4GO7X

The regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
186
structure length
165
Chain Sequence
SIHMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNVSKDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGVTATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLEATVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartokinase
publication title Structural view of the regulatory subunit of aspartate kinase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 44
structure length 165
sequence length 186
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2012-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01842 ACT ACT domain
X PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go7X02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go7X01
3DHWC 5FIIA 4M8LA 3NRBA 2PC6A 3MTJA 1KS2A 1O8BA 2JHEA 2P9EA 2RQKA 4X84A 1SC6A 1YBAA 3S1TA 4PWUA 2RE1A 1UJ6A 1LKZA 3IXQA 2F1FA 2NYIA 4GO7X 3UW1A 1LK5A 2QMWA 2JOQA 3OFHA 1Y7PA 4IO1A 5IS2A 3LUYA 2P9GA 4GMKA 5IT0A 3IBWA 1M0SA 2QMXA 3N0VA 1RWUA 3TUJC 2MDAA 5IT4A 3TUZC 3HHEA 2F8MA 3KWMA 1XTZA 3OFGA 3DDNA 2PA3A 2RQMA 5T41A 2QSWA 3ENWA 4LUBA 2J0XA 3ENVA 3U7JA 3OFFA 5JJBA 4NMLA 3DHXA 1U8SA 2H9ZA 2LVWA 1UJ5A 3MWBA 2DTJA 3DC2A 4GO5X 3ENQA 2CDQA 1PSDA 3AAWB 3OBIA 3AB4B 3AB2B 3L7OA 2P9CA 2I9SA 3OFEA 3TUIC 2ZHOA 2J0WA 1UJ4A 2LQJA 3LOUA 3O1LA 3MAHA 2DT9A 3W7BA 2KO1A 2FGCA 1LK7A 1YGYA 3K5PA 3P96A 2QRRA 3CEDA 1ZPVA
chains in the Genus database with same CATH superfamily
4ZP7A 3WX8A 2HHTA 4YY3J 1ZAXA 1O5JA 1VQ7S 3CD7A 3A3PB 4ECTA 1R31A 2B4UA 2DRAA 4ECQA 5C2CA 1RAEB 5ETNA 3NS7B 1OJ4A 2RRAA 1SJFA 4X64J 3OL7A 4CLFA 4EBCA 3DI6A 3I55S 3EYZA 2MLYA 3F73A 2HWHA 4RJVA 1FNMA 3RW6A 1F9EB 2FJDB 3ENWA 2KTQA 1NH8A 2MPUA 4NCAA 5EWGA 3LQVA 3AH6A 3WC2A 2LVWA 1RUSA 1FRXA 2VASA 3ENQA 1BWEA 2EG2A 1Q16B 3F41A 4Y2KA 1V3RA 2XB2D 1B4SA 5D8HB 2MTLA 3TP2A 4S0MA 1YGYA 2HNZB 5E33A 3V6DB 2LA6A 1UAWA 1UA0A 4KO0B 1ROFA 1HMVB 1SKUB 1WI6A 2COLA 1YJRA 2V50A 3CCES 4ZPTR 3DOLA 3VGVA 2QV6A 3GR1A 4Y2AA 1X0PA 1BQXA 4OZ0A 2CQCA 5T7LB 2BXJA 1P9YA 5IT0A 2YWKA 2LDIA 3DLGA 4OYOA 4QWEA 1BC6A 1I51B 2H4WB 2LQBA 2BUNA 1K0VA 2OEMA 1F3FA 1IBMF 1BWVA 3H59A 1VK8A 1H2TZ 2P2CB 4FXDA 4OL8A 2KFNA 4C2MA 3TX0A 1D8YA 2E44A 2Q3PA 1K8AT 5JJBA 1HNWF 5DJBA 1TK5A 4IFYB 5HP1B 2UUAF 2N7CA 1S6PB 4UOCA 1JLAA 1HBOB 1C1CA 4ZKAA 4R8UA 1FD8A 5CCLA 1YKWA 1KVIA 5L39A 4I2PB 1WTBA 2HGNA 4DSIA 2F65A 4DV4J 3QNWB 3PM9A 1LWFB 3L7PA 5DDPC 3MTJA 1LXNA 4ZCIA 3THVA 4V1Ak 2NUHA 3DLBA 2XMAA 2Y1RI 2IAJA 3PEJA 3SCJE 3W2VA 1F9FA 3PRDA 2KYXA 1YG0A 4NLWA 5DDQC 2MKJA 2RKIB 3J81j 1CULA 3PR4A 4KGMA 4WP3A 3BO2A 1SC3B 1NKBA 2ZC4A 4HTIA 2M9KA 3Q8PB 2ZH9A 4W92B 4TU8A 3OJUA 1QJHA 2DHHA 4J9MA 3QGIA 1QAIA 4WU2A 7AT1B 2E9RX 2M0GB 1YWXA 4BHQA 3R2DJ 3IAS9 4QWDA 4U7CA 3D5MA 1RAAB 2ZH1A 3MUVP 1FRIA 4DR2J 5KFMA 2JL9A 2DPIA 2N7YA 1M1GA 1SC1B 1JX4A 3K5LA 1Q8KA 3L9ZA 2V5HG 1S4EA 4NXNF 4KH0B 2CPEA 1OQ3A 3R5CA 4WK1A 1HA1A 1NNDA 3KLFB 1X5SA 5KG1A 3M6UA 1V5IB 4YB1P 2HFZA 3NOGA 4NPOA 1C4CA 3RBEA 3AD9C 4F0KA 3KUEA 3ITHB 1X0FA 1NPPA 3NMAA 3IWXA 1G6BA 4ED6A 2OELA 3CSKA 4NLTA 4D3GA 1T03A 4NLRA 4NYOA 4ZP9A 1DBDA 1RT3A 3KLVA 4KPCA 2GQ2A 2GMHA 2I5JA 3NS6A 2AKWB 1G3OA 2GO8A 3H5UA 3LWMA 4LF1A 4M5KA 1WSRA 1BD6A 3V4MA 4LR7A 2D9PA 1D3WA 4ZLNA 5CH7B 3R5GA 2BANA 4FVMA 4ILLA 3NWGA 3BO4A 2CJAA 3KK3B 4PQAA 4RW8A 3BKUA 4AL7A 3R1HA 2HS3A 4K50A 5LJ5Y 1YRUA 1UEKA 2CQHA 5A8RB 3SV4A 2OJ3A 1SXLA 3THPA 2ZUGA 1EETB 5GADI 4MAKA 3QATA 1FX2A 5CYQB 3KLEB 2F9JA 2IA0A 2JH3A 2PFFB 3NWRA 4D3HA 5C25A 2AZ1A 5I3PA 5HBMB 3QQCD 2PMHA 4JI8F 4IO1A 2XMKA 2V0NA 2A10A 1RQ0A 4P75A 1V6HA 3C14B 5I4MA 4ZPCA 2GV1A 2JEFA 2H48B 2G2YA 5L8RC 1NCLA 3DDKA 2AEMA 3BPSP 4ZJOA 4X4QA 5KFEA 2YKPA 2W9CA 1TK0A 4F0HA 4NLYA 1FK9A 3IR5B 2UUCF 2B51A 1C4AA 1K47A 4DL7A 1RBLA 4A8MP 2HK3A 3T9NA 3JSMA 1JLGA 2Z8QA 3KJNB 5G0RB 3EM1A 2CZ4A 2ATCB 3DGVA 2FGCA 2CQ1A 1VC5A 3MEDA 3AXKA 4K2JA 5F0UA 4CLUA 3CE8A 2BW2A 4TQRA 1IXKA 2R7VA 3TW0A 3QJLA 3H8YA 3SSQA 1QVGR 3D3BJ 2W2NP 4PPZA 4LSZB 1WF2A 3BH7B 2HHVA 2R9LA 4J7CA 3LUYA 5D4OA 3ZO7A 4X62F 3HHKA 4CZCA 1GXTA 4LIRA 4NLOA 5IT4A 5C7PA 1G2EA 3R5DA 4O4GB 2JFKA 5F8GA 4WYLA 1KR4A 1M1HA 2CQIA 2FJAB 3EVMA 4U8VA 9RUBA 3SI8A 4FXWA 3FFIB 3VZHA 3KMQA 1T9TA 2IYIA 1F2GA 3HDSA 1ZTTA 1IM6A 1WF0A 1J27A 4TYBA 1N34J 3LAKA 2XBPA 3AFGA 4TY8B 4MIWA 1HD0A 1FF2A 2OSRA 2ZH4A 2C22A 3CC4S 3R1LA 4I67A 3AXMA 4DV3J 2V8GA 4ED7A 2ZH5A 5D4NA 3SBMA 3PJWA 2FHKA 1CG2A 1R7IA 1KS2A 3GJTB 2YPZA 2NCKL 4EZ6A 2DNPA 5HMYA 3OVAA 4USMA 2QLBB 3UQSA 2EXUA 3DNCA 2BJ1A 2VC1A 1QAJA 2KHDA 4OYBA 1FVSA 4WFBQ 4BCAA 1Y10A 4YDXA 1TL3A 4IDKA 4DV7F 3TUZC 4JI1J 1CQNA 5J2QB 4NEYA 2J76E 5M2PA 1WC0A 3R5AA 1A6LA 3CDAA 5EWEA 3ADAC 2PE8A 4PG7A 2XYPB 2EKNA 5AE2A 3W62A 2MLXA 1SQGA 3MI7X 2WRMA 4RW9B 1GXLA 1JIHA 4KFBA 1G1XA 1EJ7L 5L1JA 3R5BA 1S0OA 5KT7A 5D0RA 3OSPA 2XC9A 1XMQF 2VJVA 1R6VA 1H72C 1RWWB 3N28A 5BYRA 1HHSA 4X65F 3MFIA 4C11A 4QYRA 2PMWA 2RT3A 5HAOA 1XJWB 1R8AA 2LU1A 1N52B 2VUGA 1RYSA 4CH7A 4WPAA 1JLQA 4RU2A 1PBAA 3HSDA 3Q89A 2EVZA 1NSAA 1Q95G 1U6FA 3A12A 1IKVA 1SIWB 4TN2A 4N56A 3HHNB 4I7FA 5IM0A 2PMZD 1RT6B 2D69A 