1CQNA

Protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN S6
publication title Designed protein tetramer zipped together with a hydrophobic Alzheimer homology: a structural clue to amyloid assembly.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 24
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cqnA00
4YHHF 4DV4F 4JI6F 1G1XA 4LF8F 4B3MF 4JYAF 2J5AA 4NXNF 4LFBF 2RJZA 4DV5F 2BXJA 4JI8F 5IWAF 3T1HF 2UU9F 4DR4F 4JI2F 4LFAF 4B3SF 4LF4F 2UXBF 4DV7F 4JI1F 4DR5F 1G7CB 4JV5F 1B64A 4GKJF 4X62F 4JI0F 5LMUF 2B7BB 4DV1F 1N36F 2E5LF 5AJ3F 1I94F 2UUBF 4OX9F 3ZZPA 4DR6F 3R3TA 2UUCF 4DR3F 1N34F 1HR0F 2VQFF 4NXMF 2KJVA 4X65F 4B3TF 2KJWA 4DV2F 1N33F 4DV6F 1J5EF 1FKAF 5BR8F 2B7CB 4DV0F 1N32F 4DUYF 1IBMF 4JI7F 4YY3F 1XNRF 4JI3F 2F4VF 1QJHA 1F60B 4X64F 2VQEF 2UUAF 4LF7F 4B3RF 1HNXF 1CQNA 2ZM6F 1LOUA 4DR7F 1XNQF 4JI5F 1IJEB 1IBKF 1HNZF 4LF5F 4LF6F 4AQYF 1GH8A 1VMBA 1IJFB 4DV3F 4K0KF 3OTOF 4DR1F 1XMOF 2UXCF 3T1YF 4DUZF 4DR2F 2HHHF 4LFCF 1RISA 1FJGF 2YY3A 4GKKF 2UXDF 4X66F 1HNWF 1CQMA 4KHPF 4JI4F 2BVZA 4LF9F 1IBLF 1XMQF 5LMNF
chains in the Genus database with same CATH superfamily
3CC2S 5DZ7A 3TOQA 2VKZG 2XWXA 3FEYB 2VBXA 2WBMA 1RAIB 5HJXA 2K7JA 1FXRA 1X9WA 4QJVA 5DG7A 2FLLA 2QIFA 4DUZJ 3OFGA 4WZQA 4U6PA 2W7OA 3DXSX 2AHOB 3CXCR 4EUVA 1DLOA 4DL4A 3I0SA 1M1GA 4NCGB 6FDRA 4FF4A 2CVEA 1NM2A 3LP2A 3BSAA 4LFAJ 3THVA 5KFDA 1JLGA 1OS5A 3ZNJ1 1OJ4A 3MTJA 2YKAA 2K8GA 2IM0A 4AXJA 2C2NA 1F3VA 4D3GA 3MUVP 3OTEA 4ECUA 4DR2F 2OPQA 3JTPA 5GAHI 5A8WA 1SQFA 1FRIA 4IFVB 2HK3A 4PWDA 1TUGB 2FB0A 4OI0A 3D68A 1M0SA 4QPXA 3IAM9 1S9EB 1LW0A 3DGPA 1N33J 2VG5B 2MB0B 2RRBA 3BGRA 1UFLA 1S6OA 1VRUA 3NGTA 1D9AA 4ED1A 3HCXA 4RW7B 4K0KJ 3J81j 5HQMA 1FRKA 2QA4S 2A6OA 4F04B 2W2NP 3A8JA 2CKWA 4RUHA 1UEKA 4HTJA 3H90A 4KT0C 4EO8A 4MAKA 2V67A 5HJYA 4USIA 2J7UA 1ZAVA 2ZOMA 2FIUA 1B7YB 4TQRA 2WVFA 3GPAA 1WF0A 2K3KA 3RW7A 1FNMA 4GKJJ 1ZA1B 2YKOA 1WEYA 1REVB 4DX8H 4G1IA 3JSRA 5F8JA 1N6QB 5HL7Q 2QL7B 1CJVA 1GT8A 4LF5F 2H9ZA 3T6JA 5F0WA 3U7JA 4ES2A 4NLGA 4H4MB 2ASYA 5IT0A 1OQ6A 2MKHA 3W61A 2VA3A 3FSIA 3MR7A 5I3UA 4V19J 1PILA 4CP5A 3MM8B 4K2JA 3MM9A 3KTQA 2HG4A 1CULA 2LEPA 1QSLA 2ATLA 3CMAS 4O4RA 1RTHA 1M5VC 3CD0A 3A8EA 1B64A 4IH6A 3BN7A 2XEXA 3FGVA 4WYWA 4CO0A 1K9MT 4HDHA 1HWIA 4DSIA 4IH7A 3N01A 2RD5C 4C2MA 2G2OA 1QM9A 3W2VA 2SXLA 5IV3A 4EO6A 1HQUB 2H54B 2HNDB 4Q44A 3I5AA 2I8EA 2PA3A 2UVWA 2COLA 3KJVA 2IBKA 5KG2A 2GGPA 2KYXA 1EP4B 5IWAJ 2CPDA 2CG8A 2FZKB 1SC1B 1VC5A 3ISND 4JI1J 2HEKA 2CZ9A 4O3QA 2LQ8A 2OMOA 2MMYA 2MHNA 3J80Y 1HNXF 2RRNA 3JYTA 1T03B 2IYIA 4TYBA 1I94J 1Y11A 4U67Q 4EI2A 1NK5A 2FHKA 1T05B 2PEHA 4P2MA 3EPGA 1Z4UA 4XIUA 1R7IA 2DNGA 2LXUA 3JTNA 1FX4A 4GVLA 1DHMA 1ZS6A 1NH8A 4RU2A 4B9SA 3AQPA 3MM5B 1BXNA 3FKBA 2EPIA 4NLOA 3D3BJ 4JI8F 3AA8A 1HQEB 4KGKA 1O6XA 1FESA 3MPUB 4KQZA 4ZCIA 4Y2CA 4NRUA 4B3RJ 1DBDA 4DZDA 2OELA 2UUBF 3A3OB 3CO9A 3VAIA 4C8ZA 5H9FK 4NCAA 5HMYA 3R7SB 1LXNA 2HVZA 3FNNA 1JLFB 3RYLA 4ECZA 4XTTA 1TZ0A 2W2OP 2DH7A 2AGOA 2L08A 2VB6A 3CCWA 3BH7B 2FTRA 4OQJA 2XLKA 4IO9Q 1LW2A 3T6BA 2RUSA 4TU8A 2F9JA 1QE1A 1J2VA 4Y2MA 3KK1A 2R7VA 1GK8A 3OTOF 1JJHA 5ETLA 4WXWA 1KHWA 2IRUA 2EC2A 2YKQA 4JV0A 1HHTP 1U49A 4Y6IA 4FF1A 3VGSA 4GMKA 1DAXA 2WSEC 4N8NA 1FKPB 5D15A 1H98A 3VZIA 4JI7J 4A8MP 1N0UA 2DH8A 5F8GA 2IM1A 4ANDA 5LOQA 4ES1A 1JLAA 2BW7A 3GONA 1S9EA 3DLBA 2VG5A 3BSCA 3KK3B 5I3PA 4RW7A 4DUTA 2HK2A 1WG1A 3S01A 1VQ9S 2B7CB 1NRKA 3D7SB 5C42B 1YG0A 3NCQA 1HQ2A 4BWMA 2O3DA 2OLWA 2D3OR 2FDNA 4PKDB 1LOUA 1F6TA 4DDFA 1RB0A 2PO4A 4U7UD 1T11A 3TO8A 1TL5A 1RTIB 3C8YA 2XHCA 1REVA 4DSEA 2OPRB 4YEAA 2Q6BA 2YNHB 2EFPA 1HBNB 4ICLA 2AW0A 5HSPA 4OYBA 1OSDA 1Y00A 1SJ3P 4C11B 1UMJA 5KG6A 5BYQA 4DUYJ 2CZVC 3OD2A 3NRBA 2VA2A 2XNQA 4P72A 3ZZZA 3MM6A 4KV8B 3K57A 5IXUA 3D9BA 2MZQA 4PYAA 2R4FA 1RTZA 1A0OB 3PRDA 3DM2A 4NLVA 1P27B 5ETMA 2HW3A 4NLQA 2NXEA 5K20B 4KGMA 4C48A 4C0BA 3PYDA 4J9RA 4OZ1A 2DGQA 1HQUA 5A6PA 3B8HA 3M6VA 2AJFE 1VISA 1EP4A 1GEHA 4P2SA 1UA1A 4LRFA 1FX2A 2B5JA 1PC4A 1Q7LB 2AIRB 4DV2J 1RCXB 4IR1A 3QAEA 2JVRA 4LF4J 4MYUA 1T03A 1DQ8A 1NDCA 2HRYA 3Q83A 3BGOP 4ZJLA 3NBPA 1LWFB 5AE1A 1DARA 4DF4A 3DGVA 3SV4A 1QVGR 1RAOA 4NA3A 3V4IB 1FD2A 3LPYA 3MTKA 2LMIA 3CCQS 1VQ8S 3UVJB 1DURA 1RT1B 4OZ5A 2HHHJ 1FNXH 2FPHX 4A8YA 1ITPA 1IBKJ 1IBLJ 4DI6A 2VQFF 1HNZJ 4LREA 4DL6A 2Q66A 3MDFA 2IDLA 4YR0A 3GYGA 2CRLA 4MFBB 4DV5J 1FVQA 3OL7A 4BWJA 3T1HJ 4FYYB 3TX8A 5E5NA 4JI3F 5D4PA 1JJ4A 2QA1A 2HBZB 2YKMA 3QZ7A 1WNEA 4ZDNA 4AE5A 2HWTA 1S9GA 4CYUB 1ZAWA 4NE9C 3AD7C 2U2FA 3GCXP 5B08A 2CUYA 1C1BA 2FC9A 5F9NA 4QIVA 3EICA 3IXQA 3MOJB 4HLBA 3A1YG 4J9SA 3EZUA 3I0RB 1NK6A 1RSCA 4EZ6A 3QGGA 4JB8B 3GJSB 1GXUA 2XSJB 2KFNA 3L95X 2NCKL 2KO1A 2M0GB 2Y0SD 2HMIA 3PRBA 1NJWA 4ZCKA 2C2DA 2E5HA 1YJWS 3V2UC 4FPRA 4TNOA 1QDUB 2DNNA 2EXUA 2PI5A 3CDEA 2XGQA 1S6PB 3KK3A 4DV0F 1WC1A 2APOA 1TU0B 2VPXB 2XMAA 3D1HA 1CC8A 2V5HG 1BHNA 2AEFA 1JLCA 3SQGA 5KFTA 4L74A 3MMBB 3HVTA 4LSNB 3C14B 5DG8A 4AFFA 3H2LA 3SEOA 2HQFA 4OZNA 1VQ7S 3KUEA 4EBCA 2HLTA 5JVGQ 1S0VA 4DPXA 3G82B 3GP9A 4V19X 1EX8A 1AW0A 4UTGA 5JMNA 2IA0A 