1CQNA

Protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed protein tetramer zipped together with a hydrophobic Alzheimer homology: a structural clue to amyloid assembly.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S6
total genus 24
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cqnA00
1QJHA 4DV2F 4DR6F 1RISA 2ZM6F 3OTOF 1FJGF 2UUBF 4X65F 4DV4F 1J5EF 4JI4F 4JI0F 4JV5F 1F60B 2YY3A 2VQEF 1HR0F 1N34F 2UXCF 1IBKF 4B3SF 3ZZPA 1XNRF 4NXMF 1CQNA 1HNXF 4GKKF 4DUYF 1VMBA 4JI1F 4YY3F 1CQMA 1XMQF 4AQYF 1N36F 2B7CB 4DV6F 4DV1F 2E5LF 1I94F 4JI3F 4LFAF 4LF6F 1N33F 4DR1F 2UXDF 2UU9F 2J5AA 4LF5F 4JI8F 2F4VF 3T1YF 4LFCF 1GH8A 4DR7F 1IBMF 4LF4F 4JI6F 4NXNF 2VQFF 4DV0F 2BXJA 4X64F 2RJZA 1XNQF 1N32F 2HHHF 5LMUF 2UUCF 4DUZF 4X66F 4K0KF 1IJEB 2KJWA 4DV3F 4JI7F 1HNZF 4DV7F 4GKJF 4JYAF 5BR8F 4B3MF 4OX9F 2B7BB 4JI2F 4LF8F 1G7CB 4LF7F 4B3RF 4DR4F 4JI5F 4DR3F 1G1XA 1LOUA 3R3TA 4KHPF 5AJ3F 4DR2F 2KJVA 4LFBF 2UUAF 1XMOF 1FKAF 4DV5F 3T1HF 4LF9F 1B64A 1IBLF 2UXBF 4DR5F 4X62F 2BVZA 4B3TF 1IJFB 5LMNF 4YHHF 1HNWF 5IWAF
chains in the Genus database with same CATH superfamily
3ZZRA 1IN0A 2YKNA 3D0HE 4YMEA 2KVQE 4EYHB 2XI3A 3I96A 2W9BB 4IYQA 4P9SA 1E6VA 3L7UA 5H9FK 4ZPAA 1TKXA 4PG6A 2HQ3A 4IH5A 2XMJA 3PCOB 1IQTA 1H6KX 1FJ7A 2AV5A 3NEKA 1P1TA 4OJ3A 2IYGA 3W60A 1OS5A 1YQHA 2J8SA 3E2EA 4J7CA 2C42A 2M88A 3DGVA 4CTAB 1NB7A 2HGMA 2VFTA 2FB0A 4IKAA 2KT3A 4NASA 2GS8A 3TARA 1K8AT 3H5XA 3CD5A 1FE4A 3UD5A 3H98A 3AA9A 3MEGA 3PX6A 1RTIA 4M5JA 3NS5A 5DETA 2MHEA 1IKXB 3C14A 4DCOB 4K50A 2DNOA 4USKA 3HHKA 1B7FA 1XNRF 3W8GA 3NY0A 2YWKA 1TL1A 3MCSA 1KVKA 2J6TA 2FC8A 2H5EA 1REVA 5GAHI 4DV4J 3MGJA 4M95A 4DQRA 2XC9A 1KVIA 2Z4PA 4WXWA 5LM7E 2KG1A 3M2RB 2BEFA 2FZCB 3QT5A 3CJKA 1SPBP 4X4SA 4DF4A 1FXLA 2O66A 4ZVGA 2MQNA 2JFDA 4I68A 1D9DA 2DHGA 2M5YA 2MSSA 5T7LB 3ADAC 4M5LA 3QJPA 3F41A 4DPWA 2WSEC 3GSDA 5EHHA 2B4OA 4LFCJ 4QWDA 4C8MA 5AE3A 4YFUA 2W7AA 4K5SA 2QEXS 2YQ1A 2WVCA 2K2PA 1FRLA 2IBKA 1YJRA 2DHXA 3OTOJ 3CCES 3V4IA 3HJFA 2AMCB 3NP5A 7FDRA 4PQUA 4EWTA 1X4DA 4LRCA 4MIBA 4TYBA 2E44A 4JI8F 5CZVA 2V8PA 5IQQA 3SCJE 2XCAA 1GH8A 3ENWA 2J6UA 2KRBA 3DCAA 4DUZF 4DR7F 1OWXA 2PN6A 4QYRA 3CJ8A 4J37A 1Q0NA 1U2CA 1WKKA 1VRTA 3D6TB 4WJBA 3IWXA 1S0VA 1BQNB 5G4DA 2R8IA 5KFTA 2GIFA 2NXJA 2OLWA 2ZE2A 2CPIA 2XMUA 1DBDA 3V2UC 5IXUA 1D9FA 2OD4A 1N5QA 1NDPA 4UW2A 5D77A 5LMUF 4ZCKA 1IKWA 2KJWA 3OT9A 4MKVA 3RB3A 1RT3A 2VOOA 4FF2A 3W9HA 4ZHRA 4MKYA 3I32A 3W1YC 5A0YB 4DLEA 3PW5A 1O6XA 3CJQA 2ZZTA 3PRDA 4NE9C 2XLIA 4NLRA 5IOLA 2BJ8A 3DMJB 1RT7B 2CJYB 5LMUJ 1S9EA 3U02A 1BGXT 4X84A 2MQOA 5ETKA 1NHUA 4ZCIA 1XJWB 3J7YU 4WP9A 1N56A 3TX0A 4M94A 1C0UA 2ZBCA 2M9KA 4A4JA 1SC3B 1VK8A 2ZDOA 3KKFA 4UOGA 4BHQA 5K20B 3SZ2A 2BM1A 4F3OA 3G6XA 2KJVA 2DXEA 1SV5B 3KK2B 4MAKA 1FX2A 1ZAXA 1NXIA 2XI2A 2VH7A 2MKYA 3MAAB 4GO5X 4I2QA 1SJRA 1HHTP 4DSIA 4JI1J 1JJ2R 4CZCA 2AEMA 5F3TA 2M2BA 3QZ8A 1GT8A 4X2BA 1OO0B 2XY6A 4TU8A 3Q8YA 5HL7Q 1N5VA 4LF5J 4M5HA 5T41A 2DNRA 1XERA 1DTQB 2UVUA 2BBEA 2C22A 1JJCB 4NMXA 3MDFA 2XHWA 5LMNF 1HIYA 1HBMA 2I0XA 1M5OC 2JLFA 3JYTB 5EWGA 3JSMA 1RT1A 3FBCA 3H8YA 4KIAA 4BDPA 4K4VA 5IT0A 1NUEA 2HAIA 1PC5A 1JIHA 4ZPCA 3R2CJ 1KOHA 2E5IA 4P7TA 4ZVFA 3SSRA 3VAHA 3KLIA 4P10A 4CP5A 1SVDA 1ZPVA 3HI9A 3CJSA 4OJGA 4CLSA 1HW8A 1JQGA 2IYIA 4UUWA 1X31C 5IC4B 4OHYA 1RWUA 3QT6A 4DPTA 5DQHA 1F60B 2CJQA 1RWXB 1CJVA 2OSRA 1PKUA 2XYHB 4AT1B 1RT6A 2CZ9A 1S9EB 5DLFA 3CJ2A 4ERDA 3K8WA 1KHVA 3PRVA 4YB5A 3HLUA 4KYZA 4C3KA 2A0FB 3ENQA 5D4PA 3QLHB 3VGUA 5D4NA 4DI6A 2GX8A 3M30B 1WUUA 3ZTRA 4ZP6A 5DDQC 4M5DA 1T9TA 2B0GA 4CO2A 2JVRA 4CH0S 1SH3A 1U24A 2RQCA 4DSKA 1BMQB 1HKAA 1T9WA 2QJ3A 3EWGA 3LW5C 1FX4A 4L6V3 3ZZPA 2W9AA 3WC2A 2YNGB 2BQRA 2DCUB 3AAWB 2YH1A 1GX6A 2J9DA 4OMFG 1DLOA 2ZUGA 3U7JA 2MQ8A 4YY3F 5J2NB 1HFEL 1TELA 3OQ2A 1E6YA 4XDCA 1N88A 2QMXA 1T05B 2IMOA 2E5LF 1JNRB 2Z2ZA 3L9ZA 3R6GB 3N5BA 4A8KA 3RB4A 4PG4A 3VVTA 2GNKA 3W62A 4NPOA 1VQOS 1B0PA 5J1EB 3A3PB 1RT5A 4A8YA 2E29A 3OXLA 2L41A 5AE1A 2UP1A 3J81U 2E5LJ 3HHLB 3FNNA 2M52A 1UZHA 1GX5A 1HYSA 4L74A 4IG0B 5IM0A 4QR2A 2DNGA 3AODA 4AYBD 4DV2J 2GGPA 3SDEA 1CVJA 4I6YA 1FDAA 3QIDA 2PFDA 4IFYA 2J9DE 4ZJLA 1YJVA 4LF4F 2KT2A 5B0BA 1S9GA 3DRRA 4N5SA 1S9GB 1WC4A 2YBVA 5A6WA 1I6JA 3CTRA 1HWIA 2Z2YB 3LA0A 1VLOA 2RRBA 2WBMA 4HR2A 1NBEB 1KBRA 3SFGA 1M5HA 4LBHA 3W5ZA 1WSRA 2BKOA 3QO9A 3FMWA 1JLCA 1WKJA 1RTHB 2O67A 1JXVA 2V50A 3OTBA 4IG3A 3GQCA 2V68A 4AD6A 4LR7A 1TMMA 1SJ1A 2N3LA 5F0UA 5LXRA 3VAFA 5J2PA 2RQMA 1NK7A 1FJEB 2IDEA 2K1RA 4HI2A 2R2RA 4P2XA 3UDVA 4KT0C 4U7CA 3TOQA 2JC0A 2LQ9A 5HSPA 2XYGB 3KDNA 4L73A 4PQAA 2VPXB 4ZPTR 4JI2F 4F50A 2ZWPA 3M6VA 2GHVC 2LXIA 2Q43A 4P7VA 4W4MA 1JLQA 4RL1A 4ZHRB 3DOMB 4ECTA 3EZOA 1NK8A 2HYIB 4QU7A 4GKKJ 3Q86A 3RAMA 1QAIA 3DYAA 1A6LA 2VG7B 4MK7A 3R3TA 4ANCA 4DLGA 2KM8B 3DRSB 3CJ5A 3QRQA 4O3RA 4WU2A 2KZMA 3A1YG 5KFHA 2NSBA 3K2YA 1WHYA 1C1BA 5CHCB 1U0HA 3OTDA 2MZ1A 1S0MA 2D3O1 1LXNA 2CVEA 3M6WA 2M8HA 2LQ8A 3FC9A 3NG8A 1K1SA 4YEAA 4UOFA 2QA4G 3D0IE 1UJ6A 4C8KA 1R27B 2HHSA 4OYPA 4O4RA 5C2CA 2V2ZA 4YUDA 1MU2B 1YJNS 2GJFA 4WU3A 