQRA 1RHKB 1JLEA 3PM9A 3KLVA 2D74B 3VHQA 1WEXA 5IM0A 2MDAA 4DX5A 2VU5A 1T03B 3B4DA 1MN9A 5GADI 5G4DA 3NAIA 2D9PA 2YWEA 4UTGA 1SCJB 2YNHB 2XSFA 4HDGA 3JSBA 4RU9A 4F2SA 2MQPA 1NK8A 5I3UB 1TL3A 3W5YA 3CMAS 1UFWA 3UNGC 4KB7A 2MEWA 4JB8B 2ZM6J 3A3OB 1Y9OA 3LP1B 3IRWP 4J9QA 2M5YA 2AKWB 2FLOA 2FZCB 1GK8A 3SV3A 3Q86A 1BQXA 3DLEB 1TKDA 3VCDA 2BKPA 2M4MA 2W1BA 3GU0A 2F63A 4ES2A 4UOGA 3VAGA 1S0NA 3G86A 4DSIA 2BUNA 4V1Ak 2E5GA 3Q8UA 5K5MA 4Z37A 2AV5A 4IFYB 3KJNB 3QAUA 4R0JA 3KK2A 2IRUA 1PYSB 2DGOA 3ILOA 2F9JA 4PZVA 1NJWA 3R5CA 2FTRA 3N9UC 3BGFA 4OHVA 4BS2A 1WHXA 1CVJA 2KT2A 2OSQA 3MR2A 1X5OA 4E2FB 4CQ1A 1VBZA 2CQGA 1HMVB 1X4GA 1RACB 1YDLA 4Q8FA 4TXSA 5CYQA 3IWNC 4QPXA 4IFVA 4DX6A 4LIWA 1UA1A 2XYGB 1T0TV 2KKHA 1M5SA 3W2VA 2VBZA 2CQ1A 1JNZB 1RTZA 3T6JA 3CJ5A 2Q43A 4C2MA 3E2EA 4L6V3 4DQQA 1W26A 2ZZTA 1LW2B 1JKHB 3P4UB 4CH7A 3AA9A 4P73A 4WCEQ 1SC3B 2ASLA 3KHLA 4ZN1A 2XM3A 1SKWA 1LXJA 2CDQA 5IT9Y 3Q24A 1FVSA 1DHMA 4E98A 1TKTA 4CNZA 4Y0FA 1KDNA 3P3DA 4Q44A 5DLFA 3G6ES 2U2FA 5HVFA 2OPPB 3OD2A 2MQNA 2OEKA 5F0UA 4WFBQ 3D54A 2X3GA 2QLBB 1A0OB 1ZOTA 2WK4A 1N32J 2RU9A 2DNPA 1NKEA 4IOAQ 4DL3A 4MIBA 1IKYB 2EFGA 2B0GA 2XMAA 2KB2A 2MSSA 4L3NA 5A8KA 3PCOB 1ZAWA 2HGNA 1C1BA 4EK2A 4TQSA 4HVZA 2GCFA 3ZZOA 1HPZA 1RT6A 1WOSA 3DDNA 3VQTA 1SL1A 1RHQB 2DHGA 3IAS9 1B3TA 1U24A 5LXRA 4CIOA 2V8HA 3VGUA 3MM8A 4J9VA 4DR3J 1CQMA 1IKVB 3P96A 4LF9J 2ZM6F 2R7WA 2UVVA 1RBAA 5KFRA 2RHQB 1RSCA 1PYTA 3ZZPA 2GJ2A 2F3JA 4KKOB 3KG1A 1S6PA 2AYMA 1KR4A 1Y0HA 2DXDA 1UJ4A 1UMJA 2CAJA 1R0BG 2VPZB 1VQMS 1AZSB 4K59A 1D3WA 4A8MP 3CO9A 1SL0A 3H8YA 3G9CA 2HWHA 1C0UA 1ZPWX 3KJFB 4O0NA 3QWPA 3LWMA 1YJRA 2XLKA 5HBMB 4IKAA 4DV6J 2V50A 2BW7A 1FF2A 2G0IA 2VKZG 3HP6A 2W25A 4EU0A 4RNMA 2OPSA 1VQNS 5KFTA 2YVSA 3VF0B 2WONA 1R8BA 2O3DA 2AIRB 5KTQA 2DBBA 1Q16B 4Y2IA 3MCNA 3I87A 2IM2A 2VBXA 2D3ZA 3TUZC 3NWRA 4WJBA 8RUCA 2XTJP 4FNIA 1SV5A 2BJ3A 7AT1B 4OZ1A 4Y34A 1PJ7A 1NZ8A 5F0WA 2ZH8A 4I0WA 1JJCB 1W7WA 1OWXA 4LF6J 2ACYA 5H9FK 3C6UB 1LXNA 3BF4A 2MJNA 2BDPA 1CJUB 5ETVA 4ER8A 2OGUA 3BGRA 2HHXA 2DGTA 4A8YA 3JAMY 3GSIA 2XMMA 5C25A 4E8UA 1P27B 4OZ3A 4DFMA 3CDBA 3SQGA 3CCTA 1YX2A 4ICLA 4N77A 1UVLA 1HNXJ 1VRUA 3QFHA 4ZHRB 4QYZJ 2FHOB 2OTJS 1HW9A 1WDDA 4DR2J 2WAQD 3UN5A 2QYCA 1JLQA 1NDLA 1WDTA 3MEGB 2RQ4A 4GVBB 4IH5A 4B17A 3I56S 4K4VA 1N32F 2X1BA 3DRYA 2XS2A 3ENVA 3DLJA 3HF5A 2BJDA 3SSQA 1KONA 4ED7A 2GX8A 2FJBB 1XK8A 1MN7A 2M52A 2VC1A 1F9HA 5CQGA 1L3SA 3TX8A 5C2CA 3R2DJ 3HI9A 4NLPA 4CO0A 2J9DE 3VTIA 5J2MB 1V3RA 4ECWA 4OYXA 3RW6A 2DEJA 4W92B 2WB1D 3BSCA 2B4PA 2OFHX 4UY8T 2VFVA 4DR3F 4CLLA 1VDHA 2Y1LB 4OX6A 1SL2A 3J7AN 4KO0A 4LF9F 1GEHA 1QUVA 3I0RA 2XO7A 3HVRA 4P75A 2GQCA 3HHLB 4CLYA 5D4OA 1SH0A 2AJFE 1F2GA 4A8QA 3AY0A 2ROGA 2F1FA 5E3RA 4B3MJ 3LANA 2HRTA 5GAGI 2NSCA 1RLCL 4DPXA 2FJEB 1RTIB 1QJHA 4C97A 1HNIA 3VZHA 2W2QP 4DV6F 1VK3A 2IC3B 3MEEA 3QT8A 1FX4A 4QWCA 3RAQA 2HHPA 1R8PA 4WYLA 1OPZA 5KOXA 1U26A 1R0AB 1OMSA 3V6DA 3TAPA 1HWLA 3TEHB 3AOBA 2VPWB 2PIIA 1IJEB 3KHGA 2GS8A 4USMA 3FRZA 2UV8A 4OZ0A 2LQ8A 4IG0B 2HGLA 1I51B 5C42A 2RQKA 2YWKA 3M2VB 2IMWP 1J2VA 1WHVA 2NYHA 4UOHA 2R7QA 2K1RB 4DUTA 4ZVPB 1YG0A 1SUQB 1L3VA 4LF6F 1IBLJ 4DV4J 4F36A 2ILYA 2VG6A 3UD5A 3WIVA 1HYSA 4LBPA 2ADBA 2DGUA 2NUHA 3G82B 1S77D 2K3KA 1G4CA 1B7YB 1N48A 4H4MB 2G0JA 5LSRA 1RHMB 1Z2ZA 4BBYA 3MPVA 4ZLNA 5EWFA 1KOHA 3CNQP 3HFZB 2VA3A 2VIHA 3NOCA 2EFPA 