2WOMA 4F3MA 1C4CA 3KNAA 3GIRA 3M2UA 1KQSR 2W9BB 1RHMB 1FDAA 2CJYB 5C25A 1RBOB 2ZZTA 2ZZMA 1HYSA 3KLEB 3W1YC 4MH8A 1T3OA 4CLSA 1DZ5A 5IT4A 3OT9A 2E5LF 3TA1A 4DR6F 3R3TA 4YR2A 1V3RA 4F4AA 4B3TF 3BO3A 4YHHJ 3MF5A 3QJPA 3NS7B 4ZVQB 2KFZA 2V4QA 3BYPA 1OYDA 4TY8A 2QGFB 5LJ3Y 2I9SA 3EVOA 1VFJA 3BQ1A 1XNQF 3WZ0A 3DLGB 2EFQA 4C3KA 1TL7A 2KXFA 4NLPA 3GYXB 3NGUA 1P6TA 2AT1B 3R9LA 4A8XA 2KU7A 5AT1B 4I56A 2V4JA 2DIVA 4DSLA 4KH0B 1SJQA 3TYTA 2DEIA 3PM9A 5BJRA 2RQ4A 2HFZA 2P2CB 2ZOGA 2F7VA 4F0HA 1RCOB 1WEZA 4IQXA 1LQ9A 1NDLA 2N7CA 5AXKA 3W5ZA 1RI7A 3LP1A 3ZC4A 3OL9A 4FNIA 3AB4B 1S72S 4HI2A 2ZD1A 3CJTA 1LEOA 2BJ3A 2LVWA 3WQPA 2NXUA 4RW8A 3V4MA 4X4SA 5IC6B 3GR1A 1WG5A 4DMZA 3IWXA 1NK8A 2B43A 2CJQA 4CRJA 1QAYA 2DNKA 1R3NA 2ZHBA 5H9EJ 3TRGA 4XPCA 2BQ3A 5L1IA 4MFBA 3BGUA 2XO6A 2H5JB 2WHOA 1VK8A 1YK9A 2A0FB 1KS2A 2Q79A 4FKXA 3RAMA 5GMDA 3PY8A 3CCVS 4USVA 4P74A 2OH2A 4RUAA 1CQMA 3CCZA 5B09A 1RWWB 4M5LA 4G3IA 2FGOA 1KVJA 2V8GA 3UN5A 4GC6A 3ZXWA 3CJKB 2NUHA 5T7LB 4OYXA 2WW8A 3P6YC 4CH1A 5J2QB 4ED6A 3N28A 1B0PA 4U7UK 3TZWA 2DO0A 3FEZA 1CJTB 2WTFA 2XSJA 4B9LA 1N5TA 5HQLA 2Y8WA 4WFYA 1CLFA 3J81U 1MU2B 3QRRA 2YWGA 2IJNA 1K0VA 5CD4A 2VFSA 3TNVA 1DJ0A 5DGBA 1R0AA 1RKJA 1RBLA 3RAXA 4FXWA 4CM2A 3NEKA 1FWPA 2ACMA 2F8HA 1NKEA 1PYSB 1UEVA 4BC7A 3OJUA 1V3ZA 1ZA2B 2FLOA 5HMXA 3K5LA 2AGPA 1BC6A 2W4PA 3DRSB 1JNRB 1SUQB 4DUZF 3HHLB 3W2WA 5ETRA 4R8UB 3CTRA 4LSNA 3FCHA 6FD1A 5G4DA 2JEGA 1MN9A 1S0NA 4Q0BB 2JNJA 1ULRA 2VPZB 4NEYA 2N3LA 1M5KC 1EAYC 4LFAF 5KT6A 1BWEA 1FD8A 2W9BA 2VFVA 2CQ0A 1KWMA 2W01A 2IY5B 3B54A 1X4FA 4KE5A 1OIAA 5E3CA 3QIPA 5J2NB 3CIZA 2NR0A 3GFHA 5F8IA 1UEUA 2I38A 1F60B 2JRSA 4L3KA 3BDEA 4DX7A 2BM1A 2GIQA 4WU2A 3DN9A 3B82A 2CQ2A 4K0KF 2K3IA 4JBCA 2PI4A 1SB6A 1UWAA 2CDQA 4PQAA 2Y1IA 2PE8A 1XEZA 1HFEL 2JX2A 2B9EA 4C7QA 2EFOA 4OJGA 2D3ZA 2GV1A 3ILLA 1WOOA 2W2QP 3D66A 3DOMA 3PACA 4GKJF 1OO0B 4OX6A 2GVDB 1V5VA 2LEAA 1TFWA 1OY9A 1WC0A 2V68A 5L38A 3UE2A 3H59A 2PT0A 4B3MJ 4WIQA 4QYRA 1JNZB 2E1AA 4O0NA 1HD1A 4FYVB 4PEOA 4M8LA 2DTJA 2CPYA 4FPIA 2BE2A 5AXNA 2HS0A 4CM0A 2AYGA 1X4CA 1SJFA 5CD4H 1S6QB 3J81Y 2HQGA 4YB1P 3K59A 3M8WA 4BLGA 2R8KA 4FVMA 3ILIA 1P1LA 1HI1A 2R8IA 2W8KA 2HHTA 3P5TL 3OVBA 4FVCA 4KHPF 1RT4A 4FS1A 4OL8A 3SI8A 1KFDA 2A6MA 4QWCA 3DDKA 1D9DA 1U1RA 3PV8A 4NI2B 4GRSA 4FNHA 2EFNA 1RLCL 3PG9A 3H20A 5IWAF 3AD9C 5E2QA 2DNMA 1Z2ZA 4JI1F 2BR0A 3R5BA 2GX8A 4YFUA 2DNYA 4USUA 3ZO7A 3VZHA 2IA6A 4ES3A 1R0BG 1I94F 1EETB 4YQWA 1AFJA 1FNOA 1VJWA 2HVIA 3KXDA 4I6YA 1GMVA 3DMJA 1IR2A 2OO4A 5CYJA 1N5YB 2XY7A 3NAIA 2F63A 4J9LA 2AEJA 4K5SA 3OR1A 2E9TA 3UR0A 3GFZA 2CPXA 3VVTA 1K73T 1MU2A 4MIAA 2MKKA 1R0CB 4LF9J 1SL0A 4OZJA 1T9WA 3GIIA 2QYGA 2QLJB 4ID5B 2ZBCA 5LXYA 4IOBA 4QW8A 3MMCB 3DRXA 1HKAA 5IZHA 4Z37A 3G8TA 2ZHAA 2VPWB 4CH7A 3MD1A 4ILLA 5L1KA 4NASA 2XCAA 3KHLA 2MZSA 1U7LA 3CCUS 2CNNB 2D41A 1TKXB 3B4MA 3FCVA 3HHLA 4R8UA 1YRUA 4ILMA 2BOAA 3DLKB 2E7WA 2Z57B 3V6DB 4EEYA 3ZZYA 3SSRA 4CIOA 4LJMA 2B0GA 2LQBA 3VGUA 3LH2S 2V8DA 3EE3A 3KUGA 2ASDA 1FKAF 3VR1A 4YB7A 3P8BB 3M8PA 1NLKL 1GX5A 3VV2B 5J2NA 2MZJA 3TR5A 1RZMA 4OYOA 5HVFA 3CWJA 4B9NA 2FVPA 2ZUGA 1FFGB 4DFJA 3VAKA 2XSFA 3V81A 4DCJB 5GAEI 4ZN3A 1MWZA 3PW2A 3K17A 3HSZA 2IPOB 4LFCF 1EKRA 1ZYQA 3EXCX 2C2OB 1Z2LA 2LA6A 2VPYB 3GIJA 3NWGA 4MKVA 1CVJA 1WTFA 3GWCA 2V2ZA 1R8AA 1SC4B 2DY1A 1Q79A 4DFMA 2HFSA 3MM7B 4NYOA 1U1MA 3ENQA 3M8ZA 1OY8A 2VV5A 5AE2A 2A1BA 1FERA 3Q23A 2XMJA 3Q8PB 4PWUA 3M9NB 1RA7A 4CLWA 4NLTA 2J0QD 3ILOA 1CBKA 1NSAA 1UWBA 3FVYA 2P5VA 4RBVA 4KH1B 2FJEB 4TU9A 4UT4A 2FJWA 3D1QA 3ZZRA 4Z2XA 2GMJA 3J7ZT 5F8LA 2C28A 4M5HA 3DDIA 2Z2LA 3VAMA 4X64F 1T9VA 3VQTA 3EGNA 3JSMB 3AOCA 3M9OB 3Q86A 2QLBB 2N4CA 5DDQC 4ZIWA 5DM7Q 3OV7A 3BEGB 4PR6A 4OYPA 3QLHA 2MQNA 1VDHA 4QOTA 4NEZA 4QWEA 1JLEA 1FRHA 2KHCA 1ZPVA 2VFTA 5CCMA 3PJXA 1S6QA 3L09A 1VS3A 1UFKA 1PO6A 3GE9A 5K8PA 5D6GA 1AZSA 1SC3B 2FHJD 4U9RA 1FFWB 1KP6A 2MLXA 5KG3A 1ZPWX 5A2QU 4E98A 1X5TA 3CPWR 1Y3KA 1S9FA 2VDHA 2OP5A 6AT1B 2CDRB 2W9CB 1NK9A 4ED8A 1H7WA 1HR0F 2GJ2A 1T7PA 4M95A 4DV2F 3VGTA 5D0RA 4QQBA 2JFDA 5FDLB 2VC1A 2WB4A 3GG1A 1VCTA 4K50A 1YDLA 3CD5A 5HBMA 3H2UB 2ZVSA 1W7WA 3D67A 3RU0A 3UW1A 3J7YI 1B99A 2YH1A 5LSLA 5CYQB 4KPCA 1VC0A 1VHFA 2HHHF 4ALZA 5LMUJ 4DG1A 1NSQA 3PDNA 4I0WA 5I3QA 1IBLF 1Y10A 2J8SA 5H9EK 4NCBA 5E3AA 5K5MA 2UUWA 4DV5F 3T1AA 3T1HF 5IOLA 3M2VB 4NLDA 3OPKA 4F26A 2QA2A 2UXCJ 2MEWA 1GTHA 4HHHA 5C24B 1TUWA 2YX4A 4DR7J 2Z2YB 1RHUB 3MEGA 2VG6A 3KYLA 1SV5B 5B0CA 2PGCA 3W3SA 5IFMA 2IBOA 3SFGA 4LSLA 1IQZA 1DTQB 4WFAQ 5KFUA 2V6AA 1KVIA 1WHYA 5L9XA 7FD1A 3UFCX 4CLYA 3CDWA 4Q45A 3HJFA 2DNHA 3CD7A 1NSPA 1Y0HA 2G9OA 4RO0A 1S79A 1GX6A 2NXNA 2XZTB 2YWEA 2ZJRQ 2GAHC 3IAS9 3EVMA 2BDPA 2DK2A 3AHPA 2I0XA 4PUOB 3UN3A 4OZ0A 1TKTA 4A46A 4RPFA 5KT7A 4RW4A 3ET6B 2HNYA 1H7XA 1WC6A 3NOCA 3S7RA 4LF7J 1OYEA 2HBRB 2N4DA 1VHIA 4FYXB 2G0CA 2CPHA 5A2QY 4U7CA 5AE3A 1JJCB 3QWUA 3H0PA 3OTCA 2KTQA 3LTOA 3BKTA 1M90T 3LQVA 2UXDJ 1AA1B 3BB5A 1F2GA 3MR6A 3X1LB 3E3XA 5KFKA 4JYAJ 1CJKA 4CLKA 4ANCA 5FD1A 5CYMA 4ITSA 1L3UA 2B4OA 2HQ3A 2AU0A 1FDBA 1XMOF 4WZMA 3TEGA 4IDKA 5L46A 