2DYAA

Crystal structure of complex between adenine nucleotide and nucleoside diphosphate kinase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
154
structure length
154
Chain Sequence
SETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of complex between Adenine nucleotide and nucleoside diphosphate kinase
rcsb
source organism Pyrococcus horikoshii
total genus 50
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2dyaA00
3ZTSA 3BBCA 3G2XA 1XIQA 4KPCA 1HLWA 3FC9A 3FBFA 4DZ6A 4S0MA 1S59A 1NB2A 1BHNA 3FKBA 2AZ3A 3ETMA 4ENOA 5CABA 3WX8A 4F4AA 1XQIA 3Q8YA 4F36A 1NSQA 1JXVA 4ANCA 3FBBA 1HIYA 3ENAA 2DY9A 2BEFA 1KDNA 1NPKA 1NLKL 1NDLA 1S5ZA 5CAAA 1NDCA 3MPDA 3GPAA 4HR2A 3VVUA 3DKDA 2CWKA 1LWXA 3NGSA 3VGVA 2NCKL 4W98A 4UOGA 5IOLA 3L7UA 2AZ1A 3EVMA 1ZS6A 2B8QA 1BE4A 1NDPA 1WKJA 1NDKA 3DDIA 2HVEA 3EJMA 3FBCA 3ZTQA 1U8WA 2DXEA 3VGSA 3BBBA 1NCLA 1WKKA 2BX6A 3Q89A 3ZTPA 3Q8UA 3VGUA 1NSKL 3ELHA 3VGTA 4ANDA 3R9LA 3FBEA 4UOHA 2B8PA 3Q86A 2DXDA 1LEOA 1BUXA 3PRVA 1UCNA 2DYAA 3FCWA 4ANEA 3Q83A 3EVOA 1NHKL 3BH7B 4FKYA 3BBFA 3B54A 1NSPA 4UOFA 1PKUA 1K44A 3JS9A 4O0NA 4WBFA 2VU5A 5C7PA 2ZUAA 1WKLA 3GP9A 3EVWA 3B6BA 3BH6B 3ZTOA 1MN7A 1VYAA 1MN9A 1EHWA 1S57A 3ZTRA 4EK2A 3EMTA 4C6AA 3VVTA 3NGUA 1B4SA 1W7WA 4FKXA 1NUEA 1F3FA 3Q8VA 2HURA 1PAEX 3NGRA 4CP5A 2HVDA 3PJ9A 3EE3A 5BXIA 3FCVA 4DUTA 1HHQA 1B99A 2DXFA 3EICA 4DI6A 1F6TA 3NGTA 3EM1A
chains in the Genus database with same CATH superfamily
4I2QA 1QVFR 1IJFB 2UXBF 4X4VA 1WC4A 3TRGA 1GMVA 4ECWA 3HLUA 5LMUJ 1PJ5A 4NXNJ 4O3SA 1TMJA 4NPOA 1VQ7S 3TA2A 3VVUA 2K3IA 3VGVA 1X9SA 4B3TF 3SQGA 4WYWA 4OFZA 1SH2A 2MJNA 2FVSA 5I42B 4LRBA 3KDOA 1EX8A 4JV1A 3TUJC 1HNWF 3KNAA 5KFPA 1S9EB 2HAFA 3DLEB 1I51B 1RWVB 3NY0A 1RT6A 3M30B 5L1IA 1S6PA 4WZMA 1SKWA 1HWUA 1RHMB 3HHDA 1KD1T 2NPIA 5KG0A 1WKLA 1NJZA 4LJMA 1GAOA 2GHVC 2RF2B 1KOOA 1PYOB 3BGLA 2QLWA 4X2BA 3DRYA 1JNRB 5A0YA 3RR7A 2LDIA 4M5DA 1HHTP 1PILA 2QLBB 2B43A 1K0TA 4LF6F 2HEKA 2YKNB 2VH7A 2CG4A 1T94A 4DXLA 2HBYB 2R8JA 4C3LA 3C3LA 4LVOP 1FNOA 2V34A 3OHAA 2CJAA 3JSMA 2UZAA 4LBPA 4JV5F 3RJMB 2ROPA 2KVIA 3QZ7A 4PWUA 4DV5F 3R8YA 4TQRA 2OUGA 2QA4S 1Q81T 1HNVA 3G82A 2RT3A 3JSBA 3NCPA 1AROP 1FE4A 4O4GB 4FNIA 2QZ8A 1IQTA 3O2IA 1TKZA 4JP8A 1RA7A 5DQIA 5GMDA 3OSNA 1R0CB 3P6YC 3JSRA 4HI1A 3H5UA 3ETOA 5EWEA 1DTQB 2ASDA 4P7VA 4A8YA 1F5AA 2HQGA 3JXOA 5ETLA 4GRSA 2IJRA 2V8GA 4URSA 4URQU 1U0SA 3AOCA 2VA2A 2LA4A 3KUGA 3M8RA 4FXVA 4JOUA 2M7SA 3K58A 4U8YA 1XMOJ 2ZE2B 4F3OA 1DLOB 2KFNA 1HNWJ 2CQPA 2NXUA 3TI0A 4L3KA 1VFJA 3I55S 4NRUA 3OFFA 3PKMA 3HF5A 2QV6A 4H54A 1FRJA 4XDCA 3GJRB 2F7VA 3QT6A 2KXFA 4NWBA 1QAYA 1RWXB 3LW5C 1C1BB 1TV6B 4P2SA 3CXCR 4E8UA 2I1RA 3G86A 1DAXA 2I2YA 1RAHB 1X7VA 1J27A 2HZAA 3CW2C 5IXUA 3IWXA 1GK8A 4J9VA 3HKWA 3G6XA 4RW4A 4LF6J 3VGUA 1GXUA 3EPGA 2XHCA 2QL9B 1BY9A 1RI7A 1L3KA 1JLGA 4PXBA 1WG5A 1RK8A 3G8SA 4X4PA 2FLPA 1P9QC 3HMJG 2HHUA 4NA3A 4E2FB 1V3ZA 5KFEA 1WHYA 4FKXA 6FD1A 1F3FA 2ZD1B 4DCPB 4RWWA 2UXDF 2KT3A 2BE2A 3UFCX 4L75A 1JNZB 2ZWOA 1T3NA 4J9MA 1WC0A 4XAKA 2FVRA 2IAJB 1Y7PA 3AXMA 1R0AB 2H3EB 1ZH5A 1BHNA 1N5TA 2JLFA 3IGVA 1ITPA 2Y8WA 2OJ3A 2QFIA 3BSAA 2UV8A 1S1WB 3GQCA 4NLYA 3HK2A 5F8HA 2WW4A 3QRQA 4CO2A 2VFRA 4C8KA 3EVMA 4M5JA 2CZ4A 5HP1B 4ZJOA 4ICLB 2F4VJ 2OFHX 2CJYB 4Y28C 1WDDA 2N7YA 5SUHA 1DTTA 4RX6A 2ZOGA 2WVCA 4B9VA 2K8GA 4FKYA 3T1HF 1NBEB 3GMGA 3PJXA 4C4WA 2XLKA 1PJ7A 1JLAA 3TR5A 5I4MA 2M9KA 4KPYA 4AL5A 1BQNB 2B51A 3BO2A 5F9NA 1QSYA 3OTOF 1NK7A 2DNHA 3TJ8A 4DV4J 2G13A 5LM7E 5LJ3Y 3X1LB 1C4AA 3KLHB 4NLPA 3EDQB 3MR6A 3N4WA 2FHKA 5H1SV 2HGLA 3PR4A 4QIWD 2VG7A 4IRCA 2CNLB 4PPZA 1RADB 4CO5A 4OYBA 4Y2MA 2YH1A 1SQEA 3DGPA 3GLJA 2C2NA 1DQ8A 2AX0A 1TFWA 1NLKL 2W9CA 2APOA 1S5ZA 4MK8A 1VQKS 2GIFA 2RMLA 3AFGA 2GX8A 4USUA 2IBKA 4PRFA 2HK2A 3FSXA 4YB1P 1IWGA 2WHOA 1SJQA 2HMIB 1VR6A 1U6ZA 4OYPA 3RTVA 4CO3A 4DR3J 1K8AT 3BJYA 3MEGB 2MQMA 3FEYB 3OFEA 1LKZA 3R5DA 3MM5B 1IBMJ 4FDFA 1RTDB 1YZ7A 2DTJA 1VQLS 4CO0A 3KLEA 8ATCB 1WC1A 3CMES 1SV5A 1T03B 4DPOA 4ZP8A 1OPIA 4KGMA 2RRNA 5B0GA 3ENAA 1KVKA 2RQMA 4LF2A 2ERRA 4ZLLA 3K59A 1KFDA 1WG4A 3I5BA 3TP2A 1PSDA 3FRYA 2NREA 4P10A 3DU6A 1X4DA 4PABA 2I38A 5SZTA 1LWFA 4NLGA 3HP6A 1JLFA 1S10A 1VIOA 3D66A 1RTHB 3D6HB 1LEOA 4ZPCA 4A8WA 4HH1A 3LH2S 3J80U 1ZTTA 1Q4RA 4ZVPB 1LW2B 2YWGA 2BE9B 3HHLD 3KJVA 3K8WA 1S57A 1NRKA 3THPA 4BBYA 4KV8B 2Z56B 2OPQB 2V4RA 2H48B 2KDOA 1SKUB 5EDWA 3ET6B 4OQJA 1IKXA 1JLBB 2CADA 4DV1J 3MECA 2YNFB 1VGYA 4YN3B 1QE1A 2CWXA 1UVIA 2BM0A 1PYTA 2QMWA 2CQ0A 1Y00A 4LUBA 3V4MA 3DKDA 1CJUA 3OTDA 1IBCB 1UEUA 3L9ZA 1REVA 5J2PB 1S1UA 4PCQA 4NLSA 3MM7A 3CCJS 1X4HA 2MSTA 5JVGQ 3EZUA 3MWBA 2IJFA 4YR3A 3A8JA 3G87A 4U8VA 3CIZA 3HFZB 4UQGA 4WFZA 2DHHA 1HWKA 3DRSA 4DFKA 3W9JA 4ANEA 1OWXA 1VQ8S 5DM6Q 3GJTB 1VQSA 2LQ9A 3RB6A 1BQMB 2W2OP 1AZSA 3FFIB 4NLDA 4DR2J 4AUKA 1HPZB 4WE1B 4OHZA 3DLGB 4H4OB 3I31A 1W2IA 2ZOFA 4EYIB 3H90A 3E01A 4JI4J 1R8CA 4QYZJ 1U45A 4PWDA 1NKCA 1FDDA 2BACA 2FHJA 3LWMA 3LALA 2NLWA 4DS5A 3MFHA 1GXLA 5GAGU 4LQ9A 4H4MA 1G1XA 1FEHA 4O4RA 4NLUA 4KR0B 4OI2A 3BYRA 2DR9A 4OZ2A 4JV0A 5BYQA 1CG2A 1QVGR 1UAWA 5KAKA 5J2QB 3GE9A 3PVXA 3VGTA 4ES1A 3TW0A 2PFDA 5DDRC 1NK6A 4X4UA 3UDVA 4CLSA 4Q45A 3LANA 2HRYA 4N76A 4USKA 1R89A 1PAUB 4AXIA 1IR1A 3PO4A 2IVFB 3IBWA 4LVNP 2W9AA 4DU7A 3V6HA 2GO9A 2W2QP 3OL7A 1S6UA 2IDEA 3A3OB 5BXIA 1TUVA 5HATA 2M70A 4HDGA 1CJKB 3IM8A 1DBDA 2W8LA 3VV2B 1UVNA 3PJWA 4DU8A 5HMYA 6AT1B 3K8VA 5JMNA 3KLGA 2YNHB 4LF5F 2GHWA 2XO6A 2HFOA 3PR5B 2CPJA 4N7TA 2WBMA 1UL3A 4UY85 3BGFA 5K14B 4CRJA 2JEIA 2GVZB 4LRCA 2FC9A 3M8PB 1H74A 1N36J 1T9YA 4GO5X 2JOQA 2EG1A 3O5TB 3U1MA 2X1AA 1HBUA 1NPPA 4B3OB 3MM8A 3LA0A 1J5EF 1CC8A 4NEZA 1IKVA 4X66F 3Q24A 4DX7A 2JEJA 1S6QB 2XSFA 1JLEB 1TAUA 5KT6A 3MM9A 4KFBA 2EBEA 1WEYA 2AJ2A 3N6MA 2BW2A 3FQKA 3B4DA 4E98A 1FVQA 3EMTA 1SPBP 3WZ0A 2FJWA 5ETPA 2CPFA 5HMXA 4QU7A 4IO9Q 1LXJA 2M8DB 9RUBA 3AT1B 1U1NA 4MK7A 3NAIA 4OZ1A 3NGTA 2F8EX 1PIEA 5AXMA 9ATCB 3OT9A 5KFMA 2UXCF 5B0AA 2GIRA 1E6YA 3G6VA 1HYSB 1Q78A 4JI0F 3C46A 5L38A 3HSDA 2OP5A 2OPSA 4HH0A 3UDEA 1PBUA 4DFPA 5I42A 2Z2ZA 3A1YG 3E8OA 3PACA 4N5SA 2DEJA 3LP2A 1AA1B 3DLEA 2MLYA 1H98A 2DNYA 2I0XA 3ZTQA 2OELA 1GX5A 4NXMF 4DWIA 3M30A 4DFMA 3TARA 2BOPA 4DPTA 1FD8A 4LRDA 1UMJA 4OHWA 4P7TA 4HT7A 2RF2A 2R8IA 2Q6CA 4LF5J 3EZOA 5IM0B 3PW0A 1HWJA 3CCLS 3V6KA 2BQRA 4EO6A 3I4PA 3D0HE 2PD1A 2YKNA 4U6PA 2J8SA 3H40A 4FYDA 3D28A 3D6MB 4ILMA 1CJVB 2WB4A 2Q43A 4WFAQ 1J5EJ 4X66J 4ENOA 1X4EA 2COLA 4LR9A 2GJFA 2VIHA 1LFPA 1GFWB 1ZAXA 3LGHA 5AT1B 4LQ3A 4JI3F 3GZ7A 1N52B 2E7VA 4NI2B 5C42A 2ILYA 3GTYX 3UCGA 3MPWA 2FZCB 1OYDA 3TAPA 2LXFA 4AT1B 4KB7A 2MMYA 3W8PA 3ZTPA 1GTHA 2X3DA 3ZO7A 2UXCJ 2KZZA 1RT3B 1H2UX 3UCZP 4QJVA 1OSDA 2HFUA 2H5IB 4CT9A 1NJYA 1NSPA 1BMQB 1YGYA 2R7XA 2ALZA 2KFYA 3EXYA 2KO1A 3AHPA 2D7SA 4F2RA 1DLOA 3AOBA 2XI3A 4NYPA 4C97A 4EBCA 2C2OB 1U1KA 3BGOP 3PTWA 1KLNA 2BQ3A 2V50A 3WC2A 2QA4G 3CCUS 1C1BA 3PEHA 2WRMA 1TV6A 2V68A 3S7RA 3DXBA 3W60A 4IOAQ 1P6TA 4DL5A 2V2QA 4WK3A 4RNOA 5HLFA 2IIHA 3M7VA 4Q44A 3E3XA 2VDIA 1WDTA 3KHRA 5F8JA 2L9NA 2DRBA 3OR1B 1Z4UA 1U2RA 1YSJA 4TYBA 1DJ0A 1SVDA 1SC1B 4B9SA 2EFGA 1QAJA 4PPDA 2HFSA 3UD4P 3NNAA 1FHTA 4UOHA 2B0GA 1SI9A 1S9GA 2JC0A 3SSQA 1RYRA 1HWIA 1CS4A 4NYOA 3AAWB 3H42A 2ZD1A 4QW8A 5IC4B 4KAIA 1JXLA 3M2UA 1MN9A 4W4MA 2IAJA 2EKYA 2X1BA 3SSRA 4C98A 1X5PA 1RT1B 4JI6J 3ITHB 1R0AA 3TJAA 3MFIA 2Q1LA 3AQOA 2XWXA 4KKOA 2VHGA 5B08A 1RKJA 5KFBA 2J9DA 4B9MA 3ISNC 1RLCL 3HZEA 3MCNA 3MR5A 3PFEA 1QSLA 1YJVA 2KHDA 1TTHB 5AXKA 2IDLA 4YDDB 3LTOA 3CJ5A 4IOBA 3RW6A 2XMUA 5A8RA 1U47A 1MWYA 4C2MA 4RR5A 4ICLA 3FJ2A 3GYGA 2ZITA 4DL3A 1CJTA 3M9MB 4DR1J 3EXCX 1U2FA 5HSPA 2ZUGA 4PQUB 2JX2A 3LP0B 1PC4A 2ZM6J 3VQSA 1UCNA 5BR8F 5KFZA 2XSJB 5JUMA 2HHHJ 1BQNA 3TX8A 2HIYA 2R4FA 3M2VB 2NYIA 3KLHA 2CJKA 4TXSA 4OZLA 3A8KA 3G96A 2W9BA 3PXGa 4I1TA 4YFUA 5GMEA 4ZPVR 2B4VA 5FLXU 3FC9A 4S0MA 2HQIA 1Q1KA 3A4TA 4NA2A 2CXEA 1FDAA 5ADZA 5IV3A 4X64J 4WJBA 3LF0A 2V8HA 3VALA 3D68A 3CDUA 3N79A 3VAFA 3AD7C 4IH6A 4R0JA 2GHPA 2CQDA 2MXYA 3CJQA 2PEHA 4I68A 2AZ1A 1ZS6A 2HMIA 1NDPA 2YWFA 3HHNB 4CLZA 4DSEA 5T7LB 4PR6A 1GMUA 2R2RA 3TA0A 3CC2S 3N28A 4W92B 4K59A 1RTDA 4LFCF 3D54A 3DLLQ 3TAMB 2GV1A 1NK4A 4GC6A 2AJ1A 2MB0B 3PRDA 3JAMY 1M90T 2BJ7A 1XMQF 2EPIA 3I5AA 4M63A 3S01A 2CJQA 3M6VA 3RG6A 1FE0A 1T03A 1F5CA 1BC6A 3MMAB 3UPFA 1UW9A 1MROB 2IM2A 1R8PA 3ENWA 4J9QA 4QWAA 4KYZA 5M2RA 3EUNA 1I1GA 2QG9B 5KFAA 2RH3A 1HNZF 2PN6A 2VKZG 1KQKA 2DY9A 5BR8J 4KHPJ 5A8KB 4DR4F 4OV1A 3CCWA 2AGPA 3GIIA 2V4JB 1QD1A 1RTHA 1YHQS 3UW1A 3U02A 3AD9C 5RUBA 4P2MA 1YITS 2AF6A 2DO4A 4ZVRB 2NXCA 2GVDA 2BMBA 2FJEB 1LW2A 1HMVB 5KFCA 1IKWB 1NHVA 2HAIA 2MKJA 1FRXA 2GA7A 4YB5A 1Q8IA 3OXLA 3BS9A 1VYAA 1X8DA 4DPUA 4Y2IA 2J6UA 2YBVA 2GS8A 5F8MA 3IC1A 3IRXA 3M9NB 3R5GA 2RE1A 4BLGA 2MHNA 4ID8A 2CQIA 2ROGA 1UVJA 4OI4A 1S97A 3OR2B 4ETXA 2UVUA 1LV5A 1UFWA 3HX9A 2DKOB 4DV0J 3ZZUA 1X4BA 1IVZA 2G2YA 4XPCA 1N6QB 3NBPB 3M32B 2CQCA 2KFZA 3CD0A 5J2PA 2MKSA 2RDJA 4BWJA 2YH0A 4D3HA 2N3OA 3KTQA 3NWRA 3IN5A 1WF2A 1FX2A 1RCXB 4RPFA 2KT2A 2EW9A 4XIUA 3PYDA 3BPSP 1VBXA 2LLZA 1B64A 3ELHA 4X4NA 5ETRA 1WOPA 4USHA 4DSLA 4F0MA 2MQOA 4O3RA 2VF3A 2DYAA 4DBQA 3FCWA 4FF2A 4YHHJ 4H4KC 3FQLA 1BQMA 1HNZJ 2OLWA 4LIWA 3PIOQ 3HJFA 2PO4A 4QW9A 1HPZA 4FPRA 4WE1A 4FXDA 4H4OA 3B6BA 4KY3A 4I56A 2FZKB 5IQQA 4DR5F 5LXRA 3HVRA 5DG8A 3P45B 1ZPWX 4ZPTR 3PZPA 3MF5A 2KU7A 3NOCA 1Y5NB 4Y0FA 2BOAA 3QQCD 3LGMA 3PYEA 2XTJP 2UUAF 3QIDA 3KHGA 3BKTA 4KGVB 4U7UD 4NZ6A 2JJ4D 3UVJB 5HN0A 2YWWA 3W5ZA 1A7GE 1NSQA 1GXTA 1UZHA 2VDHA 2XHWA 3WQPA 2CQ3A 2B9XA 3K17A 4ED7A 2H5JB 4DS4A 1XEZA 1EP4A 4WYLA 2J6TA 4B9UA 1FJEB 3GR1A 5J2QA 3EX7B 2X7IA 2Y0BB 1T8EA 3GR0A 1S9FA 3P5TL 1U8WA 5H9EK 2HZVA 3H20A 4IDKB 3TO8A 4A8FA 1PGZA 2NSCA 4DG1B 2R7OA 3NEKA 2XULA 4ED2A 2BXJA 2XBPA 3I6PA 1K1QA 1H2TZ 3AJDA 4NLRA 2DPJA 3HHEA 1HQUB 2QYGA 1CJKA 4QR2A 1F60B 3MDFA 1M5VC 1JJ4A 1KN6A 4R8UB 5CD4H 3M1VB 4L3NA 4J5OA 1X4GA 1Q86T 4FZVA 4IKAA 1UJ4A 1KC8T 2MDAA 5K14A 3RAXA 2XYGB 2BKPA 1HIYA 2GVZA 3W62A 3R27A 3CF5Q 1IJEB 3EPIA 1VQMS 1SH0A 1WSVA 3I87A 3RAMA 4B3OA 1DZ5A 3QBCA 4DR5J 3BM7A 3TZYA 3QLHA 1OYEA 1S6QA 4F02A 3OSPA 2UUBF 1CVJA 3KK3B 1WELA 3R5JB 3F44A 2DGVA 2UUAJ 4ZP9A 4MIBA 2VL1A 3IP0A 1N54B 2FLNA 1RQ0A 3BSCA 4DPYA 4O0NA 1X0FA 2DHXA 1DFDA 4GMKA 3GU0A 1W7WA 5BYSA 3G71S 1TUWA 3ZFVA 4CP5A 1N0VC 3C6TB 4WP8A 5D4NA 1FDNA 2D3ZA 3GONA 4UT4A 3QRPA 2QEXS 3DCAA 2YWHA 4IR1A 1FTCA 2QLFB 4K4VA 1HYSA 4CNZA 4MYUA 2FLLA 4FYVB 3R1HA 2V63A 2MZJA 1FKPB 3QGHA 2IVMA 3BF4A 5E3RA 1RGVA 1N4LA 3SQGB 5C5JA 4BC7A 2LXUA 1Y4ZB 3UO0A 2ZJRQ 