1Q7LB

Zn-binding domain of the t347g mutant of human aminoacylase-i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
NPWWAAFSRVCKDMNLTLEPEIMPAAGDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Aminoacylase-1
publication title Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature ec 3.5.1.14: N-acyl-aliphatic-L-amino acid amidohydrolase.
pdb deposition date 2003-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1q7lB01
1Q7LB
chains in the Genus database with same CATH superfamily
1GTHA 2IVMA 2IRXA 1XWLA 2QMUB 4IH6A 2M3DA 3QMQA 3QGPA 1U0SA 1KFDA 4LFBF 5L1JA 1DTTB 1DZ5A 4IDKA 3W63A 3KHHA 1RAOA 3D2WA 1D9DA 1RT1B 1WEXA 4UUWA 2N3LA 3OVBA 1UETA 1IBLJ 4QZVB 4EBCA 1SL0A 1F3FA 4R5PB 1RWVB 3P3DA 5G4DA 3UR3C 2VONA 3GIMA 3T5LA 5HQ8A 2MGZB 3B8HA 3BGRB 1T9UA 1KWMA 3IMQJ 2ABYA 3GU0A 2RDJA 3IAS9 4ZN1A 3BR8A 2XM3A 1T9XA 2IM3A 1ZPVA 1RBAA 2W7OA 4ZVUB 4WFXA 4YR3A 4FXWA 4F50A 3KMSA 4F36A 1WC4A 4MFBB 4Y2MA 5HBMB 2I8EA 2VIHA 1F9HA 2VKRA 2XI3A 5EWFA 2QSWA 4UW2A 2VG7A 4H54A 3T1YJ 4DR2J 2FPHX 3GJTB 1LK7A 1S1XA 1D8ZA 1OY8A 4V1Ak 1PIEA 4B3SJ 3DLEA 3LP1A 2AGOA 1XR5A 2PIIA 1Q53A 4ANDA 2HLTA 2AJFE 3DFEA 1NKBA 5GMDA 2MZTA 4USUA 2M0GB 4DV5F 2KDOA 4X4RA 2EFOA 3LUYA 3MMCB 1G7CB 1RCXB 1FE0A 1NLKL 2KYZA 1VYAA 4NXMJ 4LF4F 2VBYA 2BQUA 1R43A 1T7PA 1U1QA 3NGTA 4M5JA 3IR6B 3CPWR 3DCAA 3HVTA 4NRUA 1S4FA 1DTQA 2HPUA 4ENOA 1TV6B 1FJEB 1R6VA 2HFVA 1IJEB 1S79A 1HD1A 3GSIA 2DR8A 1GXUA 1N5YB 3PDNA 4ALZA 1KDNA 2F3JA 3M2VB 4ZLLA 4ED2A 4O0IA 4QPTA 2M8HA 1HFEL 2N4DA 1ZH5A 2KFNA 1RDRA 1KQFB 2RS2A 2YQ0A 5LJ5Y 2OMOA 3GYNA 2H1YA 2DH9A 3RRGA 3WC0A 4OZ5A 1FJGJ 2JJ4D 2R7VA 1IJFB 5D77A 2ILYA 1S49A 2F9JA 3NEKA 5J1EA 2B9WA 5KFGA 3KFWX 1M1HA 3GILA 3PR4A 2HG4A 3DRSA 2XS5A 1FRHA 5HROA 4CLYA 4HDGA 1SC1B 2VL1A 1Z4UA 1MROA 3M8SA 1R8PA 1TP7A 3I96A 5ETOA 5F41A 2J9DE 2IIHA 2B56A 1BY9A 4DR1J 2BZ2A 1YX2A 1RAJA 1T05A 1IBKJ 2WSCC 3D28A 4UOFA 3UNGC 2M8DB 2OELA 4FNIA 5CD4H 3K5LA 2ZH2A 4OX8A 5MAOA 1TL5A 3UVJA 2HHTA 3GG1A 4B9SA 1T11A 3QT6A 3NGRA 2F7VA 5SUHA 4OZLA 2AJQA 1PC5A 3ITHB 4X4TA 5A6PA 5KFIA 2E1CA 4LRAA 3DRPB 1G2EA 3UCZP 1SQEA 2BW7A 4ZA1A 1S97A 3EVWA 1RKIA 2LEAA 2R8KA 4JI1F 3IWNC 3PHTA 3BYPA 4GKKF 2YPZA 1EQ0A 3CCRS 3E2EA 2ZM6J 2AT1B 4WIQA 4DR4J 4PWWA 1RT2B 4DX7A 1EIYB 2HHHF 2B4UA 1HNIA 3C6TB 2R7WA 1N33J 3OUYA 2Z2MA 4X84A 5FD1A 3J7YU 5IT9U 1U6BA 3TR5A 1VS3A 4DPXA 3Q2TC 4RW6B 2BJ9A 2ASYA 4XAKA 1IQTA 2I38A 2XMVA 2Z2ZA 2A1BA 4LQ3A 1PJ6A 1PSDA 5E2QA 4A8MP 4DPTA 4I64A 2RDDA 2EK6A 4ZIWA 2E5LJ 4ECQA 2U1AA 4B9UA 1D8YA 2FVQA 4ZPAA 5IT4A 3BPSP 3HZGA 3VAFA 4JBCA 3OHAA 4MIBA 2ZH7A 1IR0A 2X7IA 3WIVA 1URRA 4CYUA 4U95A 4PABA 1S9EB 4OHXA 1RYSA 4YHHJ 3ZZUA 1S9GA 4RNFA 3DLKB 4KB7A 1FDAA 4XPCA 4DFKA 3QWPA 1G6BA 1ZETA 1TL3A 3JTOA 1WDDA 3CCSS 2GMJA 4KV8B 4QPXA 1U0HB 2EVZA 4NLDA 3PRDA 3H4DA 3T1HJ 3PO4A 1CQNA 4X65J 4ZDNA 3BO3A 1YJWS 1BXNA 3PM9A 5IV4A 3KKFA 1KLNA 1RA6A 1XJWB 3DRYA 3ZZOA 1IR1A 2DBBA 1HBUA 4TY8A 2R42A 1WKJA 5F8LA 3IBWA 4UOCA 3D1QA 1NHVA 4WZQA 3DGPA 5KFJA 2RH3A 2ZH3A 1P8GA 3R2DJ 4QR2A 5KFMA 5KOWA 2I5JB 1WOSA 2GZOA 2NR0A 3AT1B 1X4BA 1L3KA 4J9MA 1XR7A 3GB0A 4F04B 2OLWA 1CJTB 3MM5A 1XIQA 2QX0A 3N6LA 1U6FA 2Q66A 2OGUA 4FS2A 5D0HA 2LCWA 4C8KA 3K17A 3CMQA 2HNZB 1JLFA 4O3OA 3SSRA 2CQPA 4A8XA 3PYFA 2MXYA 2AEJA 3C14B 5KFBA 5IM0A 4ZPTR 4K4ZA 4USHA 2HFNA 2MZ1A 4TLRA 2XZWA 3BGOP 3PW5A 3KWMA 1YKWA 4LF8F 4B17A 4M5HA 1CQMA 4OLOA 1ROFA 1VRUA 2E9RX 1S10A 1SJRA 2ASDA 4OYIA 1R0AB 3UD5A 2CJBA 1XMOJ 4FZVA 3U7JA 3ULHA 4RNOA 7FDRA 4EGLA 3CXCR 1VQ4S 2FJAB 1U2FA 3LANA 5DQIA 1TKTA 1KHWA 2F1FA 1QLNA 1I94F 4A48A 5F9NA 2Y8YA 2UU9F 3NGUA 3QO9A 4EI2A 1X0PA 3KTQA 1E6YB 1HNXJ 1Q5VA 1WI8A 3N6MA 1AZSB 1RE1B 2E9ZA 1RBLA 4U96A 3Q24A 1JNZB 3A3OB 3MR7A 4LF5J 1SUQB 1FVSA 5B0DA 3CEDA 2DITA 3CJ8A 2AJ1A 4LVOP 4CLWA 3HD2A 1N5VA 2ATCB 2MQQA 2RHSB 2IM1A 3T1AA 2LDYA 3W3SA 1TVRA 2Y1IA 3T41A 4C8ZA 2DRAA 3HD1A 3F44A 3ZFVA 3TP2A 4CI0B 3QGIA 1X4DA 4ID8A 4DR3F 4C8YA 2ZDPA 4E0DA 3CMES 1XMQJ 1CULA 4P74A 1WTFA 4KHPJ 3CJQA 2UUAJ 2AGQA 4L3KA 1U1LA 4ID5A 1JB0C 2MY8A 4O44B 3CDAA 1SI9A 3Q8VA 4R0JA 1D1UA 3CO9A 4ZPWR 4O3QA 2XYGB 5B7WA 1W25A 2K1RB 3WC2A 1JJCB 1TK5A 1Z1ZA 4FKYA 3QRPA 5KFOA 1NNDA 2WVEA 4P9SA 4DLGA 4DV2J 1HARA 3JYTB 1FFWB 1Q4RA 4M63A 4EFAC 5JMNA 5C42A 4FYWB 2W01A 4DEZA 4D3HA 5CABA 5DGBA 4WU2A 4RBVA 3BB5A 4OFZA 4LFCF 4C8MA 1RTIB 3ZTOA 5DQHA 2KJWA 4X64F 1H7XA 3OTOJ 3QIPA 4N41A 3TZZA 2B9XA 4DSEA 4J9NA 2YQ3A 2WOMB 3ZZYA 2XWYA 3VAHA 1V3RA 2HAIA 1RQ0A 2AX1A 2CJKA 3CJRA 2ZUAA 2DR7A 1R0CB 1RABB 1CLFA 3ET6B 2CPHA 2NUUG 3GIKA 1FD2A 2B8PA 2IYGA 4C0BA 3X3UA 3PCOB 3KK1A 4H4MB 5HP1A 2L9WA 4ZJOA 4G1QA 3NRBA 4YR0A 5FLXU 1SBRA 1VQ9S 3LGNA 4ZVFA 4MJKA 2XLIA 2XZTB 1QE1A 2XTJP 2HHSA 2VKZG 2C2NA 2KXHA 2UUBJ 4PZVA 2Y8WA 3CUNA 2FHJD 1H0HB 1OIAA 1KVIA 2ZVIA 3EDQB 5DLGA 4JI5F 1UJ5A 3ZTQA 2BBEA 4USTA 3IG1B 3X1LB 4PR6A 2V0NA 3BR9A 2IM2A 3EPGA 4LR7A 2MQPA 4OYZA 4X65F 4OJ1A 3HVAA 3KK3A 2F4VF 1ZA2B 1VDHA 5AE2A 3VVTA 2Z56B 4K8RA 3QNWB 2GHPA 3LALA 2AYEA 3H25A 2EFPA 3FCHA 2Q6BA 2MHNA 1U7LA 2WVBA 3QWUA 1HWJA 2V69A 2P8IA 4M1KA 1OYDA 3JS9A 1WC0A 1TMJA 5D3GB 3B4MA 2RNEA 3BSAA 4Y3CA 