5B0FA

Polyketide cyclase oac from cannabis sativa, y72f mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVEVTFESVETIQDFIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0fA00
2ROEA 1CPZA 4HI2A 3UDCA 1MWYA 1TZ0A 4OJGA 3HHLC 3KG0A 1FE4A 4FNIA 1AW0A 2XMTA 5B0EA 1YJTA 2N7YA 2GA7A 1YJVA 5F0WA 1FE0A 1P8GA 2N4DA 3FRYA 1FVQA 2ASYA 4DN9A 1FESA 1R6YA 1X8DA 2JDJA 2AP6A 4U9RA 2RMLA 5B0GA 4A48A 3LGMA 4OIXA 1N5TA 2GCFA 3HHLD 2AW0A 4ZOSA 1SQEA 3BGUA 3HHLA 1APSA 2XMUA 1CC8A 2HQIA 2CRLA 3BB5A 4HL9A 1JK9B 4DPOA 1CC7A 3I9ZA 2HLTA 2LXFA 3T9NA 1JWWA 3HF5A 2W4DA 3QMQA 3TOQA 2XMJA 1GXUA 3DXSX 2OD6A 1Y3KA 1YJRA 1FVSA 5A6WA 2HLUA 5IXUA 2GGPB 1N5VA 1Q8BA 2AJ1A 2G9OA 4Y2IA 1AFIA 1FEEA 1RJJA 1VQSA 2GGPA 1GXTA 1Y9OA 1TL4A 1YRXA 2KT2A 2W4CA 3KKFA 4QOTA 4Y2MA 4F67A 3FMBA 2OFGX 2RU9A 1VQYA 2HIQA 5K9FA 3WDOA 2EW9A 1OPZA 1K0VA 3LGNA 2AJ0A 4YEAA 2GV1A 3BDEA 5B0CA 2IFXA 2K7JA 3E8OA 1Q4RA 2QIFA 5KAKA 3HHLB 3KNGA 2BJDA 3QGPA 1SB6A 2FHMA 1TUVA 1LQ9A 1OQ6A 1QUPA 2GFFA 1Q8LA 3TNVA 3VTIA 2OD4A 2N4CA 4OJ3A 1TL5A 1N5SA 2ROGA 4YDXA 1AFJA 5T7LB 4A47A 1Y0HA 5B0DA 1KQKA 5T7LA 2KKHA 2IYIA 2HFOA 2QYCA 2XMKA 2HFNA 2RSQA 3HX9A 4FNHA 4NL5A 2QLXA 5B09A 3GZ7A 3BM7A 2KT3A 5B0FA 3CJKB 1KVIA 2W4PA 3BF4A 2ZDPA 3CJKA 3MCSA 5B0AA 2FB0A 1Q53A 1P6TA 2GO8A 4OJ1A 1S6OA 2LQBA 5A6PA 1OSDA 2OKQA 2Q3PA 3K7RA 2ZDOA 2QLWA 1FD8A 1SI9A 2OMOA 3HFKA 5B0BA 2OP5A 2BBEA 1W2IA 1XBWA 1U7LA 3MZIA 1S6UA 3IWLA 4NPOA 5B08A 2L3MA 1X0PA 2BYCA 1YG0A 1URRA 4Q2MA 2BUNA 4EFAC 2K7KA 1OQ3A 2IYGA 2XMMA 4HH0A 4Q2LA 1ULRA 3F44A 3BR8A 4DL0C 2K2PA 2LDIA 2RILA 2ROPA 1TR0A 2FTRA 2LQ9A 3HDSA 3FGVA 2OFHX 4OJHA 2PGCA 1X7VA 2VH7A 3TRGA 1Y3JA 1KVJA 2ACYA 3LO3A 1WD6A 2OAUA 1YJUA 2BJEA 1N5QA 1IUJA 5F0UA 4A46A 2VV5A 1MWZA 2K1RB 3KG1A 1V3ZA 2PD1A 2XMWA 2XMVA 4HH1A 2FIUA 2K1RA 2KYZA 4Y2KA 4ZA1A 4HI1A 3DCAA 3BN7A 3IWXA 4A4JA
chains in the Genus database with same CATH superfamily
4KPYA 5BJRA 3W66A 3FRYA 3W2WB 4MIBA 1C0UB 1FDAA 2B43A 3VALA 2WONA 2XLJA 3AXKA 1HA1A 5E3AA 3DOLB 4WCEQ 4L76A 3SIPB 5HQLA 3P3DA 2QIFA 5EWFA 1JXLA 1VBZA 4IOCQ 2UUWA 3F56A 2YNIA 4DL5A 3IAS9 3G87A 2K3KA 1A9NB 4ZLPA 1L3VA 2CNLB 5KG4A 2QMWA 1TL3A 1NNDA 3PFEA 4PQUA 2E7VA 3M6WA 2FDNA 2E5JA 1NK0A 3BSNA 2BOPA 4ILRA 3EUNA 4M5HA 2K7KA 2DY1A 4WWSA 3OFGA 3KJVA 1NB7A 2VG5A 5FIIA 3DRRB 1BMQB 1QE1B 3VAMA 2NQPA 2MJUA 2BABA 4LF8F 3H2UB 2ZEJA 4DUZF 5GMKa 2AJFE 3DLEB 2UU9J 1IWGA 1FESA 5B0GA 1NK5A 1RXOB 2W9BA 1FX2A 2AD9A 4DFKA 3QRPA 3G8SA 4OHZA 5LJ3Y 4ANEA 3VGUA 1VDHA 4Q8EA 4CYUA 4NRTA 2VHGA 1E6YA 4ECTA 3VF0B 2Z30B 4DUYF 1FEHA 1KQKA 3MD1A 3FQLA 5K8OA 3NL0A 3R9LA 1IN0A 4EYIB 1KS2A 2MY8A 4WF9Q 3BZQA 3N9UC 5JXSA 4OJ1A 5KOWA 4JI6F 4KHMA 2OMOA 1TKXA 1TUWA 1LWEB 3P45B 4OV6A 3NEKA 2FJXA 3IFEA 1L3KA 3RRGA 4RPFA 2MSTA 1RT6B 3KNAA 4ZP8A 2HFZA 2RUSA 2QRRA 2LQ9A 1HBNA 1S72S 1EZZB 1P1LA 3GYNA 2J0SD 5KFZA 4OQJA 3U1MA 1NHUA 1RT1A 4DPYA 3N0VA 1HQUB 2GAHC 4XTTA 1I6JA 1FDNA 2EK1A 4UTGA 2GS8A 5G0RB 1IJEB 5BYSA 3CF5Q 3HF5A 3GV8B 5D77A 4OMFG 1AB8A 1UZHA 3POTB 4ZCIA 1FO1A 5KFDA 4IG3A 1RISA 3D0IE 1R6VA 5HLFB 1LQ9A 2C3UA 5CAAA 3Q2TC 3ZTOA 2B9XA 2QLXA 1SJ3P 5J2NA 4A8MP 1B99A 2RHQB 3HI9A 2FZCB 2Z2LA 2GVZA 5IQQA 2B3TB 3T41A 3TO8A 4DU8A 2R7VA 4RW8A 3VAHA 4DOZA 1SKSA 1WHVA 5KFJA 1K1QA 4IH5A 4NZ7A 4LFCF 4LFBJ 1HBOB 1YK9A 3HM9A 1IJFB 2K3IA 3A12A 4YHHF 4KE5A 1WF1A 3TZWA 2GJIA 4XIUA 5AE3A 3VGTA 1IKVA 4A8SA 3R2CJ 1R0AA 2XMUA 3EWGA 4NXNJ 1AYEA 2VFVA 1RTIA 3KKFA 3CJTA 5MLCV 2GQQA 2QFJA 5A0YA 1RBAA 4ZLJA 2ASLA 4O4RA 2QJ3A 1HNWJ 2A6MA 4CLKA 1RCOB 1W2BR 3TQEA 3IR5B 2EFQA 1R3NA 4YDDB 1T9YA 4ZKAA 2IJFA 5B0AA 1FRKA 1FJCA 3KK2A 4ECXA 2VIHA 1OO0B 4NPOA 5SUHA 3NCQA 2BUNA 4MYTA 4GO7X 3LP1A 2O67A 3IC1A 4RNOA 3VGSA 4DV4F 1UETA 5C25B 3M8PB 3VZHA 4ZPDA 3Q8PB 4Y0FA 4AXJA 2DGSA 4GVBA 2MZRA 2D3OR 5CZVA 3OPKA 4A48A 2WONB 3BV8A 1FRXA 2UUAJ 2KXNB 1TUGB 1T02A 4CM0A 4ICLA 2RH3A 4OHXA 4FPIA 3OL6A 1F9HA 3V6KA 2GFFA 2YNIB 3GIMA 3OSNA 1H2TZ 5CA5A 1TL3B 5B0FA 2XS5A 4WXWA 2ZNZA 2XYPB 4KH1B 1PCAA 1M5KC 2RB7A 2BJ3A 2F40A 2LEPA 3DOMA 3KJVB 4MFBA 2VG5B 4DV7J 4Q2LA 4DZ6A 1JLFA 5LM7E 4UOGA 3ISNC 3TYTA 1UAWA 1KDNA 3FZ2A 1LNQA 2AEMA 2B7CB 2DNYA 1VC6A 3IRXA 3GJSB 4BC9A 1WDDA 1H3DA 1S5ZA 1UL3A 1N54B 3FKBA 2XZDB 2XO6A 2GIFA 1X5TA 1H2UX 3IGNA 5K20B 2W9BB 3LPYA 4DV5J 4URGA 4X4UA 4FXDA 1NJZA 1B64A 3LPEA 5GAEU 4J9UE 4CH1A 2W25A 4LF5F 1IQZA 1WI8A 4UT4A 2XI3A 3DDKA 4CYUB 4EWTA 1DFDA 3CC2S 2VFUA 3BGRB 1ZETA 3Q83A 1RTHB 1K0VA 1E6YB 3NY0A 2BJDA 1YRUA 3QJPA 4DSEA 4YY3J 3HPOA 3R7SB 3TUJC 5L1LA 3DRYA 3JAMY 1JXVA 3DI6A 2IVYA 1NKCA 3TR5A 4QPXA 2ZH6A 2GMHA 2BE2A 1TKXB 4OI3A 2CPJA 3T19A 2JWNA 5IZHA 4X4OA 1N33F 4CO4A 3UFCX 4JBCA 2XB2D 2D41A 4X4RA 4U96A 4HH1A 4I7FA 2GMJA 5LL6d 5IC4B 4G3IA 1FE4A 2JC1A 1RT1B 1CJVA 4V19J 4UZCA 2HQFA 5FJ4A 2QL5B 1QAIA 3I87A 3PX4A 1N5TA 4UY8T 1GNKA 3KLHA 2M70A 3KK3A 5A8KA 2E1CA 3ILLA 2CRLA 2B4OA 4LQ3A 3TX8A 1DRZA 2ILYA 3GB0A 2IY5B 1K8AT 2HS4A 3NNCA 2XSJA 2G2YA 4IG3B 1Q79A 1IBMF 2H4WB 2VPZB 2GNKA 5HROA 3PM9A 4XPCA 3GMGA 1HNVA 5J2NB 2FLOA 5IT4A 3FUYA 2GVZB 4B9VA 2O3DA 4USTA 2OP5A 4RO0A 1EARA 1G1XA 