1B70B 1L5UA 3PG9A 4D3GA 1BXNA 1LK7A 1WJ9A 2RKIB 2ZH8A 1D9AA 2DGOA 2JSXA 3FBCA 1S6PB 1SUQA 2WW8A 2RIJA 5IM0A 2DB1A 4ZP6A 3CC7S 2CVEA 3B54A 4ED1A 3HVTA 3RYLA 2E1PA 1KHVA 3GYXB 2F63A 3GIRA 4M5DB 2CZ9A 4Q2MA 1CJVA 1FKAF 2ABYA 1RWPB 4C8NA 2B4UA 4KBIA 3TVZA 1VQ5S 2Y8YA 3MEDA 2P5VA 5D78A 4FXWA 3VTIA 3SEOA 4ZCMA 1W26A 2UVRA 3JSMB 1WACA 3W5XA 3AJ1A 1RLDA 4Q43A 1MLAA 2ZH7A 1KS2A 5LXYA 1T02A 4H4KA 1XNQF 4KHMA 5THWA 1HNVB 1H38A 5A76A 4JI5F 2BYCA 5DO2A 3C15B 3ZZPA 3Q8SB 3WBZA 2QIFA 3CTRA 1U02A 4ES2A 4ZVOB 1X4AA 2CPZA 3EGVA 3RBZA 2W7OA 1TKZB 4JI7F 5IT9Y 1EZZB 4ZN1A 1U6BA 3HULA 4JI8J 5B7WA 1RT3A 1M5SA 2Y1LB 1YBUA 1X31C 1VIXA 5GAHU 1SL0A 1HL6A 3OFHA 3PDNA 2F9JA 5GAEU 2NUUG 1AW0A 2N7CA 2ZNYA 4DOZA 3T9NA 4OZ0A 1TVRB 4CM0A 2AJ4A 4I64A 2VICA 3PYGA 2ZC3A 3DLJA 4ELTA 4KGXB 1F6TA 3ONQA 5B09A 1FFWB 2XYHB 1KQGB 3FKBA 3V2UC 3BQ1A 4ZCIA 4B02A 4ECQA 4NCBA 4J9RA 2RDDA 1MWQA 4LF7F 4FVCA 4DQRA 1TL3B 3CJRA 3NGSA 3KLFB 2NCKL 1WHXA 3BSOA 4GC7A 1O8BA 4WXOA 4EBEA 1T95A 2XG8A 1ULRA 5B0FA 1RABB 2ATCB 2CPEA 4XPEA 3M8QA 1JLGB 2ZKTA 2D3UA 4QQBA 3AQPA 2AEJA 3C8YA 1ZPVA 5D3GA 1OY8A 3OL9A 2ACMA 3WC0A 1TKDA 1HBOB 3NG8A 3SCJE 5KFXA 2E29A 2I9SA 1R8HA 4KSEB 5ITHA 4YP3A 4J7CA 3I0SB 3BO4A 1AT1B 1E6VA 2FUG9 1Y9OA 2E5GA 1S1XB 4EI2A 2GQCA 4DN9A 1VQ9S 2A0FB 2IBOA 3F0NA 4B3RF 3U7JA 5GADI 5F8IA 3PY8A 4ERDA 2B6AB 1CBKA 1KP6A 2LA6A 2C3MA 5KG3A 1F9EB 2RD5C 2LKZA 4HL9A 2KJVA 1FJ7A 2P9CA 1XR5A 2SXLA 4W98A 1YLXA 1YBTA 3HT3A 5CHCB 4ZA1A 2VG6A 2DD8S 1XN9A 4PQUA 1DTTB 3LP0A 1UP1A 3NP5A 3U1LA 1GEHA 2XSJA 2MGZB 2CIMA 1JLAB 1RBAA 3D1QA 2CPIA 1BUXA 3M2VA 4RU2A 1N5QA 2RJZA 3PV8A 2HRTA 5ETSA 5KFJA 4TLQA 2IA0A 3GG0A 3V6DB 2Y1IA 2VONA 2BDPA 2LU1A 3HXMA 2O66A 2BA9A 5LSLA 3DRRB 1C4CA 2ROEA 3NLCA 4DUZJ 3JQJA 2M4MA 1HHQA 2G0CA 1FJGJ 2OH2A 4Q0BB 4QOTA 3UR0A 1MWZA 4QWCA 1RT2B 1HW9A 2W7PA 2W9CB 1JK9B 1UWBB 1U1MA 2CPHA 1FESA 2NS1B 1AUSL 4FN5A 2YNIB 2OKQA 3HPOA 1BLUA 4QIGA 3SZ2A 2ZKUA 4AQYF 4YEAA 4LREA 3VZIA 4C3MA 1UEKA 4JI2F 4RNFA 4O3OA 5KFTA 1WHVA 3DDIA 3HZGA 2K7JA 4O0IA 5HQMA 2CQBA 5DLGA 4N8OA 1I3OB 3TAMA 1SC3B 2FJAB 4BHQA 5AJ3J 5KFVA 3AXKA 3CDWA 3R3TA 1F9FA 1FKOA 2ZFHA 4ECRA 5HMWA 4K50A 3QT5A 3MMAA 2ZVIA 2D41A 1B99A 4MIWA 2J7KA 4RO0A 3ZTSA 3CJ4A 4ZP7A 3I56S 2OHDA 3PNIA 2I5JB 3CB4A 4F4AA 5A8KA 2JVRA 3HDSA 1RUSA 2MEWA 3GWCA 2G2ZA 4JUZA 2BJEA 2GFFA 3IWNC 3OLBA 4M95A 3DOLB 1TKTB 2LP4A 2V4JA 1S0MA 2C42A 3RBDA 1LWFB 3OL8A 3E51A 5KFQA 1JLFB 2ZWPA 2NUHA 2ZC4A 3KMSA 3IR7B 4DX8H 2V6AA 1N33F 4DL4A 1IKWA 2YTCA 1QTMA 2MLZA 5KFHA 2HHSA 3QPIA 2LEAA 2VPXB 2JH3A 2XGPA 2HVHA 1I94F 4NCAA 3MAHA 3L3CA 3CDBA 4ED0A 4K7QA 1HWLA 3RW7A 5ETKA 2PC6A 4AQYJ 1S99A 4PXEA 1JLQA 1IKXB 3D0GE 1IM4A 1MW7A 3W2VA 1UZDA 2KB2A 2OEMA 3BBCA 3LPEA 1RAIB 3PX6A 4HEA9 1S76D 3CULA 2CA9A 1SQFA 3M8ZA 3CD6S 3VCDA 4FF3A 1D3WA 3M32A 1RBOB 2F3JA 4F36A 1JKHB 1H3DA 4LFBF 1M1KT 1CJUB 4ANCA 4ALZA 3H2VE 2IY5B 1Q95G 4DCOB 1S1UB 3KLIA 2KKHA 2PE8A 3NRBA 2L3MA 1RYSA 1M5PC 4O3PA 1RSCA 3OJUA 3DRSB 4PYAA 2CJXB 3TVKA 1L3VA 4GKJF 1RAEB 2XI2A 2IM3A 2RHQB 2QFJA 4HLBA 3UQSA 2JFKA 4CQ1A 2HHVA 5E2QA 2BM1A 1URNA 3E01B 1AB8A 4X4SA 4AE5A 4WU3A 4ATNA 4PWDB 4R5PB 2W25A 5DRKA 5HJXA 3UVJA 3MPYA 3IM9A 4JYAJ 4RW8B 1X5TA 4IYQA 4JV2A 4HACB 1V3RA 1F1BB 1N33J 2HRUA 4YB7A 4ZVSB 4DQPA 3BPDA 3MUTP 1ROFA 1WTFA 1R8BA 3SSSA 2ZBPA 4NX9A 1VRUB 5A2QY 5E7OB 4TU9A 2KVQE 4UY8T 2DNKA 3GCWP 3I5CA 1VS3A 1NO8A 5DJBA 5IOLA 5LMUF 2C22A 1ICEB 4NXNF 2Z58B 3MCSA 4IDKA 4DCJB 4B3SJ 5C2GA 2Q3PA 4DG1A 4CM2A 2VJVA 1VK8A 3QZ8A 2JC1A 3NCRA 1FWLA 2VBZA 1NMEB 2HBZB 3TZZA 3R5CA 2J9CA 4ZJQA 4J9NA 4KJIA 2YPYA 3IS9A 4K4XA 3KHHA 2RQ4A 2CPXA 4ECSA 2XZDB 4DN0A 4ZCLA 2CZVC 4DUTA 2DCLA 1RBLA 2EC2A 3HI9A 3QMQA 4GKJJ 4EZ9A 3D2WA 1DURA 4J9PA 2XMJA 5L1LA 2C2RA 4A8SA 5J2NB 2DRDA 1U7LA 4U96A 2KTQA 2YX4A 2XLIA 1UPPA 3D5MA 2R2SA 1B7YB 2JZ5A 2E9TA 4ZKAA 2CWKA 1HBUB 4Y2CA 2XMAA 3C16B 1FVSA 3I82A 1V9OA 1P27B 2FB0A 5E0OA 3K2YA 4CTAA 2RU9A 5L9XA 1FWKA 1Q8KA 4F4YA 2BV3A 1GMWD 3TANA 1Q7YT 3MM9B 2HNDA 3OW2R 5KFUA 2KT5A 2U2FA 4OHXA 1PCAA 1D8ZA 1IBLF 1DY3A 4WF9Q 4C9DA 3W9HA 2FJXA 3C6TA 1GH8A 4DQSA 2W01A 2WSFC 5KFWA 5EX0A 5DG7A 1E6YB 2ASLA 1M0SA 2O3DA 3FCHA 5H9FJ 1FKPA 4RW6B 2G9OA 2MTLA 1IBKJ 1W25A 2QMUB 2VBYA 2V8VA 4IO1A 3H98A 2OPSB 1XQIA 2UV8G 1VISA 4URGA 3GJQB 4C48A 1XMOF 3FVYA 1TK5A 1HA1A 1EKSA 3LP2B 2RKIA 1X60A 4DX5A 3C14B 1VI7A 4CDIA 4ZPDA 2ZZNA 1NH8A 4ZLJA 4WP9A 4TY9A 2FDNA 4G1QB 3VAJA 2DJWA 1VQ6S 3H4BA 1L3TA 1YDLA 4OJ1A 4IG0B 5A6PA 3D9BA 4I7FA 1F2GA 1EHWA 1U0HA 5HVGA 2IVYA 1UA1A 2LQJA 4ECZA 4KGZB 4ZHRA 3V5RA 2MKCA 2IRUA 3DXSX 2RAQA 5EWFA 4CWBA 2OI2A 1V5VA 2NZ4A 1HLWA 3SYZA 3BR9A 1CC7A 3DC2A 5L1JA 2KM8B 4DSIA 2WK4A 3AA8A 2ZNZA 1RXOB 2FJBB 3C15A 2DH7A 3KWMA 5C42B 2DIVA 4OX8A 2O67A 4P6QA 3CGIA 1IBLJ 3GG1A 4Y00A 2Z2MA 3DOMB 4LR8A 3NKYA 5LJ5Y 3MUMP 4DV6J 3H25A 2VV5A 1RTZA 4M8LA 5ETTA 1T11A 2EWHA 1ZBTA 3SCLE 1S72S 2YKPA 3JQKA 5CH7B 5E3CA 3H5YA 4NE9C 2M88A 3DU5A 1HBNB 1LXNA 1U1LA 2F4VF 2EKNA 2YX1A 2YWKA 2DIUA 4F3QA 3BH6B 5CA5A 1TVRA 2V5HG 3W64A 3OBIA 2E9RX 3DLHA 2O5DA 4ZVFA 3FCVA 2PIIA 3W61A 3R2DJ 2HVZA 1N32J 3FEZA 3DLKA 2Q6BA 2BJ3A 2K7KA 4DV4F 3KK1B 4K4ZA 2D3O1 5HLFB 1NK5A 1SKRA 4E0DA 1TL3A 2EEYA 3DFEA 3KLFA 2RRAA 4NRTA 2NYHA 5M2PA 1S79A 3T6JA 5L46A 4EYHB 5M2UA 2DHAA 1UW4A 1LWXA 1WG1A 3MAAA 3EWGA 4Q2LA 2HHWA 1FX4A 4NLWA 1S9GB 2C2EA 3C2PA 3GFZA 2DGUA 1CS4B 1HBOA 4OL8A 5F3TA 2I6WA 2EFOA 4TNOA 4YS2A 2HHQA 4YUDA 4WP3A 2HWTA 5IV4A 4J9OA 1TK0A 3M2UB 3A3PB 2C3YA 3I0SA 5KOWA 2F1FA 3DGVA 1TK8A 3I0RA 1YJWS 4UQTA 2GMJA 2QSWA 2AYBA 1S1XA 2WTFA 3R6LB 4DR3F 3RB4A 4I69A 1MU2A 3K89A 3HHKA 4KKOB 2W24A 2RU3A 1IBMF 3H0PA 3MCOA 3THTA 1Y10A 3BGRB 4B3MJ 4LBIA 2B6AA 2HIQA 2RQKA 3CJ8A 2Z2LA 3ZZTA 4Z2XA 1XK8A 3W2WB 4LF9J 3KK2B 3N01A 2W2NP 2X1GA 3KHLA 1Y3KA 1WOOA 4RWXA 5A8RB 1YX2A 2IHR1 5CD4A 3GIMA 3FZBA 1WF1A 4X4OA 3OJSA 5C24A 4C8LA 3G4SS 1CJTB 4UOGA 4GVBA 2HZCA 2OEJA 3HD1A 1FA0A 4IUFA 2MGZA 1VQ4S 3I96A 2HFVA 1F3VA 3UWTA 1VJWA 3TUZC 1FCAA 1BWEA 3M4XA 3V6DA 2AMCB 1YBAA 1YRUA 3CJKA 1FERA 1LWCB 2P9EA 3MM6B 1K47A 3DRRA 4L74A 1T9WA 1W2BR 2W9BB 4HHJA 2VG5B 3ILOA 1HQEA 2XLJA 2V0NA 2U1AA 5LL6d 4Q0BA 2DNPA 1RT2A 1MMDA 1IXKA 3ILLA 1OIAA 2DXFA 3JAMU 4J9UE 2AGOA 4LF4J 5IS2A 1UWBA 4A4JA 1QAIA 3MI7X 1S4EA 2K3KA 1VHFA 5HQ8A 2YNIA 2RQCA 2BZ2A 1AUDA 3WDOA 4QR0A 2DBBA 4HR2A 4DV1F 4CLLA 4FYXB 4TY8B 2CKWA 2KL8A 3KXDA 4ECVA 4LSNB 2CG8A 3DRPA 2YQ3A 4IRKA 3VHQA 3CUNA 3N9UC 2F9DA 2VPZB 4KE5A 2QLXA 7FDRA 3ZNJ1 1KR4A 2MQPA 1PKUA 3PW5A 2Z30B 2YKAA 4OZ3A 3KOAA 1S1TB 1O51A 3NGKA 5ETMA 4OYMA 4N47A 1VOMA 3OVSA 3T9ZA 1H73A 4WIQA 4NCGA 1WUUA 2DK2A 3J7A1 4I6WA 1SH3A 2ZH1A 2I5JA 2W4PA 1IM6A 2DNQA 3D0IE 4XO0A 4DR2F 4ER8A 2AWZA 3FMWA 2MPUA 4DPWA 2OIHA 1C1CA 2YPZA 4F25A 2HYIB 2AU0A 4JI4F 1N34J 2AV5A 5KFNA 3DOLA 1C2PA 1TKTA 2WVEA 3HFVA 2HWHA 3IAM9 2FYXA 3LP1A 3OVAA 1N88A 2DHGA 3FEXB 1YWXA 2QL5B 5LMNJ 1UJ5A 1BE4A 2QN6B 2GVDB 1XNRJ 4CCHA 1Q79A 1DQAA 2GCFA 4C8OA 5EHHA 5C25B 1O0PA 3NAHA 2YQ0A 1DHMA 1EB0A 5FDLA 3PCOB 3GIJA 3SQOP 2QO3A 5C2CA 1NHKL 1WHWA 2VOPA 3FUYA 3IRXB 3SV4A 1EQ0A 5DS7A 1KONA 1YI2S 4UUWA 2PEBA 2QE5A 4DV7J 1NUEA 3WHIA 3W1YC 2ADCA 4HI2A 1A9NB 2JRSA 1Y11A 4J9KA 1BGXT 4MJKA 2RDIA 1JKHA 2G0JA 2JL9A 1RWNB 5CZVA 3VAKA 4I6YA 2GNKA 2VPWB 2IA6A 5IC6B 3PX4A 4G1IA 1TU0B 1NPKA 5CYQA 1HNIB 3IBCB 2N82B 1QDUB 5AE3A 1FT8A 3UN2A 4DHVA 1S77D 2R2UA 4DMZA 5D0RA 1HI0P 2KM8C 1SB6A 3Q8UA 1F9HA 4P52A 1N36F 3N6NA 3LGNA 1U48A 1JXEA 2R42A 1FEEA 5KFOA 1OS5A 1SC6A 5KFYA 3W63A 2DISA 3OTBA 3ZNUA 1FF2A 3H7HB 2MY8A 2KYZA 3KFWX 4HDHA 3UR3C 4AYBD 1EJ7L 4R5PA 2B3TB 2ZOMA 5KG5A 4NLQA 4PAAA 3D1OA 2VA3A 5DETA 4RW8A 3QYYA 4HACA 2ZH3A 1XWLA 3R7BB 1Z2ZA 1HHSA 2YKOA 1F5BA 4TU8A 3I9V9 2RUSA 1H7WA 2NXEA 1U1PA 1VRUA 4OI6A 2ZBRA 1M5HA 2M52A 3CCMS 1VLYA 3CIMA 1EP4B 4AL7A 1KDNA 4CH1A 1EARA 1G3OA 2EXUA 3CPWR 3DYAA 3Q8RB 3V4IA 1P8GA 4L6V3 3L7UA 1FTRA 1TL5A 3W3SA 2XB2D 3HVWA 1NHUA 4F04B 5KFDA 4FBUA 4J91A 4FP9A 4J9SA 4RNHA 3IG1A 2QTWA 2BJDA 1WNEA 2IFXA 3JYTB 1FO1A 4LMZA 2DITA 4CLTA 1DQ9A 2J0XA 1NB7A 2HURA 1F2HA 4BC9A 3JSYA 5ETQA 2EFQA 2HW3A 2UVWA 1N5VA 1MNEA 2VQFJ 3N6LA 3MPVA 1VC0A 4WU2A 2DR6A 2HBQB 5CYMB 4KPCA 5DDQC 5J2NA 3W9IA 1OPZA 2A1BA 4PG7A 1JJCB 4ELVA 1Y0HA 3OXGA 3GFXA 3PM9A 5DQGA 2DR7A 1U1QA 4LRAA 2GMLA 4OJ3A 3C16A 1IR2A 5HJYA 5EGYA 3KNGA 4C11A 3QLHB 1SJ1A 1UWAA 2WVBA 1Z1ZA 3KMQA 5J1PA 2JEFA 3CJSA 5HK4A 2FLOA 2G1HA 3DMJB 4A47A 2ALYB 1TFYA 2B56A 2PA8D 4RNMA 1YJ7A 2MLXA 4QYZK 2B8PA 5KT5A 1EETB 2XC9A 3DM2B 1R8AA 3VWSA 1OQ3A 4FVMA 4MKAA 3J7YI 3MTJA 4PWWA 4RUHA 1NXIA 4DR7J 4DV3F 1RDRA 4TLRA 5F41A 2NQPA 1RTIB 3D3CJ 1UVLA 1R6YA 2CNKB 3MMCA 4F7VA 3KJFB 4RW6A 4M94A 3HHLC 3VZHA 3L09A 1VLOA 2DGQA 3W66A 4X4TA 5KFRA 4U7CA 1XIQA 2J7WA 1KFSA 5I3UA 2FTRA 2R8HA 5B0EA 5HAOA 4PG6A 1T7PA 2CVIA 1WORA 4ELUA 3KG0A 1NKEA 4ECTA 3NMRA 3C14A 3UD3P 2ZVSA 1SUQB 3KDNA 2KYXA 4IG3A 4PG4A 3S1TA 3T5JA 2KRRA 2EK1A 5T14A 4I2PA 4KTQA 4G1QA 5KG2A 3BN4A 4UUXA 1TELA 4RW9B 1R7IA 5LOQA 1ZA2B 3HVTB 1K73T 2WOMB 3T1YF 1MSWD 5IT9U 1A0OB 3WIUA 3A8EA 3UI3A 4IG0A 4WFXA 1U49A 3OTCA 2E1MC 1T05B 3GV7B 3SFGA 2OPPB 3KKFA 3MEDB 1EQMA 4X62F 6FDRA 1YJUA 5KFIA 2PFFB 3BGUA 1KEKA 4K2XA 3TUPA 1GTEA 1PAEX 2FY1A 4Z7YA 2ZZMA 3PJ9A 1C0TB 3NNCA 3FNNA 1VBZA 1XTZA 4DI6A 5IFMA 5J1EA 3ZZOA 1WI8A 3NS5A 2L48A 3VQTA 2BRLA 2Z0GA 1VBKA 1SKSA 3QSIA 2UP1A 3QWPA 5KT3A 3QNWB 4JI6F 3PYFA 1FRLA 2HFNA 4ZPBA 1AFIA 1ZZFA 3DOMA 1WWHA 3BYPA 3CJ2A 3T3FA 4I6AA 3VAGA 4DV3J 3BREA 2MZRA 3H2UB 2FHJD 2XY7A 4PYDA 2H65B 4LSLB 1R3NA 2KI2A 2CDRB 2BE7D 1S48A 1HBNA 1DRZA 1RISA 4DUYJ 2XCPA 2N3LA 4WPAA 1TUGB 4DR1F 3AH6A 4FYWB 2QYCA 4UOCA 4ZK7M 2CJBA 1HR0J 1IKYB 3CD7A 3PIPQ 2ZM6F 2R7QA 4CLWA 1YIJS 3P96A 4A8QA 2HHHF 4B08A 2OD6A 4Q5VA 3KK1A 4M5IA 5B0DA 1NKBA 2YKQA 5D0GA 1KNZA 2CRLA 4U7UK 3U27A 3AA9A 3Q8YA 3T1YJ 4OHVA 3BZQA 3BQ0A 2BEFA 4OX7A 4TN2A 2FC8A 4FS2A 1RWWB 4X62J 2XGQA 2HG4A 2E5JA 1JWWA 4WFNQ 3M8QB 4X64F 4K5SA 3FDSA 5HANA 3DHWC 2CDQA 2J7UA 5D3GB 4ZCKA 4NZ0A 2H54B 3TJ9A 5KTQA 2C2DA 2PMHA 2B7CB 5LT5A 1WI6A 4PZVA 2ZHBA 3QT8A 2A18A 2LVWA 2X1FA 1E6VB 4P73A 1H2VZ 1K1SA 3RR8A 1JB0C 4BWMA 5AXNA 2QL7B 2DH9A 3QRRA 3BGRA 2RS2A 4K4WA 2UXBJ 3GSDA 3EYZA 1D8YA 5KFGA 2DHSA 4OYIA 4Y2AA 1YJNS 3W2WA 3CE8A 2LFVA 4CYUB 3KK2A 4DL2A 2KXNB 2H4YB 5DGAA 3W7BA 1VJQA 1PC5A 3BEGB 2DNRA 2HLTA 3NGDA 3DNCA 2ZDOA 4B3TJ 4Y3CA 3O8WA 4WIIA 4KHRA 2VG6B 1NDLA 2WVDA 4USJC 4M5GA 2HNZB 2GJIA 4QWBA 1S49A 4DLGA 4KHPF 4RLEA 3WX4A 2XMMA 3FZ2A 3H2LA 3HHLA 1NCLA 3EGZA 3EGWB 3L4BC 1VMBA 2FD2A 4RW7B 2EC0A 1LWCA 1DARA 2BJ1A 3N5FA 3MM6A 4M5KA 4EEYA 1FD2A 4UZCA 1ZM3A 2VG5A 4MKVA 3Q83A 3OV7A 1PJ6A 4F4ZA 2J9DE 