3V4MA

Crystal structure of a rna binding domain of a u2 small nuclear ribonucleoprotein auxiliary factor 2 (u2af) from mus musculus at 1.80 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
GGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from Mus musculus at 1.80 A resolution
rcsb
source organism Mus musculus
total genus 29
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4mA00
2KVIA 2CQ2A 3Q2TC 2CPXA 3P5TL 4CQ1A 1FXLA 2G0CA 2DHAA 5LXRA 2LECA 2MY8A 2KH9A 3K0JA 1M5PC 3MUTP 1KOOA 5DDRC 2K8GA 3SDEA 2MKIA 1BY9A 2U2FA 4OZ0A 1VQNS 1N88A 4YOEA 2FC9A 2OTLS 3P49B 1B7FA 3U1LA 2ZJRQ 2VOPA 2XS7A 1QM9A 4BS2A 1WF0A 3EX7B 3THTA 2CPJA 2KM8C 2EK1A 1AUDA 2LXUA 2MKJA 2XS5A 3PIOQ 5GAHU 1HL6A 3G8SA 2MKSA 2CPYA 3G71S 2CQBA 3D2WA 2G4BA 3L3CA 3UCUP 1QVGR 2E5GA 3R1LA 2L41A 1G2EA 2RS8A 3BEGB 4U67Q 5LJ5Y 3BO4A 1M5KC 3MUMP 2YH1A 2LYVA 5LXYA 2DH9A 5HO4A 2KXNB 4IUFA 1JJHA 3G6ES 1U1KA 4C7QA 4V19X 3MDFA 2DK2A 1UP1A 2WBRA 1NO8A 5D77A 2MZJA 2XSFA 2KN4A 4Y00A 4W92B 2DB1A 2HGLA 2MSSA 2MKKA 3VAHA 1Q81T 2SXLA 1A9NB 1Q7YT 4LMZA 1UAWA 5DDPC 2F9DA 5IM0B 2DHXA 4P6QA 3ULHA 1YIJS 4FXVA 3R27A 2DNOA 2KT5A 3BO3A 2MZ1A 3G8TA 1VQMS 1VQKS 4YB1P 3CCRS 1R8HA 1OWXA 2MJUA 3DXBA 5LSOA 1YITS 3CC4S 3G4SS 1D9AA 1JJ2R 2YH0A 3UD3P 5GADU 2OSQA 1X4DA 3U1MA 3UCZP 1WHVA 2N3OA 2HVZA 2DNLA 1VQOS 2ADBA 2JX2A 2DO0A 2BZ2A 3VALA 3H2VE 2D3OR 1YWXA 3CC2S 2GHPA 3J7ZT 2MQLA 2MXYA 2RQCA 2DNHA 3VAKA 2D9PA 1WG4A 2CQHA 3UD4P 2DNRA 2NLWA 1UW4A 2CQIA 2DNPA 1FNXH 1OO0B 1YJ9S 2CPZA 2M8HA 3SXLA 4QU6A 1WG5A 1WF1A 4LIRA 1X4FA 3ZZYA 1VBZA 5ITHA 2CPHA 1VQ5S 4PRFA 2VONA 5DM6Q 2DNZA 1U1NA 2DGTA 2ZJPQ 2KM8B 2AYGA 3DLLQ 4W90B 1U2FA 1DHMA 3NS6A 2MPUA 2CQCA 5IM0A 2LEAA 4TLQA 2O3DA 2MQPA 2OSRA 1IQTA 1VQ8S 2B0GA 2CQ4A 3CCVS 2XNQA 5CA5A 4ED5A 2GO9A 2MKHA 2KG0A 2YTCA 4QQBA 1F9FA 2QA4S 2MY7A 1M90T 2I2YA 3S8SA 5CXTA 4J5OA 2J8AA 3VAIA 2DH8A 3MI7X 1N54B 3LPYA 4WIIA 2MQOA 4TU7A 3CCQS 5JVHQ 2HGMA 1KQSR 2RQ4A 1WG1A 1OPIA 2DNMA 1VC0A 2QFJA 5D78A 4IOAQ 2OJ3A 1URNA 2EVZA 1K73T 5MLCV 2L9WA 1X0FA 1WTBA 2OIHA 3S6EA 2K3KA 2LCWA 2JWNA 4WFBQ 1X4CA 1RKJA 1U1PA 3BS9A 3N9UC 1R8PA 2CQ1A 5GAGU 2DGQA 2MYFA 1U1RA 4M5DB 2MMYA 2DISA 2DNKA 1DBDA 5H1SV 1WEZA 2DNNA 2OTJS 2MZTA 3R1HA 3FEYB 4F02A 2E5HA 3NS5A 2MQNA 2U1AA 2LQ5A 2MJNA 1QVFR 1SJ3P 3RW6A 2AYEA 2VOOA 2FHOB 1ZH5A 3CCSS 2ZJQQ 1FT8A 1DRZA 1WI6A 3VAGA 5GMKa 2LEBA 1ZZFA 1VC6A 1VQ7S 2CQ3A 3P6YC 3G96A 1H6KX 2M0GB 1O0PA 1H2VZ 2M70A 1UFWA 3CCMS 3EGZA 2DGUA 4WKRA 3PIPQ 1P27B 5GVQA 2M4MA 2G1DA 3EGNA 2M9KA 1U1LA 1ZZNA 2KYXA 5CYJA 1PGZA 4C4WA 2BOPA 3P3DA 3TO8A 4Y0FA 4F26A 2E5IA 1Q82T 1WHWA 1M5OC 1WHXA 4WFNQ 3I56S 2MKCA 2AYMA 2LA6A 3CC7S 2DGOA 4F25A 2MHNA 1KOHA 4PR6A 4PKDB 4TU8A 4CH1A 1SJFA 4A8XA 1U1QA 4WCEQ 4CIOA 4FXWA 2MZSA 3VF0B 2JVRA 3MURP 1YI2S 1SXLA 2M8DB 2KXFA 4WF9Q 1HA1A 2X1AA 1U6BA 1X4HA 3VAJA 3CTRA 1FO1A 1X5PA 1YTYA 2DNQA 2RVJA 5DDOC 2QEXS 1VBYA 2DH7A 1JJ4A 1HD1A 2CPFA 2CPEA 2JRSA 2RNEA 4Z2XA 2J0QD 2AYBA 1VQ4S 2LA4A 2RS2A 2DGSA 3UWTA 1M5VC 2J0SD 1HD0A 2KXHA 1WWHA 5DDQC 2J76E 2E44A 3S7RA 2MSTA 3MD1A 5BJRA 2PEHA 2AD9A 1WI8A 3MXHP 3JB9k 3I55S 2MB0B 5JVGQ 5GAEU 2RRBA 1FHTA 1VQLS 2KRBA 2N82B 2CQGA 3V4MA 4OZ1A 3NNCA 1FJ7A 2JVOA 3RW7A 4IO9Q 3HI9A 2DIUA 2KG1A 1WEYA 2DGXA 2A3JA 3CCJS 3G9CA 4LJMA 2X1BA 3BO2A 2LXIA 2DIVA 2MZQA 3SMZA 2M2BA 2D9OA 4EGLA 1KD1T 2ERRA 2YWKA 1NU4A 1P1TA 1U6FA 2F3JA 2L08A 1OIAA 2Q79A 2RRAA 3HHNB 3B4MA 1U1MA 3NNHA 3CCES 2CQ0A 1YJWS 5IFMA 5IQQA 2KRRA 3CPWR 2MQQA 3CCLS 3THPA 3CUNA 2RT3A 2V94A 2N7CA 2CPIA 4YUDA 3MOJB 1X4GA 1VQ6S 1VC5A 4UY8T 2LKZA 5LJ3Y 3TP2A 2DNGA 2I38A 1VBXA 2KI2A 4QPTA 2VODA 1SJ4P 1WEXA 3US5A 1DZ5A 2MGZB 2PE8A 2DNYA 1S79A 1X4BA 1X4AA 3CD6S 2DO4A 2M7SA 1M1KT 4UQTA 5HL7Q 2XS2A 2MQMA 1X5TA 1H2UX 2DGWA 2DHSA 2XB2D 5FJ4A 1FJEB 4WFAQ 5LSLA 3OW2R 2CJKA 1XN9A 2N3LA 1WELA 1N52B 2YKAA 3NMRA 3UE2A 2KU7A 2F9JA 2RU3A 4TU9A 3SDEB 1H2TZ 2DITA 1VQ9S 2X1GA 3MUVP 1Q86T 4ZKAA 2KHCA 3VAMA 1VQPS 4ERDA 1X5SA 2KFYA 3B4DA 1X4EA 3VAFA 3NNAA 2RUGA 3Q2SC 2HGNA 2UP1A 3IRWP 3LQVA 1YHQS 3CCUS 2X1FA 1NJIT 3ZZZA 2HYIB 1L3KA 1A7GE 1K9MT 1YJNS 2EK6A 2M88A 2FC8A 5DM7Q 2CQDA 1S72S 1RK8A 4QU7A 1K8AT 3CMES 2M52A 2NZ4A 1SJRA 1N8RT 3H2UB 1WHYA 2LMIA 3MD3A 1PO6A 4RU2A 5EN1A 3CMAS 2E5JA 2MGZA 2HZCA 1W2BR 3CULA 1JMTA 1X5OA 3J7YU 3UCGA 4CH0S 2CPDA 2CQPA 3S01A 5DETA 1KC8T 2MZRA 3CXCR 2XNRA 1WF2A 4C0OC 2FPHX 3FEXB 1U1OA 2DGVA 1CVJA 2DHGA 1FJCA 1D8ZA 3TYTA 3CF5Q 2FY1A 1SJQA 3IWNC 4IOCQ 2ADCA
chains in the Genus database with same CATH superfamily
