4GO7X

The regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
186
structure length
165
Chain Sequence
SIHMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNVSKDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGVTATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLEATVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aspartokinase
publication title Structural view of the regulatory subunit of aspartate kinase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 44
structure length 165
sequence length 186
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2012-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01842 ACT ACT domain
X PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go7X02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go7X01
4GMKA 3U7JA 1YBAA 4GO5X 3IBWA 1M0SA 1YGYA 1ZPVA 1PSDA 5IS2A 2QSWA 3ENWA 3CEDA 4IO1A 2NYIA 1LK5A 1Y7PA 2FGCA 3ENQA 3OBIA 5JJBA 5IT4A 3DDNA 2JOQA 3MWBA 2J0WA 3AB2B 2DTJA 3DHWC 3OFHA 2RQMA 1LK7A 2F8MA 1O8BA 2P9CA 3TUIC 2PA3A 2RE1A 2RQKA 3ENVA 3MAHA 3OFFA 3AAWB 5FIIA 2QMXA 3KWMA 3HHEA 2LVWA 3L7OA 1U8SA 1UJ6A 4M8LA 2QRRA 2KO1A 4X84A 2F1FA 3MTJA 3AB4B 1XTZA 1UJ5A 2P9EA 2J0XA 3NRBA 1KS2A 1LKZA 3IXQA 3OFEA 3OFGA 3N0VA 2JHEA 2P9GA 4GO7X 2PC6A 4PWUA 2CDQA 3K5PA 2QMWA 3P96A 2DT9A 3S1TA 3DC2A 2I9SA 4LUBA 3LUYA 2MDAA 3LOUA 5T41A 3DHXA 1UJ4A 4NMLA 2ZHOA 3UW1A 5IT0A 3W7BA 1SC6A 3TUZC 2H9ZA 3TUJC 2LQJA 3O1LA 1RWUA
chains in the Genus database with same CATH superfamily
4RW6B 3V4IA 1S59A 4DXLA 1S77D 1JXLA 3DLKA 4M5GA 3SSSA 3LWMA 3RRHA 5LSOA 4KB7A 3OFHA 3I31A 4USVA 4JUZA 5AXMA 2IM1A 3VR1A 2KKHA 3DDIA 3GSDA 4J9LA 4XTTA 2QN6B 1S0MA 3RB3A 3N5BA 3MUTP 4GKJJ 3R8YA 1WTFA 3D6HB 4GKKF 2PEHA 2HQFA 4QR0A 1T9TA 3OQ2A 2H4YB 1DTQB 3D5MA 2UUBJ 2RD5C 1NSQA 2CIMA 3G9CA 2PIIA 4L75A 3MCSA 4CQ1A 2JHEA 3J81Y 3HFVA 1XR5A 3DOMB 4LVOP 2J5AA 1BQNA 3RTVA 2Z2YB 2R7UA 3K57A 3DRYA 1E6YB 1NJIT 2W24A 4HDGA 3N6LA 3WQPA 2OTLS 1CS4A 4H4OA 2YY3A 3WZ0A 3W63A 3ZZUA 3IBWA 2JLGA 2V50A 5JVHQ 2ZUAA 3M9OB 1SJ3P 1U0SA 3HVAA 2VB6A 4OYIA 1CQMA 3MM9A 3LGNA 2ZJRQ 1T9XA 1KSPA 4LIRA 1RT7A 3RBDA 2J0WA 5GAGI 2UU9J 4OHXA 3CIMA 1Q81T 3HDSA 3Q8VA 3Q8QB 2AJ2A 2FIUA 4LQ9A 2FY1A 2B56A 3G82B 2ADBA 4HR2A 2E5GA 2K7JA 3UCGA 5ITHA 2OPRB 1RP5A 2HRTA 3C16A 2CDRB 4DV0F 1Q16B 2GVDA 1MU2B 1MMNA 3MEKA 4ZPBA 5F8LA 4K4UA 2UUAF 2P8IA 1RT3A 2N4DA 2WSEC 5CYQB 1QAXA 2A18A 3UD4P 3GP9A 1BQMA 4I2PA 4LF4F 3QATA 3ITHA 1NK5A 2ZBPA 4JV1A 4RW8B 5KG5A 1F0XA 2K2PA 4WYWA 2QLJB 1TFWA 2DNNA 3BDEA 3D6TB 3PVXA 2AYEA 3DYAB 3HD1A 2AX1A 5JMNA 3LALA 3CMES 4A8WA 2N3OA 2QEXS 4CH1A 3OTOJ 3OBIA 2IVYA 4RW6A 3D7SB 4ILRA 3RU0A 3CMAS 3A4TA 1CULB 4IFVB 4KHRA 3FK4A 1HPZB 4K2JA 2P9CA 4B3RJ 2MZQA 3IFEA 4WF9Q 2LXIA 2VUGA 2QA4S 4JI0F 2XZTB 4JI4F 1WG5A 2CKWA 3M9MB 2C2ZB 1WHVA 3D0IE 1S6UA 3PHEA 5LSRA 1RT2B 5ADZA 2ERRA 1S5ZA 3V5RA 1RT5A 4ZS6A 1GMWD 4NL5A 4ELVA 1DTQA 2WVEA 5T14A 2RUGA 2BV3A 2Q79A 3QSIA 5I42B 3IR7B 1YDLA 2ZOFA 1HQEA 1E6YA 3W7BA 1DARA 4OZLA 4P2MA 4N76A 2EG1A 4J9KA 3U7JA 3NP5A 2OSRA 1D0EA 5HROB 3NGTA 4LRAA 4ECRA 4AE5A 5LJ3Y 2QFIA 3BQ2A 3NOCA 4ZPCA 2O5DA 4KAIA 2QO3A 4TYAA 4DCPB 4YR2A 5A2QY 2IM2A 4ZVGA 3E3XA 3HHDA 4WZQA 3T5JA 2JSXA 5FDLB 4IRKA 1JMTA 3EZOA 1KBRA 2HRUA 5HVHA 2W25A 2JC0A 3G82A 2UVUA 2O1PA 5T7LA 2IC3B 1KFDA 2FJAB 2OPRA 1QTMA 2FLLA 2IM0A 4O3OA 1K8AT 1PBAA 1HBMB 2F4VF 2AZ3A 3H59A 4ZJQA 1N5TA 2R7SA 1N5SA 4G1QB 2BZ2A 1H6KX 1WEZA 3W8PA 4PABA 2CZVC 1GT8A 3TA1A 4RW8A 4EUVA 5AJ3J 4YS2A 1G6BA 2MSTA 2YPYA 2CJBA 1PBUA 4IRCA 5GMKa 1OIAA 3L9ZA 5KFVA 2EK6A 4HVZA 3QAUA 1JLBA 4DSLA 1B3TA 2DPIA 1X5OA 1P27B 2Q1LA 4QWEA 3IO1A 4OHVA 1CULA 4IFVA 3PV8A 4DR2F 4LF2A 1NKBA 4J37A 1Q8IA 4QQBA 3K5LA 4F4KA 1YJNS 3BGOP 4LF8F 3KUHA 1FRKA 3CXCR 2ZNZA 3SEOA 2BW2A 3M6UA 2CZ9A 4XPEA 3T9NA 4CO5A 2G2YA 2ZH5A 3DGPB 4RWWA 1SV5B 1RT2A 3AODA 3SZ2A 4X4VA 2UUTA 4YB5A 4U95A 1RABB 2HEKA 3EPIA 3K8WA 3GG0A 1B0PA 3OJUA 3N79A 5I42A 5GADU 6FDRA 4QOTA 1ZPVA 4PXBA 2MYFA 2UV8G 1SIZA 1Y7PA 4QR2A 2QG9B 3RG6A 1SUQB 1R8CA 1WHXA 4OLPA 1PCAA 2E7VA 5HROA 3TX0A 3TA2A 3Q83A 4DS5A 1F1BB 4NI2B 4ID8A 4F0KA 3KLHB 2RDJA 3M9NB 4QWDA 3MCNA 2C2MB 1BD6A 1MNEA 2CPFA 1DQAA 2DHGA 5A6PA 3W2VB 5FDLA 5J2MA 3TQEA 2RKIA 4QR1A 3AD8C 4L74A 1HMVB 2OFGX 2DITA 3BYPA 4BLGA 1FNMA 1Q79A 5D4OA 4DR6F 1VQLS 3M2UB 1D1UA 2IC3A 4DV0J 3LUYA 2R8KA 3R27A 4P74A 2UUAJ 3RBXA 1HBMA 1YKWA 5HO4A 2RB7A 5BR8J 3NCPA 3G8TA 5L1JA 4G1QA 5DQGA 4LF4J 4Q44A 1RUSA 4HHUA 2PSZA 1FVQA 2F65A 2UVRA 1NUEA 4V1Ak 2XMTA 2OUGA 2XG8A 3R5AA 2JVRA 1RHMB 4ED0A 1FI4A 2GMLA 4YB7A 4ECYA 1HQ2A 2B9EA 1RWMB 1K44A 1UFWA 1RAFB 1VS3A 2F9JA 2CQDA 1SL1A 4OZ1A 2E1CA 4J9UE 2HHSA 2HK3A 4A8MP 5D6GA 4RPFA 5M2PA 2RF2B 2LYVA 2X1AA 2LDYA 1KS2A 5ETMA 4JI0J 2JZ5A 3BSOA 4LMZA 4ED1A 2HVDA 3GIRA 4YY3F 3PZPA 3WC0A 3A3OB 5CH7B 5ETSA 2G0CA 3DGPA 3D4JA 3DHXA 1SV5A 1UEKA 1RAOA 2AJ4A 4N8OA 1APSA 1X5PA 4YP3A 2DO4A 1N88A 3MECA 1QM9A 2DEJA 1MLAA 4F4AA 4X4QA 3HVWA 3D28A 2KXFA 3MM6B 4DV2F 4WU3A 4TLRA 1W26A 2VQEF 1CSJA 1PKUA 2IJRA 3WIVA 4O3QA 3M6WA 1RAJA 3ZTSA 1VQ5S 2D9PA 4FKYA 2JWNA 2QA1A 3I9V9 3GCWP 5CYJA 1SUQA 4ES2A 2H54B 3TVYA 2Y8YA 2HMIB 4H4MB 