3SIPB 4EUVA 3RZAA 3EDRB 3IO1A 3ZZZA 4PXCA 3QO9A 3ZTRA 3UNGC 3NGUA 1SCJB 2CQ1A 2KG1A 1K9MT 4HYKA 1VRQC 2EFPA 4HHHA 4QWEA 4J90A 3FBFA 3TZWA 1X9MA 1J5OB 4A48A 4JV5J 5D4OA 1X5OA 2OTJS 1TL1A 1ZM4A 4CLFA 4DV5J 2QSFA 4DPXA 4NMLA 2VJUA 4TY8A 4HTIA 4AL6A 4OHYA 4RBUA 2E7WA 3QJPA 3D7SB 2ASYA 3D1HA 4DV0F 4LSNA 5D0EA 2XY5A 1QJHA 1WC6A 2IM1A 2DXEA 4PUOA 4DQIA 2YNGB 3NL0A 3JB9k 4MT1A 1FKOB 3CCTA 2CQ4A 2OEKA 2DXDA 4L76A 2J5AA 4ZOSA 1S1TA 3SV3A 1Q82T 1I6JA 1MMLA 3RU0A 2Y9HA 5JXSA 3PW7A 2DNZA 1OJ4A 4Q8EA 2VU5A 5C7PA 1IUJA 2VPYB 2G2OA 3SMZA 3PW4A 5AE1A 3BSNA 4YHHF 3HO1A 4OYAA 4ZVGA 2BRKA 1XR6A 4BS2A 2L41A 2GAHC 2V9WA 2JWNA 3EICA 3QWUA 5KG4A 2BKOA 2IRYA 4K2JA 8RUCA 1S59A 2R3VA 4XDDA 1U24A 2BKNA 2DNLA 3ULHA 3MUVP 1JQGA 4NMXA 1FXRA 3PO5A 4WK1A 1FJCA 1YZ6A 4F2SA 4F3MA 4M5MA 2Q66A 2ZHAA 4DL7A 3TQEA 4NLXA 5C25A 5E33A 3G8QA 1JJHA 2F40A 1NDKA 2AYMA 5F9LA 2A6MA 4LF1A 3Q89A 3AB4B 3QGGA 1GNKA 2V9KA 1FRHA 1LNQA 1ZM2A 2WBRA 4MYTA 2HFZA 2QGFB 5CZXA 1KLMB 5D4PA 1X5SA 2UXDJ 4WFYA 4NEYA 3GCXP 1M1HA 1VK3A 4LFAF 1JLQB 1R6VA 1TL7A 1CPZA 2K06A 3T19A 4G1PA 3W2VB 2AW0A 4OX9F 5GADU 3IR5B 4ZDNA 4LSZB 5KOXA 2DNNA 1NJWA 2VQEF 2D9OA 4KH1B 3RRKA 1T0TV 1SJRA 1HNIA 3KLIB 3FRZA 4RBTA 3ZZRA 3TQ1A 3PHEA 2V2ZA 2VZ9A 1FFSB 4NASA 1QUPA 3M2RA 3X3UA 2QX0A 5CAAA 1D0EA 2J0SD 5IQ6A 4KO0B 4ZLPA 4OLPA 5A2QU 2Y0SD 1NH7A 2IPOB 3M6XA 4NLOA 4ZVTB 4V19J 1Z2LA 3QATA 1XERA 3T1HJ 5HROA 1JX4A 2R7UA 2VODA 2B4PA 5F0UA 4HKQA 1QTNB 1RT7B 4HT5A 4ZIVA 4QIFA 2OMOA 2MKKA 3OTOJ 1KVIA 1N8RT 1D9DA 1G6BA 2KHCA 1XR7A 4NLVA 2RNEA 1X9WA 1XC9A 3ENQA 2UU9F 5D4LA 5F3ZA 1MMNA 3EE3A 2B5JB 4G65A 3KJQB 4NYZA 2BABA 2ZEJA 4N56A 5F8NA 5DM7Q 1NJIT 3N5BA 4FF4A 1VC5A 2ATLA 2G4BA 3CCZA 5FJ4A 5A8WA 2A2CA 2NXNA 3CJTA 4R0EA 2D9PA 3HKZD 1HFEL 3NXZA 2YX7A 4LFAJ 2BJ8A 3J7Z5 3ILIA 2GAGC 3QGPA 4ZN3A 2V4QA 5L1KA 1QY7A 1O6XA 2VUGA 3K7RA 3LAKA 4OX9J 3CCES 2MZQA 5DDPC 4WCEQ 4TVAB 1YKWA 4JBCA 5DGBA 3HD2A 2CJ9A 3KUHA 3ZZ0A 2VQEJ 3BKFA 3JYTA 3MOJB 3IS9B 4DSFA 3EVOA 2W4DA 2E1RA 2V8DA 4UOFA 3C6UA 5J2MA 3MHYA 2R7TA 3V81A 1OY6A 4PKDB 4RNNA 4K4YA 2J0WA 2XWYA 4QPXA 1U1OA 2HVDA 2FPHX 5CYMA 3QIPB 1RJJA 3NNHA 1RT5B 1H72C 2GMHA 3S6EA 2VFSA 1WSRA 2B7BB 2WCXA 4WKYA 4F0HA 2V2KA 2JEGA 1FI4A 4WTYA 3QFWA 4CTAB 3DMJA 3QAEA 2E5HA 2MKHA 4OZNA 5HO4A 2CQHA 3TEGA 2HNDB 1OMSA 1B0VA 3T5KA 2UU9J 2PMWA 3A12A 1EETA 3DM2A 3UN5A 3FBEA 3SCIE 4KQZA 1V3SA 1PYSB 3PRVA 4JI8F 1HKAA 1RTIA 3J81Y 4OIXA 1SC4B 3LO3A 1U1RA 5I3PA 2MZSA 4P71A 1YVFA 3UD5A 1YRTA 3HSJA 2YQ1A 2CPYA 2HQCA 3OVBA 3OQ2A 1N5YA 3Q0AA 4ILRA 2C2ZB 1JJ2R 3VF0B 4P72A 2ZDPA 4CI0B 3HSGA 1UVMA 3MR2A 2K1RB 1QAXA 1EKRA 3GSIA 3H8YA 2VD3A 4USTA 4ID5B 3ICLA 2J8AA 2Y1JA 2POKA 3NWGA 2O1PA 4Y2KA 2CNNB 1AXQA 1Q8BA 2Z4PA 4RW9A 3PX0A 1F0XA 2B8QA 3IRWP 1NJXA 1ZTWA 1WC5A 4IOCQ 2WOMA 2AYGA 4IFVA 3BB5A 2C2KB 1CSJA 2QA2A 1T05A 1ZETA 2F4FA 4I7FB 2OPPA 4YB6A 2H4WB 1H0HB 4IFYB 1U0HB 4K0KF 2HK3A 5IZHA 1LOUA 1VHIA 4ZHRB 3GP9A 2C3UA 1C0TA 2IYIA 4EK2A 2R8KA 3NGRA 4O3NA 3ISND 1RTJB 2MQQA 1RB0A 1RWKB 2L9WA 3R5AA 1KSPA 2YXLA 3G2XA 1U26A 2F65A 1T3OA 4BCAA 3MXHP 1RAFB 1RA6A 3PKYA 3Q2TC 3M8WA 2IC3B 5JVHQ 1HW8A 2AHOB 3TOQA 1NU4A 1S1VB 2CNOB 2F8MA 4DR6F 4LSLA 1SJ3P 2UVVA 1IWAA 2M2BA 5IT4A 3RRHA 4P2FA 3FK4A 4I0WA 2E1CA 3BBBA 1UVKA 2HKEA 2XMWA 1ZAVA 5KT7A 3F56A 3UCUP 4ZVHA 4WFBQ 2ADBA 1RKIA 1S9EA 2VBXA 2GW8A 1IKYA 3D3BJ 3SDEB 2R8GA 3V6JA 3OHBA 3BV8A 3I32A 5D15A 1U25A 5K9FA 4ZIWA 4YOEA 3VVTA 2AGQA 3DLKB 1WC3A 4QWDA 3RBXA 4DL6A 3RB0A 3G6ES 2JHEA 1TZ0A 1Q8LA 5E3QA 1YG0A 1D1UA 3RUBL 4TYAA 2HS3A 3EZ5A 4DUZF 2JFDA 4KRWA 2B9EA 3BQ2A 1FJGF 2FHMA 5HL7Q 3MOZA 2BJ9A 4K0KJ 4CIOA 3MAAB 1FRMA 2EVZA 2PA3A 1G2EA 2WONB 5D77A 5ETOA 4N41A 2XYPB 2PSZA 2AJFE 3EJMA 2XY6A 2K2PA 3Q23A 3FMBA 5CQGA 4QBUA 2DGWA 3I0RB 4FS1A 4WKRA 4USVA 1KTQA 1C0UB 4O4GA 5DQHA 2Z57B 4RKUC 1BQXA 3QJLA 4DF8A 1MU2B 3POTB 3OFGA 5AJ3F 1TAQA 3VAMA 3CCQS 4DR6J 1DTQA 3Q8VA 3GFYA 4CYUA 1T9XA 5DZ7A 4PEOA 2J76E 4JI0J 4G3IA 1WOSA 2EFNA 2NR0A 3U1NA 4J37A 3IXQA 1SJ4P 1UEVA 3FSYA 3KG1A 5C24B 3AJ2A 3BDPA 2ZE2A 1NNDA 1RT4B 2HNZA 4GVBB 1ZM9A 1RHKB 4EO8A 4NXMJ 1SBRA 1U8SA 1YRXA 3UNYA 2L08A 2P6SA 1CEZA 3I4HX 4Y6IA 4RW7A 4LF8F 2ZBCA 3CJKB 2VC1A 1XJWB 2GC8A 4QCLA 2HVIA 1RAGB 1YJTA 2GGPB 1S7IA 1GQEA 4DJBA 1HQEB 4F0KA 2LU2A 3L7PA 2RILA 5G0RB 4GKKF 3NOGA 2F5GA 4HVZA 1SL2A 1FNMA 1IQZA 1U09A 2C3PA 2JLGA 1VBYA 2AEFA 2QRRA 3H59A 2ZBIA 1J5OA 4ZVEA 2WB1D 1TP7A 4CLPA 3I9ZA 4L73A 5G4DA 2XQCA 2X3GA 4CO1A 3LUYA 3CO9A 5L8RC 3IR6B 4JI3J 1HNXF 4K4TA 5KFSA 3SBMA 2C1EB 3BDEA 3LQVA 2XZTB 3O44A 2YKMB 5JJBA 1YJRA 3OD2A 1S1WA 5KG1A 3DRPB 3MURP 1Q53A 2YNGA 2HLUA 2HSEB 1QUVA 2OPRB 3K5PA 3QSYB 3CJ3A 1QM9A 3GIKA 2ZBQA 1RU2A 3C66A 3GJSB 2UUWA 2FVQA 1FXLA 2F8HA 5B0CA 5HP1A 2UUCF 4M1KA 1WF0A 4IH7A 4TU7A 4GO7X 4NCGB 4OV6A 4C8ZA 4CLKA 1KRPA 1JMTA 3T6BA 3GFHA 4ED6A 3US5A 1B4SA 5HI7A 1S12A 3ADAC 3HJVA 3CMAS 3A3NB 1C1CB 4LF8J 3FGVA 3MMBB 1NK8A 1REGX 2HQ3A 2OSRA 5LSOA 2B9WA 5HVFA 3O6QA 5L9NA 3LP1B 4USIA 2ZH9A 5E41A 1JXVA 3CWJA 4CT8A 4JYAF 3MMJA 4MFBB 4N8NA 4GKKJ 2HHPA 5GAGI 4X4QA 3VAIA 1HD0A 2MQNA 1RWMB 3CDAA 3K5LA 1LW0B 1B0PA 5FDLB 2MKYA 3J81j 2MHEA 4WZQA 4C0OC 2DGXA 2AEMA 2I8EA 4C8YA 1KLMA 2QMXA 2C28A 2M0GB 4XTTA 2OMLA 5D6GA 1WD6A 4O23A 1HNXJ 4B3SF 1M1GA 2LXIA 4V19X 3CNQP 2G1DA 4DQQA 1ZOTA 2XCAA 3EVWA 5BJRA 3MEGA 4C6AA 1Q5YA 3MM5A 1NPRA 3IFEA 2XM3A 1PG5B 1HQ2A 2VBWA 2E9ZA 2WVFA 1FDBA 1OQ6A 2LEBA 5K5MA 5CYQB 5ETNA 1CULB 4R25A 3HT0A 4C0BA 1AFJA 2VFVA 2LMIA 2EK6A 2UUCJ 4JI1F 3TZXA 1S0NA 2FIUA 5KT2A 3OL6A 3RGIA 4KO0A 5DZ6A 5MLCV 4DSKA 3B78A 1VC6A 2PDAA 2XS2A 2WSEC 1OY9A 3TVYA 1WEZA 2QJ3A 1WKJA 4OX6A 1RT7A 2CAJA 4F4KA 1PO6A 2ASJA 1HD1A 1KKHA 2NXJA 1WKKA 5L39A 1NSKL 2DRAA 1RAAB 2VC0A 4ZS6A 3VAHA 4CLUA 5B0BA 1Y5IB 4U67Q 3HVAA 3M05A 2V67A 5F8LA 5F0WA 4NA1A 3G6YA 2EFVA 1T9VA 2FVCA 3SCKE 2OO4A 5D8HB 4EGLA 5FIIA 3R7SB 4ECYA 1TKXB 4CH0S 2E5LF 3OUYB 3MAQA 2B5JA 3MCMA 2CFXA 4AD6A 4Q7AA 3Q2SC 5H9EJ 1TQLA 2N4DA 1I5OB 5U47A 4KV8A 2MZTA 1X0PA 2QT7A 3K57A 3ISZA 3QT7A 2OPQA 4OZ5A 2CUYA 2AZ3A 2PI5A 5CABA 2R9LA 2B4OA 3W8GA 2E5IA 2R7WA 4QPTA 4UZBA 3DYAB 3V4IB 3ET6A 1NM2A 3DRXA 1IBKF 1JLBA 2BW7A 3L95X 5EX3A 4ED5A 2JNJA 3PHTA 4YQWA 1YQHA 1N0UA 2YNFA 3CMQA 2C3OA 3ILJA 3KLVA 2HNYB 2VOOA 1FRKA 3UE2A 3IWLA 1VRTB 1B0TA 2BANB 2D1CA 3IG1B 5GVQA 1HI1A 3R1LA 2VFTA 4LFCJ 4LT6A 3J80Y 2O01C 2AJQA 3H5SA 3ZC4A 2M8HA 1JLCB 2GQQA 1XMQJ 1FWPA 3OTEA 3DHXA 2BR0A 3GB0A 2RVJA 3LPYA 4DL0C 4JI1J 4RUBA 5E3PA 1ZA1B 1S0OA 3QIPA 1FK9B 4KIAA 1RT5A 2OAUA 4WXWA 3S8SA 2KJWA 4OYZA 5CXTA 1SXLA 7FD1A 2EG2A 1HBMB 3FFIA 2V2VA 3DLGA 4MK9A 3ZZYA 1KQSR 3BO3A 4B9NA 1VQNS 3ETMA 4PXDA 4DR4J 2OFGX 3MGJA 4M5NA 3B4MA 4C11B 1RHQB 3JTOA 2P8IA 2CPDA 4PQAA 3RBEA 3NS6A 1Y5LB 4CLYA 3IAS9 2OTLS 4ZPWR 2E5LJ 1V5IB 3OPKA 1NSAA 4PG5A 2QC3A 4P2XA 5DDOC 3MD3A 3VGSA 3F41A 4M5HA 4A46A 5D0HA 2D69A 4DV6F 2KG0A 3R6GB 2IYGA 3BH7B 2V94A 3MMCB 4KT0C 1XBWA 1RHJB 2DNMA 1M5OC 2AJ0A 3DOKB 4Z7CA 1U4BA 1RWUA 4NOHA 1N56A 1UETA 5I3UB 3HFKA 3MR7A 4OI3A 3AY0A 2K1RA 1B3TA 2Y3YA 5HBMB 4QYRA 2VASA 1H7XA 4ES3A 2XS5A 4C3KA 4Z37A 1NZAA 5CCMA 3GV8B 1RE1B 4ID5A 4FYYB 4W90B 1N32F 3O1LA 3GV5B 3QGIA 3QJJA 4IG3B 2ACYA 3MEEB 3DI6B 4NLTA 7AT1B 2YNHA 1Q5VA 4I2PB 4PG8A 4ED4A 1SJFA 2MY7A 4A8MP 2H1YA 3QFHA 1QLNA 3PEJA 2QA1A 2HGNA 2HVEA 3CDEA 4B9LA 3M8PA 1O5JA 4IFYA 5E5NA 2LEPA 3IGNA 4V1Ak 4P75A 5BYRA 4P9SA 2OD4A 3AOAA 2CQGA 5HVHA 1X4CA 4DV2F 1RHRB 1JLEA 2E1AA 2KN4A 2DH8A 1LWEB 1RTJA 4K8RA 2EBGA 3R5BA 5J1EB 5DG9A 4QR1A 2L9DA 4ITSA 3HSZA 4MTPA 2PGCA 1NZ8A 3EM1A 4O44B 4IQMA 4EMDA 3A8IA 1WTBA 2IC3A 4RJVA 1L3UA 4I2QB 2MZ1A 3D6TB 1RCOB 1S1VA 4EZ6A 4B3MF 4A8OA 1UFLA 1RU1A 2XEXA 3T41A 4LF9F 2NZCA 1RAJA 4L72B 4RZRA 3IMQJ 4QIVA 1LQ9A 5LSRA 5EN1A 1TL4A 2EI5A 2C2MB 2CQ2A 2KH9A 2HPUA 5H9FK 2N4CA 3SDEA 3W5YA 3CEDA 4RUCA 1JIHA 4ZVUB 1FXDA 1V6HA 1ZYQA 2Q79A 4EU0A 5CCLA 2H51B 2ZH5A 1FRIA 4YMEA 1RT6B 2RB7A 3M6UA 3O3LA 2MSSA 4DFJA 3M9OB 2MKIA 2D3OR 2DR5A 3B82A 3MZIA 2FHOB 3CC4S 5KT4A 3LOUA 1ZAWA 2G0IA 3L7OA 5A0YB 1UA0A 2P6TA 2AD9A 1U6FA 2FY8A 2DNOA 3M6WA 3NCQA 2AP6A 1Q0NA 5K8OA 3MTKA 2W7AA 3T5LA 3JTNA 2LQBA 2XZWA 2DNGA 4B9TA 4LF4F 2WONA 3TAQA 1NK9A 1NDCA 3MPDA 3GPAA 4DV2J 1LFWA 2UUBJ 3CO0P 2ZJQQ 2JVOA 4G6VB 2CYYA 1SQGA 1UFKA 2DR8A 2YY3A 1RZMA 4ZLNA 1KBRA 5K8PA 3GILA 4MAKA 4NI2A 1C0UA 4OZJA 4OJGA 3G82B 2MQ8A 2LQ8A 3UDCA 2VB6A 4DX6A 1CQNA 3J7YU 3Q8QB 3POTA 4Y65A 4ED8A 2M5YA 2OGUA 3JTPA 4ZVQB 4A8XA 4YY3F 1S7HA 3NMAA 2J6SA 4IR9A 2H9ZA 1SIZA 4ECUA 2HGMA 1R0BG 1OO0B 2ILZA 2M3DA 4NL5A 4FBTA 4X4RA 1RT4A 2XMVA 2FZGB 2VFUA 4OMFG 2B9YA 2DCUB 4P74A 2MYFA 2Y1RI 5K8MA 2RRBA 4O3QA 2DEIA 2IRXA 3HHLB 1N34F 2J9EA 4MH8A 1B7FA 2FVPA 3CJ0A 2RHSB 3WIVA 2GGPA 3SFUA 3MR3A 3OR1A 4FPIA 2BX6A 2QLJB 3K5OA 5G0RA 2Z8QA 3UDLA 4OYXA 2V8PA 3K5NA 3D6FB 3MD1A 8AT1B 1IN0A 5LMNF 4RUAA 4RW4B 1QSSA 1XNRF 2LQ5A 4YDXA 3QO9B 3BBFA 1WEXA 1K44A 3JS9A 2BBEA 2W2MP 4RL1A 3AB2B 5KG6A 2RUGA 1T9UA 2RS8A 2JDJA 2NSBA 3SI8A 1TL1B 3G8TA 3CCRS 1VQYA 2WSCC 2R2TA 2BE2B 4DV7F 2A6OA 1YJ9S 1XNQJ 2DVIA 1RT1A 3ITHA 4JI5J 1FFGB 2HS4A 3VR1A 2GJ2A 2YKMA 4ED3A 4WWSA 1TMMA 2PMZD 4JI7J 2IM0A 3MPUB 1BD6A 4ETZA 2OPRA 5E3AA 1RHUB 4YY3J 4PUOB 1S0VA 3IA0A 2BVZA 5IWAF 4JB8B 1N48A 5J1NA 4LRFA 1RAOA 1H6KX 1YTYA 2A10A 2HHTA 4ECXA 4F26A 2AT1B 4HTJA 3PRBA 4TQSA 3D67A 2IMOA 4OI1A 2HBRB 5EUHA 3CT9A 3TX0A 3C19A 2E44A 2FQQB 4CNYA 1M5KC 3MMBA 2V69A 4IH5A 3TUIC 3LAMA 3AODA 2ZH4A 4J9LA 3T5HA 4X84A 1CQMA 2GO8A 1R43A 1NK0A 1FNXH 2BQUA 2X51A 4MFBA 4LF7J 4MMOA 1VQOS 3GYNA 4TKTA 1RACB 3K5MA 1G4CA 2VG7B 3FBBA 4CZCA 1K0VA 5F8GA 3F73A 1GX6A 5KG7A 2IJNA 4K5RA 4FF1A 2HHXA 3DGPB 1LW0A 4CO4A 2HWIA 1Q16B 4X65F 2A2DA 2ZZTA 1UKUA 1HI8A 2A3JA 3N0VA 4K4SA 4U9RA 5HQLA 4B17A 1UJ6A 3H5XA 1MG7A 1X4FA 1TL7B 3RRGA 5T7LA 4XK8C 2ZHOA 3BR8A 2LECA 3B8HA 4B3RJ 1ELOA 4AFFA 2W2PP 3P49B 1VCTA 2ZJPQ 1SL1A 1A6LA 2R7VA 5FLXY 4C7QA 1SIWB 1APSA 3M8YA 1CULA 1KTVA 5IWAJ 1AYEA 3KLEB 1CLFA 3HM9A 3M2RB 2IMWP 3IBFB 2GZOA 2H5EA 4OLOA 3TYTA 1MROA 2VQFF 4AXJA 2LDYA 2HQFA 1U2CA 1SV5B 3HCXA 4Y34A 4F8RA 4LIRA 3R2CJ 1GMWA 1ZZNA 1OSCA 2YVSA 4HHUA 4F4XA 1P1LA 1YK9A 3J7ZT 5HROB 4CH7A 4DF4A 2VKRA 4NZ7A 5I3QA 1NAQA 1S6OA 2FJDB 3PFOA 5K8NA 4DZDA 3W65A 3E2EA 2XMTA 3DLBA 2PI4A 1TKXA 3OUYA 4I67A 4KGKA 4BDPA 4FNHA 2BUNA 1HMVA 2XMKA 1MN7A 2LYVA 4OI0A 2ZH2A 1R27B 3P8BB 2GQ2A 2AKWB 4DDFA 2AX1A 3KYLA 1XMBA 4RU9A 2NPFA 5GMKa 3RB3A 1RP5A 3KJVB 4DR7F 4KC5A 4X65J 4ILLA 4QZVB 3KUEA 4F67A 3CD5A 4F4WA 3Q8PB 5A8WB 5T41A 3WX8A 2MQLA 2W4CA 4JI2J 4USWA 3OR2A 3P5BP 3MECB 2HNYA 1VRTA 2BANA 3TNVA 3R97A 3BN7A 1QE1B 5KFLA 4ZMMA 1N6QA 3NBPA 3CCSS 4UTGA 2DT9A 1KOHA 3CVKA 3FSIA 1JLCA 1UTAA 3K0JA 1REVB 1L3SA 2UUTA 3C6UB 4F50A 3DDKA 2DGTA 3MM7B 5J2MB 4EBDA 3PW2A 3ENVA 3V81B 3RAQA 1FK9A 4MIAA 3M8SA 4WBFA 3OLAA 1KHWA 2ZUAA 1ACMB 3ZTOA 3EGNA 1GT8A 2DO0A 2DPIA 1PBAA 1HBMA 3J81U 2KZMA 4USMA 4OYWA 4EWTA 3AD8C 2FGOA 1URRA 1AZSB 2D74B 5K20B 2KXHA 1IR0A 4DZ6A 3KJNB 4C8MA 2DY1A 1EIYB 4LBHA 3P4UB 1T9TA 3THVA 3R7NB 2PT0A 4OJHA 1S4FA 2FGCA 1KVJA 3DN9A 1N5SA 2AYEA 1Y3JA 1KWMA 5FD1A 3KG4A 2DGSA 4GVLA 3CCVS 4QU6A 4Q8FA 3A13A 3CSKA 3ZXWA 2YWEA 4H4MB 1D9FA 4U95A 3H4DA 4I4BA 1EAYC 2MJUA 2J0QD 5A6WA 1NEEA 2E7XA 3JQMA 4ANDA 3R9LA 1HARA 1I94J 2XNRA 3OXFA 3Q86A 2AQ4A 2E66A 4IRDA 3DDNA 5HMZA 1BWVA 4WTOB 3P3DA 5GAHI 3TA1A 2KRBA 4DLEA 3QAUA 4DUYF 4N77A 2P2CB 3DOKA 1N5YB 2W8KA 5KFKA 3BKUA 4KH0B 2GIQA 5GAEI 5AXLA 3UN3A 1VQPS 5DLFA 3SXLA 1HR0F 4A8KA 5HBMA 2R7RA 4LFBJ 2W1BA 1HQUA 4DSJA 5ETVA 4RBVA 2XO7A 4YR2A 3J7AN 1NB2A 4C0HA 4MKBA 4K4UA 2AIRB 2WAQD 1R31A 3MEEA 4R8UA 3DI6A 3M1VA 3NS7B 4ZJLA 4IQXA 4DEZA 2Z2YB 4ZITA 2XS7A 2OSQA 3KLGB 3LWLA 1G7CB 1P1TA 4IFVB 4OYOA 2P9GA 4MKYA 2ZH6A 2HQDA 1VDHA 1J2VA 3Q22A 1TR0A 4YR0A 1KQFB 3T1AA 4QIEA 3D4JA 2JLEA 2WZ1A 3MM8B 4EFAC 5EWGA 5MAOA 1Q7LB 1IKVB 1LWEA 5AE2A 5IT0A 3KK3A 5CYJA 3MEKA 2FJVA 1RWOB 2RSQA 3TWZA 1UPMB 3TEHB 4UF4A 3G9CA 4KFBB 2HS0A 1D09B 4LR7A 4O44A 2XNQA 1P9YA 1LK5A 4M5LA 2LCWA 4UW2A 4ZPAA 2R7SA 5KFFA