1NJWA 1HWLA 1RWOB 3QPIA 1RWNB 2FHOB 2HWTA 4X62F 2GVZA 4OYMA 5A2QU 1RHJB 2RDDA 3OVSA 1N8RT 1HLWA 1R0BG 1U8WA 2XSJA 1NAQA 3CW2C 4UTGA 3P5BP 5E3RA 4OYOA 4ED4A 3EVMA 3H2LA 5B0DA 4ZK7M 2WAQD 2CADA 1S1UA 4TQSA 3BR8A 4OZ0A 4ETXA 4DR6F 3MR2A 3G82B 1HBMB 1QD1A 5I3PA 4ER8A 3GV8B 2J0QD 2CQHA 3BGLA 3MM7A 2KI2A 3ZZYA 4YOEA 3EXYA 2NCKL 1TZ0A 4HEA9 4X65F 1PGZA 3NMAA 1E6YB 3NS7B 5KFOA 3OHAA 2ASYA 3AQPA 2DGTA 1N5TA 4OFZA 3WC0A 4ELVA 5A8KB 2B8QA 4JV5J 2AF6A 1X9WA 4RUCA 4O3QA 4Z37A 1R43A 5HJXA 3CCSS 5IT9U 2VA3A 2I8EA 4N56A 4WF9Q 4M8LA 1X4EA 3DOKA 3THVA 4EBCA 4DQSA 1KTVA 1R6VA 3D3BJ 2B51A 1S59A 1NZ8A 1S9FA 1YVFA 1FT8A 5CYMB 2MMYA 3HHLA 1LWXA 4FKYA 4ZA1A 3U27A 5DG9A 1CJKA 2W8KA 3BO2A 1IBKF 2WONA 2PC6A 2QIFA 2OEMA 3PDNA 3RB6A 1O5JA 2RQ4A 2CQ4A 3MPUB 5H9FJ 3RAQA 3W7BA 3R5CA 2JH3A 1VFJA 3WZ0A 3I6PA 1SJFA 4DUYF 3LQVA 3D68A 4NLXA 4OI3A 3IS9B 2XO7A 3RRHA 2B7CB 4MKBA 1P6TA 1RAJA 2RDIA 3KLEB 2P9EA 3ET6B 3VQTA 1D09B 3NGRA 3ITHB 1U1MA 3ZO7A 1M90T 2V5HG 3DRXA 1HNIB 4J9PA 3KJQB 2GHPA 2L08A 1F9HA 5KT2A 5AXNA 3MMBA 3DLJA 2ZJQQ 2CKWA 4OX7A 4NXMJ 3M8PB 2ZBQA 1Y5LB 1UPMB 5DO2A 3CNQP 4K0KJ 3C6UA 3LF0A 1S6QB 1FJGJ 3KG1A 1IQZA 2KB2A 3UI3A 1PYSB 4LF2A 4XPCA 2E9ZA 3MEDB 2W9CB 1NSKL 2R4FA 2CPYA 1F5AA 3KWMA 4IO1A 2HURA 4DN0A 3TX8A 1X9MA 2Y9HA 3W3SA 5HO4A 2IA0A 4TKTA 2VKRA 2MDAA 3RGIA 3KYLA 3SQGB 1M5KC 2ZUAA 3TWZA 1S1WB 3OL7A 5J2MB 3G71S 1FNOA 2BKNA 2PMWA 4FS1A 1SL0A 2VUGA 3UD3P 3FK4A 5A2QY 1WHXA 3IR6B 4X66F 1DTQA 4GO7X 2F1FA 1SUQB 1YG0A 2V69A 5LJ3Y 1WACA 3MXHP 1KN6A 2RKIA 3DDIA 4DS4A 1MWZA 2C2NA 1H73A 3OR1A 4OV1A 4CLTA 1SJ4P 3JSMB 4TVAB 1VIXA 4OJ1A 5FD1A 1D3WA 5AXMA 2FJXA 1XR7A 1N36J 4U7UK 4HH0A 1EETB 2QL7B 3C15B 4OX9J 1F1BB 2DNZA 1NK4A 5FLXY 2G1HA 4YS2A 1GQEA 2V4JA 3HHEA 3FJ2A 4OV6A 3X1LB 4ZPVR 1QUPA 3M2UA 3PEJA 1Y00A 4PRFA 5CYQA 2BW7A 2EG1A 2Z2LA 3GFHA 3M05A 3MEDA 4PWUA 2W9CA 1J5OB 4DX6A 1KRPA 1UEKA 2P9CA 5B0GA 2XS5A 4OI0A 5HN0A 1S1UB 3CDWA 2HRYA 5DS7A 2DISA 2YQ0A 4K7QA 3LTOA 2FJVA 2F9JA 3OTCA 3MI7X 2C2RA 5EUHA 3V6DA 1EQMA 4MFBB 4LQ3A 3S6EA 2CQPA 5H1SV 3DOLA 4NLTA 2FLNA 2E9RX 3POTA 4P75A 5KFAA 4MK9A 3HJVA 1S7IA 2YWWA 4LF9F 1RAOA 1RP5A 1S1XA 1XTZA 2D69A 1IKWB 2ZC3A 5CZXA 5C2GA 5HBMA 3K58A 1T94A 3ZNUA 1KC8T 1SQFA 1FRJA 5HROB 1Y10A 3CMAS 2OJ3A 2VL1A 2KZZA 3BBBA 2DJWA 2R7SA 1U49A 2CVIA 4CH7A 3NL0A 1BQNA 3GG0A 2B4UA 5ETMA 2DKOB 3MR3A 3VCDA 3CIZA 4G1PA 5B0EA 3D2WA 3UW1A 2V2QA 3FEXB 3N0VA 3OR2A 1NJIT 2LKZA 2RSQA 4B9MA 4F04B 1RISA 3MM6A 3HM9A 1GMVA 3O8WA 1ZA1B 4OZJA 5M2RA 2POKA 5L39A 3M1VB 2CJXB 4Y0FA 1ELOA 5A8WA 4ELUA 2EC2A 4DMZA 4FXWA 1IM4A 1JJ4A 2HNYA 1MROB 4K4UA 3PFOA 4C8ZA 4WKYA 1NPPA 2CPDA 1M5SA 2MZRA 9RUBA 2ZH5A 2X1BA 2ZZMA 1HARA 2MPUA 2RE1A 1C4AA 3R27A 2Y0SD 5E33A 2DHSA 2NPIA 3LO3A 1VBXA 4X4PA 1A0OB 5AJ3J 1RWMB 3M2RA 4Q8EA 2H51B 1VS3A 5CD4H 1LWEB 3WX4A 4G1IA 5J1PA 1YBTA 3GYXB 1H0HB 1I1GA 2CNLB 2MZJA 2Q6CA 4DL7A 3C8YA 2BDPA 1SJ3P 3LAMA 4ZVEA 2B4PA 2VJUA 1W2BR 2HLTA 3G6VA 2ILZA 2ZH2A 4QBUA 4WZQA 4F25A 2WVDA 4DFPA 1Y5IB 2OPPB 2WSCC 1R0AA 1UMJA 5AXKA 1KP6A 2X3DA 1VQYA 2UUTA 2V0NA 2IMWP 1RWWB 1X0PA 1X4AA 2ADBA 4OZLA 5KFPA 2RDJA 3PKMA 2HZCA 5HVHA 1HD1A 1FKPA 4JI5J 5LT5A 3NAHA 2KO1A 5CH7B 3L4BC 3CCUS 4RPFA 4PABA 2QFIA 1MN7A 3IRWP 1JX4A 2KYZA 1HI0P 4FF3A 4TN2A 4DV0F 4KFBA 1J27A 3NKYA 2CFXA 3HVTB 4LQ9A 1N32F 1SKUB 4ZPBA 3HDSA 4E98A 2OPRB 2PEBA 1RAEB 3A8JA 3KUEA 2NREA 4F36A 4IOBA 4NXNJ 1HMVB 3NGSA 3IG1A 4CO3A 2E7VA 1QTMA 2K7KA 4Z2XA 5KT5A 1N32J 2DITA 3UWTA 1K1QA 2UUAJ 1LWFB 3OLAA 1N6QA 1FXDA 3GIIA 2ASLA 3DLHA 1AYEA 3D4JA 4F4AA 4NYPA 4IUFA 3K5MA 5KFYA 3IAM9 3FDSA 3A3OB 2MJNA 4J9UE 2QTWA 1WC0A 3P4UB 1LFWA 5IWAJ 4I6WA 4RUBA 1U0SA 7FD1A 4H4MB 4DPUA 5A8RB 5C42B 3GCWP 5I4MA 1LFPA 2JL9A 2W1BA 3T9ZA 2Z2MA 4N7TA 3SV3A 2KHCA 3MEEA 3HCXA 3R9LA 2IDLA 3KXDA 4NZ0A 4JI6J 3Q8SB 2M4MA 4PUOA 3AXKA 3AOCA 4RW7B 2RNEA 5J1EA 3KLIB 3M8RA 4V19X 4JB8B 1YLXA 3EDRB 3JQMA 4I7FA 2XO6A 1XMOF 3PR4A 2CQBA 1TAQA 1FDNA 2O5DA 1FKAF 1MN9A 4OI1A 4MH8A 2HGNA 3QO9B 5IM0B 4UOCA 1HYSB 1S1TB 1RT1B 3BV8A 4R25A 4QPTA 1R8AA 3GFXA 5KFUA 3I5BA 4ETZA 1FDBA 2UZAA 5KFCA 4K4XA 1IBLJ 3DRRB 2UXBF 1C0TA 2VU5A 3ELHA 1S6QA 3MECB 4RNHA 5JJBA 3DLKB 3KJVB 1V5IB 1F5CA 2YQ3A 4NLOA 2Q1LA 3UN2A 4Q8FA 3GYGA 2J7KA 2FUG9 5B08A 4ED5A 3DRPA 2EC0A 1PAUB 2KT5A 1HNIA 2CPZA 3JSRA 3MUVP 3R6LB 1VC6A 2F8EX 2QX0A 2BANB 3TAMA 3RTVA 1ROFA 3W66A 1VC0A 3TJ8A 3CPWR 1WJ9A 3MF5A 1Q53A 1ZM3A 5F8NA 3LWLA 2OIHA 1OY6A 4DUTA 5HQLA 3Q2TC 1HNVA 1IWGA 3VGTA 2CQDA 2AYBA 1VDHA 2B9WA 2UVVA 2HK3A 1EARA 2QZ8A 2DR8A 1RDRA 1SXLA 2XLJA 2JSXA 1I94J 3CGIA 1KFDA 3G8QA 2A2DA 2X3GA 1FCAA 3MMAA 3VGVA 2XMAA 2YNGA 3WIUA 1EZZB 1NU4A 3Q23A 5CYMA 2AWZA 1RA6A 1S6UA 3CCQS 2ABYA 1FA0A 3FQKA 5E7OB 4LUBA 4NZ7A 5LOQA 4ZJOA 4DR2J 1R3NA 1RHMB 1SH2A 2DHHA 3SXLA 1PYOB 3M8WA 4USUA 1ZH5A 5KFZA 2R7VA 1LKZA 3E8OA 2E66A 5B0CA 1C0TB 2JLGA 2DPIA 3PZPA 3FSIA 2G0IA 1WG4A 4HT5A 3QT7A 5GAGU 1VMBA 2HVDA 1KQGB 1CQMA 2YWGA 1RB0A 3CSKA 4NMLA 3W9IA 4AQYF 4FXVA 3KLEA 5SUHA 4OYAA 1W7WA 3LP1A 2VPYB 3G8TA 3ZZZA 2YWHA 1B70B 1F2HA 5DGBA 2HIQA 5DDPC 1B99A 4CLLA 2YVSA 4H4OB 3MAAA 3C6TA 4I2QB 4P72A 