4GO7X

The regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
186
structure length
165
Chain Sequence
SIHMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNVSKDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGVTATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLEATVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural view of the regulatory subunit of aspartate kinase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Aspartokinase
total genus 44
structure length 165
sequence length 186
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2012-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01842 ACT ACT domain
X PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go7X02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4go7X01
3OFEA 3LOUA 1SC6A 1M0SA 5FIIA 3TUJC 3ENWA 3OFHA 1PSDA 4IO1A 2P9GA 2P9CA 1KS2A 5IS2A 3MWBA 3P96A 3TUIC 3OFGA 1LK5A 5IT4A 3HHEA 1Y7PA 3AB4B 3ENQA 1UJ4A 3OFFA 3KWMA 1O8BA 3UW1A 3W7BA 5T41A 2QRRA 2RQKA 3DC2A 3NRBA 3DDNA 2CDQA 1LK7A 2DTJA 2KO1A 2MDAA 4GMKA 2RE1A 2JHEA 5IT0A 3DHWC 3MAHA 3OBIA 4PWUA 1ZPVA 2JOQA 2DT9A 2I9SA 3ENVA 4GO7X 3K5PA 2PA3A 4LUBA 1XTZA 1YBAA 5JJBA 4M8LA 3N0VA 3AAWB 2QMWA 4NMLA 3LUYA 2F1FA 1YGYA 2J0WA 1LKZA 2PC6A 2FGCA 2H9ZA 3AB2B 3S1TA 3IXQA 2QMXA 3MTJA 2F8MA 2LVWA 1UJ6A 2RQMA 3O1LA 3IBWA 3DHXA 2QSWA 2LQJA 2J0XA 4GO5X 2ZHOA 3L7OA 1UJ5A 1U8SA 3TUZC 3CEDA 2P9EA 2NYIA 1RWUA 4X84A 3U7JA
chains in the Genus database with same CATH superfamily
4RL1A 2OAUA 3W5XA 1R8CA 2H5JB 2UVRA 1FVSA 1RB0A 1SC6A 1WG4A 3G8TA 4LF8J 5AXKA 1WI8A 3NEKA 5KFEA 3I5AA 1F5CA 3CCLS 3CJKB 4B9VA 3LAKA 4FXDA 4USWA 1IKVB 1NK7A 4OHYA 1MSWD 2ZH9A 5IT9Y 4USJC 3M8SA 2QLWA 3RRKA 3K5MA 1ZM3A 2KHDA 5HL7Q 2R2TA 1Z1ZA 5KG5A 1VQ5S 4PG5A 3DXSX 1JLBB 4OX9F 1PJ6A 2EK1A 2MPUA 3DGVA 3VVUA 1X5PA 2GHPA 3C16B 2B7CB 1HQUB 1WOPA 3DN9A 4KGVB 3KUEA 4TXSA 2N3OA 2B4VA 3BYPA 3ILOA 3HHNB 3H7HB 2KYZA 2BOAA 4EUVA 3OL6A 3UN3A 4DN0A 4KPCA 3MFHA 5D0HA 3NG8A 2DIUA 5KG7A 1CJTB 1WACA 1Q1KA 3KJNB 6FD1A 4A8WA 4ECRA 1LFPA 1SJ1A 2IFXA 1RK8A 4MYUA 2DNZA 2MKYA 2ZVIA 1FTRA 3GFHA 2HZVA 4N7TA 3OW2R 1LW2A 3GFZA 5KFCA 3GFXA 4U95A 5B0CA 2F5GA 3CPWR 3Q89A 1GMUA 1S7IA 2FDNA 1FJGF 4ANCA 2XZDB 1HBUA 1NHVA 1BMQB 2MQMA 2HZCA 2YPZA 4NA1A 4Q44A 3UR0A 1DQ8A 3JSMB 5I42A 1NH7A 1CS4B 4N76A 4ZOSA 5HK4A 4CLFA 1F2HA 3PKYA 4KV8A 1I5OB 1ZAVA 4GVBB 2HVIA 4NYOA 4Y2KA 3RRHA 5HLFB 5KT2A 1YJNS 2YX7A 2DBBA 3G6XA 2XCAA 2DPIA 1JLAB 4F67A 3R6GB 4F4KA 2B5JB 1RT3A 4PQUA 3X1LB 3KLEB 2XI3A 5B0DA 1N32F 5HMYA 5EUHA 2UXCJ 4K4XA 1W2BR 2UV8G 1I6JA 2JHEA 4K7QA 2R7UA 3RBXA 3J80Y 4QZVB 2QA1A 4HT5A 1CJVA 2QZ8A 4HTIA 4CTAA 1TUWA 1WF1A 2IM1A 1ZM2A 4JI4F 2HNZB 2DB1A 3KXDA 3VAFA 5C2GA 1B70B 3MAAA 4MTPA 3V6DB 3PW4A 2NQPA 2J7UA 2HQCA 4DS4A 1ZTWA 2HHSA 1UWAA 1Y5NB 4ZPTR 3FCWA 1FRKA 2VC1A 3QIPB 4WZMA 3VGTA 1F3FA 3IGNA 3GU0A 1WG1A 3EMTA 2ZNZA 3OTBA 2OMLA 3AA9A 1T9YA 3PG9A 4KO0B 1IJFB 2QFIA 8RUCA 5KFBA 1XC9A 2LEAA 3I96A 2C2KB 4MKVA 5JJBA 1JKHA 3M2RA 3H90A 4ZIVA 2ZE2B 2E9ZA 1HYSA 2YVSA 1PBUA 4WXOA 1EP4A 3I0RA 3MFIA 1OPZA 2EFNA 2F1FA 4WP9A 1MROB 4MFBB 2J0WA 5EX3A 2QEXS 3SMZA 1H7WA 3MM6A 5DG8A 1JWWA 3ET6A 3R6LB 3G8SA 4OI4A 2DCLA 1JLFB 1TU0B 1I94J 3IM8A 3QGPA 3DOMB 2FJEB 4DV2J 5HATA 1C0TA 4WK1A 3R7NB 2NPIA 2AEFA 1P27B 1RHRB 3BGUA 2BXJA 4NXMF 3HD2A 1FD8A 1VYAA 3I9V9 3M2UB 2VICA 4DL6A 3HHLC 4Y65A 2LVWA 1HBOA 3AQOA 1QTNB 3O1LA 4LSNB 4WFYA 3T9NA 4QWCA 1S0OA 1RCOB 3CD6S 4WYLA 4DZ6A 5ADZA 2BANA 5JVHQ 3TRGA 5JXSA 4ED6A 3GIMA 1JXVA 1VC6A 2ADBA 1RT4A 1TTHB 1KWMA 1RTZA 2P5VA 5F8GA 1I94F 1J5EJ 1SVDA 2OI2A 1CBKA 4X2BA 4W98A 4A8SA 2ZUGA 4GRSA 2OPRA 3WIUA 1HI1A 2HG4A 1HNXF 2DGTA 2VBZA 3CCSS 2RUSA 1FKOA 1KR4A 3DLHA 1WI6A 1VQSA 2ROGA 3H2VE 3VALA 3IBCB 1RI7A 5L46A 1XBWA 4RNFA 2XQCA 1XR7A 3SYZA 4B3SF 3LALA 1EAYC 3K57A 5I3PA 1Y7PA 3PYGA 1F9HA 1S4FA 2RRNA 4I69A 3AB4B 3D66A 4GVLA 3GONA 5B0GA 5J1PA 1VQLS 4LBPA 3OFFA 4UY8T 2Y1RI 2DRDA 4RW4B 3NCRA 4QIWD 4WIIA 1FCAA 5G0RB 4CDIA 5F8MA 5CXTA 1N32J 2IRXA 2D69A 2GAHC 3KWMA 2YBVA 2BOPA 1OMSA 2YPYA 4DPOA 4QYZJ 1XMQF 2L9DA 2I5JB 4UF4A 1TK8A 1ROFA 3QLHA 3H5XA 2GIFA 2LYVA 3MD3A 2RS8A 4LRCA 1NDCA 2LDYA 4DR4J 3HKWA 5HJXA 3GV5B 2C28A 1HWLA 1HWUA 3NRBA 1KTQA 1YK9A 2O66A 4WJBA 2ZHAA 4NLVA 3C8YA 4FYXB 3Q86A 1BXNA 4B3OB 4RBVA 1FWPA 5FDLA 4HACB 3BJYA 1FRMA 2NZ4A 3ILLA 3PACA 4FYVB 2GJIA 3LWMA 3BO2A 2V8HA 3WC0A 2X1AA 2ASLA 4I67A 4X4NA 1YRTA 4UZCA 5DRKA 3TEHB 3K5NA 4XAKA 2MKCA 3D3BJ 3DNCA 2E9RX 3W66A 1HPZB 1PKUA 2DCUB 3BZQA 2K2PA 3K7RA 4YY3F 5ETKA 1NZ8A 1HR0J 3OTCA 4CH1A 5C24B 1U2CA 3IS9B 4X4TA 2OPSA 4OLPA 2NPFA 1UVJA 1R8AA 3KLIB 4H4MA 3QZ7A 3Q22A 2DNRA 5HVFA 5IWAF 4OX9J 2HFUA 4HTJA 4B08A 3AOAA 1S6PB 1VFJA 2IJRA 4P75A 2AYGA 1Y3KA 1EIYB 4LF4J 1S6UA 5LSOA 4JV5F 2D1CA 1VQ4S 1X0FA 5A0YA 2QL9B 1FJEB 3TZZA 1RJJA 4BHQA 3M9NB 3JSMA 1SPBP 3DYAA 1VK3A 2M3DA 4AL5A 2YQ0A 1RXOB 1KVKA 1GMVA 4YR3A 4DFJA 2I1RA 1QAXA 4QIEA 3P49B 3UDLA 3OHAA 3J81U 1J2VA 1NO8A 1SH0A 4ZVFA 1RA6A 5E3CA 4CWBA 3IWNC 5KFSA 2ZBRA 3GJTB 3HM9A 1XK8A 1PGZA 3MMBA 4BCAA 1IM4A 1PJ5A 2DKOB 2WSFC 2X51A 3O8WA 2AW0A 3PRDA 3OL8A 1RHUB 2J9DA 3IM9A 4C3KA 5A2QY 2ZM6F 