4GO7X

The regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
186
structure length
165
Chain Sequence
b'SIHMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNVSKDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGVTATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLEATVYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartokinase
publication title Structural view of the regulatory subunit of aspartate kinase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 44
structure length 165
sequence length 186
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2012-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01842 ACT ACT domain
X PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go7X02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go7X01
2MDAA 2JHEA 2KO1A 2ZHOA 1M0SA 1YBAA 2DTJA 1UJ6A 2RQMA 3LUYA 1LK5A 4M8LA 3DC2A 3P96A 2QRRA 3HHEA 2PA3A 3OFHA 3TUZC 3W7BA 1UJ5A 3MAHA 3AAWB 3OFGA 2H9ZA 3LOUA 3O1LA 3TUJC 3ENQA 1SC6A 5JJBA 2DT9A 2F1FA 3IXQA 2RE1A 2QMXA 3OFEA 5IT0A 2FGCA 3TUIC 3DDNA 1O8BA 1LKZA 1Y7PA 1KS2A 4LUBA 1ZPVA 2LVWA 2J0WA 4NMLA 4GO7X 3OFFA 2QMWA 3MTJA 4X84A 1LK7A 3UW1A 3OBIA 1PSDA 5T41A 5IT4A 3K5PA 3L7OA 5IS2A 1XTZA 3DHXA 3MWBA 2RQKA 2I9SA 3ENWA 1RWUA 1YGYA 3KWMA 3CEDA 2LQJA 3AB2B 2NYIA 2CDQA 2J0XA 2F8MA 3U7JA 1UJ4A 3NRBA 3DHWC 4GMKA 4IO1A 3ENVA 3IBWA 5FIIA 2JOQA 2P9EA 2QSWA 3N0VA 2P9GA 2PC6A 4GO5X 2P9CA 3AB4B 4PWUA 1U8SA 3S1TA
chains in the Genus database with same CATH superfamily
1IUJA 2ABYA 4M5DB 2HNDB 2NZCA 4LREA 4ZPDA 4O4GA 1FVSA 2JLFA 1WC5A 1T03B 3PHEA 2CWKA 5IT0A 4ZCLA 1VQOS 2YNFB 1VK8A 1UPPA 1JLBB 1XEZA 2LYVA 3W9HA 1RWOB 5KFPA 2EFNA 3NS5A 4OZ5A 2O01C 1F9HA 2BE2A 4ZHRB 1NDLA 1RI7A 5L9NA 4FYWB 1H2TZ 2BOAA 5GAEU 2CJQA 4ED6A 3LP1B 5A8WA 3ZZZA 4DU7A 3UI3A 4PG4A 3KLIA 1FKAF 1JLQB 1TELA 4QIEA 2X1GA 1NU4A 2M7SA 1GK8A 5DG9A 2D69A 3LP2B 3QRRA 4MT1A 2OTLS 2P2CB 4J90A 3NWRA 1KLMB 1OY9A 1NBEB 4YN3B 1M1GA 2O1PA 2GJIA 2DVIA 3NS6A 3SBMA 2H5JB 4O3PA 1XMBA 2NCKL 4PKDB 3W8PA 5KG1A 2J6TA 4OJ3A 1VQ5S 2FC9A 2PA3A 2KJWA 1AZSB 1BY9A 1N6QA 3QPIA 1JLAB 5IQQA 4L76A 2VC0A 3PFOA 1DHMA 3MM7A 4UOFA 2QLBB 1RISA 2EG1A 1DY3A 4TQRA 1HA1A 3SQGB 5IV3A 3HKZD 5KOXA 1RU2A 4NLVA 1OY8A 3G2XA 5F8GA 2A10A 2M9KA 2DISA 1A9NB 3T5LA 3OUYB 4KAIA 2V2KA 3FSXA 2CQDA 4KGZB 3PHTA 4PYAA 3OSNA 1K73T 1WTBA 2GAGC 4WP9A 5C25B 1GX5A 2C3YA 2GZOA 5IC6B 1S6PA 3DHWC 1MROA 1TL5A 3SXLA 5J2NB 2PI4A 1RTHA 1QUVA 2QA4S 2Q43A 4ZKAA 3I4HX 4Q45A 1S0VA 3HHKA 4OV1A 3HDSA 1YBTA 2LEPA 1N36J 3I55S 2V4RA 5CAAA 2IAJA 4DZ6A 1YHQS 1X9MA 5SUHA 3GIMA 3ZZPA 2Z2LA 1MN9A 2HHUA 3DRPA 3TNVA 4DL7A 3WQPA 3NNCA 4IH7A 1ZZNA 3RUBL 1PCAA 5MLCV 2HHXA 3JTNA 3WBZA 1MN7A 3QT7A 2JEIA 1FEEA 3BBFA 4K4YA 1ZZFA 4OYOA 1XTZA 2JC0A 1S1UB 1VBYA 2XGPA 4KFBB 3T6BA 2BQRA 1AROP 4QPTA 1VLYA 2MZRA 4WZQA 2DNKA 1IVZA 1X31C 2YKAA 2R8KA 3GJTB 1SJ4P 1QDUB 2KM8B 1FRLA 2RNEA 4YS2A 1DTTA 3G6XA 3PW0A 2I6WA 4P72A 2WONB 1NPKA 2FVSA 4C0HA 4I2QA 3ELHA 3L9ZA 4TKTA 2C2DA 4HI2A 2MSTA 1O51A 4DCOB 2ALYB 4HHUA 1WC6A 1UVMA 2V0NA 4C7QA 3RBEA 1F5BA 4OZLA 2JFKA 4E98A 2Y8YA 2LDIA 1NZAA 2XSJA 1TV6B 4J9OA 4U7CA 1NSKL 3DRRA 4OX6A 1VQNS 2HFNA 4DG1A 1T05A 4A8OA 1U6BA 1WKKA 3GIIA 4DR5F 1VIXA 3GFHA 2QMWA 2NPFA 4RNMA 3RG6A 1U1NA 3UW1A 2CJXB 2XHCA 3K5PA 3KLVA 1KHVA 3FVYA 1IJFB 4WJBA 2KTQA 4EBCA 4L3NA 1RB0A 1F3VA 3D6FB 3UCZP 2QSFA 2ILYA 8AT1B 4IO1A 1UFWA 1KVKA 3DGVA 4BBYA 2FLPA 3N9UC 3TA1A 5DO2A 4DV3J 3AXMA 2OPSA 3LP0B 3PYGA 2EFVA 3PKYA 4QPXA 1S76D 1JKHA 1S4FA 2MQMA 4X64J 5L8RC 3NNHA 2F65A 1H7XA 1T7PA 1PIEA 3MAHA 2AZ1A 2ZH2A 4Z37A 3I5BA 2BA9A 1FFWB 1YIJS 1KQSR 5B0BA 2LA4A 1TL7B 3CJKA 4F8RA 4WYWA 4OLPA 3FBCA 4OHYA 4IFVA 4X2BA 1TVRA 4DS5A 2NYHA 2QLJB 4PABA 2X1BA 2ZEJA 2BW2A 5HMXA 1U24A 2V5HG 4ZVRB 3LA0A 2IA0A 4G1QB 1PC5A 4TU8A 2J8AA 4DX8H 2HVHA 4FBTA 1OPIA 1GMUA 3FC9A 2RF2A 1N52B 4DV7J 1U1PA 4DFKA 2AWZA 1RAAB 2W01A 1FXRA 8ATCB 3AD8C 4PG8A 4K59A 3ILOA 4DU8A 3KUEA 1S97A 2G9OA 1RAHB 1WOOA 1HW8A 2UVVA 1CJKB 4I4BA 2MZTA 1X5SA 4RW4B 3M8PB 4QIWD 2IFXA 3MEDA 1CQMA 2H3EB 3GP9A 2IJNA 1S10A 4GC6A 1FVQA 3KLHA 3D0GE 4A8SA 4QYRA 4DPTA 3A3PB 3QGGA 1NRKA 3CCTA 2ZBRA 2UUAJ 3H40A 4PWDB 1IM6A 1ZYQA 3OTBA 4IG0B 4MFBA 4ETZA 4QYZK 4LFCJ 3SEOA 3IG1A 2WVFA 5D4LA 3HHLD 1SC4B 4OYAA 3BBBA 1B0VA 1S7IA 4RW7B 5DETA 1HNVB 1FHTA 5HN0A 4S0MA 2CPFA 2HBZB 1RADB 3M30B 2EBGA 4XDCA 4YR3A 5HSPA 4RKUC 3V4MA 1XBWA 4HI1A 5IXUA 3AA8A 4PRFA 2P8IA 2CQ4A 3R27A 2QYGA 1LXNA 4LSZB 2RB7A 5DZ6A 3KFWX 1AB8A 3J81Y 1YWXA 5KFAA 2PC6A 1IXKA 5EGYA 2DYAA 1ZM3A 4DR2F 1RT5B 1LFPA 2KVQE 3DOKB 1NJXA 2ZHBA 1D9AA 2LKZA 1U1OA 2YPYA 3MMAB 2M4MA 2FHMA 2HFVA 3VF0B 2FJAB 3SCLE 4X62F 3NGTA 2R7SA 4M5IA 4YFUA 1T9UA 4NLSA 1U2CA 1N8RT 4WE1A 1FNXH 3JSMB 3G6VA 3OQ2A 5H9EK 4QU7A 3UR3C 2OI2A 4Q2MA 3EJMA 1HWKA 3AXKA 1C0TA 3HF5A 1RABB 1P8GA 3SDEB 3HHLC 1MU2A 1O5JA 4LR9A 2KZMA 3I9ZA 3S7RA 2I1RA 5IT9Y 4Y2IA 1JLGA 1WF0A 3OTOJ 1M5PC 2DHGA 3VQTA 3MCNA 4KH0B 4FXWA 5AXKA 3ZTOA 2OKQA 3BYPA 1U09A 4L6V3 2MZSA 2ZBPA 3QJLA 3C66A 4ELTA 2JVRA 4OHZA 2R2UA 2V67A 4YDXA 3T6JA 4ZVOB 3BSCA 2IJRA 1TTHB 2B43A 3L7UA 4G1IA 4A4JA 5MAOA 1SH0A 2W1BA 2B8PA 4OYPA 