2FVRA 4ZMMA 1AW0A 3EGNA 2DNHA 3S1TA 4HYKA 4QW8A 4RX6A 4YN3B 4AXIA 3PVXA 1TMJA 4FXDA 1OSDA 4DFKA 3BKUA 2MYFA 2OPSB 2YNHA 5D0EA 2UV8G 2LLZA 1XEZA 1N6QB 4NLVA 3IWNC 1FNXH 2OELA 1IBMF 3B4DA 3D6MB 4X4RA 1TUGB 3H7HB 3R7NB 3C46A 2FIUA 2VQFF 5F41A 2BXJA 2DR7A 3LP0A 3OJSA 2XGQA 1KEKA 2F65A 2UVWA 3IM8A 4LMZA 1BLUA 1UWBA 2CNOB 4R0EA 2LQBA 1Q95G 1HBOB 1RCXB 4WE1B 2QMUB 4JV2A 2VBZA 1ZAWA 4L72B 4RWWA 1QVGR 5BJRA 1WNEA 4XAKA 3GR1A 2G4BA 3NS6A 5D4OA 3H5UA 4I69A 1MG7A 1C2PA 1N48A 3K8VA 3TI0A 3TAPA 2DR9A 4PYDA 4MKAA 3WDOA 3CIMA 2VBWA 3PJXA 4L3KA 5L9XA 5HVGA 5DM6Q 3BO4A 3MR7A 5KFJA 3NNHA 2FC9A 3FRZA 1SH0A 3QGHA 3CCVS 2UU9J 4F67A 2NQPA 5LXYA 1VLYA 4UY85 1TAUA 2HS0A 1XC9A 4GKJJ 4B3RF 1MMLA 1U2FA 1UWAA 2H5IB 4LIRA 2MTLA 1KFSA 3K0JA 2DNMA 2L9WA 3Q8PB 4DWIA 2RS2A 4XTTA 2ZM6J 2KHDA 1UCNA 1UEVA 1KQFB 5B0FA 3FFIA 3TVKA 2JZ5A 2MLXA 2UUWA 3MOJB 3MOZA 4CYUA 3MUTP 2UUAF 1VRTB 1WORA 4CT8A 4XO0A 3H2UB 3CO9A 4Y34A 1UFWA 1XMBA 4HDHA 4ZLPA 3C16A 2LDIA 4BWMA 1F2GA 3V4MA 2LFVA 3PYEA 4AUKA 1FRKA 2D9PA 5F3ZA 1PC4A 1RABB 1WTBA 4PAAA 1U2RA 1XMQJ 3FUYA 2E1CA 4I67A 5KG7A 3D1HA 5HROA 2BVZA 5GAGI 1NK9A 1EP4A 4PXCA 4S0MA 4FBUA 3Q8QB 4A8WA 1CJTB 3EZUA 1JLAB 3WBZA 5IWAF 2V4QA 4J9VA 3M8SA 1DJ0A 3R5DA 1UFLA 2G0CA 1HQ2A 1YKWA 5B7WA 3DN9A 2E7WA 4W92B 2ZM6F 1I51B 2ZOMA 1REVB 3D5MA 4GVLA 1X5TA 5EDWA 5EN1A 4URQU 2VHGA 4KHMA 3OVBA 1TUWA 4DV4F 4OQJA 3RR8A 2KFNA 1RCOB 2IRUA 1U6FA 3EICA 1PBAA 3VVUA 1CS4B 3GJRB 3TZYA 1HL6A 1XBWA 1X4BA 2ILYA 4KPYA 3X3UA 2J8AA 2JOQA 3L09A 4ED8A 3HZEA 4FYYB 1NRKA 2DXFA 5KFWA 1URRA 1JLBA 4OYXA 2DNNA 2E1PA 1HW9A 2H54B 2MSTA 4H4KC 1M1KT 3TO8A 2D3UA 2LP4A 2UXCF 1H74A 3TUIC 1F6TA 4IOCQ 1EKRA 2QRRA 2EFVA 3T1AA 2RU9A 1TFYA 3MPYA 3UVJA 2H48B 4USTA 2NYIA 1HNXF 5KFIA 3ULHA 4DJBA 4NLUA 3SV4A 1FF2A 3M2VB 2Z8QA 1T0TV 1YJTA 2HFUA 2X1GA 1UA1A 4M1KA 4USWA 4JI3F 2GW8A 3GJQB 3BPDA 2CWKA 4NEYA 2VASA 2XGPA 1HBOA 2RRAA 1RJJA 2DNQA 1PILA 2JLEA 3AD8C 2FVQA 2HHUA 3HHNB 2UXDF 5L8RC 1YITS 1V9OA 2DNKA 2V8HA 4RNFA 5H9EJ 2ASJA 1WOOA 1RWKB 2DVIA 5GMDA 2W01A 2F4VF 2HZVA 4RW6A 1DQ9A 2HMIB 2HHVA 2FHMA 2C2MB 3ILJA 3OR2B 4IFVB 1VIOA 3GFYA 2DT9A 3M30A 5DZ6A 1KONA 1S1VB 2WTFA 2QMWA 3L7PA 2VD3A 3QATA 1YHQS 1FWKA 3ET6A 3G86A 3MR5A 3TNVA 1U7LA 3CJTA 1Y5NB 4Y2CA 2V63A 3H4BA 3VAJA 2LQ5A 3CCZA 1UAWA 3QAUA 1WELA 4OHWA 2GAGC 2XZDB 2OD6A 4ID8A 3DOLB 4RO0A 4AL7A 4CM2A 1TK5A 3O5TB 3H59A 3M32A 5I3QA 3KLHA 2DR5A 1QSLA 1Y11A 2DRAA 1U6ZA 3J80U 5U47A 1SQEA 3SI8A 3DRPB 3Q8RB 4ECYA 5JVHQ 4C0OC 1WEZA 2N7YA 4IRCA 2GVDA 2C3YA 3FSXA 4QJVA 4ZVOB 3OW2R 3IR5B 4DF8A 2MZSA 1Q5VA 2NR0A 3W5YA 4JYAJ 2NXNA 1FNMA 3PYFA 2FQQB 2CZ4A 3RU0A 4E8UA 3BYRA 1NLKL 2CPXA 5BYQA 2FLPA 2CDRB 5CCLA 3PW4A 4KR0B 4H4KA 2WW8A 2XY5A 1OYEA 2BQ3A 4N76A 5DG8A 4LFBF 2P5VA 3GMGA 4BC9A 5EX0A 4F0HA 1TUVA 5K8NA 3IS9A 3OL6A 1N5SA 2JEIA 1S12A 4PWDA 2XEXA 3OFEA 4DOZA 3ITHA 3CJ4A 3OR1B 2FD2A 4WK1A 2OH2A 2HWIA 4IDKB 4DEZA 3SCLE 4OL8A 1IXKA 3O2IA 4LSLB 5IV3A 2FGCA 5F8JA 1IVZA 2A10A 1U48A 4EEYA 3DLGB 5KFVA 2DHAA 5I42A 2GVZB 3QAEA 3M8QA 1C0UB 2IJFA 5E41A 4WKRA 4EFAC 3VAKA 1CG2A 1TV6A 4LIWA 4BBYA 2CA9A 3H20A 2MZTA 3R2DJ 1Y3JA 3EXCX 4A46A 3OTEA 3TQ1A 2QLBB 2ZH4A 4B3TJ 3ILLA 1V3SA 4KPCA 2G1DA 3NCRA 3W2WA 3MTKA 4DL2A 1RYSA 3HVAA 2BQUA 4F4ZA 4Y3CA 4H4MA 5KG0A 2UUBF 2IHR1 5MLCV 3GTYX 2OMOA 2IVYA 4MIAA 1TL3B 4K4WA 3QSIA 4QR0A 4OIXA 3SQOP 1VRQC 3V5RA 3T5HA 3MCNA 3MMAB 2C28A 5HQMA 4IQXA 4Z7CA 3UQSA 3FZ2A 2I38A 2R8HA 4I64A 1MW7A 3M6XA 3W61A 1FK9B 3HSJA 2BKPA 3MEEB 4B3SF 1RGVA 3OPKA 2QLXA 4CQ1A 4YHHJ 4NXMF 4F02A 1VQSA 3GE9A 3ZTSA 2RUSA 2ZJPQ 2ZZNA 2IC3A 3CMQA 2DY1A 3BSOA 1PCAA 4FKXA 2DRBA 5C25B 1LWCA 3NGUA 4IR1A 3N6LA 1WD6A 1UL3A 2EBGA 2YKNB 3WHIA 1WG5A 4ANEA 4YR3A 1URNA 4F4KA 5D8HB 3E01A 1BWVA 2ZDPA 3NCPA 2Q66A 2VIHA 3NBPA 1D9AA 4USHA 4DX7A 1B7YB 1KLMA 2FZKB 1S99A 4OHVA 1ZAVA 3NAIA 1HWJA 2ZBIA 2A3JA 2F4FA 7AT1B 3FVYA 3G6ES 2ZHBA 3DFEA 1S6PA 3CC4S 3KLGA 2OTJS 4X64J 1KTQA 2D41A 2GZOA 2E1RA 1WI8A 4C11B 5BYSA 4LF5F 2EFGA 2B5JB 3DRYA 4NLDA 2VFUA 4C11A 2ZOGA 4DXLA 1X7VA 5IC6B 4ES2A 5AE2A 4RU9A 3OUYB 2C3OA 2BA9A 2QA1A 2DGSA 3H90A 2BOPA 4JI1F 4W90B 1FD2A 4FVCA 3DHWC 5BYRA 4DDFA 4N77A 2QYCA 2GJ2A 2MKHA 2HBQB 2ZITA 1CJTA 3BREA 1JLFA 3HVWA 4G6VB 3VZHA 2QT7A 2XYPB 3LPEA 1XR6A 4NYOA 1C4CA 1X5OA 2R42A 3SMZA 4B08A 4HTIA 4J9SA 2MHNA 1UJ4A 4TLRA 1IJEB 4JUZA 2R7QA 2V4RA 5C25A 2M7SA 5B09A 3SIPB 2B3TB 4CLKA 2HZAA 4B3RJ 1RBOB 3AD7C 3KUHA 1NH7A 3MMCB 2WOMB 3TANA 4GKJF 4DQIA 2FHJA 4ILMA 2LXFA 4W98A 3J7ZT 1KSPA 2LA6A 4FYXB 5CCMA 2ZNZA 1X8DA 2BJ9A 5D0RA 1S10A 2HFSA 4WFNQ 6AT1B 3ZZOA 5HP1B 4NA1A 4B9TA 1UTAA 1S6PB 4URSA 4F7VA 1W25A 4LF7F 1LW2B 3FCWA 3IBWA 3JS9A 3LP2A 3G2XA 3QFHA 4H54A 4J90A 5FDLA 1VISA 4NA3A 3CULA 3EE3A 3CCWA 1LWEA 1N0VC 2CG4A 5D3GB 5DJBA 2OFHX 2PMZD 3CDEA 2CXEA 1JMTA 1EAYC 2CJBA 1JXLA 1UVIA 3FEYB 3DM2A 2IBOA 3WIVA 2VPZB 2RB7A 2N3OA 2IVMA 5AT1B 3E3XA 1RAFB 4J9QA 1YGYA 5GAEU 4DZ6A 4ZCMA 1VQLS 4PXBA 4BLGA 2KN4A 5CD4A 3IC1A 4ECVA 2Q3PA 3KJNB 4DCJB 1RYRA 2ZH9A 3M9NB 1NK0A 2IRXA 4IH7A 1IBLF 3QRPA 3M7VA 2OHDA 1IJFB 5FIIA 3I56S 1HQUA 1D8YA 1XNRJ 1I5OB 5J2MA 3TQEA 