2C2EA 4Q2MA 4ECTA 4Y2MA 5J2PA 1VRUA 1KHVA 3MM7B 4L73A 2FZKB 2ZBCA 3KG0A 2BKPA 4EU0A 1S12A 3KJFB 2CPJA 4USHA 3QYYA 1MN7A 4NLTA 1JXEA 4A47A 1RU2A 2H48B 3C6UA 3PRVA 4DQIA 3FUYA 3V6DA 4KFBB 4EK2A 2J5AA 4PCQA 1DTTA 2XHCA 4H4OB 3ZTRA 1V3ZA 3QIPA 1IR0A 5ITHA 2VFTA 3CNQP 4QJVA 2HSEB 4CLWA 3M2VA 1LWFB 1RWUA 2CRLA 3J81Y 4OYMA 2ZC4A 2WVBA 1IKWA 2W4PA 4TU8A 4WTYA 1CPZA 5HROB 4LF1A 3EM1A 2F63A 3TUJC 2IAJA 3A8IA 2VL1A 3CCTA 2V2QA 1HD0A 3HHLB 4HI1A 3EDRB 8AT1B 1PAEX 1RT2A 2VQEJ 2A6OA 3OVBA 3FBCA 1FKPA 1X9MA 4CLKA 1FRIA 5GVQA 5KFTA 5ETOA 4LSZB 5HSPA 4DV6F 1S1XA 2FLOA 3G86A 3CULA 1B0TA 3TUIC 4F7VA 3NKYA 2E9TA 2VONA 2RB7A 5L1KA 4IRDA 2OPPA 3OTDA 3PFOA 4HHJA 1UA0A 1N36F 3IRXA 1KLMB 4CLZA 1CQNA 4DR3J 4FF1A 3G9CA 3WX4A 1HMVB 2AEJA 3FRZA 4FVMA 2L41A 2WOMB 1FWLA 2IC3A 3L95X 4P52A 4DR2F 2VJVA 5LMUF 2FJXA 3FSYA 1VK8A 2APOA 3QWPA 5JVGQ 2UUAJ 4P2FA 4EZ9A 3BBBA 2B7BB 3FKBA 1SV5B 2H4YB 3V4MA 1GAOA 4I4BA 2CPHA 4DR6J 1RBAA 4NYZA 4ZPCA 1K1SA 3KJVA 4DV5J 4DL3A 4BLGA 1T9UA 2CPYA 1TMJA 3UW1A 1IM6A 2Y1LB 4AXIA 3NAHA 3C3LA 2EC0A 1CULA 2RQKA 2CPDA 1KQGB 2RDDA 3MM9B 2QIFA 5MAOA 2W9AA 3HD1A 1TK5A 4RU9A 3W3SA 1Q8LA 2OSRA 3EDQB 1WKLA 4OYXA 4P73A 2DH7A 3BEGB 2EFGA 2UZAA 4ZJOA 1UVIA 3JSYA 3H5SA 4A48A 5DDQC 1N33J 3MCNA 1EETA 3RW6A 3NY0A 3J7YI 1NDPA 2XB2D 2C42A 2PEHA 1QAYA 3MM8A 3SFUA 4F8RA 3KYLA 4GKJJ 1BC6A 2B6AA 1KD1T 2UP1A 2CVEA 3P45B 1MU2A 5M2RA 4LVNP 2XY7A 2X7IA 3TAPA 1RTIB 3CJSA 3G82A 3N5BA 4CLYA 3OLAA 3PIOQ 1RAOA 3BR8A 4WYWA 1X31C 1H2TZ 2B4UA 2ROPA 2NXUA 1HFEL 4CLLA 1TL3B 2A2DA 2W9CB 3N6MA 3Q8PB 3N6LA 3RZAA 1GFWB 1KHWA 1VC5A 4C9DA 3MMCA 5E33A 2M8DB 4B3TJ 3AY0A 3PX0A 2R7RA 1RSCA 3BSCA 2CNOB 3DGPB 2HHQA 4F0HA 2VB6A 3T1YJ 1VIOA 1WC0A 3OD2A 3QAEA 3TJAA 4C8KA 3DU5A 2YH0A 3QLHB 4YDXA 1CEZA 5IXUA 3C14A 5J2QB 1NUEA 4JI8F 2B9WA 2DH9A 4L3KA 2XHWA 4B02A 1N0VC 4HH0A 4ES3A 2RU9A 2OUGA 3B4DA 5LSRA 4K4VA 1UTAA 2YNFA 2ZH6A 1BQNA 2OD4A 3PW0A 1B64A 5F0UA 4F4ZA 2JDJA 3ZZPA 2Z2MA 3G4SS 4NEZA 2J9DE 1HNVB 1R7IA 3C15B 3IXQA 1RBLA 4L72B 5D0EA 3W2WB 4LIRA 2DYAA 2LXIA 1RACB 4C7QA 1B4SA 4L3NA 3BF4A 2V2ZA 1YBUA 4IG0A 4NZ6A 2C1EB 2CDRB 1PYOB 1VISA 3N01A 2B8QA 4FKXA 3W65A 2CJXB 2JC1A 4ANEA 2AKWB 3CUNA 4MYTA 4NL5A 1N56A 4DLGA 5KFDA 4MK9A 2CJBA 1DURA 3VAMA 2J9CA 2ACMA 2WB4A 3HDSA 1VRTA 2CQ1A 1QY7A 2XMAA 2DGSA 2V2KA 3V6HA 1CJKA 4K4SA 2P9EA 4NLUA 2EBGA 1DY3A 4KKOB 1FEHA 4X84A 3VQTA 2QO3A 4A8KA 1S9FA 1FXDA 2DEIA 3U7JA 3SV4A 4MMOA 2BQUA 4ZVSB 4DR5J 1HNZF 5AE3A 3R2CJ 2R7XA 3MHYA 2U1AA 4H4KA 5A8WA 5GADU 3RR7A 3PY8A 2JLEA 4LF5J 1VGYA 1UEKA 1Z2ZA 2F3JA 2Z30B 7AT1B 5HBMB 4MAKA 1B0VA 1S1WB 4WU2A 1U2FA 4K2XA 1KRPA 2RT3A 4AE5A 2DR8A 1TAUA 1Y0HA 1JLGB 3P96A 3G71S 3CCES 3DOKB 2EW9A 4OZ1A 5C2CA 2QLBB 3CIMA 2XLJA 5F3TA 3WZ0A 2OEKA 4CQ1A 2YKNA 4I6WA 1AUDA 2UUBJ 5EWGA 3E3XA 1NPKA 4G1QA 1M1GA 4IYQA 5EX0A 2GGPB 3Q23A 4NLXA 1C1BA 4P71A 3HFKA 1KEKA 2KRRA 3J80U 1SJRA 4I6YA 5DDRC 1ZBTA 3R5BA 3T1HJ 1OY9A 3TUPA 1T9XA 3G6YA 1K0TA 3SZ2A 2K8GA 1QE1A 4F26A 1YX2A 3I0SA 4RBTA 3H42A 1S48A 4B9NA 3ZZTA 3TQ1A 2AU0A 2J7WA 2ZH8A 1PC5A 1W25A 4KE5A 4OYIA 4ECXA 1RTJB 4QOTA 5KOXA 5BR8F 2HW3A 2IJFA 1OYDA 3QQCD 5C42A 3T1HF 1S6QA 1V9OA 2KT3A 2VPYB 5KG2A 1RLDA 4F50A 2HHHJ 1FERA 3MEGB 3HHLA 1WEZA 3KG1A 1RHKB 2VPXB 3MAAB 3SCKE 2PI5A 5DG7A 3KHGA 1ELOA 2MKJA 3GG1A 2BKOA 3ZZRA 3FMBA 4WFXA 3DLEA 2R7WA 1Y00A 4KO0A 3OT9A 4QR1A 3ZTSA 1EKSA 1R0AA 4OYAA 3NNAA 1U6ZA 2BZ2A 2ILYA 3FZ2A 8ATCB 3M32B 2BACA 3ISZA 3O2IA 3L3CA 2HIYA 3SIPB 3R1HA 2K7KA 2Z2ZA 1U49A 2X1GA 4IR1A 2ZZTA 5GMEA 2KRBA 1H3DA 2JOQA 4LF8F 1FRXA 3ENVA 2JVOA 3QIDA 1HNZJ 3K5PA 1NCLA 5KT6A 5LM7E 3RGIA 3A1YG 1TL4A 4TYAA 2FC8A 5H1SV 3DOLA 3IMQJ 4M5GA 1C0TB 1TL1A 3BH6B 1IBMF 3IC1A 2CPZA 4ILLA 4DR1J 2IDEA 3D68A 4QWAA 3MMAA 4C8LA 1CULB 3MM9A 3R3TA 1L3UA 5EWFA 3UE2A 4AUKA 3RG6A 1X4CA 4USMA 2KXFA 3ZZYA 1FE4A 2HLUA 2RSQA 4ILRA 1SKWA 2W8LA 4WFBQ 2FGCA 2VQFJ 3PW2A 1VQ7S 2W7PA 4FYYB 2D9OA 4FBTA 2MY8A 3LA0A 3DRRA 3MTJA 4Z7YA 2KVQE 1MU2B 4EGLA 2HS3A 3VGUA 1TR0A 2HEKA 1AT1B 4KJIA 1S1UA 2IRUA 2AJFE 2BMBA 4DFPA 2H65B 1KOHA 3TZXA 4C98A 2EKNA 4RW8B 3F0NA 3CVKA 1IBCB 4CNYA 5GAGU 5L38A 3QBCA 3IAM9 1CG2A 2H3EB 1FFGB 2W9CA 1WG5A 4DF8A 2HGNA 5D4PA 4M5KA 4FDFA 3RW7A 2Y9HA 4QWEA 5L9NA 4GC7A 3NP5A 1OJ4A 3J7ZT 4LF6J 3BSAA 2CXEA 5KTQA 4ZP6A 4N41A 3DGPA 5AT1B 5DGBA 1FKAF 2MMYA 1R0BG 3BO3A 4PG7A 3DRSA 2X3GA 3SBMA 4C4WA 4ZIWA 4OV1A 5F41A 3ZXWA 4HYKA 3W2VB 2V67A 1VQ9S 2VBWA 4HLBA 3W5ZA 1U0HA 5FLXU 1HW9A 4LRFA 4U96A 4ECVA 2UVVA 1G2EA 3HHDA 1ZAWA 2NXEA 3M6WA 4DU8A 2H54B 2HWHA 4TU7A 4EZ6A 1SCJB 2RJZA 4E2FB 5A8RB 1BQNB 2XBPA 3MURP 4ECUA 3SQGB 4O3SA 1BUXA 3BYRA 4KGZB 2VA2A 1SI9A 1HNVA 2NXNA 1KQSR 3CE8A 1X4HA 4Y0FA 2I2YA 3K8VA 3G6VA 2NXCA 3I87A 1UPMB 2VPZB 4TN2A 3TX8A 1T3OA 4J9RA 1N6QA 1N33F 1X4DA 4J7CA 1T05B 1SKRA 4B3OA 1BQXA 3I4HX 4MJKA 4F4AA 2B4OA 2DGQA 3D4JA 1VOMA 4C0OC 2HBZB 4CO4A 4XO0A 4TU9A 5KFRA 4DWIA 4R0EA 1X9WA 4JI0F 2VIHA 4DUTA 4Y2CA 1AA1B 5T14A 4RKUC 2YNGA 4AT1B 1UW4A 2DNLA 4RO0A 4ECWA 3BH7B 3PW5A 1K73T 2HK3A 3SSQA 1BQMB 4PXDA 2FLLA 3MGJA 2R2RA 3SFGA 2VU5A 3RBEA 1TVRA 3V81A 1AFJA 4YN3B 2I38A 1HPZA 5A8WB 5CCMA 3WHIA 5EWEA 4F36A 5KFPA 3HULA 4DR2J 2OPSB 