5B0FA

Polyketide cyclase oac from cannabis sativa, y72f mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVEVTFESVETIQDFIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0fA00
2Q3PA 4QOTA 1KVIA 2IYGA 1FEEA 4ZA1A 5B0CA 1AW0A 2OAUA 1QUPA 3FRYA 1YRXA 2QLWA 2ZDPA 3K7RA 3BN7A 1KVJA 2KKHA 2ROGA 1WD6A 4A46A 2BBEA 4A4JA 4F67A 3KNGA 1S6OA 2FTRA 3BDEA 1N5VA 2W4PA 2K2PA 2ZDOA 1GXTA 1Q4RA 2HLTA 2K1RA 1FVQA 2ROEA 3HHLB 4ZOSA 2GV1A 5B0GA 2BUNA 1AFJA 1YJVA 1OSDA 3BF4A 1TL5A 3CJKA 4DN9A 4NPOA 2CRLA 2BYCA 1LQ9A 1VQYA 2AW0A 2XMVA 1YJTA 4OIXA 2AP6A 1VQSA 2IFXA 3QMQA 2ASYA 4U9RA 3DCAA 4A48A 3MCSA 1RJJA 3LGMA 3IWXA 1W2IA 5IXUA 3KG0A 3FGVA 3WDOA 4OJHA 3E8OA 1SI9A 1X7VA 2XMJA 3DXSX 1P6TA 3LO3A 1CC8A 2ACYA 3HFKA 1V3ZA 5B0AA 1FE0A 2G9OA 1U7LA 1APSA 1ULRA 2GO8A 1URRA 2HFOA 2GA7A 3T9NA 2GCFA 4Q2MA 2IYIA 2OFHX 3UDCA 5B0BA 2LQ9A 1IUJA 3F44A 1YG0A 5T7LB 1MWZA 2AJ0A 2BJDA 3BR8A 1X8DA 2PGCA 3HX9A 5B0FA 2W4DA 4Q2LA 2RMLA 4DL0C 3IWLA 3VTIA 1OQ3A 3KG1A 3BM7A 1JWWA 2GGPB 3HHLC 5B09A 2OP5A 1N5TA 4HH1A 2VV5A 4YDXA 1CC7A 2LDIA 3I9ZA 1MWYA 1TUVA 1TZ0A 2QLXA 5B0DA 2KT3A 1CPZA 2RILA 3TNVA 1SB6A 2VH7A 3MZIA 2FB0A 4NL5A 4Y2IA 3CJKB 1Q8LA 1SQEA 1FD8A 3HF5A 3HDSA 3KKFA 1OPZA 1S6UA 2OFGX 4Y2MA 2FIUA 1Y3JA 2W4CA 1K0VA 2QIFA 4HL9A 1Y9OA 3HHLA 2XMKA 2RSQA 1N5SA 3QGPA 4OJ3A 4DPOA 2EW9A 2OKQA 2QYCA 2ROPA 2PD1A 4YEAA 5T7LA 3BGUA 2XMUA 3TOQA 1TL4A 2XMWA 5A6PA 4HI1A 2N4CA 3GZ7A 2HFNA 2HLUA 2FHMA 2OMOA 4HI2A 2LXFA 2K1RB 2GGPA 2K7KA 3TRGA 1YJRA 1Y3KA 1Q53A 2JDJA 1Q8BA 3LGNA 1X0PA 1N5QA 4Y2KA 5K9FA 3FMBA 2KYZA 2XMTA 2XMMA 2AJ1A 1JK9B 5A6WA 4FNHA 4OJ1A 2HIQA 1R6YA 1XBWA 2K7JA 5F0UA 3BB5A 5KAKA 1AFIA 2RU9A 5F0WA 1YJUA 2N4DA 2BJEA 1KQKA 2OD4A 1GXUA 1TR0A 2N7YA 5B0EA 4EFAC 2HQIA 2L3MA 4FNIA 5B08A 1FVSA 1FESA 2OD6A 3HHLD 4HH0A 1Y0HA 2LQBA 1FE4A 2KT2A 4OJGA 4A47A 2GFFA 1P8GA 1OQ6A
chains in the Genus database with same CATH superfamily
5AT1B 1FRLA 1EZZB 1RK8A 3EGNA 1IJEB 3KLFA 2M8DB 2AYEA 3TVYA 2KFYA 5DRKA 4OX9J 3CUNA 4OIXA 1IR0A 2JWNA 3CTRA 1VC5A 3IWXA 1LW0A 2APOA 2VQFF 2QZ8A 1L3VA 3H5YA 1CC8A 4H4MA 2FUG9 1BHNA 1MMLA 2ZFHA 2JNJA 1BWVA 2W8LA 3RB3A 2KXFA 2DR8A 2ZBCA 3M8PA 3HHLC 4I4BA 1S97A 3TNVA 1NK4A 3W60A 4M5LA 4JI6F 1TKXA 2FIUA 1VQ7S 1RAJA 4AE5A 2ASDA 3OFEA 3AT1B 1KBRA 2LXFA 1KQGB 2DEJA 2LU2A 4ED3A 2EFPA 1TUWA 4F02A 4FZVA 2YKNA 3M8PB 4YR0A 1YRTA 2CPJA 2VFUA 5J1NA 4A8OA 2WVEA 5D4OA 2KG1A 4Z7YA 1FEEA 4CLLA 3NKYA 2HBYB 1X60A 1F6TA 4F8RA 3BYPA 1FDNA 3SDEA 1NH8A 2ZJPQ 5F8MA 1JNZB 3THVA 5E3RA 1IKYA 3OFFA 3PM9A 5SZTA 3W61A 4JP8A 2ZC4A 4DV7J 1X5OA 3PNIA 1CC7A 4WU2A 1IBKF 4TLQA 4PQUB 2FYXA 3MEEB 3ENWA 1PG5B 2XYGB 3JQJA 1HIYA 5LMUJ 1Y5LB 5HSPA 4LFAF 1IKYB 1T05B 1BD6A 2HFZA 4X84A 3S8SA 2HHWA 5KFXA 2IBOA 1RA6A 1KOHA 2WVDA 1B4SA 3BB5A 1J2VA 2D9OA 3DLEA 2V0NA 3AOBA 3ZNJ1 1VLOA 4OZ2A 4J9LA 2DEIA 1Z4UA 4MKVA 1IBMJ 2BBEA 2ZKUA 2WB1D 1VI7A 2AJ2A 1P9QC 3EZ5A 3GMGA 3Q8PB 8ATCB 4DZDA 2DPJA 2CVIA 3NP5A 4ECSA 3VAMA 3KDNA 2AYMA 1QY7A 3R5CA 4WYWA 4X4PA 2LQ9A 3B4DA 4J9OA 5H9EK 5HATA 4C8LA 3UNYA 4TU7A 4CYUB 2V5HG 5MAOA 3EVWA 5F8LA 3OHBA 1ZPWX 2B9XA 3FEYB 2Q6BA 2NUUG 3J7Z5 3M8YA 4AL6A 2BMBA 4DL4A 1Q95G 4IO9Q 2B6AA 2VASA 3IS9B 4HEA9 2AGPA 3G6ES 4W4MA 5KFQA 1WC3A 1IBCB 5K9FA 5F0UA 5GVQA 4C48A 1WELA 4YY3J 5GAGI 1F3VA 5AE2A 5KOXA 1RHRB 2OLWA 1UKUA 5J2QA 4K4WA 5D6GA 2K2PA 1DURA 5B0GA 4L74A 1UWBA 4DN9A 5LJ3Y 1UJ4A 1UZHA 4QR0A 2OI2A 3E01A 4RW8B 5KFMA 2H4WB 2WOMA 1BQNB 4CNYA 2Z57B 3H4DA 3VGSA 2DCLA 2HVIA 2YPZA 3GR1A 2RRBA 3TZZA 3HMJG 2MKIA 1IBLF 3MEGA 2HMIA 4ECRA 2UUTA 1CS4A 1NK0A 1UWBB 4MIBA 3BGRA 4NA2A 3BYRA 1HBOA 3KTQA 4ZK7M 4UZCA 4CWBA 1RWNB 1KONA 4ZP8A 4KIAA 2RU3A 3RZAA 1X4GA 3M2RA 1XJWB 3MEGB 1NK9A 2IM0A 4O23A 3MAQA 3M32A 1CS4B 1RYSA 2W24A 2R7SA 4DF8A 3D1QA 1WF0A 2LMIA 3SQOP 2MSTA 2DO4A 5LT5A 2VUGA 2BRKA 4O4RA 5EWGA 2P9CA 1HBUB 1ZM2A 1ZOTA 4A48A 4ZHRB 1RCXB 5IV4A 2JLEA 1HARA 4AXJA 2DR6A 3M32B 4RNMA 1APSA 3F44A 3U7JA 3KK3A 1JLQA 1RBAA 2F4VJ 2BW2A 3NGSA 4A8FA 4KHMA 1UVLA 2QMXA 2UUAF 1QAYA 1T95A 2E1MC 2D3O1 3D1HA 1N0UA 1B64A 2XMKA 2V63A 4ZVHA 1LXJA 2HRUA 4KFBA 2JSXA 4DQPA 2I5JA 4LF4F 2H1YA 2O67A 1VQLS 1EHWA 1JLQB 2MLZA 4ZJLA 4QPTA 4FBTA 3A4TA 4PRFA 1B3TA 3Q2SC 3CJRA 4E98A 2ACMA 1NK6A 1QUPA 1FRKA 1X31C 4UQGA 1N34F 4PUOA 2BA9A 1FERA 2DCUB 2RS2A 1SH3A 1LNQA 4KFBB 2C28A 2OTLS 4K4ZA 2I5JB 3NXZA 4JOUA 4LQ3A 1K73T 4ED1A 4N8OA 1EB0A 2V67A 1FFSB 4Y2AA 5KT6A 2AKWB 4ZVGA 3I6PA 1SJ4P 2KT5A 1URRA 4RZRA 4OZ1A 1VQ9S 2J76E 2X3GA 3P96A 5DZ7A 4LF9F 4MJKA 4LJMA 1P9YA 4PUOB 4KBIA 3DGPB 3A3NB 1M5PC 3R1LA 3SCLE 1XNRJ 5C42A 4USWA 2BANA 1W26A 4XTTA 2AQ4A 2KO1A 4J90A 2NREA 4KSEB 3JTPA 3GJQB 2V2ZA 2AWZA 2HIYA 5IT9U 2MQNA 5KFRA 1RABB 2DHXA 5HROA 2G2YA 2DNHA 3BBCA 3ILJA 5IOLA 3BH7B 5FDLA 1F60B 2B51A 2E7XA 1PGZA 3GFXA 1WD6A 1TAUA 4EZ6A 4DUZJ 2BANB 3PW5A 3I4PA 4B3MJ 3B4MA 4RUAA 2EG1A 2N7CA 2LP4A 1M5OC 4CLTA 5MLCV 5HROB 1CSJA 1HLWA 3MD3A 3PR5B 1XERA 4ICLB 5A76A 2HGNA 2BOAA 4OV1A 1KRPA 1FFGB 3B82A 2OEKA 4ZIVA 3FSYA 4U8VA 3CCMS 3NG8A 4UF4A 2FC8A 2Z4PA 2XZDB 2KM8C 1S1TB 4OJ3A 1W25A 1BC6A 1FKPA 1U1KA 2XWXA 