3I0SB

Crystal structure of hiv reverse transcriptase in complex with inhibitor 7
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 105
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0sB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB04
3NAIA 4Q44A 2R2TA 1FKOA 2F8EX 4IH7A 5C42B 2CKWA 3Q8PB 1RDRA 2BRKA 2FJXA 3KK3A 4TY8A 1TL3A 1S1VA 3H98A 3V6KA 4NLOA 4GC6A 3GYNA 3CWJA 3HVWA 1JLGB 1JLAB 4LQ3A 1SH3A 1R0AB 3OSPA 1QAIA 1DTTA 4LSLB 5HBMA 2D41A 4EO8A 4IRKA 1D0EA 4NLDA 4H4MB 5C5JA 5KFBA 2B43A 3M8PA 2AGQA 3H4DA 4IG3A 3DYAA 4R8UB 2FVPA 4IFYB 1JKHA 5C24B 1U09A 1TKTB 3RBEA 4M94A 3DM2A 5HP1B 4U6PA 2IM3A 2FVRA 1K1SA 4O3NA 2IC3A 3KLIA 1LWFB 2AGOA 5J2MB 3HVTA 2IAJB 1S1WB 1SUQA 1HNIB 3QZ8A 3PR5B 4RW8B 1S1UA 2YNGB 3BGRA 2WTFA 4J9PA 1RAJA 1YVFA 3QZ7A 1BQMA 4G1QA 4DL5A 1TP7A 4KO0A 2VG5B 5KG4A 5KFTA 4IR1A 1N56A 4FS1A 2BANB 2EC0A 3UQSA 3H4BA 2YKMA 4EEYA 3FDSA 4WE1B 3MEGA 3JSMB 3PJXA 4WZMA 2WOMA 4KV8A 1S1TB 3V6DA 2W8LA 3G6XA 2RF2B 4MH8A 1S6QA 3TQ1A 3T5HA 4TQSA 3GIKA 3CVKA 3OL8A 5FDLB 1T94A 4QPXA 1T03A 2V4QA 1J5OB 1IM4A 4LSNB 1XR7A 4ECTA 4ECQA 1RTHA 4B3OA 1VRTA 4NLPA 4J9SA 4F4WA 2DPJA 3C6UB 4NRUA 5L1KA 1C1CB 3PW7A 2JEGA 2ZD1B 2R2UA 1RA6A 4O4GB 2B6AA 2YNIA 2OPPA 3DOKA 1T05A 3LP1A 4XO0A 4IOBA 1BQNB 2C22A 2QV6A 2IM1A 2AWZA 4IDKA 1S1XA 2HWIA 5KFDA 2R2RA 3DI6B 4K4UA 2HNDA 1EP4A 4NZ0A 1FK9B 4TY8B 2JEIA 5DG9A 3G86A 2GIQA 1N4LA 1DTTB 5HBMB 4PWDA 1S6PA 4K4TA 5KFGA 5F8GA 3M9NB 2BQ3A 3T5LA 2I5JA 4IG3B 2V0NA 3N6MA 3FFIA 5KFVA 4ECSA 3KOAA 3DOLA 2V9WA 3I0SA 1XR6A 5KG7A 3BQ2A 3DM2B 4URSA 4QWBA 2QE5A 4RW9B 3H59A 5KT6A 3KLIB 4QW9A 4IQXA 3OLAA 3BQ0A 3HVTB 1TV6A 1HQUA 5I42B 1SUQB 3H40A 4ED1A 3PW0A 1SV5A 1TKZA 1S1UB 3BGRB 1RTDA 3IGNA 3KLGA 5KFEA 1S4FA 4MK9A 3MFIA 3GIMA 4EYIB 4KO0B 4H4OA 4NYZA 3HKWA 1RTJA 4PUOA 2YKMB 4J9RA 4ICLA 3DLEB 3MEEA 2J6TA 2FJVA 5F8MA 4DL4A 1ZTTA 3T5KA 1RT6A 3IG1A 4KV8B 4MIAA 3KJVA 4WZQA 4RW6A 3DDKA 1S6QB 1GX6A 3E51A 1JLEA 1UWBA 5K14B 1S9GA 3QO9B 3C6TA 4KFBA 4JV0A 2J6SA 2W9BA 1IKXA 5D3GA 2HMIA 3PW5A 1IKYB 2C2EA 4LQ9A 3SI8A 1RTHB 4B3OB 3DRRB 1HPZA 4RUAA 1RT1A 2XI2A 3QLHA 2RKIA 4KBIA 2VG7A 3LP0A 1HYSB 3T1AA 4ZVGA 1HQEA 1RT3B 5J2NA 3FSIA 1IKVA 3TAMA 4IFVA 2FVCA 4R0EA 3DOKB 4NLUA 3TVKA 5JUMA 4URQU 1JXLA 3DLKB 1NNDA 2HNZB 1S1XB 3D28A 1KHVA 2XCAA 3RB4A 5T14A 3DMJA 5F8JA 2HNDB 1VRUA 1LW0B 2D3ZA 3M8QA 5KFSA 5DQIA 4ZVEA 1S9FA 2AX1A 4KKOA 5DQHA 1S0MA 4R5PA 2JLEA 2XI3A 4WFXA 3HVAA 3T5JA 5KFRA 4PWDB 3PW4A 3JYTA 2R8IA 3H5YA 2BQRA 2BE2A 2YNHB 4I2QA 2WK4A 3KHLA 3EPIA 1TVRA 3FFIB 4RNFA 2JEFA 3IGVA 3BJYA 3DOLB 1KLMA 4ZPCA 3I0SB 3BQ1A 3IRXA 4GC7A 1T3NA 3MEDA 2ZE2A 2XGQA 5EDWA 4I2PB 4O3OA 5KFOA 2WHOA 1OS5A 5EWGA 3QYYA 1S49A 4IG0B 1HQUB 1LW2B 2IBKA 2W8KA 1SV5B 1TKZB 4ED8A 3MTKA 4ZHRA 2B5JA 3KLGB 3RAQA 3IS9B 1C1BB 4QW8A 4ED3A 2WONA 1RT4A 3I5CA 5KFAA 3V6JA 4DL3A 4MFBB 1RT7B 1NHVA 3ITHB 1HNVA 4PUOB 2IA6A 1JLBB 4ICLB 3BREA 3QGGA 5L1IA 3I0RB 2J6UA 2UVVA 1RT5A 4HYKA 5CYQA 3I5AA 1TL1A 3DRSB 3IG1B 1CSJA 1W25A 4KSEB 3OHBA 4RW6B 1DTQA 3EPGA 4FBUA 4ZPBA 2R2SA 3KLEB 5F9LA 1JLEB 1LWEA 1UWBB 5HROB 1S9GB 2YKNA 4KFBB 2OPRB 5KT4A 1IKXB 5D3GB 2HAIA 4IKAA 4RW7A 4TN2A 2ASDA 1N6QB 2R8HA 1RT1B 3KLFB 3QLHB 1EETB 4ZVHA 5J2PB 3DLGA 3Q8RB 2OPQA 1RTIB 4ECYA 4ZVFA 4NRTA 4TY9A 4RW4A 3TAMB 1C0TB 1RYRA 4G3IA 2W9CA 4NLXA 3OL7A 4J9NA 4EYHB 1RA7A 4Q0BA 2ILYA 3CJ5A 4WXOA 5KT7A 1K1QA 3CDWA 4QWEA 4K4XA 4Q8FA 4TQRA 2WCXA 4KHRA 4Y2CA 5DLGA 1DLOA 5KFHA 1FKOB 3LALA 1MU2A 4RNOA 2E9RX 3PZPA 2AQ4A 4TYBA 1S9EA 4EO6A 3KK3B 5JXSA 1TL3B 1JLFA 1S1VB 3G6YA 2UVUA 4YQWA 4O3SA 4J9KA 5J2QA 4IH5A 2JC0A 4KB7A 4I2QB 3V6HA 3M9MB 1S0OA 2C2RA 1TVRB 2CJQA 1JLQA 3KK1A 4ECUA 2FVSA 3CJ3A 3CDUA 2HNYA 2FJWA 3PJWA 4ZMMA 5KFPA 5L1JA 4J9MA 1FKPA 3M8PB 3MEDB 5KG3A 4TLRA 4O3QA 1MMLA 1ZTWA 3DYAB 5F8HA 4F4XA 4DL6A 4K50A 3SFUA 1SH2A 3UPFA 5F9NA 3Q8QB 1JKHB 2BQUA 5F8NA 3RAXA 3T19A 4H54A 3NKYA 5KFIA 2B5JB 4ECVA 2IM2A 2IC3B 4Y3CA 5KFXA 4URGA 1RT4B 4IRCA 4RNMA 3QIPA 3DRPA 5HLFA 3MR2A 1HNVB 5KFLA 4I7FA 5KG0A 3KHRA 1BQMB 4G1QB 3GQCA 1RT5B 3IN5A 4WFYA 1TL1B 2VG6A 5KFCA 2XWYA 4Q8EA 4F4YA 1JLGA 3PR4A 2W7OA 2BRLA 1JLAA 3MEGB 1R0AA 4NLSA 1JIHA 4JV2A 3ISND 2I1RA 4WYWA 2WOMB 2OPSA 3V6DB 2WB4A 5KFKA 2UVWA 3PHEA 3NGDA 5CYMA 4IRDA 3BSNA 1N48A 1RT2A 1T03B 3DLGB 4IFYA 5C24A 3N6NA 1TKTA 4K4VA 1VRTB 4O44A 2JC1A 4RW4B 5KFJA 3RB6A 5J1EA 2W9AA 1LWFA 2IM0A 3FQKA 5J2MA 2WRMA 2B6AB 3V4IA 2YNIB 4TYAA 4QWAA 1JX4A 2IAJA 3CJ4A 3CIZA 1HNIA 4KHMA 2OPPB 2FVQA 3MECA 1T05B 3LP1B 2ALZA 1DLOB 4NCGA 1Z4UA 3NBPA 5KT2A 2DPIA 4IDKB 2VG5A 4J9LA 2IJFA 4EBDA 3D5MA 3I5BA 1EP4B 1JLCA 3JSMA 3H5UA 3MR5A 5J2QB 1HARA 2ASLA 3CDEA 4F4ZA 2RF2A 3BR9A 1TQLA 4O4RA 5KG2A 1HMVA 2W7PA 3QIDA 1S6PB 4TXSA 4U7CA 5FDLA 3EZUA 3UR0A 2XCPA 4LSNA 2XC9A 1TKXA 2I5JB 3HHKA 3OLBA 2C28A 3C6UA 1I6JA 5I3UA 4ZP6A 5DG7A 1C1CA 4DL2A 4MKBA 2VA2A 4WFZA 4O4GA 2RDJA 3M9OB 5L1LA 5DGAA 1LWCA 3LANA 4NLYA 1BQNA 4ED0A 3QIPB 3DRPB 2OH2A 1TV6B 5HLFB 4I7FB 1RTDB 4FBTA 3DI6A 3E01A 3ICLA 4Y34A 3OL9A 1FK9A 2VG6B 4RU9A 4H4OB 2O5DA 5KFQA 1RTJB 3MFHA 4K4SA 3CJ0A 5KT3A 3MEEB 3G6VA 