4E0DA 4G1QA 2E5JA 1WI8A 2G1HA 3M9MB 4TVAB 3QSYB 2XMTA 1WACA 1C4AA 3OFEA 1FWKA 3QATA 4YHHF 4DQIA 5D0EA 3NWRA 1S1XA 3T5JA 2E9RX 3P4UB 5A76A 1QD1A 2HZCA 1HPZB 4O3RA 2D9OA 2PMWA 2J0SD 2M8HA 2HLUA 1RKIA 4B9MA 2ZH8A 1L3KA 4ZPBA 3GYNA 2E9ZA 3LANA 1HWKA 1TL1B 1RT2B 3BF4A 1J5EF 1WEXA 3OUYA 2RVJA 4O4GB 3RGIA 3OHAA 1VOMA 2J6UA 2BMBA 1NB2A 1WI6A 4Y2KA 1JLQB 1UJ5A 2FZGB 4FF3A 1NAQA 3QGIA 2R2RA 3JB9k 4Q8EA 3DRRB 4HACB 5ETVA 4Y00A 3QO9A 3ICLA 4TU7A 3D5MA 1YHQS 4ZHRA 4PQUA 1HW9A 1RTJA 2HHVA 4ED7A 3UI3A 3S8SA 2YX7A 2WB1D 2H5EA 4UZCA 5HATA 3I9ZA 3D3CJ 1CJUB 4ZVEA 4OZLA 1RU1A 1RJJA 2X51A 5DZ6A 2YNFA 4JI5J 5IV4A 1YJUA 3BDPA 2LQJA 1EQMA 4KIAA 4ILRA 4PCQA 3JXOA 4P71A 4F25A 2F3JA 1HI8A 3PO5A 5ETPA 4ZCLA 2OPPA 3OJSA 1NKBA 4EWTA 1N34F 2AJ2A 3CEDA 3A4TA 3HSDA 3N9UC 2IC3B 2C2RA 2DHHA 1R43A 3SZ2A 3IS9B 2P8IA 1TK8A 3JQMA 3UCZP 4HH0A 2OPSB 2RILA 1VIXA 1BQMB 3PXGa 3I4HX 5HP1B 5GVQA 1ACMB 4RL1A 3VGVA 3I56S 2K1RB 2HYIB 3HI9A 1RADB 2DGUA 2K06A 4LF8J 3HVRA 1MSWD 4IG0A 3CJSA 3SIPB 4J7CA 3CCMS 3QT6A 2W24A 1N4LA 4LVOP 4OYZA 4H4KA 2BJ7A 1X4BA 2YNIB 3QMQA 2FLNA 3LO3A 2LU1A 2RF2A 3E01B 4ELUA 3MEKA 3WDOA 3W62A 3MD3A 2BANA 4NMLA 1FK9B 2GS8A 4X65J 1AYEA 4QIEA 5LT5A 2V9WA 2RIJA 2VG7B 4C97A 2NXCA 1BQNA 2XHWA 2ZOFA 3T1YJ 1UVNA 3MMAB 1JJ2R 3HXMA 4OX9F 2C3MA 4C98A 1N56A 4LF6J 1SI9A 3R6GB 5LSRA 3C16B 4ZVPB 1FFSB 2DD8S 3KJFB 1UFWA 4Q43A 2B51A 2OGUA 3GSIA 3OQ2A 1SIZA 3I32A 4MK7A 3KLHA 2RS8A 2Y1JA 1HBOB 2G4BA 3KLIB 4EGLA 3ITHA 5LMNJ 1U6BA 2NREA 2RKIA 2BJ9A 3HLUA 2ATCB 3QGHA 2ILYA 3HFZB 4Q8FA 1PJ5A 5IC4B 2DNRA 1MROB 3K5MA 4ZITA 2HNZB 3D0IE 2JC1A 4FXDA 1BE4A 3HP6A 5KFRA 4ECTA 4ZVSB 1KEKA 1RT5B 3I31A 3MEEA 1Q95G 2Z0GA 1HNVA 4A8KA 1IKXB 3M6WA 1RWUA 3U02A 1UZDA 2CQBA 1SJRA 2FJAB 4FBUA 2KFYA 3MPDA 4MIBA 2YWWA 4HVZA 4QWBA 2ZH5A 5MLCV 2QL5B 2C2ZB 2FY1A 3I82A 3NCRA 4DU7A 1HPZA 2FLPA 3AQOA 2DPIA 3PYGA 4KC5A 4DR1J 3MEDB 1U1QA 4USTA 1TL1A 1RT2A 1O8BA 2HQCA 4CNYA 2ZM6F 2HGMA 2Q43A 1N5QA 3K8WA 1H3DA 3M6XA 3BQ2A 4ED5A 3VWSA 2R7OA 4RWXA 3KJQB 2CVIA 3VCDA 4JV5J 2ZNZA 4W92B 2KZZA 3DRRA 3CDUA 5THWA 3QGPA 5AJ3J 1WUUA 2Y0BB 4M5MA 4WWSA 4B3MF 1XQIA 2F8EX 3W5YA 3DOLB 1O51A 4YB6A 2B8QA 1N8RT 1C0TB 3OLAA 1URRA 3AT1B 4P10A 4FKYA 4F50A 1CJUA 1RAAB 5B7WA 2DJWA 1TQLA 1GQEA 2W4CA 2CYYA 3ZZPA 2LLZA 2YWKA 2O66A 3KHGA 2BJ8A 2GQ2A 5RUBA 3QT8A 3FK4A 1UKUA 4MMOA 3L7OA 3KLGA 2QX0A 3FQLA 4C3LA 1K0TA 2IC3A 3TZZA 4L6V3 3OHBA 3CJQA 3G71S 2QZ8A 1BLUA 3PHEA 4J90A 3DLJA 3PKMA 2VONA 1TK0A 2HURA 4DR4J 3U27A 5J2PA 3PX4A 4GKKF 2XWYA 1DLOB 2J0XA 2KG1A 5F9LA 1LWEB 3QIDA 5DM6Q 3C6UA 1JKHA 3U1LA 3TUIC 3O44A 1F2HA 3LP2B 1DQAA 1OPIA 1YSJA 1T8EA 2Q1LA 1S77D 1Q4RA 3K8VA 2HWHA 3E01A 2DCUB 2IVFB 5KFHA 1DQ9A 4DL5A 2HS3A 2UXBF 2VIHA 4P7TA 1R31A 5LJ5Y 4J9MA 2CWXA 1S97A 1D1UA 1E6VB 4DPWA 3EJMA 4C0HA 8RUCA 2XMMA 2OMLA 1Q8KA 2WAQD 3U1NA 1S10A 1KQGB 2D3UA 1TP7A 1U02A 2XM3A 5A8WB 3CMES 4PWDB 1KSPA 5KFPA 2IAJA 4ELVA 1N0VC 1LW0B 3BR8A 3DGPB 4DEZA 3PJ9A 3QPIA 1S49A 3BGRB 4WK1A 2DHXA 1VRUB 3TUPA 4UOGA 1CEZA 4DQQA 4DLGA 4OV6A 5I42A 2Z4PA 2W2MP 2DGWA 5EX3A 1NHVA 3DC2A 2MGZA 4UZBA 5IQ6A 1UAWA 4L3NA 1RE1B 7FDRA 4XO0A 5DQHA 3SDEA 3HULA 3RBXA 4ZVGA 3CE8A 4DPUA 4NXMJ 2XO7A 4LFBF 1RTDA 2ZH1A 1QLNA 1MROA 2GIRA 3KDOA 2HBQB 3RRKA 4WP3A 1RUSA 3PW7A 3BZQA 4TQSA 4ETXA 1VQ6S 1YX2A 2VQEJ 3SXLA 2NLWA 1CJVB 4NLWA 2XY6A 1IKXA 4M5NA 4YP3A 1BD6A 5IQQA 2XZDB 1F9EB 2DR7A 2L48A 4EYIB 2LU2A 5K9FA 4DSFA 2FVCA 2GZOA 3H7HB 3MM9B 1WDTA 1BUXA 2RQKA 2LQ5A 1CULB 2IHR1 2GHPA 2BJ1A 1RTHB 1FF2A 3NCPA 5KFAA 2UVVA 4RNOA 2GJFA 4JI2J 4DPOA 2MY8A 5F3ZA 1EIYB 4DV6J 3E51A 2C22A 3W2VB 5HVGA 3DNCA 1N32J 5KFOA 2ZDPA 2VHGA 2F4VJ 1W2BR 1IKVB 2GGPB 1M5SA 2P9EA 3QJJA 4YR3A 2NZ4A 1S1UB 3IO1A 5HN0A 3KNGA 1RU2A 4CO3A 4DV3J 3B78A 3M30A 4NRTA 2B7BB 2BRLA 1C0TA 3NNAA 1IBCB 4XPEA 5KFYA 1F5BA 5KFVA 2IIHA 3G6YA 3ZZ0A 1XJWB 2XNRA 5JJBA 5D78A 1WKLA 1Q78A 1PJ7A 4UY85 4USWA 2ROPA 3WIVA 3TVZA 2PC6A 2IDEA 1ZH5A 4FF2A 3N4WA 4K4TA 3TAMB 2HHXA 3TP2A 5HI7A 1JK9B 4Y2IA 3G6VA 1SQGA 5U47A 3QNWB 2VICA 2IJFA 2H5IB 1IVZA 3TQ1A 5CA5A 1QAIA 1U25A 3IRWP 3M32A 1FA0A 2EWHA 2XMKA 2XMUA 2ALYB 2HVDA 5A8KB 3R5GA 2DGXA 4OIXA 3AXMA 3IMQJ 3QBCA 3J80U 3CNQP 4LRBA 2QMUB 2G2ZA 4XDCA 3RW6A 2AKWB 1E6YA 3N5BA 1UVLA 1LWEA 1LNQA 2J9CA 3LAMA 1V6HA 4WTOB 3TUZC 2DGTA 5EDWA 1LW2B 3CJ2A 2B6AB 2KXHA 1AFIA 1Q8LA 3LALA 1QE1B 3I55S 3Q24A 3KK1B 2W2PP 3ENVA 5E3PA 1DFDA 1WJ9A 2JVOA 4EU0A 4BHQA 2HVHA 1E6VA 1HWJA 2AP6A 2AD9A 1MWYA 4KGXB 3Q2TC 1AROP 4IQMA 3PX0A 5BYSA 3RB4A 2CQ4A 3A3PB 2LFVA 3RB6A 3EX7B 3UD4P 5EWEA 5F0UA 1S7HA 2OD4A 2CJBA 1TKDA 1JLAB 2JJ4D 2DXEA 3GV7B 2UXCF 2C3UA 1FDDA 2M2BA 3CT9A 2MXYA 2DRAA 1F9HA 2ABYA 1NJYA 4PXCA 2GW8A 4KO0B 2XTJP 3CCLS 4QR2A 2HZAA 5JXSA 5KFSA 2C2EA 1S1TA 2MYFA 4O44B 1G7CB 4DV1F 1WKKA 4RBUA 3HPOA 4QW9A 2AQ4A 2JWNA 1PAEX 3R1HA 3KUHA 2L3MA 1ZM4A 3I4PA 1WF2A 3I87A 4CLFA 3TZYA 3SMZA 5KFJA 5GAGU 4TLRA 4ICLB 3M8RA 4CH0S 2AX0A 2VD3A 4JOUA 4Y28C 3LP0A 4W90B 2RS2A 4USMA 3CC7S 3WX4A 2M88A 2B9YA 4YB5A 1PJ6A 3LGHA 3MM6B 1VMBA 3C15A 1K8AT 1I51B 1FEEA 4WP8A 5HLFA 1NCLA 1GMWD 5AXMA 3MPWA 4MIWA 2MY7A 3WC2A 4ZPWR 