2OPSB

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
435
structure length
409
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 108
structure length 409
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB02
1KLMA 4WFZA 4KE5A 3MEGA 4LSLB 2IJNA 2IBKA 1REVB 4I7FA 1SH2A 3T5LA 2HNYB 4Q8FA 3JYTB 3V6HA 2EC0A 1SV5A 3RB4A 1TV6B 4QW9A 4LSNB 2HNDA 4IQXA 3BREA 2VA3A 2WONA 1S1VB 2WCXA 1JLGB 3ITHB 2B43A 3NAHA 4DEZA 4F4ZA 5KFPA 3V81B 3PW4A 1TL3B 1SUQB 2YNIB 3IS9A 3BSNA 5J2NB 2BR0A 4DL7A 1GX6A 4IFVA 5C5JA 4ED3A 4ECYA 3CWJA 3M8PB 4J9SA 1JX4A 3NBPA 4NLOA 2FJVA 4Q0BA 1HMVA 4ZVFA 3FRZA 1XR6A 4IOBA 4IH5A 5KFIA 3LP0A 4ID5B 4TYAA 1VRTB 4KSEB 4URGA 4O3PA 2R8GA 5K14A 4TYBA 4QWBA 2R2SA 5F8GA 2UVWA 3NAIA 4KAIA 1DLOA 5DLGA 5KFNA 2XC9A 3RBEA 3KLVA 2FJWA 3DOKB 1LW2B 1R0AA 4PQUA 4MKAA 1QAJA 3FQLA 1TL1B 2W7PA 3SFUA 4ZP9A 1RT1B 1RTDB 3CVKA 3GQCA 1FKOA 1HNVB 5C24B 4O3SA 3GIMA 4J9OA 3KK2B 1CSJA 2RDIA 1HPZA 3KLEA 1S9GA 1U09A 3BSCA 4NLPA 2WRMA 3GIKA 4DG1B 5F8MA 1EP4B 1TVRB 2JLEA 4B3OB 4KB7A 3KLGB 1JLBA 3IN5A 2ZD1A 4YR2A 2XCAA 5L1IA 2FVPA 2HMIA 3GV8B 5KFSA 2ZKUA 3Q8PB 2W8KA 2UVVA 5HBMB 4MIAA 4KFBB 4J9MA 5C25A 2R2RA 3CO9A 4I2QB 4MIBA 3KMQA 1MU2A 4YR3A 1DTQB 4ZVEA 3GV7B 1WNEA 1RT2A 4RW4A 2CJQA 3KHGA 2D3ZA 4JV0A 1TKZB 3C6TB 5DG7A 5L1JA 2XWYA 1JKHA 3QGIA 4F4XA 1N56A 1S1TB 5I3UA 4TN2A 2W9BA 4PWDB 3KHRA 4RNMA 4DL2A 3KK3A 1HQUB 4F4WA 2BQRA 3MR6A 3G6VA 4EO8A 3KJVA 1OS5A 2YNHA 1S0MA 4XPCA 2R2TA 1IKWB 2UVUA 3TAMB 4KBIA 4NRUA 4WFXA 3UR0A 3G6YA 2ASLA 2E9TA 4R5PA 1T94A 2W9CB 1UWBA 1LWFB 4RNHA 4KV8A 5CYMB 2AX1A 2IC3B 2VG6B 3DI6A 3KLFA 2IM0A 4H4OA 3DRSB 3HVAA 5HLFA 2YNFA 4WYLA 3UQSA 2HAIA 4J9KA 1C0TA 1RT4B 3OL8A 1RT5B 4EEYA 4H4MA 4I2PA 3JSMB 3FFIB 2XI3A 3IRXB 4PUOA 4WXOA 3QO9B 2BE2B 3LP2A 4J9LA 4RW8B 3DMJB 1QE1B 5CYQB 4RNFA 4R0EA 1S1UA 4RW9B 3CJ4A 3GYNA 2UVRA 4K4SA 3MTKA 4K4UA 4IFYA 1SH0A 2D3UA 3T5HA 3RB6A 5KFZA 2VG7A 3I0RA 2OPQB 4O4GB 1YVFA 3D28A 4TY9A 1J5OA 2IJFA 3DOLB 1RTJA 1GX5A 4O3QA 5F8LA 3BQ2A 2FVSA 2AX0A 3MECA 2J6UA 1JLQA 2JEIA 3IG1B 3DLEB 4ECQA 3N6LA 3HVWA 5KG0A 3CJ3A 1HARA 3DRRA 5KG2A 3QIPA 3RB0A 1TQLA 4TQRA 1HNIB 4KKOB 1IM4A 4WE1A 1S6QA 3MEDA 3M8QA 2CKWA 4ED1A 3CDUA 1K1SA 5DG8A 3NL0A 1JIHA 3DM2A 3PVXA 4ZHRA 5DG9A 1JLCB 4ED8A 1EETA 1RT6B 1S6PB 3T5JA 1S1WB 2ASDA 1IKYB 1S4FA 3FSIA 1LW0B 1DTTB 4NLGA 3I0SA 4NCGB 5L1LA 4IH7A 4OL8A 4IRDA 1S49A 5KG7A 4WZMA 4KO0A 4WXWA 2I5JB 2V4RA 4ECVA 4O44A 2IM1A 5DQIA 3BR9A 4Y34A 1S48A 3KLIB 4G1QA 1HYSA 3PW2A 4Y3CA 3OSPA 2ATLA 2DPIA 4MK8A 1FK9A 4EYHB 3KK1B 3N6NA 2FLLA 1LWEA 2IMWP 2OPPB 2RF2A 4K4YA 5KG6A 3TQ1A 2B6AB 2JEJA 4EBEA 2YKMA 4ECZA 1RA6A 1JLAA 1S9EB 4FS1A 3DYAB 3LP1A 1LWCA 5HROB 4HKQA 2D7SA 3ICLA 5I42A 4NRTA 3LALA 4IG0B 5J2PB 5EUHA 4IRKA 2IAJB 5EWFA 4QWEA 3V6DA 1KHWA 2ZE2A 4Q43A 3CDEA 3MFIA 3EZUA 2AQ4A 1RTHA 4NLVA 1T03B 1S1XB 5KFXA 3PW5A 1HQEA 3OLBA 1BQNB 4RW6A 2E9ZA 3PR5B 3MR5A 1BQMB 2VG5A 4RNOA 2WOMA 2R2UA 1T05B 1TKXB 5J2MA 1JXLA 3VQSA 3HVTB 2HNZB 5C42A 5KFGA 3E01B 3G6XA 4TY8B 4ZVHA 3DLGB 4LSLA 3RAXA 1C1CB 2ALZA 2C2RA 1REVA 2FLNA 4K4VA 4RZRA 1XR5A 2HNYA 1C0UB 3JYTA 5HP1B 3GILA 3RAQA 2QE5A 3KK3B 1TV6A 3DRPB 4LSNA 2XGQA 2YNHB 5KT5A 1S1VA 1JLGA 3ITHA 1TKTB 5KFVA 3KHHA 4ZPBA 2XGPA 4R5PB 2BQ3A 3V81A 4RW7B 1TL3A 3QLHB 1SUQA 2YNIA 2OPRB 4M95A 5J2NA 2F8EX 3I5BA 4ICLB 1S0OA 4FBTA 4G3IA 1N48A 2JC1A 4ZPAA 4ZP7A 3H5XA 3TVKA 4RUAA 2IM3A 4LQ9A 2W9AA 4EBDA 3OL6A 3DLKB 3V6JA 1SH3A 5KFCA 4PUOB 4R8UB 4ID5A 4ECRA 1VRTA 3BSOA 4ZVGA 3RB3A 2IA6A 4JV1A 4ECSA 2BQUA 2AGQA 3QGGA 1IKXB 1JLEB 1KHVA 2B5JB 4IG3B 4WFYA 5KFEA 4DL6A 2RKIB 1LW2A 3DOKA 5KG1A 5D3GB 4KHRA 1TL1A 4NLRA 1S0NA 1RT1A 1RTDA 3DDKA 3FQKA 3H59A 3IGNA 1HNVA 5FDLB 5C24A 4ZPDA 1QUVA 2VA2A 4FBUA 3KK2A 2FVCA 3I0RB 5KFLA 2HWIA 4Q45A 3C6UB 4MFBB 3Q8QB 1IKVB 1FKPB 1RT3B 4XPEA 4DG1A 5J1EB 4IDKB 4NLWA 1EP4A 1TVRA 2YNGB 1QAIA 4B3OA 3KLGA 1RTIB 2UUWA 4MK7A 4MKBA 1I6JA 4J9PA 3CJ0A 4KHMA 3BSAA 5KFYA 4ZMMA 5KFKA 3BGRB 3KLHB 3OLAA 1C1BB 3OL9A 2C2EA 5KT6A 2W7OA 2GIQA 3MEEB 3H2LA 5HBMA 3QGHA 5F9NA 4Q44A 4DL5A 4KFBA 3PW7A 1N6QA 3RBDA 4I2QA 1RA7A 3KMSA 1DTQA 3KHLA 3H40A 4ED7A 4URSA 4RUCA 2BANB 2XI2A 1TKZA 3C6TA 3V4IB 2YKNB 3CIZA 5T14A 1S1TA 4XO0A 4PWDA 4O3OA 5F8JA 1VRUB 1KLMB 1HQUA 5DGBA 3BQ0A 3MEGB 2UUTA 3H4DA 4I7FB 2BRLA 3PW0A 1SV5B 5DQGA 1IKWA 3TAMA 4K4WA 3OSNA 3KNAA 2HNDB 2W9CA 1ZETA 3UPFA 2GIRA 1JLFA 3SI8A 1LWFA 2WONB 4YR0A 5CYMA 5JXSA 2IC3A 2VG6A 3DRSA 2JEFA 3PZPA 3GIIA 3I5CA 1RT4A 2RF2B 3IS9B 3D5MA 5F8IA 4QWAA 3EPIA 3KOAA 2V4QA 4IFVB 2RDJA 3FFIA 4LQ3A 3IRXA 3NBPB 3QO9A 2BE2A 1HMVB 4Q0BB 4O3NA 3DMJA 1QE1A 3MF5A 3LP0B 3HHKA 3UDLA 5K14B 5KFAA 4RNNA 4QWCA 3QYYA 2FLPA 1DLOB 2AU0A 2WB4A 1R0AB 4PQUB 4NZ0A 5KFQA 3OHBA 2OPQA 4NLXA 4MK9A 4NYZA 4EYIB 2J6SA 5EDWA 1FKOB 3DOLA 1ZTTA 2QV6A 5KG3A 3MR2A 3IG1A 1HPZB 3DLEA 3KLEB 1S9GB 3NGDA 4WYWA 2ASJA 3PJWA 4NLDA 4EBCA 4ED2A 1JLBB 2OPSA 4U6PA 2ZD1B 2XCPA 1HNIA 4KKOA 2IM2A 4TQSA 2AWZA 2HMIB 2FVQA 1S9FA 5L1KA 4ED0A 1RT7A 1N5YA 4O4RA 1XR7A 5C25B 2JEGA 5KFOA 4K50A 1MU2B 1JLCA 5KFTA 1RT6A 1S6PA 2V9WA 1RT2B 1S1WA 1IKYA 