3G82B 1N0UA 1PBAA 4IOCQ 3MTJA 4WXOA 3T5HA 4QWBA 2DNYA 1QDUB 1KNZA 5D15A 4ANCA 5F9LA 2J0WA 2PD1A 3AB4B 1QSLA 2KHCA 3Q86A 2MKKA 4DX8H 2HBQB 3TI0A 5IV3A 2VG6B 1XN9A 4U8YA 4OX9J 3NNCA 1U1OA 2C3UA 3A8KA 2ZZTA 1VQ8S 3BQ0A 3CW2C 2V8HA 3HVWA 1B70B 4F7VA 4Q0BA 4NLQA 4ZJLA 1NZAA 3W5ZA 2GC8A 4QOTA 3K5OA 1KS2A 2CVEA 1ZM3A 5B0EA 3CJSA 1VQMS 4DV3F 4ELVA 3QZ7A 2FTRA 2DXEA 4MKBA 3GPAA 1XMOF 3KK2B 2N4CA 4NEYA 2J7KA 3ZNJ1 2VJUA 1HNWF 2HZAA 4B9MA 4DSKA 1RLCL 3CIMA 4X62J 2UXBJ 4RW8A 3W60A 2GNKA 2FLPA 4LVNP 2KH9A 3D68A 4DV1J 1EJ7L 2QTWA 4I6AA 2ZH4A 5HO4A 3N79A 2BEFA 2EPIA 4LIWA 4CWBA 1MSWD 5K14B 3VAMA 4U7UD 4W4MA 4PG4A 3TOQA 2VASA 4DL2A 1TQLA 1OO0B 4LF5F 4DL0C 2AJ0A 4CTAA 2QA4G 1HMVA 2DNPA 3NY0A 2UUCJ 1FKAF 1E6VA 4WYWA 4EWTA 3QBCA 2PEHA 3NBPB 5DDPC 2HQGA 3NWRA 3DOKB 3D9BA 2E5IA 4DR6J 3RBZA 3K58A 3MGJA 2MDAA 1HW9A 1ZPWX 2GVDA 3RZAA 4ECRA 4KHPF 2DD8S 4LF6J 4K2XA 1FD8A 2MQNA 4Y28C 1HHSA 1HQUA 3ZTRA 2QLJB 1V9OA 2OAUA 5DZ7A 2JNJA 3JQMA 2YY3A 3W64A 3KMQA 2RD5C 4D3GA 5B0BA 3GV7B 1TELA 2RDIA 3ZC4A 1AROP 3OFGA 3VTIA 3PJXA 4DUZF 2JWNA 1S4EA 3K5PA 4MKAA 1IKYB 1MWZA 2WCXA 2QV6A 5KFTA 3KLHB 4NXNF 4X4UA 3CD0A 3ICLA 1IUJA 4QIGA 4LF9F 2A2CA 4TU9A 3E01A 4M8LA 4DV0J 5KG4A 1SPBP 1S6QB 5T41A 3O5TB 4K4TA 3AQOA 3NP5A 3J81j 1XNQJ 1M1GA 2OEKA 3R27A 2DEIA 1B7FA 2G0IA 2HNYB 2YNIA 1TKXA 4IQXA 4YMEA 5E3CA 1I3OB 3IBCB 3FBCA 5CA5A 4ES2A 3H5YA 3HJVA 3W2VB 1X31C 3MWBA 3UW1A 4J7CA 2BRLA 3CO0P 1HI0P 3CJKA 3BGUA 4OYWA 2KZMA 2OMLA 2PE8A 2KFYA 5D0GA 1TL7A 1F1BB 4DUYJ 5BR8F 5F0UA 2ZJQQ 3N28A 5CQGA 1B7YB 4NX9A 5KTQA 1Q86T 3W2WA 3J7Z5 5LSRA 2XZDB 2G2YA 1PG5B 2AJ4A 1X8DA 3QLHB 1RT5A 3BM7A 3WHIA 2UUBF 1WEYA 4JV0A 4WP8A 3WX4A 5KG0A 1ZAVA 4NMXA 2GHWA 3DOLB 5CZVA 1HPZA 4CLFA 1SKRA 3M6XA 2KJVA 3NOGA 3MEEB 5KFNA 4OI2A 2J9CA 3BH6B 1N88A 3NL0A 4PYAA 3S6EA 3H4BA 3RW6A 4LR9A 3EMTA 5AJ3F 1RJJA 4TN2A 2A18A 2GW8A 3B78A 3OSPA 3CDBA 4P73A 4CNYA 3DLGB 1WSRA 3BSOA 4UOGA 5GMKa 5CYMB 2WZ1A 1ZAWA 2WTFA 3UDCA 4F4XA 1ICEB 1UCNA 1N54B 3D67A 1Q16B 2OPRB 4OZ2A 1UVLA 3J7YI 2CYYA 4K0KF 5LL6d 3J81U 1WF0A 5KFKA 2HHQA 1KLMB 3Q0AA 4HH0A 3IRWP 4L6V3 2BMBA 1BD6A 1FRXA 1Y5NB 2L08A 4M5DB 2XG8A 3OD2A 1NK8A 1JLQA 1YI2S 1NDCA 1RTHB 1JKHB 3SDEA 2VFVA 2VC1A 1LOUA 4B3OB 3IA0A 4GO7X 4XK8C 1EKRA 1F60B 4G1IA 1M0SA 4DG1B 1S1UB 4DL4A 2YKNA 2C3MA 2L9DA 3OR2B 3OXGA 2U2FA 3O3LA 4DV7F 4ED4A 2B5JA 1UTAA 1N6QB 4USMA 4B3MF 2YWEA 4DPOA 2MZSA 4DCPB 2VFTA 2GO8A 4ZPBA 1LWEB 3EM1A 1H72C 4R8UA 5SZTA 2BE2B 4ZCIA 4DFJA 3FVYA 4AD6A 3RB6A 3DLBA 4UTGA 3CTRA 3OT9A 2QYGA 2LU1A 1X5TA 1YBUA 4RW4B 2CQGA 1U1KA 4QYZJ 3K5MA 3MZIA 2FJWA 4Y00A 4B9NA 3TAMB 1S77D 5ETRA 4Y34A 5AXKA 3P4UB 4LQ9A 1OWXA 4ETXA 1FXRA 5KFEA 2B7BB 2PI5A 4Y2KA 2HRUA 1K0VA 3RJMB 1T95A 3MFIA 4DV1F 1JJ2R 2M2BA 2KT2A 4WTOB 1GX6A 4LSLB 3GIJA 1I5OB 2DH8A 4IH7A 2EKNA 2N82B 3R7BB 2DGUA 1RT6A 5K8OA 4OHWA 1LWCA 3UO0A 3IWXA 3BN7A 1TR0A 4HH1A 1Y5IB 4JYAJ 4ED8A 2UUCF 3EWGA 4C9DA 1S6PA 3K5NA 3CC4S 2APOA 1VFJA 2GCFA 1WELA 3BYRA 2VF3A 1JLAA 3VWSA 3IO1A 2FY1A 3OFFA 4Q5VA 2GX8A 3I5AA 2YWFA 4FF4A 3R97A 4B3TJ 3RRKA 4TYAA 3PV8A 2IJNA 1VLOA 3T5KA 2VU5A 1Q5YA 1TFYA 4O4RA 3FK4A 4DZDA 3K2YA 2V8DA 1RT7A 3D54A 3MM7B 4OZ0A 1IM4A 3ZO7A 1RU1A 4JI2F 2QC3A 2UVRA 3OTEA 3LGHA 5CAAA 1VOMA 1S99A 2H5EA 5L1KA 2GIQA 5HSPA 4ZVTB 2BR0A 3DYAB 3KJVB 4B9LA 4KFBA 5CYJA 4ETZA 5B0CA 3M8PA 4J9LA 4GC6A 3KHLA 5AT1B 3NCQA 2M7SA 1ZYQA 4QU6A 1B0PA 3PYGA 4NYZA 3GWCA 1SH2A 4ED1A 3M2RB 4IOAQ 1EARA 5BJRA 4PPDA 2HQIA 1YQHA 3DHXA 5DDRC 4RW9B 3BDEA 2ZHOA 4TY9A 3QT7A 2EFVA 2KYXA 2MKSA 5KFDA 2PC6A 2AZ1A 3C15A 1JLGB 2DY1A 3OLAA 3WQPA 4OMFG 2DIUA 3EVOA 1NB7A 5IWAJ 2VOPA 2JEFA 4QQBA 2QO3A 4NI2A 3FBBA 2AEFA 1YRXA 2ZVSA 3MEGB 2QMWA 1T94A 1UA0A 1TTHB 1FERA 3DDIA 1D9FA 1DTTA 2OH2A 4KHRA 5LMNJ 1H6KX 1RT1A 2VPXB 2A10A 1SIZA 2HVHA 4N56A 2LYVA 4OYXA 4DUTA 4R5PA 3PXGa 2E7WA 4LSNB 2ZZNA 2AF6A 3OL9A 1RB0A 4LF7F 2PT0A 1VR6A 2MGZA 3BGRA 4IRKA 4ECVA 4WE1B 3TO8A 3GONA 1TU0B 4DS5A 1FRIA 3KUHA 3MUTP 4OZJA 3BSNA 1U1NA 3M7VA 2FJEB 3J80U 3JSMB 1UEUA 1G3OA 3H20A 2V2ZA 4DF4A 4MFBA 5B0AA 2CG8A 5HBMA 1MMLA 1JMTA 4C4WA 2YNGB 4ZPCA 1N5TA 2ZOFA 3QIPB 1FVQA 4A8YA 5E5NA 4LRBA 3TJ8A 2UUWA 1TUWA 3JAMY 4KSEB 4B3RF 1G1XA 2BJ8A 1OS5A 4NLWA 4ZLPA 3VQSA 1KP6A 4EMDA 1MWYA 1RWKB 3T3FA 4R0EA 5GAEI 2HKEA 3MMCA 5KFFA 3SCJE 2R2TA 3HHEA 1FKOB 2BJEA 2QMXA 1R8CA 2CNOB 3GE9A 2VQFJ 5KFPA 3HPOA 4URSA 1W2IA 3G4SS 1S1WB 4AL6A 4CCHA 1HWLA 3TUIC 1TV6A 5BYSA 1OJ4A 2BM0A 1Y11A 4OJHA 5EWGA 1N5YA 3PFOA 3RW7A 3M2VA 2CWXA 2GHVC 1J5EJ 5E3AA 3I4PA 2KL8A 3T9ZA 5LSOA 2EXUA 4UY85 1TZ0A 4PQUB 2XI2A 1FRJA 4LUBA 4F3OA 2IJFA 2OFGX 2I9SA 2KXFA 2QLBB 1BUXA 3L7OA 1GTEA 2VUGA 2EEYA 4WPAA 5IXUA 3I9V9 5HMYA 3TEHB 2XCAA 1QM9A 3DRXA 4C7QA 1VQSA 4PXEA 2VBXA 3GTYX 5EDWA 2EC2A 2ATLA 4P52A 4K4UA 1FA0A 2LVWA 3KXDA 1BC6A 1JQGA 1R3NA 3DRRB 1I51B 4NCBA 2DR5A 2PFDA 3V81B 4JYAF 1Q8IA 5CH7B 3I4HX 1U26A 4N47A 2CQ0A 3GFZA 4RBTA 2QGFB 3U1LA 1K44A 1ZBTA 3EZ5A 2R2UA 3CJTA 2VOOA 4LJMA 1Q79A 3IC1A 2DNZA 4CLTA 2C1EB 3HF5A 2CPXA 4ELUA 4K7QA 5L8RC 2HBZB 4DV6J 4MYUA 4JV5J 4DR5F 4EBDA 2CWKA 1EX8A 3CJ4A 3B82A 3MUMP 4KPYA 1XNRJ 1MNEA 3ITHA 4I7FB 4J5OA 3DRPA 