1Q7LB

Zn-binding domain of the t347g mutant of human aminoacylase-i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
NPWWAAFSRVCKDMNLTLEPEIMPAAGDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aminoacylase-1
publication title Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature ec 3.5.1.14: N-acyl-aliphatic-L-amino acid amidohydrolase.
pdb deposition date 2003-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1q7lB01
1Q7LB
chains in the Genus database with same CATH superfamily
2HVIA 4TLRA 4OYPA 2JX2A 2W4CA 4RW8B 3J7YI 1N0VC 2J8SA 3SDEA 1U49A 3L09A 3CDEA 1Y00A 3TUPA 2H3EB 3EMTA 4XTTA 3QJPA 3ISNC 1TVRB 5J1NA 3PYEA 1SJ3P 2HFZA 1OY6A 1SH3A 1WC3A 1SC6A 4LF1A 3HF5A 3J7A1 2J0QD 4WK1A 3VTIA 2Z56B 2XS2A 2CPYA 4B3MJ 1PILA 3B54A 4ZPDA 1KS2A 5JVHQ 1WDTA 3QGIA 1SV5B 3TJ8A 5DG9A 1W2IA 3QZ7A 3NGDA 4DZ6A 5F8GA 3M6VA 1K0TA 3TA2A 1JQGA 3C14A 4HKQA 2FJXA 4B08A 3QMQA 4OI0A 4CH0S 3IRXB 4PUOB 5DZ6A 3R5CA 4WBFA 1A6LA 4DR3J 1AT1B 5HVFA 3JQJA 4AL7A 1PJ6A 4Q0BA 2GVDA 4DV7F 5HQMA 2MLZA 3GLJA 2A0FB 3D1OA 3ET6A 3FBFA 1SXLA 3HI9A 4N7TA 5LMUJ 1Z2ZA 1LQ9A 2HGMA 2OKQA 3IFEA 3J81j 2VJUA 1S9EB 5KG1A 1RAFB 2HMIA 5KT7A 3T1HF 2OPQA 4NYOA 5KFOA 1NBEB 2W01A 2VDIA 3D67A 4DWIA 1ICEB 3HHKA 5A8KA 1JXEA 1YLXA 2UUCJ 4Q5VA 1PO6A 3C15A 2NXNA 2HHUA 4I2PB 1RSCA 3DLEA 4E98A 4J9RA 4OHZA 2OUGA 1URRA 1NDKA 5KT4A 4EO6A 3KLVA 1WDDA 4B9SA 1MMLA 1WORA 4DOZA 1OQ6A 4F3QA 1UPMB 4LJMA 4FYDA 4DR2J 1GMWA 5G0RB 2UUWA 1RTZA 4JI6F 4M63A 1RT6A 2DR6A 3FKBA 2AEFA 5HJXA 1RU2A 4OZ3A 3QO9B 3W64A 2QFIA 1RWUA 4PQUB 2E1PA 3BR9A 2OP5A 4FP9A 4WIIA 1LOUA 1RHMB 2BV3A 2BEFA 2DNNA 4YY3J 1VQ6S 4WZMA 3DOMA 3D6FB 1MG7A 4O4GB 4FF2A 3KJFB 5D3GB 3AOAA 1O5JA 1RCXB 1KLNA 4ICLB 5D15A 3U27A 1IWAA 2RU9A 4I7FA 4LF9J 2CQGA 2UUAJ 5ETPA 1UP1A 2Z8QA 2P2CB 4MTPA 1TL1A 3PO5A 4JYAF 3IBWA 2FC8A 2K2PA 3L7OA 3R5AA 2B5JA 4O0IA 1F2HA 1V9OA 4OI6A 3CJSA 3H5YA 3PZPA 3HHLC 1X4AA 2WSFC 2IIHA 3HVAA 4OYAA 1HWLA 1RHUB 4L73A 3VGVA 1X0FA 1SJFA 1VRUA 2FJWA 3V6HA 1SI9A 4HHHA 1A0OB 4RPFA 1EQ0A 1VCTA 3CD6S 3CF5Q 2JWNA 3DDKA 2BXJA 1VLOA 2LLZA 1S59A 1NZ8A 5J1EB 4CYUA 1UAWA 2DHHA 1HNWF 3H2UB 1WI6A 4DDFA 3LP1B 5A8RB 1NB7A 3C2PA 1UJ6A 4UY85 2V4RA 2VKZG 1Q79A 2D69A 3CVKA 2CFXA 4YHHJ 4NXNF 5CYQB 1I5OB 3HO1A 1R0AB 5KG6A 4K4SA 3JTNA 3E51A 2Q43A 2F5GA 2QYCA 3R5BA 2OELA 1WHWA 2HQGA 1M1GA 3NMRA 2RRBA 4WYLA 5B0DA 4LR8A 1CS4A 4DPYA 4IG0A 2LKZA 2PE8A 4F4XA 4D3HA 3BGRB 1EZZB 2HHXA 5HMXA 5A2QU 3Q0AA 4USHA 3M7VA 3NGUA 3W66A 3KJQB 3IR5B 7FD1A 1S0OA 4DSFA 4P2FA 4DQRA 3D6HB 3RU0A 2I38A 1VS3A 1X7VA 2QMUB 1N36J 5DDPC 1K9MT 3CMES 4CO0A 4DR4J 3T1YJ 2HQCA 2GCFA 4OJ1A 1RDRA 5J2MA 3KXDA 5I3QA 4DX6A 1BUXA 3N9UC 1NU4A 3TAQA 3ETMA 3RAXA 4HI2A 1WHXA 4RZRA 2PA3A 3DM2A 2IM1A 5CD4H 1IR1A 4K8RA 4JI8F 4DV0J 4M5HA 2ZNYA 4ES3A 4USUA 3Q2SC 4XIUA 4FXDA 2DK2A 3O5TB 2QV6A 1FRIA 1NK0A 2XCAA 3A3OB 4DFKA 2VJVA 1XNQF 1HNXJ 2X1FA 1VGYA 1RT4A 3H0PA 4U6PA 4GO7X 3D3BJ 2NPFA 1VJWA 4RBTA 1EP4A 4K50A 1B7YB 4ECXA 2Y0BB 1ZAWA 3JB9k 3OR1A 4P7VA 3KLGA 1Q8BA 1WOOA 3CJ2A 3LQVA 2CQHA 3PEJA 4QYZK 1EKSA 3CCES 4F4WA 2EKYA 1Q8IA 3DKDA 4CLLA 5ETRA 3MUVP 4BCAA 1WTFA 4P10A 1P8GA 4CLZA 1GX6A 1SCJB 2EFPA 1ZA1B 3ZTOA 1C0TA 3TI0A 2RRAA 4DG1B 1RAAB 1TK5A 4LMZA 5D4PA 4LF7F 2JLFA 2DGOA 1FWKA 5K8NA 3T3FA 3AAWB 2GGPA 4EZ9A 1Z2LA 4DZDA 1HNIB 3UN2A 1H2VZ 4EU0A 1SC3B 4CQ1A 4A47A 1GXTA 3S6EA 3G8QA 1S5ZA 3HHLA 5CHCB 1RTDA 2GIFA 1ACMB 3TZYA 3SMZA 3MOZA 2DNLA 1GTHA 1DFDA 4OHWA 3V81A 3Q89A 2FHOB 4KT0C 1YBUA 3OUYB 1KRPA 3FFIB 4ZVTB 2HIYA 3KLHA 3FCWA 2V2KA 5CYJA 2XYGB 2DHAA 1WSRA 3ITHA 4GMKA 2OPPB 2OMLA 1YITS 2MQNA 2Z2MA 2BX6A 1YSJA 2KFNA 1TL3A 4DPOA 2KM8B 1Y3JA 4GVBA 4X4VA 4ETZA 2RU3A 1N4LA 4FBTA 3MD3A 2MQQA 2OSQA 5T41A 3W62A 3LALA 1DQ8A 2ERRA 4DUYF 4KFBA 2NUUG 2NPIA 2JEFA 3NKYA 2Y8WA 2OFHX 3NLCA 3QZ8A 3CCRS 3LWMA 2FJVA 2G13A 1DY3A 2CPZA 2H4YB 5HMWA 1CJVA 4A48A 2I2YA 1JB0C 4WFYA 1H72C 2FVCA 3B82A 2MJUA 1R89A 3BSNA 3TA1A 1RHJB 4C8ZA 5AE2A 5HLFB 2IFXA 2OI2A 1SJ4P 3MXHP 3MM9A 1OY9A 5ETVA 4CIOA 5DQHA 1RWKB 2H48B 3AA9A 4ANCA 1HBNA 1UA1A 1FHTA 3R7BB 4IKAA 2HQ3A 1IBLF 2R7TA 3FZBA 2HFSA 4WFBQ 3SSQA 4YS2A 1T05B 4Y3CA 5GAGI 1S1UB 2CPDA 4Q45A 2FIUA 2E5GA 4LF2A 1U1MA 1LK5A 2HK3A 1DRZA 1EX8A 3I5AA 2K06A 5K8PA 4PXCA 3WC2A 4S0MA 2VQFJ 2V9KA 2OPSA 2ZJPQ 3VAMA 3M4XA 1IBMJ 1SL2A 3QIDA 3S8SA 3GJTB 3KLIB 1HPZB 1M5HA 2ALYB 2HHVA 2VBWA 1M5OC 2DO0A 3MMCB 1HI8A 2FLOA 3M8QB 4CTAA 4OYWA 2E9ZA 5IM0A 4C11B 3N79A 1X4EA 2QX0A 2MZTA 3NGRA 1MWQA 4ES2A 3I87A 1NB2A 4OZ5A 2VA2A 1LKZA 5EHHA 2YNHA 4ZN1A 2M8DB 1WG5A 4CM2A 3VF0B 3ILLA 4RW7A 4K59A 3DRYA 5ADZA 1IBKJ 3GCWP 2AJQA 1HQEB 4N8OA 3HKZD 2N4CA 4PG4A 2HFOA 3I0RA 1YJ9S 4CH7A 1OYEA 4DCJB 3AY0A 2OJ3A 2CQPA 2PI4A 1FKPA 2V4JA 4CLPA 2ZH1A 4QWEA 2U2FA 2GQCA 5F8NA 1RT3A 4I6AA 1OPIA 1UJ4A 2V34A 2ZH2A 3R2CJ 4RW9B 4DPWA 4R5PA 4IFYB 4ZCIA 2R9LA 1V5VA 3RUBL 3KDOA 3BB5A 4UT4A 3CEDA 3G6VA 5KFKA 1LEOA 1UFKA 2KJVA 2BOAA 2VG6A 4OZLA 3ZNJ1 4ELUA 5FIIA 1U4BA 1W2BR 2RSQA 1O8BA 3GWCA 4ZPVR 4ECYA 3V4IB 5HP1A 4HH1A 2JOQA 2RF2A 1N34F 2DPIA 2HNZB 1CQMA 2HFVA 3FVYA 2BJ9A 3NRBA 4DV6J 1FDBA 3OFGA 1X31C 2HFNA 5DRKA 3DDIA 4EUVA 