1T8EA 1HBNA 5D3GA 4DR2F 3MEKA 1A9NB 4F50A 1IM6A 3MXHP 1RTHA 2D3UA 3IXQA 4USJC 1U1LA 1SH2A 4ZVSB 1TL5A 1UETA 3I82A 4TYAA 1Q5YA 4EO6A 4BC7A 2H3EB 1O0PA 1JNRB 3E51A 1Q8LA 3QGGA 2DY9A 2GIQA 3CE8A 4NLXA 3T1HJ 3MCMA 5HMYA 2I38A 4RW4B 1VQ5S 2BM1A 3HZGA 3H2LA 3TJAA 1M5HA 2MXYA 3ILIA 4RW8A 3GSDA 2AZ1A 2DR7A 2Z0GA 2E5JA 2CWKA 2DB1A 3CTRA 3VGTA 1APSA 2M3DA 2DNHA 1CC8A 1IJFB 4R8UA 4K8RA 2E7WA 1KN6A 4WKYA 4TYBA 2K7JA 5IV3A 1QSLA 4L76A 4A8KA 3NCRA 1NLKL 1OY6A 4CLPA 2LEAA 4K2JA 4B3MF 4YHHJ 4DEZA 4IYQA 2EBGA 4WZQA 1O6XA 5HP1B 5L9XA 1FXDA 4W4MA 2B7CB 1HBOB 3EDRB 1G6BA 4B3RJ 4DSKA 2FVPA 4CO1A 4PXDA 1NPPA 3LOUA 1X5SA 4A8FA 2LLZA 4YP3A 3UCUP 5L9NA 2CRLA 1HD0A 2QA1A 2PC6A 3BKUA 2HIYA 4Q0BA 4YS2A 4K0KF 5SUHA 2P2CB 1U6ZA 4LQ3A 3PIOQ 2AEMA 3VGVA 1HA1A 4P2MA 2A18A 5SZTA 3EM1A 1S9EA 1UVJA 3KUEA 2CQ4A 3GIKA 4USVA 3I0SA 3Q22A 1OYEA 4J9OA 3M2RA 2FVQA 2HQDA 4DV4F 1TV6A 2ZD1B 4ERDA 5J2NA 3CCUS 2H4WB 3J81U 4QWBA 5L1KA 2CIMA 3JTNA 5K8PA 4O3PA 3AOCA 4HLBA 4B3OA 2J6SA 3BPSP 4WXOA 3TW0A 2JEFA 3CJ2A 2V69A 3H5YA 2CQ0A 3MM6A 1CJKB 3ZO7A 3TVYA 2QX0A 2NPIA 3GG1A 4NRTA 1VQPS 1UL3A 3EX7B 1T95A 2ZBIA 4OLPA 4TY9A 3IS9B 2OO4A 3C3LA 3H5SA 3A12A 1YRUA 1EKSA 1N4LA 5KFSA 2BJ9A 3R1HA 2JL9A 4EZ6A 4RPFA 3QRQA 3WZ0A 1MU2B 1PBUA 4K2XA 3ITHB 4USWA 1J5OA 4CLSA 4G1PA 2EBEA 4F0MA 1IKWB 3OFEA 4X66J 2XB2D 3QZ7A 2YTCA 4Y2AA 3T9NA 2PT0A 4MKBA 1G7CB 2CJKA 3HD1A 3M1VA 5I42B 3CJKA 3P49B 4C0OC 1Q79A 3GJTB 2HNZA 3PVXA 4RWXA 5F9NA 2MKCA 3M8QA 4LF2A 1AA1B 4NYPA 3GQCA 5HLFA 1XMQJ 4RNFA 2KVQE 2DD8S 2QSFA 5DM6Q 2DNYA 1ZAVA 4ECUA 3TYTA 3UWTA 1FJEB 4YHHF 2R42A 2GJFA 1VLOA 2V67A 3LAMA 3SXLA 4ED2A 3TA1A 2V4JB 3OL7A 3DRSB 4D3HA 1X8DA 1NB2A 4D3GA 3UW1A 2B56A 3MD3A 4WIIA 5F9LA 2DRAA 2Z57B 3H2VE 5J1PA 1DARA 2W4CA 2C2MB 4KFBA 1ZTWA 4YY3J 2AP6A 2VH7A 1RI7A 2LEBA 5E33A 4MK9A 1KHVA 5A76A 1SIWB 4CT9A 5K8MA 2BJ8A 3MFIA 4RBUA 2I2YA 2W9CA 3PR4A 4DI6A 4U67Q 4RW7A 4HT7A 2R7UA 3SBMA 2QZ8A 3GFYA 2C28A 4ZOSA 4DG1A 4V19X 3OVSA 4DHVA 3GJSB 5DLGA 3DRXA 1ZZNA 2GA7A 1SQEA 1QSYA 3Q83A 1CQNA 3ZZZA 1UCNA 3R7BB 1AB8A 2VONA 3NG8A 1ZM9A 3DXBA 2QA4G 3VVUA 3CT9A 1Q53A 3CGIA 2XGQA 4JV5F 3RRGA 2UXDJ 2R7TA 4NCGA 3UNYA 4P2XA 3Q8SB 4TU8A 1TUWA 4ZMMA 4LF4J 3CJ8A 3ZNJ1 4U6PA 1HWUA 2RB7A 3F44A 2D41A 4ZPVR 1C1CB 1RXOB 2GAGC 1RT2A 4OI3A 4DF8A 4ELTA 5DRKA 5E41A 1P9YA 2KDOA 3R2CJ 3JYTB 3P5BP 2VICA 1S9FA 1LWFA 1FI4A 4AL7A 2CKWA 2VG7B 3QIPB 4DR1J 4J91A 2CZ4A 3GYNA 3D68A 3AB2B 3ELHA 4LSLA 3VQSA 1C0TA 2ZH9A 2DGXA 4LBHA 4B3SJ 2X7IA 2J0WA 1ZYQA 3F56A 3M6XA 2YKAA 5B0EA 4DQIA 1IR2A 4ILLA 1IWAA 4RW6B 4CO5A 3M32B 5L1IA 3MMAB 3SDEA 1JK9B 1S79A 4ANDA 1K1QA 1MROA 2X1FA 2LYVA 3FGVA 1QD1A 1U0HA 2YQ1A 3KJQB 4KH1B 3SZ2A 1WEZA 4QW9A 2LA4A 3PV8A 1GMWD 1F0XA 3FJ2A 2HFSA 1WTBA 5FIIA 3O1LA 4RNNA 2AWZA 4TQRA 4IRKA 2HNDB 4OMFG 1JQGA 1TKXA 1UW9A 4S0MA 4FYDA 4FDFA 2LXFA 2E9RX 1RT4B 2QV6A 5D78A 4C11B 2ZKUA 3D6MB 1RCOB 1RA6A 5AXKA 2XMTA 1U2FA 3NS5A 2ZKTA 1RAGB 4Q43A 3G6VA 4X64J 3MAAA 3OL9A 2JFKA 3N5FA 4K4UA 3JSMA 1BHNA 3ISNC 3BBCA 4LR7A 1QM9A 4NMLA 2WSEC 2ZH3A 3GILA 1BUXA 3PX0A 4HHJA 3OJUA 2VG5A 2HIQA 3FRYA 3NOGA 2CYYA 3K5MA 1WG1A 2CPYA 1BE4A 3MEDB 4DV0J 3RB4A 4ES3A 2ASJA 3HJFA 2RS8A 4AT1B 2R7VA 2BE2A 3VAIA 4N41A 4RZRA 2W7OA 4KSEB 3BO2A 1HBUB 2EC0A 4LSNB 4G65A 4BLGA 4RR5A 2BA9A 4F02A 4U8YA 4A8WA 2OHDA 3D6HB 1D8ZA 1WC4A 2GVZB 1YK9A 1HL6A 2JLFA 1XERA 1BQNA 4C9DA 2H1YA 1JLAA 2A1BA 