1JLFB

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
427
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 104
structure length 404
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlfB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB03
1LWCB 4RW9A 4X2BA 4KO0B 2FLNA 3OL7A 1IKVA 4O44A 2J6UA 1HYSA 4ZHRB 2IMWP 2OH2A 1FKPB 1QE1A 1JX4A 1LWCA 4J9RA 3KLIB 4MIBA 2WONB 4KO0A 2W9BA 3QGIA 2AGPA 5DGBA 1HMVA 4R8UB 3PR4A 2E9RX 5F8NA 4ZHRA 1K1SA 4O3QA 1FKPA 3OL8A 4NLRA 4O3PA 4KV8A 2OPQB 2IM1A 3CJ3A 2UUTA 5KG5A 5T14A 1S10A 2WONA 3KK3A 2HNZA 3BGRA 5C25B 4J9KA 4F4XA 4ECWA 3QLHB 2C2EA 4R8UA 3LANA 5KG7A 1JLCB 3DM2B 2WTFA 2OPQA 4ECZA 4FBUA 4URSA 5C25A 3KHRA 3QLHA 3MR5A 4IQXA 2RF2B 5DLFA 3KLFB 1JLCA 3DM2A 1QUVA 1S1VB 2V4RA 4JV1A 1WNEA 5KFAA 1RT4B 1W25A 5KFQA 4QWAA 3CDWA 2W7OA 1RTJB 4ED6A 2GIQA 5KFEA 4J9PA 4LSNA 2RF2A 4NLWA 1N6QA 3T5HA 2R8IA 3SI8A 1ZETA 3OL9A 5DG8A 1JLEB 4Q45A 1RT4A 1RA7A 1TKZB 2W7PA 4DL5A 2J6TA 2UVVA 1JLGB 3H98A 4QW8A 5KFCA 3FDSA 1S1XB 4KFBB 4ZVFA 4DL3A 5KT3A 2HWIA 2R2UA 1IKXA 3ITHB 3FQLA 3LP2A 4ECVA 5FDLB 3E01B 2R8GA 3SFUA 3IGNA 3DOLA 1JLGA 5CYMB 2FVCA 1NHVA 4RNNA 3H4DA 4EYHB 3GIIA 1S1XA 3BREA 3ITHA 3NAIA 3LP1A 3JYTB 3DDKA 2YNIB 3E51A 1RTHB 5DQIA 1IKWA 2I5JB 3QYYA 1KLMA 1TKTB 5CYMA 5J1EB 4ZMMA 4KE5A 2BE2B 2C2RA 1VRTB 1XR7A 3JYTA 5KFXA 2YNIA 5F8GA 1RTHA 3MEDB 2I5JA 4ZPBA 2CKWA 3DLGA 3RAQA 2WK4A 4ED3A 2BE2A 2DPJA 4ECXA 1RT5B 2ATLA 1K1QA 1S1UB 2VA2A 4I2PB 4RW8B 1C1BB 1VRTA 5DG7A 1S9GB 2VG5B 1BQMA 2D7SA 3C6UB 3MEDA 5I42B 1TL3B 1YVFA 4TQSA 4KSEB 4NRTA 2B6AB 3V6DA 2YKMB 2UUWA 1XR6A 1S1UA 2ALZA 2AQ4A 4RW8A 1C1BA 3T5JA 3H2LA 4U7CA 2VG5A 5EUHA 4ZP9A 4KB7A 5I42A 1RT2A 2FJWA 2D3UA 4NLXA 2B6AA 2WB4A 2WOMA 2YKMA 4RUAA 1RYSA 1SV5B 5C5JA 3RB4A 1SUQB 4ZPCA 2BQUA 3I0RA 4R0EA 3UPFA 4IG0B 1EETB 5HBMA 3EZUA 5F8HA 2W9AA 3PW4A 1SV5A 4DL7A 4MK7A 4LQ3A 3PZPA 3DRPB 2JLEA 4PQUB 3H5XA 3MTKA 1FKOB 3H5SA 4O3SA 2JC1A 4IG0A 1EETA 4WFZA 5F8JA 2F8EX 2XGQA 2IBKA 3HVWA 2FLPA 4FS1A 3DRPA 1TP7A 1N4LA 4PQUA 1FKOA 3DRRB 2DPIA 3KK1A 2XWYA 4ECSA 3MEGB 3BQ1A 5J2MB 3DRSB 2ILZA 4K4WA 3NMAA 1N5YB 1RTIB 3V6HA 3T5LA 4H4MB 1NHUA 4H4OB 5KFFA 3DRRA 5JXSA 1S0NA 1SH3A 3MEGA 3D28A 2OPRB 3BQ0A 3RB3A 5J2MA 3DRSA 3I5BA 1C1CA 1TV6A 4G3IA 4RW7B 1N5YA 1RTIA 4H4MA 3MF5A 2XC9A 1EP4B 1HNIB 3DOKB 3NKYA 4O3NA 1ZTTA 1QAJA 1S1WB 3PHEA 1TL1B 2OPRA 5J2QB 4RW6B 2OPPB 3KK2B 3N6MA 1T05A 2BQ3A 4IFVB 2W8KA 3KLHB 5L1KA 3ISND 2JEIA 1EP4A 5CYQB 3DOKA 1Z4UA 2XCPA 3CVKA 3QIDA 1REVB 1LW0B 1S1WA 1TL1A 2WCXA 4MK8A 5J2QA 3DLEB 3KK2A 2OPPA 3HHKA 3OL6A 2YNFB 2QV6A 4F4ZA 3T19A 1HQUB 4IFVA 1MU2B 2ILYA 3ICLA 4NZ0A 2BR0A 1DTQB 4O4GB 1KHWA 3GYNA 5CYQA 1D1UA 3KLIA 5KFHA 1REVA 3V6KA 1D0EA 4WYLA 5KFWA 3OSNA 2YNFA 2GIRA 4DL4A 3D5MA 4NLUA 2O5DA 3IGVA 1DTQA 4O4GA 3PW2A 2R8KA 3M9NB 4ED0A 1S4FA 3KJVB 2WRMA 2IAJB 2FVRA 3KMQA 2XI2A 4ZP7A 1ZTWA 2UVUA 5J2PB 2VG6B 1JXLA 1I6JA 3H5YA 1S49A 4ECTA 1BQNB 4B3OB 3KJVA 1DLOB 1RT6B 3V4IB 4ZP8A 3M9MB 3DYAB 1RT1B 5KFPA 5J2PA 2VG6A 4K4TA 3KLFA 2IA6A 1S1VA 4QWBA 1C2PA 4B3OA 2BQRA 1RT6A 3V4IA 4MIAA 1MMLA 2VG7B 5KFBA 1RTJA 2IM0A 4YR3A 2BANB 1T3NA 1RT1A 3TAMB 4RNHA 4RUCA 1JLEA 3IN5A 1JKHB 1TKZA 2UVWA 4WYWA 2VG7A 2C2DA 2BANA 4XPCA 4J9OA 3M9OB 1S1TB 3V81B 2JEFA 4MK9A 4KFBA 3BSOA 4QWEA 3Q8SB 2V0NA 5FDLA 1IM4A 3Q8PB 3E01A 1JKHA 2IM2A 3N6LA 3Q8QB 3PW7A 3IS9B 2HAIA 4NLSA 1S1TA 3V81A 4YR2A 2IJFA 3PW5A 1KHVA 1JLFB 5KT4A 3H59A 4ZPAA 4XPEA 4EEYA 1TKTA 3IS9A 5J1EA 4WE1B 4ID5B 3OHAA 3VQSA 1RYRA 4K4SA 4Q43A 1UWBB 4IRCA 2AU0A 4NLOA 3CDUA 1JLFA 4RNOA 3MEEB 1LWFB 1JLQB 4HYKA 4K4YA 2ASJA 3CJ4A 5KFKA 3H5UA 1S6QB 3GIMA 4WE1A 4URQU 1U09A 4ECQA 1RT5A 1S48A 5KG6A 1UWBA 4I2PA 3KOAA 4ECUA 3KLGB 5EWFA 3MEEA 1S9GA 1JLQA 3I5AA 1JLBB 3ISNC 4LQ9A 3QO9B 1S6QA 3C6UA 3DMJB 3LAKA 2BRLA 3UDLA 1TL3A 3SFGA 5F8LA 3HKWA 4PUOB 5L1IA 4J9MA 4DEZA 4JUZA 1JLAB 1J5OB 3KLGA 3KLEB 4NLDA 1JLBA 3QO9A 1SH0A 4TXSA 3OLBA 2RKIB 5DQHA 5C42B 2XGPA 1JLAA 1J5OA 4IH5A 3RB6A 3KLEA 3CJ5A 1RA6A 5KT2A 1S9FA 4O3OA 3GV7B 2J6SA 1SUQA 5I3UB 3CIZA 4KBIA 3UR0A 4NCGB 4EO6A 3PR5B 5KFLA 4QWDA 5C42A 5J2NB 5EWEA 3NBPB 5DLGA 2GC8A 2IM3A 1OS5A 2FJXA 5I3UA 5KFVA 5KFUA 4NCGA 4RW4B 4IRKA 2FVSA 3RB0A 2ASDA 3GIKA 5J2NA 2OPSB 3MR3A 3NBPA 5DQGA 4ED8A 4RNFA 2E9TA 4TYAA 4K4XA 4Y3CA 2ZD1B 1NNDA 1JIHA 4ECYA 4RW4A 2ZE2B 4K50A 2D41A 4NYZA 4MKAA 4ZP6A 5F8MA 5KFMA 2AGOA 4I2QB 4YR0A 4IDKB 2OPSA 2V4QA 2AGQA 2IJNA 3NAHA 5L9XA 2HNYB 2IC3B 4H4OA 4MFBB 3CDEA 4LSLB 3Q8RB 4JV2A 5KFRA 4I2QA 4IDKA 1LWEB 3RBDA 4EO8A 3KHHA 2HNYA 4RW7A 3G6VA 4IRDA 3MECB 4Q0BB 3GV8B 4ICLB 1HNIA 4MFBA 4Q44A 3IG1B 3QZ8A 3MR2A 4LSLA 2R8HA 4ED2A 1GX5A 2JC0A 4RW6A 4Y2AA 5D3GB 3T1AA 4IR1A 4RW9B 1RTDB 3KMSA 5C24B 4O4RA 1T94A 1CSJA 3MECA 4Q0BA 3KLHA 3GV5B 2C22A 2B5JB 3IG1A 2I1RA 3HVAA 3DLKB 3KLVA 1LW0A 1R0AB 5KFDA 1QE1B 4URGA 5KT5A 3DLEA 3G6YA 5D3GA 3CJ0A 4TYBA 2YNHB 1RTDA 1HQUA 5C24A 1MU2A 3JSMB 3V6JA 4TY9A 2W9BB 4EBCA 3NGDA 3M8QB 1HMVB 1C0UB 2B5JA 4M95A 1HNVB 1GX6A 3I5CA 3DLKA 5KT7A 1R0AA 1RAJA 4NRUA 2HMIB 4WXOA 4KV8B 4FBTA 2YNHA 4XO0A 3JSMA 2QE5A 3KK3B 2HNZB 