2MKSA

Nmr structure of the rrm domain of rbmx from homo sapiens
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords RNA-binding motif protein, X chromosome
total genus 12
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mksA01
3UD4P 3SXLA 3CTRA 2KFYA 2F3JA 3U1LA 2HGMA 5FJ4A 2JRSA 3G71S 2CQPA 5HO4A 3FEXB 1NJIT 3V4MA 2M2BA 1U6FA 1U1NA 3CC2S 1SJFA 1JJ4A 2KRBA 2MZJA 1VQKS 3HHNB 3I56S 1VQ7S 1U6BA 1Q81T 1U1LA 1SJ3P 1L3KA 2L41A 2F9DA 1HD0A 4M5DB 2RT3A 1WEZA 1IQTA 1D8ZA 3BO2A 2DGSA 2D3OR 1OWXA 2X1FA 3G9CA 3UCGA 2DNNA 3S01A 3H2UB 3OW2R 1DHMA 2DGUA 2K8GA 1VQ8S 4YB1P 1VC5A 2VOPA 3G8SA 2MQQA 2MJNA 3CPWR 2MZ1A 2GO9A 1X4EA 5DETA 2MQLA 3B4MA 2KYXA 3S8SA 1U2FA 2M9KA 1HD1A 2FHOB 2J0QD 2DNMA 3DXBA 1FJ7A 2CQ4A 2MHNA 5BJRA 2CPZA 4Y0FA 3S7RA 1M1KT 2RRAA 2YKAA 4IOCQ 4W90B 2PEHA 3G4SS 3CD6S 1YITS 5JVHQ 5CA5A 1WI6A 2QA4S 4C4WA 2CQ1A 3VAFA 5DDPC 2DHGA 4OZ1A 1FJEB 1ZH5A 1WEYA 2MY7A 2K3KA 3UD3P 2CQHA 1N8RT 1DBDA 1FT8A 2EVZA 3MUTP 1VBZA 2YH0A 4UQTA 2JWNA 1S72S 3MUVP 2CQIA 4ZKAA 1G2EA 2LA6A 1VBXA 2J76E 1X4BA 2DNKA 2YH1A 1U1KA 2MB0B 5DDQC 1JJ2R 2BZ2A 3SMZA 1X4HA 1KD1T 3TP2A 1U1QA 4F02A 2DNYA 5CYJA 3P3DA 2CPDA 3BEGB 1QVGR 2A3JA 3CCRS 2DNHA 2E5GA 3EGZA 2LCWA 2ZJQQ 2CPIA 1YWXA 3S6EA 2FY1A 1YHQS 1U1MA 2LA4A 1R8PA 3R27A 2AYGA 4F25A 2DGQA 4ED5A 2EK1A 5DDRC 2FC8A 2YWKA 4F26A 2VONA 3P49B 2MQPA 3UE2A 1S79A 4A8XA 3IWNC 1WG1A 2RUGA 1OPIA 1K9MT 5ITHA 1WF0A 3CCQS 1X5SA 2CQ3A 1SJQA 4QPTA 2AD9A 5LSLA 2MKJA 3D2WA 5IM0B 2DNQA 2MZTA 2OSRA 2SXLA 2BOPA 1VC6A 3PIOQ 2M0GB 3THTA 1WHXA 2DO4A 2MMYA 4TU7A 2AYBA 2CPFA 4Z2XA 2M52A 4LMZA 4W92B 4QQBA 2QFJA 4CIOA 5EN1A 2RQ4A 1A7GE 2LXIA 2HGLA 2MZQA 1K73T 4OZ0A 1N52B 5GAGU 4WIIA 2LXUA 2DNZA 2D9PA 2KXFA 5LJ3Y 4CQ1A 2MJUA 2RS2A 3R1LA 2J0SD 1UAWA 5DDOC 1A9NB 4Y00A 3CCVS 5GAHU 2ZJPQ 3CXCR 3US5A 3MD1A 2E5JA 1Q7YT 2E5HA 3VAIA 2OTLS 1M5PC 1WTBA 3CCUS 1YIJS 5CXTA 2DIUA 3CC4S 1H2VZ 3ZZZA 2RU3A 4WFAQ 4TU9A 3CCSS 1FNXH 3RW6A 2MSTA 3Q2SC 3MXHP 1VBYA 1P27B 3VAMA 2Q79A 3MI7X 5D78A 3FEYB 3RW7A 3SDEB 2PE8A 3I55S 1M90T 2AYMA 2XSFA 2RNEA 4J5OA 3NNHA 3THPA 2DB1A 3LQVA 3VAGA 2L9WA 1K8AT 2CQ0A 1RKJA 3DLLQ 2GHPA 2KXHA 1QM9A 2M70A 2LEAA 2MXYA 1ZZFA 3P6YC 2VOOA 2DH9A 2UP1A 2MSSA 2CPYA 2DGOA 1WWHA 3U1MA 3SDEA 1KOOA 2QEXS 2JX2A 4WF9Q 3ZZYA 3EX7B 1X0FA 2ZJRQ 1VQ5S 1PO6A 2CPHA 4CH0S 4WCEQ 1N88A 3NNAA 2OTJS 1WG5A 5H1SV 1M5KC 2DHSA 3HI9A 2CPEA 1M5VC 2RRBA 2CQDA 4PR6A 5IM0A 1F9FA 1VQOS 1VQNS 1WF2A 1VQ6S 2E5IA 4YOEA 2DGVA 2KG0A 1H2UX 1WHYA 1VQLS 2XB2D 3B4DA 2ERRA 4PKDB 2KH9A 3CC7S 2KM8B 1FJCA 1WELA 3CCMS 4IO9Q 3MDFA 1YJNS 2YTCA 4TLQA 1X5PA 2MZRA 3CULA 2JVOA 2KM8C 1VQ9S 3R1HA 2M7SA 3P5TL 2DGWA 5GVQA 3VAKA 1U1OA 4ERDA 2DNPA 3BS9A 2I2YA 3UWTA 2DNLA 1FO1A 1X4AA 2DGXA 2OIHA 5JVGQ 3EGNA 2KG1A 1SJ4P 2O3DA 3H2VE 2N3OA 2MZSA 1X4FA 2MQOA 1WEXA 2CQBA 3TO8A 2MKIA 1YJ9S 3ULHA 4U67Q 4LJMA 3LPYA 4WFNQ 1ZZNA 2NLWA 5DM6Q 4WKRA 5IFMA 2EK6A 2RS8A 4FXVA 1M5OC 2KVIA 2DISA 5GMKa 3BO4A 1NU4A 1YJWS 2LECA 1DRZA 2CPXA 2M4MA 3VALA 1NO8A 1KQSR 1R8HA 2KU7A 1JMTA 1XN9A 1UP1A 1HL6A 2DNRA 2G1DA 2X1BA 3TYTA 3CCLS 1YTYA 2G0CA 4P6QA 5LJ5Y 2AYEA 4TU8A 4IOAQ 1DZ5A 2KN4A 4C0OC 1FHTA 2XNQA 2XS5A 5LXYA 2WBRA 2MKKA 2KXNB 1URNA 2MKHA 2G4BA 2LKZA 1CVJA 2DHXA 1WG4A 1KOHA 2MGZB 1QVFR 3CCES 5HL7Q 5MLCV 3UCZP 2DITA 1UFWA 3NS5A 3VF0B 2DIVA 3G8TA 2E44A 1X5OA 2U1AA 2N82B 1VC0A 1FXLA 2KRRA 1N54B 3BO3A 