1JLFB

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
427
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 104
structure length 404
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlfB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB03
4RNFA 2OPRB 1TV6A 2RDIA 4H4OB 4ZPAA 5L9XA 2OPQA 4IG0A 1BQMB 3JYTA 3TVKA 3DYAB 1EETB 1LW0A 4RW4A 4Q0BB 2BQ3A 4ECUA 3OSPA 4OL8A 4ECTA 5CYQB 4O3OA 4LSNB 5J1EA 5I42A 1S1XA 4ZVEA 3PW2A 4NLWA 4EYHB 4EYIB 3DM2B 4IFYA 3BREA 3LALA 1XR5A 2RDJA 4TY8A 3T5LA 2D7SA 1LWEA 1D1UA 4MIBA 2F8EX 1C2PA 1J5OB 4EO6A 3JSMB 4G1QB 5DGBA 3RB3A 2FJVA 1S1VA 3IG1B 1LW2B 3G6XA 4K4ZA 4ECWA 1C0TA 4M94A 3CJ3A 2AGPA 1N5YB 2BE2B 4FS2A 1JKHA 2UUTA 5KG0A 4JUZA 1TQLA 3C6UA 4Q8FA 3SFGA 1TKZA 4DL3A 2C2RA 1LWCB 3KK1B 3HVWA 4ZPBA 1JX4A 3PJXA 1C0UB 4TLRA 3GYNA 3NKYA 4R5PA 2W9CB 4URGA 1HMVA 1I6JA 4EEYA 3DLKB 3V81A 5I3UA 3LP1A 3ICLA 4ZHRA 5KT7A 2FJXA 4IKAA 1VRUB 5KFUA 1EP4B 3KJVA 4PQUB 2BQRA 1DLOA 5C25A 3GV7B 3MECA 4NLUA 1XR7A 3T19A 4ZVHA 5KFWA 3LANA 4J9QA 4WYLA 4RW6B 1MMLA 4XPCA 4K4VA 3GQCA 2AGOA 4O3NA 5KT2A 2FVRA 2JC1A 5KFRA 3H2LA 4KO0B 4IR9A 5KFDA 2OPRA 4JV1A 4ED8A 4I7FA 1C1CB 1BQMA 3PHEA 5L1JA 4RW9B 3LAMA 3Q8QB 2HWIA 4QWEA 5HROB 3LP2A 1EETA 1K1QA 1RTJB 3SI8A 3N6LA 3MEEB 1RT3B 3TAMB 5CYQA 4NLRA 5DQIA 4PWDA 4LSNA 5KFEA 3KLVA 4ED1A 5KT6A 1DTQB 2HMIA 4ECVA 1JLAB 3IGVA 4WFZA 5C24B 1QE1B 2FLPA 1RYSA 1HQUB 3T5KA 3V6KA 1TL1A 1N6QB 1J5OA 3QLHA 3JSMA 4G1QA 4ZP9A 2IAJB 3FQKA 4NLYA 2HNDB 4TY9A 4B3OA 1N5YA 2BE2A 5KFZA 4H4MB 4IG0B 3HHKA 3MEGB 3JYTB 4U7CA 3V4IB 3OHAA 2AQ4A 1JLEB 2R8KA 4KBIA 2XWYA 3CWJA 2W7OA 1JLFA 4F4WA 3DOKB 4DG1B 1C0UA 3HVTA 2AX0A 2OPPA 5HBMA 5KFAA 3KLFA 3D5MA 5KFYA 2IA6A 3BGRB 4IFYB 3FQLA 1FKOB 4ED0A 4QPXA 1U09A 3PJWA 5KFIA 4JV0A 1LWEB 4ECQA 3NL0A 4I2QA 5DQHA 3QYYA 1RT6A 3GV8B 1UWBA 5KFVA 3IS9A 1VRUA 1EP4A 1MU2A 3LP0A 4ID5A 4RNMA 3I0RA 1C0TB 1S1TA 4JV2A 4O3SA 4KFBA 4K4SA 1RTDA 1RAJA 1JKHB 3BQ0A 2QV6A 1BQNA 3E01A 3C6UB 1TKZB 2I1RA 2C28A 1IKXA 4FBTA 3KLGA 5EWEA 3M9NB 4KO0A 3KLHB 3G86A 3QGHA 3H5SA 2YNGB 4ZVFA 5DLGA 4WXWA 1JLBA 2FLNA 4MKBA 3DOLB 4RW9A 4KB7A 4QW8A 3M9OB 4ECSA 3MEDB 4KV8B 2R2TA 2UVRA 5I3UB 3LP1B 4Y2CA 4ZHRB 4RUAA 3CJ0A 4YR0A 3PVXA 3H4DA 1N4LA 4NZ0A 3OHBA 3BQ2A 5KFSA 3PW4A 5C25B 2XI3A 1TKTB 3T5HA 1IKYB 1HPZB 3KOAA 4MK9A 1JLAA 4RW8A 1FK9B 3DRPB 1S9FA 1HYSA 2GC8A 1S0NA 3OL9A 3PR4A 2WCXA 3V6HA 3IRXA 5L1KA 4NCGB 3PZPA 2HNDA 1KHVA 1XR6A 2R8HA 2C2EA 3BSCA 3DDKA 4ECZA 4DEZA 4URSA 2FVSA 4I7FB 4O3QA 4H4MA 3NAHA 1S0MA 1S1UA 4IH5A 3MEGA 5KT3A 3DRSB 3LP2B 3V4IA 1JLEA 4TYBA 4MK8A 4EBDA 2YNFB 1TL3A 3DOKA 4DG1A 4PWDB 1Z4UA 4LSLA 3DLGB 2HMIB 5KFKA 4QWDA 3BGRA 1FKOA 4WE1B 2JEGA 1TL1B 3QLHB 4MKAA 2J6SA 1JLGA 4YP3A 4H54A 1IKWA 2YNIA 4B3OB 1SH0A 4KHMA 5HP1B 2ASJA 3N6NA 4YMEA 2RF2A 2I5JA 3CDWA 3BSOA 4K50A 3BQ1A 5DLFA 2R8GA 4QWCA 1JLFB 3KLHA 3UQSA 5EDWA 2XC9A 2ATLA 3CVKA 2YNGA 3HVTB 3PW5A 2OPPB 5HBMB 2WK4A 2HNZB 3KLFB 4J9SA 4G3IA 1T94A 1RTIA 3DOLA 2V4RA 4NLQA 3MEDA 4KV8A 3IN5A 2WONB 3Q8RB 4I2QB 1NHVA 3MR3A 1RT6B 4IH7A 1UWBB 4WFXA 2YKNB 3IS9B 1MU2B 3LP0B 4ID5B 2ZE2A 1TKTA 3I0RB 1IKYA 1HPZA 1S1TB 5J2PA 4KFBB 4F50A 1RTDB 3GV5B 2ASDA 1FK9A 4IFVB 1C1BA 4J9RA 4K4UA 3DRPA 1BQNB 3E01B 1RT2B 4ZVGA 3CJ4A 2ASLA 5KG5A 1IKXB 4GC6A 3KLGB 5KFOA 3MR6A 2E9TA 4ICLA 4NCGA 2W7PA 2AWZA 2IM3A 5F8NA 1W25A 4J9KA 1IKVA 1JLBB 4ZP6A 3RBEA 1KHWA 4DL2A 5DG7A 3PW0A 3DRSA 1ZTTA 3NGDA 1S9EA 3M8QB 4IRKA 2YNFA 3DI6A 5C42B 5KFXA 5CYMA 4HKQA 4J9MA 5K14B 4NLOA 1D0EA 3DLGA 2JEFA 2IC3B 4QW9A 3MF5A 4RW8B 5DGAA 5KFHA 2B43A 3GIKA 4WE1A 1HYSB 3CIZA 4F4YA 3H5YA 3V6JA 3IRXB 3RAXA 4WXOA 4I2PA 1RT7B 2OPSA 3DLEA 2J6UA 3RBDA 3I5CA 5HP1A 2R2RA 1S1UB 2XCPA 2FVPA 3KLEB 2R2SA 4NLGA 4O3RA 2IM0A 3Q8PB 2VA3A 3MR2A 5KT4A 1TL3B 3UDLA 3I5BA 3G6VA 5EWGA 4NYZA 4LSLB 3DMJB 2UVWA 3KNAA 2D3UA 4NLPA 2HNZA 3KHLA 5F9LA 1LWFA 2WONA 3ITHB 3OL6A 5KFTA 4KSEB 4EBCA 3CJ2A 4ECXA 3FSIA 4TN2A 2V4QA 2YKNA 4ZP8A 5JXSA 1JLGB 4MK7A 5KFFA 4YR3A 3OSNA 3CO9A 3MR5A 2HNYA 1IKWB 2CJQA 2YNIB 1S6QB 2YNHA 2YKMB 1OS5A 1IM4A 4IFVA 5EWFA 2RF2B 3UPFA 2I5JB 1RTHA 1RT2A 2VG6B 1NNDA 4URQU 4ED6A 4O3PA 2FVQA 3GIMA 1K1SA 3KHGA 1JIHA 3BSNA 1RT4B 4FBUA 5J2MA 4NLTA 3SFUA 1SUQA 5C5JA 4HYKA 3DRRA 3QZ7A 1RTIB 2J6TA 5D3GB 3QGIA 3CJ5A 4R8UA 3QIPB 3G6YA 1VRTA 3M8QA 1RDRA 4WYWA 3KLIA 2VG7A 5C42A 3D28A 1KLMA 2AU0A 3H40A 2W9BA 5K14A 1R0AB 2UUWA 4DL4A 2ZE2B 2IC3A 5J2PB 4J9LA 1S9GB 1RT5B 1S6PA 3HVAA 2XGPA 2BANA 3H4BA 1GX5A 5KT5A 1C1BB 3KMQA 2V0NA 1REVA 4DL6A 3BJYA 1RA7A 3N6MA 5KFNA 3H59A 4ICLB 1RT7A 4NLVA 3OL7A 1T05A 3QO9B 2V9WA 1IKVB 3LAKA 1S97A 1T3NA 4F4XA 4F4ZA 5J2QB 1TKXA 5KG4A 4TQRA 1S9EB 3KLEA 3EZUA 1HARA 1HNIA 3KK2A 1CSJA 3DI6B 4K4WA 5CYMB 3T1AA 4RU9A 2UVUA 3VQSA 3TQ1A 3DMJA 5KG7A 5T14A 4ZPCA 3KHRA 4Y3CA 2B5JA 3EPGA 2C22A 1RT1A 1FKPB 5KG3A 2E9RX 2IJFA 1S4FA 4KE5A 3ITHA 3EPIA 4XPEA 3GIJA 2WTFA 4X2BA 4IR1A 5KFQA 4ED7A 4I2PB 5HLFB 4DL5A 3HKWA 2OPSB 3DLEB 4U6PA 1S6QA 3GIIA 4IG3B 2YKMA 5F8GA 2ALZA 2AX1A 5KG1A 4ZMMA 4Q44A 3C6TB 5DG9A 2VG6A 4QWAA 5F8JA 4EO8A 2O5DA 3H98A 1S1WA 3E51A 4ZP7A 3QZ8A 