3I0SB

Crystal structure of hiv reverse transcriptase in complex with inhibitor 7
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 105
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0sB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sB04
2YNFB 2IA6A 5KG6A 5C24B 1LWEB 1IKWB 4IR9A 4NZ0A 3VQSA 1JLQB 1GX6A 1FKOA 1HNIA 1MU2A 1RT6A 1S6PB 3T5HA 2HNDA 3MEGB 2BQRA 3HVTA 4ECQA 5J2MB 1S6QA 3BSCA 2J6TA 2C22A 2BRLA 3JSMA 3KK2B 3QZ7A 4QW9A 3OSNA 2W9CA 2W8LA 4ED0A 2W8KA 1RYRA 3M8QB 3KLGB 4NLVA 2C2EA 4RW8B 4ED7A 1LW0B 4RW9A 1HMVB 3G86A 1GX5A 4RNMA 3H4BA 2FVRA 1FKOB 4ED3A 1HNIB 1MU2B 3DLEA 1RT6B 1LW2B 4ZP7A 1HPZA 2HNDB 3KMSA 3HVTB 4J9NA 1S6QB 4ZPAA 4O3OA 5KT4A 1NHVA 3T5JA 1KHVA 5EUHA 3G6VA 2F8EX 2HWHA 3CDWA 2W9CB 1JLFA 3QZ8A 4EBCA 5DGAA 3H2LA 1REVA 4NLSA 2AU0A 2ZE2B 1XR5A 4LSNA 1DTQA 1RT1A 4ED2A 4H4OA 4RW9B 5CYQA 2ATLA 4YR2A 3UR0A 3GV7B 1K1SA 1JLCA 3DYAB 4MK8A 4TXSA 4YR3A 1WNEA 3KLFB 2E9TA 3DRSA 4H54A 1R0AB 4NCGB 2VA2A 2ZKUA 3PZPA 4ZMMA 2ASLA 1HPZB 3TAMB 3DLKA 3DOLA 4DL3A 3ITHA 3LAMA 4NYZA 2XC9A 4RW6A 1S1WA 5KFHA 2YNHB 5F9NA 5KT5A 1RA7A 5DLFA 1FK9A 1JLFB 3FRZA 4ECXA 5EWEA 4WXWA 4IKAA 4IOBA 2B5JA 3DI6A 4ECYA 1DTQB 1RT1B 4QWAA 4H4OB 5CYQB 1SH0A 4QWBA 4IRKA 1MMLA 1VRTA 1T94A 1HQUA 1JLCB 2AX0A 3GV5B 1RTIA 3DRSB 4URGA 4MKBA 3LAKA 5C25A 5C42A 4PWDA 4MIBA 3KNAA 3PJWA 3DLKB 4RW7A 3OHAA 3H5UA 5KFGA 3I0SB 1C0TA 1SV5A 1JLBA 2GIRA 4JV1A 1D0EA 1JIHA 4IQXA 1FK9B 1QUVA 1S9FA 3V6DB 3QGGA 4YMEA 3MR3A 1HQEA 2B5JB 2YKMA 3DI6B 3MF5A 4ECZA 3PVXA 1TKTB 1TVRB 1VRTB 1QAJA 5KFYA 1HQUB 1RTJA 5DG8A 5F9LA 1RTIB 3QIPB 3I5CA 4O4GA 4NLDA 2UUTA 2BE2A 4MFBB 1RDRA 5C25B 2GC8A 4IR1A 5EWFA 3MFHA 4J9SA 4RW7B 4J9RA 3MFIA 2R8GA 2BRKA 3ICLA 1ZTWA 5F8IA 2JEIA 2XCAA 1C0TB 1SV5B 1JLBB 3RBDA 3RB0A 3C6TB 3UQSA 2JLEA 5K14A 2FLLA 2FVQA 2O5DA 5JUMA 3C6UB 3BQ1A 4F50A 4ED1A 3H59A 4WFZA 2IBKA 3TVKA 2IM0A 1EP4A 2JC1A 4RU9A 3G6YA 1UWBA 1T3NA 1QE1B 1RTJB 4I7FB 4IG3A 5D3GA 2I1RA 4O4RA 1RT3A 1TL3A 4B3OA 3DRPB 4TY9A 3KHRA 4IFYA 1VRUA 3SI8A 1ZETA 5KG1A 1EETB 1BQMA 4KBIA 1XR7A 5KFCA 5KFQA 5F8NA 2WB4A 3NBPA 2VG5A 3OL9A 3LP1A 1S1TB 1TL1B 2IC3A 3BSNA 2DPJA 2V9WA 4ECVA 5KT3A 4YP3A 1TKZA 4PUOB 1LWFA 2WCXA 3H5YA 2RDJA 4KHRA 3LALA 4WZMA 5DQHA 4IG3B 3KHGA 1RT3B 2YNFA 2OPSA 3PW4A 4IFYB 5C24A 4IFVB 4RW4A 3V6HA 2RF2A 4Y34A 3CDEA 4DL4A 4F4WA 1BQMB 4FBUA 3I0RA 3MEGA 4WE1A 2ILYA 3NBPB 2VG5B 1S49A 3LP1B 4RNHA 2FJXA 2IC3B 4FS2A 2ASDA 4KO0A 2B43A 4J9MA 4F4YA 4NLUA 4Y3CA 1TKZB 3IS9B 3ISND 3M8QA 3KLGA 5L1LA 3FQKA 4LSLB 5KT6A 4J9QA 2HWIA 3T1AA 3GV8B 2OPSB 1JLEB 3D5MA 2B6AA 4RW4B 2RF2B 4J9OA 3T5LA 5HLFA 2C2RA 5L1IA 5DGBA 3NGDA 1LW2A 3M9NB 1NNDA 3I0RB 4WE1B 5EWGA 3TQ1A 3FQLA 3QGIA 4KO0B 4KE5A 1K1QA 1RTDA 3MEEB 2IJFA 1LWCA 1T03B 5F8GA 3GIIA 4FBTA 3KHHA 4Q44A 1DLOB 2ZE2A 4K4ZA 3E01B 3QGHA 2BQ3A 4I2PA 5KFXA 1HYSA 1TKXB 4ZP8A 3DYAA 2E9RX 2B6AB 1S1VB 3KLFA 3BREA 1R0AA 4NCGA 1S10A 5HLFB 2R8KA 1T05A 3PW0A 4ICLB 3TAMA 2V4QA 3CJ3A 3GYNA 2W9AA 3CVKA 2BQUA 1IKYB 3CWJA 2FVCA 1C0UA 5DQIA 3RB4A 2QV6A 2OH2A 1RTDB 2YNHA 1LWCB 4K4YA 1RT2B 5I3UA 2UVVA 2ILZA 4I2PB 4NLQA 4MH8A 3OLAA 1HYSB 3GQCA 3DM2A 3LP0A 4WYLA 4RZRA 4ZPBA 2RKIA 4G1QA 3UDLA 5KG0A 4K50A 2HMIA 5KG4A 1T05B 4XPEA 4TYBA 4U7CA 3H40A 4IH7A 1HNVA 2VG7B 3CO9A 4U6PA 3H4DA 5DG7A 4DL5A 2YKNB 2AWZA 2I5JA 3I0SA 2UUWA 4HYKA 1C0UB 3NAIA 3T19A 1I6JA 5J2PA 3RB6A 5KFUA 3V6DA 3G6XA 4X2BA 3IGNA 4KHMA 5I3UB 3CJ2A 4NLTA 1TKTA 1TVRA 3DM2B 1TQLA 2R8HA 5L1JA 2R8IA 5J2NA 3CDUA 2E9ZA 3LP0B 3CJ4A 3CJ0A 3QIPA 2FJWA 2RKIB 4G1QB 3M8PA 1QAIA 1YVFA 4MFBA 2HMIB 5F8MA 3LP2A 1N6QA 1IKVB 3V4IB 1HNVB 5FDLB 2I5JB 2R8JA 4TQSA 5HBMA 3C6TA 4RUAA 2YNGA 5J2PB 2XI2A 1W25A 1SH3A 4LQ9A 4MK7A 3SFUA 5KFJA 4YQWA 3PW5A 4GC6A 3PW7A 3C6UA 2IM2A 4NLGA 2WOMB 4ZP9A 2J6UA 2IAJB 4NRUA 1SH2A 5J2NB 4Q0BA 4I7FA 1QE1A 4G3IA 2D3ZA 3KHLA 5KG2A 3DRPA 3M8PB 4KB7A 4EYIB 3LP2B 1N6QB 2D3UA 4ZVHA 4EYHB 1EETA 4KFBB 1TV6B 4IRCA 3MR2A 3BSAA 4O3QA 5HBMB 3H98A 4ZPDA 5KFWA 2YNGB 1S1TA 3FSIA 1TL1A 3PR4A 2BR0A 5HP1B 2UVUA 2IM3A 2UVWA 1NHUA 4PQUB 3FDSA 4PUOA 1RT5B 4Q0BB 5KFIA 1S1XA 4M94A 4IFVA 2HAIA 3CIZA 4KV8A 2HNZA 1JLAA 3BQ2A 4RNFA 1BQNA 3LANA 5KFEA 5C5JA 4F4ZA 4R8UA 1C2PA 4ZHRA 5KFRA 3DRRB 2JEFA 2WTFA 3E51A 3IS9A 5J1EB 5KT2A 2V4RA 5T14A 4LSLA 3ISNC 2OPQA 4NLXA 4GC7A 1S1XB 4DEZA 2EC0A 1JLEA 2C28A 4TY8A 2VA3A 4KV8B 2JEGA 2HNZB 1JLAB 4IDKA 2OPPA 4MKAA 2R2RA 1BQNB 4NLOA 4RUCA 1JLGB 1RTHA 2AQ4A 3MEDA 4R8UB 3IRXA 5KG3A 1S0MA 4ZHRB 4ED6A 3MECB 3D28A 3MEEA 1T03A 4ECWA 4HKQA 5KFAA 3Q8SB 2WHOA 5KFKA 1DLOA 1JKHA 4XO0A 3E01A 4ZVEA 2DPIA 2OPQB 1TKXA 3Q8QB 3HVWA 4XPCA 4NLYA 3I5AA 4ZPCA 3KOAA 2AGPA 1S1VA 4TY8B 5EDWA 4EEYA 4IDKB 2XI3A 3PJXA 4KKOB 2OPPB 5KT7A 4ICLA 3HVAA 1RTHB 3N6MA 5KFOA 4WFXA 3MEDB 3IRXB 2HNYB 1IKYA 3KLIA 1Z4UA 2XGQA 3GILA 2AGOA 1RYSA 4I2QA 3DLGA 4ECTA 1RT2A 5HROA 5KFMA 2FVPA 4DL6A 1JKHB 3DOKA 4ECRA 5F8HA 5DLGA 4NLRA 4EO8A 3V6KA 3M9OB 3QO9A 2ZD1B 2R2TA 4QW8A 4K4XA 4RNOA 5CYMA 4K4SA 1XR6A 1ZTTA 4Q8FA 5KG7A 2W7PA 4O3NA 2FLNA 3M9MB 2VG7A 3QLHB 4DG1B 4JV0A 1N56A 3MR6A 2YKNA 2YNIA 3KLIB 4NLWA 2XGPA 