5IV3A 4RUCA 3J7YI 3VAMA 2R8IA 2AD9A 2BEFA 2DPJA 4NI2A 3KLHA 5LMUF 2XYPB 1CC7A 2FQQB 1R6VA 3QT6A 4KSEB 2ZD1B 2MQPA 4CI0B 4ZVEA 3WIUA 5U47A 3W2VA 3X3UA 2DEIA 1R8PA 1N6QA 2QMUB 1HMVA 2F8EX 2XLKA 3H4DA 5E0OA 2OAUA 3QIPB 1IR0A 2C42A 4CO4A 3M2UA 3UW1A 3BGFA 4OZ0A 4X65F 4O4RA 2AKWB 5DDQC 3M05A 5DG7A 4EBCA 2F4VJ 5C7PA 4CCHA 2LECA 1U6BA 2H3EB 2JJ4D 2WVFA 1H73A 4O3SA 2HVHA 2J6UA 5EWEA 1PAUB 3NWRA 1EHWA 1LW2B 3KNGA 4NWBA 1XIQA 4NCAA 1UZHA 3GQCA 3JQJA 2RJZA 3OL9A 2LEPA 2IBOA 1FRXA 1U8SA 3OL7A 4OYXA 4LFCF 3BBFA 2VPYB 3WBZA 3H98A 2GAHC 2FHOB 3I87A 3SV3A 4ZIWA 5HMZA 1CJTB 2MQQA 3CB4A 5KT6A 3BO4A 2DHXA 4DR2J 3DRPA 1SKWA 5KFAA 2OPSB 2RF2A 3I0RB 4CLWA 4Y00A 4PWDB 1DJ0A 5IM0B 5HBMB 3SCIE 4Y2MA 3UFCX 4JP8A 2HHWA 3K5MA 2K7KA 2GQQA 2DGXA 4A4JA 1I94J 4ZVQB 2YBVA 1NXIA 4EO6A 5DZ7A 3FDSA 1CJKA 2C2DA 1H2VZ 3WC2A 2DTJA 2RVJA 2KFZA 3TARA 4D3GA 4RW9A 3GV8B 2QA4G 3MM6A 1FF2A 3GYXB 1X4BA 3DOLA 2JEJA 2YKQA 4KHPF 3FBFA 3BN7A 1M5KC 1HIYA 4AL6A 3IC1A 5KFFA 3I6PA 2RIJA 2HMIA 1RA6A 3PDNA 4H4MA 4C2MA 3BN4A 1T9VA 2QGFB 1C4AA 2BE2B 2E9TA 2MZ1A 3PACA 3Q2SC 3AJ1A 3GFYA 3JTOA 1AROP 1FWPA 1ZBTA 2DY9A 3BJYA 4L3KA 4C8YA 1VQSA 1XNQF 2ZD1A 3NLCA 4OX6A 3CC2S 4A8KA 3AJ2A 2HLTA 4EWTA 5DGAA 1GK8A 3RYLA 3EMTA 2XYHB 3AA8A 5HL7Q 4DR6J 3FKBA 3OXFA 3QIPA 3ICLA 4TLQA 3ZZ0A 1NHUA 3ZO7A 1MG7A 3EE3A 4DL3A 2BJ8A 4JV0A 2XI3A 4EYHB 5C25B 2QLXA 4JI8F 1VGYA 4HACB 4QU6A 2IM3A 1KD1T 2XY5A 2GMHA 1LW2A 2RS8A 4A8OA 1HBNB 5H9FJ 4CO3A 2CWXA 1NO8A 2ROPA 1WC6A 4LREA 2FJEB 4WK1A 4FYYB 1IWGA 3DRRA 2J0QD 3CJTA 3OXLA 3OFGA 1QTNB 2NUHA 2KVQE 1JNRB 2KYZA 3IWLA 5D3GB 1CJTA 1XNRF 4WKRA 4IYQA 3MI7X 3H25A 2CJKA 2OPSA 3I0RA 2VG7A 1SVDA 2GQ2A 2H9ZA 3BPDA 2LQJA 5CQGA 4PWDA 4YY3J 4NLDA 4TY8B 5IM0A 4EZ9A 5HBMA 2HHPA 2ZVSA 2UV8A 1VJQA 1YGYA 2DNKA 3MD1A 1BE4A 4NLWA 2VBWA 2BE9B 1OSDA 5IQ6A 3DRSB 2ZH3A 4Q43A 2DNYA 4CO2A 4JI3F 4DU8A 5KFUA 2VOOA 4P75A 3IR6B 1C1BB 4X4OA 1KOOA 2D3OR 2VFRA 4W92B 2DRBA 2XHWA 4IDKB 4TU9A 1CEZA 2VQEJ 4KGXB 3GJQB 5K9FA 4DV3F 1U8WA 2HS3A 4LIWA 3CF5Q 1HI8A 3M1VB 3DLHA 3MFIA 4N8NA 3VGUA 4K50A 3UCUP 3U1MA 4ECWA 3T1YF 3H42A 4YOEA 3I56S 1NLKL 3PKYA 2AEMA 1F3FA 4DR5F 3CJKB 5LMUJ 4ZCIA 2BE2A 2RRBA 1RZMA 5CHCB 3I55S 3AQOA 1NB2A 3CO9A 4QYZK 4PQUB 4DPWA 3CJ0A 3L3CA 2CRLA 1P9YA 3IWNC 1EETB 1TKDA 3M8YA 1FXRA 3T1AA 2DNZA 1D9AA 1YBAA 3MMBB 1TUWA 3D54A 2GCFA 3R1LA 1DFDA 4OI6A 4RNMA 3GIJA 5D0HA 4MKVA 4P9SA 1RK8A 1QAIA 3FZ2A 3FRZA 4X65J 2HKEA 2C28A 2AU0A 4PXCA 2HZVA 4P2FA 4Q2MA 3JSBA 4DZ6A 2JDJA 4KE5A 1B4SA 4O44B 4I7FB 4RW7B 5E2QA 3RAXA 3MFHA 1D9FA 5C25A 2KG0A 2VZ9A 2YWGA 4HACA 1RT1B 4OHYA 5EX3A 4USWA 4O3NA 3FZBA 1HBNA 4Q5VA 1SKRA 2WK4A 3IXQA 2CQ4A 3QWUA 5CZVA 1GFWB 1PC5A 2QT7A 4LFCJ 1KHVA 3TANA 5F9NA 4QPTA 1X9WA 4WFNQ 3LOUA 1UVJA 1AW0A 3RRGA 2ALYB 2IAJB 3W9IA 1KONA 5D3GA 5KFGA 2PFDA 3CDBA 4G6VB 2PN6A 4M95A 2YKPA 1L3TA 3PY8A 3GFXA 4JI7F 4LVNP 3ZZOA 1RDRA 4TY8A 1S99A 1V3ZA 2V2ZA 4ZP8A 1DTTB 4DSKA 4Q8EA 3KG1A 3AH6A 4PPZA 4DSEA 3M2RA 5K5MA 5IZHA 3LWLA 3UDCA 3LH2S 1S9GA 3DRSA 3ZTRA 3CCZA 1N52B 2W9AA 1S1VB 2JNJA 2VODA 5KOXA 1WWHA 5M2UA 3W61A 3SI8A 3GIMA 4JI6F 4MT1A 2BM0A 4FNHA 1K9MT 1S76D 1HWUA 4YFUA 1E6VB 5ETKA 4IDKA 2F1FA 2HZAA 5HSPA 1GQEA 4R8UB 1EB0A 3N0VA 3BDPA 1S1WB 4BCAA 5K8MA 3VAGA 4ZLNA 4RUAA 4EZ6A 2JEGA 2V8PA 1KQKA 1TFYA 5EHHA 1G1XA 1ZAWA 3MR5A 3KHRA 3CMQA 3I0SB 3CJKA 5HJYA 1ITPA 3LP0B 1Y9OA 1XMBA 2EFVA 5ETLA 3QNWB 1XNQJ 2NR0A 1NDKA 4WFZA 2YQ1A 1LK5A 2M8DB 5DG8A 5JJBA 2IMOA 1LQ9A 2ZDOA 4YN3B 5J2PA 3MMBA 5G4DA 5L9NA 5GMEA 1VQ7S 1I1GA 3CO0P 2HYIB 1HW8A 3JQKA 5GAHU 2M52A 4KT0C 2NSCA 2D9OA 3AXMA 3C2PA 5DRKA 4FVCA 5I4MA 3HM9A 3VGVA 2LVWA 1MSWD 2HQCA 4C3MA 4DCOB 2V69A 1IXKA 4O44A 4RW7A 1K1SA 4X84A 4A8SA 4JI8J 3CCJS 4N56A 1R8AA 3AB4B 4J9VA 1UWBB 3GFZA 2KN4A 4USMA 1RT1A 3TA0A 2HHUA 1B0VA 3MMCB 3QYYA 3W64A 1CVJA 1FTCA 1WC3A 5CYMA 3VGTA 5BJRA 2CPEA 4DR1F 2A1BA 2A2CA 1TL4A 1FXDA 3EGZA 4JBCA 1O51A 4G1PA 4DL7A 1WC5A 3K0JA 1XNRJ 3VVUA 2IAJA 2DNGA 3H4BA 2CNNB 5CXTA 5IT4A 3CCWA 3IAM9 4N77A 3MM8A 2DISA 2XNQA 2A3JA 1N34J 2HS4A 1BHNA 1EAYC 1DTTA 5DDPC 2DR9A 1FEEA 2XMKA 1VBZA 5AXNA 4JYAF 1A7GE 4YB1P 3GTYX 4JI3J 3M2VB 3TR5A 4DLGA 1S1VA 2H5IB 5DJBA 3MUMP 4K8RA 1C4CA 1UJ5A 2KJVA 2W8KA 3CJ4A 4DDFA 4KRWA 1KQGB 4WK3A 1E6VA 1N5YB 5D0GA 4DV3J 4DN0A 2ZHAA 1B64A 1Q0NA 2BRLA 2OO4A 1YSJA 3D1QA 4F25A 4R8UA 3RBZA 4AD6A 5BXIA 4F4ZA 1S1WA 3KK1B 1R89A 2AMCB 1QE1B 1ICEB 1N5VA 3T1YJ 4C11A 2W2MP 5A6WA 2Y1LB 2ZJPQ 2EPIA 3CCVS 4ZCLA 3I0SA 2GVZB 3RB4A 2DR6A 5H9EK 2KXNB 3LP0A 4JV2A 4EGLA 1TZ0A 1FNXH 2NZ4A 4I6WA 2EBGA 1GX5A 1HYSA 4ZIVA 3KK3B 1ZAXA 4NLUA 2KH9A 1ZM9A 3S6EA 1WI6A 3G4SS 2IRXA 2VKZG 3H90A 2LKZA 1DBDA 4MIAA 1Y0HA 4B3SF 4M8LA 2F40A 3GPAA 1U0HB 3GLJA 4ZN1A 5J1EB 3PYDA 4DL2A 4DR3F 3RGIA 3C46A 1TR0A 5IFMA 4DFKA 4P73A 1QJHA 2PFFB 2V8VA 1UWBA 3HK2A 1VI7A 1DQ8A 5AT1B 1CG2A 4HI2A 1EZZB 1GH8A 1NSKL 1FRLA 3MMCA 3C3LA 1SKSA 2IMWP 1SC6A 3D6MB 1FCAA 1UAWA 1HBUB 1IKXB 3QQCD 2WVBA 2KU7A 2YNIB 2FVQA 2UXCF 2CA9A 2R7VA 1FD8A 5ETPA 3MWBA 2KT5A 4PXEA 2IYIA 2ZOMA 3DI6B 5DLGA 1S7HA 3TJ8A 1SCJB 2GGPB 5K8NA 2JC1A 3M8ZA 4Y2AA 3CDAA 5THWA 4JI7J 4GC6A 2VG6B 1B70B 2ILYA 2HQIA 2C3PA 4B3TF 2KO1A 4LF5F 2CQGA 