1WNEA 1XR5A 3V81A 3ISNC 3FRZA 4EBEA 1RT6B 2OPSB 4ECWA 2ZKUA 3KJVB 4NLWA 2AGPA 1S0NA 4ZP7A 5KFUA 1C0UA 2YNFA 5CYMB 3KK2A 4PQUA 3C6TB 1RT2B 4NLQA 5EWEA 2W9BB 3RB3A 2HMIB 4ZPDA 4NLRA 5KFZA 4O44B 1HPZB 2HWHA 3N6LA 5J1EB 1ZETA 5F8IA 3RBDA 2RKIB 2VG7B 4RW9A 3LP0B 1REVA 1HQEB 5KFMA 3V4IB 4Q45A 3KLHA 5KG1A 4MKAA 4YR3A 4K4YA 5J2NB 4ID5A 1IKVB 5I42A 4IFVB 3H2LA 2R8JA 4DG1A 3MECB 2GC8A 4YP3A 4ECZA 2R8GA 1KHWA 4NCGB 4MIBA 5DQGA 2UUTA 3NBPB 4K4ZA 1N5YA 2D3UA 1S48A 3DMJB 3GIJA 4WXWA 3BSAA 3DLEA 3KLVA 1VRUB 1JLCB 4ECRA 2E9TA 3M8QB 5F8LA 1IKWA 4K4WA 2JEJA 2ATLA 4KE5A 4KKOB 2UVRA 4R5PB 4RUCA 3VQSA 2D7SA 4ED6A 3RB0A 1HMVB 5K14A 3QO9A 3JYTB 4DEZA 5C25A 1IKYA 5KFNA 4ZP9A 1TKXB 2BE2B 3DRRA 2FLNA 3LAKA 5I3UB 4IH6A 2FLLA 4ED7A 1KLMB 3IRXB 1HYSA 5DGBA 3GV8B 5DG8A 3KMQA 2ZE2B 1RT3A 2ILZA 1GX5A 4MK8A 3NL0A 1LWCB 4YR2A 3CJ2A 3DLKA 3NAHA 1QE1A 2HNZA 3LP2A 4RZRA 3KMSA 2VA3A 4ZPAA 1C2PA 4ZHRB 3OHAA 5EWFA 3SFGA 3E01B 4ED2A 3H5XA 5KG6A 2WONB 1LW0A 4RNNA 1S10A 4WYLA 4O3RA 5KG5A 5C42A 5KFFA 2UUWA 1QUVA 3V81B 5CYQB 1D1UA 1SH0A 2GIRA 3NMAA 2BR0A 1DTQB 2V4RA 2AU0A 2FLPA 4X2BA 1C0UB 2YNFB 1LWEB 2YNHA 3KK2B 2AX0A 2IJNA 4PQUB 3BSCA 2YKNB 4YMEA 2ASJA 3KHGA 4LSLA 3UDLA 4RW7B 4H4MA 5EUHA 4FS2A 4KAIA 4M95A 2RDIA 3QGIA 4XPCA 4NLVA 4R8UA 5L9XA 4I2PA 4Q43A 4ECXA 1REVB 3Q8SB 2OPQB 2E9ZA 1RYSA 3KLHB 4DL7A 1S97A 4IG0A 1LW2A 4ID5B 5HP1A 4JUZA 4DG1B 2W9CB 3MR6A 3KNAA 3IS9A 1C1BA 3MR3A 4Q0BB 1N5YB 4MFBA 1RT7A 3PVXA 1S1WA 3KHHA 5DLFA 3ITHA 3PW2A 4RW8A 2YNGA 1JLBA 3QGHA 2C2DA 4NLGA 3I0RA 4ZP8A 1IKWB 1MU2B 4NLTA 4QWDA 5KFYA 4JV1A 3DRSA 3GV7B 2BANA 3GV5B 3KLEA 1S9EB 2XGPA 2R8KA 4WE1A 4IR9A 5HROA 4QWCA 1JLFB 3FQLA 4F50A 5C25B 2OPRA 1S1TA 3OSNA 1N6QA 5KFWA 3GILA 3MF5A 1JLQB 3KK1B 3KLFA 4HKQA 3OL6A 1EETA 2HNYB 4YR0A 5J2PA 4RNHA 1FKPB 4XPEA 1J5OA 4Y2AA 1NHUA 3BSOA 1RTIA 4MK7A 4EBCA 1C0TA 4J9OA 3H5SA 4J9QA 2ZD1A 3LAMA 2IMWP 1QE1B 3LP2B 4OL8A 1QAJA 4O3PA 3GIIA 5KT5A 3CO9A
chains in the Genus database with same CATH superfamily
4Q44A 3GJTB 4FP9A 1RDRA 2W4PA 4ATNA 3H98A 4FN5A 4LSLB 4OHWA 2DD8S 3CCQS 4IOAQ 3H4DA 3M1VB 1N5SA 4M5JA 3RBEA 5C24B 1U09A 1NK0A 4TU7A 2I0XA 2QMWA 3WDOA 4ZN3A 1CQNA 2DIVA 3NRBA 5J2MB 2DRDA 3EGVA 1S1WB 4J9PA 3R27A 3IAS9 3UQSA 3H4BA 4HH1A 3H8YA 4X4RA 4X4TA 2J8AA 3M32B 4A8OA 4F36A 1JMTA 3GE9A 4QPXA 5ETOA 2HS0A 2JL9A 3CPWR 3M8RA 2OPPA 2J5AA 3GR0A 3LP1A 4AT1B 1RBLA 2G2ZA 2R2RA 4F04B 4K4UA 2G1HA 3UVJA 2KXFA 3R7NB 3FFIA 3A8KA 5HN0A 4PPZA 3AODA 1RTZA 2QA1A 2YVSA 3BQ0A 3HKZD 1SXLA 5HVHA 3GG0A 3IGNA 1NZAA 2A6MA 1ZTTA 4RW6A 3VGTA 1UWBA 1JJ2R 2HVEA 1W2BR 2VG7A 1N5QA 1SKUB 1JXLA 2HNZB 1X4CA 4L3NA 5T14A 4H4KC 4KGZB 2ZUAA 2BQRA 2WK4A 3FFIB 1TZ0A 2W01A 4JBCA 1UKUA 3BQ1A 1T3NA 2XGQA 2D9PA 2OKQA 2IBKA 2C3UA 4E98A 3RAQA 3IS9B 1WC4A 4O23A 2KYXA 4MFBB 2J6UA 1JLBB 4BWJA 4RW6B 1UWBB 5AJ3J 3ETMA 3SQGA 4ZIWA 1MN9A 3SCJE 1YRXA 2OTLS 4K4XA 1BE4A 4USTA 1MU2A 1WOPA 2UVUA 2LECA 1UMJA 2CJKA 3BGLA 4PAAA 3D66A 4ECUA 4C3LA 5IS2A 2MQ8A 3PRDA 5F8HA 2YWGA 1HW9A 4ID8A 5F9NA 1CC7A 1JKHB 1FF2A 2QX0A 5DETA 2ZHAA 1PCAA 5DS7A 2XSJB 2QYCA 3VHQA 3D1QA 1CBKA 4WFYA 4Q8EA 4X65F 2XY7A 4ILRA 3BSNA 1T03B 2Z2LA 4EGLA 8RUCA 3RB6A 2HQIA 4LF4F 2IM0A 3O5TB 5HAOA 2QLBB 3CIZA 1HWLA 2YX7A 5GADU 3CCUS 2Y8WA 3E3XA 2FJEB 4OI3A 2VPWB 1VRQC 2W7PA 3FKBA 1U26A 5FDLA 4QZVB 3G9CA 2F3JA 1DFDA 1HBUB 2Y0SD 2IVYA 1U1KA 2Y1IA 1FJGF 3FRZA 4ECWA 1RT6B 4NLWA 4DV7F 1NDCA 2KZZA 2GFFA 2DNYA 4W98A 2HMIB 1PO6A 1OQ3A 3MAAA 4FYXB 1ZETA 3LP0B 1N32F 3ZTRA 2MZQA 5J2NB 3TJ8A 3MMCB 2QMUB 4OMFG 4PXCA 2MQNA 1IKWA 4K4WA 1K47A 4RUCA 3BBFA 5K14A 2ZUGA 3IR5B 4ETZA 3LAKA 4Y2KA 2RRAA 2MZTA 3Q2SC 4B9UA 5E41A 1NM2A 2BUNA 1KNZA 2GIRA 2FLPA 3C16A 1R0BG 3SIPB 4LFBJ 3MAAB 4I2PA 3BDEA 3UCZP 4N8OA 4ECXA 1N36F 1B0PA 3X3UA 3BB5A 2FYXA 4JI4F 1VC6A 3NGTA 3C46A 3D0HE 3QBCA 1C1BA 2BJ7A 4GKKF 3B6BA 2A0FB 4ZIVA 2YNGA 3FCVA 1IKWB 2VC1A 4P75A 1H73A 4DCOB 4IR9A 2R8KA 5HROA 2OPRA 2H5JB 4HT7A 1MMDA 4JI0F 2OD4A 2FHKA 1Q1KA 2AYGA 2H5IB 4FPRA 2V8PA 1S1VA 2HVHA 3PCOB 2LLZA 2ZH5A 5J1NA 3GR1A 1APSA 3C16B 2A1BA 1JXEA 1WC5A 3OVBA 1D9FA 2LEBA 1KQSR 4M8LA 1QLNA 1FD2A 2EFNA 3W2VA 2M3DA 3HVTA 1CJUA 3G87A 2XY5A 3PR5B 2YNGB 2XTJP 3W8PA 4CDIA 4KO0A 3CCJS 4TNOA 3AD7C 3OL8A 3SSSA 4I4BA 2VIHA 4NLPA 3D0IE 1C1CB 2XMWA 3EVMA 1WEYA 4B3TJ 3MUTP 1ITPA 2HNDA 2XZTB 3RBZA 4PWDA 5F8GA 1P6TA 3M9NB 3JB9k 1V6HA 3HJFA 4URSA 4QWBA 4NA2A 2W24A 3HVTB 5I42B 2F63A 3GIMA 2XMKA 4KO0B 3W5ZA 2I38A 5GAEU 5L38A 1GX6A 1SC1B 3EICA 4UOGA 2KT5A 4WP3A 2J0WA 3OTDA 2HQGA 2F40A 1I51B 1ICEB 3RAXA 4R0EA 3HCXA 4CLTA 4LF7J 2VFTA 4DX5A 1M1GA 4NCBA 1UVKA 2QSFA 3AB2B 2HNDB 5EX3A 4R5PA 1WHVA 4EK2A 1TFWA 4PWDB 2BOAA 4I2QA 3AAWB 4RNFA 1E6YA 2QSWA 1N8RT 4UT4A 1NSPA 1PYTA 2ZOFA 4Z37A 2W8KA 3CF5Q 4ZHRA 1PSDA 1KS2A 2BKPA 2FQQB 3HHNB 3I5CA 1LFWA 4DN9A 2W2PP 3I0RB 2UVVA 1DZ5A 2GZOA 1YITS 1YSJA 1TFYA 3EXCX 3K2YA 4IKAA 1RACB 3L9ZA 4RW7A 3NWRA 3Q8RB 1UVLA 4NRTA 4WBFA 3AHPA 2FZCB 5KFHA 1FKOB 3LTOA 2XS5A 4EUVA 5IM0A 2GHVC 1S9EA 2CVEA 1SJ3P 2X1AA 4Y6IA 4OI0A 4I2QB 2RS2A 4ED4A 3TANA 3R6GB 4LR9A 5LXYA 3IM9A 3SFUA 