1CQNA

Protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed protein tetramer zipped together with a hydrophobic Alzheimer homology: a structural clue to amyloid assembly.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S6
total genus 24
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cqnA00
2KJVA 3T1HF 4DR4F 4DV2F 4JI7F 5AJ3F 1IBLF 1XMQF 1G7CB 4DV5F 1FJGF 3ZZPA 2B7CB 2ZM6F 1GH8A 2J5AA 1CQMA 4DUYF 5BR8F 1F60B 4DV0F 1N33F 1CQNA 1HNZF 2UUBF 2UXBF 4DR3F 4X65F 4OX9F 4DV6F 1N36F 4KHPF 2YY3A 2VQFF 1XNQF 4B3SF 4JI4F 4DV7F 2BXJA 3OTOF 1N32F 4GKJF 4NXMF 4DV1F 1IJFB 1J5EF 1HNXF 4JI8F 1RISA 4DR5F 2HHHF 4X64F 4B3RF 1HR0F 4JYAF 1IBKF 1XMOF 4LF5F 4LF4F 4DR1F 4B3MF 4JI0F 1N34F 4LFCF 4DR6F 1G1XA 4LF8F 1FKAF 2F4VF 4LF6F 4NXNF 4DUZF 4AQYF 3R3TA 4DV3F 4YY3F 4JI3F 4LFAF 2UU9F 1VMBA 4X66F 1LOUA 4JI5F 4DR7F 1IJEB 3T1YF 1XNRF 1IBMF 2UXDF 4LF7F 5LMUF 5IWAF 2UUAF 2E5LF 2B7BB 4DR2F 4GKKF 2KJWA 5LMNF 4DV4F 4LFBF 4LF9F 4JI2F 2VQEF 2BVZA 1HNWF 4YHHF 1QJHA 4B3TF 4K0KF 2RJZA 1B64A 4JI1F 2UUCF 2UXCF 1I94F 4X62F 4JV5F 4JI6F
chains in the Genus database with same CATH superfamily
2BA9A 2RQKA 2DGVA 3TAPA 1NB7A 3IG1B 3DMJB 1IKVA 4DV2F 2F3JA 2MJUA 1B7FA 2CJ9A 1U09A 2IDEA 3D2WA 1FKPA 3GR0A 2YKPA 2YNFA 1J5OA 3D6TB 2E7XA 1YGYA 5IM0A 5DDOC 1VQKS 2HHQA 4IDKB 4QR1A 3C19A 1Q78A 1KOHA 3E8OA 3O2IA 3V4MA 2F63A 3T1AA 1JJ2R 4DL6A 1NSPA 3QT8A 4JI5J 2BQ3A 1RHJB 1U49A 2HRTA 3W9IA 4YR0A 2UXBF 1VC6A 2BJ8A 4FDFA 4B9LA 3J7YU 2ZOFA 3C6UA 1NB2A 3H98A 5AXLA 3IFEA 3PHTA 4G1QB 3KLGB 2DH9A 2J6SA 1UVIA 1S77D 1FRHA 2YY3A 1I94J 3KLIB 3H2UB 4TN2A 4RNMA 2ZH4A 3HHLD 2K1RB 2CJQA 3CDAA 2GA7A 5J2PA 2DIVA 2JNJA 1XQIA 2NYIA 3FEZA 2WSEC 4O4GA 4RBUA 1L3UA 2RDDA 3GU0A 1ZAXA 2DO4A 4I69A 3BF4A 4BLGA 1D0EA 1WC5A 4TU9A 3J7Z5 3NLCA 2VFSA 2UV8G 4OX7A 3Q83A 1F6TA 2M2BA 4NXMF 3D1HA 4LFAJ 2G4BA 3R8YA 3UCGA 2BUNA 3FK4A 4DR5F 4MKBA 3DXBA 5J2QB 4KFBA 1FT8A 2IVMA 1TVRA 1YJVA 3KUGA 3NS6A 4IOBA 2QLBB 2GGPB 3CVKA 2PMWA 2RRNA 3AD9C 3DOLB 3SSRA 3RB3A 1F5CA 3ILLA 4B3MF 1C1CA 5ETSA 4B3SJ 1JKHA 5DETA 2CRLA 3CO9A 4J90A 3TR5A 2KXFA 1SJQA 3OR1A 2CQ0A 4MH8A 4QIGA 3IRWP 1CULA 1M1KT 4J9SA 2J6UA 1TVRB 5JXSA 4KFBB 4OHWA 1S1TA 2B3TB 1SBRA 4ZVSB 5GADU 2HLUA 3W5YA 1N33J 1NK4A 1OY6A 2HG4A 4FF1A 1GX6A 2C3UA 4JI4J 1UZDA 4NL5A 2HSEB 2K7JA 1VQLS 1EETB 5KFFA 2XS7A 1DBDA 1V3SA 2D9PA 3R5CA 4LFBJ 3J7YI 2VJUA 2V50A 4J9RA 2MHNA 3G96A 1UFKA 2UU9F 4LFAF 3B54A 4DL2A 3C6TB 3MAAA 2RB7A 3RRKA 2RF2A 1FFGB 3UW1A 3ZNJ1 4FS1A 4JI7J 2AJ0A 1WG4A 3NXZA 4DV0J 2ATLA 1Z4UA 1H2TZ 2HFSA 2V5HG 4DR7F 3OUYB 3GSIA 4OQJA 1W7WA 5FLXY 2RDJA 4FBUA 1HPZB 4ZPDA 4OYMA 4LF9J 5J1NA 5EWEA 1T02A 3FQLA 3CCJS 2E9ZA 2RS8A 3L95X 4P71A 4IH5A 5K5MA 1HHSA 3P8BB 5IV3A 2GNKA 2LEAA 3N6NA 3NGSA 1WD6A 1LWXA 3GFXA 1SIZA 3CJ2A 3SV3A 2XS5A 1R0AA 5GAHI 4CO3A 4DR2F 4JV1A 1HQUB 4IUFA 2DR8A 3HVTA 4DSIA 2W2NP 2FIUA 1PSDA 4LBPA 2VG6B 1XR5A 1WJ9A 3R9LA 2FJWA 4TY8A 5EX3A 3L7OA 3L4BC 2HS0A 3D9BA 3MR7A 2LDIA 3FSYA 4KO0B 1B0TA 4HI1A 4ZCLA 3ZTPA 4N5SA 5DLGA 3KHHA 1U6BA 1FXRA 2HQIA 2DISA 4F04B 3V6DA 2ALYB 5F9LA 1L3TA 2V4JA 2YH0A 1CPZA 3M9MB 1YZ7A 1HNWJ 4M5HA 1Q79A 4UUXA 3Q8QB 2Z2YB 4R5PB 3FBEA 5CD4A 5MLCV 4ED1A 2NXEA 1EQ0A 2DNNA 4ANCA 1SQFA 2P6TA 3M8SA 4K4WA 1WC3A 3SV4A 4OHVA 5A76A 3P49B 3ET6A 1BC6A 1VRUA 2LP4A 4P73A 4O3NA 1UA0A 2J0XA 4OX8A 4YDXA 3H5XA 1H2VZ 4PPDA 4CIOA 3UDCA 1IBLF 3DKDA 3PY8A 5FDLB 3EVMA 2DT9A 1ZZFA 2CIMA 4DG1A 3CF5Q 4CLZA 1YK9A 4RZRA 2J0SD 3CJ8A 3U1NA 1RHMB 4H4KC 1KR4A 1M5VC 3N79A 3M7VA 1TUWA 2CPHA 1VBYA 4I7FA 2ZD1A 5IZHA 1N4LA 4CLTA 3FBCA 4XIUA 1W2BR 2XB2D 1LW0B 4NRTA 4NPOA 1KLMA 1TKTB 2FJDB 1W26A 1RT1A 2C42A 3UVJB 3W2VA 5CYJA 4RU2A 2WSFC 3QFWA 3LALA 3KLHB 2HGNA 2IJFA 1LWEB 4MKYA 4N7TA 1QAIA 4DR1J 4FKXA 2MLZA 1UW9A 4X65J 4ILMA 1R0BG 5A2QY 2PFFB 2M5YA 2E7VA 2IYGA 4P7VA 1S0OA 2MKYA 2UZAA 3OL9A 3M8ZA 1VR6A 2WVDA 3DGPA 4ELVA 3LTOA 2O66A 3N6MA 5KFZA 4KRWA 1BMQB 2HS4A 2Z4PA 2XM3A 4CYUB 2R8GA 1S6QB 1FWKA 4MIWA 2UVVA 1RGVA 4OX9J 1RWNB 2LQ8A 2E1MC 2I8EA 3PZPA 4JBCA 1VC0A 2GO8A 1IQTA 2BM0A 4A8WA 4LR7A 5J2NA 3CJQA 5IWAJ 1LWFB 2YKAA 1ZM3A 5ETOA 4QWDA 1BQNB 1AZSB 3D5MA 2QLWA 4DR7J 4LRFA 2KG0A 2DNYA 3NGTA 2ZBQA 2V68A 4NLDA 2HBZB 1WORA 2CQPA 1NBEB 1GMWD 4Q44A 2LEPA 1Q5VA 3C66A 1TAQA 4L76A 4RX6A 4W4MA 4K4YA 4DF8A 2CG4A 4NLYA 2X51A 3BQ2A 3DLHA 4EFAC 5E3CA 4B3OB 2KM8C 4IOCQ 2W7OA 3DOMB 3Q22A 2IY5B 1MU2A 3LA0A 2AYGA 2MDAA 3ZZYA 4LBIA 2XMTA 4WF9Q 2RVJA 3PEJA 1T03B 1XNRF 2CPXA 1WOPA 3TEGA 3EE3A 2YTCA 1WC6A 1PBUA 1C0UB 2NZCA 4PPZA 2P9EA 2DRBA 2E5LF 4F0MA 1RAIB 3KJNB 2OELA 2QJ3A 3L7PA 1S10A 4F3OA 2P8IA 1S1WB 2FVSA 1ZH5A 1RA7A 4ZVPB 2MSSA 2XEXA 4ES1A 4ALZA 3KK3B 2BQUA 2OPPA 3LUYA 1MMDA 2ROGA 4NI2A 5KG6A 2GAHC 4FZVA 1OQ6A 4K5SA 4MK9A 4MYUA 2MQ8A 3ZZ0A 5J1PA 3BM7A 1RLDA 1SUQA 5HROA 4IRCA 2EC2A 3ETOA 2V6AA 4XAKA 3BSAA 3H5SA 2ACYA 2L9NA 4OJHA 3K59A 1PCAA 2DYAA 1QAXA 5AE3A 3PW0A 4KPYA 3EWGA 1YJRA 3VALA 4DCOB 1DFDA 4LT6A 4F3MA 4WTOB 2LXUA 2K3KA 2O3DA 3QSIA 2MY8A 2HVDA 3HCXA 2AEMA 2LYVA 3CIZA 4MMOA 2V34A 2EG2A 3OFFA 2HWTA 2LQ9A 1TUGB 5AE1A 1QVGR 4FBTA 1IR1A 5KFTA 1E6VB 4KKOB 