2OPSB

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
435
structure length
409
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 108
structure length 409
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB02
2JEFA 3MR3A 5DQGA 3H5SA 4URGA 3H4DA 3Q8RB 1FKOA 4QPXA 2RF2B 4KKOB 4RW6A 2W9CA 3N6NA 5KFCA 3E01B 3QLHB 1MU2B 1BQNB 3MEGA 2W7OA 4DL2A 4JV0A 4R5PB 1DLOB 1SV5B 5L1LA 4MH8A 1HARA 1DTTA 4IG3A 3H5UA 3HKWA 2ZD1B 2CJQA 5KFIA 2YNFA 4NLUA 4J9NA 1IKVB 4KFBA 5J2PB 2V4QA 4ED2A 4XO0A 4K4VA 1C0TB 3DM2A 3GILA 4B3OB 5KFSA 3GIIA 2JC1A 2E9RX 4Q0BB 5J2QA 1S1XB 1EP4B 2OPQB 4DL3A 1W25A 2J6UA 5KFNA 1S0OA 2WHOA 3M8PA 5EWGA 3T1AA 1HYSB 5F8LA 5DG8A 5J2MB 4Q43A 1SH0A 2YNIA 2HMIB 4URSA 2WONB 4JV1A 3UDLA 2FVCA 3QIPA 3RAQA 1S9GB 2ASJA 4K4YA 1T03B 4I2PA 5KFAA 4NLRA 1S0MA 2YNGA 2W9BA 5KFOA 4GC6A 2FVQA 2V0NA 5KFKA 2HNYA 3OHAA 4RNOA 2ZKUA 4MK8A 3MECA 2ZE2B 3LP1A 3KLGB 2JEIA 4KO0A 2YKMB 3TAMB 5F9LA 3NMAA 1GX6A 2XI2A 2R8JA 2W7PA 1S6PA 5KFMA 1TVRA 3DRSB 3M8QA 4MFBA 4NCGA 3LP0A 4M94A 1K1SA 3SFUA 2EC0A 4IRCA 5DGBA 5FDLB 1FKOB 4FS1A 4RW6B 3DLKA 4RNFA 4G1QA 4NLXA 1RT4A 3MEGB 3QZ8A 4IG3B 1DTTB 2IAJA 3KK2A 5HP1B 1QAJA 4KFBB 3KK3B 2D3UA 1S4FA 4ED7A 2J6TA 4DEZA 3KLFA 2BRLA 5F8HA 5J2QB 3CDEA 5DQHA 4JV2A 1HQEA 3CWJA 4K4WA 1TKXB 4G3IA 3M8PB 3DLEA 4OL8A 4U7CA 4QWDA 3N6MA 1RTDA 3BQ1A 1QE1B 3GIJA 4LSNA 5KFWA 1RTJA 1FK9A 2I5JB 2B6AA 3QIPB 4ED3A 2BQRA 1RTHA 1C2PA 4MIBA 1S1VB 2BQ3A 2YNGB 5C25A 3KHGA 2W9BB 4ZHRB 1S0NA 1D0EA 3ITHA 4KBIA 4MK9A 3M9OB 1RT5B 3BSNA 2BANA 2VG7A 1RT2A 3MECB 2FVSA 3NL0A 5L1KA 3LP1B 2JC0A 3GV7B 1N5YB 4I7FA 4KO0B 3EZUA 2XGPA 1S6QA 3IS9A 5CYMA 2B43A 2IBKA 4K4SA 1NNDA 4RU9A 3V81B 3FFIA 3IRXA 1KLMA 1CSJA 2BQUA 3TQ1A 1TVRB 4MFBB 3Q8PB 1VRTA 3KLEA 4NLWA 4HKQA 5L1IA 5L1JA 4J9OA 4ECZA 5KT7A 1NHUA 1TL3A 4PUOA 3NGDA 3DLKB 1HNIB 3G86A 1RT4B 2BE2B 4R8UA 5KT3A 3KNAA 3GV8B 3DRRA 2RKIA 1N4LA 4K4UA 2IAJB 4NLVA 3KK2B 3H5YA 2HNDA 1LW0A 5T14A 3PZPA 3DI6B 1S9FA 4URQU 3QGIA 4J9PA 1TV6A 3DRPB 4IOBA 3DYAB 3I0SA 5HROB 4F50A 1HQEB 4RW7A 4NYZA 1RYRA 4K4ZA 5K14A 3KHRA 4O44A 5KG1A 4ICLA 3OL9A 4YQWA 4LSNB 3BSCA 4ECYA 4IQXA 5KFDA 1S9EA 1FK9B 2WOMA 1RDRA 1VRUA 3NAIA 5I42A 4TYBA 4TXSA 2B6AB 1D1UA 3CIZA 5KFEA 5C24A 1EETA 1RTHB 5HLFA 2R8GA 4JUZA 3RB0A 1T05B 5KFVA 3ITHB 4KSEB 5C42B 4ECSA 2BANB 2VG7B 4F4XA 2R8KA 4RW4A 1JLEA 4I7FB 2IC3A 2E9ZA 1S6QB 3IS9B 5CYMB 4WXOA 1LWCA 3PR5B 3CDUA 2C28A 4QW8A 3Q8SB 1KLMB 4IR9A 4EBDA 1DTQA 4NZ0A 2UUWA 4EO8A 5KG2A 3KLEB 1XR5A 3T5KA 3Q8QB 2UVUA 3HVTB 1RT6A 1TL3B 3DLGA 2XCPA 3H40A 2V9WA 4F4WA 4PWDA 1N48A 1S1UA 1LWFA 4WFYA 3BQ2A 3JYTA 4XPEA 3MR6A 2R8IA 4IG0A 5KG5A 3UR0A 3H5XA 3DRRB 5KFRA 2FLPA 5JUMA 4DL4A 4IFYA 1NHVA 1JKHA 4F4ZA 1LW0B 5KFZA 2HNZB 4GC7A 2IJNA 1TV6B 2C22A 3I0SB 3LAMA 4J9QA 4RW7B 4XPCA 2BRKA 2ILZA 2OPPB 1LWEB 3V6DB 2AGQA 1JX4A 4M95A 4RW8A 3H2LA 2W9CB 2WOMB 1VRUB 1TL1B 1BQMA 4KHRA 5C24B 1EETB 3V4IB 1IKYA 5HLFB 1K1QA 4Y2AA 3NAHA 2QE5A 2IA6A 5KFYA 4MKAA 4ED6A 5J2NA 4WZQA 2B5JA 2AQ4A 5KG6A 2OPRB 4ZVGA 4RW4B 2FJXA 2RDIA 1N6QB 4EBEA 1JLEB 2UUTA 2IC3B 4O3RA 4Y3CA 1RA6A 2V4RA 4ZPAA 4IFVA 1RYSA 3QO9B 1LWCB 4X2BA 4ECQA 3M9NB 3DOKA 1ZTWA 1DTQB 4WFXA 3LAKA 3KK1A 3QGHA 2GIQA 3PW4A 3BREA 4J9KA 3PW5A 4EYIB 1MMLA 1RT6B 5KFTA 3MEDA 2W8LA 4MIAA 2WK4A 4O4RA 3ICLA 3MR5A 1S1UB 5F8JA 3QZ7A 1HPZA 1U09A 4ED1A 3MF5A 3IGNA 3FQLA 2YNFB 3T19A 2R2RA 3NBPA 4QW9A 3RBEA 4QWBA 3OSPA 3DM2B 2JEGA 5KFQA 3BJYA 1JKHB 3PW0A 4ID5A 5KT6A 3CJ3A 3G6VA 4EO6A 4WE1A 3KJVA 3PVXA 5KFXA 2I1RA 4ZPDA 5KT2A 3CJ5A 1JLBA 4TN2A 3D28A 4ECRA 4Q8FA 1S1TA 1Z4UA 4QWAA 2YNIB 2AGPA 4NLTA 4NLSA 3C6UA 4Q44A 3HVWA 4ECVA 2AGOA 4ZPBA 1HMVA 4I2PB 4LSLA 4O3NA 4YR0A 2UVVA 3MEEA 3BR9A 5KFJA 3C6TA 3BGRA 2HNYB 1IKYB 4RZRA 5KG0A 4RUCA 3MFIA 1IKXA 4ZPCA 4YR3A 2B5JB 3FDSA 1C1BA 3CJ0A 3OL8A 3N6LA 4EBCA 4DL5A 2JEJA 2AU0A 4YMEA 1S6PB 2YNHA 1RT1A 3E51A 3M8QB 2XI3A 4NCGB 3LP0B 3G6XA 5DLFA 1JLCA 3DOKB 2D41A 1JLGA 4DG1A 4RNMA 5EWEA 4O3SA 4J9MA 3NKYA 3UQSA 3MFHA 4ED0A 5F8GA 1WNEA 4O3PA 3MEDB 4G1QB 4ZMMA 2FJVA 2AX1A 3I5AA 4WXWA 4NLGA 1OS5A 1HPZB 4EYHB 5KT5A 1JLQA 4I2QA 4MKBA 3DOLA 2FVRA 1TKZA 5KT4A 3HVAA 3FRZA 2ATLA 1IKWA 1S1WA 4ZP9A 3KLFB 4ID5B 4YP3A 4TY8A 2RDJA 2XCAA 3SFGA 1J5OA 5F8NA 2HWHA 3CVKA 2F8EX 2DPIA 3KOAA 1JLBB 3DLEB 2O5DA 2VG5A 3IG1A 3GIKA 1RTDB 1SUQA 3E01A 2VG6A 3CO9A 3G6YA 1BQNA 1RTJB 4R5PA 5KG3A 1DLOA 1SV5A 3C6UB 4WZMA 2ASLA 3T5HA 5D3GA 4ED8A 1HMVB 4LSLB 5J2PA 4IH7A 4KHMA 5C25B 3MEEB 5KG4A 3V6KA 3C6TB 5EWFA 1JIHA 4TY9A 3RB3A 3VQSA 2ALZA 1RT2B 4ECUA 1EP4A 1IKXB 1RT7A 4O4GA 1C1BB 5KFUA 4MK7A 3ISND 4ECWA 3PJXA 2VA3A 1HYSA 2YKNA 3FFIB 3IRXB 5F9NA 1RT1B 4IRDA 1VRTB 5J1EA 2WONA 1JLCB 5HBMA 4H4OA 4TYAA 4K50A 5KFFA 3T5JA 3BSOA 4J9SA 3SI8A 3RAXA 1S10A 4PUOB 5C5JA 3FQKA 2WRMA 2GIRA 2HWIA 5CYQA 4R8UB 2CKWA 1KHVA 2RKIB 3KLGA 3I5CA 2YKMA 4K4TA 1FKPA 4FBUA 2HNDB 4ZVFA 5KFLA 3BQ0A 1TKZB 3QIDA 3LP2A 3I5BA 3OLAA 1IKWB 5EDWA 4TY8B 3I0RA 3KLHA 1J5OB 1SH3A 1RTIA 4H4MA 3GV5B 5FDLA 2IM1A 4Y2CA 5K14B 3GYNA 4O44B 2VG5B 3IG1B 5DGAA 4ICLB 3OHBA 1SUQB 2VG6B 2IM3A 4LQ9A 4TQSA 2R2TA 