3DLKB 3MXHP 1NEEA 5F8NA 2PE8A 4KO0A 3MM6A 3WC2A 5JMNA 3J80Y 5EHHA 4OFZA 4QOTA 3H0PA 1IN0A 3CC7S 2BJ9A 2I38A 2M3DA 4CLYA 4OI0A 2HHUA 4IO1A 5G0RB 5HQ8A 2GW8A 3NS5A 2XQCA 1V5VA 4HKQA 1FWLA 3PYGA 3QAUA 2ASYA 1YSJA 4KPYA 2Z8QA 1T94A 2WSCC 1SI9A 1P6TA 4KO0B 1JXVA 3RRKA 3MM6B 2DD8S 3VVTA 3QATA 2GVZB 3MTKA 2RQKA 3MM5A 5KT7A 2QA4G 3NWGA 1GX6A 1H0HB 1S9FA 3HT0A 3KK2B 1DHMA 1PYTA 4BDPA 4EYIB 2IJFA 5KFJA 1UPPA 4MT1A 1VIXA 2W2MP 3EZUA 4F3OA 2E5JA 2DXFA 1TKTA 1SIWB 2DITA 1U1OA 2KI2A 2O66A 1TR0A 1WC5A 3AJ2A 4QWBA 4C8MA 1TV6A 5BR8F 5GAHU 1S5ZA 3NCPA 2VPYB 2OAUA 4YR3A 1Q7YT 1YRXA 2RQMA 1NDKA 4NXNF 3QRRA 4OZ0A 3QZ7A 1SIZA 2ZE2A 3P4UB 2UV8A 3THPA 3PO5A 2EFGA 4O3SA 3DC2A 2HHHJ 2ABYA 3OL8A 1XR7A 5B0BA 2CQBA 3U1MA 2HVDA 3ZZYA 2W2OP 1R89A 3T3FA 4Y3CA 4B9TA 7FD1A 1ZTTA 4BCAA 5CQGA 2EI5A 1FKOA 2XTJP 1R8HA 3T6JA 1M5KC 2RILA 3PY8A 3M2VA 1S4FA 3PYFA 1Y10A 4LF5F 4I6YA 1M5HA 1X9WA 3HDSA 2N3OA 2H5EA 4CDIA 5L46A 4CLPA 4DR7J 1RISA 1XMQF 4EU0A 1S72S 4A8QA 4ES1A 4I67A 2ALZA 2HBZB 2MZTA 1X0FA 3JQKA 1U6ZA 1WEYA 2IDLA 2V4JB 5KG6A 3Q86A 1T02A 4ZLLA 3PW2A 3T6BA 3M2VB 1H74A 3K7RA 4P10A 5LSOA 1BMQB 1HPZA 2ZVIA 2VG6B 4WTOB 4B3TJ 1Q82T 2IIHA 1WHWA 1GQEA 3ENQA 2BE9B 3MCSA 4E8UA 2RHSB 4PYAA 2L41A 4Y34A 1U0SA 1SPBP 4F25A 4DMZA 4DCOB 4QIWD 1IUJA 2D9PA 3N0VA 1OPIA 2HFUA 1UJ5A 1XN9A 1HPZB 2EFOA 2F4FA 2DBBA 4OI1A 4U6PA 2IVFB 4KHPF 3NBPB 1VHFA 3KKFA 1X5TA 3PKYA 5DDQC 3Q22A 2UUCJ 2R8IA 4NLXA 2IVYA 3KHGA 3UN3A 4NCAA 2KZZA 1SL1A 2MZJA 4ZVSB 2WRMA 4DG1A 1N54B 4G6VB 5GAEI 3PX6A 2LLZA 5KAKA 2F5GA 4L75A 1BUXA 4Y2CA 2AJFE 3GU0A 1NDLA 4JI7J 1T0TV 4B9NA 1IM4A 2M88A 1Y5IB 2CJQA 2FHOB 2RF2B 1NHKL 3JYTB 2VBWA 2RD5C 4DX5A 3PIPQ 3CDBA 1Q1KA 1M1GA 3LGHA 3T19A 2KVQE 2VC0A 5B0FA 4ZKAA 2D3OR 3CDUA 2ZH3A 4ED8A 3CC2S 3K8WA 1TZ0A 2X7IA 4K0KJ 3CJQA 4ZPDA 2ATCB 4ID8A 3DRXA 5E3QA 1N33J 3I9V9 4CRJA 1RTDA 4FYYB 5L8RC 2BRLA 4HHJA 4JI8F 2HHTA 2B5JB 5LJ5Y 3IG1B 4CLFA 2VB6A 3NWRA 4JI5F 1MN7A 2YQ0A 1LV5A 2JJ4D 4LF7J 1NPRA 1WDDA 3H8YA 4OX9F 4XPCA 1GXLA 3C66A 2DHGA 3IAS9 1SXLA 1G7CB 3UW1A 4ECWA 3KG4A 3EYZA 4A46A 1RTDB 5AXMA 2U2FA 2ZJQQ 3VWSA 1MROA 2LA6A 4IDKA 4ANCA 4KTQA 5DG9A 4H4KA 2JLGA 2V69A 1M1KT 2BQRA 3VAHA 5KFWA 3CGIA 5E3PA 3N28A 1QJHA 1SC3B 2GS8A 1QDUB 2GMJA 5ETOA 1UMJA 3CW2C 3HZGA 3ZFVA 4WF9Q 1NDCA 3DRSA 4ECVA 1MROB 1IXKA 2F9DA 5HQMA 3M9MB 5DDPC 4RW4B 5IC4B 3MM8B 5L9NA 3GTYX 1D9AA 3MPUB 3OVSA 3MFIA 1U8SA 5T7LA 2UV8G 3W8GA 4EUVA 3UO0A 1VBKA 4NLSA 4DV6J 4IR9A 1X0PA 4TYBA 1JK9B 2Z58B 2AV5A 3GE9A 1IKVA 4FYDA 3SCJE 4OJGA 2KL8A 3EJMA 2XS5A 1HD1A 4C8YA 3OV7A 1H2TZ 2IYGA 1ZM3A 3KNGA 3DDKA 2DGQA 4RNNA 3U1LA 1T9YA 1V3RA 3DOKB 2OEMA 4NLDA 3OPKA 4F50A 2BACA 5I3PA 1TL7A 4DV7F 4FPIA 5F3ZA 2LQ5A 2B56A 1IKVB 2VJUA 4NZ7A 1DTTA 1GK8A 2JC0A 5LMUF 2JVOA 4OI2A 3PHEA 3VTIA 2V4RA 1ZM9A 1HA1A 1YQHA 2KT3A 2M52A 2PO4A 4CZCA 3UCUP 1D9FA 2COLA 2OPQA 2J9DA 1JLAA 3DOLA 1Y3JA 1TL7B 4GO7X 5HMZA 2HWIA 1FJEB 1NKCA 3H98A 1FEHA 5CZXA 1S1VA 2J7KA 3TAQA 1DTTB 1PJ7A 3UN2A 3KLHB 3EUNA 1NZAA 2KYZA 3T1HJ 1IBMF 4JV5J 1WACA 4EFAC 1EETA 3NNHA 4FS1A 2R4FA 4NLQA 3HPOA 1ZZNA 3DHXA 4PXBA 4L3KA 1JLAB 3DOLB 3H5XA 3TVZA 3OXGA 2CADA 2RQ4A 1G6BA 3WHIA 1RWPB 3MMAA 1LQ9A 3CJ4A 1Q78A 1NJIT 4FVMA 3IN5A 1Q81T 1HNZJ 4JI1J 3D6FB 4L76A 2UXDJ 1MU2A 4ZPWR 2ASLA 4J9SA 1HD0A 1EETB 3C6UA 3GR0A 2IYIA 8AT1B 2PGCA 2NYHA 4ES3A 2CKWA 4RUHA 1C1CA 2AHOB 3MMAB 4JI3J 4YB6A 4ZCIA 2CQHA 1QTMA 4ED5A 4RWWA 1KFDA 5D0RA 3FUYA 3QIDA 4X4SA 2QA1A 3IRXB 4TXSA 3KLGB 1JB0C 1MU2B 3C8YA 3P3DA 5KFKA 3N9UC 1YI2S 1CJTA 4C7QA 5CA5A 4YY3F 3M05A 3IC1A 2FLNA 3GZ7A 2YWEA 3C6UB 2J7WA 5KT2A 1LOUA 3DU6A 2YX7A 3CD0A 4WFNQ 2RB7A 4NEZA 3J7YU 4P2MA 2AJ4A 3GPAA 1S9GB 4N56A 2ZNZA 1R3NA 2XSJA 3IWNC 4C3MA 2C2DA 2J7UA 5IT0A 1W7WA 5EWFA 1U1NA 3GWCA 4CM0A 4F3MA 2YKAA 3HFVA 3ICLA 2CFXA 1VRTA 4G3IA 3IR6B 4DHVA 1JKHA 1NBEB 2C2NA 3X3UA 2XSJB 4A8YA 2HSEB 2G1DA 4LRFA 4UOGA 2CQPA 3BKTA 1NK8A 1RT1B 2VHGA 5L1LA 2DIVA 2DXEA 1FK9A 1B0PA 1VRTB 3VGTA 4NA1A 3FEZA 3W5XA 2RT3A 2BJ7A 4DWIA 4KH1B 5LOQA 5DQHA 1PBAA 2ZH4A 2E1PA 3RRHA 2Q1LA 3VAFA 1NXIA 1T9UA 2DHHA 4DLEA 1JLBB 2R42A 5C24B 3NCRA 4XDDA 4ZP7A 5DETA 2AU0A 1RQ0A 1RWOB 4CH7A 2GQQA 4DV1J 1QUVA 4NLYA 2MGZB 3QT6A 5BJRA 1FFWB 2F4VF 5L1KA 2MKYA 2NSCA 4I6WA 1RU2A 2MLXA 3NS6A 2NPFA 4EZ9A 4DL0C 4EEYA 4F0KA 3GILA 1UEKA 4DL3A 4DU7A 1FRJA 2DNLA 1WSVA 2QLFB 5T41A 1T9VA 1U1QA 4O4GA 1RAFB 1AUSL 1S6UA 1DLOA 1HNIA 2MZQA 2EBEA 3EX7B 5ETVA 4K4XA 7FDRA 3OXFA 4LRDA 2AYBA 3DKDA 2NUHA 1UA1A 1F2GA 2XY6A 3CCVS 3FQKA 1HWKA 1REVA 5KFVA 4O44A 2ZVSA 2A1BA 4HDHA 4FF2A 3TA1A 5HVHA 1DLOB 1TL1A 4I69A 1HNIB 2FTRA 3L7UA 2GC8A 2JH3A 3G4SS 4TLRA 2XS7A 1KD1T 3CULA 2J9DE 3GIJA 2VQFJ 3LW5C 4KHRA 4H4KC 4G1IA 1REVB 1VJQA 3GYNA 4NYPA 4AT1B 5J1PA 4OMFG 1OYEA 4O44B 2DY1A 3MR7A 3DGVA 5D3GB 3KFWX 2FJAB 5SUHA 1NRKA 3ET6A 3RUBL 1XNRF 3IWLA 3KDOA 1TL1B 1RT6A 6FDRA 4CO3A 2MMYA 1YVFA 1M5SA 2V68A 4Q0BA 4J9QA 4YR2A 2DH7A 3TOQA 4DV3F 1YGYA 3WZ0A 3W66A 1X5SA 3OLBA 4MTPA 2Y9HA 1Q16B 5CD4A 3A8JA 4DUZF 2RQCA 5EWEA 3U1NA 4B3MF 1HQUB 4I2PA 5IZHA 3I0SB 4NYZA 2CQ2A 2XGPA 1WG4A 3NAHA 1GMWD 2JHEA 3CJSA 