1Q7LB

Zn-binding domain of the t347g mutant of human aminoacylase-i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
NPWWAAFSRVCKDMNLTLEPEIMPAAGDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aminoacylase-1
total genus 19
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature ec 3.5.1.14: N-acyl-aliphatic-L-amino acid amidohydrolase.
pdb deposition date 2003-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1q7lB01
1Q7LB
chains in the Genus database with same CATH superfamily
1IKVA 1X7VA 2V8PA 5K8NA 4B9NA 3KDOA 2W25A 2NYIA 2IJFA 1VR6A 1FFSB 3DRYA 3ZZTA 3GR1A 2IVFB 1NSAA 4EZ9A 5DGBA 1D09B 3K5LA 1FX4A 1HW9A 2RHQB 2DR7A 4OIXA 1PCAA 3B6BA 4DQRA 4RR5A 1DTQB 3FMWA 2DXFA 4KGKA 1RE1B 1WORA 4IH7A 4ZPVR 1H2TZ 4JI8J 3O2IA 1R89A 5LXRA 4DUZF 4JV5F 3T3FA 4HT5A 1EZZB 2RKIB 5ETSA 1WKJA 1N34J 1IR1A 3QWUA 5K20B 4LFAF 4ED4A 3KLIA 2UP1A 4PXDA 2PI5A 2HQCA 5K9FA 3BBCA 1ICEB 1VISA 4OJGA 1RABB 1AFIA 2OAUA 2F1FA 5L38A 1K8AT 3HFKA 4CYUB 1FA0A 1NBEB 1Y00A 3LALA 3V5RA 1RISA 3SYZA 1D1UA 2F4FA 3T9NA 2BM0A 4USMA 5HN0A 2X3DA 4C0BA 4DR7F 3C6UB 2LMIA 1H0HB 1WDDA 3I4PA 3W65A 5F8IA 2XLJA 4LF5F 4A8XA 4X62F 1X9SA 2XZWA 2D3UA 2WVDA 1QTNB 3GQCA 1RQ0A 2V2KA 3ENQA 2R7TA 1EKSA 2MEWA 3UFCX 3P96A 3PCOB 5A8RB 2KRBA 1K1SA 4F2SA 3DFEA 2RS2A 2POKA 1MMDA 2KVIA 2WTFA 4DV0J 1IQTA 1U2CA 4X65J 2VFSA 4RO0A 1QAIA 2VA2A 2ZBRA 3MM7B 2QV6A 4MJKA 3CCES 4ILRA 4OYPA 3C15A 5M2UA 4BWJA 3NS5A 5A6PA 1OWXA 2CKWA 3CEDA 4K4ZA 1G2EA 1RAEB 2HLUA 3TX8A 3LP0B 4MIAA 2BE2B 1HBOA 4OLOA 4PPDA 4QZVB 2UVVA 3JYTB 1WDTA 3R6GB 1YJ7A 2QRRA 3HHLA 5HP1A 2E1CA 3RJMB 3KK1B 1KVJA 4F36A 4DV3J 2R7UA 3GFXA 1FJGJ 2GHPA 4R0JA 4M1KA 1S1WA 3GFZA 4DR2J 1JLCB 1WUUA 3QFWA 1BGXT 2O66A 1D0EA 4QW9A 2Y8WA 2HK2A 2KJVA 1KSPA 2V8DA 2MY8A 1RA7A 2DGQA 3QIPA 4WBFA 2IFXA 3KG0A 1RACB 2OPRA 1JLAA 3QGPA 1ZAWA 4EU0A 5I3QA 2E1MC 1T95A 3K17A 4OZNA 4C2MA 4ZLPA 4Y00A 5LJ3Y 4EFAC 4ZP7A 3VGSA 5ETMA 1NK8A 3PYGA 2FLNA 2QYGA 2VFUA 3ETMA 3BR8A 4FDFA 5D0HA 2K8GA 1RWKB 3VTIA 2MQNA 1A0OB 2F40A 2B6AB 2E1RA 3AJ1A 2HWHA 1RT4B 1RBAA 3E8OA 3M6WA 3NGRA 2BJDA 3HCXA 3NXZA 4H4OA 3UN3A 1H6KX 4A8QA 1Q86T 1PSDA 2G2OA 1FKOB 1KQKA 4AXJA 2VG6A 3CJQA 3MCMA 1RT7B 4FBUA 2H4YB 2ADCA 3BSOA 2RRNA 1IKXB 1OYDA 2CPDA 4K59A 5SUHA 4HKQA 3PRBA 1M5OC 3NGKA 4OX7A 3PEJA 2MQQA 3L95X 4AYBD 4YB7A 2DXDA 2CQGA 1VQ5S 2FD2A 3Q23A 3KUGA 2ILZA 2XMMA 1ZBTA 3MPVA 4FNHA 3DU6A 1JJ2R 3HULA 2HIQA 2XYPB 3KKFA 5C42B 5HANA 4PUOA 3OFHA 1VRUB 2G0JA 1U1QA 2AT1B 2ZBPA 5DZ7A 2XZDB 1X4CA 2HAFA 2KYXA 3FBBA 1S1UB 2OO4A 2L9DA 3L09A 5GADU 4RZRA 2N4CA 5B08A 3CDUA 4NLYA 1ACMB 2YNFA 4FKXA 3ZZZA 2XCPA 1HWJA 2HQ3A 4XIUA 4JI4F 1U02A 4F3QA 1S9EB 2O3DA 2RH3A 2N7YA 4NLUA 5E2QA 1RI7A 1UFLA 3OSPA 2QG9B 4Q0BA 1YIJS 2J9DE 3ZZYA 5BR8F 3D1QA 4DF8A 4K4VA 2HS0A 4P73A 1KS2A 2CUYA 3CE8A 2A0FB 5ETKA 1HHQA 2KM8B 3M8RA 2V94A 3M2RA 2VU5A 3TJAA 4NPOA 3IWLA 4WIIA 2F63A 4CYUA 2CJBA 3MTKA 3BQ0A 3NLCA 1TMMA 5H9EJ 4C98A 2QC3A 2Y0SD 3HZGA 2VIHA 3W2WA 1U0HB 3MMCA 1RTHB 3N6NA 4NE9C 5GVQA 4DR6J 3DCAA 1SB6A 1TL4A 1PYOB 1UCNA 3HFVA 4ZPBA 1EETA 2ATLA 3KLVA 4TY8B 2MKIA 4RBUA 2AX0A 4CO3A 3D6FB 3C6UA 2YNGA 1RZMA 3G2XA 4TU7A 3VALA 3SZ2A 2WSFC 4O3SA 2JC1A 2UXDJ 2YNFB 1SVDA 4LSZB 2AP6A 1TVRA 2VUGA 2ZDOA 3KLGA 2ZH3A 1Y10A 4NI2B 1T3NA 3RRHA 1RAAB 1IN0A 4WZQA 4JI2F 3JSMA 5GAGI 1HNWF 2XI2A 2QYCA 4JI6F 2XBPA 3DYAB 4PG7A 5LM7E 1T05B 2VFVA 2AKWB 1AROP 3MM7A 2F9JA 2K2PA 3IMQJ 2B4VA 1HBNB 2W7AA 4O44B 4OX9F 1U48A 2ZH5A 3ILJA 4X65F 3HD2A 2NZCA 1YJWS 2HFZA 2HZAA 1J27A 1FFWB 3GSIA 2NS1B 4Y0FA 4A8FA 4ZK7M 2YQ0A 1HL6A 3EXYA 4NASA 1HI8A 5CZXA 1RU2A 2KO1A 2OIHA 2YPYA 1Q0NA 2CPYA 2HSEB 2RSQA 5KFQA 4K4TA 1N36F 3FQLA 4ZCKA 1XMOJ 4ZJOA 1TFWA 3PTWA 3Q0AA 2CVEA 4RW9A 1U0SA 2CDRB 1Y11A 2V2ZA 2RILA 3R2CJ 3QSIA 4CTAB 5HATA 2C3PA 1LOUA 1N88A 3MMAA 1C1CB 2BQRA 2CJ9A 4KQZA 4GC6A 3UQSA 3BYPA 2MTLA 4FXVA 3MWBA 4NXNF 4K4UA 3MAAA 1SC6A 4CLYA 3FBCA 3LP0A 3HVRA 1JLAB 2R7QA 2WRMA 2UZAA 3HMJG 4ECUA 3L9ZA 2SXLA 3DYAA 2AW0A 2FHKA 3MXHP 1SH2A 2RQCA 4DR4F 5AE2A 1N5QA 3JSMB 1N36J 2ZOFA 1R0AA 4C8LA 5KFDA 1X60A 2ZE2A 4OYMA 2VFTA 3MD3A 2ZNZA 4F4ZA 3LPEA 2GIQA 4YQWA 5E7OB 2FZCB 1FNXH 4IG3A 1JLGB 1X4DA 1PAUB 3GE9A 3JTNA 1Y3JA 2Z2MA 3BKFA 5EWEA 1K9MT 4TY8A 4H54A 2DR5A 3JYTA 5H9FJ 3LGMA 3MPDA 4QR2A 2DHHA 1U47A 4UY85 2DH8A 2OKQA 3JQMA 3PACA 4ILLA 5T41A 2I5JA 4LIWA 4JV2A 1IBCB 1MWZA 2DNPA 2CQHA 2FQQB 2IC3B 2IHR1 5DQIA 2ZH8A 1V5IB 3N0VA 2C22A 2HFVA 5BXIA 3EPGA 1XNQJ 3CCSS 1TUWA 2I38A 2VJVA 2XSJA 3BQ2A 1JLFB 5JXSA 4IQMA 4ES2A 1K0TA 3H5XA 2GCFA 1HPZA 2HFUA 2QLBB 1N32J 7FD1A 1VQ7S 2JEIA 1RKIA 1OQ3A 2QO3A 4M5MA 4B9TA 2VBXA 3HZEA 2CG8A 4HTJA 2K06A 3DOLB 1RP5A 4V19J 1HD1A 4HACB 1TL3B 2Y9HA 3GZ7A 1T03B 4W98A 2QL9B 3BS9A 2BEFA 4CM0A 2E7VA 5A8WB 2ZNYA 2DGWA 2HLTA 2WVCA 5THWA 2VG6B 1FWLA 2LLZA 1HARA 1TV6B 3FEYB 2HBYB 3B4DA 3MD1A 5F0WA 4EYHB 4F02A 3OTDA 1YI2S 4USHA 1L3VA 1BQNB 1B0PA 2QFJA 2DNHA 4AT1B 2V4JA 4G1QB 4OMFG 2MGZB 4QYZK 1B7YB 2KG1A 4O4GA 2AHOB 3DGPA 3R5GA 4GO7X 2XSJB 4MMOA 4X4VA 3P49B 3DLGB 1WC5A 3ZZUA 1ZAVA 3O8WA 2XMAA 2B4UA 3HXMA 4ZVOB 1MROB 2XO6A 3FZBA 2Y1JA 1Q7YT 2DBBA 1R8CA 2H54B 3BB5A 