4K59A

Crystal structure of pseudomonas aeruginosa rsmf
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
AMGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unusual CsrA family member operates in series with RsmA to amplify posttranscriptional responses in Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
molecule keywords RNA BINDING PROTEIN RsmF
total genus 9
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02599 CsrA Global regulator protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k59A00
1T3OA 4K59A 1Y00A 4KRWA 4KJIA
chains in the Genus database with same CATH superfamily
2GNKA 1TKZA 1ZH5A 1UWBB 2XMUA 1UP1A 1WEZA 2DISA 1DTQA 3TAPA 1LKZA 3ENAA 2V50A 5CCMA 2XYGB 3DHXA 3CCJS 5KT6A 2XZWA 2M3DA 1WHWA 2VC0A 4QWDA 1NJYA 5I4MA 5HQLA 2HHWA 3KYLA 4F04B 3DRPA 1EB0A 1IBLF 2PMHA 4GVBA 1NPRA 4H54A 3RB3A 3G6VA 2JL9A 1BXNA 5L1IA 2XS5A 2HGMA 2KT2A 4ES2A 3I0RB 3EGNA 1Y7PA 1I1GA 5F8NA 3MPDA 5E3PA 2HQFA 1WEXA 2D3OR 3A1YG 1VQ8S 3FBEA 3DOMA 5FD1A 1HPZA 3P5TL 1L3TA 1FJGJ 3F73A 4Q0BB 2HW3A 4UOCA 3RB0A 1Q1KA 3BYRA 2HFNA 1G3OA 2XS7A 1VRTA 2BQ3A 5LMUF 2LQJA 1HBNA 2UUTA 3O1LA 2Q6BA 1BQMB 3DLKB 1YHQS 3QFWA 3K8VA 4CZCA 2BZ2A 2WONA 2MJNA 3OJSA 4ZPVR 2I1RA 1FJGF 2WRMA 4J9SA 1GFWB 1MNEA 2B6AA 1U47A 3FSYA 4KQZA 5CCLA 4ZN3A 5AE3A 1KS2A 2W4CA 1NLKL 3KJFB 3MM5B 1S1TB 2B9YA 5T7LB 2DPJA 4B3TJ 5KG2A 1XNQF 1GXLA 2VODA 4B9MA 4RUBA 1Q0NA 4CYUB 9RUBA 2V0NA 1D8ZA 3HMJG 4CLSA 4LVNP 5KFXA 2XTJP 3W7BA 3HI9A 5A8RB 4Q8EA 4YDDB 2KXNB 3Q8PB 1ZPWX 1U2FA 1WHXA 3C15A 2HQGA 2MQPA 4CH7A 1UA1A 1X8DA 3PYEA 5DQIA 3J7YU 3LWLA 5HLFB 2B4VA 3H90A 2MMYA 2IMOA 2VBZA 3MMCA 1LW0A 2BABA 5LL6d 4RW9B 3L7OA 4WIIA 3CCTA 2ZH5A 1SV5A 5JXSA 3JSBA 5KFQA 2N82B 3H2UB 3NP5A 1UWBA 3RBXA 5B09A 4NLQA 4ALZA 4A8WA 5IWAF 4K2XA 2WVCA 2P2CB 4UOFA 3BJYA 3FNNA 3M05A 3Q23A 1R8BA 2PE8A 3CE8A 1S0MA 4Y2CA 3NBPB 3A8KA 1NSAA 1VRUB 1WI8A 3AY0A 4OX7A 2PI4A 4N41A 1JWWA 1P1LA 2DHGA 3SIPB 2VQFJ 3V5RA 2CZ9A 2XMJA 1FRHA 4O3SA 1VK8A 3DU6A 3MTKA 1TTHB 3NRBA 3LP2A 3G71S 2MZTA 2BE7D 3H0PA 8AT1B 4X4SA 3BH7B 4CIOA 3KK2A 4GC6A 3CJQA 2UVUA 3OJUA 4WXOA 4ZIVA 1WF1A 2RE1A 3MZIA 4DI6A 3HJFA 3H5XA 3TAQA 1J5OB 2GIQA 2OH2A 2ZH2A 3OT9A 2B6AB 1Q16B 4OLOA 4PPZA 4TY9A 4CLLA 3ENQA 2E1PA 4WFNQ 4DN9A 2YKNB 4HL9A 4DL2A 3QZ8A 1CQNA 2MZJA 1O51A 4X2BA 2GA7A 2Z58B 3IG1A 1WEYA 3KDNA 4FXWA 1RT2B 2MB0B 1V5VA 2K1RA 3R5GA 5KFIA 1UL3A 4DV6F 5KFPA 1ZA1B 3VAMA 4KGVB 3UO0A 4DX5A 3EWGA 3QLHB 2CDRB 2ZH7A 1X9SA 3TX8A 4DUYF 2N4CA 4I64A 1HR0F 2OELA 4O3QA 4G65A 2WW8A 4DV1F 1NB7A 5E0OA 2B5JA 3ZTSA 3HXMA 2AX0A 2YNHB 3ZNJ1 1S0VA 3I9ZA 2HBQB 3FVYA 4DV6J 2QMXA 4PG6A 3B54A 3HSGA 5IT4A 1RBOB 3CCMS 3GWCA 3PG9A 1FNXH 3KUEA 3ADAC 4Y3CA 1R0AA 3D68A 3FQKA 3GMGA 3O3LA 3PYGA 5F3ZA 1DQ9A 2QTWA 2DY1A 4L76A 1R43A 4ZCIA 3QAEA 1RAIB 3IBWA 1VS3A 3DN9A 1CVJA 2RS8A 3GR1A 4B3SF 2JFDA 2Y1LB 3M1VB 5KFYA 4QIVA 1FRKA 1U0SA 4ZA1A 3R97A 5BYRA 3OR2B 5HK4A 2FQQB 4B17A 4ECRA 1W2BR 3UCGA 2KFNA 3MI7X 4CI0B 2ZOFA 3RAMA 1U0HA 1Q95G 2HZCA 3B78A 4YB5A 5IV4A 1LNQA 1FNMA 2QT7A 1K9MT 2OPPB 3RRGA 3MMAA 2LEBA 2HYIB 3MEEA 1TL7A 4TLRA 4RW7B 1KVJA 2AYMA 1FTCA 1Q86T 2W2NP 4LRFA 3KLFA 5ETRA 2PFFB 4IO9Q 4GKJF 4JYAF 2WVFA 2KYZA 4K4VA 3IP0A 1RT7A 4FKYA 1C1CB 1ULRA 2AYEA 2BA9A 1HBOB 2ZH3A 4BLGA 1S0NA 2CWKA 2W2QP 3ZXWA 1KD1T 2HRYA 3JQJA 3EUNA 2CPFA 4OI4A 2DIVA 5HROB 2GW8A 2Y0SD 3GYGA 3JXOA 1FWPA 3HHDA 3TQ1A 1KDNA 1TL1A 1U6FA 2AJ1A 3TRGA 2A6OA 4PZVA 1FKOA 4DR1J 3RU0A 3K0JA 1LXNA 1WC1A 2M88A 4KO0A 1JXVA 1YJTA 1QE1A 5CABA 3Q8QB 2C22A 2AX1A 4K59A 2WSFC 2KJWA 3QATA 3IS9B 2V2VA 3NCPA 4WJBA 4YHHJ 1Q82T 3T1YF 2R7TA 2WZ1A 1J2VA 1R8CA 2EK1A 1RSCA 4GKKJ 2E5GA 4DR7J 1N54B 2DXEA 2KRBA 2HBRB 1TUWA 3DDIA 1KEKA 7FDRA 4NXNF 4I2QA 4B08A 1NKBA 3W64A 1XQIA 2OPQB 1RTIA 2UV8A 2PMZD 4F2SA 1X0FA 1JLEB 1UCNA 1VRUA 1UKUA 4DV5F 1G7CB 2YQ1A 2ZITA 2GQCA 3M1VA 5EX0A 2E9RX 1FHTA 3D6TB 1I5OB 5DRKA 2UV8G 4LRAA 4Y2IA 2GFFA 2MEWA 3GG1A 1TK5A 2OHDA 1S10A 2QSWA 5E7OB 3S6EA 2FYXA 3E01B 1VQ5S 3TWZA 1A9NB 1HQUB 2HLUA 3M2RB 2BKPA 1IM6A 1CULB 3HX9A 5EWGA 3EPGA 2B5JB 2HFZA 2MHEA 1XR6A 2VFSA 1IM4A 2VZ9A 3POTB 3C6UA 4ZP7A 2W4DA 1PILA 2MKKA 2UVVA 1KSPA 1KQSR 2AIRB 2LXIA 1RT7B 1N8RT 2LMIA 4ZS6A 3T5KA 3VQSA 4JI7F 2Y3YA 1HI8A 1ELOA 1T95A 5B0EA 4IOAQ 4ZHRA 4N56A 2MHNA 2WSCC 4C0OC 4KGKA 3M2UA 4PYDA 4JI3F 2ASYA 3R7SB 1TL3A 2RQCA 2DHHA 3MUTP 4NWBA 1T94A 3MAQA 3V4MA 3FSXA 2AF6A 3ILJA 2W9CB 3DNCA 3MUVP 1R6VA 5FJ4A 1SB6A 1OS5A 2ZVSA 3R7BB 3IRXB 3ELHA 5D78A 4J90A 1RQ0A 4B3RF 5HATA 4ZPDA 3G8TA 1R7IA 2FLPA 1GTHA 2LQ9A 3G4SS 1IR0A 3NBPA 1AT1B 2UU9F 1QUVA 3PTWA 1JMTA 3EGVA 4FVCA 4Y2MA 4EO8A 4F67A 4J9QA 4DS5A 2YBVA 1NH8A 2VU5A 3D9BA 1CJKA 5D6GA 4PWDB 1HQEA 2IVMA 3CCSS 4DV1J 3T5LA 3HO1A 3QJJA 1FJCA 4P52A 4ZP8A 3K7RA 1LW0B 4PXEA 1D3WA 4U8VA 3QGPA 5HP1B 4O4GA 2WSEC 2M7SA 3BO3A 4OYMA 3NS6A 2E1MC 1ZAVA 2IVYA 3D1OA 1M5SA 3Q22A 1S9GB 1WG4A 3EDQB 1RT6B 2QZ8A 3TA2A 4YP3A 2EG2A 1MROB 5C7PA 2NUHA 2QG9B 2X1FA 2BE2B 2MKCA 4DJBA 2W01A 4YEAA 1PJ5A 3CDUA 5DETA 4ELVA 2IFXA 4OJ1A 1WHYA 3I6PA 2CPYA 5KTQA 1S6QA 2DGOA 2R4FA 3PCOB 5KFGA 3OHAA 3DXSX 3IGVA 1FJ7A 4LBHA 4CO4A 5H9FJ 2FJWA 