1SH2A 4NA1A 2DGVA 3FGVA 2CFXA 2FJAB 3WHIA 4P2XA 3NWGA 5EN1A 5KFLA 3RAMA 2VODA 2P8IA 1JLGA 2LEPA 2UU9J 2VQEF 2MQLA 2WOMB 2OPSA 3LW5C 2E1MC 1HKAA 4P74A 1R89A 3J7YU 3PEJA 1HFEL 2F9DA 4U8YA 4EWTA 3UDCA 2K7KA 3D5MA 2Z2ZA 2A2CA 4HI2A 1N0VC 2D3O1 3AQPA 3HD2A 3UFCX 3GYGA 3ZTSA 1NSQA 3BPDA 1WI8A 4AE5A 5U47A 1XQIA 3W9IA 4UOFA 2RDJA 3TO8A 1LWCA 3VR1A 1QAXA 4KQZA 1AYEA 4KGXB 3ICLA 2Z58B 4LF5J 3K5LA 3CJ0A 2BA9A 3BR8A 3VAKA 2OPSB 2AGPA 3KTQA 3GCXP 4OYAA 2AD9A 5JVGQ 2PT0A 3W3SA 3IWLA 4DI6A 2PO4A 2GC8A 3DMJB 2FZGB 3M8QB 1X4HA 5GVQA 1RWUA 1FHTA 3QO9A 5ETPA 2LQBA 3TUZC 2FPHX 1UZDA 1LWCB 1NSAA 4CLKA 3H5XA 2ZOMA 4F2SA 1QUVA 4WP8A 3KJFB 4F7VA 2MQMA 2HW3A 5ETSA 3ZZRA 4LF6F 4GKJJ 1MMNA 1Y9OA 2CJAA 4H4MA 2ADBA 3QFWA 3QGIA 4NLVA 4PYAA 1VHIA 1K0TA 1H2VZ 1F3FA 2CAJA 2RSQA 2BJDA 3PVXA 1SJ1A 1RHRB 2UUAJ 4NLGA 3WIVA 2GQ2A 5IFMA 2YKPA 3GV7B 1YJ7A 2KVIA 4WK1A 3FQLA 2LQ9A 3NGSA 3R5CA 2PE8A 1KC8T 1Q8BA 4RNHA 2A18A 2ZDOA 1IBLJ 4USKA 1LFPA 1RCXB 4OZLA 5C2GA 2Q6CA 1ZS6A 2V2VA 4H4MB 2DGTA 3UNGC 4E8UA 1B7FA 2BX6A 2CG8A 3DM2A 3E2EA 3FCWA 1SVDA 4DZ6A 3ET6A 1T02A 1AZSB 2NQPA 1TP7A 1VGYA 3EWGA 2EFGA 3D67A 4WZMA 4I1TA 5ETNA 1FE0A 3TQ1A 1VQMS 1A7GE 1CG2A 4FKXA 1UTAA 4IDKA 3CD0A 2WSEC 1XIQA 4ZCKA 2ZZTA 1WC3A 3T5LA 2I5JA 4C4WA 3DM2B 3RU0A 3R1LA 1FVQA 3ET6B 2QT7A 4DFMA 4F0HA 1PIEA 4ICLA 1RAGB 2ZNZA 1S9GA 3C6TA 3VGSA 1SCJB 2PDAA 2MB0B 2RUSA 1RT1A 2N4CA 4LF1A 2HPUA 3WBZA 1HQEA 1XN9A 2O67A 4NLUA 4ZITA 4OZ2A 1S7IA 4ZJLA 3K58A 3L7UA 3D28A 2HGLA 3RG6A 1S9FA 2AT1B 2E7WA 3T5JA 3M2RA 4DSKA 3MAQA 1WG5A 5IOLA 4UOHA 4ZVQB 2FTRA 2YPYA 5L8RC 1LW2B 1DBDA 4ICLB 3BREA 2UV8A 2PI5A 4ILMA 2RRNA 4FBUA 3U1NA 2R2SA 3U7JA 1S9GB 4M1KA 1R8AA 3EGWB 1RT1B 1YJRA 1DRZA 3J7A1 4NMLA 2HAFA 4HTJA 1WHXA 1T9XA 2UUBF 9ATCB 1A9NB 3I9V9 4HLBA 4PWWA 5AE2A 2GO9A 1IR0A 2X3DA 2XULA 4O3SA 2HYIB 1CQMA 3S7RA 8ATCB 2CJQA 3MM7A 1VJQA 3I55S 3DGVA 1ULRA 1O5JA 2NR0A 5KFXA 4IRCA 1HD1A 1GTEA 3SMZA 5IV4A 1U6BA 4FDFA 1N36J 5DRKA 2RB7A 3N6NA 2DHSA 4KGVB 5J1EA 4M5GA 4B9MA 2RJZA 4NMXA 3CJ4A 1HNIA 2GIFA 1Q8LA 5BXIA 5H9EK 3NOCA 1M5KC 4DR6F 1PJ5A 2YY3A 4FXWA 1TKXA 2A3JA 2GMJA 1NPKA 3G8QA 5SUHA 1I5OB 2N4DA 1P1TA 4NLYA 2GVDB 1Z2LA 5A2QY 2WBMA 3AOAA 2PI4A 1H3DA 4U9RA 1FKAF 4YS2A 5J1EB 4P73A 5F8IA 4ITSA 4BS2A 4OHXA 1UL3A 4YP3A 1WC6A 4DPUA 3O3LA 4YY3J 3DOMB 4DR3F 1RWKB 1D3WA 3ILOA 1UVNA 4WK3A 2E44A 1IKYA 1TKXB 1WC1A 4J7CA 1X4FA 1XMBA 2XWXA 3HHLB 1GX5A 4MK8A 5LT5A 2NXJA 2OO4A 3ADAC 2HG4A 1TMJA 4JV5F 2NZ4A 3BO2A 2XM3A 5CYQB 2R7QA 3DLBA 3TZZA 4DV2F 3TAPA 4B08A 3IR6B 2RDIA 2OGUA 4F0KA 1U1OA 3Q8SB 4DCPB 3B82A 1XBWA 2C2KB 2OP5A 3DNCA 2YH1A 1KSPA 2HFNA 3WX4A 3CUNA 1X31C 4YR0A 4FF3A 4J9QA 2BEFA 3GIIA 3JTNA 3HM9A 4ZN1A 3Q8PB 1CS4B 3KK3A 4NLOA 3G82A 4LQ3A 1JLAB 2V2ZA 3LA0A 3M30B 4HDGA 3N5FA 3M8PA 4PYDA 1TUWA 2MMYA 1V3SA 2YWFA 3PO4A 2NYIA 1SL1A 5K20B 4NXNF 4KHPJ 1K1SA 1HHSA 2ROPA 2AGOA 1YRUA 2L08A 4H4KA 2DNNA 2Z57B 3TX8A 3QZ7A 3RBXA 2BACA 1N56A 4KJIA 4MJKA 1YWXA 2MGZB 1NSKL 3HI9A 1IM4A 4HTIA 2DEJA 4ZS6A 4MYUA 3OJUA 2HIQA 4YB7A 4XIUA 3DDNA 2C22A 3CEDA 1SI9A 1O6XA 4DLEA 1FTRA 1EB0A 4K2JA 4KYZA 3S6EA 3G82B 1RGVA 3G86A 4L73A 2F8MA 2V68A 1NU4A 2I9SA 2Z4PA 2DHGA 5HQLA 2E7XA 2UXCF 2GAHC 3TQEA 3BPSP 5IQQA 1U1PA 3BKFA 1PYSB 1F5BA 1VS3A 2J6TA 5F8MA 4DL4A 3IR7B 2CPJA 2LKZA 4KFBA 5D3GA 2Q6BA 3DRRB 1NK4A 2XI2A 3PACA 1NB2A 2J9CA 3CW2C 1CEZA 3TAMA 5FD1A 4HDHA 5DQIA 3BN7A 3M7VA 4DV1F 4KKOA 1QY7A 4B3SJ 3BGUA 1R43A 2O1PA 5LMUJ 1CJVB 3VF0B 3GJSB 2WBRA 2ZFHA 3QYYA 1IBCB 2XMJA 4ED8A 3A3OB 2MYFA 3DDIA 2XO7A 2XEXA 1NXIA 3BBCA 1HNVA 2IA6A 3UN3A 1FJ7A 2YBVA 5LM7E 3H20A 3OHBA 1DTQA 3LF0A 2BYCA 4KFBB 5D3GB 1L3UA 1UAWA 4RUHA 1RWNB 4TN2A 5AE3A 3OTOF 3W2WB 1QJHA 4DPYA 1EETB 2VBWA 4RW4A 3TAMB 1YZ6A 3T3FA 1UZHA 3D4JA 2ZITA 1UA0A 1FDAA 1IWAA 4FYVB 1JLFA 3Q83A 3TRGA 5ETMA 5K5MA 2ZC4A 4ZMMA 3W61A 4QIEA 3DYAB 3FEZA 4HACB 3N28A 2FGOA 5HMYA 2KT3A 4URGA 2LU1A 2DH9A 3ZTOA 1HNVB 4ANEA 3NS5A 4I7FA 1YZ7A 3PFEA 4X66F 1WOSA 2BRLA 2GQCA 4UY8T 3MUVP 3OR2B 3V6DB 4JB8B 1D9AA 1FESA 3B4DA 3GZ7A 3IA0A 4F67A 4RW4B 4DDFA 1UEKA 5ETRA 2W9AA 3TUIC 4PXDA 2DR8A 1UVJA 4DFKA 3I5BA 1LQ9A 3RUBL 3ZC4A 4EMDA 3DLJA 2GMLA 2X1GA 1HMVA 2CPDA 2PGCA 1T0TV 4LSNA 4CM0A 1M90T 4MKBA 1VCTA 4CQ1A 2ZH6A 1TL7B 3PDNA 5IT9U 5K8PA 4DV3J 1FJCA 4I7FB 3DI6A 3BF4A 3ILJA 2DNMA 4H4OB 3OW2R 1RTJB 1AFIA 3AB4B 1ZOTA 2IYGA 1TAQA 1RAOA 2HS3A 3N6LA 3VGUA 2RH3A 3TX0A 3S1TA 4MKAA 1QDUB 1IKVB 3SV3A 2N7CA 2CJXB 3W8GA 2ALYB 5F8LA 4X4SA 4NCAA 1HMVB 3MM9A 5C25A 5AXNA 2NUUG 2E5LF 4ED7A 4KT0C 1RKIA 2C3PA 3MMAA 2YKOA 3CTRA 3KMSA 4LFCF 1NLKL 4OX8A 3NCPA 3FSXA 3FZ2A 4J9VA 3BS9A 1U02A 2UXDJ 4FNHA 1SKSA 3UWTA 4YFUA 5HSPA 5HP1A 2RHSB 4Q0BB 2K1RB 2JHEA 4P7VA 5DLFA 3PW2A 2R42A 4CNYA 2FHMA 4NLTA 1F2GA 3TARA 5C25B 1S1TA 2ZHBA 3B4MA 3KK1B 5J2PA 1J5OA 3BSOA 3ILIA 4UTGA 3H5SA 4OL8A 2QC3A 4WIQA 3SSQA 2YKQA 2KB2A 2BVZA 1UW9A 1GQEA 2F8EX 2MEWA 3ZZTA 1WEZA 3CWJA 1X9MA 4DV6F 2FIUA 3CCVS 2BDPA 3D6TB 5HP1B 2IM3A 3TEHB 2QA2A 5B0AA 1TK0A 1IBKJ 1TMMA 6FD1A 4Y28C 4FS1A 1FWPA 3FDSA 3CMQA 1S1TB 2RU3A 3HULA 1J5OB 3BZQA 1NAQA 4L72B 5L1KA 