3BGRB 1QAIA 3M8QA 1C0UA 3BSAA 2B43A 1HNVA 4KAIA 5F9NA 2IAJA 3H40A 4MKBA 4Q8EA 2HMIA 2EC0A 3MFHA 1TVRB 4RU9A 4IOBA 4GC7A 2RDIA 4Q8FA 2AX0A 4R5PB 1BQNA 5KFJA 3H4BA 1DLOA 5KG0A 2E9ZA 2R8JA 4K4VA 4KHMA 2JEGA 1FK9B 3DYAA 3PJXA 4WFXA 1TVRA 4RNMA 2W9CB 5KFGA 3T5KA 1S0OA 2FLLA 3NL0A 1S6PB 4R5PA 4NLTA 4ZVEA 4LSNB 5JUMA 3TQ1A 1N6QB 4WFYA 2ZKUA 1FK9A 1RT3B 1N56A 4MH8A 3TAMA 3FQKA 1RT7B 2W9CA 4J9SA 1HARA 1VRUB 1XR5A 1S6PA 3FSIA 1T03B 2AX1A 5KG4A 4ZVGA 3G6XA 3OSPA 3CWJA 1IKXB 1RT3A 3LP2B 1RT7A 3CJ2A 4TY8B 1IKYB 5KFTA 1VRUA 3DOLB 5KFNA 1T03A 4NLQA 2FJVA 3PJWA 3MFIA 4K4UA 4DL2A 5KG1A 4J9LA 5KFYA 4OL8A 3LP1B 4ZPDA 3RAXA 4TY8A 1IKYA 4F4WA 3HVTB 3BQ2A 1IKWB 4WXWA 1KLMB 3EPGA 5F8IA 3GILA 1RDRA 3CO9A 5K14B 5KG3A 4KKOB 3LALA 2AWZA 4TQRA 3M8PB 4ID5A 3MR6A 2W8LA 3QGHA 3HVTA 5DG9A 3N6NA 4WZQA 3QIPB 4YMEA 3DLGB 1LWFA 5K14A 1TKXB 3DI6B 4KKOA 4ED7A 3M8PA 4ZVHA 4ED1A 2R2SA 2JEJA 3LAMA 1BQMB 4Y34A 3BR9A 4J9QA 1S97A 2CJQA 1SH2A 4IKAA 4U6PA 5L1JA 4FS2A 3QIPA 4I7FB 1C0TB 3BSNA 5KFZA 5L1LA 3V6DB 1TKXA 3DI6A 3UQSA 5HLFB 5F9LA 4PWDB 4QW9A 3DMJA 3BJYA 3PW0A 5DGAA 2BRKA 1S9EB 4PUOA 5KFOA 3IRXB 3PVXA 3KHLA 3C6TB 2C28A 1RT2B 4I7FA 1C0TA 5KT6A 4YP3A 2WOMB 3TVKA 5HLFA 4F50A 4PWDA 2UVRA 4NLPA 1LW2B 3I0SB 1S9EA 4WZMA 5HP1B 3GQCA 3EPIA 4ECRA 3IRXA 2RKIA 4NLGA 4TN2A 1HQEB 3C6TA 3GIJA 2XI3A 2YKNB 3QGGA 3I0RB 4G1QB 4IG3B 2RDJA 2WHOA 1LW2A 3I0SA 4DG1B 5HBMB 3G86A 5HP1A 1HQEA 4O3RA 4IFYB 2HNDB 4J9NA 4EYIB 4M94A 4NLYA 3RBEA 2YKNA 2V9WA 5HROB 4G1QA 4IG3A 4DG1A 3QZ7A 3OHBA 3FFIB 1TQLA 2D3ZA 2FVQA 4IH6A 4RZRA 4QWCA 4DL6A 4Y2CA 4IFYA 2HNDA 3FRZA 4YQWA 4IR9A 2FVPA 3KK1B 5HROA 4EBEA 2ZD1A 3BSCA 2YNGB 2ASLA 2ZE2A 1HPZB 5KG2A 5EDWA 3FFIA 2R2RA 5KFIA 5KFSA 4F4YA 2IC3A 3KNAA 4KHRA 2YNGA 2XCAA 3LP0B 4JV0A 5EWGA 1C1CB 1HPZA 1TV6B 3KHGA 4H54A 1DTTB 4EBDA 1LWEA 2VA3A 3OLAA 4TLRA 4HKQA 4NLVA 2HWHA 4IH7A 4QPXA 1IKVB 4ICLA 3LP0A 4O44B 1S0MA 2R2TA 1T05B 1HYSB 1N48A 4K4ZA 1DTTA 4GC6A
chains in the Genus database with same CATH superfamily
2D3O1 2DY9A 2FY1A 2RQMA 4F7VA 1FWPA 5DGBA 3PR4A 4ZHRA 1NXIA 2KVIA 4CNZA 1ZPWX 4FBUA 3HZEA 4Y2MA 2AZ1A 4MYUA 2E1MC 3K57A 1QJHA 2DGOA 3T5HA 1GTHA 4LF6F 2RT3A 2PIIA 4ECVA 5FDLB 3SV3A 3VZHA 5ETSA 1IR0A 1SB6A 3DDKA 4RKUC 2PO4A 2YNIA 2XO7A 2XMWA 2I5JA 1HD0A 2W25A 5EX3A 3RBZA 2DHHA 4FNHA 2FHJA 1BY9A 2EI5A 4F0KA 1SC1B 4WK1A 4F3MA 2P2CB 1HW9A 2R3VA 3M8RA 4MKYA 2R7XA 1UW9A 2WOMA 3GSDA 3V5RA 4MYTA 2Q3PA 3OUYA 1OSDA 4ZPCA 3I0RA 3NS5A 2B7BB 4P2XA 2W9AA 3FBFA 1U0HB 1DY3A 1NB7A 2ZZNA 1RXOB 1FRLA 3OTCA 2XNRA 2VQEF 2CNLB 3KK1A 1GEHA 4GRSA 1HHTP 1N5YA 2KZMA 4QIWD 2V2ZA 4EFAC 3KNGA 4O3NA 1D09B 2DT9A 1UEVA 3TZZA 3KLHB 3CVKA 4HTJA 4USVA 4NYPA 3RB4A 1OIAA 4KGXB 5CYQA 2DNKA 4QYZJ 2DNPA 3AXMA 4M5JA 1RISA 4AT1B 2GIRA 3AY0A 1JXVA 4C0OC 5DM6Q 3D2WA 2XYPB 1U25A 4ECTA 4ZPVR 1TL4A 1VR6A 1X9SA 4AQYJ 3MUVP 3A3NB 3RZAA 1RTJA 2HBZB 1VIOA 2VKZG 2R42A 1M5HA 4DLGA 5GMEA 2KVQE 2GO9A 3IO1A 4LVNP 2MQLA 2M70A 2OSQA 1RWMB 1WHVA 2AU0A 3MUTP 4NMXA 4F2SA 1PIEA 4ECQA 2MZ1A 4I2PA 2F63A 5AE1A 1JLQA 2N7CA 4XDCA 1S6QA 5H9FK 3SFGA 4U8YA 4JUZA 4OZ0A 3VAFA 2PMZD 2DHSA 3CD7A 4JI5F 1L3TA 2K8GA 5M2UA 4IH5A 4OZNA 1H98A 4UZCA 5DO2A 2FTRA 5CYJA 4DQPA 3HHLB 3GIKA 4L74A 4Y2IA 2XTJP 2EG1A 2AGOA 3AD7C 2AGQA 4B9TA 4ZLLA 1B64A 3Q8RB 3VF0B 4RW7A 3HJVA 1Q1KA 1HNIA 4C0BA 4IR1A 1DARA 2JVRA 3DLKB 2GVDA 1R0AB 3G6YA 5GAGI 4U67Q 1GX6A 4DV1F 5LSOA 3QAEA 2QFIA 3ZTQA 2QE5A 4J91A 3NGRA 2E7WA 2VH7A 4OHVA 2QA4S 2AX0A 1PYSB 2DVIA 1X4AA 5H1SV 3T9NA 3NL0A 2IMOA 3J7Z5 4QBUA 3FQKA 1WUUA 1NRKA 1FWKA 3NNAA 2CG8A 1GMWA 2GZOA 2H9ZA 5KFTA 3VZIA 1VRUA 2FHJD 2YQ3A 2RAQA 5IZHA 2RS2A 4TKTA 3PYEA 1DURA 5F8IA 2GMHA 3CO9A 3D6HB 3BPSP 2BDPA 3HLUA 2ZH2A 2L08A 3PEJA 4Y34A 4LRAA 2DXFA 2H5IB 2GQ2A 3VHQA 3H2VE 2C28A 4ES3A 4PXDA 4ZJLA 1AW0A 2WOMB 4X64F 1B70B 2HHTA 2E1PA 3I0SB 2H65B 4ETXA 4HACB 2JZ5A 1A6LA 3I0RB 4LF8F 2CZVC 1OQ6A 4DG1B 4K2JA 1RKJA 1TUGB 1R0CB 3GG0A 2UU9J 5A6WA 3PO4A 3H8YA 4QWCA 4RZRA 2Y1RI 3C46A 3FRZA 1NKCA 3KK1B 4GKJJ 1CJKA 1HPZB 1T9YA 1AZSA 3KUHA 2R2RA 1IXKA 4PZVA 4I1TA 2EBGA 5BJRA 4OYOA 5CQGA 5EWGA 3C2PA 3DHWC 2ACYA 1X5OA 1ZBTA 5GADU 2MGZB 3LUYA 4FVMA 1T9WA 2Y0BB 5F8NA 4TU9A 3SBMA 5T14A 2WONA 3VVUA 3BGRA 2RDDA 2XEXA 4X84A 3LANA 2AEJA 2WTFA 3DHXA 5D15A 4CLSA 4DS4A 4DV3J 4UOGA 1JLCA 1UJ6A 1RTJB 1R0BG 2ZBIA 3Q22A 4NMLA 3SI8A 3I31A 1PILA 2AF6A 2DNNA 5CYMB 3OVBA 3TX0A 1RADB 1M90T 3QT7A 3TX8A 1XR7A 5T41A 1B0TA 3GR1A 1Q8KA 4ZPBA 4DQIA 1KVIA 1K1QA 2VA2A 4I2PB 1NO8A 2EFQA 1YJ9S 1AT1B 2NZ4A 2UV8A 3R27A 3GWCA 4U9RA 2NUUG 3N28A 5HI7A 3WC2A 1OPZA 1BHNA 2ZBPA 2F40A 2ZOFA 1SV5A 4NXNJ 3D4JA 1K8AT 2GIFA 1QSYA 2CIMA 3RRGA 1YX2A 4OJ1A 2HHHJ 3DRRB 2XWYA 1JMTA 1U48A 5K8MA 3MR7A 2HRYA 2U1AA 4KR0B 1KD1T 4RW7B 4E0DA 2HBQB 1HNIB 3R97A 2OPPB 2DCLA 4IFVB 3OVAA 1R6YA 1EP4A 3DOKA 1CC8A 2QA2A 1TFWA 1FDDA 1O6XA 1L3UA 3ICLA 1DTQB 1FA0A 2W2NP 1RWOB 4P7VA 5AJ3F 4I6WA 1KP6A 2J9EA 3TO8A 2DIVA 4DU8A 2XI2A 1ZTWA 4DV6F 5J2PB 1FJCA 1GMWD 2CQIA 2HLUA 2N4DA 3GYGA 2CQGA 4WFNQ 1WKJA 2XSJA 3SSSA 1FEEA 3ZNUA 2OD6A 2DB1A 3MD1A 2ZDPA 4XPCA 1KQGB 2ZH8A 