1Q7LB

Zn-binding domain of the t347g mutant of human aminoacylase-i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
b'NPWWAAFSRVCKDMNLTLEPEIMPAAGDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aminoacylase-1
publication title Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature ec 3.5.1.14: N-acyl-aliphatic-L-amino acid amidohydrolase.
pdb deposition date 2003-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1q7lB01
1Q7LB
chains in the Genus database with same CATH superfamily
1CS4A 5GAGU 3D9BA 1R0BG 2Z2MA 4OYOA 4OI0A 2IM1A 2A10A 5KT5A 2XM3A 3SV4A 3HSJA 3CCRS 3RG6A 1WELA 4ZPWR 1TK8A 1YSJA 1IBLJ 3VCDA 5FDLB 3GTYX 4LSLB 4ZDNA 3C14A 2J0XA 5HQLA 4C8ZA 1SH0A 2HGMA 2VQEF 4C2MA 3NOCA 4Q45A 4NZ6A 2OD6A 2WONB 3NNHA 2DD8S 5L38A 1ZM2A 3OLAA 2MLZA 2RRAA 2HNZB 4NLTA 2QSFA 1RA6A 4W90B 1SJFA 3B4MA 2JX2A 5D3GA 3IA0A 2EG2A 1RJJA 2MEWA 2W9CB 4DSFA 4P7TA 1N36F 2BQUA 2F65A 3DOKA 1FXRA 2V68A 4TY9A 1NSAA 1EIYB 4A8OA 4M95A 4KHPJ 1H0HB 4UT4A 3TP2A 4B9VA 2CPFA 3BSOA 2ZJPQ 1D09B 3SFGA 4OYPA 4S0MA 3OTOF 4PEOA 2PO4A 2P5VA 1RWPB 2X7IA 3KG0A 3QJLA 3DGVA 4TN2A 2BEFA 3V6KA 1Q5VA 2GFFA 2LEPA 3O44A 2J6TA 4JV5J 2ZJQQ 2IJNA 1FFSB 2ZBQA 3U1NA 3UCGA 2CKWA 4WK3A 4DCPB 1TKXB 4X4SA 2OFHX 5HVFA 1YQHA 4ZHRA 2GA7A 1ZOTA 2G0CA 1Z2LA 4DWIA 1VGYA 2BV3A 2K3IA 3KUHA 1MWZA 2D3OR 5IT4A 1X5PA 4I6YA 3TYTA 2KT3A 4C3KA 4K4UA 5AXKA 2ALYB 1Q81T 2MZRA 3EWGA 4FYVB 4ECZA 1T03B 1W2BR 1R6VA 1V5VA 2DK2A 2WHOA 4KH1B 2MZSA 5DM7Q 2NCKL 4OI3A 4ZVQB 2MY7A 3MPYA 4RU2A 1PCAA 3Q0AA 3JQJA 5D6GA 3J7YU 4FNHA 4PUOA 2IDEA 5J2MB 2RS8A 2JFKA 2MSTA 3DXSX 2HMIA 3HKZD 1UJ6A 4JI7J 2QTWA 4NZ7A 5JVGQ 2OP5A 4I2QB 1U1QA 1UW4A 2DGQA 2AX1A 5D0HA 4AQYF 2OELA 1O8BA 4K2JA 4CQ1A 2LMIA 1WF0A 1B4SA 2YKMA 4PQUB 3OFHA 1FD8A 3ZO7A 3D28A 1U1NA 5E3RA 2W2NP 5GAHI 1C4AA 1ZZFA 4QIGA 4X65F 1RTDA 3B54A 4URGA 4FS2A 3M8RA 1L3UA 3DM2B 1NK6A 5B0AA 2V67A 3Q8RB 1FESA 3ISNC 1U8SA 4IRDA 1YK9A 4F7VA 1LNQA 4KPYA 1FA0A 3BB5A 4LSNA 1JLFA 5DRKA 4TU9A 4C3MA 3O1LA 2DISA 3M8SA 4QWCA 1IKWB 3WC2A 3B4DA 2KXHA 4AE5A 5DQGA 1YX2A 2BJ3A 4LF1A 2HGLA 3U02A 2HVIA 2FLOA 5ETQA 2VDHA 1SJQA 2HBZB 3IC1A 4A8SA 2LU2A 1EQMA 3D5MA 5FDLA 4WBFA 5E3PA 4LSLA 3W66A 4O0IA 2EW9A 5IWAF 2CQBA 3DMJB 1NKEA 3CSKA 1LFWA 4ZPDA 1UPMB 2WONA 3FQLA 4YY3F 1FKAF 2YXLA 1TV6B 2AWZA 2HNZA 3PRVA 4EO6A 4NRUA 3VAGA 3TWZA 3MTKA 3CGIA 4R8UA 4EMDA 3I4PA 1SIWB 2OPQB 1RT5B 2CQHA 3PW7A 2JOQA 2N4CA 4YDXA 2UVRA 1T9XA 3IP0A 4DI6A 4ZK7M 5GMDA 4NLRA 4DN9A 1S9GA 3C16B 2BKPA 2KXFA 3I32A 2KXNB 2CADA 4JI2J 1GH8A 4OLOA 1F2GA 1TKTB 1X7VA 2BRLA 3BGLA 1F6TA 2EI5A 2MYFA 5KFAA 1P9QC 3PEHA 1D8YA 1NJIT 4J7CA 1UWBB 2ATLA 2FJBB 2FYXA 3O8WA 4FP9A 1F1BB 3RU0A 4LRDA 2E29A 1VQLS 1KLMB 4YHHJ 2C3OA 1R8HA 2HHWA 3LUYA 3TOQA 1TKXA 2OKQA 4LF9J 2W9BB 4QIWD 3GE9A 3MDFA 2AYBA 4URQU 4KGXB 5H9FK 3CC4S 2XWXA 4WU2A 2UXDF 1H7XA 1JXVA 1ZBTA 1TL7B 1XMOJ 3H59A 4TQRA 3LP1B 3GSDA 2QLBB 1SV5B 2BRKA 3GV8B 4Y28C 2AF6A 3G8TA 4NRTA 2GVZB 3MECB 5HO4A 4X62F 2JLGA 1TR0A 4ELVA 2BE2B 4OLPA 2WW4A 3BH6B 1F5BA 2B56A 4OHZA 5J2MA 4ECRA 4XK8C 3D0GE 4I2QA 3BJYA 1D9DA 3GFZA 5A6PA 3FRYA 5KOXA 4MTPA 1BHNA 4PQUA 2H54B 3HMJG 3HCXA 4YN3B 1G2EA 2RRNA 5SUHA 2XB2D 3Q8YA 1Q8IA 2DO0A 2F9JA 4HACA 4LRBA 2YKNB 4A47A 4OL8A 3FZ2A 2GIFA 3DM2A 4HI1A 2CQPA 2MDAA 2EG1A 2AZ1A 4DR6F 2CDQA 4TYAA 1Y10A 2E5GA 3BGFA 4B3OB 2IMWP 3MD3A 4K0KF 2B51A 5L9XA 4U8YA 1KOOA 3W8PA 1IKWA 1DBDA 2BJ1A 4OJ1A 4MK8A 1IKYB 2RQKA 3C6TB 1SL0A 4ZVEA 4CZCA 1S0NA 4DCJB 5K20B 2R2TA 3A3OB 4IRCA 1L3KA 4ZMMA 3W9IA 1A7GE 3AFGA 1Q86T 3DMJA 3OL9A 3CC7S 4DF8A 2BM1A 2ASLA 4WXWA 1KS2A 2ZWOA 3KK2B 2D74B 2MZQA 2B9XA 4G6VB 1SL1A 2QSWA 1TV6A 5L39A 4L72B 1OYDA 3Q2TC 3BR8A 2HVDA 2ADCA 2XBPA 1TKDA 1FJGF 4WIIA 2OPQA 1MN7A 5GAEU 1K44A 2RILA 2QMUB 1JK9B 4U7UK 4CLYA 2QA4S 1IJEB 3CCUS 1NXIA 2BQRA 1XC9A 4OZ5A 4NYOA 2MZJA 4B3MJ 3OFGA 1JB0C 3C16A 4IO9Q 2N82B 5F8MA 1D9AA 4DU8A 1JKHB 3PYFA 2NZ4A 4NASA 1R89A 4UOCA 2Q79A 2X1BA 2MHNA 2CQDA 3EJMA 4LFCJ 1TKTA 4C0BA 2FVQA 4KYZA 4ELTA 3DLKB 2IMOA 2GS8A 4DUZJ 1QD1A 4DF4A 1PBAA 3E3XA 1UWBA 3MR2A 2H4WB 1LW0B 1N34F 4JBCA 1DQ8A 2KI2A 3O3LA 3OTDA 3VAKA 3R1HA 2IAJB 1YG0A 1JWWA 5KFBA 3MM8B 3KLHA 1NO8A 3R97A 3N6NA 1HARA 2RH3A 5SZTA 3I9V9 4A8KA 5EX0A 2BKOA 2P9EA 4JYAF 2DNYA 2J0SD 4DZDA 1TL7A 3JSRA 5IOLA 3TZWA 2XS7A 1SV5A 1NK9A 4DV2J 4LFBJ 3VTIA 3OVBA 2YNIB 1VC5A 2GVZA 3MECA 3BREA 1KOHA 2R2UA 4YB1P 2CVIA 5IT9Y 3NNCA 5J2NB 4B3SJ 1R8CA 5ETTA 2W2PP 2FJVA 1YKWA 1CJKA 4FVCA 2RVJA 2BE2A 4F4WA 3HD1A 1GXLA 4ZA1A 1F5AA 4C48A 4ZLPA 1MWQA 2E9TA 1XWLA 3M6UA 1VQ4S 2HK3A 2KZMA 3M6WA 4PABA 2YNFB 3VGVA 3UDVA 3CCQS 5THWA 2GC8A 3CXCR 3Q89A 3DKDA 4J5OA 4Q43A 2AIRB 2LXUA 4F3MA 1X4CA 1LWCB 2DGOA 4WFBQ 3HHDA 5AXLA 1TAUA 5CAAA 5AE3A 1KDNA 2ZH7A 3M7VA 1X5TA 4GVBB 4OZLA 4ES2A 2YKNA 1H6KX 3E01B 1UAWA 1U8WA 1VQ5S 1EAYC 1UVNA 1VLYA 4HH1A 1BE4A 3D3BJ 1EARA 4X66J 4B3OA 1OWXA 3QFHA 3U1MA 2MKHA 5BYSA 1NSKL 1N5TA 1K0VA 2VC1A 2IIHA 5K8MA 2GIRA 2DR8A 2EFGA 1PYTA 2P9CA 1NKCA 3H4DA 2UXCJ 1IKYA 3HSZA 1S59A 6FD1A 3C6TA 3SQGB 5A2QY 3R5AA 3J80U 2XNQA 3L7UA 2BW7A 3NEKA 4X4TA 2CZ4A 2PI4A 2RQ4A 4DLGA 2H65B 4NEZA 5A76A 4L3KA 