3K5NA 4AUKA 3OUYA 1H2TZ 2RS8A 2CZVC 1U2CA 4AFFA 5HVFA 4HL9A 2E1PA 3MOZA 5DM6Q 2MZRA 1G1XA 3EXYA 2DGWA 4DSEA 4OJ3A 1LNQA 4DR2F 2AF6A 4J90A 1YBUA 4DR1J 4JP8A 1RTDA 4PZVA 1AB8A 4DS4A 5IXUA 2F9JA 2P9GA 2OFHX 2GQQA 1FA0A 1NDKA 3E51A 1KVJA 4DR5F 1U0HA 4RUBA 3ILLA 2XG8A 3OUYB 5IQ6A 1PC4A 2FVCA 2HHHJ 5I3PA 2B0GA 1E6VA 1FWLA 1VRUA 2D3ZA 3FZBA 1VQ8S 1WHYA 1JXVA 1NK8A 1H98A 3KHLA 2L48A 3CCES 3IGVA 2XZWA 1KLMA 4PG4A 5KTQA 3IRXA 4YB5A 2H5EA 3KUHA 1HR0F 1OS5A 1HBNB 4IG0B 3GFZA 4QW8A 4ED3A 2WONA 3W5YA 1RT7B 2VDIA 5L1IA 2KJWA 1WUUA 1LWEA 5KT4A 1U0HB 1PJ7A 4ZPWR 3KLFB 2OPQA 5K8OA 4DR4F 1C0TB 2W9CA 4NASA 2MKSA 2VICA 2IHR1 3CDWA 1E6VB 2DGOA 2BMBA 4CLUA 4TYBA 2V2QA 5J2QA 2JC0A 3CDAA 1FKPA 1ZPWX 3FC9A 4CLZA 2WZ1A 3LUYA 1H0HB 4AL5A 2GCFA 1U1QA 5IT4A 4DV2J 3T1YJ 4A8WA 1EARA 2DVIA 4ILLA 3CGIA 1VBXA 2OIHA 4IFYA 1GFWB 4FYWB 3UCGA 4F2RA 1FRJA 2YNIB 1RHJB 1AUDA 3AJDA 4KHMA 1VR6A 5D6GA 3SCIE 5A8RA 1BQXA 2KN4A 2CQIA 5J2QB 3O2IA 1VQLS 4TXSA 5F0WA 3UR0A 2NUHA 2J0QD 1T3OA 2UXBF 1R7IA 2EFPA 4WWSA 1PG5B 4K4SA 4C3KA 2EBEA 1S0NA 5KFUA 1VQPS 2PIIA 4OJGA 2W9BB 1HPZB 3DRYA 2RKIB 4ETXA 2YXLA 4CH1A 5KG1A 2VFRA 5A8RB 4RBUA 1UFKA 3TR5A 1IXKA 2UVRA 2DXEA 3JYTB 3AXKA 4B02A 2PEBA 2CPFA 4LF9J 2ADCA 5IZHA 3WC2A 1RT3A 3SEOA 3NL0A 4DPWA 1N33J 1HNZF 5BR8F 4ZPAA 2JVOA 4N8NA 5MLCV 2JNJA 4P52A 1RUSA 2MLYA 5EUHA 2Z2YB 4XPCA 2H1YA 2G2OA 1WTFA 2GS8A 5BYRA 4OV6A 1YK9A 2C2DA 2IRXA 1GK8A 4HR2A 1Y0HA 4QJVA 2JJ4D 4F50A 1J2VA 4CO3A 3FMWA 3MPWA 1OSCA 4E0DA 1RABB 3VZHA 2WB1D 4B3RJ 3CO9A 1OWXA 4DQIA 2RIJA 2KHDA 2DGUA 1RHUB 1ROFA 4L3KA 3HMJG 1X4DA 4PCQA 4EO8A 4FZVA 4O3NA 4P71A 5DO2A 1LWFB 1K9MT 4ALZA 1S1UA 3PYDA 3UN2A 2FLOA 2OI2A 1H6KX 1FWKA 5A2QU 3EYZA 2HRTA 3JTOA 2P2CB 2KZMA 4X4OA 1Q7YT 2BV3A 3CC4S 3GYXB 5I4MA 1T05A 2HK2A 4OYMA 4ZVRB 2XYHB 2AWZA 4CO2A 3AA8A 1EP4A 2Q3PA 5GMEA 4OI2A 3MM6A 3CO0P 2J9EA 1VQKS 3AJ2A 5ETTA 1UEUA 3N5BA 5KFVA 2IVFB 3IWXA 2XLJA 3QFHA 4OX9J 4JI6F 4NOHA 2BJ3A 3VAJA 5KT6A 1RAHB 2HLTA 4PR6A 1S1UB 3W64A 1WTBA 2RAQA 3WZ0A 3H90A 2IRUA 2IFXA 3L3CA 2H54B 3EGNA 4WCEQ 3TVKA 4IFVA 1NKCA 3GSIA 3DLKB 2ATCB 1S77D 1KHVA 2XCAA 1SJQA 3IC1A 5IC6B 2HHVA 5CXTA 1DHMA 4LBIA 4NZ7A 1NCLA 4IYQA 1ZAVA 1CLFA 1VQ4S 2QLJB 3BJYA 3BEGB 2R4FA 2VB6A 4UZCA 4F02A 2IIHA 2EVZA 3CJRA 2DISA 3M6UA 1XMOF 1S4EA 3JQJA 2ZH4A 2BJEA 3QGGA 2UP1A 2EW9A 3DRSB 4DUYJ 3Q8UA 2RMLA 1FFGB 3AFGA 3GB0A 1OPIA 1N6QB 3GFXA 4DQRA 1CPZA 1VQYA 1RTIB 2YX1A 3QJPA 1OY9A 1X4BA 1TELA 2GHWA 2AEMA 4J9NA 3VTIA 5JJBA 5CZXA 5HI7A 4KHRA 3A3PB 5DLGA 2CQHA 2ZZMA 5JXSA 3D7SB 4P9SA 2VJUA 3HHDA 2C2RA 4USHA 3B8HA 2OLWA 4CLSA 2ZH7A 1TK5A 4CZCA 3Q8QB 2DR9A 2CZ4A 3FEYB 3MCOA 2CQDA 3PRBA 1HBMB 3AA9A 4RNMA 4M63A 3T9ZA 4CCHA 3MGJA 3T1HF 2NPIA 2HQFA 4A48A 4U95A 3UDVA 4ZCIA 4OZNA 1H2UX 5D4LA 3KUGA 4WYWA 2CQPA 2HKEA 2CXEA 3C14A 4KTQA 2JC1A 3JSRA 3MUMP 2JDJA 4C11A 2FUG9 2B6AB 4LRAA 5DDRC 4XDDA 4ES2A 5B7WA 1OQ6A 4RBTA 2AJ4A 2VG5A 4PABA 4EBDA 3JSMA 2XY6A 3AD8C 1RB0A 3MWBA 1KQGB 4M5KA 4YB6A 3HLUA 4DFPA 3IWNC 3OLBA 2C28A 2VOOA 3FCHA 1T9VA 4O4GA 4Y00A 1VBYA 3MM5B 2OH2A 3OL9A 3P8BB 2FHJA 2VH7A 3V81A 4UW2A 4EBEA 2V34A 1S6UA 3EZ5A 3C14B 5EWEA 3PHTA 4F0MA 3GFYA 2V6AA 4YR3A 2H4WB 4FNIA 3DLHA 1FDNA 2LCWA 2LA6A 2DCLA 2UUTA 3BYRA 1WSVA 3T6JA 1HNXJ 4LF8J 3KLVA 2E9TA 4C8KA 1H72C 1TL4A 4ERDA 3VAFA 1TTHB 1UETA 4ZJQA 1URNA 2J7WA 2ZE2B 2VV5A 3OXLA 4IO9Q 1RKJA 4B3MJ 4F3MA 3OHAA 1KTVA 3U02A 2Z56B 2CQ2A 3V81B 2CYYA 2OMOA 1SH0A 1T9TA 4X2BA 1VYAA 2M52A 4DCJB 2ZKTA 3JAMY 3PX4A 1XNRF 4QYZK 2CNNB 5CABA 3BYPA 2H65B 1B70B 2B9YA 4DJBA 3PYGA 4JV1A 4QWCA 1C4CA 3ENAA 1BD6A 2W2QP 3AQOA 5IWAF 5B0BA 1SKWA 2G9OA 3LPYA 5HANA 4CP5A 1WF2A 4C6AA 5LSOA 3ETOA 4CLWA 2HHSA 4IG3A 2RUGA 1R6VA 2HVIA 3D1HA 2FVPA 2MSTA 2WVDA 2IC3A 3UD3P 2M2BA 1VJWA 1SUQA 2IRYA 3A8JA 4G1QA 4A4JA 1RZMA 5KG4A 4IR1A 5E5NA 4IOCQ 3CB4A 1VRTA 2ROGA 3TI0A 1RISA 1M5SA 1VLOA 2IM1A 3CCTA 4C8YA 1FT8A 2Y0BB 1FRXA 1FK9B 3GMGA 1XMQJ 1UFLA 3QJLA 3VCDA 4MIWA 3ENQA 2BQ3A 4IG3B 3N6MA 4ECSA 3QQCD 2V9WA 4EFAC 3U27A 5CQGA 1SUQB 4MK9A 3A3NB 3W1YC 3PTWA 3OTEA 4DHVA 3L4BC 4JI2J 4X4PA 3G6ES 3M2VB 4RUAA 5L39A 4OI6A 1H7XA 3FSIA 4DF8A 3NMRA 3FMBA 1KFSA 2JRSA 2JLEA 3M6XA 4WFXA 1KEKA 3HD1A 5HMWA 4FVMA 4QOTA 1WI6A 4ZPCA 3MEDA 5C2CA 3CULA 4B9VA 3R97A 1UWAA 2XQCA 1YBTA 2B5JA 4G1PA 1M0SA 2ERRA 4ANDA 3FBCA 3ITHB 1NPRA 1H7WA 2PA8D 2CWXA 1NJZA 1PC5A 1CSJA 4JI1F 2DO4A 2WVFA 3KLEB 1FEEA 2YKNA 4RJVA 3BKUA 4ZVHA 3KJQB 2CQBA 3MCSA 4KH0B 5CD4A 2OSQA 1RA7A 4WXOA 2GA7A 3QSYB 4RLEA 4LFAF 3OVSA 4Q8FA 3ZZUA 2KKHA 2A2DA 2CQ1A 3PZPA 2EEYA 2LMIA 3JSYA 1WORA 3Q8VA 1JLQA 1OIAA 3CDBA 4U67Q 5E3QA 5KFPA 1VHFA 3MEDB 2YWWA 4O3QA 5F41A 4CT8A 5A6WA 2B5JB 1WKJA 3FVYA 1FVSA 1QAYA 1BQMB 3F0NA 1R8CA 3MEGB 4JV2A 4N47A 1WF1A 4LT6A 2BKOA 2IDEA 5CYMA 3UD5A 3A13A 1RP5A 5C24A 3TOQA 2BM0A 2ZBRA 3N79A 4TYAA 5J2MA 1FXLA 4OYPA 2UUCF 3HHLC 2JZ5A 2ZNYA 4NX9A 3HT0A 3EGZA 2PN6A 1WELA 4A8MP 3M32A 4C48A 2V8HA 2VA2A 1KOOA 4ELVA 2B8QA 4I68A 2E5JA 2EC2A 4DSFA 1XNQF 3UCUP 4N76A 1L5UA 2ZBIA 5LL6d 1EX8A 1MROB 3G6VA 2XZDB 3ZZOA 1XR5A 3QT6A 1R27B 5D8HB 4ZP7A 5CYMB 3MPDA 