2OPSB

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
435
structure length
409
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 108
structure length 409
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB02
3JYTA 2YKNB 1C0TA 5DG8A 4ZPBA 2UVVA 1S6QA 1W25A 3FRZA 2WHOA 1JLEA 4IR1A 4ICLA 3I5BA 3CJ4A 1S1UA 4MKBA 3PW0A 1RT6A 4Y3CA 3ICLA 1S1XB 4URQU 3BQ1A 3V6HA 3DLKB 5L9XA 3SFGA 3E01A 3HVTA 4B3OB 5KG5A 2FLPA 4I2PA 2WOMB 4KO0A 5J2QA 3UDLA 4YP3A 1HMVB 1LW0B 5D3GA 4TXSA 2I5JB 2RDIA 2WB4A 3DMJA 3MEDB 3M8QA 4DL2A 5FDLB 2XGQA 4QWCA 2XC9A 5T14A 4G3IA 1XR5A 4K4UA 4QWDA 4XPCA 1JLBA 5KG2A 4EYIB 5F8NA 2BQ3A 3KHGA 4RW6B 4IFVB 3CDEA 5KFXA 4R8UA 3IS9A 2O5DA 4J9MA 4EEYA 4IR9A 3H5UA 3FDSA 4ECWA 5DLFA 3LP1B 1J5OB 2FJXA 2C2DA 2BANB 4H4OB 1K1QA 3DI6A 1SH2A 4O3QA 5KG0A 4GC6A 1S9FA 3CJ0A 3GYNA 4JV1A 1HARA 1VRUB 3SFUA 1C0UA 2ASJA 4MIBA 4WZQA 3DLEB 1MMLA 4MKAA 3MFHA 3NAIA 3I5CA 3RAQA 4PUOB 5KFKA 4KV8B 2C28A 4ZVFA 4KFBA 2VA3A 4QW8A 2C2RA 2OPSB 5HLFB 1HNIA 3I0RA 4TYAA 1HNVA 4WXOA 4ZHRB 1RT1A 2YKMA 1S49A 4ZVEA 1RT2A 2R2SA 3CJ3A 3KLVA 4ED1A 1IKYA 2IM3A 4ECRA 1JKHA 4K50A 4J9SA 3QO9A 3ISNC 4H4MA 3KNAA 2OPQA 1T94A 1S6QB 3MEGA 4KHMA 1JLEB 1JLAA 1TV6A 2W9BA 2ATLA 3QLHA 1GX6A 3NBPA 5KG1A 2DPIA 4J9LA 2BRKA 1K1SA 2YNGA 4R5PB 3E01B 3HVTB 2JEJA 2E9RX 3GIKA 3DLGA 3BGRA 3TVKA 5D3GB 3KMQA 2ZD1A 1R0AB 1RTJB 3DMJB 4HYKA 2FVPA 5KFZA 4DL5A 3RBEA 3M8QB 1ZTWA 4YQWA 2CJQA 1QE1B 1JIHA 1SH0A 4WZMA 1JLBB 2VG5B 3CJ2A 1S1XA 4TLRA 1LW2B 3FSIA 3MFIA 1KHWA 4IFYA 1N6QA 3NAHA 2WOMA 2V0NA 3MTKA 1HMVA 3DM2B 4NLXA 3KLEA 1TQLA 3NGDA 4TYBA 2VG6B 2I5JA 2R8HA 4Y2CA 4QPXA 2B6AB 3MEDA 4DG1B 2UVRA 1ZETA 2ILZA 5FDLA 3MR5A 4J9NA 2D41A 4NCGB 4EBDA 2V4QA 1TKTA 3T5HA 2VA2A 1TVRB 4RU9A 4WYWA 4F4ZA 3KK2A 3IG1A 1TP7A 5KFGA 3H2LA 4ZMMA 4RW6A 5HP1B 3RB0A 1S0NA 4KFBB 5EUHA 2VG7A 1HNIB 3I0RB 4GC7A 1HNVB 1MU2B 3OHAA 4QW9A 4WE1A 2YKMB 3BSOA 3PW7A 4J9KA 3N6MA 2WONA 3C6UB 3LP2B 3PW5A 2J6UA 1JLFB 1IKYB 2FVQA 4ECVA 3LP1A 1J5OA 3RB3A 2ASLA 2BANA 4H4OA 2V9WA 4J9RA 4O3RA 3QO9B 2OPPA 1I6JA 3MEGB 3BSNA 4NRUA 1FKOA 3C6TA 1JLAB 5KFLA 4RZRA 2W9BB 1ZTTA 3QYYA 3NBPB 4O4GA 4M95A 5KT7A 2R8KA 2GIQA 4MK9A 1S4FA 1T3NA 2XWYA 2D7SA 4KV8A 2YNGB 5HLFA 4IRCA 4Q8EA 2ILYA 3QIPB 4LSLB 1S1VA 4IRKA 3DLGB 3MF5A 5KFRA 4YMEA 4YR2A 3BGRB 3PR4A 3H5XA 3OHBA 2I1RA 4DL3A 3OL8A 2ZD1B 4XPEA 4ZP6A 4NRTA 3VQSA 1D1UA 3ITHB 2R2TA 4H54A 5F8MA 4RUAA 3IGNA 2HNDB 5KG7A 1RA7A 3KLFA 4PWDA 1YVFA 1HQEB 5C24A 4KE5A 4FS2A 3JSMA 4RNFA 4R5PA 4TN2A 1QAIA 4ED6A 5L1IA 4IFYB 1N6QB 2IMWP 2R8IA 4IG3B 3QGIA 3KLEB 5KFFA 3OL7A 4MFBA 5J2MB 4WYLA 2W9AA 1R0AA 1RTJA 1S1WA 3LAKA 3G6XA 5KFPA 2YNFB 1S97A 2DPJA 1RTIA 1S48A 1TKTB 3KHLA 1QE1A 4URSA 5KFDA 3KK2B 3IG1B 4O4RA 2VG5A 4ECSA 1DLOB 1LW2A 2VG7B 1JLCB 4Q0BB 2QE5A 5C25A 3M8PB 5KG4A 3V6JA 4WE1B 2YNHB 3DM2A 2WONB 2WTFA 1XR6A 2VG6A 5EWFA 2BQRA 3GQCA 2B6AA 2FJWA 4DG1A 1UWBB 4K4XA 1KLMB 2W8LA 2OPPB 2W9CB 3RB4A 4IG0B 1FKOB 3C6TB 4NCGA 1JLQB 1S6PA 2AX1A 1RYSA 1TVRA 4O4GB 1T03B 3M9MB 5DQGA 2IAJA 4G1QA 2HMIB 5HP1A 3KJVA 4EBEA 1HYSB 1T05A 3EPIA 1DTTA 3H40A 1MU2A 3H5SA 4TY8A 4LQ9A 4ZPDA 1S1VB 4DL6A 3G86A 1EETB 2FVSA 3C6UA 3LP2A 3HVWA 3GIMA 1IKXB 1JLFA 3D5MA 3BQ2A 3T19A 5DQIA 5KFSA 1FK9B 2IC3B 1HPZA 1S1TA 3KLHB 4MIAA 4NLQA 4K4VA 4NLDA 4NZ0A 1JLGB 5KT4A 3GIIA 5KG6A 3CIZA 3Q8SB 4U6PA 1HQUB 1VRTB 5EWEA 5EDWA 4ED8A 5KFVA 5KFYA 3KLFB 4PWDB 3N6NA 5CYMB 5C24B 2UUTA 2AWZA 4MH8A 4KB7A 4ED3A 2HAIA 4RW9B 4O44B 3JSMB 4PQUB 2JLEA 4NLVA 4YR0A 4WXWA 3GV7B 2AQ4A 3QIPA 4LSLA 4ED0A 2ZKUA 3DOLA 1N48A 3H5YA 4F4WA 2FVCA 4ECXA 4MFBB 1OS5A 3KMSA 3DOKB 4NYZA 2RF2B 1S1WB 5C42B 5KFHA 4JV2A 1C1CB 3CDUA 2IJNA 3ITHA 3NKYA 3DRSB 1RTIB 3UQSA 4EYHB 2HNDA 4Y34A 5F8IA 4Q43A 1HQEA 4ECUA 3BJYA 4LQ3A 3I5AA 3OL6A 2AGQA 1SH3A 2J6TA 4NLGA 2BR0A 5KFAA 4K4WA 1SV5B 2E9TA 5C25B 2ZE2B 5KFEA 5KFCA 4DL4A 4IG3A 2XGPA 1RYRA 2HNZA 2BRLA 5J2MA 4RNHA 3T5KA 5J2PA 5KFIA 3V6KA 5L1JA 3KLGA 2IM2A 3CDWA 1LWEA 4NLTA 2YNFA 2IA6A 4JUZA 3PW2A 3I0SB 4RW7A 3FQLA 1S6PB 1BQNA 3CO9A 2WCXA 1SUQB 4IH7A 4EO6A 1XR7A 1Z4UA 5F9LA 4WFYA 2IAJB 4G1QB 4LSNA 3HKWA 2OH2A 3KJVB 3Q8RB 1DLOA 1T05B 3PHEA 1JLCA 1DTTB 4Q0BA 1IKWB 3M8PA 3G6YA 3RAXA 4TY8B 4KSEB 2YNHA 3OLAA 3MEEB 5KFNA 4RW8A 4J9QA 1JX4A 2FLLA 2IBKA 1IKVB 5I3UB 3CVKA 1HPZB 1S1TB 1UWBA 2BE2A 1KLMA 1NHVA 2B43A 3QGGA 1EP4A 3GILA 2W9CA 2HNYB 2C22A 4IG0A 1S10A 4RW4B 1JLQA 4OL8A 2D3ZA 3BSAA 4NLOA 2AX0A 1T03A 3EZUA 4ECZA 5J1EB 5KFMA 2OPRB 3IGVA 4KBIA 1D0EA 2HMIA 5KT5A 5HBMB 1RTHB 1HYSA 4IQXA 1LWFA 1FKPA 3OSNA 1TL1A 3KK1B 3T5LA 2UVUA 4KHRA 1EETA 3DOLB 3LALA 2FJVA 1IKXA 5J2NA 2CKWA 3H98A 3H4BA 5K14B 3G6VA 1QUVA 4EO8A 1FK9A 2IC3A 3KLHA 3DDKA 4NLUA 1JLGA 3LANA 3CWJA 4ZPCA 4ZPAA 3T5JA 5KFWA 1HQUA 1VRTA 4O3SA 2IM1A 4K4ZA 2EC0A 3M9OB 4O3OA 5CYMA 4U7CA 5EWGA 4RW9A 4ID5A 3MECB 4O44A 4PQUA 4WFZA 4ED2A 2ALZA 3PZPA 3V81A 2W7OA 1TL3B 3OLBA 5L1KA 2HNZB 2HWIA 3FFIB 2RDJA 4IKAA 5CYQA 5J2PB 3DOKA 1C2PA 3KOAA 2RF2A 2YNIA 5C42A 4I2QB 3ISND 1LWEB 1C1CA 3DRPA 3KLGB 4MK8A 4KAIA 4QWBA 4TQSA 3QZ8A 3DRSA 3GIJA 2J6SA 4RW7B 4RNNA 5I42A 