5KFEA 4X4RA 4HH0A 1HHQA 3CDBA 2CWXA 5DLGA 2G4BA 2XZWA 4B3RJ 4CH7A 1NJWA 2C22A 2HZCA 1U1PA 4DPUA 3KK2A 1TK5A 1HBNB 1VRTB 4ZS6A 1T0TV 1UA0A 3JAMY 2XY6A 1RP5A 4B9TA 1C0TB 1PO6A 1N6QB 4PKDB 1WOPA 4DBQA 4EYHB 2RS2A 2UVUA 1FWLA 3DRRB 5HMYA 4C9DA 3FEZA 2IY5B 1PJ5A 4U6PA 3AJ1A 4DR3J 2E5LJ 2XZTB 1JKHA 3CCZA 2VFUA 3FKBA 1RU1A 2XMWA 3C6UA 5GADI 3IWXA 4CLUA 3JYTB 1T94A 4A8FA 1TUGB 1H2UX 1TAQA 3HX9A 4B3TJ 1IKVB 3AODA 3MOZA 1B70B 2M9KA 2RNEA 4HYKA 3QBCA 3G6XA 2GGPB 2QL9B 3DDKA 5IZHA 2FZGB 3VV2B 3PZPA 2CJKA 1S79A 5J1PA 1FI4A 1LW0A 2H5JB 4NLWA 4WPAA 3Q86A 4IH5A 1MN9A 1W7WA 2IAJA 2R2RA 4OIXA 2R8JA 2MJNA 3ISZA 1N32F 3ZZZA 3PJ9A 1FFGB 3MM8A 2AEJA 1RTHA 2BBEA 4MJKA 1K47A 2DNLA 2O3DA 3EPIA 3KK1A 1Y5NB 4ENOA 4FVMA 4BHQA 3DLLQ 4KGKA 2F63A 2MKCA 3HULA 3FFIB 2XY5A 4FN5A 2M8HA 1FRKA 1Y3KA 3PXGa 2HNDB 3CCLS 2OMLA 3W9HA 3ELHA 4CLPA 3A8IA 3CEDA 1LV5A 3FBCA 3OW2R 2YNIA 1LWEB 1HWUA 4CLWA 2G2OA 5J2NA 3W5XA 1D9FA 3TUPA 2BUNA 2OPSB 4IDKB 2YWHA 1YTYA 3R5DA 3EZOA 3NMRA 2JFDA 4USIA 2OSQA 3FJ2A 4NZ0A 4DV7F 5I3UB 2HHHJ 2YNFA 1Y3JA 4LF5F 1HQ2A 1MMLA 4EZ6A 2E1CA 1YIJS 1J5OB 1LWCA 4OX7A 1KFDA 1S1XA 4AL6A 3IRWP 2BOAA 2AEFA 4GVBA 5C25B 2B9YA 1QM9A 3E01A 2VV5A 2HFZA 1GMWA 4LVOP 1T9TA 1GX6A 1R8PA 2UXBF 1HQUA 3RB6A 4LBIA 2J9EA 4EYIB 3I4HX 4PZVA 4AL7A 4AYBD 2YPZA 4DV3J 5DETA 3FNNA 5T14A 3ILOA 4K7QA 1BQXA 2IM3A 2GIQA 1URNA 4UY85 2LXIA 2NYIA 3QPIA 2VQFF 5KT6A 4X64J 3UD5A 5HJYA 5K8OA 3KK3B 3SQGA 1ZYQA 2LQBA 3C46A 2Z30B 3GJTB 2Q6BA 4XPEA 5EX3A 4Z37A 1L5UA 3ENQA 2AD9A 3J80Y 3HHLC 1HYSB 2WVDA 4JP8A 2C2MB 2R7OA 1U24A 3E8OA 3ZZRA 1SPBP 4WXOA 2W4CA 2ZITA 1HD0A 3JQMA 3JS9A 3FCVA 4D3GA 2VFTA 3RAQA 1HBNA 2CQ3A 1VRTA 5KFKA 3ISND 1C0TA 5HK4A 3AQPA 2ZZMA 1N6QA 1H72C 3IWLA 4RUBA 1K1QA 3F41A 1XIQA 3R6GB 3D6FB 3DRRA 3CCJS 4IR9A 2MMYA 4UZBA 2JRSA 2JWNA 1M0SA 1I5OB 2YWWA 1WJ9A 2XMKA 5A0YA 4QW8A 2ZVIA 3AB2B 5KFIA 4GKJJ 3PV8A 5L1KA 4TYBA 1F5CA 1R0AB 3JYTA 2ZDPA 3N6LA 2V0NA 3NWGA 1TTHB 4YDDB 5HANA 4MKVA 1LW2B 2E1RA 1IKVA 1IR1A 1NMEB 2HBYB 2LA4A 2DNOA 4DV6F 5HI7A 5KFNA 2GGPA 3KDNA 1EKSA 4ANEA 2V2VA 3T1HJ 1VHFA 2EBGA 1B7FA 2KYZA 3TJ8A 2BANB 4O3QA 1NRKA 2B4UA 3H25A 1G4CA 1FJCA 3LPYA 4P2FA 1JQGA 4ZPTR 4FDFA 1X5OA 3KYLA 1IWGA 2AJQA 3M9MB 1MU2A 2G2ZA 2R7QA 4JI3F 1Q0NA 2Z4PA 1HNVB 4OI2A 4DOZA 2E1PA 3HD2A 5DDRC 5EDWA 1YBUA 2E44A 3J81j 4DR4F 1M1KT 3MPUB 3G8QA 3IAS9 1SJ1A 1R6YA 3FBFA 1DQAA 4ECWA 3FFIA 1FCAA 1SC6A 5AJ3F 1KR4A 4EU0A 2XLKA 2HNDA 1IUJA 3R7BB 4NA1A 4LFAJ 1ACMB 3EUNA 2WB1D 2MZ1A 1QUPA 4M8LA 2XLIA 1WC6A 3ET6B 3BZQA 1RWOB 3D67A 2PI5A 4EGLA 1LWEA 3AQOA 5HQ8A 1GMWD 2OFGX 2OPSA 4NXMF 3SFUA 4IDKA 1S9EB 4KTQA 3I55S 4UW2A 4YOEA 2H3EB 3J7A1 5G0RB 2HFSA 3ITHB 5L9NA 1PYOB 4Y34A 5I3UA 3V6HA 5HQMA 3D6TB 1T7PA 5KFLA 2UUTA 5M2PA 5KFZA 4C11B 1BY9A 1J5OA 2FPHX 1WC1A 4OHYA 3DRPB 2QN6B 4BS2A 2AYGA 3DOMB 3WIUA 3HJVA 4KO0B 5LXRA 2DNMA 4L6V3 5C25A 3GFXA 3OT9A 1HW8A 3HLUA 2Y1RI 4GO7X 1UFLA 1DTTB 4M5NA 2V8HA 2M0GB 3DLBA 4WP9A 2IRUA 3FSYA 4IH6A 2PEHA 3VAMA 5ETNA 4YB5A 4G1QB 4C3LA 4PPDA 1Q8KA 1FT8A 5A8RB 1BLUA 2ZJRQ 5LMUF 3KK3A 1S6UA 5HROB 2V4QA 2R3VA 4NLXA 3BGUA 1S1VB 2ACYA 2YWEA 1GNKA 4Q0BB 2AV5A 1X4EA 3M2RB 2B8QA 1HYSA 2K2PA 5KOWA 2CQ1A 3PYEA 1JLCB 3T5JA 3KNGA 4QIVA 1WKKA 2CNOB 2VF3A 3CJKB 1KONA 5I42B 2DIVA 3HSDA 4I68A 1RE1B 5KFFA 2N4DA 4H4KA 1JNZB 3PNIA 1H74A 2OH2A 2QA4G 1PILA 3K58A 2H9ZA 4QZVB 4BCAA 4A46A 1QAXA 3QRPA 4Q8FA 4OI1A 4Z2XA 3LWLA 2CYYA 2W2QP 3WZ0A 1RSCA 3K5PA 4LF7J 2CWKA 2W4PA 3G6ES 2FDNA 1S99A 1UL3A 3MAAB 5L8RC 2HVEA 1FTCA 3I56S 1R0AA 2ZH2A 4DHVA 2ZOMA 2HFVA 4PG4A 4RW4B 4HTIA 1LW2A 3NCQA 4HHHA 4DSIA 3FZBA 5H9EJ 1NSQA 2WVBA 4DUYJ 1VJWA 4IG3B 2UUAF 2UUCJ 2R7TA 4P71A 3W62A 1SJ4P 2AYEA 1TFWA 1WG4A 3SSSA 3TO8A 3M8PA 2QJ3A 2ALZA 2MQLA 2WVFA 5IC4B 1UVKA 4WTOB 2XC9A 2RQCA 3LO3A 3HHKA 1Q7LB 5GMEA 1S4FA 1TMMA 1YDLA 7FDRA 4YUDA 2DXDA 2H51B 5LM7E 4RR5A 2D3ZA 1HNVA 4RW6A 1XMQJ 2CQ0A 4UQGA 3HHLB 1S6OA 4I4BA 4P74A 2ZNYA 4MIBA 3JQKA 2ZBRA 2H5IB 1NK0A 2V69A 2FC9A 1RCOB 2YKPA 1WORA 4MYUA 4ELUA 1YZ6A 1XBWA 1SC4B 3ET6A 2LQ8A 2OPRB 2VIHA 1HNXJ 4NXNJ 2FGCA 2VHGA 4Y3CA 4C97A 1YBAA 1VQ6S 2Z2LA 2QYGA 2HQ3A 4EO8A 2GMHA 3RB0A 3QAUA 4LR7A 4DV0J 1YI2S 1S9EA 2FZKB 2BABA 2YKQA 3BO4A 5G0RA 1HNWF 3CCMS 3HSGA 4WCEQ 3ITHA 3P45B 3SDEB 3R27A 3HK2A 3RUBL 4NLPA 4OX8A 3RW6A 2NS1B 3TA0A 3VGUA 2OGUA 3MFHA 4C11A 1RABB 3DRPA 2CIMA 5CYMB 3IM8A 4OI4A 3DOMA 2IVYA 1R27B 1S1WB 4KO0A 5KG4A 1RT6B 2HG4A 1WD6A 3I5CA 2FJEB 2CJYB 1DTTA 3H98A 2HAIA 1GEHA 4ED6A 2MKSA 2JEJA 2W2MP 3TEGA 2Z58B 1YGYA 1FKPB 3G6YA 3W8GA 1X4DA 4U96A 3SXLA 2Z2YB 3NXZA 2F9DA 2CG4A 2CNNB 4FKYA 2DR5A 3PW0A 4ITSA 1UVIA 4ID8A 4G1QA 4DQQA 5EUHA 2XYGB 1JX4A 1N33J 4E8UA 4DR5F 4ANDA 1KLNA 5A8RA 4CYUB 3V6JA 2CDRB 2VG5B 3Q8UA 5HROA 4NEYA 5DDQC 1VS3A 3Q8QB 3L95X 5D0GA 1S1VA 3V6DB 4Q0BA 1RAHB 4RNNA 2W4DA 3M2RA 1ZS6A 3NGKA 2VBYA 3L7OA 4KSEB 3OUYA 1VHIA 4KY3A 3GV5B 1T11A 1HHTP 4EZ9A 4J9SA 4KGMA 3CJKA 1KP6A 3VQSA 3QMQA 5I42A 3IFEA 2H48B 3LTOA 2C3MA 1YVFA 2QX0A 2HHXA 1QDUB 3M4XA 3RYLA 3H0PA 2RF2B 4CLLA 4C98A 1X31C 4KHPF 2VQEJ 3PFEA 2BE7D 2GHPA 3M2UB 5CH7B 5CYQB 1R7IA 4WE1B 2GZOA 3MAAA 5KFSA 2FD2A 3W2WB 1FDDA 