4XPEA 3GFYA 4HVZA 2WK4A 4QPTA 1MSWD 2KVQE 1REVB 2AJ1A 1UL3A 1CG2A 1L3SA 3MWBA 2E7XA 4DQQA 1RT2A 1I1GA 1MLAA 3VVTA 4N41A 1QE1B 3KJVB 4I4BA 2VBZA 1HI0P 4KKOB 3BBBA 4WIQA 2CVEA 1FTRA 5GMKa 4NCGB 3IG1A 2MKJA 4ED3A 4IFVB 4TNOA 3CCJS 2BANA 4KPCA 4W98A 4DLGA 1PJ7A 2ZDPA 4WFAQ 2XMTA 3M9MB 3W3SA 2O66A 1TUGB 3CPWR 4C8YA 4K4ZA 1UEUA 3F44A 3KTQA 2IYIA 1PAEX 4H4MA 4P2MA 1TP7A 2G2ZA 3G96A 4DV5F 4DV2F 2F9DA 4ZIVA 1XMQF 4PKDB 3GZ7A 3TUZC 3PW7A 3THPA 4ZLLA 3CXCR 3E3XA 3IS9A 3N5FA 2ZH8A 4OZNA 4Y2KA 2MGZA 1PC5A 1HQUA 3M30A 3GFXA 1U26A 3DRSA 4C0BA 3I4HX 2KVIA 4UTGA 1B0PA 3CCSS 4FF1A 2C42A 2MKIA 1NMEB 1MROB 4NE9C 3C66A 4JV5J 3ONQA 1SQEA 3B4DA 2ASYA 5KG4A 3EJMA 1B64A 3EUNA 5KFAA 2IBOA 2YKPA 1FRJA 1RHQB 4K0KF 1TK8A 2KDOA 3K58A 2V69A 4RL1A 3D28A 2ZOMA 2DNRA 4OI4A 4K4UA 3G9CA 3RYLA 2BW2A 5FD1A 4OX8A 2ZBCA 2RJZA 5KG0A 2CG8A 4OLPA 3JTPA 1WEYA 2VONA 1K8AT 3BKFA 1YJTA 2CNKB 3OL6A 4CO1A 1TKXB 3FQLA 1FDDA 3UPFA 1VQ9S 2CWKA 5LMNF 2XCPA 3NS7B 2YQ1A 4B3TF 3PHEA 3VVUA 1SIWB 3MEEB 3QGPA 1NDLA 4ECQA 4O23A 1KSPA 1ZAVA 2J8AA 3K17A 3A3NB 2C3MA 4W92B 4CH1A 3LAKA 2HHQA 2R7WA 2GO9A 1KOHA 2XC9A 1IKVA 5K14B 1IQTA 5F8HA 4B17A 2MB0B 2LXIA 2CKWA 5IS2A 3R5DA 4F0MA 2IY5B 1YZ6A 2G4BA 3VGSA 2NUHA 5HMYA 4ZVQB 1X4FA 4PCQA 2YQ3A 4MYUA 2HPUA 4EBDA 1C0UB 3BSAA 4LBPA 3MCOA 2D7SA 2BQUA 3HDSA 3GV7B 3VAHA 1M5PC 1ZOTA 5AJ3J 5KFIA 2ACYA 3TX0A 2DO4A 3K89A 1K47A 5JXSA 2Q66A 2CNOB 3NAIA 1RKJA 1HNVB 4Q43A 1S4EA 2HRUA 2XYHB 5A6PA 1K44A 3IWNC 1W7WA 2WVDA 2IMOA 1YX2A 3C6TA 5L1LA 5ITHA 1N5TA 2XS5A 2NCKL 3QJLA 2JSXA 1IVZA 3TAPA 2W4PA 5HBMA 4V1Ak 1N5YA 2IJFA 1VBZA 2WOMA 1S12A 3MM8A 3DRXA 2CQBA 1YGYA 2BJEA 3KYLA 1U6BA 3FGVA 2R7OA 1U1PA 2JNJA 2C22A 4ILMA 1JJCB 1TKTA 3WZ0A 1C4CA 2FZGB 1T0TV 4P73A 1UWBB 4RU9A 1H7WA 3KK1A 2LDYA 3EZOA 3DLLQ 3CCUS 3PG9A 1J5EJ 5EWEA 5GADU 2JEJA 4ZK7M 5LSOA 3SV3A 4QCLA 3MPUB 1FTCA 3AFGA 2N7YA 3KG1A 1IKWB 4V19J 4UY8T 4WKYA 3W2WA 3DLBA 3MMJA 1EIYB 5GAEI 5KG5A 1VC6A 4HH0A 5CH7B 1BY9A 2HQIA 1L3KA 4PZVA 2VU5A 1IKXB 4O3SA 1IQZA 1VBYA 2EFNA 4J90A 2KXFA 3UI3A 2R3VA 4GRSA 3NCPA 1G7CB 5A6WA 1CS4B 1KFSA 2CA9A 1BC6A 2DNZA 2H65B 3H2VE 4PEOA 2XNRA 5K8OA 2UXDF 1DHMA 3M1VB 3BQ2A 4DR5J 1PSDA 4LSLA 4LF8J 1V6HA 3AA8A 1HBUB 1VI7A 4EGLA 3I0SA 1KLMB 4WPAA 2O01C 1J27A 5GAHI 1M0SA 5E3CA 4FYVB 1UZDA 3TNVA 4ZJLA 4H54A 3MM5A 1YVFA 2H5IB 3X1LB 4QIEA 4MKAA 4V19X 3T1AA 3CDWA 1Y9OA 5DGAA 1RHRB 4ZP6A 3PVXA 4A8WA 2C2OB 5AXMA 2WVBA 1KFDA 2BQ3A 3EX7B 1FX2A 1S9GA 3I55S 3CIZA 3CW2C 2C2NA 5KFMA 4Y2AA 5B08A 1NDCA 1SPBP 4TY9A 4MAKA 3HHDA 1FKOA 4R0JA 4ED4A 5AXNA 3DLHA 4LSZB 2E5LF 3BR8A 4Y0FA 2YKNA 4JI7J 2RAQA 2PC6A 1XR7A 5C5JA 3TVYA 2ROGA 1Y5IB 2I9SA 2PMHA 3J7YU 2JRSA 3R5JB 2XLIA 4X4SA 3T5LA 1D9DA 2LQ9A 2YWKA 4FZVA 3D7SB 3BZQA 1VRTA 2V63A 5KFVA 3FRYA 1H98A 1HI1A 2AJ2A 4NWBA 4U67Q 4HI1A 2VBXA 3BN7A 3RRHA 3JS9A 2V8VA 4OHVA 1KVJA 4NRTA 1UVKA 2KU7A 2YX7A 3QLHB 2HS0A 3KKFA 4J9NA 1N32F 1FVSA 1YIJS 3BJYA 2IJNA 5IT9Y 2W24A 3MCNA 2XGPA 2YWEA 3PCOB 5FDLA 2M9KA 3S7RA 3M9OB 3R5GA 2XQCA 2CAJA 1G6BA 2A6OA 3HVRA 3Q8PB 1ZH5A 1EAYC 4N56A 3HD2A 2H5EA 5CD4A 4ES1A 2FLLA 4FS1A 2BE2A 1EB0A 4IO1A 2L9DA 3IGVA 3KJNB 3B78A 4M5DA 2GVZB 3ZZZA 1JLAB 4EBEA 4ZVHA 4PRFA 2XY7A 2GZOA 3HFZB 2ILZA 1NPKA 4JI5F 3H40A 3TAMB 4DPTA 6AT1B 2ADBA 2YWFA 2DR5A 3OL8A 1HBMB 2MQ8A 5LT5A 4OI1A 3POTB 4DQIA 4DPUA 2FB0A 3FC9A 4QOTA 2C2EA 2QRRA 4AXIA 3O6QA 2IVFB 5DO2A 5KFJA 1V3ZA 3O44A 4ZLJA 3DDNA 3JSMA 1QAIA 4USIA 4X2BA 1U1QA 3DOLA 4EO8A 3NWRA 4YOEA 2ALZA 2KT3A 3W7BA 2Z58B 3RZAA 3PR5B 3R7SB 3G6ES 1N5SA 3H20A 4DV7J 4PYDA 3PV8A 1I6JA 4ZVFA 1EETA 3UNGC 4OI3A 1RBLA 3L7PA 2CWXA 2W9CA 3Q8VA 1OS5A 3W5YA 4DL3A 4ED5A 4DJBA 1HHQA 1NSQA 3D6MB 2QO3A 3T1HJ 4WP9A 2JC1A 3GILA 2V9WA 1RTJB 1XMOJ 5KFPA 1CJKA 5THWA 1P1LA 5F3TA 2QMWA 3VV2B 2AMCB 4AT1B 3L4BC 4EMDA 1D3WA 1S1VB 4CO2A 1Q8KA 1UKUA 4CT8A 2E1CA 2QEXS 4X84A 2HIQA 3KUGA 4MJKA 2FZCB 4U9RA 2AYEA 3DNCA 1SH2A 5KAKA 4QW9A 1CJUA 1WWHA 2QA2A 4X62F 3LOUA 4URSA 2G0CA 4RX6A 4TXSA 2LXFA 4LF5F 4OYOA 4HEA9 1HD0A 3BSCA 4MKBA 1QAYA 2FTRA 4DU8A 1WTBA 5E7OB 3OW2R 2JVOA 1B70B 2D3ZA 2V68A 5HMZA 1F2GA 3WBZA 4L72B 2GHPA 3JSBA 2V50A 1R6YA 4EZ6A 1R8PA 1BWVA 2L3MA 2A1BA 4L3NA 3MECA 1UJ5A 3T5HA 2XEXA 1N6QA 4ID5B 1ZM3A 1Q86T 1H0HB 5D6GA 2W9AA 1AB8A 2RB7A 4Z7CA 3BKTA 3C6UA 3HPOA 1WC0A 1TMJA 3I32A 3VQTA 4ECSA 3OFFA 2RT3A 1R8AA 4FYYB 2HQFA 2H51B 1E6VB 2XMUA 3BO3A 2HVEA 3BH7B 2HNDA 1AFJA 4NASA 2YNHB 4MKVA 3IR6B 2W7PA 1TR0A 4WU2A 4MYTA 1RBOB 3QRRA 2RKIA 4ECWA 4QPXA 1TUWA 2K7JA 3HXMA 3BQ1A 3CE8A 3W8GA 3C16B 3KHHA 5HVHA 2OGUA 2W8KA 2IA0A 5KFDA 3QWPA 2DEIA 5GMEA 3BGOP 4LRAA 3A8EA 3FUYA 3HJVA 1DTTA 4Q8EA 1B0VA 4U8YA 4DMZA 4C97A 1DAXA 3DLKB 4C3KA 4NXNJ 4C9DA 1DZ5A 1UVNA 4DCOB 1WF0A 2PSZA 2LQ8A 2CQDA 3TZWA 1NK7A 3HVWA 3EXYA 3LGMA 5E0OA 4Y2CA 2BDPA 4AL5A 4OQJA 4KTQA 4KGZB 2QYGA 4EWTA 1HWUA 4NA1A 4P72A 3MM6B 3QSIA 2JDJA 1S6UA 4FVMA 3TZZA 3GQCA 1LXJA 2W25A 1U8SA 4F2SA 4DR7F 3NWGA 2GAGC 1VQ4S 2B6AB 3IM8A 4C98A 2QG9B 2A2CA 4I56A 1GX5A 3QQCD 2IAJB 5JMNA 3G82B 4H4OA 1PYSB 1S6QA 1LWFB 2J9DA 2W8LA 1VQOS 4YMEA 5EWGA 3GV8B 4G3IA 2RRNA 5G4DA 2IHR1 2AYGA 4ZPAA 4G1PA 3IMQJ 2GV1A 4DN0A 