4K59A

Crystal structure of pseudomonas aeruginosa rsmf
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
AMGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unusual CsrA family member operates in series with RsmA to amplify posttranscriptional responses in Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
molecule keywords RNA BINDING PROTEIN RsmF
total genus 9
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02599 CsrA Global regulator protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k59A00
1Y00A 4K59A 4KRWA 1T3OA 4KJIA
chains in the Genus database with same CATH superfamily
4Q44A 1S6QB 1RKIA 3VF0B 1TK8A 3CEDA 2XS5A 3AOCA 2C3OA 3PFOA 1VLYA 2GC8A 2QLFB 3CJ8A 4GVBA 4KH1B 4ANDA 3CCLS 3L09A 2V8DA 1OPIA 2RJZA 3ITHA 1VQ4S 4NCAA 2QA2A 5GMKa 3KUEA 2OHDA 2WTFA 3OQ2A 3R7SB 3J7ZT 3QJPA 4DL7A 3LP0A 2OMLA 4TNOA 2K1RA 2WONA 2Z56B 4P75A 4B3TF 1VBZA 1NB7A 3GCWP 1KLNA 4RW6B 4IH5A 4F50A 3DNCA 4OX9J 4DX8H 1TFWA 3FSIA 3VGUA 2LQ9A 1CJVB 3NWGA 2MDAA 4OYBA 2ZHBA 3DOKA 1VQ7S 1H72C 1HYSA 2ZITA 2Z2MA 3OT9A 4ERDA 4HEA9 2ZVSA 3KLGA 1BXNA 1R43A 1SQGA 3FNNA 4X62F 1QE1A 3A8IA 3J81Y 2G2YA 3J81j 1OY6A 4EFAC 3FUYA 2MSSA 2LYVA 2J9EA 2YNHA 3N0VA 4IG3B 1J5EF 5M2PA 1QAXA 2AEFA 3W62A 3TZXA 3UPFA 1CQNA 1REGX 3CB4A 1LV5A 3QJLA 1U8WA 3B78A 4HLBA 3SBMA 3ISND 2NXUA 3HFVA 5KG1A 2VG6A 2RDJA 2DNMA 5L8RC 1VQ8S 3EDRB 4DL5A 3C46A 1TL7B 2B8PA 3A1YG 5L9NA 1MN9A 2YH1A 1CJUA 1X4BA 4OX8A 4QR0A 3MMJA 1N48A 2AW0A 3Q83A 4NLUA 3MCSA 4TU8A 3H4BA 1KFSA 5IOLA 3PKMA 3MHYA 2ZUAA 1YZ6A 1ZM4A 1MROB 4P74A 2AZ1A 2YQ0A 1HNIA 4O3PA 4C97A 5ETPA 4EO8A 4J9MA 1NDPA 2HLTA 4LQ9A 4MKBA 3AA8A 4UZBA 2I2YA 2ILYA 3NGTA 3NP5A 2HSEB 2X7IA 2HRUA 4DV7J 5E3QA 3FCHA 3T1HF 2VFUA 2R2SA 3OV7A 1RYRA 3VALA 2FYXA 4IRKA 1WI6A 2ZC3A 5C42A 3PNIA 3ZZPA 3K0JA 3BGOP 1VRUB 3CJ0A 1AUDA 3OLBA 2GAGC 1DJ0A 1YX2A 2ZOGA 2UVRA 3HXMA 1XK8A 2OPQA 4ZPCA 2V2QA 5E7OB 2VQEF 1MSWD 1VBKA 2I5JB 2QC3A 3OR1A 2ZC4A 1N5VA 1PBAA 3I9ZA 2NREA 2CQ4A 2AJ2A 3RB4A 4PPZA 3OTOJ 2FC8A 1X0PA 4WKRA 4LF4J 3KKFA 3SQGA 2EWHA 1OS5A 1P8GA 4DCOB 2DJWA 1LWCA 3A12A 3IAM9 3LH2S 4MH8A 3CJRA 4U8VA 3VCDA 4NRTA 3PRBA 2AJ4A 2MPUA 2FD2A 3EGVA 3H2VE 5DS7A 3J81U 4CLYA 1HHTP 1V6HA 4JV0A 1N36F 2HGLA 2JDJA 1CPZA 1T95A 5I3UA 3MM6A 5E5NA 3KLFB 3A4TA 4PG7A 2UVWA 4B3MJ 3TP2A 1RHMB 3HLUA 5JMNA 2P2CB 2DNOA 1JLQB 5DO2A 3DRPB 1SKWA 2R7UA 2R2TA 5L1LA 2KJVA 3SFUA 2RKIA 2ILZA 1YHQS 2LU2A 2QIFA 2HVIA 5EWGA 2VBYA 2F1FA 3JQMA 4DL2A 2EKNA 2AYEA 2RUGA 2XG8A 4X62J 2CZVC 2JEIA 1S99A 1AUSL 5U47A 5LSLA 2AF6A 2GV1A 2FVRA 2CG8A 5SZTA 1GXLA 2KG1A 3G71S 3WBZA 4P72A 1NH8A 2HIQA 3HT3A 2ZDOA 3TNVA 3OJUA 3MPWA 1ACMB 3TVZA 1C0TB 4QQBA 5JVHQ 4F0KA 1VQOS 4DQSA 2CVIA 1VC0A 1CS4A 2AKWB 3NL0A 5IWAF 2EFOA 1TAUA 1T9WA 2W2QP 2BRKA 8AT1B 3LALA 5DJBA 1U7LA 3SCJE 1W25A 4NE9C 4LRAA 1H73A 4JI6F 3TQ1A 4LF8J 1GT8A 2EFPA 2RVJA 5HVGA 2GHVC 1NU4A 3H2LA 1VOMA 4X2BA 2CPZA 1YRUA 1ZM9A 2B43A 4OYIA 1RT3A 4DHVA 3TANA 1V3SA 1S0MA 2HHHF 2D74B 4EK2A 5BR8J 3MR5A 1VHFA 2F40A 3K8WA 4AE5A 2Q66A 3GFYA 3NG8A 2OPSB 4J7CA 2M5YA 2WSEC 4PKDB 4C8KA 3S8SA 3DMJA 3HVWA 3VV2B 1T9TA 3JAMU 2XLKA 3V6KA 1WKJA 1A7GE 4ECTA 5A0YA 4QWCA 2QMUB 3W5XA 3PIPQ 3I4PA 2BJ8A 1SJ1A 2HBYB 4RUHA 4L3NA 5IM0B 2DEJA 1BQMA 1IBLJ 4C2MA 3AHPA 3QT7A 3EZOA 3GJTB 1KWMA 5KFBA 1H7WA 1S5ZA 1TVRB 4MIWA 3QRQA 2FJEB 2IYGA 3I5AA 2E7VA 1LXJA 4HHJA 4OYWA 3UWTA 1IQZA 1PYTA 2GGPB 2FHJD 1S6PB 1WC6A 2MQLA 4FP9A 1C4AA 5KT2A 3GV5B 4LFBJ 2EFNA 3I0RB 3TARA 4DI6A 3H5SA 2HFUA 3HCXA 1CJKB 4HHUA 2DNZA 2GQCA 2PT0A 3OL7A 4CLTA 1U0HB 2DITA 1Z2ZA 2G1DA 1JJ2R 3PM9A 5EX3A 3W61A 2J6UA 1DHMA 2B6AB 4J91A 3W5YA 3W2VB 4A8XA 1U09A 4KRWA 1XQIA 2MZRA 3MURP 2AJFE 3TI0A 4LF9J 1KQGB 3NCRA 4H4MA 2HZVA 1S1VA 4OI6A 2E5GA 3SI8A 2DRAA 4Q5VA 3TUZC 3G8SA 2ZH3A 4C8OA 4DZDA 4O3SA 1CVJA 2AX0A 4ZLLA 3IXQA 1HWJA 3O6QA 4X66F 3P45B 3Q8YA 3E8OA 1RUSA 3FK4A 4Y00A 2AGQA 1LW0B 3GU0A 4B17A 1NEEA 2VDIA 1HBOA 1HW8A 2MZSA 2IPOB 4ZJQA 3C6UA 4RBUA 3CCMS 4N77A 4EO6A 2DGWA 4ICLB 2K1RB 5F8JA 1DTQB 1VR6A 2CQ2A 1YI2S 4DG1A 2OEKA 1NCLA 3NGKA 2VODA 2E5JA 2HFNA 3N79A 4W4MA 3MF5A 2GO9A 4Y2AA 1U1QA 2B3TB 3OD2A 4BHQA 4NLTA 4UQGA 2E5LJ 3BKUA 3PW4A 2FJAB 2PGCA 2E1AA 3HVTB 2W7OA 1NZAA 1R0CB 3POTA 1O6XA 3QAUA 4RNOA 2HQGA 4I6AA 2HNDA 3Q23A 3JSRA 3MGJA 1AW0A 3M30B 4I2QA 1C0UB 3SDEA 2W9BB 3PXGa 4OI4A 3UR3C 2YNFA 5E0OA 2JSXA 1CULA 5FD1A 3DM2B 3JAMY 2KFNA 2RDIA 3B6BA 1DRZA 1T02A 3PEJA 1ZYQA 3MM5B 4DUZF 3IGVA 2V8VA 5EX0A 4F36A 2H4YB 2Y1LB 4U7CA 1KC8T 2R8HA 2R8KA 3EVOA 4F02A 1K1SA 2V8PA 1FRIA 1JJHA 5E33A 5LXYA 2DNLA 5JXSA 3ZZ0A 5D78A 4M5KA 2DNHA 2K8GA 3FSXA 5D3GA 2CXEA 2OI2A 1TL4A 1KS2A 2RHQB 2EEYA 1FFSB 1MMLA 1UJ6A 4KHRA 5C2GA 1IQTA 5HMWA 2AYBA 1AFIA 1FKPA 3FQLA 4JV5F 1RAAB 1IKYA 3OTBA 1R27B 3MMBA 4O0NA 2OJ3A 1VRQC 2ZM6J 3CD6S 2MKHA 2OFGX 2MQPA 2GJ2A 3E2EA 2XEXA 4FF3A 3BPSP 1FD8A 1UCNA 3HSGA 2DRBA 3CDAA 3MFHA 4M5JA 4DPTA 1Q81T 3UDCA 2RS2A 1VQKS 1OQ6A 2KL8A 2ZNYA 4DXLA 1MU2A 4I2PA 2XLIA 5LJ3Y 5GAHU 1QTNB 3F56A 4O3RA 1XTZA 1S1UB 4YUDA 3PX0A 4YB7A 3OFGA 2XNRA 4R0EA 1WHXA 2C2EA 4DWIA 3UD4P 1CJKA 3AT1B 1RCXB 3NBPA 5B0DA 4TY9A 1HNWF 1YJRA 3I55S 