4J9LA 4KSEB 1S97A 4I2QB 3DLGB 3KLHB 4ED8A 4H4MA 5HROB 3MTKA 5KFFA 3Q8RB 2JEJA 5DG9A 3DOKB 3PW2A 3SFGA 1RA6A 4KAIA 2W7OA 4Y2CA 3QO9B 1S4FA 1J5OA 5CYMB 4ZVFA 3NMAA 2WK4A 3KMQA 1KLMA 4MK9A 1IKVA 3RAQA 3V4IA 1DTTA 3OL6A 5FDLA 1N5YA 5KG5A 4K4VA 3HHKA 2YNIB 2CJQA 4TYAA 5JXSA 2FJVA 2J6SA 4MIAA 2AGQA 1N48A 5L1KA 1JXLA 4O3SA 2WRMA 3GIMA 5KFBA 3IN5A 4H4MB 3KLEA 5KFPA 2BANA 5L9XA 3GIKA 3JSMB 1HARA 1RAJA 4EBEA 4DL2A 1SUQA 4WZQA 3NKYA 2WOMA 4TN2A 3RBEA 2IAJA 3UPFA 1J5OB 1IKXA 4IG0A 1KLMB 1DTTB 4KFBA 1TV6A 1C1CA 3DLEB 1N5YB 3EPIA 4K4WA 3KK3A 3KLVA 1TP7A 3RB3A 3KJVA 3KLEB 5HP1A 2D41A 3BGRA 2BANB 4EO6A 4PQUA 2OPRA 4ID5A 3BR9A 4TQRA 5J2QA 4Y2AA 1SUQB 3MR5A 4EBDA 1S9GA 3CJ5A 3V6JA 5KFNA 1REVB 4O3RA 3EPGA 1RT5A 4LSNB 5KFZA 2XWYA 1U09A 4ECSA 2FLPA 4JUZA 1IKXB 5KFVA 4IG0B 4O3PA 1S48A 4IH6A 4K4UA 1C1CB 3I5BA 3KK3B 3N6LA 3DOLB 5I42A 3KJVB 3ITHB 3BGRB 3DRRA 3HKWA 4RW6B 2OPRB 4ID5B 1S1WB 4O44A 4YR0A 5J2QB 5J1EA 3IGVA 4WXOA 2ASJA 1S9GB 4R5PA 3OL8A 2XCPA 3DMJA 4ECUA 2IJNA 4R0EA 3IG1A 2RDIA 3GIJA 5KFDA 4URSA 5DQGA 1S1UA 3KK1A 4NLPA 4RNNA 4OL8A 2D7SA 3OSPA 1RT4A 3OL7A 5C42B 4PWDB 3FFIA 4IRDA 4WFYA 1JLGA 5I42B 2IMWP 4Q8EA 3BSOA 1RT7A 4F4XA 4Q45A 3MECA 2ALZA 2WONA 3QYYA 4O44B 2R2SA 4QWDA 3OLBA 4WYWA 4R5PB 3OHBA 2W9BA 2R2UA 3DMJB 1HQEB 2YKMB 1N4LA 4K4TA 3IG1B 5KFSA 1S1UB 3KK1B 3BJYA 4J9PA 1D1UA 4O4GB 2GIQA 1RT4B 2IM1A 4KKOA 2BE2B 3N6NA 3H5SA 3JYTA 3FFIB 4NRTA 5F8LA 1FKPA 4J9KA 2UVRA 2JC0A 2VG6A 1C1BA 4ZP6A 5F8JA 1RT7B 2HNYA 4QPXA 2FVSA 4ZVGA 2WONB 1KHWA 5KFTA 4QWEA 3T5KA 5K14B 2C2DA 3PHEA 4URQU 2W9BB 1EP4B 3QIDA 1IM4A 3V81A 1S0NA 1UWBB 4Q43A 2ZD1A 5D3GB 2QE5A 1S9EA 3PR5B 1TL3B 4B3OB 4M95A 3EZUA 1OS5A 1JX4A 1VRUB 3JYTB 1LWEA 1IKWA 1FKPB 2CKWA 1S0OA 1JLQA 3BQ0A 2VG6B 2AX1A 1C1BB 3QLHA 4DG1A 3RAXA 3NAHA 2V0NA 1S6PA 3NL0A 4IH5A 5J2MA 3KLHA 4QWCA 3H5XA 4FS1A 3Q8PB 4TLRA 3KK2A 1LWFB 1CSJA 3V81B 4RW8A 3DDKA 5KFLA 1LW0A 4DL7A 4LQ3A 4JV2A 1HMVA 1S9EB
chains in the Genus database with same CATH superfamily
1XNRJ 1NM2A 2VHGA 1RAIB 4X4SA 1RT6A 5ETLA 1IBKJ 3TUJC 2H1YA 2C1EB 2BRLA 4LF7F 3G86A 1HNWJ 4JI0F 2KFNA 4F3OA 1QJHA 2FVRA 4ELTA 3KMSA 2YWGA 2NSBA 2R4FA 2W9CB 2ZE2B 2MKIA 2CPFA 1R0AB 4NCGB 2FY1A 2XG8A 4PR6A 3IR5B 2AYBA 4UY8T 4LRCA 3PDNA 1PG5B 3JSRA 4DBQA 4H4OB 1SH0A 1RISA 3J81Y 4URGA 2WAQD 4B3SJ 1S9FA 3NNCA 1UPPA 2M8HA 5HSPA 5DG8A 2GC8A 4IR1A 2AF6A 4J9SA 2EBGA 3K57A 3GE9A 3S7RA 1SV5B 3BKTA 3RBDA 3RB0A 1JK9B 3M7VA 4ED1A 3THVA 3MAQA 4IG3A 2HVHA 3PKMA 1VRUA 5JMNA 4B02A 8ATCB 5CCLA 1XR7A 3OL9A 3AH6A 3BO3A 1TKZA 1WF1A 1VC6A 2B9YA 4PAAA 2YNFA 4IFYB 3GJQB 2NSCA 2RB7A 4DFKA 4DR7F 2FYXA 3HM9A 2HBQB 3I9V9 4LSLB 4J9QA 1N5QA 4CLFA 1M5OC 4ZVUB 2M8DB 2P6TA 1IBCB 4UTGA 2P9EA 3M9NB 1NNDA 3TQ1A 3QSIA 2I9SA 2J9DA 3QGIA 2HYIB 3IO1A 2GNKA 2ZH7A 4DV7F 2IJFA 1U6ZA 1RADB 2M7SA 2E5HA 2W2NP 1ZYQA 4DPWA 5CCMA 1WTBA 5DQIA 1XNQF 2QV6A 2CQ3A 2HS3A 2NYHA 3DM2A 3CJ8A 5JVGQ 2WVCA 1T9VA 1HNVA 4C8LA 3I0SA 3RB6A 3CULA 2WSCC 3BYPA 2P6SA 5H9EK 3CJ0A 4LFCF 2ROPA 2LQ8A 3JTOA 2BKNA 1BHNA 2B8PA 3DRPA 4EYIB 3T6JA 4A8KA 3AOBA 3H25A 5M2UA 2FY8A 1V3ZA 4LF5J 2WZ1A 2HWTA 4Z7CA 1HWIA 2UUCJ 4RR5A 3NY0A 3WX8A 5HVFA 2ADCA 2LQJA 2V4RA 1UAWA 3GJSB 2CQBA 4DSKA 3T6BA 1CJTA 2ZBQA 1SBRA 5LT5A 2OHDA 4RUCA 3IRXA 1T03A 2DCUB 1RBLA 1F60B 4X64J 1CQMA 3KJFB 5EDWA 4ED5A 2GGPA 3M2UA 2HNYB 1J2VA 1UTAA 4DL6A 3TAQA 3OT9A 4EO8A 4F7VA 4CT8A 1NKCA 3LWLA 2FB0A 4O3NA 1EHWA 4AFFA 1S97A 2DB1A 5KFFA 3DOKB 4CQ1A 3WBZA 2MKYA 2FUG9 1TAQA 4JB8B 5K8PA 4OI1A 2XY7A 1Y9OA 5H9FK 3WHIA 4L74A 4GVBB 2GJIA 3MURP 4IG0A 3FNNA 4K4WA 2YKAA 4E98A 3KJVA 4IR9A 2BANB 2UU9F 1IKXB 1RXOB 2QL9B 2C3PA 3GFYA 2MB0B 4OJGA 3MEKA 3N0VA 4RW6B 1S1WB 3VAIA 5HL7Q 1QSYA 4R0EA 2RDIA 4DQIA 4CLZA 4GKJF 1KVIA 3AD8C 4PG7A 3T41A 1KP6A 4ANDA 2GO9A 3W65A 4KGVB 5E3RA 4GRSA 5IC4B 2BE2B 4OHZA 3HSDA 1C1BA 5K14B 4URQU 1OJ4A 3TP2A 3SV3A 2V2QA 2QE5A 2Q1LA 3OW2R 2XLJA 4DG1A 4DLGA 3NAHA 1FDAA 1K0VA 4CP5A 1FF2A 3PEJA 2CFXA 1HBUB 1X4AA 2OP5A 2HVEA 5C24B 2LECA 2Q43A 1R8PA 3G96A 3HLUA 2KRBA 5GAEU 1HBOA 1WORA 1MU2B 3FCVA 4GO7X 2CQ0A 1RWWB 4P74A 1NHVA 5BR8J 2YQ3A 4CLPA 1H6KX 4NLSA 2G13A 4EU0A 3I55S 2ATLA 5CYQA 1T7PA 2ZH1A 2DKOB 2KN4A 1HPZB 1N33F 5CAAA 1U49A 4FKYA 2BJEA 1JB0C 3AA9A 5K8MA 3CCLS 3NG8A 3MM6B 3BS9A 3EVMA 2QA4S 3KNAA 3PJWA 4EGLA 1FRMA 4UOGA 3T9NA 2CRLA 4DR5J 2E7XA 5G0RB 3WDOA 1RHJB 4DUYJ 1X5SA 1PJ6A 5E3AA 1UETA 2ZNYA 3P5TL 4O0IA 3M4XA 2IM0A 1EP4A 3MM8A 3RRGA 3BN7A 2IIHA 3G8SA 1YBTA 4KBIA 3OTEA 5F8NA 4OX8A 4EUVA 4X66F 4CT9A 4AXJA 3V6HA 1SL0A 3MEGA 5LL6d 1TMMA 5DM7Q 2L9WA 4RW4B 4RKUC 4J9OA 1WWHA 3QAEA 3FEXB 5AXKA 2YWKA 1LNQA 4N8OA 3PW0A 3MM7B 3CWJA 2VC1A 2YNHA 4X62J 2XB2D 1M5KC 4ZPBA 3LTOA 3W8GA 2YKNB 3R2DJ 2F3JA 2XYPB 2HHWA 1IR0A 5KFUA 2YH1A 3W1YC 5HANA 4C97A 1IWGA 2RKIB 3LPYA 1S76D 1NPRA 2UXDJ 2ABYA 3HJFA 4ZCIA 3QATA 2KM8C 2XY5A 3CC7S 2DH7A 4GC6A 4CH0S 3CXCR 1XERA 3TA1A 3DFEA 3N01A 3EGWB 3J7AN 4KFBB 1RI7A 5A2QY 4IRCA 3D54A 2VFSA 4H4KC 2UVUA 2IM3A 2CPDA 2J9DE 3AQPA 3A4TA 3BYRA 3BZQA 4CZCA 4ZJQA 4K2JA 1P1LA 3DRRB 2GMLA 1WC6A 5A0YB 1X4CA 4XDDA 3UR3C 