1RGVA 1NPKA 2A2CA 2HAIA 4NLSA 3T1YF 1U1MA 5THWA 3M32B 5GAEU 3TANA 1NSPA 1VQYA 2PFDA 1V6HA 3HSZA 4CM0A 2KTQA 4ZS6A 3SQOP 3UD5A 1TKDA 4MTPA 1TL3A 5D0RA 3FJ2A 5CH7B 1UVJA 4BWMA 2BEFA 5EN1A 2MPUA 4B3SJ 1RA6A 1SUQA 1V5IB 3Q23A 1PJ5A 4DPOA 1F60B 2RHSB 3G4SS 2J7WA 3VAKA 4F25A 1HBUA 1UP1A 1XNQF 5KFMA 4LF7F 1RLDA 3J7A1 2L9NA 3HD1A 1BMQB 4MFBB 3FEZA 1U1QA 1BQXA 4RO0A 2J8SA 2JC0A 1N52B 4RWWA 2VFRA 2XO6A 1IBKJ 2NPIA 4PG6A 3BGRB 4ELVA 3KDNA 2RRBA 1HNXF 1RKIA 3IRWP 4R5PB 4F0HA 3H4BA 2O67A 2RQCA 3VWSA 1TVRA 4FXDA 2HHXA 4CLKA 4LFBF 3TAMA 2Z30B 2KFNA 2C1EB 5KG4A 4LFCJ 1IKYB 2FJVA 3PJWA 1FF2A 4CLWA 5KFYA 5A8KB 2CQBA 3GILA 3KJQB 4M63A 3UO0A 2RU9A 2XG8A 1M5SA 5HN0A 4ZLPA 1TL7B 1RHUB 2MZJA 4JI7J 5E3QA 4I7FB 1V3ZA 3ETOA 4IOCQ 4DV0F 3MI7X 3VGVA 3LW5C 1DZ5A 2K2PA 3GQCA 2DNYA 4ILMA 2YKNB 3ILLA 1NCLA 5KTQA 2WAQD 3JXOA 4JI1J 1CLFA 3THVA 3QZ7A 3FC9A 3CMQA 5HROA 4EBEA 2HHPA 3OFGA 2IC3A 4YOEA 1MN9A 2FJEB 5JVGQ 3PIOQ 2DH9A 3TAPA 4ICLA 3AH6A 1HYSB 1M0SA 3O44A 1MROA 1LWCB 3GPAA 3OL7A 2DNZA 2JNJA 2FZGB 4Q2MA 4NCAA 4K0KF 4NXMJ 2OPQB 4ZLNA 1FERA 4ILRA 1TUVA 5IM0A 2A1BA 3MM8A 4IQXA 2RF2B 2RS8A 3P5TL 2GJ2A 1QAYA 2DNLA 4U7UD 4U7UK 3QWUA 1QM9A 4CO0A 2PGCA 3PYFA 2DRBA 3VGTA 5KFCA 3U7JA 2R2UA 2JOQA 3LP2A 5HVGA 3BO2A 3FBEA 4RNNA 5LT5A 4E8UA 1FNMA 3TUPA 3OFFA 5B0GA 3MM5A 3BPDA 2JVOA 2K7KA 5DG7A 2VG5B 1BE4A 2LVWA 3M2VA 2D7SA 3MMAB 4WFAQ 3W5XA 1TL3B 2DHGA 3SZ2A 2AT1B 3Q8YA 4DUYJ 1SCJB 4NLXA 5B0BA 1UVIA 5K8NA 1SUQB 3FKBA 2G4BA 4IG0B 2FY8A 2EBEA 2MDAA 2MKHA 4WU3A 3MTKA 3TUZC 4NZ6A 3DRPA 1SL2A 2E5LJ 3BQ1A 3CNQP 2VFUA 4KH1B 5A76A 1Y10A 2FQQB 3RB3A 1X7VA 5J2MA 1TV6A 1QAJA 1TL1B 4JP8A 1GMVA 4USUA 3MMJA 1Y0HA 2XCPA 1KNZA 3U1MA 4IQMA 2LXIA 2DY1A 1GFWB 4AQYF 3ZTSA 4M5DA 4ZVOB 4PPDA 2YNFA 1PKUA 5BYSA 4ZP7A 2WVEA 3POTA 3AHPA 1PC4A 2CQ0A 2LXUA 3RRKA 3TAMB 1B7FA 3NLCA 1FRXA 2RQKA 1GNKA 2CJYB 5L9NA 1S1TB 4AXJA 1XWLA 4JI2J 3MMBB 3IS9B 2SXLA 4A48A 3PW5A 1QDUB 4CO3A 4ZVRB 2GO8A 3M1VA 2CQPA 5KG6A 4WTYA 1HQ2A 2F65A 1JLBA 1G7CB 4PXCA 1HBNB 2PA3A 3CJ5A 1PYOB 1QSSA 5KFLA 2HQDA 4QIEA 5JMNA 3NBPB 3TRGA 2D9PA 3CD6S 2YPZA 3L7UA 4FVCA 2ZH3A 2PT0A 1S4EA 1K44A 4K50A 4YS2A 2C3MA 1NK5A 1N32F 4NE9C 5L9XA 1D9DA 2K1RB 2IC3B 3EGVA 1U2RA 4I2QA 3RBDA 4EO8A 4JI4J 4ICLB 2RD5C 3QZ8A 1Y3KA 4S0MA 1MROB 2LU2A 3UD4P 2KRBA 5G4DA 3MECA 1VOMA 3M2UA 3GV5B 3VAGA 1B0VA 2JX2A 4TYBA 2XWXA 1H72C 3NEKA 2V50A 1T9TA 1LNQA 4M1KA 1H7WA 1NKEA 2CFXA 2JEGA 2IVYA 5KFGA 2NYIA 3JB9k 1S57A 1UW4A 4MH8A 2HS4A 4RUBA 4DFKA 2Z56B 3LP2B 2F9DA 8RUCA 2VFSA 2B51A 3MFIA 4CM2A 2HPUA 3NS7B 2MTLA 1WDDA 3CF5Q 1N34J 1FEHA 3RTVA 5FJ4A 3N6NA 4BLGA 4ZVHA 1NK0A 3M2VB 1X5TA 2FGCA 4DQRA 4OMFG 4ZPWR 3AT1B 5DGAA 1LEOA 3DLJA 1C0TA 1YK9A 4OYXA 1LW2B 1S9EA 3AOBA 2F8MA 5A8RA 2C2OB 2QTWA 2RKIA 4YFUA 3PX4A 2FZCB 4C8MA 3QGGA 3Q2SC 4G1QB 3PIPQ 4ITSA 4NLYA 4DR5J 1B4SA 4Z7YA 2NCKL 1N56A 3LP0B 5HMZA 4BC9A 4FN5A 1TV6B 1A9NB 2AW0A 4YN3B 2VA3A 4NLVA 1FCAA 1S0MA 4LMZA 4YUDA 3D0IE 1NSAA 3PRDA 3NWRA 2EFPA 2W9BA 5ETNA 4X4VA 1HMVA 1AXQA 2WW4A 3K5NA 2ZJRQ 1Q16B 3W1YC 3OL8A 2M8HA 5DZ6A 4FKXA 3VQTA 4R8UA 4ZN3A 3CE8A 1Q5YA 2MSSA 1WNEA 3WZ0A 2CRLA 3DLBA 4PG5A 3CEDA 4J9PA 1VK8A 1ZETA 1K0TA 2MKSA 2X51A 2GGPA 5ETRA 1RTZA 1WC4A 1NHVA 1P1LA 1G3OA 5LSLA 2DNGA 5D4OA 3S8SA 1E6YB 1WF0A 2XS5A 2CKWA 3RAQA 5AE3A 2BE2A 2AMCB 2XMKA 2DR9A 5I42B 1OQ3A 1H0HB 2HEKA 2ALZA 2PI5A 2HHHF 1N54B 4KB7A 2D3UA 2XYGB 3QNWB 4KGVB 1EJ7L 5ETKA 2WW8A 5C5JA 5A8WB 4B9SA 1M5OC 2JH3A 2VICA 4WBFA 4DN0A 1X4BA 4O3SA 3L09A 1CJUA 3LGHA 3G71S 4OV6A 4Y00A 1UEUA 4ECSA 1HNZJ 2B4PA 3DRSB 1VIXA 4A8KA 4NZ7A 2VDHA 1HBMB 1S0NA 3W9JA 1PBAA 2E7VA 3OJSA 3R7NB 3KK2B 2PE8A 3OD2A 3O1LA 5CABA 2W8KA 3MOJB 3D6FB 4DBQA 3CD5A 3PCOB 3W2WB 4F4ZA 4ZDNA 1REVA 2R4FA 4BDPA 4DL4A 5IFMA 1SI9A 1F9FA 1Q8BA 4TU8A 1I94F 2ATCB 3DGPA 3JTPA 1C2PA 1YTYA 1U4BA 3N5FA 1X4HA 3A13A 2XLJA 1KRPA 3NS6A 3BSOA 3Q8SB 5U47A 3Q8PB 2EFOA 1WC5A 3ZZRA 3MM7A 9RUBA 2QLXA 3V81A 2CG4A 3M2RA 3FGVA 3EE3A 4K4SA 4B02A 2MSTA 1JLFA 5B0AA 2ASJA 4WE1A 3FCVA 3UI3A 2ZOGA 3KLGB 1S9GA 2FPHX 4LQ9A 4F02A 3ZZ0A 2D1CA 3EZ5A 1U1LA 5ETVA 2RKIB 2FHMA 5C42B 4J9VA 1J5OA 1JK9B 1FRKA 2NQPA 5EWEA 2B4OA 2J9DA 3IM9A 4U8VA 4CLFA 4WJBA 1KQKA 1KWMA 5KFUA 4YB6A 3HJFA 2FVSA 2ZH7A 2IYIA 3JAMY 2JJ4D 3S01A 3PFEA 1NNDA 4PKDB 1AB8A 2HFUA 5EX0A 2CQ2A 1CBKA 1RWWB 1R8HA 4LUBA 4PR6A 1QTNB 1YKWA 3G6VA 2AJ1A 4OJ3A 4WTOB 3A8KA 2R8HA 4ZPTR 2QMXA 1DJ0A 4DUZJ 4RW6A 2MKYA 3W3SA 3HVAA 1LW0A 4URGA 3B82A 2W9BB 1SJFA 1HMVB 5M2PA 5KT7A 4OHXA 1TFYA 2FJBB 3M8QA 2YKOA 3BSAA 2LQ8A 2ZEJA 1SJ4P 4Z37A 2MY7A 3E3XA 4FF1A 1W7WA 2CPJA 1WF1A 1M1HA 4FYYB 3W2VB 3QAUA 1HI0P 2ZH6A 2GGPB 4FYXB 5HMYA 3DU6A 3UN5A 2ZNZA 4WXWA 3EPGA 3MGJA 2ZBQA 3M8PB 4CT9A 4G65A 3MM6B 1WG5A 5C7PA 4DX6A 4LIWA 5K14A 3R2CJ 2VD3A 5AXMA 4JI1F 3P4UB 2ZH5A 2LFVA 3QIPA 1RWPB 3IRXB 3R3TA 2ZKTA 2E1CA 1HD1A 1RCXB 4WZMA 1KOHA 4USIA 4F36A 4ZVTB 4IG3B 3BBBA 2FYXA 4U96A 4B17A 2ZFHA 3ZZOA 4LF4F 1YJNS 3M8YA 1FDBA 4N41A 1HWKA 3M4XA 5AT1B 1CJUB 2FVQA 4IH6A 2HNDA 2FVPA 1YRUA 3BSCA 4HVZA 1SIZA 5LOQA 1YZ7A 1NK7A 4JV0A 1Q7LB 3K59A 3OR2B 2HHUA 2OIHA 