4ZVGA

Crystal structure of ggdef domain of the e. coli dosc - form iii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
MDVLTKLLNRRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNVRSSDYVFRYGGDEFIIVLTEASENETLRTAERIRSRVEKTKLKAANGEDIALSLSIGAAMFNGHPDYERLIQIADEALYIAKRRGRNRVELWKASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of an oxygen-regulated diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Signaling protein
molecule keywords Diguanylate cyclase DosC
total genus 53
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zvgA00
1CSJA 3LAMA 2HAIA 5DLFA 3BGRB 5KG6A 3IGVA 1MU2A 3BSAA 3KLIB 4LQ9A 1C1BA 4J9KA 2WRMA 5KFCA 4LQ3A 2WTFA 3N6LA 4U7CA 1RT1A 4GC6A 1S0NA 3OLBA 1SV5A 3EPIA 3KK2B 4QWEA 2FVQA 4IG3B 4ZVEA 2OPQB 4RNHA 4MFBA 3KK1B 4EBDA 1JIHA 4O3OA 1TKTB 4WZQA 2FLNA 5C42B 1TKXA 4I2PA 5C25A 4IRKA 4ECQA 2WHOA 4IFVA 5KFUA 2C28A 1JLQA 5D3GB 3PJXA 3GIKA 1RT2A 4TY9A 3MEDB 3QLHA 2VG7B 5DLGA 5EWGA 1S9EA 5J2QB 2B5JA 3DMJA 2OPRA 2FLPA 1S97A 4J9SA 3DOKA 3BGRA 3H98A 1TL3B 3TAMA 4U6PA 1C1BB 2W8LA 1VRUB 1ZETA 3VQSA 4RUAA 4EO6A 5EDWA 1XR5A 2VG7A 5JXSA 2W7PA 3RB3A 5I42A 2OPQA 3DMJB 4MFBB 4MKAA 5KFDA 3KK1A 3T5KA 2ASLA 4M94A 4J9LA 3FFIA 5C24A 3KLEA 3JYTB 5C42A 2C22A 4I7FA 1YVFA 4FBTA 2YNIA 1N5YB 4B3OB 4K50A 4I2PB 2D41A 5CYMA 4ECTA 5D3GA 2HNZA 5KFGA 4EO8A 5L1IA 1J5OB 2ILYA 2XGPA 2IM3A 2WCXA 3BREA 4RW6A 3BSOA 3NBPB 3LAKA 1TV6A 5HLFB 2B6AB 5F8NA 3E01B 2F8EX 4KV8B 2UVWA 3PW4A 1TL3A 2BQUA 2BE2A 2JC0A 4ZVGA 1J5OA 4PQUB 3DRSB 3OHAA 3GIJA 4IFYB 3BQ0A 1S0OA 1EP4B 2W8KA 3Q8QB 1TV6B 5HLFA 2IM2A 4FBUA 3T5HA 3E01A 5L1JA 3UDLA 2ASDA 1JLGA 3C6UA 2GIRA 2IM1A 4YP3A 4O4GB 5J2QA 2IBKA 3T5LA 4NLOA 5L9XA 1QE1A 2OPSB 3KNAA 2WB4A 2ILZA 5EUHA 3CO9A 4LSNB 3SFGA 2R2SA 4IH5A 2ASJA 2UUWA 2HMIB 4RZRA 1TKXB 5C25B 4IH7A 4NRTA 2IC3A 1HARA 3IS9B 1IKXB 1TKZA 4TY8B 1IM4A 3DRSA 2FVSA 3KHGA 4EEYA 4LSNA 4NYZA 2HWIA 1RTDA 3KK3A 4LSLA 2JC1A 1T3NA 3G86A 1EP4A 5T14A 2RDJA 1LW2A 2B5JB 2O5DA 3CJ3A 3QYYA 4I2QA 4JUZA 3M9MB 5KG3A 2JEJA 1JKHB 4WXWA 2FJWA 5KFBA 1S1XB 1JLBA 1KHWA 5KG2A 4IOBA 3TAMB 4RU9A 3PVXA 3RB6A 1ZTTA 1RA7A 5KT2A 2E9RX 1EETB 5KFWA 1WNEA 3CWJA 1RT4A 4EBEA 3KK3B 4RW8B 1IKYA 1NHUA 3D28A 2UUTA 3CJ0A 3I0RB 1LW2B 1C0TA 4KKOB 1DTTA 2OPPB 4QWAA 1D1UA 4NLXA 1JLCA 3FFIB 1S1XA 3T1AA 2YNIB 2ATLA 1U09A 2I5JB 3Q8SB 4F4XA 1EETA 3QO9A 5HROA 3PJWA 1RT1B 3OSPA 2AGPA 2BRLA 5CYMB 2R8KA 2GIQA 2IC3B 4RW8A 4TY8A 2J6TA 2IA6A 3H5XA 4WXOA 1C0TB 1RTJB 4ECRA 3H5YA 3NL0A 4TYAA 4Y34A 1RTDB 1JLCB 3CDUA 4URQU 2IJFA 5KFXA 3BQ1A 3NBPA 2DPJA 1IKVA 3I0SB 3I5BA 3LP0A 3QGIA 4IFVB 4KV8A 2YKNA 3DOLB 1JLBB 2R8GA 1JLQB 3CJ2A 4URGA 3KLFA 4IFYA 1RTJA 3KOAA 5DGAA 1LW0B 3MEDA 3MF5A 3QLHB 4PWDB 1NNDA 3MFIA 2VG5A 5FDLB 4YR0A 4KKOA 5J2NA 3LP0B 3V6HA 2V4RA 1SH0A 2WOMA 4MK9A 1SUQA 2B43A 4XPEA 4ED0A 5KG1A 2UVRA 2W9CA 3V4IB 1LW0A 5KFZA 4YR2A 3MR2A 3G6VA 1N48A 3QIDA 3PW5A 2VG5B 5FDLA 2ZE2B 2EC0A 4TLRA 3GV5B 2OPSA 3FQKA 5J2NB 1R0AA 1TP7A 2HMIA 5J1EB 3KLEB 3JYTA 3OHBA 3QZ8A 1N5YA 3H4BA 2RF2A 4KAIA 1RT5B 4RUCA 4F4YA 3DOLA 2JEGA 4Q45A 4ECYA 4YMEA 1IKXA 1TKZB 2ZE2A 5HP1A 3NMAA 1RT7A 5F8IA 4PWDA 3BR9A 1R0AB 3CDEA 4O3PA 3MR3A 1RAJA 4LSLB 4DL6A 4ED3A 2FJVA 4ZPAA 2CJQA 2B6AA 4KB7A 5DG8A 3FSIA 4NLGA 1S9FA 4NLQA 4G1QA 2RKIB 2BE2B 5KFPA 2W9CB 1RT7B 3V4IA 1JLFB 4H4OA 5F9LA 3LALA 4RW9B 4K4YA 1IKYB 2AGOA 2AWZA 3PW2A 3V6KA 4RNFA 5KFIA 4XO0A 5F9NA 2IAJA 3KJVA 2AGQA 1S6PA 4NLSA 4R0EA 4RNMA 3RAXA 3OL8A 3C6UB 2RDIA 2XI3A 1RT5A 4O4GA 4RW9A 5KFMA 1QUVA 5EWEA 1LWEB 4DL4A 3Q8RB 1S9GA 3H40A 3BQ2A 4QWCA 5KT3A 4ECZA 3RBDA 3ICLA 4KHRA 1IKVB 2E9ZA 3UPFA 1S6QB 2YKMA 4OL8A 2BQ3A 3CJ4A 3JSMB 2RKIA 3MR6A 3N6NA 4QW8A 3KLGB 2R2TA 3M9OB 5J2MA 1JLFA 4H4OB 4H54A 4DEZA 4ED7A 1T03A 3MFHA 4Y2CA 3IRXB 2VG6A 3D5MA 3QGHA 4NLUA 3G6XA 2JEIA 3KHRA 2QV6A 4I2QB 3DM2B 3V6DB 1S6QA 2YKMB 1HYSB 1FKOA 3FDSA 4DG1B 3V81B 1DTQB 4MIAA 3OL7A 2IMWP 1BQNB 4WYLA 1RTHA 4ZMMA 1ZTWA 1T03B 1RT4B 5L1LA 1GX6A 2VG6B 2J6UA 3I0RA 5KFSA 3KHHA 4ZP9A 1DTTB 2OPPA 2BR0A 1W25A 4DG1A 3V81A 5J1EA 3BSCA 4J9RA 1HNIA 3QIPA 5K14B 3GQCA 1HNVA 4Q8EA 3IG1B 2I5JA 3QGGA 1JLEB 1HQUB 4QW9A 3QO9B 5HROB 2V0NA 5F8GA 4EBCA 4IDKB 3OSNA 3ISNC 3T19A 3M8PB 5DQHA 5HBMB 4IH6A 1S0MA 2W9BB 1RYSA 1TQLA 5KFRA 3OL9A 1XR7A 4ZPCA 1BQMB 1HNIB 3QIPB 3I0SA 4RW7A 2R2RA 1FKOB 1JLEA 1HQUA 3DYAA 1DLOA 5CYQB 2YKNB 3BJYA 4MIBA 3I5AA 5KT7A 3CIZA 3M8PA 5F8LA 5HBMA 4IKAA 3KLFB 1RDRA 5KG7A 4TQRA 4ZVHA 4R8UB 3BSNA 4M95A 4X2BA 4IRCA 2BANA 4WFYA 4HKQA 2WK4A 1RT3A 4K4TA 2WOMB 4ZPDA 5K14A 1OS5A 1SUQB 3Q8PB 4F50A 3IG1A 3SFUA 1S48A 2XCPA 4ECSA 3HHKA 4Y2AA 4K4ZA 1LWCB 4R8UA 1HQEA 1RT6A 4NLVA 3G6YA 4O4RA 4YR3A 2C2EA 3MTKA 3HKWA 4ID5A 5KFFA 1S9GB 1RT3B 1BQMA 4GC7A 1S4FA 2E9TA 4Q43A 5L1KA 3MEEA 2RF2B 1DLOB 5CYQA 3CVKA 3JSMA 1C0UA 2YNGB 4O3QA 5HP1B 5J2MB 2XC9A 3KLGA 5KT4A 3DI6B 4DL7A 4WZMA 2XCAA 1T94A 1IKWA 3DRPB 5KG5A 4K4WA 3LP1B 3IRXA 4IRDA 4ED2A 2FVPA 2HNDB 3DM2A 2BANB 3H59A 3GIMA 4IG0B 3FRZA 2V9WA 3I5CA 1C1CB 1S1UA 4ECVA 4G1QB 2VA3A 1C0UB 2YNGA 2R8HA 5KFEA 1KHVA 4ED6A 3DI6A 3H2LA 1NHVA 4MKBA 5J2PB 5I3UB 3NKYA 2V4QA 3LP1A 1UWBB 1RT6B 4HYKA 4Q0BA 2C2RA 2XI2A 