3I0SB

Crystal structure of hiv reverse transcriptase in complex with inhibitor 7
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 105
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0sB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB04
3JYTA 2RDIA 1DLOA 4NLXA 2JEIA 4IG3B 4WYLA 5K14B 3SI8A 1RT5A 3MR5A 2UVWA 5KG0A 4O3QA 2B6AB 4K50A 2HWIA 1D1UA 4YP3A 5KFZA 4ECTA 4IQXA 4ZP9A 4EO6A 5DG7A 2OPSA 3C6UB 4DL6A 1DTTB 4ED8A 4K4SA 1LW2A 5EUHA 4RNOA 2FJWA 4HYKA 4O4GA 3OL7A 4ED3A 3DRPB 3V6DA 4ED7A 1IKWB 5F8LA 3QIDA 1T94A 5KT3A 4J9OA 1S10A 5J2QA 1JLCB 3V6KA 3KK3B 1TVRA 2BR0A 3PW0A 2D3UA 2ZE2B 5JXSA 3Q8SB 3KLFB 4MH8A 2HNZB 2VG7A 4IDKA 4PUOA 2JEFA 1HQUB 2FVPA 1TQLA 3TVKA 3EPGA 4K4UA 5F8NA 4NLRA 4NLWA 3KK2B 1J5OA 4U6PA 2OH2A 1KHWA 3DOKA 2FVSA 4FBUA 1UWBB 1C2PA 1CSJA 2RKIB 5KG5A 3I0SA 2VG5B 4I2PB 2XI3A 1DTTA 2QV6A 3NMAA 2WB4A 3BGRA 3KLVA 1JIHA 1TKTB 3MFIA 5KFSA 1S6QA 4QWBA 2BE2B 1TKTA 4Y34A 4Q43A 3QYYA 3MR2A 3M9OB 1HNVA 2W9BB 4EBEA 4ZVHA 5I42A 1FK9B 5F8IA 5KFPA 2BANB 5FDLA 1S1XA 5KFUA 3M8QB 3M8PB 3V81B 3C6TA 4ZP8A 2W9CB 3V6JA 5T14A 4QW9A 3FFIA 2CJQA 1S1UA 3G6YA 3DRSA 3UR0A 2R2TA 3KLFA 2ILZA 2AQ4A 4MIAA 1ZTWA 4MIBA 3DM2B 4KE5A 5KFAA 5KFCA 3HVTA 5KT5A 4YMEA 5D3GB 4URGA 4RW6B 2AU0A 3MEEB 4JUZA 3DMJB 4IFYA 2FVRA 3V6DB 4RU9A 2CKWA 2C2RA 3OL6A 2OPQA 2W8KA 3KNAA 2OPSB 1LW2B 2R2UA 4F4XA 4GC6A 1KHVA 1HNVB 1QAIA 3H5SA 3G6XA 1S9EA 1RT1B 4IRDA 2WONB 3QO9B 2YKMA 1OS5A 3QGHA 4ECQA 4HKQA 4K4WA 2ASDA 4K4TA 4LQ3A 2YKMB 4OL8A 4O3OA 4ID5B 2HAIA 4YR0A 1T03B 4WFXA 3KMQA 4WYWA 3VQSA 3DRRB 1C0TB 2XI2A 2GIRA 4NLYA 2V4QA 1S9GA 3ISND 5DGBA 4IG0B 4NRTA 3I5AA 4M95A 3DMJA 2YNGB 4JV2A 4MK8A 3DLGA 2DPIA 4QWCA 4KSEB 5J2MB 1T05B 2XGQA 3KHHA 3PW2A 3OHAA 3OSPA 3UPFA 4NLSA 4TQSA 3EPIA 2ZD1A 1JLGB 5KFTA 3GV5B 2D7SA 5I3UA 5DGAA 3OLAA 3LP1A 3MEEA 4TQRA 3GIKA 2VA3A 3BQ0A 1IKVB 1VRTB 5J2PA 1N6QB 2ZKUA 3BSOA 1S1XB 3MEDB 3CJ5A 4TY8A 4GC7A 4H4MA 3MECB 4LSNB 4NLVA 3CO9A 1IKXB 2W9BA 4QWAA 1EETB 1S1UB 1W25A 2R2RA 2VG6A 2WRMA 3CJ4A 3IN5A 1HYSA 4K4ZA 3C6TB 1JLEA 3M8QA 3M8PA 4DL5A 1BQMA 1MMLA 3IG1A 5KFWA 5K14A 1NHUA 4TXSA 3ITHA 3CWJA 3E51A 4IH5A 4YQWA 2DPJA 1ZTTA 4QWEA 3KJVB 5DG8A 3CDWA 3KOAA 4KKOB 1S9FA 1HPZA 4DL4A 3KLHB 1SH0A 3KLGB 2AX1A 2I1RA 4ECWA 1RT3A 3NAIA 2WTFA 2YNHB 1RT1A 1JLAA 5KFDA 1C0UB 2OPRA 5J1EA 1TKZB 1RA6A 5KFOA 4FBTA 2C2DA 2HNYA 4I2PA 2FVQA 5L9XA 3MECA 1S1TA 3RAXA 5KG2A 3KHLA 3MR6A 5L1KA 2IM3A 3M9NB 1VRTA 1N6QA 4KHRA 1JLQB 1S6PA 1D0EA 2IA6A 4PWDB 2JC0A 5J2PB 3T5HA 1C1CA 4IR1A 4PUOB 1FKPA 5KFXA 2HNZA 1KLMB 3UQSA 3G86A 3DOLB 3M9MB 4F4YA 2J6UA 3V4IA 3KLEA 4ZPBA 3GV7B 3RB4A 1XR7A 3GQCA 3H5UA 2UUWA 5CYMA 1TVRB 2GIQA 1RT2B 4ED1A 4YR3A 4EYIB 3H40A 3RB6A 1TV6A 2OPPB 1JX4A 3E01A 4U7CA 3SFUA 5C42A 3IS9B 4I7FA 1HPZB 4B3OA 3G6VA 4KKOA 1EP4A 5C24A 3JSMB 4G1QA 1EP4B 1MU2B 4O44B 3QGGA 2FJXA 2B43A 4MK7A 5KFKA 4RW7A 3PVXA 1DTQA 3H5YA 2J6TA 5HP1A 3GILA 1IM4A 3LAKA 3FRZA 1WNEA 1GX5A 4IR9A 1BQNB 1S49A 3TAMA 1EETA 2C28A 1SV5B 4H4MB 1RYSA 3MEDA 4M94A 3LP2A 4KHMA 4TY8B 3LALA 3V4IB 5EWEA 2FLPA 2VA2A 3OSNA 3CJ2A 5C25B 1K1SA 1KLMA 5KG7A 2UVRA 4DG1A 3H98A 2HWHA 5KFMA 2W7OA 1C1CB 1HQUA 2FVCA 1HNIB 5DQGA 2XCAA 1S1VB 5KFEA 4EBDA 1IKYB 4R5PB 3DM2A 2C2EA 3KK1A 2XC9A 3FDSA 3PW4A 4WXWA 3DRSB 1SH3A 3BREA 3ICLA 3BJYA 4F4ZA 2O5DA 4IOBA 1HARA 1TKZA 3Q8PB 1JKHA 4ZVFA 2YNHA 2FLNA 3MEGB 3V6HA 1RT3B 4EBCA 4K4YA 3KLGA 5KFFA 2W8LA 4J9QA 4I2QA 3DLKA 4K4XA 4Y3CA 3D5MA 4TYBA 3IRXA 1SV5A 4O3PA 3TAMB 4KBIA 5KFYA 5L1JA 4XO0A 4J9MA 3MTKA 1T03A 3H4DA 3CJ3A 4FS1A 1RTDA 2UVVA 1RTIB 3NGDA 1VRUB 5HP1B 3BSCA 3PW5A 3NL0A 2IM1A 2WONA 3QO9A 1JLEB 1RTIA 1S9EB 3PR5B 2I5JA 1Z4UA 2BQRA 3OL9A 4F50A 1JLBB 3FQLA 1HMVB 5KFBA 2JLEA 3MFHA 3I0RA 3LP0A 2W9AA 4WE1A 4ECRA 2E9RX 5J2NA 3IGNA 5DG9A 3HVAA 4RNFA 4WZQA 3I5BA 3HHKA 3DOKB 2BRKA 2ASLA 1LWEA 1UWBA 2E9ZA 3DYAA 4KV8A 5KFGA 3D28A 4RNMA 3PR4A 2JEJA 3KK2A 1J5OB 5D3GA 2YNIA 4IDKB 1FKOA 5KG1A 3QZ7A 2IBKA 4TLRA 4ZPAA 1TP7A 4LSLA 1LWCA 2RF2A 3HVTB 1NHVA 4H4OB 1JLGA 3ISNC 3KK1B 4O3SA 4XPEA 4G3IA 2RF2B 4KAIA 1S1WB 4NYZA 5KT6A 5KT4A 2V9WA 1JLFB 3RBDA 5J2QB 2AGOA 5J2MA 2R8KA 5HBMA 1JLAB 3TQ1A 2W7PA 3DRPA 2YNFA 4RW8A 1IKWA 1U09A 1S6PB 3KHGA 1S0MA 2BANA 4O4GB 5FDLB 4ZPDA 4ECYA 5J2NB 3PZPA 5I42B 3I0RB 2IJNA 5KFNA 1N48A 1BQNA 3BSNA 4J9PA 3LP0B 4ID5A 1JLBA 1RT7A 2BQUA 2HMIA 2I5JB 1SUQB 4ECXA 1HYSB 4NLOA 1HQEB 1RT5B 4ECVA 2ASJA 4RW4B 3GIIA 1S48A 3I5CA 3ITHB 2VG5A 4I2QB 2R8HA 3SFGA 4Q45A 2RKIA 3FQKA 3OLBA 3E01B 4EYHB 2IC3A 1JKHB 3LANA 4RW8B 4RNNA 3Q8QB 4IFYB 5HBMB 3LAMA 4ZP6A 3GV8B 3QIPB 3NBPB 2BRLA 4MKBA 3T5LA 2R8JA 3UDLA 4DL3A 1S1WA 1TL1A 4Y2CA 4LQ9A 3DLEA 3QLHB 4Q0BA 1JXLA 2ZE2A 2B5JA 5F8HA 3KHRA 5HLFB 1JLCA 4PQUA 4DG1B 1T3NA 4URQU 5JUMA 4O3NA 4PWDA 3T5JA 4J9NA 4KV8B 4KO0B 1S97A 2D41A 1S9GB 3MF5A 4J9LA 5F9NA 2C22A 5KG3A 1C0TA 4WFYA 1TL3B 1QUVA 1T05A 2WHOA 3T5KA 1HMVA 4R0EA 3DLGB 2IMWP 1REVB 2YNGA 4RW4A 1RA7A 2R8IA 1RTJB 3RBEA 1HQEA 2B6AA 4DL2A 2AWZA 2ILYA 5CYQB 4R8UA 3KLHA 4Q44A 3H5XA 1DTQB 5KFRA 4IG3A 4O44A 2FJVA 4XPCA 2V0NA 3HVWA 1MU2A 1DLOB 4J9RA 5C24B 