4ZVGA

Crystal structure of ggdef domain of the e. coli dosc - form iii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
b'MDVLTKLLNRRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNVRSSDYVFRYGGDEFIIVLTEASENETLRTAERIRSRVEKTKLKAANGEDIALSLSIGAAMFNGHPDYERLIQIADEALYIAKRRGRNRVELWKASLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Diguanylate cyclase DosC
molecule tags Signaling protein
source organism Escherichia coli k-12
publication title Structural analysis of an oxygen-regulated diguanylate cyclase.
pubmed doi rcsb
total genus 53
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zvgA00
3OHBA 3HVTB 1SV5B 5KG3A 3DOKB 4RNMA 3FDSA 1JIHA 3DOLA 4K4WA 4H54A 2IJNA 4JV1A 1C0TB 3BSCA 3MEEB 3LP0A 3H4DA 4IH6A 4DG1A 5HP1A 5F8HA 5CYMB 4ICLB 3RAQA 1T05A 1RYSA 4Q43A 3MFHA 5DG8A 4TYAA 1JLQB 5F8NA 3SFGA 4KKOB 4RNFA 1S49A 4HKQA 3IGNA 2AGQA 1IKWA 3QIDA 3JSMB 3NBPA 3UDLA 1RTIB 3LALA 3KK2A 4J9SA 3EZUA 1YVFA 3G6YA 3CJ0A 2W9CB 3JYTB 4RW6B 1IKVB 2ASDA 1S48A 3G6VA 4IKAA 3I5CA 3MEDA 5KFRA 4J9QA 2ILZA 1GX6A 1W25A 5KFWA 1JLGA 1HPZB 3QO9A 3DDKA 4WFYA 2W8LA 4J9NA 3MEGA 4WZMA 1RT3B 3DLGA 3GV7B 5HLFB 2W7PA 5FDLA 4R5PA 3FSIA 1HYSB 5F9LA 4R8UA 3DRSA 1C1CA 1OS5A 4NLGA 2B5JB 1RT7B 3CJ2A 2IM0A 3M8PA 1S4FA 1C1BA 4KB7A 4ZPAA 3KLHB 3KK3B 2OH2A 1RA6A 1XR6A 3T5LA 3ITHA 4PQUB 5KT5A 2JEFA 3T19A 2XI3A 4XO0A 4QWCA 3Q8PB 4IQXA 1RT1A 4FS2A 5I42A 2FJWA 1JKHA 2AGPA 3KLEA 4KHRA 3PW2A 3CDUA 1EP4B 4IG0A 3LAKA 2UVRA 3BSAA 4ZPCA 4MK9A 5K14A 4JV0A 2IA6A 4IFYB 4XPEA 4XPCA 1JLBA 5KFHA 1SV5A 1HQUA 2VG7A 2BE2B 4ZVHA 4X2BA 4JV2A 2I1RA 1HNIB 1FK9A 1RT5B 4DL5A 1S0NA 5DQGA 5CYMA 4KFBA 1R0AB 4NLQA 3DLEB 1MU2A 1IKYA 2ZE2B 3KHHA 1K1SA 4IR1A 3N6NA 4EO8A 1JLQA 4ECYA 3PW0A 4K4XA 2BR0A 5I3UA 2OPSA 5J2PB 5C24A 1IKWB 3H59A 3BSNA 1SUQA 2CJQA 3DMJA 5C42B 4EBDA 5KFJA 1N5YB 5J1EA 3KK2B 3IRXB 3M9MB 3H5YA 1REVA 1TVRB 2WOMB 4J9RA 3KLGA 2BQRA 1LWCA 3KMSA 5EWFA 3LP2A 3GIKA 3CVKA 1JLCB 4F4YA 4PUOB 4O4GA 3BREA 2C2EA 3QO9B 1HMVB 1TKTA 2AWZA 3M9NB 4ID5A 2C2RA 3Q8RB 1S1WB 4TLRA 1UWBB 2JC0A 3MECB 3DLGB 4NLDA 4I7FB 5DLGA 2UVVA 4QWEA 5KFEA 4MKAA 5KFYA 4WFZA 1HYSA 4NRTA 2JEIA 3DRSB 3GILA 3H2LA 4NLVA 3HVWA 4G1QB 1S97A 2FVPA 2JC1A 2D41A 3CO9A 2XCPA 1N4LA 4EYIB 4I2QB 5L1JA 5L1KA 4DL7A 1RTJA 2IM3A 1TKXB 5F8MA 2O5DA 1TL3A 1S0MA 1QAIA 4MK8A 3DRPA 4J9PA 4URSA 3SFUA 2W9BA 1RTDA 1RT6A 3EPIA 1EP4A 1C0UB 1HQEA 4RW7B 3KOAA 4JUZA 1S0OA 2YKNB 1FKPB 3RB3A 1JLEB 5K14B 1S9GA 4IG3B 4IFYA 2ZD1B 4Q44A 3PW7A 3IS9B 2WTFA 2R2TA 1VRUA 3BJYA 4U6PA 2R2SA 2D7SA 1FKOB 1WNEA 4ZVGA 4LQ9A 1FK9B 4O3OA 5C25B 4NLWA 5DG7A 3GIIA 2WONA 1S1XA 4QW8A 2R8GA 1RDRA 3DLEA 3E51A 3M8QB 3OHAA 4F4WA 3V81A 2OPPA 4B3OA 4K4VA 3NAHA 2GIRA 4Q0BB 4ECWA 1NHVA 3RBDA 3QGGA 5KFLA 2YNFB 3KK1B 1REVB 2XGQA 3FFIA 3UQSA 2EC0A 3QGHA 4K4SA 3ISND 4H4MA 5EWEA 1JLCA 2IM1A 1J5OA 5KT2A 4PUOA 1TV6A 4TQSA 4GC6A 1S6PB 1TQLA 2YNHB 4IDKB 4U7CA 3H40A 1UWBA 2C28A 5KFDA 4IFVB 3RB4A 2R2RA 4IH7A 2B6AA 3JYTA 4QWBA 5KFGA 1IKVA 1IM4A 3KHLA 3H5XA 3MFIA 5HBMA 3Q8SB 1JLAA 4F4XA 2V9WA 3KLIB 2R2UA 2IC3B 3PJXA 3EPGA 5L1IA 4ECVA 1TL3B 4EO6A 1D0EA 1HNVA 4WXWA 4RUAA 4ED3A 2C22A 1RT3A 2D3UA 2W9BB 3QIPB 5HLFA 3KLFB 4R8UB 1C0UA 1HQEB 4RW7A 4FBUA 5KFSA 4ZHRB 2UVWA 5HP1B 1C1BB 3KK3A 2ZD1A 1XR7A 4TY8B 4GC7A 2V4RA 3T5KA 4J9OA 4NCGB 4MIAA 3MR5A 4ZMMA 4LSLA 1JKHB 4Y3CA 2RF2A 1DTQA 4O44A 3C6UA 3JSMA 2BRKA 3DLKB 3CJ4A 1S1VA 4IG0B 2C2DA 2AGOA 1LW2A 5KFVA 2VG6B 4IRKA 4K50A 4EYHB 2OPQB 2UUTA 1JLBB 3DM2A 4RW4B 4RW8B 3RB6A 4KBIA 1U09A 3MEDB 4DL3A 4KSEB 4ED7A 5J2NB 3KHRA 1TP7A 2JEJA 2DPJA 1IKYB 2VA3A 1S1UB 2JLEA 3I0RB 4ZVFA 5KFZA 4TQRA 4NRUA 1CSJA 1TV6B 5J2PA 2HNYB 4ZPDA 2XC9A 1QE1A 1RAJA 1VRTB 2BANA 5F9NA 2AU0A 4OL8A 4DL6A 5KFTA 3KLHA 5KG5A 2WHOA 2OPRB 2UUWA 1DLOB 3ITHB 2IMWP 5C5JA 2WCXA 4H4OA 1D1UA 3PHEA 3GV8B 5KFFA 3OL7A 4J9KA 3V4IB 2I5JA 3OL8A 2IC3A 4MFBB 4RNNA 3QYYA 2ILYA 1BQNA 3MECA 4WXOA 3MF5A 3KLVA 3NAIA 1TL1B 2E9ZA 3DYAB 2AX0A 2HNDA 2RKIA 1RT5A 3BQ1A 4RW9B 2ATLA 4M94A 4KFBB 1R0AA 1SH2A 5KG7A 4YP3A 2YNGA 3MTKA 5KFOA 1RT2B 4LSLB 3HVAA 5C24B 4K4YA 3I5BA 2YNIA 1DTQB 4F50A 3DOLB 4MH8A 5C42A 5DGBA 4M95A 3V6JA 3IRXA 5J2MA 3LP0B 1S6QA 3KLGB 1S9GB 4ECQA 2OPQA 3BGRB 3KJVB 3DM2B 4KKOA 5EDWA 1HARA 3CDWA 3UPFA 4NLRA 1RTIA 4ID5B 1S1WA 4MIBA 3CIZA 1S1UA 3I0RA 2F8EX 3D5MA 3M8QA 4RW6A 3RBEA 1N6QA 3H4BA 4ECRA 5KFQA 4Q0BA 3LANA 3V6DA 1IKXB 4YR3A 2HNYA 2ZKUA 3IG1A 1ZTTA 1RYRA 1S1TB 3IGVA 1JLGB 5KFUA 3NL0A 2IJFA 1C2PA 3DRRA 1HPZA 4DEZA 2AQ4A 1DTTB 2JEGA 2HWIA 4KE5A 4KO0B 5KT6A 4H4MB 3N6MA 1RT6B 4NLYA 1J5OB 1QAJA 4IR9A 1S6PA 1TKZA 1RT7A 1C1CB 1NNDA 3BQ0A 2XGPA 3QGIA 4IH5A 4PQUA 5DG9A 3DI6B 3FQKA 3RB0A 1BQNB 5HROB 3PJWA 1LWEA 5KG6A 1S9FA 2B6AB 4RNHA 1Z4UA 2YKMA 2FLLA 2RKIB 5F8GA 1LW0B 1KLMB 3HKWA 3QLHA 2UVUA 5HBMB 2XCAA 4RU9A 1JLFB 2QE5A 1S1XB 3TVKA 4RUCA 5KFCA 1RA7A 3V81B 5J2QB 3T5HA 1RT4B 5T14A 1HNVB 1HQUB 2VG7B 4QWDA 4EEYA 2HMIA 4RZRA 4Q45A 2QV6A 5KT7A 5KT3A 4NZ0A 2VG5B 4G3IA 5DGAA 4RNOA 1S6QB 2WK4A 4WE1A 2ZE2A 4TY8A 4K4ZA 3BGRA 3KJVA 2BRLA 3SI8A 4NLPA 5CYQA 2XWYA 2HNZA 3HVTA 3BR9A 5I3UB 4YR2A 2IAJA 3OLAA 3BQ2A 5J1EB 1C0TA 4HYKA 3MEEA 2WOMA 3GQCA 