1CQNA

Protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords RIBOSOMAL PROTEIN S6
publication title Designed protein tetramer zipped together with a hydrophobic Alzheimer homology: a structural clue to amyloid assembly.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 24
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1cqnA00
4NXMF 2UXDF 4GKJF 4JV5F 4X66F 1F60B 1IBKF 2YY3A 1IJFB 3OTOF 4JI5F 4DR7F 2UXBF 2E5LF 4B3RF 4X64F 4DV2F 2VQFF 2VQEF 2KJWA 2F4VF 4X62F 2UUAF 4JI2F 2UUBF 4DV1F 2HHHF 4LF9F 4YY3F 1HNWF 2BXJA 4DUZF 4B3TF 4DUYF 2UXCF 4DV4F 2UUCF 4LF4F 1N32F 1GH8A 1XNQF 3T1YF 1QJHA 4JI7F 2B7BB 4DR4F 4NXNF 4K0KF 4LF5F 1J5EF 1RISA 1I94F 5LMUF 4LFCF 2B7CB 4DR5F 2UU9F 4DV0F 1B64A 4LF6F 1XMQF 3R3TA 1G7CB 4JI0F 1IJEB 4DV7F 4DR6F 4DV6F 4DR3F 4GKKF 1HNZF 5BR8F 4LFBF 2RJZA 5AJ3F 1IBLF 1FKAF 5IWAF 4JI3F 1LOUA 4YHHF 1HR0F 4JI6F 4LF8F 4X65F 4JI8F 1N33F 4JI1F 4DR1F 1N34F 1N36F 1HNXF 4JI4F 4KHPF 4B3SF 1FJGF 4DV5F 1G1XA 5LMNF 3ZZPA 4DV3F 2KJVA 2ZM6F 4B3MF 1CQMA 4AQYF 1VMBA 4LF7F 4OX9F 1IBMF 4DR2F 4LFAF 3T1HF 1XMOF 2J5AA 1CQNA 1XNRF 4JYAF 2BVZA
chains in the Genus database with same CATH superfamily
4K2XA 4WIIA 4QIGA 5DG7A 4GO5X 4JV0A 4OX7A 1VDHA 2ZBIA 4A8YA 3TJ8A 2C2NA 4Q8FA 3KK1A 4F02A 4ZKAA 1U6BA 2IHR1 4PWUA 2JHEA 4K0KF 3CVKA 4OZNA 4IR1A 3T9NA 1FNXH 5IT9Y 1Y5IB 3ADAC 4AXJA 1AYEA 4IG0B 3V6JA 1ZH5A 4ERDA 5MLCV 4F3QA 3OUYA 2IVFB 5KOXA 2K2PA 1DJ0A 3M1VA 1NK8A 2FIUA 4QWBA 3R5JB 4E0DA 1VISA 1OIAA 4ED4A 2FD2A 2MSTA 4LFAF 2W25A 3N6NA 1KQGB 3BH6B 3DM2B 2F3JA 2C28A 1UFKA 2JEIA 2JLGA 5AT1B 2HFUA 1UWBA 2HHPA 2GMLA 2DGSA 4USIA 1JJ4A 3CJ5A 3WBZA 3LP1A 2YKPA 5FDLB 1M1KT 2BE2A 4I68A 5KT4A 2G4BA 4X4NA 3MR2A 2MGZA 1APSA 2PN6A 3KG0A 2RRBA 4DL3A 3DI6B 1YHQS 1NZ8A 3I0SA 2I38A 4KTQA 3DOMB 1S1WA 2DYAA 1NDCA 1H3DA 4YP3A 1RLDA 2D1CA 4ED5A 2R7WA 2IDEA 4RBUA 4YMEA 2DISA 1D8ZA 1OY8A 3LW5C 4H4MB 1KC8T 3OHAA 1F9EB 1R31A 4ZHRB 3CJRA 2FGCA 2PFDA 1K0VA 1PO6A 4F7VA 2QJ3A 3S6EA 3NL0A 1CQMA 3MUTP 2JJ4D 1WACA 3T1HF 2JEJA 4ZVHA 1C0UA 3MM6A 5F9NA 1CJUA 1QAJA 4NXMF 2CPXA 4OV6A 3PACA 1QD1A 1U24A 1OY6A 2HKEA 2CQ4A 2OELA 1UAWA 5A0YA 4P71A 2XS7A 1FX4A 4ID8A 3F56A 2B5JB 2CPJA 3ELHA 2EPIA 1UVIA 1RT4B 5KFPA 3I0RB 3V6HA 5A2QU 3UI3A 5I42B 5D3GA 4QYZJ 4M5LA 1K1QA 3DNCA 2MYFA 4MIAA 4K4UA 2PDAA 3PKYA 1TKXA 4PQAA 1RSCA 2KRBA 3ISZA 2PA8D 4UW2A 4TYBA 3NGDA 3JSMB 1RBAA 1FJEB 3OXGA 2RNEA 4UQTA 2Y0SD 4G3IA 3I96A 3W1YC 1I3OB 3ILLA 2R7RA 4A8OA 4ZVQB 1S9EA 3CJ3A 1B4SA 2XC9A 2NSBA 4JP8A 1LQ9A 4DQPA 3IG1B 1UVNA 2VJUA 1R43A 4GO7X 1YJNS 1RTJB 2HHSA 1HA1A 2J5AA 4A8KA 4YDDB 2Y8YA 2XHCA 3D66A 4HHUA 4LF9J 1S79A 2RB7A 1KOOA 3MAAA 5E3AA 4NCBA 2XZWA 2QSFA 3OR2A 2WONA 1I6JA 1ZAWA 3TAMB 1SXLA 3OJUA 3MXHP 2VC1A 4DV1J 1RTHB 4QR2A 5E3PA 2CPYA 1N0UA 3GJQB 1ACMB 4YS2A 1OQ6A 1S7HA 4KRWA 2CQIA 4NA2A 2H51B 4ZPCA 5HSPA 2JX2A 3FQLA 2XYGB 2NXUA 4M5DA 4IQMA 4L72B 4DR3F 3JXOA 2GGPA 1NJXA 2XQCA 3EJMA 3VAHA 3GIRA 1W2IA 1T03B 2XMMA 1K44A 3MHYA 2ATLA 3M2UA 4J5OA 3D1HA 4C2MA 4N8NA 2ZEJA 1HD1A 1G1XA 4WFXA 4RX6A 4ED0A 1GAOA 1NKBA 2ZNYA 4YFUA 3DKDA 1KLNA 4DZDA 4QWCA 3T5HA 4PG5A 3M9OB 2JVRA 3D0IE 4OZ2A 2UXDF 4NLGA 2EKYA 3LPEA 2VL1A 1XIQA 5I3QA 4F4AA 1RYSA 4J9RA 3CJKA 4DX6A 2G0IA 4URSA 3NS5A 2E9ZA 1FK9A 3T1AA 3KJVA 1EZZB 2YNGB 3V6DA 3I55S 2AGPA 3KHRA 4QOTA 4L3NA 4J7CA 3MM8B 1TK5A 3F73A 3L7PA 2Q3PA 2VFUA 2DNZA 3HZGA 1KD1T 2LQ8A 2VG5B 1VHIA 2BRLA 2QMWA 2DNHA 3UPFA 2A1BA 3SYZA 2VC0A 2VD3A 4O23A 2ZZNA 3ZTQA 2L9NA 3HVTA 1RI7A 1IBLF 3CGIA 4K4ZA 4ZIVA 5GMDA 2XO7A 1BQNA 1NK0A 1SV5A 3FRYA 2GZOA 1QE1A 1H74A 2XMVA 3Q23A 2HHXA 2YWHA 1S77D 2AJ0A 1C4CA 3OTOJ 2M88A 2E5HA 4Q7AA 1L3VA 1G6BA 1IBMJ 1F1BB 3TUPA 4MT1A 3FSXA 4RKUC 4ZITA 3MPWA 2QFIA 5ETPA 4H4OA 1TFWA 1RYRA 2K1RA 3K7RA 3KLHA 4IFYB 2QE5A 4M5JA 2B9EA 2VPWB 1SC3B 2DXFA 4M8LA 1HQEB 2CUYA 2UUBJ 2Z2ZA 1HI1A 1NHUA 1T7PA 2QFJA 1OPIA 3B6BA 3BSCA 1CJVA 4H54A 2Z58B 3NGUA 8RUCA 5DDQC 4IRKA 4ICLA 1IKYA 1N6QA 4CLWA 4O3PA 2CG4A 2C2ZB 1VQOS 2IJFA 2EEYA 1Q8BA 3FFIB 3FBCA 2Q43A 3AD8C 5SZTA 3CCWA 4Y00A 3L7UA 2GS8A 1FJGF 2OPPA 5B08A 5F8JA 4W4MA 3BYRA 2OPSA 1UWBB 4RNMA 4Q2LA 3VR1A 1P9YA 2C3YA 2HBRB 3LP1B 4NLDA 2DCUB 4KGKA 3JSRA 1R6YA 2WSFC 3JSBA 1S9FA 2MDAA 3LPYA 2I5JA 1EQMA 2JZ5A 4N41A 2DY1A 1TMJA 1M5PC 4U8VA 2IYIA 4WKYA 3WC2A 3EVOA 2ZITA 2AX0A 1S1WB 1YIJS 2FJVA 4DSEA 3B4MA 1SH0A 1TTHB 1WORA 3LP2B 1I94J 3PYEA 1WDDA 1PIEA 2B7CB 3G8TA 1MMNA 5IQ6A 1K8AT 1H38A 3TA1A 1ZA2B 3PZPA 5D4NA 3GV7B 5B0GA 2EBEA 2ZM6J 3RAMA 3MUVP 1NSPA 3W9JA 5G4DA 3FCVA 3ZTPA 5HK4A 1S57A 3RRKA 2D41A 4UOHA 3BEGB 5RUBA 4K5SA 4DR1J 2BE7D 2VPYB 2VA2A 3C8YA 3Q8YA 2OD6A 3RB0A 3HF5A 2IM3A 3PKMA 1JLFA 4FYWB 3Q22A 3SDEA 5A0YB 2QIFA 1T94A 5DGBA 2BABA 3DFEA 1F60B 1S6PA 2YY3A 4O3NA 5HN0A 2JFDA 4F25A 5B7WA 3T1YJ 4F8RA 2NXNA 2YNFA 4DX7A 5D3GB 2MJUA 2VB6A 3LWMA 4KV8A 4X62J 1GMUA 5J2NA 1Q86T 3OD2A 3HDSA 2J0SD 3KG4A 3PX4A 3H5UA 3UN3A 4EI2A 4AE5A 5JVHQ 1YJVA 1VIXA 1P8GA 2IY5B 3C15B 4KT0C 2FHMA 2HQ3A 3D9BA 2P8IA 4OIXA 2CNOB 4F4XA 1S9EB 2AGQA 5T7LB 3QO9A 1FD2A 1QVGR 1SC6A 2YKNB 4YB5A 3UDEA 1L5UA 3Q2SC 3IAM9 1K1SA 2V8DA 4LSNB 3TVKA 