4RW4B 4QPXA 3H5SA 3NMAA 5J2QA 1LW0A 1DTTA 4EO6A 3QZ8A 4GC6A 4K4XA 4NLSA 5KFRA 5DLFA 4NCGA 1JKHB 5I3UB 3T5KA 2W9BB 5DQHA 4GC7A 4IR9A 2GC8A 2BRKA 4F4YA 2I5JA 5KT7A 4YP3A 3OHAA 4ECXA 4ED6A 3KJVB 3SFGA 5KFHA 5KFMA 3H98A 3KLIA 1S10A 5EWGA 3BQ1A 4Q8EA 1UWBB 4KV8B 4ZP8A 2R8KA 3KK1A 5KFUA 2JC0A 2OPPA 3DI6B 3KLFB 5KT4A 2V0NA 4H4OB 4NLQA 5HLFB 2B6AA 2YNFB 2FJXA 3M8PA 3PHEA 4ECUA 5KT3A 1C0TB 1S9EA 3DYAA 1D0EA 4DL4A 5HROA 4H4MB 4I2PB 1RDRA 4IG0A 3T1AA 5J2PA 1NHUA 5F9LA 2J6TA 2IAJA 3MFHA 3LP2B 1C2PA 4ZPCA 1W25A 4WZQA 1S1UB 4K4TA 1T03A 1S1XA 2R8HA 4X2BA 4IKAA 3PR4A 5KFFA 1BQNA 1N6QB 4IFYB 2ILYA 3M9OB 4H54A 1BQMA 4K4ZA 2VG7B 1Z4UA 4J9QA 3NKYA 1T05A 2C28A 1TKXA 3Q8RB 3HVTA 2HNZA 4YMEA 3E01A 4TY8A 2OH2A 3DLGA 1J5OB 4J9RA 1C1CA 1RTJB 5F8HA 4ECWA 3MECB 3LAMA 1C0UA 1JLQB 5HP1A 1N4LA 1RAJA 3I5AA 4QWDA 3GV5B 1NNDA 3BJYA 2AGPA 1RYSA 1D1UA 3DRPA 4QW8A 3MR3A 3DRRB 3QIPB 3CJ2A 3Q8SB 1TKTA 4O3RA 4WE1B 2E9RX 1S6QB 4M94A 3MEDB 1JLFB 3M8QB 4RW7A 1TP7A 5KFJA 2WK4A 5KFBA 3QLHA 4F50A 3V6KA 5KT2A 2OPRA 3DM2B 3LANA 4RU9A 3IGVA 4ICLA 4ZHRB 2ILZA 1K1QA 1EETB 2D41A 2W8LA 3FDSA 4URQU 5JUMA 3G86A 3I0SB 3DLKA 4TLRA 4TXSA 1NHVA 4R8UA 2C2DA 2HWHA 5L9XA 4KO0B 3H5UA 4IRCA 3OL7A 4DL3A 1IKXA 1T3NA 1JLEA 5KFDA 2B5JA 4IG3A 4Y2AA 4JUZA 3M9MB 2DPJA 4O44B 2RKIA 3PJXA 5D3GA 2AGOA 2O5DA 4IH6A 4JV2A 5EWEA 4J9NA 4G1QB 1HYSB 5FDLA 2WHOA 4IR1A 4MH8A 1FK9B 1LWEB 3C6UA 4MFBA 3N6MA 3H5YA 1RT5A 1IKVA 1FKPA 1RT3A 1MMLA 5J1EA 4NLUA 3M9NB 4IDKA 3JSMA 2YKMB 4Y2CA 4U7CA 1JLAB 4NLYA 2YNGA 3LAKA 4ZP6A 1RTIA 3LP1B 2WTFA 3ISND 1LWCB 4FS2A 4RW8A 5I42B 2R8JA 5CYQA 3BGRA 3KLHA 4RW9A 5F8NA 1C1BA 3V6DB 4HYKA 1S97A 2OPSB 3MEEA 3QIDA 2ZE2B 4NLTA 3H4BA 3GIJA 1RTHB 2R8IA 2FVRA 2C22A 5KFWA 3E51A 3CJ5A 3T19A 1HQEB 1RT7B 4ECTA 2BANA 1N5YB 3EPGA 4RW6B 3CDWA 1ZTWA 4O4GA 3V4IA 2YKNA 2VG5B 3ISNC 2WOMB 2I1RA 5KG5A 4YQWA 5J2QB 3HKWA 5J2MB 5DGAA 3QZ7A 1RYRA 5KG4A 5C42B 1VRUA
chains in the Genus database with same CATH superfamily
2IBKA 4I7FA 1URNA 3K5LA 2WONA 1B7YB 1NDPA 3NGUA 4QCLA 2Y1JA 5GAHU 4ZIVA 4ECYA 3KWMA 1IN0A 4IOBA 1HNZJ 4LIRA 1SVDA 1PCAA 3KFWX 1LW2B 1TL1B 9ATCB 4I4BA 4EZ6A 3IM8A 1EP4B 1TVRB 4B3OB 3KLGB 3K89A 3MPYA 2V94A 4FKXA 5B0GA 2LQ8A 4DPUA 3KMQA 1FWLA 1MU2A 3DLHA 1UVIA 1K47A 4DV2J 4ALZA 3CTRA 1WWHA 2KI2A 1KVIA 4DPXA 4F25A 3MR6A 2HVIA 1P1TA 5EX3A 3CT9A 4B3RF 1EQMA 1WELA 3QNWB 5HLFA 3ZC4A 3OXLA 2YWFA 3SBMA 4EEYA 3UN2A 4K5RA 4DV4F 5CYQB 2B7CB 5KAKA 2NLWA 1HHQA 3MUMP 4C8KA 1OYEA 5A8WB 3CCWA 3MD1A 1S1WB 4Q2LA 3FSIA 4ZLPA 2ZH9A 1TELA 2IM1A 2LEPA 3PHTA 3TUPA 5HMXA 1CLFA 1VQSA 1QSLA 1M1KT 1Z1ZA 1D8YA 4YB1P 3SSQA 4JI2F 1B0VA 2GFFA 3VQSA 3HVTB 5LXYA 4EFAC 2FJEB 3E01B 3TA2A 1R8HA 3DRPB 1WD6A 2B4OA 4LF9F 1YKWA 2HHQA 1YBAA 1Q8BA 2OPRB 4ZPAA 2GA7A 2LEAA 5DM6Q 3DLKB 3M6XA 2EBEA 1H2TZ 4DCOB 1T9XA 4X4NA 4DV3J 3R7BB 1U25A 1QUVA 3AD7C 5RUBA 1BY9A 1FEHA 3CJ0A 1GMWA 2JNJA 3UNYA 2W7OA 2XS5A 4OI1A 1N6QA 1Q7LB 2L41A 5HO4A 2F4VJ 3C6TA 1WHWA 1FERA 3BQ0A 1RCOB 3CCMS 2G2OA 4I7FB 1TL4A 3UWTA 1PJ5A 1FFSB 4F26A 2EVZA 2WONB 1DAXA 5CYMA 2J9EA 4WIIA 4PPZA 1DQAA 3IXQA 5DJBA 4E2FB 3BN4A 1TU0B 5C2CA 3QO9A 4DQQA 1IBLJ 2IHR1 2UU9F 4USJC 2HVEA 3VGSA 2Y8YA 1R89A 2N82B 1KP6A 2H4YB 1NM2A 4N56A 3C46A 2A2DA 5FIIA 2XCPA 2ALYB 1MROA 2PFDA 4OX9J 1MU2B 3PACA 5G0RB 4DHVA 3JSRA 2HSEB 1Q8KA 3QZ8A 1M5VC 1RJJA 4AXIA 5K8MA 4IR9A 2MMYA 1VK3A 1FCAA 4Z37A 1BGXT 1VISA 1HD1A 4LF5F 5HLFB 4L6V3 2NSCA 2UV8A 2Q1LA 1S12A 2G0IA 4ELTA 4WZQA 4TU8A 4P2XA 4NYPA 1NJZA 1BQMA 1Z4UA 3H0PA 4RUHA 2GAHC 3DLGA 2FZGB 4AD6A 3R9LA 1C0UA 2V5HG 4N76A 5BR8J 1EX8A 3CJ2A 2CUYA 4O3RA 5KFJA 4F50A 2MLZA 3BBBA 1HI1A 3UD3P 4DS4A 4IRCA 3N5BA 3M8WA 5M2RA 2RKIA 2JH3A 3PIPQ 1U6FA 3OPKA 1NJYA 1SJ4P 2HBRB 3EGVA 1YDLA 4FS2A 4DDFA 5F8NA 4NLTA 3J7YU 2Y9HA 3MM6A 4NL5A 4BC9A 4TU7A 1U1PA 4PG6A 2ROPA 3MEGA 1UETA 3T5LA 5B7WA 2P9GA 4RX6A 4ETXA 2HNDA 2LA6A 3EYZA 2UUBF 4IFVA 2XZWA 3GFHA 2PMWA 3BB5A 4CH0S 2KT3A 5DETA 1RLDA 2MKSA 3KLVA 1R0AA 1QAJA 6FDRA 4ZP9A 1QVFR 2X1AA 5AE2A 2RDIA 2HHPA 2VF3A 3P96A 2J7WA 2XCAA 1RAGB 2MYFA 4HHJA 4JI3J 2ZWPA 3ILJA 3PX4A 1RHRB 4ZVEA 3Q83A 2QZ8A 4DSKA 3C6TB 1T9TA 5T41A 3ISZA 4NRUA 4ILLA 2QA4G 2WB1D 2YPZA 1IM6A 5CYMB 1Z2ZA 4I69A 2HAIA 3MCNA 1D9FA 4H4MA 3AA8A 4CWBA 4X4PA 3TAQA 3I9ZA 3QO9B 4L74A 3GYNA 4RBTA 2BJEA 3T5HA 3VR1A 2ZH7A 1U0SA 1YVFA 3W62A 1X4DA 3BDPA 4P2MA 2RNEA 4LRAA 2XYPB 3UDVA 2DHGA 3CJ3A 4DX6A 1MROB 4B02A 2V8HA 5DG9A 1YJ7A 2RU3A 1S4FA 4KH0B 2KFZA 2A2CA 1HR0F 1WG5A 3MWBA 2CPHA 4Y3CA 3U02A 1T9WA 4OHZA 3WIUA 3CCLS 3L3CA 2R7WA 2CQPA 3EE3A 1WF0A 5K8PA 4FYXB 2KFYA 2VJVA 1UVMA 2NREA 1NEEA 2MEWA 1BQMB 3DLGB 3QWPA 2C2RA 1C0UB 1UTAA 2C2KB 2IFXA 3A8JA 1JLGA 4WFNQ 1WC5A 4R5PB 4AE5A 5LMUF 1TL3A 4ZPWR 2RHSB 1PC4A 3RRGA 1I5OB 4RUAA 1M5HA 3BSOA 4Y2MA 2UUAF 2RKIB 3HULA 4JBCA 2UXCF 4ZPDA 3P45B 1ZA2B 3RW7A 3OUYA 2CDRB 2FGOA 3VQTA 3I4HX 3MM6B 4Q5VA 5DDOC 4URSA 2HW3A 2XULA 4CTAA 4JI1F 3CNQP 1D09B 3K57A 3MEGB 5DQGA 1IKWA 3DDIA 1APSA 3CCUS 2HNDB 1LWXA 1WOSA 3BYRA 1HBOA 3JTNA 5GAHI 4IFVB 1T3OA 4JOUA 2BDPA 2JLGA 4EZ9A 3H7HB 5AXKA 4OYIA 5KFAA 2R3VA 