1D09B 3QRPA 2NXNA 1D9AA 1FEEA 3GR1A 2BJEA 3M8QA 3RR8A 4DSIA 3W9HA 3CCRS 2EI5A 1ROFA 1HBMB 2FHOB 2L9WA 1TELA 3CJKA 3Q86A 2XY5A 1Q82T 2HMIA 4FF1A 3MR2A 4KGMA 1F0XA 1S1WB 3EVWA 3KUGA 7FD1A 2LEBA 1EHWA 3QLHB 2PA3A 5KFRA 4K50A 1HIYA 2W9AA 3PX6A 1FXDA 5KFIA 3TOQA 1N52B 3DC2A 3D3CJ 2GZOA 1WOPA 1N56A 3TX0A 4ZMMA 2VONA 2ZBCA 4BS2A 4TYBA 4DSKA 2APOA 1ZAXA 1JLQA 2LDIA 1LFWA 1N5YB 2DH7A 3T19A 3PDNA 4N8NA 5ETKA 4QIFA 1KVIA 3HI9A 4Z7CA 5L38A 2XY7A 4JUZA 3KNGA 2BE7D 3IRXA 1WD6A 2FPHX 4B3TJ 2QE5A 2JEGA 1XR5A 4WFAQ 3DFEA 4WP3A 3UVJB 2W9CB 4Q8FA 3K8VA 2R7XA 2HIYA 5A8RB 2ZHAA 3OVSA 3AJ1A 4R8UB 1S4FA 4DV4F 1RU1A 1V9OA 3V6DA 3CW2C 2HGNA 2FJBB 3BYRA 4FVMA 4LF1A 5K14B 3FCWA 4EUVA 2AU0A 4EYIB 3UCGA 2MB0B 3L4BC 3D0HE 1FERA 2BMBA 1IBCB 4NMXA 1LWCB 3D0GE 4EU0A 2CJKA 2QGFB 4QIWD 1PJ7A 1ZPVA 2CVEA 3CCES 1IKVA 2HYIB 2L08A 1JQGA 2D69A 1G1XA 3AD9C 2YWHA 4EZ9A 1C1BA 2WB4A 4OYPA 2ASYA 3KLFA 6AT1B 4RU9A 3S01A 4JI7F 3QSYB 3U27A 5D3GB 3ILLA 4TQRA 1NJZA 4J9NA 3DLHA 2YQ3A 1XERA 2DO0A 3PJ9A 5LMUJ 4L73A 5BYSA 1GH8A 1HMVB 3ZZRA 4CWBA 1X5OA 2M9KA 4F3QA 1D8YA 2BA9A 4JV2A 5H1SV 2JC1A 3EJMA 3M32B 3V2UC 1U1LA 3NMAA 1X31C 2BE2B 4H54A 5FIIA 3EYZA 4AUKA 4PWDB 1TL3A 2W1BA 1HQEA 2JVOA 4P6QA 5B0BA 1G7CB 2BV3A 2GQQA 2H1YA 3MM8A 4M5IA 2MYFA 3U7JA 4CH7A 3SYZA 2FDNA 1UA0A 2O66A 3Q89A 1D0EA 1WEYA 4K2XA 4OYZA 1C1CB 1ZA2B 1N6QB 1FJEB 1TTHB 3OHAA 2DHGA 4CO5A 2QA4S 4OJ3A 5J2QB 1S1UA 2RRAA 3NCQA 3HPOA 2X1FA 2VQFJ 1NSPA 5AXNA 1QSSA 5F0UA 1V3RA 5BR8F 4ELTA 4ZCLA 1L3TA 2HAIA 2HGMA 3SSSA 3G4SS 3KG1A 2ZKUA 3UDVA 4ECSA 3OFHA 4CYUA 4LF6F 4PAAA 1IKWA 1K1QA 1X9SA 2OIHA 1SH0A 1LKZA 4NZ7A 2DR7A 2XMMA 1S1XB 4PPDA 5E2QA 4DX5A 2FZGB 3W2VA 5A76A 1ZAWA 4WTOB 3BYPA 5L46A 2ZH2A 3UCUP 4B9MA 4IDKA 4KO0B 5D4OA 4Z2XA 5JJBA 2C2OB 4KGZB 4JI6J 1YDLA 3VR1A 4IG3A 4N41A 1U49A 1FDBA 2XMWA 2YPYA 5KFPA 4M1KA 4RW9B 3ZZUA 1FK9A 1V5VA 5DDOC 1ULRA 3M9NB 4PUOB 3M9MB 1UW9A 1N33J 4B3RF 1DAXA 2IY5B 4DS5A 4URGA 3HKZD 3QIPA 3QO9B 4HTJA 2HZAA 4NWBA 2I0XA 2QL5B 3TJ8A 2XMVA 3EGNA 1RBLA 2R4FA 2JLFA 3DGPB 4HH1A 1NHKL 4DS4A 2K3IA 3CD7A 3FVYA 2B5JA 3DCAA 2DR5A 3Q2SC 2XY6A 5T14A 3HX9A 1OMSA 3I0RA 3W9JA 4AL7A 5KFVA 4JYAF 4HDHA 5J2QA 3DRYA 2WVFA 1SC6A 5IV4A 3PYGA 1UTAA 4F0MA 1ICEB 4IOAQ 1P9QC 1ZZFA 5SUHA 2HKEA 2IDEA 4TQSA 4RBVA 3T5KA 1S77D 4J5OA 2K7KA 2HFOA 3MEKA 5LSRA 4JB8B 4ECWA 3H5YA 3FZ2A 2E9RX 1R8BA 4DQIA 3OLAA 1SH2A 1WNEA 4QPTA 2OKQA 1RTHB 5FDLB 1RGVA 4F8RA 2DR8A 2VG7A 5IT0A 2DGUA 2X1BA 1LW0A 3GFHA 1TUWA 1TUVA 3IGNA 1NK7A 1QVGR 1FK9B 2LFVA 1F3FA 2RF2B 1SPBP 2H48B 2KU7A 3BR8A 1TFYA 4ZVFA 2DNGA 2CWKA 2B4VA 2P9GA 3IFEA 3CJTA 2J8SA 1SUQB 4X4PA 3E51A 3HJVA 2DGVA 4LF4F 2FHMA 3HSJA 4CT9A 4NLRA 2NPFA 1D9DA 1U25A 1O5JA 3I5BA 1U2RA 2U2FA 2ZKTA 2JC0A 1RAJA 4UUWA 2ZZNA 4TXSA 1NSKL 2E44A 4RW8B 3QFHA 1C1CA 4PCQA 3JB9k 1RT2B 2RIJA 4UOCA 4ECRA 4PUOA 3CJ2A 5ETLA 4B02A 3D67A 4LMZA 1T9UA 4FZVA 4DCJB 3BGRA 1UAWA 2RE1A 2ZJRQ 2DPJA 2XHWA 2K7JA 1JLFA 3K7RA 4YY3F 4AFFA 2C2RA 4U96A 2E7WA 1F9EB 4CTAB 4NXMJ 5EUHA 2KDOA 2ZH8A 3BO4A 1OY8A 3IM8A 4OX7A 3TW0A 5BXIA 5KFLA 3UN2A 1I94J 2PO4A 3A3NB 3CDEA 2ASDA 2FLNA 5A8WB 1PKUA 2MQ8A 4L6V3 5G0RA 2BYCA 2IHR1 2ZFHA 3DLKA 5CCLA 1TKZB 2GA7A 2ZZMA 2HNYA 4YP3A 5KT3A 2RD5C 1HI1A 3FZBA 3I5CA 2WVCA 4F4KA 2FY1A 3WC2A 3M2UA 1P1LA 2R42A 3CCJS 3EDQB 4Q45A 4GKJF 1GQEA 3DKDA 4TLRA 4DF4A 1F2GA 4ZP6A 4FF4A 2XMTA 5DQIA 4ZPWR 5D4PA 3JSMA 4LRFA 4DUYJ 1FRLA 1UVMA 1B3TA 4ILLA 1N4LA 1FRKA 1EKRA 5LT5A 2PN6A 4X4QA 3QATA 4P7TA 2E7XA 1RT6B 4LSLA 1GK8A 4YB5A 1B7YB 1HWLA 2O67A 1IM4A 4YB6A 5AJ3F 2R7RA 4C8YA 2P5VA 4LBIA 3HKWA 4RNHA 2H5IB 2QYCA 5F8GA 1S9FA 2UXCF 4I68A 1CS4B 1MU2B 4I2PB 4QR1A 4R0JA 3GIIA 4OJGA 4FBTA 2C2NA 1SCJB 1RI7A 2G13A 4YQWA 3BGLA 3RAMA 1BE4A 5B09A 2WRMA 2FJWA 2CFXA 3ENWA 1XWLA 2VB6A 3I56S 4RUCA 1XR7A 5HLFB 1KVKA 1RZMA 4NL5A 2JEJA 4OLPA 4FNHA 2V34A 2GJIA 2P6SA 3DRSB 3E01B 4DZ6A 3TUIC 3HMJG 5J2MB 2MQNA 4RWXA 3K5NA 2UVUA 2YTCA 1RTJA 2YKNB 1SL0A 3QSIA 1YJ9S 5KFHA 2DGTA 5KFSA 2C2MB 2PFDA 5HN0A 1XNRJ 5CABA 1HNXJ 2MKCA 1RAEB 2HNYB 2MQMA 2XI2A 5B08A 3DN9A 1UKUA 4DL0C 3DLKB 3CJQA 1RT5A 3CJ4A 2LQ5A 4C11A 7FDRA 3CC2S 4DSLA 4GRSA 3M9OB 4K0KF 1DQ9A 5DETA 3HJFA 2RAQA 5L9XA 2OSRA 4YFUA 1GMWA 2XO6A 2DNKA 3LPYA 3M8PB 4I1TA 4QCLA 4DOZA 1EARA 2N7CA 3LP0B 4EWTA 3ZZTA 2I38A 1JLAB 3DYAB 2EG2A 1REVA 4L74A 3T41A 4LSLB 2NLWA 2XCPA 3V5RA 4DR6J 2N3LA 3NMRA 4USUA 2XS2A 5KG5A 1W2BR 3MI7X 1JXEA 3FFIA 1Q8IA 1Y10A 5IC4B 3D1OA 4I4BA 2VFVA 5HQLA 4ZPTR 4DR3J 2MQQA 1NJWA 1NXIA 2NPIA 5ETQA 2ASJA 5DQHA 1P27B 5KFAA 1EIYB 2OPQB 5CCMA 2JX2A 2JH3A 2QRRA 1F3VA 3H59A 2GAHC 2BE9B 1N54B 2MMYA 3IBCB 1UP1A 3G6ES 1N32F 3GB0A 4RR5A 2CJXB 2XWYA 2EFGA 3HT0A 4OI1A 1C2PA 2YKMA 5L1JA 4MFBA 3R5JB 1LW2B 2AJQA 3FBCA 4WFXA 1YJTA 3S6EA 2KT5A 3HULA 2PC6A 3GG0A 1HD0A 3J7YU 4H4OB 2ZOMA 4ICLA 4DF8A 1JNZB 2GFFA 1WDTA 4ES1A 2C3UA 1GMVA 1Y3JA 3VAGA 4IUFA 5CYQA 2W7PA 2PFFB 3BGUA 3BKFA 4KO0A 4ED4A 1WG4A 1P1TA 3M05A 2QLWA 4V1Ak 3VAHA 4ZA1A 3J7A1 5D15A 3GFZA 2D3UA 3M6XA 5E3CA 3CTRA 1I6JA 1EETA 4PRFA 2HRYA 3OVAA 4IR1A 2Q43A 1VLOA 4UTGA 1HNZF 3CGIA 2NYHA 4KB7A 3KG4A 1SQFA 3JQJA 1VMBA 1CQMA 3C16B 2V0NA 1S79A 