3FJ2A 3W2VB 4DEZA 1UVIA 1C4AA 2JEGA 4E8UA 2E5JA 1VYAA 1QTNB 3D68A 3CDAA 2GAHC 2AZ3A 3E01A 2IDEA 1F6TA 2VB6A 1VI7A 3IM9A 1OPZA 2BXJA 2C3YA 2B7CB 2OPPB 2BM1A 4Q7AA 2CJXB 2K8GA 4OHWA 2KXNB 3KLIA 2K1RA 2BVZA 1R6VA 1ZBTA 1RHQB 4USJC 4BC9A 4ETXA 2ZD1B 4F3MA 1CULB 2KVQE 1VBKA 5EX0A 3SV4A 4CLUA 2DR5A 4ED8A 2LEBA 2XMWA 4PYDA 2XHCA 4C3LA 2Q3PA 4KAIA 4Y2CA 3TA2A 5FDLA 1UVLA 4ES3A 2RQ4A 3KLEA 1S99A 3GIKA 2AHOB 1SUQA 2DNLA 2IAJA 5A8RA 1M1KT 2HVZA 2YPZA 3OR1A 3UD3P 1N88A 3DLBA 5J1PA 3POTB 4EK2A 5DM6Q 5HP1A 3BGRA 3BR9A 2H5JB 2RUGA 1S9GA 5KFNA 5LSLA 1HI1A 3KDOA 2VBXA 1RU2A 1UA1A 3VAHA 4Y28C 3R5GA 1TR0A 1S79A 5I42B 4ILMA 3PX0A 1FFWB 2ZH4A 1X7VA 4KQZA 1LK7A 1G3OA 1D1UA 4O4GB 2G0CA 2HGNA 4M5DA 1KC8T 4J9KA 2UVRA 4DSIA 2K3IA 2M2BA 3THTA 2DNOA 3CD5A 2AYMA 1B0TA 4AQYF 3KNGA 1D3WA 3DU6A 1JX4A 4U9RA 3RAXA 2QYGA 3VF0B 2ZM6F 1YRTA 3EXYA 4FPRA 5KG6A 4NZ0A 1FKOA 1SC3B 1DY3A 3MUVP 2ZH3A 3D6HB 4ZPWR 1R8BA 2VKZG 4DFJA 4ZIWA 5FLXU 3KLGB 4RW8B 1LW0B 4RNMA 2HQ3A 3A12A 4C11B 1XEZA 4I67A 4KH0B 4ZP7A 1SL1A 2V94A 4J9NA 1U1LA 2DY1A 2B7BB 2AU0A 4JI1J 1YRUA 2YY3A 1WNEA 2HHHJ 4ZMMA 3EWGA 2QLXA 3PACA 5KFHA 5ETSA 4IOBA 4ZJOA 2NCKL 3QJJA 2ZNZA 3H5UA 1CJVA 2E1RA 1D0EA 3Q0AA 1JIHA 2W1BA 1FK9B 1FX4A 2B5JB 2DXFA 3I4HX 2BOAA 4JI3J 1RTJA 4OYXA 4DF4A 2XWXA 1RDRA 2BMBA 2CADA 1YKWA 3AY0A 3DHWC 4P10A 2YWEA 3FCWA 3VQTA 1T3NA 3HULA 2LXFA 3CCES 4B3OA 1EAYC 3ZZ0A 4RWWA 5KFQA 1LWFA 4OHVA 1YJUA 2VF3A 4Y0FA 1MMDA 5GAHU 4KGZB 2CYYA 2YWFA 4X4RA 3LP1B 2ASDA 3AOCA 3ISZA 3ISND 3ADAC 2XMKA 2NPIA 4P7VA 2GFFA 2QFIA 1RTDA 3G2XA 2CAJA 2ZH2A 2CG4A 4K4ZA 1DLOB 1IBMF 1NH8A 1XTZA 3OR2B 4M5MA 3BREA 5IQQA 4I6WA 5LMNF 1N54B 2CPXA 3TAMA 4WCEQ 2BQUA 3N9UC 3QT5A 3RB4A 3EZOA 3ZZZA 2W25A 2UP1A 3MCMA 2OELA 2UXBJ 5E3PA 1HFEL 1T95A 3CCSS 1VR6A 3CO9A 3NAIA 1PKUA 3T19A 1TKTA 3J81U 2UXCF 1WG4A 1H3DA 3AOAA 2C3UA 2I5JB 3Q2TC 4Y2IA 2ZJPQ 3TEHB 2UV8A 2XLKA 4ZIVA 3C6UA 2X7IA 3H98A 1UEVA 2UVWA 2V8HA 1V3RA 3FDSA 2IVYA 5F3ZA 1RZMA 4DF8A 2HZVA 2HFVA 1JLAA 2VD3A 3UN5A 4OI2A 5THWA 5HO4A 5GAGU 4M1KA 2J0XA 4DV0J 2EC0A 4CO5A 3D1OA 3FVYA 4R8UB 3EXCX 1SQFA 2MQPA 3PJXA 3TUPA 2VFUA 3N6MA 2G0IA 2GVZB 1IKYA 2ERRA 2HRTA 4AXIA 1S72S 4K4SA 5CYMA 5HVGA 4Q8FA 4B17A 2YNIA 4G6VB 4YB7A 4I2QB 3VR1A 1I94J 5HROB 2B9EA 1MSWD 2GO8A 4AD6A 3ENAA 2V68A 4DQRA 4MK9A 4LVOP 4EWTA 4TYAA 3JQJA 4EBEA 4ZCLA 4ZOSA 3MTJA 2QA2A 1ZZNA 4EFAC 4USUA 1N5YB 2VQEJ 5KAKA 1IJEB 2W2PP 1PO6A 2Y1LB 1FDDA 2CJBA 2G9OA 4RBTA 2VASA 3D4JA 4G1PA 3AAWB 4XK8C 3BSOA 4QOTA 2ALZA 4X4QA 2WONA 2BJ7A 4RO0A 2FGOA 1HI8A 1NAQA 3H5SA 1FKPA 1R0BG 2JC0A 4ZVGA 1NJYA 3OTDA 2BKOA 4G1IA 2H48B 5D3GB 5CZVA 1DQ9A 1JJ4A 4OYOA 1F5CA 1NDLA 2VH7A 1IBKF 2RU3A 2IA6A 4BCAA 3PM9A 1R6YA 2HKEA 1JJ2R 3JSMA 1ZPVA 3M8QB 1RWMB 4K59A 1TK0A 1RU1A 4JI4J 1U6BA 4PPZA 1CS4A 3I6PA 1SKSA 2VFTA 1DTQA 3GV7B 3DYAB 3KKFA 4TXSA 5IQ6A 4X4UA 3OFGA 2MQOA 2ZH5A 3HP6A 4DR4J 4OZLA 2Q6CA 3ITHA 2XC9A 4F4KA 4ZVRB 4LF6J 1GFWB 4IRKA 1QVFR 2AX0A 2HW3A 5C42A 4PRFA 1N5VA 1X60A 3S1TA 3IAS9 2C3MA 3PVXA 5AXMA 1TFWA 4JI8J 2A3JA 4NLDA 1SC4B 2R8GA 1WF0A 3C8YA 2FTRA 3MMBB 1A9NB 4HTIA 2EK1A 2AEMA 1U48A 1FO1A 1RJJA 3G6YA 1U0HB 4FNIA 2ZBCA 1ELOA 4N76A 4PG5A 2ZBPA 3RU0A 2V9WA 1X9WA 2CJKA 3H5YA 4KHRA 2C2NA 5DQHA 3DRXA 2LQ9A 4FBUA 1LOUA 4F4YA 3TOQA 2D74B 1B99A 5D15A 4YFUA 1U1KA 2Z2YB 4DCJB 3MM9A 4LR7A 3QRRA 4Q44A 2HQGA 1HIYA 1R8CA 5HLFB 1SL2A 2AZ1A 1LXNA 2F5GA 1FVSA 2E1AA 5GMKa 4DU7A 2CJAA 4N7TA 5CQGA 4XPEA 1N36J 4DL5A 2AWZA 1M5HA 4I68A 4OJ3A 4DZ6A 4OZ5A 5BXIA 2R8HA 2R8IA 5J2NA 3LP0B 4CO1A 3LP2A 2WBMA 1GTEA 4ILLA 1YITS 2FHOB 1UFLA 3GR0A 2XI2A 1W25A 3R7SB 2X1GA 4OYZA 4I7FA 4G3IA 4WIIA 2FLOA 2UUCF 5KFWA 3M30A 3LF0A 3C2PA 1NHUA 4W90B 1S77D 3B8HA 2VBWA 3CIZA 3MOJB 4ALZA 2XMAA 2H5EA 1GMUA 3OXFA 3ISNC 1FWPA 1S1XB 3N5FA 3OVBA 4KV8B 2VDHA 2DNKA 2Y0SD 4NLOA 1RTHA 5B09A 3MEDA 2E1MC 3RR7A 4JV5J 2RQMA 3EDRB 3BV8A 1HKAA 1RBAA 1VQ7S 4WIQA 3KOAA 2OEJA 1NK6A 1FXLA 3HVAA 5KFOA 1HNZJ 4BWJA 1AZSA 1T0TV 5IXUA 2PMHA 4A4JA 1X4FA 3LGMA 3V6KA 1OY6A 4NASA 8AT1B 3MR6A 2B56A 3R5JB 3O44A 5DG9A 3PW2A 1RA6A 2FJBB 3C14A 3DGPB 3CPWR 2CZ9A 4FYWB 4RBVA 2LQBA 3RW6A 2W7AA 3CSKA 4K7QA 4LF7J 3T1YJ 3NKYA 4JI0J 2F8MA 5IT9Y 2EW9A 1F1BB 6AT1B 3PXGa 1O5JA 1A0OB 4QZVB 1YGYA 3V6JA 3BGOP 4N8NA 3K2YA 1B64A 4ECSA 2DHSA 1Q79A 2BYCA 5A2QU 4IH6A 3MMAA 1C1CB 1CLFA 1RGVA 1SKRA 2BW2A 2H3EB 1NH7A 5J1EA 2ASJA 4R5PA 4ECUA 2IRYA 4FXDA 4F2RA 4CO4A 4IRDA 4WFYA 4F4AA 1ACMB 3T9ZA 1YIJS 1X4DA 4R0JA 5MAOA 1OQ3A 1H72C 2NXCA 3EMTA 3TVZA 2U2FA 2LXIA 3UCUP 3W7BA 4IOCQ 5A6WA 2E5LF 2BJ9A 2JL9A 2M70A 1H2UX 2HURA 1RAGB 3MM5B 1SI9A 2E29A 1UWBB 4RUBA 3M2VA 3C66A 3JYTB 1LWEA 2VG6B 1UJ5A 2R3VA 3ZZPA 2V0NA 1W26A 2MGZA 1RWVB 3P4UB 4OI6A 3NCQA 1E6VB 4DR7J 1JLQB 1HNIA 3KFWX 1S6PB 3JQMA 2BQRA 2AIRB 3NGUA 3HZEA 1TUVA 3OXLA 4OI0A 2MEWA 3MUMP 4B9LA 1S59A 4DV7J 1YSJA 1FA0A 2G2OA 5DGAA 1IBLF 2HFOA 3UR0A 2CQDA 4RBUA 3CJKB 3KLFB 2R7QA 3OJSA 1NPKA 5HATA 4OYPA 3BKUA 2ASLA 2CPIA 5ETOA 1XNQJ 4OJHA 3DI6A 3D0GE 1TL4A 1EJ7L 2MJNA 1VRTA 4DR5F 2PO4A 4CTAA 3NCRA 2BE9B 3E2EA 2Y1JA 5KFGA 2P9GA 2XY6A 1GQEA 4LFCJ 