2QA1A 1VBXA 3U1NA 5HVHA 3KJNB 1R6YA 2GAGC 4F8RA 3LO3A 2HGLA 3MM9A 1ZAXA 2XMKA 5KAKA 3MURP 2A2DA 1WTBA 2QFJA 3DMJB 4M5IA 3A8JA 4C8NA 2KRRA 2OJ3A 1N34J 2PA3A 4OI3A 1Q8KA 2XNRA 1FDBA 3DN9A 3CDEA 2CPDA 3SMZA 1DBDA 1X4AA 2R8HA 4RKUC 1RT2A 3VHQA 2IA6A 1RHUB 2AD9A 2AWZA 3C6TA 5HN0A 4KR0B 3CVKA 2AYMA 5HANA 4I1TA 5B0GA 1S1TB 1S5ZA 2PMHA 1DARA 3BO4A 1M5PC 3M9OB 2NYHA 2LXUA 4RW6A 5KFXA 4RUHA 5H9EJ 2R7TA 3BSCA 5E3RA 1Y0HA 4LIRA 1K1SA 1VBKA 4IFYB 1TL1B 1RWMB 5LT5A 1F5BA 1L3UA 4K4XA 2XQCA 3MCMA 1QVGR 2KXNB 3H5UA 2CJ9A 3NAIA 2ZE2B 3NMRA 3U1MA 5A8KB 5G0RB 2YX4A 1RT3B 2QL5B 2IJRA 2WONB 2CQBA 1S9EA 3W7BA 3LP0B 4OV6A 2W8LA 4NOHA 2ZZMA 3F73A 4C98A 3DLKA 1KRPA 2WK4A 2FB0A 4ANEA 4UZCA 4KV8A 3V4MA 2YPYA 3HHLC 1U0HA 3FSIA 4DL6A 2XY7A 1RP5A 4UZBA 4X4SA 3IRXB 2V8PA 1HLWA 4WFNQ 5T7LB 4OX6A 2LECA 4CH7A 5E3QA 1P1TA 2CRLA 1RADB 1LW2B 1NSQA 1X5SA 2EK1A 3PW7A 1PYTA 1NCLA 2LMIA 1U2CA 3SCIE 5EX0A 3R5BA 3SEOA 3CMAS 3QFHA 2QA4S 2MTLA 2VODA 3QT8A 2ZOGA 1PAUB 4PG8A 2YKQA 4ICLB 3ETMA 1F6TA 3I6PA 2I5JA 2F4FA 2Y1RI 5J1NA 2XNQA 2ASJA 3H59A 1GFWB 2HS3A 2Q3PA 3OXLA 4QW9A 1RHQB 2PGCA 5D8HB 3ZZ0A 5DDQC 4ILRA 1CJTA 3C6UB 1UWBB 3S7RA 3BV8A 3OTBA 5K9FA 4OYOA 1LNQA 2DXDA 1B64A 1HR0F 2YH1A 2HNZA 2LA6A 3IXQA 5I3QA 3EGVA 4QIVA 2FZGB 3C46A 1IKVB 3C14A 2Z2YB 2VG5B 4QYZK 5MLCV 3MOJB 1RSCA 4UF4A 2W8KA 1ELOA 4OHVA 2AX0A 1M5KC 4ED3A 3AFGA 1NJWA 4IO1A 3R8YA 5IC4B 1VQYA 3POTB 1W7WA 2VPYB 2W2NP 5GMEA 1R0AA 2UVUA 4IYQA 1H73A 3GJSB 4NLXA 2VB6A 2FHKA 1QD1A 1Y4ZB 3RAMA 3DKDA 1D3WA 1LV5A 3NGDA 4NZ6A 1RAHB 2YKOA 4URGA 1U1PA 4ELTA 5B0FA 3JSBA 2ZKUA 2RQCA 4NLYA 2BJ7A 3LPYA 3MR3A 5JXSA 1PO6A 4IKAA 1YJ9S 2B9YA 3BBCA 1YVFA 3KG4A 2R7XA 1F9EB 1YITS 4OYPA 2GIFA 4ED6A 1C1BB 4PWDB 4WTYA 1E6YA 2ZBRA 3M8ZA 3ENAA 1AZSA 5KT4A 2FVPA 1TKZB 2R4FA 4CLKA 1SUQA 2BOAA 3V6DB 1CEZA 4HHJA 3PYDA 3MPYA 4C11B 2CJAA 2KRBA 5F8HA 1CBKA 2Y1JA 4PWUA 3GV8B 4NA2A 1N8RT 1T3OA 2HK2A 2B7CB 2BOPA 1S72S 2NPFA 2IDEA 3A3PB 3D0HE 1GH8A 3LP2B 2M5YA 3MMBB 3M1VB 4MT1A 5C25B 1D09B 4O44A 3EDRB 1FFSB 4DV5J 1FRLA 3W8PA 4JV5F 1U02A 1BMQB 4WK1A 4N76A 4LF4J 1RWNB 4X2BA 2K1RA 2DYAA 4JI4J 1VRQC 4NL5A 1C0TB 1SV5B 2VBZA 3OW2R 3AA8A 3FCWA 1HKAA 2MKCA 1L3TA 4F0KA 3IP0A 4M5GA 3JYTA 4CO5A 2RT3A 5I42B 1N34F 2ALYB 1S6OA 3NNAA 5GVQA 1PGZA 3EXYA 1RTIA 3BS9A 2OPPB 2FLNA 1T02A 2Y3YA 4TXSA 1VK3A 2E7XA 3W9HA 2QSFA 1S0MA 2J7WA 1Q7LB 2LFVA 5HMXA 2HGMA 5KFZA 3FFIB 3ET6A 3ETOA 1DY3A 3MAAB 5HQLA 1F3VA 3S8SA 4H4MA 1BE4A 1QY7A 1RZMA 2AP6A 3FRYA 1T9TA 4YEAA 3BGFA 3UE2A 2MZJA 4LR8A 2ZOMA 4ECZA 1CJUB 3H2UB 2W7AA 2C2ZB 4Y6IA 4DF8A 4ZIVA 5D0EA 2H5IB 3UQSA 3OSNA 2I1RA 2J0SD 3HFKA 3IM9A 3EUNA 4ZN3A 4PAAA 4OHYA 2RQKA 4WCEQ 5HVGA 3US5A 3ILLA 3QJLA 2MQLA 1AXQA 1LXJA 3ILJA 4OI4A 5H9FJ 4ILLA 2XS2A 3CCES 3BKTA 3IG1A 1MG7A 2GV1A 3EGWB 5KFHA 4YB1P 1UKUA 5I3UB 1KVJA 5AXLA 3KLFB 1FK9A 3DLHA 1TFWA 1FNMA 3LPEA 3N4WA 3BQ1A 3MMJA 1O8BA 1NDKA 4I67A 4Y65A 2M9KA 2VFSA 1OY9A 1SCJB 2DKOB 4GKKJ 1UFWA 5LXRA 3VAIA 2H54B 3D1OA 2HHHJ 5D3GA 3UDVA 2IHR1 4FF2A 2G9OA 1Y00A 3G82A 3KLGB 2NSCA 2XGPA 2HWTA 2RVJA 1S0NA 4NZ7A 5GAHI 4Z37A 2J8SA 2DPIA 4HT5A 4M5MA 1DAXA 3QT5A 1LXNA 2LQ9A 4QW8A 1RACB 4KGZB 1JLCA 5LOQA 1SC3B 2IBKA 5A8WA 2HGNA 2VG6A 4X4PA 1KOOA 3M2UB 3MEDB 2RQMA 4O3NA 4WFAQ 2H4YB 2ZBPA 1WG4A 3NCRA 2XS7A 4QIWD 6FDRA 2L48A 3FZ2A 1Q82T 3K0JA 1K1QA 2KB2A 4L75A 2K06A 3CC7S 4MKYA 2W24A 2Z30B 4RBUA 2AQ4A 3KK2A 2B9EA 5IT9Y 3I0SB 2Y0SD 4CLLA 4DWIA 3IGVA 3GZ7A 1C1CB 1NO8A 1RA7A 1Q95G 1XEZA 2NZCA 2G2ZA 2FVSA 4NA1A 3AA9A 1N5QA 4QCLA 2MLZA 3M9NB 4I2QB 4F2SA 4AT1B 2AEMA 4NLOA 1WD6A 3HHDA 2VFUA 3HHLB 3W9IA 5KT2A 3IR5B 3MM8B 5K14A 2IBOA 4DPUA 4EYHB 2RF2B 1W2BR 4A8FA 2J9EA 1N48A 1UPMB 1PBUA 4F4YA 3M30B 1R0BG 2QRRA 1U2RA 1QSYA 4FYYB 4HHHA 2G0CA 3KNAA 4RO0A 2NXEA 3R6GB 4M94A 2C2MB 1T3NA 2W2MP 4DSJA 1YDLA 2G2OA 3BH7B 3WIUA 2GVZB 3NBPA 5JVGQ 1YBAA 2YNFB 4NLPA 3DOKA 1JLBB 2P2CB 2D3O1 4UQTA 3J7ZT 2CNNB 4KO0B 2YWWA 3B6BA 5A6WA 2ZJRQ 1IKXB 4TLQA 3QGHA 2DNRA 4OJGA 1FX4A 3H5XA 4K4SA 4F26A 2CIMA 2ADBA 2RUGA 5JVHQ 4WFBQ 4NASA 3L09A 2VA2A 4JI4F 4LF8J 1LWFB 2FJDB 4P2XA 2DGQA 2AW0A 2MKJA 3UDEA 1BWVA 1TAUA 1IKYA 2HRTA 2B4PA 3MFHA 3KLHA 2XYHB 1LWXA 4URQU 1WSVA 2QT7A 2DNOA 4PG7A 4F4AA 4A46A 3LOUA 4EBEA 2D69A 2X1AA 2DCUB 3A13A 3Q2SC 2RAQA 1YHQS 1XC9A 3H2LA 4DSLA 2CQ3A 3MXHP 5LSLA 1HBMB 1S6QA 1GAOA 3M6UA 2F40A 4ZHRB 4PKDB 2VC0A 2HNYA 1I94J 1X4EA 1FXLA 1REVB 2UU9J 2J9DA 1DQ9A 4DLEA 1KQKA 4RUCA 4WBFA 2ACMA 2WHOA 4YUDA 2Q79A 3SQOP 3W2VA 3O44A 3FCVA 4DX5A 2N3OA 2YBVA 2BJ3A 4PPZA 1IWGA 4IR9A 4O23A 2DNQA 2JEJA 1PKUA 4JI0F 3H5SA 2BX6A 2FJXA 1SB6A 2FGCA 4HDHA 4TU8A 2FD2A 4O3SA 1QJHA 2XMWA 4DR3J 2V6AA 3QLHA 4L76A 1A9NB 2JVOA 1YWXA 2BQRA 1K0TA 2DHXA 4ZP7A 2ROGA 1KBRA 3DOLA 4RNMA 3MECB 2EKYA 2FY8A 1CPZA 3KDOA 2CJYB 3MEEA 1DHMA 2BANB 2B8QA 3RBEA 3OTDA 2WVFA 2AIRB 4WFZA 1BHNA 4CNZA 2IPOB 1RT4B 4RLEA 2ZBCA 4ZVHA 2BVZA 3MM9B 2IRUA 2CZ9A 5KFQA 3LA0A 1BLUA 3DLGA 3OL8A 3PJ9A 3UN2A 1RLDA 4XDDA 5CYMA 2F8HA 4FDFA 2NPIA 2KZZA 4DL3A 2OPRA 5F3ZA 1NKCA 3GFYA 1BGXT 2HQ3A 4FVMA 4HVZA 1KLMA 1HBOB 4USWA 4LFCJ 3KUGA 4X64J 2J0XA 1N0VC 1VCTA 3L95X 4DV4F 4M5DA 4DQIA 1H74A 