2FVSA 3DM2B 4HTIA 3W63A 1UPPA 5GMKa 2L9DA 1L5UA 4HHJA 2FZCB 3HO1A 1VQ4S 5EN1A 2PSZA 2KG0A 3BS9A 5D8HB 4CO5A 3CSKA 1IKVA 2C2MB 2UV8A 1VRTA 4ZK7M 2ADCA 4PABA 1C0UA 1RHKB 1RHQB 2B5JB 1S1UA 1YZ6A 3G86A 3BBFA 4PG8A 2MQMA 4X4PA 3FEXB 2E7XA 2D69A 4KKOB 4OHWA 2UVUA 2H4YB 2WVEA 3L3CA 3V5RA 1RWNB 3PX6A 3UNYA 3NBPB 2LXIA 2OAUA 1YZ7A 3KMQA 1XERA 1TL4A 1VQPS 4PG5A 2RE1A 2CJKA 5CABA 1IWGA 2OHDA 2JFKA 5IM0B 3UQSA 2KRBA 2M52A 4YDDB 1Q81T 3TAMA 1YJRA 3HHLC 3HX9A 1J5OA 2L9WA 3EYZA 4RJVA 3T5LA 4R5PA 2VU5A 4CQ1A 2UUBJ 2NPIA 2VBYA 2BM0A 4QWAA 4UUXA 2J6TA 5D3GA 5A8KA 4B3SF 2YKMB 1S9GB 2ZC3A 2IM3A 2A10A 1C1BB 2V94A 5BYRA 1Y5LB 2R7UA 3R2DJ 2BYCA 1VIOA 1YJ7A 1KBRA 5EWFA 2B6AA 1IM6A 3G96A 3BKUA 5BR8F 3D28A 3MCMA 4AXIA 1RT3A 2C42A 2H3EB 3VAGA 4M5IA 1FHTA 5ETOA 5KT4A 4JI5F 1UETA 3FBCA 3JAMU 5E3QA 3RJMB 3MR2A 3TJAA 2YNGB 2DGVA 1Q53A 2HMIB 1FJ7A 3DRPA 3W9HA 1FE0A 3O5TB 3BH6B 4X4UA 4B9TA 1TL3A 2VH7A 2HGLA 2H65B 2R7SA 4ED2A 3SBMA 2R9LA 3R7BB 2HFUA 1UJ6A 2EK6A 4JI6F 2RH3A 1T9YA 2E7VA 2RJZA 1N52B 1XIQA 4EYHB 3KHRA 4QIWD 1RP5A 2MKCA 3HKWA 4KO0A 1JLCB 3SQGB 3HVTB 4USJC 4OYMA 4ED0A 1MG7A 1VQSA 4OX7A 3KFWX 2DNPA 1M5OC 1JIHA 3W65A 4OFZA 4X4TA 2PMZD 4OX8A 1UA0A 4G1PA 4ATNA 3DOKA 1AUSL 3MAQA 2KJWA 4O44A 3IRXB 1PAUB 5ETTA 2DGSA 3EGZA 4MKYA 4C8OA 2CQ3A 4J9VA 5HMWA 5KAKA 2WOMB 1EZZB 5KFWA 3M2UB 3GMGA 5C25B 3PTWA 1QY7A 2GQQA 1HYSB 5HMZA 3US5A 2XYHB 4I7FB 3F41A 2XB2D 2R7XA 2CADA 1ZZNA 3FBEA 3DKDA 3T1YF 3ZFVA 4YS2A 5ETKA 1ZM2A 2OTJS 2A3JA 2Y8YA 3DI6B 4TY8B 2OEKA 4MKBA 2YWFA 1GNKA 3G9CA 1RHJB 3Q8VA 3PIOQ 3A12A 1G2EA 2D7SA 4F67A 3F44A 3N5FA 3PEJA 3DU6A 1U2CA 1TL7B 2CPIA 2MQLA 4N56A 2Q3PA 1XWLA 3BGFA 4L73A 2V4JB 4UUWA 5KOXA 1U2FA 4IR9A 3UDLA 3FCWA 3OSNA 1VQNS 2KKHA 3HHKA 3EMTA 4KKOA 4X62J 3WIUA 1ZOTA 3N6LA 1F3FA 3D54A 1U1PA 3G2XA 2CQIA 3LP1B 2B4VA 3FUYA 2ZD1B 1U47A 2JZ5A 3MAHA 2YY3A 3H5YA 3TI0A 3NNCA 2MTLA 4RW8B 1I6JA 1YWXA 2Q6CA 4LBPA 5AXLA 5IM0A 3P5BP 2X7IA 5CQGA 1U4BA 2XI3A 3P49B 1JB0C 3JAMY 3H40A 2J9EA 1KD1T 4Q2LA 1RWPB 1S57A 5ETSA 4O3PA 3CCES 2QO3A 4LBIA 5H9FJ 1LV5A 4IRDA 4J9KA 2ZH2A 1F5CA 1B70B 4OYWA 2WW4A 2R2SA 1JXVA 3DCAA 2DXDA 3T5HA 4X4RA 4A8SA 2ZBRA 2FYXA 3R1LA 2W7AA 1VJQA 4XAKA 2K7KA 4QU7A 5B0DA 3RRHA 5K8NA 4UF4A 4MT1A 1KHVA 2KHDA 1I3OB 5GMEA 3W64A 2OFHX 4UW2A 3QFHA 2VOPA 3MMJA 3I6PA 2GFFA 4AL5A 5KFCA 1RABB 1M5HA 3C66A 2YNGA 4M5DA 3HK2A 3PIPQ 2J5AA 1NHUA 1KVKA 3AXKA 2DKOB 2ZE2A 3W7BA 4NYZA 2DBBA 4M63A 1R0AB 3PVXA 1TKZA 3HVWA 3PYFA 3EWGA 1K1SA 1UP1A 4USKA 2OKQA 2M5YA 3TEHB 1RT6A 1H2VZ 5HVHA 4KHRA 4FXVA 2Y3YA 1T02A 3TA2A 4RX6A 1YRXA 4IG3A 1IR0A 3BSNA 1VQMS 4WIIA 3W2WB 1GTEA 1FXDA 2RSQA 3FC9A 3OFFA 3CCTA 1S12A 5GADU 2POKA 3IRXA 2XBPA 1P8GA 4NOHA 1XR6A 3UDVA 4AYBD 2CQ1A 1T0TV 3JS9A 3MAAA 1T9XA 4ZMMA 3IGNA 5D0GA 5LM7E 3QIPB 1IBMJ 4ZLLA 4I7FA 1FJCA 2HHUA 2E5LJ 1X5PA 4Q7AA 3HM9A 4KB7A 2I5JA 3GIKA 1T95A 5DLGA 3OFHA 1UVKA 2DITA 3OXFA 5B0BA 4ER8A 1OSCA 1F5AA 1T94A 3DI6A 3M8YA 1U0HA 1NJIT 3H5SA 4I1TA 4P2XA 4K2XA 4ZS6A 3D1OA 1SBRA 2LXFA 3BN4A 3GCWP 4TXSA 4DHVA 1HNIA 1NDPA 1YJVA 3FSXA 5DDRC 4CLPA 2EK1A 5SUHA 1YTYA 5A8RA 1WHVA 1M5PC 2A18A 2GCFA 1MLAA 1VBKA 1WC5A 4DQSA 4AL6A 2EG2A 1R8BA 5KFGA 2CIMA 1U1LA 1NZ8A 5KFNA 1UVMA 2EW9A 4O23A 4PG6A 3DOMB 3DU5A 5KFQA 5D4NA 2DGOA 3H42A 2JL9A 4KBIA 3EVWA 3ENWA 3DRYA 1U8WA 1WDDA 3GFYA 2XI2A 3WX8A 1O0PA 5CH7B 4C0OC 1KTVA 2FUG9 2PDAA 1GMWA 1NJZA 2R7QA 4YOEA 1G1XA 4RW6A 1O5JA 1L3TA 1AUDA 3TZXA 1UL3A 5FIIA 2BE2B 1S0OA 4M5GA 1VR6A 4QYZJ 5KFBA 1VC6A 1WC3A 4OHVA 1N36F 2KT2A 1BMQB 4DV6F 1RT4B 5DO2A 4DL2A 1N32F 4ZVOB 2QMXA 3WHIA 2F4VF 1S4FA 1F9FA 2N3OA 1PCAA 3BM7A 2IMWP 1KDNA 3VAHA 1PGZA 2KZMA 2V2VA 2DRBA 5BXIA 2VUGA 4DV3F 1M1KT 3L7UA 2XYGB 2IRYA 2PEBA 3LPEA 1KLMA 1R6YA 4C8NA 3RAQA 3QT5A 1RBAA 2BZ2A 1YI2S 3DMJB 5C2CA 5EWGA 2V2QA 3OR2A 3NP5A 2W9AA 4I2QB 2V69A 2B9XA 3OR1B 2YKNB 4Y34A 3MFIA 1RWVB 4W4MA 3T9NA 2XMVA 1GXLA 3ELHA 2V0NA 2ZKTA 4Z7YA 3VF0B 3G4SS 2KXNB 3QRPA 2M4MA 2U1AA 2D74B 2G0JA 2FVQA 3LF0A 1S1VA 2Z2ZA 3QQCD 4LMZA 3P3DA 2PFFB 1WORA 4E2FB 8ATCB 4DPTA 1S48A 1ROFA 2CJXB 4XDDA 4DL0C 4DV7J 5DDOC 2ZHOA 2HVEA 4JV1A 2CJAA 3SFUA 1SH0A 3NGKA 1U45A 2E1RA 2LDIA 2MHEA 5ITHA 4FYWB 1RWOB 2MQ8A 1SL1A 3PR4A 1U6FA 4DR3J 1UJ4A 2JH3A 4TKTA 2CPFA 1AXQA 3X3UA 3L9ZA 5KG4A 1XNRJ 2BVZA 2VJUA 3M8PB 2I6WA 2GNKA 4OI6A 2WK4A 4CTAA 1YVFA 1LWXA 1W2IA 3TX0A 3MCOA 1GMUA 1N54B 2OSRA 3MECB 1VGYA 2HQDA 1RQ0A 3V81B 3PNIA 4WU3A 2XMWA 4OHYA 3IFEA 1N33F 3MCSA 2PFDA 3WC0A 2R42A 3K58A 4KFBA 3UCGA 1B3TA 1Q8BA 3H25A 2ILZA 4WE1A 2F5GA 3S6EA 4PWWA 1VQ5S 2DR5A 2R2UA 3QJLA 2V2KA 3ONQA 2JOQA 2RMLA 2MKYA 3HT0A 1UWBB 1DTTA 3POTA 3QWPA 4P9SA 1UVIA 3TANA 1HHQA 1HW8A 2HRUA 2RU9A 2RQCA 3HMJG 2GVZB 1RWKB 1X4DA 1WKJA 4WFXA 2MDAA 2XZWA 1R27B 1NNDA 3NXZA 1TVRB 4I6WA 3MURP 3QLHB 1PIEA 3GG0A 3QAUA 3E8OA 2WSFC 4EZ9A 1UW4A 1JLEB 3NAHA 3IP0A 4LRDA 4H4OA 2R8JA 1WOPA 4OI4A 2R8GA 5KFLA 4EBEA 3K0JA 1PYTA 1RT7A 2G13A 4OMFG 2R7RA 2WZ1A 3FDSA 2UVRA 1PBAA 3HZEA 1MMDA 3OBIA 4N47A 1C1CA 1AZSB 4I67A 2MSTA 4KHPJ 3M1VA 2QTWA 4P52A 2CNOB 2FVRA 2WVDA 4KJIA 3G87A 5E7OB 3K5NA 3PW0A 5GAHU 2KM8C 4M5KA 