3H2UB 2W2NP 3C3LA 2CZ4A 4FF3A 1R0AB 4W4MA 2V8VA 3RUBL 2AYMA 4EYIB 2Z58B 2XQCA 1U0HA 3RRKA 3IG1A 2DEIA 3DRYA 3EMTA 5IT9U 5MLCV 4TU9A 8RUCA 3KG4A 2HRTA 3TR5A 4UY8T 3CD5A 4CLWA 1RT7A 1XR7A 2CJ9A 5I3QA 2V9WA 3HPOA 1I3OB 3H5SA 4EO6A 4MKVA 2A6MA 2BRKA 4PZVA 1NDCA 2LQ9A 4WK3A 2QEXS 4M5KA 2MGZA 4DV7J 3H98A 2YBVA 2DT9A 1L3UA 2V0NA 2B6AA 4LF8F 1KD1T 4DUTA 1M5PC 1MMDA 4H4MB 2XHCA 1DARA 2IAJA 2J6TA 4PKDB 1RI7A 4DSEA 1NLKL 4FF2A 2VDIA 4ECWA 4JP8A 5ETSA 2QN6B 3BGOP 1U45A 2NUUG 2PN6A 1U48A 3TANA 2E9RX 1TP7A 1KQKA 3V6KA 5D4PA 3UDEA 5AJ3J 2X1GA 4NMXA 2JZ5A 1VC5A 4ZA1A 3ZZ0A 2R7TA 2KM8B 3H5UA 4PEOA 1N32F 3GG0A 3M9MB 2UUCF 3G8TA 3HVRA 3H25A 2VQFF 4B9TA 5J1EA 3HFZB 2CAJA 1ICEB 4CP5A 2DHXA 2XLKA 3I6PA 4RW9A 4HYKA 2OPSB 3ELHA 5E3AA 3OD2A 2MQ8A 5KFWA 1N5YB 3EPGA 2Y1IA 3MMBA 3FBCA 3QZ7A 1VRUA 2D1CA 3TVYA 2LXUA 3ENAA 4KGXB 4QW9A 3OFEA 2LU2A 2XWXA 2MKCA 3DNCA 2ZC3A 1JLGB 2I0XA 4M5NA 1TL3B 3EGNA 2K8GA 1VQOS 3LP0A 2OAUA 3R5GA 1EQ0A 5HANA 2QLWA 4NE9C 2VKZG 4OX7A 3GLJA 3OQ2A 4M5DA 2JJ4D 1XMQJ 2CQDA 4F4AA 1UJ4A 1S9GA 3OUYB 4DQIA 1RHJB 3G8SA 3AJ1A 4J9MA 5C25A 1JNZB 5IC4B 3OT9A 3RR8A 2QIFA 4F4XA 2B7BB 4CTAB 3WHIA 3JXOA 4KY3A 1HA1A 1W7WA 1IKWB 4ZJLA 2MJNA 4ZVUB 2AYBA 1HBOB 1RBLA 3QMQA 3IR5B 1NSKL 4BWMA 2W4DA 3D3CJ 4OHXA 3CCES 1CJKA 4CM2A 3IG1B 2N4DA 2GZOA 2HYIB 4PG5A 5HMYA 1TQLA 4UY85 4WE1A 2DITA 3MEDA 3M8QA 3NG8A 2FPHX 2N3LA 2GV1A 3WC2A 1HW9A 1UA1A 4KO0A 1R43A 4LF4J 2MGZB 1GK8A 2Y1LB 2FLLA 2DGVA 2B6AB 4P9SA 4CLPA 2F1FA 1LWCA 2JLFA 4HKQA 1DQ8A 3PO5A 1YTYA 2IAJB 2ZE2A 3PKMA 1FFGB 5IWAJ 4NPOA 1WEXA 4PAAA 2UXBF 4EUVA 2E9ZA 2RT3A 1GH8A 3NGTA 4CT8A 5C2GA 1SXLA 1TV6A 1BD6A 1U2RA 2KG0A 3ETOA 4PR6A 2KG1A 1PJ6A 1N54B 3T9NA 8ATCB 3TQEA 2IM3A 2HFUA 5KFCA 4ECRA 1DZ5A 5J1PA 2BQUA 2GS8A 2EFGA 4KHRA 4G1PA 3D66A 4HI2A 2ZBIA 3U7JA 3M4XA 4P6QA 4DG1A 5J1EB 3GONA 2B9WA 4HHUA 3VGUA 3TJ8A 4NEYA 4J9PA 1FJGJ 4ZMMA 3M1VA 3HMJG 4DL5A 3J7YI 2HVDA 3HJVA 1S1TA 4Y00A 4B3MJ 1IVZA 1VRUB 3EJMA 3PW0A 2A3JA 2VQEJ 2E1MC 2OLWA 3UPFA 4Z7YA 3PM9A 1X7VA 3UR3C 1SC6A 3JAMY 3GIIA 4QWAA 1T8EA 4KHPF 3IRXA 2G1HA 3LP0B 1RK8A 4NI2A 4Y28C 4QBUA 4NZ0A 1CG2A 1FX2A 4M5DB 2GCFA 5B08A 3MR2A 1S9GB 3E8OA 4E0DA 3R27A 1VQ5S 5LSOA 4U6PA 1P9QC 2VPXB 1RWMB 3TW0A 5C25B 1YG0A 1AB8A 1JLCA 6FD1A 1JJHA 3NMAA 4HT7A 3N0VA 1DTTA 2VBZA 1LXNA 5DDRC 1BQXA 1YRXA 5CA5A 2J0WA 2Q43A 3GYGA 3WQPA 4IG0A 3L7UA 2AEFA 1NAQA 3IM9A 1DURA 2R8HA 2DH7A 4LRDA 1FDBA 2XO7A 4K4ZA 1F5BA 1SPBP 1T05A 4ETZA 2D3O1 3TZXA 1CJKB 2MKYA 4LRFA 2CNOB 3HF5A 2FQQB 2ABYA 4DR2F 2E5LF 4WE1B 3LGMA 3MEDB 3M8QB 4JI4F 2BACA 1K1QA 4NX9A 2YX1A 3Q22A 4B9VA 2CG8A 4Y0FA 2EFNA 3N9UC 1U1LA 1DFDA 4KO0B 2BZ2A 4QR2A 1WKLA 4C48A 4J9NA 4QZVB 3WBZA 3F44A 3FCVA 3RZAA 3H5YA 3QSYB 1MMLA 1FNOA 2OEJA 3JSMA 3OV7A 3R2DJ 5HSPA 1LWCB 3UCGA 2BA9A 4JYAJ 3I4PA 1BE4A 4KC5A 4XIUA 3FEXB 3GZ7A 5HJYA 2ZE2B 2ZUAA 2AD9A 4DV1F 4O4GA 3CJ8A 1CBKA 5KG4A 2FTRA 2V8GA 2XMMA 4KE5A 1RWUA 1NK9A 1ZH5A 1UMJA 3RTVA 3RB4A 1TV6B 5A0YA 4WF9Q 4EMDA 2HGNA 4C3KA 1OWXA 3IP0A 2N4CA 4PXBA 4R0JA 3BSNA 3EX7B 4L73A 2LA4A 3TYTA 1MG7A 3Q2SC 3LTOA 2UVWA 3X1LB 3GIMA 1RE1B 2ZJQQ 3M6WA 2RDDA 3RBZA 1KLNA 4DG1B 3L7OA 3M1VB 1H98A 3EZOA 1RT2A 2QX0A 3TA1A 5L1JA 2KJVA 2HZVA 1S1TB 2MZ1A 1U6ZA 2W9BA 1VBXA 2DNQA 2BQRA 4BBYA 3G6VA 4I56A 5A6PA 1UWBA 4FNHA 4U67Q 1R0BG 5FLXU 4DLEA 2IM0A 4NXMF 2RVJA 3S8SA 1Q7YT 2OJ3A 3IRXB 1BLUA 2QMXA 4RW8B 1UEKA 3K5NA 1FRMA 4NI2B 2D74B 2G0CA 1GTEA 3EXCX 3T41A 2K7KA 2E1PA 4EI2A 1GX5A 1CPZA 2HZAA 3TJ9A 4Q7AA 4LR8A 5HK4A 1O6XA 2AJ4A 4TQRA 5A6WA 3JB9k 4B3SF 3DM2A 4UOCA 1JLCB 1DTTB 3THTA 3NGSA 4B9NA 1X9MA 1OPIA 2E1CA 3D1QA 1PYSB 5IT9Y 1VLYA 5ETNA 2XMWA 2EK6A 4NXNJ 4ERDA 3BO2A 3UFCX 4HL9A 4IG0B 5EUHA 3A1YG 2KVIA 4Q43A 3MFIA 2QSFA 4MYUA 3G9CA 3EDRB 1T05B 5D15A 3CCVS 4BDPA 3WIVA 2ACYA 3L9ZA 4LFBJ 1K73T 2IRUA 1S7IA 2DNOA 2LCWA 2RSQA 4FYVB 4TVAB 5KT5A 4M5HA 4I68A 2GVDA 5KFVA 4ZPBA 7AT1B 4KGMA 2ZH1A 3VV2B 1I1GA 2JFDA 1KTVA 2B9EA 2E66A 1JMTA 2BW2A 4RUBA 1VRTA 2C42A 1M1HA 2PIIA 2B51A 3BN7A 4DSJA 1AFJA 5MAOA 2DXEA 1NJXA 1NK7A 3I0RB 3CPWR 3T9ZA 4QYZJ 2CQHA 1V3SA 3CDAA 4MKBA 3IWXA 1Q4RA 4F0KA 1OJ4A 2H5EA 2VONA 1KN6A 1WOOA 2DH9A 1TKZA 2ZH6A 2UV8G 2GW8A 2AV5A 2UUTA 2WSCC 2Z2YB 3BR8A 3EGWB 3TAMA 5A0YB 4K4WA 1Y3KA 1JLFA 5G4DA 2HLUA 2PE8A 2BXJA 2B9YA 2RRNA 1NKEA 3US5A 5CCLA 4WWSA 1NO8A 3BO4A 1XQIA 5KFQA 3FGVA 2OPQA 3W65A 1NUEA 2E5GA 1A9NB 4L76A 3QT6A 2K2PA 1OY9A 1RT2B 2L3MA 3E3XA 1Q86T 3PYEA 2W9BB 1SKSA 4ECXA 2CQIA 4ED6A 2IPOB 3SMZA 4DR6J 3NS6A 3KLIA 3I56S 3NOGA 4Q8EA 1UWBB 2BJ1A 3Q23A 2HQCA 3M8PA 4DL4A 3CD6S 1KBRA 2DGQA 1IWAA 4WBFA 1YJUA 3TZWA 2KRRA 2ZNYA 5M2UA 2MKKA 4DR3J 2QRRA 2Y1RI 1VC0A 3ZXWA 2Q3PA 1QY7A 1RAFB 1TR0A 3DM2B 5IT0A 2ZHAA 2HWHA 3AB4B 2V6AA 1IKXA 3ZZYA 2B5JA 3OR1A 3DN9A 4C98A 3PJXA 4IH6A 5E41A 1RWOB 4MFBA 3M9NB 2WW8A 1UWAA 4ZP6A 1RTIA 3C66A 5E33A 1TFYA 2MQQA 3W9IA 2FVRA 3AOCA 4ECTA 2BANA 2VKRA 2ZVIA 2HFZA 2OD6A 3HP6A 1T11A 4Q8FA 3V6HA 4CNZA 4LVNP 1T0TV 4DX5A 2YVSA 4OYXA 2CPZA 1O0PA 5K5MA 2AJ0A 2ZBPA 3MPDA 4J5OA 1B7FA 1VRTB 1CJVA 4K8RA 4TYBA 4DR7F 2H1YA 1SJQA 1DLOA 5KFNA 