4DJBA 1ZA1B 1QVGR 1NB7A 5LJ5Y 3L9ZA 3LGHA 2R7UA 4PQAA 1WEYA 4LFBF 2O5DA 1SCJB 1QE1B 2I1RA 1TL3A 3VAFA 1WOPA 2VKRA 2DITA 3BPSP 2COLA 2W01A 3D3CJ 3NBPA 1TL1B 3BH7B 2OPSA 3K58A 3ILLA 4KO0A 3QFHA 2KJVA 2FHJD 3T1AA 2YH0A 2DO0A 3PO4A 5HQMA 1FXRA 3CMAS 3NGDA 1SJQA 5B0GA 4HR2A 3KUEA 4OX9F 3B6BA 2ZE2A 2YXLA 1TKXB 4OV6A 3TJAA 3NOGA 1R0AA 4NCGA 3NGSA 4NXNF 2EFQA 2EK6A 2J0QD 2QFJA 4QU7A 4O23A 1ZM9A 4DR1F 3GQCA 2DNNA 3A8EA 4MYTA 1R31A 1UZDA 1X0FA 2VG7B 2XMJA 1C0UB 5I3UB 2ZJRQ 4NMLA 1QAIA 5C2GA 2HMIB 3V4IB 2CDRB 4TQSA 2JWNA 2YNGA 2QX0A 4LF4F 1KBRA 4CLSA 2QGFB 3TZZA 1TV6B 3CCQS 2PFFB 2UU9J 1KR4A 2RHSB 4M94A 4LIWA 3U1MA 4V19J 5A8WB 2ZC4A 2XO6A 2R9LA 2DYAA 2JEFA 1N5SA 4BC7A 2P9CA 2H4WB 4LSLA 2XYHB 2C28A 4GKJJ 3D2WA 4GO5X 2HHXA 3ZZUA 4NYOA 3V2UC 5E33A 1JKHA 4Y6IA 1H98A 3UN2A 1IR1A 2P8IA 2CDQA 3K59A 5KFMA 2MQ8A 3LUYA 5KG7A 2K2PA 3R5CA 1C4CA 2G1HA 3M2RA 3DLGB 3KLHB 4ITSA 2KVIA 4ZK7M 4M5IA 3QO9B 3OL6A 5HQ8A 5KG5A 2IRUA 1RWKB 2VL1A 2C2KB 1EARA 3WZ0A 1PC4A 3UI3A 3CCUS 3M8YA 2B4PA 3WC0A 1KLMB 5JVHQ 5D0RA 3FGVA 4NYPA 4ID5A 4ZLNA 3CJ5A 4HHHA 2GS8A 4LSNB 4WFBQ 1N33J 1KVJA 3KK3B 1FWKA 3LO3A 4A8OA 3UDEA 4PWDB 3FFIA 3QGPA 2KM8B 3VGVA 2QA1A 2L9DA 3ZZTA 2YKMB 4UOCA 4K4TA 4CM0A 1RT4B 1F9FA 2HNYA 3BN4A 1KQGB 2QSFA 3CCWA 5A8KA 3K8VA 3BM7A 2F4VF 3D6TB 4QIGA 3TJ9A 2DGWA 4IH5A 4U8VA 4X66J 5LM7E 3V81B 1RP5A 1I5OB 5LJ3Y 1NBEB 1NRKA 1PYTA 3CC2S 3KK2B 4C48A 2HPUA 1PGZA 3KJNB 2A1BA 3UO0A 1HMVB 2NZCA 5L39A 1OSDA 1RT6B 1EX8A 1TUWA 2HWHA 2WSEC 2OAUA 3A3NB 3NOCA 4B9SA 2ZKUA 1UVMA 3EGZA 2DTJA 3AJ1A 2F7VA 2VBYA 4RW6A 1S1WA 4BWMA 2QYCA 4NE9C 1A6LA 3F44A 1RTIA 3UN3A 2GMJA 2JFDA 1QD1A 2RH3A 4CIOA 4Q2LA 1VQMS 2JDJA 3GFZA 5KFYA 2LU1A 3EM1A 1VGYA 4TVAB 2BE2A 1V9OA 5F8IA 2PFDA 4DV5J 2M52A 2XCAA 1S4EA 3ZTRA 5K14A 2ZBIA 1ZA2B 4UT4A 1ZETA 4KGXB 3B54A 5KG1A 3PX6A 3DLLQ 2VG5A 1JQGA 2D3OR 1LFPA 3CGIA 4DR2F 3O2IA 2IPOB 4IG3B 5C24A 2G4BA 1VIOA 3UDVA 3AODA 4OMFG 4KY3A 4DPXA 4CH7A 1TKZB 2PIIA 5KT6A 3SYZA 1JLEB 2RQCA 1WC5A 2XM3A 4E0DA 1LWCA 1PSDA 3KHHA 5HJXA 4WP9A 1Q0NA 3U1NA 3K7RA 4OHYA 4CLKA 2JJ4D 1X5PA 2WVFA 3CVKA 2HS0A 3PV8A 1PAEX 4TNOA 1J5EF 4MH8A 4DQQA 4RZRA 1NU4A 2BJDA 4U6PA 2I6WA 2KH9A 1PAUB 4P71A 4ZPVR 4X2BA 4KHMA 4B08A 1HHTP 2VIHA 3DM2B 2E9ZA 3CJ4A 5EN1A 1P6TA 3KG0A 1HNVB 4UY85 1WOOA 2UUBF 5HBMA 2IM2A 2WOMB 3BO4A 3GYGA 4Q0BA 5HQLA 4KB7A 2HEKA 1EB0A 2OI2A 1XBWA 4CDIA 2RQKA 4C6AA 4ZLPA 3F0NA 1WELA 3MMCA 5K8NA 1WI6A 4K8RA 3M05A 1WSRA 1CJUA 1FTCA 3CMQA 1HI0P 2BJ8A 3UVJA 3G87A 5ETTA 2CPZA 4IDKA 1XK8A 4M5LA 4I56A 5HN0A 1S0MA 3D28A 1WEXA 1OY8A 3Q8SB 3NNAA 5KFKA 3IC1A 1NKEA 1Q8BA 2DPIA 5T41A 3Q8QB 3EGVA 1HNXF 1CJTB 1FXDA 1MN7A 1Q78A 5KT7A 2FDNA 2AJ1A 3Q24A 1P27B 2FZKB 4YUDA 3IRXB 4KYZA 1Z4UA 4QR0A 4Z7YA 4J37A 2FHMA 3RBZA 1HBNA 2R2TA 2HFSA 3SIPB 2CQPA 4LBIA 2OMOA 1ZOTA 4OLOA 2GGPB 4DS5A 2YKNA 3JXOA 4H4MA 4YB6A 2ZM6J 1J5OA 3I31A 3RJMB 2QIFA 2LYVA 3FC9A 2ZHOA 3VWSA 2YWHA 1VK8A 4B3MF 2VQEF 5GAGI 4C0BA 4U8YA 2MZQA 2QT7A 3PFEA 4KFBA 4DPOA 4DU8A 1VCTA 3HJVA 1GAOA 2Z30B 2B9WA 1REVB 2HQIA 1DJ0A 5HMWA 4IG0B 2VC0A 1FRIA 1IQZA 3D3BJ 3PTWA 3DOLB 3KJVB 3DRRA 4A8WA 3DDIA 4PWWA 1ZZFA 3OL8A 1M1HA 2GX8A 1S0VA 5KFDA 3W2VA 5DQGA 3CW2C 2VICA 2YPYA 2VV5A 4DR3F 4HTJA 3KXDA 2XSFA 4QIWD 2ZH6A 1RLCL 1UFWA 4ZPTR 1W2IA 1X5TA 1M0SA 3ZO7A 5H9FJ 4NRTA 5G4DA 3MR7A 1WC1A 1SQGA 2IFXA 5EX3A 4YB5A 2QLFB 1BXNA 3L09A 2ZD1A 4M95A 3KG1A 3PJ9A 2ZZNA 1CULA 1C1BB 2AJ0A 2QN6B 2DIUA 3I4PA 3RYLA 3B4DA 1H74A 2HK3A 2HBYB 3W9HA 2I2YA 1L3TA 4WTOB 1TFYA 1WC0A 1APSA 3QZ7A 4DPUA 3H0PA 4NLVA 3PIPQ 4DV6F 2K7JA 2KTQA 4FYVB 4MT1A 3PEHA 2A18A 2HHQA 3CD0A 3POTA 5GADI 3IP0A 4UF4A 1DARA 1IBMJ 5IT9U 2VJVA 1FFSB 4DQPA 1HBOB 2Z2MA 1FTRA 5GVQA 1NJZA 1VQKS 1K1SA 2PEHA 5LMNJ 4H54A 2KHCA 2MLXA 1BGXT 1H7XA 3R6GB 2Z58B 5CYQB 1K8AT 3H42A 4JI8F 5C25A 1SQEA 1CC7A 1JLBA 1YX2A 2HHPA 1KFDA 2DNHA 1KEKA 4Y2MA 1IM6A 3SDEA 2SXLA 4MYUA 4USMA 1B7YB 4O4GA 3PCOB 2QMXA 4FXVA 2VQFF 1U4BA 1KTVA 1VHFA 4ZN1A 2QZ8A 4C8OA 4F50A 4P73A 2WB1D 5CD4H 1G6BA 1GT8A 4TY9A 3P6YC 5AJ3F 4TU7A 3OFEA 5AE2A 2CJYB 1ZM4A 5KT3A 3DXBA 3MM8B 3QWUA 4ELVA 1FCAA 2C2MB 2LVWA 3G4SS 3N5BA 2LU2A 4N77A 3I0RA 1S49A 1DQ8A 2C3OA 1F0XA 3M6UA 3KLGA 4P75A 4C11A 3GSDA 5KTQA 5DDQC 2Y1RI 3S6EA 3K89A 3GIIA 2FGCA 1TK5A 2OD6A 1TKDA 3CJ3A 2MY7A 4QU6A 4CLYA 3W63A 3CCZA 1D09B 2XMUA 1I6JA 4AUKA 4Y00A 3HX9A 4TU9A 1N6QA 1HL6A 2CUYA 2LMIA 3EICA 4RUAA 3PW7A 4NLGA 1WG5A 3D1HA 3NRBA 4WU3A 1FERA 1PCAA 2MLZA 2RJZA 2YX4A 3VHQA 2ZUAA 5IV3A 1Z2ZA 3MPVA 1MROB 1UWAA 1KTQA 1YJ9S 3CUNA 2OO4A 2HNZA 2HSEB 3R7BB 1HWKA 5D4PA 3I96A 4B3RF 1SIZA 2ZOGA 2RS8A 3MGJA 2MJUA 3P3DA 4FDFA 1RAOA 4KH1B 5T14A 3QBCA 4QR1A 1ITPA 1Q16B 4ED6A 2R7OA 1Y5IB 1DLOA 4ZVEA 1NUEA 3HVWA 2W4CA 3OR2A 5A6PA 4CNZA 3ZC4A 1CC8A 4WFXA 4A48A 3OBIA 4JYAF 1X9SA 2L41A 5DRKA 1CEZA 5DLGA 3PG9A 1U1MA 4G65A 3W2WA 3UE2A 1FDNA 3I82A 1LWXA 4JV0A 5F41A 4LF1A 1PYSB 2Z4PA 3KLIB 2K1RB 2ZWPA 2JX2A 3Q8RB 3Q83A 3T1YF 1P9YA 1T9UA 2DRBA 2QC3A 3KMQA 2FJVA 4MIAA 2AGQA 3IN5A 3G82B 1E6YA 3JSBA 3MD1A 3M32A 2HZCA 2XQCA 3J81j 2XNRA 2M0GB 3KLEB 1NO8A 1JXVA 1SUQB 