1LW2B 1QUVA 3C6TB 2GIQA 3CWJA 1SH0A 3FRZA 1NHUA 4ICLA 2W9AA 4ECUA 3V6DB 5KG4A 2BQ3A 3IG1B 1S9EB 3NGDA 1KHVA 4F4ZA 2B43A 4ED6A 1JLAB 1SH3A 1HMVA 3OLBA 3OSPA 1TKTB 2FVSA 4KV8A 5D3GA 3CJ3A 5JUMA 4NLXA 3T1AA 3OSNA 3KLFA 1ZTWA 3H5UA 4G1QA 3PW4A 2FJXA 4Y34A 4TYBA 4TXSA 3ICLA 2OPRA 1RTJB 5DQHA 1LWEB 2IBKA 4I2QA 4LQ3A 4WYWA 4NCGA 3M9OB 3I0SB 4PWDB 2YKMB 1T03B 5KG1A 4ZPBA 1BQMB 4WFXA 3DOKA 4TN2A 3GIMA 4ECZA 2RF2B 4PWDA 4ED1A 2HAIA 1K1QA 3DLKA 2B5JA 5KFNA 4B3OB 1JLEA 3M8PB 4NLTA 5F8JA 4IG3A 2HWHA 1T05B 3GYNA 2R8JA 5KFBA 4QPXA 3BSOA 4I2PA 1FKOA 3MR2A 2HMIB 1VRUB 3DYAA 3QZ8A 2HNDB 2D3ZA 3Q8QB 3KLEB 4ECXA 2ASLA 1I6JA 4EBEA 2J6UA 4O3RA 5C25A 2AX1A 2V0NA 3PR5B 1S10A 2WONB 3LAMA 4R0EA 3VQSA 4ECTA 2W9CA 2YNGB 5CYQB 4NLUA 5L1LA 4IRDA 1RT2A 2R8HA 2FLNA 2IAJB 3KNAA 2W7OA 3RAXA 1QE1B 4ED0A 2E9RX 4NLOA 1HNIA 4YQWA 2GC8A 3FFIB 4IOBA 4TY9A 1DLOA 5J2MB 3FQLA 3CDEA 5KFAA 1MU2B 3E01A 1T94A 4Q8FA 3MR3A 4H4OB 5KFKA 1S9EA 2FVCA 2RDIA 3D28A 3GV5B 3PW5A 2FVQA 4ED2A 4NYZA 3DMJB 5DQIA 2V4QA 1N5YA 2FLPA 4MFBA 2DPIA 4K4TA 4KV8B 2XI2A 4ZP7A 4O3PA 3KHGA 5D3GB 1N56A 1N6QB 4IFVA 1RTHA 4QW9A 3V6HA 1IKXA 1MMLA 4EBCA 3NMAA 4O4GB 2R8KA 3ISNC 3PR4A 2ALZA 4RW9A 1JXLA 3HHKA 2IM2A 4K4UA 1LWFA 3UR0A 1DTTA 5KFIA 4KO0A 3N6LA 1BQMA 3LP1A 2BE2A 3QIPA 4FBTA 2YNIB 4FS1A 4ZHRA 3TAMB 3GIJA 3IN5A 2BQUA 3DI6A 3NKYA 3I5AA 4QWAA 3G86A 4ZVEA 4I2PB 1TKXA 2ASJA 2W8KA 5JXSA 4LSNB 4URQU 3G6XA 1EETA 4ZP6A 3T5JA 2OPSB 2FJVA 4J9MA 4DL4A 1LW0A 1SUQB 3QLHB 5KFXA 2VA2A 3C6UB 4ZP8A 3OL9A 4O44B 4KHMA 1T3NA 4ZP9A 2YKNA 1TVRA 1S1VB 2VG6A 4O4RA 4DG1B 4Y2AA 1LWCB 2J6SA 4WZQA 2WB4A 5J2QA 3LP2B 4RW8A 2WRMA 2CKWA 4RW4A 3PVXA 5KG2A 1S1TA 5J2NA 5EUHA 2J6TA 4MKBA 1JX4A 3DRRB 3NBPB 4WE1B 4YR0A 5KT4A 3CJ5A 3E01B 4O3SA 5KFMA 4I7FA 5DLFA 3MR6A 2HNZB 4MK7A 5KG0A 1VRTA 4J9LA 2FVRA 2YNFA 1TKZB 3PZPA 4IRCA 2BANB 3KK1A 3TQ1A 5HROA 4DL2A 3MEGB 3C6TA 4O3QA 1RTHB 3H98A 3V6KA 3DRPB 1RTDB 4ECSA 5EWGA 4URGA 2R8IA 1KLMA 5FDLB 4R5PB 5KFPA 1JLFA 3V4IA 2I5JB 2YNHA 4IDKA 1FKPA 1LWFB 5L9XA 4Q8EA 3H5SA 1RT4A 3IS9A 1GX5A 3LP1B 5F8LA 4Y2CA 4ED8A 1XR5A 1RT1B 4O3NA 1TL1A 5I42B 5F8IA 3TAMA 3OL6A 2VG5A 4NLSA 1KHWA 1N48A 3KLIA 4YMEA 2E9TA 4KAIA 2RDJA 3KMQA 1ZETA 2OPPB 4LSNA 4WYLA 3QZ7A 3I0SA 1EETB 1T03A
chains in the Genus database with same CATH superfamily
2B7BB 4NE9C 4DSEA 1VC0A 1BXNA 1JIHA 1SI9A 3JQJA 3KNGA 3VR1A 4YDXA 3VAIA 3OUYB 4UY8T 4DR6F 3M2RA 3DOMA 3BSCA 2Z8QA 1RAIB 3L7UA 3MEEB 3OQ2A 1AB8A 5GAGU 3CGIA 4FNIA 5CYMB 4DV5J 2R7VA 1UETA 1RYSA 4Q43A 2HYIB 2EFGA 2Y0BB 3TVYA 1HI8A 5F8NA 1EJ7L 2HK3A 5H9EJ 2QA4G 2ACYA 3HSDA 2NS1B 4PABA 3RG6A 2H5IB 1RTIB 3R5CA 4K5RA 1PC4A 3EZUA 2GJ2A 3K58A 4ZJLA 5CZXA 1KOOA 2C2OB 2XMUA 2MJNA 1RI7A 3QFWA 2YTCA 4DQIA 2EBEA 3ONQA 1R27B 4PZVA 2E5JA 4IKAA 3VAMA 1ZYQA 4N76A 2ZZNA 3HLUA 3I5CA 1HIYA 2VBWA 1HW9A 2GQQA 2CQDA 3MEDA 1GX6A 3BF4A 5D15A 4DU8A 1B70B 2ZZTA 1UPPA 1CJKA 1F5AA 2V68A 3DDKA 3EWGA 3BKUA 3IBWA 4G6VB 4MYUA 5IWAJ 4WZMA 2NCKL 2BEFA 1IBLF 1R6VA 1BC6A 4V1Ak 4CDIA 4F8RA 1AFIA 4R5PA 4D3GA 3R5DA 1SL2A 1YJ7A 3DRSA 4NLGA 1RT7B 2HAFA 3M6WA 1S4FA 3MMCA 4HH0A 1YJ9S 2LQJA 3GLJA 1URRA 3TNVA 2VPZB 2X51A 2CUYA 1RWXB 2XI3A 1CC7A 4DX5A 5L1IA 2JEFA 3NNAA 3O8WA 4A47A 3CC2S 4FS2A 1GMWD 3G8TA 2FJWA 4ZS6A 4DV4F 3KLEA 2AGPA 4OZLA 1VFJA 3PW2A 2HVIA 1B99A 4MMOA 1RWOB 3GMGA 4MK9A 2FY8A 2E7VA 1CJVB 3CCVS 4IFYB 5CAAA 2FZKB 4DF4A 3J7YU 2CNKB 1Y0HA 4USJC 5A0YA 3T9NA 2CJ9A 4ZVHA 5KFHA 4XPCA 2IVMA 2HQIA 2FYXA 4JV2A 4YHHJ 2I1RA 1GT8A 1HNIB 1S7IA 3KJQB 4J7CA 4PXBA 2DH7A 3WHIA 1R0AB 1RU1A 3W5XA 4OI2A 4C48A 1OSCA 2GAGC 1K1SA 1GNKA 2FHKA 3GB0A 3N5FA 4EO8A 3KHHA 3CCLS 4PYAA 3PW0A 4NXNJ 4OJ1A 2HQDA 4FP9A 2GO8A 4ERDA 2P6TA 4NI2B 1X5PA 3LWMA 2CJQA 4X4UA 4USHA 1RAEB 4X4OA 2QSFA 3AD9C 1UZHA 3HHLD 3GFHA 2RE1A 5KFJA 3M9MB 1N5YB 1IBKF 1REVA 1TVRB 2QX0A 1UVLA 3KLGA 1LWCA 1CULA 1RJJA 3PO4A 3KMSA 3LP2A 2YXLA 1QDUB 2F63A 2XMWA 4NYPA 2P2CB 3BREA 4O4GA 4CH7A 4CLTA 2C2EA 4DN9A 1TFWA 4OV6A 1S77D 1OO0B 2AV5A 5GVQA 5HJXA 3UD4P 4DHVA 2UXBF 3ENVA 4DU7A 3Q8RB 1M90T 4LIWA 1M5VC 3MECB 2HGMA 4NMXA 2V2VA 4BWJA 1HYSA 2X1AA 1GEHA 1RBOB 2MKCA 1ACMB 2JEIA 4Y2MA 1SPBP 3BGFA 1DY3A 1QY7A 1YRXA 3H2LA 1S7HA 4Q2LA 1S97A 3MAQA 3VVTA 5MLCV 3EGZA 1P6TA 4WTOB 3UCUP 3BDEA 4I56A 4V19J 2XMJA 2IM3A 3VWSA 2ZZMA 1TL3A 2MKHA 5IFMA 2L48A 4QR2A 4XTTA 4OX9F 2MDAA 2HWTA 3OXFA 4JI4J 1UAWA 3M32B 4HDHA 1FESA 1T7PA 3G6ES 3EGWB 1QM9A 2J76E 2ZUAA 3OFEA 3ET6B 3EXCX 1OPZA 3X3UA 3MTJA 5C2CA 1A9NB 1FRXA 1S9GA 3OFGA 1J5EJ 1JJHA 4HHHA 1UFKA 3UI3A 1VBYA 4C8LA 1WNEA 2E7XA 4QOTA 2R2SA 2WVEA 1Q8KA 1YLXA 3N79A 2UU9J 4O3OA 1FNXH 2WONA 3KJNB 4QW8A 3THPA 4DCOB 1VQ7S 1BUXA 4HH1A 2EG2A 1R6YA 2CJYB 3M8QB 3MXHP 4F4WA 2KN4A 4B3OA 3CW2C 3GFXA 1QSLA 2CADA 5LXRA 1SB6A 2H48B 3UFCX 4P2MA 3K57A 4TU9A 5K8PA 3AXKA 3HSGA 2R7OA 3FFIA 2DR8A 2AZ1A 3BZQA 4C0HA 4C8KA 4Y00A 2VPWB 2ASYA 4H4MA 1NXIA 3U1LA 3VGSA 1TMMA 3A13A 3DLJA 3VV2B 2YY3A 4RR5A 3J7YI 3PX6A 4DV2F 3ZFVA 3PG9A 4L6V3 5KFDA 4OI3A 2QMXA 4EMDA 2R2RA 2V8GA 2B6AA 2R7TA 4QWBA 3BB5A 3K8WA 1IKVA 2IYIA 3GU0A 3OVSA 4JYAF 1CJTB 1HBOA 5DRKA 5HBMA 2IDEA 3GONA 2RUSA 2OGUA 3UN5A 4NXMJ 3VAFA 1FJCA 2CNLB 