3V4MA

Crystal structure of a rna binding domain of a u2 small nuclear ribonucleoprotein auxiliary factor 2 (u2af) from mus musculus at 1.80 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
GGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from Mus musculus at 1.80 A resolution
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 29
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4mA00
2LEAA 3JB9k 3G9CA 2SXLA 2DGXA 3VAIA 2DNHA 3CMAS 2CPHA 2RRAA 1O0PA 2DNLA 2RS2A 3U1LA 4IOCQ 3CCLS 1U1PA 1U1NA 2ZJQQ 2L08A 3SMZA 5CXTA 2RVJA 1VQ8S 2XS2A 3UWTA 1WI6A 1U1KA 2OIHA 3THPA 2M7SA 3HI9A 2VODA 2OTLS 1R8PA 5EN1A 4PRFA 1H6KX 4TU8A 1K8AT 2M88A 2CQ3A 2DNKA 3CC2S 1VQNS 2X1GA 5GADU 3VF0B 2LYVA 2YH1A 2KHCA 4WIIA 2CQ1A 1U1LA 3S6EA 2CPYA 2PEHA 1U1RA 2CQ0A 2HYIB 2GO9A 1SJ4P 3CC4S 1FJ7A 2E5HA 2YTCA 4M5DB 3R1HA 4WFBQ 1IQTA 2RUGA 3NNAA 1YITS 1KC8T 2O3DA 5CA5A 3D2WA 1R8HA 2KRRA 1U6FA 2N7CA 1SJRA 1WEYA 2CPZA 2DITA 3THTA 1WHVA 3TO8A 2DGVA 2RU3A 3CTRA 1SJ3P 2RRBA 3VAGA 3FEYB 2KG0A 2CPXA 4A8XA 4IOAQ 2K8GA 3PIOQ 3L3CA 3UD4P 1UFWA 4TU7A 2JX2A 1VC6A 3I55S 1VQPS 2DISA 3P3DA 1N8RT 3CPWR 3HHNB 4Z2XA 3G71S 2DNNA 2JVOA 5D78A 3DLLQ 1N52B 2KM8B 1AUDA 1VQOS 2N3LA 2PE8A 2MKCA 2AYMA 1YI2S 2FPHX 3BO3A 2KYXA 2MY7A 2MB0B 4QPTA 4FXWA 1JMTA 1OO0B 2FC8A 3CF5Q 2ADBA 2B0GA 2AYEA 2FY1A 2CQHA 2LMIA 2KH9A 2DGTA 2MJUA 2NLWA 2KU7A 2EVZA 4PR6A 2LA4A 3R27A 1P1TA 4ERDA 1VQ4S 2G0CA 4Y00A 5DETA 2LXIA 2RQ4A 2MKSA 1M5OC 3P49B 4UY8T 2U1AA 2DNGA 2M8HA 3CC7S 5HL7Q 1B7FA 2JRSA 4C0OC 2XB2D 1X5TA 1QVGR 1KOHA 3CCMS 2M2BA 1RK8A 1VQMS 3NS6A 2J0QD 4QU6A 2V94A 2X1AA 1WG1A 2KFYA 3MUVP 1L3KA 2K3KA 2MZQA 3B4DA 1X4GA 5GAHU 3EX7B 1JJHA 4UQTA 4C4WA 2MGZB 1K73T 4FXVA 3CCJS 1VBYA 3RW6A 1M5VC 3B4MA 4WF9Q 3NMRA 1ZZFA 3BS9A 1DZ5A 1H2UX 1JJ4A 3H2VE 2DO4A 1N54B 1YIJS 2D9OA 1N88A 2DNYA 2MSSA 2MMYA 1FNXH 1K9MT 2MYFA 2CQ2A 1DBDA 5GAGU 2HVZA 2KG1A 2KXHA 2KT5A 1DHMA 2DHAA 2MY8A 5IQQA 2VONA 1Q86T 2DNRA 1Q82T 1M1KT 2MZ1A 3VAHA 5LSOA 5CYJA 1YHQS 2DGWA 3CCQS 1FXLA 4ED5A 1X5PA 5GVQA 2DIUA 2CPJA 2MJNA 2M52A 5DDQC 1QM9A 4YB1P 1Q7YT 3S01A 4TU9A 5ITHA 2HGNA 2LKZA 1X0FA 3Q2TC 3U1MA 1RKJA 1U1OA 1VQ7S 1FHTA 2UP1A 2MQQA 2L9WA 5LJ5Y 2DNMA 1X5OA 4LJMA 1A7GE 1NO8A 2J76E 2E5IA 4CQ1A 2DIVA 3VAKA 2J0SD 5HO4A 5JVGQ 2VOOA 3G6ES 5D77A 1KD1T 2XSFA 3K0JA 1WELA 1F9FA 5LXRA 1JJ2R 1KQSR 2CPIA 4QQBA 4LMZA 3CCVS 3IWNC 2HGMA 2DB1A 2HGLA 2MZRA 2MQLA 2M70A 2M0GB 2MGZA 2BZ2A 4QU7A 2LECA 4BS2A 1WWHA 3SXLA 1HA1A 2KN4A 1S79A 4F25A 1H2TZ 1VC0A 2OJ3A 1WHYA 4TLQA 4Y0FA 2MPUA 2YWKA 3CUNA 1FJEB 3TYTA 3BO4A 2AYBA 1WG4A 3P5TL 2F9DA 1NJIT 2DH8A 2RT3A 3R1LA 1URNA 5IFMA 1D9AA 4OZ1A 2D3OR 3FEXB 1VQLS 5MLCV 3NNCA 5FJ4A 3SDEB 4C7QA 5LXYA 3G4SS 1SJFA 2LA6A 4CH0S 2F3JA 1WHWA 1WF1A 2MKJA 5DM7Q 2JWNA 3S8SA 3Q2SC 3I56S 1OWXA 2X1FA 4OZ0A 3ZZYA 3BEGB 4F26A 2LXUA 1VQKS 5DDOC 2DK2A 2MKKA 2F9JA 1PGZA 2DGOA 2MZSA 1YJWS 2KXNB 3IRWP 2MQMA 1YTYA 2BOPA 4WKRA 3MD1A 3OW2R 1KOOA 3NNHA 2CPEA 2E5JA 2EK1A 3UCUP 3BO2A 3UCZP 2DH7A 4J5OA 1FO1A 3CCRS 5BJRA 2WBRA 2CJKA 3VALA 2N82B 2OTJS 1X4FA 3CCES 2ADCA 1SJQA 3H2UB 2ZJRQ 1HD1A 5IM0B 1WEZA 4IO9Q 5GMKa 1Q81T 1UAWA 2DO0A 3CMES 1S72S 1X4EA 2AYGA 4CH1A 3PIPQ 2ERRA 4YOEA 1HD0A 4V19X 4W90B 3CD6S 1UW4A 2MHNA 1M5PC 2MQPA 3DXBA 1P27B 2DH9A 1BY9A 1G2EA 4WCEQ 4EGLA 2CQCA 1M5KC 1D8ZA 2HZCA 2CPDA 3SDEA 2DGSA 3MURP 2MZJA 2QFJA 2XS7A 2VOPA 2DHXA 2MKHA 1HL6A 1WEXA 2XNRA 1FJCA 1ZZNA 2XNQA 2QEXS 4ZKAA 4RU2A 1YWXA 1WHXA 2JVRA 2RS8A 1WG5A 1OIAA 1FT8A 3UE2A 4WFAQ 2I2YA 1A9NB 2CQ4A 2YH0A 3VAMA 1U2FA 3N9UC 1UP1A 2FHOB 3CXCR 2E5GA 3G8TA 2KXFA 3MXHP 3CCSS 2DGUA 3S7RA 4F02A 3LQVA 2X1BA 2LEBA 2M9KA 3ZZZA 3MI7X 1WI8A 2A3JA 1X4HA 3J7ZT 3ULHA 3CULA 5JVHQ 2J8AA 2KRBA 3VAJA 3P6YC 3J7YU 5GAEU 1NU4A 2CQIA 2Q79A 3MDFA 1X4BA 4PKDB 1CVJA 4W92B 2MQNA 1VQ5S 4CIOA 3MOJB 5IM0A 1XN9A 2NZ4A 1DRZA 1VC5A 5LJ3Y 2OSRA 2LQ5A 3MUMP 2I38A 1YJ9S 3RW7A 2RQCA 3V4MA 2MSTA 4YUDA 2KM8C 1PO6A 2M4MA 2DNOA 3MD3A 1H2VZ 2EK6A 2XS5A 3UCGA 3CCUS 2QA4S 2FC9A 5H1SV 3US5A 2MQOA 4U67Q 2L41A 3LPYA 3UD3P 2N3OA 1X4CA 2U2FA 3EGZA 2RNEA 1VQ9S 1VBXA 2DHSA 3VAFA 1QVFR 2DGQA 5DM6Q 2DHGA 2DNQA 1U1QA 5DDRC 2MZTA 2OSQA 2KI2A 1YJNS 1WF0A 2LCWA 1VQ6S 3NS5A 1ZH5A 2DNZA 2ZJPQ 3G8SA 2MXYA 2E44A 2AD9A 2KVIA 2YKAA 2G4BA 2M8DB 2CPFA 5LSLA 2GHPA 1U1MA 3G96A 1M90T 2G1DA 3EGNA 5DDPC 2MKIA 1WF2A 4IUFA 2CQGA 2CQDA 4P6QA 1OPIA 4WFNQ 1W2BR 3MUTP 1X4DA 1X4AA 2D9PA 4LIRA 2CQBA 1WTBA 1U6BA 1VBZA 1X5SA 2CQPA 2DNPA 1SXLA 3TP2A
chains in the Genus database with same CATH superfamily