2ADCA 1B7FA 2FPHX 1U1PA 3J7YU 3CMES 3MOJB 1UW4A 1Q86T 3VAJA 2MY8A 2VODA 3L3CA 4EGLA 2I38A 4V19X 5LXRA 2MPUA 1JJHA 5D77A 1SXLA 2U2FA 2DHAA 3MUMP 2X1AA 1PGZA 1AUDA 3JB9k 1H6KX 5LSOA 2X1GA 3NMRA 3CUNA 5GADU 1D9AA 1HA1A 4RU2A 5DM7Q 4PRFA 1H2TZ 1VQPS 2CQGA 2M8DB 2MGZA 4QU7A 3G96A 4CH1A 4C7QA 3CCJS 1W2BR 2CQ2A 2L08A 1X4GA 2CPJA 3NNCA 1KC8T 2XNRA 3K0JA 3NS6A 2OSQA 1X4DA 2MYFA 3IRWP 2KHCA 1OO0B 3MURP 2HGNA 2HYIB 4UY8T 1RK8A 2DK2A 1WHVA 3VAHA 1BY9A 2D9OA 2MQMA 2LEBA 2DNGA 2B0GA 2ADBA 4WFBQ 2MQNA 4QU6A 2N3LA 4YUDA 2M88A 3MD3A 2DH8A 1Q82T 1WF1A 1YI2S 2MKCA 2CQCA 3PIPQ 4BS2A 4FXWA 3UCUP 2DGTA 2JVRA 2RVJA 2DNOA 1X5TA 2V94A 1VQMS 5GAEU 5IQQA 2RQCA 2LQ5A 1WI8A 2KT5A 2CJKA 1O0PA 2N7CA 2LMIA 1OIAA 2M8HA 2HZCA 2XS2A 2DO0A 4IUFA 2FC9A 2MKSA 2KI2A 3Q2TC 1WHWA 3J7ZT 3CMAS 1U1RA 2F9JA 4LIRA 3CF5Q 1P1TA 3G6ES 1X4CA 2XS7A 2OJ3A 1VQ4S 2J8AA 2HVZA 2NZ4A 3N9UC 2LYVA 2DH7A 1SJRA
chains in the Genus database with same CATH superfamily
3WBZA 3MMJA 2F8HA 3A8KA 4RNOA 2KFYA 3H5YA 1F60B 1Z2ZA 1U48A 1TL7A 2NXEA 4KKOA 2EPIA 2AZ3A 3SQOP 2V4QA 2LLZA 2V63A 3G71S 3MPUB 3M7VA 3GV7B 1LWFA 3FCWA 3EE3A 4FKXA 4NRUA 4USTA 2RDJA 1MMLA 3QZ7A 1ZA1B 5ETQA 3V4MA 2XMVA 3ISND 5ETNA 4ECZA 2IRUA 4FF2A 1S7HA 3TA0A 2HHTA 3K5MA 3CC2S 4UW2A 1RT7B 1BUXA 3FBFA 1CBKA 2AP6A 2C2KB 2EFOA 3LAMA 5A8RA 2UXDF 4NLXA 2RDIA 3DRPB 5KFFA 4RL1A 3QFHA 3K5OA 2BUNA 1KHVA 2W2OP 3UW1A 4DS5A 4ID5A 3W8GA 1Q81T 1RLCL 1XR7A 2EFVA 2YKNB 2D69A 2NXJA 4LSNA 5L1LA 1FDAA 3P8BB 4XK8C 1CJVA 5ETMA 4A4JA 5J2NA 4CLUA 1GXTA 1G4CA 2F9DA 1LW0A 4M5DB 1J5OB 1HQ2A 1WEZA 2G2YA 3BYPA 4J9KA 4ETXA 3T41A 4USJC 1D8ZA 4DJBA 3BO2A 2D3OR 2ZHOA 4B9UA 2Y0SD 1NDPA 1X9MA 3H2UB 1NK7A 2VICA 3MECA 2BW2A 2VV5A 4X4TA 3V4IB 4WP3A 4NPOA 2H5IB 1DHMA 1U8WA 1S6PB 1H7XA 2K8GA 3CJKA 2Z2YB 3GJSB 1KTQA 2EFGA 1DTTB 3PXGa 3M8ZA 3N6NA 3PJXA 1VC5A 1J5EJ 4DPUA 4HTIA 2CNLB 4PWDB 2Z8QA 2MQQA 3WHIA 3CMQA 2R7SA 4AXJA 5B09A 1FDNA 1FDBA 2KT2A 3PO5A 5HROA 3NCRA 1PBAA 3NGKA 3CJ3A 3G82A 4CYUB 4EYHB 1B3TA 2QJ3A 4HI1A 4LFCJ 1H98A 1U2FA 3Q8QB 2M9KA 3I31A 1C0TA 3CSKA 3NCPA 3MAAA 2Y9HA 5EWGA 4LFCF 2YNIA 1T03A 1B70B 4MYTA 5RUBA 1LQ9A 1F9HA 4KJIA 3DNCA 1HW9A 1IKXB 1C1BB 3BH7B 2Q1LA 1LNQA 1HNIA 2EKYA 2IVYA 2QRRA 4EUVA 2W4CA 3R5CA 4KO0A 3CJ8A 5KFBA 2HK3A 4IOCQ 1SH0A 3LUYA 4ZPAA 4Y6IA 4WU3A 3QLHA 2BXJA 2IYIA 3QLHB 2GQQA 4J9UE 4P2MA 4CM2A 1YITS 4UZCA 4CDIA 4N47A 2HLTA 2VH7A 1LXNA 2QA4S 2RAQA 1RI7A 2AJFE 2Z57B 2M5YA 3R6GB 5HI7A 2QC3A 3ENVA 4WE1A 5DDPC 3IBCB 1KRPA 3ICLA 5IWAJ 1YVFA 2HFVA 5KFUA 2B4PA 5AXLA 1FJEB 2BE7D 4PWWA 2XZWA 4ZOSA 4YR2A 2CVIA 2H4YB 1ZH5A 1RE1B 1TQLA 1FT8A 3LF0A 3M8QB 3MHYA 2QA4G 3OL9A 1VBZA 2BQUA 4KSEB 1SIZA 2FIUA 4DPWA 4B3SF 1H73A 4X62J 4LFBJ 2IDEA 2HEKA 3UD4P 3C3LA 2JLEA 5JJBA 3LP0B 1U1KA 5A2QU 3IO1A 1H72C 3CDEA 3OXGA 5CCMA 4TU7A 1J5EF 2BQRA 4ZVGA 4JI1F 3EICA 2BKNA 2LQBA 1NPPA 4AQYF 3QO9A 5HMYA 3FSIA 1UCNA 3NCQA 2MDAA 1QVGR 4CLFA 2JNJA 1LEOA 1Y5NB 1V3RA 1M0SA 1U24A 4WFZA 4LFAJ 4N8OA 5CABA 3LO3A 3MZIA 4ZDNA 1S6QA 2E5GA 4WKYA 4ANCA 5KFOA 2AQ4A 3ILOA 2ZJQQ 4UF4A 2P9CA 3CJ4A 2BM0A 1JLFB 3HCXA 5E3CA 3S6EA 3PW2A 2C2RA 2BRKA 1YHQS 5FIIA 4MJKA 2YPZA 4A47A 4Q45A 2VOOA 3C16A 2RB7A 4F25A 4XIUA 2C28A 1BWVA 3H5XA 2OUGA 1XK8A 3AB2B 3FBCA 4ED0A 2HPUA 1MU2A 4OZ5A 1PAUB 4DSKA 4DU8A 2FC8A 2GMJA 1NJWA 1FNOA 4F26A 3KHRA 1AZSA 2LQJA 2ASJA 1CEZA 4CLPA 1S79A 4A8XA 4Y2CA 1WG1A 