2GNKA 3AD9C 2DJWA 1NU4A 2C2DA 1WG5A 2HBQB 1WI8A 2FLNA 3NCPA 4JV5F 2PD1A 4IG3A 4Y65A 3MURP 2BJ7A 4L76A 5KFJA 2UV8G 3H2LA 5AT1B 4ATNA 4NLDA 1Q79A 4RBVA 1NHVA 4FYXB 3T1AA 3OR1B 4KRWA 4KQZA 5EWGA 1VIXA 3QT7A 4DR2J 1N5SA 2C3YA 4QWAA 4YS2A 3Q23A 3UVJA 3IGNA 4K50A 1KTVA 5KFPA 4DR1F 2RDJA 1LXJA 4UOFA 1RHRB 1N88A 1U0HB 1Y9OA 3G86A 1Y0HA 5K5MA 2DRBA 1O6XA 2U1AA 3CF5Q 1QSLA 2H5EA 3RBDA 1JLBB 1PC5A 2RUGA 4FBTA 3GV7B 1OJ4A 1HL6A 2OPRA 3MAHA 2Q66A 1M5PC 2DVIA 4JI0F 2DGTA 4X4UA 4F4ZA 5L1LA 3NS7B 4JI7F 3VR1A 4B08A 1LEOA 1HR0J 4DPXA 1RT7B 3I9ZA 1LWFB 1EJ7L 1VQ8S 3G71S 2F3JA 1FE4A 4UZCA 1RT3B 1GQEA 3KUEA 2DY9A 1XQIA 2YKAA 3A8EA 1SUQB 2A18A 1LOUA 1W25A 4DX6A 5C2GA 5KT2A 5CYMA 2L9NA 2SXLA 5CA5A 1S1WA 4DFPA 2KFYA 3NS5A 1RT6A 2EFPA 3H2VE 2KO1A 4IOBA 2YNGA 1FKPA 5F0WA 2JLEA 4WYWA 3NWRA 4EEYA 3G4SS 2M8DB 3MWBA 4RWWA 1FXLA 2N7CA 3DYAB 2A6OA 5A8KA 3AJ2A 5F3ZA 3ZZTA 3FMWA 1NJYA 5MLCV 1L3TA 1RZMA 3BH7B 2K8GA 4CYUA 2VG5A 2XO6A 3QJPA 4O44B 3UQSA 4DEZA 3T5HA 2IVMA 3TZXA 5LSRA 3V6DA 1VQOS 2B9WA 1CLFA 1KBRA 4ER8A 2PA3A 4L3NA 4MKBA 2A6MA 3PVXA 3AJDA 3N28A 8AT1B 4K4SA 5F8IA 3QIPB 4U7CA 3GJQB 2DTJA 2F8EX 5JMNA 2CNKB 1KVKA 1DLOB 3GIMA 1EP4B 5C5JA 2CG8A 4JI4F 4QWEA 4OZ3A 4O4RA 1CBKA 2RF2A 1KTQA 3W2VB 3M2UA 1BQNA 2IA0A 3J81Y 5CYQA 3RR7A 4JI2F 1TVRB 3IN5A 3QATA 3VVTA 1KEKA 1PKUA 3Q83A 2XYHB 4QWDA 2MKYA 3W2WA 4ED8A 3J7Z5 4PRFA 2QZ8A 4M5JA 4P10A 4A8YA 4PWDB 3HHLD 2HWHA 1S57A 3G2XA 2OEJA 3K89A 5DS7A 1VQYA 2KYXA 3SMZA 4GC6A 1KFSA 4YHHF 1LK5A 1OYEA 2XS5A 3WBZA 4DQIA 1LWXA 3BKTA 1CVJA 4B9MA 2ZKTA 4LF9F 1RK8A 3K5LA 2ZH9A 3RZAA 2AJFE 2DNKA 5D4LA 4QOTA 4RUCA 3D68A 1RAFB 2E7XA 2AX0A 2BKNA 1KQFB 3OR1A 5GAHU 4LRAA 1VMBA 2ASDA 2B6AB 9RUBA 1FRMA 4ED3A 3TZZA 2F5GA 1HBOB 3PX4A 1VRUB 1XMOF 2ACMA 1FK9B 5D4OA 1U0HA 1WOSA 3R5GA 4X2BA 4DQRA 4ZPAA 3OD2A 3R6LB 3THPA 4G1IA 2J9DA 3BR9A 5M2RA 2NSCA 2D41A 1M5HA 4PG7A 2YH1A 3AOBA 5KFCA 1S49A 3QT5A 4DPTA 4YMEA 1REVB 2VL1A 1FNXH 3FEXB 2RHQB 3KLGA 1VQ9S 3B6BA 5DZ6A 2AT1B 2DRDA 2LA6A 2GW8A 5BR8J 1G3OA 4MFBB 1KWMA 3NGSA 3HVTB 3OSNA 5JUMA 7AT1B 1SQFA 1PJ6A 4ZPCA 1FRLA 1LWFA 1WHXA 2DGWA 2YQ1A 1FHTA 4PG6A 4NWBA 4X62J 3N0VA 2C2EA 2WW8A 2IVFB 4QWBA 5KT7A 1VC0A 3PRDA 5DLFA 1RU2A 1PBUA 4KIAA 3F0NA 4OZNA 1IXKA 3MCSA 4USHA 2DT9A 3P8BB 1RHMB 3RAXA 2NXNA 2DGXA 4QW9A 1TP7A 3T5KA 3MM5B 4E0DA 4JI5F 3QLHB 3D1HA 5B0GA 5DG7A 3PIPQ 2UU9J 3PKYA 2KJWA 3CO9A 1B64A 5HP1B 4C4WA 1NK8A 3UW1A 1S1TB 4H4OB 3ZNJ1 1QAJA 2W24A 4NCBA 3NKYA 4FZVA 2WBMA 2KVIA 2P2CB 1IBMF 4O44A 5BJRA 3R8YA 4K0KJ 4YB6A 3KHGA 1TL4A 1BQMB 3VF0B 3CMES 2VB6A 4AUKA 2VFRA 2J0WA 2JHEA 2DR6A 2HYIB 3M30A 2YPYA 3RR8A 3ZTPA 1ZZNA 3Q8PB 3NGRA 2U2FA 3D6MB 5KG6A 4M5HA 1EP4A 4RKUC 1KRPA 3V4MA 5AXMA 1YLXA 3CCES 3CJSA 3OV7A 4C0OC 4USKA 4PCQA 2OEKA 4M5DB 1ZM3A 3W2VA 1A9NB 3TVYA 3TAMA 4ECXA 2XNRA 3CO0P 3QYYA 5HVHA 1RAEB 4A4JA 3S1TA 1TVRA 4HR2A 2MQMA 2J8AA 4J9PA 1LK7A 3QGIA 2CXEA 4I64A 1FJGJ 3Q22A 3EMTA 4DUZF 2MJUA 3UD4P 4BC9A 1NUEA 4JV0A 2DNZA 3MPVA 4CNYA 4OYMA 4N7TA 5D4PA 2N7YA 4CO2A 2D3O1 1SB6A 1G7CB 3TJ9A 2DNQA 2HQDA 4F4XA 2YQ3A 2Y8WA 3WDOA 2WSFC 1N54B 4P2MA 3SEOA 2AMCB 4XAKA 4TLRA 4DV5J 3AXKA 2D3UA 1J2VA 1N34J 1F3FA 4NCGB 4C8KA 2DPJA 3H8YA 1HBOA 3M05A 3A1YG 4FF3A 2WVCA 4ZVRB 1FK9A 1FEHA 1HWKA 4KHRA 1CULB 4DV2F 3QRRA 4OJGA 2I1RA 4MIWA 1VK3A 3QSIA 4DSJA 1H2VZ 3DC2A 1ULRA 4I0WA 1CC7A 3K7RA 3M9OB 4X4OA 1ZAVA 1FRJA 1REVA 5KFUA 3LOUA 3GIRA 1PGZA 1VYAA 1VQNS 2GAHC 4JYAJ 3A3NB 3QO9B 4ZN1A 4W4MA 1QTMA 4B9LA 3LALA 3N79A 2RRBA 3N5BA 2O66A 2QL5B 4A8QA 1YHQS 1IR2A 3R9LA 2LQ5A 4I6WA 1K73T 3LP0B 1HPZB 3A13A 3H5YA 3HVTA 2QGFB 4LSZB 4PPZA 4F67A 2Y3YA 1M5SA 4QJVA 1SBRA 5FJ4A 3GJRB 1NB2A 4DMZA 2VD3A 2M88A 2B4PA 2FHMA 3MFIA 3SCJE 3ENVA 4X4QA 2ZUAA 4X66F 1J5EJ 3MM5A 3QLHA 3K5NA 4F2RA 3I5BA 3IAM9 3MTJA 5HP1A 2XSFA 2UXCF 1S1TA 1WHVA 2MZTA 4BBYA 4EI2A 4F0HA 5HMXA 3IR7B 4E98A 3BO3A 3W61A 4DLEA 2WB4A 1WSRA 4QIFA 4W98A 1OIAA 4IR1A 3HJFA 1S6QB 3GJSB 4B3RF 1FDBA 3T9ZA 3UFCX 1HW9A 2XGPA 3UE2A 3MR5A 2PA8D 4KV8B 4ZVFA 2D9PA 1CJTB 4OHVA 3K57A 2BDPA 3GILA 3LGNA 3T1YF 1T02A 2QA1A 2XY7A 5LJ3Y 2MKIA 5LSOA 4Q44A 3SBMA 5FD1A 4H54A 2BJ8A 2AW0A 4QR1A 2CVEA 1Y4ZB 2R7XA 3GR0A 1T05B 3NGUA 3RBEA 4M5DA 1Q8BA 2E5LF 5F9LA 4DXLA 1ZA1B 3ILJA 1HNZF 5CQGA 4DL3A 4Q2LA 2CPIA 1FRXA 2UVWA 3TJAA 3BBFA 3A8KA 5LMNF 1ZAWA 2YWGA 4C0HA 1NH8A 3NGTA 4CH1A 2F8MA 3W65A 1CJVB 2VG7B 1ZM9A 3ULHA 1U1OA 3QAEA 5IT0A 1OY9A 3GCWP 1KD1T 5ETOA 1E6YB 2GMLA 3ZZOA 1BWEA 4F36A 4P9SA 8RUCA 5U47A 2MLYA 3SCIE 4A8XA 4NI2B 4N41A 5CABA 4BWJA 2HVHA 3POTB 3JTOA 1YJ7A 2C2KB 2BYCA 3MD1A 2HVZA 4NCGA 2J7UA 4V19X 2HQCA 3JTPA 3HVRA 1N48A 4ZJOA 2PE8A 3KJVB 2DNNA 3HHEA 4NLYA 1QUVA 1N32J 3VAJA 5H1SV 1CULA 1O5JA 1UPPA 2RQMA 4WIQA 1FVQA 4RNFA 3HM9A 4DX5A 5J2PB 1TZ0A 2CZVC 3CCTA 3KDOA 4ID5B 4ZOSA 2AJ1A 1RHUB 3H2UB 2BR0A 1HBMB 3CIMA 2G1DA 3GYXB 3R3TA 3N9UC 1N8RT 1Q8LA 1X4AA 5DQIA 3IXQA 2OUGA 4XDDA 2W7AA 2IM0A 5F9NA 4EBCA 1NJXA 3D54A 3LP0A 5D78A 1U26A 5DG8A 3MOJB 2CJAA 3UD3P 2W9AA 5HBMB 2GVDB 1D0EA 1QVFR 2XG8A 4EUVA 2VJVA 1FDNA 1RHQB 3K2YA 1RTIB 1P27B 4NCAA 1BGXT 4LRCA 2XQCA 3IS9B 4M1KA 1B99A 4J9OA 3PTWA 4RO0A 3NCRA 3CMQA 