2AWZA 2SXLA 2DGXA 2QSWA 4ZPCA 3TRGA 4B3TJ 3KG4A 2HHTA 5CXTA 2GVZB 4EK2A 1OMSA 3T6JA 4MTPA 3NGTA 1SQFA 3ENWA 5KFRA 1GMWA 3G87A 4DUZJ 1W25A 4CO4A 4DV0F 2CQ1A 5KT6A 1HQ2A 5I3UB 1U8WA 1FDDA 4ZCLA 1RTHB 3KUGA 3BBFA 1KC8T 2PFFB 1RABB 2E1RA 4C98A 1U6FA 1Q8IA 1YRTA 3T1YJ 5C2CA 2HVDA 4MIWA 2BJ9A 1FESA 2KO1A 5JJBA 3QZ7A 1MNEA 4ICLA 2E5LJ 3GJQB 3MECA 3QJPA 4TN2A 4AQYF 1HLWA 2AEJA 5KG1A 2MKCA 2B43A 2DEJA 1OO0B 4ES3A 1CULA 1S97A 2B0GA 3ZZUA 2ZWPA 1M0SA 1R31A 2WB4A 2KH9A 3R3TA 1S49A 3DOKB 1AUSL 1Q7LB 3HPOA 2C2RA 2BE7D 1Y4ZB 2C3PA 2VQEF 3ZTPA 3DXSX 5KFXA 4X65J 3IAS9 1S4EA 1RAGB 3KHGA 1RK8A 1VQMS 5KOWA 4OQJA 2PO4A 4J91A 1YJRA 4CDIA 1HNVA 1X4GA 3B4MA 3ISZA 3MMJA 3K5PA 3BS9A 3TWZA 4GO5X 3QLHB 3U7JA 5C7PA 1DHMA 4KB7A 4RPFA 4D3GA 4ZVUB 2AGOA 1FXLA 5A8RA 1X5PA 2IC3A 3CJ2A 2O01C 2VPXB 4KQZA 5J2PA 4FYWB 4K2JA 3Q2TC 3TZWA 3MOZA 5FDLB 1DTQB 1DTTA 4JYAJ 2J0SD 2HWHA 1RU1A 2F63A 2J7UA 4MIBA 1GMWD 1JQGA 1TKXB 3CCVS 1S6OA 4L73A 2HGLA 4JV1A 2MQLA 2M70A 2MGZA 4QU7A 1HA1A 1S6QB 2OJ3A 1RTJB 2L9NA 5F8JA 1C1CA 2F9DA 2RT3A 1CSJA 4DR6F 5CZVA 1VQLS 4ECWA 1N33F 2V8DA 2F3JA 3MEEB 3G6VA 2LXUA 1ITPA 5B0BA 2OD4A 4ZN3A 3JSMB 3OR1B 3VQSA 4LF6F 4ZK7M 4Q45A 1LEOA 2B9YA 4M94A 3FFIA 1UTAA 1HKAA 2NQPA 1OYEA 1FWKA 4ETZA 5F3TA 2J5AA 2FVQA 2R2TA 5IM0B 1NH8A 3TVKA 4I2PB 3MMCA 1HD0A 2AGPA 3DMJA 4X66J 4R8UB 4JI8J 2QLXA 2DGSA 1TL7B 3MURP 1X9MA 2QLJB 2ILYA 1DQ9A 2AHOB 2QG9B 5A8WB 1WG5A 2ATLA 3R5AA 4OV1A 4N8NA 3VAMA 1U2FA 2DRAA 3IG1B 2OPRB 3CO9A 1WC6A 3GONA 3TX8A 3U02A 2DGUA 2XI2A 3SQGB 4CI0B 2JFKA 1TK5A 5C42B 1NK6A 2F8MA 4R0JA 1NU4A 5B0FA 2XMKA 2BVZA 1UVMA 2LQ5A 1XMOF 1GXUA 5SZTA 3RW7A 3KOAA 2IVFB 3AB4B 3LGMA 1T95A 4G1QA 4XDCA 4B3TF 2E1AA 2GAHC 3DRSB 3W5ZA 1JJCB 3ISND 3PR5B 1BQXA 1TFYA 2YWFA 2XLIA 1QVFR 5DM6Q 4WBFA 2HZAA 2CRLA 4ZLJA 4CWBA 4DL2A 3HVTB 3VZIA 2X3GA 3MMBB 1JLFA 2ZZTA 2WW4A 2DPJA 4A47A 2YKAA 1UEUA 2HNDB 1WC0A 2KJWA 1M90T 3KLFA 4M5KA 9ATCB 2OI2A 2R2SA 1VGYA 3T1YF 1VRTA 1S9FA 2HS3A 3FQLA 3PFEA 1T3NA 4O0NA 2E5LF 3KLEB 4PWUA 1U1NA 3CT9A 3QGHA 2A6MA 4M5HA 3FMBA 1MWQA 2EG2A 1IXKA 3G6YA 4K4WA 2NR0A 3HVWA 3M1VA 3HFZB 3QFWA 3IS9A 1VQNS 1UVLA 2YH1A 4C0BA 3M8QB 1SC6A 2HYIB 1VJQA 1HBMA 2BJ8A 4OFZA 4AD6A 4PG8A 4RNHA 1FWLA 1N5SA 4CH7A 1ZAXA 3WQPA 4C8MA 5KAKA 4ZPTR 3BZQA 3CTRA 2RDJA 4NLWA 2BXJA 2BQRA 4U8YA 4X65F 4GVLA 3MFIA 2JVOA 5HJYA 3ONQA 2XMVA 4FS1A 4ECXA 2J0WA 4P74A 1Z1ZA 3BO3A 3I32A 1RLDA 5CABA 4XPCA 3QWPA 4KHPJ 1SKSA 4N77A 4WFXA 4RNNA 2B51A 3D6MB 2RQ4A 3FBCA 4LSLA 3AQPA 2HQDA 2DNGA 4MH8A 3N5FA 5AT1B 1AYEA 2ZWOA 3RBZA 4URGA 4JBCA 4MKAA 3MECB 3W61A 2KFYA 1NK5A 4KR0B 3BF4A 1F60B 2ZOMA 5BYQA 2FLNA 1N54B 2DNYA 5LM7E 2DRBA 1CULB 3JSRA 4EO8A 3AA9A 1JNZB 1IR1A 3G86A 2KT5A 2XSJB 2V0NA 1FDNA 5LMNJ 5HAOA 2WVBA 4HH1A 4ZVFA 4AL5A 1U0HB 1KQGB 4CT8A 2YWEA 5F0WA 1FTCA 2HLUA 1FHTA 1HNXJ 4EYIB 1T3OA 4IDKB 2R7RA 1UA0A 2HRTA 4C3KA 2KL8A 2XSFA 3EDQB 1DJ0A 1RWOB 1XK8A 1FRKA 3W7BA 2V4QA 1IUJA 1HNVB 4FYXB 4C8NA 4DR1J 2MEWA 5E2QA 3D28A 1NKBA 2AQ4A 2AZ1A 4WXOA 3GB0A 1WG4A 3P5TL 1CS4A 3ZZ0A 4X66F 1FCAA 4JI8F 2HHPA 3NNCA 5K8NA 1U45A 4HHHA 5GMEA 5A8RB 1WHWA 2FLPA 3SCJE 4PXEA 2HRYA 1X8DA 5J2PB 2F9JA 4WU3A 2FLOA 3UNGC 2E7WA 4GKJJ 1KOOA 4LREA 4P73A 2RILA 3EM1A 3H7HB 1IBMJ 2HQFA 1FX2A 2ZJRQ 2HBQB 2CIMA 1S0OA 5HLFA 1Q81T 4K4ZA 1UAWA 5IXUA 3EMTA 2R8KA 1C1CB 3NKYA 3IFEA 3TUIC 3NBPB 1SC1B 2BACA 1D8ZA 4G65A 3TVYA 4B9VA 1QSSA 1MG7A 3O3LA 1RWKB 3MEDA 2UVWA 1AFJA 2ASDA 3UE2A 1JXEA 4DSKA 3BPSP 4MK9A 1RBOB 1UL3A 5HJXA 1L3SA 1WI8A 3GILA 2BJ1A 4RW9B 4KHMA 1YK9A 2FVSA 1NM2A 4QWAA 3ZNUA 2GS8A 1NSPA 2VBYA 2MSTA 3MD3A 3TR5A 3MMCB 2W2MP 3PHTA 2J8SA 3ILLA 3MEGA 5F41A 2W7PA 2ZHOA 3POTA 5CYQA 1NEEA 2DHGA 1T8EA 3WIVA 2H3EB 4OYMA 4HH0A 4RNMA 3A4TA 2VG5A 3NS5A 4J9UE 4CO3A 3VVUA 4KSEB 3PYGA 3G96A 5DDPC 2CQGA 3CIZA 2NUHA 3MUTP 4LVNP 5G0RB 1WTBA 4B3SF 5L38A 2C2ZB 4NLPA 3MR6A 3UVJA 1BC6A 1VK8A 1PG5B 2RRAA 3SSSA 2GVDA 3CWJA 2UUWA 1Y0HA 4BCAA 2OIHA 2PI4A 4ECUA 4PRFA 3O6QA 1RBLA 2E9TA 4DCOB 1IWGA 2Z2MA 4F0KA 3AD8C 2CA9A 5AE1A 1TL4A 2VC1A 1FJ7A 3N0VA 2E5HA 3OHAA 3PX0A 2HIYA 5BYRA 3CJTA 1K1QA 2HG4A 1SQEA 3D2WA 1QJHA 3DU5A 3KLFB 2DITA 1IBKJ 1WOSA 1VRTB 3DOLA 4TQSA 3CGIA 1VQPS 5DZ6A 3E01A 4F3QA 3EGWB 4E8UA 1GXLA 3MR3A 1RADB 2HHXA 5K8PA 2CZ9A 4NLUA 4URSA 4TYBA 1RHKB 3L7PA 2CQHA 1GAOA 3TEHB 2VPWB 1HBMB 4MT1A 5KFUA 1HR0J 3JSYA 1NSQA 4ERDA 5DETA 2BKNA 3ISNC 1P1LA 2XCPA 1NK8A 2HRUA 1HPZA 3H4DA 2CUYA 4IH6A 5DGBA 5C24A 1RISA 2CKWA 1MN7A 2YKQA 1HNXF 3H5YA 4OHZA 1RT1A 3V4IA 2HVEA 4HTJA 3IMQJ 4TYAA 1PCAA 2WRMA 3DGVA 3K8VA 2ZH3A 5I42A 4NWBA 2BDPA 4CO5A 2HNZA 4UQTA 2IAJA 5F9LA 3CCJS 2O66A 3I6PA 1KTQA 5KT4A 4WU2A 3LANA 3RYLA 1EIYB 1DBDA 3VTIA 2OP5A 3TAQA 2C28A 1XR7A 1Q82T 3G8QA 4FNHA 1VRQC 4CCHA 3GYNA 4Y2MA 4USJC 3TAMA 2L9DA 1FA0A 3AJ2A 4DR7J 1KR4A 4LRAA 2E7VA 1VOMA 3SZ2A 4QQBA 4LMZA 3AHPA 2ZVSA 1RT4A 3FBBA 1IBMF 4ELTA 3OD2A 2DY1A 4DPXA 1SCJB 3OVBA 2DR6A 4K7QA 2PDAA 2B9EA 4DOZA 1MLAA 2DH8A 1C4CA 2YNFB 3PFOA 2ZH5A 4YEAA 4I69A 3H98A 3AQOA 1HHSA 2V8PA 3V6HA 1TKTB 4Y34A 4OHVA 4UUWA 5IWAJ 1QY7A 1QE1A 2QTWA 3NNHA 1XEZA 2CPEA 3C6TA 3UCUP 1HI1A 2K3IA 2W2OP 1HWLA 2WBRA 2XO6A 1LWEA 2V8HA 3GR0A 3V5RA 4LF7J 4RW7A 3AT1B 2UV8G 1Q1KA 3R5GA 2XY6A 1XJWB 2Z56B 1HFEL 1M1GA 2ATCB 1FNOA 2OUGA 4Q5VA 3H20A 4W90B 5AE2A 1U49A 3KHHA 2LQ9A 2MKHA 4ZKAA 1BQMA 1UWBA 3C6UB 4P75A 1KDNA 1BQNA 2KKHA 4N47A 4DV4J 2KXFA 4Q44A 2QL9B 2AW0A 2I8EA 5HQ8A 2A3JA 2FZGB 1N32J 1OSDA 1PIEA 4W92B 4ZA1A 5E5NA 3PZPA 1MSWD 3TEGA 1S4FA 5HLFB 4LSZB 2CFXA 2W7OA 1WKJA 4LF9J 2R7OA 2JC1A 1H2VZ 3AFGA 3A8KA 5IQ6A 2UUCJ 4HHJA 1LK5A 3MEDB 2ACYA 5B08A 8RUCA 4KE5A 4IH7A 1N5VA 3UN5A 4AT1B 1SL0A 5T7LA 2EFQA 2UXCF 1U1MA 3M8WA 4NOHA 2NSCA 1NJZA 1X4DA 4NEZA 1IBKF 3QWUA 