3KHLA 2YNFA 4RNOA 1HYSA 2IAJB 2JLEA 4O3NA 3KJVB 3C6TB 2AQ4A 4QWDA 2UVUA 3NGDA 1S6PB 3UR0A 1HNVB 5F8HA 4F4WA 2D3ZA 5I3UA 1REVB 4Q44A 3KLHA 3M8QA 4TN2A 3DLGA 4IDKA 4Y3CA 1S1TB 2W7OA 1KLMB 3PW7A 1LWEA 2I1RA 4K4XA 1HMVA 2YNFB 1IKWB 3DRPA 4WE1A 3LANA 2ZD1B 2OH2A 4ECUA 1FK9B 2BQRA 4WFXA 4O3SA 3GV7B 3DYAB 1S1VA 4RNNA 3KLHB 4ICLB 2WONB 5J2PA 4ZHRA 1D0EA 3OL6A 1K1SA 4ZPBA 1RYRA 4J9OA 1XR6A 4KFBB 3IGNA 4NRUA 5EWFA 4J9MA 3PZPA 3V6DA 4ZP8A 4R5PA 3GIIA 3GYNA 4NLPA 3C6TA 2C2DA 2R2UA 4ZVFA 1DTQA 4YQWA 3CJ5A 1JX4A 1BQNA 1RTHB 3RAQA 1REVA 4JV2A 1RTIB 3T5JA 3H5UA 3TQ1A 1LWCA 4NLRA 3RB0A 1K1QA 4TQSA 5KFVA 4EYHB 1N56A 3TVKA 4IQXA 4ID5B 4R5PB 2GC8A 4TXSA 5KFOA 1FK9A 4J9PA 2IM0A 4H4MA 1TKTA 1I6JA 1S1WB 4TYBA 4ZP6A 3NAHA 2WONA 4NLWA 3V6JA 2W9BA 4K4UA 1TVRA 4FS1A 1S49A 4WYWA 3DLEA 3CDWA 3DRRB 3DLKA 4MK7A 5JUMA 1RA6A 1RT2B 3HVWA 2FLLA 4RW7B 2AX1A 2UVVA 3UQSA 3RBEA 1C1CA 1S1UB 5KT5A 2R8JA 1S1WA 2DPIA 3FQLA 2OPRB 3GILA 3ITHB 1TVRB 4FS2A 1FKPB 1RTIA 3SI8A 5F8JA 4RW4A 4IR1A 3PW0A 3DLKB 2AU0A 1T05A 1JLAA 1HPZA 2YNHA 4Q0BB 1VRUA 3NAIA 3PR4A 5DG7A 1JXLA 5I42B 2VA2A 5KFYA 5KFHA 4ECXA 4H4MB 5DGBA 1GX5A 1TL1B 4KHMA 4ZP7A 1FKPA 2FVCA 3M8QB 4DL5A 4JV0A 4RW4B 1MU2B 3KLIA 1S1TA 4NCGA 1HQEB 3RB4A 1QAIA 2HWHA 5KFNA 4PUOA 1MMLA 4ED1A 3ISND 1SV5B 3E51A 3DRRA 5KFQA 4IG3A 1VRTA 4NLYA 4KO0B 3MEEB 1TL1A 4ICLA 5KFLA 4DL2A 3N6MA 4NCGB 2HNYB 4K4SA 3ITHA 5KG4A 3M9NB 3EPGA 3HVAA 1SH2A 4ZHRB 4J9NA 3H4DA 3MECB 4O44B 5F8MA 3IN5A 4ECWA 2ALZA 1T05B 1VRTB 1JLAB 4DL3A 4Q8FA 4PQUA 2HNDA 4KO0A 4KFBA 4KBIA 2XWYA 4IG0A 3MEGB 3H5SA 2FVRA 1LWFA 4XPCA 1Z4UA 4NLTA 1N6QB 3DOKB 2ZKUA 1SH3A 2BRKA 1N4LA 1UWBA 2D3UA 1JLGB 4WFZA 4F4ZA 4PUOB 3GV8B 2AX0A 4NZ0A 4ED8A 3KMSA 5KT6A 3MEGA 5DG9A 3LP2A 3OLAA 4K4VA 5KFAA 3KMQA 1QE1B 5KFTA 2FJXA 5C24B 3HVTA 2J6SA 3DLGB 4I7FB 5DQGA 2HNYA 1KLMA 2R8IA 1QAJA 4B3OA 3PHEA 2XGQA 3KLVA 1HMVB 4WE1B 2W9AA 3DLEB 4URSA 3LP2B 3MECA 1C2PA 4O44A 3IS9A 2ZD1A 2HNZB 4NLDA 3PR5B 3KK2A 4MH8A 3MR5A 4KSEB 4EYIB 4JV1A 1S1VB 4RW6B 5KG0A 4IR9A 3HVTB 5DQIA 4KE5A 4MK8A 2JEFA 1LWFB 4G3IA 1JKHA 1N6QA 1S10A 4O3RA 3EZUA 4QWBA 3DDKA 1HPZB 2YNHB 4J9QA 4QPXA 2IJNA 3QZ7A 5KFJA 5KFKA 2QE5A 2CKWA 1S9EB 2D7SA 5C5JA
chains in the Genus database with same CATH superfamily
4F3MA 2E5IA 1F3VA 2V8GA 1Y3KA 4X84A 5DDPC 3KNAA 4LFCJ 3V2UC 3BKTA 3IGVA 3SQGB 1XWLA 1CC8A 3KLIB 5KG6A 2VQEF 4DV4F 4GKJJ 4PG4A 1Y7PA 4FVMA 2EFVA 4LQ3A 3HLUA 4ZLJA 2WTFA 1PGZA 1VQ5S 1RT1A 3CD6S 4B3RF 3FBEA 4UZCA 3K57A 4BLGA 1MNEA 2GMLA 3JAMY 2V2QA 2HVIA 5E0OA 4DR7J 2HFOA 1AZSA 2ZOMA 4ZVPB 5C42B 3OTBA 4DPUA 1D8ZA 1FTCA 2OP5A 5A8KA 4B9MA 4LR8A 4IRKA 4FZVA 1YHQS 2ZZTA 4FF2A 5LMNJ 3CD5A 3DRYA 1ZM9A 1JLQA 2OFGX 3GIKA 4ZN3A 3G8QA 3MPYA 4DHVA 2HYIB 3GFHA 1PYOB 5IV3A 5DLGA 2ZH4A 2B9EA 5J2QB 2B5JA 3F41A 4HTJA 4WIQA 3VAKA 1TK8A 2DKOB 2WW8A 4M5HA 1GEHA 1JXVA 1OWXA 1NSAA 4WKRA 1C1BB 4NZ6A 1NXIA 3IM8A 3KUHA 4HHHA 2W8LA 1FFSB 1YTYA 3AQPA 2R7XA 2KL8A 3CCMS 5JXSA 4ZVQB 1Q81T 3RRGA 5HAOA 3DMJB 4MFBB 2RIJA 2WSCC 1FDBA 3N01A 4J9LA 4HR2A 1SPBP 3KLEA 4CLWA 3NNCA 1YVFA 1VS3A 4FBTA 3DGVA 1NPPA 2ZNYA 4TU9A 4DSIA 4P2XA 1GXTA 3GFXA 3CMAS 5T7LB 5D3GA 2CPDA 2KJWA 4EO8A 2BJ8A 2KO1A 3DU6A 2ILYA 2XGPA 3CCVS 2IYIA 3BREA 3VTIA 4DV6F 4PABA 1WSVA 3LAKA 2BKPA 1P6TA 5U47A 2K7JA 2NCKL 3EYZA 2C2OB 2F8EX 2Y0SD 2OAUA 2YQ1A 2LECA 2UVWA 2CQ2A 1TL3A 2BQUA 4PYDA 3R6GB 2J9DA 3EDQB 3GIJA 3IAM9 3MPWA 2CZ4A 5FLXU 2DEIA 2NYHA 4OV1A 1E6VA 1N88A 3OT9A 4XK8C 1S0OA 1EP4B 1V5VA 5HLFA 4FBUA 4CO5A 3E01A 1YRUA 3I4PA 2BJ1A 3UDLA 4DFMA 3KYLA 2HGLA 3FBCA 3C6UA 1XIQA 2MZ1A 2IM1A 4YP3A 4NXMJ 2M3DA 5HJXA 4Y2MA 3J7Z5 1CULA 1LFPA 1WTFA 2DIUA 1X4GA 2KZZA 3CO9A 4LSNB 1LXJA 1WKJA 2D69A 4DR6J 4FYWB 3HSJA 2EBGA 1U8SA 1RHMB 3CIMA 2NZCA 2ZOGA 3PTWA 4OYPA 4USKA 4IH7A 4NRTA 4DPOA 1YRXA 1N36F 2E1CA 2IC3A 1HARA 4TY8B 1TKZA 2KHDA 2M8HA 2VFVA 4PKDB 2WAQD 3MM9B 1LV5A 4RL1A 2XS7A 2R7TA 2Z2LA 1FRLA 1H2UX 2HWIA 4YY3F 3Q24A 1RTDA 2C2KB 2NSBA 4JI1J 4NCBA 3GFZA 1EP4A 2OO4A 3G86A 2JEJA 3ENVA 3M6UA 4BWMA 1GXLA 3QPIA 1HKAA 2FJWA 5KFBA 2E7VA 1JLBA 4EU0A 3VAJA 1ZTTA 2VB6A 5B09A 1CG2A 1B70B 1Z2LA 5KFWA 1P1TA 3AD7C 3A3PB 3KJNB 3MMBA 1RCOB 4RW8B 3D28A 3ZZYA 2V8VA 2VONA 2MKJA 2X51A 2QYCA 3HZGA 1SBRA 4DCJB 1D1UA 4NLXA 1WI8A 4AXJA 1S1XA 3HULA 3OXFA 3GIMA 3T1AA 2YNIB 2GHPA 5FD1A 2I5JB 1EETA 4C8KA 3PJWA 2BRLA 3H5XA 2HQDA 2J6TA 1X60A 4PEOA 1FJGJ 1C0TB 4ZCIA 3T1YJ 3H5YA 4TYAA 4Y34A 3CDUA 4URQU 5KFXA 3BQ1A 5GAGI 4USMA 2DTJA 5BYQA 2KT3A 1IKVA 3CD0A 1HBMA 3O3LA 4LT6A 3NRBA 3KUGA 3QGIA 4CO4A 4C9DA 2GX8A 2HLUA 3DOLB 1JLBB 2IPOB 3RG6A 4LMZA 1HD1A 5G0RB 1JLQB 2NZ4A 5IWAF 1S59A 1Y5NB 1P9QC 2FTRA 4URGA 3VAIA 4IFYA 1XNQJ 2J0WA 4WTYA 3G9CA 4PWDB 1LW0B 4QYZK 2JEIA 3MHYA 4LFBF 2VG5A 1F0XA 2MB0B 4A8YA 2BVZA 3FEYB 1BQXA 3RBXA 3UCUP 3CCRS 1ZM2A 2YY3A 2WOMA 4RJVA 3NG8A 1KKHA 4CM2A 3HT3A 2R7QA 5KG1A 1RHRB 3V4IB 9ATCB 1VQ8S 3PCOB 5FDLA 4DDFA 2DHGA 4Q5VA 1GK8A 2ADCA 3OTOF 1UP1A 1QSLA 4PG8A 4X4RA 3BO4A 2HMIA 3JYTA 4A8SA 2EFQA 2FPHX 2W2NP 1YBTA 3B8HA 2RF2A 4M5IA 5BYSA 3VZIA 1FD2A 1SQEA 3ISZA 1HNXJ 3DOLA 2Q6CA 1IKXA 2YPZA 2ZE2A 4JV5J 3NMAA 4X4VA 4WFAQ 1EKRA 2HHHF 1R3NA 1KLNA 