2FUG9 2KN4A 2W9CA 4MH8A 1Z1ZA 1HBUB 4M5GA 3K5MA 3IR5B 1HLWA 2VG6B 1EKRA 3NAHA 5CYJA 4USUA 2HGNA 1UVJA 3VGTA 3S01A 2KL8A 4LF6J 2POKA 3AT1B 1U09A 4IFYB 7FD1A 5GADU 3F44A 1S0OA 3OXGA 3HP6A 3K5OA 2I5JB 4WP3A 5E3QA 1Y7PA 4NL5A 5KFTA 2B7CB 1OPIA 3IGVA 2ASJA 2VODA 2HIQA 2CJQA 2QLFB 1S6QA 4QU7A 2QEXS 5FIIA 2FJXA 3DXBA 2CQ4A 4LF8F 4NYPA 4KV8A 2HQGA 2A1BA 1TKZB 3OVAA 2F40A 3UDLA 1K1SA 4ALZA 2MKJA 2DYAA 2GQ2A 1NDCA 2N3OA 1N5QA 4FBUA 4Q2MA 3GIIA 4J9LA 4ZLJA 1WI6A 1HMVB 1U7LA 1TUWA 5F41A 3QIDA 4GKJF 3W3SA 5KFQA 3QQCD 5IT9U 1T03A 1NLKL 4QYRA 2FVPA 4PXDA 5KG5A 4DX8H 1TFYA 3MGJA 3MMBB 4PYDA 2I9SA 2VH7A 5G4DA 1U47A 3OR2B 2ZH5A 4ZN3A 3CJ8A 1Y00A 1I94F 2M70A 4RU9A 3M1VB 2A3JA 2ZKUA 2CZ9A 1KVJA 1CJVA 2VG7A 2QMWA 4OZ0A 2DHGA 4C8LA 4ECYA 2DNPA 4EWTA 1E6YA 1Q95G 2QRRA 4JV1A 4LIRA 4OZ2A 2G2YA 1WSVA 4A48A 4PXBA 4DR7F 1XNQF 1HI0P 4DV6J 4ECQA 4NI2A 2XMTA 2XMVA 4OYAA 4TXSA 4CLSA 2RT3A 1ROFA 2CPXA 2VUGA 3FC9A 4ZVSB 2XZDB 1N56A 5EHHA 3UDEA 3KJVA 2UUWA 2LYVA 3NOGA 3C66A 4OX9J 1X9WA 4AXJA 4JUZA 3H42A 3VAIA 4OHWA 2EEYA 1VBZA 5J2PA 2UUBJ 4FXDA 4ZLNA 4K4YA 2QE5A 5A2QU 1HBMA 4ZP6A 2ROPA 2R8KA 4HDGA 1LQ9A 3AOCA 4IKAA 4QIEA 2GAGC 1IR0A 4DR4J 1S0VA 2PMZD 3KHLA 3FBEA 5AJ3J 1NNDA 1URRA 1CJUB 5DO2A 3H5XA 4A8WA 4FYYB 2AZ3A 1U2FA 2F4VF 3R5BA 3KXDA 3JAMU 5HBMA 2GVDA 2RE1A 1CQMA 4F25A 2HZAA 1ZAXA 1RTIA 3TVKA 3FVYA 2MLXA 1RUSA 4I69A 5HATA 4WFNQ 4NXMJ 3IS9A 5C42B 2HLTA 3CB4A 3ADAC 3PIOQ 2J9CA 3TQEA 2NR0A 2R7RA 4NMXA 1RT5A 1HBUA 3ZTSA 1U6FA 4J9KA 4MK7A 4DU7A 2V8VA 4B17A 2P8IA 2ZE2B 1VFJA 1WOOA 3SCLE 3LH2S 3KLVA 1MW7A 1SL2A 5LXYA 3K0JA 1C4CA 1S1UB 4IFYA 3DN9A 3GCXP 2I5JA 2KRBA 4RUHA 3DLJA 2VFSA 2J9DE 3PCOB 2V2ZA 3TW0A 3MEGB 3FBBA 1YJTA 5ADZA 4JI8F 5E2QA 4KGZB 2PEBA 4HVZA 3BN7A 3KG4A 4KJIA 1KLMA 2DNGA 3LQVA 3LW5C 1TKZA 4ZP7A 2X51A 2XMMA 2W9BA 2Z8QA 5LMUJ 1JLQB 5HN0A 2V94A 2L08A 3C14B 1RAOA 5GVQA 2QFIA 3OVSA 2C1EB 5BXIA 1HA1A 4CO4A 3KHHA 2XEXA 2NXUA 4V1Ak 4F02A 5I4MA 3BYRA 4IQMA 4WF9Q 1HMVA 4LF7F 2JC1A 4OYIA 1YJNS 1S4EA 3BN4A 3T41A 3BBCA 1UP1A 3GYGA 3LP1A 4TLQA 2NXCA 1J27A 4U95A 1UEVA 1PSDA 4F4KA 2B43A 2FZCB 1HKAA 4LJMA 2J76E 4DFKA 2KZZA 2QG9B 2RSQA 3OTEA 3MMBA 4CIOA 1UVLA 1N0VC 2HHTA 3TAQA 4DUYF 3CVKA 3JTNA 2HWTA 3HO1A 1OO0B 3OR2A 3VHQA 2EK1A 1UWAA 4G1PA 5B0BA 2ILYA 3OXLA 2Q6CA 3UNGC 3LAKA 1KVIA 4I1TA 2YX7A 1F3VA 2DCLA 4ZPVR 4IUFA 2E7WA 2EKNA 2ZD1B 2LFVA 2ZBIA 1JJCB 1YWXA 2IC3B 1P6TA 4P52A 1XMQF 2OIHA 3UO0A 3ILLA 2CRLA 1PJ7A 1UEKA 3VAFA 2JC0A 3ZZYA 3BO2A 4N56A 4YP3A 4DQSA 2HRYA 5F3TA 2EFVA 3I31A 1RAGB 3C2PA 5DJBA 4PXCA 1RLCL 1SJ3P 2ZOFA 3EGNA 1MNEA 3D0IE 2R42A 4B02A 3ETMA 3Q8SB 1JIHA 1U0SA 4J91A 2LEBA 3PG9A 4J90A 4NXNF 4Y2AA 4XIUA 4CP5A 4JI1F 3M9NB 5M2UA 2HQFA 3SSQA 1IKXB 2PMWA 3DRYA 4DV0F 2IFXA 1T95A 3OQ2A 1RADB 3FUYA 1DFDA 4U8VA 5J1NA 1VBYA 1CJUA 3S6EA 1FRHA 2LDYA 3I0RB 3GLJA 1APSA 4JI6F 3BPSP 2JNJA 3BBBA 4RW7B 3PHTA 1P9YA 4M5MA 3E2EA 3PJWA 1GTEA 3RGIA 2HMIB 1K9MT 1TU0B 2DH7A 3TRGA 5C42A 2CPHA 4DSLA 1S97A 2RIJA 3D4JA 4R5PB 3CMAS 3NNAA 4HTJA 1F9HA 4NLUA 3RBXA 1S5ZA 3PJXA 5AE1A 3I0SB 2PMHA 1RACB 4K5RA 4ICLB 2IBKA 2WAQD 2ZE2A 3BYPA 4AD6A 3VAHA 2L3MA 4QCLA 2HHPA 2Z57B 5RUBA 3OJSA 3TAPA 1S1UA 2LEAA 3MPDA 2KG1A 1X4HA 1S0MA 1N33F 3N01A 1SKSA 3KUGA 4LBHA 4X4PA 5CHCB 2V8GA 4GKKF 1FTRA 4R25A 4KB7A 5DQHA 4NA2A 3TUZC 3MEGA 3DLKA 2J0QD 2AP6A 2R2SA 2QYCA 2WZ1A 4RX6A 1RKIA 4F4AA 1OPZA 1RHKB 4PWUA 2XWYA 2R7SA 3DDNA 1N0UA 1IJFB 4IO1A 4OV6A 1E6VB 4EBEA 3CT9A 1AFJA 4PQAA 2ZH3A 3DRXA 2FVRA 4DR5J 2UZAA 2HFNA 4JOUA 1SH3A 1JLQA 1HQEB 5E3CA 5ETPA 1PYSB 4C7QA 4LF4J 5E5NA 5KG7A 3BKUA 2RUSA 3ILIA 2BA9A 1RT4B 1M5OC 4HT7A 4HHJA 1IBKF 5IV3A 4DL5A 2W7PA 2B8PA 4CTAB 2YBVA 4CRJA 1GAOA 4R8UB 1T3NA 3H5SA 9ATCB 4NE9C 1CEZA 3RAMA 1UMJA 3TI0A 3LPEA 1QSYA 4YQWA 4CO1A 3W5YA 1XEZA 1NCLA 1RDRA 4J9VA 3ZNUA 2MQ8A 1S9GB 2BJDA 2PGCA 3T3FA 2GMJA 3MAQA 2ZEJA 4KPCA 3CD5A 1VISA 4ZCMA 2XTJP 3HZGA 3QRQA 4HEA9 3ZFVA 2VONA 2G13A 5ITHA 4F0MA 2ZHBA 4OYZA 3MEDB 1FFWB 5ETRA 2ZD1A 4QR2A 4LRFA 3DHWC 2D7SA 1OY8A 3K17A 4DR2F 1N5VA 2DXEA 4DV1F 2IC3A 3OBIA 1XK8A 3V2UC 1AFIA 3KLEB 1VR6A 4ZVTB 2DIUA 3BF4A 3M6VA 1N4LA 2C42A 2FY1A 2HNYB 2VPWB 4BWMA 2ASYA 1SH2A 4OYXA 4ZIWA 3PYDA 3ICLA 3WX8A 3BQ0A 3H5UA 2E1MC 2DGSA 1S76D 2G0IA 2VZ9A 2P9GA 3TA2A 1YJWS 4YR0A 3CTRA 2KDOA 1VIOA 2GCFA 4DL6A 2E5JA 2QFJA 3PACA 3G9CA 1RWMB 1EB0A 1OQ6A 4DR1J 4NX9A 1YZ7A 2HHUA 1IKXA 2AJ4A 1T9YA 2DXFA 3CCSS 1HR0F 1XR6A 3TQ1A 4MKYA 3KOAA 1NHUA 1DHMA 2DHXA 3I0RA 3H4BA 1OY6A 1UKUA 1XNRF 2ZM6F 3BQ1A 4RW7A 4X4NA 1DY3A 1FD2A 4JI0J 1OQ3A 3B82A 3NL0A 2B0GA 2Y0BB 5D77A 1B3TA 3C15B 3PRBA 3PFOA 4O3SA 4MMOA 3FSXA 1RI7A 4RPFA 1M1HA 1ZH5A 2CJ9A 4WKRA 4ZJLA 4R5PA 2CPZA 2Z0GA 2LXFA 3BQ2A 2HLUA 1WTBA 3I0SA 1C1BB 1DTQB 4HKQA 1SCJB 4ICLA 4HACB 1VQKS 3X3UA 2R9LA 2ZVSA 4DG1B 2WCXA 2MB0B 2NZCA 3KKFA 5CXTA 1FEEA 4ZCLA 2C2ZB 2ZC4A 2E66A 5KFRA 2J8SA 3CC2S 3M8WA 1UJ5A 2OD4A 1BWVA 2I8EA 2D1CA 2JVOA 1N52B 2RKIB 2UV8A 5CD4A 2XS2A 1HD1A 2PDAA 4PG8A 1DZ5A 4XPCA 5FLXY 1E6VA 3GQCA 3MMJA 5KT4A 2LLZA 3A3PB 3J7AN 5KT3A 2D69A 3OL6A 4HI2A 1IM6A 4MYTA 5F8GA 4M94A 3CD0A 1HQEA 1RAIB 4C8YA 3W1YC 5F0UA 3CJRA 1KQKA 5F8JA 