4DV6J 1J5EF 2XZWA 4USMA 1UKUA 5IOLA 3G9CA 1IR2A 2DHHA 2DNHA 3CMAS 4UZCA 4F0HA 2J7KA 3VV2B 1LWCA 2O5DA 2J9DA 2KYZA 3Q8SB 3UWTA 3MEGB 4IFYA 2M7SA 4PYDA 2OTLS 2FJVA 5ETMA 2HEKA 3POTB 5CYQB 3BQ1A 2X1GA 3Q0AA 1VHFA 3S6EA 1FF2A 2R7WA 4C3LA 2VG5B 2VPYB 5KFMA 4WFBQ 1HR0F 5D4OA 1S57A 1NNDA 4MKBA 2P2CB 2BE9B 1GEHA 1HARA 3VAGA 4OYOA 4JI2J 3T1HF 2G2ZA 4X4NA 2Q66A 3NRBA 3P3DA 2XC9A 1LW0B 3LTOA 3UVJB 3NGRA 4AXJA 3DLLQ 3NLCA 4YP3A 3LH2S 3BGRA 2GVDB 4AFFA 2R7XA 3WX4A 1YI2S 5ETTA 1S0VA 1GTEA 2MY7A 3DLGA 1N5YA 2AX0A 3RBXA 2EXUA 3FZ2A 2DR7A 3HM9A 2DEIA 4ILMA 5KFAA 4G3IA 1CQMA 3ENVA 4BLGA 2VKZG 1P6TA 3R27A 2WOMA 4NE9C 4KAIA 2OFHX 2FIUA 1R0AA 2W9CB 2FGCA 4DQPA 3FKBA 4C2MA 2HVHA 1UW9A 3DOLB 2XQCA 3B78A 2LVWA 4ER8A 3KKFA 1WG1A 2XZDB 5DLGA 2XCAA 3B4DA 1PBUA 1HWKA 1VBYA 2ZC3A 1RAEB 2CG4A 1DY3A 1G7CB 2D9OA 2WBMA 2YBVA 2HVZA 3R2DJ 4M5JA 4WP9A 2FJDB 3M30B 1S9EA 1Y5IB 4I56A 5AJ3J 1QM9A 3OLBA 1SC4B 4YB1P 4J9VA 4USKA 5ITHA 3TI0A 4I64A 1HPZB 2OLWA 2DXFA 5IWAF 2GO8A 3G6ES 1TQLA 1KQSR 2BA9A 2GIFA 5I42B 2HGMA 4V19J 2HNZB 2VBWA 2IAJB 2Q6CA 3SXLA 4LF7F 1S79A 2V4JA 4CM0A 3KDNA 4Y0FA 2QLFB 3I87A 4Y6IA 4DSEA 1KLNA 5B0AA 3GG1A 3MMAA 3R7NB 3ZTRA 3R1LA 2IA6A 4DF4A 2D3OR 1FK9A 2E29A 3BM7A 1JXLA 5DM7Q 3LAMA 4U8VA 2X1FA 3HJFA 4DX6A 5D0RA 3PX4A 4F26A 1XMQJ 2MKKA 4O3OA 1FFGB 4FXDA 1VBKA 2V2VA 4DV4F 2VPZB 5AXLA 2HHHJ 3MD1A 9RUBA 2EK1A 2COLA 4H4MA 1KQFB 3UW1A 3MPYA 1SJ1A 2VDIA 1RZMA 1N32F 1AW0A 2XG8A 2BJ3A 2AJQA 2BRKA 2EBGA 4B3RJ 1HD1A 3VR1A 3T5HA 5IC4B 3QJLA 1X4EA 2H5EA 5HMYA 5KFDA 2VJUA 4EUVA 4V19X 1G2EA 2DYAA 4DV7J 1KVJA 4NYPA 5ETSA 4ZVQB 2HHQA 2VOPA 4Q8FA 2A0FB 1HL6A 2YQ1A 3HFKA 4A8QA 3EICA 3GLJA 4LQ3A 4WFAQ 2WONB 1KVKA 4UW2A 2AJ1A 1VJWA 2UXBJ 1HYSB 3PW4A 1QE1B 2E5GA 2B7BB 3G8TA 3DGPA 2YKNB 2GGPA 3C6TB 2X1BA 4B9UA 4YY3J 2LEBA 2M9KA 3ITHA 3D7SB 3OTEA 5B0EA 5J1EA 3I4HX 4PWDB 4ZJLA 1F2GA 4DV6F 1LWEB 3QIPA 1VC5A 3EGVA 3A8JA 2POKA 5CCMA 4HT7A 2KVQE 5HANA 2FHMA 2DNOA 2OMOA 3EZUA 2FC9A 2ZC4A 4OJ1A 2MQOA 4HKQA 4MMOA 4M1KA 4RJVA 3TJ9A 4DL5A 2DHSA 1LWFA 2NS1B 3D6TB 1R6YA 2QYCA 2BQUA 4ED7A 4M5DA 1BQNB 3G8SA 1VR6A 2KVIA 3H2LA 4AE5A 2R7TA 1WC5A 2V9WA 2HHVA 3NS7B 2JDJA 3OR2B 2V5HG 2RDDA 3RBDA 1SXLA 2HMIA 4ZVPB 4JI2F 3VAIA 1O6XA 3OHBA 2XTJP 3EE3A 2CYYA 4JI5F 3K5OA 2LDIA 2IJRA 5JMNA 3JAMU 5KFKA 2NXEA 3VZHA 2DNKA 2OPQA 2K1RA 3H8YA 4WIIA 2KDOA 5T7LB 3HK2A 3PJ9A 2A2CA 1RTZA 4AYBD 1R8HA 5KT2A 1KEKA 3BDEA 2F40A 4KPCA 3CJKA 2V4RA 4QCLA 4BBYA 4DF8A 3I55S 1YLXA 5KFCA 4ANCA 2DBBA 2IDLA 4ATNA 2V8GA 1HIYA 1LWCB 1CLFA 1T9UA 3PM9A 1RHQB 4MYTA 1ZA2B 5DS7A 1YQHA 1PYTA 4KTQA 3IR7B 3CJ4A 4MYUA 3FBFA 2LMIA 2X3DA 2GZOA 2ZBIA 2RIJA 2I5JA 4J9QA 5CD4H 4GC7A 2CXEA 4PR6A 1XR6A 4Y00A 3SBMA 5AJ3F 2W9BA 3QGPA 4LF5J 1M5OC 1SI9A 4UY8T 3CCMS 3Q8UA 3CDEA 2PD1A 5E0OA 1Q16B 2V94A 4DCJB 2ZD1A 3PV8A 3DI6A 3EX7B 1U26A 1M5SA 4FXVA 1UJ5A 1EP4A 5KFWA 3DLGB 1N5YB 1C0TA 1SV5B 5IZHA 4Y2IA 2VB6A 4ZIWA 1HBUA 2VONA 2ZBPA 4DMZA 3KLIA 4LBHA 3OL8A 2WOMB 1R0AB 2CJXB 3DRXA 2LKZA 3OT9A 1XMQF 2MQQA 5LJ5Y 2ZZMA 3CSKA 2HHHF 2G0IA 1MMLA 4DL3A 5DZ7A 4W98A 5LXRA 2UXDJ 5SUHA 1B0PA 3C14A 1UCNA 2KN4A 4B3RF 1R89A 3E51A 2VU5A 1TK0A 3KUEA 5B09A 2DJWA 3N6NA 5EWFA 1B7YB 2FJXA 1J2VA 5H9FJ 2C2NA 4OZ1A 4DV7F 4R25A 3SDEB 1VDHA 3KLVA 2QGFB 4YDXA 3I9V9 4UY85 4EEYA 3BV8A 3SV4A 4RLEA 3GR1A 4PG4A 1NK9A 2UXBF 2KXNB 2BOPA 1L3VA 5GAEI 3GV8B 1JLAA 4IH5A 4L76A 2PSZA 4YY3F 1X4FA 4DFMA 1B99A 2F8EX 4IO9Q 2V4JB 5CD4A 3D54A 1DQ8A 4DX8H 2C2OB 5D4PA 2AYGA 3RZAA 2GQ2A 2A18A 3PIPQ 3MMAB 3LPEA 2DH9A 1M5KC 2VFSA 2MZJA 2V63A 3UN2A 2WVFA 1FK9B 3PX6A 1TVRA 2XNQA 5KFHA 3OLAA 4FYDA 4DQRA 4DN9A 3LO3A 2FHOB 2C2EA 1EETB 3D5MA 3ELHA 3BN7A 1T9WA 2BR0A 2FDNA 5KG7A 1HBOA 4CLZA 2HQIA 1KBRA 2R42A 3SIPB 4P2FA 4NLYA 5KT5A 2IY5B 2DRDA 4YUDA 2GAGC 3P8BB 3QT6A 3U27A 1JLCB 3M9NB 2DD8S 4LFBJ 3KG0A 2UUAF 4U67Q 3KWMA 1VQ9S 1NB7A 4LRBA 3O44A 1FE4A 1RP5A 3MPWA 3D4JA 4C11B 3HKWA 3KG1A 4IO1A 4GRSA 3FCWA 4B3MJ 5IT4A 4YR3A 3H25A 5HVFA 2E44A 4GKKJ 3ZZRA 2G4BA 4I4BA 4CLWA 3DGPB 3OJUA 2AV5A 2P9GA 1OPIA 3ITHB 3LALA 5HBMB 5J1EB 1VBZA 1VQSA 2XULA 1T0TV 2NYHA 3QIPB 2HIQA 1UPPA 5J2NA 3A12A 3HSDA 3IA0A 4LFCJ 2ZJQQ 3ET6B 5E7OB 4LBIA 4CM2A 3BKTA 1WSVA 2M88A 1OQ6A 4ZP8A 5FD1A 3CC2S 1FFWB 1Y00A 2LYVA 4DUTA 1WC3A 1U1LA 5I4MA 3NGKA 2CNNB 1SJ4P 1WDDA 1L5UA 3RU0A 1YRXA 4M5DB 1SUQA 3NNAA 3I5AA 1TMJA 1N5QA 1NSAA 4HLBA 1IKVA 3AODA 1JLEB 4LF5F 2PI5A 3A8EA 2JLFA 4FPRA 4DZDA 4OMFG 2JX2A 4DG1A 1VI7A 4QWCA 5D0HA 4Z2XA 4B9SA 4BWMA 2VG6A 1KKHA 2R4FA 3UDLA 3K7RA 2F65A 2VF3A 4OYIA 1RACB 4YB7A 5BXIA 4LQ9A 3FEZA 3UI3A 4FXWA 2MDAA 3M2RB 2K1RB 4OLOA 4JI1F 4U96A 4BDPA 1CJTB 4IRDA 2CJQA 3A13A 3TNVA 2J9CA 1V3ZA 3CJKB 2MKSA 2V50A 2W8KA 4K4UA 3PDNA 3ZZTA 1B7FA 1KOHA 4X4QA 4OJ3A 1N36J 4X4TA 4K2XA 1LWXA 3BSCA 4QU6A 3GJSB 5J2QA 5F8NA 1FKOB 2KT3A 2UVVA 1RAAB 4ZP7A 1F3FA 2IDEA 1N88A 2MMYA 4XPEA 2V6AA 4HVZA 4DX7A 1UVJA 5K5MA 3AJ1A 1LK7A 2I5JB 4YN3B 4KHRA 2RAQA 3BYPA 5CHCB 4ZLNA 4X62J 2W9BB 1R0CB 5L1IA 2ZH9A 2HGNA 5E3QA 1ICEB 2HVIA 1Z4UA 1VQ7S 4LFAJ 3BGLA 2DNMA 2VV5A 3MZIA 4OZ3A 4JI7J 4CQ1A 5HO4A 3RUBL 1T9TA 2VFUA 2AP6A 1XTZA 5ETLA 2ZD1B 3N79A 2MZRA 