4CNYA 1EARA 5IV3A 2EKNA 9ATCB 2C2KB 2R2TA 3CPWR 3NY0A 1U2FA 4OI4A 2JWNA 4YDXA 1JX4A 4O23A 4NLRA 1X5SA 3R5AA 4F67A 4P7TA 2D9OA 1AA1B 1JJ2R 4HH0A 3GLJA 2A0FB 4KJIA 2V2QA 2OUGA 4ED6A 1SJRA 4DXLA 2RE1A 2NLWA 2XHCA 2B4VA 2UVVA 1JLGB 2MY8A 3FQLA 2C3OA 3IGNA 4M5HA 3HHDA 2KJWA 4DUYF 2ZZTA 1F0XA 4M8LA 2J0WA 3M2RB 2D69A 4QJVA 2GX8A 4USJC 3JYTA 2BMBA 3TAQA 2PN6A 1I1GA 2LA4A 4ECXA 3ILIA 1S9GB 1HBOA 2H5EA 2G2OA 3V6DA 4NRTA 4WFBQ 4RW8A 4FNIA 1SJ3P 3G96A 2BE9B 4JI8J 3EVWA 3GIRA 2ZM6F 3BGUA 2ZVIA 3MDFA 4ES2A 2GVZA 3MWBA 2QIFA 2F8EX 5ITHA 4J9UE 1IUJA 4DR6J 4QU6A 1CJTB 3IBCB 5J1PA 2CJ9A 3D28A 4PXEA 5HATA 2OFHX 5ETOA 1BLUA 2F8HA 4XAKA 4WF9Q 3HCXA 4RW6B 1Z2LA 1URRA 1LW0B 1M1GA 4JYAJ 5B7WA 2VKRA 1QY7A 4O4GA 3PW2A 3VAIA 3CJKB 3NCPA 1U1RA 4JI2F 2E44A 3CSKA 4K7QA 1DBDA 2LDYA 4I6AA 3IA0A 1YRTA 2I6WA 5KFPA 3HM9A 2DITA 1TUWA 2I2YA 2ZBRA 2GNKA 1WD6A 3PRVA 2YWGA 2CJKA 2VV5A 4HT7A 2HAFA 3CCUS 4RL1A 2BJ3A 4NEYA 4NLOA 2IRUA 1VFJA 1UWBA 2XMVA 4DV4F 1JLAB 1U2CA 2HKEA 5A0YB 1ZM2A 1WI6A 3R5DA 2KFYA 1S9FA 4EGLA 5I3UB 1HI8A 4DR2J 4ZIVA 4X4RA 2ZH9A 1BD6A 2BKPA 2FD2A 3TA2A 4RW4A 1UL3A 3I82A 4PPZA 2HVEA 1VQ6S 3BM7A 3HFVA 3MXHP 5CD4H 2DJWA 4DSKA 2DISA 4Q0BB 1S99A 3R5BA 1FE4A 4CLZA 2EPIA 1Y00A 5C24B 4DZDA 1KSPA 4BCAA 4OX6A 3BH7B 1HL6A 2DH7A 1C0UB 2R7WA 2YPYA 1FFWB 2XSFA 4C3KA 2HQGA 2V8HA 1HNWJ 4XO0A 3JSMA 3CCJS 4X4QA 1PJ6A 3W5YA 2HQ3A 1HNVA 2CPIA 3GSIA 2UUAJ 3UWTA 1X5PA 1VQKS 1T9VA 5KFJA 1BWEA 1TL5A 2W9CB 4PRFA 2FLLA 2B9XA 2XMUA 4WFYA 1EIYB 4UQTA 2NR0A 4J9SA 4LF5J 5D0EA 2UXDJ 1SC6A 3FEYB 1FX4A 1J5EF 4TY8B 2BM0A 1IVZA 1PG5B 4OL8A 3LALA 1YJVA 4YDDB 4HI2A 3R7SB 3UW1A 3W8PA 3CMES 3AA9A 2EWHA 3BKUA 3P6YC 2WSFC 5L1JA 4FS2A 2VC0A 2X7IA 1U7LA 2NXCA 3V6DB 2BRKA 3NRBA 3BR8A 5K20B 3IWNC 3VAMA 3LGNA 1P9YA 2UVRA 5ADZA 5HP1B 1DRZA 1HQEB 3GIJA 1D9FA 1CS4B 1NZAA 2LXFA 3G8QA 2MHNA 3NGKA 2IBOA 4M94A 2CPZA 1HA1A 2DGVA 1GQEA 1EKRA 3O5TB 1QTMA 3FFIA 4KHRA 3TEHB 1IQZA 2J9CA 4ALZA 1LQ9A 2HWHA 2KHDA 3FBCA 4P71A 4Y28C 2J9DE 4RW9A 4MJKA 2Z2ZA 1PO6A 6FDRA 2Q79A 3EXYA 1FKPB 2VQEJ 5FIIA 2MJNA 4QR0A 3CJ3A 3QBCA 4FYDA 3Q89A 2GJFA 3PNIA 2ZC3A 2B8PA 3DKDA 2Y1IA 2R7VA 2CDRB 2CWXA 1U1KA 4PAAA 1RWKB 3H98A 2HWIA 2W7AA 1X4EA 3PJ9A 1TU0B 4ZIWA 4KE5A 2DGXA 4DV5J 1TR0A 1WORA 4PYDA 3MPYA 2BZ2A 4KT0C 3ILOA 1YVFA 4USHA 2B6AB 2NREA 2KU7A 1VS3A 1WOSA 4U7CA 1XTZA 3K5OA 4DQQA 1S7IA 1CVJA 5F0WA 1UKUA 1H2VZ 3TJ8A 2DYAA 5IQ6A 1EETB 5IC6B 3BO4A 4C9DA 3UVJA 2ZNYA 1LWXA 2AEFA 2DPIA 2LA6A 1YJWS 3QT5A 2XC9A 2ROGA 2V4JA 2C3YA 2ZH1A 5L1KA 2HVIA 2E7XA 4L3NA 3I4PA 2LDIA 5HQ8A 4CO2A 3CW2C 4QQBA 5BYRA 1AROP 1OPIA 1UMJA 2Y8WA 2HK3A 1XC9A 3K8VA 4B9LA 4OHYA 3H5YA 4B3MJ 1D3WA 3G9CA 5CHCB 4OJGA 1H2UX 2LMIA 3AOAA 4QWBA 4RLEA 1RT6A 2IM0A 4QYZK 2HWTA 2AJFE 2VG7A 2P9CA 4DV1J 3N79A 1JKHA 5CXTA 1F1BB 2MKKA 1IJEB 1WSRA 1T02A 3JAMU 4FF4A 1IBLF 2W24A 2PFFB 2N3OA 3N01A 3CJ4A 1FJGF 1O0PA 2O66A 3ZZZA 3KOAA 3ZNJ1 2YX1A 5K8OA 2ASYA 4G3IA 5L1IA 5AXKA 4WP3A 3KYLA 1MLAA 3KLEB 3QO9A 3HFZB 3C15A 4TXSA 3VAHA 3S1TA 5IT0A 1J2VA 3FK4A 4CQ1A 3B8HA 2FJDB 2OTLS 3C16B 4NCGA 3FMBA 4RWXA 4DUZF 3PACA 3TA0A 2R7SA 2V69A 4J37A 3JSBA 2D41A 4MKAA 3NXZA 2QL7B 3TP2A 4IDKB 2B0GA 4HH1A 1VQLS 1VBZA 1FRIA 1Q79A 3KHHA 4DSLA 4OIXA 4ER8A 3M30A 3R5JB 4LF8J 1GTEA 2H48B 4DPUA 4Y2AA 4RW9B 3KLVA 4X62F 3V6JA 1H7XA 3W60A 2HMIB 1R27B 2YNHA 3IMQJ 4WCEQ 4QZVB 4N77A 2ROPA 5A2QY 1HI1A 4K4VA 1FK9B 3RJMB 3TQ1A 2BJ9A 4FPRA 3CIMA 3HI9A 2EXUA 3EGZA 5D4PA 4A8WA 1RT7A 2XHWA 5T7LB 3W64A 3HVTB 1U6ZA 2KYZA 1LK7A 2B3TB 1TKXB 4ED7A 2Z58B 1NJYA 3BR9A 1T3OA 1BC6A 3BSNA 4K2XA 4QW9A 3BJYA 3N0VA 2CA9A 4PUOA 3PVXA 1YWXA 3MAAB 1PCAA 3BH6B 3ZFVA 3M6XA 3LOUA 3EPIA 4PYAA 4ECRA 2VZ9A 2QT7A 2BOPA 3GFZA 2HFVA 2CNKB 4J90A 3WX4A 4IFYB 4J9NA 3OXLA 2V6AA 2JLGA 1S0VA 2LQ9A 4JV5J 4DL6A 4P72A 2YNGB 3N4WA 2ZE2A 5EDWA 4CLLA 2QSWA 4H54A 1DTTB 4EBDA 1VC6A 2Z2YB 2WVDA 3SCJE 2R7QA 4G6VB 4I0WA 4O44A 4MIBA 3L7PA 4USWA 2AGPA 1VLOA 2HGNA 2U2FA 1RQ0A 3QLHB 1KEKA 1SBRA 2IA0A 5ETMA 4YY3F 2OP5A 1RAFB 4JV1A 2NXEA 5KFQA 3L95X 1VQ7S 2XS7A 2DXEA 4F26A 3BGOP 3M8ZA 2Q6BA 2NZCA 2W7PA 2J6TA 2VC1A 3H20A 1R31A 4P6QA 1S1XB 1VCTA 5KT3A 2VJUA 3AJ2A 1F2GA 1HIYA 3C8YA 3LPYA 1IQTA 4DR7J 3A3PB 1RTHB 2X3DA 4Y6IA 2HHQA 2YVSA 3V4MA 4F04B 3BN7A 3NOCA 4M5GA 1XMQF 1EZZB 3HDSA 2UUWA 3DC2A 2IJRA 3C15B 3GJRB 4DR6F 1FI4A 1U49A 3NNHA 3UPFA 3RBXA 3J80Y 1FKOB 2VL1A 6AT1B 1P9QC 1YITS 2IBKA 1U0HA 3NGUA 3MEGB 3SQGA 4JYAF 2BYCA 3OQ2A 3AFGA 2OPRB 1KFSA 1JXEA 2YQ0A 3QJPA 1GT8A 2A2DA 4YB7A 1RWXB 2BQ3A 3RGIA 1T9UA 2G0JA 1R8CA 2BKOA 3BYRA 2FJAB 3DLLQ 4LFAF 3AA8A 3KLIA 4DOZA 2GQQA 1XNQJ 4Q2LA 4WYLA 2CNNB 2R8KA 4QU7A 3R8YA 1TMMA 2ZITA 2WSCC 2VG6B 1AFIA 2DIUA 4B3OB 1RT1B 3KWMA 1YDLA 3PKMA 1XMOF 1PBUA 1Q81T 2UUCF 4F3OA 1IR1A 5LM7E 2V0NA 4ZKAA 2M4MA 4OHWA 2UP1A 1RI7A 2WZ1A 4XPEA 4ZCMA 1RYRA 5DETA 4Q43A 1WF2A 2JSXA 3WHIA 2HSEB 4I4BA 1OY8A 4OI3A 4KYZA 4OV1A 4PUOB 1GAOA 3OFEA 5ETPA 4EUVA 5DQHA 3EGWB 3EGNA 4QPTA 2BBEA 3QFHA 4V1Ak 1RBLA 2CPYA 3R2DJ 5EHHA 2UV8G 1T8EA 3JSRA 4HI1A 2XMAA 3EYZA 3SSQA 1YHQS 2IHR1 5DQGA 3HHLA 5DDOC 2ZE2B 4DSJA 4NYZA 