2VV5A 3RR8A 4ZVEA 4DHVA 1OS5A 1YZ6A 4DR3F 4LRAA 4Q5VA 1U1PA 3K58A 1HBMA 1JLBA 1H98A 2JVRA 3EX7B 2G13A 2Z4PA 3QMQA 1HQUA 3PV8A 2EFOA 4C11A 1X7VA 2YKNB 3Q83A 1YBTA 2F7VA 3W61A 1FNMA 1QJHA 1QUPA 3B4MA 3LWLA 1U4BA 2HURA 2KDOA 2RHQB 4DR7F 2C3YA 1MN9A 4I2QB 3ZZOA 5HO4A 3OSPA 2CJYB 2O67A 3C19A 4B9UA 4Y34A 2IBKA 3RU0A 3TEGA 1S9EB 2UVUA 1BWVA 3MF5A 5AXMA 1N8RT 2BE7D 1S1VB 4OYPA 2EFQA 4P7TA 3MR3A 2JSXA 4U8YA 2F40A 3W9HA 4M5IA 3OTEA 2DNYA 5C7PA 1WKJA 5D3GB 2F9JA 1HBUB 4FYDA 4QR2A 1RAHB 3HPOA 3QO9A 3B6BA 3UD3P 1O0PA 5HANA 3CSKA 1L3KA 3LUYA 3PEHA 1CLFA 1KTVA 1REGX 1RISA 2CA9A 2C3OA 2LXFA 3MM7A 3NS6A 3UVJA 3QZ8A 3MR6A 1S6QB 4PXCA 1B3TA 1MLAA 3F73A 4NYPA 4Y6IA 2IVYA 1WSVA 2HFSA 2XYGB 2HHPA 3GR0A 2E44A 2ZM6J 2FHOB 3ZZZA 3IFEA 1NHKL 2RRBA 4K50A 2YWGA 2R8HA 3AFGA 3GV8B 2ZH4A 4PZVA 4C3MA 1L3VA 4KPYA 4RW7B 4NASA 4U7UK 1RAGB 3CCRS 4JI7F 4CO3A 1H2VZ 4USTA 2RF2A 4FPRA 5DGAA 1YDLA 4V19J 1VJQA 1F9EB 1X9SA 4F02A 2XO7A 2ZH2A 5KG3A 1RT2B 4PG8A 4N47A 2DNKA 3TUZC 1FKPB 2VJUA 4L75A 2J6TA 1WNEA 1RU1A 4ZN1A 3W63A 3OJSA 2RAQA 1R8PA 5DLFA 5B7WA 2DR9A 5K14A 2V69A 3T3FA 3BM7A 3OFEA 4FXVA 5I3QA 3K59A 1C4CA 2OPPB 3A8KA 5D8HB 1M0SA 4AYBD 1HNWJ 4Z2XA 2PE8A 5CH7B 1JJ4A 1KQFB 2XULA 4PXBA 4K8RA 5ETRA 3FZBA 4EEYA 4Q45A 2KB2A 2MKSA 2VKZG 1U1RA 2NREA 3CMES 2G0JA 5BYRA 4RLEA 1KFSA 4UTGA 1SV5A 1Z4UA 2FHKA 4I1TA 1JIHA 1LQ9A 2KU7A 3DOMA 1VQOS 3GE9A 2VOOA 2R8KA 4IRCA 4J9UE 2XO6A 4DJBA 5D6GA 3EE3A 3SQOP 1FJCA 3UN5A 3H59A 3G87A 2HMIA 3CD5A 2BJ1A 4USIA 1FXRA 1RT7A 2EVZA 1S1UB 4B17A 3GILA 5K8PA 3DFEA 2ZWOA 2CZ4A 1CSJA 2DRBA 2DHSA 4ZVPB 3THTA 1NPPA 4QU7A 4LR9A 2MJUA 3QWUA 3EWGA 1SC1B 2XZTB 4X4QA 3CW2C 2PD1A 2V4RA 2B6AB 4RR5A 1GTHA 2PEBA 2KFNA 3NMRA 4ZVTB 4KGKA 4ZKAA 1D3WA 3M4XA 5ETMA 3G82B 5CD4A 3NNHA 1WOOA 2CDQA 4KRWA 3W9JA 4DU7A 4ILMA 4ZLLA 2XMTA 1TQLA 4RJVA 4RWXA 5D15A 1Q5YA 3PM9A 2JLGA 1D9FA 2FLPA 1GNKA 2UUCJ 4O44A 5E7OB 5B0EA 3TAMB 1FKOB 1OQ6A 3J81j 1JXLA 3HKZD 4QIVA 3UNYA 2G0CA 1UVKA 4DX5A 4QYRA 1UVMA 5CCLA 2B4PA 3PKMA 1HW8A 4DCPB 5K20B 3HMJG 4F2SA 4QQBA 3KLHA 3KG4A 2DGUA 3UI3A 4RU2A 2DJWA 4L74A 1RAFB 2MKHA 2DXDA 3IG1A 5IV4A 2KFZA 2AJ0A 3BN4A 2GVDA 4IH5A 2FVSA 2MLYA 2EFVA 1NK0A 3M8PB 2XS2A 1FDDA 1GXLA 2QL7B 3Q0AA 1JJCB 3IBFB 4KHRA 4RW9B 4EBEA 1CQMA 2YNFB 2LEPA 4Q7AA 5CYMB 2LEBA 1ZA2B 3I55S 4X66F 2EWHA 2MB0B 2DH8A 3C15A 3N0VA 5DDPC 1JLQA 2HNDB 2F8EX 4O3PA 1SKUB 1RAEB 1U24A 4PG4A 3Q8SB 2IMWP 4DX8H 3G6ES 3QT7A 4KQZA 4HACA 4DSLA 1XR5A 2W2PP 3VTIA 2F4VJ 2W1BA 1C2PA 1SB6A 5HI7A 1JJ2R 3BGLA 1C1CA 1U2RA 2GA7A 2YTCA 3GZ7A 3KMSA 2FVCA 3X3UA 4DUYF 4JI8J 2W9BA 3D0IE 4CLTA 4LF6F 1LFWA 1C0UB 1VDHA 4ED7A 1RABB 2ZDOA 4K0KJ 2OO4A 3W5YA 4LRDA 5E3PA 3TA1A 1NSKL 4UZBA 2QSWA 2LQJA 3T1YF 4K4ZA 1RUSA 2QMUB 2H5IB 4JI3J 3SI8A 3HCXA 4O4RA 4C11B 3CJKA 2E66A 2V4JB 3UDVA 5C24A 1UJ5A 4FF4A 4DF4A 1TMMA 1FE0A 1H0HB 1BY9A 1UWBB 1AYEA 2H1YA 4C2MA 1S1TB 4KB7A 1HBNA 2E29A 4RUHA 3NWRA 1SBRA 4M1KA 2NYIA 3GLJA 4X4OA 2R9LA 4P9SA 2AYBA 4A8XA 4X4UA 3C16A 3JXOA 2R3VA 4EWTA 4U6PA 5FIIA 3AD9C 5D3GA 4OIXA 2HIQA 1BWEA 2HHVA 4PYDA 2P9CA 1HHTP 3DYAB 1YTYA 2BE9B 4O23A 3BO4A 1CJTA 2ZBPA 2MQQA 1C1BB 3D54A 2AZ3A 2F8HA 2O3DA 3E51A 4TY9A 4U7CA 3TANA 3R5CA 2MKIA 4LF9J 4P2MA 4PABA 3EVWA 1VQYA 4OHWA 3HO1A 2DNGA 3JSRA 3VVTA 1S97A 2HWTA 2M4MA 3POTA 1WC3A 4DV0F 4DX7A 3TZWA 1LEOA 3OTOF 2CG8A 5HN0A 3MR2A 2W2MP 3KDOA 4DFMA 2QSFA 2OGUA 4KGXB 2N7CA 4BDPA 2JEJA 2XI2A 1S10A 4ZP9A 2NYHA 4AL7A 1RTJA 1VIXA 1X60A 4QCLA 2M88A 3FSXA 5CABA 2EK6A 1RADB 5MLCV 3H2UB 2H5EA 5C42B 4WBFA 4IOCQ 4BWMA 1Q81T 2RF2B 3MM5A 4FXWA 1CVJA 3C6UB 1HD1A 2GCFA 3HSDA 4ZPBA 3MEGA 1Q16B 3MR7A 1A7GE 3KHRA 4HKQA 3HSJA 4CYUA 5L8RC 4KT0C 3BSNA 5K8MA 5AE2A 4YP3A 3J7AN 2PDAA 1TKZA 4MKAA 2MSSA 4ZVGA 4X4PA 2WVEA 4A8FA 3EGZA 2IVMA 2IRYA 2QA2A 3CO9A 3NGRA 1ULRA 3NGUA 3BDPA 4C8OA 1IKWB 1F6TA 3LTOA 4P2XA 4JV2A 3MXHP 3BGRA 1CJVB 3MZIA 4KHMA 3N6NA 1R0AB 1DRZA 2HHHF 1FRLA 1JMTA 4LSLB 1HA1A 2MZTA 2NUUG 4JI5J 3J7A1 1ZYQA 2DTJA 4DQPA 2MEWA 2CVIA 1N5TA 3MUTP 3DLBA 3A8JA 5BR8J 1R0CB 5IQQA 1TV6B 4GMKA 1U6FA 1P1LA 2FTRA 2GMLA 2KJWA 3GSDA 4X65F 3B8HA 2RE1A 1VBKA 4ETZA 1XN9A 2MZRA 4CM2A 3KLVA 1NRKA 2WSEC 5L1IA 1RYSA 2HHXA 3CCQS 3CJTA 3I6PA 4OYZA 3IRXB 3HLUA 3SEOA 4DLEA 2G9OA 2IC3B 2D41A 2OLWA 2HQ3A 3H0PA 4ZS6A 5KFXA 4HL9A 1QVFR 4FNHA 3EGVA 4Y28C 2XYHB 4C8MA 4ALZA 2AEMA 2BW7A 1TK0A 1R8BA 3MD1A 4NLYA 4AL6A 2QLJB 4PPDA 2Q6CA 4F2RA 4FF3A 4FP9A 3KJVB 3DXBA 1PCAA 4O3OA 4NE9C 4M8LA 3NBPB 3KDNA 4FPIA 3PHEA 3RB4A 3CCMS 2D3ZA 2HQDA 5BJRA 1U6BA 3JQKA 6AT1B 2FZCB 2YNIA 3M2UA 4U67Q 1X4GA 2Y0BB 3Q8VA 2V8VA 3KMQA 3MI7X 1F5BA 4BWJA 1NZAA 4TVAB 2OEJA 2RRAA 1IQZA 3Q8YA 1SIZA 4AQYJ 5F9LA 1C4AA 4IH7A 3TA0A 1VBXA 5H9FJ 3A8EA 2XMUA 1KVJA 2IM0A 4O4GB 1K44A 5AJ3J 1R31A 2EG1A 3QGHA 4ZCKA 4O44B 3MCOA 4DI6A 1SUQA 1YQHA 1RP5A 1M5VC 2OHDA 3IAS9 1NB7A 5EDWA 4EO8A 4QU6A 3M1VB 3J7YU 2F8MA 4ZVHA 2ZZMA 5GADI 4P74A 1RTIA 4O3NA 1YSJA 2NLWA 2HVZA 3HSZA 3KLHB 3DRSB 3N9UC 5B0FA 7FD1A 1FNXH 4QIGA 3K5LA 1NB2A 4JI3F 2L48A 5KFUA 5IWAJ 2YNHA 2M5YA 4ECSA 3CWJA 3DM2A 3T5KA 3W2VA 2MZ1A 2LLZA 2GVDB 4KR0B 1U0HB 1EX8A 3MMCB 3VQSA 5RUBA 5KT5A 2WTFA 2BBEA 1N4LA 3WX8A 4K0KF 3H2LA 1TKDA 