3R5DA 1NK6A 3TRGA 3KLIB 1UVLA 2YWWA 1VRQC 3DC2A 2RE1A 2CQ2A 1JX4A 5AXNA 1GMVA 3HHLC 4N8OA 1C1BA 3OR2B 1FRHA 2WONB 1DY3A 2JC0A 1RU2A 3FVYA 3TR5A 2MQPA 1KSPA 2FVRA 5HVGA 4Q0BB 4JV5F 1VK8A 5I4MA 3T6BA 4OZ3A 1FKOB 4ECRA 4RNFA 1HL6A 2RMLA 3P96A 2ZBPA 1Y0HA 4LF9F 3G6VA 4M5DB 1NNDA 5KFIA 4DCOB 3ETOA 1XNQJ 2GGPB 3KYLA 2B8QA 2MQQA 2E1PA 3DGPB 2XCAA 4QJVA 4O4RA 4AL6A 3W2WA 3M2UB 5E41A 2WW8A 1PILA 2FZCB 4IDKA 3U27A 3PX6A 1X0FA 3BM7A 3EGWB 4FKXA 4E2FB 2RJZA 4DS5A 5GAEI 1FKAF 4R8UA 4TU8A 3AOAA 4DOZA 2BV3A 3PNIA 4C8ZA 5KFTA 3KKFA 3M6XA 2HAFA 3ENQA 2Y1JA 2J7UA 3UQSA 1PYOB 3NGSA 3Q86A 4OLPA 2ASYA 2RVJA 3V6DB 2RT3A 5EHHA 1FTRA 2GV1A 4DUZJ 3GCXP 5GMEA 2HEKA 1RHMB 2DT9A 2LDIA 3KLFA 3TP2A 1M1GA 2VFTA 1R0AB 3GFXA 1TR0A 4HT7A 3E01A 1OMSA 1VYAA 3OV7A 2IDLA 2LP4A 3MOJB 2HZAA 4ECSA 2HHQA 2RDJA 1Q4RA 1PJ6A 1IVZA 3IBCB 1YJRA 1V6HA 5J2MA 3OR1A 1S1TA 1RCXB 4A8QA 1B64A 3W9HA 5E33A 5KG3A 2E1MC 3WHIA 1VK3A 2BJDA 1FXLA 1JNZB 3AA8A 3D0GE 3FBEA 1HNZF 1RWKB 4B3MJ 3DLJA 2N3LA 3C19A 2CQ1A 4QWAA 3OFHA 5KG7A 5B0DA 1HR0J 3UCZP 3TUZC 2W01A 4P7VA 1MMLA 2ADBA 3AA9A 4QQBA 4IH7A 1UETA 4C9DA 2DHXA 1UJ5A 2OH2A 4OX6A 2E5JA 4DN9A 2CJKA 2MSSA 4ED8A 4XK8C 3CCTA 3IWXA 4F0KA 5CCMA 3D3CJ 3KLHB 1SJFA 3KXDA 4ZLNA 2HS0A 8ATCB 4KHRA 1IM4A 3OTOF 1SH3A 2CNKB 2XSJA 5JXSA 2HFSA 3B78A 2W9BA 2DPJA 2EWHA 4XDDA 2VBYA 2XEXA 3C2PA 2IPOB 4OJHA 1NPPA 3H20A 5DZ6A 3IR7B 1X9SA 4DV4J 4ICLB 2AYBA 5T14A 3SSQA 3M30A 5AJ3J 4YDXA 1FKPB 3PY8A 1V5VA 2EI5A 4ZPAA 4OYBA 2OPPB 3NP5A 4DV7J 4DI6A 4V1Ak 5LM7E 1Y00A 2R7OA 2E1CA 1DBDA 1S12A 2VUGA 1GK8A 5LSOA 2GIFA 3DHXA 4WK3A 4ID5B 4OHZA 4B9VA 1H98A 1AFIA 1PC4A 3NWGA 1KLMB 4WZMA 3IBWA 3MTJA 1EIYB 2W1BA 2BACA 3ZZZA 3P5TL 1A9NB 1HPZB 1PYSB 4PUOA 3TANA 1FESA 4CH0S 2DGVA 3HJVA 4UY85 4A8WA 2VQFJ 2HK3A 4M5MA 4NEZA 4I7FA 2EVZA 1XN9A 1UFLA 4FF4A 2XY7A 5JUMA 1KR4A 4DLEA 1SC4B 1Q8IA 3KFWX 1SH2A 1EX8A 1U47A 3RR7A 2F9DA 1S0OA 4DHVA 4NXNJ 2OEJA 1VRTA 1VQ5S 3K59A 2FHJA 4EZ6A 3O8WA 6FDRA 5F8HA 2KU7A 1KNZA 3P5BP 3C16A 1P1TA 1YSJA 4LIWA 4FYVB 1LFPA 1U0SA 2PMHA 2XM3A 4OI2A 3Q8QB 2W7AA 4B3SF 1RABB 4MH8A 1NMEB 3O1LA 3T6JA 1D9DA 1X8DA 1YBUA 2ZM6F 4PPDA 4PPZA 2GJIA 4XDCA 3W63A 2W4PA 2HQDA 1Q79A 3W5ZA 1WC5A 4F4ZA 2HMIB 2RQ4A 3RBDA 2FJXA 3ZZUA 4M5NA 3VAIA 3MUMP 1ZS6A 1OWXA 2JRSA 5LXRA 1PG5B 1DURA 2UU9J 1FWKA 3VAJA 3K2YA 4DQIA 4DUYF 3FMBA 3DYAA 4QW9A 1I1GA 1IKVB 3T1YF 4HI2A 1O6XA 1RJJA 4P73A 3TJAA 2V4QA 2BZ2A 2CA9A 2UP1A 4DR6F 1SL2A 2HAIA 3ISNC 4HH1A 4UQGA 2VOOA 3RYLA 1UJ6A 4K4WA 3JAMY 4ATNA 3U1NA 4JV2A 2Z57B 4RZRA 2DRBA 2AMCB 4EBCA 3O5TB 3CD0A 4ZDNA 4PWDA 1YKWA 4NLOA 2FZGB 3LAKA 1HKAA 1VC0A 4ZLJA 2HZCA 1J27A 4Y34A 2E44A 4JYAJ 1T9YA 3QAUA 3DXSX 2XLKA 3GIIA 3I31A 2KVQE 3JTNA 3ISND 5J2QB 3UFCX 2DKOB 3AXKA 2WSCC 2PIIA 3AB2B 2HG4A 1HBOB 3NKYA 3QSYB 2BXJA 2VG7B 2JC1A 1JLCB 2QLXA 1WF0A 3C6TA 3LGMA 1CBKA 4CM2A 5U47A 1S7IA 3VAGA 3D5MA 2A2CA 5LMUF 2KI2A 1N34J 2DGXA 3GE9A 1PGZA 2OTJS 3NBPB 5I3UB 2MLYA 2ZZMA 1EP4A 2HWTA 6FD1A 3X1LB 2HHUA 3AB4B 1DZ5A 3GJTB 3LH2S 3W64A 3MPDA 3HLUA 2ZDOA 3H5YA 3NMRA 2M9KA 1AB8A 3K8VA 5JJBA 1RTZA 4DFKA 2CG8A 2NCKL 3KLFB 3L09A 2MQMA 2XBPA 1WKJA 5KFLA 4UZCA 1RK8A 1G2EA 2UVRA 5K8PA 3IXQA 4QU7A 3ZXWA 1OSDA 4MKBA 3MR5A 1LWEA 4MYTA 3GILA 4JOUA 2RF2A 1WHVA 2WSEC 5J2MB 5HP1A 2MQLA 4HTJA 4KPYA 1KFSA 5F8LA 2WHOA 3H2VE 4DUZF 3CCVS 2AJFE 5DQGA 2PGCA 1GH8A 4EBEA 2CZ4A 2Z30B 2C2MB 1X5SA 3MMBB 3KJQB 3J7YI 4CO2A 3CDWA 4Z2XA 4PXCA 2H4YB 3ETMA 2V4RA 3DRSB 2LEBA 5K5MA 3V4IB 5KT2A 1SQEA 4YOEA 3K5PA 4NI2B 4IKAA 2KXNB 4KO0B 2B6AA 4AYBD 4RBTA 2COLA 1FDBA 3DMJA 4C8NA 3W60A 1DLOA 4ZJOA 1N56A 4PEOA 4RL1A 3KK3B 4B3MF 2Q1LA 2RQKA 2PT0A 5CD4A 3DDKA 2W9BB 3MEKA 3R6LB 1YK9A 2J0QD 4CTAB 1Y9OA 2P2CB 1WKLA 1K47A 1KHVA 4GKJJ 4CO0A 1F5AA 1O5JA 4J9UE 3H25A 2ZH2A 3PYFA 4DPYA 1TL7B 1WG5A 3PTWA 2HBQB 1PBAA 4JI2F 1SQGA 3MMAB 3G4SS 3CCJS 1JLGB 4A8XA 3K5OA 1WELA 2XZDB 2UUCJ 4HL9A 3D2WA 4I64A 5KFAA 1EETA 4ANEA 4PCQA 3SQGB 2V67A 1QAXA 5GAGI 2V34A 3SSRA 3I4HX 1M5HA 1JLAA 4NZ6A 2PD1A 4H4KC 1SIWB 4N47A 5L39A 3D6HB 4QR1A 2VIHA 3OTDA 3VAKA 1U6ZA 3NEKA 2DNNA 1PJ5A 5AJ3F 3A13A 2Y8WA 4BWMA 3D67A 1EQ0A 4V19J 1JLBA 1SJ4P 2OGUA 2PE8A 4EEYA 4ILMA 3QQCD 2NZCA 5B0FA 2DH7A 3BBCA 4OYMA 1NCLA 2VFSA 5ADZA 3HHLB 1TKTA 2DXEA 2DNKA 1Q7YT 2BA9A 1BC6A 2AEMA 2DGQA 4F04B 2QEXS 3QBCA 4WFZA 3TEHB 4FXVA 4NCGB 2HW3A 4PQUB 3POTA 4LRCA 2MKYA 3ET6A 5KFBA 4NLWA 4N76A 2IVMA 4NL5A 2VKRA 1VRTB 1V9OA 1YQHA 3WIUA 2PI5A 2BYCA 4WYLA 2FGOA 4LR9A 4ES3A 1FHTA 2UXCF 4USTA 3A8JA 4ECYA 2X1BA 2OPQA 2DNQA 4ECXA 1R7IA 1KVKA 2V9WA 3C16B 3ENAA 1T8EA 3TOQA 3SQOP 3OL7A 3P8BB 4KGMA 3THPA 1VI7A 1RAEB 1WD6A 4FBUA 3J7AN 1OYDA 1QAYA 2MZ1A 1EAYC 2FHKA 1CJTA 4JI6F 5HANA 4FYXB 3PIOQ 2EK6A 5H9EJ 4RO0A 3KHLA 1HHSA 2H1YA 4ZA1A 3UD5A 1X4BA 2L08A 1O8BA 3KNGA 2N7CA 4FNHA 1VQLS 4HH0A 2KHCA 2YPYA 3CMES 2GVZA 1XNRJ 2M5YA 1JLEA 1KBRA 3BR8A 2HVEA 4NZ7A 3DYAB 2DH8A 4EUVA 4GRSA 3AD7C 4ZJQA 4IYQA 4OJGA 1X4HA 3GMGA 3RB4A 4OZLA 3D0HE 7FD1A 3FSIA 5FLXU 2FLLA 2XCPA 1IR2A 3RAXA 2XWXA 1NRKA 3P45B 1HQUB 3QAEA 3VQTA 3CF5Q 1N48A 3KDOA 2OSQA 4Y2IA 2RS8A 2UU9F 3QJLA 3W7BA 2R8HA 1M5OC 