4Q2LA 4UF4A 4HI1A 2DPIA 4DR4F 1X4EA 2NXJA 3C2PA 2DYAA 1XNQJ 2LXIA 3D68A 3IMQJ 3MWBA 1QDUB 1NDCA 1ZPWX 1NHVA 2GW8A 3DM2A 1N6QA 4FDFA 4IRDA 4PQUB 5T7LA 1IKXB 4OZ2A 3D6HB 3M30A 2LQJA 4CLPA 3KLEB 2OTJS 1RSCA 4PZVA 3TJ9A 1YK9A 3NGRA 1NKCA 4XTTA 3ZNJ1 5J2PA 1A6LA 3UR0A 3PO4A 1PC4A 5KFEA 3QMQA 4X4OA 3QGGA 1KVJA 2BABA 4NLWA 5IZHA 3G6VA 5LOQA 4JI3J 4MT1A 1TZ0A 3T5LA 2YWEA 1M5HA 2Z30B 4F3MA 5D8HB 3A3PB 2M88A 1RWOB 4OX6A 1SBRA 1PSDA 3AOAA 3H25A 3D9BA 2OAUA 4RLEA 2IM3A 3WHIA 4J9UE 3QT5A 5L1KA 4DR1F 4FYYB 2JJ4D 4OHXA 1RTIB 3WC0A 4DPOA 4JI1F 4ILMA 5KT7A 2V67A 1YRXA 4DV4J 2NZ4A 1Q7LB 1S6QA 3MDFA 4FPRA 1KN6A 2AHOB 2M8HA 4D3HA 2BKNA 5J1PA 4K5RA 3G6YA 1S12A 1HR0F 2NUHA 3KLHA 1JWWA 4K59A 4YHHJ 1VHIA 5DZ6A 1K73T 2MLXA 5K8NA 4ZVUB 1QTMA 3CULA 3QZ8A 2VOPA 1HD1A 4GKKJ 5H9FJ 3IP0A 4HI2A 2AT1B 1MWYA 1X60A 3TEGA 1REVB 2ZE2B 2B9XA 1WC1A 2ZDPA 3HSZA 4RW4A 4WK3A 1AYEA 5GVQA 3CJ3A 3QGHA 1C4CA 4P52A 3JYTB 2R8IA 2AQ4A 3RW6A 3I32A 4LR7A 4O4GA 2LKZA 5F9NA 1N34F 3LWLA 1VS3A 1GNKA 2VPXB 2AP6A 4MK7A 1N32J 2W8KA 3G9CA 4CO4A 4AT1B 2D9OA 4USJC 3RG6A 3IRXB 2LQBA 1RA6A 5D0EA 4BLGA 4AL5A 2VBZA 1K0VA 3UI3A 4HVZA 4USMA 2W9CA 1IUJA 3DOMB 5HROB 1RWVB 3F44A 3R5CA 3Q8PB 2VU5A 3M2VB 3M1VA 1GXUA 4RPFA 3CXCR 2AJ1A 3Q8UA 5CHCB 1FRMA 4Y28C 2VICA 3MM6B 3HF5A 1RT3B 3NOGA 1NPKA 2IMOA 3QLHA 3US5A 2E1RA 2MHNA 4NCBA 1BLUA 3EICA 3OW2R 1PYSB 3PX4A 2CZ4A 3DRPA 3T9NA 1KTQA 2Z2YB 1KHWA 3SMZA 3RB0A 2ZBPA 3R6GB 4G1PA 1LNQA 1UVKA 4NLXA 2E9ZA 3BQ2A 4WCEQ 5IXUA 3WX4A 3MUMP 4C48A 1WTFA 3PR5B 3FEXB 4M5MA 1Y00A 1JLEA 5A8RA 3ET6A 3P49B 2CPEA 3IG1B 4J9SA 5BJRA 5DG9A 3D0IE 3H5XA 2KM8B 2GMLA 3H7HB 2CNNB 3MPDA 1T8EA 1X4GA 3PW2A 4CLZA 1RHUB 1NHUA 4CQ1A 3N6NA 3CDUA 4KC5A 3QT8A 2RNEA 1C0TA 2K06A 2QG9B 2D41A 1HMVA 3UVJA 1QUPA 5A8KB 2D3OR 1ZAVA 2GVZA 4MTPA 2VG5B 3O44A 1RAHB 3BR9A 1N88A 3KHGA 3EPGA 3DRXA 1T03B 1S9GA 4MKVA 1HLWA 3IWLA 3TZYA 4KFBB 1GX5A 2GCFA 1PO6A 1X4AA 2M52A 3MEDA 1JLCB 1VRUA 2EK1A 1SV5A 4ED7A 1FO1A 2B4OA 1RWWB 3CIMA 1WTBA 3QGIA 3DOMA 3TR5A 1S59A 2CPYA 5HROA 4IYQA 1FRJA 1TKZA 1RKJA 1YJNS 5AE1A 5K8PA 2V94A 4B9VA 2ZBRA 4F2RA 2QA4G 3KFWX 2GMHA 3H8YA 2ZJQQ 2NXCA 2Y0BB 2WZ1A 1CC7A 5KFJA 3BV8A 2HS4A 2IAJB 1HHSA 3P8BB 1BWVA 1KOHA 2F8MA 4CLUA 1BHNA 1SB6A 4ID5B 3BN4A 3C6UB 1U1MA 2RHSB 4M5NA 1MROA 1U2CA 4ZS6A 4N56A 2BKOA 2IJFA 3R5GA 4GVLA 5I3PA 4O3OA 3R2CJ 1OYDA 1UEUA 1TU0B 2VJUA 1Z1ZA 1X4FA 2UUBF 1UFWA 1CC8A 2E5IA 2QFIA 2R7QA 1VJQA 2XMKA 2GQ2A 3K2YA 1NLKL 2C2KB 2MZTA 5T7LB 3W7BA 2V2VA 4C7QA 3V81A 3IM9A 1E6YA 4MAKA 3RGIA 1NZ8A 3FEZA 4FS1A 3R7BB 3V4IB 1F5AA 2BM1A 2N7YA 3N4WA 5F8IA 1CEZA 4Y2CA 1WORA 2CJ9A 2OLWA 3DXBA 2CKWA 2E29A 5C24A 2BANB 4ZIWA 3M8RA 2DNQA 5EWFA 5GAHI 1VC5A 1RWUA 1Y4ZB 1S0OA 2RQKA 4K2JA 3K57A 1FEHA 5C42B 4I7FB 1VQ5S 1KQKA 2Y0SD 2B7CB 1RTIA 4PWUA 2RQCA 3GP9A 2EVZA 4Y6IA 2CQ1A 2XM3A 2XGPA 4X4UA 1F5CA 2DO4A 1PAUB 1Q4RA 1VIXA 1KHVA 2DNNA 3M6WA 3R5AA 5ETMA 1WC0A 2WW8A 4GMKA 2KZMA 4CCHA 2CJAA 4EBDA 4UY8T 1NDLA 2LXUA 4P9SA 1M5SA 4ECZA 1IXKA 3CNQP 4NLQA 1NJIT 1IBLF 2DBBA 5LJ5Y 3MOZA 2BOAA 4WFNQ 4RW7A 3GILA 1RDRA 1VYAA 1ZM2A 3IWNC 3SV3A 3NGSA 4B9TA 3OTDA 4QWBA 1PAEX 4DUTA 4OHYA 1SQEA 2DR6A 3ZTSA 3KLVA 4ED0A 5HJYA 1IKYB 3GIRA 3KXDA 2ZHOA 2CPFA 1FFWB 4OV6A 2J0SD 2YWKA 2ZD1A 3TUPA 2AYMA 3EXCX 4URQU 3JSYA 4ZP9A 1MN7A 1RXOB 4QYZK 2CDRB 1WWHA 3NGDA 1H2TZ 3C66A 1R31A 5A6PA 4RUAA 2EBGA 3LP2B 3SFGA 1UZDA 4DV3F 2ZEJA 2HNDB 3D6MB 1U2FA 3PYFA 2RF2A 2U1AA 4WK1A 1J2VA 1NJYA 2J6SA 2HVHA 2W4DA 3PCOB 2DHSA 2LU1A 3TYTA 5C25A 2MKYA 2V5HG 2DCLA 4XK8C 2LA4A 4NASA 4CM2A 4U67Q 1OY9A 4MIBA 3KK1B 1U1KA 3MCMA 2FVQA 5J2PB 2G4BA 2VJVA 4DPXA 2NCKL 2HBZB 2GGPA 2Y8WA 3VAJA 2P9CA 2R7VA 2HG4A 2AWZA 1S1XA 1WF1A 3UDLA 2YNGA 4HDGA 2YKMB 2J8AA 2JL9A 4IDKB 4KR0B 4F4XA 1JXLA 3P5BP 1WG1A 4KGXB 4EBEA 3QGPA 2YWWA 4URSA 4U95A 4IQXA 2PA8D 2V68A 1GMWD 1L3KA 3TAQA 4NRUA 1NAQA 3MPUB 4ECVA 4HACB 1APSA 4A8MP 5DM7Q 1LOUA 5J1EB 4X64J 2IVMA 3I82A 2SXLA 4GVBB 1OYEA 3IR5B 4IOBA 1J5OA 1FDNA 4UOFA 3D1HA 2A10A 2IM1A 2V63A 2IRXA 5CYQB 3TZWA 1HBUA 1KKHA 1V5IB 3QO9A 4F4AA 3Q8RB 1DBDA 4ZLJA 1HA1A 1HARA 1R8AA 2HNZA 2WSCC 5ETRA 3EWGA 3OTOF 2IIHA 5IT4A 3FRZA 1LWFA 5AXKA 2N82B 4ZPAA 2MSTA 4S0MA 2W7AA 1RTDA 4I0WA 4FYXB 3ZZYA 2DR9A 5KG4A 2HLUA 2XMAA 2PMHA 1YKWA 4TU7A 1JKHB 1S9EA 5I3QA 3JSMB 1R6YA 4ZVTB 3GJQB 3FQKA 2C3PA 4A48A 1FF2A 1HBNA 5HSPA 2KXHA 3MM9B 4FKXA 2F63A 4ED8A 1XMOF 1X8DA 1SIZA 5H9EK 4DV0J 1ITPA 3VVUA 1QVFR 4X66J 4AQYJ 2KZZA 3P4UB 3H2UB 2FVPA 5HLFA 2UUCF 1S1WA 2NS1B 3MAAB 2G2OA 3CVKA 5HVFA 4RUBA 2Q6CA 4Z37A 4P10A 3QZ7A 4LF9F 1S48A 2HQFA 2M3DA 2QLXA 2B9YA 5D0HA 4ZPDA 3LQVA 3H0PA 2OMOA 2C42A 4DL6A 4A8FA 3TAMB 1OSCA 3AY0A 2QFJA 1JLGB 2DVIA 5K9FA 1KRPA 3EX7B 1U48A 5F3TA 2ROEA 3QAEA 1PGZA 3DLGA 2IRUA 1RTDB 2V4JB 3H5UA 3IG1A 3FMBA 1NKEA 5H9FK 2WK4A 3KUHA 1VGYA 4QW8A 1RT6A 2OH2A 2I5JA 3JTNA 1RYSA 2KYZA 2DIUA 1HQUB 2UUWA 1S6UA 3NOCA 3B4DA 4NLSA 3WQPA 3KNAA 2OEMA 4YR3A 2R7SA 3RBEA 1FKPB 1TV6B 2B9WA 2MLYA 1M0SA 1NMEB 1HL6A 1TL5A 3KTQA 2OELA 4PXBA 3G8QA 4KY3A 3ZFVA 1FNXH 2DCUB 1VCTA 1RWPB 3F41A 4USTA 2ATCB 5K20B 1DQAA 1PJ5A 1RABB 2EC2A 5A8WA 1YSJA 3O5TB 3R7NB 2MKKA 