1JLFB

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
427
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 104
structure length 404
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlfB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfB03
1GX5A 5KFKA 4O3PA 3KLIB 2IAJB 3DRPA 4RUCA 1RT2B 4O4GA 2R8IA 1LW2A 4R5PB 4KFBA 2BRLA 3V6HA 1DLOA 2VG7B 4K4TA 3LP0B 4NLWA 5KFTA 2E9RX 3M8PB 3UQSA 3N6NA 1RA6A 3KHGA 4JV1A 4WFZA 3V4IA 1HYSB 3KK1A 2YNHB 4H4MB 5JXSA 3M9MB 1IKVA 1YVFA 2V4RA 3CDEA 2OPPA 3I0SB 5K14A 2AX1A 3FSIA 5F8LA 3KNAA 4WYLA 1HQEB 2J6TA 2IBKA 5J2PB 3JSMB 3DM2B 4GC6A 1FKOA 1S1VB 1RT7A 4RW8A 2YNFA 5KG4A 3SFGA 3MR2A 2JLEA 2JEFA 3ISNC 4WYWA 5I3UA 3DRPB 3QIDA 3IGVA 3BSAA 4J9PA 4ECVA 4U7CA 1LW2B 2O5DA 3IS9A 4KFBB 1DLOB 2ASLA 4YQWA 2D3ZA 2C2EA 3KMQA 4DL7A 1ZTTA 4EEYA 1JLEA 4O3SA 3V4IB 5DLFA 5KG5A 1T3NA 3KK1B 4ED1A 3FFIA 1IKVB 2ILZA 4NLQA 2OPPB 3OL6A 5K14B 3T5JA 3BGRA 1REVA 3NKYA 3QGGA 3QZ7A 3H2LA 2OPSA 4I2QA 1FKOB 4RW8B 1RT7B 2YNFB 4ED0A 4KHMA 3ISND 4MK7A 3OL9A 4Q0BA 4PWDB 5I3UB 4ECXA 3DRSA 4XPCA 4H54A 4J9NA 5KFWA 1C1BA 3D5MA 3IS9B 3KLGA 4F4ZA 4ED8A 4KSEB 4J9SA 1MU2A 1TVRA 1JLEB 4Y3CA 3KJVA 1VRUA 4IOBA 3IRXA 2I1RA 4MH8A 5DGAA 2WHOA 3NBPA 4RNMA 2BQRA 1NNDA 1REVB 2ZD1A 1R0AB 3ITHA 1D0EA 1S9FA 2QE5A 2OPSB 2YKMA 3DMJB 4I2QB 1RTDA 1JLQA 3GIJA 3N6MA 4IFVA 3MR5A 4Q0BB 3TAMA 3DRSB 3MECA 5F9NA 3DLEA 5KFZA 2BR0A 1JIHA 2C2RA 3UPFA 2FVQA 4XO0A 1LWFA 1C1BB 4OL8A 3N6LA 5KFHA 5DG8A 5L1IA 3H5XA 3EPGA 4YR0A 3KLGB 5DQIA 3H98A 4HKQA 5KFPA 3PW0A 1RT4A 1MU2B 1TVRB 2WTFA 1HNIA 1VRUB 4O3NA 3IRXB 5KT2A 4ED2A 3NBPB 3NAHA 2BRKA 5DLGA 4IRCA 1HMVB 3OSNA 3ITHB 1C2PA 5J2QA 2R8JA 2YKMB 2GIRA 4WXOA 1JLFA 1JLQB 5KFRA 3UDLA 4IFVB 3OLBA 4IFYA 3TAMB 4K4SA 3MECB 3DLEB 4IH5A 4LSLA 2FLPA 2IA6A 1LWFB 4M95A 2YKNA 1JX4A 1QUVA 4NCGA 2B6AB 4NLDA 5DQGA 3RAQA 1S0NA 4RW9A 3FQLA 4IG3A 1RT4B 1SH2A 4NRUA 5KFLA 1HNIB 3T19A 4RZRA 4K4YA 3IN5A 3DI6B 3DYAA 4Q45A 3BQ0A 5KT6A 3CJ2A 5J2QB 3H4BA 4H4OA 3HVAA 2R2SA 3LP1A 3CJ5A 3RB4A 3MR3A 5J2NA 3GIMA 4WZMA 5T14A 1S97A 1QAJA 4TY8A 3RBDA 4QW9A 4KKOA 2RF2A 4LSLB 3E01B 3CJ0A 2XC9A 2C22A 2YKNB 2FVSA 4MIAA 3GILA 4NCGB 4KHRA 2XI3A 2YNGA 4RW9B 3OL7A 4IG3B 5F8JA 4IG0A 1KLMA 2IC3A 4RW6A 1K1QA 3GQCA 4IRKA 4QWAA 4QWCA 5JUMA 3QZ8A 5C42A 2D41A 4U6PA 2XGPA 5KG3A 4Q44A 4ZPAA 3MFHA 2ASJA 5KFYA 4K4VA 4ZVEA 2B5JA 4J9LA 3OHBA 1S0MA 2BANB 4XPEA 1Z4UA 4DL3A 1JLCA 5J2NB 4TY8B 3IGNA 3KHHA 2V9WA 3V6DA 4KKOB 2RF2B 4DL5A 2JEJA 2E9TA 2VG5A 2W9CA 2YNGB 4NRTA 5L1KA 4NLSA 4ECTA 2AU0A 4IG0B 1QAIA 4Y2CA 1KLMB 2IC3B 5F8MA 4RW6B 5EWFA 5EDWA 4ZVGA 1DTQA 5C42B 1BQMA 2R2TA 4YP3A 3V6KA 1IKXB 1T05A 3JYTB 4KAIA 5KFEA 3PR5B 2DPJA 2B5JB 1XR7A 3G6YA 4LSNA 3C6TA 1S9EA 1SUQA 2W7PA 3TQ1A 4KO0A 4FBTA 2WOMA 2ZE2A 4O4GB 5KT7A 2HNYA 3RB6A 1JLCB 5CYQA 1XR5A 3QIPA 3MR6A 4NLXA 3PJXA 4NLVA 3V6DB 4RNHA 1SH0A 4F50A 2CJQA 3RAXA 3T5HA 2VG5B 2R8KA 2W9CB 2RDJA 3BSNA 3M9NB 1RTJA 2OPQA 5HLFA 1FK9A 4EBEA 4KBIA 4LQ3A 3H59A 4TYAA 1DTQB 1BQMB 5F8HA 3GIKA 1T03A 2JEGA 4KE5A 1S9GA 1JKHA 1S1XA 4LSNB 3C6TB 2R2UA 4NLOA 4KO0B 4GC7A 2WOMB 2ZE2B 5KFXA 3G86A 3RBEA 2HNYB 5CYQB 2YNIA 3QIPB 4ZPDA 4J9OA 4ECSA 4RNOA 2IJFA 2C28A 1FKPA 3PW2A 4QWEA 2ASDA 3DLKA 5J1EA 3H5SA 1K1SA 1MMLA 4TN2A 4QWBA 4IKAA 2E9ZA 4B3OA 1HPZA 1T94A 3H5UA 3FFIB 5KFAA 3KHLA 1RYRA 2UVVA 4FBUA 5L1JA 1RTJB 2OPQB 5HLFB 4TQSA 2XCAA 2VG6A 3BGRB 1FK9B 4J9MA 2FJWA 2WB4A 2UVWA 1S1TA 1T03B 1S9GB 1C1CA 1JKHB 1S48A 4RNNA 4ED3A 1S1XB 2XI2A 4KV8A 4WZQA 3MEEA 1OS5A 3LAKA 4O3OA 4O44A 2YNIB 1N5YA 4NLYA 2JC1A 1FKPB 3CVKA 5DG7A 3DLKB 5J1EB 1JXLA 3KJVB 4YR3A 2WONA 3V81A 3OLAA 3BQ2A 2IM3A 4TYBA 4YMEA 5EUHA 3RB0A 2HNZA 2VG6B 4IDKA 5C24A 2ZD1B 4R0EA 4ZPCA 1BQNA 3I0RA 3PR4A 1S1TB 3MEGA 4ECZA 1C1CB 1RTDB 1S10A 2XCPA 3PW4A 4KB7A 3IG1A 1DTTA 2FVPA 4EO8A 4KV8B 4QWDA 3H4DA 3MEEB 1LWCA 3G6XA 4NZ0A 4O44B 5KG6A 5L1LA 2W7OA 4Q8FA 1N5YB 5HP1A 2IM2A 1RYSA 4WXWA 5DGBA 5KT5A 1JLAA 4ZVHA 4URQU 5KT4A 3KLFA 4J9QA 1HARA 4EBDA 3OL8A 4RUAA 2V4QA 2WONB 1HNVA 4Q8EA 5F8GA 2HNZB 2HMIA 4TXSA 4IDKB 5C24B 1NHVA 3Q8QB 1ZETA 1TQLA 4JV2A 1BQNB 3I0RB 2IJNA 3MEGB 4MFBA 2HNDA 4ECWA 5KFQA 1JLFB 1QE1A 3MFIA 3PZPA 3MEDA 4M94A 3IG1B 1D1UA 3HVTA 4NLRA 1DTTB 4IFYB 4JUZA 5F9LA 3BSCA 2B43A 3EPIA 1LWCB 2IM0A 4J9KA 3KK3A 4NLUA 2DPIA 2VA3A 2GC8A 3NL0A 4K4ZA 3LALA 1JLAB 4Q43A 1KHVA 3KLHA 3BR9A 3OSPA 3KLFB 3I5BA 4RW7A 2FLNA 4ICLA 2HWHA 4R8UA 1JLBA 2EC0A 5KG1A 3DYAB 5F8IA 4K4WA 2IAJA 4EBCA 4RW4A 5C25A 2W8LA 4H4OB 2HNDB 4MFBB 3PW7A 4IR9A 3DDKA 1S1WA 3MF5A 4O4RA 5EWEA 4QW8A 3LP1B 3MEDB 2W9BA 4TQRA 3GV5B 3HVTB 5FDLA 4ECQA 2JC0A 4ZP8A 2RDIA 4JV0A 4EO6A 3BSOA 5KFNA 4ZP6A 4X2BA 1U09A 1TL1A 2IMWP 3KLHB 3FRZA 3KK2A 2F8EX 1RT1A 1IKYA 1S6PA 4RW7B 1RA7A 3Q8RB 5KFDA 2FVRA 3C6UA 4R8UB 1JLBB 3JSMA 4MK8A 4NLTA 3KLEA 1WNEA 4FS1A 1C0UA 2C2DA 2HAIA 1XR6A 4PUOA 4MK9A 3LANA 3DOKA 1ZTWA 4RW4B 5C25B 5EWGA 2D7SA 1TKTA 3H5YA 4WFXA 3QYYA 1S1WB 5I42A 3M9OB 1EETA 1RDRA 4O3RA 2VA2A 2W9BB 2AGQA 2W8KA 5FDLB 4IH7A 3LAMA 5KG7A 2XGQA 3D28A 1UWBA 5KFGA 1J5OA 5KFJA 1LWEA 2UVRA 1TL1B 5HROA 1S49A 3CDWA 