2OFHX 1UFKA 2KXHA 3GCXP 4C8YA 1JLFA 1U6ZA 1UZHA 1WG1A 1NK5A 1K9MT 3M8SA 3DDNA 3W63A 5IWAF 3R6LB 1WC4A 4OYIA 1ZM2A 1NZ8A 4KPYA 1RABB 4DPYA 1N5YA 4DQPA 1EP4B 2XHCA 3MMBA 4KBIA 3ETOA 5IT9U 2V8PA 3TZYA 2F8HA 3BBBA 3DYAA 4AL6A 3MPYA 3KMSA 4B9TA 4DL0C 1N54B 3TWZA 5IC6B 1KQGB 4B9UA 5LMUF 3IG1A 1R0AB 4G1QA 1RTJB 1QUVA 3HZGA 3OHAA 1S10A 1UWBB 2DISA 3OLAA 3TR5A 2CPJA 1LW2B 5KFCA 3JXOA 4FYDA 1RHRB 4JI7J 3ILOA 1U4BA 2JLEA 3I6PA 2ALYB 4O4RA 2J6SA 4FVCA 3TJ9A 3FSYA 1XIQA 3E8OA 3CDEA 2Z30B 3E01A 2W8KA 3QJJA 2YQ1A 3T6BA 4DSLA 4IUFA 3W5YA 2DR7A 2AGPA 2MZ1A 1L3VA 3W61A 2Z57B 4CH1A 3KHHA 4OZJA 3QAUA 4CTAA 2VG7A 3CJ4A 2ROPA 4URSA 1N6QB 4OYZA 4M5MA 2AJFE 4L73A 1S1XB 2DHAA 2UP1A 3B4MA 1RT4A 3R7NB 4LFCJ 4OYAA 2SXLA 2RAQA 4OQJA 3V81B 1SJQA 4Z7CA 3T6JA 4WZMA 2LA4A 2HNYA 2HHQA 3W66A 2LKZA 1HL6A 4YB7A 3J7AN 1L3TA 4WIIA 3M8PA 1YTYA 1MU2A 2GAHC 2HMIB 2YBVA 2OMOA 3QT8A 4DF8A 3BZQA 4LQ3A 2YNHA 3MAHA 2G0JA 2KKHA 3K5PA 2V67A 1UZDA 4DFMA 2AJ0A 4KV8B 2VDHA 2DNMA 4P7VA 2CZ9A 3QLHB 4DCOB 3O5TB 3QFWA 3D1HA 4CM0A 2AGQA 2GIFA 1QAYA 4L72B 4KTQA 1JLBA 1P27B 3HPOA 4ZLPA 2B56A 2J0QD 1YJUA 5KG3A 4QW9A 2KT3A 2N82B 1IM4A 1P6TA 1RTHA 2M88A 4TXSA 1U48A 1ACMB 2FHOB 2XGQA 4J37A 2E5LJ 2DH9A 2VDIA 3CJQA 4Q5VA 4OLOA 2XLKA 4RNOA 2NPIA 3TUPA 3DRXA 2EFPA 4LFAF 4LT6A 1NBEB 2VOPA 1CC7A 4HDGA 5DLFA 2DEIA 4C8LA 4C0BA 4PXDA 3W1YC 4YS2A 1RAJA 3UI3A 1CEZA 1WUUA 3LP0B 1RWVB 1F6TA 2W9BB 3KKFA 3GJQB 2EKYA 4DV6J 2YY3A 1S1TA 1AYEA 3ZTSA 1MLAA 2G13A 3IRXA 3N5FA 3PACA 2CKWA 3OTOF 2DNNA 2I2YA 1HWLA 5KFPA 1H98A 7FDRA 4QW8A 3OL6A 1UJ6A 1YVFA 4O23A 4DV5F 2CIMA 5DG8A 4LSLB 2LXUA 1OPIA 4DUYF 4DQRA 3ZNJ1 3MMAB 4OHVA 4DL6A 2AIRB 3UR0A 4MFBB 3ZZYA 3NP5A 1JXVA 2ZBPA 1IBMJ 4ZLJA 4HH1A 3V4IA 4K0KF 3H25A 1UKUA 3TEGA 1N5SA 4CLSA 4KHMA 2B8PA 2A6MA 1U6BA 4I56A 1NH7A 3ET6B 4ED1A 2HAIA 4ZS6A 3R97A 1UVMA 3EMTA 1CJVB 4QWAA 2E7WA 1FJEB 2OAUA 2UUAJ 2XZTB 2ZH7A 4OJHA 4DR5F 4WTYA 1FNXH 1X9SA 3G71S 1J5OA 2K7JA 2CYYA 3TEHB 1B99A 5KT2A 3TA0A 5KFDA 3CMAS 3MPDA 4LBHA 4NL5A 4CRJA 2ZVIA 1EARA 4LVOP 3QYYA 1JXLA 4K4ZA 3ONQA 4F3QA 1TR0A 5DQHA 4BDPA 1GX5A 1SV5B 3ZZOA 2YKMB 3JS9A 2X1GA 1FRJA 3CT9A 3EUNA 2W7OA 3J81U 1NM2A 3D68A 4U95A 2GA7A 5D0GA 1LXJA 2FDNA 3QT5A 1M1KT 4A8FA 2NSBA 2YWHA 1Y0HA 4F3OA 2O01C 2ATLA 2QT7A 3T5LA 1WHVA 3G4SS 4A8KA 3KHRA 3NOCA 4M5LA 2C2NA 2OH2A 4A8OA 3MUMP 3SZ2A 3DLLQ 4WXOA 2IIHA 4EI2A 3T1YJ 3Q23A 4C8MA 2W2MP 4X4PA 3FEXB 3V6DA 2YKQA 1ZAVA 3MM5B 1HMVA 3K8WA 3GV8B 2ZZTA 3D6MB 3H42A 4B3TJ 1FEEA 3AD8C 3DLEB 1OSDA 2IDEA 4H4KC 3JTNA 3ETMA 2MSSA 3CULA 3UDLA 2UVRA 5T7LA 3H4DA 3N5BA 1M90T 2ZD1B 3SIPB 2HVHA 4XK8C 2MQMA 2Y0SD 1U1NA 2DNLA 4M5GA 1KTQA 5HVHA 5FDLB 2HVIA 3TAQA 2PA3A 4ZVEA 1VCTA 1AB8A 3BKFA 1IBKF 3QRRA 2MY7A 4ZK7M 3OFFA 4ZJQA 5SZTA 1UW4A 5HN0A 1WEXA 2DNGA 4A47A 2XQCA 4L3NA 4IFYA 1I1GA 5HP1A 2HIYA 3N6LA 1S6PA 2DPJA 1MROB 4ECVA 2VFUA 5IQ6A 3ZTPA 4DLEA 3DRPB 3PY8A 4DR6J 2YX7A 3TVZA 4I2PA 7FD1A 3MUTP 5D3GB 2BX6A 5G4DA 5KAKA 3HXMA 3BGRB 2MY8A 2WVBA 1LWFA 1QDUB 3QSYB 4O0IA 2YQ0A 3ZZRA 4F8RA 3FK4A 3OSNA 4UQGA 1CJTB 2J8AA 1SQEA 2RKIA 4ZN3A 2IM3A 2E7VA 4CLYA 1T0TV 5FD1A 2F5GA 2JLFA 3I87A 3Q83A 2DEJA 4MT1A 4ZA1A 2J9DE 3KOAA 3Q8RB 3J80U 3IWLA 3PX6A 2BJ3A 3PRVA 3CXCR 2JEJA 3GP9A 2UUCJ 3A8JA 1UFWA 1ZTWA 3IR6B 4GKJF 3SCIE 3FGVA 3QWPA 4DFJA 1T7PA 5E3AA 3WIUA 4FPRA 3A1YG 3VVTA 5B08A 2KRBA 3ZZTA 4NLGA 4IG3B 4E8UA 1BGXT 4UW2A 4DI6A 2FHJD 5HL7Q 3KLFA 2B4VA 3IAM9 3CCLS 1U7LA 5AXKA 2G0IA 3OPKA 1E6VB 3NCQA 4HHHA 2YVSA 3J7Z5 4OYMA 1KQKA 3N79A 3ZZPA 4RUAA 5HK4A 1S4FA 1TZ0A 2ZOMA 4F4KA 3NNHA 1LEOA 2JEGA 2FLOA 3UN5A 4DSFA 2CPIA 2EWHA 5J2NB 3UDVA 3U1NA 3MM6B 1HARA 2RQCA 2YKOA 1Y5IB 1EAYC 4Q0BA 2F8EX 3HT3A 4OI6A 3C66A 2HKEA 2ZZMA 3KLGB 2KFZA 2LDYA 2E1MC 3KK3A 2EFNA 2B9WA 4NMXA 4F4XA 1K44A 5K8NA 2NQPA 3CJ8A 1YI2S 3PFOA 2HQDA 3TNVA 4OX7A 3CUNA 2LQ8A 3M8QB 5A8RA 3UVJB 4MKAA 5HQLA 5HQMA 2ACMA 1EETA 4IR9A 4O3SA 3N4WA 2YH0A 1WC6A 2R4FA 3KLEA 5KFVA 3R6GB 8RUCA 2UU9J 3Q8UA 4C4WA 4DDFA 4G1PA 2OPQB 2OPPB 1A9NB 5HBMA 4YB5A 2ZKTA 4DBQA 1WDTA 4IYQA 3KHLA 3DXBA 4DMZA 4B3OB 2WK4A 3MR2A 4HYKA 3VV2B 3C14A 4DV7J 2FC9A 5CHCB 2WB1D 1V3SA 1UCNA 4IQXA 1RWMB 5L1KA 1PC4A 4MKVA 4Q8EA 5LMNF 3U1MA 4DSKA 2VOOA 2PEBA 4OZ3A 4W4MA 3GE9A 2YNIB 3ZZUA 3M8RA 3T19A 3UWTA 4X65J 5G0RA 1FXRA 4Y2CA 2CVEA 1SH3A 1LFWA 3HVWA 3ZC4A 2Z58B 5AJ3F 4Y28C 4KHPJ 5C2GA 1NDCA 4HTJA 3HD1A 5B0BA 2FZGB 1S99A 3W60A 5SUHA 1NB2A 1C1BB 4ECYA 2QL9B 1RWXB 2CPDA 1NAQA 1RXOB 3JSYA 4AXIA 1PJ5A 1HR0J 4WXWA 1B0VA 2N4CA 4ZOSA 3KLIB 2F40A 4PABA 2GW8A 2VKRA 4O4GA 1Q81T 4DJBA 1QTNB 1QAXA 2RQMA 1U2FA 5LSRA 2HFOA 3POTB 5F41A 2FJEB 3FFIA 2MXYA 1CS4B 5K8PA 3GFHA 1TKDA 2MZSA 4HI1A 2VQFF 1VOMA 2XSFA 3GYNA 4TY8A 3OL8A 5LMUJ 5CYMA 2V68A 3QBCA 1RT2B 5KG5A 4FF4A 2MSTA 3CCSS 1B64A 4TY9A 1DJ0A 4RO0A 1U45A 1RTIB 4YDDB 4K7QA 1WF1A 2VBXA 4QJVA 2VU5A 4M5HA 1NLKL 4GKKF 3J7YU 3PHTA 3RRHA 2AP6A 1DQ8A 3RR7A 2ZOGA 3RAXA 2FLLA 1Q86T 4ITSA 3GSDA 2RDDA 3DKDA 4QQBA 1R27B 1ZOTA 5HANA 2ROGA 3SQOP 1U25A 1EKSA 2FUG9 2JNJA 3IRWP 2V34A 4U8YA 3QT7A 1NHKL 2LQ5A 3VVUA 1JQGA 2UUTA 5EGYA 5J2QA 4FF2A 2L08A 4PZVA 5AXNA 2K7KA 1GMWD 2AF6A 2QSWA 4YFUA 3EICA 4RW9A 2YWGA 2XS5A 