4A8KA 3GFXA 1UVMA 1KLMB 3QT7A 3TVKA 4KBIA 3I5AA 4G3IA 2IM1A 2HWIA 2VG7B 4HHHA 5KG0A 1TELA 1UFWA 4A8SA 1S59A 2J9EA 2HAFA 3NOGA 4CDIA 4FF1A 2UXDF 2GMLA 1S57A 3T5HA 3EXYA 4MKVA 4RNNA 2VDIA 3OVSA 4Y2AA 2X1AA 1T8EA 5B0DA 1TKXB 2CQ4A 1HWLA 3HZEA 3D1QA 2KH9A 2YKPA 2BYCA 3J81j 1KFDA 4DR6F 3CB4A 4A8MP 4QW8A 4GVBB 3T3FA 3OLBA 2GO9A 2HEKA 1ZZNA 1L3UA 1X9MA 4LF2A 2NS1B 4ED4A 5EWFA 4ITSA 2ALYB 2E5LF 1YG0A 4EBDA 1S4EA 2BE2A 1W26A 3RUBL 3KLGA 2QFJA 5HN0A 2FB0A 4C97A 4QBUA 3MM7B 3PRVA 1ZM9A 4MH8A 4NLVA 2RILA 4TYAA 5D4PA 2NXEA 5B08A 3HM9A 2RJZA 1NJWA 2FHOB 2EBEA 1N34J 5KFKA 2VIHA 1N88A 3MF5A 4CNYA 3ILOA 4WTOB 2B43A 2RHSB 3PFOA 2Z2ZA 5JJBA 5HP1A 3AD7C 4DQSA 3OTOF 3JYTB 4LRBA 1FXDA 2VG6B 3EVMA 3DGPB 2JEIA 3LPEA 3CGIA 4YY3J 1VBZA 3SV4A 4BS2A 1IBKF 5HQ8A 3KNGA 2RS2A 1SPBP 3H59A 3M6WA 1T3OA 2A6MA 2AJ2A 3C14A 4JOUA 4DUZF 4GC7A 2NLWA 5D8HB 2ZH9A 3N9UC 2IYGA 3OTCA 3PXGa 3OTOJ 2JVOA 1HNWF 2HHUA 2YXLA 5KAKA 1D9DA 1FKPB 1UFLA 3ETMA 2KVQE 5L1LA 2FGOA 4NLWA 4O44B 2XWYA 2AYGA 2JZ5A 2FVSA 3BPDA 3GONA 1RDRA 4LR8A 1WNEA 4Y2KA 2VOPA 1AXQA 4PQAA 3RGIA 1VQ7S 1CULA 2K7KA 2ILZA 2QFIA 1XTZA 1FRLA 3G6ES 2LDIA 1JJHA 1SJQA 2G2YA 2LU2A 3CEDA 4RNFA 3CC7S 3MMBA 4HTIA 3W9HA 3MCNA 4OI1A 4C8MA 3O8WA 2XCPA 2L3MA 3SYZA 4OQJA 1E6YA 4C8ZA 4USHA 1CQMA 3VCDA 3RRHA 2AZ3A 1OQ3A 1WF0A 5EGYA 3MMBB 4F26A 4WP9A 2KXFA 1FERA 4I7FA 3KHRA 1FDAA 2ZOMA 4FYWB 1TUGB 4LF7J 2YWHA 3Q8VA 1RWOB 2GVZA 4EWTA 2L9WA 3OR1A 2ZFHA 1U1NA 2DEIA 2O66A 2K3KA 3S1TA 4LFCJ 2OTJS 3GLJA 1S6OA 2F1FA 3UDLA 3KLEA 2R2SA 1EAYC 2DGSA 3H8YA 2CFXA 2ZC3A 2DCLA 5ETSA 2GO8A 3T5JA 3W65A 2P9GA 3NAIA 4DF8A 3IAS9 3N0VA 4EBCA 1YRUA 1CG2A 2B9XA 1IXKA 5G4DA 3TJ9A 1N32F 2RDDA 1N56A 2I2YA 4P75A 4IFVA 2Z2YB 3FEXB 2DO4A 1EP4A 2MKHA 2Q1LA 3R27A 4ZCKA 3Q8UA 1FA0A 2GQ2A 1FWLA 3NGDA 3JSMA 1RCXB 1DJ0A 4NMLA 5L46A 1S77D 3UDCA 2AP6A 3EDRB 4C6AA 4F0MA 4LF5J 4F2RA 5C24A 5BJRA 1YZ7A 1J5EF 2FDNA 4IRCA 1XNRF 4DN0A 1UVLA 3QWUA 4IQXA 1DLOA 2FLLA 1UAWA 4NPOA 3V4IA 3OTDA 3PIOQ 5CD4A 2JEGA 2UUCF 3AHPA 4L74A 1RAEB 5DM6Q 2VBWA 2KXHA 3QPIA 5AT1B 3TQEA 4A47A 4QWCA 4OHXA 3OLAA 4J9NA 5HROA 3OFGA 1FFWB 1HMVB 1ZM2A 2CA9A 2QJ3A 2GCFA 2QX0A 3BBFA 2MKYA 3FRYA 3R5AA 4ECUA 1S1XB 2ZDPA 2D1CA 2YNGB 2H1YA 3BR8A 3O5TB 2CJQA 3ZZPA 5AJ3J 3K5MA 3R5BA 4C3KA 4OZLA 1RAGB 4DG1B 4LUBA 2C2EA 1NKCA 1K0VA 1BWVA 3W2WA 3PKYA 3QQCD 1SXLA 2APOA 3ET6B 3LANA 1KFSA 1HQ2A 4I6AA 2HFSA 4KGMA 3TA0A 1SL0A 2UXDJ 2Y8YA 2QO3A 9ATCB 4UZBA 2GX8A 1HA1A 4RW4B 3V6DB 3OL7A 4P6QA 1VBXA 2DH8A 1AFIA 2V5HG 4G6VB 4USTA 1JB0C 4H4MA 1R0AB 1ZPVA 1SIZA 1UZDA 3U7JA 3QIDA 3WDOA 2CQ1A 1NJXA 2PI5A 1PC4A 1UMJA 2ZEJA 4NLUA 3NGTA 3IA0A 3SI8A 4FYXB 1RB0A 1JQGA 1RT5A 1ZYQA 2KDOA 1XK8A 5J2NB 3W66A 2HKEA 5GAEU 3W5XA 2BJ8A 4WFAQ 2UUWA 2D3ZA 4DSEA 4LBIA 5BYQA 2BJEA 3LP0A 3NGRA 1KONA 2Z2MA 4X4NA 2WHOA 1NK6A 2AT1B 2MYFA 1YJUA 1BD6A 1GEHA 1KHWA 1RT6A 1U02A 5CYMB 3G86A 4X65F 3KDOA 4NRUA 2KI2A 2QLFB 3ETOA 1H7XA 5HANA 2B0GA 3R6GB 5M2RA 2D9PA 1LEOA 3HFKA 4P71A 4QWBA 5KG5A 5K14A 4JP8A 5GMEA 2YKAA 4LQ9A 1J5OA 1WTBA 4Z2XA 3FKBA 2EXUA 1FVQA 2Q66A 1IQTA 1G6BA 2RUSA 8ATCB 2QLJB 4P73A 1P1TA 3HF5A 2HQ3A 2UU9J 1WWHA 1XMBA 4UZCA 1U1KA 4C8OA 5KFJA 3G6XA 2XEXA 1QD1A 3AOCA 4G1QA 1XIQA 3GJTB 2C2ZB 2FD2A 1U24A 2VBYA 2WONB 3ILIA 1RHJB 4F3QA 4ENOA 4DV0F 2GAGC 4QR0A 1SJ4P 4EO6A 3M9MB 1NK9A 2AU0A 3HSDA 4M5NA 3HFZB 1TAUA 2IM0A 3NMRA 1KQKA 1UVNA 1NJIT 4L6V3 5GAHU 3DI6B 3A8EA 1K73T 2BJDA 5A2QY 2V69A 3ZFVA 3LP1A 1REGX 2B9EA 1N34F 2VKRA 2CADA 3MM6A 5IQQA 3JAMY 4CT8A 4LFCF 5GVQA 1FDNA 3MD3A 3IAM9 3DDKA 3TZYA 1BUXA 3LP1B 4QPTA 2BKOA 4Q5VA 3D3CJ 4OI3A 2J7WA 2GGPA 3US5A 2CPZA 3C16B 4GKJJ 2OPRA 4OZJA 3KJQB 4RNMA 1YBTA 3VVUA 3K5LA 5L1JA 4DR6J 4U96A 3MEKA 2AJ0A 3NWGA 1NHKL 4USVA 5HBMA 5KFAA 4NEYA 4WYWA 3P49B 1KKHA 1GX6A 3DLJA 2A0FB 2FLOA 3E3XA 3G87A 3VAHA 4DFMA 1RLCL 2OUGA 1FDBA 2MSTA 3KLIA 4OYOA 3T6JA 3EZ5A 2ASJA 5B0AA 1KLNA 3MAAA 2QEXS 3TO8A 3MCMA 5KG6A 5D15A 5IFMA 1RWWB 5F8LA 2DGXA 1S9EB 4DX8H 1WKKA 2XMKA 3THPA 4DR5J 3DRRB 4DSKA 4O23A 2BXJA 3GCWP 3M6XA 4R5PB 1J5EJ 2B8QA 4K4YA 3GJRB 2Q43A 5DDRC 1R8HA 2Y1JA 4HKQA 2V4JB 1CLFA 2GAHC 3C8YA 4NLYA 3MM5A 4RPFA 2COLA 3VR1A 1V3RA 4OZ2A 2RRAA 4Q8FA 1YJRA 3K5PA 4PQUA 1JLQB 4ZHRB 4TU8A 3HJVA 3UI3A 1JJ4A 3PKMA 2YNGA 4K0KF 2KU7A 1URRA 3GIKA 3MM8A 2JOQA 4RU9A 3NNHA 2HHPA 3WZ0A 2IC3B 2ADBA 3NLCA 1WHVA 4KRWA 4WP3A 3DYAA 5AJ3F 2XY6A 5E41A 1HWUA 3CCES 1RZMA 4IDKB 5CHCB 4ZOSA 3M8WA 2C3OA 3WBZA 2JC0A 4ZLJA 2OMOA 4LR7A 4ZVPB 2GVDA 7AT1B 2GHVC 4DLEA 2HNDA 1IBLJ 2UUAF 3HT3A 2ACMA 2J6UA 3Q2SC 1HHTP 1KVIA 4NLDA 1S1WA 2Q3PA 5DZ6A 4OJHA 1MSWD 3MEEB 3PEHA 2MLYA 1MU2B 3AT1B 3UD3P 2C2RA 4KFBB 3OUYB 2NXJA 1REVB 1RBLA 3DGPA 2BE9B 1OWXA 5AXNA 3KWMA 4RNHA 4KSEB 2QE5A 1FE0A 4ILRA 1S1UB 4U67Q 3CVKA 3M2VB 4HH0A 4HTJA 4OI6A 4OJGA 4Y34A 4NLGA 2C3YA 4LSLA 1VQOS 4F02A 4K50A 3HDSA 5ITHA 1OIAA 3GE9A 4P2FA 2CQ2A 3H25A 3OW2R 1XBWA 4O3OA 1RGVA 2WVDA 3THTA 2ROEA 2HGNA 1GNKA 1R0CB 1TVRB 1WUUA 4PEOA 5G0RA 1IKYB 3BO4A 4ECXA 1N6QA 5E3RA 2IM3A 3RR7A 4IOBA 4Y0FA 2W9CA 2BQUA 3OV7A 4QCLA 2M52A 1Q5VA 3MTJA 3UWTA 2D3O1 2YNIA 1SIWB 3NL0A 5K8OA 1CS4A 4EEYA 3IS9A 2V9KA 3T9ZA 