4K59A

Crystal structure of pseudomonas aeruginosa rsmf
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
AMGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA BINDING PROTEIN RsmF
publication title An unusual CsrA family member operates in series with RsmA to amplify posttranscriptional responses in Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 9
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02599 CsrA Global regulator protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k59A00
1Y00A 4KRWA 4K59A 4KJIA 1T3OA
chains in the Genus database with same CATH superfamily
2DGVA 2XEXA 2IRXA 2BBEA 1T8EA 1FA0A 4GVBB 1MMDA 1MN9A 1UJ5A 2FVQA 3LQVA 1EQ0A 3SXLA 2E5LJ 2V2KA 4A8KA 3UD5A 2JLGA 4LSLA 3DLEB 3DRPA 3IC1A 2WZ1A 3H90A 4DPWA 2CQIA 3TAPA 3LPYA 4FS1A 4DI6A 3CNQP 5IC4B 4DR2F 2NSBA 3IGVA 4C4WA 3VV2B 5CCMA 6FD1A 4P74A 4UOCA 1HQEA 3E8OA 3NS6A 1PO6A 5RUBA 4O3QA 4ZN1A 3D6HB 1SPBP 1SC3B 3ZO7A 4PWDA 5KFUA 5F3ZA 2A2CA 2RH3A 1IKWA 2VJUA 2W9AA 2CZ4A 4K5RA 2YKNA 3O8WA 4JV1A 5L9XA 4ELTA 1E6VB 4CO4A 1EAYC 1MU2A 4RX6A 1R3NA 2VKRA 1N34J 2P6TA 1I51B 3C19A 3QFWA 3OFFA 4P52A 3LP0B 4C11B 2V5HG 4MIBA 2UUTA 3MECB 5HO4A 5EX0A 5KFQA 2OPPA 5HVHA 2QGFB 4OX9J 1R0CB 2NR0A 2MKIA 1NPPA 3T19A 2DH8A 2IM1A 5KG3A 2JX2A 2VC0A 1P1LA 3C16A 1CVJA 2R8GA 3NL0A 1RT2B 4OYOA 3GYXB 3QJLA 4AQYF 1F6TA 3N5FA 3BB5A 2XCAA 4KHMA 4KGMA 3DXSX 3RB3A 3OL9A 5H9EK 1X7VA 5IWAJ 3J80Y 5IOLA 1S1VB 3NGUA 1FKAF 3AA8A 2FHKA 2MQ8A 3GJRB 4FYDA 5D0GA 1NH7A 2XWYA 2IPOB 3EVOA 4O0IA 1RADB 3WQPA 4NCAA 1NU4A 1JLAB 3AOAA 2CJYB 3F56A 1OSDA 3WIUA 2CPJA 3VAKA 1S0NA 3OL7A 4TXSA 3TX0A 2R42A 4K4ZA 1VQNS 4QW9A 5KT7A 2KHDA 3IS9A 4EWTA 3HDSA 1C4AA 4AL6A 2BKPA 1VRQC 2F5GA 2FVCA 3MI7X 2CA9A 3PDNA 4HHHA 2CZ9A 3MMAB 2G0CA 2E1MC 4WIQA 2KXNB 3I4HX 3DRSB 2SXLA 1KONA 4YHHJ 3CDAA 4OI0A 4Q8FA 1RTIB 3J7YU 2B4OA 5KG7A 2IA6A 3CCJS 2N7YA 3EMTA 2DH7A 1N32F 2EKNA 1FJ7A 3I32A 1XR7A 2KN4A 2R8HA 2KFZA 4JI6F 3R8YA 3TR5A 1ZM9A 4GVBA 4ERDA 1RKJA 3NNAA 4HH1A 3NCQA 2V8PA 3KK1B 2CADA 2OMLA 2CJAA 4CH0S 1FRJA 3CJ2A 3BKFA 2QZ8A 4OYWA 1U24A 2Y1LB 4IUFA 4X4UA 2A3JA 1DBDA 2M8HA 4F4AA 2LCWA 2P9GA 1RTJB 1VRUB 4NYPA 2RT3A 4ECQA 3DRRB 4YY3J 1LWEA 2QLWA 2RUSA 3HHEA 3I96A 4RZRA 2BR0A 2BX6A 3KHHA 5KFVA 2B0GA 2XY6A 2BE9B 1VBKA 1VJQA 1E6VA 3KG4A 2EC2A 3TEGA 5E5NA 3G87A 2NQPA 1WSVA 4ZHRA 3RU0A 2HHHJ 4C11A 4JB8B 4JOUA 1HL6A 3MECA 2CRLA 2EWHA 2K3KA 3DCAA 1PIEA 3IR5B 4LRBA 3KLIB 4USIA 4BHQA 3K59A 2D3UA 3FCVA 1HNZJ 4DBQA 5F8JA 3WIVA 3H40A 3VQSA 2JL9A 3LUYA 3PYEA 2HHTA 2RS2A 1S1TB 4FF2A 3D7SB 5KFBA 1U6BA 3ISND 2KO1A 5DLGA 1FE0A 2KH9A 3LGHA 2GMJA 4QYZK 2FHJA 1XNRJ 1XJWB 4BC9A 2PI5A 2VA3A 3Q8VA 4B9NA 3BPSP 2M70A 4A8YA 2DNKA 2E5LF 1S1VA 2PO4A 4KHPJ 1X4CA 2H4YB 3QO9B 2ZDOA 5HAOA 2G13A 1URNA 1A6LA 1HWIA 2V34A 1YDLA 2UXBJ 2ZJRQ 1RT5B 1JLAA 2VZ9A 5MAOA 1VQ8S 2P5VA 2MKCA 4RNMA 1RTDB 4RNHA 1SL0A 1RB0A 2IA0A 4RW8A 3MZIA 1CPZA 1R31A 4UT4A 4TU9A 1QTMA 2VDHA 4RNNA 2JRSA 4OI1A 2CNNB 1SI9A 3ZTSA 2CPXA 4DR7J 1S57A 1N34F 2CVIA 1JNZB 3MMAA 2FJDB 2L48A 1L3UA 4BWMA 1JLCB 2M5YA 1UFKA 1VLYA 3DRSA 3C3LA 1YJVA 3D1HA 1WG5A 3PFEA 3DKDA 1XMQJ 2GIRA 1RTIA 3PKMA 5KFFA 4X4VA 3NGTA 5L9NA 1FNMA 3GWCA 3MEKA 4BS2A 1WC4A 1C2PA 2PFFB 3MDFA 4KE5A 1S6QA 4HKQA 2DNQA 4A8WA 3WHIA 2KI2A 1P9QC 1KNZA 4DSJA 2KYXA 1Q16B 3QRRA 3F44A 2VBZA 2YPZA 3KK1A 2PN6A 3TAMB 1WC3A 1HWKA 5IWAF 5C5JA 3UNGC 2LQ8A 1WEZA 2GHWA 4XDDA 1Q7YT 4OMFG 2ZH4A 2Q66A 2DJWA 1SXLA 2JEFA 1VRUA 2QSWA 1BQMA 1RLDA 1OYEA 3DRRA 2WVFA 1SJQA 5DGAA 2VG6B 2Z8QA 4U6PA 2HS3A 1N0VC 1VLOA 1VC5A 4OYBA 3HVRA 2ATLA 2KYZA 4MT1A 3EDQB 4HHUA 4U7CA 5C7PA 1PJ6A 4DL2A 2VD3A 2XI3A 1W7WA 2H1YA 3DN9A 3QGPA 3JXOA 2Q79A 3SQOP 3N01A 3PR5B 1VQPS 1MG7A 4LF6J 4NXNJ 1WACA 3KLIA 2NXUA 4YHHF 4HT5A 2LA6A 1X4EA 2DGTA 2FY1A 2J76E 4ZVTB 4ED5A 1R27B 1ZM3A 1MNEA 3EGNA 3AB2B 1KTVA 1X5SA 1F1BB 1FK9B 1S1TA 2KG1A 3B8HA 5DZ6A 3A3NB 3VAHA 3LANA 4HI1A 2LYVA 2F3JA 5H1SV 4NLGA 1OO0B 1HA1A 2J9EA 2EG1A 1SL2A 1YHQS 1AFJA 3ZZTA 1UPPA 1H2TZ 2F7VA 2VV5A 3HFVA 3QO9A 2FVPA 4L76A 5CHCB 3TZWA 2IYGA 2JVRA 5F8GA 4FYWB 3J7AN 4OLPA 1CSJA 1M90T 1FRXA 1RT5A 1NUEA 2VG7B 2N82B 2M2BA 1XR5A 2C2DA 4YY3F 1RTDA 3UWTA 2Y1RI 4ZOSA 3B54A 4HL9A 2W4DA 4WU2A 3BJYA 4QW8A 3JQMA 1N33J 2J9DA 2XNQA 4NLWA 3AXKA 4RKUC 3KDNA 3HULA 3IAM9 4WWSA 3FRZA 4ATNA 4DDFA 1U1RA 3KK2B 1JLCA 2ZVSA 2RQCA 3SYZA 1VHFA 1WI8A 1IKXB 4ZIVA 4DCPB 4EK2A 5KT5A 4NLDA 4A47A 1HNZF 3SV3A 2GJ2A 2E29A 3CSKA 3TZZA 2YKMB 3BN7A 4IH7A 5CZXA 1VYAA 2UVRA 2KFYA 3K5LA 1I94J 3KUGA 5AXKA 2HK2A 2MJNA 2QG9B 4Q0BB 2WB1D 5B0GA 3HP6A 2HFSA 3JTPA 3TA1A 2GAHC 3TJ8A 4L72B 4U96A 1HNVB 3HHLD 1X4BA 1NSQA 3TAMA 3BQ2A 4DV3J 2V68A 3GZ7A 3NNCA 2D9PA 5ETPA 3TYTA 2AP6A 4KHPF 3M2UB 4ED8A 2XI2A 3RB0A 4KYZA 3UVJB 1FWKA 3NLCA 2XS5A 1MMNA 4UUXA 1WF0A 2MZJA 3QZ8A 4DPYA 1RKIA 2UXBF 3HSGA 4M63A 2HHUA 3VAJA 3KOAA 3QLHB 4XAKA 4K4SA 1NPKA 3ET6B 2VG6A 3HSDA 4IRCA 3HZEA 1VQSA 2CIMA 2IBOA 3KUHA 3PV8A 3I55S 4Y65A 1S79A 3W5ZA 5DLFA 4CLPA 2E9ZA 3D4JA 5HK4A 3C6UB 4LVNP 2X1FA 3CIZA 4NL5A 3N5BA 5JMNA 2RMLA 4MK8A 2HQFA 3EXCX 4ANDA 2J9CA 1VJWA 3RBXA 4F7VA 4YDDB 1Y4ZB 1XMQF 1X0PA 