2ZKUA 3KHHA 3RB6A 1RT4A 4YQWA 3KK3A 2XI2A 1ZTWA 2JEIA 4O44A 2HWHA 2IJNA 1LWFB 2IM2A 5D3GA 3Q8SB 3PW7A 4Y34A 2JC0A 3ISND 4O4GA 3QIPA 4K4XA 3NBPA 2VG5B 1YVFA 1SV5A 1JLQA 3I0SA 5L1IA 3QGGA 4ZPDA 5KFJA 1S0OA 5F9NA 1R0AA 4NLDA 4ED3A 4RNOA 2HNYB 2JLEA 1QUVA 1S9GA 1RT5A 2WRMA 2WOMB 2YNHB 3BSAA 5KFMA 4K4YA 2C2DA 1HNVB 4RNNA 4FS1A 3H5UA 1RTHB 1TVRB 4WFYA 2RKIA 2IM1A 3M8PA 5KG2A 5DG8A 4GC7A 5KFLA 4ECYA 4LQ3A 4MIAA 4KKOA 2FVCA 4Q45A 2B6AB 4KAIA 5J2MB 4IDKA 1SUQB 3DRRB 3QO9A 3UR0A 3MFIA 4NLXA 3IGNA 5J2QA 1TP7A 4R8UB 1VRTB 2UVVA 5FDLA 3KLIB 2VG7B 1WNEA 1KLMB 3V6DA 2W9BB 4NLSA 4LQ9A 1HQEA 5F8HA 2D3ZA 4MH8A 3RB4A 1S6PB 1S10A 5KFGA 4K4TA 2BANB 5J2NB 4IRDA 3M9MB 1FKPA 2BRLA 3NMAA 2ILZA 3MTKA 2DPIA 2ZD1A 4ED2A 1REVB 2WHOA 2EC0A 1QAIA 4WZMA 1QAJA 2DPJA 5HLFA 5JUMA 1JLCB 1DTTB 4H4OA 4RW7B 1T05B 1T03B 3BR9A 4IG3A 4R0EA 4RZRA 4EBEA 2JEJA 3FFIB 3DYAA 3C6TA 1NHUA 4Q43A 2W8LA 1TKXB 2VA2A 3OL8A 2R8IA 4Q8EA 4NRTA 4Q0BA 1HNIB 3KK2B 4KHRA 4TXSA 3OLBA 2FLLA 2CKWA 4ECRA 4J9OA 2B5JB 4MFBB 3KMSA 3DM2A 1RT1B 3PR5B 4TYAA 3MFHA 4RUCA 3ISNC 2VG5A 1RA6A 4IQXA 3RB0A 4PUOB 3IG1A 2QE5A 1LW2A 3H5XA 2BRKA 1TV6B 2OPQB 2WOMA 2W8KA 2GIRA 1HNVA 2E9ZA 1TVRA 1LW0B 4RW4B 4WZQA 4O4RA 1S1WB 5KFCA 3QIDA 2R8JA 1JXLA 1LWCA 2AGQA 2B6AA 3KK1A 5J1EB 5I42B 1S1XB 1S49A 4DL7A 3KK3B 3I5AA 5L1LA 2W9CA 2OH2A 4Y2AA 4O44B 3DLKA 4TY8B 3CDUA 4O4GB 3NBPB 5F8IA 1SV5B 1JLQB 3I0SB 2XGQA 3FRZA 1S1VB 4PQUA 3OLAA 3GILA 2IMWP 2R2UA 5J2NA 3T5JA 2BR0A 4NRUA 4RW6A 3CDEA 2IBKA 1GX6A 2RKIB 3M8PB 2XCAA 4KKOB 5KG6A 1ZETA 1JLCA 1DTTA 4IDKB 4RW7A 2HAIA 1T03A 5DQGA 4R5PB 4RNHA 5KFPA 1N48A 1C1CA 3FFIA 1HMVB 5KFBA 1SH2A 5HROA 4M95A 1RTJA 3V81B 3FDSA 2W9AA 5F8MA 4IOBA 4J9NA 5FDLB 3MEEA 1RT3A 4XO0A 3TAMA 2FJWA 1S48A 3V6DB 2D41A 2GIQA 3KJVB 5EUHA 2BQUA 1DLOB 1HQEB 2WB4A 3MECB 2ILYA 4IH6A 1DTQA 4QWBA 4TQSA 4YR2A 4MFBA 4J9PA 1N56A 5C24A 1QE1A 1RYRA 1SH3A 4IRCA 1HQUA 1N6QA 2ZD1B 2IAJA 4PUOA 3RAQA 3NAIA 5F8LA
chains in the Genus database with same CATH superfamily
2RDIA 1ZAWA 2CJAA 3A3NB 3CCVS 3PW2A 4EYHB 3KYLA 3THPA 1FTRA 3T5LA 4FYVB 4I6YA 4EO6A 3RW7A 5IV4A 2V2VA 2KO1A 1TKZA 3TYTA 3OXLA 2N7YA 5M2RA 2DH8A 2CJBA 2FJXA 4QPTA 1DLOA 2BV3A 3GV7B 4CO4A 2D74B 3AD9C 2EK6A 4PXCA 3T3FA 5KFRA 3H2LA 1YGYA 2H51B 2OPRA 1GK8A 2WB1D 3DXSX 4USHA 4LFCF 5CYQA 5KT6A 1F2GA 1Y3KA 4X4PA 2N4CA 3R5GA 3RR8A 3M2VB 3VV2B 1J5OA 2EFOA 1E6YB 2DGQA 2J0XA 4X65J 4OI4A 7FD1A 1UVLA 3OHAA 1JLFA 4DG1B 4C3LA 3W3SA 1DJ0A 1QSLA 1RT6A 2DR7A 4U7UD 4F36A 1XNRJ 2XMMA 3SCIE 4J91A 5EX3A 3KLGA 2RUSA 3GYXB 4RUBA 4RW9A 1S7HA 4DR2J 2J8AA 4YR0A 1HLWA 2HHPA 4AL7A 2GC8A 1R6YA 3W1YC 1S77D 2DR8A 3MGJA 2CRLA 2HS4A 1HBOB 4MKVA 2ZFHA 5C7PA 3P96A 4M5MA 2Z30B 1X31C 2F4VJ 4YOEA 1PKUA 3TAQA 3HPOA 3I4HX 2GJ2A 2I8EA 2ATLA 1PYTA 3MPVA 1FRJA 4BWMA 3W65A 1B0TA 2H48B 1X4GA 2W25A 2MLZA 2G0CA 2RT3A 3D1OA 4ZJQA 3CIZA 3AD8C 1RI7A 3OR2A 1TAQA 1HBNB 4C0BA 3GP9A 3HSJA 2V8VA 1LXNA 3Q8PB 4CH0S 4NYZA 4DMZA 4NCAA 3MCSA 4NLPA 4UOHA 1VC6A 4EBCA 4TN2A 1X4DA 1X9MA 5DRKA 1S6QB 3UPFA 4ED6A 4WF9Q 4IO1A 4OYMA 2H4WB 1FD2A 1JJ4A 2N3OA 4CLKA 2A2CA 2OTJS 3H40A 1KQFB 2IC3A 4NPOA 3H4BA 2GVZB 1C1BB 1HBUB 1MN7A 1U1OA 3R5AA 1V3ZA 4NEYA 2XMJA 2KT2A 2K06A 5KAKA 4R25A 4RU9A 3N79A 2B5JA 4LREA 4DV7F 2E9RX 3W66A 3ITHA 4CRJA 1PILA 2LEPA 5CD4A 2E5HA 4ED7A 3DLEB 3BN4A 5F8GA 3PCOB 5KG1A 4J9UE 4L74A 1BHNA 2ZKUA 2JNJA 2RQCA 2HK2A 4ZKAA 3Q8SB 2GZOA 1KFDA 1BWVA 4ED3A 2GMLA 1RK8A 3L7PA 4GC7A 4ECYA 2FVCA 1J27A 4IDKA 1SUQB 1E6VA 3LGNA 3MFIA 3HJVA 3B8HA 3B78A 1XMQJ 4CLTA 2XYHB 2GFFA 1UFKA 5FDLA 2RVJA 4I6WA 4DJBA 4QU7A 1XWLA 5KFGA 2RQ4A 2DPIA 3TUZC 4QR2A 3U1LA 1WHWA 3V4MA 2BBEA 2ZUGA 4Q0BA 1NK7A 2FLLA 2CKWA 2XTJP 1YRTA 2GO8A 4MFBB 3KMSA 1U1PA 1QTMA 1MMNA 3N5FA 1U0HB 4ZCLA 3R7BB 1NJZA 2AYEA 1VLOA 4PABA 1UJ4A 2WVBA 2B9EA 2HGMA 4AYBD 2JZ5A 2AJ4A 4IO9Q 2DYAA 3NBPB 2XGQA 2YX7A 2R2UA 2RH3A 2IBKA 6FD1A 3SMZA 4DSIA 4B9SA 1KS2A 5IM0B 1DTTA 3E3XA 5DQGA 1OSCA 1HQ2A 3FFIA 2QLJB 2QX0A 3DOMB 1Y5NB 1CJKB 1P9YA 1F5BA 4ZPAA 4LF5J 1DARA 1AT1B 1XMOJ 3F56A 2GHWA 1K0TA 2FB0A 4JI4J 2ZZMA 2IIHA 4OQJA 4V19X 1YJ9S 1S1VA 1MSWD 2BE2B 2HHTA 4FS2A 2KVIA 4P2SA 3BYRA 3CD5A 3JTPA 4Q8FA 3K17A 2E5LJ 2VDHA 2DGTA 1XNQJ 1ITPA 3HD1A 4BBYA 4NASA 2R7QA 2BQRA 3OQ2A 3W5YA 3MECA 3MR7A 4DSEA 2JC1A 2HFOA 4I7FA 3LAMA 3FSYA 1DQAA 1KFSA 2PI4A 2ERRA 4DUYJ 4NLRA 3NNAA 2HHHJ 3KLVA 3IAS9 2CUYA 5AJ3F 4ZOSA 4NLYA 2HNDB 3KKFA 2KJVA 1IXKA 3TA1A 1FRHA 3BEGB 4OI2A 1HHSA 1FX2A 4WPAA 1FE0A 3GG0A 4QPXA 3I82A 1VBYA 2DTJA 5KFVA 1EB0A 1VRUA 3I0RA 1VQPS 3OVAA 1IKXA 5HSPA 2EFQA 3M2RA 5DLGA 2ZH8A 4LF4J 4Y00A 3M6WA 4RX6A 4HT7A 2EXUA 3IC1A 3DRPB 1HYSA 3LW5C 3PNIA 4DI6A 3PZPA 1UPMB 4J5OA 4ECZA 2UXBF 2V63A 1KONA 2LDIA 4NZ7A 3BKFA 2YVSA 4EBDA 5LMNJ 3LPYA 5DDRC 2HMIB 4A8OA 2FY1A 4AFFA 4JP8A 1JLGA 2JL9A 2QMWA 1U6ZA 1M5VC 2F8MA 1UTAA 4OZNA 8AT1B 1WI6A 3WDOA 2XY7A 1CVJA 3R1LA 3NG8A 1KTVA 1U1KA 3H7HB 4I2QB 1R0CB 2KU7A 4ZVGA 1CQMA 1SB6A 1W25A 1IKVA 3RBEA 4LMZA 1K47A 1S9EA 3FGVA 2YNFA 5KFXA 4I68A 1R3NA 2HHQA 1FNXH 3R5DA 4XDDA 4F4YA 3J7A1 3H5YA 2GGPB 4EFAC 1IJEB 1D8ZA 5ETKA 