5A8RB 4KC5A 4O3PA 3OR1B 4YDDB 2RDDA 1SJ4P 1L5UA 2HVDA 3BGRB 1VISA 3WX4A 2RHQB 1S9GB 2V5HG 2XCPA 3BF4A 4U67Q 1S1UA 3U27A 4D3GA 3OSPA 2ACMA 3PYEA 2BOPA 3NGKA 1TUGB 3GIRA 3QYYA 2L9NA 2AJ4A 2GJ2A 2F4FA 3OHBA 1O0PA 1U45A 5KFSA 1AUSL 2DEJA 3FBEA 3TX8A 2Y8YA 3N6NA 3HK2A 4ZP6A 2GVZA 1RAHB 1U26A 2C2DA 1CJKA 1VOMA 2PDAA 2E7VA 2W2OP 2JVOA 4DCPB 4M5DB 2KI2A 3NL0A 2AV5A 3OJUA 1Q8IA 1CSJA 4A47A 2DRDA 2BA9A 1S7HA 1NCLA 3Q89A 1SKWA 4ECQA 4QW9A 4ED0A 3VV2B 1GX5A 4ZN3A 2J0SD 1FKOB 3FSXA 3IMQJ 4HACB 3E8OA 4ZJLA 4FVMA 2IHR1 2V8PA 2BACA 1RT1A 2A2CA 3JSYA 4YR3A 2XYGB 4E2FB 1Y4ZB 2VU5A 4YHHF 2CQIA 1NJIT 4MJKA 5KT5A 5DLFA 4M5NA 2DH8A 3BGUA 3SXLA 5LMUF 1MMLA 2DISA 1SXLA 3LPEA 1OSCA 4LFAF 2DHGA 4HVZA 1TVRB 2VONA 1H2TZ 2BRKA 1CJVB 5DS7A 3C6TB 1GH8A 1XMQF 2FLLA 3RRHA 2NXEA 4B9NA 1SJ1A 1RTJB 5D3GA 5DZ7A 1RT3A 1IWAA 2XZDB 1WHWA 1EETB 3VGSA 1S5ZA 1RTZA 4MKVA 4ECVA 3ELHA 5BJRA 3ENWA 5I3PA 3KHGA 2W24A 1YG0A 1U2RA 4J90A 3MCNA 4WE1A 2MXYA 4PXBA 2EFPA 5HI7A 2KB2A 2OUGA 3IS9B 3M8QA 2APOA 1NK5A 2LLZA 2HWIA 1Q7LB 1O8BA 4FXWA 4OYMA 4DV3F 1VHIA 3R5DA 3MEEB 3MCSA 1ZAWA 1HYSA 2J7WA 3DYAA 2WW8A 2E9RX 3RAMA 2R8KA 3GONA 1YBUA 3GYNA 3Q8UA 1UFKA 2OH2A 1RTDB 1R3NA 3QT7A 2D3O1 2XNQA 3ZXWA 1V5IB 4AL6A 1RHRB 1RUSA 5KG4A 3TI0A 3OUYB 2PA8D 5J2PA 2F40A 4P6QA 1NXIA 4NLTA 2XSJA 5L1JA 1WOSA 2R42A 3DDNA 2FJWA 1NSAA 2GHWA 5F8MA 2OTLS 1VFJA 2R8JA 3GCXP 2KG0A 3MAHA 1PJ5A 1BWEA 4ZP9A 2OMLA 5KG2A 4ZVHA 1T11A 3M6VA 1Q5VA 1WJ9A 3GU0A 4RNFA 3D67A 5KFRA 2A10A 2ZFHA 4C7QA 1KQSR 3UFCX 2DNMA 2YTCA 4TY8A 1JLAB 3K5LA 2AQ4A 2N4DA 1WKJA 4J7CA 4NI2A 5ETKA 3KWMA 4NLYA 5DO2A 1URRA 2E5LJ 1RYSA 4GVLA 3R1LA 2F9DA 3R1HA 4DR6F 3M9OB 4OZ1A 1KD1T 1ZTTA 2VJUA 2ZHAA 3M9MB 4TLQA 3IWXA 3MTKA 3Q23A 3ENQA 1S4FA 5CYMB 1X0PA 2HFZA 3TZWA 4P52A 2YNIB 5JXSA 5KFPA 5DDPC 2DHAA 4PABA 1R0CB 5CABA 4WWSA 1GK8A 2KU7A 5EGYA 2JLGA 2OPRA 4YY3F 1IBLJ 3MR5A 3RW7A 2RUSA 3AXKA 3C46A 1UJ6A 1S48A 4DX6A 1VBZA 2CPJA 1X9MA 3BEGB 2J7KA 3M8WA 2KL8A 4O44A 3TR5A 4P2MA 2IJNA 4P2SA 2D7SA 4IQMA 2I8EA 1OQ6A 2POKA 3BJYA 2GHVC 2Q66A 2NPFA 1WDDA 3N4WA 2WONB 4LFBJ 2GCFA 1BUXA 2MKKA 2RE1A 1IKWA 1FKPB 2YKQA 2N7CA 4O0NA 4S0MA 2M4MA 4RJVA 2ZC3A 3KUHA 3Q8PB 2HQFA 4GKKF 1JXEA 3SEOA 3P8BB 4P2FA 4DL0C 3L3CA 3SZ2A 1NJXA 1B7FA 4C98A 3UD5A 4WU2A 3SSRA 3R3TA 2U1AA 1S6QA 4TKTA 2C2EA 1H0HB 1OIAA 2LQ5A 3BBBA 3PYFA 3K5NA 3H4BA 2HQCA 5D77A 4ED4A 4OX9J 3VGUA 3FBBA 3ETOA 1YJNS 2ZEJA 4X4NA 5HMXA 2HG4A 1P9QC 2H54B 4NXNJ 1JLCA 2D69A 2VA2A 5E5NA 4LIRA 1FE4A 1NPPA 2HIYA 3FRZA 4RPFA 5EWEA 4DR1J 2PMZD 1DTQB 4QWAA 3PX4A 1YJTA 2AD9A 1YWXA 4RW7A 4CYUA 1L3SA 1C0TA 4DV5F 2FJEB 2MHEA 2V4JA 3G6ES 4YN3B 5F9LA 2VZ9A 1FJGF 4LF4J 3O3LA 3UQSA 4MIWA 5DJBA 2IBKA 2V69A 4D3HA 2RIJA 1UWBA 3O6QA 2HFUA 2ZITA 1DRZA 5KFCA 1LKZA 1G7CB 2DPJA 3GFXA 4YP3A 4X65F 3LALA 4WBFA 3IR6B 3R8YA 4IFVB 3SQGB 1UZHA 4F8RA 2QO3A 4NLUA 1ZAXA 2P2CB 2B6AA 5EHHA 5F0WA 3K17A 1T9YA 1U8WA 1D9FA 5IV4A 1SJRA 3W5ZA 1RCOB 2HAFA 4KIAA 1DQAA 4XTTA 1GMWD 2ZJQQ 4RUHA 5IS2A 4YB1P 3KLFA 1S10A 5CHCB 1FEHA 1YDLA 1FNXH 1RAEB 2YBVA 3MM9B 4DOZA 2DGXA 1AUDA 3CB4A 2EKYA 4G1QA 2UV8G 1U7LA 2MQQA 1R43A 2OIHA 3H20A 1HWJA 3DOMB 2RS2A 3P5BP 1YVFA 1U02A 3HHLB 3M1VA 4BS2A 4C8YA 5CXTA 4JV1A 4U96A 2PA3A 3UDCA 4NRUA 3GYXB 5J2NB 1QE1A 2RNEA 3LP2B 4U7UK 5F0UA 1QSLA 3QRPA 1TL1A 1U25A 2EFOA 3PKYA 2XULA 1O6XA 4NEZA 3EUNA 1Y5LB 2V8GA 3AA8A 3VVTA 1VQ5S 3LANA 5C5JA 4DHVA 2OPQA 4GC7A 2IMOA 2CZ4A 2AEFA 5LXRA 3MECB 3ZZYA 4ELUA 4XO0A 4NWBA 1TKXA 1N34F 4L76A 2XI3A 1RTHB 1DFDA 3GJTB 3MEDB 2XGQA 1HBMA 3LGNA 3VGTA 4ECTA 1HQ2A 4ECRA 2F4VJ 4C4WA 1WHXA 2NZ4A 2BBEA 2VG7A 4PZVA 4J9LA 3VZIA 4DX8H 4K5SA 1AZSB 1RAAB 2N3LA 3NS5A 4LF9F 4L75A 3JTNA 2DT9A 2XS2A 3RAQA 3V4IA 3JAMY 1DTTA 1N48A 2AYGA 3GIMA 2KFZA 1KDNA 4WZQA 3CNQP 3RBEA 3C14B 1TV6A 1N0VC 1QAYA 1O51A 4ZVPB 5AXLA 2BM0A 1OWXA 2FLPA 3M6XA 1A7GE 4X4TA 4DUTA 3N6LA 5A8WA 4C2MA 2F65A 2M88A 4FPIA 2N82B 2HRYA 4X84A 3DMJA 4A8MP 3GIJA 2V2ZA 4I64A 1G2EA 3KK1A 3V5RA 2HQDA 3DCAA 3NGRA 2EXUA 4L73A 2XMTA 3HFZB 1RT7A 2Q6BA 1QUPA 3IBWA 4R5PB 2W9BA 2LCWA 4NOHA 2IM1A 3EYZA 3ET6A 4OFZA 1Q4RA 1DURA 2DR6A 2GV1A 3O5TB 4QWEA 5RUBA 3SCKE 1AW0A 2ZVSA 3PR5B 2NS1B 1S0OA 1NSQA 3QAUA 1UCNA 3FMWA 3KLHA 4DR2J 3DDKA 1HD1A 5KFLA 3S8SA 3M2VB 1LWEB 5ETVA 1GX6A 2MGZB 4M5KA 5IZHA 3HVTA 2BEFA 3T1HF 2W8LA 3J7ZT 1T02A 2JH3A 1HNIB 1FJCA 3R2CJ 4WK3A 5KT4A 3EGNA 4QIFA 1BLUA 4LJMA 4J5OA 1KHVA 2ZH8A 2XS7A 4LSNA 2EFVA 1EZZB 4FF1A 2VOOA 1S7IA 4KPCA 3DLKA 2V8DA 2C42A 2CPHA 1YJ7A 1ZM2A 4P7TA 5F9NA 3NXZA 1J5EJ 1B3TA 2FZCB 1HQUA 1NDCA 1Q86T 4ZVQB 1YJWS 4PYAA 4PWDA 2RD5C 4MIBA 4JP8A 4P72A 1Q82T 1Y5NB 2QLBB 2O66A 2MPUA 2Y3YA 2YKMA 3DI6B 4ECZA 1XC9A 1VRTB 4AE5A 4LT6A 4Q5VA 3I5CA 2DVIA 4CTAB 2UUBJ 1YJVA 4J9RA 4PG6A 4RWXA 4JI2F 4KTQA 2JLEA 7FDRA 2AP6A 3TVKA 2QA4G 1U1PA 2XTJP 2KT2A 2R7XA 4USKA 5F8JA 2FC9A 4BBYA 2DJWA 2HHTA 2B8QA 3SSSA 1NB2A 1S1TB 2IC3A 4ZVSB 4PUOB 1SIWB 1IQTA 1UKUA 1HLWA 4DUZF 1U8SA 2ALYB 5CZXA 4W4MA 2ZKTA 3NBPB 2JVRA 2PC6A 1OYDA 3BPDA 5L1LA 2OPSB 4FF4A 1QAXA 4Y2KA 3FQLA 1NDPA 1R8HA 4KO0B 1HNXJ 1UVNA 5KFXA 4QPTA 3DGVA 