4TQRA 1BQNB 4ED7A 3PJXA 2R8JA 4MK7A 5HROA 4LSNB 3EPGA 3D28A 3N6LA 2ASDA 1SV5A 2ZE2A 4IDKB 3KK3A 1N5YA 3CJ5A 1RAJA 1QAJA 3HVAA 4NLPA 3PJWA 4O3PA 3TQ1A 1LWCA 5KFOA 4RW8B 4I7FA 4K4TA 1BQMA 3KLIA 3V6DB 2GC8A 3QGHA 2BE2B 4M94A 4ZP8A 1EP4B 2JC1A 3I0SA 4QWAA 1RA6A 4RUCA 1RT3B 1SUQA 2XCPA 4URGA 4RNMA 4NLRA 3LP0B 3IRXB 1WNEA 3TAMA 2WK4A 5KG3A 3DYAA 1LWFB 1FKPB 1IKWA 1N56A 1RDRA 3H4DA 2UVWA 1TL1B 4X2BA 1S9EB 1S9GA 4TY9A 5KFUA 3MEEA 3V4IB 1DTQB 3UPFA 5F8GA 2R8GA 5L1LA 3T1AA 1TKZB 5J2NB 2B5JB 1TKXA 5DGBA 1IKVA 5I3UA 1C1BB 3M9NB 3BQ0A 2AGPA 2HNYA 4YR3A 4RW4A 1RT4B 4J9OA 4Q8FA 5JUMA 1RT7A 2FVRA 3KHRA 5J1EA 1U09A 2OPRA 1S0MA 1RT5A 3OL9A 3MR2A 5HBMA 4JV0A 1RTHA 4ID5B 2IM0A 3QZ7A 5KT2A 4ECTA 3KK1A 2JC0A 3V81B 3BR9A 4K4SA 1REVB 5K14A 4Q44A 2XI2A 2RKIA 3RB6A 5CYQB 3JYTB 2YNIB 3MR6A 4ZVGA 3PW4A 3DRPB 1C0TB 3Q8PB 4XO0A 2XCAA 2BQUA 4F50A 4FBTA 3PR5B 5I42B 2AU0A 5DG9A 2XI3A 1IM4A 3HHKA 4ICLB 5HROB 2HWHA 1S1UB 2UUWA 4NLSA 3MECA 1RTDA 4IRDA 4RNOA 5KFJA 1RT6B 3GV5B 5KFQA 3DRRA 3KK3B 4HKQA 1N5YB 5KT6A 4Q45A 4J9PA 2W8KA 1TL3A 3NL0A 1LWCB 2W7PA 3FFIA 2V4RA 4I2PB 5F8HA 4I7FB 2F8EX 2JEFA 4KO0B 1BQMB 3KLIB 4KKOA 5J2QB 3FQKA 1GX5A 1KHVA 2YKNA 4I2QA 1S0OA 3QIDA 5C5JA 4ECYA 3BREA 3GV8B 3E51A 4NLWA 3TAMB 2R2RA 5DG7A 3DYAB 4DEZA 1JXLA 4DL7A 4IDKA 3KHHA 4F4XA 1S9GB 3DLKA 2FLNA 4EBCA 4B3OA 4R8UB 3IS9B 4Y2AA 2IJFA 3V6DA 1TKXB 1LW0A 3UR0A 1CSJA 4R0EA 3DI6B 3NMAA 1RT3A 4ZP9A 1C0UB 1RT7B 3SI8A 4IOBA 5KFTA 4IH5A 1RT5B 3LP0A 3IRXA 2D3UA 2R2UA 3PVXA 5KT3A 4IFVA 3IN5A 3H59A 4ZVHA 1S9EA 3V4IA 4ECQA 1DTQA 2JEGA 4FBUA 2WRMA 1TKZA 3MR3A 5DQHA 1RT1B 4IH6A 4K4YA 2QV6A 2B5JA 2C2EA 1RT2B 2RKIB 5DGAA 4F4YA 1C1BA 1JKHB 2GIRA 3LAMA 3BSCA 3RBDA 5JXSA 5F8JA 1RT4A 4H4MB 2OPQB 1VRUA 4NLYA 2JEIA 1N4LA 2E9ZA 1TV6B 3DLEA 4ZP7A 3QLHB 1RTDB 4WFXA 4QWEA 4PUOA 2AGOA 5KFBA 4FS1A 3DRRB 5F9NA 2OPSA 1REVA 1NNDA 5DLGA 4O3NA 4ZHRA 5F8LA 3Q8QB 4KKOB 3OSPA 1NHUA
chains in the Genus database with same CATH superfamily
3ET6A 5ETMA 4OLPA 4N77A 2NUUG 1ICEB 2VH7A 4MYUA 1V5IB 1S1XB 3DLKB 2YWHA 3EVOA 5J2QA 3UDLA 1LW0B 4OMFG 3ZZTA 4C8NA 4B3SF 4KH1B 5C7PA 5CQGA 4CI0B 5T14A 4WFAQ 4K4UA 4GKJF 3MPDA 1UTAA 3IS9A 4CZCA 4PYDA 2HZVA 4IR9A 2MQPA 2HW3A 3BN7A 2ASJA 1VQKS 4ZPTR 4CH1A 3DLEB 2CA9A 5CH7B 3K59A 2VA3A 3QRPA 1NZ8A 1X4FA 1YI2S 1RT1A 2A2CA 2PI4A 3TA1A 1JKHA 2RVJA 4OHVA 3KNAA 2DH7A 5HANA 4OZLA 2ZHOA 3R9LA 2ASYA 1K1SA 5GMEA 1VJWA 2VBWA 1RAEB 1T02A 5BR8F 2VBXA 5D3GB 1X5PA 3KMQA 2GCFA 1Z2LA 4QCLA 3FJ2A 3HO1A 1JLBB 5KTQA 2K1RB 3J7A1 3FSIA 1WEYA 5HVGA 2V2VA 4CP5A 2ZC3A 4KGXB 2O01C 4B3TJ 2J0XA 4OYBA 1W7WA 3MR5A 3KK2A 4ZMMA 5HI7A 4KFBB 2W2QP 1M5VC 1RWMB 3PW7A 2RS8A 4J9KA 2VICA 4USTA 3UO0A 3C6TA 2MJNA 2PEBA 1L3UA 3H25A 4ZK7M 5HLFA 1FNOA 3QFWA 2UV8A 3M2UB 2YWGA 1SIZA 3RW6A 3WDOA 2JLFA 2HFNA 4V1Ak 2DY1A 3QGIA 5KFFA 2PDAA 2HHSA 2LQ9A 2I0XA 1RTIA 3KHLA 1QE1A 3D0IE 3GPAA 2HGNA 5KG4A 3EGNA 1SKRA 1GXTA 2YNHB 4C7QA 3I4PA 4C48A 4IG0B 1TVRA 3OTCA 4G1QA 4L73A 5ITHA 4J37A 4TY8A 2DK2A 5HATA 2XY6A 3C6UA 5CAAA 2RRAA 1JLGB 1KQFB 1HQUB 1PAEX 3MM5A 3D68A 4YR0A 3NGUA 4NYZA 2HIQA 3A12A 3SYZA 3K5LA 2IY5B 3A8IA 5G0RB 3N01A 2AKWB 1TKDA 1SH3A 5IQQA 4DUYJ 3E2EA 2L9WA 1EZZB 2P5VA 1SKWA 1BQNA 5F9LA 1BUXA 3NS7B 2B8QA 5D4PA 2C2MB 4YHHJ 3CC2S 1FJEB 1J5EJ 5U47A 2MGZA 2KI2A 1JLQA 3TJ9A 3BSAA 3OVBA 2GNKA 3IGVA 2HMIA 3Q8VA 4UUWA 2LVWA 1EETA 2NSCA 5J2NA 3G6VA 3DDKA 3ILLA 3S01A 2AJ1A 3ENWA 4ZVOB 3I82A 3PZPA 5GMKa 1TMMA 3OLBA 2BXJA 1C2PA 4OJ3A 1UVMA 3N79A 4MK8A 3QZ8A 2F9JA 1WJ9A 4W98A 1D9FA 4UTGA 2Y1RI 2WBMA 1GMUA 2F5GA 1U1KA 1F9HA 3UR3C 2EC2A 4Q7AA 4FF1A 4C0OC 4QWAA 1CS4A 2R8KA 1W2BR 4FNIA 4NCAA 1S9EB 3MEEA 3QAEA 2K7KA 1SJFA 1N5SA 1F3VA 1FTRA 3PNIA 1MN7A 2FD2A 4LRBA 1U09A 1RT5A 2BUNA 1RKJA 4RLEA 3V81B 2HBQB 4PKDB 2GHPA 4DV5F 2KL8A 3HHKA 5CA5A 2W8KA 1TL3A 3FFIA 2V4RA 2VC1A 3QIDA 3IR5B 2DKOB 4P75A 2B7BB 3FBBA 2DNLA 4JI4J 2GMLA 3RBZA 1XN9A 3Q86A 5KAKA 3ZTSA 3BBBA 3NXZA 2CG4A 1I1GA 3DOMA 8RUCA 2DGUA 2XQCA 5DQHA 4IH6A 3VAHA 2EEYA 2PMWA 5GAHI 3B54A 3BSCA 3MDFA 4K8RA 1HL6A 2OPQB 2CQ4A 3AHPA 2LECA 3QLHB 1XNQJ 2LDIA 5HJXA 2WSCC 5DM6Q 2D9OA 3TUPA 1N88A 4CO3A 4TU9A 2D3OR 3PW0A 2B9YA 4WFBQ 2E7VA 2V8VA 4B3OB 2J76E 5GAGU 3FZBA 2HEKA 1UA1A 1CJUB 2XC9A 5CCMA 4G3IA 1XR5A 4B3RJ 2LA6A 2IJRA 3CDEA 3EXYA 3TX8A 2QL9B 5AXKA 2XLIA 4U95A 3TARA 4ECWA 2C2DA 4GC6A 1HARA 1WDTA 3I5CA 1AFIA 2BJ3A 5KFKA 2XEXA 1YJ7A 4X84A 3MMCA 1IKYA 4C2MA 3JTNA 2CVEA 4KHMA 4USIA 2QMUB 3C46A 3M8RA 3UE2A 1WDDA 1WF0A 1Y00A 2GQQA 2UUAF 4ZLPA 4PPZA 4HYKA 1D9DA 1AUSL 4GO7X 1IBMJ 2CQGA 3KUGA 5C2GA 3S8SA 4BBYA 4NA2A 1LW2B 3MFIA 5HO4A 2Q79A 1YRXA 2B9WA 1WELA 3NNHA 2VG6B 5A8RA 2I5JA 2OGUA 3I96A 4EBDA 1TP7A 3MOZA 2BVZA 1NU4A 1Y7PA 1HNIB 2YKMB 2LEAA 3QT7A 2WONA 3P6YC 3LP1A 2BANA 4NZ6A 2CAJA 2NYHA 4OJGA 4K0KF 2ILYA 3HZEA 2K3IA 3MF5A 1N5VA 2HHVA 1RWVB 3FZ2A 1I94J 1WTBA 2X1GA 4ZVSB 3RTVA 1HQEB 3NS5A 1UPPA 3QGPA 4XAKA 4RL1A 1U1NA 1HWIA 3SQGB 2WVDA 1X9SA 1S1WA 2ZJRQ 3LAKA 1WEZA 2DJWA 1VCTA 4C8LA 3CC7S 1DQAA 4ZCMA 2CQDA 3A3OB 1YJVA 3J7YI 3PY8A 2XULA 1XR6A 1UW9A 4HHUA 2FB0A 3C15B 