4F4YA 4G3IA 1N56A 3KK2B 2J6SA 1RT1B 1IKYB 1S6PB 3QO9A 2ILYA 4IR1A 4RU9A 3C6UB 1GX6A 4TY9A 3CDUA 1TKZA 3KLEB 1C0UB 2GIQA 2JEIA 1T05B 1N6QA 4PUOB 3QLHA 4PWDA 3DOKB 1S9EB 1SUQB 3TVKA 4DG1A 1TKTB 5KFMA 4ID5A 4Y2AA 5I42B 2FJVA 3ICLA 1EETB 3LP2A 2WCXA 1S0OA 5KT3A 2R8HA 2R8GA 4IRDA 1EP4A 4NYZA 4IH6A 2XWYA 3FQKA 2IM1A 2AX0A 1S6QA 1UWBB 1J5OB 1RTIA 2ALZA 2OPRA 1I6JA 2BE2A 1LWEB 3HVWA 5HROB 4MKAA 4TLRA 4QPXA 3E51A 3DLGA 3QO9B 5J2MA 1R0AA 2AWZA 4LQ9A 4ZVFA 2I5JA 3HKWA 2AGOA 4K4UA 1TKZB 4ECYA 4ECUA 2UVUA 4YR2A 1N48A 3DMJA 3HHKA 2D3UA 4MKBA 3SFUA 1N6QB 4G1QA 3I5CA 3QLHB 4DL2A 3T5KA 2UUTA 5D3GA 4IQXA 4O3QA 5KFBA 4DG1B 4EYIB 4ID5B 2BQUA 5F8NA 4WFYA 5KFOA 3Q8SB 3LP2B 1TV6A 4DL4A 1EP4B 3GYNA 4Y34A 1TKXA 1TL3A 1W25A 4ZP7A 4ZMMA 3KLVA 1S6QB 3T1AA 1SH3A 2BQ3A 4NLPA 2WRMA 1RTIB 3Q8PB 2OPRB 2BE2B 4B3OB 1HPZB 3CO9A 4K50A 3GIIA 2UUWA 3KHRA 3DLGB 2CKWA 5J2MB 3BQ1A 1HMVA 2I5JB 3BJYA 3CJ4A 4ZP9A 2RKIA 4WE1A 4MIBA 3V6JA 2ATLA 1RTHA 3H40A 4G1QB 2J6UA 4ED6A 1HQUA 5D3GB 3KOAA 4ED7A 3GV7B 1JLGA 3PHEA 3PVXA 1TV6B 2WK4A 2B6AA 1S4FA 3CJ3A 1RT5A 1RAJA 4DEZA 1TKXB 1TL3B 1VRTA 3M8QA 3DRRA 1RT3A 4I2PA 3V81B 4DL6A 3DI6A 5C5JA 3NAIA 5KG0A 1C0TA 2FLLA 1LW0A 4K4XA 2R2RA 2RKIB 4WE1B 4F4WA 5CYMA 4PQUA 3EZUA 1RTHB 5KFVA 4ZHRA 1HQUB 3NGDA 4J9RA 3SI8A 5L9XA 3QGIA 1JLGB 3KMSA 5KFCA 1RT6A 3E01A 1IKWA 1N4LA 5HP1B 1RT5B 1S1UA 5KFIA 3I5AA 5HBMA 2FVCA 2ZKUA 1VRTB 5KFSA 3M8QB 3DRRB 1RT3B 2W9AA 2AQ4A 1SV5A 3PJWA 4URGA 4I2PB 4I7FA 3RB3A 2OH2A 1HNVB 2V0NA 4NLGA 3UR0A 3DOLA 3T5LA 3CIZA 2HMIB 1C0TB 1LW0B 4HYKA 2BANA 3KLIA 3GV8B 1RT2A 5CYMB 4URSA 4PQUB 4RNFA 4ECRA 4FS2A 1QE1B 4R5PA 4ZPBA 3NMAA 4ZHRB 2HWIA 2VG7A 4EYHB 3LP0A 3M8PA 1NHUA 1RT6B 3OHAA 3MTKA 3KK3B 3VQSA 2FJXA 1IKWB 4F4XA 5DG9A 2QV6A 1CSJA 1S1UB 1HYSA 2YNHA 4H4MA 3QGHA 5HBMB 5KFUA 3PW5A 3I0SA 1KHWA 3FDSA 3G6VA 1HQEA 1SV5B 4ICLB 4I7FB 5J2PA 1IM4A 3BREA 3DM2A 3CWJA 1IKXA 1TP7A 3DOLB 3JYTA 5DQHA 1S1VA 5KG2A 5KFFA 2AGPA
chains in the Genus database with same CATH superfamily
3KLIB 3TP2A 3BO3A 2XMWA 2VKRA 2MZRA 1IR1A 4K4TA 4USVA 1RA6A 1F2HA 2XMAA 4JOUA 2MPUA 2VD3A 1RWKB 4V19J 5I3UA 2B4VA 3CCZA 1FXDA 1REVA 2RNEA 3AJDA 3GJRB 1O0PA 4DQRA 3D3BJ 4WU2A 1MWQA 3DRSA 1VK8A 2PO4A 3HFZB 3VWSA 1MU2A 2VFTA 4RNMA 3J7ZT 3GIJA 1RHRB 4NZ7A 3OJUA 1YKWA 3TYTA 5DG8A 3DDNA 3NGSA 2OP5A 3PV8A 2DGOA 2G4BA 5KT2A 4ZVOB 3WDOA 3D9BA 2AEMA 3TUIC 2PEHA 1HBNB 2LLZA 3OLBA 3KYLA 3ZZOA 5D8HB 2BKPA 2KI2A 5A2QU 2IA0A 2RE1A 3R5BA 3W62A 3LWLA 2EWHA 2D9OA 2HHPA 2VC0A 3CGIA 2ZC4A 1JJHA 2C22A 2FVSA 4M1KA 4QWAA 3MFHA 2P6SA 2XYGB 2JSXA 2F4VJ 2HQFA 1PJ6A 2OO4A 3G8SA 4DZ6A 1JLCA 5J2NB 3R5JB 4NEYA 3Q0AA 2W9CA 4ZJOA 2VU5A 4ECTA 3VGTA 2IC3B 2V68A 3GFZA 4NA3A 4ALZA 3JB9k 2Y3YA 4KAIA 1KOOA 1SUQA 2ZE2A 3W9HA 3OR1B 3QIPA 1RE1B 2E1MC 2WZ1A 3EXCX 2OPQA 1FK9A 5FLXY 1S9GA 5A2QY 4CO3A 5K8NA 2DNLA 2WOMB 1O6XA 5LMUJ 4OHWA 3C14A 3LTOA 2QYGA 3FBBA 1HW8A 3EDQB 2ABYA 2V2ZA 5D4LA 2ZC3A 1XERA 2DNGA 2UVWA 4DR1J 4M5HA 2ZJQQ 3CCLS 3KJVB 2MKIA 4AFFA 2IM3A 2VG6B 2MKKA 2VJUA 4DUZJ 1CJVB 1RTDB 3IG1A 2YWKA 4C48A 1N5YB 1ZZFA 4KYZA 5DJBA 3N5BA 3KG0A 4P74A 2BOPA 2WONB 4WK3A 4YN3B 2G0CA 2J9DA 1ZETA 1B70B 5HI7A 3MEDA 1S72S 4JUZA 2ZWPA 4J9KA 1N36F 2QX0A 2JZ5A 3T1YJ 1EB0A 5LXRA 2ZM6J 2E1RA 3JXOA 2KRBA 3GU0A 1HI1A 2N3OA 5C25A 3ONQA 4J7CA 4UT4A 3CD7A 2E1PA 1IBKF 2CWXA 4A8YA 1NSQA 1X7VA 1IKYA 1P9YA 3C6UA 1U1LA 1JLBB 1VRQC 4CM0A 1C0UA 1XR6A 2YBVA 3PYDA 4RW4B 4ZPTR 2W8KA 1OIAA 2H1YA 2FJAB 5J1NA 1QDUB 2JEIA 3O8WA 3QLHA 3MMAA 1HBOB 2PFFB 3G8QA 2VOPA 2HK2A 2PN6A 3DFEA 1RI7A 1J2VA 4WP3A 1HHSA 4F7VA 3W3SA 4QJVA 4B02A 1H73A 2JLFA 2CQGA 1X9MA 4LMZA 4K7QA 2MDAA 1U6BA 3AXKA 4DV2J 2DRDA 2FC8A 2KTQA 3T5KA 2R7XA 5E2QA 4JI6F 2C3OA 1XTZA 2OKQA 1SH3A 1Q53A 3MCSA 4B3OB 4ZJLA 4KTQA 3GIIA 2UUWA 5L8RC 1RHKB 2AJ4A 3M8YA 1D8ZA 1RWPB 1R8AA 2ADCA 1VRTA 2QC3A 4I6WA 4P52A 4ZVQB 4PG7A 4USWA 2PI4A 2QL9B 3LW5C 5EX3A 1VIXA 1RT3B 5B0CA 3IBCB 3OUYB 3OTBA 4A48A 3RRKA 3GMGA 3HJVA 3NS5A 4A8OA 3ZZPA 4ECRA 3AXMA 3LP0A 2FY8A 5K9FA 4F4XA 2QV6A 1S1UB 5KFUA 3DOMA 3QATA 1CJUB 1ZOTA 1RHJB 3B8HA 1FWLA 1LW2A 2XTJP 5T41A 4MKYA 3KHGA 1BQXA 3UNGC 2N7YA 2X51A 3M30B 5JXSA 1S12A 3I0SB 5K14A 3FSIA 3J81U 3W5ZA 3MR2A 4B9VA 3HPOA 4GMKA 1N0UA 4OJGA 3KMQA 2IDEA 5EX0A 1ZTTA 2FC9A 1SIWB 1IKVB 4HTIA 4USUA 2DY9A 3M1VA 4EU0A 1R0BG 3VGUA 4RW8B 2YNFB 2P5VA 4YB1P 5A8WB 5GMEA 4EK2A 2GCFA 2D3OR 2CPHA 1TVRA 3D6MB 2W7AA 3V5RA 2BQRA 4OV6A 2ZD1A 1PG5B 2MZJA 1RAAB 3Q23A 4JI4J 4PCQA 1FRHA 4FVMA 3VZIA 3VGVA 4NOHA 4L3KA 2XY6A 3WC0A 3BO4A 2RVJA 4PG6A 1QUVA 2KKHA 4L73A 3QFWA 3AA8A 4MKVA 4AT1B 2KZMA 4ZLPA 3MR3A 4WZMA 4KKOA 2OMOA 2DNOA 4DUYF 3M6XA 2CJAA 4RPFA 1HQ2A 2FZCB 3OHBA 4XPEA 4ELTA 1S0VA 3ILOA 2FLOA 1RBOB 4DS4A 4M5IA 1VHFA 1WOPA 2DNPA 2KVQE 2LQ8A 2VV5A 1XMOF 1Q8BA 3G6YA 4I4BA 2WSCC 3TR5A 3ENQA 1YZ6A 3CD5A 3CJ8A 1XQIA 4FF2A 2Z2MA 3H59A 5F8HA 4KPCA 2DO4A 3R7NB 1N8RT 2QSWA 1HHTP 4YOEA 3EMTA 2MY7A 2QO3A 3NCQA 2K3KA 5EHHA 3NMRA 2WB4A 3ILIA 4WZQA 3NGUA 5GAGU 2WBRA 1WG5A 2HNZA 2V9KA 1H38A 3MEGA 4LT6A 4ECZA 3ZZZA 2XMUA 3HHLC 1SKWA 2WVBA 1CC8A 4EO8A 5ETNA 