4CO3A 2MY7A 3ILIA 3E8OA 2FY8A 4WFXA 1CQNA 2UVVA 2XLJA 2VFVA 3CUNA 3MPVA 3DRPB 3NG8A 4X65F 3TO8A 3UW1A 2JZ5A 2LEPA 3MFIA 3R27A 2MLYA 1S77D 2QL9B 5KFUA 2YNGA 2XLKA 2ZZNA 4KHPF 1XNQJ 4LRBA 4DV4F 2A6MA 4A8XA 5I3UA 3EYZA 4GKKF 2VB6A 1JLCA 4QWBA 5M2RA 3NBPA 2ZH5A 2DYAA 2IJRA 5L1IA 2WW4A 3ETOA 4ITSA 2K3IA 2YX4A 1PYTA 3A4TA 4NA2A 2BJ7A 1RXOB 5LXYA 3DGPA 3UD4P 1ZETA 1JLEA 4PXEA 1HWIA 3OFHA 4OX6A 2D41A 4GVLA 3PX4A 3HP6A 2QC3A 5ETTA 1FJGF 1XIQA 3KLFA 5D0GA 2MPUA 4O3PA 1J5OB 3NL0A 5C24A 3KK3B 2PA8D 4ZDNA 1ZTTA 4LFAF 1AW0A 2DEJA 2AX0A 3L7UA 1NH7A 1T3NA 3AJ1A 2ZH4A 2DCLA 3F41A 3I31A 1WHYA 4IDKB 3AHPA 3KHLA 3MEGB 2DNMA 2MSSA 2EKNA 3RBZA 1AZSA 3D54A 4P7TA 2BACA 2WONB 1ZAXA 2FJDB 2WBMA 3CJKA 5DS7A 5C25A 2HW3A 4C0HA 4J37A 2DTJA 1VQ5S 2F40A 1VIOA 2AYBA 3K5NA 4DSEA 3BGFA 2IVYA 4TU7A 2FUG9 4Z2XA 2P9CA 1IXKA 2R7SA 1WC1A 2QZ8A 2MZ1A 1UZHA 4AD6A 1FRXA 1F9EB 4IOBA 2J7WA 3EPIA 2GNKA 2FLPA 3TW0A 4J9LA 1IKYA 1CLFA 1YQHA 1FNOA 3BDEA 3IR7B 4J9UE 1X60A 1SKWA 1NJWA 3PJWA 4B9LA 4LSNB 4YR2A 2IPOB 4B02A 4TY8B 1SVDA 2VFSA 1UFLA 2DGXA 4DUYJ 2QT7A 1PC4A 2YPYA 5GAGU 4UQGA 2GAHC 4D3GA 4CLWA 4QIGA 4OX9F 3SQGB 3ZZTA 3SZ2A 4MFBB 3K0JA 1U48A 2AGPA 2OEKA 2MKHA 1RE1B 1RLDA 1R27B 3OJUA 1AXQA 1VC0A 5EDWA 3T5JA 1EHWA 4K2XA 1H73A 4EYHB 4UW2A 1B3TA 4FN5A 2CJYB 2F65A 4U7UD 4DEZA 1XK8A 4RJVA 2FYXA 1CBKA 1SJRA 3QJJA 1G3OA 1U0SA 2Z2LA 4KH0B 3LGHA 3WIUA 2IA6A 2F4VF 4OZ2A 2CQCA 4RUBA 4XK8C 4UOHA 4ZVPB 2P9EA 3CJ3A 3TEGA 5IT9U 1E6YB 1ELOA 1V3SA 3ICLA 5CA5A 4B3MF 5JVGQ 1DLOA 3DOKB 1VOMA 3EDQB 3EVOA 3UCGA 2P9GA 3KMQA 4MH8A 4OJGA 1RYRA 5KFTA 3D6TB 1VQ8S 5KFWA 2MKCA 2HHPA 4YQWA 1YJWS 2PEBA 1U0HB 4GO5X 4FNHA 3TP2A 4CDIA 4IG3A 1NCLA 4ZVEA 2XWXA 1VQPS 3MDFA 3D4JA 1B0TA 5CYMA 3BBCA 4USKA 3RAQA 4DUTA 2Y0SD 2KTQA 4NMLA 2WW8A 2FLNA 1PIEA 5J2QB 2CQ4A 4WXOA 2ZOGA 2ABYA 2KL8A 1HKAA 1S1XA 4JI3J 2WHOA 1SL0A 2NS1B 3GYGA 1CC7A 1TKZA 2BM1A 3BO2A 1KN6A 4FPRA 4DL2A 4KHRA 1VJQA 1NM2A 3W63A 4IUFA 2DITA 2GX8A 3UN5A 2UUCF 4WK3A 3MR5A 4RNHA 1N0UA 3P6YC 4TKTA 2CG4A 2JFDA 1S1WA 4RW4B 3CC2S 4JUZA 5F41A 2F8MA 3NXZA 3RR8A 4NLYA 3N01A 4DR2F 4BHQA 3J81Y 3LUYA 5HATA 4BDPA 4NZ7A 1UVJA 1OSCA 2QSWA 2AHOB 4PWDB 4P2XA 2V8DA 3MAAA 3M8WA 3LPEA 2W9BA 1T03A 2GA7A 2GC8A 2C2RA 2ZBPA 1XC9A 3O1LA 3QFHA 2CNLB 2R8KA 3ELHA 2UVWA 5IFMA 3M2UB 3M6WA 5F8MA 2YKAA 1UPPA 4B9MA 3UR3C 4M5NA 5KFZA 3JQMA 5D78A 2Y3YA 3LP0A 2Q6BA 3TUJC 4YY3F 1JLQB 2HSEB 4OYXA 2BKPA 3DHWC 4HHJA 3DMJB 4NRUA 2AIRB 2YQ0A 7AT1B 4HDHA 2YNIA 2NZ4A 1EQMA 1JKHA 1SH0A 2BW7A 2YH0A 2UUAF 2DIUA 4QQBA 1DQ9A 1VRQC 1SB6A 1CEZA 1M5VC 5KFEA 5J2PA 2N3OA 2HAFA 4JP8A 1RTHB 4KO0A 4N76A 4DV1F 4LFBF 4R25A 2IC3A 3VWSA 1K1QA 4I64A 4USVA 3F56A 4EI2A 3DU6A 4RR5A 4C4WA 2PI5A 4EEYA 3MOJB 4KV8A 3RAMA 4A4JA 1NUEA 1GXUA 5DQGA 3GV5B 1S57A 3VGUA 2M52A 5T7LA 4LRFA 4YR3A 3BSOA 1YTYA 1UETA 1HYSA 1Q81T 4DV5J 4DV2J 4P52A 2R4FA 4OLOA 1XMQJ 5GADI 3WIVA 2EC0A 2BR0A 1YK9A 2EPIA 1Q7YT 2HVDA 3K5LA 1F9FA 1S6PA 4YUDA 2HZAA 4ETXA 4KR0B 1S1TB 4FYWB 2XI2A 3BN4A 2DY1A 3IO1A 1QVFR 4E0DA 3CD7A 2G2YA 1EARA 2Z2ZA 1KQGB 1HMVA 4M5DB 1UWAA 2NXUA 1SQGA 3SFGA 1X5TA 3V6DB 3OTBA 2P5VA 3BF4A 4K4WA 4M5KA 3KHRA 4DL0C 1RLCL 4MIWA 5IC6B 5ETMA 2Z2YB 2EG1A 2XGQA 4PQAA 2IRYA 1NSPA 3NMAA 2J5AA 4K0KJ 5E3QA 4P9SA 3HHEA 1HW9A 3EPGA 2ILYA 4B3OB 3ZZUA 4F04B 2XSJA 4M5GA 3ZTSA 2JL9A 3CTRA 2KXHA 2EFQA 3MI7X 4F50A 3QGGA 1NK5A 2HWHA 3GR1A 3K57A 3G2XA 1C1CA 2RUGA 4RW6A 5DG8A 5KFSA 3IN5A 1KEKA 2BE9B 2DR8A 2X3DA 3GB0A 3R3TA 2XBPA 1EETB 1RT1B 2YKQA 1C1BB 4CT9A 3UFCX 4I0WA 3M8PA 4MK7A 4QR1A 5LMNJ 1SJ1A 4Q2MA 4JV1A 4YB5A 2L41A 4DV0F 3ZZ0A 2W4DA 1FRHA 1UCNA 4JBCA 2YWHA 3VGTA 4EK2A 1RI7A 2VG7B 1RZMA 1HNXF 2UP1A 4RKUC 3CC7S 4IO9Q 2I8EA 2RILA 4KPYA 3PJ9A 4IQXA 5LSRA 4NLWA 2QL7B 1N5QA 5KG2A 2AGOA 3EICA 1NJYA 3WC0A 5L1JA 5C42A 1LW2B 2J0WA 1JLFB 2QA4G 4Q8FA 4A8FA 2E1MC 2DY9A 3MPDA 2IM3A 3TQEA 4AFFA 3DI6B 5EWFA 3VZHA 4KH1B 2FVPA 3TARA 4FVCA 2GW8A 4JI4J 4RW8A 2R7VA 3G87A 4I69A 2IM2A 2B43A 2GO8A 3SQOP 5I4MA 1WKJA 2Y1JA 4TQRA 2VZ9A 2V2QA 1TVRA 1LV5A 4P75A 2CPFA 3EZUA 4CO5A 1TL7A 4OV1A 1K73T 1IUJA 1HR0F 3Q8QB 2JVRA 3E01B 3W61A 3HK2A 2DD8S 2ZHBA 3A3PB 3O8WA 1HBOB 3UDVA 1JLGB 1SV5A 2IBKA 1X4GA 4AXJA 5B0EA 5GAEU 3T19A 2V8GA 4A8SA 4R0EA 2FVSA 1O0PA 3CULA 3NP5A 4ID8A 3THVA 4WZQA 1FK9B 2CQ1A 4ZVRB 2IYGA 3TOQA 1P27B 3IRXA 4PUOA 3ZO7A 2VV5A 1XTZA 2O67A 4L74A 3I96A 3QBCA 1YZ7A 2ZHOA 4KJIA 3UVJB 1QLNA 4ZJQA 2NXEA 4BC7A 5GAHU 4NX9A 4HACB 1D0EA 4PYAA 2VPXB 1FNXH 2HHHF 4DF8A 3PY8A 3PX6A 4M5JA 2YKMB 3DLGA 1S9EA 9RUBA 4EYIB 1SUQB 4ZN3A 2Y1LB 2RD5C 3KNGA 4DUZF 4NI2B 2EXUA 2KT2A 3W9IA 3W9JA 4RUCA 5AXKA 5HI7A 4I2PA 2WCXA 3M6UA 5DM7Q 2QA4S 3HT3A 2BJ8A 1CULB 4YDDB 2LXUA 2HLTA 1T9VA 4OFZA 3HHNB 1PYOB 2DNKA 3PKMA 2FZKB 2VFTA 4K4TA 3RTVA 4UZBA 4K4VA 2ZEJA 5G0RA 1GMUA 2H5JB 2IVMA 2EK1A 1R6VA 3BGUA 3PW2A 1Z4UA 3JTOA 1NH8A 1R31A 3MMAB 1Y0HA 3QO9A 3EGWB 3HZEA 4KIAA 1ZYQA 4PQUA 5KFBA 2QLXA 3FJ2A 3CNQP 3NCRA 4C0OC 5KFQA 4X4PA 4I2QB 5E5NA 4JOUA 5BR8F 2ZJRQ 4C3MA 4J9PA 3E2EA 3DRRB 4TU9A 4LR7A 4WCEQ 1X4DA 3EXCX 4O4GA 1N88A 2OSRA 2WRMA 5CCLA 3FSYA 4WYWA 2E5LJ 4ICLA 2XZTB 3D0HE 3NY0A 2J76E 3PACA 3BO4A 