1BQXA 1RLCL 2C2EA 2VICA 1DTQB 1O8BA 1RAJA 3ETMA 5KFKA 3V4IA 4HDHA 2YKQA 3T5KA 3R7NB 2AYBA 2CJAA 2CA9A 4ID5A 5HK4A 4LFCJ 4FF2A 2J5AA 4ZVEA 4DUYF 1T05B 3M8QB 1IKYA 2DITA 3MM5B 4RBTA 1JLGA 3TWZA 1G6BA 4CLKA 2C2NA 5D6GA 2KVQE 3KG4A 5D0GA 1U1QA 3TQEA 4FF4A 1N33F 2I5JA 4WFZA 3ZTRA 1T9YA 1S99A 1YWXA 5LSOA 1KVJA 2XMVA 1CJVA 2UU9J 4LMZA 5F0WA 1EKRA 3BR9A 3JXOA 3UQSA 2Q43A 4ECWA 3MEGA 1VQ8S 2YKOA 3K89A 1AYEA 1RCOB 4KV8A 3ITHB 4LSZB 5EX0A 3RU0A 3BQ1A 4DV7F 4ECTA 4LF6J 3TUJC 3I0SB 2QFJA 2BXJA 1X4FA 1VQ5S 2ZOGA 4TU8A 3MECB 3CNQP 1TKZB 2WONA 4CH1A 4M5DA 2DHHA 2O01C 2YNHA 4P52A 4F26A 1T05A 1OSDA 2L08A 3IR7B 5SUHA 2O1PA 2PI4A 3ZZRA 2FJAB 3QIPA 5L1JA 2BOAA 2WB4A 2K3IA 2Z2LA 3DRPB 4LF2A 2IJNA 2G2YA 3AOAA 4OI6A 3WC0A 3PX4A 3OL7A 3DC2A 2ABYA 1EKSA 2CQBA 1Q8KA 2DNZA 4LSLA 4NLQA 4DQSA 1QSYA 1FX4A 3CMQA 4PXBA 3CB4A 2F1FA 2UV8A 4KR0B 4L3KA 4M5JA 4NZ0A 4WKRA 3H2VE 2KT3A 1HWKA 1ELOA 1JLBA 5D4LA 2OPQA 3DI6A 3WIUA 2W7PA 2R7RA 4LF6F 2R7UA 2OIHA 3R5AA 1CS4B 2K7KA 1SKUB 4DR5J 2GO9A 2KYZA 3V2UC 4WU3A 3VHQA 3RR7A 2JRSA 1XIQA 2NXUA 3OR2B 4ZLLA 3HK2A 1YQHA 3GQCA 3M8PA 1A9NB 2GCFA 4AE5A 1PJ6A 5HANA 4NI2B 4OFZA 3SEOA 2QLXA 4P2FA 5M2UA 1GQEA 4C0BA 2Q66A 2O5DA 1DJ0A 3BN4A 2OHDA 1RWMB 1SV5A 4NZ6A 3RTVA 4F2SA 1NK8A 1LK5A 3BGOP 2RU3A 2HHWA 4ELTA 3W5ZA 3JB9k 1NXIA 1UAWA 1Z1ZA 4DLEA 2OPRA 5KFOA 4X62J 3OLBA 4DSJA 2GIQA 3DLGB 5KFSA 2N3LA 4E8UA 1RUSA 2WOMA 2ZZTA 4HDGA 4HHJA 4P2MA 4P2SA 3TAMA 4ECQA 1VQ9S 4Q8EA 4Y2CA 2I1RA 2J7KA 3PYGA 4KY3A 2PMZD 1NKCA 1RQ0A 4NYZA 2ROEA 3Q8YA 4CLWA 5KFCA 3KLFA 3US5A 1N5YA 2H5JB 1PC4A 2R8IA 3MGJA 3ILIA 1Q53A 3KG0A 4J9VA 1JNZB 2DCUB 2QA2A 1YJNS 4Q0BA 5BYRA 1TTHB 1PYTA 1Q5YA 4HH0A 1S4FA 3VAMA 3D28A 2CPDA 3EVWA 2ZH1A 5L1LA 1K8AT 3DHWC 2W8KA 5CABA 4TQSA 4RW4B 2AV5A 3CMES 3DOKA 2E9RX 1S9GB 1O51A 2E1PA 2ZKTA 3MR2A 5I3UA 4EZ6A 2QFIA 3NGUA 3I0RA 4GO5X 2DNQA 5KFIA 4TY9A 3WQPA 4JI1F 2HHVA 3W63A 1U2FA 5KT6A 3ITHA 1H73A 5HAOA 3SFUA 3BR8A 5CA5A 5D8HB 4ZOSA 1JX4A 5AJ3J 2N82B 1V5VA 2HRYA 2VKRA 4QCLA 3RB4A 3T1HJ 2HNZB 1WEXA 3DNCA 3K58A 2EEYA 1MN7A 1SCJB 1S6QA 1WWHA 2VC0A 3OR2A 1UJ4A 5F3TA 4CTAA 4CLYA 5E3RA 1T3OA 1IXKA 1MN9A 1F60B 1S9EA 3CW2C 5C42B 2W4DA 4I6AA 1B3TA 1NJXA 3CCLS 1N36F 1R31A 3Q8VA 3IN5A 2V0NA 3HKZD 2DGWA 4H4OB 4BBYA 4ED7A 4DXLA 3CDEA 2V63A 2C2KB 1D8ZA 2NLWA 4DPOA 4LSLB 5LJ5Y 3PIOQ 2HLTA 3LWLA 1RTHB 4EYHB 1U48A 1XNQF 2YVSA 3HHLB 4JI4F 3ZZTA 3Q86A 3UVJA 2IYIA 9RUBA 2RKIB 2PFDA 2EPIA 2KVIA 2DY9A 1KLMB 2LQJA 3GJQB 4EMDA 5KFHA 3J80U 1AT1B 4X4OA 1HNIA 4FF3A 4QYZJ 2QGFB 2ROPA 3VQSA 1VQSA 4JI3J 3CULA 4JI8F 1RYRA 2KU7A 2CNLB 4IO9Q 4O3QA 5F8LA 2ASLA 3JSMB 2FJXA 3EGNA 1DQAA 5F8GA 2L3MA 4FPRA 1N56A 1P27B 4WFNQ 3JS9A 1GMWA 4KV8B 4Q7AA 4OYXA 4JI0F 4WPAA 3CC4S 2BANA 4PAAA 1QTNB 1L3KA 1SC4B 5J1EA 1ZTTA 3G82A 2MXYA 2MKHA 4LF8F 1RZMA 2YKNA 1L5UA 2QL7B 5KT7A 3FDSA 4NE9C 2GC8A 5B09A 1MSWD 4Y2MA 4YUDA 2FHOB 3LH2S 3O3LA 3V6HA 3TNVA 2Z8QA 3ENVA 1JK9B 4DUZF 2CZ9A 3RGIA 3HFKA 2HVIA 2KFYA 2GIRA 2HQDA 2N7CA 4CH0S 1H2UX 2VF3A 4ZJOA 4DN9A 4RO0A 3J81j 2ZM6J 2Z30B 1NMEB 2JEJA 4Q0BB 4OJGA 5I42A 3KOAA 2M8HA 3MUTP 1O5JA 2KFZA 3AQPA 4CM2A 1RACB 3FVYA 3BQ0A 1T0TV 3HHLA 4J7CA 1N5YB 3M4XA 1QSLA 2PI5A 1IJEB 3N6LA 4DU8A 4YOEA 1H0HB 4MYTA 3JYTA 3FSXA 3SYZA 2V8DA 1RABB 3DLGA 3Q2TC 1NHVA 3MMCB 3KWMA 1S1UA 2J9EA 3TA0A 3NAIA 4M1KA 1ZYQA 4ATNA 2HQCA 3I96A 3MEDA 2HK3A 1S9EB 2B7BB 2Z2ZA 5B08A 2CG8A 2HRUA 2XO6A 1RT7A 4DSFA 2CDQA 4UOGA 3N01A 2B51A 1RU1A 1X7VA 2CQ1A 3CTRA 4KT0C 5LMNF 4PRFA 3R2DJ 4WK3A 3K7RA 3BH6B 2H54B 1TKXB 1X4GA 2W2PP 3OTCA 3ZTOA 4S0MA 4YR2A 2FJVA 1RI7A 2AEJA 2IFXA 4LR8A 4CI0B 3CD5A 3CCRS 2GQCA 3D0HE 3QWUA 1JLBB 3GV7B 5HVHA 4AT1B 2F8EX 4EO8A 3BDPA 4QU6A 2G9OA 4RL1A 1WOOA 2W2QP 1C0UA 3HFZB 3RBEA 1WSVA 1R3NA 4PWDB 4X4SA 4CRJA 5HP1A 2QLJB 1UVMA 4ID8A 4JV5F 2BJ7A 3W9JA 4L73A 1N5VA 4J5OA 1RT5B 3BKTA 2ZJRQ 4OMFG 2OLWA 5FD1A 2ZHBA 3J7AN 2JC0A 5AJ3F 5D0RA 4DQPA 4QYZK 1LW0A 1Q4RA 2JSXA 1VISA 2NXCA 2RQ4A 1JLFB 3PACA 3J81Y 3OL8A 3OSPA 1FJGF 3QT7A 4URQU 5DDPC 1MWZA 2LXFA 2V94A 3MTKA 4UOHA 4LIRA 4XDCA 3PIPQ 1FHTA 1FE4A 2F5GA 5KFUA 5KFNA 2XY7A 2KTQA 1ZA1B 3VAHA 1C0TB 2MPUA 2UUTA 4AL7A 4OI4A 1KVKA 2Y1JA 2F40A 1QTMA 5FDLA 2UUBF 2EFGA 4KH1B 2A2CA 4DDFA 4UUWA 2PC6A 3FRZA 4K5RA 5DGAA 3G82B 2W4PA 4Y3CA 3W64A 1DLOB 5ITHA 2ZH2A 3CD0A 2ZH5A 3B6BA 4OYOA 3VQTA 4DHVA 2M9KA 2V8VA 1TP7A 3CGIA 1VLOA 4WIQA 5AXMA 2Y3YA 4JP8A 4CLUA 1VQMS 4BDPA 3OTOF 1CG2A 1RWPB 4I64A 4TYBA 4QU7A 3LWMA 4HEA9 4RW7A 3T5LA 3VZHA 4EWTA 2DNPA 1YITS 1SC3B 3ZC4A 4USKA 2X1BA 3C3LA 3BEGB 4ID5B 1RT7B 2ZWOA 3T41A 1VBXA 2J0QD 4UY85 2KFNA 3DGPB 8ATCB 1YBUA 4U9RA 2K2PA 5DDQC 2B9EA 3GFYA 3JQMA 4KKOA 1IBKF 2G0CA 3M9NB 5GADI 3A8EA 4DCJB 3G6XA 3U7JA 3MPUB 3BO4A 3RB0A 4A8YA 5EN1A 3EZOA 1K47A 3E51A 1X4AA 2KL8A 1SJRA 3DRPA 2C3OA 5B0FA 3P45B 2GIFA 1IBLJ 1C4CA 2YX4A 4NXNF 4IRKA 5T14A 4MTPA 3VAIA 2ZD1B 1BXNA 4CLLA 3OW2R 3MMBB 1SH2A 2GFFA 4OZNA 4FXVA 3U27A 2AW0A 2VBYA 1U1NA 2CJKA 4DR6J 3K5NA 3K2YA 1J27A 4ZP6A 4UQGA 5DLFA 4QPTA 1KKHA 3VZIA 4J9KA 2FZGB 1S1XB 2XTJP 3L3CA 2BDPA 4URGA 2XLJA 1HNVA 3OFHA 3NNAA 1HHTP 3QZ8A 2NSBA 2YQ3A 