4WBFA 3U1MA 3TZZA 2YX1A 2I6WA 3US5A 1YJWS 1FK9A 4XPEA 2D1CA 2CIMA 2Z58B 4M63A 1T9UA 3IM9A 1KKHA 2R2SA 2ADCA 2CJAA 4N47A 3IMQJ 1YRXA 3BB5A 5G0RB 1H2VZ 3DC2A 4P73A 4I56A 2JFKA 3TEHB 4DSJA 1VRUA 3DHXA 4B9NA 1LQ9A 3BGUA 4OZ2A 1WSVA 2AJFE 5HMYA 2FJBB 3ETMA 3HF5A 2DIVA 2YKMA 5GAEI 3OFHA 5L1KA 2LDYA 3S8SA 3OL8A 3PJWA 2J0XA 1U1LA 4NCGB 1H98A 1Y9OA 2OPQB 1IBCB 3QJLA 5D0GA 3FRYA 2H4YB 5CYQB 4IRDA 3WQPA 4QIVA 3LPYA 1FJCA 3HSZA 5JVGQ 2AQ4A 5DDRC 2OP5A 1R7IA 2FTRA 2W25A 2WVEA 4OZ3A 4E2FB 5K8PA 2XQCA 5KFRA 4C48A 4ZPDA 3HX9A 1L3SA 4P52A 3JTNA 4WIQA 4KKOA 4X4VA 3M8PA 1U45A 5GADI 4PPDA 5EGYA 5KT4A 5DM7Q 1NK5A 1I94F 3MPWA 4ZVTB 2GQCA 2DH8A 2F7VA 2FVSA 2BR0A 3OXGA 3LANA 3KLFB 2V6AA 2APOA 2OPSA 2YNHB 3PHEA 2P6TA 3QFWA 4EU0A 1L5UA 5IFMA 2LEPA 3IN5A 3B78A 4DV6J 4M5IA 4NX9A 1VQ7S 1NJYA 2AZ1A 1FEEA 1J2VA 4MIWA 1DTTA 3DDNA 1SKRA 2AJ4A 4NCGA 2BRKA 2CNNB 1ZTTA 1IBMJ 2LVWA 3J7A1 1BQMB 2OMLA 1P1LA 2CWXA 3DLGA 2JEFA 2Y8YA 4C0BA 4K4SA 4QYZK 1Z2ZA 3MCMA 1DQ8A 5KFQA 2XCPA 3KJVA 3K57A 3ETOA 2W2OP 3NWRA 3HVRA 3TUPA 4IDKA 3ILIA 3L3CA 2WW4A 3B54A 3BS9A 1HI8A 2EFNA 5HAOA 1ZM9A 2ZFHA 2HVHA 1BUXA 2MQLA 1HNZF 1T9XA 3GG1A 1RAIB 2QFJA 2V4JB 3HFZB 1NHKL 4RW9B 2RMLA 2EG2A 2IM0A 3GJSB 2HHWA 3BDEA 2R8KA 3MWBA 3DNCA 3TA1A 2G0JA 4JI2J 3Q89A 3TW0A 5CAAA 5K14B 2QE5A 1SC1B 2PA8D 2OI2A 2YX7A 1KQSR 2QLJB 2CZVC 2X1AA 3K5OA 2ZOFA 3SBMA 3UNYA 1HQUB 4CNYA 2AHOB 3MHYA 3MM7B 1S5ZA 4MT1A 4QIEA 1NH8A 2NYHA 2QGFB 3A4TA 5ETSA 1O0PA 3C2PA 1PIEA 2L9NA 4DX8H 3I9ZA 5DGAA 4XDDA 1U6BA 2CQCA 1TKTB 1GNKA 1TL5A 5L38A 4WCEQ 1RHQB 4YB1P 2BABA 3GR0A 4ZVQB 4C3LA 2RF2B 4DV5F 1KOOA 4J91A 2AEFA 4CLWA 3JAMY 3T1HF 1NKEA 1JLAA 4EK2A 4LVOP 2EKYA 3QMQA 4B3TF 3JB9k 1HQEB 3MM6B 1JLEA 1TQLA 5KG3A 4B9VA 2J0SD 4R8UB 2WBRA 3M8ZA 4WPAA 2J0WA 4PQUB 4HL9A 4URGA 4NYZA 1NPKA 2HG4A 4PXEA 3N5FA 5CA5A 3CC2S 2XHCA 4ZP8A 1U09A 1ZA2B 2VBYA 4RKUC 5KG2A 4C9DA 2AEJA 1I3OB 2IAJA 2MLZA 1TR0A 5C42A 1M1GA 2K06A 2IIHA 3DU5A 4ZLNA 4JI4F 4JI0F 3A3NB 1QAYA 1U0HB 1HBNB 3PHTA 1PO6A 2B6AA 4ZVHA 4O3OA 1SI9A 3KK1A 3KDOA 3CDUA 4JBCA 1QTNB 2DGWA 4ICLB 4LRFA 1FFGB 3VQSA 3IBCB 2KTQA 2R7TA 5DQGA 2PIIA 2HNDB 1DURA 2M8DB 1R0CB 1M0SA 4PCQA 2MXYA 2VC1A 4JP8A 3DLEB 3J7AN 3DRSA 2XNQA 2BM0A 1VYAA 2J9CA 2LCWA 2FVCA 4LF6J 1HBUB 2Y8WA 1FERA 2V94A 4QIWD 3MM9B 1LW2A 1RE1B 4MYTA 2J76E 3W65A 5HQ8A 3H4DA 1GXUA 3M1VA 3UCUP 1UVLA 3NNAA 2CG8A 1WC5A 4EGLA 2ZWOA 3R5BA 4IO9Q 3IO1A 2F9DA 3GYNA 3NBPB 3TEGA 1WDDA 4LF6F 1N4LA 1JLGA 4Q5VA 2VODA 2AZ3A 2L48A 3DKDA 4KGVB 4P2FA 3J7YI 4OLPA 2W4DA 4N8NA 2NPFA 4DUZJ 2KDOA 1UVMA 4PG7A 3HPOA 4ECXA 4OJHA 5LMNJ 1JWWA 4KB7A 4MTPA 2ZD1B 3KHLA 2NSCA 3D67A 4YDDB 4DV0J 3UCZP 1KVJA 1PBUA 1RBAA 3Q22A 1DAXA 4MJKA 3V81A 2LEAA 5E3AA 4GMKA 1FRIA 4DFMA 1RXOB 2FPHX 2HNZB 1R8PA 2G2ZA 2BZ2A 2ZHOA 1D8ZA 5D0HA 2W7OA 1ZBTA 1NZAA 2OEJA 2UUBJ 3D0GE 2WVFA 3HZGA 2F4VJ 3EVWA 1RWPB 2F8HA 1Q16B 4TQRA 2HS4A 1YZ7A 4N8OA 4YY3J 1BXNA 3AD9C 2HEKA 3DXSX 3CF5Q 4O0NA 2K3KA 2HPUA 2D9OA 1KS2A 1TKTA 4L76A 1RT5B 3MEGB 4L3NA 2XWXA 2IM1A 2RF2A 4NLSA 1EJ7L 2ALYB 2IJRA 5L9NA 3SEOA 3HD2A 4OX9F 4QWEA 2JNJA 3UDCA 2GQ2A 3M9MB 3BGFA 4ECSA 2OPQA 3RW6A 4L75A 2LECA 1S0NA 3M4XA 4DR3F 4KSEB 4K8RA 9ATCB 4HLBA 4X66J 1L3VA 1K0TA 2Z57B 2EFOA 1KDNA 1W2IA 2YX4A 2U2FA 1R8HA 4LFBJ 1IR2A 2FYXA 1RT6B 1SCJB 3SQGA 2XLKA 5BXIA 3TAMB 4ZOSA 1RZMA 1RUSA 1CC7A 4OI4A 1G4CA 2C2ZB 4DX5A 1TK8A 3PO4A 2XBPA 2FY1A 3F0NA 5KFEA 3BGRB 3NXZA 4ANDA 2JEJA 4I1TA 4TXSA 3BGRA 3V6HA 2BX6A 3NLCA 3T1YJ 1T05A 4DCPB 4Y00A 3LGNA 3N01A 1Q86T 1NDKA 4I4BA 1FVQA 1A9NB 4ZPWR 1FKOA 2L9DA 3W2WB 3OFFA 4FNIA 3CB4A 4Y6IA 4YB6A 1YBUA 4XIUA 2CQ2A 4NCAA 1WC6A 3FEZA 3OL9A 3M8YA 5LSLA 3S7RA 3O44A 3LWMA 4DV2F 4PUOB 1X4FA 3I0RB 2D74B 5F8MA 1S48A 1FE0A 4OI6A 1FJGF 2E9TA 1HWUA 2ROPA 5KFGA 4U6PA 1RKJA 1NCLA 2OSQA 1QSYA 5D3GA 2AYEA 3QJJA 3HO1A 2U1AA 4FPIA 3C3LA 2GJIA 3GIJA 2C2EA 3MMBB 2P8IA 5GADU 3NNCA 3DM2B 2RIJA 1RAHB 2N7CA 3CCLS 1U25A 4ECUA 1BQXA 2ZH6A 4AL6A 5A8KA 1UW4A 2LYVA 3R1HA 1QSSA 2B9EA 1YK9A 2JWNA 2WRMA 3MM8B 4CIOA 3AJ2A 3B8HA 2GIRA 2M0GB 4ED3A 3CD7A 4DSLA 3JSBA 5KFSA 2HHXA 2XS7A 3G82A 3AB4B 3RBEA 4PPZA 4CO4A 5M2UA 3FBEA 4FNHA 1N36F 3KNGA 5E5NA 5HLFB 1X4HA 2HHTA 1QDUB 5HATA 2HIYA 3MFIA 1AB8A 4FPRA 2C3UA 3OSNA 2IM2A 1ZM4A 1RTDB 4LFAF 2RRNA 3UR0A 4J9OA 1SQGA 3SCKE 3VWSA 4F0MA 4DR3J 4GC7A 4RBTA 4K4ZA 4DR1F 3NOCA 2GIQA 3B6BA 3UN3A 4U9RA 1AFIA 4F3QA 4TY8B 3ZC4A 3KK3A 3I4PA 1ZETA 1Q7YT 5L46A 1IWAA 1QE1A 2VG6B 3CJ3A 3UPFA 2ZH1A 4FF4A 1HNWF 1JLGB 3P5TL 2EXUA 5E0OA 1Y0HA 2I9SA 3J81Y 3HK2A 4LFCF 1MU2A 3H0PA 1G2EA 2HSEB 2A2CA 1ZTWA 5GAHU 4GVBA 3KOAA 4JI6F 4RW7A 3TA2A 1LXJA 3BBFA 1QLNA 2MQPA 5CYJA 4X64F 3UFCX 4JI8J 4KGMA 3UD4P 1CULA 1Q8LA 1O8BA 1Z2LA 2CQIA 4K5RA 4YR0A 1SIWB 3EGVA 4WFXA 2HHHF 2KU7A 1XN9A 1RSCA 3VTIA 1HMVA 4DV3F 4B9SA 1T3NA 4YP3A 4DV7J 1FTCA 5HMWA 4O0IA 1F9EB 1NSAA 2CPEA 2HFNA 5HVFA 3M2VA 2Y1LB 3MPDA 3VAIA 3IXQA 1LWFA 4C7QA 2D3OR 3BKTA 3ZTOA 3TUZC 4B17A 4DPXA 1VQNS 2LEBA 4UQTA 2HAFA 5E3QA 4O3PA 1DQAA 1VHFA 1WG1A 2DH9A 3KJFB 2ZH7A 1N5YB 1RTIB 4DR4F 8RUCA 2Z30B 4R5PA 1G1XA 2FHJD 1GMWA 3PYGA 4R5PB 4V19J 4DR2F 