2B9WA 3HULA 1Q8IA 2ZJPQ 4LSLB 1HNWF 5KFRA 4NPOA 5GMDA 4WIQA 3TZXA 2DRDA 3RW6A 1X4GA 4CLUA 2UUAF 4LREA 1RTDB 4DX8H 2I1RA 3SYZA 4ATNA 1REGX 4ZCKA 4TY9A 2IVMA 2IDLA 4LF5F 3DLKA 2MMYA 1R0AA 4NRUA 4DX7A 2UXDF 1S79A 3OR1B 4ZVUB 1EB0A 1PGZA 1R8PA 1S6PB 4NA3A 2ZKUA 2RVJA 5B08A 1XR5A 2DGQA 3G6XA 1OWXA 4K0KJ 5GMKa 3OV7A 4KGMA 1MMNA 4J7CA 3J81j 3OBIA 2OFGX 4ID5A 1FVSA 3MPVA 1F9HA 1KBRA 4WZQA 2DNHA 3FNNA 2DCUB 4TU7A 1X31C 3ENQA 2PSZA 1S77D 1CULB 4RBTA 5KFOA 1FESA 1YJUA 4GVBB 4HHJA 2DH8A 2E1RA 3HSJA 1U6BA 3I0SA 3OJUA 3A1YG 3ZZUA 4HACA 2EFGA 2HZVA 3RBEA 4UY8T 5DDPC 1PAUB 4DG1A 2DR8A 4DPXA 2RIJA 1DFDA 4C8NA 1NM2A 3K89A 2AV5A 3SQGB 4JI3F 3DN9A 4A8YA 1FRJA 2OLWA 1HPZA 2VBWA 4LF1A 1U0SA 3AB4B 1IKVB 3KKFA 3HSGA 3IBFB 4GC6A 2PA8D 5H9EJ 3KXDA 2DEJA 4KO0B 2MGZA 4J9RA 3AB2B 3KLIB 3E8OA 2I0XA 1S10A 1HWUA 1QLNA 5C25B 1MNEA 1GH8A 3DM2B 4N8OA 1KVJA 1HHSA 1Q78A 1FKAF 2GA7A 3TZYA 2QLWA 1RT4B 2ACMA 1N8RT 4P2SA 2BX6A 2GIQA 4DV5F 2XS2A 5DG8A 4NA2A 2EK1A 1Q53A 2YXLA 1YIJS 3ITHB 1E6VB 3DLHA 1FVQA 2DGSA 1RJJA 1FFSB 1LK5A 1KLMA 5CYMA 2DR7A 2BKNA 3KDOA 3F41A 3GTYX 2F5GA 5F8GA 1WHWA 2DPJA 1NJWA 1S1UB 1BQMA 2YKMB 4DPYA 4C48A 3T5JA 1RT2A 3HHLD 3IM8A 4OX9J 3TARA 3C3LA 3D68A 3PW4A 4OX7A 3GJSB 2FC9A 2XGQA 3F73A 3I6PA 5B0DA 3B78A 1RTIB 2HLTA 4H4MB 2ZDOA 4QIVA 3DRRA 2BM1A 3G82A 2AYBA 2GJIA 2HYIB 4B3MF 1VHIA 2MLZA 2FIUA 4A46A 3OL6A 3SSRA 1WC0A 1KKHA 2OPPA 4IFVA 1KHWA 4DS5A 5E3CA 1JJHA 4FPIA 1N32J 2ROEA 4OHZA 1DTQA 1S4FA 2XYHB 3HSDA 1NMEB 3I96A 4DF4A 1OO0B 3R1LA 5J2PA 4MIAA 2BANB 2CADA 3LGMA 3IN5A 2OEJA 3P96A 2KM8B 1RWNB 3E01A 3MMCB 3G2XA 4YR2A 2IJFA 3HT0A 2JDJA 5E3PA 1FD2A 4ID5B 3BZQA 2P9EA 3M32A 5KFKA 3MEKA 4DUTA 2J5AA 1RT5A 4ECUA 3UDLA 2Y1LB 3VV2B 2YQ1A 3PKYA 1P6TA 3BDPA 3RR7A 1U24A 1B7YB 2MLYA 3WBZA 1Y5LB 4FF2A 3SCKE 5MAOA 5HVHA 4ZLJA 4IRKA 3LTOA 3W9HA 5LMNF 2OPSB 2GMLA 4K4XA 4DX5A 4Z7CA 5F8MA 5A2QU 4ETZA 1WKKA 1TK8A 3HX9A 2CQ1A 5E2QA 4H4OA 2IYGA 1DQ9A 4MFBA 3IG1B 4ED2A 1LXNA 2ADCA 1NH7A 4LF2A 4FXWA 5KFDA 1EAYC 2ERRA 1WI8A 1PSDA 2E5IA 2J76E 5IT4A 4ENOA 2ZWOA 2O3DA 1ITPA 1K9MT 3HZGA 2JFKA 2ZZMA 3EICA 4Q8FA 4JBCA 2LYVA 4I69A 5C2GA 1JNZB 5IQQA 1RU2A 3CJ8A 4DQSA 3PJXA 4E2FB 1CG2A 2QZ8A 1S0OA 4R5PA 2OSRA 2EG2A 1RT3B 2HHWA 1RZMA 1LOUA 4YEAA 3GP9A 3B4DA 4WP8A 2Y3YA 2UZAA 4CIOA 2RRNA 4OI2A 4OYZA 3RAXA 1IKYA 1KLMB 4C7QA 1L3SA 3CCWA 3NGTA 4CCHA 5A8KA 3MPDA 3RR8A 3TZWA 1F6TA 1BQMB 1L3VA 4QIGA 1FTRA 1TL7A 5HLFB 2N3LA 4JV5F 3UN3A 3KHLA 3C6TB 1RT2B 4I7FA 4X66J 2GAHC 2CPHA 3TOQA 1UJ5A 1X8DA 2NXNA 4M5MA 4HEA9 1KDNA 3Q86A 3X1LB 1N36F 3J81Y 4N76A 2YKNA 2QYGA 4ED4A 1TTHB 2IPOB 2M88A 2M3DA 3H0PA 3X3UA 3NP5A 3G82B 1UVNA 2QA1A 3CDAA 1UWAA 4EMDA 1DHMA 3MFHA 1KS2A 4WKRA 4USMA 1NEEA 4ANDA 1VQ5S 4ID8A 1HYSA 1QE1A 4ANCA 2RNEA 1LWCA 1G6BA 1L3KA 1P27B 2JFDA 2FHKA 3FRYA 2UUTA 2MKCA 3WDOA 2KG1A 2H51B 4CH7A 2OPQA 1CQNA 4DR7F 2RH3A 1MWYA 2DD8S 2RU3A 3SCLE 3ENVA 2RF2A 3FSYA 4ZITA 5HO4A 1RA7A 2XMJA 4JB8B 2GW8A 1Q5VA 3BO3A 3WIUA 3US5A 3E01B 4IYQA 3J80U 3H4DA 2E5HA 2B8QA 5DQIA 2ZC4A 3QYYA 3I9V9 4A8SA 4BBYA 4R25A 1I94J 1VRTB 8ATCB 1JB0C 1HWJA 1U8WA 1RT5B 1BXNA 2ATLA 3AJDA 4TQSA 4KSEB 2UXBJ 3OTEA 2J7UA 2HURA 2VG5A 4ZP9A 5G0RB 3MMAA 4OYMA 2HBYB 2HBRB 2C2NA 2KRRA 1SL0A 2V63A 3BS9A 1YJTA 3EZUA 5HBMA 1RAHB 1FDAA 4LQ3A 4CDIA 4IG0A 5MLCV 4UUWA 1UVMA 1N4LA 1F3VA 1RK8A 2CQCA 4K4WA 4C8KA 4H4OB 2RILA 1SH3A 1P8GA 1M5KC 4CLYA 1RAIB 1S1WB 5J2QB 1CJVB 2LCWA 1Q4RA 1U26A 1TL1A 3HHKA 2PDAA 1D1UA 2CPEA 3M8WA 3OSNA 2P6SA 5CD4A 4LVOP 3D5MA 4M5LA 3CJQA 2DNMA 3KJVB 2WRMA 2FVRA 3UE2A 2QO3A 4CRJA 4NL5A 1V9OA 2EKYA 3VVTA 4I6YA 3HHLC 3M9MB 2M7SA 1L5UA 2IA6A 3GB0A 1DAXA 5FLXY 3PY8A 1MMLA 5KFBA 1NLKL 3NMRA 1UVLA 2ADBA 4AD6A 2AYEA 2JL9A 1N88A 7FDRA 2JRSA 4A8XA 3OPKA 1ZA1B 2XY6A 1IM4A 3AXKA 3UN2A 1S1TA 2D3OR 3MMBA 4OZ1A 4XK8C 4EEYA 1TKTA 3IS9A 3ELHA 4N5SA 1SC3B 3P3DA 3MEEB 1NDPA 4ZN1A 4PABA 2EC2A 5EWFA 3CC7S 2MQPA 2B9EA 3EUNA 2YWHA 2L48A 2VQFJ 4DCPB 2CDQA 3ET6B 3K2YA 5F3TA 1VJQA 3UNGC 4NI2B 1YSJA 5J2NB 1HBNA 4ILLA 1LFWA 5KFVA 2VF3A 1V3SA 5E0OA 2MYFA 3CTRA 1LV5A 3R9LA 3NBPA 1SQGA 4DSFA 1K73T 1PJ7A 4DZ6A 2K1RA 3JTNA 1X0FA 3K17A 4X4UA 5D3GB 4LF4J 3QQCD 2H4YB 4AUKA 4ZK7M 3QPIA 4B9MA 2C22A 2B5JB 1KTQA 1QE1B 3DGVA 2AP6A 3UDVA 2FLOA 2CPXA 1I5OB 1VGYA 4LR9A 3NNCA 2B9YA 3W5ZA 5F9NA 4KAIA 1MN7A 2RDIA 3HPOA 1FE0A 2F4VJ 2E9ZA 1HFEL 4MAKA 1S59A 1AUDA 3GCWP 5HANA 2IRYA 2KYXA 1T03B 5SUHA 3OSPA 2QA4G 2C42A 3R7BB 1N33F 5KG1A 1IM6A 3CD0A 1Y5NB 4KKOB 2IRXA 3MM9A 3KTQA 1WWHA 2ZHOA 3DI6B 2HZAA 1S97A 4IKAA 1A0OB 3BN4A 3UQSA 4PWDB 4E98A 2NPFA 1YBAA 4LT6A 1YI2S 1F9EB 3D6TB 4LRCA 1QVGR 2E1AA 1LW2A 5HBMB 5B0FA 3OTOF 1N5QA 3JQKA 4G1QA 2QEXS 1TQLA 2WBMA 3O8WA 5KG2A 3I32A 3M7VA 3OXGA 1TK5A 1YQHA 3I4HX 3LP0A 2ZM6J 4YB5A 1U02A 4C3LA 5LL6d 3RU0A 3DNCA 2J6UA 1NSKL 4OJHA 3SDEB 2BXJA 3QGIA 3GMGA 1K1SA 1H2TZ 4KV8A 2V2VA 1P1TA 4ECWA 3FZ2A 3ISZA 1VJWA 1UETA 2X3GA 3KHRA 2CJXB 3B6BA 5DLFA 4KIAA 1TK0A 5IT9Y 5I3PA 4UTGA 4AL6A 5DRKA 3SFUA 3DOLA 5CCMA 3HMJG 3GIIA 2YKQA 2LLZA 3BREA 2BACA 4CLTA 1TKTB 1VQNS 4JI0F 1R89A 1X60A 1MG7A 2NUHA 4OX9F 