3ELHA 8RUCA 3EUNA 1R0AB 2PA3A 4GO7X 3MR3A 2ZZNA 1I51B 4WKYA 2R9LA 3LH2S 4DL6A 3JSRA 4F4KA 2NUUG 2C42A 3D3BJ 3FSIA 3VV2B 1WORA 1O51A 4NZ7A 3IWXA 5L46A 2VL1A 3QAEA 4I64A 2BE2B 2NSCA 2HQIA 4ENOA 1RT7B 5B0FA 4LF4F 3GJQB 4OHYA 5L9NA 3C14A 3MCSA 2QRRA 1MN9A 5ETVA 2AWZA 3GJTB 3BKFA 3I6PA 3P3DA 2AYGA 2FYXA 2IAJA 3PIPQ 3EICA 3UW1A 4RBTA 1PAUB 2QMUB 1OSCA 3MZIA 4N7TA 3SDEA 4DUZF 2DITA 1V6HA 4RW9A 3AOBA 1WKLA 1QUVA 4LFAF 2NUHA 1LWEB 2HZVA 2VH7A 3H40A 1S9GA 3RBDA 3QRQA 3ZFVA 1IXKA 1X31C 2FHJD 2GV1A 2LEBA 4OQJA 2GQCA 4V19J 2YKMA 4DL0C 2RD5C 2Z0GA 3CJ4A 4LF8J 3KFWX 3D68A 1S76D 4FPRA 3W64A 2W01A 3KLGB 1TUWA 5DM6Q 4F25A 1JLFA 2R2TA 5J2MA 1UA0A 3MOJB 1SB6A 2VF3A 4HT5A 3G6XA 2P9EA 4ID8A 3TA0A 2GJFA 3DM2B 4JI8J 1HBNA 4OI0A 3M2RB 2FHKA 3FDSA 4KQZA 4DG1B 4MIAA 3JSYA 2IMWP 3D67A 4I6WA 5G4DA 1BQNB 2GHVC 2XY6A 2XM3A 1T03B 3HJFA 1FERA 1KDNA 4DCOB 5L1LA 1GX6A 4LF1A 4Q2LA 2RUGA 3MWBA 5B7WA 3PX0A 4OZ5A 4F8RA 1Y5IB 1YBAA 4DX8H 4B3OA 4KH0B 1VISA 3RYLA 3BSCA 3D0IE 2YQ3A 3QIPA 5K14B 3NOCA 3BO2A 2I5JA 3QGGA 1HQUB 3LGNA 3M4XA 2DHAA 1NM2A 2V0NA 3KJFB 3QO9B 5IM0A 5IT0A 2E5LF 4IDKB 2IHR1 3PKMA 1NSKL 1U0SA 2VPYB 3ISNC 1X9MA 4OJGA 3ZZZA 1RYSA 1TQLA 4JV5F 1GTEA 3GJSB 2ZC3A 1VLYA 1BQMB 1AFIA 4P71A 5ETQA 1XMQF 1WDTA 1FXRA 1SCJB 3I0SA 2V94A 4ZPTR 5DRKA 3HSDA 3DYAA 2MGZA 3DXSX 4XIUA 4QJVA 3HHNB 3DGPB 2NPFA 1NDLA 5KT7A 4RBVA 2XMTA 5BR8F 4IKAA 4K8RA 4DOZA 3K0JA 2HVHA 4I56A 1U0HB 1T3OA 2CQ0A 2DY1A 2VFUA 1UETA 1T9UA 4ZVHA 3W8PA 4R8UB 1JJ2R 2H5JB 3H20A 1BGXT 4ZIWA 3FSXA 2WOMB 2CPJA 2PN6A 3FGVA 4ER8A 5K14A 1SUQB 2MZTA 1QD1A 3CW2C 4O23A 1HL6A 4OHVA 5HATA 2MDAA 4X64F 4CLKA 4B3TF 2P9CA 4NI2A 1G7CB 4WK3A 3US5A 4ELVA 3MD1A 3CJQA 1R8PA 4O4RA 3TQEA 4YR3A 1LXNA 5IWAJ 3MTKA 3HKWA 4ID5A 1PYSB 4LFAJ 1HIYA 1BQMA 3PRBA 1TL7B 3G87A 2EFOA 4YDXA 1S4FA 3S01A 4B3SJ 5HQLA 2AW0A 2E9TA 4NPOA 2OD6A 3MMCB 2QL9B 4FNIA 5CYQA 4C0HA 1L3SA 5IT9U 4DX6A 2DNQA 2YNGB 1D8YA 1TZ0A 3ZZ0A 1FJGF 1HR0F 3DRPB 3QQCD 1KN6A 1RHUB 2HVZA 3MMAB 4DR7F 3SEOA 1H7XA 2CPFA 2HNDB 3UNGC 4X4QA 3SZ2A 2R7WA 1TK0A 1OO0B 3W2VB 3D9BA 2WBRA 2ZITA 1KEKA 5FLXY 4USJC 3BH6B 5KFEA 2R8HA 1RWKB 3OFFA 2MY8A 3DI6A 1NHVA 4MKBA 1EQMA 5I3UB 1LFWA 3W7BA 5LOQA 1PILA 4HL9A 4HYKA 4A8WA 3SCJE 4CYUB 2J9EA 4O0NA 3HXMA 5C7PA 3PNIA 3BS9A 3VAHA 2JLEA 2DIVA 1RWWB 1U6ZA 1TL7A 5FJ4A 1UCNA 4BC7A 2BM0A 1OQ6A 4LBHA 3UR0A 3U1NA 5F8HA 4X4NA 5IOLA 2MQQA 5AT1B 1B0VA 3BM7A 1RBLA 4TN2A 1UZDA 5CCLA 3PW7A 2ZHBA 1LWEA 1NJXA 2I1RA 4HTIA 5AXMA 1KNZA 3DRPA 4NXNJ 3EGVA 2ZD1B 1WELA 3MMAA 3UDVA 2DRDA 5ITHA 2PI4A 2F7VA 5L38A 2V6AA 3GYXB 2B8PA 4WFXA 3GV7B 3UN3A 2OHDA 2ROPA 4O3SA 3TA1A 1XJWB 2B4OA 3K5MA 4NE9C 2CIMA 1WHWA 3IWLA 5A8RB 3SV3A 1V3ZA 5J2PA 1D0EA 2IY5B 3FNNA 2J76E 1RAOA 4Q2MA 1KVKA 3I55S 2E7XA 4CH1A 4KFBB 3IGNA 4WFBQ 4J9OA 4J9MA 3V6DA 2LEAA 4ZP8A 2C2DA 4W90B 4PXEA 4MTPA 5B0EA 2XMUA 4R0JA 4JI5J 5B0BA 2AJ1A 1REVA 3BDPA 2KFNA 2OKQA 1PJ6A 1RTIB 3H5UA 3NGRA 4LF6J 2G1HA 2LQ5A 1V3SA 3RB0A 3CULA 4ES3A 1H72C 2C1EB 3HHDA 4GMKA 1JMTA 1E6YA 2XMAA 3Q0AA 4DLEA 1X0PA 3W65A 2E5LJ 4YN3B 4F3QA 1R8HA 1RAAB 2Y1LB 5A2QY 1BE4A 3JAMU 2IM0A 4H4MA 1TKTA 5F41A 4WK1A 3RRHA 3HHLA 4QCLA 5DDOC 3HHEA 5A8RA 2JL9A 1R43A 4GVBA 3W9IA 3KJQB 5CZVA 1RWMB 3DLEA 3CDWA 2FC8A 3M8ZA 2ZH2A 1K0TA 4OZLA 2KU7A 1S1UB 5D0GA 1FDNA 4BC9A 3FQLA 3DU5A 2W2MP 3GILA 4DV5J 3KUEA 4C8NA 1TVRB 3TAPA 5F8JA 2HSEB 1HI1A 7FD1A 1OPIA 3DLKB 4JI1F 4QR2A 4Q0BB 3NAIA 4X64J 2LXIA 2F40A 2YTCA 3Q86A 4USTA 3HCXA 3EX7B 3ENQA 1U25A 2F63A 2JHEA 5I42B 4PXDA 1S5ZA 3A3NB 3TJ9A 5D0EA 3TZXA 1F6TA 2XBPA 4PCQA 2MSSA 1TL1B 5C2GA 2ZJPQ 3TQ1A 1S6OA 2C3PA 2HS4A 3M8QB 1MU2B 4OYWA 2CDRB 3HKZD 4Y0FA 1WHXA 4DUZJ 2HWHA 1U1PA 4JI5F 1WC1A 2PI5A 3CCWA 3X1LB 2DR9A 4U96A 3DRRA 4IG3A 4P2MA 3ILIA 4X4TA 3GWCA 4L74A 1VQYA 5HVGA 3C46A 5ADZA 4OYXA 2IFXA 2BJEA 2G0JA 2HBYB 1Y10A 2PMZD 3EZ5A 3EPGA 1UKUA 3HVAA 4J9NA 4CLTA 4DBQA 3H4DA 3MAHA 3MECB 5F8MA 2KFZA 4DQSA 5DS7A 3RGIA 1VRTB 3T6JA 2HNDA 3MOZA 4KO0A 2GAHC 4DSKA 2ADBA 1YLXA 2VKRA 2XMVA 4UOFA 3H7HB 2HWTA 2ASYA 4HLBA 4PXBA 3RAMA 1RSCA 2NXJA 2GS8A 4FP9A 5D6GA 4GKKF 3AHPA 4Z7CA 2HFZA 2ZKUA 1SH3A 1X4BA 1N4LA 1JLGB 4CLUA 4Y6IA 1KVIA 4NZ0A 3B4DA 5E2QA 5KT6A 4DMZA 5J1NA 3JB9k 2YKAA 2J0QD 4USVA 4K4VA 5KFAA 4OI1A 1FE0A 4G1IA 1QE1B 4JOUA 4PWWA 4ZCLA 1R27B 1Q95G 1EJ7L 4XAKA 3VWSA 1KRPA 1SJ3P 3DLGB 3B78A 1RWUA 3D1HA 4OYZA 3TX8A 2GVDB 1VR6A 5DQGA 4KGVB 4DR1F 1QAJA 2V50A 4ATNA 4C11B 3F0NA 3NS6A 3LPEA 3LP2B 3MECA 4ZVTB 4CLLA 2R7UA 4EZ6A 4MH8A 4QPTA 3THVA 3N28A 2NR0A 4LIRA 5LSLA 4IR9A 3HVTB 1YZ6A 3EVWA 1PBAA 2DR6A 2CWKA 2Z57B 3RU0A 5M2UA 1JKHA 3IXQA 4K5SA 1N6QA 1AUDA 1FRKA 2WVCA 1N5TA 4KHPF 1S6UA 4LBIA 4FPIA 3DDKA 4LBPA 4QWBA 3Q83A 3JXOA 4ANDA 8AT1B 2ATCB 4QPXA 2Z8QA 4QBUA 2ZHAA 3OD2A 2F9JA 2CKWA 4L76A 2GA7A 1Q82T 1KSPA 2HAIA 4F4AA 5DLFA 4ZLLA 1AZSB 2ACYA 2DGWA 1Q8LA 2LQJA 4LQ9A 2FZCB 2WRMA 1N0VC 2V67A 1C4AA 4QIFA 3FMWA 1HHQA 3TNVA 4C11A 3KK2B 4QWEA 3BEGB 4LRBA 3AJ1A 4X62F 1VHIA 2OPQB 4IOCQ 3VCDA 3UVJA 1F9HA 3TUIC 4DR1J 2DT9A 2DVIA 3CCUS 2G0IA 2MKHA 3N5BA 1WUUA 2C2ZB 1RWNB 2D74B 2VPWB 3I9V9 3K89A 4I2PA 4ECQA 2C28A 1WEYA 4QYZJ 2CVIA 3BR8A 2IDLA 4N8OA 3T41A 