2NXNA 3RGIA 3P45B 4R0JA 2UUCJ 2GA7A 2CQ3A 3NEKA 3GTYX 2MZRA 1FRIA 2H65B 4I1TA 4PXEA 2GVDB 1HNVA 4WXWA 5D4OA 5K5MA 4DR6J 1RT3A 1VQSA 2D3UA 1RQ0A 3QIPB 5ETLA 2W9BB 3CMAS 1IR1A 5HLFA 4RUHA 4R8UB 3AQPA 5AT1B 1S4EA 3POTA 1C1BB 3K8VA 3UN3A 4JI7J 3M2VA 2F8HA 4A8OA 1SKWA 5GAEU 3C14B 3HD2A 2LMIA 3PACA 4LSLA 4E2FB 1JKHB 2XO7A 4ZCMA 3CF5Q 2RF2A 2LLZA 3MM7B 4O44A 4B3MJ 3JSMA 5HL7Q 3CT9A 3NNCA 3TJ8A 3DLKB 2C2DA 1HNXF 3FBFA 4HEA9 5IV3A 3IBCB 4M5NA 4UZCA 5A2QY 4IRKA 4K50A 2LP4A 5F3TA 4NXMF 2OPQB 4F0MA 3DM2A 1H2VZ 5HAOA 1U09A 1VQ9S 4KSEB 1N32J 3HFZB 3HK2A 1YRTA 1DQAA 4C11A 1F0XA 2W4PA 2JEJA 3QSIA 4YDDB 1RAHB 3U1MA 1KSPA 3PKMA 3I0RB 4ZVFA 4O0IA 2KJVA 2RRNA 3ELHA 3HZEA 2HKEA 1JXEA 1IVZA 8AT1B 2HNYB 2XMMA 2DHGA 4FKXA 4PXDA 1VQMS 2BANA 2AU0A 4DL6A 5D77A 1M1KT 2XMTA 4FPRA 5KG5A 2BE9B 2L9NA 2W24A 2UUBF 2UUWA 2NPFA 4WF9Q 2M5YA 1UWAA 4FVCA 5LXYA 2KO1A 3NGUA 3HSZA 4USKA 2IMWP 2Q79A 1AFJA 4H4OA 1D1UA 2ZHAA 1Q8BA 1SIZA 3EUNA 5KFFA 5A6WA 3TP2A 4K2JA 4U95A 4JI8J 1RWNB 2I5JA 3BBBA 3OL8A 4OZ0A 4MFBB 2D69A 4ZLJA 3MM5A 2VU5A 2HRYA 1UPMB 2C2ZB 3QYYA 3MZIA 3NOGA 5E3AA 4DV3F 2QIFA 1F5BA 4F3OA 1UVNA 3NAIA 1TL1B 4K7QA 2E9ZA 3KG0A 3K89A 4LFCF 4G65A 3UD5A 3JTNA 2VKZG 2L41A 2FUG9 1J27A 3Q2SC 2PSZA 5HK4A 4LSZB 3UO0A 4M94A 3NCRA 1PKUA 1SH2A 1MWQA 1HBMA 1O51A 1O5JA 2E5GA 1YDLA 1AYEA 2PFDA 3BPSP 4EU0A 5KFOA 1QVFR 4DV3J 4ZCIA 5CZVA 2XHWA 2ZBCA 2ZH3A 2CQHA 5C24B 2IRUA 1F3FA 4X4SA 1OWXA 2AHOB 4WPAA 1FA0A 1SIWB 1WDDA 2HIYA 1I3OB 3DOMB 3OR1A 3CCES 5J2MA 1C4AA 2KRRA 2RU3A 2WSEC 2MJUA 5ITHA 4PG5A 4LFBJ 3MOZA 4HT5A 4LR8A 3CCRS 3IBFB 3MEKA 2R4FA 4ZPTR 3CC4S 2EKYA 2KG1A 2EVZA 2A1BA 3UPFA 1H73A 3PNIA 1U1LA 1FXDA 2N7YA 3TZXA 3C19A 3M6UA 4MIBA 3I0RA 2F8EX 3HT3A 4RW6A 3CDAA 2B0GA 5KFQA 3LANA 3SEOA 4YR3A 2HNYA 2ZKUA 3IG1A 1ZTTA 1X4CA 4X66F 1RYRA 3WC2A 2LU2A 2XSJB 3DCAA 3HCXA 1JLGB 1WEYA 3DRRA 1HPZA 5F0UA 2J5AA 4OJHA 4DEZA 3AB2B 4ZIVA 4KE5A 4H4MB 1FDDA 3M1VA 1N36J 1RT6B 3NXZA 4RLEA 1J5OB 1QAJA 5M2RA 4NXNF 1FRHA 1TKZA 1RT7A 1C1CB 2ATCB 3MMCB 4AUKA 2KXHA 3W8GA 4ZLLA 2XGPA 3DI6B 2KXNB 2OMOA 3FQKA 4EZ9A 3P5TL 2EBGA 5HROB 5DJBA 3PJWA 1X9SA 4UOFA 3VQTA 1LV5A 2C3YA 1DRZA 1IUJA 1KP6A 1B0TA 1OY8A 1YHQS 5F8GA 3RR7A 3LO3A 3CCTA 1H72C 3QLHA 3T6JA 4DDFA 5HBMB 2DVIA 3RW7A 3RBXA 1ZZFA 3LF0A 4I4BA 4KRWA 2W4CA 1KR4A 3T41A 2HFNA 2W2QP 2BW7A 4OYAA 3NLCA 5RUBA 3JXOA 5J2QB 1RT4B 3MPYA 5E33A 2I6WA 4OI0A 3M2UA 4YB5A 3NWRA 4RZRA 4B9SA 4CTAB 4Y28C 2ZM6J 4G3IA 1FFWB 1HL6A 5DGAA 4DSFA 2BM1A 2HG4A 2WAQD 3POTB 4BCAA 1ITPA 2QTWA 2ZE2A 1KTQA 4QIFA 3C66A 3NNHA 2BRLA 3VF0B 2F40A 2BZ2A 4NLPA 2CIMA 5A8KA 2XLIA 1KD1T 1VI7A 1WKLA 2XWYA 1AT1B 2HNZA 2VBZA 2ZUGA 3BR9A 3HVTA 4KHPF 2F4FA 3Q8YA 5CD4A 3MURP 3BQ2A 1WTBA 1HNZJ 2MPUA 3OUYA 4HYKA 1PIEA 1R31A 1VC5A 2KT3A 2FPHX 2MMYA 1F6TA 1QUVA 4ICLA 4ECUA 1R8AA 3MUTP 2W9AA 4C8OA 2B56A 2OEKA 5KG4A 2XTJP 4CO3A 4ZKAA 2B9XA 3NGDA 2FD2A 1BGXT 2D1CA 2DNOA 3K59A 1JLAB 1T9UA 5SZTA 1SH3A 4MIWA 3MUVP 4P52A 3I56S 1Q7YT 3OPKA 4X84A 3OSPA 4EI2A 3LH2S 1RHQB 3A8KA 4P2FA 1H6KX 1HHQA 3DXSX 1MROA 1DURA 2IMOA 3M1VB 1KQFB 3S7RA 1R0CB 3OSNA 1WKKA 3D9BA 3KLFA 1N36F 4WJBA 3H5UA 2KB2A 4WP9A 1H98A 2ZDOA 3M6XA 3PXGa 3T9ZA 5DO2A 3PW4A 2UUBJ 4TYBA 2GMJA 2FHMA 4NZ7A 2BUNA 4LF1A 4ZN3A 4LF7J 4KHPJ 5K8OA 2DNGA 2EFVA 3C14A 3ZZYA 5IQ6A 2YKMB 2GNKA 1P8GA 3RW6A 3A1YG 5H9EK 4MJKA 2OLWA 1T0TV 3I55S 2NSBA 5F8JA 2CDRB 3QPIA 2RAQA 2WVCA 1ULRA 3K5LA 2XYHB 4F2SA 1U1PA 1L3SA 5AXMA 4A8SA 1TL4A 2D3ZA 4U7UD 1YSJA 2O01C 4ALZA 4JI4F 2E5HA 1S10A 2KDOA 1LXNA 3NGRA 4L75A 4USWA 4NCBA 3LAMA 2XS7A 3C16A 3PYEA 3FGVA 2V2ZA 1SVDA 4GVLA 4C97A 4JI6F 2FLNA 5LMUF 4I6WA 2ZOMA 1QE1B 3GE9A 2W7OA 4PG4A 4GRSA 2K1RA 4XK8C 1NH8A 3IM9A 5DZ6A 2RB7A 1BWEA 2JX2A 5CH7B 4RU2A 1DLOA 3CD6S 2D9OA 1CC8A 5KFAA 3PW5A 1S9EA 2FVQA 3D28A 1MMNA 2E7WA 2DHSA 1KS2A 4BHQA 4B9MA 2B4UA 2FQQB 4P9SA 1N5YA 1WHYA 4B9LA 3SIPB 1QAXA 2XI2A 4ZP7A 4O3PA 3SYZA 3W7BA 4X4NA 1CPZA 2P9GA 3K5NA 3QWUA 4FYVB 1CJTA 1HBOB 3BGUA 4O4GB 2R8KA 2M3DA 2MY7A 2ALZA 2PI5A 4ELVA 4YN3B 2NREA 1VR6A 3NGSA 2IM2A 3GJRB 4K4UA 1OMSA 2J9EA 4HR2A 1NCLA 1NMEB 1WF2A 1Y4ZB 1NDPA 1RAGB 1Q86T 4KO0A 4YFUA 1HNZF 1NKBA 4B9NA 2KI2A 4FBTA 4QYRA 3LPYA 4F3MA 4OZJA 4KGMA 4OI4A 1TMJA 3N4WA 4QWAA 1YJUA 4KC5A 3MM9A 1D9DA 1F3VA 2DRAA 2OPSB 3DGPB 3GJTB 1SUQB 3M32A 1LWXA 3K5MA 4ZP8A 4CLWA 3OL9A 2QLFB 4EGLA 2C3MA 3TJ9A 4PEOA 4LF6J 2F4VF 2E1RA 4ZP9A 3CD7A 4WKRA 1WC6A 2LXFA 4Y2AA 4ANDA 4LFCJ 2W4DA 2WB4A 3ISZA 3TJAA 2LXUA 5ETQA 1OPIA 2K7KA 2LQ8A 4RW4A 3PVXA 1PSDA 1S1TA 2CQ1A 5KG2A 1H2TZ 2AMCB 1B0PA 3HHLA 3MCNA 4MKBA 4RWWA 3LGNA 1JX4A 4WFBQ 1M5HA 4WE1B 5KT4A 3CJ5A 3E01B 2M8DB 2PA3A 4O3SA 2Y8WA 4QU7A 2CQ0A 2NZ4A 1DHMA 4LF4J 5A8KB 1T11A 2A2CA 1NB7A 1X4HA 2YNFA 2QGFB 4A8MP 3PCOB 3TQ1A 2ZJQQ 1NPRA 3D6TB 4O3QA 1NRKA 3D68A 1ZA2B 3QRRA 4LR7A 1UEUA 5E3CA 5FDLB 2DR6A 1X5OA 1Q8LA 1JLFA 2RD5C 4QR0A 3OTDA 2I5JB 1P9QC 3PYGA 4ER8A 1WG1A 1FKPA 1WC4A 2Y9HA 4YUDA 1GX5A 4B3SJ 5F8LA 4DPWA 1VDHA 4ED8A 3SCLE 5T7LB 4O3NA 5I42B 2UXDF 2ZJRQ 2GMLA 4CTAA 1SBRA 2EPIA 4YEAA 2ZHOA 1KHWA 4DUTA 3D3BJ 1N48A 3KLIA 2E9TA 3UVJB 4JOUA 4KAIA 4HHUA 3KMQA 1ZETA 2IIHA 3W5YA 3RUBL 3QZ7A 2R8GA 3TUZC 