1S9EB 4NLQA 5I42B 3RBDA 4KB7A 5HP1A 5D3GB 4HYKA 4FS2A 3KK3A 2HAIA 4ZP8A 4ECXA 4TQRA 4IH5A 1T3NA 3EPIA 5I3UA 1XR6A 4FBTA 1RT7B 3HHKA 4O4GB 2JLEA 4O3OA 4K4XA 3GIMA 2VA2A 1KHWA 1TKXA 3JSMA 2FLNA 1JLFA 2UVWA 3OLBA 4QWCA 2XC9A 3LALA 2YKNB 1QE1A 1UWBA 4NRUA 2W9AA 2XWYA 1QAIA 5J1EB 1QUVA 5HBMB 2I5JA 4H4OB 4RNNA 3DLGB 3DDKA 1S1VA 3CDWA 4NLOA 2R2UA 4ZHRA 4PWDB 1LWFB 3DMJA 4IR1A 2IM0A 3JYTB 1RT5A 4NLDA 3IGVA 4IG0B 5CYQB 4IKAA 4ZP7A 2OH2A 3KMQA 4WYWA 3LANA 3MR2A 1N5YA 1LW2A 4DL7A 4IFYB 1FKPB 4ZP6A 4PQUA 3KLVA 3V81A 3LP2B 4IDKA 3OL7A 2ASDA 2GC8A 3I0RB 3KLHB 4J9RA 5F8IA 1ZETA 2WCXA 1TKTA 1RTIB 4H4MB 3PHEA 1HNVA 5DQIA 4U6PA 5EUHA 5KFPA 1HNIA 4KE5A 2BE2A 3PW2A 4RW8B 2OPSA 4NLYA 1HQUA 1XR7A 1RT3A 1BQMB 1RA7A 2D3ZA 4DL6A 2IJFA 4RNHA 1R0AA 4O3QA 3MTKA 3DI6A 3EPGA 1SH2A 5J2NB 3FSIA 3DRPA 3D5MA 3DYAA 5I3UB 5HROA 1T94A 1GX5A 4ZVEA 4YR2A 2W8KA 3JSMB 1JLFB 4IFVB 3TVKA 1C1CA 4J9LA 5DG9A 4IRKA 1JXLA 1UWBB 3H4BA 4KV8A 1S48A 1IM4A 3OSNA 3PW7A 1JLAA 3KK1B 1ZTTA 3GQCA 3KHHA 2C2RA 3UPFA 5KFBA 1C0UA 1T05A 3DMJB 5C42A 3KLIA 4ECTA 1REVA 4F4YA 5DG7A 1N56A 3NBPB 2UVRA 3BSAA 1LW2B 3RB6A 2C2DA 4RW9A 4RUAA 2WTFA 2DPJA 4WYLA 4LQ3A 4QWEA 4PQUB 1RAJA 4WE1B 3KJVB 4IDKB 1YVFA 5F8MA 2RF2A 4KKOA 4H54A 1S97A 3HVTA 1S1TB 3T5LA 1TKTB 3QLHA 4NRTA 1HNVB 1MU2A 2QV6A 2D7SA 3CJ4A 2FLLA 5KFGA 3KHLA 2FVPA 4Y34A 2ILYA 2J6SA 2WB4A 2ZD1A 5KFHA 4IH6A 2OPSB 3V6HA 1HQUB 1IKVA 2C2EA 2E9TA 1RT3B 1C0TA 3BGRB 2R2SA 3H59A 4B3OA 4WFZA 4ZVHA 4EEYA 2HNZA 1R0AB 3QYYA 3OL6A 4Q0BA 3H98A 3RB4A 1TQLA 1S1XA 2OPQA 3ISNC 2AWZA 3QGGA 5KG7A 5JXSA 3CJ2A 5J2MA 3V6JA 2R8HA 2YNHB 2FJWA 5DLGA 2HMIA 1C1CB 2OPPA 1LWEA 4KV8B 3V6DA 1JLGB 1S9GA 4DG1B 1T03A 1JLAB 4Q8EA 4TLRA 1S49A 1TL1A 2XGQA 3M9MB 3V4IA 1TP7A 2IM2A 1I6JA 3IN5A 1C0UB 4NLPA 2ZE2A 4KAIA 5L9XA 2AX0A 4R0EA 3TAMA 1JLQB 3KLIB 4I2QB 1REVB 2OPRA 3PJWA 4Q45A 2IMWP 3DOLB 1N6QA 2BR0A 3PR4A 3KMSA 4RW9B 1S1WB 3DRSA 3QO9A
chains in the Genus database with same CATH superfamily
2MKYA 5DQGA 3H5SA 4MKYA 1FKOA 2GGPA 2W4PA 3QLHB 2V8HA 1SV5B 2EFPA 4YHHF 3H5UA 3PIOQ 3QSIA 3M2RB 3OUYB 2M4MA 3PX0A 5J2QA 1W25A 2KYXA 4RX6A 3M8PA 5EWGA 3R5AA 3H2VE 3PYFA 1TAUA 3UDLA 4IOAQ 4DV7J 3CMQA 1MN7A 2ZUAA 1R6VA 5HVFA 2DH8A 2B9WA 4ZCLA 3CCWA 4MFBA 2CZ4A 4QU6A 3BKFA 2EC0A 5DGBA 2UUCJ 3BO2A 4RNFA 2EXUA 1VJQA 2XMUA 2EEYA 1CG2A 3KLFA 5F8HA 2QX0A 4DQIA 2HIYA 2DHHA 4C3KA 2RRAA 4UOHA 3BSNA 3Q8YA 3AOCA 3GV7B 4A8KA 4K4SA 2UXCF 1Y3KA 1Z2ZA 4DZDA 4Y6IA 2VU5A 1TVRB 3Q8PB 2L41A 3DLJA 5L1IA 2CG4A 2QGFB 4PWWA 4LFCF 3NGDA 1GK8A 1RT4B 3OTOF 5AXKA 4AYBD 3JSBA 4CH7A 2XO6A 1TV6A 2O1PA 4AD6A 2LEBA 2N7YA 3KHRA 1JJCB 3NWRA 1IBLF 1XIQA 2WOMA 2BJEA 3FCHA 5HQLA 5C24A 4A8OA 2R7OA 4M63A 2GAHC 4JI0J 2E9ZA 1ELOA 2Q79A 4M5KA 1DTQA 3QWUA 1NSAA 3DCAA 4CI0B 2W2NP 2CADA 2E1AA 4XPEA 3KJFB 2R8IA 4BCAA 3MAHA 5ETQA 4J90A 5KFRA 5ITHA 4UT4A 1LW0B 3JS9A 4PXCA 5LMNF 4DF8A 4HVZA 1NK6A 5HLFB 2EG1A 3KUHA 2VPZB 3HJFA 1X5PA 4HACA 5J2NA 3K5MA 2ZHBA 5IV3A 3J81U 1TFWA 3HVRA 3D66A 3EWGA 3U1NA 3FCVA 3DOKA 5M2UA 4OYOA 4EYIB 2QL9B 1HBUB 3THTA 3D2WA 2JEGA 1E6YA 2X3DA 3PRBA 4ZPDA 4C8YA 1DHMA 1S57A 2YKQA 4PQAA 1KQKA 1EZZB 2FGOA 4YR0A 3ZTRA 2E5LF 1L5UA 3F41A 2W2QP 1NJWA 2RQMA 5GMEA 1PYOB 1H72C 3OL8A 4YMEA 5B08A 4OYWA 1VQSA 4XDCA 4RNMA 2V67A 4N8OA 3CJTA 5F8GA 4PG8A 2AEFA 3ISZA 1RADB 1YHQS 2GX8A 4U7UK 1NPRA 4B9UA 1VQOS 4KYZA 3ZTOA 2YWEA 1VOMA 4LF2A 2F8EX 1RTDB 3G6YA 1RTJB 4WFNQ 2K1RA 1FE0A 4HEA9 2X1BA 1HMVB 5A6WA 2WVFA 2XYGB 3G87A 3R8YA 5HQMA 5F9NA 2GQ2A 2DR8A 3JSRA 2M88A 2DH9A 3QATA 2GIRA 4FF1A 3CJKA 3V2UC 3BQ0A 2QL5B 1FDDA 2RAQA 1YRTA 2C2MB 3D7SB 3CXCR 4B3SF 4NXMJ 2CDRB 4I64A 4K4XA 3AY0A 2YKNB 1U25A 2XZDB 5DDOC 3NGKA 2GA7A 1FJEB 3G96A 4QIFA 4ID8A 1FHTA 2DEJA 2VHGA 4DLEA 3H8YA 4ZLLA 4FZVA 4ZN1A 5E2QA 4O3QA 2OFGX 2D3OR 1LEOA 2CPXA 1WC0A 1X4FA 1Q82T 3HSGA 4RPFA 3FKBA 1RAHB 3BH6B 2IVYA 5KFBA 4DR4F 1REVA 2RJZA 4RUAA 3DGVA 4KT0C 2A0FB 5CH7B 1MU2A 4MAKA 4DN9A 3KHLA 4LF9J 3AD7C 2M8DB 2WB4A 4CDIA 1IKVA 4OYPA 2DT9A 3LPYA 3D67A 2AWZA 4L3NA 3LW5C 2XNRA 1M1KT 5M2RA 2WW4A 4NOHA 2OPPA 1RUSA 1T03A 4UOFA 4D3HA 3AAWB 3GIRA 1PJ7A 3W66A 3M30B 3IR6B 2QZ8A 4M5JA 1CJVB 3I56S 4USWA 3O2IA 3OFGA 1VQ4S 3HKWA 1NJXA 3BKUA 1C0TB 5IWAF 2HK2A 1IM6A 2XMWA 2QYGA 2DJWA 4CLTA 2YNIA 3TRGA 1UVLA 1FWKA 2E5GA 5A8WB 3MECA 2ZUGA 5GAEU 5G4DA 1GX6A 1XMOF 4FVCA 2XZTB 4P7TA 3MEGB 2NXCA 3L95X 2A10A 1S4FA 1Y5NB 4HH0A 3CULA 4JP8A 2HZAA 1KVKA 4RJVA 3TAQA 9RUBA 1VBXA 2VG7A 3QGPA 5G0RA 2XO7A 2BQUA 4DCPB 1KLMA 1E6VB 1GH8A 4LRFA 4E8UA 2DRBA 4DV6J 3P8BB 3DLKB 1MLAA 4JI2J 2YPYA 2BE2B 2XYHB 3KNAA 2DNLA 5JVGQ 2ZM6F 3H90A 3PZPA 5B0DA 4K2XA 4LBIA 2M7SA 3MMJA 2LQBA 3A1YG 1BLUA 2YKPA 1VRQC 4TYBA 3PX6A 4PWUA 3K59A 2XS5A 4ZDNA 2NCKL 2D3O1 1FRHA 2HQCA 2YX1A 3KLEB 2LECA 4K0KJ 3C8YA 4GRSA 3RUBL 1IUJA 3H2UB 5AE1A 4ED4A 3DRRB 3TP2A 3JQMA 1D09B 1YG0A 1P9QC 3ZXWA 4J9QA 1UVNA 2PFFB 1U2CA 2BKPA 2L3MA 2WVEA 4X84A 4DR7J 1GFWB 1BQMA 4KHRA 1K1QA 2LQ9A 2QE5A 3T6JA 2V50A 2RDIA 3F56A 3U1LA 2IC3B 3K58A 1VI7A 3QGHA 1RT6B 3QZ7A 1NSPA 4ZOSA 4PABA 4UTGA 3PVXA 5IZHA 4OV1A 2FJBB 5A8KA 