3ZZPA 1GMVA 1RBOB 1Q4RA 3U1LA 3GB0A 1HWLA 2XZDB 3J80Y 4MMOA 2VFTA 3DMJA 4TLQA 2ZJQQ 1LQ9A 2BACA 4YY3J 2ZM6F 2ROEA 4OX7A 1ZETA 1TAQA 2DNGA 1S4EA 2DGQA 3HMJG 4RUAA 1J2VA 5EDWA 4ZVUB 3L7OA 2W7PA 5I42A 5E3RA 3RB3A 2GGPA 2OPQA 4E0DA 2IDEA 1OMSA 4MKAA 5KFDA 4M94A 1KONA 1MWQA 1HD0A 3A8KA 2B56A 2MKCA 2OFHX 3BB5A 2QN6B 5C24A 1D9DA 2C22A 1YJTA 2MLYA 1PIEA 1HW8A 4I7FA 1YI2S 2G2YA 5LXRA 4K50A 2QTWA 1CJVB 2D41A 1WC5A 2BJDA 2EBEA 2EK6A 3LOUA 2P5VA 4NMLA 3VALA 3MAAA 3UCGA 4DLGA 2HNZA 5KFGA 5L1IA 1J5OB 4JI4F 2VOPA 1SVDA 2P6TA 2UXDF 2IM3A 2XNQA 3OFHA 4OYMA 3MR7A 5A8WB 1FXLA 4RW6A 1NSQA 3RJMB 3BSOA 4UUXA 3NBPB 1CJKA 3QT8A 4WP3A 5HLFB 3LO3A 2FUG9 3BO3A 1ZAXA 2EFNA 3E01B 4OX6A 4PYAA 5IC4B 3T1YF 3MM7A 3PW4A 1NK4A 2Z56B 3SQOP 2JC0A 1U24A 3UDEA 3M32A 1UVLA 3EXCX 5LMUF 4UY85 5IQQA 2KXNB 1SQGA 4L3KA 3FK4A 4E8UA 1HA1A 2MPUA 3W62A 5IZHA 4RUBA 2EKNA 1K9MT 1JLGA 3M1VA 2GIRA 2KTQA 1H6KX 1GQEA 2XZWA 1CLFA 1GTHA 4NMXA 3WZ0A 5GAEU 3TX0A 4NLOA 3Q89A 2ZH1A 1QE1A 4B3MJ 1WC4A 2BXJA 4J90A 1JQGA 1UEVA 4FYYB 4IH5A 1HLWA 2UUWA 1FWPA 1NZ8A 1TKXB 1H73A 2RAQA 5C25B 1OQ3A 3TP2A 1DRZA 1RTZA 2CZ9A 3C66A 3NGUA 1IKXB 5HMWA 1SJ4P 4N5SA 3KHGA 1FI4A 2AZ1A 1Q5VA 4G6VB 4Z37A 2JC1A 3RTVA 5T14A 2W4CA 1GAOA 3CJ3A 4P6QA 4TU8A 2UXDJ 2ZUAA 5D0HA 1FJEB 3N9UC 1IBMF 4CO1A 5JVGQ 3PVXA 4RU9A 2A2CA 2KHCA 4LR7A 2MQNA 1ZM3A 5KT2A 3C16A 3MURP 2E9RX 1WNEA 2HHVA 1T02A 3CWJA 4QIVA 1RAEB 2F1FA 2QA4G 4EBEA 1IKYA 3K8VA 2C3UA 2UUTA 1VK3A 2MKKA 1YJVA 1AROP 1C0TA 1M5PC 1RAFB 3DLLQ 4NEZA 2DCLA 5ETLA 5KOXA 1JLCA 3E8OA 3T9ZA 1RADB 2E29A 3WC0A 3P49B 4MYTA 5DZ7A 2DHSA 1FCAA 2PSZA 3SDEB 3CGIA 4F4XA 2XY7A 3F56A 3IRWP 3OSPA 1BHNA 2HGMA 2VBZA 2GIQA 2KKHA 2PO4A 3MMBB 4RW8A 2MHNA 5E3AA 4RUHA 1SI9A 1U49A 4WXOA 1RTJB 1YSJA 3CCSS 3M8RA 3MPDA 1NDKA 1ZOTA 3VAFA 1UPPA 3CCTA 2KM8B 3J81Y 2RUSA 3LP0A 4WP8A 3TZWA 1L3KA 4IFVB 4KV8A 4PAAA 2ZOFA 2OSRA 4ZVSB 1VCTA 2HHSA 1KOHA 1OY8A 3KLFA 4CCHA 3AJ2A 5T41A 1YQHA 3KOAA 5DGAA 5LM7E 3EDRB 3MF5A 2FQQB 3QWUA 4G1PA 2I38A 2Q3PA 2V5HG 3MFIA 3GSIA 4NX9A 3BPDA 3UR3C 4DWIA 4Y65A 3MM8A 2IJRA 1NK8A 4LF9J 1RU2A 4XPEA 2B43A 3S8SA 4OHXA 4ED0A 2UVRA 2W9CA 4FF3A 1OYEA 1UVMA 5K8OA 2DXDA 1N48A 2SXLA 3EZOA 5KFZA 3IBFB 3PYFA 5DDRC 1OSDA 2ZE2B 3CMQA 5D77A 3FQKA 4F2RA 1GT8A 2Z58B 1W7WA 5B08A 1R0AA 2K8GA 5F3TA 5J1EB 1VBXA 2C2MB 4OYAA 5SUHA 4A8FA 1B64A 3QZ8A 1WDDA 4CWBA 2L9NA 1LKZA 2HIQA 3MAAB 4FXWA 1TKZB 5HP1A 4P9SA 2W24A 4C97A 2FZGB 3OTEA 3M2VA 3BR9A 1UVJA 3CDEA 4O3PA 4AL7A 1RAJA 4LSLB 1M90T 4ED3A 2DY9A 1GMWA 2CVEA 2CJQA 2HFSA 1OPZA 1R7IA 2B6AA 2RVJA 4JBCA 2MGZB 1S9FA 1I94F 4DU7A 4RU2A 1T9VA 3OR2A 4G1QA 1TL4A 3DGPA 3K2YA 3P5TL 1T9YA 3W63A 2W9CB 3DNCA 3LQVA 4H4OA 5HL7Q 3IFEA 3JQJA 3C3LA 3OTDA 2ZC4A 2WSFC 3PX6A 4LF9F 3BH7B 1YJWS 2GVZA 2X1FA 2JOQA 1X5PA 3PV8A 2Y9HA 1CBKA 2IYGA 3GJRB 4NCAA 1TFYA 4ILMA 2HHUA 2AGQA 1UW9A 2CG8A 3RAXA 4NLSA 2GJ2A 4R0EA 3VHQA 4F67A 4RNMA 3OJSA 5DZ6A 1OY9A 2RDIA 2W2PP 3BN7A 1YJNS 2B9XA 1Q78A 3OFEA 1S0VA 3TVZA 5EWEA 3ILOA 2OTLS 4TVAB 3LPYA 2XWXA 4OJ3A 8ATCB 4K0KJ 3G82B 1BLUA 1RCXB 2BABA 4QWCA 4ECZA 3THPA 1LEOA 1IKVB 4X4SA 4OL8A 4LF7J 1HBNB 4EMDA 3MMCA 2QSWA 3U7JA 5CD4H 5E3PA 4DFJA 3HFKA 3TEGA 3MR6A 2VC0A 1SJQA 3M9OB 1H7WA 4H4OB 4H54A 2XS2A 1LK7A 3TOQA 4YB7A 1G6BA 4Y2CA 4DSJA 3G8TA 2VG6A 3D5MA 3L9ZA 3ETMA 4NLUA 4USHA 4UW2A 2V63A 1WF2A 4CTAA 2UU9F 1X7VA 4V19X 4ANCA 4AE5A 2YKMB 2UUBJ 3GZ7A 1FKOA 3V81B 1U1NA 4B9SA 3Q22A 1DTQB 1RE1B 3TYTA 3CXCR 1U48A 1FESA 3CSKA 3D1OA 3FRYA 3WQPA 1ZTWA 2U2FA 2BKNA 1NH8A 1RT4B 2POKA 4RX6A 4AYBD 1U1MA 3KHHA 1SL0A 2RT3A 5ETTA 4ZP9A 2OPPA 2BR0A 2CQHA 5JJBA 3AB4B 1JNZB 2JFKA 2WB1D 4M5DA 2QA4S 2FJDB 2BDPA 1HNVA 4Q8EA 3JTPA 2M4MA 2H48B 2RILA 3K7RA 4BBYA 5F8GA 1L3VA 4DJBA 3TRGA 3V4MA 3T19A 4AL6A 1KC8T 3TUPA 4FN5A 4IH6A 1S0MA 1D3WA 3OL9A 5ETRA 3D6TB 1XR7A 1CC7A 1R0BG 1ZYQA 2AKWB 1X9SA 2KVQE 3QIPB 2DNMA 3BBCA 2LMIA 1VQOS 1FKOB 1HQUA 1U1LA 1DLOA 3AOAA 1UJ6A 2W4DA 4B9VA 2XLKA 2G2OA 4NYPA 3KLFB 2KFYA 3JQKA 1PKUA 2GO9A 3U27A 1NO8A 2DNYA 2E1PA 5ETSA 4BCAA 4FVCA 4H4KC 3TR5A 4CLSA 2WBMA 4TQRA 3BSNA 4XDCA 4IRCA 1Y3JA 4UTGA 3DLJA 4WFYA 5GAHI 4M5DB 3QFHA 4K4TA 2PGCA 5DM7Q 2Y8WA 1RI7A 2N82B 2FY8A 4DN0A 1P27B 2HK3A 4GKJF 2IBOA 4PRFA 4ECSA 2DYAA 4Y2AA 1L3TA 4HEA9 4R8UA 2G9OA 2MTLA 1RT6A 3G2XA 4NA2A 3AT1B 4N56A 3G6YA 1EARA 3AA9A 1QVGR 4DI6A 1SC6A 3CJSA 5ETMA 4OV6A 1RGVA 1RT3B 4P10A 1SKUB 1U8WA 2IVFB 1IWAA 1WEZA 1NLKL 4JI6F 1NK7A 3QJPA 3P5BP 4Q43A 5L1KA 2XYPB 3MEEA 4A8XA 3R2CJ 3W1YC 1DLOB 1SJFA 2OMLA 4C8YA 2XSFA 2DEJA 1VQ4S 4X66J 3C2PA 4N41A 5HP1B 2OTJS 3DDNA 5J2MB 3KLGA 5KT4A 3DI6B 4DL7A 4WZMA 3M2VB 1F9FA 1Q86T 4KR0B 1RLCL 1IKWA 1SL2A 5KG5A 4K4WA 4KPYA 2VJVA 4FF1A 1QVFR 4ED2A 5I4MA 4C7QA 3DM2A 1NBEB 1XERA 2CAJA 1BXNA 2PEBA 3EM1A 1K47A 1JXEA 3FRZA 3FZBA 4IG0B 1SIWB 3I5CA 1S1UA 4CH0S 2H4YB 4G1QB 2YNGA 2LQBA 1FRXA 1CJTA 2B8QA 4F04B 1FRJA 2PMHA 3LP1A 4IO1A 1RT6B 3HPOA 4Q0BA 2BM1A 1XMBA 3UD4P 2YNFA 3O44A 4RNOA 2GZOA 2VQFF 3KJVB 1U1QA 1U2RA 1WJ9A 1IJEB 2O66A 3ZZTA 3KWMA 1RKJA 3NGDA 1YJRA 3G8SA 3TEHB 2D3ZA 5I3UA 2UXBJ 4DQQA 3L09A 3KLHA 1W2BR 4MYUA 4IDKA 1D9FA 4J9UE 4RBUA 2C2NA 2W4PA 4OX9F 2ZJRQ 2QFJA 1HMVA 