4HI1A 3AD7C 2V6AA 3LP2A 3OUYB 5IV4A 5KFSA 1HPZA 4NZ0A 2UXDF 4U6PA 3M30B 1TAUA 3TYTA 4J91A 1IR2A 1HNZF 4X65F 3VAJA 1N36F 3DOKB 3H8YA 2KZZA 1XQIA 1HLWA 1FRLA 3OL6A 2GVZA 2DIVA 2XS2A 5C25B 4MKYA 3MPUB 2DNHA 1FVQA 5J2PA 3UI3A 4DFKA 4CO0A 4M5LA 2OH2A 4HI2A 1T05B 1IKWB 3T1HJ 4QQBA 4F25A 3FMBA 2FLLA 3LWLA 1NHVA 3GILA 2D3ZA 2NXCA 1RCOB 1KQSR 1KQKA 2WW8A 4HHJA 4F04B 2CKWA 1OPZA 4PRFA 2OJ3A 4ZPCA 4AL6A 1FWKA 4K4ZA 1GMWD 3HHLB 3C14A 2P2CB 1JXVA 2RRNA 1ZZFA 2ALZA 2W7OA 1JXEA 5DZ7A 2HWIA 2ZHBA 1UEUA 3ZTOA 2G0CA 4DR4J 1SKSA 3L95X 3ZTQA 2RJZA 3HHLC 4B3MF 3LGNA 2BJDA 2DHGA 2JC1A 2AEMA 4LBHA 2J7UA 2XLKA 4DR6F 1UFKA 4OI3A 2C3UA 2MSSA 4RO0A 3EZOA 5DGBA 2E5LJ 5I3UA 1Q5VA 2BX6A 2N4CA 4NCBA 4MIWA 1TL7B 1CC7A 1RAHB 7FD1A 2HVEA 4LF6J 2QC3A 4ICLB 2XMAA 3K8VA 1RTDA 2CJYB 2ZFHA 3CJRA 1M5HA 2OIHA 2W7PA 5F8HA 4WKRA 3FQKA 2Z30B 4PG7A 2Z8QA 3KHHA 4F4XA 2VJUA 2IJFA 3SBMA 4A46A 1X4EA 2DNKA 3DI6B 1XNRJ 1C0UB 4IH5A 3IRXA 3AAWB 2UXCJ 2KM8B 4JYAF 3TRGA 4RBTA 3M2RB 5T41A 1EJ7L 2JRSA 1Y9OA 3M2VB 2HK3A 1N4LA 1V3RA 2EBEA 5F9NA 2OPSA 3DN9A 5I4MA 4ZHRA 1B7YB 3QSIA 3OSPA 2N3LA 1WOSA 4USMA 3CD6S 1WC3A 3P8BB 1S6QA 1B0TA 2E1MC 4ANEA 5EX3A 3MMAA 3I4HX 3T1YF 1GH8A 4K5SA 1FRXA 4GKKF 3U1LA 2F8HA 4RW6B 2AP6A 2FGCA 3KKFA 1SH2A 3ILOA 4USVA 3OXFA 3TAPA 1N54B 3KJFB 3UNYA 2YQ1A 4ERDA 2HHQA 2POKA 5K9FA 5A0YA 1RT2A 1H0HB 2PFFB 2NXNA 2QLBB 3JXOA 4J9SA 3VGUA 1P9YA 4YOEA 4CH0S 2N82B 1RADB 3BGRA 5B08A 2KVQE 3MAQA 6FD1A 4YQWA 4WZMA 1KKHA 5IWAJ 1S1XA 4IOAQ 3CJTA 3H0PA 1VIOA 3P49B 1G3OA 4NLXA 3EVWA 1FD2A 2B6AB 2E66A 3W1YC 4J9NA 4NCGB 4RU9A 3IG1A 2VOOA 1RWNB 1VMBA 4B9SA 4F2RA 2KT5A 4R0JA 4JV5J 2W2MP 4L3NA 2VU5A 3SV3A 3MEGB 2BJEA 4O4GA 2GIQA 2A2DA 4DV1J 2GJ2A 2CDRB 3RBXA 3QIPB 2EXUA 1S1VA 4IRKA 3CD5A 3CCLS 2GO8A 2KJVA 2VPZB 2FHJA 4DQPA 1P1LA 1KOHA 1ITPA 1RCXB 1GK8A 4KYZA 2E1PA 3EMTA 2R7VA 5AE3A 4WK1A 2FHOB 4K2JA 1S97A 2DPJA 2FY1A 3L4BC 5KFDA 2K1RA 5A8KB 1DLOB 4TNOA 3ZZZA 2R7XA 4CLTA 2M5YA 2N3OA 3MOJB 2DEJA 1M1KT 4HL9A 5EX0A 3HF5A 2YTCA 3CSKA 2DNPA 2CPZA 2MQ8A 4ED8A 5KFVA 1U48A 2UUTA 2OELA 4NLVA 1TK8A 1R3NA 2HLUA 3IC1A 4C8ZA 2A3JA 1N48A 3JSRA 5JJBA 1QTMA 3M2UA 1N5QA 3QRQA 1UMJA 3UW1A 1FJGJ 2BR0A 1SV5B 1NB2A 2XTJP 4LF1A 3KXDA 4FP9A 3T5KA 3VAGA 4DV4J 5L1JA 1RACB 4QU7A 4OHWA 4HTIA 4X4QA 3S7RA 8ATCB 1OY8A 5L8RC 2YNHA 2BM0A 1VIXA 2Z2MA 1VK3A 1YTYA 2IBKA 3RRKA 4YUDA 4IG0A 4JOUA 3AJ2A 2AX0A 4O0NA 2DCUB 2CPDA 3T5LA 4KHRA 1CJKA 1FWPA 5FIIA 3AB2B 2GMJA 1JLGA 1HQUA 3BPSP 3CCMS 2NPIA 2UV8G 2Y8YA 2E1AA 3MPYA 4Y2MA 2DGOA 5L1KA 4EZ6A 4DUZF 3KLGB 2CPJA 1OQ3A 1U45A 5ETNA 4UQGA 1VBZA 3BYPA 1RAJA 4ZDNA 2DHAA 1VS3A 1EP4B 4ES3A 2JZ5A 2BOAA 4DF8A 4F2SA 4CNYA 2KTQA 5KG3A 4X66J 3OR2B 1RDRA 3ZZYA 2Y0BB 1NK9A 2R8GA 1HBOB 5IT0A 3UNGC 5L9NA 2B7CB 3ETOA 2J7KA 4OZ1A 4DQIA 2IM0A 2MQQA 2JC0A 2BKNA 4Q44A 1Q16B 2XI2A 1IBLF 4M5JA 4ZVGA 2NR0A 4C11A 1IM4A 2GHWA 5L38A 1VGYA 5KFJA 2OLWA 1X4CA 5KFQA 4CLSA 3E8OA 3NCQA 2ZC4A 1GX5A 4ECYA 2C3OA 2CYYA 1RGVA 3A1YG 5ETLA 2MYFA 2D1CA 1E6VB 1XTZA 1YJNS 2HHUA 3ONQA 1S9EA 4KGVB 4PWUA 4JI0F 1NPPA 4JI3J 2AW0A 3DLJA 2JOQA 5F8JA 4E2FB 3BGUA 2JEIA 2CPXA 4N47A 2W24A 1Q53A 4CWBA 1PO6A 4I64A 4DN0A 1U26A 2WHOA 1JLEA 3I5BA 4BCAA 1FXRA 1EIYB 4MKBA 3W8PA 3BQ1A 3TUJC 2F4VJ 4KJIA 5I3PA 1DHMA 2ZBRA 3MMJA 4DR5J 3J7YU 5BYRA 5F8NA 3CCRS 1TMJA 2RAQA 1E6YB 3TANA 2J0WA 1K1QA 2CNNB 3GYNA 3OTOF 1VHIA 1XIQA 3K2YA 4TVAB 1H73A 3C8YA 2QA4G 2R4FA 2OMLA 1HNVA 1MWYA 3CJ3A 4ECRA 1QVGR 1GXUA 3LW5C 2OPQA 3QLHA 2Z2YB 3PYEA 2MB0B 4J9LA 2Z4PA 1FRJA 3TVKA 2ZD1A 4DSLA 4DR7J 2MJUA 4FXVA 4MT1A 4D3GA 3CJ2A 1QUPA 1T9UA 2OSRA 1TQLA 2GZOA 3G8QA 4QPXA 2F8MA 2JVRA 1CJUA 4DPYA 2PFDA 5DDPC 1S0NA 3HDSA 3OTDA 1MU2B 3J81j 1F2HA 1PYSB 4LFCJ 4P2SA 4Y65A 4FF4A 1FKOA 2OFGX 2XWYA 3G9CA 5D6GA 2D9PA 3H5XA 3RRGA 2MZRA 1FNXH 2FJBB 3KLFA 3R6LB 4KE5A 5D4OA 4FS2A 2QA4S 5DJBA 3F44A 2ZNZA 4HHHA 4ED6A 3Q2SC 3CULA 4DV2J 4PZVA 5KFPA 2A1BA 2B4VA 1LW2A 1JLCB 2KVIA 3V6JA 4ILLA 2XWXA 1BGXT 4DR1F 2VG6A 2BQRA 2OPPB 3RB4A 2NREA 1RYSA 1IR1A 3RUBL 3ZXWA 4QR1A 3KJVA 4U8VA 1NM2A 3HVWA 4MKVA 5IT9Y 1ZPWX 5HL7Q 1HI8A 2LU1A 4ED3A 2AWZA 1K8AT 2WSEC 2DGWA 1TAQA 4ECXA 2K7JA 2IJNA 4Y34A 1HQEA 5K20B 5IC4B 2HFZA 1FJCA 2O66A 3SQGA 2PO4A 4Y00A 2CQ2A 3ZZ0A 1IXKA 3FQLA 2ZH1A 1FRMA 4EO6A 2IAJB 4JI7J 1ELOA 4Q2MA 3OLAA 1U2RA 2GV1A 1GT8A 3ZC4A 3MCMA 2JJ4D 2HBRB 1S10A 5E33A 2C22A 1BXNA 2ZDPA 1UFLA 3C15A 3R7NB 1OWXA 1R8CA 3TUZC 2UVUA 3JAMU 3K89A 3JSBA 1TU0B 3OUYA 4NMXA 3X1LB 3M30A 1FRKA 3H2UB 4DFPA 3DOKA 2IRYA 2YNIA 3U27A 4RW7B 1L3TA 2V2QA 1VC5A 2H4WB 5E41A 4K4TA 1T95A 2BE2B 3ZZRA 4OI4A 4DR3F 1YBUA 4RNMA 3LP0B 1KONA 5LXRA 1IKWA 2HFOA 1BY9A 5L1LA 3K17A 1UA0A 2YQ3A 3CJKA 1FDBA 2ZOFA 3QZ7A 3US5A 1HD1A 1O8BA 3AY0A 5E7OB 3RB6A 2IA0A 3PW4A 4FBTA 1WC4A 2HVDA 1HNWJ 4QIWD 3HHLA 4NEZA 1NK8A 4QU6A 1SC1B 4K5RA 3MTJA 1QDUB 2M0GB 2XZTB 2YKNA 1VISA 4ED5A 1AA1B 3DLBA 2L9NA 1NSPA 4FPRA 4DL7A 3SQOP 2MLZA 2FLNA 3HSDA 3MAHA 1U6ZA 1TKXB 1CSJA 2GO9A 1TK5A 1F2GA 4NXNF 4LF5J 4C6AA 3J81Y 2DXFA 1RHQB 1YRUA 4LFBF 2RKIB 4C3MA 2F63A 4B02A 1AZSB 4FZVA 3THVA 4GMKA 3UN3A 1NNDA 