4DV2J 1X5TA 1UVLA 3W8GA 5CYJA 1TELA 2HS0A 4LBPA 1RLCL 2XQCA 3K8WA 3MAQA 1RU1A 1FK9A 4KPCA 4LRCA 4CO5A 1REGX 3KHGA 1U2CA 1S48A 3X3UA 1F0XA 2AYGA 5ETVA 3RG6A 2CWKA 3I5CA 2OJ3A 1RUSA 3S6EA 1HW8A 2GCFA 3UNYA 3UCZP 2ZNZA 2MTLA 4UZCA 4DSIA 4RO0A 2GIFA 2EFQA 4QIEA 1HIYA 5MLCV 4NI2B 3J7YI 5A8WB 3RTVA 5LSRA 3T5HA 2W7AA 2BRLA 4KKOB 4P71A 2EFGA 1PKUA 2Y3YA 4DFKA 3LAMA 5KG1A 2QTWA 3SCIE 5C25B 2O66A 2VG7A 7FD1A 4X66F 3QAEA 3P5BP 3CMQA 4HVZA 4ETXA 5KFYA 1P8GA 2XULA 1XERA 3UW1A 2YNIB 3E01B 5KFHA 1O0PA 3BO3A 2GVZB 2RHSB 1TK0A 2M52A 2XGPA 2OO4A 2C42A 3M8WA 2GQCA 3AD8C 4IOCQ 4B9UA 2QT7A 3HT3A 2A1BA 3D5MA 5T41A 1Y5LB 2WK4A 1AXQA 4CH7A 1Y5NB 4JI3J 2CYYA 4M5JA 2CJBA 1SQFA 3SV4A 2APOA 3OPKA 1KDNA 2R7WA 4N76A 1FNXH 4LF6F 4NXNF 1IKXA 1XMBA 1Y5IB 3V81B 4NCGB 4DV0J 2H4WB 1R8CA 3RW6A 1QUVA 5EHHA 2WSEC 4J5OA 2ASJA 1NK6A 1Q78A 1UZDA 2YKMA 2YBVA 1GAOA 5E3CA 4PABA 3EGZA 2Q43A 3IBFB 4KTQA 4EUVA 4C8OA 2XYPB 2V9KA 2E1RA 3RB4A 3H20A 3OJSA 1IJFB 1HNVA 2MZSA 4FBUA 1F60B 1L3TA 2YNGA 5I3PA 4H54A 3TVYA 3U02A 3GR0A 2Q6CA 4DV7J 3D6MB 2VIHA 4UOHA 2XGQA 3M2UA 3AFGA 2H54B 3GFYA 3AD9C 3UVJA 4FF1A 4HHJA 4PQUB 3O2IA 1VR6A 1ZYQA 4OLOA 2DXEA 4QYRA 4DFMA 3QLHA 3ET6A 2JZ5A 2HW3A 1GXUA 1WF1A 3QMQA 3TWZA 4I69A 1OQ3A 1KQSR 3ZTRA 1ZM2A 1QVFR 1RK8A 4WFAQ 2XNRA 4RW7B 1U0SA 3M05A 3T1YJ 4ZVSB 1N33F 3C6UA 2AV5A 2OUGA 3PO4A 2BW7A 1FE4A 1U8WA 2V2ZA 4O0NA 2V50A 3JYTB 2O3DA 2DR5A 2OD6A 3ZZPA 1RBOB 3GQCA 1LNQA 5I4MA 4LF7F 1CG2A 2AJQA 2MY7A 4ZCKA 2QMUB 2C1EB 1NCLA 5HANA 2Y1IA 5FIIA 3C8YA 4DR4F 1WHVA 2BKOA 1VMBA 3CVKA 3QAUA 4ELUA 2HZAA 2HRTA 4KFBB 5GVQA 3G6VA 2V8GA 3ZZUA 2GHPA 3TO8A 4DS4A 3FBCA 4X4NA 1I94F 3QZ7A 2KKHA 1XNQJ 3RAXA 2RQMA 3BYPA 1PAEX 3MPYA 1PC5A 4QBUA 1VIXA 2MQPA 2ZKTA 4HH0A 4DL4A 3ILLA 3I82A 4NI2A 1EQMA 5A8WA 4LSNA 4B9LA 4DEZA 4DV3F 2IBKA 3PYFA 5HATA 8RUCA 3X1LB 4KKOA 2W25A 3KXDA 2EFOA 2BE7D 5AT1B 3FMBA 1S76D 5KAKA 4PUOB 1UVIA 3G4SS 2C22A 4PG4A 2Y8YA 1NB7A 5C25A 1S6OA 3G86A 1JB0C 2XMTA 1FTCA 3MPUB 3SIPB 1NSKL 3E01A 2BA9A 3QRPA 2GVZA 5IFMA 3K5OA 5DDQC 4FNHA 1RHRB 5A2QU 1UVJA 4C7QA 4NMXA 3HZGA 3MCSA 2MMYA 3TW0A 3JSMA 2CG4A 4WTYA 3R7BB 2DHSA 2AQ4A 4LSZB 2W4CA 2V8VA 4RBTA 5CZVA 4U67Q 3KLEB 1LWFB 2CQCA 3MAHA 2B9XA 4WU3A 4FKXA 2UXCF 2DISA 4KGKA 4NCGA 2DY9A 1L3SA 2MZRA 4DV2F 3Q8UA 3OFHA 4AYBD 5J2NB 1S7IA 2QEXS 3W62A 5DDRC 9ATCB 1IBLJ 4ANCA 4YN3B 2IFXA 1GQEA 1UEVA 3R1HA 4ED3A 4KJIA 3QT5A 2VU5A 3GJSB 4K0KJ 5HQLA 4F4WA 1S1XB 4F3OA 1JXEA 5D4NA 1B0PA 3QSIA 1JJHA 1LXNA 3MMJA 2W2NP 4FXVA 2FHJD 2VFSA 2YTCA 1BY9A 1K1SA 3PX4A 4DU7A 3ITHB 2K1RA 5A0YB 5SZTA 2KM8B 4PQUA 4NYOA 2D7SA 3PIOQ 2J0QD 2MQQA 4I6YA 3M6VA 1UVKA 2ILYA 1SUQB 1KRPA 2YPYA 3MMBB 4QIGA 3DRXA 3SQGB 1VGYA 3GG0A 4CLTA 4B3RJ 3RGIA 1C1CB 2GA7A 3P6YC 3H2VE 4DN0A 4RW7A 4F26A 1CJTB 1FCAA 2IDLA 2JVOA 2FY8A 5L1JA 2MXYA 2C2RA 1M1HA 3G6XA 1CJUB 2E7WA 3VAFA 3IN5A 3HVTB 4WJBA 4ZPCA 3JYTA 3MWBA 3H7HB 2BMBA 4G6VB 4RUAA 3M32B 4DG1B 2F8EX 4JI3F 3QIDA 2YKPA 1XR6A 5KFLA 3MR7A 1H3DA 2R3VA 1YZ7A 4ILMA 3OFEA 4ZITA 2XC9A 4Y6IA 5D0HA 1V9OA 1ZBTA 2HFZA 3WC2A 1U0HB 3G96A 4DV0F 4KFBA 3BBFA 3DLGB 4USTA 2FB0A 4F4XA 2VFRA 4CTAB 1VQ6S 3I5AA 1FT8A 1YWXA 4NRTA 1NJYA 1VI7A 4C0HA 3BR8A 3PX6A 2GQ2A 3NY0A 5GAGU 2GZOA 3VR1A 3R5GA 5D0EA 2MKKA 1M5KC 4C3KA 1OJ4A 2IRYA 2NXEA 2PMHA 3JSRA 3GYGA 3OQ2A 4EI2A 4DV7F 1IWAA 2EXUA 3CCTA 4PUOA 2QSFA 3J81j 5D4OA 3KJVB 1FRKA 3M6WA 5KFTA 3R5JB 1RWVB 3T6JA 3J7ZT 4WP8A 3TX8A 4ELVA 3KYLA 3EZUA 1GX6A 1HMVB 2ZD1B 4U95A 4O3NA 4WFNQ 1T9YA 3B82A 3CO9A 2XMAA 1T3NA 3NOGA 3GIJA 1ICEB 4NLUA 5L8RC 3G6YA 2IIHA 5L38A 4C8NA 3T1YF 2UUWA 1D09B 4YR2A 5K8MA 2P9CA 3A13A 3BH7B 1NSPA 2GVDB 3KLEA 2KT3A 4HEA9 1VQLS 1LWXA 1U25A 3H5SA 1J5EJ 1DY3A 1LWFA 2RU9A 4I6AA 4ZVPB 4RUCA 3EM1A 4DLEA 3BPDA 2I6WA 2W8LA 4CT8A 2MZQA 4W92B 3OLAA 4KPYA 2LP4A 1DARA 5CYMB 4O23A 3PRBA 2F65A 1V3SA 2KDOA 2VG5B 2LXIA 4NXMJ 3ENVA 2B9EA 1PBUA 2CPDA 1F5CA 1RWKB 4MIWA 1FD2A 2WVDA 3RR7A 2EEYA 1HPZB 4WYWA 5CCLA 3F0NA 4B3TF 2CJXB 2DNNA 3IM8A 2EBEA 1SJRA 1XNQF 4I0WA 4DR3J 1UL3A 2QL9B 4TVAB 3SCLE 1S1XA 1WI6A 2NYHA 2DNOA 2AJ1A 2XCPA 3QPIA 2F4FA 1TFYA 5FJ4A 1TU0B 3O5TB 4JI0J 3OVSA 3IBWA 4L6V3 3OLBA 4WFXA 3LO3A 2CWXA 2F8HA 3ITHA 1Q95G 5A0YA 1JLEA 2E7VA 4E98A 1TUWA 4FN5A 3ZTPA 3R5AA 2P8IA 2LQ9A 3NCRA 3MMBA 1N0UA 3SQGA 2Y0SD 4NMLA 2DPJA 2CZVC 2DHAA 2J8SA 4IFVB 4ED2A 1C1CA 1RSCA 3IWLA 5EGYA 1O5JA 1UFLA 4XPCA 1CJTA 2DO4A 4FYVB 3RUBL 3ZZ0A 1IQTA 2GGPB 1CJUA 4AXJA 1Z1ZA 4K4TA 4U9RA 3ZTOA 3M32A 4DG1A 3HF5A 4DPUA 4CLLA 3H4DA 3ISZA 3EE3A 2UXDJ 3PX0A 3VZHA 2HAFA 3B6BA 1DTQB 4WCEQ 1NAQA 1LW2B 2M0GB 3I56S 4Q43A 2L9NA 1APSA 1AYEA 3BZQA 1U0HA 5ETQA 1OS5A 4ER8A 2XLIA 2R7VA 1CC8A 2DXFA 1JXLA 2R9LA 2P9EA 3O1LA 3LH2S 3TUJC 1S5ZA 3O3LA 1IBLF 4FXDA 5EN1A 1VBYA 2DYAA 4ECWA 4AT1B 4JP8A 2RDJA 1LOUA 2FC9A 3HLUA 4OFZA 2QLBB 3EZ5A 3M9OB 2ZOGA 3N79A 4ENOA 4K0KF 3V6HA 2RKIA 2GAGC 2BACA 1G3OA 3WC0A 1U47A 1WTBA 2BQUA 2CQ3A 3KJVA 2HLUA 4EFAC 3IG1B 1ZAXA 2I8EA 5LSLA 4FF4A 1RWOB 2KJVA 1B3TA 3Q24A 4NLTA 2WONA 1UFWA 4IO9Q 2KG0A 4CZCA 1HMVA 4CQ1A 2ZD1A 1ZAVA 3N4WA 4UTGA 2BJ3A 2PSZA 4B3RF 4NWBA 4IO1A 3ZZZA 2HRUA 2AHOB 2R2RA 2DGWA 3RW7A 3HHNB 