2GV1A 2IY5B 2IRUA 1E6VB 1TP7A 2PI5A 5CYMA 3P5BP 1RT3A 4X65J 3CCSS 2V8GA 4KKOA 2GHPA 3H42A 1M90T 3RAXA 2ACYA 3R9LA 1WOSA 4KRWA 2CUYA 1ZS6A 3J7A1 4I64A 1IBKJ 1BLUA 2A0FB 1JWWA 3UFCX 5F9LA 5KFIA 1T9XA 4YDXA 3KJVB 3BQ0A 1NSAA 3C16A 4ZPTR 4ZVOB 2JEIA 2LXUA 4P2XA 3IGVA 4RNHA 4ZCMA 3L95X 1RT3B 3SSRA 2YNGA 5DS7A 4KKOB 2QN6B 2AYGA 3HFZB 3OJSA 2ADCA 3HLUA 3ZZRA 1T3NA 3ISND 2PMZD 2DNRA 1YJ9S 1XR6A 3SSSA 1RT4A 2DGXA 4LMZA 3MCMA 2FLOA 4DPUA 2U1AA 4LVOP 4FF3A 2MKCA 4IFVA 3ENAA 5H9FK 3W9IA 3IBCB 4ZA1A 3HVTA 3QWPA 2ROGA 1HBMA 2YNGB 2W2QP 4G65A 3RG6A 1C0TA 4QIVA 3TAMA 3JSMA 5DG7A 1WKKA 2RKIA 4HDGA 3GYGA 2IFXA 2L9DA 2QL9B 4PCQA 3G8SA 1FKAF 5ETRA 3AY0A 1RT4B 1FXLA 4CLKA 3T5JA 1LXNA 2GAGC 1URNA 1YZ6A 4IFVB 4GKKF 4LSZB 5ETNA 1YG0A 4J5OA 4NX9A 1HNVA 1UP1A 4P73A 3CC4S 2DNOA 1K1QA 5K8MA 1MSWD 1HBMB 2H51B 3LP0B 3TAMB 3JSMB 2X1BA 2RKIB 1QTNB 1Y00A 3L7PA 2CQIA 3DRPA 1K44A 2HPUA 4F2SA 3W63A 1OS5A 2V2VA 2HS4A 2HFNA 2ZBRA 4GO5X 3PZPA 4UZBA 3QGGA 4OYOA 3MEKA 4GVBB 1N5QA 1HNVB 1RHKB 3PR4A 4PXCA 5F0WA 1S1XA 3G82A 3GP9A 3T1YF 4KAIA 2DNYA 2CDQA 3BPSP 1O8BA 1P8GA 4OX6A 1HFEL 3VCDA 5DQIA 2D41A 2QA2A 2YNHB 5CYJA 4DQSA 2XNRA 4ZOSA 2PEHA 2G0CA 1SH2A 2L9WA 1Q86T 4QIFA 4C11A 4EBDA 3R5DA 2EC2A 3VAIA 1CJUA 3W62A 1TUGB 1S1XB 3QSYB 3G82B 2MZ1A 5KG5A 5DGBA 2J6UA 3Q8SB 1EKSA 4Q8FA 3G9CA 5B0DA 3EPGA 4P52A 4DR7F 4NA3A 2DNZA 3J7YI 4FVCA 4C11B 3R7BB 1S7IA 5RUBA 4U7UD 1VQPS 2HAIA 3MPDA 2NXCA 1U47A 4P9SA 3C15A 4YS2A 4B3TF 3OVBA 4GC6A 1T11A 3GYXB 1UW9A 3MPYA 4B3OB 2XBPA 1R8AA 3M9OB 4JI4J 2DGWA 3R1HA 4F67A 2UUWA 4F04B 1H38A 1VQNS 3CJKA 3FFIA 4TVAB 1YBAA 1UTAA 1VC0A 2OPSA 2MQMA 5KFDA 3SQGB 3E8OA 3Q89A 2J9CA 4LSLA 3OQ2A 3T9ZA 2QC3A 2OEJA 3VAJA 1ZTWA 3FBBA 5EX3A 2YKOA 4ZP6A 1WHVA 3JB9k 2UUCF 1SC6A 3FCVA 2NXJA 2QLXA 1WJ9A 1O6XA 3KHHA 4NLVA 5FIIA 3ZZPA 3CJKB 3FFIB 2G0JA 2RVJA 2OPSB 2ATLA 2OPPA 1ZBTA 4LF4J 2R7UA 3ZTRA 3NGKA 2ADBA 3HSGA 4QYZJ 4LSLB 2PFFB 2R8HA 3WQPA 1U24A 3WX8A 3NAIA 2GVDA 4WBFA 3MR6A 1VQOS 3DLLQ 2A2CA 4JI7F 3OFHA 5KFPA 4USTA 1ITPA 5KFUA 4LQ9A 3OR1A 4M5DA 5KFGA 3D5MA 3OUYA 4KGMA 3V2UC 1KSPA 2AEJA 4NEYA 1UL3A 2NLWA 4GC7A 3QQCD 2R2UA 2FC9A 1PO6A 2GVDB 1W2IA 4FP9A 3EICA 4MAKA 5GADU 1TTHB 1X7VA 3KLEA 1TAQA 4FF1A 3NOCA 1F9FA 2M7SA 3CO0P 2YKPA 3OR1B 4M5DB 1MWZA 3CF5Q 1N33F 1S1UA 3UQSA 1U1MA 2KG0A 3K89A 3OUYB 2DYAA 5EUHA 1T03B 2V8DA 1F5AA 3QT5A 3HVRA 1O5JA 3RYLA 1Q0NA 3OL7A 1TMJA 2DGVA 2NR0A 3ZXWA 1S1WB 4P7VA 4O3RA 1LWEA 3GCWP 3HK2A 1I1GA 4USHA 2OSRA 3KLEB 4LF7F 2GJ2A 1RT5B 1UCNA 1SUQA 4WK3A 3TEGA 2RHQB 5EDWA 1VBXA 1WOPA 5EN1A 3PFEA 2IHR1 3L9ZA 4FXVA 4OI4A 4OI6A 1RT2A 4DN0A 1LWEB 4ZVUB 4N7TA 3G6YA 2F8EX 1FDAA 1FJCA 2EVZA 5A2QU 2QMWA 3A8EA 4M8LA 3CDAA 1NUEA 1SQGA 4C3KA 2PT0A 2HWTA 3PFOA 4DUTA 3DLGA 1H7XA 3PTWA 2PI4A 2V8PA 3V6JA 3UPFA 2VA2A 2EEYA 1KNZA 5KT3A 1VS3A 4NOHA 1KP6A 4URGA 1QAJA 3R27A 4DF4A 2FPHX 2KJWA 4NL5A 1U0HA 5AE1A 4NLWA 2YNIA 2DY9A 1OPZA 5ETQA 2EG2A 1FRXA 1FRIA 1RT7B 4DV6F 4QU7A 2FDNA 2RSQA 1YRUA 3O3LA 2HHPA 1S0MA 1JLCB 2G1HA 1BQXA 2HHQA 3N6LA 3DLGB 2V34A 4JI0J 3UR0A 1X5PA 3GV7B 1FNXH 3KK1A 2DPIA 4RL1A 4GRSA 4NYOA 1QE1A 4PEOA 4LBPA 3GSDA 1FVSA 1Y0HA 2OSQA 2B7BB 4C2MA 3RBDA 3MR2A 1C4AA 4D3HA 2FVRA 4K4UA 3BDPA 1C4CA 1DQ8A 2KRRA 3BDEA 1NPPA 4J37A 3TUZC 1TL5A 3O6QA 4IKAA 1KC8T 1W2BR 1J5OA 3F73A 4K59A 3MWBA 4EO6A 3B78A 5DDRC 3M6XA 3HHEA 2AF6A 1QE1B 2ZHBA 3PJ9A 2DNNA 2GA7A 1GTHA 3EGWB 3W8PA 2RH3A 1RWMB 1ZA2B 2JRSA 1F0XA 3ULHA 3MF5A 5F8GA 1G3OA 4NRTA 3SSQA 1NZ8A 4ITSA 4F3QA 4YHHJ 4B3SJ 4E0DA 3A3PB 3C6TA 4ZVTB 2DTJA 1Y9OA 2R9LA 4JV5F 4NLUA 3Q8RB 3SI8A 2J0WA 2K1RB 1N48A 3J7AN 2JDJA 2L48A 3DXBA 3IR5B 4O3OA 3GV8B 5BR8J 3RJMB 4URSA 4P75A 2P9GA 1FJ7A 2B43A 1FRMA 3RAQA 5HL7Q 2BJ8A 1FI4A 1HNZF 4JI1F 5D4NA 2UXDF 3V6DA 2RDDA 3TZXA 4ELUA 3V5RA 4DOZA 1OY9A 3OTCA 1CQNA 4QYRA 4DQIA 3GJRB 4A8MP 4IG0A 1AUDA 2Y0SD 3S01A 4JI3F 4PG8A 1U1RA 1RUSA 4WWSA 1V5IB 2VFSA 5KG1A 3V6DB 3AXKA 3IP0A 2ZZTA 1H98A 5C2CA 4RX6A 1RGVA 1RWKB 3R7SB 4DL5A 3D0GE 4IH7A 1I94J 2CPFA 4C0OC 3BGUA 3J81U 1A9NB 4LSNB 4MKYA 4UY8T 5D8HB 3ZTQA 1VRQC 1XBWA 9ATCB 5DO2A 2MSSA 2DGUA 2NCKL 4HH0A 5H9EJ 3HJFA 4N47A 1OQ6A 2FZGB 3W65A 3MEDB 1PKUA 2VG5A 5M2PA 2QJ3A 3GG0A 4IOBA 1VQYA 1B0TA 3UR3C 4FYVB 2MXYA 3R6GB 5A8KA 2YTCA 1Q8IA 5C7PA 3EDRB 4DR5F 2G0IA 3DNCA 4JI2F 4OX8A 3ISNC 1WI8A 2W9AA 1CJKA 4Q2LA 4UOCA 2VV5A 2LDIA 4KHPJ 1A0OB 1N36J 4IOAQ 3TX8A 3HCXA 2NXNA 2RRAA 4H4OA 2YWGA 4DUYJ 3G2XA 2UVRA 2QIFA 2HBRB 4NI2A 4M5KA 1RWWB 4ILRA 1JQGA 5A8KB 4K4SA 3QO9A 3SEOA 1RTJA 2HLUA 5FLXY 2K3KA 4LF1A 3K5PA 5D15A 3TAPA 2XYPB 1I6JA 2ZH1A 5J2PA 2LQBA 2ZH9A 3I96A 3QLHB 1K1SA 2AIRB 4DV1F 2P6SA 4H4OB 4CO1A 4DL7A 3I32A 4ZVFA 1JLEB 2FGOA 1WORA 3OFGA 4ZIWA 3GIRA 2QE5A 4NI2B 3BREA 1SJ3P 2BV3A 1RTJB 1SKWA 2M70A 4CNZA 3I4HX 3AOCA 3FGVA 1UFWA 2NXUA 2O3DA 4RW9A 5ITHA 2YKQA 5E33A 4CQ1A 4FKXA 3TUIC 2R7OA 4J9KA 4L72B 4WJBA 4EO8A 5KFLA 5CZVA 3HF5A 4QIGA 1OSCA 4LVNP 3FRZA 1VQMS 4YEAA 2PD1A 4JI5J 3LALA 4GMKA 3M8WA 4DFKA 4RW9B 3P8BB 1FDBA 2RNEA 1HQ2A 4YDDB 3D67A 3CB4A 1MMDA 5B08A 2V50A 3D9BA 3LH2S 1J5EF 3GJTB 1NB2A 2P9EA 3Q8VA 