4FNHA 2J0QD 2BXJA 2CWKA 1VK8A 2DHXA 1DZ5A 4H54A 4JV1A 5SUHA 3W9JA 1U48A 1EARA 5F8HA 3Q2TC 2JFKA 5LT5A 2HLTA 4OZ5A 1U25A 2YH0A 4NYOA 1JLQB 5HI7A 5KOXA 5HANA 5KTQA 3THVA 4RNFA 2BOPA 2KFYA 5A6PA 1IKWA 4K2XA 4DV2J 2VPYB 4OYBA 4NA3A 2P9CA 3CIMA 4GVBA 3R8YA 2CQ2A 3CJ0A 1MLAA 2F7VA 2KT2A 1KFDA 1S48A 3G6VA 4I64A 3UN2A 4DSKA 1Q16B 2FC9A 1NSKL 4J9QA 2E44A 4JI8F 2P5VA 1W25A 4CO1A 3SQGB 4X65J 5H9FJ 1JLGA 2MY8A 2J8SA 3QO9A 1KFSA 3JSRA 2XZWA 1Q4RA 3TWZA 4V19X 3OVBA 1IJFB 1RT3B 4KY3A 2N7CA 3GV7B 1RGVA 2VPXB 3K2YA 1HYSB 5F9LA 4YS2A 3IP0A 3NOCA 1PO6A 3KG4A 3VHQA 4ZVRB 3R3TA 1N5QA 2B5JB 2IRYA 4KB7A 5DDOC 4ZPAA 3KLHB 3CUNA 1XMOJ 2OH2A 2H9ZA 2UXCF 2HGLA 1RABB 4U9RA 4ZCKA 2RU9A 3DN9A 3TZYA 1OYEA 3Q0AA 4XO0A 4IQXA 3QJJA 2VODA 1MNEA 4Q7AA 2XNQA 3TZWA 2I9SA 2AYEA 7FD1A 1EP4B 1VJWA 1Y9OA 3AQOA 3FUYA 4IG0A 3A3OB 2XO6A 3BSAA 1WHXA 3N9UC 4P2SA 3J81U 5K14A 5AJ3F 3F73A 3AH6A 3CMQA 1HBUB 4I0WA 2IA6A 1OQ3A 2IPOB 4RWXA 3PIOQ 2WSFC 2KHDA 2BE2B 2UP1A 3J80Y 4Z2XA 5I3PA 1T9XA 2ZOGA 2K1RB 2FJAB 1RLDA 1GXUA 1RT5B 1VYAA 2ZFHA 4RX6A 2DR5A 4YOEA 4RBUA 1YG0A 1YJRA 5CYMA 3RBEA 2OI2A 1OIAA 4U8YA 2ROGA 1KVIA 4IR1A 2AYGA 1JLQA 1HA1A 1SQGA 5M2UA 4R25A 3H59A 4WK3A 4DLGA 1SUQA 3EXYA 4B08A 3HJVA 4Q5VA 3PDNA 5EX0A 4EBDA 1FJGF 2WVFA 3KK2B 1MW7A 4M5DB 2YKQA 1IQTA 4J9RA 2E1AA 3GP9A 1Y3JA 2AJ2A 2AYMA 3R5JB 1PBUA 1WELA 1BWVA 3CVKA 4UOCA 1JLCB 3GIKA 4DR5F 1RKJA 1YKWA 1TFYA 4ID5A 3B54A 1Q5VA 1MROB 1UJ4A 4TLRA 3GYGA 3DLGB 5CABA 5DLGA 2GVZB 5KFYA 3PYFA 3Q83A 4WFZA 3BH6B 3DRSB 5D0HA 1HI1A 4LFAF 2VDIA 3PFOA 4F3QA 2JC1A 2D41A 4JV5J 2CDQA 2HLUA 4I2QB 1VBZA 2QMWA 1HKAA 3PM9A 3I31A 1RZMA 4N8NA 1PC5A 1S0MA 3W66A 3OXLA 1MN9A 2VF3A 2W9BA 2R9LA 4C8YA 1RT6A 2J9DE 1C0UB 4RW7B 2LDYA 5HSPA 2QLBB 4JUZA 2YKNB 1RB0A 5JJBA 4JV5F 1R3NA 1YITS 3TVZA 4FXVA 2WTFA 1VRUA 4U6PA 2X1BA 1FKOB 2DNNA 4ZVGA 2CPHA 1OYDA 1F2HA 1FK9B 1RU2A 2QA4S 2ZM6F 4NLWA 2MEWA 3C15B 3GR1A 1WOSA 3DLEA 3HFVA 4ZK7M 3E51A 3C16B 4DV4J 1RHMB 2F9JA 3DDNA 3SV4A 4K4VA 4CWBA 3R1LA 2HS4A 3WX8A 3RBDA 3QGGA 1B0VA 1RISA 3E8OA 3M2UB 2MB0B 2HBRB 1RAOA 2DNLA 2QO3A 1YK9A 2CPJA 2XSJA 4X4RA 2D3O1 4USTA 2BOAA 2EC0A 3D1OA 3UQSA 4NOHA 4CT8A 3TI0A 1S6OA 3JAMU 2ADBA 4OFZA 3VGUA 2PMWA 4OYPA 2B9EA 2VC1A 5EWEA 4DQSA 1JXVA 4PUOA 3H90A 1J5OA 4QYZJ 1NDKA 2CQPA 4Y2IA 1FX2A 2YWFA 2ZOFA 4YY3J 1ZM4A 3H40A 2VD3A 3FNNA 2YKOA 2Z2LA 1TR0A 4NEZA 5KFGA 3Q89A 1IM4A 2E29A 4DV5F 3MFIA 3M8WA 1NH7A 2HHPA 4C3LA 1JLAA 1KNZA 5MAOA 4LREA 3CMES 4LJMA 2FJEB 1ZM9A 4GKKF 1F60B 2QN6B 2R2UA 3EPGA 4PR6A 4ED3A 3OTOJ 5ETNA 2JHEA 3VALA 4F7VA 3SZ2A 1BHNA 2XBPA 2Z2YB 1VHIA 1HQEB 1RAAB 2E1PA 1KEKA 4FBUA 1N88A 5JVHQ 2JFDA 3KK3A 3K0JA 2ZD1A 2V4RA 4HI1A 4J9OA 2Z0GA 4NCGB 3T5KA 4LRAA 2XLKA 3MR5A 1TL7A 1QJHA 1KVJA 3H8YA 4ZMMA 3ZZRA 3NP5A 4J37A 1M5PC 1BD6A 1UMJA 2GZOA 1Z2ZA 2BRKA 3CJ4A 1S1VA 1A6LA 1D8ZA 2G0IA 2ZC3A 4LRDA 4N47A 2XY6A 3MMAB 1HFEL 1WTFA 3OTCA 2GGPA 3OT9A 4FZVA 1IWGA 1HR0F 2XZDB 2FY1A 2XM3A 4N7TA 4UT4A 4RW8B 3PRBA 4W90B 1VIOA 3BPDA 3UCGA 2MKKA 3KHRA 1TP7A 4IUFA 4K0KF 1V5IB 1SKUB 2J7UA 2DGSA 5GMKa 1CQNA 1IKYB 2NXCA 2JVRA 1RHUB 3TA2A 2UXCJ 4B3TJ 2R7XA 2DD8S 5J2PA 1FT8A 1CBKA 1VHFA 5F9NA 3SV3A 4BLGA 4Q8EA 4OL8A 1YBUA 3I6PA 4OHVA 3PV8A 1DFDA 1Q7LB 2LQBA 1EKRA 2PDAA 2OPRB 2WHOA 4DV7F 3ITHB 4IO9Q 1IBLJ 3OBIA 5ETVA 5HQMA 1UEVA 3LWLA 1CS4A 3U1NA 2R7RA 3GFYA 3PHEA 2V8DA 1FE0A 4A8XA 3M8YA 3LUYA 1WHVA 1VMBA 1I51B 2OD6A 1UW9A 3W9HA 2Z57B 3QSYB 2CG4A 3MF5A 1ZS6A 2YVSA 4OZNA 4P75A 4B3SF 2MKSA 4CI0B 4LF9F 1F2GA 3S6EA 3MCSA 2OAUA 4DPUA 2FHJA 2MQLA 1TELA 4IQMA 5B0FA 2JSXA 3M6VA 2M52A 2CWXA 2W1BA 1O0PA 2CJXB 4KPYA 1UVMA 3O5TB 5KG7A 1E6YB 1U2CA 3T6BA 1ZM3A 3DLHA 4JI3J 3MTKA 2VBXA 1PG5B 4LSLB 2F3JA 3HVAA 4K4YA 1ZZNA 2UXBJ 3I5BA 4WWSA 4F4AA 1DBDA 1AW0A 4LR9A 2BBEA 3GPAA 1FWLA 3UR3C 1VJQA 2ZH6A 1JQGA 1S9GB 1YQHA 3LOUA 4P74A 3UNYA 3P4UB 4RKUC 5L38A 3B4MA 1ZOTA 2DGXA 1X4EA 3BGRB 3AFGA 3DM2B 3DDIA 3QAUA 3W61A 1S99A 2HQGA 4DQPA 2HHVA 1U0HA 2OSRA 3W2VA 1WKJA 3KWMA 3IWNC 1IBCB 1RTIA 2J9CA 4X4PA 2AZ3A 5D78A 1S1UA 4A48A 1U6ZA 4C0OC 2GV1A 3WDOA 4CIOA 2XY7A 2ZH4A 2BV3A 4ECRA 1RCOB 3GZ7A 5AE1A 4Q0BA 3V6DA 1VBKA 1IKXB 3AA8A 1YZ6A 5LSRA 5FLXY 2V6AA 3TA1A 2X1FA 3Q86A 3HI9A 2LVWA 4ED5A 2ZNYA 1C2PA 1Q82T 3BO4A 4PQAA 2CRLA 3A4TA 1T02A 2HWIA 4KO0B 2DY1A 2HFUA 1X8DA 3HDSA 4M5IA 4JYAJ 2KVIA 2MSTA 4L3KA 4ZVTB 1FJGJ 1NNDA 2BKNA 3JAMY 1RHKB 3QGIA 4DX7A 5DG9A 4KR0B 1Q78A 2G2OA 3W65A 2XMAA 3RB0A 2BJ9A 2CQCA 3RZAA 2VICA 1LWEA 5KG6A 1K0TA 5IQQA 4M5MA 2DT9A 3R6LB 1VCTA 1Z4UA 3H42A 2Z58B 4QIVA 2GX8A 4P6QA 1S57A 4ZA1A 1NM2A 3S1TA 3VAGA 2XNRA 2KM8B 1NKCA 3ZZPA 2K3KA 3OFFA 4P10A 1JLFB 1XK8A 1SQFA 2QE5A 9ATCB 1S1XB 1TZ0A 1QSYA 1XTZA 2WB1D 5E7OB 1I5OB 2R42A 4OLOA 2CQBA 2HFOA 2HURA 1RCXB 4USVA 4WCEQ 1D3WA 1H7XA 4PWUA 2KKHA 3MAHA 3GSIA 3T1YF 1LFPA 4DUZF 2HMIA 5IS2A 3KUEA 4Q45A 5DM6Q 1NDLA 2QFJA 3V2UC 2HHTA 2VG5B 4LVNP 5LJ5Y 5K20B 2KM8C 4LRBA 2L3MA 1S6QB 4WE1A 4FVMA 4TY8A 4DLEA 3H2UB 4CCHA 1W7WA 2NXJA 4OI6A 5GAHU 3SI8A 2QYCA 1U1KA 1NLKL 5CYQA 4C8MA 3WIUA 2OD4A 4YR2A 5BR8J 2IAJA 2NYHA 2O67A 3P3DA 4Y65A 3OLAA 5ADZA 2V63A 3HF5A 1G2EA 1LW2B 1S6UA 2ZBRA 4M5DA 2OP5A 3C6TB 3EMTA 4ENOA 