4WE1A 1IR2A 4ZJOA 1AFJA 2YVSA 4TKTA 2XSJB 4ECUA 1KWMA 2RRAA 2MYFA 1T0TV 1O8BA 3NCQA 5IC6B 2LU2A 5GADU 3QRRA 2Z2YB 1K0VA 1S1VA 3ZTPA 1YG0A 2Q79A 1VQLS 3D6FB 4ICLB 2M2BA 4RPFA 1FEEA 5IS2A 4X65J 2YWWA 2UUAJ 2H3EB 3H90A 1N8RT 3TZYA 4RWWA 1CJTB 4ZHRA 2F3JA 1B99A 1QDUB 3OL6A 4C98A 2NQPA 1N52B 4NOHA 3QBCA 5MAOA 1FT8A 3M6WA 4C8LA 4C0OC 3SYZA 1R8BA 3C6TA 1DBDA 3DHWC 3HSGA 3O1LA 1DTQA 4LJMA 4ZVFA 4AXIA 2KRRA 2HS0A 2AJ4A 3ZC4A 3ILLA 5ETKA 4P7VA 1URNA 3OXGA 2MLXA 3SQGA 3T5JA 1C4CA 1Y0HA 1LWCA 4OZ3A 4CDIA 2YH1A 1HNXF 2DR8A 2Z2ZA 4TQSA 3ZTOA 3AA8A 5KFVA 3DRXA 4B17A 2ZH7A 5KTQA 5H9EK 2MKIA 5GVQA 2Y1IA 5CD4A 2A10A 2CNOB 3HDSA 3UE2A 1NB7A 4DN9A 3NWGA 4KH1B 3W61A 5K20B 4DR6F 4YB5A 2BE7D 1N36J 1TMMA 1GMWD 3AQOA 1AUSL 1S1WB 1YX2A 1JK9B 4TYBA 1XNRJ 3NAHA 3GR0A 4AQYF 4J7CA 4KJIA 2CQ4A 2W9BA 1VRQC 4HI2A 4Q7AA 1RWVB 2RMLA 2MKYA 3MPUB 1F9EB 3BDEA 3M2UA 3DLKA 3KG1A 4MK7A 5E33A 3HVWA 1RUSA 1WOOA 4HI1A 2KZMA 2BE9B 3RBEA 4ERDA 1NB2A 5KT5A 2HAFA 4FKYA 2V4JA 1U6FA 4DR5J 3OR1B 2QYGA 2JRSA 4X4UA 2GQ2A 3EWGA 3SI8A 2D3O1 4AT1B 3PW0A 3Q8UA 4M5JA 2AU0A 3NMRA 3W66A 2YNHA 2XULA 2EG2A 4CYUA 1WG1A 5CA5A 5DG7A 3HF5A 2OGUA 2DNNA 3SCLE 2PMWA 2VA2A 3G6ES 4ECXA 5DGBA 1EX8A 1GX5A 3AAWB 1FKPA 2FVCA 1T95A 4RW4B 3EXYA 3Q8VA 5KFNA 1QUPA 1MMLA 3UDCA 2HQ3A 1CS4B 3ISND 3W5XA 3ENAA 4ES2A 4M5LA 1F5CA 1T7PA 3A8EA 4MKYA 3MI7X 3NP5A 2CQIA 3MEEB 1J27A 3A8IA 2V9KA 3LF0A 4DL2A 2B4PA 4NCGB 2HNYB 1RWXB 2LXUA 3UN2A 5B0CA 4JYAF 2DH8A 3ITHA 3UO0A 2AD9A 1SH2A 2CQ3A 3DOMA 2VUGA 4O44B 4D3GA 4Q8FA 4PQUA 2CPIA 1JLAB 4DL3A 4F0HA 2EXUA 2W7AA 1QAYA 1YJ7A 4KFBA 4NWBA 5HQMA 2FY1A 5HN0A 2ZFHA 4F0MA 3HX9A 4W4MA 5ETNA 5GMKa 2VFSA 4DR3F 2GIFA 3GONA 2JH3A 2YX4A 3MGJA 3CDAA 5MLCV 1ZPWX 2QA2A 1UWBA 2VBWA 3EVMA 1UFLA 1R89A 2LQ8A 1K44A 1KS2A 2AX0A 4ZIVA 1E6YB 4WTOB 3GV8B 2COLA 5DG9A 3LP2A 3M8YA 1CULB 2XMWA 2YX7A 3C15A 4H4KA 3KMQA 2GGPB 4MAKA 3IR7B 1YBUA 5KFTA 2A2DA 3JTOA 1WC6A 3L95X 4I7FB 2R8IA 4N8NA 3SXLA 3NCRA 2XGQA 3KLVA 1HNWJ 1HMVB 4WE1B 4X62J 2QZ8A 3L3CA 2JNJA 2W9AA 1C2PA 1BC6A 2ZHOA 2CZVC 1WWHA 1RJJA 4ZN1A 1QTMA 4JV1A 5A8WA 3MAQA 3JQMA 3IM9A 1U4BA 4OLOA 4DR4J 3O2IA 2LU1A 2JEFA 1KFDA 4OFZA 2FJVA 3HO1A 3R27A 1S10A 4JI0F 3ZTQA 1PYTA 1VC0A 3WX8A 3NEKA 4NA1A 4DXLA 1FVQA 4GO5X 4YFUA 2A6OA 1HPZB 1KR4A 2UXBF 3MM5A 1MN7A 1MROA 1R31A 3BBBA 5KFJA 5J2QA 2H54B 2D7SA 1FD8A 1A9NB 4FKXA 2HFVA 3LAMA 2Y3YA 4PG6A 2J8AA 1V9OA 1MU2A 2HRTA 2RHQB 5M2PA 1C1BA 4J9KA 1WKKA 1EZZB 5KFCA 3OXLA 3OW2R 3N6LA 4U7CA 4GC6A 1HHTP 2R4FA 3SCKE 3UNYA 2MJNA 3OLBA 1CQMA 4K59A 1DY3A 4IG3B 4LVNP 2HVEA 4LSZB 4OIXA 4ZVEA 2FVQA 4MFBA 1NCLA 4S0MA 2KH9A 1X4DA 1HNZF 4YUDA 3NGKA 1JIHA 2GCFA 4O3OA 4YB1P 2DRBA 3BPSP 2JX2A 2FLNA 4NXNF 2P8IA 2O67A 1TKXA 4WZQA 1NRKA 2G13A 2UZAA 2I9SA 4WU2A 4ANEA 5C25A 2WHOA 5KFUA 1U45A 1SJ1A 2D9OA 3QT6A 3LUYA 4A8QA 1RAHB 1I3OB 3PJXA 5D3GB 1RT2A 3FCHA 4TY9A 2CFXA 3MEDB 3QLHA 1OYDA 3RR8A 1MROB 1RWPB 4ZPVR 2VG7B 2V68A 2EC2A 4LRDA 1N32F 1S9EA 3MPVA 3M8WA 1XNQF 1F5BA 2OPRA 2FLPA 3A3OB 3EJMA 3ZXWA 4J9SA 1FNOA 3A12A 3DOKA 1MMNA 1UFWA 3H98A 1TL3B 2MZRA 1FFGB 3TAMA 3GCXP 3VF0B 4DR4F 2HHWA 3EE3A 4KGXB 3NS5A 3P4UB 3DC2A 3PFEA 4K2JA 4OZJA 4DQIA 1XR5A 4A46A 4K5RA 4U9RA 2ASLA 1ZH5A 2GQQA 1XTZA 3NY0A 4OI4A 4ZA1A 3P8BB 4NEYA 4RKUC 4A47A 3JYTB 4LF5J 5C42A 2NXEA 4B3OB 5E5NA 1S77D 1CS4A 1M5SA 5AJ3J 1CJUA 4ECTA 1FVSA 4LUBA 2CADA 1PCAA 3PY8A 4ALZA 2DJWA 3OQ2A 2DNLA 3CJTA 3PO5A 1TAUA 1T9WA 1KTVA 2X3GA 3FEZA 4KHPJ 2AV5A 3FCWA 1GFWB 4KIAA 1TV6A 5F8NA 1CJVA 2VODA 1YWXA 2KYZA 4KV8B 2JJ4D 2VD3A 4CO0A 4EI2A 3EGZA 2MJUA 3LGHA 1IBCB 1I1GA 1WF1A 2BE2A 3EMTA 3ENWA 4P74A 4ZVGA 5THWA 3OHAA 1J5OA 2UXCF 3FBBA 2OMOA 3BQ0A 3P6YC 3D6MB 2W8KA 2QSFA 3Q8QB 2CXEA 3ET6B 2ZH6A 2F8HA 4WPAA 3TJAA 5L1JA 4C4WA 1ZZFA 2IRXA 2LYVA 1WI6A 2APOA 2CJBA 2OELA 2V2ZA 2ZKTA 1HHSA 2HZAA 2DNPA 2JVOA 3OPKA 2QFIA 4OLPA 1HBOA 3J80U 5DETA 4HH1A 4O4GB 2G1DA 7AT1B 4WBFA 4TU7A 1PSDA 3OVAA 3T5LA 2F8MA 3AH6A 1Q7LB 2NXNA 2OPSB 1HQ2A 4L73A 2AP6A 2WB4A 2ILZA 2KVIA 5EUHA 2VFRA 3SFGA 3ZZUA 2R2SA 2ASJA 1XMQJ 1OJ4A 3GFYA 2ZBQA 2V2VA 3O6QA 4DPWA 3AB2B 2ZVSA 1YJUA 3N4WA 2QLJB 2OIHA 4U8YA 3LGMA 2C3OA 1S72S 2E5HA 1IM4A 1REGX 1VC5A 2WSEC 2KG0A 1MWZA 2L48A 3MD3A 1FDAA 1P9YA 1WACA 4LSLA 4NYZA 5E7OB 5ETOA 1KQKA 3KK3A 2RDJA 1T3NA 2O5DA 2AMCB 3QYYA 2I8EA 4U95A 1RBAA 2J9DE 3VGSA 4DS5A 1G2EA 1H98A 2J8SA 4WXWA 1N32J 1N34F 5KG2A 1KHWA 2MQMA 1HBUB 2QMWA 2AJQA 2BBEA 1QSYA 2N7CA 1FXDA 5F0UA 3MCOA 4L72B 3B82A 3CJ0A 2QIFA 3GPAA 3I0RB 1LW2B 3FUYA 3R5JB 4KKOB 1DTTA 5GADI 4QWAA 2ZH8A 1TR0A 4CI0B 2BZ2A 2PDAA 1XBWA 1GNKA 3FFIB 4CLYA 5K8NA 4K2XA 4CH7A 3R1HA 4HT7A 2GMHA 5DJBA 2ATLA 1U09A 1VYAA 3NOGA 3Q8SB 3SV4A 4W98A 3AOCA 3QO9A 4M5GA 1RT1B 2NYIA 2AGPA 5CYMB 3CJ8A 2MZQA 2IC3B 4TY8A 4CT8A 2ZM6J 2IA6A 3PYEA 1V3RA 3MM9A 4ECRA 2E1RA 3E3XA 4U8VA 3NL0A 1YKWA 1RTDB 1JLCB 4CO2A 2C3YA 1UWAA 2IJFA 3QMQA 2MQPA 3NBPA 2DPJA 1CQNA 5D78A 3I0SB 4PG5A 2K7KA 2QL5B 2YWGA 2DNZA 1NK9A 3TZZA 3UCZP 1ACMB 1XEZA 4LRFA 2OJ3A 4ZLNA 2UP1A 1RTJA 1JNRB 2ZBRA 3MEDA 2O1PA 3QLHB 1J5EJ 2XNRA 2M5YA 3PDNA 4YR0A 4ZVOB 4PWUA 5B0AA 4KKOA 5BJRA 3EGNA 3LP0B 4PPZA 2V4RA 4B9LA 3PM9A 3CB4A 