3T1AA 3KLIA 3FC9A 4IRCA 4CP5A 1AROP 1Y4ZB 3TR5A 4URQU 5HI7A 2JEJA 4CCHA 5HMWA 1D3WA 1VQSA 2IAJB 1NU4A 3ONQA 5DG8A 1FHTA 5DZ6A 3OHAA 2C2KB 5D77A 1VGYA 4LF8F 2P8IA 4B9VA 4M5MA 3KLIB 5IM0A 3KG1A 3LWMA 2M8HA 1JLGB 4IOCQ 3QFWA 4D3GA 2Y1IA 4R25A 2ZITA 5E2QA 1B7YB 4C9DA 2LU1A 4TN2A 2X3DA 2XMWA 1Y5NB 5ETMA 1KWMA 3HI9A 2CZ9A 4DR2J 3KJQB 2AEMA 1Y11A 1UVIA 4PQUA 2XMMA 4WKYA 3MEEA 5IM0B 1YJ7A 4C3LA 5DDOC 1SJRA 4PG5A 3ZZUA 4ZDNA 1KVIA 1F3FA 1QD1A 1RHUB 2QLWA 4X65F 1T05A 4ZLNA 3DLJA 2H4YB 3QSIA 2R3VA 1YJVA 2BXJA 3R5JB 1GX5A 4IG3A 4I2QA 3AQOA 3TANA 2V2KA 4MFBB 1P27B 1CG2A 5HVFA 1K8AT 2A18A 2ZH2A 2HW3A 3ILLA 2ZD1B 2D1CA 1N5YB 2E5GA 2DNMA 4YN3B 4DJBA 1JJHA 2ZBIA 4AFFA 1VR6A 1SBRA 3SYZA 3K58A 4R0EA 3MMBB 2DNKA 4IG3B 4I2QB 1TKZB 3I0RA 2OPRB 3CWJA 3V81B 2BQUA 5E41A 1RYRA 2R7XA 4U7CA 5CABA 4PWDA 4CYUA 4UY85 2E1RA 4RPFA 2N7YA 1NMEB 3DDNA 1YJWS 2ZM6J 4NZ6A 3IS9A 1EP4A 2C3UA 5B0CA 1NPKA 2KZMA 1UVNA 3NEKA 3I0RB 3TA0A 5IV3A 1HL6A 3K5LA 1UJ6A 1FXDA 4WE1A 3MPWA 4PWDB 2HEKA 2DGTA 1A7GE 1NB7A 1FWKA 2NYIA 3HULA 3TI0A 3PEHA 4OI3A 5A2QY 1FE0A 2OELA 3UDCA 1EP4B 5HK4A 3FBEA 3OJUA 2UXCJ 1N5TA 4RW8A 4GKJJ 1TUVA 1N88A 5KG2A 4DSLA 1OMSA 1XTZA 3AH6A 3JSYA 4WP8A 3FBFA 2C2MB 1BQNA 3KLVA 4NE9C 1RHJB 1K0VA 4WE1B 1KN6A 4KQZA 2MDAA 1Q5VA 4QPXA 2EWHA 4WIQA 4BS2A 4WXOA 2MKKA 5K8OA 3CJ8A 2PFDA 2XZWA 4J9RA 2KRBA 3R5GA 5LL6d 4IFYA 1R7IA 2IM3A 3DMJB 5K8PA 1FA0A 3KWMA 2Y8YA 3QZ8A 2VC1A 2QTWA 3U27A 3GSIA 4ZPAA 3A12A 1S7HA 4WK1A 2KU7A 3MPVA 2OJ3A 3UE2A 4U9RA 2KFNA 2J5AA 2CJAA 3N4WA 3FMWA 2AX0A 3ITHB 4P72A 2HFOA 4M5NA 4IFYB 3AD7C 1HBUA 1S0OA 3GFHA 2FJEB 4IR1A 3QWUA 3HHDA 4BHQA 4ZHRA 1FD8A 4R5PA 3EDQB 1R0AA 2EFNA 3W2WB 3OBIA 3FBCA 2XLKA 1S12A 1CBKA 1C0UA 3TQEA 4FF4A 4A8KA 1S48A 2D3ZA 2HQFA 4FYWB 1H6KX 1Y3KA 3QGHA 3M8QA 4IRDA 2FHJD 4Y2KA 4AXIA 4JI4F 2CVEA 4OJ1A 1S6PB 2R2TA 4U67Q 4UTGA 3TW0A 2GZOA 4ZLPA 1PIEA 2G2OA 4R5PB 1ZPVA 1KS2A 5D78A 4QIEA 4PG7A 2FHKA 2YWWA 1R0AB 2FJWA 3MURP 1C0UB 2AJQA 3DI6A 2ZBQA 3BS9A 3M8QB 3M2UA 3S1TA 1JJ4A 4X4UA 3H40A 3MR3A 2QYGA 4DR3J 2CPEA 1NM2A 4LRBA 3AODA 2W4DA 3LUYA 1PJ5A 1R0CB 5D0EA 4MMOA 5E0OA 1L3SA 2XG8A 2ZEJA 2L9NA 4C0BA 3WC0A 3DI6B 3LTOA 2FVQA 2W01A 3M2UB 2VFVA 3H59A 1T8EA 2E5IA 4HI2A 1U2FA 4KV8A 5LSLA 5KFZA 4AQYJ 3DGPA 1LWXA 4ENOA 3RB6A 2CAJA 2K7JA 3J81Y 2J9EA 4NLTA 4JV2A 4F7VA 2FJXA 1IKXA 3HSZA 2HBQB 2CJ9A 1DBDA 4BWJA 3BZQA 3H90A 4OYXA 3M6VA 2B8QA 3QJPA 4LFCJ 4XIUA 2HHXA 4NRUA 3HP6A 2VOPA 3HD1A 4KV8B 4DV0J 2CDRB 2OUGA 2HNYA 1RWUA 3CJ0A 3R5BA 1VQ5S 3ZTPA 2QO3A 3AD8C 4ETZA 4KC5A 2UVWA 1DJ0A 4X2BA 2KTQA 3KYLA 1IKXB 5HP1B 4IQXA 1RHQB 1RLDA 4Q8EA 2CPIA 1NKEA 4FS2A 3BSNA 2CG8A 1ZZFA 2HFVA 4CIOA 2XZTB 1SJQA 2FB0A 3RRGA 2QFIA 4ED4A 5LSRA 4Y2MA 4DV3J 5D4LA 2HNYB 3HHLA 3T5HA 2VBZA 3GIIA 4PQAA 1DTQA 2ZH8A 2XY5A 3CEDA 4ICLA 4FYXB 4O3QA 1VCTA 4LF6J 2AZ3A 2EFQA 2PN6A 3A8IA 3CCZA 2W9BB 1ZA1B 3GB0A 3BEGB 1N32J 1AYEA 1HW8A 1K9MT 5C5JA 3EM1A 3Q8QB 4ECZA 1RTIB 5K5MA 4X4VA 2OD6A 3V6KA 1WTFA 4DSEA 4J9MA 2JEFA 4CLZA 1S1TA 1HMVA 1E6YB 4QR1A 4A4JA 4DSJA 3HHLB 1YBTA 1DTQB 3HO1A 3DLKA 2G4BA 3JQMA 3PV8A 1K0TA 4ZS6A 4OQJA 3M4XA 2FHJA 1HBNB 2RJZA 5M2RA 2MLYA 4Q2MA 2LA4A 3BH6B 1LW2A 1HMVB 4K2XA 1VRUB 1F9EB 5G0RA 1UA0A 4HH1A 5ETLA 3CJ2A 1G1XA 1AA1B 4OL8A 3G87A 4OZLA 4JI0F 2G2ZA 5KG4A 2D7SA 2O1PA 2DIUA 4ETXA 4RKUC 2GVZA 2NS1B 2XMUA 1IWAA 1F2HA 3MUVP 3SV4A 2K06A 4RR5A 1S4EA 1HHTP 2W2PP 3JTOA 1LW2B 5H1SV 5AXKA 4IH6A 3KK2A 4MYTA 3FZ2A 1ACMB 1XR5A 4WIIA 2HQIA 1SVDA 2ZKTA 2CNLB 3BSAA 3TEHB 4BWMA 2XYHB 1R0BG 1HYSA 1Q79A 2Z2LA 2FGCA 2W4PA 4TU9A 1UAWA 3AFGA 2RUGA 2HURA 3AXMA 3K5MA 3BJYA 4DLGA 2AP6A 3W1YC 1VHIA 3P5TL 1Q7LB 1RHMB 4GKKJ 5IQ6A 5HLFA 3QRPA 2I2YA 4O0NA 4YHHF 3QT7A 4B3SF 2GMLA 3AB2B 3GV5B 5I4MA 2D3UA 2LQJA 1HYSB 2GGPB 4F4WA 2VFRA 4M94A 5GAGU 2IVMA 2DT9A 2XLIA 1MW7A 2V2QA 4TQRA 2GJIA 4DSKA 2ROPA 1TL4A 5HLFB 1IM6A 4OZNA 2R8KA 1FT8A 2IM2A 5C2GA 3T1YJ 1AFIA 5A0YB 4X4RA 1SJ1A 3TARA 4RWXA 2WAQD 2G13A 2DJWA 1QVGR 4A47A 3D4JA 4KH0B 1HWUA 3V4IB 1BY9A 1QLNA 4KGZB 3W2VB 3MD1A 2C2EA 3HHKA 1FX2A 3G71S 3CXCR 2MY7A 3HSDA 2XY7A 4KB7A 2HRTA 2BYCA 2RS8A 2WBMA 4CLSA 3VQSA 2QV6A 2V4JA 3G96A 3GLJA 3LQVA 3QIPA 2DVIA 1D9DA 1HNXJ 1WSRA 2H5IB 2GCFA 2VG6A 1RAEB 2XLJA 4K4TA 2YVSA 4QQBA 4EMDA 3AA9A 2HS0A 3BGLA 3G8TA 1DRZA 1BXNA 4KY3A 3OR2B 1I94F 4ZPBA 2JLFA 2GAHC 2E1AA 2YKMA 1TQLA 2IDEA 3DM2A 4NCBA 4QWDA 1GFWB 4F36A 3ZTSA 4P74A 4DR6J 3Q83A 2DNQA 3QIPB 5HN0A 3NGUA 2F65A 1YK9A 5KFEA 2YX1A 1M1HA 2XMTA 2W25A 3NBPA 3H4BA 1FESA 2DR7A 5KFYA 2E9RX 2YKMB 2XM3A 4M5HA 2QG9B 3DM2B 2C2RA 3NMRA 5CCMA 2YQ3A 1RAHB 5AXLA 5IT4A 4HT7A 3US5A 4WFAQ 4Y2IA 5CYQA 4MIAA 4WP3A 4KJIA 1XC9A 4JB8B 1RADB 4RNOA 4LBHA 4LR9A 4XO0A 1N36F 4B17A 2G9OA 1NJYA 3D28A 1NAQA 4DCPB 4HACB 2ZZNA 1GMUA 1YDLA 2WTFA 2VPWB 1BE4A 2ASJA 1FD2A 2XO6A 1BWEA 4DUYF 1UZDA 4J9VA 4CM2A 1NCLA 3FCHA 1FJGJ 2RF2A 1H7WA 3JYTA 5CYQB 2UU9J 1S59A 4Y6IA 2M4MA 4WP9A 4EBCA 2E29A 3SFUA 1TU0B 2WBRA 2XHWA 2BVZA 4PKDB 1CULB 2DISA 4HI1A 5KFTA 1JJ2R 1YJRA 3QRQA 2VFTA 2XS2A 1RKIA 4TY8A 3BN4A 2AJ1A 2DO0A 2CG4A 2HNZB 3W9HA 1WHXA 3CMAS 2CZVC 