1ZOTA 1Z2LA 4Z37A 4RW9A 2PFDA 2L9WA 2BJDA 2GZOA 2JX2A 5A8RA 4A4JA 1QAJA 3SQGA 4KBIA 2AQ4A 4FF2A 3RUBL 3H40A 4ZPVR 3KLFA 1ZM9A 2P9GA 1JLQB 2HNDA 2DNPA 2VZ9A 2OPQB 5IS2A 5J2QA 2C2RA 4IH6A 3VGSA 5F8JA 1B99A 2GFFA 4ID8A 2HPUA 2IPOB 5G0RA 1T05A 4M95A 4XK8C 1AXQA 1MWQA 3VHQA 7FDRA 4ZHRA 3CJ4A 2VASA 3C66A 4DUZF 2BQ3A 2C2ZB 1FX2A 3CCWA 2JJ4D 3KHLA 4EBCA 4O3RA 1QM9A 3TNVA 2YNGB 1HWIA 1NPRA 3W2WA 1C0UA 3TX0A 4B3TF 1TFYA 3M9MB 4GKKF 2HBQB 3FC9A 4DSJA 5A8KB 1AROP 3LF0A 5T7LB 4RNNA 4PAAA 2FHJA 2GO8A 4UW2A 4ES1A 5DQIA 3BS9A 3E2EA 2V4JA 5KG6A 1HWJA 1SQFA 3JTPA 3K5OA 4WK3A 2BE2B 1V3RA 2BKNA 4YHHJ 2QFJA 3MPVA 1JLCA 2QRRA 2CQIA 5DQGA 3NXZA 4IRKA 4K4TA 3JAMY 1AB8A 1XIQA 4IDKA 3A4TA 5E3RA 3TJ9A 3ZZUA 4PYAA 1VQPS 2DXEA 1FK9B 4KIAA 3DLKA 1H38A 4IR9A 4DG1B 2MYFA 4F25A 4LBHA 2M2BA 5LL6d 1VBYA 1RYRA 1U26A 2KT5A 3FEYB 4TNOA 5DJBA 3M6VA 1VQ6S 2HVEA 2IYIA 3OV7A 1NJZA 1K8AT 3DOKA 3PRBA 3H98A 1YKWA 4NI2B 4XDDA 2HNYA 2Z0GA 5D78A 4DL7A 4F3OA 4LMZA 4CT9A 2HHTA 4A46A 3BDEA 2R2UA 2KTQA 3PJWA 1IKYB 1FTCA 1WSRA 2R8JA 3FEXB 3MPDA 5DO2A 5A0YB 4DEZA 4G1QB 1U47A 4Y2IA 5A2QU 3QO9B 4DFKA 2YKMA 2R7VA 2HQIA 5J1EA 1KP6A 4M63A 3I5CA 3CC7S 1PAUB 3BGOP 1E6YA 5C25A 1CJUB 3AOCA 3FCVA 3NS5A 3RBZA 3D0HE 5I4MA 5LMUJ 3P5TL 2WCXA 5B0BA 2FVQA 2UUAF 2ASYA 1WF0A 4DSFA 2DO0A 5ETSA 2N3LA 4LUBA 4YR2A 5G4DA 4C8NA 3U1LA 4CT8A 3H4DA 2QTWA 4R5PB 1N36J 3DRPA 4JI2F 3GTYX 3MEDA 3I4PA 4IFYA 3MPUB 3PDNA 3OHBA 1VR6A 1UW9A 2L08A 3D1OA 2J6SA 4QWBA 4DQSA 1GMWA 5J2PB 2P2CB 4RW7A 4DN9A 1LKZA 9ATCB 3UCGA 3OUYA 4F3QA 4OI3A 4OYBA 4KC5A 5CHCB 4K4WA 2QYCA 2AD9A 1S0NA 1RWNB 1X4FA 2OSQA 2POKA 1WORA 1VQKS 4WZQA 1HNWF 1Y5IB 2WHOA 4NEYA 4PXEA 1PYTA 4YS2A 4ECQA 2QC3A 2B9EA 5EHHA 3VZIA 3MEEB 4NZ7A 1YJ7A 2FZGB 4OJGA 2DO4A 2AYEA 3JTOA 5K14B 3PXGa 3DLEB 5AXLA 3DHXA 1S6OA 2J0XA 5B09A 2HAFA 2ZOGA 5LXYA 2CJKA 2CPFA 2SXLA 1FDBA 4JV0A 1SQEA 2YY3A 4LFAJ 1ZA1B 4JB8B 3MR5A 4MIWA 1L3SA 5DZ7A 2CUYA 3CJRA 4G65A 2CQCA 4IOBA 2LA4A 2ABYA 3H20A 5HJYA 3PEJA 3VAKA 3T5HA 1G7CB 5E41A 2LKZA 2LCWA 4U8VA 1RTDB 3QFHA 4IFVB 2CQDA 2JH3A 4WE1B 4EMDA 3TZYA 1QDUB 1NAQA 3DOLB 3VGVA 1TL1B 2DITA 3ENWA 3OFHA 1PSDA 3OXGA 3RAQA 5KFIA 3KK1A 1FA0A 3E01B 5IM0A 3TAQA 2HMIB 3MWBA 2IIHA 2JFKA 2H4WB 3SDEB 1RWWB 1Q7LB 2HKEA 2FUG9 3PO4A 4AXJA 4JV5J 1NKEA 2RUGA 4OI6A 3IR6B 4O4GA 1WHXA 4TKTA 2FHJD 5IZHA 2WBMA 2W7AA 3OSNA 2B51A 2PT0A 2K1RB 1SL1A 2J6UA 3P6YC 3M1VA 2DNMA 3PFEA 4DDFA 4EYIB 1PO6A 3KLGB 3DLJA 2VODA 1TUVA 2C2NA 2WAQD 2N82B 2QA4G 4NCGB 2HS0A 2QGFB 2XWXA 4YY3J 1EETB 1N5YA 3QNWB 5E3QA 4J91A 2BABA 3MM8B 5BYSA 2AIRB 3MCSA 2FY1A 1OWXA 3DM2B 4AFFA 3HP6A 3SV3A 2ZJQQ 2GJ2A 2B3TB 2XMJA 3GB0A 4LIWA 4AD6A 4B9MA 1RHJB 1WJ9A 1I3OB 3HVAA 1NK4A 1IBLJ 3TOQA 1MG7A 3CJ5A 3CO0P 2VOPA 1LK7A 2CIMA 3LW5C 4P7VA 1REVA 2PMWA 4Q8EA 3R2DJ 2FHMA 1UZHA 4K5RA 4UQGA 4B3MJ 2KO1A 2E5IA 4ITSA 2CNKB 1M1KT 1WC6A 4J5OA 1LW0A 5K9FA 4PR6A 4ZLJA 2Y8YA 3QGIA 1UFKA 3P3DA 2ZKUA 2DNNA 2PFFB 2AF6A 2BYCA 2WK4A 4HHHA 4ZITA 2U2FA 1D8YA 4JI0J 3T6JA 1AZSA 4NOHA 2GW8A 4DR5F 4ZHRB 5F8HA 3RAXA 3JQJA 1XMQJ 2PI4A 4UUWA 3OTOJ 3CC4S 1S0VA 1YJVA 3AODA 3KK3B 2IDLA 5E5NA 2PGCA 3HJVA 3QRPA 4WIQA 2ZJPQ 3S7RA 1L3TA 3IWLA 4Q8FA 1FJ7A 4LF9F 2B8PA 3G8QA 4MH8A 2VBXA 4IUFA 2KM8B 1LNQA 2AWZA 4XPCA 4M5HA 1T11A 4X62F 1DBDA 3AAWB 2KH9A 2VG7A 2OD6A 1BQMA 1QSYA 2L3MA 1Y9OA 4R8UA 4IDKB 4BC7A 3EVOA 4IG0B 1QVGR 1JK9B 1TVRB 2C2MB 3V81B 3NAIA 1LWEB 3AB2B 1O6XA 3BPSP 3UQSA 5IT9U 4C0BA 1Y4ZB 1UWBA 4QR0A 1RCXB 4FNIA 1GK8A 4RBUA 1LOUA 2UUTA 2WONA 1HBNB 4ZVQB 4J9NA 1J5EF 2D9PA 2MZQA 4KGMA 1HBMB 3ZZ0A 4ZPDA 1ZPWX 2XMWA 3D28A 4CLUA 1ZETA 1GH8A 1K1QA 2R7TA 4ZVUB 4DUYJ 1HKAA 3L7OA 2VKRA 3I82A 4A8YA 3RRGA 4NXNJ 1KNZA 4I2QA 2FJVA 1DTQB 2Y1JA 3G96A 1R43A 1VBZA 1KDNA 4C97A 3VAGA 1YITS 1E6YB 1DAXA 5C25B 2RDJA 3MDFA 3UCZP 2BJ9A 3CJ3A 4X64F 2E5LJ 4NXMJ 2WSCC 3L9ZA 4XPEA 1S1VA 2BDPA 1DQAA 3B82A 1IR1A 1Y3JA 4DOZA 4DV2F 2DNOA 4NCAA 3PIPQ 2W2NP 5H9EJ 4X66J 1U1NA 1V5VA 2MTLA 4KTQA 3CT9A 3JQMA 1YLXA 2LECA 4OJ1A 2GGPA 2E5GA 1FD2A 5IC4B 4KH1B 5J2MB 3UVJB 3DLLQ 2VBYA 2MQLA 2D3UA 2Z57B 1SIWB 1IXKA 3QJJA 4V1Ak 5E0OA 1QE1B 3KK3A 4I68A 3A3NB 4HH1A 3LP0B 3KK2A 3LGHA 1WTBA 1S7HA 2JEIA 2R42A 1PC4A 1TKZB 1S5ZA 2GJFA 3NL0A 1P9QC 5DZ6A 3SCLE 2COLA 3AA8A 4DV5F 1RLCL 3EPIA 3BGRB 3HT3A 1WEYA 3O44A 1NJXA 4B3MF 2BM0A 2V6AA 1APSA 2M9KA 3ADAC 3MOZA 3W7BA 3KHHA 1U48A 3D6HB 2HVDA 4DV1F 4DSIA 2VG5B 3HZGA 2UXCF 3UR3C 1SJFA 4E98A 3OL7A 2P6SA 1SL2A 2OFGX 5SZTA 4LBIA 3T9ZA 3LPEA 1FRHA 1HL6A 2HK2A 3CTRA 3CDEA 3QSIA 1SJ3P 1X8DA 5DLGA 1T02A 5KFNA 1UKUA 4RUBA 1YI2S 3FQLA 4X4VA 2HLTA 3GG0A 3PW7A 4OHXA 2XMVA 3JB9k 4C8YA 3E01A 5IM0B 2C2OB 2KL8A 2LU1A 3L4BC 2RDIA 3ITHB 3EZOA 1BE4A 1S49A 2RH3A 2ZEJA 1S99A 3M6UA 1RGVA 2I8EA 2W01A 5F8LA 4A8QA 2X3DA 1XNRJ 3TW0A 3N79A 2OKQA 2ROEA 1BD6A 3NS7B 2PMZD 4LR8A 1YJ9S 4ZA1A 2M8HA 2XMMA 3D3CJ 5KFMA 2K7JA 1UAWA 3TVYA 2YNIB 1SH3A 3A13A 1UVNA 3PTWA 4D3HA 2DT9A 2I9SA 1DHMA 1E6VB 2MLZA 3KLGA 1S9GA 1FX4A 4GO7X 3Q24A 1Q53A 2CQBA 2PA3A 2VFUA 2XMKA 3D7SB 4OJHA 1M5OC 3US5A 1FESA 1G3OA 1YBAA 4HVZA 4FS2A 2XY5A 1IBKF 3AD8C 4OZ3A 3QT5A 1JLEA 4J37A 4WPAA 3ZTOA 3UCUP 1YZ7A 3DRRB 4LF2A 2AJ1A 3AOBA 