1RAGB 4OYPA 1C4AA 1NSAA 2KRBA 1SJ4P 3RB6A 1Q82T 4GKKJ 2AGOA 2MGZB 2VV5A 4B9NA 7FDRA 5EGYA 4DQRA 2C3MA 2RAQA 4TU7A 4E0DA 1VRTA 2JEGA 2W24A 2BM1A 5A8RB 3RZAA 1FRIA 4FNHA 2ASYA 3DRSA 2V4JB 2B6AA 2AYMA 3M8YA 3W65A 3M8QA 3CC7S 5B0AA 5DDRC 3EICA 2ZBPA 4TQRA 3MTJA 4LRCA 2M3DA 3IS9A 4RU9A 2NQPA 7FD1A 3RBXA 5HVGA 3VAKA 3O8WA 4KO0A 1OY8A 2OPSB 3QT5A 4DPXA 4C4WA 3P5TL 4QYRA 1BUXA 2E5GA 2PN6A 2PSZA 2QZ8A 1DTQA 1GMUA 2RNEA 3MCNA 3N0VA 3WZ0A 1SJ3P 3DM2A 2CJBA 3KDOA 2HVZA 5KOWA 3KLFB 2XHCA 3AODA 4UZBA 4FXDA 4NEZA 1VQ6S 1KP6A 5K9FA 2EFOA 2HPUA 3QQCD 4NWBA 5E0OA 1HQEB 2GMHA 3M2RA 4DJBA 4CH7A 1BGXT 1WHVA 1VQ7S 4MT1A 1NK7A 1LW2B 1XNRJ 1U25A 2Q6BA 3TX8A 3OUYA 5J2NB 4QW8A 1SUQB 2PEHA 2AGQA 2FY1A 3CCWA 1RTDA 4F50A 1KVIA 4OJ1A 2VODA 4ICLA 3I32A 3FKBA 2MEWA 2VKZG 4DV4F 4FYDA 2JL9A 2LCWA 1RDRA 4JI6J 1CSJA 4M5MA 1U24A 1Y3KA 3OJSA 1UTAA 1V3ZA 3CEDA 2EI5A 1G3OA 4NLWA 3UFCX 3DLEB 4JI1J 2OPQB 2VL1A 2RIJA 3DI6B 2JLGA 3BSNA 1IUJA 2YNFB 3G86A 3QGHA 4FN5A 4M5LA 2HNDA 1AB8A 1S6OA 2XYPB 2YX7A 3G87A 4P2XA 1HA1A 1FJ7A 2JDJA 4R8UA 4LUBA 2HHXA 3KHRA 3A3PB 1FFSB 3BH7B 1JLQA 2Q79A 3ZFVA 3GIKA 3PX6A 5D3GA 3HT0A 2HS3A 3KJQB 4ETXA 1RE1B 3UN5A 4G65A 3DOKB 4HT7A 5HBMA 3TRGA 2NPIA 4FPIA 1WOSA 4YHHJ 1RAEB 1RKJA 3LGHA 1HI8A 3PRVA 1JB0C 3FZBA 2FHJA 3MPYA 1J5EF 2DEIA 2OI2A 4Y65A 2GHPA 3OPKA 3PRBA 4ER8A 3D1OA 4ZJQA 4DG1B 1WACA 3SCLE 2H9ZA 5DM6Q 1RADB 4LBHA 1N36J 3M6VA 2ZBIA 4HHHA 4ZP9A 3SDEA 3FCVA 1HR0F 5HMZA 4AYBD 4AUKA 1K9MT 2Y1RI 4MKVA 3MEGB 1FD8A 4LF4F 3W2WA 2QN6B 3LW5C 2MLXA 3G8TA 2UVWA 2KRRA 4C9DA 1DURA 1FKAF 4DV3J 1KN6A 2R7WA 1JQGA 3M8RA 3QRRA 1UP1A 1VJWA 2CDRB 1JXLA 4WXOA 2MZSA 1WC4A 2VASA 3MM5A 2EC0A 2IRUA 2IA6A 4CO5A 4M95A 3MXHP 1DTTB 3R3TA 4XPCA 4U67Q 2Z2MA 2ADCA 2HFOA 1JLCB 1WEZA 4XDDA 1RAAB 2GVDA 5E5NA 4Y28C 4A8SA 4NLSA 2EWHA 3I4HX 5ETTA 3U1LA 2CPIA 1EJ7L 2C2ZB 1J5EJ 2N3OA 3KUHA 3RR8A 1NZ8A 1VK8A 2VG6A 1KONA 4QW9A 2P5VA 2ZBCA 5BYSA 4DLGA 1BHNA 1HR0J 1YDLA 5D15A 3D3BJ 3M32A 4D3HA 2E5IA 1S1VB 4YB6A 4Q8FA 2V8PA 1EX8A 1C2PA 1T9XA 3PYFA 4UOCA 4ECZA 3W5XA 2N4CA 1HKAA 4H4OA 2V4QA 5F0UA 3PNIA 4ENOA 4ZPWR 1JXEA 3UD3P 4FYVB 5EDWA 3IM9A 2UUBJ 5KFQA 2CQDA 2D3ZA 3OXLA 3PJ9A 3BBFA 4C97A 2H4YB 3QMQA 3SI8A 2QG9B 3MEEA 4KH0B 3EDQB 1NPRA 3JTPA 3MECA 5J2MB 2WBMA 4DL4A 5E2QA 4X4QA 2R8KA 4X2BA 4LIWA 4LF9F 3ZZUA 5CH7B 1QUVA 4LVNP 3AQOA 3ILOA 1IQZA 4QWCA 4ZPTR 4A4JA 4WFXA 4ZPVR 1Q7YT 5KG7A 2WSCC 2W9CB 2YNGB 4K0KF 5DO2A 2NPFA 1NJZA 2BV3A 1ZPWX 1NDCA 2OD4A 3FCHA 2HFZA 1TK0A 4C8LA 1CJVB 8RUCA 3MM8B 3ELHA 1D1UA 3GIMA 2H5IB 1I94F 1KQKA 2B0GA 3FEXB 3OR1B 4Y2KA 1RAHB 1KTQA 5JJBA 3OTDA 4AD6A 4ZPBA 5I3UB 1V6HA 3RW6A 1MU2B 2ZH3A 4KGKA 4OYZA 2XSJB 2BJEA 1RT6A 2BE9B 2C2OB 1IKXB 1RP5A 3AJDA 2VPWB 3L7UA 3MCSA 1KBRA 1FO1A 1VLYA 5K8NA 2IMWP 3CCTA 3GPAA 2XGQA 1NJIT 2HVHA 1YIJS 2MY7A 3LGNA 1N8RT 2H1YA 1OPIA 3PYEA 4O0NA 1Q95G 3EGWB 4U96A 3VR1A 3CJ4A 1HWJA 4OI1A 4USMA 5IT9U 2GAGC 3UI3A 2ZHAA 2Y1LB 4DPTA 5KG2A 2HGLA 1E6VA 1WTBA 3KHGA 4NLGA 2JC1A 3NOCA 4RNOA 4DFJA 2DGOA 4HYKA 1RWOB 4FNIA 4RNHA 4JYAJ 1U7LA 5KFPA 3FFIA 4DR3F 4LSNA 3EGZA 4QZVB 3SQGB 3ZNUA 4BWMA 1SIWB 3UO0A 1OQ3A 1VQ4S 4I2PB 4CLFA 4J37A 3DRRB 2XQCA 3B4DA 4M63A 3ZO7A 5K14B 2QL5B 2LXIA 2ZUGA 5C25B 4ITSA 8AT1B 3RBDA 3OBIA 2XYGB 4LSNB 4YP3A 3C6TA 3D3CJ 2BW7A 2EBGA 2IAJA 3A12A 1VYAA 3ENWA 3MAAB 3DU6A 4OHXA 1H72C 1K0TA 1GX5A 3MCMA 1AA1B 1KHVA 3C8YA 3GMGA 1WHWA 4C8MA 1R7IA 1HIYA 3A1YG 4MK8A 4TNOA 1HNXF 1FE0A 2AF6A 2DJWA 5GMDA 3UNYA 5GAGI 1S12A 2C2MB 1P1LA 3HKWA 3IO1A 3MF5A 4PWUA 2CQCA 1L3VA 3RBZA 1J5OB 4B3MJ 5DQGA 4ED5A 5KAKA 5CZVA 2DIUA 3FZ2A 4JYAF 2ZJPQ 4ECUA 3PJXA 1FNXH 4PABA 1M5SA 1YG0A 9ATCB 5DM7Q 1N54B 2A1BA 1X9WA 2GW8A 1HBMA 4Y2IA 1NEEA 2DRAA 2M8DB 4KB7A 2D74B 2JZ5A 3L9ZA 1U26A 4PXDA 3IM8A 4LF5J 1T94A 2GVZB 4WWSA 4F36A 2DGUA 2ILYA 3DDKA 3GR1A 3MM8A 2IBOA 3TAQA 2ASDA 2MKJA 2AX0A 4ZCKA 1S0VA 2R2RA 1GXTA 4HT5A 3TVYA 3VGSA 4JI2J 4YQWA 4DMZA 1SH0A 2BMBA 3T6BA 3OVSA 2BE2A 1N0UA 4Q2MA 1FESA 2CFXA 3I0SA 2MSTA 1LWCB 4LREA 5MAOA 2L41A 5LSLA 3KFWX 3EDRB 2R8HA 1P8GA 5ETQA 2FLLA 3IWXA 2CVEA 1Y5LB 5ETVA 4JI5F 4ZHRB 4HH1A 1VRUB 5KFJA 4KAIA 3T1YF 2B9XA 1LWFA 4JOUA 5KT4A 1WUUA 3CMAS 2BRLA 2D9OA 1X4EA 3HD1A 2XCAA 4QIFA 4NCGB 4QWBA 4JI0J 3H25A 5LMUF 4LF7F 4K8RA 2FLOA 1HBMB 4TLRA 1NNDA 3MD1A 5HO4A 3HT3A 1N5TA 4IYQA 3KTQA 1KQSR 1FRJA 3D67A 1T9TA 1RHKB 3BGLA 3GLJA 1HBUA 3V4IB 3B8HA 6AT1B 5JUMA 1NU4A 1RKIA 1FKPB 2JLEA 2Y0BB 1FFWB 4AFFA 4CNZA 1HQUA 4H4KA 2BVZA 1QY7A 5CYMB 5B0GA 1XMQJ 2ZKUA 1KTVA 2EXUA 2RH3A 3G71S 2QL9B 5D0EA 1U1KA 2DD8S 3CD6S 2BACA 2DGTA 1YHQS 4ILRA 3I56S 3VAFA 3GJSB 2LFVA 4QOTA 3GIIA 2HBRB 2VQFJ 3P6YC 3ENAA 3FBFA 1NKEA 4H4MB 4LF8J 4EYIB 4GC6A 1B70B 2Y0SD 3ISND 2VBXA 1X8DA 3PRDA 3PKYA 3I31A 4ZCIA 3FMWA 4CDIA 5KFDA 5JVHQ 3TOQA 4V19J 4O0IA 2RILA 3MZIA 4K4VA 1RWKB 4L72B 3WHIA 1VGYA 1VIXA 3CCSS 3IMQJ 2MZTA 1S49A 2ZHOA 2B7CB 3OFGA 1HYSA 1BLUA 2ZM6F 2GQ2A 3KK3A 2XMKA 4ZPCA 3QRQA 1IWAA 1S1WA 4U7CA 1RHQB 3K5MA 3TI0A 3TVZA 3M6WA 4TLQA 3PO4A 2D3O1 2UUCJ 5IC4B 4ZVRB 4F2RA 2DTJA 1X4DA 2WW4A 3GWCA 2W8LA 1CQNA 5F8JA 3QGPA 2HYIB 4QQBA 4QWEA 2PGCA 