3GU0A 1FKOA 4LFAJ 4PCQA 1FX4A 3GIKA 5B0CA 1FWKA 3RAMA 1HNXF 2JLEA 1IXKA 4KB7A 3T6JA 2HMIA 4M63A 3THVA 2VDHA 1N5VA 2XMAA 4DQRA 1TKZB 2ZJPQ 1WTFA 3AAWB 1JKHA 1Y7PA 5I3UA 5HVHA 4LRCA 5CCMA 1QD1A 2VZ9A 2YNHA 2R2TA 4GKKJ 3TAMB 3AQOA 4P10A 2PO4A 4C8NA 3EICA 1O5JA 4JI6J 2X1FA 4WPAA 2F8MA 4K4SA 1G4CA 4KR0B 3MTKA 3R8YA 2OPQB 3TOQA 2CPDA 1YSJA 4DJBA 3CW2C 4JV5J 1Q81T 3PYDA 4HHHA 4PG4A 4QYRA 1RHUB 4ED8A 4ZPVR 2XHWA 2IIHA 4OL8A 2Z2ZA 4DR5J 2XMVA 4DF8A 3NY0A 2V4RA 3BR9A 4EGLA 3PW2A 3KLIB 1KQFB 2H48B 3W8GA 2ZH8A 2IMWP 3G4SS 4FS1A 1DQ9A 4G6VB 3DDNA 5EWFA 4ILMA 3NCRA 4X4QA 1X4HA 4QPTA 2LXIA 4DWIA 3PR5B 1ZYQA 2K7JA 2WVBA 1NKCA 2MLYA 1Y5IB 3DHWC 2MZTA 5C42A 5KFGA 2ALZA 1REVA 1SL0A 3JYTA 2H4WB 3QGPA 4FYYB 2VFTA 2XGQA 4FXDA 2YWHA 4DF4A 1G2EA 5GAGU 1OMSA 3TVKA 4PUOB 4ZVGA 1NDKA 1IKXB 1SQFA 2B5JB 4WFYA 3OR1B 4PYDA 1S0NA 2WAQD 2RHQB 4FBUA 4DI6A 1U8SA 2ZUGA 4MFBB 4USVA 2H3EB 2QL9B 2JX2A 4F02A 1RTIB 5KFKA 3I31A 2BANB 2ZKTA 4QQBA 4XO0A 3TZYA 4C6AA 3CC4S 3FBFA 3I82A 4WP8A 3CE8A 2GIRA 5JXSA 5F8IA 4ZVOB 3MCSA 5A8RA 2HBZB 3TNVA 1MWZA 5D77A 2CQ4A 2ZDOA 3QAUA 1CJVB 2WVEA 1DLOB 2GJIA 3B8HA 3OHBA 1O8BA 1U4BA 3R1LA 1FKOB 3DOLA 2N7CA 2EXUA 2C3OA 4WYWA 2Z30B 4KPCA 1D9DA 3FRYA 1HLWA 4ZVSB 2HMIB 2VPYB 2MLXA 5L9NA 1X4AA 5DLFA 4GC6A 5LXRA 5IS2A 1YITS 1JKHB 5I3UB 3T5KA 2F65A 3PTWA 1FVSA 4X84A 4P72A 4FXVA 2VICA 2DGWA 1S9EA 4QIGA 5J2PA 1VS3A 2VD3A 5D0HA 4RBUA 1SL1A 1RXOB 4ZPCA 1T03A 3C15B 1NK4A 2APOA 2RRAA 4OI0A 4DR4J 1YJWS 3Q8RB 4MTPA 4JI8J 3O6QA 2YY3A 3ILLA 1VQNS 1D1UA 3ZZZA 2XYHB 2LECA 3DOMA 4UOHA 4CO0A 2OEMA 2WK4A 5KFBA 3LANA 3IGVA 1RSCA 2CXEA 1VRQC 2GQCA 4QIEA 1P27B 1IJFB 2DHHA 2EG1A 4IR1A 1YRTA 2QLXA 2KHDA 2OFGX 3VAMA 4NLUA 4IDKA 3Q8VA 2A18A 4OZJA 3EXYA 2FJAB 1S97A 5GAEU 4ANCA 1RLCL 1FE0A 2XNQA 2YX7A 5KG5A 5D4NA 5C42B 3U1LA 3OJSA 1REVB 3JYTB 3DU5A 2SXLA 3UN3A 2BR0A 3IS9A 2MKJA 3UO0A 4NLOA 1HMVA 3FRZA 4IH5A 4KH1B 1R8AA 1VIOA 3OJUA 2XYGB 4MKAA 1G1XA 3VGTA 5DRKA 4I67A 1GT8A 3J7ZT 2B3TB 2BJ8A 2BVZA 2HURA 1UW9A 3MD3A 5KFSA 1WTBA 1FFWB 2F40A 2CJQA 3PYFA 4C8ZA 1N33J 2NXCA 3T1YJ 1TK8A 3RBXA 2DK2A 5F41A 2AX1A 4QR1A 4UZBA 2P5VA 3FJ2A 3SYZA 1FVQA 1C0TA 3TZZA 4USTA 5ETOA 5A8RB 1UCNA 3BS9A 4A47A 4FDFA 1PG5B 3C2PA 3DOLB 2E7VA 3EWGA 5F8LA 2AX0A 3SQOP 2FHJD 2G9OA 2E29A 3HFVA 1WDTA 3HLUA 4LF6J 4RJVA 3KJQB 4RWXA 1TTHB 1DHMA 3MDFA 2R7QA 3VVUA 4BC7A 3I0SA 2WZ1A 2YKPA 1L3SA 4Y34A 1NJWA 4JI7J 2DO4A 2ATLA 1GMVA 4OJ3A 3R5JB 2ZOGA 2QLJB 3TQ1A 2DR8A 3Q24A 4EBEA 2JEJA 1S9EB 3LP1A 3O1LA 5J2PB 2DGUA 3PFOA 3V6DA 2J7KA 3KG1A 1BWVA 4OHYA 2W24A 4DV5J 3GMGA 1T03B 4K0KJ 2XMUA 2W7AA 1URRA 1N36J 4O0IA 1WOPA 4USIA 2XMKA 2FLNA 1XR5A 4UOGA 4CLSA 3DOMB 2MTLA 3ZTQA 2F4FA 4WFBQ 4G3IA 3I5BA 1N48A 3LA0A 2MPUA 1ULRA 5HQMA 1RBAA 4EBDA 4ID5A 3B82A 2IA6A 4CLZA 2IA0A 3M32A 5ETVA 2UXDJ 1A7GE 1LNQA 2DEJA 3K7RA 3H59A 1VQ4S 2HWIA 4C0OC 4PG8A 1I94J 4IDKB 3MEKA 2JVRA 3M2RA 3WX4A 1VQPS 4YEAA 5KFYA 4YHHJ 3OLAA 3OL9A 3QGHA 3PYGA 1DTQA 1KTQA 2OP5A 4I1TA 3VAHA 3U1MA 3OBIA 1H2VZ 2FHKA 1MWQA 1UP1A 4ANEA 3SV3A 4YR0A 3UCUP 3C16A 3Q86A 2BE7D 4FNIA 2RF2B 3IS9B 2B4UA 4DSLA 1HMVB 3UDLA 4ZDNA 3W63A 4MK9A 3J7Z5 4QIFA 4IQMA 2DH8A 3IWLA 3T1HJ 3SSSA 4K7QA 3TEHB 3W2VA 4ED2A 4TQSA 1S9FA 4ED0A 4NWBA 1XMOF 2ATCB 1B0PA 1FNMA 1D3WA 3NWGA 5ETMA 2C3PA 5IQ6A 2EI5A 4CYUA 1WUUA 1KONA 1U26A 1Q82T 2FLOA 2HHHF 2ZHOA 2HVHA 2KL8A 4NZ6A 2OPPA 1HFEL 2H9ZA 5CH7B 4HEA9 1C0TB 3M8YA 1FJCA 3W66A 1F1BB 2R7VA 1T9UA 1S1XA 2FJBB 2VFSA 2JHEA 2PMHA 4PXCA 1ITPA 1G6BA 4TY8A 4J9RA 1C1CA 4C8LA 1ZAWA 4QWDA 3RG6A 2AGPA 2F63A 3S7RA 3T3FA 2HHSA 5LT5A 1RWNB 4YDXA 4OQJA 3W1YC 1H0HB 1RBOB 3BYPA 2J9DA 3FDSA 3I0SB 4TXSA 2L08A 4DN0A 3SSRA 5K8OA 4OYAA 3N5FA 4MYTA 3CC2S 1TUGB 3VVTA 2I2YA 2ZH3A 1Q8IA 1GXUA 2HG4A 4HT5A 1RT5A 2DNKA 3THPA 3CJRA 2QA4S 1QUPA 1ZPWX 3NNCA 3LP1B 5M2PA 3K59A 3V6DB 4C0BA 4HR2A 4CO4A 3QJJA 3ISNC 3V2UC 1RYRA 4GO7X 2WSEC 4A8KA 4LFCF 3RW6A 1U24A 5KFPA 3PW4A 5GAGI 3G71S 3CWJA 2WVFA 2ZH5A 3MZIA 5KFIA 4ID5B 1FEEA 3NGKA 4P52A 3M32B 2XC9A 4J9OA 1U7LA 1RADB 4UTGA 2DIVA 2V8DA 4ZCLA 2M4MA 3R3TA 4P2SA 1PO6A 1HPZA 3KLEA 1U09A 4NLPA 2J9CA 4MIAA 4FXWA 4ATNA 5SZTA 3ZZUA 1DTQB 1XNRF 3MAAA 2KH9A 3KJVA 4WP9A 4N41A 5AXLA 2LYVA 1ZA1B 3C16B 1HNWF 2HLTA 3PXGa 4DMZA 3K5MA 3I9V9 2JOQA 5KFZA 2ZBRA 3CUNA 3P6YC 3NNHA 1RTJA 1SKWA 1FJ7A 1NH7A 2JEIA 4ECQA 2VL1A 5KG0A 5E3RA 1HARA 3W2VB 1MWYA 2PC6A 4ED1A 3BH6B 2BKNA 2DKOB 2XB2D 1U1NA 3Q8YA 2KDOA 4CYUB 2ZITA 3AJ2A 2DNNA 3MOJB 2OPPB 2Y8WA 2YKMA 2YWWA 4DLGA 3CCRS 1HD0A 3EZUA 1RTHA 1S1XB 5DO2A 3CXCR 4B3RJ 3W2WA 4I6WA 2XG8A 4TY8B 4ZVHA 5ETRA 1C1CB 4X62F 4DV4J 4RZRA 2WSFC 4H4KA 3KK3B 4KGZB 1CQMA 2BQ3A 1VGYA 4USKA 4CLYA 3LH2S 3D6HB 4IUFA 4RO0A 4GKJF 1FRKA 4ZP7A 4CO1A 3P49B 4LQ9A 2GHWA 3BV8A 4ECSA 3GJSB 4F2SA 5B0EA 3VAKA 1YHQS 2M52A 2V2ZA 2N7YA 2JDJA 1TUWA 3GJTB 2VA2A 4Q45A 4B9MA 1VOMA 4XPEA 3OTOF 2YQ3A 2W01A 2C2EA 3OTCA 3NXZA 4I2QA 4KT0C 5GAEI 4AL7A 2M5YA 3KMSA 4QYZK 1OY6A 2EFQA 1RB0A 2VODA 3L4BC 5KOWA 2MJUA 2CPJA 2P6SA 3GR0A 2QL5B 3KNAA 1P9YA 2KKHA 4JI2J 4X4TA 3A13A 3DRXA 3D5MA 3C19A 4XK8C 4I6YA 3R5AA 