1E6YA 3MEDB 4P10A 1X0PA 2W4CA 1C1BB 3Q83A 4FDFA 1VDHA 2F4FA 1IR2A 1VQSA 5I42A 2FJWA 1VISA 1NK6A 2CJBA 2APOA 3S6EA 4F4AA 1KC8T 1RBOB 4DN9A 3WX8A 5A8WA 4L3KA 4MK7A 3SMZA 4PQUB 1EKSA 4FS1A 4DV4J 2OJ3A 5F3ZA 3SXLA 1NHUA 3BV8A 5LXRA 1N0UA 3DRSA 1C1CA 2RUGA 2DGTA 3EVMA 1HBMA 1ZTTA 4P52A 2HRUA 3CT9A 1WTBA 3T1HJ 2C2MB 3KK2A 4NZ0A 3TR5A 3HT3A 2YKAA 2V2KA 3GYNA 2CVIA 4OX8A 4PQAA 3W2WA 3H90A 5HJYA 4KGZB 2W4PA 2BW7A 2VOOA 3GZ7A 5D4NA 1WJ9A 1I6JA 1GK8A 2J8AA 3V4IB 3IR5B 3UFCX 2VU5A 1NB2A 2QMWA 5AE2A 4KC5A 3H7HB 1T3NA 4RNHA 1NK4A 2L9WA 4GKKF 3IBWA 2UVWA 4J9OA 4CO1A 4ANEA 1IWAA 3PW7A 2AJ0A 5KOWA 3LWLA 1Y7PA 3MM9B 4LR8A 2BJDA 2BW2A 1CPZA 2HVDA 4RNOA 1S48A 1JWWA 2DNOA 5HL7Q 3C6UA 2X1FA 5F8LA 2CAJA 1RU1A 1KN6A 4UOHA 3CO0P 1J5EJ 2H4WB 3KLGA 4PXBA 4KTQA 4O0IA 2ZHAA 3D6MB 3U27A 1K0VA 2PEBA 1TELA 4KBIA 2Z57B 5C42A 1OS5A 4KHPF 2QYCA 4N8NA 2E9TA 3Q0AA 2HRTA 4OZ5A 2HNYB 1ZM4A 1RHMB 4FP9A 3EZOA 5HMXA 3KFWX 5LJ5Y 3D54A 2KHCA 1X9MA 2MXYA 5L39A 4OYBA 1HQUA 2DGUA 1PYTA 4DV7J 4CO5A 5CCLA 1NJIT 4Q7AA 3D0HE 4WXOA 4KV8B 3GFHA 3K5PA 3T6BA 7AT1B 2YKPA 3CJRA 4GVLA 4UF4A 1HHQA 4F2RA 1FJ7A 4KPYA 4M5KA 1WACA 1XNRJ 3P8BB 4ELTA 3EJMA 4LIRA 3QFWA 2A10A 3W2VA 3W9IA 4DSIA 1XEZA 3DOLB 3NWGA 1CC7A 3J81U 2PMWA 4X66F 1LKZA 1X4CA 4JI6F 3KJFB 3QGHA 2FB0A 5DG9A 4RU2A 2BJ8A 3M8PA 2VBYA 4ED1A 3LAMA 3MM6A 5L8RC 1SH2A 5KFZA 3S7RA 3PW0A 5F9LA 3DMJA 2VPZB 1SKRA 3OT9A 2XLKA 1A7GE 1JJ4A 4F50A 3TWZA 2FDNA 3IRXA 1FTCA 4TN2A 2HS3A 3DCAA 3IAM9 2V5HG 3J7YI 2EK6A 3TVYA 3U1NA 1Q82T 2V9WA 4IG3A 1WEXA 3DU5A 4BS2A 3VTIA 2LQBA 4P75A 4IR9A 1RCOB 2QRRA 4OI1A 3L4BC 2I8EA 5KFSA 1C1CB 5GAGU 4C8LA 4QPXA 1N48A 3OR2A 1T11A 4X2BA 3NCQA 2KXFA 1WSVA 4ZHRB 5DZ7A 4B3TF 1RABB 1TMJA 4O3QA 5KG5A 3W61A 2HNZA 3K0JA 5KG7A 1M5VC 4AL7A 3M6VA 3W66A 2CQHA 2VPWB 5D77A 5KFAA 3FMWA 2R8IA 2BABA 3ZTRA 4DL5A 2OMOA 1SQEA 5AXNA 2KI2A 2UXBF 1JLGA 2MKIA 4DSEA 4EYHB 2R7UA 4L73A 4OZJA 2MHEA 2R9LA 2YNIB 3L7OA 3G87A 2I5JB 4PG4A 3FBBA 1WC6A 4AE5A 2BJEA 3C6UB 1RAGB 3QATA 1ZAWA 3KUEA 2GCFA 2ZJQQ 3OUYB 1U1NA 3J7ZT 2WB4A 2DHXA 2QN6B 2G13A 2W2PP 1NKBA 4CP5A 2X1GA 1VHFA 1IBLJ 2JLEA 2DO4A 1FJGJ 1ZZNA 3H5SA 3W8GA 2XQCA 3MCNA 4WFZA 1RUSA 1S72S 3NMAA 1N5YB 3GR0A 3AQOA 5FLXU 1KTVA 2O1PA 1CJTA 3I5BA 1VBXA 3NKYA 1WG4A 2LQ5A 3CCES 2QJ3A 3CMAS 1Q0NA 2OKQA 5CYQB 2QL5B 1F5CA 4MK8A 4HLBA 1HQUB 5LSRA 2KT5A 4CTAA 1WEZA 2QMUB 1FXLA 2QX0A 3M9NB 1OY9A 1FRMA 3J7AN 2DHAA 2CJAA 2HG4A 5K5MA 2HHVA 2BJ1A 1S49A 3CJKA 3IWLA 1R6VA 5LJ3Y 5LMUJ 3KG1A 2F3JA 3CCZA 4X62J 5IV4A 3D3CJ 3PEHA 4KFBA 5B0CA 1FD8A 2H5JB 3Q8QB 5AXLA 2VQFF 5KT4A 4WP9A 3VQSA 4C2MA 4WWSA 4HYKA 1JLQB 2GMJA 1S6QB 3GIMA 3HHEA 2CWKA 3MHYA 2XCAA 3DMJB 4USTA 2UXCF 1OSCA 2KB2A 3A3OB 1JLAA 5BYQA 5KT2A 3VALA 2IFXA 1SVDA 5A0YA 4QWDA 5DLGA 1FO1A 5I3UA 1RHRB 4WIIA 3W63A 4IOAQ 4ECYA 1MMDA 5BXIA 2L9DA 3L9ZA 1HR0J 3MD3A 1FRHA 4OLPA 2LEAA 1ICEB 2GVDB 2EFVA 1CSJA 2HFNA 4Q0BA 2F4VF 2NSBA 4TNOA 5C24A 1ZS6A 1VC5A 3HKZD 2VBZA 1JQGA 2CQ3A 1UCNA 2HNZB 5DJBA 2F7VA 1C0UA 2Z4PA 1C4AA 2FGOA 1IBMF 4GC7A 1BQNA 1DLOA 3O6QA 3T5KA 3U02A 5D0HA 2V68A 4UT4A 2OI2A 4RR5A 4PWUA 2W9CA 2E66A 1XBWA 1VRUB 2BV3A 1D8ZA 5IXUA 2M5YA 4EK2A 4P2FA 2Z2MA 1QUPA 5KFNA 2OELA 4DL2A 4TY8A 2IIHA 4YY3J 3CDBA 2DKOB 2Z2LA 3MR6A 2J0SD 4NCBA 4DU7A 4YMEA 3HXMA 4KQZA 4D3GA 2GS8A 4UQGA 4NLPA 3TUJC 2R7RA 2HGMA 1FDNA 2CPFA 3IAS9 5HP1A 1HQEA 4EYIB 1CS4A 4AXIA 1XERA 2OEKA 1X9WA 1CJKB 2HZCA 3OHBA 1AZSB 1XMQJ 3MCSA 3W7BA 3ZZYA 3G6ES 3LWMA 5L38A 1X4FA 2EEYA 2P9GA 1U47A 1LWEA 4UUXA 3HD2A 5IT9U 2AWZA 2AJ2A 3QJLA 3TQEA 3ZO7A 4CTAB 4DR4J 1R3NA 3A4TA 2WONB 2V67A 1KQFB 1HW8A 4CYUA 1FKPA 2BUNA 3I87A 1H73A 1HKAA 2OHDA 3KK3A 5CZVA 1LFPA 3FEXB 1JLCB 3D1OA 1QUVA 4GO5X 2YX4A 2N7YA 3OL9A 2OTJS 2QLJB 3DDNA 4LFAJ 3EDQB 4KFBB 3FVYA 1LXJA 1VC0A 3QRPA 3LQVA 3QT6A 2NS1B 1VQ8S 3E51A 2AYGA 1IKWA 4CT8A 4ZMMA 4CZCA 2HQFA 3SV4A 5E3AA 5KFXA 4ED3A 4OYAA 3D0GE 1XMOJ 4I56A 2UUCJ 1ZPVA 4KGKA 3PDNA 2B6AA 3CC4S 4HDHA 3MCMA 1SV5B 2Q6CA 5D8HB 1G2EA 1RSCA 4W4MA 1ULRA 4DL7A 3T1HF 5I4MA 1UJ4A 1EETA 1XQIA 2QLFB 2CZ9A 4F8RA 3JTOA 3V6HA 2GHVC 1EP4B 3DOKB 3KJNB 4OLOA 3N6MA 2C3PA 3CC2S 2MQMA 2VFVA 2WCXA 2AJ4A 2Y0SD 2QV6A 2ILYA 3IWXA 1N5SA 1D0EA 4ED0A 1RBAA 1FXRA 1BQNB 2XSJB 1DLOB 4DCJB 5HQLA 3CB4A 3O2IA 4RBUA 2YWWA 5D78A 1JLEA 1SL1A 2JEFA 4MK9A 1KLNA 2IM2A 3MAHA 5H9FJ 4M5IA 4KPCA 4CH1A 2WVCA 2Y1JA 4ZPAA 2DTJA 5J1EA 1ZZFA 3BGFA 3MZIA 2YWFA 2LP4A 4MT1A 3LA0A 2IY5B 1FWLA 2KL8A 3HKWA 1T9XA 1MW7A 3OTDA 1NDLA 2XGPA 3KLEA 3UR0A 2HGLA 3D3BJ 3TYTA 1HBUB 2GC8A 2K3IA 1Q86T 3BB5A 1Q8LA 1NJXA 3C16A 3IR6B 5EGYA 1F3FA 1VQ4S 1QVFR 4W92B 4NWBA 3QMQA 4L76A 2V4QA 2HIQA 4DV7F 4JV2A 4IDKA 1LWEB 1SQFA 1F2HA 4IRDA 3M6WA 4GO7X 1GX5A 3BKFA 1SJQA 4O4RA 2H3EB 5KT5A 3DLEA 3CCMS 1MU2A 4GMKA 2A6OA 4CYUB 1XNRF 4JI3J 2WSEC 3KK3B 2CZ4A 2EVZA 2IAJA 3H40A 2HMIA 1TVRB 4IOBA 3T3FA 2KG0A 2CYYA 5GAHI 2GFFA 3DYAA 4WFXA 3QWPA 4G1IA 2A6MA 1FK9A 3CGIA 2Y8YA 4B9UA 4ZVGA 3CWJA 3EMTA 5D0GA 3CJ2A 1Z2ZA 5HJXA 4NA1A 4I64A 4X4TA 1NZ8A 1IKWB 5T7LA 1UA1A 3NG8A 1R8BA 2DNQA 3HVTA 1OYDA 3OXFA 2E29A 2VONA 2XB2D 2HW3A 1VK3A 