1I3OB 4JI0F 2H5JB 2C2ZB 4LFBF 3ET6A 3HZEA 3KJVB 5E3QA 3OJSA 4O4GA 1EZZB 4ZDNA 3G8TA 3CCES 5EX0A 4UUWA 3GG0A 1UZDA 2GW8A 2KXFA 2QLXA 1RAHB 4CI0B 5MAOA 3I9ZA 4DV1F 3KLHA 5DG9A 1B0TA 2AYEA 1R3NA 3D4JA 2AJ1A 1R31A 4DR6F 3EPIA 2P5VA 3MM9B 4DV7J 1XMOF 1BY9A 4M5DA 4DR1F 2MGZA 1K8AT 2AX1A 3DRPA 2G1DA 2W01A 2QL5B 4V19J 3V6KA 3BDPA 1RU1A 1N52B 2HPUA 2CJAA 2MYFA 3TZYA 3PYGA 3T19A 2UUBJ 3IAM9 4LF5F 4R25A 4AL5A 4C48A 2QE5A 3M30A 4H4KA 3M9MB 2MZ1A 4PXEA 4HEA9 3MR5A 2ZH6A 2U1AA 4DL6A 1T9WA 2BKNA 1NJIT 1X4FA 3DMJA 3PG9A 3LALA 2HK2A 4CTAB 4NZ0A 1NK4A 2RHSB 1FERA 1CULA 3TQ1A 5E7OB 5CA5A 3V4IB 4DSEA 3B54A 4ZPWR 4CYUB 5FLXU 3CD5A 1PAUB 1M5KC 2JEIA 4Y3CA 4C0HA 4NA2A 2LCWA 2AEFA 3FDSA 4IDKB 1LEOA 1GMWA 2OPQB 4WU2A 1TVRA 2CPHA 3MPUB 2ILZA 3TOQA 4BWMA 1WC6A 3BQ0A 4X64F 2YWHA 1XMBA 1FD8A 5HQMA 1WSRA 1FX2A 1NH8A 1FWPA 2FHJD 4AYBD 4Z7CA 1R6YA 4RUBA 2R7SA 2MQMA 4URQU 3GJRB 4PCQA 4NZ7A 4KV8B 3KWMA 5JXSA 2MB0B 4K4XA 1S57A 3DM2B 3OUYA 1YVFA 5E2QA 1ZA2B 2DHHA 2IJFA 3BH6B 2IMOA 1GXTA 4DV0F 4OYOA 3KG4A 3OR2A 4R5PA 2FDNA 4JI8J 1SC1B 4NOHA 3VZIA 2GMHA 1CJTA 3FEZA 3HT3A 3BYPA 2DNNA 1KNZA 1S7IA 3GIMA 1WKJA 2F4VF 4ZVTB 3MMCB 4A8XA 2HVEA 3AA8A 5E3CA 1TMMA 3ADAC 3PHTA 2Y3YA 1NK9A 1N5YB 1HHQA 2JOQA 4ZJQA 2G13A 3TEGA 2OTLS 4OLOA 3MHYA 1JLFA 4OHZA 2W7PA 1FKOA 3TVKA 3G4SS 2XNQA 4TLRA 4LBIA 2C3PA 3M8YA 3R97A 1G1XA 1T05A 4ED5A 2VD3A 4C7QA 2H54B 3T41A 3KNAA 2FJDB 1T9XA 1GQEA 1PYOB 3HX9A 5GAEU 4OJ3A 2WBRA 1RT5B 2XNRA 3GV5B 3WDOA 3C19A 4FKYA 1DQAA 3C16B 4DN9A 2ABYA 1RQ0A 5KFEA 2LQ5A 2CNOB 4DV7F 1ITPA 2AGPA 4OV1A 4QU7A 1SBRA 3R9LA 2V68A 4WFYA 2WVBA 2UVUA 4G1QB 1GXLA 3CCWA 2GHWA 2UUBF 1V9OA 2HNYA 2IA0A 2N3LA 2E1PA 4KBIA 5B0CA 3FBCA 3K57A 3C14A 3TA0A 4X4QA 2V34A 2XS7A 4ECXA 1GAOA 2W2PP 2V8DA 4DL4A 2B7BB 4YEAA 1RYRA 1YJ7A 4J9NA 4M1KA 2YH1A 2G1HA 4J9SA 1RAIB 4DX7A 4C8LA 1N56A 1Z4UA 3ZZUA 1TL7B 4ZP9A 4I68A 2IRXA 1CJVA 4DLGA 4LF8J 5A8RB 2GC8A 1U1KA 2H5EA 2C2NA 5EUHA 4E0DA 4ID5B 1L3KA 4NA1A 1MMLA 1WTFA 1ICEB 3POTA 3HLUA 3MUMP 5HL7Q 1SKSA 2HLUA 2AJ4A 3HVWA 2HEKA 1SPBP 5AXLA 3TQEA 3KK3A 1SJ4P 2MZSA 2A6OA 2OH2A 3L3CA 4NWBA 1RWNB 4WTYA 2IBKA 2MHEA 4DL2A 3UD4P 3CPWR 4JI8F 4KPCA 4WBFA 3DLKB 2FLPA 1S59A 3EVWA 2Q6BA 3NGRA 2RF2B 3FZ2A 4I64A 3LP2B 5A8WB 1FHTA 1OSCA 5HAOA 4C8ZA 2WB4A 3GE9A 4BHQA 3OTBA 4YUDA 5IFMA 2YNIA 4NXNJ 1NM2A 1U1MA 2L08A 2VFTA 3UVJB 3JSRA 4ZA1A 3V2UC 4OYBA 3LGMA 2JLEA 2X51A 3X3UA 4C6AA 4ZLJA 1U8SA 4H4OA 1DRZA 4OIXA 4K4ZA 2XWYA 5T7LB 2CJBA 2QEXS 2QA2A 2GJIA 4NL5A 5FDLA 3O44A 3J80Y 4RNOA 5JVGQ 4LFAJ 2NZ4A 5KFIA 3P5TL 1U4BA 1FKPA 4PG6A 2RRBA 4X4TA 4JYAJ 1S5ZA 2WSFC 1BMQB 3ENWA 2GQ2A 3DHWC 2F4FA 3H59A 4QYZK 2CJXB 1TU0B 5J2PA 3RBEA 1XNRF 1U48A 3FKBA 2XHWA 5IT4A 5K20B 3SCLE 3G8SA 3DGVA 3FSXA 1YJ9S 4I2PA 1JXVA 5J1NA 1HBMA 2CQIA 4IG3A 3DOLA 1CS4A 1U25A 1J5EJ 2XY6A 2N82B 1ELOA 3L95X 1RTDA 3R5DA 3OVBA 1CC7A 3EMTA 1ZA1B 3H20A 2HYIB 3KOAA 2KM8C 1S99A 2XG8A 4Q45A 1GX6A 1SQFA 3EGNA 3SEOA 1ZM4A 2HZCA 4I7FA 4PAAA 1XQIA 5D0GA 1ZM3A 2OPRA 3DOMB 2K06A 1IKXA 4CWBA 3DFEA 1N5QA 4LF8F 1Q5VA 4P74A 1N8RT 2MKHA 3GPAA 3IGVA 1NJZA 2N7YA 4Y2KA 3C15B 1RBOB 4EO8A 2Y9HA 1PAEX 3I4HX 2XO6A 2LVWA 2DR5A 4OZLA 4OX8A 4YB1P 1XR6A 1TKZB 2ZH2A 3CJTA 4O44A 2EXUA 3NBPB 3MFHA 3CD7A 4B9MA 4NPOA 3WX8A 2B4OA 4K4TA 3CJ0A 3C2PA 2IVFB 4LR9A 2IM1A 2QG9B 4NLVA 4KHPF 4PQAA 4ANEA 2R8GA 2IDLA 3OL6A 4X4UA 1DQ8A 7FD1A 2MKYA 4ELUA 4NXNF 