2HS3A 1XMQJ 1SQGA 1HW8A 4KGMA 1OPIA 1XC9A 1S1WB 3QIPA 3A4TA 4LSZB 5HVFA 1K9MT 1WF0A 2W7AA 3BM7A 1X5SA 1AFJA 1U8SA 3KYLA 2MKJA 4JI7J 9RUBA 3W2VB 4F3OA 1IKXA 1C1BA 3OBIA 4OMFG 3AJ2A 5A0YA 3L09A 5HATA 1FJGF 5DGBA 1VC6A 2RQKA 4NCGA 3MOZA 2QE5A 3GSIA 3M2RB 3R8YA 3THTA 5T14A 3C15A 2FLNA 2AYBA 2CPFA 1Z2LA 3IC1A 7FD1A 3BSNA 4W92B 4LMZA 4QQBA 1RHUB 3I5CA 2QFJA 4B3SJ 4IQXA 3O44A 4CIOA 1UVIA 5EN1A 2RILA 2BW7A 1LKZA 3MEDB 2BEFA 4ED6A 3FJ2A 2R2UA 1HYSB 2RHQB 2VFVA 4OZ0A 4ZMMA 5KFQA 3AQOA 1R0AA 4LRBA 3IR5B 3D1QA 5T7LA 2D9PA 3HLUA 2KXFA 1S4FA 3U27A 1HBUA 3CDBA 1HQEA 2A1BA 1UAWA 4DV1F 1A9NB 2P6TA 2VB6A 2UUAF 5KG1A 1LWFB 4KV8A 2ZJPQ 3GG0A 1XNQJ 3MPWA 3NKYA 2E5JA 2HHSA 3D3BJ 3M8WA 2CJ9A 3FC9A 2IDLA 4KO0B 4LVNP 3ETOA 1FXRA 3TQEA 1NK8A 1N33F 1FRLA 3A8JA 1LOUA 1H2VZ 1N5SA 3U1NA 4WFAQ 5AT1B 3NLCA 5K20B 1RYSA 1BQMB 1P27B 3IWLA 4WK1A 4JV5F 1N33J 2KFNA 2UZAA 1KWMA 2HNDB 3KLFB 4PQUA 1HYSA 3FEYB 3RW7A 1U09A 1HQUA 1OY6A 2NUHA 3DGVA 3PJ9A 2BKOA 2J7KA 2QO3A 3M2VA 2GJIA 3QBCA 4L76A 1RKIA 5CHCB 3SDEB 3TX8A 3D7SB 3PV8A 1WC4A 4ZJQA 2DBBA 3DMJA 2RKIB 2J9DE 2PFDA 4J5OA 4YR3A 1K44A 2BJDA 2W8KA 3MMBB 2JHEA 3THPA 5L9NA 5A0YB 2Y1IA 5F8NA 1YLXA 1H74A 4RUCA 5LMUJ 1HPZB 3SFUA 4DSEA 3V4IA 1RKJA 2BJEA 1QAIA 2VKRA 1IR1A 1FRMA 1QM9A 2CDQA 1C0UB 3GSDA 5HVGA 1T9YA 2HWTA 2IAJB 4OZLA 4M5MA 4IYQA 4RW4A 2DXDA 3MTJA 1ZAXA 2AV5A 3MMBA 4WXOA 4CLWA 3BGRA 4ZN1A 1ZTTA 3V81B 3GILA 3KJVA 5KG2A 2ASDA 2NZCA 1ROFA 4DN0A 3SDEA 1EHWA 4IOBA 3BSCA 3PJWA 4QZVB 1R3NA 2QEXS 2JX2A 3MM6B 3CD7A 4F3MA 4DPYA 1FF2A 2EG2A 4ZVPB 3D1OA 1ZBTA 2W2NP 4FYWB 1MROA 5DQIA 4ECTA 4WCEQ 4USHA 2UUBF 2VFSA 5K5MA 3GFHA 4UTGA 2XMKA 4LR8A 4X4RA 4J7CA 5L9XA 1M5KC 2DHSA 3HI9A 4I2QB 3OTOJ 2QL9B 5ETKA 1S97A 1HWLA 3W61A 2VG6A 1HARA 1DQAA 2H9ZA 1PG5B 3R7BB 4C98A 2ZH1A 4HLBA 4J9OA 3W2VA 4MK8A 4H4MA 4NX9A 2XZDB 1JXEA 2K06A 1JQGA 4JI6F 3R5AA 1WF2A 3OV7A 2E5IA 1S57A 4YOEA 1RBLA 2IM0A 1MG7A 5HQ8A 3E2EA 3D66A 4DF4A 4ECUA 1E6VB 4RWXA 3QFWA 5KG3A 2OEMA 4F7VA 3G87A 1WHYA 3R7SB 5L1IA 1AYEA 4JI8J 3BH6B 5JMNA 1G6BA 4L3KA 4NYOA 3H4DA 3MEDA 3T1YJ 2CNNB 1RBOB 5KFAA 3D68A 1HBMB 1KONA 2CFXA 1HBMA 3TZWA 3W64A 1WELA 4M5NA 1S6UA 4C8MA 1RTJA 4IO9Q 5J2QB 1TL5A 2HNYA 1YSJA 2P8IA 3W2WA 5KFDA 1YJNS 1UETA 4ZVEA 4KH0B 2NSCA 1D9FA 1BQMA 2K7KA 3QRRA 2IMWP 2FLLA 1WKJA 1X5PA 3AODA 2JVOA 3PW4A 2BKPA 4ELTA 2I9SA 3DLJA 3TVZA 4DCPB 3VQTA 3AA9A 1MNEA 3R1HA 3I0RB 3PR5B 3HFVA 4I67A 4P10A 2HHWA 4YN3B 5CH7B 5GVQA 2JSXA 1N5QA 3QO9B 5C42A 4ERDA 1S1WA 3LALA 1CC7A 1NSKL 2IJNA 3HHLD 3F44A 3QIPB 4Y2IA 5ETOA 1IBMF 2DNLA 2B4OA 2WB4A 4B3RJ 3PEHA 4DR1J 2OLWA 3BN7A 3H20A 3M4XA 1QAXA 1RAIB 2HRTA 4TNOA 2KG1A 2KB2A 3OR1B 2N3OA 1X4FA 1YRUA 4KHMA 2BJ1A 2YX7A 4XO0A 2UVRA 1I3OB 2CQBA 2MKIA 3PW7A 1CULA 3ULHA 1YJ9S 1VGYA 2IYGA 4U67Q 3MAAB 4LJMA 3QJLA 3FCHA 1QD1A 4E0DA 2NLWA 1MN9A 1FVSA 5DM6Q 3GIIA 4J9RA 2C2MB 4RW6A 4ED2A 4WKRA 1T9TA 2OHDA 3KJVB 2F5GA 4FXVA 5EX3A 3WZ0A 4AFFA 5AJ3F 1HI8A 4PG7A 4NCGB 2C22A 1PSDA 1NKBA 1O51A 1M5OC 2CDRB 1IR0A 2DISA 2HNZA 1SC4B 3PACA 4LVOP 5C25A 1HI0P 3OSPA 1GT8A 4NE9C 2KDOA 4FVCA 4ZP6A 1DRZA 2CPXA 2M4MA 1KQSR 1CS4A 4ICLB 3C46A 2KU7A 3SQGA 2XQCA 4Y34A 2ILZA 5J2MB 3RAQA 1IBKF 2GJ2A 1TUWA 5GAGI 5EUHA 4B9SA 2DNRA 2GGPA 2DJWA 2X1BA 1B0PA 2CZ4A 3CCLS 3OHBA 4P2XA 2A6MA 4M5DA 1U7LA 2V69A 5LJ5Y 4LQ3A 1XIQA 4TU8A 3JSYA 4NWBA 4X62F 3J80Y 3KK1B 4Y65A 1V5IB 4LFBF 