2GVDA 2CUYA 3CO9A 2HHTA 4NZ0A 2XSJA 2QLJB 5A2QU 1S10A 1X4DA 2PIIA 2QL9B 3NS5A 3EE3A 3CO0P 2MHEA 4BBYA 2OO4A 3CDWA 3MTJA 5DGBA 2J0XA 1UVNA 1IWAA 4YY3J 2F8EX 3OL9A 1SI9A 4JI5J 2XO7A 1VBYA 1TUGB 3DU6A 4YB1P 1S1TB 3HZGA 4G65A 4TYAA 2YQ1A 2P9EA 3D54A 3MCOA 1HBUB 3IBWA 3LP1A 3OXGA 1IBKJ 5DDQC 1VFJA 3OR2B 2WB1D 2XYGB 2CNKB 1RT4A 2ZH5A 5DGAA 1YJ7A 2FQQB 1NH7A 4K5SA 2JWNA 3TWZA 4TU9A 3THPA 2XBPA 4DR1J 4ER8A 1F5BA 2Z2ZA 4OZLA 2CJYB 2IVFB 6FD1A 4JV1A 4KT0C 2V6AA 3CMQA 1NSQA 3ZXWA 4CZCA 4N5SA 2EC0A 4ZVEA 4C3KA 1YRTA 3UW1A 1GTEA 1R0BG 4IG0A 3RB3A 2I1RA 3MPVA 5MLCV 1HR0J 1WC5A 4ED6A 1H98A 2KVQE 2OGUA 2YKAA 2UXBJ 3BSCA 1XEZA 3L7PA 8ATCB 2AMCB 3D7SB 5KFFA 1P6TA 3K5MA 3C15B 3NRBA 4NOHA 4PXDA 4RX6A 4JP8A 1Q8LA 3M8ZA 3RRKA 1RTHA 2AIRB 5FDLA 4ZIVA 4DFPA 4PQUA 5HMXA 4RNNA 4LSNB 1XMQJ 4Q0BA 5HAOA 1LK7A 3AOBA 1B4SA 5IC6B 2C2ZB 3PR4A 1N34J 2DHXA 2E9TA 3HHNB 4OJ1A 1LW2A 1NUEA 1RE1B 2HS0A 1B64A 1EP4A 2YX4A 4NI2B 4DEZA 2NR0A 1WF0A 1RHJB 2WW4A 1B99A 1FA0A 2FZKB 1D1UA 2KXFA 2R2UA 4OI2A 5GAGI 2UV8G 3N28A 4U6PA 4RU2A 2KTQA 1TKDA 2KRBA 3GWCA 3VTIA 1T94A 1VQSA 2WBMA 3DGPA 3PKYA 1UFLA 2MEWA 4JI2F 1RT7A 4L72B 1QUVA 2V9KA 4J9OA 4CO3A 1KLMA 2I8EA 2DGSA 1HBOB 4TKTA 3H4DA 4OJHA 4WF9Q 4KKOA 3BJYA 1BQMB 5GADI 4LIRA 5IV3A 2DXFA 2H3EB 3D6FB 4O3QA 4CLLA 2L41A 3HO1A 3LGHA 3OBIA 4RL1A 2GVDB 3KMSA 1DTTA 5IT9Y 3CE8A 2BQRA 1Y0HA 2BANA 2KI2A 5KG3A 5C25B 4AD6A 2V9WA 2RUSA 4XO0A 4KHPJ 2ZE2A 3H42A 4N8OA 2XB2D 1U02A 5L39A 3MEEA 3NXZA 4P2SA 3CIZA 4NA1A 3GIMA 4I7FA 4FS2A 2RU9A 1Y3KA 1S72S 3GTYX 4OHVA 4K4TA 1N33F 3P5TL 2G0CA 1U1NA 4GKJJ 3IO1A 3LTOA 1IKVB 1IKWB 5EHHA 5E41A 4QWAA 5CXTA 3GJRB 4UW2A 1PCAA 4FYDA 4WZQA 4ED3A 5M2RA 2QN6B 4R5PB 3I0SA 2FC9A 3N6MA 3MUTP 4DV6J 2UU9J 2B51A 5AE2A 4DX7A 4B3OB 1FTCA 1RCOB 4K4YA 3MMAA 4RKUC 4ED1A 4P2FA 1B7FA 3GIJA 4J37A 1MMNA 2BE2A 4K4UA 1KR4A 2RT3A 4DSEA 1DTQA 5KFCA 3KJFB 2HHHJ 1M5KC 5BYQA 3ZZZA 4JI3F 1H3DA 2ZVIA 3CCWA 3ZTOA 4KTQA 3G2XA 4OZ1A 2HK3A 3OL6A 3BO2A 5KOXA 3KLEA 1AT1B 1X5SA 3FRYA 1BQNB 3I96A 2DNYA 3PRVA 3VGVA 1KNZA 1XBWA 3N01A 2FGCA 2RKIB 5IT9U 3HD1A 4WWSA 2HQIA 4DN9A 2HFVA 4PYAA 2XCAA 4JI4J 4JI4F 3L7UA 2ZH6A 2FY8A 5A8KA 4RO0A 3W63A 2VV5A 2CAJA 1JIHA 3MM9A 2O3DA 2O5DA 2UVVA 5GAEI 2MKSA 3LGNA 1WHYA 4WZMA 5IS2A 1N0VC 3HSDA 4QU6A 4IFYB 2B0GA 1H7XA 2CPJA 5F3ZA 2FJXA 4C0HA 1HWIA 1D3WA 5F8MA 4X65F 2VKRA 3ENAA 3MZIA 2HPUA 1FCAA 1RT5B 3M8YA 4C11B 2IYIA 4WBFA 4WFBQ 4AL6A 3ET6B 4KAIA 4J90A 5GMEA 1YBAA 4OYAA 1TL1B 2ROGA 4IOCQ 2VBWA 2HVDA 1HWKA 2VBXA 3CT9A 3KHHA 4JI0J 1JB0C 2IAJA 3R97A 1RWMB 2VPYB 3AQOA 4DU8A 2BJ3A 3TA2A 2YKQA 3CC4S 2IVYA 3CMAS 3JS9A 4ID5A 4TLQA 4FVCA 4DX6A 2ATLA 1Y5IB 2O1PA 2IDLA 3GJSB 4ES3A 3BSNA 1X5TA 2B4UA 3TAMA 1J5OB 2H65B 5KFOA 5E3RA 2UXDF 5C7PA 5JUMA 3I4HX 2XULA 2VL1A 2D1CA 4FXVA 4NEZA 5E3AA 1T03A 4M5DA 4K4WA 1WC4A 3AA9A 3EPIA 2N4DA 3AQPA 2V4RA 3H98A 4QIVA 2L48A 3Q22A 4ZLNA 3RTVA 1SJFA 2OTLS 4KHPF 2HFZA 1D8ZA 1RHRB 1VDHA 3FFIB 3OXFA 5THWA 2AJ0A 3QBCA 1JKHA 1T9YA 4ID8A 4WE1A 5I42B 4KGVB 2LVWA 2W4PA 2IFXA 4TY8A 3D2WA 5J2NB 1FVQA 1T05A 2NSCA 2NZCA 4HL9A 3ZTPA 1HBMA 2HMIB 2XHCA 5IFMA 2UUTA 5H9EJ 4W98A 1RT2A 1NDKA 2W2NP 3OTCA 1M5OC 1LQ9A 1WACA 2A2DA 5B7WA 3H40A 2WVDA 2BBEA 3N5FA 3DU5A 1TR0A 2R9LA 1I94F 3VZIA 3BM7A 1PJ6A 4C8LA 2F4VF 2M70A 3RR7A 1HNZJ 3MAAA 4G1QA 2UXCJ 2NUUG 4ECUA 3CUNA 2VUGA 2XZWA 2PEBA 4LVNP 2VZ9A 2F9DA 2R3VA 5K5MA 3VHQA 3EXYA 3PHEA 5FLXY 4NLDA 1HQ2A 4CH1A 1S97A 5G0RB 4K7QA 1CLFA 4DPUA 1NK8A 2VG6B 4E0DA 2OD6A 3AXKA 3UN5A 2LCWA 3MMBB 4K8RA 2ASLA 4X4SA 2V4JA 4N76A 3GV7B 1F1BB 4ILRA 4ECXA 3FC9A 3UD3P 4NXMF 3FEYB 3FBFA 1X4CA 4XDDA 2ADCA 1Q16B 2KN4A 4BWMA 5AXMA 2VFRA 2MTLA 3GONA 1KOOA 3DDIA 1XNRF 1URRA 3P6YC 4A47A 1K47A 2VC1A 3V4MA 3FMWA 3M6VA 4WP8A 1G6BA 2WONB 3W1YC 2ZM6F 3NNCA 4FYVB 2PMWA 5A2QY 1IKXA 1H2UX 3D6TB 4O4GB 4UT4A 2HWTA 5CQGA 4U8YA 2ADBA 2GIRA 1MLAA 4R5PA 3WIUA 3T5JA 5E3PA 1OIAA 3DHWC 4KE5A 1SIWB 4X65J 2RB7A 3KDNA 2FUG9 4LFCF 1F6TA 1YZ7A 2H51B 3TVKA 1X7VA 2JLEA 2ZBIA 3KJNB 4MKAA 4GO5X 1TL7A 4LBPA 2OSQA 4NLPA 5D0RA 3RW7A 4WU3A 4RJVA 3W60A 4WFYA 2DNPA 2FVSA 3K5PA 3D28A 3THVA 2QZ8A 4LREA 1TK5A 1FNOA 4Q0BB 3PG9A 4CO1A 4RW7B 3CWJA 4C3MA 2HWIA 3ZNUA 4LFAJ 3Q0AA 2M2BA 1UMJA 2DXDA 3GFXA 3PEHA 4NI2A 1RT1B 2GJFA 3J80Y 3AODA 4DUYF 1KSPA 1U6ZA 1IR1A 4EGLA 4F0HA 2MGZA 1ZH5A 1T9XA 1JK9B 1YG0A 4RW6A 4QIEA 4PEOA 4DG1B 2ABYA 4RW9A 5B0CA 4N7TA 5B0GA 1DZ5A 2JEFA 3M4XA 1CJVA 3DLEA 1GMUA 4ZCMA 5CD4H 1WI8A 4KJIA 2KFYA 2R2RA 2FVCA 1BY9A 2C28A 1HNIB 2LLZA 1LK5A 3IA0A 1K8AT 2YWFA 4Y65A 2WHOA 4QWEA 2KFZA 1KP6A 2MKJA 4DN0A 5HQ8A 3OSPA 2RU3A 5DLGA 2CG4A 4I56A 4CH0S 4IFVB 2HNZB 3ULHA 4J9PA 5CYJA 1M5VC 2UUAF 1HPZA 3GZ7A 2G0IA 1VQNS 4ECQA 5K8OA 2H4WB 4FYWB 4IG0B 3OL8A 2V8GA 1RACB 2ERRA 4NEYA 2AGPA 2BM0A 2Z57B 4OMFG 2XLJA 1U0HA 5D77A 2UU9F 1DFDA 4BCAA 5KG2A 2MY8A 1X5PA 4PR6A 5KFGA 4NZ6A 3BSAA 4LSNA 5HJXA 4A8OA 1NK9A 2YNGB 2Z0GA 4KHMA 3GYXB 4Q2MA 3NGUA 3PV8A 4LRCA 2ZH1A 4WJBA 5EDWA 5AE3A 5LSOA 4IO9Q 3MEEB 1EP4B 4HT7A 5LM7E 5ETOA 1KEKA 4HT5A 1SJQA 1YBUA 1VQ6S 2MZQA 3HFZB 4V19J 2RILA 3HHLA 1IN0A 3AH6A 1P9YA 4P71A 3BH7B 4JI1J 4Q43A 1K44A 1RAIB 3FBEA 