2DGOA 2F8EX 2ERRA 3JTPA 5IM0A 4ECTA 2F4FA 4JI5F 1RKJA 1PBAA 4F2SA 1DQ9A 1FNOA 2MQNA 3QGHA 1IKYA 3KUHA 4ZN1A 3D7SB 3DOLB 3BBCA 3CCZA 3B54A 5DQHA 1JIHA 4M63A 3F0NA 4WFZA 4G3IA 4CLTA 5L39A 3OLBA 5HVHA 3GG0A 2IRUA 2YX4A 4C8MA 2IBKA 1RTJA 3MFHA 4DUYF 4WIQA 4ZVTB 3ZFVA 4CT9A 5KFQA 4OJHA 2P9CA 3GILA 1HQUA 3TZYA 5BR8F 2IRXA 3TEGA 4YP3A 1HNZF 4JI3J 4CLLA 9RUBA 2MKSA 4ZVFA 5CCLA 4OX9J 2A18A 4RW8A 3CCES 2QO3A 1JX4A 1GH8A 1HW9A 1VC5A 1RWXB 5C42B 5BYSA 5D3GA 4UOCA 5I4MA 3A12A 4X4TA 4GVBA 1RT6A 4MK9A 3PJWA 4AFFA 2R9LA 3G6ES 2VU5A 3KJVA 2HMIA 2GCFA 3BGUA 2WHOA 2VUGA 1DTQA 3WDOA 3CMES 4CYUA 3DLEA 2HFZA 1F60B 4NCAA 4I6AA 3OXFA 3EUNA 3M8WA 3PO4A 4QBUA 4F3QA 3C14A 4LR8A 3N6LA 4NEYA 1UVNA 2VPZB 5EX0A 4LSLB 3DYAB 2QA2A 1PAEX 2HBRB 2CIMA 3I0RB 1T9TA 1VQ8S 1BXNA 5IT9U 3GIJA 3N28A 2ADBA 1L3TA 2IY5B 3VAIA 1HFEL 1GMWD 4BS2A 4Q2LA 2Z4PA 1UJ5A 2OFGX 2CKWA 1LV5A 3JQKA 2W9CA 3PKMA 3EGWB 1HWUA 3CC2S 4OI1A 3OTEA 2RDDA 1RTDA 2XM3A 2R2TA 2WSCC 2GV1A 1MWYA 1ZM4A 4GKKF 5U47A 3H5UA 2R4FA 1D8YA 3MHYA 4FVCA 2YPZA 2B3TB 2BW7A 1WDTA 5F3ZA 3HVAA 3Q8YA 4NXNF 2IM2A 5B09A 5C24A 2ZDPA 3TA2A 4PQUB 2F3JA 2R42A 2HRUA 3EGVA 1TL3B 3HVTA 4FKXA 4NI2A 1L3UA 2LFVA 4QR2A 3W65A 4U7UK 4ED1A 2NQPA 4DLEA 2IVMA 2UUBJ 2M8HA 2BQ3A 1TL1A 3BEGB 4DPUA 1J5OA 3DOMB 2IMOA 1EIYB 4DMZA 2BYCA 1K0TA 3R5CA 4IUFA 5E3CA 4I6WA 1SKUB 5DDOC 3PO5A 1UKUA 4ZMMA 2I5JB 3T1YF 3RBZA 1S1VB 4ZLNA 3V6DB 1SQGA 6FD1A 2VIHA 2AYMA 2VBYA 2EK6A 5FDLA 2EPIA 5K9FA 3FZBA 4WKYA 1WOPA 2HQDA 1NM2A 5D0GA 4MK7A 2YKOA 1RTIB 3S6EA 4C3LA 1FKOA 1RAEB 4JI1J 5F0WA 4IDKA 2LXIA 1B99A 4HDHA 1BUXA 1TK0A 1EETA 3D9BA 4O3RA 2Y3YA 3VWSA 2C3UA 2V6AA 3A4TA 4DSKA 2O67A 4TY8B 2YKMA 4IQXA 5EX3A 1KRPA 3I0SA 2IRYA 1MG7A 2KH9A 1U7LA 2UV8G 2KVIA 5KFJA 4U9RA 2BXJA 3D3CJ 1FKPA 3M05A 5IQ6A 3DMJB 4I2PA 2ZOMA 4NASA 4DL0C 2AQ4A 3M32B 3JB9k 3WX4A 2XQCA 2ZH8A 2HVIA 4F36A 5E3QA 4A8MP 3ZZ0A 4Y2AA 4DR3F 1C2PA 3R5BA 3DDIA 4K5RA 3AAWB 4B9NA 1NK0A 2E5IA 3MAAB 1UETA 1Q8KA 1WHYA 2LP4A 3UN3A 3QJPA 1M5SA 5GADU 3BKFA 2F1FA 2DNQA 1R6YA 3MEGA 3MF5A 4P7VA 2ZC3A 2K3KA 1QSLA 2QL7B 2W4DA 2GW8A 4RNOA 4DL2A 3KDOA 4R8UA 3J7Z5 2IBOA 4ZP9A 1WKJA 2JSXA 4PXDA 1T94A 3GFYA 4IRDA 2YY3A 4B02A 2PO4A 2KJVA 4DSEA 4RR5A 4TY9A 2JNJA 3M6XA 2R8HA 4AUKA 2ROPA 3US5A 3IR6B 2LQ9A 1V3ZA 1FE0A 4CH0S 2BJ7A 2XYPB 3C15A 4O23A 5KFFA 3GYGA 1VJQA 4ED7A 4C8KA 1U1QA 3MR5A 3MUTP 4BWJA 1XQIA 3SV4A 2ZM6F 2J7WA 4ZP8A 1OSCA 2LECA 2QMUB 1LWEA 1FTCA 2DH8A 4LF6F 2KG1A 1FDNA 3LWLA 4ZLPA 4ZCMA 2HFSA 2WVEA 2E5LJ 4LRAA 1PYOB 4DV4J 4DL3A 1K44A 1TKXB 3VCDA 5KG2A 3DLLQ 1UA0A 4ZCIA 3DLJA 3MI7X 5BR8J 4DR6F 1OSDA 1SJ3P 1HNZJ 1N33F 1KBRA 2D41A 4U6PA 2VA2A 2GAHC 5J1EA 4J9QA 4K4ZA 4EI2A 3LPYA 3ZNJ1 5D4NA 1L3SA 3KLGA 2J0XA 2YXLA 3UDLA 3IWLA 4JI4J 5FIIA 2KN4A 3RBDA 2E1MC 4RBTA 4CDIA 3A8EA 2G1DA 2ASDA 2VD3A 4ELUA 3CJ5A 3BKUA 4RW9B 1C1BB 4U7UD 3ITHA 2FJVA 1IKXB 1O0PA 4DUTA 2YNHB 1U2RA 2ZH5A 4DFPA 1Y0HA 2FVPA 3VQSA 2QRRA 2VOOA 3EZOA 4B3RF 1HQEB 2XS2A 1NK4A 2ZBQA 3HHLA 4WFAQ 4F67A 1Q79A 2AGOA 1C4CA 2QGFB 2XC9A 5E33A 1SL0A 3MCOA 1RUSA 4C98A 1U26A 3W61A 4B3SF 3L7PA 1FJGJ 2YH0A 3JYTB 1TK5A 3BPSP 5HQMA 1G6BA 2CNOB 3UDCA 3J7YI 3PACA 3KWMA 5J2MB 2LQJA 4TU7A 3Q8PB 1ULRA 3KLFA 2OD6A 1CJVA 1IR2A 5KT4A 4KR0B 2B5JA 3OJSA 3TJ8A 2RH3A 2DK2A 1AA1B 1ZOTA 1NK6A 4GMKA 4OX7A 4P2FA 2F63A 1LWCB 2ZOGA 4G65A 2ZD1B 2D1CA 4EWTA 3HVRA 1SV5A 3PTWA 5EN1A 3ZZYA 3H5YA 1R8AA 5D4OA 2VG5B 2XMJA 3HI9A 1IKWB 2MYFA 2R8IA 5J1PA 2F4VF 1OIAA 1TK8A 4Y2KA 3DLKA 2V8GA 1WJ9A 3LGHA 5KFXA 1IBKF 1AW0A 1U4BA 1LXJA 1RHKB 1JLFB 1R6VA 3EWGA 4M5DA 4LVOP 2R3VA 3OXGA 1MW7A 5M2PA 3CNQP 1AFIA 2FGCA 1GTEA 2HEKA 3BS9A 2IM3A 4FPRA 1AT1B 2FC8A 3J7YU 2EEYA 3VHQA 1T03A 2JVOA 5K14A 5HP1B 2W2NP 5B0GA 2APOA 3EYZA 1S9EA 2FY8A 1JLBA 3WC0A 2V2VA 4C8LA 1DLOA 1XR7A 4FF1A 4QW8A 1CBKA 4DV5J 2F8MA 2EXUA 2BANA 3W3SA 4X66J 2AMCB 2OSQA 4P10A 1AYEA 1V5IB 4X4PA 1VBXA 4GC7A 4LF1A 2J0SD 3LP2A 2OMOA 4Q43A 3GV5B 1NKBA 4EGLA 5E3PA 1V5VA 1C1CB 3H4DA 1R43A 4HR2A 4ZVGA 4URQU 3RR8A 4M5JA 4YEAA 4DEZA 2ZNZA 4ICLB 5D6GA 1YRTA 3O1LA 3P45B 1JB0C 2QC3A 4RPFA 2MEWA 3M2UB 1SI9A 1AZSA 1N5YA 4ZIWA 4ID5B 2KHDA 4P73A 1WG4A 3VAFA 1NSAA 3EZ5A 2EBEA 3NEKA 2YKPA 2BUNA 2WVBA 5KOWA 1VQ6S 4OYWA 3OUYA 5KT3A 1KWMA 1KFSA 3DM2B 2N82B 4JI0J 1S48A 3H25A 4CLZA 3POTB 4K0KJ 2CPEA 2VV5A 2QTWA 4I1TA 5C5JA 1P1LA 3EDRB 4LFAF 3OL6A 1UZDA 4ZVSB 2QN6B 4OZ2A 5J2NA 4F4KA 4TQSA 2DPIA 3QIPB 1SL2A 4LF9F 1S1TA 3KDNA 4F4XA 3CCUS 2HS0A 3H42A 4WFXA 1GX6A 4WZMA 1QSSA 2XMAA 4LSNB 2CPDA 3MCSA 3TA0A 4KBIA 3MM9B 2VJUA 1CJTB 3KHRA 1LQ9A 1UP1A 1XC9A 3MZIA 4P2MA 2HQCA 5GAHI 5EDWA 2CQIA 1NJWA 2DR8A 2QX0A 4M94A 2KYZA 2RRNA 3ILIA 1LW0A 3DLGB 4USKA 3M8SA 4LIRA 4HT5A 4CO4A 1WEYA 2XULA 4QCLA 2R7TA 4XTTA 3NGUA 2CQHA 4MYTA 2E1RA 2MKKA 2KFNA 3DCAA 1S1UA 2BDPA 2CZ4A 3NRBA 1HD1A 3D6HB 2HS4A 2WW8A 3V5RA 4B9VA 1G4CA 4DV2F 4QWDA 2HLTA 2CZVC 3LWMA 2HHHF 4MKAA 3K5MA 3A13A 3QAUA 2YQ3A 4JV1A 5E3RA 1GMWA 4GKJJ 4MKYA 1D9DA 3TQEA 4F4YA 1URRA 3EPIA 1NK8A 1IBMJ 3FQLA 1RE1B 1Y5IB 4NE9C 5ETVA 1RWVB 4P2SA 2DY1A 4RNFA 1HNWJ 5ETSA 4YR2A 4O0IA 4DPWA 4H4KC 1UMJA 1YVFA 3OXLA 3TR5A 1VC6A 2WCXA 1V9OA 2DBBA 2ZWPA 1QJHA 2V8DA 4JUZA 1NSPA 