3HSGA 4NLRA 4DG1A 1LK5A 1SJQA 4DHVA 2HVHA 3F44A 2CYYA 3KUHA 1CJTA 2DR9A 4K5RA 2OFHX 2F9DA 1DLOB 2KXFA 2XI2A 4IRDA 1NMEB 4B9LA 4LBIA 3GIKA 2WVEA 3PW2A 4K0KF 1AROP 2IM2A 2HVIA 3PR4A 1R0AB 3HT0A 1A0OB 2W24A 4WFNQ 3OL7A 4HHHA 3EXYA 1RTIB 2AJ1A 2ZH5A 3BDPA 1BGXT 4IKAA 1LXJA 5A8WA 3DMJA 2EG1A 4DL3A 4OI2A 4B3TF 4ANCA 1WSRA 1Y5LB 4X4TA 4IO9Q 3PR5B 2PEBA 4V19X 1NH8A 2BR0A 4MIWA 4OZ2A 3GV5B 4USKA 2DCLA 2PSZA 1SXLA 3KK2B 4UOCA 2FJEB 3PY8A 2BQRA 3W2VA 1WOPA 1FA0A 2V94A 1JLCA 2YNHB 4XDCA 4X4NA 1PILA 3LP1B 3BN4A 4H4OB 4GRSA 5LXYA 3CMES 4JI5J 1GMWA 3JXOA 1EX8A 2N3LA 3J7YI 1WHWA 4LF6F 3CDAA 4YR0A 5K8MA 4KGMA 1NHKL 1LOUA 1KTVA 2ZHOA 3RR8A 4AQYF 2HNDA 5F0WA 2A2DA 4PKDB 2MLZA 1I51B 5E41A 4WU3A 2E29A 2H65B 2ZUGA 5L1KA 3M1VA 4ICLB 2IPOB 3EVOA 2W4CA 4H4KA 1UA0A 3H90A 2DVIA 3TJ9A 2H54B 1HHSA 3GYGA 4F2SA 1C1CA 2U2FA 2HHHF 2PT0A 1SJ1A 4F3QA 1FNOA 3JS9A 2EC2A 2LQ5A 2NREA 5LT5A 1N56A 2EWHA 2EVZA 1T9XA 2CVEA 1S1XA 1FD8A 2GJ2A 3NBPA 3DOMB 3OJUA 1C2PA 1T9TA 3CGIA 5CD4H 1JQGA 2Z2MA 2E1RA 5AE2A 1C4AA 1JLFB 2YPYA 2QA4G 1KVKA 1XK8A 3N5BA 3RBZA 4H4MA 3HSJA 2HHSA 4KFBB 3IRXB 4OI4A 2X1GA 3NAHA 2A0FB 1IBKF 1YBUA 3OBIA 2Z2YB 4OYOA 2BE7D 2CQBA 2XLIA 3CCJS 1KSPA 2AGPA 5GADU 2CQ1A 3ISZA 3RU0A 2E7WA 1U8WA 2KM8B 4ZPCA 3NP5A 3THVA 1JIHA 3BGUA 4X62J 3EGWB 4X4SA 5IC6B 2IRYA 4Z37A 3AA8A 4DR7F 3N28A 2JEGA 2ZWPA 1ACMB 4QOTA 1W7WA 3QPIA 5K9FA 3DLLQ 4R8UA 1IBCB 1DAXA 3CW2C 1IBLF 2GV1A 4HEA9 5IM0A 3KLEA 1TFWA 3KJQB 4CM2A 1LXNA 3LWMA 3KXDA 4C3KA 3PX0A 4KT0C 2DHHA 1RACB 1T94A 3DI6B 2B9WA 2HHUA 3L9ZA 3RGIA 2VASA 1YITS 3NCPA 3D0HE 5G4DA 1J5EF 2BE2B 1P6TA 3S7RA 1W2IA 1URNA 3IWLA 2MZTA 2OJ3A 3MMCA 5HVHA 2ALYB 2FLPA 2RHSB 3UW1A 3A13A 4OHWA 4I7FB 3TA2A 1HBMA 1QLNA 2DIVA 2ZBCA 4HI1A 1S57A 4F2RA 3MM9B 4WKRA 3L7PA 3RRKA 1CJVB 5IT9U 3MDFA 4BC7A 1Z1ZA 1T9UA 3KK3B 3KLHB 5A8KB 1APSA 5DQIA 1CVJA 4OLOA 4ID8A 3W1YC 1WKLA 4ZP9A 2QG9B 3CD7A 1GXTA 2A2CA 2XSJB 1R8PA 4ZJOA 2PI5A 3QT6A 5T7LA 1HNVB 2JFDA 1VYAA 1SL1A 2DKOB 3PRBA 1J5OB 4OYZA 3ULHA 2PFFB 2EG2A 1JKHA 4DUTA 4PXBA 1S6OA 4J9PA 1VIXA 1OSDA 1HPZB 2BBEA 1FFWB 3CCVS 1N48A 4F3MA 3RRHA 1CJTB 4WFYA 1JNZB 4NWBA 4UQTA 5DDQC 2YY3A 1KVJA 3LO3A 2BANA 1MWZA 3QATA 3KG1A 2CQ4A 1N6QA 4IH6A 3GFYA 2BQUA 4ZP7A 2X3DA 2DRDA 2DO4A 3V2UC 2Q66A 1WWHA 3RZAA 2OEMA 3DGVA 3Q86A 1U8SA 2LXFA 4QWBA 2FYXA 4WK3A 2YH1A 3KK1A 5A8WB 4OI0A 2GHPA 1S1WA 3TP2A 3I9V9 1T05B 1FWLA 1EKRA 2Q6BA 1HWJA 2YQ1A 1FK9A 2ZFHA 3AJDA 5DO2A 4LF7F 1Q53A 3W2VB 4OYIA 3DRPA 4NZ6A 2B6AB 5B08A 1Q7LB 2JEFA 2ZC3A 2CNKB 3UWTA 5EWGA 3CCUS 4M5IA 4KQZA 1LKZA 2HURA 3ZNJ1 2JNJA 2ZH8A 3U7JA 2Z58B 5LJ5Y 2DEJA 2Z8QA 3R1HA 2Y9HA 2XMTA 4J7CA 4M1KA 3RBEA 1U6FA 2ASYA 3V5RA 1TL7A 3MMBA 2AQ4A 3BREA 1YI2S 1B70B 3I55S 4FXVA 3LUYA 3OR2B 3MWBA 2V67A 3M1VB 2V68A 3BYPA 4IOAQ 2RUGA 2G9OA 1VGYA 2P6TA 3MURP 1X60A 3HULA 3HK2A 3R5GA 1KQGB 2UUCF 1FDBA 5LOQA 3H5SA 4BHQA 2IDLA 4UW2A 2ZBRA 2MLXA 4X64J 1TU0B 2JOQA 3DM2A 1QSSA 2ZE2A 1YJNS 1L3SA 1NJYA 1V6HA 2KT5A 5ETVA 4B9SA 2ZVIA 4MH8A 1S1XB 3NBPB 2RDIA 1IKWA 1OSCA 3RBXA 4K59A 3PACA 1NPPA 5DETA 3RAQA 4NXMJ 4H4MB 4LF9J 4C0OC 2VBWA 5KG2A 5HMWA 2YNFB 2HEKA 1N36F 3CJ0A 3TVYA 2HMIA 4I6AA 2I38A 2D3O1 2DNMA 1YX2A 3OL9A 3I56S 1HWKA 1VIOA 4V1Ak 1UWAA 2FGOA 5C42B 3UD5A 2PA8D 4C8NA 2XYGB 1PC5A 5F8LA 4R8UB 3WDOA 4RZRA 4DPUA 4P9SA 5IM0B 1NK8A 3KLEB 2YTCA 2VFRA 1XR7A 4ZPWR 5H9EJ 2RQCA 3M30A 4I2QA 1WDTA 1QY7A 5HAOA 2UV8A 2J9CA 4ZCLA 2DHAA 2WW4A 3OTEA 3WIUA 1FXDA 3K7RA 3A3PB 2CPIA 2AHOB 5KOXA 2KL8A 3M32A 2YWKA 3MMCB 2RRAA 3IG1A 2ACMA 1RWXB 4URSA 2V4QA 2X1FA 5CZXA 1HBMB 4JI1J 2PDAA 3JYTA 4DFJA 2DXEA 4RJVA 4ZVOB 1HQEA 2AGOA 1YJTA 3H42A 2YWWA 5F3TA 3BKFA 2YKMA 5KFPA 1S1TA 3HSZA 2CG8A 2HAIA 3UO0A 3EE3A 4OHVA 2LCWA 4M94A 2MKHA 2F1FA 4W90B 1L3UA 1H6KX 4LRBA 2LEBA 2RU9A 4YR2A 4B9NA 1XNRF 3NRBA 3UR0A 4OX9J 3TAPA 1RAIB 3CNQP 4U8VA 1M5HA 5T7LB 1FD2A 2KFNA 2OEJA 4DV7F 2ILZA 2ZH2A 5LSRA 2OPQA 1RWNB 4WZMA 3FCWA 1U2FA 3MOZA 2OKQA 4WYWA 2R7XA 4BLGA 4ELTA 5DZ6A 1K47A 2EFGA 4JB8B 2JEIA 1YJWS 1VQ9S 4ZVPB 4J91A 2OEKA 3GILA 4DV5F 2HHPA 6AT1B 2BANB 2OAUA 1RE1B 3KYLA 4Q43A 3CJQA 2VDHA 4U8YA 4HHUA 4OJGA 3C16B 3EZUA 1A6LA 1NDPA 4J9RA 3ILJA 4ED8A 2Y1JA 5GAEI 2KFZA 4JI3F 2A18A 2J0WA 3CMAS 3CTRA 1RTJA 2VFTA 3LA0A 1AW0A 4U6PA 2A6OA 2BRKA 1S1WB 1GMUA 1VQYA 2KZMA 4K5SA 3MCNA 2E5LJ 3NGSA 4NI2A 5DS7A 3O5TB 2R2SA 1XMQF 1RHMB 1GX6A 3SFGA 2NXCA 1FK9B 1FKPA 2R7OA 3GP9A 1Q0NA 1VR6A 5J2QB 3CCES 1C1BA 1NXIA 4EGLA 3DRPB 2FPHX 3LTOA 3NMAA 2ATCB 3EDQB 1KEKA 4J9VA 2F8MA 1RKJA 4C3MA 1HMVA 1ULRA 3B82A 3G82A 2BVZA 2CQCA 4DLGA 3Q8VA 4U95A 2MQOA 2XMVA 2NLWA 5IT9Y 2K1RA 4PYAA 2G2OA 3CC7S 1CPZA 3UPFA 5LMUJ 5HK4A 4OYAA 1CJUA 2CDQA 1GXLA 2P8IA 2B0GA 1NSQA 3GWCA 1TL7B 3MMBB 4ZVSB 3FRZA 4LMZA 2DGUA 2MQPA 2V2ZA 2HHVA 1P27B 3M6VA 2F3JA 4I68A 2NZ4A 4L6V3 3L3CA 4KIAA 4IH7A 3RUBL 3QIPA 1F60B 1Q86T 1LW2A 3SZ2A 4QIEA 4F4KA 1S0MA 3KNGA 2X1BA 1TL5A 4IR1A 2ZE2B 5L1IA 3OVAA 2CJKA 4F0KA 4CLPA 3ZTRA 5EUHA 2GO8A 3PTWA 1IKWB 2CNOB 2UUBF 2ZDOA 1SV5A 5B0BA 2WW8A 1IM4A 1RA6A 5M2RA 3HVRA 2BMBA 1QVFR 4MKAA 1D8YA 2K2PA 4CO3A 3EJMA 1UTAA 1PSDA 