4O44A 4PWDB 2G13A 4QYRA 5K8OA 4LF8J 3HSZA 1TL3A 3EICA 4RW8B 4QWDA 2BX6A 3TZWA 1ZYQA 3WX8A 2GCFA 1FXDA 4TY8A 5B0EA 1N52B 3AJ1A 4X84A 3AODA 5D0GA 3ENVA 2MKCA 3MDFA 1WJ9A 1DTQB 3TAPA 3C6TB 3D28A 1XEZA 3W2VA 3P3DA 3K58A 4DV2J 1NB7A 4ZVEA 1HBNB 1NH8A 5KFJA 4LJMA 3KNAA 3FEYB 2BANA 1VJWA 4KBIA 2WTFA 3W66A 3EVMA 2B51A 3HI9A 2B7BB 1TELA 2G2ZA 3S1TA 2UVWA 2MZQA 3QT5A 3BDPA 1TU0B 3QMQA 2HFNA 3J80Y 2FJDB 1OPZA 3HK2A 4WFYA 3MMCA 4I2PA 3LOUA 6AT1B 4U6PA 2FLOA 9ATCB 1U0HA 3CD7A 3HT3A 1TAQA 3T5LA 5CD4H 2Y0BB 2CIMA 4JI3J 1IM6A 3DOLA 3BO3A 1N34F 3OJSA 2D74B 3VGTA 1S1XA 2A2DA 3NMAA 1LWEB 4R0EA 2ZE2A 5KFXA 2RUGA 3TZYA 4PR6A 2RF2B 4OX9F 1AZSB 2YNIB 4AL7A 1KP6A 2P9EA 1IR1A 2OTLS 1GX5A 1V5IB 4ZJLA 1XTZA 3DLEA 4HT5A 5K8NA 2K7JA 4DR7F 1N5TA 4ZP6A 5ETKA 5BYRA 5KT7A 3MR6A 1RWNB 3IS9A 3MR7A 4CWBA 1S48A 4G1QA 4W92B 1QY7A 5SUHA 2KB2A 1IKXA 2SXLA 4NLRA 1N32J 1SJ3P 3K5LA 3QZ7A 2C3OA 4GMKA 1ZETA 4ZVSB 3DMJB 3HULA 3GLJA 1F9FA 2DHSA 2EK1A 1YITS 3K8WA 4DV6J 5BR8J 1BXNA 4O0IA 1HWLA 4J9QA 1LWFB 3R6GB 4L75A 3GFYA 1J2VA 2OMLA 1RCOB 4JI4J 1Q0NA 1RT5A 4ECTA 1OQ3A 3CJ0A 2J7KA 2XS5A 4YB7A 2VG6A 1MMDA 1YJUA 1H7XA 1WC4A 2CZ9A 3GG1A 1FA0A 3H42A 2Q66A 4X66F 1IN0A 1VQ4S 5A8KA 4CZCA 3HSDA 1RAHB 2CKWA 2CVIA 4LMZA 3MCOA 4X64J 4O4GB 9RUBA 1NDLA 4FDFA 1JXVA 2I6WA 1S0VA 4LR8A 4NLXA 2AW0A 3KWMA 5DLFA 2DNPA 4ECQA 1F2HA 2FHOB 2HGMA 4J9OA 1H2UX 1XMQF 4LSZB 5IXUA 2CPIA 2W2PP 4ZPWR 4F3MA 5IS2A 4C8KA 1RB0A 2DRDA 1ICEB 3N28A 4CLKA 1ZM3A 2E29A 5EN1A 2B4PA 2GJFA 1RUSA 4WXWA 1TKTB 3UN5A 5DLGA 1C0TA 1AW0A 4DV5F 4K4VA 1Z2LA 2WBRA 4F26A 4ECZA 3ZZPA 3J81j 2MB0B 2MY7A 1Q78A 2H3EB 4LBHA 1CQNA 1WEXA 4I56A 3QLHB 3IRXB 3IC1A 3GIMA 1UZHA 2OPQB 2ZOGA 3ITHA 5CYMA 1F5CA 3DU6A 2DR6A 1XMBA 2F8HA 5HVHA 4V19X 5CXTA 1VQMS 3AJDA 4K5RA 3DLKB 2X51A 2CPDA 3DRRB 2HHHF 1HNWF 1FRMA 1RT3A 2JEGA 5HBMA 3KG1A 3LANA 3SCKE 2KHDA 1NJWA 3QIPB 4MIWA 1CJTB 3C66A 2H48B 2JEFA 2WW4A 2OPRA 1DAXA 2AJ1A 2PC6A 1S72S 3ZTRA 2R2SA 5LT5A 2MKKA 4ZCKA 4YR3A 2MZTA 2GVZB 3R2DJ 5FD1A 3G2XA 1JLEB 2IM0A 2IA0A 1TZ0A 5B0BA 4DR2J 3MCMA 3PW0A 4XTTA 1ELOA 3PG9A 1JJCB 1ROFA 3LGHA 2BJ1A 1SJRA 2YBVA 1RWUA 1VBXA 3GJRB 3IR5B 4C3KA 1OO0B 3R5CA 3HVAA 2OEKA 3D7SB 5B0AA 1FDDA 4MJKA 4B3TF 3EE3A 1OJ4A 3MMJA 2DH9A 4O44B 2APOA 4Y3CA 5D4OA 3QGPA 4C3MA 4A4JA 2V69A 1WI6A 2PA3A 4NCAA 1NK5A 4IG0A 3ZZOA 4CNYA 1G7CB 4O0NA 2MLZA 1T3NA 3NS6A 3TEGA 2R2RA 2R8KA 4DSFA 2J9EA 2RDIA 4CLTA 3EUNA 4UY8T 3ONQA 5HROB 2LXUA 4PAAA 2BE9B 5ETSA 1CLFA 4YHHF 4TN2A 2ZFHA 2ILYA 2MMYA 1IR0A 3MM7A 2XNRA 5EWEA 3CULA 4DN0A 5LMNF 1Q53A 2FVPA 4EYIB 4DV3J 2DO0A 2XI3A 2HVZA 4LF7J 3PXGa 3H5XA 4OYOA 3DM2A 1TV6B 4YY3J 2Q79A 4CLLA 1IBKF 2NXJA 4KGVB 3PHTA 3R5GA 3JTOA 2G0JA 1SBRA 4NLQA 1PAEX 2XO6A 4K50A 2R8JA 1F0XA 2KJWA 4U7CA 5FDLA 1SJ1A 2V5HG 5AXLA 3V81B 4DS4A 3BJYA 1FDAA 4DSJA 1JQGA 3TARA 3MMCB 1H73A 3A4TA 2EC0A 4B9UA 7FDRA 4WFNQ 1MROA 2BKOA 1RISA 3DI6A 2DHAA 2KYXA 1U7LA 3HT0A 4B3OA 2Y3YA 3W8PA 3DOMA 5DDPC 3SMZA 2DIUA 5CZXA 4LREA 2ZE2B 3R7NB 5A6PA 2L3MA 3CIZA 4OZ0A 5L9XA 4ZHRA 2XB2D 4L6V3 4KB7A 2VPZB 4U95A 3DLEB 4UZBA 4W90B 1FE0A 4ZOSA 3PW2A 2R7SA 2QGFB 4BC9A 4ZPDA 3W5XA 2YPZA 3S01A 4OQJA 4QW8A 2ZH8A 2C3PA 1IKXB 1XJWB 2WZ1A 2XI2A 2UXBJ 4ANDA 4B3RJ 4HI1A 3CJSA 3UD4P 1B7FA 5EX3A 2X1GA 5KG4A 2NQPA 2B5JA 2B4OA 4CO1A 4ED3A 2HWIA 4I6YA 1RT4A 5IV4A 3CCZA 3VGSA 2W24A 3I0RA 2J9DA 3HKZD 4OHWA 4GVLA 1QJHA 5I42A 3M2RB 4WTOB 2E7WA 1SL1A 4YB6A 1X5OA 2MLXA 2WVCA 3PX0A 3FUYA 3MAHA 1T0TV 5E7OB 3JSMA 5K9FA 2X1AA 3GJSB 4U7UD 1BD6A 1PYTA 2CQDA 4PG4A 1VR6A 5HMZA 1RT5B 3IBFB 5KFQA 4LFBF 5CH7B 2ERRA 5J2PA 2I2YA 2EC2A 2WVBA 1TL1A 1O0PA 1VBYA 1N36F 1NO8A 1WC3A 3IG1A 2FJWA 1BGXT 1ULRA 4OZ5A 4J91A 5A8KB 4OHYA 1VC6A 2ZWPA 5K14B 1RTJA 1CVJA 2VQEJ 3MURP 4MYUA 1KTQA 3N4WA 3OLBA 2W2QP 1F3FA 4ZLLA 1U1KA 3CCLS 3KUHA 1NAQA 3DRPA 1B70B 2LCWA 1R0CB 1KONA 1W25A 2VDHA 5KFGA 3Q8RB 1VQPS 3R2CJ 1RU1A 4B9SA 1UPMB 5KFKA 1RTHA 3NGKA 4CIOA 4X4SA 3QGIA 5HJYA 1H7WA 2F9JA 1RE1B 3D4JA 3GV8B 4TY9A 4DG1B 3W9IA 2R7XA 3WIVA 3HHKA 4KGXB 1VRUB 2BJEA 2Z56B 3HKWA 4KE5A 3HX9A 1T03A 3VCDA 1LOUA 5EWFA 3TNVA 2NREA 4JI8J 3IWLA 2LKZA 4FZVA 1D0EA 4GVBB 3R8YA 5M2RA 1UJ4A 4MKVA 1ZAXA 3SFUA 3QFWA 4AUKA 4LVNP 1VBKA 5LJ3Y 3HFKA 4J37A 4KQZA 2DGTA 1NDPA 3MPUB 4DJBA 3CD6S 1YZ6A 2DEJA 1FEHA 2YNGA 2HVDA 2G1HA 1UVKA 1RAIB 1FFWB 3M4XA 4RNHA 4UUXA 1B0VA 1RAAB 2RKIA 3MM8A 2QL7B 4KFBA 1KHWA 2HQIA 3C6UA 2VG5A 2RRNA 1WOSA 3BGRB 1E6YA 2ZHAA 2V2KA 4BLGA 3S8SA 3QWPA 2EFNA 3MM9B 5DDRC 4JI0J 4BCAA 3M8RA 4A8MP 3GYXB 1IKWB 4OYZA 4CLZA 1FCAA 1ZOTA 3E2EA 4FNIA 2Z2LA 5C5JA 3Q89A 1FFGB 3W61A 3PCOB 1OSCA 4ZVOB 2H54B 1X60A 2Z0GA 3H5SA 4FPRA 4W98A 4ZVUB 2WVFA 3Q8VA 1WC0A 2H5EA 2W2OP 2GHWA 3PR4A 1IWAA 4ALZA 1WDTA 4IFYA 3WC0A 1HQEA 3L95X 4WPAA 4S0MA 4DEZA 1AA1B 5LSRA 4CDIA 3PVXA 5J1PA 4LSLB 3Q83A 3W62A 4LFCF 2XMWA 2DY9A 2AP6A 2VV5A 3MM7B 3R3TA 4PXBA 2N3OA 4IOAQ 1REVB 1UTAA 3M9NB 3ZNUA 3FFIA 2NUHA 2DEIA 1VQ9S 3DRXA 1VQ8S 4TVAB 2CPHA 2IJNA 3UR0A 1U26A 4YEAA 1Y10A 5C2GA 3RJMB 2R3VA 2DNYA 2GMJA 5EDWA 3LTOA 2L9DA 3M7VA 3GFHA 1D9AA 2J7WA 1BY9A 2GX8A 2GQ2A 3JYTB 1JK9B 1UWAA 1SL0A 2KKHA 