2MZSA 1Z4UA 3C6UA 2Z2ZA 4ZCMA 1H98A 3DFEA 2B8PA 2HNYB 1IKYB 1IN0A 5IFMA 4HDGA 4DL5A 2AU0A 1S6PB 4USMA 4ILLA 2COLA 3DRXA 4FNIA 2HBYB 4IUFA 2AX1A 4EYHB 1DY3A 3DRYA 5KT4A 3HVAA 2QTWA 2DPIA 4B9TA 1CJKB 3IG1A 2DGTA 3GIKA 4HR2A 1UEKA 3OJSA 3HHDA 3TZYA 2HHXA 3C16A 3M2VB 4ZVQB 4JV5J 4I68A 2B9XA 4MK7A 1HYSA 3SDEB 3TUPA 2KRRA 3CCQS 2FDNA 4K4TA 3TWZA 1MMDA 2OUGA 2JJ4D 2D1CA 1X31C 1RTIA 3GR1A 3TJAA 3CC4S 1S9EB 4B3RF 4KB7A 5E3RA 2FZKB 2OAUA 2P6SA 1QE1A 4PXBA 1N5SA 4Y2KA 3K5LA 2C3MA 3K8VA 3ETOA 3LANA 3EUNA 4X4SA 1G6BA 2D9OA 4ZP6A 4NZ7A 1F9HA 4ELUA 4RW8B 2M0GB 4DU8A 5HMZA 2KXFA 1SH2A 4I4BA 3FSIA 1D8ZA 4LF5J 1M5KC 3HFZB 1FJCA 4D3GA 3AH6A 4C7QA 3E8OA 1T7PA 4I0WA 3W62A 4P2SA 1T05A 1NB7A 2R9LA 1RP5A 4ZVSB 5HJYA 4QWEA 2CPJA 4ZLNA 4PQUB 3MCMA 1EIYB 2XBPA 4NRTA 3CJ4A 4HI2A 5D4NA 2CJ9A 3L9ZA 3V6HA 2OPSB 2N3LA 3DN9A 4YY3J 3T41A 2QG9B 3LUYA 4DV4J 1TQLA 4Y2MA 2GO8A 3QGGA 2E7WA 3US5A 2G1DA 5RUBA 1NCLA 2YNHB 1JLGB 5HVGA 1B0TA 3SBMA 2XGQA 4V19X 2EKYA 1C0UB 2DY1A 2NUUG 4CO3A 1S1WB 1SH0A 3QO9A 2GVZB 4CLLA 4AXJA 3E01B 4BC9A 3UO0A 3BGLA 3UWTA 2CWKA 2CJQA 2XG8A 2JC1A 1SJRA 3M2UB 1RWUA 2OPQB 2KH9A 5KFNA 1HW8A 3IBCB 4PKDB 3MDFA 5J2MB 1VYAA 3ENWA 3RAQA 4DU7A 5LT5A 4JI7F 5L39A 4O23A 2KM8C 3EDRB 2J9EA 1Q8LA 3ZTPA 4M94A 2V4JA 3N4WA 4QQBA 1FKOB 4OIXA 3JB9k 1UVMA 3PG9A 3FZBA 1XERA 2J6TA 4F3OA 5J2QB 4DXLA 1RWOB 3CWJA 1TKXB 4EUVA 1SJ3P 3M8PB 3DLEA 4QWDA 2MLYA 2VB6A 4PPDA 4ED3A 3THVA 5C25A 4KGXB 3ZZ0A 5HQ8A 1T8EA 1S6QA 4I6YA 1F5CA 3GFYA 4MFBB 2W2PP 4X62J 4NLWA 2B9YA 4ECZA 2P9EA 3A8KA 1HI0P 1TL3A 2HGLA 2NR0A 5DS7A 2YWKA 1RHQB 5KT3A 4Z2XA 1RWPB 2OTJS 1QSLA 3MOZA 3DYAB 3GJQB 4ZJQA 4ETZA 5KG1A 4YQWA 4ER8A 1RDRA 2OTLS 4WFAQ 4TXSA 1EETA 1U0SA 5C42B 5HMWA 1JLEA 4NX9A 4DV1J 4DFKA 1F5BA 1NMEB 3FSYA 1VIXA 2WVCA 2XS7A 1BD6A 2HNZB 4QU7A 4O0IA 1TV6B 1HWUA 2RSQA 2WOMB 4LT6A 4DBQA 5C24B 3HCXA 4JI4F 2KM8B 3AHPA 5KG6A 2OMOA 1LK7A 1W2BR 4O3RA 2ZH8A 4Q2LA 1DTQB 1DFDA 5KFTA 2HRUA 1H0HB 2QJ3A 7AT1B 2KO1A 1VLOA 4LBHA 4PXEA 3OSPA 1HHSA 1XNRF 3TUZC 4OZNA 2MPUA 4C8ZA 3IC1A 3GFHA 2DB1A 4ECVA 1TU0B 3R5JB 5KG0A 4HACB 5DM7Q 2DKOB 3CJ0A 3N6LA 5DLFA 3DOKB 4DG1A 4X4UA 5A2QY 3UQSA 4WP3A 5E41A 4Q7AA 3U27A 5KT5A 3KJNB 2QT7A 1UEVA 5HJXA 1AYEA 1E6YB 4K7QA 1FJ7A 5DM6Q 1VIOA 1SUQA 2XMJA 1NK8A 3D6HB 3WHIA 2VBYA 4I6AA 4ECWA 3IRXB 1QVGR 2KVIA 4Z37A 4FBUA 3QIDA 3OLAA 2VPYB 3MGJA 1RWXB 1RTZA 3TA0A 4ANEA 1FCAA 5I42B 2MMYA 2MY7A 3QRQA 3BDPA 3S1TA 4ZLJA 2XB2D 4DV0J 4CO5A 3GIMA 4NRUA 4OI3A 2MQ8A 4KHPJ 5LMUF 5A2QU 4QR1A 1NK5A 1N5YA 2BM0A 2Q6CA 3KLVA 2NSBA 1HD0A 2HEKA 2CPIA 4U6PA 2BABA 1NK7A 3FEYB 4U9RA 1Z1ZA 2D3ZA 3B8HA 2DBBA 3MTKA 5E33A 1HNZJ 4WF9Q 1WUUA 4YR2A 5AE2A 2B9EA 2A1BA 3MM9A 1Q4RA 4J9UE 4BLGA 3DLHA 3GQCA 1BUXA 2DGVA 3G8TA 4LF8F 1S7HA 2MXYA 2NQPA 1S72S 2EI5A 5DJBA 3DC2A 2YQ1A 3OR1A 1UVIA 3CCMS 2NLWA 2CPFA 4KGZB 4QOTA 2CG8A 3D9BA 1X9WA 5ADZA 2R2SA 2EFGA 3H59A 1Y5LB 2XY7A 5KG7A 5DLGA 4J7CA 2RHSB 1WKKA 5EGYA 1QAXA 4LRDA 4NLPA 4AUKA 5L9XA 3PJWA 1REVB 4BWMA 4AXIA 1FRKA 2RHQB 3N6NA 1MU2B 3Q22A 2W7OA 1QSSA 1OY6A 4ATNA 2YNFA 1IKVB 2DISA 2ZH7A 3CCES 1NK4A 1B4SA 1FWLA 4J9VA 4U95A 1REGX 2WHOA 2J7WA 2B4OA 4URSA 1W7WA 1T03B 2YKMB 1MNEA 2K7JA 2R8JA 5KFMA 1F9FA 3K5NA 4USTA 4LR9A 4ILRA 3DDNA 2AJ1A 5HI7A 4DSIA 3KK2A 1UJ5A 5HP1B 2VFTA 1WKLA 2NYHA 4YHHJ 2ZJPQ 1HI1A 4CCHA 2UXBF 3H0PA 2NPIA 2JNJA 2V8VA 2FVSA 3MECB 2CQHA 1B64A 1YZ6A 3RRGA 1YSJA 1N34F 1V9OA 2KVQE 3HO1A 4PG5A 4USIA 2PEHA 2H5JB 3BGFA 5ETOA 2XY5A 3ENVA 2F8MA 3IP0A 4JI1F 2E5IA 2W9CA 4Q5VA 2OSQA 1FKAF 2DHXA 3TJ9A 4KSEB 4M1KA 2VG7B 5G0RB 2ZZNA 4KH1B 2DIVA 4L73A 1KLMB 4F0MA 1N32F 4ZLPA 2V9WA 4F4WA 2MHEA 1LWFA 3BQ2A 4JYAF 3QFHA 5ETSA 3UR0A 4DV5J 2AEMA 1BWEA 2AD9A 1NDCA 3D68A 2ZH4A 1FDBA 2YWGA 3D1QA 1WHVA 2XM3A 1ULRA 5GAHU 1IBLJ 3VAIA 4IFVA 1PGZA 3PRDA 2F4VF 4P2FA 3MAQA 3PO4A 3Q8VA 4ALZA 1S77D 1B3TA 4C2MA 4S0MA 2H54B 2UUBJ 2UXDF 2G0IA 3KJVA 1S1TA 1WSVA 1ITPA 2HBZB 3ULHA 1H7XA 4HLBA 4CYUB 3W61A 3VHQA 1KC8T 4HL9A 1S59A 3BR9A 3VWSA 4RZRA 5LMNJ 1LKZA 1TK5A 4ZPCA 5ETNA 1RHMB 2PA3A 4V19J 4QCLA 1VS3A 3WIVA 4C98A 3UCZP 5J1NA 4WXWA 1SKWA 5M2PA 2HVEA 4MKBA 5I3PA 1XMBA 1X4DA 4CT8A 1WC5A 3UD5A 2M2BA 5DZ6A 5A8KB 5IM0B 2VG6A 3G71S 4R5PA 3C6UB 4WZMA 4KHMA 5KG4A 3PX4A 5EWFA 1XN9A 2KN4A 1RT2B 1KSPA 2LQ8A 5GADI 2G2YA 1DAXA 1FVSA 1FRLA 3K5PA 2HFOA 3IFEA 5B0AA 1K0VA 3MEKA 2BA9A 2HNDB 3L4BC 4UW2A 2MQPA 5FDLA 3IG1B 2J7UA 2Q3PA 2HHPA 2ZNYA 4I6WA 2XMKA 4HT7A 2CQCA 3EGVA 2D9PA 3CPWR 3C16B 4FS2A 4HYKA 4GVLA 4TQRA 4IH5A 1K47A 2E1MC 4C8OA 2VA2A 5KOXA 3OLBA 3LALA 1V3SA 1UWBA 1KQSR 4QYZJ 3HX9A 2HHWA 5MLCV 4F25A 4PWDB 3JYTB 3S6EA 2BJ7A 1LXNA 3OL7A 4P10A 4N41A 2C2KB 4J9RA 1RTIB 2JZ5A 1HWLA 1NB2A 3R2CJ 2HS4A 1SQGA 5IXUA 4YFUA 2E66A 5BXIA 1R0AA 2NPFA 3PCOB 2RUSA 3TVKA 3OSNA 4B3SJ 3KK1B 2DNRA 4WK3A 1VQLS 3CJ8A 1WDTA 2NZCA 4LUBA 2A2DA 2HFNA 5DG7A 4OYZA 3NBPB 4UZBA 1NKEA 1FRIA 2I8EA 4ZA1A 2RILA 3VF0B 2QV6A 3VAHA 2D7SA 2VJUA 1MG7A 2ZD1A 4IH6A 3I6PA 1VLYA 3L7PA 2LXUA 5MAOA 3SQOP 2NZ4A 3C66A 2HAFA 1I6JA 1WDDA 3P4UB 2GNKA 4DR3J 2ZE2A 1D9FA 2DR5A 1H74A 4A8SA 2IMWP 3QBCA 