3JSMA 4NCGA 1GX6A 5EWFA 2V4RA 5C42B 2IM0A 3DLKB 1N5YB 4B3OB 2OPQB 3MEGA 4ECUA 4ICLA 1RT6B 4MFBB 5HROB 3CIZA 2YNFB 4ED6A 2VG6B 3RB0A 5DLFA 4RUAA 3FSIA 4JV0A 4F4WA 2FLLA 1YVFA 2B5JB 3BR9A 4LSNA 1TL3A 1LW0B 5KT7A 2UVUA 4KO0A 4ZP7A 1FKPB 1XR6A 4RW9A 4PQUB 1HNIA 5F9LA 4IFVB 3KMSA 4RW9B 4FS2A 3EZUA 4URSA 2IC3B 5C5JA 1LWEB 5F8MA 1RYRA 3T19A 5KFQA 3OL8A 4IH6A 4Y2AA 3QGIA 4NLTA 5DQIA 4ZHRB 4X2BA 3QZ8A 2AGQA 2HNYB 2IAJB 1RT4A 3C6UA 1S1TB 2OPRB 5J1EB 3CJ0A 4ZVGA 4ZMMA 4KB7A 5KFIA 5L1LA 1S6QB 4RW7B 1XR5A 1VRUA 4G1QB 4NCGB 4ED2A 1RTDB 4YR2A 4NLDA 3BGRB 4ED0A 4JV1A 3DDKA 4TN2A 3IRXB 2IM2A 4ZVEA 4WXOA 3BQ1A 2HNDA 2EC0A 3RB3A 5KFJA 1RTHA 3DI6A 1BQMB 3IG1B 2BE2A 2WOMA 3BSAA 4EEYA 2ALZA 2HMIB 3IGVA 1QE1B 2R2SA 4QW8A 5KG6A 3MR3A 1RTJA 1TV6B 2OPPA 5F8JA 5F8GA 4NLPA 2GC8A 2AX0A 1IKXA 2VG7B 1RT2A 3KLEB 4ZHRA 4QWDA 4DEZA 2IAJA 3H4BA 3H2LA 4QPXA 2E9TA 4MKAA 4NRUA 3DOLA 4LSLB 3NAHA 1IKYA 1NNDA 4IFVA 4R5PA 1FKOB 2BQ3A 2YNIB 4RW6A 4NLGA 2D3ZA 5I3UB 3DYAB 1JLFA 4IRCA 4ECZA 1C1BB 3GIMA 2WCXA 1JLQA 1N4LA 4NLQA 3BQ2A 1ZETA 1S0OA 1K1QA 2R8GA 4Q8EA 4H4OA 1LWCB 1TKXA 1R0AA 2JC1A 2J6SA 1C0UA 2QE5A 4H54A 4IH7A 3GYNA 3N6NA 1RT6A 4MFBA 2WOMB 4ICLB 4ZPCA 3V81A 1RTHB 1QE1A 3DI6B 5HROA 1N5YA 3OHBA 1FK9A 4NZ0A 1RDRA 5DQHA 4EO8A 2HNDB 4J9SA 2YKNA 5KG4A 3DRRA 3JYTB 1S4FA 2YKNB 1RAJA 3NKYA 4MK9A 3T1AA 5EDWA 4RZRA 2RDJA 3RAQA 4IRKA 3IS9A 4I7FB 1SUQA 4KFBB 1RT7B 5CYQA 4R8UB 5KFHA 1REVA 5KFVA 4TYAA 1RT4B 3N6MA 4NLUA 3I0SB 3KLIB 5CYMB 2IJFA 4O4RA 3PJXA 1TKXB 1R0AB 3CDEA 3N6LA 5DLGA 3GIJA 1N56A 1IKVA 1SH2A 5EWGA 2XCPA 1C1BA 4IKAA 5KT2A 2WK4A 3Q8RB 2AGPA 3PW7A 4DL7A 3LP1B 4TY9A 4J9KA 3CVKA 5HLFA 5L1IA 2UUTA 3PJWA 3DLEB 1LWFB 5C25A 4Q0BB 2XWYA 1TL1B 4RUCA 2F8EX 1LW0A 2ZD1B 3QLHA 3LP2B 2ATLA 1LWFA 3NBPA 3HKWA 1S0NA 4WZMA 4Q8FA 3KK3A 2JEGA 1S1VA 3QIPA 4K4VA 2W9CA 5KFLA 1QAJA 3FFIB 4O3RA 4IG0A 4KFBA 4RNHA 3PHEA 3H59A 2XGPA 1I6JA 3CDUA 4ECSA 4WFZA 4WE1B 3KJVA 3KLIA
chains in the Genus database with same CATH superfamily
1TR0A 1WSVA 4PAAA 4AL6A 5K14B 3SI8A 1X4GA 3MM9A 1RT5A 4W90B 4GVLA 3GP9A 3ZTSA 5BJRA 2B6AB 3PJ9A 4K50A 2B51A 3HZEA 3M2UA 3UDVA 4IQXA 1QJHA 4UUXA 2IJRA 4EO6A 1LK5A 2CJ9A 1DTTB 4ED8A 4DL6A 1LW2A 3W9JA 4NYOA 3W64A 1Q81T 1FEEA 4I64A 1UZHA 3HHLC 4YEAA 2IY5B 1RWUA 1B7YB 3KTQA 3BGFA 1F60B 2CG4A 4LF5J 1T94A 3NGUA 4N5SA 1N36J 5J2QA 5A2QU 1KR4A 1SC1B 1UKUA 3NS7B 3D4JA 1JMTA 2VIHA 2ZE2B 4LRCA 5JXSA 4ZJLA 3Q8SB 2HBRB 3VAJA 1N34J 3N5BA 4RL1A 5DJBA 1TAUA 3KLFB 1SKSA 3FGVA 4UZBA 3VQTA 1RAHB 2BM0A 4PUOA 4HHHA 3MPDA 1HQUB 4OHYA 3EPGA 1ZPWX 1EQ0A 3MUTP 1V5IB 1KOHA 4O23A 4U6PA 2OH2A 3CMES 2FVSA 2XQCA 3FBFA 2KJWA 2HK3A 2KL8A 2O3DA 2RKIB 1TTHB 4I6YA 1VC5A 1MMDA 3T1YJ 4DFPA 2VOOA 1CBKA 1YZ6A 4I2PB 3AFGA 2RDDA 3U1MA 1KQSR 2OUGA 2Z2ZA 4TKTA 1F6TA 1P27B 2DGUA 5KTQA 4YY3J 1TKTB 2AV5A 1CS4B 3KLVA 5HQMA 1NRKA 3MCMA 4QWBA 2BE2B 2XO6A 1CQMA 2RAQA 3PV8A 3MXHP 1X4DA 5BYSA 4Q43A 4DUZJ 3ILLA 2W9BB 4EBEA 3MCNA 4ZVHA 1Q8BA 3NMRA 5C2GA 5F8IA 4LBHA 2V8VA 3C3LA 2YVSA 3AD8C 1DBDA 3C6TA 5A6PA 5J1PA 2MSTA 2M2BA 3NS5A 2EFQA 5F41A 1X9SA 4K59A 4KPCA 3QGPA 3BBCA 1U2FA 2ROPA 3LO3A 3LOUA 3CMQA 3VAIA 5DDRC 3OXFA 4MIBA 3X3UA 3DM2B 1FRJA 5KFCA 2UUCF 3HVTA 1HD1A 5AJ3J 5D3GB 2BE7D 5AXNA 3AOAA 4RW6B 3CC4S 4OHWA 4IFYA 3GG1A 3R6LB 2FYXA 3TAPA 2CKWA 2VB6A 1WUUA 1RADB 4P6QA 3OL6A 2OPQA 4HTJA 2ZH5A 3UD3P 3M6XA 2MLYA 3KNAA 2GCFA 3KXDA 2DH8A 4OYBA 2R7SA 1OPIA 3EVWA 2HFSA 3KG0A 4X65J 2CQBA 2UP1A 2ZKTA 3G6XA 2MHEA 1MN7A 4S0MA 1S9EA 1UA0A 3UD4P 4IRDA 2WONB 3QO9B 1PC4A 3HP6A 3VGSA 4QU7A 1CLFA 4DFJA 4HKQA 1TL5A 2AD9A 2ASDA 4PR6A 4OL8A 4B3TF 1U1LA 5IT9Y 2ZM6F 2JRSA 2OI2A 5F3TA 1ZA1B 1T03B 5IT0A 2VJUA 1YHQS 2OIHA 3KMQA 3HVRA 4USUA 1S76D 3DRRB 1C0TB 1JXVA 2HZCA 2ZBRA 3HULA 2V4QA 4L3NA 4CIOA 1N54B 1OWXA 4KGXB 5DGBA 3S1TA 3DMJA 2YNGB 1DY3A 3RZAA 4MK8A 4P2MA 5LXRA 4ZPTR 3UCUP 2DPIA 1RHUB 3PYGA 5J2MB 3RG6A 2XZTB 1O0PA 4DV4J 3JQJA 4J5OA 2LECA 1Y9OA 2Y1JA 4B3SF 3UPFA 5L9NA 3C14B 1FJEB 1HWJA 1EQMA 1V3ZA 2JX2A 2V2ZA 2K1RB 3IXQA 5DGAA 2MZRA 3K5PA 2CQ2A 4NWBA 2BBEA 3OLAA 3LP1A 2B7CB 4X64F 3BKTA 3MEEA 4EGLA 2PEHA 4UT4A 3JTNA 2E5LJ 2VA3A 1S4EA 1UEVA 1VRTB 5J2PA 4P7TA 4ZCLA 3BSOA 2PT0A 1U1RA 4AUKA 2KKHA 4F8RA 3R2DJ 3MEDB 2CG8A 3CJ5A 4WCEQ 3HFZB 4H4MA 2G2ZA 4D3GA 4YS2A 7AT1B 3R1HA 1X9MA 3CO9A 3J7A1 4DR6F 2W9BA 1B7FA 1DFDA 4OZ1A 1NSAA 4CO2A 1S1UB 1W25A 2W2NP 2QMWA 3CJ4A 3GIRA 1HI1A 4PG8A 4LFBF 1JK9B 3C6TB 1JLEA 4BWJA 3C2PA 5K8NA 3IG1A 1MMLA 4KGVB 3RR7A 5K14A 2MGZB 1CC8A 2CZ9A 3MMAB 1BD6A 3E51A 2FHKA 3MCOA 3W7BA 2BUNA 2XYGB 2LQ8A 3MM6A 3CDWA 2FGCA 4KKOB 2EKNA 5CCMA 1SQEA 1PBUA 3KLGB 1VBXA 3NAIA 1MNEA 2WTFA 2RVJA 3LGNA 4MYTA 1JLAA 4ES1A 1WI6A 4USMA 5KFOA 1T11A 3W62A 3TA2A 1BC6A 2C2DA 4DQPA 4I2PA 4K2JA 5L9XA 1RBAA 1S57A 3QFWA 4CLSA 3H42A 2MZJA 3MR6A 2IVMA 1YBTA 2IM3A 3M9NB 4ZCMA 3ENVA 1VRTA 3O2IA 4WP8A 1D0EA 3T1HF 4EU0A 4PWDB 2UUAF 4AL7A 1CJUA 4AD6A 5FLXY 4V19J 2DHXA 3T5HA 3OFGA 1IBKF 1C1CA 2UZAA 3MWBA 4UQGA 3I82A 1SIWB 3G86A 1VQPS 3DOLB 1Y3JA 4F4YA 2J6UA 2HHUA 3V4IA 5IC6B 5LM7E 2VKZG 2OTLS 2LMIA 1TVRB 4ED1A 