4PG4A 4UF4A 4E98A 4ECVA 3DRPB 2KL8A 2ZD1A 3B78A 1Q5YA 3CMQA 4ZP8A 3BQ1A 4FZVA 3VZIA 1SBRA 4LFBF 3O3LA 2C42A 2X1FA 1CULA 5D15A 1TP7A 3HHLB 3BO3A 5J2PB 2XMVA 4P75A 3SIPB 4ANEA 5GAHU 5D6GA 3IG1A 2JLFA 4PXCA 1YRXA 3A1YG 3CJRA 4C0OC 4MFBA 3I0RB 2ZITA 3BH6B 2Q1LA 1BQMB 1RT3B 5AE3A 3E2EA 1YJUA 3ETOA 4FP9A 1HW8A 1UJ4A 2LFVA 3D6MB 1H98A 3MAAB 3KLGB 1NEEA 1UFKA 2H4WB 1TKTB 2UXBF 3BKUA 3BDPA 2M0GB 2AJ4A 2O01C 2YWHA 4H4KA 2I9SA 4NMXA 3HM9A 1IR0A 5FDLA 2VQEF 2DJWA 3RAQA 2R7OA 1IJFB 3F0NA 5B0EA 3IO1A 3G87A 1CSJA 4F67A 2FHJD 2J76E 4X62J 2ZD1B 4IG0B 4NCAA 4DFPA 2ZBIA 1L3KA 5JVHQ 3VAGA 5IQ6A 3OLBA 1ZTTA 1S10A 4CO1A 3RB4A 2VONA 1HNZJ 4PYAA 2W4CA 4HTIA 3CSKA 4N47A 2BQUA 1UVJA 4PWUA 3G6ES 2P5VA 3DLEB 3LOUA 4TNOA 1W2BR 2CNNB 4WU3A 1UMJA 2M52A 4CDIA 1GX5A 4C4WA 2QEXS 4O44A 1EP4A 4LF6F 4DSFA 3F44A 1X5PA 1YJNS 2CDQA 2LXUA 1BHNA 1P9YA 4OZ0A 4A48A 3DLKA 4KAIA 3PKYA 4FPRA 4OYBA 4I69A 5ITHA 2F4VJ 2JFKA 3W8PA 2BW2A 4RJVA 4LVNP 3K5NA 2FJWA 4J9VA 5L1LA 4NL5A 3BF4A 4G1IA 2FJVA 2APOA 2B9YA 3PIPQ 1FCAA 4C8KA 1SL1A 2KVQE 4KKOB 4HLBA 4ED1A 2KKHA 3MR2A 4IFVA 3UNGC 4ECQA 2YKPA 2ZKUA 3BKTA 4KV8A 2MJUA 2KRRA 5KFTA 2HHWA 4OI0A 2I2YA 3FK4A 3RZAA 3MR5A 3CCMS 1XMOF 4DSJA 4JV1A 3MMBB 1FRKA 3KK2B 1AB8A 4AL6A 2C2ZB 3PW7A 2DNLA 3DRSA 5CABA 2BJ8A 3QWPA 5J1NA 3PFOA 3PR4A 3CDEA 4LR7A 1R6YA 5KG6A 4NLOA 3EZ5A 3C14A 3HVTB 1WC3A 4OYZA 2IMOA 4N76A 3MDFA 2KTQA 4PQAA 1T9UA 3FZ2A 3NCQA 4AXIA 3RBEA 1KDNA 2DHGA 1S12A 2BUNA 4UOGA 2Z0GA 2DT9A 3VQTA 2ROGA 1KLNA 4IRDA 5DQHA 3MCSA 4UZCA 3G71S 3PEHA 3SQGA 2DH9A 3W9JA 2P2CB 2E9ZA 2PGCA 9ATCB 1NK9A 3WIUA 3ILOA 1Z4UA 2C2NA 4DPWA 3GTYX 1E6YB 3OL7A 3DMJA 1F5CA 3GONA 5JUMA 2YNIA 5C7PA 1S9GA 1R8HA 4OZ2A 3DRRA 3HHDA 2D9OA 1FTRA 3K57A 1U4BA 1TL7A 5A2QU 4LSNB 3Q86A 3A12A 1LWCA 4YB1P 3G8SA 2DR8A 3HSGA 1S97A 2I8EA 2COLA 3PHTA 3PRDA 2M70A 2J8SA 4LBHA 2HZCA 1LEOA 1XERA 3V4MA 5EWGA 4RNOA 2UXBJ 4B9VA 1TL1A 1FXDA 4GKJJ 2QA4G 2Q43A 3J7AN 2KT2A 3MOJB 2GQCA 2DK2A 1VK8A 4R8UA 1CJUA 3N6LA 3R5BA 4DPXA 2UV8A 2Z2YB 2DCLA 3E01A 3NWRA 3DLGA 3CVKA 2Z56B 9RUBA 5HROA 3T5KA 5ETQA 5A0YA 2VG5A 3CD0A 2OI2A 4QJVA 2E1PA 2LQ5A 2V4JB 4G1QA 5B0DA 5CZVA 3OFEA 3O1LA 1BQNA 3M1VA 1X31C 3I9ZA 3TVKA 3UDVA 2Y3YA 2RJZA 2FIUA 4M5NA 2HHQA 3IWNC 1OO0B 1KLMA 4G3IA 3M2UA 4LF2A 2PT0A 4ED3A 1ROFA 2ZZTA 3LH2S 3JQJA 1HQEB 5F8HA 1FD2A 1FHTA 2EI5A 1CVJA 2NXJA 1Q8IA 1WG1A 1M5HA 2V8VA 3PYEA 2HGMA 3AJDA 3GR0A 5CYMA 3KK1A 1X4AA 5ETLA 3NNAA 2HHPA 4NLQA 2RRBA 1YBUA 3C8YA 4WFZA 1WHWA 2K1RA 1RT2B 4J9OA 1BXNA 1V5VA 3DOLA 2XY5A 2PMHA 2YTCA 4DV6J 5KT2A 2BE2A 4OYAA 3DNCA 4Y65A 2ZBQA 2BJ9A 4DOZA 2C2EA 1MW7A 4CT9A 4URQU 4PQUA 2C2DA 3J81j 1CJVA 3BSAA 1M5SA 3UI3A 4L3KA 5IS2A 2ZZMA 1FXRA 1MLAA 3U27A 1N8RT 2YVSA 4KFBB 3NL0A 2RAQA 4DX7A 4YS2A 1Y5NB 3W61A 2CXEA 3OR2B 4KHMA 2GVZA 4M5KA 2W2PP 1SQGA 3IRXB 1H2VZ 4LVOP 1HNXJ 2CJQA 3CGIA 1NMEB 3GFHA 3NMRA 4BLGA 2JL9A 3D2WA 4DG1A 4OZLA 2HRTA 1O6XA 2HGLA 3TA0A 2N4DA 2MZJA 3P3DA 1TELA 2QGFB 2IAJA 4ED6A 5J2MB 4OYWA 1RHKB 2QA1A 3QATA 3PG9A 4XDDA 1UAWA 4DV3F 2VL1A 2IA6A 2CADA 2DH7A 3W60A 3H4DA 4DV1F 1P1LA 1Y4ZB 5KG4A 5DG9A 1C0UA 2J0SD 4HI1A 5C42A 4PUOB 1SH0A 1Y0HA 4X4SA 2PFDA 3ZTQA 3RW7A 4I2QA 4NLXA 4ZLLA 3TJ8A 2FJDB 4DJBA 4M5JA 1NCLA 1YKWA 3E51A 3CCRS 1KQSR 5DDPC 4DL4A 4DSKA 5CYQB 2ALZA 4LRFA 2YNHA 4UZBA 4DLGA 1T02A 3MMAB 4HT7A 3KUHA 3SSQA 2PEBA 5KT5A 1YTYA 1KLMB 2C2KB 1VRQC 1HWUA 1SIWB 2RNEA 4R5PA 1FKOA 1FT8A 1X4FA 1VC5A 2AJQA 2YXLA 5K8MA 4QOTA 3MM9B 4ID5B 4OHXA 3SDEB 4U6PA 4ZVGA 1NJWA 3L4BC 1QAXA 1H7WA 3JQKA 2D3O1 1N32F 3IR6B 1VOMA 2H5IB 4RUCA 2BX6A 4USJC 3OJSA 2N3OA 1IR2A 2J7UA 4R8UB 1P1TA 3D0IE 2NXNA 1FRJA 3MEGB 3G86A 3HVAA 3UPFA 4KT0C 4QR0A 3G9CA 2DCUB 4W90B 5LOQA 4X84A 1SQFA 1WWHA 3GPAA 1UKUA 1Q4RA 4A8OA 5F9LA 1S7HA 2LVWA 4DZ6A 5DLGA 2Q6CA 2B4OA 3AOCA 1X4HA 1V3ZA 4RNNA 2W8KA 1VRTB 4K2JA 2ASLA 3A8IA 3HD1A 2G2ZA 3H4BA 1Q8BA 2K7JA 3LAKA 3OFFA 4ZS6A 2XGPA 1SJ3P 4NLDA 1JB0C 4DCJB 3EGWB 3OTCA 4G65A 4OYXA 1SJ4P 3PX4A 1GNKA 3DM2B 1HQUA 5IZHA 1SC3B 2JSXA 3R1HA 1HA1A 5DM7Q 3C15B 3MUMP 1S99A 3HK2A 4ZPDA 2V9KA 5KFYA 4MT1A 1OPZA 3LGHA 4M8LA 2MYFA 3G8TA 1PYTA 1UEVA 4Y2MA 1RCXB 1KC8T 3KLFB 2RQ4A 2RDJA 2U2FA 4Q7AA 5DG7A 1LV5A 4ED0A 3QBCA 4K2XA 3AY0A 1F60B 4WP3A 3SCKE 1FWPA 2RQKA 3CCVS 2ZVIA 3OL6A 4DU8A 4U9RA 4M63A 5AXNA 1M1KT 5KFMA 1IVZA 3W5XA 5D77A 4UUWA 1RAFB 2DEIA 2I1RA 2MKYA 2QJ3A 4C8ZA 4KO0A 1HNIB 2CZ9A 1IBKJ 2MKKA 1CBKA 2BMBA 2V69A 1VQOS 2XHWA 3QT7A 2L9WA 1NNDA 5I4MA 1WTBA 4ECYA 2BRKA 1UVLA 1SV5A 1L3SA 3KHHA 1KOHA 3HSDA 2B56A 2KT3A 1LKZA 3B8HA 3BV8A 5EHHA 3EUNA 4X66F 3C2PA 2XY6A 2FHJA 3V2UC 1XJWB 2VG7A 4RWXA 4ED8A 2JH3A 2HNYA 3X3UA 3ILIA 3P4UB 4F50A 1F5AA 3UE2A 3X1LB 5B0GA 3R5CA 3TA2A 1VYAA 2RF2B 2CYYA 4QIWD 4CLZA 3LWMA 2RDDA 5GAEU 2WHOA 3MI7X 3Q8YA 4CO2A 1MWQA 1SJRA 1IM6A 1FX2A 2FB0A 3OUYA 5HJYA 3K5MA 1V6HA 1UVKA 4PZVA 3CUNA 4A8SA 3EZOA 2CA9A 1X4BA 3WBZA 2EFNA 4FN5A 5ETNA 1NB2A 5GMEA 5A2QY 4K4YA 5LSOA 4MKVA 3VVUA 5D0EA 4USTA 2P6SA 5KFLA 3T6JA 1FDBA 3DDKA 1X9MA 4M94A 1MMNA 1VQNS 5KT7A 3UDCA 1YBTA 1M1HA 4ZOSA 1AFJA 1FJGF 3QO9A 5E3AA 2NLWA 1RYSA 2CQ3A 2DGTA 2NUUG 5DS7A 1FKPA 4ICLA 3OV7A 3DLJA 