chains in the Genus database with same CATH topology
3ZTSA 3BBCA 3G2XA 1XIQA 4KPCA 1HLWA 3FC9A 3FBFA 4DZ6A 4S0MA 1S59A 1NB2A 1BHNA 3FKBA 2AZ3A 3ETMA 4ENOA 5CABA 3WX8A 4F4AA 1XQIA 3Q8YA 4F36A 1NSQA 1JXVA 4ANCA 3FBBA 1HIYA 3ENAA 2DY9A 2BEFA 1KDNA 1NPKA 1NLKL 1NDLA 1S5ZA 5CAAA 1NDCA 3MPDA 3GPAA 4HR2A 3VVUA 3DKDA 2CWKA 1LWXA 3NGSA 3VGVA 2NCKL 4W98A 4UOGA 5IOLA 3L7UA 2AZ1A 3EVMA 1ZS6A 2B8QA 1BE4A 1NDPA 1WKJA 1NDKA 3DDIA 2HVEA 3EJMA 3FBCA 3ZTQA 1U8WA 2DXEA 3VGSA 3BBBA 1NCLA 1WKKA 2BX6A 3Q89A 3ZTPA 3Q8UA 3VGUA 1NSKL 3ELHA 3VGTA 4ANDA 3R9LA 3FBEA 4UOHA 2B8PA 3Q86A 2DXDA 1LEOA 1BUXA 3PRVA 1UCNA 2DYAA 3FCWA 4ANEA 3Q83A 3EVOA 1NHKL 3BH7B 4FKYA 3BBFA 3B54A 1NSPA 4UOFA 1PKUA 1K44A 3JS9A 4O0NA 4WBFA 2VU5A 5C7PA 2ZUAA 1WKLA 3GP9A 3EVWA 3B6BA 3BH6B 3ZTOA 1MN7A 1VYAA 1MN9A 1EHWA 1S57A 3ZTRA 4EK2A 3EMTA 4C6AA 3VVTA 3NGUA 1B4SA 1W7WA 4FKXA 1NUEA 1F3FA 3Q8VA 2HURA 1PAEX 3NGRA 4CP5A 2HVDA 3PJ9A 3EE3A 5BXIA 3FCVA 4DUTA 1HHQA 1B99A 2DXFA 3EICA 4DI6A 1F6TA 3NGTA 3EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTS A;  3BBC A;  3G2X A;  1XIQ A;  4KPC A;  1HLW A;  3FC9 A;  3FBF A;  4DZ6 A;  4S0M A;  1S59 A;  1NB2 A;  1BHN A;  3FKB A;  2AZ3 A;  3ETM A;  4ENO A;  5CAB A;  3WX8 A;  4F4A A;  1XQI A;  3Q8Y A;  4F36 A;  1NSQ A;  1JXV A;  4ANC A;  3FBB A;  1HIY A;  3ENA A;  2DY9 A;  2BEF A;  1KDN A;  1NPK A;  1NLK L;  1NDL A;  1S5Z A;  5CAA A;  1NDC A;  3MPD A;  3GPA A;  4HR2 A;  3VVU A;  3DKD A;  2CWK A;  1LWX A;  3NGS A;  3VGV A;  2NCK L;  4W98 A;  4UOG A;  5IOL A;  3L7U A;  2AZ1 A;  3EVM A;  1ZS6 A;  2B8Q A;  1BE4 A;  1NDP A;  1WKJ A;  1NDK A;  3DDI A;  2HVE A;  3EJM A;  3FBC A;  3ZTQ A;  1U8W A;  2DXE A;  3VGS A;  3BBB A;  1NCL A;  1WKK A;  2BX6 A;  3Q89 A;  3ZTP A;  3Q8U A;  3VGU A;  1NSK L;  3ELH A;  3VGT A;  4AND A;  3R9L A;  3FBE A;  4UOH A;  2B8P A;  3Q86 A;  2DXD A;  1LEO A;  1BUX A;  3PRV A;  1UCN A;  2DYA A;  3FCW A;  4ANE A;  3Q83 A;  3EVO A;  1NHK L;  3BH7 B;  4FKY A;  3BBF A;  3B54 A;  1NSP A;  4UOF A;  1PKU A;  1K44 A;  3JS9 A;  4O0N A;  4WBF A;  2VU5 A;  5C7P A;  2ZUA A;  1WKL A;  3GP9 A;  3EVW A;  3B6B A;  3BH6 B;  3ZTO A;  1MN7 A;  1VYA A;  1MN9 A;  1EHW A;  1S57 A;  3ZTR A;  4EK2 A;  3EMT A;  4C6A A;  3VVT A;  3NGU A;  1B4S A;  1W7W A;  4FKX A;  1NUE A;  1F3F A;  3Q8V A;  2HUR A;  1PAE X;  3NGR A;  4CP5 A;  2HVD A;  3PJ9 A;  3EE3 A;  5BXI A;  3FCV A;  4DUT A;  1HHQ A;  1B99 A;  2DXF A;  3EIC A;  4DI6 A;  1F6T A;  3NGT A;  3EM1 A; 
#chains in the Genus database with same CATH topology
 4I2Q A;  1QVF R;  1IJF B;  2UXB F;  4X4V A;  1WC4 A;  3TRG A;  1GMV A;  4ECW A;  3HLU A;  5LMU J;  1PJ5 A;  4NXN J;  4O3S A;  1TMJ A;  4NPO A;  1VQ7 S;  3TA2 A;  3VVU A;  2K3I A;  3VGV A;  1X9S A;  4B3T F;  3SQG A;  4WYW A;  4OFZ A;  1SH2 A;  2MJN A;  2FVS A;  5I42 B;  4LRB A;  3KDO A;  1EX8 A;  4JV1 A;  3TUJ C;  1HNW F;  3KNA A;  5KFP A;  1S9E B;  2HAF A;  3DLE B;  1I51 B;  1RWV B;  3NY0 A;  1RT6 A;  3M30 B;  5L1I A;  1S6P A;  4WZM A;  1SKW A;  1HWU A;  1RHM B;  3HHD A;  1KD1 T;  2NPI A;  5KG0 A;  1WKL A;  1NJZ A;  4LJM A;  1GAO A;  2GHV C;  2RF2 B;  1KOO A;  1PYO B;  3BGL A;  2QLW A;  4X2B A;  3DRY A;  1JNR B;  5A0Y A;  3RR7 A;  2LDI A;  4M5D A;  1HHT P;  1PIL A;  2QLB B;  2B43 A;  1K0T A;  4LF6 F;  2HEK A;  2YKN B;  2VH7 A;  2CG4 A;  1T94 A;  4DXL A;  2HBY B;  2R8J A;  4C3L A;  3C3L A;  4LVO P;  1FNO A;  2V34 A;  3OHA A;  2CJA A;  3JSM A;  2UZA A;  4LBP A;  4JV5 F;  3RJM B;  2ROP A;  2KVI A;  3QZ7 A;  4PWU A;  4DV5 F;  3R8Y A;  4TQR A;  2OUG A;  2QA4 S;  1Q81 T;  1HNV A;  3G82 A;  2RT3 A;  3JSB A;  3NCP A;  1ARO P;  1FE4 A;  4O4G B;  4FNI A;  2QZ8 A;  1IQT A;  3O2I A;  1TKZ A;  4JP8 A;  1RA7 A;  5DQI A;  5GMD A;  3OSN A;  1R0C B;  3P6Y C;  3JSR A;  4HI1 A;  3H5U A;  3ETO A;  5EWE A;  1DTQ B;  2ASD A;  4P7V A;  4A8Y A;  1F5A A;  2HQG A;  3JXO A;  5ETL A;  4GRS A;  2IJR A;  2V8G A;  4URS A;  4URQ U;  1U0S A;  3AOC A;  2VA2 A;  2LA4 A;  3KUG A;  3M8R A;  4FXV A;  4JOU A;  2M7S A;  3K58 A;  4U8Y A;  1XMO J;  2ZE2 B;  4F3O A;  1DLO B;  2KFN A;  1HNW J;  2CQP A;  2NXU A;  3TI0 A;  4L3K A;  1VFJ A;  3I55 S;  4NRU A;  3OFF A;  3PKM A;  3HF5 A;  2QV6 A;  4H54 A;  1FRJ A;  4XDC A;  3GJR B;  2F7V A;  3QT6 A;  2KXF A;  4NWB A;  1QAY A;  1RWX B;  3LW5 C;  1C1B B;  1TV6 B;  4P2S A;  3CXC R;  4E8U A;  2I1R A;  3G86 A;  1DAX A;  2I2Y A;  1RAH B;  1X7V A;  1J27 A;  2HZA A;  3CW2 C;  5IXU A;  3IWX A;  1GK8 A;  4J9V A;  3HKW A;  3G6X A;  4RW4 A;  4LF6 J;  3VGU A;  1GXU A;  3EPG A;  2XHC A;  2QL9 B;  1BY9 A;  1RI7 A;  1L3K A;  1JLG A;  4PXB A;  1WG5 A;  1RK8 A;  3G8S A;  4X4P A;  2FLP A;  1P9Q C;  3HMJ G;  2HHU A;  4NA3 A;  4E2F B;  1V3Z A;  5KFE A;  1WHY A;  4FKX A;  6FD1 A;  1F3F A;  2ZD1 B;  4DCP B;  4RWW A;  2UXD F;  2KT3 A;  2BE2 A;  3UFC X;  4L75 A;  1JNZ B;  2ZWO A;  1T3N A;  4J9M A;  1WC0 A;  4XAK A;  2FVR A;  2IAJ B;  1Y7P A;  3AXM A;  1R0A B;  2H3E B;  1ZH5 A;  1BHN A;  1N5T A;  2JLF A;  3IGV A;  1ITP A;  2Y8W A;  2OJ3 A;  2QFI A;  3BSA A;  2UV8 A;  1S1W B;  3GQC A;  4NLY A;  3HK2 A;  5F8H A;  2WW4 A;  3QRQ A;  4CO2 A;  2VFR A;  4C8K A;  3EVM A;  4M5J A;  2CZ4 A;  5HP1 B;  4ZJO A;  4ICL B;  2F4V J;  2OFH X;  2CJY B;  4Y28 C;  1WDD A;  2N7Y A;  5SUH A;  1DTT A;  4RX6 A;  2ZOG A;  2WVC A;  4B9V A;  2K8G A;  4FKY A;  3T1H F;  1NBE B;  3GMG A;  3PJX A;  4C4W A;  2XLK A;  1PJ7 A;  1JLA A;  3TR5 A;  5I4M A;  2M9K A;  4KPY A;  4AL5 A;  1BQN B;  2B51 A;  3BO2 A;  5F9N A;  1QSY A;  3OTO F;  1NK7 A;  2DNH A;  3TJ8 A;  4DV4 J;  2G13 A;  5LM7 E;  5LJ3 Y;  3X1L B;  1C4A A;  3KLH B;  4NLP A;  3EDQ B;  3MR6 A;  3N4W A;  2FHK A;  5H1S V;  2HGL A;  3PR4 A;  4QIW D;  2VG7 A;  4IRC A;  2CNL B;  4PPZ A;  1RAD B;  4CO5 A;  4OYB A;  4Y2M A;  2YH1 A;  1SQE A;  3DGP A;  3GLJ A;  2C2N A;  1DQ8 A;  2AX0 A;  1TFW A;  1NLK L;  2W9C A;  2APO A;  1S5Z A;  4MK8 A;  1VQK S;  2GIF A;  2RML A;  3AFG A;  2GX8 A;  4USU A;  2IBK A;  4PRF A;  2HK2 A;  3FSX A;  4YB1 P;  1IWG A;  2WHO A;  1SJQ A;  2HMI B;  1VR6 A;  1U6Z A;  4OYP A;  3RTV A;  4CO3 A;  4DR3 J;  1K8A T;  3BJY A;  3MEG B;  2MQM A;  3FEY B;  3OFE A;  1LKZ A;  3R5D A;  3MM5 B;  1IBM J;  4FDF A;  1RTD B;  1YZ7 A;  2DTJ A;  1VQL S;  4CO0 A;  3KLE A;  8ATC B;  1WC1 A;  3CME S;  1SV5 A;  1T03 B;  4DPO A;  4ZP8 A;  1OPI A;  4KGM A;  2RRN A;  5B0G A;  3ENA A;  1KVK A;  2RQM A;  4LF2 A;  2ERR A;  4ZLL A;  3K59 A;  1KFD A;  1WG4 A;  3I5B A;  3TP2 A;  1PSD A;  3FRY A;  2NRE A;  4P10 A;  3DU6 A;  1X4D A;  4PAB A;  2I38 A;  5SZT A;  1LWF A;  4NLG A;  3HP6 A;  1JLF A;  1S10 A;  1VIO A;  3D66 A;  1RTH B;  3D6H B;  1LEO A;  4ZPC A;  4A8W A;  4HH1 A;  3LH2 S;  3J80 U;  1ZTT A;  1Q4R A;  4ZVP B;  1LW2 B;  2YWG A;  2BE9 B;  3HHL D;  3KJV A;  3K8W A;  1S57 A;  1NRK A;  3THP A;  4BBY A;  4KV8 B;  2Z56 B;  2OPQ B;  2V4R A;  2H48 B;  2KDO A;  1SKU B;  5EDW A;  3ET6 B;  4OQJ A;  1IKX A;  1JLB B;  2CAD A;  4DV1 J;  3MEC A;  2YNF B;  1VGY A;  4YN3 B;  1QE1 A;  2CWX A;  1UVI A;  2BM0 A;  1PYT A;  2QMW A;  2CQ0 A;  1Y00 A;  4LUB A;  3V4M A;  3DKD A;  1CJU A;  3OTD A;  1IBC B;  1UEU A;  3L9Z A;  1REV A;  5J2P B;  1S1U A;  4PCQ A;  4NLS A;  3MM7 A;  3CCJ S;  1X4H A;  2MST A;  5JVG Q;  3EZU A;  3MWB A;  2IJF A;  4YR3 A;  3A8J A;  3G87 A;  4U8V A;  3CIZ A;  3HFZ B;  4UQG A;  4WFZ A;  2DHH A;  1HWK A;  3DRS A;  4DFK A;  3W9J A;  4ANE A;  1OWX A;  1VQ8 S;  5DM6 Q;  3GJT B;  1VQS A;  2LQ9 A;  3RB6 A;  1BQM B;  2W2O P;  1AZS A;  3FFI B;  4NLD A;  4DR2 J;  4AUK A;  1HPZ B;  4WE1 B;  4OHZ A;  3DLG B;  4H4O B;  3I31 A;  1W2I A;  2ZOF A;  4EYI B;  3H90 A;  3E01 A;  4JI4 J;  1R8C A;  4QYZ J;  1U45 A;  4PWD A;  1NKC A;  1FDD A;  2BAC A;  2FHJ A;  3LWM A;  3LAL A;  2NLW A;  4DS5 A;  3MFH A;  1GXL A;  5GAG U;  4LQ9 A;  4H4M A;  1G1X A;  1FEH A;  4O4R A;  4NLU A;  4KR0 B;  4OI2 A;  3BYR A;  2DR9 A;  4OZ2 A;  4JV0 A;  5BYQ A;  1CG2 A;  1QVG R;  1UAW A;  5KAK A;  5J2Q B;  3GE9 A;  3PVX A;  3VGT A;  4ES1 A;  3TW0 A;  2PFD A;  5DDR C;  1NK6 A;  4X4U A;  3UDV A;  4CLS A;  4Q45 A;  3LAN A;  2HRY A;  4N76 A;  4USK A;  1R89 A;  1PAU B;  4AXI A;  1IR1 A;  3PO4 A;  2IVF B;  3IBW A;  4LVN P;  2W9A A;  4DU7 A;  3V6H A;  2GO9 A;  2W2Q P;  3OL7 A;  1S6U A;  2IDE A;  3A3O B;  5BXI A;  1TUV A;  5HAT A;  2M70 A;  4HDG A;  1CJK B;  3IM8 A;  1DBD A;  2W8L A;  3VV2 B;  1UVN A;  3PJW A;  4DU8 A;  5HMY A;  6AT1 B;  3K8V A;  5JMN A;  3KLG A;  2YNH B;  4LF5 F;  2GHW A;  2XO6 A;  2HFO A;  3PR5 B;  2CPJ A;  4N7T A;  2WBM A;  1UL3 A;  4UY8 5;  3BGF A;  5K14 B;  4CRJ A;  2JEI A;  2GVZ B;  4LRC A;  2FC9 A;  3M8P B;  1H74 A;  1N36 J;  1T9Y A;  4GO5 X;  2JOQ A;  2EG1 A;  3O5T B;  3U1M A;  2X1A A;  1HBU A;  1NPP A;  4B3O B;  3MM8 A;  3LA0 A;  1J5E F;  1CC8 A;  4NEZ A;  1IKV A;  4X66 F;  3Q24 A;  4DX7 A;  2JEJ A;  1S6Q B;  2XSF A;  1JLE B;  1TAU A;  5KT6 A;  3MM9 A;  4KFB A;  2EBE A;  1WEY A;  2AJ2 A;  3N6M A;  2BW2 A;  3FQK A;  3B4D A;  4E98 A;  1FVQ A;  3EMT A;  1SPB P;  3WZ0 A;  2FJW A;  5ETP A;  2CPF A;  5HMX A;  4QU7 A;  4IO9 Q;  1LXJ A;  2M8D B;  9RUB A;  3AT1 B;  1U1N A;  4MK7 A;  