1TL3B 4A48A 4X65F 2AMCB 3HVAA 3H7HB 1S7HA 3LPYA 3BGUA 1IKXA 2P6SA 3Q89A 3EPGA 1EB0A 4ECSA 1VQNS 3U02A 4QIVA 5K8PA 3BSOA 1K1QA 4FVMA 4DV6J 4ES3A 1FK9A 4B3OA 4OIXA 3THTA 5SZTA 2JFKA 1WTFA 3MI7X 1S48A 4R8UB 3GILA 1NDPA 5GAEU 3JTOA 2YNGA 1SJFA 2ZDPA 1RTJB 1RT4A 3R97A 4DOZA 1PBAA 4O3SA 4M5NA 5KFBA 1IJFB 3TEHB 3SBMA 2BJ9A 4KHMA 2QA4S 3TO8A 1HBOA 2H5EA 2KYXA 5L38A 2NS1B 1YI2S 3NL0A 1U1PA 3THPA 3IRXB 3PYDA 3M2UA 1TFYA 2HFVA 1GNKA 1PYOB 3QBCA 4C11B 1RAFB 2H51B 2QSFA 4ICLB 3HMJG 5J2PB 5KFWA 5K14A 1U45A 1RTDB 2IM3A 1OWXA 2WAQD 3DRRA 4B02A 1MMLA 1Y11A 2X3DA 2XWXA 1S6PA 3UR3C 3W9HA 1WNEA 1I51B 2LLZA 3KUEA 3BREA 5EWGA 2UVRA 2CXEA 5D78A 1G4CA 2F4VF 4RW9A 3T3FA 4Q5VA 3M2UB 4PXCA 4A8XA 3DDNA 3PW7A 3VV2B 1IM6A 1CC7A 3OFEA 2F4FA 2Q1LA 3M32B 1WC1A 4YY3F 1FNMA 3A8JA 4C3LA 4RUCA 4LF7J 2YNIB 3AOCA 3MFHA 5IM0B 3UDVA 1KSPA 1GK8A 3KXDA 1ZA2B 1H38A 2CPYA 2AJ2A 3TZZA 1YBAA 4O44B 3KMQA 4M8LA 5AE2A 1TU0B 3CT9A 4DV2J 1A7GE 3OTBA 5FIIA 2E44A 1F9FA 4F8RA 4J9LA 2B6AB 1OIAA 4DPUA 4PG4A 5F8MA 2L48A 1AFIA 2CNKB 1NPKA 2DR7A 4NCGA 4WP3A 4QIWD 4ZVOB 2YQ1A 1KDNA 1NJYA 3LAKA 2GMJA 2I9SA 5HSPA 3G6VA 2UXCJ 2RUSA 1X60A 1X5SA 3D6MB 4ZHRA 3TA2A 2J0WA 2VB6A 2XBPA 3MM6B 1HNVB 3SQOP 5KOXA 2G0JA 5GMKa 4Q45A 1PILA 3BYPA 3OV7A 4F4ZA 1KD1T 2UUAJ 5A2QU 3W1YC 5A8KB 2RRBA 3F44A 1HYSB 2EK6A 2IPOB 2OFGX 5DGBA 1NKBA 4O4GB 1EHWA 3AD8C 4Z37A 1TR0A 4PEOA 4U95A 3DRYA 2FVCA 4J9UE 3C46A 2RJZA 2VPZB 3EXCX 3ENQA 3O5TB 1UPMB 1GMVA 4A46A 3T5JA 2F8MA 4NEYA 3MR3A 1TL5A 5C2CA 2U2FA 3TYTA 3WBZA 2DNKA 4PG8A 2JVOA 4GC7A 1VBZA 1HNXJ 2DHGA 1R27B 1NDLA 3Q8RB 2G2ZA 4V19X 1HBNB 1JLQB 5IXUA 3CO0P 1SL1A 2ASJA 1NRKA 3AFGA 2AD9A 2EKNA 2XS2A 2KKHA 1QD1A 1YLXA 3I82A 3K8VA 2HNDB 5H9FK 1ZM4A 2DNOA 5HMYA 3RAQA 4ZVFA 3VCDA 2YNIA 1O0PA 5E41A 1CJUA 4IG0A 5D4PA 3DMJA 1L3SA 5AXKA 1X4HA 2AJ4A 2OMOA 4X4RA 3G2XA 4OI2A 1S7IA 4OYAA 5IV4A 3MFIA 4B3TJ 5C25A 3TARA 4I2QA 4B3RJ 5CYQA 4OYBA 2XY5A 1NPPA 1WSRA 1VHIA 1HD1A 1TZ0A 2HVEA 3MURP 3NBPB 2V4RA 4RR5A 2JX2A 1LW2A 1H3DA 2AEFA 1UW4A 1TK5A 3H40A 3CCQS 4B9TA 1HQEA 1GTHA 4M94A 3K0JA 1RT3B 4MIAA 3CJ3A 4A8FA 5F8HA 5KFXA 3EPIA 3KK1A 1S57A 1C0TA 4X4PA 1K0VA 2V2ZA 1WG1A 3ZXWA 5FLXU 3QPIA 4XPEA 2XULA 4PR6A 4YDDB 5CD4H 2XZDB 3SZ2A 1NK6A 4Y00A 3TA1A 1XJWB 3CJ0A 3NRBA 2BE7D 2YWHA 3TANA 1CULB 2FQQB 5L1KA 3SCKE 4QR0A 3RAXA 1GXUA 1RT6B 3HZEA 1FWPA 5AXNA 2CZ4A 2IA0A 2WB1D 3NKYA 3ICLA 4DS5A 2WCXA 3BDEA 1C1CB 2IC3B 1VRTB 2IM1A 3KNGA 2IRXA 1DQ8A 2IVYA 4I6YA 3SFGA 3OJUA 1CJKB 3GCWP 3KLEB 3V81A 1FRKA 2BQRA 3H2LA 4B9MA 1TUVA 3O1LA 4DPWA 4BWJA 4KBIA 5L8RC 1URRA 4ILLA 3A13A 1SQGA 4ZDNA 3SSSA 4CNYA 2FPHX 2OD6A 3GCXP 1XEZA 1IR2A 1NJWA 1HWUA 4HTIA 1BQMB 3BGRA 3DRXA 3IAS9 3QGGA 4C0OC 2KM8B 1GXLA 1FJCA 3DN9A 3LP1B 3PXGa 1UCNA 1TL7A 5J2MA 1R6VA 2HFUA 1OO0B 3QYYA 4IO1A 5KFRA 5KT2A 1F9EB 3MMBA 2D3UA 2F7VA 3H20A 3LF0A 5IQQA 4QPXA 4YFUA 1UA1A 1FDDA 3AH6A 2ZVIA 4PQAA 4DFKA 1FKOB 1RWWB 1SB6A 1PG5B 2C1EB 2DNHA 2J8SA 2IM2A 4ZPAA 2LU2A 2XO7A 2X1AA 1SKRA 5HL7Q 4C11A 1YJTA 3MMCA 1AUDA 1TMMA 1T11A 5IS2A 2DH8A 5ADZA 3GFZA 3GJTB 3B82A 2P2CB 3P5BP 3TX0A 1JIHA 4DV7J 5ETLA 3CE8A 4G1PA 4C8NA 1R0CB 2WVBA 1RT4B 2ACMA 2XLKA 2HFNA 1UMJA 3PV8A 4DV1J 3QAUA 1FWLA 5IT0A 1YTYA 2GVDB 1JLCA 4IOAQ 2ZH9A 4DR3J 1R8BA 1W2IA 3T9NA 2MHEA 2GMLA 2QA1A 2D1CA 3FCWA 2ZVSA 3LO3A 4USJC 1HI0P 4DSEA 1HNZJ 4N56A 3K57A 2C2DA 1KQFB 2AZ3A 2B4UA 3IBFB 3M6XA 2PD1A 3KK2A 2R9LA 5LMUJ 3RW7A 4CCHA 1U1OA 3BBCA 3MM9A 1GFWB 1T95A 2VHGA 1ZAVA 3FEYB 2VJVA 4EO6A 3TW0A 4WCEQ 4JV0A 1D9DA 4BC9A 1QAJA 2BRKA 1AFJA 1DLOA 4CO2A 2COLA 1WDTA 2CUYA 3CSKA 3VVTA 2UVUA 3THVA 4JI7F 2XNRA 1IM4A 2HWHA 4R25A 1HLWA 3ZZOA 4HACB 4KTQA 2QC3A 4OLOA 4D3GA 5I3QA 2KHDA 4DX6A 2KZZA 2BE2B 2ZOMA 4ZS6A 2BJDA 1C1BA 2OEMA 5C24B 4K2JA 1YJWS 3MM6A 2NSCA 1U2RA 1NHUA 5HJYA 1LV5A 1BE4A 2YX1A 1DQ9A 3JQKA 1IN0A 2UXBJ 1JLFA 3GYXB 3HD2A 3M8WA 4IG3B 1HNZF 2M0GB 3HDSA 3HHKA 1ZM2A 6FD1A 2OTJS 4H4MA 3JSBA 1REVB 4OZ0A 4X4NA 3MCOA 4G1IA 1VQPS 1FEEA 3N28A 2PA8D 2VG5B 3OXGA 4LQ3A 5IT4A 2A3JA 2Z58B 3LGMA 3PJWA 1S1VA 4PWDA 2WVFA 4QBUA 5CCMA 1RSCA 3OHBA 4FKYA 5CXTA 1JJCB 5BR8J 5F3ZA 4GVBA 2Q6CA 4PXEA 5A8WB 4P10A 2X1GA 5KTQA 5JVGQ 2AHOB 2AU0A 1N32F 4DSKA 5E3PA 4FVCA 5IFMA 3CIMA 1Y00A 4O3OA 3S8SA 2YKMA 3NS5A 1RISA 2DK2A 1OYDA 4NLOA 4CO0A 1YJ7A 1W25A 2FVPA 3G9CA 1YJ9S 4EK2A 2YBVA 3HZGA 3P96A 3BBBA 4WU2A 3UR0A 4F67A 4PQUA 5B0CA 4A8MP 4OL8A 5LJ3Y 4DR1F 2XMJA 4IFVB 1V5IB 2UXDJ 1G1XA 4UZCA 4WFAQ 2VOPA 3SCIE 3WC2A 3K5LA 3F73A 1NUEA 2W9AA 4F3QA 3IRXA 1UPPA 2Y9HA 2V9WA 4AL5A 2M88A 2YWKA 3C15A 1UETA 3LP0B 4KGVB 4NMLA 1H98A 5A0YB 4DX7A 2WVCA 3PO5A 4DV3F 1KFSA 1VBKA 2FD2A 2MKIA 3L09A 2R7XA 3R1HA 3M1VB 5KT3A 1N34J 4ZVGA 2M7SA 3G4SS 3IS9B 2QA4G 3QNWB 2PEBA 1T7PA 1XWLA 4DN0A 3QO9B 2JH3A 4NLUA 2E5HA 2MQMA 4ZIWA 4NLXA 2GQQA 1MW7A 3I5CA 1YZ6A 1MMNA 3N9UC 3HSDA 4ECRA 2FHKA 2E9TA 3QJLA 4E2FB 2BEFA 1NM2A 5KFGA 2J76E 1M1HA 1U0SA 4JV5J 3T9ZA 1PAEX 3DDIA 3FSIA 3UD5A 1FTCA 2LQ5A 1FA0A 2VA2A 2XZTB 4RJVA 3ZTQA 1RTIB 4UQTA 3EVOA 1JJHA 2VDHA 1KS2A 1Y7PA 1RWUA 4A47A 2CPEA 3DLEA 3QATA 3TJ8A 5DQHA 3GV5B 2V2QA 4ZLPA 1JLAA 2AP6A 