1E6VB 4ZHRA 4I7FA 2HS4A 3A8JA 3GZ7A 2LU1A 2XBPA 3CJ2A 1RXOB 4JI1J 4YY3J 1WNEA 1RAEB 1HNXJ 2XS7A 1ZM2A 1QM9A 1LEOA 2QMXA 1XMQJ 2IM2A 2XS5A 4K50A 1IBKF 1WOOA 2B6AA 4L6V3 2XMJA 3L3CA 3UCUP 3VV2B 2IBKA 4I2PB 5HO4A 4P2SA 5L1JA 3RB6A 1RWXB 2GMLA 1UP1A 4NLRA 2PI4A 1F60B 1PJ6A 3QQCD 4P7VA 1CJUA 2GIRA 2K7KA 2JOQA 3EVWA 5ADZA 1T9UA 2VQFF 1VJWA 4H4OA 3BO3A 4DSIA 2W7OA 1XMOJ 5ETOA 3TARA 2K2PA 1IBLF 2YNGB 5FDLA 4IH7A 3QJLA 4IR1A 5HATA 3HLUA 3ZTRA 1KBRA 2FVCA 2J9DA 3J7ZT 4K4SA 1M1GA 2D9PA 1FK9B 3I87A 1T7PA 2FJWA 5HMWA 4OYOA 4LIRA 1S9GB 1X4FA 1N33F 3KUEA 1Z2LA 3QNWB 2DBBA 3SCIE 2IA0A 3PRDA 1CJVA 2MQPA 4GO5X 3MR7A 5HVFA 1NKCA 3RAQA 2CQ4A 4HEA9 3EUNA 2EFQA 4DJBA 3K89A 4QQBA 5L9NA 2GGPA 5F3TA 2FD2A 2ZH6A 1R27B 1A6LA 4ETZA 2UVWA 1UJ6A 4C8ZA 2XI3A 1SV5A 5CYQA 3HVTA 1HBOA 2QSWA 3N9UC 4NLVA 1RTIB 2DGQA 3D66A 4FF1A 2OFGX 4WP9A 1GAOA 1FRIA 3M6UA 5IQ6A 4JI1F 2IA6A 4YY3F 2OPPB 3PW5A 3RB3A 3V2UC 1HNXF 4ES1A 1FFSB 4W4MA 2VKZG 2H3EB 2AF6A 3KLFB 2R2SA 1XMQF 3CCMS 1QUVA 1PYTA 1ZAXA 3OR1A 2ZH9A 1Y3JA 4C4WA 3M7VA 1T9XA 4DR3J 2Q6BA 4E2FB 1HARA 1LWFA 3MAQA 2DGOA 2KFNA 2N7YA 4TQSA 4ZLLA 4FS2A 4RNMA 2YKPA 3PKMA 4YDDB 4C3KA 1ZS6A 4J90A 3NGKA 4ZCLA 3C3LA 3OSNA 1XMOF 1X5PA 4C8KA 2QEXS 1M5SA 3TJ9A 5HK4A 4MIBA 3OJSA 2KHDA 3QGPA 4CCHA 4JI5J 1Z4UA 2CJQA 5KTQA 3EGWB 2RKIA 4X4SA 2V2KA 1LW2A 3H25A 4RJVA 3CSKA 1BQNB 4QWCA 2C3MA 2PT0A 4XPEA 1RCOB 3KLGB 1QSSA 2OPQA 5IV3A 4QYRA 2X3DA 1YGYA 4O3QA 3VQTA 2EPIA 4K7QA 4QWEA 1XERA 4ZVOB 1U45A 4PWDA 5KT3A 4KV8A 4Q8EA 2Q79A 2RRAA 1FWLA 2PSZA 2IJFA 1FKPA 1FD2A 3PCOB 3CUNA 2V94A 4PQUB 4QCLA 1R0AA 1X9MA 4NCAA 2DNGA 4LF2A 3CCTA 1APSA 4Q0BB 1ZETA 2M3DA 2DNYA 4J9KA 4ZPBA 4ENOA 2RDDA 3PO4A 4DR6J 4AL7A 2QSFA 4UUXA 2XSJA 4JOUA 3D3BJ 3DRRB 4KBIA 2IDLA 5DGAA 1L3UA 2VC1A 4X4VA 1HBUB 1VLYA 4DPUA 1T3OA 4ZKAA 4KT0C 3VAMA 3MEGA 4ERDA 3B4DA 2F5GA 1WTFA 5SUHA 3DU5A 1YHQS 2GFFA 4OHWA 4KH0B 1NJIT 4XO0A 1IBMJ 4HR2A 1SQEA 4DR3F 1K8AT 3H2UB 1WHYA 5ETKA 1K44A 1IKYB 1W2BR 3CDEA 3MGJA 4JI0J 4CH0S 4CLFA 2HZAA 1KC8T 5IT4A 4QWBA 3EXCX 1F5AA 3FEXB 3M6XA 1IBCB 3C66A 2F7VA 3R5DA 3P5TL 4BWJA 1C1BB 2VG5A 2HHPA 2LECA 4O3PA 3W62A 1EHWA 1KOOA 4JI5F 4HI1A 3OXGA 2OTLS 4ED7A 1PCAA 3AXKA 2YNFA 1XK8A 2ZM6J 1JNRB 1EJ7L 3A12A 5GADI 5A8KA 2ZNZA 4KSEB 5HQMA 4KHMA 3KNAA 4YR3A 3GJSB 4P52A 2PMHA 4A8QA 1BQMB 1OJ4A 5A8RB 4TYBA 1JJHA 2HMIB 4I2QA 4CYUB 4B3OB 4W92B 2CWXA 2BE2B 1FRJA 1NK0A 2CFXA 2HVHA 2SXLA 1A9NB 1QE1B 1ITPA 3ZTSA 2J0WA 2HHWA 2DNOA 5D6GA 2MZ1A 1CBKA 4LVOP 2NREA 4G1QA 1TK8A 4HH0A 5GADU 4Y2CA 4OZ3A 4DR6F 2HVZA 3DOKA 3TX0A 2HNZB 2GHPA 1HLWA 2DPJA 3B82A 5KFXA 4NYZA 4NI2B 3T6BA 1YRTA 2O1PA 4QU6A 2GZOA 3ZZYA 4FKYA 5IS2A 4U7CA 1R8AA 3E01B 3AOAA 1FCAA 3HD1A 2GIQA 2ZDOA 3DRSA 3OBIA 5K14B 2XNQA 1XNQJ 1IBMF 4OX9J 2QA4S 5CZXA 3NXZA 2I2YA 4EO6A 4J5OA 2PEBA 1N54B 4RW9B 3F0NA 1QTMA 3TUIC 4ECYA 4GKKJ 4JI0F 2R8HA 2IDEA 1ZM9A 4OYAA 4XK8C 4EYHB 3DOLB 3MZIA 2E9TA 3L7UA 4LF6J 1RT4A 1Y5IB 1QVFR 1N5VA 1SJ3P 3GSDA 5C24A 3SV4A 5LSRA 3HDSA 4QWDA 2ZM6F 4M5MA 4QW9A 1YBAA 1CG2A 5C5JA 2BJDA 5F9LA 4RZRA 4YFUA 5GVQA 1IKWB 4WK1A 1ZZNA 1T05B 1PGZA 4LF1A 3O2IA 4E98A 2VUGA 3Q83A 1Q82T 4C6AA 2NSBA 3HFKA 3OUYA 5U47A 2HRUA 4P71A 3BR8A 2DXEA 2JVRA 4WWSA 3HVAA 4RW7B 1FDDA 1HA1A 3SCJE 3CDBA 1SKSA 1RT2B 7AT1B 1ULRA 2HHTA 1C4CA 2HQFA 3S7RA 2R7OA 4O4GA 4NLUA 4FP9A 2M5YA 4ZN1A 3BREA 1FHTA 4F04B 4LT6A 1MU2A 2EI5A 3VGVA 4LRBA 3V4MA 2YBVA 3HI9A 2DIUA 2OI2A 4E8UA 4K8RA 3IO1A 4ECVA 2P6SA 1B0VA 4DZDA 4PABA 3OTDA 2FIUA 1H7WA 4ELTA 4LJMA 2NUUG 2JJ4D 3Q22A 3PHTA 1NU4A 3AOBA 4N7TA 1TQLA 3MEEA 5IWAJ 1XNQF 1RA7A 1RHKB 4FNHA 3G6VA 4OX9F 1RTJB 1UKUA 4DX5A 3M6WA 2LKZA 5EWEA 4GKKF 4XIUA 2PE8A 1UWBB 1GX5A 4EBEA 3M2RA 1T9YA 4UQTA 5KFCA 3QPIA 4LBPA 2KB2A 1FJEB 1J5OA 2QLXA 3H7HB 1Q5YA 4MKVA 4DR2J 4LF6F 2XMAA 2DCUB 5KFLA 3FFIA 2KU7A 1FDBA 4ID5B 2AX0A 4B9NA 5KFKA 2DR7A 1X5SA 2XZWA 4H4MA 2ZUAA 4CDIA 2ASYA 2J5AA 1N6QB 2CVEA 4XTTA 4ZPTR 3LPEA 1BGXT 4USIA 1NH7A 3SCLE 3D68A 1YJNS 5B0FA 4QOTA 4ECZA 2ZVIA 3N4WA 4NPOA 4WFZA 5I3PA 1Y00A 4O3NA 4OZNA 3HHLD 3QJJA 4MMOA 1DQAA 2AIRB 4J7CA 3DU6A 3TOQA 2FY1A 1RQ0A 2UVVA 2CJ9A 2DR8A 4FPRA 2AT1B 2KVIA 2F1FA 4M63A 4DXLA 3U27A 2BJ3A 4CNZA 4KHPJ 1TL4A 5DDRC 3SDEA 5CCLA 3M2UA 3IN5A 4OHXA 4PYDA 2LVWA 1QAIA 2C3PA 4NLGA 1AUDA 4NYOA 2WK4A 3G8SA 3DNCA 1UWAA 1FEEA 2QO3A 2G4BA 2E5GA 4U67Q 3TZZA 3IAM9 4CO5A 1UFLA 4PZVA 4RW8B 3GCWP 3LANA 8RUCA 3JSMB 4Y00A 1FE0A 1RYRA 3WDOA 3VGUA 1Q7YT 3D6MB 5IWAF 2DHXA 2CRLA 4KY3A 1CULA 3R27A 3V6HA 3G8TA 5ETLA 2V50A 1VFJA 1YITS 1QSYA 3WX4A 2GQQA 3NKYA 1OSCA 4A8KA 3VALA 5IV4A 5L8RC 4LREA 4Q2MA 5HP1B 1BWVA 3AQPA 3CD0A 3BSAA 2DD8S 4RW6A 3MOZA 4DR2F 5KFFA 3D28A 1X7VA 2O5DA 1UW4A 2E9RX 1IR0A 4OX7A 2UUCJ 2BUNA 1M0SA 5ITHA 3A3PB 5D0RA 1U2RA 2W9CA 1LXNA 1PC4A 3NS6A 4P10A 1RA6A 3QIDA 1JLCB 1F2HA 1NK4A 1WUUA 3H40A 1RJJA 1I94J 2MQ8A 1RHMB 4Y28C 4J91A 2CUYA 5C25A 2D7SA 1OPIA 3W5XA 1U0HB 2ZBRA 1JX4A 2EVZA 3RRGA 4FNIA 1G4CA 3S6EA 3JAMU 4CLTA 2PDAA 3A8IA 2C2OB 3RBXA 2OTJS 4KHPF 1RWKB 1NK5A 2U1AA 2HNDB 2MJNA 2IMOA 4C3MA 5H9FK 2DCLA 4KPYA 5KFNA 2R2UA 1O0PA 2W9BB 4ECQA 3PIPQ 3I4PA 1FI4A 2G1DA 3W66A 3AODA 3LH2S 4OIXA 1WOSA 1O6XA 1MSWD 5CZVA 1KR4A 3AD8C 3I56S 4OYIA 3BGRA 4J9MA 4WCEQ 5DZ6A 4RUCA 4DWIA 2YX1A 4RNOA 1B99A 2V2ZA 3G82B 4DL4A 1G6BA 3CTRA 2BANA 2BQRA 3ZNUA 4M95A 3I0SB 2E29A 5I4MA 2VBWA 3R7SB 3VZHA 5A8WB 3I4HX 1XR6A 2QL7B 2ZITA 1YLXA 3OPKA 5HN0A 4DN9A 3QT8A 3LOUA 2N82B 3EPIA 2OAUA 3CGIA 4KAIA 3M05A 4OV1A 1LKZA 3AJ2A 2G13A 3W1YC 2UUCF 2O01C 1SH3A 3ILOA 3R5BA 1B7YB 4KO0A 2RU9A 2XO6A 1P1LA 2ERRA 2YWKA 3ITHA 1RT6A 4NXNJ 3QO9A 1FJGJ 4TKTA 3B4MA 1U1MA 2ZH5A 4YN3B 1D9FA 1U26A 4EZ6A 1I94F 4RO0A 2GVZB 4B9TA 2E1AA 2XLIA 2I38A 4ZVTB 1TL7A 3TA2A 1DFDA 1S6QA 