3T1HJ 3W2WB 2GJ2A 3PYEA 3MWBA 3QGHA 1APSA 1HBMB 2ASJA 1JNZB 3MD3A 5C24B 4WCEQ 2E29A 4BC9A 2HZCA 1RP5A 2B8QA 2ZHAA 3CO9A 4LRFA 2BRKA 4YR2A 1QSSA 2E5IA 3WIVA 4P72A 1EX8A 3WX4A 3T1AA 2AYMA 3AQPA 2C3PA 2JHEA 2MQNA 1FE0A 3Q2TC 4LR9A 3MMJA 2EFVA 1Y11A 1NSKL 5D77A 3D6HB 2H65B 4LF7F 1YJVA 1RT6A 4ILMA 3BEGB 1D9FA 1YLXA 3QRPA 3IC1A 1ZZNA 4LFAJ 5KFAA 4CYUB 3SFUA 1UVIA 2H51B 1KN6A 3CVKA 4G3IA 3M2UB 2N3LA 3X3UA 1EP4A 3EE3A 4RNHA 1IR0A 2MKSA 1CPZA 3I9ZA 2CJXB 2AJ2A 3ILJA 4LIWA 2POKA 2BQRA 1R0AA 1RTJA 3UDCA 3GYGA 2WTFA 1X9WA 1UWBA 4LF8F 4F3MA 4WKRA 5AE1A 2CQ2A 3S6EA 4P6QA 1RAGB 4O3QA 1HLWA 3OTOJ 2WVFA 1RTDB 2DNOA 4AUKA 2VG5B 1UFLA 2DY9A 1FT8A 3ZTQA 4RW6B 4DR4J 3JSRA 3IN5A 4NXMF 4NLQA 4DUYJ 3ISZA 4N47A 2GHWA 4OX9J 1M0SA 4AQYF 3C15B 1TV6B 4C0HA 3F44A 3RBDA 1N33F 1SJRA 8AT1B 1FI4A 1JLEB 4XAKA 1AROP 3KJFB 1N6QA 2HURA 5L38A 4KAIA 1S1XA 4FS1A 1TELA 1IKWB 4RNFA 3LGMA 3M30A 4LF5J 3V81A 1LW0B 4UF4A 4ZVGA 4DV1F 3T5JA 1BQMB 4V19J 4ZVPB 1FWLA 3BGUA 4GO5X 1R8HA 2QLFB 1QE1B 2ZBQA 5DETA 2HMIA 5EUHA 2JC0A 4PPDA 4CWBA 3K7RA 1TL5A 3D6TB 2QZ8A 4OIXA 5I42B 1QM9A 1DZ5A 2ADBA 4KV8A 4XIUA 1WOOA 1D9AA 3C16B 1HYSB 3QLHA 1V5VA 1YJ7A 5E3QA 4I64A 3LGNA 1FKAF 3TZWA 3PIPQ 2OFGX 1DTQB 3O8WA 2QA2A 1S6QB 1OY6A 5BXIA 3M6WA 4IH6A 1TFYA 4CLWA 3RJMB 4RWXA 4ZDNA 2BW7A 1X7VA 2KHCA 2P6SA 4DL3A 1PILA 2W9CB 5DQGA 2BA9A 5BR8J 4UT4A 4OLPA 1Y3KA 2W8LA 4FF3A 3RRGA 4RUBA 3I5CA 3N9UC 1N32F 1XMOJ 2VBWA 2IYGA 2Z2ZA 4J9KA 1ELOA 1U24A 4M5IA 4FF1A 3IWNC 2MZRA 2W24A 4K4YA 4QIFA 2OLWA 3B8HA 3KJVB 1S59A 4Y34A 1K0TA 1BY9A 1GAOA 3D0GE 3LP0A 3T41A 1Q1KA 2W9BA 1H74A 3ILLA 4DSJA 2AEJA 5DQIA 1IBLF 5H9FJ 3NCRA 4EBDA 4IOBA 3M8WA 3JQKA 3PHEA 1RAOA 3FC9A 2A1BA 2DR6A 1VRUB 4JP8A 2BE9B 3A8IA 3BQ0A 3I9V9 1KKHA 4LRDA 3FZBA 1T3OA 1Q7LB 4LF9F 2BACA 1FTCA 4LSLA 3TX8A 1JMTA 2CWKA 2J7UA 3MMAA 3PNIA 2NREA 2B7CB 2R7UA 3W65A 4J9NA 4MFBA 2NXNA 1MWZA 2DGSA 2OHDA 1LWEB 3GV5B 4JI3F 3TVKA 2WSCC 2MQQA 1IVZA 4ELUA 3ET6A 1TKZB 2O5DA 2QL7B 1CJVA 4DR3F 4LMZA 1SL2A 1R0CB 1U47A 4E0DA 3KTQA 2OGUA 2JJ4D 1PKUA 3DXSX 3UCZP 1URNA 3VZIA 4AFFA 4J9OA 2JVOA 1NJYA 1OS5A 5AE3A 3TZZA 1UETA 5EHHA 3BBCA 5KT6A 5B0AA 1A7GE 1SV5A 3PW7A 1FESA 2YKMA 1JXEA 4UOHA 1WD6A 3O3LA 3GIRA 3NMRA 4CO2A 3Q8YA 1T9XA 2BYCA 2YWEA 2IFXA 1VC6A 3TUJC 1U1OA 4QCLA 2FLNA 3TYTA 3S8SA 3W3SA 5HATA 4JBCA 4P2SA 2WCXA 4Q8FA 2QN6B 3CCQS 4ED2A 2BRLA 1RCXB 3X1LB 1FO1A 5KFKA 3LW5C 3M6XA 1S9GB 2MEWA 2V9WA 5ITHA 4MMOA 4PG6A 2B3TB 3D54A 2UXBJ 4Z37A 5ETVA 2VFRA 1CLFA 5H9FK 4RW7B 1SBRA 1XMBA 3MM5A 2WW4A 2Z56B 1TK8A 3CWJA 3HVTB 1VS3A 4OI2A 1J5EF 1YJNS 1T05B 2M7SA 4JI0J 3DOKB 4DV2J 4CCHA 2WB4A 3DLEA 3MEKA 2V94A 2A2DA 2RQ4A 2F1FA 4H4OB 3M8YA 1VHFA 4AE5A 5D15A 2ZD1A 2V4QA 1TTHB 4OZNA 3SV3A 3NNAA 2A0FB 1E6YA 3B78A 3D4JA 2XMJA 1IWAA 3MAAB 4G6VB 5FDLA 3QT6A 2PDAA 1D8ZA 2HWIA 1HI8A 3FCWA 2M3DA 4NLDA 1IWGA 1WACA 4FNHA 3BB5A 2CJBA 1R89A 2RHSB 2WVDA 2GVDB 4NRUA 5FJ4A 1MROA 4F2RA 1T94A 4UOGA 4A4JA 5HSPA 4B3SF 2OEJA 2VIHA 3DRPA 2L9DA 2VFSA 5F9LA 3S01A 4LRCA 4ZIWA 2H5JB 1M5SA 4URGA 5K20B 3BGRA 1RK8A 1FWKA 1NK9A 4ZN1A 2R2UA 5M2RA 1UVKA 2IJNA 1NJZA 2R2RA 2WVCA 1VK3A 4U7UD 1IR1A 2M5YA 4DV0F 3US5A 5IQQA 1FDNA 1TL7B 1LV5A 1OMSA 1VQYA 2OIHA 1CJTA 4OHYA 4X66F 4WFYA 2CQPA 3PYFA 2LU2A 5DLGA 1FDBA 3GFXA 1KQFB 4DX8H 4KGKA 2BM1A 4P2FA 4LJMA 2CPHA 2PT0A 1ULRA 2EI5A 2HHHF 4PCQA 2W1BA 4CP5A 2V63A 2HRTA 2YPYA 2VFVA 5DDOC 3AA9A 1B3TA 5KFBA 2MZJA 1H2VZ 2KVIA 3PIOQ 4DPOA 3R27A 3DN9A 3D1OA 3W7BA 4J9SA 3BYPA 4OZ5A 3SCLE 4ETXA 1FXDA 4IG3A 2VPWB 2C42A 3VCDA 5GAEU 1FJ7A 3BN7A 3DU5A 4IG0B 4KQZA 2I8EA 3BQ1A 2IMOA 5HROB 1SC6A 2BJDA 5D78A 2XSJB 1E6VA 3KLHB 3U02A 3HHLB 2RB7A 2MQLA 1ZA1B 3N6MA 1S9FA 4KGVB 4P2XA 3HVRA 4ETZA 4JB8B 1PYTA 1BXNA 1VRQC 4YHHF 1RLCL 5J2NA 4M63A 1XR7A 1R0BG 2B7BB 3NLCA 3C46A 5FLXU 3MM6A 2FZCB 2EFOA 2XCPA 4O0NA 2J7KA 3LANA 2H3EB 1HIYA 5KFHA 1GNKA 3NKYA 5HLFB 5KG0A 3GILA 3UNYA 3KLGA 4PUOB 1Z2LA 4CLTA 2RIJA 1SL0A 1EKRA 4Y65A 1TL1B 4R0EA 2GAGC 4DG1B 5I3UB 1FRHA 2QEXS 3M8QA 4JI5J 3UVJA 1T9UA 5HVGA 3OXFA 5KFTA 3CMQA 2IVMA 2CG8A 5CQGA 2WZ1A 4ECWA 2BV3A 4GKKJ 2V2QA 2R42A 3C6UB 3ELHA 2DIUA 1KVJA 1OY9A 2OPPA 4DLGA 1IR2A 1RT7B 3JTPA 4WJBA 4OV1A 4B3OA 3IBWA 4Y6IA 4URQU 4ZP8A 1BQNB 1YX2A 2MQPA 1Q82T 2KYZA 4YR0A 1KFSA 3CCJS 2DGXA 4XPEA 4TLRA 5T41A 3DOMB 1BE4A 1DQ9A 4C0OC 4DWIA 3GIMA 2G1DA 1GTEA 2YNIA 1X5PA 1NK4A 3UN2A 2XLIA 1WELA 4YR3A 3P49B 4ANDA 2BMBA 3OBIA 4DS4A 4CH0S 3H20A 3EVOA 4CDIA 4QIWD 4QZVB 3W9IA 5GAGU 3NCPA 1VQKS 1RBAA 5DZ7A 3FKBA 2RILA 1REVB 2O67A 2CJ9A 1XNRF 1QSYA 2KJWA 2DKOB 1XC9A 2UUBJ 2R7SA 1C1BA 4EK2A 3KK2B 3VALA 1LK5A 1PAUB 1T9WA 4C7QA 1YIJS 2EC0A 4LF7J 1Y4ZB 3FEZA 3SDEB 3EWGA 2DJWA 4C8KA 3PW5A 4FBUA 3KLIA 5K8MA 4ICLB 2RUGA 5E3CA 4WTOB 4XDCA 3SYZA 3B82A 1S48A 2HW3A 1Q5YA 5ETOA 3G6ES 1TUWA 4PWWA 3POTA 4TYAA 3VTIA 3BDPA 1JWWA 2JSXA 1CS4A 3KK1B 3DMJB 2AU0A 4R25A 3ZTOA 2HLUA 1HWIA 2AJQA 1F0XA 5L46A 2FPHX 1RGVA 3SFGA 4LF8J 4JI2J 3B54A 2U2FA 1RT2A 4M5DB 5LSLA 2KO1A 5A2QU 1O6XA 3MD1A 1KQSR 3VAIA 1VISA 4RU9A 3RR8A 2L3MA 1RTIA 1HBUB 3AA8A 1HKAA 4O3PA 3TAPA 5IV3A 1NSQA 4OI0A 3FVYA 4OYPA 1S12A 3OW2R 1GMWA 3OL9A 2HFUA 5E2QA 1ZPWX 5ETLA 1CJUB 1WJ9A 