4LSZB 5IT9Y 2ZEJA 3MM5B 1X5TA 4DQSA 2LQJA 3N01A 2YQ0A 2LU2A 5I4MA 4MT1A 4IG3A 3QT8A 4ECYA 1JB0C 3MUTP 5KFSA 3GIIA 2JH3A 2XLKA 1Q7LB 4P9SA 4I2PA 4TU9A 4NLRA 2YNGA 3SCIE 4JB8B 3LP1A 1UJ6A 2HLTA 4I67A 1WKJA 3ZTQA 1SJ4P 2WW8A 2Y1LB 2ZBPA 4FDFA 2X1GA 4HHHA 3UCUP 3VVUA 4KR0B 3P5TL 3KK3B 4YN3B 4F7VA 3BYPA 2VFSA 4NZ6A 5E3PA 1GMVA 4FF3A 1FK9A 2I5JB 3DOMB 4F0HA 1EQ0A 3ITHA 3NEKA 2BANA 3AD9C 2V68A 4BBYA 1NNDA 1DRZA 2NXEA 3TQ1A 1ICEB 2PFDA 3VV2B 1OY8A 1VBYA 4X66F 1XMOJ 2GCFA 5D78A 3H5YA 4B3TJ 6AT1B 3I0SA 2JVOA 2VKRA 3OTCA 2VZ9A 2G2OA 3G4SS 1M1HA 1VGYA 4ICLA 4CT9A 3VGTA 4W92B 2VQEF 2V2VA 3TAPA 4F4XA 1T9UA 2M8HA 4QBUA 1S6QB 2ZITA 3KNGA 5B0EA 2VPWB 4IO9Q 1XR5A 1WACA 2MKHA 3H40A 1TL3B 1TMJA 5LXYA 5E3QA 1RLDA 4EFAC 1SXLA 4USKA 1M5VC 4DX6A 3LAMA 5IQ6A 1RB0A 2BRKA 1LWEB 2LA4A 1DZ5A 3V4IB 1EETB 1U7LA 4LR8A 5KFYA 4ZVGA 1N6QB 2UZAA 1JLEB 2ZFHA 1ZA2B 2Y1JA 3UCGA 4ZVUB 4E0DA 4O4RA 2CNOB 3DM2B 4GVBB 5KFXA 1PBUA 4TN2A 4ECRA 5JJBA 2UV8G 2L48A 1LXJA 1PBAA 4OHVA 4DPXA 3CDBA 4C8KA 1WJ9A 3FDSA 1RE1B 1G2EA 3LP0B 1JLCA 1IBKF 1KOOA 1AXQA 4NMLA 5EWEA 3MFHA 3UD4P 3L7OA 2ZH1A 4C0BA 4NLGA 4BS2A 3DOLA 2ATLA 5A8RA 2RDJA 4DS5A 1J5OA 1WC6A 3R5GA 4DUYF 1SV5A 2ZBQA 4K5SA 5K9FA 1IVZA 1V3RA 1B0PA 3M2RA 5HANA 4ZCIA 2FZCB 2KHDA 5HBMA 5GVQA 2BE7D 3SCJE 4OZLA 4PUOB 2HWIA 4CNZA 2FTRA 2IBOA 1F60B 2IMOA 3I9V9 2OLWA 3LP2A 3SCLE 1IBMJ 4B9MA 2JWNA 3KLHA 1GQEA 2F3JA 2YTCA 2IM1A 2OIHA 3GYNA 1SUQB 2HHUA 4G1PA 4X65F 2HFZA 1XR6A 4O3OA 1W2IA 1RWWB 3AQPA 5D4LA 3W3SA 1XMQF 4Q8EA 2E5HA 3KMQA 1LW2A 3I4PA 4HTJA 4PRFA 3QJJA 3L09A 4MIWA 4DS4A 4JI6F 1ZETA 5D8HB 3O8WA 2FHJD 4B3MF 2FC8A 1M5SA 4L6V3 3T1HF 2VDHA 1A9NB 1N5VA 1HKAA 1NBEB 4J9LA 3C14A 4KV8A 1H7WA 4LFBJ 2VQFF 3RGIA 3UPFA 4X4QA 3MUVP 1R31A 2UVRA 3RR8A 4WE1B 1Y5IB 1UW9A 4ZS6A 4LFAF 4TNOA 3W64A 3S8SA 3MURP 3BGRB 1S1XA 2D74B 3GJRB 4ES3A 1I94J 2H1YA 3E3XA 2XNQA 1S9GA 1U1KA 4WK1A 1OSDA 1LFPA 1HL6A 3FCWA 3KMSA 4OJ1A 2JOQA 3OR1B 2ZH2A 1BQNB 1DLOB 4MH8A 4NLUA 2ZVIA 3AJDA 3OBIA 4X64J 1LFWA 1JXVA 3VGUA 2J6UA 3CCTA 4Q43A 2GMLA 5K8OA 4ZJOA 2HFSA 2ZH6A 1PJ5A 1RKJA 3MWBA 3O44A 2XYPB 5ETKA 4L76A 4FKYA 4UUWA 1VDHA 2WSCC 4JI8F 4FF2A 2CPDA 3MMBB 3ILOA 4U7CA 1RTDA 5D77A 2MQLA 1RTJA 2F40A 3BZQA 1SKRA 2V94A 1HIYA 1S1VB 2DNZA 1S0NA 3M9OB 1MW7A 1N5QA 3PYDA 1FTCA 1HR0F 4JI7J 3Q8UA 3UNGC 4CLUA 2CA9A 3P96A 5K8NA 2OD6A 3TARA 3KK2B 2IHR1 4RWXA 4MYTA 3DHXA 3KJQB 1Q86T 2HQFA 2H4YB 3SCKE 1D1UA 5F0UA 2POKA 2DCUB 1X4HA 4OJ3A 4UQGA 4J91A 4QZVB 2G0CA 4QW8A 3MCSA 2VASA 4NZ0A 2E5JA 2XCPA 2VUGA 1GEHA 3L3CA 1YK9A 3MR6A 4DPWA 5J1PA 4DL4A 1N33F 4F0KA 3UDEA 3GTYX 3HMJG 3ZZPA 4AL6A 2WZ1A 2W9CB 4DOZA 4LRBA 2JHEA 2CFXA 3Q89A 3TX8A 4USUA 3VALA 4ED6A 1N36F 2B5JA 4ES1A 2OPRB 2IJRA 1U47A 2CRLA 1FXDA 2J0SD 4DR6F 2CQDA 4ED1A 2NUHA 4A48A 4C8LA 3FQLA 2R2RA 3KTQA 3MM8B 5BR8F 1B70B 5LSOA 1Q8KA 2LEPA 3BGOP 3J7YU 2UVVA 1KP6A 2VFUA 2AJ4A 2V34A 2E1CA 4EBCA 4OZ0A 3J81j 5HSPA 1B7YB 4B02A 4CM0A 2HKEA 1IJEB 2PMZD 1UTAA 1FD8A 3PKYA 2IYIA 4AFFA 4DX5A 1IKWA 1ZZFA 2XCAA 4DUZF 2F65A 4PXDA 1XNRJ 1DURA 4CO4A 1DJ0A 1RK8A 4LVNP 3FK4A 4IRDA 1QSYA 5J1EA 5LSRA 2AYEA 5AT1B 3D4JA 2BX6A 2M3DA 5C5JA 1AW0A 5A8WA 3KXDA 4M5HA 2RKIB 3I5CA 1UZDA 3RJMB 5A6PA 1XNQJ 4A8WA 2CQIA 1SH3A 1NK9A 5K14B 4O44B 2VG6B 2IM3A 3MPDA 2IYGA 2DXEA 1RI7A 5GMKa 4QWCA 1QAIA 4IYQA 3W8GA 1D3WA 1U1PA 2E29A 1PCAA 2IM0A 4TU8A 2DK2A 1PAEX 2XY6A 1E6VA 1ROFA 4CLPA 2OP5A 5DQIA 1X60A 4KE5A 2BE2A 4CLWA 2HVIA 2EG2A 4ZVEA 5AXLA 1BY9A 1UWBB 1KTVA 2C2RA 1UA0A 2F63A 3KLIA 4F4YA 4ZVPB 4LF4J 2RRBA 1Q5VA 1J5EJ 3HHLA 2OFHX 5LMUJ 4GKJF 3CCRS 3T5LA 4RUBA 2V2ZA 3BEGB 3DLLQ 1R0AB 2AMCB 4DQRA 4EMDA 3AOBA 2IRYA 5I3QA 1LK5A 1TZ0A 1RGVA 3GG1A 1TP7A 3HJVA 2FGCA 1LWXA 5H9EK 1FF2A 4CH0S 1K9MT 3I87A 4LF8J 3EVOA 1OO0B 2MKJA 3TA1A 2AJ0A 1U49A 3D1HA 3KG0A 2GQQA 2ZD1B 2DH7A 2HK3A 2JL9A 2FPHX 2DNHA 2W1BA 2QYCA 5AE3A 4OHWA 4ENOA 2EC2A 2R7QA 2ZVSA 1R0CB 1WTFA 3WIUA 2HNYA 2ZKUA 2DRAA 2ZE2B 2OELA 1S6PA 4QR0A 1TFYA 4DMZA 5DZ7A 2IDLA 3GFXA 4IG3B 1FTRA 1QY7A 4JV2A 2ACYA 3D6MB 2CYYA 2MGZA 2YNGB 1KQGB 4NI2A 1RT5B 1BWVA 3LP1B 3GR0A 4OI1A 3SDEA 2F1FA 2DGQA 4J9OA 3CMES 3MOJB 5LM7E 4R0JA 1RWNB 3OVBA 1LOUA 3CD0A 2NXUA 2A6OA 5HVHA 1DARA 5HROB 1P27B 2XSFA 3OL9A 1IR1A 3FEXB 1TELA 4NA2A 1S9EA 1FK9B 2JX2A 3BB5A 1VRUA 3HFKA 2LFVA 2R8GA 1YKWA 4YB1P 2ACMA 3ITHB 2BANB 2UXBJ 1ZM3A 2LP4A 4AL7A 2QA4G 4EO8A 3B54A 2UVUA 3T5KA 2KJVA 2L9NA 3NOGA 1QTMA 2HYIB 3MXHP 3H5XA 2FLPA 2QLWA 1S79A 4NCBA 5AJ3F 4PAAA 2B0GA 1SC3B 3I0SB 2BJ8A 1SIZA 2E7VA 2AYGA 4RW8A 3ZFVA 4L72B 1URRA 1MWQA 2Y8YA 4JI1J 3ET6A 3CCZA 2EFVA 2QC3A 1RYSA 4QIEA 4X2BA 3W9HA 4WFXA 5HO4A 2PN6A 2AIRB 5F8JA 1AFIA 3NGSA 3IGNA 3T19A 4QW9A 3Q86A 3UR3C 2AJQA 1YQHA 5KTQA 4JYAJ 1JLBA 3D28A 3A4TA 3O6QA 4ZN3A 4JI0F 4UZCA 3R7NB 4LSLA 2ZHAA 3C6TA 4ETXA 3W1YC 2YNHA 3E51A 5GMDA 1VQ8S 1JLGA 5L38A 3NKYA 3W5XA 5K20B 5GAGI 2C2OB 1S1WA 2GVZA 4F67A 3SFGA 2B56A 1V5VA 2FHKA 3E01A 3CO9A 4A8YA 2IVMA 1ZAVA 3GSIA 2UXDJ 4ZPTR 2H9ZA 1F2GA 3GG0A 3CJRA 2YKAA 3M8YA 4R25A 1D9AA 1KRPA 1JLCB 5KFFA 3T5JA 2FLOA 4FN5A 3AODA 1G1XA 1SQFA 4ELVA 