1NK4A 1XMOJ 2YH0A 5F8MA 2CQPA 2V50A 4RW4B 5KFRA 4OHVA 2W9CB 4J9NA 3NOGA 4OYWA 2MPUA 1MROB 3KTQA 1Q95G 1SKSA 1Y11A 1C4AA 4UUWA 2Z2MA 1NJZA 4B3OB 2W2MP 2YX7A 4YY3F 2G2YA 1IXKA 2O66A 3LP0B 5G0RB 4ZN1A 1X5TA 1U1MA 2B9YA 4LF4J 4G1PA 3HCXA 4NLVA 2BQRA 1DRZA 3LP2A 3RU0A 4DL7A 4MKYA 5EX0A 2MTLA 1S6UA 2CAJA 3M8SA 4PRFA 1X4CA 5IWAF 1HBUB 4WFBQ 2GW8A 3IGNA 3THVA 2KXFA 2RDDA 2AV5A 4KH1B 2HLTA 3WZ0A 2GC8A 5L46A 3R1HA 5ETNA 3J7ZT 3I32A 4O3SA 2RD5C 4AL5A 2FY1A 1WOPA 4CNZA 4ANCA 4CT9A 1CEZA 1IUJA 3W65A 3LQVA 4NLUA 5H9EK 5KT5A 1IQZA 1S9GB 4K4SA 1KFDA 2UUAF 1MG7A 2CRLA 3M8PB 2ALZA 2ZH5A 2E7XA 2HVIA 3R27A 1UL3A 3IP0A 2F63A 2R2TA 4ZLPA 3N0VA 3C15A 1XR7A 4Q43A 5ETQA 3CMQA 5J2PB 1YBAA 1TL1B 1GQEA 2J8SA 2ZBRA 5T7LA 2V4JB 1XR5A 2YKNA 3K5MA 3ZO7A 3LA0A 3A3PB 2PFFB 3TI0A 1NHVA 5HQ8A 3V2UC 3KHHA 3DLBA 4LSNA 4X65F 4KAIA 2NYIA 3T41A 1RTIA 3KLIA 5GVQA 3DRPB 2AJ2A 5IQQA 1D9FA 3QJPA 2KJVA 3IAS9 2DXDA 1GEHA 2UZAA 3QATA 4K2JA 1F6TA 4DF8A 3ZZ0A 2QL5B 3CCMS 3V4MA 2J0WA 3AFGA 4Q0BA 2MQ8A 1DTTA 3U1LA 1FKOA 1JJHA 3LALA 2RHQB 2VQEF 5EUHA 3T9ZA 1NBEB 5C24B 3J81Y 4X4PA 3A8IA 4ECVA 1DQ9A 1FNMA 3UDLA 5DDOC 1X4DA 1JMTA 3DGPA 5D8HB 3FGVA 2D3ZA 2OHDA 2DNRA 2ILZA 3QT8A 4DR5J 2GIRA 3G82A 2EW9A 4L3KA 4DPOA 3I6PA 3N79A 1LKZA 2P9GA 2XZTB 1FRLA 1NSQA 5IV3A 2BJ8A 4NLTA 1GXTA 3QWUA 2C2EA 4Y2KA 2J0XA 1LWXA 3IRWP 2CNNB 1TKDA 3MD1A 3CJQA 4KSEB 2MKIA 1FRXA 3UO0A 4DQRA 1LK7A 2QA4S 5L9NA 5GADI 4PYDA 2VBXA 1U45A 3TVZA 2QTWA 2JSXA 2RKIB 1RT6B 3X3UA 4KFBB 3PJXA 1R0AA 2F4VF 3C6UB 1WG1A 3JQMA 5HVFA 5H9FK 1E6YB 1HQ2A 1UCNA 1YJWS 3EGNA 4A48A 1RTDA 2V0NA 2XY5A 3FBBA 5AE1A 5DRKA 4OLOA 2AYGA 4FVMA 2BMBA 2KFZA 3NGRA 2NPFA 3SBMA 2RS2A 1MLAA 5LSLA 1IWGA 5T41A 5L1LA 1M5SA 4WKRA 4AD6A 3AOBA 3FEXB 2NR0A 2FQQB 2HSEB 1GFWB 1N33F 3VV2B 3NLCA 2V2ZA 4CLSA 3F0NA 3MCNA 3MAQA 1NUEA 5DJBA 1NDKA 4AQYJ 1HBMB 1S59A 5KT6A 3HSGA 2B3TB 4L74A 1Q7LB 2AT1B 3G8QA 8AT1B 2PO4A 3BH7B 1ZM9A 3G86A 4IG3B 3MEEB 3LGNA 1PSDA 4DFPA 3MCSA 2RAQA 4CH1A 5KG0A 1U4BA 1NPRA 3DOKA 5D78A 4P74A 5DQHA 4P9SA 3SCIE 1ZBTA 1UZDA 1U02A 2NLWA 1HNVB 2JFKA 2FZKB 1QLNA 3CNQP 1VC5A 1FKPA 2KG1A 4K0KJ 3IWNC 5IT9U 4UF4A 2RSQA 3TO8A 3LAMA 1YZ7A 2QG9B 3OL9A 3BZQA 1U49A 5LOQA 4ID5A 3OFGA 3CJTA 2AYMA 3B54A 1WSRA 1KLMA 2LA4A 3PHEA 3D6MB 4IQXA 4EU0A 1WC6A 2DJWA 2DRAA 5J1EB 5KFWA 3NNAA 4LFAJ 5C42A 1NSAA 5K20B 4AFFA 2NXEA 5IT4A 4MK8A 1KRPA 1VBZA 1HPZA 4WYWA 3CJ4A 2DNMA 2RH3A 1DQ8A 1ZPWX 4M1KA 3DU5A 4F0HA 1WNEA 1M5VC 4NRTA 1B7YB 3HJFA 4WWSA 4RUAA 3LWLA 4ED7A 1HYSB 3T5JA 4IRDA 1X4EA 1JWWA 1NH7A 1QUVA 2KYZA 2YWGA 3CCES 1YJ9S 1NHKL 1S4FA 4P75A 1E6VB 3KDNA 1QTMA 3GIKA 1MWQA 1B99A 2LU2A 4ZPBA 3E8OA 3MI7X 2DGUA 1FT8A 3THTA 1Z4UA 2HBZB 2VASA 3E51A 4ZCMA 4IO9Q 4CT8A 3V5RA 3OVSA 4F36A 3PYGA 1YJTA 4KGZB 4DF4A 4NZ0A 2L41A 5HLFB 4TQSA 3MTKA 1SC1B 3UE2A 4LRAA 1HIYA 5KFMA 5L38A 3G8SA 4C4WA 3T1HJ 2XNQA 1C2PA 3BBFA 5F0UA 4EFAC 4B17A 4IH5A 1O51A 2HMIA 2ACYA 2CFXA 4NXMJ 1K9MT 1NK9A 1BE4A 3CJ2A 2QV6A 1B0TA 5L1KA 5J1NA 4WTYA 5HMWA 2ZHBA 4BWJA 5F8NA 2OIHA 1VQ6S 5D15A 2R42A 1IKVA 5A2QY 3HHNB 2K7KA 1RACB 1U1RA 4F4KA 3UCUP 2BOAA 2Z8QA 3N5FA 2H5IB 4PABA 3VQSA 1FJ7A 1WF1A 5HQLA 4X4OA 4CO4A 1VGYA 2CADA 1YRXA 5F3TA 1BQMB 1MU2B 1RTIB 3A12A 2MY8A 3M8QB 1IJEB 4X2BA 4XPCA 1T95A 1Y3KA 3TVYA 3KLGB 4I6AA 4ZVRB 3PO5A 4OYIA 2Z2YB 2AEJA 1Q8KA 2FJAB 1GX6A 1DTTB 1WEZA 1AUDA 1T05B 3TW0A 2FPHX 4DFMA 1T3OA 3A3NB 3MWBA 1RAOA 2W8LA 3CXCR 1WSVA 2EG2A 2ZDPA 2U2FA 2CQGA 2IMWP 2HQCA 3ZFVA 2A6OA 3CO9A 3MOZA 4URQU 1JLQB 3AY0A 1P9QC 4B9MA 5J2QA 3TQ1A 1TMMA 2QSWA 4CRJA 1HBOA 3MM5B 1Z2ZA 2VG7A 3EM1A 4DV1F 1JLCA 1BWVA 4F0MA 3R5BA 3G82B 1Y7PA 3VHQA 4LQ3A 2ZD1B 3D3BJ 3FQKA 1S6QA 2HNDB 1RAGB 4A8SA 5CAAA 2L9WA 4ZPVR 2MXYA 1ZM2A 3JB9k 3BBBA 3O44A 1FEEA 2MEWA 4WK1A 4LRBA 4DX8H 5KG1A 3NBPA 5I3UA 3SV3A 5HI7A 4DR3J 4C0OC 3I4PA 2PSZA 2WOMB 1U1OA 4KKOB 1CG2A 3Q8PB 1FVSA 4ED2A 1QUPA 4JBCA 1NEEA 2WB1D 1N5YB 3HFZB 2X3GA 2UV8G 2VOPA 5ETLA 3OVBA 3WQPA 5CA5A 4ES1A 3QZ8A 2CQ3A 4BHQA 2M8HA 2D7SA 5JMNA 4KR0B 4AXIA 1UVJA 4RW7A 2OKQA 4FF3A 2GFFA 2D9PA 4LRFA 1RTDB 2UXDJ 4TNOA 1Q1KA 3H7HB 4AT1B 2ZH4A 2WB4A 1J5OA 1I51B 4G6VB 2IJRA 2BJ9A 1WTFA 2YNHB 5I3PA 2GO9A 2GO8A 3MMBA 2GHPA 2JLFA 2IYGA 3CW2C 2ZHOA 4C8OA 3DRSA 4USJC 1MN9A 2Q6BA 3V4IA 4K4TA 4KY3A 3TWZA 2MQOA 4NI2A 2DTJA 4J9VA 4KO0A 1IBLJ 3OTEA 2JOQA 2AJQA 3R9LA 1JXLA 2XWYA 5CQGA 4OV1A 2P6SA 1WI8A 4JB8B 1VQSA 1ZPVA 2LEAA 1ZZFA 4C8MA 3KK3A 3M32B 1FE4A 1IBMF 5CCLA 3W3SA 3SIPB 2DPIA 1NLKL 3DOKB 4CTAA 1T9TA 1Q82T 2AZ3A 1XBWA 2NPIA 3FZ2A 3RR8A 4DPWA 2LEPA 4DU8A 1RGVA 1RT7B 4JI7J 2B4VA 1TL7A 4DR4J 1TL4A 3MMAA 1JLGA 4DPTA 3J7YU 2JLEA 2NUUG 3VGUA 2UUBF 2F5GA 3NGTA 2M0GB 2XMJA 3PR5B 3AHPA 4NA1A 4HR2A 1VJQA 2GIQA 3OXLA 3EGZA 4MTPA 3VF0B 3SQGA 4PYAA 3UVJB 4OFZA 1T11A 1RHQB 3CC7S 3KHGA 1VOMA 4YR0A 1HW9A 1SVDA 2YH1A 1FERA 2GVDB 2LXIA 2V8PA 4M5HA 2CJAA 5ETTA 5HJXA 5D4LA 5C42B 4F2SA 2OAUA 2ZJRQ 1FJGJ 2KH9A 1LW2A 4FXWA 3HHLA 3EDRB 1A6LA 2KDOA 4K8RA 2B0GA 3G6ES 4NCGA 3ZC4A 5D0RA 4PQUA 4QU6A 2HNZA 3QFHA 2QC3A 3AQPA 2GAGC 2DGWA 1RWMB 3ZTSA 3U02A 2QA1A 5GAGU 2BKNA 5DETA 3PYDA 4RW9A 4DPUA 