1FESA 1H38A 2IJRA 1TUVA 5B09A 3BO4A 1VLYA 2NQPA 3HFVA 1EX8A 3R3TA 2XMVA 2BRLA 1WF2A 3DRRB 3R5JB 1T9UA 2A0FB 3OR1B 1T03A 4KAIA 1IQTA 2WBMA 3LF0A 2YNHA 4IR1A 4RWWA 4LFAF 3CDUA 4DX8H 3KLFB 5I3UA 1HWJA 3NMAA 2EW9A 4JYAF 3SCJE 3CCZA 2VPXB 3ZTQA 1OSDA 2JWNA 2W8LA 1BD6A 2KYZA 3OSPA 2KO1A 3LP1A 2CQHA 4NMXA 4OX9J 2BBEA 2VJVA 4F67A 3DLEA 2DGQA 3MI7X 1AUSL 3PW7A 5DQHA 1X4HA 1QTMA 2PE8A 3CWJA 3A3NB 5ETSA 4AD6A 5MLCV 2YKNB 5AXMA 1V5IB 2B9YA 3CJRA 5CCMA 4A8OA 4IFYA 4ED4A 1D09B 4JI3J 2N3OA 2ZC4A 1FNXH 3K2YA 3J7YU 1EAYC 2BM0A 1IBMJ 3HK2A 2QSWA 2WVEA 4A4JA 3BGUA 2FLLA 3D3CJ 5GMKa 2HHHF 4RJVA 1HMVA 3Q8QB 5KFOA 1TL1B 2MSTA 3T5LA 1FJGJ 1WKLA 1KSPA 4NXMJ 2E1AA 2QTWA 5KFGA 4X2BA 1IQZA 2PSZA 4OYIA 1REVB 1Y5IB 1T11A 4DPWA 1P1TA 1N54B 3EVOA 4WXWA 3KLEB 2MMYA 2R2RA 2YWWA 4PPZA 1TMJA 4HACB 4ZN3A 3C6TB 1U02A 4ECQA 4FBTA 2QMWA 1EETA 4N47A 2MKIA 4JI4F 4IRCA 1VQ8S 1LW2A 1RABB 1FRIA 1X31C 3GTYX 1JKHA 5G0RB 1O51A 2CQ3A 2XMWA 3MD1A 5ETMA 1U2RA 4ZJLA 5AJ3J 3JXOA 4I2QB 5HI7A 2O1PA 4CM0A 4J9LA 2OPPA 4LF1A 2CFXA 4FPRA 3E3XA 3RBZA 4FXDA 5B08A 3FC9A 5DZ6A 2ZBPA 1JJ2R 1OY9A 4PEOA 4GMKA 1CLFA 4JUZA 2J76E 3R1LA 1NJXA 2VV5A 3U02A 3BBBA 4EWTA 3R7NB 4U8VA 3TARA 2VOPA 1WSVA 2RIJA 4GRSA 3MOZA 2VQEF 4B02A 3R5AA 2MQ8A 3VAJA 3RR8A 3HFKA 4LR8A 1IKVA 5C2GA 3MAHA 4J9MA 4MK7A 2H4YB 1SIZA 4QWEA 2DY1A 2A3JA 3PJWA 1NDKA 5D6GA 4FF2A 5BYQA 2LXUA 4P52A 1X4DA 4KKOA 2F5GA 4NLWA 5F8IA 3G6YA 4DN0A 1SC4B 4WKRA 4NX9A 2YNGB 1GTHA 1JJHA 1AZSA 4OFZA 1URRA 3I5BA 4JI6J 5B0BA 1XC9A 1XNQJ 4ZS6A 4JI3F 1F3FA 2UXCF 2R2TA 3CCVS 1R8AA 4USHA 1H2VZ 1ZS6A 4PKDB 3QFWA 3A8KA 4CM2A 4OYWA 1IBMF 1PILA 3THTA 4EUVA 4ENOA 2JRSA 2M8DB 3FQLA 1F60B 2QT7A 1X5TA 1DTQB 1D9AA 1T9TA 1HBNB 2AMCB 1FJGF 1CPZA 3BS9A 2J0QD 3I5AA 4NXMF 3SCKE 2NCKL 3WX4A 5LT5A 2PGCA 3NP5A 4C3MA 2L3MA 4ZVOB 2PMWA 2DNGA 1E6VB 2CG4A 1OY8A 5KT7A 1B0VA 1VFJA 3DGPB 3OLAA 2AQ4A 5EDWA 3C6UA 3C8YA 3NGTA 2H5IB 1CJUA 5F8HA 3EZOA 4M5LA 3W2WB 4AUKA 4A47A 2BKOA 1GT8A 1F5BA 4KGZB 1Y10A 4XK8C 4ZVGA 1S6QB 2QMXA 3D0HE 2IYIA 4CLWA 1F6TA 3WIUA 2DHAA 4RW9B 5AJ3F 3DLGB 1UTAA 1KOOA 4F4ZA 3O8WA 3BGOP 1REGX 4ZHRA 4JBCA 3VALA 4P2SA 2HS4A 3MOJB 4DL5A 3IC1A 1VQ9S 1RE1B 1AT1B 4M5MA 3MEGA 4DV5F 4GVBA 3V5RA 2FZGB 1T3NA 3BSOA 4FXWA 1VIOA 1L3TA 1AW0A 4ZCIA 4DQSA 2NZCA 3EXCX 4F25A 4HYKA 3MAQA 1HQ2A 5E5NA 2JNJA 4NLRA 4LRDA 4QR2A 4N76A 4N8NA 1MWZA 1WOOA 3DC2A 1YTYA 4JV0A 1Q7LB 2NPFA 3K8WA 5J2MA 4FNHA 3KNGA 5KFNA 2PN6A 1JLBA 3ONQA 2AGOA 4DUZF 4HL9A 3HXMA 5GMEA 2DH9A 2EG1A 5C24B 5ETQA 3UCZP 3GIRA 4O4RA 1FXRA 4MIWA 4P9SA 4M5GA 3IMQJ 1WKKA 3HHLA 3W9IA 3FFIA 4O3QA 1U1OA 1WOPA 2CZVC 5GMDA 3SQOP 1U1QA 5IV4A 2YWFA 2RUSA 1KVKA 3LQVA 4DPOA 2AGQA 4O3NA 4Z7YA 1NAQA 3M6UA 2E1CA 4CLZA 4KQZA 2QLFB 1XNQF 5IOLA 2CJYB 1QAXA 1EP4B 1RTIA 1N6QB 2Z2LA 1NU4A 2EWHA 3LA0A 2G9OA 2IC3A 2CQDA 5J2NB 4ANCA 2W7AA 5HVGA 3B6BA 5HMWA 1SC6A 1ZPVA 3W63A 3AXMA 4UF4A 2IIHA 1R0AA 3QRPA 4I4BA 2O66A 5KFJA 1G2EA 1SJ1A 4NEZA 4WP3A 2Z2MA 1ZTTA 2D69A 4CDIA 2XZDB 2IPOB 2ZH5A 3W9JA 2GHVC 3TJ9A 1WG4A 4U7UD 4IG0A 2LU2A 2KRBA 3HHLC 3CUNA 2B43A 2YXLA 1TTHB 3M2VA 5H9EJ 2DCUB 1DZ5A 2BQ3A 3GFZA 2WVCA 2FLNA 3A8EA 1FKAF 2K1RA 4JI5J 4X4RA 3SV4A 1SUQA 2C1EB 4ZVRB 4OZ5A 4XIUA 4KE5A 4DR7F 1N5TA 2CQPA 3G82A 2XYHB 2P9GA 4K7QA 2L41A 4H4MA 4DL0C 2VFRA 3TAMB 3SSRA 1S1VB 2DNMA 3F0NA 1N33J 2VC0A 1RJJA 3M05A 1HW8A 4GKKJ 3QLHB 5ADZA 3H5UA 3PFEA 5F8NA 3IRXB 