1JMTA 2QE5A 4J5OA 3RZAA 4RBTA 1X5SA 4WXOA 4M5JA 3AAWB 3PRVA 3UWTA 2OIHA 2I2YA 4CO1A 7AT1B 1SC6A 2BKPA 3KK2A 5JVHQ 4OJ3A 3R97A 5HBMB 3IA0A 1ZBTA 4FDFA 1N5SA 2P9CA 4I2QA 4K5RA 2YKNA 3HSJA 4J9OA 1KR4A 3E2EA 3CB4A 2JLEA 3ULHA 1YRTA 3GV8B 1HMVB 3M2RA 2KDOA 1D9FA 3R5AA 4K4XA 2N82B 4ELTA 4ED3A 1UZHA 4DG1B 2HIQA 1LK5A 1RAEB 3ZTQA 4DQPA 3IWLA 3KWMA 2XCPA 3CDBA 4B3RF 3LWLA 5F8MA 4LR7A 2F65A 3EGVA 3GJQB 3VHQA 3IBCB 4ECSA 3TA0A 2M8DB 1QVFR 3K5PA 4FP9A 2H4WB 3C2PA 4R0EA 2HFOA 2JLGA 2K2PA 4F0KA 2BE9B 2P9GA 3ZNUA 3THPA 3MEGB 4MK9A 4NCGA 4L76A 2VG6B 4K8RA 1KTQA 5HQ8A 2UUAJ 4CLLA 2LP4A 4GVBB 1IUJA 4LQ9A 1TR0A 2EFVA 4LSLB 3R7NB 2HZVA 4NZ6A 2MQOA 3MWBA 3GILA 2YPZA 4DCPB 4YDXA 3C19A 4URSA 4IO1A 1B0TA 5EX0A 4AT1B 1WSVA 1EQ0A 4L75A 4LIRA 1VBZA 2Z58B 2P6TA 3MECA 4IFVA 2GO9A 4PG7A 3U1MA 2VC0A 2HSEB 2L9NA 4JI7F 4LFCJ 4CCHA 1YJNS 1X4AA 2M3DA 2RHSB 3G6XA 1SCJB 3H5UA 2JEJA 1T9TA 4ECRA 2DYAA 2KN4A 2BACA 1TKTB 2RAQA 1PYOB 1NO8A 4AL7A 4RW4B 1X60A 1VYAA 4EK2A 3MUTP 3D6TB 3GJRB 2YKPA 2NS1B 2HNYB 3AJ2A 3NMAA 2J9DE 1WWHA 2DR8A 3N6NA 2CG4A 1YQHA 2E1CA 2BKOA 3VAJA 4C6AA 1IQTA 1H73A 4EFAC 2QFIA 4DN0A 2VASA 3H98A 4BC9A 3H4BA 2J7KA 3CF5Q 1NU4A 2GJIA 4IKAA 2HHWA 4P7VA 2HHQA 1I1GA 5FLXU 1N6QA 3W8PA 4QWDA 1FRJA 2HHPA 2XG8A 3M8QB 4X64J 1CJKB 3CULA 4H4MA 1PC5A 1WD6A 3CIMA 2GVZA 5CYMB 1RYSA 2HWIA 1FO1A 4HT5A 2NQPA 5HO4A 1BGXT 4X4VA 2M70A 4IDKB 3EDRB 4G1QB 3NL0A 1TVRA 4NXNJ 1SQEA 4LBHA 4ANEA 3MUMP 4WKRA 3MM8A 4URQU 2W4DA 4DUYF 3B4DA 2UU9J 2EKYA 3P45B 5M2RA 2EI5A 1IN0A 1RWXB 2IMOA 1S1XB 1X4EA 2QFJA 4M1KA 1VLOA 3CMQA 3Q89A 3RG6A 1XN9A 2OEJA 1W26A 3DFEA 2DT9A 2GO8A 4DX6A 4ZVFA 4IRKA 3Q8RB 4GO5X 4K4SA 5K8MA 2HNDA 1Q0NA 1P9QC 1ZETA 4PPZA 4DLEA 4X4QA 3OUYB 4OJHA 2KT5A 3LGNA 1HR0J 1VBYA 1EJ7L 4DJBA 2BKNA 1RHRB 2KRRA 2BUNA 4A48A 2DNQA 2IYGA 4LF4F 1GFWB 4LR9A 5I4MA 1H38A 2NSCA 4X62F 1T05A 3QO9B 4ZP9A 4ZHRB 1SPBP 4PQUB 3CO0P 1D3WA 2JSXA 3PHTA 1RTJB 2I1RA 1GXTA 2AJ0A 4WK3A 4U8VA 3MM5A 1HD0A 2ZVIA 3PW5A 1Y9OA 1UPMB 5D77A 3FQKA 4NZ0A 1HMVA 4QR0A 5J1NA 4QYZK 1HQEA 2CQDA 2YNFB 4I6AA 2NUUG 2BV3A 3G6ES 4JI0J 2V8PA 2AYMA 4CI0B 3CW2C 1B7FA 4EBDA 1IBKF 3NG8A 1HNZF 1VQKS 2MZRA 3KMSA 2EKNA 1BQXA 4C3MA 3T41A 3SCJE 2O01C 2UZAA 4NA2A 4ZLPA 1WC4A 2OPPB 1ELOA 2UUTA 1JWWA 5KT5A 1FVSA 3MZIA 1HI0P 2ZITA 2X1GA 1NEEA 4DOZA 4N5SA 1JLFA 2EG1A 4DSJA 1RK8A 3ZZTA 3MHYA 2RB7A 2ADBA 3Q8UA 4CNZA 4RUBA 4GVBA 3A13A 3HHLD 2ZBQA 4WBFA 4IG0B 1Y3JA 2VZ9A 3KG0A 1RLDA 3ADAC 1XMQJ 3OVSA 3ZTSA 3MOZA 1YBUA 5HROB 2JEIA 1OWXA 4ECVA 2ZH3A 2RF2B 3AB2B 1H2UX 5FLXY 2BANB 3GU0A 3THTA 4N8OA 2J9DA 1FKPA 1KOHA 3KLVA 2HBYB 4ECYA 4URGA 1X8DA 1BQNB 1APSA 5F8HA 4CLZA 3V6KA 2O1PA 3GQCA 3SYZA 1V3SA 1QTMA 3F0NA 5DG9A 2VBZA 2B3TB 5C42A 2D3O1 2FJDB 4HL9A 2QA4G 3FBBA 1X7VA 4ECXA 2D1CA 1R8CA 3TQEA 2BW2A 3MFHA 4DQRA 2J8AA 2IFXA 3KLHB 3PYEA 2ZH4A 1TELA 4J91A 1UVJA 1U48A 3CCJS 3QYYA 3ITHB 3MCNA 4PYDA 2RKIB 1HBUB 1RTIA 5F8NA 1HNWJ 1DRZA 2AJ1A 2OPRA 2NPFA 2KL8A 1SXLA 4OV1A 3M8QA 3V6HA 2YNHA 1F0XA 3D6HB 1SJ1A 3HD1A 2IM2A 2PN6A 1HBNA 1XMOJ 3LUYA 2O5DA 2AEMA 1EHWA 3FMBA 2BRKA 5KFXA 1IBMF 3G8SA 4ZLNA 3N6MA 1F1BB 3MEEB 4C11A 1OMSA 4X84A 1HNVB 1NH7A 2W7PA 2ASJA 1I5OB 4KV8A 4F7VA 4MK8A 2XGPA 3ETOA 1ZM3A 2QLFB 2WVBA 3R6LB 2XS2A 3UN2A 3IGVA 4RW9B 3HD2A 1KFSA 2YQ0A 4ZPCA 2G2YA 4OI1A 2OJ3A 4KAIA 2MZ1A 3IN5A 4IFYB 1J5EJ 3OTBA 3HZGA 3Q8SB 4O3SA 2Y1LB 1LWCB 5F41A 5CZVA 2XY5A 2UP1A 4OHZA 2JLFA 3V6JA 5H1SV 1QAXA 1UCNA 4NX9A 1QUPA 4FZVA 4YN3B 3C3LA 1LWFA 1QAJA 1S6UA 3CCRS 3FBFA 3J7A1 5ETNA 3VALA 4R0JA 2C2KB 3V4IA 2E1MC 4I2PB 1FCAA 4PRFA 1VRQC 3QRQA 1BY9A 1IXKA 2ROEA 3I5BA 3UVJA 4OI3A 1RT1A 5IT9U 9ATCB 8AT1B 1ZZFA 1EB0A 3FSYA 1S99A 1ZAXA 1VLYA 4CWBA 5KT2A 1KLNA 2OSQA 2QV6A 4P6QA 3EGWB 3EUNA 4F3OA 1N34J 2MQPA 5B0AA 1Q86T 1Y5IB 3KLGB 4K4UA 4CYUA 2PA8D 2PMHA 3UDCA 2RQMA 1D8ZA 4ZOSA 4X66J 4LR8A 3OL6A 3NNHA 3RBZA 1N88A 5J2PB 1FWLA 4F4YA 3I0RA 2VOOA 2YPYA 3DLEB 3NGSA 3GR0A 2C3PA 3SSQA 4OLPA 2ZNYA 4LVNP 3C6UB 3J7Z5 1S4EA 3BBBA 2ZH6A 1JKHB 2B4PA 2KM8B 1R8HA 3RB0A 2YWHA 4CO2A 2GQCA 1D0EA 1NB7A 5HROA 3TVYA 2HFNA 3G8QA 2JDJA 5D4OA 1H2TZ 2LEBA 4K4ZA 1M1HA 4HR2A 2V34A 4WJBA 4DS4A 1S1WB 4Q5VA 1ZTWA 1Q8IA 9RUBA 4DL3A 4B9UA 4B17A 3K7RA 2QSWA 1DY3A 3AJ1A 2ASLA 4P73A 2X3DA 2CJ9A 5J1EB 1S6PA 4DZ6A 1QSYA 1OPZA 3BKFA 4P75A 4ZKAA 2CQGA 4OX9J 5L1LA 3KJNB 2RNEA 3I9V9 5CAAA 2IAJB 1OY6A 3MMBA 1HLWA 4RNMA 4DV7F 2H1YA 3C14A 1B0VA 2IVYA 4F4KA 3IM8A 3UR3C 1FJGJ 5I42B 1A7GE 2QC3A 1NUEA 4ZJOA 4JI4J 4IRCA 3G82A 4DR3F 4OI2A 2MGZB 2DIUA 1HBUA 1H74A 3A8IA 3SDEB 1N48A 4OJ1A 4PG4A 2BQUA 2DO4A 4I4BA 5K8OA 1XNRF 1C2PA 2Z2MA 1QJHA 4F2SA 1RTDB 3JQJA 1HWLA 5L8RC 5T41A 5E33A 1VQLS 3KLEA 3FZ2A 3BGLA 1HBMB 3DHWC 2A2DA 1D8YA 1W25A 5L1JA 2QLXA 4ZP8A 2M9KA 1YITS 3AY0A 5HANA 1SKSA 3DLLQ 3EXYA 2L41A 5MAOA 5A6WA 3MGJA 4CLUA 2A2CA 3CJ4A 1S5ZA 4RW9A 4A8QA 5IT9Y 3ZTOA 3EDQB 3PR5B 4NLSA 1TK5A 4BDPA 1V9OA 3DLGA 4A8OA 1S0MA 3OXGA 3UO0A 3VAFA 3JSYA 3UDEA 3M6UA 3LW5C 4NWBA 2MZTA 3BYRA 2LDYA 4IFYA 5KFZA 2ZM6J 5K14B 3S1TA 5M2PA 1NXIA 1HA1A 3NS5A 2XLIA 3OVAA 2F4FA 1LWCA 2ZDOA 5F3TA 5B0GA 1U26A 1X0PA 2J0WA 2AMCB 