2CZVC 1RTHA 3G8QA 4Q2LA 1JKHA 4HL9A 1HQEB 2HNDB 2YNHB 1V3ZA 4B3OA 3EX7B 3EGNA 3KJFB 4H4OB 2GIRA 3IN5A 1PJ5A 3OJSA 4CO1A 4DG1A 4JI8J 1S1UA 2P9CA 2EFGA 2PSZA 3OR2A 1DRZA 1YGYA 1J2VA 1B3TA 4LFAF 3R5CA 4CH0S 1N6QA 1ZZFA 1NB2A 4IR1A 2MB0B 2NREA 3PFEA 4KGKA 1LFWA 1LWEA 5DS7A 5BYQA 3OR1B 3RB4A 4USVA 1AYEA 2BE2A 3FUYA 1Y10A 4RWXA 2RMLA 1ZOTA 2V2QA 4TVAB 4RW4A 4NLVA 4WFYA 4KH1B 1T9WA 2E29A 4JI5J 4CH1A 4UOHA 2CVIA 3SI8A 2FYXA 3TAMA 1VQPS 4XIUA 2E5JA 1IKWB 1JK9B 5J1PA 4J9VA 1RU2A 1FE4A 4TQSA 4GMKA 4UQGA 2J5AA 2WSFC 2F4VJ 5FLXY 1R8BA 2CQDA 2RS8A 2JH3A 2A0FB 2OUGA 4LSLA 2XBPA 2E1RA 1QSSA 3ZXWA 3TJ9A 2X3DA 1NK7A 1NK5A 4FF1A 1N56A 2FJVA 1RAFB 1MWQA 2DRBA 3N01A 3SQGB 4X4VA 4MMOA 3TAQA 3KJQB 4OI6A 5DZ6A 1FDNA 3FGVA 1SC4B 2K7KA 9ATCB 2C2DA 5B09A 1P9QC 2CFXA 4I2PB 3VGUA 4QR1A 2ROEA 2V4RA 1O0PA 4N8NA 5AXNA 1HNZF 1H2UX 2WVDA 2Y9HA 1U49A 1JXLA 2HBYB 2GQ2A 3CCLS 2Z4PA 3AHPA 3EPIA 1NAQA 3BQ2A 2E1AA 3VCDA 4GKJF 2E66A 3MM7A 2NXJA 2F65A 2PI4A 2RU3A 4IFVB 3PACA 2AJ2A 4K5SA 2DXFA 3ZNUA 2KM8C 4DV3J 2QN6B 2HFZA 4HHUA 5A2QY 5HQMA 2JVRA 2R3VA 2DGSA 4DQRA 1W26A 4QWDA 3DYAA 2JOQA 2XSJB 3KJVA 1HNWJ 4I69A 5M2RA 1NM2A 1WUUA 2D7SA 1U47A 2GQCA 4RW7B 4DS4A 3O8WA 2FGOA 3HK2A 4I6YA 4CLSA 4B9VA 2XGQA 3G2XA 3M2RA 3MR6A 1P1LA 2COLA 3PHEA 5ETTA 4IOBA 2KU7A 3J7AN 2J7UA 4Q43A 4UT4A 3HXMA 3UWTA 4W90B 1XERA 2BRKA 4RW9A 3V6JA 2YXLA 1HYSB 3VGTA 1NDLA 1J5OB 3QSIA 3VGSA 5F8NA 3C2PA 1JLGA 5H9FK 3AOBA 2BE9B 1VGYA 1GT8A 2DNLA 1S48A 3DI6B 2V94A 1KR4A 1KHVA 2WB4A 5BYRA 4P6QA 1PAEX 3FNNA 5D4LA 3QPIA 5HMZA 2Y1LB 4K4WA 3MEGA 2V68A 3TUZC 3RR8A 3TX0A 1PJ7A 1JJ4A 2XY6A 3I56S 3PEJA 2J6TA 4Q7AA 3OHBA 4F0HA 2DJWA 4AQYF 1JNRB 4CM2A 2VQEJ 1AT1B 2P6TA 5D0RA 5JUMA 4OQJA 4GVBB 4X4QA 4F4KA 1DQAA 1F2GA 1IR2A 1YLXA 4TQRA 4LSNA 3LTOA 3TUPA 2QE5A 4W98A 2BKOA 3KG1A 1Y5LB 1NK0A 4DUZJ 2QG9B 2G0JA 4RL1A 5J2NB 3DOMB 2NUHA 3NS7B 4WE1A 4Y2AA 3QATA 4NXNJ 4C3KA 2BJDA 5HI7A 2Q1LA 4DHVA 3OQ2A 5E33A 3JSMA 1DQ8A 3R9LA 5A0YB 4LF9J 2OSRA 1NPRA 5IC6B 3A12A 1N52B 1HWIA 3DC2A 4YN3B 1WDTA 2EC0A 4J91A 5KOXA 2YNGA 3HM9A 2DGVA 4YFUA 2ZEJA 2G4BA 3NLCA 1UFLA 2GGPB 1AFJA 3HSJA 1OMSA 1WF1A 2K3IA 4KGXB 4ZP6A 2YKMB 3FJ2A 4OZNA 4OZ3A 2R7UA 4JI8F 2H48B 1QVFR 2BYCA 3G6XA 5BR8J 3BO2A 1Q8BA 1FKOA 1VQ6S 5L9XA 1FKPB 2WW4A 4C3LA 1ULRA 5DM6Q 2M88A 3ISNC 3W62A 4HT7A 1S1WA 2C3YA 5GAEU 2GAHC 2HZVA 3QRRA 1NJXA 5IQQA 5DG8A 1WKKA 1X7VA 2CZ4A 3Q22A 3VQTA 5L38A 3OL7A 4OLPA 4U67Q 3QQCD 2OTJS 1H2TZ 4AUKA 1RTDB 2BA9A 2YKPA 4YB5A 3C66A 4JI6F 2OPQB 4PEOA 2V4QA 3HSDA 4PQUA 1FK9B 2RIJA 3I32A 4OIXA 5DJBA 5AJ3J 4ERDA 1MU2B 2HLUA 3GFHA 3MPDA 2ZH1A 2W2OP 4OI0A 2O66A 2VH7A 3QJPA 2WB1D 4PUOB 1N36J 3H8YA 4K0KJ 2WAQD 2RRBA 2E44A 1Y3KA 3DRRA 5ETQA 2OD4A 3V81A 2Z0GA 4NPOA 3OLBA 5K20B 5IOLA 5A2QU 5KFCA 4A8SA 2FC8A 4DX6A 1CC7A 4YQWA 4MH8A 4ZVRB 3EGZA 3AB2B 4MKVA 2HBRB 1C4CA 2ZJPQ 2L3MA 3R5AA 2CDRB 1EP4B 1WACA 2B6AB 1JLCB 1VQKS 4X4NA 3BGLA 3DDKA 3UCUP 3PR5B 5A8WB 1NBEB 2DPJA 2IMOA 4CT8A 2EBEA 2LXFA 2HVEA 4FNHA 4J9UE 4DFMA 2EBGA 5F8GA 4R25A 4HI2A 2W1BA 4DV7J 3THVA 3CJ0A 4I7FA 1WORA 2XSFA 4B3MJ 4PG6A 2DRDA 3MMAA 2XLKA 3J81Y 1R31A 1XR6A 7FD1A 3I5BA 3ADAC 1HHQA 1GMWA 3DMJA 1S0VA 2VA3A 2KT5A 3FQKA 3TZXA 2XWXA 2O5DA 3I82A 2RQ4A 1LFPA 1RWWB 2JLFA 3SV4A 3T5JA 3UN3A 4CDIA 3GCWP 3UPFA 4L72B 3T6BA 1CS4B 5HJXA 4CIOA 3K8VA 1PC4A 1SJ3P 1UPPA 4U8VA 3HFZB 4G3IA 1S1TA 3HO1A 6FD1A 2KN4A 2XMTA 4QU7A 1S1VB 1HBNB 4Z7YA 2MSTA 2ZH9A 2LQ8A 2V4JB 5CCMA 4IFYA 3R5GA 3M6VA 2NQPA 1TL1A 2J76E 2JDJA 4ZP9A 4LREA 4CRJA 5ETVA 1HL6A 3MF5A 3PYEA 4ECXA 1B0TA 2IC3B 2ZE2A 2OIHA 5HLFB 1BQMB 4NLGA 1GX5A 5A8KA 5G0RA 2W9CB 1RT3A 1JLEB 3BKUA 4AXIA 2WONA 3PJWA 2A6OA 3LP0A 3KHGA 2VV5A 4USKA 4YY3F 4X4OA 1UEVA 5KFRA 2VQEF 3AJ1A 4HTIA 2UXDF 2JFKA 4S0MA 3K59A 2QZ8A 4WK3A 4F4ZA 3NG8A 1A0OB 3F0NA 4U6PA 4ZPVR 4FS1A 4FXDA 1X4HA 3IRXA 3GJRB 4JI2J 2I6WA 4YB6A 4IG3B 4NYOA 5T7LA 3HDSA 2MQ8A 3ZTPA 3CD5A 4QR0A 1LW2A 2RHQB 4WP3A 5C24B 4A8OA 1A6LA 1H2VZ 1S76D 4J9OA 4ICLA 2LQBA 4O4GB 3G6VA 2KM8B 2UXCF 1L3SA 3ISZA 5L9NA 5LJ3Y 3OL6A 4HEA9 1U4BA 1ZA1B 4DZ6A 2HW3A 1YSJA 3D6TB 3C6UA 1UWBA 2EG2A 4J9PA 4WWSA 2W4CA 1APSA 2QLFB 1HD0A 2D3ZA 4OHZA 2EW9A 2HFUA 2ZD1B 4DQPA 1GXLA 1HHTP 3C8YA 1UWAA 1YJNS 2IDLA 3PO5A 1CSJA 3HKZD 1KN6A 4XO0A 4C97A 1IKVA 4A4JA 3HVRA 1RGVA 3PW0A 3MCNA 3D1HA 3HP6A 2VG5A 3MAQA 4A8QA 1S7IA 1FWKA 4E8UA 2W2QP 3MD1A 1UVJA 1WC1A 2RKIB 1WNEA 2BKPA 1CJVB 7AT1B 3C19A 5A76A 5ETKA 2O01C 4KPCA 2C2OB 3PKYA 3POTA 4ZCMA 1SJ1A 3HSZA 3P5BP 5CYQB 3NKYA 3HX9A 4H4KC 3LH2S 1UVIA 4DR7F 1HNVB 1I1GA 4KHMA 1H98A 1GMWD 1NEEA 1JJHA 4P2MA 4PXCA 4FPRA 2EWHA 3A8IA 2L41A 4RUAA 1NK4A 1QAJA 3M8QB 4WKYA 1EB0A 1M5OC 4G6VB 3T9NA 4LF7J 1C1BA 1NHKL 4PWDA 1NJYA 2V9WA 4ZITA 3LGMA 2DHSA 1DLOB 2VZ9A 1TKZA 1SKSA 3UD4P 2K7JA 1VISA 1N36F 3V6DA 2IA0A 4V19X 2UV8A 1KONA 5HMWA 5A8RA 1GXTA 4C11A 2RRAA 2DH7A 1GEHA 2MZQA 4BLGA 1NZ8A 4NCGB 3P6YC 1U25A 1L3VA 1AFIA 2R7OA 1QUVA 5I3PA 3JSRA 2UVVA 3DHWC 1WJ9A 1F5AA 4B3RJ 2P5VA 3LP2A 4JUZA 1UW4A 3MMBA 3M1VA 1RWPB 4ZLJA 2J8AA 1SJ4P 5JJBA 1VHIA 5C25A 4WIIA 3BREA 1KQSR 2IVFB 2V5HG 3BJYA 2K3KA 4M5LA 4WZMA 3J80Y 1Y7PA 1MN9A 4JI3F 2A6MA 