3TARA 1SUQA 2QG9B 4M8LA 1HR0J 4F02A 2LP4A 2XMKA 1NHKL 2VDIA 3WHIA 3TAQA 3MR2A 1NUEA 3GCWP 3UD3P 4HACB 1OY6A 4YEAA 4B08A 3HHLD 1Q8IA 3DXBA 5J2NB 5LMUJ 1NPKA 1TU0B 1TP7A 4A8KA 4MJKA 3BN4A 3KLEB 3VAGA 2F4VF 3PEHA 4KGKA 2F65A 4OX9J 3H4BA 4DV4J 3PYDA 3ADAC 4F4YA 2E66A 2JEGA 2ZEJA 4QIWD 5GMEA 4B3SF 4JP8A 5T7LA 3J7AN 2RJZA 4UOGA 2BYCA 1Q0NA 5F8IA 2MMYA 4PWDA 6FDRA 3PO4A 1X4CA 4JI4J 1QJHA 2J7KA 2P9GA 2GVZB 3D0HE 1ZZNA 1HWJA 4ZPAA 1FF2A 4QIGA 1X5SA 4KB7A 2MQ8A 3M7VA 4DR3J 4U67Q 1URRA 5LL6d 2VDHA 1VQKS 2IVMA 1B7FA 1U1OA 4OYIA 4B9UA 3M05A 5CCMA 3V4IA 4KY3A 3J7A1 1JLFB 3W3SA 2BW2A 1PC4A 2ZNZA 2ZH5A 3LALA 4QQBA 4C8MA 1O6XA 5CAAA 1IKYB 3K59A 2AGOA 4P52A 3V6KA 4RNFA 4XO0A 1N5VA 3PIOQ 1S7HA 3FVYA 1VOMA 3CC4S 1S6PA 1NJYA 1XNRF 2NXUA 2RNEA 4FYXB 1DHMA 3C6UB 2HIYA 2OEKA 4OYBA 4UQTA 5JMNA 2D3OR 3CO0P 4O4GA 4M95A 5HK4A 1IBMJ 5KFMA 1VJWA 1H2VZ 4CO3A 3W8GA 3V5RA 2J9CA 3W9HA 3J81j 3H0PA 4DL4A 3Q8RB 2YKQA 2RU9A 3BQ2A 4I0WA 5KT3A 1XMOF 4KHRA 2OD4A 3Q2SC 4OJHA 2E9ZA 3UPFA 2BQ3A 3FEXB 3D1QA 1ICEB 2EVZA 1FO1A 4LF6F 1TFWA 1Q8BA 2FD2A 3PFOA 3N6NA 1MWYA 1NAQA 3C14B 2EK1A 3QGHA 2X1AA 3R6LB 2RSQA 2CNLB 2QV6A 4E98A 4B9NA 3V6DB 1S6QA 2HFNA 1KTQA 3R3TA 4EGLA 1VI7A 2FDNA 3ILJA 2J7WA 1XK8A 1HI8A 3OL7A 2HHXA 3GE9A 3DHXA 4WYLA 5EX3A 4YB6A 4ZMMA 4P72A 2JZ5A 1YK9A 2CUYA 2AJFE 2VG6B 4MIWA 1NH7A 3I0RA 1DTTB 1N33F 1QY7A 3AFGA 4ZPWR 3V81A 2FB0A 2Q1LA 4WF9Q 1D09B 3RW7A 5J1EA 1HNIA 3GQCA 1H38A 2UUCF 3A13A 4HH0A 2R7OA 4MT1A 1R8CA 4QW9A 1BWEA 1HWKA 3A4TA 4EBCA 2MLZA 3OSNA 2P2CB 3GIRA 1S7IA 3M8PB 5DQHA 5HBMB 4LR9A 1TTHB 1ZS6A 4DR2F 1VQ9S 4DSLA 4OZ0A 5KFRA 5BYRA 3QWPA 3LW5C 4ZPCA 1Q7YT 3PHTA 1N54B 4KRWA 3C19A 4ETXA 3OFGA 4RW7A 2R2RA 2RQCA 1JLEA 5CYQB 4F2SA 1FWKA 3JS9A 3OR2B 3OUYA 4DSEA 1XC9A 5G0RA 3I5AA 2HBRB 1R8AA 1VBKA 5F8LA 2Q66A 3EVOA 1G1XA 3HSZA 4JI2F 1DAXA 5KG7A 4DV1F 3L7PA 1Y5LB 2KDOA 4J91A 2HURA 3MCNA 3QAUA 1YJ9S 2UUAF 2HRYA 3CC2S 5GAHU 1TK5A 2B7CB 3K5NA 4HKQA 2WK4A 1RT3A 3QATA 4F50A 3Q8PB 1SC3B 3WDOA 1JB0C 5K8MA 1ROFA 3SCIE 4HHUA 3X3UA 2XCPA 3HHKA 4HACA 1LWCB 2YXLA 1HQEA 5IFMA 3T9NA 4DV7J 2EFPA 2C2EA 3GSDA 5KFFA 3DCAA 2GMJA 1XN9A 4DV0F 4FYVB 2ZZMA 2AIRB 2RHSB 2ZDOA 1FHTA 5A2QU 4DZ6A 4DR5F 2JSXA 2RF2B 5IT9Y 3R5BA 3JSMA 2E7WA 2W2OP 2YWFA 1NK6A 1C0UA 1X4EA 1MW7A 2KYXA 2LA4A 2XQCA 2M70A 2XHCA 3AJDA 1T94A 2N3OA 1U0HA 2XCAA 2Y8YA 3LP1B 3IRXA 5A0YB 2FHMA 5K5MA 4DPTA 2DGXA 1ZPVA 1S99A 3TVYA 2FC9A 4WP9A 3RW6A 1NJWA 4ECVA 4DU8A 1M1GA 3WX4A 4DSFA 3CMES 4DQPA 3H2LA 2EI5A 5J2PB 4LVOP 1UVNA 3HVRA 4M5MA 1FTRA 1O0PA 2A1BA 2K3IA 1U1KA 4NXMF 2CJAA 2FLOA 2OI2A 4ZOSA 2XI2A 3RUBL 3D54A 3PG9A 4MKVA 3TANA 2C2RA 2BX6A 2IAJB 3JTNA 5D4LA 2AQ4A 4AL5A 3GG0A 4CLFA 4QWDA 2XSJA 2JLGA 1SKSA 1S6PB 2AHOB 3CNQP 1HNVB 1UA1A 4F4WA 3O5TB 1NKEA 2XS5A 1REVB 2AYEA 3QT5A 2I6WA 3UD5A 3DLGA 4A4JA 1S1TB 3J7YI 2W7OA 2E5GA 4K4XA 2YNFB 5ETPA 3LANA 3CPWR 1F3FA 2OH2A 5B0GA 3RRKA 2K1RA 1FK9B 1WHVA 1UW4A 4CT9A 1VIXA 2UV8G 2BQRA 1X0FA 3WIVA 1N5QA 5H9FK 4RNNA 3KLHB 4WIIA 3HHLC 2DNOA 5HMXA 1IQTA 3CD7A 3MM6A 4P2SA 2RQKA 3VGUA 2WONB 2QLFB 2AZ3A 1V5IB 4LRCA 2K2PA 4OMFG 2H5IB 2N3LA 2RS8A 2DD8S 2KI2A 2Y1JA 2HHTA 5RUBA 3POTB 1J5EF 1F2GA 4ZPBA 1XR6A 4C3LA 4IOAQ 3PZPA 4R5PA 3GIIA 3GYNA 3NS7B 4YQWA 2FHOB 2BV3A 2XEXA 4I1TA 1BQNA 4UT4A 1BUXA 1HI0P 3R5CA 3MUVP 1UVIA 2PC6A 3MCMA 1F60B 4JV2A 4DF4A 3IP0A 2HHPA 4ILRA 1HWIA 2HW3A 4IYQA 1K1QA 4EYHB 1OIAA 2CNNB 1RHQB 3R8YA 4IQXA 2GC8A 3M2UB 5KOWA 5KFOA 2CQBA 1FK9A 2BJ7A 1NSPA 1RXOB 3B4MA 3UVJB 3OTOJ 2CQCA 4W92B 1IVZA 2B9YA 1BMQB 3M6XA 1NU4A 2ABYA 1W26A 2WONA 1DQ9A 2CPHA 2NS1B 1FX2A 1I5OB 3BGOP 4NLWA 4R25A 1VQNS 3OR1A 4FS1A 1S49A 4WYWA 4DV6J 1EIYB 1DQ8A 3DRRB 2BW7A 2EPIA 1RA6A 5JUMA 3PX4A 4QOTA 1IBKJ 3M30B 2FLLA 4GRSA 1ZAVA 4RW7B 2AX1A 5DO2A 4JI2J 1O5JA 1C1CA 2R8JA 1S1WA 2VC1A 2RQMA 2DPIA 2HQGA 1U6BA 4HVZA 1U2FA 4WFNQ 2HQCA 1FKPB 1NEEA 1RTIA 4RW4A 2XO7A 2L08A 4K7QA 4DS4A 2HKEA 4ZCKA 2YQ0A 1HPZA 2BJ9A 1T05A 1VRUA 2CPYA 2ZUGA 3CJKA 5CABA 5CYJA 2N4DA 4DUYJ 2BEFA 3TUJC 1T9TA 2DO4A 2KRBA 4NL5A 2CJYB 4ZITA 1RAGB 2JWNA 4H4MB 4BS2A 1TUVA 3HHLB 4JV0A 3KLIA 1U02A 1UMJA 2LKZA 1HQEB 4NCGA 1LK5A 4L75A 4A8OA 9RUBA 2R7RA 2VQEJ 4ED1A 2CPEA 2MZJA 1U26A 3DOMB 3L7UA 2NXCA 1RLDA 2BOAA 2Q43A 1F2HA 6FD1A 3E51A 5LT5A 3TUZC 2UV8A 5KFQA 4NLYA 2XLIA 4I69A 4I68A 1M1HA 3KG0A 3I82A 4OHZA 5IV4A 3K5LA 1R6VA 4ICLA 3K5OA 3N6MA 5A8KB 1CJKB 2N7YA 4K4SA 5E3QA 2CQDA 1R0CB 2CQGA 4ZHRB 2FJBB 3CCZA 3M9NB 3E2EA 3C8YA 4OI6A 2ALZA 4ECWA 5A0YA 2FJEB 3IN5A 3N0VA 1T05B 3QRPA 1ZA2B 1KOOA 2JDJA 2RRBA 3D6HB 3VZHA 4M1KA 2LEPA 2RDDA 5AE1A 3IR6B 2FVRA 2F4FA 1I94J 2XZTB 2DGSA 2PD1A 1CPZA 1LWFA 4XPCA 4C3MA 1IBLJ 1N6QB 3A8JA 3KG4A 2GHWA 2LFVA 1X4FA 2H9ZA 3DOKB 3W60A 5F0WA 5DDQC 4DUYF 2BRKA 2HZCA 1EHWA 1NK0A 4WFZA 4DUTA 2G2ZA 4ZS6A 4CQ1A 5CXTA 2AT1B 4I67A 4ED8A 3KMSA 3KDOA 3MEGA 4PPDA 4QR1A 3BF4A 3MDFA 4DZDA 7FDRA 4DV2J 1VIOA 4WCEQ 4OI2A 3QT7A 2KG1A 2FJXA 2J6SA 3B54A 2OEJA 1Y00A 1WOSA 3TJ8A 2XY5A 3CCQS 3DFEA 4GC7A 1M5OC 4LF5F 3P45B 3KK2A 1Q1KA 2ZD1A 3IS9A 2DGVA 3OTCA 4NLDA 3DKDA 5LSRA 3MR5A 5D15A 3RZAA 3DLHA 1QLNA 4ZJLA 4U7UK 1KP6A 5KG0A 2QC3A 4JI7J 2CNKB 1VQ7S 1GMUA 