2MKSA

Nmr structure of the rrm domain of rbmx from homo sapiens
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords RNA-binding motif protein, X chromosome
total genus 12
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mksA01
3G6ES 2N7CA 3Q2TC 1FT8A 2CPXA 5DDRC 3CMAS 1K9MT 1VQLS 2DNGA 4Z2XA 2OTLS 2KM8B 2EVZA 2DB1A 1M5VC 1FXLA 1YJNS 2RNEA 2HZCA 1U1PA 2QA4S 4ERDA 2LKZA 5MLCV 3CTRA 2J0QD 2J0SD 1WI6A 2KYXA 1HD1A 1FO1A 1VC5A 4YUDA 2L08A 2MZ1A 3MURP 3THTA 1VQ6S 2DNZA 5HO4A 4LIRA 2RQ4A 3UD3P 3EGNA 2CQPA 3CC7S 2MKSA 1VBYA 2M52A 2MHNA 2DNQA 3CF5Q 2DK2A 4M5DB 3Q2SC 2K8GA 1NO8A 2QEXS 2AYEA 1AUDA 1YJWS 1U6FA 2RUGA 3ULHA 5CYJA 2HGLA 2DNKA 3MD1A 4P6QA 3G96A 1KC8T 1WELA 2M8HA 2JWNA 1KD1T 1X0FA 1U2FA 2ADCA 2RS2A 2OIHA 1VQ8S 2JRSA 3VALA 2KN4A 3NMRA 2DISA 4C7QA 2MZQA 2D9OA 2XNRA 2KRBA 2MGZB 1VQPS 1M1KT 2DHAA 2MZJA 3UD4P 2J8AA 2DIVA 2XNQA 5DM7Q 3MDFA 4W90B 2LYVA 3L3CA 2DNRA 1U1LA 2DNPA 2DIUA 1JJHA 2MZSA 2FY1A 3OW2R 2CQGA 3MI7X 4RU2A 2DGTA 4V19X 2Q79A 3EX7B 2MQQA 3US5A 3S01A 1UW4A 3BEGB 2KVIA 2HGNA 2M7SA 2CPZA 2E44A 1KOHA 2DH9A 5CXTA 2U2FA 1FHTA 3ZZZA 4TU8A 3SXLA 2KXNB 1W2BR 3G8SA 5HL7Q 4CH0S 2DNOA 2XS5A 3IWNC 1FJ7A 2KT5A 2DHSA 2ERRA 2MQNA 2F9DA 1OWXA 3U1MA 2U1AA 3UWTA 4CIOA 3J7YU 1N88A 2K3KA 4WFBQ 4W92B 2DNLA 1CVJA 1UFWA 5DETA 2I2YA 1SJQA 2KI2A 3MUTP 5DM6Q 3G9CA 4F02A 3PIOQ 5BJRA 1SJ4P 3DXBA 2DGWA 2MGZA 1X4EA 1A7GE 1H2TZ 1X4DA 2DNHA 3LQVA 2GHPA 3CUNA 4WKRA 2G1DA 2D3OR 2A3JA 2LQ5A 1S72S 3BO2A 2MJUA 2CPJA 5GAGU 1DRZA 4ED5A 2LA6A 1YTYA 4UY8T 3BS9A 5DDOC 3K0JA 3P5TL 2DGSA 2OSQA 2YTCA 2MZRA 1FJCA 4PKDB 2DNMA 1Q86T 3NNAA 1D9AA 1JJ2R 1VC6A 1QVFR 5JVGQ 3ZZYA 2J76E 1H2UX 3P49B 2QFJA 2G4BA 4CH1A 3VAGA 2MQMA 5GAHU 3LPYA 4TU7A 2BZ2A 1UP1A 4J5OA 2RQCA 2CQ0A 1D8ZA 4F26A 3R27A 2DH7A 1P1TA 2HGMA 1WHYA 2MYFA 5LXYA 1ZH5A 1HD0A 1SJRA 2N82B 5ITHA 2KXHA 3CD6S 1OPIA 3B4DA 2I38A 4WIIA 3CC2S 2XB2D 3EGZA 2ZJPQ 2CQ2A 2L41A 5CA5A 3TYTA 2JVOA 5LJ5Y 5GADU 2M9KA 4A8XA 1ZZFA 2M2BA 1WG4A 4FXVA 3CCRS 3G71S 3VF0B 3CCJS 2MKCA 4CQ1A 4QU6A 3J7ZT 1KOOA 1X5OA 2YH1A 1UAWA 3TO8A 3U1LA 3VAIA 2LMIA 1FJEB 3UCGA 2LXIA 1ZZNA 1U1OA 2MKKA 5GVQA 2KHCA 4Y0FA 3MXHP 1QVGR 1A9NB 3B4MA 2CQIA 1F9FA 3I56S 2PEHA 3UCZP 5GAEU 2FC8A 4WCEQ 2DHGA 3D2WA 2HYIB 2MQLA 1Q7YT 2CPDA 1VQ5S 1OO0B 3HI9A 4FXWA 1URNA 2X1AA 4F25A 3THPA 3R1LA 2DNYA 3VAFA 2DHXA 2RRAA 1X4FA 4OZ1A 1SJ3P 1R8HA 3TP2A 1M5KC 2BOPA 1WF2A 2F9JA 2GO9A 3CCSS 2KM8C 2XSFA 1U1KA 3NS6A 3MD3A 1OIAA 1KQSR 2XS7A 2CQDA 4PRFA 1U1QA 4IO9Q 3SDEA 2ZJRQ 4U67Q 1RK8A 2FC9A 4WFNQ 2MQOA 2LEBA 1X5TA 4LJMA 3FEXB 1U1RA 1K8AT 1M5OC 3VAHA 4C0OC 2VOOA 2OSRA 3MUVP 4QPTA 3NNHA 5LSOA 2CJKA 3HHNB 1X4AA 2DITA 3UCUP 2CPYA 3MOJB 2E5HA 3SDEB 2MPUA 1S79A 3DLLQ 3CCUS 2KFYA 3MUMP 1Q81T 3CCQS 4YOEA 2X1FA 2F3JA 4QQBA 2X1BA 3NNCA 2MQPA 1YI2S 2DO4A 3JB9k 1N52B 2E5IA 1VBXA 4IOAQ 2MMYA 3S7RA 2M4MA 2KG1A 2FHOB 3VAJA 1YITS 1VQ4S 2V94A 2AD9A 1U6BA 2MSTA 4ZKAA 1N54B 3UE2A 2N3LA 2SXLA 1M90T 2CQCA 5IM0A 2ZJQQ 5IFMA 5D77A 1U1MA 3BO3A 2DGQA 2MSSA 4PR6A 2N3OA 4QU7A 2AYGA 1BY9A 3R1HA 1YJ9S 1X5SA 2KRRA 2NLWA 4Y00A 1WF1A 2NZ4A 1RKJA 2OTJS 1QM9A 2AYBA 4EGLA 2B0GA 3G4SS 1WI8A 2PE8A 5DDPC 1B7FA 3CCMS 3I55S 1P27B 1U1NA 1VC0A 1PO6A 3CXCR 2UP1A 1WEZA 1WHXA 2M70A 5H1SV 3CULA 2FPHX 1H2VZ 1H6KX 3H2VE 2KH9A 2RT3A 1WHVA 1M5PC 4UQTA 2L9WA 3NS5A 1XN9A 5IQQA 1WTBA 1VQ9S 2CPHA 2DO0A 5LSLA 4IOCQ 2LEAA 1JJ4A 3P6YC 2YWKA 4WF9Q 4BS2A 3CC4S 2M8DB 1WHWA 2OJ3A 5IM0B 5JVHQ 1NJIT 3RW6A 4C4WA 2DGXA 1X4BA 1YWXA 3H2UB 1G2EA 1DHMA 2ADBA 2MKIA 2CQ3A 3N9UC 1YHQS 2RVJA 3S8SA 5FJ4A 3P3DA 2MKHA 2MY8A 2E5GA 1WG5A 5D78A 1HA1A 2M88A 1VBZA 2VONA 4TU9A 2MKJA 2VODA 2DH8A 3SMZA 1R8PA 4WFAQ 1X4HA 1O0PA 5GMKa 2MZTA 1VQ7S 2CQBA 3CCES 1WF0A 3BO4A 2D9PA 5DDQC 1X4GA 1Q82T 2CQHA 3IRWP 1DZ5A 2EK1A 2EK6A 2RS8A 3G8TA 2WBRA 2LECA 2DGUA 2HVZA 3CCVS 2RRBA 2DGOA 4OZ0A 2M0GB 2CQ1A 1IQTA 3FEYB 1HL6A 2JVRA 2CQ4A 1X4CA 3VAMA 2RU3A 2KG0A 2VOPA 3CPWR 1JMTA 2DNNA 2E5JA 3S6EA 5LXRA 5EN1A 1X5PA 2LA4A 5LJ3Y 1YIJS 2XS2A 2CPIA 2DGVA 1VQNS 3CCLS 1L3KA 1VQOS 2CPEA 1SJFA 2MY7A 1VQKS 4TLQA 3VAKA 3CMES 1WG1A 2YH0A 2LXUA 3V4MA 1VQMS 1N8RT 2KXFA 1DBDA 4YB1P 4IUFA 1NU4A 2O3DA 2MXYA 1K73T 2LCWA 2CPFA 4LMZA 1SXLA 1FNXH 2MJNA 2X1GA 1WEXA 2JX2A 2G0CA 2KU7A 2AYMA 2MB0B 3RW7A 1WWHA 3PIPQ 1PGZA 1WEYA 2YKAA
chains in the Genus database with same CATH superfamily