1IKWB 1RACB 2FGCA 4IUFA 2GMLA 2ZH7A 2XLJA 2FHMA 4E8UA 3M30B 4I2PA 2VF3A 4ZJQA 3CUNA 2GMHA 2Y1RI 1XK8A 2ACYA 2ROGA 1P9YA 3CD6S 2FHJA 2B8PA 2VKRA 3R5JB 3KOAA 3FMWA 4WFBQ 1L3SA 3TAQA 2CPJA 4ZP6A 1MMNA 4X4OA 5DDPC 4Q2MA 2WSCC 1FJEB 3UPFA 3Q8YA 4G6VB 4ZVRB 4MYTA 2CZ4A 1NDKA 3LOUA 2FJVA 4KGVB 2LA4A 4WFZA 4CDIA 2RDJA 2C1EB 5DS7A 1HARA 4DV4J 3M32B 4F4ZA 3RUBL 2KVQE 5FJ4A 1X5OA 3CJKA 4GKKJ 1WHXA 1IKYB 2JC0A 5T7LA 3J7AN 2NXJA 3DLEA 3H8YA 2HPUA 1G3OA 5DRKA 5J2QA 1VBXA 1E6YB 1SH3A 3T9ZA 3QT7A 4U8YA 2E44A 4HHUA 4I68A 5HK4A 3PZPA 2UUCJ 4NA1A 1CJTA 3T19A 3N79A 3AD8C 1NK4A 2B4UA 2R7TA 2UXBJ 2DXFA 5G0RB 2PIIA 4Y3CA 4DX5A 3M8SA 4LF1A 2ZEJA 4LF9F 1WELA 1S1WA 5EHHA 2UV8G 1KNZA 1FRMA 1A6LA 1PSDA 3W9IA 2MSSA 5J1EA 4ZPVR 1VQOS 4LSZB 3AOBA 3KLFB 3F73A 3SSSA 2W8LA 3DRSA 2AYBA 4FBTA 3K89A 1KQFB 5KTQA 2BJDA 1SUQA 3Q22A 2OFGX 2RUGA 4IOAQ 4YUDA 3HF5A 2DB1A 2YVSA 4OHXA 4LQ3A 3KG4A 1KOOA 1IWAA 1IR1A 2ZWPA 3CJ0A 1WOSA 2E5IA 2AWZA 4Q0BA 2RHQB 3DXBA 3HVAA 4N7TA 2UUAF 4NLUA 4ZPDA 1S76D 2HAIA 1NK7A 2V8VA 1CQNA 4IH5A 4UQTA 5EUHA 1S1TB 2JEFA 2KVIA 1QUVA 5A0YB 1HWUA 4LFBJ 3AA9A 5B0EA 2WONB 4ERDA 1GH8A 3BBCA 4WP9A 4I64A 2F40A 4ZN1A 3R5CA 2HGNA 2M7SA 4IOCQ 1HBMA 2VDIA 3IBWA 2ZFHA 4Y2AA 3FFIB 4QPTA 3LA0A 3UNGC 4RU9A 2X1FA 5L39A 1RYRA 4KHMA 4JUZA 4AQYJ 5ADZA 3LP0B 4A47A 4JV2A 5LSOA 4HT7A 3IM9A 3ISNC 5EGYA 2MPUA 3SCLE 4B9VA 3C15B 1MWQA 4G65A 1RAJA 1Q16B 5HLFB 2V50A 3PKYA 3D4JA 2XC9A 2ERRA 3GV5B 4K4WA 3I5CA 5K14A 2WVCA 1TMMA 4RKUC 3M05A 3FRYA 2EEYA 1X0FA 4DR5J 1VK3A 2MLYA 2CPZA 3CGIA 3DYAB 5KFEA 1TAUA 1R6VA 3PFEA 2NSBA 3D0GE 4ZCMA 2GVDA 3M4XA 2QT7A 1VRTB 1IKWA 1C0UB 1V5IB 3K5OA 3MXHP 3NGRA 5KG0A 1EARA 2ZBPA 4YY3J 4LF2A 5CHCB 3R27A 2ZC4A 2ZJQQ 3Q0AA 4DS5A 1A9NB 4U95A 2KH9A 4NXNF 1CSJA 2CQHA 2CPEA 1D09B 4HI1A 2UU9F 3AH6A 2G0IA 2VL1A 3JTOA 1EKSA 4KTQA 3O2IA 3ZTPA 4UOHA 1XC9A 5DETA 5JUMA 1TV6B 3ZZOA 1TUVA 1B4SA 2YBVA 1J5OB 1LFPA 1LK7A 3O8WA 1X9SA 2CAJA 4R5PB 5LXRA 1FRLA 1YBTA 4NI2A 3UD3P 4ED4A 4KPYA 2NZCA 4DFPA 5GAEU 4F2RA 1X4GA 2X1AA 5D3GB 5GAGI 2QL9B 3NS6A 1XTZA 4F8RA 2YXLA 1IKYA 1EETA 3MI7X 2KB2A 4N41A 2KI2A 4OZ2A 1Q5VA 3IWNC 1FT8A 1N5YA 2AJQA 1SH2A 2AJ4A 2DCLA 3HHEA 2R3VA 2LECA 1RT3B 5G0RA 3EPIA 1YBAA 2DH9A 4DPYA 4RWWA 1KC8T 4QIGA 4ID5A 1QTNB 3HFVA 3D6MB 4RLEA 4JI0F 5LMUF 3MMCA 4DR2J 2CQCA 4PXDA 2VFRA 1U8SA 4C4WA 4A4JA 2DRDA 1Q1KA 4RNFA 3DRPB 2HKEA 1TL3B 4QIFA 3KLFA 2F8MA 1SVDA 3K2YA 1TKXA 1FE4A 2DPJA 4OYIA 3RRGA 4DFKA 5KFMA 3BSOA 4C8YA 1Q5YA 4DR7F 2CNKB 3DLKA 2AX1A 3TAPA 3V6DA 2V8HA 3TJ8A 4A8WA 3PCOB 1U0SA 4ZLJA 2JHEA 4X4NA 3TW0A 3NGDA 1YLXA 3EZ5A 4ECQA 2YH0A 3MPYA 3QSIA 5A0YA 3DOKB 4KY3A 4K4YA 4DV1J 2WONA 4N77A 4ECWA 1XMQF 3PO4A 5C2GA 4CZCA 2YX1A 2XQCA 1Q7YT 4LF5J 2QN6B 2XS5A 3FFIA 4C8MA 1R89A 4F0MA 1LXJA 4RNNA 5KG1A 4AD6A 1TAQA 4USHA 2OUGA 4RNHA 3PFOA 2BJEA 2FJXA 1YJ9S 4LF7F 3J7YU 1KQKA 3BPDA 4J37A 3MM7A 2DNOA 5HAOA 4TN2A 4B3OB 4A8FA 4K7QA 3DYAA 1Y7PA 2UXDF 1MNEA 1HNWF 2C3YA 1PG5B 5C7PA 3CCSS 2BQRA 1HNXJ 4JYAF 4HYKA 2F1FA 2KT3A 3C46A 2MJNA 3JSMA 4ZVHA 1AB8A 2E29A 2EBEA 2VJVA 4PZVA 1U24A 2GHWA 4DXLA 3O6QA 2J6SA 3TJ9A 1NHKL 3A3NB 5T14A 2EBGA 5LL6d 3TWZA 3GIMA 4IYQA 3QFWA 5DQIA 4F3QA 2VBWA 3BV8A 4LRAA 2MKJA 1XMBA 2DEJA 4X2BA 4DL7A 2EC0A 3PW4A 1RGVA 4JI8J 3R8YA 1TV6A 1UTAA 1HL6A 5E0OA 1J27A 3QZ8A 2GA7A 2LCWA 4ENOA 5CCLA 1HHSA 1CG2A 2QJ3A 5ETQA 3PEHA 3IR7B 3BQ0A 4OYAA 2BX6A 2RU3A 2W9CA 4BCAA 4B3SJ 2ZZNA 4MTPA 4BS2A 2QEXS 2RRAA 3HDSA 1QSSA 4DWIA 4WKYA 2FHOB 5FDLA 3T3FA 2OD6A 4O3NA 1JQGA 4J9UE 1PBUA 2FC8A 2YQ1A 1RXOB 1LKZA 3OTDA 3TUJC 4GC7A 2AGQA 1WG4A 5BR8J 1NBEB 3RTVA 2X1BA 2XYPB 1RWMB 3CJ5A 3OTOJ 3N0VA 2BA9A 4GO7X 5CYQA 2KYZA 3AJDA 2EFGA 2P6SA 3O3LA 5CXTA 2DNZA 3GSDA 2E1PA 4NZ7A 4O0IA 1SJ4P 4M5DB 3RBEA 3GTYX 5M2UA 2HIYA 3NLCA 3M2VA 1K44A 2BBEA 2ZE2B 1NSKL 4JI6J 1TKZB 3B6BA 5C24A 2MQQA 2AF6A 1RT6B 2QRRA 3L4BC 2GC8A 2ZWOA 3O1LA 1U2RA 1NJXA 1SV5A 4X66F 4IG3B 4ZVUB 1CC7A 3KDNA 2AZ1A 1OQ3A 1U1NA 1X9MA 1HIYA 4LIWA 4LF8F 2IVMA 3CJ3A 2DR6A 3UD5A 3TVKA 1DTQA 2LKZA 5DJBA 4N76A 1S7IA 4HKQA 3FJ2A 2AZ3A 2MJUA 2HAFA 1MW7A 1WHWA 2FY8A 3KKFA 3F56A 2R2TA 2Z8QA 2GIFA 4EMDA 4NPOA 4NLXA 1U1OA 3MAAB 1FTRA 1PKUA 1NK0A 3RB3A 2CXEA 4RR5A 4X65F 1S59A 5KG7A 4UOCA 4ID8A 2O67A 3L7PA 2DNLA 4UY8T 2X3GA 3HHNB 4PUOA 3GFXA 3IR6B 2HHSA 1H72C 2I5JB 3P96A 4XK8C 4FYDA 3ET6A 1FEHA 4HEA9 1YJTA 4LUBA 4LF6F 4UQGA 4TLQA 2BEFA 1L3VA 1UW9A 4TYAA 1WF1A 5B0FA 5E41A 1U0HB 5J2MB 3HT3A 4NMXA 1CPZA 4PPDA 2DR9A 4U96A 4CO4A 2HRTA 1TTHB 1FJGF 1FKOB 2BOPA 4JI4F 5D0HA 1HNIB 1KONA 3ETMA 4B3OA 3VQSA 5LMNF 4NLRA 3PJWA 5A8RB 2DHGA 2CNLB 3ZTRA 4PXBA 1WSRA 4ZP7A 2QG9B 4O3OA 2IRXA 3BR9A 3H2VE 1NZAA 2AYEA 4B02A 4BBYA 1KKHA 1RAFB 3C6TB 3I96A 2DISA 2B9WA 3KG1A 2FD2A 2F9DA 4CT9A 3GJTB 4WYLA 1FTCA 3CJ8A 4CLTA 1MN7A 4DF8A 4MKAA 1RAGB 2MKSA 4M94A 2W25A 4TY9A 4RW6B 2XS7A 3CJRA 1G4CA 1WTBA 2CFXA 2Z30B 1CS4B 3BJYA 1JXEA 3GZ7A 1Q82T 5GADI 3A8KA 4ETZA 2VQFJ 4DR1F 2R8HA 1R8PA 2C3OA 1FRXA 5C5JA 3GB0A 2H48B 4HDGA 3SCKE 4JI3J 4O4GA 1T3NA 4J9QA 1JLQA 1SKWA 2OTLS 3W8GA 4H54A 5E3RA 4QR1A 4HACA 4RZRA 4JV5F 3CDAA 3W5XA 4FS2A 2QSFA 