1QD1A 3OXLA 2ALZA 2F9DA 2CPIA 1RWMB 2ZH7A 2DHGA 2OP5A 1LWCB 3BV8A 2YQ3A 5L9XA 1KOOA 2YXLA 3M7VA 3QAUA 4WXWA 4CO1A 1T9WA 4ED5A 1TELA 2AGPA 4I6AA 2I6WA 3I31A 2CYYA 4PWWA 2AYMA 2FPHX 2VH7A 4B3RJ 4QYZK 3ONQA 2HZAA 2A10A 4ZPAA 4QW8A 4EFAC 3CMAS 4XIUA 4FVCA 4DSEA 5HMXA 1W7WA 3ZFVA 2E7WA 1TUGB 2V9WA 1UJ6A 3GR1A 2PMHA 3TO8A 1EKRA 2C3MA 2HBYB 4NLPA 4YR0A 4J9PA 4ED1A 4ICLA 3Q8UA 2UU9F 4LF4F 3HHLD 2FGOA 2CAJA 3HXMA 4TLRA 5L1LA 4CO5A 3RBDA 2V68A 2WW4A 1WDDA 2N4DA 2OMOA 2AX0A 3OR2A 2LDIA 5A6WA 4CO0A 1QUVA 4ZCIA 1FO1A 1HNIB 3JYTA 1JQGA 3FQKA 1Y11A 2J8SA 4DQRA 5DM7Q 4Q43A 2CFXA 2AMCB 4ANDA 3HFZB 2J9EA 3QRRA 1P9YA 2MY7A 1ZZNA 2GIQA 1EARA 3GP9A 1D0EA 4JI2J 3M8QB 1LXNA 4PEOA 5JMNA 2J0QD 2KYXA 4OL8A 2BRLA 3I5BA 3C6TA 5B0AA 1S77D 1TKXA 1WKKA 3HI9A 4NLWA 2Y0SD 4W4MA 5A8KA 3PR4A 3VAJA 1U45A 1N34F 3ULHA 3CIZA 1QSSA 4HHUA 3NWGA 2NS1B 1D8ZA 4NZ0A 4Q2LA 5F8IA 3QRQA 4DPUA 3K8WA 5GAEI 3OVSA 1QTMA 1G1XA 4K2JA 5F0WA 2VDIA 3FNNA 3J7Z5 1NSAA 1U25A 3DKDA 1I1GA 1JLCB 4ID5A 2WONB 3PO5A 4DR4F 3OL9A 1UA1A 2DHXA 3MCMA 3IRWP 2AGQA 1YJRA 2V0NA 3H5YA 4O0IA 1GX5A 2NUHA 2JFDA 3EGWB 4I0WA 2V9KA 2HGLA 3DLKB 4YB6A 5ETVA 2OEMA 1UL3A 3GMGA 2VDHA 4HI2A 1NBEB 2AP6A 3FBBA 4DV1J 2VG6B 3OPKA 1DTQA 3D0GE 3WBZA 4F0KA 3H4BA 1I51B 2OH2A 1S1TA 1NKBA 4JBCA 4NI2A 1MMLA 2MJNA 4C48A 2HRYA 4WP3A 2WBRA 1HI0P 1LW2B 4GKJF 1XNRF 5DETA 2GQ2A 3QATA 4YHHF 2BM1A 4ELVA 4WKRA 5L39A 2JEGA 4ETXA 1SQGA 2YKMB 2ZFHA 3DMJA 3N28A 3N5FA 5I42B 1ZTTA 3F44A 5CYJA 2J0SD 4OZJA 1UPPA 4K4YA 1S9EA 2V34A 3ISNC 2MQOA 1HQ2A 3LQVA 3K2YA 2FC9A 3MMJA 4PUOA 1S59A 3POTB 4RZRA 5HLFA 3DHWC 4TLQA 4RUAA 2OFHX 4QW9A 5CYQA 2P6TA 1RZMA 1SC3B 2YX4A 4H4KC 4DUZJ 2OIHA 4DR6F 4W90B 2H51B 3LP0A 2B5JA 3R5GA 4IFYB 2LQBA 3PHTA 5I3UB 3KK2B 3QSYB 3EJMA 3ETOA 1YJWS 5KG0A 3PJ9A 1RAIB 1Q8BA 2UUWA 2K06A 1F60B 1UEVA 1B7YB 2DGVA 1NM2A 1RHMB 4U7UD 3QPIA 2W2QP 5BXIA 3OUYB 3OR1A 2QV6A 2XLIA 2RQ4A 3M8RA 3BQ2A 4ED3A 4X64J 2PN6A 3HZEA 1NK9A 4F04B 1MWZA 5KFOA 3HJFA 2VD3A 3MUMP 1G4CA 4WCEQ 2Z2YB 1RBOB 2GIRA 4NPOA 4YUDA 2ZVSA 2ZWPA 2LP4A 2YH1A 5HQMA 4DV6J 1D9DA 1GEHA 2DXFA 4DMZA 4F4XA 2GO9A 3R7SB 3GV7B 5D4OA 4P6QA 2OTLS 3IA0A 1Q79A 3MPWA 4YEAA 3HVRA 2AHOB 1NHUA 1O5JA 3HFVA 4DV7J 1HYSB 5HMZA 1VLOA 4FBUA 4YDDB 3P4UB 2V8GA 2KT2A 4DSKA 1FFSB 3D1HA 2ERRA 1A0OB 1B0PA 2X1BA 4LFBJ 1TV6A 2BX6A 3ELHA 1EJ7L 4URGA 3CDAA 1NJIT 4FKYA 4ZN3A 3IBWA 5DG9A 4NWBA 3WC2A 5HQ8A 3ET6B 3UNGC 3ETMA 2ZOMA 2UV8A 3U1NA 5KT4A 5KFFA 3D6FB 4G1IA 2ZHOA 4J9VA 4ZMMA 3DRXA 3R97A 3D9BA 1VI7A 5KFVA 5CA5A 1N5QA 1KN6A 1BGXT 5LOQA 2XZWA 3O5TB 2HHUA 3NGTA 1N88A 2N7YA 2ILZA 3GCWP 1NDLA 3FK4A 4LSNA 2V50A 2ZH5A 2E1AA 4YOEA 3T19A 3T1AA 5KG4A 5ETPA 1Q7YT 3M30B 1N54B 4OZ2A 2DHAA 2XYPB 1JLEB 2RMLA 2CWXA 2YKOA 2VF3A 3G2XA 4IO1A 1U1LA 2D3OR 2IA6A 1FWKA 2RKIA 5LMNF 4ED8A 2DEJA 3TARA 1P8GA 2QG9B 1ZH5A 2KG0A 3GYGA 2DY1A 3OFGA 3CCVS 3MEKA 1HQEB 2XEXA 4NLGA 2JEFA 1Q0NA 2OPRB 1HHQA 4IOAQ 1R8HA 3OXFA 5LT5A 2L9NA 3D6MB 1TKTA 1SUQB 2GQCA 1T94A 3PJXA 1WHVA 2E5HA 3RYLA 4WKYA 1FXLA 2BJ7A 2VPWB 1HIYA 1XQIA 3B78A 4NRTA 3T41A 4KYZA 5C5JA 4X65J 1MMNA 1Q8IA 1IBLF 1FJGJ 3M05A 2CZ9A 4ZP7A 2HQGA 1D09B 1O8BA 1REVB 2XG8A 1HR0F 4JYAJ 1AFIA 2GAGC 3L09A 4JI5F 3AXMA 1FRJA 2YNHB 3TYTA 3OR2B 1LW0B 1UZDA 1JX4A 2EC2A 3AJ1A 2BRKA 3ZNJ1 1WF2A 3HF5A 3SCJE 1YIJS 1DARA 1GTEA 4IQXA 1QSLA 3JSBA 1RWVB 2I5JA 4TYBA 1J27A 3KLFB 1SJQA 3QGGA 5KFZA 5U47A 4ZDNA 5GMKa 2E7VA 3KOAA 2MDAA 2BR0A 3EUNA 2G2YA 2O5DA 2FIUA 3M8WA 4YMEA 1MWYA 1M1HA 3CD0A 2W25A 3BBFA 2IJNA 5FDLB 1GT8A 3RJMB 1ZS6A 2PSZA 3VV2B 2YWKA 4J9SA 1L5UA 3EICA 3ZC4A 2G4BA 3OBIA 3FFIB 4OX8A 4USVA 5ETLA 3SSRA 4LVOP 2W8KA 5HP1A 2UUBF 4XDCA 3PX4A 4MKYA 2XSJB 3K17A 4PWUA 1H73A 2G1HA 3R5AA 1H7XA 3BSOA 1H2UX 2RILA 3FDSA 3GJRB 2XCPA 4J9OA 2HRUA 3D6TB 4ER8A 2Q1LA 2VC0A 4R8UB 2J8AA 1DFDA 5T7LA 1S4EA 4DS5A 3Q8RB 3H25A 4WP8A 1RQ0A 4ZJLA 5DM6Q 1P6TA 3N4WA 1WC5A 1C1CB 4K59A 3CF5Q 2Q6BA 3AD7C 3IS9A 2DR7A 4LFAF 1VQNS 1YHQS 5KFYA 3UD5A 4OI2A 2ADCA 3NGKA 4ED4A 5DDOC 2JZ5A 1WD6A 2PC6A 3C2PA 4LFCJ 3MOJB 5JUMA 1FK9A 4M5MA 4DG1A 2PA8D 4ZVOB 3IR7B 1NK8A 3AQPA 4LR7A 3P8BB 4YB7A 1URNA 4J9LA 2EBEA 3FVYA 1TL7A 5CQGA 1XMOF 1HWKA 3QJPA 2DR6A 4PUOB 5D0RA 2HNYB 4MKBA 2Q66A 3TI0A 1OO0B 3VF0B 3CJ0A 4ZCLA 4B9TA 1W2IA 1M5SA 2AJ4A 2Z56B 4BS2A 4OI0A 5CYQB 5KFWA 2Q79A 5CZXA 2CQ0A 3V4IB 1R6VA 2F4VF 2CJQA 5I3UA 2AJ2A 2FQQB 1CS4A 2NSBA 4IG3A 4OQJA 4W92B 3F56A 4MT1A 1DZ5A 2NR0A 3UD4P 2R2SA 4ZK7M 1F0XA 3LO3A 3AXKA 5ETTA 3R8YA 2KZZA 2XY6A 2VA3A 3DRPB 5J2NA 2XTJP 1A9NB 2KHCA 1UMJA 2X1FA 1N52B 2UXBF 3MEDB 1YRUA 4PQAA 1VJWA 3BKTA 2P8IA 4KY3A 2W24A 1NDKA 2MHNA 5D0GA 3K89A 2E1MC 3GJSB 1NJWA 4CCHA 2YKPA 4LJMA 5IT4A 3OQ2A 2MKKA 4M5DA 2VUGA 2A6MA 3MM5B 1FNOA 2GQQA 2HNZA 4UOHA 4LQ9A 4OHZA 1HI8A 4NLDA 4CYUB 5K8OA 1ITPA 2KXHA 1D9AA 4DV3J 1VQMS 2QA4S 4J9MA 4L6V3 1N48A 3A12A 2HGMA 3QT8A 5A6PA 4X4SA 1XR6A 4OHVA 1NU4A 4ZPWR 2B9YA 4TQSA 1DJ0A 2KM8C 1OIAA 5GAHU 4EO6A 4F4YA 4HDHA 4ECYA 2BW2A 1HARA 1JKHB 4JI4J 4LSLA 5IC6B 1ACMB 2A0FB 2ZE2A 1IUJA 2FB0A 2DGWA 5T41A 5B08A 2MXYA 3HSGA 3M8ZA 2KI2A 3S6EA 1WELA 4DV3F 4RPFA 2M0GB 3FMWA 1KC8T 3ITHA 1RTDA 3AJDA 4ZJQA 4IFVA 4I2PA 4WE1A 1JJHA 