4OV1A 2HVDA 4NYZA 2R7XA 1Y9OA 1IWGA 2XB2D 1VLYA 1F9EB 5M2PA 3OVBA 1EQ0A 5E3CA 5KFDA 1BLUA 4ANDA 3NMAA 4QU6A 4HI1A 1K47A 2CXEA 4LRDA 2FJXA 4KY3A 1VI7A 4OX6A 4ZJLA 5KFZA 5GAHI 3KKFA 1NZ8A 3IN5A 3TI0A 3DLHA 4J9UE 4HVZA 1KQGB 2BJ3A 2Z56B 1U1PA 4Q7AA 4C8NA 1VIOA 1ZM3A 5C25A 2YX1A 2C42A 4KHMA 1F3VA 2XNQA 2RRNA 2YKNA 4NLOA 4ECSA 1RWMB 3THVA 2ASDA 1SKWA 1H7WA 4F7VA 1N32J 2CQHA 1RT3B 4OYZA 2KT5A 4Y00A 3K57A 4J9RA 5CD4H 1IKWB 2HVEA 5F9LA 1OSDA 4JV2A 1LWFA 4JI3J 3NWRA 1FVSA 3SQGA 2RT3A 3A3PB 4DV7J 1Y3JA 4ED7A 4TKTA 1IN0A 5AXMA 3DLEB 4WF9Q 1NNDA 3BGRB 5F3TA 2N3OA 4QPXA 4AQYJ 1K1QA 3BGOP 2W4PA 4U7UK 1N5QA 2AGQA 4LF8F 4NA3A 3CC2S 2G4BA 2VASA 1IBMJ 1QAIA 4LF4J 4CTAA 2MKIA 2J9CA 2P6SA 3OBIA 4HHUA 4FF3A 4DXLA 3OTEA 2XI2A 4RUCA 2R7QA 2OPRB 4ZVFA 4J9MA 5D3GA 2DGVA 5LSRA 1F5BA 1JNRB 2NUUG 1HQEB 3DLGB 5E3AA 1KR4A 3DYAB 4ER8A 1YQHA 4F4XA 2HIQA 3CTRA 2LQBA 1VDHA 4DBQA 2MQQA 4X4PA 4F3OA 2DCUB 1C0UB 4ZPWR 4DUYJ 1OY8A 4C98A 2HMIB 4LQ3A 4K5SA 1WI6A 2XSFA 3B4DA 1IJFB 4FNHA 2Z8QA 3A8IA 4F0KA 1NK8A 1RT2A 4BDPA 4O3RA 4OL8A 1F60B 1WG5A 2JVRA 1SVDA 5F8GA 5KFCA 4DR4F 1GXTA 2G2ZA 3MM9A 1KQFB 4WFBQ 4H4OA 2R2TA 4RW6A 1SJRA 2DRAA 1C1BA 1RTZA 5DQGA 1PBAA 2W1BA 2XMWA 2ZE2B 2V2KA 3MEGB 1HWIA 2YQ3A 2FIUA 3OD2A 3RBDA 4B9UA 2HURA 1Q79A 1P9YA 2FGCA 1U45A 4M94A 4LFAF 2UXCF 4Q45A 2V4JA 2BJ1A 4USMA 4CP5A 2CNKB 3DMJA 4NI2A 1S6QB 2R8JA 4FPRA 2BKNA 1L3SA 1S1UA 2CNNB 2EPIA 4ED0A 1MWQA 1YZ6A 4CRJA 4XK8C 4X65J 2UUAJ 3B6BA 4TY8B 2ZJPQ 3DOMB 5JVGQ 4LF9J 3KNAA 2ZKUA 3C16A 3SBMA 2AW0A 2P8IA 2YTCA 1Q8BA 4JV1A 2RQKA 1RU2A 1CJTA 3CDAA 3LGHA 5DZ7A 3HK2A 2BOPA 2H3EB 1R27B 3GFZA 2HPUA 1V3ZA 1QAYA 3MM6B 5CYJA 2OD6A 2GVDB 1F2GA 2XLJA 3IBFB 2E66A 4PYAA 4OJ3A 2XY5A 3ZZTA 4TU7A 3IM9A 2MQOA 2JLFA 1HARA 1UEVA 2A3JA 2FJEB 1KTVA 2IM2A 1APSA 2LA6A 3UE2A 3WHIA 3QGIA 5C42A 1RYRA 3PEJA 1RT5B 1WC3A 5JMNA 1YBUA 4R25A 2DGTA 2NXNA 2KL8A 1HWKA 1R89A 3BYPA 1FD8A 2V8DA 1FX4A 4U95A 5GADI 5L1KA 2OAUA 2VICA 1NO8A 1Q5YA 1RT1B 3EVOA 4ZK7M 3QJPA 3HKWA 5DG9A 1JNZB 3K8WA 3MEGA 2MZSA 5ADZA 1H73A 4V19X 2N3LA 2R7OA 4ZJOA 3KJVA 2ATLA 1WSRA 1P9QC 3KG0A 1JLBA 3PNIA 4LBPA 1O8BA 1GAOA 3H20A 3I0SB 3LOUA 2QLWA 4OZ1A 4PG4A 1AA1B 2HQIA 2ZZMA 4FXVA 3PJ9A 2HMIA 4GVLA 1C4CA 1MN9A 3OHBA 1HW9A 1OJ4A 2B51A 2KTQA 2CPHA 3RG6A 2VKZG 1ZM4A 2C2OB 2XQCA 4F8RA 1UTAA 2E5LJ 3PYDA 1TR0A 4KE5A 4QZVB 4QIGA 3TOQA 3H40A 1XWLA 4IR1A 1B0TA 4RZRA 1VMBA 4AD6A 2CJXB 2HNZA 2YWKA 4Y28C 4USJC 4YN3B 2EFPA 4UTGA 5F0UA 4GRSA 1FKAF 5K14B 4PKDB 3UD4P 2IAJB 1M5OC 3CUNA 2VOOA 1OY9A 3DDNA 2HHXA 2DNZA 5B0CA 3L9ZA 5H9EJ 2J8AA 4PUOB 3N6LA 4Z7CA 4DR7F 3SXLA 4OLPA 1LWCA 3I82A 2FVQA 3A12A 5D0RA 1Y11A 4IG3A 1WD6A 1X31C 1WKLA 4DPTA 3IXQA 3RBEA 4KC5A 4NXMJ 2K7JA 2OI2A 2LEPA 3G9CA 2CDQA 4UQTA 5J1EB 2ZE2A 2FLNA 3S7RA 5H1SV 2OJ3A 4TLQA 1REVA 3PIPQ 3CXCR 2EI5A 1LV5A 1Z4UA 4FF4A 2ZHBA 2IRUA 2YWGA 2WCXA 1BWEA 5DS7A 2NSCA 2L9DA 3IWNC 5CZXA 2V94A 4URGA 1S48A 2DKOB 5JVHQ 5J2MB 4DV3F 1U1MA 3PM9A 2UXBJ 1C0UA 3D67A 4N77A 1IBCB 1O6XA 1TV6B 5KFEA 1XR5A 2YNFA 1UJ6A 4C0BA 4ZIWA 1HNZJ 3CC4S 2B9WA 3CDBA 5IZHA 2IA0A 3BN4A 3MECB 2W2OP 4NLTA 2VPYB 3J7AN 3CF5Q 1IR1A 2YNIB 2HWHA 3CCZA 1SH2A 5IV3A 1T05B 3CD6S 1YLXA 2DR9A 3JTPA 4J91A 5KT7A 3D4JA 4RW8B 2XO6A 1OPZA 4OZ5A 4DPYA 1HNIA 3M32B 1S49A 2V63A 4NEZA 4DZDA 1VQ6S 1Y0HA 4U7CA 4ED1A 2A10A 2RKIA 3LGMA 3MMAB 3M7VA 2B56A 3H98A 4OHWA 2LU1A 1BY9A 4NLRA 4WU2A 3UN2A 4RLEA 2KM8C 4ED6A 5CXTA 4ELTA 1HFEL 1OYDA 3NNAA 1IKXA 3PRDA 1TVRA 3ILLA 4FZVA 4QIFA 1JLAA 1PYOB 3FEZA 2MGZA 3MDFA 4KR0B 2PFDA 1MLAA 4R8UA 4K4SA 3P3DA 3SQGB 3MR6A 2DB1A 1L5UA 4PAAA 1FFSB 2J6SA 4A4JA 2Y0BB 2AV5A 1GT8A 5HBMB 5HJYA 1HBUA 4FNIA 2CRLA 2CIMA 3GCXP 2P6TA 5E33A 4CH0S 4CM0A 1RAHB 2WOMB 3FGVA 4O3NA 3CMQA 1W25A 2VH7A 3ENVA 4MKAA 2EC0A 2MZ1A 3L4BC 2V4QA 2HVZA 5HO4A 4YMEA 2XNRA 1X4FA 2FHKA 3CJ4A 2XMTA 5AE1A 1C2PA 2LDYA 4KT0C 2OSQA 2FHMA 4HR2A 3HP6A 1N5YA 1PAEX 2G13A 2GVZB 2O67A 2JSXA 2RAQA 4M8LA 3R2CJ 1CJUB 2DR5A 4ZPAA 4QWEA 1GH8A 2LYVA 5DO2A 3TJAA 3CD7A 1DFDA 1NH7A 1SH3A 2F7VA 4URSA 3KLHA 4LSNA 2G1DA 4UT4A 2D7SA 1ZBTA 5K5MA 1IUJA 3BGUA 4P2MA 5I3PA 3IG1B 1NSPA 3MWBA 2IC3A 3DRYA 2AEFA 3D1HA 2XI3A 3JQMA 4QOTA 5KFTA 4XPCA 1N4LA 1BGXT 2E29A 1FDDA 1IKYA 2XGPA 1TV6A 1N36F 2XHCA 2KZMA 3RTVA 4LJMA 2PC6A 1RI7A 2RB7A 1EETB 3AODA 4PXDA 1WACA 3N4WA 5KFUA 2HG4A 1X7VA 1RWUA 2CPEA 3A4TA 3BB5A 4J9VA 2NXUA 3SZ2A 3T1HJ 3HHLB 4L72B 1RHMB 3QBCA 1RJJA 2OEMA 2BEFA 3UDEA 2DNNA 2IVFB 5BYSA 4O44A 4USUA 3HHLD 3CMES 4J37A 4AL7A 1UJ4A 2DNHA 1T9XA 3JYTA 1QM9A 2GGPB 3JS9A 1S76D 5DLFA 2DRBA 4IG3B 5KT3A 2D3UA 3QRPA 1MMLA 2V9WA 3TJ8A 1VR6A 4KKOA 1ZA2B 4RBVA 2CVEA 4NZ7A 3HVTA 2VPWB 3FFIB 4C3LA 4LR9A 1CEZA 1RT4A 4J5OA 3SFUA 4ATNA 1FEHA 2RMLA 3QAUA 3VGUA 4PABA 5C42B 5KOWA 2M2BA 1FJEB 2K8GA 2DY9A 5A76A 3A3OB 2V34A 3SSQA 2BM1A 1X5TA 2VPXB 2R7SA 4IG0A 2ZH1A 3QSIA 1RHKB 5K8MA 1K0TA 2BR0A 4DX7A 2JDJA 3UCZP 4RO0A 2FY8A 4LIRA 2R2RA 2M70A 4N8NA 3RAXA 3SMZA 3BM7A 1LFWA 1WDDA 4C0HA 1VQYA 5F9NA 1U09A 1YRXA 1PO6A 3TZXA 2ZNYA 1U25A 3BSOA 4EMDA 1IBKJ 1UVIA 4KGZB 3J7ZT 4K4UA 2J0XA 3TUJC 1Z1ZA 4F4WA 3PW0A 3BQ2A 5HMWA 1S1TA 4NZ0A 2G0IA 2QV6A 3O6QA 