4F3QA 3HHEA 4M94A 5GAEI 1SBRA 3Q2TC 2KJWA 1LXJA 3FSYA 3CMAS 4P7VA 4EEYA 4WYLA 4IO1A 3SBMA 1UEVA 1EAYC 1N33F 1HWJA 2EVZA 4K2JA 1BMQB 1R43A 4FF4A 3R5CA 3I96A 3D3CJ 4M5IA 4CH7A 1M5VC 2HFUA 3TR5A 1RUSA 3POTB 1FVQA 2IM3A 2RNEA 2E66A 3MMJA 1FXLA 1U1PA 4IH6A 2G2OA 3HSGA 3C66A 1XJWB 2AZ3A 3CTRA 5HI7A 3OHBA 3NMAA 1TUWA 2GX8A 1WI6A 3QSYB 1MNEA 2KYXA 3SI8A 2B7CB 3J81U 3NL0A 4KQZA 3NXZA 2IM1A 2RHQB 1HNZF 1T9WA 4YUDA 1VC5A 1SIZA 1RWMB 1ZM3A 3V6KA 2LU1A 2ZE2A 1RAAB 2QN6B 4DN9A 2AZ1A 2GNKA 3EGNA 2QLBB 3UD3P 3I0RB 2KT2A 3GIKA 4DLEA 2R7OA 5CD4H 3PR4A 1QSYA 3O8WA 2DVIA 4DG1B 3CC7S 2MKSA 2QMWA 3KJNB 2M52A 3LALA 3UI3A 1VBYA 4KRWA 4L3KA 1XR6A 2DK2A 4UZCA 3KK2A 4CO3A 3R2CJ 2CDQA 3DGVA 2ZOFA 3GCWP 3HFZB 1S59A 4DR1J 4GC6A 2HNZB 2H9ZA 1PILA 5HBMB 2RUGA 3M32B 4YP3A 1YJWS 4YB5A 3PVXA 4LSLB 2C3OA 2HHSA 4P6QA 4ZOSA 3SIPB 4MK9A 1WELA 2M8HA 5AE3A 1RT4A 1I1GA 4Y28C 2BJDA 2X51A 4NLYA 4Y65A 4B3MF 3RRGA 4LF9J 2PA3A 2QIFA 1TL7B 4ES3A 4LF2A 1ICEB 2MLYA 3MR7A 4PEOA 3KK1A 2ADCA 4C98A 3RAXA 1VQ8S 2IYGA 5F3ZA 2KZZA 3G2XA 1HLWA 2KN4A 3VQSA 2MZQA 4C7QA 2D9OA 1HHQA 1RWWB 2I6WA 5EHHA 2EBEA 1VQPS 3TEHB 1M1KT 4DF8A 3I5BA 4F4ZA 3MDFA 4ZDNA 2OAUA 4B9UA 4ZPVR 4EBEA 1CLFA 4OHWA 4NCGB 1N6QA 2LYVA 1YZ7A 2OPSB 2IIHA 1S1WB 2KO1A 4KFBA 1TL3A 2Y1RI 3GJTB 2E7XA 3OL7A 4NLSA 3JSBA 1RTDB 4DR4J 1I5OB 1RT6B 2HHWA 1YJUA 1UKUA 2OEMA 5CCMA 3KLEA 3V81B 2NSBA 4JI0J 1RTHA 1RT5A 2V67A 3KLIA 4OI3A 4UUXA 5T41A 1CBKA 3HVTA 3G8QA 3NG8A 2W4DA 4K4ZA 4PWDA 2PI5A 1S6QA 3VTIA 5A8RB 5BYQA 3X3UA 2UXBF 1TL7A 3CJRA 4XIUA 2Q79A 1AZSA 1Y11A 2BE2B 2BX6A 2PO4A 3LANA 7AT1B 3EX7B 1JXEA 2HHXA 2KVIA 3LP1B 3PKMA 5CXTA 3DNCA 2U2FA 1KFDA 4K4XA 4DN0A 3GR0A 4CLFA 4DWIA 4ECVA 2HK2A 5KFGA 1RA6A 2NCKL 3R5AA 4EK2A 1G6BA 1FDDA 3GFYA 4DX7A 2IBKA 4WFZA 4I6WA 3F73A 4USIA 2K2PA 3FBCA 4PPZA 2CJQA 2CVEA 4O44B 1C2PA 4HI1A 4R5PB 5K8PA 2XS5A 1HARA 5KFLA 2XZTB 2AT1B 2CIMA 2E1MC 4LBPA 1HBNA 4M5DA 1UJ4A 2M3DA 3BSAA 2W7AA 3JS9A 2MQNA 4NLVA 1RQ0A 5E3RA 3BJYA 2ERRA 1OWXA 4QIVA 2U1AA 3U1MA 3DOMB 1FRJA 4S0MA 1ACMB 4YR2A 4KKOA 4JI0F 3T1HF 4NE9C 4LRDA 2IY5B 3S1TA 1UPPA 2CG4A 4N8OA 4B17A 3DOKA 1AA1B 3L09A 3KHRA 1RTJB 4RNHA 3EPIA 3TJ8A 2R2RA 5J2QB 1CVJA 4I1TA 2I2YA 4FS2A 3TAMB 1PKUA 2KI2A 3RBEA 1RDRA 4DV5J 4CLZA 2ALZA 2YPYA 1NM2A 2BRLA 3TAQA 4B9VA 4QR2A 2QZ8A 2FJBB 4OYAA 1FCAA 1S9GA 3DRRA 4O3QA 2IA0A 5BJRA 3PIOQ 2KJVA 2WSEC 3DXBA 3UO0A 2MGZA 1T0TV 1N5VA 3ZZ0A 2OPRA 3AQOA 2JSXA 1TV6A 3VGTA 1F60B 2XMJA 3AH6A 3PR5B 2Y1JA 3LQVA 3FQKA 2V9KA 1PCAA 4AL6A 3G87A 4OZ2A 1AW0A 2CJBA 2G1DA 2ZFHA 3PY8A 3M2VA 3PO4A 3OTEA 1NSQA 3TQ1A 3SQGB 3ILOA 5H9FJ 1S72S 2J9CA 2MJUA 2CPJA 2IVYA 4F04B 2R2TA 3BO2A 1SL2A 3FZBA 3EZUA 2JEJA 1KKHA 1FXRA 4WJBA 4X4UA 2D74B 5KG2A 5A8KB 3KLGA 4P72A 1WKLA 2H5EA 2ZBRA 4CLKA 2OSQA 1OYEA 4YHHJ 1TR0A 2MZRA 3W9IA 5LMUF 4A8MP 4RX6A 1FJCA 2BM0A 2RJZA 4F2SA 4UOFA 2BE7D 1VC6A 1QVFR 5A6PA 3CJTA 3R6LB 4QWBA 2L3MA 3C15B 3PYFA 4DV7F 4WE1B 4H4MA 5C24B 2XSJA 4FP9A 3SSRA 1CSJA 2XG8A 1VLYA 4DSLA 4HKQA 4B3SJ 3R27A 4ELTA 3GPAA 3AB2B 5LXYA 2WAQD 2IHR1 5IZHA 2XYPB 4DV0J 2AJQA 3MMCB 5K20B 4ECSA 3UDEA 3Q0AA 2N82B 1U7LA 5K14B 1PBAA 4K59A 4OLOA 1JK9B 2LDIA 2XMVA 3MEDB 4DPOA 4WIIA 3M1VA 5ETNA 4X4NA 4ED3A 5J2QA 2XBPA 5CA5A 3TYTA 5LJ5Y 2DR9A 5GADU 2M9KA 3A8IA 3DLGB 3UD5A 2YX7A 1ZZFA 3MEEB 1APSA 1TMJA 1WG4A 4A8WA 3PV8A 3I0RA 3MMAB 2K7JA 1S49A 1EIYB 1I6JA 1WOPA 1Z2ZA 3DLBA 2CG8A 1S6UA 2LP4A 4NXMF 3M7VA 1SI9A 7FD1A 3MEGA 2MKCA 4PQAA 3OXGA 2AQ4A 4K7QA 4BDPA 2E7WA 2WOMB 2K3IA 2DD8S 1X5OA 3GP9A 3I82A 3TZZA 3J7ZT 2J6UA 2YH1A 2GIRA 1JLAA 4HI2A 3TO8A 3RBDA 3VAIA 2FJAB 2LMIA 2NQPA 2GQ2A 3QAEA 1HBMB 1FJEB 2EWHA 4GKJF 2XWYA 2UXCF 2FJVA 1W7WA 2Q43A 2W1BA 3K5OA 1ZZNA 4P74A 4NXNF 2DRDA 2YXLA 4LIWA 2MKKA 4GVLA 2VC0A 3K7RA 5MAOA 1S6OA 3FMWA 1SKRA 1N0UA 3W66A 4Y0FA 5D4PA 1N5YA 3R2DJ 3MXHP 1A9NB 2CQIA 2CNKB 2R7VA 2V2KA 2CWXA 2F5GA 3IBWA 1NDPA 3QO9A 5KT7A 5GAEU 2FC8A 2IMWP 4LQ3A 3D2WA 2HYIB 1X31C 1RT5B 1H7XA 1RTHB 2CPDA 3R8YA 2LFVA 2RIJA 1FE4A 1Y3JA 3DYAA 5D0GA 4ZA1A 3KKFA 4CZCA 5J2PA 4WTYA 2XSJB 1DQ8A 1V6HA 3MFIA 2OPSA 3HDSA 5F41A 1F6TA 2UXDJ 1DQ9A 5HMYA 4H4OA 4U7CA 4MK7A 2DBBA 4IQMA 4C3MA 3R1LA 2XZWA 4G1PA 3MAAA 2DHXA 4OHXA 1XR7A 5E0OA 4USMA 4V1Ak 5AE2A 3TP2A 1CJKB 4HACB 1WF2A 3PTWA 1U25A 3DGPA 4ZPCA 2VU5A 3CCSS 1PJ5A 2XSFA 5J2NA 1EJ7L 4TNOA 2GJFA 1HI1A 3OR1B 2IVFB 1WTFA 3LP1A 1JLFB 4FPRA 3TW0A 4DV5F 1NJZA 2HRTA 3D0HE 5M2PA 1P6TA 4NLGA 4DS4A 5EX3A 1U24A 4Y2CA 3L7OA 4F67A 3D9BA 2VA2A 5DG8A 2WOMA 1SL0A 3Q8YA 3SV4A 3E2EA 1S9FA 3T5HA 2GS8A 2BA9A 2CFXA 3BZQA 2MQOA 4WBFA 3MMBB 3D6MB 3GIMA 1B3TA 1KNZA 5B0DA 3D1OA 1TFYA 1XC9A 1K8AT 1M5OC 3BYPA 3VAHA 2WSCC 1BE4A 4X4PA 5DO2A 4CNZA 3KUGA 4FVMA 3HHNB 3H5XA 4UOCA 1SL1A 3B6BA 3FUYA 1RWOB 4EBDA 2HFZA 1IKVA 1BLUA 2RE1A 4DPXA 1TAQA 8RUCA 4K4YA 1R7IA 1YLXA 4ZVUB 4O23A 5L8RC 4DX6A 1Y5LB 1LWEA 1Y7PA 5DZ6A 1IQZA 2C3YA 3GFZA 4ILRA 5U47A 3HVRA 2MPUA 2JEFA 3VWSA 3F44A 1FRMA 4K2XA 1CG2A 9ATCB 1GXLA 3CCUS 1H7WA 1M5HA 2ZUAA 1RA7A 1YJRA 3OFGA 4TLRA 4DI6A 2CADA 3GR1A 4NLRA 1HI0P 4L73A 1GH8A 1RYRA 4DV3F 4ANEA 4CYUB 1JLCA 2P2CB 3CCQS 1QUVA 4QQBA 2X1BA 1TK8A 3FCWA 2BKNA 3PHEA 3J81Y 4F4XA 5KFPA 3PYEA 3EE3A 3HVAA 3JB9k 1O51A 2JFKA 3MR3A 1K0VA 1C0UA 2MMYA 2ZNYA 3U7JA 5IXUA 1NHKL 3M8ZA 3QGGA 2KDOA 4GO5X 2J7KA 1V5VA 2KG1A 4JI1F 4U6PA 5ETOA 1JXVA 2ZHOA 1JLFA 3CJ5A 3HMJG 3V6DA 4LF4J 4J9LA 1CQMA 4N77A 3PRBA 4UTGA 3PJXA 2HIQA 4ZVRB 2Y8YA 3PDNA 1U09A 2YKQA 4IG0A 4N7TA 4MT1A 3VVTA 4C0BA 1AXQA 5IM0A 3C15A 2ZJQQ 3CDEA 4RL1A 5D77A 1AFJA 3PJWA 5CAAA 4NYOA 1DARA 3H2LA 5C2CA 3F0NA 1H3DA 2PFFB 3IM9A 3Q8QB 4U96A 3HD1A 4OX9F 2Q6BA 1PYOB 4DV2F 3QWPA 1AYEA 4W4MA 1KS2A 1S99A 2GAHC 4I69A 4C6AA 2XCAA 3MEDA 1T8EA 1N5YB 4ELUA 4G1QA 3A13A 4QOTA 1UVNA 1ZA1B 4U8VA 1GX5A 4ZLNA 5HVHA 4KO0A 1JQGA 2NZ4A 2HLTA 1RKJA 4CP5A 5KFVA 3ISND 2BW2A 1RAOA 4ID5A 