2GVZB 3TVZA 1JLFA 2LQ5A 1RHQB 2O01C 3UFCX 3IN5A 2ZH3A 2KN4A 2ZDPA 2RS2A 3R5DA 3AHPA 1UFWA 3TVKA 2BJEA 3NOCA 2EI5A 4KH0B 4BC9A 3CCJS 1UFLA 3CB4A 3RB3A 1S0MA 2EPIA 2DIVA 3NCQA 4UQTA 4O3QA 3BQ1A 1WWHA 2C22A 3V5RA 1HBOB 3BB5A 4DZDA 1S9GB 1OQ3A 1XEZA 3GSIA 1SH2A 3LP2A 4TY8B 3SDEA 4BBYA 4CO2A 4DX6A 2RVJA 2FJWA 2C2DA 5CAAA 2RD5C 2HFOA 3BQ0A 1OPIA 3NBPA 4MIAA 4NLSA 1H6KX 5KFGA 2LQ9A 3VZHA 2K1RA 1RWOB 3VR1A 5KFQA 3SCIE 1NXIA 4I56A 3CGIA 4UOFA 2AV5A 5J1NA 5HQLA 5AXNA 2IM3A 2MZJA 1XMBA 1RT1A 3ZTPA 5LJ3Y 2MZSA 1NK5A 3D67A 2FD2A 4DL0C 4USUA 1F9FA 3DU6A 1N5YB 3R5JB 4UOCA 1U02A 3IP0A 2VQEF 1Q86T 5BYQA 2BEFA 4M5NA 3CMQA 4I7FA 3MTKA 2FJAB 4MIBA 3IO1A 5IOLA 1SJ4P 2DVIA 3C46A 3HVWA 1FDNA 2KJVA 3V2UC 3R9LA 1EHWA 5HVHA 3AJ2A 3IWXA 2F65A 1U1QA 3KNGA 2ZZNA 4DPWA 4EYHB 1T03B 2ZBIA 1M5KC 4P72A 1IQTA 2Z58B 1ICEB 5F3ZA 1T3NA 3KJQB 3S1TA 5M2PA 2A1BA 2GHWA 4DCOB 5KFAA 3EPGA 4DL4A 5SUHA 1CC7A 1PIEA 2GX8A 1U1MA 4FYWB 3KTQA 5AJ3F 1KQKA 4JI7J 4FN5A 2M70A 2FLNA 1Q5VA 2CQ4A 3FJ2A 1Q78A 3PYEA 3M8YA 1FI4A 2CNLB 4RW6A 1VC0A 1U7LA 1LV5A 4D3GA 1VLYA 1U0SA 4GC6A 5KFHA 3V6JA 4JP8A 4JI1F 5H9FK 1N34J 4JI1J 1GXUA 2CQPA 1W26A 1IWGA 1RAJA 1XWLA 1T9TA 4OYWA 2HRTA 2GMHA 1RWKB 2G1DA 2OPQA 5ETQA 3W8GA 3C6TB 2XNQA 3ILJA 1RT5B 4F3MA 2MQPA 4N8OA 3BPDA 2OJ3A 1IBKJ 1CC8A 2E7XA 3I32A 4OLOA 4F0MA 5DQHA 4OV6A 4C6AA 2M52A 4DPYA 5LXRA 1Q8KA 2MGZA 1FHTA 2IA0A 1VHIA 2BA9A 2YX1A 1RKJA 3RTVA 1RKIA 1XJWB 2GS8A 3CJQA 4NCBA 1B7FA 3U1MA 1S72S 1JNRB 3FCHA 4IKAA 4NX9A 4B9SA 1BLUA 4OI1A 5KFJA 4ZCMA 2CG4A 1U09A 2CZVC 4DL2A 3DCAA 1LK5A 1PBAA 4A8OA 2KZMA 3MECB 4OZNA 1FF2A 1V5IB 1F1BB 1IWAA 1LWEA 3SXLA 1U8WA 2KKHA 2LA6A 2HWIA 4DR7J 1EQMA 4ELTA 4LREA 2ZOFA 2BE2A 2E1RA 2C3UA 1S1WA 2B43A 1J5OA 3ENQA 2HHWA 5A76A 1DQ9A 1TL7B 1JLGA 2YKQA 1S6PA 3QT6A 3EZUA 4EBDA 1YVFA 2BJ8A 5D4LA 4E8UA 3EXYA 4JYAF 4G1PA 1N0UA 4YB1P 3FEZA 3OJUA 4KHPJ 4OMFG 3MPYA 4L76A 4HEA9 3Q8QB 2HYIB 4EI2A 3ICLA 2PIIA 5IV3A 3W60A 2XM3A 1GQEA 4HR2A 1QLNA 1OY6A 2RQCA 4LF7F 3HK2A 4Y00A 3TA2A 4MK7A 3AH6A 1NK6A 3W64A 1YJTA 3CCZA 3W1YC 5D4NA 2FVRA 3EZ5A 4QBUA 2LU2A 1YRXA 3NGSA 1IKYA 1X0PA 3I9ZA 2W2OP 3GIIA 2E1PA 4URSA 3DI6A 5LJ5Y 2AT1B 2DRAA 1X4EA 5FJ4A 4OJ3A 2R7OA 6FDRA 5J1EB 2NZCA 1UEUA 1ZZFA 1CJUA 4DV0J 1VRUB 2HFVA 5J2MA 2BV3A 2J76E 3HVTB 4USKA 2KXNB 4YQWA 3GWCA 2IY5B 3OR1B 2A2CA 2EFPA 1HHSA 1U1OA 4S0MA 1VCTA 1VS3A 5FLXY 5IFMA 4R5PA 2ASDA 2ZH1A 3KNAA 1XNQF 1D1UA 2QLXA 3D1QA 4WTOB 4PQUB 4URQU 2D3O1 4B3SJ 1ZPVA 2HS4A 2IVFB 1LWFA 4M94A 4OX6A 3R7BB 1R6YA 5L1JA 2DNHA 4C8ZA 3T5LA 2EG2A 5D77A 2E5LF 4ERDA 5HROA 4CTAB 2NCKL 4LT6A 5LSLA 3E8OA 2IAJB 4Y3CA 4J9QA 5CZVA 2DISA 4QIFA 5KAKA 1M5HA 1HNXJ 3M32A 4CI0B 1HLWA 4LFBF 2CJ9A 2A3JA 2KVIA 2QMWA 2ALYB 3EGNA 1T95A 4NXNF 3MEEA 1S1XB 1YGYA 3UDCA 2WVFA 3NLCA 2WW8A 4H54A 5FD1A 2W7OA 2GVZA 2XGQA 5EN1A 1FT8A 1RT6B 3I56S 2ATLA 3NCPA 2Y8WA 2QLFB 1KLMA 2HFNA 4K4UA 1HMVA 3K0JA 2DR5A 2HVHA 2WB1D 4Q0BA 1V3SA 3MMAB 2Y1IA 3TR5A 5F9NA 1UVLA 1KVIA 3U27A 2FY8A 1A6LA 3FRYA 1MROA 2RQMA 3IGVA 1H74A 1N5VA 3LGMA 4MFBA 3KUHA 2RHSB 1ZM4A 3MM6B 4IQMA 4TY8A 2G2ZA 3PYFA 5CD4H 2AZ1A 2YWFA 3MAQA 3EXCX 2YWEA 3PX6A 2CADA 1M90T 5EGYA 2XWYA 2PO4A 4O0NA 1Y5LB 4PPZA 2V5HG 3RB0A 1NJYA 2UVWA 1P1TA 2V63A 4RUCA 4UY85 2RKIB 4X62J 5E3AA 3KK1B 1TAQA 1OSDA 1T7PA 3CEDA 3TJ8A 1VRQC 3HX9A 2QX0A 3O3LA 1NSQA 5KT3A 4J90A 3UDEA 4PWDB 3ZO7A 2W4DA 3LOUA 2WZ1A 2DGXA 3PCOB 5HMWA 4QWDA 3THPA 2BANB 1MW7A 2EKYA 2QN6B 4YB5A 1O51A 3FSIA 3GYXB 4I7FB 1RT4B 3BR9A 3GCXP 4C3LA 3VAHA 2CQGA 4RNMA 2XNRA 2DPJA 2Z8QA 3JTNA 2ZHBA 2V4QA 3CC2S 2CWKA 2MQNA 4ES2A 3M9OB 2LFVA 2WVCA 1WHYA 1X4BA 3HHEA 1N5SA 2JRSA 3CDUA 3L7UA 3M6XA 4NCGA 3S8SA 2XLKA 1NMEB 2GNKA 1TL3A 2VFSA 1WUUA 2NSCA 2O1PA 2Y3YA 4PG6A 4CNZA 2UUCF 1IVZA 3VWSA 1IKXB 1LXJA 1UETA 3A3OB 2ACYA 4U9RA 1K9MT 1K0VA 1QAIA 3BGFA 3UWTA 2D7SA 3H8YA 1JNZB 4P10A 4RWWA 4QPXA 3GYNA 4NA3A 1FEEA 1MMDA 4ICLB 2LXUA 2MLXA 3SSSA 4CLSA 3GQCA 1EQ0A 1F2GA 1RWPB 1RAAB 5GAEU 2BJ3A 2XC9A 1KONA 2IYGA 1NSPA 2CJAA 3BKFA 3BN7A 4B9LA 3DLGB 1WDTA 1PILA 3U02A 3JYTB 2IBOA 2D74B 2Q3PA 2V8PA 4JI6F 5KFKA 4WFNQ 2CPEA 5GAGI 1EB0A 1UP1A 2ZBQA 5HAOA 3CXCR 1N6QB 3NOGA 3WQPA 1AZSB 2YWWA 2MGZB 1RWXB 4ZP8A 1AW0A 4ZLNA 2XS7A 2LMIA 2VFRA 3FFIA 5HP1B 2E1CA 2AJQA 1WHWA 3WIVA 1Y10A 1KBRA 1KSPA 2ZJRQ 3A3PB 2ZD1A 3JS9A 4JI6J 4DPXA 3D2WA 5DS7A 1SL0A 4F4WA 1TKXB 2M7SA 3PZPA 3BKUA 2K3IA 2V94A 3LAMA 3LP1B 3MECA 2MHEA 2Q43A 1R3NA 4V19X 2NXJA 3MAHA 4NMXA 4OX7A 1K47A 4CH0S 1T0TV 2GV1A 2WVDA 3KKFA 3PR5B 2R7QA 2A18A 3FBEA 1DLOB 2B0GA 4HT7A 1U1KA 1G6BA 1VRTB 4ID5B 4OZLA 1J5OB 3CJ8A 1CJKB 2VG7B 5KOWA 3F41A 2HQFA 1EZZB 4KKOA 3QFWA 1RTHB 3IR5B 4HDGA 3W9IA 4OZ5A 3JAMU 1UCNA 3PYDA 1FVQA 1XTZA 2UU9J 2KG1A 2QT7A 4C0HA 3GIKA 4LF5F 2VG6A 1IKVA 1T8EA 2FYXA 2HAIA 5HBMA 2YQ1A 3RAMA 1SC4B 2I0XA 2IM2A 2E5JA 2V8DA 1X5SA 3KLIA 4H4MB 1WEXA 4NLRA 4JUZA 4TQRA 2JC0A 5LMNJ 5H9EK 2AGOA 3L7PA 1PYSB 4B3RF 1YJUA 1YG0A 3R27A 2F4FA 4LRBA 4N8NA 4UUXA 4ENOA 4UOGA 2RU3A 3CCUS 4DQQA 3MUVP 4DL5A 1RA7A 2H9ZA 2G2OA 4ED0A 3AT1B 3PNIA 1OYEA 3V4IA 1GMWD 4N56A 1NLKL 3DI6B 2JNJA 3DMJB 2G0IA 3W62A 3NGDA 2GMJA 4CH7A 4IG3B 5HVGA 4KHPF 4Z7CA 4KAIA 3HVTA 