5HQMA 2XTJP 4NRUA 3H7HB 1RHKB 2MHNA 2HMIB 2MHEA 1DZ5A 1RHRB 3DGPB 2NXEA 1RT5A 1UFLA 4C0HA 5L38A 4DXLA 2ZVSA 2WOMA 4OIXA 2E66A 1QSYA 3VV2B 3PW0A 4NX9A 1S6PA 3MPWA 3HJFA 2BEFA 1RWUA 1VQLS 4F4ZA 1FEEA 1UEVA 1WEZA 2R7UA 1UCNA 5KFYA 1JLAA 3M30B 2V69A 4CWBA 4I2QB 3D6HB 4UUXA 3ILIA 4RL1A 3GIJA 3T1HJ 1DJ0A 3UR3C 5AXLA 3CIZA 2ZDPA 2F8HA 4LVOP 4ES3A 5KG1A 3GCWP 3RW7A 2IMOA 5F8GA 1P9YA 4WFBQ 4O3PA 2YWGA 2R3VA 3GG1A 4NCAA 2WB1D 2DRBA 3JYTB 1U1OA 4ZJQA 4EBDA 3JSBA 1Q8IA 4ILMA 2O66A 2IVMA 2DXFA 3GJQB 3HT3A 1HQEB 3OR1A 1TTHB 5CYMA 4DL4A 3PHEA 3PW4A 2AKWB 2YKMB 3AOCA 1S1TB 2OH2A 3GIRA 3KOAA 3HFVA 3MI7X 2PA3A 4OX6A 1RWOB 4I6WA 2UXDF 1KKHA 2QN6B 1OS5A 2LLZA 4DFMA 2PMHA 5KFSA 2DXDA 1NKBA 2EFNA 4ZVTB 3OTBA 1CBKA 2UXBJ 4G1QA 2JJ4D 2DPIA 5AXKA 4B3RJ 3HHEA 3BO4A 2OPQB 3J7A1 1ZTWA 3ENWA 3GJTB 1VQ7S 4ZVGA 1XR5A 5DM7Q 1HHQA 2LQBA 5A8RA 4NYOA 4FF2A 4RLEA 2DISA 3FMWA 1KLNA 1YDLA 1KFSA 5D0RA 1FNXH 1YJ7A 1PJ7A 2OHDA 4QBUA 1QAJA 3HD2A 2LEAA 1UVKA 1UPMB 5DZ7A 2ZH3A 4X62F 4M5GA 4G1IA 2KDOA 1SL0A 2NZCA 4HI2A 4HLBA 2N7YA 5GAHU 4A8FA 3M6UA 2N4DA 3VVUA 4AXIA 2OTJS 3B6BA 2HQ3A 1WC1A 4DCPB 4FBUA 1T0TV 1UFWA 1VQOS 1Y3KA 5IXUA 1D3WA 2WSEC 1VS3A 3IS9A 1HW8A 2H9ZA 3TJ8A 4NI2B 1D8ZA 4TQRA 1RLCL 2G2ZA 2A3JA 4B17A 3GCXP 1Q82T 1HBUA 4OZLA 2HZAA 1IM6A 1FKPB 4DV1J 1HNXJ 2CPZA 3G86A 4FNHA 4OLPA 3TARA 2QC3A 4ZPAA 5KFWA 9RUBA 2HHQA 2IDEA 2D1CA 4CI0B 2AU0A 1JB0C 2R2RA 4WP9A 1HMVB 3G82B 4I4BA 3R6GB 4ECSA 3NGRA 1ZAVA 2JVRA 3K8VA 2K1RB 5MAOA 5KFMA 4Y2KA 5U47A 3RB3A 2FHOB 2CQGA 3H98A 4DU7A 1CJUB 3QNWB 4OZ3A 3TANA 2EFPA 1HHTP 2FQQB 1L3TA 4WP8A 4O3OA 2JDJA 2HBZB 3PKYA 3QAEA 2MKIA 8AT1B 3QIPB 2BQ3A 5CCLA 3ZZYA 2A1BA 2W1BA 2CJXB 1LW2B 4J90A 4F0MA 1T95A 2CQ3A 1UPPA 2E9ZA 1OPZA 3GSDA 3BGLA 3M8ZA 2DGWA 1JMTA 4KRWA 4DL6A 3FEXB 3OTOJ 2KKHA 2UVWA 3OTDA 1U6BA 3QJJA 2HFUA 5HMZA 4DN0A 4NLPA 4Y2AA 1S6UA 1YKWA 5SZTA 1M5PC 3HKZD 4NLTA 1S9EA 2HNZA 2P6SA 1TQLA 3DLGA 1EIYB 4B3MF 3HDSA 3DHWC 1VRUA 4DEZA 4N47A 2Y8YA 2RRBA 4A46A 3QGHA 4CLLA 4DBQA 1FKAF 4ZIVA 1RT5B 3UQSA 5D15A 3HP6A 3LGMA 2YH0A 4B3SF 4HDGA 3HO1A 1T03A 3JTPA 3OHAA 2NYHA 2EPIA 2E1MC 1BE4A 1DQAA 5CD4A 5C24A 4USUA 1KLMA 4ES1A 5M2UA 1WOOA 2FUG9 4TKTA 4HKQA 5ETRA 4YB6A 3MEKA 5KT3A 4RNFA 4TY8A 2IRXA 1FF2A 2HWHA 1B7YB 2CWXA 4KJIA 3AY0A 3PZPA 2APOA 5B0CA 3W7BA 1S48A 1NJIT 1ZS6A 5BR8F 1RLDA 5IT0A 3GTYX 2E1PA 4KGZB 5FDLA 1HR0F 1KOHA 4WIQA 4NA2A 2PN6A 2D3UA 1FRMA 4DR5J 3GLJA 2XO7A 3D3CJ 3BBFA 1JNRB 3T1YJ 1R27B 2JLFA 2V2KA 2DIUA 1XNQJ 1QSLA 1ZM3A 3SSQA 3UDVA 1GT8A 2BDPA 2DNRA 1PAUB 1W26A 4TLRA 4O0NA 1JX4A 1NHVA 1RBLA 3FGVA 3MF5A 4O23A 4DR2F 4PWWA 2XULA 4Y6IA 3BPDA 3ONQA 3QWPA 3MCOA 5IFMA 3OR1B 3IBCB 3CD5A 3DRSA 5LSLA 3W8GA 2W2NP 3ELHA 3OXGA 3A8IA 3D67A 4CO5A 1WI6A 3ET6B 2Q79A 2QL9B 5CYQA 3I32A 3O44A 4R0EA 8RUCA 3MMAB 3SCJE 3EYZA 2QSWA 2DNGA 3H2LA 3FQKA 2DYAA 2L08A 3JQKA 1JWWA 4DSLA 3R7NB 3HHLB 3RAXA 4G1QB 4LIRA 3MEDA 2QYCA 3SCLE 4A8XA 5AJ3F 3C3LA 3BGFA 5LMNF 2XMAA 3FCVA 4C98A 3DOKA 5A8RB 4P10A 4RW9A 2E5IA 2HVZA 3CCLS 4HTJA 4DV6F 2Y1LB 3CULA 1X0PA 3RR7A 3D1QA 5DG9A 4B9MA 4P7VA 2FTRA 3W2WA 4LFAF 2KH9A 2I9SA 1SBRA 3ZZPA 2CZVC 2BA9A 3C46A 1S4EA 3DLKA 4MAKA 4QCLA 3OFEA 3UDCA 4ZVEA 2WK4A 3G71S 3DOLA 1WHXA 2J0QD 5HATA 1V5VA 1YIJS 4Q8FA 3QSYB 2VBZA 3TI0A 3V4IA 2C2DA 1UA1A 3R97A 4MKYA 3DU6A 1DQ9A 2XLKA 1Q16B 2LXIA 1HBUB 2KVIA 5C5JA 4RNMA 3K5LA 1CS4A 3DYAA 4WKYA 4ELVA 5HBMB 1S10A 2IJNA 1YWXA 4XPEA 2FJBB 2RIJA 4JI1F 2HGLA 4TNOA 4J9MA 1U7LA 1JJ4A 1WACA 3EPIA 1HI8A 4HH0A 2R42A 4K50A 4A8QA 3FNNA 3ITHA 4NLSA 5EDWA 1F2HA 3SCIE 3VQTA 4DV2F 5GAGU 1Q78A 1N8RT 1NK4A 4KKOA 4IO1A 4X65F 3PW5A 3HHLC 3DDIA 1T9VA 2CFXA 1CJKA 3MEEA 4ZPTR 4E98A 4OX9F 3BKUA 4GO5X 1DTTA 4QYZK 4BCAA 3G6YA 3ZTQA 3OL8A 2AZ1A 2EXUA 1GXUA 5KFQA 5KG0A 1N5VA 2V9KA 2FJWA 4OYMA 5ADZA 3E51A 4JI8F 4BS2A 2H3EB 1XMOF 4MTPA 2IC3A 4DFPA 1ZTTA 4L74A 1SQFA 4ZVFA 3K5OA 4ECQA 1DARA 4A8OA 2RJZA 2E5HA 3OHBA 4PUOA 2JZ5A 3G9CA 3AQPA 5JMNA 1BLUA 4YB5A 1UVLA 3HFKA 1S9EB 2HNZB 2RDJA 1U1KA 1YGYA 4QYRA 1BQNA 3DLGB 3KLFA 4JV5J 5KT2A 5E2QA 1VRUB 2DNQA 3D3BJ 2V8DA 4DV0F 2GMLA 1HQUA 4TXSA 4CNZA 2R8HA 1FJGJ 3D1OA 4CDIA 5D6GA 5L9XA 5F8MA 3W61A 3LWLA 2PEHA 3QZ8A 4K4XA 4OV1A 3QLHB 2QO3A 3D0GE 2DD8S 4C8MA 2RMLA 4WBFA 3CXCR 4F0HA 1T03B 2EC0A 2HS0A 2R7QA 4ETXA 1CC8A 1NU4A 2ZM6J 5C24B 1KLMB 4OI6A 2HHTA 1VBXA 2GAGC 4M5KA 1RJJA 5ETQA 3RB6A 4TY8B 4OZ1A 4JI7J 5HMXA 2C2KB 4J9NA 3QYYA 3PG9A 4RWWA 2VODA 5FDLB 1BD6A 4A47A 1REVA 2J7UA 1SJFA 2XMKA 1B4SA 4ZVRB 1M5OC 4J37A 1U49A 1VQ6S 4DSFA 1WHYA 1VI7A 1NPKA 3A3OB 2H1YA 3DHXA 5KFFA 1HWUA 2ZH7A 5E0OA 4MKVA 4RNNA 2W2OP 2MZ1A 2BM0A 3DRSB 2NXUA 2KI2A 4U7UK 2C1EB 1PYTA 2XGQA 3ENVA 2W9AA 2OGUA 3L4BC 2UVUA 5F8NA 2XG8A 1D9AA 4AL5A 4ZIWA 5CYQB 4USMA 4DL7A 2DR6A 3W8PA 2J9EA 3T5JA 3BBBA 1QD1A 1QDUB 4P74A 4O3QA 3RW6A 4YOEA 2COLA 4F4YA 3ZTPA 4ENOA 2VU5A 3TA1A 4ECVA 1I1GA 1S6QB 1Q7YT 1UMJA 1XJWB 3JAMU 4NLOA 2W2PP 4W98A 3C2PA 3CJ3A 3MEDB 3OLBA 2GQ2A 2J6UA 2H51B 2ZD1A 2DH9A 3KMSA 1G4CA 1N0UA 3LW5C 3QGIA 2HPUA 3DOKB 4RW9B 4RW4A 5C25A 2G1DA 3CB4A 3Q23A 4A8YA 4GMKA 3GQCA 1XQIA 