3RB6A 2F8HA 3M8YA 2UV8G 1WTFA 3DRXA 4QIFA 3ULHA 3PIPQ 2XLKA 2B8QA 4JI2J 1XN9A 2ZNZA 3MMCA 5C7PA 4U7CA 3SFUA 5C42A 2DK2A 4I7FA 3O3LA 1ICEB 4LR8A 3ZTPA 1S5ZA 2EC2A 3MMBA 2NUUG 4C11A 1EP4A 2B4VA 4NA1A 1ZZFA 5EN1A 2HBZB 4JP8A 2UU9F 2AW0A 2MZSA 5M2RA 4MK7A 1GTEA 3VR1A 2FGOA 5KFKA 2HHQA 2J8AA 1DTQA 2QMUB 4N7TA 3H5YA 2J6TA 3VV2B 2FHMA 3FRZA 3HI9A 4IR9A 1EETA 1KN6A 4RKUC 3Q8UA 1Y5LB 4B3MJ 3ADAC 3MEDA 4M94A 2HBQB 2LU2A 2VPWB 3LALA 2FLPA 3LTOA 5C25B 2DHAA 1Q53A 3MPUB 3S01A 1RLDA 2OO4A 1NDPA 3ISZA 2BJ8A 4I56A 3H98A 2HWHA 5KFMA 2UVRA 2FVCA 2E5JA 2VBYA 5DQGA 4DV5F 1AYEA 3EDRB 1RSCA 2D3O1 5AE2A 1NSPA 3QNWB 4H4KC 1ULRA 3VGVA 3ZFVA 4ZITA 1UVJA 2HVDA 3KK1A 4PWUA 5AE1A 2CIMA 4GO5X 4WXWA 3PW4A 4LRAA 3N01A 4FZVA 2NSBA 3OR2B 2HFVA 1SH3A 3BREA 4P9SA 2GS8A 3UD5A 3BJYA 2VJVA 1Q8LA 1X5TA 1FRXA 2O5DA 2YQ1A 4QR1A 3Q8PB 4ZVFA 2MQQA 2QLJB 4WK3A 3TEGA 1T9YA 1XMBA 2QFIA 1ZBTA 1OYEA 5HMXA 4EBCA 3V6HA 2AIRB 5KFFA 2D1CA 3DLKA 4DL0C 4K4XA 2QMXA 3ILIA 3QWUA 1FI4A 2HQIA 4O3PA 5L1JA 2VL1A 5A8RB 4P72A 4OJ3A 1OY6A 2MY7A 1RTIB 1VRUB 5HP1B 1PG5B 1FFSB 3BSCA 3IA0A 1HNWF 3NL0A 2WONA 3QO9A 3BGLA 3PR5B 1WELA 4F50A 4USVA 3MMJA 2MDAA 2JLEA 4X4VA 3LP0A 2W9AA 2E9RX 1WTBA 5DG9A 4UQTA 2HFUA 3ILOA 2WSCC 1YJUA 3HHKA 5CA5A 3DOKB 2VFTA 1VK3A 1LWEA 3NOGA 4LF6J 5F0WA 2RRNA 1RZMA 1WI8A 2GMJA 1K44A 5KFGA 1J5OB 4Y0FA 2YNIA 2NXJA 2MKJA 1FKOA 4CH0S 1RWPB 1WC6A 3QZ7A 4LSLA 4F02A 2VODA 1NO8A 5D4LA 4XPEA 4G3IA 2V9WA 2V5HG 3QT6A 5HMZA 3RBDA 5HBMA 1U1NA 1F9FA 1JLAB 2VQEF 2Q6BA 1YLXA 1RU1A 3TQ1A 1S0MA 1IQTA 1S6PB 3NG8A 4FVCA 4O4GB 1REGX 2HIYA 2GJIA 4NXNJ 3RBEA 1U26A 3I0RB 2ACMA 2IRYA 4TU9A 3PIOQ 3CCUS 1FDAA 1BQNA 3BSNA 1KTVA 1RWMB 2PI5A 5M2PA 4OI2A 4ID5A 2CUYA 4AT1B 1RT7A 2P9CA 2HQFA 1HFEL 5I4MA 5DM7Q 1KSPA 1HQEB 1H2TZ 3K17A 4NX9A 1VFJA 2GV1A 3PKYA 1S48A 2VC0A 4B9LA 3K5NA 2AT1B 2VG5A 3ET6B 4ZOSA 5LJ5Y 4RR5A 3SFGA 4DPWA 2J0WA 3O5TB 2OKQA 3FQKA 3WX4A 3O6QA 4G1IA 4OLPA 2PFFB 3BBBA 4DCPB 2MKYA 3LAMA 4ZP6A 1U1QA 2X3DA 2VHGA 5GAHI 2AZ1A 2XSFA 3NBPB 1WC5A 3T5LA 1ZYQA 3FEYB 3RRHA 2KI2A 2VASA 3J7ZT 1NUEA 2CQDA 5D4OA 2G9OA 2OFGX 4ANEA 1UVMA 3D6FB 1EARA 3K0JA 2HVEA 1P6TA 2HQDA 5F8HA 3R6GB 3RBZA 2DT9A 1MWQA 3M1VA 1CJUB 3PX4A 1HL6A 4URQU 4O3NA 1GXUA 1Y11A 3CD7A 1U45A 4Y28C 2CQ0A 2CQ4A 1A0OB 1ACMB 1OQ3A 3M2RA 5KG3A 3M2VB 1SJ1A 3K5MA 1TL3B 1QUVA 2PIIA 1V9OA 3OT9A 4WKRA 1VISA 2I2YA 3HF5A 1HW9A 2W2PP 2LVWA 1S72S 3IO1A 1HA1A 2ILYA 3HD1A 2PN6A 2YQ3A 4E98A 4YFUA 2PI4A 2DEJA 4RPFA 3THTA 1TK0A 4ZLLA 4C8LA 2K2PA 1Q4RA 1T3OA 1DLOB 2JDJA 4UOFA 4C11B 2HYIB 4OHXA 2F8MA 4NCGA 2RQ4A 5EWFA 2V4RA 1RK8A 1HKAA 1V3SA 1UAWA 2ROGA 2YTCA 4Y6IA 2GJFA 4BWMA 1VLOA 5LSOA 3W9IA 2J0QD 2DRAA 4MFBB 2Y1IA 4WFZA 1VC6A 2YNFB 1VJWA 2GGPB 2VG6B 2APOA 3CNQP 3RB0A 5DLFA 5FJ4A 3Q8YA 2BJ3A 4EZ9A 1YVFA 1WF2A 2CQCA 4DV6F 4F2SA 1APSA 4LSNA 1TL3A 3DCAA 1LW0B 2HFNA 1G1XA 2UXBF 3M05A 2YX1A 4P2FA 4D3HA 4F67A 5IM0B 4CQ1A 3AB2B 3D54A 3CW2C 3GJQB 2FB0A 4RU2A 4PQUB 4USTA 1HNIA 2LXUA 4QIWD 1VGYA 5CABA 4RW9B 3KMSA 3H25A 1AZSB 3EZUA 3OR1B 5C5JA 1QAYA 1ZM3A 4F3MA 1I51B 2GHWA 2FY8A 3H2VE 1RYRA 3HT0A 4FDFA 2CPHA 1S1TB 4ZIVA 2Q66A 3CJ0A 3QAEA 2A3JA 3ZZTA 3GFZA 1S7HA 4ZVQB 2AP6A 4RW7B 1XR5A 3UR3C 3TARA 5LT5A 2H4WB 4MYUA 1HBNB 3FZBA 4QOTA 4JV1A 3HFKA 4XK8C 3GSIA 4ZPVR 2EBGA 2RT3A 2FTRA 2HIQA 4EUVA 2IM2A 2XS5A 1OO0B 4ZVEA 1FTRA 1FA0A 1EAYC 2HNDA 2EG2A 4WXOA 1VI7A 3RB3A 2ZVIA 4USIA 4PXBA 1BQMB 2EC0A 2KTQA 2R2SA 1FRHA 4TU7A 5E3CA 4AXJA 3PYEA 2E66A 5F8GA 2BKPA 5K8PA 2ZEJA 1LXNA 3U1LA 5LOQA 4FF3A 4DR1F 3ZTRA 1WC4A 4ZPWR 3EXCX 2BKNA 3M2RB 4F3QA 1E6VA 2DVIA 3DOLA 2DEIA 4LSLB 3AY0A 3NAHA 1IKYA 1NNDA 1P9QC 5IQQA 2HLUA 3D3CJ 3TVYA 2A6OA 4C9DA 4RW6A 2CYYA 2D3ZA 5I3UB 4OYZA 2IPOB 3FCVA 1F5CA 1ZM2A 1VBKA 2OSRA 2QRRA 3IM9A 2KFYA 1JLQA 2YKQA 2P6TA 1ZETA 1HWLA 1KD1T 1FJCA 5A8WA 3ZZ0A 1XQIA 1T7PA 2MJUA 1C0UA 1YJRA 3M4XA 3PXGa 1K73T 2UUBF 2VPXB 3N6NA 4A8MP 2CQIA 3VZIA 4DUZF 4LF6F 1RT6A 3CGIA 3OTDA 2WOMB 3D7SB 5LJ3Y 3V81A 3DI6B 3R5JB 2C42A 1N5YA 1RWXB 4NZ0A 5H9FK 1Q0NA 4EO8A 5H9FJ 2V4JB 2PE8A 1WKLA 5KG4A 3HHNB 4X4NA 3JYTB 1S4FA 3CD5A 3L9ZA 4LBIA 4OYIA 4ZVOB 2YKNB 1GTHA 5EDWA 3T1AA 3C15A 2X3GA 1CJTA 2FZCB 4RZRA 2RDJA 3IS9A 2YX7A 2V68A 3QJPA 4L76A 4NASA 1RT7B 4C8YA 2CQPA 1N0UA 5KFHA 3I56S 3CCWA 3G87A 3DRYA 1UW9A 5JMNA 1RT4B 1W2IA 2O01C 2YWGA 4X62F 4DQSA 3I0SB 3P3DA 1KQFB 3PRVA 4O4RA 1MSWD 3PJXA 1VCTA 2P8IA 4L75A 5IXUA 1IWGA 5DLGA 4A8KA 4ENOA 3A3PB 1XJWB 1SH2A 2O1PA 2XCPA 4PWWA 3O44A 2M3DA 2ZFHA 3PW7A 3LP1B 4TY9A 3F44A 4RUHA 5HLFA 5ETOA 4ANCA 2VQEJ 2ATCB 2OMLA 3CC2S 3CDBA 5AXLA 1GMVA 3QLHA 2ATLA 2W7AA 4WBFA 3V4MA 3J81j 2BYCA 1B64A 4WZMA 4Q8FA 3KK3A 2KO1A 4JOUA 4TU8A 5IV3A 1GQEA 1QAJA 2OFHX 3VVTA 2DNRA 2XULA 3UN5A 4OZNA 1X4BA 3PHEA 1SC4B 3I4PA 4DR7F 1I6JA 4Y2IA 5HVFA 1QTMA 4AYBD 4WE1B 3H2UB 1UVNA 2DH7A 2JEIA 3A12A 2R7QA 4J90A 2DITA 1RBLA 2GQ2A 2X1GA 3J7YU 2O66A 3OJSA 3MR5A 1QY7A 2C3YA 2KVQE 3W61A 4YP3A 4ECTA 1U2CA 3NLCA 1IQZA 4C8MA 5CD4H 1MROA 2K7JA 2AHOB 3GJTB 1W2BR 4K5SA 1XNRJ 2KRRA 1MW7A 3CJTA 1RCOB 2F63A 3SIPB 4RNOA 4O4GA 1Y0HA 2HVHA 2GHVC 2H54B 