2OH2A 2ZVSA 4D3HA 1HBUB 4EGLA 2B0GA 3GE9A 6FDRA 2MTLA 5ETQA 3N5BA 4ECUA 4IRDA 1UL3A 1HPZA 3DLEB 3HHKA 3L7PA 1SQEA 2WK4A 3CE8A 3WC2A 4L3NA 5L1JA 4QYZK 5D8HB 5F9LA 2W24A 1N5SA 3GJSB 3M6WA 4I64A 1PO6A 3W2VB 2VICA 5HQLA 5CYQB 3CULA 1MN7A 3TX0A 3KTQA 1LW2B 2G0IA 2AKWB 1SQGA 3E01A 3MTKA 5H9EJ 1FRHA 2AJ0A 4I6AA 2L9WA 2OP5A 3I6PA 1S1VB 3Q24A 2DPJA 5B09A 4ZIWA 3UVJB 4OX9J 5KG1A 2HBYB 4O0NA 1WSVA 1LK7A 4OJ1A 4DPWA 2J8SA 4J9RA 2G1HA 5HLFB 3OTDA 2ABYA 2CPHA 2XMMA 5T7LB 1VFJA 1FRXA 3FDSA 1U4BA 3IBFB 4KHMA 1JJ4A 4K4SA 3P6YC 2XC9A 2ZHAA 3POTA 3JAMY 2ZVIA 4U9RA 4C8LA 1HNVA 3EZOA 3IWXA 3NAIA 1WHWA 3WDOA 3IG1A 3GB0A 4CI0B 2GMLA 4NLUA 3DI6A 2W8LA 3RR7A 3SQGA 3FBEA 1N0VC 4M8LA 1Y4ZB 5KT2A 4DUZJ 3N6MA 2ILYA 4LSZB 2V4JB 4FNHA 5B0FA 4KB7A 2BXJA 1T94A 4FYYB 2DR5A 3BB5A 4URSA 3ZXWA 2ADBA 1MU2A 2BACA 1D9DA 3LP2A 1LKZA 2HFSA 3SFUA 2F4VJ 3S8SA 3FQLA 4HTJA 5GAGI 5I3QA 1BGXT 4B3OB 2B9XA 3MGJA 3GIJA 2BVZA 2MKHA 3MWBA 1WG5A 1EZZB 3O2IA 3M8WA 4ZP6A 4OYIA 5D78A 5KFAA 1KLMB 2VQFF 4EZ6A 2NYHA 2E9RX 2HNZA 1TVRA 4TU9A 2W7OA 4OX7A 3I4HX 4ID5B 4USJC 1R8PA 4WFAQ 1EKSA 4NASA 3J80U 3OR2B 3MECB 3TVKA 4DCOB 1VQ7S 3R5DA 1NK0A 3FGVA 3OVBA 2NXCA 2CJ9A 2D9PA 1U8SA 1X4GA 2YKNB 5DDQC 1Q82T 2PEBA 4LF5J 3NGKA 5H9EK 2CVIA 5BR8J 2V4JA 1DZ5A 4ZPTR 2HZVA 1F2HA 4UQGA 3GJRB 2WBRA 5GAHI 3NY0A 3UN3A 3RYLA 1REVB 4Y34A 5C5JA 3ELHA 3MM8A 2I9SA 1FK9A 3M8PA 1MWZA 4RU9A 4BLGA 2RRBA 1BWVA 2DGOA 3KUHA 4P2SA 4ED8A 1HBOB 3ISNC 2BYCA 1KP6A 4JI6F 4F36A 1HHTP 1FESA 3NOCA 1YJTA 5B0BA 5FLXU 4RWXA 3GQCA 4J9SA 4NLTA 1HL6A 3KLHB 4WP8A 2CQ4A 2KVQE 3J81j 3NCRA 4KY3A 2W4CA 2GZOA 3DDNA 4OI6A 1YG0A 1VMBA 3DOLB 5LXRA 2ZUGA 5LMNF 3OSNA 1U47A 2UVVA 1XNQF 3OV7A 1SUQA 4ALZA 4J7CA 3HJFA 3OTOJ 1VQKS 1N33J 3O44A 2FGCA 2CJAA 4NMLA 2XMTA 4NYZA 2MDAA 1FFGB 5B0AA 2GHVC 2FZCB 4ELVA 3KHHA 1CULB 4FYXB 2B4VA 2XWXA 4ITSA 4LREA 2Y8WA 2VF3A 5KT6A 3JYTB 4HT5A 4MIWA 3HHLB 2HVEA 4EYHB 2E9ZA 1IBMJ 1DBDA 5KFMA 3TAPA 3K2YA 5THWA 3RTVA 3BN7A 4ID8A 4KBIA 2AJ1A 4IG0B 2ZZNA 4GKJJ 3I4PA 1NU4A 1RT7B 2L48A 4ZHRB 2HAIA 2IRYA 4YR3A 1K1SA 3KK1B 3QRRA 3M8QA 3HSJA 1T9UA 2F8HA 4XO0A 1WJ9A 2CKWA 4RJVA 2KU7A 2QJ3A 3I5CA 1T11A 3PACA 1WWHA 2ZM6J 2HHTA 3NEKA 2YKAA 4PYAA 5K5MA 1SCJB 4QBUA 5KFDA 5AXMA 1WKJA 2BABA 3H5UA 2N7CA 1HQUB 1S1WA 4X4VA 3H42A 5FD1A 1VQLS 2A2CA 1K9MT 1KSPA 2HHVA 3ET6A 2DNGA 4NCGA 1VHIA 3D5MA 3L7UA 5JUMA 1N6QB 3ZC4A 2OTLS 5DS7A 4A8YA 2YX4A 2GMJA 2PC6A 3MM8B 3T9NA 3W8PA 5SZTA 1U48A 1B4SA 4H4MB 2RUSA 2E5LJ 4NOHA 2BJ8A 2DR7A 2FLLA 1NPRA 1HW8A 3GONA 4LF9F 2B9YA 2R7WA 1R0AB 2L9NA 3A8JA 5KG0A 1IBMF 1QAJA 2J0QD 4OX6A 1SKWA 2L9DA 4MJKA 3D6HB 2DT9A 1FO1A 2HSEB 1FD2A 1S4EA 2GJIA 2AWZA 1CS4A 1Q4RA 1IKVB 2C42A 3NCQA 4Y2IA 3THTA 3VGSA 3DLGA 1IJFB 2DNZA 2HQGA 4NL5A 5HO4A 1S6PA 3C6UA 3CD5A 4LIRA 4NLOA 3W61A 3RB3A 1KLNA 2V8DA 1BQNA 1JJCB 2V50A 3TX8A 3MEGB 4PG7A 2YNFA 4DR6J 2I0XA 4FYWB 3D28A 2MHNA 5EWGA 3SCJE 1VYAA 3ZNUA 5I42B 3EPGA 3WX4A 4EBCA 1NO8A 1NJYA 2QEXS 2H3EB 4UF4A 2ACMA 2AYEA 3AHPA 1U6FA 3ULHA 1S77D 2HGLA 3MD1A 1KC8T 1RB0A 3AODA 2V8HA 1DTQB 4DQSA 2F63A 2D3O1 3W7BA 4G1IA 3DDIA 3BQ0A 1GMUA 3AA9A 1SPBP 2GGPA 2J0WA 1NH7A 1HNVB 1U2CA 3FVYA 1PYSB 2GO8A 3GU0A 4OYMA 2ZH4A 4RW4B 4PQUA 1E6VB 4N41A 4LFCF 2JRSA 4JI2F 3VALA 2XGQA 4FF3A 1HNZJ 3G6XA 3ILIA 2J9DA 3PW0A 2XNRA 4DSFA 2MGZB 3DHXA 3FSIA 2ZDPA 1IR0A 2DEIA 2XNQA 3NAHA 1JLEB 5DM7Q 3QBCA 1MU2B 3J7A1 3A3OB 4KH1B 5B0EA 4WIQA 1F5BA 5I3UB 2IDLA 1TL4A 2RB7A 3AAWB 1GEHA 3A12A 4DV1J 2ASDA 1KRPA 4I67A 1S1TB 1JJHA 2G2YA 4Q45A 2OPPA 3QATA 2FY1A 1V3SA 5C2GA 5K9FA 5KT4A 2VUGA 3DOMA 2VFTA 1P9YA 4RU2A 1EETA 3HSZA 4EYIB 2VBZA 1R0AA 1HNXF 3ETOA 1R0CB 1RHRB 5SUHA 4JI3J 3LP0B 2BUNA 2M7SA 1CQNA 2CPZA 2DH9A 4ZVPB 1B0TA 2LQBA 4B3MJ 4J9PA 3ZZZA 2DY1A 4A8KA 4B9SA 3N6LA 1VK8A 1IKWA 1TUVA 2H48B 2GVZB 4P7TA 5E3QA 2EKNA 1I51B 2XY7A 5HL7Q 3SV3A 4O4RA 4CH0S 5A8WB 1QAXA 3RRKA 5GMEA 1QSLA 3O1LA 5CH7B 1UEKA 4L72B 3PZPA 4PPDA 2F1FA 4IFVA 4PZVA 2E9TA 3H25A 3DRPA 3KLFA 2KT3A 2DY9A 4P2MA 4ECWA 2BRKA 4U7UD 1TELA 2JLEA 2K1RB 3OFEA 2F9DA 3BGLA 5FDLA 4DL0C 3GV7B 3PEHA 4CIOA 4MTPA 3HFVA 4C97A 3AJ2A 1PC5A 2XMUA 3RJMB 4R0JA 4C3KA 3NBPB 2G9OA 3JTOA 4J9QA 4MH8A 4LT6A 2WONA 1U0HA 2WRMA 3HJVA 4FPIA 3Q83A 4NLXA 3V5RA 1UFWA 5KG3A 2HZAA 5DETA 2W8KA 4MKYA 4FXDA 1SJQA 1S0VA 3T41A 4JV0A 3MEEA 4TQSA 3JYTA 1LWXA 3KG0A 2Y9HA 3BBCA 2DXDA 3KG1A 5DM6Q 4KJIA 4ZCMA 2EW9A 3GIRA 1KHVA 5KFWA 2FLPA 2IC3B 4Q2LA 4F02A 3TOQA 4B3SF 4E98A 1G7CB 2DNHA 1RHJB 5HAOA 3V6HA 3J7Z5 5HLFA 3ZZTA 1R8AA 4Y6IA 4IFYB 3EVOA 3OL6A 3CUNA 4QIGA 2GHWA 5K8OA 1TL5A 2A3JA 1U8WA 2LQ5A 5IV4A 4F8RA 2B8PA 5GAGU 4ED5A 1X60A 4CO1A 1BQXA 1B0VA 2LA6A 4P9SA 4USWA 4G3IA 3QIPA 4GRSA 5KFKA 4P71A 3K5LA 2BBEA 4PCQA 2VIHA 4K4UA 2UUAJ 2ZH8A 3P8BB 4K4TA 1S6QB 5A8RA 2DGSA 3K0JA 3QRPA 3AOCA 1KVKA 1OY8A 4WKYA 1FNOA 3R97A 2C2DA 1H38A 2Z30B 1ZETA 4DEZA 3BPDA 3RRHA 5KTQA 3HZGA 2NREA 2HHQA 1D9AA 1QY7A 5F8LA 1A0OB 1JJ2R 4MKAA 2KKHA 2XHWA 5KFZA 2RAQA 4EU0A 2DJWA 5A76A 1C0UB 3VR1A 4OL8A 3U02A 4QPXA 1YRUA 1PSDA 2ZDOA 1LEOA 3VAGA 1Z4UA 4MFBA 3WX8A 5GAHU 3LPYA 2ZH5A 3TNVA 1UP1A 2XULA 3QSIA 