2DHAA 4DQRA 2VC1A 1FFGB 2B0GA 3F41A 1MMDA 2JH3A 3OR1B 2G1DA 4JI6J 5JVGQ 3D66A 3QGIA 2VBZA 4QZVB 3CCES 2XMAA 3Q8YA 1XBWA 2ZH2A 5L38A 4C0BA 1N4LA 3V6HA 4ZP9A 2PI4A 3KK1A 2XMJA 1QE1A 3OLBA 2CJAA 2KHDA 1KN6A 3QRQA 4P52A 3BGRB 2IDLA 3MR7A 2J6SA 2JLEA 4O3PA 1QUPA 2GVZA 4U7CA 5KFKA 2I38A 2H5JB 1PIEA 2AW0A 5F41A 4WCEQ 4QIGA 5LOQA 4OQJA 5DDRC 4ALZA 1OPZA 3IGNA 3TNVA 1FKAF 2HFZA 2GJIA 4ID5B 4WXWA 4PUOB 4GRSA 1NHVA 3K59A 2R8HA 3SQOP 2FZKB 4A48A 2WB1D 3OV7A 3KG4A 1IJFB 1U1QA 2WTFA 2MZTA 2DJWA 1R0AB 2AT1B 2FVPA 2QZ8A 1WKLA 2FD2A 4FYWB 5J1EA 5KG1A 4IKAA 4LUBA 2HHTA 1EJ7L 4USJC 4N5SA 1X9SA 4OX8A 4RW4B 9ATCB 2F3JA 2RRNA 3KHLA 3Q22A 3QWPA 2YNGB 3G71S 3OL8A 2CQHA 5IS2A 4DL4A 3VAFA 4QYZJ 3G8QA 4NA3A 4DR1J 2BANB 4RNHA 2G2ZA 1IKXA 3ENAA 2HQDA 2YNIA 4DX8H 2HNYB 3Q8RB 2NXCA 1OY6A 3U1LA 1I5OB 1OJ4A 1U48A 4JV5F 5GAGU 2Q66A 1S72S 2OHDA 3DI6A 5E3PA 2GGPA 1RCOB 2J7KA 3N01A 1RADB 2MB0B 2DH7A 2VG6A 1KLNA 3MM5B 2DD8S 5LM7E 3DLEB 1GMWA 4U6PA 2XTJP 5B0EA 3E8OA 4BC9A 4M5HA 4JYAJ 4OI2A 2MKKA 2F9DA 2I9SA 1F5CA 2XS5A 3FUYA 5FD1A 2XO6A 4CH7A 2OIHA 4F2SA 3OR1A 2MHEA 3FGVA 4E0DA 4X4SA 1AZSA 1LFPA 1RISA 4HH1A 1TKZB 2MQLA 1S1XB 1V6HA 2DCUB 4F8RA 2KVIA 1RAAB 3QT7A 3A8IA 3D1HA 2C2EA 3EUNA 1UKUA 1Z2LA 2KI2A 2D1CA 3NAIA 8RUCA 5KFSA 4KO0B 2HHHF 1X9MA 4J9RA 2PGCA 3TEGA 2CG8A 2W1BA 3IS9B 4ED3A 1HWKA 1SC3B 1NPKA 3BGRA 3QMQA 2F5GA 1IQTA 2HWIA 1G3OA 5CD4H 2FHJD 1TK8A 2RQ4A 2OH2A 2J0SD 2YVSA 1TV6B 1M90T 4D3HA 3JXOA 2D74B 3DN9A 4FP9A 2VBYA 1T94A 3UD3P 3AOBA 4TY9A 3POTB 3T5HA 2LU1A 4ID5A 4PUOA 2VU5A 3BPSP 4B3SJ 2CPIA 4OZNA 4RUBA 1QDUB 3A8JA 3HF5A 4ZJOA 2GAGC 1R0AA 4L76A 5J2QB 4DR3J 3PG9A 3RJMB 2B4PA 4YMEA 5FLXU 5LT5A 5RUBA 4CTAA 4MKAA 2BKNA 2FVCA 5K8PA 3NS7B 3OHAA 5E3AA 2XGQA 4Z2XA 2E29A 3PIPQ 1ZZNA 3J80U 2CPYA 1IR1A 1S9FA 2WVCA 4LF1A 5KFZA 1PO6A 4WE1B 4USKA 3BH7B 3HSJA 2Q43A 2YNGA 2ZBRA 2GFFA 3CJ3A 4OYMA 3IN5A 1FTRA 3IG1B 3HPOA 1VRUA 2X51A 3NAHA 1IBKF 5HMWA 2XY6A 2BANA 3LA0A 1JLQA 3IMQJ 1LOUA 1H38A 2W4DA 2UXCJ 1GTEA 3EWGA 5H1SV 3BH6B 1PILA 4YDDB 4OI0A 1RHRB 4ECUA 1IBMF 1YRTA 1Y10A 2O01C 1TMMA 2BQ3A 2XY7A 3GV5B 4FXWA 1MN7A 1T0TV 1VYAA 1Q53A 3T9ZA 4I64A 2CFXA 4CRJA 1AT1B 2QX0A 5B0AA 4B3TJ 5LJ5Y 4LF5J 4USUA 3U02A 3MM5A 3VZHA 4ZVOB 3DLEA 2BA9A 1XR7A 2MY8A 3AOCA 1X4EA 4X62F 3D3CJ 3O2IA 1X8DA 3G6ES 5EX0A 4KGKA 1A6LA 1L3KA 3EVOA 2VQFF 2I0XA 2Z0GA 3LGMA 1TKZA 4DHVA 1S1XA 2GNKA 3MEGA 3Q8PB 3HCXA 2B9XA 9RUBA 3DHWC 3EYZA 2H48B 1M5SA 2C1EB 1S1TB 4NLYA 4P7VA 2ZZTA 2P6TA 1TAQA 1T05B 4AUKA 2YKMB 2OMLA 3QLHB 2NSBA 4QIWD 2HIYA 3I4HX 3GB0A 1UFKA 2W2NP 2RH3A 3HD2A 3UR0A 2J76E 1M1HA 4OI1A 2NXEA 4URQU 2CADA 2IDEA 4Y6IA 3OSPA 2NZCA 3C66A 1TV6A 3R6LB 4PEOA 2LFVA 4QIVA 1WKKA 4C0OC 4DI6A 1J27A 2B6AB 3TO8A 5HANA 2YX4A 2X7IA 3POTA 3QSYB 5KFHA 2K06A 4U96A 3UN5A 5KFNA 1HKAA 3GYNA 4DFJA 1C0TB 2EI5A 2GHWA 5J2QA 2VHGA 4GMKA 1GEHA 1S48A 1HNWF 4LSNB 2QL5B 4O0NA 2EFPA 1VMBA 4AXJA 4J9MA 1RI7A 2VKRA 2V2VA 4OFZA 3CT9A 4EMDA 1UZDA 3QRPA 3OXGA 2RS2A 3SXLA 3I32A 1JJ4A 1YQHA 1G4CA 1VQMS 4QW8A 2HW3A 4MH8A 2N3LA 5H9EJ 2WZ1A 2ZBQA 7FD1A 1WC4A 2OPQB 3IG1A 3AT1B 1GTHA 5KAKA 1WG1A 4B3OB 4OJGA 4OL8A 2BE7D 1TL3A 4JV5J 2EVZA 2DNOA 4NXMF 2Y3YA 1OYEA 1H2TZ 4OYAA 2I6WA 1RWPB 3EDQB 1PJ5A 3PR4A 4QW9A 1YJVA 2CPZA 3R2CJ 1VC0A 5MLCV 1UETA 2V67A 3CD0A 3Q23A 4EO8A 1KNZA 3ILLA 1VK8A 3NNHA 2QTWA 5IV4A 2RDIA 1N36J 2V5HG 5EDWA 2ZC3A 4TQSA 1VQ8S 3VAHA 2QE5A 3Q2TC 3GONA 1KQFB 1TL7B 3IRXB 2HAFA 3ENQA 3NKYA 2NYHA 3QPIA 1TL1A 1Z2ZA 2KM8C 2DGTA 1YLXA 3G8SA 4UOCA 5HATA 3UD5A 3AXKA 3H0PA 3V4MA 4FNIA 4FYVB 3FEXB 4HDHA 5C42B 3PNIA 3PEJA 1S1TA 1ZA1B 4DPXA 1RTDB 4K0KF 2UUCF 1UJ6A 3KXDA 4MYTA 1T05A 2HHHJ 1WEYA 4DQQA 5I3UB 1ZA2B 1SB6A 2MHNA 1Q4RA 5D8HB 3QLHA 5F0WA 1UVNA 5KG7A 1U26A 3OTCA 4F4WA 2JRSA 3G6XA 1MWQA 3PW5A 4ZJLA 4G1IA 3W65A 3PO5A 2OKQA 2ZVIA 2N4CA 3MTKA 3CDWA 1X0PA 2DCLA 2QL9B 1KOHA 4JI2F 4DUTA 2J8SA 2GIRA 1Q82T 1WORA 5DO2A 4R25A 1LXNA 4DX5A 4KBIA 1C0TA 2ZBIA 1SC1B 2B8QA 3TZWA 2Q3PA 3D2WA 5KFMA 3NNCA 1JJ2R 4Y2CA 2I5JB 4LSNA 2G1HA 4ER8A 4UY8T 3GV7B 3PX4A 2E5HA 1V3RA 4NLGA 2DNLA 1RAIB 2MKYA 3NGKA 2KRRA 4JB8B 4ZVTB 3RRKA 3FQLA 1U4BA 1PC4A 1CS4B 2YH1A 2LEAA 3IP0A 4QWAA 1X4GA 2V4RA 3PM9A 4LRDA 1VLYA 1IBKJ 3J7YU 2OPQA 1TKXB 2DIVA 1O0PA 1YZ6A 3MM9B 5ETRA 2EFQA 5KFQA 1RAGB 4RJVA 3MPDA 3GE9A 2E66A 1IBMJ 3TQ1A 1RAEB 3AD7C 5KT3A 3MZIA 4RZRA 3RUBL 5HLFB 5KFYA 5K8OA 2ZHOA 2DNQA 2M2BA 3R5GA 2VBXA 4PKDB 1FDDA 1UTAA 3C16B 3MGJA 1NK0A 3ZFVA 1RWVB 3P4UB 4EEYA 3UNGC 4DPTA 4X62J 3SSRA 4FS2A 1L3UA 1MN9A 1NK4A 5BYQA 4U7UD 1SJ4P 3MR6A 1TL7A 3ZC4A 2MXYA 3ITHB 3PRBA 2FVSA 2E9ZA 4DLEA 1SQGA 4A47A 1FA0A 3CW2C 3R3TA 5AJ3F 2AX0A 3UN2A 1VC5A 1OS5A 3LPYA 3MPWA 4YEAA 3GJTB 2CPXA 3W62A 3MTJA 1REVB 1RTDA 1YK9A 1S4FA 5I3UA 3PW4A 4F3MA 3PKMA 4Z7CA 1D09B 1RE1B 2L9WA 2YKNA 4DV4F 3IM8A 1OYDA 5T41A 3FNNA 1LWEB 1YBUA 3Q24A 4ILMA 4ECVA 1NMEB 2LMIA 2P5VA 5IXUA 4G3IA 2KHCA 1HBOB 4O23A 4YUDA 4ZVHA 3K58A 5KFLA 3ISND 3FQKA 3SCLE 1R6YA 2NYIA 4DF8A 2O66A 1FNOA 3RW6A 2YPZA 3DGVA 3FSXA 2ZH8A 1RCXB 3DRXA 1RT5B 2A0FB 1LK7A 3NGRA 3PR5B 4J9PA 4C8NA 3RW7A 1AXQA 4F0HA 3LTOA 5DG9A 1HNWJ 2BJ9A 2LEBA 2PT0A 5GAEI 5AE1A 3VAJA 3F73A 2I5JA 