5M2RA 1FT8A 2XMVA 2ZJQQ 1JWWA 4ICLA 1FERA 1P9QC 1VQ7S 2ZBQA 1RWUA 3SFGA 4Z37A 3O3LA 1VBYA 4YP3A 2MKHA 3K57A 1MMDA 3CMQA 1YZ7A 4P72A 1U0HA 2RQMA 3M7VA 5GAEU 4LF7F 3CNQP 4PEOA 3KFWX 3DI6A 1YLXA 2YXLA 2JWNA 1C0UA 5A2QY 4WZQA 3EGVA 5ETPA 3R3TA 3QBCA 2C28A 4ZVFA 1N34J 3EGZA 2JFDA 4LVNP 1KFSA 2W2PP 1WC0A 3T41A 4DDFA 1U2CA 3R1HA 4DZDA 1LOUA 4OX9F 3GMGA 3HVTB 1WHVA 4DL5A 1V3SA 4EK2A 1Y0HA 4DHVA 4FXWA 5CHCB 3MEKA 3MI7X 1QSSA 2EG1A 5HMYA 1PIEA 2V0NA 2M8DB 1U1QA 4TU7A 2ALYB 2VC0A 4PXBA 2LDYA 2CWXA 3GB0A 4RW6A 3RB0A 3EICA 4ATNA 2VQEJ 2O3DA 4DLGA 1QSLA 4ETXA 1HBMA 3N6MA 1JLFB 1GFWB 3QO9B 1WHWA 1R43A 1I6JA 3BKTA 5KFLA 3PO4A 3NBPB 3D3BJ 3QJPA 1S4EA 3CCJS 4USKA 3WZ0A 4MJKA 4XPEA 4OZNA 3VQSA 1NKBA 1RA7A 1QAIA 3D0GE 1XC9A 3KLEB 1KVKA 2UUBF 3PEHA 1UZHA 2RE1A 3THPA 2VG7B 2JH3A 2JL9A 4NXMJ 4X4TA 3IWLA 2DNOA 3DRXA 4A8XA 2B6AA 4NCGA 4JI5F 5LJ5Y 3QWPA 4EBEA 1HYSB 3IM9A 3MCOA 2OP5A 1RABB 2ZBIA 1U6BA 4OI1A 4ZCKA 5KT4A 3Q8SB 5CXTA 1N32F 1F5BA 5CYMB 3M32A 3QIPA 4Y28C 1OS5A 3SCLE 4P6QA 3OJSA 4P2FA 2AGQA 1OPIA 2J6TA 3C19A 1RYRA 1HNXF 2V50A 4CLZA 3PW2A 2WCXA 1X8DA 1DLOA 1X4DA 3KG0A 1DTTB 3A4TA 2QMXA 1FXDA 1NAQA 3MD1A 3K5PA 3V2UC 3ILIA 2JX2A 2DIUA 1VI7A 3L3CA 2ZH4A 3LA0A 3OPKA 3EZUA 1WUUA 4MTPA 1CG2A 4DV3J 2JDJA 2FJVA 2MXYA 5HN0A 2BJ8A 2FLOA 2I38A 4U67Q 2J9EA 4TKTA 1GEHA 5CABA 4O3SA 2IM1A 1VBKA 5EWGA 3CCWA 3NNAA 1NJZA 1G7CB 1U49A 3DRPA 5DLFA 4LIRA 5LSRA 1APSA 2C2KB 4ED4A 4LSNB 4B9UA 1SV5A 4RWWA 3TQ1A 2E5GA 1LWCA 4RW8B 4I7FA 5H9FK 3M6XA 3ZZPA 5HQ8A 1LWFB 2KDOA 3H4DA 5IV3A 1C1BB 2ZDOA 5IS2A 2RHQB 3KHRA 1VR6A 1FF2A 4CO4A 3C66A 1REVB 1JNZB 4LF9J 2H9ZA 3R2DJ 1RQ0A 2EFNA 3Q8PB 3PRBA 3RR7A 4F3MA 2XZDB 4Y2KA 1S0VA 1WSRA 3DRRA 3CCTA 1S5ZA 1URNA 2NPFA 3PYGA 4U7UK 3I6PA 4OZJA 3J80U 3PX6A 1YJWS 3CCSS 3SV4A 4NLWA 1RU1A 2Y1IA 2VD3A 1ZM2A 1ZPVA 1U1PA 1RP5A 3UR0A 1ZM3A 1KOOA 3VALA 1ZS6A 3R5AA 4V19X 4AQYJ 4U96A 2F40A 2SXLA 4WK3A 3LF0A 1FWLA 5J1NA 2IYGA 2E9ZA 1TV6B 3MAAB 4PUOA 2VFTA 4B9LA 1NJXA 3QJLA 3G87A 5A76A 4ZPBA 2UXBJ 2ZZNA 3UD3P 2LQ8A 1BD6A 3V6HA 2KRBA 3R1LA 3W3SA 4OX6A 3EDRB 5GADI 2NCKL 2R9LA 4B3SJ 2RH3A 3CDBA 1DY3A 1X5OA 1E6VA 1S7IA 1D09B 3NGSA 1Q1KA 1JJCB 2HWTA 3ZZOA 3SDEB 2XMMA 3IO1A 1PILA 4AXIA 1JLAA 3F41A 2DO4A 2DPIA 2AJ2A 2VDIA 1RWOB 3GG1A 2JEJA 3LTOA 1RWPB 2DGVA 2YKOA 4PQAA 3CB4A 4JI4F 3UD5A 2HFVA 2CJQA 3LWMA 1OY9A 1KHWA 1N6QA 3A13A 4E8UA 2XO7A 1I3OB 3TZYA 1HR0F 2G9OA 3H2LA 5HP1B 5EUHA 3AOBA 2MZTA 4AE5A 1R8PA 4DV7J 4M95A 4ENOA 5CYJA 2C42A 1Q81T 3FRYA 4OJHA 3UFCX 2M7SA 3JTPA 2FHKA 1RB0A 4NI2B 2DNMA 4EWTA 2FY8A 3HX9A 2YNFB 3PEJA 3DGPB 4YN3B 1R6YA 4YY3F 4Q0BB 4WE1B 4OYMA 2FJWA 2IIHA 1ZZNA 4I68A 2W8LA 2C2OB 4X62F 2VODA 1H98A 3AH6A 3RU0A 4IUFA 1H2TZ 1VQMS 1MU2A 4LF2A 4PABA 4MIAA 1SJRA 1S1TA 4KRWA 2FZCB 3GIIA 2NZCA 1U47A 4OJ1A 3Q24A 5C24B 3Q0AA 1SXLA 2QG9B 3B4DA 4MFBB 4DS4A 3DLLQ 3RGIA 2C3PA 5F8IA 3GJRB 4ECUA 1MWQA 3R97A 1FI4A 2YX1A 1XMOJ 1LWEA 2IA6A 4LMZA 1JLCA 4KSEB 3AQPA 2VKZG 3D0HE 1JX4A 1RE1B 2PN6A 4AL5A 2WSFC 4RW4B 5ETQA 5LT5A 1T3OA 1HWLA 4I56A 1IBKF 3AD8C 3N28A 4ES1A 2CQPA 4X4OA 3JSYA 4XTTA 2EFQA 2V94A 2LLZA 1CJTA 3KG1A 3GLJA 1U1MA 4CQ1A 2IPOB 4TQSA 3MM6A 3F73A 2J6SA 1MNEA 1NDKA 1NJWA 4ED7A 3HJVA 2NUHA 2ZWPA 4GO5X 3KK3A 1DBDA 3DNCA 1SQEA 4M94A 4YS2A 2HBZB 1WNEA 1F60B 2MKJA 4FKXA 3KUHA 2EFPA 1YQHA 1RT4B 3QATA 5JUMA 4XK8C 3OL9A 3IBFB 4WWSA 5EN1A 3TI0A 3SIPB 1OSCA 3IBWA 1CEZA 1B4SA 4F50A 5I42B 2AU0A 5DG9A 3NOGA 3TAQA 1T9WA 1V9OA 4EFAC 2UUWA 4DV5J 1RT6B 3GV5B 4Q5VA 5KOXA 4DX5A 5H9FJ 4ZCIA 5LXYA 4LIWA 5CZVA 3TZWA 3TP2A 4U7UD 2R3VA 4LFAJ 2HVZA 1Q8LA 3SCJE 2N7YA 2DHXA 2W7AA 1REGX 4ETZA 4FKYA 4DR2J 3N9UC 1RT7B 3LP0A 3D54A 1SPBP 4IYQA 2C2EA 2XLJA 2LXFA 2F7VA 3MPWA 3OD2A 3RBDA 3OR1B 4ZP7A 3SXLA 1WOPA 1ACMB 4O3NA 1TFWA 5F8LA 2FJAB 2Z58B 5IZHA 2CNLB 4NA3A 3M6WA 1ZYQA 2QGFB 5B7WA 2WB4A 1LFWA 1FEEA 3M8QA 4DL2A 3NGTA 2H5EA 2NXJA 3CT9A 5DRKA 4J9MA 2JNJA 3DFEA 1IBCB 1B0PA 3CJ0A 4P74A 1NH7A 2YKPA 1WKJA 3MPVA 5L39A 2UP1A 3POTA 5CCLA 2X7IA 1NUEA 3PHTA 4K2XA 1X4AA 4HACB 5KG1A 1AZSA 4DI6A 1G4CA 4DWIA 5K8MA 3NCRA 4UW2A 4PXDA 1R0AB 2FVPA 3BEGB 4DPOA 1MROB 2UUAJ 3GYXB 1SH0A 5A8WA 3IM8A 1S7HA 4C98A 3KUEA 2CZVC 1Y5LB 3SEOA 4TYBA 2VFVA 4DG1B 4ZJLA 4X4UA 3T6JA 1EX8A 1XBWA 1XMQJ 3CCQS 2HHTA 3B6BA 3DRYA 1Q79A 1R31A 4ECVA 2MZ1A 2ASLA 2F3JA 2W9BB 1S4FA 1L3SA 2YNGB 3GP9A 3PTWA 1MW7A 1YJUA 3HPOA 3IGNA 1YVFA 4DLEA 1RXOB 2RSQA 3JSMA 1RWWB 2HSEB 3W64A 2AIRB 4IG3B 4WYLA 1YGYA 3G6XA 1S48A 4URSA 2EWHA 2DNQA 3M1VA 1YBTA 2KT3A 3W63A 1YX2A 1G1XA 2AX1A 3GFZA 3AJ1A 1U7LA 1NPKA 5H9EK 1Y5NB 5M2UA 2FVSA 2V68A 3AT1B 1IKXB 1JLFA 1R8AA 2ZUAA 2GA7A 3WIVA 2I9SA 4O44B 1FKAF 3QPIA 3IP0A 2MHNA 2UXDJ 2AQ4A 4CIOA 3QNWB 4B9TA 1HNZJ 4E0DA 1FDDA 1FD8A 5IFMA 5C42B 1UCNA 5L46A 2J0SD 1N36J 2LCWA 1CULB 1VK8A 5B0CA 5KFCA 3C3LA 4LRAA 2HNZA 2V69A 4RNHA 4OYOA 4A8KA 3DU5A 4M5HA 2FC8A 1GMWA 1YBAA 4DV0J 1Z4UA 3AXKA 3W5YA 2VUGA 2COLA 3P96A 5B0AA 3RAXA 4JV5F 2HS0A 3H42A 5KFNA 4L74A 3CVKA 1UP1A 5DDQC 1MSWD 3QGGA 5ADZA 3PJ9A 5T7LA 4NLOA 5LJ3Y 5KT5A 5HBMB 1HYSA 2W2NP 5E3CA 4ES2A 1N0UA 1TL1A 