5BXIA 5K8MA 4ED7A 2A1BA 1DZ5A 1IKWB 4NMXA 3JAMY 2RU3A 1OY8A 1N0VC 2A6MA 3HM9A 1JLCB 1GH8A 3KK3B 1TVRA 1KVKA 3H20A 4U7UK 5LMUF 3PW0A 3U27A 1XERA 2J9DA 1UMJA 2C3PA 2VQFF 2CQGA 2P6SA 4CO4A 4ILMA 1N52B 1JNZB 2XHCA 2IMOA 2J9CA 2C2NA 3OTBA 3VHQA 1XC9A 4JI5J 2EWHA 2VG7A 1RWWB 5FLXU 2FVPA 3TVKA 4R0JA 2RS2A 2EKYA 4OV1A 1KHWA 2XMVA 4FBUA 2DNYA 2NCKL 3D1OA 1CSJA 3L95X 1E6VB 1R6YA 4P73A 3G6ES 2DNOA 4WIQA 3I96A 5KG5A 3I0SA 2P5VA 3J81Y 1DTTA 3AQOA 4QJVA 5HQLA 2ASYA 3BGRA 1N32F 2LLZA 2XO7A 1Y5IB 3N79A 5GADU 4JI3J 4EK2A 4OX9F 5B0DA 2YPZA 1PAUB 4FYWB 2QL7B 4A8YA 4YDXA 2L48A 1X0PA 4Y34A 3SDEB 2CPYA 4DJBA 3ZZYA 5H1SV 2R7RA 5T41A 2IDEA 5A8KA 3PX6A 4A8SA 3QSIA 4Z37A 4PRFA 3MURP 1FK9B 2DY9A 1E6YB 1Q79A 2QL5B 3M8QB 3M8PB 4W4MA 4M63A 3V81B 3HSGA 3IM8A 2R9LA 3BO4A 4I67A 4K7QA 4QW9A 3FFIA 2GVDB 4UY85 1S1UA 2RQMA 5GAEI 3HSJA 3DRSA 1RAFB 2COLA 3ELHA 3OD2A 2R2TA 2IRXA 4LT6A 2ZJPQ 1ZTWA 2CQHA 1R8HA 1TL7A 3AOBA 3C46A 5KT5A 2M4MA 3PEHA 1HHQA 3GE9A 4KIAA 1F5AA 3M32B 1ZAWA 4YMEA 5ETNA 4URGA 5HVGA 3FSXA 3TZWA 3CULA 3R2CJ 3C8YA 2HHTA 1Z2ZA 3HCXA 2W01A 2LQ9A 1M5SA 4WP9A 2NYIA 2VH7A 2W8KA 3PM9A 1KRPA 2ZHOA 3R1LA 1X4EA 1NEEA 2R2UA 2KVIA 1L3SA 1U6FA 1QAIA 1NHKL 3H5SA 1GEHA 4KHPF 2YKOA 1RT1B 1G7CB 1IR0A 1OQ6A 1SPBP 2JZ5A 3GLJA 4MKYA 1X5PA 1VQLS 1CJTB 3TOQA 3GCWP 4WYWA 4DU8A 2DB1A 4CH7A 5D4NA 1X60A 1OSDA 3NY0A 5HJXA 4CWBA 3FMBA 4NA2A 2X1FA 2VPZB 1PJ6A 1S9GA 2ZUGA 2RUSA 4HDHA 2P9GA 3R3TA 2OEKA 5CQGA 2XY5A 4M5JA 1R8CA 6AT1B 4M5IA 1Q82T 2DR7A 4FYDA 2BZ2A 4M5NA 2MKIA 3PX0A 4KSEB 2Y0SD 5E3AA 4OI1A 2XGQA 3M8SA 1H73A 2XZDB 3QT5A 3WC2A 3PW2A 3OHAA 4NMLA 3OSPA 3PO5A 4YUDA 4NLSA 1DARA 4JI1J 1H98A 2ZD1A 5ETKA 1XNQJ 5K20B 3OJUA 2D7SA 2VBZA 1P9YA 1JJ2R 3TP2A 1GXLA 4I4BA 2H5JB 2VONA 2E29A 2V94A 3JSRA 4TQRA 4JI8J 1QVFR 2HLTA 3BQ0A 2ZKUA 3NNAA 3J7YI 1WC3A 1WF1A 1S1XB 1L3KA 4OI3A 4ZK7M 4GC7A 1D8YA 2CPIA 1VQ8S 3TO8A 4LSNB 2WAQD 1NKBA 4CDIA 1IKXB 5A8KB 5B0BA 4X66F 1EETB 3I4HX 5H9EK 5FIIA 4USJC 2VG6A 1X31C 2WRMA 3EWGA 5THWA 1VQOS 1HYSA 2A18A 4L6V3 1SKRA 3R7NB 4N76A 1YKWA 2V50A 4NYPA 3W5XA 2I8EA 2VDHA 4DL5A 4B9VA 1BQMA 1Q1KA 3CXCR 1AA1B 4DR1J 2A0FB 4CO0A 2DPJA 5ETSA 3TWZA 2MY8A 3TUPA 3HHLB 1B99A 5DRKA 1WHXA 4DLEA 2FC8A 1IR1A 2VFUA 3VGTA 1S9FA 1NPRA 1HPZA 3EVOA 3MMCB 5IT4A 4NXNF 4C4WA 4KJIA 2J9EA 2N82B 1RT3A 2Z0GA 3NGKA 3EICA 3J7AN 1RT1A 5IFMA 3FJ2A 2ZH4A 3R5CA 1UA1A 4NCBA 3K58A 1C0UB 2E7XA 2H51B 2V9KA 3W9HA 1RAGB 1NJYA 3UWTA 3A8JA 1S1TA 3GONA 1TELA 1PYTA 4FP9A 4FF1A 4DR7J 3KHLA 4CRJA 3W2VB 5L1KA 3IFEA 1SXLA 3T9NA 1KP6A 1JLQB 4BS2A 3NNCA 1GMWD 6FDRA 3VAMA 5D8HB 2VU5A 3OVBA 1SL1A 4QR2A 2IYIA 4CTAA 1KFSA 4DN0A 1ZPVA 3UQSA 1KLMB 1WF0A 1WHWA 2IRUA 1IUJA 3NP5A 2LQBA 4N41A 1N5QA 3AJ2A 4Z7YA 3M9MB 1RAAB 1CQNA 3H5UA 1NK6A 2UUWA 5BR8J 5D0GA 1RT2B 3CB4A 2V2KA 3B54A 4RX6A 3H40A 4LIRA 4LF1A 2F7VA 1MWZA 1UFLA 4C3KA 3E01A 1Y00A 1WOOA 2EEYA 2QGFB 3IS9B 1HPZB 2UXCJ 3AA8A 4NZ6A 3WZ0A 5C24A 4DV3J 1VQSA 2ZH6A 4G1QA 3BV8A 1MU2B 1B0TA 2MLZA 2Z30B 3GU0A 2FJXA 3QGGA 3MEKA 4M5GA 4OHVA 3THPA 4DSJA 3OL9A 4RW7A 2LA4A 3EGWB 4ITSA 5HP1A 4U9RA 3LAKA 2K7KA 4JYAJ 3FEZA 2M8DB 1KTQA 1HHSA 4U67Q 3CD0A 3D68A 2ZZTA 1TUVA 2KT2A 1T9UA 3LP2A 4OQJA 1RAIB 3V4IB 2LXIA 3R7SB 4DZ6A 4C2MA 3IC1A 5B0AA 2HAFA 4OYPA 3OSNA 1KS2A 1J5EJ 1PC5A 1U1KA 5DO2A 4DG1A 5CHCB 2G4BA 1ITPA 2W7OA 1C4AA 1C1CB 3CCSS 2DTJA 1HNIB 4R5PB 3MAAA 4DSIA 3ZZOA 4MIWA 3DM2A 2C2EA 2XC9A 3FDSA 1BWVA 1EB0A 1SC6A 1B70B 2AJ0A 2E5GA 3DXBA 1VQNS 2V8PA 4ED5A 3CD6S 3MM7B 2WSFC 2QA2A 3PHTA 4OI6A 4I6AA 1JJ4A 2YNHA 3A3NB 1RT3B 5AT1B 3KLGA 4RJVA 2CPJA 5HJYA 4OZ3A 2K3KA 4M5DA 4TYBA 3MCSA 2GW8A 3RUBL 4J9MA 3WHIA 3MTKA 4FS1A 2UVVA 2AJ1A 3CJ3A 4P75A 4QYZJ 2JJ4D 4ED4A 1XWLA 2QLXA 3O1LA 5F0UA 5IZHA 3PW5A 3RR8A 3G8QA 3Q8VA 5LSLA 2E1PA 4ELTA 2Y9HA 3SCJE 1Z4UA 2OAUA 4OYAA 5D15A 1JLBB 1U1PA 1HMVB 2RJZA 2CWXA 2ZWOA 3OQ2A 4A48A 4DPOA 3NOCA 3JXOA 3LW5C 2QX0A 3IGNA 3MPWA 4F7VA 1FE0A 2MJNA 4F0HA 2I38A 4WZQA 1FRKA 2FPHX 2BW7A 1TUWA 4W92B 1UWBA 3FBEA 4LRFA 4KV8A 3KDNA 4DSLA 3BBFA 1HIYA 1UVKA 3PG9A 2JVRA 2VUGA 4DX6A 2FD2A 1UL3A 1TP7A 2CJYB 2IBOA 1LWCA 4P2SA 1NHVA 4TLRA 2CQ1A 4H4OB 3N28A 4LIWA 5B0CA 3KK1B 2N7CA 4DQIA 4O3SA 2OHDA 2RF2B 4LBPA 3SXLA 3VGUA 5KT4A 1JLFB 1ZAXA 1WKJA 1O8BA 4OI4A 3GR1A 1PJ7A 4O0IA 1QSYA 3CJQA 4N56A 3W5ZA 1IKWA 1U09A 3W66A 3JTOA 1E6YA 4N8NA 2RSQA 4CP5A 5D0HA 5K5MA 2YH0A 3UDEA 3W1YC 9RUBA 2F5GA 2X51A 2Y8WA 3K59A 1S59A 1XEZA 2CPFA 3IWLA 4DV3F 2EG1A 4GMKA 3CSKA 2HMIA 2DGXA 3US5A 4X65F 2R4FA 2OLWA 2GQQA 2MLXA 2MQNA 1RT5B 2OELA 1RHQB 4NLOA 5E3RA 5ETQA 3TR5A 4B9NA 1TFYA 2G1HA 3GIIA 4F26A 5J1NA 5SUHA 4DR3F 1VQMS 2OSQA 2ZH2A 3SEOA 4YB6A 2OP5A 1XMQJ 1IXKA 2BMBA 3B78A 4Q45A 2RKIA 2B0GA 3CIMA 3VF0B 1XMOF 3SZ2A 3E01B 5GAHU 2MZ1A 2V8GA 4EYHB 1M90T 1KWMA 1JKHB 2DNNA 2MQPA 4RNNA 1KC8T 4IFYB 5E2QA 1IBMJ 1CEZA 4ELUA 4WKYA 4XIUA 2E5LF 1FDDA 2BRLA 2L3MA 2Q43A 2G2YA 4YB5A 5CH7B 3UDLA 4RLEA 1X4CA 2CJAA 2EVZA 5B0FA 1R43A 3RJMB 4Q0BA 3QLHB 1D3WA 1LEOA 3CJKB 1FKAF 2ZE2A 1WACA 3MR7A 4CNYA 4OX7A 1HNWJ 1GMUA 4DDFA 4B9SA 1JLCA 4DV4F 1G3OA 2DIUA 3I9ZA 4FNHA 3CCMS 