1NK0A 1CULB 2NSCA 2CA9A 3CSKA 3P8BB 3Q8VA 4NA2A 3JB9k 1KHVA 1UFLA 2B43A 4PWWA 1KQKA 4CLZA 2DRBA 2MHEA 3Q24A 1HMVA 1V3ZA 1WSRA 3L09A 2HHHF 1RACB 3MCMA 2B4OA 1OY6A 2LFVA 2V69A 3CJRA 1QD1A 2FVSA 1WUUA 2HGNA 5L39A 5JUMA 4NLXA 3OVAA 2CVIA 2XZTB 4ITSA 1RLCL 2J7WA 2G2YA 2Q66A 1LFWA 2LEAA 2BKPA 1N5SA 3K7RA 1YZ7A 1NO8A 2BW2A 2GHWA 3C8YA 4RJVA 3UVJA 2JLFA 5DQHA 4JI1F 2R7SA 4KJIA 4DFMA 3I0SB 5HN0A 1T03B 3FK4A 4AD6A 4ZPBA 1BQMB 1FVSA 2HRTA 4WFXA 4M5KA 2DNRA 2N4DA 3GIMA 4ECZA 3PYDA 1E6VB 4FKYA 2ZH9A 2WBMA 3DKDA 4ED1A 2B5JA 1XMOF 4YB1P 2HZVA 3M8PB 3MM6A 4NLTA 5E3PA 2EEYA 5M2PA 3G9CA 3GYNA 1Y11A 5L46A 4QPXA 5KFBA 5HVFA 4C6AA 3MR2A 1Y7PA 2M9KA 3DYAA 2HVZA 1UA1A 2HNDB 4DR3J 2HS3A 3P5BP 4ECXA 3D7SB 4O3RA 2RRBA 2QMUB 1NAQA 2AX1A 2V0NA 5LJ3Y 4JBCA 1PILA 3PR5B 1VQ8S 2WONB 4ZVPB 5D4LA 2PT0A 3BV8A 1VIXA 3VQSA 4ECTA 1CJVA 2MKYA 2VFSA 2YNGB 2E1CA 4IRDA 1TUVA 2R8HA 4C8NA 2K06A 2IAJB 2DK2A 4MKVA 4NLOA 1HNIA 4IOBA 4NA1A 1TAQA 4B3RJ 4AXIA 1MU2B 1WEZA 1XQIA 2PC6A 2C3OA 1T94A 3E01A 3L4BC 2CPXA 1GXLA 4AT1B 2R3VA 1AZSB 2XWXA 3QAEA 1XN9A 2F5GA 2RDIA 4CQ1A 5KFKA 4GKJF 2KZZA 2ZBIA 4B02A 1FERA 4OI1A 4W92B 1SC3B 5IC6B 5D0RA 2DPIA 3G2XA 3W63A 1HWIA 4P7VA 3B8HA 1N56A 2OTJS 2XB2D 3DNCA 1R43A 4OX6A 2VONA 2FTRA 3R27A 1IBKJ 4L72B 4FF4A 1U1OA 1NZ8A 3W9IA 2KT5A 5CYJA 3G87A 3IFEA 1X4GA 3TR5A 2HHUA 4RW9A 1WWHA 4CH0S 4PG8A 2DGTA 1WF1A 2FIUA 3EDQB 4DPOA 5HMZA 4B9UA 1T95A 4LBHA 2DH9A 2GQCA 5KFIA 1K8AT 1CVJA 3W5ZA 2GQ2A 1RUSA 2BE2A 3R7SB 4HL9A 3EZOA 4LUBA 2YNIB 4AE5A 3NRBA 2W2PP 2OFHX 1DAXA 3BM7A 3GIJA 2I0XA 4AXJA 1LK5A 4A4JA 1M5SA 3FVYA 3MUMP 8RUCA 1TKXA 3C3LA 1C4CA 2RUGA 3G6XA 2C3PA 2Z56B 2ZITA 1EETA 1VQYA 3AOCA 3KUGA 5CA5A 4DV6J 3T5JA 1NJZA 3QLHB 3ULHA 3L3CA 3R5AA 1PJ7A 3W2VB 5B0DA 4KHMA 4TU7A 3MCOA 1T3NA 1CG2A 1HWUA 1S1VB 1ROFA 4O4RA 3ZTRA 4WZQA 1LWCB 2J6SA 1U1MA 2B3TB 4J9UE 4NZ6A 3HMJG 3LP2B 1SKSA 1FEEA 1QTNB 4RW8A 2WRMA 2CKWA 4DUYJ 2K2PA 3HVRA 1ELOA 1SQEA 2HVDA 5E3QA 4ZVOB 2A6MA 4F0KA 3QT7A 5B0BA 3CCMS 3BN7A 3ETMA 1RBAA 2CPYA 2P8IA 1XMQJ 4MKYA 1KONA 2LDIA 4LF8F 2DIUA 2GVZA 3MR6A 3TUPA 3OR2A 1GQEA 1MG7A 2Q43A 1YJTA 1BMQB 3BS9A 2F1FA 1EHWA 4MK7A 5THWA 4J9LA 3MMBB 3T1HJ 4IRCA 3PZPA 2MGZA 3IMQJ 1NSQA 4I68A 3KK1A 3MOJB 3N01A 3SDEA 4DL2A 3FEYB 3MEGB 2AJFE 3I87A 1RTHB 2HHSA 4N56A 1RTDB 1K47A 5EWGA 3PTWA 4DR1J 5KFPA 2XHCA 3TA0A 2MQMA 3IR5B 3SSRA 5IM0B 1BQXA 1HBNA 4DR7F 1LWFB 3CE8A 3ZNJ1 2A0FB 3Q22A 2BJ7A 1IR0A 4LRFA 2DKOB 1RKIA 3W60A 1XR5A 1VRQC 2MLYA 1RT1B 5HJYA 1WI6A 4DR3F 3FBBA 1CJUA 2HHXA 1Z1ZA 3OL6A 2VG5A 1IM6A 3CCJS 1HBMB 1AXQA 2B9WA 1NUEA 1UKUA 2BJ8A 3BGLA 2OPPB 4UUWA 4LSNA 4CLUA 1Y10A 3I0SA 4UUXA 3KYLA 4KTQA 2VOOA 2UV8G 5BJRA 2VQEJ 2V9KA 3HVTB 1UCNA 3LW5C 5T41A 1PBAA 2A2DA 4M5LA 5KG3A 3DOLA 4RNMA 4KGKA 2IJNA 2VJUA 2F4VJ 1C0TB 1N52B 4KGXB 3E3XA 1I94J 2QL5B 4DV1J 3H4DA 4DG1A 5HP1A 4WU2A 1MWZA 2DGUA 4ICLB 1RXOB 1WOOA 1T05A 3MFHA 5DG8A 1FRKA 4TYAA 4NEYA 4EUVA 2ZH8A 3SFGA 4HKQA 2MKJA 3BBFA 1U0HB 3IGNA 2WVDA 3JTOA 3JSMB 3NBPA 3NGTA 3UDLA 1NZAA 3LALA 4ZJOA 1YVFA 1U1NA 3MMAA 3G6YA 4BDPA 3NS6A 5FJ4A 2W9CB 3JYTB 1IKVB 1X60A 3EICA 4HLBA 1Q1KA 1SC1B 4J91A 4WTYA 3IO1A 1U0SA 1SCJB 1YX2A 2HVEA 3DRYA 2QRRA 2Q6CA 2RHQB 4ZVSB 3MAAA 5KFWA 2AEJA 4P73A 2MQPA 1HPZB 4WFYA 3CTRA 1UEKA 2DXEA 1ZAVA 3BKFA 3LA0A 4HT7A 4FXDA 3TAPA 2J7KA 3DLGA 2XLJA 3RR8A 1A7GE 2H5EA 2X3GA 3D1HA 1M1GA 3AT1B 5CCMA 4N5SA 1C1CA 2X3DA 3OTBA 1SJ4P 2IM0A 3ENWA 1WC3A 2JNJA 3KK3B 3CB4A 2AF6A 4KH1B 5IC4B 1RA6A 1XR6A 3OTOF 3ITHA 3T5LA 5KT5A 2D74B 4LIRA 2DEJA 1TU0B 2K3IA 4ZITA 3IC1A 5EGYA 4QWCA 1RT1A 3Q8PB 4FXWA 5D8HB 2PMHA 4DPXA 4CLLA 1JKHA 4RO0A 1TK5A 3AJ2A 3GG1A 2BA9A 4A46A 2CJBA 1YBAA 4F67A 4WFNQ 1EB0A 3ZTQA 3MMJA 3JSYA 4ZPCA 1XNRF 4JV0A 3B82A 3JQMA 3G82B 1JLBA 3X1LB 1SV5A 1HQUA 2VG7A 3SSQA 5BXIA 1KTVA 3J81j 3TW0A 1FK9A 1K73T 2DTJA 2B4PA 1KKHA 2E5IA 4D3HA 4DL5A 1DJ0A 5DQGA 1S0NA 2CPFA 3U02A 1IKYA 2ZE2B 1RADB 2QT7A 2G9OA 3N6NA 2BR0A 3UDVA 4ECYA 2MQ8A 3HO1A 2RNEA 1P1TA 2N3LA 5C24A 5J2PB 2LEBA 2PD1A 4FYDA 5C42B 2YX7A 4Z37A 3OR1B 3H5YA 2DNMA 1GMWA 3DFEA 3DXBA 3NS7B 2AEFA 2GIFA 5EWFA 4ELTA 3ETOA 1IJEB 3AOBA 1UA0A 3GCXP 1Y5LB 1NK7A 3FMBA 1X4FA 3BYRA 2AEMA 4A8YA 3OV7A 3AY0A 3N5BA 5F41A 1X9MA 1EIYB 3EYZA 2C2RA 3OW2R 4AQYF 1U47A 5D0GA 1S1WB 4QYZK 4M8LA 5AXNA 1UVKA 4I7FB 2QLJB 4PCQA 4QWEA 3R5GA 4MKAA 2UVVA 4NRTA 1GMVA 2JDJA 3I4HX 4NLVA 4B17A 3GILA 3HVWA 1HHSA 2RQMA 1R8BA 4DPYA 2C42A 4EYIB 1N4LA 1HNWF 5L1KA 4DS4A 4DL7A 2EFPA 1RTJA 3ENAA 4UF4A 1QAIA 4HVZA 3DRPA 2YX1A 1RTDA 1Q53A 4L73A 3SFUA 5J1PA 2BKOA 2BJDA 2GO9A 2U2FA 1ZPWX 3TEHB 3EPIA 1V6HA 1UJ6A 2AP6A 3VTIA 1HQEA 1UL3A 4WP8A 1S0OA 3RB3A 2UV8A 4IG3B 4IFYA 1XERA 2LU1A 1XBWA 2ZD1B 3QFHA 3G82A 3TUIC 1VISA 2R2TA 2AYBA 3QRQA 2BJ1A 2BABA 2W2NP 2W2OP 2XQCA 3BBCA 1KBRA 3HSJA 1L3VA 1HWKA 3DLBA 1H3DA 3CCWA 5C7PA 4ZOSA 2MYFA 5DG7A 4OYZA 2HEKA 5K8NA 3GIIA 1U4BA 2DNKA 4FYWB 4PYDA 2DCLA 3OHAA 4OZ1A 2JJ4D 3NAHA 1FRLA 2GIRA 2W7AA 4QJVA 3MPWA 3V4MA 1NHVA 3KUHA 2FJDB 5KFLA 3ZO7A 2B7CB 2GMHA 5ETRA 2I2YA 3EDRB 5E2QA 3VGTA 3KK1B 4ES3A 1VQPS 4OIXA 3IWXA 4K5SA 4M5HA 5FIIA 1Q79A 2DGWA 4OLPA 3CDBA 4RUBA 3ISND 4K4SA 3ZTOA 3CCSS 4E98A 