2O01C 3K58A 4F4YA 1YITS 1TAQA 1PC5A 2Q79A 3AB2B 1VJWA 4MFBB 2A3JA 1WDDA 4QR2A 3SXLA 1TL3B 3BKTA 2CPHA 3SCLE 5D6GA 4C9DA 2R8JA 4YHHF 2OEJA 1HKAA 2QV6A 4C0OC 2XQCA 4AQYF 4B9NA 4FBUA 1FT8A 2DGQA 2F5GA 4LQ3A 3NNAA 2UUCJ 2CQDA 3JXOA 4M63A 3W65A 1CJTA 3IS9A 3PHTA 2MGZB 2FZCB 1ZETA 4JV5J 1FHTA 1LWEB 1LEOA 1GX6A 2D3ZA 2WVEA 3K89A 2GIFA 4JOUA 3HP6A 2HRTA 2KYXA 3H20A 2KVIA 3LANA 2R8GA 1GXTA 2BOPA 3BO3A 3A8EA 1DY3A 3U1MA 3KLIB 2XI3A 5B0AA 4DV6F 2V50A 3UE2A 2MKIA 3MUVP 1EAYC 2FIUA 3NKYA 3T6BA 1XC9A 5KFMA 4LFCJ 2QLBB 4G1QB 1SC1B 4CO2A 4IO1A 1RB0A 4M8LA 3KK3A 1XMOJ 4OL8A 3AAWB 2QL7B 4WXOA 3ILIA 3ADAC 4P2MA 4OIXA 2HVEA 3C3LA 2KT2A 2XZTB 4PXCA 5B0FA 3RJMB 3GIKA 2VA3A 4DSJA 2CNLB 1WKLA 3R9LA 3DLGB 2V69A 4WIIA 5EN1A 5F41A 5KFTA 4WP9A 4ZCIA 3M8QB 2QMWA 1FJCA 4MYUA 1JLGA 2VA2A 4DL3A 4R25A 2L3MA 2DY9A 2LECA 3RB6A 2UXBF 1HNVA 2Z8QA 4O4RA 3UQSA 1UFKA 1TP7A 4DR2F 4X4NA 1HW9A 2AEJA 4ITSA 5AXLA 4YR0A 3DLLQ 2R7OA 3CJ5A 7AT1B 2C1EB 3D5MA 3DMJB 1EB0A 1QSYA 3PO5A 4CI0B 2M8DB 1NPPA 1VK3A 2OPSA 3ENVA 4QU7A 3WZ0A 2X3DA 4DR5J 1RT4B 2IM0A 3UFCX 4X64F 4F7VA 2XC9A 4ZVQB 2KXNB 4A8KA 4H4KA 4MKYA 3VVTA 1CJTB 3IS9B 3DHXA 3GSIA 3MTKA 4G1IA 4DPWA 3BQ0A 1M1KT 1YGYA 4Y2KA 3LAKA 3NBPB 1HQEB 3A8KA 2FGOA 4RW8A 4OZ5A 3T3FA 5J2NA 2IC3A 4F67A 1S0VA 2CQGA 4AYBD 4PG6A 2BQ3A 1IBKF 3N5BA 4C6AA 2CADA 1W7WA 1ZBTA 4IFYA 1YWXA 4B3MF 4WXWA 3NAIA 2X3GA 2HBRB 1YBTA 1UETA 1S49A 3ILOA 2HW3A 4BC9A 3UO0A 4LVOP 1L5UA 2CQ0A 2RQ4A 2K3KA 3R6LB 3UNYA 2LP4A 2W01A 3QT6A 5GAEU 1C1BB 1EKSA 2HS3A 3MECB 1A0OB 3QFWA 3MMCA 2J9CA 4I69A 2DH9A 3BEGB 4I6YA 2MQOA 3D4JA 3KHLA 4HHHA 3OTEA 2W4CA 3S7RA 4PWDA 1MNEA 1XMBA 1UEKA 2LXFA 1XIQA 4FKYA 3KLHB 1MWZA 5RUBA 1GFWB 2YKOA 4QWDA 4DV5F 2KHDA 5LMUF 3UCZP 3GMGA 4QZVB 1RP5A 3I87A 1U1PA 4K4VA 2CYYA 3GG1A 1VQLS 1HPZB 1QJHA 4NLOA 3DOKB 4NA3A 1KDNA 4IH7A 1QM9A 4O44B 1D9FA 4DFKA 4M94A 4ED5A 1W26A 3BF4A 3ISZA 1WEZA 1SKUB 1SH3A 4MK9A 5J1NA 2R7WA 2Z2LA 3CMES 4LJMA 3FCVA 1FJGF 4CTAA 1FRXA 4ZVPB 5HP1B 3KLIA 4U7UD 4NLYA 2MZ1A 1UW4A 1AZSB 2YPZA 4YS2A 1AXQA 1R0AA 3DRRA 4DFJA 5F0WA 2J0QD 1Q8KA 1RAGB 2QA1A 3M2VA 1U0SA 2NYIA 2B5JB 3P96A 2HVZA 4LSZB 4OYOA 4OQJA 3MD3A 2EFVA 4CM0A 4YR2A 3CCVS 4C4WA 3POTB 4NA2A 4M5HA 2W24A 5FLXU 3EZ5A 5CAAA 1XMQF 3B54A 3BDEA 1SKSA 1XNQF 3KWMA 4I2QB 2CQHA 1GAOA 4NCGB 2DNRA 2IBKA 3TZZA 3C6TB 3OVBA 4OYXA 2VIHA 5L1IA 2PI4A 4ANCA 1Y7PA 3KYLA 3ZTQA 4OI0A 1L3SA 2D3O1 4J9KA 1K0TA 2JFDA 5ETNA 1LXNA 5IQ6A 1WG5A 2YH0A 3ONQA 4YOEA 4FXDA 1Y11A 3WX8A 2A2CA 3MPYA 2VG7B 4JI0F 2IMWP 1RT7B 5KFYA 2CRLA 2AGOA 2HHSA 5GADU 1VI7A 1URNA 3DLEB 1KLMB 2VPWB 3GCXP 3W2WB 1JJCB 1R3NA 2RDDA 2MXYA 1U26A 2F7VA 4B9SA 3IBFB 5KT4A 3S1TA 3EUNA 4USHA 1F2HA 5HATA 4IR9A 1MWQA 4JI5F 1JLBA 2B7BB 1SC4B 4CLWA 2DT9A 4GC7A 3LWMA 2YVSA 1Y5LB 4DL4A 2A0FB 4NXNJ 3GYNA 2UP1A 1FX4A 1Q53A 2Y3YA 2C3MA 5DQGA 4A8WA 4JI8J 1X9WA 4PABA 4HH0A 1M5PC 2CNOB 2J5AA 2KJWA 1FDDA 3Q8VA 5B0EA 1N5QA 5DG8A 4ZPBA 1HYSB 2VF3A 2ZBQA 4A8QA 1R0AB 2UV8A 4QYZJ 3TA1A 3JTPA 3BBFA 2BJ7A 3FDSA 5HBMA 3RUBL 3IAS9 3J80U 3Q8QB 3PZPA 3T1HJ 1VQMS 1ZZNA 1AB8A 4LT6A 1U1OA 1WF2A 2WVBA 1O0PA 2J7WA 4DBQA 2F4VJ 3QRRA 2QT7A 2OFHX 3VAFA 2GHPA 2FTRA 4CP5A 4DV5J 4ZLPA 3T1YJ 4ZJLA 4O44A 3ZC4A 2Q1LA 2I9SA 5LL6d 4N47A 4C98A 3OSNA 1Y5NB 3LUYA 1DQ8A 2RQMA 3V6HA 2OUGA 4E2FB 3PW7A 1T3NA 1NPRA 1JNRB 1QLNA 1IJFB 3VAKA 4UOGA 5A0YB 4J9VA 1X9MA 3PIOQ 1BD6A 2HHQA 3DXSX 3EM1A 1QAYA 3NAHA 3ETMA 4P73A 4Y3CA 2IM2A 3O3LA 1K9MT 4B3SF 5C24B 2EXUA 3KJVB 1NK4A 4LF8F 3HVAA 4IKAA 3FSYA 3HDSA 2PEHA 3M7VA 3V81B 1T7PA 4Y0FA 4MMOA 5HP1A 3EMTA 5F8LA 2VKZG 4B08A 4R8UA 1VIOA 1Q7YT 4WFZA 3R2DJ 1R8HA 1VC6A 5D4LA 3GPAA 3Q8SB 3DRRB 2DGOA 3F73A 4MYTA 1VBXA 4JI2J 3C19A 4DQQA 4BWJA 2C22A 4DV1F 1O8BA 1T05B 4DV1J 5F8HA 4ZKAA 3NEKA 2HFSA 3T1AA 3GYGA 3MM8B 5HL7Q 4LFBF 1Z4UA 1F60B 2ZUGA 1VRTB 4OZJA 3R1LA 3KJQB 2N4CA 1DLOB 2JLGA 1U1RA 3VQTA 3TA0A 4H4KC 2J6TA 1RBOB 3HFKA 2CIMA 3NS6A 3B8HA 4O23A 4I67A 1KBRA 3DRSA 2CWXA 1FJ7A 3R3TA 2HAFA 4LUBA 3O2IA 1YIJS 1HNVB 2EKYA 3OR2A 5DRKA 4EBCA 1CSJA 1Q5VA 4ALZA 2RRBA 2C3YA 4CLSA 2WCXA 2C2DA 2X51A 2F4FA 4MIAA 1ZTWA 4I6WA 1S1TA 4Q7AA 3SSQA 4LF5F 2R7TA 4W90B 3RAQA 1R6VA 1RJJA 3CC7S 4ZHRB 2HHPA 2YNIA 1JXVA 5DM6Q 1OPZA 1UPPA 1E6VA 2MY7A 2FB0A 4OFZA 4ZP7A 5IWAJ 3BQ1A 2Q3PA 2QEXS 1N5TA 3SZ2A 3EVMA 3G6XA 5CYMA 2H54B 5LMNF 3PYDA 3L3CA 4NXNF 2DD8S 1FE4A 1RBAA 2RH3A 1EQ0A 3LF0A 1YVFA 4FN5A 2EK6A 3OFFA 3JTOA 3G86A 5AT1B 1VQPS 1NK6A 2E5LF 3W8PA 4RBTA 1AA1B 1I51B 2XSFA 3JQKA 4LBHA 2IC3B 2YBVA 3A13A 3BBBA 1TKXB 1TKTB 4YN3B 1R8CA 1UZHA 1SXLA 4DDFA 5A6WA 4CT8A 4KSEB 2NXEA 4M5LA 4OHWA 4TY8B 2B9EA 1QD1A 3RU0A 1UJ5A 2QX0A 3SEOA 3U1NA 3MM7B 2UUBJ 3K5LA 1YLXA 3RAXA 3W5ZA 4F04B 5KFKA 2PDAA 2ZNZA 1S6OA 2GX8A 2IJRA 2YKPA 3D1QA 3SV4A 1Q79A 1CBKA 4PG8A 2MZJA 3GV8B 2XTJP 4M95A 4DJBA 3T1YF 4QPXA 4ZN3A 3E01A 3M2UB 1ZA1B 2BRLA 3LAMA 1NJXA 2VFTA 3W3SA 2DY1A 1BQXA 1NM2A 2GHWA 3K17A 3W2WA 4DCPB 3KK2A 5G4DA 2MJNA 3M8SA 3CCTA 3C14A 2M7SA 3DI6B 1OJ4A 3RBDA 3M2RB 4OZ3A 4EMDA 1RISA 5I3UB 2NSBA 4A8YA 1ELOA 2M4MA 3BGFA 3G96A 1U8SA 4DR7F 4DR7J 2EW9A 4USKA 4CIOA 3OFEA 5DLFA 2YNIB 4EI2A 2DGXA 5KT6A 4QW9A 