2AGPA 2F4VF 3THVA 1F3FA 4IDKB 3N01A 3M8PB 1SPBP 2VG7B 2DY1A 1SKRA 4OHVA 5KFSA 3EZUA 4KGMA 1VIOA 1JKHA 1WC0A 3HJVA 5C2GA 3D67A 1R8BA 2NREA 1PBAA 4MK9A 3S1TA 4D3HA 5DM6Q 2HVIA 4OHWA 2HNZB 4RW7A 2XLKA 1HNVA 3MEGA 1KONA 1DY3A 1ELOA 1F9FA 1QE1A 2Q3PA 1A6LA 3BM7A 3H7HB 3NRBA 1LW2B 5KTQA 2GIFA 4ERDA 1GMVA 1PBUA 2AMCB 1UVNA 2MKHA 1HNIA 2B43A 2RUGA 5H1SV 3D5MA 3AXMA 3BO4A 1FVQA 2KH9A 3K0JA 3I87A 4IQXA 3V81A 1CLFA 4DSIA 3OLAA 2A2DA 5IT9U 1J5EJ 1X0FA 3K89A 4YB6A 2J5AA 2B0GA 1U2RA 3WDOA 4AL7A 3ISNC 3Q2TC 1VQLS 1FJ7A 5C5JA 4X4TA 4FYWB 1LWEB 2ZOGA 4QYZJ 3UD4P 2GVZB 3UDLA 2PMZD 4J91A 2FJEB 2H48B 3LP2B 1U6ZA 2OPQA 3W2VB 2X1AA 1RTDA 3BJYA 3LANA 4AE5A 2I0XA 3ICLA 5F8JA 1ZAXA 2FGOA 4DPTA 1MU2A 4AL5A 5J1EB 3S8SA 3KXDA 2NPIA 2DNGA 1E6VB 3RG6A 5A76A 4ID5A 3SDEA 3J7ZT 2B9WA 1GQEA 3SQOP 3PW5A 3CJ5A 2MKSA 4ZCLA 1VJWA 4PXEA 2JLGA 2DTJA 3W9HA 3TUZC 1IJEB 1YSJA 2DO0A 1RWOB 2UUWA 3BN4A 5IM0A 2MQPA 2JZ5A 2XC9A 4I4BA 3GLJA 3ZC4A 2OFHX 5KAKA 2PA3A 2E7XA 3U02A 1SUQA 1TQLA 1ZPVA 2VPZB 3NS6A 1LQ9A 4WP8A 1QUVA 4Y2CA 4YY3F 3I9V9 1ZETA 4GKKJ 3EVOA 4USWA 4DV2J 1FXLA 3D54A 2RHSB 1HIYA 3FDSA 4FPIA 4ZVFA 2N3LA 3C6TA 5DRKA 3PFEA 2Y1LB 2XWYA 4KGVB 3LWLA 1HR0J 1Q53A 1M5KC 3TAMB 4C6AA 4ZKAA 4WWSA 3TUIC 5B0CA 4YR3A 4FF4A 2CQIA 2H5EA 2NXEA 1F9HA 3CJ4A 2VBZA 3HT3A 3V4IA 2JEFA 2CWKA 5IWAJ 5GAEI 3M32A 1MU2B 2GC8A 2WVBA 3MM9A 1CQNA 1Z2LA 5EDWA 4EEYA 1ZH5A 1RADB 3DM2A 3I31A 4GVLA 4DXLA 3MCOA 4WK1A 3EGVA 3IP0A 3TUJC 3EWGA 3VHQA 4N77A 5H9FK 2ZHAA 3Q22A 2K1RB 2J6SA 4EBCA 1JLGA 1N6QB 4LFBJ 4ID8A 3PW2A 2B7BB 3KLFA 3ZNJ1 1HNZF 1WC6A 1Z1ZA 3D0HE 1CJKB 1G4CA 1ZPWX 3ADAC 2NCKL 1GXTA 3K8VA 3CWJA 1RAGB 4KC5A 5J2NB 4C8OA 3L7OA 1OY6A 3PW0A 2YPZA 4PEOA 3QJPA 1BD6A 5KG3A 3TYTA 2IVMA 3WC0A 1N4LA 4ECSA 4PRFA 4NXMJ 3R7BB 4NLTA 3SXLA 2HGNA 4B02A 1HBMA 4DV7J 3WZ0A 2R2SA 2AGOA 3RYLA 2HFSA 3I32A 3JTOA 1VBZA 2QLJB 3ZNUA 2OTLS 3PJ9A 1S5ZA 2FY8A 3CCJS 1JJCB 4K4WA 1C2PA 2RVJA 4YDDB 4NMLA 3H2UB 1AXQA 2ADBA 4TKTA 5EGYA 4O3OA 3HPOA 4IDKA 4X64J 4NRTA 1PILA 1WG4A 3FQKA 1Q82T 8ATCB 2ZDPA 3UW1A 4B9SA 3CCQS 2MLYA 1YITS 5ADZA 4F4KA 5KFUA 4DZDA 1HD0A 3TQ1A 1N52B 3KNGA 4Q8EA 2Z4PA 4PCQA 5AT1B 2GS8A 3CJ8A 1WF2A 2GMHA 2GAGC 1GAOA 4M5IA 5A0YB 4KHRA 2C28A 3C3LA 4FYVB 3DLHA 3PIOQ 4C11B 2J8AA 2DHXA 5KG7A 5DGAA 3T1HJ 4UQTA 3TAMA 1H72C 1VC6A 4ZVHA 1E6YA 3PX0A 4NXNJ 1RT5B 4O3PA 3B54A 4JI3F 1KR4A 1S6QB 1S79A 1M0SA 1M5VC 4EI2A 2DVIA 3CDAA 3JTPA 3LA0A 3LW5C 3AB2B 2BJ1A 3R6LB 2DRDA 4CI0B 2VHGA 2KZMA 4ZLJA 3NOCA 5EX3A 1WC1A 1U8SA 2W1BA 3MEDB 5ETTA 3VCDA 4B3SF 2DEJA 2F7VA 3TAQA 3GSDA 3EDRB 3IBCB 3HP6A 4BHQA 3LP2A 5DO2A 1YX2A 4DR2F 1W25A 1RHQB 4EK2A 4NZ7A 1TK8A 2CZVC 4NLGA 1RLDA 3CO9A 3IR5B 3GYXB 4AQYJ 4DU7A 4RLEA 2UUAJ 4ZPTR 2BJ3A 5MLCV 1Y7PA 2L3MA 3G6XA 1VBKA 4JI7J 4QCLA 3U1NA 3ELHA 1YRUA 2EWHA 2NSCA 3H90A 3M2VB 3TR5A 3UR0A 3UCZP 1U1NA 3R1LA 1YJVA 2NUHA 3OTBA 4CRJA 1NPKA 1S4FA 4GVBA 2G0IA 2AJ0A 3C16B 3RGIA 4M5GA 3ZFVA 1NPRA 4ETZA 2ROEA 2W2OP 2X7IA 2W9AA 2OPQB 2GGPA 3CT9A 5IT4A 3KLHB 1DHMA 1S9EA 1NKCA 4ZIVA 3CULA 2VV5A 2VODA 1R43A 2DO4A 2ZVSA 5AXLA 4EGLA 3BGOP 3IRXA 4YB5A 4AQYF 3MR7A 4ER8A 1UA1A 2Q66A 2V9WA 4X4UA 5LMNF 2DB1A 1RHUB 2V8GA 1CS4A 3T5LA 3M8PA 1TR0A 4YY3J 4RNHA 1TUGB 3JS9A 1TK5A 2V8HA 1I94F 2XM3A 2HG4A 1FKPB 4ICLB 4HDGA 1KFSA 1Q16B 3QLHA 4JB8B 3CC4S 3M30B 4W92B 2AX1A 4R25A 4CLKA 3SCJE 4DSLA 4ENOA 3CW2C 2BACA 1VIXA 2EEYA 4FF1A 3CCLS 2GQ2A 2J7WA 4LQ3A 4WFBQ 1E6VA 2VPXB 4C11A 5ETRA 1F6TA 1HMVB 1C4CA 1VQYA 5LSLA 4O4RA 2IDLA 4CTAA 3G82A 3RAXA 3D3CJ 3W8GA 2ERRA 1IXKA 1KFDA 5L39A 3RR7A 3HHKA 4ELVA 2VPYB 2DR9A 4DFKA 2G13A 5FLXU 3NKYA 2HHXA 1RT4A 4H4OB 2XG8A 1S0NA 4ECRA 2M2BA 4TN2A 2F5GA 2DGSA 2WB4A 2HNDB 4NOHA 5KT4A 1RBLA 4DX8H 4J9NA 2M4MA 2Y0BB 3HKZD 2HHTA 3BEGB 1H7XA 1FRLA 1T9WA 1FI4A 2LXIA 3T1YF 4DS5A 5IC4B 1XR7A 2CJKA 2ACMA 2HQDA 2XMKA 3EM1A 1K47A 4C97A 1WD6A 3AA8A 3H25A 2D74B 3TI0A 1C0UB 1VHFA 2DNQA 1FEEA 3IM8A 2EKYA 4V1Ak 3V6JA 1Q7LB 2GX8A 4I6WA 2HMIB 1UZHA 3HKWA 4DR6F 3QYYA 4A4JA 2XNQA 1XN9A 4DV7F 2EPIA 3HF5A 3NEKA 1X9WA 2ZJRQ 1N56A 2VOOA 1I6JA 4DUTA 4MTPA 3QQCD 4PG8A 3KMSA 1XMQF 1VCTA 2QLFB 3I0SB 1RHMB 2NXCA 4W4MA 4WJBA 2YKOA 5IWAF 5K8OA 1VFJA 5CD4H 2UVWA 2LKZA 2VPWB 3T9ZA 4EO6A 4F4YA 1NRKA 4O3RA 4JI2J 1JIHA 2MMYA 4MH8A 2GAHC 1NDPA 1U0HA 3MMCB 4DMZA 3L3CA 2XZTB 4AD6A 5LJ5Y 3CCTA 3H98A 3QO9B 2NPFA 4C3MA 3G96A 3M6XA 1JXVA 4KFBA 3C16A 4NLPA 1S1TB 2ZKTA 3MEEA 1U45A 3M2RB 5J2MA 3NAHA 5SZTA 3GJTB 4GRSA 3IS9A 4MK8A 3D68A 2UUBJ 1WJ9A 2CNKB 3US5A 4LSLA 2XY7A 3M8ZA 1HNXF 4USIA 4JI3J 1KTVA 3MTJA 1TKZB 2EBEA 1LFPA 5KFFA 1R0BG 2FHMA 5KFXA 3WQPA 2DRBA 1TV6A 2WW4A 3J80Y 2PMWA 3AODA 3DOKB 2P9GA 1HR0F 3QGGA 1B0VA 3KHGA 1N5YB 3U7JA 2OEJA 3TZWA 1G3OA 1XC9A 2DNRA 4F2RA 2AEMA 2ZE2B 2EKNA 3VAIA 3GG0A 2CQ4A 4DF4A 5L9XA 4WFAQ 2CVIA 1NK0A 4A8YA 4DR5J 1CJVB 3OHBA 2FVRA 5HVGA 2RIJA 3HHLC 4OFZA 2H5JB 4DL7A 4K50A 3Q8UA 3CJ3A 2XTJP 4ECWA 2YX7A 3Q8SB 3AD8C 4OI2A 3FRYA 4RL1A 1U2FA 4DL5A 3M6UA 2ZHOA 2ZM6F 1KKHA 4NYPA 1OYEA 3TQEA 1VRTA 3H2LA 3IA0A 3VWSA 1U1KA 1EIYB 2HYIB 2DITA 2ABYA 3R7SB 4DV2F 4LF5J 4QWEA 2FVCA 3M8YA 1KQFB 2WCXA 3NOGA 4DX6A 4CQ1A 2V50A 