2IM1A 4P72A 5KT2A 3FSYA 2GHPA 1TV6A 2ZNZA 3DGVA 2VV5A 3JS9A 4TQSA 4NASA 1URNA 1X5SA 3D4JA 2ZH5A 3NCQA 1S12A 4OX8A 1NK4A 2HHHJ 1JJ2R 1NK6A 4IFVB 3HX9A 4OQJA 2P6SA 4RBTA 3GFZA 3VZHA 3JYTA 4DV0F 3F41A 2PFFB 3H5XA 4DX6A 3L9ZA 3Q8SB 1UW4A 4HTIA 3KDOA 4F4XA 1REGX 4X66J 4CLFA 4N41A 3CJSA 3KLIB 2RSQA 5A76A 3B78A 5KAKA 2IC3B 3PJXA 5BR8F 1TL3B 2V5HG 2C22A 1WJ9A 1DQ9A 3FCHA 1YIJS 4C3MA 1KRPA 3CULA 3AD8C 3HHNB 1C0UA 4RW7A 2RHSB 5KFSA 4ZHRB 1NJIT 4WFAQ 2UZAA 1D09B 2V67A 5HP1B 1EZZB 2PE8A 2UVWA 1XR7A 4LFBF 3TRGA 2IY5B 3TX8A 3PEJA 2HQ3A 4DR2J 4UTGA 3CCZA 4MIAA 2OFGX 5K8MA 4DUZJ 2GS8A 2E5LF 5H1SV 4X4TA 2HHWA 3GG0A 3D6HB 4F26A 1FVQA 5DDQC 5B09A 2CQGA 2ZWOA 3C6UA 5IWAF 2H1YA 4IG0B 3PEHA 1TK0A 1LW2A 5KFVA 2VG6B 3QQCD 2RDJA 4EYHB 4ZIWA 2IBOA 1U6BA 2IFXA 1UJ5A 3TARA 1QSSA 1JLBB 4DCPB 4RW4B 3OJSA 3G8QA 4MT1A 3L7OA 2Y1RI 3M8SA 4DL3A 3NS5A 1RP5A 2NYIA 2NLWA 3RAMA 3SMZA 3WIVA 4DV0J 4A8QA 2V8VA 2APOA 4ZLNA 4QIGA 3FZBA 2DPJA 4JI5J 4HDGA 2OEJA 5EHHA 4NRUA 4LF5F 4DR4J 1XMQF 1CSJA 1I94F 1Y3KA 4LT6A 3MMBA 1FFSB 3UW1A 2XC9A 1FD8A 1VRTB 3KG1A 1O6XA 5KFTA 2MGZB 1K0VA 1Q8IA 2M88A 2VQEF 1FXLA 2QA2A 1S5ZA 3FEXB 4S0MA 1ICEB 4OYWA 3ZZ0A 2C2MB 2N4CA 2FGCA 1EKSA 2Y1IA 2PGCA 4LF8J 4X62J 3TUJC 2CNNB 2DCUB 2DHHA 4KYZA 4TU8A 2Y1JA 3QRPA 2M8HA 3R6GB 4KIAA 3V4IB 5A8WB 2GCFA 4OYMA 2VFUA 3QT8A 4RNNA 2RQCA 2ILYA 1BQNA 3MECA 2UXDJ 4ES1A 2BE7D 3CJQA 1FO1A 1IWAA 4LFAJ 2AX0A 2HNDA 2RKIA 4EWTA 1GTHA 2HZAA 4OX9J 1RT5A 1JB0C 2E1MC 4TVAB 3BQ1A 2DY9A 4RW9B 2ATLA 4LRCA 2UUCF 1R0AA 3O44A 1U45A 4FF2A 1G1XA 2I38A 1RHRB 4YP3A 1VQ4S 1NEEA 4WK1A 1N33J 1LOUA 1R8CA 1N5TA 2LYVA 1NK9A 1TUGB 1RT2B 4JI3F 1KN6A 4AYBD 2EC2A 1AROP 2YNIA 1DTQB 2KG0A 3PO5A 3WC0A 3M2RB 3DOLB 4MH8A 1FF2A 2MZJA 3RRKA 5C42A 3CXCR 4F50A 3V6JA 2HVHA 4X62F 2ZHBA 3KLGB 1H38A 2V2QA 1U1RA 3AHPA 3KJVB 4UOHA 1AZSA 3H2VE 5IT0A 3M05A 1SL0A 5E41A 5FD1A 1SJ1A 2AKWB 4DV7J 5DDPC 5L8RC 3I82A 1N34F 1LEOA 2VL1A 3CDWA 5B7WA 2QEXS 1PYOB 1ZM2A 4ID5B 2VJVA 1HD0A 2F9DA 3D5MA 3M8QA 1N6QA 4IOCQ 4PG7A 2DXDA 2LXIA 3GJQB 2BDPA 3I96A 3CC7S 2XMKA 1UVIA 3G96A 1EX8A 3PRDA 1S1TB 1SC6A 2WVBA 3IGVA 4OHXA 1AUDA 1F9HA 1KOHA 5KFUA 3NL0A 4I69A 1N0UA 2O1PA 2IJFA 1CJKB 5GAHI 2CPDA 1WI8A 4QPTA 5ETPA 2AQ4A 1G7CB 1PGZA 3HHEA 2XG8A 5KT6A 4DR4F 1H2UX 2JH3A 2Y8YA 4ATNA 2BX6A 3M4XA 1S6PA 2RRAA 1J5EF 1YTYA 1WF0A 3RBZA 2HK2A 1KVKA 4I6YA 5BYSA 1VK3A 1D0EA 2E5LJ 2LA6A 3BEGB 2CJKA 2PA8D 2XY5A 2FLLA 2RKIB 1FEHA 1KLMB 2HS0A 3FEZA 2J0XA 4ZPWR 4UY85 1E6VA 2YWEA 4WIQA 4WU3A 4DWIA 4RUCA 3W1YC 5AJ3J 4U67Q 1VQKS 2K7JA 2GW8A 1V9OA 5A2QU 1RA7A 3V81B 5T14A 2VC0A 1HNVB 2ZC4A 5DETA 3GR0A 4QWDA 1NKEA 1WDTA 4DSJA 3MWBA 3IM8A 4DSIA 4F4KA 3GJSB 2ROPA 5KT7A 4NZ0A 1B4SA 5KT3A 2YWHA 1IR2A 3HULA 4RNOA 1XMBA 2RQKA 5KOWA 2ZWPA 4ECQA 4K4ZA 3KJVA 2GJIA 2BACA 3EVMA 2A18A 1HQ2A 3NWGA 4UQGA 3OXGA 4C0BA 4CH1A 4CO4A 3A8JA 3AJ1A 3S01A 3VAHA 5B08A 4B9VA 5I3UB 1GH8A 3AA9A 4ZJQA 4AL6A 5LSLA 4NI2A 2RS8A 3AODA 1NK8A 1C0TA 3ZXWA 4WKYA 1FJ7A 1IBMJ 2CAJA 2YKAA 3MEEA 2EXUA 3WBZA 2OEMA 4M1KA 3CEDA 4QIWD 3DHXA 2GIQA 3SCIE 1SH0A 4I67A 1NHUA 3BH7B 3V6DB 3R2DJ 1U7LA 1S79A 3ZC4A 3EVWA 4ZN1A 1X9WA 1N5VA 3QATA 4O0NA 4DJBA 2V50A 3NCPA 1SJQA 1I1GA 1D8YA 2C2KB 5EX3A 2F65A 5ETTA 2ZBPA 5B0EA 2V94A 1SL1A 3BR8A 1TKTB 2C1EB 2KRBA 3G4SS 4DN0A 1G6BA 2ZDPA 2OKQA 4J9VA 3T1AA 1UFWA 2HQFA 3K5PA 2V8PA 4U96A 3ZTSA 1ZTWA 4Y2KA 2B9YA 2DH8A 4G1QA 5AE2A 4DQRA 3LGHA 4Y34A 4M63A 2VOPA 2Y3YA 3ICLA 2VH7A 1RTJB 2IBKA 3A3NB 4WYWA 3M9OB 1R7IA 1VS3A 5E3RA 3DLLQ 2D9PA 3DOKA 1WORA 2PMZD 4PWDA 3BGOP 1P27B 3GWCA 4CO0A 4PUOB 1K1QA 3DLKA 6FD1A 2ACMA 4IG3A 1ZAWA 4Y0FA 1TAUA 5B0GA 5IXUA 1X0FA 2DJWA 2R8JA 3HPOA 1RWVB 3BSOA 4YB6A 1N34J 5H9FK 2HMIB 4LBIA 4Y6IA 2ASLA 4CO2A 3KLEB 1I6JA 1CQMA 4EBEA 2RJZA 5C25A 2CPZA 1WHWA 2Z2ZA 3DU5A 4USIA 3W2WA 4R0EA 2B8PA 3MM8B 1OY9A 2PIIA 2W9CA 2EFNA 3P6YC 5L1LA 1D9AA 1RT2A 6AT1B 3US5A 2MTLA 1FD2A 4ID8A 2XULA 3FCWA 3NY0A 4GMKA 3UDEA 4YQWA 4ED0A 1APSA 2GC8A 4TY9A 1P9YA 5DS7A 4CLYA 4NX9A 3CDEA 5J2MB 2W25A 3GSDA 4C8ZA 3NGKA 3TEGA 3HP6A 1KQGB 2JRSA 4M5GA 1VBXA 5IT9U 2B8QA 1CS4B 3QT5A 2FVCA 4BC9A 3MR3A 3GV5B 4IOAQ 2KFZA 4ED2A 3JTPA 4GKJJ 3FRYA 4NYZA 4UZBA 1L3UA 5HVHA 4NL5A 2A10A 3T1YJ 2FLPA 4MFBA 4TNOA 2ZVIA 1ZH5A 4KV8B 3KHGA 5D3GB 2R7WA 4ETZA 1B7FA 4IFVA 4CO5A 4PG6A 5E5NA 1S76D 4QW9A 1IKXA 1MMLA 4JB8B 5J1NA 3CD0A 5GADI 4NWBA 2VQFJ 2H4YB 3THTA 1X4DA 2F8MA 2AJ0A 2HQCA 3W62A 1JXLA 3HHKA 3MPVA 1KLNA 4UOGA 2YPYA 5BYRA 2IA0A 2AJ1A 3I9ZA 4N8OA 4QIEA 3NMRA 1NPPA 3BYPA 3LP1A 3N6LA 2MQQA 3QT6A 5IT9Y 3K17A 4LF5J 4EZ6A 2FHOB 5AE3A 3TAMB 5HATA 3IN5A 1VQ5S 4QZVB 5JMNA 2QLXA 3DI6A 4X64F 2EFQA 1JNRB 2W8KA 1TL7B 2BM0A 2FJVA 1AA1B 1B7YB 1LW0A 1U26A 1T8EA 2VA2A 3C6UB 1MN7A 2PI4A 4UQTA 5G4DA 5I4MA 4A8WA 4O44B 3ET6A 3KFWX 2ALYB 3QWPA 2VG6A 1DARA 2XYPB 2AD9A 1U1QA 4A8FA 1XNQJ 2ZVSA 2NR0A 4JI2J 2DNYA 2DO0A 4QQBA 2KVQE 2FJBB 1T9WA 2JVOA 5EUHA 1YJVA 3H25A 3RTVA 3QJLA 2J6TA 4X65F 4ZCLA 1OJ4A 3EGNA 1IXKA 4WIIA 3A8IA 4DZ6A 2AJ4A 4I7FA 1PYTA 5DLFA 4JI5F 3IR7B 1FI4A 3ZZTA 4C7QA 3Q23A 2HNZB 5HMXA 1WC1A 3GYXB 4ZDNA 2XMVA 1FRJA 1R0BG 4OMFG 2HBZB 4ANCA 3N28A 4FYYB 4U7UK 2EWHA 5HROA 2OELA 3H98A 