2ASYA 2QJ3A 2YTCA 1RI7A 4LQ9A 2ZHBA 4AQYJ 1N33J 2DD8S 1QSLA 2QA1A 3DLHA 1B70B 1FFWB 3MHYA 2JDJA 5T14A 4ZLLA 3FQKA 1WHYA 2DNRA 5H9EJ 2XMTA 4I6AA 2DNYA 1FFGB 4N8NA 2ZH2A 1SC4B 2Q66A 5MAOA 4CM2A 3C8YA 3GMGA 4DCJB 2UVWA 3VGSA 1VHIA 3W2WA 2VPYB 5DO2A 2W2PP 3DC2A 2V8HA 2CDQA 3HFKA 4I0WA 1HBMA 3AAWB 3OJSA 1A0OB 3K2YA 2XM3A 1VBKA 3HD2A 1K73T 2U1AA 5C24A 2B6AB 5MLCV 2ZHOA 4K5SA 2PGCA 4NLPA 5GAHU 1MMDA 2HVDA 1PAEX 3OD2A 2BQ3A 4OZLA 5CAAA 2LECA 3N01A 3UDEA 3BN4A 4LF4F 2M70A 4QYZJ 4X4OA 1O8BA 3HO1A 4CO4A 4DR7F 2AV5A 5KFWA 1QVFR 4ZVOB 3M7VA 3W5ZA 3BSAA 1X8DA 3JQJA 1RWKB 2HLTA 4WZQA 1N88A 1ZYQA 3FJ2A 4JI6J 2IY5B 2VONA 2QLXA 4KYZA 3W9JA 4NRTA 4QPTA 2V9KA 1W26A 1N32J 3ISND 5KFRA 4CYUA 4BWJA 4ZPBA 2AMCB 5THWA 4PR6A 2VODA 3M2UA 1I6JA 3HHLC 2PN6A 4EZ9A 2F3JA 1XK8A 4F25A 3H2VE 2OPRB 4AL5A 3CJ0A 2DGTA 1IBLJ 4X4TA 1RWOB 2KU7A 4F4YA 3MURP 3TUIC 2LQJA 3MR6A 2C2KB 4EU0A 2CPYA 3M05A 3HK2A 2XULA 3GG0A 5F8LA 1RTDA 1TMJA 2PC6A 2VG5A 3UD5A 4YP3A 3CCWA 1Y5NB 1RZMA 3GU0A 4RW6A 2ZBIA 2DGOA 4F2SA 1M5KC 4K59A 1Q5VA 1X4EA 3UCGA 4DV4F 4ZVHA 3FCHA 3UE2A 2AX1A 3FQLA 3DLKB 2Z0GA 1N5TA 4ELTA 3C15A 1TV6A 4Q0BB 3QMQA 1JLEA 1FDDA 3I4HX 3CD5A 1L3UA 5DZ6A 4NZ6A 5B0GA 2G4BA 1KC8T 3H2LA 1IKWA 2CXEA 3G82B 1LW0A 4DR3J 4FDFA 2IM2A 3MZIA 2YWFA 1BQMA 4DR1J 2XZWA 1VQ5S 1FX4A 3BV8A 1QE1A 3KDNA 4MIAA 4B9SA 2KVQE 4QU7A 1H0HB 3L7OA 1QD1A 3RU0A 2GIRA 3MM9B 4FN5A 2NXJA 5I42A 1B0PA 5L9NA 1XBWA 4ELVA 4TVAB 1RTZA 4USJC 3C16A 1HYSA 4ZITA 4OI1A 4NE9C 4FYWB 2WHOA 1D09B 2FJBB 5D0EA 2KZMA 4ED4A 1DTQA 5LM7E 4J90A 4CI0B 4X4SA 3BPDA 2DO4A 2UVUA 1S6QA 1IKYB 1RE1B 5IZHA 2QLJB 5A8KB 3MR7A 1U49A 2NPFA 5F8MA 3MAQA 2HNDA 1OYDA 3OTDA 5GMEA 5F3TA 2VQEJ 3K89A 3G87A 3BQ2A 3KWMA 2QGFB 4ANEA 4IR1A 3A13A 3GR0A 1VI7A 1PYOB 3VR1A 3TARA 2UXDJ 3LH2S 2PO4A 4H54A 3KJVA 1CJKB 3J7A1 3IFEA 1PIEA 1SJ1A 3MR5A 3CD6S 4CT9A 3AT1B 2M2BA 3CCUS 2XI3A 5DDRC 2PA8D 1XNQJ 1I94J 4IRKA 1UPPA 4DUZF 4J91A 4I69A 2QIFA 2KL8A 1PCAA 2D7SA 2ZZNA 3F0NA 1VRUA 2OKQA 1X4CA 3Q8QB 5HMXA 2JEIA 3HKZD 5HI7A 4X2BA 2UV8A 1W7WA 1WI8A 1HQ2A 2DVIA 2FIUA 2HQGA 3FUYA 5F8NA 4OFZA 3OV7A 2W01A 4AT1B 2W2QP 4DN9A 4ZVQB 1KHWA 2ADCA 1LWEA 1T8EA 1XN9A 1ITPA 1EHWA 3QIPB 1WORA 2FY8A 5CYMB 4X4NA 2QE5A 1TKZA 3EXYA 2YH1A 3QJPA 1B7YB 2V2ZA 2EEYA 1UJ5A 2XTJP 3CJTA 3I31A 1NSPA 1JLCB 1KWMA 1DLOB 3CIMA 4QIGA 1URRA 1C0UA 4AD6A 1BUXA 1R8PA 3V6HA 3OHBA 2XMVA 4CLKA 3MTKA 2R7TA 2ZBRA 3GZ7A 1FJGJ 3SMZA 4MTPA 4X84A 3VWSA 4O3OA 3H5XA 2E5GA 1VQSA 2HWTA 1MWYA 2ZDPA 1HQEB 1TKTB 2LEPA 3RTVA 3OFHA 2DBBA 2Z4PA 3EPGA 2QYCA 2ZFHA 2C3YA 3K5MA 1RSCA 2HVZA 2JZ5A 2HGLA 3T5KA 3T3FA 2ZH3A 4LF6J 2CQ4A 2BKOA 2L9NA 4ZVUB 2J7WA 1U02A 2C3UA 1XERA 4LRAA 3DHXA 5LJ3Y 1XQIA 4OMFG 3HCXA 1NPKA 3CTRA 2RDJA 4L6V3 2HFVA 1SUQB 1PJ6A 3H90A 1S9GA 1M5PC 2ZM6J 4UTGA 3FNNA 1OYEA 2AJ1A 3LPYA 2O3DA 3UR3C 2Q6CA 4RW7A 2A6OA 1N34F 2EC2A 3VAKA 3BKTA 1VFJA 2LMIA 3HVTA 3TI0A 5BJRA 1T05A 4PYAA 3DOKA 3MMCB 2CRLA 1I3OB 2O1PA 3GB0A 4EYHB 3NS5A 2HFNA 3HJFA 3RRKA 4H4OA 1O51A 2DGVA 4Q44A 1GMVA 2MHNA 1LNQA 4GC7A 3JQMA 4IO9Q 4OI4A 4OX8A 2I1RA 4ZJLA 2HZVA 3MAAA 3SQGB 2AX0A 3QPIA 2GVZB 2FLPA 3A3OB 4PEOA 1RT5B 2W2OP 1HWKA 2Z2LA 2KI2A 2XI2A 3HX9A 1WKLA 3EGWB 1RBOB 2MKKA 2GVDA 4JI1F 2XMUA 2OSQA 4PRFA 3NAHA 4PQUB 2IVFB 3FCVA 4RBVA 1NO8A 4OHZA 4DUTA 2J0WA 2XHWA 4HDHA 2EPIA 4C97A 1WSVA 2QRRA 1RWPB 2V8DA 3GFZA 1DY3A 5A76A 2B5JB 1VJWA 5GADU 3NRBA 4ED5A 3EDRB 2IC3B 4L76A 3E3XA 1WKKA 1HNVB 2ZITA 1TL7A 3ENAA 3IGNA 3MCOA 1OQ6A 1TKXB 1ZM9A 3UCUP 2HSEB 1SKWA 3M30B 3U27A 4QPXA 4KB7A 2GQCA 4DZDA 3IBCB 5B0CA 4F67A 4F4WA 4MK9A 4ZP6A 4K4UA 1RT1B 4LRBA 1X4GA 2LFVA 5LOQA 4DEZA 2VD3A 2DR9A 2IBKA 2HFSA 1U1PA 4QWBA 4A8WA 1SB6A 3AY0A 1YITS 4JV5J 4J9RA 2FJWA 4QR0A 4U6PA 3M8ZA 5AT1B 1D1UA 1SPBP 1M5HA 4KGXB 1NEEA 3NG8A 1FEHA 4DXLA 2ALZA 3DHWC 3MEGB 4EYIB 3PFEA 1TP7A 4H4MB 4ID5B 4C8OA 5E3PA 4IG0A 1XNRJ 2AT1B 2J6TA 4ALZA 4Q2LA 3SCKE 2DNZA 3JSBA 5HROA 2XO7A 2RHQB 1W2IA 2XSJA 1XR6A 2RE1A 3KLHA 3HHLA 3NEKA 3R5JB 2W9AA 2VG6B 2R7QA 5KG4A 1F2HA 4W98A 2HPUA 1X4HA 2QLWA 4B17A 2A2CA 3W64A 3Q24A 4P10A 3JAMU 3M2RA 4DL2A 1XR5A 4WU3A 3MR3A 3TZXA 1IBCB 1F9HA 1GFWB 4F7VA 1R43A 1YJTA 3J7ZT 1UVLA 5HLFA 4U7UK 4LBIA 4UY85 4MJKA 1U1MA 1C0TB 3GQCA 2PD1A 4PUOA 3GPAA 1TL1A 2Y0BB 1VQNS 4DG1A 5IXUA 4ID8A 5I3UA 8ATCB 2P9CA 4LFCF 2PI5A 2NXCA 2F7VA 1UJ4A 1ZM4A 4PG8A 1RB0A 1OY8A 1U1QA 2DHGA 4C98A 3HFZB 1KONA 4DFPA 1OSCA 1Q0NA 3PDNA 2UXCF 4DU8A 2J9DA 1TAQA 2H1YA 4KRWA 1EIYB 4DQSA 4RUCA 3C6UA 5B09A 2HHPA 1RHJB 2VPZB 1RT7A 1YRTA 4B9LA 4CT8A 4EO6A 2Y9HA 1HNWJ 2APOA 4JV0A 2XY7A 1BQNA 1RDRA 3OXLA 3TJ8A 3H7HB 1KD1T 2RUSA 2V2VA 4Z7YA 3OR2A 3DOMA 2F4VF 4F36A 2DNHA 2R2TA 1S76D 1TMMA 1JB0C 2GQQA 4OJ1A 1FA0A 2B0GA 1MW7A 2E5LF 4ES2A 2BM0A 1Q4RA 3A8EA 2YX1A 2W4CA 1SQFA 2NLWA 3DRYA 5F0WA 2ZBCA 5KFYA 2DT9A 5CD4A 1Y3JA 2RQKA 4LF4J 3TA1A 5HMWA 3MPVA 4K4SA 1REVA 4C48A 4ER8A 4DR7J 4A8XA 3MM8B 2J6UA 2LYVA 5CXTA 4DV6F 4DPXA 1GEHA 3KK2A 4CO1A 4DOZA 3CCMS 4LBPA 4KH1B 4M5JA 3DRSB 1HHQA 4B9VA 3EDQB 3SDEA 3ILIA 3I82A 2KM8B 4ICLA 3OXGA 2IA6A 4MKYA 3E51A 3UD4P 1HI1A 1QY7A 1NU4A 2PFDA 4HR2A 3A8KA 3IR7B 2NZCA 4DU7A 4LUBA 3KK1A 3DMJA 3HP6A 1EQMA 4NXNJ 