4M5LA 4LSNB 2ALZA 3CD6S 1DQ9A 2YY3A 4ALZA 5D4OA 4L74A 1H2UX 2IIHA 2A18A 2CJKA 4I0WA 1SIZA 1WELA 5KFHA 5E3PA 3DN9A 3R97A 4JI2J 1RT3A 3LTOA 3KLHB 1AFIA 4K4ZA 1TVRA 2YVSA 1Z1ZA 1ROFA 1XTZA 1X60A 2OH2A 3LQVA 1H72C 3CJ4A 4WYWA 3MMCA 3HVWA 2LQ9A 1K9MT 4HT7A 4TXSA 1NAQA 3KUHA 2J7WA 1FTCA 2B5JB 3JS9A 1PO6A 1LWCA 2Q1LA 2FHJA 3T41A 3KUGA 1CS4B 1SQFA 5DETA 1MN9A 2CZ4A 2D41A 2P6TA 5C42A 4C0OC 2XCPA 1U1OA 1CVJA 2Z57B 2IM0A 1D8ZA 1HNVA 4U96A 5I3QA 3PTWA 2EFGA 3T3FA 3R2CJ 3QIPB 2CXEA 3EZUA 1Q16B 3IXQA 4DS5A 2G2ZA 4ED8A 4R0EA 4EK2A 1HI8A 2AJQA 2LQ8A 3OT9A 3U02A 1H74A 3GR0A 4Y2AA 4YB7A 4GC6A 2HAFA 3ZFVA 1HBNA 3D2WA 1MN7A 3TZXA 5ETQA 5D4LA 2H48B 4XDDA 4KGMA 2F40A 5CD4A 4DS4A 2CA9A 2GA7A 2AKWB 1CJTB 4B08A 4NXNF 1FJGF 1UZDA 2P9EA 1HW8A 1KP6A 2ATLA 5F9NA 3GPAA 1VQMS 1VQKS 3TAMB 3EGVA 1Q7LB 1OWXA 3T19A 3K59A 2PFFB 1KRPA 3RAXA 1GQEA 2J9DE 5J2PB 3P4UB 4D3GA 2IMWP 1HKAA 3RGIA 2DO0A 1F3VA 4WBFA 2ZBIA 3ZZ0A 1FA0A 4TY8A 4LF9J 2WCXA 4JI2F 1OO0B 4DQQA 1GMWD 2VONA 2UUWA 2IYGA 5HANA 3BF4A 1JLQA 3TEGA 1SL0A 4ZVEA 5IM0A 4IDKA 2DXFA 1FDAA 4ED5A 1F9FA 1XC9A 4OHZA 3K2YA 3J80Y 4DV1J 2MQOA 4OQJA 4DFPA 5JVHQ 3MMBA 4NZ6A 2FGOA 4WKYA 3D0IE 4A8FA 2OJ3A 1SIWB 1K73T 3GFZA 1WTBA 2LCWA 2YKMB 5HI7A 3VGTA 2ZOFA 1T9WA 5A2QY 1TAQA 2FVRA 1EZZB 2F8MA 3H5SA 3Q8SB 4XDCA 1YSJA 4URSA 2HQ3A 2AHOB 1SI9A 1FE4A 4EO8A 2UXCJ 2AZ1A 4UTGA 2QLJB 5J2QB 3T1AA 1S4EA 1ZZFA 2CQ3A 5KFZA 1NZ8A 3HHLC 2M4MA 1S1WA 1U1LA 1MMLA 4E0DA 2HKEA 2RIJA 2BOPA 3CDWA 3LUYA 3LA0A 2MKCA 2MHNA 2F4VJ 1KOHA 2ZDPA 2R7SA 4U7UK 2EKNA 2B8QA 2D3ZA 4MK7A 5L1IA 1Q0NA 3TI0A 4DLEA 3MFIA 4PXEA 4EBCA 1HFEL 5GAHI 2RNEA 4NCGB 3PDNA 2WTFA 4JV5J 4AD6A 1EKSA 3MD1A 5K20B 1ZBTA 5KFPA 1TUVA 4L76A 4ZS6A 1B4SA 3NNCA 3DYAA 3IP0A 3M30B 4LF9F 3Q8YA 3W2VB 3EDQB 4ZJQA 1WEYA 3MR2A 2XMMA 4OYXA 5KT7A 2YNHA 4Y2MA 4LBIA 3MCSA 3LP2B 1KD1T 5DZ7A 4MFBA 3MR6A 2F3JA 3KTQA 1MW7A 4ZPDA 1F3FA 3NNHA 1VJQA 2B4UA 4X64J 2E66A 2DTJA 1RUSA 2HWHA 5E3RA 4DV1F 5A76A 1KS2A 2C2ZB 5HROA 3J81U 3H5YA 2E7VA 2RSQA 1HQEA 2PN6A 3CJKA 1FEHA 4DDFA 2DO4A 3N0VA 3C15B 3OVAA 1SKUB 1JNZB 5KFWA 1URRA 4IFVB 1D09B 4LR7A 4QIEA 3FQKA 2W2QP 2Z2YB 5DG8A 2XLKA 2UXCF 4JV1A 4ZA1A 2DITA 2AMCB 3JTOA 1UVNA 1EAYC 3MF5A 4L72B 1TMJA 4LR8A 1HIYA 3EM1A 1IWAA 2UVUA 3NLCA 2VB6A 1IM6A 2M52A 1SJRA 4J9SA 1WDTA 1WOPA 2F4VF 4A4JA 2E5JA 3CWJA 1YDLA 1WSVA 1HMVB 2BXJA 2Z30B 7FD1A 1U25A 1JLFA 2CYYA 3FZ2A 3IWNC 2IRUA 1C1CA 4DG1B 2ROPA 1SB6A 2P5VA 1FXLA 5DRKA 4KH1B 2E7XA 4DF4A 3MAAA 2VG6B 4JV5F 4KGZB 1AZSA 4BS2A 4NA1A 2RHQB 2MKJA 3MR5A 1WKJA 2V9WA 3PKYA 1S1XA 1W25A 3MCMA 4I4BA 3R1LA 3CJQA 2EFNA 3ZXWA 2YH1A 4G1PA 3MM7A 1NHUA 4C8OA 3FSXA 1VRUB 5D77A 4OL8A 4IRDA 2XSFA 1QY7A 1BWEA 3O1LA 3W7BA 1UAWA 4X64F 1OQ6A 1PAEX 1YIJS 1E6VA 1LW0A 3DLKB 3VGSA 1ZM3A 1UZHA 5F0WA 3KMQA 3UDVA 3IG1A 4ITSA 3BYRA 2F4FA 2QMWA 1GMWA 2N3OA 1YZ7A 1VQOS 3BYPA 3LP1B 4DPOA 1YWXA 4HDHA 3EMTA 4DL3A 3PG9A 4I2PA 4B3SJ 1GT8A 5LT5A 3HJFA 1F6TA 2G0IA 4I6YA 1TFYA 2X7IA 5HBMB 2RAQA 3FKBA 2RB7A 3D9BA 3FRYA 4G1IA 5B0AA 1HBMB 2WHOA 5KFSA 2R2RA 4LRDA 2HEKA 2MKHA 1NEEA 3S8SA 1KLMA 1RHJB 2YNGA 3OTEA 4OLOA 2XGPA 1LWEB 4C48A 5AE2A 2WB1D 2FVPA 5KOWA 3D1QA 3BN7A 2XHWA 1RKJA 3BS9A 5KFUA 1FK9A 1VISA 1BE4A 4BWMA 4C11B 1TL3B 2K06A 1S9GA 5EUHA 4YB6A 1O8BA 3DDNA 4YQWA 1GEHA 2OHDA 2YPYA 1MMDA 2KO1A 1VQ7S 5E41A 2D74B 3V6JA 3FNNA 5GAEI 5CYJA 3HMJG 3UR3C 4DF8A 2HVIA 3FSYA 3BGOP 1I6JA 4YHHJ 1FTRA 5CAAA 1KVKA 2W2OP 4CH1A 3CE8A 4OYWA 1VS3A 4RWWA 4IQMA 3VF0B 2UV8A 3ZTPA 1RTIA 4RBVA 3T1YJ 3T5LA 1TKXB 5C2GA 2P9CA 3NMAA 1U6BA 3VAJA 2NSCA 2DNQA 2CPEA 2JRSA 2J0QD 2AYBA 4OJHA 3HX9A 2VIHA 4U9RA 2I0XA 1BD6A 2CNOB 3FCWA 1HHTP 3KLFA 4RUHA 4LF7J 5JVGQ 5GAEU 4LFAJ 4HHHA 3SSRA 3PFOA 4B3SF 3MHYA 4NLQA 5JXSA 1WORA 1WDDA 2DGXA 3SYZA 2N4DA 2M2BA 4F2RA 3R8YA 4PG8A 1Q78A 1NLKL 1FKOB 5BYSA 3A1YG 3G6YA 1OSDA 2MQQA 3H5UA 3BSNA 1RZMA 1VQ6S 3GFYA 4NL5A 4QPTA 1CQMA 3V6KA 1DZ5A 2APOA 3MM8B 2FB0A 1E6YB 1M1KT 1BQNA 2DGWA 1RWWB 3KLGA 4KYZA 3IS9B 2ZD1B 1NPKA 3NMRA 2YQ0A 5KG5A 1VQPS 5KFQA 5D3GB 4WZMA 4IQXA 3D6TB 3M2VB 2QL5B 2HGNA 2RQKA 2OEJA 3ZZZA 5ETPA 5DQGA 2HYIB 2RD5C 4PQUA 4F4AA 4DFKA 2EK6A 1IR2A 2QG9B 4YHHF 4DCOB 1FRXA 2OUGA 4Q0BA 1RAOA 3CULA 3TVZA 1JMTA 3RG6A 4FS1A 4J9UE 2QRRA 5AJ3J 2MZRA 2MEWA 3MR3A 3T1YF 2FLLA 3W60A 4J9QA 3GYXB 2YQ3A 1HW9A 2JFKA 4OZLA 1RWUA 2GC8A 3DHWC 1HBUA 4OZ0A 3CDUA 2B9EA 4O3RA 4Q8FA 5I3UA 2ZJRQ 3TJAA 4LF7F 1WF0A 2QJ3A 4NA3A 4P2MA 2EK1A 4LFAF 3MWBA 3BGLA 2GVDB 4MAKA 2CQBA 3UO0A 2P2CB 2FZKB 2Y9HA 2RS8A 2JLEA 2KXNB 3HVRA 5HMZA 1IKYA 2DK2A 5ETVA 4EI2A 4Q2LA 3NGRA 3MTKA 4DV7J 1MWQA 1XR5A 1B0PA 4LF5J 2AGQA 4FXVA 4C9DA 4RKUC 2LEPA 4BBYA 1C1BA 5DG9A 4M5KA 1C0UB 1KFDA 1R8HA 5K8OA 3CO9A 1JJ2R 2YH0A 1C0TB 1EKRA 2DNLA 5KFJA 4EFAC 2RQCA 5A8RA 1PYSB 3NWRA 2HMIA 4DL6A 2H5IB 3A8EA 3IGNA 1FNXH 4CYUA 4B3OA 3KKFA 1VQ5S 4PRFA 4ECWA 5DM6Q 2C2EA 3W5YA 4Q5VA 2BE2A 5D8HB 2JL9A 2CJAA 1QE1A 4YP3A 2O3DA 5EX0A 3CCVS 2V4JA 4H4OB 3KLVA 3NS7B 2ALYB 7FDRA 3M8WA 2GO9A 4IOBA 4PEOA 1HR0J 4B3TJ 3VAIA 2LFVA 2WVFA 3LPYA 2HGMA 5DQHA 4LRFA 4UT4A 5D78A 2AJ0A 3QFWA 2GV1A 5AJ3F 2OIHA 1MWZA 2HNZA 2GHVC 4K2JA 3W3SA 1UEUA 