2B56A 1R31A 3M8PA 2XBPA 3ENQA 3K5NA 3LF0A 2FVCA 2DRAA 1WC0A 1U1MA 3OUYA 1O8BA 1HFEL 2C2NA 1WOSA 1DURA 1V3ZA 3DLKB 3QO9A 5J2PA 2YKOA 3PYGA 4B9TA 4K4UA 4IQXA 4IQMA 1FRJA 2VKZG 2HWIA 2ZBPA 1DTQA 2LDYA 3K8WA 3KLVA 2W4DA 3MFHA 4NOHA 2ALZA 5KFLA 1Q8BA 3V4IB 1HLWA 3T1HF 2C3PA 1CULA 3E3XA 5J1NA 3AD8C 4B08A 3QQCD 3LANA 1U45A 1K73T 1TK5A 5KFAA 5AXMA 4ITSA 1BHNA 1CLFA 4C7QA 3MAQA 3AB2B 1CS4B 3H4DA 3DYAB 4X66F 2W2QP 2POKA 2RSQA 2ZZMA 5K8NA 1YRTA 4ECZA 1SH3A 1VJQA 2VC0A 4DMZA 3AH6A 4I1TA 4P71A 5T14A 1URRA 1TMMA 3ITHB 1Y11A 4KHPF 4FZVA 3LQVA 1VK8A 1Y3JA 4KKOB 1RAHB 4GKKF 1S7HA 1FJEB 3FSIA 1TVRB 2BJ8A 2QLBB 3GV7B 4CO1A 3HCXA 1X0FA 1CJKB 2V2VA 4ZN3A 3MEEB 3BQ0A 3CCMS 2M4MA 3BGRA 1RTHA 1DTTB 3K5MA 1RAOA 1RZMA 2KN4A 4JI2J 1D1UA 4K4ZA 5C2GA 1HD0A 2UXBF 5KFRA 1TL1A 1SC3B 5AE1A 4DS5A 2D3ZA 4GVLA 2W8KA 1BY9A 7FD1A 3PRDA 2IC3B 2O01C 5KFHA 5EWEA 1JXEA 1CG2A 2Y0BB 4LF8J 2IYIA 4QWEA 3AJ1A 3CPWR 4PUOB 4NL5A 1O0PA 4TYBA 2EK6A 3CCSS 2VJUA 1EB0A 3QT8A 4DQSA 4S0MA 1PC4A 5D4LA 2AEJA 1SI9A 1BQNB 2IVFB 3KLFB 5HMYA 5IWAF 1HYSA 4YB7A 5KFVA 3UNGC 2DBBA 4KYZA 3J80U 5F9LA 4RU9A 3I0SA 2ACYA 1FHTA 2LXUA 2FIUA 4DUYJ 3HD1A 3SSRA 3VAJA 1SC1B 2M5YA 2J9DA 2Y0SD 3CO9A 4AE5A 3CDUA 1J27A 4JI6J 5E5NA 3LP0A 3MHYA 1YJRA 4DV1F 2OPSA 1HNXF 2MGZB 3DC2A 2J76E 3PYEA 1U26A 5KFUA 4DQIA 3L7OA 3F41A 3IP0A 5KAKA 1VRTA 1REVB 5E3CA 1U1QA 2BW2A 3AJ2A 2KRBA 1JLEA 3W60A 1VC5A 4KAIA 4FXWA 4DR4F 1DLOA 4AT1B 4ALZA 4FYVB 5IOLA 2V34A 2NXNA 5HVFA 1U0HB 3SSSA 2ROPA 3U02A 4Z7YA 2HIYA 2H5JB 3MTKA 1FKOA 3OXLA 1N5QA 2E1AA 4OX8A 4PG5A 3T1AA 3BN7A 3SI8A 2AF6A 2CQ2A 4FF3A 4NASA 2HHWA 2YXLA 2AYEA 4I56A 4Y00A 3KG4A 1F9FA 1QM9A 5FD1A 1TFYA 3MAAB 3M9OB 2CQDA 3N79A 2AJ0A 3S1TA 4ZVHA 4LFCJ 2VD3A 2MY7A 4ZPVR 3X1LB 4NZ0A 1GFWB 1R43A 3CJ2A 4Q7AA 2ZD1B 2YNHA 2JX2A 2DHGA 2MLYA 4H4OA 2AMCB 1RAFB 4FVCA 4B9UA 3M4XA 4BBYA 4RW4B 2QA2A 3CJ4A 1NSAA 1PAEX 3MR3A 2CIMA 3BSAA 1QTMA 1HL6A 2F7VA 4FPRA 2L3MA 2K06A 4RUCA 2DK2A 3PIPQ 3OUYB 3EGZA 2JVOA 2PGCA 3QT5A 3J81U 3HHNB 3MCMA 3QO9B 3VGVA 2J8SA 5J2PB 4ID5A 4I67A 3DCAA 2A10A 1XMBA 4CCHA 4C8YA 1P9QC 5J1EA 5L8RC 2E44A 1OJ4A 3GFXA 3MPYA 4EZ9A 1DTQB 2QSFA 3MM7A 3BH6B 3HMJG 2HLTA 3QMQA 4O3NA 5A6WA 4LF4F 4DR5F 4P2FA 2KT2A 1CULB 3PHTA 4KTQA 3SQGA 3U1NA 3MECA 1XNQF 4DV4J 4C11A 1UVNA 1AFJA 1H74A 3LH2S 3KUEA 3VZIA 2C28A 2DITA 1H98A 1WTFA 1S7IA 2JL9A 4WYLA 5A6PA 4KFBA 2OELA 4JI4F 2HRUA 1KWMA 2MDAA 2AX0A 2GVDA 2K8GA 2Y1RI 4RUAA 4RUHA 1BC6A 4RKUC 3BR8A 2XZTB 1TP7A 1ZA2B 3EX7B 5FLXY 1BXNA 1U25A 4QIFA 3KDNA 4RU2A 2B8QA 3L09A 1ZPWX 2N82B 4X84A 3A8JA 3FVYA 4DCOB 1RTZA 6FDRA 2BOAA 1R8CA 2CA9A 2Q6CA 4ZOSA 4FKXA 3I9ZA 1TL1B 1FI4A 4Q45A 1PJ6A 2CNNB 4ED4A 1GX5A 5EX0A 3THTA 1MNEA 2HYIB 4RWXA 4FS1A 1RKIA 3TNVA 1VBKA 3QZ7A 2FHJD 4WTOB 3OVSA 2C2RA 1N88A 5F8HA 7FDRA 3D6FB 2DNHA 3NNHA 4R25A 2FVPA 3H59A 2RU3A 3PW7A 4LBPA 1I94F 3MM9A 3SMZA 4LF5J 2XMMA 1HYSB 4OZ5A 1NZ8A 1RAEB 2LDIA 1WF0A 5F8JA 4CT8A 2HSEB 4C8LA 3I0SB 4UOHA 4B3OA 2BJEA 4K4VA 4ER8A 1RADB 2AYGA 2KTQA 5ETMA 4F04B 4X4PA 2XCPA 2MTLA 3D6MB 3CDBA 1VQ8S 1WKJA 1OPIA 3NOGA 2JLGA 2AP6A 4LUBA 2CUYA 3RAMA 2DNNA 2VF3A 5KT7A 1M1GA 2VPWB 4FDFA 4IOBA 5KTQA 4IUFA 3LP0B 1RYRA 4AFFA 2OPSB 1AUSL 1RCXB 3MPDA 3G6ES 5DRKA 1J5OA 3CD6S 2E5GA 3O6QA 2DGTA 5F41A 2RD5C 4KGXB 3QFHA 4ZVUB 4DQPA 1VRTB 4J9QA 6FD1A 3LAMA 1HPZA 3CJ8A 2RQKA 1F1BB 1JLEB 2MSSA 4Q5VA 2OO4A 1VQKS 1RTDB 3D66A 3QIDA 2B5JA 5DLGA 2LA4A 1YG0A 3Q0AA 3KHRA 4KV8B 1RHUB 4LREA 1ZYQA 5IS2A 4QU7A 2BKNA 1Q81T 2DJWA 1YTYA 3GYXB 2UXCF 1FKOB 1V3SA 5DQHA 3M2RA 4QPTA 1IBMJ 1C4CA 4WJBA 4RBTA 4DV3J 1MLAA 2DGVA 1WG5A 5B0EA 1H73A 5J2MA 1T05A 4NLVA 4NLGA 3I31A 3CSKA 2OIHA 4KC5A 5HL7Q 4OYBA 3GR1A 2HVEA 3SCKE 2L9DA 1WC6A 1TAQA 5K14A 4ECUA 2XS7A 2HBQB 3CUNA 2WVDA 5D4NA 1FWKA 4CLFA 2QLFB 4JYAF 1IQTA 1TUVA 1MW7A 2FC9A 1Q5VA 2CKWA 5D0HA 2B6AA 2ABYA 1L5UA 1VFJA 2R8KA 4BWMA 4K0KJ 2VONA 3E2EA 3J81j 3BSCA 4Y28C 2VG6A 2ZJQQ 3B8HA 2G0CA 4EMDA 1TK0A 4Q0BB 3J80Y 5T41A 1VBYA 1WEYA 4FVMA 2Y3YA 3CJRA 2QMXA 1NDLA 2ZNYA 4DF8A 3AD9C 1TKDA 2QX0A 1X4HA 3BJYA 3IM8A 4LSZB 1Y7PA 2WSCC 4QR2A 4ID5B 4P2SA 1WTBA 2KYZA 3OR2A 1A7GE 4G6VB 3IR6B 2ZM6F 5J1EB 4B3TJ 3TAMA 3N6LA 3EDRB 4M63A 1X8DA 3MM7B 3EVWA 4KO0A 4USHA 4JV0A 3DLBA 3VHQA 2KJWA 2E7XA 2YWFA 3SQGB 3MECB 2HQDA 1IWAA 4C11B 2MEWA 4LF6J 3GONA 1KNZA 4TU9A 4ZK7M 2DNOA 4Y3CA 1IR1A 3PJXA 2FJAB 4AQYJ 2BJ7A 3FBCA 2C42A 2AIRB 2F4VF 4EK2A 3D5MA 2G13A 1S9GB 3FBBA 2YNFA 2GVDB 3ZZTA 3MUTP 3WBZA 3G2XA 4WFXA 5H9FK 2G0JA 3PEHA 4DI6A 4DR1F 3ENAA 4ED7A 4K2JA 3LAKA 2V8HA 4YN3B 4A8KA 4C2MA 3DXBA 5C42A 2IHR1 2HHHJ 2ADBA 1U1NA 5C7PA 1UJ6A 3SDEA 3SEOA 2NS1B 2ZOFA 1YJVA 4UZBA 1VHIA 1P8GA 2DR8A 4URQU 4P73A 2CQ0A 1S99A 1KRPA 1UP1A 3M8WA 2L41A 3CT9A 4LJMA 4PG7A 1X4GA 4HTIA 2ASDA 3U27A 2DT9A 4PWDB 1OY8A 2VQEJ 2VOOA 4OFZA 1MSWD 3MAHA 1QJHA 2QYGA 1YQHA 1OQ6A 3UCUP 4EO8A 3BGOP 3SV3A 3GFHA 3CCZA 3NGDA 2MB0B 2V4JA 3RB0A 1VJWA 4USIA 5JUMA 1HKAA 2B9EA 1S1UB 3AODA 2FC8A 4C6AA 3R8YA 4EYHB 1NH7A 2ZKTA 3J81Y 3JQMA 2MKJA 4D3HA 2D9OA 4B3OB 3K0JA 3RG6A 4ZA1A 1WUUA 2NSBA 4DQRA 3IA0A 2P5VA 3RB4A 1U2CA 