3SQOP 2JZ5A 4ECSA 2HZCA 4URGA 1FJEB 2J0SD 2YBVA 1FE4A 4OHZA 1ZPVA 3ILJA 1HR0J 4ES2A 1FWKA 3AXMA 4DS5A 3M7VA 5GMEA 4ILMA 4J5OA 3MM5B 3H5SA 1IN0A 1RT4A 1GAOA 3IS9A 4KT0C 4MAKA 1GFWB 2LQ5A 4Y2CA 1VOMA 1RHJB 5A8RB 1B64A 1OQ6A 1TL1A 1Q81T 2EG1A 1LK7A 1NB2A 2W2MP 2BMBA 3D67A 3MR7A 4OJGA 3TAMA 4DF8A 2FLOA 2YKPA 1WG4A 4YMEA 1YWXA 1VGYA 5DDRC 4JI7F 1UVJA 2ZEJA 1A0OB 4XDDA 1QAYA 3LPEA 2YWKA 4WYLA 1EETB 1Y5IB 1XNQF 4PPDA 3ZZZA 5A0YB 3OHBA 1SV5B 3PX4A 3DOKB 4GKKJ 3FDSA 2G1HA 4ILRA 4K4WA 1UP1A 1ZAXA 3IWLA 3RRGA 2G4BA 1NDCA 3A12A 4F36A 3LP0A 4FYXB 2HFSA 4IH6A 2Z30B 2DR9A 2AT1B 3RAQA 2DNZA 3SDEB 1N33F 4KKOB 1FHTA 1S49A 4ANEA 2AGQA 1N32F 3QIDA 1WC5A 2V8HA 3MM7A 4QR1A 4ZVQB 2FDNA 3FCVA 2MZ1A 1UZDA 3KK2A 3W2WB 4J9SA 4F2RA 1V3RA 1YRUA 4W4MA 1JJCB 2RT3A 2NQPA 4RW6B 3OR2B 2ASDA 4FF1A 2HHQA 5CD4H 1X0PA 3T1HF 1FDBA 5KFRA 4P7TA 2ILZA 1XC9A 2MHNA 1FXRA 1N54B 2W8LA 3MEGA 3G71S 4J9NA 2GVDA 2QZ8A 2XSFA 3UNGC 2YH1A 4LF4F 1N0VC 3VCDA 2VQFF 2W7PA 5FDLA 3FSIA 5HLFB 2LKZA 1B3TA 1FFGB 3KDNA 4TKTA 4R8UA 2V4JA 4HHJA 4N77A 4UW2A 1OS5A 2VBYA 3KTQA 1CLFA 3J7AN 3CJ2A 3M30B 1YJNS 3M8PA 3MM6B 1C1BA 1MMDA 2OO4A 5LOQA 4JI0J 4PQUB 2HIQA 2ZH2A 4C9DA 2KYZA 3T19A 4DQQA 5A8RA 5LL6d 5T7LA 2QG9B 3OD2A 5I42A 4USUA 4KHRA 3RRHA 3I4PA 1K44A 3CDUA 3R97A 2RQ4A 1LNQA 1R8HA 2JWNA 3LAKA 2UVRA 3CJTA 1FNOA 5G0RB 2DGQA 4EK2A 2G1DA 2VASA 4CM0A 3HHDA 4XPEA 4OZ3A 1HHTP 1WSVA 4X2BA 2DO4A 1EQ0A 5GMDA 3FZ2A 5FLXU 1FTCA 3QGPA 4KFBA 4NLQA 3DLEB 1MU2A 4OV1A 1FDAA 2BJEA 2Y1LB 3RU0A 1WEXA 2VFVA 4K4XA 2MQNA 5I3UA 2OPSA 3BSNA 3HJFA 1IKWB 2CJAA 3LTOA 2IJRA 3DMJA 3RJMB 5J1EA 1Y00A 3IRXB 4GVBB 4NCAA 4OYOA 2IVFB 2DXFA 2X1GA 2WOMB 3A3PB 3L7PA 2NXEA 2QL7B 2BQRA 1NU4A 3IAM9 2RS2A 4ELUA 1HWJA 4PRFA 2PO4A 2WW8A 3PX0A 1FDNA 1X4BA 1DQ8A 2RIJA 3W64A 3IAS9 4ZLPA 4F4YA 3DU6A 4B3TF 4AQYJ 3W3SA 1L5UA 3NG8A 2ZBQA 2UU9F 3QO9B 1HMVB 1TKTA 2AWZA 2CPEA 2FC8A 5K9FA 3M9NB 1BY9A 3C2PA 4JI6J 2NUHA 1UWBB 2JC0A 4NLDA 3N0VA 2CQ4A 1RWWB 4RBVA 5KFEA 2OUGA 3H7HB 8ATCB 1G3OA 3UCZP 4G1QB 3CJKA 4RL1A 2FVPA 2BJ3A 1F1BB 3CO9A 2XCPA 2VIHA 5L1JA 1SC4B 2NPIA 3HHLC 5LMUJ 1VQ6S 1TKXB 3D0IE 2O5DA 4OZ2A 5F8MA 4AL7A 4MK8A 4J9PA 4URSA 3CCQS 2DB1A 2CZVC 2QL9B 4DZDA 1FKAF 1T9YA 1EP4A 2DR7A 1HWLA 2MSSA 3KOAA 1FKPB 2DGOA 1JLEB 2FHJD 2G13A 2YX4A 5K14B 4BWMA 4Q44A 3SCJE 5LMNF 1W26A 2Q1LA 3U27A 3PW7A 1YI2S 3IS9B 2CQIA 3BJYA 5CXTA 2L08A 5EN1A 2D7SA 5GAEI 4PPZA 3PKYA 5D4NA 3MD3A 1R8PA 4LQ9A 5C25B 3B6BA 3D6MB 3ILLA 2Z4PA 1S1XA 4IYQA 1RDRA 1VLOA 5IOLA 2VB6A 3MM8A 3V81A 4Q0BB 2OPPA 4NPOA 5LMNJ 2Z2MA 4ECWA 2V2KA 3Q8UA 5D0EA 2FZCB 2I8EA 4E0DA 1TK8A 2YNFB 1GMUA 3JQKA 3AAWB 4JI1J 3D3CJ 5E0OA 1U8WA 3BO3A 1REVB 2XGQA 3PJ9A 1OSDA 3QGHA 1WD6A 3UD3P 2LA4A 2RMLA 3DRXA 1EQMA 1GK8A 1PAEX 2MLZA 1JLCA 2P9EA 3CCUS 4GC6A 1M5KC 2B51A 1S6PB 1TQLA 3E2EA 2YNHB 4IDKB 4K59A 4U7CA 3J7A1 2HFZA 1UWBA 2JLGA 2C28A 4RPFA 2EW9A 4L3NA 4MTPA 4YHHF 3RB4A 4IH7A 5F3ZA 2QJ3A 3VZIA 3EGVA 5L9NA 4B9TA 4DR1F 3KHLA 3K5OA 4HI2A 3VAKA 2R7QA 3UDCA 2V9WA 1CEZA 4F0HA 2WSCC 3I9V9 3GCWP 3TYTA 2OTLS 5A8WA 2GAHC 4ECVA 3PHTA 4I6AA 4MYTA 4PKDB 4EO6A 4RUAA 2G0CA 1NJXA 4FPIA 3SSSA 4CT9A 3A8EA 5ETMA 4DBQA 3KLFB 1W2BR 1SKRA 2J9DA 2CNOB 2HBYB 4LMZA 3HFKA 4CNZA 1T3OA 3FSXA 2RH3A 4TY8B 3TX0A 4GC7A 2HPUA 5F0WA 3VGVA 3SCKE 5JVGQ 2H51B 4LVOP 3CNQP 3TAQA 2VFTA 3DHWC 2BVZA 4Y3CA 3DGPA 3M8RA 1DTQA 2QLWA 2BYCA 2SXLA 4QCLA 4CYUB 1RK8A 3R7BB 4FN5A 2MKIA 2AGOA 1QVGR 3CO0P 2XYGB 4ZPVR 5G0RA 1HW8A 1PAUB 1RWUA 3MHYA 1HNWJ 3R2CJ 1JJ4A 3TANA 2KJWA 2L9WA 2UUTA 1JMTA 4P2XA 1EAYC 2IYGA 3EVOA 3QNWB 4KBIA 3MEDB 2A3JA 4WP3A 6FDRA 3RB6A 1KDNA 5J2NB 4ED7A 3CD5A 3C46A 3HHLB 3B4DA 3VAJA 2FGOA 1JWWA 4YY3F 1NK5A 1R89A 2ZJPQ 2VA3A 1S1UB 2JLEA 5KFZA 4TQRA 3WZ0A 3EM1A 3T3FA 2ZH1A 4JI0F 1VQLS 1TV6B 3D0GE 3MDFA 1NJYA 4ZPDA 2OHDA 2L9DA 3I32A 1QE1A 1RAJA 2KHCA 3U7JA 3HM9A 4F02A 1QUPA 1SJRA 4GO7X 1L3TA 3KLHA 2EI5A 1DLOB 2J8AA 1RE1B 4C98A 2VKRA 2DEIA 3DC2A 5C5JA 4XDCA 4DOZA 3SXLA 3OJUA 2WCXA 3GV8B 3OL7A 5HVGA 3FC9A 4CRJA 4J9KA 3BKTA 5IM0A 1RWMB 2WW4A 4CP5A 3QJPA 2IC3A 3W8PA 2UUAJ 4DV6F 5CCLA 1VQOS 1RTZA 2CZ4A 4WXOA 1F5CA 3KLVA 1S59A 3DYAB 1U8SA 4LBPA 2CXEA 2EK1A 3R1HA 1O8BA 1U24A 2DNHA 4CLPA 2YQ3A 4LF6F 4CLSA 4KFBB 3D6FB 1VQNS 1WOPA 2YNGA 2LCWA 1F9FA 2IVYA 1FNMA 1YBTA 2DYAA 9RUBA 4ZVUB 2RVJA 2N3OA 3ILIA 1NHKL 5DGBA 4M95A 3P49B 5I3QA 1HD1A 3IRXA 2XS2A 3LP0B 4DFKA 1S6QA 2V34A 3HXMA 5B0CA 4C4WA 2YWWA 5LM7E 3EX7B 2CPIA 2OPQA 2U1AA 3MPUB 3WQPA 3O1LA 1HI0P 1SXLA 2B4VA 3FMWA 1RBLA 1W2IA 4KKOA 5EDWA 1HARA 3BDPA 4PAAA 4DR2F 1L3KA 4NLRA 1F9EB 5HMYA 4TLQA 7AT1B 5ETSA 1FX4A 1S1WA 2NZCA 3CIZA 2CZ9A 4W98A 1K9MT 2FB0A 2ERRA 1WC0A 3H0PA 3H4BA 3OTEA 1LKZA 5HQ8A 4DFPA 1LXJA 2Q6BA 4C3KA 3PIPQ 4M5JA 1X7VA 2VFRA 4KGVB 4K0KJ 3MAAB 3M8ZA 2RDDA 1MSWD 3IRWP 2NUUG 2QYGA 3EJMA 1DTTB 3F44A 3HZGA 1UTAA 3JSBA 3MI7X 4J90A 1LQ9A 4CM2A 4DCJB 4F04B 2JEGA 4QBUA 3N6MA 4NLYA 4IR9A 4X4VA 3BQ0A 2V4JB 3AD7C 4DX8H 1RAFB 1V5VA 2MZQA 4IH5A 4X64J 4PQUA 3M30A 4XIUA 2KTQA 4H4KC 1BQNB 2C2NA 4FDFA 1PCAA 3ZZOA 4X4QA 1VLYA 3SBMA 3MM9B 1S9FA 4Z7CA 2B6AB 4RNHA 4DV1F 3F56A 2YKMA 2M2BA 2VDHA 5LSOA 3G8SA 4OX7A 1LW0B 1SJFA 3HKWA 