4KHPF 2IVFB 3T6BA 4DV1J 2ZE2B 3MD1A 5J1NA 4F2RA 1APSA 1S49A 2KFZA 1ZS6A 2E7XA 1RKIA 2AX1A 1FRXA 1RU1A 1ULRA 2BJDA 4U96A 2EWHA 3QGPA 1NSQA 1HA1A 4ICLA 3KNAA 2IM3A 2XZWA 2G13A 2FJAB 3GLJA 3BJYA 3E01B 4ELTA 2WOMA 2VBXA 3EJMA 2Y1IA 4KGZB 1X9SA 1VQ8S 1U1PA 2ZVIA 3IRXA 3RB0A 2A18A 4ECRA 4JV0A 4DR6J 1RAGB 4DG1B 4OI2A 3QGGA 4ZIWA 3P3DA 2W8LA 5C5JA 4ZJQA 3HXMA 3IFEA 2SXLA 3F44A 4Q0BA 3UNGC 1QJHA 2PDAA 3B82A 3BM7A 2FLOA 2CQ1A 2JRSA 2VV5A 3I82A 3K5PA 4HH1A 4X62J 1Z1ZA 3JAMU 1S0OA 1UPPA 3I55S 2R8GA 2VQFJ 1TU0B 2RD5C 1P9YA 3HP6A 4ED2A 1N54B 4AXJA 1XMOJ 4ECWA 1WOSA 2CAJA 4UOHA 2DNLA 2BJEA 5F8LA 4UZBA 3M9OB 3HHDA 1S76D 1YBAA 4PWDB 4NI2B 3LGHA 2VKZG 4WFYA 4WXOA 4O3SA 5CABA 1JB0C 2DXDA 2BE9B 4J9NA 3CEDA 2HNYB 1PJ7A 2CDQA 3VF0B 4Q43A 2KH9A 4NLYA 4TNOA 3PV8A 3T1HJ 3CXCR 3K7RA 4M5KA 4CRJA 4IRKA 5I42B 5ADZA 1N0UA 1TFWA 2WCXA 4ZN3A 3BSNA 3P6YC 3IGNA 1ZM2A 3GIRA 1LW0B 2JC1A 2NXUA 3OJUA 3LP1B 2JHEA 1FRHA 1FXRA 4DV1F 3GILA 3TUJC 5HMXA 3W64A 5L1JA 3VGSA 3OHBA 1PYTA 4P74A 3UO0A 2OGUA 2AGPA 1KLNA 1SBRA 3G4SS 4UY8T 1X0FA 2GGPB 3SDEB 3NGDA 3L7OA 1N33F 2J9EA 4WWSA 2FVPA 1WEYA 2XS2A 1P9QC 2E5HA 2P6SA 5KAKA 2CJ9A 5E2QA 4PYAA 2DO4A 3ONQA 2DR6A 3IWLA 4GRSA 4M5DB 4QOTA 2ZJRQ 1J5OA 1D0EA 1U1RA 4ES3A 3PX0A 1OIAA 3DLLQ 2ZH8A 2QV6A 2EW9A 3MEKA 3BR9A 8ATCB 4M5MA 2PEHA 1Q79A 2B56A 3ENVA 5F8IA 3KK2A 1VC5A 4NXNF 2DH7A 1V3RA 4ZLLA 1S57A 1MWQA 2DCLA 5J2NA 3HKZD 2KKHA 1K47A 2BJ3A 5B0AA 4QWAA 3POTB 1EB0A 4RJVA 3GU0A 2F8MA 5K8OA 2VPWB 5K8MA 5DG7A 4B3MJ 1UVJA 2C3PA 2AIRB 1QY7A 3F73A 1RLDA 1X4GA 4EBDA 1LW0A 2MKJA 3S01A 3TR5A 2EFPA 3ZXWA 1UVKA 4YQWA 1NKBA 1SKWA 1VRUB 2Z0GA 1GTHA 1YX2A 3GV5B 2AP6A 1UETA 5T14A 2JX2A 2C2KB 1Q78A 3I0SA 4F4YA 4B3MF 1KWMA 3I0SB 4CLPA 2YKMB 2B7BB 3AQOA 5ETOA 4LREA 5HI7A 4F26A 1VQKS 3UR3C 3RBZA 2W2NP 4A8XA 1YZ6A 3DDKA 3MM5A 1G7CB 4C97A 3MM5B 4HI1A 1XNQF 4QU6A 1HBUA 3PO5A 4JOUA 5FLXU 4WYWA 2CQGA 1LV5A 1SC4B 2RVJA 3PEHA 2UXCJ 3HFVA 4B3OA 2HW3A 1YJ7A 5AJ3F 5E3CA 4JI7J 1NHVA 2DGUA 1B3TA 2KRRA 4RBVA 1EIYB 4C8LA 4KH1B 3PJ9A 5HMZA 2YKAA 5AXLA 1KR4A 2GO9A 2OPRA 3Q8UA 3KG0A 1HNXJ 2A6OA 1U47A 4CCHA 2IJNA 5THWA 2ALZA 2Y0BB 4KO0B 4RZRA 2C2OB 1DHMA 2IY5B 4DV5J 3M32B 3KLHB 4FYDA 3M8QB 1RWVB 2HVEA 4Q2LA 1HNWJ 1OQ6A 3EX7B 2B9YA 4KQZA 3P45B 1VOMA 4U95A 5ETTA 5MAOA 3EPGA 2AGOA 1CLFA 1EP4B 3KHHA 3UVJB 2C2DA 1KNZA 3D1QA 2ZH3A 4Y28C 2R7XA 3O3LA 4UUXA 1GEHA 3ZZUA 2YKOA 3T5LA 3MAQA 2ACMA 5HK4A 5ETNA 5KT7A 4LRDA 4QQBA 4CLFA 1GTEA 4DU8A 2V34A 4DSFA 3QGIA 4AE5A 1X5SA 2JVOA 2LXUA 2XSFA 3CD6S 1HI1A 2BACA 3AA8A 3N6NA 3AT1B 3LP2B 4FDFA 4K2XA 2CQ0A 4CM0A 3QZ7A 3CJKB 3KK3B 3GFZA 2XNRA 1IUJA 1HD0A 1J5EF 4JI0J 1PSDA 3G9CA 4JI4J 3TZXA 2LU2A 4C8OA 4F4WA 3CD0A 3GB0A 2DGXA 5RUBA 3HD1A 4OZ5A 2VQEF 4F2SA 3DLEA 2VFVA 2F40A 3AY0A 2V9WA 2VA2A 4NWBA 2XSJB 1N34F 5IQ6A 3BN4A 2RUGA 3SSSA 4RW8B 5FDLB 1L3UA 2ZD1A 4NOHA 4RW8A 1CPZA 1YIJS 1HWKA 1Q1KA 1BY9A 1SB6A 1UEUA 3N4WA 3D1OA 1S72S 2F63A 3D9BA 4QPXA 1MSWD 5KFBA 1SL1A 3CCRS 4CO0A 3AHPA 2E5JA 3OUYA 1ACMB 4PG8A 1S4FA 1BHNA 2F3JA 2KYXA 1CQNA 1VQ9S 3HKWA 1TL7B 4CWBA 5KT3A 1ZYQA 2ZVSA 3KMQA 3BEGB 1NSPA 2WSFC 1OJ4A 3J81j 2QLWA 1UWBB 1G3OA 1WTFA 4OYZA 4K4YA 4QWCA 3CMES 3FCHA 2QL9B 2YNFA 4CO5A 2E5GA 1OQ3A 3QWPA 4QR1A 2B5JA 2E1AA 4M5GA 2B6AB 3KK1B 1TVRA 1N5YA 4TY8A 4C98A 2BMBA 2UU9F 1UA0A 4KY3A 1U8SA 3VHQA 2HNDA 3H2VE 1WF1A 3D6FB 4LR9A 2VG7A 2V67A 3IP0A 1T03B 1N33J 4WYLA 3MD3A 2FLLA 4QIGA 4NRTA 4QWBA 4DR7J 3PW7A 5JXSA 4DL4A 4DG1A 1RACB 1H2TZ 4ZVRB 2R9LA 2VONA 4R8UA 4NL5A 3NCQA 2BE7D 5KFMA 1HPZB 1Q81T 2LU1A 1TKZA 3F56A 3HSGA 3K5NA 2N82B 4E0DA 1UVNA 4U8VA 3R7SB 4Q44A 2FJDB 3R5JB 2PD1A 4K0KF 3EUNA 1FI4A 4TY9A 5IT4A 4DV7F 5HP1A 1NJZA 3LUYA 3ZFVA 4AL5A 1J5EJ 1XQIA 2F5GA 1JLBB 4O4GB 4B9LA 4C8YA 2YWFA 3QIPB 3E51A 1DFDA 3MM8A 3ISND 3RG6A 1RT2B 4ZLJA 4X4QA 3KHRA 3FZBA 5DQIA 4LF8F 2QSFA 1KD1T 3OFGA 1WKLA 1JLQB 1RHRB 1S6OA 4KC5A 1RTJA 4RR5A 1TL7A 2VDHA 2PO4A 3TJ9A 1MWYA 1WHVA 1TKXB 2CYYA 2MKCA 5C24A 1QE1B 2VG6A 1SL2A 1XR5A 5IZHA 3H25A 5D78A 3V6DB 1IKVA 4K2JA 5CQGA 3I0RA 2EK1A 3MR6A 2V9KA 4A8FA 4USVA 1VQ5S 1FRMA 1BQMA 4EI2A 4EMDA 2VDIA 5K9FA 1WOPA 2R7OA 3D6HB 3LGMA 4DR1J 5CXTA 4Y65A 2NUUG 5A0YA 1WC1A 4YR2A 1JLCB 1T95A 1WEXA 3EYZA 4QYZJ 2VB6A 1OYDA 1SC6A 1SJQA 2DK2A 3CE8A 4LSLA 5ETVA 4X65J 2GMLA 3NGKA 5GMEA 2DTJA 2NXEA 1N52B 2YWEA 4BWJA 3UDLA 4DPOA 8AT1B 2B9XA 2Y1RI 4GVBB 5F8HA 5DDOC 4EZ9A 4OZ1A 4JV1A 3M2UB 3G6YA 4PG5A 1VR6A 2DO0A 4K59A 1X4CA 4F4XA 1W26A 3AJ1A 3DGPB 3BQ0A 1VQMS 1FHTA 2GQQA 1QAJA 2Z56B 2HBRB 5J2QB 3HT0A 2ASDA 4USIA 5I3UB 1R8BA 2L3MA 4KKOB 3HHLD 4FN5A 3SCIE 4DR4J 3AOBA 2MY8A 4LJMA 4WFAQ 5C7PA 3GV7B 2DY9A 5K14A 1A7GE 2UUCJ 1PG5B 2CPHA 1MLAA 4LF9J 5HANA 3KLFA 2EFQA 3TYTA 1ZPWX 1NMEB 4LR8A 1S97A 4C2MA 1DZ5A 1VGYA 3V6JA 2KL8A 1VJWA 1XK8A 2MKSA 4LSNA 4CO1A 4FBTA 4MK8A 5F8GA 2W2PP 2RHSB 3D28A 3DMJA 5DLGA 4FYVB 4KHRA 2OAUA 4PZVA 5D4LA 4KH0B 4ECQA 4Y2KA 1VQ6S 1DRZA 3QLHA 2ATLA 1GMUA 1QM9A 2I5JA 4GKKF 1B0TA 2DGQA 4I7FB 4OYWA 1Q5YA 1S1VA 3ILOA 1NDLA 3P8BB 3T41A 4X4TA 4Q7AA 5E3PA 2VOPA 1CJUB 2RT3A 4Q0BB 4QCLA 4I2PB 1RQ0A 1TKZB 4CNZA 3PYDA 3V6KA 1H72C 