4KE5A 1IUJA 2V4JB 3Q8YA 1LWFB 1PG5B 4NYOA 1UAWA 3T1HJ 4G3IA 2GW8A 5D0RA 2M52A 1X8DA 4LFBJ 4ETZA 1QSSA 2QO3A 2ALYB 3EZUA 3G4SS 2YNHB 4OHWA 1U7LA 2MQOA 4AD6A 4OZ2A 3BKUA 3QZ7A 2HGNA 2ZBPA 2A3JA 2QE5A 2PA8D 3R7BB 4LRAA 1NJIT 1RP5A 1B4SA 5C5JA 3J7YU 1CSJA 2MQLA 2O01C 2XTJP 4JI3J 2M0GB 2H4WB 3T6BA 2DXFA 1WG4A 3BGRB 4P73A 3W2WB 2MKSA 3BSAA 1RACB 4KTQA 1HNZJ 2EEYA 1X4AA 2W25A 3PXGa 2ERRA 4UOHA 1S0NA 1SV5A 3EPIA 4X4PA 4RNHA 1TUGB 3KK1B 4ZJQA 4JYAJ 4EBDA 3GU0A 4HHJA 2A0FB 1TKTB 2AEFA 3QFWA 1NKCA 3VVUA 3H42A 4M5KA 1ZAWA 1IBKF 4GVBB 1TMJA 1FFWB 2NPIA 3BGLA 4IFVA 6AT1B 5HMYA 2DR5A 3TI0A 2OUGA 4ITSA 2ZVIA 3R2DJ 4KYZA 2HEKA 1SC4B 4N77A 3H2VE 1AT1B 1PBUA 2DB1A 4CNZA 5EWGA 4ZLPA 3K17A 1S97A 3J7ZT 3N5FA 1G3OA 1JJCB 2ZWPA 3BGRA 3FCVA 3HFZB 3MM8B 1KQSR 1HBUA 2QJ3A 5B0DA 2LQ9A 5F3ZA 4U6PA 2IA0A 4B3TJ 1UPMB 1VRUB 3QJLA 3SBMA 1NMEB 3VQSA 1FNXH 3CJKB 4EO6A 4USUA 1YIJS 3RR7A 2VG7A 4CM0A 4CLZA 3KXDA 1WF0A 2QX0A 3KK1A 3T5KA 3SSSA 3L4BC 1VQMS 1ULRA 3FFIA 1VC6A 5GAEI 4YOEA 1UJ5A 2HBQB 1Q79A 2YNIA 4O0IA 1N5YB 4I2PB 5A76A 1X9WA 1IWGA 5CYMA 2HFUA 3VR1A 5FIIA 4A48A 4DV3J 2M8DB 4AQYJ 4QU6A 2WCXA 3FC9A 2VASA 3IBCB 1VFJA 3UI3A 4UY8T 1HBMB 3NWRA 2H1YA 2B6AB 4UOCA 1LOUA 2H5EA 4DR2J 2B3TB 4ES1A 2CJKA 1SKWA 4FXVA 1F1BB 4EZ9A 2PFDA 3BYPA 3DRSB 2L3MA 2DNKA 2VZ9A 1HBOB 2BA9A 4IFYB 2AJ2A 1SL1A 3MUTP 1IR1A 1PJ7A 1JJHA 2ACMA 4Z2XA 1AYEA 1VHFA 3THTA 4L6V3 2PIIA 2BJ3A 3FJ2A 1TV6B 2ASDA 2IM2A 3T5HA 1DURA 3QSYB 2WVEA 3MMJA 4CZCA 1UEUA 1Z2ZA 1UL3A 3C16B 5HMZA 1FNMA 2KJVA 2DNHA 4C0BA 2IBKA 2J0SD 2UU9J 4C8OA 2K06A 4JB8B 3KTQA 5L9XA 1S12A 5IXUA 3WBZA 3ET6A 4RO0A 4YHHJ 2CJ9A 2HMIB 1RZMA 3TWZA 1TELA 3I4HX 4RZRA 3IWNC 1Z1ZA 1M0SA 2AYBA 4LF2A 5LJ5Y 2QL7B 4LFCF 1UJ4A 3IS9B 3A1YG 1H3DA 2D1CA 3DRSA 2FVSA 4LF7F 1BWVA 4EEYA 4CNYA 4LSNA 2VOOA 2X1BA 1ZM4A 1LW2A 2B5JB 1MLAA 2XYHB 4I2QA 4JUZA 3M9MB 1NKBA 5KG3A 5D4NA 1JKHB 3AODA 2ROGA 3CCLS 3IC1A 1S1XB 4P7TA 4DV1J 4IOBA 3TAMB 3RB6A 1VMBA 2B7BB 1RA7A 2B4UA 3M1VB 4UF4A 1EETB 2LLZA 4E2FB 2DGTA 3G96A 1RT4A 3KK3B 2J7UA 4CRJA 2RS2A 1VQPS 1NHUA 3MXHP 1ZBTA 4F36A 1QAXA 1Y9OA 2OPPB 5HVFA 1VBZA 2K3KA 3DN9A 5EGYA 5AJ3F 3U02A 2R7VA 4TNOA 1Y11A 3VGVA 5AXLA 2EW9A 2XHWA 2MY7A 4HDGA 5HROA 1RU1A 2R8KA 1CJUB 1X4HA 4NASA 3NNHA 1WC3A 4N76A 3PACA 1VK8A 3VGTA 3NXZA 4RLEA 3R9LA 1X5OA 4DV2F 2V2KA 2OSQA 3QSIA 4QIEA 4J37A 3I5BA 3TW0A 4I4BA 2B4VA 2YKNA 4C3KA 3S1TA 1U47A 4F26A 2R8GA 1RWOB 2XMMA 3CJ2A 3JSBA 2QGFB 3UWTA 5LMNF 3MTJA 3NGTA 2LA6A 5D4PA 2RRNA 2J0XA 5GMDA 5EX0A 4Y00A 1L5UA 4ZVRB 1CEZA 2CYYA 2HLTA 3HI9A 4JI0J 3ULHA 1NNDA 4N47A 1WC0A 5FDLB 4FNHA 1AXQA 3SSQA 3ZNUA 1P1LA 3MUMP 5J2NA 1HWUA 2DISA 1YITS 4U7UD 3V6HA 3TO8A 5I3PA 1SH0A 3H8YA 2V8PA 1FKAF 4MK9A 4LF4J 3PRDA 3FSYA 1KFSA 4QZVB 5K8PA 2HPUA 4CIOA 1LW0A 1KD1T 4YR2A 3G6VA 3QIDA 1UZHA 1WSRA 1WD6A 2VG5B 4PR6A 5H1SV 3CCJS 3PW5A 4TLRA 3GV5B 4F3OA 2OPSA 2EC0A 2V8HA 3BBFA 2RQ4A 4B02A 4DPXA 2DGUA 4FXDA 1Y4ZB 3OHBA 5GAGU 4UUWA 3FZ2A 2BKOA 1BY9A 1NK5A 1N5YA 2HHHJ 1U2CA 2VKZG 4K0KF 4PQAA 4KAIA 1RT5B 4DX5A 1YDLA 3KDNA 3M6VA 4RUCA 4Q45A 4ECYA 3NNAA 3NGSA 1R6YA 4YMEA 2VQFJ 5CH7B 5HI7A 1AA1B 1RT7A 2MSTA 5E3CA 1F5AA 3CE8A 4NA3A 2EKYA 1ELOA 3BV8A 2NREA 3H2UB 2FGCA 2G0CA 2CWXA 2EG1A 3EGWB 4ELUA 2E1MC 1T11A 3I96A 4Y2IA 1EB0A 2GJIA 3IO1A 5DG8A 5H9FJ 1WTBA 3AXMA 4NLQA 4NLGA 1WEXA 2CA9A 2R42A 2RKIB 4BWJA 3D0GE 5KFPA 1UVKA 2ZH3A 2VU5A 3M32B 5F9LA 4B3RJ 4RW9B 2DR7A 4K4YA 2FIUA 4QU7A 2WZ1A 3PW2A 5HANA 1S57A 5KFIA 5F9NA 3KJVA 1NPRA 1VLOA 2MHEA 2WW4A 2YWHA 3HK2A 3VQTA 5E41A 1JJ4A 1IQZA 5IT4A 3OL8A 4M5NA 4FYDA 3I9ZA 2XI3A 1RT5A 1YZ7A 3PEJA 1MG7A 3QNWB 1VQ6S 1VBYA 3BYRA 1K73T 2CPZA 4PQUB 3CF5Q 3G71S 1BD6A 1IN0A 2W2QP 1RQ0A 4HDHA 2GFFA 5CHCB 2OEMA 5LSOA 4JI6J 1A0OB 1DQAA 2X1GA 3ICLA 3HP6A 2QLWA 3Q23A 1D9AA 3BZQA 1S6QB 1SJRA 2DO0A 4V1Ak 3JSMB 5EN1A 5IQ6A 2RKIA 2DGOA 4QW8A 2CJXB 4OZNA 4XDDA 4GVLA 5AE2A 3W5YA 4DEZA 4ED7A 5A6WA 1T03A 3MFHA 3GR1A 2IRYA 3IRXB 2F9DA 3GMGA 3KHRA 2AEJA 4I2QB 1AW0A 3SIPB 1P8GA 1HYSB 2XB2D 4C2MA 2JFDA 5BXIA 5BR8J 2VICA 4Y2KA 4LIWA 3LWLA 2VBYA 3IBWA 2YPYA 4ZK7M 4CLPA 5HO4A 1DZ5A 1RTHA 2LDYA 2X7IA 3ZZRA 1N0UA 1RHJB 4EUVA 1EKSA 2J6UA 5KFSA 3DLBA 2D9PA 3PYGA 2YX1A 3M2RA 1W25A 1B0TA 1QTNB 3G82A 4RWXA 4AFFA 4J9VA 4DG1A 4M63A 4J9RA 4GKKJ 3IG1B 1JLEB 2Z30B 3UFCX 2JVRA 2AF6A 3D4JA 3HJVA 2DH7A 2M88A 2I0XA 4EWTA 5HROB 5H9EJ 2OLWA 4IUFA 3N79A 2HVDA 2XYGB 2MXYA 1KQGB 4UQGA 2W9BB 3GYGA 5M2RA 2GNKA 4I6AA 3F44A 2NLWA 1W2IA 4KGMA 3W5ZA 1HW9A 4QYRA 2WVDA 1HNIB 3BGFA 4CP5A 3GLJA 2XLJA 2ZH9A 2PFFB 3IAS9 2QT7A 2YKNB 5K9FA 3BJYA 2V34A 4MIBA 2IVYA 3MM6B 5L8RC 2Y0BB 3CIZA 3M8PA 4Y28C 5HBMA 4A8MP 1CVJA 2UUBF 2IMOA 4J5OA 1RDRA 4NI2B 2O3DA 3T3FA 1TKDA 2HBZB 1LNQA 2ZBCA 1IJFB 2CDQA 3POTA 2JLFA 2BANA 3CEDA 3D66A 3D7SB 1A7GE 2H51B 2ZBIA 4ZPDA 3OUYB 1OS5A 4IQMA 5SZTA 1M5HA 2C3MA 3IG1A 3SFUA 1S48A 4DFKA 1K8AT 4K4ZA 1XMOJ 3ZZOA 1SQFA 4NLVA 2PEHA 2DBBA 1PC5A 2X3DA 3CDBA 2KT5A 1FWLA 1S9GB 2WVFA 1FJCA 2V8DA 4I6YA 1H74A 3DDIA 3GG1A 2XMJA 4FDFA 4DV5F 3PRVA 4DV7F 2UXCJ 3W2VA 3CVKA 3PKYA 1SXLA 2FHJA 1MMDA 1IM6A 2B51A 4O3QA 2KB2A 2XC9A 4EFAC 3P96A 3K5PA 2FJAB 2M7SA 2KT2A 5LXYA 