5C2GA 4QIGA 2UP1A 4ZVFA 3S01A 3I5BA 3PEHA 5A8RB 5EDWA 1J5OB 2RU9A 3ZZZA 2HQGA 4TKTA 2PA8D 3RBDA 2RS2A 2H51B 4DQQA 1HI8A 4A46A 2J0WA 3GZ7A 4FXVA 2JLEA 1KHWA 1TKXA 3JSMA 2Y0BB 1X4AA 4JBCA 4EU0A 4PYAA 3QQCD 1VQ6S 5HBMB 2OI2A 3DLGB 4YB5A 1P1LA 4IG0B 3CW2C 1FXLA 3LP2B 4DFJA 5T7LA 1FI4A 2AW0A 3KLHB 4NCAA 5ETLA 1U1OA 1CVJA 1YWXA 1RCOB 3E2EA 2BMBA 2AJ2A 3F0NA 3T6BA 5CHCB 1UP1A 2EKNA 3DYAA 3TZWA 4JI5J 2EWHA 2DYAA 4IRKA 2H48B 1S48A 1VQMS 1ZTTA 4IO1A 5C42A 1LW2B 2OJ3A 3W63A 2B3TB 1HBNB 2FLLA 5KFGA 2FVPA 3T9ZA 4ZKAA 5B09A 2P2CB 4CO2A 4EI2A 2HNZA 3QYYA 1WEYA 1BGXT 3ENAA 2QLFB 3CJ2A 3BPSP 3C14B 4KV8B 1NDLA 2CAJA 3G8SA 1UEUA 1YLXA 3IN5A 1U26A 1Y7PA 1FRMA 3MR3A 3H4DA 5B0CA 4OYAA 2MZRA 1QJHA 1UMJA 1S1XB 2XULA 3T3FA 4DL3A 3CJQA 4JV1A 1S9GB 2N82B 4OJHA 2PIIA 1ZOTA 3K5OA 4CLYA 3W9IA 3NMRA 3B6BA 3VZIA 3J7Z5 1BHNA 2IY5B 2M52A 5D4OA 3NCPA 1EARA 3BPDA 1RZMA 3GCXP 4FYYB 4NXNF 2FYXA 2CJYB 2B43A 1U6FA 3U02A 3IRXA 4NMXA 1U8SA 3G6ES 2MKKA 4U67Q 4U8YA 1EQMA 2MQOA 2DGSA 3RAMA 2V69A 2PDAA 2DCLA 4NYOA 3TR5A 3D0GE 7FDRA 4OI4A 2HQDA 3VGVA 2GV1A 3FUYA 3B4MA 4IQXA 1HLWA 3GP9A 3TOQA 5I42A 5KFVA 4TU7A 3MPUB 4M5DA 4WXOA 3CDUA 1K73T 1FWPA 4EBDA 5E3CA 3ZZTA 3DXBA 1FFSB 3M1VB 4A4JA 3HHLD 4X66J 1M0SA 4ERDA 5IC4B 3WBZA 2GIFA 3O3LA 2DITA 1VCTA 3H2LA 2HVZA 3TO8A 2QFJA 2RB7A 2W4DA 2IA6A 2XMVA 1PSDA 4EBEA 4DV6F 4JI2F 2VQEJ 3HT3A 3PW4A 2ZWOA 4J9KA 3P3DA 2W8LA 1U09A 1BQXA 3EICA 3KDOA 4QWBA 3TEGA 3G6VA 4QJVA 1YJ7A 1YJWS 3CJ5A 3IAS9 1I5OB 1YDLA 3PIPQ 3BBFA 4B08A 1O5JA 1SJFA 1IWAA 2B5JB 4B9SA 3SMZA 2Y3YA 3V4MA 3GE9A 1UETA 1KDNA 4ED0A 4DPUA 2KRBA 3D6FB 3AJ2A 3UVJB 2B51A 3GYXB 4G65A 4OX6A 3Q2SC 2MZTA 3FRZA 3QT6A 3VCDA 4ZPVR 1ZAWA 1VHFA 1TKDA 1IWGA 5SZTA 2VONA 2CNKB 3RB3A 2ALZA 2QEXS 4CO0A 1CC8A 4H4OA 2CJKA 3DGPA 1FA0A 1TR0A 2VOPA 4R8UB 1BMQB 2YKMA 3MR7A 3HHLC 3DU5A 1M90T 1IKWB 9ATCB 2QLJB 2AKWB 1FNXH 2R2TA 4I56A 1AT1B 5HP1A 1Q78A 1NU4A 3BO4A 1CJTA 4WZQA 5CD4A 1I1GA 2N3OA 2XC9A 5J1EB 2ROPA 3M05A 1NDKA 3FEZA 3QSYB 1WEXA 4IFYB 5IQQA 5F8IA 1L3VA 3I9ZA 1NH7A 1UPMB 1UCNA 1S12A 2JRSA 3ZTSA 1K44A 4HI1A 2YH1A 4F02A 2FC9A 2PSZA 1AZSA 4GKKF 3H4BA 2J8AA 3PW7A 3PDNA 3A3OB 4HHUA 3TZXA 4H4KC 4RW9A 5FLXY 2V2KA 1FERA 5B0FA 4CM2A 1Y0HA 5F8MA 4KJIA 4RWWA 2XZWA 5DDQC 2HBRB 4JI6J 5KFHA 1XK8A 4NA3A 4PEOA 4EEYA 4WFZA 1VQ5S 1U45A 2EBGA 1NPPA 3GONA 4OYBA 2PE8A 1S49A 5K8PA 1TAQA 4I2QB 3KLIB 1WI8A 2W2MP 1D9DA 1PG5B 3POTB 3VAKA 3HHLB 1M1GA 1HWKA 3OXGA 3C3LA 5KFCA 4LF5F 5L1LA 4XO0A 1SKSA 3M6VA 4LFAJ 4M5GA 1EP4B 1S0OA 4F4KA 2JLFA 1KFSA 1XBWA 2ZOFA 3PM9A 2WONB 3CNQP 4CYUA 4GC6A 2V0NA 5KFKA 5H9FK 1Q53A 4DR1F 3NGRA 1YJTA 3JTPA 4PYDA 3OVAA 5AXMA 4YY3F 5FLXU 4FS1A 4J5OA 3O5TB 5IT4A 2KZZA 2IAJA 2LVWA 4UOCA 1QAJA 2J5AA 2ZDPA 5FIIA 3SSRA 2BDPA 5IM0A 4LSNA 4P72A 2C42A 2LMIA 2HS3A 4ZHRB 3LO3A 3VGSA 4OMFG 1RT2A 5L1KA 3I55S 3IS9A 2UU9F 4RU9A 2O66A 2BJ1A 1IQZA 2RMLA 2W4CA 2MZJA 3UD3P 3R1LA 3G86A 3UW1A 2XS2A 4AT1B 3SEOA 1N0VC 4N8NA 2HNDA 2X1AA 3QGIA 3DRPB 2I0XA 3MCOA 4F50A 2OO4A 3OFFA 3UE2A 1AUSL 1U0HB 2ZH9A 2FUG9 1U1QA 2MLZA 1A0OB 1ZZNA 4JI8J 2MGZB 3NNCA 3MUMP 1R8HA 3RB0A 4NI2B 4ECSA 3P45B 2R8KA 4RBVA 4UQTA 2DGXA 3Q8SB 4F2SA 1YI2S 5KG2A 3HVTB 2H5IB 4PWDA 1HR0J 3JYTA 5JUMA 4FP9A 4C0HA 4ED5A 4C8MA 4WU2A 3R6GB 2G2ZA 3S7RA 4LF6J 3MM7A 1TL5A 1VRUB 1XWLA 1SL1A 4MKAA 2K3KA 4ZPAA 4BHQA 4FXWA 5D0RA 3KK1A 1LV5A 3PW5A 1X5OA 3MR5A 1FVQA 1MROA 1WC3A 4F26A 3NBPA 1RAIB 3OXLA 3EJMA 5IT0A 5L8RC 1N33J 1WG5A 3HVWA 4DV1F 4ZPBA 1X9MA 2LDIA 1IKXA 3G9CA 2YY3A 1PYSB 3ET6B 5K8MA 4CTAB 1GXLA 2Y0SD 1HD1A 3PFOA 2D41A 2GVDA 4LJMA 4OYXA 4G1QB 4ZMMA 2C1EB 1FXRA 3NCQA 1RXOB 4DV3F 3MM5A 1RAAB 4DR6J 1F6TA 1JLBB 2O5DA 2GHWA 3T5HA 5D3GA 4LSLB 1ZBTA 4IH7A 3GWCA 4PPZA 3C6TB 2PD1A 1MMNA 4X4TA 4ZIWA 2LYVA 2OKQA 3FFIB 1H2UX 2WBMA 1VRTB 4F2RA 4X4NA 4Q2MA 1IR0A 4J9SA 3VVTA 1JJHA 5KFLA 4YB6A 3EYZA 4ELTA 3GV5B 4Y2CA 1KS2A 5DGAA 1VJWA 3KK3A 2HAIA 2HHVA 1URNA 5I3UA 1Y9OA 3TI0A 1P9YA 3VAMA 2XWYA 1QUVA 2I5JA 4RNNA 3DOMA 2HWTA 4C8NA 4NLDA 4ZP7A 4WU3A 5ETTA 2MKSA 1U1RA 2QSFA 2ASDA 4AL5A 1KVJA 1KTQA 1AROP 1EHWA 2GQCA 4NLYA 3J7ZT 4DL6A 4OZ5A 2Z2YB 2DNYA 4AQYJ 1R8BA 3JSMB 3HD2A 2FJAB 1RISA 2Z2LA 4B9VA 2E1RA 4NL5A 1HNWJ 1UVJA 2PI4A 1DBDA 2A2CA 3HHEA 2DPJA 1WHWA 3WC2A 5LJ5Y 5T7LB 3FGVA 4KKOA 1UA1A 1QM9A 1T9WA 4DV0F 1TMMA 2J6SA 2IFXA 3GB0A 4KGVB 1R0BG 3HK2A 4B3OA 2PMWA 2GJ2A 4KHPF 2KT3A 1OQ3A 3V6JA 4QIVA 2R8HA 2KFNA 5THWA 1LWEA 3OV7A 2DNMA 3FRYA 3ZC4A 6FDRA 1F0XA 3V4IA 1RBAA 4FXDA 3TAMA 1N6QA 2BR0A 2IPOB 3G2XA 4XK8C 4QPXA 4IQMA 3PYEA 5ETRA 1AFJA 1NK0A 5J2PB 3P6YC 3DM2A 4GVBA 4P6QA 3JXOA 1Q1KA 3GJTB 1RBOB 2N4CA 1FFWB 2W9BA 1ZPWX 1Q79A 3OHAA 2XHCA 4KO0A 1RU1A 3LGHA 1S99A 3R27A 4YUDA 3LP0A 2L9WA 1IBCB 1ZM2A 2GO9A 3I82A 1H2VZ 3K57A 2R7TA 2FD2A 3W7BA 4PR6A 1AA1B 2BRLA 1X4EA 2M70A 3CDEA 5DQHA 2VD3A 5A0YB 4WTOB 3GIJA 1WHYA 5KFWA 4OX9F 1UVKA 3P5BP 4UY85 5DDPC 4KBIA 2MJUA 3TW0A 1RWVB 2JC0A 3PFEA 4I7FA 2I2YA 3V81B 2V2QA 4DSLA 5IS2A 4HKQA 1YRUA 3CMAS 1TL7B 4PUOA 2LQ5A 4OLPA 4DR5F 2ADCA 4RW7A 4NYZA 1RYRA 3T1YJ 3EM1A 5KFDA 2IRUA 3N28A 1U1NA 4RW4A 