3NAI A;  4OZ1 A;  3NGT A;  2F8E X;  1PIE A;  5AXM A;  9ATC B;  3OT9 A;  5KFM A;  2UXC F;  5B0A A;  2GIR A;  1E6Y A;  3G6V A;  1HYS B;  1Q78 A;  4JI0 F;  3C46 A;  5L38 A;  3HSD A;  2OP5 A;  2OPS A;  4HH0 A;  3UDE A;  1PBU A;  4DFP A;  5I42 A;  2Z2Z A;  3A1Y G;  3E8O A;  3PAC A;  4N5S A;  2DEJ A;  3LP2 A;  1AA1 B;  3DLE A;  2MLY A;  1H98 A;  2DNY A;  2I0X A;  3ZTQ A;  2OEL A;  1GX5 A;  4NXM F;  4DWI A;  3M30 A;  4DFM A;  3TAR A;  2BOP A;  4DPT A;  1FD8 A;  4LRD A;  1UMJ A;  4OHW A;  4P7T A;  4HT7 A;  2RF2 A;  2R8I A;  2Q6C A;  4LF5 J;  3EZO A;  5IM0 B;  3PW0 A;  1HWJ A;  3CCL S;  3V6K A;  2BQR A;  4EO6 A;  3I4P A;  3D0H E;  2PD1 A;  2YKN A;  4U6P A;  2J8S A;  3H40 A;  4FYD A;  3D28 A;  3D6M B;  4ILM A;  1CJV B;  2WB4 A;  2Q43 A;  4WFA Q;  1J5E J;  4X66 J;  4ENO A;  1X4E A;  2COL A;  4LR9 A;  2GJF A;  2VIH A;  1LFP A;  1GFW B;  1ZAX A;  3LGH A;  5AT1 B;  4LQ3 A;  4JI3 F;  3GZ7 A;  1N52 B;  2E7V A;  4NI2 B;  5C42 A;  2ILY A;  3GTY X;  3UCG A;  3MPW A;  2FZC B;  1OYD A;  3TAP A;  2LXF A;  4AT1 B;  4KB7 A;  2MMY A;  3W8P A;  3ZTP A;  1GTH A;  2X3D A;  3ZO7 A;  2UXC J;  2KZZ A;  1RT3 B;  1H2U X;  3UCZ P;  4QJV A;  1OSD A;  2HFU A;  2H5I B;  4CT9 A;  1NJY A;  1NSP A;  1BMQ B;  1YGY A;  2R7X A;  2ALZ A;  2KFY A;  3EXY A;  2KO1 A;  3AHP A;  2D7S A;  4F2R A;  1DLO A;  3AOB A;  2XI3 A;  4NYP A;  4C97 A;  4EBC A;  2C2O B;  1U1K A;  3BGO P;  3PTW A;  1KLN A;  2BQ3 A;  2V50 A;  3WC2 A;  2QA4 G;  3CCU S;  1C1B A;  3PEH A;  2WRM A;  1TV6 A;  2V68 A;  3S7R A;  3DXB A;  3W60 A;  4IOA Q;  1P6T A;  4DL5 A;  2V2Q A;  4WK3 A;  4RNO A;  5HLF A;  2IIH A;  3M7V A;  4Q44 A;  3E3X A;  2VDI A;  1WDT A;  3KHR A;  5F8J A;  2L9N A;  2DRB A;  3OR1 B;  1Z4U A;  1U2R A;  1YSJ A;  4TYB A;  1DJ0 A;  1SVD A;  1SC1 B;  4B9S A;  2EFG A;  1QAJ A;  4PPD A;  2HFS A;  3UD4 P;  3NNA A;  1FHT A;  4UOH A;  2B0G A;  1SI9 A;  1S9G A;  2JC0 A;  3SSQ A;  1RYR A;  1HWI A;  1CS4 A;  4NYO A;  3AAW B;  3H42 A;  2ZD1 A;  4QW8 A;  5IC4 B;  4KAI A;  1JXL A;  3M2U A;  1MN9 A;  4W4M A;  2IAJ A;  2EKY A;  2X1B A;  3SSR A;  4C98 A;  1X5P A;  1RT1 B;  4JI6 J;  3ITH B;  1R0A A;  3TJA A;  3MFI A;  2Q1L A;  3AQO A;  2XWX A;  4KKO A;  2VHG A;  5B08 A;  1RKJ A;  5KFB A;  2J9D A;  4B9M A;  3ISN C;  1RLC L;  3HZE A;  3MCN A;  3MR5 A;  3PFE A;  1QSL A;  1YJV A;  2KHD A;  1TTH B;  5AXK A;  2IDL A;  4YDD B;  3LTO A;  3CJ5 A;  4IOB A;  3RW6 A;  2XMU A;  5A8R A;  1U47 A;  1MWY A;  4C2M A;  4RR5 A;  4ICL A;  3FJ2 A;  3GYG A;  2ZIT A;  4DL3 A;  1CJT A;  3M9M B;  4DR1 J;  3EXC X;  1U2F A;  5HSP A;  2ZUG A;  4PQU B;  2JX2 A;  3LP0 B;  1PC4 A;  2ZM6 J;  3VQS A;  1UCN A;  5BR8 F;  5KFZ A;  2XSJ B;  5JUM A;  2HHH J;  1BQN A;  3TX8 A;  2HIY A;  2R4F A;  3M2V B;  2NYI A;  3KLH A;  2CJK A;  4TXS A;  4OZL A;  3A8K A;  3G96 A;  2W9B A;  3PXG a;  4I1T A;  4YFU A;  5GME A;  4ZPV R;  2B4V A;  5FLX U;  3FC9 A;  4S0M A;  2HQI A;  1Q1K A;  3A4T A;  4NA2 A;  2CXE A;  1FDA A;  5ADZ A;  5IV3 A;  4X64 J;  4WJB A;  3LF0 A;  2V8H A;  3VAL A;  3D68 A;  3CDU A;  3N79 A;  3VAF A;  3AD7 C;  4IH6 A;  4R0J A;  2GHP A;  2CQD A;  2MXY A;  3CJQ A;  2PEH A;  4I68 A;  2AZ1 A;  1ZS6 A;  2HMI A;  1NDP A;  2YWF A;  3HHN B;  4CLZ A;  4DSE A;  5T7L B;  4PR6 A;  1GMU A;  2R2R A;  3TA0 A;  3CC2 S;  3N28 A;  4W92 B;  4K59 A;  1RTD A;  4LFC F;  3D54 A;  3DLL Q;  3TAM B;  2GV1 A;  1NK4 A;  4GC6 A;  2AJ1 A;  2MB0 B;  3PRD A;  3JAM Y;  1M90 T;  2BJ7 A;  1XMQ F;  2EPI A;  3I5A A;  4M63 A;  3S01 A;  2CJQ A;  3M6V A;  3RG6 A;  1FE0 A;  1T03 A;  1F5C A;  1BC6 A;  3MMA B;  3UPF A;  1UW9 A;  1MRO B;  2IM2 A;  1R8P A;  3ENW A;  4J9Q A;  4QWA A;  4KYZ A;  5M2R A;  3EUN A;  1I1G A;  2QG9 B;  5KFA A;  2RH3 A;  1HNZ F;  2PN6 A;  2VKZ G;  1KQK A;  2DY9 A;  5BR8 J;  4KHP J;  5A8K B;  4DR4 F;  4OV1 A;  3CCW A;  2AGP A;  3GII A;  2V4J B;  1QD1 A;  1RTH A;  1YHQ S;  3UW1 A;  3U02 A;  3AD9 C;  5RUB A;  4P2M A;  1YIT S;  2AF6 A;  2DO4 A;  4ZVR B;  2NXC A;  2GVD A;  2BMB A;  2FJE B;  1LW2 A;  1HMV B;  5KFC A;  1IKW B;  1NHV A;  2HAI A;  2MKJ A;  1FRX A;  2GA7 A;  4YB5 A;  1Q8I A;  3OXL A;  3BS9 A;  1VYA A;  1X8D A;  4DPU A;  4Y2I A;  2J6U A;  2YBV A;  2GS8 A;  5F8M A;  3IC1 A;  3IRX A;  3M9N B;  3R5G A;  2RE1 A;  4BLG A;  2MHN A;  4ID8 A;  2CQI A;  2ROG A;  1UVJ A;  4OI4 A;  1S97 A;  3OR2 B;  4ETX A;  2UVU A;  1LV5 A;  1UFW A;  3HX9 A;  2DKO B;  4DV0 J;  3ZZU A;  1X4B A;  1IVZ A;  2G2Y A;  4XPC A;  1N6Q B;  3NBP B;  3M32 B;  2CQC A;  2KFZ A;  3CD0 A;  5J2P A;  2MKS A;  2RDJ A;  4BWJ A;  2YH0 A;  4D3H A;  2N3O A;  3KTQ A;  3NWR A;  3IN5 A;  1WF2 A;  1FX2 A;  1RCX B;  4RPF A;  2KT2 A;  2EW9 A;  4XIU A;  3PYD A;  3BPS P;  1VBX A;  2LLZ A;  1B64 A;  3ELH A;  4X4N A;  5ETR A;  1WOP A;  4USH A;  4DSL A;  4F0M A;  2MQO A;  4O3R A;  2VF3 A;  2DYA A;  4DBQ A;  3FCW A;  4FF2 A;  4YHH J;  4H4K C;  3FQL A;  1BQM A;  1HNZ J;  2OLW A;  4LIW A;  3PIO Q;  3HJF A;  2PO4 A;  4QW9 A;  1HPZ A;  4FPR A;  4WE1 A;  4FXD A;  4H4O A;  3B6B A;  4KY3 A;  4I56 A;  2FZK B;  5IQQ A;  4DR5 F;  5LXR A;  3HVR A;  5DG8 A;  3P45 B;  1ZPW X;  4ZPT R;  3PZP A;  3MF5 A;  2KU7 A;  3NOC A;  1Y5N B;  4Y0F A;  2BOA A;  3QQC D;  3LGM A;  3PYE A;  2XTJ P;  2UUA F;  3QID A;  3KHG A;  3BKT A;  4KGV B;  4U7U D;  4NZ6 A;  2JJ4 D;  3UVJ B;  5HN0 A;  2YWW A;  3W5Z A;  1A7G E;  1NSQ A;  1GXT A;  1UZH A;  2VDH A;  2XHW A;  3WQP A;  2CQ3 A;  2B9X A;  3K17 A;  4ED7 A;  2H5J B;  4DS4 A;  1XEZ A;  1EP4 A;  4WYL A;  2J6T A;  4B9U A;  1FJE B;  3GR1 A;  5J2Q A;  3EX7 B;  2X7I A;  2Y0B B;  1T8E A;  3GR0 A;  1S9F A;  3P5T L;  1U8W A;  5H9E K;  2HZV A;  3H20 A;  4IDK B;  3TO8 A;  4A8F A;  1PGZ A;  2NSC A;  4DG1 B;  2R7O A;  3NEK A;  2XUL A;  4ED2 A;  2BXJ A;  2XBP A;  3I6P A;  1K1Q A;  1H2T Z;  3AJD A;  4NLR A;  2DPJ A;  3HHE A;  1HQU B;  2QYG A;  1CJK A;  4QR2 A;  1F60 B;  3MDF A;  1M5V C;  1JJ4 A;  1KN6 A;  4R8U B;  5CD4 H;  3M1V B;  4L3N A;  4J5O A;  1X4G A;  1Q86 T;  4FZV A;  4IKA A;  1UJ4 A;  1KC8 T;  2MDA A;  5K14 A;  3RAX A;  2XYG B;  2BKP A;  1HIY A;  2GVZ A;  3W62 A;  3R27 A;  3CF5 Q;  1IJE B;  3EPI A;  1VQM S;  1SH0 A;  1WSV A;  3I87 A;  3RAM A;  4B3O A;  1DZ5 A;  3QBC A;  4DR5 J;  3BM7 A;  3TZY A;  3QLH A;  1OYE A;  1S6Q A;  4F02 A;  3OSP A;  2UUB F;  1CVJ A;  3KK3 B;  1WEL A;  3R5J B;  3F44 A;  2DGV A;  2UUA J;  4ZP9 A;  4MIB A;  2VL1 A;  3IP0 A;  1N54 B;  2FLN A;  1RQ0 A;  3BSC A;  4DPY A;  4O0N A;  1X0F A;  2DHX A;  1DFD A;  4GMK A;  3GU0 A;  1W7W A;  5BYS A;  3G71 S;  1TUW A;  3ZFV A;  4CP5 A;  1N0V C;  3C6T B;  4WP8 A;  5D4N A;  1FDN A;  2D3Z A;  3GON A;  4UT4 A;  3QRP A;  2QEX S;  3DCA A;  2YWH A;  4IR1 A;  1FTC A;  2QLF B;  4K4V A;  1HYS A;  4CNZ A;  4MYU A;  2FLL A;  4FYV B;  3R1H A;  2V63 A;  2MZJ A;  1FKP B;  3QGH A;  2IVM A;  3BF4 A;  5E3R A;  1RGV A;  1N4L A;  3SQG B;  5C5J A;  4BC7 A;  2LXU A;  1Y4Z B;  3UO0 A;  2ZJR Q;  1B70 B;  1L5U A;  3PG9 A;  4D3G A;  1BXN A;  1LK7 A;  1WJ9 A;  2RKI B;  2ZH8 A;  1D9A A;  2DGO A;  2JSX A;  3FBC A;  1S6P B;  1SUQ A;  2WW8 A;  2RIJ A;  5IM0 A;  2DB1 A;  4ZP6 A;  3CC7 S;  2CVE A;  3B54 A;  4ED1 A;  3HVT A;  3RYL A;  2E1P A;  1KHV A;  3GYX B;  2F63 A;  3GIR A;  4M5D B;  2CZ9 A;  4Q2M A;  1CJV A;  1FKA F;  2ABY A;  1RWP B;  4C8N A;  2B4U A;  4KBI A;  3TVZ A;  1VQ5 S;  2Y8Y A;  3MED A;  2P5V A;  5D78 A;  4FXW A;  3VTI A;  3SEO A;  4ZCM A;  1W26 A;  2UVR A;  3JSM B;  1WAC A;  3W5X A;  3AJ1 A;  1RLD A;  4Q43 A;  1MLA A;  2ZH7 A;  1KS2 A;  5LXY A;  1T02 A;  4H4K A;  1XNQ F;  4KHM A;  5THW A;  1HNV B;  1H38 A;  5A76 A;  4JI5 F;  2BYC A;  5DO2 A;  3C15 B;  3ZZP A;  3Q8S B;  3WBZ A;  2QIF A;  3CTR A;  1U02 A;  4ES2 A;  4ZVO B;  1X4A A;  2CPZ A;  3EGV A;  3RBZ A;  2W7O A;  1TKZ B;  4JI7 F;  5IT9 Y;  1EZZ B;  4ZN1 A;  1U6B A;  3HUL A;  4JI8 J;  5B7W A;  1RT3 A;  1M5S A;  2Y1L B;  1YBU A;  1X31 C;  1VIX A;  5GAH U;  1SL0 A;  1HL6 A;  3OFH A;  3PDN A;  2F9J A;  5GAE U;  2NUU G;  1AW0 A;  2N7C A;  2ZNY A;  4DOZ A;  3T9N A;  4OZ0 A;  1TVR B;  4CM0 A;  2AJ4 A;  4I64 A;  2VIC A;  3PYG A;  2ZC3 A;  3DLJ A;  4ELT A;  4KGX B;  1F6T A;  3ONQ A;  5B09 A;  1FFW B;  2XYH B;  1KQG B;  3FKB A;  3V2U C;  3BQ1 A;  4ZCI A;  4B02 A;  4ECQ A;  4NCB A;  4J9R A;  2RDD A;  1MWQ A;  4LF7 F;  4FVC A;  4DQR A;  1TL3 B;  3CJR A;  3NGS A;  3KLF B;  2NCK L;  1WHX A;  3BSO A;  4GC7 A;  1O8B A;  4WXO A;  4EBE A;  1T95 A;  2XG8 A;  1ULR A;  5B0F A;  1RAB B;  2ATC B;  2CPE A;  4XPE A;  3M8Q A;  1JLG B;  2ZKT A;  2D3U A;  4QQB A;  3AQP A;  2AEJ A;  3C8Y A;  1ZPV A;  5D3G A;  1OY8 A;  3OL9 A;  2ACM A;  3WC0 A;  1TKD A;  1HBO B;  3NG8 A;  3SCJ E;  5KFX A;  2E29 A;  2I9S A;  1R8H A;  4KSE B;  5ITH A;  4YP3 A;  4J7C A;  3I0S B;  3BO4 A;  1AT1 B;  1E6V A;  2FUG 9;  1Y9O A;  2E5G A;  1S1X B;  4EI2 A;  2GQC A;  4DN9 A;  1VQ9 S;  2A0F B;  2IBO A;  3F0N A;  4B3R F;  3U7J A;  5GAD I;  5F8I A;  3PY8 A;  4ERD A;  2B6A B;  1CBK A;  1KP6 A;  2LA6 A;  2C3M A;  5KG3 A;  1F9E B;  2RD5 C;  2LKZ A;  4HL9 A;  2KJV A;  1FJ7 A;  2P9C A;  1XR5 A;  2SXL A;  4W98 A;  1YLX A;  1YBT A;  3HT3 A;  5CHC B;  4ZA1 A;  2VG6 A;  2DD8 S;  1XN9 A;  4PQU A;  1DTT B;  3LP0 A;  1UP1 A;  3NP5 A;  3U1L A;  1GEH A;  2XSJ A;  2MGZ B;  2CIM A;  1JLA B;  1RBA A;  3D1Q A;  2CPI A;  1BUX A;  3M2V A;  4RU2 A;  1N5Q A;  2RJZ A;  3PV8 A;  2HRT A;  5ETS A;  5KFJ A;  4TLQ A;  2IA0 A;  3GG0 A;  3V6D B;  2Y1I A;  2VON A;  2BDP A;  2LU1 A;  3HXM A;  2O66 A;  2BA9 A;  5LSL A;  3DRR B;  1C4C A;  2ROE A;  3NLC A;  4DUZ J;  3JQJ A;  2M4M A;  1HHQ A;  2G0C A;  1FJG J;  2OH2 A;  4Q0B B;  4QOT A;  3UR0 A;  1MWZ A;  4QWC A;  1RT2 B;  1HW9 A;  2W7P A;  2W9C B;  1JK9 B;  1UWB B;  1U1M A;  2CPH A;  1FES A;  2NS1 B;  1AUS L;  4FN5 A;  2YNI B;  2OKQ A;  3HPO A;  1BLU A;  4QIG A;  3SZ2 A;  2ZKU A;  4AQY F;  4YEA A;  4LRE A;  3VZI A;  4C3M A;  1UEK A;  4JI2 F;  4RNF A;  4O3O A;  5KFT A;  1WHV A;  3DDI A;  3HZG A;  2K7J A;  4O0I A;  5HQM A;  2CQB A;  5DLG A;  4N8O A;  1I3O B;  3TAM A;  1SC3 B;  2FJA B;  4BHQ A;  5AJ3 J;  5KFV A;  3AXK A;  3CDW A;  3R3T A;  1F9F A;  1FKO A;  2ZFH A;  4ECR A;  5HMW A;  4K50 A;  3QT5 A;  3MMA A;  2ZVI A;  2D41 A;  1B99 A;  4MIW A;  2J7K A;  4RO0 A;  3ZTS A;  3CJ4 A;  4ZP7 A;  3I56 S;  2OHD A;  3PNI A;  2I5J B;  3CB4 A;  4F4A A;  5A8K A;  2JVR A;  3HDS A;  1RUS A;  2MEW A;  3GWC A;  2G2Z A;  4JUZ A;  2BJE A;  2GFF A;  3IWN C;  3OLB A;  4M95 A;  3DOL B;  1TKT B;  2LP4 A;  2V4J