1NHKL 3UPFA 2JDJA 5KOXA 4IH5A 3PHEA 3Q8YA 2Z2YB 2IAJB 4J37A 3HHKA 3V6JA 5D3GB 1BHNA 2ZZNA 2WCXA 1BXNA 2YNHB 3IBCB 4AFFA 2H5EA 1OY6A 1OSCA 4WK1A 3RRKA 3NGRA 4C8LA 4WFBQ 2ZWOA 4RL1A 5CYMA 5J1NA 4TKTA 2C3MA 3BS9A 1NB2A 1T9XA 2VG5A 1XN9A 2O1PA 4DV6J 2MSSA 4CO3A 2XHCA 4K4VA 4NOHA 4NX9A 4ZPBA 1HPZA 1X9WA 2F40A 3TUZC 2C3YA 1YLXA 2RQKA 3MPVA 5KT2A 4IYQA 1F2GA 2DHXA 3FEXB 4KV8B 2FHOB 4ZLNA 2MPUA 4G1QB 1TMMA 1HBNB 2V94A 5C24B 1QAXA 1EIYB 1HARA 3PW4A 2WOMB 2ZOFA 1PGZA 2ZDPA 2DT9A 2D3OR 3GU0A 3AB4B 2VJVA 2AYMA 2CG8A 5IM0B 4X65J 4WBFA 3CJ4A 4L3NA 3BKTA 3AA9A 2BYCA 2QN6B 1Z4UA 3KMQA 2VB6A 3PXGa 1IBMF 1XC9A 1AZSB 3OL6A 3B4MA 2RVJA 2GGPA 4KH1B 4JI5J 5SUHA 1RWNB 4URSA 3D6FB 2GIQA 2VONA 2IDEA 4CYUB 2FDNA 3DLBA 2ABYA 1HKAA 2XHWA 1KN6A 4ZJLA 3LTOA 3W5XA 5B09A 1J5EF 1DTQA 1L3VA 3MXHP 4I56A 4A8OA 3BO4A 1LW2A 3PEHA 4CLFA 1N56A 2IJNA 3PJXA 2ZH8A 1UMJA 2VBXA 4OJHA 2BJ8A 1SH3A 2KFNA 3MPDA 5HMWA 3UD4P 5B0BA 5GAEU 3QT7A 4S0MA 2HBZB 3SZ2A 2EG2A 3H42A 4B3SJ 4ZP6A 5G4DA 3VAGA 2OI2A 2RS8A 3VHQA 4DR3F 4LF4J 4CT9A 3A8IA 5GADI 1WDDA 3PYGA 1G4CA 4AE5A 3VGSA 2DPIA 5F8LA 1REVB 1N36J 1X9SA 4JI0F 1WOPA 5BYQA 4P2FA 3CCRS 3TVKA 3ZZOA 2Z2LA 1MSWD 3IG1A 5DZ7A 2M9KA 4CNZA 4OL8A 2GS8A 5U47A 2BRKA 1ZAWA 1U2FA 4YB7A 1FRHA 1RBLA 3GYNA 1R8BA 2PIIA 2CXEA 2LLZA 4RWWA 3L7PA 2YQ0A 2EFVA 2C2KB 5EDWA 2DEJA 1DFDA 3G71S 4QWDA 4LUBA 3GIMA 5HJXA 8AT1B 1SKWA 3CD7A 1Z2LA 2BJ1A 3ILIA 3NGDA 2CAJA 4BC7A 2HRYA 1URRA 2IAJA 1VBZA 5D3GA 2HMIB 3NWGA 1MWYA 3FJ2A 1NHUA 2NUHA 3GV8B 3AQPA 2YNHA 4MKAA 2YX4A 3EYZA 1NDLA 4B3MJ 1T3OA 3KHLA 2UXDF 2AZ1A 4OYXA 4WKYA 3ILOA 5C2GA 1W26A 5D4LA 1GXTA 3T1AA 5CD4H 4P2XA 4J9KA 2R2TA 3IMQJ 3N28A 4TN2A 2DNRA 3R5CA 2HVDA 2YWGA 2VUGA 3GG1A 4Q8EA 1N48A 3DC2A 1XTZA 1WSRA 3MM5B 1Q8BA 3SEOA 3PG9A 1IR1A 1QDUB 2EW9A 3OFGA 3V4IB 1Q53A 4EBEA 4KV8A 1Q8KA 3FVYA 4R8UB 1HBNA 3W64A 5C24A 2Y9HA 4DR2J 4ALZA 4C8ZA 3RBDA 4UUWA 3KJQB 5H9FJ 2JC1A 3EGWB 4PYDA 2MYFA 4MTPA 2WOMA 3JB9k 2C2OB 1NNDA 5IM0A 1YJ7A 3KMSA 2RHQB 1MN7A 4DR6J 3LOUA 5F9NA 4KRWA 2R8KA 2D41A 4E8UA 1RWMB 1T9VA 2AT1B 4C98A 4C6AA 1TVRA 1KEKA 1AZSA 1CQMA 3E51A 3M2VB 1S77D 3TNVA 4EBDA 5CQGA 5L46A 2GHVC 3KKFA 1UEKA 2HNZB 3DNCA 1LFWA 3T3FA 1VISA 2YH0A 1UCNA 4RW9B 3G8QA 3AXMA 4CYUA 4YDXA 3S7RA 3V6DB 1FDDA 5FD1A 4E0DA 3W9JA 2Z0GA 5BYRA 3WDOA 2LMIA 2ZHAA 3PO5A 3SI8A 1J2VA 1NRKA 2XMVA 3OJUA 1YBAA 4YUDA 5ITHA 5E3QA 1RHUB 3VAIA 3POTB 3RAMA 2X3GA 1N5SA 4WKRA 3MPWA 4WFZA 4DX6A 5K14B 1DQ9A 1HBOB 2HQIA 2RDDA 2WHOA 4DCJB 4CNYA 3MR3A 3NCPA 3TA0A 4PG7A 4LF9J 1WELA 3VGTA 2JH3A 2E66A 1EKRA 1R8HA 4EZ9A 4K59A 4CO2A 4ZDNA 2HHSA 3I9V9 4RW6B 3T41A 2ROGA 1QUPA 1REVA 4ZP7A 2V9WA 1RA6A 2CQHA 3GIRA 2Z58B 1DLOB 3NGKA 3NXZA 4JI2J 3CDUA 4PCQA 2QFIA 3ENWA 3L9ZA 4DFJA 1CBKA 1J27A 4C8MA 3MR5A 1RQ0A 5A2QY 3ENAA 3PYDA 1FTRA 4X65F 4QWAA 1NJXA 1S1WB 1TL3A 3HKWA 1TL1A 4PWUA 1ZPWX 4DLGA 4YQWA 1FKOA 4CM2A 4TNOA 2EFPA 3DU6A 1PG5B 5ADZA 1HBUB 4IH6A 3VVTA 2UU9J 3MMCB 4JI5F 2CDRB 1NEEA 1EP4B 5JJBA 2HMIA 2LQJA 3JAMY 2J0WA 1RA7A 3OTCA 2A0FB 4DSKA 4YS2A 3CW2C 2CPEA 1HYSB 1S6PB 1YI2S 1EARA 3CEDA 3N0VA 3AOBA 1ZM4A 1GMUA 1D8YA 4WK3A 4OI4A 4DPTA 1N5TA 3LW5C 5EUHA 2HAIA 3MAAA 3IR6B 5HJYA 1S10A 3MM5A 2QJ3A 4NASA 5DJBA 3TJ9A 2YKOA 1TMJA 4C2MA 5CABA 2GNKA 5FDLB 2BOAA 3FUYA 3V4IA 1N6QB 2ROEA 3BQ1A 4QWEA 1KOHA 4QQBA 4JUZA 4IRKA 4R8UA 4B3SF 4KO0B 2RE1A 1R0BG 2QX0A 1RABB 2BW2A 4NE9C 2F4VJ 3Q0AA 5KG2A 1ZETA 2GMHA 1QTNB 3RAQA 4KR0B 1N36F 1SB6A 4B9TA 5DM6Q 4J9PA 5LT5A 1WHXA 3ZNUA 4J9VA 2PGCA 2DNMA 4EO8A 2V8DA 3M2VA 1RT1B 1HHTP 4LT6A 3D28A 4OYMA 4WP3A 1CJVB 4DV4J 2ASDA 3OTEA 1EKSA 3KK3B 2HNZA 1RHKB 1GMWA 4HTIA 5IXUA 4RW9A 1XIQA 1KR4A 1VRTA 2JEJA 3V6DA 3VALA 2UVUA 4EYHB 3KWMA 1RAAB 2EI5A 4Q45A 3LF0A 4LFBJ 3M8QB 4USMA 4B02A 1YSJA 1XMOJ 4BBYA 4WZMA 4B3MF 1R6YA 3POTA 2CPZA 5HBMA 3MCNA 1QSSA 1JXVA 3DXBA 5KFRA 4WP9A 5K14A 4RUHA 3KUEA 1IQZA 2W4PA 5CH7B 1HBOA 4OHWA 3I0SB 2KXHA 1RWUA 3UDCA 4A8XA 1P27B 4RNFA 1VQ7S 3WZ0A 3UR3C 2DHHA 3SFUA 4U7UK 3MM9B 1K0TA 4GVLA 4YB5A 5E33A 1MW7A 4ID5A 1QSLA 4AL7A 4RW6A 1Q1KA 3CDBA 1YRXA 1X4GA 1ACMB 2G1HA 2W9CA 5BJRA 4UY85 2R7XA 3EX7B 2ZNYA 1DLOA 5T7LB 3HXMA 3J7Z5 4CRJA 5KFJA 3H2LA 4DR6F 3VCDA 3TA2A 1S1WA 2PT0A 3GTYX 5AXNA 8ATCB 2I9SA 5K8NA 1PJ7A 3HI9A 2V2QA 2AIRB 1HBUA 1NDKA 1KBRA 2RIJA 3D9BA 4V1Ak 3MMCA 5L1KA 4L3KA 3CDEA 1EP4A 4RPFA 1KLMB 2MKHA 3BGUA 3BDPA 2CQ1A 1WEYA 2J9DE 2YWWA 3US5A 1SV5A 3PZPA 1HYSA 3SSSA 1RTZA 2H48B 4FVCA 1IUJA 1S6PA 2I38A 2IHR1 5E2QA 4LRAA 1B0TA 4ECUA 1YX2A 3KLGB 2KTQA 1V3RA 1S7HA 3H0PA 3THTA 2L3MA 1WOOA 2XM3A 2JOQA 2WW8A 1T03B 2HS4A 1UW4A 3AT1B 2GMLA 1K0VA 1BLUA 4ECXA 1GT8A 2VPWB 4WF9Q 4JI4J 4UOGA 3IRWP 3DDNA 1N6QA 5AXMA 4D3GA 4LF9F 2XLKA 4F3MA 1I1GA 2B9YA 1U1KA 2DNZA 2C2EA 1FESA 4OZ3A 1TUVA 4M5MA 1SCJB 3OVAA 2IVMA 1GFWB 2OAUA 3A12A 4G1IA 1QAJA 5KFGA 4TYBA 1AUSL 4JI2F 2FLLA 2MQLA 5GAEI 1UZHA 3EVWA 3HJVA 3JTNA 4EO6A 1RT1A 5HSPA 2DRDA 1CJVA 4B3OB 3QRQA 2L9DA 3KK3A 1RAGB 4J9LA 2WBMA 2N7CA 2DCLA 1SBRA 2UU9F 5KFIA 1HHQA 2DITA 4B17A 4KSEB 5LXRA 3C2PA 3NEKA 1R43A 3M8QA 3Q86A 4MYUA 2KRBA 3D6TB 2BANB 2YVSA 3Q83A 3QWPA 1X0FA 1IKYB 3K5PA 5IV4A 2X3DA 1WEXA 