2OPSB

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
435
structure length
409
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 108
structure length 409
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opsB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opsB02
4QW8A 3BGRA 4GC6A 4RW4B 5C25B 5DLGA 2HNZB 1RA6A 2VG6A 2HAIA 3OL7A 3RBEA 4QWEA 1IKXA 4TY8B 2BR0A 4EYHB 1TVRB 3IG1B 4QWBA 3TQ1A 2W9AA 4QWCA 4I2PA 2HNDB 2ATLA 4RUCA 5K14A 5J2QB 1Z4UA 3OLBA 1BQMA 4ECXA 3V6JA 2UUWA 1HNIA 1IKYA 4NRTA 4I2QA 3BSAA 3KJVB 1JLGB 3V6HA 3PJWA 1RT7A 4TY9A 3FFIA 4Q8EA 4ZPBA 2YNHA 1LWEB 4J9QA 2ZE2A 5KG4A 1C0UB 3DYAB 4YR0A 2ZKUA 1S9EA 2AGPA 1FK9B 4ZVHA 4J9NA 5KFYA 5KFKA 5J1EB 2YKNB 4MFBB 4NLGA 2E9RX 2OPPB 4XPCA 1FKOA 3M8QB 1S97A 2FJVA 1RT6A 4RW8B 5HLFB 5KG1A 2UVVA 2D7SA 3KHGA 4MKAA 1XR5A 3OL8A 3NGDA 3I5CA 5I3UB 3H5XA 2FVCA 4K4XA 3H4DA 4I7FB 4RW9B 5KT3A 4DL2A 3MEGA 1EETB 3RB3A 4J9KA 2B5JA 2E9ZA 4WYLA 3DLEB 3QGIA 2W8LA 1K1SA 3NL0A 1N4LA 3UR0A 3FQKA 3MFHA 2V4RA 4IRDA 1IKYB 1JLQB 2B43A 3HHKA 1RT2B 4ID5B 3M8PB 5HP1B 3KJVA 2F8EX 2YNFB 3G6VA 4EBEA 4ED7A 1ZTTA 4NCGA 1DLOA 1TQLA 4MK9A 4IR9A 1C1BA 4F50A 5D3GB 1JLBA 1S10A 3I5AA 4ZMMA 2IJFA 2W8KA 1JLAA 4URSA 4ECTA 1IKVA 1RT3A 1N5YA 1HQUB 3QZ7A 2HNYB 2IC3B 4MFBA 5HBMB 4TYBA 2OPPA 3HKWA 4F4ZA 3CJ0A 1MU2B 2VG5A 2BE2A 5DQHA 4JUZA 3UQSA 4O4GB 5F8LA 3KK1B 4X2BA 3IS9B 3PW2A 4O3NA 1RT6B 5HLFA 2V4QA 3PW0A 5J2PA 1LWFA 1RTJB 4H4OA 4KV8B 4RW7B 3JSMB 1SH3A 4H4MB 1RTDB 2AGOA 1VRTA 2C2RA 4TYAA 3GV5B 1LW0B 2ZD1B 3GIKA 3G6XA 2EC0A 5CYMB 5J2MB 3MECB 1RAJA 3Q8SB 4LQ9A 4Q43A 3KMSA 1S6PA 3EPIA 3KLGA 4ED0A 3QIPA 3CDUA 1YVFA 5F8JA 1S1TA 1TL1B 1RT2A 2IM0A 2I1RA 2YNFA 4RW4A 3M9MB 5KFTA 4NLYA 4NRUA 2XCAA 2DPJA 3PJXA 4EO8A 1TVRA 1DTQB 3DOLB 5DGAA 4I2PB 1XR6A 4Y2AA 4RUAA 1JLAB 4B3OA 4IRCA 3MEEB 3V4IB 3LAKA 3DI6B 4PUOB 3I5BA 1S1VB 2RDJA 1TKXA 4J9RA 3MFIA 1TP7A 3LP2B 2VA3A 4EBCA 1JXLA 1S9GA 1S48A 1ZTWA 3IS9A 2GC8A 4ED6A 4Q0BA 4MKBA 5F8MA 3LALA 3H5SA 4NLOA 3Q8PB 4Y3CA 4RW7A 2R8HA 2HWHA 3DLGB 3KLEA 4J9MA 4FS2A 5KFNA 5FDLA 3RB0A 5C24A 3DRRA 4TLRA 4ZP9A 4EEYA 3PW4A 1W25A 4IR1A 4U6PA 3C6UA 3N6NA 3KK3B 3Q8RB 4TN2A 4FBTA 1C0TA 1EP4A 3BGRB 3PHEA 5KFVA 3M8QA 1N6QB 3FRZA 3TAMA 3KK2B 4WFXA 1TL3B 2UVRA 4RW8A 1T03B 3QIDA 5JUMA 4O44B 4XPEA 4NLWA 4J9OA 1RTIA 2OPSA 2V9WA 4ECUA 1T05B 4IH7A 4WXWA 2JEIA 3DOKA 1OS5A 5KT2A 2AGQA 1HQEA 3I0SB 4H54A 5L1KA 2ASLA 1EETA 3C6TB 3ITHB 4YP3A 4DL7A 2WRMA 5KFQA 5KT6A 4QWAA 2J6SA 4O3OA 2WONA 4Y34A 1N56A 1TV6A 2YNHB 2BRKA 2O5DA 5L1IA 3DM2A 1T94A 2ILYA 4ZPDA 1HMVA 1S9FA 1TKXB 3KLHA 3D5MA 4NLDA 5KFZA 3RBDA 3DRSB 4URQU 2WB4A 5J1EA 2BANB 2FJXA 3CJ5A 2I5JA 1RA7A 4WYWA 2R8JA 2BQUA 3LP1A 4DEZA 3SFUA 4IH6A 1S1XA 3GV7B 3G6YA 2YNGB 4MK7A 1NHUA 2AWZA 4ECZA 4Q45A 5HROB 3FQLA 1QE1A 1UWBA 1KHWA 1N6QA 2WCXA 5KFXA 4DG1B 2FVQA 1JKHA 2R8IA 2UVUA 2UVWA 3H5YA 3GILA 5KFGA 1RTJA 4KV8A 4O44A 3JSMA 1LWCB 2JC0A 1RTIB 2OPSB 1C2PA 5KFCA 3LP0B 2GIRA 3DMJA 2R2RA 2IAJA 2HWIA 4ICLB 4KO0A 2AX0A 5KFHA 5KFJA 5DGBA 4KFBB 5I42A 5DG8A 2W9CB 3I0SA 2IMWP 2QE5A 4TQRA 4IRKA 4PQUA 4K4ZA 1TKZA 1QAIA 4K50A 4KAIA 1RDRA 4IDKB 4M95A 5D3GA 3QIPB 1S1TB 5K14B 5J2QA 3KLHB 4ZP6A 4RZRA 1ZETA 1J5OA 1RTHB 4NLQA 4ZVFA 1KLMA 5C42B 1DTQA 3DOLA 2BE2B 2RF2A 3QYYA 3I0RB 4Y2CA 4IFVB 3MEEA 4JV0A 4WZMA 3DI6A 5F9NA 1LWEA 4RNMA 4F4XA 4KKOB 1C0UA 1HNVA 5KG2A 4ECVA 2IM3A 2XI2A 3N6LA 4LSLB 4IG0B 3LP2A 4LSNA 5EWEA 2JEJA 2BRLA 2YKNA 3IGVA 2HMIA 1IKWB 2V0NA 5J2MA 5KFDA 1HYSB 1TKTB 3QO9A 3OHBA 1SH2A 3FDSA 2WTFA 2WHOA 1FKPA 5KFMA 5KT7A 5C24B 3NAHA 4ED2A 3T5JA 1T3NA 1S6PB 4O3PA 2C2EA 3KLGB 3QGGA 2WOMA 1D1UA 4ZHRA 3JYTA 1RT1A 2IM2A 5JXSA 2R2SA 4F4WA 4I7FA 4RW9A 4OL8A 5J2NA 3BREA 2QV6A 1S0OA 4G1QB 2JEGA 4MH8A 3V6KA 2DPIA 3MR6A 4ECQA 3KLFA 5KG7A 3DLEA 3NAIA 3QZ8A 3BSNA 4XO0A 3IRXB 3V4IA 1S1WA 4IKAA 5KFOA 2RKIA 1QAJA 5KFUA 3KLIB 4RU9A 5C42A 3G86A 4K4SA 4ID5A 5HP1A 1IM4A 3C6TA 1S9GB 4NCGB 2R2TA 3CO9A 3GIJA 2R2UA 3SFGA 5F8IA 3OHAA 3E01A 2IJNA 1RT4B 3KLVA 4URGA 1BQNA 3CVKA 3H4BA 3RAQA 3H40A 1VRUB 1SUQB 1LW2B 3NBPB 3DM2B 1NHVA 3DLGA 3KLEB 3T5HA 1HNVB 3DRRB 4LSLA 3EZUA 1JLEB 4YQWA 2YNIB 1DTTB 3DLKA 5HBMA 3LAMA 4Q44A 2I5JB 3IN5A 1IKWA 4IFYA 4KHMA 1TKTA 4ZP7A 1HPZB 3KK1A 1FKPB 2ASDA 1T03A 1K1QA 3UPFA 4PWDB 4H4OB 5KFIA 4H4MA 3JYTB 4K4WA 5HROA 3EPGA 3DOKB 4IQXA 1UWBB 3CIZA 1JX4A 4LQ3A 1IKXB 4TY8A 3TVKA 3ITHA 3FSIA 2HNDA 2RDIA 2W9BA 2FLPA 2WONB 5EDWA 4DL6A 1TV6B 2RKIB 2D3UA 5F8GA 4ICLA 4KO0B 2AX1A 2OPQA 2XI3A 4I2QB 3PR4A 2YKMA 4HKQA 4IH5A 1S1UB 1JLGA 4WFZA 3DRSA 1RT7B 3CDWA 4TQSA 5KFAA 3E01B 5L1JA 3LANA 1REVB 5CYQA 3V81B 1R0AB 1C1CA 4MIAA 2C2DA 3DYAA 3RB4A 3PVXA 1JLEA 1RTHA 1DTTA 1S4FA 2FLLA 3DLKB 1S1VA 4GC7A 1SH0A 1I6JA 4ZVEA 1XR7A 3BQ2A 4R8UA 4FBUA 1QE1B 4RNOA 3I0RA 4J9PA 4DG1A 4ECSA 5KG5A 3CJ4A 4Q0BB 3CJ3A 4EYIB 3ISND 3UDLA 2C28A 3ICLA 2OH2A 1JLCB 1SV5A 3H2LA 4K4YA 5FDLB 5I3UA 4EO6A 3BQ1A 3DMJB 4IG0A 3ISNC 4LSNB 3PZPA 2IAJB 4IG3A 3KK3A 3BQ0A 3MEGB 1C0TB 1EP4B 5EWFA 5EUHA 2VG7A 1HYSA 3KK2A 1JLFA 2AQ4A 2W9BB 5KT5A 3V6DA 1S6QB 2JC1A 5C5JA 3T1AA 3KHHA 3MR5A 