1PAUB 3CD7A 2CQBA 3PR5B 3Q2TC 4IR9A 3OT9A 4DL0C 2MHNA 3Q8QB 2LEAA 2FB0A 3UI3A 1N48A 5LXRA 2H5EA 2AF6A 2Y8WA 1NHVA 1FESA 2AYMA 2PO4A 3J80Y 4M8LA 3BM7A 3IR7B 3V6DB 1VK8A 1RAEB 4Y2AA 3R2DJ 2FJXA 2WSEC 4M5DB 1CJUA 3CD6S 4KGMA 3M9NB 4LF7F 4ZJLA 4IOCQ 3MEDA 4N47A 5A76A 2OSRA 4RO0A 4WE1A 1Y3JA 2KYZA 2DIUA 2GJFA 5KT2A 2ROEA 2AGPA 3EXCX 4M5LA 3QRPA 5AJ3J 1H3DA 2O3DA 2HHHF 2YKOA 3MEEA 3BGRA 3J81Y 3MFIA 3PACA 3Q0AA 4UUXA 1O8BA 3M8QB 4DV5F 2V8PA 3FVYA 1KFDA 4O3SA 1O0PA 3AQOA 2QFIA 3I5AA 1WWHA 3C15B 1EKSA 1VK3A 3FMBA 1TKZA 1ZM4A 3NP5A 1FEEA 2WVDA 4DSEA 3J80U 4CLZA 1BQNA 2VIHA 1DLOA 4KH0B 1JIHA 3NGTA 1G7CB 3R1HA 1NAQA 1EB0A 4O4GA 4C11A 2BM1A 3QAEA 1P6TA 3DHWC 2UUBF 1WF2A 3W65A 3FQKA 2DTJA 1KHVA 3W5ZA 2J8SA 1G3OA 3BF4A 4KTQA 2ATCB 1XQIA 1KWMA 1WELA 1UZHA 3EPIA 3QRRA 3EVWA 3MMBA 5HATA 3ILIA 4H4OB 2VL1A 1UFWA 3DGPB 1S1VA 3CDWA 2R2UA 5HMXA 2KT2A 1BXNA 2JSXA 4IDKA 3R9LA 4DPTA 1QLNA 1RT3A 1SIWB 1YBTA 4ZVTB 4DF4A 2BOAA 3EPGA 1CJTB 1T94A 3AA9A 2W8KA 2CNLB 3TUIC 5H1SV 1NKCA 4FYWB 3LH2S 2WBRA 1KNZA 4OZ3A 3VAGA 3BSAA 5D0GA 5HN0A 3KG4A 2BV3A 4FPRA 3F44A 2E1PA 4Y34A 3OR2A 2ILYA 4Q0BA 3MAAA 1F3VA 4P2XA 2VOOA 2BW2A 1AZSB 3D0IE 2DEIA 2UUAF 3BBCA 3LGNA 4KAIA 2BACA 2OPRA 3K7RA 5ETVA 3PR4A 4RW9B 4C3MA 1YBUA 2FHJA 2UXCJ 1R89A 4WP9A 4ED2A 3MM8A 3CC7S 3CGIA 4LFCJ 2AV5A 1XEZA 3OTOJ 3K2YA 2FVCA 1S0MA 2JFDA 2FVQA 5DDRC 2VC0A 5DETA 4I1TA 5F9LA 3VTIA 2XMTA 2ZOGA 2Z0GA 4XTTA 2GMHA 1FJGF 2BUNA 1U8WA 4OV6A 4L3KA 1HQEA 4DR3F 3N6MA 2B6AA 4ZIVA 4MIBA 3HFVA 3H20A 2BQ3A 2R7RA 4MTPA 3D3BJ 2XGPA 3OVSA 1U1MA 4OFZA 2DNGA 3FJ2A 5IOLA 3EXYA 2W24A 2R7SA 3VR1A 2RT3A 4NWBA 2RKIA 2IAJB 4P71A 3M8SA 1GMWA 4J9PA 2ZOMA 1J27A 5K14A 2ZBRA 4O44A 4DFMA 4LSNB 3ZZYA 2FJDB 5KFEA 3KUEA 4OHYA 1UKUA 4F3MA 6FD1A 3IS9B 4NXNJ 4RL1A 3K8WA 2E5LJ 2PC6A 4NEZA 2DGUA 1YJRA 1Q5YA 3UN2A 1JKHA 3TQEA 4F04B 1IQTA 3OQ2A 2C22A 2AEJA 4B9NA 4FYDA 1WSRA 4XPCA 8ATCB 2AGQA 1TL1B 1S0VA 4WWSA 4B3TF 2MLXA 2PI5A 2J9CA 1S7IA 4MIAA 2VH7A 3ICLA 3K89A 1N8RT 1N54B 2YX7A 1RHKB 3THPA 4C3LA 3EGNA 2ZKTA 2FHMA 2I1RA 2EK1A 2J76E 4NLTA 4Q44A 3MM7B 1HFEL 3CT9A 5KFJA 8AT1B 1RT1A 4NCGB 2J9DA 3IWXA 2WSFC 1ZM9A 1HBMA 4DV2F 1CULA 5ETMA 3TUJC 3CCJS 3ZZUA 4EZ6A 3NY0A 2HBQB 5CABA 2ZDOA 1MROB 2FVRA 3GPAA 1T9VA 1ZS6A 4ZP9A 4TY8A 2CZVC 3CVKA 2KG1A 3SZ2A 4W90B 1Y00A 1ACMB 1SC1B 2W01A 2B7BB 3QJPA 1Q8BA 3WZ0A 1L3TA 2J0XA 1UWAA 1IKXB 5KFUA 1FFGB 1JNRB 2KKHA 2PMHA 1F5AA 4K50A 1RHJB 2C3UA 3BSOA 1QUPA 2GVDB 3JSYA 5CYQA 4WIQA 2ZNZA 2IVFB 3AD8C 4Y65A 1Y10A 1JMTA 4DR4J 3I0RA 3W8PA 1SPBP 2P9GA 4LQ9A 3FNNA 5D3GB 4MYUA 3BKTA 4CH1A 1UL3A 4N77A 3HHKA 3CUNA 3DU6A 3NS5A 2XSJA 2O01C 2CJXB 1PO6A 1RT5A 3MR2A 4C6AA 2DNQA 2C2NA 1R8PA 2V6AA 4G1IA 2B4VA 2CIMA 2HFUA 2QMWA 5F3ZA 1FE4A 5DRKA 4HTIA 2VPXB 3MPVA 5I3UB 5HROA 3W2WA 1C1CA 1JXLA 4CQ1A 5IWAJ 1JLAA 3KHHA 5LL6d 1IBMF 4CLKA 4UY8T 2I9SA 1UFKA 2K8GA 2FQQB 2KTQA 2L08A 1RU2A 2V63A 4ZVOB 3KWMA 3UFCX 2NSCA 4H54A 5IT9U 4OI2A 4DI6A 2OEMA 3MHYA 1NKBA 2C2EA 1WHXA 1H73A 1YJNS 2Z30B 3ZNUA 1VC6A 2VBZA 1OMSA 3AA8A 3W2VB 3RYLA 1V5IB 5KAKA 2HMIA 1RHUB 4TLRA 2IM2A 5LSLA 4J37A 4GKKJ 1JLQB 1YTYA 3NNHA 2QA4S 4JI3F 1OQ6A 4OYIA 1KEKA 4KKOB 2CPHA 2KT5A 3H42A 4JV0A 3F73A 2QMXA 1DTTA 4J9NA 2LU1A 4B3OB 4LFBF 4DWIA 4DR2F 3NCRA 5GAHI 1RLCL 2ZM6J 3KKFA 1X4CA 3SQGA 2DNNA 3KLGB 3TAMB 3R97A 2RH3A 3HXMA 2ZZMA 2FZGB 4PZVA 3AB4B 3K17A 4LVOP 1I94F 3ILLA 4EGLA 3OD2A 5CXTA 2BVZA 3M32B 2RUGA 3N5BA 4YDXA 2KFYA 2W9BB 3KHGA 3MZIA 3G82A 1SL0A 3NL0A 2K06A 1JJ2R 2HHTA 4KO0B 3C46A 2L9DA 1RAOA 1CS4A 1EX8A 3AT1B 2K3IA 4X64F 4DR1J 1SVDA 4M5IA 5HAOA 1TTHB 1HNIB 3CSKA 5SUHA 3GV8B 4K4UA 2DNPA 2F4FA 3DI6B 3HP6A 3BH7B 2XHWA 1OWXA 1R43A 1ZPVA 2DRDA 4K4ZA 3HSDA 1I3OB 3DKDA 3PJ9A 4V1Ak 5CQGA 2YWWA 2ROGA 5H9EJ 4I7FB 2BE9B 4EZ9A 2BYCA 4FPIA 1LWCA 3SXLA 2RIJA 4PG6A 3BBBA 3UDCA 3DLGA 2H4WB 2A6MA 2UU9J 4IG0A 3MMAA 1CC7A 3M6XA 4GC7A 2CQ1A 2IJNA 4MMOA 4RW7B 3PRVA 2ILZA 2DGWA 3D1OA 2OEKA 4M95A 2XWXA 2MTLA 3AFGA 3NAHA 2FJEB 1FDNA 5BYSA 4RW4B 5IV4A 3M8ZA 4ECQA 1ZTWA 4EWTA 2GGPB 3BREA 3TX0A 2WK4A 4RR5A 2DD8S 2EBEA 1K8AT 1VISA 2W7AA 2HZVA 5HL7Q 1VQNS 1IR2A 1HBNA 1H38A 2YQ3A 4K5RA 5FD1A 1AUDA 2CQPA 2AGOA 4YDDB 4O3NA 2RQ4A 3TZZA 1G4CA 3O1LA 4YEAA 4RUCA 4QR2A 2HIQA 4NA1A 3PXGa 5BJRA 4B3RJ 3TVYA 1CJUB 3R6LB 1C4CA 2X3GA 3EGWB 1WG1A 3H7HB 3MEDB 4FYVB 4WKRA 2VODA 3UNYA 1VC0A 3KLFB 2VG5A 3MI7X 1Y11A 4DUTA 4P75A 5KG3A 3IRWP 1L3UA 2ASLA 4ED8A 3B78A 3MEEB 1JJ4A 1KBRA 1DQAA 4CO1A 3VQTA 4ECUA 1HNXF 2NS1B 4X4VA 4DZ6A 1T11A 2KB2A 5K5MA 2IA0A 2G1HA 3GYGA 3LWLA 4O0NA 3CD5A 1FKPA 1TKZB 4LREA 2K7KA 3SV3A 4DV3J 1GTHA 3GJSB 3LGMA 4HDHA 4ZP8A 1GMWD 3NS6A 4O4GB 4XIUA 4C11B 2OD4A 2UVWA 1JLFA 3HKZD 3TVZA 2C3OA 2MEWA 2W9AA 4TVAB 2ZH3A 3LOUA 3MMCA 1UPPA 4NLOA 4IR1A 4DLGA 3IGVA 1WOSA 1U2RA 1YGYA 2YH0A 3R5BA 3A8JA 5BYRA 3SYZA 2B8QA 5EUHA 1HQUA 2CQ3A 5E5NA 4TLQA 2BKNA 1HBOA 1Q8IA 3SSQA 1J2VA 5J2NB 3PTWA 1GX5A 4ZCKA 2EVZA 1U6ZA 1M5HA 5DG9A 1YJVA 4N76A 2M5YA 1SQEA 1IM4A 1XNQF 3FMWA 3MPYA 4KQZA 1P1TA 2ZC3A 2CDQA 2WTFA 1S6OA 1U48A 4IDKB 3ELHA 2RF2A 3M8RA 1FRJA 3CDAA 1RT3B 