3BPDA 2HLUA 2L08A 3ISND 1SJFA 3HPOA 3T1HF 2UV8A 1NJYA 4ZJOA 1P27B 3PDNA 1NPRA 3GJRB 2ZBIA 2WW4A 4BWMA 1UVLA 3OVAA 4K2XA 5HMYA 1RBAA 2EKNA 3GJSB 2ZZMA 3HX9A 2F5GA 2CRLA 4ZPVR 2RMLA 2XWYA 2I8EA 4K4WA 2KXHA 4TXSA 1XJWB 4QR0A 4GVLA 1WI8A 3V4IB 1A0OB 4NRTA 2FVCA 5I3PA 3QSYB 5L46A 2NPIA 3CCMS 2LLZA 3NAHA 1N5TA 1O8BA 4W4MA 3MM8B 2FD2A 1IR1A 3W2VB 2RUSA 3MPYA 3AOBA 2E1AA 4EYIB 2FHOB 1DZ5A 2H51B 1PJ7A 2M2BA 4CI0B 4OYMA 4ES3A 4NXMF 4F02A 4F7VA 1S6UA 5KTQA 2XZDB 5HLFB 1UAWA 2B7CB 4MKVA 4PXBA 2YWHA 3RTVA 2FLOA 1ZH5A 1M1HA 4CIOA 3ISNC 3Q83A 3B82A 3FCWA 1M90T 4NLXA 2AGPA 2PD1A 2CVIA 1VQKS 1A7GE 1YBAA 3KK2A 3CIMA 1S57A 4RW4A 2GVDA 3G87A 5IWAJ 4ECWA 5CQGA 1CS4B 4WXOA 1WNEA 4ZPBA 4FZVA 2EFGA 2ZITA 1FK9B 2HSEB 1Q86T 1VYAA 5HJYA 3AJDA 3O5TB 1Z1ZA 2GHPA 4YHHF 1H72C 5CD4H 1FRIA 2IPOB 2L48A 2W9AA 4ZVQB 2G2YA 5KT7A 3VGSA 3K5LA 2GA7A 3VGVA 4EZ9A 2DR7A 4RW7A 5AT1B 4YB5A 4ANEA 2HQ3A 2UVRA 3FEXB 2OUGA 4Y0FA 4IOAQ 1Y5NB 2OHDA 4OV6A 3IS9A 2G0JA 4EO6A 2JEGA 2VC1A 5A0YA 3T3FA 3LQVA 4FS2A 2NXJA 3MAQA 1RLCL 3D3BJ 2A6MA 1VQPS 1FEHA 1W25A 5A2QU 2Y0SD 1PG5B 1YKWA 3AH6A 5CZXA 3PYFA 4P9SA 5F0UA 1UEVA 3DC2A 2NR0A 2OEMA 4OL8A 3DOKA 4JYAJ 3BDEA 1APSA 3VZIA 3MMAA 5HK4A 2MLXA 4LQ9A 5BYRA 4LFAJ 1HBNB 1URNA 4IH5A 2B4PA 3UR0A 2B0GA 4N8NA 2J6UA 3KK1B 3SCKE 4HDGA 3QSIA 4IH6A 1BC6A 4J9NA 4WFYA 2PFFB 1T9VA 3E01A 4DHVA 2VOPA 2U1AA 2M0GB 1N32F 3K89A 6FDRA 4LF7F 3ETMA 1Q7LB 4NCBA 3PYDA 1FT8A 2B51A 3PEJA 2G2OA 1QD1A 1VOMA 1V3RA 3GFXA 1TUGB 3CD6S 2Y1IA 4E2FB 2OD4A 2DXFA 4ALZA 3QGIA 3H2UB 2HYIB 5HQ8A 1BMQB 2HHSA 1HI0P 3N6NA 3KMSA 5G4DA 4EK2A 1RT1B 2Z0GA 3GV7B 2ZJRQ 3RW7A 1I94F 2YWEA 5AJ3J 1HPZB 5EWGA 4U67Q 2KKHA 2EKYA 3NY0A 5L1KA 5FLXY 3CEDA 3RAQA 2RRBA 1SJQA 3SZ2A 3TUPA 1HHQA 1FDDA 3TAMB 3BB5A 1EJ7L 3GIRA 2CQCA 4R0JA 5A6WA 1JXLA 4PPDA 1UVKA 3OHAA 5C2GA 2MQLA 4BCAA 2JHEA 5DLGA 4ZPTR 1REVB 3MOZA 4DR7F 3RGIA 1BQNA 5HANA 5K8PA 2MKJA 1Q7YT 5H9FJ 4CO3A 6AT1B 1KQGB 1RACB 4JI8F 2UXDF 2FLLA 1LWFB 1KVIA 2RKIA 5J1NA 2XMWA 1U02A 4K7QA 4PZVA 4F4AA 1QVGR 2XCPA 3PW2A 1RDRA 4CLPA 1ZTTA 5E5NA 2UXBJ 4LF8F 2V68A 3T9ZA 4NA1A 5IZHA 4E8UA 5C42A 2MGZB 4FXDA 2BZ2A 5E3AA 1VK3A 5DQIA 1SCJB 3M6UA 4YMEA 2X1AA 3HSGA 1N48A 3FCHA 3CDEA 3FK4A 4I0WA 3NOCA 3Q2SC 1PILA 2C1EB 4K4VA 2YNIB 5HVFA 2BKOA 2JZ5A 2E1PA 4RO0A 1M5KC 1PJ6A 2OPPA 2D74B 2J5AA 2HWHA 3ILLA 3MDFA 4OYBA 3OR1B 2BX6A 1HBOB 4DR4J 3OTDA 1UWBB 5HI7A 1Q53A 3QQCD 4AL7A 4L72B 4JOUA 4LRCA 2E66A 3IRWP 2HAFA 1VRUB 4LSLA 3DYAA 4NXMJ 1A6LA 1CULA 4OI6A 4WK3A 3IGVA 4CH7A 1HBMB 3ICLA 4ZJQA 2EFPA 4O4GB 3THPA 2E1CA 1RHRB 4UT4A 2W7OA 1SB6A 4ILRA 3DDNA 1FRKA 3C6TA 4LIWA 2W8LA 4GRSA 5LJ3Y 2IIHA 1YTYA 4IRCA 5AXNA 5L9XA 1WEZA 4IFYB 2FB0A 4KY3A 4DQPA 1KN6A 1MMNA 3FEYB 1Q82T 1NCLA 1FTRA 1NK5A 2V69A 3HJFA 2R8GA 3EXCX 4BHQA 5A8WB 2Z30B 1N56A 3KLIB 4RNHA 3PX4A 4ZP7A 4IOCQ 3QLHB 2QSWA 2NUHA 1TL3A 3UD4P 4F4ZA 2GQCA 2X51A 2UUWA 4CWBA 1T8EA 2KFZA 5FLXU 3SI8A 1MMLA 4UQGA 1XN9A 4HHHA 4H4KA 4KO0B 3VVTA 1Q5VA 1RHUB 3DGPB 2C2OB 4FVMA 2C2MB 4M8LA 1B3TA 1IBLJ 3CCQS 3DOMA 4CZCA 3SV3A 2RUGA 3R97A 1JMTA 1IQZA 4NZ0A 5L38A 5M2UA 3Q24A 5F8HA 2HGNA 2I5JA 3BGFA 2V34A 1N36F 3V6DA 1QM9A 1YX2A 2PEBA 4OYIA 3RU0A 4DPOA 1LKZA 4V1Ak 1LW2A 4UW2A 3Q22A 4M5MA 3HSJA 1YJVA 5KG3A 3BGOP 4RNNA 4ZP6A 2ZC4A 4UOGA 4KHPJ 2ZH7A 3TVYA 1RTIA 2OAUA 3AOCA 2IYIA 2LMIA 2E9RX 4I64A 1T95A 3CD7A 1B7FA 5AE3A 3K7RA 2DJWA 1ICEB 1OPZA 2AT1B 2DPJA 1SJRA 4K4TA 3H2LA 1MROB 2FYXA 5KFDA 4HTIA 1WHVA 1L3KA 4XO0A 1IKVA 4FYDA 4LVNP 4DUZJ 3TRGA 2G4BA 1YJRA 3P5TL 2VPXB 3M32A 1NPPA 1NDCA 3GR0A 3QWPA 2IAJB 4G6VB 2WK4A 5KFKA 3A8IA 1HI8A 4HLBA 4DR1J 4X4UA 2HVZA 4HH1A 1KONA 2W4CA 3LO3A 3MAAA 3LF0A 3CD5A 4UUWA 2GGPB 2C2NA 2YKNA 5CCMA 2DNZA 3JS9A 4DSIA 2CADA 2HS3A 5IV4A 1HHTP 2YWWA 3SIPB 3FEZA 3BQ1A 2YQ1A 4OI2A 3O6QA 2XSFA 1FESA 3KG0A 4OYXA 1VGYA 3OSPA 2NLWA 4ILLA 3OLAA 2ZZNA 3M2RB 4RUCA 4NYZA 3MM5A 3ZTQA 2GMHA 3OD2A 2GVZA 2CXEA 4B9SA 3MEEB 5CYMA 3PFEA 2BJ3A 3PX0A 4MTPA 4P7TA 4LF5J 3R5JB 4I2QB 3MR2A 3NS7B 2MJUA 4DV3F 3OFGA 5HBMB 3NGRA 4BC7A 2G0CA 3ILJA 1HBUA 2AJ0A 1QVFR 2GQ2A 1WOSA 1WDDA 3AJ2A 3FBFA 2DO4A 4X64F 5IFMA 3CJ2A 2KL8A 3P3DA 1XNRJ 1H74A 3MMJA 3DRRB 3GZ7A 1N5VA 1GQEA 1S1XA 4PCQA 4KHRA 2RSQA 4DL4A 4DG1B 4IO9Q 4LJMA 4I69A 2JRSA 1PSDA 3L7OA 2HHWA 3CJQA 5IOLA 3GSIA 1SH3A 3TAQA 1T9XA 3IM9A 4N56A 2LU1A 2C2RA 3P5BP 3OW2R 3MECA 2DR9A 2ZE2B 1VCTA 2J7UA 4LF8J 3J7ZT 3RAMA 4CP5A 1HMVA 4Y28C 4IG3B 2JFDA 2L9NA 1IJEB 4WKRA 2CQ1A 3EVMA 4DV7F 1TUVA 4AL6A 3M8ZA 2ROGA 4XPEA 3D2WA 2OPSB 1XIQA 1VQLS 5KFWA 1C1BA 2XO6A 4B9MA 3TARA 3BQ0A 2BM0A 4J9SA 1VQ7S 2YNHA 1TAQA 4OYZA 3SFUA 2WVDA 4QIFA 4MK8A 5ETLA 2OPQB 1HQEA 4AL5A 4Q44A 3CJSA 3PRBA 4R5PB 1F9FA 2DNRA 2UUAF 2OP5A 2LVWA 3RW6A 1H6KX 1VHIA 2ACMA 5IS2A 4LFCF 2XG8A 3UD5A 3QT8A 4O4RA 1ZM2A 2AEMA 2H5IB 2HBQB 4H4MB 3FBBA 4U8YA 3PIOQ 1N4LA 5J2MA 3A3OB 4WPAA 2IVYA 3D54A 2FQQB 2FJBB 4JV0A 2WTFA 3M4XA 1F9EB 4O44B 1LWCA 4ID8A 5KG7A 4X4QA 2RQMA 3MEDB 1T0TV 4KV8A 3N5FA 2DGQA 1RWNB 2B4OA 5CA5A 2VG5A 1IKWA 1P1TA 1E6VA 3QNWB 2D3OR 4W90B 3IBFB 4CLYA 4EUVA 4MAKA 4DQSA 1UPMB 3IG1B 3ZXWA 2XNQA 2QL9B 2HGMA 1NK7A 4NLOA 3ISZA 2C2KB 4L74A 3GMGA 1WD6A 1NDKA 2HHPA 