4DV3J 4IOCQ 5A6PA 3K59A 4I6YA 5DM7Q 3W5YA 2XMAA 2MDAA 1NHUA 4ZPBA 4QW9A 1VBYA 2IJNA 4G1PA 1GMVA 1N48A 3GYXB 3Q8RB 1H2TZ 4YQWA 3DLBA 1RT1A 3CDWA 4GO7X 4JI4J 1NM2A 1UETA 3GYNA 2KT3A 2GQQA 3FCHA 3N79A 3GFHA 1WSVA 4ILLA 4A8QA 2J76E 1T9VA 2CAJA 4XO0A 1B0PA 3KK1B 3AH6A 3D66A 1UWAA 4ZITA 3KFWX 1KWMA 4CLWA 1VQMS 1U6BA 4LF7F 1OYEA 2HLTA 4IH6A 4DPOA 1DLOB 1SJ3P 1HNXF 2HHHF 2CG4A 3GB0A 2CQBA 3ZZUA 2R9LA 4CLYA 2C3PA 5CZVA 1WOPA 1W2IA 3HVTB 4TNOA 1NPPA 3CWJA 3GU0A 2W8KA 4ECQA 4JI6J 1SC6A 3BSCA 3QO9A 1R31A 1NSKL 2POKA 1T03B 4F4KA 1VRQC 3P96A 1YWXA 4CYUA 3HHEA 1MMNA 3LPYA 2R42A 4WFZA 3Q8SB 4YR0A 3FFIA 1JLFA 4J9KA 1T9YA 1NK0A 1JLCB 2FVRA 2YQ0A 1M90T 2H5IB 1VJQA 1JLEA 2JC1A 2QLXA 2RH3A 3QNWB 1VLOA 2PD1A 1EETA 3MXHP 2OGUA 4DDFA 2RHQB 3IRXA 1CJKB 4PG8A 4PWDA 2A2DA 4CO2A 1C0TB 3D2WA 1FCAA 2DR6A 1AUSL 1HI0P 1O0PA 3NCQA 1XC9A 1R0BG 2F63A 2HVHA 4YDXA 4R0EA 2I6WA 3KJVB 1UZHA 1YITS 3DOLA 4ZVSB 3K89A 2JEFA 1Z2LA 4FDFA 4RBTA 2ALZA 1T7PA 4OYIA 4JI7J 1VFJA 3C6UB 2IJFA 2KYXA 3GJQB 1NDKA 3HSZA 2WVBA 3GIJA 2XSJA 3M8SA 3OFEA 1SC1B 4FBTA 1S6UA 4M5IA 4DV5J 3TARA 1N36J 2DR7A 4QU7A 3MD1A 3H4DA 3BREA 1TFWA 4USKA 1L3KA 4NYOA 3RYLA 4CO3A 2DVIA 1T9WA 1HNZF 4M5LA 2NPIA 1C1CA 2XZDB 3AJ1A 3K5NA 4M5DB 1RAAB 3OFHA 3W2VA 1F5AA 3DGVA 3HCXA 1L3VA 1CJUA 3VAKA 4C8KA 1RBAA 4NXMF 4K4XA 1CBKA 1IR2A 4OX9J 2VFRA 3C14B 3GFYA 3J81Y 2AKWB 3HVAA 1RWVB 3EJMA 4OYPA 4F4AA 3JSMB 4OZNA 3W9IA 2VPZB 2AMCB 3GV5B 2C28A 3Q8YA 4JV5J 2JHEA 2JWNA 5L38A 4MIWA 2FVCA 2VG6A 3G8QA 4EK2A 5SZTA 4LF6F 2DNMA 4LT6A 5DDPC 4YB7A 2HNYB 4MK8A 3ZTRA 1NB2A 4D3GA 3PW4A 1HBUB 1VQPS 3UR3C 3GG0A 3MEDB 4MK7A 2C2KB 4ZVTB 3L09A 5LM7E 5K20B 3QWPA 4YR2A 1XMOJ 1U6ZA 4PCQA 1ZZFA 2NYIA 5E2QA 3GSIA 5A0YA 4K7QA 3LGNA 2OTLS 3F44A 3TW0A 4KHRA 3BDEA 3QYYA 1MW7A 1TK0A 2OEKA 1N5VA 3A8JA 3M30B 3U27A 4I2QB 3W60A 3FCVA 4XAKA 1HYSB 2J9DE 3AQPA 4RW6B 4TQRA 1QSLA 1FT8A 4CCHA 5IC4B 2DNLA 1H98A 3KG4A 4R0JA 5EWEA 1SJFA 1D9FA 5IWAJ 1GQEA 3M2UB 1RHUB 1QE1B 3ISND 4JI2F 4X64F 3QIPB 4LSNB 3J80U 4JI8J 3V2UC 1HIYA 3V6HA 4TYBA 1FKOB 2RD5C 2ZUGA 4A46A 1FX2A 2AJQA 5IT9U 1ZAWA 2B7BB 2HS4A 4IFYB 4FVMA 2C2DA 1VQ4S 1EZZB 1AZSA 4NLPA 4JI2J 2KZZA 1T0TV 4X84A 3HULA 2AGOA 3KLGB 1SKRA 4C9DA 3TUPA 4PG5A 4JI0J 3PRBA 1JKHB 2ZBCA 3P5BP 2M4MA 1M1KT 1URNA 1I94J 3BN7A 2DNRA 3M6VA 3B8HA 3RRKA 5H9FK 3DRSB 4CWBA 3UNGC 1KRPA 3IR7B 2AJ4A 3D7SB 1UEUA 2OPSB 2ZC4A 1F2HA 5F8MA 2CPJA 2KVIA 5KOXA 3CMAS 3C6TB 1FK9B 1U2RA 2Q79A 4UOHA 4ETXA 4R8UB 1CJVB 3T1AA 1M5HA 5K8NA 4R5PA 4DF4A 1RTIB 3H4BA 2J7UA 3EX7B 1Q8IA 5J2QA 1DZ5A 2HHHJ 2IAJA 2HIYA 2M9KA 1KHVA 4MYUA 1RAFB 2JJ4D 5IT0A 3PJWA 1GMUA 1RU1A 4C7QA 2MY7A 2GHPA 1NDLA 3EGWB 3L95X 1B70B 1MU2A 3HVRA 4I69A 1H2UX 1I51B 1XR7A 2GV1A 1GXUA 3W61A 1JLCA 2YX7A 1FE4A 1VK3A 2VG5A 3UNYA 1HLWA 4UY85 1TKXA 3ZZ0A 3BSNA 3E51A 4DHVA 2GMHA 1G1XA 3CCVS 2WB4A 2XC9A 1KOOA 1TL4A 1MWYA 4S0MA 3QGHA 5D4OA 4CLZA 2MJUA 4NI2B 1XMQJ 2CWXA 1LW2B 2VG7A 2OFGX 2BANA 2BRLA 3BGFA 1MWZA 1NPKA 2AWZA 3PW2A 1FWKA 2PEBA 3LH2S 4V1Ak 3VZHA 1SKSA 4RBUA 1UEKA 1K8AT 4KIAA 3Q83A 3G82A 3J7Z5 4HLBA 2Q6CA 4OZ3A 2WVEA 2VUGA 4KHPF 4DQPA 4WE1A 3NEKA 2G1HA 4IH7A 2JH3A 5T7LA 5KG4A 2KG0A 3CIMA 4K0KJ 2WB1D 4FF2A 4P10A 4MAKA 4ZVEA 4KAIA 2E9TA 2BDPA 4J9PA 2W9BA 6FD1A 4QIWD 5H9EK 2HAIA 2QA4G 4KHPJ 1YRTA 1SCJB 2F8HA 2W7AA 2KM8B 2DHAA 4EYIB 4ZPCA 4LSLB 1Q8KA 5CYQB 4PUOA 2IRYA 4B9NA 4OYBA 2QL7B 1YK9A 4X4VA 2V8VA 2Z0GA 4HACA 4TXSA 3ZO7A 3M4XA 3FZ2A 4C11A 2DR8A 4JI1J 1LQ9A 2ZM6F 4EZ9A 3E01A 1YGYA 5F0WA 2M5YA 2YWEA 1RT4B 3M9OB 1EQMA 2EG1A 2KN4A 3IR5B 4C11B 1GX5A 4MFBA 2BJ9A 1EHWA 1VCTA 5L9NA 1ZAXA 4IRKA 5ETOA 1WJ9A 5RUBA 1HKAA 2DRDA 2XWXA 3KMSA 2RDJA 3BDPA 2UUCJ 2X1BA 3ITHB 4MJKA 3Q2TC 2AYBA 3CJ8A 4KV8B 1U1OA 3JSYA 3QSYB 1QY7A 1T9UA 4J9OA 3BQ0A 4B9LA 3I96A 2EEYA 5JUMA 3CSKA 3OL9A 2IYIA 2K1RB 3B4MA 3D0GE 1H6KX 2CNLB 1VC6A 2UZAA 4AFFA 2A18A 1Q81T 2FPHX 4HDGA 4DL6A 2I38A 1M5VC 3C15B 4IUFA 4O3PA 2H5EA 2P9EA 3MM8B 1LFPA 1R3NA 4ED3A 4P2XA 3EE3A 4WXWA 4ZLLA 2CQPA 2DT9A 2X3GA 3DRSA 1M5PC 3B82A 1MN7A 4HT5A 1N5TA 1DBDA 1S1VA 1S7HA 4ID5B 5KG7A 3EVWA 2KB2A 5MLCV 5GAGI 1ZETA 3MCSA 1HHSA 5E5NA 3DCAA 3NAHA 1IJEB 2DXFA 3LUYA 5DJBA 5J1NA 4DMZA 3V81A 4F4YA 3R1LA 1Y4ZB 1HQUA 4B9SA 1KTQA 1DURA 3MUMP 3D54A 4OYWA 3Q86A 3CD5A 4JI6F 5EHHA 2F5GA 4BCAA 4NA2A 5HAOA 4OX9F 3IBCB 2IBKA 2LQ8A 3CNQP 1S1XA 3ZTPA 5L39A 1PGZA 1JLGA 4LFBF 3V6KA 3G2XA 2V8HA 2YX4A 1CJTB 2EKNA 5K8PA 3MR3A 1F9FA 1HPZB 5KG3A 4CO5A 1LWEA 1WC0A 4ZN1A 3HVWA 3KMQA 3W3SA 3LP0B 1QTMA 1H3DA 1RA6A 3EYZA 2EFQA 1FFGB 2EWHA 2ILYA 3M30A 5HLFA 4NL5A 5HSPA 1XNQJ 2F8MA 2ZVIA 2HQCA 5GADU 2CKWA 4AE5A 1R6YA 1RKIA 1RK8A 1FI4A 2ZJRQ 3OSNA 2MQNA 2RF2B 3TZZA 2JLGA 1IVZA 3D5MA 3QJLA 2ZH6A 2CYYA 2XG8A 1RTJA 2PO4A 4DV2F 1S6PA 5A8KA 3EPIA 1Q8LA 3EMTA 4IQMA 3KTQA 1XN9A 1AB8A 4QYZJ 3VALA 1RTDA 3I56S 1C1BB 2O5DA 5LMUJ 1ZTTA 1TKZB 4ETZA 4WKRA 1SQEA 4DSFA 2X1GA 1Z2ZA 1RTHB 2BVZA 3SFGA 2LA4A 4DFKA 2H9ZA 3A13A 1B64A 3CJRA 1S79A 1DARA 2W2MP 3CIZA 5AXLA 4KO0B 1JJCB 3W2WB 4WWSA 2XBPA 4XPEA 3H5SA 3CJKB 4G1QB 4CT9A 4CO0A 4F0HA 5DDOC 1EARA 1KN6A 2OP5A 2BANB 2RVJA 3ZC4A 1JKHA 3CCQS 4OI0A 2H48B 2N7YA 