3HPOA 3M1VA 1HWJA 3H98A 1C4AA 3RB4A 1KLNA 1T02A 3MTJA 3BO3A 2DHSA 1AB8A 1TUVA 4A8QA 5GADU 1M5PC 1T95A 3M9MB 2KFZA 2RQKA 1GAOA 3DRSA 1K0TA 4URGA 1NSQA 4FYXB 2NREA 4B17A 4P73A 3R7SB 2GAGC 4ZK7M 1R6YA 4DL2A 2K1RB 3OR2B 2X51A 4KFBA 2HURA 1O6XA 4Q0BB 3A3NB 3MAAB 2DNOA 5DG8A 3CIMA 1YX2A 1SBRA 4DJBA 3DLBA 2VFRA 1GT8A 4LF4F 4USHA 1VR6A 1J5EF 2BW7A 3CCVS 4RNOA 4MK8A 4OX7A 4DX7A 2AZ3A 1X8DA 2XI2A 3CJKB 3N9UC 3HHNB 3R5CA 4IRCA 5DO2A 2ZH5A 4DPOA 4A8XA 1Q95G 4NLXA 3UVJA 5IC6B 2AT1B 5EX0A 5EX3A 4DEZA 4K2JA 4G3IA 2Y9HA 2QLBB 1PIEA 1RTHA 5E7OB 1C2PA 2LDYA 2CQ0A 2Z8QA 2Y1IA 1WOOA 2EW9A 2JLGA 1NLKL 1BE4A 3UN5A 3GU0A 4JI4J 4ZITA 3PNIA 1NHUA 3LQVA 5C7PA 4R8UA 3OTBA 2CWXA 1S9FA 2JFKA 3OTDA 3NLCA 1HQEB 4C4WA 4WCEQ 3ZO7A 2B6AB 3CIZA 2Z58B 1YRXA 2HZCA 3D54A 4JUZA 4I69A 2U1AA 4P2MA 4OX9J 3BS9A 2C28A 3M7VA 1N5TA 2DHAA 1ZA1B 1S1UA 4WFYA 1T9XA 3NRBA 4RBUA 4IFYA 1UW4A 2CZ9A 2Q1LA 4RKUC 2ZJQQ 2DO0A 3QAUA 1RKIA 2MQNA 2CQ4A 2OPPB 4DR5J 1X4GA 2GW8A 2YVSA 1CBKA 3UDVA 3C2PA 4KGKA 1HW9A 2AQ4A 4FVMA 1WEZA 3IXQA 1LNQA 1RA6A 3NG8A 2HS0A 2DY9A 2R42A 2ERRA 3KUGA 1PJ6A 1HPZA 3RBEA 5L9NA 1F2HA 2R7WA 3WX4A 3BJYA 1JKHB 1F3FA 4ID5A 3N5FA 3K0JA 4BWJA 4OI0A 4Q8FA 1BC6A 4QWAA 2YNIB 1A7GE 5D0HA 4OJGA 2MQMA 1C1BA 2BBEA 4F36A 3KG1A 2JEJA 2ZJRQ 2XEXA 2RNEA 1JNZB 2XI3A 3J7A1 2U2FA 5D0EA 4KIAA 1NEEA 3UN3A 1OS5A 3I31A 4I2QA 4WP8A 2DR6A 4LF7J 3POTA 5T41A 4YP3A 2ZC4A 2LXIA 3KOAA 1TK0A 1RCXB 1HWIA 4YOEA 1KVIA 2KL8A 3I96A 3V6KA 3VQSA 4F3QA 3RBXA 3QMQA 1Q7YT 1EP4A 1RT7A 3MCNA 2HHHJ 1RT1B 2WONA 1RBLA 1RACB 1HBMB 1VBZA 1CULB 2VKZG 2CKWA 1RWKB 2C3YA 4NPOA 2RU3A 4TY8B 4A8FA 2HQ3A 3DXSX 3IMQJ 4TQSA 2VFVA 4NLQA 1FRXA 4DSFA 3DDIA 1S76D 2GS8A 3LA0A 5LJ3Y 2CXEA 2OMLA 4KC5A 4RBTA 5HK4A 4FBTA 4QYRA 3JQKA 3R3TA 3BYRA 5F0WA 1OSCA 5B7WA 4OZ1A 4ZHRA 5AXNA 2KI2A 5CYQB 3PO5A 2CPEA 4DL7A 4ZPWR 4BDPA 4H4KA 4OLOA 3ETMA 3I0RB 1TKTA 3PHEA 1YJUA 5KFPA 3ILJA 3PW2A 1YITS 4DX8H 1NJIT 1BQMB 1RA7A 1T3OA 3HF5A 3ONQA 3QWPA 5CAAA 4RLEA 1S6UA 3DRPA 2V5HG 1U0HA 1GXUA 1FD2A 2LLZA 2XSJB 2HGMA 1WTBA 2JDJA 2XTJP 1FX4A 4ZVRB 3IBWA 1SC6A 2C2DA 4LQ3A 3ENQA 2F9JA 5JMNA 1YVFA 3RW7A 1RJJA 4ILMA 1S97A 2KU7A 3HVTA 2XMAA 3Q23A 2DO4A 1TK8A 3TA2A 2Z2MA 3GFZA 4CLSA 4ZVHA 1R8AA 3QJLA 4DV7F 2MKIA 2HVHA 1HHTP 3W2WB 2FJWA 2H65B 1C1CB 3P49B 2Q43A 1JLAB 3WX8A 1FDAA 4G6VB 2AJFE 5D15A 1KOHA 2P8IA 4R0EA 3QPIA 2UUCF 2JVRA 3BDEA 2MB0B 1U1LA 1HHQA 2JEFA 2XMMA 4RW6A 2B4UA 4B9LA 3LF0A 4Z7YA 3M6WA 1VFJA 4JI5F 2CJAA 2BEFA 2VBWA 1R7IA 1N34J 1JXEA 2E9RX 1V3ZA 5F8LA 1HYSB 3W60A 2V8GA 2HMIB 3QFWA 3QIPA 1UAWA 4W98A 4WKYA 3MM6A 3W9JA 5JVHQ 1PILA 2UUAJ 4CTAA 2DVIA 1OYEA 3CJSA 5B0GA 4G1QA 3QZ8A 1DTTB 2J9DE 3HZEA 1N32J 2RS8A 1OPZA 5D4PA 3GSDA 3J7YI 4K4WA 4OL8A 2HLUA 1QE1B 4CP5A 4N5SA 2BQRA 3SQGB 1D0EA 2A3JA 2IBKA 5CYMA 1Q81T 2N4DA 3FFIA 1CSJA 1VRTA 2H3EB 2Q66A 5KT7A 2ZBCA 4OQJA 1U02A 4QIWD 4L74A 4X4RA 2R4FA 1EJ7L 1FJGJ 1N4LA 2AZ1A 2W2OP 5T14A 1QAYA 2F4VJ 4URQU 5CYJA 2VC1A 1R3NA 1WF1A 1NSKL 4C9DA 1FO1A 1MN9A 2QN6B 1T05B 1RAFB 4YB7A 3G82B 3SSSA 4E2FB 4GO5X 2AP6A 3OJUA 3IM8A 1GMUA 1CS4B 2CQ2A 2UUWA 3IR5B 2CNNB 2UV8A 4USVA 4WJBA 2ZZTA 2ZHOA 3FSXA 1B7FA 2XLJA 3IA0A 3V5RA 2F9DA 3LPEA 5H9FJ 3ZZRA 2ASYA 2UUTA 5E0OA 1I51B 3QO9B 1LWCB 2J7KA 1F1BB 3LAKA 3NNAA 3A8IA 1PC5A 4Y2IA 1ZYQA 3MMAB 5CZVA 2VBXA 5KFQA 2I38A 5KT6A 3AJ1A 3IAM9 4DN0A 1DQ9A 4NLSA 3TJ8A 3IO1A 4ITSA 2BXJA 3PKMA 1X9SA 1N88A 3TNVA 2V4JB 2G13A 2MYFA 3C19A 4O3PA 2FJVA 1GXTA 2CUYA 1YZ7A 4OX8A 4YS2A 1OIAA 3B4DA 4OHZA 4HHJA 2KXHA 3HLUA 5CD4H 3FBBA 4DPYA 3DLEB 4NXMF 4DCOB 1B0VA 2BZ2A 5J2PA 1SB6A 5C25B 2Z4PA 4TY9A 3WQPA 4RU2A 7FD1A 1X0PA 1WD6A 3RRKA 4E98A 2ZWPA 3RAXA 1S10A 3BN4A 1T9YA 4USJC 1XJWB 2HRYA 3AXKA 4DV2J 1W26A 2GFFA 4H4MA 2KG0A 3A8EA 1NZAA 3T9NA 2VG5B 4K8RA 3WC0A 1M5OC 1T0TV 5EN1A 5EHHA 2XQCA 5A0YA 3L7UA 4UOGA 3N79A 2KXNB 3DDKA 3M4XA 1FX2A 1VQ9S 3DMJA 1L3KA 2OH2A 1L3SA 5LOQA 1FKPB 1FNMA 3MD1A 4LF9F 3V81A 3U7JA 2E7XA 1HA1A 4K59A 2WCXA 1TL7A 1HNVA 4A8MP 4XAKA 2NXNA 2LCWA 2HPUA 2F7VA 5HMYA 2RDDA 1JLFB 2F5GA 2CJBA 4AE5A 1R27B 4FNHA 1GNKA 3MMCB 1N0UA 2DHGA 1RHRB 4WBFA 1GTEA 4LBPA 2RE1A 4M5MA 3QLHA 4UF4A 3D6TB 3VAFA 4KY3A 4M5NA 1RWMB 1HQUB 2ABYA 3OUYA 1HBOB 1QTNB 1OY9A 2EPIA 4LF1A 5JXSA 3OFEA 4F8RA 4Y28C 3V6DA 4DG1B 2G9OA 2DR7A 1PKUA 4OZ2A 3EGZA 2VJVA 4MKVA 4DHVA 1OPIA 3Q8RB 2E44A 2RF2B 3WDOA 4N7TA 5E3AA 3W5YA 3TANA 3N0VA 4K4VA 2V4QA 1X7VA 3GILA 2QIFA 4DSKA 2DXFA 2A18A 3CTRA 1CEZA 2B7CB 3M6UA 2ASJA 3BR8A 4K4YA 2DGOA 3QNWB 2IIHA 2VF3A 1KR4A 2BJDA 2JEIA 2W7PA 2DXDA 1VC5A 1TVRA 3DRSB 3M8QA 3SFUA 1K1SA 4EK2A 2FY8A 1NM2A 4JI3J 1RT4A 3C15A 1U6BA 4KFBB 2D3UA 5F3TA 3A3PB 4Y00A 2HHSA 3J7AN 3R5DA 4CNYA 2P9CA 5CZXA 2RRNA 1S4EA 4Z7CA 4DR2J 4MK9A 1Z2LA 1CQNA 1FT8A 4K0KF 1SCJB 5D6GA 1N5YB 3EZUA 4NEYA 1NRKA 3MD3A 5FJ4A 2PGCA 3TEHB 2CPZA 3X3UA 4NLVA 1LW0A 1JWWA 1LQ9A 8RUCA 3AB2B 4DR7F 1WI6A 1FEHA 3QT5A 3MM9B 3NAIA 4CIOA 5HLFA 1RTHB 1NPKA 2QA1A 1NJYA 2KDOA 1TL4A 4NYPA 4LRAA 1EKRA 2ADBA 1KQFB 3IWNC 1H6KX 3KDNA 1UJ4A 5CCLA 1HBUA 1YJ9S 1VQKS 1MWYA 1CPZA 2MSTA 2KHCA 1IBKJ 1CQMA 2HGNA 3A12A 