4ECZA 1FFWB 3TWZA 4RNOA 3VCDA 1Q4RA 1S79A 4NLQA 4OFZA 1KFDA 1M5PC 4G3IA 3I0SB 2CQ2A 2K3KA 3MMBB 4G6VB 2RNEA 4GO5X 2DY9A 5J2NB 4CZCA 4UT4A 3VAIA 4DCJB 4ED2A 2UXDF 1U8SA 1RDRA 2QYGA 4GKKJ 1TZ0A 1URRA 1MNEA 3H5UA 2ASJA 1GX6A 3O6QA 4KV8B 2GC8A 2XSFA 5E2QA 1RE1B 4GVBA 2EEYA 3ISND 1VQ8S 3QJLA 2OELA 4FZVA 2BUNA 4DPTA 2KFYA 4K5SA 3GPAA 4M5DB 1JB0C 1WC4A 4NLOA 4DV7F 2BQRA 1F5AA 2IMOA 2VFVA 1JLAA 3CDWA 3EVMA 4KFBA 3UPFA 1DTTB 4H4OA 1RT3B 1KS2A 1PG5B 4JOUA 4M5LA 3KLEA 1F3VA 2IHR1 2WRMA 3M2VB 4I64A 4WF9Q 3KFWX 4XTTA 3W8PA 3NNCA 5KG1A 3OLBA 1RT6A 2CQHA 4MK8A 4WFZA 4ELUA 2CPXA 3EYZA 3Q2TC 4DXLA 1S57A 2CKWA 2DD8S 2QJ3A 1IN0A 2YKAA 3DDIA 3D5MA 3NMAA 4CLPA 4CP5A 5GAHI 4R0JA 1R89A 2FVPA 4Q0BB 2VG5A 5GMDA 2J7KA 2RIJA 1UJ4A 1SKSA 4A8MP 3GFYA 3GIRA 3HHKA 2C3PA 1WOSA 5M2UA 4I2PB 4DV4J 2B56A 1XNQJ 2JL9A 2OTJS 5K5MA 2DNQA 2HBRB 3M2RB 2YWHA 4WWSA 3KUGA 1AUSL 3WDOA 4E0DA 4OZ0A 2ZNYA 2WOMA 1EP4B 2FJDB 3I0RB 4RX6A 1WC1A 5ETNA 2CNNB 3DC2A 1FDAA 4PWDA 3UN2A 1RT7B 4NRUA 2DGOA 3ZTQA 5KT7A 3LP2B 4OYOA 2QE5A 3DDNA 4WU3A 1OSCA 1TP7A 3DRYA 4FS1A 1NNDA 1T9VA 2LQ8A 3M30A 4P2SA 3V6KA 1V6HA 1NEEA 2R8IA 1TL5A 1GXTA 4KSEB 1NH8A 4WFAQ 2HFZA 2N4CA 2ZKTA 4R25A 3B54A 4DV4F 1NKCA 2UXBJ 1XERA 1E6VA 1H72C 1ZAXA 3CD7A 4LF7J 1HQEA 5IT0A 4PKDB 1RT1B 3S01A 1KKHA 4M5JA 4CM0A 4N5SA 4NA2A 3R1LA 4RW8A 5IQ6A 4ZVRB 3LANA 4LQ3A 1OY8A 2XS5A 1TKTB 2VHGA 3T5JA 3FGVA 3TAMA 4PRFA 2GHVC 1IKXA 3ILIA 1X5TA 4CRJA 1Q95G 2R4FA 3CJ2A 1VHFA 5AE1A 2XGPA 3PVXA 4CIOA 2ZC3A 5THWA 1LWCA 2AX1A 3LGNA 3GIJA 1T03A 4IO9Q 3BBCA 2QL5B 9RUBA 2R8GA 1YWXA 1PJ7A 3CDBA 1X4AA 2ZUAA 3ENAA 2W4CA 1XMOJ 1LWXA 1IR2A 3IG1B 4Y2AA 3UO0A 2V2VA 3DLGA 4NMLA 3LH2S 4ZLPA 2EXUA 2DK2A 3M8PA 1X5OA 2ZITA 2MSTA 3Q2SC 4RW6B 1KLNA 4J9KA 3FBFA 1BHNA 2ATCB 5K8NA 3HT0A 5CYMA 3P5BP 4LFCF 2JWNA 4N77A 3T6BA 2UXDJ 2R7SA 3LPYA 3RB6A 2QMXA 5KFLA 3C14B 1HNIA 2FJBB 1R27B 1RT5A 2DHHA 2MQ8A 2ZD1B 4DBQA 2VQFF 4AQYF 4RW4A 3THVA 3LP1A 3TQEA 5F8NA 1WTFA 4RNHA 3GJQB 4X4RA 4JV1A 1S76D 2BVZA 1SXLA 3M8QA 4QPTA 2B9XA 3TP2A 2Z2LA 1DLOA 1Q82T 4DR1F 2W9BB 2XSJA 1VMBA 3BREA 1IBMJ 1TFWA 2CQ3A 4ATNA 4YFUA 3ZNUA 2JLFA 3DDKA 1RTHA 3OVAA 1IJEB
chains in the Genus database with same CATH topology
2OAUA 1R8CA 2UVRA 1FVSA 4FXDA 1SC6A 1WG4A 3G8TA 5AXKA 1WI8A 5KFEA 3CCLS 3I5AA 1F5CA 3CJKB 4B9VA 3LAKA 4OHYA 1IKVB 1MSWD 5IT9Y 2ZH9A 4USJC 3M8SA 2QLWA 3RRKA 3K5MA 1ZM3A 2KHDA 5HL7Q 2R2TA 1Z1ZA 5KG5A 1VQ5S 4PG5A 3DXSX 1JLBB 4OX9F 2EK1A 2MPUA 1X5PA 2GHPA 4TXSA 2B7CB 1HQUB 3DN9A 3HPOA 2N3OA 2B4VA 3HHNB 2KYZA 4EUVA 3OL6A 3MFHA 4DN0A 3NG8A 2DIUA 5KG7A 1WACA 1Q1KA 6FD1A 4A8WA 4ECRA 1LFPA 1SJ1A 2IFXA 1RK8A 4MYUA 2DNZA 3GFHA 1FTRA 3OW2R 1LW2A 3GFZA 5KFCA 3GFXA 5B0CA 3CPWR 1FJGF 2FDNA 1HBUA 1NHVA 2MQMA 4Q44A 2HZCA 4NA1A 3UR0A 1DQ8A 3JSMB 5I42A 1NH7A 4N76A 4ZOSA 3PKYA 4KV8A 1ZAVA 2HVIA 4NYOA 4Y2KA 3RRHA 5HLFB 5KT2A 1YJNS 2YX7A 2DBBA 3G6XA 2XCAA 2DPIA 1JLAB 4F67A 4F4KA 2B5JB 1RT3A 4PQUA 3X1LB 3KLEB 2XI3A 5B0DA 1N32F 5HMYA 5EUHA 4K4XA 1W2BR 2UV8G 1I6JA 2JHEA 2R7UA 3J80Y 4QZVB 2QA1A 4HT5A 4HTIA 2QZ8A 4CTAA 1WF1A 4JI4F 2IM1A 1ZM2A 2HNZB 2DB1A 3VAFA 3PW4A 2NQPA 4MTPA 3V6DB 2HHSA 2J7UA 4DS4A 1ZTWA 1Y5NB 4ZPTR 1FRKA 2VC1A 3QIPB 4WZMA 3IGNA 1WG1A 2ZNZA 3OTBA 2OMLA 3AA9A 4KO0B 1IJFB 5KFBA 1XC9A 2LEAA 3I96A 5JJBA 1JKHA 3M2RA 2ZE2B 2E9ZA 1HYSA 2YVSA 4WXOA 1EP4A 3I0RA 3MFIA 1OPZA 2EFNA 2F1FA 1MROB 4MFBB 2J0WA 5EX3A 2QEXS 3SMZA 1H7WA 3MM6A 5DG8A 1JWWA 3G8SA 4OI4A 2DCLA 1JLFB 3QGPA 2FJEB 1C0TA 4WK1A 2NPIA 1P27B 3BGUA 2BXJA 4NXMF 1FD8A 3I9V9 3M2UB 4DL6A 3HHLC 4Y65A 2LVWA 1HBOA 3AQOA 3O1LA 4LSNB 4WFYA 3T9NA 4QWCA 1S0OA 3CD6S 4WYLA 5ADZA 2BANA 5JVHQ 3TRGA 5JXSA 4ED6A 3GIMA 1VC6A 2ADBA 1RT4A 2P5VA 5F8GA 1I94F 4X2BA 4A8SA 2ZUGA 2OPRA 1HI1A 2HG4A 1HNXF 2DGTA 2VBZA 3CCSS 1FKOA 1KR4A 3DLHA 1WI6A 1VQSA 2ROGA 3H2VE 3VALA 1RI7A 1XBWA 4RNFA 3SYZA 1XR7A 4B3SF 3LALA 3K57A 5I3PA 1Y7PA 4I69A 2RRNA 1S4FA 3AB4B 5B0GA 5J1PA 1VQLS 3OFFA 4UY8T 2Y1RI 4RW4B 3NCRA 4QIWD 4WIIA 1FCAA 5G0RB 5F8MA 5CXTA 2IRXA 3KWMA 2BOPA 4DPOA 4QYZJ 1XMQF 2L9DA 2I5JB 1ROFA 3QLHA 3H5XA 2LYVA 3MD3A 2RS8A 2LDYA 3HKWA 3GV5B 2C28A 1HWLA 1HWUA 3NRBA 1KTQA 2O66A 4WJBA 2ZHAA 4NLVA 3C8YA 4B3OB 4RBVA 5FDLA 3BJYA 1FRMA 2NZ4A 3PACA 2GJIA 3LWMA 3BO2A 2V8HA 3WC0A 2X1AA 2ASLA 4I67A 4X4NA 1YRTA 5DRKA 3K5NA 4XAKA 2MKCA 3DNCA 2E9RX 1QTMA 1HPZB 2DCUB 3BZQA 2K2PA 3K7RA 4YY3F 3OTCA 4CH1A 5C24B 3IS9B 4X4TA 2OPSA 4OLPA 2NPFA 1UVJA 1R8AA 3KLIB 4H4MA 3QZ7A 3Q22A 2DNRA 5IWAF 4HTJA 4B08A 2AYGA 1S6PB 1VFJA 1Y3KA 1S6UA 5LSOA 4JV5F 2D1CA 1VQ4S 1X0FA 5A0YA 1FJEB 1RJJA 4BHQA 3M9NB 3JSMA 3DYAA 1VK3A 2M3DA 4AL5A 4YR3A 4DFJA 2I1RA 1QAXA 4QIEA 3P49B 3UDLA 3OHAA 1J2VA 1NO8A 1SH0A 4ZVFA 1RA6A 5E3CA 3IWNC 5KFSA 3HM9A 1XK8A 3MMBA 4BCAA 1IM4A 3O8WA 2WSFC 2X51A 1N34F 2AW0A 3PRDA 3OL8A 2ZM6F 2J9DA 4C3KA 5A2QY 2C2EA 4Q2MA 4ECTA 4Y2MA 5J2PA 1VRUA 1KHVA 3MM7B 4EU0A 3KG0A 2ZBCA 2CPJA 4USHA 3QYYA 4NLTA 1JXEA 4A47A 3C6UA 4DQIA 3V6DA 4KFBB 2J5AA 4PCQA 1DTTA 4H4OB 5ITHA 1V3ZA 3QIPA 1IR0A 2VFTA 4QJVA 3M2VA 1LWFB 1RWUA 2CRLA 3J81Y 2ZC4A 1IKWA 2W4PA 4TU8A 4WTYA 1CPZA 5HROB 3TUJC 2IAJA 2VL1A 3CCTA 1HD0A 3HHLB 4HI1A 1RT2A 3OVBA 1FKPA 