4C11B 2FTRA 2A6MA 4BDPA 4J9LA 2DR9A 2IMOA 3HVRA 3K5NA 3U1MA 1K0TA 1Z1ZA 1A7GE 4X4RA 2F8MA 4FF2A 1I94F 3QNWB 2WVEA 5B09A 4RPFA 3QSIA 3JSYA 1Q5VA 3D1OA 1CJKA 1TVRA 1RT1B 4ZIWA 2HFZA 2OI2A 2YXLA 4C3LA 5DQIA 4ELUA 1GMWA 5KFUA 2O1PA 3RB3A 3TAQA 4ILLA 1VCTA 1RDRA 4P2FA 2DNLA 1MSWD 2BBEA 3BREA 2X7IA 4WJBA 4DR1F 3IM8A 1KKHA 1AROP 4RUHA 4WBFA 4I4BA 4DSKA 3FK4A 1T02A 2CZVC 1LNQA 3PRVA 2V8VA 2IBKA 4R0JA 3ILIA 1RWVB 4YN3B 1URNA 4CLYA 2OO4A 5KG6A 4M5GA 3EGVA 3HD1A 2RQCA 2ZNZA 1WKKA 3NOCA 4LVOP 5A8RB 3TQEA 1FRIA 4X62F 2C3MA 3K17A 1FVQA 3NRBA 2IC3B 3Q0AA 4I2QB 1RWWB 1S1VB 2C2RA 2F1FA 1HQUA 2QLJB 5E5NA 3R7SB 1FRJA 2CJYB 2MHNA 2B9XA 5KFDA 3L4BC 2IRYA 3N6LA 1GTHA 4EZ9A 5CYJA 2HS3A 3TZZA 1RQ0A 4K4YA 1X7VA 1CULA 3RRHA 1TUGB 1R3NA 4ZP9A 1HWUA 2UUWA 4RW8A 4Z7CA 2IRXA 2HWHA 4WE1B 1WWHA 2XMTA 2IVYA 2DNGA 2ABYA 1IQTA 2YWEA 1S5ZA 2YQ3A 3H40A 1DTQA 4JV5J 3GTYX 1S6QB 3I5BA 3I9V9 2HNYB 3PDNA 2YKAA 4DFJA 1HBNA 2A10A 1SIZA 4RLEA 1JB0C 4ETZA 3UWTA 2LXFA 2FLNA 2ZVSA 3VAFA 1HMVB 4OZ1A 1N88A 2BQ3A 2F40A 1ZM4A 1XNQF 1PCAA 3PIPQ 3EX7B 1KQSR 1HWIA 1HHQA 1KWMA 5DO2A 2ZWOA 4G1IA 2K8GA 2LYVA 4TU9A 4ZCLA 2E5GA 4Y2MA 4IH6A 1FO1A 4MIBA 3RZAA 1KDNA 2KFNA 4OI4A 2PEBA 4FN5A 4RW7B 1RBOB 4ITSA 2HZVA 2DHGA 1CC7A 3CT9A 1LK5A 3DLGA 3E3XA 2R8GA 1AZSA 2QZ8A 4DBQA 2YNIA 2B56A 4XIUA 5KTQA 2VA3A 2Z4PA 1J5OB 2H5JB 5BXIA 4MAKA 5FJ4A 2W2NP 2EFPA 3KK2B 4RWWA 4CH7A 3H4DA 3OL8A 3MD3A 3J7A1 4A46A 2BRKA 3EZOA 4LF5J 3C14B 1T9WA 2CPFA 2KL8A 2M3DA 1SCJB 1U6FA 2HQFA 2QN6B 4J9PA 3RBXA 2NYHA 3D1QA 4HTIA 3MFIA 4C8YA 3HPOA 1FX2A 1ZTTA 1QSLA 1EKRA 4XO0A 1M5KC 1N5QA 1HNZJ 4B02A 2ALYB 1HR0F 1LWFA 1ZA1B 1FJCA 2XTJP 2KT2A 2LU1A 3KUGA 1R8AA 2O01C 1WF2A 1VQKS 2F8EX 2RU9A 2BR0A 2ROPA 4NPOA 4C48A 4KHMA 4CI0B 1HNIA 1JNRB 2WAQD 2R7UA 1LW0B 2CJ9A 1M1HA 4HVZA 1CS4A 2DBBA 4R5PA 2KTQA 4ZK7M 3Q8UA 4O4GA 2WVDA 3FNNA 2HYIB 2D3O1 2Y1LB 3CSKA 3VAMA 3OPKA 2MHEA 3AQOA 4P2MA 4DV4F 3KK1B 2C2KB 3PJWA 1FRKA 2GHVC 1B0PA 4JI7F 2ZZTA 2ZH7A 4DR4F 3D68A 2QA4G 2O67A 4JUZA 2ATCB 3BGOP 3AD9C 3SFGA 2AU0A 4ZPTR 3UNGC 4DV7F 2FDNA 1UP1A 1R89A 2VONA 4OYPA 2HVHA 1LW2B 3OUYB 1XERA 4WF9Q 2ZOMA 3M1VB 3VZHA 4UOGA 2EFVA 3AXMA 2A3JA 4KIAA 2HNZB 4IOCQ 1YVFA 3ZNJ1 4CM0A 3EZUA 1TL5A 2DVIA 1NJYA 5IC4B 2VODA 3M8WA 3QRQA 4I1TA 4RW9B 3QLHA 4MKAA 2C2OB 3IRXA 1N8RT 1EKSA 5F3ZA 2VQFF 2PMZD 3DLKA 2DK2A 4EBDA 1RAFB 3DRRA 2X3DA 4ELVA 3EXYA 2CDQA 2KRRA 2BE2B 4NLYA 1CJKB 1TVRB 3CE8A 5HATA 4KH0B 1NJIT 5EGYA 3FKBA 4WIQA 2KT5A 3QIPA 3TX0A 3CCRS 1YTYA 3H2LA 4NXNF 2MGZB 1NK7A 1V3SA 2DIVA 4LR7A 3KUEA 1N0VC 3I0SB 1LXJA 1V3ZA 1YRTA 4Q2MA 2HHVA 3MEDA 2R7QA 3DDIA 1T9UA 2UVUA 3BDEA 3RRGA 1RT2A 3T3FA 4PG8A 4NRUA 3A1YG 1SUQA 4B3SJ 1Q81T 4CCHA 1T9XA 2CJQA 3G96A 4JI5J 4NLSA 3PW4A 1VQ7S 1P27B 2LQ9A 2RIJA 2CJXB 3GSIA 1RHRB 2R7VA 1GNKA 1C0UB 3MM6B 2W7PA 1CJUB 4FVCA 3SCLE 2YWFA 3BKTA 1IJFB 2XMAA 2R7TA 1TQLA 3FRZA 2OLWA 3NY0A 1NB2A 4P7TA 4X4QA 1NZAA 2GQCA 2QYGA 4FXDA 1U8SA 1Y4ZB 2E1AA 4OI3A 2AHOB 4DUYJ 1KS2A 1L3TA 1AUSL 1D09B 4L73A 1ZTWA 1CULB 2MZRA 3FCWA 3R97A 2JWNA 3BO2A 3EXCX 1TKXB 5AXKA 2ROEA 3UDVA 2LFVA 4ZP8A 2GQQA 5A6WA 4DR6J 5HROA 1TK0A 2C1EB 3EZ5A 4FS2A 3JAMU 2AIRB 3BN4A 3G71S 1KQFB 3DRYA 4FP9A 1VIOA 1S97A 1TV6A 1P6TA 2FJEB 3QRPA 4JYAF 3PEJA 2W8KA 1TKZA 4M63A 2MKHA 4USWA 1W7WA 3MAAB 2RQMA 2G9OA 1M90T 3AT1B 4M5KA 1J5EJ 3K0JA 3V81A 3NNCA 3CMAS 5A8WA 5F41A 3IR6B 4GKKJ 5E3CA 3B8HA 4ED6A 2G2OA 3PRBA 1S10A 2HPUA 1LEOA 5IM0A 1WTBA 4Y65A 2NS1B 1KOHA 1HWKA 3CCQS 5LMUJ 3BGLA 1V3RA 2YQ0A 1YBTA 2M4MA 3UR3C 4H4KA 2QYCA 2HQGA 3G6XA 1X0PA 3NXZA 3DLGB 5AXMA 5KFSA 5H9FJ 4IFVA 2G0CA 4Q44A 2XLIA 2XHWA 1NKCA 4MFBA 3HHLD 2W7OA 2N82B 3DLHA 4O3OA 3MFHA 2NSCA 2EFQA 4KJIA 2XLJA 1RP5A 3EDQB 2HLUA 4F50A 2V94A 3BO4A 2W9AA 2H65B 2FJBB 5EWGA 2U1AA 2BVZA 2KT3A 2ZKTA 3VALA 3LUYA 2FHJD 1HI8A 1U8WA 3P49B 2QA2A 5LJ5Y 1KN6A 5DM6Q 5F9LA 3CJKB 4CLFA 1YWXA 2K3IA 4IO1A 1FK9B 3KJVB 4UOCA 3BQ0A 5GAHU 3M2RA 1TAUA 4DPXA 1GMWD 3BQ2A 2PI4A 2IM1A 4LF5F 2XYHB 3SZ2A 3PV8A 4QCLA 1NXIA 1KVIA 1LFWA 5IT0A 4ZS6A 4KHPJ 4NMXA 2AGOA 2EBGA 4CP5A 2HFVA 3S7RA 3HZEA 2FC9A 3HVTB 3OSNA 3A8KA 5BJRA 1R8BA 2VF3A 2AX1A 5LXYA 3OTCA 1TFYA 1HNIB 4OJ3A 1W26A 1BQNB 4DWIA 1SV5B 2B8PA 2ZC3A 2BM0A 1QE1B 5HQMA 1CS4B 1UKUA 4R5PB 5K14A 2RUSA 3QYYA 1UFWA 2LQBA 3RBEA 3MECA 5C2CA 4C0HA 2Y1RI 5DS7A 3CC2S 2E9RX 4EK2A 4GKJF 2ZH3A 4DZ6A 1S0MA 1JIHA 2HK2A 3TX8A 5KFNA 2YKMA 3H59A 1NM2A 4H4OB 1VLYA 2K1RB 5CHCB 4JI2J 3SI8A 2JH3A 4FS1A 1U1LA 3BKUA 2UUCF 5L1JA 3MGJA 3FC9A 3R1LA 2HGNA 4Q45A 4DG1A 4RU2A 1CJVB 1W2BR 4PG6A 4D3GA 1RKJA 1F5BA 4CLPA 1G4CA 1VRUA 2XMKA 1K73T 3DGVA 1UVMA 1IKYB 1N6QB 2ADCA 1XC9A 4I6WA 2H9ZA 3PW7A 2BJ3A 2OPSB 4GVBA 2M52A 2UUTA 4B9LA 4DL6A 2POKA 4WU3A 4DX5A 2FLPA 5BYSA 3GU0A 2I5JB 3WDOA 3QPIA 4WXOA 2X1FA 4J9KA 1FWPA 3PW5A 2BUNA 3ICLA 3M2VA 3I82A 2UXCJ 4PKDB 3BF4A 3CWJA 3MEDB 3BGRA 5DG9A 4NYPA 5IZHA 3GB0A 1RT2B 4X4VA 4JI1J 3MM9A 3FJ2A 4LIRA 1SUQB 1SJQA 2ZBQA 3DDNA 4RW6A 4F4WA 3OVAA 4IR9A 4K7QA 2J9DE 4N77A 1IKWA 3R5AA 2DO4A 3HM9A 3M05A 3NG8A 4JI6J 2VH7A 3KMQA 2OFGX 1DFDA 3GG0A 4EWTA 4YR2A 3M8ZA 5CZVA 1YRUA 1JLFB 3WX4A 4ETXA 