2P2CB 1HBUA 1R27B 3MTJA 4LF9J 5C7PA 4QWCA 1MNEA 3CEDA 4NLXA 1B99A 4C2MA 2VBXA 1HPZB 3KLEB 2ASJA 1M0SA 5AE1A 5LMNF 1Y4ZB 1LK7A 4B9UA 1LW0A 4K4XA 3MAAB 4X65F 2IVYA 5E3QA 1NBEB 3OHAA 3KJVB 3SFGA 1UPMB 3HHLA 1Q16B 5EWGA 4HDHA 1K8AT 3QFHA 1ZM4A 2M9KA 1AROP 1ZAVA 4OZLA 3TUJC 2DJWA 1HBNB 2NPIA 4U7UD 5F9LA 4F8RA 4CLTA 4BHQA 4QIVA 4JI5F 2M8HA 2B4VA 4J9QA 2HNZA 1RTJB 1V3ZA 4DQSA 3LAMA 2UU9J 2G13A 3Q8SB 1KR4A 2KM8C 4J91A 3RU0A 3OL7A 1XMBA 3D0IE 1RWKB 4YUDA 2YKMB 2YNGA 1R7IA 4FPRA 3DLJA 4DPTA 1Q5YA 1RTHB 3G6ES 2R8IA 3PG9A 2C22A 2PFFB 3W2WB 3W5YA 4LF5J 3CDWA 1T9VA 5J2QB 2CNLB 2C1EB 3M2UA 1UL3A 3PRBA 4NA1A 3UW1A 2WCXA 4EWTA 5ETQA 1GX6A 2QYCA 2ZBCA 4N8NA 1TK0A 3ZZTA 2HHXA 4IOCQ 1U2CA 2PGCA 1TL7B 2HPUA 2R2SA 5DLGA 4DN9A 5CD4H 4TLQA 1NK5A 2QJ3A 2R7RA 1P8GA 1EARA 4HDGA 5LL6d 2FVPA 3GWCA 2UVVA 4CT9A 4I2QB 3GV7B 3OR2A 2XWYA 1N56A 4USUA 4RNMA 3W7BA 2Q79A 2ROEA 1OS5A 1XNQF 3UR0A 1X4EA 4M5JA 4FVMA 3KLFA 1H7XA 4QU6A 4QJVA 3NS5A 1KDNA 3OL8A 1YJ9S 1HBUB 4RNFA 3VZIA 4DR1F 1ZS6A 2G4BA 1FDNA 5I3PA 2UUBJ 4OJHA 4FF1A 4TY9A 2J6UA 4PWUA 3RB0A 2E1AA 2OMLA 1WI8A 2BMBA 1X5OA 4OX6A 4TKTA 2RILA 1AT1B 4LR7A 1XEZA 1LW0B 5IV4A 4GVBA 2PD1A 1LKZA 2KXFA 1AXQA 4FVCA 4M5GA 4F0HA 4O44A 4WIQA 3ZTOA 1S48A 3HHLB 4RU2A 4K4YA 5KG6A 3BH7B 1HHTP 4M8LA 5HVFA 4IRKA 1U1QA 3P4UB 1RZMA 3OLBA 3MGJA 5HI7A 4B3TF 2HNZB 3MMAA 2HFVA 4LSLA 1X8DA 4K4VA 3RAQA 4UOFA 1RCXB 4XAKA 4ZLLA 4K5SA 4B17A 3H5XA 4CLLA 2W9AA 3ULHA 4X4SA 2AMCB 4ZCIA 2E7XA 4DL6A 5KG1A 2OKQA 1RTDA 5C24A 5KFLA 4A8YA 1GMUA 4DSFA 3RR7A 2YNGB 4MK7A 1YLXA 1HR0J 2GIQA 1RABB 4YB6A 3IRWP 3H20A 4X64F 3BO3A 3M2UB 2FJDB 5DZ6A 2RS8A 1YIJS 3FEYB 2IC3A 5A2QU 3PZPA 1LK5A 1AW0A 1RHKB 3OW2R 3KG0A 3AFGA 5LMUJ 2AKWB 2AU0A 2A6OA 2FB0A 2RJZA 3LPEA 1ELOA 4DFKA 3NGDA 4U8YA 2CPYA 2UUAJ 4U95A 1RP5A 2UXCJ 4O4RA 5KFOA 2FIUA 3OR2B 4QPXA 4DUZF 1Q8LA 1IBMF 4EK2A 1GXLA 1N8RT 1QJHA 4MIWA 4U7UK 2B56A 2M8DB 3KLFB 1S5ZA 4JI1J 5KT3A 2WVDA 2RUSA 1D0EA 1NZAA 2FY1A 3CMAS 2GIFA 1PYOB 4F04B 4Q2MA 2RRBA 4JI0F 1YJVA 5KFFA 5DDPC 2DR7A 1N6QB 3W60A 2Q6CA 4H54A 1KFDA 2HK3A 5ADZA 3I5AA 2GVZA 3GV5B 3BJYA 1RAHB 3M30A 3K0JA 2PEHA 4ICLA 4CNYA 3CJQA 5E3PA 3FUYA 4GVBB 1BMQB 1CULA 3LWMA 4ZVTB 2F5GA 2VH7A 4IG3A 4O44B 2U2FA 2Z8QA 4CM0A 1B64A 2AHOB 1YWXA 1R3NA 3N4WA 3C6UA 3N6MA 1RT3A 5L8RC 1OY8A 4Y2CA 3J7AN 3J80Y 2YX4A 4FP9A 5BYQA 1X0FA 1OQ6A 1JWWA 4P2FA 2HHTA 1ZTWA 4LF8J 2DO0A 3HKWA 4WFZA 2VFRA 2V2VA 4LSLB 1QAXA 1WKKA 1F2GA 4OV1A 1XN9A 1TMMA 2OTJS 3BDEA 2V4JA 4DL7A 4UQTA 3R7NB 1WC4A 4ZVFA 4USWA 1WF2A 1PGZA 2CQGA 4U9RA 2XLIA 3RBEA 2KN4A 1E6VA 2D3OR 5CZVA 3PIOQ 1RTDB 5IM0A 1SCJB 5C24B 1FNXH 2FHMA 4L72B 1N32J 4OI3A 3HO1A 2VHGA 2UUCJ 4OV6A 4X66F 3FZBA 1NDLA 1UW4A 2KT5A 4DUYF 3JS9A 2VQFJ 1JJ2R 4AFFA 4TN2A 4QR0A 4MMOA 2PA3A 4DL2A 3CJKA 3VALA 4XPCA 1GQEA 4WFXA 3DGVA 2GMHA 2IC3B 4H4OA 2LP4A 3VTIA 2DNHA 3LP2A 4USHA 3CJ4A 4K4UA 2ZZMA 1XBWA 3MM5A 1UVLA 2NPFA 3N6LA 3HVWA 4KRWA 2VC0A 3DRRA 4RR5A 2AIRB 3H42A 4HVZA 1R8PA 2ZM6F 3J81Y 4NLGA 3OTBA 1S49A 5KG7A 3ZFVA 2BW7A 1WORA 1RWPB 2L9WA 5K9FA 2DPIA 1UPPA 4Z2XA 4LF1A 5I42A 3LALA 4ID8A 2HGLA 2JSXA 1HQEA 5DZ7A 2NZCA 2VG5A 2DRAA 1N0UA 5J2MA 5CXTA 2GVZB 2QE5A 3PFEA 2MZSA 1PILA 1MN7A 3ITHA 3M30B 4MT1A 3KHHA 3VAJA 3FC9A 1SUQA 2F8EX 4ICLB 2QG9B 5E2QA 2GAGC 2JC1A 3NEKA 2D9PA 1WDDA 3A12A 4JV1A 1CULB 1WEZA 2BUNA 3RB3A 1J5EF 1EZZB 1AZSA 2EEYA 2PSZA 3QGGA 2AGQA 2V69A 2C2ZB 4IG3B 5KFEA 4DV5F 2FUG9 4PXEA 1RT1A 1OSDA 3DDKA 2DR6A 2ZNZA 1X9SA 3C6UB 1RT3B 4N47A 2CIMA 4E98A 4U8VA 4M5IA 4LF7F 2H5IB 4RUCA 1WKJA 3CIZA 2JWNA 5BYRA 5F8JA 3TP2A 1VQ9S 3GB0A 1S99A 5HJXA 1Q1KA 2UXBJ 1DBDA 1ZETA 1OQ3A 4C11A 1S57A 2XMJA 1MW7A 2V4JB 1RT4A 2ZDPA 2V4QA 2HVZA 3WZ0A 2LDIA 1X5PA 2BEFA 3HHKA 4YHHF 1NU4A 4RNNA 3VZHA 2CWXA 2WB4A 5IM0B 5EDWA 1RKJA 1QTMA 1ZTTA 3DU6A 1FXLA 3OVBA 4BCAA 2AJ2A 3AD8C 5B09A 3EVOA 2DRDA 5B0FA 2QLFB 4ILRA 4NCGA 1UEVA 2CQ1A 1H3DA 2VV5A 1ZM2A 4YP3A 1F6TA 5KFHA 2CPFA 2Y3YA 2KZZA 3K2YA 1X4CA 3A3NB 3BQ1A 3R5CA 3O44A 2JC0A 2F3JA 4H4OB 3PHEA 3R5BA 5A76A 1NHUA 3T1AA 2DNZA 3LP2B 2M88A 3KJFB 3TVZA 5H9FJ 1KS2A 2HGMA 1FTCA 4KHPJ 3MM5B 1SIZA 2OH2A 2X3GA 2VFUA 1YJTA 2HQDA 3DRRB 1IQZA 3AODA 2CVEA 3CCZA 4UW2A 4PXDA 2FC8A 4RW7A 2J7UA 3K8VA 2ZZNA 4I6AA 2M7SA 2ILZA 2MQOA 1JNRB 5E3CA 2F8HA 4URQU 4NYOA 4TLRA 3FMWA 2MB0B 2NXEA 3H8YA 2AGOA 2GHVC 1KSPA 3GSDA 2GO8A 1IKVA 1U0HB 3F56A 1WG4A 1X0PA 1PSDA 1XERA 3ISND 5I42B 5CYQA 3G96A 3CCSS 1HQEB 1RT7B 2UZAA 3JSBA 2VG5B 5J2MB 4DV0F 3PRDA 1RAAB 3Q0AA 2BOAA 3D67A 5T7LA 4NEZA 3ITHB 4A46A 1SUQB 4ED3A 5C5JA 3G2XA 3NBPA 1WC6A 4Q0BA 4TYAA 4URGA 4DR2J 1AZSB 1VMBA 2E5LJ 4DPWA 5CQGA 3NAIA 4JI4J 1RGVA 4NMLA 1RT1B 5D6GA 2CPXA 4MKYA 4N8OA 1W2BR 3ILOA 3D1OA 4ELUA 1NCLA 2BM1A 2QA2A 3B4DA 4B9LA 3RGIA 3GV8B 3LOUA 3OFHA 3CO9A 1WNEA 5ETLA 2AF6A 2X1BA 2D3ZA 3EM1A 2K06A 1EAYC 5ETKA 2WBRA 4IO9Q 5GVQA 4D3GA 1C4CA 3W3SA 2B8PA 3S01A 4DV1J 4C11B 1OIAA 2MZRA 1FRHA 2O66A 3V5RA 3GG1A 2AZ3A 1RT4B 5HAOA 4ZPTR 4I2PA 4P71A 2LQJA 4X4UA 4RW9B 4RWWA 1IBKF 1YGYA 2PA8D 4CH7A 4DOZA 4OMFG 2YH0A 2W25A 3OXGA 2VG7A 3AXMA 3MMBB 3R2CJ 4CLKA 1J5OA 