4LSLA 3ILOA 4M5DB 4DR6J 2GHWA 1VLYA 3UCZP 1J5EJ 1ZPVA 1FJ7A 3HHLD 4WK1A 3WZ0A 2CZ4A 3BB5A 1HQ2A 1RT4A 2XMJA 5DM6Q 1FVSA 1X31C 2YBVA 3J7Z5 3KWMA 3R3TA 4EO6A 1TMJA 2OFGX 1TAUA 3HXMA 2V6AA 3P5BP 2MZQA 3K89A 4AL7A 4X2BA 3QRQA 4F50A 3NGKA 4GKJJ 1LWFA 2UU9F 5KG6A 4DWIA 3OFHA 2D7SA 4EBCA 4PWUA 2B5JB 3K2YA 2C3OA 1TELA 3FBEA 2VA2A 3C16A 2MQ8A 2GHVC 1D0EA 4NMXA 2Q1LA 3KUGA 1RP5A 3M2RB 1X4EA 1G6BA 4JI2F 1EQMA 3E01A 3MM6B 1ZBTA 2MQNA 1KC8T 3IWXA 1NDCA 4YB1P 2GA7A 3I5BA 5J2MB 3AHPA 1FVQA 2HAFA 2DH8A 1RAAB 4IG0A 4ZJLA 1SQEA 2G1HA 4HT7A 1S0VA 2YWHA 4D3GA 4LT6A 4QR0A 4DLEA 2LECA 4RR5A 5K14B 3NWGA 4QIWD 2OSRA 4TY9A 3B4MA 4ATNA 4IFVA 5J2QA 2VJVA 5HN0A 3RTVA 3QGPA 2FHMA 1WEXA 2HVDA 4OJ3A 2EBGA 3BS9A 3MM5A 2HW3A 3T6BA 4N8OA 4N77A 1XWLA 4F36A 3R2DJ 4ZMMA 2VG6B 3HZGA 3R5AA 2YKAA 2L9WA 2HWTA 1RWVB 1M5SA 4UOFA 3THPA 3JSMA 4IDKA 4LQ9A 2CVIA 2YKQA 4XK8C 1ZOTA 1EAYC 3M05A 1S12A 1TK8A 1UW4A 2C2OB 3EVMA 4N56A 4P72A 1FT8A 3Q8SB 2LU2A 3FDSA 5D4OA 3TAMB 1UEUA 2Y1IA 1LWXA 2F9JA 4E2FB 4I64A 5KG7A 4DN9A 1RU1A 4LF7J 4X4VA 1Y00A 5EGYA 4KO0B 2OSQA 2DNKA 1CC7A 3R6LB 1AFIA 1VQSA 2QEXS 2EKNA 5E33A 2ZC4A 3A1YG 3BDEA 4LFBF 1N32J 3SXLA 2FY8A 2M0GB 2VC1A 2C3YA 4ZCKA 3BH7B 1TKZA 2PMWA 5DJBA 1UFKA 1RAJA 4FYWB 2FHKA 2WTFA 3TVZA 2H5EA 4NXNF 4CLWA 2J0XA 2IYGA 3A3NB 4ZITA 3T5KA 2QV6A 3DGPA 3MOJB 5KFNA 1WC3A 1RSCA 1HNWF 2IM1A 3M2VB 2P9CA 2UUCJ 4CZCA 4L72B 4HDHA 2QA1A 3SV4A 3SDEB 1PO6A 1B3TA 1RB0A 4KY3A 4O3SA 4K8RA 1X4FA 3OW2R 2N3OA 4DX7A 3JQJA 2ZHAA 3V6JA 2WBRA 1E6VA 3BKTA 3W62A 4ELUA 2ZH4A 1F3VA 3K59A 3SYZA 1WC5A 2NSCA 2CJBA 5K5MA 4J9KA 2HFVA 1UKUA 1MWQA 4G1PA 4YS2A 3QSIA 1KHWA 3OTCA 4FYDA 1KFDA 2IIHA 3Q8UA 5KFOA 3BQ1A 5D78A 2NCKL 3H5YA 1S0OA 3GFZA 2QLJB 2R7TA 2ZOMA 1N36J 3UVJA 4P75A 2FHJA 2V4JB 2OMLA 3CE8A 2DHXA 2ERRA 3HJVA 2HGNA 2D69A 2OPRA 1ZA1B 1U47A 1HNIA 2UUAF 3MZIA 1Y5NB 4C9DA 4N76A 2EEYA 4PRFA 3GG0A 3PXGa 2VH7A 1QUVA 3HVTA 3TUIC 1SJRA 2HG4A 3I96A 1IXKA 3ADAC 3DLHA 2ZJPQ 2MXYA 4LSLB 1NUEA 2YQ3A 3D6TB 2RE1A 1Q1KA 4PCQA 1GK8A 3I6PA 1RT4B 4PYDA 4USVA 3PIOQ 4ZDNA 1JJCB 3EM1A 5ETOA 4JI0J 3NXZA 2B4UA 2J8AA 2RS2A 5AT1B 2MPUA 4LVNP 3OXFA 2YWEA 1RT7A 2VQFJ 1R8BA 1SUQA 3RBDA 2OD4A 2IBOA 1N5SA 3FZBA 3C6UA 2AGQA 3MR2A 1SCJB 1NZAA 1K44A 1LWFB 2VUGA 1GEHA 3EMTA 3KHLA 2WZ1A 1WG1A 2NXJA 3D7SB 2AT1B 1N34J 1B0PA 4AUKA 3UCGA 4PQUB 3H0PA 1ZM2A 1FCAA 4HACA 4MMOA 1XNRJ 3CC4S 1NEEA 2HKEA 1MROA 1CSJA 3E01B 4ZN1A 4YY3F 1U2RA 1XEZA 3MEGA 2XYHB 2M2BA 1O5JA 1HWIA 1FRHA 1M90T 2ASJA 4F7VA 4KSEB 2UZAA 1H38A 4N41A 1S97A 2FLNA 1EHWA 2Y8WA 3CWJA 4IG0B 1REGX 4O0IA 4F25A 2GCFA 3BR9A 3MM8A 1UWBA 2CJQA 2RRNA 1C0TA 4CRJA 4EU0A 4DX6A 3ZZUA 3PYDA 2EFOA 4IFYA 2VZ9A 3FMBA 4IFVB 3UNYA 2R7WA 4MT1A 3R5CA 4HT5A 2F65A 1SL2A 4CLUA 3NCRA 4DSKA 3MM5B 4DF4A 2H4YB 1DHMA 1S59A 2AJ2A 2I2YA 4DR3J 4UUWA 3CCTA 3NS7B 1GTHA 5ETSA 2W4PA 4DPTA 1XIQA 3PJ9A 2M52A 2AZ3A 4CQ1A 1BQXA 3GPAA 4JI3J 4M5JA 3QBCA 2QZ8A 3JSMB 4IDKB 5DG8A 2W7PA 4M8LA 3R5JB 3N5FA 1SKRA 2EKYA 3DU5A 2LMIA 5HI7A 8ATCB 3FEYB 1IUJA 3EICA 1XMQJ 3G8TA 1ELOA 2GQCA 1PYOB 1LW0A 3TUPA 3PDNA 5A76A 3TEHB 1Y5IB 3CIMA 1UVMA 1HBNB 3SBMA 5B7WA 4BDPA 2AW0A 1X4CA 4YFUA 5I3QA 4TLQA 3MMJA 1X5PA 4G65A 3HFZB 1XC9A 3S6EA 2IA0A 3BYRA 1NBEB 2HBRB 1OY6A 2DGOA 3LP2A 4HYKA 4MYUA 4F4AA 5CYJA 2PE8A 3VR1A 4LF2A 5GMDA 3SQOP 1NDKA 1N4LA 3HX9A 2JHEA 1TKZB 1D9DA 3UI3A 2AV5A 5L1JA 2XM3A 4P2XA 2J7KA 4DV3F 4RNHA 4J9LA 1S1VA 4ED6A 1B0VA 3GU0A 2VBYA 4I0WA 1YJUA 5A2QU 1AZSA 2F8EX 3BPSP 1SKUB 1GTEA 4RW8B 1B7FA 2MQQA 3VAIA 4PEOA 4EBEA 1AUDA 1E6VB 2BX6A 5L39A 3B54A 2V8GA 4C48A 2UUBJ 2R4FA 3IBFB 1Z4UA 4K4SA 3IGVA 3MFIA 1IR2A 1YBTA 4JI5F 1Y9OA 1T8EA 3R5BA 3MUVP 4NMLA 2LQ8A 1WC4A 3Q8RB 1FNMA 3DFEA 3CMQA 7AT1B 1IKVB 4CLTA 4PG6A 3UVJB 3VAFA 5KFIA 3JSRA 2XHWA 2KT3A 5A0YB 3QFWA 2OPRB 2FGCA 3U1LA 1HNIB 1CQMA 3CCQS 1MMDA 3D28A 4EFAC 2HZCA 2BM1A 2XS2A 2RILA 5DDPC 1N52B 5M2PA 2GW8A 3ET6A 4E8UA 3HVTB 1WD6A 4I2PA 3T3FA 2XC9A 3MMAA 3W9IA 1WKKA 4GC7A 3VQSA 3CJSA 2NR0A 2ZJRQ 2CZ9A 4CIOA 3UDEA 1UW9A 3OT9A 3N6NA 3HHLA 1SC6A 3MPVA 1MN7A 4HL9A 3MR5A 1DBDA 3T9NA 2LFVA 5ETNA 3TOQA 4ANDA 3WIVA 1NSKL 3A4TA 2GGPA 4RUBA 5F8IA 4Y2MA 3H20A 1U02A 4GVBB 1VHFA 1AXQA 2B9YA 1YBAA 4QQBA 1RT7B 1NPRA 1NJXA 1SUQB 3PJWA 2D9PA 2HQGA 5I4MA 3C6UB 4YDXA 1R0BG 1FFGB 1ICEB 4LRDA 2HFNA 2HRYA 3PEJA 4CH0S 2IJRA 3G8QA 2BXJA 4QR1A 2KRRA 4NLYA 2DHSA 3P8BB 2UXDJ 3N6MA 5GADI 2C22A 3KJNB 1AT1B 3D9BA 4HACB 3NLCA 3AAWB 3DN9A 4BWJA 1YHQS 1MROB 2ZH1A 1QAYA 3MEGB 3WQPA 2XEXA 2GC8A 3MXHP 2EBEA 5DDRC 4FKYA 3V6DA 1XERA 4MFBB 1FFSB 2VQEF 2DPJA 4P7TA 4PXCA 2XGPA 3UN5A 5L46A 1IVZA 1OY9A 2DO0A 3MM8B 1UWBB 1KONA 2ZZTA 1C0TB 5E3QA 3R1LA 2PI4A 3ZC4A 3QGGA 3CO0P 2UVVA 4IFYB 4WIIA 3O2IA 2IAJA 3VWSA 2U1AA 2YVSA 5KFKA 1SC4B 2Z2ZA 5HBMA 2Z57B 4FF4A 3Q2SC 3QAUA 2ROGA 5D4PA 5HQ8A 4DPXA 3MR7A 1XTZA 2FVQA 3TZXA 1SH2A 2NUUG 1H7WA 1Q95G 2SXLA 2E9TA 2BKPA 2MKYA 2CXEA 4QWAA 1MMNA 3C19A 3NS6A 3M8QA 3KHGA 3WC2A 5KT4A 3CEDA 4LRFA 1I3OB 2I8EA 4OJHA 2ZZNA 1FRIA 4DR6F 1X7VA 2ZKUA 1LW0B 1GH8A 4A4JA 1GQEA 1UJ5A 3HSDA 3MPUB 5JJBA 2VB6A 5CH7B 3OJSA 4U9RA 1O51A 