1UEUA 1XNRF 3SDEB 4DCJB 2V2QA 4Y2CA 4Z7YA 4USMA 1S6PB 3DCAA 4JI5F 4F3OA 3UDCA 5THWA 4K59A 4BBYA 2YNFB 5FLXY 2HIYA 4KV8B 5J2NB 3BPSP 4UT4A 4LSLA 4GC7A 4UOFA 4HDHA 1QM9A 3ZZRA 2BJ7A 1XWLA 4B08A 2QLWA 2DR5A 2VJVA 1U1NA 1G3OA 2AQ4A 2UVVA 1S6OA 1L3SA 1REVA 1N4LA 3QO9B 1RA6A 1PAUB 3NNHA 5KG2A 2J76E 3PFEA 4RU9A 4LF8F 4FF1A 2QMXA 3PO4A 1GTEA 1TKZB 1U1QA 4O3RA 3PJ9A 3JYTA 2F4FA 1CC8A 3T19A 1AFJA 4NMLA 4OX8A 5ITHA 3NWRA 1X31C 1C1BB 3RGIA 2XULA 4LBPA 3OFEA 2HGLA 4P52A 3HD2A 2RRAA 4Q8EA 4YB1P 4RW4A 2KFYA 3HXMA 2XGPA 2J6TA 5A8WB 2W9CA 1KEKA 2DGOA 4DV2F 5IM0B 2UV8A 4EO8A 1CPZA 5ETMA 3PRDA 1UA0A 3LP0A 5G0RA 1XR6A 1TK8A 5K8MA 3GR0A 2MKSA 4ER8A 1J5EF 5F8IA 4IFVB 4KPCA 4RNNA 2OP5A 2HIQA 1D1UA 4MFBB 4BS2A 3V6KA 3W2WB 3MPVA 1FTCA 2PMWA 3G9CA 3IFEA 4N5SA 1R8CA 4GKKF 4IDKB 3J80U 3UW1A 2F7VA 4FYYB 1MN7A 1HBUA 5KFVA 4JI3F 3CDAA 4R8UB 4C7QA 2CQ0A 5L8RC 5DM7Q 2E7VA 4OZJA 3CC4S 3CIMA 1BLUA 2AWZA 3TUIC 3O6QA 4TU7A 1YI2S 2BKPA 4GC6A 3MEGA 4OX9J 2JNJA 2GAHC 5DGAA 3CDUA 4WCEQ 2QL9B 2E9TA 2HRTA 2CQBA 4USUA 1S9GA 4DR7J 3H2UB 3M8PA 1QDUB 4C98A 1H0HB 3Q8SB 4WZQA 3FEZA 1X9MA 3ILOA 2YX4A 3E01B 2A0FB 4DV0J 3GV5B 2IIHA 4IRCA 2KVIA 4ECWA 2KM8C 2M2BA 1N32F 2FVSA 1KTVA 3M9MB 1HFEL 1PJ7A 3FSYA 2LLZA 4DLGA 2CJBA 3OR1B 5D4PA 1HWJA 3NCPA 2V4JA 1S1TB 3GONA 3BV8A 3GSDA 4ES2A 4DV6F 5BR8F 2CPZA 3T5KA 3M8YA 2ZH1A 3MECB 5D0HA 2I0XA 4JI4F 4KHPF 4C6AA 2BW7A 3NCRA 1REGX 1NU4A 4N56A 2WCXA 2YKMB 2ZH6A 2XG8A 4EGLA 2ZKUA 2C2DA 2XGQA 3HHEA 4OJ1A 1SB6A 1DQAA 3F41A 1WG4A 5MAOA 4QYZK 2E66A 3FCHA 3OLAA 4X66J 3ZZTA 2R4FA 4DSLA 1WHYA 2CVEA 5HMXA 2XSJB 4X64F 1RLCL 4ILRA 5C24A 5A76A 2CQHA 4DL5A 4DL4A 2VFVA 2QMUB 2PEHA 3NAHA 1U25A 1WHWA 4P72A 1IBCB 2OEMA 3US5A 1QVFR 2C22A 4B9TA 2J8AA 2VFRA 4QWEA 2WK4A 4HACA 3M30B 3C46A 2WBMA 3M6VA 4J90A 3OHBA 2D3UA 4P2XA 1XMQJ 1L3KA 4IUFA 1BQXA 3CJ8A 1UW4A 4URGA 1WOOA 4NLPA 3B82A 3I5CA 4DV5J 4TQRA 4XAKA 5M2PA 1URRA 1JJ2R 2OMOA 4OYXA 2BQUA 2XY6A 1VMBA 2H4WB 3OXFA 2EG1A 4LBIA 3GWCA 3MZIA 3M2VB 1HHTP 1HD0A 4E98A 4DCPB 2D3OR 1RT6A 4PUOB 1R6VA 3AAWB 2ZBCA 1RA7A 2LDYA 4P6QA 2OD4A 2QLBB 4PG7A 4O3QA 3JQKA 2J9CA 4PXDA 1LXNA 4I7FB 4ENOA 4NX9A 3OBIA 2HHHJ 3KJNB 1S99A 1PBUA 1HNWJ 3ENWA 2K3KA 4RW6B 4QR0A 1RXOB 1Q8LA 4ZVGA 4DQQA 2BW2A 4TXSA 4TLQA 4EMDA 4M95A 2R9LA 5ETVA 1GXLA 3EMTA 2XMUA 2Y1IA 2O5DA 4PZVA 3DLLQ 5GADU 2OJ3A 4JI1F 1H72C 3ZTOA 4NE9C 5HMYA 1HBMA 4DR2F 4RUBA 2HFOA 4DMZA 4U7UK 4ELTA 5L1IA 2CQCA 4IG3A 3MEEA 4G65A 2HHTA 3HHDA 4USVA 3GR1A 4LUBA 4RUCA 2V8HA 3BSAA 3KLEA 2VICA 2V9KA 2RILA 3UD3P 1HNVA 1YJ7A 4B3TJ 3PM9A 2AEFA 1FWLA 4WFAQ 4DXLA 4ED1A 1RWOB 5M2UA 1A0OB 3A8EA 3BPDA 2N7YA 3GPAA 4ZMMA 4B9NA 1EHWA 4NEYA 2I1RA 2LQJA 2IAJA 3VTIA 4YHHJ 2XS2A 3BSNA 3J7Z5 1BHNA 3VVUA 3DHWC 5H1SV 4DV3F 4JV1A 2I8EA 5LMNJ 2FUG9 5J1EA 4LF7F 2EKNA 1UEKA 3QT6A 1DHMA 4HHJA 1WUUA 3RW6A 3EYZA 1VLOA 1X4FA 2RU3A 3KJFB 5AE3A 2IRUA 2HRYA 4A47A 2ZC4A 1IBKJ 4CYUA 3I5AA 3N9UC 3IGVA 1Q16B 3QT7A 4DDFA 4KC5A 5C25A 4WP9A 4QIVA 4U96A 1Y5LB 1AT1B 2CYYA 1TP7A 1U48A 3CDEA 1QSYA 1HYSA 2VKZG 1GT8A 4ZP7A 2FVCA 3IMQJ 4CQ1A 3N01A 3IA0A 1E6VA 4A8FA 4LT6A 1RADB 1VFJA 1YGYA 2DCLA 2J6UA 1VHFA 2OSRA 4F2RA 1KQKA 3OL6A 3KLVA 3JQJA 1EP4B 3MEGB 2VHGA 3VWSA 4PWWA 1SPBP 2MZSA 5HLFA 4ZVFA 3QJJA 2RHSB 2KG0A 3VGVA 3CCSS 4OI6A 5KFOA 3HFVA 5JVGQ 4I67A 4NA3A 2O3DA 2VZ9A 4TLRA 4QIEA 1D8YA 1R27B 2QLFB 2AD9A 2WRMA 3QGGA 3MPYA 5D0EA 2UXBF 3B4DA 4B3RF 2BDPA 2YKOA 1SKRA 5HP1B 4DUTA 1FDNA 3FDSA 4F4YA 2ZH9A 1FNOA 3RAQA 4LRDA 3L9ZA 4CO5A 1RHJB 1H2VZ 2LMIA 2GJ2A 3OW2R 1BQMA 1MU2A 1RWPB 4DV0F 3HP6A 3M8QA 3FMWA 3HO1A 3BN7A 4HDGA 3KLGA 4QPTA 4LFBJ 3TA0A 3ULHA 1YLXA 2XSFA 4L76A 4QIFA 4DL2A 2B6AB 4LF2A 1T05A 3RTVA 2AJ4A 2NXCA 1N36J 3H4BA 3D54A 2LECA 3HMJG 2I9SA 1DLOB 5F0WA 2YX1A 1R8PA 3DXBA 3W8GA 4C8LA 3OTBA 3H0PA 4ZCIA 4MMOA 1L3UA 4U67Q 1JLQA 4Y2AA 2AZ1A 2VU5A 1N54B 4DQSA 3VVTA 4RWXA 2C42A 1UPPA 4HACB 1U2FA 2JDJA 4RJVA 4WP8A 3MM5A 3IM9A 5F8GA 4LF6J 4CO3A 5ETRA 1SQFA 7AT1B 2ZD1A 3OFFA 2HNDA 3MR3A 5B0CA 3OT9A 5C7PA 5GMKa 2M7SA 1EETB 3O3LA 3GIJA 5KT3A 1JLAB 3EPGA 3G87A 5E3QA 4MK7A 5ETOA 3GCWP 2BOPA 2WOMA 2FB0A 1DARA 2GMHA 4KKOA 4FKYA 2VBZA 4NASA 3HVWA 3SCJE 1S1UA 1OS5A 2K06A 4JI8F 1SI9A 1N5YA 4C97A 4NOHA 1JLBB 1R0BG 1WHXA 2OUGA 1C1CA 3ILJA 2J6SA 1RKIA 2E5LJ 1RZMA 3OQ2A 2BM1A 3CD5A 1RWXB 2YVSA 2DD8S 3AJ2A 3CCUS 3AOCA 2B9WA 1Q5YA 3Q2TC 3BKFA 4ECUA 3IO1A 4U9RA 2R8IA 4DU7A 5D6GA 3POTB 3RBZA 5GAEU 3ET6B 1ZAVA 2ZOFA 1S0NA 2QO3A 1U1PA 3KMSA 3SXLA 3SSSA 4X4UA 2YNHA 1D3WA 1MWYA 4LF1A 4EO6A 1FFSB 2EXUA 3R7BB 1QAIA 1LWCA 2JVOA 3FZBA 3Q24A 1HNXJ 1KVJA 4JI0F 1UMJA 2Q6CA 5IFMA 2CPEA 5KFYA 4PXEA 4Y0FA 5HO4A 2M70A 1PC5A 3CDBA 2V2VA 2NZ4A 5E2QA 2V8GA 3M32A 1WEYA 2DNOA 1U2CA 2AYEA 3QIDA 4OI1A 1UW9A 4Y6IA 1HLWA 3N6MA 3KLEB 2ASDA 4K4XA 1RT7A 4BC7A 3M6UA 4OHXA 3LF0A 1SKWA 2YQ1A 4YQWA 5D77A 1JKHA 1U2RA 3TA2A 5CYQA 4I69A 5KFHA 5E3RA 1JXEA 1BWEA 3BR9A 2L48A 1OYEA 1QTNB 2IFXA 3CB4A 2KM8B 5HAOA 3UVJA 2G1DA 3L7OA 3H90A 4EYHB 2ASJA 2KZZA 2IAJB 1YG0A 4LFCJ 2YKQA 2LA6A 2OFHX 4QPXA 3K89A 1RBLA 4HEA9 2GVDA 2HS4A 3UNYA 2MKJA 3EPIA 3F44A 2KXHA 2P6TA 3I87A 2AKWB 