1FXDA 1I5OB 3S01A 4ZPAA 5D15A 4PXEA 2N3LA 4CH1A 1O8BA 4LJMA 2MZ1A 3I31A 3MTKA 3I0SA 5IT0A 4C0BA 3W60A 2JEGA 4JV0A 1BD6A 3IWXA 1GH8A 2BDPA 4J9SA 1CLFA 5KG0A 4B9MA 3DLEA 4M5LA 2CNKB 3M8RA 1HI8A 3MM9A 5J2MB 3NGSA 9RUBA 1U1LA 2R7SA 2BOPA 4JYAF 4ICLB 2OKQA 3K0JA 3AY0A 4OI2A 4PKDB 1H0HB 2F4VF 2X7IA 2HHQA 2ZBCA 3AODA 2FZKB 2AU0A 5T7LA 3CWJA 3GIIA 5KT6A 1QY7A 2VH7A 2OMOA 4ZVOB 1ZA1B 4JV5J 3UFCX 5J2QB 4LRFA 3BSAA 3OT9A 1ELOA 3J7A1 1T9TA 3J81Y 1ZTTA 2ZH7A 2OEKA 3MM7B 4DV4F 4NA2A 3CCWA 2B6AB 4HDGA 2PMZD 1YQHA 3LA0A 4YP3A 4LF8F 3DHXA 2HGMA 4M5NA 3G8SA 4O3OA 3LP0A 1F5AA 1KLMA 4NA3A 1UA0A 2I2YA 3CMES 4ZP8A 2NLWA 2PC6A 1R0AB 4LFBF 2B4PA 2C3PA 1VCTA 2KVQE 3GJTB 1XMOF 2GJIA 4ZVUB 4AL5A 4UQTA 4IFYB 3RRHA 4DSLA 2MKYA 4XTTA 3KLGA 5DS7A 2HBQB 3BKUA 1QSYA 1PBAA 1RWWB 4TY8B 3QIPB 1RT2A 4USHA 1WKKA 1T03A 5IT4A 1EX8A 1Q79A 5HVGA 2J6SA 5D6GA 1VQKS 4ECYA 2VFUA 2AWZA 3IR7B 2RJZA 3W3SA 1HWJA 2HHXA 2HNYB 4I2QB 3H25A 1WG4A 4ED6A 2H9ZA 3JTOA 4EEYA 3SFGA 4FVMA 2DH9A 3TZXA 2MSTA 4A4JA 3W9IA 1UJ4A 1Q0NA 2H5JB 1KQFB 2HWTA 1W2IA 3MM8B 3BGFA 4QOTA 3K17A 1TQLA 4R0EA 4RBVA 4DPXA 4U8YA 3ZFVA 3PW0A 3QGHA 3G6ES 2POKA 4DZDA 2DGSA 2RSQA 2AMCB 2BEFA 1IKVB 4J9RA 3G82B 3SCKE 1RHMB 1OY9A 2E44A 2ATCB 1T05B 5I3UB 2ZZTA 2BANA 3OUYB 1IKYA 3IGNA 2XO6A 4IG0B 2YQ3A 1YBUA 2ZH1A 4RJVA 3P49B 1LW0B 1KS2A 2RQ4A 1OMSA 4J7CA 4IQMA 5KG6A 1RI7A 4FF3A 1S9EB 4LRDA 2ERRA 2VC1A 4JBCA 4ZN3A 1TKDA 4K5SA 2DBBA 4LF1A 1TK5A 2ALYB 3TEHB 2UUAF 5T14A 4JI4F 1OY8A 2EC0A 1Y3KA 4Y2AA 1FXLA 3UQSA 2C2ZB 2B5JB 2QE5A 5J2MA 4F4KA 2KM8C 2VQFJ 2CQBA 3HD1A 4ICLA 5KFAA 3T9ZA 3I87A 1NO8A 2NUUG 2FZCB 1NHVA 4DN9A 1F9EB 1VK3A 4QR0A 2IYIA 1B64A 2BJ9A 2QC3A 1RTJA 4DZ6A 4X66J 1WTFA 3L09A 3RYLA 1V3ZA 3Q89A 5GMEA 1RT7B 4DQIA 4ILLA 4H4KC 2A18A 2G0IA 5FLXU 2DIUA 3ZXWA 4M95A 1RAJA 4R5PB 4G1PA 2XBPA 4F04B 5J2QA 5J2PB 3IXQA 4DF8A 3E3XA 1JX4A 1VFJA 4OJGA 2DIVA 3DOKB 5AE1A 5DGBA 2K7KA 1QE1B 4DOZA 5LMNJ 1NJIT 3MM7A 2LFVA 2B6AA 3OL8A 2WTFA 2HHPA 3RJMB 4RW4B 1L3KA 1RT4B 2G1DA 3TI0A 4UOFA 2CPHA 4NCBA 4N56A 1R0AA 1LWCB 1ROFA 3H5UA 4P2SA 3FCHA 4HT7A 2QA2A 4NPOA 4IFYA 3BSNA 4NZ7A 3DLJA 2HQ3A 2VOOA 1U1MA 1K44A 5HL7Q 2XYHB 2VFVA 4TY8A 1HNIB 5KG4A 5LMUJ 1WG1A 4EZ6A 2V4JB 4PG6A 4C8YA 3K8VA 4NLQA 4K50A 1WD6A 2OPRB 3EJMA 1SC6A 4I2QA 3UI3A 1ZPVA 4U8VA 2A2DA 2PFDA 4Y3CA 7AT1B 1UAWA 5HROB 2DR9A 3MEDB 3GP9A 4CWBA 1WC5A 3OSPA 2GFFA 5IT9U 1Y00A 3W2VB 2Z4PA 5EWEA 2J7KA 2Z57B 3Q8PB 3ZNJ1 4QIWD 5CYQB 4V19X 3M8YA 1NKBA 3A8JA 1YRTA 1BMQB 3GFXA 2B9WA 4JV5F 1T9WA 4LR7A 2HHWA 4F4ZA 4ZLJA 2CQGA 1IKVA 3R9LA 4ZS6A 3CC4S 3G82A 2G2YA 4ECVA 1M1GA 4LF7J 1T05A 1JK9B 2QMXA 1Q5YA 4RLEA 1YITS 1TKTB 5E3RA 5I3UA 3VGUA 4LQ3A 4ES3A 2DNHA 2HEKA 1DJ0A 4ZPVR 1M5PC 4DR4J 3OUYA 5HN0A 2HGLA 3OTBA 2ILZA 4Z7YA 4IG0A 4EMDA 1B7FA 1EZZB 1YGYA 3KG0A 2MJUA 4OX6A 3UN5A 1LW0A 4ES1A 2HYIB 2DR8A 3QGGA 2J5AA 2WB4A 4DUYJ 2C3OA 2YKNB 1S9EA 3R7NB 2OGUA 3G9CA 1U1OA 4I2PB 3ULHA 3QT8A 4JI8J 2HQDA 2CDQA 2VFTA 5F8NA 1OWXA 2HG4A 2B5JA 3BF4A 1DTTB 1H72C 3BN4A 4CLKA 4DX5A 2D3O1 2WSFC 2OPPB 1SIZA 1HWUA 3GCXP 4OX8A 3VTIA 1T02A 3C16B 2B7CB 5G0RB 1NZAA 4R5PA 5J2PA 2ZBPA 1SQGA 1KHVA 3DOKA 4OI6A 1QE1A 2R8JA 3P8BB 2AEJA 3ISNC 2GJFA 4MFBB 2MKSA 2UUBJ 3EPGA 2Z56B 4RW4A 2R7OA 4EYIB 4YMEA 1RT4A 3H59A 5LJ3Y 2B8QA 4P7VA 3MCOA 2ZC4A 2UXCJ 5ETTA 1LEOA 1S49A 3FNNA 2IC3B 2VPYB 1CULB 1I6JA 2ZE2B 2DEIA 2BM0A 2WW4A 1GMWD 3C46A 1TL4A 3GV5B 1ZA2B 5HMYA 4O3RA 3KLVA 1BWVA 4ZA1A 1YJNS 5ETMA 2VDIA 1RCOB 2V4JA 4P7TA 4DHVA 1OYDA 1YJ9S 1UA1A 3OVBA 1X5OA 3GSDA 3D0HE 1OIAA 4WTOB 1M5SA 2LQBA 4OHXA 2E5JA 3EUNA 1PYTA 2VQFF 2HLTA 2QL5B 3BGRB 2M7SA 1YG0A 2IVYA 3MEDA 3N9UC 4OJ3A 2YX7A 4P73A 3W2VA 1E6YB 2IY5B 3WX4A 5GMDA 2D69A 3BGOP 4M5GA 1KFSA 3JSYA 1N5VA 1SKRA 3M30B 2L08A 5K5MA 3LGMA 1X60A 4FP9A 1U6FA 4USVA 2HZVA 3Q2TC 3FZ2A 2GO9A 3U1MA 3CIMA 3R3TA 1IBKJ 2UP1A 2IRUA 5LJ5Y 3TUIC 1JLQB 3P4UB 3BDEA 5LMNF 4I6WA 3KK2A 1Q7LB 5K8PA 2V2VA 1MROB 5E7OB 4QIVA 1N88A 3CCES 2O01C 1TKTA 1PJ5A 2FJAB 3W65A 4ZVHA 2LU1A 3L7OA 3TANA 4DJBA 1Y10A 4PXDA 1LWEB 3ETMA 4EGLA 5D0RA 5J1EB 2V4QA 3CD5A 3R27A 2FVRA 3V4MA 1SL1A 3H98A 5D8HB 4Q0BA 1WHWA 4H4MB 3KFWX 4I2PA 4NZ6A 5LMUF 2C28A 3W2WB 2XSJB 2B8PA 4ZHRB 4I64A 2W1BA 3GSIA 4QU7A 1C1BB 4KBIA 1DTTA 3UD3P 1JLBB 4F02A 3OTOJ 3MD1A 4K4WA 4FYYB 3I6PA 3FC9A 3RRGA 1KD1T 4ZMMA 4EU0A 3BGLA 1NKEA 4OZ2A 4TLQA 3VQTA 2XMUA 3OD2A 1V5IB 4CO0A 3DI6B 3Q22A 3K2YA 2VL1A 3PEJA 4Y2IA 3HFKA 2VF3A 2RRNA 5G0RA 3G2XA 1YK9A 1VQ4S 1T0TV 5D78A 1RTHB 1FRLA 3CDWA 5HQ8A 2CKWA 2ZEJA 1FX4A 2KJWA 2N4CA 5L39A 4GKJJ 4MFBA 4PYAA 4PXCA 3V2UC 2B43A 1RT6B 4ZCLA 3CJSA 4MK7A 3CCQS 4NLOA 1QD1A 1WORA 2O67A 1H38A 2OD4A 2I1RA 4ILRA 2P6SA 1A7GE 4NLRA 2IC3A 1CULA 2ZE2A 3AJDA 4DXLA 1LK5A 1JMTA 4R0JA 1NZ8A 3MEGB 3OBIA 4J91A 3FRYA 2F8MA 4ZLLA 2XMMA 4RW8B 2HIQA 1N4LA 2XY5A 4B3TJ 2CQPA 3L95X 4DUYF 3NP5A 3NWRA 4W4MA 2W2QP 3M7VA 3MEEB 4E2FB 4JI8F 4WFYA 4FZVA 4UW2A 3EWGA 7FDRA 4GKKJ 2MHNA 4K8RA 2FLNA 5IQ6A 3FDSA 3P96A 3V6KA 2UZAA 1B7YB 3BGRA 2BVZA 2H3EB 4MK9A 3NOCA 2V0NA 2ZZMA 1E6YA 5H9EJ 2DB1A 4AUKA 3N6MA 3QWUA 2UV8G 3V5RA 2PD1A 4K4UA 3M30A 4ED4A 4Y0FA 3THVA 2YNIA 1GTHA 1NSAA 