4J5OA 2CQ0A 3T6JA 2RQCA 2DH7A 1FFSB 3M2RB 1P1TA 4R8UA 1WHYA 3VV2B 2VHGA 2AU0A 1ZH5A 5IT9U 4NZ6A 4Q43A 3TZWA 3M9NB 5ITHA 3CD6S 2HBRB 1VRUA 1MMLA 1NHUA 1XMQF 2PT0A 2W2NP 4DMZA 3EGZA 1RT2B 2IJNA 4OI0A 2ZJPQ 2CQ2A 3OR2A 2D69A 2L41A 3KFWX 1LWCA 4P10A 2V9WA 2LDYA 3MM5B 4J9OA 1N34J 3G82B 3KNAA 4FXVA 1HBOA 2W2MP 1Q7LB 1YDLA 4KE5A 2N7YA 3IWLA 4YHHF 1T7PA 2OELA 3MCOA 3N28A 5LSRA 2UXDF 3U27A 4KGZB 2Z58B 1YX2A 4MYUA 4B08A 4CQ1A 3KLEB 5HATA 3QGPA 4N8NA 4I2QA 3GV5B 3NLCA 4CM0A 3W8GA 3V81A 2DPIA 3OL9A 4PABA 2OUGA 5EX0A 3OVAA 3FCVA 1TV6B 4OV1A 4ZP8A 3U1LA 2NR0A 1O5JA 4DDFA 4AL5A 3EUNA 5LM7E 4M5GA 1XIQA 2RH3A 4JV5J 2DTJA 3KDNA 5KOXA 3FNNA 5A6WA 5GVQA 1E6VA 1M90T 3CMQA 3N79A 2KHCA 2NUHA 2RQMA 2ZBIA 4OZLA 1QVGR 2Q6CA 4LR8A 5DRKA 5DQHA 1HWLA 4OYZA 2YKMA 1QD1A 2PSZA 3PKYA 1FRKA 3H4DA 3UCZP 4OHYA 2HQCA 2C3MA 3TJAA 3TA0A 4EFAC 1Q7YT 5B7WA 1XMOF 3T9ZA 2NYIA 2FLOA 4J9NA 1VQ5S 1OO0B 2WHOA 3CB4A 2E1CA 3M2UA 2R42A 1URNA 1XWLA 4ZP9A 2Z4PA 1NBEB 2HAFA 2HLUA 2XZDB 3NCPA 4M5KA 4F25A 3OHAA 3TWZA 3W5XA 1BXNA 1IXKA 1VBKA 2Q1LA 2QE5A 3W1YC 2RRAA 1SJ3P 2FHJA 1PGZA 6AT1B 3PX0A 1R8HA 1XBWA 3JQJA 2EBGA 1ZAWA 3QGIA 1BHNA 4RBTA 1HYSA 4XDDA 4DSIA 5HQMA 2KM8C 1WDTA 3VZHA 2YNIB 1U1KA 1NK5A 5A8WA 3T5KA 2J0XA 4LF6J 2B9WA 4ZVOB 3CCTA 4Q2MA 1F3FA 1OIAA 5D4LA 2XS7A 2JHEA 4WXOA 2Y1LB 1W25A 2ROGA 2K1RA 3OSPA 1M0SA 1QUPA 3D3BJ 3SDEA 8AT1B 5CCLA 3NWGA 1RGVA 4LRCA 5DGBA 4U67Q 1CPZA 2J7UA 1S9EB 1VHFA 4DFKA 2YQ0A 5KFHA 3EWGA 4QW8A 2A0FB 1LNQA 1TKXB 2FC9A 4WFNQ 3HT3A 1HBMA 2HQ3A 3HLUA 4X66F 2IMOA 1HNIB 4KC5A 2MKYA 2VOOA 4FYDA 3RBZA 3TUZC 1BQNB 2GVDB 2HBQB 4QPTA 4WP3A 1KR4A 1NAQA 3NNHA 2YKOA 2CJKA 1UWBB 1PBUA 3QWUA 3DOKB 5RUBA 1F2GA 4IG3A 4OYBA 4HVZA 5F8GA 2DITA 1RYSA 4LF4F 2DHHA 1T02A 5CYMA 2CPYA 4O3NA 4L76A 2QV6A 1OSCA 3RGIA 2W2OP 4LF6F 1R89A 2YKMB 3DLEA 1VCTA 3QLHA 4PXEA 4RW7B 2O66A 3SDEB 1RHUB 1TK0A 5F3TA 1VQSA 3B82A 2GGPB 2BV3A 1C0TB 5AJ3J 1B99A 1FA0A 3G6VA 4FF2A 2F4FA 4DV2J 3UN2A 2VQEJ 2LU2A 4KIAA 1Q81T 1IKXB 2WVDA 1HFEL 2X1FA 4N76A 3AB4B 5C7PA 4QR0A 4ZVFA 2MQPA 5B08A 4LFAJ 2D7SA 3O5TB 1HYSB 3IR7B 1FKPB 3IA0A 2CZ4A 1O8BA 1VBXA 1B0PA 2W01A 4IOAQ 2HHUA 1E6YA 2GC8A 2MQ8A 3AQPA 5F8HA 2IBOA 3S7RA 3PW4A 3GV8B 2AGQA 1S10A 2M4MA 3T5JA 2HK3A 1IWGA 1JLQA 1LW0A 4RUBA 4ZN1A 2FHOB 3EGWB 3GFXA 3KLIB 4NYPA 1CJVB 5J1NA 5D4NA 3M8SA 3VAJA 2AD9A 1VQ4S 2JZ5A 5L9XA 4I2QB 2CJYB 5D3GA 2UUBF 3M9MB 5HANA 2QYGA 2CQCA 4FYVB 1ULRA 1X9WA 1J5OA 3N0VA 3AD7C 2YX1A 1EP4A 3KK3A 2ZH9A 4RNNA 3K8WA 4ED0A 1K0TA 2HHHF 2D3UA 5ETVA 1FFWB 1DY3A 5K14A 4QU7A 5DZ7A 4HHUA 3CEDA 3TRGA 4CLTA 1YK9A 4CO0A 4C11B 4A8QA 1RBLA 2V63A 3Q89A 3T19A 1LWCB 2P9GA 3OTBA 4HH1A 3SFGA 3F56A 2DR6A 5IC4B 2VC1A 3R1HA 1Q53A 3UNGC 1RT2A 4Q44A 1MMNA 1X5SA 2KRRA 2PFDA 2YNGA 3D67A 4URQU 3MZIA 3V6JA 1NKCA 1WF1A 2Z56B 3CDBA 3KJFB 1TMMA 2C22A 4O4GA 1S0MA 1Q0NA 2JEGA 4DR3J 2GCFA 2GIQA 3QGHA 1QM9A 1RT1A 2I5JA 4F0HA 1KLMA 3R7SB 3HHLC 4PG8A 2I8EA 5DDPC 4K5RA 1S57A 1WORA 2D1CA 3ILJA 5HMZA 3I55S 2DYAA 3A3NB 1P27B 3FC9A 3MAAB 1U49A 2UUCF 1QE1B 2VKRA 2E1RA 4DR5F 4LF7F 2FPHX 2RSQA 3FRYA 1MROA 5HK4A 3H2VE 4LFBF 2KH9A 3NGDA 1HWIA 3BGUA 3BKTA 3LPEA 1MMDA 2GFFA 3MM7A 2IDEA 2P8IA 2QGFB 4OJ3A 5F0WA 1FWPA 3FFIA 5E2QA 1FKPA 2LQJA 1T3NA 4BCAA 2QG9B 4DPYA 4NX9A 2VBYA 4YQWA 2DO0A 4F50A 3CDAA 1T3OA 3TUIC 5LSLA 4MIAA 4AQYJ 2CAJA 2LEAA 1RTZA 4AUKA 2C2OB 5HP1B 1TZ0A 4IKAA 1ZA2B 4LSLA 4NMXA 3OXLA 4WF9Q 3PO5A 2AGOA 4P52A 1KBRA 1JXLA 2M8DB 1HQ2A 3KUEA 4BS2A 2M5YA 3DOLA 5AE1A 4A47A 1TAUA 1T9YA 2BE9B 4F4AA 1XK8A 1WC0A 1PYTA 1RT4B 3ZZUA 4C4WA 3WC0A 4U8YA 4AXIA 4LBIA 2VASA 3R7NB 4DR5J 2VBWA 3DGPB 3Q86A 3LF0A 4RBUA 1YWXA 3NRBA 3VHQA 1CJKA 2FHMA 4BBYA 4NEZA 1YHQS 3N9UC 5FJ4A 3CCZA 5KT5A 4DV6F 3DM2B 5DG7A 2NPIA 5KFYA 1Q1KA 2B4PA 2E5GA 2IPOB 2COLA 2E7VA 2MY8A 3DKDA 1JNZB 1HA1A 1HBUA 1QAYA 1URRA 2QO3A 2XGPA 3BSOA 1VBZA 2MKJA 2VONA 2VODA 1FDNA 3CIMA 4AQYF 1JLGB 2YPZA 4ZVEA 2VFRA 1HQEA 1SB6A 3NOGA 2R8HA 1LK5A 3W5YA 1X4HA 5KFJA 5JXSA 1AZSB 1IKYA 2BE2A 3AJDA 3MCNA 2UVUA 1WUUA 3D68A 4KPCA 2ZBPA 4XDCA 4IG3B 4WK1A 5D0EA 1C1BA 4DQIA 4V19X 3QFWA 2RS8A 2WW4A 3G8TA 3M4XA 2XYGB 2DGUA 5IT0A 3LP0A 4K4VA 5G0RA 5A2QY 4QIFA 3E01B 1RLDA 3LP2B 4KGKA 1YSJA 2C3PA 4OV6A 4Y3CA 3CCVS 2VH7A 1DJ0A 1VI7A 2M0GB 1S1UB 2CQ1A 1RAHB 2MLXA 1JLAB 2AEJA 4OJGA 1C0TA 1H72C 2F8EX 3EDRB 3H59A 3WBZA 4ED4A 1T05A 2AJ2A 1TVRB 2ROEA 1FKOB 2E1PA 2EFQA 2K06A 4X64F 1HMVA 2JVRA 3EDQB 3PYGA 1RBOB 2VQFJ 3C3LA 4IFVB 2V6AA 5KFXA 1FKAF 4HYKA 1JMTA 2E5JA 1IKYB 1Y5IB 3HF5A 5EN1A 2LQ9A 3I0SA 3K58A 1YIJS 4W98A 2WZ1A 3QIDA 3T3FA 5ETMA 1M1GA 2CPIA 2DGVA 4DZDA 2B51A 1UVLA 2XLJA 3CCLS 2RKIB 2V2QA 4DR2J 5DGAA 1TL1B 2MY7A 1PJ7A 1RCXB 4X84A 5LOQA 1V3RA 4JOUA 3B54A 1ROFA 3JSMB 4K0KF 1VK3A 4ENOA 1X0PA 2H4YB 3J80Y 2BQRA 2DXEA 2R4FA 2KXFA 4KHPF 1VDHA 2VG5A 2KFZA 4ZVSB 1MSWD 3BR9A 4KPYA 1SVDA 5E7OB 2BKPA 3PW7A 3DRPB 4UOGA 2Z2ZA 5KT3A 1RAIB 1VLOA 4K5SA 1OPZA 5G4DA 4D3GA 4WPAA 2ZH7A 1HHSA 4J37A 5HVGA 1FWKA 2YWWA 2MXYA 2OMOA 2CPFA 4KV8A 1Q5YA 1FNXH 2HQDA 3NMRA 4X62F 4RR5A 1RHKB 1EP4B 2Z0GA 1OY9A 1F9HA 4DCPB 5KG7A 3KK3B 2R8GA 1CJUB 