4U6PA 4WKYA 3VR1A 3TNVA 1TKXA 1M1KT 2XMMA 4RUHA 4J5OA 1NUEA 3ZTPA 3PM9A 5LXYA 2MEWA 5IWAJ 4NLGA 2M0GB 3DXSX 3MAAA 5CZXA 2HQCA 4PCQA 2WB1D 3RYLA 3O3LA 2HFSA 3M6UA 5HROB 7FD1A 4C6AA 1KFDA 5IC4B 2D3ZA 2C2EA 4Y2CA 4IFYA 1AYEA 4QOTA 3G8SA 1NBEB 3Q8UA 3P5BP 4C8OA 4L75A 4USKA 2YNGA 3R5GA 1ROFA 1NAQA 4MKVA 1DTTA 2M2BA 2EFNA 5KOXA 3TUIC 4ZA1A 2W01A 3D66A 4ZJQA 1FNXH 5JVHQ 5IM0B 2W2MP 1NDCA 2IM1A 2MQQA 1RAAB 2ABYA 3WIVA 4I67A 4DDFA 4ZOSA 3MM8B 2MQNA 5H9EK 4URSA 2ZUGA 3QLHA 4ZCIA 1EQMA 2VJVA 2JHEA 3OTBA 1W2BR 3MPUB 4NLWA 1N6QA 3HK2A 1JLEB 3THTA 3PTWA 4OFZA 2YWKA 4R0JA 3GJQB 4QW8A 4DL3A 2BJ7A 3CCVS 1S1XA 3MM5B 4C3MA 2J7KA 4MIWA 5J1EB 4EZ6A 1HLWA 1RTHA 2UU9F 5D6GA 5E3RA 1KOOA 4GKJF 2LKZA 2AQ4A 2W1BA 2HIYA 5IS2A 2MZQA 3ZZTA 2RUSA 4UZBA 3ONQA 2Z0GA 4X65J 4HL9A 4L6V3 4LRDA 3DRPB 1U1PA 2G1HA 1RHQB 4G1PA 3GCXP 3HVWA 3PRBA 1FKOA 4KY3A 5J2MB 3AJ1A 1CEZA 4ED5A 1S12A 1SJ1A 3MEGA 3BQ0A 1B99A 4ZVSB 4FKYA 2RMLA 3EX7B 4DV3F 1RB0A 4PWWA 4DR3J 2OPRA 4M5DB 3D1HA 2FC8A 3ISND 1Z4UA 4LBPA 1VBYA 3QJJA 3DLEB 5LMUF 2J0XA 2YNFB 2AKWB 3T19A 4IUFA 1MU2B 5LMNJ 2WVFA 3A8JA 3V6KA 1N0VC 3DRXA 3BKTA 3POTB 3IGVA 2IAJB 2M8DB 4B9VA 1PC5A 1JXLA 2PC6A 2QG9B 3PYDA 3DYAB 2VG6A 1FNOA 1S1VA 4I68A 2MKJA 4B3OA 3QSIA 4RPFA 1RT1A 1S6UA 3R6LB 4CO4A 2R7OA 1TKZA 3QGPA 4L72B 4X4PA 5K8PA 3LO3A 2HHSA 4A47A 4QWEA 1MWZA 2LU1A 2Y9HA 5DS7A 1WG1A 3M1VB 4NXNF 1DQAA 5C2CA 2MQOA 3H5UA 2V8VA 2ZOMA 1UPMB 3J7YU 2W2QP 1YLXA 3I5AA 1JLBB 4UOCA 3LAKA 2P8IA 1GXTA 3PG9A 3OLBA 2K06A 1HR0F 3PR5B 4EWTA 3A8EA 2X1AA 1RE1B 2I9SA 4Y3CA 2COLA 1NDKA 1RP5A 4ZP6A 1UPPA 4I2QB 4LF9J 3UCUP 3NAHA 2BE7D 1NJZA 4CI0B 2OEMA 3BBCA 3MECB 3M2UB 2DO0A 4P9SA 4LSLA 3D1QA 2XBPA 2R7TA 1WKLA 1T94A 1N36J 3LH2S 1RTDA 1S7HA 3I5CA 1EQ0A 2XULA 1YGYA 1BGXT 3KG4A 4C4WA 4MKBA 4O0NA 1WOOA 3G8TA 1NU4A 3OR1A 4RNMA 2CUYA 1SKWA 3IXQA 1QAXA 1N6QB 2P6TA 3BF4A 1S6PA 2RJZA 4DCOB 5F41A 4QIFA 4OI6A 2GQCA 1SKSA 4J9LA 4AYBD 3ZXWA 4ZPDA 4B3SF 3PO5A 1UTAA 3BQ2A 2QC3A 1YBUA 4FYVB 2K3KA 1LWFA 1XJWB 4XIUA 2ALYB 1BWVA 2JEJA 4N56A 1C0TB 2Q66A 3MCOA 2W4DA 3BYPA 2J0QD 5CAAA 1S9EB 5A8RB 4C97A 1MSWD 3TEGA 5KT6A 3R1HA 1CULA 4C8ZA 1VBKA 4GVBA 4DJBA 2XI3A 1S76D 2A18A 2QSFA 2PD1A 2XNQA 1H3DA 2KT3A 3RUBL 2K7JA 4KH0B 4DR4F 1F5BA 1IBKF 2Q43A 3SCIE 3KNAA 3ZC4A 4IH7A 4YB1P 2VASA 1HWIA 1IKVA 2RB7A 2AZ3A 2BA9A 1G4CA 2OH2A 1ZA2B 4ELUA 2HFOA 4UW2A 3K5LA 4KO0A 2QLBB 1Q95G 4R8UB 4LFCF 3LF0A 3ZTOA 4CH0S 4WK3A 1SPBP 4ECZA 2VBXA 1K47A 5C25A 2DK2A 2BVZA 3DM2A 2V4RA 1S1VB 1W25A 3ULHA 4QWAA 2B4UA 3CDWA 4JI7F 2DNRA 3BBFA 1Y4ZB 1RT4A 5CA5A 1TKZB 4ERDA 3FDSA 4B3RJ 4P73A 1IKXA 2R8GA 4RBVA 3FZBA 3ITHA 5E5NA 3NAIA 1E6VA 1WC1A 1ZOTA 2BE2B 2AJQA 2CNOB 2I38A 1U1OA 3DLGA 2WK4A 2DR5A 3K58A 3PFOA 5BR8J 5HK4A 3GE9A 4OZ2A 3Q2TC 1XR6A 1S1UA 3F44A 2OMLA 5SZTA 3PYGA 2YKMA 3A12A 1RHJB 1H74A 2V8GA 4F4KA 3NCRA 2XMTA 5F8HA 2XZDB 4H4KA 2DGWA 2KJVA 2JC1A 3AD8C 2FLPA 2M9KA 3K5MA 4NXMF 1RAEB 4ES1A 5JXSA 1T7PA 1KONA 1N5TA 3VGUA 3PX6A 1RTIA 2QL9B 4H4MA 2MQ8A 2L3MA 2G2ZA 2JEIA 3KUGA 1VQOS 3DXBA 5B0EA 3QIDA 1REVB 2N82B 2VDIA 2H54B 4DI6A 1OYEA 3V2UC 1IN0A 4NOHA 3DGPB 4IO1A 4ZP8A 4DR1J 1QSLA 2XLIA 4LBIA 2KKHA 4K4TA 2BQRA 4YR3A 4LRFA 4RUCA 4HDGA 3MM7B 1NPPA 2BANA 3ILJA 3V81B 2ZBCA 3FCWA 2G2YA 3N6LA 4UY85 2G1DA 1JLFB 3L3CA 3F56A 4WE1B 1JJCB 3MMCA 2PI4A 1W2IA 3JSYA 4P2MA 3VCDA 1LWFB 2E5JA 4EZ9A 3ISNC 2E5LF 3H2UB 3OW2R 1VI7A 4DEZA 1J5OB 2RRAA 4NLDA 1S6OA 1N33J 1SH0A 2NSCA 1YJRA 2J6SA 3RB6A 1ZM3A 4DFMA 4O3OA 3RW7A 2DRAA 2G0IA 4EO6A 2AD9A 1XK8A 1U45A 1OMSA 2IM3A 1YJ7A 2CPDA 2ASDA 2RHQB 4A4JA 4Y65A 3GYXB 1NSQA 4X4NA 2OPSA 4NX9A 1ZH5A 2AEMA 2VB6A 1J27A 3Q8VA 3CDEA 3R6GB 1U8SA 4U95A 4WU2A 1UFWA 4Q44A 3OTOJ 1R43A 1RAOA 3IG1A 4RX6A 3IR7B 1PAEX 3N5BA 4EBCA 1B3TA 3M8QB 2Z8QA 4M95A 1WELA 4DMZA 1QAIA 3U1LA 1D8YA 2CQ4A 2KO1A 4RU9A 4B9NA 2R8JA 4KHMA 4BC7A 1C4CA 2FZKB 3UNYA 5JUMA 3WC0A 1UAWA 2POKA 2YBVA 2YY3A 1HARA 1XN9A 3FSIA 3JQJA 3VAJA 4YHHJ 1IKXB 1RT3A 4HHUA 3I9ZA 3Q24A 1NHKL 3CJTA 2MZTA 4K4UA 1R7IA 4ZCLA 4Q5VA 3HVRA 5K14B 3FSXA 5IWAF 1OJ4A 2HQIA 2BOAA 2VPYB 3QIPB 3DLGB 2HFZA 2R2SA 4J9QA 2CJQA 1WC3A 4K8RA 1B0PA 2GAGC 4ZVQB 2P5VA 5HLFA 1UZHA 4JI4F 1GXUA 3MPWA 3C6TA 3AODA 2WHOA 4JI0J 4DL0C 5RUBA 4O3RA 5IOLA 2HNDB 2VHGA 2V8DA 2KT2A 4W98A 5HQMA 3K7RA 2UUBJ 2ASLA 3H25A 4B08A 1UFKA 3QSYB 3OLAA 4HKQA 1AFJA 1VQPS 4X4SA 4NYOA 4AFFA 2KXHA 2G9OA 2V8PA 3CCLS 5J1NA 2IMWP 1TAUA 2VPXB 3TJ9A 5KAKA 2VIHA 2DEIA 4DV2J 4OYIA 2E9RX 4A8OA 2AHOB 2YWEA 4BWJA 3EM1A 1N34F 2KFZA 2H1YA 3CCRS 1VYAA 1VQ9S 6FD1A 1O8BA 3GFXA 1V3RA 5HVFA 4V19J 1RWUA 3JS9A 3CCSS 2YX7A 1ZAVA 2QGFB 2E5GA 3JYTB 3VGSA 4LBHA 1NPRA 4D3HA 2C2RA 2XZTB 3C14A 4HTIA 1HBOB 4LF6J 4DR5F 1WHYA 2OD4A 4X65F 4RW8B 1VRTA 3UR3C 2G0CA 3M8SA 3IC1A 4GKKJ 5B09A 2C2ZB 3CJSA 3H2LA 3NGSA 1H38A 4RUAA 2GVZB 2CXEA 5G0RA 2BQUA 1D9AA 2B56A 3RRHA 4Y2KA 4A8QA 3PZPA 4DR3F 4FXVA 3GONA 3TVZA 2JLFA 2DBBA 3FUYA 5KFFA 4PG8A 2OAUA 2NXJA 3PHEA 2HVZA 1GXLA 1S1WA 4KHPJ 5J2QA 1WDTA 4RJVA 2ZVSA 3HHNB 1ZM9A 4O4GB 1CJVA 5GAHU 2GHWA 5KFWA 4NLUA 4HT5A 4HHHA 3KMQA 5GADI 2L41A 3KJVA 2KXNB 