A;  1S0M A;  2C42 A;  3RBD A;  1LWF B;  3OL8 A;  3E51 A;  5KFQ A;  1JLF B;  2ZWP A;  2NUH A;  2ZC4 A;  3KMS A;  3IR7 B;  4DX8 H;  2V6A A;  1N33 F;  4DL4 A;  1IKW A;  2YTC A;  1QTM A;  2MLZ A;  5KFH A;  2HHS A;  3QPI A;  2LEA A;  2VPX B;  2JH3 A;  2XGP A;  2HVH A;  1I94 F;  4NCA A;  3MAH A;  3L3C A;  3CDB A;  4ED0 A;  4K7Q A;  1HWL A;  3RW7 A;  5ETK A;  2PC6 A;  4AQY J;  1S99 A;  4PXE A;  1JLQ A;  1IKX B;  3D0G E;  1IM4 A;  1MW7 A;  3W2V A;  1UZD A;  2KB2 A;  2OEM A;  3BBC A;  3LPE A;  1RAI B;  3PX6 A;  4HEA 9;  1S76 D;  3CUL A;  2CA9 A;  1SQF A;  3M8Z A;  3CD6 S;  3VCD A;  4FF3 A;  1D3W A;  3M32 A;  1RBO B;  2F3J A;  4F36 A;  1JKH B;  1H3D A;  4LFB F;  1M1K T;  1CJU B;  4ANC A;  4ALZ A;  3H2V E;  2IY5 B;  1Q95 G;  4DCO B;  1S1U B;  3KLI A;  2KKH A;  2PE8 A;  3NRB A;  2L3M A;  1RYS A;  1M5P C;  4O3P A;  1RSC A;  3OJU A;  3DRS B;  4PYA A;  2CJX B;  3TVK A;  1L3V A;  4GKJ F;  1RAE B;  2XI2 A;  2IM3 A;  2RHQ B;  2QFJ A;  4HLB A;  3UQS A;  2JFK A;  4CQ1 A;  2HHV A;  5E2Q A;  2BM1 A;  1URN A;  3E01 B;  1AB8 A;  4X4S A;  4AE5 A;  4WU3 A;  4ATN A;  4PWD B;  4R5P B;  2W25 A;  5DRK A;  5HJX A;  3UVJ A;  3MPY A;  3IM9 A;  4JYA J;  4RW8 B;  1X5T A;  4IYQ A;  4JV2 A;  4HAC B;  1V3R A;  1F1B B;  1N33 J;  2HRU A;  4YB7 A;  4ZVS B;  4DQP A;  3BPD A;  3MUT P;  1ROF A;  1WTF A;  1R8B A;  3SSS A;  2ZBP A;  4NX9 A;  1VRU B;  5A2Q Y;  5E7O B;  4TU9 A;  2KVQ E;  4UY8 T;  2DNK A;  3GCW P;  3I5C A;  1VS3 A;  1NO8 A;  5DJB A;  5IOL A;  5LMU F;  2C22 A;  1ICE B;  4NXN F;  2Z58 B;  3MCS A;  4IDK A;  4DCJ B;  4B3S J;  5C2G A;  2Q3P A;  4DG1 A;  4CM2 A;  2VJV A;  1VK8 A;  3QZ8 A;  2JC1 A;  3NCR A;  1FWL A;  2VBZ A;  1NME B;  2HBZ B;  3TZZ A;  3R5C A;  2J9C A;  4ZJQ A;  4J9N A;  4KJI A;  2YPY A;  3IS9 A;  4K4X A;  3KHH A;  2RQ4 A;  2CPX A;  4ECS A;  2XZD B;  4DN0 A;  4ZCL A;  2CZV C;  4DUT A;  2DCL A;  1RBL A;  2EC2 A;  3HI9 A;  3QMQ A;  4GKJ J;  4EZ9 A;  3D2W A;  1DUR A;  4J9P A;  2XMJ A;  5L1L A;  2C2R A;  4A8S A;  5J2N B;  2DRD A;  1U7L A;  4U96 A;  2KTQ A;  2YX4 A;  2XLI A;  1UPP A;  3D5M A;  2R2S A;  1B7Y B;  2JZ5 A;  2E9T A;  4ZKA A;  2CWK A;  1HBU B;  4Y2C A;  2XMA A;  3C16 B;  1FVS A;  3I82 A;  1V9O A;  1P27 B;  2FB0 A;  5E0O A;  3K2Y A;  4CTA A;  2RU9 A;  5L9X A;  1FWK A;  1Q8K A;  4F4Y A;  2BV3 A;  1GMW D;  3TAN A;  1Q7Y T;  3MM9 B;  2HND A;  3OW2 R;  5KFU A;  2KT5 A;  2U2F A;  4OHX A;  1PCA A;  1D8Z A;  1IBL F;  1DY3 A;  4WF9 Q;  4C9D A;  3W9H A;  2FJX A;  3C6T A;  1GH8 A;  4DQS A;  2W01 A;  2WSF C;  5KFW A;  5EX0 A;  5DG7 A;  1E6Y B;  2ASL A;  1M0S A;  2O3D A;  3FCH A;  5H9F J;  1FKP A;  4RW6 B;  2G9O A;  2MTL A;  1IBK J;  1W25 A;  2QMU B;  2VBY A;  2V8V A;  4IO1 A;  3H98 A;  2OPS B;  1XQI A;  2UV8 G;  1VIS A;  4URG A;  3GJQ B;  4C48 A;  1XMO F;  3FVY A;  1TK5 A;  1HA1 A;  1EKS A;  3LP2 B;  2RKI A;  1X60 A;  4DX5 A;  3C14 B;  1VI7 A;  4CDI A;  4ZPD A;  2ZZN A;  1NH8 A;  4ZLJ A;  4WP9 A;  4TY9 A;  2FDN A;  4G1Q B;  3VAJ A;  2DJW A;  1VQ6 S;  3H4B A;  1L3T A;  1YDL A;  4OJ1 A;  4IG0 B;  5A6P A;  3D9B A;  4I7F A;  1F2G A;  1EHW A;  1U0H A;  5HVG A;  2IVY A;  1UA1 A;  2LQJ A;  4ECZ A;  4KGZ B;  4ZHR A;  3V5R A;  2MKC A;  2IRU A;  3DXS X;  2RAQ A;  5EWF A;  4CWB A;  2OI2 A;  1V5V A;  2NZ4 A;  1HLW A;  3SYZ A;  3BR9 A;  1CC7 A;  3DC2 A;  5L1J A;  2KM8 B;  4DSI A;  2WK4 A;  3AA8 A;  2ZNZ A;  1RXO B;  2FJB B;  3C15 A;  2DH7 A;  3KWM A;  5C42 B;  2DIV A;  4OX8 A;  2O67 A;  4P6Q A;  3CGI A;  1IBL J;  3GG1 A;  4Y00 A;  2Z2M A;  3DOM B;  4LR8 A;  3NKY A;  5LJ5 Y;  3MUM P;  4DV6 J;  3H25 A;  2VV5 A;  1RTZ A;  4M8L A;  5ETT A;  1T11 A;  2EWH A;  1ZBT A;  3SCL E;  1S72 S;  2YKP A;  3JQK A;  5CH7 B;  5E3C A;  3H5Y A;  4NE9 C;  2M88 A;  3DU5 A;  1HBN B;  1LXN A;  1U1L A;  2F4V F;  2EKN A;  2YX1 A;  2YWK A;  2DIU A;  4F3Q A;  3BH6 B;  5CA5 A;  1TVR A;  2V5H G;  3W64 A;  3OBI A;  2E9R X;  3DLH A;  2O5D A;  4ZVF A;  3FCV A;  2PII A;  3W61 A;  3R2D J;  2HVZ A;  1N32 J;  3FEZ A;  3DLK A;  2Q6B A;  2BJ3 A;  2K7K A;  4DV4 F;  3KK1 B;  4K4Z A;  2D3O 1;  5HLF B;  1NK5 A;  1SKR A;  4E0D A;  1TL3 A;  2EEY A;  3DFE A;  3KLF A;  2RRA A;  4NRT A;  2NYH A;  5M2P A;  1S79 A;  3T6J A;  5L46 A;  4EYH B;  5M2U A;  2DHA A;  1UW4 A;  1LWX A;  1WG1 A;  3MAA A;  3EWG A;  4Q2L A;  2HHW A;  1FX4 A;  4NLW A;  1S9G B;  2C2E A;  3C2P A;  3GFZ A;  2DGU A;  1CS4 B;  1HBO A;  4OL8 A;  5F3T A;  2I6W A;  2EFO A;  4TNO A;  4YS2 A;  2HHQ A;  4YUD A;  4WP3 A;  2HWT A;  5IV4 A;  4J9O A;  1TK0 A;  3M2U B;  3A3P B;  2C3Y A;  3I0S A;  5KOW A;  2F1F A;  3DGV A;  1TK8 A;  3I0R A;  1YJW S;  4UQT A;  2GMJ A;  2QSW A;  2AYB A;  1S1X A;  2WTF A;  3R6L B;  4DR3 F;  3RB4 A;  4I69 A;  1MU2 A;  3K89 A;  3HHK A;  4KKO B;  2W24 A;  2RU3 A;  1IBM F;  3H0P A;  3MCO A;  3THT A;  1Y10 A;  3BGR B;  4B3M J;  4LBI A;  2B6A A;  2HIQ A;  2RQK A;  3CJ8 A;  2Z2L A;  3ZZT A;  4Z2X A;  1XK8 A;  3W2W B;  4LF9 J;  3KK2 B;  3N01 A;  2W2N P;  2X1G A;  3KHL A;  1Y3K A;  1WOO A;  4RWX A;  5A8R B;  1YX2 A;  2IHR 1;  5CD4 A;  3GIM A;  3FZB A;  1WF1 A;  4X4O A;  3OJS A;  5C24 A;  4C8L A;  3G4S S;  1CJT B;  4UOG A;  4GVB A;  2HZC A;  2OEJ A;  3HD1 A;  1FA0 A;  4IUF A;  2MGZ A;  1VQ4 S;  3I96 A;  2HFV A;  1F3V A;  3UWT A;  1VJW A;  3TUZ C;  1FCA A;  1BWE A;  3M4X A;  3V6D A;  2AMC B;  1YBA A;  1YRU A;  3CJK A;  1FER A;  1LWC B;  2P9E A;  3MM6 B;  1K47 A;  3DRR A;  4L74 A;  1T9W A;  1W2B R;  2W9B B;  4HHJ A;  2VG5 B;  3ILO A;  1HQE A;  2XLJ A;  2V0N A;  2U1A A;  5LL6 d;  4Q0B A;  2DNP A;  1RT2 A;  1MMD A;  1IXK A;  3ILL A;  1OIA A;  2DXF A;  3JAM U;  4J9U E;  2AGO A;  4LF4 J;  5IS2 A;  1UWB A;  4A4J A;  1QAI A;  3MI7 X;  1S4E A;  2K3K A;  1VHF A;  5HQ8 A;  2YNI A;  2RQC A;  2BZ2 A;  1AUD A;  3WDO A;  4QR0 A;  2DBB A;  4HR2 A;  4DV1 F;  4CLL A;  4FYX B;  4TY8 B;  2CKW A;  2KL8 A;  3KXD A;  4ECV A;  4LSN B;  2CG8 A;  3DRP A;  2YQ3 A;  4IRK A;  3VHQ A;  3CUN A;  3N9U C;  2F9D A;  2VPZ B;  4KE5 A;  2QLX A;  7FDR A;  3ZNJ 1;  1KR4 A;  2MQP A;  1PKU A;  3PW5 A;  2Z30 B;  2YKA A;  4OZ3 A;  3KOA A;  1S1T B;  1O51 A;  3NGK A;  5ETM A;  4OYM A;  4N47 A;  1VOM A;  3OVS A;  3T9Z A;  1H73 A;  4WIQ A;  4NCG A;  1WUU A;  2DK2 A;  3J7A 1;  4I6W A;  1SH3 A;  2ZH1 A;  2I5J A;  2W4P A;  1IM6 A;  2DNQ A;  3D0I E;  4XO0 A;  4DR2 F;  4ER8 A;  2AWZ A;  3FMW A;  2MPU A;  4DPW A;  2OIH A;  1C1C A;  2YPZ A;  4F25 A;  2HYI B;  2AU0 A;  4JI4 F;  1N34 J;  2AV5 A;  5KFN A;  3DOL A;  1C2P A;  1TKT A;  2WVE A;  3HFV A;  2HWH A;  3IAM 9;  2FYX A;  3LP1 A;  3OVA A;  1N88 A;  2DHG A;  3FEX B;  1YWX A;  2QL5 B;  5LMN J;  1UJ5 A;  1BE4 A;  2QN6 B;  2GVD B;  1XNR J;  4CCH A;  1Q79 A;  1DQA A;  2GCF A;  4C8O A;  5EHH A;  5C25 B;  1O0P A;  3NAH A;  2YQ0 A;  1DHM A;  1EB0 A;  5FDL A;  3PCO B;  3GIJ A;  3SQO P;  2QO3 A;  5C2C A;  1NHK L;  1WHW A;  2VOP A;  3FUY A;  3IRX B;  3SV4 A;  1EQ0 A;  5DS7 A;  1KON A;  1YI2 S;  4UUW A;  2PEB A;  2QE5 A;  4DV7 J;  1NUE A;  3WHI A;  3W1Y C;  2ADC A;  4HI2 A;  1A9N B;  2JRS A;  1Y11 A;  4J9K A;  1BGX T;  4MJK A;  2RDI A;  1JKH A;  2G0J A;  2JL9 A;  1RWN B;  5CZV A;  3VAK A;  4I6Y A;  2GNK A;  2VPW B;  2IA6 A;  5IC6 B;  3PX4 A;  4G1I A;  1TU0 B;  1NPK A;  5CYQ A;  1HNI B;  3IBC B;  2N82 B;  1QDU B;  5AE3 A;  1FT8 A;  3UN2 A;  4DHV A;  1S77 D;  2R2U A;  4DMZ A;  5D0R A;  1HI0 P;  2KM8 C;  1SB6 A;  3Q8U A;  1F9H A;  4P52 A;  1N36 F;  3N6N A;  3LGN A;  1U48 A;  1JXE A;  2R42 A;  1FEE A;  5KFO A;  1OS5 A;  1SC6 A;  5KFY A;  3W63 A;  2DIS A;  3OTB A;  3ZNU A;  1FF2 A;  3H7H B;  2MY8 A;  2KYZ A;  3KFW X;  4HDH A;  3UR3 C;  4AYB D;  1EJ7 L;  4R5P A;  2B3T B;  2ZOM A;  5KG5 A;  4NLQ A;  4PAA A;  3D1O A;  2VA3 A;  5DET A;  4RW8 A;  3QYY A;  4HAC A;  2ZH3 A;  1XWL A;  3R7B B;  1Z2Z A;  1HHS A;  2YKO A;  1F5B A;  4TU8 A;  3I9V 9;  2RUS A;  1H7W A;  2NXE A;  1U1P A;  1VRU A;  4OI6 A;  2ZBR A;  1M5H A;  2M52 A;  3CCM S;  1VLY A;  3CIM A;  1EP4 B;  4AL7 A;  1KDN A;  4CH1 A;  1EAR A;  1G3O A;  2EXU A;  3CPW R;  3DYA A;  3Q8R B;  3V4I A;  1P8G A;  4L6V 3;  3L7U A;  1FTR A;  1TL5 A;  3W3S A;  2XB2 D;  3HVW A;  1NHU A;  4F04 B;  5KFD A;  4FBU A;  4J91 A;  4FP9 A;  4J9S A;  4RNH A;  3IG1 A;  2QTW A;  2BJD A;  1WNE A;  2IFX A;  3JYT B;  1FO1 A;  4LMZ A;  2DIT A;  4CLT A;  1DQ9 A;  2J0X A;  1NB7 A;  2HUR A;  1F2H A;  4BC9 A;  3JSY A;  5ETQ A;  2EFQ A;  2HW3 A;  2UVW A;  1N5V A;  1MNE A;  2VQF J;  3N6L A;  3MPV A;  1VC0 A;  4WU2 A;  2DR6 A;  2HBQ B;  5CYM B;  4KPC A;  5DDQ C;  5J2N A;  3W9I A;  1OPZ A;  2A1B A;  4PG7 A;  1JJC B;  4ELV A;  1Y0H A;  3OXG A;  3GFX A;  3PM9 A;  5DQG A;  2DR7 A;  1U1Q A;  4LRA A;  2GML A;  4OJ3 A;  3C16 A;  1IR2 A;  5HJY A;  5EGY A;  3KNG A;  4C11 A;  3QLH B;  1SJ1 A;  1UWA A;  2WVB A;  1Z1Z A;  3KMQ A;  5J1P A;  2JEF A;  3CJS A;  5HK4 A;  2FLO A;  2G1H A;  3DMJ B;  4A47 A;  2ALY B;  1TFY A;  2B56 A;  2PA8 D;  4RNM A;  1YJ7 A;  2MLX A;  4QYZ K;  2B8P A;  5KT5 A;  1EET B;  2XC9 A;  3DM2 B;  1R8A A;  3VWS A;  1OQ3 A;  4FVM A;  4MKA A;  3J7Y I;  3MTJ A;  4PWW A;  4RUH A;  1NXI A;  4DR7 J;  4DV3 F;  1RDR A;  4TLR A;  5F41 A;  2NQP A;  1RTI B;  3D3C J;  1UVL A;  1R6Y A;  2CNK B;  3MMC A;  4F7V A;  3KJF B;  4RW6 A;  4M94 A;  3HHL C;  3VZH A;  3L09 A;  1VLO A;  2DGQ A;  3W66 A;  4X4T A;  5KFR A;  4U7C A;  1XIQ A;  2J7W A;  1KFS A;  5I3U A;  2FTR A;  2R8H A;  5B0E A;  5HAO A;  4PG6 A;  1T7P A;  2CVI A;  1WOR A;  4ELU A;  3KG0 A;  1NKE A;  4ECT A;  3NMR A;  3C14 A;  3UD3 P;  2ZVS A;  1SUQ B;  3KDN A;  2KYX A;  4IG3 A;  4PG4 A;  3S1T A;  3T5J A;  2KRR A;  2EK1 A;  5T14 A;  4I2P A;  4KTQ A;  4G1Q A;  5KG2 A;  3BN4 A;  4UUX A;  1TEL A;  4RW9 B;  1R7I A;  5LOQ A;  1ZA2 B;  3HVT B;  1K73 T;  2WOM B;  3T1Y F;  1MSW D;  5IT9 U;  1A0O B;  3WIU A;  3A8E A;  3UI3 A;  4IG0 A;  4WFX A;  1U49 A;  3OTC A;  2E1M C;  1T05 B;  3GV7 B;  3SFG A;  2OPP B;  3KKF A;  3MED B;  1EQM A;  4X62 F;  6FDR A;  1YJU A;  5KFI A;  2PFF B;  3BGU A;  1KEK A;  4K2X A;  3TUP A;  1GTE A;  1PAE X;  2FY1 A;  4Z7Y A;  2ZZM A;  3PJ9 A;  1C0T B;  3NNC A;  3FNN A;  1VBZ A;  1XTZ A;  4DI6 A;  5IFM A;  5J1E A;  3ZZO A;  1WI8 A;  3NS5 A;  2L48 A;  3VQT A;  2BRL A;  2Z0G A;  1VBK A;  1SKS A;  3QSI A;  2UP1 A;  3QWP A;  5KT3 A;  3QNW B;  4JI6 F;  3PYF A;  1FRL A;  2HFN A;  4ZPB A;  1AFI A;  1ZZF A;  3DOM A;  1WWH A;  3BYP A;  3CJ2 A;  3T3F A;  4I6A A;  3VAG A;  4DV3 J;  3BRE A;  2MZR A;  3H2U B;  2FHJ D;  2XY7 A;  4PYD