1X4BA 4NPOA 3TA1A 5DG9A 1HWJA 1RT4A 3R7NB 1TUVA 1FRIA 4CTAA 1SI9A 1NPPA 1VCTA 4WFXA 5DDOC 4ILLA 4C8NA 2JLFA 2ZC3A 1SVDA 2HRTA 1H7WA 2PIIA 4JI4J 5IFMA 4GVLA 4ZLLA 2CFXA 1OSCA 4UQTA 1FF2A 2M52A 3EM1A 2VOOA 2KJVA 2CA9A 2JVRA 4P7VA 3MM6B 4U7UD 4RW8B 4N76A 1U49A 3CIZA 2JEFA 2HK2A 4HHUA 1RT1B 1VRQC 1I3OB 4DV4F 1LXNA 3PO5A 3FCHA 1AUDA 2DHAA 3MEDA 3DGPB 2J6UA 2EC0A 3M2VB 2UP1A 5BYQA 2V8DA 2NLWA 1REGX 2XGQA 5L1JA 3RB4A 3KLEA 1V3RA 2A2DA 5CCLA 1AA1B 3AD7C 2HNYA 2PSZA 1AROP 1UFWA 2OI2A 2J6SA 2AQ4A 1RWWB 1BUXA 2NYHA 2FQQB 3KLHB 1QVGR 1MROB 5IC6B 4ZVGA 1UZDA 3OHAA 1RYSA 1NB7A 2EBEA 2VOPA 5F8NA 3MR6A 3LANA 4ED0A 4ZCIA 2L48A 3IO1A 2BVZA 1JNRB 3AXMA 3GYNA 4DZ6A 2QC3A 4FXVA 1NEEA 1F2HA 5BR8F 4QQBA 1PAUB 1ZTWA 3M8QB 4ED7A 1ZTTA 4CM0A 2DPIA 1WKJA 1WEXA 3G96A 3NS6A 1JXLA 2ZBPA 4K59A 3BDPA 1UW9A 3D0HE 3N5FA 3AA9A 1CJKB 1YRUA 4DFJA 4FYDA 2F8HA 2LVWA 2KFZA 3C15A 2XCAA 1AXQA 1RGVA 1WNEA 1HI1A 3W64A 1NAQA 3GP9A 2OTJS 1QJHA 4OYBA 2UU9F 3GIKA 2M2BA 2H1YA 2VKZG 3R5JB 2V5HG 2W8KA 1C1BA 5C24B 3E51A 4P75A 1DTQA 3TX8A 3QGGA 4LR9A 3RB3A 5ETVA 2J7KA 2O1PA 2GO8A 3QZ8A 1UCNA 4DG1A 1D3WA 4K4TA 1R0CB 1GK8A 4UOGA 5A8WB 3G87A 2VDIA 1QTNB 3R1LA 4N47A 4JI5J 2FC8A 3MCOA 2OEMA 4NLQA 2RKIA 3I82A 1T9WA 5KFGA 3BDEA 1BD6A 4DL0C 1B0VA 4C6AA 2BX6A 3FCWA 5GAGI 1A0OB 2C2RA 2C2OB 3UCUP 3D66A 2NUUG 4M5IA 2M3DA 2BANA 4DL7A 1VQ7S 4TNOA 1BMQB 1ZPWX 3MEEB 5EWEA 3EICA 2JJ4D 3KJQB 2VBWA 3HF5A 1U2RA 4LIWA 1IBMJ 4Q7AA 3I5AA 3PR5B 2G0JA 4D3HA 2B4VA 1ICEB 1S7IA 3P5BP 4RZRA 1Q53A 2DR7A 5CZXA 2MTLA 3AH6A 4TU8A 5DGBA 2KB2A 2YNHB 2EFNA 3T5LA 4QU6A 2DKOB 2FHOB 3V81B 3IG1B 3BV8A 3WQPA 3QT8A 1RAAB 1U1MA 3EXYA 4CLFA 4IOAQ 1FNOA 2MQNA 3MM6A 1BC6A 4Y2KA 4GC7A 4RW8A 2R7VA 3JXOA 1UZHA 2NPIA 3CJQA 3RRHA 1RT1A 3C6UB 2EK6A 2VPZB 3ZZUA 1F9FA 3NG8A 1JLAB 4P72A 4QYZJ 1MWYA 2FJWA 4USWA 4WFYA 5HMZA 3SCKE 1K8AT 1TL1B 2ATCB 3ZZPA 4ECSA 3DGPA 4CLTA 5K8NA 3VZHA 4DV5F 3M2VA 2V50A 1Q5YA 3SYZA 1H73A 1U2CA 4KHMA 4FF4A 2CPEA 1X9SA 3UPFA 2FHKA 3P5TL 4CO5A 3K59A 2X3DA 2CPYA 5IM0B 5KFWA 2BZ2A 5D0EA 1D1UA 4CLKA 2AGQA 3KLFB 4PYAA 3US5A 1RBLA 1S7HA 1MROA 5L1IA 4I56A 1RTHB 1WHYA 2XHCA 2YX4A 1RWKB 3CJ2A 1EZZB 3KK1B 1IVZA 3D2WA 3EXCX 3PKMA 3DLEB 3B8HA 2EKYA 5J1EB 2YH0A 1Q1KA 4ECUA 2MPUA 4KE5A 3A8JA 3KHRA 1IBLF 3BGRB 2F7VA 2NUHA 5KG0A 1UETA 3DU5A 3M8QA 4C8MA 3WX4A 2E7VA 1S77D 1YITS 4TY8B 3GMGA 1NKBA 1U45A 2CQGA 3IBWA 3MEKA 2IM2A 3ZTQA 2XSJB 2FHJA 3GR1A 4RJVA 1GX5A 2GV1A 1JLCA 5KFYA 3BSCA 4J9NA 3OTBA 3WC0A 2HIYA 3HKWA 3IM9A 4H4KC 2HQIA 3J7YI 3MMCB 3UR3C 2L9WA 1K0TA 4RBUA 4Y2CA 1J5EF 2HHVA 3J81U 3W5ZA 2GJ2A 5HSPA 3PEJA 1KKHA 4EK2A 3B78A 4DFMA 5JVHQ 1S1XB 1WF2A 5C24A 2RDDA 2B5JB 3MF5A 2XLJA 4UY8T 2FLPA 2AJ2A 3GFHA 2X1AA 3M32B 4XDCA 2NQPA 1P1LA 3AAWB 1PIEA 5A8WA 2YY3A 3P96A 1N36J 1HQUB 1IWAA 2ZH4A 4QPTA 4RW4A 5K14B 4O3RA 1RWXB 3G6VA 4KKOB 4K5SA 1FKOB 3PX6A 2MQPA 3KJFB 4N77A 1I6JA 4K4WA 1JLGB 3DU6A 3HT0A 5BYRA 2L9DA 4RW9B 2HRUA 3N4WA 1JJ4A 4F3OA 4FXWA 2IJRA 3MR3A 1X5SA 2E9ZA 3AD8C 3ENAA 1HWIA 3MEEA 3OTOJ 1U6BA 5MAOA 1M90T 2WK4A 2EC2A 2HPUA 3PM9A 2EXUA 2FGOA 4CDIA 1MG7A 4J9MA 3TX0A 1RISA 2KFNA 2CQIA 4OHXA 3EDRB 3MMAB 3MUVP 1TQLA 3HHLA 2YNHA 1YBTA 4NLOA 3T1YJ 3C3LA 3UI3A 1KNZA 2HWIA 1MMNA 2E1AA 3OPKA 3V81A 3SI8A 2AGPA 3IG1A 3SV3A 1Z4UA 2GJIA 3CUNA 2DO4A 2YVSA 2FVCA 4V19J 4ERDA 2I2YA 2V34A 4CNZA 1U1LA 1WDTA 4RBTA 2G1HA 2KT2A 5A0YB 2OAUA 4KH0B 1XJWB 2ZDOA 4UUWA 1FE0A 1HNZJ 4FPRA 2YX1A 4P2SA 4HLBA 1JLAA 3IMQJ 3BEGB 4ILMA 1SXLA 4R0EA 5L46A 3R7SB 1NK5A 1TL1A 5CD4H 3D1OA 3CD7A 4ETZA 3SDEA 3FSIA 2VJUA 2QMXA 4ILRA 5IXUA 2VA3A 4KR0B 3M8YA 4F2SA 4N8NA 4NLVA 2CJXB 3CNQP 1NK7A 5LMNJ 4I2PB 2MKKA 2DBBA 4ZITA 4C8OA 2IYGA 2VICA 2JDJA 3CD6S 5IM0A 4F0KA 1VDHA 1IN0A 3MM9B 3IWNC 2WSEC 1RAJA 2M4MA 1XTZA 3ZXWA 2FHJD 3CDAA 3DOLB 3KNAA 4O23A 4L74A 4AQYJ 3KLFA 1S48A 1WACA 1B7YB 1MU2B 4IOCQ 5LJ5Y 1RB0A 3UN2A 4B9UA 1QY7A 2VFVA 5DM6Q 2AHOB 4ZIVA 2IRYA 1QE1B 2ZH8A 1NPRA 3OFFA 2J7WA 3DLEA 4WTYA 2NXEA 3RRKA 3GG1A 2AEMA 5J1EA 1NBEB 4P2XA 2V4JB 3LGHA 1BXNA 5EN1A 4X65J 3FRZA 2R8HA 2PC6A 3BGRA 3EDQB 4UF4A 2PFDA 4F8RA 2COLA 1GTHA 4TY8A 2W8LA 3GIJA 2AYMA 2XSJA 3P6YC 4OI6A 2B4OA 4LQ9A 2Z56B 5KAKA 1VBXA 1NZ8A 3T6BA 4I67A 3KFWX 3CJ3A 4OJ3A 1S12A 2XMUA 3MMCA 4NLSA 2ERRA 4ZPBA 1WHWA 1X60A 3L4BC 2YKOA 4E2FB 5IWAJ 2LQJA 2WBRA 3R2DJ 1FXDA 3AHPA 4F04B 2XMJA 4LF6F 3HFKA 2L41A 2KHDA 5T7LB 1U1KA 4DSKA 3MCNA 2C3UA 4YY3J 2B5JA 2K3KA 3TR5A 4HT5A 4DL4A 1VQSA 1TK0A 3BM7A 4WE1A 2Y1IA 3VGSA 3M32A 1S9FA 2RB7A 5D15A 3LP2B 1HIYA 3OTCA 2DCUB 4MK9A 4IRKA 2FVSA 2HS0A 1X0PA 1R8BA 1KC8T 1C1CB 3K8WA 4J37A 5K14A 4OMFG 1KHVA 2HURA 4KKOA 1C0UB 1Z2ZA 1FKOA 3T9NA 1FERA 1WDDA 1JLGA 3TNVA 1FWPA 5T41A 3ZZ0A 4CM2A 3LGMA 4AXIA 4RW9A 5I3PA 2VPXB 1NJZA 2VBZA 4LT6A 3MM7B 2V9WA 3PY8A 1Q82T 1VJQA 1CC8A 1WC5A 4F50A 4LF8J 3F73A 3EGWB 1X8DA 3MMAA 1AB8A 3PW2A 4YEAA 4JV2A 1YRXA 2P6TA 2BACA 3L9ZA 3VVUA 5HAOA 3H20A 5HL7Q 4KC5A 2C28A 4K4ZA 1JLBA 2ZHAA 1WC4A 3A12A 1OSDA 3K8VA 1GT8A 5GAEI 1AUSL 2HBRB 3OXFA 4ED2A 5EGYA 3O6QA 4ED4A 1Y5LB 4CT9A 2UXDJ 3KWMA 2E5IA 4WFZA 5B0CA 5HJXA 4DPWA 3IBFB 4U67Q 1ZPVA 4OFZA 2I6WA 2XO7A 4O3PA 4G3IA 