3PYDA 3PW2A 4F25A 1EP4B 4R0EA 4BC7A 5AXKA 2C3MA 4D3HA 4FPIA 3DHWC 1C0TB 4P2MA 3PY8A 1KN6A 1RT2A 1BUXA 1NKEA 3EDRB 3M8PB 4Q2LA 4DR5F 3D67A 3KLIB 5BR8J 5LXYA 3NG8A 4J9MA 2BE2A 3Q2SC 1Q95G 5DG7A 1FJGF 3FSXA 2MQMA 3KTQA 1PC5A 4RUCA 4OX8A 5IT0A 1IKYA 3VALA 4NLTA 3QJJA 2YWWA 2R3VA 3C14B 4CP5A 3MM5A 1GFWB 1XBWA 3CJQA 4NRUA 3KMQA 3MM8A 1HMVA 4UOHA 5KFEA 2XWYA 4LSNA 3TJ8A 4LFBF 5CCLA 3G2XA 5J2MA 3KLGB 3K5MA 2RH3A 2HNYA 3SQOP 3MR5A 1W7WA 1TUWA 2HS0A 2VFVA 3CXCR 1GX5A 2VFRA 2W2QP 5A6PA 3DM2A 3RB0A 1MWZA 5C5JA 2B4OA 2E9RX 1DARA 3J7ZT 1U0SA 3P6YC 2V2ZA 2ZM6J 5GAEU 2MQNA 1VQ5S 3HHLA 1OQ3A 4B17A 2CG8A 1T03B 5FLXU 3QATA 1VHIA 4ECZA 3IRXA 3NGUA 4KO0A 2ACMA 4DPOA 3OXFA 2YPYA 3MCSA 4OZ5A 1TVRB 1U1QA 5EWEA 2GQCA 1B3TA 4H4OB 4YHHJ 4ZCIA 3FSIA 5IV3A 1SBRA 2QLWA 4WE1A 3IP0A 3K59A 1FRMA 3EGNA 4WK3A 4RUHA 1LQ9A 4DPYA 1NHKL 3J81U 1HBOB 2IMWP 2CQBA 3M05A 1R8CA 2FHKA 1TL3A 2VUGA 1WTFA 1MU2A 3Q8VA 4X4OA 2CDRB 4LT6A 4ECQA 2LU2A 3CIMA 3LA0A 2V2KA 1WI6A 5DG9A 3MCOA 5HVHA 4DZ6A 3BH7B 3J80U 4Y65A 2DR8A 1U02A 3VF0B 5F8MA 1RTDA 1YBAA 3T1AA 2YTCA 4NASA 1NK7A 2EFNA 1RHJB 3M6UA 1UVNA 4CTAA 3D3CJ 3JQJA 1I6JA 4NLDA 2VQEJ 5K9FA 3D3BJ 5J1NA 3HT0A 1F9HA 3M2VA 4RBVA 4URQU 5A0YA 2H48B 2BJDA 4M95A 1RT5B 1NZAA 2N7YA 2ZE2A 1N36F 1FD2A 2ZOGA 1S1XA 3TUPA 2EWHA 4CO0A 4ITSA 1FERA 2PE8A 5GAGI 2RHSB 4O4GB 1RAJA 4NCBA 4KFBB 2ZUAA 3PRBA 2F8HA 1TP7A 2EFGA 2EPIA 2KU7A 1I5OB 4C48A 3TAPA 4ED3A 4X4PA 2W7AA 4A4JA 3HHLD 2XY7A 4ZVHA 3RRHA 4QJVA 4EFAC 1KS2A 2QA4G 1H38A 4KBIA 3NCQA 1X31C 5U47A 1R43A 1UFKA 2C3UA 4Y28C 1TKZB 3KUHA 2VG6B 4LF8F 2EKNA 1RT3A 1IBLJ 4DN0A 4YS2A 1W26A 1CEZA 4FKXA 4F04B 2V8VA 4Y3CA 4DI6A 5LT5A 2XI3A 4ED5A 5BR8F 1N33J 1NSKL 2RF2A 2Z2YB 5KG4A 4J9PA 3PG9A 1VCTA 1HQUA 4ZLLA 3MAAB 3CCWA 1X0FA 2B4PA 4DV1F 4USWA 2W9AA 1A7GE 4F36A 3HXMA 2GIRA 1JK9B 1X9SA 2AZ3A 2ZKUA 2LECA 4UF4A 1VC0A 1IJEB 1F0XA 2GV1A 1NPRA 1F3VA 3AD7C 3W1YC 1YJVA 2AYBA 2ZNYA 4FF4A 3L7UA 1WSRA 5IFMA 4LF1A 2IM3A 2ZVIA 2QX0A 3ZZYA 4CLFA 2OPPA 2YNHA 2DGOA 4DV5F 1BWVA 3F73A 4EWTA 3KK3A 2P5VA 3NP5A 4I68A 4N7TA 1GTHA 3GIKA 3D9BA 1JLBB 2ZM6F 2UVUA 1WEZA 1XMOJ 3MPDA 3OUYA 3K8WA 4DCPB 4C8KA 3A3PB 3Q8YA 3HDSA 4TVAB 2ERRA 4YOEA 4FN5A 1RT2B 2RSQA 2NXUA 3R5JB 4U95A 1S10A 1T9VA 2YKMA 1WC1A 4ZVTB 3NGDA 4DPUA 1MROA 1RYSA 2DHXA 1OY6A 2K06A 2BJEA 3TZYA 3C46A 4ZVGA 5KOXA 4JV0A 2JLEA 4ZJOA 2BE2B 2QEXS 2JFDA 3K57A 4YHHF 4EU0A 1JKHA 2YQ3A 1U24A 1Q8BA 1WKKA 3DU6A 2YKPA 3MXHP 1WC4A 4GC6A 3R6GB 2GJIA 5DQHA 3MPVA 4KV8B 1IN0A 3OTDA 1QUPA 4NLGA 2CDQA 1CVJA 3KJFB 2MLYA 2V68A 3QAUA 2LLZA 1E6YB 3AOBA 1RT7A 1HMVB 3CCUS 1G1XA 2PEBA 1RCOB 5GADI 4LSNB 2J9DE 3HHEA 1TTHB 4U6PA 3UNYA 4NLVA 3HX9A 2Z2ZA 5CH7B 5E3PA 2MZTA 3VQTA 3CDUA 1P8GA 3DN9A 3DLJA 4FYYB 4I67A 2ZJPQ 1EARA 4KGMA 2B56A 5KFYA 1W2BR 4DL4A 3BPDA 1X4AA 3FNNA 4PXCA 3I5CA 2AJFE 2Y8WA 1H73A 1ZM2A 3HHLB 2CNOB 2EC0A 3BKFA 1APSA 3AAWB 3LP0B 3IRXB 3HI9A 5HN0A 2FGOA 3PCOB 2F7VA 4A8FA 2FLLA 3PKMA 1UETA 3DNCA 3L7OA 3PJXA 3DOMA 3FDSA 3NXZA 1U1RA 3DDKA 4F67A 2WTFA 3R1HA 4WWSA 1QUVA 4WE1B 4P9SA 2N7CA 2ZITA 3PNIA 2GC8A 3VGVA 3TANA 4MFBA 4USVA 3TQEA 4B9LA 4BWJA 3NOCA 4JP8A 4TU7A 1TL3B 1B64A 2G1HA 3NAIA 2J9EA 1MU2B 3M9OB 3OFGA 3CPWR 3K58A 2DNNA 5D78A 2JSXA 2MQ8A 1NBEB 2E1MC 1OYDA 3RB4A 1VQOS 1IBLF 4DFPA 2HK3A 4S0MA 2J6SA 1YJ7A 2JLGA 3GIIA 3LAKA 4QIVA 1S1VA 1NRKA 4DR2J 4P52A 2FC8A 4NZ6A 4UOFA 1QAIA 1RTDB 3A8IA 1Y3KA 3FZBA 4RWXA 4FP9A 4IKAA 2BKPA 4WFZA 3EUNA 2Q43A 2CWXA 1RGVA 4K5RA 2PMWA 3M2VB 5HL7Q 1YBTA 5A0YB 1QVGR 1XNQJ 1FI4A 4B08A 2NCKL 5IT9U 4KPYA 2VHGA 2OD6A 2WZ1A 3HT3A 6FD1A 3AY0A 1WUUA 4WF9Q 2LDYA 4RW8B 1OS5A 4OJHA 2CNKB 4XK8C 1VQYA 2CQ2A 2RQKA 3PRVA 5GAGU 2KXHA 4EBDA 2R8GA 2DNRA 4KC5A 3CJ3A 3R6LB 1C0UB 2HFZA 1YJUA 1NCLA 3I0RA 2CAJA 1S12A 4ZPWR 5DDQC 4L3KA 4KT0C 1O8BA 5KG2A 2P6TA 4HDGA 3UQSA 1AB8A 5E33A 2L9WA 2XWXA 1NO8A 3TW0A 4C9DA 1F9EB 3RG6A 3RRGA 1RWMB 1RAIB 2R9LA 4ZITA 1YZ6A 4ES1A 1V3SA 3W60A 4UQGA 5KG6A 2HBRB 2JJ4D 4CLYA 4DX5A 4TLQA 1IJFB 1VLYA 3TYTA 1RUSA 2EEYA 4QYZK 4FVMA 2K7KA 3G4SS 4ZHRA 3KK2A 4WJBA 4F4ZA 1HQUB 2JEJA 4OX9F 2F4VF 4PG6A 2K2PA 1NPPA 1JLGA 3J7YI 1YTYA 3KJVA 3KMSA 2F4FA 1TL1A 3H0PA 2IM0A 2ZH7A 2VFTA 4J5OA 2WVCA 3EVOA 2HQCA 3HHLC 3H2UB 3W2WA 1UMJA 3G82A 3E3XA 3CMES 2HAFA 1JX4A 4PUOB 4IG3A 5CZXA 2PMZD 3DXBA 1KSPA 4WTOB 2HZCA 3GCWP 1YG0A 4K4TA 2LQJA 2Y8YA 1FJCA 4DUYJ 2OPPB 2YNHB 3RGIA 3LP2A 1FT8A 2I2YA 5ETVA 3N9UC 1H98A 3EWGA 5ETNA 2VBZA 3KK3B 3S7RA 4F02A 1IKXB 1TL5A 2E1PA 5T14A 2NYIA 2QRRA 3EPGA 1YDLA 5CAAA 4JV5J 5JVHQ 4B3SJ 3I0SA 1F6TA 1YZ7A 1DRZA 3OUYB 4KGKA 4NMXA 2EK6A 4HT5A 2XS5A 2GIQA 3GWCA 1FD8A 2Z57B 1NK0A 1UZHA 1ROFA 4C8ZA 3LGNA 7AT1B 5A2QU 2DNQA 2NPIA 2KTQA 2XO7A 3T19A 3R9LA 3EXCX 1ZAWA 1S6PA 1V5IB 3O8WA 4IR1A 2M8DB 2CPFA 5LSLA 2GHPA 2IRUA 2MKIA 4L75A 4P6QA 4L6V3 4YFUA 1Y11A 3MTJA 2R7QA 4KY3A 2CQPA 1BHNA 2VD3A 4ICLB 3QRRA 2HPUA 3MFHA 3AB2B 2NREA 4F4KA 3SMZA 3C16A 2HFNA 3T41A 2Y0SD 1R8PA 2OFGX 5EN1A 3QT8A 1S76D 4X4VA 4DR2F 5GADU 2PEHA 7FDRA 2CQ0A 4A46A 3T9NA 3I4PA 4ED1A 4LRFA 1P9QC 4OIXA 3WBZA 3THTA 2RU3A 6FDRA 3T5KA 1N56A 2K8GA 1D3WA 3C3LA 1XNQF 1SIZA 3BSAA 4RZRA 4DL6A 