3GFHA 1S1VB 3EDQB 7FD1A 1MWZA 1BQXA 2V4QA 1IXKA 2CVIA 3ZNJ1 3RBXA 1OY9A 4GMKA 3THPA 2ILZA 2J8SA 1HHSA 3OTBA 1PILA 3CJTA 5DG7A 5M2RA 5D0GA 3A13A 4NA1A 3PHTA 3M8PA 2L08A 5DDOC 3BBFA 1YLXA 3PFOA 4B3MJ 4C8ZA 3MPWA 2J6UA 3PY8A 1WHVA 2D9OA 5KOWA 1G4CA 3MHYA 1RKJA 4CLWA 2QRRA 4ZPDA 2YNGB 2GVDB 3MAAA 3PR4A 3TARA 1N0UA 2KYXA 1RT5B 1WKLA 2IBOA 1P8GA 2L3MA 2HAIA 3HD2A 5GADU 2KT3A 1BQNA 3VAGA 4RLEA 3T3FA 4FKXA 1MLAA 3FEZA 1PBAA 2GMHA 2E1CA 3TZXA 1L3VA 1JLEA 4DR3J 1JLGB 5D78A 1KN6A 3HPOA 2Q79A 1H38A 4FNHA 2KFYA 5HMYA 5L46A 4EEYA 5JJBA 1BWVA 2MKCA 1GEHA 1HD0A 3FBCA 4DSEA 1F2GA 2MZSA 6FD1A 4K5RA 1JKHB 3BDEA 3CJRA 3QNWB 3TRGA 2R7SA 4QW8A 4K4XA 1W7WA 4PEOA 2XGPA 1YRXA 3AXMA 3TANA 3SFGA 4NCBA 1CQNA 2GQCA 2WK4A 2CWKA 3GG0A 3F56A 3M2RB 4K4VA 3OQ2A 4OZJA 4O3SA 2WRMA 3MDFA 2CXEA 4DV6J 2WOMA 4TN2A 3GWCA 5B0BA 3HMJG 2DGUA 3D0IE 1RQ0A 4DV2F 1KOOA 5J2QA 3GG1A 1B0PA 1N52B 5ETPA 2XWYA 1F5BA 3QJLA 3ENVA 4F02A 4UOHA 2DBBA 3SBMA 4ID5B 1TL7A 3IGVA 2OJ3A 1U1RA 3MZIA 4DXLA 2EG1A 4AYBD 2IMWP 1WF2A 2OSRA 3AFGA 3C15A 2H9ZA 1HQEB 4J9PA 2VQFJ 2GIQA 3JTPA 3FFIB 1NK0A 5BYRA 2AEJA 2DEIA 2FVSA 2DNZA 1V6HA 1RABB 3EVWA 3LW5C 2GJFA 1NZ8A 1S9EA 5AJ3J 3FBFA 3B4MA 3HHEA 1GMVA 3Q8VA 5J2MA 1ICEB 3H5XA 1YI2S 2FC8A 2BJ3A 5A8KB 2O1PA 4DL7A 2AJFE 3WIVA 1OMSA 1VQ9S 2HNDA 1UA0A 4C8NA 9ATCB 3VAMA 5HVHA 3FRYA 4OV1A 3CCVS 4RW9A 2XZWA 4USTA 3S01A 1LW2B 5KOXA 4OI4A 1Y7PA 3CDWA 1JLFA 4DX7A 1REVA 1PBUA 1JNZB 4MK8A 3DRSA 1YTYA 1FWLA 3DOLA 4DL3A 4NYZA 1KQFB 4CLLA 3OD2A 3R9LA 1S0NA 2Z2LA 3JB9k 1OO0B 2D1CA 4MKBA 3OHAA 2V50A 2GIRA 2KZZA 1VQNS 3BO2A 3V6DB 3FMBA 1QM9A 1QAJA 2DGTA 1RTIB 3QIPB 3CC4S 4MFBB 3HSZA 3MFIA 3R7NB 3VTIA 3J7A1 1REGX 5D4NA 1FDBA 3OFFA 3CT9A 2Y8WA 3KHRA 4LMZA 4KGKA 4WP3A 1BQMA 2HS4A 3NP5A 4QJVA 2GQ2A 1WTFA 2RDJA 1S6UA 3MI7X 2OFGX 4WZMA 3C19A 3PW4A 2OKQA 2RF2A 4DL4A 3L4BC 5LSRA 1ZS6A 4B3RJ 3FSYA 2VG5B 3VALA 4J9MA 2FHKA 5M2PA 3AD9C 4J9UE 1AA1B 2IVFB 3T5LA 3CD7A 5L1IA 2IYIA 1WHYA 5EWGA 4ZCKA 4I2PA 5E3CA 2HZAA 3HF5A 1VLOA 4MMOA 3CDBA 1T05A 4ZCMA 4JYAJ 1LWCB 3DLJA 1RT2B 2NXJA 3L7UA 1YK9A 5IM0A 1RLDA 1I1GA 4FF3A 2V63A 5IWAF 2P5VA 5K8OA 1TQLA 2LDYA 1IKVB 4IO9Q 3NS7B 2DXDA 3L7OA 3NMAA 4JI5F 4JI7F 3QMQA 1T9TA 1Q81T 4A8FA 3NGTA 2D3UA 4EYHB 5HBMB 2NXNA 3FSIA 5C2CA 4Q0BB 5KFIA 4DFPA 4B3TF 3WIUA 4UW2A 4ZHRA 4DV1F 1SPBP 2VPZB 3MMCB 2MQMA 2BW7A 1CJUB 1WG1A 1TZ0A 3UVJB 5E0OA 5HMZA 3IBCB 4ZPCA 4IDKB 2FHJA 2MKSA 3I87A 4B9UA 3OXGA 4OZ0A 2AGOA 2PGCA 1TELA 4QCLA 5L8RC 1RWUA 4NLRA 3BGFA 2X3GA 3HI9A 3W64A 3QLHB 1EKSA 1N56A 4NLWA 3LQVA 1UVJA 4FF2A 1SJFA 3A3PB 2LEPA 1HBNB 4DSJA 4CRJA 5E41A 1PIEA 4WF9Q 2J6SA 4PG8A 1JXLA 4H4MB 1VK3A 3IFEA 4LR8A 3MMJA 3HCXA 3P49B 3UPFA 1J5OB 3D1QA 2QSWA 3OVAA 2RSQA 3DLEB 2B51A 1IVZA 2CWXA 4WPAA 2NXUA 3A8IA 4TQRA 1GTHA 4Y2AA 1MROA 5KFZA 5D0HA 1EQMA 4YHHJ 2ADBA 4YS2A 2A0FB 4HL9A 4HI1A 4F0HA 2WSFC 3TJ8A 5HJYA 5LMUJ 3F73A 5T7LB 3IG1A 2J76E 4PWUA 3ILJA 3QFWA 3DKDA 4RNNA 4LFAJ 5B0DA 1LFWA 3OL7A 5IC6B 2IVMA 2AKWB 4PKDB 3OLBA 4F2SA 2DNGA 4CH1A 4UUXA 2X1AA 2GW8A 2MMYA 3OV7A 4WP8A 4LRFA 4A8QA 2NLWA 4LF2A 4HHUA 3D0HE 3QSYB 1XMQJ 2AJQA 2VFVA 1EIYB 2CKWA 4OI3A 2BJ1A 3NEKA 1HW8A 4WTYA 3W61A 3P45B 4YOEA 2W4PA 2R7TA 3GSIA 4F0KA 1AB8A 1WUUA 4JI6F 1JJHA 3W8PA 3KTQA 1NZAA 3G82A 2W9CA 3W66A 4ED7A 2DO4A 3US5A 4NA2A 2GIFA 5U47A 3JAMU 4OQJA 4ED3A 4DV3J 1I51B 2N4CA 1FJEB 3H2UB 5B0AA 5EUHA 3G6VA 4M63A 2XMVA 4EBCA 3H2LA 4H4OA 2ZOFA 1UEKA 2UUAF 3QRQA 3NWGA 3B82A 3HD1A 1XMOF 1M90T 3MCOA 2DK2A 4MAKA 2V2VA 3LAKA 3OTOJ 3FEYB 1VQYA 1SV5A 2LXUA 1QUVA 3MR3A 3MF5A 1UW4A 2DRAA 2CQ2A 2JHEA 2MZ1A 4AT1B 5C25B 1ZTWA 1UPMB 1JLBB 3FKBA 3SDEB 3HSGA 2JC1A 3UCZP 5KFJA 3W9IA 3C16B 4IFYA 1IR2A 2AYEA 1Q53A 2ZDPA 1VRQC 4FN5A 2CJ9A 2ZZTA 1M1GA 2IJRA 4OZ3A 2MQLA 2X3DA 3LH2S 4CO2A 2DD8S 1U1QA 3JS9A 3VAKA 3ZTOA 3CCMS 4WFNQ 1Y0HA 4KJIA 2VODA 2HRUA 3TYTA 4C9DA 1GNKA 1R8AA 2UZAA 4Y3CA 3CF5Q 1WSVA 3AQOA 2G2ZA 1F9EB 1Y00A 3AJ2A 3I0RB 5ADZA 4HI2A 4CWBA 4HACA 3H8YA 5IT4A 1ULRA 4ZP8A 1N32F 1X8DA 4ICLB 3VAJA 1DZ5A 4M5JA 4EMDA 3CJSA 2DGQA 5CA5A 4DR6J 3CCJS 4NXMJ 1YQHA 5KG0A 1FRLA 4TYBA 1VQ4S 3NWRA 3WC2A 3CJ2A 2DR8A 5LSOA 1TVRA 3ULHA 1MWQA 4U7UD 4LF8F 2KT5A 4ILRA 1AT1B 3C6TA 3IWNC 1D9AA 4C3MA 3U7JA 4N5SA 5F3TA 3UD4P 2WBRA 3VCDA 4X4PA 4YEAA 1N6QB 1EETA 3BSAA 5B0FA 2LKZA 4YY3J 2BR0A 1HA1A 4C8KA 4PQUB 4EI2A 4X4OA 5B0EA 1BMQB 3AJDA 4A8SA 4KT0C 2A2DA 1TU0B 2Z0GA 4DV4F 2ZHBA 1QDUB 4F3QA 1NSPA 1C2PA 4UUWA 2ROEA 3IS9A 2XEXA 4K0KF 4DWIA 2B4VA 1AROP 2HNZB 2HGMA 1EKRA 4MKAA 4C8MA 4WKRA 5KG3A 3MEEA 2WHOA 5DZ6A 5GMEA 4N41A 3I5AA 2AGPA 3TX0A 5ETQA 4DFMA 4KKOB 4B9TA 2CPEA 2CG8A 2LDIA 4ETZA 3DOKA 1B4SA 2VPYB 1UEUA 2LA6A 1QLNA 1XR6A 3OUYA 2YWWA 4HT7A 4KGMA 4GKKJ 4GVBA 5D4OA 4LRAA 3W2WB 2B3TB 2ASYA 2DH9A 3JQKA 4U95A 1R27B 1R7IA 1L3KA 1RSCA 2BANA 2HBZB 2DGOA 2PE8A 3FZBA 1HWLA 1KQKA 1Q5YA 1IKXA 2PI4A 3KUGA 3J7YI 1H2VZ 4OYAA 1FI4A 3X3UA 2CA9A 1E6YB 3M32B 1FD8A 1U09A 2XLIA 3MPYA 2BDPA 2XMMA 4IOAQ 1HR0F 4K4UA 2NQPA 2PD1A 3CCTA 2I0XA 4URSA 3KG4A 3NNHA 1VIXA 5ETRA 1PJ7A 1KOHA 4HH0A 5AT1B 1DBDA 3W5XA 2OTJS 4PXCA 1N4LA 