4PXEA 2ZBIA 1XBWA 1Y5NB 3IG1B 4MJKA 4JP8A 4W98A 5AJ3F 2WCXA 3CC4S 2WBRA 3D6FB 1H6KX 4C9DA 1KLMB 1JLBB 2QMWA 2VFUA 3D0HE 3RBDA 4K59A 2E5GA 4DSKA 4KSEB 3OR2B 3SQOP 2NYIA 4QZVB 2CA9A 3FZBA 1P1TA 3JSBA 3DDNA 4V1Ak 1FXLA 3BO2A 2R7WA 3VTIA 1NPKA 2FJBB 3ISZA 1ZTTA 3SV3A 3KHHA 4I69A 1MMLA 4FN5A 4RUCA 2LYVA 4HH1A 1RISA 3W60A 2QYCA 4Y0FA 4DV0J 2RT3A 1TMJA 1S1VB 4NLYA 3IS9A 3MPVA 3NOGA 3UCUP 2D9PA 1YGYA 5DQGA 3MR3A 2OPSA 4DV4F 1BQMA 1SKRA 5HP1A 2HQIA 3HJVA 2VODA 1VQYA 2K1RA 2ZJPQ 4DR4F 2V4RA 1IM4A 3CVKA 4C8KA 1RAHB 1REGX 3I0SB 4DN9A 5CZXA 1U09A 4AUKA 4F36A 3W9JA 3RR7A 2YNIA 1FI4A 2UUCF 5IS2A 4KRWA 2Y9HA 4KR0B 1JLGB 3NKYA 1RA6A 1XR7A 4D3HA 4NYPA 4QU6A 2Z56B 5DLFA 2CQPA 1YKWA 4QBUA 4ZPAA 5L9NA 1FK9A 4WCEQ 1LFWA 3H5XA 3EZOA 4F02A 2VG7A 2J7WA 2QLWA 2YQ3A 3M7VA 2DVIA 4CTAB 2DHAA 2DY9A 1VI7A 2OPQB 2LQ9A 1RDRA 2W1BA 2PD1A 1GAOA 4OLOA 3LWMA 3ZZUA 4DR6J 3MMAA 1FDNA 4WTYA 1NPRA 3R2CJ 5KOWA 4B3TJ 1IJFB 4KYZA 3DLHA 2YTCA 3Q2SC 3AFGA 1XR5A 3C16A 3MR5A 4LRCA 4PAAA 4QCLA 5J2MA 3AODA 3OSPA 3WBZA 5KG5A 3EM1A 3R5DA 4KFBB 3IBFB 4ZIVA 4K4VA 3D2WA 1XNQJ 1ICEB 1U1KA 1HBOA 4WE1B 1YIJS 1SKUB 1ZM9A 1FKOA 2OI2A 3KLIA 4Y65A 1TFYA 3TARA 2EVZA 4ZPTR 1KN6A 2BABA 2G1DA 2IJRA 4YMEA 4LT6A 3HHDA 4NL5A 5DGAA 2HNZA 2B56A 2GHVC 4NXMF 2H51B 2J76E 4WFNQ 1DTTB 3POTB 2V9KA 3SCIE 3OW2R 3FRZA 2N7YA 1RT5A 3C6TA 2VQEF 2MLZA 3GLJA 1K47A 3IC1A 1U6ZA 3NMRA 4DCOB 3BREA 5D4LA 1IJEB 4AQYF 5KFFA 2OEMA 5I3UB 3OL8A 2BE7D 3LGMA 3VVUA 3LAKA 1SL2A 4L72B 4B08A 4H4OB 1URNA 3AOAA 1CS4A 2DHSA 1RT7B 1H0HB 2HFVA 2ZUAA 3MEDA 1N36J 5J1PA 2XULA 4CT8A 4WPAA 1BWVA 3ILJA 4OZ3A 1C1CB 1X4HA 2RDDA 2HS4A 3HFKA 2BXJA 3M1VB 2RDIA 4UOFA 1AT1B 1K1QA 4JI2F 4J9NA 1G6BA 4ZA1A 3T5KA 4DR5F 3RR8A 3OXLA 5KT3A 4S0MA 1NKCA 3KJVB 1NPPA 4H4KC 5SZTA 3H4DA 1X31C 3ENAA 5KFIA 1NMEB 3Q8QB 2KJVA 4KGZB 4R25A 4Z7CA 4WF9Q 1JX4A 1SIWB 3BPSP 3OLBA 2ZKUA 4P2FA 3JYTB 3W66A 3IG1A 1N5VA 3DOLA 4C8LA 4YY3F 4F4WA 3IR5B 4DU8A 2E66A 3KK2B 2NYHA 3JQKA 1JLBA 3DHXA 3HSGA 3NY0A 4J9PA 2CWKA 2GAGC 1JXLA 3BO4A 2AV5A 1Y4ZB 2WRMA 1Z1ZA 3HKZD 4F4XA 4DBQA 2ZH9A 3M2RB 4ZVTB 2ALZA 2FQQB 2V63A 2MKIA 1T9UA 1KRPA
chains in the Genus database with same CATH topology
5D6GA 2FHJD 3DI6B 4U9RA 3CC2S 5L1LA 3TOQA 4TY8B 5KG3A 2RNEA 3I9V9 1ZPWX 2VKZG 2XWXA 3FEYB 4MKBA 4E98A 2YWFA 2IAJB 2VBXA 1GNKA 3G9CA 2WBMA 1X5TA 3MMBA 3PIOQ 2K7JA 4RNMA 1FXRA 1X9WA 3CPWR 4DV7F 1G2EA 1Y3KA 1S9FA 2D7SA 4QJVA 4F67A 5DG7A 3F44A 1B0VA 2IVYA 3N5FA 3PEJA 3DU6A 4F4KA 2FLLA 2QIFA 2CPIA 2OP5A 2MQLA 3OFGA 3UR3C 4N56A 4WZQA 5I42B 1A7GE 4U6PA 2W9CB 2W7OA 4IRCA 3DXSX 1NK9A 4ED8A 2Q3PA 1H7WA 3CXCR 4DR3F 4EUVA 1DLOA 1XWLA 4OI2A 2MGZB 2GJ2A 4DL4A 1HR0F 3BGFA 1T7PA 4M95A 4DV2F 3I0SA 2V4JB 4UUWA 4NCGB 2DIUA 4QQBA 5KOXA 1U2FA 6FDRA 1HBUA 4FF4A 4IR9A 2CVEA 2JFDA 3UDLA 5FDLB 2VC1A 3SDEB 2WB4A 1N48A 4OJ1A 3LP2A 3OSNA 3GG1A 4PG4A 2BQUA 2DO4A 3BSAA 4I4BA 5K8OA 1XNRF 4K50A 1C2PA 2Z2MA 1QJHA 3THVA 4F2SA 3CD5A 5HBMA 5KFDA 1RTDB 2KKHA 1VQNS 1HWLA 3H2UB 1JLGA 1OS5A 5L8RC 3HHKA 5T41A 4KKOA 5E33A 2ZVSA 1VQLS 3KLEA 3FZ2A 3MTJA 1ZOTA 3BGLA 1HBMB 3DHWC 2YKAA 2A2DA 2K8GA 2IM0A 4AXJA 1D8YA 3RU0A 3N6LA 4D3GA 3MUVP 3UW1A 3J7YI 1W25A 2YH1A 5L1JA 2QLXA 3D54A 4ZP8A 3OTEA 1U1PA 2M9KA 5LSLA 5CYQB 4ECUA 2CQIA 1YITS 3LP1B 3UCUP 3AY0A 2B4VA 1VC0A 1VHFA 2ZD1B 1U47A 4DR2F 2HHHF 2OPQA 2JZ5A 3JTPA 5GAHI 3MAHA 2YY3A 3H5YA 1SKSA 3DLLQ 3TI0A 4ALZA 3EXYA 5A8WA 3NNCA 4RW8B 2L41A 1I6JA 1YWXA 5MAOA 5A6WA 2Q6CA 4DG1A 5AXLA 1FRIA 5IM0A 3MGJA 3PDNA 4I0WA 4IFVB 5I3QA 1IBLF 4PWDA 2A2CA 2FB0A 4OI0A 3CJ4A 5CQGA 1M0SA 1U4BA 4NCBA 4RW9A 5E3AA 4QPXA 5K5MA 3IAM9 4A8QA 2XI3A 3P49B 5IT9Y 2UUWA 1JB0C 1S9EB 3JAMY 1LW0A 3DGPA 4DV5F 2VG5B 3PR5B 2MB0B 4NLSA 1TK5A 3H40A 2RRBA 3BGRA 3T1AA 4BDPA 3T1HF 1V9OA 1UFLA 1S6OA 1VRUA 1D9AA 3DLGA 3M2VB 4NLDA 4A8OA 4ED1A 3OXGA 2J9EA 1S0MA 3OPKA 4RW7B 1KD1T 4Q2LA 1FRKA 2QA4S 4F26A 2QA2A 3VAFA 3JSYA 4O3PA 1GTHA 3CCES 2QO3A 3M6UA 3LW5C 5C24B 4NWBA 2CKWA 2MZTA 4RUHA 5H9FJ 4HTJA 4IFYA 2LDYA 5KFZA 1LV5A 2YX4A 4IRDA 4J9KA 2ZH2A 1F5CA 5K14B 3S1TA 3MEGA 5M2PA 4KT0C 1HA1A 3NS5A 4EO8A 2XLIA 4MAKA 2VG6A 4USIA 2J7UA 3KYLA 2R2SA 1ZAVA 1SV5B 2ZOMA 5B0CA 2FIUA 2PGCA 3W3SA 3OVAA 3DCAA 5IFMA 4TQRA 3T5HA 1LWCA 4X4RA 4A8SA 2ZDOA 2IBOA 5F3TA 5B0GA 3R1LA 2W7AA 4XAKA 3SFGA 1U26A 1WF0A 1X0PA 2J0WA 2K7KA 4QU7A 2K3KA 3RW7A 1FNMA 4LSLA 1IKWB 5B0DA 1IQZA 1DTQB 5K8NA 4WFAQ 3RRHA 2FGCA 5KFUA 4IUFA 2GMLA 2YKOA 1WEYA 1KHVA 1REVB 2ZH7A 4DX8H 1KVIA 4G1IA 2KHDA 3JSRA 2XLJA 1WHYA 5F8JA 1N6QB 5L9XA 5HL7Q 4LF5F 7FD1A 1GT8A 3UFCX 2FHMA 4E8UA 2H9ZA 3M30B 3T6JA 2OFHX 4UW2A 3CDWA 5F0WA 3U7JA 4ES2A 4Q45A 4NLGA 2VOPA 4I2PA 3HJFA 4H4MB 2ASYA 3MMJA 3I6PA 2GFFA 4AL5A 2DNHA 3CD7A 5IT0A 5KFCA 1Y0HA 3CUNA 2GMHA 2Y1RI 1XK8A 2ACYA 2ROGA 1OQ6A 3CD6S 2G9OA 2MKHA 2FHJA 1M5HA 1S79A 1GX6A 2VKRA 2VA3A 3KOAA 3FMWA 2YWEA 3C66A 3FSIA 2YNGA 4WFBQ 2ZJRQ 5I3UA 1PILA 4M5DA 4V19J 1L3SA 3TAQA 3IAS9 2CPJA 2BDPA 3HK2A 3PIPQ 3MM8B 4ZP6A 2DK2A 1MMNA 3MM9A 2J5AA 3KTQA 1NHUA 4X4OA 2HG4A 3AHPA 5DDPC 2I0XA 4Q2MA 2ZE2A 2LEPA 4PUOB 1QSLA 2ATLA 3W7BA 4OZ0A 1TKTA 4NYZA 2DBBA 