5DQGA 2BQ3A 2OPQB 3MEDB 3M8PA 2YKMB 3T19A 1RT1B 1J5OB 2JEFA 5C25A 3GIIA 2VG6B 1KLMB 4RNNA 5DG7A 4DL3A 1RT5B 1RYSA 3QLHA 4K4VA 4J9LA 2B6AA 3PW7A 4DL4A 2RF2B 2J6UA 3KLFB 1C1CB 5KFWA 2R8KA 4M94A 3GQCA 1RT3B 4WXOA 2FVRA 3VQSA 1S1WB 5L1LA 1HNIB 4QW9A 3KLIA 2CJQA 4JV1A 5DQIA 5F8HA 4EBDA 5KFPA 3DDKA 2BANA 3SI8A 2HMIB 1BQNB 4KE5A 4KHRA 1LW2A 1JLCA 1SV5B 2JLEA 3QO9B 4KSEB 3BR9A 5F9LA 3OSNA 5EWGA 1S9EB 3E51A 2ILZA 3GIMA 1S1XB 2YNIA 3BSCA 2WOMB 1LW0A 2ZD1A 4ZVGA 4ZHRB 4R0EA 3DRPB 4R5PB 3CDEA 2AU0A 2HNZA 1FKOB 4IFYB 1S0MA 5KFLA 4ECWA 2FVSA 4DL5A 1JLFB 4G1QA 5KG6A 5KG3A 3MR2A 3KHLA 3IG1A 4PWDA 2WK4A 5KT4A 1TL1A 3M9OB 3MEDA 3LP0A 3H59A 5L9XA 3IRXA 4TXSA 3MR3A 2W7PA 1RT5A 4KFBA 4WE1A 5I42B 4RW6A 1S49A 3NMAA 3IGNA 3GV8B 2B5JB 2J6TA 4Q8FA 4PQUB 3HVTB 1TKZB 1D0EA 4B3OB 5KFFA 4FS1A 5F8NA 4NZ0A 4IDKA 3HVAA 5DLFA 1VRUA 2OPRA 1JLQA 3NBPA 2ZE2B 2GIQA 2UUTA 3MTKA 1NNDA 4QWDA 1GX5A 2FLNA 1S1UA 4MK8A 3OL6A 2BQRA 1FK9A 1U09A 3NKYA 1KHVA 4ED1A 3HVWA 2D41A 3CJ2A 4ECYA 3BSOA 5T14A 2FJWA 1JLBB 3H5UA 5DG9A 4O3QA 4NLRA 2C22A 3M9NB 2R8GA 4O4RA 3KMQA 1HPZA 4NLVA 4IFVA 4WFYA 1HARA 4NLPA 1RYRA 1N5YB 1JIHA 2CKWA 2E9TA 4KKOA 3OL9A 4MIBA 2D3ZA 5KFBA 3DRPA 4R5PA 4R8UB 4YMEA 2VG5B 3QGHA 1S0NA 4ZPCA 3TAMB 2XGQA 4KBIA 1TL3A 4K4UA 5KG0A 2XGPA 1LWFB 4O3SA 3CWJA 3KOAA 1T05A 4HYKA 4G3IA 1VRTB 4RNFA 4RNHA 4F4YA 1MMLA 2ALZA 2VA2A 1HQEB 4WE1B 2XCPA 4RW6B 4NLXA 5CYMA 3H98A 3MF5A 2W7OA 1DLOB 3T5LA 3HVTA 2FVPA 3KHRA 5J2NB 1CSJA 1C1BB 4NLSA 4YR3A 1REVA 5CYQB 2OPRB 3V81A 1R0AA 3D28A 4ED8A 1HMVB 2IM1A 4ECRA 4NYZA 1BQMB 1IKVB 4ZPAA 2IBKA 5KFRA 1HQUA 2HNYA 2IC3A 3Q8QB 3BJYA 4O3RA 3QLHB 2XC9A 1MU2A 2B6AB 3KNAA 4O4GA 3PR5B 4NLUA 3FFIB 3LP1B 4IOBA 1GX6A 1RT4A 4ZP8A 4U7CA 5J2PB 4PUOA 1SUQA 4WZQA 2YNGA 3OSPA 4JV2A 1RTDA 3GYNA 4J9SA 4IG3B 4KB7A 1JKHB 2IA6A 4YR2A 1WNEA 3PW5A 3T5KA 2VG7B 3MECA 4QPXA 1LWCA 2XWYA 3RB6A 5KFSA 3N6MA 4ED3A 3RAXA 3V6DB 5KFEA 3OLAA 1S6QA 2ASJA 4K4TA 1N48A 1QUVA 3C6UB 2W9CA 4NLTA
chains in the Genus database with same CATH superfamily
3D0HE 1FDDA 4QW8A 4ZIWA 3OUYA 1SL0A 5C25B 2KFZA 3OL7A 3R5JB 2BJ1A 1X0FA 4EYHB 4O0NA 2YKOA 4UOHA 1IBLJ 4QWBA 1CLFA 4QWCA 2ATLA 2C3YA 4V19J 1B4SA 2LFVA 1WHWA 3Q0AA 4ECXA 1SIZA 3GR1A 1Y7PA 2GMJA 1HNIA 2UUWA 3GSIA 4JI1F 2RUGA 3ZZTA 4DX7A 3KJVB 2MMYA 2IJRA 3D66A 4X66F 3CDBA 3V6HA 4EZ6A 5E3PA 1D8ZA 1Q1KA 1RT7A 3MM6B 4OZLA 1FJGF 4Q8EA 2QN6B 1Y5LB 2Y1LB 3G9CA 1CQNA 2NUHA 3K5MA 3ZZZA 1LWEB 1Q95G 1FO1A 4L6V3 5KG4A 2QMUB 3HFZB 5GAGU 1EARA 2R7VA 4JI0J 5H1SV 4J9NA 1IXKA 1WJ9A 2M5YA 5IC6B 4D3GA 5L38A 4RR5A 1I94J 1XBWA 4A8KA 1XNQJ 1B7YB 5M2RA 4C3MA 3AJDA 1RT6A 2MY7A 2UVVA 4P9SA 4JI5J 2G4BA 2GX8A 3FCWA 1IVZA 3ZFVA 2BE9B 3KUEA 3IR7B 4X65J 2LA4A 2N3LA 1WF1A 4KGXB 1H2TZ 1M5KC 5FLXY 2YKQA 4DCOB 1T9XA 3RB3A 4AL7A 1EIYB 1N88A 4IQMA 4KPYA 2JFKA 2QYCA 3QGIA 2W8LA 3FQKA 4E8UA 1YI2S 2AP6A 4IRDA 1IKYB 1I51B 1GTHA 6FDRA 1MWQA 4ID5B 3FBCA 3G6VA 1U1OA 3A3NB 4L74A 4C0BA 1ZTTA 1NDLA 4NCGA 1FX2A 2MZQA 2Q1LA 1OPIA 1TQLA 2RU9A 5F3ZA 4DUZJ 2E5GA 3M30B 3M8ZA 4ZCIA 2B4VA 1WOPA 3DHXA 4LRCA 1G7CB 1NO8A 2BUNA 2P6TA 3HFKA 5D4OA 3R1HA 1DFDA 1S57A 4ECTA 1IKVA 4A8MP 4CLTA 1WI8A 1FRMA 2CXEA 4I0WA 4OZJA 3WBZA 3QZ7A 3NMRA 4MFBA 5HBMB 4KGMA 4TYBA 3HKWA 5HK4A 2XO6A 4WFNQ 4F02A 2QA1A 4ZLPA 1NSKL 3MURP 2BE2A 1RABB 4K2JA 4TLQA 4USHA 3W63A 1WORA 1RHJB 3CJKA 4YB1P 1XEZA 3PW0A 2XMMA 5E5NA 3TEHB 4WFBQ 5ETKA 1KDNA 3GJTB 1KS2A 2EKYA 5D6GA 2NZ4A 2C1EB 2ZUAA 1I3OB 1LW0B 1FRJA 2KT2A 3LH2S 1RISA 2YTCA 3MM5B 3OFEA 3LGNA 3W2WA 3GIKA 2DO0A 2FC9A 4ETZA 1SC6A 2WSEC 2Z8QA 4GO7X 4JV5F 1HLWA 2ZHAA 1QLNA 3TZYA 5IV4A 3KMSA 1S6PA 4H4KA 3EPIA 3KLGA 2DNQA 1NLKL 1YVFA 2IM0A 1GXUA 2ZM6J 2PA8D 2I1RA 2YNFA 2JZ5A 3R5AA 1NZAA 2CVEA 2FTRA 1VC0A 3A4TA 2DPJA 4LF9J 2PA3A 2N3OA 4FXWA 1FEHA 1ZM9A 1JLAB 3TX8A 3CJTA 2VPYB 3S1TA 3LO3A 3ZC4A 3V4IB 3HT3A 1PYOB 2JFDA 3BKTA 4J9RA 2I2YA 2C2ZB 1TP7A 4P52A 5G0RB 3SEOA 4EBCA 4A8QA 2EG1A 2HPUA 3IS9A 4ED6A 1R43A 5T7LB 4OZ5A 5MLCV 1QVGR 4LF5J 2ZH8A 3QJJA 1YJRA 1UEVA 2F9JA 1NJWA 4EEYA 3BN7A 2XMTA 3BBFA 4USUA 4U6PA 3Q8RB 3G4SS 1S99A 1KQSR 4LJMA 2CWXA 4DSFA 1FJ7A 5KFVA 3SSSA 2UU9F 3WIVA 2KZZA 1TKDA 1JXVA 4V19X 3OTBA 2CPYA 2QA4G 2GFFA 4RW8A 4ZS6A 1PBUA 5H9FK 3QIDA 5JUMA 4O44B 2CRLA 4YUDA 3LA0A 2V4JB 4X4OA 3B82A 3W9IA 4DV1J 3WQPA 3DU5A 1VYAA 2HBYB 5HSPA 4ZJQA 2YH1A 2AGQA 1U2CA 2DRBA 2Z57B 2DNKA 1FKAF 3M2UA 1GK8A 1S5ZA 1EETA 4DUYF 4M5IA 3ITHB 3DNCA 2V94A 2ZBIA 3BF4A 1Q8BA 2FY1A 1U24A 3VAKA 4HHHA 4GRSA 1N56A 1SBRA 3WC2A 2BRKA 4Q2MA 3ZTPA 1TKXB 1EAYC 2QLFB 1DRZA 3IC1A 4URQU 2CPXA 2ZOMA 2VUGA 2CPEA 4X4PA 2FJXA 3FZBA 1IR1A 4OHYA 3QNWB 3NWGA 2XQCA 4CWBA 4LREA 3WZ0A 3MCOA 2M52A 1J5EF 3BPDA 3TUIC 4QR0A 3M6VA 4DV0J 4A4JA 2RS8A 2CNKB 3D1HA 3G6YA 3C16B 4UQGA 1NHUA 3R3TA 4N8OA 1FWLA 1QE1A 1UWBA 5KFXA 1N6QA 1ZOTA 4U95A 1M1KT 3PO4A 1JKHA 4B3RF 2GVZA 2R3VA 3CEDA 2E1MC 1UVJA 1NBEB 4C8YA 4X64J 2OUGA 3R7NB 3EVWA 2GIRA 1T9VA 2YBVA 4C3LA 1U47A 2HWIA 3MPWA 5THWA 1PJ6A 3EMTA 3ILOA 2J9DA 5J1NA 3QT8A 4CLPA 5DGBA 5DG8A 3I0SA 2AMCB 1Y4ZB 3OUYB 3W2VB 1YITS 4TQRA 2R7TA 3AT1B 1WC5A 4PQUA 