2G1HA 3A8KA 2XCPA 3L3CA 1GXTA 4ZITA 1VBZA 1TL3B 2YKQA 4BC7A 2Y3YA 4KSEB 3DGPA 1IKWB 2X3DA 2YNIB 1PJ7A 2POKA 3ULHA 3OVBA 3TZZA 1VI7A 2E29A 1XTZA 5K14A 3SV4A 4PYDA 3L4BC 3LAKA 3VQTA 4NI2A 4KPYA 3DKDA 2EK1A 5AT1B 5DM6Q 1N34J 5K8NA 3R7NB 1SI9A 2XS2A 2J7KA 3EPGA 1K8AT 2IJFA 4KE5A 1Y00A 2WTFA 2E7WA 1KKHA 1Y10A 3MM9B 2FD2A 4LF7J 2OPSB 3H98A 1M5SA 1HIYA 3PW7A 1NK6A 3EM1A 4B9TA 1UPPA 5I3QA 1UCNA 2HNYB 2HZAA 2HBQB 2WOMB 4USVA 2XMKA 1TVRB 3M8ZA 4ZVSB 3M32A 4KKOA 3TRGA 3W60A 4B9UA 4BDPA 4LRFA 2FZKB 1BGXT 3QO9A 3CGIA 3R5CA 3N9UC 5HK4A 3CCZA 2W9BB 4KPCA 1RTZA 1VMBA 3EWGA 4LRDA 5D0RA 3ELHA 2NCKL 4OX9J 1QJHA 2DPJA 3MXHP 4EBEA 1RAIB 5LT5A 3NGRA 4F0HA 3THVA 2QFIA 2WVCA 4B3SJ 2H9ZA 4J9OA 4M5LA 1PYOB 4RWXA 2C2KB 3NCPA 4AQYJ 5HANA 4X64J 1NPRA 2GQ2A 4DL7A 5I42B 1S49A 3MPYA 3M8YA 1SV5B 2IMWP 1P9QC 2RKIB 5B0GA 3QSYB 1PC4A 3LTOA 1CEZA 3K7RA 4RW7A 2WSCC 2RDDA 1B7FA 3TAMA 5EUHA 1DTQA 4YR2A 1AYEA 3OUYA 3LQVA 1N6QA 4ES3A 4HLBA 2EFVA 9RUBA 5IV3A 3D6MB 4LF8J 3JYTA 3EMTA 3M8WA 4ANEA 3EDQB 2XEXA 1YX2A 5DGBA 3K5LA 2PA8D 1SBRA 1JKHA 1WOOA 1TQLA 3SFGA 4DSLA 2ADCA 1WKKA 3CJTA 4USKA 3TZXA 4ZPBA 2A6OA 3L7UA 2W9CB 3QJLA 4EEYA 4EUVA 5KT7A 2MJNA 2F9JA 2OD6A 2E66A 3T19A 2F3JA 5GADU 4K4VA 4P71A 3SEOA 4ED8A 4YB5A 1RTJB 4X66J 3MEEB 4PWDA 1WELA 1GTHA 3TJAA 2V6AA 1DFDA 5C24B 1QE1B 1HI8A 3FC9A 4N7TA 1ZAXA 2M8DB 1N5TA 3SXLA 4WCEQ 4P2FA 2DVIA 4ENOA 3CXCR 4F2SA 3GV8B 1M1HA 2QSFA 3GJRB 4DV2F 3AXKA 2OEMA 1VK3A 3KJFB 4ZVFA 1NK9A 3EXCX 1T3OA 3M9OB 5IT9Y 1TL7B 3LP1B 4ZHRB 3CJ0A 3R9LA 4LR7A 3KG1A 4PG5A 2RE1A 2Q1LA 4OJHA 1CC7A 1HPZB 5HL7Q 5CAAA 4HHJA 3M2VA 3MM8A 4ZVPB 3N0VA 2FDNA 3POTB 1TL4A 6AT1B 1F3FA 3PV8A 4TYBA 4DG1A 4C3KA 2JEGA 4B3TF 2EFNA 1RABB 4B3OB 3GONA 3D7SB 4FXWA 4LFCJ 2DIUA 3EGWB 1UWBB 4WFXA 4KFBB 4J9RA 1LFWA 3D67A 5KG5A 2H4YB 4M5KA 1KHWA 3KUHA 1IBLF 3NGDA 1HBOA 4CP5A 2MMYA 3IWLA 4J9MA 4ZN3A 2J0QD 7FDRA 3GIKA 3A3OB 1DY3A 4JI0J 1R8HA 4TVAB 2DXDA 3KLEB 2PEHA 1N88A 3NCRA 2V34A 3CJ2A 2XS5A 4MK7A 3DN9A 2HS0A 3T6JA 3LOUA 1JIHA 5T7LB 1BD6A 2HFSA 4FF1A 2V94A 1YJRA 4J9LA 5J2PB 1S9GB 3G82B 4N56A 2XLJA 1YTYA 3CCTA 5F0WA 1PBAA 1HBNA 1VYAA 1NDKA 2CDRB 1K44A 2HGLA 3OXGA 4K4WA 1KSPA 3GG1A 4YB7A 1FRLA 1S4FA 4M5DB 2MHNA 2OMOA 4IR1A 4DL5A 1LOUA 3ZZOA 1S6QA 2MDAA 3DU5A 4ZMMA 4AXJA 1AA1B 3KHHA 4K2XA 4UZBA 3C66A 1S57A 2GX8A 2IM2A 2JH3A 3ISND 3W8PA 3CDAA 1QUVA 3D1QA 2GVZA 1HBUA 1ZZFA 5DG8A 2YQ1A 5CCLA 4A8WA 4UW2A 1Y0HA 3UW1A 1Y9OA 4R8UB 4MYUA 2BKPA 4LQ9A 2D3ZA 2O67A 4K4TA 2BRLA 3H8YA 1TK8A 3MTKA 3Q0AA 3QRRA 5JUMA 3BR9A 2CAJA 4DQPA 1BMQB 4NE9C 3KK2B 3MMCA 1CC8A 2AEMA 2V8DA 2OO4A 3NS6A 2GHPA 5L9NA 4RUCA 4CH1A 2QE5A 1LW2A 2BRKA 1T7PA 3O2IA 5A8RB 3KK3B 3HHLD 4DQIA 1WDTA 2YKPA 4DV7J 3I0SB 3FRZA 2C3UA 4P73A 2QEXS 4LSZB 3MD3A 1MW7A 3HDSA 5T41A 1FT8A 2R3VA 4DQRA 1HMVB 1SH2A 2GIQA 5LM7E 3I6PA 3RYLA 3Q2SC 2ADBA 4MFBA 4N76A 2IDLA 3SDEB 3RAQA 3DRYA 1U0HA 2WVDA 3MTJA 2CADA 2M5YA 2DCLA 2IYGA 2GA7A 4OL8A 3BREA 2DRAA 1LWEA 2AGPA 5HATA 2X1AA 2DNGA 1DZ5A 3R8YA 3OFHA 1B70B 4JI7F 4R0JA 1S12A 2AKWB 1CJKA 2CQBA 1Y11A 4LF6J 1VJQA 1KWMA 2Z57B 2KFNA 3LP2A 2VJVA 4W90B 1OO0B 4QIVA 4WFZA 2B9XA 3BBCA 3BF4A 1AZSB 1UEKA 4GKJF 5CHCB 1Y5IB 3SQGB 4OYBA 1CG2A 2BE2A 4IG0B 3V4IB 4XAKA 1T02A 1RAFB 2VPZB 5HBMA 5ETLA 5KFYA 4IFYB 1ZPVA 3QYYA 2ZH3A 4WFAQ 1RAJA 2OELA 4OFZA 4P74A 4YB6A 2OAUA 2XLIA 2NLWA 4BLGA 4ECSA 5HVGA 2F9DA 1IKYB 2OGUA 2YKOA 2DBBA 3EGNA 2HNDA 2R8HA 4HI2A 2Q79A 1HI1A 4URSA 3FBFA 4DR7F 5E3RA 1FWLA 4QWDA 1CS4B 2UUAF 1S5ZA 3P49B 2DHHA 3EGZA 1TL1B 1Q81T 2OMLA 2LA6A 3QRPA 2PC6A 3CCRS 2BJ1A 2XC9A 3CVKA 2WK4A 2BACA 3C16A 5D4OA 5AJ3J 3TEGA 2FJBB 3G96A 1CJUA 2L41A 1VIXA 1AUSL 3DRPA 2DKOB 2BJ7A 2WSFC 4WIIA 2M9KA 2QLXA 4XK8C 2VKZG 2MHEA 2MPUA 3Q2TC 2P2CB 2OD4A 2JEFA 3MF5A 4E98A 3S8SA 2J7UA 4EMDA 2DRBA 2EEYA 1TFYA 1EX8A 4DHVA 2ZVIA 2D3UA 4EK2A 5F9LA 4IUFA 1JJCB 2V4QA 1WF0A 4WU2A 2YNHA 1IM4A 2UXBJ 1DBDA 3HJFA 3GIMA 3KUGA 1RAHB 3BGOP 5E3QA 4LIRA 1FA0A 2MQNA 1S6PA 4DZ6A 5KT5A 2VB6A 3KMQA 4XIUA 4OIXA 4OX6A 1RA7A 4ZA1A 4USWA 4N8OA 4F0MA 2F65A 4Q7AA 2HVEA 4I6AA 3K5NA 2NXEA 2JWNA 1SQGA 1JXVA 3ZZTA 1WHYA 4CO2A 2EFPA 1YITS 1ZTWA 3KJNB 4F8RA 2JC0A 1NDCA 3LWLA 1VR6A 3NCQA 4FS1A 3IFEA 2R7UA 2DHGA 3DRRB 5G0RB 1TFWA 3HXMA 4NLXA 2W01A 3KLIB 1F9FA 2OSRA 1YJ7A 3M9MB 3CC7S 6FDRA 3NGUA 2M52A 4DV3F 1OYDA 3BS9A 1U8WA 1NHUA 1WHXA 3C15B 1BQXA 2XB2D 1YSJA 3MUTP 3RAMA 4L75A 2EKYA 2XMTA 1RA6A 3D2WA 1VQSA 2QGFB 3IO1A 4USIA 5FIIA 2WOMA 1TUGB 1TVRA 1RWVB 4Y2MA 5KFCA 2R8JA 1LWCA 4K7QA 3Q83A 4ERDA 3NS5A 4KT0C 1QSSA 1X7VA 1JLQB 2H3EB 2JHEA 1QVGR 2CQ0A 3CD0A 3M4XA 2BYCA 3QT8A 4UQTA 4R5PB 1ELOA 4FPIA 3FDSA 3MOZA 2G2OA 2D41A 1S48A 3KJVB 2WBRA 2BQUA 3KJQB 1N56A 4A8MP 4OX7A 5KTQA 4RBUA 2NS1B 3DCAA 3CMQA 2ZC4A 2BJDA 3HKZD 5I42A 2PDAA 1L3KA 2LXUA 4DR6F 2F7VA 3H90A 2FUG9 1XR5A 1FHTA 5HVHA 2JSXA 4MIBA 3RB3A 2VPXB 5FJ4A 2BUNA 1RAOA 4DL3A 3PJXA 4WTOB 3GFHA 1WTBA 2O01C 2MKYA 5I3UA 3ICLA 4ZN1A 2WAQD 4DU8A 1RLDA 1XR7A 1Q53A 2PO4A 5KT2A 4KO0B 3N5BA 2VODA 3PY8A 3N6LA 5DQIA 3ZTRA 1UJ5A 4G6VB 1GMWA 1MMDA 2IAJB 2CDQA 5ETVA 2M0GB 2XQCA 1L3UA 