3LAKA 1TELA 4NYOA 2BYCA 1HQEB 2OPPB 4OI4A 2KT2A 4C3LA 3MPYA 4UTGA 2V4JA 5KFIA 1M5VC 4YB6A 2KM8B 1M5PC 2MJNA 2LLZA 1AFIA 2HVIA 4BWMA 2UUWA 1TKXA 1LFWA 3Q86A 3D68A 3L95X 4R5PB 4NMLA 4C4WA 4NXMJ 1Y4ZB 1YJUA 3BZQA 4LF9J 5HLFA 1ZS6A 4Q8FA 4OMFG 5E3RA 5T7LB 3UCZP 3ZTQA 2BX6A 2IYGA 5MAOA 1JKHB 4CP5A 4PYDA 4C97A 4JI1F 4UOFA 5E7OB 1NBEB 7AT1B 1RTIB 3OL6A 1P8GA 4ZPTR 4CH0S 3X1LB 5JUMA 1VQYA 1RWXB 1XC9A 5KFTA 5BR8F 2FJWA 4DN9A 3HVTA 2G0IA 3ZTOA 4IQMA 3QT5A 4Q7AA 4ZLLA 3IR5B 3F44A 1TL5A 2ZKTA 4K5RA 5BYSA 4K0KJ 2UUCJ 1FFSB 4F7VA 2GJFA 3LP1A 1REVA 1JLBB 2IFXA 4WP8A 1F9EB 4MIWA 4RR5A 2VFUA 3T3FA 3SFUA 3O1LA 1T9YA 3NGUA 1LWEA 2DIUA 1LWFA 2DRDA 3SMZA 4LRCA 3FSYA 1HBOA 4WPAA 4RBUA 2VDIA 4LT6A 2ASDA 2APOA 4JI2J 4O0IA 1Q95G 5DZ6A 2RQMA 4DSIA 1PGZA 1TUVA 1UA1A 3ILIA 2C2RA 2M88A 2R7TA 4CLZA 4LQ3A 5J1PA 4LRFA 2XLJA 2R42A 1D9DA 3HHEA 2PE8A 1LNQA 2HBRB 3ULHA 3NMAA 2DXEA 3M32A 1OO0B 5D0RA 1SBRA 1B99A 2OPPA 2JLFA 1FO1A 3ETMA 2RHSB 2ADCA 3TAMB 3LANA 1IUJA 4IH7A 1VISA 1XMQF 4PG8A 3R7SB 4C6AA 3E2EA 2GA7A 3VQTA 2CJ9A 2Q6CA 5H9FK 4ZPDA 1S4EA 1SL2A 3A3PB 3TUZC 2VOPA 3NL0A 4DX7A 3FCWA 4KC5A 1T03B 3GCXP 2HGMA 4R5PA 3A3NB 5KT2A 4ES3A 5EN1A 3T19A 5J2MB 1TP7A 1QSYA 1RACB 2RKIB 3LAMA 3T6JA 3T5KA 3BBBA 1S7IA 3PHTA 4H4KA 4EFAC 4NLPA 1U49A 1X4HA 1NEEA 1BGXT 1WC0A 1JKHA 2L9DA 1OY9A 3KDNA 3V2UC 1RTIA 1NPPA 5ETTA 4KPCA 1V5IB 4DL6A 4E8UA 4E98A 2IY5B 3CJ8A 1RTHB 4NEYA 3C6UB 3VCDA 3OFEA 1JX4A 4KJIA 1R0CB 2K3IA 1S0OA 3ILOA 2CDQA 5F8GA 1FT8A 1HHQA 4U8VA 2GJ2A 5DETA 3HFKA 3WX4A 2ZITA 2OD6A 3V6DB 3E01A 3JTNA 1UP1A 4NEZA 3QJJA 2G13A 4USHA 4DJBA 3W5YA 3HXMA 2A6OA 2E1MC 3KLIB 5E3CA 4DV4J 2XLIA 3PCOB 2D41A 3Q0AA 7FDRA 1UMJA 3EICA 1NDLA 1NU4A 1YJWS 2AHOB 1PG5B 3F56A 2EFGA 4ES1A 4HHHA 2B43A 5EUHA 3B6BA 2OP5A 1YJTA 2RAQA 3MPVA 3SQGB 5A8KB 4NE9C 3BBCA 2ZH9A 1YJRA 1S49A 1I94F 1KTVA 1F2GA 2DKOB 4C7QA 3UO0A 2L3MA 3MECB 2V4QA 4K5SA 4ANEA 2Z2LA 2FLNA 4UF4A 4TYBA 3MMAB 2ZFHA 3UVJB 3MOZA 5L1IA 1U1OA 2D3ZA 2QFJA 2E5JA 4KTQA 3O44A 1R7IA 2CQ0A 3TAMA 1YG0A 4ED2A 1QD1A 5EWGA 2E5IA 3H2LA 2Z2MA 2F63A 3VZIA 1WTBA 1WSRA 4ZCMA 3BR9A 4I69A 3VGSA 3Q89A 1T03A 1XR6A 4OZJA 3OVSA 2HHQA 3R7NB 2DNMA 3EX7B 4KR0B 5KFJA 4GVLA 4ED4A 3PYGA 1X60A 1ACMB 3WHIA 2D69A 1H72C 1N6QB 2X1BA 1DHMA 5FIIA 1C1CA 2N82B 2XQCA 2R9LA 4RBTA 4JI1J 1QAJA 1Y5LB 4ETXA 1S97A 2H51B 2DR7A 4M63A 4C8LA 1VBKA 2WW8A 4C8OA 4X66F 1SJ1A 4ANDA 3GR0A 2MQOA 4PWUA 3ZZYA 2EG2A 1BMQB 1EKSA 1RTHA 4LRBA 3C6UA 4P71A 2BOAA 2MJUA 1U02A 3LPEA 4ZPAA 1RSCA 1HFEL 3B4DA 4GO5X 2ZH4A 4NA2A 3V6DA 4CO0A 4HT7A 2GO8A 2NCKL 4DPYA 3N4WA 4Y2KA 3FBBA 4B9MA 3KLIA 1UCNA 4FF1A 3KKFA 4ZPWR 2GS8A 2F7VA 3DRPB 3SYZA 4CLFA 4YR3A 5C24B 4ZKAA 4OYWA 4FBTA 2HSEB 4M5JA 5F0UA 2J7UA 2DH9A 3MCMA 2Z30B 4DPOA 4XDCA 2QYCA 3TAPA 3N6MA 1Y11A 1X4FA 4B9UA 2XSFA 2POKA 4PG7A 3SQGA 5A8KA 3MEDB 2B4UA 4XPCA 2RILA 1CJKB 2XMUA 4FXVA 2OSQA 1U1MA 2DT9A 2HS0A 4AYBD 4RW9B 3MMAA 2EFNA 4ZLPA 3ZZTA 1BY9A 2L9NA 2GIFA 3UVJA 4M94A 2HFVA 1S12A 3DOLB 2CQ3A 2AGPA 3RB6A 2C3MA 1XMQJ 4UOHA 4Q0BB 3G6YA 2RT3A 3LGHA 5E33A 4I0WA 3VAIA 1S79A 1N48A 2BQRA 3QZ7A 3QGGA 1VBXA 2ZDPA 3ELHA 2V9KA 2Z4PA 3EVMA 1FE4A 2XBPA 4ZA1A 3CDUA 3VTIA 4B08A 5B7WA 1BQXA 2X3DA 3L7OA 2D3UA 2AP6A 2VFTA 3EJMA 4PAAA 1YRUA 2I8EA 1IN0A 2C22A 2WOMB 4GC7A 2VG5B 1JJHA 4ZVRB 1GXUA 3TUPA 1W7WA 4FVMA 5KFEA 1XEZA 1WOPA 1IQZA 1VHIA 2XS7A 1R31A 3VAKA 2FHKA 3IA0A 4UQGA 2F4FA 2R2TA 1N56A 4ECXA 4OJHA 3SSQA 3T5LA 5L1LA 2MGZA 2OJ3A 3BSAA 4UW2A 3OTBA 1JXVA 1LWCB 5HAOA 3KJNB 3CEDA 3VVTA 5K20B 3D0HE 2YWHA 3W5ZA 5KFCA 3HSDA 3GJSB 3DRRB 3DFEA 2CQCA 1XWLA 4K4XA 3JSMB 3CCLS 4K4YA 5K14B 4FXDA 3ZNJ1 2MQ8A 2H1YA 4WXOA 3ISZA 2YXLA 1RWNB 2LU2A 1VK3A 2RDDA 5DS7A 3HKZD 3A8KA 4WJBA 1NJYA 2X1GA 2VG7B 2HBZB 3TVKA 5C24A 2YH0A 2NS1B 1K0TA 1J2VA 3NG8A 4TXSA 2P9EA 1V5VA 1S10A 4HTJA 1IM4A 4C98A 1WELA 5F8MA 4QWBA 4IG0B 1KFSA 2IVMA 2EBEA 3G6VA 4RNOA 4RO0A 2K8GA 3FMWA 4KQZA 3BQ1A 1URRA 2V94A 3MEDA 1UVLA 4WWSA 3CCUS 1W2IA 4OLOA 1IBLF 1FESA 1T9UA 2GZOA 3DU5A 3N6NA 2OD4A 2XWXA 1RB0A 2IIHA 4DV7F 3B78A 1RXOB 2VICA 4IO1A 3C14B 5DQIA 1F5BA 4Q0BA 2QA2A 4L3NA 3MXHP 3CVKA 4LR9A 3T1HF 2XM3A 2QV6A 2U1AA 3W9JA 1X4DA 3VQSA 5HP1A 2CNLB 2RHQB 3B54A 3KUEA 3R1HA 1T3OA 1FHTA 4BS2A 4DV6F 1QAYA 3TVZA 1UPMB 3ZXWA 4QYRA 4DMZA 2BRKA 2ROGA 4N41A 1FRHA 1LKZA 1UEVA 1FKOB 3P3DA 3R7BB 4CLSA 3OVBA 2WOMA 3K5PA 5KOWA 2VG5A 3QBCA 3DLJA 1X5SA 1FJGF 1HNIB 4FDFA 5B0CA 3NGSA 3PXGa 4X66J 4I6AA 1VQNS 3DCAA 3MOJB 2A10A 3M8PA 2CPJA 2HPUA 3RR7A 3LW5C 4DQSA 5FJ4A 1H74A 4HL9A 2FGOA 1LWCA 4A8FA 6FD1A 2MZRA 3R5BA 4EU0A 4ZVSB 2KFNA 3BKUA 2Y8WA 3MAHA 4A8QA 2HRYA 3NEKA 4FF2A 2QLFB 3D9BA 4DV5J 2FHJA 3JSMA 3LP2B 2RNEA 1LWXA 5K14A 1VIXA 2XI2A 1TKTA 3ET6B 2EKYA 2R7RA 1WJ9A 1R3NA 3JYTB 4RL1A 3HZGA 1U2FA 2ZZMA 1VHFA 1BXNA 2C2NA 3MCOA 1FRIA 2C2KB 2R3VA 3ZNUA 4GVBB 3BREA 5DLFA 3H8YA 3J81U 1N34F 5CCMA 3M2RB 4K4SA 2AQ4A 4IG0A 1S9GB 4MKBA 3DLBA 2DGOA 4FZVA 4DR4F 4F3OA 4ZP7A 2BMBA 2HBQB 2LXUA 4CLUA 2CPDA 1DRZA 2DGQA 4NLQA 1KLMB 1I51B 5HMYA 2R2SA 2DO0A 2X3GA 2OTJS 4CNYA 2B8PA 3DMJB 4FS1A 3QJLA 1U24A 3NCQA 2B5JB 3C14A 2MEWA 4OZ3A 1KQSR 1TK0A 2HK2A 1Q5VA 2QYGA 1Z4UA 2UXBF 1OSCA 3R6GB 2XCAA 