1S1UB 2EG2A 4OLPA 3PNIA 1FJGJ 1HWUA 2CIMA 2MLYA 4DZDA 2Y9HA 4QPXA 4HDGA 1LK5A 1HBUA 1VRUB 5GMDA 3EE3A 2AX1A 5ITHA 1CJKB 4TLRA 4X65J 3R5BA 3R27A 4FYDA 3G8TA 3Q86A 4QR2A 2YNFB 2HHVA 2AT1B 3VQSA 1Z1ZA 1VJQA 1MU2A 2IA0A 2J6TA 2C22A 1RYRA 3M8RA 2QLJB 1VBXA 2W8KA 2X1FA 2CZVC 3H7HB 2DCLA 4P2XA 1ZPWX 3QJPA 1HPZA 4OIXA 3GP9A 4ED2A 3HKZD 3MM6A 3GPAA 1P1TA 5FJ4A 3FUYA 3IM8A 4NL5A 3ZTSA 4IKAA 3L7PA 1NDKA 4KHPF 2BX6A 1RT1B 3EJMA 4ECYA 5C7PA 1T94A 1S57A 1VJWA 5G0RA 2MSTA 4DPYA 2YQ0A 5ETMA 1WI8A 3IXQA 3I0SB 3ILIA 1YJRA 1VQPS 1VQSA 3NMRA 2UUTA 3MFHA 2K7KA 1RHKB 4MKYA 5IOLA 4UOFA 2FVQA 1BE4A 3ZZRA 3H59A 4CO3A 1SB6A 1SVDA 4O4RA 3DRPB 3IA0A 3M8SA 2IY5B 3A1YG 2WCXA 3TNVA 4LRDA 3CO0P 3W9JA 1RT3B 2OFHX 4RW4A 1XNRF 2RT3A 2BABA 2OGUA 2ILYA 4RNHA 2B43A 2J8AA 4PXEA 1IUJA 2OD4A 1HNWF 1AYEA 4DDFA 4WE1B 3MM7A 5DETA 3ZZOA 1T03B 1RKIA 3IAM9 1N34J 4ZA1A 1JJCB 2HIQA 3M2UB 3GLJA 1PYOB 4ER8A 5AE3A 2NR0A 1ZM3A 4QIVA 2HLTA 4FYYB 1HYSB 1Y10A 2NUUG 2RKIA 5L9NA 1ZAVA 4F04B 4U7CA 1LEOA 3UCGA 2UUWA 4HYKA 2JLFA 3CD6S 3G6XA 4QBUA 2AMCB 4B3SF 4LF9J 3SCIE 1MNEA 3QT6A 4KPYA 5J2PB 3SFUA 4LQ9A 4YQWA 2ZBRA 4WK1A 5I3QA 2KRRA 2XSJB 3R97A 2O3DA 3J80Y 1MW7A 4OX7A 4QQBA 4M5HA 1IN0A 2CQCA 2KYZA 4UQGA 1KNZA 5A0YA 3LOUA 4IFVA 4DI6A 4KR0B 3SQGA 2NUHA 2N3OA 3AHPA 3E51A 5D6GA 1N8RT 6FDRA 2OPPA 2R2RA 4BDPA 3PYDA 2GA7A 3D6MB 2PI5A 4B9MA 4HKQA 5KFAA 2GQQA 2CNLB 4TY8B 1YBAA 2CQGA 4CCHA 4NI2B 4Z2XA 5F8HA 2VFRA 1JNRB 4RNOA 1I3OB 2VOPA 2EFNA 1KWMA 4DG1B 5AXNA 3RG6A 4ERDA 1FNOA 1Q95G 3DOMA 4FVCA 4NCAA 4ZVFA 1RWPB 1VC0A 3AD7C 3HHKA 3HHLA 2E1PA 3T1HJ 1RHMB 1K0TA 5CYJA 3D6FB 3HT0A 3V4MA 3W60A 4IUFA 4HH1A 2RRNA 1Y11A 1FKAF 1TP7A 1XJWB 2D41A 4HHJA 3IRWP 3EPGA 3F41A 4LF5F 2QL7B 2V2KA 4ZVTB 3I5BA 1QY7A 5I42A 2J9CA 2J9EA 2IDLA 1MG7A 2OPRB 4ZVOB 3HO1A 3HVRA 3Q22A 3AB2B 3SQOP 1L3UA 3MOZA 3HHDA 3MECA 4O44B 2R2SA 1XN9A 3W62A 3Q8YA 1FT8A 4X64F 5CH7B 2QLWA 4JI2J 3D66A 4C0OC 3HSJA 3PO5A 1KHWA 5KFTA 8RUCA 3T5KA 1EP4B 3QIDA 4Q43A 5LXYA 1OS5A 1FRXA 7AT1B 3K5OA 3TA0A 4QWCA 1QSSA 4EZ6A 2ZH9A 4DUZJ 4RW8A 1X31C 1LW0A 1Y3JA 3TW0A 4LQ3A 4JV2A 1IKWB 4LR9A 5LOQA 4W92B 3T5HA 2VBZA 3MEGB 3N28A 1FESA 2KG1A 1FHTA 1MMNA 3EVOA 2BZ2A 3H2VE 1FNMA 5SZTA 2MTLA 2KXFA 4X4VA 3DNCA 1S6QB 1CBKA 4ZPAA 1S6OA 3T5JA 2F8EX 5B7WA 2Z8QA 5K5MA 1WC4A 1NHKL 3DHXA 3HHLD 2IRXA 2E9TA 3PZPA 1U0SA 4I0WA 1LV5A 2YNHB 1FK9A 3RUBL 2B5JA 3MD3A 4BLGA 1BC6A 1JLCB 4L3KA 3GV5B 4MTPA 2AW0A 2H5IB 3IBFB 1RBOB 3QGGA 4YMEA 2RRBA 2PSZA 1XMBA 3C3LA 4RU2A 1V5VA 4RW7B 2ZVIA 4CYUB 3ICLA 1C0TB 2Y0BB 4W98A 1B70B 4WFZA 2V4JB 2QL5B 1ROFA 1RACB 2HFNA 3O8WA 1B0VA 4NZ6A 3LP1A 4JBCA 4DPTA 4PXDA 4YDXA 3U02A 2R7VA 4Y34A 4OZNA 2VPXB 1UL3A 3CMES 2D9PA 4FS2A 2JRSA 2OEMA 5J1NA 4ID8A 2GHPA 2C2RA 1K47A 1K1QA 4FBTA 5BR8F 4UZCA 3E01B 3QGHA 2BQ3A 4OYWA 1HW9A 4LRBA 2B6AB 2FVCA 2XZTB 1UVKA 2UVVA 3OLAA 2YX7A 2CQ1A 3KYLA 4K50A 3H40A 3A8KA 3GMGA 2RAQA 3H4DA 2I5JA 2JNJA 4M5GA 2J7UA 2H51B 1T9XA 1KSPA 2RRAA 9RUBA 3PRBA 4G1QB 2HK2A 4BHQA 4DUYF 1FEEA 5FDLB 1K73T 2QMUB 2NREA 1UP1A 2CQ4A 3PW5A 2VDIA 1GXTA 2IAJB 3BR8A 1Q8LA 4ES2A 3MR2A 3GR1A 3H90A 3M1VB 3RTVA 4DV2J 1S1TA 5HP1B 1SC6A 2RMLA 3KDNA 4PUOA 2ZZMA 3O1LA 2M5YA 3HZGA 1NK9A 5GAEI 3MUTP 4F4ZA 4R8UA 1IJFB 1KFSA 2BE7D 4NLXA 4ZS6A 2DNRA 3A8JA 3PRVA 1CVJA 2VA3A 2OSQA 1WKKA 2OPQB 3CIMA 4NMXA 4XPCA 4ANCA 1S1VA 1WEZA 5BYQA 3X1LB 3GILA 4I2QA 1Q7YT 5HROA 4X62F 3D9BA 4B9VA 1F3FA 3GTYX 3DXSX 1KONA 2X51A 4J91A 1HBMB 2R7WA 1G1XA 2CNOB 2JEJA 1WDTA 2W7OA 3Q2SC 3K8WA 1N5YA 2I38A 2EBEA 2UXDF 5L1KA 4WKYA 5D0EA 5L9XA 1RAJA 5I4MA 3ILOA 4OYBA 4DL2A 4V19X 2KDOA 3TEGA 1DTTB 4ZLLA 3RB3A 2GVDA 2J5AA 1URNA 1NLKL 5IT0A 2ROGA 3BBCA 4EBDA 4UQTA 4O3RA 1RT5A 4N47A 1N5TA 2JZ5A 2DIVA 4I69A 1M5SA 5IFMA 2RU9A 2EKNA 3MWBA 4WXOA 4PCQA 1XWLA 1RHUB 4NLPA 1DHMA 2YKPA 4PG4A 2C2OB 1JLGA 2ATCB 1HHQA 4Q45A 2MDAA 4HDHA 4AL7A 4WYWA 4WJBA 3DMJB 4DN0A 5E7OB 3KK1B 3NLCA 1UMJA 4M8LA 4Y65A 2FZGB 3UNGC 3L95X 2E44A 1RT7B 1M5VC 3QWPA 3PHEA 2W9BB 3RZAA 3UNYA 4HT5A 2KJWA 4B3OB 3ET6B 1EQ0A 1CPZA 4FS1A 1R89A 1LWFB 3IR7B 1DAXA 4HLBA 1VC5A 2XS5A 3SSQA 3MPDA 2FJAB 3BSCA 1D8YA 3OSNA 2DNPA 1AFJA 3HVTB 4I6YA 1RCXB 4LSZB 2HHSA 4R25A 2YQ1A 1BY9A 1MN9A 3TAMB 2XHWA 3OTOF 3LAMA 3GCWP 4WXWA 3SMZA 2CPYA 5B08A 1NK7A 3DC2A 2R7RA 3DLKB 4F67A 5IWAJ 3MMBA 2A6MA 4QYZJ 2MSSA 4F25A 4WFAQ 1FRHA 1HQEA 2H65B 1TKTB 3GJRB 1HQUB 3LA0A 4DMZA 1U0HA 3WQPA 5EWFA 2DR7A 1FE0A 2C2ZB 4JI5J 2QG9B 4N56A 4JI7J 3C6UB 2QTWA 2OEKA 4RU9A 3SI8A 4KRWA 3I56S 1NK8A 4LVNP 1WD6A 5K20B 4ATNA 4CO0A 4B3TJ 2B0GA 2JSXA 2CQHA 4L72B 4DV1J 2JOQA 2IC3B 3KJQB 2W2QP 1U1OA 3HXMA 1WACA 2EWHA 4C0HA 3GV8B 3D5MA 2F8HA 2EEYA 5HLFA 3QPIA 5DGBA 1LW2A 4TU8A 1VMBA 4ANEA 4JI1F 2RILA 1SC1B 1KRPA 3R6LB 4NXMF 4USIA 2HHHF 2MZJA 3HHLC 1JWWA 1TTHB 2W9AA 1IKYB 4OHXA 3E3XA 2MQNA 4P9SA 3J7Z5 2YX1A 1BD6A 2EVZA 2G2YA 4L6V3 3LP0A 3UDLA 4IH7A 3BGLA 2EI5A 4NZ7A 1RE1B 3I9ZA 3V6DA 3IGNA 3DLHA 3D7SB 3AB4B 1J27A 3QIPA 4JI3F 4MFBA 5MLCV 1VQLS 4C3KA 3SCJE 2MZRA 5E2QA 2DY9A 1SH2A 2D3ZA 1KVKA 3M8PB 2BV3A 5ETNA 3TVYA 1RWOB 2MKHA 1OPIA 1Q1KA 3HDSA 2E66A 