4HHUA 1P8GA 1MROA 3GMGA 2ZBCA 4LUBA 5I3PA 3TOQA 5E0OA 4EO8A 4LF7J 1T9TA 4WK3A 2B9XA 3R8YA 4J9UE 2AZ3A 1U8WA 3I56S 4M5DB 1GEHA 3ZZ0A 3MEKA 1U6BA 2AJ1A 4DV1J 3NP5A 2R2UA 4ES1A 3FGVA 2OEMA 4DN9A 4GKKF 2JWNA 3LF0A 5KFVA 1L3UA 2OD6A 1EJ7L 2MHEA 2BR0A 5F9NA 4CT8A 1NB7A 5L46A 3TNVA 2L08A 3QJLA 2K7KA 1JLQA 1HHSA 3HX9A 1DURA 4R5PB 3Q24A 4TYAA 4N56A 2FVQA 2W7OA 2L9NA 3KOAA 4ZVTB 4PPZA 2VQFJ 3QJJA 1S9FA 1XWLA 2UUTA 4Q2LA 2HHHJ 5EUHA 3NGUA 3AT1B 1RUSA 1Y3KA 4YMEA 4DPOA 5J1PA 1RAOA 2MY7A 3NNHA 2FC9A 4DR7J 1S9GB 2M3DA 1HQEA 2JVOA 2MSSA 2L41A 3PO4A 3LO3A 4JOUA 3S6EA 3VZHA 1XK8A 3RR8A 5K14A 3IAM9 2GMJA 3MM5B 4J7CA 3GV8B 1NZAA 1HHTP 3M9MB 1WF0A 5JVGQ 5E3CA 4DQQA 1RLCL 4LF4J 2PA8D 3D9BA 4NWBA 3G6YA 2RUSA 1H38A 2R8GA 2V0NA 1C1BA 1RSCA 2XI3A 3IAS9 3W63A 3W66A 4FNIA 3I5AA 4IRCA 1XIQA 2MGZA 3SSRA 4PQUB 4QWDA 5A8RA 2G4BA 3CO0P 4BDPA 1JMTA 2B51A 4JI6J 2R9LA 2CJXB 2IRUA 2XLIA 3TP2A 1S72S 1WEXA 2H65B 4RW9B 4EZ6A 5GADI 5KFEA 4F4WA 1B99A 1NHVA 3CCZA 2OD4A 2JJ4D 1SJ1A 2DYAA 3MPYA 3ZZOA 1OPIA 3EJMA 2WSEC 2IM3A 1S1VB 4KR0B 3IGNA 2HBZB 5KFJA 1WI6A 1T0TV 2PI4A 2HNYB 5A8KB 3KLEA 4LIRA 3M2UB 4DFMA 1F3VA 4G6VB 3AQPA 4KGZB 4X64F 3T1HF 4UUXA 1VBYA 1KVKA 5F8NA 1P6TA 3I5BA 4TXSA 2YNIB 1B4SA 2WBMA 2YH1A 4HI2A 4UY8T 1KTQA 2BE9B 2ZUAA 3EICA 2AYEA 2IM0A 1RTZA 3N4WA 4KKOA 4PG5A 1XNRJ 2RKIA 4ZA1A 4J5OA 1GXLA 2D1CA 2XGQA 2ZH6A 2HRYA 1S0MA 1IKWB 1MN7A 4X2BA 3PHEA 2FVPA 2DISA 4KO0B 2MPUA 5E5NA 2B9EA 2LECA 1JX4A 3N79A 3CMES 1OIAA 2XMJA 2VZ9A 3QFHA 3DOKA 3PV8A 3FSXA 2FPHX 4ZIWA 3MGJA 4K4XA 4OHZA 1OJ4A 2MXYA 1Q8LA 1FNOA 2C3UA 1CEZA 4L72B 1YBAA 2ZC4A 3ISZA 5DDRC 2UVRA 4U7UD 2A2CA 1U1PA 3KWMA 2QSFA 4CLTA 1JXLA 1FO1A 2CJYB 4O0IA 4ZVQB 3PW4A 2MSTA 3NY0A 4KPCA 4KYZA 2CRLA 2EXUA 3ONQA 5CCLA 5C24B 4WKRA 1UJ6A 5IV3A 4QYRA 3UNYA 4OYIA 5FLXY 4DQPA 1AZSA 3MM5A 4I68A 2E5JA 2BE7D 2X3GA 4P74A 2B5JB 2W01A 2GJIA 4UTGA 3CF5Q 3GIJA 3SMZA 5FIIA 4IH6A 3ZXWA 3IRWP 2FJBB 3LQVA 4EBDA 1RAHB 3U1LA 1TMJA 1TL1B 2ASDA 2BJ7A 2A10A 1LK5A 2QLXA 4TQSA 1YK9A 4ELUA 1KP6A 2WBRA 3C19A 2ZWOA 1DFDA 1JKHB 1C0TB 1FF2A 2FC8A 2NYHA 3F41A 1XR6A 4ELTA 2YQ1A 3DOMB 1FRMA 3OR1A 3P6YC 2FYXA 4P10A 3OL8A 4WXWA 1S59A 3W7BA 2OPSA 3AHPA 1BQMA 1RT3A 4I7FA 5J2QB 1U1OA 1GXUA 3ET6A 5ETPA 1RWWB 3KG4A 2PO4A 5E3RA 4K5RA 4LF8J 2E5IA 4ZVSB 4M5LA 2ZC3A 4EMDA 3I6PA 3K5OA 3W9IA 2OH2A 4NYOA 1Y5IB 4P6QA 2HNDA 1NK7A 3MCNA 5KFRA 4NLVA 2DGVA 2EFPA 2OPRB 3Q8QB 2EG1A 4PG6A 1LXNA 2NZ4A 3ILLA 2Z2LA 3Q2SC 4B3MF 3PJXA 1S0VA 3QT6A 3QPIA 3MF5A 4NLSA 4OZJA 5DDOC 1UPMB 4D3GA 3SI8A 2FLPA 1SKUB 2ZOMA 4Y2IA 1VBXA 5A8WA 2B6AA 3H5UA 3QAUA 1C0TA 2IYIA 3LPYA 1JNRB 3DXBA 3PM9A 2F8EX 2YWGA 4CO5A 1FEHA 4MK7A 4ZN1A 4Q8FA 4JYAF 3VAKA 1F2GA 3HO1A 1RKJA 3PVXA 1K73T 4FXDA 2MQ8A 1VS3A 3MZIA 4OJ3A 4ZCMA 5AJ3F 1O51A 1CG2A 2M8HA 3AOAA 3EDQB 4MIBA 4AFFA 1WSVA 2LA4A 1VQSA 2Q79A 4AUKA 5KFHA 4ED7A 1YZ7A 3HVWA 3JSBA 1LW0B 3ITHB 5BYSA 1Q81T 3LP1A 1F2HA 4P7VA 4RBTA 4KGXB 2DY9A 1OMSA 5D0RA 1QUPA 5B09A 4DL2A 3A3PB 3R97A 1HWLA 4DEZA 5HQLA 3G4SS 1RT1A 3J7A1 5EN1A 4IG0A 5I3UB 2KG0A 4ZHRA 1KRPA 1Q1KA 3D1OA 3G6VA 2M5YA 3OHAA 1YRTA 4YP3A 1S1XB 1X5SA 2HKEA 3GP9A 1QSLA 4LRDA 3KNAA 5D3GA 3MFIA 3LGNA 2VOPA 1QAYA 4WKYA 2LP4A 4IOCQ 3W2WB 3GIMA 1AZSB 1YZ6A 4F04B 3EGZA 1IKWA 4JI1F 2MZTA 4WE1B 1DLOB 1M1GA 3FEZA 4L76A 4YFUA 1VLYA 2H3EB 5E41A 1JJ4A 1IKYB 2IC3A 4IFYA 1BE4A 1WKKA 1YQHA 1NLKL 1JLCA 4ANCA 4LT6A 3EYZA 2CZ4A 2CPFA 4DHVA 3UD3P 2MKJA 4WYWA 1RYRA 2UUCF 4ZLNA 5C25A 3AFGA 5DETA 4DS4A 2Z8QA 3HDSA 4DR1F 3T6BA 1NK4A 1SL2A 2RDIA 4RU2A 1S6OA 2E66A 2VDHA 1IBLF 2MQMA 2DXEA 3WX8A 2E5LJ 2HVHA 1PC4A 3SCLE 3JAMU 3CJ2A 2KT5A 2QT7A 3CCWA 4ZP9A 1TL3A 5D4PA 3MUTP 2MLZA 1VMBA 2B5JA 4WFXA 3CXCR 3B82A 5IT9Y 1RHRB 5KFNA 2VH7A 4N7TA 1H74A 3R5DA 3LUYA 1X5TA 1DZ5A 2DNZA 2YH0A 3U1MA 5CYJA 1N5SA 5C24A 3QZ7A 2HS4A 2WVEA 2HS3A 2FDNA 4OV6A 1ZM9A 3NNCA 3DLEA 1O5JA 1JLEB 2BABA 4E8UA 1KNZA 3GFYA 2K3IA 4ED5A 1MNEA 1YJTA 1ZM3A 4CNZA 2X51A 4KSEB 2E5GA 4LF9F 4OL8A 3R27A 1I3OB 1NSQA 3MM8B 1VDHA 1S77D 4PWDA 4B3OB 4B3OA 3CIMA 3W1YC 4CP5A 2ZZNA 3M9OB 1UVMA 4TY9A 2ZM6J 2GNKA 4X66J 3GJRB 5KFPA 4IRKA 1A7GE 3MURP 2C2MB 4ES3A 2A1BA 2J0XA 2YNGB 3T1AA 4ECTA 3HSJA 2KFZA 3JB9k 2M88A 1W7WA 2L48A 4MAKA 4RW8A 5AXKA 4QU6A 1B3TA 2FVSA 1WG5A 1HBNA 1SJQA 4G1PA 5KOWA 4BWMA 2MHNA 4USKA 3TX0A 3BSCA 3BGLA 3EGNA 3GYGA 2JX2A 1Z2ZA 3GJSB 3PYDA 1VGYA 2LQJA 1UWBB 1BY9A 2U1AA 3BH7B 3KG1A 1YVFA 3R9LA 2H9ZA 4NI2A 3NGDA 2XEXA 1QSSA 4RPFA 4WFNQ 3FBFA 4URSA 5B0BA 5BJRA 1QSYA 1ZZFA 1N5YA 2E5HA 2GVDB 2VQEJ 2F8HA 4M5DA 1N33J 4R0EA 3T19A 1YDLA 4KHPJ 5GAHI 3TUPA 3LAMA 2QL7B 4Q43A 4B9LA 4B3RF 2PIIA 2GGPB 1UVIA 2XS5A 2DNOA 3DKDA 2E7WA 2AIRB 2JEGA 4PWDB 2MKCA 2OELA 1WHXA 3KJQB 2HHHF 2F8MA 1CPZA 1R8AA 2ZUGA 5CHCB 5IC6B 2PE8A 3OPKA 5CD4A 4QWAA 5HK4A 1DQAA 1OSDA 1MN9A 2DGUA 2WK4A 1LW0A 2VC0A 2YWKA 3ITHA 3A8KA 1TKDA 1B0TA 3RBZA 2LEPA 5F8MA 3N28A 1U24A 1H3DA 4NRUA 2FJAB 4KV8B 3HJFA 1K1QA 3VAFA 3KLIB 4RNFA 3T41A 1DAXA 4Q0BB 2D9PA 5DDQC 1ZS6A 2R7VA 1KHWA 2DNMA 5LL6d 1KVIA 2GVDA 3KUEA 1WC4A 3BGRB 5HLFB 2IA0A 5I42B 4ZP6A 1GT8A 3K8WA 3PNIA 4NZ6A 1W26A 4QR1A 4J9LA 5T14A 2VKRA 2KXHA 2EBGA 