4AL6A 1YRXA 1Q78A 4O0IA 2D74B 3KLFA 2XGPA 5E33A 4C0OC 2YWWA 3ZC4A 1Y3KA 3H98A 3MR6A 5DS7A 5BYRA 2DY9A 3I4PA 1W26A 5LM7E 4DR6F 4DV1J 2H5JB 4KYZA 3W63A 5H9EK 4JUZA 5DG8A 1Y00A 4WP8A 5CAAA 2GIFA 4KGKA 2OPSA 2J6UA 2R7VA 2LKZA 3TEHB 3FNNA 3CEDA 5ETRA 3H5SA 1CVJA 3Q8VA 4RW8A 5B7WA 3B54A 4WZQA 3HF5A 4ZPTR 1KR4A 3DOKB 3JAMY 4MH8A 2D3UA 2KJVA 4UOGA 5HL7Q 5MLCV 2QYGA 4FYVB 1XR6A 5D4NA 2Y1RI 3CB4A 3FUYA 3F41A 3H25A 4OI0A 4HACB 1I5OB 3VF0B 3HFZB 3PYFA 2M3DA 4ZHRA 3TARA 2HQIA 1R31A 3HSGA 4UQGA 5DGAA 1RDRA 1KTVA 4NLGA 1V3ZA 2WTFA 3L7PA 3NGDA 2KTQA 2QLXA 3BO3A 1ZTWA 2FPHX 3K5NA 3P4UB 1U1PA 3CMES 4MKBA 3QJPA 4EI2A 1VLYA 1NCLA 3ZO7A 3E01B 3HHLA 2DRAA 3L3CA 4TQSA 3TAQA 5KOWA 1HBNA 3DLHA 1NH7A 4MK7A 3AT1B 2ALZA 4V19X 2LP4A 1NSPA 3CJTA 1VK3A 2X1AA 1Y0HA 1NUEA 3NMRA 3RAMA 1XR5A 4A8SA 5GADU 2WVEA 4H54A 4PYAA 3MR5A 2VASA 2QL7B 2UUTA 2HLUA 2RRNA 2XWYA 3MPVA 1U26A 1UWBA 5DM7Q 1H2TZ 4ZPVR 2YNGA 4ZVFA 3KHHA 3U02A 3TUIC 1TK0A 1WC3A 3NWRA 4C8YA 1ZM2A 3JYTB 1OMSA 1Q53A 3HZEA 2QLJB 5DZ7A 4Q5VA 4ZP8A 4CH1A 4C7QA 1W2BR 3KOAA 1LV5A 4P75A 3DOMB 4I2QA 5HJXA 4YEAA 5B0CA 1FWPA 2BDPA 2WK4A 5ETTA 1KS2A 3K0JA 1T03B 4K50A 4EWTA 2OSQA 1SH3A 1X4DA 2JH3A 3PCOB 4LSLA 4DFMA 1CJKB 3M2UA 3RBDA 1Y5LB 1WC5A 1RA7A 1G3OA 4G1IA 2FD2A 4I69A 2DK2A 1IJEB 5B08A 4OX8A 2X51A 2NCKL 5EHHA 3MEGB 4DFKA 1BY9A 4FBUA 1F2GA 4DG1A 4CLZA 2LEBA 3OL6A 1UVJA 4LF5F 4CWBA 4ECXA 1TELA 4NCAA 4TLRA 4F3QA 2F65A 2NQPA 4DL6A 1RAAB 4ILRA 3GCXP 3PIPQ 3AJ1A 3P45B 2AGQA 4IRCA 2JVRA 2OEKA 2R8HA 4DV3F 2CWXA 3HSJA 4DV2F 1VQMS 5GAEU 4EO6A 3H2LA 1UJ5A 2HFOA 1EJ7L 1Y4ZB 2LQ5A 3H5UA 5IQQA 2YKPA 4ZK7M 2EBGA 2AU0A 1O0PA 1GEHA 2N7CA 3J7Z5 3HX9A 3X3UA 2YQ0A 3SIPB 2VF3A 3K57A 2PT0A 4M95A 2XS2A 5J2PB 4WYWA 3R9LA 2MKSA 3W65A 3TZZA 5DG7A 4Q0BA 5LMUF 2KI2A 2LU1A 3DI6B 2LQ8A 2J7WA 1WHWA 3MM6A 4M5IA 3A8EA 5CZXA 3DRSA 2F9JA 4LIRA 3VGTA 4GC7A 1JLBB 1P1TA 2JL9A 4B3TJ 1SH2A 5HMZA 4BHQA 1VK8A 3G6ES 3TA1A 1DJ0A 4I56A 4JI2F 1I94F 2VD3A 3I5BA 2GZOA 1NH8A 2J8AA 3ZTRA 3ISNC 3MEEB 4QIEA 3OVBA 4ECQA 2J9DA 4DUZF 1QSSA 2BABA 3TW0A 2DR9A 5E0OA 1T9WA 4BDPA 1KKHA 4RW9B 5FJ4A 4C8OA 2HS4A 3QT7A 1A6LA 1NK0A 1NJIT 2GIQA 1KVJA 2HHPA 1U6FA 4LF1A 2IC3A 1WOPA 3AHPA 3D9BA 1U1NA 1PYOB 1S1VA 4K8RA 4ENOA 3LH2S 1D9DA 4O3RA 5F3ZA 2KRBA 1VQKS 1S1XA 4B9VA 1W25A 2VG5A 3HULA 4PXBA 3S1TA 5J1PA 5EWFA 4P9SA 3OTOF 4M94A 2QSFA 4K2JA 2GAHC 4AE5A 4PABA 3KXDA 1KQKA 3D6FB 3IR7B 3T3FA 1SQEA 3H7HB 3JTPA 3SCLE 1S48A 3MM8B 1D1UA 1LWCA 4QIWD 1QE1A 1KHWA 4KBIA 1RT3B 1FWLA 4NA1A 4U7UK 3MFIA 2FJEB 5M2UA 3GPAA 3OT9A 3JAMU 1Q95G 2DYAA 2OPRB 2BA9A 3C8YA 2L41A 4JI6J 4X4OA 2RT3A 4N77A 4ALZA 2ZBPA 5KT6A 2XM3A 3DRRA 1D8YA 4KHPJ 2C2OB 2DGSA 3I5AA 1KLMA 2IBKA 3G9CA 4JYAF 2XYGB 3S01A 3B6BA 4L74A 3W62A 4EFAC 1IM6A 5AE3A 3MR3A 3BSAA 3PG9A 4RX6A 2Y1JA 2O01C 3TAMB 1FE0A 1GX6A 2Q3PA 2POKA 1FRJA 1GH8A 1BQXA 3TWZA 4C0BA 4O3NA 1LW0B 1X31C 1QTNB 2EWHA 3JSBA 4J91A 2AEMA 5KFIA 1S99A 1TVRA 4U95A 5HJYA 3HMJG 4YB1P 4RBVA 4ZIWA 4RKUC 4BLGA 2GO9A 3NXZA 5DETA 5HP1A 2FVRA 2ABYA 4DCJB 3CDAA 2KYXA 3QPIA 2C2NA 1R27B 4DX8H 1HD1A 4KGXB 1N5YA 1TFWA 2CJQA 3QQCD 1YDLA 4DBQA 3IM8A 5A8RB 2NUUG 5IWAF 1FK9A 2DNMA 3DXBA 5ETPA 2XLJA 3PY8A 3K8WA 1VRTB 3CJQA 2MHNA 5BJRA 3KFWX 5IV4A 4Y0FA 1NSQA 3V81A 1EKSA 4KH1B 1M1KT 4CRJA 5C7PA 4UUWA 2RRAA 2YKAA 2JLFA 4NI2A 4U96A 3TAMA 4X4UA 1JNRB 2V8GA 3I32A 4W90B 2Q66A 2PEHA 1R0CB 2UUWA 