2UVUA 2KZMA 4U8VA 2XCAA 4RU9A 1SJ3P 4FF3A 3C15A 2MZSA 3FBEA 3TVKA 5KFCA 1HBNB 3MD1A 1TUWA 1E6YA 3HT0A 4IO1A 4OHYA 4OHWA 3T5HA 2OJ3A 2AW0A 1HQUB 2VG7B 3ADAC 3D54A 4OYIA 1H7WA 4EEYA 2QV6A 3MGJA 1Z2LA 1CJUB 3ZZUA 1KC8T 2DITA 1NSPA 2JOQA 3MPDA 4KH0B 1N8RT 2QC3A 2ZKTA 2WK4A 3O2IA 5AXLA 4CLKA 2YQ1A 3PFEA 3BGRA 3F0NA 5ETOA 5IV4A 4DR7J 1JK9B 1ZBTA 2XEXA 4F25A 1HLWA 5CHCB 3J80U 1U02A 1JNZB 5J1EB 2WOMA 2GFFA 3GQCA 3CWJA 3S8SA 4CZCA 3FRZA 1S72S 2QSWA 4KQZA 4ED4A 2BQ3A 3IG1B 1S9EB 2CG8A 4F4ZA 4YB7A 4A8KA 2POKA 3D0HE 2MXYA 4ED6A 2J0WA 2XS5A 3KJFB 4PXCA 3OLBA 3IA0A 1NJWA 2DHAA 4KV8A 5D3GA 1WG5A 3CJ3A 2DIVA 2G2ZA 2KXFA 3AJDA 2OMLA 4DSLA 3QBCA 1TKDA 2M0GB 1BLUA 3O3LA 1M1HA 1PJ6A 1YGYA 2NXUA 3CPWR 4OJ3A 3J7ZT 2FJXA 2OIHA 3FJ2A 3CJKB 1Y5NB 4TXSA 5D4PA 2KH9A 2D3OR 2OPRA 1LWEB 1D9FA 1FWPA 4I2QA 4LQ3A 4NCGA 1QLNA 4PWDB 3R9LA 1MWYA 4LF7F 5KG1A 1AUSL 3ZNUA 1FRMA 2Q3PA 4HACB 4TN2A 2RF2B 3TO8A 3BO2A 1NSAA 2HAIA 1G4CA 1X31C 2DBBA 4KGZB 4CYUA 1JLEA 5KFNA 1KQSR 4B3OB 2HWHA 3PRVA 4AL5A 1T05B 2YPZA 2GGPB 2K8GA 2IHR1 5HQLA 2RILA 4I2PA 1FKOA 1VRUB 3QZ8A 2IRXA 2H5JB 3H20A 3Q8QB 5DM7Q 3QMQA 2J6UA 1PJ5A 1RWPB 4KPCA 4L74A 1TL5A 4C11B 5HMWA 5IZHA 3O6QA 4QU6A 2AJQA 4G1PA 1YJWS 2AIRB 5CYQB 4NLUA 4C2MA 2FZGB 1XNRJ 5BYQA 3KNAA 2LECA 3RAXA 2E9RX 3IXQA 2M70A 4H4KA 2YWGA 1IQZA 4EFAC 3LGMA 4ETXA 3FFIB 3V5RA 1IBMF 3D1QA 1QTMA 3FQLA 4BC7A 2M4MA 1T9VA 1NPKA 1XJWB 2H54B 4Q8FA 4H4OB 3TZZA 2GJFA 4HTJA 1U49A 1KWMA 4ILLA 1Q0NA 3UWTA 1V3SA 3DMJB 5DQIA 2CFXA 4NMLA 3J7Z5 2V4QA 3RYLA 2MZTA 5IT4A 2VZ9A 4K4TA 1N6QB 4B3RF 3AB4B 3LQVA 2VHGA 3HKZD 1RTHA 2G0JA 4USMA 4DR5J 3V6HA 4EBCA 2KFNA 1P1LA 1GXTA 5ETKA 2M7SA 5C2GA 5GAGI 3D2WA 2ZH7A 3NMAA 1RSCA 3ISNC 3PR4A 1XIQA 3EZ5A 2HBQB 1Q5YA 3IR6B 1LWFA 2DNPA 2QFIA 3UR0A 1U2RA 2KU7A 1DTTA 5U47A 2N82B 1VC6A 1BQMA 1TTHB 2EK6A 1XEZA 1WACA 3ILOA 3QIPA 4HACA 4WBFA 5DZ7A 3J81Y 3ENQA 4FS1A 4ZHRA 3KKFA 2WBRA 2BQUA 3M2VB 3NKYA 1M0SA 3I5AA 4DI6A 2DISA 1X4AA 2HW3A 1J2VA 3G86A 4ZVEA 4I2PB 2ASJA 4BS2A 2PN6A 4LSNB 4URQU 5JXSA 4ZP6A 4OYXA 4J9MA 4DL4A 5KFXA 2CYYA 3D66A 1FCAA 4L76A 2A6OA 4CNYA 3ZTPA 4DXLA 4P71A 4Z7YA 2KYXA 1TVRA 2YKNA 4DG1B 4LF9J 2Y0SD 7FDRA 3R5BA 4E8UA 5J2QA 1M5OC 4G1IA 2QA1A 3FBCA 5B0AA 1Q95G 2E66A 2MQOA 4DMZA 2VUGA 3VVUA 5J2NA 4LF2A 2YQ0A 4K8RA 3DRRB 3NBPB 4YR0A 5KFMA 2O3DA 1X5TA 2C3UA 1BE4A 3UE2A 2OSQA 3L95X 2HRUA 5KG0A 1VRTA 4DL0C 2FVRA 1TKZB 1XWLA 2JL9A 3TQEA 2BANB 2CVEA 2PEHA 4DPTA 5D6GA 2R7UA 3SQGA 1U2FA 2H3EB 3GIRA 1PYSB 4BBYA 3C6TA 3PY8A 1RWKB 3V6KA 1H0HB 3R7NB 3DRPB 3HD1A 2ROEA 4JP8A 2KL8A 5GADU 2O66A 2W01A 3EE3A 2R8IA 1KLMA 4R5PB 5AXKA 1HNXJ 1FTRA 4XAKA 2COLA 3V4IA 1H74A 2YNHA 4IDKA 3OFHA 1ZA1B 2LQ9A 2HSEB 2IDLA 2DNQA 5L9XA 2X7IA 1NBEB 2HFVA 3LP1B 4AFFA 3WX4A 4DFJA 1T9TA 2PEBA 2UUAF 2GHVC 2ABYA 3FKBA 2EFOA 4B3MF 3P96A 4Q2MA 5F8IA 4O23A 1GTEA 3BN4A 2ADCA 5CQGA 4NLSA 4GO5X 2WZ1A 3KXDA 1S0VA 4DUYF 2DRDA 4JI2F 3TOQA 1U6FA 2LEPA 2H4WB 2DGVA 3AOAA 3CJ8A 2EKNA 2MLXA 1HBUA 5HO4A 1T03A
chains in the Genus database with same CATH topology
2B7BB 4DSEA 1VC0A 1JIHA 1SI9A 3KNGA 3VR1A 4UY8T 4YDXA 3VAIA 3OUYB 4DR6F 3M2RA 3DOMA 3BSCA 2Z8QA 3MEEB 3OQ2A 5GAGU 3CGIA 4FNIA 5CYMB 2R7VA 1UETA 1RYSA 4Q43A 2HYIB 2EFGA 3TVYA 1HI8A 5F8NA 5H9EJ 2QA4G 2ACYA 2NS1B 3R5CA 1RTIB 4K5RA 1PC4A 3EZUA 2GJ2A 3K58A 4LFAF 5CZXA 1KOOA 2XMUA 2MJNA 1RI7A 2YTCA 4DQIA 2EBEA 3ONQA 1R27B 2E5JA 4IKAA 3VAMA 1ZYQA 4N76A 2ZZNA 3HLUA 3I5CA 2VBWA 3MEDA 1HW9A 2GQQA 2CQDA 1GX6A 3BF4A 1F5AA 3IBWA 3DDKA 4G6VB 4MYUA 4WZMA 1IBLF 1BC6A 1AFIA 4F8RA 4R5PA 4D3GA 3R5DA 1SL2A 3DRSA 4NLGA 1RT7B 3M6WA 3MMCA 1S4FA 4HH0A 1YJ9S 2LQJA 1URRA 3TNVA 2VPZB 2X51A 2JEFA 2XI3A 1CC7A 3NNAA 3O8WA 4A47A 3CC2S 4FS2A 3G8TA 2FJWA 4ZS6A 4DV4F 3KLEA 2AGPA 4OZLA 1VFJA 3PW2A 2HVIA 4MMOA 3GMGA 4MK9A 3CCVS 4IFYB 4DF4A 3J7YU 4USJC 1Y0HA 5A0YA 3T9NA 4XPCA 2CJ9A 4ZVHA 5KFHA 2IVMA 2HQIA 4JV2A 2I1RA 1GT8A 1HNIB 4PXBA 2DH7A 1R0AB 4OI2A 1OSCA 3GB0A 1K1SA 1GNKA 2FHKA 3N5FA 4EO8A 3KHHA 3CCLS 3PW0A 4OJ1A 4FP9A 4ERDA 2GO8A 2P6TA 3LWMA 1X5PA 2CJQA 4X4UA 4USHA 2QSFA 1IBKF 3HHLD 5KFJA 3GFHA 2RE1A 1N5YB 3M9MB 1REVA 1TVRB 1UVLA 3KLGA 1LWCA 1RJJA 3PO4A 3KMSA 3LP2A 2XMWA 4NYPA 4O4GA 3BREA 4CH7A 2C2EA 1TFWA 1S77D 4DN9A 1OO0B 2AV5A 5GVQA 3UD4P 4DHVA 2UXBF 3ENVA 3Q8RB 1M90T 4LIWA 1M5VC 3MECB 2HGMA 4BWJA 1HYSA 2X1AA 2MKCA 2JEIA 4Y2MA 3BGFA 1QY7A 3H2LA 1YRXA 1S7HA 4Q2LA 1S97A 3MAQA 5MLCV 3EGZA 1P6TA 3UCUP 3BDEA 4I56A 4V19J 2XMJA 2IM3A 3VWSA 2ZZMA 1TL3A 2MKHA 5IFMA 2L48A 4QR2A 4OX9F 2MDAA 2HWTA 3OXFA 1UAWA 3M32B 4HDHA 1FESA 1T7PA 3G6ES 3EGWB 1QM9A 2J76E 3OFEA 3EXCX 3X3UA 1OPZA 3MTJA 1A9NB 1FRXA 1S9GA 3OFGA 1JJHA 3UI3A 1VBYA 4C8LA 1WNEA 2E7XA 4QOTA 2R2SA 3N79A 4O3OA 1FNXH 2WONA 4QW8A 3THPA 1VQ7S 4HH1A 2EG2A 1R6YA 3M8QB 3MXHP 4F4WA 2KN4A 3GFXA 1QSLA 5LXRA 1SB6A 3UFCX 3K57A 4TU9A 5K8PA 2R7OA 3FFIA 2DR8A 4C8KA 3BZQA 4C0HA 4Y00A 2VPWB 2ASYA 4H4MA 3U1LA 3DLJA 2YY3A 3J7YI 3PX6A 4DV2F 3ZFVA 4L6V3 5KFDA 4OI3A 2QMXA 2R2RA 2V8GA 2B6AA 2R7TA 4QWBA 3BB5A 3K8WA 1IKVA 2IYIA 4JYAF 3OVSA 1HBOA 5DRKA 5HBMA 1FJCA 3VAFA 4R0JA 2GA7A 2CQ3A 4I1TA 4DPOA 2MZRA 1FRIA 5L1IA 5D4OA 4PXEA 5K5MA 1HNVA 4WXWA