3SDEB 3W5ZA 4K2JA 4EI2A 4ZP6A 3G96A 4B9VA 3AOBA 3BKFA 4KJIA 2C3UA 1HBOA 3LQVA 2WBMA 4ZCMA 2FJVA 2AEJA 2OKQA 2YNFB 2FZCB 3DOKA 3ZTQA 2OPPA 4Q0BA 5EDWA 4DFPA 3QRRA 5D0EA 3SQOP 4ZCLA 4YR3A 3QIPA 3W8GA 3VAGA 1H0HB 3KLFB 4MKBA 1PAUB 2ZBIA 4XDDA 2EVZA 1B3TA 1F9HA 2XMMA 3FSIA 2FC9A 1X4DA 4O4RA 3TNVA 2MSSA 2Y9HA 1HNVA 1RISA 2ZNZA 4M5KA 4AQYF 2HK2A 5G0RB 2HNYA 5E3QA 3I32A 4LFAJ 3NGKA 3TEGA 5BXIA 5J2QB 1EIYB 2PDAA 3PACA 4ES1A 4TQSA 2JNJA 3N5FA 4U6PA 5KFSA 3M8RA 3C6TA 1DHMA 2DYAA 3SEOA 1QSYA 1QVFR 2QYCA 3U1LA 3M8QA 2MPUA 2MQ8A 3R6LB 1FXRA 1XERA 5ETLA 1VQKS 2HHVA 2QA1A 5KT5A 2VQFF 2MZRA 4TN2A 2J8SA 2M8HA 1IBMF 4W90B 1UW4A 4RW9A 5J1EA 4UQGA 4NE9C 1NAQA 3DRXA 4USWA 3KLEB 3AB2B 4IRDA 1CSJA 1UPPA 3CJ0A 2HRUA 1SI9A 1VQLS 2GS8A 5HVHA 2ZWPA 1AZSB 1DQAA 2VJUA 4NOHA 3PZPA 2D74B 2YPYA 3H2VE 2XSJB 4PWUA 4NASA 1NSQA 4AL5A 4BBYA 2E7WA 2F4VJ 4LMZA 5GAGU 1S97A 3ZZYA 5KFMA 2GC8A 2IDEA 2B4PA 3I4HX 3S01A 2VV5A 1PG5B 2RSQA 3I0SA 5D77A 1R8PA 2QMWA 1BE4A 1HD0A 3LO3A 3G6YA 1CC7A 4I1TA 2DNYA 1W7WA 4CM2A 1U4BA 1KNZA 1YJ9S 2Z2LA 3D6HB 1PJ7A 4NXNJ 4I6WA 1V3SA 1UA0A 2JX2A 1WDTA 2DNGA 4FKXA 5KFBA 4RJVA 3HLUA 1Q7YT 1RYSA 1HR0J 2F40A 2RDIA 2HSEB 1U26A 3K5OA 2HZVA 4MK9A 1D8YA 2ADCA 2HRTA 2Z57B 4ZPTR 3T19A 4LRCA 1VC5A 1D09B 4ICLA 3CCLS 3AJ2A 4HHJA 4M95A 4XIUA 1HBNB 4ZLPA 4CH1A 1YKWA 1OMSA 3PW5A 1JLFB 1EKSA 2RIJA 4IFVB 1SV5B 3F41A 3VZIA 4MIBA 5B0GA 3ITHA 1I6JA 3CO0P 1ROFA 1SL1A 2B8PA 4I56A 4RX6A 1S6PB 3MFIA 3PHTA 2E1RA 5ETNA 5ETVA 1GMWD 1VHFA 5LMNF 1IKVB 2DTJA 3N01A 6AT1B 3H5YA 3RJMB 4HDHA 2BMBA 2HNDB 4NMXA 2VQEF 1YTYA 3MPWA 2AQ4A 4IG0B 3TAMA 1XMQF 2ZD1B 4E0DA 1C4AA 4CO1A 2XS2A 3KK3A 2MKSA 3MMCB 4ZVQB 2H5JB 2R7VA 1X4EA 4HACB 3T9NA 3V81B 1A6LA 4Z37A 4WTYA 1JK9B 1KOHA 2W9BB 3FCWA 3A3NB 5IM0A 3VTIA 1F5CA 2BUNA 3UVJB 3BPSP 4ED2A 3PX0A 2LEAA 3HD1A 3MAHA 4Q2LA 4MYTA 1TL5A 4YS2A 4B3RJ 1HD1A 2WTFA 2RRBA 5A8RA 2RUGA 1N5SA 2DNOA 2KHCA 5A2QU 3KK1A 3OXLA 1B7YB 3JTNA 4H4MB 4MTPA 4PQUB 4EUVA 1VYAA 3FDSA 2HWTA 2PMWA 4DOZA 2SXLA 4WE1B 3PO4A 3IM8A 3RB4A 5KFOA 3MR7A 2XMVA 2IY5B 3LP2B 2IPOB 2V2ZA 2V68A 3P4UB 5HMZA 1YIJS 3KOAA 3HHLA 4YUDA 1HL6A 5THWA 1FD2A 4I2PB 1BC6A 4DCOB 3MAAB 5IC6B 5C5JA 2C2MB 2JRSA 1F3FA 2FJBB 3ZZZA 4YHHF 3M6UA 3AA9A 4JV5F 4WZMA 2BRKA 2NQPA 5IT9Y 2ZM6J 2HS3A 2V8GA 4DV7F 1RADB 1FNOA 4WK1A 2IDLA 4DR5F 3NKYA 2UUBJ 4B3TF 3K17A 2OFHX 1TL3B 2CG8A 5ETQA 4OHZA 4ECZA 2VFTA 4D3HA 1B0VA 1NU4A 4PWWA 4BWJA 4EYHB 3NNCA 2LKZA 4L75A 4X66J 4CTAB 4QYZK 3E8OA 2NCKL 1Q53A 2BM0A 1FESA 1T02A 5U47A 4LVOP 5IQ6A 2YKQA 5FLXU 1SL2A 4IYQA 5GMKa 5I3UA 5LSOA 1WTFA 4UUWA 2FVPA 1XNRJ 5KT2A 3R2DJ 1N5YB 1WKJA 2XULA 1RKJA 5D0GA 3PJXA 4ELUA 5FDLB 3M8YA 4O4GB 3CCRS 5AXKA 3H5UA 5DQHA 4LSZB 3KK3B 5KFVA 3EICA 3FUYA 2FZKB 3DI6A 5KFHA 4KH0B 4LIWA 2E7XA 2QC3A 3PY8A 2CQ0A 1SUQA 1SKUB 1UJ5A 1Y00A 2PA8D 4HEA9 3NS5A 5DGAA 2KRRA 4MMOA 4P72A 4NZ6A 1PC5A 3RB6A 3SV3A 3D0IE 1WG1A 1YI2S 2E1AA 4KTQA 2ROPA 4LF4F 4DS4A 2E9ZA 2KKHA 3VV2B 3HSJA 5HJXA 4A8OA 4LF6J 1SH0A 3ULHA 4F36A 1PYTA 1PIEA 1VRTB 3AXKA 3JTOA 2AJFE 3OFFA 1HW8A 4OV6A 1WOOA 2KFYA 1RT3A 3AD8C 2NZCA 5LOQA 2F8EX 1D0EA 4WPAA 4FS1A 3N6NA 2VBXA 4IKAA 3I4PA 5B7WA 3C46A 2EK6A 5J1PA 3GILA 2HHQA 4PG7A 2R3VA 4DUTA 3DOKB 4ED5A 3D3BJ 4IH5A 3CPWR 1CS4B 1SJ1A 2YKOA 3FBCA 5C24B 1TKTB 4QR2A 1KP6A 2VFUA 1VQ9S 5LT5A 2O01C 4B02A 2B4OA 5KFLA 4P7VA 4YOEA 1B4SA 3D6MB 3HKZD 5L9XA 2CQGA 3WIVA 1FRMA 1NMEB 1PSDA 5KFNA 1U7LA 4YFUA 2YH1A 2XY7A 1QAJA 3I5CA 3UN5A 3BQ1A 1S9FA 2DNKA 4CLFA 2X3DA 2LECA 2BW2A 3I87A 4KKOB 2J6TA 4I0WA 2HHTA 1RTHA 2MGZB 5EUHA 2W7PA 3PX6A 3NOCA 2IIHA 3GZ7A 2ZDOA 4C3MA 4CNZA 1XMOF 3LALA 3K2YA 2ZBRA 3CJ5A 3OXFA 1E6VB 2QIFA 2YPZA 4DFJA 1RWKB 5BR8F 1N6QB 3BGRA 4RKUC 3LA0A 4NRTA 4ECVA 2CVIA 2DBBA 5SUHA 1FXLA 5B0BA 3SSSA 4ANEA 2RQMA 1YBAA 2OO4A 4IFYA 4Q44A 2L48A 2ZHAA 2NREA 2EC2A 3E2EA 3VVTA 1K44A 4DG1A 4M5JA 1WC6A 3TEHB 3MMJA 1X0PA 4ILMA 1ITPA 3TUZC 1QUPA 4DPUA 1HNIB 2KJVA 1IKXB 3M32A 1E6YB 1O5JA 5GMDA 3PO5A 4MT1A 4X4TA 5F8HA 4AXIA 3MOJB 2FC8A 4ANCA 1Q4RA 2YWWA 2RQ4A 2LFVA 4EFAC 4ES3A 1YJNS 4W92B 5KFFA 2WAQD 2OD4A 1S1WB 3NGUA 3SCJE 2CJKA 3SDEA 1TP7A 2DO0A 4RW8A 2H4WB 2WK4A 4JI1F 4ZVUB 2GJIA 2IBOA 3DKDA 3GTYX 3K58A 1RCOB 4IO1A 5D0HA 4OYAA 1SC4B 3HPOA 5J2MA 1NKEA 3BEGB 3TX0A 1RP5A 3DC2A 3T41A 1BQNB 4DL0C 1P8GA 3GJSB 2XGQA 3LF0A 3MR2A 1B7FA 1WORA 2LP4A 3DM2B 4FN5A 3D0HE 1YSJA 1FRJA 1NDPA 2WW4A 3BF4A 3I9V9 1PKUA 4HYKA 1SQGA 4DL7A 4JI4F 1TFYA 2MTLA 3R5DA 2KHDA 5HI7A 2B7CB 5C2CA 2NYHA 5DLGA 3KLVA 4RU2A 4OHVA 4LF5F 2GIRA 3EGZA 3J81U 5KT4A 1QVGR 3HHLC 2LXUA 2CJBA 4QQBA 1WELA 2EFVA 2X7IA 3DRRA 3CD0A 4GKKF 2WBRA 4DR4J 4ZVOB 1GTEA 1VGYA 3EXCX 5DG7A 1LXJA 1ZS6A 1S5ZA 4WP8A 5IOLA 4X4QA 2XO7A 4DX6A 1EKRA 2C3MA 2H54B 1Y10A 2I5JA 4K4WA 1TKDA 3BH6B 2RF2A 2ZBQA 1VQSA 4RUHA 5I3UB 3G8SA 2ACYA 2CPDA 3UFCX 1U1RA 5HVGA 4ZVRB 4DR3F 2LLZA 1S99A 2DPIA 1RUSA 3SCKE 1V6HA 3BKUA 3ICLA 4P74A 3TVYA 3W62A 3AB4B 3DOLB 3J7YI 1NEEA 1T05A 1S0OA 2HNZB 3VGVA 1OPIA 1RWNB 2Z30B 5LXRA 4DPWA 4DR3J 3BSAA 2MLXA 5K9FA 3JQKA 2IHR1 1DY3A 4ZLNA 4IR9A 3ZTOA 3UN3A 1UVJA 5MAOA 4LFBJ 2GJFA 3QZ7A 1RAOA 1X4AA 4XTTA 4AUKA 1N33J 4QJVA 