4NPOA 3H0PA 4BC9A 3PIPQ 3T1YF 3ZO7A 4DG1A 1XERA 1R3NA 3T5LA 1NZAA 1QTMA 3RU0A 1NH8A 1FT8A 2CPXA 2VD3A 4PUOA 3CSKA 1GMWD 2BKOA 3W62A 4CTAA 2VFSA 4WYWA 4G1QB 1S0NA 5G0RB 3TUPA 2DB1A 4MAKA 3VGVA 4EO6A 4FVCA 3UDLA 3ZFVA 4KHPJ 2ZKUA 4PAAA 2EFOA 2QA4S 1UVIA 4ERDA 2LKZA 4TY8A 5MLCV 4DR7J 4MFBB 5C24A 4X4QA 2J0SD 5D0RA 1QAIA 1F3VA 3KLHA 1NB7A 5M2RA 3PX6A 2WTFA 1K47A 4WFXA 5A0YA 3KHGA 3EYZA 2VV5A 4RW6B 5HROA 3JTNA 3DDKA 4I4BA 2RQ4A 3R9LA 4F0MA 1N56A 4I7FB 2HHPA 3T1YJ 3DHWC 2CQPA 4DSJA 1RJJA 4NRUA 3K57A 1XR5A 1NKEA 3GWCA 5F0UA 5F8JA 2OD4A 3D1HA 4M5DB 3Q2SC 4JV2A 1GK8A 3QQCD 3VCDA 1AUDA 3MR2A 2GJ2A 4I0WA 3ZTOA 2DNKA 3G96A 3LO3A 1YVFA 2VDIA 2PDAA 2V5HG 3VZIA 5J2MB 4L75A 1RSCA 3E51A 4NWBA 2ZBQA 2B4UA 1Y3KA 1VRTB 1VIXA 1TKZB 3NGSA 1U2FA 4ICLB 4HH0A 2RS2A 2BM1A 4ETXA 2OIHA 1F0XA 1IWAA 4C8OA 3O6QA 1N36J 3V2UC 3MM5A 2H5JB 2W2QP 3HD2A 2GQCA 3UNYA 2JLGA 3CGIA 4OIXA 5JMNA 2KRBA 4P2FA 3BQ2A 2DHAA 3UD4P 2J8AA 4LR7A 2FVPA 3GILA 3KLVA 1UMJA 3TZXA 1RCOB 3QT5A 2VBXA 4W90B 3C8YA 5CHCB 1U45A 4PXCA 3Q8RB 5C42A 4CT8A 2H5IB 3MPVA 1RT3A 2EFVA 1WC5A 3BSNA 4IFYA 1U1LA 2D41A 3WHIA 1IBLJ 3KLFB 1C1CA 4WP9A 2BR0A 5GMDA 2MZSA 2YKNA 2VDHA 3G6YA 1Q5VA 3OW2R 1KVIA 4ZLPA 2AEMA 4UW2A 2O67A 1YBUA 1RBAA 5IQ6A 5KFBA 1WC6A 4OYPA 5C25B 3ISZA 1N5QA 1OS5A 3W63A 2ROPA 2R9LA 5LL6d 1UW4A 2BJ1A 3VVUA 1X9SA 2HGNA 2XLIA 2OKQA 2HBZB 4TU8A 1XTZA 2KXNB 5A0YB 3MM6A 3PXGa 3J7YI 3FKBA 4LFCJ 1UEUA 2RU9A 3G8SA 3O3LA 2YNIA 1N4LA 4O3OA 3DMJB 1S48A 1RWXB 1NK6A 2ZC3A 2YWGA 3P5BP 2WVBA 3ZZRA 1J5EF 3F41A 4TYAA 4B9LA 1FJ7A 4RBVA 2HIYA 3L9ZA 3GG0A 3HVWA 3AA8A 3OVSA 3KK2B 2FJEB 1P1LA 4F0KA 2UUAF 4DR4F 4DOZA 1ITPA 1Y00A 3UWTA 4DV1F 1B64A 3DLHA 3FBBA 5L46A 1N88A 3IS9A 2O5DA 3QIPB 4OQJA 4ECZA 1J27A 2UZAA 2HS4A 3JSMA 1QE1A 5IV3A 5KG4A 2ZH6A 1WNEA 2VG7B 2QA1A 2RKIA 3TJ9A 2W7PA 4JI3F 1SV5A 2G0JA 3FCHA 4KHRA 3WZ0A 2HWHA 4NLDA 1RAGB 4DV7J 3KJVB 3AXMA 3SYZA 2NS1B 2JC1A 3KXDA 3WIUA 2ZWPA 1AROP 1PAEX 1WD6A 1RHMB 2DGWA 2HURA 2HS0A 4K8RA 4P75A 4ZN3A 1A7GE 1NMEB 1AUSL 2CDRB 1X4DA 4DZ6A 1FRIA 3U1NA 1L3SA 2ZHBA 4DF4A 2GHPA 2FZGB 1RWNB 3IRXB 3BN4A 2HMIB 3DRYA 4WKRA 1EQ0A 3K5MA 3H5SA 1K44A 2D3OR 4RW8B 3BV8A 4CLSA 2NZCA 3C16B 3IS9B 3PYDA 3QAUA 4NA2A 2HKEA 1C1CB 1S1TA 2A10A 4OYXA 1RLCL 2FGOA 3KMSA 5AXLA 5KFUA 1MLAA 2NPFA 1FTCA 3IR6B 5EDWA 2WVFA 2EC0A 2DNMA 4B3RJ 4ZVTB 4ZLLA 3NNAA 2V2VA 1WDDA 3DYAB 3JQMA 2H1YA 4NZ0A 4KGMA 1MWYA 1OQ3A 2J76E 2MLZA 4UUWA 3ZZYA 5M2UA 4M95A 3KOAA 4GVBA 3P49B 1DTTA 1G4CA 1UPMB 4CH1A 4RNMA 4ECYA 3PJ9A 4OYOA 4TU7A 1PAUB 2BZ2A 3DC2A 4DXLA 4X4TA 3M6XA 2VPYB 4WXWA 4JP8A 4R5PA 1XNRF 3LWMA 5BYRA 1NB2A 4C8ZA 1KQFB 2HGMA 4JV5F 3BM7A 1HD0A 1H0HB 5HVFA 2PMZD 4QWAA 5J2MA 3DRXA 1OPIA 3Q22A 4CNYA 1IKXA 4C8KA 1HKAA 2HQIA 2XB2D 4M1KA 1ZAXA 4LF1A 3PG9A 2AW0A 3D66A 5BXIA 5CD4A 1UA1A 1JX4A 1SIWB 3CCRS 1OMSA 3RUBL 4I7FA 2W9BA 4ZCLA 1GFWB 2VB6A 3CCWA 1AT1B 4NCBA 4MYTA 3UW1A 4DFMA 4DX5A 1ZS6A 4QW9A 1JLBA 3BDPA 4JI7F 4NCAA 1S9EA 1KOOA 4OFZA 5IWAF 1WSRA 3IRXA 1HPZB 2ZC4A 3A3PB 5IT9Y 1UAWA 5I42A 2CNNB 1UWAA 4ICLA 3MMBA 3UCGA 4IH5A 1O6XA 4CO4A 2LXIA 4OJHA 2DCUB 1WKKA 2F65A 3PRDA 2BQUA 4FNIA 4DV0F 4G65A 1I94J 4ZJQA 1U1OA 4IQXA 3MPUB 1CC8A 3W3SA 2HRYA 3FFIB 1S1VA 2B4OA 4QJVA 2XO6A 3C6TB 3FK4A 4ATNA 1F9FA 1NEEA 2PEHA 2F8MA 4KFBB 4OMFG 4I2PB 1ZM2A 4DX8H 6FD1A 5KFNA 2PD1A 2VA3A 1RAEB 1S97A 4WCEQ 2DHGA 1N34F 2MQLA 2XLKA 2X7IA 3GIIA 4B02A 3C14B 4ZVGA 5C42B 4DL6A 3HI9A 2AX0A 1NSAA 2YBVA 2QX0A 4FXWA 4X66J 5EUHA 1DTTB 4KSEB 1EB0A 2FB0A 5E3AA 3THPA 3MTJA 2DNYA 4LBHA 4OZ1A 2XYHB 2QL7B 3A8EA 3ZTPA 5FLXY 2NSCA 2OPPB 4YR0A 3V4IB 1UW9A 1RU2A 2LQ8A 3MM6B 3UFCX 4MK8A 1SKSA 3NGUA 1Y5NB 2F9JA 2C2NA 2PMWA 3TAMA 4WZQA 2WVEA 4RW9B 3BBFA 3GCXP 3M8RA 3AD8C 3OFHA 5CZVA 2QFIA 3QO9B 1NK8A 1CJTA 5E33A 1T9TA 4XK8C 4CM2A 1KQSR 4MMOA 1S7IA 2CQDA 4PRFA 2C1EB 1DLOA 4ECXA 3KHLA 1NPKA 1U1QA 4P2XA 4WK3A 1X9MA 1M5SA 3HHDA 1J5OB 4ZLJA 4PUOB 1RISA 2H54B 2BW7A 2V8GA 2HMIA 3H5YA 3BBBA 1IBKF 1RK8A 1S1XA 2EG1A 2W9AA 4ZIVA 4O44A 5ETKA 2LEBA 2A6MA 2ZD1B 4LJMA 4IDKA 2PI4A 4JYAF 2AGPA 4C8YA 2OSRA 1QSSA 2YNGB 4NLQA 4K4WA 4LF8J 3MCSA 3IBCB 5D15A 5T14A 4WU2A 4DSEA 1XMBA 4JI4J 2AX1A 4JI1J 3A4TA 4DUTA 5KFQA 1LFWA 2FHJD 2OPQA 1NCLA 4ZPBA 1BQMB 2P5VA 3AOAA 2YQ1A 4F4KA 2R8JA 3MOJB 2R7QA 2IRUA 4HEA9 4NI2B 3EZ5A 4LSNB 1GMVA 1OJ4A 4OZ5A 3DRSA 1KTVA 5D3GB 1S1XB 1S79A 3TQEA 2IJFA 3GYXB 3R5BA 2FLNA 1GT8A 2K7KA 3BREA 2QA4G 4HL9A 2KFYA 3HCXA 1HQEB 2B7BB 2DCLA 2FVCA 4IDKB 2JNJA 1IBKJ 1WC1A 3UR3C 1FTRA 4YOEA 1LXNA 4X2BA 3NNCA 4ANCA 4LUBA 4F3MA 1A6LA 1ZBTA 4ED1A 2DO4A 3DLJA 2KYZA 4M63A 1IJEB 2E5IA 2UV8A 3I9ZA 4BWMA 4DR3F 3ENQA 1U6ZA 1S0OA 1NDLA 1LOUA 4PWWA 3DXSX 2XEXA 4TVAB 1VISA 1EX8A 4PG4A 3PW2A 2AF6A 4O3RA 3HP6A 2G2ZA 2OMLA 3HZEA 4EO8A 4CLYA 1UVMA 1YITS 1SH2A 2B6AB 1JLBB 2MSTA 2Y0BB 4P73A 4QIWD 4ZKAA 3UE2A 2UUCJ 1CC7A 3IMQJ 2N3LA 2SXLA 3B78A 2VG5B 2VFVA 1H98A 3EVMA 1OQ6A 4XPEA 2P6TA 3LGHA 3RAMA 3IG1B 4WWSA 1FJGF 3MHYA 2MSSA 3NGRA 2N3OA 2EPIA 2XM3A 4JB8B 1RT7A 4ZHRA 3HSDA 2JH3A 2YVSA 3M05A 1FERA 5HJYA 1D0EA 2AYGA 4F4YA 1LFPA 2DXFA 3B8HA 1BY9A 2UVRA 3HULA 2LEPA 