4YDDB 4TNOA 5E3PA 1T02A 2CQBA 1A6LA 1UFKA 3F73A 2CADA 5M2RA 2H9ZA 5B7WA 4K4SA 2HWTA 3ETMA 4LMZA 4RL1A 3SFUA 1RCXB 2OUGA 3R5GA 5U47A 1DFDA 2J9DA 4O0IA 4RW4A 2RVJA 3QIDA 2BEFA 4NCAA 2MLZA 1KQGB 3PIPQ 2GFFA 4RNHA 1DTTB 4ITSA 2V2QA 1J27A 3IG1B 5K14B 2NS1B 4K5RA 2AJ2A 4UZBA 3G96A 4KR0B 4PWDB 2CPJA 3DI6B 3IR6B 1UVKA 2RJZA 1R27B 4EBEA 4OI0A 4KFBB 1T3OA 3FVYA 3SMZA 3MMBB 4LSZB 2W24A 1X0PA 2AEJA 2HFUA 1MWQA 5J1EB 4Y28C 1JXLA 3NAHA 5HP1A 3MPDA 2YNFB 2JLGA 2UVWA 1KQSR 3NCQA 1EHWA 1HBOA 2KVIA 1LOUA 3CSKA 4FN5A 2E9ZA 1MMNA 3IR7B 1YI2S 3AFGA 1D8YA 1VRTB 1U6BA 4WPAA 3ILLA 1KS2A 3M8RA 3DDIA 4FS2A 4EGLA 3LPEA 2ZC3A 1FCAA 2XULA 2ALZA 1TELA 3QT5A 2IM3A 1JLGB 2Q3PA 2B6AB 2GVDB 3N6NA 2OD6A 4Q7AA 1S9GB 3D67A 4DV2J 2JDJA 4XPCA 2FJWA 4CLUA 2AZ3A 2HFZA 4PPDA 5B0AA 3AOAA 4DFJA 2Y8WA 2PO4A 3BDEA 3MUTP 2APOA 4YFUA 4JI5F 2VQFJ 5HVHA 4W98A 3HULA 1Q8IA 2ZD1A 4H54A 1Q4RA 2J6UA 2C2RA 2W8KA 4MYUA 2GGPB 2IDEA 2YY3A 4NLSA 4J9RA 4Y2CA 2DNLA 2Z4PA 5CAAA 1RWOB 1S4FA 4KY3A 2DGWA 4OJ1A 4B9VA 1NRKA 2CPDA 3UN3A 4EYIB 3VV2B 2WSCC 5DO2A 2GMLA 3QATA 2DIVA 5BXIA 1DY3A 2ROPA 1H72C 1Y3KA 5KFMA 4NZ6A 1CJKA 2A2DA 1GXUA 2DVIA 2HAIA 3IM9A 4JV2A 3ISZA 1VC6A 2EPIA 1S97A 1B70B 3LO3A 2IY5B 3S1TA 1YIJS 1AROP 1JJ4A 1BXNA 1N88A 4C8NA 1MU2A 1FDNA 2B3TB 2OELA 2LA6A 3ITHA 1WF0A 4XPEA 4U96A 3BKTA 3BZQA 4JOUA 4NE9C 1IKWA 1CSJA 4IUFA 3CIZA 4O3SA 5KG6A 2RDDA 1ROFA 2B5JA 5LMUJ 3QZ8A 2BJ1A 3CJQA 5I42A 5B0GA 5EWGA 3BV8A 2Z2YB 5KFLA 1B0PA 4L73A 5FLXY 1NKBA 1OPIA 2PI5A 3IR5B 2QMUB 3MURP 4ILRA 2UUCJ 1HNVB 2FPHX 5D0EA 2J9CA 2P6TA 3HHDA 1N0UA 3GWCA 2W9BB 3TA2A 4NLGA 2HZVA 3M2UB 1ZBTA 4ZCLA 4M94A 2V4JA 1Q7YT 4A8SA 2HVHA 4HHUA 3H40A 3IWLA 2M2BA 3DRSA 3EGZA 1H6KX 3PJXA 4ZCKA 1YJNS 5DG7A 1QSSA 3GZ7A 3C46A 2KN4A 4MIAA 3HHNB 4G6VB 4MJKA 2C2KB 3U1LA 3BR8A 4LF7J 1S72S 3BB5A 1FWKA 1V6HA 3TO8A 5KG3A 4DV2F 1FE0A 3ET6B 2R4FA 4F4AA 5EX3A 4HI1A 2DHXA 2IBOA 1QE1B 2FYXA 1EB0A 2AT1B 2PMHA 3THVA 2OIHA 3AAWB 4FYXB 1RT7B 3N0VA 3DLBA 4C8KA 2ZOGA 4CH1A 2V8GA 3I5CA 2HQFA 1S1TB 5AE2A 2WW8A 5EGYA 1Y11A 3PNIA 3J7ZT 3GR0A 5ETKA 2ADCA 3CC2S 2MGZB 3NRBA 3PKYA 1LWCB 2COLA 3IA0A 1RLDA 1VHFA 5KFFA 3RGIA 5GAHU 2MJUA 3OHAA 2YQ3A 4CRJA 3I55S 2WTFA 1GMVA 4NEYA 1R8HA 4AQYJ 4OI4A 3DU5A 5E3AA 5KFAA 3TZXA 5HROB 3CCQS 4JI7J 3CIMA 3QMQA 3FCWA 1C1CA 3IWXA 3JYTA 3FBBA 1KVIA 1VBYA 2QJ3A 2J7UA 1N34J 3PXGa 3IBWA 4CLTA 5LMUF 4FBUA 2VG7A 3QIPA 3NNCA 3BSNA 4MAKA 2UP1A 4CO2A 2ZH4A 2K7KA 2HW3A 4MH8A 1IBKJ 2WOMB 4NLYA 3NS6A 4KJIA 2VUGA 1H98A 1RWMB 2OLWA 2HURA 4UQGA 2WCXA 1NB7A 1O8BA 2RDIA 2UUCF 4YDXA 1BLUA 2BRKA 1EQMA 4RW6A 3LAKA 3HD2A 3M32A 3MMAA 1RT3B 2R7OA 1EQ0A 2KRRA 1BQMB 2YX1A 4M5JA 3JQJA 2DR9A 3CDEA 4OYAA 2HHQA 3KG0A 2QGFB 3OR2B 2FQQB 5D77A 2HNDA 1EKRA 2NXCA 1YRXA 2DRDA 2VFSA 1RT4A 4OYZA 3UFCX 2UV8G 4C11A 4DS5A 2CVEA 3GIIA 2W2OP 3D66A 3JSYA 4F2RA 4KTQA 4RX6A 1Z2LA 2LDYA 3RB0A 4FXVA 1LW0B 1RAEB 3RAXA 2YPZA 3CJSA 4GC6A 5HJYA 1HLWA 4QZVB 3BN7A 5HATA 2OI2A 3PW4A 2ZHAA 2ERRA 3KLIB 4F0KA 4URSA 3MUVP 1GTEA 3MEDA 3D7SB 1HNXF 2V8VA 3RR7A 3G6XA 2UUTA 2GO8A 1QAJA 1Q78A 4KYZA 4C3KA 3KMSA 4TU7A 3V6HA 4DCOB 1HBUA 4CH0S 2DK2A 5T41A 4LSNA 2FJVA 5LJ3Y 4JI2J 4X4OA 3C66A 1FEEA 3QPIA 2R8HA 4PUOB 2KFNA 2GVZA 1WUUA 5LXYA 2AYBA 3CF5Q 1HQUB 3PYDA 2MZTA 3CDWA 1OQ6A 2KH9A 3KJVA 1NSQA 1I1GA 3MR7A 2BR0A 1FD2A 3C14B 4YQWA 2ZOMA 5IWAJ 3J7A1 4IH7A 1FDBA 3V6JA 4PQUB 3KK1B 2A10A 4IO9Q 