2C1EB 3WC2A 1LWXA 1FKPA 2BBEA 2CZ4A 2CJYB 4QWAA 1JXLA 3DLLQ 2P5VA 3HHNB 1Y5IB 2BJ7A 2IMWP 4FBUA 2VA2A 2AD9A 3BBCA 3C19A 2LVWA 1RE1B 3FBFA 3GIRA 4H4OB 3ZZRA 4CLUA 3KUGA 1SQFA 1N33F 2PN6A 4KPYA 3IWXA 2FTRA 1U8WA 2QRRA 4C4WA 5HL7Q 2IA6A 1FRIA 1PJ6A 2F65A 5IXUA 4UW2A 1HNXJ 4ID8A 4QIEA 1NDCA 5FDLA 5B0FA 4ZKAA 3NS7B 1LWCB 3SCIE 1QDUB 4NX9A 4A8YA 1FO1A 5CYMA 1BQMA 1XEZA 2E7VA 1UFKA 4PXBA 3ZNUA 3OQ2A 8RUCA 3CT9A 1RHQB 3GP9A 5F41A 3RW7A 3WQPA 5A8WB 4K5RA 1U8SA 1OQ6A 1LK7A 1M0SA 3QT6A 3OL6A 4ECYA 5D3GB 4ZJQA 4W4MA 3RZAA 4JI5J 1TU0B 3BZQA 3O2IA 3MOZA 2DH9A 1M5KC 4ERDA 4RUAA 3BV8A 2FJDB 2ZH4A 3O44A 4PPDA 1TQLA 3OXGA 4LREA 3SCLE 5CA5A 4NCBA 1P6TA 3NGSA 2PSZA 4NA1A 4A8XA 1X5SA 3LAMA 3T1YJ 4FPIA 1NBEB 4NCGA 4F3MA 4X66F 3D6FB 4FXDA 2XCAA 3MR5A 2F3JA 5CQGA 2EFGA 4F4ZA 5LJ5Y 4WZQA 4L3KA 1DTQB 1D9AA 3TA1A 3P8BB 1CJVA 4CLTA 2CQIA 1VQNS 1NUEA 1NJZA 1QJHA 3MM9B 2W24A 3DU5A 4ICLB 4WFXA 3KJNB 4H4KC 1R8AA 1T11A 3TZWA 3VHQA 2EBGA 2L41A 3FBBA 5HQMA 2VDHA 3BR9A 2FJAB 2GMJA 2EFOA 1X4CA 1ZOTA 3M8PA 3T1HF 5DGBA 2DHXA 2M8DB 2HGLA 4N47A 1S72S 4DV4J 4ZVGA 4C2MA 2QSFA 4I4BA 5IM0B 4DEZA 3L3CA 3HD2A 2NR0A 1LW2A 2J5AA 4KV8A 4JI8F 4K4TA 4X64J 2AGPA 4V19J 4DZ6A 5J2PB 3QT8A 2CPXA 2N7CA 1TUVA 1DAXA 2AEMA 6FDRA 2DD8S 5LSLA 2HS0A 3Q24A 4KGXB 1TK8A 1A0OB 3ISNC 2E1CA 3MURP 4DV4F 2DGWA 3TAMB 4FP9A 2R8KA 7FD1A 4DU8A 3UQSA 2OSRA 1EJ7L 3D28A 2CPIA 4OMFG 4ECTA 1RWPB 5D4NA 3CULA 2R2UA 2DNPA 3R5CA 2D69A 2M0GB 1X9WA 4W98A 3X3UA 4AL6A 3QRQA 2QGFB 1TMJA 2CUYA 2D41A 2G0JA 3W9JA 1ICEB 1FF2A 4E2FB 4YB1P 3N28A 1JJ2R 4DL4A 3FMWA 1QLNA 4X62J 3KHHA 1SBRA 3QGGA 2H51B 4WK3A 2OPQA 3N6MA 5KFRA 1RTDB 3TYTA 1VC0A 1X5OA 3MHYA 2YH0A 5CYQA 3OR2A 1RTJB 4FYYB 4WBFA 2O1PA 5KFWA 4M5MA 4M1KA 4JV0A 3LWMA 2V2QA 1CPZA 1LWFB 1MMDA 1QTNB 1IQZA 2R7WA 3FMBA 3OPKA 1AUDA 4B3OB 4FYVB 3GIMA 2ERRA 3DLEA 3HZGA 1LWEB 2YKMB 4KPCA 4RWWA 3KHGA 2YY3A 2QA2A 3PHEA 2ZUAA 3OUYA 3PVXA 3NY0A 3W1YC 2ZH8A 3G82B 3T6BA 4DL3A 1RHRB 4KB7A 3CDEA 4YB6A 4UOGA 2W2PP 5F8JA 3IFEA 3RAQA 2BQRA 4K8RA 4E98A 4DV0J 3TANA 3IR6B 2DNQA 4OFZA 4M5DA 3W2VB 1SC3B 2BX6A 2XHWA 4WFYA 3BO2A 3DM2A 2XLIA 3FZBA 3R7NB 3BGLA 4N76A 2ZZNA 2ABYA 2I8EA 1NK5A 4AT1B 3LTOA 1H72C 1WC5A 3R1HA 1H74A 1M1HA 2BV3A 3DLGA 3U1NA 3GV8B 3M2RA 1TL7B 1HMVA 1V5IB 2MQMA 1JIHA 5FIIA 3M9NB 2AZ1A 1DTTB 3DFEA 1WC4A 4U8YA 3PR5B 5A6WA 4LF9F 5DDQC 3VAJA 4OYXA 1S1VB 5ETPA 1U0HB 2VQEJ 4O0NA 4UF4A 4AYBD 4M63A 5C2GA 3KLHB 1OO0B 3QMQA 3V4IB 2FUG9 4WIQA 1JLQA 5IS2A 4DR2J 4UY8T 4BC7A 2GHWA 4HT7A 1UW9A 2B4UA 2DGQA 3M8QB 4X4RA 2A2CA 1A7GE 2R8HA 1FRXA 1NRKA 5A0YB 2ZBPA 3N5BA 1PBUA 3H2LA 2R8IA 2I5JB 2KO1A 1XJWB 2A1BA 5A8KB 4XDCA 1NK4A 1HNVB 2H65B 3F0NA 3VAFA 1ACMB 3KLIB 4EZ6A 4KFBA 4CLKA 3GV7B 3M8ZA 1FTRA 1Y5LB 1KVKA 4MFBB 1U1LA 4DCJB 3IO1A 4JI5F 1YX2A 2MLZA 4OI2A 2KG1A 1U48A 2VHGA 2XLKA 4MIAA 1Y3KA 2G9OA 3GPAA 5C25B 4B3MJ 1HNWJ 5L8RC 3CO9A 2L9NA 1PYSB 2O3DA 2J0WA 1RAJA 4N8OA 4Y6IA 5T14A 3QT5A 4JUZA 3OSPA 3U1MA 3AQOA 5A8WA 3POTA 4RR5A 2J0SD 5J2PA 1YDLA 1QSSA 2OEJA 2RKIB 5AE2A 1JXEA 2Y1RI 4BHQA 2W25A 3AOAA 4NCAA 3CJSA 1U49A 1HI1A 2FZGB 3EM1A 4ZDNA 4FS2A 4B3MF 4AXJA 4X4OA 1HHQA 4TVAB 3UD5A 1X60A 1V9OA 2CZVC 3QFHA 4IDKA 3M8PB 5LXYA 3OL8A 1AROP 2R7RA 4RW7A 4DQQA 1OSCA 2I9SA 4GO5X 4O0IA 2PA3A 2MKJA 4YY3F 1FEEA 3CJ3A 3NG8A 4X4UA 2XM3A 3L7PA 4DSJA 2CJAA 2K2PA 2NXCA 4HH1A 3AD9C 1S9EA 2V4RA 4L73A 4B3OA 1TAQA 4M5GA 2DJWA 3RBZA 3MCOA 2EFNA 2EKYA 2P9CA 3BBBA 2LQ5A 2MQLA 3Q0AA 1YJWS 2V6AA 1F0XA 2YWFA 3MEDA 1BMQB 1AYEA 3M2VA 3FEYB 4H4KA 3PW7A 3FJ2A 2Y8WA 5T41A 2E5IA 4P7TA 4J7CA 4DPXA 1HWJA 1RABB 3PDNA 2ZZTA 2LCWA 1E6VA 1KLMA 2J7KA 4HI2A 4NCGB 4EU0A 4RWXA 3QO9B 1F1BB 1S9GA 3LAKA 5DG8A 3GQCA 3I0RA 1P27B 4WKYA 2UVRA 4TU9A 3UVJA 4C8YA 1LK5A 1B99A 2E5JA 4URQU 4X62F 3VAIA 2J9DA 2W8LA 3PV8A 3DRPB 4KH1B 2ZJQQ 1AFJA 2KFZA 3UCUP 2H4YB 1NHVA 3C66A 3QLHA 4TY8A 3TR5A 3VF0B 5F8IA 4N7TA 2QN6B 3HT0A 2MXYA 3IC1A 3I31A 1N52B 1RXOB 1MROA 2GIFA 3DHWC 1U2CA 1F6TA 1NZAA 5J2NA 1YVFA 4USIA 2VJVA 1D1UA 1RLDA 1VHIA 1Q78A 3RR8A 1OY6A 3JAMU 2F9DA 1KC8T 2DHSA 4ID5A 2MZQA 1VIXA 2R7UA 3KG1A 4DQRA 3CW2C 3W63A 4B9TA 4Y65A 2VA3A 3GIIA 5CAAA 2ASLA 3EZOA 5HMXA 3W8PA 3NCRA 3ZZOA 4WU3A 4Q43A 4CLPA 3PR4A 2E5HA 3VWSA 4L3NA 1HBMA 4ZVHA 1C0TA 3C3LA 1BQNA 4QYRA 1JLBB 4ECWA 2OIHA 5HVFA 1MG7A 3IRWP 3AA8A 1X4HA 1RWXB 2GJ2A 2ZHOA 5EN1A 3ISZA 3GR0A 4N5SA 4G1IA 3WX4A 3ENWA 3C2PA 3AJDA 3EZUA 1DQ8A 1GMWA 1RA7A 2CQDA 1TZ0A 2DK2A 3AFGA 2X51A 3BS9A 3DLKA 2HBZB 4GMKA 3WIUA 2VFVA 4EBEA 2QL9B 4U7UD 2HBYB 3AXMA 3WC0A 2LXFA 4P2SA 2J0QD 1VOMA 3R9LA 1GK8A 2U2FA 1T03A 3HHKA 2ATCB 2VG5B 4LF8J 3OTBA 1I94F 2ZD1A 2R8GA 4DU7A 3U02A 4I67A 4DCPB 5EX3A 2NZ4A 2OLWA 4OZ0A 1IKVA 2PGCA 3MPVA 5I42B 3VGSA 3MPUB 3R8YA 2ZOGA 1KBRA 2PT0A 2OMLA 4JBCA 4NLSA 5ETTA 4DSLA 1S12A 1FK9A 3H7HB 4DLGA 2DGUA 4RW4A 3V6DA 1K1SA 3PX4A 2BW7A 2ROGA 3PFEA 3DMJB 3FRZA 1BHNA 2OPSA 2VB6A 4I68A 4PR6A 3TVZA 3VGTA 3ET6A 4CQ1A 1I3OB 2FY1A 3MPYA 1RACB 2HK3A 2HFUA 2XYHB 1JLAB 1N0UA 2CQCA 2IJRA 1NXIA 2BOAA 1TL1B 2CQ3A 2QMUB 3CJTA 3FQLA 4E8UA 3IWLA 4KYZA 4DL5A 3CCUS 2HFVA 2VL1A 3S8SA 2W7OA 2G2OA 1S4FA 1LOUA 1UPMB 5BR8J 3V6JA 