1FRJA 2DISA 1BD6A 1U8SA 1KRPA 2EKYA 3DDIA 1ZA1B 1VLOA 1VRUA 4K4YA 4O3QA 3HP6A 2I0XA 4N41A 4DFJA 2QZ8A 2ASYA 1Q0NA 1RCXB 3DOMB 2HFVA 2HFOA 1RWUA 2KB2A 3CB4A 3HCXA 3KK1A 2PFDA 3WZ0A 3VWSA 2IC3B 2LU1A 4MFBB 1AA1B 2BV3A 2OHDA 3J7A1 2JRSA 1YSJA 1DTTB 4C0OC 1X5TA 4CRJA 5D4LA 3CEDA 4NZ7A 1RXOB 2IBOA 2VJVA 4RO0A 2VQFF 1N34J 2F1FA 4ECVA 1JJHA 4C4WA 2MGZB 1K73T 3MWBA 1RAOA 1NJYA 3NMRA 1S1VB 3H2VE 3SEOA 3VHQA 4DS4A 3P5BP 5B7WA 4PPDA 2DY9A 3T5JA 3C15A 3DOKA 3TOQA 3HSJA 2P9EA 4ZVOB 1ZPWX 1YRUA 3F41A 4M8LA 1OY9A 1PAUB 4CLTA 1NDCA 4PXDA 4ZPDA 1ULRA 1H0HB 5KFGA 2JZ5A 1A6LA 4EZ9A 3PHEA 4ECSA 1NPKA 2IJFA 1XNRJ 3FFIB 5HP1A 5THWA 3IWNC 4OYWA 2DB1A 3LUYA 3L09A 2PT0A 4BS2A 4A8OA 4NXMF 1H2TZ 3O5TB 3W8PA 2FJBB 3DYAA 2R8IA 1FJEB 3GFZA 3PXGa 4TQRA 4QWBA 2P9CA 1CJVA 3KFWX 1T02A 2XGPA 4JI3J 3DMJB 4A8MP 4DU7A 1D9AA 2Y9HA 5L1LA 4I6AA 5MLCV 2H1YA 2PN6A 4C7QA 1N48A 5L1KA 2W8LA 1SJFA 1RKIA 3I0RB 2BYCA 3S8SA 3J7AN 1CBKA 3NWGA 4L72B 5AXMA 1H7XA 2HWTA 4DUYF 1DTQA 3QGGA 5H9EK 2XMTA 4NA3A 3OW2R 3HVAA 4BC9A 1Z2LA 1S0NA 4JV5F 5BJRA 4ZPAA 2DXDA 3ZXWA 5MAOA 5JUMA 2DO0A 5DO2A 3K5NA 4CH1A 3T3FA 2VBXA 3CD6S 2DKOB 4G1QB 1ZTWA 3IWLA 1M5PC 2MQPA 3PKYA 1BY9A 2ZBCA 2IA0A 3GTYX 4FF3A 1WEXA 2Z58B 1SH0A 1ZZNA 3KK2B 1PSDA 1JLFB 3CDBA 2UXCJ 1IM6A 3JSMA 4FS2A 3KJVB 4LUBA 5KFZA 2WB1D 1DLOA 2ZKTA 1J5EJ 4QIEA 3J7YU 1XR5A 3MDFA 3MOJB 5IM0A 2AT1B 4TKTA 4WK1A 4HL9A 3W2WB 3UPFA 2PC6A 2V9KA 3G82B 1PYOB 2AU0A 2H5IB 2B3TB 4HHUA 4IG3B 1B0VA 2C3YA 2QA2A 4XTTA 4OYXA 3M1VB 3IS9B 1ZM9A 3BJYA 2KI2A 2ALYB 2BX6A 3GQCA 3LP2B 1U09A 3SSRA 3IG1A 4K4VA 2Z30B 2MXYA 1R7IA 3D0GE 4Y2KA 5DLFA 2D9PA 5C42A 3PO5A 3M6XA 3T1HJ 2KHDA 3I0SB 1SPBP 4DSIA 3ZTOA 2BEFA 1NDPA 5L9NA 2Q3PA 1O0PA 4TY8A 3UDVA 1T94A 2GMJA 4NLQA 1KLMA 4IFVA 3DRSA 4YB6A 3THVA 4MKVA 4IYQA 1U6ZA 1KWMA 3R5BA 5JXSA 4USTA 2VDHA 3HVTA 1I51B 3MMBA 2WCXA 2GO9A 1IKWA 3W8GA 1S6PB 4LRDA 1YITS 2B9WA 2O3DA 5CA5A 2KRRA 3OTCA 3NL0A 2I6WA 1BWEA 4LSLB 1KHVA 1WD6A 1IM4A 3UD4P 4AUKA 1N0VC 3P45B 1Y3JA 3VGUA 3HHNB 3K17A 1N34F 3T6BA 2KM8B 1H7WA 3QRPA 2W1BA 3C16B 4LRCA 4FBUA 5FIIA 3HMJG 1HW9A 4ELUA 4QPTA 1R8AA 3AA8A 2NLWA 1U25A 3OL7A 1NKCA 1REVA 5IS2A 2RB7A 3CW2C 2G0CA 1YBUA 2YX4A 4I6WA 1RDRA 2LP4A 5EWGA 2ZOFA 2V34A 1JNRB 2VASA 3H5SA 4HI1A 1GT8A 2FVCA 1XNRF 2DTJA 2MZQA 5EDWA 2YWGA 1VRUB 4YMEA 1E6VA 5L1JA 1WACA 3HZGA 4F4AA 2DHAA 3AOCA 1CS4B 4JI3F 2NXNA 2BMBA 1Q86T 4K4SA 4XAKA 4LF4F 4USUA 3VAHA 3KK1B 3Q8PB 4F2RA 3ILJA 3CCQS 1LKZA 3RRKA 5GVQA 2KZZA 4DHVA 2ZH6A 5KFIA 4U9RA 2V67A 1U2RA 5A8KA 4I1TA 2BBEA 5JVGQ 3FCHA 3JS9A 3NWRA 1RHUB 4OZ2A 1KD1T 4ZP6A 4IQXA 5D0GA 2V2QA 4NCAA 4TXSA 1PJ7A 2QL7B 1ZM4A 4USHA 4ECTA 1WKLA 4DDFA 4HACA 3MEKA 3CUNA 1FVQA 5LSRA 1FX4A 1QLNA 3M4XA 1GK8A 2XSJA 4OYBA 5KFJA 4NI2A 3C15B 1RAFB 4X64J 3T5LA 3JYTA 1U0HA 3WX8A 1Y5NB 3I56S 1EZZB 2Y1JA 2CVEA 1WDTA 3MR7A 2DK2A 3OSNA 1T7PA 4IDKA 3IRWP 4HYKA 4JI4F 2VKRA 2V69A 2XY5A 3F44A 3A1YG 1JLQA 2YX7A 5HP1B 3LF0A 4V1Ak 3RBEA 1FFSB 3B54A 4QIWD 2J7WA 2B5JA 3DYAB 4WP3A 4NYOA 1SB6A 4ED8A 3K89A 1CJVB 1Q8KA 2KJVA 3DFEA 3GPAA 2HQ3A 1EKSA 3KYLA 3M8SA 3ZTQA 1UJ6A 3HVRA 3H42A 2CQ4A 4AL6A 1CC8A 2NXJA 3H4BA 4DR3F 3TZZA 1AROP 4HEA9 2EW9A 4B9TA 2J8AA 2KRBA 4L3NA 1D9FA 1KFSA 4M5LA 4E2FB 2IPOB 2HHSA 2IIHA 5CYMA 2N4CA 5KFVA 2ZH8A 1BXNA 4M5MA 3KDOA 3VVTA 1LFWA 2KM8C 2XZTB 3PRDA 4JI5J 4CLKA 3MTKA 4LIWA 3TA2A 3NBPA 5HMXA 5ADZA 3LPYA 3UD3P 2U2FA 1D1UA 5EX3A 2NUUG 5LMUJ 3MAQA 1R27B 5DDRC 2OSQA 3TUJC 1PJ6A 5E3CA 5EUHA 4ZS6A 2DNZA 3VCDA 1OPZA 3ZFVA 3KNAA 1R8BA 1S9GA 2OMLA 1EAYC 4HTIA 1GMVA 3HHKA 1DLOB 1HNZJ 5M2PA 3AOAA 2D69A 1HQEA 3TP2A 2QMUB 4RW9A 2A6OA 2VL1A 2YPZA 3OSPA 2B7CB 4ZIVA 2CPHA 3E01B 2DNLA 2B4UA 4IOCQ 1U1PA 1NLKL 2XS2A 3KHLA 4OX7A 1KFDA 1K8AT 4EBEA 3M2UA 3DLEA 2D74B 4PG7A 3CVKA 2CPYA 3CC4S 2VIHA 1B0TA 1IQTA 3FMWA 2RUGA 4NLXA 2IM1A 3TUZC 3DKDA 1WEYA 1ZS6A 3DC2A 1FKPA 4ZVEA 4JUZA 2JEGA 5G0RA 3TO8A 5C24B 3OL6A 2I1RA 1UFWA 4H54A 2GJFA 1SH2A 2QIFA 2VC0A 3WC2A 1I3OB 1RT1B 3V4IB 4NLSA 1SKRA 2FQQB 4TY8B 1N52B 1KLMB 3R7SB 2VH7A 4EI2A 2C42A 4IFVB 2G2YA 1D8YA 2AYMA 8ATCB 3X1LB 5ETOA 4DUZF 1OJ4A 2ADBA 2RDIA 4Q0BA 4K5SA 4O0IA 2G0JA 3RJMB 3AXMA 3C66A 2QLBB 4K0KJ 3M32A 4Z37A 3QRQA 2R7SA 1IKWB 3D6HB 3EJMA 4RNFA 4RW6A 5E41A 1S59A 3P49B 3FUYA 3TAMB 3Q89A 1J5OA 2M8HA 2CJAA 2H4YB 2APOA 4C0HA 2BW7A 4EBCA 4ZVSB 2R7UA 2M2BA 4B9NA 4OZJA 1Y7PA 1I1GA 3LP1A 1LW2A 3H5XA 1RT4B 2IRYA 1SC3B 1M5VC 3GMGA 1DURA 1DZ5A 3N6MA 3GIJA 4ID5A 1YIJS 3SCKE 2MYFA 2JEFA 3Q23A 5IQQA 4AXIA 4X64F 4FF2A 4O3PA 4ANEA 2MZ1A 1SKWA 1R6VA 2QJ3A 1REVB 2P6SA 2CJBA 2ZH1A 4NPOA 1NJWA 5GMDA 3S01A 4O3NA 1RKJA 4NMLA 3SFUA 2UP1A 2K7JA 2BQ3A 1KTVA 5J1PA 2J6TA 3DCAA 5KT3A 3Q8QB 2Q6BA 2GHWA 2WSEC 1WELA 2R7VA 2QN6B 3AD9C 1JJ2R 3KNGA 2OO4A 3NAHA 2IYGA 4Y2CA 2OH2A 3D6FB 4X4UA 1L3UA 4RW7B 4F2SA 1RWWB 3UR0A 3PYFA 2UV8A 1E6VB 2MPUA 1FNMA 1J27A 1FDAA 1UWAA 3ZO7A 3PW0A 3Q24A 2B8PA 5FJ4A 4DQSA 2LA6A 4CH0S 5K20B 3MM7A 2FVRA 5DGAA 3EVMA 3W63A 3DLHA 1HW8A 2ZH4A 3ZC4A 1BQMB 1UWBB 5HATA 2O67A 2ZBRA 3TARA 1FRIA 4OZNA 1RU2A 5A8KB 4JYAF 5KFSA 3BYRA 3UCZP 2Y0BB 2DH7A 1MN9A 4ETXA 1HNWJ 1LNQA 4P72A 4KKOA 4OJGA 