2R42A 3OLAA 1N52B 2VFRA 2EBEA 2RHQB 2XSFA 3CSKA 3OT9A 3R9LA 5I3UB 2NYHA 3MR7A 1NKEA 2BABA 1FWLA 5IWAF 3RBEA 1MU2B 1ULRA 4DSJA 3M8RA 1VHIA 3K2YA 1XWLA 1N32J 4DL6A 4AYBD 3OHAA 5DQIA 3V2UC 4X4NA 2DGSA 2ACMA 4ANDA 1YRTA 3DHXA 3GYXB 4K4YA 2XI3A 2CVIA 3LP1A 5A8RA 2K1RA 2B51A 2VHGA 3RW7A 1M90T 5K20B 4O44B 4AE5A 5HANA 1YJVA 1V5IB 5CYQA 4AL6A 2KM8C 1BMQB 2IDLA 3GIJA 2J9DE 1R0AA 4DF4A 3PJXA 4IOAQ 4QYRA 5KFFA 3GJRB 2ZE2B 4J9QA 4Y2IA 2UU9F 2R7RA 5J2NB 3ZTRA 1AZSB 4JB8B 3AXKA 3ZC4A 4PPZA 3BGRA 1RA6A 5IT0A 1ZM4A 2ZM6J 1OIAA 3BREA 3H5XA 2CJBA 4RBUA 3J81U 2Y8YA 1SKUB 3PW0A 1ZS6A 2PT0A 1OQ3A 2DRDA 1YJNS 4ZHRB 3SV4A 2J6SA 5SZTA 2OO4A 2KYXA 3OVSA 2LCWA 4RBVA 4U95A 4Y34A 1AA1B 4GC6A 3QT5A 4Y2MA 3ENVA 2EEYA 5GVQA 1QTNB 3TR5A 2ZITA 3DGVA 1T11A 4R8UB 1KOOA 5ETSA 2ZC4A 3PRVA 2OH2A 2OTLS 3A12A 4EFAC 3J7ZT 3DXBA 1FD8A 3H5UA 1RWXB 2GIRA 1X9MA 4OYBA 3OTOJ 4IRKA 1S79A 2HS4A 5HSPA 3OJSA 1AROP 3OXLA 3A8KA 4I6YA 2KFYA 1FVQA 2V2ZA 2HVHA 4PWUA 4WE1B 5A0YB 4ANEA 2F63A 3IRWP 1PAUB 1FI4A 2LA6A 4BBYA 3AB4B 1RT5A 1BQXA 5L39A 3GPAA 5I42B 2KO1A 1RUSA 4FBUA 3MM7B 1L3UA 2HVZA 1TAUA 4X62J 1RAHB 3QIPB 1YBTA 3RRKA 1FT8A 4LF5J 3O2IA 3QSYB 3R1HA 2ZD1B 8AT1B 5IT4A 1CJTB 2YNFB 5HROB 3CCWA 4KB7A 4Y6IA 3TRGA 4DG1A 4FPIA 5CXTA 3M32B 2AJFE 2J6UA 2BMBA 1XMBA 5ETNA 1WF2A 4YP3A 1BE4A 2PFDA 3O3LA 1BD6A 4A8YA 1HNIA 1JXVA 3OTDA 4PR6A 2ZC3A 2PN6A 5AE1A 3W2VB 4ED0A 3D0IE 2LU1A 9ATCB 2P8IA 3LTOA 3CB4A 2AEMA 5HAOA 2HFUA 1RP5A 2OPRB 3F73A 3OUYA 3MEDB 3HVTB 3FFIA 2MEWA 2Y1IA 2B8PA 1IBCB 4ATNA 2OPPA 2B9WA 2Z4PA 2Y9HA 2PGCA 1LFWA 4UOCA 3VHQA 2CADA 1UEKA 2MKYA 5HVGA 2XY6A 3N0VA 4Q44A 3MAHA 4DL4A 5A8WB 3QNWB 3Q8RB 4E2FB 2DH7A 2RUSA 4RNNA 3GYNA 1WHVA 4BS2A 3CGIA 3FMWA 2VG5B 2X7IA 1BQMB 2ATCB 1F3VA 5E2QA 2Q3PA 3JSYA 2EK6A 3PYDA 5E41A 5MLCV 3Q86A 1S0MA 5DDQC 4DL5A 2X1AA 1FXDA 3NCQA 1VQMS 4ZVUB 2KG0A 1QSLA 1NKBA 4B3RF 1NPPA 3VAGA 4X4UA 5IC4B 2HK2A 3OHBA 4M95A 1RJJA 3KDNA 5D0HA 5HLFA 3JYTB 4ELVA 2JC0A 3MMBB 5HJYA 3FRZA 1LNQA 3OLBA 1NPRA 5D8HB 1X5SA 4F4AA 4YN3B 3VCDA 5C2CA 3VQSA 4NXMJ 3I6PA 1UTAA 2OD4A 2KYZA 1T05A 1S1UA 1LW0B 2CQIA 4RNMA 4X4QA 2J0XA 2ZVIA 2MSTA 4YB6A 2F8EX 1GH8A 1GQEA 3CT9A 2B0GA 5KT2A 2EBGA 3M2VB 3OSNA 5B0CA 2VASA 4RLEA 1U24A 3NAHA 3KLIA 3VZIA 1HPZA 2JEIA 4Q2LA 1HD1A 4ZP7A 1RAEB 3AD7C 3LP2B 2DNOA 3M8QA 1J5EF 4MK8A 4C11A 1ZM9A 2PMWA 2DJWA 2LDIA 1JNZB 2UV8A 5LXRA 1X0PA 2FD2A 3KK2B 3RB3A 5D4NA 5KFXA 5L8RC 4DV4J 1B4SA 4GKKJ 2VDHA 1KHVA 5CQGA 3EZ5A 1ZPVA 2HG4A 2D3OR 3HKWA 4CWBA 4CLKA 3VAFA 3FMBA 3US5A 2BVZA 1WG1A 1Y5NB 2WVEA 1PGZA 1VBXA 2FDNA 2KZZA 2YXLA 2HS3A 3PYFA 2GQQA 2K3KA 2IDEA 3WX4A 4PG8A 3W8PA 4J91A 4RW9A 4IFYA 2G0IA 4DR5F 2VFUA 3OXFA 2ZJQQ 1RHKB 1YHQS 4LFAJ 2UXBF 4MK9A 3OBIA 1BQNB 1OO0B 2AJ0A 2OIHA 2XS7A 3S01A 4CO4A 3DFEA 2NR0A 2R8JA 2HWTA 5FLXY 2E1RA 1SC1B 3D1HA 3K8WA 5A76A 3V4IA 3DYAB 2DISA 1DURA 1U09A 4OYMA 3UCUP 4LQ9A 4OL8A 3CC4S 5HQ8A 2HNZA 3R7NB 1JIHA 5F8LA 1TAQA 4RW6B 2V2VA 2B7BB 1RT7B 3M2RB 4HDGA 1REVA 3FNNA 2QA1A 2OLWA 2CDRB 1S49A 5IV3A 3NOGA 1LWEB 1YJUA 1JK9B 5LSLA 1JLBB 2GQ2A 4NCBA 1UVLA 4J9KA 2HNYB 4UQTA 1QE1A 2RS2A 4FS2A 3KJVA 3RR7A 5H1SV 2VICA 3OR2B 4ZPBA 4JI7F 1FO1A 1DTQB 3VAIA 1MMDA 4KKOA 2FVQA 4G1QB 4NLRA 3K5PA 4X4RA 4G65A 1T9YA 4LF4J 3LANA 4CM0A 1RTIA 2VOOA 4NCGA 3KLEB 2QLWA 3PO4A 2CDQA 4IFVA 3DC2A 4GKJF 4L6V3 4CLSA 5KOXA 2UV8G 3AD9C 2C2MB 1CPZA 2UVUA 3I5CA 3PKYA 3M6XA 4OHXA 3SDEB 4RWWA 1SL1A 4URQU 2M5YA 2I6WA 4WKRA 1R8CA 4YEAA 3HFKA 5AXLA 1FXRA 2ZVSA 1KC8T 2M2BA 2W2PP 3PR4A 4U7UK 2KZMA 1T02A 2KXNB 3MTJA 1H6KX 5M2UA 1S6OA 1RKIA 2MTLA 3JQKA 4MIAA 4P6QA 2Q6CA 5ETLA 2L9WA 3FZ2A 1KWMA 2AZ1A 4N5SA 2B4PA 2UUBJ 3BYRA 2MZQA 2AP6A 1UVIA 4CNZA 1TL4A 2HQDA 2YWGA 1S7IA 5LL6d 1HNZF 3OVBA 3P4UB 1VQYA 3AJ2A 1Y3KA 1QD1A 3C14B 1T9WA 2DHGA 1MROA 1RWPB 1RAGB 1TL7B 2W7OA 1HW8A 1I3OB 3CCQS 2F4VJ 2HWIA 5DM6Q 1T8EA 2MKKA 3CDAA 4TN2A 4Q0BB 2GVDB 1HWKA 1NEEA 2YVSA 3MCSA 3VR1A 3PIOQ 3NGKA 3ET6B 2WVCA 1RBAA 1FJCA 1HQ2A 3C3LA 1IR0A 1S9FA 2N7CA 2AF6A 2AYMA 2QLFB 2QLJB 3EGZA 3SCLE 2HMIB 4Y65A 4JI2F 2R2SA 2OPQB 2DIVA 1X8DA 4LFCF 2J7UA 4F25A 2G1HA 4LF6J 3WQPA 5A8KB 4ECTA 2ZNZA 5DLGA 4WU3A 1FDNA 3A8IA 1ZPWX 2BYCA 3C15B 1B99A 1TKXA 4M5IA 3G8TA 4N47A 3DLEB 2R7UA 4X4OA 2BA9A 1NJIT 4ZMMA 4ZITA 2XMAA 3IAS9 4O3RA 2E7WA 3DLGB 2ZH6A 2RQCA 3MEEA 2MQOA 4ED6A 1XMOF 1VBKA 4O3OA 5ETKA 1KR4A 5T14A 1N56A 4X66F 5B0GA 1RT6B 3HFVA 2KHCA 3BGLA 1I94F 4OIXA 2QMXA 1RYSA 3Q2TC 1IR2A 2DGTA 5K14A 3GMGA 4QR2A 5ETOA 4DX7A 2WVFA 3CCZA 2ZH7A 4OYZA 3OVAA 2FY1A 5KT5A 4NLTA 3T9ZA 3DOMB 4NLPA 1XBWA 1NK8A 3Q8UA 1EKRA 4QU7A 2DNPA 1C0UA 5CZXA 4ZLPA 3FCHA 1H7XA 4CI0B 3CO0P 4ZJOA 1KKHA 1M5SA 1BLUA 1Q95G 4I7FB 3MR3A 3K8VA 1RWMB 2DNGA 2KN4A 1TL1B 3C8YA 4PAAA 1HNVA 1Y7PA 2FHJA 2XMKA 2B5JB 2DHSA 2XHWA 2ZDOA 3CMQA 4J5OA 4Y28C 1VRUB 4USMA 2DVIA 2ZKUA 4JI0F 5J1PA 2VC1A 4HT7A 1YWXA 3P3DA 4CYUB 4C8LA 2R2TA 2CZ9A 2C3PA 1F5BA 5KFCA 4KHMA 5BXIA 1UWBA 4NLDA 3GSDA 4DV1J 3SIPB 2CPHA 2XZDB 2UVRA 4LFBJ 3UQSA 1UW9A 2AGQA 1WEXA 3L3CA 2BBEA 1RABB 2LFVA 3AH6A 2N4DA 3AJDA 1U2CA 2MZJA 4XAKA 3M05A 2D9PA 1XNRJ 1WC6A 5CCMA 1IKWA 2YPZA 3PYGA 2A18A 1P1TA 1Q0NA 4K2JA 