3I6PA 1DRZA 2KJWA 2V2KA 2GV1A 2FTRA 2WW8A 1PAUB 3CJRA 3JQJA 4JI2F 5LXRA 5GMEA 3HVRA 3SSQA 5B7WA 2C3YA 5KG1A 1PIEA 1QJHA 3G6ES 5G0RA 1GEHA 2B4OA 2GS8A 3EXYA 3UDLA 2HMIA 2VG7B 3QIDA 4I2PA 2CWXA 3DLKA 2XMAA 2NZ4A 2UXCF 2E5JA 1RT2B 3HO1A 3QZ7A 3RYLA 4NLRA 4C48A 2G1HA 3FFIB 3WDOA 4DPYA 2HGMA 2QLFB 1TMJA 1H7XA 3PKMA 3IWLA 4K7QA 3AB2B 1FJGJ 4KC5A 4I4BA 2K06A 1QE1B 1NDKA 4KPCA 2RMLA 1VIOA 1BWEA 5LOQA 3W2WB 4DV5F 1S79A 3GV8B 1N0VC 2QMWA 2H3EB 1T9UA 1WEYA 2OPSA 3DHXA 3MOZA 3W60A 4CM0A 4RW8A 3F56A 5I4MA 2KHCA 1MLAA 3MWBA 3NP5A 4PG7A 5A6WA 1TKDA 1RBOB 1Q7LB 3M30B 5BR8F 2QEXS 1URNA 2XSFA 1LK7A 1NO8A 3MR5A 2PT0A 2YQ0A 3A3NB 5A8RA 3KJVB 4J9OA 4DV0F 3GG0A 4IR9A 1YX2A 4ELUA 4ERDA 1RYSA 4HKQA 2HW3A 5KG0A 3S01A 2P9CA 1U1LA 2CQ2A 3NNHA 3BPSP 1LKZA 2CQGA 3CD7A 3PTWA 2W9BB 3PG9A 1VI7A 3I87A 5J1EB 5LSRA 3UPFA 2XGPA 2VQFF 3X1LB 2R7SA 2DNGA 2ZH6A 2HIQA 4DR2J 2AJFE 2Z0GA 1JXVA 2ZWPA 2VFRA 2MQOA 4C3MA 4A8QA 4AL6A 2JOQA 4NXNJ 4DBQA 2AGPA 3JSMA 1EP4B 1P1TA 4ZP7A 4K4TA 2K8GA 1LEOA 3U1MA 1IKYB 1U6FA 1UFLA 3CCES 2LA6A 4LJMA 2HNYB 1HMVA 4QWAA 2HHHF 2M70A 4NASA 1ZM9A 4B3RF 2PIIA 4J91A 1DY3A 2NXNA 1TL1B 2FC8A 3ONQA 3PCOB 3QLHB 3NOGA 3JAMU 1SVDA 3A3OB 3EJMA 4TXSA 4WTYA 1QAYA 1FDBA 3D6HB 2HWIA 4LR9A 5GAHU 1XMOF 2AX1A 4EGLA 2X3GA 1MWQA 2AIRB 3NMRA 1N34F 1RTHA 4WE1A 1ROFA 2J9DE 4HVZA 3QWPA 3DLJA 2VDIA 2QTWA 4J9QA 2JJ4D 1DZ5A 2QSWA 2JWNA 2NUHA 2ZE2B 2OH2A 2OSQA 1JLEB 2AWZA 4H54A 2MTLA 2XMWA 3T6JA 2KI2A 4F0KA 2UUWA 3I4PA 2GJFA 2HQ3A 2VU5A 3M6UA 4NA2A 3HM9A 3R5BA 3DU5A 1S72S 3HVWA 4X4UA 1RXOB 4LQ9A 3VGTA 1N5SA 1VHFA 1M90T 4O3RA 1UJ5A 3ULHA 2HHUA 1OMSA 5JMNA 4OJ3A 3X3UA 4ECVA 1VCTA 1UVNA 1V9OA 3IP0A 3M8PB 3KMSA 4KSEB 4IFYB 3POTA 3OL6A 2E7WA 4CLPA 2VUGA 3KYLA 2CAJA 2J7UA 3HI9A 4I6WA 4B9SA 2F65A 5BXIA 3D1QA 1RB0A 3PDNA 3MEDB 4ZP8A 1WF2A 4Q43A 1Y5IB 3AD7C 4WFBQ 2HBQB 4EBCA 4U8YA 4I56A 1MROB 2ZE2A 1ZPVA 4ZVHA 1IBMF 2HZCA 1FF2A 1LXNA 1X5TA 2DB1A 2EFNA 1D09B 2HHTA 3VTIA 1KHWA 2VBZA 4RPFA 5GVQA 2B9YA 3MMJA 1VQOS 3DLBA 4DFPA 3CJ5A 2DR5A 1YRTA 5RUBA 4ED6A 1QDUB 2C3PA 5I42B 1PC5A 4OHZA 4LVOP 2JEIA 2D7SA 1AXQA 3AT1B 2DHAA 3C14A 2N4DA 2I6WA 4LFBF 5LMNJ 2OEJA 2DHXA 2VQEF 2GHWA 2HNYA 3J80Y 4WXWA 2Q3PA 4WZMA 1R8HA 4RUHA 5LT5A 4YHHF 4YR3A 4DZDA 1FX2A 2L9DA 1YBTA 2GHVC 1ZETA 3LP0A 5L39A 5K20B 1TV6A 4F0HA 4DFMA 1U02A 2HZAA 2R3VA 5HP1B 2J8AA 1X0FA 4USVA 3ILJA 2LKZA 3UN2A 4CLSA 4JI6F 3R7SB 4CQ1A 4DL7A 4U7UD 1FXLA 2R7VA 1VFJA 3OHAA 5ETKA 3CDUA 1TFWA 1SV5B 1H6KX 4USIA 2RQCA 1SQEA 2FC9A 1FVSA 3B78A 4PQUB 4CO1A 1OS5A 3KJVA 4B9VA 1YSJA 1Y3JA 2D69A 2I2YA 3MEEB 2FGOA 3UN3A 7AT1B 1IBCB 5LM7E 1KOOA 5ETPA 1LXJA 3Q24A 1HNIB 3M2VB 4IQXA 4C7QA 4MAKA 1WF0A 1M5KC 4OZ2A 1SKSA 2DXEA 1LFWA 2WBRA 4WP9A 4PG5A 4EU0A 2QRRA 2DCLA 1KQGB 2DHSA 4P74A 2LU1A 2C2RA 1Y0HA 5HJXA 2EW9A 1M5HA 1FERA 2XG8A 2ZNZA 3ADAC 3KJFB 3LQVA 3M2RB 4U8VA 3CC2S 5E33A 4WFYA 2ZC3A 1NSQA 2WZ1A 2Z56B 3H0PA 1NSKL 4EUVA 3OSNA 3D7SB 2J6TA 1WELA 1SC6A 4DS4A 2I0XA 1R89A 1UVKA 2W2MP 1XMOJ 1WHYA 1REVA 2MQLA 3I9ZA 4NLTA 5U47A 1TKTA 1N6QB 3IWNC 1HD0A 2OFHX 1NLKL 2FGCA 4NOHA 4WKYA 1TL1A 2DNRA 4AXIA 1LQ9A 4ZIVA 3Q8PB 1D8YA 4GKJF 4I7FB 4CTAB 3NCQA 4WK1A 3NGDA 2H4WB 1DTTA 4K2XA 1JMTA 2YNHB 3I5BA 3PFEA 4EBEA 2QX0A 3BZQA 2KG1A 3A4TA 4QJVA 5HMXA 1EQMA 4X64F 2DY1A 4EEYA 3TZXA 2LMIA 2RQMA 4AXJA 3TJ9A 2A6MA 4JV2A 4PUOB 2V9KA 4RNFA 4N8OA 4KYZA 3KLVA 1N48A 3OQ2A 2Y8YA 1XTZA 1WHXA 2N7YA 2RHQB 2X7IA 1WI6A 4M5KA 3QRPA 2CJYB 2CPZA 2I38A 3R2CJ 4P75A 2ILZA 3N5BA 5T7LA 2ZH7A 2X1FA 3IBCB 4O4RA 1MNEA 3SDEB 1S0NA 2E1RA 2ZZNA 2BR0A 5L1IA 1M1GA 3A8KA 1YVFA 5B0EA 3DOMA 1UWBA 5DZ6A 3SXLA 3HJVA 4NMXA 1UEVA 4Y2AA 5F41A 3V6JA 2VPXB 3VF0B 2F4VJ 1OPZA 2ZC4A 2ZFHA 4I68A 1X4CA 2B9WA 1YRXA 3C14B 1D3WA 2BOPA 3M1VA 1RHUB 4UT4A 2RDIA 4HR2A 4OYWA 5B0DA 2YPYA 4ZITA 4ED3A 1KRPA 2ZUAA 1NCLA 4C8ZA 3NGKA 4NYOA 3TUPA 3KHLA 1U1RA 4ED4A 5GAGU 2A10A 2R4FA 3LPEA 5IQ6A 1O6XA 1Z2ZA 2E1AA 1ICEB 3K17A 4OI3A 5CCLA 3OVAA 3C16A 4CT9A 1K44A 3TP2A 2IHR1 4F4AA 3H90A 1RT2A 1Q8BA 1WDDA 2B43A 1ULRA 3UWTA 1Y10A 2FHJD 1SC1B 3DLKB 4OLPA 5C42A 2G13A 1DARA 4NZ7A 4B08A 4J9PA 4DU7A 2VONA 3EYZA 1EAYC 2PMHA 1X4BA 5HROB 3TQ1A 2ZBRA 1NK9A 3EZ5A 5HQ8A 2W2OP 3IXQA 3MPDA 3AY0A 3AXMA 4LRAA 3JAMY 1D9FA 4RW7B 3KDNA 2RF2B 3NG8A 3WX8A 2RU9A 4GO7X 1QVFR 2R2SA 4EI2A 3E2EA 2IMOA 3GIJA 1V3RA 2DH7A 1BQMA 1KWMA 3BGRB 1S0MA 3BB5A 1I6JA 1S97A 1KFDA 3GP9A 3VWSA 3PX0A 1B64A 2XMUA 3H4BA 1NH7A 4USTA 1S1UB 2BJ1A 2V8HA 2A0FB 1IR0A 4HHUA 1FRXA 5D0HA 3C16B 4DF4A 3IGNA 4ANDA 5HQMA 4F4KA 3HJFA 3FJ2A 3JYTB 3UCUP 1Q16B 1PJ7A 1Q8IA 4ECYA 4DL3A 4OZLA 1CBKA 1AW0A 4W98A 1HHQA 5K8OA 3KLHA 2WRMA 3ISZA 3T1HF 3GG1A 2HEKA 3R5GA 4HL9A 3GYNA 3RAMA 3UCZP 2YPZA 4DI6A 2RE1A 2XI3A 5IC6B 3TUZC 1XMQF 4NCAA 4DUTA 3AXKA 3HLUA 1N5QA 3CJTA 1B4SA 1RA6A 1HMVB 2A18A 5G4DA 2FYXA 1F1BB 1E6YB 1GH8A 1PYSB 3DRSB 3GFHA 4P9SA 2BKNA 3AOBA 3D6FB 4A8KA 5DG8A 3QFHA 4FYXB 3MAQA 2R8JA 2ZZMA 3W61A 3GONA 4WYWA 4FS2A 2XLIA 3R5DA 1TELA 4DUYJ 1VRQC 2OGUA 2YKNB 4XK8C 1EIYB 4XO0A 2HKEA 3F41A 4O23A 5E3QA 2V69A 4HLBA 1S1XA 2G1DA 3H5YA 4W92B 3MM9B 3CCVS 3BPDA 2PDAA 4R0JA 3D0GE 