4IRDA 5CZXA 3J81U 1JWWA 2XG8A 2YKPA 3HT0A 2EWHA 2FVPA 4IO9Q 3H59A 2BANB 2GO8A 2G4BA 2DK2A 3ETOA 5AE3A 2V9WA 1VDHA 2PE8A 2VV5A 1C1CB 2B9WA 2Z2MA 4L3NA 3OV7A 2VA3A 1C0UB 1NJZA 1KHVA 2IIHA 4ED6A 2PT0A 2V69A 2VHGA 3NKYA 1RK8A 2V4QA 1KBRA 3SSRA 1UWBB 2Q6BA 3FBFA 1WG5A 4WU3A 3KHLA 1FRIA 2RB7A 3CUNA 2BMBA 4O3NA 3C6TB 1YRTA 2RE1A 2UVUA 1RKIA 3WIUA 4DF8A 2L9WA 4ILLA 2RH3A 5IM0B 1APSA 2DNRA 5D4OA 4Q44A 4YS2A 2GAGC 3M8QA 3R7NB 5C2CA 1B3TA 4Y3CA 2F4VJ 1KLMB 1WHYA 2EFGA 3VAMA 4DFPA 3W9JA 3FMBA 4KT0C 3SMZA 1IKWB 3R97A 4C6AA 2YKOA 2DHXA 1FRHA 1G4CA 4C48A 1DJ0A 1M5VC 2CQ1A 1FEHA 1SC1B 2LXFA 1RISA 2WVBA 4QR0A 1UTAA 3S6EA 2KM8C 2BUNA 4ELTA 1HNWF 3OVBA 1S79A 3DYAB 3K58A 4DCPB 3Q2TC 3S7RA 1H0HB 1SKRA 3UN5A 5L39A 4USWA 4DPYA 2KXFA 1WOPA 3ZNJ1 1L3UA 2KN4A 4C8ZA 2F5GA 3D2WA 2IRUA 1K1SA 3TA2A 1B7YB 1VQSA 4CTAB 2HQFA 2K1RB 1RYRA 4X4OA 3CJRA 3NCPA 4NRUA 5AXKA 5EWFA 3MM5B 1HYSA 4JI3F 2RU3A 3AXKA 3HD2A 4NLPA 4XTTA 1GH8A 2R2UA 3D3CJ 4ED5A 3I87A 3CJ5A 4WWSA 3O8WA 1TL5A 1JX4A 1RTHB 4USIA 3RAQA 3NLCA 1FDDA 1LWXA 4DV0J 3IR5B 2A18A 2E1AA 4NLRA 2B0GA 3GP9A 3PJ9A 4F7VA 4AUKA 1N56A 2FGOA 3MEKA 3TVKA 4ID5B 2I2YA 2YH0A 4R5PB 5EHHA 4TXSA 3FKBA 2W1BA 3GTYX 3R5GA 4J9PA 5CQGA 4OZ1A 3QJJA 4B9TA 1A6LA 3CT9A 1PO6A 3F73A 2AEMA 1Q5YA 1I6JA 4ZP6A 2N4CA 3V6JA 4K4UA 1TVRA 4P75A 5HJYA 1T8EA 4BHQA 4DX7A 2YWKA 1M1KT 3B6BA 2KXHA 2QLXA 1RT2B 1EAYC 1QM9A 3KKFA 4PXCA 1FE4A 3OJUA 2ZWOA 2VBXA 1RHKB 2LCWA 3R5AA 3UQSA 3CCES 2UVVA 4YDDB 5I3QA 1HFEL 3AD8C 2YBVA 3HD1A 2OPRB 4JI8F 1FX4A 2QA1A 2HRUA 3ITHB 2DXEA 2BOPA 2HG4A 1Q16B 4FS2A 1DARA 4LREA 3IA0A 4IR1A 1FRMA 2A6MA 1EQ0A 2CG4A 1JLAA 4F0KA 4PZVA 1X5TA 3M30A 1VGYA 2Y1RI 5HQ8A 3PR4A 4ZCMA 2DRAA 3ZO7A 1JXLA 4G65A 1IBLF 2R7SA 4P2FA 5KFYA 5HSPA 2P6SA 5KFHA 2Z4PA 1N33J 4KHMA 4DL5A 4ZP7A 3W2WA 3CC7S 2QEXS 2ZDPA 1S1TA 3M8SA 3RB4A 1QAIA 2UUCJ 3WC2A 4PUOA 1PAEX 4B3MF 3ONQA 4DV3F 4KPCA 5AXNA 3CTRA 1SV5B 1KQFB 3C15B 1VRTA 2DH9A 2FZKB 2MZSA 3HM9A 5JVHQ 4KO0B 3R1LA 1TL1A 3LA0A 4FF4A 4EK2A 2LDIA 5KFLA 2VIHA 1VJQA 1NDPA 1NDCA 5KG4A 3HZEA 4X65F 2M9KA 1N5SA 2QMXA 1RABB 3KNGA 3ZTRA 4OJ1A 3H25A 1T9XA 4KBIA 2XWYA 4IG0A 2U1AA 1IR0A 1E6VB 3H5SA 3MEGB 5KAKA 3I31A 3R5DA 4OYOA 3I56S 2VPZB 4OI3A 1ZA1B 1RAIB 2HK2A 4WJBA 1Z4UA 4NLTA 1U1RA 2CQPA 2E5JA 1PJ5A 2D3UA 3OBIA 4UZBA 4F4ZA 3LWMA 4PUOB 1Q8KA 5J1PA 5LJ3Y 4X2BA 2R3VA 3I32A 3OLAA 1UEKA 2MEWA 3VVTA 2AYMA 3LTOA 4ED4A 4YHHF 1KVJA 1Q53A 5HVHA 1NZAA 1MSWD 2L9DA 1GXUA 2DHHA 2H65B 3AY0A 3HVTA 3K8WA 4Z7YA 5C24B 2L41A 2J5AA 1AB8A 1KLMA 1RB0A 2HNYA 2HS3A 3PHEA 3RBZA 4DQRA 5D8HB 4PG7A 2HHQA 1FA0A 3DLEB 4OX8A 3BGUA 4O44A 4URSA 3PR5B 4JI7F 3HFVA 2HNZB 4KGZB 5A6PA 1ITPA 1DFDA 1XQIA 3ZTSA 2CPXA 4KSEB 2XO6A 4EYIB 1S1VB 4RW6B 3IMQJ 4ZDNA 2YWEA 3QGPA 4D3HA 5DQIA 2VJUA 4LF8F 4MK8A 1M5KC 1B0PA 2GVDA 4X66F 4KC5A 3MM7B 4O3RA 4BDPA 1YGYA 1FJ7A 1SIZA 2LVWA 2VPXB 3OVSA 4J9QA 1H2TZ 2E44A 3T1HF 2CRLA 2AJ0A 2QLBB 3R7SB 2IJNA 4ZKAA 5KFKA 1N34J 1UFKA 4RR5A 3U1MA 1S9EB 2DCUB 3AD9C
chains in the Genus database with same CATH topology
4F3MA 2E5IA 2V8GA 1Y3KA 4X84A 3V2UC 5KG6A 3IGVA 3SQGB 1XWLA 1CC8A 3KLIB 4DV4F 4PG4A 1Y7PA 4FVMA 2EFVA 4LQ3A 3HLUA 3CD6S 2WTFA 1PGZA 1VQ5S 1RT1A 3K57A 1MNEA 2GMLA 3JAMY 2HVIA 5E0OA 2HFOA 2ZOMA 5C42B 3OTBA 1D8ZA 1FTCA 2OP5A 5A8KA 4B9MA 4IRKA 4FZVA 1YHQS 4FF2A 3CD5A 3DRYA 1ZM9A 1JLQA 2OFGX 3GIKA 3G8QA 3MPYA 4DHVA 2HYIB 3GFHA 5DLGA 2ZH4A 5J2QB 2B5JA 3F41A 4HTJA 3VAKA 1TK8A 2WW8A 1OWXA 4WKRA 1C1BB 4NZ6A 2W8LA 1YTYA 2R7XA 3AQPA 3CCMS 5JXSA 1Q81T 3RRGA 3DMJB 4MFBB 2RIJA 2WSCC 1FDBA 3N01A 4J9LA 3KLEA 3NNCA 1YVFA 1VS3A 4FBTA 2ZNYA 4TU9A 1GXTA 3GFXA 3CMAS 5T7LB 5D3GA 2CPDA 2KJWA 4EO8A 3DU6A 2KO1A 2ILYA 2XGPA 3CCVS 2IYIA 3BREA 3VTIA 4DV6F 3LAKA 1P6TA 5U47A 2K7JA 3EYZA 2Y0SD 2F8EX 2LECA 2OAUA 2UVWA 2CQ2A 1TL3A 2BQUA 2J9DA 3GIJA 3IAM9 3MPWA 2CZ4A 4OV1A 1E6VA 1N88A 4XK8C 1S0OA 1EP4B 5HLFA 4FBUA 4CO5A 3E01A 1YRUA 3I4PA 3UDLA 4DFMA 3KYLA 2HGLA 3C6UA 2MZ1A 2IM1A 4YP3A 2M3DA 4Y2MA 3J7Z5 1LFPA 1WTFA 2DIUA 1X4GA 2KZZA 3CO9A 4LSNB 1LXJA 2EBGA 1U8SA 3CIMA 2ZOGA 4IH7A 4NRTA 4DPOA 1YRXA 1N36F 2E1CA 2IC3A 1HARA 4TY8B 1TKZA 2KHDA 2M8HA 2VFVA 4PKDB 2WAQD 3MM9B 1LV5A 2XS7A 2R7TA 2Z2LA 1FRLA 1H2UX 2HWIA 4YY3F 3Q24A 1RTDA 2NSBA 4NCBA 3GFZA 1EP4A 2OO4A 3G86A 2JEJA 3ENVA 3M6UA 4BWMA 1GXLA 3QPIA 2FJWA 5KFBA 3VAJA 1JLBA 4EU0A 1ZTTA 2VB6A 5B09A 1CG2A 5KFWA 1Z2LA 1P1TA 3MMBA 4RW8B 3ZZYA 3D28A 2VONA 2V8VA 2MKJA 2X51A 2QYCA 3HZGA 1SBRA 1D1UA 4NLXA 1WI8A 4AXJA 1S1XA 3OXFA 3T1AA 2YNIB 2GHPA 5FD1A 2I5JB 1EETA 4C8KA 3PJWA 2BRLA 3H5XA 2J6TA 1C0TB 4ZCIA 3H5YA 4TYAA 4Y34A 3CDUA 4URQU 5KFXA 3BQ1A 5GAGI 2DTJA 5BYQA 2KT3A 1IKVA 3CD0A 1HBMA 3O3LA 4LT6A 3NRBA 3QGIA 4CO4A 4C9DA 2GX8A 2HLUA 3DOLB 1JLBB 1HD1A 4LMZA 5G0RB 1JLQB 2NZ4A 5IWAF 2FTRA 1Y5NB 1P9QC 4URGA 3VAIA 4IFYA 2J0WA 4WTYA 3G9CA 4PWDB 1LW0B 3MHYA 4LFBF 2VG5A 1F0XA 2MB0B 4A8YA 2BVZA 3FEYB 1BQXA 3UCUP 3CCRS 1ZM2A 2YY3A 2WOMA 3NG8A 3HT3A 2R7QA 5KG1A 3V4IB 1VQ8S 5FDLA 4DDFA 2DHGA 4Q5VA 2ADCA 3OTOF 1UP1A 1QSLA 4PG8A 4X4RA 3BO4A 2HMIA 3JYTA 2EFQA 2FPHX 3B8HA 2RF2A 5BYSA 3VZIA 1FD2A 1SQEA 3ISZA 3DOLA 1IKXA 2ZE2A 4X4VA 3NMAA 4WFAQ 2HHHF