4OV6A 2MZQA 2XNRA 2N4DA 5KFOA 4PKDB 1JKHB 4CO5A 4K4WA 2D3ZA 2MJUA 4RW4B 4M5DA 2CNOB 2CPZA 3MDFA 1T9YA 2QL5B 3T5HA 2N3OA 5CYJA 1HBUA 2FVQA 4RPFA 4ECZA 3RBZA 2DCUB 3K5NA 1S1VB 3BS9A 1AUSL 1CBKA 1E6YB 1Z2ZA 2HIQA 1T3NA 3FBCA 4YB6A 4GO7X 2R3VA 1CJUA 3PVXA 3PYDA 2BKNA 3BR9A 1HQUB 3VGUA 2X3DA 2Y1JA 4MH8A 4DN0A 2XWYA 2YWWA 2YKAA 1U0SA 4ATNA 5EX3A 4M5NA 3P5TL 3HULA 5DM6Q 3PKYA 4RBUA 3WHIA 2NUUG 4KGZB 1Q7YT 1F5BA 4CIOA 2ZWOA 3IGVA 3QO9B 4B9MA 5IT9Y 3AB4B 1S0MA 3AB2B 1FRKA 2B6AA 2RSQA 4RKUC 4LSNB 3FSXA 2IDLA 3GJRB 1ZAWA 5KFLA 2HRYA 3OTEA 4TNOA 5JUMA 3VAJA 1ZH5A 4CNYA 1F5CA 1X4BA 3LGHA 3BDEA 4U67Q 4JI8J 5CZVA 5KT5A 4NLXA 3VAHA 2GCFA 4WE1B 3T1YF 4DPTA 2B9YA 2R8GA 1RISA 5ETRA 3S1TA 1LKZA 4NLVA 2VC0A 2GIQA 4JOUA 5K8OA 1HD1A 1U0HA 3CD0A 4HVZA 2Y8YA 3DLJA 4B3TF 5EX0A 5KT4A 3UFCX 4F0MA 4JI4F 2GX8A 2MQOA 4MK7A 1TQLA 1W25A 5F8IA 4O44B 1R6YA 3CO0P 3GIIA 5ETTA 2RD5C 1LOUA 4HACB 2NSCA 2K3KA 2NZ4A 2ZJQQ 4QU6A 1CC8A 2R7RA 1GH8A 1H2UX 4E98A 3K8VA 3M6VA 2K2PA 4P2MA 2OPRA 4EUVA 3JYTB 2ZKUA 3NGRA 3EZOA 3M1VA 4DUZJ 1P9QC 3FZ2A 5ADZA 4GVLA 2CG4A 2HYIB 2C2OB 4WP9A 3IM8A 3AQOA 2KDOA 4JV2A 1PBUA 4X62J 2FC8A 2MZTA 1FFSB 1KLMB 3GCWP 2QA4G 4DR6F 5B0FA 2DIVA 4RWWA 2KZZA 2XO6A 1YBAA 3MECB 1VMBA 3H5SA 3WDOA 2FHMA 2KH9A 1KEKA 3MM7B 1N0UA 1YRXA 1H7WA 5EN1A 3K0JA 2OPSB 2H5EA 3DLKA 3TO8A 2LLZA 3CJ3A 3D7SB 1WTFA 2OEKA 3CIZA 2ZC3A 2OUGA 1Z4UA 2A18A 5LXYA 1KOHA 4IOCQ 1NHVA 4FNIA 2NR0A 4WFZA 2OP5A 1TUVA 1RHKB 2X7IA 3G82A 2BABA 1MMLA 2ILZA 2ZNZA 4HLBA 3RW7A 4L74A 1KSPA 2RS2A 2ILYA 3JAMY 4ZVRB 3GONA 3MCSA 3PW4A 3HJVA 4O3RA 3EJMA 3FRYA 1FWPA 2Q6BA 2XZDB 2I0XA 3NBPB 3O1LA 3MM9A 1GTHA 1AUDA 1NDKA 3EGZA 4J9UE 1U09A 1UPMB 5FIIA 4USVA 4Q2MA 2C2ZB 3UD3P 1MNEA 3EXCX 4WIQA 4JUZA 2XYHB 3H4BA 5LSOA 3C6TB 3IO1A 1HBNB 1VQ9S 3O2IA 3G2XA 4NWBA 1U2CA 1IKYA 5JMNA 4PWDB 3BGLA 5A8KA 4PYDA 4USHA 3G8QA 4WFNQ 3CDBA 1QUPA 2K06A 2KXNB 3D66A 3C19A 5IFMA 4ECXA 2X3GA 4A8YA 3G6VA 3OFGA 1XMQJ 3LWLA 1P1LA 3DM2A 3PRBA 1S49A 3RBXA 2K1RB 2G9OA 5EWFA 1CJKA 4ZPVR 1UP1A 2HS4A 2NXUA 1X60A 2C3OA 2GZOA 2MKYA 3CJ5A 1TL4A 3D6FB 3CDWA 2XY6A 1WG5A 2ERRA 5D4PA 2KM8C 1AA1B 2E5HA 1T02A 3FMWA 1VQMS 3D2WA 3KUHA 3IP0A 1FHTA 4ZPDA 4KJIA 3C2PA 1LK7A 2MYFA 4IKAA 2LQ9A 1VQ8S 4WYWA 4ZVTB 3HSJA 4ENOA 3BGFA 4DFKA 3MOJB 3R7BB 1KTVA 2RMLA 2E9TA 4DX7A 2I6WA 4I6YA 4CLPA 4ZHRB 2KT2A 1KNZA 5IWAJ 2YNFB 2OTLS 3RAMA 2KFYA 2ACYA 2LP4A 2GS8A 2RU3A 2EFQA 4P9SA 4GRSA 3J81Y 2QFJA 2XS7A 2UU9F 3H2UB 3IA0A 3QIPA 1SH2A 1HPZB 1S0NA 3RB4A 2FD2A 2BR0A 4ECRA 1FTRA 4B02A 3VGTA 5BYSA 3G8SA 4Z2XA 1JLCA 3PZPA 3UPFA 3F56A 1DLOA 2DH8A 5K5MA 1PJ7A 4NASA 3TJAA 2HK2A 3I0SB 4JYAF 1R3NA 1HW8A 2QFIA 5JVHQ 3H40A 4L3KA 1H38A 1WC3A 4KT0C 2CNLB 2K8GA 4DHVA 4FBTA 3EGNA 4TQSA 2VICA 2HEKA 2ROEA 2QA4S 2DNQA 4NLUA 2OD4A 4NCBA 2HHWA 4DPWA 2PEHA 2ASLA 1HQEA 5E5NA 1TKTA 2D9OA 2WAQD 4KHPF 1VQOS 1KBRA 4FP9A 5DS7A 1PO6A 3ZZ0A 2RU9A 2YKNB 4JV1A 2HQFA 4NA1A 3PX4A 2MDAA 2Y8WA 5KFSA 2VF3A 4B3RF 1VC0A 4QR1A 1J2VA 3Q0AA 1HNZF 1VQ4S 3TANA 4NOHA 1HR0F 2DGWA 2E1CA 2HVEA 3PX0A 3ZTRA 3THTA 3LALA 4DQIA 3MGJA 5ETSA 5LXRA 1SUQA 3V6KA 3HKWA 2HBZB 3CEDA 5KFXA 2AYBA 3IM9A 5A8WB 3VAMA 1UEUA 3NY0A 3P45B 1WG4A 1FNOA 4IRCA 1SKSA 3MMCA 2J8SA 2X1BA 4Y3CA 2E1PA 3QZ7A 1NKCA 4USWA 2UUWA 4QOTA 3QAEA 1PGZA 1DRZA 2BJ9A 1F1BB 5F8JA 3G6XA 3L4BC 4Y2MA 5J2MB 5KFJA 5F9NA 1NMEB 4K2XA 3HHDA 2EK6A 1TVRB 3H0PA 4RNMA 2L9WA 2DCLA 3SQGA 2MHEA 2HRUA 2GVZA 2MKIA 3IS9B 1RT5A 4DQQA 3AOCA 3J80Y 1F5AA 4AXJA 2D41A 1XWLA 2H9ZA 2B4OA 3MOZA 4QR2A 4PAAA 3CCVS 3PXGa 3I32A 2FGOA 3BR8A 1YBUA 4PQUA 1SL1A 4NA3A 3CNQP 2YNGA 1S57A 3EGVA 4CO3A 2B9EA 2VZ9A 4DV5J 5CZXA 2BE2B 2GHVC 3OT9A 2P6TA 2B5JA 2GO9A 3T1HF 1M5VC 1EB0A 2IC3A 2EW9A 2UXCJ 2EFGA 1WEYA 4FYVB 2D3O1 1VRTB 1HNVA 2MGZB 5CCMA 5E41A 3WQPA 4KHRA 2X1AA 4PG5A 1TKXA 4K0KJ 3R9LA 3TAMB 2DXFA 1RAFB 3DU6A 3P5BP 2C2MB 3BO3A 2HQ3A 1PYSB 2ZWPA 2O66A 5IC4B 2HAFA 2H5IB 1U1KA 3LO3A 1IUJA 2EK1A 3GLJA 2CAJA 2AEFA 1S72S 4F26A 4DR5J 1RT1A 1JJHA 2F4VJ 1NHUA 4FKXA 6FD1A 3CMES 1U1LA 2XYGB 1HNIB 3HLUA 1U1RA 1T9VA 2KB2A 2FZKB 4CLZA 1SI9A 3GIKA 2QYGA 4HHJA 9ATCB 3M32B 3MCNA 5HQ8A 4FPIA 1FD2A 2UZAA 2XLJA 3MEGA 4LF2A 4TU7A 4H4MA 4ID5A 1NRKA 2FVSA 2C3MA 4XPCA 3K5OA 4HT7A 3AD7C 1IKXB 2P9EA 2PSZA 2HNDB 3GFYA 5DGAA 4UZBA 4PWUA 3GJSB 4OYXA 2FVCA 2JC1A 4A8QA 1SJ4P 1AFJA 3D28A 2VG6A 1RAIB 1AZSB 4YN3B 2LEBA 4WKYA 2QMXA 1D0EA 5J2PB 2ZVSA 3N0VA 1QLNA 4DR4F 4MKBA 5GMKa 2HS0A 1SKRA 1WC5A 3EZUA 1VQPS 2CQGA 4OX9F 4U96A 1MWQA 4NYZA 1FKOB 2CJKA 1C0TA 4KIAA 1UMJA 2XG8A 1OO0B 4NCGB 3OUYB 1S9EB 1S1UB 4KR0B 1RA6A 3OR1B 5KG7A 2KG1A 4C3KA 3MPWA 2OD6A 2BKPA 1VGYA 3RYLA 4LF5F 4NI2B 1YQHA 4R5PB 1SH0A 2QSFA 5KOWA 4HKQA 4ED0A 3O44A 2W4DA 1MMNA 3D0IE 4TLQA 4MYTA 2UVVA 3BSCA 4C6AA 2R7WA 1RAHB 3LP2B 2CUYA 1YJ9S 4QWCA 2VBYA 3NL0A 2ZE2B 4EFAC 3LP1B 2CNKB 1AXQA 3HM9A 1IBKJ 4WP8A 4G65A 3M9MB 4FYXB 2RRBA 1U8WA 2R2SA 1WKJA 2LEAA 5JVGQ 3NGDA 2HBYB 2R8JA 4LR8A 1XTZA 4ECSA 2V69A 4BBYA 1K1SA 1ZA2B 4ED3A 3A3NB 2QX0A 1C0UB 1D9DA 4U9RA 1YSJA 4TKTA 5C5JA 5BR8F 4DSEA 4OI3A 3DRRB 2F4FA 5HMZA 4XO0A 1PSDA 4CQ1A 1HI0P 5DM7Q 3C3LA 1XMOF 2R8IA 4K8RA 3OFEA 2RDIA 1KOOA 2IM0A 3RAQA 2NXEA 