2BOPA 4X4PA 2Y0SD 4PCQA 4X4RA 2DGSA 4HH0A 1N33J 3ISNC 2VD3A 4KH0B 3E51A 3OLAA 2W7OA 2M7SA 4FPIA 3RZAA 4ED6A 2HVEA 3C15B 1NKEA 2UVWA 2PC6A 1KP6A 2VASA 1VQKS 1NZAA 5J2PB 1VQ9S 3CCQS 4NCGB 1U1KA 1FKOA 4KKOB 3BQ0A 2B7BB 2VPXB 4CM2A 2HQ3A 1UEUA 2W7PA 1H7WA 1HHTP 4OV6A 4H54A 2FPHX 1HNIA 3THVA 1FXLA 3CJRA 2ALZA 2J8AA 3I5AA 1TTHB 1RGVA 2RMLA 2FUG9 2J7WA 1WNEA 3BF4A 1IBCB 2YWKA 1RAHB 1H7XA 2IJFA 3CSKA 2ASJA 1AB8A 4I67A 3IM9A 3GIKA 3V6KA 5CYMB 1QLNA 3BO2A 2VH7A 4F4XA 4IR1A 4CLTA 2MKJA 4OJ3A 1OPIA 5DQHA 2DRAA 3FBEA 3M8WA 3M8SA 3LP2A 3ET6A 1MMLA 2R7WA 3HULA 3JYTA 2W9CB 2AYBA 3SBMA 5ETNA 3CCSS 3JTPA 1AUSL 3MM8B 5AXLA 1T11A 2NXNA 4GVBA 2CVIA 1EX8A 4CLYA 2AJFE 3A1YG 2KG1A 4EBDA 1U1NA 3NY0A 1FKPB 1YHQS 5C5JA 4DQPA 3DOMA 3ONQA 4OX9J 4KV8B 2ABYA 4UOGA 2VPWB 1IBLJ 2VF3A 5HQ8A 3BSNA 4K4ZA 1BWVA 2Y9HA 3H5XA 2KZMA 2GC8A 5A2QU 3G2XA 2XGPA 1KLMA 4DV7J 3HT3A 2A2DA 3KK2B 4X4UA 4YHHJ 3DMJA 3PW2A 5D4LA 1WSVA 5DM7Q 3SCKE 2B5JA 2GMJA 3PFEA 3KMSA 1KKHA 1RBAA 1ZETA 3T1HJ 2AJ1A 5IOLA 4M5IA 1N0UA 4FYDA 3HI9A 4C11B 4OYOA 2V2QA 1QSLA 1EP4B 1VRTB 2HNDB 3C19A 4DPUA 2V2KA 2FLOA 4GO7X 3CC7S 4MKYA 3ZZRA 4DV6J 5CAAA 4NCBA 1HYSB 3EZUA 2HGLA 3C15A 3FCHA 5BYRA 1UWAA 1WUUA 4DV1F 3SFGA 4NCGA 1SPBP 1MU2A 1YWXA 2PI5A 4KKOA 1HI1A 1LEOA 3EGWB 3PJ9A 4WFYA 4ZLJA 4B3MF 1FJGJ 1JWWA 2V8HA 5CYQA 2AGOA 4Y28C 5LMNF 5ETQA 1NM2A 4ZOSA 4DFMA 4IG3B 2DB1A 2BJDA 2C3OA 3F0NA 2EW9A 4EBEA 4YR0A 3QJPA 5J1NA 3GFHA 3DYAA 3CNQP 2IA6A 2U2FA 1Y5NB 3H5UA 1Q1KA 4WP3A 1LXJA 2Z56B 2KFYA 3FCVA 1RHKB 4B9SA 3I82A 2CXEA 5B0BA 4LF6F 1HPZA 4OI3A 2NPIA 1XMOF 2BJ1A 1C2PA 1XQIA 4DU7A 3S1TA 3CCMS 4W90B 1KEKA 1X0FA 1Q7YT 1RWWB 2B51A 2FDNA 4CT8A 4B9LA 3AQPA 2W9CA 8ATCB 4J9NA 4PG5A 4LFBF 4M5NA 4GKKJ 3VHQA 1TK5A 4DZDA 4DQIA 2YNFB 1PSDA 4NLSA 4CNZA 2QSWA 3UWTA 1SI9A 2XEXA 1P6TA 1BC6A 1N54B 4CLLA 3R97A 3BM7A 5J2NB 3VV2B 1Y00A 3DDNA 2LDIA 2IRUA 1NB7A 3AB2B 3AD9C 3L09A 4WZMA 3BS9A 1FKPA 4DR4J 1V3SA 2OEKA 1RLDA 4OHWA 4AT1B 2PEBA 2CYYA 3K5OA 3S01A 2ZWPA 5F8JA 2BABA 4KV8A 3HFZB 4LBIA 2FJDB 1RT6B 4Y2IA 4DCJB 1KWMA 4X4TA 4NLXA 3H40A 4DUZF 2QIFA 2EC0A 4XO0A 2E1AA 1N5QA 3KK2A 3H7HB 4HI1A 3CDEA 1BUXA 2UXBJ 3W5XA 1YVFA 3OTEA 3O3LA 4HLBA 4ZHRB 1EP4A 2WSFC 4DX6A 1VRTA 2HNDA 2VPZB 2AGQA 4ED5A 4TU8A 4XK8C 1Q8KA 4OHZA 3HLUA 1HR0F 5DGBA 3C6TB 1FJ7A 5B09A 1NPRA 5SZTA 4V19X 1K0VA 1SQEA 2ZBCA 5IQQA 3MURP 3JB9k 2IPOB 5GVQA 2XS2A 2IJNA 2DNRA 2BKOA 4F04B 4A8YA 3HKWA 3CJQA 3GG1A 1ELOA 4PQAA 1VQ6S 4CLKA 1UVKA 1H2UX 1RA7A 1GMVA 5KFOA 4ED8A 1RHJB 1WF1A 3V6JA 4IG3A 4B9NA 3PTWA 4TQRA 5D4PA 4W98A 4AQYF 3KLEB 3RB0A 3TYTA 2GW8A 3K7RA 2P2CB 1EKRA 2AEJA 1WG4A 5KT7A 4KIAA 1RKJA 3GR1A 4QIEA 1VRQC 1SKUB 2B9WA 1UW9A 1HD0A 2FY8A 1JB0C 2J9CA 3FMBA 4XIUA 1J5EF 2MKIA 2FB0A 4RX6A 5D15A 3K5NA 2CVEA 1IM6A 4M5MA 3K2YA 4JI4J 4ZVPB 2DHSA 4DFPA 4PWWA 2FHMA 2CQ1A 2RUSA 2DR8A 3OTDA 4BHQA 2CNOB 4CWBA 2FVRA 4RUHA 5HVGA 1FJCA 1HNZF 4V19J 2V63A 2YNFA 1UL3A 1ZM2A 3L4BC 2ATLA 5J2NA 4N47A 1WOOA 1NK8A 2XMVA 1REGX 1SQFA 4DSFA 2IRYA 1AZSB 3PIOQ 2OEJA 1RT6A 3CCRS 2ZNYA 3J81j 2GHVC 3J7Z5 4NZ7A 3O5TB 3MM7B 2P9GA 1Q78A 3MEEB 3MR2A 3BGUA 1U09A 1N32F 2BACA 1JLCB 1TMJA 4I68A 3EZ5A 2XMWA 3ETOA 3TJAA 2C3YA 4ZHRA 4K4TA 2ATCB 2ASYA 3ADAC 4WFXA 2DY1A 3THPA 4BC7A 4J5OA 2WAQD 2R7XA 3A12A 5KFPA 2OFHX 4NZ0A 1F9HA 1B0TA 3C6TA 1OY8A 4ECQA 4DV1J 2XC9A 3GJRB 2M70A 4QBUA 4B3MJ 4PG4A 4UUXA 1S6PB 3EGVA 4C8KA 3GMGA 2LQ8A 3AA9A 5LMNJ 2XB2D 1FDBA 1RU2A 4CTAB 2AZ1A 4Z7YA 4P2XA 3EPGA 1S6QB 1GMUA 2ZKUA 1KTQA 2BKPA 3GU0A 4QWCA 3OVAA 1AFJA 5CD4A 5GAEU 4NLRA 3HX9A 2CQPA 2V34A 3KLEA 2E5LF 2AF6A 1K1QA 2CQ2A 3LF0A 4QCLA 4M5KA 3NBPB 1R27B 4KGMA 2W4PA 2WHOA 3BEGB 2N7CA 1F9FA 3TWZA 4AL7A 1VDHA 4LBPA 1VRUB 2ZH7A 3K17A 4RLEA 1R8HA 4USIA 4WBFA 1JLQB 4LF6J 2UZAA 1OMSA 4FPRA 4FN5A 3TZZA 2Y1IA 1XMOJ 3HHLD 4DG1B 4PYAA 2XMMA 5ETOA 4LF8J 3FSIA 4ZITA 3KJFB 3UNYA 4UY85 1WF0A 3DXBA 1JIHA 3QO9B 5A8WB 4LFBJ 2SXLA 5AXKA 1HI0P 1R0BG 1RQ0A 3TUIC 2VIHA 4RBVA 2PA8D 3CWJA 2NREA 3HSZA 3OFFA 1U25A 3I96A 4M1KA 3CULA 4L73A 2RU9A 1N36F 1RWKB 1ULRA 1GAOA 1N8RT 4NMXA 4MFBB 2ZUGA 1M1GA 1ZAVA 4MK9A 2E9RX 1HW9A 1GXTA 3KJVB 4ETZA 4ANCA 3MEGB 3DDKA 4HT5A 4RU9A 4DUZJ 1JXEA 3DNCA 4HYKA 1O6XA 4J7CA 4ICLB 3NNAA 3MM7A 5D77A 2R7OA 3DLLQ 3QFHA 2DGUA 3MEEA 3PO4A 1SJQA 3IGVA 1JLCA 3BO3A 1VFJA 1RYSA 1PYOB 2CPHA 1YJ9S 4F2RA 3NS5A 1U45A 3I5BA 1HR0J 4ZMMA 3HZEA 4P72A 3C8YA 4DR7F 3J7AN 4DL0C 4I56A 2XNRA 1ZTTA 5HK4A 1KVKA 1X31C 4WFAQ 3SCJE 1S6PA 3PJXA 1W2BR 2KYXA 3Q8UA 4PG6A 1NSAA 1KVJA 2CAJA 1HHSA 1S6QA 1XERA 1SH3A 4AQYJ 4QJVA 3MR3A 1DZ5A 2NXUA 3T41A 2W7AA 1QVGR 4QU7A 5FLXY 1S6OA 3KHHA 3NBPA 3W8GA 2ZWOA 1UJ4A 4U7UK 1PAEX 3WDOA 5IT0A 3KHGA 4LJMA 2DXFA 4TU7A 1D8ZA 3J80Y 4KGVB 4HKQA 2OELA 5IT9U 3FC9A 1P1LA 3FFIB 1RWOB 2PMWA 1I6JA 1J5EJ 3CJ2A 1JQGA 4I1TA 4LFAF 3HP6A 3QIDA 1TL3B 4DG1A 2LQ5A 5IT9Y 1L3VA 2W2OP 2G2OA 1J5OB 1S0VA 4MJKA 4B02A 3OHBA 4U67Q 2XWYA 2CZ4A 5CZXA 5L9XA 1EARA 2BJ3A 4B17A 3QO9A 3ENVA 5A8WA 2YKAA 2JEFA 2QMXA 1HNZJ 1F60B 5KT4A 4Q45A 4X4NA 1L3SA 1RU1A 1RT4B 3FEYB 2WBRA 3D67A 1UPPA 2OMOA 1M5HA 3RAMA 1CBKA 2V8GA 2M3DA 4PZVA 5CABA 4DV2J 4URGA 2VJVA 2B3TB 4OV1A 2MQNA 4F36A 4MFBA 3TJ9A 