2DH7A 4C8LA 2VONA 4OHYA 2HVIA 4MKYA 2U1AA 3UDVA 1YJ7A 2JLEA 3I55S 5LJ3Y 2ZWOA 1U1QA 3AAWB 2VD3A 4DR2F 2V67A 3CJ2A 4ZP9A 4Z7YA 3GSDA 3HFVA 2EW9A 1G4CA 3JSRA 3L7UA 2FHJD 2YVSA 3NXZA 1DTTA 1X5PA 3I5BA 4PRFA 3ONQA 4OX8A 4ED8A 2JFKA 1DRZA 3MECA 4WYLA 1BQXA 3MGJA 4M5HA 3RW6A 4PXCA 4OIXA 4RNOA 4B3SJ 1VISA 3FK4A 1H38A 3VQTA 1HYSA 4EGLA 4Q2MA 2Z4PA 2QYGA 4UUXA 3BKTA 4F25A 3KXDA 1M1GA 2ZKTA 3Q89A 4NLXA 3JB9k 3P6YC 1X4BA 2RU3A 5FLXY 4RL1A 2GZOA 2QA4S 3KHLA 4DUZJ 3IGNA 2MY8A 1Y5NB 4K4ZA 1NK7A 1G2EA 4J9LA 1WOSA 5KG1A 1IKWA 2UXCJ 2PIIA 5ETMA 1VBKA 2HZAA 1EP4B 3J7A1 2AHOB 2HQDA 1X4GA 4P9SA 3SSRA 3TP2A 3TUIC 2YKMA 2DIUA 3DXBA 2UP1A 1TMMA 4NYPA 4JI0F 3OVAA 2WOMA 2NPFA 1PCAA 2DEJA 2CJ9A 1IWAA 2E44A 3F56A 4A48A 5I42A 3OR1B 1WF2A 1TKTA 4A8FA 1UVKA 3J80Y 1JX4A 2K06A 2XZTB 4DSIA 4I7FB 4BC9A 2V8PA 3MM7A 1ZTWA 2F4VF 2L08A 2CNOB 3UR0A 2QLBB 4U9RA 5D4LA 2DXDA 2FHJA 4LF1A 1EX8A 5GAEI 1T9TA 4DR1F 1Q7LB 2F4FA 2VC1A 3X1LB 2UUBF 1T3NA 1NCLA 4F50A 2Y1IA 4C48A 2C2NA 3P45B 2I0XA 3IMQJ 2W9AA 2RNEA 2YNHA 1JLGB 2DITA 2XYPB 1QAXA 2BACA 2K3IA 5CH7B 3UPFA 2HHSA 3WX8A 5HMYA 5ETKA 3FC9A 2NSBA 4JYAJ 1CC8A 2F9JA 1YJVA 3H42A 3CJKA 1J27A 4I2PA 2D9OA 2N4DA 2QL5B 3PYFA 1AW0A 2JEJA 3UW1A 1VJWA 5I3QA 4JB8B 3KK2B 1HBMB 3LW5C 1SUQB 2B3TB 2UVWA 2UXBF 2VF3A 2G0CA 4WCEQ 2RU9A 3KUHA 2HFOA 3MFHA 4BWMA 4FYDA 4QR1A 3R5JB 4ZMMA 4DQIA 5LMNJ 5M2UA 1N0VC 2PEHA 1H2VZ 3R3TA 4DWIA 4DV2J 3CCWA 2IRXA 1S7IA
chains in the Genus database with same CATH topology
2GNKA 1TKZA 1ZH5A 1UWBB 2XMUA 1UP1A 1WEZA 2DISA 1DTQA 3TAPA 1LKZA 5CCMA 3DHXA 3CCJS 5KT6A 2XZWA 2M3DA 1WHWA 2VC0A 4QWDA 1NJYA 5I4MA 2HHWA 3KYLA 3DRPA 1IBLF 2PMHA 4H54A 3RB3A 3G6VA 2JL9A 5L1IA 2XS5A 2HGMA 2KT2A 4ES2A 3I0RB 3EGNA 1Y7PA 1I1GA 5E3PA 1WEXA 2D3OR 3A1YG 1VQ8S 5FD1A 3DOMA 4Q0BB 1HPZA 3P5TL 1L3TA 3F73A 2HW3A 4UOCA 3RB0A 1Q1KA 2HFNA 1G3OA 2XS7A 1VRTA 2BQ3A 5LMUF 2LQJA 1HBNA 2UUTA 3O1LA 2Q6BA 1BQMB 3DLKB 1YHQS 3K8VA 4CZCA 2BZ2A 2WONA 2MJNA 3OJSA 4ZPVR 2I1RA 1FJGF 2WRMA 4J9SA 1MNEA 2B6AA 1U47A 3FSYA 4KQZA 5CCLA 5AE3A 1KS2A 2W4CA 3MM5B 5T7LB 1S1TB 2B9YA 2DPJA 1XNQF 2VODA 5KG2A 1GXLA 4B9MA 2V0NA 1D8ZA 3HMJG 4LVNP 5KFXA 3W7BA 5A8RB 3HI9A 4Q8EA 4YDDB 2KXNB 3Q8PB 1ZPWX 1U2FA 1WHXA 2MQPA 4CH7A 1UA1A 1X8DA 5DQIA 3J7YU 3LWLA 5HLFB 2B4VA 2MMYA 2IMOA 2VBZA 3MMCA 1LW0A 2BABA 5LL6d 4RW9B 3L7OA 4WIIA 3CCTA 2ZH5A 1SV5A 5JXSA 3JSBA 5KFQA 2N82B 3H2UB 3NP5A 1UWBA 5B09A 3RAXA 4NLQA 4ALZA 5IWAF 4K2XA 3BJYA 3FNNA 3M05A 3Q23A 1R8BA 2PE8A 3CE8A 1S0MA 4Y2CA 3NBPB 4OX7A 1VRUB 1WI8A 3AY0A 4N41A 1P1LA 2DHGA 3V5RA 2XMJA 1FRHA 4O3SA 1VK8A 3DU6A 3MTKA 3NRBA 3LP2A 3G71S 2MZTA 4CIOA 3KK2A 4GC6A 4X4SA 2UVUA 3OJUA 4WXOA 1WF1A 2RE1A 3MZIA 3HJFA 3H5XA 3TAQA 1J5OB 2GIQA 2OH2A 2ZH2A 2B6AB 1Q16B 4OLOA 4PPZA 4TY9A 3ENQA 4WFNQ 4DN9A 2YKNB 4HL9A 4DL2A 3QZ8A 1CQNA 2MZJA 1O51A 4X2BA 2GA7A 4FXWA 3IG1A 1WEYA 1RT2B 2MB0B 2K1RA 5KFIA 1UL3A 4DV6F 5KFPA 3VAMA 1X9SA 3QLHB 3TX8A 4DUYF 2N4CA 4I64A 1HR0F 4O3QA 2WW8A 4DV1F 1NB7A 5E0OA 2B5JA 3HXMA 2AX0A 2YNHB 1S0VA 3I9ZA 3FVYA 2QMXA 4PG6A 5IT4A 3CCMS 3GWCA 1FNXH 4Y3CA 1R0AA 3FQKA 3GMGA 3O3LA 5F3ZA 1DQ9A 1R43A 4ZCIA 3QAEA 3IBWA 1VS3A 3DN9A 1CVJA 2RS8A 3GR1A 4B3SF 2JFDA 3M1VB 5KFYA 4QIVA 1FRKA 4ZA1A 5BYRA 3OR2B 4B17A 4ECRA 1W2BR 3UCGA 3MI7X 4CI0B 2ZOFA 3RAMA 2HZCA 3B78A 4YB5A 3RRGA 1FNMA 2QT7A 1K9MT 2OPPB 3MMAA 2LEBA 2HYIB 3MEEA 4TLRA 4RW7B 1KVJA 2AYMA 1FTCA 1Q86T 3KLFA 2PFFB 4IO9Q 4GKJF 4JYAF 2KYZA 4K4VA 1RT7A 1C1CB 1ULRA 2AYEA 2BA9A 1HBOB 2ZH3A 1S0NA 1KD1T 2HRYA 3EUNA 2CPFA 4OI4A 2DIVA 5HROB 2GW8A 2Y0SD 3TQ1A 3HHDA 1TL1A 1U6FA 2AJ1A 3TRGA 1FKOA 3K0JA 3RU0A 1LXNA 2M88A 4KO0A 1YJTA 1QE1A 3Q8QB 2C22A 2AX1A 4K59A 2WSFC 2KJWA 4WJBA 3IS9B 2R7TA 3NCPA 1Q82T 3T1YF 1J2VA 1R8CA 2EK1A 2E5GA 1N54B 2KRBA 1KEKA 7FDRA 4NXNF 4I2QA 4B08A 1NKBA 2OPQB 1RTIA 2UV8A 2PMZD 4F2SA 1X0FA 1JLEB 1VRUA 1UKUA 4DV5F 1G7CB 2ZITA 3M1VA 2GQCA 5EX0A 2E9RX 1FHTA 5DRKA 2UV8G 4Y2IA 2GFFA 3GG1A 1TK5A 1S10A 2QSWA 5E7OB 3S6EA 3E01B 1VQ5S 1A9NB 1HQUB 2HLUA 3M2RB 5EWGA 3HX9A 3EPGA 2B5JB 2MHEA 2HFZA 1XR6A 2VFSA 1IM4A 2VZ9A 3POTB 3C6UA 4ZP7A 2W4DA 1PILA 2MKKA 1KSPA 1KQSR 2LXIA 1RT7B 1N8RT 2LMIA 4ZS6A 3T5KA 3VQSA 4JI7F 4IOAQ 1HI8A 1ELOA 1T95A 5B0EA 4ZHRA 4N56A 2MHNA 2WSCC 4C0OC 4KGKA 3M2UA 4JI3F 2ASYA 1TL3A 3MUTP 4NWBA 1T94A 3MAQA 3V4MA 3FSXA 2AF6A 2W9CB 3DNCA 3MUVP 5FJ4A 1SB6A 1OS5A 2ZVSA 5D78A 3IRXB 1RQ0A 4B3RF 4ZPDA 3G8TA 1R7IA 2FLPA 1GTHA 2LQ9A 3G4SS 1IR0A 3NBPA 2UU9F 1QUVA 4FVCA 1JMTA 4Y2MA 4F67A 4J9QA 4EO8A 4DS5A 1NH8A 4PWDB 5D6GA 1HQEA 2IVMA 3CCSS 3T5LA 3HO1A 3QJJA 1FJCA 4ZP8A 3K7RA 1LW0B 4PXEA 1D3WA 3QGPA 5HP1B 4O4GA 2WSEC 2M7SA 3BO3A 3NS6A 2E1MC 1ZAVA 2IVYA 3D1OA 1M5SA 3Q22A 1S9GB 1WG4A 4YP3A 1RT6B 2QZ8A 3TA2A 2EG2A 1MROB 2NUHA 2X1FA 2BE2B 2MKCA 4DJBA 4YEAA 3CDUA 5DETA 2IFXA 4OJ1A 1WHYA 3I6PA 2CPYA 5KTQA 1S6QA 2DGOA 2R4FA 5KFGA 3OHAA 3DXSX 3IGVA 1FJ7A 4CO4A 5H9FJ 2FJWA 4A8KA 3GFXA 1UVMA 1KLMB 3TVKA 4KBIA 3I5AA 2IM1A 2HWIA 2VG7B 5KG0A 1UFWA 4A8SA 2J9EA 4FF1A 2UXDF 2GMLA 3T5HA 3EXYA 4RNNA 3OVSA 4Y2AA 2X1AA 1T8EA 5B0DA 1TKXB 2CQ4A 1HWLA 3HZEA 3D1QA 2KH9A 2YKPA 2BYCA 1KFDA 4DR6F 3CB4A 