2XM3A 3TX0A 3J7A1 1YHQS 1NEEA 1YBTA 3ENQA 3J80U 4IDKB 3UN5A 3K5NA 3CCTA 4E0DA 2RE1A 4CH7A 2B9YA 1S1TB 2VDHA 1T9YA 1HNZJ 5H9EK 4M1KA 1ZETA 1RWPB 2C3PA 2LMIA 1SKUB 1KLMA 2VFUA 2J9CA 4GVLA 4TVAB 2DHGA 1OSDA 3VTIA 1VQKS 5CCLA 3QYYA 3M05A 4M5GA 4YB6A 4RBUA 2EW9A 2VV5A 3MAQA 1CS4B 2Z30B 2M88A 1WUUA 1VQ6S 1DY3A 1VIOA 3AY0A 4F4XA 3KTQA 3MCNA 1OY9A 1LEOA 2RDDA 3CSKA 3TANA 2WSCC 2FPHX 2YKNA 1SIWB 3IGVA 4I4BA 2HMIA 4O0IA 3CNQP 4DV4J 5J2MA 1HHQA 3HVRA 4B3TJ 3QO9A 1FDBA 3FDSA 2XB2D 3D67A 5KFMA 3ETOA 3ILJA 2BBEA 1LFWA 3EDQB 5KT7A 1T3NA 2C2OB 2OAUA 4O3PA 5EHHA 5HI7A 3K2YA 8AT1B 4M5MA 1UFWA 5AJ3J 4M5JA 5JXSA 2K2PA 2RJZA 3P96A 1E6VA 2BJ7A 4OL8A 5D4NA 1SQEA 2VJVA 3VAIA 2BM1A 3CCMS 4AFFA 1U1LA 1X5OA 3PYFA 3KLFA 1UWAA 1KN6A 3D6TB 3TZWA 3BSNA 3QZ8A 2EXUA 4IKAA 1S1WA 4LIWA 2RKIA 4CTAA 3KLIB 1HW9A 4ID5A 2MHEA 3VAJA 4DS5A 1IM4A 3JQJA 3B4DA 3PRDA 1S9GB 4CT9A 3U1LA 4OZ0A 3GIJA 2R2UA 1IBKJ 2FGOA 3Q8YA 4LF4J 1OQ3A 4KR0B 4F36A 4K7QA 1CC8A 3CVKA 3O1LA 4OJ1A 3TZZA 3RAQA 4A8FA 2NXNA 3DLGA 2HK2A 1NSAA 1VCTA 2OLWA 4C0HA 3DRRB 3FC9A 3PJ9A 1T02A 2LEAA 3RTVA 2YNIB 1DTTB 3LAMA 2L08A 2ROEA 3U1NA 4C8LA 1IKWA 4HH0A 1VJWA 2ALYB 1S79A 1RWWB 4FN5A 1PJ7A 1V3SA 2DBBA 5BR8F 2HG4A 3KUHA 4Y6IA 3J80Y 4CCHA 1T03A 3UPFA 3OXLA 4PWDB 3HHLD 4P7TA 4USVA 4H4MA 1SJQA 2OEMA 3KG1A 3R97A 4ALZA 1B0PA 3DOKB 1NH8A 3GONA 1UWBB 4NYPA 2BM0A 2CJBA 2N4CA 1EQMA 5FD1A 4F2RA 2ZZTA 1IKXB 2QMXA 1YDLA 2HYIB 4NCBA 3FSIA 4QR1A 5IWAJ 3EVMA 3JAMU 1RE1B 1UJ4A 1H98A 2W9BA 2WONB 3TNVA 2WW8A 1TV6B 4JI1J 3PR4A 5F8GA 5CXTA 2XMWA 4IOAQ 1TZ0A 9ATCB 1X9SA 3B54A 1JLGA 5AE3A 3A8KA 4WFZA 3DLLQ 2NR0A 3FUYA 1L3VA 5GMEA 2W24A 3LPEA 5KFAA 3E01B 2DYAA 1N33F 4N5SA 1H7WA 1R0AB 4B3SJ 3DRYA 2C2DA 3RB4A 2MKSA 4NWBA 3I9ZA 1OIAA 3BBCA 4UTGA 1QAXA 3TOQA 2Y8WA 3CMQA 1XR7A 6AT1B 4R8UA 5H9FJ 3RR8A 2OD4A 2RB7A 3VZIA 3I0RA 3BH7B 2XNQA 4Q0BB 4CH0S 4DXLA 2VHGA 4U67Q 2IRYA 2OH2A 4PWWA 2LQ8A 5B7WA 1SV5A 1CULA 2OSQA 3H2LA 3I9V9 4CH1A 4ZJLA 7FDRA 1NK7A 3UWTA 4EO6A 1O5JA 4S0MA 4RUHA 4X65F 3TAQA 3TI0A 4ELTA 2MLXA 2DRAA 1D9FA 3PIOQ 2IAJB 4IG3A 4ZN1A 4GKKF 3J81j 4HLBA 1H74A 4DUTA 5LXYA 1X5TA 4ER8A 4OX9J 5KTQA 1JLFA 4JI6F 4FF1A 4I69A 4CO4A 2LCWA 3GU0A 2HQ3A 3MUVP 3T1AA 2B9XA 3MM7A 4FNHA 3MR5A 1NK6A 1U8WA 1KD1T 2M3DA 3CGIA 4RNNA 1RP5A 2HWTA 3HFVA 2XNRA 1MN7A 4RL1A 5E3QA 1RT5B 1WHYA 1RYSA 3IR5B 4BC9A 4J9LA 2RF2B 2ZH1A 5ETLA 1SJFA 1NB7A 1S1WB 2NCKL 4OFZA 4P2MA 3TA1A 2CPHA 4C8MA 5HJYA 1HHTP 2LQBA 5K8OA 2ZC3A 1YX2A 1HD0A 2DY1A 3DDKA 5KFPA 3NGSA 5GAHI 3IBFB 3UD4P 3PX6A 4FYDA 3N0VA 4DZDA 2W01A 1CJUA 4FF3A 2FHJA 4KHRA 2UUBJ 1R8PA 4DWIA 4LUBA 3JAMY 1RI7A 1GEHA 4LVOP 5F9LA 4YEAA 1S9EB 2DTJA 2XMAA 1NPPA 2AYMA 1NK9A 1MG7A 2VBZA 1S1XB 2YNIA 3BSCA 2WOMB 5ETOA 1LW0A 3MM5A 5K5MA 2RHQB 4ZHRB 2KYXA 4R5PB 3DDNA 2ZH4A 2AU0A 1VDHA 3GSDA 1FKOB 4IFYB 2KVQE 3IM8A 5KFLA 5DM7Q 4MYUA 3ETMA 3J7Z5 4QIGA 1UKUA 3UO0A 4AQYF 1UVNA 3D3CJ 5KG3A 3AD8C 2M4MA 2QTWA 4LF5F 5KT4A 1TL1A 1ZPWX 2VFSA 3PYDA 1HL6A 5I3QA 2NREA 5L9XA 3IRXA 3MM9A 1D09B 1R89A 4M5HA 4W98A 3SBMA 3MR3A 2PFFB 2W2MP 1IJFB 4KFBA 1R8AA 3SQGA 5E3AA 5KOWA 1KEKA 2KM8C 4K0KJ 1PYSB 2GNKA 2DGSA 2RRNA 2MJUA 4PQUB 2W1BA 3MM6A 1D0EA 4B3OB 4PG5A 2ZH5A 4NZ0A 2A3JA 2CQBA 2EFNA 2HHPA 3QRQA 2GIQA 2UUTA 3AD7C 1M1HA 2FLNA 1H73A 4A8WA 4DJBA 4FXDA 4RWXA 3OL6A 1FK9A 2V8GA 3UNYA 1NRKA 1YJ9S 3A3PB 3CJ2A 1TMMA 2VBWA 1F3FA 2NSCA 3FJ2A 2FJWA 1JLBB 1R7IA 2OTLS 2MY8A 2CFXA 3A12A 3D1OA 2R8GA 1HPZA 1PBAA 2PSZA 4NLVA 4DZ6A 3FBEA 3TJ8A 5AXNA 3VAFA 2GW8A 4B9UA 8ATCB 1RYRA 1NCLA 2RQMA 1Y10A 1TTHB 2XMKA 4NPOA 3OVBA 2H65B 1X4CA 4KKOA 3NGUA 3VVUA 2D3ZA 4USMA 5KFBA 1SVDA 3QJLA 4C9DA 1YG0A 4R8UB 3NCQA 2ADBA 1IBMF 4B17A 1X0PA 2APOA 3MI7X 2XGQA 5HATA 2HVEA 4K4UA 1N5VA 5LT5A 4JI6J 4NXNJ 4OYAA 4O3SA 1P8GA 3CWJA 2VC1A 2V69A 2HS3A 4HYKA 4RNFA 3C15A 4F25A 2D74B 1NK0A 1YJVA 3J7YU 1HQEB 4WE1B 4RW6B 4DPOA 5CYMA 2Q6CA 3K5OA 3LQVA 3MF5A 1CJKA 5A76A 2FVPA 1DARA 3THVA 1AZSB 4MJKA 2YPYA 3OTDA 2F7VA 1REVA 4NLSA 4CM2A 2IDLA 4YR3A 2OPRB 3I4HX 5GAHU 2X3DA 4USWA 2IM1A 4ECRA 2K06A 1IKVB 3S6EA 3OR1B 4NXMJ 2HNYA 3Q8QB 2IVMA 2R7UA 4O3RA 1RAEB 2CPDA 4J5OA 3TVYA 2MJNA 2B6AB 2JWNA 3T41A 4NASA 5GMKa 4Z7CA 4O4GA 2GHWA 2XSJA 1SKWA 1HKAA 1JJ4A 1GQEA 3I32A 1LXNA 3PCOB 4PWUA 4ZP8A 4U7CA 4WP9A 4PUOA 2DR6A 3GFXA 4HACA 4KTQA 2AT1B 3K8VA 3PXGa 3QATA 4I68A 2R7QA 4DCPB 4JV2A 3M6WA 5IV3A 4DSLA 1RTDA 3GYNA 5EGYA 3F41A 2BZ2A 4Y2IA 2B9EA 4KHPJ 2IA6A 4YR2A 5F3TA 1RAFB 1VK3A 4UUXA 3PW5A 2B0GA 2BJDA 4WFAQ 5M2PA 1SC4B 3D3BJ 4OIXA 2VQFJ 2HZCA 1WC4A 3N6MA 2LYVA 3RAXA 1HWJA 5KFEA 3BO3A 1N48A 1BY9A 4WU3A 4K4TA 5LL6d 2W9CA 4NLTA 1G4CA 4PQAA 2CUYA 2XZWA 2HAIA 3SIPB 2XZDB 1XNRJ 1X4GA 4F3OA 4UY85 1URRA 2RILA 4B08A 3IAM9 3GJSB 1IKXA 1VQSA 2GAHC 2XHWA 3AQOA 3WC0A 4QWEA 2M70A 2BR0A 3RR7A 2RSQA 4C3KA 2OFHX 3G6ES 4I2PA 2C3OA 2KH9A 3ZZOA 3OLBA 1BQMA 2HRTA 3V6JA 4NRTA 3G8QA 4LRDA 3BSAA 1Q7LB 1JLGB 4OJ3A 2WZ1A 1Q5YA 4TY9A 2RS2A 3ILLA 3FFIA 2G1DA 2GJIA 4B9TA 2NUUG 1CS4A 1FF2A 2Y1IA 4Y2KA 2H5IB 2YNHA 2HVZA 4YY3F 4J9QA 4A8YA 3C66A 4AL5A 3MXHP 3ONQA 1KQGB 1RHUB 2PI5A 1FK9B 2KKHA 