4PR6A 2VFRA 5G4DA 4LR8A 1AT1B 4EO8A 3RR8A 2XMUA 4LRCA 2PE8A 5CYMA 1Q7LB 2EFOA 3K8WA 2XSJA 4U7CA 3MECB 1SBRA 4KHPF 3WX8A 5CYQA 4DSFA 3KOAA 4CLYA 5D78A 1DQ9A 1KN6A 3D28A 4DSKA 3TZZA 3TVYA 4B3MJ 2X3DA 4RUCA 3PCOB 4HH0A 4NE9C 3TAMA 5D4NA 4LR9A 4OX8A 3T1AA 4DR6J 4L75A 1WC6A 2HURA 2NXUA 3O8WA 4J9OA 4Q8FA 1U2FA 1DRZA 4L76A 2XZWA 5E3AA 3I87A 3GE9A 2Z56B 1KTVA 2HS4A 3FSYA 2RB7A 4DV4F 4X64F 4J9PA 4N5SA 2WVFA 2JEFA 2XYPB 1WHYA 2DVIA 3A8JA 3H20A 4DEZA 1S9GB 2J7WA 4Y2AA 3T6BA 3W2VB 2EKNA 2XMTA 5LMNF 2D3UA 2R2UA 3FCHA 3H59A 4ECQA 3VV2B 2DRDA 3Q8YA 4F67A 2QV6A 3GWCA 1C1BA 5IXUA 1VRUA 2G4BA 4XDDA 2MHEA 1PGZA 5KFBA 2FJEB 1REVA 2C3MA 1M5KC 2QYGA 3Q8QB 3EXCX 1FDNA 4ER8A 3FRZA 4IR1A 1FFWB 3NGKA 3LUYA 4J9VA 2ZOMA 3T1YJ 1UEVA 3DMJA 2V2ZA 7AT1B 4IFVB 2KXHA 4GKKJ 1NK7A 2GJFA 1JJ4A 2FJXA 3BM7A 1GAOA 2ZH2A 2CUYA 3PKYA 2ZZMA 1MMLA 5AE2A 3GIRA 2I6WA 1ZOTA 2JVOA 3NOCA 3I0RA 2HZCA 2IM3A 3NY0A 3ISNC 1TV6A 2BW7A 2ZH8A 3QQCD 5IC6B 4R5PB 2DRBA 5BXIA 3BBCA 3DLGA 1ROFA 1YKWA 2Y0SD 3BGOP 3RBEA 2V9KA 2MQLA 1X5SA 2VFSA 4LR7A 1O51A 2AT1B 3R6GB 3NAHA 2VF3A 2YX7A 3LO3A 2K2PA 1TKTA 2CZ4A 4JI3F 3WQPA 4WYWA 1FTCA 3HKZD 1SIWB 2J6UA 1VQ9S 1NSKL 2HS3A 4N7TA 1GTHA 2P6TA 2VL1A 4OX7A 3G4SS 4Q8EA 2HFSA 2W2OP 3BDEA 4LJMA 3FCWA 4LREA 4H54A 2F4VF 4PWDA 2RRBA 1RI7A 4RJVA 3EJMA 2CPFA 3W5ZA 2RILA 3EWGA 5M2PA 3P3DA 4A47A 1FXLA 3H7HB 3KK2B 2DRAA 2DO0A 2QE5A 2HLTA 4ITSA 2B9EA 1F0XA 4DX6A 3C6TB 1S6PA 3VGVA 5HP1A 3D4JA 3W9JA 2EK6A 4DL6A 4JI2F 2MKIA 2P6SA 1DARA 3FBCA 1RAGB 3L09A 3IAS9 2MLYA 2ZKTA 3FSXA 3QFHA 3HSGA 3N5FA 3GV7B 4DR7F 5ETTA 2RF2B 3CDUA 3UCZP 3NKYA 3TUIC 1RTIB 5LM7E 3D67A 2DH8A 2LA4A 2E7XA 4FYYB 4NI2A 2XGPA 5KFIA 4DPWA 1NK0A 2YNFA 1LNQA 4WFYA 4G1QB 1R0BG 4Q0BA 3CJSA 6FDRA 4TY8B 5H9EJ 3MURP 2ZNYA 5RUBA 4CH7A 1CBKA 5FLXY 1M5OC 5J1EB 1D0EA 2DH9A 1FKPA 4M5NA 1BWEA 4JI1F 1JQGA 2QO3A 4HLBA 1ZAWA 2Y1LB 4QYZK 5K8PA 3IR6B 1WSVA 3HP6A 1IJEB 5IM0A 2BJ7A 1BQNB 4DUZJ 3QT6A 5HROA 4USWA 1PBAA 1CPZA 2XBPA 2MGZB 1FX2A 1LEOA 1S6OA 3UDCA 4ZN3A 4F0KA 4URGA 1H38A 3O6QA 3VWSA 3DYAA 5J2NB 2MY8A 4FYDA 3M9NB 2HHWA 4RW4A 1TZ0A 3HD2A 3U02A 2CRLA 2RQ4A 3BGLA 1CLFA 4XO0A 2BOPA 3MM9B 1IBLJ 1M1GA 2H65B 1WG5A 1X5TA 1SJQA 1IUJA 1PCAA 3BREA 1NKEA 4FN5A 2IVMA 1GTEA 1Y3KA 1JXLA 4PXCA 1VDHA 2LXIA 4QIVA 3M6VA 2QLXA 3QT5A 1YJ9S 4I0WA 1RT5B 1SC3B 1CC8A 2HK2A 3M8YA 2XS7A 4DV6F 1SVDA 1TK0A 1DURA 2MY7A 2R7RA 2AYMA 4JI6F 2GIRA 4JI0J 3MD3A 4TU8A 1RT4A 1XJWB 1RISA 4L3KA 3GTYX 2MKYA 4FXDA 2OTLS 4A8FA 1W25A 3LGMA 1RT6A 3E01A 5KG5A 1KC8T 2WOMB 3DXSX 1HMVB 3NRBA 2RDIA 4YFUA 2XGQA 1S12A 1OMSA 1DAXA 4FF3A 4ZIWA 3U7JA 4H4OB 2CJ9A 4MKAA 4CDIA 2QYCA 1N5TA 2E29A 4H4KC 4ZVEA 2GIFA 2IYIA 3DDNA 2XO6A 1RAFB 2DNGA 4N76A 1M5SA 2ATLA 2BRKA 1H6KX 4HH1A 3GIKA 1FHTA 1ZTWA 3MM8B 2FQQB 1P27B 5D0EA 3QJJA 1EARA 5MLCV 4IFYA 4RX6A 2GVDA 4OI6A 4RU2A 2GGPB 1U24A 4LF5F 1HWKA 3W62A 2VA2A 4ILMA 1VLYA 5FD1A 3M8SA 3MMCB 3PW5A 1IKYB 2V9WA 2OD4A 2RS2A 2J9DE 1Q8KA 4CLLA 2M4MA 4RWXA 4XIUA 4HACA 4ZPVR 5KG7A 1EKSA 2HQGA 3RW7A 1VQYA 4LRFA 2NS1B 3OT9A 2B3TB 5J2MB 1R0AA 2E7WA 1YZ6A 1QAXA 1SQFA 2NXEA 3Q89A 1A6LA 3CW2C 2AHOB 2WONB 3GQCA 4DG1A 1MLAA 3R5GA 3W2WB 4M1KA 2EFVA 1T03B 2QN6B 1H2UX 2V8HA 4QZVB 3H40A 3C16A 2LQJA 3UN2A 4P2MA 3GR1A 2GAHC 1ZH5A 4NLDA 3KTQA 3HMJG 5KG6A 5A6PA 2OD6A 2XY5A 3KG4A 4F7VA 3KYLA 2JLEA 2QT7A 2X3GA 2G2YA 2D3O1 3DOLA 3KWMA 4F3QA 2RQCA 1S1WB 1OY6A 2YH0A 3DCAA 3PV8A 3AJDA 3I5AA 4NMLA 1XERA 4DXLA 4IG3A 2DR5A 2X1AA 3HZGA 4KT0C 2VASA 3TEHB 1KLNA 4OYPA 4ZVQB 4DX8H 4XDCA 4PWWA 1HPZB 4YB5A 2HNYB 2MTLA 1WKKA 3VCDA 1TTHB 5AJ3J 4I67A 2VB6A 2XHCA 2XNQA 3W9IA 1H2VZ 4G6VB 1IKXA 2H4YB 5BJRA 3BS9A 1X60A 1Q0NA 3I31A 4O3OA 1IVZA 4ID5A 4O44A 3PRVA 3EYZA 1YDLA 1GNKA 5K8NA 2KM8C 2XMWA 5J2PB 4ZPWR 5C42A 2CQCA 4RNNA 4NXMF 3FCVA 3PJXA 4K59A 5DS7A 1CULA 1N5YA 4A8QA 1CQMA 3P5BP 3VGSA 1HHTP 1NKCA 1BQMA 3KLIA 1UKUA 3ZO7A 2HHPA 2XCPA 5IOLA 3CGIA 2VQFJ 4DR3J 1IWGA 1TL4A 3UPFA 1DTQB 2ZEJA 4UZCA 1TKZB 1PG5B 1RSCA 3BQ0A 3R5JB 4A8WA 4G1PA 5HBMA 3BR9A 1U1RA 4QYZJ 2V2KA 4UOFA 1PSDA 1WG4A 2PD1A 3JYTB 1RK8A 3EX7B 5MAOA 1C0TB 2UU9F 4IRDA 3MECA 2IFXA 5F0UA 1PKUA 1Q86T 2CZ9A 1NK5A 4KO0B 4KKOA 4WU3A 3I9ZA 4OYAA 3GV8B 2VONA 2R2RA 3Q8UA 3DLKA 2OAUA 4RR5A 3R2CJ 2A6MA 1LW0A 2DNRA 2KFYA 4BLGA 4R0EA 4Q2LA 2EPIA 4ZP9A 3B82A 4Y2IA 4IOBA 1VQ6S 5SUHA 1XMBA 1LK5A 3IN5A 3TVZA 3HHDA 1L5UA 4NWBA 4BC7A 4A8MP 3DLEA 1RTDB 3CUNA 4FS1A 3LGHA 1N33J 1YITS 3HCXA 5F8GA 2G0IA 4BWJA 2MQNA 2QSFA 2ZZTA 4CYUB 3EM1A 2BDPA 1RAAB 2UVVA 1RBOB 4G1IA 3A8EA 1FE0A 4FVMA 1OJ4A 3B78A 4Z7YA 1VYAA 4NASA 4DL0C 1VJQA 2AZ1A 1HW8A 5D3GA 4TXSA 3IBCB 5BYQA 1X7VA 2E5HA 4N56A 1JLBA 1IJFB 3W7BA 1WEXA 2O5DA 4EEYA 2L41A 1S9FA 4O3QA 4F02A 1DFDA 4LF7J 3SFUA 3DHWC 4DQSA 4LF9F 4ZLLA 3RAQA 2YKQA 4KFBA 4HDHA 2OPSB 4ZHRB 2DR7A 2DY9A 1S6QB 4CLWA 1AW0A 1GX6A 1T9XA 2YKAA 3TA2A 4OX9J 2CJXB 3B4MA 4ZA1A 2BM1A 2K06A 5CZXA 4JI8F 4C3LA 4ZS6A 2DHSA 3ZNJ1 2HHHF 7FDRA 3CEDA 5IT9U 1RTZA 3BZQA 5HVHA 4BC9A 2RUGA 5IQ6A 2D74B 5A0YB 4DCPB 3OHAA 1LK7A 5DO2A 3R27A 2FVQA 4LF8F 1VLOA 3SSRA 5ETKA 3QYYA 2QL5B 4F4KA 