4DSJA 3PKMA 2QG9B 1F5CA 1UEKA 3HVAA 2H1YA 3MCMA 1WNEA 5JVHQ 1N36J 1RZMA 1YG0A 1X7VA 1CS4B 3BKFA 3LP1B 4ICLA 4KIAA 2RIJA 2R8KA 2GCFA 4EEYA 2AJQA 5U47A 5H9EJ 3C6UA 3MM5A 1RT2B 4J9PA 3TAPA 1GMVA 4DV0F 1GXLA 2HNZB 2RMLA 4XPCA 2ZH3A 3RRKA 2HZVA 1HBNB 2FLOA 2B51A 4I1TA 1WEYA 2K3KA 1LW2A 1QY7A 1NDKA 3KUEA 5A8WA 3IWXA 1VQSA 3CJRA 2DR5A 4A8FA 2ZHBA 3M8PA 3SV4A 1N32J 1U25A 2ZDOA 3MUTP 4ER8A 2AEFA 2GW8A 2CG4A 3HSDA 3I0SB 1S72S 3MUVP 3SI8A 3KLHB 5L1KA 2LA6A 1VBXA 4AL7A 3IS9A 1X4BA 3SSSA 2VIHA 2JEIA 4O4GB 4DDFA 3KWMA 3WIVA 2YH1A 2NXUA 1D09B 1XQIA 4AQYJ 2AKWB 3SMZA 3RBEA 4P2FA 3PHTA 1KD1T 1U1QA 2XI3A 3C66A 3RTVA 2QYCA 4WJBA 4LF8F 2FZCB 1WTFA 2KKHA 5D4LA 3POTA 1HBUB 3ET6B 1MU2B 4F2SA 2DNHA 3W1YC 2OD4A 3Q86A 1XMBA 1VRUA 5HANA 5C24B 3GMGA 1EETA 1UWAA 3M6XA 1TKTB 2BJ7A 3M32B 5B0AA 3EUNA 4Z7CA 5JUMA 3Q8RB 2GVDB 3OUYB 2XO7A 2HVIA 3IG1A 1U1MA 2HWHA 4IG3A 2RJZA 1JLGA 2V4JA 1PBUA 2Y3YA 5T41A 3R27A 4K4VA 3PZPA 2AYGA 5F3TA 5L8RC 1GQEA 2AJ0A 2OFHX 4ED5A 4NLQA 1FXDA 3BR8A 2GNKA 1TP7A 2WVDA 1S9EB 4A8MP 3BGOP 5J1EB 3MM5B 4LF9J 3IWNC 3PRDA 2FJDB 5IOLA 4HKQA 4QYZK 2NSBA 5KFKA 2FZGB 2OH2A 1LFWA 1TKXA 4DX5A 4KFBA 4UZBA 3OL7A 4KFBB 4NCBA 2CQ3A 1QAYA 1SI9A 1VS3A 1GK8A 2R7OA 4QPTA 4XTTA 2AD9A 5LSLA 3HKZD 2CJYB 3LAKA 4USIA 3UI3A 4YS2A 2MZTA 5HQMA 3SYZA 3RRGA 5M2PA 3KJNB 3VR1A 3PIOQ 2MLZA 4F0HA 1XNRF 2MMYA 3MEGA 3CIMA 3CCTA 2CRLA 1FRKA 3MMAA 4LQ9A 1JLAA 4DI6A 3KNAA 2HQFA 2YNHA 3R2CJ 2J0XA 3HHLB 2Z30B 1D0EA 1FK9B 4FXDA 2CUYA 4DV7J 3OQ2A 4C3LA 3GR1A 4ID5B 4LSLB 2G0JA 3VVUA 2Y1LB 2HGLA 4M63A 1K73T 3BPSP 3O2IA 3G82B 3UDVA 4CYUA 4ZVSB 2VHGA 4WP9A 2LXUA 2DNZA 3ILIA 1UA0A 4E98A 3KHLA 3HXMA 3POTB 2R2TA 3M8YA 2EEYA 1DTTA 1ELOA 2B5JA 2J0SD 4KE5A 5AE1A 2YNGB 3ENWA 4K7QA 4DU7A 3MFHA 3CCVS 5I42A 1SC6A 4GC6A 3U7JA 3D5MA 3MD1A 3MECB 1JJCB 2DR6A 2D3ZA 2K7JA 2YQ3A 4AYBD 1WTBA 2OTLS 1GMUA 2VPXB 3KJQB 2V9KA 1W2IA 1U49A 4ZLLA 1M5SA 5LOQA 2PC6A 3ZZZA 1FNXH 1RT1B 3I4HX 3RW6A 3OPKA 3MXHP 4I0WA 3R5GA 3VAMA 1TKZB 2C3UA 1JLEB 3MI7X 1NHVA 4UOCA 2GVZB 3EVMA 1Q8BA 5FD1A 3L95X 4OHZA 2L48A 4P7VA 1LWEA 1RT6B 3EZOA 2XC9A 1SUQA 4G6VB 3V6KA 1ZOTA 2HQDA 1S9FA 3R5JB 1RTIA 2WSFC 1PJ7A 2E66A 1UZHA 4QBUA 3T9NA 1XMQF 2AYMA 4DR4F 4JYAJ 4G65A 2QIFA 2XSFA 1N5VA 1U2CA 2HBRB 2Z58B 2BRLA 3DOLB 1NB7A 2J8SA 2G1HA 3D1HA 4OYAA 4OYXA 3PX6A 2IM1A 2WOMB 4M5HA 1Q8IA 2RF2A 5L39A 3OL8A 4DX7A 1NRKA 2AT1B 2LEAA 3T6BA 4CNZA 1IVZA 2E9TA 1ZZFA 2XY7A 3P6YC 1UVKA 4OV1A 4RW9A 1UPPA 2ROEA 3GG1A 4X65J 1VFJA 2ZE2A 3KMSA 1DTQA 1GXUA 3A3NB 5D0EA 4KR0B 2QA2A 5HMWA 2MSSA 2WW8A 3BB5A 3UPFA 4DV7F 2AX1A 3ZNJ1 4ECSA 3DRYA 1EIYB 3Q8PB 3OLBA 2B7CB 3PO4A 4USKA 3EZUA 4P2SA 3U1MA 1CC8A 1SQFA 3PDNA 1U45A 1KOOA 1SIWB 3BR9A 1FTRA 3CT9A 4TYAA 3UD5A 2UUBJ 3GIRA 3EWGA 1HNXF 4B3OB 4WF9Q 1SKUB 2C3YA 5K8OA 3CE8A 2CJBA 1CSJA 2E1RA 5HP1B 3EXCX 1S76D 5KAKA 1R7IA 2FHMA 1SKSA 4V1Ak 5KFZA 5H1SV 4Q8EA 2DEIA 3TJ9A 3LGHA 2CPEA 3UN3A 1WDTA 1RCXB 4DPOA 4QWEA 4DQRA 2CKWA 3BDPA 2RRBA 2GFFA 5CD4H 4TVAB 3NAHA 2R4FA 3RB4A 2KO1A 3M8SA 1F9FA 2VFUA 3WQPA 2NYIA 1DQ9A 2KJWA 2YWFA 4CTAB 5J1EA 1S0VA 2JEJA 3N6LA 2EFPA 3C6TA 2QTWA 3OFEA 1V3SA 3UNGC 1NLKL 4RBUA 1FX2A 1UKUA 4QWCA 1EARA 3M6VA 1H2UX 5F8LA 2R2SA 4LF4F 2NYHA 1Q8LA 2DXEA 3HHKA 4GKJF 2QT7A 3DRXA 5HLFB 2YKQA 2V2QA 4IDKA 1VQLS 4DR7F 3N6MA 1VRTA 1UJ4A 2CNOB 4WFYA 4NZ0A 2KH9A 3ITHA 4CNYA 2EC0A 3N5FA 2XCPA 1IJFB 4KRWA 