2WSCC 4A46A 4M63A 4O4RA 3CMAS 3PVXA 1R0AB 1FJEB 5KT7A 4RW4A 1RTHA 1TKZA 3UPFA 1M5VC 3CD0A 3A8EA 3HVWA 4G6VB 1K1SA 1UP1A 1B64A 4IH6A 2OKQA 3BN7A 2XEXA 2M5YA 2HNYA 4MYTA 2CZ4A 1H7XA 3S7RA 3FGVA 4WYWA 4CO0A 1RT6A 1K9MT 4HDHA 1HWIA 1H2VZ 4DSIA 3LOUA 2FJVA 4IH7A 3N01A 2LA4A 2RD5C 2N4DA 4KHRA 4FXVA 4WFZA 4C2MA 1T02A 3TA2A 2RDJA 1QM9A 3W2VA 2SXLA 2G0CA 4RX6A 1YRXA 4IG3A 5DS7A 2CPHA 1HARA 4EO6A 1IR0A 3BSNA 1HQUB 2HNDB 3M32B 4Q44A 1VQMS 4WIIA 3W2WB 5A2QY 3I5AA 1GTEA 2I8EA 2PA3A 1FXDA 2UVWA 4U7CA 5AE3A 2COLA 3KJVA 2IBKA 5KG2A 2GGPA 4F4ZA 2KYXA 3QWUA 1EP4B 2RSQA 2CPDA 3OTCA 2KTQA 3OFFA 5FJ4A 1X5OA 3CJKA 1M90T 3LQVA 3CCTA 1VC5A 3ISND 1WHXA 1IKYB 2JC0A 3BB5A 5T7LA 5GADU 2POKA 3H8YA 2OMOA 3DLEA 4O3QA 2MMYA 2MHNA 3IRXA 3J80Y 2HPUA 1HNXF 1F2GA 1G3OA 5DRKA 3MR6A 5J2QA 1VBXA 1E6YB 3X1LB 3E3XA 2RRNA 1SH3A 3JYTA 2XBPA 3T9ZA 5KFKA 1P8GA 4NOHA 1T03B 1XR6A 2IYIA 2E44A 4AYBD 4TYBA 2CQ1A 4I68A 4U67Q 3PZPA 5FD1A 5CYMA 4NA1A 4ITSA 1NK5A 2FHKA 3T19A 1L3UA 3N79A 1T05B 2B4OA 4ZMMA 2HQ3A 1NK4A 2PEHA 2AU0A 2B4UA 1FDBA 2R7TA 3EPGA 1XMOF 1Z4UA 4WZMA 4IDKA 4E0DA 4G1QA 2E5JA 5G0RB 1WI8A 3IGNA 2PIIA 4XIUA 3M9MB 1R7IA 4Y3CA 2DNGA 3QIPB 3M8SA 2LXUA 2XMTA 3JTNA 1WACA 1C4AA 4I7FA 3OFEA 4LF9F 1WELA 1FJCA 1DHMA 2HHUA 1S1WA 1X5PA 5EHHA 1NH8A 4YHHF 4RU2A 4B9SA 2UV8G 3AQPA 4Q7AA 1KNZA 4DQIA 1FRMA 1A6LA 3MM5B 3HM9A 4KB7A 1PSDA 2EPIA 4NLOA 2I5JA 1S1XA 3GIKA 4JI8F 2MSSA 3AA8A 3T5JA 2E9RX 1HQEB 1T95A 5DLGA 3OFHA 4KGKA 2HZCA 5J1EA 1FESA 1HPZB 4O3RA 2D9OA 1UVKA 4ZPVR 2DITA 1VQOS 3OXFA 5B0BA 4KQZA 1OSCA 1F5AA 4ZCIA 1T94A 2M8HA 2HLUA 3DI6A 3KLFB 3F73A 4Y2CA 3SSSA 2W8LA 4NRUA 1NJIT 1DBDA 1RKIA 3H5SA 3DRSA 2AYBA 4B9MA 2ZH8A 1L3KA 4FBTA 4I1TA 1KQFB 5KTQA 2BJDA 4ZPBA 1SUQA 3GYNA 3Q22A 4K2XA 4ZS6A 2UUBF 2E9ZA 3LANA 2OFGX 2RUGA 1HWKA 3D1OA 4IOAQ 4YUDA 3CO9A 3VAIA 4C8ZA 1SBRA 1TL1B 2LXFA 3BN4A 3HF5A 2DB1A 1RT2B 2YVSA 4OHXA 4LQ3A 4TXSA 3KG4A 4DHVA 1HNIA 1KOOA 3BF4A 1J5EF 1YJVA 4NCAA 3FSXA 5HMYA 5DDRC 1WEXA 3OUYA 2EK1A 1LXNA 5SUHA 3CJ0A 5A8RA 1YTYA 2RVJA 4O4GB 3OHAA 1WHVA 1M5PC 2E5IA 1VOMA 2J6UA 2AWZA 4Q0BA 2HVZA 2A18A 2GCFA 3DXBA 3FNNA 3HVAA 1JLFB 1WI6A 4Y2KA 3RYLA 4DQSA 1JLQB 2UUAF 4AL6A 2EG2A 4ECZA 1R8BA 1UJ5A 4NLUA 4ZPDA 5KFGA 1TZ0A 2DH7A 4FF3A 2HAIA 1S76D 2AGOA 1NK7A 2L08A 2VB6A 2V8VA 1CQNA 1NAQA 3CCWA 3QGIA 2CIMA 4IH5A 2R2RA 3JB9k 4UQTA 5EUHA 1U1LA 4Q8EA 1S1TB 2JEFA 2KVIA 5KFNA 1UVMA 3DRRB 1QUVA 2FTRA 4OQJA 2XLKA 4IO9Q 1LW2A 2EW9A 3T6BA 5A0YB 1HWUA 4O23A 4Y00A 3AA9A 4TU8A 5B0EA 4PG6A 2F9JA 2WONB 3ICLA 3QO9A 4TU7A 4ERDA 1QE1A 1J2VA 1GH8A 3DU5A 4Y2MA 3D5MA 4I64A 5D4NA 2F40A 5KFQA 1YHQS 4ZHRA 2DGOA 3KK1A 4PQUA 2R7VA 3OTOF 2JL9A 4KBIA 3R5CA 2HGNA 3ENWA 2M7SA 1HW9A 3DRYA 1JJHA 1RTJA 4IOCQ 4WXWA 2HHVA 1KHWA 4ED7A 2IRUA 1HBMA 3UI3A 2YKQA 3GFYA 3S8SA 2XI2A 2WB1D 2YX7A 1O0PA 5CH7B 2H5EA 4JV0A 1HHTP 4C0OC 3IBWA 1U49A 2ZFHA 4Y2AA 3FFIB 4Y6IA 4QPTA 3I9ZA 4FF1A 1KTVA 2FUG9 2PDAA 3UNGC 1NJZA 2R7QA 4YOEA 4ZVEA 4RU9A 1G1XA 4OZLA 2X1FA 1RJJA 2X51A 4GMKA 1DAXA 5L39A 1RYRA 4RW6A 4KHMA 1O5JA 4JUZA 2YNFA 1L3TA 1AUDA 1YJUA 1UL3A 5FIIA 3BDPA 2WSEC 2BE2B 2LQJA 4N8NA 1S0OA 5ADZA 3LP0B 4A47A 4JV2A 5LSOA 1FKPB 4QYZJ 4HT7A 5KFBA 3ISNC 1H98A 4KIAA 4ILRA 3VZIA 4A8MP 1N0UA 4PCQA 2DH8A 1VC6A 5F8GA 2IM1A 4F25A 4OHVA 4ES1A 1JLAA 1S9EA 5EGYA 3DLBA 2MPUA 2VG5A 2F3JA 3BSCA 3SCLE 3KK3B 4B9VA 1HI8A 1N36F 3PO5A 2KT2A 4ZCLA 1RAJA 1Q16B 2OPPA 3OJSA 5HLFB 1NKBA 5I3PA 4EWTA 1N34F 4RW7A 3CEDA 3N9UC 3PKYA 1WG1A 4DV6F 2IC3B 2XC9A 2C2RA 3S01A 1R43A 1VQ9S 1RT4B 3SZ2A 2B7CB 5DO2A 3IS9B 2ERRA 1NRKA 4DL2A 3GV5B 4K4WA 1TK8A 1N32F 3UCZP 2QMXA 3I5CA 1YG0A 4HH0A 5C42B 3NCQA 5K14A 2OPSB 2RILA 2F4VF 1VIXA 4BWMA 4RKUC 1BQMB 3M05A 3PXGa 3FRYA 3I4HX 1S4FA 2O3DA 2OLWA 5GVQA 5HP1B 1F9FA 1X0FA 1VK3A 2N3OA 2D3OR 2FDNA 3I56S 3BM7A 2K1RB 4PKDB 1LOUA 2CPZA 3CGIA 3DYAB 5KFEA 2HYIB 3HI9A 2DGUA 1TAUA 3PFEA 4DDFA 3HVRA 2IMWP 2NSBA 2PO4A 3VAHA 3D0GE 4ZCMA 1PGZA 2KZMA 1MSWD 3M4XA 4IG0A 2DRBA 2QT7A 1VRTB 3CCMS 2VUGA 2W24A 4DV3F 3TO8A 1N4LA 1IKWA 4LVOP 1TL5A 4H4KA 1M1KT 1C0UB 1RTIB 1X4BA 3K5OA 3MXHP 2YNIB 3C8YA 3QMQA 1REVA 4DSEA 5KG0A 2IRYA 2OPRB 2FLNA 1KLMA 1R6YA 4C8NA 3LO3A 3RAQA 4YEAA 2Q6BA 2LU1A 2RF2A 3E01B 3R27A 5CHCB 4ELUA 2ZC4A 2BZ2A 2YNHB 3MEKA 3DMJB 3WDOA 3Q0AA 2ZJQQ 1YI2S 5EWGA 4DS5A 3MD3A 1A9NB 3OR2A 2BANA 2EFPA 3NP5A 4NMLA 1HBNB 4ICLA 2KH9A 2AW0A 2W9AA 4I2QB 2B9XA 1FK9B 3OR1B 2YKNB 4NXNF 1OSDA 1Y00A 4Y34A 3MFIA 4QIEA 5LT5A 1CSJA 3T9NA 2V9WA 2XMVA 2CQHA 1GXLA 2CPEA 2RIJA 2VG7B 4C97A 1SJ3P 4HI1A 4C11B 2V0NA 3AH6A 2UU9F 1BQNA 1UMJA 2ZKTA 5KG6A 2XHWA 2ZOFA 5BYQA 2CZVC 3NRBA 2VL1A 2VA2A 2XNQA 3VF0B 3ZZZA 3JTOA 3MM6A 4KV8B 3K57A 5IXUA 3G4SS 2KXNB 4KTQA 1UVNA 3MMAB 3O2IA 2MZQA 2M4MA 1JJ2R 3HXMA 2U1AA 2D74B 2R4FA 1XC9A 4OX9F 5DETA 5JUMA 1TV6B 2FVQA 3ZZOA 1TUVA 2C3MA 3LF0A 1S1VA 4C98A 1N56A 3PRDA 1J5OB 1SI9A 1LFPA 3DM2A 4NLVA 1P27B 5LSRA 1LK7A 4LMZA 2DD8S 3P3DA 3O8WA 2PFFB 1UFWA 1X9SA 4Q43A 2B51A 1S48A 4R5PB 1ROFA 5LXRA 2HW3A 4NLQA 1FRLA 3UD3P 3OQ2A 4XDDA 4KPYA 4DL0C 4KGMA 4C0BA 5DDOC 2ZHOA 4J9RA 4DFPA 4OZ1A 1SIZA 3I32A 4MK7A 3KLHA 2DGQA