1JNRB 5KFZA 3D3CJ 4OHXA 3R2CJ 2JWNA 1PG5B 3G96A 2AQ4A 5K14B 3GV7B 2IRXA 4J9QA 3MM8A 1RKIA 1VBXA 2V4JB 4N5SA 4DCPB 1BMQB 1RA7A 2HNZA 2Z2MA 4DX5A 2B43A 4KO0A 3DRSA 4O3NA 5JXSA 1ZS6A 4Q45A 4JI4J 3MF5A 2BOPA 4GKJJ 1O0PA 1LWXA 2FVRA 2QTWA 2R8HA 1FKPB 2XGPA 3KNAA 3SXLA 2HQCA 4FYYB 1GK8A 2PIIA 2OO4A 3CCRS 5ETKA 4CLLA 5CA5A 2NYHA 3NXZA 1N4LA 4KE5A 1NK7A 4DF4A 1DURA 2BZ2A 2WBRA 3CC2S 1JKHA 5C42B 5J1EB 5A0YB 3MCMA 1VBZA 1NB7A 3FRZA 4RW4A 1H7XA 1NPRA 3M2VB 4OZ2A 3TA2A 4IFVB 1L5UA 1HBOA 1KFDA 1DFDA 1S1VA 3J7YI 3KFWX 3OLBA 3ICLA 5DGBA 3QFHA 2ZDOA 4ED8A 1Y7PA 2CJYB 2W7PA 3RUBL 1HQUA 1Q8LA 3KNGA 4IH7A 3RB3A 1HHTP 1SIZA 1RHUB 3PKMA 3I4PA 4DPUA 4NYPA 1WHWA 2J0XA 2L41A 4K4VA 2XNQA 4NMLA 3EX7B 4BS2A 2F63A 3QO9A 4KKOB 4ES3A 2DRBA 1N56A 3AODA 3I96A 3Q22A 1L3SA 4LSNA 2FTRA 3L7UA 1W2BR 1RWNB 2CZVC 1DQAA 3BYRA 5M2UA 4FS2A 1RYRA 4EWTA 1PC5A 4HHUA 3PO5A 1DTTB 2NS1B 5L9XA 2WBMA 1AT1B 4J9PA 3DGPB 4USIA 4WE1A 4J9VA 4BLGA 5CD4H 5IOLA 2UXBF 3L09A 1YBTA 2P5VA 3HT0A 4ILRA 4M95A 5KFIA 2BEFA 3FDSA 2CDRB 3M4XA 5LMNJ 4JI0F 2JX2A 2CVIA 3I0RB 4DV2F 2AYEA 2FHJA 4I2QB 2I38A 4YEAA 4O44A 2CJQA 3CJ2A 3ITHA 3VQSA 2C1EB 2WOMB 3DCAA 5E7OB 1G4CA 2XY5A 1FXLA 4HACA 2P8IA 2BBEA 5AJ3J 4OYWA 1KHVA 2KXFA 2IM1A 2DTJA 4GVBB 3JYTA 5ETQA 5KG2A 2V6AA 2FVPA 4RR5A 2DB1A 1LWCB 3LOUA 4LFBF 2VV5A 3Q2SC 4NX9A 1S1WB 3QRQA 3W8PA 3LPEA 1KLMA 2WONB 4BWMA 3K59A 3M2RB 3MECA 3ZXWA 1T11A 3CJRA 3MM7A 3VHQA 3QSIA 2MKCA 3MEEB 2OMLA 3FBEA 2OPSA 5IS2A 4RLEA 5CYQA 2MJNA 4YMEA 4WFAQ 4HEA9 1BLUA 1N36F 1HNXF 2DHSA 3K57A 1IQZA 5KFNA 1JJ2R 3IBFB 1FERA 1CQMA 1Y9OA 4ZIVA 2VQFJ 2C2EA 5EDWA 2C2DA 1LQ9A 2DYAA 3CJKB 4AYBD 2D3UA 2VFTA 1OPZA 3LAMA 2GGPB 1S7HA 2RH3A 1VDHA 1RACB 1BHNA 4HI2A 2RF2B 1U2RA 3RB0A 4JYAJ 1VJQA 1UEVA 5A6WA 2IJRA 3NBPA 2Q43A 1H73A 3RGIA 2CADA 4WBFA 1ZPVA 3H5YA 1VR6A 2C2RA 3FBBA 1GX6A 2HHSA 1VLOA 3RZAA 3C6TA 1HBNA 3G86A 1MN9A 1YDLA 3HVAA 1VQ6S 1FRLA 2MKHA 5KTQA 1VLYA 2KG0A 4PWDA 2LXIA 4UOFA 3OR2B 4L75A 3L3CA 3E2EA 2CQDA 1M5OC 3OTCA 5A6PA 3DI6B 4B3RJ 2F8MA 2ABYA 2RVJA 2JFDA 1HNZJ 3ZNUA 3IMQJ 3B4DA 4W90B 2V8VA 4M1KA 3CCTA 2ZJPQ 4ZVSB 2K1RA 4B3MF 5KFFA 2AYGA 3ZFVA 2UV8G 2M52A 4ZCMA 1NK6A 4DZ6A 2AGOA 4I68A 1R8BA 2R7XA 2DXEA 4IRDA 1WEZA 2XWXA 4RUHA 3U1LA 5KT3A 1U26A 2IPOB 2D74B 2F9DA 3DOLB 2QC3A 4JI5F 2Z2YB 4R0JA 3CJSA 3UW1A 4ZHRA 3D9BA 1GMUA 2GMJA 3CDUA 4LREA 4NEZA 2YNFA 1AFIA 4K5RA 1UVNA 3DLGB 4F02A 2K3IA 1YK9A 2DO0A 3D1QA 3HFVA 2KRRA 1DARA 3I5BA 3VQTA 1X9MA 3SSSA 1NJWA 1RCOB 4CNZA 1HPZA 2AWZA 4TU9A 3TVYA 1RU1A 1LFPA 4UUXA 1JLAB 4PXCA 1C1CB 1HW9A 2CWXA 3MFHA 4R8UB 3I0SA 4X4RA 1UTAA 3Q8VA 4NXMJ 4OX6A 3GYXB 2CPFA 4GC6A 2MB0B 3H98A 4YY3F 1UW9A 3HZEA 4IH5A 1HWUA 5CABA 2WVEA 5AXMA 3TRGA 2IAJB 3W2VB 2QMWA 5AXLA 1SVDA 3UN3A 1NDPA 5KFQA 2P9GA 2EG1A 1SCJB 1CULB 2LXFA 5DRKA 4DV1J 2YKNA 3DFEA 4X64F 3BM7A 4N76A 2UUBF 4WFXA 1NUEA 4X4VA 5K9FA 2IMWP 2GFFA 2X51A 3PYGA 3KUGA 2D3OR 1S77D 2QG9B 5ETPA 3ZZZA 4ZMMA 4DX6A 3U7JA 1MG7A 3I5AA 2XCAA 2ZH8A 3R8YA 3GSIA 4A46A 2VA3A 5KG6A 1WC1A 4C9DA 3LTOA 3OVSA 1L3KA 3KDOA 1S97A 5E3RA 4N7TA 1MN7A 3BJYA 3G6YA 1JK9B 2ZNYA 3B6BA 1N8RT 1JJ4A 3EZ5A 1NKEA 2W7AA 3EPIA 2BJ8A 5A8WA 4H4KA 1U0HB 3QZ8A 4UUWA 3NNCA 2QMUB 1TUGB 2RRNA 2Y3YA 2HBRB 4P7TA 1KLNA 2IVYA 2FQQB 2ZUAA 4JI2F 1NZAA 4A8SA 1LW2A 1DHMA 4DL5A 2IRYA 1DAXA 2MMYA 3Q86A 4X4UA 2XEXA 5J2MA 2B9XA 1VIOA 3VAFA 3HSGA 4NA2A 1RHMB 4P52A 1RWUA 4KC5A 1T03B 4NLSA 3UNGC 3HHEA 1TVRA 1RT3B 1CVJA 3PW2A 3ULHA 2I5JB 3G8TA 3IS9A 2J0SD 4CO0A 3W5XA 3M1VB 4PG4A 5ETMA 2IJFA 3V2UC 2BANB 2B4PA 3CW2C 2VKZG 5KFUA 1VIXA 5U47A 1EZZB 2MQ8A 4RW8B 4USUA 2E5JA 2RJZA 1X4DA 4K4XA 2YXLA 2JVRA 2VB6A 2GNKA 4LF9J 4B08A 3P6YC 2ZH6A 4F04B 2E66A 2BE2A 1S6UA 3N6NA 2DH7A 2XS2A 4HL9A 3SSRA 5F8HA 1VRTA 3JTOA 3PTWA 1RU2A 2MGZA 4JI3J 1VQLS 3PJ9A 2LCWA 2DGQA 3IXQA 4Q7AA 2Q79A 2NYIA 5D6GA 5C25B 4M94A 3TAMA 5E0OA 3PJXA 4UQTA 2YQ3A 2H54B 5H9EK 4DS5A 4OJGA 3KG4A 1B0TA 4YQWA 1N48A 4Y2IA 4C3LA 1Q79A 1N5VA 2DR5A 1NXIA 4NZ0A 1UL3A 1H6KX 4ZVFA 1VYAA 4NZ7A 2L48A 1GQEA 2DXDA 4I1TA 5FLXY 4N41A 2BOAA 3FMBA 1MSWD 1HNIA 1KDNA 4JI6F 2FY1A 1FK9B 2DNKA 1H3DA 4C8NA 2V4RA 2E7XA 4IOAQ 1X4AA 3BSNA 1WOSA 3D0HE 3JSMB 3M32A 1JLGB 4DR2F 1NJXA 4QYZK 1Q53A 1YJWS 1NK0A 1NDLA 4MIBA 3P96A 1NJIT 4XDDA 3MEDB 3GG1A 2HQIA 2WSFC 4M8LA 2KT5A 3KYLA 4A48A 5GAEI 3PO4A 1T95A 1IKXA 2XMMA 4QIVA 5D0HA 1S5ZA 4K4TA 2BE7D 4ES1A 3HMJG 1RKJA 3DM2B 5BYQA 1X31C 2DITA 3AJ1A 1B7FA 4FZVA 1AZSA 1QTMA 5J2PA 2GJIA 4DL4A 1GT8A 5KFGA 4I4BA 2V2KA 2M8DB 4YOEA 5L1LA 3R7SB 4BC7A 4UZCA 4Q43A 2YX4A 6FDRA 1X4FA 3R3TA 4I6WA 1FKOA 2AD9A 2VBZA 2WW8A 1Y5LB 4NCGA 2CQ3A 3OUYA 2AZ3A 1S9EA 1S1UA 2BJ7A 1J5EJ 3OR1A 3QGGA 2QO3A 1REGX 3CC7S 2R7OA 3RG6A 4UY8T 4NI2A 2DR8A 1N5QA 4G1IA 4EO8A 4R5PA 2EBEA 4USKA 2CQ0A 2HBQB 3S7RA 4DR1F 3K17A 3W8GA 2VPXB 2IBOA 3MPUB 1UWAA 3LP2A 3OVBA 4ZCKA 2ZE2A 3V5RA 2Y1LB 3LP1A 3OTBA 1WWHA 2IHR1 3EVWA 3CPWR 5DG9A 1TL3B 3KHGA 3HF5A 4IDKB 1F60B 4Y0FA 3M9NB 1Z1ZA 3KJQB 4B3SJ 1TFWA 4KY3A 2G1HA 4OJ3A 2ZJRQ 1ZETA 4KFBB 4MYUA 3TQ1A 2MLZA 4RBTA 3BBFA 2VQEF 3VF0B 3GIJA 3DRRA 2DK2A 4DV0J 1RADB 1KVKA 3P3DA 4WF9Q 1CSJA 2UXDF 4C11B 2E9ZA 4WWSA 5GAGI 5A2QY 4F50A 4X66J 2D1CA 