1FTCA 3LGMA 4UY8T 1G1XA 3E8OA 4A8SA 1R8BA 3PDNA 1ZBTA 2V8PA 2CWXA 2XWYA 3KLFA 2MB0B 4BC9A 2YX1A 4UZCA 3TUJC 4YDXA 3CNQP 1JJ2R 1BQNA 4ZVOB 2L9WA 3PM9A 1HD0A 5ITHA 2MLYA 3LF0A 4KB7A 4Y2CA 2XNQA 3NNHA 3CB4A 2XI3A 1X5TA 1SXLA 4UTGA 4MK9A 3I9ZA 1SJ1A 3IRXA 1NZ8A 1KHVA 1Q95G 4P72A 1S1UA 3TW0A 4JYAJ 3O5TB 2NZ4A 2R42A 1Q1KA 5J1NA 4LSLA 3DLGB 2G1DA 5RUBA 4A8XA 1O0PA 2C2OB 4WE1B 2J6SA 1OY6A 1J2VA 5HP1B 2I5JA 3PW5A 2OPPB 4OMFG 2KT3A 4ES1A 1HD1A 4OLPA 1TL7A 2W1BA 2KHDA 3CCSS 1HPZA 1SC4B 1RTDB 5HMZA 3CE8A 1IQTA 5KFOA 1FNMA 4CIOA 2W7PA 2AWZA 3Q22A 4J9KA 3BGLA 4XDCA 4DV2J 3CJQA 4NYOA 4CTAB 2Z2MA 3R27A 4C4WA 2DIVA 3QWUA 4X62J 2RB7A 3ZTSA 5CD4H 2KRBA 3MR2A 5KT4A 2IDEA 5EWGA 3NXZA 4MT1A 2QO3A 2HPUA 2RILA 3CEDA 2DGOA 4YR3A 2NXNA 3MR5A 3TQEA 1FDNA 2JOQA 2RF2B 4GVBB 5E7OB 5C5JA 1NJIT 3QIPB 4LR8A 5BR8F 2ZE2B 5H1SV 4B3TJ 2FJEB 2BANA 1T9TA 2V0NA 4RBVA 3N6MA 1N0UA 3SCLE 1NO8A 3QWPA 4RPFA 4A4JA 3KLEA 4AXIA 1RP5A 2KM8C 3VQSA 3TQ1A 2QRRA 2YY3A 4OZ2A 1RT1A 5JVGQ 2Z2YB 5D15A 3TVYA 4PCQA 3CJSA 1RXOB 5DG9A 3MM7A 1IBLJ 3EXYA 4DV1F 3FZ2A 2PI5A 2XI2A 3M30B 4E8UA 4K4XA 1YVFA 1W7WA 4DR3F 5D0EA 2J9CA 1MWZA 1S9GA 3GJQB 1U1LA 4M5HA 2C2DA 3VGUA 4ED5A 1TKDA 3MMJA 3AA8A 2XZWA 3K89A 3QFHA 4MAKA 1KLMB 4O23A 1U6BA 1YRXA 4KH1B 1JJHA 1H6KX 2QA4G 4A47A 3KFWX 3G6ES 2LECA 2DGUA 2H5EA 4D3HA 2F4VF 4USMA 4H4OA 4HACA 3TJ8A 4UUXA 3QAUA 3ET6B 5CQGA 1YKWA 4NOHA 2U1AA 1RWUA 3I4PA 4ZJLA 1NZAA 2F40A 1U47A 4IQXA 1X8DA 2YQ0A 3PFOA 2YPZA 2N3LA 5J1EB 3GCWP 4Z7YA 4O44B 4FYDA 5F8IA 2YH1A 4CM2A 1ROFA 2CXEA 4KYZA 2J0WA 1N5QA 3M8PB 2BABA 3MM6B 4ELUA 2GQQA 4TU7A 1VDHA 2L48A 1RT3A 1U8SA 1OPIA 4DV4F 2J0SD 4WFBQ 1TELA 3DHXA 1Q8KA 1HNZF 3K0JA 2MGZB 1HWJA 2V2ZA 3B54A 4KGZB 5CCMA 5D8HB 4F4AA 2J9DA 2Z2LA 4H4KA 5C2CA 3PO4A 2UUTA 3C6UA 3AAWB 4A8QA 1NSPA 3JSYA 1HMVA 4HI1A 2FTRA 4IKAA 1ZS6A 3H2UB 5C25A 3LPEA 2ZBRA 4K0KF 1X9WA 2DHSA 4KHPF 2XSJB 4C11A 2ZHBA 4QWEA 4WWSA 1RLCL 1M1GA 2HWTA 2RS8A 4ECVA 3HFKA 1S7IA 2LP4A 3GWCA 3ZZYA 1VK8A 2KTQA 3UN2A 4YFUA 3HHKA 3M6UA 3D54A 1LK7A 2Y1JA 3DOKB 4X4QA 3D5MA 1JMTA 1PBUA 5KFIA 4OI3A 1MU2A 1I3OB 2R7WA 4X4OA 5LXYA 4O3SA 1IWGA 2FPHX 3QAEA 4DPUA 4ZPVR 3OTOF 2A18A 2DHXA 1CJTB 3ENQA 1YQHA 2PMZD 1X5OA 3T5HA 3IR7B 1S9FA 1S0NA 3Q8YA 3V6HA 1ZM9A 2EPIA 1W26A 4DCPB 3O44A 4DSJA 3V4IA 1FFGB 2OTLS 1LV5A 4JI7J 4B3RF 4BCAA 1EAYC 4LJMA 4ED4A 5KFKA 2DNKA 3AJDA 2BOAA 1T11A 1X4FA 4YP3A 4H54A 1WOPA 3HLUA 1QM9A 3BQ1A 3BDEA 2R8GA 3BGFA 1T94A 2BW2A 2ZJQQ 1NHVA 3MR3A 1TTHB 4GKJJ 2IRXA 1IKYA 2XY6A 2ASDA 4IFVB 4K4UA 2C2NA 4C98A 5F8NA 4DL2A 3WC2A 5CA5A 3DI6A 5CYMA 4QW9A 1CS4A 4RW8B 5DGAA 5KFHA 3JTNA 3HSDA 4WXOA 5IXUA 2LMIA 2X1GA 2BE9B 1KQKA 4DPYA 1YZ7A 2LQ5A 2B9WA 3OL6A 2CQGA 2VBYA 2PA3A 1RU2A 4Z2XA 5EWFA 4LRAA 4DR1F 4DR7J 4FBUA 1RT4B 5J2MA 3WX8A 4M8LA 5KOWA 2UUAJ 1VRTA 1RDRA 2HHHF 4DUTA 4ZCIA 2Q43A 2AYBA 1T05A 3MM5A 4F4ZA 1REGX 3H0PA 1HNIA 1GXUA 2VIHA 1WEYA 1X0PA 1RBAA 1RCXB 5DETA 1FO1A 3KDNA 4KC5A 2RU9A 1KQSR 2V4JA 2RIJA 3RB6A 3HP6A 4CYUB 2CQPA 3CCUS 1BY9A 4C9DA 3F0NA 3I9V9 2HQIA 4FF4A 3T9ZA 3IWNC 3BPDA 5F3TA 1XBWA 2LDYA 3BKTA 5GAHU 3P3DA 2QYCA 1G6BA 1U1MA 5DDQC 1SJRA 1SJ3P 1R43A 4IRDA 5J2NB 3NMAA 3FVYA 3HHNB 3W61A 1T03B 4CNZA 1EIYB 2CIMA 1WTFA 1TKXB 3NWGA 3M1VB 3GSIA 1U25A 2YBVA 3C8YA 1D9DA 4EZ9A 2U2FA 3DM2A 1IR1A 2HHXA 1NLKL 3H5XA 2XHWA 1ZPWX 1O5JA 4KTQA 3UD3P 3UD4P 3OBIA 1S1WB 3G8SA 4A48A 4AD6A 7AT1B 3V5RA 2B3TB 3GLJA 3RRKA 3DLKA 2JJ4D 4FPRA 4OZ0A 2V8GA 1ZZNA 4NXNF 2DR6A 4NEZA 1IQZA 4JI8F 5GAGI 2FHOB 2XCAA 5DZ7A 5LMUF 3C15A 2QT7A 1WEZA 4F3QA 2BZ2A 3AOAA 3OTEA 1NSAA 2HS3A 2F4FA 5A2QU 4LT6A 2DT9A 2P6TA 2LQJA 2MKJA 4ECTA 3BN7A 1A0OB 4PEOA 3JSMB 2KKHA 5DO2A 1RUSA 1QDUB 4DV3J 3CJ3A 1EKRA 2ZVSA 4ZLJA 2FZCB 2E7VA 1C0UB 2XMAA 4R5PA 2K3IA 4LFAF 3G8TA 3DLHA 3KJVA 1RE1B 4HHHA 4J9QA 1WG5A 4OHZA 2ZBIA 4QIEA 2CJ9A 2VC0A 2V2KA 1FEHA 3OTBA 3S1TA 3MHYA 2DNQA 2LCWA 1WORA 1WJ9A 3FCWA 3L9ZA 4EU0A 4RLEA 3UD5A 1HQUB 3T5KA 2C3OA 4X4NA 4ZP9A 4BWJA 1UL3A 4Z37A 2H65B 5HMYA 1RHMB 3KWMA 2EI5A 2R8KA 3JQJA 3C19A 2HQDA 3DDNA 2IA6A 1B7YB 1FKOB 3NL0A 1FDAA 4ZVQB 3EVOA 1H7XA 3IS9A 2XZTB 2GAGC 3KNGA 2K1RA 4PR6A 3RW6A 3GCXP 5EGYA 3E01A 4RR5A 4KO0A 2YWKA 4WK3A 1FWKA 4K5SA 4DR6J 2N4DA 4MKBA 1KVIA 3D1HA 2UVRA 1DRZA 4F3MA 1TKTB 3ISZA 3CC2S 4A46A 1UA0A 2C2EA 4WK1A 2LA4A 3G71S 4DU7A 1WD6A 5ETPA 1RWWB 5HJYA 5A8KB 2AJQA 2BJ9A 3I87A 3SZ2A 2AD9A 4UY85 4EI2A 3HHLB 3BZQA 3OJSA 3QLHB 2R7OA 3BH6B 1F9EB 1YRUA 5DLFA 2BMBA 3UQSA 3HVTB 4PG8A 2HNZB 4A8FA 2YWEA 4IH7A 5K20B 3BBBA 3K58A 2QTWA 2C1EB 3SBMA 3UCZP 1RT2B 5HO4A 2ACMA 2RD5C 3MR6A 1NKBA 3PW0A 1U7LA 3DLGA 3HMJG 2DNOA 4DBQA 4WE1A 3AB4B 3CUNA 3VGTA 5HP1A 3SIPB 2XO7A 3I5BA 5HQLA 1U02A 1L5UA 4CO3A 1VQKS 5KFFA 3B82A 3IP0A 3QMQA 4URQU 4O3PA 2FVQA 4LRCA 3N01A 5CXTA 1RZMA 2XG8A 5LJ3Y 4WU3A 5L38A 5A6PA 2CFXA 1REVA 2RU3A 2RMLA 3OVSA 2DHAA 4U8VA 4NLVA 1SKRA 5EX0A 3T41A 1S97A 3AJ2A 5IT0A 1OWXA 1P27B 1CSJA 2UVUA 4C8ZA 3DFEA 2C22A 3BDPA 3VGVA 2ZJRQ 2VKRA 4I2PB 5EN1A 4GVBA 2V50A 4W98A 3ZZZA 3E51A 2XY5A 1NH7A 1F5CA 9ATCB 1B3TA 1LWFB 5ETRA 4E2FB 3QIPA 3PO5A 3QGGA 4ZPDA 