1IBMF 2E1CA 3J81Y 1MSWD 1FJEB 1YLXA 4DV5F 2R8JA 4DG1A 4ECZA 1N5YA 2F4VJ 1XTZA 3PX6A 2DR5A 3J7Z5 1QVGR 3NY0A 4CH7A 3LH2S 2GV1A 2BE2B 3L09A 3GLJA 5D0EA 1T11A 4X64J 3R1HA 1F2HA 1HHQA 2HNZA 1C2PA 4ED2A 1EKSA 2B7BB 1ZYQA 2E1AA 4K2XA 2AHOB 2BR0A 2G2YA 2NSBA 2K2PA 2IJNA 2DPIA 4OYWA 3LGMA 1TUGB 4FF4A 2LXIA 4TU8A 1W7WA 3TYTA 5LMNJ 1RYSA 4DR7J 2XHCA 2XO6A 4DG1B 2MXYA 3R7BB 3IS9A 1D9DA 1N5YB 4MFBA 1VQSA 4RW8A 1JLBA 3L95X 2P5VA 2DHXA 4QWDA 1S6OA 2HRUA 3GV5B 5KOXA 2HFOA 5AE1A 4A8QA 4OLPA 1Q8IA 3UW1A 3Q89A 3WIUA 4KGMA 4DUZF 2HNYB 4L74A 2CQCA 3N4WA 4WPAA 2IMWP 4NE9C 1UP1A 1N5TA 2R2TA 2VBYA 2BE9B 2Q79A 5BJRA 1SH3A 3UE2A 3JTPA 2OUGA 2GX8A 3FBEA 2B43A 1VQ5S 1JKHA 1TKTB 2HGMA 5JMNA 4U6PA 2VU5A 3GJRB 2XSJA 3LPEA 4KR0B 4RW8B 4QR2A 4DUTA 2W8LA 2MKJA 1JB0C 3M8YA 2CNKB 1T03A 4ECQA 4LVOP 3NS7B 2DH8A 1KQKA 3C6UB 4WIIA 3D54A 1J5EF 2CZ9A 4XO0A 3DKDA 4NXMF 1RWWB 2CPHA 1Y11A 1SBRA 4UQGA 4C9DA 2JX2A 1O8BA 2M9KA 1HBUA 2PSZA 3DOLA 5KG7A 3J81j 2VZ9A 3RRHA 4IQXA 3AT1B 3DXBA 3VAHA 5CYJA 2KI2A 2CPIA 4DSIA 1RT6A 2KG0A 2M70A 3BH6B 1X9SA 1IKXA 3EE3A 2HMIA 2M4MA 1HLWA 4KGKA 3QLHA 3LP0A 5J2NA 2MKYA 1Y7PA 4URQU 2KL8A 2QA4G 3MMCA 4ZLNA 1AA1B 2YH0A 1XWLA 5KFSA 2XI3A 1VFJA 3LGNA 2FHOB 3MPVA 2APOA 3US5A 3AH6A 1TVRA 3BGOP 3DOLB 3LWMA 4RU2A 2CNOB 1VOMA 1HWIA 5D0GA 1HI1A 2DK2A 4ZVSB 2AYBA 1P8GA 3WC0A 1SJFA 4BC7A 1NHVA 4JI7F 4DSJA 1LK5A 2K3KA 2HHWA 5B0EA 5KOWA 4ZPBA 2Y8YA 3LQVA 1IKXB 4C8LA 1XJWB 3QLHB 2CPEA 2SXLA 3M2UA 4G3IA 2F4FA 5LJ3Y 1NDPA 4ZOSA 2VPXB 4DPOA 3V2UC 5CAAA 3NNAA 2OEMA 1S0OA 1TVRB 2FVSA 3PJWA 3CDUA 2YKAA 3EZOA 4P2SA 5KFIA 3POTB 2CPZA 2HVDA 2DBBA 2KM8B 2VHGA 5KG0A 1YJNS 2HBQB 3IN5A 1X5SA 1U1NA 2I1RA 1RT2A 3M6VA 3M2UB 3W62A 1B3TA 4USMA 2CQ4A 3T9NA 2O3DA 4Q5VA 1NMEB 2QLXA 4JI5F 2LFVA 2W4DA 2IJFA 1JLCA 3RRKA 2EKNA 1RHKB 3PY8A 3DGPB 5GMKa 2VJVA 1LWXA 2L41A 1C1CA 3K0JA 3UDEA 3HVRA 3EDQB 5DGAA 3IRWP 1TV6B 2NPFA 3MR7A 1U2FA 5B0CA 3ZZ0A 3MEEB 2OTJS 1RAFB 2V8GA 1RT2B 4BBYA 3RR7A 5KFZA 3Q86A 4WFNQ 2ZDPA 4JI3J 4CRJA 5KFMA 5I42A 2R8GA 3I87A 2D3UA 5ETQA 4I64A 2AW0A 1JLCB 1PILA 3FBFA 2D1CA 3HZEA 4X84A 2ACYA 3I96A 2B51A 1N52B 2R3VA 1RWMB 2RRBA 5D4PA 3VGVA 4IH6A 1XERA 5DGBA 2HSEB 3ONQA 1LOUA 3CJ2A 2VA3A 4MKYA 1JJCB 3K5MA 5KG6A 1U8WA 3A12A 4C98A 5B09A 2R7UA 2QGFB 3TA0A 1LEOA 3P45B 3MEKA 2QLFB 3QRPA 5EX0A 2G0IA 2DNOA 2KRRA 1FFSB 4LBHA 2P6SA 1S97A 3MMJA 3SV4A 4CH0S 3KYLA 3QGHA 3I0RA 1N34J 4BDPA 3PYFA 4P2MA 4ZLPA 4DV4J 1IQTA 1YX2A 5E33A 4FPIA 2DR6A 3OSNA 1NH8A 3IBWA 2QTWA 1VBKA 5IT9Y 4OIXA 4K0KJ 1FDBA 3EVOA 3THVA 2B4PA 2CQ0A 3I9ZA 2VQFJ 3RB3A 4DN0A 5MAOA 4QPTA 1FKOA 2ZJRQ 1SKRA 2BRKA 2LVWA 3VAMA 4GC6A 2MY8A 2XMMA 1R0AB 1U25A 1AT1B 3MZIA 3MM8B 1EIYB 4M94A 1M5HA 2QFJA 2AJ1A 4P10A 1F9EB 4CYUB 1RU2A 5AJ3F 3C8YA 2IAJB 3GONA 5D0HA 2YQ1A 1CJKA 2MKCA 5B08A 4LF2A 2WOMA 1RK8A 2RF2B 2KJVA 2QYGA 4RPFA 1XR7A 1NH7A 1TL5A 4F4WA 1T9YA 1KWMA 3VAIA 2LQJA 2G1DA 1BQNB 3TEGA 1FXRA 3O44A 2RQKA 1HBOA 1PBAA 4LREA 4YHHF 3WX8A 4K4TA 3CJQA 3NG8A 1HA1A 4FYDA 3KG1A 3I0SA 3KFWX 4RW9B 3TVZA 2AJ2A 3NNHA 3RRGA 1HQUA 4NI2A 1CJKB 4N7TA 3MMBB 1P9YA 4WZQA 2FY8A 3A4TA 1Y5NB 4JI8J 3HK2A 4C97A 1X8DA 4DV0J 3JAMU 4ZVGA 2ZM6F 4OX7A 3MCMA 3PIOQ 1Q79A 1BWEA 3DMJA 3M8QA 2E66A 2JOQA 1HBOB 5DQHA 1FI4A 3QRQA 1ZA2B 2HVZA 1VIXA 3W5XA 1YKWA 2CADA 2L9WA 3OBIA 3I0SB 1B4SA 1HQUB 4NI2B 1T8EA 1X4EA 2QZ8A 3HSDA 3KDNA 1YJVA 1L3KA 1F60B 3ULHA 4D3HA 2Z8QA 2UZAA 4DV5J 4IO1A 4NYPA 1HWJA 1SC4B 4ECYA 1Q86T 3ZNUA 2NYHA 2FJDB 3CJ5A 3P4UB 2KFNA 2CA9A 4I6YA 4Z7YA 4S0MA 1TL3B 3R5JB 4J9KA 4IH5A 1Y10A 3FSYA 4XK8C 2B4OA 2NXEA 3NXZA 3RW7A 2PFFB 5L1JA 3VALA 2V4JA 4R0JA 4K50A 2R7RA 5T7LA 3BN4A 2VC0A 1VLYA 2J9DA 4LFBF 4UUWA 3QIPA 5M2UA 1JNZB 5RUBA 4F4YA 4PXBA 3FK4A 4LRFA 1PGZA 4GMKA 1W2IA 1NKBA 3QMQA 4MYTA 4HT5A 5A8KB 2WRMA 2CNLB 2J76E 1CC8A 2MJNA 1WKKA 1AZSA 4NCGA 3NBPA 3FJ2A 2ASLA 1F1BB 4DL0C 1S6PB 4U7CA 2V4JB 4USUA 5I3UA 4ZP6A 5B0FA 3D3BJ 5B0GA 5T7LB 1VDHA 4C8ZA 3QIPB 1YG0A 4K5SA 3H42A 4QIWD 1G2EA 4Y0FA 4HHHA 2X7IA 3KJVB 3KK2A 2B4VA 1UA1A 3QPIA 2WAQD 3N9UC 1REVA 3KLHA 2MLXA 4NCGB 3NBPB 4ZPVR 4Q7AA 4WXWA 4J37A 5JVHQ 3NEKA 2E1RA 4ZP9A 3W7BA 4B3TF 4A8SA 2GVZA 5I3UB 1Q8KA 4K8RA 3MD3A 1SJ4P 2IPOB 1RAEB 2CJBA 3BKTA 3QATA 5C42A 1R6YA 1MWYA 4CWBA 5C7PA 1VQ9S 4WTOB 1B0VA 3KK2B 3BSCA 5HJYA 4FS2A 4M95A 2JFDA 3VQTA 2C2MB 1IVZA 1REVB 3KLHB 4X65J 2KVQE 1LW2A 3MR6A 5L46A 1OPZA 4MT1A 2C42A 5HQ8A 2MKIA 4LF4J 6AT1B 1QVFR 4GO7X 4U7UK 4LF7F 4U7UD 3HX9A 2GVZB 1O51A 2KHCA 4EBCA 3GSDA 1KLNA 1V3ZA 3IBCB 4DQQA 5C42B 3G71S 3G8SA 4OYZA 3OSPA 4IRKA 1MWQA 1FJGJ 5F3ZA 1YJ9S 4PRFA 5E3RA 4DV7J 4ED0A 3BGRA 1NKEA 4OFZA 5GAHI 4RBVA 4DL5A 4F8RA 2NSCA 5H9FK 1N32J 5EHHA 2NREA 2P9EA 1D09B 3ZTQA 4C7QA 3OVAA 1TAUA 4TQSA 3DN9A 2V4QA 2W1BA 4B3OA 1RWVB 3J81U 1RA6A 3BH7B 3T41A 2ZJQQ 3VZIA 2QL7B 1NDLA 3TWZA 3I6PA 1TR0A 1BWVA 4WKYA 5E0OA 1NEEA 1X9WA 5KFGA 4JYAF 2EFVA 4B9SA 2V0NA 2XBPA 3IMQJ 1XR6A 1JWWA 1RAIB 5ITHA 2UU9F 2Y9HA 2GVDA 4ED1A 2KXNB 3BGRB 4NWBA 3WQPA 3MFIA 1M5OC 3TW0A 1VISA 7FDRA 4J9RA 3DLEB 1VBZA 2ZH9A 3DLLQ 3DDKA 4JI4J 2EI5A 4GKKJ 4B3OB 2W7AA 2G0CA 