3CDEA 1RT7A 1YRTA 1VQMS 1NSPA 2QL7B 2VASA 1WC3A 4CWBA 3U1LA 1RT3A 5K9FA 5AE2A 2M5YA 4I2PA 3DI6B 2Y9HA 1I94J 2XI2A 4IH7A 4DUTA 1SUQA 4ED5A 3HI9A 3M8PB 3EGZA 4WZQA 1VC6A 3MM9A 2EVZA 4LR8A 1WC0A 3NGDA 2XYPB 3DOLA 2R8IA 4A8MP 4MT1A 3EZUA 4K8RA 2KHCA 2GQCA 5CZVA 4OX9F 2W25A 4MKAA 3GONA 1W2IA 4MAKA 1T9UA 2HAFA 1XR7A 3GU0A 4DR7J 4DJBA 3TVZA 5KFOA 1XNQJ 2UUBF 4RW6B 3T19A 2LECA 1QE1A 2G9OA 2B3TB 3CJ4A 2CQ2A 3LWMA 3DYAA 2PFFB 1S72S 2MSSA 2V4JA 4ECTA 1PG5B 3PX0A 2KTQA 2DRAA 2C3PA 1RXOB 5GMKa 1HNIB 1GMVA 4DR6J 4Q8EA 3PR4A 1HWLA 3ENWA 3DCAA 5IQ6A 1NH7A 4FPIA 3LF0A 2I38A 2IBOA 3MI7X 2NPFA 2IJFA 1VI7A 3KLIB 4OV1A 1OMSA 4RWXA 4X84A 5B0EA 3QIPA 2W7OA 1R43A 3AOAA 1JJ2R 5J2QB 2ZFHA 2HHSA 2EWHA 1V6HA 2WOMB 1O51A 1DLOA 4AFFA 4O4GB 1RWNB 3QT6A 5D0RA 2F4VJ 1DJ0A 1TL3B 3FQKA 2VA2A 1CSJA 2O5DA 4B3MF 4CI0B 3VZIA 5T7LA 1RWVB 3L7PA 4M5KA 1RHJB 3EYZA 2GQQA 1R8AA 2LCWA 1A6LA 3EVOA 3S7RA 2EFQA 1RBOB 3LP2A 3T6JA 4LFCF 1AW0A 2LQ9A 3NP5A 2MQQA 5DDPC 5AXNA 1U25A 3D7SB 2VBXA 3GB0A 1C1CA 4PWDA 4LUBA 1C0UA 4CT8A 3L09A 2R7WA 2DNHA 4ES3A 2E5HA 2Y8YA 2HKEA 3CJ5A 4DPYA 2DH8A 1TELA 1L3SA 3NAIA 4RNOA 3D3CJ 4IG0B 3WHIA 2MXYA 3JB9k 3QZ7A 4Y00A 3NLCA 2VC0A 4LQ3A 1GXTA 3OHBA 3MM7A 3HFVA 2KG0A 2OO4A 3U27A 4JI8J 1F60B 1JJHA 2O67A 1YJRA 1IQTA 2B6AA 1EETB 3OUYB 4RNMA 4P6QA 1NM2A 2X1GA 1VRUA 2P6SA 3WIVA 4ETXA 1ITPA 2K7JA 3DHXA 3CDWA 4UUXA 3EX7B 4LFBF 4TKTA 4ANCA 3HPOA 3GG0A 3TZYA 2BOPA 4WFAQ 1EHWA 4B3SF 3W7BA 2GHVC 1RTZA 3CDUA 1SQGA 3VQTA 2RDIA 2DR9A 4ZCKA 2MQOA 3TANA 1NHKL 1FWKA 4UTGA 2K06A 4Y0FA 2JL9A 1M5VC 4FF2A 4Z7YA 4AT1B 2ROGA 1MLAA 1KQGB 2HS3A 4EFAC 4JB8B 4MFBA 1EX8A 3AA8A 4F26A 1DQ9A 1AYEA 1FJEB 4ES1A 4CH0S 2RMLA 3DI6A 3C19A 1WWHA 1GMUA 2CPDA 1FX4A 5HVGA 5ETSA 3Q24A 5ETKA 4R0JA 3MPWA 1WF1A 3GSIA 2CNLB 2VPYB 4MIAA 4WWSA 1XERA 3DRSB 5ETLA 1SQEA 2JSXA 4PAAA 3RJMB 4KFBB 3W9JA 1T3OA 3GFYA 2LDIA 3UVJB 3X1LB 4USJC 1TMJA 1RA7A 3MUTP 1RQ0A 4TQSA 2NREA 4H4OA 2HSEB 5LOQA 4QYZK 1O0PA 1MSWD 3DNCA 1ZETA 4WU3A 1JXEA 1HNIA 5E33A 5CCMA 2ZH1A 2DHSA 6AT1B 5B08A 2Q43A 1VLOA 1IBCB 2ZNZA 3I6PA 2YWFA 1WKLA 2YWKA 3AY0A 4Z7CA 2MY8A 4ECVA 1BQMA 2FLLA 2K7KA 5B0DA 4JI1J 4O0NA 4ZP8A 2EFOA 4CCHA 2DITA 3KLIA 2BW2A 5E7OB 4RNHA 2V8PA 4F4YA 3D6HB 5J2QA 1FDAA 4G65A 2WOMA 2DGVA 4O4GA 2XULA 2KH9A 1TL3A 5E41A 4JI6J 3CJTA 2DB1A 3IRXB 3I96A 3GZ7A 4WKYA 1HI8A 1N5YB 3C8YA 4DR3F 3DLGB 2XHWA 3UR0A 1KQSR 4GMKA 1NPKA 1QAYA 4K4XA 2BMBA 2D9OA 1OS5A 4Y2MA 3BPDA 5F8HA 5DZ7A 2IPOB 4B3TF 2YNGB 5KFDA 1DARA 1NDPA 2DEIA 2HW3A 4OQJA 1U02A 4FYWB 4BDPA 4USVA 1AZSB 5A8KB 4HDHA 1IM4A 2KT5A 3NMAA 4ZP9A 3FGVA 6FDRA 5EWFA 2OTLS 5KFVA 2CJBA 4IG0A 4DN0A 3VALA 2MHEA 2DGUA 4GKKJ 4EBDA 2JH3A 3ZTRA 2N3LA 4DCOB 2CQCA 2ZZTA 4LF4F 1VQPS 2QO3A 3QWPA 4N8OA 3OSPA 1D8ZA 4GO5X 2WVEA 2AGOA 3M8ZA 3UCZP 1EETA 5C7PA 3Q8VA 2ZHOA 4M5LA 1IQZA 4IFVB 4PG5A 4K4VA 1QSSA 1Y11A 2GHWA 3J7ZT 2KKHA 4CO3A 1UEUA 2DH9A 3F56A 1XR5A 5DGAA 3O2IA 4ED1A 3SQOP 1S10A 4M63A 3H7HB 3BSAA 1BQNB 5JJBA 2HHQA 3EVWA 2JZ5A 5LL6d 2YQ0A 3FDSA 3HFZB 1S6PB 1ZA2B 1IBKJ 3NY0A 1R31A 3MUMP 3BSNA 2B9EA 4I7FB 3QO9A 4YR2A 1NK4A 1VBKA 4CLZA 2MGZB 2HS4A 2HHHF 5D8HB 1SIZA 3LAMA 1UFKA 4DPOA 1HPZA 4YFUA 2IA6A 3EGVA 1GFWB 4OZ1A 3M6XA 1RKJA 3NBPB 3EZ5A 3V4IB 4Q5VA 3PYGA 3JSYA 1HHSA 4NLGA 3HXMA 1H2TZ 1LFPA 1U1RA 4J9QA 3W60A 5JXSA 1G6BA 2OJ3A 1Y5IB 4DV7J 4LF5J 4PR6A 1RT2B 3HVAA 1TL5A 2QV6A 3DRSA 2BJEA 4DV3F 2AU0A 2NSBA 4KFBA 1V3ZA 5E0OA 2Y1LB 4L75A 4DV1J 5K8PA 4LREA 4DS5A 3OL8A 4LBPA 3CE8A 3CWJA 1WEYA 2IRXA 4X64F 4OZJA 2ZWPA 2Q3PA 5IQQA 4DX7A 3KJNB 2IHR1 4X4VA 2ZUGA 1DURA 4DDFA 2QIFA 2UXBJ 1CQNA 3QWUA 2W1BA 4QPXA 1CG2A 2A0FB 2LKZA 5KFMA 3KLGB 3QFWA 4ZVHA 2V2KA 1CJTA 4ZVOB 1PC4A 2V6AA 2OLWA 2VQFJ 1T9VA 1B0TA 3VWSA 4ZJQA 1KHWA 1XN9A 1XMBA 3PDNA 2QLWA 2Y0SD 2ABYA 2WSCC 1DRZA 2DEJA 2R8GA 4QBUA 1YJUA 2H4YB 4WP8A 3CW2C 4RLEA 4FS1A 2Z2ZA 4UOHA 1QAIA 2BE9B 1T05A 1SKRA 3IRXA 4U9RA 3JSBA 3KG1A 1XNRJ 2J5AA 3N6MA 4L73A 2ZM6J 1N5YA 4B9SA 3DLGA 4KBIA 5F8LA 1NDKA 2OPPB 4K2XA 1P8GA 3LA0A 1AT1B 1X4FA 2DNRA 2M7SA 2QLXA 3MXHP 4B9NA 1Q4RA 5IS2A 2W01A 2KVQE 3SZ2A 3PO4A 4FNIA 3TUIC 2WTFA 3SIPB 3KTQA 4FKXA 2I0XA 4IQXA 1JLEB 5H9FJ 1AZSA 3T1HF 2CUYA 2WRMA 1EQ0A 3OJUA 1FNMA 2AJ0A 1RTJB 2PT0A 2RU3A 3UN5A 2OHDA 3RBZA 3IR6B 1RCXB 2ROEA 3RTVA 1RWUA 2F4FA 2KM8C 1H3DA 4LMZA 3O5TB 3CJ0A 3POTA 2OMOA 3M30B 2XMAA 4IFVA 3TEHB 1RYRA 1L3VA 4LFAF 3UWTA 2UVVA 2RU9A 3HT3A 2V2QA 2GJFA 4JI3J 4GRSA 4XO0A 4ID5A 2BXJA 3MCMA 3TAMB 5IV4A 1S6PA 3P3DA 3DFEA 3HDSA 5KTQA 3G8SA 1M1GA 2C2NA 3D1QA 3HVWA 4I7FA 2KU7A 4AL5A 4N5SA 2X1FA 1B0PA 2MGZA 3R2CJ 4Y6IA 1F0XA 3RW7A 1NDLA 3MR7A 3OLBA 4Y2IA 2IDLA 2ILZA 1UVMA 3BKFA 2W2OP 2HFOA 3HZEA 4NOHA 3NBPA 3V4IA 2XI3A 3DLHA 3ZC4A 1RLDA 3JSMB 3GWCA 4RL1A 4DL2A 3OL7A 4OJHA 3DDIA 5LSLA 1V5IB 4DV4J 1YJVA 5E3AA 1X9MA 5C2CA 2ZOGA 1Q16B 2FJAB 2VG6A 3U7JA 1RT2A 3G82B 4TU7A 4QR0A 4NA3A 4DQPA 3THTA 1F9EB 3ZTOA 3QSYB 1PAEX 4OYWA 3KMSA 4WK1A 4J9RA 4H4MB 1KSPA 4W92B 5HLFB 2K1RB 2KRRA 3PW5A 2RD5C 2OSRA 1YJ9S 3TARA 1H38A 1SC1B 1SC3B 8ATCB 1FJ7A 4ZVPB 1Q78A 1UTAA 3QJJA 4NYZA 1VOMA 5ETMA 5B7WA 3A4TA 1CS4B 2QA2A 3I87A 3W63A 2RJZA 1KN6A 4KAIA 