3B82A 4Y65A 5L39A 2YKOA 4JI7F 1YLXA 1NCLA 3BM7A 4FYYB 2J0XA 2JC0A 3KLGB 1RHJB 3W9HA 4KH0B 2HAFA 3MM9A 3HHKA 1N34F 1YQHA 2BQUA 1E6YB 4NYZA 1S1XB 2E29A 3FBEA 5D0RA 4MFBA 3ZZTA 3HMJG 2LQJA 3GIJA 3JTOA 2G4BA 3T5KA 1DLOB 1XR7A 1FT8A 3CCJS 2PMZD 2YKMB 1S1UB 2DJWA 3AH6A 5CXTA 1HWIA 3TUIC 1H2UX 4TVAB 4A48A 1S6UA 3L09A 1NEEA 2EKYA 5ETTA 3N6LA 4WF9Q 3QQCD 4OHXA 4CTAA 2FC9A 2CXEA 2EI5A 2LKZA 3D6TB 3V4IA 1BGXT 4PWWA 3QWUA 3BQ1A 1OO0B 3TR5A 5CD4A 3TVZA 4CYUA 4GKJJ 1YJTA 3GYGA 1P6TA 4IDKA 2RRNA 4QCLA 2OPQA 3AD7C 1U09A 3V81B 1HIYA 4G3IA 1R7IA 1KWMA 2A2CA 1HNWJ 1FRHA 3FMWA 3MZIA 2HFOA 2BE9B 1IR1A 3NMRA 2VZ9A 4DJBA 2YX7A 2VDHA 3O2IA 1IBLF 3AXKA 2E1RA 5DQGA 3HJVA 4RUAA 3D6FB 4AL6A 4PRFA 4KV8A 5LSLA 3DXSX 3UPFA 1U1RA 1YBTA 3LH2S 2JZ5A 3DM2A 1B64A 2HQGA 3PFOA 2H51B 3FBFA 1FDDA 3EPGA 2ZBCA 1QLNA 4U9RA 3WC0A 4KHMA 3UR0A 5B0FA 2BYCA 4URGA 1H73A 1ZETA 2NXUA 1UWBB 3MMCA 5CYMB 4JI2F 4DZ6A 2AD9A 2F40A 4P6QA 1N5YA 5C7PA 2MQLA 4LUBA 4WE1B 1PJ5A 2BX6A 1F1BB 3GFHA 5KT6A 1F3VA 3MECB 4AXJA 2W2NP 4AFFA 1RHRB 3PW2A 5IZHA 4NCBA 3T1HF 1KFDA 1M5OC 1TFWA 4NLOA 3MM7B 2L9WA 5T14A 3QNWB 2CZ9A 3CC4S 2AHOB 4OJHA 3CB4A 1RT5A 1WD6A 1Q8KA 1IBCB 2B4UA 1RWXB 4WK3A 3UQSA 4NYOA 4X4NA 1UJ6A 1RB0A 4K4WA 3PYFA 4QIEA 4Y2MA 2OMLA 2I9SA 3T5HA 2C2EA 1UEKA 4G1QA 2VOOA 3ZTRA 2NR0A 3FCHA 1D9FA 2WHOA 4TLQA 3JQMA 1TL4A 2J5AA 3G8QA 1K9MT 4B3RF 5A0YB 4KHRA 3WBZA 5KFYA 4AXIA 5DZ7A 3QYYA 1RTJB 2DXEA 1NDPA 2RRAA 4GKJF 2V0NA 3X1LB 1K1SA 1FRJA 4K5SA 1TL7A 2VKRA 3LUYA 1IUJA 2RUGA 2VBYA 5A8RA 1N5SA 2DTJA 1HNWF 3L7UA 5IC6B 4ID5A 3EYZA 1LKZA 1RGVA 2GNKA 2DGSA 4TY8B 4FKXA 3VAMA 1KLMB 4U7CA 5A2QY 3MM5B 4FF3A 3LWLA 1DQ9A 1Y5NB 2KXNB 3LP0B 5JMNA 2Z8QA 4BCAA 5JJBA 2E1MC 2XCAA 1CBKA 2ZJQQ 4OI1A 3QT6A 1YGYA 2YX4A 3LGHA 3M8SA 3A8JA 4F4WA 3HKWA 4LRCA 3DLKA 4DQRA 4CCHA 1AYEA 2EK1A 2KXHA 2RF2A 2XY5A 1HNZJ 3PY8A 2MPUA 4P7VA 3LP2A 5A8WA 1OQ3A 1YJUA 1ZAXA 2QA4S 2UUAJ 3A1YG 2C2OB 3UVJA 3PW5A 2EVZA 4B3TJ 4QQBA 4KRWA 1GMUA 4MKAA 4ZP7A 4QIWD 4USUA 3GV7B 5T7LA 3Q89A 5GAEI 4AE5A 2L9DA 3PJ9A 2H48B 1HKAA 1WACA 2D9OA 2YBVA 3ULHA 3Q8PB 1B7FA 3M8PB 4QOTA 1RDRA 4RBTA 4ZLPA 4X66F 2CJQA 2FVCA 3HO1A 2BANB 2RE1A 3IBFB 1JWWA 2YPYA 4M95A 1AXQA 1JLCA 5HJXA 3FMBA 4NI2B 1H7WA 2ATLA 3EVMA 4B9UA 2Y0BB 1LV5A 3HCXA 1XMQF 1UVIA 4ED8A 1WC1A 5A6PA 3SI8A 1F2HA 3ZTOA 4DLEA 1U1NA 2ZE2B 5KFWA 5J2QB 3G87A 3UDVA 2M0GB 2J7WA 2HSEB 2PD1A 4L72B 3AJDA 3W62A 4X84A 1EETB 4J9UE 3TX0A 4FPIA 1YRTA 3MTKA 1WHYA 4DMZA 4FYWB 2XSJB 4PXCA 3UDEA 3RG6A 1M5PC 2WVFA 3M9NB 1NPKA 3RRHA 1MG7A 3RYLA 4DZDA 1OJ4A 4NASA 2NUUG 4QR1A 3HSJA 1F5CA 1NK5A 4P10A 3SCIE 2XZTB 1K0VA 3DOMA 2J8AA 4B9LA 4IQMA 3OW2R 4YY3F 1NHKL 2MZQA 2I5JB 4WYWA 1P1LA 4PYDA 1JB0C 3W3SA 3C15A 2RSQA 3ZNUA 3PR5B 5HO4A 3S6EA 1H0HB 3AB4B 3D1OA 1H2TZ 2HK3A 1TKZA 4DS4A 1LWEB 3NBPA 3H42A 1PO6A 2ZJPQ 5DETA 2BACA 4DPUA 2BABA 1Q0NA 3H98A 3CCRS 4ZIWA 2JEJA 1FFGB 1HNZF 2D3O1 3NNHA 2DYAA 1QVFR 2UUAF 5DQIA 2J7KA 1UVNA 2KYXA 2IAJB 5H9EK 2EKNA 2VB6A 2UXDF 1IWGA 4B3TF 4M5IA 2FB0A 2V2VA 3J80U 2C2DA 3DRRA 4DBQA 2HMIB 1VR6A 4FS1A 5IT0A 3OR1A 4PG5A 3MWBA 4GO5X 4LF4F 1RAOA 3R8YA 3ZXWA 1EIYB 4ATNA 4R0EA 1KTVA 3QGHA 3P8BB 1DAXA 2C22A 4LFCJ 2AJQA 4LRFA 1U6FA 1N0VC 2R7RA 2OD4A 3KLFA 2HLTA 2W2MP 4IH6A 4QR0A 1NMEB 1RT1A 2QL9B 1BC6A 4ELVA 3QJLA 3PO4A 4M5HA 1VMBA 4B3SF 4PR6A 2RKIB 5DJBA 3HT0A 1YWXA 3L7OA 3SSSA 3PX6A 2VL1A 4UUXA 2J6TA 3CXCR 