3E8OA 3M8RA 4F4WA 3GSDA 1HWKA 3CNQP 3EE3A 5EWEA 1C0TA 1SV5A 1N32F 1F5CA 2C2EA 5FDLB 3UD3P 2XHWA 1OQ6A 2N7CA 2ADCA 3GLJA 5FJ4A 2R2RA 5J2MB 4AL7A 5I42A 2HHUA 1UJ4A 2HZCA 1TK0A 2F5GA 2PMZD 4F25A 4I0WA 3IR7B 4EUVA 2NSBA 4C8LA 3JTPA 3MM6B 1X5OA 1X0FA 2ZBQA 2N7YA 2OPPA 3CC2S 2H51B 1FT8A 3M8WA 2PO4A 2HFOA 2AU0A 1OYEA 2VICA 1EQMA 5J2QB 1BQNA 3FFIA 4YB7A 3VAJA 4I68A 3RBDA 1U09A 3MAAA 4MIAA 3D0GE 3M8YA 4KBIA 4HACB 2PN6A 2HAFA 3H98A 1O5JA 3JTNA 4A47A 2DNKA 2OP5A 4CLUA 1NUEA 1IBLF 1JXEA 1CJUA 2UZAA 2R8GA 4K5RA 2E9TA 1BQXA 2ZH5A 2DHGA 4Q2MA 5K8NA 4HLBA 2BJ1A 4MTPA 1FX2A 1I6JA 3ENWA 3VZHA 4HR2A 1HW8A 4EO8A 2OSQA 4I56A 1RHJB 3AOCA 4DR5J 3I0RB 3A4TA 5I3UA 1FESA 2LEBA 4ZVQB 1UFKA 3W5XA 4N8OA 5KFAA 4TNOA 3KLFA 2G13A 2F8MA 1WKLA 8AT1B 2PMWA 4WP9A 1IWAA 3LW5C 1EKSA 3T1YF 1XK8A 4NMLA 4DR2F 3CCTA 3BDPA 3IGNA 3C16B 1ZM2A 1GQEA 5F8IA 4JV1A 3PIOQ 4P72A 2AZ3A 4B3SF 3G86A 2LDIA 1YBTA 3CWJA 1OPZA 4F3QA 4P71A 2VBWA 2EFNA 2V2KA 3D3CJ 1FRMA 5KG1A 5IZHA 3AJDA 3G87A 1WHYA 3VV2B 3KLGA 3Q8QB 2ZC4A 2FHJA 4NXMF 2P9GA 2H65B 2VDIA 3JSYA 4ZPDA 2NXUA 1KVKA 3HLUA 1N4LA 5C2GA 3H42A 3S1TA 3M2UA 3MEDA 1YIJS 2QLWA 2ILZA 5GAHU 5DM7Q 3UFCX 2XYPB 3TZWA 2W9BA 5LM7E 4NYPA 3TW0A 2X3GA 3KYLA 3WZ0A 1VLYA 2XCPA 1RHKB 1X5PA 1GNKA 2KI2A 2ALZA 4DFPA 4ECYA 3SCKE 3R3TA 5KG2A 1FJGF 3R6LB 4DPYA 1NSKL 3N6NA 2C2RA 1IQZA 3CJ3A 2UV8G 2IM0A 1S12A 3I0SA 3THPA 4FVCA 1U8WA 1Z2ZA 4PXDA 2MQOA 4DBQA 1C1CA 2MLXA 2DT9A 5KT3A 2DO0A 2V8GA 2B4VA 1Z2LA 2VPWB 2CQ2A 2ACYA 4ZLNA 3R7NB 5C7PA 3FZBA 1HWUA 5KFYA 2DK2A 2WBRA 3TQ1A 2BXJA 5GAGI 4I2QA 4KH0B 4J90A 3UR0A 1QAIA 2DY9A 3HHLA 3M32B 3MM8A 3I87A 3JB9k 4G65A 4CO0A 4KGMA 4WJBA 2GA7A 4DR1F 4ZVEA 2HQDA 2RF2A 1IBKF 2E7VA 2NZ4A 3D66A 3IFEA 3M30A 1IM6A 3PZPA 2MQMA 3FC9A 1Q1KA 3CF5Q 2CKWA 4P2FA 4C6AA 1WG1A 2R7RA 2JHEA 3N5FA 2ZH8A 4DDFA 5AXMA 3MPUB 2C2KB 1RK8A 1R8AA 2GVZA 3CJ5A 2CAJA 2XY5A 2YNFA 2NLWA 2YWHA 3D3BJ 5KT5A 1JLBA 2MSSA 3KLIB 1LEOA 1B0VA 1HR0J 4KO0A 4W92B 1RHMB 4O0NA 1IKXA 3MI7X 3QRQA 1WC5A 4CP5A 2KO1A 3UCGA 4A8WA 2JLEA 2BE7D 4KKOB 2ZM6F 4BC7A 4NA3A 1YJVA 4DR4F 4ECUA 1YZ6A 1VRTB 2NCKL 4U9RA 2HHWA 3ZZTA 1LWFA 3CCVS 1F2HA 1FJ7A 2HK3A 1N33F 3R5DA 4EO6A 4DL5A 2DNNA 5ITHA 1Q78A 2VFRA 1UW9A 2MYFA 3IS9B 3NCPA 3TYTA 2DCLA 1R27B 3JXOA 3BF4A 1AA1B 3CCZA 2ZUGA 1CJKB 5D6GA 1HBMA 2E5LF 1T9YA 1C0UB 2WRMA 4ZHRA 2AYBA 3M9MB 2CQ4A 3NXZA 3HHNB 1VC5A 1X9SA 4ECSA 5RUBA 2ZITA 1REVA 2AGPA 5IT0A 4OJ3A 3F41A 3RGIA 4EZ9A 3PX0A 1UVKA 1X4FA 2V67A 2AHOB 1VHFA 2JEIA 1LK5A 2BW2A 4YHHF 3TQEA 1NSPA 3E51A 3MR2A 1RAAB 1FDDA 1RAIB 1RTJB 4IG0B 4KT0C 3D7SB 1CC8A 2YWKA 1ZM9A 2IAJB 3I9ZA 1SJFA 1RWUA 4KQZA 1UZDA 4RU2A 2IY5B 1FI4A 3SCLE 1NJZA 2YQ1A 4RR5A 3T1HF 2G1DA 4NE9C 4HYKA 2GJ2A 3KLEB 4C48A 4WF9Q 2LP4A 3RR7A 1TK8A 3FRZA 3EJMA 3MHYA 5M2UA 2QIFA 2ZDOA 2I2YA 4KRWA 1T03B 3SV3A 4BS2A 5EUHA 1MW7A 3MECA 2CPFA 2JZ5A 5ETSA 3MCOA 2O3DA 2MLYA 1NXIA 4DQQA 1NPPA 1U45A 2DR9A 2BANA 3R5JB 4NRTA 2JL9A 3KDNA 3ENQA 5HVFA 3FSXA 3MMAB 3P45B 2HSEB 4IO9Q 4CQ1A 1RT4A 4P7TA 2MKYA 2OPSB 1RYRA 4LBHA 2DGTA 4LT6A 1LW0B 2CA9A 1AB8A 1RISA 1NH8A 3FBEA 4IRCA 5CZXA 2RB7A 3PKMA 3QYYA 4LBIA 3R2CJ 3G9CA 1XTZA 3HHLD 4LSZB 5J2PB 4TU7A 1HBOA 3TVKA 1OQ3A 1EETA 5L1LA 3D6HB 3OVSA 3CSKA 3AXKA 2X51A 1P9YA 3V4IB 2HHVA 3HSGA 3DM2B 1HQEA 2HNDA 3D5MA 2YNHA 3PW4A 2VJVA 2MHEA 4H4OA 3RAXA 1C4AA 2PEBA 1U24A 3H90A 2FJBB 4OYBA 4USJC 1NMEB 2MPUA 3HT3A 4UUXA 2XO7A 2ZNZA 1SJQA 2DNGA 2DR6A 4OX7A 2J6UA 4IDKB 1FCAA 3GCXP 4ER8A 2C3PA 4KTQA 1MMNA 2XEXA 4FYVB 3OR1A 4CO4A 3IAM9 1LQ9A 4MK7A 4XTTA 2GQQA 5KFWA 2DGWA 2ZFHA 3ZTSA 2KG0A 1WWHA 1HNXF 4LF2A 2AYGA 1AW0A 2E5GA 2OFHX 4QBUA 4RJVA 2QLXA 3MDFA 3FQLA 1IKWA 4PQAA 3M6WA 5U47A 1VMBA 5E7OB 5HATA 2KTQA 3K7RA 3NOCA 2VG7B 1KTQA 2CUYA 2CPEA 4LRDA 5KT7A 4NLSA 2JLGA 2LEPA 1XMQF 3PNIA 5EGYA 1S1XB 2UUAF 1CVJA 4N7TA 3DLEB 3LP1B 2KT3A 2LKZA 2MY7A 2O67A 1D0EA 4NCAA 4BBYA 2HHXA 3VALA 4LRFA 1P6TA 3SQGA 4QJVA 2JSXA 2HQFA 5K8MA 3SBMA 5ETNA 1CG2A 2RILA 4F0MA 2FLOA 5DLFA 1UEKA 3GR1A 4RPFA 3LAKA 4Q8FA 2LQJA 2POKA 1F0XA 2DISA 1RUSA 1L5UA 2CPIA 1TUVA 4I2PA 1YRTA 3DLJA 3HVTB 2FC9A 2XLJA 1DTQB 4DV2F 3TANA 4RZRA 2MEWA 1YJTA 4Z7CA 2CXEA 4FBTA 3PVXA 3PX6A 4WKRA 4BWMA 1V3SA 1QTMA 2IVYA 4P10A 2V8VA 2HEKA 1YG0A 1VBZA 1T8EA 2JEGA 3BEGB 3CB4A 3OV7A 3I55S 2R7SA 1FTCA 1TAQA 4DN0A 1M5SA 4IFVA 3OTOF 3PTWA 4EU0A 1R7IA 5KT6A 2WW8A 2R8JA 2ZWPA 2VD3A 1RI7A 2JC0A 1NPKA 2DEJA 2BUNA 1Q0NA 2GMLA 5J1EB 2XSJA 3MPWA 2DHAA 5EX3A 3BKFA 2XC9A 3ZZRA 3I31A 2EFQA 3DRSB 2XMMA 4RW7A 4ZK7M 1WEZA 2GJFA 3WBZA 1V5VA 5E3PA 5HROB 1MROB 1OSCA 1TUGB 5E41A 2MJNA 1KD1T 4I6WA 4JI7J 3DXBA 1HYSA 1T05B 1J5OA 8ATCB 3D6MB 3QIDA 3HMJG 1SKWA 3DGVA 4EEYA 2ZKTA 3UVJB 1YJ7A 5A8RB 3L7PA 3MOZA 3DI6A 1QAXA 4FYXB 3G8SA 3KHRA 4ILMA 1ACMB 1VQNS 2KVIA 1U6ZA 5ETLA 2OEJA 2LXIA 2HQCA 5D78A 2FHMA 4CLZA 4HKQA 2FHOB 4I4BA 3TUJC 2DNHA 3JQKA 4GVBA 1FTRA 1Y3JA 3Q8SB 4JV2A 1SH3A 4IRDA 2R9LA 2F9DA 1HNIB 3VVUA 1U8SA 3TVYA 4M5NA 3OUYB 4RX6A 1N5SA 5B08A 2RU9A 4FXVA 5K8PA 5J2NA 3DOMA 3LWMA 4B02A 1VQOS 3ENVA 1Q7YT 5DRKA 4XPEA 1RTZA 5A0YA 5HL7Q 3DU6A 2K8GA 4KY3A 2VHGA 4OX9F 2AV5A 2DIVA 4P7VA 3UNYA 1MMDA 5ETPA 