5C7PA 1TKXA 1FDNA 1M5OC 4JB8B 3J7A1 4ED2A 4NLPA 4M5IA 4C8OA 3T19A 4IKAA 4NX9A 4DV1F 1XERA 3BO2A 5LXYA 2BYCA 3D54A 4RW8B 5ETNA 3DLLQ 1XN9A 4Q2LA 4ZLNA 2XC9A 1HQ2A 2EFQA 3SMZA 1SJ1A 2CJXB 2CYYA 1N6QA 2UP1A 2XCPA 1M0SA 3GZ7A 1RWXB 2RS2A 2DVIA 1QE1A 3HVTB 4C3KA 1LNQA 3BS9A 4LF5F 1Y9OA 2LDYA 1WG5A 4ETZA 3K5PA 3NWRA 2FZCB 4PZVA 4WE1B 5BJRA 5C2GA 3CXCR 4DSLA 4DX5A 2KZMA 3N4WA 5I3PA 1X5OA 3BKFA 4ZMMA 2BKPA 1XR6A 2L9WA 3NY0A 1WKKA 2ZDOA 3H8YA 3O6QA 1B7YB 1R6YA 4ZVUB 4BC7A 1P9YA 3UE2A 3GB0A 2BW2A 4RWWA 4AQYF 3NNCA 4Z2XA 2HHHJ 5F8NA 1ZZNA 2YH1A 1ACMB 5HVFA 4DX8H 4X4VA 3GIRA 2M52A 2EFPA 3K8WA 1QSSA 2BJ3A 2GZOA 1EP4A 3CJSA 1H7WA 2Y8WA 5A8KA 1A6LA 4X66F 5EWFA 1Q86T 4CWBA 3DXSX 4YMEA 2BKOA 5T7LB 2OEKA 2DPJA 1KEKA 3V5RA 5IT9Y 1I5OB 1XMBA 5KG4A 5HLFB 5FJ4A 3FGVA 1I3OB 2HBYB 3BYRA 3AA8A 1TV6B 2UXDF 3PW4A 4L74A 2EVZA 3FC9A 4KGMA 4OX6A 3MUMP 3KK2B 2I5JB 2FJBB 1FEHA 4LRBA 4R5PA 2CQHA 1OY9A 2JLFA 1S9GA 4MIBA 5DS7A 3G8SA 3PM9A 4P7TA 4NYPA 4RBVA 1E6YA 2LVWA 1CVJA 3VVUA 3K5OA 2EFVA 1IWGA 5H1SV 4RWXA 3NGRA 4YB1P 5DG7A 5KFLA 2PA3A 4ZVTB 3I9V9 3C2PA 5EHHA 5ETMA 2FVQA 2CWKA 2RKIA 4NLVA 2MZRA 5EUHA 1NZAA 2MZ1A 3EMTA 3I5AA 3Q23A 1K1SA 2B56A 4Y6IA 1RT5A 4DL0C 3WX4A 4N76A 3EZUA 3MPWA 4GRSA 3TAMB 3W8PA 2VOOA 1HFEL 2R7QA 2DRDA 3PR5B 4ANEA 3EX7B 4PKDB 2QMXA 2R42A 2QO3A 4GMKA 5LL6d 3T5HA 4X62F 4OI0A 1Q8LA 3GTYX 3JSRA 1QUPA 1X9MA 4DV4J 3LANA 2MQPA 1FKOA 3KLIA 1ZBTA 2VG7A 2KJVA 1H74A 4C8KA 5HQLA 5G0RB 4G1QA 3M2VA 1R8CA 2DGXA 3KLGA 2IM0A 3WIVA 4DUZJ 4YB5A 2KXHA 4ZCMA 3POTB 2GJ2A 1G7CB 4WIIA 4XTTA 3DFEA 5KG5A 2VD3A 3Q2SC 5DG9A 3PW2A 1R8AA 2XI2A 3R6LB 4URSA 2YKMB 4WJBA 3OLAA 4U7UK 5CQGA 3D0IE 2RSQA 1T9WA 3OD2A 1CJUB 3RRGA 4MFBA 2KT2A 1IVZA 5F8IA 1XC9A 3R6GB 2MJNA 3D66A 2QV6A 1Z2LA 2GX8A 4HTJA 3R7BB 4ZA1A 1Y5NB 5KFYA 1XK8A 3HULA 4DV6F 1G2EA 2RRAA 4IR1A 4KHPF 5HATA 2XYHB 1OJ4A 3I0RB 1RJJA 1LWEA 3OT9A 1TL4A 3FMBA 1KNZA 1WI8A 2HHPA 3QGIA 4ED8A 3TZYA 2CZVC 2KN4A 2XWYA 3OTOJ 4RW4A 1S76D 1U6ZA 2IJRA 4MK7A 4DEZA 5J2QA 3ISNC 3H5UA 3RJMB 3HFVA 3V6KA 3TVKA 4M5DB 2VFUA 1U0HA 2APOA 4TKTA 1UWBB 1RHRB 2CPFA 2J7WA 4TVAB 5KFVA 5K8MA 2DBBA 2YXLA 4U6PA 1RCXB 1YRUA 3TZWA 2SXLA 2ZJQQ 2RUGA 1PGZA 2DNLA 3BO3A 3MOJB 2HAIA 3CJKA 4C6AA 1DAXA 1JNRB 3M05A 3BN7A 1PO6A 1UVJA 2EBEA 5CHCB 3M9OB 1D9AA 2XNQA 1MROA 4PG6A 3S6EA 4DZ6A 4F4YA 2IVFB 2BANB 1ZTWA 2H48B 2MZQA 3Q8SB 2FHMA 3CCZA 4PYAA 4ZN1A 3PR4A 1VDHA 3NBPA 3H42A 3MD3A 4MJKA 5C5JA 2W4CA 3VAJA 4J9MA 2VFTA 4PUOA 4F4XA 4PYDA 2V8GA 3NMAA 1SXLA 1FI4A 1YKWA 4IFYA 1JLGB 1GAOA 2EG1A 4FXWA 4MKAA 3SIPB 2IBKA 4RW6A 4K0KJ 4YN3B 4F02A 3IR5B 2VQEJ 2HK2A 2MYFA 3FNNA 4YEAA 4N47A 5CYMA 2ZEJA 1VQYA 1HWLA 4K59A 4OV1A 4JI3F 4IDKA 1VMBA 4TY8B 2CVIA 4B9UA 4JUZA 2MMYA 4LF4J 3R27A 1ZAWA 2MB0B 5IOLA 3IR6B 4DQIA 1LOUA 4X66J 4USHA 4IH6A 4KJIA 3PEHA 1SL2A 3OTEA 4USUA 3LOUA 4BHQA 6FDRA 4CZCA 4UY8T 4DL5A 2W1BA 4DWIA 2GJIA 3J81U 1R8PA 2HZVA 2FY8A 2CKWA 2QYGA 2UUAF 2IRYA 2PE8A 3NAHA 4IG3A 4L6V3 4DR4J 3BKUA 2VZ9A 3HPOA 1EARA 4OZ3A 1X0PA 2DGQA 2VC1A 2HURA 4KHRA 4GKKF 2MQNA 1C1BB 2MZJA 3MEKA 1UEKA 2B5JB 2DNMA 2HNZA 3LP1A 1QM9A 4OZJA 2MQQA 3PW5A 3B4MA 3W62A 4A8OA 1RTZA 4HACA 3HXMA 2NYHA 3FBBA 4ZVQB 4ZKAA 2CNOB 1U47A 4F4WA 1UJ6A 2VBWA 5D4OA 1HL6A 1IBKJ 1RTJA 4B3TF 1N52B 4KGXB 2QE5A 3BV8A 3QT6A 3ZTSA 1WKJA 3HSZA 1F2HA 4X4TA 2W9BA 2AQ4A 2F8HA 5CZXA 3RG6A 2VPYB 3R1LA 1NK5A 4RKUC 2HQGA 2XHWA 1T03A 1CJTB 4WP8A 1FNOA 2EK1A 1ZOTA 4QIEA 4UF4A 5H9EJ 2YWGA 2QT7A 3KG1A 3HHDA 3LP2A 3M30A 4F25A 1CC8A 4DR4F 2B8QA 3QO9A 2NR0A 2ZITA 1FDAA 1F9HA 2JVRA 3IBWA 1FD2A 1FXDA 3ZZPA 1RU2A 2NXJA 2LEBA 2FZKB 5D77A 1CQMA 1SPBP 4F7VA 1YJUA 5GAEI 3E3XA 3QAEA 1BD6A 4K4UA 5E3AA 4RNNA 4DV5J 1VS3A 2G2OA 3AB4B 4EZ9A 2WK4A 2WOMB 3S7RA 2XZWA 3GJRB 2MLYA 1RT3A 2CQ4A 3G6YA 2FLNA 3RUBL 5DZ7A 1BQNA 2OPRB 4KE5A 4ED0A 2OAUA 2G0IA 1KLNA 4JI8J 4G3IA 1HARA 2DXFA 3W66A 1IBMJ 2R7OA 1Q81T 4ZN3A 4Z7CA 2JEFA 4KHPJ 2FLPA 4OHYA 3R5JB 4B3SF 1REGX 5CYQB 2ADBA 3QJJA 2DGSA 3SQGA 1S5ZA 2Y1IA 2FUG9 3CPWR 2JHEA 4O3PA 2OPPB 2KH9A 2W01A 3NCRA 3HHLC 4IG0B 3NWGA 1GT8A 1B99A 1CS4A 1EETA 3AHPA 2IIHA 4R0EA 2DPIA 4WZQA 4NRUA 5DQIA 1XBWA 2AJ1A 3GSDA 5KFMA 1JLEA 2MKSA 3MM7B 5F9NA 3IG1A 3D68A 5T41A 1B0VA 3RRHA 1FTRA 1U1MA 1UWAA 1B0PA 3HX9A 3TJAA 1NAQA 1P9QC 5KFAA 2IC3A 3CDWA 5B0BA 3UD4P 1S9FA 2FDNA 3W2VB 1S4EA 1N32J 3QLHA 2ALZA 2HHSA 3QIPB 1U2CA 5DJBA 1RWVB 2GGPA 3DOLA 2MKKA 5AT1B 2OO4A 2W7AA 2M4MA 3D4JA 2C22A 1ITPA 3FQKA 4UTGA 5KG3A 3IC1A 3HP6A 1TKZA 2AYEA 2WONB 3DCAA 2V67A 1AROP 1NHKL 3I55S 5KFEA 1BWVA 1LWCA 2MKCA 2YWWA 2E29A 2XMMA 3F0NA 2QYCA 4GKJJ 1UVLA 3CDBA 1FVQA 3ZZZA 2WTFA 2OTLS 1RBLA 1UKUA 2B5JA 4KIAA 1X31C 2CPJA 4N8NA 1AZSA 1PKUA 1VJQA 2CADA 2R2TA 2DR9A 1NK0A 2KDOA 3EM1A 1TAUA 1MWYA 1F3FA 4UOFA 4ES2A 1T8EA 3PHEA 3NCPA 2KXNB 5H9EK 2IDLA 4N41A 1P6TA 2YWFA 5CAAA 2AZ1A 5IWAF 2U1AA 4AQYJ 1RBAA 5DRKA 4BS2A 4M5GA 1FCAA 1SKWA 2XY6A 4L3NA 1EZZB 2H65B 5M2RA 4ECXA 4NA1A 2VH7A 1NH8A 3MM7A 4O44A 3UNGC 1CEZA 3W7BA 2BABA 1X9SA 3W8GA 2F9JA 3IAM9 4LF1A 3DYAB 2WVEA 3H4DA 1HBUB 4IQMA 4WBFA 2E66A 4ZJLA 5L46A 1FJEB 3T1YJ 3P4UB 4C0HA 3LAMA 