2BZ2A 4RW4B 1TMMA 3JYTA 2RSQA 4A8SA 4HYKA 1NB2A 1QY7A 4OZNA 5MAOA 3I9V9 4F3OA 3IWXA 4PYDA 3GE9A 4X4TA 1C0UA 3SDEB 2FLOA 2W9BA 3GLJA 3VWSA 2L9DA 4RNFA 4TVAB 1SUQA 2E1CA 1T9VA 4NPOA 4D3GA 3AD8C 4UOHA 2KO1A 3PVXA 4IFVA 4DV0F 3BB5A 4X84A 4K4XA 5KG7A 6FDRA 2ACYA 4C8MA 3IR6B 1AZSA 5GMDA 2DB1A 3RBZA 2OPPB 4ETXA 4DR6F 2ALZA 4KPYA 1ZOTA 2JHEA 3A8JA 2YXLA 1X0FA 2F9JA 4H4OA 5ADZA 3HM9A 4G6VB 3BGRB 2N3OA 1JX4A 2I6WA 9RUBA 2D9PA 2DHAA 2KHCA 2RRNA 4O3NA 2FLLA 1FJGJ 4ED2A 3GR0A 2EPIA 3DLJA 2AX1A 3HHLB 2KM8C 3HZEA 1UWAA 1TQLA 4NYPA 3PW0A 3TUJC 3NS7B 1QAJA 1VK8A 1TMJA 2BVZA 5C5JA 2VD3A 1UA1A 1S76D 2HK2A 2PMZD 3MMAB 1NBEB 1G2EA 2Z58B 1SL2A 4H4MB 3C16A 1SL1A 1SJ3P 4OYMA 4QOTA 3RBXA 8RUCA 1EETB 2K2PA 1Q95G 1M1HA 2ZD1B 3TX8A 3PACA 2FHKA 3C8YA 3KMQA 4OV1A 1N8RT 3ILJA 2BXJA 2XYPB 4F2SA 2UZAA 2J7UA 4C3LA 3CCSS 4NLGA 1FKOA 2WOMB 2Y1JA 1B0PA 2H9ZA 1H2VZ 5K14A 1JLBB 5GAGU 3SCIE 2Y9HA 1S6PA 3CD0A 3SSRA 2W8LA 1RA7A 3CF5Q 1H74A 4DR5F 4BC7A 3FBBA 3OJSA 1XJWB 1Z2LA 4DPYA 4C8ZA 1N5YA 1IR0A 5ETVA 3VGTA 2VC0A 2XSJB 2PSZA 3I31A 3BBCA 5KFUA 5EWEA 4V19X 4QBUA 4DUZJ 2XMUA 3CSKA 2BW7A 4ZVHA 2HHUA 2E1PA 3ITHB 4X4RA 1HFEL 4NYOA 1FVSA 1DURA 1T0TV 3L95X 4KYZA 3G87A 3BDPA 2YKNA 3BREA 2DISA 4K4SA 4OHZA 4ENOA 1F9FA 5KFQA 1WC3A 1S7HA 3C14B 1V3ZA 3DI6A 1LFPA 4E8UA 2BKPA 2B6AA 3TJAA 2J76E 4XAKA 3LP2A 2V4QA 2CQ3A 3LP1B 2JRSA 3UD5A 1UVJA 5F8NA 1FXRA 3VAMA 4KQZA 1S1VB 3NY0A 2CZ9A 4NMLA 4ZITA 4JI7J 5KFZA 3B4MA 1E6YB 1IJEB 2F65A 2JFKA 2QMXA 4PWWA 1GEHA 3IN5A 5K8MA 3F0NA 1S0NA 1AROP 2IRYA 3BN7A 3MEGA 4KGKA 1PG5B 4IQMA 3D66A 1RWXB 3ZTRA 3V4IA 3Q2TC 1HI8A 4DR3F 2YX1A 4Z7YA 1TVRA 2DKOB 3P3DA 2KH9A 2HQCA 2QSFA 2H5EA 4GO7X 1S57A 3AB4B 2B4PA 2B56A 3M8PA 2HHWA 1IVZA 4UY85 3M8WA 3OUYA 2VQEJ 4KKOB 4DV2J 3V6DB 3T5HA 2BQUA 5KFWA 1SVDA 2M0GB 5KTQA 1UVIA 1JMTA 2CA9A 1UVLA 3KK2B 3LPEA 3R1HA 2OPPA 3FGVA 5KFXA 4CLKA 5KT5A 2Z4PA 2QJ3A 3NCPA 4B3SJ 5DDPC 2QSWA 2CJQA 3LO3A 4KFBA 4U7UK 4ELUA 3QJJA 5J2MA 1JLCA 1KONA 4RZRA 4NLVA 2KG0A 1B0VA 1HWUA 1MMDA 4LR9A 3GQCA 1WOSA 4OX9F 2ZZTA 5CZVA 2IA6A 1FWKA 5T41A 5M2UA 3J7Z5 4LF7F 4LF7J 3MECA 3WIVA 1Q5YA 4J9QA 5HQMA 4DR2J 3BPDA 1Y9OA 2OD4A 2ALYB 2BUNA 3CCZA 1NKBA 3AFGA 1BGXT 1UWBA 2P6TA 2ZH4A 2KT3A 2HEKA 3GSDA 4XDCA 2VFSA 1R7IA 1EQMA 1RLCL 2DXEA 3H90A 3EZUA 5D4NA 4KBIA 1KQFB 3LOUA 2H5JB 2G1HA 2LEPA 3TRGA 1JLEB 3ZZOA 2Y1IA 3DLBA 3RZAA 5I42A 4CRJA 3NLCA 5HMZA 2IJNA 2CDQA 1RWKB 1E6VB 5HVHA 2CPXA 2JVRA 3KJVA 1I1GA 2GNKA 4DV3J 1ZTTA 3FJ2A 1X4HA 4F26A 4GC6A 5I4MA 1OSDA 4UQTA 4W92B 2VOOA 4F4ZA 3L7OA 2VG5A 3M1VB 1VISA 3OPKA 1UJ4A 1FRHA 1DLOA 4OZ0A 1A9NB 4DFMA 2VDHA 3SQOP 1WHVA 2VASA 1XR6A 2DEIA 5LMNJ 2OPRB 1VRTA 1YQHA 3BZQA 3UN3A 2ACMA 2BW2A 3ICLA 3R27A 4WPAA 1SC3B 2CQIA 4ZVSB 4NX9A 3W9IA 1RHQB 3ENQA 5HK4A 1L3UA 1G3OA 3M6UA 3SIPB 2J9DA 3MR6A 3PJWA 1FNMA 2YY3A 4GKKF 3I0SB 2DHHA 2A6OA 3PFEA 3X3UA 2KRRA 1RLDA 4KH0B 1LWFB 4B3OA 3DDKA 5EGYA 3BSOA 1CG2A 3MEGB 1GTHA 5DDRC 1UWBB 4LRBA 2RMLA 4ZHRA 2W2PP 4PQAA 4ZK7M 4UUXA 2J0WA 1NRKA 3AD7C 2FLPA 2G0JA 4PG5A 3KOAA 5DZ7A 5C2CA 2PE8A 2ZJPQ 1BMQB 5CZXA 4O0IA 4DQRA 2AD9A 1WKKA 1R89A 1HI0P 4NYZA 2XS7A 3ISNC 4HR2A 1BQNA 2AEMA 2YNHB 1PBUA 1Q86T 3PJXA 1SKRA 1SJRA 1H38A 3AJ2A 3BS9A 1Q1KA 5ETTA 1QE1B 2EFQA 1XN9A 1WSVA 4ZVGA 1BUXA 2XZDB 4KIAA 4QIGA 2V2ZA 3CJSA 1LWXA 1PILA 1WHWA 1YJUA 3I6PA 3OXLA 4WTYA 1WUUA 3UNGC 3ZO7A 2CQCA 2ZWOA 2HWHA 3HHEA 2UXDJ 4OI3A 3IC1A 5KFDA 4DU7A 3A3OB 5ETSA 5LXRA 1NO8A 1RT1A 1J27A 4NCGA 2FJVA 2QTWA 3HHKA 1KD1T 1N36J 1FESA 3EGWB 3T9ZA 4Q8EA 3E3XA 1T3OA 1N5SA 2HBQB 5HO4A 2HHVA 4YDXA 4KPCA 3U1LA 1M90T 4IH6A 5CD4A 4BDPA 3ETOA 2HHXA 1S4EA 2E1MC 3JSBA 4FPIA 2CJBA 2LMIA 1DARA 1U6FA 5DG7A 1U45A 2ZH7A 3TAPA 4X4VA 4J9LA 4XIUA 3HD2A 2CQPA 2GO8A 2PD1A 4QJVA 1OQ3A 3W64A 1W2IA 3NWRA 4ZP8A 4DLEA 4B9LA 3QQCD 1M1GA 1HNWJ 5HANA 1T11A 4ATNA 1FTRA 2A1BA 3O8WA 3HVTA 2V2KA 4XPEA 1FKAF 3C15A 2X1AA 1YTYA 1FE0A 4USIA 2PI5A 3KG0A 5CH7B 1BWEA 4LFAF 2JZ5A 4PG4A 4JI8F 2P8IA 4P2XA 2IBOA 2XWXA 4ZJOA 4AXIA 3KLGB 2BX6A 1QSLA 1ZS6A 4A46A 2OPRA 4DQPA 1EZZB 2POKA 1FKOB 2WOMA 3J7YI 1Q8BA 3WDOA 4WKYA 2XGQA 4WE1B 2F3JA 2GMJA 2Q6BA 5HI7A 5AJ3J 1FXLA 3C6TA 3G8TA 4RWWA 2YNFB 1WJ9A 5IQQA 3G82A 3CCQS 4EZ6A 4TN2A 1SV5B 1VQ9S 1H6KX 2AV5A 3U02A 4YMEA 1U4BA 1FDAA 2CPDA 3CD5A 2XNQA 3DGVA 5F9LA 1FWPA 1RTJB 2E66A 3IRWP 1G4CA 2ROPA 1UEVA 4CYUB 1O51A 4C8NA 2WAQD 2EBEA 2VQFF 3VGSA 2DH8A 2ZOFA 2A18A 1WSRA 4HACA 2UUAJ 3LGMA 4WU2A 4FNIA 2BACA 2BJ9A 4FXWA 3J7AN 4DMZA 3HHLD 3ELHA 1U24A 3MD1A 3MOJB 4AXJA 1RK8A 2VH7A 1WEXA 2MLZA 4K4ZA 2LDYA 3M32A 2Y1RI 1HHQA 3DOLA 5KG6A 4K0KJ 4KV8A 2FJDB 2Y8YA 1UPMB 3TQEA 1MW7A 2DRDA 2J7KA 4U9RA 3VAIA 4PXEA 1RHKB 3LW5C 2VHGA 1RAFB 2HQ3A 3DYAA 3QYYA 1MG7A 1IWGA 2V8HA 2BJDA 1PIEA 3N9UC 2GS8A 3TVYA 1JJ4A 2ZWPA 1Q0NA 2DIVA 5FJ4A 5HMYA 1SJ4P 2LQ8A 2MJUA 4USWA 4QYRA 1AFJA 3PY8A 4B3RJ 2DK2A 3PTWA 4DV7F 2KB2A 3HHDA 2JNJA 3HVRA 1S9GB 4L3KA 5JVGQ 1TV6A 3RRGA 2W2OP 1RQ0A 4WYWA 1PYOB 2GVZB 1BC6A 2EG1A 1N0UA 3MM7A 4LIWA 4CNYA 1QAIA 1OO0B 3MMCB 3MXHP 3RRHA 2WSFC 3X1LB 3PRDA 2G9OA 4EEYA 3PYEA 1TKTA 4IRCA 3CJKB 2IA0A 2W2MP 1U6BA 2KKHA 2ZH9A 2FHJA 1FWLA 3SCKE 4JYAJ 