3DLKB 4HACA 3W64A 2XQCA 2FGCA 3LP1B 4A8WA 3NCPA 4C3KA 4RW4A 2M7SA 2UXCF 2YKAA 4LRBA 5CH7B 4ITSA 5ETVA 5LMNJ 2EG2A 2KFNA 1O8BA 3R3TA 3OL9A 1QVGR 2VG5B 1AUSL 3F73A 1DBDA 2QA4S 1F0XA 4X4OA 2KB2A 2R4FA 4J9PA 5EX0A 3UWTA 1YGYA 3HHEA 2ASYA 4ZN3A 3QGHA 1R8PA 1EAYC 4LREA 1U1RA 1D9FA 4B3TF 3EE3A 2W8LA 3FMBA 2EC0A 4MKBA 5D3GB 1NJZA 1F1BB 4UT4A 4NEYA 3BR9A 4A46A 1ZTWA 1WELA 3PJWA 2AYBA 4EWTA 2LCWA 4IOAQ 1ZM2A 5HVFA 3THTA 5I3UA 4OI4A 3A13A 2EFVA 1NDKA 1RT1B 2C3OA 3FNNA 4DUYJ 1IKVB 3FVYA 3OTEA 4DUZJ 4DN0A 1T7PA 1QJHA 1C1BB 1WHYA 2LU1A 2YKNB 4A47A 3TA1A 1LW2A 3I4HX 5IV4A 2AGQA 1ITPA 2VJUA 2W7PA 2O1PA 5B0FA 4CO4A 3OTOJ 1OY9A 4LRAA 2DHSA 1RTHA 3EXCX 2DR6A 3CJSA 1IQZA 3ZTPA 3AQOA 2GMLA 3DC2A 1XQIA 1DLOA 3IG1B 1HQ2A 1UW4A 1RAIB 1CS4B 1DARA 1S6PA 2ASJA 2HAIA 3NGTA 3ENAA 3SQGB 1FDDA 2LXFA 1UJ5A 1RB0A 3AJ2A 1NJXA 2JEJA 1FTCA 1R7IA 3D4JA 3QRQA 1IUJA 4I6YA 2LA6A 1X5OA 2E29A 1TL5A 3AD9C 2VKZG 5F8GA 3KLHA 5C25B 3O5TB 5LMUF 2R2TA 4DV5J 4XTTA 3C46A 1FRHA 4PABA 2ZH7A 2LU2A 2ZHBA 2HHUA 2HQIA 2RQMA 2IVYA 1AW0A 2AEJA 3C14B 3R7NB 1YJ9S 1BWEA 1S1TA 3MEEB 2R7XA 1FFGB 2EC2A 3ZTRA 2KJWA 5MAOA 2BANB 4DV0F 4I67A 2B7CB 2M9KA 1H2UX 2DNYA 2KHDA 4DQSA 1FD8A 1JWWA 1JLBB 2QE5A 1GH8A 1PYSB 4ZDNA 3IBFB 2VF3A 3KMQA 3CNQP 1B7FA 1X4EA 3DU5A 2LQBA 2DIVA 2W4DA 2UU9F 4RBVA 3VVTA 5KFCA 3I0SA 2XULA 4I7FB 4C9DA 4YEAA 2OPSB 5J2QA 1UL3A 1APSA 3TVZA 1DQ9A 3A8JA 3IWXA 3G82B 3PYFA 2HWIA 1RCOB 2RU9A 1URNA 7AT1B 1S1UA 3HHLD 1FJCA 3RAMA 2PD1A 1B64A 1EARA 2HBQB 1TTHB 1TKZA 2F9DA 2GHWA 1VC0A 1HYSB 3MR6A 2BOPA 5L1JA 2GIRA 4J9SA 3VGVA 2QIFA 1TU0B 3IS9B 2AWZA 4JV0A 1XMBA 6FD1A 4DL3A 2OMOA 1Q95G 1R31A 2GV1A 1RGVA 1KD1T 4Y34A 2F65A 3ZTSA 2ZH1A 1S0OA 2BANA 1IBLJ 1IBMJ 2VA3A 2GA7A 2GO9A 2IJNA 2IM2A 4RW6A 5LMUJ 3QRPA 4CH1A 1RT7A 1FE0A 3R5AA 4O0NA 1KBRA 1RTIA 2C2OB 1JNZB 2J9CA 4KB7A 1PG5B 5HBMB 3SV3A 1TAQA 1U26A 2V34A 1GMWD 2QFIA 1NDLA 2V63A 2GQQA 4YOEA 1UFWA 3NBPB 3SFGA 3JAMY 5KT6A 1NSKL 2Z2ZA 1JK9B 4QIFA 4Y6IA 2W9CA 4K0KF 4M95A 2EFGA 3W3SA 1ZA1B 2KXNB 1RU1A 1R27B 2CQ0A 3OTOF 1FKAF 2G9OA 3AOBA 2E44A 2UVUA 1UWBA 1WSRA 2QMXA 3AAWB 1PC5A 1GX6A 3HFZB 5F3ZA 2BOAA 3PZPA 2CPXA 3HT0A 1MG7A 1NZ8A 1YWXA 4I64A 1NPPA 1SC1B 4Q2MA 5E3PA 4ZCIA 2XO7A 3V6KA 3PX6A 2J6UA 4L6V3 2EFQA 3KJVB 4A8KA 2R7SA 5L9NA 1T11A 3KYLA 4JI4J 3PRVA 5KFGA 1WNEA 2CQPA 1CULB 1R6VA 1HKAA 1T9YA 2AYGA 2YQ3A 5HP1B 4B3TJ 4FVMA 4O3QA 1HBOB 2Z30B 4OI6A 2AYMA 2HVZA 4MKYA 2A18A 2KN4A 3SCIE 2VC1A 2OLWA 3MM8A 1L3TA 4DR4J 4GVBB 1XNRF 1VQMS 4LR8A 3O6QA 4OQJA 2HPUA 3I82A 3N5BA 4NLRA 4ANDA 2PDAA 4E2FB 2YX1A 5AE1A 4U7CA 1NSPA 3R5JB 1QTMA 3DGPB 3UN2A 3V6DB 1DQ8A 1C4AA 2ATCB 2IBOA 3Q89A 2F3JA 4J90A 2ZH4A 1ZYQA 1NJYA 4KTQA 3UVJB 4KJIA 3QIPB 3TVYA 4P52A 1UP1A 5KG5A 1IWAA 4V19X 2E9TA 3OJUA 3M7VA 6AT1B 4FYYB 4YHHJ 4EYIB 3PKMA 1ZM4A 3JSRA 3KJNB 3OXLA 5HVHA 5KFOA 3MFHA 1XBWA 4OYOA 3W62A 3GIKA 4JV5J 4WZMA 3DOMA 3SV4A 3FC9A 2BKPA 1Q8KA 2HFNA 4K7QA 3I5CA 1T03A 1OS5A 4L73A 2V5HG 1WTFA 4P2SA 3KDNA 1SCJB 1GTEA 3D0GE 4X4QA 4DR3J 2C2RA 1EETB 4UOFA 4NCGA 4ZVUB 2N82B 2BKOA 2HQGA 1WF1A 4XAKA 3OVAA 4IR1A 1PJ7A 2RRAA 1SKSA 3PY8A 1HNWJ 3OVBA 4DPUA 3WX4A 3JSYA 4TLQA 1I94J 2VDIA 1FK9B 2LDYA 1SXLA 4ZVEA 2YKMA 5D0GA 4ECZA 1B70B 2K3KA 5HAOA 3CJTA 3ZZRA 4RUHA 2BQ3A 4DG1B 2BW7A 2C1EB 1R0CB 4JBCA 1FRXA 1HI1A 2QMUB 5GAGU 1CC7A 2I5JB 5LSRA 2V4RA 3VF0B 1RXOB 4YN3B 3BBBA 3ZO7A 1S1XA 5IT0A 1NH7A 1Q5VA 4OI3A 4TU8A 1KWMA 3H42A 5L8RC 5HJXA 2HEKA 1NJIT 3CTRA 2JFDA 4TVAB 4IFVB 3D66A 1XMQJ 1TUVA 3RRKA 4F3MA 3DHXA 5IXUA 3EPIA 4HVZA 4J9MA 3M32B 2RT3A 3DGVA 4MYUA 1F5BA 4F4XA 4RWWA 4LMZA 3B4MA 2HMIA 1FDNA 1S7IA 1VK3A 2CJAA 2D41A 4L3NA 4OLPA 4NCGB 5IFMA 2Y1IA 1R0AB 2GHVC 5K14B 3GCWP 3L7UA 1FRIA 3GJQB 3DDIA 3S01A 1CC8A 2YX4A 3C66A 3CD7A 1ZZNA 2WONA 4LF7F 1CJKA 2LEAA 5BR8J 5L1IA 3SFUA 2A6MA 3NS7B 5A8KA 4B17A 1W2IA 2GZOA 3OFGA 2MZSA 4I1TA 3KLEB 3MR3A 1RK8A 3FUYA 3RB3A 4B3SJ 4TLRA 3MEDA 1N33F 1UEKA 2QMWA 1S1VA 3H20A 3NCRA 1J5OA 1HWKA 1CJTB 3UO0A 3M1VB 1D3WA 3MOZA 3UVJA 2VFRA 1LXJA 3K7RA 5F41A 4CH7A 3CCUS 2HZVA 4JI7F 4CH0S 1RAJA 1N5VA 3BGUA 5E33A 1K0VA 3TARA 2HFOA 3FSYA 3BGFA 1CQMA 4LSLB 3CJKA 3V6HA 3AH6A 1IBMF 2DD8S 2R8KA 2XB2D 2J0WA 4HHJA 5J1EA 1DJ0A 1JLEA 5E3QA 2BXJA 2D3ZA 4WIQA 2WZ1A 5GMKa 2G0CA 4NXMF 1QE1B 2JOQA 4UOCA 4CLPA 2E5LF 2D7SA 3QLHB 4IOBA 3SBMA 3BN7A 1RBOB 1NUEA 4OZ3A 3T5JA 2R8JA 3EX7B 1IM4A 1GFWB 2CWXA 1UW9A 3GIIA 2QN6B 1S1WB 2PC6A 2BBEA 3MM6A 3DDNA 4YHHF 3JXOA 3IFEA 2DIUA 1X4GA 3NWGA 3Q8VA 5KFIA 1XEZA 5G0RB 8RUCA 4UOHA 3TZYA 2QL5B 1EHWA 1HMVA 1SQEA 3EVMA 4Q44A 4URGA 4ED2A 2OSRA 3IM9A 2CPHA 1HFEL 1HBMB 3FEXB 4QBUA 2PEHA 4DV4J 1T94A 4WPAA 4U95A 2XMTA 4GC7A 2V2VA 4HEA9 1TKXA 4CLSA 4CLLA 3NG8A 5HQMA 1WI8A 3M30A 4RU9A 1V3SA 2EVZA 2JDJA 3D28A 2ALYB 2O67A 3E3XA 2KM8C 3KK3B 1VQ4S 2YWFA 1HBUA 3G8QA 4LQ9A 4WE1A 2XS7A 5DLFA 1HLWA 1SJFA 3H40A 1BUXA 2HRUA 5KFZA 2OTJS 4NA3A 4DI6A 1IWGA 1SH3A 4I2PA 1FWKA 3SSSA 1J2VA 4FS2A 3HVTA 4RKUC 4LFCJ 4MYTA 4WTOB 3MAQA 1PJ5A 2JC0A 4YR2A 4DUYF 2O5DA 3M4XA 4P72A 5KG2A 4OHYA 3FBEA 5KG1A 4WCEQ 1SUQB 5BYRA 5DG8A 3QSYB 3L7PA 2DHAA 4U67Q 1RHJB 4PAAA 5D78A 3K2YA 2CNOB 4Y2KA 1QY7A 