4O3QA 3TAPA 3MECA 1JLQA 2M70A 2XLJA 5KG2A 1Y5LB 1N34J 3MAHA 2V2KA 1Y10A 5IC6B 3NL0A 1JIHA 1EETA 2XMTA 3QT7A 2QSWA 1FDDA 2DB1A 4NCGB 4MJKA 1RWXB 4WXWA 2MKHA 1FF2A 4ECVA 1HIYA 3TARA 3IBCB 3QFWA 4DV6F 4C3MA 3D0HE 2D7SA 1KHWA 3P8BB 1YQHA 4DQPA 2ROGA 3PW5A 1CEZA 3W64A 4NXMJ 1Y11A 3AOBA 2MSSA 3AY0A 2VUGA 3UD4P 1TAUA 1IUJA 1VI7A 4ED4A 4RW7B 3FBEA 5G0RA 4FBTA 3LF0A 1SH3A 1VQYA 4NASA 3Q89A 4B3SJ 5HVGA 2IBOA 2RQMA 2AEJA 3Q8QB 4CRJA 1IKVB 4NA2A 2UUWA 4ER8A 4YY3F 1BC6A 4PYAA 4YOEA 4WP3A 2MHEA 2VOOA 1R8CA 2C3UA 5T14A 4CDIA 4O3OA 1Q79A 1JXVA 3H4DA 4AYBD 4W92B 1YZ7A 2AZ1A 5T7LB 2X7IA 1HI0P 2NS1B 4NA3A 3CCJS 4AQYF 3DXSX 3SXLA 3FFIA 3NBPB 3BGFA 4Q0BB 2MZJA 2BJDA 3HK2A 3DMJA 3MF5A 3IAS9 3KUHA 1YBUA 2DGSA 2FD2A 2P6TA 5E7OB 4WKYA 3DLEA 1P1LA 3E2EA 4F0MA 3R7SB 3I87A 3TX8A 2RAQA 3POTA 3D54A 4NLSA 5THWA 3O2IA 3EDQB 4KGVB 1VBKA 4ENOA 1A0OB 4F4YA 4DPOA 1G3OA 1S10A 3PO4A 2HRYA 2MQPA 2PDAA 3MHYA 2DISA 1GFWB 2QL7B 2C2NA 3ZTPA 3QPIA 5HROA 1U47A 4I2PB 2QC3A 3IAM9 2M2BA 3MFHA 2YTCA 4KTQA 3PR4A 4Z7CA 1S59A 2VG7B 2E5HA 3LPYA 3HX9A 2BV3A 1J5OB 3HZEA 3MECB 1JLQB 2Y0SD 4QW8A 1T7PA 1FT8A 1R6VA 1B70B 1F9FA 2HHVA 1B3TA 1HNZF 2CA9A 4RU9A 2K3KA 1NK8A 1EETB 2LKZA 3VF0B 2L48A 4DSIA 4R8UA 4O23A 1TFWA 5KFDA 4Y2AA 2VBWA 1RU1A 2AJFE 4A8OA 4DV2F 4ZCMA 2RE1A 2CQ2A 3R6GB 4YB7A 3D6TB 2EBGA 3BGRA 3H4BA 3M05A 2DBBA 2CWKA 3T19A 1UZHA 3AXKA 1HKAA 2IJNA 2OTLS 1ACMB 3OFGA 3CIMA 2B43A 4V19X 3SCLE 2BYCA 3N79A 3AJDA 2DNGA 2R8GA 5K14A 2LDYA 5F8GA 4CO2A 3GQCA 4ZVRB 3PX0A 1WC3A 3TEGA 2WRMA 3PNIA 1IWGA 3MM9A 2QGFB 4MIBA 3BF4A 5FD1A 4Y6IA 2ZH2A 2IY5B 1MLAA 3KHRA 2B8QA 2XY5A 3CD0A 4R5PA 2KFNA 1VHIA 1T95A 2YNFA 3U1NA 2IYGA 2F9DA 3PJ9A 3HDSA 4OLOA 3JSMB 3FFIB 5SUHA 4WXOA 1F5AA 1F3VA 2LQBA 4J9LA 1H74A 3DMJB 1S1UA 2UVRA 4YN3B 2F9JA 4EU0A 4OI4A 1ZAXA 2Q66A 5HQ8A 4O4GB 1IR0A 3MOZA 2DGTA 3DLEB 2V34A 2W1BA 3NCPA 4DR7J 2HBYB 3JAMU 3IFEA 2PI4A 2IJRA 1XIQA 1K1SA 4DV3F 4ES2A 3POTB 3NMRA 2DIUA 4BWJA 1KVJA 4V1Ak 2KXHA 5L1LA 4F36A 4IH7A 1HNXJ 3VAIA 4YB5A 4OI6A 1SBRA 3UN5A 2ZEJA 2G2YA 1V9OA 3L09A 3A8EA 2LVWA 2OELA 3N6NA 4DBQA 2F4VF 3ZZPA 3QAEA 1PBUA 1RA6A 4KIAA 5HROB 4NRTA 2COLA 1F60B 1TAQA 1AUSL 2R42A 3MR5A 4A8MP 2R2UA 4NOHA 2DVIA 1YI2S 4DFJA 1J27A 2HNYA 2YH1A 1SIWB 1IBLF 3MM7A 3MXHP 2MXYA 2PI5A 4LR9A 1K0TA 3CD7A 3ENVA 4FYDA 3B6BA 2ZFHA 4R8UB 1FD8A 3Q2TC 1SL2A 5JJBA 1KHVA 1RTZA 1C4AA 3HZGA 2E7WA 3FQKA 2CG4A 4OX9F 1FTRA 1PJ7A 1L5UA 4ANDA 3WX8A 1SB6A 3BGRB 4X4VA 2P8IA 4LF2A 1KRPA 3RBDA 5F9NA 4Q44A 4KFBA 3KHLA 3TRGA 3CJTA 3DKDA 3FZ2A 3K8WA 2CYYA 4PWDA 2CJYB 2QTWA 3VAFA 2MY8A 5HL7Q 1S6OA 3SI8A 2E5JA 2GO9A 2Z2MA 4CLFA 2BE2A 3BBCA 3TUIC 5BR8F 3A3OB 1U49A 4OZ1A 1HBMA 5K14B 3D0GE 2FLPA 2YXLA 3HHEA 4F3OA 4WKRA 5B0DA 2MKIA 3DLBA 3GJRB 1F9HA 4OIXA 4OFZA 2F7VA 4M5MA 2QV6A 2M0GB 1HW8A 1HWLA 1ZBTA 2HQFA 4EBCA 2OPSA 1Q5VA 3MM9B 2GVDB 2HZCA 1N5YA 1IKYA 3AHPA 5KFRA 1HWKA 4GMKA 4KGKA 3MPVA 2I5JA 5KFMA 1CS4A 1SC4B 2X51A 1S6UA 1X60A 2YNFB 2GQ2A 2XTJP 3DYAA 3K17A 1RDRA 3LGNA 3KKFA 3TO8A 1S4EA 1C2PA 1W25A 4L3NA 1S1UB 1S0VA 4IKAA 4ZITA 1DY3A 3O5TB 1TKXA 2WBMA 4YMEA 2DYAA 4RBVA 4C4WA 3ONQA 1RAJA 3RRHA 1WHVA 2HK2A 4ZLNA 1JLFB 2RUGA 3MURP 2HFSA 4GO5X 2EC2A 4R25A 3ZO7A 1NHVA 2CJXB 5D78A 2C2DA 3HSGA 1T3NA 1TMJA 1DRZA 4JI3F 5EWEA 4UQGA 2CQ3A 2J0XA 2WHOA 1UVJA 1F0XA 5KTQA 3R97A 2I38A 1FKPA 3LAKA 6AT1B 3CMES 3KLHA 3BZQA 4J90A 3QIDA 3E51A 1R6YA 3CJ5A 3LW5C 1YJRA 1VYAA 2IDLA 1F5CA 4C8YA 2CJAA 2HNYB 2DXDA 1SV5A 4LT6A 1YX2A 3MM7B 4DFMA 4DEZA 4F4ZA 5DM7Q 2P9EA 2CPIA 4RLEA 3M8PB 2V2QA 4GVLA 4A48A 3JQKA 2KXNB 2DNLA 1KVKA 3FQLA 4LVOP 4CO5A 2HWTA 2H54B 3KUEA 1GNKA 4FZVA 5L1IA 3GYXB 1CQNA 4KFBB 2ZOFA 4LSZB 3TUZC 1FHTA 2OHDA 2BOPA 5JMNA 4PWDB 4YDDB 1Q78A 2RQ4A 1FXDA 4EO8A 3ET6A 2O3DA 2VASA 2UVUA 4KBIA 2E9TA 2XEXA 2MQNA 3W5XA 2R7SA 1VCTA 4DX8H 4HI1A 3MMJA 2BE2B 3W8PA 3D7SB 2V8PA 1HBMB 2V67A 2D3UA 1YBTA 5I4MA 5F3TA 5KOXA 4ZKAA 4A8SA 4HH1A 2MDAA 3NRBA 1NZ8A 3WDOA 4DU8A 2Q6BA 5EHHA 4AT1B 1RUSA 3PEHA 3HSZA 1IKYB 3O8WA 2J0QD 3BPSP 5AT1B 1PKUA 3CCTA 2YQ1A 4JB8B 3QT5A 5LSLA 2I5JB 5CYJA 5DQIA 4M1KA 1CS4B 4DU7A 2YQ0A 3MR7A 1UVKA 3OSPA 3MPUB 3MPWA 3DYAB 2G2ZA 2C2MB 2M3DA 4F2RA 5D8HB 1RAOA 2YKOA 2Z57B 4ES1A 4YS2A 1PAEX 2ZVSA 3CDEA 2AQ4A 2CRLA 4NLVA 2GMJA 4A8XA 1TKXB 1X4GA 4WCEQ 3V4MA 1ZZNA 2YNHB 1FDAA 1S1VA 4ZK7M 1DJ0A 4ZS6A 1JQGA 2VPWB 3OL6A 3QJLA 4F67A 2XSJA 5A8KA 1SJ3P 4NLRA 1XK8A 5HMZA 1HNVA 1VDHA 3UNGC 2JVOA 3KK2A 2O01C 5FLXY 1FKPB 2E44A 3A3PB 4F3MA 1FI4A 3KLHB 2HKEA 2MY7A 2NZ4A 1LEOA 1UZDA 4DV7F 3JQJA 3MCOA 2ZOMA 1P6TA 1WACA 4QU7A 1QVGR 1SV5B 1VJWA 1K9MT 4TNOA 1IBCB 4J37A 2FY8A 3M2VA 3EPIA 1SI9A 3GE9A 2FHOB 1ZM9A 5H9EJ 4DZDA 4O3NA 5D0GA 1QE1A 4CZCA 3CC7S 2Z2LA 2NCKL 3BKTA 1OYDA 1VFJA 1NMEB 5AJ3F 1CJTA 3QRQA 4OYZA 4OX8A 4KKOA 2XZDB 1WJ9A 1X5SA 3OTEA 1VQ8S 3ZNJ1 4K50A 5AE3A 1GAOA 2HAFA 3IC1A 2EFPA 4GC7A 2CQ0A 3HSJA 5K8NA 1VBZA 3ET6B 5HATA 1FESA 3VCDA 4B9SA 1KQSR 2XO6A 2HHWA 4AUKA 4K4TA 2AEMA 1BQNA 3M9OB 5D0RA 5H9FK 3SQGA 3R6LB 3N28A 4ZN1A 2XS7A 1TKTA 3LGHA 1HQ2A 2VJUA 1WF1A 2BABA 4UUWA 3I55S 3IWNC 5ITHA 2U1AA 