4CO2A 3CT9A 4DL7A 1VJQA 5KFUA 2JRSA 2HYIB 3T6JA 4ED7A 4ES3A 4RNHA 2GGPA 2ZHBA 3S01A 1IVZA 2XMUA 3GP9A 3MCSA 2FZCB 3D4JA 2OKQA 3AY0A 2UVWA 2KFZA 4ED5A 1YJRA 3M4XA 1BQNB 4CYUB 2YKMA 3LAMA 2W25A 4B9TA 4LMZA 4TYBA 4BCAA 1VBYA 1S9GB 1MN7A 1WC3A 5DDOC 2CDQA 4CZCA 2HMIA 1TL3B 4YDXA 4NLUA 2FZKB 2HURA 1WC6A 1NK6A 1FKPA 1WHVA 4JI0J 2AMCB 2B51A 4X62F 2UXBF 1S57A 3QAUA 4LF1A 4DU8A 2MKIA 4YDDB 3LWLA 4OI1A 3RAQA 4DSFA 2C28A 5ADZA 4FF3A 5CXTA 2H3EB 1HBUB 3L4BC 4TY8B 1SL2A 4NLRA 3L9ZA 4GRSA 1RKJA 5LXYA 4QWEA 1FNXH 2HRYA 1SQGA 2WBMA 3DGPB 1HI1A 1RTDA 3UDLA 1ZTTA 3PG9A 2OPQA 3AD8C 5IFMA 4PRFA 4JP8A 4DN9A 1P27B 5THWA 2KKHA 2LA4A 3KNGA 2YTCA 2Z57B 3P8BB 3G6ES 1OSDA 1MU2A 1JX4A 3KLVA 3MM5B 1AUDA 4DR6F 4DOZA 4NWBA 2XB2D 1WI6A 4LF6F 2C42A 4PUOA 1S59A 5HAOA 4ZVGA 1YTYA 2KVQE 1JLFB 2CG4A 3RB0A 2Z8QA 1ZTWA 5FIIA 5IM0B 4BWJA 1HIYA 2ZBIA 1FWPA 4MK8A 4DPWA 2BDPA 1M5VC 4DV4J 2QJ3A 3VZIA 1B99A 4ED0A 4K50A 3VAGA 1FRKA 1Q8LA 2YH0A 2GO9A 2HWHA 3G8TA 1F9FA 1EP4A 3C3LA 2B6AA 3K57A 1VRUB 3B54A 2B0GA 2AKWB 3BBFA 2J6SA 1FXDA 2CQ1A 3QJJA 1BWEA 2W7PA 3THTA 5DQGA 2XULA 4LFAJ 2H4WB 1UL3A 2W9BB 4O3RA 5I4MA 5HJYA 1SL1A 1FJCA 4DV0F 2C3OA 1MLAA 2W9AA 1TKTB 1XNQF 2R8IA 4QWCA 3OFHA 5CD4A 1FHTA 4Q45A 2XMAA 4RNNA 3OPKA 1K9MT 4DXLA 3QO9B 5CHCB 5DETA 3FBFA 1TKDA 3B4DA 3MAHA 5F3TA 4ECTA 4J9QA 4CLPA 3W8GA 4YR2A 4PXBA 4OL8A 1XBWA 5LMUJ 3VGVA 3HFVA 2Q43A 3G6YA 4J9SA 3NNHA 4G1PA 3PY8A 3IBFB 2F63A 3EZUA 2CADA 4DUYF 2QEXS 1CS4A 2QL7B 3SSSA 4GVLA 2YVSA 5GADU 1PYSB 2HHPA 3HULA 1SKUB 4DQSA 2CPZA 8RUCA 2Z58B 2M70A 1TVRB 4OYAA 4JI7F 4AXJA 5CCLA 2HVDA 1S1VA 2ZHAA 2YX1A 1HBNA 1CULB 1O6XA 2V4JA 4Q44A 1XQIA 4KIAA 4ID5B 1H3DA 4Y2CA 3CCQS 3F56A 2W4DA 3OJUA 2BABA 1JXVA 1J27A 3DNCA 1HQ2A 2IC3A 4ES1A 5IS2A 3MPVA 5HLFA 1BQMA 1NDPA 2LU2A 2KHDA 4K59A 4WU3A 5D4OA 5KG7A 2D74B 1U48A 2IYIA 2W9CA 1JLEA 1S6UA 1SVDA 2J0QD 2HIYA 1KC8T 4DSIA 2D9PA 1NU4A 1HNZJ 1WOOA 2ZNYA 2FVCA 4EK2A 1VI7A 5DGAA 3Q8YA 1UP1A 5C42B 2PDAA 1VQ7S 1JWWA 3R1HA 3AODA 4QIEA 2FLLA 1FWLA 4GKJJ 4WXWA 1SXLA 3P96A 2HIQA 1VC0A 4ZKAA 1YRUA 3TJAA 3WX8A 4IG3A 2HWIA 3ELHA 2C22A 5F8MA 3A8EA 3CCUS 3TA0A 3GR0A 3ZZPA 2I0XA 3CGIA 1WOPA 5C24A 1WG5A 5T14A 2E1PA 5H9EK 2B43A 3I5CA 3ZZZA 3NAHA 4O4GA 2GFFA 2BACA 3FDSA 3KK1B 3E3XA 2DHHA 4ZMMA 5HP1B 1PCAA 3HZEA 4G1QB 1RCOB 3LQVA 4FYDA 9RUBA 3D6FB 3KOAA 4P2SA 1UAWA 2MMYA 3RG6A 2D3OR 1URNA 3ILOA 1M5HA 4QIFA 3RYLA 3AXMA 1GMUA 4RWWA 3FSYA 1QE1B 1UVMA 1EAYC 1RWOB 2D3UA 2ZD1A 2M4MA 5DG7A 3QGGA 2EI5A 3FMWA 4J9KA 4KC5A 3Q8UA 4NZ0A 2E5HA 2A3JA 2VDHA 2YWGA 3DXSX 3R1LA 1H38A 4U7UK 1A7GE 1R8HA 2QFIA 2RKIA 4KE5A 1CJVA 2GMHA 4B08A 3KK3B 2QL9B 2X1FA 3O6QA 3CD7A 1PYOB 3V6HA 2LLZA 4KGVB 1FF2A 2GS8A 2R7QA 4E98A 2DGOA 1X9WA 5CYQA 3J7A1 2CNLB 4AQYJ 4ZVSB 2H9ZA 2FUG9 1IBMJ 2EG1A 4PG5A 3LF0A 2HVZA 1KEKA 1HNVA 2CNKB 3OTCA 2Z2LA 1FO1A 3W1YC 1KQGB 3V2UC 3AOAA 3GIIA 1UZHA 1X4CA 2HS0A 2CQCA 5AE3A 3M8QA 1EZZB 1FFGB 4ZP8A 4J9RA 2D1CA 3CDUA 4Y0FA 2ROPA 2SXLA 4C0OC 2IMWP 1Q81T 1DLOA 4MAKA 2MZRA 4LBPA 2CJXB 5EN1A 1GMVA 1ZM4A 4DI6A 4B3TF 5F8JA 5KFLA 2QA2A 4KJIA 3DDNA 1FEHA 1NSAA 4OZ1A 1NHUA 3GV5B 1EETB 4NCGA 4Q0BB 2DGXA 2LQ5A 2OTLS 4HI1A 4TKTA 2PFFB 1X60A 1VQ5S 1WHWA 2W2PP 4J37A 2D9OA 4C8OA 1XMBA 4F3MA 5D4PA 4WYLA 1VK8A 3HKWA 3NS6A 4ZJQA 3TARA 3GQCA 2ERRA 4NLTA 4ZVPB 4YP3A 1YZ7A 4RW8B 4ZCLA 5L1IA 2BQ3A 5KG6A 5KFVA 2PA8D 3AAWB 4K2JA 5FDLA 1R89A 1RBOB 3GYGA 2MJUA 5J2MA 1QAYA 2BKNA 2FVRA 3R7SB 3PW2A 4Z2XA 1SQFA 3GG0A 5LMUF 1EHWA 1S7HA 3MM6A 5H1SV 1ZZNA 3KUEA 3N9UC 4JI6J 2BV3A 1NRKA 5BXIA 4DJBA 3TA2A 2YKAA 3TZYA 2RRNA 3G96A 5K5MA 4CTAB 1HMVB 4LRCA 3PEHA 5IWAF 1E6VB 3QSYB 3NMAA 4V19J 1NK9A 3L7UA 1TMMA 3PX4A 5J2QA 4F67A 3HI9A 3U02A 3HJFA 2HVIA 3GYXB 4IUFA 2GVDB 2NXCA 3DLLQ 5E0OA 4K4YA 1KTVA 3EYZA 4HACA 3Q8PB 1HQUB 4P75A 3K8WA 1SIWB 2ZC3A 1H7WA 5LMNF 4NEZA 3CCMS 3K89A 3AD7C 3GFXA 4BC9A 5D4NA 5M2PA 3SZ2A 2DVIA 1IXKA 3JAMU 4MK9A 3CCWA 2V50A 3AD9C 4N5SA 3Q89A 4FN5A 2IFXA 1QTNB 3AQPA 3I0RA 1DFDA 1QUPA 2YX7A 1FNOA 1K73T 4X66J 5L46A 3E01B 2L9NA 4ZS6A 1OY6A 3V5RA 2RE1A 4PYDA 3HCXA 3JQJA 3TEGA 4KAIA 3FKBA 4DU7A 1M1KT 2FDNA 2CPYA 3OXFA 2YNIB 3H2VE 5F0WA 3C16A 1TKXB 1YK9A 3OBIA 2DNMA 1RXOB 3TNVA 4EZ6A 4KYZA 4DMZA 4AFFA 3SYZA 1JIHA 4CT9A 1S0OA 3P5TL 1YJUA 3CJKB 3FMBA 1O51A 1TL7B 2OHDA 2O1PA 3GJQB 4E2FB 1REGX 1IBCB 2RJZA 3EVMA 2VQFF 3W2WB 4JB8B 3QZ8A 2R2SA 4Q8EA 2D41A 3SXLA 4CO3A 1RT5B 2JC1A 2JX2A 2NXNA 4MIWA 2ZH6A 4LFBJ 5DO2A 3QFWA 2V2VA 4A8KA 2Q6CA 4USIA 5AE1A 1HPZB 3H7HB 3N5BA 1J5EF 2GJIA 4YOEA 1X9MA 3RRHA 3WDOA 2UUTA 5ETMA 3NWGA 3IWLA 4Y2IA 6AT1B 4F2RA 2DO4A 4OV1A 1WHXA 2DTJA 3MUVP 4YY3J 1VJWA 2P6SA 3W65A 1IBMF 2OO4A 4PCQA 2UXDJ 3CJ2A 4L3NA 1C2PA 1VQLS 4HTJA 1DJ0A 2IRYA 4RU9A 3NGSA 2CJQA 3FEYB 4ZVOB 1OPIA 2UP1A 4FP9A 1TL4A 4U7CA 3ISND 3TX8A 4UY8T 3NGKA 1NJIT 3M32A 3ONQA 3P49B 2NYIA 1JLQB 3W66A 3H0PA 3SDEB 3GMGA 1VIXA 3BZQA 5GAGU 1ZS6A 2E1MC 3AJ2A 3EZOA 2BM1A 4FPIA 3GIRA 2CQIA 2XHCA 3M05A 4DV6F 1D9AA 2YKNB 2F8EX 2UXCJ 3TRGA 2MKHA 3RU0A 3O1LA 1XNRF 2KG1A 2B5JB 4IQMA 3EICA 2ASLA 3IM8A 3Q23A 1RWXB 2OEMA 3N0VA 3KLIA 1PILA 2Y0BB 4K4VA 4R8UB 4ITSA 4XDCA 3A3NB 3KG0A 1K8AT 