4CLSA 3J7YU 2EKNA 4EBDA 4Q8EA 2M5YA 1NHVA 4JV2A 4QR2A 5HJXA 5AT1B 2HNDA 5F9LA 5B08A 1GMWD 2VFRA 4D3GA 2ZUAA 3I5BA 3M2RB 3WBZA 1BHNA 2JWNA 3MF5A 1S59A 1YK9A 1FX4A 2V5HG 2DRAA 4H4KA 2CVIA 5KFNA 1EX8A 4HH0A 4P75A 2JRSA 1WF1A 3ET6A 1NKBA 1WNEA 3KLEA 3UDVA 3LANA 1F5BA 2ZDPA 3KTQA 3ZTRA 3CCWA 3D28A 1Y0HA 4BC7A 4C11B 4Y2IA 2UVRA 1RLCL 1UJ4A 2CXEA 4TY9A 1L3TA 4ZN1A 4M5JA 3MOZA 1UWAA 3R5CA 5D77A 5I42B 4EZ6A 2MGZB 4DMZA 2AYEA 3HMJG 5AXMA 3HT0A 1UVKA 3POTB 3HKWA 4ZITA 2UUBJ 1JWWA 1N48A 2D3UA 4ZPVR 1HNZJ 3I4HX 2BQUA 2ZNZA 5F8NA 3LP2B 4QIWD 2LCWA 2FGOA 1TL3A 1BMQB 2MZ1A 1A0OB 2F7VA 5J2MB 3ETOA 2J6UA 1H74A 2K1RB 3UCZP 2GVDA 1KTVA 1GMWA 3PVXA 4FYVB 4E2FB 3WHIA 3DRRA 2AKWB 4QYZK 1ZS6A 1U1KA 1HBMB 5KFVA 1WG4A 4TU7A 1FVSA 4ZHRA 3TI0A 3OR2B 3OFEA 2IVFB 3PXGa 5LMUF 3TJAA 3KNGA 2ZOFA 4DX6A 5ETKA 3T5LA 3CIZA 1T95A 4GKJJ 2KXHA 4MT1A 4R5PA 1AW0A 4DR1F 1U1OA 4L3NA 2RJZA 5FIIA 2C2ZB 2KT5A 1N34F 5KG2A 5D4OA 1S1VA 5D4NA 3I31A 1S79A 3R3TA 1ROFA 2BKNA 3T1HJ 2V69A 1AZSB 2E9RX 4DUZF 2VFSA 2NYIA 1VC5A 2DRBA 2V4RA 3FCVA 1YJVA 3ZTOA 2A1BA 4WYWA 1S6OA 2ASLA 3IR5B 4O3SA 4ED1A 2A6MA 3BYRA 3W2WA 3QZ7A 3T1YF 4I2QA 2L48A 3ISND 3OL9A 1YTYA 4DV3F 2ZM6F 1C1BA 3PX4A 3MHYA 3KJVA 2DNRA 3S6EA 2I1RA 1WJ9A 1CJTB 1NNDA 4B3RF 1RTDA 3W2VA 3LWMA 4OI0A 5KFZA 3U1MA 3C8YA 1LWFA 1UEKA 3M6UA 1WACA 3G71S 1R8BA 1F9HA 1JLQB 2XG8A 2DGTA 1GFWB 2NLWA 2YKNA 4NLDA 3MM8B 2B6AB 5CCLA 1WKKA 3EICA 1ZZNA 3CNQP 3ULHA 3HKZD 1M5KC 4Z37A 3PEHA 4WU3A 4DV2F 4MIAA 2W2NP 1XNQJ 5RUBA 1WHYA 2D41A 1CJKB 5KG3A 1NKCA 3OBIA 1RCOB 4DL3A 3V6DA 2RF2B 4DL5A 2E9TA 4RW6B 3IA0A 4ES3A 1BQMA 1GK8A 2B8PA 2CPXA 4ELUA 3OJSA 2HFZA 3GIRA 4NWBA 1Q5VA 2W2PP 2LDIA 3R5DA 5DDRC 3OXGA 5HLFA 3GG0A 1DTQB 1T03A 2KDOA 2NS1B 1S1XA 1FD2A 3JQKA 1SC3B 1T02A 2XMMA 2YNIA 2AT1B 2IVYA 4RNOA 2FHMA 1RAFB 4TVAB 4OHZA 2KB2A 4B3OA 3H5UA 4N7TA 3HULA 2BEFA 2FJWA 1G7CB 1G6BA 4CM2A 2QEXS 1S48A 4CLZA 1U0HB 2AF6A 3MEEA 2GHWA 4XTTA 1Z2LA 2CQIA 1XJWB 1MNEA 3RGIA 1IUJA 2Y8WA 2AYMA 2QMWA 1GNKA 2W7OA 3IP0A 2IM2A 1RYSA 1FTCA 4URQU 2CJ9A 1WG1A 3A13A 5F3ZA 5HK4A 5GMKa 3MAAA 2VBWA 1Q5YA 5ETTA 2GFFA 4NPOA 5T7LB 3K5MA 3HVTA 3QMQA 3CCQS 4K4ZA 4FYXB 3LALA 2VPXB 1VDHA 4Q43A 1CJUA 3KFWX 3SIPB 5B7WA 4DFMA 5LM7E 2HGLA 1R7IA 2MKYA 2R7VA 2XB2D 2G2YA 4RL1A 4ZP8A 4UZCA 3KK2A 4RW7B 2NXNA 1FEEA 4PUOA 4MK9A 3OTEA 1F5CA 3W64A 1KS2A 2QL5B 3EX7B 4CT9A 3B4DA 4G3IA 4N5SA 4DR4J 2GIQA 1JJCB 3AD7C 2VBZA 3ICLA 1KP6A 3SCKE 2ZBIA 4QPXA 2ZVSA 1KRPA 4YR2A 3HHKA 4RWWA 5C7PA 3AH6A 3F41A 1PSDA 1IBCB 4DL4A 1LQ9A 4C0HA 4ELVA 1S6QB 3T1AA 3N0VA 2WRMA 4E8UA 1HPZB 3IO1A 3LOUA 3BV8A 1NDLA 4WBFA 3UVJB 1A6LA 2JHEA 3R2CJ 3VR1A 2R7RA 4C3KA 2N4CA 4LIWA 4ERDA 3LGHA 5HAOA 2ZH9A 4J9RA 3A8KA 4XDCA 2XY5A 1DAXA 2FVCA 3PFOA 3C46A 1VQ8S 2Z4PA 4L75A 2XMJA 1T9WA 3BKTA 4QZVB 2MKHA 2B7CB 3NMAA 3KK3B 3E8OA 2R7OA 1Y10A 3QGHA 4Y28C 1T9VA 3GSDA 3R2DJ 2J0WA 1UVNA 2CQBA 4X4SA 2B0GA 2YQ0A 1HQEB 1AFIA 4GC6A 3DLLQ 5KG4A 2JFKA 3BSAA 2BA9A 3GZ7A 4J9PA 1CS4B 3IXQA 2Q43A 4UF4A 3K2YA 3KDNA 3DXSX 2ZH6A 3R6LB 2LMIA 2CQCA 5CHCB 4LFBF 4KGKA 1SQEA 4ED8A 2A2CA 4OFZA 3HSJA 1JLEB 3RJMB 2Z58B 4KGMA 6FDRA 3TAMA 3UPFA 5GMDA 3T9NA 3EPGA 1UKUA 1FHTA 4YDDB 4X62J 4OX9J 5IC6B 3BR8A 2Z8QA 2FQQB 3GCWP 3NBPB 2HBZB 2BRKA 3WX8A 4ER8A 1ZM9A 5E3PA 5DRKA 2M2BA 4UQTA 4NCGA 5GADI 3FQLA 2Z2LA 5IM0B 1T3OA 1FTRA 3T19A 4RBUA 4RZRA 2VONA 4PXBA 1IQZA 3VAIA 4LFAF 1L3KA 5T14A 2UUBF 1R6YA 2YNGA 1HNZF 2CWKA 2JOQA 2ASJA 5ITHA 2CNKB 1HIYA 2HHXA 1O5JA 1ZPWX 2RIJA 1JB0C 2NUUG 3PIOQ 5C42B 4UOCA 4A8QA 4YP3A 5DDQC 1DQAA 4LF2A 2HNYA 1HL6A 3JTOA 1FXLA 3FSXA 4Y2KA 5H9FK 1ULRA 2RD5C 4KH0B 4KE5A 3M8SA 5JVHQ 4F02A 2YH1A 2DNQA 3CD0A 3WQPA 4ECSA 1ITPA 1J5EJ 4GKKJ 2UUAJ 2EEYA 4M5KA 3D1HA 2P6TA 1SJRA 2YPZA 3ZZ0A 4Q5VA 1WTBA 2GJIA 2A10A 4B9LA 2K7KA 4A8KA 1SCJB 3B78A 2M9KA 2VJVA 2OELA 4FXWA 3FBEA 3T1HF 1CULA 1NH7A 5IV4A 2FZKB 4ZLLA 3RB0A 3I55S 1OJ4A 4ZVSB 4R0EA 1LV5A 4F8RA 2XCPA 4AL5A 3A3OB 4HI1A 1LWCA 4WKYA 3VALA 3KLFA 2UXBJ 3MGJA 4FN5A 2GAGC 4CYUA 2IRYA 3RRGA 1NO8A 1BQNB 3MFIA 5HVFA 5CAAA 3P6YC 2HLTA 2ACYA 1D9FA 3NL0A 2I6WA 2QMUB 2GQ2A 4ZIVA 4NA2A 3R6GB 1DURA 2PEBA 1X0FA 4D3HA 2APOA 3DHWC 3LP1B 1RXOB 2JC0A 1FRIA 4W98A 1KLNA 2UXCF 1U09A 3JSBA 1C4AA 3FRZA 5KFDA 3A8JA 3J81j 3DOKA 2JNJA 1ZTWA 1TKTA 2CPEA 5DETA 1Q4RA 2YTCA 1PC5A 1WTFA 3UW1A 1P9QC 3TVKA 4DG1A 2CQHA 1PO6A 1X0PA 2ALZA 3M2UB 4TLRA 1RTZA 2J0XA 3IM9A 3RG6A 5AXKA 3RUBL 1IM6A 4K4UA 2QZ8A 1XNQF 3GE9A 1SPBP 2Y0SD 4CLYA 2Z30B 4ZP7A 1F60B 2OPRB 2D1CA 1FJGJ 4N76A 2CKWA 4ZP9A 4MIBA 3V6JA 2YVSA 2HIQA 2B6AA 1K44A 3HXMA 4X66J 2MLYA 5KG0A 4QQBA 3P5BP 2R2RA 5CYMA 3HHLD 2BV3A 3QGIA 5KFCA 3BN7A 1FDBA 2OUGA 4U9RA 2HHQA 3FBCA 3N5FA 1WI6A 1C0TB 4RNFA 4PQUB 2AP6A 2X1GA 3CD6S 1GEHA 5DG9A 4ZLNA 2FYXA 1KHWA 4ICLB 1IM4A 3CWJA 1MG7A 2X1BA 2OEMA 3V6HA 1F6TA 4NLWA 1FJEB 4DPTA 4UY8T 2UUCJ 2OPPA 2A0FB 2GVZA 1FKOA 2JLEA 1SB6A 3LH2S 3QIDA 1QY7A 1HBUB 1DLOB 1FDNA 4DOZA 3KG1A 3V4IB 1P6TA 1Y3KA 3GLJA 4NLQA 1FJCA 3F56A 4MYTA 1KFSA 2MQMA 3QGGA 1OPZA 1MMDA 3RBXA 3Q89A 5KFWA 2GAHC 1X8DA 4U7UK 4U96A 1VRUA 2Y8YA 2WSEC 4CH7A 