5K8MA 4CCHA 1OY6A 1YJ9S 4YB6A 3NP5A 2NLWA 2HQFA 5E5NA 1REGX 3BGRB 4Y00A 5I4MA 1IUJA 3CO0P 1HWKA 3H90A 3OTCA 1YGYA 2W9BB 3BKFA 1HI8A 2V0NA 4OLPA 3H8YA 3AFGA 3PCOB 4OZNA 4DJBA 1Q8KA 3CD7A 1RABB 2ASYA 2GW8A 2FVSA 2AYBA 1RADB 2IAJA 3G4SS 3P45B 3JSYA 1PJ6A 3HKZD 2YKPA 2VPXB 4YY3J 4TN2A 4QWCA 2BOAA 3D7SB 3FZ2A 5D6GA 4DL5A 1VC0A 3PEJA 4KR0B 1WHXA 2M70A 2QMUB 5E3PA 5IT4A 5H1SV 2V8VA 3TUJC 1NJWA 1FRLA 4RPFA 1VS3A 1T03A 4X65F 1UZHA 4A4JA 2A1BA 1M5PC 2CA9A 3BGOP 4UQTA 4DFJA 5L39A 1N48A 5CQGA 3HPOA 1KQKA 4RUHA 1WTBA 1S1UA 1VQ9S 2RILA 3ICLA 2PN6A 2J5AA 3ZNJ1 2B5JB 2V4QA 1CEZA 5DQIA 2ZOGA 2ASJA 1L3VA 3GSDA 4ETZA 4YFUA 1WC4A 4HHHA 4RNFA 1E6YB 3M2VB 4R0EA 1LQ9A 8ATCB 2JEIA 3W64A 3GZ7A 3CJKA 2VZ9A 3GTYX 3KG4A 4Q7AA 3DFEA 3M9OB 4QCLA 1EHWA 3ADAC 4AXJA 2PMHA 2YWKA 2OPRB 3V6DB 1TKDA 1N32F 3CC4S 3GYGA 4LF5F 2B56A 2OJ3A 5BR8F 1B70B 2F7VA 3MECA 2OI2A 3I0SB 1NJIT 4YY3F 3OLAA 2ACYA 3ILLA 5L9NA 3IN5A 3K59A 4EWTA 2AJ4A 2MHEA 4AL7A 2OTJS 3Q8UA 1X4BA 4ZPDA 2BDPA 3HO1A 1ZTTA 4C0HA 5DLFA 1VIOA 2QTWA 2ZZTA 1TKZA 2YWEA 3CJ8A 4QYRA 2XO7A 4M5LA 4ED7A 3HHLA 1DHMA 3W9JA 1G2EA 3AT1B 2MKIA 3RAQA 2CQ3A 3M30B 3PHTA 2C2RA 4I56A 4Z7YA 2BMBA 4OZ3A 4X64J 3UR0A 4R8UB 4DQPA 5A2QU 4LF8F 2M88A 1TQLA 3K17A 4DR2F 1SKUB 1DLOB 3KMQA 4DQRA 1RAFB 1R0BG 4JI8J 2ZD1A 1KQGB 3CCES 3MM9B 4AYBD 3BO4A 5EWEA 4QWEA 1TKXA 3M6UA 4PWDB 1BWEA 3G82A 2VJUA 2CQHA 1Q95G 3MM7B 1XQIA 2R8IA 4O3SA 1NSPA 1MROB 2QC3A 4RO0A 2LECA 2J9EA 3CDWA 5KAKA 4HLBA 1JLQB 1LW0B 1V9OA 1TP7A 3D4JA 4YDDB 4A8SA 4OZ0A 1UA0A 3C46A 4V19J 4OYWA 4C8MA 1ZTWA 3VGUA 3AD9C 2H65B 3E8OA 1IQTA 2F4VF 1RT6A 4H4KA 1M1HA 1HBNB 1C4AA 2GMHA 2RU3A 2IYIA 3DN9A 3LH2S 3KJQB 2UU9F 2VOPA 4M5JA 2DNNA 2HWIA 2Z8QA 3M8QB 3S6EA 1GXTA 3CPWR 2IM2A 2WCXA 1Y10A 2LA4A 1J2VA 1F1BB 5LJ3Y 2XS2A 2B43A 1VQNS 2HFOA 5GADI 4MKVA 3QMQA 1L3KA 4IH7A 2CZVC 4Y2AA 2CPEA 3BGFA 4ZMMA 5CABA 1VQOS 2HRUA 2FHKA 1T9VA 4TLQA 4TKTA 4NEYA 4AE5A 1TK5A 2YH0A 5HMWA 2V69A 2IC3A 2R8KA 1RZMA 1EARA 4LRBA 2HPUA 2Q3PA 4KO0B 4E0DA 2W9CA 3Q23A 3CDUA 3RZAA 1S76D 3HX9A 2WB1D 2RF2A 4OI4A 1AFIA 1YBAA 2HFNA 4M5MA 2ZITA 2E29A 5ADZA 4F2RA 2XHCA 2JL9A 1HMVB 3ZZOA 3RB6A 2QLJB 1JB0C 4KAIA 5J2PB 1VRTA 1NKBA 5F8IA 2J6SA 4KT0C 1K73T 2ZH2A 2LCWA 3IR5B 3TI0A 1SXLA 3TA1A 4LRFA 3EGVA 4H4OB 2AIRB 2JX2A 4ZJOA 1D9FA 1WOOA 2AYMA 3RB0A 2MB0B 3RW7A 2QA2A 2RRNA 3D6TB 3OR1A 4HT7A 4N56A 4JI5J 4JUZA 2C2MB 4RW6A 2R7RA 2IA6A 3QRQA 4DR6F 1P9QC 4C48A 1XNQJ 1HIYA 3UDCA 1HR0J 3TEGA 1UTAA 3G6ES 1C4CA 4C11A 1F5AA 1MG7A 3BQ1A 5DDRC 5CZXA 2CJXB 4DR1F 4OZJA 3SCLE 4Z2XA 3NWRA 4PG5A 5T7LA 3OTOF 2KM8B 2QLFB 4ED6A 1LV5A 1REVA 2A6OA 4TXSA 5F9NA 2EEYA 1YJNS 2HZCA 2WSFC 3IP0A 4CT9A 5IS2A 1ZAVA 1JKHA 2LXFA 2ZKTA 3FMBA 4R25A 2B3TB 1T05B 4WE1A 1LW2A 4PG6A 1VRUB 1UVJA 2XI3A 2XMAA 4JI2J 4DL4A 1ELOA 1UWBA 4J9VA 2R7TA 1YJVA 1HD1A 1BD6A 1NPPA 2EG2A 2L08A 2MZ1A 2CNOB 3MURP 1KN6A 1MN9A 2NXJA 1IN0A 2F40A 1VQ6S 2BJ9A 1IM4A 1HNIA 1RWPB 2NXUA 4KYZA 4ZCIA 2FJWA 4USVA 5HJXA 2ZWOA 4YS2A 3H4BA 2FVRA 2ZM6F 1ZYQA 1JLEA 4CTAB 2XY5A 1KVJA 5DJBA 2B5JA 4ECRA 2HVHA 1HR0F 5DG9A 2DNQA 3CF5Q 3QZ8A 2YNHB 3JSRA 4DBQA 4ZK7M 2VJVA 2K8GA 2APOA 3BPSP 2EC2A 4ZP7A 5CYJA 3KYLA 1WOSA 1FXDA 1BC6A 1R8BA 1X8DA 4CYUA 2BQ3A 5KFIA 3QLHB 2WONB 4RW7A 3OLBA 2E5LF 1IBCB 2W25A 3SQOP 2JWNA 3MMCA 1GTEA 1KTQA 3I9V9 4DQQA 5ETSA 1VQYA 1EETB 2RMLA 1KD1T 2HS3A 5KFEA 4IOBA 1X0FA 1L3TA 2CZ9A 2DR8A 3QYYA 1TKTB 3OD2A 3R3TA 5EGYA 4F3OA 2AP6A 2ZE2B 1GXUA 2J9DE 3MOZA 2ZZMA 2DISA 2IVMA 3CJ2A 5B0GA 3MAQA 2VG6A 1S7HA 3UQSA 1GNKA 2MZJA 2YY3A 2DIVA 3QPIA 2YNFB 4LR9A 4OHZA 3W60A 1J5EJ 3BYRA 4LVOP 3OL8A 1RHQB 2JDJA 3L3CA 2BJ3A 1OSDA 1SC4B 1JLGA 2DNRA 2O1PA 2V34A 2ZOMA 4G6VB 1R6YA 3OUYB 2N4CA 2R2UA 3T1HJ 4B9NA 1RWKB 5E41A 2DNPA 2DIUA 2R7SA 3ZTQA 1IM6A 1D8YA 2CQGA 3OJSA 3MI7X 2DGTA 1JKHB 2FZKB 1U02A 3KWMA 2MQQA 5KFSA 3P96A 3US5A 4MKBA 3BEGB 4RW9A 3K8VA 3S01A 2E44A 1KOHA 1FHTA 1H74A 4J9MA 3IAM9 2N4DA 3I5AA 3C6TA 3SXLA 2EKYA 4U95A 1FNMA 4L74A 1W2BR 3M6VA 3PNIA 3LW5C 3Q8VA 3SZ2A 1N36F 3EVWA 4CWBA 1U26A 4NLWA 1JNRB 2QL9B 4ANDA 2DNOA 5HSPA 3BGRA 1W26A 3TVZA 4DL3A 1RT3B 3BH6B 3IWNC 2YWFA 2KT5A 2RDJA 3M2UB 4DL7A 1RXOB 3Q8SB 2J7WA 1Q16B 2YNHA 4DL2A 1R6VA 2DHSA 2QLXA 1LWFA 2ZEJA 4JI5F 4E2FB 1TU0B 2P9EA 4DS5A 3DLKA 3J7YU 1RWVB 2K3KA 4WFBQ 3ITHB 4DU7A 3ENWA 2OGUA 4CO5A 4W92B 4C9DA 3MF5A 5HN0A 1Z1ZA 2DKOB 2DNLA 3D0IE 3WIVA 2UXBJ 2Q66A 3J7AN 4E8UA 4I68A 3MUTP 1HNXJ 1UJ6A 2W9CB 3MCMA 2G4BA 2EFGA 4NI2A 3SCIE 3OQ2A 1PG5B 2RF2B 3G9CA 1CULA 2B9EA 1HWUA 3M8YA 2Z2MA 2ZNZA 4USHA 3DMJA 1SJ4P 1YRTA 4ZS6A 2O01C 1XNRJ 1X4EA 2QYCA 1H2TZ 1WACA 2C2EA 3H20A 4ED2A 3CJ0A 2ALYB 3RR8A 1IBLF 5AXKA 1FWLA 1LWEB 2GV1A 4N5SA 1XMQJ 3NS7B 4A48A 1RAJA 1TL3B 3MEKA 3RBXA 5JJBA 1DRZA 2DRBA 4XPCA 4LFBJ 1DQAA 3I87A 1YTYA 2YWHA 3NBPA 3TVYA 4UY8T 4FZVA 3HVTB 4DLGA 3BS9A 5DDOC 2OD6A 4HHJA 2Z2LA 4KGXB 4Q5VA 1Q8BA 3LTOA 3P5TL 2VG7A 2YTCA 3OFFA 1KHWA 2CXEA 3LUYA 4X4RA 4M5NA 3AJ1A 2IRXA 1P8GA 4PKDB 1Q78A 3CJSA 1NRKA 1R8CA 2P9CA 1Q86T 5LT5A 4FF1A 4ZJLA 2JOQA 1MW7A 4DV4F 1UFKA 4DCJB 5JVGQ 3ET6B 1SQFA 2JJ4D 5IWAJ 1H2UX 1F9EB 2PGCA 