4ETZA 3KLIA 3GE9A 3CCMS 3T5HA 2V0NA 3M6UA 4B9LA 1OY9A 1RAFB 1NPKA 5KT3A 4IFYA 5KFCA 4CI0B 4PG6A 4DL7A 1Z4UA 3A3PB 3FDSA 3CULA 2VQFF 4OI3A 3QMQA 2ZH9A 4LBHA 2PGCA 3GTYX 2DGWA 3BSOA 2E1PA 4RNHA 1F1BB 1ZM9A 2F8MA 3ISZA 3HSZA 4HEA9 5CZVA 2DNPA 4K4TA 4CT9A 3A8IA 2I2YA 5CCLA 2B9WA 4H4OA 3PW5A 2P9GA 1X4AA 2EG1A 2KT3A 2DGXA 4RO0A 5E3AA 1RTZA 2IHR1 2LDYA 3EGNA 3LP0A 1RCOB 3ENAA 5EDWA 5JVGQ 1SJ4P 4HDHA 3H2VE 2R8IA 2W24A 4I64A 2GHWA 1HKAA 2VBYA 3DGPB 3V5RA 2MQOA 3FBEA 2V34A 2VZ9A 4OYIA 2HFUA 4DR2J 2AGPA 1R8CA 1NMEB 4FF4A 1AXQA 4EZ6A 4Q0BB 3M9MB 1S9GB 1S9GA 3IR6B 3QAEA 4H4KA 4WFNQ 4PEOA 1OJ4A 2E1AA 1NZAA 2CXEA 3GV8B 4I2PA 3WC2A 2E1CA 2UP1A 3DGPA 1L3VA 2QN6B 2XHWA 4DV4F 2NXCA 4MKVA 3DLBA 3D6HB 2KVQE 4FYYB 3BO4A 2VL1A 4FN5A 4HH0A 1W7WA 5I3PA 4HVZA 2JEGA 5B0EA 1S0OA 2BJ3A 3P96A 4IFVB 3PKYA 3VALA 3FK4A 3J7A1 1T8EA 1UVNA 4ANEA 2V8DA 5I42B 1MWYA 4JI8F 5K8MA 1JMTA 1XN9A 2B56A 2COLA 1IKYB 3QIDA 1QLNA 2AX0A 3W5XA 3DHWC 2R7RA 4DQIA 1N32F 3CDWA 3MWBA 4B17A 2DRDA 2HS0A 3T5JA 3LANA 3SFGA 5KFMA 4K4WA 2A6OA 3PYEA 2MKYA 2FJAB 2AYEA 4USMA 4OYZA 3N28A 3PHEA 4OZJA 4JV5J 1NB2A 5G0RB 2UVUA 1U6ZA 5KG4A 5GADI 2UXBJ 4ED1A 4YP3A 1PKUA 2H65B 1EX8A 4BWMA 3R5BA 5J2PA 2BBEA 4O4RA 3A3OB 4ZCKA 3VVTA 1FHTA 4HT7A 5LXYA 2YNHB 3KDNA 4JOUA 5A6PA 3BZQA 4IDKB 2MKHA 4TQRA 2MKKA 2KXNB 3G6VA 5HLFA 1TL4A 2BQ3A 1JX4A 4JI4J 2G4BA 4XAKA 2V68A 1JIHA 2UU9F 3DU5A 3K5PA 1C2PA 1KOHA 1VOMA 4DV5F 4ZLPA 4EYIB 4DPXA 3CCES 4R8UA 1JB0C 1S6PA 2RF2B 5KG7A 2FJXA 1Q4RA 2YX4A 1QAJA 3UCZP 3G86A 3J7AN 1CJTB 1FKOB 1X60A 1RWKB 2NXNA 2HAIA 4R5PB 5E41A 4F04B 2DIVA 3DOLA 2XYPB 1VC0A 1SPBP 4J90A 4EU0A 1S0NA 1F2HA 1N54B 1B7YB 2ADCA 3OR2A 4M5LA 4NLDA 4DR4J 3BBFA 5IT9U 1SUQB 1WUUA 1RT6A 2B6AB 1CJVB 3MOJB 1UW4A 1KBRA 3QT5A 1U02A 3VAJA 2HIQA 4ECWA 1U2RA 1N5TA 1S49A 3WIUA 4DOZA 4B3OA 2G0IA 4G1QA 1KLNA 5E5NA 5KFLA 3MEKA 1EETB 3IAS9 3R7NB 2UVVA 1SXLA 4ILMA 2W8LA 2U2FA 4ES3A 1RWOB 2DHAA 1PGZA 1KFSA 5LSOA 2PFFB 3AOBA 5D3GB 1U6BA 1D9AA 1ACMB 3GIJA 4CLLA 3TUJC 1RXOB 2CWKA 3VV2B 1XNRJ 4TY9A 3K59A 1RT4A 3DKDA 1HWJA 3Q83A 2C2ZB 4DZ6A 3X1LB 4C6AA 2W1BA 3I9ZA 4JV0A 2EW9A 2C2DA 5E3QA 4C97A 3KUHA 3LWMA 3PFOA 2OPPB 2Z2ZA 4JP8A 1BHNA 3CD0A 1IKWA 1GFWB 4NMLA 4USVA 3HPOA 4PUOB 5D3GA 5T7LB 3FMWA 4N76A 3DXSX 4LIWA 2I1RA 3M6WA 4K4UA 1YBUA 2JC0A 3TEGA 3C16B 3ZFVA 3SZ2A 2XGQA 4DV2J 1KC8T 3EM1A 3C2PA 5B0BA 2YNIB 2FVCA 2VDHA 1FA0A 4FVMA 2WVBA 1VHIA 2IMOA 3LPEA 1LK7A 2AHOB 2QMWA 4K5SA 2W9BA 3ITHB 3RB3A 3HHDA 2ZH4A 3D67A 1Y3JA 2CIMA 1AROP 1RWVB 1FI4A 1WJ9A 2EFNA 3MMAB 3NBPB 3OFFA 4IKAA 4KY3A 3CJ5A 3SSQA 2G2OA 5KFTA 5BXIA 1KSPA 1GAOA 5HROB 1H0HB 1YQHA 2I6WA 1UMJA 2BOAA 5K14B 5IT4A 4QU6A 1DLOB 1LXJA 4YUDA 2M88A 2ROPA 2DH8A 2UV8G 2QX0A 2OPPA 3PRBA 1WF1A 2C1EB 5KFPA 1DURA 3UQSA 2CQCA 4P74A 1TR0A 4PXEA 4W98A 1WOOA 4QPXA 4KGZB 1WSRA 2RVJA 3BDEA 2HMIA 4FNHA 3T5LA 1RAOA 4IRDA 2FJWA 2XLKA 3FFIB 3B82A 1HFEL 4DL4A 3DC2A 1U1OA 1XNQF 5A76A 4JV2A 1O8BA 2W4DA 2HK2A 1KVKA 9ATCB 3J81Y 1RQ0A 1P6TA 3PYGA 2HWIA 1OIAA 1YKWA 2M8HA 2XSJA 3EJMA 2GC8A 4L72B 3KUGA 4NLWA 2D3O1 1FFSB 2DO0A 1T05B 4Y2KA 3QZ8A 1HNZJ 3C19A 4NZ7A 3WX8A 4HYKA 4C3MA 3J7ZT 2IA0A 4PCQA 3CF5Q 1XEZA 4M8LA 3HJFA 4NXMF 1REVA 5H9FJ 1X4CA 2HFNA 4QOTA 2R8GA 5KFRA 2ZH6A 2R9LA 2XS7A 3NRBA 2IFXA 4HHHA 1FFGB 4RNFA 3PFEA 1VQ4S 3T19A 5KT2A 1JNZB 1RWPB 1YZ7A 4LR7A 2GGPB 2LYVA 2XMUA 4B3RF 2DH7A 5IT0A 