3CDWA 4KTQA 3R5AA 3VGTA 4DDFA 3UWTA 2E9TA 3V81B 2Y9HA 5KFLA 1MNEA 2KFYA 2CPHA 1JXVA 4Y65A 2GMLA 2J0QD 3TZXA 5KG5A 2B4VA 1WTFA 4X65J 2DNHA 4I68A 4O0NA 4WFBQ 1XMOJ 4QYZJ 2V8PA 3G8TA 2FIUA 2X3DA 1VI7A 4HVZA 4QWCA 4O3SA 1FNMA 3OTOF 2VFTA 2E7XA 2ATLA 1G2EA 4MMOA 1C1CA 1MLAA 1DRZA 3W5YA 2HNYB 1KKHA 2C3OA 1S49A 1IWGA 2MHNA 3FMWA 1YJTA 3H4BA 1WI6A 4F0KA 4GO7X 2WB4A 2MY7A 4WE1B 2XYGB 4PR6A 5B0CA 3M9OB 1KVJA 5CD4A 2HGLA 2OTJS 2FJDB 5KFGA 4X4VA 2VG6A 1NHVA 1MU2B 1FWPA 4U95A 1UVJA 3EGNA 3CF5Q 3DM2A 3CMAS 3I4PA 5BJRA 4DN0A 2AJ4A 4EFAC 2EFQA 3OVSA 2HBYB 5LM7E 2AYEA 2HHTA 4N5SA 5H9EJ 3QIDA 3CDBA 3MMBA 2W9BA 2XMUA 1XWLA 2PN6A 3HFKA 3GJQB 2H9ZA 4JP8A 3BO2A 1XNQJ 3EXYA 4KPCA 4XK8C 4LSNA 3K59A 4JI3F 1ZM9A 4PYDA 4OX9F 4TU9A 4DFJA 4CNYA 3UN5A 2FGOA 2PA8D 1IKYB 1CJTA 3QT5A 3BSNA 3PCOB 3RR7A 4MJKA 1JNZB 5GMEA 5EWFA 4JB8B 4P75A 2UP1A 3FNNA 5KFMA 2CQ2A 1KQKA 4F26A 2MLYA 2YTCA 3DLGA 1QE1B 2A3JA 2AEJA 4M5HA 2HFUA 2ZDOA 2XMVA 2PT0A 4IR9A 2F7VA 3GLJA 1EKSA 1MWZA 1RTJB 3F56A 5I3UA 4I6YA 4I7FB 1KDNA 2BVZA 3W63A 1UFLA 1M5HA 2FJWA 1R8HA 3MURP 4N47A 1TP7A 2B9YA 4FYXB 2G0IA 1IN0A 4FYVB 4OMFG 4XAKA 2OEKA 1VJWA 1WHXA 3KK3B 4M1KA 2RHQB 3E8OA 3KNAA 4RW8B 4O3OA 4JV5J 1LWXA 2ZH6A 3MPVA 3HFZB 4CLKA 4NLGA 3KHHA 4GVBB 3HT3A 4R0EA 2RVJA 1H98A 3M7VA 2DNYA 1RK8A 1T3OA 1PC4A 1N0VC 2JLEA 2QA1A 3KJVB 2HMIB 4RUHA 1EP4A 1R8PA 5IT4A 3HSZA 3WIVA 4Q8EA 2W24A 3I6PA 1DTQB 1XMQJ 3D66A 2AJ2A 4DL5A 2RDJA 1F5CA 5HO4A 2J7KA 1HQ2A 2AX0A 1HNXJ 1NKEA 4N76A 3J81j 2CYYA 3MM6A 1U48A 1FD2A 1IWAA 4AYBD 2OGUA 3H7HB 2MKYA 4QQBA 2YNGA 2KB2A 1HKAA 2XS7A 2PMZD 2LQBA 1RT2A 3IA0A 3NNAA 4RUBA 3T5HA 2UUBF 1S6QB 2Q1LA 4CRJA 1SPBP 5F3TA 2B9WA 2V4JB 4OZ0A 3UO0A 5HMWA 5KFOA 1VHFA 1RT4B 2W9CB 3HHNB 2VDIA 3V4IA 3KMQA 1K9MT 4ZCKA 3U1MA 2W7AA 4USHA 2X7IA 4ECQA 3BH7B 4DLGA 2YWGA 1KLNA 3EVWA 3Q23A 3NBPA 4EYHB 2OPRB 2RQKA 2YKQA 1TL4A 2LA6A 3W2VA 4NA3A 5C24B 2ZBCA 3FQKA 4JI1F 3HK2A 5DGAA 4W98A 4YR0A 3M1VA 3L95X 3ENVA 3HVTB 3UN2A 5GMDA 1U0HA 4ED5A 1NZ8A 2E5JA 3D4JA 3LGNA 2FUG9 4NLRA 5HLFA 2DHXA 4Z7YA 1CG2A 3O8WA 1W2IA 5GVQA 2QJ3A 4EBDA 3KXDA 1B7YB 2RILA 1YITS 1TL1B 4JI2J 1OO0B 2BKPA 1B0TA 1NEEA 1SH2A 4A8YA 3K8WA 1Q8LA 4KYZA 2GIQA 1BD6A 1PGZA 3MXHP 2PDAA 4KKOB 2PSZA 2F9DA 5J2PA 2FJXA 2HHVA 2KI2A 5DG7A 1RT3B 2BMBA 3H8YA 3VGUA 3OHBA 1U0SA 2J0WA 4IOBA 2GHVC 5KG0A 1BLUA 3HJVA 5DDRC 2OSRA 4NA2A 4WCEQ 2Y1RI 4ZN3A 4IDKB 1RQ0A 4DXLA 4N77A 5LL6d 1EKRA 1JNRB 3CVKA 1UW9A 5DG8A 4NX9A 5F8LA 1XERA 4C3MA 3IM8A 1VRTB 5F8IA 4OHWA 2YKMB 4FPIA 1RYSA 4ZDNA 2NSCA 2UXCJ 1WORA 3NOGA 5GMKa 1WUUA 3M6VA 4FF3A 2V8HA 2DNNA 4WTYA 1AUSL 2XY7A 5CYQA 5T14A 5GAGI 2DD8S 2E5GA 1G7CB 3CULA 1Z4UA 4A8WA 1RAOA 4NLQA 3C46A 4A47A 3RJMB 4FKYA 4PEOA 5HROB 2CA9A 1X4FA 5A8RB 2FHJD 1DAXA 2RU9A 1IR0A 3HULA 3RB3A 4LRFA 4CO2A 3PYEA 2GHWA 5LT5A 2UVUA 1NB2A 3MEGB 4LQ3A 3I31A 1RT7B 1OY6A 2W2MP 2CAJA 1LFWA 1U2FA 2VF3A 1HBNA 1I1GA 4R8UB 3FFIA 3GYXB 4ZOSA 1D0EA 4XIUA 4ITSA 3H5SA 2E5LF 3BQ2A 4DV4F 2NYIA 5THWA 1TFYA 3D28A 4CO0A 1OS5A 3J7AN 2Q3PA 4J9KA 5GAGU 5D0RA 2WSEC 1RSCA 4DV0J 3J81U 2AD9A 4WF9Q 2B9XA 1PJ5A 3G8QA 4NOHA 1S12A 5CYJA 5A76A 2VODA 3S1TA 2DIUA 4FF2A 4IKAA 3VTIA 1M0SA 3A3NB 4IRKA 4WU2A 4JI4F 3VAJA 2C2EA 2MZJA 5KAKA 1R27B 2FVQA 2IM1A 2CWXA 3RB6A 2H65B 5KFRA 1LWEB 4X4SA 1VQ4S 3R7NB 3U1NA 1FWKA 1Y3KA 1S99A 3J80Y 3VAMA 3C16A 2NSBA 4FBUA 4XDDA 4LR7A 4OI0A 4RUAA 1C4AA 3R3TA 2V9WA 4URGA 5K8NA 2NXNA 2Z58B 1RT1A 4DX6A 3W2WA 1FO1A 1S9GB 1NO8A 1Q1KA 2I9SA 3ENWA 2D3O1 2WRMA 4IYQA 4YY3J 1HPZA 1E6YA 1FD8A 1WELA 1BWVA 2B8QA 4ETXA 5HVGA 1FJGF 3T19A 3KLGB 2BJ8A 4CLSA 1GXLA 1HWIA 2Z2MA 3Q2TC 4HACA 4ZPAA 5SZTA 2CQ0A 1R0BG 4TNOA 5B0FA 3HVWA 5CZVA 3HFVA 2RRAA 5B7WA 3BYRA 4C11B 1ZAVA 4USIA 3ET6A 3Q86A 3TYTA 3IGNA 3HP6A 1U1RA 3CT9A 2CJBA 3ITHB 4KGVB 3W7BA 4FXVA 2JC1A 1H2VZ 8RUCA 4NYPA 1NXIA 1NSQA 3HHLB 4KH1B 2NXEA 2V50A 2UU9J 2E7WA 1UL3A 4ECVA 3DRSB 2BJ1A 2RQ4A 2CJKA 4DF4A 3W66A 1I51B 1P9YA 2QIFA 1ZETA 3ENAA 3PW7A 1R7IA 1N5QA 4NMXA 4QR1A 4QW9A 3BO3A 2R7VA 2EG2A 4ANCA 2XB2D 2LDYA 4ELVA 1PAUB 2B5JB 2YNIA 1SUQB 3SQOP 2G13A 5D0HA 1OJ4A 4B3MJ 3KOAA 3QJJA 4JI7J 3PV8A 1FXLA 3H59A 2KRRA 3Q8VA 3PW5A 5GAEI 4DV5F 2PI5A 4X66F 1KR4A 1SV5B 1UWBA 4BC9A 1TKTB 3WZ0A 3OL7A 2KM8C 2CQPA 3TJAA 4RW6B 1ELOA 3DLKB 1VMBA 4LF2A 1X8DA 1GMVA 3PNIA 1X4CA 1VQYA 1NH8A 2YWFA 1HBMA 3GSDA 3GTYX 2PGCA 1NLKL 2K06A 2HIYA 2XEXA 2N4CA 5I42B 5AXMA 4C3KA 3QFHA 5EUHA 2CNKB 5K14B 1X9SA 2K7JA 3J80U 1WSRA 4ES1A 1D1UA 2K8GA 1U8WA 1VS3A 4IFYA 2U2FA 3K17A 1S9EB 3R7SB 1Y3JA 5DM6Q 5ETNA 3CXCR 1DQAA 2XI2A 1EB0A 2J9CA 2KT3A 3M6WA 5L1LA 1DLOB 4F0HA 2BJ9A 2QT7A 1X4GA 3M2VA 1CLFA 2BANB 2DXEA 3BGRB 1DURA 2MKIA 1BHNA 3KHGA 3QLHA 3MR7A 1RWWB 2C3MA 2Y0BB 1QUPA 1JJ4A 5F9NA 4JI0F 4PG5A 3UQSA 1RWMB 4K0KF 2MKCA 2HNZB 3CC7S 2QE5A 2ZWOA 4KO0A 2VKZG 3W5ZA 4KE5A 3DGPA 2Z2YB 1T11A 2KT2A 1BQMB 1BQXA 4LFBJ 2Q79A 1PO6A 1N5YB 5LMNJ 1HYSB 3B6BA 4B17A 4CT8A 4DSJA 2PMHA 3F73A 2I38A 5KFYA 3WIUA 2ZHAA 4NEZA 7FDRA 3UNYA 3SCIE 4DV1J 3JTOA 5KFCA 4J9PA 3D0IE 1ACMB 3QZ8A 2DHHA 1TMMA 4CTAB 3LAKA 3SSRA 3UVJA 1Z2LA 4QJVA 3KG1A 4FNIA 3CW2C 1YJNS 2HZVA 2QLWA 3HSDA 2CNNB 4PQAA 4WIIA 5CH7B 2H5EA 4O3NA 1FDAA 