1OY9A 4CLYA 1T3NA 3Q2SC 1DURA 2WVDA 4KV8B 3ENAA 2ZH9A 2B56A 3NGSA 4WPAA 1WSRA 1S9GB 1NKEA 4DR4J 5F9NA 1OIAA 3H7HB 2CXEA 4DQQA 2JFKA 1SL2A 3T5KA 4R0EA 2HHVA 2K3IA 2DNZA 1YQHA 5LSRA 1REVB 1UJ5A 1FTCA 1MROB 2LYVA 1RTJB 1MMNA 2GAHC 8ATCB 4DL2A 1IVZA 1AXQA 3GJSB 4C8KA 4CCHA 3KLHA 1DTQB 2ROEA 5KFRA 4IG3A 2LFVA 5HI7A 2RHQB 2FJVA 2XWXA 1QSLA 2R3VA 2XB2D 1TK5A 1LFWA 1T9VA 1JQGA 5C24B 3BGOP 1B4SA 4P52A 1MWYA 1RE1B 1H2VZ 5IS2A 2IM0A 3DLKB 3FSYA 5I3QA 4B3OB 4C48A 2XNRA 5HAOA 1DAXA 3CIZA 2NPIA 3BYRA 4ED6A 2ZJQQ 3M1VB 1GAOA 4HVZA 1RWKB 2W24A 4RUAA 2KZMA 3BR9A 1L5UA 2WVEA 4U8YA 2PO4A 3D6HB 1M5VC 4DF8A 1A9NB 1UJ6A 2C2KB 1X9WA 2UVUA 2BJDA 1FKPB 5BYQA 4QYZK 4RW9A 1FVSA 1KBRA 4AQYJ 4E8UA 1S6OA 1G2EA 2E44A 4UUWA 1LWXA 1VQ9S 4IOAQ 3P49B 3A4TA 3P96A 4URSA 3RYLA 4DU7A 1LWEB 1NDKA 4ILRA 5F8MA 3T19A 4CLLA 5KFQA 1LOUA 3OL8A 2EFPA 3Q89A 3QGIA 2XMJA 4HACB 4Y2AA 1HBMA 5EGYA 4C0OC 2UU9J 2QLFB 2AGQA 2HNYB 2IAJB 1NDCA 3GB0A 1RT4A 3C6UA 4G6VB 1Z2LA 4LRDA 4PPDA 1HQ2A 4AXIA 4LVOP 1H38A 2HHHJ 2KDOA 2W2OP 3M8RA 3HK2A 3QQCD 4DV5J 4JI4F 4ZCIA 3MD1A 1M5KC 3AOCA 1BLUA 3EM1A 3OXLA 4TN2A 5CD4A 2XLIA 2MKHA 2DRDA 4PG4A 1NH7A 1U0HB 3DI6A 2QN6B 4F0MA 5GAGI 1N34F 3IR5B 4EEYA 3IGVA 5KG6A 1QE1B 3MR3A 4DCJB 1RTJA 2OPPA 4OLOA 5G0RA 2NXCA 3J81U 3ETMA 4NLPA 2GC8A 2B9YA 2MQ8A 1IKXA 4DSKA 1IBLJ 2IAJA 3FCHA 3TA0A 5CZXA 1PYSB 2KU7A 1R0CB 4YB1P 1RBOB 4IFVA 2BQ3A 1FKOB 4IQMA 3NCRA 1RABB 4DN9A 2DYAA 1TU0B 2XEXA 1N36F 3DYAB 2KHDA 1JLFA 2FLOA 3KDOA 4C0BA 2ERRA 4IRCA 1C1BB 3BQ2A 1S0OA 4Q8EA 2DXEA 1K1QA 4H4OA 2RRAA 3N5FA 4GKJJ 1TKXA 2JC1A 3N4WA 4RUBA 2QE5A 2Q1LA 3GYGA 1RHRB 3SSRA 1Y3KA 2QSWA 5T7LB 1SL0A 4LF7J 3EJMA 4HTIA 1PAEX 1U0HA 2CNLB 3U02A 4DSEA 4QU6A 3BPDA 2YKNA 1WG4A 2PFDA 1YJTA 1W26A 3QRPA 1Q16B 3F0NA 3PY8A 4FPRA 3PRBA 2E7WA 2OJ3A 1RKIA 4JI1F 3MMAA 2YQ0A 1D09B 2DH9A 1BHNA 4GKKJ 4XTTA 3T6BA 5CYQA 4R8UB 3D6MB 4OZ5A 1DJ0A 1LNQA 4TYAA 3N6MA 3MM7A 4NLUA 3AH6A 3KLIB 3OTOF 3WC0A 1VC0A 1TKXB 3MM8B 4HACA 5HSPA 3ZZPA 2VC1A 1O6XA 5A8WB 1HBMB 1FRLA 1YITS 1N56A 2DR8A 2G2OA 1K0TA 5EWGA 3R9LA 4DV7F 1C1BA 1FFWB 2AYMA 2WK4A 2MEWA 1CULA 1NLKL 2GMHA 2YWEA 4IKAA 2F9JA 4K5RA 3Q8RB 2AGPA 1TKDA 5IWAJ 1AROP 2F40A 3JQMA 2KH9A 3CVKA 2XMWA 4DOZA 3CJKA 1FHTA 1Y7PA 2UUTA 1FRIA 3VAHA 3BH6B 2NYHA 3HZGA 2E1MC 3UNYA 3MHYA 4F2RA 2H5IB 1LWFA 2G0IA 1N5SA 1VS3A 2IFXA 3WX8A 3NCQA 4RBTA 3UE2A 3TRGA 3FEXB 1AUSL 2C1EB 2W2QP 3G82B 3SV3A 1J5EF 1D8ZA 2DXFA 5DZ7A 5SZTA 3P45B 4O3RA 4Y2KA 4FF2A 4KFBA 4DR5F 3OW2R 4YN3B 5A6WA 3CDUA 3MM6B 3MM8A 4ECSA 4Q2MA 2PC6A 4USWA 3JYTA 3DFEA 3TZZA 2RDIA 1DLOA 1HI8A 2B8PA 4ZVUB 2HVIA 3X1LB 4IG3B 1QTNB 3UO0A 1SJFA 1MLAA 2QA4S 4ZLJA 2D69A 4PEOA 3K89A 2H9ZA 2BOAA 4CT8A 2UVWA 1AFIA 4O3QA 4M8LA 2MQOA 5KFZA 4XDCA 2V34A 1CS4A 1PSDA 2BE9B 4ZP9A 4TLQA 1UETA 3I6PA 4FYYB 4U96A 2HEKA 3C6UB 1GNKA 2VBWA 5EUHA 2CNOB 2FJWA 3D66A 4OYXA 4FN5A 1FF2A 3MZIA 2XHWA 4ERDA 2CPDA 3DRPB 3V6DA 1FXRA 1X8DA 3QIDA 2XM3A 4B3TJ 2HKEA 3V6KA 1QSSA 3BB5A 2DRBA 2B3TB 1RGVA 5ETTA 2UXCF 3L3CA 2Y0BB 2MZTA 4CLPA 1V3RA 2BV3A 2HNZB 5E33A 4JV2A 1H74A 2JEFA 4GRSA 4PCQA 4QIVA 3S7RA 4ANDA 3G71S 4JI4J 4NLWA 3KK2B 4NPOA 1LK7A 5L39A 3BQ1A 3DOKA 4UOHA 1URNA 2DD8S 3GCXP 4DV1J 1FESA 4ALZA 4WJBA 3QSYB 4EFAC 3FCWA 4B3SJ 2XS7A 3GFXA 1HNXJ 1VBZA 3POTA 2HGNA 2VG5B 2XI3A 4MKVA 2W4CA 4PQAA 3QFHA 2J7UA 4UZCA 2DNQA 3IRWP 5E7OB 3NMAA 5L46A 1JIHA 1I94J 1UWAA 3MFIA 4BDPA 1BUXA 2E5IA 5KFSA 4ZKAA 1VOMA 1HW8A 3FMWA 4ETZA 4DV0F 1WHVA 1VQ5S 5E41A 3MR2A 3QYYA 4DI6A 1U24A 2EK6A 4X4SA 4KGZB 2BANB 5FDLA 1S1XA 3C16A 5KFUA 1YI2S 3AAWB 2XSJB 4ZP8A 2W9CB 5T14A 3L09A 2CJBA 3KUHA 3TYTA 3W5YA 1KDNA 2D9OA 2CJQA 2DO4A 4HHUA 1SB6A 1HI0P 1S79A 1WC1A 1TL7B 3B82A 2JNJA 1NPKA 2ILZA 3UR0A 5ETPA 4MIAA 2AQ4A 4B3RJ 3A13A 4IYQA 4KE5A 5KFAA 2AJFE 1T02A 4JV5F 4PXCA 4DZDA 5IC4B 2AU0A 3R7BB 2GO9A 2QLBB 3W63A 5AJ3F 1XMOJ 2M52A 4MTPA 3V6DB 2C2RA 3GZ7A 3ENWA 5B7WA 4LFCF 3LH2S 4EZ6A 1M5HA 1U0SA 1TZ0A 1FWPA 1LW2B 1H3DA 2CQ3A 3GYXB 1NK7A 1T8EA 1KHVA 1HNVB 2W1BA 4I0WA 3P5BP 4ECQA 1U4BA 5E3PA 3GFHA 1R7IA 4N77A 2ZHAA 4J9UE 3CCLS 4K4TA 4K4WA 2LEBA 2YKMB 3HHEA 4CYUA 1YG0A 1PBAA 4ID5B 3T3FA 5HATA 4CO1A 4WFXA 2WVCA 2ZNYA 3VQSA 2KM8C 4LMZA 3POTB 2M88A 3D0GE 3D1QA 3FVYA 1RISA 1YK9A 2DGQA 2CJKA 3ZZRA 4NRTA 2J7KA 2LEPA 3EZOA 1UZDA 3DLGA 4QWCA 3T1YF 3E2EA 3J7Z5 1P1TA 2BM1A 3OBIA 1NCLA 2ALYB 4ZCKA 4TQSA 2R7UA 3EPIA 2JFDA 1JLGB 5KFTA 4ZJOA 3ONQA 3AD7C 5C2CA 3CMAS 4DQRA 5JVGQ 4DR5J 1FX2A 1UCNA 2H65B 2Z57B 4GVBB 4BHQA 4JI8F 3GPAA 1N6QB 3EUNA 4FKYA 1U25A 2CVEA 3IMQJ 4HI1A 3W2VA 2XMAA 2RQCA 1FERA 1F9HA 2FJBB 3MECB 4G65A 1CVJA 1ROFA 4I69A 4KPYA 4PG6A 1URRA 2RIJA 4KGKA 3BKFA 2R2RA 2CPEA 2N7YA 3EGZA 2VFSA 1VDHA 1NSKL 4MAKA 2BX6A 4X4OA 1YRUA 2FHOB 3EX7B 3M8QA 3M8PA 1RTZA 1R0BG 2BJ7A 4Z2XA 5GAEU 3EYZA 4R25A 1GFWB 1FXLA 2R7VA 4TXSA 3ITHA 2HK2A 3CWJA 4YQWA 1U1OA 4HEA9 1FT8A 4QWEA 1HWUA 1BMQB 1WEXA 4Q2LA 4Z7CA 3I31A 3MMBB 6FD1A 1VHFA 2CDRB 3OTOJ 3KOAA 3KLHB 1SH0A 4OZ0A 5FD1A 1DRZA 1KNZA 3CT9A 1N32J 4XDDA 2KFZA 2ABYA 2QO3A 3DOMA 1RA6A 5J1EA 2Z8QA 5KFDA 2RB7A 3LGHA 1IBLF 2QEXS 2HNYA 