1SJRA 1JKHA 5DRKA 4ZLJA 3BJYA 3SXLA 2ZBIA 1RWNB 4EBCA 1YJ7A 2HGMA 4OYBA 5KT4A 4C8LA 4JI5J 5CYMB 1RWWB 2R7QA 1VDHA 2JRSA 3G2XA 3CIZA 3DHXA 4KKOB 4NEZA 2HBYB 4P73A 3JSMB 2VQEF 2CQPA 3KK3A 3AA8A 3PX0A 1YJTA 3FEXB 3GYGA 2ZC4A 3HHEA 2M2BA 4MIAA 4NLSA 3MCOA 4NI2B 5KFVA 2IM3A 4MKYA 1Q8KA 1SC3B 3JSRA 4Y2AA 1RTIB 1LFPA 2GMLA 1S59A 2V5HG 1RABB 2MZJA 4U8VA 4ZPWR 3VTIA 5L1JA 1JLCB 2AJ1A 2RKIA 5EGYA 1YBAA 4LF6J 3I56S 1VQ7S 1FKAF 4HT5A 4NXNJ 4DV4J 2YKNA 1T02A 1HBOA 2E7WA 1U1LA 3OUYA 1DARA 2HRUA 4GVLA 3FKBA 3N01A 2FJVA 3EVWA 1SJ3P 5JXSA 4WE1B 1ZAVA 1S12A 1BWEA 2QFIA 3VWSA 1HNXJ 2UUCF 4IH5A 4RNMA 3CDUA 3CJKB 4RNNA 4HACA 3GFXA 3JQKA 3QNWB 4N8NA 3MR7A 1QJHA 1FTCA 2V67A 1Q5VA 5B0DA 1OWXA 2PEBA 2X1FA 2OI2A 2W4PA 3UCGA 2DNNA 2BE2A 4CLYA 3ZZRA 3OW2R 3KG1A 1K47A 2QMXA 4F2RA 4K4ZA 1FEHA 3RB6A 4WFXA 1V9OA 4WIQA 3B8HA 4QR0A 1J5OA 3IBWA 1VQ8S 1Q79A 2QSWA 1PILA 2ZOGA 3BKUA 4R0JA 3M9NB 3G6YA 3CNQP 1OS5A 4FZVA 3CPWR 3UVJA 4DWIA 1X4EA 2QLFB 3H40A 3LP2A 1R0AB 2WAQD 1XMOJ 1VBKA 1AA1B 5HAOA 2FHOB 2LXFA 1YJUA 1HR0F 2HFZA 4NOHA 3UDCA 1RU1A 2P2CB 1FJ7A 1MW7A 5KG0A 2CQ4A 1G7CB 1N0VC 1CLFA 3LWLA 2JFDA 3K8VA 3C6UB 4OX9F 4K4YA 5BYSA 3FZBA 1HNWF 1FD2A 4QWBA 2O5DA 1U0HB 1C0UA 3TANA 3O1LA 3CD6S 1M1GA 1TAQA 4WYLA 1FD8A 4KAIA 4ZS6A 5D0GA 4ES2A 5CA5A 1WORA 4Q43A 1F0XA 3NGSA 4L3NA 4F8RA 4CO2A 3IN5A 5F8JA 1RACB 2IRXA 4CM0A 4C4WA 4QYRA 1SBRA 4QW8A 1CG2A 5J2NB 3AOCA 4HHUA 1N0UA 2DHGA 4DG1B 4DX6A 1QSYA 4IFYB 4I4BA 2J7UA 3CJ2A 2I0XA 3OTEA 2VQEJ 3R2DJ 1R43A 4OI4A 1FDDA 4QIGA 1L3SA 1SV5A 3GFYA 1NAQA 2CQHA 2VPZB 3HJVA 1U4BA 4CP5A 2EI5A 2HNDA 1HNVA 1RLDA 2E29A 2EVZA 4GVBB 1S1UA 1JLFA 2BJ9A 2IIHA 3WDOA 3M30A 4ZVUB 4WK3A 4UQTA 3W8PA 3MM7B 1KDNA 3WX4A 2CQIA 4P71A 4RJVA 2VJVA 2J76E 3QGIA 2DNKA 4RW4B 4B9TA 4O3SA 2MB0B 3ADAC 2ZD1B 1JJ2R 2BZ2A 2ZD1A 1X4HA 3E51A 4OI2A 2C42A 2D41A 1BXNA 3TP2A 3I0RA 3ZZ0A 3QGHA 4F02A 4N5SA 3BQ1A 2UUCJ 3HT0A 3HVTB 3P3DA 4Q2MA 1RHKB 2XMWA 1HQEB 3AD9C 4WXWA 4DV3J 2A3JA 3GR0A 4K5RA 4DR6J 3V6DB 3R97A 1C4AA 8AT1B 2VC0A 2LCWA 4DL5A 2P6SA 1YJRA 2CPIA 1OPZA 2F63A 1YWXA 3QGGA 5IC4B 2HAFA 2XULA 6FDRA 2PA3A 5KFGA 2G2ZA 5GAEI 1RJJA 3E01A 5DLGA 5ETVA 3NS7B 3MM9A 2DGQA 3KLGA 2FLPA 3L4BC 2JLGA 4F4ZA 1T94A 1FRXA 2D7SA 5DDRC 3BPDA 1G1XA 1GMWA 2GJFA 3SCJE 4C8KA 2YWKA 3CO9A 3L7UA 3OLAA 2A2CA 2VONA 3P49B 3AJDA 1HWKA 1SKRA 3JQJA 4F4WA 4OZNA 2R7WA 3NMAA 2PA8D 2J0WA 2WCXA 1HR0J 3JTNA 5ITHA 1YZ6A 3CCQS 2N7YA 3GONA 1SJQA 1URRA 1HHQA 1RT4B 2E7VA 2HVDA 1NKEA 4Q7AA 5EX0A 2XWXA 5A8KA 5IM0B 3MMCB 1VRQC 3FGVA 2OSRA 2BJ8A 2PSZA 4FNIA 2SXLA 4OYOA 2WHOA 4K0KF 2DT9A 2CZVC 2M0GB 2XMAA 2B4UA 3M9OB 1WHXA 2DO4A 3CJ0A 4OZ3A 1RWUA 2QLWA 4FS1A 2W25A 4DHVA 2M52A 4Z2XA 4OL8A 1SJ1A 1IXKA 5LMNJ 2YXLA 1EAYC 2QV6A 4NA3A 5IQ6A 1R6YA 3Q23A 3ILJA 2RQ4A 3OJSA 4YY3F 5LMNF 1UEUA 3UR0A 1RHQB 2GVZA 2ZC3A 2LXIA 2MZQA 1DAXA 3A1YG 4EBDA 2IA6A 2FHJD 5LT5A 4DV6J 2R8JA 1N52B 3GCWP 5D8HB 4WIIA 3IRXA 1JWWA 5LJ3Y 3DLKB 1C1CA 3MPYA 2F4VJ 3TVYA 3R1LA 3D4JA 1L3TA 1WC1A 2ASYA 4NYZA 5DDOC 4Y00A 5MAOA 4QR2A 4OHWA 2VBZA 4MAKA 4ZITA 3NG8A 3US5A 5J2MA 2Y8YA 1MMNA 2WONA 5B0GA 3FEZA 2WONB 1Q7YT 4FYDA 3HZGA 3VAIA 1M5PC 2QGFB 1SC1B 2BM1A 3W9JA 4CO4A 3CCUS 4DSIA 4OV6A 2DIUA 4E2FB 4A8WA 1EQMA 1NXIA 5CXTA 2HHHJ 3CC4S 3TA2A 2RU3A 4ZP9A 5I3UA 4DXLA 3AD8C 3Q2SC 4IG0A 4LRDA 4QR1A 1VBYA 3GIMA 1JK9B 1A0OB 1REVB 2OMOA 3KG0A 3SSRA 1KVIA 1JLQA 