3IM8A 4FKYA 5KFTA 1QJHA 2ILZA 2QFJA 2GVZA 4GO7X 3IGVA 4ZVQB 2NXEA 1NK7A 4IR9A 2MQMA 2QT7A 3IO1A 4URGA 3M32A 1XEZA 3IFEA 2HW3A 4YN3B 1V3ZA 1D8ZA 4F26A 1YBTA 2UXCJ 5H9FK 3QT8A 2MYFA 1RP5A 4NXNJ 3SSSA 1SJRA 2VFUA 2QL5B 1I94F 3BR8A 1W2IA 1UZDA 2XTJP 2KXHA 2YQ3A 3ENVA 3UDVA 5I3PA 3L4BC 3PX4A 3B4DA 4PQUB 5J2NB 1JLCB 4TY8B 1DURA 1LWFB 2I38A 4CDIA 3CC2S 2J6TA 4Q0BB 3PW5A 3VQTA 4Z37A 1FDAA 1NDCA 1WC3A 4ILLA 1RACB 2JVOA 3HT0A 2D3ZA 1ZPWX 5E3CA 2Z2YB 1KWMA 4A8XA 1FEHA 1NSKL 2M2BA 3W5ZA 3OJUA 1XMOJ 1NJXA 1RT1B 2I5JB 4LVNP 3BKUA 3RG6A 4ILMA 4O4GB 3G71S 4DFPA 5HQ8A 5LMUJ 5I3UA 2HNDB 4B3RF 3HKWA 2W4PA 4HDHA 3VF0B 1FK9B 3M8PB 3ENAA 7FDRA 1VR6A 2CNLB 3CCJS 4DV4J 4ZITA 4N47A 4B9MA 1YQHA 2FQQB 2OFHX 5HBMA 3OPKA 2V4RA 1UFLA 3D6FB 3HFKA 2H51B 2HNYB 3D1QA 4RWWA 2CWKA 3EM1A 2RDDA 4B9TA 1GQEA 3E3XA 2KFNA 1DFDA 3N01A 1FDBA 3GJQB 4Z7CA 2XY6A 1D1UA 1TL1A 1FF2A 2NUUG 4USTA 4WFYA 4ECTA 1DTQA 1FE0A 1FX2A 1K1QA 2R3VA 3CJ4A 3W2WB 2AV5A 2EFNA 4TYBA 3LGNA 3D0GE 3CNQP 4FBTA 3KDOA 3B4MA 3EXCX 3I56S 1D3WA 5J1EB 2VKZG 4LSNA 3R6GB 3CJKB 2VL1A 1CJTB 4A8OA 5AXNA 4JV1A 4GC7A 2VPWB 3TA2A 3UN5A 3UVJA 4JBCA 1KONA 5D4OA 4AFFA 1SC1B 2OHDA 2QSWA 3X1LB 2AEFA 4USUA 2KZMA 2JLFA 4CLUA 3H7HB 4KTQA 4GVBB 2X1AA 4O0IA 4NXMJ 1ZPVA 5KG5A 2QRRA 3DCAA 3DLKB 3VAFA 1CJUA 4JI7J 1NUEA 1SC6A 1X4FA 2OLWA 1FD8A 4HR2A 1QLNA 3JTPA 2ASLA 1T03B 1GAOA 4JI4F 1M5KC 2HVIA 1VJQA 2FVQA 2BOPA 3R5GA 3IAS9 3QT7A 2GVDA 1S5ZA 1Y0HA 2GO9A 3BSCA 3FSXA 9RUBA 4WTOB 3PFEA 3DU5A 2G13A 3JXOA 3GSIA 5ETTA 3NS6A 1UVKA 4PYDA 1PIEA 4DPTA 1S4FA 1CJVA 1T9XA 1ZM4A 3G86A 4Y2KA 4UZBA 3C2PA 3MD3A 2HFVA 4UOHA 3MMAA 5CYMB 4XAKA 3HHLD 4H4KC 2QSFA 4LRAA 2UVWA 2P6SA 4Q8EA 3CIZA 1X7VA 4QIEA 2ZBCA 5AJ3F 2OEJA 3TARA 1G1XA 4IO9Q 3ZZPA 2ZJRQ 4J9UE 2VQEF 4DV3J 4X4SA 4I6YA 3WQPA 1NNDA 2FUG9 1RTIB 1RTJA 2OFGX 3D54A 1X5TA 3CVKA 2HNYA 2W2PP 2CUYA 5IC6B 3FEXB 4KKOB 1U1RA 5KFOA 2QLWA 4L6V3 4GMKA 4C0OC 4EUVA 3ZTSA 3MUVP 5L1KA 4UY85 5F8NA 5D0HA 1YJ7A 2GA7A 1IVZA 5LSOA 1X4AA 1U0HB 1C1BB 1MWQA 1F5CA 3GMGA 5C25A 2RD5C 3JAMU 4OI2A 3UCUP 3K5PA 1KFSA 3CW2C 1NDKA 2UUBJ 3BH7B 4YB7A 2OEKA 2C28A 1JIHA 2E5HA 4CO2A 5ETLA 3K5NA 2KHDA 2HHHJ 3QJPA 2A18A 3DLLQ 2XMKA 1VJWA 2HEKA 3R7BB 3EMTA 3GLJA 2XI2A 1BUXA 4O3PA 4CLLA 5A8KA 1SUQB 3DU6A 2C2ZB 3KLGB 5L1IA 4RW4A 1TTHB 3W2VA 3MUMP 3C16A 2FDNA 4OI1A 3N4WA 2F3JA 1GTHA 3OXFA 4WU3A 4C2MA 1V5IB 4RW8A 3MR6A 2VG6B 1YI2S 2Z57B 1Q8IA 4DU8A 1SC3B 1N52B 2AJFE 4JYAJ 4C3LA 4ES2A 1VOMA 1RTDA 2OPQB 1T95A 1U0SA 4PWUA 4Y2MA 2IM0A 4X4OA 1OYDA 2WB4A 2HNDA 4DSKA 3MPYA 2RQKA 1U2RA 5B0CA 4DUYF 1TFWA 4OHVA 4J90A 2V94A 3PFOA 3M2RA 4CLWA 1L3UA 2WW8A 1U6BA 4HDGA 3GFHA 1N54B 3ETMA 3QFHA 5DQGA 2RHSB 1FI4A 3DI6B 4RUCA 3KNGA 5IFMA 1U1MA 4X65J 2GIFA 3BO3A 1VRQC 1EKRA 2DGQA 2XQCA 1S12A 2VPZB 3GYNA 3SCKE 5HROB 3CJQA 4PR6A 4TQRA 2HG4A 3QJLA 3N6NA 2V68A 4RZRA 1SH3A 2GQQA 1HQUA 2FYXA 5AT1B 1N5TA 3L95X 3W65A 4ECQA 2DRAA 2FJDB 1YZ6A 4C8NA 3THVA 4Q0BA 4CLPA 4LFAF 5KG6A 1NK9A 3OT9A 3PRVA 4GKKF 2BANA 1FVSA 1BQMA 5F8MA 1UCNA 2Y3YA 4MIBA 3QNWB 2A2DA 4U7UK 1SH0A 1N32J 2KB2A 1NXIA 4EMDA 1RKIA 2IFXA 1WI8A 2PE8A 3DRSB 3UPFA 4ES1A 1B7FA 4DUYJ 3CCMS 3ITHA 4ZPAA 3K89A 5BYSA 2EI5A 4B3TJ 1U1NA 2HWTA 3FJ2A 4IRKA 2UP1A 3CXCR 4FDFA 2R2SA 1WEZA 2R7UA 2OO4A 4YEAA 1H2VZ 1H6KX 3NKYA 4IYQA 5L38A 3TZYA 4IRCA 2RT3A 2UUWA 3LOUA 1WHVA 4EZ9A 1FJGJ 5KFFA 4NRTA 3C19A 3NS5A 4BC7A 1XN9A 3QJJA 5IQQA 2XCPA 4IR1A 3Q8PB 1IR1A 3CD0A 3IXQA 4DV6J 3A1YG 2POKA 3QZ7A 2BANB 2H4WB 3AXKA 3C14A 3PM9A 4I2PA 4QR1A 4TY9A 3MPDA 3M30A 4AD6A 4Q8FA 2CRLA 2ATLA 1GMWA 3LGMA 5KFRA 1KEKA 3BF4A 3EICA 3I31A 4IOCQ 4GKKJ 4PXDA 1ZOTA 1FKOA 2BJEA 5KFCA 3HK2A 2NXNA 1NZ8A 4QYZJ 3H98A 2UV8G 3A8KA 3R5JB 2BJ7A 4BWJA 3V4IA 3I32A 4HACA 5CYQA 5IM0B 5JVHQ 3RW6A 4KH0B 3LAKA 1B7YB 3P4UB 4B3TF 4NZ7A 2DGXA 4J9KA 4AT1B 4RLEA 4LF7J 4QZVB 4DHVA 2KL8A 1PC4A 4NA1A 1RU1A 2XMWA 1S6PB 3C6UB 3H2UB 5ETRA 1NHVA 2FTRA 2V8PA 3CT9A 3LAMA 2UUTA 4J91A 1HNWJ 1YRXA 1Q8LA 2PA8D 2RVJA 4LQ9A 4A8FA 4WZMA 1FEEA 3N5FA 3P3DA 5IOLA 4RNOA 2E1AA 1I3OB 4ZPWR 1Y9OA 1RTIA 2IAJB 2UU9J 3RB4A 3CWJA 5L1LA 2KTQA 2DH8A 1L5UA 1NLKL 3SMZA 5J1PA 4FBUA 2FD2A 1RE1B 1O0PA 3T6BA 2MZTA 5GMKa 2CQBA 1R31A 2DEJA 2FY8A 1WF0A 2PIIA 3GG1A 2ZH1A 2CYYA 3EXYA 4UT4A 4K0KJ 2JFDA 3IC1A 3IRWP 4FN5A 3MFHA 5ETPA 4EI2A 2EK1A 1SJ1A 2EK6A 1RWUA 5FIIA 4DPUA 2ZH3A 2X3DA 5KOWA 1TUGB 3M1VB 1KDNA 3AOBA 3ZTRA 2HVZA 1EQMA 4OX8A 3SSQA 4DUZF 1ZM9A 4H54A 2BEFA 2X3GA 3MPWA 2HVDA 4K50A 4B3OA 3ONQA 2MEWA 3NGTA 3CO9A 3LA0A 1IKWB 2V2ZA 2LLZA 4USKA 4PXBA 4QU6A 1HNWF 4F7VA 3FEYB 3OUYA 5HP1A 2R7XA 4CRJA 3OBIA 1QDUB 1QTNB 1Z2LA 3JQKA 1X4CA 4X62J 3VAMA 1NK4A 2C3UA 2WVCA 3LWLA 2KG0A 1Q79A 1D09B 3MR5A 1HW9A 2AMCB 3FBFA 3MM9A 4KV8B 4NLPA 3W9HA 1FX4A 1X5PA 4RUAA 4ER8A 2Y0SD 1RI7A 2QMXA 5FDLB 3AY0A 2ATCB 5K8NA 2WBMA 3T1AA 4YMEA 3H40A 2C2KB 5J1EA 4JI8F 2EFPA 3FEZA 2Y1IA 4KGVB 3SEOA 3EJMA 4M5HA 1AB8A 5HMXA 1SJFA 1JWWA 1YKWA 1DAXA 4HTIA 4XTTA 3VAKA 3CMES 2JC0A 1R27B 1WG1A 3W2WA 4F4WA 1S9GB 3DRRB 2LXUA 1G3OA 2GAGC 3FRZA 3IGNA 4YDXA 4NA3A 3V4MA 4BHQA 5DLGA 3HXMA 1SV5B 5EWFA 1VQMS 4FKXA 1N8RT 1H73A 4ZVHA 2IJRA 4DR7F 3KJVA 3HM9A 4ZCKA 3CJ3A 4YB1P 4A46A 2EXUA 3DM2A 4IUFA 1VGYA 1UETA 3QT6A 2O3DA 2AHOB 2B6AA 2LVWA 4JI6J 4QWDA 4LMZA 1IR2A 4RKUC 3MAHA 2MJNA 2X1GA 2I1RA 1WEXA 1GX6A 2G0CA 4FS1A 1UJ5A 2B8QA 2FIUA 1TKTA 2RDIA 2FJXA 3BDEA 1CS4B 1WEYA 5LMNJ 3TANA