1XMQF 3W61A 1HL6A 1H6KX 2NUHA 2VBYA 1YZ6A 1XMOJ 1GEHA 5CD4A 4W98A 1CC7A 1N88A 3G82A 1HWJA 2HHHJ 4RW8A 1NPRA 3MEEA 1Y00A 2VFVA 1HWIA 1VQKS 1U1KA 4H4KC 4YQWA 1WHXA 5DGAA 4WU2A 1R0CB 2EC0A 5E5NA 1F2HA 1WSVA 1REGX 1S1VB 3UI3A 2CQCA 2D9OA 2FJVA 1RACB 3HD1A 2LMIA 2CNNB 1XR6A 3MI7X 2BE9B 2KT2A 3RJMB 4KSEB 5CHCB 2XSJB 3DLLQ 5A8KB 4KAIA 2W7PA 1SJ1A 3CVKA 1HNVB 3KK2B 3IA0A 3AA9A 5F8MA 1NK6A 3P5TL 1FJEB 4LF4F 2AT1B 2ZKUA 4LJMA 2IVFB 2W8KA 4PQAA 2DR5A 4JV0A 3PKYA 4OZ2A 4Y2KA 3KTQA 2IRXA 3F0NA 3TX0A 2RS2A 1PBAA 3OXFA 1S0MA 2ZH4A 4Y2IA 5IWAF 1V6HA 1T94A 4DCPB 4WYLA 3UQSA 4FPIA 3GFYA 3M2VB 1HHSA 4C97A 1QE1B 4LFCJ 5DDQC 2G0JA 3ZZRA 2J0SD 3BKUA 3I0RA 3AOAA 1CVJA 3NWRA 1CJTB 1IR1A 4QIWD 2QMUB 4KKOB 4ZHRA 1UJ5A 2CFXA 1EJ7L 3T5JA 2W4CA 1T9YA 4HACA 4IRDA 3PDNA 3HHLC 3SEOA 2B9XA 4IO1A 3GTYX 4PABA 1FJGF 1ZM3A 3LWLA 3ZZOA 4G1QA 1HYSA 1GXTA 1LOUA 4MK8A 1XNRJ 1FK9A 4EYHB 2Y0BB 4S0MA 1N5QA 1M1GA 4LIWA 4CO3A 5HQLA 4ECZA 4B3MF 3ICLA 4AL5A 2N3OA 4QWEA 3IBFB 5E0OA 3TWZA 2VQEF 2LFVA 1N34F 2XS2A 1BQNB 1HNWJ 5LJ5Y 3RAXA 3AB2B 2BJ9A 3SQGB 4ES3A 5BYSA 1TKTB 3V81A 5EX0A 4FF4A 1LV5A 4IOAQ 4C8OA 3P5BP 2OSQA 2GQQA 3D4JA 3KDOA 3EZ5A 1X4BA 2W2QP 3Q8UA 3HHDA 1WC0A 2OEKA 4KQZA 4E8UA 3DOKA 2NXJA 3QJPA 3HT0A 4HH0A 2FVCA 1HI8A 3K5OA 3G82B 4NLWA 3HFKA 1NRKA 1QAIA 2L9DA 1KQGB 2ZWOA 3MEEB 3H2LA 1Q95G 1N52B 1V5IB 2V68A 2OI2A 3VAGA 4ZLJA 2R4FA 3M8RA 2FZKB 3SCIE 4DPYA 1TK5A 5DGBA 1HQUA 2W2PP 2BRLA 2W2MP 3UVJA 1G7CB 3GPAA 3OSNA 5H1SV 3MM8A 2MQMA 3DRSA 2B0GA 3WC0A 3HXMA 4BLGA 4X62J 2Z4PA 4LQ3A 3DCAA 3M8ZA 1Y5NB 2CADA 5F0UA 1SKRA 1WG1A 2KB2A 2YKAA 4GKJJ 2J6SA 1VC6A 3VWSA 2VU5A 2X3DA 4HTIA 2OD4A 3GIRA 2DHAA 2NYHA 2IM2A 2VIHA 3HD2A 1TUVA 1RT6A 1S6PA 2P9CA 4K2XA 3FCWA 3OTOJ 4ITSA 4C8MA 4C9DA 3TJAA 4CI0B 1SJFA 1Y9OA 1YRUA 2DNRA 3NGRA 2FHJA 2FYXA 2BJ3A 1JJ4A 4JYAF 2CQBA 3A8IA 4DCJB 5F3ZA 4ZP8A 2QMWA 5KFUA 1RKIA 5KT4A 2VB6A 4NLQA 2FJXA 1S72S 3R5DA 4MAKA 4ECUA 4OJGA 5IQQA 3BBFA 4P75A 2BBEA 4A8WA 1X4FA 3M2RB 1Y3JA 3KNGA 2QT7A 2QYGA 1RHQB 2C28A 1XTZA 3QT8A 3KOAA 1N4LA 1VIXA 4UT4A 1S77D 4WK1A 3BGLA 2H5JB 3K5PA 3QLHA 5KT2A 4ZHRB 4I0WA 2EKYA 1B0TA 1L3VA 4HACB 3M8SA 5L9XA 5U47A 2CPEA 2J5AA 2QLBB 4OZ3A 5LMNJ 4G1QB 1HYSB 2K1RA 1FK9B 2E1RA 4X65J 2DY9A 4U7CA 2WTFA 2R8JA 1C1BA 5AXMA 1UFKA 2EWHA 3LUYA 2IVMA 1FRJA 4LREA 3SV4A 2DGXA 2A10A 3KYLA 2OSRA 2DD8S 1KLMA 3EVWA 4X4OA 1U8WA 3D68A 1QSSA 2RQKA 1ZZFA 4IQXA 4JI5J 1WEYA 1PIEA 3BREA 3MUVP 5IV3A 1VHFA 3NAHA 1RWVB 4FKYA 3V81B 3M6UA 3U27A 1NHKL 1JX4A 2YWGA 2DRBA 1IQTA 4N7TA 1K44A 4OI2A 3DOKB 4PQUA 3SFUA 5EN1A 2HS3A 4A4JA 2FZCB 1CSJA 5LSRA 3BSCA 1TZ0A 2KU7A 1JLBA 3MAQA 4YR2A 1WC1A 4I64A 3KHGA 1BWEA 5DG7A 2IYIA 4NXNF 2IRYA 3BM7A 2VC1A 2YPYA 1HQUB 2BM0A 3DHXA 4LBPA 3G6YA 3UVJB 1UA0A 3ZNUA 2DY1A 4RNHA 3MM8B 3DI6A 1JK9B 2RD5C 3DRSB 2PMZD 2HRUA 1XC9A 1RT5B 5GMEA 1NPKA 4PUOA 4LFBF 2AJQA 3L95X 3SCKE 4LRBA 3GSIA 1Q53A 3VGVA 3CULA 1QM9A 2XBPA 4IFYA 3MUTP 3X3UA 1RAIB 3HJFA 2XZTB 5LOQA 1U1OA 4ZIWA 4J9VA 3PV8A 2WW4A 3G8QA 2CKWA 3CDUA 1W26A 1RT6B 1S6PB 1QAYA 4N5SA 4WZMA 4P7VA 2LXFA 7FDRA 4OJ1A 3CGIA 3D1HA 1JLAA 4NCAA 4C3LA 5IFMA 3J81j 2HS4A 2R9LA 3CSKA 1S7HA 2ADBA 1XNQJ 4ZJQA 5KFXA 2JFKA 3B4MA 4RNOA 4LBIA 4X4RA 3G6XA 3SCJE 5JVGQ 3GILA 1SJRA 2D69A 2UP1A 4LSNA 5D0EA 4DR1J 3ENWA 1FRXA 3J7A1 1EKRA 2YKQA 2Z56B 5BXIA 3QLHB 4M95A 1JB0C 3NOCA 3IR6B 2RMLA 2MSTA 4KYZA 5D4OA 2CDQA 3F73A 1D8ZA 2EW9A 3SDEA 1H73A 3DFEA 2XGPA 3IGNA 2QFJA 1PAUB 1KFSA 2K1RB 3F41A 3FMBA 4GRSA 1NB2A 3ILIA 4LUBA 2NQPA 3EUNA 1I6JA 1MN9A 1C1BB 3C15A 1LQ9A 3ENQA 4DR6F 1NJIT 2KHCA 3PX6A 2XI2A 2YWKA 2AYEA 2KJWA 5ETPA 1NK0A 2ZHBA 1KLMB 1UVNA 5D4LA 2W9CA 3CF5Q 1KC8T 3PY8A 3OVSA 4B3TJ 4B08A 2LQ5A 2RDJA 1UJ6A 4DR3F 2XM3A 1BHNA 4ZVPB 2OMOA 1A6LA 4PQUB 2MQLA 3HI9A 4OLPA 5KG3A 1UFLA 2JRSA 2DNPA 3H2VE 1JLBB 2AWZA 4KJIA 1IJEB 2FVQA 4AL6A 5L1KA 1KKHA 1ZPVA 3ETMA 2GC8A 2ACMA 4J9UE 1EIYB 1L3TA 2MHNA 2PT0A 3KK1A 3DI6B 3BEGB 2GJ2A 5L46A 4X64J 1MSWD 4WTOB 3AQPA 1EHWA 2J8AA 4OZ0A 3QRRA 4P7TA 4IFYB 4XTTA 2GHPA 8AT1B 1IR2A 4O0NA 4WU3A 4ZN3A 3IR7B 2RH3A 5HP1A 1NNDA 5GADU 4A8FA 3MR3A 2NXNA 3CO0P 2ASYA 4M94A 1CJUA 4P73A 1FO1A 5ETTA 4LFAF 2W8LA 5JUMA 3W5ZA 4WFAQ 2ADCA 3GFXA 1JLEA 5D3GA 5DS7A 5FDLA 3RYLA 2J9DE 4DUZJ 3M7VA 2OO4A 2NXUA 2DXFA 1IBMJ 1JLAB 3DGPA 1EB0A 1V3RA 4GKKF 1JXEA 3KJNB 3OVAA 2WVCA 3V4IA 4DX7A 2I1RA 1F9EB 3FEZA 4JI6F 1WHYA 3TA0A 4JI0J 4LSNB 2VA3A 1AUDA 2CZVC 2AYGA 2E5IA 2C3YA 4J9SA 1KNZA 4O3PA 1AYEA 4QWBA 2EPIA 4JV5F 3SDEB 3R1HA 4HTJA 3C14A 4O3SA 2NSBA 1PYTA 1E6YA 2R7UA 3SZ2A 5B0AA 4F3QA 4UF4A 1RISA 2ERRA 3W9HA 4DR5F 1M5KC 3IN5A 2ZD1A 2O1PA 4C7QA 1RAEB 2YWEA 1L3KA 1NH8A 4FYWB 1ZOTA 4YR3A 3QRPA 1NSQA 1H2UX 1YK9A 1UAWA 3D3BJ 3NS7B 2ASLA 2W9CB 3IBWA 1M90T 3W9JA 3HVAA 2GJFA 2EFVA 2XI3A 3FSXA 3ZTRA 4R0EA 4NCBA 2ZJRQ 2I8EA 3I96A 1RQ0A 2VOPA 1KWMA 1QDUB 1UFWA 3D9BA 1FE4A 2OIHA 3BQ2A 2FVSA 3AH6A 4BS2A 3IMQJ 3QIPA 1IM4A 1S6QA 3PVXA 2ASDA 1H72C 2V50A 1VQLS 4C0HA 1U6BA 1NKBA 1VQ6S 1W2IA 1I51B 4X66J 2DTJA 2EK1A 4PRFA 1RHMB 4DUYJ 3SIPB 2AW0A 3KDNA 3PRVA 3KK1B 3FSYA 2RF2A 4ZCKA 4PG7A 