3BPSP 5IS2A 4ZPTR 5J1EB 2YKNB 4NLGA 4YDDB 2AJ0A 2IBOA 4KYZA 3G87A 4DFJA 2D3OR 1YJWS 4JI2J 3DXBA 3MMCB 4PZVA 1S97A 2OMOA 4N77A 5HO4A 4WU2A 3B8HA 2W2OP 1EX8A 3TJ9A 4RW8B 2EEYA 4ES2A 3J7YI 4I6YA 2HVIA 3KDOA 4MKAA 3OL8A 4DLGA 1VLYA 3F56A 2ZWOA 3H5XA 3CCRS 1NJZA 2MGZB 4JI7F 1IQTA 4I7FB 2VFVA 2YPZA 3CCWA 2RMLA 4QPTA 1RK8A 1EETB 4J9KA 1VISA 3DLEB 3V2UC 1K1SA 1N4LA 4KC5A 1TAUA 1T9UA 3M1VB 3N01A 3HHKA 3MM7B 4XDCA 3P5BP 1RT2B 4ILLA 5HP1B 4ED7A 2YNFB 1BGXT 1V3RA 2DGXA 2F65A 5B0GA 5HMXA 2NQPA 2HRYA 2OP5A 1RAHB 1NK4A 1C1BA 3MGJA 1JWWA 5D3GB 1LK7A 3ET6A 3NP5A 2CQ0A 2BEFA 2HBZB 4ZMMA 2W8KA 3RRHA 4DQIA 1Q0NA 4URSA 3PY8A 1RKIA 4UT4A 2JX2A 4M5DB 4OJGA 3UDCA 4I56A 2HNYB 1UJ6A 2HLTA 2M2BA 2KI2A 4MT1A 4USTA 5IQ6A 2OPPA 1RHRB 2J8SA 2ZNZA 2K1RB 5A8KB 3PIPQ 4OX6A 1MU2B 4OJHA 4U9RA 4Y28C 3W9HA 4JUZA 3UQSA 4O4GB 2XSJB 2PI4A 3MMBB 2UXBJ 2HHWA 3IS9B 2RVJA 5HLFA 5D0EA 5CZVA 3TA2A 1IWGA 3HMJG 1LWFA 4H4KC 3QWUA 3GJQB 2VICA 4RW7B 3OTEA 1VQPS 4G65A 1T8EA 4H4MB 1N8RT 2R7XA 2H3EB 1RTDB 5HVFA 1EHWA 4TYAA 5A0YB 1AFJA 1U8SA 2CADA 3GV5B 5L46A 4DV2J 2ZD1B 2LDYA 3MPDA 3G6XA 1Y11A 3W2VA 1HI8A 1RAJA 3GYXB 4LQ9A 2VQEJ 1VBKA 3R9LA 5C2CA 2ERRA 2HAFA 1T9TA 1WD6A 5L9NA 2X1BA 1S1TA 1TL1B 4HH1A 2EI5A 5GVQA 5BYRA 2RNEA 1AT1B 5CH7B 1NSPA 1VFJA 3FMBA 4WTOB 2JVRA 3BGOP 3X3UA 4OV6A 1PILA 1X4BA 3CCSS 2A6MA 2MPUA 4FYXB 1TVRA 4UUWA 3HPOA 4B9SA 3DOLB 2EBGA 2HS4A 3M2VA 4I2PB 3P5TL 2LEBA 3CE8A 4B3OA 5HMWA 1DURA 1N5QA 2ZDOA 2WVBA 3IWNC 3I5BA 3OR2B 3DI6B 1HBNB 3VV2B 3F73A 1HR0J 3EWGA 3EGVA 4OV1A 1TKXA 2BYCA 1B7FA 2VA3A 1X5PA 3VAMA 3BB5A 1FTRA 1WSRA 2KXFA 4CZCA 1JMTA 4N7TA 5RUBA 1JXLA 4Q0BA 3Q8PB 4Y3CA 1N36F 3AFGA 4PCQA 2R8HA 3TUPA 2E5IA 1U0HA 2XTJP 2Q66A 2H51B 4ZPVR 2LU2A 1W25A 4F0HA 5A8WB 3BEGB 1L3TA 3NS7B 1C0TA 3BGRB 2FZGB 2V34A 2CG8A 4F04B 2LXUA 2HQDA 5DZ6A 1N6QB 3FRZA 3LGHA 1E6VB 5LSRA 4HDGA 5HQLA 2UVRA 3HF5A 3MAHA 4DU8A 2K8GA 2Q3PA 3M2RA 4WIQA 4XPEA 1MROA 4NLWA 5GADI 3CXCR 1R6YA 4J9OA 4DR1J 2HKEA 3GR0A 3MOZA 4IH7A 3CCZA 4PAAA 2C2KB 2CQ2A 4WXWA 3WIUA 3HK2A 1OS5A 5KT2A 1FA0A 3HSJA 1FD2A 3P45B 4JP8A 2QLXA 2DNPA 4XTTA 1HQEA 3QT5A 2GGPB 2GCFA 2JDJA 4YP3A 4L73A 3EGNA 2WVEA 2WRMA 2XY6A 4QCLA 5ADZA 5KFQA 4IOCQ 2J6SA 4OQJA 2OTJS 4LF7F 1OYDA 2O5DA 2HHXA 1T94A 2XG8A 3D0IE 1HMVA 2JRSA 2Q6BA 3D5MA 4YB5A 4ZPDA 1NK5A 3CW2C 3RBDA 3G8SA 4A8OA 5T41A 2LQJA 4YS2A 2HGMA 2ZVSA 1CJUB 1RA7A 2VFRA 4OZ1A 3N28A 3ET6B 5IM0B 4Y0FA 2QO3A 2UUBF 2DR9A 4DSEA 2BQUA 2G2OA 4DOZA 3TUZC 2HS0A 3SFUA 1KNZA 2KFNA 4PABA 2CQCA 1NJYA 4DU7A 1S1XA 1WF2A 4HT7A 4MK7A 2QA4S 4DV6J 1JQGA 4LF6F 3J7AN 1FTCA 5HROB 4CNZA 1FFGB 4Z7YA 2R8IA 2WCXA 3AD9C 3D6FB 4J91A 3GILA 3MAAA 5D4LA 2QSFA 2VKZG 1RTIB 2OPSB 5EX3A 3H20A 4LBIA 4K5SA 4OYIA 1CPZA 4J9UE 3AXMA 1PAEX 3M8RA 4JOUA 5KFHA 3PACA 5KFJA 3CD6S 4X4VA 4KFBB 3SQGB 4QR2A 3IA0A 3CJ8A 2IY5B 2KB2A 1B0TA 2CVIA 1XJWB 1R0CB 2U1AA 4FVMA 4LRFA 3SCKE 1D8YA 1NUEA 1TKZA 2ZBCA 4I6WA 5CA5A 1M5HA 1RDRA 1V3ZA 3CCVS 1HNXF 3P6YC 3KJQB 4KY3A 3QIPB 3Q2TC 3O2IA 1UZHA 5J2QA 4RZRA 3KLHB 1S72S 4R0JA 1SJRA 1J5OA 3N79A 1RTHB 1YRXA 4BCAA 2LQ5A 3KG0A 4ID8A 3VVTA 1WELA 2P9GA 1F9EB 2DGUA 3DOLA 2BE2B 1U45A 1GXTA 3I0RB 3CUNA 4MYTA 1U1MA 1RU1A 2AJ4A 3MEEA 2CQ1A 1RWVB 3D54A 4WZMA 3DI6A 1F9HA 1HBNA 2LLZA 2YX1A 2GHVC 3CD5A 3D6HB 5F9NA 4KKOB 4RNMA 5LMUJ 1SKSA 2XI2A 2V50A 2IRXA 3ZTSA 3NY0A 4DR7J 3LP2A 4LSNA 1FD8A 1KOOA 3ZTRA 2M0GB 1F1BB 2PDAA 2XMJA 4QZVB 3U1MA 1BC6A 4OI1A 4ILMA 5DS7A 4DPWA 3O5TB 1Q81T 5KFDA 3DLHA 2WTFA 3C46A 3T5JA 3ENVA 1S6PB 1RADB 4LRBA 3SCLE 2CZ4A 2CJXB 4IYQA 3WX4A 4JI0F 1D1UA 1VK8A 1RT1A 3OFHA 4CLSA 2AYBA 2B7BB 4WBFA 4I7FA 2GQ2A 3P3DA 2UXDF 3SYZA 3NGTA 2F3JA 2QV6A 3AB4B 1S0OA 1WDDA 1QTMA 4OYBA 1TELA 5B0FA 3V6KA 3M2RB 1IQZA 2BJ3A 2R4FA 3ZO7A 4B3MF 5E3RA 2JNJA 3DLEA 4V1Ak 4DMZA 3NAIA 3O44A 3NNHA 4W90B 4XO0A 3V4IA 5DDRC 1N52B 4RU9A 2XULA 4K4SA 5C42A 5HP1A 3RRGA 3C3LA 1H2UX 1RU2A 3OFGA 4UF4A 1IR0A 5IXUA 2R2TA 3EXCX 5DDPC 3CO9A 5ETPA 2NLWA 3SFGA 1YTYA 2P9CA 4N47A 1YRUA 2IJNA 1RT4B 4OHVA 4URGA 1RAIB 1UW4A 5A2QU 4NI2A 3T5HA 1SUQB 1WOSA 2FIUA 3EM1A 4NE9C 1X8DA 5I4MA 4YQWA 4LSLA 5CQGA 1JLEB 2EC2A 4NOHA 3BH6B 1XERA 5ETQA 1FCAA 2GMHA 4YOEA 4Q44A 2K1RA 5A8KA 3FBFA 1NKEA 1VIXA 3NS5A 4IFYA 1PYTA 1TKTA 4KHMA 4W92B 4HVZA 4CLKA 1HI0P 3P49B 1JNZB 1YBUA 2PE8A 3IFEA 1K1QA 3D68A 2V2KA 1Y00A 2IPOB 3FKBA 1A7GE 5HVHA 3BBBA 3SV4A 4USIA 1DAXA 2HQFA 1B0VA 2NXCA 4K4WA 1K0VA 5HROA 2DD8S 2ZEJA 3RRKA 1NJIT 1F5AA 4IQXA 1SQGA 2HGLA 2P6SA 3ZZYA 1Z2LA 3KJFB 3ITHA 2QZ8A 2EK6A 2QFIA 2X3GA 3TAPA 1K8AT 2GS8A 4ED4A 2FLPA 2FJAB 2FHOB 2ZHOA 3UCGA 4BHQA 5EDWA 2UV8G 3BYRA 2OMLA 2AX1A 4ZLJA 3K5LA 1DHMA 2A18A 1U02A 4NZ7A 4WPAA 4IH5A 5ETSA 3RG6A 2R7SA 1ZZNA 2XEXA 3DRSA 4LF8F 3GLJA 3JTNA 5B0DA 1RXOB 5LM7E 3MUMP 5L1JA 2FQQB 4P7VA 5FJ4A 2Z56B 2DGWA 1AA1B 3B4MA 2J7KA 1C1CA 3FEXB 4NA2A 2V63A 4ZJOA 4BLGA 4PPDA 2V67A 2H9ZA 3VGUA 1MWYA 1RTHA 2HHTA 5IC4B 4FPRA 3MZIA 4DR5J 4ZVRB 1S1VA 2ZOGA 2UXBF 1M5VC 1I6JA 4ZVEA 3BQ2A 4FBUA 4LFBF 1QE1B 2DY9A 2BOPA 4RNOA 2HHHF 4DG1A 2HFZA 3L95X 2XMVA 4P72A 2ZWPA 5KG5A 3CJ4A 2FDNA 1BD6A 1JNRB 2FD2A 