2FB0A 1UA1A 5KFXA 2FIUA 3EPGA 4NMLA 4BLGA 4RUAA 3TUJC 2FTRA 3H40A 1Q7YT 2A2CA 4YB7A 1I1GA 1U6ZA 3R5CA 2ZBCA 3CCWA 1QLNA 1G1XA 2ADBA 3EE3A 4BC7A 2HEKA 1U4BA 1M5KC 4KGVB 1VK8A 2V4RA 2OPPA 5D3GB 4DS4A 4I6AA 4P73A 2HZVA 3UDCA 3DOKB 1V9OA 4O3OA 1FO1A 3QNWB 2B7BB 4XTTA 2DY1A 2APOA 2JEGA 5D4NA 1LKZA 3L3CA 1P1TA 5KFHA 2UUCF 1R3NA 1H98A 4IYQA 1UJ4A 1JLEA 3M1VA 1U48A 2VKRA 3AB4B 2BM0A 3UN3A 1V3SA 4O3NA 2QT7A 1ZM4A 1JMTA 1WG1A 4FF1A 2NXJA 5A6WA 1T8EA 1I51B 1RTJA 3PHEA 3FEYB 3CPWR 2QLJB 4USTA 3OFEA 2EPIA 3CCVS 3QGPA 2CAJA 2RHSB 3BGOP 2O01C 3EVMA 4USMA 4F3QA 3QGHA 2R4FA 3CULA 3H90A 4LVNP 4DSEA 2UUAJ 2FJDB 1NZAA 3P49B 3KMQA 3IBCB 5KG1A 5B0FA 1FVSA 5KG3A 3HHNB 5B09A 2XCPA 4ZHRB 2ZH6A 4WZMA 2DHHA 4LF2A 2YTCA 1C2PA 3ONQA 1WTFA 2BQ3A 1W26A 4WJBA 3GPAA 4PWWA 4URSA 1HNXF 4TVAB 2BJ9A 3FK4A 5KG2A 4ZVUB 3PW4A 5I3QA 2AKWB 1ELOA 2RAQA 2V63A 3MZIA 5LT5A 1X0FA 2ZZNA 2CPJA 2GX8A 2X3GA 2E9RX 3V5RA 3MHYA 2Q1LA 1CPZA 1FX2A 3ETOA 2HFUA 2VU5A 4PUOB 1MMDA 4HL9A 2FY8A 3JSMA 1RBAA 3Q2SC 4KT0C 2JEIA 4ZKAA 2Y1JA 1WUUA 3FMBA 3S8SA 1HNWJ 2YKMB 1WEZA 5HMWA 2V9KA 2R7UA 2PN6A 2LU1A 3G82A 3P4UB 4PXEA 1HFEL 1GXUA 1X4GA 4J9UE 1RTDB 3BS9A 2LP4A 2KM8B 2GO9A 4H4MA 4YR3A 4CO0A 2IYIA 5HLFA 2K1RA 1SJRA 3UNYA 2F1FA 4OX6A 3SSRA 1SKUB 1DAXA 1SKWA 4LSNB 1JLFB 4WYLA 5H9EK 3NRBA 5FLXU 3RRGA 3THVA
chains in the Genus database with same CATH topology
1U47A 2WSEC 5GAGU 1RAJA 2M4MA 3OR2B 2ZH5A 1KONA 5I42B 1XTZA 1Y00A 2FHJD 3CDAA 2M70A 1I94F 4RU9A 3DOLB 3KNAA 4O23A 2DIVA 3M1VB 2Z2MA 2A3JA 1S48A 2ZKUA 4I68A 5KFFA 1WACA 2IM1A 2N4DA 4H4KA 4OI0A 2A10A 5KT5A 1JNZB 3PNIA 3SV4A 1MU2B 4IOCQ 1KVJA 5LJ5Y 2OH2A 2QA4G 4B9UA 1QY7A 1PILA 2VFVA 5DM6Q 3K58A 2VG7A 2H9ZA 4QZVB 4BCAA 2QMWA 3CCRS 1WELA 4OZ0A 4ZPWR 1TK8A 4A46A 1YSJA 2DHGA 4C8LA 2IRYA 4ECYA 1QE1B 3VCDA 1QAXA 2ZH8A 4Q8FA 2DNPA 4OI1A 4EWTA 4Z2XA 1E6YA 3LWLA 3OFFA 2QRRA 2CYYA 4JV1A 2J7WA 3WZ0A 3DLEA 5FDLB 4WTYA 3RRKA 3GG1A 4LIRA 3K5PA 4LSLB 5J1EA 4ZDNA 2V4JB 4A48A 5EN1A 4PXBA 2J0XA 4DR7F 4C8ZA 3FRZA 1SH0A 1XNQF 2W4PA 3G6ES 1HI0P 2FDNA 1S99A 1UL3A 2HGMA 2R8HA 4C2MA 2VQEF 4ECQA 2PC6A 2XMTA 4Q45A 2XMVA 4NZ6A 5L8RC 3BGRA 4TXSA 2OD6A 2WONB 3NNHA 2DD8S 1FTCA 3I56S 1R0AA 5L38A 1ZM2A 2ZH2A 3OLAA 4DHVA 2ZOMA 2RT3A 1ROFA 2RRAA 4PG4A 2HNZB 4NLTA 2QSFA 4RW4B 2CPXA 2VUGA 4HTIA 4F8RA 1LW2A 2COLA 3NCQA 4DSIA 1RA6A 1GTHA 1N56A 3FZBA 4TY8A 4W90B 2W8LA 1SJFA 5H9EJ 5EHHA 3B4MA 3GIJA 2JX2A 5D3GA 3IA0A 2EG2A 1RJJA 2AYMA 2W9CB 2XSJA 3KJVA 3P6YC 4OI6A 4DSFA 2B4OA 1VJWA 4IG3B 4P7TA 4LQ9A 2UUAF 1N36F 2UUWA 2BQUA 2R7TA 3DOKA 2LYVA 1FXRA 1SJ4P 4TY9A 2AYEA 1TFWA 3C66A 5KAKA 1X9WA 1WG4A 4AXJA 1VBXA 4JUZA 3SSSA 3TO8A 3T6BA 3VAIA 3KFWX 3M8PA 4I67A 3CJ3A 4OHWA 2ALZA 4A8OA 2MQLA 4OJ3A 4M95A 5J2PA 1VBZA 1UVKA 1H0HB 2XC9A 2RQCA 2XMUA 3MMCA 4NLSA 4FXDA 3LO3A 3HHKA 4K4YA 3TP2A 2QE5A 4ZPBA 2ERRA 1WHWA 1Q7LB 1HBMA 1S4FA 4ZP6A 2ROPA 2R8KA 4HDGA 4B9VA 1LQ9A 2CPFA 2YKOA 4IKAA 4QIEA 3BSOA 1IR0A 7FDRA 4YUDA 2LQJA 2WBRA 1S0VA 2ZJPQ 1FXDA 2D3ZA 3AHPA 2PMZD 3KHLA 3SFGA 1HNVA 2XMJA 4LF6F 3HFKA 4RW6A 2L41A 2KHDA 5T7LB 1NNDA 1U1KA 1URRA 4DSKA 2C3UA 5DO2A 3OTOF 3H5XA 2B5JA 2K3KA 2CQ0A 3TR5A 4UQGA 3HHLB 2PO4A 1S6OA 1U2FA 4HT5A 4I4BA 4DL4A 2F4VF 2P5VA 2ZNYA 1VQSA 4MIBA 1TK0A 3BM7A 4WE1A 3KG0A 3QJLA 1NK0A 2FC9A 4TN2A 2Y1IA 3R5BA 3M32A 1S9FA 2RB7A 3V6KA 3LP2B 2GFFA 2YKPA 2LEPA 3O44A 2J6TA 3OTCA 5HBMA 2DCUB 4MK9A 2RE1A 4IRKA 1CQMA 2ZJQQ 4F25A 1ZAXA 2FVSA 1RTIA 1X0PA 2HS0A 3TVKA 4MYUA 4ELUA 2IJNA 3FVYA 1R8BA 1KC8T 1XBWA 1C1CB 3K8WA 4I69A 3U1NA 3UCGA 2CKWA 4J37A 4WK3A 4WFNQ 3IS9A 5K14A 4OMFG 5C42B 1TKXB 1KHVA 2OPRB 4X4SA 2OFHX 4KKOA 2HLTA 3CB4A 1C0UB 1Z2ZA 3PIOQ 1FKOA 1YQHA 4ZHRA 2FGCA 2J9CA 3T9NA 2GA7A 2NR0A 1FERA 2R7RA 4Y3CA 4C97A 1YBAA 1RT5A 1ZOTA 1HBUA 2G0CA 1VQ6S 1U6FA 4J9KA 2Z2LA 1Z2LA 4DWIA 4MK7A 1JLGA 1VGYA 2HQ3A 3TNVA 4EO8A 2GMHA 3ZZ0A 5T41A 3RB0A 2V8VA 3QAUA 3LGMA 4B17A 2BV3A 2K3IA 4AXIA 4RW9A 1YI2S 1S9EA 1MWZA 2D3OR 5I3PA 5IT4A 1X5PA 2ZE2B 2BABA 2VPXB 2YKQA 1VFJA 1NJZA 3BO4A 3SCLE 5G0RA 3LH2S 3KLVA 1MW7A 1SL2A 4I6YA 5LXYA 1HNWF 2VBZA 3CCMS 4LT6A 3TYTA 3K0JA 4WCEQ 1C4CA 1S1UB 3ITHA 3MM7B 2KT3A 4IFYA 4C3KA 3SDEB 3R27A 2V9WA 4K4UA 3DN9A 3PY8A 3HK2A 4NLPA 4OX8A 5AXKA 3RW6A 2NS1B 1Q81T 1Q82T 2MZRA 2I5JA 4ECZA 3TA0A 1CC8A 2KRBA 1T03B 4RUHA 3DLJA 2VFSA 3MFHA 4C11A 1W2BR 2J9DE 4F50A 3TW0A 2DK2A 3F73A 3EGWB 2WHOA 3DRPA 3MEGB 2CIMA 1X8DA 3MMAA 3PW2A 5CYMB 2MZSA 4OI4A 4YEAA 1YJTA 3DOMA 5ADZA 2IVYA 1YRXA 2P6TA 4JV2A 1R27B 1S1WB 4JI8F 4KO0A 5DM7Q 5KG4A 5E2QA 2BACA 1RT6B 2HG4A 1WD6A 3H20A 3I5CA 4OI3A 5HL7Q 2FJEB 2MY7A 1DTTA 3MPYA 3H98A 4RU2A 2HAIA 4HVZA 4KC5A 3BN7A 3Q0AA 4ED6A 2MKSA 2JEJA 5D6GA 2C28A 1YGYA 1FKPB 4K4ZA 3J7YU 3KG4A 4FNHA 4PUOA 1JLBA 4KJIA 3G6YA 1KLMA 5J2MB 2RS8A 2ZHAA 2JFKA 2DNGA 3LQVA 3LW5C 2MSTA 1TKZA 3DXSX 1OSDA 1X4DA 3K8VA 3SXLA 2HMIA 1GT8A 3HKZD 2F9DA 1UJ6A 4ZP7A 5GAEI 4NZ7A 5JVGQ 2OP5A 2X51A 4I2QB 1U1QA 1UW4A 2XMMA 3OXFA 2DGQA 2W9BA 2Z8QA 2AX1A 1JLQB 2CG4A 2DR5A 4AQYF 4ED2A 1O8BA 5HN0A 4CQ1A 2LMIA 3PW0A 5EGYA 1WF0A 2V94A 3O6QA 4ITSA 2L08A 1Y5LB 2YKMA 4ID8A 4CT9A 1UVIA 4PQUB 3KWMA 2E5IA 5GVQA 