1NLKL 5GAHU 3BGRB 3KNGA 1RLCL 4ZP6A 3F0NA 2HNDB 4P10A 4R5PA 2C2NA 3W8GA 2B9XA 2W1BA 4IO9Q 1IWAA 3Q23A 1BC6A 2J8AA 2E1CA 2UUBJ 5G0RA 3IG1B 2EFGA 4CCHA 3UN5A 1T9TA 3HSJA 4ZKAA 1UWBB 5LSOA 3FBEA 1P1TA 4BS2A 3NWGA 3N4WA 4O4GB 2J9DA 5FJ4A 4ZPDA 1S1VB 4JI5J 1HIYA 3G86A 3CPWR 3D5MA 3BQ2A 1HWUA 3LH2S 2NQPA 5EDWA 3JB9k 2BYCA 4Z2XA 2MLXA 1U25A 1QSYA 4MH8A 1IM6A 2HAIA 1UVLA 1N32J 4S0MA 2ZKUA 1IR0A 3M8WA 2B4PA 1VQ5S 3T9ZA 2DNYA 1KEKA 4ALZA 2NYIA 1HI1A 4F0MA 5KFAA 2V8PA 5HAOA 2DGSA 3V6KA 4P7VA 2IM2A 4CTAB 1HBUB 1HNXJ 2XS5A 1VC6A 4IH7A 3ENQA 1R6VA 3CO0P 2HGLA 1N8RT 2N7CA 2KRRA 4DPTA 4DV7F 1ZBTA 2G1DA 4WIQA 3OBIA 5KFMA 2OPRB 3ZFVA 3BH7B 1RTHB 3H98A 3ZZUA 5LMUF 2W25A 4PG4A 4OYIA 3HHNB 5F41A 3DU6A 1NDPA 3V81A 1T8EA 3R5CA 1IQTA 4IKAA 2AJ0A 3M6UA 2RF2A 2UVRA 2OTJS 4ELTA 3J81U 1NK4A 3N6LA 2ZVIA 3AA8A 1HW9A 3CJ5A 4JB8B 4O3PA 2V8DA 3OV7A 1W26A 2DD8S 4BWMA 1FRHA 4W90B 1C4AA 2VV5A 1HA1A 2BMBA 1RT3B 1V5VA 3GCWP 4OQJA 4TY9A 1CJKB 5DETA 3P5TL 2KH9A 4HVZA 3OJUA 3IWNC 5J1EA 1S0MA 4HR2A 2ROGA 5JVGQ 2ZM6J 3CDAA 2B51A 3OQ2A 3S6EA 1B70B 4L72B 4ZVPB 2FYXA 3FGVA 1O5JA 2Y1JA 4ZVRB 4P71A 5D8HB 2R42A 1XMOF 4NLSA 3I56S 3EDQB 1VQLS 2HAFA 4LVOP 5KT6A 3NL0A 3WHIA 5EGYA 4I2PB 2EKYA 4WFNQ 2HQDA 4J5OA 4KIAA 1AB8A 4WP3A 2AYGA 5F3ZA 5A2QU 4U9RA 2DGTA 4DSEA 4B3OA 4L6V3 3OVAA 2KXFA 1FNMA 4ANCA 5HJYA 2UUCJ 4YDXA 4NLYA 4C11B 5CD4H 1QLNA 3FMWA 4X4VA 3FNNA 4QWEA 5B0FA 5B0DA 2R7WA 4NPOA 1SKUB 2BA9A 3MM9A 4QYRA 3ICLA 3TEGA 1X31C 2GHVC 4CO5A 5L9XA 5B09A 3WIUA 1M1HA 6AT1B 1NPRA 4QWCA 2M9KA 3D6FB 1WF1A 3HFZB 1H74A 3AOCA 3VQTA 3EE3A 4WJBA 2MMYA 3SSSA 3NAIA 3TA0A 3CCVS 4QW8A 2C2RA 1HNIA 4F4AA 1Q82T 2YKMA 2LKZA 3DDIA 1HKAA 1MN9A 1T94A 1JLEB 1RHKB 4U8YA 3BBFA 1HFEL 4LFAF 1BMQB 1IQZA 3VF0B 1RTJB 2MKSA 4OZ0A 2LMIA 1LKZA 3KDNA 2VG5B 1R27B 4I6AA 4DR2F 2WOMA 3VGTA 1HMVA 3DM2B 4DCJB 1JNRB 2R7QA 1Q7YT 3WC0A 1GXLA 4H4KA 2Z0GA 1J2VA 4PYAA 2WVBA 1HNVB 1HR0J 2X1BA 4H4OA 4J9RA 3RZAA 1T9VA 4ZIVA 2V8GA 2R7UA 4RZRA 2X1FA 2QX0A 2AJ4A 4MK9A 1B3TA 3D7SB 3PG9A 4HT7A 4YMEA 2BJ9A 2CJAA 4DL3A 2ZD1B 4ID8A 1U0SA 1AUDA 2DGQA 2HZAA 2R2TA 5F8MA 1EHWA 2DXEA 1FDAA 3TO8A 3IR7B 2J5AA 3W65A 2OEKA 2H3EB 4RNFA 4TN2A 3VR1A 4WKYA 4ANDA 1A9NB 4ZCLA 1FA0A 1WHXA 5BYSA 2P9EA 3MM8A 3PRDA 5HMWA 3CMAS 5C25A 3ZNUA 2GGPA 4YY3J 1F9EB 3GZ7A 2U1AA 2RU9A 1FKOB 4DN9A 1G2EA 1T05A 1RJJA 4X62J 3NEKA 3GIMA 3T19A 3RRHA 2EI5A 3HK2A 3KLHB 2Z57B 3RJMB 1VRTB 1K0VA 2MKKA 3KLFB 2ABYA 3N6NA 3SMZA 2R7OA 4QIFA 3H5YA 3BH6B 3HXMA 4DU8A 4EGLA 3P45B 4NLGA 2XHWA 4IQMA 5J1PA 1H7XA 2Q43A 5KFEA 3CC4S 3QMQA 1UJ6A 2MPUA 5J2MA 1XMQF 2ZOGA 1XEZA 4F36A 4PG8A 3HKWA 2AEFA 3KJVB 1OQ6A 3Q8RB 2QEXS 3BO3A 5C2CA 1IKVB 2OFHX 4C8YA 3W2WA 3I32A 1T03A 3VZIA 3OSNA 2CPIA 2CPHA 3LALA 3H4BA 1IBKJ 2YQ0A 4TLQA 2B8PA 5KFWA 3IAM9 1C4CA 4UY8T 2XNRA 3H90A 4UUXA 5HVFA 1TL7A 5K5MA 4UY85 4ZOSA 1QJHA 3DHXA 5E5NA 2DR8A 2A10A 1QD1A 1SJ3P 2KFNA 3HSZA 3V6DB 1S99A 4LF4F 2HG4A 1KP6A 1RA6A 2AMCB 4YB6A 4PG5A 2UVWA 3V4IB 2OSQA 3W61A 4PCQA 2MSTA 2JLGA 2HNYA 1RKIA 4YR3A 1HHSA 2FVRA 2LFVA 2GFFA 3HLUA 1SC6A 3R5DA 2YWEA 3M2RA 1KS2A 5LL6d 2QRRA 2YNIB 3M2VA 2D69A 2Z2ZA 3CD0A 1X9WA 4DV0F 3AD9C 4R25A 2OEMA 2QLWA 1IN0A 3RG6A 3E51A 1YIJS 1JMTA 2YPYA 5D4LA 2ACMA 4Y6IA 2W4PA 3CJKB 3MR7A 3VAIA 2AJQA 1S59A 4UZBA 1DTQA 2WRMA 1TKZA 4ZITA 1G6BA 5D0GA 4OI0A 4H4MB 1BLUA 3JS9A 1FX4A 4USJC 2PC6A 2YVSA 3JYTA 2YKNB 2CQ1A 2DTJA 3BKUA 3I55S 1C0TA 1Y4ZB 3HJFA 1F6TA 2GQ2A 1OIAA 3CJ4A 1XK8A 3PDNA 5GVQA 4CO1A 1U8SA 1NJIT 3QSYB 4KO0A 2PT0A 2ZUGA 1Q78A 4UOGA 1Y3JA 3LPYA 3MEDB 3A3NB 3K7RA 3GYGA 3U1NA 4A4JA 4PXEA 4I6YA 2VIHA 2YPZA 1O6XA 3FDSA 2HRYA 4JV1A 2AF6A 3HFVA 1KRPA 1S49A 1Z1ZA 1RLDA 4ED1A 3GJSB 3SCKE 3CMES 4QOTA 3MEGA 3DGVA 1LXJA 2KKHA 1SQGA 2M8HA 4WPAA 4DU7A 1YK9A 5THWA 2E9RX 1VQPS 1X4GA 2V67A 4CYUA 5IT4A 4AUKA 1U0HB 4M5IA 3PKMA 3WX4A 3UCUP 1WD6A 2AYEA 1UW4A 4B3TF 3MTKA 2ROPA 2V63A 5LSLA 3T5HA 5A8KA 4ZLNA 4GC7A 1Y5IB 2RQKA 1B99A 3WC2A 2WB1D 1OYDA 4AD6A 3NCPA 3BSNA 2KZMA 3T9NA 1CQNA 2C3YA 3D6HB 3N0VA 4FF2A 3D6TB 3CJQA 3W60A 2G1HA 2LP4A 3PR4A 2IMOA 3OHBA 2I1RA 5LOQA 1KVJA 4NRTA 3PFOA 3ITHB 3TJAA 2G2ZA 1FO1A 1RZMA 2R7SA 4RKUC 1H3DA 3J7AN 1HWJA 4AXJA 1U1OA 1QAYA 5ETVA 3JQMA 4KGKA 1ZAVA 3M8PB 3MZIA 5D0RA 1HBMB 3EGWB 2EVZA 2VKRA 4K4XA 1KLMB 2W9CB 2DR6A 3M9MB 5DQGA 3K5OA 1B0VA 3NG8A 2FJDB 1KQGB 4DQQA 2P8IA 3GSDA 3PO5A 3W66A 1K44A 1PC4A 1FK9B 4FDFA 4NLQA 2ZH9A 2LU2A 1Q4RA 3CIZA 4KB7A 4PQUB 3AXMA 1KR4A 4ED0A 4F4WA 3PIPQ 3KMSA 5ETRA 1C1CB 4RBUA 4DUYF 2KHCA 4ZLJA 3DRSB 3CIMA 4EYHB 3AA9A 2HNDA 2QFIA 2KO1A 3G82B 1JJ2R 2ZE2B 5KOWA 4DL4A 3HT3A 3KLGA 2E1RA 3AOAA 4YHHF 3CO9A 1SUQB 1J5EF 1UJ5A 3G6YA 1PJ7A 5HK4A 2I8EA 3D6MB 1UWBA 2B4UA 2B43A 2G0JA 1EP4A 3HVRA 1K0TA 2WVEA 3M32B 3OR2A 1YWXA 1HBOA 1RHJB 4ZJOA 4YDDB 1X9MA 4I6WA 1N52B 4OIXA 2RUSA 3PYFA 3F56A 2C2ZB 1FE4A 1NHKL 3TNVA 5F3TA 4UOCA 1Q5YA 3BGFA 4ECTA 3D1QA 3TR5A 3GIJA 4KHPJ 1CJVB 3A3PB 4CT9A 2R8JA 2CVIA 3HD1A 3EPGA 2ASDA 3AFGA 2HRTA 1SL0A 1JK9B 1QAJA 4NLPA 1HHQA 3NLCA 2V4JB 3QGHA 1FJ7A 4HTJA 5GAEI 4CTAA 1HBUA 5DDRC 1B7FA 4UT4A 2RD5C 4NLRA 