2FC8A 3EWGA 3D6FB 1UA1A 1P1LA 1XQIA 2CWKA 2W4CA 1TL3B 3W5YA 2D9OA 4XPEA 2MQNA 4CYUB 1HW8A 1UEVA 5C25B 1X5PA 4HHHA 1M0SA 1MNEA 1XMOF 2C3UA 1LV5A 4TY8B 3GFZA 4M5IA 2VPXB 2HURA 1TUWA 4QIWD 4D3HA 3FBFA 2FY8A 4FYDA 3L3CA 1N5SA 3BSOA 3W2VB 1X4AA 1MWZA 4C11A 1MW7A 1X9WA 2E5IA 3JTPA 5KFZA 2BANB 4LF4F 2QRRA 1XK8A 2ROGA 3IN5A 3A3OB 3NS7B 3K57A 2XYPB 5AE2A 1BMQB 4OL8A 4NYOA 3LO3A 3RW7A 3JS9A 2ZJPQ 2MZJA 2N4CA 5E0OA 1RT1A 1FD8A 3OSPA 3GP9A 4FPIA 4WU2A 3BB5A 4YUDA 2W4DA 4U8YA 2CXEA 4I2PB 1ITPA 4NWBA 3RUBL 2CWXA 1U0HB 1EB0A 5IWAJ 3H98A 2ZJQQ 3DOLB 2R2UA 4P10A 1EJ7L 2KN4A 2YWKA 4OI0A 5GAHI 1S1XB 4ZVPB 4R25A 4ZN3A 1S4EA 2IBOA 4H4MA 1RHKB 3MF5A 4IOBA 3BYPA 2V6AA 4J9SA 2ACMA 2P5VA 2M8DB 4RNOA 5BYQA 3M6WA 5A8RA 1QSSA 1YX2A 1Y3JA 3IS9B 2UUAJ 2IC3A 5DG8A 4G1QB 4I2QA 2QX0A 1S1VA 1U09A 3C3LA 1T9VA 3P6YC 5CABA 5FIIA 1RAJA 2ZUAA 1N5VA 2CDRB 4E8UA 4OYAA 1F3VA 1EARA 2A18A 2KZMA 4NYZA 3G6YA 3TUJC 1AXQA 4USHA 4Z37A 4HKQA 2ZVIA 3VZIA 1H6KX 4KYZA 3CUNA 2VDIA 1S76D 3PEHA 2DR8A 1YDLA 4UTGA 4X65J 1VQYA 1F2GA 4ZVTB 2FVQA 1R8HA 5KFCA 4WE1A 2LVWA 1ZZNA 1B3TA 1HARA 3CTRA 4N7TA 2VG6B 4MK9A 2DR7A 4QZVB 3ZZYA 3P4UB 1X4GA 2Y9HA 2ZUGA 2HRUA 2HNYA 3QGHA 2HBYB 2ASLA 3NCQA 1HMVA 1PKUA 2V68A 3I9ZA 3J81U 4P2SA 2GNKA 1FXRA 2B4UA 3O2IA 2GA7A 5KFEA 2V63A 4CLUA 3U7JA 3BQ1A 4HLBA 3PFOA 4X4TA 3TAMA 4DR5F 2DHHA 2EFGA 3AH6A 1S1UB 4TYAA 4LF6F 1HI0P 3CEDA 4LQ9A 2LQ5A 3I56S 4RR5A 1C1CB 3DN9A 1SKUB 1Y5NB 3CPWR 1NSKL 2AF6A 3NAIA 1NPKA 3GYNA 3HSJA 5LL6d 2DB1A 4DL0C 3BGFA 1WC1A 2IM2A 1C0TB 1CSJA 4J9MA 3KOAA 3GQCA 1FI4A 5KOWA 3RB6A 2IA6A 4RBVA 3TZXA 2VBWA 2B43A 4Y28C 1H2TZ 4WP3A 2E1RA 3SV4A 4C0BA 3KK2A 1VQNS 2DITA 3N5BA 2QT7A 2E5LF 3ITHB 5CYMB 3C14A 5DZ7A 2HHWA 2KO1A 2F4VJ 1RHUB 1LWCB 2CNLB 4FBTA 1TUVA 1S49A 4TKTA 3BGUA 4OMFG 1RT3B 5HBMB 2YTCA 2EFOA 5KG5A 5KAKA 3TYTA 2FYXA 2P9CA 3CO0P 1OY9A 2D69A 3EVWA 3GZ7A 2F65A 4M94A 2BEFA 2OPRB 4Q5VA 5IOLA 2N4DA 3TJ9A 1BUXA 4I0WA 3UCGA 4USKA 4F67A 1NKEA 5HL7Q 3BS9A 3D6TB 5IC6B 3SEOA 1VS3A 3RG6A 1I5OB 1N33J 1HNXF 4DSIA 3QRRA 1F9HA 4HYKA 3UN2A 4QBUA 4AQYF 3H8YA 2JL9A 3GYGA 1JKHB 5KFFA 2MJNA 1GXUA 5CYQB 1LW0A 1FF2A
chains in the Genus database with same CATH topology
1BC6A 4K2XA 2DGQA 2PO4A 2QEXS 4WIIA 4WFZA 4QIGA 1ZM9A 4FXVA 4NCGB 3G86A 4IG3B 5DG7A 2I5JB 4GO5X 4PQUB 2HW3A 3MEEB 3POTA 3LGNA 4JV0A 3WDOA 1PSDA 4DFPA 3MCSA 3QPIA 4OX7A 5KFBA 4WXOA 2X1FA 4J9KA 4CH1A 5KG0A 1U4BA 4NLWA 4N76A 2IVMA 2ZBIA 3DOKA 4NL5A 5D78A 2VKRA 4A8YA 1VRTB 1V9OA 3PW5A 1YQHA 2BUNA 5DQHA 3ICLA 2PI5A 4Q8FA 3SCIE 2BYCA 3M2VA 4WYLA 2FGOA 3KK1A 3I82A 4ES3A 1FHTA 4F02A 1ZBTA 4ZKAA 2UXCF 1U6BA 2IHR1 2NLWA 1HNVB 4PWUA 2JFKA 4ECYA 4PKDB 2X1BA 1QLNA 2OPQA 2DNQA 2JHEA 1VC5A 1FKPA 3BF4A 3CWJA 3MEDB 4ECXA 1R7IA 2V9WA 4K0KF 3CVKA 4OZNA 3BGRA 4IR1A 2KG1A 3T9NA 5DG9A 1T8EA 1FNXH 4NYPA 5IZHA 5IT9Y 3TOQA 3GB0A 1Y5IB 4AXJA 1RT2B 3IWNC 4IG0B 3V6JA 4X4VA 1ZH5A 3OL7A 4ERDA 3MM9A 3FJ2A 5MLCV 4KGMA 4LIRA 1SUQB 3THPA 1VI7A 2RSQA 1SJQA 1WD6A 3TO8A 3DDNA 3LAMA 4RW6A 4F3QA 4FBUA 4F4WA 3OVAA 1QAYA 2MZ1A 4IR9A 2J9DE 3OUYA 3OL9A 3BZQA 2FHKA 4N77A 2IVFB 5KOXA 2K2PA 1IKWA 3R5AA 2DO4A 4JI6F 3M05A 3HM9A 1U49A 1DJ0A 3M1VA 3NG8A 3PIOQ 2VH7A 2EK6A 3KMQA 4ID5A 3OFGA 2OFGX 1NK8A 2AYMA 2FIUA 5H9EJ 1DFDA 1KLMA 3GG0A 2LA4A 4EWTA 4QWBA 4YR2A 3PHEA 3KHLA 1HHSA 4IQXA 4ZA1A 4EU0A 4E0DA 1X4BA 1OIAA 2DJWA 5CZVA 2L08A 1O8BA 2DRAA 3KNGA 2FD2A 2N7CA 5J1EB 2MSTA 1YRUA 5KFWA 4LFAF 3NNAA 2W25A 4FNHA 3N6NA 1VQLS 4HH0A 5C42A 1JLFB 1KQGB 3WX4A 2KHCA 4ETXA 3CMES 4AFFA 1UEUA 5IT4A 1XNRF 3SDEB 4MK8A 3DM2B 2F3JA 1KRPA 1VBZA 1HPZA 2C28A 2M5YA 2JEIA 2JLGA 4Y2CA 4WYWA 1JLEA 3BR8A 3CJ4A 1UWBA 1S6PB 2HHPA 3DCAA 4NZ7A 3DYAB 2DH8A 4EUVA 2GMLA 2DGSA 4USIA 1JJ4A 3CJ5A 4JI5F 2DNMA 2RH3A 1DQ8A 1ZPWX 4F3OA 3UDCA 4M1KA 5THWA 4K59A 3WBZA 4BBYA 4IYQA 4OJGA 3LP1A 3DU5A 2YNFB 2YKPA 1X4HA 5FLXY 1WNEA 5FDLB 1M5VC 4KV8B 3GMGA 4NRTA 3RB4A 2BE2A 4OZLA 1M1KT 5J2NB 3D0HE 7FD1A 3FSIA 3HJFA 4RUAA 2FLLA 3LWLA 2XCPA 4ED7A 4I68A 1HYSB 3T5JA 4IRDA 1X4EA 5KT4A 2G4BA 3RAXA 1JWWA 4LSLA 2XWXA 1NH7A 1NRKA 4GC7A 4X4NA 3MR2A 4HDHA 2MGZA 1HQUB 3QAEA 1QM9A 3ZZRA 1QUVA 3VQTA 3CF5Q 1APSA 2KYZA 2YWGA 1N48A 1XWLA 2PN6A 3KG0A 4B08A 3CCES 1YJ9S 2RRBA 1S4FA 4DL3A 2OSQA 1E6VB 2QLWA 3DI6B 4Y2IA 1YHQS 2DR5A 1QTMA 2RS8A 3I0SA 1U1NA 1G3OA 2UU9F 3GIKA 2AQ4A 2UVVA 1S6OA 2I38A 4KTQA 3QJLA 3W7BA 2R8HA 1L3SA 1REVA 1S1WA 2LU2A 1M5OC 4ZPBA 3E8OA 1H3DA 3MI7X 4O44A 4YP3A 1N4LA 3QO9B 2DGUA 1FT8A 3THTA 1RA6A 3NNHA 1Z4UA 2J76E 5KG2A 2D1CA 4PWDB 4ED5A 2R7WA 2VASA 3E51A 4ZCMA 4RBUA 2G13A 4YMEA 4IO9Q 4CT8A 3V5RA 3OVSA 2DISA 1D8ZA 3PFEA 4H4MB 3LW5C 4QYRA 1YJTA 4RU9A 4LF8F 5K8OA 1KC8T 3OHAA 1R31A 4DF4A 4FF1A 4ZHRB 1TL3A 2QMXA 3PO4A 4NZ0A 2FGCA 1K0VA 1PO6A 1GTEA 2L41A 5HLFB 1TKZB 4TQSA 4RW8B 4QWDA 3MTKA 1U1QA 4O3RA 3UE2A 3S6EA 3NL0A 3JYTA 1CQMA 1AFJA 1CC8A 3T19A 3MUTP 1ZYQA 4NMLA 2JJ4D 4OX8A 5ITHA 5KFMA 1WACA 5L38A 2GCFA 3T1HF 3G8SA 2JEJA 4C4WA 1C1BB 4ZVHA 2XNQA 1C0UA 1C2PA 1FXDA 4TY8A 5F0UA 3MM6A 4EFAC 2XULA 5B0EA 4B17A 4IH5A 5F9NA 1O51A 1N52B 3OFEA 1QAJA 2HGLA 2RRAA 2HMIA 4NXMF 4Q8EA 3AJ1A 