4G1QA 4WFZA 5B0CA 4DQQA 3OVSA 3OFHA 5EUHA 1FD8A 4U67Q 1HA1A 4CO4A 3KHHA 1JX4A 1ZPVA 4OFZA 3D28A 2XEXA 4E8UA 4DR5F 1KLNA 1U1NA 2NXUA 5A8RA 5E3RA 3V6JA 2XO7A 2VG5B 4O3PA 4F02A 5I4MA 5HROA 5DDQC 4IQMA 4WF9Q 1HMVA 1VS3A 4G3IA 4LF7F 3Q8QB 5GAHI 2JC1A 3CDEA 1YJNS 1RT7A 1C4AA 1ZZFA 4QIGA 1YRTA 4X65F 3L95X 1VQMS 1RTDA 4URGA 4FS2A 1S1VA 3BN4A 3V6DB 3M8RA 1L3UA 2VASA 4Q0BA 3DM2B 1UP1A 4RNNA 3U1LA 2W4DA 3M2RA 3LP1A 1NK6A 4TLQA 1RT3A 3NGKA 5B0AA 5K9FA 1UEVA 1PSDA 2VBYA 4F4KA 3L7OA 5AE2A 2M5YA 4I2PA 1FESA 2B43A 3DI6B 3ISNC 4KSEB 3Q8RB 1U8SA 4IRDA 2XI2A 4IH7A 3OUYA 4LJMA 2J76E 1SUQA 4KPYA 4ED5A 1FA0A 3BB5A 3HI9A 3GV5B 4DFKA 3M8PB 4LSNA 1JLFA 2KZZA 2RSQA 3OTEA 3EGZA 5DRKA 3MMBA 4TU9A 1HHTP 4CIOA 4C3MA 3O1LA 2DISA 4EZ9A 4J9SA 1N0VC 3M8SA 1UVLA 3TAQA 4KGMA 4QWCA 2HHTA 4WZQA 1IKWB 1VC6A 3MM9A 4DUYF 2EVZA 3CJKA 3CVKA 3JTNA 3WC2A 2HWTA 3HO1A 1OO0B 3B4DA 3NGDA 2KXHA 4AE5A 3OR2A 3VQSA 3QMQA 2EK1A 5I42A 5DQGA 3IFEA 2C3MA 3DOLA 1YVFA 4G1PA 2R8IA 4A8MP 2HHXA 2HGLA 3EZUA 5CZVA 2ILYA 2GQCA 2KHCA 3U02A 4OX9F 5B0BA 3OXLA 2W25A 4MKAA 2HVIA 1W2IA 3M4XA 4MAKA 2Q6CA 1XR7A 3RYLA 3UNGC 3LAKA 1KVIA 4DJBA 4I1TA 2FLOA 2RF2B 3TVZA 5KFOA 2YX7A 4C98A 4KHPF 2UUBF 3PFEA 2GHPA 4RW6B 3M2UB 2DCLA 3T19A 2LECA 1QE1A 2G9OA 2B3TB 3CJ4A 5CH7B 4ZPVR 2CQ2A 3LWMA 1SJQA 4IUFA 3DYAA 3IC1A 2E7WA 5CYQB 4A8SA 2ZD1B 2LU2A 5FDLA 3D5MA 1R7IA 2PFFB 4WE1B 5E3PA 4LSLA 1S72S 2MSSA 4O0IA 2V4JA 4ECTA 2EW9A 5IWAF 2CQBA 2ZBIA 3DMJB 3PX0A 2KTQA 1NKEA 1YWXA 2DRAA 3CSKA 2C3PA 1LFWA 2IC3B 1P6TA 4ZPDA 5KFSA 5GMKa 1XMQF 2FD2A 1HNIB 2WONA 3FQLA 4YY3F 1FKAF 2OIHA 3W2WB 1FDDA 2GNKA 4Q8EA 2DJWA 1NU4A 1TV6B 2CRLA 3VAFA 2C2DA 1WG5A 2AWZA 2JC0A 2HNZA 3ZZYA 4EO6A 4NRUA 3PR4A 1HWLA 3ENWA 3BO2A 3VAGA 1WI8A 4N56A 3DCAA 3MTKA 5IQ6A 4YP3A 1NH7A 4DQSA 2FLNA 2HRYA 3CGIA 5F3TA 2EFVA 4R8UA 3LF0A 3NCPA 3I31A 2I38A 2IBOA 4JV5F 2PD1A 3MI7X 3I4PA 2NPFA 3C2PA 1SIWB 2OPQB 1RT5B 4PXCA 5DJBA 4IG3A 4Y65A 2CQHA 3MURP 3PW7A 2IJFA 2JOQA 1SJ3P 2ZOFA 2N4CA 3EGNA 1MNEA 1VI7A 3D0IE 3KLIB 4OV1A 4B02A 4YDXA 2UVRA 4RWXA 4X84A 5B0EA 3QIPA 3Q8SB 2W7OA 1R43A 4ZK7M 1JIHA 1JJ2R 5KFJA 5J2QB 4NLRA 2ZFHA 4DN9A 2LEBA 2HHSA 2EWHA 1S9GA 4NXNF 2UV8G 3H2LA 4Y2AA 1V6HA 4ATNA 4XIUA 4NLDA 1Q79A 2WOMB 4RBVA 1NHVA 1O51A 1DLOA 4JI1F 4AFFA 3M9NB 4O4GB 5M2UA 2KXFA 3I32A 2KXNB 1DJ0A 1TL3B 3SSQA 1IKXB 3DRYA 4DV0F 3FQKA 3T1AA 3OR1B 4KRWA 4KQZA 5EWGA 1GH8A 2IFXA 4OLOA 2VA2A 1CSJA 1VIXA 1F2GA 2O5DA 4B3MF 1T95A 4CI0B 3OQ2A 3VZIA 1TKTB 1X7VA 1N5SA 2BRLA 2C3YA 3BGLA 4QWAA 1DFDA 5T7LA 5J1NA 3Q23A 3L7PA 2EI5A 1VBYA 2MYFA 5KFAA 3S6EA 1FRHA 1P9QC 2LDYA 3IGNA 3PEHA 3EYZA 2GQQA 1D8YA 1KTVA 4K50A 1R8AA 5KFPA 4DR1F 2LCWA 3I0RB 2RDJA 1NJIT 1LXJA 1APSA 4JI6F 1A6LA 3S7RA 1UWBB 1N88A 2EFQA 2FJBB 2ATLA 1Y9OA 3G86A 3O8WA 1Y0HA 3LP2A 4RW7B 3T6JA 4LFCF 4FP9A 3RU0A 1AW0A 2E29A 2LQ9A 3NP5A 5K5MA 2MQQA 2DRBA 5DDPC 2U1AA 5AXNA 3CF5Q 1QSLA 2H5EA 3E2EA 3RBDA 1JLBB 1VQLS 1KLMB 1PC5A 2RUGA 4FBTA 2C3OA 1U25A 1R8HA 3PJWA 2HHWA 3LUYA 1GTEA 2VBXA 3GB0A 1C1CA 3TOQA 3GV7B 4PWDA 2HMIB 1K9MT 2DH7A 3TRGA 5C42A 1HL6A 2CPHA 1TKXA 2OPRA 4LUBA 2OKQA 3MAHA 2W9BB 2Q66A 1C0UA 1M5PC 4QIWD 2DVIA 4CT8A 3GE9A 3L09A 4DSLA 2R7WA 2DNHA 4ES3A 2E5HA 4JI0F 1S97A 2DGTA 2RIJA 4X4UA 3CJ5A 2DH8A 4R5PB 3CMAS 4F4ZA 3NNAA 4HTJA 5L1LA 3MDFA 4NLUA 1L3SA 2AYBA 3PJXA 3NAIA 4RNOA 5AE1A 4IG0B 3I0SB 4JI7F 2PMHA 4URQU 3VR1A 2MXYA 3JB9k 3QZ7A 4Y00A 4K5RA 4B08A 3NLCA 4ICLB 2IBKA 2WAQD 2ZE2A 2VC0A 3CC4S 2XWXA 4LQ3A 1GXTA 3OHBA 3VAHA 2L3MA 4WU2A 4QCLA 2HHPA 1RT7B 2UXDF 3I9ZA 1H7XA 3OJSA 3TAPA 1S1UA 2LEAA 3MM7A 1LWFB 2KG0A 1ZBTA 2KG1A 2OO4A 1VQ8S 3G71S 1X4HA 1S0MA 2F3JA 3H59A 1FE4A 3U27A 3LP1B 3GSDA 3N01A 1F60B 1RT3B 4TQRA 1N33F 1SKSA 1JJHA 2O67A 1GQEA 1YJRA 5CHCB 4X4PA 1IQTA 2V8GA 4GKKF 1FTRA 1SV5B 2B6AA 2BRKA 4R25A 3GV8B 1EETB 3OUYB 4Y28C 4KB7A 2YKAA 3A8EA 1SUQB 4RNMA 5DQHA 2A18A 4P6QA 2AF6A 1LOUA 4NA2A 3TUZC 1W25A 3G8TA 4NRTA 3MEGA 3MECB 3DLKA 5KT2A 2J0QD 2X1GA 2AP6A 5CYMA 1VRUA 2L9NA 5HO4A 2SXLA 2R2SA 2QYCA 5CA5A 1S1WA 2P6SA 4DFPA 2KFYA 3NS5A 4ETXA 4RX6A 4X62F 1RT6A 1RKIA 2EFPA 2K7JA 2JLGA 1OPZA 1TR0A 3DHXA 3CDWA 4UUXA 4ELVA 4PWUA 2BE2B 2XWYA 3H2VE 3EX7B 3DDNA 2KO1A 1N0UA 2R7SA 4LFBF 4OLPA 4IOBA 2YNGA 1FKPA 1F5BA 5F0WA 1IJFB 4IO1A 2JLEA 4WYWA 2B56A 1E6VB 4TKTA 4OHZA 5J2MA 3HPOA 3CT9A 4EBEA 4ECRA 4EEYA 3GG0A 1AFJA 4PQAA 3G4SS 2BOPA 4WFAQ 2M8DB 2ZH3A 3DRXA 4XK8C 2FVRA 4B3SF 3W7BA 3MWBA 4RWWA 1FXLA 2UZAA 2HFNA 3D0GE 2GHVC 4JOUA 4I2QA 2N7CA 1SH3A 3DYAB 1JLQA 3CDUA 3VQTA 3BJYA 2RDIA 2DR9A 5A8KA 1D9DA 3GFZA 4ZCKA 5A6PA 3FRYA 5KOXA 3AJ2A 2MQOA 3TANA 1HQEB 5F3ZA 4MTPA 5E3CA 3ZZTA 4PQUA 3FMWA 4C7QA 3HMJG 4Y0FA 1G2EA 5E5NA 2RRNA 2JL9A 1NJYA 5SUHA 5MLCV 1L3TA 1M5VC 5KG7A 4FF2A 2XB2D 2K8GA 1Q8IA 2BA9A 2ROGA 1KQGB 2HS3A 1RT4B 2DO0A 2F9JA 1M5OC 2VG5A 4HT7A 4EFAC 4HHJA 1IBKF 3QJPA 4DL5A 4MFBA 4O44B 3UQSA 4DEZA 2W7PA 2YKNB 4CTAB 3T5HA 3AA8A 2IVMA 4A47A 5LSRA 4F26A 4OL8A 3V6DA 3FZ2A 1GAOA 1VQOS 4R8UB 3DM2A 1DQ9A 1T3NA 2B9WA 4HI1A 3H5SA 1CLFA 2CQPA 2MDAA 1FJEB 1CEZA 3RAMA 1UMJA 2EG1A 4ES1A 3TI0A 4CH0S 2RMLA 2CDQA 2PA3A 1QSYA 4YQWA 4DR6F 4TYAA 3DI6A 4L3NA