4BDPA 2CDQA 4OV6A 3GFXA 3M8ZA 4GKJJ 2XSFA 1R8HA 1UPMB 3UWTA 2OPRA 3OFGA 1S72S 1YSJA 1RTHA 4IOCQ 1A0OB 3GJQB 3MR6A 4M63A 3DRPB 3PR5B 2GX8A 1U6FA 1PJ5A 2DB1A 1S1UB 4HT5A 5AXNA 1LWXA 2QLJB 1VQ4S 1LWCB 4I7FB 4GRSA 3THTA 3HM9A 3TZXA 1KHVA 3CF5Q 1EQ0A 4X64J 2RT3A 4O0IA 2L3MA 5BR8J 3GG0A 2V5HG 4MMOA 4R8UB 3OFEA 4X4SA 1RT3A 2BABA 4OZ5A 4WP8A 3HFKA 3OTEA 1E6YA 3CD7A 5LMNJ 1TL5A 3MUVP 1XNQF 2H5JB 3HT0A 2I2YA 3K0JA 1P6TA 3ENVA 1UVIA 3DRRB 3OTBA 4FNHA 1NHUA 2QA1A 1BE4A 1SCJB 1JB0C 4QPTA 9RUBA 3MHYA 4RUHA 4A48A 4KTQA 2DBBA 4I2PA 2O1PA 2E5IA 4DPUA 3A8KA 1FESA 4WU2A 3BO2A 1T7PA 4B3RF 3IA0A 1ZA1B 4XPCA 5KG2A 1NBEB 3KHGA 1SJ1A 1ULRA 5KFXA 2ZH6A 3C2PA 2ZH5A 4MIBA 2HYIB 3ISZA 3JQKA 4PUOB 4TYAA 5HSPA 3D1OA 1UETA 4LBPA 5D15A 2KT2A 5A6WA 2ZHAA 1IBMF 2PGCA 4LBIA 4E98A 4X4PA 1KSPA 3PXGa 3U1MA 1JIHA 1VBXA 3MGJA 2VPYB 4AYBD 2JFKA 2FDNA 3NGDA 2CNOB 3BDPA 3BR8A 2ATCB 4EI2A 2Q66A 1VOMA 5KFGA 3BSOA 4I4BA 3RB3A 3ZTPA 4O3RA 3QWUA 2OPPA 4NRUA 1JLAB 3NWRA 3FC9A 1I94F 4LSLB 2V34A 4DQRA 1I51B 5KFRA 5E2QA 4QIEA 4RUAA 4C3KA 3GSIA 2VPWB 1N6QB 3R8YA 1PBUA 4N41A 1RTJA 2AV5A 3NS6A 1UZDA 2XM3A 3PIOQ 1F9FA 4DPXA 2VG5A 1U4BA 3HULA 3DM2A 2BV3A 5F0WA 1F5CA 3I9V9 3IRWP 2IAJA 1N0VC 1YHQS 4C97A 2JSXA 1RUSA 4CRJA 4DMZA 4Z7CA 3NP5A 3RAMA 5EWEA 4JI2J 4RW9B 5D77A 4NA1A 5B0EA 2FVCA 4X4RA 4N8OA 2CWKA 5E0OA 1VQNS 4Q43A 3BJYA 4W4MA 2G13A 1DJ0A 1UJ4A 1RAOA 3HHEA 4NX9A 3CDWA 3I0SB 4RW7A 3T1HF 3O1LA 4OZ3A 2H51B 3IXQA 1U1LA 1VQ8S 1OSDA 1SI9A 1NRKA 2CPYA 1S1TB 2BE2A 2F1FA 1QY7A 2HKEA 1KVIA 2CFXA 3KK1B 1LV5A 1FEHA 3KLHA 1NH8A 3LANA 1VRTA 2EC0A 3MM7B 4JI1J 1X0PA 2QTWA 4ED2A 2APOA 4AFFA 4DR4F 1LWEB 1A7GE 4A8SA 2KU7A 4ZVUB 4NL5A 4MK7A 2FC9A 3VVTA 2HIYA 2HQIA 4IDKB 5KFYA 2BKPA 1PJ6A 3QAUA 1YRTA 2M3DA 2XY7A 4X4NA 2WK4A 2E5LF 5D0HA 4X2BA 2CNKB 4KPCA 1TKXA 1IKVA 3R7BB 4QJVA 1UVJA 3L7UA 4CLFA 1UFWA 2HQCA 4NYPA 4LF6F 2ZBPA 4J90A 5AT1B 3MUTP 5B0GA 1CJTB 2PMZD 2RKIA 4EZ9A 3MM6B 1T11A 4DX7A 1K47A 2QLFB 1UL3A 2XI3A 1VQSA 3KK3B 3JQJA 4Q45A 4F3OA 2KJWA 3MMBB 4KGMA 3LPEA 4V19J 3BB5A 4LUBA 2NLWA 4QIGA 4ZVTB 1KBRA 4P7TA 2CJBA 3BKFA 1XNRF 3V6DA 2ADBA 3R5BA 5AJ3F 4CNZA 2XB2D 3NMAA 2UXCF 2VBYA 1VC0A 4D3HA 3PVXA 3V4IA 4FBUA 4DV6J 5HQMA 5JXSA 1VQOS 3MUMP 4ELUA 4JI6J 1NK6A 2HVIA 1Q8BA 4WFXA 2ZH3A 3VVUA 1RWKB 3BF4A 3O5TB 5DLGA 3VZHA 4DF4A 3VHQA 4K0KJ 4M8LA 1WKLA 1F5AA 4USHA 1OYEA 2M88A 1U02A 4URQU 4QBUA 3TW0A 3HVTA 3BN4A 1KDNA 3UCGA 4CM2A 4ELVA 3Q83A 4J7CA 2VQFF 5FDLB 2DNZA 1ZAXA 4OYWA 4MYTA 1MMNA 4EUVA 2HPUA 3H5UA 1J5OB 3FBFA 2BACA 3D2WA 2XG8A 3MFHA 1NB7A 4B9MA 4KV8B 1BWVA 4WXOA 2QFJA 2RMLA 4USUA 3X3UA 1HBNB 1H7WA 3QO9A 1WF2A 3PX4A 4H4MA 4K7QA 3IWXA 2WZ1A 2IVFB 3NBPA 1FFSB 4DOZA 2PSZA 4KY3A 5E3PA 4F0HA 2RIJA 2OO4A 4M5DB 4X65J 3VAMA 2XMJA 3TJ8A 1PC5A 5IWAF 3M8QB 3PACA 3PFEA 2EK1A 3MCNA 5ETSA 4A8OA 1WOOA 3CJ8A 2A6OA 3KLEA 3AB4B 2R8HA 3MEDA 2W4CA 2ILZA 3OVSA 2V4QA 1Q8IA 2QL7B 1V3ZA 2M2BA 2VG7A 3POTB 4NOHA 4DV1F 1N33F 5KT7A 1T3NA 2GS8A 1MWZA 3MWBA 1RBLA 4M5MA 1PAUB 5A8WB 2C1EB 4NYOA 4F26A 4ILRA 3FEXB 3UVJB 3FK4A 1AYEA 2CIMA 4PG6A 1S57A 1VFJA 5FLXU 3G71S 2ZBCA 4FYXB 1R8BA 4C8KA 3K5MA 3ADAC 2WTFA 2H48B 5GADU 2ZJPQ 1FFGB 4LT6A 2RDDA 3NGRA 3CCES 2FHJD 1RHMB 3EPIA 1DTTA 4RPFA 2QJ3A 2M52A 3H5SA 1S76D 1NCLA 2PA3A 2BEFA 2IC3B 4M5GA 1ZM4A 4FPIA 3D1HA 2VZ9A 2YH1A 4I69A 3G8SA 2J9CA 3JSMB 4C8MA 2DISA 4YB1P 2G2OA 2VFUA 5KFHA 2QIFA 1FJGF 2BJ1A 3ITHA 2QSWA 3UQSA 2IBOA 1QM9A 4LQ3A 5GMDA 3CE8A 2P9GA 2GJIA 4K4WA 2MZJA 2E9TA 2J0QD 2CG8A 3PM9A 3V4MA 2E5JA 2LXUA 1Q95G 2HHXA 2CADA 3M1VB 2LQBA 2KN4A 3CCZA 3G96A 4LSNA 1YJTA 3PHEA 3M8PA 3L7PA 1NXIA 4RW8A 1PYTA 2XYHB 1KLMA 2MZQA 2W9CA 4OL8A 3WBZA 1LQ9A 1LWFA 3GJTB 4OZ2A 3ETMA 2M70A 1CVJA 1RHRB 5K14B 2ZVSA 2R7TA 1FK9A 1DQ8A 1WTFA 2CQHA 4NLUA 4JYAJ 4B9NA 2OEJA 4OHYA 4PQUA 2B0GA 2H54B 1W2IA 2HNZB 1KD1T 4I2QB 3ISND 1C1CA 3DRSA 3GFYA 4TQRA 4QR0A 1UVKA 2Q1LA 3G82A 4PPDA 2IDLA 2ZE2A 3HVAA 1SJ4P 1F1BB 5KFOA 2LEBA 3B8HA 4X66F 5B0BA 5T7LB 1SUQA 1D3WA 1R0CB 1TL1B 3UDEA 2Q3PA 5HMZA 2B5JB 2AGPA 2EBGA 2KB2A 2MZSA 2GMHA 2CJKA 3IMQJ 2XSJB 3D66A 4GVBB 5E3RA 5CYQB 3ET6B 4QR2A 3NMRA 1VRQC 2LEPA 4AL7A 3MAAA 3ZTRA 1L3KA 3HI9A 4HKQA 4C0HA 2UU9J 4CLKA 2F8EX 5J2QB 3JAMY 4B08A 4F8RA 1CJVA 3RYLA 2AD9A 3L7OA 1AFJA 2YBVA 3TAMB 5HMXA 2EW9A 3VTIA 3IS9B 2V4JA 3EUNA 1QTNB 2FUG9 1UWAA 3FVYA 5KFTA 5KT3A 1TUGB 1RT1B 5DGAA 4O23A 4F4YA 2CQBA 1JKHB 1BQXA 1M5PC 2KYXA 4WBFA 2KG1A 1EQMA 2HQ3A 4C8OA 3FKBA 3GONA 3OXLA 3BPDA 3SDEA 3OW2R 1S77D 1J27A 5DG8A 3Q22A 4BHQA 2E44A 1S1UA 3T3FA 4Y3CA 1WC1A 4B17A 5JMNA 3D9BA 4DR5F 4C9DA 4FYVB 4QWDA 4EYIB 1QVFR 3QT8A 1WACA 4R8UA 2K8GA 2HFUA 3OXGA 1NMEB 4DUTA 5AXMA 1VRUB 2ZM6F 3DXBA 2PIIA 5HLFB 3LOUA 2W4DA 2BW2A 3UD4P 3KLVA 1D9AA 1NDCA 2FIUA 1BHNA 1NSAA 1FRIA 1AROP 1SL1A 4C4WA 1P8GA 3VAFA 1GQEA 3DMJB 5KFZA 1QE1B 2MDAA 4JI8J 3KJNB 1AXQA 2FPHX 3J7ZT 3ELHA 3IFEA 2HHHJ 4Y2CA 1ZETA 1L3VA 2D41A 3J7Z5 3DGPA 1TVRB 2OI2A 2FGOA 2KHDA 4LFCF 2UUCF 4OHZA 4GVLA 3I0RB 1WI6A 4QW9A 4WE1A 4MAKA 3C6UB 2YWFA 4DBQA 3P4UB 2MEWA 3SCIE 2IRXA 4LF8J 3MM5B 3BO4A 2Y8WA 4IRCA 4IO1A 4DSIA 