3MD3A 3CCJS 4L73A 3SFUA 4GO5X 4IH5A 2WVCA 1IN0A 1UJ6A 2HS4A 2HMIB 3DU5A 2H5JB 3SFGA 3PRBA 3OFEA 4KKOA 2RSQA 4ZOSA 3VF0B 5HK4A 3NS5A 3UN5A 4O3PA 3CD6S 3FEXB 1KSPA 5L39A 2QYCA 3A1YG 1VRTA 2X1GA 2B4OA 1X4GA 2G1HA 4QWAA 3SSQA 3V6KA 2WSEC 4FKXA 1RAGB 3CULA 2CPJA 1Y9OA 2WOMA 2B3TB 2V9KA 3RUBL 4AL5A 4GC7A 3EXCX 3T19A 4BHQA 1VC6A 1M90T 1G4CA 3IS9A 3MR5A 2P9EA 1AUSL 3CIZA 2JFDA 1SC6A 4MYTA 4FBUA 3MTKA 1RT6B 4DR7J 4C0HA 5KG5A 4AYBD 1NKEA 1T0TV 1UVNA 1CJKA 2FIUA 1LWCB 3RBXA 1RHRB 1C0UA 4H4KA 3ILIA 3HT0A 3SIPB 1B4SA 1HA1A 2FQQB 3RTVA 2M52A 4ZCKA 1ITPA 2V63A 1NH7A 1S6PB 2W4PA 3TAPA 2CQHA 3OVAA 1JLAB 3UI3A 5KFSA 1U1RA 2XO6A 1UA1A 3RB3A 3W61A 3PIPQ 5C5JA 2VPZB 3BBBA 3BN4A 4L74A 1RTJA 4IG0A 4M95A 4EYIB 5KG3A 2NS1B 1WF2A 4ECWA 4CM0A 1T9VA 1VIOA 5IQ6A 3VAKA 3G71S 3AH6A 5C2CA 2IAJA 2OD6A 3O2IA 2OI2A 1RT7B 4ATNA 4N77A 3QAEA 2V34A 4RUBA 3Q8RB 3KLEA 3D0IE 1V5IB 4JI1J 1V6HA 1T03A 2ZWOA 2K2PA 2RUSA 4BDPA 4DCJB 3MEKA 4JOUA 4X66F 3TVZA 1S9FA 4KFBB 4JI3J 3U27A 3M8PB 4F02A 3H40A 1N32J 1UMJA 5DG9A 2OPSA 4AE5A 1KOHA 1LW0A 3FEZA 2XMJA 3W5YA 5EHHA 1HI8A 1K47A 2HFSA 1FEEA 1U1MA 1GK8A 3BPDA 3VR1A 2DB1A 3TA1A 5GADI 3W9JA 1KFSA 1SH0A 1LKZA 4YS2A 4DCOB 5J2PA 2X1BA 3CE8A 4M5KA 3TWZA 3C15B 1RAEB 3PRVA 4QYRA 3CDWA 4C2MA 1KKHA 3V4IA 4NI2B 3Q83A 3DM2A 1DURA 3L3CA 4OYMA 4C3MA 3HHKA
chains in the Genus database with same CATH topology
4PQAA 1GTHA 2IVMA 3M6WA 2IRXA 4I2PB 4KFBA 4QR1A 5U47A 5CYJA 1VMBA 4ETZA 2ROEA 5B0CA 1XWLA 3M8PA 2V4RA 4J9LA 1O0PA 4GC6A 4N8NA 5AXNA 4IH6A 5E7OB 3KHLA 2M3DA 3QMQA 1HNZF 3NCQA 1H2UX 3QGPA 2KTQA 3K7RA 1KFDA 2M7SA 1ZYQA 4QU6A 1U49A 2VG7B 1B0PA 4LFBF 1JXLA 5L1JA 4NYZA 3GWCA 1KTQA 1DTTB 1SH2A 3M2RB 4ED1A 4IOAQ 2GQ2A 1DZ5A 2CPEA 4IDKA 3KHHA 3CCLS 2Z4PA 3AHPA 5BJRA 3EPIA 1NAQA 2HQIA 4PPDA 5KT7A 3D2WA 1D9DA 1RT1B 1WEXA 4UUWA 3BQ2A 1YQHA 3DHXA 5DDRC 2E1AA 2N3LA 4NLSA 3OVBA 4RW9B 1UETA 2JLGA 3VCDA 4GKJF 4QZVB 3BDEA 2LEPA 2ZHOA 1XMQF 4TY9A 4EBCA 1SL0A 2E66A 3PNIA 2EFVA 5EGYA 3MM7A 1S1XB 2KYXA 2UUAF 1CVJA 3DLEB 3LP1B 4R5PB 2PI4A 2KT3A 2RU3A 4IFVB 3P3DA 2LKZA 3PACA 2MY7A 2O67A 1D0EA 5G4DA 4NCAA 2MKSA 4BBYA 2HHXA 5KFDA 2PC6A 4K5SA 3VALA 3UR3C 1P6TA 3SQGA 2VONA 3GIMA 1JLGB 2KM8C 3T5LA 2HFZA 4QJVA 2JSXA 5HQ8A 3OLAA 5A2QY 5K8MA 4OMFG 3B8HA 3BGRB 2MGZB 2DIUA 1NB7A 2ABYA 2JVRA 1CG2A 2RDJA 2DGSA 4DQRA 2RILA 2VOPA 3IAS9 2FLOA 5DLFA 3BR8A 3GR1A 2JEFA 4QQBA 2QO3A 2IM3A 3LAKA 4QWDA 1ZPVA 3DYAA 4Q8FA 2JOQA 2LQJA 2POKA 2XSJB 3KJVA 2W7OA 1F0XA 2DISA 4WFXA 2CPIA 1L5UA 4YR3A 1TUVA 4FXWA 4I69A 4I2PA 1YRTA 1YRXA 2ZVSA 3MEGB 5M2RA 2QMWA 4F50A 1T94A 3KMSA 2D7SA 1U47A 2GQCA 4RW7B 4MFBB 3DLJA 4DS4A 4Y2MA 3O8WA 3HVTB 5HBMB 2FC9A 2FGOA 1UA0A 2XLJA 1DTQB 3HK2A 2I8EA 4DV2F 3TANA 4RZRA 2VKRA 1YJTA 1FERA 4I6YA 2XI3A 5EWFA 2QSWA 4B9VA 4UW2A 2VG7A 4H54A 2XGQA 4FBTA 1D9FA 3PVXA 1DTTA 3M2RA 2FPHX 3MR6A 3PX6A 1P1LA 2COLA 2OH2A 3PHEA 4WKRA 4KHRA 1H6KX 4IOBA 2KU7A 2J7UA 4Q43A 4BWMA 1V3SA 1RT1A 1QTMA 2VPXB 3HXMA 3UWTA 2IVYA 2A10A 4W90B 1SIZA 2V8VA 1YG0A 1VBZA 1T8EA 1XERA 2HVHA 2BRKA 4RW9A 3BEGB 3CB4A 3OV7A 2JEGA 3V6JA 3I55S 1LK7A 1HYSB 4N56A 1S1XA 1D8ZA 2R7SA 1J5OB 2LYVA 3DLEA 1FTCA 3LP1A 4R5PA 2AGOA 3PXGa 1XR5A 1TAQA 2E7WA 2PIIA 4DN0A 1Q53A 1M5SA 2HLTA 4IFVA 2AJFE 3DFEA 3OTOF 1NKBA 4EU0A 1R7IA 5KT6A 5F8NA 2MZTA 2WW8A 2R8JA 3C2PA 4LSNB 2ZZNA 2M0GB 1JLGA 2AF6A 2VD3A 3OL9A 4DV5F 2KDOA 4X4RA 2EFOA 3LUYA 2PT0A 4LF7F 3MMCB 1RI7A 3BGRA 2MGZA 1G7CB 4IRKA 2JC0A 1VGYA 1GT8A 1FE0A 4ECVA 2DNLA 1S48A 3DI6B 2V94A 2BUNA 4WE1B 1KR4A 1KHVA 2WB4A 5BYRA 4P6QA 2KYZA 2GMLA 3FNNA 5D4LA 3QPIA 3TO8A 4LF4F 4DS5A 2VBYA 1FRIA 5HMZA 3MUTP 4OZJA 5J1EB 3BSNA 1U1NA 2XSJA 2FJEB 2BQUA 1R43A 3JSMB 3MPWA 2DHAA 1UEUA 5EX3A 4K4WA 1G3OA 1U1QA 1T7PA 2XC9A 3MEGA 3H20A 3IR6B 3I31A 3ZZRA 3TUZC 3CPWR 4DF4A 3RR8A 2EFQA 3DCAA 3DRSB 2XMMA 4RW7A 4MFBA 5B0AA 4ZK7M 1WEZA 1JJ4A 3HVTA 5HBMA 4NRUA 1S4FA 1DTQA 2HPUA 3WBZA 2XY6A 1MMLA 5E3PA 1TV6B 1JMTA 3I56S 1FJEB 5HROB 4C4WA 3PEJA 2J6TA 2YNGB 4Q7AA 3OHBA 1IJEB 1S79A 1HD1A 1MROB 1OSCA 2DJWA 4ZPCA 4AQYF 1N5TA 2DR8A 1JNRB 1GXUA 2ZOFA 3QIPB 1N5YB 1FVQA 3PDNA 5E41A 2MJNA 4ALZA 2P6TA 4A8YA 1KD1T 2F3JA 3M2VB 4I6WA 5JUMA 4ED2A 5E5NA 4O0IA 4QPTA 3DXBA 2M8HA 1HFEL 4OQJA 2UUWA 2N4DA 4X4QA 1HYSA 4F4KA 1T05B 1DQAA 3JAMY 4KSEB 1ZH5A 4B3RF 1RDRA 2KFNA 1J5OA 1G1XA 1F2GA 1KQFB 2RS2A 1OS5A 4TQRA 4NLWA 4ZLPA 3QIDA 3VQSA 5LJ5Y 3HMJG 2OMOA 1SKWA 3GYNA 2DH9A 4LSNA 4EEYA 3RRGA 2ZKTA 3WC0A 2QE5A 4OZ5A 1MWYA 3KG1A 1Y5LB 1NK0A 3T3FA 4R0EA 5GAEI 5A8RB 3MMCA 3L7PA 5KFFA 2JJ4D 2R7VA 1IJFB 5J2NB 3MOZA 3DI6A 3SCJE 5D77A 2NUHA 2R2TA 3HHEA 4WE1A 1FKOB 2BJEA 2QMXA 4Y2AA 4C3KA 2BJDA 1QAXA 5HI7A 2ILYA 1R8CA 1S49A 2F9JA 2Q1LA 4DHVA 3G8SA 3KHRA 5J1EA 3OQ2A 4ILMA 5E33A 3GE9A 2B9WA 5KFPA 5KFGA 1DQ8A 3JSMA 1VQNS 3KFWX 5A0YB 2KVIA 3GILA 2OSRA 3HPOA 4URSA 3PR4A 1N52B 1U6ZA 1W2IA 3G4SS 2HG4A 1S1WB 4AL6A 1HWIA 3DRSA 2LXIA 3DC2A 4CCHA 1HWLA 3TUIC 2EC0A 1TV6A 2XS5A 1FRHA 5BYSA 5HROA 5KOXA 2YNGA 4HDGA 3HM9A 2DGVA 2VL1A 1Z4UA 5D78A 1MROA 2BM0A 3M8SA 4YFUA 1R8PA 2FHMA 4OJHA 4HKQA 5EWGA 1TP7A 3I96A 3NLCA 1UFLA 3PFOA 5F41A 1N5YA 2J9DE 2GGPB 2G4BA 