3RU0A 2R7QA 2HQDA 3FNNA 1C2PA 2MKHA 2B5JA 4MK9A 4USMA 3IG1A 1B0VA 1PYOB 2DNGA 3J80U 4NMXA 2OH2A 1RBOB 2XI3A 2M9KA 1XK8A 5F8JA 4N8NA 5I42B 3DU5A 3QMQA 3R3TA 4TY8B 2W9CA 2PMHA 4B9LA 3ILOA 1KQSR 3BSOA 4NLGA 2GJFA 2HK2A 3ZZTA 4F2RA 2RIJA 3OTBA 1VMBA 1HNWF 3SMZA 4RNFA 2SXLA 3I56S 4E2FB 1RBLA 3BM7A 4IH5A 1UWAA 4X4TA 3I9ZA 4I7FA 3BBBA 3JSBA 5C25A 4UOHA 3ADAC 3GIMA 4X66J 1NDPA 4ZCKA 1C1BA 4K5SA 2W9CB 1I5OB 1X4AA 1U26A 3QJJA 4BLGA 2LYVA 3KMQA 2MEWA 4RU2A 3CJ3A 3KLFB 3PO4A 2C3MA 4C8ZA 2AEFA 4DCJB 3OTEA 4NASA 3BQ2A 4RW4A 3UCZP 2OD4A 3MM8A 2HZAA 1WHYA 4I7FB 1LW0B 5C25B 1C1BB 4H4MB 3AA8A 6FD1A 2CQ1A 1ICEB 1Q4RA 3WBZA 3OT9A 2XNQA 3MMCA 4MH8A 5ADZA 2OGUA 3I82A 2MQ8A 3IR7B 3TQ1A 1HI1A 2DR9A 2BJ3A 2AZ1A 2CJBA 1TKXB 4B3RF 5DGAA 3LO3A 2NZCA 3ISZA 5B0AA 1RAAB 2EFVA 3WIVA 3LA0A 4ZVEA 4ANEA 4QCLA 3DOKA 2UUBJ 3LPYA 3N5FA 1CEZA 3FJ2A 2YKNB 3MMCB 3MZIA 3K17A 2NPIA 3N5BA 2Y1LB 3IA0A 4DR2F 3I31A 4H54A 1UFKA 3VAKA 2DRAA 4OHWA 2KN4A 3LP1A 3FK4A 3MECA 5ETPA 2F8MA 4K50A 2XI2A 3DN9A 2A10A 5L9XA 3SDEB 2PA3A 2EBGA 3P45B 1SJFA 2CWKA 3E51A 4BBYA 1MN9A 3H2UB 2MB0B 4YP3A 3LP1B 4CLWA 1FCAA 3KLHA 2QL5B 1Z1ZA 4MK7A 3CCES 3MECB 1TK0A 1VFJA 4DR4J 2KM8B 1NKBA 4ZCLA 1MMNA 2R7VA 4PPZA 3UDVA 2XEXA 3KHRA 3VGVA 2RMLA 2VICA 4ECTA 2XULA 2I0XA 3Q8YA 2M0GB 3DLEB 2P6TA 4NXMJ 1D1UA 3JTNA 4WZQA 5IT9Y 4YB5A 2FJDB 4U8YA 4X4QA 4ERDA 3BBFA 5AJ3J 2KHDA 2ZM6F 2J8AA 4UQTA 3CE8A 2ZBPA 2V4QA 4W90B 5KFCA 4ZPVR 1YTYA 1MLAA 3D2WA 1S6QA 2I8EA 1D8ZA 5J2NA 3PDNA 4PYDA 4ALZA 1IWGA 4FN5A 5IQQA 3R5AA 2BE2A 4WFXA 2IA6A 2LQ8A 3IRXA 3KLGA 1H73A 3MGJA 1S6OA 1N5VA 1WC4A 4A8SA 1EJ7L 2Z30B 3M8ZA 2JC1A 4OHYA 3POTA 3R6LB 3FQLA 3D0HE 3CDWA 3DCAA 3M1VA 1ZM4A 1F1BB 3CJ5A 3LGMA 3OXLA 1V6HA 2UXCF 3NY0A 1S9GA 3PW4A 1B7FA 4GKJF 2BW7A 4QWCA 1S6QB 2B6AB 1RDRA 5J2NB 5GAHI 2PIIA 4ECQA 2BE2B 4ZMMA 2Z56B 3T5LA 5H9FJ 4WFBQ 3TP2A 1VQKS 1MWYA 1HKAA 3MFHA 3FEXB 5HAOA 1XMBA 2ZUGA 3POTB 1JLFA 2B4VA 3M1VB 3EXCX 1X4FA 3EMTA 3NNAA 1RXOB 5J2QB 4F4AA 3I5AA 4AUKA 2BZ2A 4ILLA 1V9OA 3PJWA 2HIQA 3E01B 2ZHOA 1YX2A 2AX1A 2WOMB 4CH0S 4XPEA 1RT1A 1VBYA 3UD5A 2DK2A 3X1LB 1KVJA 2HZCA 3FCWA 2MZSA 1JLFB 3AHPA 2ZDOA 2Z2ZA 3BQ1A 4RW6A 1OSDA 2HMIB 3KMSA 3HT3A 2XMVA 5A8WA 4K4YA 1FWPA 4DR5J 5LXRA 2Q66A 4JI2J 4NCGA 4RUBA 1EAYC 2MJNA 3HZEA 4PG6A 1RB0A 3M6WA 1R8CA 1JLBA 3EPIA 5C24A 3MR5A 3BGRB 3F41A 1HBOB 4JYAJ 3RGIA 3Q23A 2D69A 5GAEU 1YWXA 4AYBD 2VKRA 5HJXA 2HHVA 2MGZA 3IRWP 4RW6B 2KDOA 3M2RB 3VGUA 4V1Ak 2IRXA 1U09A 4QWAA 1T7PA 5A8WB 5CD4H 4NCGB 2K3IA 2E7WA 2LEBA 4UW2A 1QAIA 2JZ5A 3DRRA 5DM6Q 4HHHA 2K7KA 2F3JA 4KPCA 2JL9A 3S7RA 2ZZMA 2L08A 4C8NA 1SL0A 2RU9A 2BJEA 2HWHA 3BO3A 2B9EA 4TKTA 2LDYA 2KT2A 1X4EA 3TJ9A 2VKZG 3BO4A 5KG3A 4UUXA 1L5UA 5L1IA 2DNPA 3KK3B 1G2EA 3VALA 2HLTA 3MI7X 1LWFA 3CO9A 4PWWA 3DRRB 3DYAA 2R2SA 5FD1A 2ZH7A 4DR3F 2IRYA 3JS9A 3GFZA 4MK8A 2C3OA 4OV6A 2R2RA 1KHWA 3RW6A 4S0MA 5EGYA 1HW9A 3BV8A 3TX0A 3R97A 3GONA 4G1PA 3SBMA 1LWFB 2Y0BB 3H20A 3OL9A 1UPMB 3DYAB 2HRYA 2BOPA 3UD4P 4AQYF 2DH8A 3GIKA 3PXGa 3QYYA 2F9JA 2JFDA 5D3GA 2YX4A 1LFWA 2HQGA 3PKMA 1Q53A 4L6V3 5D0GA 3PW7A 1J5EJ 3IGNA 1R8PA 3C46A 4LFCF 4DFMA 2VU5A 3H2LA 1PILA 5KT4A 1RLCL 3MDFA 1RZMA 4GVLA 4DV0F 3HM9A 3NLCA 1KQFB 1GXTA 3N6NA 1FVQA 3MTJA 4KE5A 4O0IA 1AB8A 4IYQA 2UP1A 3TJ8A 4LF8J 3P6YC 4F26A 1HQUA 2XMJA 2BR0A 5C42B 3I0SA 3O5TB 4OYAA 3Q2TC 4DV4F 2MPUA 4U96A 1GH8A 2CPYA 1GEHA 1NJXA 1E6VA 1U2CA 4Y28C 2KVIA 4ZVRB 3ELHA 3PHTA 1B70B 2FJBB 4ED0A 4X4OA 2X51A 5D4PA 4LF6F 2LCWA 2CYYA 1WKJA 2V8VA 1QSYA 4QZVB 4HL9A 3AJ1A 1N32F 3ZZOA 5FDLB 3UI3A 1FNOA 3QGPA 5A6PA 3O8WA 3HHNB 4YB7A 3TRGA 3H25A 2N82B 4LBIA 3KJVA 1VDHA 4M1KA 2RE1A 1GXUA 2JOQA 2HVZA 1FE4A 2DR5A 2XGQA 3CDEA 2ZC3A 1Q8KA 2QGFB 1RE1B 2V9KA 2C2OB 3MAHA 1NSKL 1WI6A 1NHUA 1N56A 1DFDA 1PSDA 3IBFB 1VK8A 3C19A 4QW9A 1UETA 4XDCA 2BKOA 1TELA 5F41A 2C2ZB 5AXNA 4KGKA 2BKPA 1UFLA 2UVVA 2GO8A 4AL7A 3JXOA 4RBVA 2MHNA 4LIWA 1U1PA 1FKPB 1ELOA 3OLAA 3TVKA 3L7OA 1GTEA 1SKRA 4P7TA 3V6HA 1QVFR 2HK3A 2ZWOA 1FTRA 3A3OB 4W98A 2PSZA 2ZOMA 4Q43A 3W9JA 3NGDA 5BYQA 3FMBA 4JBCA 5K8NA 3LP0A 4FXWA 1FDDA 2HQCA 3KNAA 1LKZA 4DPWA 2WW8A 4LFBF 5E5NA 2WVFA 4GVBA 3MM5B 2HQ3A 2HG4A 2MY8A 3BKUA 2AT1B 2CA9A 2RUSA 1KEKA 2NSBA 1SCJB 2IJRA 5F8IA 3MMJA 4HVZA 2V9WA 1U4BA 4NMLA 4LF2A 2H65B 1PC5A 2YNHA 2FD2A 1Z2ZA 4RO0A 4DV5J 2FJVA 1KKHA 4WFYA 4ZITA 3DHWC 1TKTB 1CPZA 3UVJA 4M95A 3LP2A 2HKEA 3MCNA 4DU8A 1ZYQA 3OW2R 5I3UA 1HWIA 1WTBA 1TV6B 1XNQJ 4OZJA 3RW7A 1EQ0A 1WUUA 1CQMA 3CD6S 4UOFA 2FHMA 2OMOA 4ES2A 3NGRA 3L3CA 4B9UA 2QFJA 1LFPA 2MTLA 5KT5A 5A6WA 2ZE2B 4WPAA 2L3MA 2MKJA 1RSCA 3MOJB 4DXLA 3UVJB 2V6AA 1VOMA 3LP2B 3HSJA 3W5ZA 4ATNA 5I3UB 3BN7A 3TYTA 4DQRA 3IBWA 2R8GA 1H3DA 4X62J 2QRRA 5E3CA 1AFJA 1OY8A 1D09B 2MYFA 4F4XA 1HNXF 1FKOB 2CJKA 2AW0A 4K8RA 4K2JA 1AXQA 1NHVA 2O01C 2XWYA 2OO4A 4FPRA 2QEXS 3SXLA 1N6QA 4MKBA 1KTQA 4WXWA 1IJFB 2XC9A 2WVCA 1S0NA 4B3OA 1EIYB 3BO2A 4OX7A 1U7LA 1N0VC 4QWEA 3PX4A 2FLLA 3RBEA 3KJFB 2VONA 4DR6F 1UVKA 4OYBA 3HKZD 3VV2B 1JJCB 5KTQA 2WSFC 3OSNA 3AQPA 3KJNB 3SQGA 5EX0A 4V19X 4ECUA 1NSQA 3QBCA 4X64J 3EE3A 1N6QB 