1U0HB 2HVDA 2I9SA 3P8BB 3DMJB 2FJDB 4IG0A 1WF0A 4ZVUB 4LSNB 5J1PA 3PZPA 4U8VA 1ITPA 2GMLA 3L7OA 1EKRA 4HR2A 4IUFA 1C0TB 2YWHA 5EWFA 5AXMA 2DXEA 2VG7A 2AQ4A 3ADAC 4RBTA 2UUAJ 5KT5A 5A2QY 4X4UA 3C19A 5G4DA 4ELUA 1S6QB 2JC1A 3IRWP 2OEJA 4XAKA 2BQ3A 2OPQB 1XMQF 3T19A 1RT1B 4CLWA 2JEFA 5C25A 3GIIA 2DO4A 1LFPA 2FY8A 1GTEA 2ZBRA 3EVOA 2L41A 2B6AA 4DR3J 3PW7A 3C14A 2O01C 1RHQB 1N34J 1KRPA 2R8KA 2DIVA 4HEA9 3Q22A 4CYUA 2WB1D 3U27A 4DCJB 2FJEB 4C97A 4WXOA 2FVRA 2J5AA 3VQSA 1HNIB 4HACB 1N5TA 4JV1A 2KHDA 4P2FA 2O1PA 3LTOA 1TMJA 3EZOA 3VALA 2KZMA 1FVQA 4EBDA 2HZVA 4ZVSB 1G2EA 3RYLA 1HI1A 3CC7S 3MMBA 2V68A 4ANCA 4ANDA 2OD6A 2CNNB 3UVJB 1TUWA 1BQNB 2H4WB 3KXDA 1WC1A 1NXIA 3DN9A 3MM8B 4KSEB 1FE4A 3QO9B 4K59A 4NI2B 4ZITA 2ZH2A 5GAEI 5EWGA 1W2BR 2VKRA 3E51A 2LEPA 2CWKA 3JSYA 1M1GA 2V2ZA 3GIMA 2ZD1A 4PPZA 4DHVA 1YKWA 4R0EA 3DRPB 4LR7A 2XSFA 4DQQA 3EE3A 1S0MA 1K9MT 1KTQA 2K3IA 1S76D 4PXEA 4AXIA 3Q8VA 1V9OA 3PYGA 3MAAB 3WX8A 2MQMA 4NX9A 4DSIA 3DU6A 1RWXB 3PEHA 4PEOA 3ZNUA 3MEDA 3H59A 4TXSA 2XHCA 1XNQF 2JVOA 5LJ3Y 3G82A 5K8MA 3N4WA 4LT6A 5I42B 3NS6A 3ZTQA 1C4CA 4RW6A 3FEZA 5B0AA 1UTAA 1S49A 1FE0A 3RU0A 2DR8A 3GV8B 1UA0A 3NMAA 1TKZB 1F3VA 5LMNF 2W4DA 3HVAA 1P1LA 2JSXA 1CJVA 2OPRA 2SXLA 5IOLA 1NNDA 2O3DA 1GX5A 4QJVA 3ZZ0A 4DN9A 2ZH7A 3N5FA 1G6BA 3FEYB 1XWLA 5D0HA 4DR5F 1M5OC 4OI0A 2EWHA 2MKCA 4DV5J 1UPPA 1BUXA 3HVWA 1WHXA 3A1YG 2MXYA 1B3TA 4ECYA 2VPZB 1FRXA 3M30A 1WACA 3BS9A 3H5UA 1N36J 4O3QA 1U1RA 2G2ZA 2L48A 2FHMA 3H2UB 4CO0A 1HARA 1UP1A 2IHR1 2R7OA 4KIAA 1SXLA 1JIHA 1KONA 2XY7A 2ZZNA 1ZH5A 5MAOA 3HI9A 4YMEA 2MGZA 2XLIA 1S0VA 2HK3A 3TAMB 1YJ7A 3MPYA 2ZFHA 3VAHA 5KG0A 2RU3A 1ELOA 3ENAA 4WTYA 3K0JA 4DQSA 3KOAA 3H0PA 3K59A 4G3IA 3HLUA 1VRTB 2E1AA 1SJ4P 1UL3A 1MMLA 2MB0B 3A13A 1K0TA 4F3QA 4OYOA 3H7HB 4IO9Q 1ZAWA 1AUDA 4YDXA 1Y5IB 2MEWA 1HA1A 1JB0C 3AXKA 3DOMA 1J27A 1YJUA 1WEXA 2E1PA 3HVTA 3IAS9 3PFOA 1CSJA 4X4TA 3KHRA 2Z2ZA 1C1BB 5DDQC 3AJ2A 2R7WA 4I64A 2G13A 3OT9A 1WG4A 5CYQB 3LWMA 4ED8A 1R0AA 4YN3B 1FWKA 1O6XA 1HMVB 4L75A 2CDRB 4NYZA 4USJC 4ZA1A 5LJ5Y 4DR4F 5KFRA 2FB0A 1HQUA 3QGPA 1RUSA 2B4PA 3DDIA 3BJYA 2XC9A 4BDPA 1MU2A 1X9WA 1FJEB 4UOCA 4G1PA 3BZQA 3RW6A 3FFIB 1JK9B 1VQ4S 3FNNA 1RT4A 1LV5A 1SUQA 3K7RA 4WZQA 5ETNA 3OSPA 2ACYA 1MN9A 2KXHA 1BQXA 4LF9F 4ES3A 3H2VE 3MEKA 4A46A 2RHSB 3T5KA 1N33J 3MM8A 3MECA 1U26A 4OI6A 2I6WA 3MMCA 2E29A 3QAUA 5E0OA 3KWMA 4YFUA 3HM9A 1RWUA 5BJRA 4ED3A 3V6DB 3L7UA 3OLAA 2VONA 1QUVA 2PIIA 1H38A 1VQ9S 4WKYA 1H7XA 5D15A 4GC6A 1B70B 4RW4B 2GV1A 5DLGA 2HNZB 1RA6A 2VG6A 2GO9A 3PKMA 4CT8A 3LF0A 5DM6Q 2EFOA 1TVRB 5DJBA 2ZHBA 2W9AA 2ZVIA 3W65A 2HNDB 3L09A 4RUCA 3CCUS 2VOOA 5J2QB 1F6TA 1Z4UA 4PYDA 4DS4A 1IKYA 3W64A 2ZM6F 4I2QA 4F4KA 1FRHA 3BV8A 3PJWA 4RX6A 2W9CB 1A9NB 4ZPBA 3TZXA 2WW4A 1CJVB 1IBKF 3UDVA 1XC9A 2ZE2A 1YBAA 1C0UB 4LFCF 1YK9A 2PMWA 1QM9A 2AGPA 1HBMB 4RWWA 1U6BA 5KFYA 1LQ9A 1OO0B 2AEJA 4MFBB 5KFKA 1CBKA 2DNOA 2E9RX 2NPIA 2CIMA 4XPCA 1FKOA 1S7HA 3QSYB 1WC0A 2FJVA 4FKYA 4KGKA 2KM8B 1HNXJ 2M8DB 1HHSA 5KG1A 5DO2A 3DLJA 2D7SA 2WVFA 3KHGA 5HL7Q 2DGOA 4RU2A 2CZ9A 2FVCA 3H42A 3PFEA 4K4XA 2C3MA 1UVLA 1BE4A 1RWMB 4RW9B 4DL2A 3MEGA 3F0NA 3ZTOA 1VBXA 2E1CA 1WDTA 2AJ2A 2LXFA 3BGFA 1BXNA 2B5JA 4NEYA 4GVBA 4OMFG 4WYLA 4DV0F 2HZAA 4NA3A 5F0WA 3NL0A 2Y3YA 2VFTA 3AH6A 2V4RA 1TL5A 5HMYA 1JLQB 2B43A 2VL1A 1VS3A 3M8PB 2MKKA 4B3RJ 4EK2A 1LK5A 2HFSA 3K8WA 4FDFA 1ZM4A 2JHEA 1SJ3P 2HFNA 2AW0A 2DNRA 2V8VA 4F50A 1FERA 4IR9A 2XO7A 1JLBA 4M5KA 3GE9A 2X7IA 1JLAA 2QL7B 3OJSA 3NNAA 4KH0B 1RT3A 3GFHA 1N5YA 1HQUB 2E66A 3BO2A 4F4ZA 1F5BA 2EPIA 2CA9A 5E33A 2VG5A 3MR7A 5DQHA 5F8LA 4DL0C 3DKDA 4OYZA 5IQQA 3CO0P 4JI4F 3PW2A 1RT6B 2V4QA 3E2EA 2GZOA 2GA7A 4KV8B 1SH3A 5K8NA 4J9VA 1DJ0A 1J5EJ 2H4YB 3TQEA 1X9MA 2VIHA 4X62F 2Z58B 4LRAA 2W4CA 1S6OA 4DR4J 4Q2LA 3K89A 1TK0A 4R25A 4E98A 2QEXS 2EC0A 2YKAA 1RWOB 2QA2A 4J7CA 5CYMB 5J2MB 3MECB 4OI3A 3TO8A 3Q8SB 2MQOA 1Q8IA 5JMNA 1CJTA 4Q43A 3VGTA 4HI2A 3V5RA 2J7WA 1NB2A 1UAWA 2MSSA 4RBVA 3QIPA 2XLJA 4ED0A 1S10A 1G1XA 1WC3A 3RJMB 1PSDA 3KUGA 3BGLA 4RW4A 2IYIA 1ULRA 2P5VA 4LR9A 1SB6A 5KFTA 2XCAA 2F4VJ 2UXCF 4EO8A 2B8PA 4C98A 4P71A 2ZH3A 1DTQB 2DEJA 4AE5A 3AOBA 2AV5A 5DGAA 3OXGA 1U25A 3PEJA 3GB0A 3W61A 4IRCA 3MEEB 4C48A 2E5LJ 3LAKA 5CABA 4WIIA 3SCIE 2CAJA 4X4SA 1S1VB 1AYEA 2RDJA 3MFIA 3LP2B 4AQYJ 1I94F 2C2MB 1S48A 1ZTWA 2B8QA 4C11B 3S01A 2GC8A 1I5OB 4MKBA 3TRGA 5F8MA 3H5SA 4NLOA 1BHNA 2K3KA 2D3O1 3R2DJ 2JLGA 4J9MA 3ZZUA 4FS2A 3KLEA 2DH9A 3PDNA 3CCQS 2RT3A 2MDAA 3SCJE 5B0BA 1ZYQA 2L9DA 4TLRA 1PAUB 1RCOB 4KGZB 4NXMF 5F41A 2VPWB 4I6AA 3CCES 2UP1A 4IR1A 3C6UA 3E8OA 3KK3B 1QDUB 4FBTA 1EP4A 3PHEA 4DQRA 4C2MA 2J7UA 2MZ1A 4B02A 1WKKA 3TAMA 3KK2B 4M5NA 3W5YA 4A48A 5D78A 1SL1A 1TL3B 4DPXA 1W7WA 2GQQA 4K8RA 2VB6A 3HULA 2E1RA 1RTIA 2OPSA 2V9WA 4ECUA 1OMSA 1O8BA 2JEIA 3NEKA 1IM6A 2CQ3A 5E41A 1Q82T 4QIFA 2MZJA 3IO1A 4X4QA 4EZ9A 3I0SB 1R3NA 3N5BA 2ZH6A 5L1KA 1QD1A 3M6UA 4DV3J 3C6TB 1N34F 2VZ9A 2WONA 2KN4A 4Y34A 4ZOSA 1TV6A 1T9WA 3O8WA 3T1YJ 3W66A 3KLHA 2RUSA 5CZXA 1S59A 1YLXA 2CJ9A 3FCVA 5KFZA 4AD6A 