4NLDA 3M6VA 4HR2A 2DH7A 3PG9A 3J7YI 2IRYA 4ER8A 4QBUA 3UR0A 1SJ4P 2VOOA 2RS2A 3CCQS 1NK0A 2VG7B 3V6DA 4NLSA 1IWAA 5THWA 3FBCA 2GS8A 2VH7A 1QAIA 3OTCA 2Y0SD 1OY8A 2VA2A 4Q43A 2ZOGA 3UVJA 1M5OC 1NK8A 3QATA 1H2UX 5BR8J 4A8YA 2OI2A 3W64A 2NUUG 1WC6A 3RB0A 1U24A 2PGCA 1TV6B 4C0OC 4WZQA 3QIDA 4HDHA 2AGQA 1S1XB 3I5AA 3D3CJ 2KFZA 4OZ1A 2DY9A 1JNZB 2HQCA 3EYZA 4PQUA 5CH7B 1J5EF 2HFZA 3DGVA 1U2CA 4DV1J 1T95A 3CTRA 4JI0F 3ZZ0A 4RNHA 2OUGA 3P4UB 1C1CA 2C3MA 5HROA 2DNHA 2W9AA 4DR3J 2ILYA 2G0JA 1ULRA 1KTQA 3CF5Q 4EWTA 1RKJA 1WDDA 2HIYA 5J1EA 1VQ4S 3UN3A 5GMKa 2D7SA 2UZAA 1IBMF 1SJFA 1S6UA 1IR2A 3NMRA 2B0GA 2C2RA 1AFIA 2QMUB 3KK1B 2GIFA 4DF8A 3H25A 2HURA 2G9OA 4OZLA 2N82B 1EP4B 4ZVHA 3LANA 2XS7A 4WYLA 4RW6B 4XPCA 2D3O1 2FVRA 2DD8S 3EZOA 1XQIA 2C42A 4DWIA 4DLEA 3SI8A 2MGZA 3VCDA 1RYSA 2AF6A 1HR0F 3LUYA 2NXCA 4ZCMA 2J9DE 2C3YA 3NY0A 2M2BA 4FXDA 4DV4J 4J37A 4DN9A 3A12A 3LP0A 4ID5A 4RNMA 4M5JA 1HNZJ 5IZHA 2HZCA 1GNKA 1TKZB 5AXNA 3M9NB 3I56S 2FLNA 3DOLB 4QW8A 2R2TA 3BQ2A 3MMAA 3OW2R 5F3ZA 3SYZA 3ZNJ1 3VAJA 4M63A 5L1KA 2X1BA 1Q7LB 3DOKA 3JS9A 1NEEA 3S6EA 4DFMA 2CJXB 4K0KJ 4KHPJ 4IQMA 4UOCA 4DPTA 1N33F 1LWXA 3BSOA 2X7IA 3J81U 1JLFB 1RTIA 1QAXA 2HQ3A 1CJTA 2Q6BA 1RT6B 2WVEA 1YBUA 3CJ4A 3KLGB 2VC1A 3WBZA 1Q8IA 4ZP6A 2ALYB 5C2GA 1FVSA 4GRSA 4NLOA 1MROB 3R6LB 4Y2IA 1YG0A 3JQMA 1N36F 3HZGA 3OTOJ 2DNRA 1FXDA 2VFVA 2MSSA 4NMXA 3JAMU 1QAYA 3CO9A 2YTCA 2CJQA 3SSSA 1Z2ZA 4LF6F 1RAAB 4IFVA 1RTHA 3KHGA 2BJ8A 4B3RJ 2LLZA 4ES2A 1KD1T 1P6TA 3G6YA 2B8PA 1QSYA 2MYFA 2ZJPQ 1RT5B 2E44A 4S0MA 5KFNA 2RHQB 2ZNYA 2ZNZA 1T3NA 4ZIWA 4FVMA 3QGPA 1FEEA 4C7QA 5B0AA 1FKPB 2Z0GA 3IR5B 3IR6B 4XPEA 1LFPA 3OR2B 5HLFB 1F6TA 3HKWA 1BXNA 2YWFA 5FD1A 1UZHA 4LBPA 2DNMA 3QZ8A 1RKIA 1RT4A 1H74A 2QFJA 5F9NA 1H0HB 1OQ3A 3I55S 4MIAA 4DSFA 1GAOA 5AXMA 2B7CB 1M0SA 4P52A 2ATCB 3EDRB 2FY8A 1GT8A 3MURP 2VV5A 4FP9A 1HQEA 5EHHA 2BVZA 5F8HA 4MH8A 4MKYA 2CNKB 2ZD1A 4DR1J 2UXCF 2JEJA 3R3TA 3DYAA 2R8IA 1LK5A 1RACB 3IXQA 1PG5B 1NXIA 4CYUA 2B5JB 3VVTA 5K8OA 2HHUA 3MFHA 3QT6A 4NMLA 2DNYA 5A8WB 3IG1A 1SL1A 1WC3A 4HTIA 1VS3A 4DR5F 4JI2F 4RO0A 5HVFA 3M2UA 2XYGB 4PQAA 4RW4B 3TUPA 4O4RA 3S7RA 2BX6A 2QLBB 4CO5A 2X1FA 1GMWD 3CDUA 2HYIB 2ZKTA 3GILA 4FKYA 5J2NA 3WX4A 3EGVA 1H73A 3ZTPA 1KN6A 1N0VC 2XMVA 5LSRA 4IDKB 2L3MA 1E6VB 1T03A 4QJVA 1ZAVA 3AJ1A 4M95A 5FDLB 3IWXA 2GCFA 5E3PA 2WB4A 2NQPA 1L3VA 1GXLA 3FJ2A 3TA0A 3QT7A 3MAAA 4TU8A 1SC1B 1Y5LB 1X9SA 2BDPA 1FE4A 2AJ0A 3SSQA 3J81j 2XBPA 3MEKA 4Q0BB 1TMJA 5GAEI 4ZVEA 1B99A 4F0KA 3TARA 4DQQA 2F8EX 2WBMA 2E5JA 1TL5A 2RJZA 1C0TA 2APOA 1ZM3A 5MLCV 3WIVA 3HVWA 1G7CB 3G87A 4KGMA 1S76D 4NLUA 5B0EA 2AJFE 1Z2LA 4RJVA 3I96A 2AEFA 2LYVA 4C2MA 1K1QA 3QJJA 5KFEA 4NXNJ 1LEOA 4ED1A 1SVDA 4JI8J 1FI4A 3JSMA 1K0VA 2OKQA 3IA0A 5LMUJ 4GMKA 2QLWA 3M6XA 1JLEB 3PACA 3CWJA 4ZK7M 4WBFA 2DEIA 1C0UA 1RAEB 1LNQA 4Y2KA 2WZ1A 2CPEA 3QRQA 4H4KC 1S1TA 4JV2A 2F8HA 1HW9A 2QL9B 5K5MA 4FNIA 1RISA 1JLBA 4KV8B 1NPPA 3OHBA 4NA2A 1FK9B 1MG7A 1UEVA 4OZ5A 1FJEB 2K3KA 1FERA 4P75A 4I7FB 3MCMA 3TNVA 4LFAJ 1EQ0A 2DEJA 5A0YA 1FKOA 1V5IB 1MWYA 5IC6B 4YMEA 5G4DA 3UDEA 2HFNA 1HNWJ 4Q5VA 1FFWB 2HVDA 1KBRA 3NLCA 5E3AA 2E5IA 1HWKA 1TKTA 3I0RB 1Q5YA 5BXIA 1U26A 5I4MA 1IKXB 2E9TA 3M2RB 4ICLA 2GW8A 2HRYA 1YJWS 5DG7A 3LWMA 5C42B 3PKMA 4HKQA 1S59A 5U47A 1XERA 1R0BG 2QJ3A 1FDDA 2C2ZB 1HYSB 1DHMA 2VF3A 2ZHAA 3D6TB 2AMCB 2HKEA 3CJ8A 1X4AA 2KFYA 5F0UA 1OJ4A 2HNZA 1UVKA 3MMBB 4DCOB 2V5HG 3K57A 1DQ8A 3FSIA 1JLGB 1U4BA 3MD1A 1T9VA 4DF4A 4JV5F 2H1YA 1RT2A 1K1SA 2KN4A 5AE1A 4DSKA 2QL5B 4V1Ak 1CULA 2X3GA 2IY5B 2UUWA 4DLGA 3JSRA 1YHQS 1I1GA 4B3MF 2C3PA 4OYAA 3BBFA 3O1LA 3BJYA 1X4BA 4PYAA 3PX0A 1IKVB 1NKEA 3FCVA 4TQRA 1S9EB 4PWWA 3CDBA 5IS2A 2KM8B 2PSZA 5KG3A 3MOJB 3NWRA 3AQPA 3J7ZT 3UDVA 2ALZA 3C6TB 5D77A 3JXOA 5BYSA 5F8JA 1YK9A 2YX4A 1OY9A 4DPXA 3W2WA 4O4GA 2VG5B 5L1IA 2C2MB 5KFJA 2YWHA 3KUEA 4JOUA 4Q45A 4HTJA 4JYAF 2ZOMA 2I6WA 4CT8A 1NJYA 1RWKB 4F02A 4CLLA 1X4HA 4ED2A 4NA1A 4WZMA 2ZH7A 4FNHA 4R0EA 2Z8QA 1V9OA 4NI2B 1Q0NA 4NRTA 4X4UA 4LF9F 3VAFA 1T9WA 3PR5B 3ISNC 3HD2A 2DISA 4B08A 2CPZA 4OHXA 1R7IA 1UW4A 2HZVA 4RBTA 3LO3A 3M32B 4KKOB 2BKNA 4X62F 3N4WA 5E33A 4JI6F 4P9SA 1PCAA 4IH6A 2DNNA 4TQSA 3TUIC 2R7TA 2QA1A 2GQCA 5K9FA 3MCOA 4U7UK 2ZBPA 3GFZA 1E6YA 4K5RA 1TV6A 4K59A 1I51B 1RSCA 1S1XA 3TJ9A 3HHLC 2NXUA 2Y1RI 2FJVA 1HW8A 2I0XA 4G1PA 5DDOC 1N5YB 2CVEA 4N47A 3AQOA 1UA1A 1VFJA 5AE3A 1PIEA 1R31A 3DU6A 1WG1A 2ZH9A 2OEKA 1WI8A 3UDCA 4G1IA 3GQCA 5KFDA 2J76E 3CO0P 1KP6A 4I1TA 1R89A 2HK3A 2QC3A 2R7XA 3TAMB 1DTQB 2UU9F 3IGVA 3IBCB 2FLPA 1AFJA 1J5EJ 1N6QB 2VUGA 2N7CA 3JYTB 4U7CA 2B9YA 5FLXY 1JK9B 1U2FA 2VL1A 3EICA 3BGRB 1HNXF 3PJWA 3AT1B 3VZHA 1EP4A 1XN9A 4PPZA 2M88A 4K4SA 1JKHB 3BQ0A 2HHVA 1ZOTA 2RRBA 4QYZJ 5H9FJ 3ZC4A 3ZTQA 1IBMJ 2W4DA 1X5SA 3OL9A 3R1HA 2KRRA 3EVWA 3IM9A 1XR6A 4DEZA 3NAHA 2PMWA 2FIUA 2VFRA 4C8MA 3ENWA 4PWDB 4PZVA 3O3LA 2MKCA 4KJIA 2ASJA 3WHIA 2AYMA 4HL9A 1RCOB 2CZVC 3F44A 2XMWA 3DOLA 4LFBF 4NLQA 2WONB 4QZVB 3Q8RB 2DJWA 1HR0J 2K2PA 1C1BA 5H9EJ 2IJRA 4ILMA 4CLFA 2E1CA 2D9PA 1N32F 1FF2A 