3QATA 2NR0A 3D6MB 1ROFA 2BKOA 1AA1B 2EKNA 1OPZA 5F0WA 5GMDA 2BX6A 5IXUA 2QFIA 4FN5A 4DXLA 1JXLA 3UCZP 1GTHA 5HP1B 4CCHA 2KZMA 4AXJA 1CJUB 2YNIA 1S0OA 5J2NA 3QSIA 2CJKA 2Z0GA 1VQMS 2G1DA 3S6EA 1JLEB 3CMQA 2R7XA 5D3GB 2DNMA 2ZM6J 5FDLB 3T6BA 3HSDA 2CZ9A 1NPPA 1TL5A 2HHUA 2R7OA 2ZC4A 3DGPB 1B4SA 5AXNA 1QSYA 1N0VC 2GGPA 5HBMA 5CAAA 2OFHX 4OHVA 1OSCA 3V4IB 1R31A 3FBBA 4PWWA 7FD1A 3I32A 1LWFA 3PEJA 4OYOA 2VG6A 4DR4F 2HS0A 3I5CA 4G1IA 3MMCA 2CVIA 4JI8F 1QLNA 1XWLA 1BXNA 2DGOA 1UEUA 3LO3A 3QYYA 2QO3A 5H9EK 3C14B 4LBHA 2FC9A 4NYZA 4ED5A 1R8BA 1E6YB 3MMAB 1S79A 1J5EJ 3PJWA 4NLDA 3JTPA 4N77A 2ZD1B 1HNIA 4K2JA 2BJ7A 1O51A 5FJ4A 2CNKB 5KFTA 4CQ1A 4Y65A 4CH1A 2DR9A 3UD5A 3EGZA 4K59A 5KT7A 3M6VA 4LF7J 3CB4A 4ZOSA 1V5VA 2R8KA 3B54A 1PC5A 2HIQA 4OYPA 3A4TA 1SQEA 4L75A 4X2BA 3OTDA 3JSYA 2XSFA 1TKDA 1D9AA 2ILYA 1FRIA 2HIYA 3NKYA 5F8HA 1RYSA 3EVMA 2ZZTA 3QIPB 3FCHA 1S6QB 2MZQA 3FVYA 1SKUB 5CABA 2D41A 4OYBA 4ZVQB 3D2WA 4OYMA 4DL3A 2DHSA 2O5DA 3GFZA 3L7PA 1H38A 4WJBA 2KYZA 2KVQE 5BJRA 3FKBA 3FK4A 3UDCA 2H65B 4KPYA 2EG2A 1N33F 3GIJA 1NSAA 2K3IA 3T1YF 3G87A 2LU1A 2YKNA 1EKSA 2OUGA 4DL0C 1SH2A 2J8SA 5GMKa 2XY7A 3NCQA 4IYQA 3QQCD 3KXDA 1U02A 2FDNA 3C8YA 3O3LA 2AJ1A 2EFOA 2YNIB 5K20B 5J2NB 3NNAA 1SQGA 3CCQS 1X9WA 3HKZD 2KRBA 2NYIA 4F7VA 2LEBA 4LF6F 3VHQA 1FXRA 4XDCA 2FJWA 3MCMA 2GX8A 2C2OB 2H51B 4UUXA 3H90A 1NB7A 2FGCA 2JL9A 5L39A 3Q8PB 2GGPB 5HBMB 2R2RA 4JI7F 1OO0B 5EGYA 4RW4A 1QTNB 2RIJA 1YJNS 1J2VA 1VBYA 3QGIA 2L9NA 2HQIA 3KK3A 4F4WA 1LFPA 4A8QA 3BKFA 2KYXA 4K0KF 4UZCA 1LWFB 4KV8A 1LFWA 2VG6B 1AFIA 1Z2LA 2A1BA 1N36F 1NSPA 4J9KA 3AD9C 3MMCB 4DV0J 2HBQB 5CZXA 2V63A 2V9KA 2I6WA 4D3HA 1SH0A 1X5TA 3RB6A 1X31C 3D28A 2IJFA 4DS5A 4M5LA 2KO1A 4J7CA 3HHLD 3DXBA 1HNIB 4OZNA 2UXDF 5DG8A 2I9SA 4W90B 2DCUB 3ZTSA 3TI0A 3JQMA 4ELVA 2DNYA 1I94F 1S76D 3HCXA 3FNNA 1T02A 4PPDA 1E6VB 5IT4A 2IMOA 1SC3B 1FWPA 1LWEA 1U1RA 5HMWA 3OFFA 4OZ5A 2QA1A 3P3DA 4RPFA 2ZBQA 4HLBA 4RW6A 2HFOA 2WOMA 1CC8A 3GCXP 2W2OP 2LLZA 1M5SA 4OHWA 3DC2A 3CJKB 2A0FB 3BGUA 5L38A 1IBKJ 2B4PA 5GADI 2HQGA 3JTOA 1VR6A 3GCWP 4OYWA 4RKUC 4V19J 1XJWB 1MMNA 1M5OC 3V6JA 5LJ3Y 3T1HF 2HQ3A 2OGUA 4U96A 3KUGA 1LW2A 2HEKA 1TL1A 1FRLA 1U2FA 3GJQB 4DZ6A 2GNKA 1HBNA 1EP4A 1TVRA 2KTQA 4B3OA 3KLGA 4NZ7A 2GMLA 4KHMA 3BSAA 5KT6A 5IZHA 3PW7A 1RA7A 3H40A 4ED7A 4DV6J 4DFPA 2YKNB 1LXJA 2J76E 1FKAF 1N5SA 3NLCA 5J1NA 2RU9A 3IO1A 1NXIA 1VK8A 4ZJOA 1UKUA 2JEFA 3HT3A 3J80U 4CIOA 2W4PA 1FA0A 3QBCA 1U1MA 4LMZA 3D6FB 2POKA 2RB7A 4WTYA 3BPDA 1KEKA 5A8WA 1VQ7S 3LQVA 5IOLA 1BUXA 4G65A 1JJCB 2VPZB 2XY6A 2JEGA 1S1WA 4RW4B 5J2QA 3GR1A 3A8KA 3ADAC 2DCLA 4YY3J 5DQHA 1GMWD 3CDBA 5LM7E 2O67A 9RUBA 3UE2A 3K58A 1KOHA 2BKPA 1RWWB 1SC1B 3GP9A 4KV8B 4USMA 2RQCA 4L3KA 1VJQA 1WSRA 2XNRA 3N01A 3PCOB 2AP6A 1TL7A 1K0VA 4XDDA 1N5TA 1Q0NA 1H7WA 3HM9A 4AQYJ 5HN0A 4CLUA 3HVTA 2C3MA 3E01A 5JVHQ 2IDEA 2PEBA 4P74A 3DRPA 4F4KA 2CJBA 3HHNB 4YFUA 1Y0HA 1KOOA 2OPRA 3G86A 1WI6A 3B78A 3DLKA 1RU2A 3AT1B 4JUZA 2DPJA 4JV2A 4MH8A 1LWEB 4RL1A 1F3FA 4QOTA 5A2QY 4NLYA 1HWUA 1FD2A 2HFNA 5B0BA 3J81U 1VLOA 4RW6B 2WOMB 3CJSA 3NP5A 3QWUA 3S1TA
chains in the Genus database with same CATH topology
4WFZA 2VFRA 4LSLB 1QAXA 2IBKA 4I7FA 4Q8FA 3V6HA 4CNZA 5E5NA 2EC0A 1URNA 1F2GA 3K5LA 4LVNP 4OV1A 2YVSA 2WONA 1S1VB 3UI3A 1XN9A 2OTJS 3BDEA 2V4JA 4QCLA 2CPZA 2Y1JA 5GAHU 1O0PA 2CQCA 5K5MA 4DL7A 4UQTA 2AJ0A 4ECYA 2D9OA 3KWMA 1IN0A 2FJVA 4J5OA 2LMIA 4ZVFA 1XR6A 3MI7X 4IOBA 1B7FA 2KT2A 1VRTB 4KSEB 5CHCB 4TYBA 1WF2A 4DR7F 2XSJB 1PGZA 3DLLQ 5A8KB 2CQGA 1SJQA 4U9RA 2XLIA 4KAIA 1DLOA 4LIRA 5KFNA 3RBEA 3KFWX 2KN4A 1E6VA 1LW2B 2W7PA 2D3OR 1TL1B 5CZVA 1SJ1A 4I4BA 3PIOQ 4EZ6A 1RTDB 3CVKA 5IM0A 1FKOA 1HNVB 5C24B 4PCQA 3KK2B 1FNXH 3IA0A 3GIKA 5B0CA 3AA9A 2FHMA 5F8MA 4L72B 3RAMA 1EP4B 1TVRB 2JLEA 1IXKA 1NK6A 4B3OB 1HNXF 4KB7A 3KLGB 3P5TL 4OI3A 3HO1A 1FJEB 4LF4F 3MPYA 3T6JA 2HMIA 2V94A 4X66F 4LJMA 2ZKUA 3FZBA 5B0GA 2IVFB 4M63A 4PQAA 2W8KA 3KMQA 1UW4A 2KT5A 3THVA 1MU2A 4DUYF 2DR5A 3DLHA 1N5VA 1UVIA 4DQRA 4JV0A 4ALZA 1TKZB 2ZJPQ 3CTRA 1WTFA 3AAWB 1JKHA 1WWHA 2KI2A 1Y7PA 3PKYA 1JJ2R 4AFFA 5I3UA 4TN2A 4Y2KA 3KTQA 1KVIA 2IRXA 4QR0A 4MMOA 2PA3A 4DL2A 3CJKA 2RS2A 4F25A 5CCMA 3MR6A 3VALA 2HVIA 2VZ9A 1P1TA 3OXFA 2YNHA 1S0MA 4XPCA 2R2TA 2ZH4A 3TAMB 1GQEA 3AQOA 4WFXA 4Y2IA 5IWAF 1V6HA 1T94A 5EX3A 3CT9A 2GMHA 4B3RF 2PO4A 4C8NA 2IC3B 1WELA 4H4OA 4WYLA 5HLFA 1O5JA 3UQSA 3VTIA 3ZC4A 3OXLA 2YWFA 3GFYA 2DNHA 3M2VB 1HHSA 4C97A 4EEYA 2X1FA 2F8MA 4K5RA 3LP2A 4USHA 4DV4F 5CYQB 1QE1B 3CJ4A 2B7CB 4K4SA 4KR0B 5DDQC 3MTKA 4K4UA 3ZZRA 5KAKA 2ZZMA 2J0SD 2NLWA 1XBWA 3MUMP 3I0RA 2OPQB 3MM5A 1UVLA 4C8KA 3TOQA 2NPFA 1CVJA 2CPDA 3N6LA 1YSJA 3HVWA 4KRWA 4DJBA 2VC0A 3DRRA 5A8WB 1Q81T 4QIWD 3CCWA 4KKOB 3MD1A 4HVZA 1R8PA 4PG4A 4QYRA 4ZHRA 1UJ5A 2CFXA 2ZM6F 4ED8A 4ZPVR 3T5JA 1S1WB 3J81Y 4Q2LA 3FSIA 4ZLPA 2W4CA 4NLGA 2XHWA 3OTBA 4OL8A 4IRDA 1S49A 3PDNA 5KG7A 3HHLC 2XMVA 3ZFVA 4DF8A 3SEOA 2B9XA 2ZH9A 4IO1A 2V4RA 1FJGF 1ZM3A 2IM1A 2L9WA 3LWLA 3BR9A 3ZZOA 4EGLA 5K9FA 3PW2A 3KLIB 4G1QA 1HYSA 1GXTA </