2FVQA 3MECA 9ATCB 2Z2YB 1C4CA 2GO8A 5HL7Q 2CPXA 2HPUA 5KG2A 2XYHB 4RBVA 2J0SD 2QZ8A 1N6QA 2XMMA 1SBRA 5D6GA 5J2PB 2EW9A 1AT1B 2F9DA 4W98A 3D0HE 2AKWB 3LGMA 2HGLA 4KH0B 2FHJA 2UUAJ 4FBTA 2E5HA 4PUOB 2XS2A 2HNZA 3Q22A 4B9MA 4I1TA 4RWXA 2FY1A 2G0JA 2LDIA 1RB0A 3GV7B 1KQKA 2MQMA 2GIQA 2M8HA 3VTIA 4EYIB 1Y4ZB 2KYZA 3TNVA 2OPPB 5G0RB 3OVAA 3FKBA 4AE5A 3DLLQ 2BA9A 4CI0B 1Q7LB 3QWPA 3NWGA 1SCJB 3B4DA 4FYVB 4N47A 3EGNA 3HMJG 2IA0A 4B3OA 2LA6A 2R7OA 4HT7A 4KKOA 1YDLA 4PG7A 3LQVA 3UDCA 3G6VA 2UXDJ 3GJRB 2QFJA 1UTAA 3D6TB 4DXLA 1HR0F 4M5DB 4BC9A 1LKZA 4LVNP 1H6KX 2WBMA 3BN7A 3HHDA 3PVXA 4OYMA 3GILA 3DDIA 2DO0A 4Y00A 4BLGA 1WNEA 1NJZA 1KKHA 1UPMB 1D9DA 5D0RA 1SV5B 2DHSA 3EDQB 4H4MB 2DHGA 2D74B 4X4QA 2HRUA 3AD9C 4KHMA 3TJAA 1PJ5A 5EWEA 1N5VA 2VA2A 1T9XA 5HK4A 1S0VA 3AXKA 3CJ2A 3QT8A 4NOHA 1K1SA 3DGVA 4OZJA 2C2MB 4LFCJ 2YBVA 4JBCA 4DV2J 3A1YG 3M32A 1SVDA 3MD3A 4CTAB 2XCAA 1PGZA 3QJLA 2LDYA 1HWKA 5KFEA 1R89A 3G8TA 1IKYB 4TVAB 1ZOTA 4DUYJ 5GAGU 2ZDOA 4HH0A 5B09A 4NXMF 4C8ZA 1GMWA 2VKRA 3AT1B 4A8QA 4QZVB 3BGUA 4FXWA 3C14A 3DKDA 5KFJA 3LF0A 5HQ8A 4DV1F 1RYSA 2UUCJ 4B3RF 1FJ7A 2PMHA 3H0PA 2GMLA 4IOBA 4UW2A 1TKZA 5E5NA 5EHHA 4DWIA 5EX3A 1O51A 2QTWA 2XYPB 4ZLNA 1X4FA 1FVQA 8AT1B 3MEGB 1NMEB 3VAFA 2FLNA 2BDPA 4CM0A 2ZITA 3SQOP 3HD2A 3RU0A 2W8LA 4I2QA 4NEZA 4Y3CA 3SV4A 3D5MA 1RHMB 1TAQA 1WC0A 1N5TA 3TAMB 1D9AA 2VD3A 4KBIA 4P2XA 5KFYA 1HNZF 2AZ3A 1T03A 4OZ2A 3SMZA 3H4DA 4WU3A 2X7IA 2IM1A 2YH1A 1RP5A 2J7WA 1PIEA 1JLEB 2Z4PA 1S9EB 1FEHA 2DY1A 3EE3A 3C15B 3PFOA 1U47A 4DUTA 4QBUA 1HLWA 1B3TA 3TUIC 2JVOA 1H2UX 2IVFB 4DV0J 1YJNS 2NS1B 4ECRA 2VV5A 2H48B 5J2NA 1FE4A 1FRMA 2YXLA 3CE8A 3HJVA 2J5AA 5LL6d 5BR8F 2E1CA 5A76A 3AA9A 1WOSA 4RNFA 2KHCA 5I3PA 2OTJS 1B0VA 2RUGA 4WP3A 2BRKA 4ES2A 5L38A 2ASLA 3MI7X 1FJGF 3CCJS 3D28A 3UW1A 2PSZA 3A3OB 1NJXA 1NAQA 3W3SA 2W4PA 5HVHA 5IV4A 4ZPAA 3TAQA 3OR2A 1PKUA 3E3XA 2RF2A 3HVTB 1X4AA 3ISNC 3VWSA 4IO9Q 4WF9Q 1FNOA 2PD1A 2PA8D 4BBYA 5KT6A 3SQGB 1N33F 3GWCA 2IYGA 2L9DA 1RLCL 1SC3B 4L3KA 3PYFA 4X84A 3UNGC 2R7WA 2R8KA 1NZ8A 2AMCB 3IAS9 3DOMB 3PYDA 3LWMA 2CWKA 4EWTA 3WQPA 3DRPA 2KB2A 2YNFA 2DCLA 3FK4A 1HBOA 1J27A 3GMGA 3PCOB 5ETVA 3KHGA 2BANA 5FDLB 1UVIA 2HRTA 4ZPDA 4K0KF 3MPVA 4J9VA 2B4UA 4ECYA 5J2NB 4DX8H 3PZPA 5I42B 1WEYA 2IJNA 4X66J 4C3MA 4J9PA 2R7XA 2VBXA 5U47A 2DKOB 3DHWC 3A8KA 4OMFG 4IUFA 2I5JB 4YY3F 4H4KA 1H72C 3ZC4A 3Q24A 3HHLA 2R7TA 4U95A 3CPWR 3ITHB 1FD2A 4I2QB 2MGZA 1YTYA 4PXEA 2RS8A 2BJ1A 2VZ9A 3OLBA 1KOOA 3LANA 1J2VA 4ZIWA 1HBOB 3DN9A 4DBQA 3Q8QB 1RAEB 2VQFJ 2NR0A 2FUG9 4X4UA 4O0NA 3K5LA 4ETXA 2K1RA 3WIVA 2R8JA 4DL3A 1JNRB 1S1WA 2JOQA 2LQ5A 2F4FA 2GJ2A 2LP4A 2M0GB 3DLEA 2M5YA 4Y2CA 4YDDB 3K8WA 1HNZJ 3K57A 1JXLA 2IIHA 4KYZA 2DGVA 5HLFB 2BJ9A 1YBUA 3G2XA 2C3MA 2AEFA 4ZN1A 4FNIA 4G1PA 4PWDA 3B8HA 2I0XA 2RQKA 3NS6A 5JUMA 4J9NA 3T5JA 4KO0B 1S97A 1KEKA 3QATA 2C22A 1U8SA 4KQZA 1T05A 2WHOA 1HMVA 3DLGB 2IMWP 2YNGA 2KXFA 2VF3A 2CDQA 5K8OA 2HFZA 1HQEA 3C19A 3MM5B 4LREA 2R8IA 1L3TA 2AWZA 2PMWA 4U8VA 2KXNB 2EI5A 1AUDA 4LF9J 1HBUA 3MM9B 1QDUB 4Q44A 3H5XA 1XMQF 4JI7F 3V2UC 3KFWX 4HT5A 4XPCA 1R3NA 1MU2A 5B0GA 4OIXA 3SCLE 3MOJB 1VYAA 2AYGA 4J9RA 4CO5A 1GX6A 3Q83A 4RO0A 1H7XA 1R8PA 4F3OA 4WK1A 2W25A 1U1MA 1M5OC 3MEGA 4CLZA 2XY7A 1NJIT 1RT6B 5HROB 3T1HJ 2IHR1 1V6HA 4QIGA 1VMBA 2RD5C 3OFEA 4LSZB 4CLUA 1NK5A 3IBWA 2FLLA 4LF5F 2HHSA 2Q79A 2FZKB 1NH8A 2XZWA 4FXVA 5LMUJ 3R8YA 2E1RA 5KT7A 5CCLA 4KO0A 1HR0J 4GKJF 3J80U 3DHXA 4JI0F 3NGTA 2DNGA 5F9LA 4IFVB 3DLBA 2L08A 2ZOFA 2U2FA 4FS2A 3TW0A 2AF6A 4MT1A 4JI2F 3FZ2A 3RTVA 1FCAA 4ID8A 4LFAF 2FQQB 3TI0A 3MTJA 3UVJA 4ZHRB 1BQXA 3ET6A 4CLKA 3QZ8A 4UY8T 2HBYB 5J1EB 1CPZA 4M5MA 4ZVGA 4FYXB 5IOLA 5DDPC 1U7LA 3G96A 3CJSA 4N8OA 1U6ZA 2J76E 1RAOA 2GHPA 2ZH3A 3CDAA 4ZS6A 4C0HA 3VAKA 4A8WA 1NDLA 2W2MP 1S99A 1VRUA 2FHJD 4NCGB 4ED2A 5DZ6A 3BGRB 4C7QA 2V67A 4C8NA 3DDKA 3EVMA 1Q5YA 3R5DA 5DDQC 4JYAF 3HSZA 3DGPA 3OUYB 3PNIA 4F4KA 4PYDA 2ALZA 3F73A 3KJNB 2BE2A 4CNZA 1M1HA 1NZAA 3QT7A 5F8JA 1TV6B 1EKRA 1TMJA 3HLUA 3G82A 4ER8A 2DGSA 2ADCA 3KLEB 4ZHRA 4F36A 3M2VA 1EHWA 2DJWA 2NXUA 3D1HA 4HH1A 4OFZA 3H2LA 2EFOA 3CCTA 4DPYA 3H4BA 2E9TA 1NSQA 1NJWA 2V69A 1HNXF 2CJXB 2IDLA 3HX9A 2JWNA 3NCPA 3B6BA 1NBEB 1NK9A 2GIFA 3MGJA 2HQCA 4M5KA 4C97A 3UCGA 1DHMA 2B7BB 2OD6A 3GIMA 4ECZA 3P5TL 2KJVA 4LFBJ 1LQ9A 3CCQS 2ACYA 2RHSB 2CFXA 1FXDA 5LMNF 3RW6A 1YIJS 4LRBA 4PXDA 1XNRF 1KONA 4H54A 4IH7A 2EFNA 2E1AA 2FC9A 1FJGJ 4MFBA 4C6AA 3OTEA 4ZN3A 2G1DA 2GGPA 1TFWA 1U8WA 1RTHB 1QE1A 5HROA 1I1GA 2EPIA 1RWOB 2VFRA 3BEGB 3DNCA 3OUYA 4LF8F 3TJ9A 3FBCA 1RDRA 2CRLA 1EKSA 1UPPA 2HNDB 2RRBA 3HKZD 4USKA 4J9SA 3RGIA 1T0TV 2F65A 1UFWA 2OGUA 4ZVTB 5JJBA 3AODA 3BDPA 1EJ7L 4NCAA 2J0XA 4MK9A 4JI6F 3P6YC 2HWTA 4QCLA 3RAQA 4A8XA 1SUQA 4KFBB 2GAGC 4DR2J 1WHYA 3I87A 3QAUA 1NU4A 4NA3A 1REVA 2HQ3A 2H3EB 4HL9A 4DR3J 4WTOB 3CO0P 2J9DE 4ZLPA 3NGRA 3CTRA 1SQGA 4DPXA 2XMTA 4RUCA 4GO7X 2CNKB 4FVMA 3KWMA 4L74A 4PPZA 1M0SA 3D2WA 4EMDA 2J8SA 2JL9A 3PEJA 4KY3A 1JJHA 2VICA 2XMKA 5L1IA 2QYCA 3PJWA 4Q0BB 2BACA 1LWFB 1VRQC 1XTZA 1TL1B 