chains in the Genus database with same CATH topology
4F3QA 3HHEA 4M94A 5GAEI 1SBRA 3Q2TC 2KJWA 1LXJA 3FSYA 3CMAS 4P7VA 4EEYA 4WYLA 4IO1A 1UEVA 1N33F 1HWJA 2EVZA 4FF4A 1R43A 3R5CA 3I96A 4CH7A 1M5VC 3TR5A 3POTB 1FXLA 1FVQA 2IM3A 2RNEA 2E66A 3MMJA 1U1PA 4IH6A 3C66A 3CTRA 5HI7A 3OHBA 3NMAA 2GX8A 3NL0A 1WI6A 1MNEA 2KYXA 3SI8A 2B7CB 4KQZA 2IM1A 1HNZF 1VC5A 4YUDA 1SIZA 1ZM3A 3V6KA 2LU1A 2ZE2A 4DN9A 2GNKA 3EGNA 3UD3P 4JI5F 3I0RB 2KT2A 3GIKA 4DLEA 2R7OA 5CD4H 3PR4A 1QSYA 3O8WA 2DVIA 3CC7S 2MKSA 2QMWA 1VBYA 2M52A 3LALA 3UI3A 1IBLF 4KRWA 1XR6A 2DK2A 3KK2A 4CO3A 2CDQA 2ZOFA 4GC6A 2HNZB 2H9ZA 1PILA 5HBMB 2RUGA 3M32B 4YP3A 1YJWS 4YB5A 3PVXA 4LSLB 2C3OA 2HHSA 4P6QA 4ZOSA 4MK9A 1WELA 2M8HA 5AE3A 1RT4A 1I1GA 4Y28C 2BJDA 2X51A 4NLYA 4Y65A 4B3MF 3RRGA 2PA3A 2QIFA 4ES3A 3KK1A 2ADCA 4C98A 3RAXA 1VQ8S 2IYGA 5F3ZA 2KZZA 2KN4A 3VQSA 2MZQA 4C7QA 2D9OA 5EHHA 1VQPS 1M1KT 2EBEA 4DF8A 3I5BA 4F4ZA 3MDFA 4ZDNA 2OAUA 4B9UA 4ZPVR 4EBEA 1CLFA 4OHWA 4NCGB 1N6QA 2LYVA 2OPSB 2KO1A 1S1WB 4KFBA 1RTDB 1TL3A 2Y1RI 3OL7A 2E7XA 4NLSA 3JSBA 2HHWA 1RT6B 1YJUA 1UKUA 5CCMA 3KLEA 3V81B 2NSBA 1RTHA 1RT5A 4UUXA 3KLIA 4OI3A 5T41A 3HVTA 3G8QA 3NG8A 2W4DA 4K4ZA 4PWDA 2PI5A 1S6QA 3VTIA 5A8RB 5BYQA 3X3UA 2UXBF 4XIUA 2Q79A 2BE2B 2PO4A 3LANA 3EX7B 4V19X 1JXEA 2HHXA 2KVIA 3LP1B 3PKMA 5CXTA 3DNCA 2U2FA 1KFDA 4K4XA 4DN0A 3GR0A 4DWIA 4ECVA 5KFGA 1RA6A 3R5AA 2IBKA 1G6BA 1FDDA 3GFYA 4WFZA 4I6WA 3F73A 4USIA 2K2PA 4PPZA 4R5PB 2CJQA 2CVEA 4O44B 1C2PA 4HI1A 5K8PA 2XS5A 1HARA 5KFLA 2CIMA 2E1MC 1HBNA 4M5DA 1UJ4A 2M3DA 3BSAA 2W7AA 4NLVA 2MQNA 2ERRA 1RQ0A 5E3RA 3BJYA 1OWXA 4QIVA 2U1AA 3U1MA 3T1HF 1FRJA 4YR2A 4KKOA 4JI0F 3S1TA 2CG4A 4N8OA 4B17A 3KHRA 3DOKA 3L09A 3EPIA 2R2RA 1RTJB 4RNHA 5J2QB 1CVJA 4I1TA 2I2YA 4FS2A 3TAMB 3RBEA 2KI2A 1RDRA 2ALZA 2BRLA 4B9VA 3TAQA 4QR2A 2QZ8A 2FJBB 1FCAA 1S9GA 3DRRA 4O3QA 2IA0A 5BJRA 3PIOQ 2KJVA 2WSEC 3DXBA 2MGZA 3ZZ0A 1N5VA 2OPRA 3AQOA 1TV6A 2JSXA 1F60B 2XMJA 3AH6A 3PR5B 2Y1JA 3LQVA 3FQKA 2V9KA 4AL6A 1AW0A 2CJBA 2G1DA 2ZFHA 3PY8A 3M2VA 3PO4A 3OTEA 3TQ1A 3SQGB 1S72S 5H9FJ 2J9CA 2MJUA 2CPJA 2IVYA 2R2TA 3BO2A 1SL2A 2JEJA 3FZBA 3EZUA 1FXRA 4WJBA 2D74B 5KG2A 5A8KB 3KLGA 2H5EA 2OSQA 1TR0A 2MZRA 5LMUF 4A8MP 4RX6A 1FJCA 2BM0A 2RJZA 4F2SA 1VC6A 1QVFR 5A6PA 4QWBA 2L3MA 4DV7F 4WE1B 4H4MA 5C24B 2XSJA 4FP9A 3SSRA 1CSJA 2XG8A 1VLYA 4DSLA 4HKQA 3R27A 4ELTA 3AB2B 5LXYA 2WAQD 2IHR1 5IZHA 2AJQA 3MMCB 4ECSA 3Q0AA 2N82B 1U7LA 5K14B 4K59A 4OLOA 1JK9B 2XMVA 2LDIA 3MEDB 4DPOA 4WIIA 3M1VA 4X4NA 4ED3A 5J2QA 2XBPA 5CA5A 3TYTA 5LJ5Y 2DR9A 5GADU 2M9KA 3DLGB 2YX7A 1ZZFA 3MEEB 1APSA 1WG4A 4A8WA 3PV8A 3I0RA 3MMAB 2K7JA 1S49A 1I6JA 1Z2ZA 3DLBA 1S6UA 4NXMF 1SI9A 7FD1A 3MEGA 2MKCA 4PQAA 3OXGA 2AQ4A 4QU6A 2E7WA 2WOMB 2K3IA 2DD8S 1X5OA 3I82A 3J7ZT 2J6UA 2YH1A 2GIRA 1JLAA 4HI2A 3TO8A 3RBDA 3VAIA 2FJAB 2LMIA 2NQPA 2GQ2A 3QAEA 1HBMB 1FJEB 2EWHA 2XWYA 2UXCF 2FJVA 2Q43A 3K5OA 4NXNF 1ZZNA 4LIWA 2MKKA 2VC0A 3K7RA 5MAOA 1S6OA 3FMWA 1SKRA 1N0UA 4Y0FA 3MXHP 5D4PA 1N5YA 1A9NB 2R7VA 2CQIA 2V2KA 3IBWA 3QO9A 5KT7A 5GAEU 2FC8A 2IMWP 4LQ3A 3D2WA 2HYIB 1RT5B 1H7XA 1RTHB 2CPDA 2RIJA 5J2PA 1FE4A 1Y3JA 3DYAA 4ZA1A 3KKFA 4CZCA 4WTYA 2XSJB 1DQ8A 1V6HA 3MFIA 2OPSA 3HDSA 5F41A 1DQ9A 5HMYA 4H4OA 4U7CA 4MK7A 2DBBA 4IQMA 4C3MA 3R1LA 2XZWA 4G1PA 2DHXA 4OHXA 1XR7A 5E0OA 5AE2A 3TP2A 1WF2A 1U25A 3DGPA 4ZPCA 3CCSS 2XSFA 5J2NA 4TNOA 1HI1A 3OR1B 2IVFB 1WTFA 3LP1A 1JLFB 4FPRA 3TW0A 1NJZA 3D0HE 5M2PA 1P6TA 4NLGA 4DS4A 5EX3A 1U24A 4Y2CA 3L7OA 4F67A 2VA2A 5DG8A 2WOMA 1SL0A 3SV4A 3E2EA 1S9FA 3T5HA 2BA9A 2CFXA 3BZQA 2MQOA 3GIMA 3MMBB 1KNZA 5B0DA 3D1OA 1TFYA 1XC9A 1K8AT 1M5OC 3VAHA 2WSCC 4X4PA 5DO2A 4CNZA 4FVMA 3HHNB 3H5XA 4UOCA 1SL1A 4EBDA 2HFZA 1IKVA 1BLUA 2RE1A 4K4YA 1TAQA 1R7IA 5L8RC 4O23A 1Y5LB 1LWEA 1Y7PA 1IQZA 2C3YA 3GFZA 4ILRA 5U47A 3HVRA 2MPUA 2JEFA 3VWSA 3F44A 1FRMA 4K2XA 1CG2A 1GXLA 3CCUS 1H7WA 1M5HA 3OFGA 1RA7A 1YJRA 4TLRA 3GR1A 4NLRA 1HI0P 1GH8A 1RYRA 4DV3F 3CCQS 1JLCA 1TK8A 1QUVA 4QQBA 2X1BA 3PHEA 3J81Y 4F4XA 5KFPA 3HVAA 3JB9k 1O51A 2JFKA 3MR3A 1K0VA 1C0UA 2MMYA 2ZNYA 3U7JA 5IXUA 3QGGA 2KDOA 4GO5X 2J7KA 2KG1A 4JI1F 4U6PA 3CJ5A 2ZHOA 1JLFA 3HMJG 3V6DA 4J9LA 1CQMA 4N77A 3PRBA 3PJXA 2HIQA 3PDNA 1U09A 2YKQA 4IG0A 1M90T 5IM0A 4C0BA 2ZJQQ 1AXQA 3CDEA 5D77A 1AFJA 3PJWA 4NYOA 1DARA 3H2LA 1H3DA 2PFFB 3Q8QB 4OX9F 2Q6BA 4DV2F 3QWPA 2XCAA 1T8EA 1KS2A 1S99A 1N5YB 4I69A 1UVNA 3MEDA 4ELUA 4G1QA 4QOTA 1GX5A 4KO0A 2NZ4A 2HLTA 1RKJA 2OTJS 5KFVA 3ISND 2BW2A 4ID5A 2OH2A 2ZVSA 4D3HA 1HBUB 4EGLA 2B0GA 3GE9A 6FDRA 3N5BA 4ECUA 4IRDA 1UL3A 1HPZA 3DLEB 3HHKA 3L7PA 1SQEA 2WK4A 3CE8A 3WC2A 4L3NA 5L1JA 5D8HB 5F9LA 2W24A 1N5SA 1PO6A 3M6WA 4I64A 3W2VB 3CULA 5CYQB 3KTQA 1LW2B 3E01A 3MTKA 5H9EJ 1FRHA 2AJ0A 4I6AA 2L9WA 2OP5A 3I6PA 1S1VB 3Q24A 2DPJA 5B09A 5KG1A 4OJ1A 1LK7A