1MWZA 4DUYJ 1EAYC 2NYIA 1SKUB 3PV8A 2V4RA 1T9TA 4QYZK 3OTEA 2GIQA 4U8VA 1MMLA 4OI6A 4NASA 2X7IA 1S1UB 2GHPA 2QL7B 3NXZA 2YNFB 1A6LA 3IWLA 2CPYA 4JV5F 2WB1D 1HMVA 1QDUB 1SL2A 2W25A 4A47A 4Y0FA 3GLJA 4YR3A 3G6XA 1U2FA 3AXMA 1YIJS 4X65J 4PCQA 2MZ1A 1VMBA 4KPCA 1RABB 1HPZB 2YBVA 2G4BA 4LF6F 1WOPA 3LWMA 4ID5B 1RSCA 1VQPS 1XMQJ 2P5VA 2EFOA 3PY8A 2YPZA 3NWGA 4CZCA 4QPTA 2BJ3A 2QLXA 3JTNA 2X1FA 5U47A 4B3MJ 1C1BB 3ISND 3A13A 2VA3A 2YKNA 1PC4A 4TYAA 2YWFA 3T1HJ 1KD1T 2AYBA 4P52A 1VQ7S 3CE8A 2FY1A 4LIRA 2VQFJ 3OXFA 3CB4A 1VHIA 3KYLA 1S5ZA 2OHDA 2NXJA 3MPWA 3GMGA 2EFNA 5C2CA 4OZJA 2CQGA 1RT7B 4MJKA 2FLNA 4BC7A 2IRXA 2V8DA 2RD5C 1HNXJ 3JQJA 1LWFB 4IKAA 4WYWA 2WAQD 1KONA 4X4PA 3B82A 2CVIA 2GC8A 4HT5A 3IBFB 4DV4F 3RW6A 1XR7A 3PHTA 2IJFA 4KPYA 3SV4A 3CF5Q 2Z56B 1MSWD 4JOUA 3RG6A 4IFVB 1U24A 2DNKA 2HSEB 3M8WA 1NDPA 3M30A 4ECTA 3X1LB 1Y4ZB 2Y1RI 5GAGU 1RAJA 1VBKA 3KJVB 2Z57B 1CJVA 3HSJA 1S1TB 1TKTB 1V6HA 2FHOB 2YXLA 4DQPA 2MZQA 3LTOA 1C0TA 3BV8A 1TUWA 3GCWP 3ISNC 2QRRA 2LKZA 1KN6A 2CVEA 1TL1A 4GMKA 4N56A 2KZMA 4L75A 2AX0A 5CCMA 4CLFA 2ZBIA 4U7UD 2YX4A 1HQ2A 5L46A 3CCUS 2RQCA 2GJIA 3MEGA 4R5PB 2PEBA 4AQYF 1HARA 3U1MA 5KFIA 3NOCA 2APOA 3CEDA 2VDIA 1HNWF 3T1AA 1DQ8A 2HW3A 3HSZA 5KFAA 5KFOA 2HVDA 2RVJA 4X62F 1JK9B 3NMAA 3NGUA 3FZ2A 4NCGA 3PEJA 5FDLB 3EZ5A 2MKCA 4RW6B 3DLKA 3HDSA 3EVMA 2KJWA 5BYQA 3FC9A 2N7CA 3IM9A 3FBEA 4ED7A 4WPAA 3HT0A 1O51A 4KRWA 1NHKL 4X4OA 3HZGA 3BQ1A 4ES2A 3PYGA 3QIPB 1QD1A 1Q16B 3EE3A 2QMUB 2C3PA 3H25A 2QSWA 3MM6B 4GO7X 3HI9A 3ZNJ1 2R7UA 4ANDA 3KLEA 5L1JA 1N36J 3R7BB 1X4BA 3DRRA 2BJ9A 4C48A 3AOAA 2C2ZB 2Q6BA 4IOBA 1XC9A 4DFPA 1Q0NA 1CLFA 2F8HA 3EX7B 4XDDA 3BSCA 5BR8J 4WIIA 5CA5A 2I6WA 3OW2R 2O67A 2M9KA 1QVFR 4FF4A 2XLIA 3RZAA 4C0OC 3FBFA 2IC3A 5CYMB 2VV5A 2GZOA 3ZZOA 3I32A 3EDQB 2R7XA 1RT6A 2GMJA 3I4HX 5KG5A 2DR9A 1WF0A 2FIUA 4F4ZA 1F9EB 5KFZA 2EK6A 3EZOA 2P6TA 4FKXA 4OHXA 4C97A 1D8YA 3HM9A 1JQGA 3D0HE 1JX4A 1ZAXA 3JAMY 4DUZJ 1IKYA 5KOWA 4U96A 1OJ4A 2K2PA 4Y3CA 4ANCA 3OPKA 1NZ8A 3BGUA 1KKHA 1ZH5A 2QO3A 4DCJB 1N52B 5GAEI 1SJQA 3MF5A 3T1YF 1YBAA 1R8CA 4OYMA 3PW0A 5F41A 4CRJA 3CJ3A 4EO6A 2BKOA 3D3CJ 1NO8A 1CJKA 4WTYA 1WC4A 2AHOB 1SJ1A 1RQ0A 4I2PB 3M2VA 4HH1A 2OGUA 3W2VA 1U4BA 4J9MA 1WNEA 3CO0P 3BN7A 4NE9C 1JLQA 4DDFA 3DNCA 2MJNA 5F8NA 2HWHA 4WFBQ 2QA2A 3JTOA 1SC4B 4CWBA 4DSJA 1X0FA 1UFLA 4P7VA 2LA6A 3JAMU 2HRTA 1B99A 2PT0A 3RBZA 3PJXA 1P8GA 3SI8A 4PG7A 2SXLA 2WRMA 1WG4A 3OFHA 3HD1A 2HFVA 3KLGA 2R3VA 1H2TZ 2MDAA 3RRHA 2HG4A 4LIWA 1IXKA 2R7VA 2HQIA 1HNZF 4ICLB 3OHBA 1OYDA 2HHQA 3Q24A 4GKJJ 4ECXA 1T3NA 3M32A 2GHVC 4RUHA 2MQQA 1NXIA 3ADAC 1NUEA 4PQUA 2B4PA 4LMZA 2ALYB 2VICA 3KFWX 3RU0A 4H4MB 2OEJA 2J0QD 1RAGB 3CCLS 1X5SA 1HNIA 1SI9A 2OPSA 1TUGB 2V9KA 4RNHA 3DI6A 1NJZA 3D5MA 3RTVA 2G0JA 3CCSS 2BOPA 1NH8A 2YWHA 4W4MA 1FNOA 1WC1A 3CC2S 1C0UA 3DMJB 3RR7A 3FBCA 4F4AA 1N56A 3Q83A 2EFQA 3RB6A 4WYLA 4LR7A 1PYTA 3VAJA 4PG4A 1APSA 1HNVB 2LXFA 4LRCA 2D69A 1WORA 2E9TA 3G8QA 3VZHA 2WVBA 3NS7B 3OL6A 3HULA 3SIPB 3M2UA 5ETPA 1XTZA 2OPQA 2MSSA 3EMTA 2MY8A 5J2MA 3QT7A 3TYTA 4P74A 1VQYA 4Q45A 3DOLB 1IJFB 5B0BA 2IDEA
chains in the Genus database with same CATH topology
3HHLB 1HWKA 5DQGA 3H5SA 4URGA 3MM5B 1X5TA 4MKYA 4DQSA 3OXGA 2NREA 1FKOA 2LQJA 4B17A 3N01A 2GGPA 2W4PA 3C3LA 5KFCA 2LU2A 3QLHB 4ZK7M 1R6YA 2V8HA 5I4MA 4DL2A 4LF5F 1SV5B 2K1RB 5L1LA 4IG3A 2EFPA 3OR2B 2X51A 4YHHF 3H5UA 3PIOQ 4ECYA 4KFBA 3M2RB 4XO0A 1JB0C 3OUYB 3MUTP 5KFSA 1SKSA 3GIIA 2M4MA 3M6VA 4Q0BB 3PX0A 2JH3A 5J2QA 2XLKA 1EP4B 1W25A 2DNOA 2KYXA 1S0OA 4RX6A 4F4KA 3M8PA 5EWGA 5DG8A 2JLFA 3CIMA 1Q7LB 3R5AA 1SBRA 3H2VE 1XBWA 2ZOFA 3PM9A 4DJBA 2VFRA 1KFSA 3DLBA 2WONB 1GT8A 4LF4F 1TAUA 4USHA 3UDLA 4IOAQ 1J5EF 4I2PA 4TU9A 4NLRA 3CCVS 2YNGA 4GC6A 3SCIE 2V0NA 5KFKA 4RNOA 4MK8A 1Q53A 4OX7A 3LP1A 4DR1F 1UJ6A 2DH8A 1X8DA 2XI2A 3CJKB 2B9WA 1YJTA 2HLTA 4I67A 3JTPA 4ZCLA 3CCWA 4MFBA 3N9UC 2CZ4A 3OVAA 5AXMA 4QU6A 4YY3F 2EC0A 3HHNB 3R5CA 4IRCA 1SJ4P 5DGBA 2WW8A 5DO2A 4DPOA 2ZH5A 4FS1A 4A8XA 3BO2A 4J5OA 4RNFA 3O5TB 5IT4A 4NLXA 2KZZA 2X1GA 3UCUP 4KR0B 2IAJA 2LVWA 2XMUA 3P5TL 4UOCA 1QAJA 3KK3B 2J5AA 5EX0A 2ZDPA 5EX3A 4DEZA 1CG2A 5FIIA 3KLFA 5F8HA 3SSRA 4DQIA 2VFSA 4NZ6A 2BDPA 4G3IA 5E3PA 5IM0A 4LSNA 2C42A 4FF3A 1FK9A 2I5JB 4C3KA 2LMIA 2RRAA 1RTHA 5E7OB 1C2PA 2HS3A 2LDYA 2CQ0A 2Z8QA 4ZHRB 3LO3A 3ITHA 3BSNA 4OMFG 2BANA 1RT2A 2Y1IA 5L1KA 3I55S 2EW9A 3GV7B 4BBYA 4A8KA 3IS9A 4K4SA 2UU9F 2UXCF 1NNDA 2JLGA 1Y3KA 1Z2ZA 4RU9A 4Y6IA 1DRZA 3TQ1A 2O66A 1TVRB 3Q8PB 1IQZA 2L41A 3DLJA 3PNIA 5L1IA 2RMLA 2W4CA 1NHUA 3LQVA 2CG4A 2MZJA 3UD3P 1VBYA 4LFCF 3NGDA 4X66F 3R1LA 3G86A 1RT4B 4R8UA 3OTOF 3UW1A 2GCFA 5AXKA 3OTBA 2XS2A 3SEOA 1N0VC 5D78A 3H5YA 4N8NA 2HNDA 4AYBD 2X1AA 1S9FA 2JFKA 3JSBA 3OTDA 3QGIA 4CH7A 1TV6A 3DRPB 3I0SA 2I0XA 2O1PA 3NLCA 2JVOA 4F50A 2VKRA 3OTCA 2LEBA 1HQEB 2OO4A 2VZ9A 3OFFA 3UE2A 2N7YA 3G4SS 3KHRA 4C4WA 1VGYA 4ICLA 4CT9A 4WCEQ 1IBLF 2ZH9A 2FUG9 1U1QA 4W92B 2VQEF 2WOMA 2BJEA 1ZZNA 2B6AB 3CIZA 3FCHA 2MGZB 3NNCA 5C24A 1YRXA 2HZCA 3D54A 2R7OA 1R8HA 4JUZA 4A8OA