4IG0B 4X4TA 1F1BB 2K1RB 3V4MA 1T3OA 4OV6A 4L76A 2W2NP 1Y4ZB 3T41A 3FBCA 2HKEA 1IKXA 4DV3F 2J7KA 1ITPA 1U1RA 2AD9A 1LK7A 4DI6A 4RWXA 5JJBA 5E3RA 4N8NA 3C46A 2NSCA 3LAMA 1NHKL 2EFVA 1VQKS 3M1VA 3RGIA 2GMLA 5J2MB 1HBUA 1KLMA 4I67A 3HX9A 1K0VA 2DH9A 5KFNA 4DSLA 2GS8A 4F4KA 2VD3A 4B3SF 3N5BA 3FCVA 4YB1P 3FBEA 2OEMA 3DM2B 2G9OA 1MMNA 5IQQA 2XMWA 4EBCA 3PRBA 2MQMA 4ZS6A 2V6AA 3D68A 3V6JA 3R6GB 1H3DA 2PD1A 1FESA 1NJXA 1RT4B 5CABA 3TANA 1FD2A 5EX3A 3KUEA 3R6LB 4I6WA 5U47A 1EP4B 3AD8C 1WOSA 4M5LA 1FE4A 3OR1B 1LFPA 2G2OA 3KLGB 2CQ2A 3AOBA 1WOPA 2VA3A 1NJZA 1WACA 3IWXA 1URNA 2J9CA 2JH3A 2B4OA 3UCZP 2KG1A 1VC5A 1U7LA 4F4ZA 2M8HA 4LIRA 3K59A 3IXQA 2HBQB 3CWJA 5HO4A 1PBAA 4ED7A 4ZVSB 3CIMA 1SKSA 1C0TB 1VFJA 3SSRA 4FF3A 2QTWA 3FBBA 3QLHA 1HARA 3CCVS 1U2RA 4TYBA 1RT5B 3QAUA 3A8JA 2GGPB 3UR0A 1AFIA 5DGBA 1S0VA 1NDPA 2APOA 1S97A 2UXCF 3HHLB 3UO0A 3P49B 1JJHA 3TQ1A 1V3RA 1RTDB 1Q78A 2COLA 3CCTA 5K9FA 1UFWA 2DH8A 4UF4A 2MQLA 1CC8A 1FF2A 3V81B 4KBIA 4IRDA 1X4BA 2AEJA 1FKAF 3KLHB 2L9NA 3NEKA 4KSEB 1SQFA 1VK8A 1NZAA 3ITHB 4ED8A 2GVZA 2BE7D 3HCXA 1JLAA 2R2UA 2V0NA 4X64F 1TL3B 2X1BA 4LRCA 3UDCA 2DNHA 5C7PA 1REGX 3TAMA 2H54B 1HR0J 2HRYA 4AQYF 1Z1ZA 4GVBB 1QY7A 3A1YG 1HBMA 1U1OA 3POTA 1CVJA 4YFUA 1XJWB 4KGMA 2WBRA 2QSFA 2ZBRA 2BZ2A 1RISA 4UOFA 1UMJA 4QWAA 3IGNA 3JXOA 4OZ1A 4KFBB 2XMMA 3GCXP 4CZCA 4C8NA 2CJAA 4PG7A 1APSA 3M9NB 5IOLA 3PDNA 4OI2A 2ZBIA 5D0RA 3AQOA 5FLXU 2LQBA 1NXIA 1CJVB 1J2VA 2CNNB 4KC5A 1WG4A 2LYVA 3A13A 3RBDA 5RUBA 2O5DA 3Q23A 5C2GA 3MM9B 5KFGA 4G1IA 2HHHJ 4ALZA 3CD0A 1N33F 4RUAA 3UDEA 1QTMA 2HRTA 1KQFB 3D0GE 1HBNB 4QYZJ 1N8RT 3QPIA 3I82A 3DCAA 2MZSA 1GK8A 1RTJA 2MLXA 4DR1F 2XNQA 2R7XA 4DUZJ 4ER8A 1TU0B 4JI6J 2K8GA 3OPKA 2ZUAA 3F0NA 5F8JA 1S1VA 1Y11A 5F0WA 2H1YA 2HZVA 3QRQA 3TJ9A 3DN9A 3LWLA 2P6SA 1WSVA 4OYIA 3IM9A 2OPSB 4WTOB 1HWJA 3CJTA 1VMBA 3W5XA 3BEGB 2DXEA 3UN3A 2VQEF 3QT6A 3TYTA 2LQ5A 2B9XA 4CTAB 4LUBA 3RG6A 4F0KA 4DBQA 1VK3A 5IM0B 3SI8A 1FFGB 2HBZB 2AW0A 3MR6A 5BR8J 4ZCKA 1VYAA 3PRDA 2CRLA 4LRDA 3ENWA 4CRJA 4JYAJ 4CLYA 4RW7B 4ID5A 2ZKTA 1U1NA 3TEHB 4ECUA 4KYZA 2CIMA 2RDJA 3ENQA 3I0RB 3UDLA 4HL9A 3PXGa 5LOQA 1YDLA 2NXJA 3N6LA 1ZTWA 3PIPQ 2VBYA 3PNIA 4QU6A 1FKPB 1BGXT 2V4JB 2E44A 1E6VA 1RU1A 1RT3B 2QIFA 1HL6A 1TV6A 3K7RA 1QAJA 1HNWJ 2CPXA 2DBBA 5H9EK 1K1SA 2IMWP 4JI3F 1XQIA 1WKKA 4R5PB 5KFHA 4Z7YA 5IWAJ 4PXBA 4XPCA 4DN9A 4JI1F 4WXWA 3ILJA 4G6VB 3HM9A 3U02A 3FEYB 3Q8YA 3LA0A 2VG6B 3C16A 4FKYA 1RCOB 3SFUA 2E66A 3CCLS 4WTYA 5HP1B 4IYQA 1U25A 2RF2B 1RK8A 1T94A 1MN9A 2FJEB 2DGQA 4A8KA 2KHDA 3MTKA 4DSKA 2ASJA 1GAOA 1F5CA 3DLKA 2RVJA 4LBHA 2B8QA 1HA1A 4HYKA 2E9TA 2NXCA 1YKWA 3KUHA 1QVGR 5E3PA 4ZP9A 3D2WA 1NSAA 1RT2B 3ENAA 3P8BB 1UA0A 3MM6A 2I5JA 2UU9J 3N6NA 1NAQA 3W5ZA 3UNYA 5EX0A 4DQPA 3KOAA 1F0XA 2GJ2A 3IG1B 5BJRA 4IR9A 4QZVB 1GMVA 2GHWA 1HLWA 1NHVA 2QLBB 1F5AA 2O3DA 1LWCA 2BANB 2B6AA 4HLBA 2AX1A 1ZBTA 4CNYA 2J0SD 3M8ZA 4JI8J 4QW8A 2IAJA 2FJAB 3PW5A 3G82A 4WFNQ 4FDFA 1LWFA 2JHEA 5EN1A 4H4MB 4DS4A 3OL7A 5H9EJ 3OTEA 3UD5A 2LECA 2KFZA 1RTIB 1D9AA 3LH2S 2ZWOA 1ROFA 2XZWA 2V67A 3IS9B 1NK9A 3GR0A 2MGZB 2BM0A 1HQUB 3GIKA 3M30B 4LR9A 4H4KC 3DRPA 3DRSB 1FJ7A 1X4CA 3H98A 4KQZA 3G86A 5D77A 2E5HA 1TTHB 4DU7A 2VF3A 1KTVA 4DR6F 3H25A 4NEZA 3CJRA 1NRKA 3IBCB 5F3ZA 1S0NA 1FDAA 4LF7J 3EWGA 5H9FK 3R8YA 1JX4A 1JXLA 4IOCQ 2ZZMA 3WHIA 3W1YC 2VUGA 3IA0A 1VQSA 3G6XA 3M8YA 3BPDA 5IXUA 2J9EA 3ZNUA 2NREA 1SC4B 1IJEB 2C3OA 3T9NA 2DR7A 1J5OA 1I51B 2FHMA 4A8QA 4JV2A 2QL5B 3KK3A 4ZPTR 4YR0A 1IJFB 2Z30B 3Q83A 2A2DA 3LPYA 1OSDA 4IDKA 2I1RA 2LEAA 3MEGA 2YY3A 3B8HA 2CPIA 2KH9A 3V6KA 3T6JA 5DJBA 4DX8H 1SKRA 3HSGA 5F9NA 2RQ4A 4LT6A 3IWLA 5L9NA 2CZ4A 3W65A 3H4DA 2LA4A 2OMOA 2WONA 4K5SA 2HLUA 3SCJE 1XEZA 3G6YA 2VOPA 2GFFA 4NLSA 1MWZA 4RNFA 3R1LA 4L75A 4URGA 1VIXA 2PFFB 1IKVB 3FSXA 3SBMA 3S1TA 2N3LA 5F9LA 3ZFVA 4K7QA 3IAM9 4OJ3A 3AT1B 1FWPA 2CJKA 4ERDA 3J7Z5 4ZP8A 2M0GB 1ZM2A 4WJBA 1ZA2B 4LSNA 2ZBQA 4P71A 3MGJA 2XO7A 4TY8A 5H9FJ 3H5SA 3B6BA 1FFSB 3P5BP 2CJXB 4ZPWR 4E8UA 2XMVA 2CPEA 3U1LA 1NSKL 5DETA 3SQGA 1RWWB 3AODA 1IBLJ 2VKRA 1WI8A 4MFBA 2Q1LA 3NNCA 4B3RJ 4C2MA 3C6TB 2X3GA 3DLJA 3L95X 1Q1KA 2KB2A 5F0UA 4BWJA 2VODA 1KQKA 4F67A 4JI4F 1T7PA 3KNAA 4ILLA 5HBMB 3HT0A 1N5YB 4U8VA 1WC4A 2WOMB 1NK4A 3MM8B 2L08A 4WFZA 1O51A 2ZWPA 4DX5A 1IM4A 1TKTB 5AE3A 2H9ZA 2WTFA 5KFYA 3GJQB 3OTCA 2AV5A 3KK1B 1U02A 2BRKA 4H4KA 2EG2A 1E6YA 1H38A 4DR3F 2HGLA 4BWMA 2E5IA 3DOKA 2X51A 4ZPCA 1RB0A 3CDUA 2R8GA 2CZVC 2D9OA 1BWEA 3OL9A 1HIYA 3JSRA 2KRRA 4ECRA 5LMUF 1KVIA 1M1HA 3MPYA 1U0HA 2Z0GA 4OJHA 4ZCLA 4B9TA 1RADB 4ZLNA 1OYDA 2QJ3A 2CYYA 1B7FA 3Q8SB 3W2WB 4NA3A 2AJ4A 1QM9A 2M70A 5AT1B 4NCAA 2B4UA 2HHTA 1SBRA 3ZTQA 2V8PA 4KGXB 5J2QA 1TZ0A 3N6MA 2BJ3A 2MHNA 4O3NA 1R7IA 1WF1A 1VHFA 4LSLB 4QR0A 4F02A 5DDOC 3I0SB 2VPWB 4LBIA 1FE0A 1Q8LA 2XYPB 3G8SA 4KE5A 2DXDA 1OY8A 2HBYB 3MEKA 3VAJA 1MN7A 3MM5B 1RA7A 4TU8A 1TL5A 3TWZA 1DBDA 4Y00A 1S48A 2RS8A 3RW6A 4DL7A 3SYZA 3KMSA 4RW4A 3CDBA 1N34J 4TLQA 2MDAA 3GG1A 3TVKA 2R8IA 5KT3A 1S9GB 2BKOA 4IRCA 4M1KA 2FJBB 3EM1A 4NLUA 2UXBJ 1HHTP 2W7AA 1FKOB 3Q22A 4PWDA 2BUNA 4KAIA 1S7HA 