4MKAA 4XK8C 5T7LB 4JI8F 2E1AA 2YWWA 1H73A 4DR1J 2JHEA 3T1YJ 1S6QA 3H5SA 4RX6A 1NXIA 1VRUA 1WOSA 4U96A 4LBPA 3VQSA 1VHIA 4RNMA 2LYVA 3GWCA 2QTWA 4DR3F 2HW3A 3DHWC 2JRSA 3D1HA 2UUAF 1NHUA 5KG0A 2CAJA 4C7QA 1RDRA 2XMWA 2Z58B 2RF2A 2I6WA 2AZ1A 4CNYA 1SL0A 4IR9A 1BLUA 1I5OB 2CPZA 2DNNA 1ZOTA 4P7TA 2IRYA 1U6FA 2FZKB 3M8QA 4DPYA 4ETXA 3J7YI 3HSZA 3FKBA 2RU3A 1N34F 3PR5B 1S48A 4C8NA 4F0HA 1IKXA 1QM9A 4OZ5A 2H51B 2W2MP 2G1HA 2W4PA 2MDAA 2OUGA 2VBYA 4I2PB 4P9SA 3THPA 3GV5B 4J9QA 4QPXA 1L5UA 3NMAA 2PFFB 5D4LA 1S4EA 3R2DJ 2OPPB 2HURA 4FYDA 3V6DA 2WOMB 3IBWA 5K8PA 3DLBA 5KFBA 4F4AA 2VD3A 5KFWA 3QZ8A 4FBTA 2IY5B 1LWFA 3TJ9A 3W5YA 4YUDA 4IO1A 3MHYA 4O3NA 1NK6A 2FJXA 4OI1A 3FJ2A 3J7YU 3OUYB 4FS1A 1VLOA 5CXTA 3ISND 1TKXB 5U47A 1RTDB 2HIYA 2FLLA 1ULRA 2AU0A 1REVB 4H4MB 4CIOA 2W9BB 1J5OB 2CG4A 5JMNA 2CPEA 2OHDA 4XO0A 1NKEA 1KOOA 4LFCF 3EVWA 4DFJA 4ILMA 1VQ6S 4B3RJ 4KIAA 4CLUA 1YJRA 4P2XA 5A6WA 3TRGA 1QAJA 2CIMA 3BSNA 3VGUA 1UEUA 3J7Z5 4K0KJ 2CQDA 4Q45A 4S0MA 1EKRA 2HBRB 2KDOA 1HBUB 1F9EB 4DCOB 4XPEA 3M6VA 3EMTA 4KPYA 2B8QA 3K5PA 5CA5A 3VAMA 5D4NA 4MFBB 3OSNA 1KN6A 4N5SA 2X1GA 4KBIA 1EQ0A 4L75A 4P71A 3QNWB 1JLQB 5DJBA 2YKNA 2MQOA 3GILA 4DV4F 3CC7S 4X4PA 4LF8F 2WAQD 3DLLQ 3S7RA 1LWFB 1FNMA 4N8NA 3BZQA 2RE1A 4GMKA 4LFAJ 3NBPA 3GV7B 1N0VC 4QIEA 1AUDA 5CCMA 1PGZA 2ZJQQ 3OVSA 4JP8A 4PR6A 3QAEA 3C6TB 3BBFA 2VB6A 4ZJQA 3M9NB 3DN9A 3H59A 5CQGA 2J0QD 3A3NB 3OR2A 3UCGA 2CQCA 1A9NB 2IRXA 2IDEA 2Z57B 3M8QB 3QRRA 3OW2R 1EB0A 2HHVA 4ZJLA 3RB6A 2YBVA 1D9AA 4NA1A 3QT5A 3I55S 4Y28C 4ZPWR 3A4TA 2R8HA 3RTVA 1EX8A 2R3VA 2AF6A 3GU0A 2YWEA 3GYNA 3POTA 3POTB 2JNJA 5HO4A 1U49A 2IBKA 2XYHB 1RT2A 4CLFA 2CPIA 4QPTA 2J9DA 1S57A 2W24A 4HHHA 1WHVA 2VASA 5B7WA 3J81U 1RWXB 4KRWA 4J9RA 4JI5F 5T7LA 2IMWP 2OMLA 5G0RA 1XNQF 1Q79A 5CYMB 2IM1A 3AA9A 2MZ1A 3BGRA 1WKLA 4PWWA 1VI7A 3BYRA 5HLFA 1DRZA 1MWYA 2CPJA 2LQ8A 5J2NA 1UZDA 3KFWX 4C0HA 1SKWA 1QDUB 5F0UA 5LXYA 3CC2S 3H8YA 4O23A 4P2MA 4LF1A 1JQGA 4EBEA 2P9EA 3MAHA 2BM1A 4WXOA 5IM0B 4WYLA 4DV6F 2WONB 2BRLA 4DBQA 2B8PA 5HMWA 1SIZA 1T9XA 2V67A 5KFKA 1HPZB 4RUAA 1JLFA 3HHNB 3TEHB 2PN6A 1D9DA 2CQ1A 5DQGA 2ZH2A 2MB0B 3BO2A 4U8YA 4IUFA 4OV1A 2OEKA 2ROPA 3AD7C 4Z7YA 3F56A 1RJJA 3GB0A 4FXWA 2CNLB 2A3JA 2NR0A 4WP9A 4DV5F 1GK8A 1UPPA 1Y5LB 2BVZA 3FFIB 2OGUA 2HVEA 4BBYA 1D8ZA 4Z2XA 2RB7A 4Q5VA 3RBDA 4IG3B 3CIZA 5CYQA 4C8MA 1LWCB 2DNKA 1N5TA 1Q78A 3DRXA 3M05A 4CO0A 3A8EA 2XYGB 3K59A 3V81B 4QW8A 1N6QA 3OT9A 5LT5A 1T3OA 1AT1B 1PO6A 1R3NA 1XTZA 3OD2A 4NA2A 2G1DA 3VR1A 5F8LA 7FDRA 3K58A 2N7CA 3WC2A 2GO8A 1REVA 4H4MA 2W9BA 3W5ZA 1LK7A 3MECA 4F3OA 1NO8A 3AB4B 1LWXA 4RW8B 1WEZA 2DRAA 1YG0A 3FRZA 3Q83A 2IPOB 1RWMB 1P9QC 4OX9J 2BV3A 3D3BJ 4CWBA 1XR5A 3V4IB 1C1CA 2LQ9A 4OJ1A 1J5EF 3CJKB 2A6OA 3NGSA 2EW9A 3TEGA 5AJ3J 5DZ6A 1G6BA 4I0WA 3RUBL 4DLEA 3AXKA 1OQ6A 1RTIB 2XMUA 5M2RA 5KT3A 3CJ0A 4USUA 2OFGX 5RUBA 2KU7A 2FHOB 5CAAA 1V9OA 1URRA 3MPUB 5JJBA 3CMAS 1PAEX 1HI0P 3OXFA 3KTQA 2MLXA 2MZRA 4IKAA 3DXSX 3CD6S 3GIRA 4Z37A 2YNHB 1QLNA 2WVFA 4F25A 2V2QA 4FKYA 4BC7A 1S76D 2QZ8A 2KHCA 2KYZA 2ZWPA 1FESA 1GMUA 1MSWD 4XDCA 4DL6A 2WOMA 2QA2A 5KOXA 1I1GA 3BDEA 2OPPA 4F8RA 4KHPF 1BC6A 1CJUB 1UETA 3IGVA 3QT8A 3VGTA 2IIHA 2BA9A 2DKOB 3MECB 1FDAA 3TO8A 1N48A 3FCHA 4LF4F 2IJRA 2XHCA 2BYCA 2Y1RI 4QWBA 4IO9Q 1D8YA 1TVRB 4FF2A 4CLWA 2IYGA 4F0MA 4K8RA 2W9CB 1JXEA 2R2RA 1NK5A 8AT1B 2LEBA 2NXUA 4HR2A 5HL7Q 3D7SB 1V3RA 2J9EA 1KHVA 4GO5X 4ZITA 4UQGA 2D3OR 3M8SA 1TL7B 2B4PA 2AQ4A 4LF6J 3BPSP 3DRRB 4C48A 2UU9J 4X4NA 2KI2A 2C3MA 4WFYA 2M8DB 4DQIA 1FVSA 2HQFA 3P5BP 3FFIA 2LDIA 4ECXA 1JLBA 4KY3A 3NAIA 1FE4A 4OX6A 1I51B 4USVA 4YR0A 2AJFE 1FK9A 3FCWA 2CFXA 4DCPB 2GJFA 4LRCA 4ALZA 2WW8A 3M2VA 2FZGB 4IYQA 3UN5A 1VQPS 1FERA 2V6AA 1HYSA 4GKJF 5G4DA 4DWIA 3P45B 4ZHRB 3UDEA 1NH8A 1S6UA 3TW0A 4TU9A 1OSCA 2HVDA 1RTJA 1U1MA 3QIDA 1G1XA 5GMDA 1P27B 5HMZA 1UTAA 1VQ8S 3KJVA 4CM2A 1M90T 2EK6A 4KE5A 4Z7CA 1U25A 1N0UA 1O0PA 4FYXB 2DGXA 4QWCA 2DPIA 4NCBA 4DDFA 4B08A 1HQUB 4NX9A 3Q8RB 2R8IA 1DTTA 4BS2A 4ZVRB 2ILYA 1NU4A 1RT6A 1REGX 2HNZA 4RW7B 3J80U 4OZ1A 3UD5A 2P8IA 3IC1A 3OXGA 5HMYA 3D6TB 1TAUA 2QLWA 4KH1B 1NDCA 4NLWA 5FD1A 3TAPA 3RB0A 1IBKF 1PIEA 2KXFA 2FTRA 1YLXA 4JUZA 3FCVA 2OJ3A 5HQ8A 2ZFHA 4RUBA 3CDBA 2DGOA 1TK0A 2NQPA 2NSBA 2XSFA 4PYDA 4J37A 2KFYA 2JVRA 3RU0A 4JI0J 2EFOA 1CJTA 4F0KA 1RWPB 1SC4B 2BJEA 2BZ2A 2OSQA 3Q8PB 1TZ0A 2PSZA 2XNRA 4M5HA 1MMLA 1LWEA 2XWXA 2ACYA 3OBIA 1K44A 1KEKA 4QIVA 1G7CB 2BDPA 1JJHA 4ZMMA 1AYEA 2RMLA 2MQLA 2R42A 1QVFR 4NYZA 2UUBF 4N8OA 1T05A 1AA1B 5C2CA 4K4SA 2B3TB 4YDXA 3PDNA 4LBIA 4CCHA 1RT6B 4C8YA 2QSWA 4HYKA 1DTTB 2VQFF 4I6AA 1HNVB 5HSPA 2FY1A 3VAJA 2V4QA 3HI9A 3OR1B 2G2YA 2H1YA 5I42A 4DL0C 2XS2A 2AJ2A 3PXGa 2UUCJ 2P9CA 1U7LA 4EUVA 2ZJPQ 1NKBA 4LR9A 4J9KA 3CDWA 3QMQA 1TKTA 1RWUA 2FUG9 4U7UK 3MM6B 2FLOA 2DPJA 5FJ4A 1RTJB 5HBMA 2GFFA 5F3TA 2X1BA 3ENWA 1KQGB 4ZPCA 3H5YA 3I0RA 1IKYA 4IFYB 3N9UC 3MMJA 5M2PA 1U1LA 4ZPAA 6FDRA 4WF9Q 2WB1D 3H0PA 2UV8G 2YKMB 2C3YA 3KK3A 2AEFA 1GMWA 5EWFA 1EQMA 4O4GB 2VBWA 1WOOA 5J2PA 4A8MP 3UCUP 3BREA 5D8HB 4C3LA 3A3OB 3TZZA 2MZQA 1GTHA 2RS8A 4UW2A 4QIGA 