2ZE2B 1FRMA 2ZWOA 2FY8A 3MM5B 4ANCA 2E5HA 1D1UA 3HSZA 2G2OA 4WZQA 4GO7X 4KRWA 5HLFA 3E01A 1LFWA 3BN4A 3G8QA 2HLUA 1DTTB 1NHKL 2HLTA 2VL1A 1KQFB 4NLYA 1K0VA 5K14A 4OI6A 2ZZMA 4ZVHA 2M9KA 3CJ5A 5FIIA 4DV4J 1M5OC 2WOMB 2XYHB 1NNDA 1V5IB 2WVBA 1OQ3A 3K5OA 1S1TB 1GK8A 4DV7F 2GNKA 1OY6A 2ZVSA 1N0VC 1HBOB 2L48A 3NGSA 3WIUA 1CQNA 2NYIA 2PA3A 4LF5F 4O4RA 1L3TA 3RR8A 1LFPA 4WJBA 1Y10A 1Q8BA 2Y8YA 3DLEA 3DOLA 1Q53A 5ETRA 3ICLA 4DX8H 1NSPA 3UVJB 4O44B 4OV6A 1BUXA 2FJBB 4FXDA 1S4FA 2UVRA 4HLBA 4K4TA 3I9ZA 3HD2A 2MSTA 3TAPA 2PEHA 4MYTA 1P9YA 3AT1B 1IKWA 1I5OB 4TNOA 1N4LA 3NOGA 3OR1B 1T05A 2KFZA 3OTBA 1RAIB 3BDEA 4A8YA 4ZPWR 2AGOA 3K5LA 2EG1A 2DVIA 3SQGB 2LXIA 2ASDA 3GV7B 2DRBA 4MKAA 4ES3A 3FJ2A 4CO0A 1TELA 3EJMA 2NCKL 4ZLJA 5ETMA 3T9ZA 3O3LA 3EZ5A 1HR0F 5D0HA 3VCDA 4B3TF 2NXJA 4IFYB 2CG4A 2NXNA 3IRXB 1VCTA 4JUZA 1S79A 3IBFB 3IR7B 2XS2A 3KHLA 3V4IB 5KT5A 3TR5A 2FZCB 4O3SA 3VHQA 5F8JA 3D7SB 4YDXA 1SL2A 4RPFA 4B9UA 4A8MP 2CDQA 4PWDB 2Y0BB 3LGHA 5HJXA 2LQJA 3OJUA 1NM2A 2G1HA 1X4EA 3VAFA 1TL1A 4DUZJ 2UP1A 1K1QA 4Q43A 1RTJA 2KL8A 2HHHJ 4JV2A 1T11A 4NLOA 3FRZA 4DV4F 1FWKA 1S72S 2FJXA 3TWZA 3LP0B 3BSCA 1S76D 2RF2B 5EN1A 5M2UA 4OZJA 3BR9A 5F8IA 5F3ZA 2HZCA 1SH2A 4EMDA 1UWBA 1X5OA 2GMHA 5FLXY 4L75A 4BLGA 1UVLA 3QWPA 1Q95G 2AWZA 2QA2A 1M1HA 3HZGA 2DR6A 4C2MA 3TQEA 3QRQA 4ID5A 3H42A 2VOPA 4DUTA 2CPJA 1N6QA 1X0PA 4F4XA 4CM0A 1CPZA 3ELHA 2UV8G 3QSIA 2AEFA 2QLWA 5A0YB 3VVUA 1LQ9A 2L41A 2IAJA 5LJ5Y 4N77A 2LYVA 2ZEJA 5KFBA 4CO2A 3MDFA 4QR2A 1UJ4A 2NZCA 1V3RA 1ZA2B 2GMJA 2HFSA 5E3AA 5HMXA 3PZPA 4PWUA 3I5CA 1N32J 3IBCB 3OVSA 4H54A 2A6OA 1GNKA 3ENQA 3D3CJ 3FSIA 3MM9B 4M5JA 5K5MA 4P75A 4KR0B 4OZ5A 3CC4S 2HHSA 4I68A 2OSQA 2IVMA 1LK7A 2BZ2A 1KKHA 4WK3A 4PXCA 4ELUA 2QTWA 4RW8A 3AB2B 3E8OA 2CPZA 3TAQA 3R7BB 2DNZA 1U1NA 3PX4A 4DUZF 4NX9A 2KT2A 2P9GA 4TLQA 2OSRA 2HHHF 3DOMB 2YTCA 1REGX 3M6VA 1RE1B 2VG7B 1SC3B 4HKQA 4USWA 4G1QB 5L38A 1JXVA 3LAKA 3IMQJ 2QLFB 3KK3B 1L5UA 1UFKA 3RAMA 1QTNB 3A4TA 5IT9U 2G9OA 3OSPA 1QAXA 2YKOA 4WFBQ 5HP1A 4URQU 1N5SA 3GP9A 2DNKA 5H1SV 2DNNA 3FEYB 4Z37A 4FZVA 2MQNA 4NWBA 3OFHA 2OMOA 2KYZA 5CQGA 3CCSS 4DL0C 1DRZA 4ZVSB 5GMKa 1JLCA 2K1RB 1UFWA 2P8IA 4A8SA 3CNQP 1FXRA 4CLKA 4FDFA 2ROGA 4WFNQ 4WYLA 3NCQA 2ZKUA 1NK9A 3FCVA 1HWIA 1U47A 2BKNA 3TUJC 3GYGA 2V4QA 2AJFE 1N32F 1GMUA 1MMNA 1SXLA 5KG1A 3QT6A 2HG4A 4RNNA 4QR1A 2R8KA 3N01A 5D15A 4RWXA 1RT4B 1OS5A 4ED3A 3VVTA 4CI0B 4KHRA 1N56A 1YG0A 2IPOB 2LA4A 5C24B 4C97A 1JKHB 1RTHB 4I6AA 2E44A 2FLNA 2V67A 4UOHA 3IA0A 2CG8A 3BQ2A 2W9BA 2HK2A 3QGIA 2JC0A 2W9AA 4CM2A 2X51A 2L9NA 3MPDA 5CABA 1JK9B 5IC6B 1N36J 2VDHA 3CCJS 2RDJA 2YNIA 1HNIB 4TLRA 4Y2IA 3KG1A 3AH6A 2R7TA 3K58A 3QATA 3G82A 3GJRB 2QYGA 2KT3A 3I0SA 2RT3A 2B9XA 4ZP7A 4NEYA 2Y3YA 3ET6B 4C8YA 1K0TA 5A8WA 1RBLA 3JAMY 4IG3B 2XHCA 4NEZA 1X4AA 1NCLA 3Q0AA 1KHWA 1LWXA 3R6LB 1UVKA 2VFVA 2ZHOA 1JQGA 3DLGB 1DQ8A 2OEMA 1VK3A 2B3TB 3M9NB 3DLHA 2GX8A 2VFSA 3J81j 2F9JA 3ZC4A 2RUGA 3NAIA 4Y3CA 2EBEA 2LU2A 1TV6B 4M5IA 4ER8A 1A7GE 2QA4G 2GVZA 1N5YB 1T9TA 2UUTA 5DM7Q 1W2IA 4X4TA 2NXEA 5B0BA 2XY5A 3DFEA 3PW0A 1S10A 2DHGA 2XY7A 4Q45A 4WPAA 4HACB 2J8SA 2IHR1 3NOCA 5KG2A 2BW7A 4H4MB 1XMBA 3U1LA 1GTEA 5J1EA 3FBCA 4R0JA 1TP7A 3MEKA 4HHUA 3X1LB 5DQIA 5AXMA 2GJ2A 4ZVQB 4GKJJ 3C16B 3IWXA 2B5JA 3KJFB 3K17A 2IY5B 1N36F 4ED6A 3V5RA 4OFZA 4DQPA 1Y3KA 1S9FA 2RHSB 2WBRA 3KNGA 3E2EA 1CS4A 3KOAA 2FJEB 2HGLA 4N8OA 4QIFA 2OD4A 5B0DA 3SSQA 4OI1A 2ZNYA 2WVEA 3QIPA 2DRDA 3FBFA 3W9JA 5KFIA 1N34J 3I96A 1BQXA 2OEKA 3M2UB 3PYFA 1Y5NB 2BRKA 2JHEA 1VYAA 1X4DA 3U1MA 1TKTB 3QLHB 2IBOA 1GXLA 2HIYA 4RNFA 5E3CA 4DV5J 3GIMA 1AT1B 1YKWA 1WG4A 3KJNB 3FEZA 1VIXA 2HRTA 4J9RA 1R0CB 2MLXA 3NWGA 3MECB 1VBZA 1HWJA 2XG8A 1X9SA 1CJTA 5KFTA 1MROB 4RUAA 1RT5B 2DHHA 3RBZA 5DO2A 4CTAB 1CULB 3D6FB 3QAUA 2A6MA 1UEVA 2AGPA 2CIMA 3TAMA 4JI8J 2ZH7A 4A48A 4YS2A 2J7KA 2DH8A 3MI7X 1KQSR 2RQ4A 5J2PA 2QFIA 2FJDB 2H5EA 1FD8A 2I1RA 2DKOB 2GCFA 1U7LA 1V5VA 4CP5A 4RW6B 2MYFA 1KEKA 2MMYA 3TZYA 1RHUB 2GS8A 3HT0A 2QLBB 1YRXA 1UPMB 3RW6A 4DCPB 1TTHB 4G3IA 2C2NA 4EU0A 2HWTA 2H54B 3T9NA 4UZBA 4QR0A 1H6KX 4ED0A 2W2NP 2DGUA 4GKJF 2N4CA 3BBBA 2KYXA 5BR8J 4QIVA 4KKOB 1HI1A 3G87A 4DR7J 3MM6B 1VHIA 4PKDB 3GJQB 5T7LB 4TU8A 2C42A 1S49A 4UF4A 2CJBA 2GHWA 2YKMA 1TU0B 3C6UB 5I42A 3HXMA 4WF9Q 2WSCC 3C2PA 2HHQA 1X9WA 1N34F 1NH8A 3OFFA 2V34A 4QIGA 4Z2XA 1J27A 3ILJA 2JZ5A 5J2QA 2XZTB 2KXHA 2NPFA 1W26A 2HFNA 3Q24A 2AD9A 3SQOP 3MXHP 3JB9k 2W24A 5HQLA 4DFMA 2AV5A 4A8WA 1S0VA 4GMKA 4DV5F 4Z7YA 1KWMA 1SC1B 2BABA 2XTJP 2FJVA 2QT7A 3FMBA 4C8NA 1OYDA 3SEOA 1UEKA 2A3JA 2VPWB 4USJC 2GO8A 4K59A 2MZQA 2DT9A 2EEYA 5IXUA 1KSPA 1REVB 2CQ0A 1YJUA 3FCHA 2PA8D 4OJGA 1VGYA 2YX4A 4JI8F 3HSJA 3PR4A 1KVJA 2AX1A 4NCGA 4P2FA 1VBXA 4TQRA 3N5BA 3US5A 1I3OB 1SPBP 1NHVA 1U09A 1R6VA 5KFVA 3B8HA 2DHSA 4PQAA 3M30A 3L9ZA 3W2VA 4CT8A 2YKAA 3H20A 3UE2A 1EETA 2RU3A 3LP2A 3PV8A 2E7WA 1RT6B 3QO9B 3A3NB 3CJTA 2HBRB 5CH7B 3QWUA 3JTNA 2KDOA 5L9XA 4CO3A 5BR8F 2BBEA 1RK8A 4FYXB 5T41A 4DR7F 1RWNB 2B7BB 3DRPB 4RU2A 3K8VA 3SSSA 1S6QB 2HFVA 1P8GA 3KWMA 2CQPA 2EKYA 2VDIA 3C15A 5IZHA 1U6ZA 1WF2A 