2UUAF 3CJ5A 2H5JB 3UVJA 1QJHA 2VBXA 1IJEB 3D4JA 1MNEA 4WYWA 4AL6A 4DSKA 2R8JA 1GMWA 2BKPA 2ZKTA 2AJQA 5L8RC 1YIJS 3LP1A 4DEZA 3PX0A 3KFWX 2KJVA 2YXLA 4IH6A 4QYZK 2V2VA 2R9LA 1GMWD 2GIFA 4ZVTB 3EX7B 1ZA2B 1FWPA 2QC3A 1FNMA 1TUGB 1S77D 3A8JA 1KHWA 1QUPA 2BKOA 1RWKB 4QU6A 2IA0A 3AJ1A 2LQ9A 4F67A 1EQ0A 4U96A 2J0XA 1GT8A 4LBHA 2D9PA 1RTJA 3DGPA 1NSQA 4KV8A 2MKIA 1MLAA 1LWCB 3HDSA 2YWEA 1C2PA 2BJEA 2BV3A 2KVIA 1BWVA 4ZIVA 2R2RA 4ICLB 4LF6J 2IMWP 4MKYA 5I42A 4KHPF 3JSBA 4PXCA 1OYEA 3R1LA 2J6UA 4GKKJ 2DNYA 2H5EA 5AE2A 5CYJA 3R7BB 2HVHA 4QBUA 5KAKA 4M95A 2BJ9A 5D3GA 2E5LF 1TU0B 3T6BA 5BYSA 1RZMA 1VLOA 5K14B 4ZP6A 3DXSX 5B08A 3DLBA 2Z2MA 4NLQA 3W8PA 4ZVFA 3D7SB 4ENOA 3EDRB 2HBRB 3NWRA 4C8ZA 4TU8A 1DTQA 2RF2A 4P74A 5SZTA 3PM9A 1WC6A 4IFVB 4L72B 1WHVA 3R6LB 4JV0A 4GKJJ 1U48A 3TARA 4BWMA 1C0UA 3R5CA 5KG2A 4ECVA 4X62J 3W7BA 4IG0B 5EWEA 2NSBA 3TR5A 3M8SA 3B78A 3W3SA 4MTPA 2HIYA 1IKWB 4DFPA 2MZSA 4BS2A 1VHFA 4ECZA 3OHBA 4DF8A 1SH2A 5HMZA 2UXCJ 2HIQA 3NAHA 4QYRA 1ZPVA 2C2EA 3KLGB 1RCXB 3QGGA 2QT7A 2CNLB 2GVDB 5GAEU 2N7YA 3QRRA 2KTQA 3SSQA 2IM2A 2Z0GA 4ATNA 1BWEA 4F4WA 3NCRA 1AB8A 1PIEA 2J76E 2LXIA 3B6BA 4P2SA 1R6VA 4RW9A 3HO1A 3QQCD 4DV5F 2E7WA 2KHCA 3BREA 4CO5A 4G1QB 1D3WA 2JEGA 4MH8A 3FK4A 4ZCMA 2PEHA 2DPIA 4FYYB 5KG7A 3PRVA 3Q24A 1EKSA 1T95A 1HW8A 1ZM2A 4EGLA 3SZ2A 4KH1B 4UOGA 3OR2A 3IP0A 5KFOA 2DK2A 3EICA 1GNKA 2AKWB 3UNGC 3G86A 1KC8T 2W2PP 4OX7A 1XN9A 5G0RA 4C8NA 3C6TA 1WSVA 2F4FA 2VPXB 2VQEF 3L3CA 1SC1B 3E01A 1RWNB 1TK8A 1BQNA 2DNLA 4EFAC 3NNCA 2XMUA 1VRUB 3NBPB 1LW2B 3H40A 4LFAJ 1TK5A 4ERDA 1HNVB 2MZRA 4RKUC 4PR6A 3EZUA 4B9MA 4P73A 3P4UB 2EFQA 1DBDA 3CB4A 2H48B 1WEYA 2FZCB 3PRBA 3IN5A 1U4BA 2EG2A 4JI3J 1M0SA 1M5PC 1IN0A 2ABYA 3KK1A 4XDDA 1FKPB 4UOFA 4F0MA 1RHMB 2X1GA 2ASDA 1HR0F 2CQGA 4N41A 4FYWB 4CLYA 3R6GB 1VI7A 1E6YB 2VU5A 1URNA 2ZJPQ 3C8YA 1GMUA 1KQKA 3CMES 3JYTB 3HJVA 2AYEA 2B3TB 4PG4A 4QU7A 3CIZA 2ZJRQ 8RUCA 1JX4A 1IBMJ 1UZDA 2PT0A 2FGCA 4OYPA 4TY8A 3TVKA 4PG8A 3M2UB 1ACMB 2Z2YB 2HFUA 2OELA 1GFWB 2OEKA 3N9UC 3O6QA 4HHJA 2HNDA 3VR1A 3PG9A 4Y65A 4NXNF 4DR6F 1VR6A 2GJ2A 2RDIA 3MWBA 4C8OA 4ITSA 4DL6A 4P2XA 5HJXA 4ICLA 2C3UA 2XI3A 2OPQA 2V8HA 4I2QB 3E3XA 3NXZA 4HKQA 2BA9A 3L9ZA 4ES1A 2PFDA 4LFBJ 2IYGA 2XYPB 1UCNA 3CDWA 4K0KF 2W4PA 5B0EA 1S4EA 5IM0A 1REVB 3CCJS 1RACB 1MMNA 1RGVA 2ATCB 2W7AA 3V81B 1HBOB 3BO4A 3TEGA 4CYUB 1N54B 2VASA 3POTA 4D3HA 3PVXA 2U2FA 4P6QA 1IR2A 1DTTA 2M9KA 3DLKB 3DRXA 1FEEA 3GMGA 4GC7A 2YWGA 1SH0A 3PV8A 4JV5J 2G9OA 2RQKA 3QWPA 3ZXWA 3GFZA 3H8YA 2WBRA 4EYIB 4X4NA 3UD5A 3UDLA 1TAQA 3EUNA 3ICLA 4HI1A 3L4BC 2F63A 4DLEA 1X7VA 4IO1A 1T7PA 1NU4A 2BVZA 1KSPA 1EJ7L 1NZ8A 2JJ4D 5I3UA 3FZ2A 3BQ1A 2CQIA 1O51A 3ISNC 5AJ3F 1PKUA 1H0HB 1P9QC 1HNZF 1APSA 3KK3A 3MEGB 2JL9A 1EP4B 2V2QA 3HSGA 2QJ3A 3KJNB 1K47A 3M8YA 2GAGC 2L9WA 5EUHA 4KQZA 4DR3F 3CJQA 4DUZF 3KK2A 1QY7A 2DNZA 2V8DA 3K5PA 1F2GA 2JOQA 3GPAA 3NOGA 2W9BB 2GO8A 2VQFF 1HD1A 5C5JA 3UN3A 1P6TA 5DQGA 3MEDB 3PHTA 3M8PA 2YKMB 1SQFA 3QBCA 2LU1A 4G6VB 5FLXU 1J5OB 3OW2R 1KLMB 1DQ8A 5DG7A 1FESA 3QJPA 2A1BA 4F3MA 1Z2ZA 2CJAA 1VOMA 2YWFA 4K4VA 3LWLA 4CO3A 2YX4A 4JI4J 4LFAF 1KTVA 1ZAXA 1RT3B 2Z2LA 3M6XA 3RZAA 4JI5F 2CJQA 1V5VA 2AJFE 2NS1B 2ZBPA 2D1CA 4JI8J 4WK1A 3OSNA 5DZ7A 4U7UK 1DQ9A 3SI8A 1WOOA 5ETVA 2HMIB 3Q83A 4KE5A 3FGVA 5ETRA 1LW2A 1JLCA 3BR9A 4U7UD 1CVJA 3VF0B 2ZJQQ 2HHUA 3KKFA 1S12A 4QIEA 3AAWB 2BACA 3TVZA 5LSLA 4YHHJ 1AFIA 5LXRA 2DR5A 2PD1A 3K57A 2QIFA 1VQNS 2HNZA 1Q8KA 4ECWA 1UJ5A 2KYZA 1UEUA 2RIJA 5E3CA 5IWAF 1U2FA 2BMBA 2CYYA 1N5SA 3NRBA 3MR2A 1DZ5A 2DIUA 2DXFA 4USKA 2XZTB 4DSJA 3MOJB 1MW7A 4FXVA 1OY8A 1X4HA 3LP0A 3QPIA 4MMOA 1F5CA 2XY5A 1RAGB 3D2WA 2BX6A 1N32J 4CTAB 3TUJC 1K44A 1Z1ZA 4WE1A 2NXJA 2V8PA 2R42A 3W9JA 3AHPA 2WVDA 1YZ6A 2J6TA 4Q8FA 2B7CB 1A0OB 3GIRA 4QIWD 1SPBP 3T1YF 4ED5A 2DT9A 5HAOA 4EWTA 2ZE2B 4QWDA 4N76A 2FHJD 4DX8H 3I56S 1S1UA 2BQRA 1U09A 2KG0A 1KHVA 1X4EA 1V5IB 3R8YA 4NL5A 1FXRA 1WG1A 2D41A 1RLDA 2YWWA 4C11A 2UU9J 1P9YA 2NZCA 4M8LA 1KFDA 5T14A 3BSOA 2PGCA 1HIYA 4W4MA 5DG9A 4NLRA 3HP6A 1G3OA 2C22A 5I3PA 4P10A 4IFVA 4WFYA 5K20B 3POTB 4NLPA 4CLZA 4M5DA 3MCSA 2FJBB 4L3NA 4JYAF 4MIBA 5KOXA 4R5PA 4OZ2A 3QGHA 2HQCA 4CLLA 3OJUA 4FYVB 4ZPCA 1TL3A 2NYHA 3D1QA 1LWFB 4F8RA 3AOAA 2F5GA 4XIUA 3D0GE 1T05A 4NEZA 1ZZFA 2J0WA 1QTNB 4RNHA 3EJMA 3K58A 2YQ1A 5L39A 2O67A 1IBCB 5EX0A 2FHKA 4DUYJ 4NLXA 2IRUA 5DRKA 2DJWA 2VOPA 2DNHA 4ZKAA 2W7OA 1YSJA 2EFPA 1IWAA 5ETTA 3HZEA 5HQ8A 4KT0C 3ULHA 2RRAA 2HQIA 3BKFA 1ZA1B 4UQTA 1OWXA 2Y9HA 2UZAA 2N4DA 4PXDA 1UVKA 2GQCA 2ZNYA 3PKYA 1BQMB 4DV2F 2B4OA 2CJKA 2IBKA 4JI8F 2XWXA 1HFEL 2IC3A 2AHOB 2IVYA 3OXFA 4LVNP 3SXLA 5DDOC 1NDCA 1RJJA 2A0FB 2DEIA 2H1YA 3ISZA 4WP3A 3KNAA 2VBYA 4TU7A 2POKA 3OD2A 4NLUA 3LP1B 1VQYA 4IOBA 5CD4H 2OSRA 4NZ6A 2KT3A 1YJNS 4DQPA 2Y1RI 1KVIA 2BW2A 2CZVC 2MKYA 2G0JA 4B9LA 4AYBD 2QRRA 5KFNA 2YNGA 4F4AA 3HHNB 1HBMA 2V6AA 4IG3B 1F9FA 4KB7A 4OX8A 2KXNB 4LBPA 4UW2A 3OVAA 1QSLA 1WNEA 2KT5A 2IDEA 2VG7B 1KVKA 3G2XA 2HHQA 1YRTA 4I1TA 1LWCA 4QPXA 2JH3A 4ZVQB 3I87A 4DPYA 1FFWB 2DH7A 3AB2B 3D6MB 