2PFDA 3CVKA 1EQ0A 4JOUA 2KXHA 3EGNA 4QW9A 3W5YA 3GIIA 3JB9k 1U48A 5KT6A 4GKJF 2XY7A 1KBRA 2L48A 1AA1B 4UF4A 2RDDA 4OYXA 4JV2A 2IFXA 1ZM9A 2RQ4A 3LP2B 3CD0A 1HNZJ 4LRCA 3BEGB 3OV7A 2N4CA 4RW7A 2M8DB 3D2WA 1VK3A 3BQ2A 4M5NA 2CADA 1NKEA 2KG1A 3DRXA 4KR0B 2J6TA 4L3NA 1HW9A 5BYRA 3OFFA 5HROB 2VDIA 1Y10A 1V9OA 4PR6A 4HHJA 5D8HB 1S1VB 3L95X 3WHIA 1H72C 3JSYA 3NNAA 2VL1A 3QLHA 3W65A 1N0VC 5F0UA 1AZSB 2I0XA 1KQFB 3RYLA 2PD1A 3PCOB 2CPDA 4DG1B 4L73A 2KM8C 2M8HA 3TZZA 2GX8A 2XNRA 2HBYB 4TU7A 2HZVA 1VCTA 2WVCA 2MQMA 3NOCA 1KD1T 2ZBQA 2UV8G 3LALA 2CJ9A 3PYFA 4DDFA 2QT7A 4ZLNA 4FYXB 2KFYA 3PO5A 5H1SV 1NK7A 4B3MJ 1Q5YA 3J7ZT 3IMQJ 4ZVQB 1ZZNA 3TAQA 4NLDA 1CQNA 3W5ZA 3P5TL 4F4WA 1SH0A 2YX4A 2F4FA 3AT1B 3FEZA 2H5IB 1IR0A 2HFOA 3V81A 1V5IB 2C2ZB 4TN2A 3DMJB 3MCSA 4P2MA 4EUVA 3OD2A 3FSYA 3C14A 4B3SJ 1S0NA 2OPPA 1YLXA 4UQGA 3A8KA 4XAKA 4IRCA 2JEJA 1UJ4A 4KGKA 3WX8A 3UDLA 3HHDA 1TKTA 4I2PB 2AWZA 5BR8J 3EGVA 5CHCB 4YP3A 3PV8A 2DGXA 4X64F 3TUZC 1GMVA 1JLCB 1HR0J 4CP5A 3HVWA 2Z0GA 2XWXA 4DQQA 2RAQA 1N32F 1S6QA 3AFGA 4WU2A 5ITHA 1UVJA 3H5XA 2HGMA 1OIAA 2GGPB 2HNDB 1R7IA 4R0JA 4NXMF 4LF9F 2R2UA 4DR2J 2W01A 4PQAA 1ZAXA 1SVDA 3MGJA 3OSPA 1VQ4S 3QRRA 4O4GA 2DR7A 3B78A 3Q89A 4YQWA 1GAOA 1C1CB 2LQJA 3IN5A 4K7QA 2V63A 3L7UA 1HIYA 5I3UA 3OVBA 5A2QY 4PZVA 1FTRA 2VICA 1D9FA 1FTCA 1VC0A 2V8VA 4CTAA 4PG4A 4ETZA 2VV5A 4F3OA 3FC9A 3ZNUA 2P2CB 3B4DA 4QYZJ 3V6DB 2I5JA 1WNEA 3R27A 1VRQC 5AJ3J 2QGFB 2MKCA 5LMNJ 2ZHBA 1FERA 2R9LA 3O8WA 2WSFC 4QU6A 1NSPA 1P1TA 1JK9B 4DV6J 1IKYA 3DXSX 3H40A 2IAJB 4PXEA 4NEZA 4LFAJ 2M7SA 1T7PA 4ZHRA 1VLOA 1F5CA 2WVBA 4L3KA 3WX4A 2XSFA 4JUZA 3M6XA 3NWRA 2BE9B 2B7BB 3CDEA 2MJNA 2IA6A 2FZGB 3GSIA 1KN6A 4ZCMA 3M8QB 3AXMA 1TVRA 1RWKB 4CO0A 2XCAA 3NG8A 2L9NA 1HI1A 4OX7A 1KP6A 2CQIA 4LBHA 1MWYA 4FNIA 2P9EA 1MN9A 1F6TA 1F9EB 4JI0F 4CLYA 1FE0A 2PO4A 3KDOA 1Y4ZB 1X5SA 4RW6A 1FWPA 4CT9A 3P6YC 1U6ZA 4H4KC 3NMRA 2VQFF 3KLGA 2VG7A 4KGVB 2HQIA 3K58A 1FXLA 4DPOA 3Q8QB 4P6QA 2YX1A 4O44A 4DV2J 3TJAA 3M8RA 4RW7B 2MZJA 5I3PA 4X65J 2DNZA 2NPIA 1R8HA 1N34F 3P49B 1M1HA 1OWXA 4FF1A 3CJKA 5EX3A 3KHHA 3O3LA 2XQCA 2KVQE 1I5OB 2ZITA 5H9EK 2KHDA 3OLAA 2IBKA 1U0SA 4DSJA 1OMSA 1OQ3A 1RHJB 4WP3A 1T9WA 4IR9A 3ZZRA 4JI8J 2E5LF 1JKHB 1XMOJ 4IYQA 2J6SA 3TRGA 3K5PA 2IM3A 2HK3A 3GJRB 5KFBA 4C8OA 1H7XA 2XHCA 3TVKA 1TZ0A 1Z2ZA 3NAIA 1W25A 2VPYB 4LR9A 2MGZA 3AB4B 4U7CA 1MU2A 3AD7C 2BJ1A 2WB4A 4HVZA 3AOBA 3EPGA 1NK6A 3I4HX 3T5LA 1G7CB 1N6QB 5K8PA 3D68A 3AOAA 4DR3F 4ED0A 4ECWA 4PPDA 4DV0J 2E9RX 2J9DE 1RWPB 1Q8LA 4DSIA 2CDRB 3V81B 5LMUF 2YQ0A 2V2QA 1K9MT 5KG5A 3W9JA 1O6XA 3KK1B 2V5HG 1U0HA 2CPEA 1U09A 2O1PA 4NLUA 4FBTA 4LIWA 3DLJA 4L75A 2G0IA 3C14B 2JRSA 2OPPB 3C8YA 2BRLA 3Q24A 2M88A 5FLXU 1HARA 4JP8A 2W9CA 4NA1A 1Z2LA 1PBUA 3WC0A 5ETPA 3X3UA 5HJXA 1TKTB 2Z4PA 5F9NA 3H8YA 2B4VA 1BQMA 1FDDA 1NM2A 2F63A 5GMEA 1VQPS 5BYQA 3T9ZA 3PKMA 2IM0A 2IMWP 3KG0A 1NO8A 2WBMA 1TV6A 4K4WA 2D74B 3UN2A 1JLBA 2BJ9A 3MAAA 4W92B 3ETMA 4P52A 5D0GA 4ED3A 4ZPBA 1U1LA 2YNGA 4YMEA 1WSVA 3IR7B 3MD3A 2HLUA 1LFWA 1RWMB 1K0TA 1NRKA 1FX4A 3C15A 1PJ5A 1IKXA 3LGNA 3VVTA 2R7RA 1JJHA 3E8OA 4KB7A 4DX8H 3DKDA 2BKOA 4GC6A 4DCJB 2RKIA 3S01A 2CQHA 3I4PA 2JLEA 3H25A 4O4GB 4QJVA 1S4FA 2QL7B 2AJQA 4A8WA 3BO3A 5E7OB 5BXIA 1YVFA 3G4SS 3V4MA 5I3UB 3DM2B 2BACA 3FBFA 2AJ4A 1KQSR 1FXRA 4MK7A 5CCMA 4CTAB 5KFCA 2X7IA 2I6WA 2FD2A 3DNCA 2DR5A 2I5JB 4F8RA 2OI2A 3H5UA 1BUXA 3M2UA 2DY9A 1R8AA 3M9MB 1M5VC 3TX0A 5IQ6A 4F26A 4J5OA 9ATCB 4LRAA 3N01A 2QMUB 3M8SA 2VOPA 4Z7CA 1IKYB 2YKNA 2DNPA 4EEYA 4KPCA 3NS5A 4ZHRB 4MIAA 2CWKA 2JFKA 5E3RA 1V3RA 1VQNS 4ZS6A 3Q22A 2YPZA 3PRVA 3N4WA 1WELA 3T5HA 2GIQA 2RF2A 3GZ7A 2KG0A 1NK9A 2V0NA 3PFOA 2KB2A 2OLWA 4HR2A 1SJ4P 3R5DA 5AXNA 5F3ZA 1T3NA 1TR0A 2MKSA 4WZQA 1X4DA 2P9GA 2PMZD 1F5BA 2VBXA 5THWA 4B3RF 2H48B 2ROEA 3M32B 5GVQA 4KH0B 3IG1B 4X66J 2C2MB 5J1PA 1QTNB 1SPBP 1JJ2R 3IAM9 4RW6B 1VOMA 3KLGB 2ZOGA 2VG7B 3ZFVA 2XZWA 1T11A 4QWDA 1RYSA 3CJ5A 3ISND 4DUZJ 5DGAA 2V8PA 5KT5A 4O44B 2WRMA 1NJWA 4KHPJ 2ZWOA 1S9FA 2CJAA 4J9OA 4GKKJ 4EZ6A 1F2GA 2ATLA 4K4YA 1RK8A 1RWWB 2VA3A 2CJYB 2KJVA 2W7AA 4TQSA 3TEGA 3TW0A 3BM7A 3CJKB 1X9SA 3BF4A 4Y2CA 5ETKA 2KYXA 4Z2XA 1RT3A 1XBWA 1RAGB 3KLIA 3I0RA 3IO1A 2DEIA 5GAHI 5LSOA 2KO1A 2JC0A 5D3GA 3J7AN 4ILLA 5KFEA 2QFIA 2J5AA 3US5A 4CH7A 5HANA 1YZ7A 2CPHA 4MK9A 2C2EA 3K57A 1VQ5S 4XDDA 2X51A 1MU2B 1R6YA 2KHCA 1XN9A 1M1KT 1F3FA 2FJVA 3HVAA 2RNEA 2RS8A 4Y2IA 2RT3A 4MKBA 5IWAJ 2OTLS 1N5YA 2WAQD 1X4BA 1EETA 1PBAA 4YUDA 2F5GA 1RTDA 3FFIA 2AEFA 3TZYA 4KV8A 3TWZA 1RTJB 4QZVB 3O1LA 2V50A 1ZH5A 3PO4A 2QA4S 1H0HB 4ED2A 2O5DA 3BO2A 4DZDA 2W9CB 1EKSA 1F0XA 4DL0C 3G96A 4Y65A 1RUSA 2GIRA 1NB2A 5KFGA 5HO4A 1BQMB 3UE2A 1C1BB 2LA6A 4W4MA 2UP1A 2BZ2A 3OTOF 2M3DA 1X5OA 2W7OA 4U7UD 2AYBA 1ZAWA 1TV6B 4WFZA 1JLBB 2UUTA 5E3PA 4O3RA 1JLQA 3ICLA 4OZNA 1HNZF 4DR4J 2YNGB 4C97A 1OYEA 2DH7A 3C66A 2MKKA 4YHHJ 4WPAA 2HRTA 3C15B 1RDRA 1PGZA 2R8GA 4OZ0A 1IKXB 2HIQA 3IXQA 1VQMS 3NGUA 3C6TA 1RU2A 4PPZA 4PABA 3CCWA 4RBVA 2NYIA 1PIEA 2RKIB 1Y0HA 4Q0BA 2FVRA 3TA0A 4N8NA 4YR3A 1Q8KA 