3L9ZA 4ES2A 1KQSR 3CPWR 1RU2A 3QWUA 2BEFA 4C0BA 2D7SA 4DV2F 1JLAA 3DDNA 4A4JA 1H0HB 2DTJA 2JOQA 3TEHB 3M2RA 3QPIA 4ZN1A 4DLGA 1KTVA 9ATCB 4Y2IA 1FFGB 3MCNA 4LRDA 4Y2MA 1CJUB 4YDDB 5KAKA 2GIQA 2YWGA 4ZCKA 5IM0A 4LR8A 2COLA 2HURA 2LA6A 5CYMB 2XMJA 1RWNB 3R5DA 4LF6J 1YJVA 3HK2A 1HBNB 3T6JA 4DR4J 2QYGA 5KG0A 4YEAA 4ANEA 3QWPA 1HQUA 3AJDA 3N6LA 1Q78A 3MAQA 3MEDB 3TO8A 2XYHB 1R8PA 4LF2A 4M5GA 4E98A 2HQDA 4ZOSA 4OLOA 1YJWS 1VQYA 3V6JA 1S7IA 1TKXA 1IM6A 3CDBA 4ZVRB 2WBRA 4CO0A 3OUYB 3FKBA 4ELVA 3MR3A 5D0GA 3OHBA 3MAHA 3BH6B 2F8HA 4Y34A 2LEAA 2AYGA 4XPCA 4P7VA 1F9HA 3Q24A 4G3IA 4J9RA 1J5EJ 2BDPA 2HZCA 1RADB 3LA0A 2BJ1A 2YX7A 3R5BA 4FF2A 2A6MA 4CLFA 1HNXF 1IBMJ 1IBMF 4I64A 3RYLA 2QO3A 3QIDA 4KV8B 3KHRA 2L9NA 2RS8A 2B8QA 2G2ZA 4WIQA 5J1EA 1IR2A 1WELA 1RTZA 3VQSA 4ECYA 3W66A 4M5DB 3SQGB 1I3OB 1I5OB 1RAOA 4HTIA 3R8YA 1NK0A 1FI4A 4F4WA 1UL3A 4ETZA 1LWEA 1NNDA 1EX8A 2W25A 3B82A 3HHLC 3KDOA 4UZCA 3AXMA 4ZPVR 4WYLA 4EYHB 4USVA 3O1LA 3QIPB 3K59A 4B9UA 1U47A 4CNZA 3QNWB 4LF5J 4L75A 3G82B 3CCUS 3K5OA 3UDEA 4RNMA 3PW5A 1B0TA 1JLFB 5ITHA 1S9EB 2NQPA 1WOOA 2AZ3A 4ZVOB 2CPIA 1EJ7L 2CQBA 3VZHA 4F25A 5KFNA 2J9DE 4JBCA 4MK8A 2OP5A 1B70B 3MR7A 4ZDNA 5HBMB 3IR7B 3MFIA 1NK5A 1TK0A 4HKQA 1DTTB 2VPZB 1TL1A 2E5HA 3MM5A 4MJKA 3EGZA 2X1GA 2BR0A 1ZM3A 1FX2A 3THTA 1KFDA 3W8GA 3KK1A 4L76A 1L3VA 3D3BJ 5BYRA 4CDIA 3NNHA 1CULB 4DSFA 5KOWA 3KK3B 3OR1B 1OWXA 1NSAA 1FD2A 5CA5A 3DOLB
chains in the Genus database with same CATH topology
4Q44A 1S6QB 1RKIA 3VF0B 1TK8A 3CEDA 2XS5A 2C3OA 3PFOA 1VLYA 2GC8A 3CCLS 3L09A 2V8DA 1OPIA 2RJZA 3ITHA 1VQ4S 4NCAA 2QA2A 5GMKa 2WTFA 3OQ2A 3J7ZT 3QJPA 4DL7A 3LP0A 2OMLA 4TNOA 2K1RA 2WONA 4B3TF 1VBZA 1NB7A 1KLNA 4RW6B 4IH5A 4F50A 3DNCA 1TFWA 3FSIA 2LQ9A 3NWGA 2MDAA 2ZHBA 3DOKA 1VQ7S 1HYSA 2ZITA 2Z2MA 4ERDA 4HEA9 2ZVSA 3KLGA 1R43A 3FNNA 4X62F 1QE1A 3J81Y 4EFAC 2MSSA 2LYVA 2J9EA 2YNHA 3N0VA 4IG3B 1J5EF 5M2PA 1QAXA 3UPFA 1CQNA 3CB4A 1LV5A 3QJLA 3B78A 4HLBA 3ISND 2NXUA 1VQ8S 5KG1A 2VG6A 2RDJA 2DNMA 5L8RC 3C46A 4DL5A 3A1YG 5L9NA 2YH1A 1X4BA 4OX8A 4QR0A 3MMJA 1N48A 2AW0A 4NLUA 1KFSA 3MCSA 4TU8A 3H4BA 4WZMA 3PKMA 3MHYA 1ZM4A 1MROB 4O3PA 4C97A 1HNIA 4EO8A 4J9MA 4LQ9A 2HLTA 4MKBA 3AA8A 2I2YA 2ILYA 3NP5A 2HRUA 5E3QA 3FCHA 3T1HF 2VFUA 2R2SA 3OV7A 1RYRA 3VALA 4IRKA 1WI6A 2ZC3A 5C42A 3PNIA 3ZZPA 3K0JA 1VRUB 3CJ0A 1AUDA 3OLBA 1DJ0A 2ZOGA 2UVRA 3HXMA 1XK8A 2OPQA 4ZPCA 5E7OB 2VQEF 1MSWD 2I5JB 3OR1A 2ZC4A 1N5VA 2NREA 3I9ZA 2CQ4A 3RB4A 4PPZA 2FC8A 1X0PA 4WKRA 3KKFA 3SQGA 2EWHA 1OS5A 1P8GA 2DJWA 1LWCA 3LH2S 3IAM9 4MH8A 3VCDA 4NRTA 3PRBA 2AJ4A 2MPUA 2FD2A 3H2VE 5DS7A 1HHTP 1V6HA 4JV0A 1N36F 2HGLA 2JDJA 1CPZA 1T95A 5I3UA 3MM6A 5E5NA 3KLFB 4PG7A 2UVWA 3TP2A 3HLUA 2DNOA 1JLQB 5DO2A 3DRPB 1SKWA 2R7UA 2R2TA 5L1LA 2KJVA 3SFUA 2RKIA 2ILZA 1YHQS 2LU2A 2QIFA 2HVIA 5EWGA 2VBYA 2F1FA 4DL2A 2AYEA 2RUGA 2XG8A 2CZVC 2JEIA 1S99A 5U47A 2AF6A 2GV1A 2FVRA 5SZTA 1GXLA 2KG1A 3G71S 3WBZA 3HT3A 1NH8A 2HIQA 2ZDOA 3TNVA 3OJUA 3MPWA 3TVZA 1C0TB 4QQBA 1VQOS 4DQSA 2CVIA 1VC0A 3NL0A 5IWAF 2EFOA 1TAUA 2BRKA 3LALA 5DJBA 1U7LA 3SCJE 1W25A 4JI6F 3TQ1A 1GT8A 2EFPA 2RVJA 2GHVC 1NU4A 3H2LA 1VOMA 4X2BA 2CPZA 1YRUA 1ZM9A 2B43A 1RT3A 4DHVA 3TANA 1V3SA 1S0MA 2HHHF 2D74B 3MR5A 1VHFA 2F40A 3K8WA 4AE5A 2Q66A 3GFYA 3NG8A 2OPSB 2M5YA 2WSEC 4PKDB 4C8KA 3S8SA 3DMJA 3HVWA 2XLKA 1K0TA 3V6KA 4ECTA 1A7GE 2VODA 5A0YA 4QWCA 3PIPQ 3I4PA 1SJ1A 4RUHA 4L3NA 5IM0B 1BQMA 4C2MA 3AHPA 5KFBA 1H7WA 1TVRB 4MIWA 2FJEB 2IYGA 3I5AA 3UWTA 1LXJA 4HHJA 1IQZA 2GGPB 4FP9A 2FHJD 1S6PB 2MQLA 1C4AA 5KT2A 3GV5B 2EFNA 3I0RB 3TARA 3H5SA 2DNZA 2GQCA 2PT0A 3OL7A 1JJ2R 2DITA 2J6UA 1Z2ZA 2G1DA 3PM9A 5EX3A 1DHMA 2B6AB 4A8XA 3W2VB 1U09A 4KRWA 2MZRA 3MURP 2AJFE 3TI0A 1KQGB 3NCRA 4H4MA 1S1VA 4OI6A 2E5GA 3SI8A 2DRAA 4Q5VA 3TUZC 3G8SA 2ZH3A 4C8OA 4O3SA 1CVJA 2AX0A 3IXQA 1HWJA 3O6QA 4X66F 4Y00A 3E8OA 2AGQA 4PUOA 1LW0B 4AL7A 4B17A 1NEEA 1M5PC 1HBOA 1HW8A 2MZSA 3CCMS 1D0EA 3C6UA 4RBUA 4N77A 4EO6A 2DGWA 4ICLB 2K1RB 5F8JA 1DTQB 2CQ2A 1YI2S 4DG1A 3NGKA 2E5JA 2HFNA 3N79A 3MF5A 2GO9A 4Y2AA 1U1QA 2B3TB 4BHQA 4NLTA 4UQGA 3PW4A 2FJAB 2PGCA 2E1AA 3HVTB 2W7OA 1NZAA 3POTA 3QAUA 4RNOA 4I6AA 2HNDA 3Q23A 3JSRA 3MGJA 1AW0A 3M30B 4I2QA 1C0UB 3SDEA 2W9BB 3PXGa 4OI4A 3UR3C 2YNFA 5E0OA 2JSXA 5FD1A 3DM2B 3JAMY 2KFNA 2RDIA 1DRZA 1T02A 3PEJA 1ZYQA 3MM5B 4DUZF 3IGVA 2V8VA 5EX0A 4U7CA 1KC8T 2R8HA 2R8KA 1K1SA 1FRIA 1JJHA 5E33A 5LXYA 2DNLA 5JXSA 3ZZ0A 5D78A 2DNHA 2K8GA 3FSXA 5D3GA 1TL4A 1KS2A 4KHRA 1MMLA 1UJ6A 5HMWA 2AYBA 1AFIA 1FKPA 3FQLA 4JV5F 1IKYA 3OTBA 1R27B 3MMBA 2OJ3A 3CD6S 2MKHA 2OFGX 2MQPA 2GJ2A 3E2EA 2XEXA 4FF3A 1FD8A 2DRBA 3CDAA 3MFHA 1Q81T 3UDCA 2RS2A 1VQKS 1OQ6A 2ZNYA 2XLIA 1MU2A 4I2PA 5LJ3Y 5GAHU 3F56A 4O3RA 1XTZA 1S1UB 4YUDA 3PX0A 4YB7A 3OFGA 2XNRA 4R0EA 1WHXA 2C2EA 4DWIA 3UD4P 3NBPA 5B0DA 4TY9A 1HNWF 1YJRA 3I55S 1D9AA 1FEEA 3GR1A 2BJEA 3M8QA 3RR8A 4DSIA 3CCRS 2EI5A 1ROFA 1HBMB 2FHOB 2L9WA 2XY5A 3CJKA 1Q82T 2HMIA 4FF1A 3MR2A 4KGMA 1F0XA 1S1WB 7FD1A 2LEBA 3QLHB 2PA3A 5KFRA 4K50A 2W9AA 3PX6A 1FXDA 5KFIA 3TOQA 1N52B 3DC2A 1N56A 4ZMMA 2VONA 2ZBCA 4BS2A 4TYBA 4DSKA 2APOA 