3A8KA 3CJTA 3FDSA 3SMZA 4KB7A 4B3TJ 1S1TB 2B6AA 1IBCB 3I9V9 4WYLA 1H2UX 2Q6BA 1K1QA 4NCGA 1D3WA 3UDEA 1KC8T 1QAYA 2VQEJ 3DKDA 3PY8A 4RX6A 4GKJF 2IC3A 5DLFA 2MPUA 4FS1A 4N7TA 2AHOB 5CXTA 3D6MB 1IBMF 2XYHB 2N3LA 4PXCA 4Q0BB 4DV6F 3DU6A 1SJ1A 2GGPA 4LBHA 3CCJS 1HNWF 3FRZA 1LW0B 2L9WA 2HK2A 5DZ7A 5DRKA 1TKZB 3CDAA 1X5TA 4J9VA 4URSA 4HEA9 3C8YA 2A0FB 2Z8QA 3MCMA 2AYGA 2CNLB 4DQIA 3G6YA 3M2RA 2KHCA 4B3OA 3R7BB 4TLRA 3FGVA 2VG7A 2MZQA 1T02A 2JWNA 2FZCB 1FWLA 3MD3A 3F44A 3K5NA 2PFDA 3D1QA 2XO7A 1Q4RA 2V8VA 1D9FA 3MEEA 4I67A 2XGQA 2ZVIA 5KFUA 1XK8A 2C2ZB 4NPOA 2I2YA 2VQFJ 5HBMA 2DCLA 2OELA 3D68A 4K2JA 1EX8A 1FJ7A 3AA9A 2F9JA 4KGKA 4CLWA 2FZGB 4RL1A 3T9NA 4D3GA 1JLCB 1RCXB 2E9ZA 2CPYA 1N34J 1J27A 4NLYA 4ENOA 3U1LA 3IP0A 4CNZA 4K8RA 4LBIA 2DIVA 2ZNYA 4C8ZA 4LRBA 4P52A 2D3UA 1X0FA 2UUCJ 2M5YA 3MFIA 4CM0A 4L73A 4EU0A 2FHKA 3G71S 3IWNC 3P4UB 2HNDA 2ZE2A 4L75A 4M5GA 3HMJG 2DTJA 1LOUA 4HL9A 4IG3A 4ECXA 5LMUJ 1S1WB 3DI6B 4HT7A 2RAQA 3KUGA 4R25A 5D4PA 1QSYA 1KNZA 1B64A 2YNFA 3QO9B 3C6UB 2FY1A 2W2QP 1WF1A 1JLEB 5D8HB 3TUIC 4Z2XA 4ZHRA 2HIQA 5T7LB 5IWAF 3LP1A 4ECSA 1FRJA 2OPQA 4HTJA 1FRMA 3O3LA 2NZ4A 4H4OB 5F9LA 4R5PA 1JLQA 1YDLA 1IM4A 5KFZA 4A8XA 2V94A 4PG7A 2YQ0A 1FRHA 4U96A 3NAIA 5KFIA 1KLMA 3EM1A 4AXJA 2QFIA 2P9GA 3D6TB 2IA6A 4H4MA 4ZLJA 5HMZA 4DF8A 3KNGA 3AQPA 4ZITA 1REGX 2RJZA 2PE8A 2KXNB 3CJ0A 4KC5A 4B9LA 2OFHX 1HL6A 4MKBA 1VQ9S 3CDUA 3G8SA 1JLAA 3W64A 1VR6A 1VISA 3KK2B 3TUZC 4O44A 2VBWA 1X4EA 2FHJA 3I5CA 2AW0A 3GWCA 4F3MA 3MUMP 2GVDB 1KFDA 2LXUA 4K50A 3SQGA 2ZUAA 5LOQA 4OI3A 4IQMA 2BV3A 1BGXT 3UCGA 1RBOB 2J76E 2K1RB 5ETKA 2EWHA 1Y7PA 2AX1A 3OVBA 1KS2A 5A8KB 2QZ8A 3PRDA 2AJFE 4JYAF 4NMLA 1Q0NA 3KTQA 3JAMY 3S8SA 5KG6A 2DHSA 3OTCA 4HHJA 4DJBA 1FRXA 3CJ8A 2DNOA 5CABA 4ECRA 3TOQA 4ECZA 5C2CA 5C25A 1MWQA 4J5OA 1FXDA 3K2YA 2W8KA 1RHJB 2BR0A 3GCWP 3LANA 3V81A 2N7CA 1WHWA 5B0EA 3IS9B 5A0YB 4USUA 3NMRA 5LXYA 1FFSB 2HWIA 2GS8A 5L1IA 3H90A 4USVA 1YJWS 1RHMB 1YLXA 3NMAA 3M8QB 2HRYA 3IC1A 4U8VA 4PPZA 1VQSA 3JSRA 2B7BB 3LW5C 3G9CA 4AD6A 2CJAA 1SIZA 4C0OC 2CPIA 3DRXA 1I5OB 2NXUA 2R7QA 3CSKA 2DR6A 3PEHA 5BYQA 1PYTA 2HNYA 3MTJA 2MTLA 5ETRA 4USWA 4WP3A 4KFBA 3DHXA 1SL1A 3CJ3A 5B0AA 3VAKA 2HZAA 3NGDA 2XMTA 1U1LA 3ULHA 2V9KA 1YZ6A 1OWXA 3MD1A 3KLEB 4K4XA 3Q8QB 3GIKA 3A8JA 3E01B 4C0BA 5AJ3F 2IMWP 4B9UA 1GXUA 2ZH1A 4NLWA 3W60A 1SQEA 2WONA 4DL6A 1EZZB 1U1KA 2CVEA 2DB1A 3Q8SB 3ZC4A 1YJ7A 2R2SA 3MGJA 4TYBA 5GAHU 3TAPA 3AOAA 1DFDA 1GAOA 4DV6J 5ITHA 1UJ6A 5E2QA 1OQ3A 2GNKA 3MMCB 4LRDA 1W2BR 4Q8FA 1CPZA 2AGQA 4KHMA 1TV6A 2M52A 4HYKA 5B0DA 1R89A 3LTOA 3CC4S 1D09B 3C3LA 1NJIT 1UZHA 2YBVA 1N5SA 1HNIB 3I5AA 5DGBA 4MIAA 3SSQA 1SIWB 1Y9OA 1RAGB 3THTA 3CIZA 2N4DA 3G82B 2CJYB 2DGSA 1TZ0A 3FMBA 4CLUA 3C2PA 1WWHA 2UXBF 4DSLA 3AB2B 2E44A 3R1HA 4ATNA 2HK3A 1Q8IA 1PBUA 3ZZUA 2VKRA 2KT5A 1MMDA 2SXLA 3JAMU 2L3MA 3BGLA 2KU7A 3CWJA 3LP0A 3OPKA 5DDQC 4WXWA 1QE1A 1Q95G 2KG0A 1R0AB 3CCVS 3DLBA 2AF6A 4F0MA 3V6JA 4FYYB 3OR2B 2R7UA 1QY7A 3BSAA 1F2HA 4I7FA 1L5UA 2F40A 1BQNB 4DR5J 2R7XA 4DR4F 4N41A 1TL7A 3QAEA 4C8NA 1TAUA 2RKIB 5I3QA 2QMXA 4OQJA 1H7WA 2MSSA 2WOMB 3KK3A 4NZ6A 3BJYA 2BJEA 3OV7A 4G1QA 1ZTWA 4E0DA 2QL5B 2BBEA 4OHXA 4UY85 3AHPA 2XLKA 1U6FA 1RWUA 1TMJA 3EMTA 1NB7A 5D77A 4F25A 4ERDA 1S0NA 1K0VA 1K47A 1H73A 5ETOA 1CJKA 3M8PA 3TX0A 3B8HA 2OPPB 3GYNA 1Q5YA 1MSWD 3CPWR 1YRXA 3JSYA 5HQLA 3X1LB 3DFEA 1ROFA 1I6JA 1VRQC 1U8SA 3CE8A 4OJGA 2OEJA 5FD1A 3KYLA 4PWDA 4YB6A 2DGUA 4IG0A 2GQQA 5HL7Q 1RWPB 3TWZA 2MY8A 5JUMA 1CULB 1K1SA 2O3DA 5AXLA 1U49A 2VJVA 3S01A 1S6QA 1HNVA 4JI6F 5D78A 1NMEB 3TP2A 4CH1A 2XCAA 3M30A 3ZZRA 1IBLF 2V4JA 3CTRA 3C19A 1RWKB 2COLA 1RT4A 4UZBA 3PG9A 3NCRA 3C6TB 1TR0A 2YX1A 4F04B 2RU3A 4UTGA 4YDDB 4USTA 2G2ZA 2HURA 1NK9A 3R6LB 1Q16B 2OPRA 1GEHA 2QG9B 2ZFHA 5JXSA 3I32A 1VQMS 4EEYA 2W2OP 5G0RB 1DJ0A 1I3OB 2JJ4D 2LEAA 1JK9B 4KHPF 3O44A 1RT5A 4P2XA 4ZVHA 4DCPB 1S0OA 3VZHA 2M88A 5K8OA 1DBDA 2NXCA 3HCXA 1RZMA 1X9WA 4M95A 3D5MA 3ETOA 4DPXA 5ETTA 3EE3A 3ZNUA 1S77D 3FZ2A 4USMA 3B4DA 1TKDA 1OQ6A 3W62A 1SXLA 4FN5A 1KEKA 1YJUA 4DN9A 3OJUA 3VVUA 1AXQA 2BJDA 2HFOA 4DUZF 3JSMA 3V6KA 4KKOA 3K0JA 3IWXA 2A6OA 3T5KA 1RT3A 3RB0A 1UEKA 3CD0A 3ZO7A 5KFNA 2BRLA 4KQZA 3SDEA 4ZVUB 4DFMA 1LW2B 2PIIA 3CGIA 3CMQA 3PR5B 2W25A 4DR1F 2Y1JA 3RRHA 4A8KA 3UDVA 2VASA 2RHSB 4DR2J 5FJ4A 4PWWA 3P49B 3V6HA 5GADI 3IAS9 3NGSA 4DSFA 4DQRA 1RCOB 3CUNA 2KDOA 4DZDA 5KG4A 2GJ2A 1VRTA 1JJHA 2P6SA 4DCJB 1TQLA 4X62J 3IRXB 2HRTA 3RRKA 3K5OA 2FPHX 2HKEA 1IKVB 1LK5A 3TI0A 1RAIB 4OFZA 3DDKA 3ONQA 3QYYA 3OFHA 3UFCX 2QEXS 3TUJC 2AIRB 3ENQA 2GMJA 7AT1B 2MQPA 5HROA 2AEFA 4LF5F 1CC8A 5J2QB 3DOLA 3MR3A 3CO9A 1ZA2B 1YSJA 4Y2MA 5A8RA 3QATA 4RJVA 3V2UC 1G3OA 3CCWA 3GONA 3M8RA 3JSBA 1WC0A 1LK7A 1NUEA 2YKNB 1YQHA 2V63A 1RT7A 1UWAA 4A8FA 1XNRF 3EZUA 2F8HA 1N54B 1VC0A 1SKRA 1XR5A 2BEFA 1J5EF 3RZAA 1Y10A 2R7OA 2VFVA 1HARA 5D15A 3I96A 3FRYA 2O5DA 4QWBA 3MM5B 4WWSA 2L41A 2DNLA 2XLIA 1SC3B 1M5VC 4JI5J 4Y3CA 4EZ6A 2J9EA 2GVZB 1UW4A 2KXFA 5C7PA 2KRBA 3MPUB 5CYMB 4J7CA 2AP6A 3KJNB 1CVJA 5M2RA 5LSOA 3L09A 2LQ5A 3CJ4A 3N01A 4P74A 1KTQA 3OL8A 2E7VA 3VALA 3CJRA 5AE2A 4NLDA 1HBUB 