2YKMA 4IFVA 3HHLA 4Q0BB 3D68A 3N6LA 3A12A 3H5XA 4RBTA 2CPFA 3H98A 3T3FA 1ZM2A 2NSCA 3AA9A 2E1CA 5ETLA 1DY3A 4A47A 3CE8A 1TL4A 1PILA 2GIRA 2PE8A 2BJDA 4LR9A 4DR4F 1X5PA 4J37A 2FLPA 4IG3A 1RT4B 4LF7J 3IBWA 3EGVA 2CQ2A 1WUUA 2X1FA 1NDCA 5M2PA 2MY8A 4QW9A 5IZHA 4B3MF 4KHRA 2CJKA 3TJ8A 3W61A 1NCLA 4I6AA 1TK8A 3D2WA 1Z1ZA 4C0BA 5KFYA 4I56A 2DO0A 4HHUA 2ZVIA 2B9YA 1HHQA 1DJ0A 1AXQA 5EWFA 2OSQA 4BLGA 4XK8C 2V4JB 3BBBA 3MR6A 1OYEA 4I68A 2CJQA 2R8KA 2ZBRA 1RGVA 1FF2A 1PJ5A 5K8PA 4LSNB 5CA5A 2KM8B 1FKPA 1X4FA 3FGVA 5EGYA 3OTCA 4IKAA 1HPZA 4ZPWR 4J9MA 3Q2TC 4RNNA 5HATA 1TFWA 2KFNA 4KV8A 1Y3JA 4CO1A 5EUHA 1RUSA 3U02A 1LXNA 4Q7AA 1Q95G 3IBFB 2VZ9A 3NGTA 3AOBA 2EFGA 1FT8A 1Y4ZB 4B3TF 1H98A 3DHXA 5KG6A 5L1LA 3HX9A 1GQEA 2MQLA 3M8RA 1RWOB 2MQ8A 3QRRA 2CQDA 4TKTA 8RUCA 1SKRA 1TQLA 3I0RB 4DFJA 3PZPA 2ZH4A 3EGZA 1TU0B 3KK3A 1NLKL 3BR9A 3K5NA 4C8ZA 5HVGA 4PPZA 1UMJA 3GV5B 4F2RA 3BGLA 4ECQA 1FE0A 2PI5A 5L9NA 1KNZA 2VQFJ 3HDSA 4DPWA 2R7WA 4JB8B 3SZ2A 2COLA 2G0JA 4FPIA 4BDPA 1CLFA 3UN5A 1LWEA 1S49A 4JI1J 1S6PB 4TU8A 3CDUA 2QSFA 2CPZA 3K5LA 2BDPA 2FJVA 1EETB 4NX9A 3VQTA 2CQPA 1LOUA 4NYZA 3FQKA 2DD8S 3AOCA 4FNHA 4ZJQA 2HYIB 2DNZA 4ZVFA 1ZAWA 4LR8A 3QT5A 5IC4B 4X4UA 2J7WA 2H3EB 3HLUA 4ID5B 1N54B 4WFYA 1TV6A 3SV4A 3PHTA 3GYNA 5A8KA 5I3PA 2BQ3A 4WIQA 1ZPVA 3Q8PB 4F0KA 2R9LA 3M32B 4ZCIA 3QRPA 2ZJRQ 4WE1A 1FA0A 3MUTP 3GFYA 1HR0J 4C3LA 3MMCB 3SSQA 3CJ3A 3DLHA 3KJNB 4FDFA 4ZOSA 3PO5A 4NI2B 4P2XA 2UZAA 4IYQA 2RKIB 4F4WA 1RTHB 1M5HA 4HACB 5L9XA 1KFDA 1N4LA 1B0VA 3I5AA 2UP1A 2HVEA 3DU6A 1J5EF 4GKKF 2UUAF 3FNNA 2MKCA 2KXFA 4ZVPB 1NHUA 1PYOB 2EFOA 3MCNA 3HO1A 1SV5B 3GFXA 3BREA 1NB2A 2R8IA 4JI0J 4ED5A 3N6NA 3MM5B 1P27B 3H90A 1HYSB 3M6WA 2J0QD 3KNAA 1H7WA 1VC6A 1RT7A 3SFGA 2UXBF 4FF4A 1U1PA 1D9AA 2OFHX 1YQHA 4EEYA 4FYWB 4CCHA 1IQTA 2DBBA 2ILZA 1YJUA 3NEKA 4A8WA 1U2CA 1ACMB 5I3UB 3FMBA 1OY9A 2NR0A 3NCRA 1YZ7A 2MQOA 4DPOA 1JNZB 4DSJA 2YWGA 2GO9A 1REVB 1VQ4S 1RAHB 3CB4A 2NZ4A 3OT9A 3DRSB 3DLEA 2C2NA 3HM9A 2VL1A 4YR0A 5GADU 2EKYA 1MU2B 1KBRA 1HNIA 1DZ5A 2AD9A 5D78A 1C2PA 2XEXA 4DFPA 1B7YB 4ITSA 2HZCA 3RAQA 1VQ5S 1UZHA 3AOAA 1YJWS 1TTHB 5KFLA 4DUTA 1X4EA 2HQIA 4KT0C 2K06A 3GSIA 4P73A 1SJ4P 3A4TA 2R2SA 3TRGA 3LP1A 3HD2A 2DB1A 1BGXT 2DEJA 1F0XA 4LBPA 2ALYB 4ZN3A 7FD1A 1D8YA 4DWIA 1FJGF 1BUXA 2X3GA 1M5PC 1TR0A 4GVLA 1FFWB 1IR2A 3JSRA 1WC5A 1G3OA 2RUGA 4C98A 3ZO7A 4X66F 1NJZA 3NOGA 4O4GB 1VQSA 1JLCB 5CYQA 3FC9A 1U48A 2J9DE 2W9CB 3M2UA 1FNOA 1S4EA 3UE2A 2A6OA 3C16A 4KBIA 4I0WA 4TYAA 4DPXA 1HA1A 4ANDA 2RU3A 2ZE2B 4LUBA 2B3TB 3RBEA 1GAOA 3QIPB 5G0RA 1GMVA 3BKFA 3DLKA 2V94A 2OPQB 1FK9B 1S9GB 4KPYA 2DR6A 3LAKA 4O44A 4LIRA 3C14B 3DRXA 1M90T 4ENOA 5DG7A 1IJFB 2UUCF 1FKAF 1LXJA 2Y1JA 2AJQA 2ZHAA 4X4PA 5KT5A 3HK2A 2ZNYA 5F8GA 2BUNA 1OSDA 4FKYA 4E0DA 4NLRA 3IG1B 4GO7X 4ICLA 4R8UA 4B17A 4WFBQ 5HMXA 5HMYA 2W8LA 2M8HA 4H4OB 1X5OA 3MEDB 4UY85 2RDIA 3MD3A 5D15A 2F8EX 2HRYA 1ELOA 4FS1A 3DRYA 1QVGR 2E5IA 3M7VA 5C25B 2DCLA 2ZKTA 3DNCA 1DQ9A 3M9OB 5I4MA 3IFEA 4EI2A 4XAKA 3L7OA 4Y65A 3D1QA 4OJHA 4F4YA 2QLJB 2FDNA 1IKYB 3US5A 3C6UB 1C0UB 2BJEA 2DXEA 4DF4A 4K8RA 4DN0A 2XWYA 3KWMA 4ECUA 2HW3A 3MCMA 1Q81T 3QLHB 5D3GA 3Q22A 1W25A 1TKXA 1NU4A 1Q7LB 2VPZB 5CH7B 3BJYA 4P2FA 1TAUA 1UP1A 3RZAA 1HI0P 4I6YA 3EYZA 4ZK7M 3PY8A 3ISZA 1VQNS 1L3VA 5DS7A 1S99A 3BH6B 2ZBCA 4K4XA 3MM7A 1RT6A 4EFAC 5KFIA 1D9DA 1VRTB 2LKZA 3RB3A 2GJFA 2QLXA 1D09B 3QAUA 3SEOA 2VG7A 2B51A 4H4MA 2R42A 2W2OP 2PMWA 2VB6A 3RRHA 2XZTB 1YI2S 4NASA 4KFBA 3LP0B 1BWVA 3OTDA 3TNVA 1HD1A 1EKSA 3KK1A 5F41A 3M9MB 3J7A1 3DOMB 1QLNA 3AQPA 3DGPA 4DN9A 3TVZA 2ZITA 4ZS6A 1LW2B 4WFAQ 2D3ZA 2VBYA 4E98A 3OL6A 5K14B 1R0CB 3H2LA 2OPSA 1FWKA 2OTLS 4NYOA 2MZQA 3M1VB 1NK0A 4RKUC 2KT3A 3QBCA 4OIXA 4RWXA 2QGFB 2VQFF 1RWXB 2V2KA 2QYCA 2C2RA 5KFHA 3O1LA 4B9SA 3PTWA 1TVRB 4LF4J 3EDRB 4M5NA 4RUBA 4PPDA 2QIFA 4JI1F 1YSJA 2Q1LA 2G0IA 4K4SA 2HBQB 2GZOA 3VAMA 3D66A 2MXYA 4RW9A 4NRUA 2DGXA 1X9SA 2B7BB 1KOHA 4K4YA 6FD1A 3IN5A 2PD1A 4Q45A 2B9EA 2RQMA 3RB4A 3L3CA 4ZVUB 1RZMA 2XC9A 2DGQA 3B54A 4RX6A 3MAHA 2X3DA 5BYSA 4PZVA 3P96A 1UVMA 1ICEB 1WKLA 1VLOA 2B9XA 4KKOB 1XMQF 1KDNA 3G2XA 2VG5A 2B4UA 1HR0F 1VR6A 5EDWA 2OMLA 2DPJA 2EK1A 3TQ1A 5KT7A 3UD4P 3RB6A 3AHPA 3V4MA 3T5HA 2UV8G 5AE1A 3BSNA 1PKUA 2XSJB 3MEKA 4DV1F 3EE3A 1JKHA 1GXLA 3BF4A 3FBFA 2R2UA 3G86A 2HQCA 4L6V3 1UPMB 2C28A 1UA1A 1K1SA 1MSWD 4TN2A 3HHDA 2E1AA 4ZLJA 2ZH1A 4FF3A 4DPYA 2CDQA 3L09A 4YHHJ 1AFJA 3FSYA 3IAS9 1BWEA 2CZ4A 3MMCA 3D6TB 2JC1A 3CVKA 4JI0F 1JXLA 1K47A 1EIYB 1N32F 4I1TA 3C15A 4LJMA 2JJ4D 4V19X 2BABA 4QR1A 2KYZA 1XMOJ 4ZVHA 1AROP 2V4QA 3A3PB 5IOLA 5ETSA 2HNZB 2J8AA 2WVEA 3MEGB 2DR9A 3R9LA 2IYGA 4IFYB 2MQPA 3K59A 2VA3A 5DM7Q 3OSPA 3KLHA 2PDAA 1Y5IB 2C3YA 3DYAB 5F8IA 1YLXA 4EBCA 2HNDB 1I5OB 1TL7A 5FDLA 5B0BA 1SL2A 2HS0A 4LR7A 5U47A 1YWXA 2G9OA 3Q8VA 2C2DA 3JSYA 1R3NA 2D7SA 4J9UE 4RBVA 4OX7A 2CPJA 5HROA 3ET6B 5GAEU 4RR5A 3KLEB 1T05B 5FD1A 3TOQA 2NSBA 2R8HA 3D1OA 1OMSA 2ZH2A 1RTIA 4B9UA 3FZBA 3TZWA 2BE2A 1FWPA 2UVUA 3NWGA 1XNRJ 4U7UD 5HN0A 4IQXA 4OYIA 4O3QA 4HH1A 4FYDA 