3TRGA 5KFFA 2ZEJA 3GWCA 4G1QB 1Z4UA 3HHLC 1R89A 1RBLA 4KTQA 1LNQA 3R7BB 5D15A 4C6AA 4DSEA 2ACYA 1C1CB 3NGTA 3PIOQ 2OTLS 4IOAQ 1C1CA 1RT4A 1MMDA 3PW2A 4I6AA 4ZVUB 3T1YF 1REGX 3FBBA 3HVTA 1YDLA 3BF4A 4RBUA 2VZ9A 1GAOA 5ETLA 1T03A 3R5GA 4HKQA 2W4PA 3K5LA 2FJWA 4BCAA 4LBPA 1HNZJ 4B3SJ 4DHVA 3KMSA 1UZDA 4KV8A 2DEIA 1JKHA 1PAEX 4WIIA 4ATNA 2HFVA 3OSPA 3PFEA 4RW6B 3GP9A 4O3NA 6FD1A 4DBQA 2HMIA 2AJQA 2IFXA 5ITHA 1WF2A 3H40A 3K59A 1VQPS 2UUCF 1K73T 3DLBA 3R1LA 2ZKTA 3Q24A 2HGLA 2BOAA 2KVIA 3LAKA 3PRBA 2W2QP 3JXOA 2R7WA 2MB0B 4TU9A 4HTJA 2WVBA 4XK8C 2NZCA 1RT7A 2I1RA 1CSJA 2O01C 2BJ1A 3Q0AA 3RRGA 4OLOA 4DFJA 4BS2A 1JNZB 3MCOA 1F0XA 5GVQA 4DL5A 1HR0J 4UQGA 3AH6A 3EVOA 2PSZA 4ZVPB 2QN6B 1T9VA 2BRLA 3A8EA 3CJRA 2WZ1A 4OX8A 1L3TA 3EDQB 3ISNC 2FGOA 3TJAA 4USMA 2G2OA 1NO8A 1ITPA 1FEHA 4R0JA 1R31A 3QRRA 1Q8IA 2W24A 4NLQA 4RLEA 1M5VC 4NRUA 2VFRA 2GFFA 4PEOA 3HFKA 3RR7A 2HBYB 3IG1B 2HNZA 1YI2S 4DQPA 1JLFB 1K9MT 3BQ2A 4GC6A 1UP1A 3D54A 4RU2A 1RI7A 3MMJA 3W63A 1Y7PA 1RHKB 5KG5A 3TZWA 1C1BB 2HKEA 5ETPA 3G87A 5H9EK 1V3ZA 3PNIA 4P6QA 4ZITA 4WE1A 4F8RA 2AGQA 3BN7A 3O6QA 3R8YA 2GO8A 2JEGA 1IKYB 3T5KA 4IR9A 2BUNA 1SKSA 4HDGA 2COLA 1U4BA 4YHHF 3FQLA 3LP0B 4KGKA 3GJTB 4RNMA 3C14B 1T02A 2H4WB 1Q7LB 2JDJA 4KV8B 4TYAA 4WFZA 2VJVA 3RAXA 3QSYB 1QVFR 2QSWA 1Q4RA 1LK7A 4Y2MA 3TA0A 2FHKA 3BH7B 4ILRA 5KG4A 4UT4A 2NZ4A 2IC3B 4D3GA 2IA6A 3PY8A 5KFXA 1FTRA 2RILA 3U1LA 4OYBA 2YPZA 3GPAA 3GIKA 1OMSA 1DY3A 4FP9A 3AJDA 1IM6A 3WX8A 1CEZA 3C6TB 2YY3A 1OY8A 2ROEA 3FMBA 4CYUB 4G1QA 3BO3A 1HR0F 1KLMB 2GA7A 4EO6A 1HQEA 4NZ6A 5GMKa 4OX6A 3MFHA 1TTHB 2BYCA 2K7JA 1FWLA 2DEJA 3FFIB 1Y3KA 2PA3A 2WHOA 2W7PA 4DL6A 2HQIA 4JI3J 2YNIB 4ZDNA 1VQ4S 4CT9A 2X51A 3ZZTA 2EVZA 4I0WA 1FDDA 2HK2A 1T9YA 2K1RB 2NLWA 2HHHJ 4EZ6A 2VC0A 2UXBJ 2VICA 5HLFA 1NJXA 1EQ0A 4ENOA 3RJMB 3MTJA 1H7WA 2DD8S 3QNWB 4WFBQ 2R7RA 1H7XA 3DI6A 4NLWA 3AFGA 4PWWA 3KHGA 1R6YA 2RHQB 2YH0A 1CJUA 1UFKA 4KJIA 1U1NA 2OKQA 2RH3A 5A8WB 2WK4A 1NB2A 1JK9B 4LRAA 2ERRA 3JQJA 5LSRA 1DTTB 2J5AA 2XMMA 3QQCD 1RLCL 2B8PA 1X5PA 1EETA 3T6JA 3QWUA 3KTQA 3ZTPA 3VALA 3N9UC 1ZZFA 3TP2A 3TAQA 2ZHAA 4B9UA 2CUYA 4U8YA 2R2TA 4CI0B 2FJEB 2A1BA 4KBIA 3DLKA 2D7SA 3EGWB 3CWJA 4V1Ak 3CDAA 4LFAJ 1LWCB 2RJZA 3TVYA 5KFKA 4RNNA 2ZBRA 2KM8C 1TKDA 4Q2MA 1GK8A 2KXNB 1N34J 1AROP 4KGXB 5HJYA 2EKNA 3CT9A 4N41A 3O1LA 3AXMA 4KHPJ 2MQMA 2YTCA 3BH6B 1FO1A 4U67Q 4FZVA 2O3DA 1B0VA 1ICEB 3I5AA 1TV6B 4RUHA 2AX0A 3FGVA 2MGZA 4B3OB 4A8MP 3N28A 3G8SA 4ITSA 5IS2A 2YKPA 4USJC 3T9NA 2CQ3A 4ZKAA 3JYTA 3D3CJ 5I3UA 5C24B 2XB2D 2AU0A 5A8RA 2M3DA 1RADB 4MYUA 4YB7A 3W2VA 3CCMS 1KHWA 1YJ9S 1AA1B 4X4UA 2DGOA 1VK3A 2N4CA 3GIMA 2QA2A 1V6HA 4NLGA 4NEZA 4U7UD 4DUYJ 2HS3A 4IFVA 5G0RA 1SUQA 3OBIA 5IV4A 3DU6A 2PGCA 4WP3A 4WK3A 4ZN1A 4OYIA 3I4HX 4ID5A 1CC8A 3FBFA 3MMCA 4CLUA 3MUMP 1H38A 1G6BA 1CS4A 4K4TA 4HACB 1CJVB 1SV5A 3GONA 4UZCA 5M2PA 4O44A 1CJKB 2AJ2A 1S1TA 5KFLA 4O44B 2OFGX 4EBEA 4OZNA 3PW0A 3K17A 2BW2A 2CPJA 1FWPA 3ZTQA 4DPYA 3V4IB 1TK0A 3IGVA 4LF7J 2PE8A 2ZKUA 3DGPA 4I2PA 1XNQJ 4FYWB 4FS2A 2HFOA 3BYPA 1FVSA 1XIQA 2PT0A 4J5OA 1D1UA 4P2SA 2C1EB 2DNPA 2EI5A 2YNIA 1Y4ZB 4X4OA 1YTYA 3JTPA 3HSDA 3OLBA 2WB1D 2PI4A 2UV8A 5A6PA 3KLGB 1M1HA 3H5YA 2V8GA 4ZP9A 4OHXA 1VJQA 1U26A 1EKSA 3B4MA 3C6UB 3CO0P 3THPA 3ICLA 2XM3A 2GV1A 3FKBA 5L1IA 1FESA 1F9FA 4DQQA 2N4DA 3BBCA 2OPPA 3EZ5A 1R0AB 4LF8J 3ENAA 4WP8A 3V81B 3QT8A 2HQFA 3IBFB 3KFWX 3N79A 2W4CA 1NM2A 4CDIA 4EO8A 4O23A 4ED7A 1NKCA 2VF3A 1AZSB 4LBIA 4ZIVA 2WONB 1BWEA 2PI5A 3UE2A 2VQEJ 3IRXB 1IR1A 4HVZA 4M5NA 2P9GA 2DBBA 2H65B 2HBZB 1NNDA 2PMHA 3GZ7A 4DL0C 5KOXA 3CCJS 1XMQF 4MMOA 1X60A 2HVZA 2VFSA 3JTOA 4AQYJ 3R97A 3M6UA 2XZTB 1WHWA 1AT1B 3MECA 1Q8KA 2DB1A 2QLFB 4HHJA 2M70A 2NXCA 5F0WA 5EX3A 3IA0A 4C8NA 4WTOB 1H2UX 1VBKA 3A8KA 5T7LA 3L95X 3I9V9 4NLPA 2EEYA 2J7WA 2W9BA 1UKUA 2YXLA 2MJUA 2R7UA 1P8GA 4Y2IA 2AD9A 1IBKJ 4DN9A 3NOGA 2AYGA 1AUDA 4IH6A 3Q83A 1JLEB 5JUMA 2DRDA 1OY9A 3OXFA 2MZQA 3A8IA 1CULB 3ZZ0A 3T5JA 4ECZA 5BR8J 3DXBA 2R8JA 4LF4J 4CTAA 3DOMA 1S7HA 3VAMA 3JQKA 5IT9Y 4CH1A 4RW4B 5KG1A 5F9LA 4FF1A 2EK6A 4G3IA 5ETRA 2I2YA 1T3OA 4X4NA 1IKVB 2IAJB 1FKPB 1T11A 4RUAA 1RTDA 3SSQA 1YRTA 3MPVA 3HULA 3W8PA 2ZNYA 2ATCB 1RHUB 4EYIB 4JI7F 3CDBA 1RK8A 3UDEA 3EGZA 4A47A 3BDPA 1R8CA 1L3KA 1TVRB 4LT6A 2E1MC 2MLYA 2CNKB 4H4OA 5ETQA 6FDRA 1HHSA 2YKQA 4DR5J 3N6MA 2XG8A 4WZMA 2EBEA 4HHUA 4RWXA 1U1KA 3U1NA 3VR1A 2V2KA 1LK5A 3IAS9 2ROGA 1K0VA 2HWHA 2B4VA 1F3VA 1VBYA 2BV3A 2I5JB 2CPFA 4ZP7A 2MKKA 1JJHA 2RAQA 3BKFA 3A12A 3KLVA 4A8SA 2J6SA 1BC6A 4ZCLA 1IR0A 1U1QA 3C66A 5A76A 1O51A 3Q8VA 3BSCA 4KRWA 4KE5A 1RAAB 2LA4A 2WB4A 4LRBA 1MROA 3D7SB 4RW4A 4PR6A 1AFJA 4PKDB 5SZTA 1DLOB 4MFBA 1SIZA 4C0HA 4ED0A 3A13A 5LL6d 2GMHA 4DL3A 1JKHB 3PG9A 1T7PA 3RUBL 4A48A 2AKWB 1HBNA 1RT4B 3HMJG 1HNVB 2AYMA 2DYAA 2H9ZA 1S1XB 3KUGA 2J7UA 2MEWA 5F9NA 2QA4S 3SYZA 2W2MP 4ED6A 1OPIA 4QW9A 2CJKA 1B64A 4BC7A 2Q6BA 4A8QA 2QO3A 2G9OA 1FKOB 1WC3A 4ID5B 3PACA 2G2YA 2RQKA 4P71A 2XULA 5J2QA 2QC3A 1E6VB 3AB2B 2XMWA 3KG4A 4P2MA 2KFYA 1VCTA 2B43A 1CBKA 2HHPA 4LVNP 3ZNJ1 5KG6A 2O1PA 