A;  2H65 B;  4LSL B;  1R3N A;  2KI2 A;  2CDR B;  2BE7 D;  1S48 A;  1HBN A;  1DRZ A;  1RIS A;  4DUY J;  2XCP A;  2N3L A;  4WPA A;  1TUG B;  4DR1 F;  3AH6 A;  4FYW B;  2QYC A;  4UOC A;  4ZK7 M;  2CJB A;  1HR0 J;  1IKY B;  3CD7 A;  3PIP Q;  2ZM6 F;  2R7Q A;  4CLW A;  1YIJ S;  3P96 A;  4A8Q A;  2HHH F;  4B08 A;  2OD6 A;  4Q5V A;  3KK1 A;  4M5I A;  5B0D A;  1NKB A;  2YKQ A;  5D0G A;  1KNZ A;  2CRL A;  4U7U K;  3U27 A;  3AA9 A;  3Q8Y A;  3T1Y J;  4OHV A;  3BZQ A;  3BQ0 A;  2BEF A;  4OX7 A;  4TN2 A;  2FC8 A;  4FS2 A;  1RWW B;  4X62 J;  2XGQ A;  2HG4 A;  2E5J A;  1JWW A;  4WFN Q;  3M8Q B;  4X64 F;  4K5S A;  3FDS A;  5HAN A;  3DHW C;  2CDQ A;  2J7U A;  5D3G B;  4ZCK A;  4NZ0 A;  2H54 B;  3TJ9 A;  5KTQ A;  2C2D A;  2PMH A;  2B7C B;  5LT5 A;  1WI6 A;  4PZV A;  2ZHB A;  3QT8 A;  2A18 A;  2LVW A;  2X1F A;  1E6V B;  4P73 A;  1H2V Z;  1K1S A;  3RR8 A;  1JB0 C;  4BWM A;  5AXN A;  2QL7 B;  2DH9 A;  3QRR A;  3BGR A;  2RS2 A;  4K4W A;  2UXB J;  3GSD A;  3EYZ A;  1D8Y A;  5KFG A;  2DHS A;  4OYI A;  4Y2A A;  1YJN S;  3W2W A;  3CE8 A;  2LFV A;  4CYU B;  3KK2 A;  4DL2 A;  2KXN B;  2H4Y B;  5DGA A;  3W7B A;  1VJQ A;  1PC5 A;  3BEG B;  2DNR A;  2HLT A;  3NGD A;  3DNC A;  2ZDO A;  4B3T J;  4Y3C A;  3O8W A;  4WII A;  4KHR A;  2VG6 B;  1NDL A;  2WVD A;  4USJ C;  4M5G A;  2HNZ B;  2GJI A;  4QWB A;  1S49 A;  4DLG A;  4KHP F;  4RLE A;  3WX4 A;  2XMM A;  3FZ2 A;  3H2L A;  3HHL A;  1NCL A;  3EGZ A;  3EGW B;  3L4B C;  1VMB A;  2FD2 A;  4RW7 B;  2EC0 A;  1LWC A;  1DAR A;  2BJ1 A;  3N5F A;  3MM6 A;  4M5K A;  4EEY A;  1FD2 A;  4UZC A;  1ZM3 A;  2VG5 A;  4MKV A;  3Q83 A;  3OV7 A;  1PJ6 A;  4F4Z A;  2J9D E;  3SIP B;  4EUV A;  3RZA A;  3EDR B;  3IO1 A;  3ZZZ A;  4PXC A;  3QO9 A;  3ZTR A;  3UNG C;  3NGU A;  1SCJ B;  2CQ1 A;  2KG1 A;  1K9M T;  4HYK A;  1VRQ C;  2EFP A;  4HHH A;  4QWE A;  4J90 A;  3FBF A;  3TZW A;  1X9M A;  1J5O B;  4A48 A;  4JV5 J;  5D4O A;  1X5O A;  2OTJ S;  1TL1 A;  1ZM4 A;  4CLF A;  4DV5 J;  2QSF A;  4DPX A;  4NML A;  2VJU A;  4TY8 A;  4HTI A;  4AL6 A;  4OHY A;  4RBU A;  2E7W A;  3QJP A;  3D7S B;  2ASY A;  3D1H A;  4DV0 F;  4LSN A;  5D0E A;  2XY5 A;  1QJH A;  1WC6 A;  2IM1 A;  2DXE A;  4PUO A;  4DQI A;  2YNG B;  3NL0 A;  3JB9 k;  4MT1 A;  1FKO B;  3CCT A;  2CQ4 A;  2OEK A;  2DXD A;  4L76 A;  2J5A A;  4ZOS A;  1S1T A;  3SV3 A;  1Q82 T;  1I6J A;  1MML A;  3RU0 A;  2Y9H A;  5JXS A;  3PW7 A;  2DNZ A;  1OJ4 A;  4Q8E A;  2VU5 A;  5C7P A;  1IUJ A;  2VPY B;  2G2O A;  3SMZ A;  3PW4 A;  5AE1 A;  3BSN A;  4YHH F;  3HO1 A;  4OYA A;  4ZVG A;  2BRK A;  1XR6 A;  4BS2 A;  2L41 A;  2GAH C;  2V9W A;  2JWN A;  3EIC A;  3QWU A;  5KG4 A;  2BKO A;  2IRY A;  4K2J A;  8RUC A;  1S59 A;  2R3V A;  4XDD A;  1U24 A;  2BKN A;  2DNL A;  3ULH A;  3MUV P;  1JQG A;  4NMX A;  1FXR A;  3PO5 A;  4WK1 A;  1FJC A;  1YZ6 A;  4F2S A;  4F3M A;  4M5M A;  2Q66 A;  2ZHA A;  4DL7 A;  3TQE A;  4NLX A;  5C25 A;  5E33 A;  3G8Q A;  1JJH A;  2F40 A;  1NDK A;  2AYM A;  5F9L A;  2A6M A;  4LF1 A;  3Q89 A;  3AB4 B;  3QGG A;  1GNK A;  2V9K A;  1FRH A;  1LNQ A;  1ZM2 A;  2WBR A;  4MYT A;  2HFZ A;  2QGF B;  5CZX A;  1KLM B;  5D4P A;  1X5S A;  2UXD J;  4WFY A;  4NEY A;  3GCX P;  1M1H A;  1VK3 A;  4LFA F;  1JLQ B;  1R6V A;  1TL7 A;  1CPZ A;  2K06 A;  3T19 A;  4G1P A;  3W2V B;  2AW0 A;  4OX9 F;  5GAD U;  3IR5 B;  4ZDN A;  4LSZ B;  5KOX A;  2DNN A;  1NJW A;  2VQE F;  2D9O A;  4KH1 B;  3RRK A;  1T0T V;  1SJR A;  1HNI A;  3KLI B;  3FRZ A;  4RBT A;  3ZZR A;  3TQ1 A;  3PHE A;  2V2Z A;  2VZ9 A;  1FFS B;  4NAS A;  1QUP A;  3M2R A;  3X3U A;  2QX0 A;  5CAA A;  1D0E A;  2J0S D;  5IQ6 A;  4KO0 B;  4ZLP A;  4OLP A;  5A2Q U;  2Y0S D;  1NH7 A;  2IPO B;  3M6X A;  4NLO A;  4ZVT B;  4V19 J;  1Z2L A;  3QAT A;  1XER A;  3T1H J;  5HRO A;  1JX4 A;  2R7U A;  2VOD A;  2B4P A;  5F0U A;  4HKQ A;  1QTN B;  1RT7 B;  4HT5 A;  4ZIV A;  4QIF A;  2OMO A;  2MKK A;  3OTO J;  1KVI A;  1N8R T;  1D9D A;  1G6B A;  2KHC A;  1XR7 A;  4NLV A;  2RNE A;  1X9W A;  1XC9 A;  3ENQ A;  2UU9 F;  5D4L A;  5F3Z A;  1MMN A;  3EE3 A;  2B5J B;  4G65 A;  3KJQ B;  4NYZ A;  2BAB A;  2ZEJ A;  4N56 A;  5F8N A;  5DM7 Q;  1NJI T;  3N5B A;  4FF4 A;  1VC5 A;  2ATL A;  2G4B A;  3CCZ A;  5FJ4 A;  5A8W A;  2A2C A;  2NXN A;  3CJT A;  4R0E A;  2D9P A;  3HKZ D;  1HFE L;  3NXZ A;  2YX7 A;  4LFA J;  2BJ8 A;  3J7Z 5;  3ILI A;  2GAG C;  3QGP A;  4ZN3 A;  2V4Q A;  5L1K A;  1QY7 A;  1O6X A;  2VUG A;  3K7R A;  3LAK A;  4OX9 J;  3CCE S;  2MZQ A;  5DDP C;  4WCE Q;  4TVA B;  1YKW A;  4JBC A;  5DGB A;  3HD2 A;  2CJ9 A;  3KUH A;  3ZZ0 A;  2VQE J;  3BKF A;  3JYT A;  3MOJ B;  3IS9 B;  4DSF A;  3EVO A;  2W4D A;  2E1R A;  2V8D A;  4UOF A;  3C6U A;  5J2M A;  3MHY A;  2R7T A;  3V81 A;  1OY6 A;  4PKD B;  4RNN A;  4K4Y A;  2J0W A;  2XWY A;  4QPX A;  1U1O A;  2HVD A;  2FPH X;  5CYM A;  3QIP B;  1RJJ A;  3NNH A;  1RT5 B;  1H72 C;  2GMH A;  3S6E A;  2VFS A;  1WSR A;  2B7B B;  2WCX A;  4WKY A;  4F0H A;  2V2K A;  2JEG A;  1FI4 A;  4WTY A;  3QFW A;  4CTA B;  3DMJ A;  3QAE A;  2E5H A;  2MKH A;  4OZN A;  5HO4 A;  2CQH A;  3TEG A;  2HND B;  1OMS A;  1B0V A;  3T5K A;  2UU9 J;  2PMW A;  3A12 A;  1EET A;  3DM2 A;  3UN5 A;  3FBE A;  3SCI E;  4KQZ A;  1V3S A;  1PYS B;  3PRV A;  4JI8 F;  1HKA A;  1RTI A;  3J81 Y;  4OIX A;  1SC4 B;  3LO3 A;  1U1R A;  5I3P A;  2MZS A;  4P71 A;  1YVF A;  3UD5 A;  1YRT A;  3HSJ A;  2YQ1 A;  2CPY A;  2HQC A;  3OVB A;  3OQ2 A;  1N5Y A;  3Q0A A;  4ILR A;  2C2Z B;  1JJ2 R;  3VF0 B;  4P72 A;  2ZDP A;  4CI0 B;  3HSG A;  1UVM A;  3MR2 A;  2K1R B;  1QAX A;  1EKR A;  3GSI A;  3H8Y A;  2VD3 A;  4UST A;  4ID5 B;  3ICL A;  2J8A A;  2Y1J A;  2POK A;  3NWG A;  2O1P A;  4Y2K A;  2CNN B;  1AXQ A;  1Q8B A;  2Z4P A;  4RW9 A;  3PX0 A;  1F0X A;  2B8Q A;  3IRW P;  1NJX A;  1ZTW A;  1WC5 A;  4IOC Q;  2WOM A;  2AYG A;  4IFV A;  3BB5 A;  2C2K B;  1CSJ A;  2QA2 A;  1T05 A;  1ZET A;  2F4F A;  4I7F B;  2OPP A;  4YB6 A;  2H4W B;  1H0H B;  4IFY B;  1U0H B;  4K0K F;  2HK3 A;  5IZH A;  1LOU A;  1VHI A;  4ZHR B;  3GP9 A;  2C3U A;  1C0T A;  2IYI A;  4EK2 A;  2R8K A;  3NGR A;  4O3N A;  3ISN D;  1RTJ B;  2MQQ A;  1RB0 A;  1RWK B;  2L9W A;  3R5A A;  1KSP A;  2YXL A;  3G2X A;  1U26 A;  2F65 A;  1T3O A;  4BCA A;  3MXH P;  1RAF B;  1RA6 A;  3PKY A;  3Q2T C;  3M8W A;  2IC3 B;  5JVH Q;  1HW8 A;  2AHO B;  3TOQ A;  1NU4 A;  1S1V B;  2CNO B;  2F8M A;  4DR6 F;  4LSL A;  1SJ3 P;  2UVV A;  1IWA A;  2M2B A;  5IT4 A;  3RRH A;  4P2F A;  3FK4 A;  4I0W A;  2E1C A;  3BBB A;  1UVK A;  2HKE A;  2XMW A;  1ZAV A;  5KT7 A;  3F56 A;  3UCU P;  4ZVH A;  4WFB Q;  2ADB A;  1RKI A;  1S9E A;  2VBX A;  2GW8 A;  1IKY A;  3D3B J;  3SDE B;  2R8G A;  3V6J A;  3OHB A;  3BV8 A;  3I32 A;  5D15 A;  1U25 A;  5K9F A;  4ZIW A;  4YOE A;  3VVT A;  2AGQ A;  3DLK B;  1WC3 A;  4QWD A;  3RBX A;  4DL6 A;  3RB0 A;  3G6E S;  2JHE A;  1TZ0 A;  1Q8L A;  5E3Q A;  1YG0 A;  1D1U A;  3RUB L;  4TYA A;  2HS3 A;  3EZ5 A;  4DUZ F;  2JFD A;  4KRW A;  2B9E A;  3BQ2 A;  1FJG F;  2FHM A;  5HL7 Q;  3MOZ A;  2BJ9 A;  4K0K J;  4CIO A;  3MAA B;  1FRM A;  2EVZ A;  2PA3 A;  1G2E A;  2WON B;  5D77 A;  5ETO A;  4N41 A;  2XYP B;  2PSZ A;  2AJF E;  3EJM A;  2XY6 A;  2K2P A;  3Q23 A;  3FMB A;  5CQG A;  4QBU A;  2DGW A;  3I0R B;  4FS1 A;  4WKR A;  4USV A;  1KTQ A;  1C0U B;  4O4G A;  5DQH A;  2Z57 B;  4RKU C;  1BQX A;  3QJL A;  4DF8 A;  1MU2 B;  3POT B;  3OFG A;  5AJ3 F;  1TAQ A;  3VAM A;  3CCQ S;  4DR6 J;  1DTQ A;  3Q8V A;  3GFY A;  4CYU A;  1T9X A;  5DZ7 A;  4PEO A;  2J76 E;  4JI0 J;  4G3I A;  1WOS A;  2EFN A;  2NR0 A;  3U1N A;  4J37 A;  3IXQ A;  1SJ4 P;  1UEV A;  3FSY A;  3KG1 A;  5C24 B;  3AJ2 A;  3BDP A;  2ZE2 A;  1NND A;  1RT4 B;  2HNZ A;  4GVB B;  1ZM9 A;  1RHK B;  4EO8 A;  4NXM J;  1SBR A;  1U8S A;  1YRX A;  3UNY A;  2L08 A;  2P6S A;  1CEZ A;  3I4H X;  4Y6I A;  4RW7 A;  4LF8 F;  2ZBC A;  3CJK B;  2VC1 A;  1XJW B;  2GC8 A;  4QCL A;  2HVI A;  1RAG B;  1YJT A;  2GGP B;  1S7I A;  1GQE A;  4DJB A;  1HQE B;  4F0K A;  2LU2 A;  3L7P A;  2RIL A;  5G0R B;  4GKK F;  3NOG A;  2F5G A;  4HVZ A;  1SL2 A;  1FNM A;  1IQZ A;  1U09 A;  2C3P A;  2JLG A;  1VBY A;  2AEF A;  2QRR A;  3H59 A;  2ZBI A;  1J5O A;  4ZVE A;  2WB1 D;  1TP7 A;  4CLP A;  3I9Z A;  4L73 A;  5G4D A;  2XQC A;  2X3G A;  4CO1 A;  3LUY A;  3CO9 A;  5L8R C;  3IR6 B;  4JI3 J;  1HNX F;  4K4T A;  5KFS A;  3SBM A;  2C1E B;  3BDE A;  3LQV A;  2XZT B;  3O44 A;  2YKM B;  5JJB A;  1YJR A;  3OD2 A;  1S1W A;  5KG1 A;  3DRP B;  3MUR P;  1Q53 A;  2YNG A;  2HLU A;  2HSE B;  1QUV A;  2OPR B;  3K5P A;  3QSY B;  3CJ3 A;  1QM9 A;  3GIK A;  2ZBQ A;  1RU2 A;  3C66 A;  3GJS B;  2UUW A;  2FVQ A;  1FXL A;  2F8H A;  5B0C A;  5HP1 A;  2UUC F;  4M1K A;  1WF0 A;  4IH7 A;  4TU7 A;  4GO7 X;  4NCG B;  4OV6 A;  4C8Z A;  4CLK A;  1KRP A;  1JMT A;  3T6B A;  3GFH A;  4ED6 A;  3US5 A;  1B4S A;  5HI7 A;  1S12 A;  3ADA C;  3HJV A;  3CMA S;  3A3N B;  1C1C B;  4LF8 J;  3FGV A;  3MMB B;  1NK8 A;  1REG X;  2HQ3 A;  2OSR A;  5LSO A;  2B9W A;  5HVF A;  3O6Q A;  5L9N A;  3LP1 B;  4USI A;  2ZH9 A;  5E41 A;  1JXV A;  3CWJ A;  4CT8 A;  4JYA F;  3MMJ A;  4MFB B;  4N8N A;  4GKK J;  2HHP A;  5GAG I;  4X4Q A;  3VAI A;  1HD0 A;  2MQN A;  1RWM B;  3CDA A;  3K5L A;  1LW0 B;  1B0P A;  5FDL B;  2MKY A;  3J81 j;  2MHE A;  4WZQ A;  4C0O C;  2DGX A;  2AEM A;  2I8E A;  4C8Y A;  1KLM A;  2QMX A;  2C28 A;  2M0G B;  4XTT A;  2OML A;  5D6G A;  1WD6 A;  4O23 A;  1HNX J;  4B3S F;  1M1G A;  2LXI A;  4V19 X;  3CNQ P;  2G1D A;  4DQQ A;  1ZOT A;  2XCA A;  3EVW A;  5BJR A;  3MEG A;  4C6A A;  1Q5Y A;  3MM5 A;  1NPR A;  3IFE A;  2XM3 A;  1PG5 B;  1HQ2 A;  2VBW A;  2E9Z A;  2WVF A;  1FDB A;  1OQ6 A;  2LEB A;  5K5M A;  5CYQ B;  5ETN A;  1CUL B;  4R25 A;  3HT0 A;  4C0B A;  1AFJ A;  2VFV A;  2LMI A;  2EK6 A;  2UUC J;  4JI1 F;  3TZX A;  1S0N A;  2FIU A;  5KT2 A;  3OL6 A;  3RGI A;  4KO0 A;  5DZ6 A;  5MLC V;  4DSK A;  3B78 A;  1VC6 A;  2PDA A;  2XS2 A;  2WSE C;  1OY9 A;  3TVY A;  1WEZ A;  2QJ3 A;  1WKJ A;  4OX6 A;  1RT7 A;  2CAJ A;  4F4K A;  1PO6 A;  2ASJ A;  1HD1 A;  1KKH A;  2NXJ A;  1WKK A;  5L39 A;  1NSK L;  2DRA A;  1RAA B;  2VC0 A;  4ZS6 A;  3VAH A;  4CLU A;  5B0B A;  1Y5I B;  4U67 Q;  3HVA A;  3M05 A;  2V67 A;  5F8L A;  5F0W A;  4NA1 A;  3G6Y A;  2EFV A;  1T9V A;  2FVC A;  3SCK E;  2OO4 A;  5D8H B;  4EGL A;  5FII A;  3R7S B;  4ECY A;  1TKX B;  4CH0 S;  2E5L F;  3OUY B;  3MAQ A;  2B5J A;  3MCM A;  2CFX A;  4AD6 A;  4Q7A A;  3Q2S C;  