3E51A 3BN4A 2A2DA 1C0UB 1ZAXA 5CHCB 3RAXA 1CJUB 2H4YB 2A1BA 4MIWA 3UD3P 5KFBA 3RYLA 4PUOB 4DUYJ 2N7YA 1EARA 1S1XB 1VFJA 4K5SA 1VBZA 2IDLA 2W2PP 3ZZOA 3PRVA 3PXGa 1S9GA 4KGXB 1YK9A 4C9DA 2QV6A 2JOQA 3MECB 4J9UE 3IBCB 1S0MA 2IHR1 3I0RA 1GT8A 2DRDA 4X4OA 1T9WA 2ZKTA 4F2RA 1SC1B 3JQJA 1RAJA 1HMVB 4F3OA 2KO1A 1H3DA 3W9IA 1FX2A 2R7RA 3CO0P 2VFRA 1FJEB 4CCHA 1B4SA 3HZGA 4C11A 2WSFC 5RUBA 3BV8A 2GX8A 2ACYA 3MR6A 1ITPA 2XNRA 3NGKA 4LT6A 1PKUA 2P5VA 4DI6A 1F1BB 2BE2B 4OI4A 1CSJA 2OLWA 4OZNA 1RAFB 4F4WA 2AV5A 1NJZA 2JL9A 2PEHA 2XMKA 4F50A 4A48A 2HHQA 2VBZA 4PG6A 1R0CB 4ED8A 5K20B 3THVA 3RRGA 3W9JA 4PQUA 4UUXA 4ZVEA 3DRSA 1WC4A 4AT1B 2UZAA 3D1HA 1TU0B 2NS1B 2N3OA 1BE4A 1UFKA 4JI6J 3IBWA 1U1MA 2CFXA 2MKHA 4K4SA 4DWIA 3QBCA 3N6MA 2PMWA 3U02A 2QLFB 1SUQA 1N6QB 1S1VA 2HPUA 1X0PA 2BM1A 4X65F 3MM7B 3TW0A 3VAHA 4GKKJ 1XMOF 4DS4A 4KV8B 1FCAA 3EX7B 3QRPA 1KTVA 1R8CA 5DQGA 3GR1A 4MIBA 4NXNJ 3ZTPA 1E6VB 1TKTA 2GIFA 3HD2A 3NWGA 3U27A 1CEZA 3DRYA 2OIHA 4RW6A 4YUDA 2ZVSA 2YVSA 1F6TA 4RZRA 2D3ZA 3OFFA 2IJFA 1S9FA 1Y00A 1W26A 4RBUA 1S6PB 4TY8A 1T9YA 5I42A 2VHGA 4DPYA 3CCSS 1RTHB 2VFSA 3TJ9A 4WFNQ 3QMQA 2DH9A 2DKOB 3DMJA 2GFFA 3D67A 1NKCA 4V19X 3T1YJ 2RD5C 4H54A 3PX6A 2NUUG 2ZH4A 2Z2ZA 5H1SV 2CG8A 2ILZA 4ZPWR 1EHWA 1FF2A 1ZS6A 4ZVPB 1QTNB 1VIOA 3BGRA 3DRPB 2G1HA 1WEXA 1FJCA 2HQIA 1FI4A 2QA4G 4ECYA 2B56A 2J9DE 1Q8BA 2DEJA 1RA6A 4OZ1A 4WK1A 2C22A 3TO8A 3GQCA 3WC2A 2HNZA 3W8GA 3MPDA 4QIGA 2Q6CA 3IXQA 3KHLA 4CLFA 2EFOA 4UOHA 4M5LA 1DQ8A 1RTZA 1FFGB 2A2CA 3QWUA 1BQMA 1XNQF 4Y34A 1NHKL 2K3IA 1F2GA 1PYSB 1V3SA 3RBXA 3R8YA 3TEHB 3PJXA 2P6TA 1HYSA 4RWXA 2ASLA 1HHSA 2AJ1A 1U6ZA 1K8AT 2VG6B 3QT6A 5F8MA 1DTTB 4KRWA 4OIXA 4ANDA 2WAQD 4DR3J 4C6AA 2VPYB 3M9NB 2XLJA 4CTAA 3VAGA 2Q66A 4K4UA 1X4DA 4P71A 4B08A 2KYXA 5A6PA 2DGVA 2V2ZA 1RLDA 3GPAA 2XSJB 3H20A 1GTHA 3MOJB 2FTRA 3A1YG 3E3XA 3MMBB 2W9BB 2E5HA 5KT5A 1T05B 4YB1P 1QAJA 1J5EJ 2DXDA 5ETPA 1TKXA 3G86A 1X60A 5JMNA 3R1LA 1AFJA 3NP5A 1J2VA 2ZOFA 2CJ9A 4FDFA 4ZS6A 3K58A 3UPFA 3L3CA 2CQBA 3Q8RB 2VDHA 4EO8A 2DEIA 2DNMA 2ZKUA 4JV5F 4J9RA 1X4AA 4Y2CA 4ECUA 3PVXA 5KFHA 3N4WA 4Q0BA 5DJBA 4W92B 3OT9A 2R2RA 4DX5A 2LEBA 5D0EA 2ZM6J 2ATCB 2Y1LB 2CG4A 2EVZA 4DX7A 1OMSA 2P9EA 2Z56B 2ZZTA 4RW9A 1XMQF 4NLTA 1TKZA 1JKHB 1YRUA 4LF6J 1IKXA 5F8NA 3F41A 3HKWA 2E29A 2DGXA 1R3NA 1U47A 3EDQB 2J9DA 5I3UB 2FDNA 5E7OB 3PIPQ 2J8SA 2HQFA 1L3VA 1HNXF 1NAQA 3GE9A 3IR5B 2RQCA 4ER8A 4DR6J 3CJKB 3GU0A 1N33J 4MYUA 1JQGA 4IFVB 3FSIA 1TVRB 3SCJE 3EPGA 4CM2A 2GC8A 5KFVA 2X1FA 2MMYA 1H0HB 3JYTA 4AE5A 2GJFA 1CQNA 5BXIA 1RBLA 3OBIA 2RF2B 2VONA 2R7WA 3DLHA 4NYOA 1WKLA 4OHVA 3HZEA 4C8YA 1EP4B 4C2MA 2GIRA 3GFZA 1Z2ZA 4C8OA 3W1YC 4LMZA 3AJ1A 1DARA 3I82A 1Y4ZB 3TX8A 2ZUGA 1JLCA 3BR9A 1RXOB 3KG4A 2HZCA 1HI1A 2BACA 1KOHA 4FP9A 4TVAB 1S6OA 1HWJA 1R8BA 2ZD1A 4J91A 3KLHB 4B3RJ 4DOZA 3BDPA 2DRBA 5A2QY 3R9LA 3MM6B 3Q0AA 2D9OA 2ZH9A 1KD1T 3EVOA 1O6XA 5F8JA 2DNGA 1T3NA 4MFBB 2YNGB 2C28A 1JLFA 2DY9A 2NREA 4AXIA 1X5OA 5LXRA 3BN7A 1RT2B 4OLOA 4B3SJ 1SC6A 3O2IA 1S1WA 3MPWA 1XR6A 3DI6A 4JI2F 3B78A 2C42A 5HP1A 4C48A 3LH2S 2XZTB 3NL0A 3Q89A 2XTJP 3H0PA 3QO9A 3C6UA 3HT0A 3TZWA 3HM9A 1JLEA 2MLZA 3VV2B 4QWAA 4TN2A 2MQQA 2O66A 5T7LA 2IYGA 4WTOB 3NBPB 1UA1A 4L3KA 1TUWA 3LPEA 4H4OA 2ASYA 2CDQA 1S5ZA 3E2EA 4HKQA 4CO5A 4KIAA 3AT1B 1B70B 4WP8A 2ZJPQ 2F4VJ 3N5BA 2WVCA 1IBKJ 2OH2A 1ZPWX 3M1VB 3MUVP 2VPWB 1JWWA 3BKTA 4J9LA 4QU6A 1U0HB 3AB4B 4KGMA 4X4NA 5HAOA 2CQGA 3W5XA 5JVHQ 3BF4A 4ICLA 2D7SA 2UXCF 3PM9A 3M2UA 4NL5A 5EHHA 2EI5A 4UF4A 3KJFB 4M5NA 4ID5A 4LF4F 5J2PB 5KT2A 1C0TB 1YG0A 3PW4A 4ED2A 1EAYC 3EICA 2UVWA 3JQMA 1TFWA 2K1RA 3G4SS 2OO4A 5A8KA 5ETMA 1JLGB 2LQ8A 3ZTSA 4EMDA 2YH1A 1RU1A 3R2CJ 2D9PA 3L4BC 5F41A 1N0UA 5LJ5Y 4XPCA 2VB6A 2ADCA 1Q78A 4ED4A 3POTA 1QAXA 4OX8A 4J9MA 3Q8UA 4EBEA 3HHDA 2VBXA 1WG1A 3H98A 1HLWA 3LAMA 3AY0A 3HD1A 3AQOA 3QIPA 1H38A 3NLCA 1W7WA 3ADAC 4CO1A 1F3FA 3UCUP 3NCPA 5IM0B 5CYQB 1Q81T 5HJXA 2H48B 4V19J 4JV2A 3WX8A 1F0XA 4DV0F 2JDJA 4M5KA 3MM9A 4KSEB 2GO8A 3M8QA 5E0OA 3EGZA 2V4QA 3N79A 4OJ1A 4ED3A 2WZ1A 9ATCB 1KP6A 3DXSX 3D0HE 2XBPA 1S79A 3R5DA 5ETQA 4ES2A 1M5OC 3FFIB 3BREA 2YWKA 1V6HA 2M8DB 2DNPA 3T41A 4BLGA 4LF9J 2XY6A 3NKYA 1HR0F 1HQUB 2BRKA 4KJIA 3N0VA 3KLEA 4OZJA 4Q5VA 2X3GA 4I56A 2VH7A 4YY3F 2LU2A 4TLQA 3KKFA 2RDIA 3H2VE 5DDPC 4PXEA 5D3GB 1KQFB 1ZBTA 4A8QA 1RT6B 3IMQJ 4BDPA 1SKSA 2B4UA 4RLEA 3WHIA 7FD1A 2VFUA 2DCUB 1AUDA 4RBVA 3MMCA 1IQTA 1WC1A 4O3QA 4CYUB 3DLEB 3X3UA 3C16B 2M3DA 2LCWA 2QLXA 2RS2A 2EC0A 1HWLA 3GG1A 3D1OA 1ZAWA 2VA3A 1HNIA 4DV2J 3C14B 2VICA 2CPJA 3W2WB 2H4WB 2V2QA 1UVIA 3DU5A 3T1AA 2JH3A 2UU9F 1F5AA 3G82A 2BABA 2HHHJ 4B9TA 2IDEA 3BR8A 2DR5A 4ZPCA 4AQYF 1E6YB 2AZ3A 3BM7A 2Y8WA 4UQTA 4RU2A 3CCRS 1YZ7A 1OYDA 4HACB 2POKA 3FBEA 4N8OA 2ZHOA 1RGVA 3QGPA 5IC4B 2HW3A 2RS8A 1VDHA 3ET6B 1R0AA 1WSVA 4B3MF 4JI7F 1B0PA 2DRAA 3LOUA 4Q7AA 1RTDB 4YOEA 3OR2A 3HXMA 2EC2A 2LXFA 4JBCA 1VLOA 4ZLLA 1WG5A 2FJEB 4NWBA 3MM8A 3T5JA 2CZ9A 1QAIA 3IN5A 3T1HJ 3QRQA 5EWEA 4LUBA 4ZIVA 1SQFA 2CDRB 3FCVA 2WOMA 2FZKB 4NI2B 3BO4A 3GB0A 2JEFA 3BZQA 2FLNA 5ADZA 3FSYA 1VBKA 5DM7Q 1FDBA 2YX7A 4FF4A 1NDPA 2HG4A 2MHEA 2BKNA 