4I67A 5ETMA 1OPZA 1VQLS 4YHHJ 2CNLB 3PYFA 4WP8A 3MM8B 2OJ3A 3RAXA 3DLEA 3K5PA 3G2XA 4O3RA 3GE9A 1KC8T 4J7CA 2LXFA 3A3PB 2VDIA 2LU2A 2CZ9A 2LVWA 3TANA 3Q89A 3G4SS 2NXJA 1Y3JA 2JVOA 2LEBA 1SUQA 1HWIA 2Y9HA 5D3GB 1VQOS 2AU0A 3PFEA 4I4BA 3GJSB 3CPWR 4F26A 1MROA 3HVAA 2NUHA 1N33J 2ZH5A 2ACYA 1GH8A 4DL6A 3U1MA 3TR5A 3OV7A 1WSRA 2FZGB 4OYWA 2A0FB 1Q82T 5KG4A 2WVFA 1H2TZ 1B0PA 2Z56B 4CZCA 4C48A 2QLFB 4P6QA 2HVZA 4U6PA 4LBIA 3D0HE 5JMNA 3ILLA 1B0VA 2MKIA 1X0FA 3WC0A 1SL2A 2VBWA 4Y34A 3NBPA 1Q79A 4OX8A 2ZH2A 1KVJA 2Q3PA 3RRGA 1N36J 5KFMA 1RT5A 3BSAA 4Y6IA 3PEHA 4LQ3A 3A1YG 2B6AB 5IM0A 3O6QA 3CCJS 1SIZA 5E41A 2VFSA 1T8EA 5LSOA 1C4CA 2ZBQA 3DOMA 3RB4A 3IMQJ 1FKPA 4ZLNA 1AB8A 2IYIA 3ILJA 1H72C 4UOFA 2MJUA 5HLFA 2D9OA 4RZRA 4DL0C 2FYXA 3U27A 4ECRA 2XM3A 3MWBA 1UVMA 2EG1A 4ANCA 2DITA 2AEJA 2B8QA 4HH1A 3GSDA 4DV0F 1LW0B 2VBZA 3DLBA 1UFWA 2B4PA 2MZTA 4TY8B 3W9IA 2JX2A 1VOMA 3OTDA 4PG7A 3D6FB 3ETOA 1MNEA 2BR0A 2OLWA 3K2YA 3CDEA 2P9EA 1YDLA 1I94F 2DNLA 5KG6A 2XHCA 1FNOA 4WJBA 1RHKB 4I69A 4J9PA 2E1RA 1T9XA 4I56A 1NKCA 5GMDA 3NEKA 5A8WA 3B4DA 1TK5A 2MXYA 4V19J 4DFKA 2LQBA 2QMXA 4RW4A 1D3WA 3MMCB 4EYIB 4FYWB 1T9UA 1YWXA 1TMMA 1EKSA 1LW2B 4K4ZA 5B09A 3PRVA 4FF3A 2QA4S 5A2QY 1F3VA 2UXCJ 4JUZA 3Q86A 3K59A 4URGA 2WSEC 3GMGA 2MZQA 1W2IA 5KFUA 4MYTA 4DR5J 2EBEA 1AW0A 4JI2J 2YWWA 1RB0A 3PTWA 2AGOA 4LBHA 3MCNA 3TX8A 3R6GB 1MWQA 4JV1A 3U7JA 3OD2A 3X3UA 4ATNA 4EGLA 3H2VE 1KR4A 4Q2LA 1N5VA 3AOCA 2HMIA 2H5IB 1Q86T 4DOZA 2KYXA 4HDGA 1HHQA 5B0BA 4TY9A 1VQNS 1R6VA 4AL6A 1UP1A 1IM6A 2CVIA 1LWEB 4I2QA 5ETNA 3BH7B 2E7XA 1UJ6A 2W7AA 2XMUA 2HHWA 4DV6F 3R7SB 2C28A 4FBTA 2ROEA 2HG4A 2OFGX 3G86A 2BA9A 1KVKA 1UAWA 4OJGA 1NRKA 3IRWP 2PN6A 4M1KA 1QY7A 3HF5A 3A13A 4K8RA 3TEHB 4QYZK 2GGPA 5H9FK 1YJVA 4NCGB 4Y0FA 3TZWA 5CZVA 3BB5A 2MY7A 5KT3A 3DRSB 3LP2B 1NUEA 4LF1A 4LRBA 1JLEA 4M5IA 3BGUA 1WKLA 1TL3A 1EQMA 3QPIA 2W24A 4MKAA 4BHQA 1FX4A 1IKWA 2YNIA 1SH0A 3TI0A 1HHTP 5IC4B 2V69A 5EDWA 5HBMB 3FCHA 4J9SA 4KY3A 4KV8A 2JDJA 2RQKA 2PMHA 5ETQA 4ETZA 4ZJOA 1WACA 1KOHA 1FK9A 2YXLA 3QJPA 2DO0A 3U02A 1W2BR 2FC8A 2IM3A 2Z2ZA 3GZ7A 1WC0A 5GVQA 4IRKA 2FGOA 5H9EK 4OI0A 2PFFB 4RU2A 2VQEF 1G4CA 3MM9A 4CLSA 2ZZNA 1PAEX 2CQ1A 2OPSA 4ALZA 2J6UA 3RBDA 2D3OR 3OR1B 3T1HF 5IWAF 2R2SA 2F5GA 3U1NA 2UVWA 3BM7A 1UKUA 4ELTA 2HVIA 2VASA 2RRAA 2AZ3A 2HNYA 1OS5A 2AJ1A 2VOPA 2VFUA 3GR0A 3BSNA 4MJKA 4NLTA 4QQBA 2IPOB 4HYKA 1XEZA 3QZ7A 3C16B 4DX8H 1HA1A 2ZUAA 5C42A 3CCES 2W9BA 4DL4A 1CJUB 2CQ4A 5BJRA 1JWWA 1LKZA 2MSTA 1VLYA 4CO0A 2BEFA 2JVRA 3MPWA 5DZ6A 1WEXA 5J2QB 1IR0A 2PT0A 1GTEA 3EZUA 2G13A 4GKKF 2Y1LB 3MMBA 5AXLA 3GIJA 4X2BA 2J5AA 2J9EA 1S79A 4L6V3 4OYPA 2HBYB 3BO4A 2IA0A 4EZ6A 1HI0P 1IVZA 2L9DA 4CDIA 1H7WA 1F1BB 4AE5A 1UMJA 1S0OA 1SV5A 1O8BA 2FLOA 2YNHB 3KTQA 4CT9A 2RKIA 2IM1A 1S99A 5KFLA 4KGVB 2XZDB 3J80U 5L46A 3B6BA 4FF2A 2UVVA 2AYGA 1YJNS 1S6PB 2M7SA 4CCHA 1WF1A 4JV5J 2HFVA 1QLNA 4DPWA 3IAM9 3ZNUA 1WC4A 1P8GA 1JLCB 2DR5A 3C6TA 2EG2A 1XMBA 2UUCF 3J7Z5 4B3MJ 4TYAA 2VG5A 3R5BA 4N8NA 3GR1A 3AODA 4QOTA 4ILRA 4AL5A 3E2EA 1V3RA 2AIRB 4XTTA 3TO8A 5DS7A 3AHPA 5L1LA 2W9CA 2K8GA 1FJCA 1P1LA 1S72S 3Q24A 3HSZA 3RJMB 4YY3F 2NZCA 3GPAA 2MZ1A 1XIQA 1N48A 1RBOB 2W2PP 1RTJA 4J9NA 3MEEA 2FJWA 2OFHX 5C24A 1QE1A 3TVZA 3C2PA 4DPOA 4PKDB 3TVKA 3SCKE 3K8WA 4O3OA 3VAMA 4LSNB 3TOQA 3DC2A 2RDJA 1L3SA 1D1UA 1K9MT 4G1QB 1RAGB 4M94A 1APSA 1T0TV 1RU1A 4OYOA 5CABA 1LWCB 2E1MC 2F1FA 4TLRA 4LF9J 3Q23A 1JB0C 1I6JA 4KR0B 5LOQA 2A10A 2MZJA 3VR1A 3LP1A 4I0WA 4ZHRA 3C3LA 1WC5A 2KXHA 1AROP 1VQ7S 2W2MP 1NPKA 3PHEA 3POTA 1DQ9A 1BWEA 2BKOA 1S6OA 2H5JB 3OFFA 1Q7YT 1JLAB 2ZZTA 3V6KA 4ILLA 2YQ3A 1NB7A 3WIUA 1SKWA 1H38A 3ENAA 1BUXA 4B3OA 1N5YA 3QBCA 2LKZA 2I2YA 1VIOA 2W7OA 4F4WA 4JI6J 3UO0A 8ATCB 5CZXA 3Q8UA 4ED0A 2V9KA 3FZBA 1U09A 4A8KA 3R97A 1UWBA 2HHSA 2B51A 4OZ3A 1NMEB 3JQKA 4KFBA 2QV6A 2LEAA 1F0XA 2GO9A 2OHDA 5EWEA 1KRPA 2ROGA 2AT1B 4G65A 3MEDB 5I3UB 3AXMA 3PVXA 1VBXA 3DRXA 1WWHA 2W4PA 4PXEA 3K5OA 1EARA 3BR8A 1R8CA 1YZ6A 2Y8WA 4X4VA 1EHWA 4IH5A 4NXMF 1FJ7A 1GEHA 3BGRA 1CPZA 2W4CA 4KHMA 5MAOA 1RQ0A 3C14B 1RWOB 3LA0A 1FVQA 5T7LA 3RRHA 3KLFB 2UU9J 2ZITA 4PWUA 3HCXA 2ZM6F 1B64A 4Z7CA 3RGIA 1FD8A 5J2PA 3G82A 4F50A 1NM2A 1BQNB 1QUPA 4DFPA 2GHVC 3J81Y 4GVLA 5HAOA 1FRXA 1ZTTA 1HWUA 1HNXJ 3M8QB 3DHWC 3JB9k 2XNRA 1WKJA 4KH0B 4M5DA 2CPFA 1L3TA 3IRXB 2CJKA 1RT7B 1FXRA 4UUWA 2R2RA 1VRQC 1S1UB 5F41A 4F04B 2CQIA 2CYYA 4U96A 1VQ6S 4LSLB 3DMJB 2CJYB 2WONA 2Q66A 5KFTA 4ECXA 1VHFA 1G2EA 2NSCA 1ACMB 2YKMB 2VBXA 2I5JB 4C8YA 3A8IA 3V2UC 1V5VA 3NGKA 4R8UA 2QL7B 4WYWA 3D28A 3JAMY 3OFEA 1R0AB 2UUBF 1P1TA 5B0CA 1GX5A 3MAQA 3ZXWA 1YJTA 1PC5A 5GADI 3OL7A 4LFBJ 3KK2A 5T14A 4WP9A 3KHRA 2CPJA 3FEZA 3L7OA 2EVZA 3FK4A 2AX1A 1N32J 4QWAA 1D9FA 1WOSA 2HBRB 1NCLA 5A8RA 3KK3A 2QZ8A 1TZ0A 2JEIA 4M5NA 2M8HA 5D3GA 1V3SA 3I0SA 3DDIA 2XYPB 1ZA2B 4RNNA 3H5UA 4WFYA 2ZH1A 4ANDA 3TWZA 1RWNB 2JLFA 1VQ8S 4DS5A 4PG6A 2RNEA 4UT4A 4ITSA 2BANB 1NH8A 2Y1IA 3SDEA 4PPDA 4U8YA 4ZCKA 3GJTB 2CZ4A 2W2NP 1RT1B 2KG0A 5AE2A 2OPQB 2FHJA 3OJUA 1NK5A 2GIRA 3MM7B 4FXVA 