1TL1B 3QRRA 3I9ZA 3R9LA 3EVWA 1YITS 3KJVA 1DURA 1U1PA 3PYFA 1WOSA 3LQVA 2YNHB 3HO1A 4ICLA 5C2CA 3TW0A 5B08A 1SIWB 1U7LA 3AY0A 5KT5A 1N32J 1JK9B 1VC6A 2R7QA 1XJWB 1S0NA 4W4MA 1U47A 2XCPA 4IH5A 3RBEA 2BVZA 2BUNA 4NLOA 2PO4A 2UXDF 1PYTA 5E5NA 3N28A 1WC1A 1Q7LB 1OQ6A 3DKDA 3BYRA 2AEFA 1WEXA 4ILLA 1Q5YA 1AYEA 3UE2A 4O4GB 1NDPA 1QY7A 3K8VA 3P49B 2DGWA 3B8HA 2J6TA 3D6FB 4PXDA 2J0XA 1X4CA 1Y3KA 2NUUG 4LR7A 2Z57B 3VWSA 1NH8A 1WI8A 1K73T 2YTCA 3PX0A 2EKNA 4IOAQ 4ZP6A 3GILA 3N5FA 3CUNA 2W4CA 3B82A 5LXRA 2E5LJ 5HQMA 1JLEB 3IWXA 2ACYA 4M5DB 2R2UA 5EWFA 2DK2A 2ZC4A 4LSZB 3W1YC 3KDOA 2HFNA 3CIZA 4CYUB 3FFIA 2ZH1A 3BKTA 4P10A 3MD3A 4TKTA 3UQSA 2DYAA 4A8XA 2M0GB 1UA0A 1FVSA 3QGHA 4IUFA 4HHJA 3AAWB 3KWMA 3HSGA 2WONB 5HQLA 1J5OA 3HJVA 4ED7A 1PJ6A 4WKYA 2F8HA 2FYXA 3BR8A 4LF9F 3KJQB 3J7ZT 2VONA 3GIIA 1MWYA 1A0OB 4ZVFA 1RT4A 1DQ9A 3GZ7A 2YWWA 1IJEB 2CWKA 1PJ7A 2OLWA 4AXIA 5C2GA 2V68A 1XN9A 4Y34A 1C1BA 4ELUA 2MKHA 5GADI 1FRJA 3KTQA 3JS9A 1JJCB 1S9EB 2R8JA 2D3O1 1CJUB 2WRMA 2X1FA 4KHPJ 2HZCA 3U1NA 4DUYF 2ACMA 4HEA9 2AV5A 4RWXA 4LSLB 3M1VA 1IKYB 3TRGA 3P5TL 1NKCA 3EXYA 1UFLA 3M30B 1U2CA 2YNHA 4RNNA 2B9YA 2BBEA 4BWJA 3W2WB 4NYPA 2MSSA 2DGVA 5KFBA 1VOMA 2VFVA 3CCTA 3HMJG 4DWIA 1X7VA 1C0UB 5LL6d 1NSPA 4PQUA 1DAXA 1VQOS 2KZZA 2YKNB 3MAAB 2EK1A 1CLFA 3W3SA 4IOCQ 1EETA 3OW2R 4H4KC 4KGZB 3PJWA 3J7A1 2MPUA 2O3DA 2HNZB 4OYZA 2RQCA 1XTZA 1SC4B 2R2RA 3DOKB 3CJ5A 4O4GA 3PW7A 2C2OB 2EWHA 2VJUA 4DR7J 1M1KT 2VDHA 3O6QA 1S57A 3SV4A 3OSNA 2E44A 1JLFB 1NK7A 4I7FA 2MMYA 1WHWA 4UQTA 1A9NB 3UDLA 3DM2B 5L46A 2QLWA 1F3VA 3L7PA 5D4NA 2K1RB 3MHYA 4OZ5A 2VA2A 3KOAA 1JLEA 1TU0B 4NRTA 2V4JB 1N0VC 2MLYA 2JOQA 1HNXF 4M5DA 1TVRB 4EYIB 3QFWA 2EC2A 1ZPWX 1T02A 2L08A 4OIXA 4IR9A 4CYUA 3GWCA 4LFAJ 3TOQA 4ZPVR 2GO9A 1WKJA 4MYUA 4CLPA 1NJXA 1IKVB 4I6YA 1WF2A 2WONA 5B0FA 2GX8A 4DSJA 4F4YA 2LQBA 4F26A 5ETVA 4NXNF 3NS6A 4LBHA 5I3PA 1NK9A 5B0DA 3THTA 4UT4A 2P6SA 4MMOA 3P45B 1SH0A 5IC6B 4MIBA 3DC2A 3R5JB 5JXSA 4AL5A 1U1RA 4C8MA 2IA0A 3HVTB 4UZCA 3HT0A 1RTZA 2JFKA 2BJEA 1S9EA 5D78A 1CJUA 2EEYA 1FJEB 3OPKA 4LSLA 1QVFR 1IKYA 5M2RA 1VLOA 3M30A 3OUYB 4DR5J 1GXLA 4C3KA 3W2WA 3VALA 3LP1B 1T7PA 3KUGA 3TZXA 3HHNB 1U2RA 4LF7F 1VQPS 1C0UA 2HWTA 4DF4A 3AHPA 3MAAA 2UXDJ 3CC4S 1W25A 4JOUA 4DS4A 1WDTA 1LWFB 2GQCA 1WHYA 2M5YA 1RYRA 3KG0A 3P6YC 4UZBA 2VL1A 3ZTPA 3UDVA 1B7FA 2HNZA 2MZJA 3DOKA 2RU3A 2ASLA 2FJVA 4ZVUB 5HVFA 4QIFA 4HTIA 3OT9A 4QPXA 2DR5A 1LV5A 2AYGA 1AUDA 4KHMA 2EXUA 1JLFA 2HHVA 2QSFA 5L8RC 2VA3A 3M32B 2FC9A 4L6V3 4CDIA 2AYMA 2XZDB 3DM2A 4FBUA 5KG0A 2K1RA 3CPWR 2BQUA 1UVIA 2CG4A 5L39A 4ENOA 4CIOA 2FZGB 2RE1A 5HJXA 4TVAB 1IVZA 3M7VA 5IWAF 1TVRA 4N7TA 5KFDA 2D7SA 2FJXA 1R8BA 1MROB 2FZCB 3FEZA 3OD2A 3UI3A 2CJXB 1QSSA 2YKOA 2L48A 3KLFB 1FWLA 2RSQA 1SH2A 2UP1A 1T8EA 1IKVA 4PRFA 4NASA 4DOZA 2NQPA 1YRXA 4K4VA 3M2VA 5DM6Q 1TUGB 1OQ3A 1S1UB 3ILJA 3KLVA 2HURA 2MQMA 3T6BA 1UW4A 1RWUA 2E7WA 4IOBA 5F8NA 3QAEA 2FC8A 5A0YB 3MF5A 2GHPA 1N5YA 4ATNA 3N9UC 4NLVA 2HFUA 3JQMA 4P7TA 2F8MA 2LP4A 1JLAB 2B7CB 4DUYJ 1RHUB 1Y5IB 2W9BB 4DBQA 2LXFA 1JNZB 4L72B 2ZM6F 1BWEA 1M5OC 2ZH6A 3OUYA 4J90A 1CC8A 2IHR1 1P1TA 5KFWA 2QRRA 3E01B 3R2DJ 4B9VA 3CD5A 3TX8A 1FE0A 2M4MA 5A8RB 1Y3JA 4C48A 3M8QB 1RBLA 3WX8A 1YJ7A 1SJFA 4LR8A 1V9OA 2MKCA 1YIJS 3KK3A 3QZ8A 1T3NA 1YX2A 1FX4A 4JI5F 4X2BA 3M6VA 3NOGA 1VBYA 2Z2ZA 3KNAA 4K59A 2VV5A 1F5AA 2K3KA 4C0HA 3QT8A 4ITSA 3BB5A 3P5BP 2JEIA 1U0HA 3SIPB 3RAQA 3U27A 4YQWA 2E1PA 3AFGA 2Z58B 2DH8A 1M0SA 4WP9A 1KR4A 4J9OA 5E3QA 3QGPA 4USTA 2HVZA 3V81B 3S8SA 1NRKA 1ZYQA 4J9SA 2LA6A 4PPDA 4WIQA 1FDNA 1RHQB 3R5DA 2BXJA 1KDNA 1VR6A 2MY7A 1HBUA 5A76A 1HNXJ 2GV1A 4NYZA 2W8LA 4C9DA 2JL9A 1FEHA 2HHXA 5KFRA 4OX7A 3ZZPA 4B9TA 1CQNA 2HGNA 2BJ7A 1CJVB 2JFDA 1MROA 1P9QC 3JSRA 4X64F 2JVOA 2XULA 3D0GE 3KLFA 1YBTA 5CCLA 3EXCX 4CT9A 1G2EA 1QUVA 1PYSB 3HJFA 2YQ0A 4WIIA 5AE2A 4NXNJ 5F9LA 1C1CB 2RRAA 1H98A 3VF0B 4RNFA 1RKIA 1S1UA 4IQXA 3R5CA 4FF3A 1Z1ZA 5A0YA 1O8BA 4I2QB 4F02A 2RQKA 1JLAA 2W9BA 2DNHA 3HHLC 5KG2A 1SJRA 1HLWA 2J9DE 1ZM3A 1HA1A 4CZCA 3TAQA 2ILZA 2YQ3A 2DVIA 4ZK7M 2YX1A 4LF7J 4KPYA 3PRDA 1O5JA 3I4PA 5A8RA 1HWJA 4MK7A 3M8QA 1HQUB 1NDCA 5HMXA 3KYLA 2HQGA 1I3OB 4OYPA 1JLGB 4URSA 1HD1A 1FK9B 3H5SA 1U6FA 1X5TA 2CJYB 2WVDA 2MKSA 6AT1B 4U8YA 2OEMA 3FBCA 1LW0B 4A46A 1D8YA 1NAQA 2FTRA 1YTYA 3UN3A 5HN0A 2YWFA 2MTLA 3P8BB 2BM1A 4OYBA 3I5CA 4Y3CA 1KHWA 2LQ9A 4BBYA 1NHKL 2W01A 4NOHA 1FDAA 2BDPA 4K4WA 2LCWA 1NZ8A 4RW4A 2NPFA 3IBFB 3D1OA 2QJ3A 2I2YA 3V81A 1RJJA 2Z8QA 2H5EA 2HFOA 1HNVB 1MWZA 1WACA 2I1RA 1ZTWA 4KFBB 3PRVA 1KVIA 5IWAJ 3DU6A 1B7YB 3IAS9 3DLGB 4IRDA 2B4OA 2HNYA 4IFYB 2G0JA 3G96A 3KLGB 2CNKB 3G86A 5DDOC 1CJVA 3K89A 3SDEB 1ZM4A 1NNDA 3AOAA 1URNA 2QL7B 4C8ZA 2MLZA 3UPFA 1G7CB 3PFOA 2XYGB 3D3BJ 2J9DA 1IWAA 1RLCL 2KT3A 1F2HA 3EM1A 5D0EA 2M9KA 5GMDA 2H4WB 4P6QA 4Z37A 1KC8T 3BGLA 1VCTA 4OZ2A 4ZN3A 2J9EA 2ZOGA 4XDDA 3CTRA 2FJBB 4RU2A 2N7YA 3GSIA 3BKFA 4P2SA 2E1RA 2HIQA 3UDEA 4WTOB 5KG4A 4I2QA 3MDFA 4F50A 4KH1B 4R0JA 2WB4A 4G65A 3TZYA 2MGZB 1GX6A 5SUHA 2ZM6J 2CQIA 4NLTA 1Q86T 4KO0A 1TAUA 2V6AA 3PW0A 5G0RB 4ZDNA 8AT1B 3IS9A 1K47A 3DXSX 1SL0A 2AWZA 4WFBQ 2XZWA 