2DGVA 4I6WA 4B02A 1XEZA 4IFVA 3F56A 2HNYB 2GIFA 3GCXP 4NE9C 1RT3B 2MY8A 3HO1A 2K8GA 3HZEA 2VBXA 4URGA 2XY6A 2ACMA 3D6HB 3THTA 2XZDB 3M8SA 3T5JA 1NZAA 4YB5A 1M5HA 3MMCB 4ZCMA 2CPYA 2HWIA 2K3IA 1S12A 4NCBA 3P96A 4HDGA 3HP6A 3DGPB 1QVGR 4PUOB 1M5KC 2PO4A 3BQ1A 4RUBA 1Q79A 3G6ES 2JLGA 4USTA 2MKYA 2QYCA 2MZJA 1Y9OA 5C42B 1VIOA 2JLFA 2F9DA 4DG1A 3J81Y 1BHNA 4WXWA 3CCRS 2C28A 2HHVA 5AE3A 1TKZB 3BKTA 1R89A 4WU2A 6FD1A 2W8KA 2R8IA 2ADBA 2HAIA 3SZ2A 2XULA 5F8MA 4C0HA 2NPIA 5GAGI 5FLXU 2DNRA 1N0UA 2NLWA 1VRUA 1YRUA 4DL2A 2WBMA 3T5KA 1MNEA 3CB4A 3RRKA 4RLEA 4NXMJ 1U2FA 1UA0A 1VLOA 3MTJA 1VK8A 1RU2A 2B0GA 3DLKA 3RYLA 3R5JB 4OZ2A 3JSYA 1HNWJ 3PX0A 4ILMA 1W7WA 4N47A 3DMJB 1AB8A 3NGTA 4LFCJ 3GIIA 4YR0A 3LP1A 1RKIA 1X4CA 1DLOB 3OL7A 5GAGU 1CC7A 3TUPA 1U1RA 3KLIB 3H8YA 3W2WB 3TZWA 4USKA 3UNYA 3R1HA 3W8GA 3NS5A 4NA2A 4KB7A 5HBMA 3BQ0A 3ISND 1RAHB 1KTQA 2FHOB 1V3ZA 2XCAA 4X4OA 1YX2A 5KFDA 1IJEB 2ZH2A 2W4PA 3VAGA 4L73A 1HBMA 1IKXB 1GTHA 3P6YC 1AUSL 2M0GB 3C6TB 3NBPB 4M5HA 3W9HA 3P3DA 4DSEA 3MMBB 4Y65A 4LRCA 2FDNA 3N5FA 4ICLB 1SJFA 4LBHA 1LWEA 2FUG9 4FXWA 4ED1A 3PR5B 2I6WA 3SFUA 4C11A 3FUYA 1FWPA 1TL3A 2J7UA 5KG4A 2BM0A 1NKEA 5C2CA 1IKVA 5LL6d 3OFGA 1RCXB 2F63A 1WC4A 4OX6A 3AA9A 3VWSA 5E0OA 3W61A 1WC0A 1DTQB 2MB0B 4WP3A 3QYYA 1S1UB 1V3SA 1S1WB 1U48A 3MCNA 1RBOB 3R6GB 2NR0A 4QIWD 2QN6B 1RWPB 2RUSA 5JMNA 1EQ0A 1VHFA 3W65A 1SUQB 3KDOA 4O23A 3G9CA 5B08A 4EGLA 1R7IA 1KN6A 4NXMF 1P1TA 1FRLA 3EVOA 1TKXA 3NCRA 2HVEA 3CPWR 5HJYA 1S1VB 4K4UA 3CCLS 2PMZD 2XO7A 1LV5A 1HNWF 1UW9A 4UY8T 4ETXA 3TA1A 4FYWB 4ED4A 1IJFB 5AT1B 1TR0A 2MGZB 2Y1IA 4LFCF 1NB7A 1X4BA 2JEFA 1PBUA 5ETNA 3KK1B 3NGUA 4Z7CA 5EGYA 3OL9A 3K5NA 5LSLA 4NRUA 2WONB 2YKNB 1HQUA 4ZPAA 2N3LA 2YNHB 5KFOA 3RBDA 2IJNA 2GJFA 4HYKA 2KHCA 2FVQA 2I5JA 3NG8A 3TA0A 3H98A 1FKOA 4EBDA 3R3TA 4A46A 1TL5A 2EW9A 3RJMB 2NQPA 1N5TA 1Y4ZB 5L39A 2M88A 4AE5A 3I82A 2CQDA 5HROB 3PYEA 5GMEA 1HQEB 4FPIA 3MM8A 2FTRA 3P8BB 1T9VA 2W4DA 2CPDA 4N41A 4QYZJ 1E6YA 3AA8A 3CXCR 5K9FA 2XNRA 2FPHX 1H3DA 1PYOB 1IQZA 1RHRB 2ZD1A 1RWOB 4CQ1A 2DHAA 1RU1A 3JSBA 1M5PC 2U2FA 3ADAC 1VQNS 5D3GA 3CJRA 3Q8RB 1S0OA 3M2VA 4P9SA 2HBZB 3RTVA 1UPPA 3WC2A 4H4KC 1X31C 1NDPA 4BHQA 3QT5A 1U1KA 4C7QA 4ZLNA 2PC6A 4ZPVR 3F73A 2DB1A 4LIWA 4AL5A 3DLBA 2CDRB 4I67A 4N76A 1WD6A 2VKRA 3RU0A 5E2QA 1WSRA 4YB1P 1YJRA 1B70B 2BM1A 3M8YA 4MKBA 4F7VA 1IVZA 1NBEB 1QAYA 3TQ1A 3IGVA 5LOQA 4ECTA 3PM9A 4KIAA 2QIFA 2HQGA 5BYQA 1S1XB 2GVDA 3ONQA 3SI8A 2BJ7A 3GYNA 4D3HA 1UMJA 2MQLA 4F36A 2YXLA 2MXYA 1PILA 3MM7B 4OI2A 2BV3A 4RU9A 1JLGA 3ENAA 4PCQA 3UDLA 1WF1A 4UOFA 3J7AN 5L46A 3GG1A 1S57A 2KM8B 4FF2A 1DHMA 3OV7A 4WE1B 4IG0B 5AXLA 1LW0B 2W2PP 1ZAVA 3LGNA 1ZAWA 2AEMA 4NMLA 9ATCB 1C0UA 2H9ZA 3B6BA 2OPSB 1F1BB 3IG1B 5M2PA 3KLEB 4TU7A 2XYPB 3M32B 3GONA 4IOAQ 1C0TA 4USUA 2L9WA 1FX4A 3GIJA 2YQ1A 1TK0A 1NSQA 1GX6A 5CYMB 3DC2A 2OP5A 2B4VA 1WEZA 2FLPA 2B9WA 1BXNA 2IFXA 4AT1B 2UU9J 5M2RA 2ILYA 2R7QA 1WI6A 1FERA 2HVDA 1VC6A 1CLFA 3F41A 2VBYA 3OHAA 2NUHA 2HQDA 2AJ1A 1YJ7A 4DR1J 1KLMB 2DRAA 3M1VB 2XEXA 1DARA 4F26A 2PGCA 1NMEB 3T5HA 2AYMA 4PAAA 4K0KJ 2FZGB 1D0EA 3KXDA 2ZH4A 1XNRJ 3MURP 3SCKE 1VQYA 2J9EA 2ZE2A 5K8MA 4UUWA 1Q8IA 3HHLA 3MM5A 4HHJA 5DDOC 3ETOA 3LGMA 1VQ4S 2VPYB 2HS0A 1M5VC 1VMBA 2EC2A 3NEKA 5F0UA 5KAKA 3HJVA 1S97A 2V63A 1DTTA 5BJRA 3HULA 3EWGA 3V6DB 1NK8A 1IN0A 2VC0A 4YMEA 1HI0P 3BJYA 4WTYA 2GAGC 2JVOA 2KJVA 4UY85 2H65B 1MLAA 2WOMA 2ZH8A 1N48A 1U02A 2ZBPA 5J1PA 1S1TA 1RT7B 1RLDA 3BPSP 4F3MA 2KRRA 5F8LA 1S6PB 4OYPA 4DI6A 2A0FB 3Q8QB 3UVJA 4O44A 1VC5A 1NSKL 3TVYA 3D54A 2GQ2A 3AJDA 1LXJA 3KK2B 4NZ7A 1D9DA 3TRGA 3K57A 3F44A 2R7UA 4ES2A 2ASLA 5HL7Q 4WFAQ 1T8EA 1UVIA 3A13A 2CADA 1RLCL 3HHDA 3M8PB 3MPWA 2UU9F 3SQGA 4TU9A 4QPXA 1NPRA 2ZBCA 5F8NA 1EQMA 3HFZB 3GLJA 2W8LA 3RB4A 4N8NA 3ZO7A 4IRKA 1CJKB 1RTZA 3CCUS 1R6YA 2WZ1A 4FKXA 2UXBJ 1H73A 2VQEJ 4DR1F 3ZZTA 4NRTA 2FC8A 1OY9A 3Q86A 4DR5J 4QU7A 4DL5A 2DR9A 4IFYA 1U4BA 4F4WA 3IRXA 4K0KF 3CMAS 4ZCIA 3G6XA 3M8QB 5HVGA 1WC1A 1XNRF 3ISNC 3V4IA 3HT3A 4KGKA 4ZP6A 4MK9A 1VBKA 2K7JA 4LVNP 2EFPA 1NK6A 2CPXA 2WSEC 2ASJA 2IRYA 3GSIA 4KE5A 3FGVA 3HCXA 3C14B 4X4RA 2EG2A 1P9QC 3W9IA 3JQMA 1HL6A 2MKSA 2XWXA 3FBEA 2DH9A 2Z56B 3LP0A 2RF2A 3BV8A 2A2CA 3TX8A 4X4QA 4BCAA 1UA1A 3VAHA 1UVJA 1JIHA 2H4WB 3ULHA 4LF8J 1TAUA 2YWWA 3DCAA 1RGVA 2J0XA 2MJUA 3OR2B 4I64A 5I3UB 1YJTA 2G0JA 2DY9A 3UD3P 4M5GA 3QZ7A 5C7PA 1R43A 4QZVB 4DV3J 3H2VE 5A0YA 3CC2S 1F0XA 4C8MA 3C8YA 2HPUA 4M5DA 2CQHA 2PIIA 1RDRA 4EYIB 4PG7A 2POKA 3ZZRA 4O0IA 1JWWA 1WC3A 5KFGA 2CPHA 3BZQA 5KFMA 1HWKA 3CD7A 3UN3A 2ZJPQ 4ECRA 3FC9A 2AYGA 2ZOMA 2KTQA 3N28A 1QLNA 2UXBF 2VQEF 3QRPA 5CA5A 1V6HA 4JV0A 3MM9A 4DR5F 3O44A 4F3QA 4WIIA 4DPYA 2DNMA 1Y5LB 5K8PA 4DV2J 5B0CA 4JYAJ 2W7PA 4P72A 2JWNA 4B9MA 1XJWB 1A0OB 3PX6A 3PYGA 1DBDA 2HBQB 4P73A 3UDEA 2KKHA 3HSGA 3ZZPA 2O67A 3LO3A 2Z2LA 3DKDA 1FT8A 3J7Z5 4FN5A 4K2XA 4HT5A 4LSLA 3G96A 2V4JB 3GIKA 2HIQA 3DOMA 1D3WA 2VG7A 3BSOA 2CAJA 4Y0FA 2AP6A 1NJWA 1HWLA 3KK3A 3MEDB 1NXIA 2YWFA 4CLYA 3UNGC 4UQGA 4LFBJ 2OFHX 4L3NA 2QL9B 4X4NA 4FYDA 2Q3PA 4LF8F 3C19A 4CLWA 2BEFA 2DXDA 