4WIIA 3PO4A 3A3NB 2KZZA 3OTOF 3BQ1A 3QJJA 4NEZA 4F67A 4ED6A 2D3O1 1RT5A 4DEZA 1TL3B 1AUDA 2JH3A 3M8QA 3BGOP 1UW9A 1LW0A 5F0WA 4X65J 3SI8A 1RHMB 1U1NA 1NHKL 2GVDB 5FLXU 1NK5A 3QWUA 4CDIA 5IT0A 3DRRB 2V8GA 4URGA 2D9PA 4I7FA 1I3OB 2N82B 3O6QA 3UR0A 5ADZA 1PAEX 5GAHI 4OZ5A 1K0VA 2CYYA 4ZHRB 5L46A 2HBRB 1RAEB 4QIFA 5L38A 4AXIA 3OV7A 2KU7A 3ZFVA 1NK6A 2VH7A 4O4GA 1FDAA 4R5PB 1EZZB 5MAOA 3CDEA 4OHYA 2VASA 1KQKA 1OQ6A 1S1VB 2DGWA 3T9ZA 1B64A 2HLUA 2DISA 4DR5F 4YQWA 1F5AA 4OLOA 3SCIE 4LRBA 1T3NA 5AXNA 3UD5A 4RO0A 1U1MA 2W24A 4OZ3A 1KC8T 3ZC4A 3TZZA 3AODA 1GXUA 1N5TA 4IOBA 1Y5LB 2BMBA 2OEKA 3W2WB 4I2QB 3UCUP 3O44A 3N9UC 1LK7A 2HRTA 3QJPA 2W2MP 3MI7X 3V2UC 4OL8A 1C1BB 3IR7B 1N34J 1VMBA 4DCOB 3RBZA 3C19A 2CUYA 1KQSR 2R3VA 2E5GA 3P5TL 5J2QA 2EFVA 5KFRA 3W2VB 1B4SA 2F8HA 2C3MA 1LWFB 1S0NA 4CP5A 1M5SA 2RS2A 1NPPA 4F0MA 3C2PA 3MM6A 4H4OA 3CJ5A 3RBDA 3CEDA 1KQFB 3E01B 4CRJA 2YKNB 1H0HB 1FRLA 3AD8C 4DLGA 4QWCA 5JUMA 4DV3J 1VQPS 1ZM3A 4K4VA 3GG1A 2B5JA 1S0MA 1YHQS 2GMJA 2LQJA 5BR8J 5LJ3Y 4NRTA 2MHEA 4B3RJ 2HHTA 1FNXH 4C4WA 3D6HB 4PQAA 3NXZA 1C4CA 4Z7CA 2W7PA 1IXKA 2AYGA 4NLVA 3V6DB 4O0NA 4F36A 2RDJA 4DV5J 1K8AT 1NJWA 1BQMB 4MAKA 2HS4A 4S0MA 4CQ1A 3HZEA 1WC0A 3T6JA 2EG2A 2FHOB 5J1EA 2P2CB 5HLFB 1BD6A 4F2SA 2R7UA 1T03B 4YB7A 1S1XB 4B9MA 4DR2F 1FFSB 3FCWA 2YNIB 1S77D 2HHVA 3CJSA 1AA1B 3PYFA 2E5JA 4TYBA 2IIHA 2CADA 4QWDA 3MEEB 3G6XA 2J0SD 3D54A 5DGBA 2ASYA 1JJ2R 4RUAA 4JP8A 2EPIA 2V50A 5L39A 4DZDA 2HWHA 2IYIA 3MAAB 4K4WA 3FVYA 1RWNB 3BPDA 1YJTA 1R89A 3HVTB 4X2BA 7AT1B 2VHGA 1RT1A 3Q8RB 2FVRA 2AJ0A 4MK8A 1WHWA 4LF4F 1RDRA 2Y0BB 2EFNA 3THVA 4C0OC 2BW7A 2ZH8A 3CDWA 3KK2B 5HQMA 1GTEA 2N3LA 4PUOB 1VQ7S 4HVZA 1U4BA 1UFLA 1UEUA 3EXYA 2GX8A 4OHVA 2RQKA 2IM1A 2HHSA 2RAQA 3CJTA 1IBMF 2RQCA 4HDGA 1CC7A 4ATNA 1SQFA 1ZAVA 2RMLA 2VICA 4PRFA 3HD1A 1EJ7L 4K2XA 4B9TA 4NLPA 1N33F 3BS9A 3Q2SC 3F0NA 2ZJPQ 3GYXB 1Q1KA 1F9FA 1RAJA 2DR5A 5IXUA 5D0GA 1KONA 3QWPA 1VQOS 2CQ0A 2HFVA 2HRUA 4CLKA 2AQ4A 4LRFA 4OI2A 2ZFHA 4LBIA 2HMIB 4JI2J 4JI7J 4HYKA 1NSAA 5LXYA 1Q16B 4GVBB 4JI3J 3OHAA 1H6KX 2MEWA 4YHHF 3PW5A 5A76A 1UJ6A 3M8ZA 4N47A 3UQSA 1Q8IA 1GMUA 2L9DA 1WEZA 4MYUA 2G2ZA 2KFYA 4DFKA 2XSJA 1A7GE 2LXFA 4YS2A 3VAHA 5LL6d 1HWKA 2I8EA 5ETOA 4C7QA 1HWIA 1N5SA 1WHXA 2NREA 1OY8A 1GTHA 3UI3A 3QPIA 3D5MA 4NL5A 2DEIA 2AZ3A 5ETRA 4ZDNA 5LOQA 1TUVA 3N6MA 1VS3A 3ZZYA 3TUPA 2KHCA 2NUHA 2E7WA 2QLBB 5MLCV 4AL6A 2GIFA 4ED2A 4M63A 4IRCA 2DGSA 4IFYA 3TAMB 4LSLA 1VJQA 4P72A 1KTQA 1SJ3P 3DYAA 4M5GA 2BYCA 3LGMA 3F44A 4DF8A 3HI9A 1RB0A 2ZH5A 3VV2B 1KD1T 3CJ0A 2DNHA 4NCGB 1XNRF 5F8JA 3OL7A 1KLMA 4LFBJ 2HURA 3QZ8A 4U6PA 3SSSA 4DV0J 3OFHA 1QSSA 1JK9B 2EVZA 1QSYA 1Z4UA 3A8IA 2DH7A 4H4KC 3IRWP 2V8PA 2YNGB 5K20B 3KXDA 4Y2CA 1OY6A 1L3UA 4HEA9 2RSQA 1T05A 1TAQA 1VQMS 3VVUA 2E5HA 2LYVA 2M4MA 1S7IA 4X65F 2RU9A 2L3MA 1WOOA 4FXDA 3G82A 3BPSP 1I94J 2HNYB 1NJXA 4J9OA 3TUZC 2Q6BA 1SKUB 4X84A 3TAQA 1IJEB 1RYRA 2E9ZA 4OZNA 4TQSA 4LFAJ 3BGRB 3GPAA 3VGSA 3VVTA 3KJFB 1S1TA 4NXNJ 3OVBA 2LQ9A 3NCPA 4YMEA 2YKQA 1WI8A 4HTJA 1E6VA 2CJXB 3H4DA 2JL9A 3O3LA 1FX2A 4U95A 5KT4A 4J9QA 3IWXA 3J80U 1CULB 1YRXA 1FE4A 1S76D 2CQ4A 5A0YA 5D0RA 4MFBA 5F3TA 3UO0A 2LP4A 1JLFB 1D1UA 1HNWJ 1LWCB 2GC8A 2XHCA 4ILLA 3KLFB 1YBTA 3ZTQA 1R43A 4CYUB 5KG1A 4PKDB 3SQGA 1S1WA 2PGCA 2LVWA 1PIEA 4OYMA 4ZP6A 2XS5A 3R7BB 4M5LA 4CIOA 1TL1A 1NRKA 3S8SA 2NXJA 2CA9A 2MQQA 2IRUA 3GR1A 3QYYA 3BO2A 4Y6IA 3CC7S 1XBWA 1J5OA 3W63A 3FRYA 2C2MB 1MMNA 2HG4A 2ZBQA 3QO9A 2HHHJ 4RU9A 1E6YA 4CH1A 3CCUS 1Y11A 4AE5A 3H8YA 3J80Y 3DOKB 2FHKA 1FD8A 1TKTB 1S0OA 1UVJA 2DNYA 2YX7A 2R7QA 2HBYB 3H42A 5CZXA 1FRKA 1MROA 1X60A 3DLGA 1SBRA 2I5JA 2V8DA 3I5CA 3M4XA 4DG1B 2AJ2A 2BZ2A 5BR8F 7FDRA 1HFEL 2F3JA 1FEHA 1NJIT 4JV5J 2UXCJ 2EFPA 1HQUA 3GV7B 2HKEA 3PHEA 5LSOA 1I1GA 1H2TZ 4KH1B 4CLPA 2L9NA 5GAGI 4I2PA 2B8QA 2P9EA 1FDDA 1BXNA 1PBUA 1QTNB 4DV5F 1BE4A 5GAHU 2DH8A 3PEJA 3E01A 3J7YI 2MLZA 2GGPA 4DS5A 3K57A 1TUWA 2W9AA 4BBYA 3GV8B 5CYMB 3BBCA 2H5EA 2YQ3A 3RR7A 8AT1B 4M5DB 2HWIA 2MTLA 4DQSA 3HSGA 3M8PA 3F73A 3PNIA 2H51B 3FDSA 9RUBA 4LF1A 3DM2A 2AGPA 4RUHA 3CPWR 2FIUA 4OQJA 3CO0P 3TA0A 2BRLA 4W92B 3G87A 1U0SA 4MIWA 3CCTA 1MWZA 5F8LA 1PJ7A 4W4MA 2IBKA 4USMA 2W01A 2HHWA 2GQCA 1RWVB 3ISNC 4O0IA 5JJBA 2XWXA 3IS9A 3CJKA 2NQPA 3TA2A 3O2IA 2OPPB 2GVZB 1B7FA 4C8LA 3M05A 1FKOB 4UOHA 4KHMA 3SSRA 4MK7A 1EARA 4K5SA 4H54A 2RQ4A 4F4ZA 2XZDB 1FESA 2MSTA 3IRXA 1RAOA 2XZWA 5DGAA 2C3PA 2QE5A 1IWGA 4OZLA 3MECA 1P8GA 1N0VC 4ES2A 2BW2A 4F3QA 5C2GA 2NPIA 4HKQA 2XO7A 3CJQA 1VRUB 2H5JB 3X1LB 3D6FB 1HMVB 3K8VA 2YKMB 4FP9A 4IFVB 3HHLB 2XMTA 2FB0A 1R6VA 3R97A 2Q6CA 1JX4A 2OLWA 5DQGA 5ETQA 2Z0GA 1U6ZA 2GMHA 2DYAA 2HQGA 4AUKA 4OHXA 3JTNA 3N01A 1VYAA 4KGVB 4K59A 4USTA 5A8RA 4PYAA 1QAJA 5B0AA 1VOMA 4IG3B 2P9GA 4IG0A 1FI4A 2DXDA 4Q2MA 4C9DA 2V2VA 2CG8A 2YXLA 3CCRS 2AZ1A 4DR6J 5HVHA 4K0KF 4O23A 4NLSA 2JLGA 1L3SA 1P1LA 1VFJA 5D0HA 2VUGA 5JVGQ 4CO0A 3V6KA 3FEXB 3EVOA 2XMVA 2BX6A 4NLXA 3PJXA 4PEOA 3NOCA 2M70A 1FXRA 4P9SA 1RTJA 3D67A 4X64J 3TVYA 4NXMF 3BGFA 1NXIA 5IT9Y 1QAYA 4JI2F 3EZ5A 