5KFSA 3W5ZA 4F26A 3RB6A 1S6QA 5GMDA 2XBPA 2ASLA 4EU0A 2XYHB 2FYXA 2YH0A 3BGRA 3ILIA 4JBCA 1NPRA 2BW7A 2HHHJ 4MIWA 2VC0A 1FFSB 2QL5B 3RBEA 1U1PA 2I8EA 2G2YA 1PJ5A 4TY8B 3TA0A 1FJGJ 2QLJB 2DNGA 4ZCLA 3CC4S 3IG1B 3TQ1A 3TJAA 3MMAA 1RAAB 3HHLA 3Q23A 1FNXH 5K14A 1HWLA 2YWKA 2EK1A 1EB0A 3L7PA 4LR8A 4KGVB 3DCAA 1H72C 1VQMS 3BM7A 4Z37A 2DGVA 3US5A 1ROFA 1QSSA 2DB1A 3QT7A 4FVCA 3VWSA 4F2SA 5IT9Y 1Y3KA 4Y2MA 1U49A 2F8HA 2WAQD 3GG1A 1IBLF 2B51A 1PCAA 4EUVA 3R2CJ 4C4WA 3PYEA 1RHKB 3Q86A 4LF7J 3HHLC 1HBOA 1S6UA 4DFKA 3DYAB 4DBQA 4YR0A 2ZKUA 1S9EA 3S7RA 2AZ3A 2ZC4A 4ZVHA 4L76A 4JI3F 4X84A 3CF5Q 4LF8J 2OPPB 2EBEA 2M8HA 3GG0A 4HL9A 1WG5A 5AT1B 4X66J 5LOQA 6FD1A 5BR8J 1NDKA 3M8QB 1HNWF 1KR4A 2RQCA 2H54B 5HLFB 3OTCA 3MUTP 1NKBA 3NCPA 1XR5A 3NGDA 3I5CA 4B9VA 4NMLA 5I3UB 1UETA 2DKOB 3AODA 3I96A 1RBOB 2RAQA 3M4XA 3CC2S 2CQDA 3H4DA 4ZPWR 1TL4A 4OHZA 5KT3A 2IFXA 3SDEB 2E9ZA 1IUJA 1RTZA 1Y0HA 1KFSA 1CJTB 4CDIA 3OTOJ 3UR0A 3MFHA 3IWXA 2AEMA 1RB0A 2N7CA 5M2UA 3M8WA 1T11A 2DCUB 1R8BA 1LNQA 3KJVA 2F8EX 4EBEA 1VQOS 2UUCF 5LSOA 5CCMA 2DR7A 1DQAA 1DLOA 2XS2A 4MK9A 5DETA 4B3SF 3GYGA 2NPFA 3I5AA 4OHWA 4DV4F 4B3TF 2IJFA 2QSWA 2J0SD 1VQ5S 4Q7AA 3R27A 3MD1A 4WP8A 4LMZA 1Q53A 9RUBA 2HFVA 2OHDA 1H3DA 3THPA 3MPUB 4A8XA 5IFMA 2IC3B 1Q79A 3QT6A 5IZHA 4UZBA 3CPWR 2D9OA 3BDPA 3Q89A 3CJ0A 3V4MA 1X60A 3KK1B 1L3SA 4CLUA 4X2BA 4O3NA 7AT1B 5J2PA 4DPUA 1RTJB 1X31C 4H4OA 3JSMB 1HBUA 2FC8A 1FDAA 2V9KA 3BYPA 3DGPB 3IM9A 3MPVA 4HTIA 4DDFA 1A6LA 1FT8A 4DR7F 3IMQJ 1VRTA 2KL8A 2C2RA 3C15B 2AGOA 4LFCJ 1FRIA 4UZCA 2WSFC 3LOUA 2J8AA 3UE2A 2ZUGA 2J0QD 3DOMB 4ED1A 1CJKB 3U02A 2QYGA 5IT9U 3M32A 5LMUF 1AZSA 2MLZA 2PMHA 3K17A 4ZVOB 1U0SA 2CNOB 4RLEA 5IT4A 4L3KA 2A2CA 3CD7A 3CDUA 3SV3A 2DVIA 5F8JA 2CPFA 4AUKA 1RT2A 3W60A 3FRYA 1L3KA 1R27B 3MMJA 3G71S 5ETMA 1UVIA 3OR1A 3LUYA 2BOAA 4M5LA 3HD2A 4DX5A 3M9MB 2CDQA 5IT0A 3G8TA 2XLKA 3H25A 4NLYA 4NRUA 4YB7A 2UXDJ 1NM2A 1X5SA 3PJXA 2BJ8A 1PGZA 2XS5A 3RGIA 3THTA 3A3OB 3HHLB 1XR6A 4Y2AA 2FUG9 7FD1A 4RUAA 2C2NA 5E2QA 4C0OC 3BR8A 4PUOB 4WWSA 2DNMA 2QMWA 1SJ1A 1GH8A 4RJVA 3T1HF 1CEZA 1AXQA 2AIRB 2V5HG 1S9GA 1XQIA 1U7LA 2MQ8A 3OV7A 1VQLS 2OJ3A 2E44A 2MSTA 4B3MJ 3LALA 2DHXA 1Q78A 4QQBA 3MHYA 4RW7A 1WWHA 2HWHA 3DLGB 3RB0A 2MQLA 4CI0B 2BXJA 5FDLA 5C24A 1HWIA 3DRRA 1AUSL 1TL7B 2P9EA 4ZP9A 3TP2A 2N82B 3PW4A 3UI3A 1KLNA 1B64A 1WI6A 3N6NA 2HURA 4TN2A 3DHWC 3VHQA 3W2WB 1QAYA 1SC3B 3MTJA 2Y1JA 3JXOA 3M8QA 1X4DA 5E7OB 2AZ1A 3KDNA 4HHUA 1VHIA 2B4UA 3NGRA 4WFXA 3GCXP 3I4PA 5A8RB 1M5SA 1T03B 2MZTA 2YVSA 2PMZD 4UY8T 3IXQA 2MQQA 2LECA 1KQFB 3QAEA 4G1IA 1T05B 3EGWB 3DOKA 3I31A 1BLUA 1WTBA 4QOTA 1RQ0A 1F2HA 3A8IA 4H54A 5D8HB 2CPIA 1PG5B 2UV8A 4DL7A 1VMBA 3H90A 3HX9A 4OYWA 2WBMA 4LSZB 4JI2F 3JTPA 4O3OA 5KT6A 4QWAA 3CMAS 5L1IA 2YNHB 3HSZA 3C2PA 4WF9Q 3DM2A 2ILYA 1D9DA 5LMNJ 1S9FA 2Y0BB 2HLUA 4NLDA 1JJHA 4QYZJ 3DRSB 1Q5VA 2WB4A 5J1EA 2FZKB 2BANB 3KYLA 5GADU 2I5JA 2LP4A 3BN4A 2YY3A 4LF1A 4XK8C 1VC6A 2PO4A 4FNIA 4OX9F 2YX7A 3FCHA 1T3OA 3NOCA 2OIHA 4JYAJ 1UFLA 3W5XA 2YQ0A 2Z4PA 3AA8A 1JJCB 4NCAA 2DCLA 4PRFA 3GV7B 4OHXA 1E6YA 2YNGB 5K9FA 2AWZA 4Q45A 3RAMA 1U1KA 3FQLA 3IR6B 3UFCX 1C4AA 3W8GA 4DG1B 2FVQA 3IBWA 3RUBL 2KRBA 4FPIA 4KPCA 4TU9A 3PX4A 3H5YA 2UVWA 3SSRA 2UVUA 3CJKB 5CAAA 5KFGA 1VQ7S 1FJCA 3JSMA 4O44A 1HBUB 2P2CB 2JC0A 2V4JA 4GVBB 4TKTA 4Z2XA 3LP0B 5KFCA 3DMJA 2VDIA 3GZ7A 3LPYA 5JJBA 2IAJA 4MAKA 4KO0A 2AX0A 1CC7A 3JTOA 4C6AA 3OVSA 1V6HA 2LA6A 1XMOF 1FX4A 1LOUA 2QE5A 1XIQA 1SKRA 4WCEQ 4IRKA 4K4ZA 1ZS6A 1QAIA 2F1FA 4KAIA 5AE1A 2F9DA 4K50A 2OGUA 5BYQA 1CQMA 3HHEA 3MMAB 4HTJA 4PXBA 5ITHA 2G1HA 1VJQA 2GHPA 5F0UA 2QX0A 4CO1A 2XYGB 2Y0SD 4K5RA 5C42B 1TR0A 3BGUA 1KKHA 4KRWA 4LIRA 1FHTA 1X4FA 3CDAA 3C14B 4Y2CA 1UVMA 1NH7A 3HD1A 3JS9A 5H9EJ 3BDEA 3UD3P 1LWEA 4N8NA 5A6WA 1H6KX 3R5DA 1HNVA 2IIHA 2Y8YA 2IM3A 2X51A 3N6LA 4LSLB 1OY6A 4O23A 2ZOFA 2VODA 4J37A 5A0YA 4DFMA 2JEJA 3PTWA 2BRLA 1J2VA 2W2QP 3JQKA 3KNGA 4PG6A 1KWMA 2KU7A 2R7RA 2XS7A 3QSIA 2V0NA 2G0IA 5T7LA 1Q86T 1SL2A 4BWJA 4DR2J 3X1LB 1HYSB 1TKTB 2AEFA 1WTFA 1Y3JA 3VGVA 2WHOA 1FKPA 4EMDA 5C24B 2OKQA 1R8HA 4MKVA 1TL7A 1N0VC 4CLFA 2KFYA 4ED2A 3VAGA 1UMJA 1WKJA 1Q8LA 3DGVA 3PO5A 2WOMA 4F7VA 3TW0A 2E5JA 3NG8A 4OLPA 4ZHRA 3JYTA 1PC4A 1HWKA 2R2SA 3FSXA 2KJWA 1PO6A 3JQMA 3IWLA 3OPKA 4DPTA 5J2NA 3J7ZT 3VGSA 4LF2A 1L5UA 2QGFB 3MR6A 2ADCA 4ECQA 3R5BA 3S8SA 5FIIA 2QG9B 2RH3A 3IRXB 1NAQA 3MM9B 1QAJA 1XMQJ 1UEKA 1RSCA 1P1TA 5KFUA 3DC2A 2CJYB 3T6JA 2G0CA 1U2RA 3HXMA 2ACMA 4NCGB 2DGTA 3ZZRA 3EXYA 1Q4RA 5F8IA 3OHAA 3KLVA 5C7PA 5HN0A 3HT0A 3H4BA 3HJFA 3KMQA 1YWXA 1NHVA 2FLOA 3DM2B 5SUHA 3KLEB 3CTRA 3CD0A 1NHKL 1LKZA 1T0TV 2JLFA 2ZDPA 4I67A 5A8WA 2HGNA 2HQGA 1SI9A 2E7VA 3DLKA 5HBMA 2I5JB 2COLA 1JJ2R 4C7QA 2QLWA 2Q43A 4ZP7A 1HPZB 3VCDA 2KDOA 3CCLS 2DRDA 4PYAA 1NKCA 3TWZA 4WKRA 1Y9OA 2W25A 2ZBQA 1NJXA 2IMOA 5KFIA 4H4OB 1KVJA 1MROB 1N0UA 1VBYA 4JI7J 3GTYX 4B9NA 4ELVA 1FDNA 3GCWP 3EPGA 2DHAA 4ZLNA 3Q2SC 4LQ3A 2GGPA 2HSEB 1H2VZ 3JB9k 4FP9A 2QFJA 3T9ZA 1ZM3A 3BKUA 3F44A 3M32B 3Q8UA 3VQTA 2L3MA 2RD5C 3CJRA 4YY3J 