3GFHA 4GRSA 1S6QB 1KTQA 2YWEA 4ZK7M 1HD1A 5KOWA 4ED1A 2Y0BB 1U8SA 2B7BB 5ETRA 1JLQA 3PFOA 1EB0A 2OFHX 5KFKA 1SJ4P 3NMRA 2AKWB 2DR6A 3FBEA 2UVVA 3PIPQ 2UUBF 2BQ3A 1MROA 5AXLA 3MFIA 2Q1LA 5I42B 3HHLC 2QLFB 3M6XA 2OSRA 3GV7B 2FC8A 5GADU 1IR2A 4NA1A 3T5JA 1BQMB 3V81A 4C8KA 1BQNB 3CB4A 4O3SA 3Q2SC 5J1EA 3ZZYA 4CI0B 5C2CA 2ZBQA 3CCUS 4QPXA 4OIXA 4OJ1A 2QL7B 1PYOB 1EETB 2ZH5A 2QFJA 3AH6A 2RILA 4H4MA 1UVMA 3H2UB 1FERA 3P45B 2IM0A 4RWXA 1T9UA 3W2WA 2XSJA 1M1KT 4CLWA 3CC7S 3Q8RB 4ID8A 1C1BA 2YWHA 2LQ5A 1JLBA 5CA5A 2U1AA 5BR8J 1KVIA 5ETSA 4UQGA 1XWLA 2LDYA 4CCHA 4QWCA 4IQXA 3DLHA 2R8IA 3NS5A 1S0VA 2RRBA 5B08A 1X5PA 4DSFA 4FNIA 4NEYA 1TFWA 3MR6A 3DI6A 2OTLS 4ZKAA 2NXJA 1S4FA 2HSEB 5KT3A 2WVEA 3HVWA 1MMLA 1RDRA 1JLGB 4A8QA 1G2EA 1RTHA 2W2MP 3D1OA 1IBKF 3OSNA 4OQJA 3IAS9 1J5OB 2BABA 2J8AA 1KC8T 1D8ZA 3WX8A 4RR5A 2MHEA 1RT6A 1FEHA 1NH8A 1FD8A 4P10A 4OHZA 2AGPA 3FMWA 4QIFA 1QAIA 3R7SB 2K06A 1QLNA 4NRUA 3MEGA 5CAAA 5J1PA 3C15B 4LVOP 4LBIA 3ZZRA 3D54A 3BV8A 4X64J 2KVIA 3TQEA 3GIKA 1JIHA 2E1AA 2V4RA 3CD0A 5E41A 1FFSB 2L9WA 3W9HA 1YJRA 2PA8D 4CDIA 1UVNA 3MEEA 3NBPB 2FUG9 3AQOA 3K5NA 3DDKA 2WVCA 3U27A 1ITPA 4X4SA 4QYZJ 4FDFA 3CULA 3OTOF 2PDAA 4MKVA 4X4PA 1RT3B 1TZ0A 4UY8T 2JC0A 4DF4A 4ZPTR 2KB2A 3RZAA 2GV1A 4OX9F 4M5DB 4RU2A 2HGNA 2PE8A 5F0WA 4MYTA 1IBMJ 3ETOA 3RBEA 3G8TA 2C2MB 2YNFB 4DU8A 4KHRA 5B0CA 2FIUA 4NYZA 3BH6B 2GW8A 2XZDB 1RAEB 4O4GB 4K2JA 4M8LA 4XK8C 4OYAA 4GKJF 3LAKA 2X1BA 5GAHI 5I42A 2CPFA 1Y0HA 3GLJA 1CJKB 3PJWA 4CLZA 6FDRA 2E1CA 1SKUB 1TK8A 3FQKA 1IN0A 5DDOC 1NK4A 2KL8A 1BQNA 3CC2S 4USUA 4UF4A 3U1NA 3QJPA 1U49A 5J2NA 4JI1J 1JLFB 2D74B 1UWAA 2GC8A 2VHGA 3DFEA 1UETA 4TU8A 4PPDA 3IRXB 1EETA 2HQCA 3HPOA 4PPZA 4W90B 4I67A 4WIIA 2DNLA 1IWGA 1SC4B 1Q4RA 3DGPB 5L1LA 2NCKL 3TOQA 4M1KA 2E9TA 1B0VA 3VVUA 2G2OA 3BSCA 4GKKF 4FS2A 1UPMB 5B0AA 1S97A 1FRMA 2YWKA 2FZGB 3DYAB 3B4DA 4LF5J 1WJ9A 4USKA 2VBWA 5FLXY 3MGJA 1V6HA 2OTJS 1PILA 4C0OC 1SUQA 5JVGQ 1VDHA 4U7UD 3I0RB 3UDLA 3PHTA 1Q8LA 3DMJB 4P2MA 2LVWA 3VWSA 3CTRA 3PR4A 1JLGA 2QYCA 3FFIB 2IM2A 4IR9A 1YKWA 2ZITA 3R2CJ 2ZUGA 2QMWA 3HVTA 5F8MA 1J5OA 1UEUA 4XO0A 5KFXA 2OSQA 1YVFA 4I68A 4NLVA 3BBCA 2FJWA 1S4EA 3FBBA 5HLFB 2RRAA 2KZMA 5E3PA 3LWLA 1T7PA 3DLLQ 2DNGA 1Q8IA 1JJ4A 1S59A 1TL7B 1FKPB 5LL6d 5KFEA 3C15A 4DR5J 1KQGB 2JSXA 5A6WA 4PWWA 2J7UA 2CNOB 3DLGA 1UW9A 3M9NB 4CTAA 3P3DA 2ZFHA 1ZZFA 5KFDA 2HURA 2X51A 3H4BA 4ZVEA 4DPOA 3PKYA 3LP2B 1RXOB 4N5SA 2R7UA 3NBPA 3HJFA 4KC5A 1DURA 3K57A 2HHHF 3D68A 2W2OP 3DOLB 4J9QA 3FBFA 3OXFA 1UKUA 5IT9Y 3NAIA 1U2RA 5BR8F 3Q8SB 1RT3A 1I3OB 3B78A 4M5DA 1Y7PA 3PACA 5BYSA 1KWMA 1TKXB 1JWWA 2O5DA 4OZ0A 2IMWP 4ZP9A 1R8PA 2AW0A 4ZLPA 2MDAA 1KQKA 2KXFA 3BEGB 3SCJE 2YNFA 4OYZA 4XPEA 4F25A 3MURP 3MCMA 3OR2B 2WSCC 1XNRF 3D0GE 2WVBA 1HQ2A 1HD0A 2HZCA 1SH0A 4O4GA 2YNGB 3D1QA 1L5UA 4Y28C 2E9RX 2RU3A 2K2PA 5DQGA 2NREA 2GVDA 1FF2A 1NPRA 1HNXJ 2QRRA 4N41A 2F9JA 1CJKA 3VZIA 4A8SA 3I9ZA 2YH1A 2OH2A 2CVEA 3MF5A 3A1YG 2JFKA 1DRZA 5JXSA 1S0OA 1X31C 2HK3A 3CCSS 3H8YA 2I5JB 1JLFA 2CPYA 1KVJA 1IXKA 3KNGA 4ZPDA 4ZVFA 1X4AA 3IRXA 3OHAA 2MEWA 4IG3B 5JVHQ 4QR2A 2ZVIA 5CD4A 2RNEA 4X64F 1V5VA 1TP7A 4ZCIA 3AOCA 1BC6A 3DGPA 4Z2XA 2NYIA 2EPIA 4DR7F 1VQYA 2ZJQQ 3DOMB 1XBWA 4DL5A 3CJ0A 3O6QA 3PTWA 5B0DA 2VASA 4DV1J 2JFDA 1TKZB 3GPAA 1JNRB 1EHWA 2XS2A 3DYAA 4DCOB 3HD2A 1H73A 3TP2A 3JSBA 5KFSA 3CCVS 2GO8A 2VICA 2ZBIA 1PCAA 3NG8A 4DUZJ 3FEZA 2J0SD 2LEPA 2Q3PA 3L3CA 3KLHB 3I0RA 1YZ6A 1CQNA 1C0TB 2EK1A 4IFVA 3DMJA 2A10A 3DDIA 3FFIA 3FKBA 1VC6A 1FVQA 2YQ1A 4V19J 3R5DA 2L41A 4C97A 3M9MB 2ACMA 3H5XA 1VQOS 4LSNB 1BGXT 2ZOMA 2FQQB 1GTEA 3EXYA 1NK9A 3QQCD 2ZH9A 5HP1B 5HLFA 5A8KB 1MWZA 3L7UA 1WC0A 4G3IA 4Q44A 4QJVA 1RGVA 1TL7A 1FKPA 1S99A 5EWGA 2UV8A 4F4YA 4CLYA 4Y2CA 4Z37A 4JI1F 1BUXA 1A9NB 2KRRA 1X4HA 3D0IE 1MLAA 5K20B 1M5HA 3JSMB 4X4QA 3LP2A 2HBRB 4J9UE 1G6BA 3HO1A 5KFOA 3CT9A 5M2PA 1D9FA 3CJQA 2HBYB 1FX2A 1IBCB 1LK7A 3DOLA 2E1PA 2DY1A 1FJGJ 2COLA 3I5BA 2ZWPA 4I1TA 1F9HA 3LGNA 2DD8S 1X4DA 2MLZA 4QCLA 3CCZA 1ZZNA 1H98A 2JHEA 1QJHA 3PNIA 4DQQA 4UZBA 3OHBA 4LF5F 1RZMA 1TKXA 3BREA 1R89A 1UTAA 4C3LA 3EDRB 1NMEB 2W01A 1H7WA 3W8PA 5H9FK 2K3IA 3OR2A 2WBRA 4G65A 1HWLA 2C2NA 1C0UB 3FEYB 1Y9OA 4F8RA 4LBHA 3QT6A 4DUTA 3HCXA 1AFIA 3MFHA 3M6UA 2G2ZA 1RACB 4N47A 4L74A 1GK8A 2W24A 3FK4A 1X8DA 2XY7A 2AD9A 2PEHA 1RYRA 3NRBA 3UR0A 2MQOA 2HHVA 2K1RB 5ETOA 2LA4A 2MZTA 1X9MA 2CQ0A 3CJ8A 3IFEA 1P6TA 4P9SA 3FZBA 4AXIA 2VODA 1ZH5A 2I5JA 3QATA 4AD6A 1O6XA 4DR5F 2P2CB 4IG3A 4QPTA 3MTJA 3C66A 5F0UA 4ZPWR 4J90A 2MQNA 2U2FA 5KFMA 3D3BJ 3PCOB 2MKJA 2OELA 1SKSA 2AJ2A 2UVWA 4DQRA 2R2SA 3DOMA 4G1QA 1K8AT 1WNEA 3VF0B 2ZH6A 1SJFA 2A6OA 5HQMA 1YJTA 1TKZA 3W63A 4HR2A 4K4YA 2FJXA 4GMKA 3BSOA 5DDPC 4ZVGA 3MOZA 2ZC3A 1GX5A 3CPWR 3DGVA 3KLHA 2M8DB 3CJKB 1C0TA 5DRKA 5C42B 1RAHB 2F63A 2KT5A 3BYRA 1NJWA 1WKJA 4HI2A 5DG8A 2DGQA 3GILA 4YR3A 4EBCA 2KZZA 1KHWA 1AUDA 3A3OB 4KH0B 2W7OA 3R6LB 4N8NA 4F50A 1YBTA 1G1XA 2YKAA 2F9DA 2DKOB 4YR0A 5K8OA 5HP1A 1HNXF 5A8KA 4KQZA 4LFAJ 4F2RA 4XDCA 3CF5Q 2FJEB 4FBTA 2RF2B 3HKZD 3SDEB 4RU9A 1ZS6A 3S8SA 4DMZA 2LKZA 4GC7A 4WYLA 1SJ3P 