1HYSB 3T1AA 3PG9A 5M2RA 2LEAA 1WKLA 3H2UB 3DOMA 2ZH1A 1LW0B 4JI0J 7AT1B 3EJMA 4M5MA 1A0OB 4X4NA 5KFRA 3PW4A 1Y3KA 3H5YA 2R8IA 2IMOA 2YNHB 4LIWA 4LF5F 2KO1A 3HHLA 5EDWA 3R9LA 4A8FA 1S49A 3UD4P 2V63A 3KJNB 5M2PA 5CYQA 3A1YG 2HAIA 1KN6A 4OZ0A 4ENOA 2R8HA 3ZZZA 2MQOA 1UJ5A 4ZA1A 1ZAWA 4OJ1A 4QWEA 1Q16B 4K59A 5THWA 5H9EJ 4YQWA 4BHQA 3OT9A 2NS1B 4WJBA 2FJWA 5KG3A 4ED5A 1T95A 2Y1RI 3NKYA 4Y2MA 2IM2A 4GKJF 3K59A 4Y3CA 3JS9A 1CS4A 3GQCA 5KFCA 2ZHOA 1JLAA 3M30A 3D2WA 3ISND 4OYXA 1KRPA 2EG2A 3NGDA 2UUAF 2D3OR 3AD9C 2E5GA 4USIA 3V4IA 2W2MP 2OPPB 3LP1B 2AP6A 1Y4ZB 3UVJB 2MGZA 1IBLF 1DARA 3L7OA 5HL7Q 2F65A 2AJQA 1F0XA 2XCPA 3HHKA 4DL2A 3UI3A 2HWTA 1YGYA 5L1LA 3F73A 2MQQA 2XMVA 1X60A 3CIMA 1NBEB 5D4OA 5KFQA 1WNEA 3R6LB 2P9CA 5D0RA 3NS6A 2DXFA 4PQUA 2HBYB 2E7VA 4USVA 2VG7B 3V4IB 4ZK7M 4OI1A 5SZTA 4UOCA 3F44A 1S48A 1N5VA 3HHLD 2AKWB 3BSAA 4EI2A 5J1PA 2KTQA 3GWCA 1P9QC 1ZZNA 1B64A 3DRRA 1DY3A 1G7CB 2CJ9A 1RXOB 3UN5A 4NEZA 2CDRB 1QE1A 2C2ZB 4YHHJ 2DO0A 4RNNA 3NGUA 1M5PC 2HZCA 1IUJA 2DNQA 3NNCA 3M4XA 4PQUB 1YDLA 3PX0A 3DHWC 1CJVA 3IM8A 3SQGB 4AL6A 2RILA 4PEOA 2EFOA 1RSCA 5ETVA 3J7AN 2VQEJ 1VIOA 2AMCB 1MU2B 2XGPA 1SB6A 2ZM6J 2DTJA 3W2WA 3GILA 1EETA 1Q0NA 1NHUA 4MK7A 5FIIA 1U49A 3MD1A 2E29A 2L9DA 1CVJA 1QE1B 5CCLA 1YIJS 3OFGA 3MTJA 3CNQP 2CKWA 4LJMA 5CD4H 3U1MA 3Q22A 4TY8A 3V6KA 1MN7A 3P49B 5HBMA 2YWKA 2RQCA 3RW6A 2YX4A 2VUGA 3DYAA 2LDIA 4HACA 1WSRA 4ELTA 2GW8A 4EZ9A 3MXHP 3OQ2A 4KPCA 4YDXA 3M8WA 3AY0A 1YJWS 3OR2A 4DQPA 2QLWA 2KXHA 1FRIA 3V6DA 2ABYA 5G4DA 2EK6A 1BC6A 4MH8A 1S6QA 4G65A 5FDLB 4RWXA 2DPJA 1GXTA 4KRWA 3I31A 4G6VB 2ACMA 1PBUA 3SCKE 4ZVPB 4OZJA 1FRMA 1FD8A 4TY8B 2HQ3A 5DG9A 4PWUA 5HBMB 2RQMA 4DFJA 4PPDA 3R8YA 1X0FA 1TL7A 2HGNA 1U47A 4J5OA 2QE5A 3H59A 2G4BA 3H40A 4LF6J 1SV5A 1YTYA 4PG7A 1S4FA 2DJWA 4H4OA 2AJFE 3BGFA 4GVLA 1RTJA 4PUOA 2BJ9A 4E2FB 2OMLA 1FRKA 1WJ9A 4FXDA 1U6FA 1S6QB 3HPOA 5K14B 2J6SA 2DNRA 4LQ9A 4O0IA 2G13A 3TZYA 1WACA 4OYIA 1IKVA 3VV2B 1MLAA 2XNQA 4AXJA 3R2CJ 1IJEB 2QA4S 3TUJC 3HVAA 3DC2A 4A8YA 2W2OP 3C66A 1T7PA 1QM9A 4L6V3 1YBAA 2HLUA 4A8XA 4YDDB 4I2PB 1Y00A 2WHOA 2M7SA 1IM6A 5IV3A 1SV5B 3KNGA 1C1BB 4K7QA 4PUOB 1TL1A 1EQMA 1S99A 3HFZB 2VOPA 5HROB 2OPRB 3CCWA 4QQBA 1HIYA 4YY3F 1BXNA 2H4YB 3DLGA 2ZH3A 1H74A 2DGQA 4YEAA 3Q24A 3DXSX 2X1BA 1IWGA 3VAGA 3A8EA 4Q0BA 2K1RA 1MNEA 2LQ8A 1WDDA 2E9RX 1OYEA 2AQ4A 4DWIA 4ES1A 4AYBD 2DH7A 1S1VB 1HWKA 2K8GA 2NLWA 3QT7A 3KK1A 4P7TA 4R25A 3VWSA 3W65A 2ASJA 1ZTWA 4DLGA 2EBGA 3UPFA 4X62F 4QIFA 3W2VB 1J27A 5HLFA 1CJUB 1Y5IB 1KQFB 4FKYA 3LWLA 2N3OA 3KHRA 1TL1B 2VG6A 5ETKA 4F3OA 1PKUA 2W7OA 2WB4A 5KFKA 2UVWA 1FTCA 1NJIT 4DOZA 2HS4A 3W9JA 3DLGB 4QR0A 2R7SA 1JX4A 1AROP 2GJFA 1Z4UA 3HSZA 2KYZA 2RHQB 4J9LA 4EZ6A 1OY8A 4F4ZA 2R7WA 1OJ4A 5HATA 2XC9A 3H2VE 4TKTA 2VASA 1R3NA 3EDRB 2QEXS 5HLFB 2IY5B 4NPOA 2VG6B 4RU9A 3C15A 1G3OA 3TP2A 4KHPF 5GMDA 2CUYA 3MHYA 1UW4A 3OTCA 4ZPDA 4NLRA 4RR5A 2D74B 2QFIA 2KU7A 2YWEA 3GFHA 3PM9A 3SZ2A 2OSRA 3GIJA 2F1FA 3HT3A 3OFHA 4R5PB 4C2MA 2UUBJ 2C1EB 3RR8A 4X4QA 4BLGA 1FX2A 3GTYX 1DQAA 1RBOB 1E6YB 4FYYB 3I4HX 2ILZA 4LRCA 3HJVA 1Q5YA 4UUXA 1BHNA 4NL5A 2MZ1A 4ZHRB 2MJUA 4JYAJ 1RCOB 3C15B 1RADB 1IN0A 1HI0P 1LXJA 5HMXA 2Q66A 2AX0A 4RW7B 4KAIA 1F5AA 2DNGA 1N54B 2RDDA 2OELA 1NO8A 1HBNA 4IG0A 1I1GA 2RD5C 1ZM2A 2ZH8A 1RT7A 3D6MB 4N56A 4ZP8A 2J7KA 3KDOA 5IM0B 3W66A 1S9EB 2EC0A 3OJSA 3P5BP 5ETLA 4KPYA 5KFWA 3KLFA 4HKQA 2GAGC 1F6TA 2VPZB 1U45A 1C0TA 2W2NP 1Q53A 4DR6J 4B3SF 4IH7A 5LMUF 4JOUA 5A76A 2V8VA 1JLGB 3CJTA 1QAIA 2BJ8A 3OPKA 3GP9A 5AT1B 5KFBA 4C0OC 3BO4A 2DNKA 5BYSA 2MHNA 4MAKA 1KP6A 1ZM3A 3HXMA 4CLFA 1UFWA 2NXUA 5HO4A 3PJXA 4MTPA 3KXDA 3T5HA 1UPMB 4MKVA 4DR3J 1S57A 3PW7A 1I94F 5BYQA 3W9HA 2YNIA 1QSLA 1GMVA 4IOBA 4B9TA 4B9LA 3AJ1A 4C0HA 4OZ3A 5CH7B 3OFFA 1RLCL 2CWKA 2JLGA 1N0UA 4NEYA 4JV5J 4UZBA 3K8VA 2VONA 1RBAA 1BMQB 1TKZA 3KLGA 3ZNJ1 1V3RA 4FXVA 2FJVA 4W4MA 2MSSA 1U2RA 3QO9B 2W9BA 3PW5A 1KR4A 4QIVA 1HPZA 1XC9A 5G0RA 2RKIA 1NJYA 3R5GA 1KTQA 5GAHU 3RB4A 1V5IB 1VMBA 5K9FA 1OSDA 5F8JA 4CO5A 1QTNB 2KM8C 3R2DJ 2BE7D 1BGXT 3JYTA 1FNOA 4DV3F 3MOJB 3CJ8A 5KFOA 4O3OA 5EWGA 2ROEA 1TKZB 3MTKA 1VQOS 3KLGB 1TU0B 5HVGA 2ZJPQ 2FD2A 3I5AA 1W25A 3T6BA 4KSEB 4NXNJ 5H1SV 5F9LA 4GO5X 3UO0A 4CO0A 3JQKA 1DQ8A 5G0RB 4RX6A 2F7VA 2DNLA 4XAKA 3OL7A 5KT7A 1SPBP 4TQRA 1DLOA 1EZZB 3KUEA 1U24A 3OD2A 3KG4A 4KB7A 3CJ3A 4J9MA 4UF4A 3K17A 4TLRA 2VL1A 1WHWA 2UXDF 4ZVOB 3H7HB 1HWUA 3PJ9A 1FNMA 3SBMA 2UXCJ 1B0TA 1REGX 3PR4A 2DNPA 1JIHA 4K4VA 1VC5A 2U2FA 5AXMA 2JWNA 1LWFA 2CVIA 2HIYA 3H25A 1YQHA 5DDPC 1KFDA 2ALZA 1DLOB 2IYIA 1X5PA 4HI1A 4IDKB 4Y2IA 2CDQA 5ADZA 4WTYA 2OFGX 1SQFA 1HARA 3CDEA 3TZXA 4O4RA 3OTBA 2YQ0A 2I5JB 3KWMA 1UVMA 3M6WA 4WFZA 5FLXY 4DV1J 3M8ZA 3TZWA 1AFJA 1L3SA 3FRYA 3AXMA 2CPYA 4HHUA 4TVAB 4LR7A 1T9WA 2XMAA 2OHDA 1IBKF 2HQDA 3PXGa 3C6TB 1NRKA 1GAOA 1RWOB 1HQEB 4Q45A 4I6AA 4X4VA 2BM1A 2HFUA 3OTOJ 1EJ7L 3C19A 1N88A 1X0PA 4ZVTB 3M2RB 4AXIA 2FZKB 1Z2ZA 3BM7A 1G4CA 4TU9A 3PYEA 5GAGI 1X4AA 3KMQA 4MMOA 2V2KA 2ZBPA 3DLKA 3NAHA 3LP2A 1GTHA 1YHQS 1JQGA 3SFGA 3ISZA 