4JI7F 2GV1A 2IJFA 4JI3F 4WP9A 3D0GE 1C1CA 4B3MJ 4ED3A 4EUVA 2NXEA 2XS2A 4NLYA 1VC0A 4OZJA 1FKPB 3EM1A 2XHWA 1W26A 2V8HA 2FZGB 2NPFA 2CAJA 3OFFA 1J27A 3PR4A 4LF9F 1SI9A 2O1PA 4QBUA 4QYRA 3U1LA 1DTTA 4KV8B 3FUYA 2J9CA 2WW4A 4R25A 5F0UA 2X7IA 2MSSA 4PXCA 3RW7A 2HMIA 2RDDA 1VI7A 4PXDA 2IJNA 4GVBA 3UN3A 1CEZA 4IRDA 2BJ3A 1SJFA 1F2GA 3TUJC 3TA1A 2DPIA 3M2VA 3IR6B 2YKAA 4FPRA 4B3SJ 1HKAA 4DXLA 1TK0A 4QW8A 2B4OA 3I32A 3OW2R 3FEYB 3LO3A 2W9BA 1M5VC 3JS9A 3GJSB 2BACA 4DX7A 3TZYA 1UJ5A 3PG9A 2DIUA 3MPVA 5M2RA 2WB1D 2RB7A 1HD0A 4O3RA 3MR7A 3GJTB 2VA2A 2AGQA 2FJBB 3W8PA 2XGQA 1MW7A 4DR7J 1UWBA 4ZVRB 2OHDA 5KFJA 3I4PA 2IHR1 3AY0A 1TKZA 3MMBB 4B3TJ 1N6QA 2EXUA 1OQ3A 3RAMA 5KT3A 3JAMU 3MOJB 1LWEB 2HFSA 3SV3A 4RLEA 3AFGA 4OI6A 4G1QA 2C42A 4N8NA 2HAFA 4CH0S 5CYJA 5KFOA 4DV0F 5K8MA 2Z57B 2HSEB 3W9JA 4NMLA 3DXBA 1SKSA 3W5YA 3VAJA 2EK6A 3CW2C 3NGKA 1XK8A 4DX5A 3X3UA 1TV6B 1GH8A 2E7VA 1Y9OA 5A8KB 4JI5J 1L5UA 4DL6A 3DGVA 3LPEA 4AQYJ 2UXDJ 4WE1B 3R5AA 3AJ1A 1IKWA 1Y00A 2W4DA 1VBZA 2ZKUA 1I94F 4IO1A 2OH2A 3N79A 4JI8F 3JAMY 3DKDA 3AAWB 4ILMA 3HZGA 1RT2A 4ETZA 1V3ZA 2H5IB 1PYTA 2YNHA 4KGZB 4NXNF 5J2PA 1SQGA 4CT8A 5KFFA 2OGUA 2XI3A 3UR3C 2OTJS 3DRPA 4CWBA 2RS8A 1RKIA 2LXIA 2DR8A 4I67A 3WX4A 3MWBA 2AX1A 2YKPA 3JSMB 4YUDA 4DCPB 5K8OA 2W4PA 3PRVA 2QFJA 1NZAA 1SIZA 1NAQA 1XN9A 2KJVA 3CT9A 1LEOA 5KG5A 1SC1B 2Y1IA 1WD6A 1HNWF 4V1Ak 3BGRA 4BS2A 1RT7B 4ED0A 1IN0A 3NP5A 2VFUA 4X4QA 2BVZA 1YBAA 2VPWB 3DDIA 3Q86A 3KLGA 4LFCJ 5EN1A 1U1QA 3CCES 4MH8A 2WHOA 4CLLA 1RQ0A 3ZNJ1 2RUSA 2AW0A 5H9EJ 3ITHA 1ZA2B 4UQGA 3MR5A 5F9NA 2DY1A 2FVQA 3K58A 3UWTA 1QD1A 3C66A 5KFPA 1Z2ZA 2BJ8A 2AHOB 1JLFA 3UDLA 1F3VA 2HHHF 3H0PA 4KR0B 3DLEB 2KG0A 2IA6A 2ZHBA 3W5XA 1V5IB 2DK2A 2RHQB 1RKJA 3NNHA 1HNIB 2BM1A 4TNOA 4A46A 3GIMA 4TY8A 4X4OA 3DLJA 3RW6A 2DNNA 1S6UA 1H7XA 1U8SA 3ZNUA 2F5GA 3QAEA 2D74B 3ZZTA 3RU0A 3PIPQ 1UVIA 4JV5F 1KR4A 5L1KA 2AU0A 5F8MA 1WF0A 4ZKAA 2DHGA 3C6TA 1HLWA 4KO0A 3CJRA 1XR5A 2J9EA 3RAXA 5IQQA 1PAUB 2HFOA 3PKMA 4PR6A 3PYEA 2C1EB 4EBEA 4KQZA 4Z2XA 1EAYC 3TX8A 3ILLA 5CYQB 1FRJA 1PCAA 2POKA 3E3XA 2KXNB 3TARA 4QWBA 1G1XA 2UVVA 3C16B 4DX8H 2DR7A 4OZ0A 2GW8A 1PYSB 2HIYA 2HZVA 1JNRB 3NWRA 1T0TV 2AJ1A 5AE2A 5G0RB 3DLKB 3BQ2A 4IDKA 5C24A 1WSVA 4BWJA 3FJ2A 2YWFA 4O44B 1X5SA 2RRNA 3J81Y 4ANEA 1JLAA 4G6VB 4LREA 2AMCB 5B0EA 1NEEA 3CULA 4I69A 4J90A 4M5DA 2FJDB 2HHUA 5DDOC 3CTRA 4ZA1A 5GVQA 4F25A 2RT3A 3LPYA 1TL5A 4C97A 2EC0A 3LGNA 2N4DA 3TZXA 1U24A 4IR9A 5EWEA 2LDYA 3SXLA 4USKA 2WSFC 2IMWP 5THWA 4DU7A 2HGNA 4R8UB 4BHQA 3GR0A 2I0XA 4DV4F 3LAMA 3A8EA 1YRTA 5E41A 4DV6J 1YJ9S 2XNQA 4XDDA 4IR1A 2MQNA 3KKFA 2ZZMA 4Z7YA 1CVJA 5KFMA 4PXEA 3ENAA 1EP4A 3RYLA 5E5NA 1K0TA 4YFUA 4LF5J 1W7WA 4DSIA 3HVWA 2ATCB 2B9WA 4CLWA 2DHHA 2Q66A 2NXUA 2KH9A 3SCLE 3GONA 5HSPA 3IMQJ 3CC2S 1SC6A 1RU1A 2IPOB 4DR6F 1AUSL 2GHVC 2H54B 1VLYA 4LBHA 1HMVA 1JXEA 3TX0A 1LFPA 2CZ9A 2MMYA 1Q8LA 5D3GB 1Q79A 3R5GA 3KOAA 5ETMA 1JLGA 4A8SA 1TKXB 2V2QA 1TELA 3DCAA 3V81B 3BYPA 3UFCX 2NYHA 3MM9A 4IQMA 1DHMA 3S1TA 4PWWA 3BKUA 2H4YB 4X64F 3K89A 3NGRA 5B09A 5HP1B 4CTAA 5DM6Q 5HBMA 3PJWA 4B08A 3H2UB 1FFGB 4NLGA 3DOLA 3KLIA 4A8MP 3MM7B 1UVLA 1K73T 1PBAA 2CG4A 3G6ES 3CMES 1RT6B 3L7UA 5KOXA 2KT2A 3VQSA 1WKJA 2G13A 1KVJA 3G6VA 2Z56B 3BN4A 4OYAA 1X4HA 4O3PA 2IAJB 4RUCA 1SC4B 1X5TA 2VG7B 4JV1A 4WFZA 2HVHA 5M2UA 3OXFA 2FD2A 4H4MB 3J7AN 1YVFA 5HQ8A 1BY9A 3UD3P 1YIJS 4PG8A 1NK4A 2JEFA 2I9SA 4WPAA 4KFBB 3TW0A 4DCJB 3MXHP 1EKRA 1QAXA 1DQ8A 3KK1B 4ZVTB 3J7Z5 3NKYA 3DGPB 2L08A 4XPCA 4B3SF 3NY0A 2FUG9 2F4VF 5HJYA 5B0DA 1VIOA 1TMJA 2IMOA 2OPSB 1HBNA 2VQEJ 4F4AA 1PGZA 4OX8A 2CNOB 1JIHA 2MJNA 4XO0A 2PMZD 5DQIA 4PAAA 4K2JA 4DR7F 3D0IE 1NB7A 2R8JA 1VQ9S 5E7OB 1LK5A 3TEGA 3MAQA 1U25A 2HFUA 4M95A 2FJEB 3VAKA 3GP9A 3P45B 4YDXA 1MN9A 3G8TA 1VHIA 3P49B 2F9JA 3Q8YA 2O3DA 2VODA 3CJ2A 5J1PA 1R27B 2KVIA 1G4CA 1EQ0A 5J2NA 5E3RA 3EWGA 3GILA 3WC2A 5DZ6A 2DNMA 4ETXA 4RW9B 2IC3A 4Q44A 2F65A 4QPTA 2WVDA 1QVFR 3OR1A 5CD4A 3IGNA 3KHHA 3EUNA 3ENWA 4JI5F 3MMBA 2UU9J 1IKXB 3JYTB 3ELHA 4QU6A 4FBTA 2WOMA 5B0FA 4PG4A 2VF3A 4AQYF 2UXDF 2HVIA 1WC1A 2WW8A 2VG5B 3HT3A 2Y9HA 3QT8A 2XM3A 2OJ3A 4GC7A 1FVQA 1ZBTA 3BM7A 2ASDA 4OYPA 2F9DA 3KHLA 5AE3A 1B0TA 2VG6A 4C6AA 1EHWA 3I9ZA 1CJVA 1JKHB 1P1TA 2MZSA 1N5YA 1KVKA 3KUGA 4YB6A 2CPYA 1ZA1B 2WONA 2M52A 4G65A 2RILA 5LSLA 3GYGA 4WJBA 4ZPCA 1XMQJ 5KOWA 2MB0B 1UCNA 2LEBA 4Q8FA 4USJC 3OL8A 3I96A 3QSIA 4GRSA 4ED4A 3C15B 4CNZA 1UEVA 4NLUA 1RACB 4DV1J 3DC2A 2DHXA 2FLNA 3MUVP 1JLBA 4LFCF 2ZHOA 4QCLA 3P3DA 4RW4A 3PW7A 2XLJA 2DGUA 2CNNB 4DJBA 1UFWA 4DLEA 4EO6A 4BC9A 2W25A 2ZWOA 3KLHB 4DSEA 3PCOB 3JSMA 2E7XA 3VAFA 1HBOA 4P71A 1NSKL 1UAWA 1TL7B 5FDLB 3W1YC 3CDBA 1N32J 4OZ1A 1N56A 4IUFA 2BBEA 1WELA 3JQJA 1S9EB 4Y2AA 2DGVA 4DV7J 2YX1A 1CG2A 4C3MA 2ZH7A 1I6JA 2U1AA 5HROB 1RBAA 2BJ1A 1U2RA 2HZAA 2AGOA 3K17A 4ECYA 4DL2A 2YKOA 4EYIB 2XMKA 3CDAA 3L95X 4ZMMA 3D3CJ 2F63A 1RTIB 4P6QA 2BE2B 5HANA 3KHRA 3CJ4A 2JVOA 2ATLA 3H40A 3UCGA 2CPIA 2WK4A 1S4FA 4IO9Q 2HPUA 2BM0A 1RT3A 4U67Q 5CXTA 3OUYA 3EZUA 1OPIA 1WHVA 2GO8A 3G9CA 