3KLFA 3DRYA 3TJAA 1ZAXA 1S5ZA 1WOPA 1ELOA 4K5SA 2KH9A 4N7TA 1QD1A 2AYMA 1YZ6A 1UVKA 3DOMA 2MZSA 1KHVA 3H59A 2C3UA 1VRQC 4KRWA 3OHAA 1UWBB 1OY6A 2YH0A 3CDUA 4K4YA 3C19A 2V9KA 2DXDA 4DLEA 3GU0A 3MEEA 1HNZF 3C66A 3R5CA 2LQJA 4J9MA 3HFKA 2MLXA 1KR4A 4M5NA 4OYWA 3AAWB 3K8WA 4LF9F 5GVQA 4JI6J 4A8MP 5DM7Q 4DPTA 3ET6A 3MAQA 2FJXA 2ZWPA 3UDCA 4RW4B 4NI2A 5A6PA 5J2NA 4LSZB 3RG6A 1UA0A 2XY5A 5ETQA 3CXCR 1RWVB 4JI5J 1Y11A 2IJNA 1IBCB 1FX2A 4MMOA 3D67A 3PHTA 3GV8B 3MR2A 3JQMA 3DFEA 3T1AA 5HMWA 4F0MA 5D3GA 2HS0A 3JSMB 3NGDA 2B5JA 1HNVB 1RAJA 3T41A 2B43A 4Q8EA 2NXUA 1FXDA 2EC0A 5JJBA 2GHPA 5E7OB 5KG0A 1YRXA 3PX0A 3W65A 4NLTA 4ZVEA 4UOFA 1FFGB 5HSPA 2OO4A 4B3TJ 2YTCA 2O01C 2AX1A 1T03A 8AT1B 4C8YA 2VFTA 2VODA 2MZRA 4F4WA 2VUGA 4DFPA 3C14B 2M52A 4KKOA 5HAOA 2F1FA 1TZ0A 1TAQA 5DDRC 2WBRA 2RQ4A 5L1LA 3DI6A 3UCGA 1EHWA 1SXLA 5GAEI 1F5AA 3TVKA 4PWDA 3D9BA 4QR1A 1W26A 4LRBA 3BDEA 3ZZPA 5E33A 1MWQA 2FHOB 3G86A 1YG0A 1I3OB 4N47A 4JOUA 3FFIB 3AOCA 4IO9Q 4C98A 4C0HA 2ZD1A 2W2OP 4X64J 2B7CB 4F4YA 4K5RA 1G1XA 4C11A 3B54A 2PEHA 1T95A 3EWGA 3B4MA 2PMHA 2V94A 2FLNA 4OYPA 5ETLA 1VLYA 1SC4B 3SDEA 2RSQA 4K59A 4O3PA 3ENAA 4B3RF 4J9KA 4F4XA 4H4KC 1RLCL 3T6JA 1FHTA 3MR5A 3KLFB 3TA1A 2XY7A 4FZVA 2W7OA 5KFEA 4LSNA 4Q45A 4DF8A 4ZVFA 5BR8F 1U6FA 3ETMA 3DOMB 1WEYA 2FVCA 3PXGa 4F3QA 3EVOA 4X4OA 3LP1A 1BUXA 2CVEA 3GJTB 4FF3A 2ZUAA 1UZDA 4OZLA 1M5PC 3CULA 1V5VA 4ZVPB 1UFLA 1IWGA 3MEDA 4TLQA 3CCTA 5L46A 3QRRA 1C1BA 5EUHA 2XM3A 4QYRA 4NEZA 1RYSA 3FCHA 2IVFB 4R0EA 3UVJB 4PG7A 4DWIA 1NH8A 3H5XA 4DFJA 5F8JA 1Z1ZA 1TP7A 4PQUA 4XTTA 2KM8C 2D74B 3MUMP 2ILZA 2UXCJ 3T5LA 3ENWA 2V4JB 1AUSL 3HF5A 3GG1A 3CUNA 2ZH4A 3MF5A 3CCQS 1VQMS 1SIWB 3OFHA 1T05A 4DR1F 2DR6A 4Z2XA 4CLPA 4XDDA 1I51B 2BR0A 4WPAA 4A8FA 5KFHA 2MB0B 1H6KX 4QCLA 2FUG9 2A3JA 3D7SB 1N5VA 2O5DA 1NK8A 1APSA 3E2EA 1XMBA 2UVUA 2N4CA 1DQ8A 1RT6B 2GV1A 1IJFB 3V4IA 2VG7B 4FYWB 3M05A 3TI0A 5AJ3J 1JKHB 4WYWA 2C2DA 1GMUA 2VOPA 3M9OB 4DV6J 5FDLA 1X4DA 4JI8F 3AD9C 2AIRB 1UEKA 1IBMJ 3EDRB 1T0TV 5FD1A 3I56S 3AQPA 1WHXA 1FJEB 1Y9OA 2LEBA 4IRCA 3MOZA 4EI2A 4ZJOA 1KVKA 4URQU 1U09A 4LJMA 1SKUB 1Q7YT 3QO9B 4DPWA 2BRLA 3KG0A 3T1YJ 3F0NA 1EX8A 3BEGB 5DDQC 3GV7B 3CIZA 4TVAB 4NCGB 3A8IA 4CWBA 3IP0A 3THPA 5D4LA 5I3QA 4BHQA 3RB0A 2ZHBA 3MR3A 2LEPA 4ED8A 4RNFA 4TYAA 3LPEA 1O5JA 2ZD1B 1JIHA 1HWLA 1Y5IB 4YR0A 3WQPA 3H42A 3M30B 4C11B 1RHKB 4HR2A 4W90B 2HNYA 4V19X 3P49B 3N9UC 3HP6A 2OGUA 2KDOA 3KMSA 3ADAC 3KLHA 3I55S 3OVSA 3CJ0A 4P74A 1URNA 2YNHB 4LF7J 5M2RA 1O51A 3P45B 4FBTA 3MTJA 1RACB 4YHHF 4OZ3A 5ETTA 1ZYQA 5E41A 2NYHA 3TW0A 1FT8A 1Y3JA 4DHVA 1NK9A 2XZWA 4LSNB 4Y0FA 1RT7B 1ACMB 3UD3P 1HNXJ 4OQJA 2V34A 1CQMA 3SEOA 4NLQA 1JNRB 2WVBA 3LP1B 1KQSR 1RDRA 4TQRA 5KG3A 2KN4A 1R8AA 1XIQA 4DR2F 2W8LA 4LFBJ 3NOGA 3MURP 5F0UA 3UDEA 4LR7A 3W62A 2F9JA 2HK2A 2MJUA 3QT8A 3PV8A 4NASA 2KZZA 2UUBF 2X1BA 4YP3A 4EU0A 4PEOA 2HVHA 2CQDA 2RDJA 3BGLA 2QFJA 3UCZP 3HO1A 3EXCX 4DV0J 2EW9A 4QR2A 1YBTA 2IDEA 2Q1LA 1WTFA 4YQWA 3IFEA 1VMBA 4AL5A 3RAMA 3DDIA 4DV2F 3T9ZA 5KFIA 2YH1A 5K9FA 2LECA 3KHGA 4TLRA 4O44B 3SIPB 1T05B 3QRQA 4K4ZA 3GFYA 4OI0A
chains in the Genus database with same CATH topology
2EFNA 5KOXA 1U2FA 4OI4A 1NEEA 3TUIC 1VQ5S 4ID8A 2JWNA 1HYSA 2FY1A 4YDXA 2RQMA 1QE1A 1JX4A 4ZA1A 2RNEA 1LWCA 4O23A 1G6BA 1FNXH 1L3KA 5DGBA 3PR4A 1P27B 5JVHQ 4ZHRA 2JFDA 5IM0B 2FHKA 3FRYA 4NLRA 1X5SA 2IM1A 2MQQA 2UUTA 3R5AA 2ABYA 2MKCA 4I67A 3WDOA 2KG1A 4DDFA 4ZOSA 2KVIA 4F67A 3MM8B 4P7TA 4CNZA 4CH7A 2OPQA 2D9OA 1ZPWX 2MQNA 1JJ2R 4HH0A 4FBUA 4URSA 3HZEA 2ZUGA 1CQNA 4Y2MA 3QLHA 4ZCIA 4DR7F 2RH3A 2JHEA 1MWYA 2DD8S 2RU3A 4MYUA 3OTBA 1W2BR 4KJIA 4ED6A 1SJRA 2E1MC 3SCLE 3ENVA 3K57A 2RE1A 1QJHA 2DGOA 2NLWA 2RF2A 4NLWA 1N6QA 3FSYA 5HO4A 1GTHA 3T5HA 4LF6F 3HK2A 1JLEB 2B4VA 1RA7A 3THTA 2XMJA 4OFZA 2UVVA 1JLGB 2YWKA 2MY8A 4R0JA 4QW8A 4DL3A 2RT3A 2GW8A 2PIIA 3FQLA 3BO3A 4ECVA 5FDLB 3SV3A 3US5A 3E01B 3VZHA 2C3OA 3IGNA 3CCVS 4IYQA 3H4DA 3HHDA 1S1XA 2KJWA 3MM5B 4C3MA 1IR0A 4DUYF 2J7KA 1SB6A 4MIWA 1F0XA 2E5HA 4M8LA 3DDKA 4RKUC 2J0WA 5DQIA 2ZC4A 3M2RB 3QYYA 3I9V9 2PO4A 4A8SA 5J1EB 4QJVA 4BBYA 2GX8A 4R25A 4USJC 4EZ6A 1VRTB 3JYTA 2YNIA 3TAQA 2PN6A 2XO7A 1RTHA 2UU9F 2XMWA 2I5JA 1JB0C 1I1GA 1HD0A 1HWJA 2LA4A 2W25A 5D6GA 5E3RA 5EX3A 4ECXA 1RT5B 2ATLA 1KOOA 4FNHA 1S9GB 2FHJA 1HBOA 2H5EA 4TQSA 4KSEB 4GKJF 4NRTA 3V6DA 1BY9A 3OTEA 2EI5A 4WFBQ 2LKZA 2J7UA 2AQ4A 4WK1A 4RW8A 4FNIA 4F3MA 2VG5A 1SJ3P 4ZP9A 5G0RB 3G96A 1HW9A 3MMAA 3M8RA 4MKYA 2R7XA 2WOMA 3GSDA 3V5RA 4MYTA 2MZQA 5IS2A 3ZZTA 2Q3PA 3OUYA 1OSDA 2KRRA 4ZPCA 1SL0A 3I0RA 3BGUA 2ZM6F 3ONQA 3MDFA 3BS9A 1YJTA 2Z0GA 4ES2A 3NS5A 3EZUA 5HBMA 2B7BB 3MWBA 2W9AA 4HL9A 4L6V3 1NB7A 1FDAA 4LQ3A 3DRPB 1U1PA 2ZZNA 2QIFA 1FRLA 3OTCA 2XNRA 4G1PA 4IG0A 2VQEF 2F8EX 5ITHA 5MLCV 4UUWA 3HVWA 1UVMA 1IUJA 1N4LA 3PRBA 1FKOA 3KK1A 4QU6A 5J2MB 5J1PA 1RK8A 2CQCA 4K4WA 3AJ1A 4C8KA 1CEZA 4ED5A 2CJ9A 4H4OB 2RILA 1SJ1A 1SH3A 3MEGA 3D28A 1P8GA 3BQ0A 4PXEA 2OFHX 1HHTP 1M5KC 1BLUA 2RMLA 3EX7B 1N5YA 2KZMA 4QIWD 2F8HA 4EFAC 4XAKA 3KNGA 4O3NA 4DV3F 4WF9Q