1X9MA 1FRIA 5GVQA 5KFTA 4DV6F 3CULA 1S1XA 2FLOA 3G86A 1B0TA 3TUIC 3NKYA 2E9TA 2VONA 2RB7A 5L1KA 4IRDA 2OPPA 3OTDA 3PFOA 4HHJA 1UA0A 1N36F 3IRXA 1KLMB 1CQNA 4FF1A 3G9CA 3WX4A 1HMVB 3FRZA 4FVMA 2L41A 2WOMB 2IC3A 3L95X 4DR2F 5LMUF 2FJXA 3FSYA 1VK8A 2APOA 3QWPA 5JVGQ 4EZ9A 2B7BB 1SV5B 3V4MA 1GAOA 4I4BA 2CPHA 4NYZA 4ZPCA 1K1SA 3KJVA 4DL3A 2CPYA 3UW1A 4AXIA 3C3LA 2EC0A 3NAHA 2RQKA 3MM9B 2CPDA 1KQGB 2W9AA 2QIFA 1TK5A 4RU9A 3W3SA 1Q8LA 2OSRA 2DH7A 3BEGB 2EFGA 2UZAA 1UVIA 3JSYA 3H5SA 4A48A 5DDQC 1EETA 3RW6A 3J7YI 2XB2D 2C42A 2PEHA 1QAYA 3MM8A 3SFUA 4F8RA 3KYLA 1BC6A 2B6AA 1KD1T 2UP1A 2CVEA 5M2RA 1MU2A 4LVNP 2XY7A 3TAPA 1RTIB 3N5BA 3OLAA 3PIOQ 3BR8A 4WYWA 1H2TZ 2B4UA 2ROPA 2NXUA 1HFEL 1TL3B 2A2DA 2W9CB 3N6MA 3Q8PB 3N6LA 3RZAA 1KHWA 1VC5A 4C9DA 3MMCA 5E33A 2M8DB 3AY0A 3PX0A 2R7RA 3BSCA 2HHQA 2VB6A 1VIOA 3QAEA 4C8KA 3DU5A 2YH0A 3QLHB 4YDXA 1CEZA 5IXUA 5J2QB 4JI8F 2B9WA 2DH9A 2XHWA 4B02A 1N0VC 4HH0A 4ES3A 2RU9A 3B4DA 5LSRA 4K4VA 2ZH6A 2YNFA 1B64A 1BQNA 2OD4A 3PW0A 5F0UA 4F4ZA 2JDJA 3ZZPA 2Z2MA 3G4SS 2J9DE 1HNVB 1R7IA 3IXQA 4L72B 3W2WB 4LIRA 2LXIA 4C7QA 4L3NA 3BF4A 4IG0A 4NZ6A 3N01A 3CCQS 3CUNA 2JC1A 4MYTA 4NL5A 1N56A 4DLGA 5KFDA 4MK9A 2CJBA 1DURA 3VAMA 2WB4A 2J9CA 3HDSA 4K4SA 1VRTA 2CQ1A 1QY7A 3V6HA 2DGSA 2V2KA 2KFNA 2P9EA 4NLUA 2EBGA 4KKOB 1FEHA 4X84A 3VQTA 2QO3A 4A8KA 1S9FA 1FXDA 3U7JA 3SV4A 2BQUA 4MMOA 1JJ4A 2R7XA 1HNZF 5AE3A 3MHYA 2U1AA 4H4KA 5A8WA 5GADU 3RR7A 3PY8A 2JLEA 1VGYA 1Z2ZA 2F3JA 5HBMB 4MAKA 1B0VA 1S1WB 4WU2A 1U2FA 4K2XA 1KRPA 2RT3A 4AE5A 2DR8A 1TAUA 1Y0HA 1JLGB 3P96A 3G71S 3CCES 3DOKB 2EW9A 4OZ1A 3CIMA 2XLJA 5F3TA 3WZ0A 4CQ1A 2YKNA 4I6WA 1AUDA 5EWGA 3E3XA 4G1QA 4IYQA 5EX0A 2GGPB 3Q23A 4NLXA 1C1BA 3HFKA 1KEKA 2KRRA 1SJRA 4I6YA 5DDRC 1ZBTA 3R5BA 3G6YA 1K0TA 3SZ2A 2K8GA 1QE1A 4F26A 3I0SA 4RBTA 1S48A 4B9NA 3ZZTA 2AU0A 2J7WA 2ZH8A 1PC5A 1W25A 4KE5A 2HW3A 4ECXA 1RTJB 4QOTA 5KOXA 5BR8F 2IJFA 5C42A 3T1HF 1S6QA 1V9OA 2KT3A 2VPYB 5KG2A 4F50A 1FERA 3MEGB 3HHLA 1WEZA 3KG1A 3SCKE 2VPXB 2PI5A 5DG7A 3KHGA 1ELOA 2MKJA 3GG1A 3ZZRA 3FMBA 4WFXA 3DLEA 2R7WA 1Y00A 4KO0A 4QR1A 1R0AA 3NNAA 1U6ZA 2BZ2A 2ILYA 3FZ2A 3M32B 2BACA 3ISZA 3O2IA 3L3CA 3R1HA 2K7KA 1U49A 2X1GA 4IR1A 2KRBA 1H3DA 2JOQA 4LF8F 1FRXA 3ENVA 2JVOA 3QIDA 3K5PA 5KT6A 3A1YG 1TL4A 4TYAA 2FC8A 5H1SV 3DOLA 1C0TB 1TL1A 1IBMF 3IC1A 2CPZA 4ILLA 4QWAA 3MMAA 4C8LA 3MM9A 3R3TA 1L3UA 5EWFA 3UE2A 4AUKA 1X4CA 2KXFA 3ZZYA 1FE4A 2HLUA 2RSQA 4ILRA 1SKWA 2W8LA 4WFBQ 2FGCA 3PW2A 1VQ7S 2W7PA 2D9OA 4FBTA 2MY8A 3DRRA 3MTJA 1MU2B 4EGLA 2HS3A 1TR0A 1S1UA 2IRUA 2AJFE 4DFPA 1KOHA 4C98A 4RW8B 3CVKA 4CNYA 5GAGU 5L38A 3IAM9 1CG2A 2W9CA 1WG5A 4DF8A 2HGNA 5D4PA 3RW7A 4QWEA 5L9NA 4GC7A 3NP5A 3J7ZT 3BSAA 5KTQA 4ZP6A 4N41A 3DGPA 5DGBA 1FKAF 2MMYA 3BO3A 4PG7A 3DRSA 2X3GA 4C4WA 4OV1A 5F41A 4HYKA 3W2VB 1VQ9S 2VBWA 4HLBA 1HW9A 4ECVA 2UVVA 1G2EA 3HHDA 1ZAWA 3M6WA 2HWHA 4TU7A 4EZ6A 2RJZA 5A8RB 3MURP 4O3SA 1BQNB 2XBPA 4ECUA 3SQGB 2VA2A 1SI9A 1HNVA 1KQSR 3CE8A 1X4HA 4Y0FA 2I2YA 3K8VA 3G6VA 3I87A 2VPZB 4TN2A 3TX8A 1T3OA 4J9RA 1N6QA 1N33F 1X4DA 1T05B 1SKRA 4B3OA 1BQXA 3I4HX 4MJKA 2B4OA 2DGQA 4C0OC 1VOMA 4TU9A 4CO4A 4XO0A 4DWIA 5KFRA 4R0EA 1X9WA 4JI0F 4Y2CA 5T14A 4RKUC 2YNGA 1UW4A 2DNLA 1K73T 4ECWA 3PW5A 3SSQA 1BQMB 4PXDA 2FLLA 3MGJA 2R2RA 3SFGA 3RBEA 1TVRA 3V81A 1AFJA 2I38A 1HPZA 5A8WB 5CCMA 5EWEA 5KFPA 2OPSB 2VV5A 3RR8A 4ZVEA 4DHVA 1OS5A 4DR3F 4Q5VA 1U1PA 3K58A 1HBMA 1JLBA 1H98A 2JVRA 3EX7B 2G13A 2Z4PA 3QMQA 1HQUA 3PV8A 2EFOA 4C11A 1X7VA 2YKNB 3LWLA 2F7VA 1NB7A 1FNMA 1QJHA 1QUPA 3B4MA 4DR7F 1U4BA 2KDOA 2C3YA 4I2QB 3ZZOA 5HO4A 3OSPA 2O67A 4B9UA 4Y34A 2IBKA 3RU0A 1S9EB 2UVUA 3MF5A 5AXMA 1N8RT 3MR3A 1S1VB 4P7TA 2EFQA 2JSXA 2F40A 3OTEA 2DNYA 5D3GB 2F9JA 1HBUB 4FYDA 4QR2A 3QO9A 3UD3P 1O0PA 3CSKA 1L3KA 3LUYA 3PEHA 1KTVA 1RISA 2C3OA 2LXFA 3MM7A 3NS6A 3QZ8A 3MR6A 1S6QB 4PXCA 3F73A 4NYPA 4Y6IA 2IVYA 2HHPA 3GR0A 2E44A 2FHOB 3ZZZA 3IFEA 2RRBA 4K50A 2YWGA 2R8HA 3GV8B 2ZH4A 4C3MA 1L3VA 4KPYA 4RW7B 4U7UK 3CCRS 4JI7F 4CO3A 1H2VZ 2RF2A 4FPRA 5DGAA 4V19J 4F02A 1X9SA 2XO7A 2ZH2A 5KG3A 1RT2B 4PG8A 4N47A 2DNKA 3TUZC 1FKPB 2J6TA 1WNEA 3OJSA 1R8PA 5DLFA 5B7WA 2DR9A 5K14A 3T3FA 3BM7A 3OFEA 4FXVA 5I3QA 3K59A 1C4CA 2OPPB 5D8HB 1M0SA 4AYBD 4Z2XA 2PE8A 5CH7B 1KQFB 2XULA 4PXBA 3FZBA 4EEYA 1U1RA 2KB2A 2MKSA 2VKZG 2NREA 3CMES 5BYRA 4RLEA 1KFSA 1SV5A 1Z4UA 2FHKA 4I1TA 1JIHA 1LQ9A 2KU7A 3DOMA 1VQOS 3GE9A 2VOOA 2R8KA 4IRCA 4DJBA 5D6GA 1FJCA 3H59A 2HMIA 3CD5A 4USIA 1FXRA 1RT7A 2EVZA 1S1UB 4B17A 3GILA 5K8PA 3DFEA 2CZ4A 1CSJA 2DRBA 2DHSA 3THTA 4QU7A 2MJUA 3QWUA 4X4QA 2PD1A 2V4RA 2B6AB 1GTHA 3NMRA 4KGKA 4ZKAA 1D3WA 3M4XA 3NNHA 2CDQA 4KRWA 4ILMA 2XMTA 1TQLA 4RWXA 2FLPA 2JLGA 3PM9A 1D9FA 1GNKA 4O44A 5E7OB 5B0EA 3TAMB 1FKOB 1OQ6A 1JXLA 3HKZD 4QIVA 2G0CA 1UVKA 4QYRA 1UVMA 5CCLA 2B4PA 3PKMA 1HW8A 3HMJG 4QQBA 3KLHA 3KG4A 2DGUA 3UI3A 4RU2A 2DJWA 2MKHA 3IG1A 2KFZA 2AJ0A 3BN4A 2FVSA 4IH5A 2EFVA 1NK0A 3M8PB 2XS2A 1FDDA 1GXLA 3Q0AA 4KHRA 4RW9B 4EBEA 1CQMA 2YNFB 2LEPA 4Q7AA 5CYMB 2LEBA 3I55S 4X66F 2EWHA 2MB0B 2DH8A 3N0VA 5DDPC 1JLQA 2HNDB 2F8EX 4O3PA 1U24A 4PG4A 3Q8SB 2IMWP 4DX8H 3G6ES 4KQZA 4DSLA 1XR5A