2H48B 4KHPJ 1RT5B 1S1UA 4KRWA 5KFSA 3M8QB 4HDHA 2K2PA 2LECA 1LW0B 4NA1A 2XQCA 2RRAA 2LEAA 1QE1B 1RK8A 3TJ9A 3SYZA 3M30A 4JI4F 3E2EA 3I0SA 4I7FB 2KG1A 4F26A 3BH7B 4FF1A 2Y1LB 3TANA 3OTOJ 1SXLA 2FTRA 4Q2LA 1IKVA 4LVNP 1YX2A 4RW8A 4DI6A 2YNFA 2B56A 4AD6A 2QLWA 3T6BA 5A8WA 4U7CA 4EWTA 4DL7A 2CJBA 3TAPA 3S7RA 2CQ3A 4ECXA 4J9NA 3N4WA 3AB4B 2RH3A 4A8FA 1WC3A 3H2VE 6AT1B 1S9FA 4F0HA 2CDRB 2VOOA 1YRUA 4X4RA 2G1DA 3K7RA 5SUHA 4RJVA 4DR3J 1AYEA 5HMZA 3MCOA 5IV3A 5C2CA 2KN4A 4DV6F 3PYGA 4AXJA 3IC1A 4L76A 3R1LA 2LQ5A 3AQOA 4NZ6A 1HWUA 3DI6B 2HQDA 3BQ0A 4LF5F 4DR5J 3ZZUA 5J2QB 3QNWB 1RHUB 2DT9A 1U8WA 1S97A 1T9XA 2YQ1A 4HLBA 2YPYA 4ANCA 1M1GA 4C8NA 1N5VA 1NK9A 4NE9C 4ZVEA 3W8GA 2CFXA 3MM6B 4OMFG 3PRDA 1FNMA 2HK3A 3FK4A 2HVZA 1RADB 2E29A 3W66A 2R2TA 2B5JB 1XR7A 3THTA 1JJ4A 1VISA 2M7SA 1HNXJ 4F50A 1SH0A 2V63A 3GIKA 3CMAS 2HQ3A 4NLOA 1I51B 2QMXA 2YWWA 3JTPA 2V8VA 4QWEA 3H5SA 4AL7A 1KWMA 3EJMA 5ETPA 4OJ1A 2YWEA 3K8WA 2XI2A 3VCDA 1OS5A 3HJFA 3I6PA 3M6VA 4WWSA 5J1EB 3W7BA 3V81A 2PA3A 4MMOA 1T9YA 4HI2A 4C8MA 3PW4A 2VDIA 4KB7A 3U27A 2FVPA 4OI4A 4W90B 4KY3A 2LEPA 5HP1A 3MPDA 3D0HE 5LT5A 3M2RA 1T7PA 1LNQA 4M5MA 5SZTA 2XLKA 2ACMA 3NS7B 2O66A 4KC5A 4ED7A 2PMHA 2IFXA 1RHQB 3M8WA 2J8SA 4HL9A 3RR8A 3UDEA 1RBLA 4NCAA 1H72C 2VFVA 2IAJA 2IBOA 4OI1A 2IDLA 4UTGA 2VQEF 3FZ2A 4C11A 2HGMA 3G96A 4Y00A 1M1HA 4DR2J 3CIMA 1TUGB 2B4PA 4PWUA 2UV8A 3KG4A 3H5YA 4WFXA 5I42A 1S5ZA 4YEAA 1X31C 2MGZA 1U02A 3K5OA 1X4GA 1VGYA 3P4UB 2DCUB 2FY1A 2J6SA 1RT1B 2ILYA 3POTA 1YJ7A 2JX2A 3G4SS 3SMZA 2AEFA 2KM8C 3MZIA 3LP2A 4ZCLA 4GKJF 2AX0A 4QYZJ 5D0EA 4MKAA 3SCJE 3BBFA 5J2MA 4QU7A 2KO1A 2ZOGA 1Q7YT 3SFUA 5CZVA 1UPPA 1HWJA 2K1RA 5KFBA 3Q8SB 1CBKA 4FYYB 4MTPA 1HI8A 1ZM4A 1F3FA 4GO5X 3MDFA 2N7CA 2V34A 1HBMA 1BLUA 1NUEA 2AYBA 1WDDA 4OYWA 3OR2A 2UU9F 1APSA 1KVIA 1H2UX 2L41A 5C5JA 3SQOP 1FERA 1WWHA 1OWXA 3GB0A 3LUYA 3NGDA 3KMSA 1RAIB 3NLCA 4N8OA 1HNVB 1RSCA 1RCXB 1RWUA 1IBMJ 1AZSA 1G2EA 1CSJA 3IWNC 3FKBA 1VJWA 4WP8A 2KYXA 1IKXA 3JYTA 3N28A 1NSPA 1N33J 3NG8A 3B4MA 2ADBA 4LF6J 1K9MT 1HW9A 1MWYA 3FEZA 3IGVA 4EZ9A 4ECVA 2O5DA 2F8MA 3MMJA 3WIVA 2OD4A 5DLFA 1NK7A 2EC2A 2QFIA 1JQGA 3T5JA 1CJTA 1RISA 5LMNJ 3EVWA 3AJ2A 3H25A 1VBYA 4USIA 2CQ1A 3B82A 5E3CA 2X1AA 3TWZA 4J9SA 4Y3CA 2GA7A 4NYPA 1SL0A 3KUEA 1X4DA 1D0EA 4FXVA 3T41A 1JLQA 4DDFA 1NKEA 3D4JA 1S7HA 2QT7A 4ZCMA 3PX0A 3MM8A 3GCXP 4DPUA 3PW0A 1WORA 2EI5A 2WTFA 2DIVA 5AJ3J 3NAHA 3THPA 3OSNA 1REGX 2J76E 3PX6A 2EBGA 2CVEA 2YWHA 1W2BR 4IH5A 1QTMA 4OLPA 2H65B 1SH2A 4DV7F 4USHA 1CJKA 1UA0A 2QRRA 1ZAXA 1Q82T 2XNRA 2PT0A 2R4FA 4FVCA 3HF5A 2RF2A 4LSLB 2G1HA 4RW6A 3GQCA 3KUHA 4LVOP 4CO2A 4LRDA 5BYRA 1VBXA 4KJIA 4DQIA 2GNKA 1RWWB 2HS3A 4WK1A 3UDCA 2JEJA 1AT1B 1NM2A 2AJFE 1KLMB 3MPYA 4F4KA 3SDEB 1DTQA 2AIRB 5KFEA 3P8BB 1S9EA 3K0JA 2I2YA 2AEJA 1URRA 2GMLA 3W60A 4U8YA 4WKRA 1NPRA 3EGWB 4NMXA 4P7VA 4KHPF 4LRCA 1NZ8A 2IJRA 5H1SV 2JEGA 1U0HA 1LKZA 4ZPDA 1WC6A 4DHVA 3PW2A 2XULA 1ZYQA 1MMLA 4QIVA 1T94A 4FBUA 3FFIB 5L1JA 2XCAA 1TK5A 2F1FA 1FJ7A 2YH0A 3MURP 3G82B 4UUWA 4O3OA 3OVSA 2H4WB 3L9ZA 1B0PA 4ZIWA 2DVIA 1QM9A 3LQVA 3H7HB 4M8LA 1S1TB 3CMQA 4UZBA 5T7LA 3UNYA 4XIUA 2EG1A 2K7JA 2GQQA 3JQMA 2GS8A 1Q0NA 3L7PA 4N77A 3MD1A 5KFQA 1QE1A 1E6VB 1U26A 2OEJA 1F1BB 1U6FA 3CF5Q 4RW7A 4QIEA 5A0YB 3GWCA 1RLDA 3NNCA 1JXVA 4MFBB 2BJ7A 2QA1A 4O4RA 2Z2ZA 2QA2A 4LSZB 2AV5A 5LJ5Y 1XEZA 3QFHA 4QIGA 3K5PA 4HHHA 1RA7A 2ZBPA 4DR3F 2WVFA 2HAIA 3SQGB 3PKYA 3R8YA 5EWGA 1S1WB 1IR0A 2LU1A 1Y7PA 2KFZA 4IH7A 5KG7A 2FPHX 5DO2A 1TL1B 1SVDA 1EQMA 5KAKA 4EGLA 5FJ4A 1M0SA 4OI3A 4UUXA 2R8GA 4IH6A 1KQGB 1S6QA 1U49A 1XWLA 2CJYB 1J5OB 1DARA 4F3MA 4CO4A 4OYOA 3QO9B 2AWZA 4LQ9A 1VQ6S 1E6YB 4WCEQ 2PSZA 3HP6A 3MPWA 4K5RA 2EBEA 2GJ2A 2CRLA 2OIHA 3UVJA 4LF8J 1RJJA 3I56S 1S57A 3MTJA 1MROB 3DLGB 4DBQA 3TEHB 2I5JB 2OAUA 2OI2A 3O5TB 2WAQD 2ZZNA 3VHQA 1IBLJ 1OSCA 1HNXF 3MUMP 2ZEJA 3DI6A 3NAIA 2W2QP 3GFHA 1HQUB 1UTAA 2I38A 4P10A 1TFYA 2HVDA 4I2PB 5HL7Q 2V0NA 4G1PA 1Q8KA 2E5LJ 3CCJS 3HHEA 4ZPBA 3DLBA 1SJ1A 2J7KA 2GGPB 1QSLA 3CSKA 4WTOB 1HQEA 4X62F 1TP7A 5DQHA 4OX9F 1GX5A 2O67A 2BE9B 1CS4A 1CQNA 5KFTA 4L74A 5IWAJ 3BEGB 4X4NA 3M8PB 1YG0A 4DU8A 2QN6B 2SXLA 4WYLA 2J6TA 3GTYX 4MJKA 5KTQA 3DM2B 2JVRA 2F40A 2ZUGA 2C2EA 1TZ0A 1JLEA 5E0OA 5E3QA 4F04B 5GAEI 3ILJA 2Z2YB 3LF0A 2LA4A 4ID8A 5CABA 4WFNQ 4PWDB 2E66A 3IAM9 2U2FA 1V5VA 2HWTA 3IS9B 3CJKB 1FCAA 1VQKS 3OD2A 2M0GB 4JYAJ 3HFKA 2E44A 3NBPA 4RU2A 1R0AB 4Y0FA 5ETVA 5K5MA 3DMJB 4N56A 3NNAA 1X4CA 2ROPA 2BR0A 3PFEA 5BXIA 3OPKA 5IM0A 4F3OA 1W2IA 4YY3J 4O3NA 3IRXB 2MKSA 3OVAA 4WXOA 2LA6A 4B9NA 5B0GA 3MECB 1T9TA 4ES1A 1WC4A 1BC6A 3B6BA 4UW2A 4G1IA 1PC4A 1U45A 2L9WA 1VK3A 2VPYB 4QOTA 3H4BA 1NPKA 2FGCA 2NXCA 3OXLA 4OZ2A 2KL8A 4CLUA 5HQLA 2A3JA 1K1QA 3UN2A 1AB8A 5H9FJ 1B99A 5C42A 2XGPA 8ATCB 2A18A 4J9LA 2BANB 3FCHA 5A8RB 2O01C 2V9WA 2J7UA 4J91A 3ENVA 1O51A 4I64A 2PFDA 4IG0B 5HMWA 4ZVGA 2OSRA 2G2OA 2OFGX 3PR5B 2DHSA 5CQGA 4OYBA 2QG9B 4DSFA 3L4BC 1V3SA 2DTJA 5I3QA 2EFQA 3OFGA 1NDPA 2Q79A 2QA4S 4LQ3A 2NZCA 1YDLA 2MHNA 1O8BA 1QUPA 1RABB 1R8HA 9ATCB 