3DRYA 1S1XA 4KV8A 5B0CA 3BQ2A 1F5AA 2HBRB 1KKHA 5KFEA 4ZDNA 3MAAB 2K3KA 2V9KA 4F36A 2WTFA 3I32A 3PRDA 1F9HA 2DHHA 3K5PA 3TO8A 2F1FA 4DSFA 3UW1A 2MKJA 3TWZA 1BQNB 4DQSA 4CM2A 1T3OA 4CI0B 1X4EA 3RRKA 5SUHA 3BDPA 2HVIA 3MXHP 4I4BA 4OJ1A 2VUGA 3IWLA 1ZH5A 2FD2A 1RT2A 2FVPA 3FCHA 3DGPA 3OTCA 1GMWA 3HFVA 4A8XA 2UXBF 1FRKA 2FLNA 1FJ7A 2ZUGA 2MZTA 4KSEB 1VDHA 4DX5A 2WW4A 2DNQA 2NYIA 3FZ2A 3QQCD 2N7YA 1Z2LA 3ZTQA 2E7WA 2B4OA 4ZKAA 1IKVA 4JI6J 1YZ6A 4ES1A 2XBPA 3ZTPA 5KFBA 3G71S 3JSMB 1HARA 4FP9A 1XQIA 3OFHA 3CEDA 2FJDB 4XDCA 2EPIA 1C1CA 5GAHI 3EPIA 3KLVA 1S12A 3ZNUA 2CNKB 4I1TA 4EO6A 1CS4B 4RL1A 1H7WA 3J80U 5HK4A 2UUAJ 3GZ7A 4JUZA 2Z57B 4QYRA 2XO7A 3ITHB 4RX6A 5J2QB 1XMOJ 4F26A 4OL8A 1NKBA 4DV0F 3QT8A 3RGIA 5C42B 1X5OA 3EZ5A 4Q8EA 2F9JA 1VBYA 4F4XA 5DDRC 1TL7B 4QWDA 2YVSA 3RR8A 2KZMA 2EFGA 3MM5A 1RK8A 4UZBA 3B78A 1GXUA 4LBHA 5FD1A 3JYTA 5F8LA 3ETMA 2VG6A 2PMWA 1FFGB 5BYSA 3C15B 5H9EJ 5H1SV 1YHQS 5E3QA 1IM4A 1E6VA 2PT0A 3TZYA 2Z56B 3M8ZA 1JLQA 3BQ0A 3QLHA 1S6PA 2RVJA 2ZWOA 4AQYJ 1F3VA 1I94F 4HEA9 2KKHA 3A3OB 1S9EB 4DN9A 4QIEA 1RB0A 5J2MB 4NEYA 2WVEA 1U47A 2O01C 1D8ZA 2B9XA 3CJKA 1U24A 3DLEA 2HNDB 4O3OA 5D4LA 3QZ8A 1XR5A 4RW9B 4YR2A 3PYGA 1N32J 4V1Ak 3TUIC 4USVA 3GB0A 2HLUA 1X4HA 5AE1A 4DLEA 2Z2ZA 1RA7A 1JLFB 4ECXA 2CNNB 2FQQB 4LUBA 1WC3A 5T7LA 1TAUA 4QWBA 4XIUA 1V3SA 1FX2A 3DRSB 2G0JA 4ENOA 2KHDA 2HHUA 2JFKA 3W3SA 1KS2A 4IQXA 4L3NA 1UJ4A 2ZDOA 4ZLJA 4LF8J 2JEIA 5JUMA 3BQ1A 1GXLA 3EX7B 1NSKL 2BUNA 4I7FB 4OYIA 4CNYA 3NCPA 1T9WA 4FZVA 4J9VA 2WB4A 3M30B 3BSNA 1U6FA 1TMJA 1X4BA 1AFIA 4DV4J 3J7YU 3CDEA 4F4WA 1BQMB 1H73A 3W5YA 2WVDA 2FJXA 4K0KJ 2G1DA 2PEBA 2QJ3A 3FQKA 2YKOA 3UWTA 3BKFA 1LXJA 1KLNA 2RF2B 2DXEA 1U2CA 3TAPA 2GZOA 4JI4F 3HT3A 4KE5A 4NX9A 3TUZC 5F8GA 2F63A 1K44A 4CLTA 3HHNB 2W4DA 2V34A 4A8YA 4K2XA 1C0UA 4DR4F 1NK4A 4K4YA 3K0JA 3CE8A 2FIUA 5I3UA 4NLQA 4I2PB 2KO1A 2M3DA 4LF6F 4WYLA 2HMIA 4LBPA 1T05B 4AL5A 2MHNA 1U1NA 4A46A 1U2FA 3TQEA 2IYGA 5IM0B 5HAOA 1VLYA 3CDUA 2BKPA 2LP4A 1SKUB 1UW9A 1SH3A 4MK7A 3OVSA 4OX6A 2UXCJ 2QMWA 1PC5A 1RWNB 3AT1B 4IO1A 3KHLA 1K9MT 3C16A 4DCOB 4O3QA 2DNYA 2HGLA 2AJ2A 4NPOA 3VZHA 1NJWA 3MPUB 2LEAA 1X4GA 1NEEA 1HR0J 3P96A 1RWXB 3MMAB 3R5AA 4DS4A 3SCLE 5J1EB 1FVQA 5KT2A 1FRJA 2GAGC 2V6AA 4JOUA 2B4UA 3PIOQ 1JMTA 4PPDA 2DR9A 2VPWB 4ZHRB 3DU5A 4ECWA 3BH6B 3CJQA 1D9DA 1YZ7A 2W2MP 5D8HB 4ICLA 2E5GA 3CTRA 2FPHX 3DLGA 2L48A 3ONQA 4QYZK 3QO9A 1TK8A 2WVBA 2V8VA 4I6AA 2W7PA 3NS6A 2K06A 2DGVA 1N36F 5L38A 4Z37A 2E5IA 1TL5A 4FYXB 5FLXY 1KLMA 2X1BA 2EC2A 2CJQA 4USWA 2DGSA 2LA4A 4ZITA 2Y1IA 2LFVA 2OLWA 3ZFVA 2M9KA 4F0MA 2V67A 2H4YB 1W2BR 2CVEA 3FK4A 1Q8KA 5FIIA 3KK3A 4PQUA 1QTMA 1LQ9A 3DN9A 3K5MA 1VQOS 2QEXS 1VQ8S 2DHXA 5KFVA 5K9FA 1F2HA 4EZ9A 4IYQA 3HKWA 4YR0A 3M6WA 4KHPJ 2MYFA 2J0WA 1NMEB 4NA3A 1VQ6S 3HFKA 4XAKA 1M5PC 2KXHA 3G9CA 1RT4A 2ZOMA 1Y3KA 5A76A 4LREA 4DSLA 4H4KA 3OPKA 1AXQA 4JV5F 2R2UA 1RAFB 3G8QA 4OZ2A 3IG1B 2PN6A 4KKOA 1FD2A 5CD4A 3N79A 4Q2MA 1T8EA 3U1LA 1HNZF 3V81A 1CG2A 1OYEA 1TL3B 3EZUA 1VS3A 1SJ3P 1XIQA 2MY8A 3CCRS 2O67A 3LWMA 2ACYA 3KK2A 4USHA 2A6OA 1MWYA 3BB5A 3VVUA 1HMVA
chains in the Genus database with same CATH topology
3L3CA 2YNFB 3SZ2A 2HHVA 3VQSA 1NJXA 1JLQB 1Z1ZA 1HNIA 4C98A 1MU2A 3KFWX 4X4SA 1RT6A 4WU2A 3SSRA 1S6PB 3R3TA 2BQRA 2IA0A 2U1AA 4KHPF 3TUJC 1S6QA 2J6TA 2C22A 4TKTA 2BRLA 1RYRA 3M8RA 1VBXA 2W8KA 4LF7F 2C2EA 1H0HB 2X1FA 1OIAA 2LQ5A 2CZVC 3HZEA 3G86A 1TUVA 3OXLA 4JI0F 2DCLA 4OI0A 2KFNA 3K5NA 3H4BA 4F3OA 1QJHA 2FVRA 1ZPWX 3QJPA 5D77A 1HPZA 3MUMP 4ELTA 3KMSA 4B9LA 2YWGA 4OIXA 1YSJA 1FA0A 2NSBA 2R4FA 5DGAA 3ETOA 2W9CB 1IBLF 1YJNS 2ZE2B 4ED2A 3HKZD 3MM6A 2MKIA 4X4NA 2HFOA 3UR0A 5HMXA 2HG4A 1P9QC 2CQDA 1JLCA 1P1TA 4RBUA 5FJ4A 3CJKB 3KLFB 2CPFA 2R7QA 3OJSA 1R0AB 4NCGB 2VA2A 2FY1A 5E5NA 2ASLA 4NL5A 4LIRA 2XG8A 2CPIA 4PR6A 1FE4A 3IR5B 2AYBA 4UY8T 3FRZA 3PDNA 4OJHA 5EWEA 4IKAA 3JSRA 3L7PA 3DI6A 3D0GE 1TL4A 1DTQB 1RT1B 2PMZD 4H4OB 1SH0A 2MJNA 4DBQA 4QWAA 4ECYA 3PX4A 1T94A 1VRTA 1VJWA 5G0RA 1YJTA 2MSTA 4DR5F 1RISA 2PO4A 3J81Y 4URGA 2AD9A 4CTAA 3NCRA 1WI8A 3IXQA 1YWXA 3E2EA 4RW7A 2Y1JA 5KFGA 2WAQD 1L3SA 2P9GA 3I0SB 1C0TA 1YJRA 4DV5F 1S9FA 3NNCA 2XY6A 1VQPS 2M8HA 2FJEB 1VQSA 2MHEA 2V4JA 1GQEA 3G6ES 5DG8A 5F9LA 4DJBA 3NMRA 2VZ9A 2UUTA 2GC8A 4IR1A 2AF6A 1FJGF 3MFHA 4J9SA 1QVGR 2EBGA 2K7KA 3K57A 4MKYA 1NB7A 3GE9A 3S7RA 5LJ5Y 1SV5B 3RBDA 3RB0A 1JK9B 2R7UA 3O3LA 3UQSA 4MIWA 2FVQA 4PQAA 1WEYA 4LFBF 2O5DA 3ZZRA 4ED1A 3H59A 5DJBA 4CO3A 2IBKA 1SB6A 4D3HA 3THVA 2RIJA 3MAQA 1UWBA 1QE1B 2I1RA 4IG3A 4O4RA 1TL3A 3VAFA 3DRPB 2HVHA 3PKMA 1VRUA 3O6QA 4B02A 2VKRA 3IA0A 3M8SA 5CCLA 2DITA 4QYZJ 2ZITA 1DRZA 5KFCA 1XR7A 1LKZA 2COLA 3NBPA 3OL9A 1G7CB 3AH6A 3BO3A 1TL1B 2DPJA 3A1YG 3GFXA 4YP3A 1TKZA 1WF1A 2WCXA 3TNVA 4X65F 3LALA 1VC6A 2B9YA 3IR6B 1RT3B 2YNFA 2OPSA 2OFHX 4IFYB 4IFVB 4RW4A 2NSCA 3SQGB 1XNRF 2RB7A 3K58A 4DFKA 2RT3A 2BABA 4DR7F 2ILYA 4F8RA 3HM9A 4RNHA 4KO0A 2B43A 2QO3A 4NLUA 3I9V9 2J8AA 1ZAXA 4PXEA 2KJVA 1IUJA 2FHJD 4LSLB 2OD4A 4J9QA 3T1AA 1N5QA 1M5OC 2YH0A 2DO0A 2B6AA 5EHHA