1T9WA 5LXYA 4DV5F 1RTJB 4J9QA 3S7RA 4M5LA 1HQUA 5F8IA 4FF4A 1H3DA 1FWKA 1DLOB 2COLA 4FYXB 1JLGA 3H2UB 3IRWP 4JI5J 1FK9A 4GKJF 5GAHI 3NCRA 3MAQA 5KG3A 2DHHA 4AFFA 4WTYA 1LW0A 5LSLA 2AIRB 3KFWX 3MUVP 1WDDA 3MMJA 3W66A 2UUBF 1D3WA 2QC3A 2GIQA 1NCLA 1HARA 3BV8A 3FJ2A 3HVRA 1NJZA 4ELTA 3EGNA 1X4AA 3OR2B 1EQMA 2DBBA 2MZSA 1ROFA 3M6XA 4WE1A 2E7XA 2UVVA 2ZZNA 1U1LA 2KJWA 2HFSA 3NMRA 2KXHA 4NPOA 4DL5A 1HNVA 2O67A 5I3QA 2PD1A 2V0NA 2DNPA 1ZH5A 3NGDA 2MDAA 4KFBA 3TEHB 1WD6A 3G87A 3HHLB 5KTQA 3DLGA 3CGIA 5HP1B 2YWEA 5L1KA 4IFYA 1F6TA 3KLGA 2UU9F 3HHKA 5F3TA 1T95A 1N33F 1SXLA 3TP2A 4X64J 4IO9Q 3SDEA 2M8HA 4S0MA 4WU2A 2ZE2B 1NJWA 4BDPA 4J91A 2IVFB 3H2VE 4KYZA 4NRUA 4XAKA 2VFSA 3EDRB 4ECZA 5HI7A 2HBYB 1VQ4S 2L41A 2R8GA 2C3UA 2BW7A 4F3QA 4Y65A 1FRMA 2A6MA 1L5UA 1VIOA 4FKXA 2FLPA 2WBMA 4DEZA 2G4BA 4ERDA 2QLBB 4R0EA 4EK2A 3UR3C 2WCXA 4U9RA 3NWGA 2WW4A 2IBKA 2XSJB 3ZZZA 3M8PB 3TI0A 1Q8LA 1YI2S 2KB2A 4ECTA 2QMWA 2G9OA 5B0GA 4F0MA 5CA5A 1IKWB 2KRBA 2YX7A 3IBCB 3MPUB 2Q6BA 2YKMA 3PX6A 5G0RA 2B4VA 3V4IB 1UVMA 2PMZD 4EI2A 2AJQA 3OTOF 2NLWA 3DLKB 2OI2A 2DXDA 3M4XA 3PEHA 1H0HB 5F8HA 4B3RF 2ZJQQ 1RBOB 1TKTB 1RTJA 3CE8A 2AJ0A 1HWLA 2EFOA 2PDAA 1NK6A 3CJSA 2XO7A 1Q8BA 4MTPA 1DLOA 4WYLA 3FRYA 3LO3A 3L7UA 4TN2A 2B6AA 2W2PP 4O3RA 2CJQA 2WSCC 3H5YA 2HLUA 2HWHA 1AA1B 4TNOA 3US5A 2Y1RI 5AE3A 2VC0A 3JAMU 1FFWB 3JSYA 3H20A 1ZOTA 2XHCA 1IR2A 1FERA 4K7QA 3B4MA 3M8RA 1BQNB 2BR0A 2ZEJA 3JAMY 4OX9F 3OR2A 3CD7A 4NX9A 2CQBA 2JX2A 2OGUA 4H4OB 4ECSA 4F67A 3A13A 4YHHF 2PMHA 1MW7A 3W60A 4ZCKA 2NXJA 4Y0FA 5KFXA 2H65B 4B3OA 1VJWA 1RT7B 3HHLA 4NA1A 4I4BA 4E2FB 5IC4B 3ENWA 3BSCA 5KG6A 2FGCA 3AJDA 2ROEA 3FVYA 1HWIA 2MLXA 1OWXA 2HG4A 2ZE2A 2Y1JA 4CO1A 3O8WA 3OJSA 1FD2A 2V9WA 1EIYB 1NH7A 4KY3A 3KMQA 4K2XA 2PA3A 2HAIA 1HL6A 2GVDB 1KRPA 4OJ1A 1GNKA 2W2QP 2KTQA 1BLUA 1RT3B 3GYGA 4NZ6A 5EGYA 1U6ZA 1BQMB 2VQFJ 2R4FA 5E41A 4I2PB 1TQLA 3IRXA 5F3ZA 4YDXA 3NXZA 1FX2A 2V8DA 3NRBA 1XK8A 2CUYA 3A8EA 4PR6A 3RR8A 1R43A 3PYEA 3P96A 2KL8A 4UUWA 3CD6S 2LA4A 2XSJA 4MK8A 4Q2LA 4CM0A 5C42A 4IH6A 1EQ0A 3W9HA 1CPZA 1DY3A 3TUJC 1IKWA 1YZ7A 3Q8SB 2Y0BB 2KDOA 4MAKA 4RKUC 2ZHBA 1ZZFA
chains in the Genus database with same CATH topology
4RW6B 5A6WA 3V4IA 1P1LA 2E5IA 3H2LA 3FFIB 2ZJPQ 2EPIA 2Z2MA 1JXLA 1S77D 3DLKA 1I6JA 3SSSA 3LWMA 3CCVS 4ZCLA 3I0SA 3VZIA 3RRHA 3CJ2A 1WTBA 3RB4A 4ZCMA 3BR9A 4I69A 4I1TA 4LFAF 2KXNB 3LP0A 5LSOA 4JV2A 4KB7A 4EGLA 1TZ0A 3HP6A 1FNXH 3QIDA 1T03A 2NZ4A 1TL3B 1XR6A 4DG1A 2LQ5A 4I6WA 5IT9Y 1L3VA 4OZJA 3OVSA 2EBGA 2HHQA 3OFHA 3I31A 4JUZA 1GX5A 2DNMA 2IM1A 5AXMA 1HYSA 3EX7B 4KR0B 3VR1A 5KFJA 2KKHA 1J5OB 3GSDA 1S0VA 3KK3B 1ZAXA 4J9LA 4NLUA 2KH9A 4MJKA 4B02A 3OHBA 4U67Q 1ZM9A 3S6EA 2XWYA 2CZ4A 1WI6A 5CZXA 3N5BA 5L9XA 3G4SS 3RB3A 1S0MA 1N6QB 2IRXA 3QO9A 4B17A 3ENVA 5A8WA 2VKZG 3MUTP 2X1BA 2YKAA 1DHMA 2LKZA 5FIIA 1DBDA 1WTFA 4MIAA 2QMXA 2JEFA 1C1CA 1F60B 1Y0HA 4GKKF 5KT4A 2N82B 4Q45A 4B3SF 1L3SA 4X4NA 1RT4B 4M8LA 2PEHA 2F40A 2R9LA 3FEYB 4RBTA 4QR0A 2WBRA 3OQ2A 1QAJA 2OMOA 1M5HA 1Y5LB 1DTQB 5J1EB 3D5MA 4DL2A 4ETXA 1S97A 3RAMA 4DR3F 2RD5C 2V8GA 2DR7A 2M3DA 2CIMA 3C46A 3G9CA 2PIIA 1TR0A 3MCSA 4M63A 4C8LA 2WW8A 4CQ1A 5IFMA 4C8OA 4X66F 1SJ1A 2JHEA 4URGA 3GR0A 4DFKA 3J81Y 1QJHA 2MQOA 2B3TB 4OV1A 2MQNA 1XR5A 4LVOP 4PWUA 2J5AA 1BQNA 3ZZYA 3RTVA 2PFFB 2EG2A 2V8VA 4MFBA 2R7UA 3K57A 1TL1B 1E6YB 3DRYA 1RTHA 1UWBA 1NJIT 3HK2A 3C6UA 3I9ZA 1VI7A 1YITS 3KJVA 1DQ8A 2W24A 4HDGA 1CG2A 1DURA 3N6LA 2MJUA 4HI2A 1U1PA 1GH8A 1FRLA 4ZPAA 2OTLS 3LQVA 3MMCA 3C3LA 1SKSA 2YNHB 3HO1A 2IMWP 1SC6A 4H4OA 2YY3A 4ICLA 1FCAA 3WZ0A 3TW0A 1UAWA 5B08A 1HBUB 1HFEL 3B4DA 3ZZUA 4GO5X 3IBWA 1SIWB 1U7LA 2JLGA 3AY0A 5KT5A 2ZH4A 5JVHQ 1IKXB 1JK9B 4NA2A 3M9OB 3V6DA 1SJ3P 4CO0A 1VC6A 4HT7A 3HVAA 2KU7A 2VB6A 2YNIB 2FVQA 2R7QA 2GO8A 1CQMA 3MM9A 1S0NA 2UXCF 3LGNA 1U47A 2ZJRQ 2R7VA 1FD8A 2XCPA 1KSPA 4LIRA 1RT7A 3MWBA 3N4WA 3RBDA 4Y2KA 2J0WA 4IH5A 2KT5A 2BVZA 5GAGI 3RBEA 4B9MA 3KLIA 4OHXA 2BUNA 3CIMA 4PXEA 1Q81T 2IYIA 2PO4A 4NLOA 4FF1A 2UXDF 3KKFA 2ZOMA 4ZPWR 3HDSA 3DI6B 5DLGA 1S7HA 3Q8QB 2F7VA 3DRPB 2GGPB 3SYZA 2FIUA 5K8NA 5E5NA 3N28A 1Q7LB 2JC1A 4YR3A 1OQ6A 4LQ9A 4Y2AA 2FY1A 5C24B 2B56A 3CDAA 4ZKAA 4FBTA 2ADBA 5THWA 1WEXA 2E5GA 2K7JA 5F0UA 3UCGA 4ILLA 2J7UA 2DH9A 5ITHA 4GC6A 2VG6B 3UE2A 2ILYA 2OPRB 4O4GB 1RP5A 2HQIA 4XDCA 4DPOA 2C3PA 1QY7A 3K8VA 4B3TF 2KO1A 2QYCA 4DV0F 3P49B 1Q16B 4LF5F 2DGWA 2CQGA 3TAPA 3N6MA 1X4FA 2DHAA 3B8HA 1MU2B 1MMNA 3MEKA 4DQRA 2J6TA 4B9UA 4ZPBA 2XSFA 5F8LA 2POKA 4PXDA 4PG7A 4K4UA 2J0XA 3SQGA 5A8KA 2UUAF 1RT3A 2N4DA 2VC1A 1X4CA 3MEDB 2WSEC 1Y3KA 5CYQB 2B0GA 3F41A 1QAXA 2NUUG 1MMDA 2B4UA 2JH3A 2A18A 4XPCA 3UD4P 2RILA 3OR1B 1BQMA 2G1DA 2XMUA 5JVGQ 4I2PA 4FXVA 4LF4F 3ITHA 1NK5A 2OSQA 3VWSA 1U1MA 1NH8A 1WI8A 2DT9A 1K73T 3QGIA 2HS0A 2VBZA 4JV1A 4RW8B 4AYBD 5KG5A 4RW9B 4QZVB 2YTCA 3CCES 3PX0A 3MMAA 2EFNA 1F0XA 4IOAQ 4ZP6A 4ZLPA 3N5FA 3ZZTA 2K2PA 1BY9A 2L9NA 3GILA 1XBWA 3CUNA 4M94A 2W4CA 4WYWA 3B82A 5LXRA 3DOLB 1TFWA 2DNNA 3BDEA 2CQ3A 2AGPA 3RB6A 2ZH2A 1JLEB 2C3MA 3IWXA 5L38A 4C0BA 3PVXA 4Q0BB 3G6YA 1N4LA 3V6HA 4ZP9A 2ACYA 2PI4A 2AYEA 3DYAB 2RT3A 2XMJA 