4ZP9A 1HWUA 5HLFB 1VBYA 1RT1B 2CPFA 3CW2C 2Y1LB 4QBUA 4DPXA 2DEIA 4U8YA 3CJ8A 4C3LA 1GXUA 2R8GA 3UDCA 2VBZA 5DDQC 3BBCA 2PI5A 3H90A 2K1RA 1O5JA 2B7CB 2QC3A 4DV3F 5KT4A 2WW8A 3VQSA 1S9EB 4Y34A 4K5SA 3QMQA 1TUWA 4P2XA 3H4DA 3QAEA 8ATCB 4MIWA 2MDAA 2DIVA 2FLOA 3SMZA 2HHUA 2C22A 2R7WA 1OIAA 4ZITA 3HHNB 3CCES 1YJWS 4DSLA 3DLEB 4WTOB 4CH7A 2VPXB 4OJ3A 2R3VA 4CLSA 3SBMA 3I0RB 4TYAA 1T03B 1TZ0A 8AT1B 4DPTA 1B64A 2Y1JA 1JLEB 5J2MB 2CZ9A 2I8EA 5IT9Y 1JKHA 1RTHA 2VODA 4DV2F 1Y11A 1PG5B 3H4BA 3DM2B 4JYAF 3Q8PB 2OPRB 1XR7A 3J7YI 1HPZB 4OI0A 1FESA 4NLXA 1XN9A 4CLPA 2ZBQA 3IR5B 1HNIA 1N5QA 1Q86T 3PW4A 2KVQE 2ZZNA 4F4ZA 3OQ2A 3DI6B 2Q43A 5DS7A 3TUZC 3TNVA 3PRVA 3OLAA 2BJ9A 2H1YA 2Y1RI 3ET6A 2FJAB 2HFZA 3CMES 4CLLA 3MD3A 5D0EA 4IG3A 1KQKA 1RACB 3K5MA 4LFBF 3UI3A 3J7YU 4AFFA 1RWMB 5EHHA 1L3SA 4WFXA 4M1KA 5ETSA 3QBCA 5LMUJ 2JNJA 3QFHA 3DLGA 2C1EB 1VRTB 4USHA 3D1OA 2JDJA 2KH9A 5G0RB 3MUTP 4DBQA 5J2NB 2MLZA 1TL1B 5DLGA 4IKAA 4X84A 1MG7A 2V8DA 5F8HA 3PIOQ 1TV6A 3CD5A 3K7RA 3G71S 1N5YA 3BEGB 4UOGA 5LXYA 3AD9C 4F0MA 1JLBB 3BKUA 4I56A 1NO8A 5KG0A 5HVHA 2VFTA 3CCWA 1Q81T 2EFOA 2IC3B 2BKPA 4HACA 1BMQB 1HHSA 3O8WA 3OVBA 2XWYA 3LALA 4QJVA 3HHKA 4M94A 3DRXA 1S77D 1ZM4A 5LSOA 2LLZA 3T6JA 1RBAA 4UOCA 2Z58B 4NYPA 2AZ3A 2OELA 3M8RA 4RNHA 4B17A 2D3OR 5D4PA 3BGUA 4A47A 4DPWA 3QSYB 2IAJB 3C16A 2DNHA 3CMQA 5EDWA 3UD4P 4ZJLA 4MT1A 4ZVRB 2J6SA 2DNPA 2M8HA 1D8YA 1Q1KA 4DX6A 2OPPA 2DYAA 3MFHA 2IRXA 2DGTA 2R7RA 1UETA 3PXGa 1WC6A 3WBZA 3V81B 4X2BA 2FHJD 2ROEA 3VR1A 1FX2A 1M90T 3OTCA 4TY9A 4ANDA 2GW8A 1S0NA 2J8AA 4FYYB 3R7NB 5GMDA 1P6TA 3GR1A 1VC0A 2QFJA 1TKTA 3QLHA 5MLCV 1C2PA 3R5AA 1QAJA 3JSRA 4DZ6A 5LMUF 4I1TA 1HNZJ 1SH0A 4X62J 4RW4B 4USMA 1RAJA 2Z4PA 3PJWA 3MECA 5DJBA 3GE9A 1MROA 1RT5A 1EP4B 3L95X 3MMAB 4ZVFA 4CTAA 1OYEA 1FFWB 2GAHC 5JUMA 3EGZA 2DJWA 3ZTQA 4F3OA 2C2MB 5F8GA 1Y0HA 1ZPWX 1WHWA 1YQHA 2FVSA 2LA6A 3P5BP 4F25A 3NP5A 1Q8KA 1S48A 1FFGB 2FYXA 3EXYA 3U1NA 1HYSB 3JYTB 3AD7C 2QGFB 5AXNA 4P7TA 3SV3A 1X4HA 3KJVB 4KFBB 4EUVA 4R8UB 3GTYX 2VJUA 4ELVA 2BRLA 4WIQA 2VJVA 3T1HJ 3UD5A 3UWTA 2E1RA 2J76E 2BMBA 4CRJA 2VU5A 4ZLPA 4K5RA 2KRBA 1RTDB 2XC9A 3ZNJ1 3W64A 3NAHA 1IUJA 4KKOA 2A2DA 4MJKA 3DDKA 3CJ0A 2I9SA 4GRSA 2FHMA 1JXEA 3MM6A 3DRRA 5T7LA 2ZZTA 3W5ZA 4K4WA 4UW2A 5EWGA 4GVBB 2CJXB 4AQYJ 3C6UA 1IM4A 4OX8A 2LXFA 2V8VA 4R5PB 4Q7AA 2H4YB 2N7CA 2ZHBA 3UN2A 1RHQB 4YUDA 3IBWA 3E3XA 4PWWA 2XM3A 1KFSA 2XMUA 2D3UA 4K4XA 3O6QA 4DSFA 1RYSA 4HVZA 4IO1A 2MQMA 3POTB 2VH7A 1JLAB 1HNZF 3I5BA 3BGFA 5FJ4A 1Q4RA 4X62F 4PPZA 2F65A 4ZHRB 4I7FB 3M9OB 3SIPB 4PG5A 2YNIB 2VA3A 4Y2KA 5J1NA 5KOXA 3HHEA 3IM9A 2EWHA 1V9OA 3BBFA 2YWHA 1SL1A 4ATNA 3PW2A 1REVA 2ILZA 4OMFG 2X1FA 2KJWA 1L3KA 4X4PA 2B6AB 3AQOA 2RILA 4AYBD 3TVKA 4O3OA 4FF4A 1VQSA 5K8NA 1RWVB 4DHVA 3FMWA 1BQMA 4UZCA 4N5SA 3EYZA 2V69A 5A6PA 4DOZA 3A3OB 4DCJB 2E1PA 1CJUB 1JXLA 3CF5Q 3Q8UA 2CQ2A 3PHEA 2R9LA 2ZHAA 2G0CA 4ID8A 1T0TV 3T1HF 1BY9A 3AY0A 1N88A 3H59A 5H9FJ 5FDLB 2MTLA 9RUBA 2LXUA 5LMNJ 4OYMA 4JI3J 1WKKA 5IT0A 5AXKA 2ZFHA 4ZK7M 3BO4A 4NI2A 1R0BG 5EX3A 4NZ0A 2JH3A 1FNOA 3PVXA 4IUFA 2E1MC 3DRPA 2HURA 2HK3A 1WACA 2J6UA 3HF5A 4AQYF 2ZH1A 1G7CB 1CJVB 4CLZA 4DU7A 2D69A 2HNYA 2XMWA 1ZYQA 2GGPB 3ZZUA 2AW0A 3EPGA 2CNKB 3G4SS 4RW9A 5J1EB 3GB0A 3UCZP 4J9OA 3A8KA 1SV5B 5CYQB 3D4JA 4ZDNA 3UPFA 3HVTB 3DGPA 2ZWPA 4JI4J 4PUOA 3VAKA 1PJ7A 4NLSA 1NJZA 1KTVA 1ELOA 3SXLA 3BH7B 5FD1A 1OMSA 3NGDA 1RSCA 1WC5A 1KDNA 2MPUA 2CQCA 2HQCA 2LEAA 2LDIA 1VQ8S 2CVIA 2XYGB 2H5JB 1LK5A 3K8WA 4NLDA 3FDSA 3CO0P 4CLUA 2C3YA 3JXOA 3RUBL 1TKZA 1LWFB 4RX6A 1URNA 1NDKA 3BKFA 1U1PA 2E5LJ 1R8PA 1AXQA 3TW0A 2R7VA 3ENWA 4RW7A 1RT2A 1S59A 4DSKA 5KG6A 1FXDA 1OPZA 3IWLA 5HSPA 1RAAB 2AYEA 1KHVA 1PSDA 5D0GA 1GH8A 1QDUB 2LDYA 2RKIB 4MH8A 5LMNF 4JI3F 4OHYA 1RISA 4PG6A 1LW2B 1WKLA 3EGNA 3IC1A 2IJRA 3DLJA 2OPQB 1QJHA 1WHXA 3CC7S 2V8GA 3DMJA 1YVFA 1UVMA 2ZC3A 4KTQA 5KG7A 4YEAA 2JC1A 4HI2A 2B51A 1FRHA 3WC0A 4KV8B 1DLOA 2W25A 3QT7A 2BE7D 2M8DB 1ZTWA 3TANA 3KLIA 3W2WA 1AYEA 1FKPB 3EVMA 3D1HA 1YTYA 3KG0A 2HW3A 1R0AB 1FF2A 2PFDA 3LW5C 1OY8A 2J0SD 4JBCA 4JI7J 1Y7PA 2AJ4A 5E5NA 4NOHA 6AT1B 3DGVA 1IKXA 1NDLA 3C6TA 2B4PA 2BOAA 1K1SA 1Q8LA 1VQLS 4X65J 4F0HA 1S6UA 3NBPA 4O0NA 4KQZA 4JI4F 2HFOA 1FJ7A 1DY3A 3RW7A 1S0MA 3G86A 2IVYA 1BLUA 2XSJB 3GU0A 2NYHA 4ICLA 2X1BA 1PBAA 2MHEA 2UUAJ 1YBUA 1DJ0A 3MEGB 5I42B 3OD2A 1U6FA 2YWEA 3P45B 4F50A 3KHHA 5IFMA 4DV6J 3THPA 4C8LA 4B3RJ 4BDPA 2CPIA 3D0GE 4ZP8A 3PJXA 1TKDA 2Y0SD 4NMXA 2KI2A 5THWA 1SJ4P 3PNIA 5EWFA 1TMMA 1KNZA 3QZ8A 1DTQA 1F2GA 1S1UA 2E5LF 1X5TA 1CSJA 1YBTA 2WAQD 2R42A 3OW2R 4WP8A 3H5XA 2FQQB 1N52B 2VG5B 1SUQA 4DV0J 3LWLA 4ECUA 1RABB 4ANEA 3PW7A 4DQIA 1TFWA 1AROP 2AEJA 2BW2A 1SQGA 4XAKA 2KFYA 3R5CA 3RRHA 3NNAA 1TUGB 2YNFB 2YKQA 4RR5A 2HS3A 2IVFB 1RI7A 1S1VA 5A8KB 2OLWA 2WB4A 3CVKA 4F0KA 3U7JA 1R8BA 2E9ZA 3UQSA 4V19J 3ETMA 2MGZA 4M8LA 4GC7A 4I2QB 2ZOGA 2UZAA 3CIZA 3BH6B 3S01A 3ZTOA 3JSMA 3KMSA 4AXJA 4KJIA 4BC7A 3KK1A 1FJCA 3TYTA 2WONA 4IOCQ 2YKNA 2V2QA 1XIQA 2BACA 2HRYA 1T94A 1EETB 3OHBA 2Q66A 5HQ8A 3Q23A 4JI7F 2FC9A 1B7FA 4JP8A 3B78A 1H7XA 4WU3A 4LUBA 