2OEJA 3OXLA 5M2UA 5ETRA 3TI0A 3HVTA 4OYPA 4EFAC 4G1IA 3HPOA 8AT1B 1SH3A 2YKNA 1UJ5A 3Q2TC 3CMES 1NJYA 1LK7A 2DR6A 4KGXB 2DH8A 5IS2A 2ZOFA 2XYPB 4OV6A 1VQ7S 1R0CB 2FC8A 4HI2A 5F8LA 1PG5B 1XWLA 5LL6d 4B9TA 1KP6A 1M1GA 1EJ7L 2AYGA 2I0XA 3W8PA 1YZ7A 5DG8A 1TL1A 2HS0A 2I1RA 2KT3A 4YB6A 4RU2A 1VYAA 1IVZA 1FE4A 1NUEA 2O5DA 1Z1ZA 1SB6A 4DFPA 2IHR1 1JXEA 2MQOA 1REVA 3D3BJ 3LW5C 1RYSA 5F3TA 4C98A 2OSRA 1TAUA 1HFEL 3KLEA 1RAAB 4H4KC 1C4AA 1QUPA 1Q86T 5GADU 4HACA 4MYTA 3C6TA 2FGCA 3KYLA 1I94J 2XS5A 3MR3A 3HVAA 1KFSA 3E01B 1F9EB 4OQJA 5KT3A 1JLBB 5G0RA 3TANA 1W25A 2QC3A 5K8NA 1VC0A 1UEUA 5KG4A 3UD3P 3DYAB 3KXDA 1Q95G 1AUDA 4I2QA 1P9QC 4N56A 2HVIA 3PTWA 2DPJA 1C2PA 4ZPTR 3QO9B 2CNLB 1U2CA 4I6YA 3FFIB 1RWUA 2FY8A 3QJPA 1VQKS 4OL8A 3VR1A 3JS9A 3TAQA 4WIQA 4A46A 3NGKA 2MY7A 4NA3A 3OTOJ 3MTJA 4WFXA 4GO7X 2AF6A 2ZBRA 1XTZA 1VQSA 1PGZA 4LFCF 5KFDA 1M5VC 2CDRB 3KTQA 3WHIA 3AQPA 5ETLA 3BN4A 4LVOP 2FHMA 4CP5A 1KLNA 2JVRA 3DOKA 2KFZA 4K0KJ 1S7HA 3GR1A 1L3UA 2J9EA 4PG7A 3MMJA 2UXBJ 2YH0A 1X9SA 4J5OA 1NZAA 3NLCA 1S49A 1P8GA 3PZPA 2E9TA 1HQEB 2YNGA 1VQYA 1FJ7A 4KT0C 1FK9B 1NHVA 2M70A 4JI1J 3LPYA 2FJXA 3J7YI 3AJ2A 3JB9k 4U7UK 3BQ2A 4DR4J 3QBCA 1RAFB 2BOPA 1O5JA 1LNQA 4DPYA 4NLUA 1Y00A 1BWEA 3RAMA 3IO1A 3ETOA 1UZHA 2RNEA 4ID8A 2D3OR 1S76D 2BOAA 1U49A 2MHNA 1TP7A 5I3PA 4YOEA 1DTQA 2DIUA 2PFDA 2DO0A 5HQLA 2HBQB 1TZ0A 1JLEB 1WC3A 2F7VA 3D28A 4YB7A 1RKJA 3NS7B 3R6LB 4ED0A 3PW0A 3H7HB 2ZHBA 5IM0B 2MZJA 1UP1A 4O23A 5HMZA 2E7XA 3DN9A 3OXGA 3IN5A 9ATCB 1E6VA 5C5JA 2NXJA 5EHHA 3BO3A 2JVOA 3DGPA 3FCVA 4DDFA 1FFSB 3M6WA 1I94F 1X60A 3TUJC 1NNDA 2VF3A 3W2WA 1FDAA 1TL3B 4DFKA 2JC1A 2FHJA 4OZNA 4OHWA 1S6QA 1R43A 2UU9J 3KHRA 3DCAA 3FUYA 4KC5A 4RW9A 2ZDOA 5IXUA 1X4BA 3DLGA 4B08A 1QTNB 3GP9A 3CD6S 3I31A 5JVHQ 4F3OA 2IM0A 4FVCA 4RBVA 1JIHA 5KFVA 1BWVA 2LDIA 1N5VA 5KAKA 3HSDA 2AW0A 4JV1A 2ZNYA 2LXIA 3KK2B 3ENQA 4EMDA 4F3QA 2CNNB 2N4CA 6AT1B 1ACMB 3OTOF 2RAQA 1SJFA 4QIVA 1FVQA 2C3OA 4X4PA 2ATCB 3D5MA 2MTLA 2F8MA 2GIRA 2PEHA 3JTPA 2FIUA 2EFNA 2ZNZA 2N7CA 1NSKL 4WFNQ 2RQMA 1LFWA 2DNZA 4ZVFA 3ZTSA 5C24A 5CYQB 3TZZA 4DQPA 3DLLQ 3I9V9 4IFVB 1SQGA 2BVZA 3HSGA 1W2BR 2DRBA 5DS7A 3UR3C 4ILMA 2UXBF 2GAHC 2X3DA 2NREA 3JQKA 3W2VB 3K5LA 1YJVA 2SXLA 2BZ2A 2CJ9A 3MF5A 2BW2A 4J7CA 2K3IA 2E66A 4JI1F 1S12A 1EP4A 1N6QA 2E5HA 4DR4F 4J9KA 1HD1A 3GLJA 3ICLA 4UT4A 5CH7B 1TKTB 2KZZA 2DPIA 2KG0A 4DU8A 1R89A 4WU3A 2HHTA 2ZUAA 3AD9C 3T6BA 3O3LA 1F9FA 3I6PA 2WZ1A 4UOFA 4Y6IA 4XTTA 2KG1A 4XAKA 5LMNJ 4HTIA 4DXLA 4ZIVA 4HKQA 2HS3A 2ZJRQ 1HWKA 5KFKA 1K73T 4JV5J 4DOZA 3NCPA 5A8KB 2JEGA 3DLHA 1C1BB 2KU7A 3EDQB 3OFHA 4XDDA 5CCLA 1FA0A 1HPZB 1RT6B 2XZWA 3TRGA 1Q82T 4PABA 2B4VA 3MM8B 1PIEA 4KGMA 3F41A 2UU9F 2RMLA 1I5OB 3TAMA 3PEHA 3ISND 1S1VA 2B5JB 4K4YA 2IVMA 5L1JA 1S6PB 5CABA 3VAFA 1HHTP 3QLHA 2R8JA 1S1WA 1RA7A 2IFXA 2RT3A 1NK6A 5DGAA 3TUPA 4ZVQB 3QSIA 2C3YA 2JSXA 4X4SA 3H5XA 2L48A 5DDPC 2JFDA 3IRXA 4FF1A 1C0UB 3GONA 3K5OA 2NXNA 1TK0A 3GJQB 6FD1A 1RWVB 5GAGU 4HH1A 1TUGB 4I69A 5LM7E 2QLWA 4Y00A 2V9KA 4ZPDA 2OPSB 1S0OA 2HFNA 3KFWX 2WONB 3BKFA 4ALZA 4N7TA 2KJVA 1B99A 2BXJA 2B8QA 2VA2A 2UZAA 2ZEJA 1M1HA 1DTTA 3IG1A 3P6YC 5K14A 3P45B 3GYXB 4PWDA 3CCMS 3W64A 3DI6A 2V2ZA 3LGNA 1SV5B 2DO4A 2X1GA 3CJ3A 4ECRA 2EEYA 1TK5A 3RBDA 3BGRB 1J5EF 3MMBA 3T1YJ 4W90B 3J81j 4EYHB 3HKZD 5J1EA 4OX7A 2HRUA 5C25B 1YHQS 2HBYB 2ZDPA 2YNFA 2HQ3A 