1U6FA 3MM7A 2R7RA 5LMNJ 3QGIA 2NXEA 1RAOA 4OHXA 3I5BA 4FNIA 5HBMA 4QBUA 1U48A 3LPEA 4EK2A 3PYDA 2KKHA 2ZH6A 3BF4A 3GG1A 2QA4S 1H72C 1RCOB 3HKWA 1QM9A 3DFEA 4CLUA 3MM7B 1YJTA 2I9SA 1TL3A 3S6EA 4DEZA 2B7CB 4RU9A 4XK8C 1FJGF 1J27A 2EC0A 3PRVA 2QSFA 5CAAA 5HBMB 2UU9F 4X4NA 4U7UK 4EBEA 3QJLA 1TFWA 1IR1A 4DG1B 1IQZA 4DSIA 3OTOF 4PABA 2IBKA 2X1FA 3G6XA 2WW4A 1EQMA 4PPDA 2QX0A 1TL3B 3LWLA 2DHAA 3UN5A 3HXMA 3RAMA 3UCGA 1IVZA 3LAKA 3K8VA 4OYIA 3M8RA 1RAGB 3LOUA 4NZ0A 1UVJA 1U02A 1TKDA 2D74B 4M63A 1T03A 3SZ2A 3C14A 4HLBA 3UDEA 1VQ4S 1S1WA 2ZDPA 4DL6A 1OWXA 4QJVA 4AL5A 2CPDA 1VK3A 2DGOA 2RDIA 1RT5A 4MKAA 2ALYB 1XMOJ 1PJ6A 2OTJS 4I0WA 1RU1A 3E3XA 3HD2A 4YB1P 1KLNA 3NGTA 1M5VC 4LRAA 4RLEA 4OJHA 5JVHQ 2CQ0A 5HMXA 3HFKA 2AD9A 3C14B 4X66F 1X4BA 3M6UA 3GJSB 4HT5A 3ZZ0A 4N77A 1HQEA 2QT7A 3W3SA 3R2DJ 1MWQA 1LK5A 1WNEA 2MHEA 3LANA 2ZOGA 2F8HA 2FVCA 2J0QD 4OYWA 2NQPA 4CT8A 5K20B 4XAKA 3D54A 3U02A 3EWGA 4IDKB 1CLFA 3TZYA 4KR0B 3RR7A 3SV3A 3PRBA 2YQ1A 2GO9A 2N4DA 2E5LJ 1HQEB 4A8WA 4YFUA 2EPIA 1RT7A 1Z2LA 1U2RA 3I5CA 2OP5A 4PWUA 1DZ5A 2VQEJ 3AOAA 3VZIA 1JLCA 4YUDA 3Q24A 1VIOA 4CTAA 4CO5A 2CXEA 5F8HA 2A3JA 5JJBA 1JXLA 3DRSB 3TZWA 1X4DA 2YNFA 5JXSA 4ED2A 1VBZA 2VD3A 4M5IA 3PVXA 2UUBF 3WDOA 1RWVB 3PJXA 4LR7A 2HFSA 3CCQS 2WB4A 5T7LB 5THWA 2Y3YA 2EK6A 2WK4A 5HO4A 4CTAB 7AT1B 1UVMA 4CO4A 2YNFB 3EVMA 4J9UE 4ILMA 2E66A 2HGLA 1WEXA 2QLJB 1S77D 1YZ7A 1T9TA 1WKLA 2Z2YB 4EWTA 3CD5A 5IWAJ 3H5SA 2H9ZA 5KOWA 1M0SA 2FY8A 2HAFA 1HR0J 4WFZA 1AZSA 3O2IA 4DR4F 1FX4A 2UZAA 2K1RA 1ZH5A 3NMAA 4N41A 3EXYA 1TVRA 3RBZA 4KGVB 5J2MA 4O3NA 1DQ9A 2DHSA 2OPQB 3G86A 4LUBA 5D0HA 3BR9A 3L4BC 4N5SA 1K47A 4WZMA 3L09A 1FXRA 5KFAA 4NXMF 1S1VB 1S99A 5T14A 2PEBA 2XCAA 1AZSB 5KG7A 3PIOQ 3VR1A 2GMHA 1TVRB 3ETMA 2VH7A 4O3PA 3W5YA 5J2MB 1SQEA 5AJ3F 5FJ4A 4B08A 2W4CA 2JEGA 2N3LA 1QSLA 1RAIB 3JSRA 2N4CA 3FSXA 3QAEA 3SIPB 4R8UA 2UVUA 2ZJRQ 1YHQS 4KGXB 1FO1A 1RA7A 1VISA 5DM7Q 1RKJA 2E44A 1S10A 3TO8A 1ZETA 4KYZA 5CHCB 3CCLS 4DPXA 2KXHA 4IQMA 4LSNA 3ZC4A 1U45A 4Y00A 2KYXA 4ECYA 3D0IE 2MKSA 1NNDA 2YH0A 2B0GA 1C1CB 4R8UB 1R31A 1DARA 1FRHA 1CVJA 5L1JA 3UWTA 4USKA 2KB2A 4F0HA 1XIQA 3MEDA 1GT8A 3KOAA 5KFSA 3M7VA 1CJTB 3BR8A 1OY6A 1ZAXA 4DV2J 1SC1B 2OMLA 2PDAA 5CCLA 1REGX 1Y7PA 3OL6A 2CQDA 2J6SA 1O51A 2WZ1A 2C3PA 3B6BA 1DY3A 3BSCA 3T5KA 1S9EA 1ZAWA 4G1QA 1AT1B 3BKFA 2C42A 1KQKA 2W8KA 1VYAA 2O5DA 1X4CA 1O0PA 2VF3A 2VPXB 1LWCA 1WF2A 3TA2A 2XHCA 2JX2A 3H7HB 4J9NA 1JKHB 4TNOA 5E3AA 2H48B 2IM1A 2UXBJ 4JYAF 3LF0A 4I56A 4FKYA 1S9EB 3UNGC 3Q0AA 4G1QB 3QLHA 3DXSX 1UEVA 1JLEA 3CNQP 4J7CA 1ULRA 4WTYA 2WONA 1FK9B 1HI8A 2Q79A 1LWCB 5KFFA 2VIHA 4C6AA 4ZVQB 2VODA 1VQ6S 1HHSA 2AGQA 3K59A 1U25A 1VJWA 4C8OA 4CO0A 4OHVA 1UEUA 3SCKE 1WWHA 2CWXA 1QSSA 4ED7A 2XB2D 2RRNA 1LK7A 3QNWB 4DR1J 3NS7B 1EARA 3UDLA 2WONB 2ZOFA 2GNKA 2E1CA 3PEJA 4OZ3A 2GQ2A 3ETOA 4F4KA 1KLMA 3K57A 2K8GA 2CJYB 2LECA 3JAMU 3NOGA 1GAOA 1HHQA 3TUPA 5K14A 2GX8A 8RUCA 4TYAA 4B02A 4WCEQ 5KFBA 2MQLA 3ZTOA 1KHVA 1KFSA 4O4GB 2HYIB 2CQGA 2BEFA 3KXDA 1HNWJ 1KLMB 2HVHA 3F56A 2IMWP 4PZVA 1XEZA 4UT4A 4DFPA 2Z0GA 5K14B 1HWJA 2IAJA 2CQ3A 3IM9A 1RTHA 4I6AA 3A1YG 1YITS 4PAAA 4F4ZA 4DPYA 4AD6A 5BYRA 4YOEA 2W7PA 5GADI 4OLOA 1PBUA 2QYCA 2A6MA 3PX0A 1TFYA 9RUBA 2PMWA 2M5YA 4JI6J 2CJXB 3LGNA 4C8KA 1JLGA 3R2CJ 1OJ4A 4FXDA 1SC4B 4DQQA 2C3YA 5GMDA 3DDIA 4K4VA 1UW4A 2FLPA 5DJBA 4LT6A 3KUHA 2GHVC 1RTHB 1NK7A 1CJVA 2V8HA 3TJAA 1VLYA 3IM8A 2C22A 2OHDA 3ET6B 4B9SA 4P6QA 2IMOA 2ILZA 4NPOA 1RT6B 4C0HA 1S57A 4B3RJ 3TUJC 2JFKA 2BX6A 5F3TA 3IFEA 3RTVA 4M5JA 4Q0BB 4J9PA 2DRBA 3DRYA 3H5UA 4EGLA 1WC0A 5ETSA 1WG1A 4BC9A 1CJVB 1VQ8S 1T3OA 2VBXA 2E9TA 3R7NB 2GHWA 4DDFA 2BM1A 2GIFA 4JV0A 2X1GA 4RBUA 4MFBA 1NSPA 2OFGX 3MAAA 1FTCA 4OLPA 4Q5VA 2ZD1A 4ZVPB 4I2PB 4DPOA 4UUWA 1R43A 1N5YA 2CQCA 1WC1A 3P49B 2Z2MA 4I1TA 2LEAA 3K0JA 2BJ1A 2QSWA 3UD3P 4ECXA 3ZO7A 4LFAJ 2LEPA 1NH7A 2PA8D 3MMBA 5CYMB 2VDIA 1S76D 1WF1A 2YWFA 1TKZA 1RTZA 3PCOB 1JMTA 1LEOA 3VVUA 2OPRA 3W7BA 3V81A 3FRYA 1R8BA 2P5VA 1U49A 1S79A 5DLGA 1Q5YA 3MAAB 4WU3A 1KDNA 5I3QA 1S0VA 2LXIA 2I6WA 3J81j 4CH1A 3PRDA 3NCQA 3C16B 4C98A 2WSEC 3NL0A 3V4MA 2VDHA 2XO7A 3IAM9 3VF0B 4Q44A 4HTJA 4IRKA 4HYKA 2GIQA 1X8DA 4F4YA 2FZCB 4Y65A 4ZP9A 1YKWA 4RW7A 5IS2A 2HNDA 2KFZA 3VZHA 4IUFA 1V3SA 3CSKA 5HJYA 2BE7D 3PYEA 1JXEA 4HHUA 2JVRA 4P71A 3QPIA 3RB0A 2CNNB 2EW9A 4DS5A 3HVTB 2B4UA 3M30A 1BQMA 4L73A 3SFGA 3K5NA 4PXEA 1C0TB 4YMEA 4ELVA 2XCPA 1YJUA 4RW7B 2HNDB 3GQCA 2HHSA 4ZPCA 5FLXU 4Z7CA 3PW0A 1OIAA 4DX8H 4ZLJA 3DLHA 4LIRA 5DQGA 1XWLA 1RP5A 3M30B 5ETTA 1BQMB 4ER8A 3CJTA 2E9ZA 4DV5F 4C97A 2DB1A 4USVA 2B4OA 3CCWA 3DMJA 2WHOA 3CCJS 3DRPB 2ILYA 1SL2A 3KUEA 3M9NB 2HHHF 4PR6A 1JX4A 5KFHA 4C4WA 3M8SA 5B7WA 4TU8A 1OQ3A 5B09A 2CNOB 1XNQF 1YJNS 2QMUB 3D66A 3CMQA 2ERRA 5HQLA 3E2EA 1WG5A 5IFMA 1IBLJ 4DZ6A 1YLXA 3FDSA 3ITHA 2HZVA 1ZAVA 5CH7B 2XSFA 1GMWA 3I55S 4FNHA 1A6LA 2J6TA 2FVPA 1RI7A 3HHLD 4X62F 3RR8A 2B3TB 4ELTA 2GFFA 3W2WA 1WOOA 2YWKA 4JUZA 2KH9A 5ETKA 1CJUB 1DQAA 5HVGA 2FVSA 2YH1A 4USJC 3CMES 2B8PA 2CRLA 1IR2A 1S6PA 4LRCA 3O1LA 