3GIMA 1V5VA 1UJ4A 5GMKa 2Y3YA 5B0DA 4HACB 3EPIA 1TV6A 1S1UA 2YNFA 4NI2B 2UUAJ 4FNIA 5RUBA 3KXDA 4OHXA 3FSYA 2IFXA 1WJ9A 4NA2A 1RHMB 3IR6B 4CO2A 3ZTSA 4M63A 3FCVA 3PVXA 3JYTB 4RUAA 5LMUF 2XNRA 1R0BG 4ZN1A 1TKTA 1YWXA 2N4DA 3M7VA 5ETRA 4ZOSA 1NJXA 1RT6A 1JLQB 3IBFB 4MJKA 1HNZF 4TLRA 3M8ZA 1X4BA 2HWIA 1S7HA 2NZ4A 2OSRA 3OTBA 2B5JB 3MUMP 3EZ5A 1YJ9S 1PAEX 5ETQA 1U2CA 2M4MA 3BKUA 3WHIA 5ETPA 5L8RC 3MCNA 1NAQA 3R97A 3OL9A 4IFYB 4N76A 3EGZA 3OV7A 2HBZB 3A3NB 1WOOA 2AGQA 2ZFHA 3K5LA 4IR9A 5D3GA 3TX0A 1WF0A 3D1QA 3C6UA 1NDKA 3HKZD 3GV5B 4DQIA 1ZAVA 3IGNA 4J9OA 5KG3A 4J9NA 3B8HA 5K14A 4F7VA 5DQGA 2DNPA 5CYMB 1PYSB 2HS4A 3HD2A 4A8KA 5D8HB 4P7TA 5F3ZA 4M5NA 3BGRB 2VODA 1QTMA 2E7XA 4TU8A 3PJWA 2CQ3A 4DL0C 1G4CA 1U4BA 4UTGA 4JI1J 4J9SA 4CNYA 4LR8A 4K0KF 2NZCA 4ED2A 2IHR1 2Y1RI 4UUXA 1T11A 3TQ1A 4EO6A 3KHRA 4PAAA 1S9GB 1SJRA 5KG5A 2CPZA 2IBKA 3LGHA 2DXEA 2OGUA 2RRBA 3DRPA 1VFJA 1HQEB 4CO1A 4CZCA 3DHXA 3DLKA 4CLSA 2X7IA 3I5BA 3CCTA 3Q86A 3JAMY 3JTNA 4H4KA 4NLOA 2MB0B 2XYHB 4PCQA 3M2UB 3DLEB 4LVOP 4Y2AA 1VMBA 4ZDNA 4F0MA 2KFZA 1NHUA 4RWWA 4JB8B 4G1IA 4QR2A 2EVZA 1AXQA 3CJ5A 1S9EB 2UVRA 1S6UA 2VA3A 2MLXA 1FKPB 5I3PA 1FWPA 2U1AA 3ENQA 3M6WA 3F0NA 2PMHA 4OYAA 2UU9J 4NL5A 2XGQA 1LW0A 3NS6A 1L3KA 2CZVC 3DDNA 3BQ0A 2DR9A 2DO4A 1IBCB 2FTRA 3GJTB 1TK8A 4KHPF 2KG1A 4Q0BB 4DR5J 3M32B 2YQ0A 4TY9A 1MW7A 5LSOA 4ZLPA 1KP6A 2CPJA 4G1PA 2W9CA 4O3RA 2P8IA 3ICLA 2CNLB 4RW6B 3IGVA 1FJGJ 1NZ8A 1QSLA 4F3MA 1J5OB 4P71A 3PYEA 3KLHA 2ZHAA 2Z8QA 3RB6A 4LJMA 2J76E 2E5IA 3CCZA 1OSCA 4R5PA 3LP1B 1LW2B 5HSPA 3BGOP 3P96A 4H4MB 1HNWF 1VIXA 2C22A 2M0GB 5F8LA 1QSYA 2LFVA 2YKOA 3BSNA 1WWHA 1RSCA 4ILLA 2IYIA 4PPZA 4ID5B 1JIHA 2HFSA 4XO0A 2GFFA 4C8LA 2WSCC 3NCRA 2YX1A 3C19A 3GSIA 5LMNF 3M30A 3I31A 3OJSA 3QSIA 2H9ZA 1OWXA 1K1SA 4FDFA 3IBWA 1HHTP 1SIWB 4WKRA 2B8QA 2GGPB 3JTOA 3H5UA 1I94J 1W2IA 2C2MB 1Q8LA 4DSJA 1QAXA 3QT7A 2NPFA 4DR1F 1MWYA 4DPWA 3HO1A 3EXYA 5BYSA 1UW4A 5KT7A 5L46A 1D09B 2CPDA 2EI5A 3NY0A 3B6BA 3R8YA 3MM7B 1LWFB 1HHQA 2JOQA 1D0EA 1OIAA 1WNEA 1GH8A 2YNIA 2D3ZA 3LOUA 1Q5VA 4GKJF 3CCSS 1LV5A 3WC0A 3BBBA 1FEEA 3ULHA 5L39A 5B0GA 3L9ZA 4KKOB 3MHYA 2HMIB 4FBTA 4C8YA 2R8HA 5LJ3Y 2D41A 3OPKA 5M2RA 2I38A 2DPIA 2RQCA 3SCIE 4ES2A 1DAXA 4ZCKA 3UCGA 1TV6B 1S1UB 2RQMA 3OBIA 2RNEA 3MAHA 3W64A 2OPQB 1S5ZA 1Y5LB 2IVMA 2WONA 4MK7A 4FVCA 3EVWA 4MK8A 2RUSA 1HYSA 3BQ2A 3W66A 1VISA 2YKNA 5IV4A 1RT6B 2FJAB 4PWDA 4O44A 3SI8A 2GHVC 4U7CA 1F2HA 3IXQA 4DWIA 2L08A 1CQNA 1X60A 1XC9A 2B9XA 1F5BA 3THPA 3LWMA 3VGSA 1R3NA 1H6KX 3OXGA 1F1BB 4JOUA 5D3GB 5KTQA 1X0PA 2FHJA 4ENOA 4RKUC 2ZEJA 4NA1A 3W9JA 1YKWA 4CLPA 2BKOA 2BW2A 5K14B 2D3O1 1G6BA 3OR2A 4ID8A 3V6JA 2DGVA 1SJ3P 3MF5A 3W2VA 2KG0A 3U1NA 1VC6A 2UU9F 2XYPB 4M5IA 4GMKA 2VICA 2GCFA 5I3QA 2BRLA 5ETKA 4LR9A 4LF8J 2ALZA 2NSBA 2C3OA 5A6WA 2BOAA 3C2PA 1NXIA 3DI6B 1HI8A 4N56A 2MHEA 4W4MA 3CJRA 4I0WA 1JMTA 3MM9A 2FY8A 2D7SA 3BBCA 2EFVA 1RLCL 1HBUB 4QR0A 4GVBA 2JHEA 1L3TA 2XMMA 3GIRA 2CJ9A 3ILIA 2J0XA 4RW4A 2E1CA 4DV1J 1UVIA 3DRPB 2XB2D 4DV3J 4OYPA 3R5DA 2J6UA 3DLKB 4I2QA 4CLUA 1CG2A 3Q83A 5CQGA 3HD1A 4M5GA 3QT5A 2GA7A 1H2UX 5D15A 5KFQA 2MSSA 1ZYQA 3NGSA 1K9MT 3UO0A 3QFHA 3FRYA 2A2DA 4P2SA 4WFYA 1YHQS 5KFBA 4A8SA 2JEIA 2ILZA 2DIUA 2FB0A 3CJ0A 2G2OA 1IQZA 3U1MA 3BH6B 4DV5J 2AIRB 3SFGA 2DIVA 4DU8A 3RR7A 4C8OA 1JLAB 4DLGA 1I94F 4QYZJ 1Y9OA 4O3SA 3FK4A 4NXNJ 2BZ2A 3QIDA 2FHJD 3BB5A 5LL6d 4MAKA 1QDUB 1SV5A 4OI1A 4X4RA 4F3OA 3IR5B 2W4DA 2C2KB 4NYZA 1H3DA 3KJQB 3FEXB 1JXVA 4PYAA 3W62A 3HSZA 3PW7A 2GW8A 1O51A 3BEGB 1C2PA 1CC7A 2VG7A 2ROGA 2FD2A 5F8IA 1PGZA 1GNKA 1KHWA 3KLHB 3CJ8A 4QIGA 4DR7F 1LOUA 4NX9A 2XMAA 3A3OB 4R5PB 4G6VB 2Y1LB 2XHWA 4UZBA 2N82B 4B02A 1K0VA 3UFCX 1TAQA 1F5AA 4OI0A 2Z0GA 4JV2A 1S72S 4C6AA 4C3MA 1K0TA 1XIQA 3QPIA 1PJ5A 3SDEA 5C25A 3R5CA 2ZDOA 2OELA 3GFXA 1CJKA 3OFFA 3GFHA 2MTLA 3EYZA 4QR1A 3ZZZA 2YXLA 4WP8A 5E3AA 5E3RA 4CIOA 3R7BB 1XN9A 2C2DA 2EBEA 5J2NB 3V4MA 4PQUA 1REGX 3BR9A 4LBPA 3AXKA 1Q79A 4A8WA 4QYRA 2W2PP 1UEKA 2HQGA 3FJ2A 3US5A 2L41A 1X4CA 5KFOA 5HMZA 4DS5A 1VBXA 5EX0A 4ZVRB 3MCMA 4FYVB 4F8RA 3PW5A 4MKYA 4QIFA 4UOGA 1HI0P 4RR5A 1YJNS 1RBAA 3OTOJ 4DQQA 2DCLA 3V81A 2QMWA 1EETA 4WZQA 1SUQB 4QW9A 2YNIB 5KG0A 3W9IA 4OV6A 3IM9A 3SSQA 1IKVB 4IUFA 4WFNQ 4ZJQA 2FYXA 1GQEA 3CNQP 4LIRA 3TA0A 4FKYA 4IG0A 1GXTA 2H4WB 2LEAA 1S77D 3O1LA 4DG1B 3H90A 2AEMA 1VIOA 2XYGB 3CE8A 5C2GA 2CVIA 2Z4PA 4LF9F 1JLCA 3H40A 2RVJA 1VQ8S 4K50A 1HNIA 1U1KA 5FLXY 1MMDA 4WYLA 4H4KC 4ILRA 5D4NA 2WK4A 3O2IA 2UUCF 1S1TA 3Q8RB 4C11A 4J90A 6AT1B 4DPTA 5HQMA 1FTRA 3PO4A 3ILOA 4NEYA 3TVZA 2QC3A 3R2CJ 4MIAA 2PGCA 2EFOA 1WHVA 5HBMA 2BM1A 2QT7A 3J81Y 2CPXA 4A8XA 2I9SA 1C4AA 4O44B 4DV3F 3NMAA 1NB2A 2OEMA 3NEKA 3QQCD 4U7UK 2FZCB 2KZMA 1KVIA 4DEZA 3FC9A 3ET6A 5J2QB 1LXJA 2X51A 1FE0A 2N3LA 2FPHX 2HK2A 4I7FA 2UZAA 2GMLA 2RU9A 3RTVA 4J9RA 3P4UB 3J80Y 3ETOA 4KYZA 1T9YA 4RL1A 2RD5C 4UT4A 1S48A 2XEXA 1AZSA 3G6XA 2L3MA 1HBNA 5KFPA 4HI2A 1JLEA 2LXIA 1QD1A 1M1HA 2ZBQA 2HAIA 3W2VB 2IMOA 3NCPA 4IRKA 2J0QD 5HROA 3MUVP 3LWLA 2W4PA 2GX8A 2ASJA 1HWJA 4DBQA 3W3SA 4NXNF 4KGXB 3WDOA 2KT2A 5DJBA 3FVYA 1N0UA 