3SQGB 3N28A 1I6JA 3H25A 1FWLA 4ICLB 1VRUB 3BBFA 2X1AA 2C3MA 2G2OA 4RKUC 2HHVA 2IJNA 2Q1LA 4FYVB 2ALYB 3SFGA 1VRTA 3WQPA 2Y1IA 1NH7A 1NSAA 3HM9A 3FEYB 2KTQA 1JLQB 2D7SA 3UI3A 1FRKA 2HRYA 1VGYA 3GFXA 5DDRC 2FY1A 1JLGA 2XLJA 2B6AA 5LMNF 3Q8VA 2GVDA 2CQ2A 1CG2A 2CQCA 1UKUA 4JI0J 1S9GA 2DNOA 1VC5A 4LFBJ 1T9YA 1H3DA 3MDFA 5CD4H 5JUMA 1M0SA 3K7RA 1SJQA 3DKDA 1DURA 5RUBA 4DV3J 2BV3A 2XGPA 2QL7B 1XBWA 3DDKA 4UZCA 4M8LA 1VBKA 2GGPA 4DV1J 1RWWB 1FFWB 1Q1KA 4DR6J 2GO9A 1Y3JA 3RU0A 4KO0B 3OTDA 3I0RB 4NLDA 4DSLA 1XMOJ 4QYRA 2GZOA 1CEZA 3UO0A 1WELA 4IOCQ 3TP2A 2GQQA 1PBAA 2XHCA 1FTRA 3E8OA 4IQXA 1IKYA 1WJ9A 3M8ZA 4X4VA 4LF5J 3HSZA 3RJMB 1FEHA 1RWPB 2AX0A 4P7TA 2HHSA 1HNIB 3H4DA 3CC7S 1MWYA 1MLAA 3MEEB 3BR9A 2CPZA 4CO4A 2I8EA 1VQLS 1IM4A 1RK8A 4YB5A 2G0CA 2B9XA 3V6DB 2GMJA 4DR5J 4N5SA 3PRDA 1VQOS 4QWDA 1SI9A 2OMOA 2Q6CA 2Y8YA 3ILJA 4ZP8A 4YR3A 1RZMA 1KD1T 5IQ6A 4F4XA 4YR0A 4OX9F 4L75A 4F0HA 1T94A 3IP0A 5C42B 4LVNP 4DPTA 1KHWA 3N6MA 4OZ2A 1S6OA 2RU3A 3NGDA 5F8MA 4KPYA 5KT4A 3PKMA 1RU2A 1HNVA 1T9VA 2LP4A 3NY0A 2VG6B 1KVJA 1K0TA 1HYSB 3T1YF 5HBMA 2W9BA 2MQQA 3M2UA 4WP8A 5D4PA 5IC4B 3G2XA 3OV7A 3A8IA 3L9ZA 2VASA 4WZMA 2QFJA 5HANA 4I6WA 3K5NA 2HKEA 4EZ9A 2ZFHA 5D3GB
chains in the Genus database with same CATH topology
3J81Y 4LQ9A 1ZAWA 2HGNA 4A48A 1U1PA 1C1BA 2XY7A 5J2PA 1S6UA 3L09A 1NEEA 2EKYA 3RBEA 2M9KA 3N6LA 1XNRF 2DNRA 1RTHB 1U48A 2XHWA 5IT4A 2O67A 4TQSA 4HVZA 1U45A 2GCFA 3ZZOA 1HPZA 1RT6A 4OHXA 4WF9Q 3SCLE 3DDNA 4CTAA 3VQTA 1RAJA 1D1UA 3G8SA 1SL1A 2FC9A 2DHGA 3IAS9 2EI5A 2LKZA 3V4IA 1BGXT 1U24A 3FSXA 1YJ9S 4I2PA 3OTCA 5LXRA 4CIOA 3QWUA 5J1NA 2V8HA 3BQ1A 1OO0B 3UDCA 3MM8A 1HBMA 2CQIA 3TR5A 1CQMA 4IG3A 1IKVB 3DOLA 5F8JA 3TVZA 1U25A 1YJTA 3VAHA 3P96A 3CEDA 2ZM6F 2R7WA 2XY6A 4DV3F 2N82B 2UVVA 1QE1A 5KFRA 1ELOA 1P6TA 3L95X 4IDKA 1M90T 1RTDA 3ZZPA 2RRNA 3R5DA 4QCLA 3OVBA 2GJ2A 2OPQA 1U09A 1UEVA 2F3JA 1NO8A 1CC7A 1S6PA 3KG1A 3OQ2A 4KKOB 3V81B 2AYMA 1RT7A 1KEKA 1KR4A 1WWHA 1Y0HA 5THWA 4G3IA 1G3OA 1R7IA 3H20A 2HYIB 3EUNA 1UJ4A 1UMJA 4HTJA 3KOAA 2A2CA 2KM8C 1FRHA 3FMWA 3MZIA 2HFOA 1S99A 2XMKA 1S10A 2XG8A 3NMRA 2QIFA 2VPZB 4RW8B 1VQMS 4Q45A 1GX6A 2VZ9A 4DJBA 2YX7A 4K59A 1D3WA 1S1TA 4A8MP 3MCSA 3CD0A 3CO9A 3EGNA 1WI6A 3MR6A 3SEOA 3O2IA 1SL0A 1IBLF 3R5BA 3H8YA 2R2SA 3G9CA 4Q5VA 1ZM4A 2E1RA 2HWHA 5L1LA 1C0UA 1ZPWX 2DH7A 5DQGA 4RUAA 1WNEA 2M7SA 2HZCA 4DSJA 3QWPA 4I7FA 4AL6A 2GV1A 1GNKA 3LWMA 1YJRA 2XLKA 5CYJA 5HBMB 4IKAA 4PRFA 1ZM3A 2OPRA 4R8UB 1QAIA 2HGMA 3ZZ0A 4KV8A 3US5A 5LSLA 3DXSX 2P9CA 3UPFA 1U1RA 4QU6A 3LH2S 1IKXA 2JZ5A 3DFEA 1FF2A 1N5QA 2VKZG 4MFBB 4B9NA 3HP6A 4LF8F 3DM2A 5CZVA 1B64A 1N8RT 2W25A 4EU0A 2MKHA 4RNMA 3PFOA 2OPSA 5KG5A 2LU1A 3IGVA 1LWCA 1VQNS 5KFTA 2PA3A 1FDDA 1NJZA 2DCLA 2N7YA 4OJGA 4Y2KA 2YVSA 3EPGA 2ZBCA 3VF0B 1QLNA 4BDPA 2WONA 4U9RA 2DISA 4EO8A 1R8BA 2O3DA 3WC0A 2CVIA 5KTQA 2C3UA 4KHMA 3UR0A 2DBBA 5B0FA 2BYCA 3I4HX 4URGA 5KFPA 1Q16B 2LVWA 4Y2IA 1TK8A 2DR5A 3B78A 1ZETA 2NXUA 1UWBB 3MMCA 4OZLA 3I87A 1WG5A 2IM2A 4OX8A 5CYMB 2VBXA 1XR6A 4JI2F 4YB1P 1TKZB 2D3ZA 2F40A 3TUZC 2AD9A 2ZH2A 4P6QA 1N5YA 4WJBA 4O44A 3NBPB 4FNIA 2MQLA 3CD7A 3MFHA 4B9MA 4NPOA 4LUBA 1SV5A 2B4OA 4K4TA 5HROA 4WE1B 3CJ0A 3MUTP 4OZ1A 4Y34A 5F0WA 1WF1A 3C2PA 2ZH8A 3GFHA 2IVFB 3KMQA 4Q2LA 4I0WA 4DR5F 5KT6A 1OWXA 3D0GE 4Q0BB 2ACYA 2P6SA 2IM1A 3MECB 3C6UB 5D4LA 1LXNA 3BF4A 4NLVA<