3UD3P 4WP3A 2EVZA 1N54B 2YKNB 5L38A 4NLQA 2YH1A 4RNOA 1XR5A 2MKSA 3FEXB 3KHGA 3M2UA 4LF9F 1GNKA 4F26A 1QUVA 3PW4A 4ZA1A 5L9XA 2PMZD 4ZOSA 3BDPA 4NZ0A 4NL5A 3OFEA 4Q7AA 3JAMY 3HZGA 1VRTB 1JLQA 4C3LA 2B9YA 1TFWA 3EGVA 1S4FA 2HHSA 3DMJA 1KDNA 1YRUA 3AQPA 2V94A 3GU0A 3RB0A 5ETQA 1QUPA 1FEEA 3P96A 5FDLB 4OMFG 1GXLA 4U7CA 3N28A 5LJ3Y 1VQNS 1TUVA 3KFWX 2AT1B 3M8SA 2ZUGA 2MQPA 4GKJJ 1RTHA 1NKCA 5IZHA 5E33A 5I3PA 4F36A 1VQLS 2UZAA 2D3O1 2AWZA 2W2MP 4J7CA 1KONA 4NMXA 2AQ4A 2FPHX 2RMLA 4YHHF 2HGNA 2BE2B 4A8OA 3X3UA 2OD6A 4ELTA 1FRKA 2FGOA 1WJ9A 1X5OA 2M88A 4GC7A 3HSZA 3OSPA 1W25A 3NS5A 2BJDA 2XY5A 4NLGA 5KG3A 2Z57B 4C8MA 4LVNP 2PO4A 1M1KT 2DRAA 3B4MA 5DG7A 1H74A 2DB1A 1A7GE 3I5BA 1DARA 1YI2S 2OEJA 3TVZA 3BPSP 1S1TA 2ROEA 4KGKA 1OPZA 3ZZYA 3QFWA 1HNZJ 3PFOA 3J80Y 2Q79A 3NNHA 4HR2A 4QIVA 1YBAA 4DSIA 1DQAA 1N36F 2RDDA 1XN9A 4FF4A 2DNQA 2WB1D 3JSMB 1FX4A 3DOLB 3THTA 3V6DA 3T1YF 4DR4F 1KP6A 2FC9A 3MUMP 2JJ4D 2J6TA 2YKOA 1HFEL 1RAJA 2E9RX 4M8LA 2KKHA 2E1AA 1T9UA 3PX0A 2GJFA 1KHWA 3CMAS 1TFYA 2ZM6F 1YJRA 2ZH9A 2ROPA 1GFWB 2W9CB 4F7VA 2GHVC 2F1FA 4B3TJ 4KY3A 4B3OA 1R3NA 4LIWA 5KFRA 2EWHA 2C2KB 4JI2J 4N77A 1F60B 3BS9A 3GONA 3R2DJ 4J9SA 5BYRA 1CJKB 4LFCJ 1FXLA 1L3VA 2ZH3A 1O6XA 1QSSA 1Q16B 3U1MA 2LQJA 4FXVA 1QAXA 1RGVA 1RT1A 4F4YA 2RE1A 4OHYA 1C1BA 4CLTA 1WUUA 3EGNA 3SCKE 2QFJA 2RHSB 4IH6A 3SSSA 2XTJP 1Y10A 1S10A 4XO0A 1IN0A 1KBRA 3QAEA 4KGVB 4KRWA 1LWXA 1CJUB 2VG7A 4OZJA 3GSIA 3OTOF 4LQ3A 4P2SA 2H4WB 2CPJA 3IBFB 4X66J 1R8BA 2LEBA 4FYXB 4DFMA 1AUDA 1L5UA 1I94J 2JLGA 2ATLA 4LREA 1H2UX 3ADAC 4O4RA 2DKOB 1P9QC 3UE2A 1WNEA 5CAAA 1LW2A 2E29A 3MECB 1JLFA 1N6QB 1GMWD 3QYYA 3DI6A 2C3UA 2HYIB 2K7KA 1FEHA 4P74A 3C6UB 1D9FA 1VQ7S 3H4BA 3GJSB 4FNIA 2DHXA 1Q7LB 1U45A 2VH7A 1AUSL 5IQ6A 2HNDB 1U2FA 1KNZA 2RQKA 2MJNA 1U6ZA 2RNEA 2GIQA 2M4MA 1RAOA 2FHJD 2BKNA 2JFKA 2DR9A 2DGVA 1MNEA 2VC0A 3E01A 4B9NA 2RKIB 4HTJA 5KG7A 4IR1A 2M3DA 4QIFA 1HBOA 3RB4A 1NO8A 4MMOA 1OMSA 2ASDA 1JLGA 3W60A 4JI0J 3ZXWA 3I4PA 2SXLA 4O0NA 1UVMA 5B0FA 4CP5A 3HSJA 1TV6B 4XDDA 2NSBA 2W1BA 5D0EA 4PG5A 1FK9A 1DTTB 2DCUB 1Y5LB 2ADCA 1RACB 3D1QA 4DQSA 2L48A 2B7CB 2MZRA 3CJ0A 1JWWA 4RO0A 1TKDA 4DFJA 3ISND 2GMJA 3UVJA 2A10A 4PXDA 4W4MA 1Q53A 5K8MA 1ZZNA 3MAQA 2HURA 4HACA 4LVOP 2QGFB 1D1UA 4F3OA 4ECVA 2YKMA 3HMJG 2UXDJ 3FEZA 3OQ2A 4FXWA 1SUQA 2G0JA 2AKWB 4OZ0A 1PG5B 2DRBA 5B0BA 2YX1A 2MMYA 3BV8A 4NI2A 4BC9A 3H2LA 1X5PA 3HSDA 2YTCA 4IH5A 3BYPA 4DV3J 1TELA 3GE9A 3CD5A 2BRLA 3I9ZA 4O3QA 4H4OB 1AYEA 1CULA 1S6QB 1FA0A 4I1TA 2I5JB 7FDRA 4NLXA 1U1KA 2VQFF 3G4SS 5DLFA 1IBMF 4CLUA 1VISA 2C2DA 1D8ZA 1PCAA 2NLWA 2CQ0A 4AUKA 4NXMF 2RQMA 5E3AA 4W90B 4YDXA 4NYPA 5D3GA 3Q24A 1LWCB 4B3SJ 1F3FA 3MMAA 3I56S 3MD1A 3GP9A 2CUYA 3MPWA 2HAIA 4I2QA 2R2RA 2YNGB 3GFZA 3VAKA 1A9NB 2HEKA 6FD1A 4NZ6A 3DRRA 1XR6A 4NPOA 1JLCB 2IRXA 4QWCA 1U1LA 1IBKF 3H8YA 2EW9A 3MURP 4XDCA 3NBPB 3HLUA 4DCPB 4A46A 1SJQA 3NGSA 2EC2A 3MF5A 2ASLA 5HL7Q 4U96A 1ZZFA 2FGCA 3DGPB 3WDOA 1JLEB 2E5JA 4F0HA 1WC5A 5HN0A 5J1EA 2XM3A 3WX8A 3KLFB 3MHYA 3P45B 4L3KA 2IRUA 1JJ2R 1R0CB 3K5OA 5C24B 4USWA 1IWGA 4TQSA 5LJ5Y 1MU2A 1UW4A 3P5TL 4CCHA 1QJHA 1WEZA 4ENOA 4C7QA 2G1DA 3AOCA 2M7SA 4ZCMA 1PBUA 2AZ3A 4J9OA 4DFPA 1Q5YA 1KQSR 2UXCJ 2BQRA 1NNDA 4JI5J 1KTQA 2PEHA 1JMTA 5L46A 1FRLA 3I9V9 4MT1A 5KT6A 4DS5A 3H7HB 2R7QA 2YBVA 4DV6F 2PIIA 3CJKB 5C25B 4O44A 1Q82T 2KI2A 2OHDA 3D9BA 4C48A 1MW7A 4J9VA 4MIBA 2N82B 3H42A 2POKA 3H59A 1EJ7L 1P6TA 1MWYA 2BJ1A 5EUHA 3EVWA 2FVRA 2ZE2A 4Z37A 5IV4A 5D4LA 4X64J 1YJ7A 1G4CA 1Q4RA 4MKYA 2DGWA 2C28A 5J2NA 3MZIA 4NYZA 3HHLD 1N5VA 4AQYJ 1IKYB 2JEGA 3G71S 4WP8A 1S76D 1C2PA 2MY8A 2LP4A 3AB2B 3FQKA 1NHUA 3KG4A 3N4WA 3T5KA 1S72S 3DXSX 6FDRA 4QIWD 1C4AA 1BHNA 5KTQA 1M5KC 3GTYX 1WELA 2KJWA 1LXNA 3FSIA 4TVAB 1BXNA 3SXLA 4ZHRA 4ZIWA 1WKLA 3IP0A 1U47A 3ULHA 2C3YA 2XB2D 4LF4F 3PM9A 2EFOA 1HHSA 3QT7A 1KD1T 3ZZPA 1PJ5A 2F3JA 4HTIA 2LVWA 2B4VA 3RB6A 1T9XA 3JAMU 4UZCA 4R8UA 4B9UA 1N33J 3PFEA 2MYFA 3D3CJ 3PEHA 4DR1J 8RUCA 4WWSA 1PKUA 4JV5F 3DU5A 5BYSA 1U8WA 4ZVOB 1NLKL 5HQLA 4PG6A 4WE1A 2GJIA 5SUHA 5A0YA 3LO3A 2WSEC 1DLOB 1N48A 2XULA 3PTWA 2UUBF 2V5HG 1UEVA 3MFHA 1DJ0A 1RWNB 3HJFA 5I42A 2B56A 1FRMA 3MM7A 3TA0A 5GMDA 3QIPA 4IG3B 1GEHA 2XWYA 2CXEA 4ILRA 4DLEA 3ZTPA 2VQEJ 5CYMB 2V8HA 2ZD1A 3U7JA 3K5MA 1P9YA 1CJTA 2YNFA 4ED2A 5HROA 3OV7A 3BH6B 1FERA 3M32A 1R43A 3RRGA 2NQPA 3SEOA 1FNMA 2W2QP 1RWOB 2XG8A 3NOCA 1R8HA 1S1XB 2D1CA 3W2VA 4A8MP 4HT5A 2W2OP 2V4QA 2F8HA 1TKZB 3J80U 3D66A 2NZCA 4IQMA 5FJ4A 3MUTP 3LGNA 4DHVA 3BKUA 1F9HA 1H2TZ 3LW5C 2B9EA 4LF6F 2OFGX 2OPRA 3MEDA 3HVTA 5EGYA 1RAIB 1G1XA 5KOWA 2HBRB 2R8HA 2WSCC 3QGHA 2WZ1A 2F9JA 1S1WB 4JV0A 5A2QY 2LMIA 2UUTA 3QWUA 3GIMA 2E7VA 1KVKA 4ED1A 1IM6A 2VPYB 3D5MA 2FQQB 4WF9Q 5D4OA 2B3TB 4NOHA 3CJ8A 4JI1J 2CQ3A 5A8WA 2IM0A 4PPDA 1VR6A 2GMHA 3HD1A 3V5RA 3AXMA 3MAAB 3BM7A 2W9BB 1XERA 2VG5A 1T03B 3KWMA 2ZHAA 1CSJA 1BQMA 5AJ3F 3SCIE 3NS6A 5B09A 4UOGA 1D8YA 4DR7J 4C8OA 3LP0B 3RJMB 3VALA 3QATA 2OAUA 4PWWA 3TUIC 3IC1A 4M5MA 1FFWB 4K5RA 2XO6A 4DXLA 5BYQA 1S99A 1VDHA 3C19A 4NEYA 4ZVGA 2A3JA 4IH7A 3BBFA 3JYTA 4I68A 1T95A 3UWTA 4F3MA 