2NLWA 3FNNA 2F8EX 1LW0A 1UFKA 2YPYA 3C66A 3GTYX 1S0NA 2V8HA 3NBPA 4MMOA 2NXEA 2F1FA 2GVZA 2JEGA 1S1VA 5A2QY 3QIPA 2H1YA 2MMYA 4FF4A 2PA3A 1I94F 5KFLA 4I6WA 5A0YB 1ZH5A 1UEKA 3FFIB 2K06A 2YWFA 1WKKA 2MSSA 4IG0A 3C16B 5D4PA 1IBMF 2XSJA 2ZC4A 1YJWS 2DGTA 2HFOA 4QW8A 5CZVA 3KJVA 3KLIA 3QPIA 4J7CA 1YBAA 4KH1B 1M1KT 4NLXA 1IWAA 4NXMJ 1SJ3P 1QLNA 3OVSA 4JV5J 2KFNA 4L73A 3UFCX 2VDIA 4WYLA 2WW8A 2XLJA 3DU6A 2RNEA 3PFEA 2N4CA 3MPYA 5KG0A 2BW2A 5ITHA 1XIQA 3D0IE 3CEDA 2HWIA 3MM5A 1D1UA 4LF8J 1AW0A 3I32A 4WFBQ 1F5BA 5G4DA 2C3UA 2DXDA 2GQCA 3CF5Q 5DG7A 3WIUA 2OPSA 3ZTOA 4ES3A 1YJVA 4CH1A 4WFNQ 4K4SA 1HD0A 4DPUA 1CJKB 4WTYA 3OL7A 4HYKA 4ED3A 2ZZNA 2B4PA 3HO1A 3J80Y 1UVLA 1VQ6S 1IJEB 3QMQA 2A2CA 3LUYA 2IVYA 5F8LA 2MHNA 5KT3A 4J9OA 1S10A 3JB9k 1P8GA 1F3VA 2GVZB 4E0DA 1SKWA 2BR0A 1GK8A 3DXSX 2UXBJ 1R31A 2D3UA 1U48A 2DGOA 2ZBCA 3BDEA 1NB2A 2OEMA 2M7SA 2XTJP 3MAAB 4MH8A 2HGMA 4IDKA 4Q5VA 1TQLA 4K4UA 5CAAA 4ZJQA 5F8NA 4NLRA 3W60A 1J5OA 3KKFA 3RAMA 4DL4A 2DGWA 3M6UA 3R5AA 5M2UA 1UWBB 1C2PA 4WFAQ 2FJEB 5GMKa 1K8AT 4RBUA 4K2XA 1NPPA 3W65A 1PCAA 4DSFA 1VQ7S 4M1KA 4RWWA 1X5OA 1Y10A 3ZXWA 1XK8A 2V2VA 2QV6A 3GR0A 2WB4A 5AXKA 1VIXA 1GXTA 2C2OB 3TVZA 4DS4A 3UCZP 3LPEA 4DR4F 2K8GA 1S6QA 1RHJB 2D9PA 3M2UB 4OX6A 1TKTA 4CM2A 5CXTA 4V19X 1TL4A 3HSDA 2AYBA 3OTCA 3M9OB 3PTWA 2HRYA 4OHZA 3BZQA 1ZAVA 1HNVA 3BPSP 2D3OR 2V4JA 1YSJA 3Q2TC 4ZVSB 4CZCA 3BYPA 1LXJA 5I42A 3RBXA 4F4AA 5KFPA 2KG1A 3QRQA 3EMTA 1X7VA 1NKCA 1OYDA 1BGXT 1RU2A 3MOZA 3BM7A 3R27A 3V6JA 1F2HA 2QL9B 5A0YA 1KLNA 5D77A 3G6YA 2CA9A 1T9TA 1SKUB 2W4DA 3KYLA 3JTPA 4OX9J 4A4JA 3KLFA 2G0CA 3IR7B 5B08A 2RMLA 1Q8IA 4LF2A 3OR1A 3ZZUA 5D0EA 3RRGA 1FDNA 2LCWA 3MEEB 2KXHA 4JUZA 3DMJB 3W8GA 1D9FA 1K47A 2FVRA 4JI7J 4RU9A 1JJCB 2H5EA 1VHIA 2QYGA 3AJ1A 1Q8KA 2HQGA 5AXMA 2RILA 2YWHA 2BABA 4KC5A 2KRBA 2WVFA 4UF4A 4ZVPB 3ILJA 4E2FB 2ZH8A 3NNHA 2OPSB 4WU2A 1S7IA 1RACB 1UW4A 1WOPA 1YX2A 4F4XA 4GC6A 4LR7A 2FJDB 1U6BA 4YHHJ 4TNOA 2YKMA 1OS5A 3QGHA 1F1BB 2ZWPA 3T41A 4LQ3A 2EFVA 4K8RA 4HDGA 1AB8A 2WB1D 4O3OA 4X4RA 3SSSA 2HAIA 5E0OA 4YR0A 1B0PA 1CG2A 1RHKB 1TMMA 4YB7A 3G4SS 2OD4A 5A8RA 2QC3A 1Q5VA 1A7GE 3TJ8A 3CCRS 2XI2A 5EX0A 2GIRA 3F56A 4NLYA 4CLTA 3M6WA 3ISND 3B4MA 1FDBA 4IG0B 1F9EB 2QIFA 3TANA 3AJDA 3I5AA 1A6LA 4M95A 3DLJA 2WSEC 4C8OA 3ZZZA 1T05B 1ELOA 3KHHA 1V5VA 1RCXB 4DPTA 3GV5B 1MN9A 5I3UA 4QQBA 2LU1A 3H8YA 3GIKA 4OX8A 3ZTQA 1IKVB 4LF7F 5GMDA 3DLHA 4DFMA 1CJVB 3IWXA 4Y65A 4TY8A 3THVA 2VFVA 4NLVA 2R42A 4QWAA 4QPTA 1P1LA 4IOCQ 1PILA 3IN5A 1S12A 1M5PC 1I5OB 2OMOA 2VPYB 1ZS6A 2I6WA 3ZNUA 2HS4A 4K4ZA 2HS3A 3IBCB 5KFWA 2ZDPA 1NHUA 1RWVB 2RE1A 4UTGA 4A47A 3PRDA 4IH5A 4B9TA 1ZTTA 5GMEA 4OI0A 3KNGA 3KJVB 2QT7A 1X4HA 5DG8A 2ZH1A 1RUSA 3W2WB 3MAQA 4KR0B 4B02A 1VK8A 1HBUB 2AX1A 1WD6A 4DX5A 3R5GA 2M70A 2I1RA 1SJRA 4WIIA 2DNPA 4ECWA 2DR6A 2PEBA 2YNHB 2ZZMA 3CUNA 4LJMA 3WBZA 3TZYA 2OPRA 1TKZB 1UEUA 2RH3A 2UUBJ 5DDOC 2WZ1A 3RAXA 3OFHA 1LFPA 3K2YA 1WJ9A 4JB8B 2JLGA 2JH3A 4KHRA 1Q7YT 2IA6A 1S6PA 1CJVA 2JC0A 2DHHA 4NI2A 2FIUA 2B9EA 2MQLA 2JLFA 4HHJA 4P74A 2Y1LB 4GVBA 1WDTA 4IR1A 1YWXA 2YY3A 1FKPA 2ZBIA 4OYWA 4PYAA 2YWKA 3BR8A 5KFXA 2MXYA 4B9UA 2ZUAA 3KG1A 3G8SA 4DLGA 3QRRA 2JHEA 2DISA 2POKA 2GA7A 3KLEA 4ZPBA 3RB4A 1WDDA 1XR7A 3GQCA 1S77D 5CYMA 4CLWA 1WEZA 1X5SA 4YR3A 2KG0A 1TV6A 1JX4A 2DR9A 4USHA 5DM6Q 1RWNB 4X4PA 4ZDNA 4LUBA 2MKSA 2XG8A 1LV5A 2F3JA 3BN4A 4OJ1A 3OPKA 3PKMA 1TUGB 4B08A 1UJ4A 3KJFB 1SJ4P 2UXDF 4U7UD 3SYZA 3JSMB 4KGMA 1NB7A 3SDEA 1EP4B 3AXMA 4O44B 1Q95G 1Y5NB 3L4BC 3MUMP 4DR2F 2B43A 3SSQA 3ZNJ1 1U2RA 2ZOGA 2YKAA 5B0EA 5KAKA 4DUYF 1IM4A 1EIYB 3AHPA 2SXLA 3A8EA 3JS9A 2NPFA 3TA1A 1KVJA 1GX5A 1VQKS 5HO4A 3HJFA 1BQNB 1S49A 2GFFA 3TAMA 1VLYA 3A8IA 5ETLA 2C28A 2BOPA 2MPUA 4TY8B 4XAKA 3VALA 5LXYA 4PKDB 1VJQA 1NK4A 2EK1A 1KLMA 1FNMA 2LKZA 4M5LA 5KG7A 4CT9A 2XMUA 4QIEA 1HQUA 4EBDA 1S1VB 2A10A 5AE3A 1BXNA 1T95A 1N8RT 4DX7A 3P4UB 4AFFA 4EI2A 1WWHA 5KOXA 3DRSB 3GSDA 4UOCA 2QSFA 4J37A 1IJFB 1WG1A 3ICLA 4F4ZA 1NK0A 1HARA 4CO3A 5H9EJ 1DQ8A 3RW7A 1JKHA 5IQ6A 2Q3PA 4DV7J 4X4TA 1RKJA 3LWLA 4LF4J 3SBMA 3BF4A 2CADA 1PYOB 1ZM4A 2JSXA 4K4YA 4J9QA 5DS7A 4JI5F 4JI0J 2N3LA 3IRXA 1SV5A 2QLWA 3LPYA 1UP1A 4IO1A 4YOEA 3L7UA 2DNLA 4XO0A 2EXUA 2Z2MA 1RTDA 1QM9A 2HG4A 2NXNA 4YHHF 4CYUB 3NGDA 4DF4A 3ETOA 1BE4A 1FD8A 3N9UC 1RTIA 2BQRA 3K8VA 2I5JA 3S6EA 2BXJA 3FQLA 5KFBA 2X1BA 3MFHA 4B17A 5RUBA 3I0RA 1IBCB 3ZO7A 4WE1A 2QJ3A 3SCKE 2MKKA 5KOWA 2Z2LA 3JSBA 3V5RA 3HVAA 4UOGA 3E8OA 2CPZA 3I5BA 1H0HB 1VR6A 2F4VF 1R8BA 1PO6A 2E9ZA 3G9CA 3DYAA 1MG7A 4RNMA 3PR4A 2JEJA 3KK2A 5D3GA 3BS9A 4C3LA 4IDKB 5KG1A 2BJEA 4ILLA 2BVZA 4F04B 2Z56B 1JLGA 2BEFA 3SQGA 3M7VA 4KAIA 1S1WB 2CNNB 2LXFA 4NYZA 2CZVC 2LEAA 4DFKA 2NQPA 5J2QB 2AGOA 5J2MA 3T6JA 2GX8A 1JXEA 5K9FA 2HZVA 2WBRA 2W7PA 2DR5A 1OMSA 4L72B 2EFGA 4RW8A 2L9WA 3TUJC 4ZVRB 2DBBA 2YWWA 1QVGR 4KRWA 2V8DA 2AJQA 3M6VA 2C3OA 2KN4A 3DDNA 4NEYA 1CJKA 4DV6J 1KVIA 4K0KJ 5KFNA 8RUCA 2NZCA 2DNHA 2WVBA 3MDFA 2P9EA 3UN3A 2DCUB 1ZA2B 3LP0B 2U1AA 4DS5A 2KT3A 2VOPA 1RJJA 1RQ0A 5E3QA 4LF4F 3BO3A 1JLBA 