2CPXA 2ACYA 2CFXA 4X84A 4YB1P 4RW4A 2KFYA 1K9MT 3PACA 3ENVA 2MKCA 3HXMA 3MDFA 2XGPA 2J6TA 1DTQB 5A8WB 2W9CA 3TAPA 1NK9A 3C6TB 3D28A 1KEKA 1XEZA 2DGOA 4DV2F 3W2VA 3CJ2A 3P3DA 3K58A 2QV6A 1B0TA 1U24A 5IM0B 5J1NA 2CQ4A 5L1KA 4WTYA 2UV8A 1UAWA 5A0YA 4ZVEA 1HBNB 1NH8A 5HMWA 2ZHBA 1NB7A 4EO8A 4BWJA 2XS7A 2OIHA 5F8NA 1CPZA 3PRDA 1UA0A 1VQ6S 3LP0A 5G0RA 4ID8A 3F56A 5KFJA 1XR6A 4LJMA 3KNAA 3FEYB 2BANA 2B5JB 1VJWA 2CPJA 4KBIA 2WTFA 1IKVA 5A2QY 2EPIA 2B51A 1UVIA 3HHNB 1RT4B 2K7KA 3HI9A 5KFPA 1U1RA 1TK8A 3I0RB 5K8MA 4F4KA 3UCUP 2Z8QA 2B7BB 3V6HA 3GR0A 3N5FA 3UI3A 5I42B 2MKSA 5D3GA 3VQSA 4QYZJ 1J5EF 1K1QA 3S1TA 3DNCA 2MYFA 2MZQA 4MIAA 5F8IA 4IFVB 2UVWA 4RNNA 4K4UA 1FJ7A 2PDAA 3BDPA 1WF1A 2OP5A 3PKYA 2HIQA 3QMQA 1TKXA 4PQAA 1D1UA 4X4OA 4MFBB 4CO4A 3ISZA 2KRBA 1VGYA 1YRXA 4BS2A 3V6KA 2PA8D 5F3TA 1BQMB 2HFNA 3W2WB 4UW2A 3MPVA 1MU2B 1FTCA 1RTIB 4TYBA 3J80Y 3NGDA 2FJDB 3JSMB 2MY8A 1OPZA 3M8QB 1FJEB 1IJEB 4X2BA 3OXGA 4XPCA 3G9CA 3HK2A 4WFYA 3IFEA 3MMCA 1R8CA 4I2PA 4N5SA 4GKKF 4IDKB 1T95A 1Y3KA 3LOUA 2RNEA 4UQTA 2FLOA 3TVYA 3UW1A 4U6PA 2F7VA 2Y0SD 4G3IA 3CD7A 3KLGB 3HT3A 1HBUA 5KFVA 1TAQA 3T5LA 5CD4H 4JI3F 3CDAA 3I96A 4I6AA 2CIMA 4R8UB 2R7RA 3DOLA 3PO5A 4C7QA 3BO3A 4A8OA 2CQ0A 1S9EA 3CJ3A 1N34F 3OJSA 2D74B 2FJAB 5L8RC 1GX6A 1S1XA 2XC9A 1DTTB 5DM7Q 1WEZA 4OZJA 2NSBA 1AUDA 1T05B 2A2DA 3CIMA 3CC4S 3TW0A 2FPHX 1LQ9A 1LWEB 1T3OA 2ZE2A 4R0EA 1BLUA 4DFMA 4DQPA 2AWZA 3MWBA 3TUIC 3IG1B 3O6QA 5KFXA 1UVNA 1R43A 2RUGA 4TU7A 1YI2S 2W8LA 4PR6A 4GC6A 4GO7X 2RF2B 4OX9F 3CXCR 3MEGA 2YNIB 2EG2A 2ZDPA 4AL7A 1RTJB 1YJNS 5DGAA 2HHSA 2P9EA 2U2FA 1HA1A 2CQGA 2J5AA 2IMWP 2OTLS 1GX5A 4A8KA 4YDDB 3ZFVA 1S79A 3CDUA 1XTZA 4WCEQ 2E9TA 2RB7A 3DLEA 3CO9A 3MOZA 1KOOA 2CQBA 5E3AA 4HT5A 1JLQB 4URQU 3AY0A 5K8NA 1S9GA 2K7JA 4DR7F 1P9QC 4NCBA 1N5TA 4ZP6A 2XZWA 4B9MA 5J2QA 3H2UB 5BYRA 3TQ1A 2QSFA 3OR2A 5KT7A 3MR6A 3M8PA 3IS9A 4C98A 2WONA 1I6JA 1H0HB 3Q8SB 2QSWA 4WZQA 1HBOA 1S48A 3FEZA 1ZAWA 4G1QA 1X9MA 3TAMB 4W92B 1SXLA 3MM5B 1Z2ZA 2YX4A 3E01B 3OJUA 2VG7A 3MXHP 1JLCA 4DV1F 1QY7A 2VC1A 3GV5B 5SUHA 4IRCA 2KVIA 4ECWA 1RTHB 2KB2A 3R5BA 4QR2A 2KM8C 5E3PA 2CPYA 1IKXA 1Y7PA 2M2BA 4LQ3A 2ZD1B 2SXLA 3FQKA 1N0UA 1N32F 4NLRA 1S6QA 2HNDB 2FVSA 4A8SA 1KTVA 3M9MB 1SJ3P 1HFEL 3K5LA 3FSYA 3QZ7A 1OQ6A 1S7HA 4KRWA 2CQIA 2LLZA 4DLGA 2C3OA 2L9WA 4NA2A 4ZPVR 2MXYA 1ZM2A 2CJBA 4GMKA 3OR1B 3JB9k 5D4PA 1ZETA 3O44A 4ZPCA 1HWJA 1FEEA 3NCPA 2V4JA 1S1TB 4WK1A 2JX2A 4DX8H 3FQLA 5KG1A 3DMJB 3GSDA 3NBPA 1F9FA 2DHSA 2EK1A 2NXUA 4M5DA 4ES2A 1YITS 4IQMA 5I3UA 3K8WA 4L72B 3SV3A 5HI7A 4DV6F 4DR3F 2GGPA 5BR8F 2CPZA 3T5KA 1NJXA 4C0OC 3I4PA 2PSZA 2WOMB 2ZH1A 3VAHA 1U1OA 4KKOB 1W2IA 1T03B 2XMMA 1CG2A 4O0IA 1HWLA 4J9QA 3MECB 3MHYA 2ATLA 1LWFB 2KTQA 3M2UA 4J5OA 1FVSA 2I0XA 3Q8PB 3D1HA 4ED2A 1QUPA 3GFYA 4JBCA 4C2MA 1J2VA 2OMLA 1NEEA 2WB1D 4JI4F 4KHPF 4N8NA 1N5YB 1HD1A 1G1XA 4WFXA 4RX6A 2X3GA 1RT5A 2UV8G 2VOPA 3NCRA 4ED0A 4ECTA 3OVBA 1GAOA 1NKBA 5CA5A 4ES1A 1OQ3A 3CJ0A 2ZNYA 1NU4A 2J7KA 4YFUA 3QZ8A 2CQ3A 2XS5A 4YB7A 4N56A 1KLNA 2VG6A 2WCXA 2YKMB 1MMDA 1YJUA 1H7XA 4BHQA 2ZH6A 2XG8A 4EGLA 2ZKUA 2C2DA 4QWCA 2M8HA 2D7SA 3T5HA 2XGQA 4PG5A 3HHEA 4OJ1A 1SB6A 1DQAA 3F41A 3GG1A 4KR0B 4AXIA 1WG4A 1UVJA 4RW7A 5MAOA 2OKQA 3M9OB 4FF3A 2JVRA 2E66A 2GFFA 1FA0A 3D0IE 2D9PA 3FCHA 2UXDF 2Q66A 4NLGA 3OLAA 4X66F 1RTDB 4TNOA 2EKYA 1IN0A 3ZZTA 2VL1A 2R4FA 1VQ4S 4DSLA 5A8KA 4CZCA 2CKWA 1Q1KA 1WHYA 2CVEA 5I3QA 2CVIA 5HMXA 1RYSA 4J9RA 2XSJB 4LMZA 3CJKA 2ZH4A 4X64F 4ILRA 5C24A 2CQHA 2WB4A 1J5OA 4URSA 4DL5A 3NS5A 4O4GB 4DL4A 2E9ZA 1FK9A 3T1AA 3KJVA 2VFVA 2YNGB 3V6DA 4G6VB 3I55S 1S0VA 2PEHA 2AGPA 1WTFA 3NAHA 2YNHB 1U25A 2GO9A 4NLXA 5I3PA 2AW0A 1WHWA 3KWMA 3KHRA 3US5A 5DLFA 1QVFR 4QOTA 4L3NA 2DNPA 2C22A 4B9TA 2J8AA 2GO8A 2VFRA 3MM8B 4QWEA 2WK4A 4ECQA 1TK5A 3F73A 3L7PA 3MMBA 2GHPA 2Q3PA 2JLFA 2IYGA 2VFUA 3M30B 2FHOB 2DNZA 3HZGA 2HGMA 1KD1T 3C46A 2WBMA 2ZHOA 3M6VA 3OHBA 2VG5B 4C8OA 3DRSA 4USJC 4J9OA 2BRLA 1H2UX 2QMWA 1XMQF 2D3UA 5IXUA 2DNHA 3UPFA 2Q6BA 2CPIA 1L3KA 3V4IA 4ZPWR 4K4TA 4F3MA 5IS2A 4C8KA 2A1BA 3SYZA 4IUFA 2VC0A 2VD3A 4O23A 1BQXA 2ZZNA 2MQOA 2L9NA 3N28A 3HVTA 1UW4A 1RI7A 1IBLF 4URGA 2DTJA 1ZM3A 2E29A 4KO0A 2B4PA 3CGIA 5EN1A 3OTEA 2JOQA 4K4ZA 2AJQA 4WXWA 1TKTB 1JXLA 2XWYA 5CQGA 4OV1A 5DLGA 2P6SA 1WI8A 2XO7A 1BQNA 4NLPA 3B82A 1VQSA 3I5CA 1NK0A 1SV5A 1C0TA 1ZPVA 1AW0A 3FRYA 2LEAA 1QE1A 3Q23A 2XMVA 4DV5F 1ZZFA 4K4VA 2HHXA 1Z2LA 2WBRA 2YWHA 4C8MA 4XAKA 2AJ0A 4F26A 1C4CA 5M2PA 4TQRA 1S77D 3KK3A 1URRA 3ZZPA 4ECZA 1JJ2R 2MB0B 3M32B 2OMOA 1FE4A 2MY7A 2BQUA 2XY6A 1VMBA 1Q78A 2M88A 2E5HA 4Q7AA 1IBMF 1L3VA 3OXFA 5CCLA 2EG1A 1G6BA 3W3SA 2DPIA 3DOKB 4CTAA 1Q82T 1CQNA 1WEXA 3GWCA 4I56A 3MZIA 1XBWA 3M2VB 2NPIA 3FSXA 3FZ2A 1HHTP 1HD0A 4E98A 3QLHB 4RKUC 3IRXB 3RR8A 3IC1A 2D3OR 2LEPA 1RT6A 3MPWA 3GIMA 4PUOB 2OPQB 1RGVA 1RT7B 2ZOGA 3AAWB 2B4VA 3ITHA 5CYMA 4H4OA 1TFWA 1TL4A 1RYRA 1F5CA 3DU6A 2K1RA 1XMBA 3MMAA 2F8HA 3K7RA 2ZBCA 1RA7A 3KLHA 4IFYB 4V19X 5CXTA 2LDYA 4K5RA 2QE5A 1JLGA 3DLKB 4P6QA 1VQMS 3J7YU 2OD4A 2X51A 2JLEA 2NUUG 4PG7A 2VPWB 4O3QA 2J9CA