4HHUA 4K4XA 4J9MA 2DNYA 4USTA 3MR2A 3MMBA 2F7VA 2YNIB 1JKHB 3GFHA 1U6FA 3TX8A 2MXYA 2O1PA 1OJ4A 3CJQA 1JJ4A 2RDIA 2I0XA 5J2PB 4PABA 1T9TA 1R0BG 4NLOA 4KO0B 3CCMS 2U1AA 2FHKA 5B7WA 2IC3B 3MMCA 3T6BA 1LW0A 4F2RA 4B9VA 1G2EA 4DPXA 1SIZA 1GT8A 4X65J 4RUHA 2RH3A 1TQLA 4KV8B 3L9ZA 3CO9A 4USJC 2ZOFA 2DXFA 4QBUA 5T7LB 4KHPJ 2HHWA 2D74B 5F8IA 2DT9A 1HYSB 5DDRC 3M2VA 2XMJA 4ECZA 3HULA 4OX7A 1HQEA 2VL1A 5DZ7A 5M2PA 1RQ0A 4YB7A 3EDRB 1D09B 2MHEA 5HK4A 1FJEB 5B0AA 3LP2A 1X4HA 1S6PB 3BQ0A 8ATCB 1Q5VA 2Y1RI 2ZZTA 3TZXA 2C2ZB 3ZZOA 1QSYA 2C1EB 3KK2A 1HMVB 3NGTA 2D3UA 1XNRF 3CJ5A 1FJGJ 2LU2A 2DGUA 3U1NA 2BOPA 1F6TA 3ISZA 4DR6J 3RBXA 3GIIA 2CJ9A 2PDAA 2OTJS 1X9SA 1GTEA 4LF8F 1W26A 1RWVB 5JUMA 2EFGA 2VIHA 3GG0A 1VLYA 1FCAA 2WB4A 3J7AN 3PHTA 3EE3A 1X9WA 2ZFHA 1YG0A 2VPZB 3MCMA 4RU2A 5KFLA 2JLEA 2XSJB 3NNAA 3CJ4A 2CJQA 5K5MA 5LM7E 1TK0A 2HZCA 1C1CB 4CLFA 1BQNA 4C8KA 1NK6A 3M8PB 2XHCA 3W9HA 2DPJA 1YRXA 3ILOA 1QDUB 2YWWA 4UUXA 5MAOA 2F4FA 3OD2A 3DYAA 3H90A 3KG0A 4QJVA 1WD6A 2AU0A 4NLVA 1OWXA 1RT7A 3M2RA 1TMMA 3QRPA 4C6AA 4FKXA 2QE5A 2KT5A 4F8RA 4TYAA 2NYIA 1LWEA 3R97A 1JNRB 3GIRA 1JLBA 5CZVA 2RIJA 3EVMA 4ZKAA 4OX9J 2HNYA 3LF0A 3FDSA 1L3TA 2KRBA 2QN6B 4QWDA 3OR2A 4UUWA 3ZZRA 5L1KA 1DTQA 2EI5A 5C42B 4G1QA 2P6TA 3TJAA 4BLGA 2WAQD 3QT8A 3OXGA 3KLEA 3FK4A 4M94A 2X1GA
chains in the Genus database with same CATH topology
3O44A 3T6JA 2HVIA 5DJBA 4DX8H 5A0YB 3DDNA 1SKRA 4TLRA 3JSMA 1QAIA 4USIA 5F9NA 2RQ4A 2JX2A 4X2BA 2W4CA 4LT6A 3IWLA 3IRWP 1U1QA 4RW8B 3J7YI 3DOLA 5L9NA 4EO8A 2LA6A 2CZ4A 4BBYA 4YOEA 1N0VC 3AB4B 2ALZA 3SDEA 1U49A 2KT3A 3H4DA 3L09A 2LA4A 2OMOA 2WONA 3W7BA 3CDEA 1Y00A 1RT5A 4K5SA 1BQXA 2HLUA 3RZAA 3SCJE 5L39A 3PR5B 1U4BA 5I42B 1XEZA 2KO1A 3G6ES 3ISNC 1N5SA 3QJPA 1TVRB 5J1NA 3G6YA 3H20A 4FBUA 2VOPA 2GFFA 3MM7B 1L3UA 2HVZA 1SJ3P 4NLSA 1MWZA 3PV8A 1TAUA 2HFZA 4RNFA 1I6JA 3R1LA 4ZVFA 1SH3A 3QIPB 1EETA 3RRKA 4URGA 3UNGC 1SC6A 3HF5A 1FT8A 3J7A1 1VIXA 2J0QD 4OI3A 4WK1A 3VTIA 3L7PA 2XS2A 2PFFB 2W9CA 1IKVB 3O2IA 3FSXA 3R1HA 2ZD1B 3S1TA 5IT4A 1OS5A 2YNFB 2N3LA 5HROB 3CCWA 2CPYA 1PILA 4KB7A 4Y6IA 5F9LA 4DL3A 4ED5A 4ZPDA 4DJBA 1KS2A 5JVHQ 3TRGA 4DG1A 3ZFVA 3IAM9 5CXTA 2QO3A 4OJ3A 3M32B 2AJFE 2J6UA 2JC1A 2CJKA 1XMBA 4ERDA 3QGIA 3GILA 3J7Z5 2V9WA 1RTJB 1WF2A 5KFPA 5THWA 1P1LA 4YP3A 1SV5B 4ZP8A 5F3TA 5DG9A 2M0GB 1W2IA 2QMWA 3QZ7A 1ZM2A 4WJBA 3NGDA 3O3LA 1BD6A 4LSNA 3M6VA 5F8GA 1K0TA 4A8YA 1HNIA 3TA2A 3OTDA 4PR6A 1D3WA 2ZC3A 3MGJA 2XO7A 1S1VB 4TY8A 2PN6A 4HKQA 5AE1A 5H9FJ 3W2VB 3H5SA 4CO2A 2FJXA 4B08A 3QMQA 4OI0A 4CH0S 1UKUA 4CT8A 3IRXB 4ED0A 2E1CA 4PUOB 4ZPWR 4E8UA 3D0IE 3R5CA 2LU1A 2QEXS 4X84A 2XMVA 2HIQA 2CPEA 3U1LA 3CB4A 1A6LA 4MJKA 4U9RA 5DETA 3SQGA 2AYEA 4AL7A 3DNCA 1SH2A 5KAKA 1RP5A 2OPRB 3F73A 4DV7F 4Q0BA 3OUYA 4QW9A 3MEDB 3HVTB 2VKRA 1WI8A 4MFBA 3FFIA 1WWHA 2QA2A 4X62F 3D1OA 1SXLA 2Y1IA 3HI9A 3LOUA 4URSA 2G0CA 4RX6A 4TXSA 2Q1LA 4ATNA 1Z2ZA 3NNCA 1LQ9A 4C2MA 2LXFA 2OPPA 2X3GA 3C6TB 3DLJA 2HGMA 3L95X 1HD0A 1Q1KA 2OKQA 4HEA9 2KB2A 2B9WA 3BSCA 4MKBA 3IFEA 1QAYA 2FTRA 2Z4PA 5F0UA 2PGCA 1WTBA 1LFWA 5E7OB 2JVOA 3OW2R 4BWJA 4UOCA 1S9EB 2VODA 5KG1A 2D3ZA 1KQKA 4F67A 4JI4F 1T7PA 2HMIA 3KNAA 4ILLA 5HBMB 5KT7A 5HMZA 3T1HF 1N5YB 2OPQA 1F2GA 4NYOA 2XY6A 5KFOA 3WBZA 4L72B 2GHPA 2WOMB 1NK4A 3JSBA 3MM8B 2L08A 4WFZA 1O51A 4DWIA 1R6YA 3N0VA 4EZ6A 4Q44A 3MAHA 4DL4A 5A8WB 3Q8RB 3HHKA 5A8KA 1JXEA 2DH7A 1R8PA 4RNNA 2L3MA 2A1BA 4L3NA 3MECA 3GYNA 4Q5VA 1WHVA 1PO6A 1UJ5A 4BS2A 3CGIA 1IM4A 1TKTB 3FMWA 5AE3A 3T5HA 2VG5B 2H9ZA 2WTFA 5KFYA 2XEXA 1N6QA 4ID5B 1ZM3A 4I2PB 1H0HB 1BQMB 5D6GA 1Q86T 2HHUA 3DLEA 3OTCA 2AV5A 5E2QA 4E98A 2W9AA 4J9RA 2Q3PA 3JSYA 4OHZA 2EK6A 3KK1B 2RB7A 5E41A 2BRKA 1URRA 4H4KA 5MLCV 2EG2A 1E6YA 1H38A 1S0MA 4DR3F 3C6UA 2HGLA 5KT4A 3HPOA 4BWMA 4EO6A 5DDQC 4DL5A 3KLVA 2E5IA 3DOKA 3I32A 4B9SA 2X51A 1MMLA 4ZPCA 3VQTA 4DOZA 4ECSA 1OQ6A 3OFFA 3CDUA 4F3QA 2X1AA 2R8GA 4LJMA 2RT3A 1FXDA 1R8AA 2CZVC 2D9OA 3NCQA 4FYDA 3OL9A 1BWEA 5G0RB 3JSRA 1E6VB 2UUWA 2XMUA 2KRRA 3BO3A 1VQMS 2KG0A 4ECRA 5LMUF 1QSLA 1KVIA 1NKBA 3MPYA 2HNDA 1AFJA 4B3RF 4JI6F 3VAGA 2YNHB 4M63A 4X4UA 1RT6A 2Z0GA 3IR6B 4OJHA 3OHBA 2W7PA 4M95A 1RJJA 4ZCLA 1TR0A 4B9TA 5HLFA 4WU2A 3QO9B 3JYTB 4ELVA 1RWUA 4PQUB 2CYYA 1B7FA 4MYTA 3Q8SB 2JC0A 3BR9A 3W2WB 4NA3A 2AJ4A 2OP5A 3MMBB 2RKIA 3FRZA 4ECWA 1QM9A 4FP9A 2M70A 4QPXA 2K7JA 4WIIA 4NCAA 1LOUA 2BV3A 3HXMA 3OLBA 3BQ1A 3CE8A 2B4UA 2HHTA 5D8HB 1X5SA 1SBRA 3KHHA 3VCDA 2DNNA 3VQSA 5J2QA 1VQ6S 4WZMA 3I6PA 3DOMA 1TZ0A 2OD4A 2KYZA 2W8KA 2IA0A 5KFDA 3N6MA 4O4GB 3QWPA 1T05A 2MHNA 4FF2A 4O3NA 5D3GB 1R7IA 1S1UA 1LW0B 2CQIA 4RNMA 3A8EA 1O5JA 1KLNA 4X4QA 4ICLB 2J0XA 1DTTA 1WF1A 1VHFA 2MSTA 4Q8EA 4LSLB 4QR0A 1B0VA 5DDOC 4F02A 3U27A 4DMZA 3I0SB 4C97A 4YB6A 2RU9A 2F8EX 4I7FA 1GH8A 2VPWB 1GQEA 1DAXA 2CQGA 1FE0A 1Q8LA 3G8SA 3DLKB 2UUBF 4KE5A 4C3KA 3CT9A 1UP1A 2B0GA 2Z8QA 5KT2A 4C9DA 4MTPA 3MEKA 1DZ5A 1TL1A 2EBGA 3VAJA 3PO5A 1UVNA 1WF0A 3M2VB 3MM5B 2PSZA 1RA7A 2CQDA 1NK7A 3OSNA 4TU8A 3HVWA 1TL5A 4JYAF 5B0CA 1DBDA 2VASA 2FC8A 3EXYA 2K2PA 3IBWA 3LGMA 3L7OA 5E0OA 4Y00A 4RLEA 3R5AA 1U24A 2B5JA 