1JLQB 5K14A 1XNQF 1I94F 3AHPA 1F3VA 1IKVB 2V4JA 2G0CA 4EMDA 2RS8A 4Y00A 3BREA 3TQEA 1RLDA 4J5OA 1WNEA 4FKYA 2JOQA 3WC0A 4QBUA 2HHHJ 5GMDA 3ISNC 3PG9A 2Y1IA 4I7FB 3LF0A 4GMKA 2HHXA 5J1NA 3PW0A 5IM0B 3CB4A 3BGOP 5IV4A 5GVQA 3NGUA 1X5TA 4P71A 2M4MA 1JLFB 1EQ0A 1G7CB 6AT1B 1FKPA 1Y00A 1VBYA 2BJEA 4OZ1A 5LT5A 1NK8A 2OTJS 1N5YB 4C8ZA 1U8SA 3AJDA 3MMBB 4C3MA 4ZPAA 4RX6A 3DYAB 4USTA 1RJJA 5C42A 1OWXA 5J1EA 5A0YA 2JLGA 3IG1B 4G1QB 4ZPWR 4LFBJ 2M8HA 3Q8SB 2FB0A 2H4YB 3PV8A 4YUDA 1FE4A 3BH6B 1Q8BA 3KG1A 4DV3F 3M2VA 1UVJA 1FRMA 1K1QA 4IFVA 3VAGA 2CQBA 3GTYX 3V6JA 1S79A 1FVQA 2DGUA 1IN0A 3D67A 5D3GA 1ICEB 3E01B 1YZ7A 4PXBA 2GJFA 4YHHJ 2AHOB 3PR5B 5KOXA 2VHGA 5LL6d 1X5OA 4RL1A 1IJFB 1IQTA 2KJVA 1N36J 1HNXJ 1YZ6A 2C28A 4CTAB 2BVZA 2VG7B 1FJGF 3BF4A 4WK3A 3DDIA 1FDAA 1N0VC 1ZM3A 4ERDA 1XEZA 2OI2A 2FJXA 1RT4B 1FJCA 5B7WA 1ZZFA 2GHPA 1AW0A 1KP6A 5D4LA 3KG0A 3ENVA 2YNGB 2AW0A 3BSOA 2HNYB 4KKOA 3M8PB 1MU2B 1S7IA 4XTTA 2PI4A 2DRDA 3P8BB 4LF6F 2G2OA 1Q78A 3CF5Q 2Q1LA 2YNHB 5GAHI 1YHQS 2CA9A 3AOAA 3NGKA 2GC8A 1S6OA 1IJEB 4FXVA 1DTTA 5HO4A 3GWCA 4OHWA 4IQMA 3CCZA 3DGPA 2J5AA 3K58A 5HJXA 4F4ZA 1R8CA 2ZM6F 3AJ2A 4N8OA 4EBEA 4HT5A 3UO0A 3I56S 1V9OA 2DY1A 3JB9k 1JLBB 1SJ3P 3FSIA 4QIEA 4E2FB 5DG7A 3KXDA 1RTHB 2W25A 1KRPA 2HGMA 5HVFA 4ANCA 4B9NA 2RNEA 3I0RA 4F4AA 4I2QA 5HJYA 4ECUA 3PEHA 2CPXA 4ZCLA 1FCAA 2WOMA 3TOQA 1OIAA 5I3QA 3AOBA 3M9OB 2VA2A 5L1IA 3QGPA 2J9CA 3T9ZA 1C2PA 1S0VA 4B3MJ 2W4PA 3NAIA 2IRUA 3G9CA 2E1RA 1P1TA 1HFEL 3NGSA 3SEOA 2CFXA 5RUBA 4GVBA 5H1SV 4KSEB 2G2ZA 4PXEA 3A4TA 3OQ2A 2FJVA 5F3ZA 2AJ4A 1I5OB 1LWCA 3HHLD 1S1TB 4LVNP 1P8GA 4J9LA 3WZ0A 2BQUA 1S1WA 1HWJA 4RNNA 2E1AA 4EEYA 3IRXB 1TU0B 3O6QA 2ZOFA 4JI7F 3CGIA 2WONA 2R8KA 1Q8IA 2EBGA 4N77A 1WHXA 3L95X 2J9EA 2HHUA 1WOPA 3MXHP 5J1PA 2VH7A 2CNNB 3NGTA 3HI9A 4V19X 1TAUA 3MEEA 4HH0A 4P74A 2ASDA 3FBFA 2BDPA 4P73A 1JJCB 2VJUA 3RB6A 2OPQA 3P4UB 3FEYB 3V4IB 2VL1A 2FYXA 2X1FA 1ZBTA 2HZAA 1WDDA 3PCOB 2KN4A 2JRSA 3LA0A 3CJKA 5B0DA 5B0EA 1RHQB 1GXUA 4EGLA 2DHXA 2GGPA 2WSEC 2ZEJA 3QIDA 2XMWA 3HSZA 2GMLA 2RF2A 2A3JA 2I9SA 1UA1A 2HG4A 4MK8A 4RZRA 3W9HA 1J5OB 1V3ZA 3QWUA 3WBZA 4JV5F
chains in the Genus database with same CATH topology
1VRUA 1SH0A 2QSFA 4Y28C 2OKQA 1X4CA 4ZP7A 2HHTA 5KOWA 3Q8QB 4HKQA 4HTJA 4ED0A 3O44A 2W4DA 5HMXA 2JEIA 1MMNA 1ZAXA 3HKZD 5HI7A 4X2BA 2UV8A 1O5JA 3D0IE 5B0BA 4TLQA 1VQ7S 1WI8A 1S99A 4MYTA 2UVVA 3BSCA 2R7WA 2DVIA 2FIUA 3CD7A 5SUHA 3LP2B 1YJ9S 5F8NA 4QWCA 1C1BB 4ECTA 4ECYA 2VBYA 4OFZA 2CPDA 3NL0A 2ZE2B 3OV7A 1NAQA 1R31A 2B4UA 4EFAC 3LP1B 3JSYA 2DRAA 4AXIA 4ECQA 1AXQA 3HM9A 4WXWA 4DN9A 1KHWA 2ADCA 1B0VA 3M9MB 2N4CA 2RRBA 4ZOSA 3KLIB 2R2SA 2RRAA 1SJFA 3OL7A 1LWEA 2LEAA 4EBCA 5JVGQ 3NGDA 2F40A 3DI6A 4C8LA 2R8JA 1T8EA 2GW8A 3I55S 2VKRA 1XN9A 4O4GA 1XTZA 3EYZA 1Q81T 4DJBA 3F73A 1QAXA 2HWHA 4ECSA 4BBYA 1FNMA 3QIPB 3RW6A 2RQMA 1K1SA 1U2FA 2FJDB 5LSRA 5CYMB 4ED3A 2HFOA 4X4NA 3POTB 5F41A 2QE5A 2FJEB 3ENWA 1TKZA 3FFIA 2KTQA 1NH8A 2MPUA 4NCAA 2MXYA 5K8PA 5EWGA 1C0UB 1D9DA 4U9RA 1YSJA 3EXYA 4TKTA 2YH1A 3QJPA 5C5JA 3LQVA 3AH6A 3WC2A 2LVWA 5BR8F 1UJ5A 3I31A 3GFHA 1TKDA 2MZSA 1JLCB 1FRXA 4DSEA 4OI3A 2VASA 3DRRB 1DLOB 4HI1A 3ENQA 5HMZA 2VQFF 1BWEA 4XO0A 1PSDA 4CQ1A 1VOMA 2XSFA 3GYNA 4TY8A 3OL8A 1HI0P 5DM7Q 3C3LA 1XMOF 2EG2A 3CIMA 4QIGA 5CYMA 2R8IA 1Q16B 3F41A 4Y2KA 3OFEA 2RDIA 1V3RA 1KOOA 2IM0A 2XB2D 5D8HB 1RT2B 1URRA 1C0UA 3RAQA 3TP2A 5KG5A 4FF4A 2MSTA 1R8PA 3CCSS 1YGYA 2HNZB 1B64A 5E33A 3OHBA 3V6HA 4TY9A 3V6DB 1JNRB 1DJ0A 2LA6A 5KFZA 1UAWA 4OHXA 2XMVA 1UA0A 1U45A 2JWNA 4KO0B 1ROFA 1RTIB 3MTKA 3G96A 1HMVB 1WI6A 2R7TA 4YDDB 2AQ4A 5K14B 3GV7B 2IRXA 1WF1A 2VBXA 2COLA 3GZ7A 4QJVA 4J9QA 3MM8A 3SMZA 4MTPA 1RKIA 1VBXA 4X84A 4GKKF 1YJRA 3J7YU 3VWSA 2AP6A 1DQ8A 3CCES 2V4JB 3DOLA 4ZPTR 4N5SA 3RRHA 3RR7A 4O3OA 3H5XA 1RA7A 2ZOGA 2HNZA 3RAXA 2Z2MA 2E5GA 1Q86T 2FLLA 2QV6A 3GR1A 1VQSA 2HWTA 1MWYA 2ZDPA 4ITSA 3GSDA 1X0PA 1HQEB 4Y2AA 2B43A 1TKTB 1BQXA 4OZ0A 4KO0A 2LEPA 2CQCA 4QQBA 1R27B 3RTVA 3OFHA 1ZOTA 3DRSA 2ROGA 5T7LB 2DBBA 2Z4PA 4O3NA 1U25A 3EPGA 2BXJA 5IT0A 5JXSA 2YWKA 2FUG9 2LDIA 2QYCA 3DLGA 4QWEA 1BC6A 2ZFHA 3IRWP 4Q45A 2LQBA 2BUNA 1K0VA 2C3YA 3MF5A 2LQ5A 3K5MA 2HVZA 2JZ5A 2HGLA 2BOPA 1IBMF 2UUTA 5EGYA 5J2QA 4FF2A 2L08A 1O0PA 3H59A 3T5KA 1VK8A 2FVRA 5AXNA 2K7KA 2R8HA 1FKPB 2XGPA 1H2TZ 2ZH3A 3T3FA 3KNAA 3SXLA 2CQ4A 2AF6A 2QSWA 4YFUA 4FXDA 4OL8A 2KFNA 2L9NA 4C2MA 2PIIA 2OO4A 4RW9A 2E44A 2J7WA 3CCRS 1D8YA 2C3UA 2Q3PA 1K8AT 5JJBA 1XERA 3DHXA 1HNWF 2YWGA 5DJBA 5LJ3Y 1TK5A 2XS5A 5CA5A 4IFYB 5HP1B 3W2WB 2N7CA 2UUAF 2GJ2A 1N4LA 4OMFG 1S6PB 3MWBA 4KE5A 1NK7A 4UOCA 3CTRA 4DF4A 1DURA 2BZ2A 2RDJA 4L6V3 2WBRA 1JLAA 3CC2S 1HBOB 1JKHA 1C1CA 3QGHA 1APSA 1SUQB 5C42B 1HBMB 4ZKAA 2ASJA 4R8UA 1JNZB 1FD8A 5CCLA 5A0YB 5J1EB 3MD3A 1S9GA 1M5PC 1VBZA 5C24B 1NB7A 4WCEQ 1KVIA 3FRZA 2E29A 4RW4A 5L39A 1H7XA 2HZCA 4BC9A 4I2PB 3FNNA 1RP5A 2AJ1A 2ZHAA 1WTBA 2HGNA 3CO9A 3LPYA 2O3DA 3UR3C 4DSIA 2BRKA 4YR2A 1QSSA 2Q6CA 4RW7A 2E5IA 3M2VB 3PM9A 3TA2A 1N34F 3WX4A 3VAKA 1LWFB 4IFVB 3T1AA 1L5UA 1HBOA 3L7PA 2AYMA 3AQPA 1VFJA 2LMIA 3HVTA 1KFDA 5DDPC 3MTJA 2C3PA 3TI0A 1LXNA 