4DPWA 1RI7A 4DJBA 4PXDA 3KMQA 1SKWA 3W63A 2QE5A 1OYDA 2W8LA 3CDWA 1G3OA 4Q2MA 1DQ8A 1VMBA 1RBOB 4CNYA 1U24A 5JVGQ 3T6JA 5C2CA 2HNYA 4C3LA 4B02A 3FCHA 1DY3A 1JLGA 1SV5B 2XMWA 5DLFA 3M2UB 2ZUAA 1UZDA 1MMLA 2HFSA 4OZJA 4KBIA 5HP1A 3UN3A 2V4RA 2RVJA 3QWUA 3T1YF 3PNIA 3G6XA 1S79A 1PYSB 1F5AA 3FJ2A 3UD3P 1RQ0A 2YKNB 2CPYA 3PX6A 4DL2A 3ZZ0A 1R0CB 2YKPA 1U1PA 2WOMB 3H2VE 1K1SA 1SB6A 1S9GA 1UEKA 1S6PB 3VAGA 4Y34A 4TVAB 2RF2B 4QIGA 5B09A 1EP4A 1KOOA 1MG7A 4LR8A 4NLQA 1RA7A 4OL8A 2B4PA 1SQGA 4WXOA 3P4UB 1JLAB 1RHQB 4NCGA 2C3MA 4LF4J 2R7SA 5IV3A 2G4BA 3IRWP 5KFTA 5D0EA 4TYAA 3HKWA 4M95A 1S49A 1HWLA 3D54A 4U67Q 2FY1A 1H2VZ 1SIWB 2DNLA 1HI0P 4PWDA 1RT2A 3VCDA 2FZKB 4R5PA 2N7CA 4E0DA 4UY85 2VKRA 4ZLLA 3ZO7A 3JTNA 3QT7A 1G2EA 4JI4J 3GR0A 3W64A 4DS4A 1NCLA 2FVSA 5CYMB 4CO2A 3NKYA 3MTJA 4OYWA 3IM9A 4K4TA 2K7JA 3H4BA 3QJLA 4QW8A 5HSPA 2RQMA 1S1UA 4NA3A 3TQ1A 4LSNA 1WF2A 2HQCA 4M5LA 4WE1A 1HD1A 4LR7A 1RT3B 2QLWA 2BV3A 4ECYA 3VAKA 3KLIB 3I0RB 1BWVA 4FS2A 1LWCA 4NCBA 3M7VA 5D3GB 4X4QA 3LOUA 3ZZZA 4M5DA 4WFAQ 5DG7A 5I42A 4ECRA 2R2TA 3ZTSA 4F02A 2PC6A 2FLLA 4IRKA 1N33J 4LF1A 4MJKA 4RX6A 1M0SA 4F4XA 5L9NA 2PIIA 2JSXA 4RBUA 3IWNC 1J2VA 1C0UA 3W3SA 3MR6A 5DGBA 3AA9A 4PAAA 1I94J 3ZZOA 1D09B 3KFWX 1UVIA 1N5YB 1EETB 1KTQA 3F0NA 3FFIB 3HLUA 1Q4RA 4WTYA 4ED1A 3HHKA 1SIZA 1NLKL 1YZ6A 2XY5A 5B0DA 2UVRA 2FJDB 1PKUA 1S77D 3R7BB 4FYYB 5GAGI 2KZZA 3IS9B 1FRLA 4ED5A 2CAJA 1NAQA 1LV5A 4C8ZA 4Q44A 2WCXA 2LYVA 3KJFB 2WHOA 1YJ9S 4PG8A 3W5XA 4CLSA 3MM6A 3CCRS 2MQLA 4KHRA 4C8KA 5ETLA 2DB1A 3AQOA 4EI2A 2ADCA 3DRRA 1QE1A 1VISA 2CPFA 3I5AA 1X4AA 3SFUA 4USJC 3EXCX 3D4JA 1XR6A 2NUHA 3FSXA 4K2XA 1JLQB 3DLEA 5RUBA 3M9NB 2R8JA 4DX5A 5ETTA 3RJMB 1QVGR 4TU8A 4NE9C 4JV5F 3KTQA 4NYPA 1YRXA 4MK8A 3M8YA 3LGHA 4AL6A 2B8PA 4C4WA 1U1RA 5DDOC 4YEAA 2GJFA 2BW7A 1FJGF 2UXCJ 3C6TB 2DTJA 3S8SA 5CQGA 1QUPA 2XNQA 3P96A 2HHXA 3G6VA 4NYZA 4FP9A 3BBCA 2HS3A 4ES2A 3IBWA 2X1AA 2WVFA 2AX1A 5H9FJ 2GO9A 2X3GA 2Q3PA 4OYPA 4USWA 2VFSA 2HK2A 1QAXA 1LWEA 4OHYA 3FK4A 3W9HA 4NEYA 1RT6A 4JI7F 3MUMP 2M9KA 2HNYB 1JLGB 3J7YU 4JYAJ 1WG4A 5KFXA 1S76D 1KHVA 2J7WA 5HP1B 1X9WA 2MZSA 4AYBD 1ZZFA 3K17A 4NLXA 3A8EA 4I6YA 3PVXA 5G0RA 4J9SA 1R89A 1ITPA 2OD6A 5DQGA 2QTWA 2MYFA 4CLZA 4I69A 1TL4A 3POTA 1BWEA 2EFVA 4F67A 5EN1A 2LP4A 3I82A 2LVWA 2EW9A 2OUGA 1U4BA 3Q8YA 3F73A 5HLFA 5LXRA 2KU7A 2IRUA 5IV4A 1YSJA 2CG4A 2W2MP 1EP4B 4QIVA 2CPXA 1ROFA 4N7TA 3ETOA 2FB0A 2LU1A 3M2VA 3GE9A 2NPFA 4NCGB 1RGVA 5HJYA 1T3OA 2BYCA 2XWYA 1WJ9A 1LEOA 1B0TA 4ZP6A 1HBOA 2JH3A 3HZEA 3EZ5A 1ZM4A 2EI5A 1RT2B 4R5PB 2VPXB 3I5CA 2DGQA 2DCUB 4QWCA 4OI1A 2Q43A 2V9WA 2AYMA 2F4VJ 1PG5B 1EJ7L 5CXTA 3D1HA 1RABB 2CQPA 5EHHA 1IBKJ 4XO0A 4FN5A 4N5SA 2R8IA 4M5MA 3NGTA 2B51A 4JV1A 5CABA 4DR1J 5KG3A 3VTIA 1LK7A 1X9MA 2YX7A 2ZH9A 4LSNB 4DR7J 4ERDA 2GZOA 1KR4A 1KVIA 3UD4P 4WE1B 2MMYA 3OQ2A 2I1RA 3V6HA 1IBLJ 3ZXWA 4C0BA 4AD6A 5HVGA 3BSOA 2XY6A 4NLWA 1LWCB 3EZOA 4H54A 1GMWD 5I42B 1CEZA 3DDNA 2ZBIA 1WORA 1LFPA 2LKZA 3JTOA 5JVHQ 2Z56B
chains in the Genus database with same CATH topology
3CC7S 1CPZA 4KPYA 2KM8C 3UPFA 2M8HA 3L09A 1ZPWX 2GX8A 2N82B 2XNRA 4X84A 5BJRA 3FVYA 2CDQA 1GXLA 4TU7A 2B0GA 3FRYA 3W2WB 3GWCA 4MIBA 2MQMA 3MMBB 3FRZA 1C0UB 1FDAA 2B43A 1KD1T 4LMZA 2UV8G 2DGUA 3VALA 2MQPA 6FDRA 2HHVA 1P27B 1R8CA 2Q6CA 2F3JA 3M6VA 4ZOSA 3LALA 2CJ9A 2WONA 4I68A 2NZ4A 4DDFA 4L6V3 2XLJA 2QT7A 3L3CA 3I9ZA 1TL1B 4KIAA 4IH7A 1HA1A 3QIPA 4Q45A 5E3AA 1F60B 1Q86T 2KFYA 1GX5A 1LW2A 5EX0A 3PO5A 5H1SV 3SZ2A 3THTA 1MNEA 1NK7A 3DOLB 4WCEQ 3J7ZT 2HYIB 4RWXA 4QIEA 1ZZNA 3TAQA 4FS1A 3P3DA 4NLDA 1CQNA 2QIFA 1RKIA 5EWFA 3KNGA 1S0MA 3P5TL 4F4KA 1JXLA 4F4WA 2X1BA 1VBZA 4IOCQ 3TNVA 1TL5A 1SH0A 2YX4A 4IR1A 2UUWA 3QZ7A 3F56A 2YNIA 2FHJD 4DL5A 2ZE2B 3FEZA 3IAS9 1IR0A 3OVSA 2HFOA 3V81A 2K3KA 1A9NB 4ZLPA 1L3VA 5KG4A 5L1IA 2C2RA 1N88A 2QMWA 1TL3A 1NNDA 5F8HA 3OVAA 3PFEA 4PQUA 4TN2A 2CJKA 3DMJB 3MCSA 3M6WA 7FDRA 2DNHA 2FDNA 4EUVA 2E5JA 4R25A 1NK0A 5EUHA 2GO8A 3NNHA 1IKWB 2UUBF 3FSYA 2ZDOA 3H59A 2RU3A 1SV5A 2FVPA 3PW7A 3BSNA 5B0BA 2WW8A 1S0NA 2OPPA 2BOPA 1IM4A 4ILRA 3EUNA 1I94F 1RA6A 5M2RA 3HVRA 1QVFR 2K7KA 3MM9A 4UQGA 4MKAA 3SMZA 1HYSB 2XMMA 3OFGA 4XAKA 4OZ5A 3KJVA 1D8YA 4IRCA 1NB7A 2VG5A 2K2PA 5FIIA 4CO3A 2JEJA 2LDIA 1WF0A 3DRRB 5F8JA 4CT8A 1QE1B 4C8LA 3I0SB 1UJ4A 4KGKA 3VAMA 3UDLA 3HHDA 1DFDA 1TKTA 4I2PB 4B3OA 2BJEA 2NQPA 1PSDA 2AWZA 4K4VA 2MJUA 2BABA 2AYGA 2KTQA 5CHCB 4YP3A 3PV8A 2DGXA 4X64F 4LF8F 4NRUA 3TUZC 3H2UB 1JLCB 4X4PA 2XCPA 2MHNA 4DUZF 2HMIB 2MHEA 1DZ5A 3HVWA 2Z0GA 3CDBA 5GMKa 2AJFE 1VQ8S 3DLEB 2XWXA 1RT5A 1UFLA 1OPIA 4DQQA 1FESA 2JLGA 4C0HA 5L38A 2AP6A 5B0GA 1N32F 1S6QA 1NK5A 4LUBA 2ZVSA 2WOMA 4OIXA 2E66A 4WU2A 3RAMA 2DNNA 2W9BA 5KT7A 1QSYA 2VPWB 2AD9A 5ITHA 4IOBA 5KTQA 4DFKA 4IUFA 3PW0A 3LP0B 4NX9A 3G8SA 1S6PA 3MPWA 4OHZA 1RYRA 4AFFA 1UVJA 3H5XA 2HGMA 1OIAA 2OPSB 3HJFA 5LJ3Y 1RWUA 2GGPB 1VQLS 4F4ZA 2HNDB 1FEEA 1R7IA 4Q8EA 4R0JA 4NXMF 3G6ES 4LF9F 1UEVA 5DRKA 1J5OA 3CD6S 2E5GA 3O6QA 2DGTA 4NRTA 5F41A 2RD5C 2R2UA 1WEZA 4DQPA 1E6YA 1VRTB 4ECTA 4PQAA 