5B09A 2ZITA 2UUCJ 2RKIB 2D3UA 2QL9B 4KO0B 2F40A 3CT9A 2YKMA 4OI4A 1S1UB 1B99A 1Q16B 2DGQA 2MLYA 3UCZP 2MKHA 1RT7B 1FRLA 2J9EA 4NYOA 1GXLA 4TQSA 3CULA 2ROPA 2NXUA 3LANA 4CM0A 5CYQA 3ZZPA 4A8SA 2LVWA 2LDIA 4MIAA 3DYAA 4X4RA 1Y5NB 1JLEA 1XK8A 2OFGX 4BC7A 1VQ8S 2DHHA 2MTLA 4DV6F 1ZBTA 1FRKA 1S4FA 2FLLA 2X1FA 4PKDB 4OI2A 4RUBA 3UR3C 5D77A 4AT1B 1OJ4A 3ZNJ1 4FZVA 1NDPA 2J9DE 4J9PA 2ZH9A 4DR2F 5AXLA 4ECSA 1U1QA 3CJ3A 2C28A 2B56A 3ISND 1JXEA 2VF3A 1MSWD 4NMXA 2HHVA 1JLCB 3OTOF 2MKJA 2PN6A 3TYTA 4K4YA 5FDLB 1FVSA 3OQ2A 2CPZA 3BQ0A 1YQHA 4GO5X 3O3LA 2P8IA 1HQ2A 2ZZMA 4J90A 1RBAA 1HYSA 3FMWA 2EFGA 3FVYA 3MCMA 3UN2A 3W62A 4PG7A 5C2GA 4DV7F 3V6DA 1FXDA 3MD3A 2CG4A 4OZ3A 1NK8A 3KHHA 3J81U 3WHIA 1R8CA 1S7IA 4HT5A 2HW3A 4DV1F 1YZ7A 2K7JA 2MQNA 2AJ1A 2DISA 2VG6B 3AOCA 1F60B 3FBBA 3QFHA 4WK3A 3G82B 4ZK7M 3OFFA 5CD4A 5HANA 4DL3A 1QVFR 3QLHA 3AQPA 3IBCB 1RAOA 3SQOP 3OBIA 4DL4A 3QMQA 1RLCL 3KLFB 1C1CB 1VGYA 2BABA 2VH7A 5KFWA 2MQPA 4M94A 1HNWJ 3GQCA 1F0XA 5L1LA 5AXKA 2I38A 1LXJA 3KLIA 4WJBA 2A10A 2HEKA 3PNIA 4QW9A 1UW9A 2WVCA 5DQIA 5F8HA 1P27B 3R5GA 2CQPA 1YJTA 4FF2A 1TFWA 1WEZA 1AW0A 2RQ4A 1U6ZA 1R0BG 2E5HA 2BANA 3I6PA 2VJUA 2D69A 1QSYA 4KJIA 1CG2A 1VRQC 3GJRB 3UCUP 4C8KA 2KG1A 2JLEA 1SV5B 1CULB 2L9NA 3NGKA 4ZDNA 1R31A 1U6FA 1EZZB 1NMEB 1O0PA 2CPJA 1UFKA 2GVDA 2ILZA 2YQ3A 1K73T 4HDHA 1HWUA 5K8PA 4ZVGA 1N32F 1Q7YT 3CDEA 2YKPA 5D0RA 3R7SB 4CRJA 2FVSA 4DL5A 1JLFB 2GVZB 4CIOA 4G1QA 5KG6A 3CJSA 3I82A 2EVZA 3KHLA 3IG1A 4PWDA 2BKNA 1LWXA 2BE7D 2KO1A 2CQ4A 2WK4A 3GFYA 5B0CA 3M9OB 1RBLA 3MDFA 2X1AA 1D9AA 3LW5C 1VBZA 1I1GA 1BMQB 4YHHF 2W7PA 2C42A 3QRPA 4N56A 1RT5A 4GKJF 3GP9A 1REGX 3IGNA 4DN0A 2B5JB 1SCJB 4OLOA 3HVTB 5KFFA 4FS1A 5F8NA 4DV3F 2ASYA 4IDKA 1TUVA 5DLFA 3M1VA 1VRUA 3NBPA 1JLQA 2VD3A 3ENWA 3MTKA 3NLCA 1XTZA 4RPFA 3FSYA 4CO2A 1FNOA 4K2XA 4MK8A 3T9NA 4CQ1A 5A6PA 3NKYA 4ZCKA 5CHCB 2DNNA 3GWCA 1WKLA 2A2DA 4Q5VA 4DR6J 3U7JA 2BDPA 3AA9A 4OYXA 3M9NB 1KP6A 1OPZA 4O4RA 4OYMA 5HQMA 2EKNA 4NA1A 5EN1A 3HKZD 2RRBA 4Y00A 1N5YB 2K7KA 3RW7A 4AXJA 5HVGA 4DR1F 2E9TA 1UPMB 1XMBA 2CKWA 3A8EA 3UW1A 1ICEB 1MMDA 2PC6A 3J81Y 2OO4A 4DF4A 3DRPA 2B9WA 2VG5B 2O66A 4RO0A 1S0NA 4LF4F 4KBIA 1U1NA 5A8RA 2XGPA 1UA1A 3SDEA 2DXDA 2HBQB 2A6OA 1RKJA 3QFWA 4M63A 3WDOA 4ZLLA 1M90T 4X64F 1TFYA 2AF6A 4F4YA 2NXEA 2ALZA 4ILRA 2VA2A 2MYFA 2DHSA 2XCPA 4ZVPB 4FF4A 3HSDA 1L3UA 1KBRA 3T1HJ 4F0KA 3H98A 4E2FB 2AYGA 1DLOB 3T5LA 5J2NB 4TNOA 4ETXA 1FXLA 4P75A 2EFVA 3RBXA 4FKXA 3RBZA 4A47A 3D28A 3V81A 2DITA 4GMKA 5D0GA 5JVHQ 5GAGI 2E7XA 3G96A 1GAOA 3ELHA 4QIVA 4ZPAA 2KRRA 3VZHA 5JVGQ 1FI4A 2DH8A 3CIMA 3M7VA 4EI2A 5BXIA 5U47A 3HCXA 3QLHB 5D4PA 2F4VF 4JB8B 4OZNA 2HHSA 1AROP 2W2NP 3M2VB 2M7SA 3PR5B 3EZ5A 3SMZA 2IVFB 1ZAVA 3HZGA 4CP5A 2LKZA 1GX6A 2OI2A 3EYZA 5J2PB 4CNYA 4DX6A 1X4AA 3DFEA 1MWZA 2Q79A 3KG4A 3C16A 4DV7J 3T3FA 2AD9A 1W2IA 2PEBA 2CQHA 4J9SA 2HRUA 3I55S 1XNRF 1YGYA 2ROGA 1JKHB 4DI6A 1XMOJ 1OQ6A 1PC5A 4ZN3A 2MHNA 4U8YA 2NYIA 1KOHA 3D9BA 4ANEA 1OSCA 3LGMA 1VC5A 2GJFA 2XWYA 2QLBB 4BBYA 3W1YC 3JSRA 2ASJA 3EGZA 2I0XA 2F8MA 1W26A 1NPKA 2HFOA 1GMVA 3C6UB 3HHDA 3UDEA 3OL9A
chains in the Genus database with same CATH topology
3D0HE 1FDDA 4QW8A 3OUYA 1SL0A 5C25B 2KFZA 3OL7A 1X0FA 4EYHB 2YKOA 4QWBA 1CLFA 4QWCA 2ATLA 2C3YA 1WHWA 3Q0AA 4ECXA 1SIZA 3GR1A 1Y7PA 2GMJA 1HNIA 2UUWA 4JI1F 2RUGA 3ZZTA 3KJVB 2MMYA 4X66F 3V6HA 3CDBA 4EZ6A 5E3PA 1D8ZA 1Q1KA 1RT7A 3MM6B 4OZLA 1FJGF 4Q8EA 1Y5LB 3G9CA 1CQNA 2NUHA 3K5MA 3ZZZA 1LWEB 1FO1A 4L6V3 5KG4A 5GAGU 2R7VA 5H1SV 4J9NA 1IXKA 2M5YA 4D3GA 5L38A 1XBWA 4A8KA 5M2RA 4C3MA 1RT6A 2MY7A 2UVVA 2G4BA 2GX8A 3ZFVA 3IR7B 2LA4A 2N3LA 1WF1A 1H2TZ 1M5KC 5FLXY 2YKQA 3RB3A 4AL7A 1N88A 4IQMA 4KPYA 2JFKA 2QYCA 3QGIA 2W8LA 3FQKA 4E8UA 1YI2S 2AP6A 4IRDA 1IKYB 1GTHA 6FDRA 4ID5B 3G6VA 1U1OA 4C0BA 1ZTTA 4NCGA 2MZQA 2Q1LA 1OPIA 1TQLA 2RU9A 5F3ZA 2E5GA 3M30B 4ZCIA 2B4VA 3DHXA 1S10A 1G7CB 1NO8A 2BUNA 2P6TA 3HFKA 5D4OA 3R1HA 1DFDA 4ECTA 1IKVA 4A8MP 3NMRA 1WI8A 1FRMA 4I0WA 4OZJA 3WBZA 3QZ7A 4MFBA 5HBMB 4KGMA 4TYBA 3HKWA 4WFNQ 4F02A 2QA1A 4ZLPA 3MURP 2BE2A 4TLQA 4USHA 3CJKA 4YB1P 1XEZA 3PW0A 2XMMA 5E5NA 4WFBQ 5D6GA 1KS2A 2EKYA 2NZ4A 1LW0B 1FRJA 2KT2A 3LH2S 1RISA 2YTCA 3MM5B 3OFEA 3LGNA 3W2WA 3GIKA 2DO0A 2FC9A 4ETZA 1SC6A 2WSEC 2Z8QA 4GO7X 2ZHAA 1QLNA 3KMSA 1S6PA 4H4KA 3EPIA 3KLGA 2DNQA 1YVFA 2IM0A 1GXUA 2PA8D 2I1RA 2YNFA 2JZ5A 3R5AA 1NZAA 2CVEA 2FTRA 1VC0A 2DPJA 2PA3A 2N3OA 4FXWA 1FEHA 1ZM9A 1JLAB 3TX8A 2VPYB 3S1TA 3LO3A 3ZC4A 3V4IB 3HT3A 2JFDA 4J9RA 2I2YA 1TP7A 5G0RB 3SEOA 4EBCA 4A8QA 2EG1A 2HPUA 3IS9A 4ED6A 1R43A 5T7LB 4OZ5A 5MLCV 1QVGR 2ZH8A 3QJJA 1YJRA 1UEVA 2F9JA 1NJWA 4EEYA 3BN7A 2XMTA 4U6PA 3G4SS 3Q8RB 1KQSR 1S99A 4LJMA 4DSFA 1FJ7A 5KFVA 3SSSA 2UU9F 2KZZA 1TKDA 4V19X 3OTBA 2CPYA 2QA4G 2GFFA 4RW8A 4ZS6A 3QIDA 5JUMA 4O44B 2CRLA 4YUDA 2V4JB 4X4OA 3B82A 3DU5A 2AGQA 2YH1A 2DRBA 2DNKA 1FKAF 3M2UA 4DUYF 1EETA 3ITHB 3DNCA 2V94A 2ZBIA 3BF4A 1Q8BA 2FY1A 1U24A 3VAKA 1N56A 1SBRA 3WC2A 2BRKA 4Q2MA 1TKXB 1DRZA 3IC1A 4URQU 2CPXA 2ZOMA 2VUGA 2CPEA 4X4PA 2FJXA 3FZBA 4OHYA