2B4VA 2HQFA 1R0AB 3NEKA 3TUIC 3JTNA 2IAJB 2A6OA 1HBNA 1T9VA 4KQZA 4RW6B 2ATCB 2VG5A 1GTEA 4P72A 3S1TA 2UUCF 2QIFA 2OKQA 1OSCA 4IH7A 4C2MA 1BY9A 1RT1B 1TQLA 1IKWA 1Q0NA 3HHEA 1HPZA 2POKA 3MPVA 3W3SA 2CNNB 1HI1A 2HMIB 5BYQA 4LRDA 4DQQA 1QLNA 5THWA 4RUAA 3H59A 1S6UA 2NCKL 4I1TA 3MHYA 4NA3A 3J7ZT 2AKWB 2F9DA 3AA9A 1RAOA 1ZS6A 4C98A 3VAGA 4Y34A 4RLEA 3CJKB 4WYLA 1MG7A 2DEJA 3FRYA 1JLAB 1HBOB 4G6VB 2OMLA 4OZ5A 4RUBA 3HF5A 3SCJE 2DKOB 3HSGA 2RHSB 1U0HB 4CT8A 2P9GA 5M2PA 4Y0FA 1RTIA 2OP5A 3GYGA 4GVLA 4FYWB 3KKFA 3MUVP 2NUUG 4KGZB 3ET6B 4EBDA 1FRLA 2YWEA 5ETRA 2FJEB 1VC5A 2E1CA 4K4XA 1F5AA 4OX9F 5HBMB 1RK8A 2NREA 2XSJA 2MGZA 4C8YA 3MR6A 3CUNA 2VIHA 1SL0A 2BZ2A 3BSCA 3G8QA 4YS2A 1JJ4A 1TL3A 1F3VA 1WKLA 3N5FA 3V6DB 4V1Ak 4BCAA 2D3OR 1J2VA 4NCBA 1U8WA 3FUYA 2EKYA 3VGUA 3AJ2A 2FVRA 4Z7YA 1VK3A 4K4SA 4IRDA 2J9CA 4MFBB 4TYAA 3EGVA 5KT5A 3A8IA 3C15B 3JSYA 4PCQA 5A0YA 4YY3J 1KC8T 5L9NA 1F2GA 1JWWA 1I1GA 2DO0A 2RD5C 1FRMA 1HW9A 5HI7A 1F5BA 4OYIA 4YB7A 4RW9B 1UEUA 3AJ1A 1A0OB 3GE9A 4UW2A 1OYEA 2K1RA 4ZLJA 2VA3A 4X64J 3HHNB 3QJPA 2B4PA 4LFCF 3BJYA 4DR6F 4IFVA 1S6PB 3KNAA 1U4BA 2OJ3A 4NXMJ 4I2QB 2J9DA 1X5PA 1U8SA 2KB2A 2CQ3A 3IGVA 4OZ1A 4X84A 1WF1A 1APSA 1TL7B 2LQBA 3OVBA 2PO4A 5C24A 1SI9A 4CYUA 4ZK7M 2OUGA 1UZHA 2QMUB 3NS7B 1WC0A 2E5LJ 2A2DA 2R7TA 3DM2B 4I67A 4GVBB 5A8WA 4J9NA 3DYAA 3MDFA 2BX6A 1CLFA 1S1TB 5A6PA 1XR7A 1IKVB 1HWIA 2DXDA 5HN0A 4K4ZA 5L9XA 2B8PA 3PFOA 2OSRA 3QSYB 2LECA 1CJKA 4CO4A 3KLEA 1FK9B 2CQIA 3V81B 2V2VA 2Z57B 4PWWA 4B17A 4I0WA 3LP2B 1JKHB 3E01A 4USWA 4DCPB 1Q1KA 2JFDA 3BGFA 3EUNA 1CJTA 1Y4ZB 3HSJA 1PJ5A 2KT5A 3MMAA 2WHOA 4FYYB 4L75A 2W25A 2DR6A 4QR2A 3PVXA 1DHMA 2AJQA 4W90B 1K73T 1UL3A 1S59A 5E7OB 2O67A 2HAFA 5D4NA 5HLFA 3Q0AA 2C28A 2W9CA 3O44A 1T3NA 2ZH8A 1R43A 4N77A 3CWJA 1LFPA 2BBEA 3DGVA 1F0XA 3KK1B 3CCUS 1UFWA 1N88A 2KO1A 5H9FJ 2ZNYA 4CP5A 2LA4A 3MAHA 3CCMS 1VOMA 3AAWB 2ERRA 3VGVA 3IA0A 3Q8UA 3UDEA 5HMWA 4FP9A 1HNWF 4K50A 2VFVA 1TK8A 2AT1B 2GVZA 3P3DA 1SH3A 3OXFA 2D41A 2HIYA 3MMAB 4P6QA 4E98A 1IKWB 1XNQJ 3C6UB 1M5PC 4HI2A 4OV6A 1HW8A 3E01B 2R2UA 2RT3A 1AUSL 5D3GB 2FB0A
chains in the Genus database with same CATH topology
2BA9A 2RQKA 2DGVA 3TAPA 3IG1B 3DMJB 1IKVA 4DV2F 2F3JA 2MJUA 1B7FA 2CJ9A 1U09A 3D2WA 1FKPA 3GR0A 2YKPA 2YNFA 1J5OA 2E7XA 1YGYA 5IM0A 5DDOC 1VQKS 2HHQA 4IDKB 4QR1A 1Q78A 1KOHA 3E8OA 3O2IA 3V4MA 3T1AA 1JJ2R 4DL6A 2BQ3A 1U49A 4YR0A 2UXBF 1VC6A 4B9LA 3J7YU 2ZOFA 3C6UA 3H98A 5AXLA 3IFEA 4G1QB 3KLGB 1S77D 2DH9A 2J6SA 1UVIA 1FRHA 2YY3A 3KLIB 3H2UB 4TN2A 4RNMA 2ZH4A 3HHLD 2K1RB 2CJQA 3CDAA 2GA7A 5J2PA 2DIVA 2NYIA 3FEZA 4RBUA 1L3UA 2WSEC 4O4GA 1ZAXA 2DO4A 4I69A 3BF4A 1D0EA 4TU9A 3J7Z5 3NLCA 2VFSA 2UV8G 4OX7A 2M2BA 4NXMF 3D1HA 2G4BA 3UCGA 2BUNA 4DR5F 4MKBA 3DXBA 5J2QB 4KFBA 1FT8A 2IVMA 1TVRA 1YJVA 3NS6A 4IOBA 3CVKA 2GGPB 3DOLB 3SSRA 2RRNA 3RB3A 1F5CA 4B3MF 1C1CA 1JKHA 5DETA 2CRLA 3CO9A 3TR5A 2KXFA 1SJQA 3OR1A 2CQ0A 4MH8A 4QIGA 3IRWP 1M1KT 2J6UA 1TVRB 5JXSA 4KFBB 4OHWA 1S1TA 2B3TB 1SBRA 5GADU 2HLUA 1NK4A 2HG4A 4FF1A 1GX6A 2C3UA 4NL5A 2K7JA 1VQLS 1EETB 5KFFA 2XS7A 1DBDA 1V3SA 2D9PA 3R5CA 3J7YI 4J9RA 2UU9F 4LFAF 2MHNA 3G96A 4DL2A 3C6TB 2RB7A 3RRKA 2RF2A 3UW1A 4FS1A 2AJ0A 1WG4A 2ATLA 4DR7F 1Z4UA 1H2TZ 2V5HG 3OUYB 4OQJA 5FLXY 2RDJA 1HPZB 4ZPDA 5J1NA 5EWEA 1T02A 3FQLA 3CCJS 2E9ZA 2RS8A 3L95X 5K5MA 4IH5A 1HHSA 2GNKA 2LEAA 3N6NA 1WD6A 3GFXA 1SIZA 3CJ2A 3SV3A 1R0AA 5GAHI 4CO3A 4DR2F 4JV1A 1HQUB 4IUFA 2DR8A 3HVTA 4DSIA 2FIUA 1PSDA 2VG6B 1XR5A 2FJWA 2HYIB 4TY8A 5EX3A 3L7OA 4ZCLA 2HS0A 2LDIA 3FSYA 4KO0B 1B0TA 4HI1A 3KHHA 4N5SA 5DLGA 1U6BA 1FXRA 2DISA 2HQIA 3V6DA 5F9LA 1L3TA 2V4JA 2YH0A 3M9MB 1Q79A 4UUXA 3Q8QB 4R5PB 4ED1A 5MLCV 2DNNA 4K4WA 2P6TA 3M8SA 3SV4A 3P49B 4OHVA 1BC6A 1VRUA 4O3NA 1UA0A 2J0XA 4OX8A 4YDXA 3H5XA 1H2VZ 4PPDA 4CIOA 3UDCA 1IBLF 3PY8A 5FDLB 2DT9A 1ZZFA 2CIMA 4DG1A 3CF5Q 4RZRA 2J0SD 3U1NA 4H4KC 1KR4A 1M5VC 3N79A 2CPHA 1VBYA 4I7FA 2ZD1A 5IZHA 1N4LA 1W2BR 4XIUA 2XB2D 1LW0B 4NRTA 4NPOA 1KLMA 1TKTB 2FJDB 2C42A 1RT1A 3W2VA 5CYJA 4RU2A 2WSFC 3LALA 3KLHB 2HGNA 2IJFA 1LWEB 4MKYA 1QAIA 4ILMA 5A2QY 2PFFB 2M5YA 2IYGA 4P7VA 1S0OA 2UZAA 3OL9A 3DGPA 4ELVA 2O66A 3N6MA 5KFZA 4KRWA 2HS4A 2Z4PA 2R8GA 1S6QB 4MIWA 2UVVA 1RGVA 2E1MC 2I8EA 3PZPA 4JBCA 1VC0A 2GO8A 1IQTA 2BM0A 4A8WA 5J2NA 1LWFB 2YKAA 1ZM3A 4QWDA 1BQNB 3D5MA 2QLWA 2KG0A 2DNYA 4NLDA 2CQPA 4Q44A 2LEPA 3C66A 4RX6A 1TAQA 4K4YA 4DF8A 2CG4A 4NLYA 2X51A 3BQ2A 3DLHA 4EFAC 5E3CA 4B3OB 2KM8C 4IOCQ 2W7OA 3Q22A 1MU2A 2AYGA 2MDAA 3ZZYA 2XMTA 4WF9Q 2RVJA 3PEJA 1T03B 1XNRF 2CPXA 2YTCA 1C0UB 2DRBA 4PPZA 2P9EA 2E5LF 3L7PA 1S10A 4F3OA 1S1WB 2FVSA 1ZH5A 1RA7A 2MSSA 2XEXA 4ES1A 4ALZA 3KK3B 2BQUA 2OPPA 3LUYA 1MMDA 2ROGA 5KG6A 4FZVA 1OQ6A 4K5SA 4MK9A 4MYUA 3ZZ0A 5J1PA 3BM7A 1SUQA 5HROA 4IRCA 3ETOA 4XAKA 3BSAA 3H5SA 2ACYA 2L9NA 4OJHA 3K59A 1QAXA 5AE3A 3PW0A 4KPYA 1DFDA 1YJRA 3VALA 4LT6A 4F3MA 2LXUA 2K3KA 2O3DA 2MY8A 2LYVA 3CIZA 4MMOA 5AE1A 1QVGR 2EG2A 3OFFA 2HWTA 2LQ9A 4FBTA 5KFTA 1E6VB 4KKOB 1BQXA 2C2EA 1DTQB 1O8BA 1RAJA 5KFKA 3V4IA 4HDHA 2YKQA 3T5KA 2AYBA 2CJAA 4ID5A 