3U7JA 2W4PA 2H1YA 4DQQA 1J5OB 4MH8A 3FKBA 1OYEA 1GNKA 1KSPA 3QZ7A 5HATA 3GV8B 2RT3A 2ZH3A 4CQ1A 4ED0A 2WBMA 5K8MA 2MDAA 1RP5A 2JLGA 1CS4A 1EQMA 4LBPA 1S4EA 1S59A 3P96A 1FK9A 5FDLB 1P9QC 2HVEA 4OZ3A 3P6YC 1JJCB 1YJ9S 1KHWA 2XMMA 4QZVB 1UEUA 1FKOB 1KOOA 4YQWA 2ASJA 3J7A1 4WU3A 3IAM9 1EETB 1UCNA 1EQ0A 4Z7CA 2VL1A 3DN9A 2Z57B 4J37A 5K5MA 2DITA 2I0XA 3FUYA 3RB4A 3HO1A 2B9EA 3TZZA 2MXYA 4A46A 3I0SB 2DO0A 1NNDA 4QWEA 4DBQA 3P8BB 3TANA 1FERA 2OMLA 3K8VA 4LFBF 3PJ9A 3CCLS 1FKPB 1D8ZA 3M8YA 1RKIA 3NCQA 5LMNF 4I2PB 4LF4J 5KFTA 3AFGA 3HLUA 3UNGC 2XHWA 5B08A 2KZZA 4Y6IA 3MTKA 4IR1A 1RYRA 4DV1F 4GO5X 2CPXA 1X7VA 4NZ7A 5DS7A 3M2VB 4G1PA 4UY8T 2JEJA 4PWUA 5G0RA 2R8JA 2MJNA 1RHQB 1JJ2R 4YHHJ 3LUYA 3HHEA 2XY5A 3VR1A 4RWWA 3LGMA 1GFWB 1SBRA 4P6QA 4USJC 3TVZA 1JXEA 4NLUA 1QLNA 3KJQB 3R5GA 3KK1A 5E41A 1LNQA 4B3TF 4ZJLA 2AU0A 3R2DJ 4NRUA 1UTAA 1BWEA 2FVRA 5T41A 1FA0A 1GXTA 2VQEF 3OL9A 1X4HA 1YI2S 3B4MA 1YGYA 1RJJA 2L9DA 2BOPA 3C15B 1S7HA 3GCXP 3UVJB 2WBRA 2VZ9A 3PR4A 2K2PA 2AKWB 2CUYA 4C97A 3ZTRA 1P6TA 3JXOA 4RU9A 2AYBA 1WACA 3G96A 5AE1A 5LSLA 1LEOA 2EK1A 3BSOA 3IRXA 2DHAA 2OJ3A 1WF2A 4UZCA 1NH7A 1HR0J 2B6AB 1SKWA 1N88A 2RE1A 3OFEA 4NCGB 3BH6B 1ZPVA 5J1EB 1N32J 2UUTA 3DNCA 1NHUA 2BE7D 2IC3B 3SFGA 4X4RA 3SSSA 4X84A 1U25A 2HVDA 2ROEA 1FE4A 5J2QA 4LF7J 5H9FK 4WBFA 2HQGA 3AD7C 1R31A 3MWBA 3IFEA 4QIVA 5L1JA 2GO9A 2VQFF 2DGTA 2MQOA 3ZZTA 1Y11A 4NLPA 2CQ3A 2MZ1A 3TAMA 2DH7A 2XZWA 1UJ4A 4PAAA 1WC3A 2MB0B 1G1XA 3NG8A 1ZA1B 1FX4A 1X4BA 2RIJA 2ALZA 1REVA 2QFJA 1N34F 1HD0A 1CC7A 4ZA1A 2M70A 4QOTA 3R6GB 5LSRA 4B3OB 4C4WA 4KT0C 4HH0A 2UUCF 4D3HA 4ZK7M 2VG7B 1LWFA 1Y5LB 3LALA 3NXZA 1SVDA 2HWTA 1YBUA 1I94J 3DXBA 2C3PA 1X5PA 4FNHA 5KFEA 2J6SA 4AQYJ 3M9MB 2DGWA 3K57A 1M1KT 5JJBA 2JX2A 2MGZA 2DT9A 3UE2A 2IVFB 2BQUA 4Y00A 3TVKA 2HAIA 2H54B 2IM0A 5LMUF 1S72S 2CPZA 2ZJQQ 3AODA 3I87A 2K7KA 3AD9C 2QYCA 3QFWA 2XWXA 3PZPA 4TYAA 3SYZA 3KLFB 1CJVB 4ILMA 2EW9A 2WB1D 2BE9B 3H5XA 1C0UA 2W7PA 1CJUA 2MQ8A 4PUOA 3I56S 1U45A 4YB7A 3TQ1A 4DR7J 3OR1A 5JVGQ 5KFSA 2AJQA 1HBOA 2XS5A 3CB4A 5KT6A 3FJ2A 1HIYA 4KPYA 3IR7B 4JI8J 2UXDJ 1RA7A 2XI3A 3IO1A 3MEKA 1VRUA 1QTMA
chains in the Genus database with same CATH topology
1IUJA 3RRKA 3QIPB 2ABYA 1SL2A 3K5OA 4LF9F 2FPHX 4M5DB 2PMZD 2LQBA 2HNDB 1S1TA 1IKVB 1LK5A 1RT2A 4F4XA 3TI0A 3IA0A 4ZPDA 3CCUS 4OFZA 3DDKA 3ONQA 2HS0A 3QYYA 3OFHA 3NNAA 4WFXA 1GX6A 4O4GA 3UFCX 1FVSA 3T5HA 2UUBF 1S6QB 4WZMA 2Q1LA 1QSSA 2QEXS 4LSNB 5F3TA 2B9WA 3TUJC 2JLFA 3ENQA 2V4JB 2CPDA 4OZ0A 5KFOA 5HMWA 2GMJA 3MCSA 1T03B 1VHFA 3PHEA 1RT4B 2MQPA 5IT0A 3TA0A 4KBIA 5HROA 3MM9B 2W9CB 4ZCLA 1VQOS 2YNFB 4LF5F 3KHRA 1CC8A 5J2QB 3HHNB 1VK8A 3DOLA 1LQ9A 1UP1A 3V4IA 3MR3A 1XC9A 3CO9A 3MZIA 3KMQA 1YSJA 4Y2MA 5A8RA 1JLBB 1XEZA 4ZCKA 2LYVA 1K9MT 5KFPA 3U1MA 2W7AA 3V2UC 5GAHI 1G3OA 4USHA 3CCWA 4ECQA 2EFNA 2CQIA 5EDWA 3NS5A 3M8RA 3JSBA 4OZ5A 2O01C 4DLGA 4ZHRB 2BE2A 2YWGA 1NJWA 1KLNA 1LK7A 1RI7A 5L9NA 1H2TZ 2DR8A 4M94A 3Q23A 2KYZA 2RRNA 2YKNB 3NBPA 5GAEU 1LW0A 2CJQA 3DLGB 4EYHB 1YQHA 3LP1B 4ED6A 2OPRB 2RQKA 5A8WA 3M8SA 2YKQA 3ZZZA 4LIRA 4HT5A 1TL4A 1RT7A 3UI3A 4PG4A 3KLIA 1FKAF 2LA6A 4CO4A 1WEYA 3W2VA 1JLQB 4A8FA 4QIEA 2XULA 4QCLA 2X1GA 2R7TA 1NU4A 1XNRF 2M7SA 4NA3A 2CQHA 3EZUA 4MYTA 2F8HA 2ZBCA 5C24B 3FQKA 5DG9A 2E1RA 1N54B 2MKKA 2KFNA 4JI1F 3DCAA 3HK2A 1VC0A 1S1UA 3LP2B 5DGAA 2BDPA 2CZ4A 3NRBA 1SKRA 1HD1A 1XR5A 2HS4A 2WW8A 1J5EF 4YR0A 3M1VA 3L95X 3RZAA 2OTLS 3V5RA 3ENVA 3HVTB 2R7OA 4B9VA 2VFVA 4ED5A 4DV2F 1HARA 2E5JA 4QWDA 3I96A 3LGNA 2FUG9 1KLMB 2HLTA 4NLRA 3FRYA 2DHXA 2O5DA 4QWBA 5HLFA 1CG2A 3O8WA 1W2IA 3MM5B 2O1PA 5GVQA 4EBDA 2L41A 2CZVC 2DNLA 2XLIA 3LWMA 2GJIA 1M5VC 2HHHF 2DVIA 4MKAA 3NS6A 3K5MA 4Y3CA 4O3PA 2RILA 1XMBA 2J9EA 3QAUA 1YITS 4EZ6A 1TL1B 2YQ3A 4JV1A 4PKDB 1UW4A 2KXFA 1OO0B 5E3RA 4MKYA 1B0TA 5KG1A 2J6TA 4OJ3A 1NEEA 2KRBA 1SH2A 4A8YA 1D9DA 3K8WA 5CYMB 1VQ5S 1Q8LA 2FC9A 2GIQA 1BD6A 2PA3A 2AP6A 4F4YA 1URRA 3EPIA 1NK8A 1PGZA 3MXHP 2KJWA 1CVJA 2PDAA 4KKOB 5M2RA 5LSOA 3L09A 2LQ5A 3FQLA 2PSZA 1BY9A 1Y5IB 3QPIA 1JLAB 2F9DA 1N6QA 3CJ4A 3N01A 5J2PA 2FJXA 5IQQA 2HHVA 1KTQA 2VC0A 2KI2A 3OL8A 5DG7A 1RT3B 3PFOA 1DHMA 3MM7A 1RISA 3VALA 2EG1A 4P2SA 4TQRA 5AE2A 3H8YA 4RNFA 1HA1A 4NLDA 3SQGB 4YR2A 1HBUB 3E51A 3HKZD 5KOXA 3BN4A 4O0IA 4H4KC 2A2DA 1C0UB 1ZAXA 4NLVA 5CHCB 1UMJA 1YVFA 3RAXA 3OHBA 3OXLA 5F8GA 2A10A 2J0WA 2M9KA 2DISA 4IOBA 3TR5A 1VC6A 1A9NB 2A1BA 2GHVC 5KG0A 2WCXA 4MIWA 3T5LA 1BLUA 3UD3P 3OUYB 5KFBA 1V9OA 2DBBA 3RYLA 5DDRC 4PUOB 4KAIA 1QJHA 2V8DA 4JUZA 2OSRA 2V2KA 2N7YA 4NA2A 4WCEQ 2HLUA 3FSXA 1S1XB 2CQDA 2Y1RI 1VFJA 2L08A 3ISND 4IDKB 4K5SA 1RQ0A 3OSNA 1VBZA 1SJFA 4N77A 5LL6d 1K73T 1WTBA 3ZZOA 3HPOA 1JNRB 3CVKA 2UV8A 3T1HF 1NJYA 5DG8A 1P27B 3PDNA 5C25B 1GX5A 2C3YA 4NX9A 5F8LA 3PXGa 1S9GA 1S6PA 1XERA 4C3MA 1VRTB 2ZBIA 5F8IA 4OHWA 3DHWC 4C9DA 1MROA 2QV6A 1TL5A 2YKMB 3SXLA 4BWMA 1UVLA 5J2NB 1RYSA 2JOQA 2NSCA 3MECB 4ZDNA 3OVAA 2PI4A 1RTHA 4K2XA 5HMYA 1S0MA 1QUVA 2IHR1 5GMKa 2QA4S 2Q43A 3I0RA 2ZZMA 1GT8A 3HX9A 3M6VA 4ZKAA 4FF3A 3I4HX 4X4OA 2V8HA 4Q45A 2ZKTA 2DNNA 1S0VA 2CRLA 3HHKA 4OV1A 4WTYA 4F2RA 3HDSA 2XY7A 5CYQA 