3DLGB 2CQIA 2ZH7A 1NJYA 5C24A 2F9DA 4DV2F 2YWKA 2IMWP 3OL7A 1TUVA 4MFBA 2W9AA 3LQVA 1TKTB 1UEKA 2UZAA 1Z2ZA 5H1SV 2L9DA 4P9SA 2OHDA 3UDVA 2FTRA 4UQTA 1KTQA 2PMHA 4P52A 2U2FA 3PYDA 4OHXA 1JLQB 2EG2A 2HMIB 1LXNA 1RU2A 4UF4A 2DCLA 4KQZA 1EETB 4OFZA 1ZA2B 2CXEA 2BBEA 5DQIA 2ZITA 2CQ0A 2WBRA 1SL2A 4PWDB 3ULHA 3G6ES 4LSLA 1I5OB 1YG0A 3QRRA 4JV2A 4J9UE 1EB0A 2RU3A 2YX4A 1Y11A 2FZKB 3M05A 1K9MT 2F4FA 2BE7D 2YY3A 2AYBA 1WC5A 5HQLA 1EKRA 1SB6A 3FEZA 2F65A 1ZM9A 4JI7F 4JUZA 1S6PB 1CS4B 2BZ2A 1JJHA 3N5BA 2IVYA 3MEEB 4J9QA 1RWXB 2XYGB 3VAKA 2DNNA 4KGZB 4KBIA 1LFPA 2B4OA 4IQXA 4AT1B 1T9YA 1QUVA 3T5JA 3FUYA 2PI5A 5LMUJ 4HEA9 4RW9A 3TQEA 4RUBA 1TL3B 3FFIB 4WF9Q 4KAIA 4PAAA 4QWBA 5JVHQ 5I42A 1RHUB 3GFHA 3ENAA 4LSZB 2GC8A 2OUGA 3I0SA 4JBCA 3CTRA 3DOMB 1N56A 1FKPB 3O44A 2K3KA 1HI0P 1WI8A 2AJFE 2H5IB 3KJQB 2LQ5A 3SSQA 4NEYA 1RT7A 1PYOB 1WORA 3MR2A 1M0SA 3OTOJ 3KK1A 4K4SA 2HVHA 1GMVA 1HNWF 4NZ7A 2BQUA 3AQOA 5IM0B 2X51A 4DCOB 3OR1A 4HDGA 3MM7A 5HROB 2HWHA 4RNOA 4B9VA 4I1TA 5C5JA 2IHR1 1WWHA 2BE9B 1TELA 3DYAB 3TOQA 4IDKA 2AZ3A 3SZ2A 9ATCB 4WCEQ 3Q2TC 2JHEA 4G65A 3TWZA 3SI8A 3O2IA 2DT9A 3HHLD 4KR0B 3MR3A 1HQ2A 5AXLA 4FYWB 2AGOA 2OKQA 1KWMA 2LYVA 2KG0A 1URRA 2GAGC 4M5KA 5DM7Q 1FCAA 4EMDA 4DFMA 3DLHA 4DFJA 1T0TV 3M4XA 4DJBA 2VHGA 2FLPA 3DKDA 2HBYB 3MMBA 5A8RB 2I5JB 1H72C 2B56A 1MROA 3E3XA 1NO8A 3AODA 2BQ3A 5CD4A 4EU0A 2HRUA 4LRDA 1MG7A 1D8ZA 3LP1B 2BANB 5KG0A 3BV8A 3GU0A 4WTYA 3J80Y 1N34F 4DR1J 2MKCA 1UVNA 3KDOA 2R2SA 2FHMA 1KNZA 1NZAA 8AT1B 4K50A 3MCSA 1M90T 2W9BA 3TX0A 2DGXA 5K8OA 2J8SA 2YNGA 3E01B 2YWWA 2CQ3A 1NEEA 4P73A 1UAWA 5E3QA 4TLRA 1OO0B 2ERRA 2GW8A 5FDLA 2VQEF 1O0PA 1X4BA 4F4ZA 4N8NA 4KPYA 2DYAA 2OMOA 3LP2B 1J5OA 3H2VE 3R7SB 3W9HA 2DEIA 1ZTTA 4OI2A 2D7SA 4KV8A 2VOPA 1S6UA 3CCUS 4YR2A 5DDOC 1HBNA 3OL8A 4CM0A 2WVCA 2L08A 1D1UA 4ZJQA 1NDLA 1V6HA 2GVZB 2FZGB 5L1IA 4IFYB 2Q6CA 2GVDB 2P9CA 4P2XA 2R8IA 3PX0A 1WG1A 2Z2LA 2ADCA 2H1YA 4M5DA 4C0BA 5GAGI 2W01A 1VHFA 4ZN1A 2MQOA 4O4RA 4ECSA 1YJRA 2A18A 1Y10A 2RHSB 2PEHA 5EWFA 4KC5A 2DITA 3G2XA 1RAIB 3NNCA 4OV1A 1K73T 4LQ9A 3G8TA 3S1TA 1X0FA 4DZ6A 4K4VA 2DHHA 2GQCA 3K58A 2ZWOA 3OFHA 1U8WA 3C14B 4WTOB 1KFDA 2Y9HA 1FVSA 4WXWA 2DR9A 5I3QA 4CO2A 1NSQA 4RBVA 2KFZA 3UVJA 1B64A 4WIIA 2BRLA 3OFFA 2O67A 2HQFA 4CLPA 1TR0A 4NLTA 3JTOA 3DC2A 3GR0A 5AE1A 1XR7A 2IRUA 2NSBA 2QZ8A 3C16B 4A8YA 3EVMA 4CLUA 1RBAA 5I3UB 1D8YA 3GCXP 4JP8A 4CT8A 2QA2A 4DV3F 4ECZA 2NZ4A 1S79A 3V5RA 4YEAA 3DOLB 2KXNB 4NXNJ 2IC3A 2DXDA 5EHHA 3CWJA 4ZPAA 4LFBJ 3M9OB 2BKOA 4KH0B 4WFZA 3MXHP 2RDJA 5ETOA 4UOHA 4OYXA 5SZTA 2ACYA 1R7IA 4FVCA 2L48A 2MQMA 1SC4B 3PJWA 4ZP8A 3EZ5A 2CPEA 1XWLA 3IRXB 4LF4J 2VBZA 1S9GA 2Y3YA 5KFUA 3FEYB 2KYZA 4YB7A 3W2VA 1F3FA 1EAYC 2AEJA 3L9ZA 2VJVA 4JV0A 4ID5B 4WP9A 2PA8D 1TUWA 5KT2A 2WW4A 2Q6BA 5K14A 2XCAA 1DZ5A 1HD0A 3W5XA 2ROEA 1R89A 3MMAB 1X4HA 4Y0FA 1N5YB 4OYZA 2A0FB 1BQMB 3KLIB 5DZ6A 4I2QA 1S0OA 3CXCR 3D3CJ 2RNEA 4DSJA 5DG7A 3BYRA 4OLOA 4EBCA 2HGMA 4DS5A 2WAQD 3ILJA 3K5NA 4AQYF 1TFYA 2XMKA 2IDEA 4IFVA 4ZVHA 2N4DA 2JEGA 4K4YA 4W92B 2B5JA 1RT2B 3LAMA 2QMWA 2VPXB 2UXBF 2VDHA 4GVBA 4KKOB
chains in the Genus database with same CATH topology
2QA1A 2ZJQQ 4OLPA 1JWWA 4N77A 4A8FA 1JB0C 1W25A 2NUUG 3LGMA 4QPTA 4ICLA 3MHYA 1FERA 2VH7A 4RUHA 4MYUA 1P9QC 1RT6A 1VQ7S 1S1XB 4A48A 1RWUA 3DLKB 2YWHA 4KTQA 3SFGA 3E01A 2DBBA 4Z37A 5KG5A 4I2PA 2O1PA 2WOMB 2E5IA 3DXSX 5J2QA 3O3LA 3UDLA 4YP3A 1HMVB 1VBYA 1LW0B 4OMFG 3NRBA 2MKHA 3ZZTA 3K57A 1FESA 1MMDA 2RDIA 4WU2A 4C8NA 3BO2A 1T7PA 4B3SF 4B3RF 4YFUA 3IA0A 2XGQA 5CQGA 4CI0B 5T14A 4WFAQ 4K4UA 4XPCA 5KG2A 4GKJF 1DAXA 1SJ1A 3KHGA 1ULRA 4FF3A 2RQMA 5KFXA 3IS9A 5GAEU 4LF7F 4CZCA 2ZH6A 4IR9A 3U7JA 3KFWX 4H4OB 3DI6A 3C2PA 2MQPA 2HW3A 2JWNA 3BN7A 2ZH5A 1C0UA 2ASJA 1VQKS 4MIBA 4ZPTR 5A2QY 2CJ9A 3DLEB 4CH1A 2HYIB 4MKAA 3ISZA 4WZQA 2QYCA 4PUOB 1N5TA 2E29A 3R3TA 5CH7B 3K59A 4H4KC 4ZVFA 2C28A 2VA3A 3EGZA 4TYAA 1X4FA 2JFDA 1YI2S 1RT1A 4ZVEA 4LVNP 3D1OA 2IYIA 2A2CA 2PI4A 3DDNA 3TA1A 1KFSA 1JKHA 2RVJA 4OHVA 2DNGA 4N76A 1M5SA 3KNAA 2DH7A 1UETA 2ATLA 4OZLA 4DDFA 2ZHOA 2KT2A 3R1HA 2BRKA 2ASYA 1K1SA 1LOUA 1H6KX 1VJWA 4HH1A 4OX9F 3GMGA 3HVTB 2VBWA 1T02A 5BR8F 3GIKA 5A6WA 2ZHAA 1IBMF 2VBXA 1FHTA 5D3GB 2PGCA 1X5PA 3KMQA 1WHVA 4DL5A 4E98A 1V3SA 2GCFA 1Z2LA 4X4PA 4QCLA 1ZTWA 3FJ2A 1KSPA 3PXGa 3U1MA 3HO1A 1JIHA 1Y0HA 1VBXA 4DHVA 3MM8B 4FXWA 1JLBB 5KTQA 2K1RB 3MGJA 2VPYB 5CHCB 4AYBD 1P27B 3QJJA 3MEKA 5MLCV 3J7A1 3FSIA 3MI7X 1WEYA 1QSSA 2EG1A 4IFYA 4RX6A 2JFKA 5HMYA 2V0NA 4OI6A 4RU2A 2FDNA 2ZC3A 3NGDA 2M8DB 1U1QA 3BDPA 2GGPB 1U24A 4TU7A 2O01C 3BR8A 4LF5F 2J0XA 2VC0A 3MR5A 1HWKA 4PXBA 2VA2A 4ILMA 2Q66A 1VOMA 3KK2A 2LDYA 5KFGA 4ZMMA 3GB0A 4RW6A 5HI7A 3RB0A 1VLYA 4KFBB 4ATNA 1M5VC 2O3DA 4DLGA 5FD1A 3BSOA 4I4BA 1HBMA 2RS8A 4ETXA 3N6MA 4J9KA 3PW7A 3M8SA 1QSLA 3MMCB 3PW5A 1JLFB 1IKYB 3RB3A 2V9WA 4O3RA 3QWUA 2OD4A 3QO9B 1WHWA 1R43A 2RS2A 2OPPA 1I6JA 2J9DE 4NRUA 3C6TA 5KFLA 1JLAB 2MJNA 3PO4A 3NBPB 1L3UA 3H25A 4ZK7M 5HLFA 3QJPA 1I94F 4LSLB 1FNOA 4DQRA 2M4MA 3CCJS 5KFRA 4RWXA 3WZ0A