4X65F 5GAHU 3DOKB 4OYZA 3S1TA 1EARA 1G2EA 1C4AA 2XI2A 4F8RA 5KT6A 4P74A 1T02A 3N6LA 5G4DA 3BDPA 3O5TB 2Z2ZA 2UUAF 1AFJA 6FDRA 4DV6F 4TVAB 3DRSB 4B3RF 2CNLB 2V2VA 2KT5A 3VTIA 4DX7A 4S0MA 2V9KA 2JEGA 3IR6B 1CC8A 1U0HA 5D4NA 4MIAA 1LOUA 5CD4H 1WJ9A 3AJ1A 1LNQA 1U8WA 4DLGA 3RB0A 1T95A 4DV0F 1WG5A 2HNDA 4F4KA 3D5MA 1S6OA 3H2LA 3ILLA 4NLWA 5ETTA 3DLLQ 4W90B 1KQGB 3CDAA 2JEJA 3GV8B 3WHIA 4F67A 4DSJA 4LR9A 2OGUA 3R5GA 4OI3A 3N6NA 2R8JA 5KT2A 4WFYA 3OUYB 1SCJB 1X0FA 4CT9A 2QMUB 4ZVGA 2C2RA 3NL0A 3CIMA 2PMWA 2DISA 4YR2A 2V8HA 3PEHA 1PKUA 2LQ5A 4JI6J 2AU0A 1ZH5A 3I5AA 4U8VA 3KJQB 1R31A 1YJVA 4WE1A 4IG0A 4O4GB 2WRMA 4M5NA 2Z2MA 4L3KA 1MU2B 1IR1A 2OPSA 4PYAA 2BJ1A 3KLEA 4KGXB 3UFCX 3M32A 2G2YA 4PR6A 5RUBA 3CEDA 1ZOTA 4PXDA 1NSAA 1U1QA 2B4OA 5KG3A 3W8PA 3TJ8A 3NCPA 3MEEB 4EZ9A 5CYMA 3GIRA 2V8PA 5SZTA 3OTOJ 1EB0A 2EC0A 1FO1A 2NS1B 4LSZB 3MPVA 3PJ9A 2BJ8A 2VA2A 3M4XA 4X4UA 1HD1A 5DGBA 2BR0A 1HD0A 1WWHA 4C98A 2BJEA 5B0GA 5HAOA 2ZH3A 1ZPVA 3I55S 4LSNA 3M2RB 2RRBA 3N79A 2CQGA 3ISZA 1T3NA 1Z2ZA 3M1VA 2BQ3A 1J5OB 4IO9Q 2HQIA 3Q8VA 2KG1A 1G1XA 3E51A 4PXBA 3FFIB 3UN5A 3BO2A 5CCMA 3KLHA 1R3NA 2R7XA 4B3MJ 5IQQA 1R8CA 3DHXA 4B9LA 2Y8WA 4HTIA 1IKVB 1X4GA 2WVDA 3NRBA 4FVCA 3TP2A 5JJBA 3GG0A 2IM1A 1WEXA 4KPCA 3V6DA 4KC5A 4FBUA 4Y6IA 1UTAA 4FVMA 1NJYA 2EFVA 4G6VB 4LQ3A 1VI7A 3K5PA 1FKAF 3LF0A 2Z8QA 3M8ZA 1U24A 4DU8A 1NB2A 3GV5B 5L1LA 4JI6F 5DG7A 2HBYB 3SDEB 1VQ9S 1RT7A 2VF3A 2RDIA 2X1GA 3MUVP 4K4YA 1RAFB 1RAGB 2W7AA 4GVLA 1G3OA 4FF3A 3RZAA 2A10A 2EXUA 1S6PA 2B56A 1U2CA 3KHGA 3OFEA 1FDNA 4DEZA 1N8RT 4IRCA 3KK2A 3GJTB 2XMVA 1XQIA 1S7HA 2WVCA 3MPYA 1PAUB 2BA9A 1B0TA 1SJQA 2V5HG 2V6AA 1HQUB 4U95A 3OTOF 2D3O1 4ZIWA 2OD6A 5LXRA 3M8PA 3K0JA 2MKIA 1QSLA 3X3UA 1F9EB 1H0HB 2C2KB 3OXLA 5DLFA 2I5JB 3P49B 5KFEA 1DAXA 1AW0A 4OI4A 2KM8C 2NXUA 1CJKA 3JQJA 3KHRA 2QA1A 2YWGA 2R2TA 2ZC4A 3D67A 4RBUA 3GWCA 4PG4A 4CO1A 5HMYA 2Q6CA 2WSFC 4ZCKA 1KVIA 4V19X 3FZBA 2DR5A 1F5BA 4ZVPB 3M8QA 2VV5A 3B54A 2W9CB 5DDPC 3EE3A 1SKWA 4B3MF 4P6QA 4DL7A 3N6MA 4OYBA 2BVZA 1SC4B 3MAHA 4K4VA 5L1KA 4Q44A 2VICA 3FBBA 2VASA 5C25B 1D9AA 3C14A 2CNNB 1FRKA 1WHVA 4QWAA 2JX2A 3EICA 4ED2A 1S7IA 2VPZB 3QGHA 2DEJA 4C0BA 2VZ9A 3ZZOA 2CQIA 2FGCA 3BPDA 3I6PA 1NUEA 2V0NA 3AHPA 4MTPA 2OKQA 2LP4A 2CKWA 1IQTA 4BC9A 2W01A 3MMJA 3WQPA 3WX8A 3OR2A 3CCZA 3HK2A 3BGRB 3RR7A 4DR4J 4DQSA 3IAS9 3Q89A 1S99A 4N56A 4AUKA 1IWGA 2BX6A 3PRBA 3TEHB 1JLGB 3J7A1 3JTPA 2BANB 2C3UA 1ZTTA 2MZTA 5KFYA 4F02A 1GMVA 4EWTA 2VOOA 2RRNA 5BYRA 3L4BC 2F8HA 2XGQA 3HKZD 2R4FA 3IM8A 4I69A 2LEBA 4CNYA 1NPPA 2ZUGA 1P27B 3AXMA 4J9VA 2XMKA 1SVDA 1SKRA 2C3OA 2CJYB 2QX0A 4ZIVA 2HHXA 2E5IA 1J5EJ 3JQKA 2JEIA 3W63A 4CIOA 4KO0B 3MCOA 3VZIA 2MZSA 3ITHB 1YI2S 2KXFA 1I1GA 2X1AA 3OXFA 2QZ8A 2JSXA 5E3QA 4RL1A 2DH7A 3QGGA 1JJ4A 2VFUA 1F5CA 1TL7B 2EBGA 2J6TA 3H0PA 1WI8A 2RQMA 3PACA 1NRKA 3BB5A 3PYDA 3KG4A 1ICEB 5H9EK 1FVQA 2UXDJ 2B8PA 2W2MP 2YPZA 3LWMA 3CT9A 3HPOA 1DURA 3MEDA 1TVRB 1EIYB 2KZMA 2BKOA 3I9V9 1NJXA 1EX8A 1U8SA 2B43A 5F41A 2V4RA 3HHLB 3L09A 1ZA1B 4WXOA 2L3MA 4X66J 1H98A 1X8DA 1KLNA 1RT1A 4OLPA 5LJ3Y 3THVA 3FVYA 4ECXA 1PC5A 1LWCB 4DR4F 3I31A 4USVA 2M7SA 2ZKTA 1S9EA 4LF4J 1HMVA 2XB2D 1HNVB 3GFXA 4ZMMA 2ACYA 2B9YA 2OMLA 1H2TZ 1ACMB 3UR0A 2VG6A 1NK7A 1RB0A 2CZVC 4R25A 3IRWP 2XMTA 4W98A 3I0RA 1T03A 1HBNB 4NASA 1J5EF 1JLEA 1NDCA 5J2MA 3GILA 4J9NA 2IM3A 2LMIA 2VFRA 5H9EJ 3DM2A 3G2XA 2AJ2A 3J80U 5CHCB 3UCGA 2OPRA 2J9CA 2UUBJ 2W1BA 1HPZA 1O51A 1F9HA 2E1CA 5AE1A 2XQCA 2ABYA 3Q2TC 5BXIA 5A2QU 1Q5VA 4U7UD 2NXCA 1QUPA 3WIVA 2XLJA 3DRYA 4YOEA 2A1BA 2ATCB 3BM7A 4J9PA 3KDNA 3FK4A 2BYCA 3EX7B 3DI6A 2HFUA 2C2DA 4B9VA 4ECSA 3MPUB 3IFEA 3HSDA 4F4YA 3GQCA 2UXDF 3MUMP 4TY8B 3DDIA 2O66A 3FQLA 1TK5A 4DUYJ 3QRRA 1AA1B 2KN4A 4KGVB 2MSSA 3KFWX 2MKKA 3AB4B 1NKBA 3GMGA 1JLQB 4LMZA 1VRQC 5IM0B 5E7OB 1VRTA 3ENVA 4IDKB 4NLPA 3AFGA 3LAMA 4ZOSA 1VR6A 4CZCA 4TN2A 4X66F 2COLA 4H4KA 5G0RA 3DXBA 5J2NA 1KONA 4JB8B 1YK9A 1UCNA 1U49A 5B0EA 3HM9A 4FYVB 2V68A 4LF4F 1SC6A 4A8OA 1HQ2A 1JLBA 1H38A 2X3GA 2HZVA 1YJ9S 2YX7A 4OJ1A 4RBTA 3SFGA 2W4CA 4LQ9A 4J9LA 1UJ5A 2IYIA 4F2SA 5IOLA 4ZJOA 2RE1A 3QJPA 2IC3A 1JB0C 1XBWA 4HL9A 2KG0A 2AQ4A 2MY7A 1PJ5A 4ZN3A 4ZPCA 5CXTA 4NLTA 1SJ1A 1L3VA 3CCQS 4DFJA 1WG1A 2RH3A 3L7PA 4QYZK 2MLYA 4FBTA 1XWLA 2CWKA 4AL6A 3PO5A 2UUBF 3PY8A 4ILLA 2K3KA 4IH5A 2GQCA 2CQ1A 3PFEA 4DQRA 4M5DB 2RJZA 5LM7E 4EEYA 4PPDA 2BE9B 2BQUA 3OL6A 4ILRA 3KYLA 2ZJQQ 1K47A 4XPCA 1VOMA 2DPIA 1H2VZ 2M70A 3V81A 4WKRA 1YZ6A 2HSEB 3DYAB 1I51B 3TO8A 1IXKA 5T14A 4MYUA 4V1Ak 4DUYF 1HHQA 4IR9A 4A8XA 2JFDA 4QW8A 1PIEA 2QV6A 4DMZA 4MFBB 2DY1A 4HTJA 1CEZA 3EDRB 4MK8A 1SBRA 4RW4A 3C46A 2D1CA 1S5ZA 2RVJA 4B9SA 2VD3A 3GFHA 3UW1A 2RS2A 2BDPA 2DGSA 1EP4A 4G65A 3MMAA 2FHKA 4LSLB 1GXTA 3CJKB 5MAOA 5B7WA 2KZZA 4OHVA 1IBKJ 1FNMA 3L7OA 4OZ1A 2RMLA 3HKWA 3IS9A 2OO4A 4DN0A 1J2VA 3PEJA 4CO4A 2VHGA 4MKYA 1FVSA 2D9OA 1HYSA 3JYTA 4AXIA 2Z0GA 1RP5A 1UL3A 3M9MB 3EZOA 2L08A 5IC4B 3AAWB 4CWBA 3D0HE 3DXSX 1B3TA 3KJVA 2L9DA 3NY0A 5B09A 4KFBA 2VQFJ 1MWYA 3AOCA 4R8UA 3MOJB 2PD1A 3OL8A 4J37A 3HFVA 1U0SA 1IBLJ 2WW4A 3R2DJ 3RBEA 4HH1A 5E33A 1RTDA 1JJCB 1JLFB 1C1CB 4ZVUB 1N33J 3MAAB 3ILIA 4GVBA 1AZSB 3Q2SC 4R5PA 5KFRA 3CJSA 3I32A 2LQBA 5KFAA 1BC6A 3R9LA 1GFWB 3WZ0A 3OLBA 2NZ4A 4IYQA 1QD1A 2GJIA 2F8EX 2QE5A 4LRAA 3CJ3A 5A6WA 2H51B 1RADB 4U6PA 3POTA 1VDHA 1JLAA 4IH6A 2ADCA