5KFXA 3AD9C 3BDPA 2V6AA 2BOAA 2FHJD 3ZTPA 2NCKL 3Q8UA 1RTJB 4TU9A 1LWXA 2QA4G 1V6HA 3R1HA 1QJHA 3IWLA 2BXJA 1UZDA 3VF0B 2XYPB 3OLAA 4DSKA 1Y5NB 1U7LA 4WF9Q 2JFDA 1DBDA 1BQNA 1OYDA 1X4AA 4LF6F 1C1CB 3OQ2A 4R0JA 4K0KJ 1WEYA 3BDEA 4DQPA 1H3DA 1HARA 3CC4S 1HNVA 4X4TA 2H9ZA 4BCAA 1R31A 3Q8QB 3HSDA 4A8XA 4ECWA 5LMNF 2C2KB 4M94A 1DTTB 3BSCA 2B43A 2XBPA 2IM0A 3EPIA 3I9V9 2VDHA 2LFVA 2A2DA 1B3TA 1M1KT 4NXMJ 4HR2A 1DRZA 4CI0B 2XY7A 1NK8A 3DDKA 3HFVA 3EGNA 4JV0A 3M2VB 3S01A 3WIUA 3LA0A 2QLFB 5D6GA 1NMEB 4JBCA 1WEXA 5AJ3F 2W9BB 3PRBA 3ADAC 4ZCKA 2K8GA 1KEKA 5KFGA 2FHJA 4CLFA 3SBMA 4LF9J 3VAGA 4P7TA 2MZTA 1VQYA 1CPZA 4OV1A 3WZ0A 4HHJA 4CNYA 1KN6A 2Y1RI 1RWMB 3A1YG 3NRBA 2J5AA 1SUQB 5BYQA 2WCXA 4FNIA 2LU2A 1UWBB 2OPRA 3PJ9A 2YX4A 1KSPA 3E51A 5IFMA 1TKZB 4MKBA 5HO4A 1N6QB 1UL3A 1NDKA 5E33A 2RHSB 5DDPC 3CO9A 1F9EB 2ROGA 4K50A 2HFNA 2P8IA 2PA8D 4G1QB 4OYXA 4FZVA 2XLIA 2D69A 3FMWA 3ETMA 2KRRA 2WVCA 1VCTA 4N41A 3ZZRA 3BZQA 3HHNB 2RRBA 1C0TA 2KHDA 4PQUA 2M88A 2VIHA 2C3UA 2XS7A 1YITS 1TKDA 4U8VA 2DJWA 4WTYA 1CQMA 3AB2B 4KGXB 3KJQB 3PM9A 1D3WA 1T9UA 4URSA 4FS2A 4EYHB 2DH9A 5DZ7A 5AXLA 1A9NB 3MTKA 3I82A 2FJXA 1IKWB 4HT7A 2LXUA 3SDEA 2IVMA 3EVMA 2QTWA 4UOFA 5KFKA 1RT2B 4FKXA 1HBUA 1DLOA 3Q24A 1NBEB 3V4IA 2YNHB 3U7JA 3HVRA 5J2PB 2M8DB 4LF7F 4C8YA 3DRPB 2ROEA 4BWMA 5CD4H 3HCXA 1IVZA 3W9IA 3FFIA 4OX6A 3H20A 1UW4A 1ZH5A 1N52B 1GXTA 1N36J 4Q0BA 3MMAB 4JI8J 1JMTA 3BB5A 4KSEB 4PYDA 1YGYA 2LQBA 1IBKJ 5G4DA 3QT6A 3RTVA 1URNA 1M5OC 4C2MA 4IOCQ 5L1IA 2GHPA 1XC9A 1LFWA 3KLGB 1DFDA 1RT4A 1GT8A 1UFKA 2XSFA 1YJRA 1N88A 2VKZG 5DLGA 3ITHB 3Q83A 2ZDOA 3R7SB 3KDOA 1V9OA 2V67A 2MLXA 1U1RA 4J9VA 5A6WA 3CUNA 3BGUA 1FRMA 1WDTA 2MYFA 5H9EK 5KT6A 3PDNA 3HVAA 2VC1A 1TMMA 2W1BA 4IRKA 4LF8F 2CPDA 5D4PA 4ZPAA 2V4JA 2PIIA 4JI6J 1KKHA 3AT1B 2QJ3A 4TY8B 3DU5A 1U2FA 1QAIA 4A4JA 1IBLF 3VZHA 3I87A 4CLTA 1X9WA 4LSNA 1H2VZ 3TQEA 3U1NA 2W4CA 4RNHA 4IOAQ 5IT4A 1XMBA 4DSLA 3M9NB 3C6TB 1HWLA 2Q3PA 2CIMA 4KO0B 4PG5A 1Q78A 2E5LF 5KFAA 1UETA 1X4BA 2OD6A 2XYHB 2ZZTA 1T11A 2WBMA 5BJRA 3R27A 4YR3A 1YBUA 5IWAF 2YY3A 2ZD1B 1FRXA 4HT5A 3CXCR 3I0RA 5JMNA 1S10A 4PABA 2EW9A 2JDJA 1R8CA 1T8EA 1R8PA 4NZ0A 4WXWA 3D7SB 2BKOA 4TXSA 4IDKB 5C24B 3TO8A 4Y2MA 2F4FA 1IWAA 3CCVS 1JLAB 2BJ9A 1KHVA 2DNKA 1RP5A 2R7TA 2C2OB 4KIAA 4DQQA 4CZCA 4JYAF 2HEKA 4QR0A 2M3DA 4TQRA 3ZXWA 1SL1A 3BSOA 4L72B 1S6PA 3QT7A 2IRXA 1YJNS 4NLTA 4P2MA 4YY3F 3NS6A 1EETA 3IM8A 5CCMA 2VBXA 1MN7A 4UOGA 1GX6A 4EMDA 2XO6A 4PWDA 4ID5A 4LRAA 1WSRA 3ZTSA 3CCMS 3HSZA 4OJ3A 3M32A 1R0AA 1RU2A 3DMJA 1SJQA 3QSYB 4DUYJ 4X4VA 2UUTA 1XIQA 4P2SA 4C8KA 3VTIA 1EP4B 5E3AA 1V3RA 4Y34A 3KLVA 1FO1A 1VBKA 3C3LA 2QL7B 3QJLA 3W65A 1OO0B 1N5QA 3MPUB 4NI2A 2PC6A 3EZOA 2ZOMA 2ZH3A 2CNLB 2RKIA 1RAGB 4CO5A 1RTHA 2IY5B 2KJWA 4AYBD 4HACA 2DITA 1VQLS 2BE7D 2MKJA 3CCSS 4J5OA 3QGPA 3GJQB 3PACA 1U47A 2DKOB 4TLQA 4DV4J 2FLLA 5IQ6A 2MJUA 1Q86T 2CZVC 2P9CA 1JLGB 4YB5A 4OYZA 5A6PA 5IS2A 4DL0C 1SV5A 5IT9U 1WF2A 5LSRA 3MM9B 2BANA 2DHAA 4NCBA 3QQCD 3MM5A 3QRQA 1HYSA 4CTAB 5HBMB 1NH8A 2K3IA 2R7SA 2ERRA 4ILRA 2DXFA 1MLAA 3DN9A 3DOLB 1WOSA 1NJYA 4C8OA
chains in the Genus database with same CATH topology
2X1BA 4N47A 3KLIB 3TP2A 3BO3A 2XMWA 2VKRA 3V6HA 2MZRA 4K4TA 3TANA 4NLWA 1FJEB 3UQSA 4UY8T 1SXLA 2FTRA 1RA6A 4Q2LA 1Q8IA 2L9DA 1WEZA 4MYUA 2KFYA 1IKVA 4DFKA 4JOUA 2MPUA 2OPPA 2XSJA 1A7GE 4LVNP 2VD3A 2LXFA 1FKOA 4RW8A 4V19J 2YNFA 2B56A 2JLEA 3VAHA 5I3UA 1SB6A 2B4VA 2QLWA 3LH2S 3QIDA 3T6BA 1QY7A 5A8WA 4U7CA 1HBUB 5LL6d 1HWKA 4EWTA 1DLOB 2I8EA 4DL7A 1FDNA 4DOZA 3KG1A 3CCZA 3V4IB 1P6TA 1Y3KA 4C7QA 2CJBA 4NLQA 1FJCA 3F56A 1FXDA 1HWIA 4MYTA 1KFSA 1N5SA 2MQMA 1REVA 1WHXA 3QGGA 2NREA 2RNEA 1OPZA 1MMDA 3TAPA 1O0PA 4DQRA 4WU2A 1GTHA 3S7RA 2CQ3A 3QPIA 3UI3A 4ECXA 3DRSA 4J9NA 5KFWA 1VK8A 1X8DA 2PO4A 3D5MA 4NL5A 4U7UK 3VWSA 3N4WA 1MU2A 1VRUA 3AB4B 2WSEC 2RH3A 2VFTA 4RNMA 3J7ZT 4A8FA 4ZDNA 3H2VE 1TUVA 1S9FA 4CH7A 2YKMA 3GIJA 2VOOA 1YRUA 4X4RA 3N6MA 4IFVA 2G1DA 4NZ7A 1VS3A 3HHLA 4Q0BB 3OJUA 3ZZYA 3K7RA 3TYTA 3N6LA 3H5XA 5DG8A 2KHCA 2NUHA 2CPFA 4RBTA 3DDNA 3CMES 2E7WA 2OP5A 3H98A 5SUHA 3T3FA 1ZM2A 2NSCA 3PV8A 5MLCV 4AL6A 5HMZA 3AA9A 2DGOA 2G4BA 5KT2A 4ED2A 3WDOA 2E1CA 4M63A 4A47A 2KN4A 4DV6F 4IRCA 3TUIC 2DGSA 3CE8A 1TL4A 1HBNB 2LLZA 2PEHA 1PILA 2GIRA 2PE8A 4AXJA 3OLBA 3IC1A 4IFYA 3TAMB 2BJDA 4DR4F 1X5PA 4J37A 3KYLA 4LSLA 3ZZOA 2FLPA 5D8HB 3R1LA 2KI2A 2IA0A 4IG3A 2LQ5A 2RE1A 3R5BA 1RT4B 1KTQA 3IBWA 3AQOA 4NZ6A 1HWUA 1SJ3P 3DI6B 3DYAA 3BQ0A 2BYCA 4LF5F 3ZZUA 3LGMA 5J2QB 3F44A 3LWLA 2EWHA 4DF8A 3HI9A 2CQ2A 2D9OA 2HHPA 2DT9A 2X1FA 2VC0A 5M2PA 2MY8A 2ZH5A 3CGIA 1S97A 1KD1T 4QW9A 2ZC4A 4HLBA 5IZHA 3CJ0A 1JJHA 2C22A 2FVSA 4B3MF 2DNHA 4NCGB 4KHRA 1XNRF 2CJKA 4M1KA 5F8JA 3OL7A 4C8NA 1KLMA 1N5VA 4I6AA 1TK8A 4QWAA 3D2WA 3QZ8A 1Z1ZA 4C0BA 4U6PA 1NK9A 3MFHA 2P6SA 3SSSA 2JSXA 5KFYA 4ZVEA 3OFHA 1QSSA 1JK9B 2CFXA 3MM6B 2EVZA 1QSYA 1Z4UA 2OO4A 4I56A 3G8SA 4OMFG 3PRDA 2DO0A 1JLCA 5J2NB 1FNMA 2DH7A 4H4KC 3Q0AA 3IRWP 2W9CA 2YNGB 2HVZA 2B9YA 4ECTA 2E29A 1DJ0A 4Y2CA 1AXQA 2IC3B 3GFZA