3VF0B 4J9QA 2R7UA 6FD1A 3LAMA 1HPZA 5KFYA 4DUYF 1JLAA 3M30B 1ZAXA 1FEHA 4I2QB 1KQKA 2RQKA 4UUXA 3MD1A 3MGJA 1JLEB 3FQLA 5K8OA 3NL0A 3OSPA 3GIJA 2MSSA 4Q5VA 1VQ4S 1IN0A 4O4GA 1DJ0A 4EYIB 1KS2A 2OO4A 3UR3C 2DR7A 5AXLA 3CIZA 2ZDPA 1VQKS 3B78A 1RTDB 4YQWA 2MY8A 4WF9Q 3BZQA 3N9UC 5JXSA 4OJ1A 5KOWA 4JI6F 1GAOA 1C1CB 2F8HA 4KHMA 2LQJA 2OMOA 1TKXA 3QIDA 2B5JA 3IN5A 1LWEB 4LVOP 5DLGA 2LA4A 4ES3A 5KG1A 2FJXA 1YG0A 3Q0AA 3KHRA 3RW7A 3IFEA 4KV8B 1ZYQA 2IMOA 1L3KA 5IS2A 3RRGA 5I3UA 3OVBA 5F8GA 4QU7A 2MSTA 5A2QY 1RT6B 1Q81T 2DJWA 3KNAA 1FTRA 1YTYA 1D9FA 4ZP8A 1FTCA 2HFZA 1VC0A 4WFBQ 2QRRA 2YWGA 4O3PA 2LQ9A 3GYXB 2V8VA 3GG1A 4NCAA 1HBNA 1FKOB 4CTAA 1S72S 1V3SA 5DQHA 2WB1D 3M2RA 4QPTA 2DRBA 4PG4A 4ETZA 3JYTB 1U1OA 1C4CA 2VV5A 4F3OA 4EBDA 3JSBA 1Q8IA 4ILMA 2O66A 1P1LA 3B4DA 2IVMA 3V6DB 4QYZJ 2I5JA 3GYNA 4WJBA 1WNEA 3HT3A 4RBTA 1HQEB 3R27A 3OR1A 2J0SD 5KFZA 4OQJA 2DGVA 1WG5A 5CYMA 5B0EA 3U1MA 1NHUA 1RT1A 4DL4A 3PHEA 3PW4A 2MKCA 2YKMB 5J2MA 3N0VA 1HQUB 1S1TB 2ZHBA 1FERA 1I6JA 1FDNA 2OH2A 3KOAA 2EK1A 3MI7X 5G0RB 1T05A 4NLVA 2R9LA 4NLGA 3O8WA 2WSFC 4QU6A 1IJEB 2PA3A 4OX6A 5BYSA 3I31A 1P1TA 3CSKA 1JK9B 4KC5A 2OIHA 5HL7Q 3CF5Q 3HF5A 1IKYA 3GR1A 3GV8B 3DXSX 5D77A 3H40A 4OMFG 4I6WA 2UXDF 2IAJB 3SCKE 3POTB 2L9DA 1TAQA 5K14A 4ZCIA 4ECUA 1OS5A 2XS7A 2LLZA 4PXEA 4DFMA 2PMHA 1FO1A 3CUNA 5KFSA 1NKBA 5D4NA 2EFNA 5KFDA 2M7SA 1T7PA 4IG3A 4ZHRA 4JYAF 1RISA 3D0IE 1IQTA 1TUVA 1F5CA 1MW7A 2FC9A 3OTBA 1LQ9A 5HLFB 2C3UA 2CKWA 2B6AA 3Q2TC 3WX4A 4G1QA 2ABYA 2JJ4D 2DPIA 2XSFA 1L5UA 5AXKA 3HHEA 2B9XA 4JUZA 3BO4A 1VFJA 2R8KA 3M6XA 2QLXA 2B7BB 2OPQB 3CDEA 3J7A1 1ZTWA 2MJNA 1SJ3P 4BWMA 5J2NA 4A8MP 3ENWA 2VONA 3E2EA 1VQ7S 3HI9A 2IA6A 3BSCA 4Y28C 2Z2LA 4ZVGA 1XR5A 5IQQA 2VG6A 2LQBA 5A8RA 5DM7Q 4NYOA 2ZJQQ 2B3TB 4RLEA 4FF2A 3B8HA 2DISA 2G0CA 3FMWA 1KLNA 1KN6A 3TO8A 4ZCMA 1TK0A 4Q0BB 2R7VA 3J80Y 5T41A 3M8QB 1VBYA 4RW8A 1WEYA 3VAHA 1KFSA 1TVRA 4FVMA 4DOZA 4CO0A 1SKSA 2QMXA 2ZNYA 2XCAA 1FNXH 1QAJA 4QBUA 1WHVA 5KFJA 4DF8A 3NG8A 1K1QA 2L9NA 1TKDA 2LEAA 1X4HA 1UVKA 3BJYA 4IH5A 1HI1A 4NZ7A 2ZH3A 4LFCF 4OX7A 1Y7PA 1HBOB 2WSCC 4X62F 4QR2A 4ID5B 4P2SA 2CQIA 1WTBA 2KYZA 3OR2A 1A7GE 4G6VB 3IR6B 2ZM6F 5J1EB 3HM9A 4G1IA 2KDOA 1IJFB 1SL0A 3TAMA 2K3IA 4HI2A 1MWYA 4YHHF 4FNIA 4HLBA 2P9EA 3N6LA 2N7YA 5GAHU 4JI0F 4KE5A 1WF1A 4A8FA 3M6UA 1FE0A 2N4DA 2PO4A 1Y4ZB 4AXIA 2GJIA 4M63A 2OTJS 1X5SA 1X8DA 4XIUA 3MM7B 5AE3A 4RW6A 4CT9A 3P6YC 1U6ZA 4H4KC 1IKVA 4A8SA 3NMRA 2VQFF 1R0AA 3KLGA 2HQ3A 2XMUA 2VG7A 2HQIA 3K58A 1FXLA 4KO0A 4DPOA 3Q8QB 4USHA 4JV0A 4FBUA 1UFWA 1VQOS 1Y3KA 5IXUA 3DLBA 4P6QA 1D3WA 2VFVA 1RTIA 3KKFA 2KJWA 2YX1A 2WSEC 1VS3A 3IS9A 5MLCV 2E7XA 4O44A 2GQQA 2YWFA 1HW8A 3SQGB 2QFJA 5A0YA 2H9ZA 3MECB 1D8ZA 2ASLA 4O4RA 4C11B 4TQRA 3M8RA 4RW7B 1KNZA 2A3JA 4B17A 2MZJA 5I3PA 4TU9A 1Q82T 1HBUA 2DNZA 4OZLA 4ZK7M 2DNOA 4Y3CA 1W2BR 2NPIA 3IR5B 1FKPB 3PJXA 1R8HA 1N34F 3P49B 2CPZA 3G86A 4FNHA 2EFQA 2FJAB 4OLPA 1R3NA 3TARA 4YDDB 1OWXA 2C42A 4ZPAA 4FF1A 4ZKAA 2IJFA 5EX3A 3CJKA 5KFWA 3KHHA 2F4VF 3O3LA 5B0AA 2HHQA 3D5MA 1FRKA 1FJCA 2G13A 2D1CA 4CI0B 2ZITA 3KK2A 1S9GB 2AU0A 2KHDA 3OLAA 4ECXA 2YNFA 2IBKA 1OO0B 4NPOA 1JB0C 5SUHA 2R2RA 4DSJA 3NCQA 2BUNA 3ZZTA 1HMVB 3MUTP 1OQ3A 4MYTA 4GO7X 3WBZA 4I4BA 4WFXA 4IR9A 3LP1A 2O67A 3ZZRA 3IC1A 4ECSA 4RNOA 2E5LF 3PEHA 1JKHB 4DR1F 4IYQA 1ZAVA 4ED7A 3TRGA 2J6SA 4DV4F 1UETA 3K5PA 5C25B 2IM3A 2JVRA 3K8VA 3LAKA 2V8HA 2K1RB 5KFBA 5MAOA 5KFMA 1H7XA 4A8KA 4Y2KA 4C8OA 5U47A 3RB3A 2FHOB 4C2MA 2CQGA 3DXBA 5C42A 3M8PB 2IHR1 3VZHA 3TVKA 3H98A 2ADBA 1TZ0A 1Z2ZA 3NAIA 4ZPDA 1U1NA 4W90B 1W25A 2VPYB 3TANA 1UJ6A 2EFPA 3SDEA 3SEOA 2NS1B 2ZOFA 2MGZA 3Q8PB 1HHTP 1YJVA 3AB4B 2DR8A 4Y0FA 1P8GA 4U7CA 4URQU 4AXJA 2DGSA 1L3TA 2CQ0A 2MZRA 1MU2A 2D3OR 1S99A 2WB4A 4O3OA 2JDJA 1KRPA 1UP1A 5CZVA 3OPKA 4A48A 4HVZA 2WONB 2L41A 3CT9A 4LJMA 4PG7A 3EPGA 1X4GA 3PKYA 4HTIA 2ASDA 1NK6A 3I4HX 3QAEA 2MKIA 3T5LA 1G7CB 1N6QB 1FRXA 3U27A 5K8PA 3QIPB 2BQ3A 5CCLA 2KXNB 3ZZYA 1T02A 2A1BA 2DT9A 4PWDB 4DR3F 1LW2B 4ICLA 2VOOA 4ED0A 4ECWA 4PPDA 4OFZA 1T95A 2RH3A 4OHXA 2CQ3A 2E9ZA 1OPZA 3OL6A 1MSWD 3GSDA 3BGLA 3MAHA 1QJHA 2DGWA 3V6KA 1JMTA 2E9RX 2J9DE 1YQHA 4KRWA 1OQ6A 2GFFA 3UCUP 1Q8LA 4EO8A 4DSIA 2YNIB 3GIMA 3SV3A 4DL6A 3FEXB 3V81B 2KKHA 3GFHA 5LMUF 2UVWA 3CCZA 3OSNA 1H2TZ 1K9MT 3NGDA 3OTDA 5KG5A 2V4JA 5CA5A 2MB0B 1U6BA 1TL3B 3KK1B 3RB0A 2V5HG 5B0FA 2XS5A 1VJWA 4USIA 5JUMA 2CPEA 3QJJA 4WXWA 1U09A 2O1PA 4NLUA 4FBTA 4LIWA 3DLJA 2ZNZA 5HMZA 4DN0A 2JRSA 2OPPB 3C8YA 1S1UB 4NLPA 2FC8A 2BRLA 2RB7A 1M5KC 4Y2AA 1S6UA 3Q24A 2M88A 2F40A 2LEPA 5SZTA 3DOMA 1HARA 3KJVB 4MFBA 4EYHB 3HKZD 1M5PC 1NH7A 2W9CA 2ZKTA 2VG5B 4NLTA 4NA1A 1S9EA 1Z2LA 2HNZA 2P6SA 1TQLA 4Q2LA 3J81Y 1JLFA 3DLGA 3WC0A 4B3MF 3X3UA 2MKJA 3HDSA 3DHWC 1VRUA 3ISNC 1TKTB 4D3HA 3TYTA 2D9OA 1UAWA 2Z4PA 4B3OB 4DEZA 4N47A 5F9NA 3H8YA 2B4VA 1BQMA 1FDDA 3FZ2A 3K0JA 2RRBA 2B7CB 4A46A 2DNYA 3QGHA 1VQPS 1VC6A 3IRXA 4ZA1A 5BYQA 2NSBA 4DBQA 3T9ZA 4BC9A 3PKMA 1H3DA 4DQRA 2IM0A 2IMWP 3KG0A 1UL3A 1N54B 1FKAF 3IA0A 1NO8A 2P5VA 3RB4A 2WBMA 1RT5B 3UQSA