4QIGA 2B6AA 1NSQA 5M2UA 1UEUA 1FCAA 3DNCA 2V8HA 2QN6B 3ZZPA 3T5JA 2A2DA 4NRUA 3UCUP 2DGVA 2ASYA 1I5OB 4NL5A 2HAIA 2A1BA 4WP3A 4XO0A 5KFAA 1SKUB 3NOCA 4LIWA 1WHVA 2EC2A 2MKHA 1AZSA 4LVNP 3SQGA 4H4OB 3HHEA 4HACB 4IG0A 1FFSB 2P9GA 1EETB 1LW0A 1NHKL 4ECUA 3L95X 4IFYA 4PAAA 5IQ6A 1F2HA 4TY8A 2ROPA 1RHQB 3PIOQ 3GFYA 3IBWA 2ZH4A 1NDLA 3W62A 3CJKB 2E5GA 4QIWD 4YEAA 4L76A 1KLNA 3T1YF 4DX5A 2MQQA 4DR4F 5KFWA 2EWHA 4DV0J 4O3NA 1F60B 4PG4A 3MI7X 2HWIA 1WUUA 1RT3B 5D4LA 3CC4S 4ZS6A 2LQ8A 1TL1A 2FHMA 1UZDA 1I94J 2NYHA 4DCJB 2SXLA 1OYEA 4DDFA 3PHTA 4H4MB 1NDPA 2HFUA 4KBIA 2WW8A 2A3JA 3CIMA 2VQFF 3ZZRA 4CM0A 4ECQA 4JV0A 3D9BA 1IUJA 2KYZA 4DZDA 3C6UB 2I1RA 1UVJA 3KLHB 3GFXA 1U0SA 3H5SA 2YNGB 5D0GA 1LQ9A 4PRFA 2BXJA 1RGVA 1SKSA 2P5VA 3CCLS 2B4VA 3PW4A 5C25B 3KOAA 2KH9A 2QIFA 1TAUA 2WCXA 3BSCA 3M7VA 4C11B 5KOXA 4BS2A 4OLOA 4MK8A 2FJDB 1UWAA 5DM7Q 2VD3A 2QYGA 2YWGA 1X60A 4QR1A 3S01A 2B4OA 3NP5A 2QG9B 2V2QA 2HRTA 1VJWA 2PD1A 3I32A 1X4CA 3D0GE 4NWBA 4K50A 2EW9A 5ETSA 4USJC 3UNGC 3QSIA 2HLTA 4WTYA 3IN5A 4CLZA 5GAGU 3FMBA 2YKNB 1MU2B 5ADZA 4JI5F 2IBOA 5AXKA 4X4SA 1UETA 2ASLA 4GC6A 1VGYA 4DX7A 4NCGA 5D78A 5LL6d 3DLJA 4X84A 3DRSA 4ZDNA 4OYXA 4JBCA 3PJ9A 2BM0A 2QA2A 4DUZF 4DV6J 4F3OA 2RUGA 3EUNA 1SJQA 2M4MA 4RWWA 2FJAB 4JI1F 1VQMS 4OYIA 3G6VA 1Q4RA 3KHLA 3D3BJ 2KI2A 2XLKA 3ZFVA 4C3MA 2CPDA 2IHR1 1F9HA 3KDOA 1NNDA 1OSDA 3SFUA 3DRRA 5G0RA 1HBMB 3KLIA 4KRWA 2R7SA 2DR9A 4GO7X 5DDPC 2IMOA 3MUVP 3IM8A 1PAUB 4ZVUB 4FKXA 2V9WA 3OR1A 2DGWA 3KG0A 2CNNB 2Z4PA 1BLUA 3DI6B 5CYMB 3W63A 2QSWA 2HVHA 1HL6A 1U49A 1FRIA 4OI1A 1ZM4A 1U48A 4IG3B 1PO6A 1PYSB 3P45B 1GMVA 2O5DA 1YIJS 4C8KA 3G8QA 2P6SA 3PRBA 2Y8YA 1G3OA 2RHSB 4Q2MA 3C46A 3HT3A 2VQEJ 4ELVA 1JLQA 2ZBCA 4NZ6A 2HAFA 4K4YA 2R9LA 3T1HJ 2I9SA 3B4MA 5IWAJ 5D6GA 2I38A 3M8SA 5J2MB 1CQNA 5J2QA 5A76A 1VRTB 1WNEA 3HSGA 4KIAA 1S10A 3AY0A 2ILZA 3VGSA 4OYZA 2WHOA 1T05B 1UFLA 3MM5B 4ID8A 1SIWB 1VQ5S 2UXDF 1HNWF 1HNIB 2EFGA 3CCMS 1WSVA 5IT4A 4PUOB 4FZVA 2B4UA 3UN5A 4QR0A 2YKAA 2NPFA 1B4SA 2V4JB 1FJGF 2HW3A 2KJWA 2AW0A 3Q8VA 2ZDPA 4GKKJ 2UV8A 4WIQA 1SQFA 3KXDA 2PFDA 3GYGA 1JLCA 3MPUB 2CQ3A 5KFPA 2KZZA 3V81B 5F8MA 1BE4A 2DXEA 3H4DA 4QWBA 4KQZA 2IAJA 3RBZA 1NJXA 5L9XA 1BQMB 3FMWA 3I31A 2BQ3A 3OSPA 2VPYB 5SUHA 4B9VA 4OV6A 3DM2B 1DURA 2OP5A 2J7WA 3L09A 3GU0A 4TKTA 3G6XA 4ECWA 5JJBA 5IQQA 2K7KA 5HQ8A 4N5SA 4P2XA 1NBEB 2DH9A 2DXFA 2UUCJ 2VZ9A 2HRUA 3DLKB 4Y28C 2IFXA 5B0DA 3VAGA 3D6HB 2BOPA 3CULA 2CA9A 1PJ5A 4F4KA 2CQDA 4IR9A 1HKAA 2NR0A 3CMAS 3DLLQ 5CYJA 4LSNA 1FDBA 4YY3J 3DXBA 3MDFA 2R4FA 4G1QA 3M8RA 1O6XA 2MKSA 3MEGB 3FKBA 2AQ4A 3GB0A 1UVNA 2AX0A 2OPPA 2CWKA 1VISA 2VFTA 1CJVB 2Z58B 3FNNA 3J7YU 4JI3F 1Q8BA 1RTDA 2RSQA 4F25A 4OZJA 1HFEL 4U95A 4DQSA 1N52B 1FESA 3QGHA 4N41A 3W9HA 1YLXA 2E1AA 2MEWA 4PXBA 1CBKA 2JLGA 2G2ZA 4C8LA 2KHCA 1JLAA 4CTAA 1A7GE 1K73T 2XO6A 3DDKA 4CLYA 1S0MA 5ETTA 3H20A 3PYEA 2HBZB 4UQGA 2CQCA 3HFVA 2FHKA 5L8RC 4IOAQ 2M70A 4AT1B 2GVDB 2D69A 3OT9A 2HLUA 2RF2A 4JB8B 1CLFA 4QWCA 1Q8LA 3PRDA 1M1KT 1A6LA 3MEDA 4FYYB 3O8WA 3IS9B 2ZDOA 2ZE2A 2K1RB 2AHOB 3GV5B 3H42A 3E01B 3GIRA 1Y7PA 1KDNA 2EBGA 3ILOA 4IOCQ 4L3KA 2XWXA 2KDOA 2HIQA 1MN9A 1YBAA 3VAIA 2MQ8A 2IVMA 3AD7C 1IJFB 3I5CA 2GMJA 3C14A 4P7VA 2FVPA 2DO4A 3W8GA 2VA3A 1M5HA 3UDLA 1VHIA 4CO1A 1IBKF 3M30A 3KG4A 5K8PA 3OSNA 3J7AN 2BJ3A 2B7BB 4ETXA 2K7JA 2VG6B 4TNOA 3TAPA 4NXMJ 3W2VB 4UF4A 1MLAA 3BV8A 4UOGA 2NYIA 3QGIA 3M8QA 5BYQA 1KLMA 3NNCA 4AUKA 3VF0B 2OIHA 1RT7A 2JFDA 1SL0A 1T9YA 2UP1A 4F4XA 3ET6A 2DB1A 2JRSA 2ZM6J 3DMJA 5KG7A 1Z1ZA 2RRNA 1XJWB 5JVHQ 3GIIA 2YKMA 4P10A 1JQGA 4WKRA 2WW4A 4O44A 3CT9A 2IJNA 2YH0A 1O51A 1JX4A 1PSDA 1R0AA 4RNOA 3AFGA 2JLEA 1HNVB 2AJ2A 4DV5F 3M8PA 3LGHA 3VALA 3MM6A 3NGSA 4YB1P 4CI0B 4LVOP 1F5AA 1RJJA 3BKUA 3HZEA 3A8EA 1S0VA 1ZH5A 3CD6S 2GJIA 1REVB 4USTA 3UFCX 4USUA 1QAJA 1OMSA 2W8LA 2DGXA 4Q8EA 3K8VA 1QVFR 4KHRA 3OLBA 1KOOA 2UUBJ 1EZZB 1SCJB 4O0NA 3W9JA 1YBTA 1SC6A 1EJ7L 2KXFA 4OJ3A 2ZWOA 2W8KA 4OI6A 1S4EA 1TR0A 4GO5X 2OH2A 3UNYA 4Y2AA 5GMEA 5A6WA 2R7RA 3HT0A 5LXRA 3F73A 4YHHF 3OLAA 1H98A 1FKAF 1WC1A 4X65F 2XSJA 3THTA 2A6MA 5J1PA 4IOBA 1DAXA 3V6DB 3N28A 3ZZUA 1DLOB 2G4BA 3OXFA 3X1LB 1JNRB 4IRCA 1X4EA 1NAQA 1R8AA 1XNRF 5F8LA 3TP2A 4RNFA 2OPRB 1GMUA 2J8SA 2OPQA 5B0FA 3UVJB 1RBLA 4OV1A 4ZIVA 5CYQB 3CSKA 1R27B 5DJBA 3LALA 4DR2F 4F7VA 1C2PA 1J5OB 1D8YA 4W4MA 2HGNA 5KG0A 3WQPA 2JFKA 3NKYA 1RHUB 3EZ5A 4ZLPA 4PQUB 2G0IA 1MMLA 5E2QA 2DGSA 3JTOA 1HWLA 3FBEA 3LH2S 1C1CB 5L1JA 4RW9B 5HROB 3OPKA 1EETA 3NOGA 4NX9A 3EE3A 1WF2A 4MTPA 3US5A 3HFZB 4B9LA 1IN0A 1LXJA 4LR9A 4N77A 3PX4A 5KFZA 1SC3B 3CJKA 2PE8A 3PX6A 2X51A 2KZMA 5D4PA 5IT9U 3HO1A 3ADAC 4HEA9 4L3NA 4CQ1A 4HVZA 3ENVA 3PYDA 3HULA 1SQEA 4WXWA 4IYQA 2LFVA 1N4LA 4RW8A 3PEJA 1NB2A 3QQCD 1FRMA 3VVUA 1X5PA 3PXGa 4O3QA 4H4MA 4C8NA 2GJFA 3T1YJ 1Z4UA 4O0IA 3MPDA 3P5BP 4DR4J 4C8OA 3P5TL 1Q16B 1RWMB 2XULA 2L08A 3K5MA 3CDWA 3AH6A 3KLHA 3ZO7A 2YNGA 4G3IA 2V4RA 2V67A 4J9VA 2L9NA 2VHGA 3LP0B 4ID5B 2LQ9A 2MZSA 1Y4ZB 3QFWA 1XC9A 2VQFJ 3D4JA 3RR7A 3RZAA 4DFJA 3UR3C 1TK0A 3MMAB 4ZPTR 