3PM9A 5GMKa 3CMAS 4KY3A 2CJKA 1VIOA 1IVZA 3QSYB 5M2RA 1JJ2R 2XZTB 4X4OA 2ROPA 2XMJA 4DQSA 2X1GA 5LXYA 3CO0P 3ZC4A 3MHYA 1TL5A 2ZM6J 4FYXB 4F0KA 1FWLA 2DK2A 3DU5A 3W7BA 2QA4G 1TUGB 4YFUA 2N4DA 1U48A 1QVGR 4USWA 1D9AA 5DO2A 1BQXA 3LP1B 2DRBA 2QA4S 1P9YA 4DV5J 2D9OA 3JAMU 2XLJA 3M2RB 4DV1F 2XYGB 2RAQA 3HVAA 4Y00A 2ZH2A 4B9VA 4F0MA 2EKYA 2X1AA 3TARA 2NXNA 4DUZF 1GEHA 4F36A 2PA3A 3SBMA 3R5BA 2AF6A 4JI7J 3RR8A 1RJJA 2ZJPQ 2LEBA 4PRFA 4PQAA 1N54B 5DETA 1KOOA 4ED0A 1C0UA 4MH8A 2Z2MA 1VHIA 2FJBB 5E3AA 4KGVB 3MR2A 1Y11A 3M8PB 2NPFA 4CP5A 5HI7A 2V8HA 2LXFA 4ECTA 4GO5X 3CJ5A 2XMKA 4X62J 4WZQA 4CM0A 5DG7A 4TY9A 1O51A 4USJC 1W25A 3PRVA 1H6KX 3GFZA 4YB1P 1WHYA 1NDPA 3HM9A 2FTRA 1HI0P 4ETZA 1CEZA 1JLEB 2HNDB 4ANEA 1XQIA 1KVKA 4WPAA 2Q6BA 1LFPA 4OYIA 4ZJQA 2ZUAA 3CCMS 3KLFB 2DGUA 2XZWA 3IO1A 1Q5VA 2OHDA 2R2UA 3KDOA 2D3ZA 3QYYA 1IR0A 1FDBA 4OHYA 1XEZA 1HQUB 2YWFA 2W7PA 2K7JA 2QV6A 1AB8A 2Y1JA 1GXLA 1F3FA 3JS9A 3C6TB 1HI1A 4C3MA 1JQGA 1ZTWA 1RU2A 2YKQA 2FLPA 4JYAJ 2A6MA 4N7TA 4ECZA 4DL6A 4Y2MA 4WE1B 2EFNA 3T1HJ 3T5KA 2RB7A 1FJGF 5E0OA 1NK7A 2CNLB 4WXOA 1PSDA 4OZ5A 1U1PA 3QBCA 3RB6A 4Y34A 5F8HA 1B99A 4ZIWA 2QA1A 4R25A 1PYSB 5KFNA 2BJ7A 3CJKA 2DRAA 3CUNA 5C42A 4KIAA 4NLYA 2OPSB 1LQ9A 4O4RA 1Z2ZA 2AJ4A 5CXTA 2HKEA 1NBEB 2OIHA 3TJAA 4CIOA 3KNAA 2DCUB 4LF8J 3GR1A 1SH2A 3KJNB 2AGOA 1AW0A 4YEAA 3ZTQA 2XG8A 1T11A 3THPA 4QR1A 1KSPA 1TV6B 3LWMA 2PMWA 3OR1B 3ILJA 2RKIB 4LFCJ 1S0MA 1NK8A 2HVIA 2M4MA 2V67A 4HTJA 3BO2A 4H4OB 1DQAA 1VK8A 1Q82T 2RF2A 3SDEA 2NPIA 2AZ3A 2AYEA 4PXBA 1HR0J 1NJZA 2WONB 1AA1B 2LXUA 2QO3A 4ECRA 4KGZB 4A46A 1NK0A 4DL7A 3U1LA 4NEZA 2XSFA 4M5KA 2MGZB 3HSJA 2RUGA 3CCLS 2HWHA 4BDPA 1A0OB 2CJQA 3K89A 2DHGA 2VBYA 1TR0A 1FDAA 3OV7A 4YB6A 3PJ9A 3LP1A 2Z30B 3DRYA 4Z7CA 1BWEA 2ASLA 2CQDA 2M88A 3M2RA 4CO1A 1U1QA 1H2UX 1RWXB 3IM9A 4FXWA 2H65B 1FRIA 5I3QA 1HFEL 5IZHA 4K7QA 4OZLA 3HMJG 4LR9A 3DLKB 3UO0A 3LPEA 2G0JA 1H2VZ 4DX8H 4P75A 2H5IB 2GX8A 1B70B 4W98A 1AT1B 4MMOA 3UDEA 3M8PA 5DM7Q 5DQIA 1HNWJ 1VQ9S 2YXLA 1U4BA 1NXIA 2CPIA 2E5IA 2BUNA 3J80U 4TLRA 5D4PA 3IWNC 4Y2KA 4X4RA 1SIWB 5LSOA 3GJQB 4P6QA 2J6TA 1Q81T 3A8EA 1S72S 2HFOA 1WUUA 2J6UA 5F8IA 4RUBA 2HNDA 2DTJA 2CUYA 2IJFA 4LFAF 2KHCA 5THWA 3PY8A 1S9GB 1KFDA 4LMZA 1AROP 4ZVQB 2FJVA 2DNYA 3KLFA 4OZJA 3VAMA 1PAUB 1B4SA 3MD3A 1K1QA 4TQRA 3LALA 1NDCA 4H4KA 2OLWA 3OTDA 1HQUA 3AJ1A 4CLSA 2UUAJ 1RHJB 2CJ9A 3C6TA 5FDLA 5KG5A 1HW9A 2OPQB 1OPZA 2JJ4D 5F41A 2B51A 3GB0A 1DQ8A 2ZM6F 1VOMA 4LR8A 1WKLA 4KO0A 4WE1A 2HVEA 4I7FB 1FHTA 2BQRA 4DV5F 3NMAA 2EVZA 2BXJA 4HYKA 5EX3A 3TZYA 1D9DA 5F9LA 3TUPA 5KFPA 2VQEJ 3OW2R 2AGQA 1VQMS 4RBUA 3RBZA 4Q7AA 2OPSA 4JI7F 3QGIA 1DHMA 4K4XA 2AX1A 5LM7E 2OP5A 4O3PA 1U6ZA 2E7XA 4URGA 2CQ2A 2HFNA 4OHVA 4M5HA 2C3UA 4DFPA 4J9NA 1TV6A 2QLJB 4X62F 3GONA 1JKHB 5KFCA 3MUTP 2V69A 3OR1A 3A4TA 1FDNA 2ASYA 1FEEA 1U7LA 4HLBA 4LQ9A 4NLSA 1U26A 2MB0B 4H4OA 3P5TL 2XMWA 4DR1J 1TAUA 4DQPA 3PRDA 5JUMA 3D2WA 3D3CJ 5KFZA 3ENQA 1YJUA 4L75A 1K73T 2ZKUA 2HVZA 2M3DA 3E2EA 4LIWA 3UN3A 2OFGX 2ZHOA 1FVSA 2QYGA 5K9FA 3F73A 3CD6S 4OX7A 3W5YA 1MWQA 1S12A 3J81U 1BE4A 3FSIA 2MGZA 2XB2D 3R97A 2LEAA 4PZVA 3R2DJ 1Y3JA 3Q8QB 1KKHA 2MLXA 2AEFA 2VPXB 2UUCJ 1WC6A 1ZOTA 3T1HF 4OV6A 2VOPA 1HLWA 2MQMA 3QJJA 2XO7A 2EK6A 4NLPA 4IR1A 3DLKA 4Q5VA 4KB7A 4GO7X 1N5QA 3A8KA 4YOEA 2Z2ZA 4PAAA 2WRMA 3ADAC 5A76A 2W2PP 1SQEA 1FFGB 2JNJA 5F3TA 3WBZA 4TYAA 1RAOA 3NS7B 1OQ6A 2NSCA 4IDKB 5L1IA 1S1UB 3KG1A 1N52B 3IP0A 3N6LA 5AJ3J 4A8MP 3DHWC 1HHSA 4LFCF 4M94A 1YJWS 1S9GA 2ACYA 4ZVRB 1G7CB 5AE3A 3EGVA 2J7WA 5D77A 1HR0F 2XWXA 1TVRB 1H74A 1VQ5S 2ADBA 4F67A 4DL0C 4N8OA 3UCGA 2PI4A 4TU7A 2ADCA 1JJCB 4TQSA 1H7XA 3KTQA 1QM9A 4HACB 4A48A 2OPQA 2IJRA 4J9MA 3HFZB 5IQQA 2AYBA 3M8ZA 3FSXA 4M5IA 2B3TB 5DG9A 1F5BA 4KT0C 4I7FA 5B0EA 1CS4B 1YTYA 4GC6A 2XTJP 2B56A 3EVMA 1R8AA 2RD5C 3UCUP 2V6AA 5ETLA 5KTQA 3GCWP 3M1VB 1RE1B 3BBBA 3T9NA 4NXMF 2DGXA 3SSRA 2HFVA 4B3OA 2HQGA 2ZBRA 4FKYA 3S1TA 1UWBB 1QAYA 3JQJA 1VBXA 4NZ0A 4JV2A 3QNWB 1HNWF 1JKHA 4FPIA 4F2SA 4X2BA 2HWIA 1HBMB 2AEMA 1R7IA 2BJDA 4CLUA 4A8FA 1RCXB 2MY8A 5DQHA 2G9OA 2DVIA 4ED7A 1FNOA 3UDVA 4OZ1A 3T5LA 3HT0A 1GNKA 1RP5A 2RDIA 1CC7A 2FD2A 1TL3B 3D66A 1TL1B 1FKOB 1SC1B 5B0FA 2B4UA 4ITSA 4DSEA 3R6GB 4WXWA 2VPZB 2JLEA 3FQLA 4OYPA 1N8RT 3TAQA 2VA2A 2HFUA 2B4VA 1K47A 3UN2A 5A8RB 3IA0A 2NS1B 1FXRA 1VS3A 3HHLB 1FFWB 4OZNA 3MOJB 4L73A 1SVDA 2EBGA 4BLGA 4XIUA 3MUMP 3MAAB 4J9OA 3PW5A 3ONQA 2G4BA 4X84A 2VQEF 2K8GA 2KU7A 3K7RA 2FGCA 4X4TA 4NLXA 5LOQA 5A6PA 1C4CA 5ETKA 2FLOA 4Q2LA 3NAHA 1LXJA 2BKNA 4DL3A 4IDKA 4D3HA 1S1UA 3OXGA 3CXCR 2IVFB 4DX7A 3F41A 1PC4A 2BM1A 1F3VA 4BCAA 3T6BA 2BJEA 1XK8A 3K5MA 3U7JA 4DR1F 1TAQA 2OEJA 3C14B 2NXCA 3MM6B 3CGIA 3EICA 1RYSA 4O44B 3HSZA 3QIPA 5GAGI 3CJRA 3K58A 5EWFA 3SMZA 2R7QA 2E5HA 4LF2A 3DM2B 4N77A 1N5YB 1IJEB 1UJ6A 4HACA 3W66A 5KFWA 1EJ7L 3HHDA 2V63A 2N3OA 5M2UA 3AJ2A 2BE2B 1DAXA 1VRTB 1M5VC 4IOAQ 2HNYA 5IV3A 5KT4A 3EPIA 1IM6A 3QFHA 4LIRA 5HVFA 1FJEB 4KAIA 1CS4A 4DS5A 1F2HA 2UUCF 1DZ5A 2NZCA 2DGOA 4PEOA 2FVSA 5HBMB 3BQ0A 2W9BB 4B08A 1OPIA 2KT2A 3MM8A 2FYXA 1IM4A 3AHPA 1T94A 4PG8A 