4ZPVR 5T14A 1RAJA 2RMLA 2XWYA 1HMVB 4F3OA 2I8EA 2LEPA 2KO1A 1H3DA 5GAGI 3I55S 2R7RA 2DD8S 2E5GA 2V4RA 4K4WA 1G7CB 2KXHA 2VFRA 4TXSA 3CULA 1FJEB 2IAJA 1Z4UA 4A8WA 4NLQA 4QR0A 1YHQS 3C46A 4CCHA 1X9MA 5SUHA 3HZGA 3ZZPA 4A47A 4C11A 3GIMA 2Z2LA 5HROB 2WSFC 2HHUA 3DRPA 2GX8A 1WI8A 2ACYA 3MR6A 3TNVA 3V4IB 1X4FA 4NRTA 2XNRA 4DL7A 5A8RB 3NNCA 2FVCA 4IH7A 2FHJD 1DAXA 5I3PA 1ZZNA 3NGKA 2RU9A 4LT6A 1IR0A 2P5VA 3RB3A 2BE2B 5MLCV 2NPIA 3CCMS 4OI4A 2LLZA 1CSJA 3NAHA 2HHXA 1N5TA 4CO2A 2OLWA 1O8BA 3JTNA 4OZNA 3WBZA 2GHWA 5LT5A 2UVUA 4F4WA 2AV5A 1NJZA 2JL9A 3MEGB 4LQ3A 2PEHA 3I31A 3MM8B 2FD2A 2XMKA 4F50A 1RT7B 4A48A 2HHQA 2VBZA 2JEIA 4PG6A 4ED8A 3W2VB 1FEEA 3MPYA 1LFWA 1U2FA 2E1AA 1ZZFA 4K4YA 4EYIB 1HBNA 2FHOB 1I1GA 3THVA 4R8UB 3FFIA 3RRGA 1XTZA 3GYXB 4PQUA 1DZ5A 2JC0A 1S1UB 2M2BA 4UUXA 4ZVEA 4ZOSA 3DRSA 4CI0B 1VBYA 2XGPA 1D0EA 4XIUA 4ES3A 4KFBB 4NXMF 4ITSA 3H5SA 3T6BA 2E5LF 4F02A 3BQ2A 4DV4F 2BQRA 1AROP 2UZAA 2NYIA 1S6UA 5KTQA 4QPTA 5THWA 1VLYA 3D1HA 5HLFB 1TFYA 3D28A 4CO0A 1UAWA 2MZRA 4WZQA 2B7CB 2NS1B 1OS5A 2N3OA 4PXBA 2DNKA 2YWHA 3RTVA 2FLOA 2Q3PA 1ZH5A 3IBWA 4J9KA 2YKAA 2R8KA 5GAGU 4CIOA 1U1MA 2CFXA 2MKHA 2WSEC 3ISNC 1SJ4P 4DWIA 2KM8B 4K4SA 3B82A 1FRLA 3N6MA 2AD9A 2RNEA 3U02A 4WF9Q 2B9XA 1M90T 3G8QA 4NLXA 1DTTA 3G6XA 2AGPA 4NOHA 3PW0A 2PD1A 2WONB 5CYJA 2FVSA 1SUQA 2VODA 3S1TA 2CVIA 1VQKS 4C0HA 2DIUA 4I2QA 4FF2A 4TKTA 2C2DA 4IKAA 1A7GE 3VTIA 1M0SA 1N6QB 1YBAA 3KK2A 4HI2A 1S1VA 1O51A 2MSTA 3CIMA 4IRKA 4WU2A 4JI4F 2HPUA 1X0PA 2BM1A 3VAJA 2C2EA 4RW4A 4X65F 2MZJA 3MM7B 5KAKA 1R27B 3TW0A 2FVQA 2V0NA 4C7QA 1UVMA 3VAHA 1XMOF 4ECWA 3RBEA 5CQGA 4DS4A 4WXOA 1F5BA 2IM1A 1WNEA 4OZLA 4ZPBA 2JFKA 4FZVA 2EFGA 4KV8B 4E98A 2ZITA 1FK9B 3RB6A 1FCAA 1Q86T 5KFRA 3EX7B 1KTVA 1LWEB 2LDIA 4X4SA 1NZAA 1VQ4S 3U1NA 1R8CA 1Y3KA 3O5TB 1S99A 5DQGA 3GR1A 1Z1ZA 3J80Y 4MIBA 3VAMA 2XSJA 1TV6B 2NSBA 4J9OA 2GHPA 1E6VB 1TKTA 4U7CA 4FBUA 3DRRA 4XDDA 3NWGA 4OX6A 4YHHF 1VQNS 3U27A 1CEZA 3DRYA 2OIHA 5CD4H 2HFNA 4RW6A 4YUDA 1FRIA 4DG1A 1T05A 2ZVSA 2YVSA 4OI0A 4A8OA 1U6BA 3GIIA 4RUAA 1C4AA 2L48A 4DR5F 2W9AA 4RZRA 1VIXA 3GFHA 3R3TA 2D3ZA 3OFFA 2QMWA 2IJFA 2V9WA 2NPFA 4RNMA 1U1NA 4URGA 1S9FA 3UW1A 5K8NA 1RT1A 1Y00A 3W2WA 3K5PA 1FO1A 5KT7A 3K5LA 2GA7A 4EZ9A 1S9GB 4RBUA 1S6PB 2DR7A 4TY8A 3KLVA 4RW7A 1KHVA 1NO8A 1Q1KA 3FVYA 2I9SA 4YB5A 3ENWA 2HQ3A 2UVRA 1IJFB 2WRMA 3FEXB 5I42A 4IYQA 4WJBA 2KTQA 4Y0FA 4L3NA 4EBCA 3CCSS 1RTHB 1HPZA 4IOAQ 2VFSA 1E6YA 1FD8A 1Y5NB 3UCZP 3IS9A 1WELA 2QSFA 4EO6A 2JEGA 2VC1A 5A0YA 3T3FA 4ETXA 3LQVA 4WFNQ 2ILYA 1FJGF 3T19A 4FS2A 3QMQA 3MAQA 3KLGB 2DH9A 4IO1A 3DMJA 2GFFA 1UFWA 1NKCA 4V19X 2RD5C 1GXLA 1HWIA 4BBYA 2Z2MA 2FLPA 3Q2TC 3N9UC 4H54A 4ZPAA 5SZTA 2CQ0A 3PX6A 3TA1A 2NUUG 4TNOA 5DO2A 5B0FA 2ZH4A 3HVWA 5H1SV 5CZVA 1VQPS 2OPSA 3LP0B 2EFVA 2RRAA 1FEHA 5B7WA 1W25A 2Y0SD 2ILZA 3PKYA 4C11B 4ZPWR 1ZAVA 4USIA 1FF2A 4QPXA 3AH6A 3TYTA 3IGNA 1S76D 1VIOA 1JKHA 3BGRA 3DRPB 3HP6A 1U1RA 3CT9A 2CJBA 1S4FA 5CZXA 2MQMA 3ITHB 1WEXA 5F0UA 1FJCA 5L8RC 3NNHA 1UEVA 3DC2A 2HQIA 2NR0A 1H7XA 2QA4G 1T7PA 3W7BA 4OL8A 3DOKA 4ECYA 4FXVA 2B56A 2J9DE 1Q8BA 2JC1A 1H2VZ 3MAHA 3BDEA 3I5BA 1RA6A 2BA9A 4Z37A 4OZ1A 1APSA 3VZIA 4WK1A 2C22A 3TO8A 3GQCA 1YIJS 4NYPA 3MMAA 3WC2A 2HNZA 1KQSR 4QIGA 5B0BA 2Q6CA 3IXQA 2LA4A 3HHLB 3KHLA 4LQ9A 5BYRA 3CJKA 1HBNB 2EFOA 4F8RA 4WYWA 1URNA 4IH5A 2E7WA 1DQ8A 1UL3A 2B4PA 4OLPA 4OHYA 3UR0A 4IFVA 4ECVA 2A2CA 1TVRA 2B0GA 3DRSB 4DS5A 4X2BA 4N8NA 2RQ4A 2J6UA 2CJKA 2X1BA 3KK1B 2BW2A 3QWUA 5HMXA 1U24A 3SCKE 4DF4A 4HDGA 2V5HG 1BQMA 4IH6A 1XNQF 4Y34A 2IA0A 2K3IA 4G1QB 1BC6A 1F2GA 1PC5A 1V3SA 4TU8A 2J8AA 2QIFA 4WFYA 4DX8H 4J9NA 1ZETA 4FBTA 2HVHA 2PFFB 1OPIA 3PJXA 3PW7A 1R7IA 2P6TA 1HYSA 4RWXA 2ASLA 1N5QA 3E01A 1HHSA 2AJ1A 2RF2A 2U1AA 4DHVA 2VOPA 1N52B 2M0GB 1N32F 1U1PA 4QR1A 4QW9A 4DFKA 3BO3A 2R7VA 2EG2A 2AWZA 6FDRA 2XB2D 1U6ZA 1K8AT 2LDYA 1FXRA 2VG6B 5F8MA 4ELVA 1DTTB 4KRWA 4OIXA 4LF7F 4PG8A 2B5JB 1Q7LB 2WAQD 2YNIA 1SUQB 4K59A 2VPYB 4NCBA 3M9NB 1S97A 2G9OA 2G13A 2XLJA 1FT8A 1HW8A 4CTAA 2UVVA 3KOAA 3QJJA 3PV8A 1FXLA 2B51A 3PEJA 4I4BA 3H59A 2MZTA 1X5SA 4RW4B 3VAGA 3M8PB 2Q66A 4K4UA 1X4DA 2KRRA 4QIWD 4B08A 2IFXA 3MEDA 2KYXA 3PW5A 5GAEI 1VOMA 1CQMA 5A6PA 4DV5F 2IJNA 1S10A 4GC6A 1FVQA 3KLHA 3D0GE 4A8SA 2DGVA 4QYRA 2PI5A 3QGGA 4X66F 1KR4A 1NRKA 1V3RA 3CCTA 1SV5B 3GFXA 1UWBA 3CD6S 4BC9A 2XSJB 3H20A 1GTHA 3MOJB 2Y1IA 2FTRA 1TKTB 2OD4A 3WZ0A 3OL7A 3A1YG 3E3XA 2KM8C 3H40A 4ALZA 4PWDB 3MMBB 2W9BB 3QGIA 2CQPA 2E5HA 1ZYQA 3H2UB 3OTBA 4IG0B 4RW6B 1ELOA 4MFBA 5KT5A 1T05B 3DLKB 1VMBA 4YB1P 1QAJA 2HYIB 4ETZA 5HQ8A 2HHSA 3SEOA 3IG1A 1X8DA 1HI0P 5D4LA 3HHLD 3N6NA 3KMSA 5G4DA 1TKXA 3PNIA 3G86A 1X4CA 1B0VA 1RT1B 1VQYA 1NH8A 2YWFA 1HBMA 2Z0GA 3GV7B 3R1LA 3NP5A 1AFJA 3GSDA 4RW7B 3RW7A 2ZJRQ 5DETA 1J2VA 2PGCA 1HNVB 2ZOFA 1FHTA 5HN0A 2CJ9A 1I94F 4ZS6A 3K58A 2XEXA 2CPFA 2N4CA 5I42B 2YWEA 3UPFA 3L3CA 2CQBA 3M30B 2EBGA 4XDCA 5AXMA 3Q8RB 4C3KA 1HPZB 4EO8A 4YR3A 2ZKUA 2DNMA 5EUHA 5EWGA 4U67Q 4JV5F 2KKHA 5K14B 1X9SA 4J9RA 2EKYA 4RKUC 1X4AA 2K7JA 3V4MA 1XBWA 4HI1A 4Y2CA 5IXUA 4ECUA 5L1KA 4ES1A 5FLXY 3AA8A 3CEDA 1D1UA 4PRFA 2K8GA 5KFHA 3PVXA