5FLXU 1D0EA 4HH0A 5L39A 3WZ0A 2IC3B 4DXLA 5D4NA 3CW2C 2B43A 3AOBA 5LSLA 2ZWPA 2FGCA 3V6JA 3ZTOA 3F41A 4FDFA 4U9RA 5GAEU 4DX6A 4MIWA 4NLGA 4ZPWR 1Q78A 5HN0A 3P8BB 3D0IE 1XMQF 3ITHB 5E0OA 1V6HA 2YKNA 4ZP8A 2O3DA 3R5JB 4C0HA 3VAHA 2W2QP 2O66A 4ZVTB 1RTIB 3CJ5A 1WG4A 1OIAA 2CPHA 2XGPA 3IBFB 4TLQA 3H59A 1NSKL 4LUBA 2NPIA 1TKXA 3T6BA 2DCUB 3EVMA 3M1VA 1HARA 1QD1A 2LXIA 4ZPCA 1RADB 4Y3CA 4PXDA 4JI5J 1KNZA 3EPIA 3PKYA 4P7TA 4Q44A 4QIFA 1S1WA 5LJ5Y 3SSRA 1FRKA 1XK8A 2ZC3A 4YQWA 5ETOA 2HWHA 1HBMA 4DUZJ 4M5GA 2P8IA 1QTNB 2G2YA 2GAHC 3QNWB 1RTHB 4JI1J 1U1NA 2E1PA 4KAIA 4LF5F 4WFNQ 1KQGB 3AB2B 2KL8A 3IGNA 1N54B 4ZLLA 2DY1A 1N8RT 3D68A 1TP7A 1XMOF 2MQLA 1YJUA 4JI4F 1AUDA 1PJ6A 2EC0A 1D9AA 3W5XA 3MAHA 2KT5A 3J80Y 5IOLA 1DTTB 4IG3A 1VQYA 3VHQA 2COLA 3FFIB 3RBXA 3OL8A 2E5LF 4TXSA 1XNQF 1U6FA 2GV1A 4YUDA 4C6AA 3BO2A 3CMES 1C4AA 2CG8A 3UCGA 1JXLA 3SCJE 2EKNA 4FYXB 4DUYF 1S1VB 1URRA 1GX6A 4QYRA 2MTLA 2LU1A 3NGTA 5HMWA 3A4TA 3HX9A 3VAKA 2FQQB 4QU6A 3MUMP 3T9NA 4B17A 1HQEB 3MECB 2CQHA 2AZ1A 1RYRA 1HQUA 2ZEJA 4U67Q 1RHRB 2ZD1B 4TU9A 4PUOA 3NAIA 1VC0A 3DYAB 4B9MA 3EJMA 4NLWA 4NA3A 1A9NB 4LF4F 3AA9A 3IG1B 1RHJB 2Y0BB 5M2PA 3FRYA 3M2UB 2OEJA 1YI2S 2UXDJ 2XSFA 1URNA 2CNOB 3GYNA 5I3PA 3UI3A 4OHVA 2CPIA 4Y65A 5E3CA 3V81A 2DK2A 3RU0A 5LMNF 1VRUB 2HQGA 1R8PA 3QT5A 4KGKA 1U45A 2RQMA 4OHYA 1H3DA 1FJGJ 2BM1A 4DS4A 2V68A 2AP6A 2YPYA 5SZTA 1BQMA 3Q8QB 3RTVA 5A8KA 3P6YC 4RUHA 4LF2A 1TUVA 3ONQA 1GFWB 3HHLA 4FN5A 1FXLA 2MY8A 3R2CJ 3QLHA 3CD7A 3MAAB 3FQKA 2Q6CA 5B08A 1NU4A 1NK4A 4J90A 3HM9A 3VTIA 1ZYQA 3HVTA 2MQMA 2DNPA 3FQLA 2P9CA 2OSQA 3HI9A 4YN3B 2ZHOA 4CWBA 5DQHA 2VONA 1C0TB 3W7BA 1VBKA 1U1RA 4F2RA 2ZOFA 2HEKA 3M05A 4L72B 4CLPA 4RUAA 2R7VA 5GAHI 4NZ0A 1AXQA 2MZRA 5KFSA 3D66A 2GNKA 3FUYA 5D0HA 3RG6A 3PR4A 2IVFB 1M5PC 2AV5A 4ZVRB 2FVSA 3GTYX 3MEGA 2GMHA 2MKKA 3ILIA 2YNFB 1BC6A 3SQOP 1CJVA 3CJRA 3HK2A 3BO3A 3A8JA 5K8MA 2PIIA 3N6NA 2VICA 3EX7B 3SV3A 1N34F 4B02A 3DGPB 5HQMA 1S1TB 4E0DA 2D1CA 1N5SA 3FEYB 1JXEA 1H2VZ 4LF7F 4X4TA 2NSBA 2IRUA 1JLBB 3UWTA 5K14B 2RAQA 1UVIA 2KVQE 4JI3J 1U2RA 2CG4A 4CLWA 3VWSA 4B9NA 1FWPA 2GVDA 4I2PA 2IM0A 2H54B 3KNAA 4CH7A 4DN0A 2MQPA 2ABYA 4CLUA 5A0YB 1LWFA 3FBBA 5JXSA 1Q5VA 2BW7A 1UW9A 4WKYA 3G9CA 3BYPA 1SPBP 3ETMA 4OX9F 3R2DJ 2PEBA 2J6TA 4OJ1A 4RL1A 2VU5A 2VG7A 4F67A 4B3SF 2HQFA 1D09B 2FHJD 5HI7A 2KB2A 4K2JA 5E5NA 1ZA1B 1M90T 4ICLB 1TU0B 3QO9B 4HHUA 4CNYA 4AQYF 1NJWA 3NRBA 2F63A 8RUCA 4X64F 3T1AA 3TZYA 1M5KC 5KFQA 1VCTA 2VG6A 4EO8A 5HJXA 4ZP7A 3W2VA 1VQ9S 3HVRA 2MQOA 3FEXB 4QCLA 2WRMA 4HT5A 4NCBA 4W92B 5KG2A 4RKUC 2B56A 3NS7B 1VC5A 1IBKJ 2ZH6A 4C97A 4LF8F 2CPXA 1CULB 3W5ZA 1GQEA 3RUBL 2KG1A 4KGXB 2M3DA 5IFMA 4MMOA 4P2MA 4RW7B 3VZIA 2W2OP 3OFGA 4YDDB 1KEKA 5HMXA 1PGZA 4OHWA 1TUWA 3OUYB 2HSEB 2DRDA 5B7WA 1OQ6A 1HNVA 2E9ZA 3CCWA 3KK1A 3TA2A 4D3GA 4X4RA 4L73A 1RWPB 3W2WB 1ZM2A 4X66F 4O4GB 1IBCB 2O1PA 2MLXA 4YS2A 2BE7D 2FC9A 4I64A 2NREA 3MZIA 2IVYA 4RW6A 1RWXB 2CQ2A 2KXNB 3TX0A 1ZETA 2BJEA 3PIPQ 2VPWB 2DNZA 2VJUA 5KFBA 4FVCA 2CPYA 3UE2A 5BYRA 3FSXA 3PYGA 4NYPA 3BPSP 1ICEB 1SH3A 3HHDA 4DV5J 3JSBA 2UV8G 1U1QA
chains in the Genus database with same CATH topology
3SQGA 5KTQA 1Y5LB 1X9SA 4RBUA 2NS1B 4H4OB 2RDIA 3HHEA 1ZAWA 2CJAA 3DCAA 2BDPA 4IG0A 1FE4A 2P9GA 2AJ0A 1EETB 1LW0A 2BJDA 2ZC4A 3HKZD 2XBPA 3SSQA 3MEKA 3CCVS 4Q0BB 4ECUA 3L95X 5GAEI 5I42A 2PDAA 4ZVEA 3PW2A 1L3KA 2LXUA 4DR6F 4EYHB 3KYLA 2F7VA 4IFYA 1FTRA 3THPA 2FUG9 5IQ6A 3TARA 1XR5A 1FHTA 4TY8A 3T5LA 4DQQA 2JSXA 2F8EX 2ROPA 4I6YA 4MIBA 4EO6A 3RB3A 3RW7A 2WBMA 2VPXB 2E5JA 1TL5A 2RJZA 1C0TA 2APOA 3PIOQ 5FJ4A 2KO1A 3GFYA 2BUNA 3IBWA 2ZH4A 1TKZA 4DL3A 1ZM3A 5MLCV 3CJKB 3TYTA 2E5GA 4QIWD 4YEAA 3HVWA 3PJXA 3OXLA 3GFHA 1WTBA 2N7YA 1G7CB 5M2RA 2O01C 4KGMA 1KLNA 5I3UA 3ICLA 3T1YF 2DH8A 2CJBA 2FJXA 2WAQD 4QPTA 1DLOA 2BV3A 2MQQA 4CO4A 3GV7B 2D74B 4NLUA 1XR7A 1Q53A 1S76D 4DR4F 5KFWA 5B0EA 2EK6A 2EWHA 2PO4A 2AJFE 4PXCA 3T3FA 1Z2LA 4O3NA 5KT2A 5KFRA 3H2LA 1YGYA 4KO0B 3N5BA 1F60B 2OPRA 2WB1D 3I96A 2VODA 4PG4A 2LYVA 3MI7X 4C2MA 2HWIA 3DXSX 1K1QA 3QJJA 4USHA 4LFCF 3PY8A 3N6LA 1RT3B 5D4LA 5CYQA 5DQIA 5KFEA 4ED1A 5KT6A 1F2GA 1Y3KA 4X4PA 3CC4S 1UJ5A 2N4CA 4ZS6A 3RR8A 3M2VB 4G6VB 1TL1A 1J5OA 3JSMA 1MMDA 2FHMA 2IAJB 1E6YB 2CDQA 2EFOA 1K0VA 2M0GB 1L3UA 2DGQA 1FTCA 3LGMA 4UY8T 2J0XA 2OKQA 2SXLA 3IA0A 1G1XA 3E8OA 4A8SA 4OI4A 4GMKA 4DDFA 4H4MB 1R8BA 3PDNA 7FD1A 1UVLA 2QLWA 3M6XA 1ZBTA 3OHAA 1JLEB 3PACA 4KBIA 2XWYA 3CWJA 4ZK7M 2WW8A 1JLFA 2A3JA 4DG1B 3CIMA 1C0UA 4C3LA 3KLFA 2VQFF 3ZZRA 3W3SA 1DJ0A 4Y2KA 2MB0B 4BC9A 2YX1A 4ECQA 4JV0A 1QSLA 2CPEA 1RT6A 1IUJA 2DR7A 3TUJC 4YDXA 4H4KC 1S1TA 4JV2A 2F8HA 2XMMA 1HW9A 3SCIE 2KYZA 5K5MA 1JJ2R 1BQNA 3C6UB 5EX3A 2L9WA 2I1RA 3PM9A 1HD0A 3KLGA 5ITHA 1UVJA 3KLHB 3GFXA 4FNIA 3LF0A 3H5SA 1RISA 2YNGB 3GYXB 1LQ9A 1JLBA 4PRFA 4RW9A 4KB7A 2BXJA 4KV8B 1S7HA 1RGVA 4Y2CA 1SKSA 2P5VA 2XNQA 2J8AA 4YR0A 3CCLS 3OHBA 4NA2A 3NNHA 2HHPA 2B4VA 3CB4A 3PW4A 5C25B 2XI3A 1X5TA 3KOAA 1SXLA 2KH9A 2QIFA 4MK9A 1TAUA 1FK9B 4AL7A 2GC8A 3I9ZA 1SJ1A 1UEVA 2WCXA 4OZ5A