2YY3A 3M4XA 3M1VA 4ES2A 4AQYJ 1U1NA 2JEIA 3PW7A 1WWHA 4DV6F 1KP6A 2ZH3A 2E5GA 4OI3A 1UWBA 4MAKA 2LU2A 4B9SA 4IKAA 4LSLB 2FPHX 3DRPB 1LKZA 2PEBA 2MLYA 2F1FA 4ID5B 2IM3A 4F0HA 2DR7A 1D3WA 1HBMA 1NLKL 2H51B 1UP1A 4LREA 2WAQD 3FSYA 3CJ3A 2W9CB 1HQEB 1WC1A 5AJ3F 2DNPA 3CE8A 2BV3A 1U02A 3JQKA 3HX9A 4PWDB 3OXLA 3KJFB 5HMZA 1IKWB 6AT1B 1WDTA 3KHRA 2CFXA 3VGVA 4QZVB 3TQ1A 1MU2B 3BM7A 5HMXA 3UE2A 3R1LA 1SJ1A 1RISA 2CQ4A 3W61A 4MIAA 1RBAA 3GE9A 3FCWA 1NKCA 4PG5A 2ZHBA 2FGOA 5ETNA 1TTHB 1KLNA 2D1CA 5A8RA 5IC6B 1T95A 5B7WA 1SV5B 4ZCMA 1N32J 2NZ4A 3Q23A 5GAHU 2FHMA 4BWJA 4RNOA 1YRUA 1M5OC 3HK2A 2AX0A 3HHLA 4F3QA 3NNHA 1RT7A 4C9DA 1GMVA 4JI6J 2R7TA 3M8SA 1WOSA 1RHQB 4IOBA 4ECSA 1FI4A 3PVXA 2R7RA 3N6NA 1S6UA 3TVZA 2JWNA 2Y8WA 3AAWB 3EZOA 4P72A 1K9MT 3O44A 2BZ2A 1WF2A 1D0EA 5IS2A 1Q86T 4PR6A 4MJKA 4I4BA 1RAFB 4ZJOA 2VKZG 3CJTA 2LECA 4K2XA 2JLFA 1RAIB 2QLXA 3NKYA 4LF4F 2R4FA 3MUVP 4MKBA 3I4PA 4URQU 1U09A 4DWIA 4QU6A 1LWCA 1U45A 3BR9A 4HDHA 1NK5A 2AJFE 1VC0A 3A3PB 3L4BC 1FJCA 2IMOA 2W8KA 4Q2MA 2HVHA 4FPRA 2YX1A 3C14A 3AD7C 4C48A 3H5YA 3MM6A 2ALZA 1D1UA 1X4FA 4KGXB 1ULRA 3GMGA 4O44A 1F9FA 3ELHA 2XS7A 1HNIA 3IS9B 3PW2A 1NM2A 2I0XA 1M0SA 4MKYA 2GQQA 3DM2A 1N5YA 5AE2A 4QWBA 1LV5A 3TRGA 2DO0A 1FWPA 3D67A 3W1YC 2BE2A 3SSQA 1YIJS 2OEMA 2OPRA 4OV1A 1W2BR 2DXDA 2HPUA 2J0XA 5HROA 5BXIA 3ICLA 1FO1A 2QIFA 3FGVA 1R6VA 4IRDA 2W9BA 1P1TA 1S9FA 2HIYA 2LDIA 2AJ0A 5CYQA 1RWPB
chains in the Genus database with same CATH topology
2DGVA 1T05B 1M5HA 2XEXA 5D4OA 3JSMB 2IRXA 4X4QA 3KJVB 1FRKA 3M6WA 2BBEA 3LP2A 5KFTA 1T8EA 1FA0A 3T6JA 3J7ZT 3TX8A 4ELVA 1MMDA 1G6BA 5I3UB 3HO1A 5KFOA 3CT9A 2BANA 5M2PA 1UJ5A 3KYLA 3EZUA 1D9FA 2FVQA 3OUYB 1IKYA 3IGNA 1GX6A 3LQVA 3SXLA 1HMVB 1LK7A 2V2KA 3DOLA 4A8KA 2ZD1B 4IG0B 2YQ3A 4O3NA 4WFNQ 2JLGA 2COLA 3I5BA 4I1TA 4LSLA 3DLEB 3B82A 3CO9A 2ZH1A 3DRPA 3IC1A 3LGNA 2DD8S 1X4DA 4QCLA 3CCZA 1T3NA 3P49B 2CQIA 3TAPA 3GIJA 3LPYA 1LW0B 4FS1A 1ZZNA 4NLUA 1KS2A 5L8RC 3G6YA 1H98A 5L38A 2JHEA 1QJHA 2RQ4A 3PNIA 4C8NA 3T1YF 2UUWA 4DQQA 3OHBA 4LF5F 4IQMA 4YR2A 4DR2F 1TKXA 5KG6A 2NSBA 1RI7A 5K8MA 3IGVA 4FF3A 1S9EB 4C4WA 2P9CA 5CCMA 2ERRA 3BREA 6FD1A 2VC1A 1R89A 4UOCA 1HQEA 3E8OA 4JBCA 3NS6A 1TKDA 1PO6A 4C3LA 4K5SA 3KLEA 2KT3A 4HEA9 2DBBA 1VQLS 1TK5A 4O3QA 1U25A 3H5SA 2UUAF 1LWFA 1H7WA 2RU9A 5T14A 4JI4F 4I6AA 4RUCA 2EC0A 1Y3KA 4Y2AA 4DLEA 1FXLA 2K3IA 3OR2A 3UQSA 2WBRA 1HWLA 1C0UB 2B5JB 2QE5A 5KFUA 4PWDA 5J2MA 4F4KA 2KM8C 2W8LA 5F3ZA 3FEYB 4CT8A 1Y9OA 2A2CA 2CQBA 2RH3A 2MZQA 1IKWA 4W92B 3OLAA 4F8RA 4KPYA 2W9AA 4ICLA 5KFAA 3T9ZA 3I87A 1DARA 1NO8A 2NUUG 5CYMB 2CZ4A 4K5RA 4O23A 2YKNA 3O8WA 4JV1A 1NHVA 5L9XA 4DN9A 1E6VB 1VK3A 4QR0A 1MU2A 3M6UA 4RX6A 1R3NA 4CO4A 3MFHA 2IYIA 3PRBA 4N47A 2VKRA 1B64A 2W24A 1V3SA 2KDOA 2P6TA 2VG5B 1RTJA 1WTFA 1X8DA 3L09A 2LXIA 2XY7A 2AD9A 3ENVA 3RYLA 1V3ZA 1RT7B 2PEHA 1RYRA 4DQIA 2CPDA 1F5CA 3NRBA 3UR0A 4ILLA 4H4KC 2A18A 2MQOA 2DIUA 4MIWA 3OFFA 1FD2A 2HHVA 4M95A 3LP0B 3RR7A 4WYWA 1HPZB 2V5HG 4C11B 5CCLA 2K1RB 4MIBA 1RAJA 4B3TF 2DNNA 2LA4A 2UUTA 3MECB 4R5PB 4G1PA 2MZTA 2XBPA 5J2QA 1X9MA 2EBEA 1SJRA 5HO4A 5J2PB 1XNQF 4I0WA 2CQ0A 3IFEA 1P6TA 3IXQA 4DF8A 3E3XA 5EX0A 3FZBA 4AXIA 1UL3A 2VODA 1JX4A 1ZH5A 1VFJA 4OJGA 2DIVA 2I5JA 3SCLE 5KFQA 2OPPA 3DOKB 5AE1A 5DGBA 1S1XA 1WI6A 2K7KA 2DNOA 2AJ1A 2NR0A 1QE1B 2XCPA 3QPIA 4DOZA 1NJIT 3MM7A 4DR5F 1TFYA 2MKIA 5FJ4A 2B6AA 3T19A 3O5TB 3OL8A 3OVSA 3IBWA 4L6V3 4IG3A 2DH8A 4QPTA 2IM1A 2WTFA 2HHPA 3MTJA 5KG3A 3OLBA 2JX2A 3C66A 5F0UA 2VC0A 4WFXA 4RW4B 3LO3A 1L3KA 1P1LA 1CVJA 2F8HA 3ITHA 5A0YA 1RT4B 1JLEA 2G1DA 4ZPWR 2R8GA 3NL0A 3TI0A 2MQNA 1RT2B 2U2FA 4FN5A 4E98A 2CPHA 5KFMA 3R5AA 2MKJA 4NCBA 3GYXB 3QJLA 4AQYF 3N5FA 1SKSA 4N56A 2LQ9A 1R0AA 3NCRA 3MMBA 2UVWA 1N0UA 3SQGA 4DQRA 3BB5A 1LWCB 2R2SA 2XCAA 2Y0SD 1ROFA 4NMLA 3H5UA 2DPJA 3DOMA 2CZVC 2DHAA 4G1QA 4P2SA 4KHMA 1K8AT 3FCHA 1WNEA 4KGMA 4HT7A 4IFVB 3VF0B 4ED2A 2ZH6A 1C1CA 3DXSX 3RB3A 1SJFA 3OL9A 2QA2A 1X7VA 3IWLA 4NPOA 5EGYA 1O5JA 1UFLA 4IFYA 3J80Y 1YJTA 4XPCA 1TKZA 1S1VB 2DO4A 4K4YA 3BSNA 2FJXA 4NZ7A 1FKAF 3DLJA 3AA8A 2FHKA 2HQ3A 3ZZ0A 1IQTA 2VOOA 1U1MA 4FYDA 5HL7Q 2GGPB 2VFVA 4GMKA 4TY8A 3BSOA 4AXJA 1NH7A 1Z1ZA 5DDPC 4ZVGA 3MOZA 2ZC3A 2XWYA 1HNIB 1GX5A 4K4TA 4U9RA 4O0IA 3CPWR 5KG4A 3M32A 3KLHA 4DG1A 3HF5A 2M8DB 3CJKB 1WG1A 4EZ6A 1C0TA 5DRKA 4NCAA 1NU4A 1JLAB 2V4JB 3H4DA 5C42B 4PG6A 4C8YA 3ISZA 3K8VA 4NLQA 2KT5A 3F56A 4K50A 1OSDA 3PX0A 3VZHA 1WD6A 1DTQB 2CPJA 2OPRB 3VAKA 1S0NA 1NJWA 4WCEQ 1NAQA 1LW2B 1SC6A 4HI2A 2M0GB 4I2QA 2DGQA 4TXSA 3UI3A 1ZPVA 5DG8A 4Q43A 3OL7A 3I56S 3GILA 4YR3A 4K4ZA 4ELTA 4EBCA 2A2DA 2KZZA 2L9NA 1VQNS 1KHWA 1APSA 4QW9A 4Y3CA 3BZQA 5KT7A 1AUDA 2KHDA 1OS5A 2XLIA 1UAWA 3IS9A 5HROB 3MEDB 4EWTA 2DR9A 2R7VA 3HDSA 1CC8A 2W7OA 1C4AA 4AL6A 3OSPA 4N8NA 2GFFA 1JXLA 2R9LA 4F50A 1Y00A 1G1XA 2YKAA 2Z4PA 3W2VB 2FVCA 3MI7X 5EWEA 2J7KA 2F9DA 3PDNA 4YR0A 2P9EA 3Q8PB 3O1LA 3LH2S 5K8OA 5HP1A 3MMAB 3TUJC 4QIWD 1HNXF 5CYQB 5A8KA 4KQZA 4V19X 4F2RA 3O3LA 1IBLF 1NKBA 4FXDA 5EN1A 2G0CA 2E1MC 1VBYA 1YRTA 2KXNB 4XDCA 3I4HX 3CF5Q 2FJEB 4ECWA 4FBTA 3DRSB 2RF2B 1KONA 