4A8MP 4QW8A 3T3FA 3OLBA 2GO9A 1L3UA 1ZZNA 1X9MA 2NS1B 5EWFA 4ITSA 2E5LF 1YG0A 4EBDA 2BE2A 2QFJA 3KLGA 5HN0A 2FB0A 4C97A 4QBUA 3MM7B 5B08A 1ZM9A 4MH8A 4NLVA 2RILA 4TYAA 5D4PA 3HM9A 1NJWA 2RJZA 2FHOB 2EBEA 5KFKA 1N88A 3MF5A 4CNYA 2B43A 3PFOA 5JJBA 5HP1A 4DQSA 3OTOF 3JYTB 1FXDA 2VG6B 2JEIA 3CGIA 1VBZA 3SV4A 4BS2A 1IBKF 5HQ8A 3KNGA 2RS2A 3H59A 3M6WA 4GC7A 1T3OA 4JOUA 4DUZF 2NLWA 5D8HB 2ZH9A 3N9UC 2IYGA 3OTCA 3PXGa 1HNWF 2JVOA 2HHUA 5KAKA 1D9DA 1FKPB 1UFLA 5L1LA 2FGOA 4NLWA 4O44B 2XWYA 2AYGA 2JZ5A 2FVSA 1RDRA 1WNEA 4Y2KA 2VOPA 1AXQA 4PQAA 1VQ7S 2K7KA 2ILZA 1XTZA 1FRLA 3G6ES 2LDIA 1JJHA 1SJQA 2LU2A 3CEDA 4RNFA 3CC7S 3MMBA 4HTIA 4OI1A 4C8MA 3O8WA 2XCPA 2L3MA 3SYZA 4OQJA 1E6YA 4C8ZA 4USHA 1CQMA 3VCDA 3RRHA 1OQ3A 1WF0A 5EGYA 3MMBB 4F26A 2KXFA 1FERA 4I7FA 3KHRA 1FDAA 2ZOMA 2YWHA 4EWTA 2L9WA 3OR1A 2ZFHA 1U1NA 2O66A 2K3KA 3S1TA 2OTJS 1S6OA 2F1FA 3UDLA 3KLEA 2R2SA 2DGSA 3H8YA 2CFXA 2ZC3A 2DCLA 2GO8A 3T5JA 2P9GA 3NAIA 4DF8A 3IAS9 3N0VA 4EBCA 1YRUA 1CG2A 2B9XA 1IXKA 5G4DA 1N32F 1N56A 2I2YA 4IFVA 3FEXB 2DO4A 1EP4A 2MKHA 2Q1LA 3R27A 4ZCKA 3JSMA 1FA0A 2GQ2A 1DJ0A 4NMLA 1S77D 3UDCA 2AP6A 4F2RA 5C24A 5BJRA 1J5EF 2FDNA 4IRCA 1XNRF 4DN0A 1UVLA 3QWUA 4IQXA 1DLOA 2FLLA 1UAWA 4NPOA 3V4IA 3OTDA 3PIOQ 2JEGA 2UUCF 3AHPA 5DM6Q 2VBWA 2KXHA 3QPIA 4A47A 4QWCA 4OHXA 3OLAA 4J9NA 5HROA 3OFGA 1HMVB 4KV8B 1ZM2A 3FRYA 3R5AA 2GCFA 4NLXA 1IBMF 4ECUA 1S1XB 2ZDPA 2D1CA 2YNGB 3BR8A 3O5TB 2CJQA 3ZZPA 3K5MA 3R5BA 4C3KA 4OZLA 1K0VA 4DG1B 4LUBA 2C2EA 1NKCA 3W2WA 3PKYA 1SXLA 2APOA 3LANA 1KFSA 4I6AA 4KGMA 3TA0A 2QO3A 2GX8A 1HA1A 4RW4B 3V6DB 3OL7A 4P6QA 1VBXA 2DH8A 1AFIA 2V5HG 4G6VB 1JB0C 4H4MA 1R0AB 1ZPVA 1SIZA 1NJXA 3U7JA 3QIDA 3WDOA 2CQ1A 2PI5A 1PC4A 1UMJA 4NLUA 3IA0A 3SI8A 1RT5A 1ZYQA 2KDOA 1XK8A 5J2NB 4WFAQ 5GAEU 4DSEA 2UUWA 2D3ZA 5BYQA 2BJEA 3LP0A 1KONA 2Z2MA 4X4NA 2WHOA 1NK6A 2MYFA 1BD6A 1RT6A 1KHWA 1YJUA 5CYMB 3G86A 4X65F 4NRUA 2KI2A 3ETOA 2ZH7A 1H7XA 4QWBA 2B0GA 5M2RA 2D9PA 3HFKA 5KG5A 5K14A 2YKAA 4LQ9A 1J5OA 1WTBA 4Z2XA 1FVQA 2Q66A 1G6BA 1P1TA 3HF5A 2HQ3A 4C8OA 1WWHA 1XMBA 1U1KA 5KFJA 3G6XA 2XEXA 4G1QA 2FD2A 1U24A 2VBYA 2WONB 4DV0F 4F3QA 1SJ4P 4QR0A 4EO6A 3M9MB 1NK9A 2AU0A 1TAUA 2IM0A 3NMRA 1KQKA 1NJIT 4L6V3 5GAHU 3DI6B 3A8EA 1K73T 2BJDA 5A2QY 3ZFVA 3LP1A 1N34F 2VKRA 3MM6A 5IQQA 3JAMY 4CT8A 4LFCF 5GVQA 1FDNA 3MD3A 3IAM9 3DDKA 3LP1B 4QPTA 4Q5VA 4OI3A 2J7WA 2GGPA 3US5A 2CPZA 2OPRA 4OZJA 4RNMA 3K5LA 5L1JA 3MEKA 2AJ0A 3NWGA 5HBMA 5KFAA 4WYWA 3P49B 4DFMA 1GX6A 3DLJA 2FLOA 3E3XA 3VAHA 1FDBA 2MSTA 3KLIA 3T6JA 2ASJA 3EZ5A 5B0AA 1KLNA 2QEXS 3TO8A 5KG6A 5IFMA 5F8LA 2DGXA 1S9EB 4DX8H 3THPA 2XMKA 3DRRB 4DSKA 4O23A 2BXJA 4R5PB 3M6XA 4K4YA 1CLFA 2Q43A 5DDRC 1R8HA 2Y1JA 4HKQA 2V4JB 3C8YA 4NLYA 3MM5A 3VR1A 2COLA 1V3RA 2RRAA 4PQUA 4Q8FA 1YJRA 3K5PA 1JLQB 4ZHRB 4TU8A 3UI3A 1JJ4A 3PKMA 4K0KF 2YNGA 2KU7A 1URRA 3GIKA 3MM8A 2JOQA 4RU9A 3NNHA 2HHPA 3WZ0A 2IC3B 2ADBA 3NLCA 1WHVA 4KRWA 3DYAA 5AJ3F 2XY6A 5E41A 1HWUA 3CCES 4IDKB 5CHCB 4ZOSA 2C3OA 3WBZA 2JC0A 2OMOA 2GHVC 4DLEA 2HNDA 2UUAF 3HT3A 2J6UA 3Q2SC 1HHTP 1KVIA 4NLDA 1S1WA 2Q3PA 4OJHA 1MSWD 3MEEB 3PEHA 1MU2B 3UD3P 2C2RA 4KFBB 3OUYB 1REVB 3DGPA 1OWXA 5AXNA 3KWMA 4RNHA 4KSEB 2QE5A 1FE0A 4ILRA 1S1UB 4U67Q 3CVKA 3M2VB 4HH0A 4HTJA 4OI6A 4OJGA 4Y34A 4NLGA 2C3YA 4LSLA 1VQOS 4F02A 4K50A 3HDSA 5ITHA 1OIAA 3GE9A 3H25A 2CQ2A 3OW2R 1XBWA 4O3OA 1RGVA 3THTA 3KLGB 2ROEA 1GNKA 1TVRB 2HGNA 5G0RA 1N6QA 3BO4A 1IKYB 4ECXA 5E3RA 2IM3A 3RR7A 4IOBA 4Y0FA 2W9CA 2BQUA 3OV7A 4QCLA 2M52A 3MTJA 3UWTA 2YNIA 1SIWB 3NL0A 5K8OA 4EEYA 3IS9A 2V9KA 3T9ZA 4OV1A 4NYZA 2R7XA 1Y9OA 2XB2D 1VLYA 3OVBA 5M2PA 5E3CA 5KFDA 1BLUA 3NMAA 4QU6A 4HI1A 2FJXA 1VI7A 4OX6A 5KFZA 5GAHI 3KKFA 3TI0A 3IN5A 3DLHA 4HVZA 1KQGB 1U1PA 4Q7AA 4C8NA 1VIOA 1ZM3A 5C25A 2YX1A 2C42A 4KHMA 2XNQA 2YKNA 2RRNA 4NLOA 4ECSA 3THVA 2ASDA 1SKWA 1H7WA 2CQHA 1RT3B 4Y00A 2KT5A 3K57A 4J9RA 5CD4H 1IKWB 5F9LA 4JV2A 1OSDA 1LWFA 1FVSA 3SQGA 2RT3A 1Y3JA 4ED7A 4TKTA 1IN0A 5AXMA 3DLEB 4WF9Q 1NNDA 3BGRB 5F3TA 2N3OA 4QPXA 1K1QA 2W4PA 4U7UK 1N5QA 2AGQA 4LF8F 4NA3A 3CC2S 2G4BA 2VASA 1QAIA 4CTAA 2MKIA 2J9CA 2P6SA 3OBIA 4FF3A 3OTEA 2XI2A 4RUCA 2R7QA 2OPRB 4ZVFA 4J9MA 5D3GA 2DGVA 5LSRA 1F5BA 1JNRB 2NUUG 1HQEB 3DLGB 5E3AA 1KR4A 3DYAB 1YQHA 4F4XA 2HIQA 3CTRA 2LQBA 4DBQA 2MQQA 4X4PA 4F3OA 2DCUB 1C0UB 4ZPWR 4C98A 2HMIB 4LQ3A 4K5SA 1WI6A 2XSFA 3B4DA 1IJFB 4FNHA 2Z8QA 1NK8A 4O3RA 1RT2A 4OL8A 1F60B 1WG5A 2JVRA 5KFCA 5F8GA 4DR4F 1GXTA 1KQFB 3MM9A 4WFBQ 2R2TA 4H4OA 4RW6A 1SJRA 2DRAA 1C1BA 5DQGA 2ZE2B 2XMWA 3MEGB 2V2KA 3RBDA 1HWIA 2YQ3A 2FIUA 4B9UA 1Q79A 2FGCA 1U45A 4M94A 4LFAF 2UXCF 4Q45A 2V4JA 3DMJA 2R8JA 1S6QB 4FPRA 1L3SA 1S1UA 2EPIA 4ED0A 4XK8C 5JVGQ 4TY8B 2ZJPQ 3KNAA 2ZKUA 2AW0A 2YTCA 1Q8BA 4JV1A 2RQKA 3HK2A 3CDAA 2BOPA 1R27B 3GFZA 2HPUA 1V3ZA 1QAYA 3MM6B 5CYJA 2OD6A 2XLJA 2E66A 2XY5A 4OJ3A 3ZZTA 4TU7A 2MQOA 2JLFA 1HARA 1UEVA 2A3JA 2FJEB 1KTVA 2IM2A 1APSA 2LA6A 3UE2A 3QGIA 5C42A 1RYRA 3PEJA 1RT5B 4R25A 2DGTA 1HWKA 1R89A 1FD8A 2V8DA 5GADI 5L1KA 2OAUA 3QJPA 1NO8A 1RT1B 4ZK7M 3HKWA 5DG9A 1JNZB 3K8WA 3MEGA 2MZSA 5ADZA 4V19X 2N3LA 2R7OA 3KJVA 2ATLA