1RJJA 3M2RA 3IBCB 1XERA 5K8OA 3MM9B 4K59A 1H72C 1YGYA 1CJTA 4GVBB 4B3OA 2XHCA 2E9ZA 2AJ4A 2DCUB 3GZ7A 3JSBA 1BMQB 4OX9J 2F4VJ 2AF6A 4RW4B 3TA1A 1RA6A 2UUTA 3UDCA 4QWEA 2VOOA 5D77A 2W2NP 1F9FA 1IKYB 2W4CA 4I2QB 4FZVA 3JTPA 4QZVB 1ELOA 1FKOA 1FRLA 2OEJA 3VGTA 3MM5B 1NH7A 2RJZA 2ZZNA 4Q2MA 4NCGA 4OZLA 2YWKA 5L9XA 1SH3A 3MM8B 3PEHA 1TR0A 4ZPVR 4UOCA 5H9EJ 1URNA 2IVYA 2HHWA 2MLZA 1ZPVA 2HSEB 1RWXB 2HFUA 5J2MB 4WXWA 3D1OA 2HNYB 4OZ0A 3V6DA 4J9LA 4DV2J 5DDOC 4F4WA 3UDEA 4O4RA 2JH3A 2E5JA 3DM2B 4XIUA 2RHQB 3GCXP 2RE1A 4F4YA 1D9DA 2CJKA 2XLKA 1SJQA 1RA7A 1RTIA 2FUG9 2F5GA 2MHNA 1Q4RA 3M8PA 4EGLA 2CQCA 2JL9A 2C1EB 2H51B 4B9MA 4J9KA 4KO0B 2XS7A 2KFNA 4K8RA 1C1BA 4A8YA 4DLEA 3UN3A 4WKYA 1WHXA 2RS8A 1JB0C 2VG7B 3HJVA 3OTOF 2YH0A 1QAJA 1K47A 5F9NA 2LQ8A 1X4HA 3N4WA 5F8GA 2PA8D 3GSDA 5D0EA 1FKAF 2HURA 1ZETA 1N6QA 2ASLA 2FJEB 3NOGA 1IWAA 5EGYA 1GX6A 1PKUA 1PO6A 2DVIA 4PXBA 4HR2A 2HHUA 3IN5A 4KJIA 5HK4A 2NXCA 5H1SV 1IR0A 2WSFC 4Q43A 4ELVA 2N3OA 3KLGA 5KFTA 5C25B 1CPZA 4ZMMA 1Q78A 1U48A 1DQAA 4RBUA 2LCWA 1VQ6S 1CJKB 4F4XA 4L74A 3ZZPA 4JI0J 4ANDA 1XWLA 4RBTA 4CNZA 4CTAB 5T41A 3K2YA 4A48A 5M2UA 2IRXA 2R8JA 4KGZB 4USIA 2DT9A 4WIQA 1TU0B 3CD7A 3HF5A 2HLTA 2ZE2B 1S1XB 4PQUB 2RS2A 1T03A 3U1LA 1FXDA 5DG8A 3CCLS 4OI6A 3D0HE 4ECRA 4I6YA 3BGFA 1S1WA 3E2EA 4OHWA 1NUEA 3I9ZA 4RX6A 1YX2A 1H74A 3FRZA 1V6HA 3QNWB 4P7VA 3M6VA 1SKUB 4H4OA 1EHWA 1M5HA 2EC2A 1TUVA 4PZVA 3V81B 4WTYA 3CD5A 2YWHA 3BN4A 2YVSA 1RHRB 2CWKA 3HZEA 1N5TA 4AL7A 3DRRA 4CYUA 4IOAQ 4IG0B 3ENAA 1EX8A 5GAHI 3WIUA 1RWVB 4YB5A 4Z7CA 1N8RT 3G71S 1O5JA 2VQFJ 2HZVA 3T9ZA 3D66A 1AUDA 1RT3B 3HULA 1HNIB 4DSFA 1SL1A 3W5YA 4BHQA 3MM6A 2QFIA 4WPAA 2QSFA 3QO9A 3RAXA 1RE1B 1S1TB 1CJUA 2AYEA 2CADA 1NHVA 2MJUA 2LEPA 2D3UA 2XMWA 3TZXA 1P1TA 3RAMA 4JI6J 2ZH2A 2RF2B 4EZ6A 1B4SA 3BR8A 3CC7S 1RT5A 1Z2ZA 1FRXA 2Y1IA 1XMBA 3ZNJ1 2X1AA 2HKEA 1ZBTA 2K3KA 1KQKA 2Q1LA 2G13A 3IM8A 4K4XA 4NXMJ 3RW6A 2RKIA 4I7FB 2WAQD 3N01A 1ZZFA 4O4GA 4RNOA 5K8MA 4KFBA 4DJBA 2W24A 3IC1A 5AE3A 1FNXH 3PR4A 3BSOA 2B6AA 1X7VA 2MY8A 3KJNB 3HSGA 4NZ0A 3AJDA 4X2BA 2XLJA 1AZSB 5CYJA 2DGWA 3JQKA 1HBNB 2OAUA 3FBEA 2UUBJ 2MJNA 1N4LA 2ZDPA 3OQ2A 1Q7YT 2A1BA 3QSYB 2QA1A 3QBCA 4DV2F 3GE9A 2OKQA 4OLPA 1X5OA 1FVSA 3HHDA 1TKZA 5HROB 5IT9Y 2WVEA 2CPIA 4DFKA 4P10A 3W9HA 3JQMA 3GG0A 3SV3A 2AJ2A 3QAEA 2R2RA 1LXNA 4PQAA 1WHYA 3M8RA 3HFVA 5DQIA 1SVDA 3BO4A 2QE5A 1G3OA 2YY3A 2BJ7A 2EG1A 4RUBA 3BREA 4KIAA 2YKMB 4B3OB 3GJRB 1MROB 1WF1A 4QW8A 3RR8A 1X9WA 3MAAA 2MKYA 1T05A 1PBAA 1JKHB 2VZ9A 1VK3A 2MZSA 3SYZA 2CJYB 4OYZA 4N8OA 3RB3A 1V9OA 4OI3A 4QPXA 2UXDF 2OTJS 3IWXA 4PEOA 1QAYA 2YNGA 4QWDA 1DFDA 4NCGB 1VS3A 3TJAA 5B0CA 1RT7B 2BUNA 4WCEQ 2O1PA 2XM3A 2QFJA 4C97A 2ROEA 4KRWA 2AMCB 3RAQA 2AKWB 2G9OA 3V6DB 2H5JB 5IC6B 2OPSA 2JVRA 3N28A 3GYXB 3QYYA 2BANA 5A76A 4JI0F 3OXLA 2ZNZA 3MI7X 4J37A 1WOPA 1JLBA 2CQIA 2Q79A 2M3DA 3FGVA 1UA1A 3W65A 3QGIA 4OHYA 1VYAA 1RTIB 1NDLA 2QV6A 3C8YA 3ETMA 3H59A 3MPUB 3OFEA 3GP9A 5HMWA 1EQMA 1RI7A 3SCLE 2GVZA 3CJSA 1A0OB 1FRHA 2DGQA 1C1BB 4ED0A 4CT9A 5I3UA 2HW3A 2GMHA 1LFPA 2XBPA 1RTHA 3HLUA 1HWIA 4OI2A 5KFLA 2ROPA 1UZDA 4KH1B 2G1DA 4KV8A 1P9YA 1T9XA 2CQDA 3ZZOA 1QTNB 1F5CA 1X5SA 3PTWA 4HDHA 3J81j 1N6QB 2WW8A 3JB9k 2H65B 1SQGA 2WHOA 2FZKB 1BE4A 2IM2A 1PILA 1E6YA 4F50A 4X84A 1B70B 1TELA 3V6KA 3DLBA 4DR4J 2JC0A 2KHCA 3DRYA 3E8OA 5A2QY 1U47A 3GYGA 4B3MF 5KFNA 2LXFA 4ED4A 4GKKF 2H54B 1Q53A 4JI6F 1EJ7L 4LF2A 3B82A 1UPMB 1URRA 3FEYB 2VA2A 4EYHB 3PIOQ 3L3CA 2IJNA 3UD5A 4EMDA 4N5SA 4E98A 3GU0A 4DL7A 2RMLA 3EZOA 1YJTA 1AT1B 4QOTA 3LP0A 4LFCF 4O23A 2ZHBA 1S1WB 1S0MA 4ED6A 2EFPA 2KYXA 2L48A 1S7IA 4YR2A 3CDWA 3IO1A 3CF5Q 3QLHA 4DV0J 1TKDA 2FY1A 2ZUGA 2DGTA 3GFYA 4LF4J 3D68A 3N5BA 4ZPBA 2GJ2A 1UEVA 2LA4A 1VQ4S 4P2XA 1UFLA 2UUBF 1RAHB 3L95X 1TMMA 5FDLA 3DRRB 3CDAA 4YQWA 4CYUB 4X4SA 2GQQA 1ACMB 5HQLA 4GO7X 1ZOTA 4XDDA 2PA3A 2QL5B 4ALZA 1WORA 3CO0P 1TUGB 4AQYJ 3I82A 3OVAA 1TKXA 1EKRA 5GAHU 3LW5C 1XQIA 4YDDB 4IOBA 1S6QA 3MM6B 2W01A 1RTJA 3N6LA 1RYRA 3QO9B 3QMQA 1JJ4A 4J7CA 1CJUB 1BLUA 1GMUA 1M1KT 8AT1B 2OEKA 4E0DA 4ZHRB 4FF1A 1NK4A 2M52A 3MEEA 1TFWA 5D6GA 3GV7B 4NLRA 2RRNA 4TU9A 3J7Z5 1V3RA 4KGVB 3V2UC 3CD0A 1RWPB 1U1OA 5AXNA 2JNJA 2A10A 3OR1A 1JLGB 3D1HA 3VAKA 2FVPA 4JI4J 3UR3C 3BGUA 1TL1B 3Q22A 3K0JA 4Q8EA 3ADAC 2FJWA 4OL8A 7FD1A 3QZ8A 1EB0A 3PEJA 4WYWA 4RW8A 1K44A 2RKIB 3OFHA 3JXOA 4CLLA 3IAM9 2M5YA 4I2PA 4ZP9A 4R8UA 2B6AB 1NJIT 2AEFA 5LOQA 1ZTTA 1NMEB 1TL7A 1C0UA 2MKJA 2BABA 1SL2A 2JWNA 4U7UD 2BM0A 2DR5A 4X62F 3AH6A 4ECYA 5A8WA 1VQKS 5H9FK 4LFAF 4OI4A 2OPRA 1RWNB 5DRKA 1YJWS 4DR3J 2W25A 2AX1A 5G4DA 4JI7F 3MGJA 3SQGA 1MMNA 4PABA 2B4VA 3BO2A 4DSLA 4NRTA 1FO1A 3CCRS 2ADCA 3CCES 2ABYA 2AJ0A 3D0IE 5F0UA 3PACA 3FQKA 4PWWA 3M9MB 1PC4A 1HWUA 1RB0A 1YVFA 4QBUA 2GNKA 4DXLA 1Q5YA 3S1TA 1P27B 4DR6J 1KNZA 1JWWA 3F56A 2Z2LA 2WVDA 4WZMA 2LQBA 3CMQA 4RU2A 4IQMA 5HVGA 2D1CA 1A9NB 1T05B 1UP1A 2HNDA 4LF6J 4Q7AA 3I96A 3LQVA 2R2UA 5KFFA 1KONA 1RQ0A 3CULA 3OVSA 4PG5A 3VAJA 4IRCA 4TNOA 4PKDB 2YNGB 1BGXT 1EQ0A 1U7LA 3X3UA 2CZ4A 1IVZA 3KLEA 1AFIA 4PUOA 1Y10A 2QA4S 3W5XA 2QO3A 1ZM3A 2PIIA 1FXRA 3VAFA 2HBYB 2E66A 4DR4F 5EHHA 4ZCMA 2QMXA 3M8QA 3MR2A 4OX6A 1S99A 4LR7A 4Z7YA 2XMUA 3L4BC 1FDBA 2OPSB 1ZH5A 3M8YA 1OY8A 4KH0B 4RU9A 1TAUA 2BANB 2AD9A 1FEHA 2QYGA 1IKXA 5F8HA 3BDPA 1WF2A 2XMJA 4YR0A 1UVKA 1U6BA 1TZ0A 5HI7A