5BJRA 1DFDA 4ZCIA 1T05A 2JHEA 3THVA 3DOKA 2NUHA 2MQNA 3MMCB 1S1VA 2CRLA 1FE0A 3Q2TC 3J7YI 3KFWX 2O1PA 3OLBA 3DLBA 2Y1RI 3GB0A 2IAJA 3PEJA 3SCJE 3W2VA 1F9FA 3ICLA 3MMJA 3PRDA 4EYHB 3NS5A 2KYXA 1YG0A 2HFNA 5DGBA 3HJFA 3RRKA 4NLWA 5DDQC 2ZDOA 4H4OA 1O51A 2EFVA 4ED8A 2DGVA 1Y7PA 4Q44A 2MKJA 2W7PA 5D77A 2RKIB 1HQUA 2MHNA 4LF7F 1Q8LA 4GC7A 1YJVA 3KNGA 1RT6A 4IO9Q 4OI4A 3PR4A 4OX8A 4KGMA 3BO2A 4ILMA 3BEGB 1D9FA 1NKBA 2ZC4A 4HTIA 2I1RA 2M9KA 4IH7A 3Q8PB 3RB3A 2ZH9A 4W92B 3IC1A 1HHTP 3SQGB 1SIZA 2AX0A 1ZZNA 4TU8A 3PKMA 3QPIA 5KFAA 2FLPA 3I4PA 4NYPA 3SFUA 3OJUA 1UVIA 1RT5B 1QJHA 1WHWA 4J9MA 1HWKA 2Z2LA 2J0XA 3QGIA 2L41A 1KN6A 3CVKA 1QAIA 4K4VA 2XNQA 4WU2A 4G3IA 2KI2A 2E9RX 2M0GB 2XI2A 3HX9A 3M2UB 1YWXA 4NMLA 2N3LA 3EGWB 1EP4A 3X3UA 3EX7B 4BHQA 4RNHA 4BS2A 1IR0A 2MKSA 2MKKA 3QO9A 4KKOB 4ES3A 2DRBA 4JI1F 1CPZA 1N56A 2XMUA 3IAS9 3I9ZA 4QWDA 2OSQA 3I96A 3Q22A 4U7CA 3D5MA 4PRFA 4LIWA 2POKA 3NAHA 2IVFB 2ZH1A 4PQUB 3MUVP 1L3SA 2BQRA 4RBVA 1R0AA 4LSNA 1FRIA 1RTJA 1NO8A 4OHZA 2FTRA 3UDCA 2J0WA 5KFMA 2WTFA 2CZVC 2JL9A 1W2BR 1X9WA 2XHWA 2DPIA 1DQAA 1UWBA 2N7YA 4LF8F 1JX4A 3K5LA 4HDHA 4F3MA 2EPIA 4C97A 4WKRA 5AE1A 2CQ2A 5M2UA 2QRRA 3S6EA 4P6QA 4FS2A 4O3QA 1RYRA 2V8DA 4EWTA 2V5HG 1PC5A 3GFZA 4NXNF 2B5JB 1VJWA 5GADU 3NRBA 4ED5A 3PO5A 2IC3B 1RTDB 2CPEA 2DNOA 1DTTB 4AUKA 2NS1B 5L9XA 2VG5B 1OQ3A 3E3XA 3R5CA 4WK1A 2WBMA 1HNVB 1HA1A 1NNDA 4J9PA 3KLFB 1UFLA 1X5SA 4USIA 4WE1A 5KG1A 3M6UA 2ZITA 4YB1P 1FT8A 2HFZA 5CD4H 4RW6B 3IGNA 3JSRA 3IN5A 4NPOA 4NXMF 1C4CA 1OQ6A 1TKXB 4NLQA 3RBEA 2UXBF 1ZM9A 3L09A 3UCUP 2P5VA 4ILRA 3ITHB 1X0FA 3ISZA 4M95A 5KFIA 3NMAA 3FDSA 1SKWA 3IWXA 3M30B 4N47A 2GHWA 3U27A 4QPXA 1G6BA 4ED6A 4KB7A 1M0SA 2GQCA 3CSKA 4NLTA 4AQYF 1TV6B 3M4XA 4C0HA 3F44A 3RBDA 1N33F 1SJRA 4D3GA 4JI0F 2JX2A 5B0CA 1JLEB 4XAKA 2CVIA 1AROP 3I0RB 2AYEA 2FHJA 4F67A 4DV2F 4I2QB 4NLRA 1T03A 4F4WA 4NYOA 4MK9A 4ZP9A 4ZP6A 1N6QA 1DBDA 2I38A 4YEAA 5L38A 1RT3A 4KAIA 3KLVA 1S1XA 2GQ2A 4FS1A 4O44A 4K4UA 2CJQA 3CJ2A 3ITHA 2GMHA 3VQSA 2I5JA 3NS6A 2WOMB 1RT1B 1G3OA 2GO8A 1IKWB 4RNFA 3LGMA 1X4GA 3H5UA 3M30A 3LWMA 3DCAA 5E7OB 2XY5A 1FXLA 1BD6A 3V81A 4DEZA 2VD3A 3V4MA 1LW0B 2DR9A 2D9PA 2IBKA 1U1PA 1D3WA 4QWBA 4ZVGA 2BBEA 5CH7B 4DV1F 4A8WA 1SB6A 3T5JA 2BANA 3AY0A 1YITS 4J9RA 4FVMA 2FJWA 4QR0A 1BQMB 1KHVA 4ILLA 2KXFA 3NWGA 3BO4A 4V19J 2CJAA 2IM1A 3BGUA 2DTJA 4GO5X 1R8HA 4PQAA 4U6PA 3KK3B 4RW8A 3JYTA 1QE1B 5KG2A 1D1UA 5DETA 2FVPA 4AL7A 2HMIA 5EUHA 2JC0A 3R1HA 4PPDA 3K7RA 2HS3A 4K50A 1TL5A 5LJ5Y 2DB1A 1YRUA 1LWCB 3LOUA 4LFBF 1M5HA 2CQHA 5A8RB 1NEEA 2VV5A 3Q2SC 4NX9A 2QZ8A 4OIXA 3SV4A 3NG8A 5I42B 2OJ3A 1FEHA 1QM9A 1S1WB 2ALZA 1DZ5A 1SXLA 2ADBA 3DHWC 4KV8A 3MEGB 3THPA 4EYIB 2ZUGA 1EETB 4XIUA 5GADI 1D9AA 1HYSB 3PFEA 1TP7A 4H4MB 3QLHA 4ID5B 4C8OA 5E3PA 4MAKA 4IG0A 2J6TA 5CYQB 1KLMA 2WONB 4BWMA 4ALZA 4Q2LA 3SCKE 2DNZA 3K59A 3JSBA 3M2RB 5E3QA 5HROA 4I64A 3LGNA 1FKAF 2XO7A 3KLEB 1W2IA 2XSJA 2F9JA 3MECA 3PIPQ 2OFGX 2IA0A 1DTQB 1XR6A 2RE1A 3O8WA 2JH3A 2PFFB 2QA2A 3MM7A 3KLHA 4D3HA 5C25A 1S6QB 3HHLA 5I3PA 5HBMB 3M6WA 2W9AA 2MKCA 4IH6A 2VG6B 2R7QA 3MEEB 5KG4A 2OMLA 1TFYA 2PMHA 4JI8F 2OPSA 4RWXA 4IO1A 5IS2A 4ZDNA 2HPUA 1X4HA 2QLWA 4B17A 2A2CA 4RLEA 2XMKA 3Q24A 2V0NA 2MJNA 1X7VA 2KHCA 2P6SA 5CYQA 4YMEA 4HEA9 4WFAQ 1BLUA 2A10A 4DL3A 1N36F 1PILA 1HNXF 2W9CB 3M2RA 5DQGA 4DL2A 1XR5A 4WU3A 1RQ0A 3MR3A 2BA9A 2DHSA 1V6HA 3K57A 1IQZA 4OLPA 5I4MA 5KFNA 1Y3KA 4ZPCA 2W8LA 1JJ2R 2GV1A 2JEFA 1FERA 1CQMA 1R43A 4FF3A 1YJTA 3RRGA 1Y9OA 3I5CA 3N9UC 5L8RC 3DDKA 2C2EA 1N32F 3J7ZT 2VBWA 2IYGA 5EDWA 2C2DA 1LQ9A 4J9KA 1ELOA 4X4QA 5KFEA 1U24A 1UVLA 4FF1A 3IWNC 2MZRA 2YKPA 5HLFA 2W24A 4K4YA 4QIFA 2OLWA 4U7UK 2W9CA 1TK0A 3CJKB 3B8HA 3KJVB 4UY85 4MJKA 4NLYA 1FK9A 4Y34A 4AYBD 1U1MA 1BY9A 1C0TB 3GQCA 2D3UA 1K0TA 2PD1A 1GAOA 2VFTA 4PUOA 3IR5B 3D0GE 3LP0A 1OPZA 3LAMA 2UUCF 2GGPB 1S7HA 2B51A 2RH3A 1Q1KA 1TL1A 1C4AA 4DL7A 2W9BA 4DSJA 1VQNS 4A8MP 4HI2A 4DG1A 5IXUA 5DQIA 4ID8A 2RF2B 1IBLF 3T9NA 5H9FJ 1U2RA 5I3UA 3RB0A 2P9CA 4LFCF 3NCRA 2PI5A 1UEVA 5A6WA 3JSMA 1JLGA 2F7VA 2Z8QA 5G0RB 1UJ4A 4EBDA 1ZM4A 4IOBA 4PG8A 3NBPA 2CZ4A 2Q43A 2FGCA 3PHEA 1U1QA 2CQ1A 2DHGA 1VC5A 4C98A 3MEDA 1ZPVA 5F0UA 2A1BA 3H5YA 1VRUB 1KONA 4DFPA 1OSCA 3PDNA 2C2RA 2UXCF 3CE8A 2J9DA 1TAQA 4KRWA 1GX6A 2BW2A 4TQRA 4DQSA 3BQ0A 2HHSA 1IXKA 2R7VA 3TW0A 4RUCA 3QJLA 3RZAA 3I9V9 3H8YA 3C6TA 3SSQA 3FZBA 3C6UA 1HBNA 5B09A 3G86A 1QVGR 1T3OA 1Q7LB 4LF9F 3HVAA 2HHPA 4PPZA 1VQ6S 1FRLA 2BACA 1FTCA 1WF2A 2MKHA 4LSLA 5KTQA 2VPZB 3TX8A 1JMTA 2HHVA 2J7UA 2R9LA 1VLYA 2KG0A 4PWDA 3MMAA 3PNIA 2NREA 2LXIA 1RT7A 3LUYA 2B7CB 1YRTA 3OR2B 3L3CA 5D4OA 2R7UA 4J9NA 2CQDA 4MFBA 4X62F 3E2EA 1M5OC 3HHKA 4B9LA 4CT8A 1MWZA 4CZCA 4EO6A 2APOA 2DGSA 3OTCA 5A6PA 1GXTA 4LIRA 4JV0A 2XY7A 1BQNA 1LWEB 4NLOA 1RDRA 5IT4A 3OXLA 3GV5B 4JI3F 3DI6B 2F8MA 2ABYA 3TVKA 2RVJA 1G2EA 3R5DA 4O4GB 2WSCC 2JFKA 5F8GA 2JFDA 1KD1T 4WYLA 1KR4A 2MQQA 3B4DA 2CQIA 2FJAB 4ELUA 4W90B 2V8VA 3OR2A 4M1KA 3CCTA 3DOMA 2F4VF 3SI8A 2DNHA 1TKZB 2O5DA 3FFIB 4FXWA 3VZHA 2R2TA 2ZJPQ 3KMQA 2K1RA 4B3MF 2IYIA 1S76D 4DR3F 1JB0C 4LMZA 1F2GA 2GQQA 3HDSA 4OJ1A 5KFFA 2AYGA 1ZTTA