2WVBA 1PAEX 2C2NA 2IBOA 2HBRB 4DR1F 1MG7A 2QO3A 3NGKA 4X66J 1Y3JA 4ANCA 4JUZA 3KNAA 3MR3A 4D3GA 1GEHA 4OI4A 1IQZA 2Y1JA 1U48A 5KFYA 4TLQA 3DRSA 1U1MA 3FEXB 1RLDA 1SQEA 1HI8A 3GIRA 4WE1A 2HHHF 2CQGA 3TVYA 2B7CB 1N6QA 5LXRA 3MF5A 3MM7B 4CT9A 4Y2AA 1RTIA 4LR8A 4OYBA 4J9OA 2HURA 3LP2B 3CCMS 1QAJA 3A8IA 5KT5A 1IR1A 5LJ5Y 2HK3A 3NOGA 2QRRA 2M88A 3MPYA 2N82B 2I2YA 2HQCA 4KH1B 3OXGA 1F9FA 2R9LA 5IC4B 2PC6A 2DY1A 2HRYA 4DMZA 2RVJA 2LXFA 4PG6A 3P6YC 3QAUA 1HBMA 4FF2A 4QIGA 1HNIB 1RAJA 4C3MA 5KFTA 4DXLA 1K73T 2YKMA 3M05A 4EEYA 4WE1B 3D6FB 4QU6A 4V19X 2D69A 1HD0A 2XYPB 4LIRA 2B6AA 3R3TA 2DCUB 2OEJA 2VFSA 2E5LJ 2XMTA 4NZ0A 2GIQA 2WVCA 4X62J 1PJ6A 4LFCJ 3DU6A 3V5RA 1XEZA 2GJIA 3PNIA 3T1YF 2B4UA 4USWA 1KKHA 5HK4A 4CM2A 1V9OA 3MM5A 2DB1A 2PD1A 2YTCA 4EYIB 2CRLA 2YKMB 2R7OA 3Q0AA 2H51B 1LXNA 1S5ZA 4MIAA 3TNVA 1JLEA 3N01A 2A10A 1DQ9A 5E3AA 4JV0A 1IKYB 2C2EA 2HZAA 1GXLA 5JUMA 5A8WA 2KH9A 1NNDA 4I0WA 1PYOB 2ZC3A 2LU2A 2WVEA 1NB7A 2EXUA 2M8DB 2HFZA 1WDTA 1KVKA 2XLIA 4KC5A 4ZJOA 2QG9B 4LMZA 2ZE2A 3CD6S 3J7ZT 3CCZA 2W4CA 3SQOP 4DV6J 4L76A 2EG1A 4HYKA 2MLZA 2HZVA 5CHCB 2MDAA 1JLEB 4ER8A 3G96A 2ASDA 2KRBA 4RKUC 2EKYA 3HSGA 3PV8A 5DDOC 2HBZB 4NLXA 5A8WB 3CXCR 4OHYA 1K1QA 2C3OA 4USJC 1U4BA 3CC2S 4LF9F 1WWHA 3KK3B 1RE1B 3G6YA 1N33F 1U1RA 3MURP 1IJFB 2LXUA 3M8PB 4F4XA 2QL9B 5L9NA 4W90B 1WG4A 4ECVA 1GMWA 1ZA1B 3RYLA 3MR2A 4F4AA 2QIFA 2XWYA 4DR2J 1L3TA 4GVBA 4NLSA 2P6TA 3OXFA 4IRDA 3CMES 5HJXA 1N48A 4M5HA 1WD6A 3MCNA 1X5OA 3P3DA 1SJRA 1NK6A 4LBPA 4DR5J 3TUPA 2R7TA 1K0VA 1S59A 3H5UA 1D8YA 2J0XA 3GU0A 1URRA 4B3RF 4RWWA 3EUNA 1RJJA 3PKYA 1I6JA 1NZ8A 5DG7A 3EM1A 2MTLA 1HNWF 4NYOA 2MY7A 4FBTA 3E01A 1FK9A 4CLPA 4GVBB 1C4AA 1MWZA 2GO8A 1HR0J 3FUYA 2CIMA 5DJBA 2YNFA 2WW8A 1B7YB 3RBDA 4QYZJ 1KONA 1ZAXA 1KHWA 4K4ZA 3HP6A 4OHZA 4QCLA 4ECRA 4KE5A 4KKOB 4DR4J 3VQSA 3RB0A 2DNZA 1I94J 3K57A 1K44A 5KFNA 2FHJD 3M2VA 2FLNA 3G2XA 3NCQA 2HHQA 1QSYA 3E8OA 3GV8B 1RWXB 4YR2A 2HFVA 4OJHA 4FVCA 3E01B 3DHXA 4OHVA 3F56A 2UUWA 3I4PA 4OX9F 1YI2S 1X4GA 1D1UA 1DTQB 2YNFB 4YMEA 2Y3YA 2OEKA 4QBUA 2R7VA 4WF9Q 4QR1A 1Q95G 4R8UA 5L9XA 2XHWA 2YWHA 1ELOA 4YN3B 1NUEA 3ITHA 1K8AT 1ZH5A 2POKA 1F5CA 1GMWD 3KLEA 1JLFB 1UPPA 3SDEA 3P5TL 4CIOA 4BCAA 3S01A 2ZEJA 5E2QA 2Q43A 1U1LA 4O3PA 2Z2MA 2C3YA 1ZPVA 1NPPA 2HFSA 2MKHA 3MI7X 2UXBJ 3HVWA 2D41A 2AZ3A 4DF4A 4R8UB 2DIUA 2DHAA 3V4MA 4DUYF 3IFEA 3KLIA 3PEHA 3CT9A 3W63A 3AOBA 2FGCA 1V5VA 1W26A 1YVFA 1BQMA 3J80Y 5HMZA 4ZLJA 3MEGA 3SDEB 3G6XA 3CVKA 1T94A 3QGPA 4LSNB 1GT8A 1RTHA 4OYOA 1OY6A 2R2UA 4DX8H 2RE1A 4B17A 3BBBA 2BJ1A 2VKRA 1S0VA 3O6QA 1UVIA 4ZDNA 2WSFC 3DI6B 3DCAA 2ZZNA 4CO4A 3QRRA 4F3QA 4CLYA 1HNZJ 5BR8J 4PKDB 2PMHA 2HHUA 4LUBA 5F3TA 1G6BA 3KOAA 1DJ0A 1R8PA 3BQ2A 2FC8A 1LV5A 1NJWA 3KLIB 4KY3A 2FY1A 2AJ0A 3HKWA 1RI7A 1MROA 4YB1P 4BWMA 5AXLA 3T5KA 3IG1A 3PKMA 3W60A 3NGRA 4DZDA 2FDNA 3MM9B 1RHMB 3JSBA 3SI8A 1RTHB 2L3MA 4KBIA 3X1LB 3MMAB 2RU9A 5HQMA 1NJXA 4Q43A 4WP9A 2BW2A 2H9ZA 1JJ4A 2COLA 3SXLA 1VQ6S 2GNKA 4FF1A 3HDSA 4HHJA 2BE2A 3R5BA 3NP5A 4L75A 3CSKA 4GC7A 5E7OB 1WEXA 1B99A 3ZTPA 2LYVA 2BKNA 2VBZA 1RT4A 5KFAA 2VDHA 2QJ3A 3IG1B 1CULA 3EPGA 2IJRA 2W25A 3SSRA 2JVRA 4AL7A 1SL0A 1HNXF 4LF8F 3LOUA 4M5NA 5J2PB 1NK7A 4ZVFA 2PA3A 2K7JA 2X3GA 4RO0A 4EYHB 4OZ5A 4Z2XA 2ILYA 4EU0A 1O0PA 2WCXA 2BABA 3IAM9 1M1KT 4DU8A 5EGYA 4B3MF 3V6HA 3M9MB 2HNYA 1Q7LB 2C2OB 2B8PA 4ZLLA 5LSRA 3RJMB 4H54A 4ES3A 2R7XA 1RT4B 1S76D 5DZ7A 1CULB 3GJQB 4JI6J 1LKZA 1EKRA 1FXDA 3GPAA 3UNYA 4F25A 1TKTA 4P2FA 4IUFA 2EK1A 3FQKA 5B0DA 4QWAA 3Q2TC 2AEJA 4WU3A 4N41A 1KOHA 4ZPTR 2MZSA 2G0JA 1DAXA 4CI0B 1KD1T 3C6UA 5CA5A 2CQ3A 4C0BA 3G4SS 2V67A 2BBEA 2VKZG 3C3LA 3LANA 2B9EA 2DT9A 5I3QA 1RTDB 2O5DA 2ASYA 3TJAA 3MFHA 1MW7A 3RGIA 2U1AA 2KT2A 1XMOJ 2V94A 1YJUA 2JFKA 2HWHA 3KKFA 4N5SA 3TA1A 4ID5A 1P1LA 2BZ2A 2DRBA 1R8BA 4NZ6A 1CJTA 2DYAA 4PQAA 4V1Ak 1VRUB 3JXOA 5AXKA 3CD7A 2EPIA 3HHEA 2D7SA 4ED6A 2ZWOA 4DEZA 2BXJA 2MQPA 1KLMB 3CJSA 3IRXB 5DG8A 1XMQF 1X7VA 1WC0A 1T9UA 2X1FA 2C3MA 4RZRA 1PAUB 4ZVUB 5EWFA 5LSLA 4Q2MA 2WONB 1JNRB 4UQTA 1Q81T 4O3RA 4A47A 5KFFA 3Q23A 3DU5A 1S72S 1Q82T 2AU0A 4AQYF 3S8SA 1LWEB 1Z1ZA 4DQSA 3UDLA 3T1HJ 3D0GE 2IVMA 4LSZB 2OPQB 4ID5B 2W9CB 2EWHA 1OYDA 1CJTB 2FB0A 4JI2F 3EX7B 1SIZA 3KHHA 1VK8A 1QD1A 4P6QA 2BANA 4QYRA 3QNWB 4ZKAA 1X5TA 1FKPB 2CPXA 1ZM4A 5D77A 2ZD1A 3LGHA 4XTTA 3QWPA 4UY85 4XDCA 4IQMA 1R31A 2GMHA 4ELUA 3R5DA 3UR3C 1DTTA 1S7HA 1D0EA 1U8SA 1SC3B 5GAGU 1WOOA 2UV8G 4LRDA 4O0NA 2DY9A 3BV8A 2D9OA 4IFYB 3POTA 1TKDA 2GGPA 5FLXU 2DRAA 3VVUA 3MDFA 3HFKA 2MKKA 2BANB 4PG5A 3P96A 3ZFVA 1Q4RA 2E5IA 3TJ9A 3IP0A 2I6WA 1FFWB 9RUBA 1WG1A 4J9SA 5D4NA 5K8NA 2BW7A 1P27B 2JEGA 2ZD1B 2XB2D 4J91A 3HFVA 2H3EB 2QV6A 3ZZYA 2HWIA 5KFDA 2AYEA 2JEIA 1U7LA 2HHPA 2LA4A 4DBQA 3PIPQ 2J8SA 3DGPA 1DTTB 3EMTA 1FCAA 4DS5A 1AXQA 2GGPB 4QW9A 4OV1A 4CTAA 1TV6A 1F9HA 1FDDA 3IBFB 1RHQB 1XNRJ 4DU7A 3MEEA 2OJ3A 2A6OA 1F3VA 2XYGB 1RT3B 3EVWA 2CJYB 4DSLA 4AD6A 1FNXH 3TA2A 2XSFA 2AX1A 5IWAJ 2PFDA 3BDPA 3CJKA 1QSSA 3F41A 1HNWJ 2X51A 3ZXWA 3H0PA 1NK5A 2PEHA 1LK7A 2FJBB 1D8ZA 