4JI3F 2BQUA 7FDRA 4LR9A 1T9WA 1SUQB 2V6AA 1YRTA 3IR6B 5JVHQ 2CZ4A 1FWKA 1F0XA 2HS0A 1X0FA 1HYSB 4OZLA 3W2WA 3TUZC 1JB0C 4ECVA 3FBBA 2ASJA 4RW4B 3HDSA 1R8AA 1DQ9A 1U02A 1I3OB 1SQFA 1BY9A 3I5CA 4ATNA 2R8HA 1HWIA 2NZ4A 3CC7S 2N4DA 4J91A 3WDOA 3QBCA 2ZBQA 3JQKA 4FKXA 2IC3A 4DHVA 5GVQA 2HHHF 4RW8B 3M8ZA 5HBMB 2Y1RI 2PDAA 3KJQB 3HPOA 3QIPB 3GV8B 4MKBA 5ADZA 3EZ5A 2MKCA 2H4YB 1TL1A 2PGCA 5IM0A 2ZHBA 4LQ9A 1YJ9S 1IN0A 1N88A 3M30A 3OXGA 2B9WA 1M1GA 2B5JA 2WW4A 2B9XA 3KHRA 3VCDA 4PQUA 4DG1B 2ZM6J 2AJ2A 2DNMA 2GVDA 4KT0C 4NI2B 4NZ7A 2LQJA 3TX8A 1Q86T 4KTQA 4A8OA 2D41A 1IBKJ 3MF5A 1SI9A 4J9LA 2MZQA 2IBKA 1CC7A 1C0TA 4WFYA 4DMZA 2NREA 3LA0A 4AL5A 1RA7A 4RW4A 2P2CB 3UN2A 3VVUA 1GT8A 3EXYA 1S6UA 2B6AA 4AQYF 2XY6A 4OYOA 4QR0A 1R6VA 2GNKA 3GG0A 3TQEA 5CYQB 4R8UA 4CLFA 3GFYA 1FFGB 1WG5A 4P71A 4O44A 2M9KA 3PO4A 3CCZA 2V0NA 3QJJA 1AFJA 3D67A 1Z1ZA 3HVWA 2AEMA 4I68A 2N3OA 4OV6A 3N0VA 3FUYA 4JI6J 3JSMA 3KG4A 2HHWA 3AQPA 5C42B 1QD1A 4DV2F 1N5YB 4BCAA 2OPQB 2NUHA 5HANA 4ECUA 3S8SA 4ICLA 2HZAA 3D3BJ 5T7LA 4M5HA 1ZM9A 3HFVA 3Q0AA 1EX8A 3TZXA 1QUPA 3FSIA 5BYRA 4JV0A 3NXZA 2FJAB 2B5JB 4F4WA 4B3MF 1L3UA 3K7RA 4Q7AA 3T9ZA 4P10A 2Y8YA 4ZP7A 5MLCV 1NM2A 1XR6A 2GZOA 4DCOB 1YZ7A 3D9BA 1KFDA 3UI3A 4BC7A 2MB0B 2Q6CA 3JSYA 3JAMU 1VQ4S 2IC3B 1YJ7A 2FDNA 2Y3YA 1VBYA 2KZZA 2NSCA 1K9MT 4IH6A 4NLTA 2AJ4A 2ZBPA 4X62J 5DQIA 4X2BA 2DIVA 2OPRB 2HVZA 3M8WA 2ADBA 2ZVSA 1WORA 2KYXA 1IR2A 2XBPA 4ZMMA 1JWWA 4KB7A 5KFIA 2G13A 4PG5A 5LMNJ 5L1LA 3I9V9 1S6QB 2QA4G 4FXDA 4G1QB 1FWLA 1RTDB 2V2QA 2ZOMA 4NLDA 5MAOA 4YR2A 3KUEA 3O8WA 3DGPB 4ED0A 4ZA1A 4Y2MA 4KHPJ 1OPZA 1HBNA 4FPIA 3IRXB 3U7JA 3PACA 1OJ4A 3OFFA 3H90A 4OJGA 3W8PA 2QA1A 1YGYA 1RTHA 1W7WA 3IG1B 1Q78A 3BSAA 2WOMA 7FD1A 5F3ZA 1HHTP 2HMIB 3IP0A 3TX0A 1N48A 3HT3A 4HLBA 1XNQF 1EZZB 3L7OA 2AX0A 2HHPA 2VG7B 1RT2A 2CAJA 2MTLA 2QG9B 2Z58B 3KUGA 3R5BA 4DEZA 3R97A 4QWDA 2KM8B 1U49A 2HW3A 3UVJB 5HMYA 4QPXA 1NXIA 1OSCA 4MKAA 4NRUA 5HN0A 1DQAA 3EGVA 4ELVA 1FO1A 4LF9F 4R5PA 2EBEA 4LFAJ 1SIZA 1AZSA 2YNIB 3BH7B 1H7WA 3FRYA 4NLGA 1NK8A 3F41A 3CCES 4C98A 1QAXA 1CULB 2O67A 1ZZNA 4WWSA 2WCXA 1N4LA 3I55S 4NLQA 2R8GA 5L8RC 3Q86A 1RXOB 1LWCB 1R0AA 1F3FA 1VIOA 1FX4A 4PABA 2YKPA 3RRKA 3TEHB 4F0KA 2J6SA 3HXMA 3GYNA 1O5JA 2YX4A 4HI2A 2HSEB 2ZJRQ 2OEJA 2F4VJ 4GKKF 2C2ZB 4ICLB 4ZPCA 2HHXA 4DR6J 3AB4B 3OHBA 5DETA 1FK9A 5DQHA 3P8BB 1F2GA 3HHLD 3DRRA 3FC9A 4P7VA 3BKUA 1TK8A 2L9NA 1RAJA 1SJQA 2AYEA 1YRXA 3DU5A 2KT5A 2HURA 3CJRA 3NKYA 2XNQA 3CJ8A 4I7FB 2B4OA 3DC2A 3L7PA 4PZVA 5D78A 2ZH7A 3BO2A 4IRKA 1BWEA 3K5OA 5ETMA 3VZHA 2RU9A 5KFVA 4QYRA 1K0VA 3IWNC 1KQGB 4NE9C 1G4CA 5CYMB 2E7VA 2IJFA 3NEKA 3SCIE 1R0AB 2MYFA 3CDEA 3N6LA 3GIJA 1G6BA 3CCVS 1VQYA 1IKVA 3Q23A 4V1Ak 5IT9U 5KT2A 2BKOA 4X64J 3IAM9 4A46A 3IBFB 5GADI 4DL7A 4J9KA 4NL5A 3PDNA 3OV7A 2CVIA 3M30B 5IWAF 2UV8A 5ETRA 3ENQA 2L41A 3DLEB 3NRBA 5C25A 2XWYA 2A2DA 1IM6A 3MAHA 4MJKA 2PMZD 5CYJA 2ZD1B 5HMWA 3U1NA 2AEJA 3LP2B 1RI7A 3HKWA 3MUVP 4OJHA 2ZC3A 1R27B 4F25A 4A8FA 3NWRA 2W9CA 1FNXH 2DNKA 4HR2A 4K4VA 3VAGA 1L3VA 1N33J 4RNHA 1XBWA 2I9SA 3H59A 2V63A 2XGPA 2X1AA 2FZGB 4ECXA
chains in the Genus database with same CATH topology
1TR0A 4AL6A 5K14B 3SI8A 1X4GA 3MM9A 1RT5A 4W90B 5BJRA 2B6AB 4K50A 2B51A 3HZEA 3M2UA 4IQXA 1QJHA 4UUXA 4EO6A 1LK5A 2CJ9A 1DTTB 4ED8A 4DL6A 1LW2A 4NYOA 1Q81T 1FEEA 4I64A 3HHLC 4YEAA 1RWUA 3KTQA 3BGFA 1F60B 2CG4A 1T94A 4N5SA 5J2QA 1KR4A 1UKUA 1JMTA 2ZE2B 5JXSA 3Q8SB 3VAJA 3N5BA 5DJBA 1TAUA 3KLFB 1SKSA 3FGVA 3VQTA 2BM0A 4PUOA 1HQUB 4OHYA 3EPGA 1ZPWX 3MUTP 4O23A 1KOHA 4U6PA 2OH2A 3CMES 2FVSA 2KJWA 2O3DA 1VC5A 2RKIB 4I6YA 1MMDA 4DFPA 2VOOA 1KQSR 4I2PB 3U1MA 4TKTA 5KTQA 1P27B 2DGUA 3KLVA 1TKTB 2AV5A 1NRKA 4QWBA 2BE2B 1CQMA 3PV8A 3MXHP 1X4DA 5BYSA 4Q43A 2W9BB 4EBEA 4ZVHA 1Q8BA 3NMRA 5F8IA 2V8VA 3C3LA 2YVSA 1DBDA 3C6TA 5A6PA 5J1PA 2MSTA 2M2BA 3NS5A 2EFQA 5F41A 1X9SA 4K59A 3QGPA 1U2FA 2ROPA 3LO3A 3LOUA 3VAIA 5DDRC 3OXFA 4MIBA 3X3UA 3DM2B 1FRJA 5KFCA 2UUCF 3HVTA 1HD1A 5D3GB 5AXNA 4RW6B 3CC4S 4OHWA 4IFYA 3GG1A 3TAPA 2CKWA 2VB6A 4P6QA 3OL6A 3UD3P 2OPQA 4HTJA 3M6XA 3KNAA 2GCFA 2DH8A 2R7SA 1OPIA 3KG0A 2CQBA 2UP1A 2ZKTA 3G6XA 2MHEA 1S9EA 1UA0A 3UD4P 4IRDA 2WONB 3QO9B 1PC4A 3HP6A 4QU7A 1CLFA 4DFJA 4HKQA 1TL5A 2AD9A 2ASDA 4PR6A 4OL8A 4B3TF 1U1LA 5IT9Y 2ZM6F 2JRSA 5F3TA 1YHQS 1T03B 5IT0A 3KMQA 2OIHA 3HVRA 1S76D 3DRRB 1C0TB 2HZCA 2V4QA 4L3NA 4CIOA 1N54B 1OWXA 5DGBA 3S1TA 3DMJA 2YNGB 3UCUP 3RZAA 4MK8A 5LXRA 4JV2A 4ZPTR 2DPIA 5J2MB 2Y1JA 1O0PA 2LECA 4J5OA 1Y9OA 4B3SF 3UPFA 5L9NA 1FJEB 1HWJA 1V3ZA 2JX2A 3IXQA 2K1RB 5DGAA 2MZRA 3K5PA 2CQ2A 4NWBA 2BBEA 3OLAA 3LP1A 2B7CB 4X64F 4EGLA 3MEEA 2PEHA 3JTNA 2VA3A 1UEVA 4ZCLA 1VRTB 5J2PA 4P7TA 3BSOA 1U1RA 2PT0A 4AUKA 2KKHA 4F8RA 3MEDB 3CJ5A 4WCEQ 4D3GA 4H4MA 3R1HA 1X9MA 3J7A1 1DFDA 4DR6F 3CO9A 2W9BA 4OZ1A 4CO2A 1S1UB 1W25A 2QMWA 3CJ4A 4PG8A 1HI1A 4LFBF 1JK9B 3C6TB 1JLEA 4BWJA 3C2PA 3IG1A 1MMLA 3RR7A 5K14A 2MGZB 1CC8A 3MMAB 1BD6A 3E51A 2FHKA 3W7BA 2BUNA 3MM6A 3CDWA 2FGCA 4KKOB 5CCMA 1SQEA 3KLGB 1VBXA 3NAIA 1MNEA 2WTFA 2RVJA 3LGNA