3KK1A 4M5DB 2AX1A 3LALA 5E33A 2R2UA 3CMES 1QE1A 4I0WA 5EWFA 3OLBA 2DK2A 2CJAA 2ZC4A 4A8WA 3VAIA 4UY85 2N3OA 2KHDA 2QEXS 1S79A 4CH1A 2HFNA 1N48A 3CIZA 3OBIA 1KN6A 2IVYA 4RW6A 2BQRA 3BGRB 3QZ7A 3QGGA 3FFIA 4ILRA 1VBXA 3RU0A 2ZH1A 2J6SA 2ZDPA 3CMAS 4IFVB 2JLEA 2V9KA 4KHRA 4O3PA 2Z4PA 1HPZB 2P9CA 1QUPA 1FE4A 2XBPA 3MD3A 4U7CA 4TKTA 2MZQA 3IFEA 5KFKA 4WF9Q 4ZA1A 3CDUA 3UQSA 3VTIA 2I38A 4A8XA 2M0GB 2AW0A 2LXIA 2VUGA 1FVSA 3QGHA 5F41A 4QIGA 4WCEQ 2QA4S 1UA0A 4IUFA 4HHJA 4OQJA 3AAWB 4JI0F 4B08A 5B7WA 3KWMA 2WONB 1BQXA 4ALZA 5DDRC 1OPZA 1WG5A 1J5OA 4JI4F 3IGNA 3L7OA 2CKWA 4ED7A 2D3UA 3M9MB 4WKYA 2AP6A 2F8HA 3TNVA 2VFTA 1FKAF 3BR8A 2HFZA 4LF9F 1Q7YT 2GJIA 4ID5B 1YRUA 4WXWA 1WHVA 3J7ZT 4PUOB 3D0IE 2VONA 1S6UA 1IN0A 2I8EA 3PHEA 3GIIA 1MWYA 2WOMB 4GC7A 2C22A 1NHVA 3K59A 2VG5B 5LSRA 2R8HA 4A48A 1RT2B 2WB1D 3OV7A 1JJHA 3KG4A 5ADZA 2ERRA 1IJFB 3V5RA 1GXUA 4ZVFA 1U1QA 1RT4A 1DQ9A 2WTFA 3GZ7A 1RT5A 2MZTA 2DJWA 4ZS6A 1R0AB 2FVPA 1IJEB 2QZ8A 4NL5A 4FVMA 5KFEA 2FD2A 1XEZA 2OLWA 4AXIA 4ELVA 1IQZA 1DTQA 5J1EA 2XS7A 1XN9A 5KG1A 4Y34A 5T14A 1C1BA 1R31A 3VAKA 4ELUA 2FHKA 2RUGA 4IKAA 2BV3A 2MKHA 2Q79A 3IA0A 4LUBA 5I42B 4UQGA 5GADI 2HHTA 3IR7B 4USJC 2R2TA 1N56A 4ECXA 2ZOFA 4OJHA 4N5SA 1HQEA 1FRJA 1X9SA 3KTQA 3SSQA 3T5LA 1S9EB 4OX8A 2R8JA 2WRMA 2X1FA 2HZCA 4RW4B 5L1LA 1E6YA 3W7BA 2RRNA 2F3JA 1DARA 3KHLA 4OZLA 2MGZA 2OJ3A 3U1NA 3BSAA 3Q22A 4UW2A 3QWPA 4DUYF 4N76A 2EG1A 2YNGB 3OTBA 4HEA9 2AV5A 4J9KA 4RWXA 4LSLB 3NP5A 3U7JA 3G71S 3M1VA 1IKYB 3TRGA 3P5TL 1NKCA 3OL8A 3EXYA 1UFLA 2CQHA 1LWCB 3M30B 2OSRA 5IS2A 5HROB 1D0EA 2YNHA 3CEDA 4RNNA 2B9YA 4DL4A 2BBEA 4BWJA 3VAFA 3W2WB 4ECRA 3D0HE 4QYZJ 4AE5A 5LJ3Y 3G8QA 2YWHA 4NYPA 2MSSA 5KFCA 4NA3A 3BQ2A 3DRRB 4ZPCA 2DGVA 2O5DA 3DFEA 2BANB 2QO3A 4KAIA 4RNHA 2CQCA 4TYAA 5KFBA 1VOMA 1XWLA 2VFVA 3CCTA 1IKXA 3HMJG 4DWIA 4YR2A 5A2QY 2IM2A 1X7VA 1C0UB 5LL6d 4K4XA 2YNIA 4DX8H 3JSMB 4ZVGA 3CCLS 3E3XA 4K4YA 2HNYB 3HHDA 5K14B 3Q8RB 4PQUA 1DAXA 1VQOS 4FXDA 3U1LA 2KZZA 4WZQA 2YKNB 1U48A 4WXOA 4JV5F 2EK1A 3T5JA 3ISZA 1CLFA 2JSXA 5GAGU 2LU2A 1VK3A 4IOCQ 5FDLB 5DS7A 4IRKA 1S72S 2Q66A 1JMTA 3HKZD 1EETA 4WJBA 3DI6A 1NJYA 3OW2R 2HRUA 2GGPA 4H4KC 5E3PA 2X1GA 2W25A 2JC0A 2VG7B 3TVKA 5C24A 3PJWA 2J7KA 2YH0A 2NS1B 2UVUA 3J7A1 2MPUA 1K0TA 2O1PA 1J2VA 3N01A 5T7LA 2O3DA 3NG8A 4TXSA 2HNZB 2MB0B 2RQCA 1XTZA 2DH7A 2IC3B 2P9EA 2VG6A 1KFDA 2FJAB 2R2RA 2OPRA 1S10A 3DOKB 3CJ5A 3MM5B 4O4GA 3PW7A 1KLNA 1QTMA 2DD8S 4HTJA 2EWHA 3DLEB 2FLLA 1IM4A 4C98A 1WELA 5F8MA 1M1KT 2IM0A 4O3OA 4U6PA 1K8AT 5B0EA 3E8OA 4BC9A 4QWBA 3O6QA 4IG0B 4OI2A 1HBMB 2MKKA 2F9DA 1KFSA 2IVMA 3SV4A 2F4VF 3H59A 2EBEA 3G6VA 4RNOA 3OSNA 2K8GA 3FMWA 1N5TA 2R7SA 2E44A 1F5CA 1JLFB 1N5SA 2I9SA 4I7FA 4KQZA 3BQ1A 1NK7A 4G1QB 1URRA 2BZ2A 2MMYA 1H6KX 2V94A 1WHWA 3MEDA 2XS5A 1UVLA 5FD1A 4UQTA 4CH7A 2OIHA 4F2SA 3OR1A 2MHEA 3FGVA 4E0DA 1A9NB 1WEZA 4X4SA 1LFPA 1RISA 4HH1A 3CCUS 1TKZB 2MQLA 3UDLA 1S1XB 1V6HA 2CZVC 1W2IA 4OLOA 2DCUB 1IBLF 4F8RA 1FESA 1GT8A 2KVIA 3TA1A 3DM2B 4RW8A 4EUVA 2QLWA 3DU5A 3N6NA 2OD4A 1G6BA 3L7PA 5D4NA 2XWXA 4DV7F 2MSTA 2K1RB 3MHYA 4OZ5A 2VA2A 3B78A 3D1HA 2C2EA 2CJBA 4IO1A 3KOAA 4IRCA 5DQIA 3EUNA 5GMKa 1OIAA 1F5BA 1JLEA 1UKUA 4NRTA 1Z2LA 2V4JB 5KFVA 2EK6A 1N0VC 2KI2A 4Q0BA 2QA2A 4L3NA 4HVZA 2D1CA 2JOQA 3NAIA 1HNXF 3MXHP 5KFSA 3CVKA 3QAUA 3T1HF 1JLBA 4KO0B 4M5DA 2HHHF 1X9MA 2QV6A 4DSLA 1TVRB 4J9RA 2PGCA 2U1AA 4EYIB 1X4DA 1ZPWX 2DPIA 1X5OA 3VQSA 3IS9B 1P27B 4ED3A 1T02A 2L08A 4OIXA 5HP1A 1HWKA 2Q1LA 4IR9A 4QWEA 3IO1A 3BGRA 3GWCA 3QMQA 1IQTA 2HWIA 4OHVA 1G3OA 4IFVA 3TOQA 3R1HA 5CD4H 2FHJD 1TK8A 1T3OA 3PV8A 4DR2F 2RQ4A 2OH2A 2J0SD 1FHTA 4BS2A 1NKBA 4J37A 1Q8IA 4DV6F 4QQBA 3K5LA 4ZPVR 4F4KA 1QAYA 1YJNS 2YVSA 3TVZA 1TV6B 2GO9A 1M90T 4D3HA 4LF8F 4QYRA 4MYUA 1FRKA 4DMZA 1NJXA 3CXCR 2BRKA 2ZNZA 1IKVB 3SEOA 4I6YA 1WF2A 2D74B 2WONA 2BW2A 2ROGA 3M6UA 5B0FA 2GX8A 3DN9A 4XPEA 4DSJA 4FP9A 3T9NA 4F4YA 4N41A 1FRHA 2VBYA 1LKZA 1UEVA 1T94A 4CO5A 1FKOB 2LQBA 4F26A 3UD3P 2ZH5A 4TY9A 3POTB 3T5HA 2LU1A 3P3DA 4ID5A 3NS6A 4NXNF 4PUOA 4RWWA 5I3PA 1NK9A 5B0DA 3OVBA 3THTA 2WOMA 1SV5B 2CPIA 3K5PA 4OZNA 2VG5A 5KOWA 2P6SA 1RT2A 4MMOA 3DLJA 3SZ2A 3HF5A 1SH0A 4MIBA 3DC2A 1X5SA 4X4VA 2UUTA 1FJGF 1R0AA 4YB5A 5J2QB 1HNIB 2B4PA 4YMEA 3EPIA 3K8WA 3GG0A 5B0CA 1B0PA 5LT5A 5JXSA 4CTAA 3PXGa 4MKAA 4AL5A 3OJUA 2FVCA 3N79A 5K8PA 1U1RA 4I6AA 5I42A 1VQNS 3OHAA 4C8MA 5E3AA 2XGQA 4Z2XA 2E29A 3PIPQ 2IA0A 3HVTB 5GADU 1ZZNA 6FDRA 2CPYA 1S9FA 4QOTA 2JFKA 1ZPVA 3DCAA 3MOJB 2BJEA 5KFZA 4PXBA 4WE1B 1S9EA 2MYFA 5D78A 1PO6A 2A10A 1FJEB 3M8PA 2CPJA 2UV8G 1SIZA 2HPUA 1Y7PA 4QR2A 3RR7A 2Q43A 2YNGA 3LW5C 3OPKA 4DQSA 1SUQB 4LSLA 1R8CA 1QVFR 5FJ4A 1IKYA 1WHXA 5M2RA 2GFFA 4HL9A 4OLPA 2FGOA 1LWCA 3CJ3A 3M30A 3OUYB 3IN5A 5HROA 4A8FA 6FD1A 1FTRA 2MZRA 3TA2A 3R5BA 1GXLA 4DS5A 3IG1B 4C3KA 4EU0A 3HPOA 1VRUA 3W2WA 4ID8A 3KLHB 3VALA 2KFNA 2X51A 3LP1B 3NAHA 1IBKF 2RDJA 1T7PA 5HMWA 2XY6A 2BANA 3HHNB 1U2RA 1JLQA 3MAHA 1LOUA 4A8QA 3M9NB 4LF7F 2HRYA 1H38A 4FF2A 2W4DA 1VQPS 1GTEA 5H1SV 1C0UA 4QWDA 2HWTA 4DF4A 2FHJA 3JSMA 3LP2B 2RNEA 1BD6A 5K14A 1VIXA 2XI2A 1TKTA 1PILA 4YDDB 1MNEA 4OI0A 2EKY<