4CTAB 2H48B 1RU1A 1QUPA 3THPA 2RNEA 4HH0A 4PG8A 2JH3A 5GADI 1VI7A 1BUXA 2DEIA 1QTMA 4NA3A 2F4VF 5CZVA 5DDQC 1FERA 4Z7CA 2NZCA 2WW4A 2Z30B 3K5OA 4B9NA 4ZCMA 2PMZD 4RNOA 4X64F 4EO6A 2XMUA 1FO1A 2XLKA 3CJKB 2DITA 4W92B 2WSCC 1MMLA 2BQUA 3DRPA 3CC7S 2MZJA 5LMNF 2K3IA 4J9UE 3RZAA 4DR7F 4A8KA 1S79A 1R0AA 2B9WA 2VPYB 3PHEA 3MM8A 1SQGA 2Y1LB 1SIWB 5KFJA 1A6LA 1FX4A 1IR2A 2J9DE 4CYUA 3KG0A 2IAJA 2FVQA 3JQMA 3MECA 1T05B 5KT2A 1ZZFA 2QMXA 1EP4B 4OZ1A 1KBRA 4RL1A 3MM6B 3MR5A 4YUDA 3HF5A 2RF2A 3BR9A 5DZ6A 2VD3A 5KG2A 3QIDA 3VVTA 3EZUA 2MHEA 2YPZA 7FD1A 2KFYA 1ZBTA 1YJTA 2OAUA 3DRXA 2Q1LA 3M9OB 3K7RA 1BQNA 3DRPB 3MAHA 4PXEA 4Y34A 1HW8A 3C2PA 3I82A 4KIAA 1JJHA 5KT3A 1L3VA 1C0UA 5D78A 4NLQA 1DURA 1M5VC 2B3TB 3AOCA 4RW9A 4JI1J 3H2LA 4IFVB 3MECB 5DQGA 2BOPA 3MMBA 3CCSS 4LFAJ 2AEFA 2QL5B 1FE4A 1YRTA 1FEHA 4CLLA 5T41A 3SYZA 2IDLA 3NCRA 5DM7Q 3ZO7A 2ZVSA 1AUSL 4DPTA 1S10A 4WYLA 5KG5A 4LVNP 1XK8A 2FC9A 1UJ6A 1C0UB 3O1LA 2DGSA 3CCRS 3D6HB 1NHKL 2L9NA 2E9ZA 4DL7A 1BY9A 3ENWA 3CD5A 2XS2A 1VK3A 4U96A 2Z0GA 3M8SA 2DXDA 3B54A 2UUCJ 3QWUA 2QN6B 3PO5A 4HVZA 4QU7A 5CCMA 3D3CJ 1WF0A 2KDOA 3NAIA 1FRLA 2FJXA 1TL3A 2AV5A 2RQ4A 5GAEI 3GYNA 1VC0A 2I8EA 1SL2A 2GHPA 4NLDA 5C5JA 2CG4A 2XS7A 2AGQA 1XNQJ 3IXQA 2VFVA 2V9KA 3R7SB 4V19J 4OQJA 4GRSA 2FVRA 4C11B 3QZ8A 2WTFA 2OD6A 1IBMJ 2M5YA 2VG5B 2LDYA 3JSMB 2F8HA 4M5DA 4KV8A 1ZM9A 3B78A 3L7PA 3GIKA 4ECTA 1U0SA 1KDNA 4NRUA 5A8KA 2KG1A 4O4GB 2M0GB 2J0SD 3SCLE 2RT3A 3DOKA 1UCNA 3QJJA 1S1XA 3HO1A 2O66A 1HHTP 4DX6A 2ZWPA 2E5HA 1M1HA 4G1IA 1N4LA 4U8VA 2PMWA 1S6PA 4P72A 2LP4A 4F4KA 2ZVIA 1FRHA 2HEKA 1KVIA 3FBBA 3R5AA 3K5PA 3OLAA 2DNHA 2AIRB 3PW0A 3GCWP 3OV7A 3PRVA 5KFEA 4X4UA 1AW0A 4NYZA 5A6PA 4M5DB 4C8NA 4KV8B 3KJVA 4OLOA 1GXUA 1Q5VA 1SC6A 2M8HA 4CO1A 4DPXA 3THTA 4K5RA 3DOKB 5A0YA 3GG1A 1S1XB 2HHXA 2HHTA 2J7UA 4DUZJ 1I3OB 1EQ0A 4ZVEA 1ACMB 2NXNA 1S0MA 5LOQA 3D9BA 3LO3A 1HL6A 2V50A 3PFOA 3EPIA 4WFBQ 1Q78A 2JEFA 4I56A 3U1LA 2F5GA 2O01C 1RAAB 4ZCLA 2K06A 3CCLS 3J7YI 3V6JA 4DL3A 4I69A 2B9XA 1TK8A 2ZOGA 4JI3F 1RT5A 3NLCA 4BC9A 1UJ4A 4TY9A 3D68A 2NCKL 1RYRA 5E3CA 5A0YB 2YQ3A 5FJ4A 3RTVA 2DGXA 4Y2CA 3LALA 4I6WA 3J80U 4HEA9 1J5EJ 1GH8A 4WFAQ 4WU2A 3QSIA 4DX7A 4NXMJ 4DL6A 1GNKA 4F26A 6FDRA 3TAQA 5F8NA 3T19A 2IC3B 1OO0B 4AQYJ 2ZBQA 3G8TA 3O8WA 4G1QB 1RT5B 2V8DA 3OFEA 1RWPB 3CMAS 1Y5LB 1R0CB 1N34F 4M5IA 1VRTB 4O44A 3BO3A 1EAYC 4DV4F 3HZGA 1GMUA 1UEVA 2MPUA 4WKRA 1VQ7S 5IT0A 3N0VA 4CNZA 4K0KF 3I56S 3IO1A 2V5HG 3D1OA 1TQLA 2VQFF 2JSXA 3HSJA 2N3LA 1NK9A 4YOEA 4N77A 2NXCA 1S12A 2AZ1A 3QT8A 3OR1A 3ELHA 1EHWA 3ISNC 2ZKUA 2DKOB 2LQ5A 1R8HA 4O44B 4JI7J 2GJ2A 2DR7A 3FNNA 5F0UA 3QT5A 2ATLA 4K4YA 1OMSA 2IA0A 4I67A 1JK9B 3MPUB 4MIBA 1HQ2A 1BLUA 3DLEA 5KAKA 2JEJA 5E3PA 3K89A 2DHHA 1U6ZA 2EFQA 2FLLA 2KFZA 1HYSA 3I32A 2VFUA 3ENVA 8AT1B 2AYMA 3ZZPA 4Q2LA 5D15A 3CE8A 2ZH2A 3OR1B 1LW0A 1H38A 4OX6A 3NMAA 5K8MA 2V4RA 4C8MA 4A46A 2YNHA 2YKNB 3KHGA 4LSLA 3Q8YA 2JLFA 4M5LA 3M1VA 1RQ0A 4Y65A 2V69A 4LRBA 4JI8F 2B56A 1TUVA 1S1WA 3DFEA 2VF3A 4DV0F 2VBXA 2XNRA 3K8WA 5H9FJ 4JI5J 1JLQB 1VQNS 3OL6A 2ZBCA 3QAEA 4XPEA 3LAMA 4C8OA 2N7YA
chains in the Genus database with same CATH topology
4DN0A 5MAOA 4Q44A 4QPTA 5LJ5Y 1FKOA 1GQEA 2F8EX 2QRRA 3ZZTA 2M88A 2ZJRQ 1SKRA 4FP9A 1RDRA 2W4PA 2BRKA 2LVWA 3MPYA 2N82B 4ATNA 3VAMA 2I2YA 3H98A 1WEZA 4GC6A 3CWJA 3OXGA 1X9MA 2MY8A 4FN5A 2XMMA 1R0AB 1U25A 1F9FA 4LSLB 4OHWA 4DV6F 2R9LA 3MZIA 2DD8S 2FIUA 2PC6A 3CCQS 4IOAQ 3H4DA 3CCVS 3M1VB 1N5SA 3MM8B 2HRYA 4DMZA 3RBEA 2BDPA 2RVJA 5C24B 1U09A 1NK0A 2LXFA 4TU7A 4M94A 2I0XA 1M5HA 2QMWA 3WDOA 5HP1B 2QFJA 2AJ1A 2IM3A 1CQNA 4PG6A 2DIVA 3NRBA 2QA2A 3P6YC 3QAUA 5B0AA 1TK0A 5J2MB 1HBMA 4QIGA 4FF2A 6FD1A 5AJ3F 3C8YA 2IAJB 1S1WB 1HNIB 4Y28C 4J9PA 1RAJA 3R27A 4C3MA 2MKCA 5B08A 5KFTA 4FS1A 3IAS9 3UQSA 3H4BA 2YKMA 3M05A 3FDSA 4EEYA 1K73T 4WE1B 4HH1A 3H8YA 4X4RA 2WOMA 1RK8A 1S1TB 2RU3A 4X4TA 2RF2B 2J8AA 4QU6A 2KJVA 3M32B 4A8OA 1JMTA 3GE9A 4QPXA 1J5OB 1XR7A 3BZQA 1NH7A 1TL5A 1NAQA 4F4WA 4L72B 1HD0A 4V19X 5L1KA 3K5NA 2HS0A 2JL9A 3CPWR 4AUKA 3OUYA 4LIRA 3VAIA 2B6AA 3M8RA 2LQJA 2G1DA 3R3TA 2OPPA 2J5AA 3GR0A 3LP1A 1BQNB 1H2TZ 2DCUB 2VFSA 2R2RA 2CZVC 2RS8A 1FXRA 4K4UA 4AFFA 3O44A 2RQKA 2XMTA 4NZ0A 1HBOA 4HL9A 3MOZA 2GIQA 5DM6Q 4YHHF 2MZRA 2KXFA 1G1XA 3EXYA 2DGWA 4DSEA 4K4TA 4OJ3A 3NG8A 1HA1A 3DU6A 3V5RA 4FYDA 1XEZA 3FFIA 2GJIA 3PNIA 3T1YF 2B4UA 3I0SA 3KG1A 5HN0A 4PPZA 4DR2F 3KFWX 2AF6A 4RW9B 2QA1A 3TVZA 1V9OA 3NNHA 2YVSA 3BQ0A 3HKZD 3RRGA 3MM5A 1SXLA 2DB1A 1HQUA 3I9ZA 3GG0A 2PD1A 1RTDA 3IGNA 4DS4A 2YTCA 5IXUA 4EYIB 2CRLA 2F9JA 2P9GA 2YKMB 1NZAA 2OFHX 2R7OA 3MMBB 3Q0AA 2GQQA 1ZTTA 1LXNA 1FA0A 4WZQA 4MIAA 3TNVA 4RW6A 1Y5NB 3E51A 1KVJA 4DR5F 1JLEA 1UWBA 2A10A 1DQ9A 3N01A 5E3AA 4JV0A 1JJ2R 1IKYB 2C2EA 1W2BR 3HK2A 4C97A 1X8DA 2XG8A 2VG7A 1N5QA 3OUYB 1GXLA 4ZVGA 5IQ6A 1PC4A 2FVCA 5JUMA 2ZM6F 4OX7A 5A8WA 1JXLA 2KH9A 1NNDA 2HNZB 3PIOQ 1X4CA 1Q79A 5I3PA 4I0WA 2B0GA 4L3NA 1E6VA 1BWEA 5T14A 3DMJA 2ZC3A 2LU2A 1VRUA 2D3ZA 3FZBA 3M8QA 1VQ8S 2E66A 2JOQA 1HBOB 1NB7A 4H4KC 1WHYA 5DQHA