2SXLA 3CDAA 3GFXA 3HKZD 3SDEB 2RDJA 4RU9A 2B9WA 4OI0A 3S8SA 4Q8FA 4DMZA 1RTIB 4JV5F 1LOUA 2LKZA 2FC9A 4GC7A 3J7YU 4WYLA 2B4OA 5KG7A 2IA6A 1SJ3P 3HLUA 4OFZA 3PM9A 5GMKa 3CMAS 3CCJS 3EZ5A 3M9OB 2ZOGA 3N79A 2CJKA 1VIOA 2N7YA 2HHWA 2DH7A 1N32F 5M2RA 4F4ZA 4K0KF 3V6HA 1JJ2R 1FJ7A 3I32A 2RKIA 4X4OA 2CQGA 1IKVA 1XR7A 2ROPA 2XMJA 2BACA 4ZS6A 3CC4S 4DQSA 1G3OA 2KN4A 2X1GA 5LXYA 2R8HA 4ECVA 3WC0A 1T05A 1U47A 3ZC4A 2KFZA 1WTBA 4JI6F 2BQUA 2CQ3A 1JK9B 3MHYA 3TR5A 2QMXA 3KJVA 2HLUA 1TL5A 4RLEA 4EFAC 1YITS 1TKTB 1ZM9A 1ZAXA 2I8EA 3IG1B 5E3RA 5I3UA 4LQ3A 4ES3A 5LSLA 4FF4A 2DK2A 3DU5A 2DNHA 2KJVA 4ERDA 1DJ0A 3W7BA 3Q24A 2QA4G 4NLTA 4ZPVR 1RKJA 1M5PC 3NNAA 3OUYA 2WONA 5HN0A 1UFWA 2N4DA 4YFUA 1U48A 2HGLA 4IO9Q 1QVGR 2KG0A 4CZCA 1D9AA 1HMVA 3OTBA 5DO2A 4HH1A 2ILZA 1BQXA 4CQ1A 2ZD1A 3NCQA 3LP1B 1ZAVA 4IG0A 3N4WA 1B7FA 2DRBA 1YGYA 3KK1B 2OMLA 2PSZA 3KG0A 2CJAA 4NWBA 2MJUA 4CH0S 2QA4S 4B3RF 2D9OA 1FRJA 3CJ2A 4IO1A 2QZ8A 4OX6A 3ZZZA 2XLJA 1LW0A 3M2RB 2HRUA 4ES1A 4DV1F 2HYIB 2DR8A 3QGGA 1U24A 3HVAA 4Y00A 2R2RA 2DGWA 2ZH2A 4B9VA 3RW7A 4IUFA 2J5AA 2WB4A 3HHNB 3UPFA 2A3JA 4X4UA 2JDJA 1DBDA 2C3OA 4IH5A 3PHEA 5KOXA 2YKNB 1S9EA 2EKYA 2M8HA 2X1AA 3TARA 2IAJB 2LCWA 2P9GA 4DUZF 4J37A 1U1OA 3HHKA 3G9CA 2PA3A 3R5BA 3V6JA 5D3GB 1RTJB 1VRUB 4I2PB 4NYPA 2ZZNA 2WCXA 2RT3A 3ULHA 2AF6A 4ECQA 3RR8A 1RJJA 2ZJPQ 3DRRB 2LEBA 1LWEA 2QLWA 3HHEA 3I96A 4PRFA 4PQAA 2YNHB 4RZRA 2BR0A 2VFTA 1N54B 2CDQA 5DETA 4AFFA 5F8NA 1KOOA 1OWXA 4ED0A 1C0UA 2H5EA 2HG4A 4MH8A 2B5JA 2Z2MA 3BF4A 1OSCA 4WK1A 2FJBB 5E3AA 3RRKA 3MR2A 3M8PB 2NPFA 3KHHA 5KFVA 1DTTB 3BN4A 4C8LA 4WFBQ 5HI7A 2V8HA 2LXFA 4ECTA 5CYMA 2B0GA 5J1NA 4TKTA 2XY6A 4GO5X 3CJ5A 2XMKA 4WZQA 3KG4A 5DG7A 1E6VA 2C3MA 3BS9A 4TY9A 1O51A 2WSFC 2OPPB 4USJC 2VG5A 1W25A 5E5NA 1H6KX 2NQPA 1SIZA 3GFZA 1HWUA 1XN9A 2O1PA 2MSSA 4OX8A 4CO3A 4K4VA 4YB1P 4NOHA 1WHYA 4ZHRA 3RU0A 3VTIA 4NX9A 1T02A 3HM9A 2FTRA 4ZPBA 1HPZA 4C11A 2F40A 4ETZA 3TUZC 1X9WA 1HI0P 1CEZA 1JLEB 2B7CB 4JOUA 2HNDB 1HL6A 2C3YA 2RQKA 3MECA 2CRLA 5G0RB 1NZAA 4R5PA 3MPVA 2Q6BA 5KT2A 1LFPA 2EWHA 2K3KA 5J2PA 3DCAA 3IR5B 1KHVA 4IYQA 3KLIB 1F2GA 2DHXA 4USIA 4BHQA 3FEXB 3K59A 4KV8B 2FHOB 2MPUA 2D3UA 3DOKA 4G1QB 2DGUA 3KLFB 3CCMS 4DBQA 1HBNB 2V94A 1QE1A 4OI6A 3H40A 5F8JA 2XZWA 3IO1A 2R8JA 5C24B 1QAXA 3VQSA 2R2UA 3ISNC 2JL9A 4MFBB 2MKSA 2D3ZA 3LUYA 1HARA 2HHTA 3QYYA 1IR0A 3EPGA 1FDBA 4OHYA 1XEZA 3PW4A 4RW4A 2R7OA 1S1TB 1HQUB 2YWFA 2W7PA 4EYIB 2RS2A 4FF2A 2K7JA 2QV6A 2WOMB 1RT4A 3H59A 2ZOFA 4YMEA 5LJ3Y 2Y1JA 1PGZA 1GXLA 2ZDPA 4P7VA 5KFBA 1U6BA 2DT9A 3ISND 2KO1A 3C6TB 5DLGA 1HI1A 2D3OR 1FE0A 3AB4B 4C3MA 2ZC4A 2KH9A 2AYMA 2GMJA 5IM0B 1ZTWA 1S49A 2FHJA 3CJ4A 4L3NA 3AA9A 3FNNA 2YKQA 2FLPA 2BYCA 4BC9A 2IC3B 2PI5A 2VPYB 4ECZA 4DL6A 2VA3A 1I6JA 2ZE2B 4Y2MA 1Z4UA 4B9NA 3KMQA 2BM0A 2M70A 2VB6A 3PXGa 4A8YA 4WE1B 2EFNA 1IBMF 1XC9A 2DNKA 3C46A 3OL6A 2E5LF 3T5KA 1S1VA 2RB7A 1TL4A 1FJGF 2PO4A 5E0OA 3GV5B 3B4MA 2RVJA 1NK7A 1X4CA 5HMYA 4O3RA 4WXOA 3KLVA 1PSDA 4OZ5A 2GGPA 3QO9B 4ZA1A 1U1PA 2ZDOA 5SUHA 3RB6A 4Y34A 5F8HA 1YJNS 2G13A 1URNA 4URSA 1A6LA 2QA1A 1HWIA 2GIQA 4R25A 2VONA 5KFNA 2FDNA 3CJKA 3DLBA 2ZJRQ 2DRAA 3CUNA 1RT5B 1JLAA 2V4JA 2VZ9A 2ABYA 4P7TA 4DHVA 5C42A 5MAOA 1VQ8S 2P5VA 2XHWA 4KIAA 4NLYA 1KN6A 1YJ9S 1UA1A 2OPSB 1LQ9A 4O4RA 3OVBA 2MKCA 1X5OA 1Z2ZA 3D0HE 3GSDA 5B09A 4RNMA 1J5EF 1DTQA 1L3VA 1RTDB 3MXHP 4I56A 1OIAA 2AJ4A 4A8OA 1M5SA 4RNHA 3BO4A 1LW2A 2LQBA 5CXTA 1SL0A 2IA0A 3PEHA 4OHXA 2OIHA 1N56A 4RW8A 3MZIA 4CIOA 2E5JA 3EUNA 3KNAA 1CPZA 2DCUB 1R31A 2IJNA 2VQFF 2HLTA 3GR1A 4TU9A 1SH2A 2AGOA 1QTMA 1AW0A 3BGRB 3PJXA 2M7SA 4YEAA 1YG0A 2IVYA 2XG8A 3MEDA 2ZH8A 4RNNA 2JRSA 1UMJA 4OI1A 3THPA 4QR1A 2VBXA 4OJHA 1KSPA 1TV6B 3N9UC 1SH3A 4OJ3A 3LWMA 1SI9A 2YX7A 2CPXA 3W2VA 3OR1B 1E6YB 1N34F 2KFNA 2RKIB 3WX4A 1S0MA 1NK8A 2HVIA 2M4MA 2CVIA 1JNZB 5HMWA 3UD4P 1KFSA 3JSYA 5B0BA 5GAEU 3MMAA 2FJDB 4HTJA 3BO2A 1N5VA 1SKRA 4H4OB 3M30B 2L08A 1DQAA 2L48A 5K5MA 1VK8A 3LGMA 4BWMA 1JLCB 2M5YA 4FP9A 1L3UA 3SZ2A 1VLYA 3DRSA 1Q82T 2RF2A 3C3LA 1U6FA 1YJVA 2EG2A 3D1HA 3SDEA 1WG5A 2NPIA 2AYEA 3PFEA 2GIRA 4PXBA 1RTIA 4ZP6A 5G4DA 3Q2TC 3FZ2A 2GO9A 3PKMA 3VAGA 5KFFA 4X4VA 2RS8A 1NJZA 3U1MA 4DR3F 4CT9A 2WONB 3CIMA 5GADI 3R3TA 2UP1A 2LXUA 2IRUA 2QO3A 5LJ5Y 3TUIC 1JLQB 4ECRA 5L9NA 1FNMA 4AE5A 2DPIA 3GWCA 5F8LA 3MEKA 3BDEA 4BS2A 5LMNF 4A46A 4I6WA 1REVB 3KK2A 1Q7LB 1X9SA 4JI0F 1NK0A 5K8PA 4DL7A 1MROB 1C2PA 5E7OB 5BYQA 3U1LA 2PFFB 3CCRS 3MDFA 3TVKA 4QIVA 4KE5A 2XSFA 1N88A 3CCES 1S6QA 4HKQA 3ZZOA 2O01C 1TKTA 2MGZB 2Z2LA 1MSWD 3IG1A 2M9KA 2DNQA 4CNZA 4A8WA 2FJAB 2RUGA 3CCLS 4ZVHA 4OL8A 5U47A 2HWHA 2BRKA 2LU1A 4BDPA 1ZAWA 2CJQA 3L7OA 2KI2A 1P9QC 2DHGA 2VBYA 1U2FA 4YB7A 1TR0A 3TANA 4DJBA 1KNZA 1FRHA 1FDAA 3GYNA 1R8BA 4DSJA 3OV7A 2KYXA 1Q16B 4YB6A 3F44A 3LP1A 2VBZA 2PIIA 4PXDA 1LWEB 3DRYA 3KK1A 2PN6A 2LLZA 4RWWA 3L7PA 3TAMB 2EFVA 5EDWA 4EGLA 1BWEA 1HWKA 1DFDA 3G71S 4QWDA 4LUBA 3GIMA 2ASLA 2CQDA 2M88A 5J1EB 5IWAF 3M2RA 5C5JA 1SKWA 2V4QA 3CD7A 4CO1A 1U1QA 1H2UX 3UNGC 1Z2LA 3CD5A 3R27A 4FXWA 2FVRA 1WEZA 2GHWA 4XDDA 1FRIA 3V4MA 3NGDA 1SL1A 5I3QA 1HFEL</