chains in the Genus database with same CATH topology
1E6VB 4ZHRA 2CQ2A 4I7FA 4IFVA 4DG1B 2ROPA 3PHEA 1SB6A 3F56A 2HS4A 2P5VA 2R9LA 2ZHAA 2HNYB 1FXLA 2G0CA 5DRKA 1RT3B 2MY8A 3GZ7A 2LU1A 2E7XA 3HO1A 4ID8A 2XBPA 3CJ2A 2K8GA 3T1HF 1BY9A 3HZEA 3AY0A 4DF4A 2VG6B 4JV5F 1N88A 2VBXA 1WNEA 3H59A 2XS7A 1ZM2A 1QM9A 5H9FJ 4URGA 4BS2A 5FDLB 2XY6A 4NA1A 3THTA 2QMXA 3M8SA 3T5JA 2LXUA 1NZAA 2MKJA 2IM2A 3MR5A 2XS5A 4YB5A 1M5HA 3MMCB 1IBKF 4K50A 4ZCMA 2CPYA 5IT0A 2HWIA 2K3IA 1S1XA 5AXKA 3PKYA 2V9WA 1W25A 2B6AA 4L6V3 4NCBA 2XMJA 3P96A 4HDGA 3L3CA 4I4BA 3HP6A 3UCUP 1QVGR 3R1LA 2ZFHA 2IBKA 4ZK7M 4PUOB 4I2PB 2EFNA 3BO4A 1M5KC 2PO4A 5EX3A 2YH1A 4G1PA 3MM7A 3BQ1A 5HO4A 1NHUA 2JH3A 4NZ0A 4P2SA 1FNOA 5L1JA 3PVXA 3RB6A 1Q79A 2E1MC 3DRPA 3FSXA 3G6ES 4C8OA 2GMLA 4IUFA 1VRUB 2JLGA 1WACA 1UP1A 2J6UA 2QYCA 3HF5A 5D77A 4NLRA 4OL8A 4IRDA 2MZJA 2XSFA 2PI4A 4AQYF 1F60B 1Y9OA 1QY7A 5C42B 1VIOA 4P7VA 1BWEA 2ZH1A 3O1LA 2JLFA 1G7CB 2GIRA 1RKJA 3W7BA 1UAWA 2K7KA 2F9DA 4X64F 1OQ6A 1YIJS 1E6VA 2JOQA 4DG1A 5ADZA 1LW0A 3J81Y 3DLKB 2VQFF 1VJWA 2HNYA 4H4OA 3BO3A 4DSIA 2XMWA 2W7OA 1ZYQA 4WXWA 1ZM3A 2GGPB 3CCRS 2C28A 5F0WA 3KMQA 2HHVA 3TARA 3ZZUA 5AE3A 3IG1A 2K2PA 2AW0A 1IBLF 2YNGB 3EPGA 3G4SS 1TKZB 4RW9A 5J1EB 4ITSA 5FDLA 3GB0A 3UCZP 4IH7A 3QJLA 2QMWA 1R89A 4J9OA 4WU2A 6FD1A 2N3OA 1SV5B 5CYQB 1VQOS 4IR1A 2W8KA 2R8IA 2ADBA 3HLUA 4ZDNA 3LP1B 2HAIA 4DPOA 1YWXA 2FVCA 4HDHA 3UPFA 3HVTB 4A8KA 4DL3A 3DGPA 2J9DA 3J7ZT 3SZ2A 4K4SA 4PUOA 2XULA 4I2PA 5F8MA 3VAKA 1GT8A 4C0HA 2D9PA 1FK9B 3I87A 5LT5A 2NPIA 5GAGI 3HJFA 4NLSA 1NJZA 1T7PA 2DNRA 1N0UA 2NLWA 2FJWA 1VRUA 5HMWA 4I6YA 1TFYA 1YRUA 4DL2A 1KTVA 1ELOA 3SXLA 5HBMB 2WBMA 4LIRA 1S9GB 5FD1A 1X4FA 1N33F 1Z2LA 2DBBA 3T5KA 1MNEA 3SCIE 2RB7A 2IA0A 3CB4A 3RRKA 3NGDA 3PRDA 4RLEA 1U2FA 3FRYA 4G1IA 1UA0A 2MPUA 2CQCA 5B0AA 1HBMB 2LEAA 1VK8A 2LDIA 2WHOA 3MTJA 4GO5X 5KFSA 2MQPA 2R2RA 1VQ8S 2B0GA 1NKCA 3RAQA 2CQ4A 2CVIA 4HEA9 3EUNA 2EFQA 3DLKA 3RYLA 4DJBA 1LK5A 2MKHA 1NEEA 4QQBA 5L9NA 3JSYA 2GGPA 3K8WA 4NLDA 5F3TA 2FD2A 3S8SA 1KLMA 3FDSA 3PX0A 4ILMA 2ZH6A 1R27B 2C3YA 2YNGA 1A6LA 4N47A 1TKZA 3OTEA 1LWFB 3DMJB 4OLOA 4ETZA 2XGPA 4RX6A 2UVWA 1UJ6A 4C8ZA 1LWEB 1URNA 3GIIA 2XI3A 4YR0A 1SV5A 5CYQA 5AE2A 2WB1D 2FVPA 5KOWA 3D1QA 3LP1A 3BN7A 2XHWA 1RKIA 1X4CA 1DLOB 3HVTA 1HBOA 3BS9A 2QSWA 3N9UC 1R8PA 4NLVA 1RTIB 1AXQA 3OL7A 5GAGU 2DGQA 3TW0A 2R7VA 3ENWA 4RW7A 1CC7A 5KFUA 1U1RA 3KLIB 3H8YA 1FK9A 3W2WB 4FF1A 4C11B 2OFGX 4BWMA 1TL3B 1RT2A 1GAOA 3R1HA 4DSKA 5KG6A 3NS5A 1FRIA 3M6UA 4KB7A 1FXDA 4NA2A 1OPZA 5HBMA 3BQ0A 3ISND 3IWLA 1S9GA 5EUHA 5IQ6A 4JI1F 2IA6A 4YB6A 4YY3F 1KTQA 2OPPB 1O8BA 3PW5A 2AYEA 3DDNA 2FHOB 4YQWA 3RB3A 1V3ZA 3V2UC 2XCAA 1KHVA 1PSDA 4ES1A 1HNXF 4X4OA 1MMDA 2VKZG 1GH8A 2LDYA 5KFDA 1IJEB 2ZH2A 2W4PA 3VAGA 2KO1A 2RKIB 1HBMA 1IKXB 2AF6A 3KLFB 2R2SA 1VQ7S 1XMQF 1GTHA 3P6YC 4MH8A 5LMNF 2M0GB 3C6TB 5E41A 4JI3F 3CCMS 4OHYA 1RISA 1QUVA 2D74B 4PG6A 1LW2B 3V6JA 3FNNA 1ZAXA 3NBPB 3EGNA 5GAEI 3IC1A 3OR1A 2ZH9A 5CYJA 1Y3JA 3DLJA 3HMJG 4C4WA 2OPQB 3P3DA 3UR3C 4DF8A 4DSEA 2HVIA 3FSYA 1QJHA 3MMBB 1WHXA 2Q6BA 4Y65A 1I6JA 1HARA 3CC7S 1LWFA 3MAQA 2V8GA 2DGOA 3DMJA 1FTRA 2FDNA 3N5FA 2KFNA 1YVFA 2N7YA 4ICLB 1SJFA 4CH1A 2ZC3A 1UVMA 3CE8A 1LWEA 4KTQA 5KG7A 4TQSA 1VS3A 4YEAA 4RWWA 2JC1A 4HI2A 4FS2A 2B51A 1FRHA 2FUG9 2YKPA 4FXWA 4RNMA 3WC0A 4ED1A 3PR5B 4IQMA 3VF0B 3PKMA 4KV8B 2UV8A 1DLOA 4YDDB 2W25A 4C3KA 1RTIA 4RBVA 2M8DB 3T5LA 3TANA 1TKXB 3KLIA 2P9CA 1ZTWA 3W2WA 3NMAA 1U6BA 3SFUA 1FKPB 3NGKA 4C11A 1TL3A 4ZCLA 2J7UA 3VAJA 3C3LA 5KG4A 3D1HA 3OSNA 1XMOF 2NSCA 1X5PA 1YTYA 2BM0A 4C8KA 2DNQA 1NKEA 3KG0A 2QEXS 1M5SA 2HW3A 1R0AB 1FF2A 4MIBA 3OJSA 2CPEA 1IKVA 2JRSA 3LW5C 5LL6d 2J0QD 2AYBA 4OJHA 3OFGA 3HX9A 2KHDA 3QGPA 4CCHA 1Z4UA 2J0SD 2CJQA 4U9RA 2I0XA 1BD6A 4OX6A 4JBCA 5KTQA 1Y7PA 3AA9A 2AJ4A 3VWSA 5E5NA 4NOHA 1HHTP 3EGWB 2RKIA 5E0OA 3KLFA 1IKXA 4RUHA 4X4SA 1DTQB 3C6TA 2MB0B 2B4PA 5JVGQ 3QYYA 5GAEU 2V2KA 1LW2A 3H25A 1K1SA 1Q8LA 3CSKA 1BQNB 1VQLS 3SSRA 1S1UB 1V3SA 1S1WB 1U48A 1S6UA 3NBPA 3PFOA 4KQZA 4QWCA 4JI4F 2C3MA 2PT0A 4B3SF 4XPEA 2NR0A 2HFOA 3MHYA 4QIWD 3KLGB 1QSSA 1FJ7A 2OPQA 4NLQA 3RW7A 4QYRA 1YGYA 4O3QA 1S0MA 3G86A 3VQTA 2IVYA 1VHFA 2EPIA 5JXSA 1BLUA 2XSJB 2DGXA 1SUQB 4O23A 4QWEA 4ICLA 3SYZA 1XERA 3G9CA 2N4DA 2X1BA 5B08A 4EGLA 1U45A 2M2BA 4F2RA 2MHEA 4PWDA 1R7IA 1KN6A 4NXMF 5KT3A 3MEGB 1DJ0A 4PG8A 1Q78A 1P1TA 4KV8A 5I42B 1U6FA 4Q8EA 2YWEA 2Q79A 1FRLA 2RRAA 1TKXA 1FKOB 3KHHA 5BYSA 4F50A 2PSZA 2IJFA 3A1YG 3G6YA 1OSDA 5IFMA 3NCRA 1FKPA 1FD2A 3CPWR 2MQQA 1S1VB 4K4UA 3CCLS 3THPA 2PMZD 3H5UA 2XO7A 1LV5A 4C8LA 3CUNA 4BDPA 2V94A 2CPIA 3D0GE 3BSNA 4PQUB 4QCLA 4ZP8A 1R0AA 1HNWF 1X9MA 3PJXA 1VQ6S 3GFYA 4UY8T 4ETXA 1TKDA 2Y0SD 4NCAA 2DNGA 3TA1A 4NL5A 2KI2A 3CCTA 4QPTA 5THWA 1SJ4P 3PNIA 1CQMA 5EWFA 1APSA 3V6KA 1IJFB 1TR0A 1DZ5A 4Q0BB 1ZETA 2MGZB