3PACA 4ZN3A 3BGOP 5KFOA 3Q8UA 4OYZA 1KVKA 3G8QA 2MQPA 3C2PA 3EVOA 1PAEX 2PC6A 3I87A 4MYUA 2R8JA 2MJUA 2LFVA 5KFNA 4X64F 3D3CJ 3BGFA 1U1LA 1SB6A 4USIA 3C15B 5LMNF 2VL1A 4P2FA 1H2UX 5JVGQ 3GFYA 2HGMA 2UUAJ 3MUTP 3IXQA 3ILIA 2WVBA 4OZ5A 4CO2A 2NZ4A 2HVEA 1B99A 2YWHA 3MUMP 5L39A 2V94A 2KJVA 2Q3PA 1AW0A 5LM7E 2J0XA 5IC6B 2VOOA 2F1FA 2E7VA 2LVWA 2E5HA 5IXUA 2J8SA 3KHLA 1IQTA 4V19J 1QAXA 2EKYA 1HWLA 3BPDA 1N34J 3KG0A 4PXDA 3CT9A 2OPPB 3D6MB 3EGZA 5J1EA 3T9NA 2LKZA 4EI2A 2BJDA 1EX8A 1PAUB 1TK5A 2B4PA 4K7QA 2F63A 2ZWPA 1Q8LA 4K0KF 2Y1RI 4LF9J 2J0SD 1F5CA 5HP1A 2YY3A 2R7TA 4OYMA 2CQ4A 5J1EB 3CIMA 3K2YA 1XMOF 1R27B 2W1BA 2VBYA 1RACB 2ROEA 2W9BA 1S1UB 2QLBB 2CNKB 3CCRS 4RJVA 2XMAA 1VC6A 3MHYA 1RTIA 4OHZA 4DX6A 4Y0FA 5U47A 2OIHA 4DPTA 3OSPA 4DV4J 2KHCA 3MCOA 1IKWA 1E6YA 1V3ZA 2OFHX 1N4LA 2YXLA 3THTA 3W64A 2CZ4A 2W7AA 4ZN1A 1NJWA 4WYLA 1NK5A 2B9WA 4CI0B 2Y1JA 1U8WA 1SUQB 2FQQB 1D0EA 1JNRB 4NLPA 1HBNA 3WX4A 3MOZA 2C1EB 5E7OB 1I3OB 2E5LF 2ZHAA 4LR8A 1RT2B 2DRDA 1IKWB 2Q6CA 1VRUA 1SKUB 4NWBA 2Y8WA 3ZZZA 1X4HA 1PC4A 5G4DA 3AB4B 2VQEF 1R6YA 3VQTA 5CXTA 4J91A 5A8RA 3K5OA 3HJVA 4HTIA 1YBUA 2HS3A 1NO8A 4NLRA 1TK8A 2CPHA 5DLFA 1X9SA 3KUGA 1MG7A 4FBUA 4DSFA 3JAMY 2QL7B 4OYPA 2Q43A 1G4CA 2IC3A 1U0HB 1F5BA 2YNIB 4NLOA 2X1AA 5A8RB 1FF2A 4P2SA 1BGXT 2CIMA 2W2NP 2VG7A 2A6OA 4USUA 1RWXB 3KK1B 2VA3A 2POKA 1KOOA 3GCXP 4WKRA 3AJDA 1WC6A 1S49A 1L3KA 2FZKB 4DS4A 4W92B 5IWAF 2IC3B 3NNCA 3LAMA 4KT0C 4L3NA 5BXIA 3HVWA 5HMYA 3D1OA 2CPXA 2GGPA 3FSIA 3A8KA 1Q8BA 2DXDA 1HR0F 2BDPA 2RAQA 1R6VA 4QW8A 1J5OB 2AMCB 2VG7B 2EXUA 3B54A 2BM0A 4ED6A 3T1HF 3WIUA 3AD9C 4LFBJ 4FDFA 4DI6A 3ZNUA 3DLBA 1N52B 3HVAA 2KXNB 3FKBA 5A0YA 2W7OA 4ZJOA 4NXNJ 3D3BJ 1RJJA 2ZH5A 3PG9A 3N6MA 2RDJA 3C6TB 1JIHA 4LREA 3EZOA 2B9YA 3V4IA 2M2BA 3OVAA 1WEZA 3W2VA 2ZNYA 2MZRA 1KR4A 2CPZA 5HANA 1ROFA 3QFHA 1NLKL 4U95A 5GMEA 4DL2A 3R8YA 4R0JA 3MM9A 1OO0B 2YBVA 1L3TA 2DH9A 4LF5J 3VAGA 3OR2A 3NRBA 1P1LA 2BABA 1GMVA 2BKNA 2ZUAA 3VHQA 3G6VA 5B0EA 2A2DA 3FVYA 1XMQJ 4TY9A 2F7VA 1I51B 5L38A 3A13A 2DGSA 4IG0B 2FY1A 2EK1A 3MM9B 3OD2A 1D8YA 1XQIA 1HI0P 4PG4A 4ANDA 3C3LA 4HR2A 4QYZK 2P2CB 2IJNA 2F40A 2VZ9A 1GNKA 4DFJA 4N76A 5LXYA 4Z37A 4Z2XA 1PYSB 4MIWA 1P1TA 1SH0A 3D68A 4DV2F 3N79A 4DBQA 2AJ0A 5KG0A 1WDTA 3D6TB 6AT1B 2H3EB 3D7SB 4ZJQA 1PCAA 1X9MA 3J7ZT 2DKOB 3CCUS 3CVKA 2BQ3A 4JV1A 1MNEA 4HACA 5JUMA 1T9WA 3QT8A 3DOMA 3T41A 1YIJS 3N01A 4QU6A 2R7WA 4RBTA 1SV5A 3D6HB 2VG5B 3H2VE 1OYDA 2EKNA 4K5RA 2VJVA 1N8RT 1F9HA 3CIZA 4RUCA 3O44A 3ENVA 5AE3A 4I68A 3F0NA 3FZBA 3EGVA 4YQWA 2UXBF 2YPYA 1CULA 3AAWB 3TWZA 3IO1A 1L3UA 1CJKB 1TMMA 1SKSA 2BUNA 4QR2A 3DOMB 3SCIE 3CCTA 4A8XA 1SV5B 1KTVA 2I1RA 1NJZA 2MQOA 2HNZA 3CD7A 3RB4A 1DAXA 2H54B 2IPOB 5GMKa 4CT9A 4BC7A 3OTDA 3QO9B 5F9NA 2MQQA 3HX9A 3OTOJ 4M5GA 2H5JB 4ID5A 5I42A 2AGOA 1SQFA 2IA0A 3RBXA 1U6BA 4F0MA 1EKRA 4EYHB 5BYSA 2GQCA 5J2PB 4DR1F 5M2UA 1H2VZ 1N5SA 4B9MA 1FNMA 2OKQA 3CPWR 4TQSA 2WCXA 3B8HA 4DX7A 2GIRA 4JI8J 3IMQJ 4Q45A 4Q7AA 4ID5B 2VPZB
chains in the Genus database with same CATH topology
2CJ9A 1DBDA 1FRLA 2ZDPA 4BWJA 3TA1A 4DL6A 1OWXA 4QJVA 4AL5A 1DLOB 1TL1A 1VK3A 2CPDA 3BZQA 4I69A 1HNIB 2DGOA 1RK8A 2RDIA 3EGNA 2FTRA 3M6VA 1IJEB 3KLFA 1RT5A 4MKAA 2M8DB 3QJPA 4XIUA 2AYEA 3G4SS 2GC8A 2JH3A 4NRUA 2HHXA 4TLRA 3TVYA 2KFYA 5DRKA 2XS7A 3HP6A 3CUNA 1KD1T 2VOPA 2OTJS 4I0WA 3CULA 2J9DE 3E3XA 4OIXA 4YB1P 4KV8B 3GIJA 1IR0A 2JWNA 3CJ0A 2HNYA 1RWUA 3CTRA 3R5BA 1KLNA 3LW5C 1VC5A 4KHRA 1M5VC 2QO3A 1VQ5S 3IWXA 1LW0A 2APOA 4ETZA 4H4KC 4RLEA 4G1IA 4OJHA 2VQFF 4KC5A 2CQ0A 5JVHQ 1REVB 1DJ0A 2QZ8A 3GYNA 4NYPA 5HMXA 1CC8A 5J1PA 3H5YA 3HFKA 4H4MA 1L3VA 4OMFG 2AD9A 2KTQA 4X2BA 4O44B 2FUG9 3KYLA 1IKXB 1MMLA 2ZFHA 5HP1B 4IQXA 4X66F 5D3GB 3KFWX 2W8LA 2FJAB 1X4BA 4Q8EA 5SUHA 1NRKA 3M6UA 3RB3A 2CPIA 4HT5A 2KXFA 1XNRF 3IWLA 2ZBCA 1NKEA 2DR8A 3M8PA 1TL1B 4N77A 3HHLC 3ZZ0A 3BSNA 4FS2A 1HQEA 2QT7A 1ZZFA 1RT6A 3W3SA 4I4BA 4CIOA 1S97A 1LK5A 3TNVA 6FDRA 1SJQA 4CO3A 1NK4A 2FB0A 3RRGA 1WNEA 2MHEA 2MMYA 1YVFA 5LSRA 4JI6F 3LANA 4Y2MA 1TKXA 2FIUA 1M5SA 4Q0BA 2ZOGA 4J9QA 5D4LA 2HNYB 3HHLA 3T5HA 2VBZA 1VQ7S 1RAJA 3GIIA 4PQAA 1DTQA 4AE5A 2F8HA 2FVCA 2ZH8A 2XY5A 3CEDA 2ASDA 2J0QD 3OFEA 4ICLA 4YR2A 2DH7A 2NQPA 3TOQA 4DV3F 4CT8A 1YGYA 4O3QA 3WZ0A 4XAKA 3D54A 3U02A 2EFQA 2PN6A 2LXFA 1KQGB 2LU2A 4ED3A 1X5SA 2EFPA 3CCZA 3OLBA 4IDKB 4MTPA 2W9BB 3GB0A 4F02A 3BEGB 1CLFA 4FZVA 1HW8A 1K9MT 1Q16B 4KR0B 3RR7A 2YKNA 3SV3A 5C5JA 3PRBA 3Q8QB 2GO9A 2N4DA 4ECZA 3M8PB 4YR0A 1RTIB 5K5MA 4X4VA 4DUZF 1HQEB 1YRTA 2OD6A 4A8WA 3V6KA 4YFUA 1WTFA 2CPJA 2VFUA 2RQCA 2EPIA 1RT7A 1Z2LA 5J1NA 4A8OA 5D4OA 4DSEA 1U2RA 5EWEA 3U1NA 3I5CA 4B3MF 2KG1A 1HQUB 2OP5A 4J9MA 2JEFA 1S1TA 4I2PA 1FEEA 1HMVA 5IZHA 1E6YB 4PWUA 3I0SB 4QR1A 1DZ5A 4NYZA 2CQ2A 2XGPA 4A4JA 1WG4A 3NAHA 3VZIA 1JLCA 4DSJA 2JHEA 3NKYA 4YUDA 3HHLB 3Q24A 2GV1A 1DTQB 3HO1A 1VIOA 2IRUA 3DLKA 4CTAA 4CO5A 2G4BA 4F8RA 5F8HA 1FDNA 1E6VB 2A3JA 3PV8A 1TP7A 3SDEA 5JJBA 2PI5A 5CYMA 1JXLA 1K0TA 3DRSB 1RT3A 1X4DA 2YNFA 1NH8A 5JXSA 2ZJPQ 4ZS6A 5F8MA 1JNZB 3CCSS 