4N41A 2UXCJ 3QGIA 3VV2B 4P2FA 1UA0A 2XCAA 5D4OA 4KH0B 3MPWA 5HMXA 1RWNB 2YY3A 1X8DA 1WACA 1LNQA 2CQBA 4F26A 1NM2A 2WSCC 3GG1A 2YKQA 5L1KA 5IQQA 3P5TL 4HH0A 4RW6B 4ATNA 3LTOA 4CZCA 2W2NP 4NEZA 4U8VA 4QQBA 3H2VE 4HH1A 1QD1A 3P8BB 2HHSA 4MIWA 5IOLA 3KHRA 1YHQS 4B9MA 5KFAA 2J7KA 4QU7A 4H4KC 3MUVP 3VAHA 2W2QP 1SV5B 3UR3C 5HI7A 1VQKS 1EP4B 4JI5J 2HWTA 3T5HA 4IH5A 1RT5A 4FF3A 4RW4B 4E0DA 2Y8YA 1WEYA 4WTYA 4BCAA 4JYAJ 1NHKL 3HLUA 4I56A 4ZVPB 2BKNA 3N5FA 2J6TA 2GW8A 4Y3CA 3SEOA 1DTQA 2V68A 4JI0F 4HDHA 4NZ0A 1BMQB 4WU2A 1VQ9S 3RBXA 1BWVA 4FVCA 2ZEJA 3W2VA 3M8WA 2AD9A 3TANA 4LF9J 3J81Y 3ULHA 2AV5A 2RD5C 2EK1A 1ZA2B 1VJQA 2HK3A 4BC9A 1WOPA 1LFWA 3N6MA 5BYQA 3GCXP 2ZH9A 3KJFB 3DI6B 2UXDF 1RWVB 1S49A 2R7RA 5HROB 4TYBA 4I2QB 3CB4A 3WIVA 5H9EK 3RRGA 1N54B 3E01B 2QX0A 3ET6B 1FJEB 3IR7B 4DX5A 2MJNA 4OJHA 2P6TA 1HWIA 3ZTOA 4B3MJ 3PO5A 3RW6A 2OP5A 3I96A 2KZZA 3IXQA 5B0AA 4PXBA 1PJ6A 1SI9A 4JI1J 1Y9OA 3OQ2A 3BPDA 4PKDB 3CPWR 1X0PA 5AXMA 5FDLB 3WHIA 4DSEA 1T8EA 1M5PC 4HL9A 2E9RX 4Y2AA 4X4RA 3O44A 1BQXA 4LSNA 1S6PB 5ETOA 1UWAA 3ENVA 4F7VA 3FSIA 4DR5F 5K5MA 3DRPA 3TZXA 3D6HB 1PKUA 2GJ2A 3IN5A 4B9UA 1TFYA 3DMJB 4K5SA 4LJMA 3ZZPA 2D69A 2Q6BA 1NAQA 4OX8A 2VICA 2R7WA 1U09A 3DRSB 1RA6A 1T9VA 4L74A 3KHLA 4TQRA 3CD5A 2JLEA 4XPCA 1OY8A 3MMBA 3TWZA 3KK2A 3DI6A 2IAJB 2CQ2A
chains in the Genus database with same CATH topology
1IKVA 1X7VA 5K8NA 4B9NA 2W25A 2NYIA 2IJFA 3DRYA 3ZZTA 3GR1A 2IVFB 4EZ9A 5DGBA 2DR7A 1HW9A 4OIXA 4DQRA 1DTQB 3FMWA 4KGKA 4IH7A 4ZPVR 1H2TZ 3O2IA 1R89A 5LXRA 4DUZF 4JV5F 3T3FA 4HT5A 2RKIB 3QWUA 4LFAF 3KLIA 2UP1A 4PXDA 2PI5A 5K9FA 4OJGA 1AFIA 2OAUA 2F1FA 5L38A 1K8AT 3HFKA 1FA0A 1Y00A 3LALA 3V5RA 1RISA 3SYZA 1D1UA 3T9NA 2BM0A 5HN0A 4C0BA 4DR7F 3C6UB 2LMIA 1H0HB 3I4PA 5F8IA 2XLJA 4LF5F 4A8XA 4X62F 1X9SA 2XZWA 2D3UA 3GQCA 1RQ0A 2V2KA 3ENQA 2R7TA 3UFCX 3P96A 5A8RB 2KRBA 1K1SA 4F2SA 3DFEA 2RS2A 2POKA 1MMDA 2KVIA 2WTFA 1IQTA 2VFSA 1QAIA 2VA2A 3MM7B 2QV6A 4MJKA 3CCES 4ILRA 5M2UA 4BWJA 3NS5A 5A6PA 1OWXA 2CKWA 3CEDA 4K4ZA 1G2EA 2HLUA 3TX8A 3LP0B 4MIAA 2BE2B 1HBOA 4OLOA 4PPDA 4QZVB 2UVVA 3JYTB 2QRRA 3HHLA 5HP1A 2E1CA 3KK1B 1KVJA 2R7UA 3GFXA 2GHPA 4R0JA 4M1KA 1S1WA 3GFZA 1JLCB 1BGXT 2O66A 1D0EA 4QW9A 2KJVA 1KSPA 2V8DA 2MY8A 1RA7A 2DGQA 3QIPA 1N4LA 2IFXA 3KG0A 5I3QA 2OPRA 1JLAA 3QGPA 1ZAWA 4EU0A 5HO4A 2E1MC 1T95A 4OZNA 4C2MA 5LJ3Y 4ZLPA 4Y00A 2OIHA 4EFAC 4ZP7A 1NK8A 2FLNA 2VFUA 3BR8A 2K8GA 3VTIA 2MQNA 2F40A 2B6AB 2E1RA 3AJ1A 2HWHA 1RT4B 3M6WA 3E8OA 3ONQA 4H4OA 2BJDA 4A8QA 1Q86T 1H6KX 1PSDA 4AXJA 1FKOB 1KQKA 2VG6A 1RT7B 4FBUA 2ADCA 3BSOA 2RRNA 1IKXB 2CPDA 4K59A 5SUHA 4HKQA 3PRBA 1M5OC 3NGKA 4OX7A 3PEJA 2MQQA 3L95X 4AYBD 4YB7A 2CQGA 1VQ5S 2FD2A 3Q23A 2ILZA 2XMMA 1ZBTA 3MPVA 4FNHA 3DU6A 1JJ2R 2HIQA 5C42B 3KKFA 4PUOA 3OFHA 1VRUB 1U1QA 1X4CA 2KYXA 4RZRA 2ZHBA 1S1UB 2OO4A 2L9DA 3L09A 5GADU 2N4CA 5B08A 3CDUA 4NLYA 2YNFA 3ZZZA 2XCPA 1HWJA 2HQ3A 4XIUA 4JI4F 4F3QA 1S9EB 2O3DA 2RH3A 2N7YA 4NLUA 5E2QA 1RI7A 1UFLA 3OSPA 4Q0BA 1YIJS 2J9DE 3ZZYA 5BR8F 3D1QA 4DF8A 4K4VA 2HS0A 1KS2A 3CE8A 2KM8B 3M8RA 2V94A 3M2RA 4NPOA 3IWLA 4WIIA 2CJBA 3MTKA 3BQ0A 3NLCA 5H9EJ 4C98A 2Y0SD 3HZGA 3W2WA 3MMCA 1RTHB 3N6NA 5GVQA 3DCAA 1SB6A 1TL4A 4ZPBA 1EETA 2ATLA 3KLVA 4TY8B 2MKIA 4RBUA 2AX0A 4CO3A 3C6UA 2YNGA 4TU7A 3VALA 3SZ2A 1KN6A 2WSFC 4O3SA 2JC1A 2YNFB 2AP6A 1TVRA 2VUGA 2ZDOA 3KLGA 2ZH3A 1T3NA 3RRHA 1IN0A 4WZQA 4JI2F 3JSMA 5GAGI 1HNWF 2XI2A 2QYCA 4JI6F 2XBPA 3DYAB 4PG7A 1T05B 2VFVA 1AROP 3MM7A 2F9JA 2K2PA 4OX9F 2B4VA 1HBNB 2W7AA 4O44B 1U48A 2ZH5A 4X65F 1YJWS 2HFZA 2JEIA 4Y0FA 4A8FA 2NS1B 4ZK7M 1HL6A 3EXYA 1HI8A 5CZXA 2KO1A 4K4TA 2CPYA 5KFQA 2RSQA 1N36F 1TFWA 3FQLA 4ZCKA 3Q0AA 2CVEA 4RW9A 2RILA 4CTAB 2C3PA 1LOUA 1N88A 3MMAA 1C1CB 2BQRA 2CJ9A 4KQZA 4GC6A 3UQSA 4FXVA 4K4UA 3MWBA 4NXNF 1SC6A 3LP0A 3HVRA 1JLAB 2R7QA 2WRMA 2UZAA 3HMJG 4ECUA 4DR4F 2SXLA 3DYAA 2AW0A 2FHKA 3MXHP 1SH2A 2RQCA 5AE2A 1N5QA 3JSMB 2ZOFA 1R0AA 4C8LA 5KFDA 2ZE2A 2VFTA 3MD3A 2ZNZA 4F4ZA 2GIQA 4YQWA 5E7OB 1FNXH 4IG3A 1JLGB 1X4DA 3GE9A 3JTNA 5EWEA 1Y3JA 2Z2MA 1K9MT 4TY8A 4H54A 2DR5A 3JYTA 5H9FJ 3LGMA 1U47A 4QR2A 4UY85 2DH8A 2OKQA 3PACA 4ILLA 5T41A 2I5JA 4LIWA 4JV2A 1MWZA 2DNPA 2CQHA 2IHR1 2IC3B 2ZH8A 5DQIA 2C22A 3N0VA 3EPGA 3CCSS 2I38A 2XSJA 3BQ2A 1JLFB 5JXSA 4IQMA 4ES2A 1K0TA 3H5XA 2GCFA 1HPZA 7FD1A 1VQ7S 1RKIA 1OQ3A 2QO3A 4B9TA 2VBXA 3HZEA 4HTJA 3DOLB 1RP5A 4V19J 1HD1A 1TL3B 3GZ7A 1T03B 5A8WB 3BS9A 2ZNYA 2DGWA 2HLTA 5THWA 2VG6B 2LLZA 3FEYB 1HARA 1TV6B 4F02A 3B4DA 5F0WA 3MD1A 4EYHB 4X2BA 3OTDA 1YI2S 4USHA 1L3VA 1BQNB 1B0PA 2QFJA 2DNHA 2V4JA 4G1QB 4OMFG 2MGZB 2KG1A 4O4GA 3DGPA 4GO7X 2XSJB 4MMOA 4X4VA 3P49B 3DLGB 3ZZUA 1ZAVA 3O8WA 2Y1JA 2B4UA 3HXMA 1Q7YT 1MROB 3FZBA 2DBBA 1R8CA 3BB5A 4PG4A 4E98A 4ECVA 3DRPB 2ZD1A 3B78A 4ZP8A 3BQ1A 4FZVA 3VZIA 1SBRA 4LFBF 3O3LA 2C42A 2X1FA 1TP7A 3HHLB 3BO3A 5J2PB 2XMVA 5GAHU 5D6GA 3IG1A 2JLFA 4PXCA 1YRXA 3A1YG 4C0OC 4MFBA 3I0RB 2ZITA 2Q1LA 1BQMB 1RT3B 5AE3A 3E2EA 1YJUA 3ETOA 4FP9A 1HW8A 1UJ4A 1H98A 3KLGB 1NEEA 1TKTB 2UXBF 3BDPA 2M0GB 2O01C 2AJ4A 2YWHA 4H4KA 2I9SA 3HM9A 2VQEF 1IR0A 5FDLA 4DV1F 2DJWA 