1ZAXA 1JLQA 2LDIA 1LFWA 1N5YB 2DH7A 3T19A 3PDNA 4N8NA 4QIFA 1KVIA 3HI9A 5L38A 2XY7A 4JUZA 3KNGA 3IRXA 1WD6A 2FPHX 2QE5A 2JEGA 1XR5A 3DFEA 2W9CB 4Q8FA 2R7XA 3K8VA 5A8RB 2ZHAA 3OVSA 3AJ1A 4R8UB 1S4FA 4DV4F 1V9OA 3V6DA 2HGNA 2FJBB 4FVMA 5K14B 4EUVA 2AU0A 4EYIB 3UCGA 2MB0B 3D0HE 1FERA 1LWCB 3D0GE 4EU0A 2CJKA 4QIWD 1ZPVA 2CVEA 3CCES 1IKVA 2HYIB 2L08A 1G1XA 2YWHA 4EZ9A 1C1BA 2WB4A 2ASYA 3KLFA 4RU9A 3S01A 4JI7F 5D3GB 1NJZA 3DLHA 4TQRA 4J9NA 2YQ3A 1XERA 2DO0A 1GH8A 5BYSA 1HMVB 3ZZRA 1X5OA 2M9KA 4F3QA 1D8YA 2BA9A 4JV2A 5H1SV 2JC1A 3NMAA 3M32B 3V2UC 1U1LA 5FIIA 2BE2B 4H54A 3EYZA 4AUKA 1TL3A 5B0BA 1HQEA 2JVOA 4P6QA 1G7CB 2BV3A 2GQQA 3MM8A 3U7JA 3SYZA 2MYFA 1UA0A 4CH7A 2FDNA 2O66A 1WEYA 4K2XA 1C1CB 1N6QB 1FJEB 3OHAA 2DHGA 4CO5A 2QA4S 4OJ3A 5J2QB 1S1UA 2RRAA 3NCQA 3HPOA 2X1FA 5AXNA 1QSSA 5F0UA 1V3RA 5BR8F 4ELTA 4ZCLA 1L3TA 2HAIA 2HGMA 3SSSA 3G4SS 3KG1A 2ZKUA 4ECSA 3OFHA 4LF6F 1IKWA 1K1QA 1X9SA 2OIHA 1SH0A 1LKZA 4NZ7A 2DR7A 2XMMA 1S1XB 4PPDA 5E2QA 2ZH2A 1YJ9S 3W2VA 1ZAWA 4B9MA 3UCUP 4IDKA 4KO0B 5D4OA 4Z2XA 5JJBA 4N41A 3VR1A 4IG3A 1U49A 1FDBA 2XMWA 5KFPA 4M1KA 4RW9B 3ZZUA 1FK9A 5DDOC 1ULRA 3M9NB 4PUOB 3M9MB 4B3RF 1DAXA 4DS5A 4URGA 3HKZD 3QIPA 3QO9B 4HTJA 4NWBA 2I0XA 2XMVA 3EGNA 2R4FA 2JLFA 4HH1A 4DS4A 3CD7A 2K3IA 3FVYA 2B5JA 3DCAA 2DR5A 3Q2SC 2XY6A 5T14A 3HX9A 3I0RA 4JYAF 5KFVA 4HDHA 5J2QA 3DRYA 1SC6A 4IOAQ 1P9QC 1ZZFA 5SUHA 4TQSA 4RBVA 3T5KA 1S77D 4J5OA 2K7KA 2HFOA 3MEKA 5LSRA 4ECWA 3H5YA 3FZ2A 2E9RX 1R8BA 4DQIA 3OLAA 1SH2A 1WNEA 4QPTA 2OKQA 1RTHB 5FDLB 1RGVA 4F8RA 2DR8A 2VG7A 5IT0A 2DGUA 2X1BA 1LW0A 3GFHA 1NK7A 1TUVA 3IGNA 1QVGR 1FK9B 2RF2B 2KU7A 3BR8A 1TFYA 4ZVFA 2DNGA 2P9GA 2B4VA 3IFEA 1SUQB 4X4PA 3E51A 2DGVA 4LF4F 2FHMA 4CT9A 4NLRA 2NPFA 1D9DA 1U25A 1O5JA 3I5BA 1U2RA 2U2FA 2ZKTA 2JC0A 1RAJA 4UUWA 2ZZNA 4TXSA 2E44A 4RW8B 1C1CA 4PCQA 3JB9k 1RT2B 2RIJA 4UOCA 4ECRA 4LMZA 3CJ2A 4B02A 4FZVA 3BGRA 1UAWA 2RE1A 2ZJRQ 2DPJA 2XHWA 2K7JA 1JLFA 3K7RA 4YY3F 4AFFA 2C2RA 2E7WA 4CTAB 5EUHA 2KDOA 2ZH8A 3BO4A 4OX7A 3TW0A 5KFLA 2PO4A 3CDEA 2FLNA 2ASDA 5A8WB 5G0RA 4L6V3 2ZZMA 2BYCA 2IHR1 2ZFHA 3DLKA 5CCLA 1TKZB 2GA7A 2HNYA 4YP3A 5KT3A 2RD5C 1HI1A 3FZBA 3I5CA 4F4KA 2FY1A 3WC2A 3M2UA 1P1LA 3CCJS 4GKJF 4Q45A 1GQEA 4TLRA 4DF4A 4ZP6A 4FF4A 2XMTA 5DQIA 4ZPWR 5D4PA 3JSMA 1FRLA 1UVMA 4ILLA 1N4LA 1FRKA 5LT5A 4X4QA 2PN6A 4YB5A 4P7TA 2E7XA 1RT6B 4LSLA 3U27A 5AJ3F 2O67A 1HWLA 4YB6A 1IM4A 2R7RA 4C8YA 2P5VA 4RNHA 3HKWA 2UXCF 2QYCA 5F8GA 1S9FA 4I68A 1MU2B 4I2PB 4QR1A 4R0JA 3GIIA 4OJGA 4FBTA 1RI7A 2G13A 4YQWA 3BGLA 3RAMA 5B09A 2WRMA 2FJWA 2CFXA 3ENWA 1XWLA 2VB6A 3I56S 4RUCA 1XR7A 5HLFB 4NL5A 2JEJA 4OLPA 4FNHA 3HMJG 2GJIA 2P6SA 3DRSB 3E01B 4X4UA 3TUIC 5J2MB 2MQNA 4RWXA 3K5NA 2UVUA 2YTCA 1RTJA 2YKNB 1SL0A 5KFHA 2DGTA 5KFSA 5HN0A 2MKCA 2HNYB 2MQMA 2XI2A 5B08A 3DN9A 1UKUA 4DL0C 3DLKB 1RT5A 3CJ4A 2LQ5A 4C11A 7FDRA 3CC2S 4DSLA 4K0KF 3M9OB 1DQ9A 5DETA 3HJFA 5L9XA 2OSRA 4YFUA 2DNKA 3LPYA 3M8PB 4I1TA 4QCLA 4DOZA 2N7CA 3LP0B 4EWTA 3ZZTA 2I38A 1JLAB 3DYAB 2EG2A 1REVA 2XCPA 4LSLB 2NLWA 3V5RA 2N3LA 3NMRA 2XS2A 5KG5A 1W2BR 3MI7X 1JXEA 3FFIA 1Q8IA 3D1OA 4I4BA 2VFVA 4ZPTR 2MQQA 1NJWA 2NPIA 2ASJA 5DQHA 1P27B 5KFAA 2OPQB 5CCMA 2JX2A 2JH3A 2QRRA 3H59A 5JVHQ 2MMYA 1N54B 3G6ES 1N32F 1UP1A 3GB0A 2XWYA 2EFGA 4OI1A 1C2PA 2YKMA 5L1JA 4MFBA 1LW2B 2AJQA 4WFXA 3S6EA 1YJTA 2KT5A 3J7YU 2PC6A 3GG0A 1HD0A 4DF8A 4H4OB 2ZOMA 4ICLA 1JNZB 2GFFA 4ES1A 3VAGA 2C3UA 4IUFA 1Y3JA 5CYQA 2W7PA 2PFFB 3BGUA 4KO0A 1WG4A 1P1TA 3M05A 2QLWA 3VAHA 3J7A1 4ZA1A 3GFZA 2D3UA 3M6XA 5E3CA 3CTRA 1I6JA 1EETA 4PRFA 2HRYA 3OVAA 4IR1A 2Q43A 1HNZF 3CGIA 4KB7A 3KG4A 1VMBA 1CQMA 2V0NA 1S79A 4Q2LA 2DPIA 4HI1A 4DR4F 1X4EA 3C2PA 2LXIA 3MWBA 2GW8A 1ZPWX 3DM2A 1NHVA 1N6QA 4PQUB 5T7LA 1IKXB 3M30A 2LQJA 3KLEB 2OTJS 1NKCA 5J2PA 1A6LA 3UR0A 3PO4A 1PC4A 5KFEA 3QMQA 4X4OA 3QGGA 1KVJA 2BABA 4NLWA 5IZHA 3G6VA 1TZ0A 3T5LA 2YWEA 1M5HA 4F3MA 5D8HB 4OX6A 2M88A 1SBRA 1PSDA 3H25A 4RLEA 2OAUA 2IM3A 4DR1F 5L1KA 2JJ4D 4OHXA 1RTIB 3WC0A 4DPOA 4JI1F 4ILMA 5KT7A 1YRXA 2NZ4A 1KN6A 1Q7LB 1S6QA 3MDFA 4FPRA 2M8HA 4D3HA 5J1PA 4K5RA 3G6YA 1HR0F 2NUHA 3KLHA 1JWWA 4K59A 1K73T 1QTMA 5K8NA 3CULA 2VOPA 1HD1A 3QZ8A 5H9FJ 4HI2A 1MWYA 1REVB 2ZE2B 2B9XA 2ZDPA 4WK3A 4RW4A 5GVQA 3JYTB 2R8IA 3CJ3A 3QGHA 1C4CA 2AQ4A 4IRDA 3RW6A 3I32A 4O4GA 2LKZA 5F9NA 1N34F 3LWLA 1VS3A 1GNKA 2VPXB 2AP6A 4MK7A 2W8KA 3G9CA 4CO4A 2D9OA 4USJC 3IRXB 2LQBA 1RA6A 4AL5A 2VBZA 1K0VA 3UI3A 4HVZA 2W9CA 1IUJA 5HROB 3F44A 3R5CA 3Q8PB 3M2VB 3M1VA 1GXUA 3CXCR 2AJ1A 5CHCB 1FRMA 4Y28C 3MM6B 3HF5A 1RT3B 2IMOA 3QLHA 3US5A 2E1RA 2MHNA 4NCBA 1BLUA 3OW2R 2CZ4A 3DRPA 3T9NA 1KTQA 1KHWA 3SMZA 3RB0A 4G1PA 1UVKA 4NLXA 2E9ZA 3BQ2A 4WCEQ 5IXUA 3WX4A 3MUMP 1WTFA 3PR5B 3FEXB 5A8RA 1Y00A 1JLEA 3P49B 2CPEA 3IG1B 4J9SA 5BJRA 5DG9A 3D0IE 3H5XA 2KM8B 2GMLA 1T8EA 1X4GA 3PW2A 1NHUA 4CQ1A 3N6NA 3CDUA 4KC5A 2RNEA 1C0TA 2D3OR 2D41A 1HMVA 5A8KB 1QUPA 1ZAVA 4MTPA 2VG5B 3O44A 3KHGA 3BR9A 1N88A 3EPGA 3DRXA 1T03B 1S9GA 3IWLA 4KFBB 1GX5A 2GCFA 1PO6A 1X4AA 2M52A 3MEDA 1JLCB 1VRUA 2EK1A 1SV5A 4ED7A 1FO1A 2B4OA 3CIMA 1WTBA 3QGIA 3DOMA 3TR5A 5HROA 2CPYA