4ED2A 3THVA 2V8GA 5E3RA 1IKYA 1VBZA 2VD3A 4KKOA 4OQJA 3PVXA 2UUBF 3WDOA 3M4XA 2FHJA 2GHPA 1M90T 3RAXA 2ACYA 1HBNB 3OFFA 2RJZA 3PM9A 5SZTA 4KRWA 5M2RA 3PJXA 4Q2MA 2LA4A 3J7A1 3CCQS 1LW2A 2WB4A 4I64A 5T7LB 5THWA 1HMVB 2ZC4A 4K2XA 1BLUA 1VRUB 5G0RA 1X5OA 3UFCX 5F9LA 2EK6A 3PNIA 5KFIA 1UA0A 1JWWA 4HH1A 2WK4A 4YDXA 1CC7A 4WU2A 5HO4A 1IBKF 4TLQA 3KJVB 3BQ0A 4ZPTR 4PQUB 3CJ2A 1G1XA 4OL8A 3MEEB 2JEIA 4CTAB 2LXUA 3ENWA 3IGVA 4OZLA 4RNHA 1Y5LB 4JI0F 4ZCMA 1UVMA 3L95X 1RT3B 3SSRA 4CO4A 2YNFB 5KG4A 4ILMA 2D7SA 2YNGA 2O1PA 2E66A 4LFAF 5DS7A 2HGLA 1WEXA 1IKYB 2DIUA 4ETXA 4KKOB 4RKUC 1S77D 2NS1B 2XMUA 1T05B 2AYGA 1BD6A 3OJSA 2ADCA 2HFZA 4X84A 3HLUA 3S8SA 2HHWA 3ZZRA 5KFXA 1T3NA 2IBOA 3MUVP 3SV4A 3ISND 2PMZD 1RA6A 1HHTP 3JTOA 1LW2B 5H1SV 4EWTA 2DNRA 1YJ9S 5AXKA 1KOHA 1XR6A 4IH6A 3CD5A 3KK2A 3SSSA 4MYTA 3BB5A 3FZ2A 1J2VA 1RT4A 2DGXA 3H5SA 1XR5A 4LMZA 2D9OA 4WIIA 2HQIA 3DLEA 2FLOA 2H9ZA 5KOWA 1M0SA 2ZKTA 2V0NA 2U1AA 4LVOP 4FF3A 2MKCA 4IFVA 4J9LA 3BSAA 4BWMA 4ZA1A 1Z4UA 4WFZA 3HVTA 3QWPA 2ROGA 1HYSA 2BBEA 1Q79A 2Z2LA 2ZKUA 3O2IA 2WB1D 1VI7A 4DR4F 2UZAA 1HBMA 2FGCA 2W4PA 2YNGB 1P9QC 2K1RA 3EZ5A 1ZH5A 3GMGA 3NMAA 4TU9A 3Q8PB 1UAWA 3EXYA 4N41A 1TVRA 1C0TA 2RUGA 2DPJA 4QIVA 3TAMA 3JSMA 5DG7A 5J2MA 4O3NA 2CVIA 2RKIA 3K5MA 3BJYA 3NP5A 4HDGA 4ECSA 4DLGA 3VAMA 1DQ9A 2AP6A 2DHSA 2IFXA 2L9DA 4PCQA 2AYMA 2OPQB 3G8SA 1FKAF 3P5TL 3G86A 1QY7A 1Q7LB 3AY0A 3R5CA 4LUBA 3BR9A 1RT4B 5IQ6A 5HLFA 4N5SA 4WYWA 1FXLA 3T5JA 1LXNA 1URNA 4WZMA 3L09A 2I2YA 1FXRA 4X4PA 4IFVB 2LQ9A 3B4DA 4YHHF 4GKKF 1YG0A 4J5OA 4NX9A 4J9OA 5KFAA 4B3SF 1HNVA 2GMLA 1UP1A 4NXMF 1S1VB 1S99A 5T14A 3CC4S 2DNOA 3AB2B 3GV5B 4C8LA 2XCAA 5I4MA 2D3UA 2LQJA 1K1QA 2GGPB 1HYSB 5KG7A 5K8MA 4TU7A 3PIOQ 1MSWD 3VR1A 1HBMB 4F4WA 2V5HG 2VFRA 5MAOA 2GMHA 1TVRB 2VH7A 4M94A 3LP0B 4O3PA 3TAMB 3JSMB 5F8LA 2X1BA 3OHBA 5J2MB 2RKIB 1SQEA 1ZPWX 2B9XA 5GAGU 5AJ3F 5FJ4A 2IVMA 1Y00A 3FEYB 3L7PA 2Q6BA 4B08A 2W4CA 2NUUG 3J7Z5 2CQIA 2JEGA 4AL6A 3DRPA 4DL4A 2N3LA 4IO9Q 2B6AA 2DT9A 2VASA 3IS9B 2HPUA 4HEA9 1MW7A 4TQRA 2XLIA 4F2SA 1QSLA 2AGPA 2GJIA 1OS5A 2ROPA 4DSKA 3G6ES 1TL4A 3JSRA 2HS4A 2N4CA 3FSXA 5KFQA 3QAEA 5HLFB 2HFNA 4GO5X 3PZPA 4R8UA 3QGGA 3MEKA 4OZNA 2R8KA 2UVUA 2ZJRQ 1N5QA 1FT8A 2IM2A 1YHQS 5K9FA 1HNVB 3PR4A 4PXCA 1AFIA 5F0UA 5A0YB 4X4RA 1SJ1A 5F0WA 3TARA 1FO1A 4RWXA 2WAQD 2G13A 1RA7A 5GVQA 1S1XA 1WELA 5DM7Q 3T1YF 2DJWA 4KAIA 2E44A 5GAGI 2DNYA 1RKJA 1QVGR 4A47A 2CDQA 1S10A 1O8BA 1P8GA 3TO8A 5AE2A 4OX6A 5KOXA 1ZETA 1HFEL 3VCDA 1HWUA 5DQIA 2D41A 2QA2A 5CHCB 1BY9A 3CCLS 3V4IB 2YNHB 5CYJA 1QLNA 2KXHA 2OLWA 1UKUA 5J2QA 4DQSA 4K4WA 4IQMA 3W2VB 5D6GA 2K2PA 3MD1A 4LSNA 3ZC4A 2C2EA 4ZOSA 2XNRA 1U45A 2PEHA 3HHKA 1DURA 5B0GA 4Y00A 2G0CA 3G71S 3CXCR 2KYXA 1UWBA 2MY7A 4ECYA 3D0IE 2MKSA 2XY7A 4DN9A 1UJ4A 1NNDA 1SH2A 4KB7A 4QR0A 2L9WA 2YH0A 5LJ3Y 2BYCA 2RS8A 3E01A 2WBMA 4RW8B 2B0GA 5KFMA 1C1CB 4R8UB 1Q86T 4QIFA 3VQSA 2QV6A 4C11A 2V4JA 1R31A 3G96A 1DARA 1BQNB 1FRHA 2WOMA 3LQVA 3R5DA 4CNYA 4EBDA 1CVJA 5L1JA 3H4DA 3VAIA 2DCLA 3QIPA 3UWTA 2DVIA 2HVIA 1D9DA 1S1XB 2KB2A 3GR1A 2RRBA 5KG5A 2GCFA 2MZ1A 3MEDA 1GT8A 2VG6A 2XLJA 4K4TA 5KFSA 5DGBA 2YVSA 3KOAA 3HMJG 4QQBA 2J6UA 3BR8A 2MKIA 3AA9A 3Q8SB 1IBLF 4Q8FA 3MEGA 2HMIA 2HS0A 3BGLA 3G8TA 4ECRA 1DRZA 1ZAXA 3OR2B 2UUTA 3G9CA 5B0DA 1I94F 4ZPBA 2JLFA 3EPGA 2E1AA 2YKMA 1TQLA 1NK0A 4DR7F 4NA3A 3DM2A 4NCBA 1UWBB 2DNZA 4QWDA 2OMLA 3J7YI 2PDAA 4MIBA 5CCLA 1Y7PA 4FVCA 2DNQA 3OL6A 4C11B 2CQDA 3BGRA 4NA2A 2J6SA 1HBOA 3KTQA 1O51A 3QIPB 5HN0A 4ZK7M 2C3PA 5KFEA 1VQPS 2YX1A 2HAIA 3BSCA 3T5KA 1S9EA 1KONA 1ZAWA 4ZP8A 4KIAA 2XMTA 2RU3A 1U47A 3RZAA 1X4GA 4G1QA 2W25A 3M2RA 3MEGB 1NK9A 2C42A 2IM0A 4O23A 3NBPA 1KQKA 3H4BA 3MAQA 2W8KA 1FESA 3M32A 2DR7A 5KFYA 4B3TF 2E9RX 2YKMB 3OVBA 4GC6A 3GYXB 3DM2B 2C2RA 3NMRA 3MPYA 2O5DA 1RYSA 2W24A 4B3OB 1X4CA 5CCMA 2YQ3A 2R7SA 2XBPA 4DF8A 1O0PA 1R8AA 3D1QA 5AXLA 3M9OB 5IT4A 4HT7A 1WF0A 3US5A 2LMIA 2DGWA 4WFAQ 2MSTA 1LWCA 1WF2A 2VPXB 3R1HA 4Y2IA 5CYQA 4F67A 4MIAA 2DO4A 5LT5A 3TA2A 2UUWA 2VUGA 2JX2A 2BRKA 4J9NA 1JKHB 4O4RA 5EWGA 1H38A 1VQNS 3CJKA 3FFIA 2P9CA 1YBAA 4KJIA 1HBUB 4TNOA 1XC9A 5E3AA 1VC0A 2IM1A 2OPSA 4JYAF 1ZM2A 3LF0A 4I56A 1ZOTA 2MQMA 4A48A 4RNOA 1S9EB 4ZHRB 3UNGC 5KFDA 3SQGB 3Q0AA 4G1QB 3QLHA 3E8OA 4XO0A 2JLEA 3DXSX 2J9CA 4LSLA 1HARA 3OQ2A 3T9ZA 1UEVA 4AXJA 1JLEA 1N36F 3M32B 2G9OA 4B17A 4RNMA 3D28A 1ULRA 3VAJA 1NJYA 1APSA 1NAQA 2ZZNA 1ZTWA 2WTFA 2VPWB 3F44A 3U7JA 3KK3A 2ASJA 1FD2A 4WTYA 2WONA 1JLQA 1BWEA 5EX3A 1FK9B 1HI8A 2YKOA 4ZP6A 4DUYF 1WHVA 3FCHA 3JB9k 2BW2A 2UUCF 1SC6A 2RF2A 2Q79A 1H7WA 4A8FA 1LWCB 4KHMA 2QLXA 5KFFA 5CYQB 3JYTA 1UVLA 2QMXA 3KHHA 2UUAF 4NLVA 5FIIA 3ZZPA 3CJKB 3FFIB 1QAYA 2VODA 1VQ6S 4Y6IA 1HHSA 1T95A 2M4MA 2E1MC 2AGQA 3K59A 1U25A 2RVJA 4EBCA 2E29A 1VJWA 2OPSB 3SFUA 4C8OA 3D1HA 4CO0A 2WBRA 1N0UA 2XHWA 2BVZA 2OPPA 4OHVA 2ATLA 1UEUA 3SCKE 2XMKA 1B64A 1ZBTA 2R7UA 1WWHA 3NGKA 4PKDB 4ZVHA 2ADBA 1LXJA 2HRUA 2DISA 4QYZJ 4KFBA 1QSSA 2JSXA 4HI1A 4LSLB 2R8HA 4ED7A 4DQPA 2PFFB 2XB2D 2I5JA 2RRNA 5KFTA 4LF4F 1JJ2R 1LK7A 2O67A