1AZSA 1TP7A 2QYGA 1BE4A 4IG0A 2NS1B 2MKIA 4UF4A 3VAGA 1GXLA 2HRTA 1TL3A 4Y2AA 1UJ5A 4IFYB 3H42A 3NRBA 3PXGa 2DPJA 4F3MA 2IPOB 3OTOF 1OPZA 3OV7A 4TLQA 2K3IA 3W9JA 2VG5B 2OEKA 2X1FA 3BGOP 2P2CB 1K44A 2V8VA 4NCBA 5FJ4A 1GMWD 4YDXA 2DIUA 5J2PB 4JV5F 4LSNB 5DRKA 2XMTA 3EMTA 4Q45A 2KG0A 3CVKA 1MNEA 2HFZA 2GC8A 1GFWB 3C15A 3PM9A 2FDNA 2BE2B 4G65A 1YWXA 2KXHA 2HQGA 4KO0A 2BE2A 4WTYA 4A8OA 2FZGB 2MQQA 3G96A 2XY7A 1T8EA 3LH2S 2H1YA 4DS5A 1YJUA 3W5XA 3PX4A 1FFWB 1JXEA 2MGZB 4Z7YA 3OVAA 2EPIA 1LEOA 5EWFA 2DGVA 1RTHA 2GAHC 3BQ1A 2V2VA 3RBXA 2R2UA 4J9RA 2BANA 1RTJB 1UW9A 2Q79A 3GSIA 3EM1A 4DU7A 5KTQA 2Y1JA 1Q8BA 1S1WA 2YPYA 3GCXP 4RW9A 4ES1A 3MAHA 1PJ5A 4ZVSB 2LMIA 4DV6F 2MY7A 3AOAA 1WI6A 3PTWA 4RNOA 2D3ZA 1KQKA 1S79A 3CC7S 3D66A 1DARA 2PFFB 4ALZA 1OSCA 5KOWA 3RYLA 1ZZNA 2HRUA 3RBDA 5LJ5Y 3NWGA 4CLYA 4C3MA 2RKIB 5HBMB 4HT7A 3HT3A 2OUGA 1QUVA 3MZIA 4QZVB 4FVMA 3J7Z5 3R5AA 2GCFA 2QL5B 3I31A 3W2VB 2XWYA 1V5VA 2V8DA 4LF1A 2Y3YA 1WWHA 3C19A 3PIPQ 2CRLA 2JJ4D 2GMJA 3TVZA 2OO4A 1VI7A 3CCTA 2XMKA 2IRYA 1NPRA 1H3DA 3K89A 1GXTA 3PKYA 1RT3B 1VHIA 4B02A 3PR5B 2HVIA 3VV2B 1FD8A 5DZ7A 5KT6A 4NA2A 4J9LA 2VG5A 5EWEA 5K5MA 2HLUA 4HACA 1M5PC 1ZOTA 2GHWA 1FFSB 2A6MA 2H5JB 1QAXA 3BZQA 4TU7A 3EPIA 2C3MA 1YRUA 2ZBPA 3RRKA 3P49B 4D3HA 1F3FA 1WDTA 2AW0A 3RW7A 1BD6A 4HHHA 2RU3A 4JYAF 3C16B 2H3EB 5BR8F 2YNFB 4J9KA 3VZIA 3JSYA 3OD2A 4LSZB 3CUNA 2HHQA 2FY8A 5LSOA 2LQJA 2KXFA 5KFDA 1EX8A 1RT2A 5KFNA 3IR7B 4IQMA 2UVRA 1NDCA 3ISZA 2K8GA 2X7IA 1PJ6A 2GVDB 1RU2A 1TL4A 1WF0A 2XTJP 4KAIA 1U02A 4DZDA 5D6GA 1NK6A 3MURP 4JI5F 2AJ0A 3LOUA 1LOUA 3DYAB 3RZAA 5JMNA 3J80Y 3H5SA 4ZS6A 4DV3J 4ED1A 4PXDA 2HQCA 4EUVA 2AT1B 3QBCA 5L1LA 1S4EA 3BPSP 3SFUA 3UN5A 4J9MA 1RA7A 3DI6B 1XWLA 3FCVA 3I5CA 3DOKB 3MM9A 3THTA 4AFFA 1HPZA 2AJ1A 2R3VA 4NI2A 3T3FA 3NMRA 1VBZA 2UXDJ 2RS8A 1IKYA 2DNYA 3T19A 3UCGA 1Q82T 4ILLA 3Q2SC 3BSAA 1IKXA 1EHWA 3FSYA 3LALA 1B4SA 1MMNA 1NEEA 3QYYA 4IG3B 4CLZA 1S77D 1YSJA 4OHZA 4DR5F 1P27B 2BJ7A 3CJ0A 1RTZA 2HQDA 1TL1B 2NUHA 2XMVA 3I87A 4F0KA 1U1OA 2ZC4A 4QIFA 3P96A 2QG9B 1AUSL 3QIPA 4C4WA 1F5BA 4O4GA 1AXQA 4KFBB 1HHQA
chains in the Genus database with same CATH topology
3ZZRA 1IN0A 2YKNA 3D0HE 4YMEA 4EYHB 2XI3A 3I96A 2W9BB 4IYQA 1E6VA 4ZPAA 1TKXA 4PG6A 2HQ3A 4IH5A 2XMJA 1FJ7A 1IQTA 1H6KX 2AV5A 1P1TA 4OJ3A 2IYGA 1OS5A 1YQHA 3E2EA 2C42A 2M88A 4CTAB 1NB7A 2HGMA 2VFTA 2FB0A 4IKAA 2KT3A 3TARA 1K8AT 3H5XA 3CD5A 1FE4A 3H98A 3AA9A 3MEGA 3PX6A 1RTIA 3NS5A 5DETA 2MHEA 1IKXB 2DNOA 3HHKA 1B7FA 1XNRF 2YWKA 1TL1A 3MCSA 2J6TA 2FC8A 2H5EA 1REVA 5GAHI 1KVIA 3MGJA 4M95A 4DQRA 2XC9A 2Z4PA 4WXWA 2KG1A 3M2RB 3CJKA 4DF4A 1FXLA 2O66A 4ZVGA 2MQNA 2JFDA 4I68A 1D9DA 2DHGA 2M5YA 2MSSA 5T7LB 3QJPA 3F41A 2WSEC 3GSDA 5EHHA 2B4OA 4QWDA 4C8MA 5AE3A 4YFUA 2W7AA 4K5SA 2QEXS 2K2PA 1FRLA 2IBKA 1YJRA 2DHXA 3CCES 3V4IA 3HJFA 7FDRA 3NP5A 4PQUA 4EWTA 1X4DA 4JI8F 4MIBA 4TYBA 2E44A 5CZVA 5IQQA 3SCJE 2XCAA 1GH8A 3ENWA 2J6UA 2KRBA 3DCAA 4DR7F 1OWXA 2PN6A 4QYRA 4J37A 4WJBA 1VRTA 1S0VA 3IWXA 1BQNB 5G4DA 2R8IA 5KFTA 2OLWA 5IXUA 2ZE2A 1XNQF 2CPIA 2XMUA 1DBDA 3V2UC 1D9FA 2OD4A 1N5QA 4UW2A 5D77A 5LMUF 4ZCKA 1IKWA 2KJWA 3RB3A 1RT3A 2VOOA 4ZHRA 4MKYA 3I32A 5A0YB 4DLEA 3PW5A 3PRDA 3RR7A 2XLIA 4NLRA 3DMJB 1RT7B 1S9EA 3U02A 1BGXT 4X84A 2MQOA 1NHUA 4ZCIA 3J7YU 1N56A 4M94A 1C0UA 2ZBCA 2M9KA 4A4JA 1VK8A 2ZDOA 3KKFA 4BHQA 3SZ2A 2BM1A 4F3OA 3G6XA 2KJVA 1SV5B 3KK2B 4MAKA 1ZAXA 2XI2A 2VH7A 4DSIA 4GO5X 4I2QA 1SJRA 1HHTP 1JJ2R 4CZCA 5F3TA 2M2BA 3QZ8A 1GT8A 4X2BA 1OO0B 2XY6A 4TU8A 5HL7Q 1N5VA 5T41A 2DNRA 1XERA 1DTQB 2BBEA 2C22A 3MDFA 2XHWA 5LMNF 1HBMA 2I0XA 1M5OC 2JLFA 3JYTB 3JSMA 1RT1A 3H8YA 4KIAA 4BDPA 4K4VA 5IT0A 2HAIA 1PC5A 1JIHA 4ZPCA 1KOHA 2E5IA 4P7TA 4ZVFA 3SSRA 3VAHA 3KLIA 1ZPVA 3HI9A 4OJGA 1HW8A 2IYIA 4UUWA 4OHYA 1RWUA 5DQHA 1F60B 2CJQA 2OSRA 1RT6A 5DLFA 1S9EB 3CJ2A 4ERDA 3K8WA 1KHVA 4YB5A 3HLUA 4C3KA 3ENQA 5D4PA 3QLHB 5D4NA 2GX8A 3M30B 5DDQC 4ZP6A 4M5DA 2B0GA 4CO2A 2JVRA 4CH0S 1SH3A 1U24A 2RQCA 4DSKA 4L6V3 3LW5C 3WC2A 3ZZPA 2W9AA 2YNGB 2BQRA 2DCUB 3AAWB 2YH1A 1GX6A 2J9DA 4OMFG 1DLOA 2ZUGA 3U7JA 4YY3F 5EWGA 5J2NB 1HFEL 3OQ2A 4XDCA 1E6YA 1N88A 2QMXA 2IMOA 2E5LF 1JNRB 3N5BA 4A8KA 3RB4A 4PG4A 2GNKA 4NPOA 1VQOS 1B0PA 5J1EB 1RT5A 4A8YA 2E29A 3OXLA 2L41A 5AE1A 2UP1A 3HHLB 3FNNA 2M52A 1HYSA 1GX5A 4IG0B 5IM0A 4QR2A 2DNGA 4AYBD 2GGPA 3SDEA 1CVJA 4I6YA 1FDAA 3QIDA 4IFYA 2J9DE 1YJVA 4LF4F 2KT2A 5B0BA 1S9GA 3DRRA 4N5SA 1S9GB 1I6JA 5A6WA 4B9LA 3CTRA 1HWIA 4WFYA 4WXOA 2RRBA 3SFGA 2WBMA 4EO8A 2M8DB 1M5HA 3QO9A 3FMWA 1JLCA 2O67A 1RTHB 4DUZF 4IG3A 3OTBA 3GQCA 2W7OA 1SJ1A 2N3LA 5F0UA 5LXRA 3VAFA 2RQMA 1NK7A 1FJEB 2K1RA 4HI2A 2R2RA 4KT0C 4U7CA 3TOQA 2JC0A 2LQ9A 4PQAA 2VPXB 4ZPTR 4JI2F 4F50A 3M6VA 2GHVC 2LXIA 2Q43A 4P7VA 4ZHRB 1JLQA 4ECTA 2HYIB 4QU7A 1NK8A 3RAMA 1QAIA 3DYAA 1A6LA 2VG7B 4MK7A 3R3TA 4DLGA 2KM8B 3DRSB 3CJ5A 4O3RA 4WU2A 2KZMA 3A1YG 5KFHA 2NSBA 3K2YA 1WHYA 1C1BA 5CHCB 3OTDA 2MZ1A 1S0MA 1LXNA 2CVEA 3M6WA 2M8HA 3NG8A 1K1SA 4YEAA 2QA4G 3D0IE 1UJ6A 4C8KA 1R27B 2HHSA 4O4RA 4YUDA 1MU2B 1YJNS 4WU3A 1NJWA 1HWLA 3QPIA 