chains in the Genus database with same CATH topology
4O44A 2HMIA 4JI2F 2GHVC 3SI8A 2AWZA 2SXLA 2DGXA 4U7CA 3OHBA 2VD3A 3VAIA 4ICLB 2QSWA 4ZPCA 2HPUA 3TRGA 3MFHA 3AB2B 3IXQA 2NREA 2CYYA 3KG4A 4DWIA 4F4KA 2L08A 4JI5F 1CQNA 2HHTA 3SMZA 3K5OA 5CXTA 2LDIA 1XC9A 2B9XA 1F5BA 2HFNA 3THPA 3LWMA 3T6JA 2Y0SD 4MTPA 5KFKA 1R8PA 2OFGX 1R3NA 5EN1A 1H6KX 3OXGA 3ENWA 5KFRA 3VZHA 1S76D 2DNKA 4X4VA 2OPQA 4DR2F 2K1RA 1W25A 3H8YA 5GADU 4CO4A 4JOUA 4WIIA 4DV0F 2CQ1A 5KT6A 2PEHA 7FDRA 5KTQA 5D3GB 1X0PA 2CQ0A 5I3UB 2FHJA 4A46A 1FDDA 1T03A 2KDOA 4RKUC 4ZCLA 5T7LB 3HK2A 1RTHB 3T9NA 3I4PA 1KC8T 2PFFB 2A2CA 4ED1A 4NA1A 4AYBD 2E1RA 4C98A 1R8HA 1KEKA 5KT2A 1U6FA 3BDEA 2BW2A 5K14B 2F40A 3CJKA 1Q8IA 1YRTA 1G6BA 1P9QC 3OR2A 4ID8A 4OIXA 3WBZA 3THTA 2V4RA 3V6JA 4QCLA 2DGVA 2RU3A 6FDRA 4MIWA 1SJ3P 3MF5A 3W2VA 2KG0A 1FESA 3T5KA 3U1NA 4BBYA 1N56A 2K8GA 1D3WA 3C3LA 2KO1A 1VC6A 1XNQF 5JJBA 2UU9F 3QZ7A 4DF8A 1SIZA 1MNEA 4ICLA 3I55S 3BSAA 4GMKA 4RZRA 5KFCA 4DL6A 1FRJA 2DISA 2GCFA 3MECA 3QJPA 5I3QA 1BD6A 2BRLA 2DBBA 4TN2A 4AQYF 4ATNA 1U8SA 2ALZA 1KRPA 2EKYA 2V8GA 2NSBA 1LWCB 1CLFA 2C3OA 5A6WA 3C2PA 1VRUA 3PM9A 4K4YA 4O3QA 4MYTA 3DI6B 2I0XA 3HP6A 4N41A 1HI8A 5KG1A 4N56A 2MHEA 2MKCA 5DS7A 1YQHA 2B43A 4KTQA 3IR7B 3CJ4A 4I0WA 1JMTA 4DFJA 1OO0B 2QZ8A 3MM9A 4MYUA 4ES3A 1S97A 2ASYA 2B0GA 2D7SA 3ZZUA 1M0SA 1R31A 2WB4A 2LMIA 2EFVA 2KH9A 2HFOA 3R3TA 2ZBIA 1RWUA 1S49A 2KB2A 2I5JA 2RIJA 1HBUB 3DOKB 3CB4A 4QR0A 4J9QA 2JHEA 5CD4H 3KK1A 1L3TA 1Q7LB 4GC7A 2XMMA 3HPOA 3WZ0A 4PR6A 3VWSA 2C2RA 2CJ9A 1XR6A 1Y4ZB 2C3PA 4Y00A 2IC3B 2LU1A 5AJ3F 2W9BA 3QGPA 2VQEF 1M5OC 1SI9A 4UY8T 2J0XA 4MFBB 4RW4A 3DXSX 2E1CA 2BV3A 5KFXA 1UVIA 3J7A1 2JRSA 1YSJA 3DRPB 1DTTB 4C0OC 2XB2D 1X5TA 3IAS9 3CCMS 5D4LA 3KHGA 3CEDA 1RK8A 4NZ7A 1VQMS 3R5DA 2IBOA 2J6UA 3CDEA 5KOWA 2PD1A 4OQJA 5E0OA 1Q16B 2V94A 2PO4A 2F1FA 2VQFF 3DLKB 2ZD1A 4I2QA 1YJRA 3PV8A 1CG2A 3DI6A 1HNVA 1X4GA 3EX7B 4ECVA 1JJHA 5CQGA 4C4WA 1U26A 2MGZB 1K73T 1M5SA 4FXVA 3MWBA 3B4MA 1NJYA 1UJ5A 3ISZA 3MMJA 1EP4A 5KFWA 3NMRA 2GA7A 3K5PA 3DLGB 3BS9A 1H2UX 1N5YB 1C0TA 1S1VB 3H2VE 3SEOA 1SV5B 5IZHA 4DS4A 4Y2IA 5KFQA 2MSSA 1ZYQA 5B7WA 4GO5X 1K9MT 2VB6A 3QLHB 4PPDA 3U7JA 1DHMA 3T5JA 4KB7A 1HBUA 3DOKA 3TOQA 4D3GA 2VONA 3FRYA 2A2DA 2P9EA 4DMZA 2AGOA 3KLIA 4P2SA 4WFYA 1YHQS 3OL8A 1ZPWX 5KFBA 1YRUA 4A8SA 1FXLA 2JEIA 5A8RA 1X5PA 2IC3A 2ILZA 2DIUA 3CJ2A 3F41A 4M8LA 2WOMB 2O01C 2VPXB 2FB0A 4KQZA 3CJ0A 4PXDA 4ZPDA 1R0AB 1ULRA 1H0HB 5KFGA 5J2PA 3DRXA 2LKZA 3Q2TC 1IQZA 3U1MA 3MOZA 5FDLB 1DTQB 1XMQF 1DTTA 2JZ5A 1A6LA 2MQQA 3SFGA 4EZ9A 5LJ5Y 2ZZMA 2DIVA 3RR7A 2J0SD 3CSKA 3PHEA 4ECSA 2HHHF 2HWHA 4C8OA 1MMLA 1JLAB 4DL3A 4DLGA 2J7UA 2IJFA 4MIBA 5LXRA 1I94F 3FFIB 5SUHA 1TKXB 5HP1A 4QYZJ 1Y9OA 1S6OA 5THWA 3CCVS 4O3SA 3IWNC 1B0PA 2DB1A 2HGLA 4JV1A 3LUYA 2MQLA 2M70A 3L09A 2PT0A 2MGZA 2BZ2A 4QU7A 3QIDA 4BS2A 2FHJD 3BB5A 4A8OA 4NXMF 1HA1A 2KN4A 1S6QB 4B3RF 1H2TZ 3O5TB 5LL6d 4MAKA 2FJBB 2OJ3A 3DYAA 2R8IA 1R89A 1RTJB 2L9NA 1SV5A 3E51A 4OI1A 1TK0A 4X4RA 4F3OA 3IR5B 1FJEB 3GFZA 3PXGa 5F8JA 2W4DA 5B09A 4TQRA 1C1CA 2DJWA 3N6NA 2P9CA 4QWBA 5EWFA 3KFWX 2FJXA 1J2VA 4NYZA 1T02A 1H3DA 2F9DA 2XGPA 5H9FJ 3DMJB 2RT3A 4A8MP 1CSJA 4DR6F 5CZVA 1D9AA 4DV7F 4OZ1A 5L1LA 3FEXB 4I6AA 1VQLS 5MLCV 2PN6A 4ECWA 4R25A 3SDEB 4C7QA 1N48A 5L1KA 2W8LA 3PW7A 1SJFA 1N33F 2V8DA 2F3JA 3KLVA 1RKIA 3I0RB 2BYCA 4YDXA 3S8SA 3MEEB 3G6VA 2GW8A 4O3RA 3NWGA 1O51A 3BEGB 3I9V9 1C2PA 1CC7A 2VG7A 4UY85 4EEYA 2LXUA 4L72B 5AXMA 1H7XA 2HWTA 4DUYF 3SV4A 4RLEA 1DTQA 2ROGA 2FD2A 3GR1A 5B0BA 2OD4A 3QGGA 5F8IA 1PGZA 4PG4A 2XMTA 1GNKA 1NK9A 1KHWA 2KXNB 3KLHB 3JSMB 2UXBF 3OR1B 2BOPA 1L3VA 3VQSA 4QIGA 5GAEI 4NA3A 3GV8B 4LF6F 4ZK7M 3OW2R 4DR7F 1JLAA 1LOUA 4NX9A 4Q45A 3HVAA 2B9YA 4IH5A 4R5PB 2PSZA 4G6VB 4M94A 4YY3F 4BC9A 3FFIA 1Z2LA 2XHWA 1S0NA 4JV5F 5BJRA 4ZPAA 2N82B 1X4FA 2NQPA 4DFMA 4B02A 1K0VA 3UFCX 4ETZA 5F3TA 2J5AA 2FVQA 1TAQA 2F8EX 2R2TA 5IM0B 4IO9Q 2V4JB 3D54A 1DQ8A 1F5AA 4DX8H 5MAOA 5JUMA 2DO0A 2Z0GA 4JV2A 4OI0A 1S72S 5D4PA 1NH8A 3TVKA 2AYGA 5DO2A 3RZAA 3K5NA 2GQ2A 2A18A 4C3MA 4CH1A 3T3FA 3PIPQ 1K0TA 4I2PB 2VBXA 3MMCA 3MMAB 1HD0A 2AGPA 3QPIA 3DMJA 3CD6S 4R8UB 4G1QB 1ZTWA 3IWLA 1M5PC 2MQPA 2DH9A 1BY9A 3PKYA 1M5KC 2QLXA 2ZBCA 2VFSA 3SDEA 2DGSA 1X9MA 3MURP 2MZJA 3R5CA 5C25A 2IA0A 1FK9B 3PX6A 2ILYA 4FF3A 1DQ9A 1WEXA 1TVRA 2ZDOA 1SH0A 1ZZNA 2XNQA 5KFHA 3KK2B 1PSDA 3OLAA 3GFXA 5A8WB 4FYDA 1WG5A 2ATLA 3R5AA 1JLFB 4DQRA 4OV1A 3CDBA 3OFFA 4N8NA 4DN9A 3VAMA 3LO3A 1U2FA 3JSMA 2DRAA 2FHOB 3GFHA 1EETB 3IG1B 2OPRB 3CO9A 4FS2A 3D5MA 2C2EA 3TX8A 3U02A 3KJVB 2DGUA 3BN7A 2XI2A 3SQGB 3EYZA 4CI0B 4LUBA 4QR1A 2JFKA 2BR0A 3ZZZA 2FDNA 5KFZA 2WB1D 5KG7A 1DLOA 1HBOA 2ZKTA 1TK5A 5E3AA 5C42B 4QIEA 2F8MA 4R0JA 3J7YU 1NK6A 1NU4A 1XR5A 5E3RA 3MDFA 5B0FA 2HQIA 2XMKA 4CIOA 3MOJB 5IM0A 1XN9A 4TKTA 4WK1A 4HL9A 3W2WB 2BVZA 3UPFA 1UVMA