3RAQA 2R7OA 1IJFB 5B0EA 3IO1A 1CSJA 4F67A 2FHJD 2J76E 2ZD1B 4IG0B 4NCAA 4DFPA 2ZBIA 1L3KA 5JVHQ 3VAGA 5IQ6A 3OLBA 1ZTTA 1S10A 4CO1A 3RB4A 2VONA 2W4CA 4HTIA 3CSKA 4N47A 2BQUA 1UVJA 4PWUA 3G6ES 2P5VA 3DLEB 3LOUA 4TNOA 1W2BR 4WU3A 1UMJA 2M52A 1GX5A 4C4WA 2QEXS 4O44A 1EP4A 4LF6F 4DSFA 3F44A 1X5PA 1YJNS 2CDQA 2LXUA 4OZ0A 4A48A 3DLKA 4KAIA 3PKYA 4FPRA 4I69A 5ITHA 2JFKA 2BW2A 3K5NA 4LVNP 2FJWA 5L1LA 2FJVA 4NL5A 3BF4A 4G1IA 2APOA 2B9YA 3PIPQ 1FCAA 4C8KA 1SL1A 4ED1A 4KKOB 4HLBA 2KKHA 3MR2A 4IFVA 3UNGC 4ECQA 2YKPA 2ZKUA 4KV8A 5KFTA 2MJUA 2KRRA 2HHWA 4OI0A 2I2YA 3RZAA 3MR5A 3CCMS 1XMOF 4DSJA 4JV1A 3MMBB 1FRKA 3KK2B 4AL6A 3PW7A 2DNLA 3DRSA 3QWPA 5J1NA 3PFOA 3PR4A 3CDEA 3EZ5A 1R6YA 5KG6A 4NLOA 3HVTB 2IMOA 4N76A 3MDFA 2KTQA 4PQAA 3FZ2A 3NCQA 4AXIA 3RBEA 2DHGA 2BUNA 1KLNA 2Z0GA 2DT9A 3VQTA 2ROGA 4IRDA 5DQHA 3MCSA 3G71S 3PEHA 3SQGA 2DH9A 2E9ZA 2PGCA 1NK9A 1Z4UA 3OL7A 1E6YB 3DMJA 1F5CA 5JUMA 2YNIA 1S9GA 1R8HA 3DRRA 3HHDA 2D9OA 1FTRA 3K57A 4YB1P 4LSNB 3G8SA 1LWCA 2DR8A 1S97A 2I8EA 2COLA 3PRDA 2M70A 4RNOA 3V4MA 2HZCA 1XERA 5EWGA 4B9VA 1TL1A 1FXDA 2QA4G 2Q43A 2KT2A 3MOJB 2GQCA 2DK2A 1VK8A 4R8UA 3N6LA 3R5BA 2UV8A 2DCLA 3E01A 3DLGA 3CVKA 5HROA 3T5KA 5A0YA 2VG5A 3CD0A 4QJVA 2LQ5A 5B0DA 2V4JB 4G1QA 5CZVA 3OFEA 3O1LA 1BQNA 3M1VA 3I9ZA 3TVKA 2HHQA 2RJZA 2FIUA 3IWNC 1OO0B 1KLMA 4G3IA 3M2UA 2PT0A 4ED3A 1ROFA 3LH2S 1HQEB 5F8HA 1FD2A 1FHTA 2EI5A 1CVJA 1Q8IA 1WG1A 1M5HA 2V8VA 5CYMA 2HGMA 3GR0A 3KK1A 1X4AA 2HHPA 4NLQA 2RRBA 3C8YA 4WFZA 1WHWA 2K1RA 1RT2B 4J9OA 3DOLA 2XY5A 2PMHA 2YTCA 5KT2A 2BE2A 3DNCA 4Y65A 4DOZA 2C2EA 1MW7A 4CT9A 4URQU 4PQUA 2C2DA 3BSAA 1M5SA 3UI3A 5IS2A 2ZZMA 1FXRA 3U27A 1N8RT 2YVSA 4KFBB 3NL0A 1Y5NB 3OR2B 4KHMA 3IRXB 1H2VZ 4LVOP 2CJQA 3CGIA 3GFHA 3NMRA 2JL9A 3D2WA 4DG1A 4OZLA 2HGLA 3TA0A 2N4DA 2MZJA 3P3DA 2IAJA 4ED6A 5J2MB 2QA1A 4XDDA 1UAWA 4DV3F 2VL1A 2IA6A 2DH7A 3H4DA 1P1LA 1Y4ZB 5KG4A 5DG9A 1C0UA 2J0SD 4HI1A 5C42A 4PUOB 1SH0A 1Y0HA 4X4SA 3RW7A 4I2QA 4NLXA 2FJDB 4DJBA 3E51A 3CCRS 1KQSR 5DDPC 4DL4A 4DSKA 5CYQB 2ALZA 2YNHA 4DLGA 1T02A 3MMAB 4HT7A 3SSQA 1YTYA 5KT5A 1KLMB 1HWUA 1SIWB 2RNEA 4R5PA 1FKOA 1FT8A 1X4FA 1VC5A 2AJQA 5K8MA 4QOTA 3MM9B 4ID5B 4OHXA 3SDEB 4U6PA 4ZVGA 1NJWA 1QAXA 1H7WA 1N32F 3IR6B 1VOMA 4RUCA 4USJC 3OJSA 2N3OA 2J7UA 4R8UB 1P1TA 3D0IE 1FRJA 3MEGB 3G86A 3HVAA 3UPFA 4KT0C 4QR0A 3G9CA 2DCUB 4W90B 4X84A 1WWHA 1UKUA 1Q4RA 4A8OA 5F9LA 1S7HA 2LVWA 5DLGA 2Q6CA 2B4OA 1X4HA 1V3ZA 4RNNA 2W8KA 1VRTB 2ASLA 1SJ3P 3H4BA 1Q82T 1Q8BA 2K7JA 3LAKA 3OFFA 4ZS6A 2XGPA 4NLDA 1JB0C 3EGWB 3OTCA 1SJ4P 3PX4A 1GNKA 3DM2B 1HQUA 5IZHA 2JSXA 3R1HA 3HK2A 1HA1A 5DM7Q 3MUMP 1S99A 4ZPDA 2V9KA 5KFYA 1OPZA 4M8LA 2MYFA 3G8TA 1UEVA 1KC8T 4Y2MA 3KLFB 2RQ4A 2RDJA 2U2FA 4Q7AA 5DG7A 1LV5A 4ED0A 4K2XA 3AY0A 1F60B 3SCKE 3CCVS 2RQKA 3OL6A 4U9RA 4M63A 5AXNA 1M1KT 5KFMA 5D77A 4UUWA 4C8ZA 2I1RA 4KO0A 1HNIB 2MKKA 1VQOS 2XHWA 2L9WA 1NNDA 5I4MA 1WTBA 4ECYA 2BRKA 1UVLA 1SV5A 1L3SA 3KHHA 1KOHA 2B56A 2KT3A 1LKZA 3B8HA 5EHHA 4X66F 3EUNA 3C2PA 2XY6A 2FHJA 3V2UC 2VG7A 4RWXA 4ED8A 2JH3A 2HNYA 3X3UA 4F50A 1F5AA 3UE2A 3X1LB 5B0GA 3R5CA 3TA2A 2RF2B 2CYYA 4QIWD 3LWMA 5GAEU 2WHOA 3MI7X 4CO2A 1SJRA 2FB0A 3OUYA 3K5MA 4A8SA 1V6HA 1UVKA 3CUNA 1X4BA 3WBZA 2EFNA 4FN5A 5A2QY 4K4YA 5LSOA 2P6SA 5KFLA 3T6JA 1FDBA 3DDKA 1X9MA 4M94A 1MMNA 1VQNS 5KT7A 3UDCA 4ZOSA 1AFJA 1FJGF 3QO9A 5E3AA 2NLWA 1RYSA 2CQ3A 2DGTA 2NUUG 5DS7A 1FKPA 4ICLA 3OV7A 3DLJA 2AGPA 2F4VF 3THVA 4IDKB 3N01A 3M8PB 2VG7B 1SKRA 4OHVA 5KFSA 3EZUA 4KGMA 1VIOA 1JKHA 1R8BA 2NREA 4MK9A 3S1TA 4D3HA 5DM6Q 2HVIA 4OHWA 2HNZB 4RW7A 2XLKA 1HNVA 3MEGA 1F9FA 1ELOA 1KONA 1QE1A 2Q3PA 5KTQA 1A6LA 3BM7A 3NRBA 4ERDA 1LW2B 1UVNA 2MKHA 1HNIA 2B43A 2RUGA 5H1SV 3D5MA 3BO4A 1FVQA 2KH9A 3K0JA 3I87A 4IQXA 3V81A 1CLFA 4DSIA 3OLAA 2A2DA 1X0FA 4YB6A 2J5AA 2B0GA 1U2RA 3WDOA 4AL7A 3ISNC 3Q2TC 1VQLS 1FJ7A 5C5JA 4X4TA 1LWEB 2ZOGA 4QYZJ 3UD4P 3UDLA 2PMZD 2FJEB 3LP2B 1U6ZA 2OPQA 3W2VB 2X1AA 1RTDA 3BJYA 3LANA 4AE5A 2I0XA 3ICLA 5F8JA 1ZAXA 2FGOA 1MU2A 4AL5A 5J1EB 3S8SA 2NPIA 2DNGA 1E6VB 3J7ZT 4ID5A 3SDEA 2B9WA 1GQEA 3PW5A 3CJ5A 2MKSA 4ZCLA 1VJWA 4PXEA 2JLGA 2DTJA 3TUZC 1IJEB 1YSJA 2DO0A 3BN4A 2UUWA 5IM0A 2MQPA 2JZ5A 2XC9A 4I4BA 3ZC4A 5KAKA 2OFHX 2PA3A 2E7XA 3U02A 1SUQA 1TQLA 1ZPVA 2VPZB 3NS6A 1LQ9A 4YY3F 1QUVA 4Y2CA 1ZETA 3I9V9 1FXLA 3D54A 3FDSA 4ZVFA 2N3LA 3C6TA 5DRKA 3PFEA 2XWYA 3LWLA 1M5KC 1Q53A 3TAMB 4ZKAA 4YR3A 3TUIC 5B0CA 4FF4A 2CQIA 2H5EA 3CJ4A 3HT3A 2VBZA 3V4IA 2JEFA 5GAEI 3M32A 1MU2B 2GC8A 3MM9A 1CQNA 1Z2LA 5EDWA 4EEYA 1ZH5A 3DM2A 3I31A 4WK1A 3TUJC 4N77A 2ZHAA 3Q22A 2K1RB 2J6SA 4EBCA 1JLGA 1N6QB 4ID8A 3PW2A 2B7BB 3KLFA 1HNZF 3D0HE 1Z1ZA 3GIJA 1ZPWX 1X9WA 1GXTA 3K8VA 3CWJA 4KC5A 5J2NB 4C8OA 3L7OA 3PW0A 3QJPA 1BD6A 5KG3A 3TYTA 2IVMA 3WC0A 4ECSA 4NLTA 3SXLA 2HGNA 4B02A 1HBMA 3WZ0A 2R2SA 2AGOA 3RYLA 3JTOA 3I32A 2OTLS 3CCJS 4K4WA 1C2PA 2RVJA 4YDDB 4NMLA 3H2UB 1AXQA 2ADBA 4TKTA 5EGYA 4O3OA 3HPOA 4IDKA 4NRTA 1PILA 1WG4A 3FQKA 4B9SA 2ZDPA 3UW1A 3CCQS 1YITS 5ADZA 4F4KA 5KFUA 1HD0A 3TQ1A 1N52B 3KNGA 4Q8EA 2Z4PA 4PCQA 3C3LA 1WF2A 2GMHA 5A0YB 1GAOA 3NNAA 4KHRA 2C28A 3DLHA 3PIOQ