4FF2A 2J5AA 4ZVEA 4DUYF 1T05B 3M8QB 1IKYA 2DITA 3MM5B 4RBTA 1JLGA 5D6GA 1G6BA 4FF4A 1N33F 3KG4A 1U1QA 2I5JA 4WFZA 1S99A 1YWXA 5LSOA 1KVJA 2XMVA 4LMZA 5F0WA 3BR9A 3UQSA 2Q43A 4ECWA 3MEGA 1VQ8S 2YKOA 5EX0A 4KV8A 3ITHB 3RU0A 3BQ1A 4DV7F 4ECTA 3TUJC 3I0SB 2BXJA 1X4FA 1VQ5S 2ZOGA 4TU8A 3MECB 1TKZB 2WONA 4CH1A 4M5DA 2YNHA 2O01C 1T05A 4F26A 1OSDA 2L08A 3IR7B 5SUHA 2O1PA 2PI4A 3ZZRA 2FJAB 3QIPA 5L1JA 2WB4A 2K3IA 2Z2LA 3DRPB 2IJNA 4OI6A 3WC0A 3PX4A 3OL7A 3DC2A 2ABYA 2CQBA 4LSLA 2DNZA 4NLQA 4DQSA 1QSYA 4PXBA 3CB4A 2F1FA 2UV8A 4KR0B 4NZ0A 4WKRA 3H2VE 2KT3A 1HWKA 1ELOA 1JLBA 2W7PA 2OPQA 3DI6A 2R7RA 4LF6F 2R7UA 2OIHA 3R5AA 2K7KA 2GO9A 2KYZA 3V2UC 4WU3A 3RR7A 2JRSA 2NXUA 3OR2B 3HK2A 1YQHA 3M8PA 1A9NB 2GCFA 4AE5A 4OFZA 3SEOA 2QLXA 5M2UA 1GQEA 4C0BA 2Q66A 2O5DA 1DJ0A 3BN4A 1SV5A 4NZ6A 3RTVA 4F2SA 1NK8A 1LK5A 2RU3A 2HHWA 4ELTA 3JB9k 1UAWA 1Z1ZA 4DLEA 2OPRA 5KFOA 3OLBA 4DSJA 2GIQA 3DLGB 5KFSA 2N3LA 4E8UA 4HDGA 2WOMA 4HHJA 4ECQA 3TAMA 4Q8EA 4P2SA 1K0VA 1VQ9S 4Y2CA 2I1RA 2J7KA 2PMZD 1NKCA 1RQ0A 4NYZA 2ROEA 3KLFA 5KFCA 1N5YA 3US5A 1PC4A 2R8IA 3MGJA 1Q53A 3KG0A 1YJNS 1JNZB 2DCUB 2QA2A 4Q0BA 5BYRA 4HH0A 1S4FA 3VAMA 3D28A 2CPDA 2ZH1A 5L1LA 3DHWC 2W8KA 4TQSA 3CMES 4RW4B 2AV5A 3DOKA 2E9RX 1S9GB 1O51A 2ZKTA 3MR2A 5I3UA 4EZ6A 5KFIA 4JI1F 3I0RA 4GO5X 2DNQA 4TY9A 2HHVA 1U2FA 5KT6A 3ITHA 3SFUA 3BR8A 5CA5A 5D8HB 4ZOSA 1JX4A 2N82B 2HRYA 2VKRA 4QCLA 3RB4A 2HNZB 1WEXA 3DNCA 3K58A 1S6QA 1WWHA 2VC0A 3OR2A 1UJ4A 5F3TA 4CTAA 5E3RA 1T3OA 1IXKA 1F60B 1S9EA 5C42B 2W4DA 4I6AA 1NJXA 3CCLS 1N36F 1R31A 3IN5A 2V0NA 3HKZD 2DGWA 4H4OB 4BBYA 4ED7A 3CDEA 1D8ZA 2NLWA 4DPOA 4LSLB 5LJ5Y 3PIOQ 2HLTA 3LWLA 1RTHB 4EYHB 1U48A 1XNQF 2YVSA 3HHLB 4JI4F 3ZZTA 2IYIA 4WZQA 2RKIB 4J9SA 2EPIA 2KVIA 2LQJA 1KLMB 5KFHA 4X4OA 1HNIA 4FF3A 4QYZJ 2ROPA 3VQSA 1VQSA 3CULA 4JI8F 1RYRA 2KU7A 4IO9Q 4O3QA 5F8LA 2ASLA 3JSMB 2FJXA 3EGNA 1DQAA 5F8GA 2L3MA 4FPRA 1N56A 1P27B 4WFNQ 4KV8B 4Q7AA 4JI0F 3CC4S 2BANA 1L3KA 5J1EA 2MXYA 2MKHA 4LF8F 2YKNA 1L5UA 5KT7A 3FDSA 2GC8A 5B09A 1MSWD 4Y2MA 4YUDA 2FHOB 3LH2S 3O3LA 3V6HA 3TNVA 2Z8QA 3ENVA 1JK9B 4DUZF 3HFKA 2HVIA 2KFYA 2GIRA 2N7CA 4CH0S 1H2UX 4DN9A 2JEJA 4Q0BB 4OJGA 5I42A 3KOAA 2M8HA 3MUTP 1O5JA 2KFZA 3AQPA 3FVYA 3BQ0A 3HHLA 1N5YB 3M4XA 1QSLA 2PI5A 1IJEB 3N6LA 4YOEA 1H0HB 4MYTA 3JYTA 3FSXA 3SYZA 2V8DA 3DLGA 3Q2TC 1NHVA 3MMCB 3KWMA 1S1UA 2J9EA 3TA0A 3NAIA 4M1KA 4ATNA 3I96A 3MEDA 5B08A 1S9EB 2B7BB 4DSFA 2HRUA 1RT7A 2CDQA 3N01A 2B51A 1X7VA 2CQ1A 3CTRA 4KT0C 5LMNF 4PRFA 4WK3A 3K7RA 1TKXB 1X4GA 3OTCA 2FJVA 4YR2A 1RI7A 4CI0B 2IFXA 3CD5A 3CCRS 2GQCA 3D0HE 3QWUA 1JLBB 3GV7B 4EO8A 2F8EX 3BDPA 4QU6A 2G9OA 1C0UA 3RBEA 4PWDB 1R3NA 4X4SA 5HP1A 1UVMA 4JV5F 4ID8A 1N5VA 4J5OA 1RT5B 2ZJRQ 4OMFG 2OLWA 5FD1A 2ZHBA 2JC0A 5AJ3F 4DQPA 1LW0A 1Q4RA 2JSXA 2RQ4A 3PACA 3J81Y 1JLFB 1FJGF 1CPZA 3OL8A 3OSPA 5DDPC 4URQU 1MWZA 2LXFA 2V94A 3MTKA 4XDCA 4LIRA 3PIPQ 1FHTA 1FE4A 5KFUA 5KFNA 2KTQA 2XY7A 3VAHA 1C0TB 2MPUA 2UUTA 4AL7A 4OI4A 2Y1JA 2F40A 1QTMA 5FDLA 2UUBF 2EFGA 4DDFA 2A2CA 4UUWA 2PC6A 3FRZA 4K5RA 5DGAA 2W4PA 4Y3CA 5ITHA 1DLOB 2ZH2A 3CD0A 2ZH5A 3VQTA 4DHVA 2M9KA 2V8VA 1TP7A 3CGIA 5AXMA 1VQMS 4BDPA 3OTOF 1CG2A 4I64A 4TYBA 4QU7A 3LWMA 4HEA9 4RW7A 3T5LA 3VZHA 4EWTA 2DNPA 1YITS 3ZC4A 2X1BA 3C3LA 3BEGB 4ID5B 1RT7B 2KFNA 1VBXA 2J0QD 4UY85 4U9RA 2K2PA 5DDQC 3GFYA 1IBKF 4KKOA 2G0CA 3M9NB 5GADI 3A8EA 3G6XA 3U7JA 3BO4A 3RB0A 4A8YA 5EN1A 3E51A 1X4AA 1SJRA 3DRPA 2C3OA 5B0FA 1C4CA 2YX4A 4NXNF 4IRKA 5T14A 4MTPA 3VAIA 2ZD1B 3OW2R 3MMBB 1SH2A 2GFFA 4OZNA 4FXVA 3U27A 2AW0A 2VBYA 1U1NA 2CJKA 3K5NA 3K2YA 4ZP6A 4UQGA 5DLFA 4QPTA 3VZIA 4J9KA 1S1XB 2BDPA 3L3CA 4URGA 2XLJA 1HNVA 3OFHA 3NNAA 1HHTP 3QZ8A 2NSBA 2YQ3A 1C4AA 2KRBA 1SJ4P 3RB6A 1Q82T 2AGOA 2VV5A 4B9NA 7FDRA 5EGYA 4DQRA 2C3MA 4TU7A 4E0DA 1VRTA 2JEGA 2W24A 2BM1A 5A8RB 3RZAA 1FRIA 4FNHA 2ASYA 3DRSA 2V4JB 2B6AA 2AYMA 3CC7S 3M8QA 5B0AA 5DDRC 4TQRA 3MTJA 4RU9A 2M3DA 3IS9A 2NQPA 7FD1A 3O8WA 4KO0A 2OPSB 4C4WA 3P5TL 4QYRA 2E5GA 2PN6A 2PSZA 2QZ8A 3W2WA 1DTQA 2RNEA 3N0VA 3WZ0A 1SJ3P 3DM2A 2CJBA 2HVZA 5KOWA 3KLFB 4FXDA 5K9FA 2EFOA 2HPUA 4NWBA 5E0OA 1HQEB 2GMHA 3M2RA 4DJBA 4CH7A 1BGXT 1WHVA 1NK7A 1LW2B 1U25A 2Q6BA 3TX8A 3OUYA 5J2NB 4QW8A 1SUQB 2PEHA 2AGQA 2FY1A 3CCWA 1RTDA 4F50A 1KVIA 4OJ1A 2VODA 4ICLA 3I32A 4FYDA 2VKZG 4DV4F 2JL9A 2LCWA 1RDRA 1CSJA 1U24A 1Y3KA 3OJSA 1V3ZA 3CEDA 2EI5A 1G3OA 4NLWA 3UFCX 3DLEB 2OPQB 2VL1A 2RIJA 3DI6B 2JLGA 3BSNA 1IUJA 2YNFB 3G86A 3QGHA 4FN5A 2HNDA 1S6OA 2YX7A 1FJ7A 1HA1A 2JDJA 4R8UA 4LUBA 2HHXA 3KHRA 1JLQA 2Q79A 3ZFVA 3GIKA 3PX6A 5D3GA 2HS3A 4ETXA 3DOKB 4HT7A 5HBMA 3TRGA 2NPIA 1RKJA 1HI8A 1JB0C 3FZBA 2FHJA 3MPYA 1J5EF 4Y65A 2GHPA 3OPKA 3PRBA 3D1OA 4DG1B 1WACA 3SCLE 2H9ZA 5DM6Q 3M6VA 2ZBIA 4ZP9A 3SDEA 1HR0F 5HMZA 4AYBD 4AUKA 1K9MT 2Y1RI 3MEGB 1FD8A 4LF4F 3LW5C 3G8TA 2UVWA 2KRRA 4C9DA 1DURA 1FKAF 1KN6A 2R7WA 3M8RA 1UP1A 1VJWA 1JXLA 4WXOA 2MZSA 2VASA 3MM5A 2EC0A 2IRUA 2IA6A 4CO5A 4M95A 3MXHP 1DTTB 3R3TA 4XPCA 4U67Q 2Z2MA 2ADCA 2HFOA 1JLCB 1WEZA 4XDDA 5E5NA 4AL5A 1FXLA 4Y28C 4A8SA 4NLSA 2EWHA 3I4HX 3U1LA 2CPIA 2N3OA