2FHOB 2HWTA 3OVSA 4X62F 1N8RT 2XSJA 5E3RA 1NAQA 3H2LA 5B0DA 4ZK7M 2WAQD 1S1UA 4TQSA 3BR8A 4OZ0A 4ETXA 4DR6F 3MR2A 1HBMB 5I3PA 3GV8B 2J0QD 2CQHA 3BGLA 3MM7A 2KI2A 3ZZYA 4YOEA 3EXYA 4HEA9 1TZ0A 1PGZA 4X65F 3NMAA 1E6YB 5KFOA 3OHAA 2ASYA 3AQPA 2DGTA 1N5TA 4OFZA 3WC0A 4ELVA 5A8KB 2AF6A 1X9WA 4RUCA 4O3QA 4Z37A 1R43A 3CCSS 2VA3A 2I8EA 4N56A 4WF9Q 4M8LA 1X4EA 3DOKA 3THVA 4EBCA 4DQSA 1KTVA 2B51A 1S9FA 1YVFA 1FT8A 5CYMB 2MMYA 3HHLA 3RR8A 4ZA1A 5DG9A 3U27A 2W8KA 3BO2A 1IBKF 2WONA 2PC6A 2QIFA 3PDNA 3RB6A 1O5JA 2RQ4A 2CQ4A 5H9FJ 3RAQA 3W7BA 3R5CA 2JH3A 1VFJA 3WZ0A 3I6PA 1SJFA 4DUYF 3LQVA 4NLXA 2XO7A 4OI3A 3IS9B 3RRHA 2B7CB 4MKBA 1P6TA 1RAJA 2RDIA 3KLEB 2P9EA 3VQTA 3ITHB 1U1MA 1M90T 2V5HG 3DRXA 1HNIB 4J9PA 2GHPA 2L08A 5KT2A 5AXNA 3MMBA 3DLJA 2ZJQQ 2CKWA 4OX7A 3M8PB 1Y5LB 5DO2A 3C6UA 3LF0A 1S6QB 3KG1A 1IQZA 2KB2A 3UI3A 4XPCA 2E9ZA 3MEDB 2W9CB 2R4FA 3KWMA 2CPYA 1F5AA 4IO1A 4DN0A 3TX8A 1X9MA 3W3SA 5HO4A 2IA0A 4TKTA 2VKRA 2MDAA 1M5KC 3KYLA 3SQGB 1S1WB 3OL7A 5J2MB 3G71S 1FNOA 4FS1A 1SL0A 2VUGA 3UD3P 5A2QY 1WHXA 3IR6B 4X66F 1DTQA 4GO7X 2F1FA 1SUQB 1YG0A 5LJ3Y 3MXHP 1WACA 1KN6A 2RKIA 4DS4A 1MWZA 3OR1A 4OV1A 1SJ4P 3JSMB 2FJXA 1VIXA 4OJ1A 5FD1A 1D3WA 5AXMA 2VODA 1XR7A 4U7UK 4HH0A 1EETB 2DNZA 1NK4A 5FLXY 1GQEA 2V4JA 3HHEA 3FJ2A 3X1LB 4ZPVR 1QUPA 3M2UA 3PEJA 1Y00A 4PRFA 5CYQA 2EG1A 2Z2LA 3GFHA 3M05A 3MEDA 4PWUA 2W9CA 1J5OB 1KRPA 2P9CA 5B0GA 2XS5A 4OI0A 5HN0A 1S1UB 3CDWA 2HRYA 5DS7A 2DISA 2FJVA 2F9JA 3OTCA 3MI7X 2C2RA 5EUHA 3V6DA 4MFBB 4LQ3A 3S6EA 2CQPA 5H1SV 3DOLA 4NLTA 2FLNA 2E9RX 3POTA 5KFAA 4MK9A 4LF9F 1RP5A 1S1XA 1XTZA 2ZC3A 1IKWB 5CZXA 3K58A 5HBMA 1T94A 1KC8T 1FRJA 5HROB 3CMAS 2OJ3A 2VL1A 2KZZA 2R7SA 2DJWA 1U49A 2CVIA 4CH7A 3NL0A 1BQNA 3GG0A 2B4UA 3MR3A 3VCDA 3CIZA 4G1PA 5B0EA 3D2WA 3UW1A 3N0VA 3FEXB 1NJIT 3OR2A 4B9MA 2LKZA 2RSQA 1RISA 3MM6A 3HM9A 3O8WA 4OZJA 5M2RA 2POKA 5L39A 3M1VB 4Y0FA 1ELOA 5A8WA 4ELUA 4DMZA 4FXWA 1IM4A 1JJ4A 2HNYA 1MROB 4K4UA 3PFOA 4C8ZA 4WKYA 2CPDA 1M5SA 2MZRA 2ZH5A 2X1BA 2ZZMA 1HARA 2MPUA 2RE1A 1C4AA 3R27A 2Y0SD 5E33A 2DHSA 2NPIA 3LO3A 1VBXA 4X4PA 3M2RA 4Q8EA 1VS3A 5CD4H 1LWEB 3WX4A 4G1IA 5J1PA 3GYXB 1H0HB 1I1GA 2MZJA 2Q6CA 4DL7A 3C8YA 1SJ3P 3LAMA 4ZVEA 2B4PA 1W2BR 2HLTA 3G6VA 2ILZA 2ZH2A 4QBUA 4WZQA 4F25A 4DFPA 1Y5IB 2OPPB 2WSCC 1R0AA 1UMJA 5AXKA 1VQYA 2UUTA 2V0NA 2IMWP 1X0PA 1X4AA 2ADBA 4OZLA 5KFPA 2RDJA 2HZCA 1HD1A 1FKPA 5LT5A 3NAHA 2KO1A 5CH7B 3CCUS 4FF3A 3IRWP 1HI0P 1JX4A 2KYZA 4TN2A 4DV0F 4KFBA 3NKYA 2CFXA 3HVTB 4LQ9A 1N32F 4ZPBA 3HDSA 4E98A 2OPRB 2NREA 4IOBA 1HMVB 3IG1A 4CO3A 1QTMA 2K7KA 4Z2XA 5KT5A 2DITA 3UWTA 1K1QA 1LWFB 3OLAA 1N6QA 1FXDA 3GIIA 2ASLA 3DLHA 4IUFA 1G2EA 4NYPA 3K5MA 5KFYA 3IAM9 3FDSA 2MJNA 1LFWA 4I6WA 7FD1A 4H4MB 5A8RB 5C42B 5I4MA 1LFPA 2JL9A 3T9ZA 2Z2MA 3SV3A 2KHCA 3MEEA 4PUOA 4NZ0A 3Q8SB 2M4MA 4V19X 4RW7B 2RNEA 5J1EA 3KLIB 3M8RA 4I7FA 1XMOF 3PR4A 2CQBA 1TAQA 1FDNA 2O5DA 1FKAF 4OI1A 4MH8A 2HGNA 3QO9B 5IM0B 4UOCA 1HYSB 1S1TB 1RT1B 4R25A 4QPTA 1R8AA 3GFXA 5KFUA 3I5BA 4ETZA 1FDBA 2UZAA 5KFCA 4K4XA 2UXBF 3DRRB 1C0TA 1S6QA 4RNHA 5JJBA 3DLKB 3KJVB 1F5CA 2YQ3A 4NLOA 2Q1LA 4Q8FA 4ED5A 2J7KA 2FUG9 5B08A 3DRPA 2EC0A 2KT5A 1HNIA 2CPZA 3JSRA 3MUVP 1VC6A 2F8EX 2BANB 3TAMA 3RTVA 1ROFA 1VC0A 3CPWR 3MF5A 1Q53A 1ZM3A 5F8NA 3LWLA 2OIHA 3Q2TC 1HNVA 2CQDA 2AYBA 2UVVA 2B9WA 2QZ8A 2DR8A 1RDRA 1SXLA 2XLJA 2JSXA 3CGIA 1KFDA 3G8QA 2A2DA 2X3GA 1FCAA 3MMAA 3Q23A 2YNGA 1NU4A 3CCQS 5CYMA 2AWZA 1RA6A 1S6UA 2ABYA 1FA0A 3FQKA 5E7OB 4LUBA 4NZ7A 1R3NA 1SH2A 3SXLA 1ZH5A 5KFZA 2R7VA 1LKZA 3E8OA 2E66A 5B0CA 1C0TB 2JLGA 2DPIA 3PZPA 3FSIA 1WG4A 4HT5A 5GAGU 2XCPA 1VMBA 3CSKA 1KQGB 1CQMA 2YWGA 4AQYF 4NMLA 4FXVA 3KLEA 5SUHA 3G8TA 3LP1A 2VPYB 3ZZZA 2YWHA 5DGBA 2HIQA 5DDPC 2YVSA 4H4OB 4I2QB 3C6TA 2FVRA 1AW0A 4ZMMA 3EGNA 2DNHA 3S1TA 4HYKA 4QW8A 4RX6A 4AXIA 3PVXA 4FXDA 1OSDA 4DFKA 2MYFA 2OPSB 2YNHA 1N6QB 2UV8G 2LLZA 1XEZA 3IWNC 4NLVA 1FNXH 1IBMF 3B4DA 4X4RA 3C46A 2FIUA 2VQFF 5F41A 2BXJA 2DR7A 3LP0A 3OJSA 2XGQA 1KEKA 2UVWA 4LMZA 1BLUA 1UWBA 4R0EA 2LQBA 1HBOB 4WE1B 4JV2A 2VBZA 1ZAWA 4L72B 4RWWA 1QVGR 5BJRA 1WNEA 4XAKA 3GR1A 2G4BA 3NS6A 5D4OA 3H5UA 4I69A 1C2PA 1N48A 3K8VA 3TI0A 3TAPA 2DR9A 2OH2A 4MKAA 3WDOA 3CIMA 2VBWA 3PJXA 5L9XA 5DM6Q 3BO4A 3NNHA 5KFJA 2FC9A 3FRZA 1SH0A 3QGHA 3CCVS 2NQPA 4F67A 5LXYA 1VLYA 4UY85 2HS0A 4B3RF 1MMLA 1U2FA 4LIRA 1KFSA 3K0JA 2DNMA 2L9WA 3Q8PB 4DWIA 2RS2A 2KHDA 1UEVA 1KQFB 5B0FA 3FFIA 3TVKA 2JZ5A 3MOJB 2UUWA 3MOZA 3MUTP 2UUAF 1VRTB 4XO0A 4CT8A 3H2UB 3CO9A 4Y34A 1UFWA 1XMBA 4HDHA 4ZLPA 2LDIA 4BWMA 1F2GA 3V4MA 4AUKA 1FRKA 2D9PA 5F3ZA 1PC4A 1WTBA 1U2RA 2E1CA 4I67A 5KG7A 3D1HA 5HROA 2BVZA 5GAGI 1NK9A 1EP4A 4PXCA 4FBUA 3Q8QB 4A8WA 3EZUA 1JLAB 3WBZA 5IWAF 2V4QA 3M8SA 1DJ0A 3R5DA 1UFLA 2G0CA 5B7WA 3DN9A 2E7WA 4W92B 2ZM6F 2ZOMA 3D5MA 1REVB 5EDWA 1X5TA 5EN1A 4URQU 4KHMA 3OVBA 4DV4F 2KFNA 4OQJA 1U6FA 2IRUA 1HL6A 1XBWA 1X4BA 2ILYA 4KPYA 3X3UA 2J8AA 2JOQA 3L09A 4ED8A 3HZEA 1NRKA 5KFWA 1URRA 1JLBA 2DNNA 1HW9A 2MSTA 4H4KC 1M1KT 3TO8A 2D3UA 2UXCF 3TUIC 4IOCQ 3T1AA 2QRRA 2EFVA 2RU9A 1TFYA 3MPYA 2NYIA 1HNXF 5KFIA