4O0IA 4Y2CA 3NAHA 2BDPA 1S48A 3KLIA 4AL5A 2RS8A 4OQJA 4KTQA 3VZIA 3RW6A 1HPZA 4DL7A 2JEIA 4EWTA 3SYZA 1HWUA 4NA1A 4Q2LA 3KMSA 1V9OA 3MM6B 4OI6A 3H5YA 2JDJA 1HD1A 1S6UA 4FVMA 4ZP7A 3PZPA 4RW4A 3HHLC 3CDBA 1X4AA 3LP2B 4TLQA 2WSFC 3HVAA 2MDAA 3GQCA 2DNOA 3M8QA 1HWLA 1LXJA 1X0FA 1SJFA 1J5EF 2W25A 4MK8A 1U8SA 3GG1A 1VRUA 3TVKA 2FJWA 4F2SA 3V6HA 4DR7F 1SI9A 4C11A 2R8IA 3NWGA 1ZM9A 5KT3A 1S9GB 2DJWA 2LDIA 1JNZB 2UV8A 5LXRA 4IRCA 4M1KA 2FJBB 3CD6S 1X0PA 3CF5Q 2FD2A 4NLUA 2JWNA 3KK2B 3DDKA 2BXJA 1VQ4S 3RB3A 2B6AB 5D4NA 4C98A 5KFXA 5L8RC 2A2CA 2LLZA 2W7AA 1FKOB 3Q22A 1HHTP 4PWDA 2BUNA 4KAIA 1S7HA 3UD3P 5J1EB 2EVZA 4I56A 1GX5A 1UAWA 1HNWF 1KHVA 3H2UB 5CQGA 1WI6A 3EZ5A 1ZPVA 2HG4A 2D3OR 3HKWA 4DDFA 1N54B 3LP1B 2IAJB 5A8RB 2YKNB 5L38A 4NLQA 2YH1A 4H4OA 4RNOA 1UJ6A 1XR5A 2MKSA 3VAFA 1NB7A 3C2PA 4UY85 1S6QA 3FMBA 2V4RA 2VKZG 3FEXB 3US5A 3M2UA 3KHGA 2BVZA 1LWFB 4LF9F 1GNKA 4F26A 1Q79A 1QUVA 2J9DA 3CVKA 2CFXA 4NXNF 5CYQB 1WG1A 4ZA1A 3PW4A 1Y5NB 2PMZD 4ZOSA 5L9XA 2W8LA 3BDPA 1VQOS 3HO1A 4NZ0A 4YMEA 5EWGA 1R0AB 5KG6A 4K4SA 4NL5A 3JTNA 3E51A 2Q43A 3GV8B 4G3IA 3OFEA 1PGZA 2RRNA 1VBXA 2FDNA 2QYCA 4Q7AA 3R5BA 5G4DA 3JAMY 2KZZA 3HZGA 1WHWA 1VRTB 2HS3A 2IHR1 1JLQA 4C3LA 2B9YA 2GQQA 2AYGA 1TFWA 3NMRA 2K3KA 4ZPAA 2RRBA 4G1PA 1S4FA 2GV1A 4DN0A 3WX4A 4CO3A 4WYLA 5B0DA 2HHSA 2MY7A 4PG8A 3E8OA 4WFXA 3DMJA 1CQNA 2UVVA 1YRUA 2XLJA 2VFVA 3AQPA 2V94A 4RW9A 3CUNA 4IG0A 4IFYA 2LKZA 3MPVA 3DRPB 3NG8A 2PE8A 4X65F 3TO8A 3UW1A 4F4XA 3RB0A 4DR5F 4D3HA 3BGRB 2HHXA 2VFUA 5HMXA 2JZ5A 2LEPA 3RR7A 3MFIA 3OXFA 3R27A 3Q0AA 2ZJQQ 4USHA 1YHQS 1S77D 5KFUA 1QUPA 2YNGA 1FEEA 2XLKA 2ZZNA 3P96A 3IR5B 2UXBF 4MK9A 3OBIA 4KHPF 5FDLB 7FD1A 1BQNB 1OO0B 2AJ0A 1S0OA 2OIHA 4DSFA 4DV4F 4OMFG 2XS7A 4A8XA 4DQRA 1GXLA 3S01A 4CO4A 4U7CA 5I3UA 3EYZA 3DFEA 3N28A 3RU0A 4GKKF 2NR0A 2I38A 5LJ3Y 2VB6A 1VS3A 1VQNS 1JLCA 1TUVA 2R8JA 3KFWX 4QWBA 1X7VA 3M8SA 2HWTA 2ZUGA 5M2RA 2MQPA 5FLXY 3NBPA 1RTHA 2ZH5A 5IZHA 1NKCA 2E1RA 5DDPC 5E33A 5I3PA 1K9MT 3D1HA 1VQLS 2UZAA 5L1IA 3K8WA 2AWZA 3V4IA 3CMES 1KONA 3DYAB 4CO0A 2DISA 2AQ4A 1DURA 3ETOA 2FPHX 1U09A 2RMLA 2K3IA 4ITSA 2YX4A 3UCUP 4LQ9A 4OL8A 4YHHF 2GCFA 4NA2A 3CC4S 5HQ8A 2HNZA 4OJ1A 1RDRA 2HGNA 2BE2B 4A8OA 3X3UA 5J2MA 2OD6A 5LXYA 5I3QA 4ELTA 1FRKA 3DGPA 1JIHA 3UD4P 1ZETA 1JLEA 5F8LA 1TAQA 2FGOA 3N9UC 1X5OA 1NU4A 4PXEA 4RW6B 1HWIA 3TAQA 3OFHA 4OX6A 3RAXA 2M88A 2B7BB 2D41A 1RT7B 3M2RB 4GC7A 3PX4A 4HDGA 1REVA 3FNNA 3HP6A 3OSPA 2QA1A 2OLWA 1W25A 1FJGF 3NS5A 4HI2A 1WHXA 2BJDA 2XY5A 4NLGA 1S49A 5KG3A 3KLFA 4RZRA 2PA3A 1LWEB 4C8MA 1YJUA 1JK9B 4LVNP 2PO4A 3DM2A 2IM1A 5LSLA 1JLBB 2GQ2A 1M1KT 4NCBA 2MPUA 2DRAA 5CD4H 3B4MA 4O3PA 4JI8F 1J5OB 4J9KA 5DG7A 1UVLA 2HNYB 4UQTA 3NL0A 2DB1A 1QE1A 2ZNYA 5C24A 3KK3B 1A7GE 3I5BA 4ES3A 5H1SV 3KJVA 2PA8D 3Q2SC 4XIUA 4FS2A 3OR2B 4ZPBA 4JI7F 1FO1A 4FXDA 2DK2A 4ZDNA 1DTQB 3VAIA 1MMDA 1ZTTA 1DARA 4KKOA 3O5TB 4LFAF 1AW0A 2QV6A 2FVQA 1YI2S 2AX0A 1FRIA 4G1QB 1NK0A 1NH7A 4NLRA 2XCAA 3TVZA 4DFKA 1T3NA 3K5PA 3AJ1A 2ZH4A 1S1TA 4X4RA 2DCLA 1XNQF 3F41A 2ROEA 3I31A 3LANA 1OPZA 4KGKA 1RTIA 3ZZYA 2X1FA 2VOOA 1WHYA 4IDKB 4NCGA 3AHPA 3KHLA 1VGYA 3PFOA 3KLEB 1RT4A 3MEGB 3J80Y 2Q79A 2QLWA 3PO4A 3NNHA 2CDQA 4U6PA 4IFVA 4QIVA 3DC2A 1YBAA 4DSIA 1DQAA 2DNMA 2MSSA 1N36F 4GKJF 4GO7X 1XN9A 4L6V3 4FF4A 2DNQA 5KOXA 2WB1D 2UV8G 3JSMB 2NPFA 1CPZA 3DOLB 1VJWA 3I5CA 3THTA 3V6DA 2UVUA 3D54A 4RBTA 1EP4A 3M6XA 4OHXA 3PKYA 3T1YF 4DR4F 4K50A 3SDEB 2FC9A 4P7TA 4ECXA 2BACA 2WONB 1ZAWA 3MUMP 3JB9k 4RWWA 3OR1A 2JJ4D 4P7VA 3KLGA 2J6TA 2YKOA 1HFEL 1Q8BA 1RAJA 1ZAXA 2FJDB 2WBMA 3CJ2A 4M8LA 4URQU 5DS7A 2KKHA 2M5YA 3CJKA 5C25A 2E1AA 1SL1A 2HW3A 1R8CA 3LQVA 2CQHA 4YEAA 3PX0A 4C0HA 4WKRA 3PEJA 3HFKA 5AXLA 1FXRA 2ZVSA 4J37A 2DTJA 1VQ5S 2F40A 1VIOA 2M2BA 3CCES 1KC8T 2AYBA 1KHWA 3CMAS 4F4WA 1TFYA 2EKYA 3K5NA 2ZM6F 4DSEA 1Q8IA 1YJRA 3BGFA 2IVYA 4U7UK 3PR4A 2KZMA 1T02A 4TU7A 2KXNB 2FUG9 4Z2XA 3MTJA 1H6KX 2ZH9A 3MUVP 4BCAA 2ROPA 5M2UA 1S6OA 2W9CB 1WTFA 2P9CA 2AD9A 1RKIA 1IXKA 1P8GA 2GHVC 1GX6A 2F1FA 2R7SA 2EFPA 4MIAA 4B3OA 1R3NA 2QZ8A 4P6QA 4LIWA 2Q6CA 1C0TA 2MZ1A 2L9WA 3TI0A 5KFRA 3FZ2A 2RRAA 4DG1B 2EWHA 4N5SA 2B4PA 1FRXA 1TK5A 4LMZA 5D4PA 4LF7F 4IOBA 2JLFA 4N77A 1F60B 2J7WA 3EPIA 2GNKA 2FLPA 2DGOA 2MZQA 3BS9A 3TW0A 4J9SA 4J9LA 5BYRA 2AP6A 1IKYA 1CLFA 1YQHA 1FNOA 3BDEA 3IR7B 5K8NA 1UVIA 1SKWA 3T3FA 4CNZA 3AAWB 1TL4A 1FXLA 1NJWA 3PJWA 2YWGA 1L3VA 4B9LA 5LL6d 2ZH3A 1HNZF 4LSNB 2GGPA 4EZ9A 1Z2LA 1QSSA 1Q16B 1HNIB 3OVBA 4YR2A 1VQYA 3AJ2A 1H2VZ 4EU0A 1Y3KA 4CQ1A 4B02A 3U1MA 4TY8B 2LQJA 1GXTA 4FXVA 4A47A 1QAXA 1RGVA 3S6EA 2VFSA 2DHGA 3G8QA 1MROA 1UFLA 2DGXA 1HW8A 1RT1A 2QT7A 2RE1A 3HHLA 2W7OA 3CCQS 1C1BA 4F4YA 4OHYA 1PC4A 5CHCB 2HWIA 1RTDA 5DM6Q 1T8EA 3SCKE 3EGNA 2MKKA 5GAGU 4UQGA 3CDAA 2QFJA 4D3GA 3MURP 4IH6A 3SMZA 3SSSA 3MOZA 2DNLA 1GTHA 4TN2A 1DFDA 4OHWA 4QIGA 4OX9F 3SQGB 1S10A 4XO0A 1IN0A 3V81A 2FHOB 4KT0C 3ZZTA 4Q0BB 3QAEA 3OUYB 1HWKA 3SZ2A 1KRPA 4KRWA 1NEEA 2YVSA 3MCSA 3VR1A 4MFBB 3PIOQ 3K0JA 3FFIB 1U48A 3NGKA 3KLHA 2V2KA 2VG7A 5CYJA 2DHAA 2AGPA 4OZJA 1FJCA 3OTOF 4LQ3A 2MKHA 4P2SA 3ITHA 4GMKA