2FHOB 3RW7A 4I4BA 2B56A 3M2VA 3TUJC 2GHVC 1BY9A 1AFJA 1WF1A 2DNHA 5E3AA 2BZ2A 1FTRA 2K3IA 3I4PA 1RAJA 1T05A 1Y3JA 2WSCC 3D28A 3T9ZA 3Q8SB 5LSOA 3UNGC 4UY85 2M8DB 4JV2A 4ZP6A 4FNIA 1SH3A 4IRDA 1TZ0A 2R9LA 5CD4H 3K5LA 2ZH2A 2YKMB 3FJ2A 2F9DA 4OX8A 4OZNA 4PQUB 5MAOA 1HNIB 2R7UA 1U8SA 1TL5A 2XI2A 1FRJA 3TVYA 4JI8F 4LUBA 4F3OA 2HHTA 2IJFA 2OFGX 3GG1A 3OUYB 4B9SA 1QVFR 2BYCA 2I9SA 4RX6A 2KXFA 1N5SA 5B08A 3G6XA 2RU9A 4FXVA 5K8PA 3BO2A 5J2NA 2F7VA 3DOMA 5SUHA 3L7OA 1Q8BA 4OZLA 1FKOA 3LWMA 1GTEA 2VUGA 1VQ6S 2AJQA 5IXUA 1PC5A 3I9V9 3ITHB 4X4TA 5L9XA 4B02A 5A6PA 5HMYA 5KFIA 1VQOS 1FKPB 3ENVA 1Q7YT 2E1CA 5DRKA 2XCAA 1QM9A 3DRXA 4XPEA 4C7QA 3DRPB 4C3LA 1VQSA 4PXEA 1G2EA 1ULRA 5A0YA 5HL7Q 3UCZP 2VBXA 5DM6Q 2ATLA 2M88A 5EDWA 3DU6A 3ISNC 2K8GA 4HT7A 4OX9F 1S1WA 2AV5A 2DIVA 4P7VA 4K4UA 1FA0A 1SQEA 1MMDA 2C3YA 4ZA1A 1S97A 5GAEU 1RKIA 2LVWA 3CT9A 4CO2A 4DL7A 1BC6A 1R3NA 3DRRB 2LEAA 5KFUA 2R8KA 2JRSA 2HYIB 1NJXA 4JI1F 4NCBA 2DR5A 3V81B 5IQQA 4JYAF 3T6JA 5DG8A 4ED7A 1Q8IA 4ES3A 1X7VA 5CH7B 3I4HX 3IWNC 2CZ4A 4RNHA 1U26A 2GGPA 3VQTA 3Q22A 5L38A 2ZHBA 4N47A 2CQ0A 3S01A 3GFZA 3OL7A 2XMUA 4OLPA 4GKKF 3MCSA 4RBTA 4U67Q 2OKQA 3AY0A 3CCRS 3E2EA 2OTJS 3U1LA 1H2TZ 4AUKA 1RTDB 2BA9A 2UVWA 2KFZA 2YKPA 4ED5A 4YB5A 1ZBTA 3C66A 1YJRA 4JI6F 2OPQB 3EZ5A 3M4XA 2R2UA 1BQNB 1RT2B 2VOOA 4LJMA 1Q79A 3IC1A 2V4QA 2DNZA 2YKMA 2HHHF 3LAMA 2B4UA 4PQUA 2W25A 1HNIA 3C6TB 1FK9B 2R7WA 4B9TA 2RIJA 3HF5A 2CPXA 4LMZA 4TYBA 4BCAA 1VBYA 4ELUA 1S9GB 3I32A 4OIXA 5L8RC 5DJBA 5DDOC 2CDQA 4CZCA 3OUYA 2HMIA 4MYUA 2Z2MA 4X84A 4DR5F 4EBDA 4ERDA 1TL3B 4YDXA 5FD1A 4NLUA 1MU2B 3J7YU 2HLUA 3CJ4A 3B82A 3MUMP 1U6BA 3TR5A 4KPYA 3GFHA 2ZH1A 1VS3A 1MNEA 4OI0A 3ITHA 3Q2TC 4I7FB 1NK6A 1FKPA 1WHVA 2O66A 4RW6B 4J5OA 2VH7A 2B51A 2ASYA 3QJPA 4XAKA 3DRPA 2QA1A 1IQTA 2I38A 4X62F 2UXBF 2XMVA 2WB1D 3QAUA 4PUOB 1VBXA 3U1NA 2A1BA 2MKIA 4LQ3A 4YDDB 3LWLA 1R6YA 4OI1A 3RAQA 4F8RA 3LO3A 1PSDA 5E2QA 3H8YA 2WAQD 4A8MP 4DSFA 2RRBA 2E44A 2C28A 5ADZA 4FF3A 2HGLA 3MM9A 4I64A 5CXTA 1ZAXA 2XMKA 2EK6A 5KAKA 1Y3KA 2U1AA 3DRRA 3MURP 4ECQA 1HBUB 2A2DA 1WTBA 2QFJA 4B9UA 2OD4A 4TY8B 1SL2A 3V81A 2Z0GA 3DMJB 3HHKA 4NLRA 4NPOA 1D8YA 3OLBA 1RKJA 2FVQA 5LXYA 4C8NA 4ZPAA 5IT4A 4QWEA 5KFCA 4A8SA 3HZGA 1FNXH 3VAFA 2HRYA 2KRRA 2OJ3A 2FC8A 4JBCA 2PA3A 3OHAA 1CC7A 4OI3A 2WBMA 4MH8A 4YQWA 3EGZA 1HI1A 2XNRA 1FDBA 3AB2B 1RTDA 4MIBA 3UDLA 3DN9A 3CDEA 2ZH7A 1ZTTA 1IR0A 1C4CA 2ZJPQ 2CPDA 2OPQA 3SMZA 2L3MA 1DBDA 1X4AA 2R8HA 3R5AA 4RKUC 1EP4B 1RT2A 1URRA 1WACA 2B6AB 1JLCB 1VQKS 2IA6A 4X4NA 1S9EB 2AD9A 2AWZA 3BGLA 5IFMA 3DDKA 3UCUP 4OHXA 3C6TA 1RYSA 4PRFA 3PR5B 5A8WB 3ZZUA 4DN9A 5HN0A 1P27B 1S9GA 5THWA 4RNFA 2KKHA 2LA4A 3DLKB 4KR0B 3KNGA 2DPJA 4KB7A 2IMOA 1FDAA 2YTCA 4CT8A 3CVKA 2EBEA 3QWPA 1G6BA 4XPCA 2AYMA 4DFKA 2LXFA 1ZETA 4FNHA 4I1TA 1TL3A 1OSDA 3JTOA 2EBGA 3G6ES 4DFMA 5B0GA 1MU2A 1S1TB 5F8GA 1JX4A 4R25A 3CCSS 4HI2A 2GMJA 4KV8B 2PMHA 3KLVA 3MM5B 1DARA 1AUDA 4QPXA 3THVA 3BO4A 3CJ0A 4I7FA 1M5PC 3M9OB 4DR6F 4DOZA 2XSFA 2LXUA 4NWBA 4RW6A 5KFXA 4RUHA 2EVZA 4NLDA 4PG6A 5H9EJ 2R7TA 3PRDA 3BSCA 3H4DA 2XB2D 3MMAA 5E3RA 1WI6A 1Y0HA 2C42A 3PO4A 4LF6F 4PUOA 1CQNA 4ZDNA 3BO3A 4LIRA 1YJWS 3PM9A 1K1SA 4ZVGA 2XLKA 1YTYA 3J81Y 4IFYB 1JLFB 3KKFA 2CG4A 1KLNA 1RA6A 3DRYA 3ZZOA 3RB0A 1TL1B 1R31A 1XR6A 2Z8QA 1ZTWA 5FIIA 7FD1A 3I5BA 2DBBA 5LT5A 1HBUA 1F5BA 5IM0B 4TY8A 4BWJA 3DMJA 1L3UA 2ZBIA 4K4XA 4MK8A 5F8LA 3IBWA 4UOCA 1QVGR 2BDPA 1S0VA 2VA3A 1M5VC 2KT5A 2KXNB 3D1QA 1NHVA 2CJ9A 3H5UA 4WZQA 3VZIA 3FQKA 4ED0A 3NAIA 4K50A 2XWXA 2ZE2B 1FRKA 3DGPA 5KFJA 2RH3A 3VAGA 2ZH3A 1Q8LA 2YH0A 2O5DA 3I82A 3NMRA 3U1MA 2GO9A 5A8KB 5G0RB 2RQ4A 2YX4A 1LFPA 1P8GA 1RT3B 2HWHA 2JLFA 3SV4A 3G8TA 4QR2A 2WONB 3T5JA 1F9FA 1EP4A 5KFMA 3C3LA 5KOWA 2B6AA 2I5JB 3K57A 2CQBA 1VRUB 1S9EA 3W7BA 3LP0B 3UPFA 2NR0A 4L72B 3T6BA 2W8LA 4NOHA 2B0GA 2ZZMA 3F73A 4C98A 3DLKA 1KRPA 2WK4A 1X4BA 4CIOA 2J6SA 3K8VA 1PC4A 1SJ3P 1FXDA 2CQ1A 1L3KA 3QJJA 1BWEA 2FB0A 4G3IA 1S1TA 4J9MA 1XR7A 3HO1A 3GB0A 6FD1A 2W7PA 2KN4A 2OLWA 2XMTA 3THTA 5DQGA 4KV8A 2XULA 3MM5A 3N6LA 1U6FA 1UL3A 3HHLC 3V4MA 2W9BB 4O3RA 5I4MA 2Q66A 3FSIA 1SL1A 1S1VB 4QU7A 4DV0F 4DL6A 1FJCA 2C3OA 2XY7A 4FS2A 2LCWA 4C8KA 1HBNB 2MSTA 2HNZB 2W9AA 1RP5A 2V4JB 2ZH9A 1TKTB 5CCMA 4X4SA 4IFYA 1JLFA 1XNQF 3IRXB 2R8IA 4O3OA 4QWCA 3M6VA 3OFHA 3SSRA 2NQPA 4Q45A 1FHTA 2CQPA 4RNNA 1TL1A 4A8XA 2J76E 2JDJA 4ZP9A 3OPKA 2MXYA 5KFBA 5IM0A 4ZPTR 1K9MT 4K4ZA 4WFNQ 4USHA 5T7LB 2HFNA 3QO9B 4OX6A 2LECA 5CHCB 4CH7A 5DETA 2MZ1A 4TLRA 5E3QA 1TKDA 1P1TA 2CRLA 3B4DA 2XZWA 3MAHA 5F3TA 1LW2B 1HL6A 1X5SA 4ECTA 2EK1A 4J9QA 3MF5A 3PW7A 2LMIA 3PW5A 4ECXA 1B0TA 3SCIE 5EX0A 2IC3B 3R5BA 4YR2A 2ZE2A 3SEOA 3CMAS 2OIHA 4PXBA 1BQMB 5HLFB 3KWMA 2QA4S 4OL8A 2VODA 4NLGA 1GX5A 5A8KA 2ZOGA 5G0RA 4LF8F 1RT3A 4PG8A 1JLEB 1XBWA 2W9CB 4B17A 2YKQA 1CQMA 2Q43A 1ROFA 4OLOA 4ICLB 4AXIA 2WONA 3G6YA 3PJWA 3I6PA 4J9SA 2I5JA 3NNHA 1VRUA 2Y1RI 4G1PA 3LP0A 5J1NA 2XNQA 3PY8A 2ASJA 2E9RX 1S10A 3EZUA 4DUYF 3H59A 1SJRA 2QEXS 2ASDA 2HS3A 2Q3PA 1R0AB 3SSSA 3KHGA 2CJBA 3OXLA 2VV5A 2YVSA 5GADU 4QW9A 4FZVA 2HHPA 3U7JA 4YY3F 2PGCA <