5H9E J;  1TQL A;  2N4D A;  1I5O B;  5U47 A;  4KV8 A;  2MZT A;  1X0P A;  2QT7 A;  3K57 A;  3ISZ A;  3QT7 A;  2OPQ A;  4OZ5 A;  2CUY A;  2AZ3 A;  2PI5 A;  5CAB A;  2R9L A;  2B4O A;  3W8G A;  2E5I A;  2R7W A;  4QPT A;  4UZB A;  3DYA B;  3V4I B;  3ET6 A;  1NM2 A;  3DRX A;  1IBK F;  1JLB A;  2BW7 A;  3L95 X;  5EX3 A;  4ED5 A;  2JNJ A;  3PHT A;  4YQW A;  1YQH A;  1N0U A;  2YNF A;  3CMQ A;  2C3O A;  3ILJ A;  3KLV A;  2HNY B;  2VOO A;  1FRK A;  3UE2 A;  3IWL A;  1VRT B;  1B0T A;  2BAN B;  2D1C A;  3IG1 B;  5GVQ A;  1HI1 A;  3R1L A;  2VFT A;  4LFC J;  4LT6 A;  3J80 Y;  2O01 C;  2AJQ A;  3H5S A;  3ZC4 A;  2M8H A;  1JLC B;  2GQQ A;  1XMQ J;  1FWP A;  3OTE A;  3DHX A;  2BR0 A;  3GB0 A;  2RVJ A;  3LPY A;  4DL0 C;  4JI1 J;  4RUB A;  5E3P A;  1ZA1 B;  1S0O A;  3QIP A;  1FK9 B;  4KIA A;  1RT5 A;  2OAU A;  4WXW A;  3S8S A;  2KJW A;  4OYZ A;  5CXT A;  1SXL A;  7FD1 A;  2EG2 A;  1HBM B;  3FFI A;  2V2V A;  3DLG A;  4MK9 A;  3ZZY A;  1KQS R;  3BO3 A;  4B9N A;  1VQN S;  3ETM A;  4PXD A;  4DR4 J;  2OFG X;  3MGJ A;  4M5N A;  3B4M A;  4C11 B;  1RHQ B;  3JTO A;  2P8I A;  2CPD A;  4PQA A;  3RBE A;  3NS6 A;  1Y5L B;  4CLY A;  3IAS 9;  2OTL S;  4ZPW R;  2E5L J;  1V5I B;  3OPK A;  1NSA A;  4PG5 A;  2QC3 A;  4P2X A;  5DDO C;  3MD3 A;  3VGS A;  3F41 A;  4M5H A;  4A46 A;  5D0H A;  2D69 A;  4DV6 F;  2KG0 A;  3R6G B;  2IYG A;  3BH7 B;  2V94 A;  3MMC B;  4KT0 C;  1XBW A;  1RHJ B;  2DNM A;  1M5O C;  2AJ0 A;  3DOK B;  4Z7C A;  1U4B A;  1RWU A;  4NOH A;  1N56 A;  1UET A;  5I3U B;  3HFK A;  3MR7 A;  4OI3 A;  3AY0 A;  2K1R A;  1B3T A;  2Y3Y A;  5HBM B;  4QYR A;  2VAS A;  1H7X A;  4ES3 A;  2XS5 A;  4C3K A;  4Z37 A;  1NZA A;  5CCM A;  3GV8 B;  1RE1 B;  4ID5 A;  4FYY B;  4W90 B;  1N32 F;  3O1L A;  3GV5 B;  3QGI A;  3QJJ A;  4IG3 B;  2ACY A;  3MEE B;  3DI6 B;  4NLT A;  7AT1 B;  2YNH A;  1Q5V A;  4I2P B;  4PG8 A;  4ED4 A;  1SJF A;  2MY7 A;  4A8M P;  2H1Y A;  3QFH A;  1QLN A;  3PEJ A;  2QA1 A;  2HGN A;  2HVE A;  3CDE A;  4B9L A;  3M8P A;  1O5J A;  4IFY A;  5E5N A;  2LEP A;  3IGN A;  4V1A k;  4P75 A;  5BYR A;  4P9S A;  2OD4 A;  3AOA A;  2CQG A;  5HVH A;  1X4C A;  4DV2 F;  1RHR B;  1JLE A;  2E1A A;  2KN4 A;  2DH8 A;  1LWE B;  1RTJ A;  4K8R A;  2EBG A;  3R5B A;  5J1E B;  5DG9 A;  4QR1 A;  2L9D A;  4ITS A;  3HSZ A;  4MTP A;  2PGC A;  1NZ8 A;  3EM1 A;  4O44 B;  4IQM A;  4EMD A;  3A8I A;  1WTB A;  2IC3 A;  4RJV A;  1L3U A;  4I2Q B;  2MZ1 A;  3D6T B;  1RCO B;  1S1V A;  4EZ6 A;  4B3M F;  4A8O A;  1UFL A;  1RU1 A;  2XEX A;  3T41 A;  4LF9 F;  2NZC A;  1RAJ A;  4L72 B;  4RZR A;  3IMQ J;  4QIV A;  1LQ9 A;  5LSR A;  5EN1 A;  1TL4 A;  2EI5 A;  2C2M B;  2CQ2 A;  2KH9 A;  2HPU A;  5H9F K;  2N4C A;  3SDE A;  3W5Y A;  3CED A;  4RUC A;  1JIH A;  4ZVU B;  1FXD A;  1V6H A;  1ZYQ A;  2Q79 A;  4EU0 A;  5CCL A;  2H51 B;  2ZH5 A;  1FRI A;  4YME A;  1RT6 B;  2RB7 A;  3M6U A;  3O3L A;  2MSS A;  4DFJ A;  3M9O B;  2MKI A;  2D3O R;  2DR5 A;  3B82 A;  3MZI A;  2FHO B;  3CC4 S;  5KT4 A;  3LOU A;  1ZAW A;  2G0I A;  3L7O A;  5A0Y B;  1UA0 A;  2P6T A;  2AD9 A;  1U6F A;  2FY8 A;  2DNO A;  3M6W A;  3NCQ A;  2AP6 A;  1Q0N A;  5K8O A;  3MTK A;  2W7A A;  3T5L A;  3JTN A;  2LQB A;  2XZW A;  2DNG A;  4B9T A;  4LF4 F;  2WON A;  3TAQ A;  1NK9 A;  1NDC A;  3MPD A;  3GPA A;  4DV2 J;  1LFW A;  2UUB J;  3CO0 P;  2ZJQ Q;  2JVO A;  4G6V B;  2CYY A;  1SQG A;  1UFK A;  2DR8 A;  2YY3 A;  1RZM A;  4ZLN A;  1KBR A;  5K8P A;  3GIL A;  4MAK A;  4NI2 A;  1C0U A;  4OZJ A;  4OJG A;  3G82 B;  2MQ8 A;  2LQ8 A;  3UDC A;  2VB6 A;  4DX6 A;  1CQN A;  3J7Y U;  3Q8Q B;  3POT A;  4Y65 A;  4ED8 A;  2M5Y A;  2OGU A;  3JTP A;  4ZVQ B;  4A8X A;  4YY3 F;  1S7H A;  3NMA A;  2J6S A;  4IR9 A;  2H9Z A;  1SIZ A;  4ECU A;  2HGM A;  1R0B G;  1OO0 B;  2ILZ A;  2M3D A;  4NL5 A;  4FBT A;  4X4R A;  1RT4 A;  2XMV A;  2FZG B;  2VFU A;  4OMF G;  2B9Y A;  2DCU B;  4P74 A;  2MYF A;  2Y1R I;  5K8M A;  2RRB A;  4O3Q A;  2DEI A;  2IRX A;  3HHL B;  1N34 F;  2J9E A;  4MH8 A;  1B7F A;  2FVP A;  3CJ0 A;  2RHS B;  3WIV A;  2GGP A;  3SFU A;  3MR3 A;  3OR1 A;  4FPI A;  2BX6 A;  2QLJ B;  3K5O A;  5G0R A;  2Z8Q A;  3UDL A;  4OYX A;  2V8P A;  3K5N A;  3D6F B;  3MD1 A;  8AT1 B;  1IN0 A;  5LMN F;  4RUA A;  4RW4 B;  1QSS A;  1XNR F;  2LQ5 A;  4YDX A;  3QO9 B;  3BBF A;  1WEX A;  1K44 A;  3JS9 A;  2BBE A;  2W2M P;  4RL1 A;  3AB2 B;  5KG6 A;  2RUG A;  1T9U A;  2RS8 A;  2JDJ A;  2NSB A;  3SI8 A;  1TL1 B;  3G8T A;  3CCR S;  1VQY A;  2WSC C;  2R2T A;  2BE2 B;  4DV7 F;  2A6O A;  1YJ9 S;  1XNQ J;  2DVI A;  1RT1 A;  3ITH A;  4JI5 J;  1FFG B;  2HS4 A;  3VR1 A;  2GJ2 A;  2YKM A;  4ED3 A;  4WWS A;  1TMM A;  2PMZ D;  4JI7 J;  2IM0 A;  3MPU B;  1BD6 A;  4ETZ A;  2OPR A;  5E3A A;  1RHU B;  4YY3 J;  4PUO B;  1S0V A;  3IA0 A;  2BVZ A;  5IWA F;  4JB8 B;  1N48 A;  5J1N A;  4LRF A;  1RAO A;  1H6K X;  1YTY A;  2A10 A;  2HHT A;  4ECX A;  4F26 A;  2AT1 B;  4HTJ A;  3PRB A;  4TQS A;  3D67 A;  2IMO A;  4OI1 A;  2HBR B;  5EUH A;  3CT9 A;  3TX0 A;  3C19 A;  2E44 A;  2FQQ B;  4CNY A;  1M5K C;  3MMB A;  2V69 A;  4IH5 A;  3TUI C;  3LAM A;  3AOD A;  2ZH4 A;  4J9L A;  3T5H A;  4X84 A;  1CQM A;  2GO8 A;  1R43 A;  1NK0 A;  1FNX H;  2BQU A;  2X51 A;  4MFB A;  4LF7 J;  4MMO A;  1VQO S;  3GYN A;  4TKT A;  1RAC B;  3K5M A;  1G4C A;  2VG7 B;  3FBB A;  4CZC A;  1K0V A;  5F8G A;  3F73 A;  1GX6 A;  5KG7 A;  2IJN A;  4K5R A;  4FF1 A;  2HHX A;  3DGP B;  1LW0 A;  4CO4 A;  2HWI A;  1Q16 B;  4X65 F;  2A2D A;  2ZZT A;  1UKU A;  1HI8 A;  2A3J A;  3N0V A;  4K4S A;  4U9R A;  5HQL A;  4B17 A;  1UJ6 A;  3H5X A;  1MG7 A;  1X4F A;  1TL7 B;  3RRG A;  5T7L A;  4XK8 C;  2ZHO A;  3BR8 A;  2LEC A;  3B8H A;  4B3R J;  1ELO A;  4AFF A;  2W2P P;  3P49 B;  1VCT A;  2ZJP Q;  1SL1 A;  1A6L A;  2R7V A;  5FLX Y;  4C7Q A;  1SIW B;  1APS A;  3M8Y A;  1CUL A;  1KTV A;  5IWA J;  1AYE A;  3KLE B;  1CLF A;  3HM9 A;  3M2R B;  2IMW P;  3IBF B;  2GZO A;  2H5E A;  4OLO A;  3TYT A;  1MRO A;  2VQF F;  4AXJ A;  2LDY A;  2HQF A;  1U2C A;  1SV5 B;  3HCX A;  4Y34 A;  4F8R A;  4LIR A;  3R2C J;  1GMW A;  1ZZN A;  1OSC A;  2YVS A;  4HHU A;  4F4X A;  1P1L A;  1YK9 A;  3J7Z T;  5HRO B;  4CH7 A;  4DF4 A;  2VKR A;  4NZ7 A;  5I3Q A;  1NAQ A;  1S6O A;  2FJD B;  3PFO A;  5K8N A;  4DZD A;  3W65 A;  3E2E A;  2XMT A;  3DLB A;  2PI4 A;  1TKX A;  3OUY A;  4I67 A;  4KGK A;  4BDP A;  4FNH A;  2BUN A;  1HMV A;  2XMK A;  1MN7 A;  2LYV A;  4OI0 A;  2ZH2 A;  1R27 B;  3P8B B;  2GQ2 A;  2AKW B;  4DDF A;  2AX1 A;  3KYL A;  1XMB A;  4RU9 A;  2NPF A;  5GMK a;  3RB3 A;  1RP5 A;  3KJV B;  4DR7 F;  4KC5 A;  4X65 J;  4ILL A;  4QZV B;  3KUE A;  4F67 A;  3CD5 A;  4F4W A;  3Q8P B;  5A8W B;  5T41 A;  3WX8 A;  2MQL A;  2W4C A;  4JI2 J;  4USW A;  3OR2 A;  3P5B P;  3MEC B;  2HNY A;  1VRT A;  2BAN A;  3TNV A;  3R97 A;  3BN7 A;  1QE1 B;  5KFL A;  4ZMM A;  1N6Q A;  3NBP A;  3CCS S;  4UTG A;  2DT9 A;  1KOH A;  3CVK A;  3FSI A;  1JLC A;  1UTA A;  3K0J A;  1REV B;  1L3S A;  2UUT A;  3C6U B;  4F50 A;  3DDK A;  2DGT A;  3MM7 B;  5J2M B;  4EBD A;  3PW2 A;  3ENV A;  3V81 B;  3RAQ A;  1FK9 A;  4MIA A;  3M8S A;  4WBF A;  3OLA A;  1KHW A;  2ZUA A;  1ACM B;  3ZTO A;  3EGN A;  1GT8 A;  2DO0 A;  2DPI A;  1PBA A;  1HBM A;  3J81 U;  2KZM A;  4USM A;  4OYW A;  4EWT A;  3AD8 C;  2FGO A;  1URR A;  1AZS B;  2D74 B;  5K20 B;  2KXH A;  1IR0 A;  4DZ6 A;  3KJN B;  4C8M A;  2DY1 A;  1EIY B;  4LBH A;  3P4U B;  1T9T A;  3THV A;  3R7N B;  2PT0 A;  4OJH A;  1S4F A;  2FGC A;  1KVJ A;  3DN9 A;  1N5S A;  2AYE A;  1Y3J A;  1KWM A;  5FD1 A;  3KG4 A;  2DGS A;  4GVL A;  3CCV S;  4QU6 A;  4Q8F A;  3A13 A;  3CSK A;  3ZXW A;  2YWE A;  4H4M B;  1D9F A;  4U95 A;  3H4D A;  4I4B A;  1EAY C;  2MJU A;  2J0Q D;  5A6W A;  1NEE A;  2E7X A;  3JQM A;  4AND A;  3R9L A;  1HAR A;  1I94 J;  2XNR A;  3OXF A;  3Q86 A;  2AQ4 A;  2E66 A;  4IRD A;  3DDN A;  5HMZ A;  1BWV A;  4WTO B;  3P3D A;  5GAH I;  3TA1 A;  2KRB A;  4DLE A;  3QAU A;  4DUY F;  4N77 A;  2P2C B;  3DOK A;  1N5Y B;  2W8K A;  5KFK A;  3BKU A;  4KH0 B;  2GIQ A;  5GAE I;  5AXL A;  3UN3 A;  1VQP S;  5DLF A;  3SXL A;  1HR0 F;  4A8K A;  5HBM A;  2R7R A;  4LFB J;  2W1B A;  1HQU A;  4DSJ A;  5ETV A;  4RBV A;  2XO7 A;  4YR2 A;  3J7A N;  1NB2 A;  4C0H A;  4MKB A;  4K4U A;  2AIR B;  2WAQ D;  1R31 A;  3MEE A;  4R8U A;  3DI6 A;  3M1V A;  3NS7 B;  4ZJL A;  4IQX A;  4DEZ A;  2Z2Y B;  4ZIT A;  2XS7 A;  2OSQ A;  3KLG B;  3LWL A;  1G7C B;  1P1T A;  4IFV B;  4OYO A;  2P9G A;  4MKY A;  2ZH6 A;  2HQD A;  1VDH A;  1J2V A;  3Q22 A;  1TR0 A;  4YR0 A;  1KQF B;  3T1A A;  4QIE A;  3D4J A;  2JLE A;  2WZ1 A;  3MM8 B;  4EFA C;  5EWG A;  5MAO A;  1Q7L B;  1IKV B;  1LWE A;  5AE2 A;  5IT0 A;  3KK3 A;  5CYJ A;  3MEK A;  2FJV A;  1RWO B;  2RSQ A;  3TWZ A;  1UPM B;  3TEH B;  4UF4 A;  3G9C A;  4KFB B;  2HS0 A;  1D09 B;  4LR7 A;  4O44 A;  2XNQ A;  1P9Y A;  1LK5 A;  4M5L A;  2LCW A;  4UW2 A;  4ZPA A;  2R7S A;  5KFF A; 
#chains in the Genus database with same CATH homology
 3ZTS A;  3BBC A;  3G2X A;  1XIQ A;  4KPC A;  1HLW A;  3FC9 A;  3FBF A;  4DZ6 A;  4S0M A;  1S59 A;  1NB2 A;  1BHN A;  3FKB A;  2AZ3 A;  3ETM A;  4ENO A;  5CAB A;  3WX8 A;  4F4A A;  1XQI A;  3Q8Y A;  4F36 A;  1NSQ A;  1JXV A;  4ANC A;  3FBB A;  1HIY A;  3ENA A;  2DY9 A;  2BEF A;  1KDN A;  1NPK A;  1NLK L;  1NDL A;  1S5Z A;  5CAA A;  1NDC A;  3MPD A;  3GPA A;  4HR2 A;  3VVU A;  3DKD A;  2CWK A;  1LWX A;  3NGS A;  3VGV A;  2NCK L;  4W98 A;  4UOG A;  5IOL A;  3L7U A;  2AZ1 A;  3EVM A;  1ZS6 A;  2B8Q A;  1BE4 A;  1NDP A;  1WKJ A;  1NDK A;  3DDI A;  2HVE A;  3EJM A;  3FBC A;  3ZTQ A;  1U8W A;  2DXE A;  3VGS A;  3BBB A;  1NCL A;  1WKK A;  2BX6 A;  3Q89 A;  3ZTP A;  3Q8U A;  3VGU A;  1NSK L;  3ELH A;  3VGT A;  4AND A;  3R9L A;  3FBE A;  4UOH A;  2B8P A;  3Q86 A;  2DXD A;  1LEO A;  1BUX A;  3PRV A;  1UCN A;  2DYA A;  3FCW A;  4ANE A;  3Q83 A;  3EVO A;  1NHK L;  3BH7 B;  4FKY A;  3BBF A;  3B54 A;  1NSP A;  4UOF A;  1PKU A;  1K44 A;  3JS9 A;  4O0N A;  4WBF A;  2VU5 A;  5C7P A;  2ZUA A;  1WKL A;  3GP9 A;  3EVW A;  3B6B A;  3BH6 B;  3ZTO A;  1MN7 A;  1VYA A;  1MN9 A;  1EHW A;  1S57 A;  3ZTR A;  4EK2 A;  3EMT A;  4C6A A;  3VVT A;  3NGU A;  1B4S A;  1W7W A;  4FKX A;  1NUE A;  1F3F A;  3Q8V A;  2HUR A;  1PAE X;  3NGR A;  4CP5 A;  2HVD A;  3PJ9 A;  3EE3 A;  5BXI A;  3FCV A;  4DUT A;  1HHQ A;  1B99 A;  2DXF A;  3EIC A;  4DI6 A;  1F6T A;  3NGT A;  3EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...