5GMEA 2WVFA 5D78A 4ZP7A 1ZA2B 2XBPA 4YB5A 2L3MA 2Z4PA 1O6XA 1RAGB 1JXVA 4NLYA 4O3QA 4UT4A 3FSXA 1H38A 2WBMA 3NY0A 3UN2A 4DFJA 5EWEA 1CULB 1TL1A 4I7FA 2WB1D 3I55S 5BYQA 4ANDA 1S77D 1RT1A 1ZPVA 3NGUA 4ZN3A 3OVAA 4AXIA 1UJ6A 4FDFA 3J7YI 1N34J 2J9EA 3PTWA 1KN6A 4C11B 3LQVA 1SCJB 2RSQA 3H59A 2BYCA 3O6QA 2L9WA 2KL8A 5A2QY 4X66F 3QRPA 1RAHB 2QLBB 2XI2A 3DLLQ 3W5ZA 4F0KA 4X2BA 3H42A 2KXHA 3DFEA 1JKHB 3N0VA 4DL2A 1VIXA 4OX7A 1OQ6A 2DH9A 4O4GA 1UTAA 3GJQB 4KQZA 3DDKA 4KB7A 4TXSA 3AQPA 4YDXA 4BWJA 2IVFB 2IRYA 3R3TA 1I94J 3I0SA 3HVRA 4PQUB 4U7CA 1WWHA 4BBYA 2W01A 4OI6A 3THVA 1N6QA 1C0TB 4JB8B 4L73A 1REGX 1Q1KA 3EX7B 4LF7J 2FB0A 3BBCA 1VQ5S 4QWAA 1JLEA 1RGVA 2CPHA 1TKZA 2DD8S 4NLPA 2KZZA 4IO1A 3JS9A 1N88A 2QL5B 2AZ1A 3NNAA 1TKTA 1YGYA 2W7OA 2OTJS 5M2RA 3KHGA 3AY0A 2L9NA 3FBBA 3Q22A 4RPFA 1M5HA 1M5VC 4F36A 5KFXA 4DR3J 3V6DA 4UY85 4XPEA 2GAGC 4EZ9A 4PR6A 2F4FA 4P52A 2FHKA 5IM0A 1VQOS 4PQAA 4FF1A 1WACA 3AXMA 3I96A 4Y2MA 1S9EA 1J27A 1T9VA 2HZAA 3NOCA 2ZITA 4A8OA 2KG0A 5K9FA 3FMBA 3GYNA 4KT0C 5C25B 2ZVIA 1RWXB 3MR2A 1X9WA 4JI5F 2OPSB 4J9QA 1NZ8A 1S7IA 1URNA 1X0PA 4WTYA 3W60A 4RZRA 4DR5J 2ERRA 2VG7A 4PKDB 2XB2D 2BACA 1XBWA 1RTHB 1Z1ZA 3CC7S 1HNVB 2DY1A 4GVBA 1FJCA 2GO8A 1FEEA 1RBAA 2AGOA 1RTJB 4IQMA 1V5VA 2HHHF 3TZYA 2F8EX 3HFKA 2PN6A 1FRIA 3C14B 4NEYA 4ZVTB 3WC0A 4D3GA 4FKYA 4N56A 4N7TA 1TAUA 4TLQA 5C5JA 3UDLA 2H4WB 2MHEA 4IG0B 4NLRA 3RU0A 1NJZA 2MEWA 3OXLA 1PC5A 3MTKA 1KFDA 4PPZA 2GMHA 4C0HA 1VQ9S 4LF8J 2M7SA 5KFEA 2E9ZA 1F5AA 3T1HF 2EFQA 3NGRA 4WPAA 3HVTA 4ED7A 3B78A 1TKXB 3EMTA 2E7XA 2OFGX 3BS9A 4I6WA 3SBMA 4ID8A 2VU5A 5FLXU 4LF2A 3PVXA 2AJ4A 2G9OA 3PM9A 2IJFA 1ULRA 2V6AA 3T1AA 1PYTA 1QDUB 2VBXA 2IPOB 2BR0A 4DQSA 1WSVA 2V8HA 2MZSA 1VJWA 4DL0C 2ZVSA 1ICEB 1IBLJ 1RT3A 4RBTA 2VJUA 3CGIA 3BN4A 3RG6A 2RE1A 3TO8A 2DEJA 4FBTA 4IR1A 2CNKB 3JTOA 4F0MA 2VDIA 2W9AA 1NDLA 4WZMA 3G8QA 3TQ1A 1SV5B 2HBZB 1NPRA 2H51B 3D6TB 1MN7A 2RS8A 5IFMA 1RT2A 2XG8A 4TYBA 2UXBF 3IGNA 1OSDA 2KVIA 4U8YA 4DPTA 5KT5A 2DCLA 2YKOA 5GMKa 1YJWS 2XY5A 4DLGA 3OFHA 1IM4A 3ZZOA 1K1QA 2V50A 2XCAA 1C4CA 4H4OB 2RQMA 2LECA 5IT9Y 4K0KJ 3VGSA 5I3UB 4X4SA 3OJUA 1NK5A 1YJVA 5HBMB 1R8HA 4IR9A 3ONQA 4WU2A 3DM2A 2UV8A 1XJWB 5C2GA 3Q8SB 1UP1A 2NPIA 1HL6A 2RH3A 4HH1A 4OHVA 1K0TA 3K7RA 3MM7A 1NHKL 1QUVA 5FDLB 5HK4A 3TYTA 3TVKA 4BC9A 3UDEA 1YTYA 3AOAA 4DEZA 4P6QA 1RT5B 4G1QB 5GAHI 4F4AA 4IOAQ 3NL0A 3FCVA 3NGTA 4YQWA 3RR7A 3MGJA 3R5DA 4P7TA 2HQGA 3EXYA 2GHVC 3AXKA 4LFAF 1LWEB 2OGUA 2OELA 3D0IE 3EGVA 2EKNA 1PIEA 2R7TA 1OSCA 2HVHA 1JLCA 3P5BP 4ATNA 1IWAA 1K1SA 1BQNA 4CO5A 5AE2A 3BGLA 2HG4A 5AXKA 3SQGB 4IH6A 3K58A 2JJ4D 5J1NA 3RBXA 5KTQA 3IXQA 5SZTA 1QVFR 4HDGA 4AL5A 2GA7A 2PMWA 8RUCA 2GQCA 2VA3A 1VLOA 3SEOA 2K3IA 1T7PA 2X3GA 1WKLA 4USUA 3OSNA 4B9MA 1UFWA 1PJ6A 2G13A 3GJTB 4X64F 3BBBA 3NP5A 4L6V3 4U6PA 4K4XA 1HHSA 2E44A 1X5OA 2U1AA 2N82B 3EYZA 4G3IA 4RW6B 1FXLA 1R8AA 2KRRA 1P8GA 3SCIE 1HWIA 2RUSA 4LRAA 1QTMA 7AT1B 1AT1B 4A8QA 1B7FA 4ZJOA 2DHHA 3J7YU 4FF3A 3M2VB 2W2QP 4Y28C 1VISA 4OI1A 3TR5A 4DN9A 4ED8A 1I51B 1RHMB 4ZCMA 1UW9A 2A0FB 1AB8A 1GNKA 1GTHA 5BR8J 2J5AA 2MY8A 2O67A 2WW4A 3DRPA 4EGLA 2CZ9A 2I38A 2VODA 2Q6CA 4DQQA 4V19J 1K0VA 2HHXA 2NS1B 5D6GA 2V9WA 1FKPB 4LUBA 2MPUA 3OR1A 1JJHA 2XMMA 3UVJB 1NJYA 1IBLF 5D77A 4FYXB 1AUDA 3K17A 3SCKE 3RGIA 1H6KX 4CH7A 3CUNA 4MFBA 3E8OA 3CVKA 3H4BA 1IUJA 1EP4A 2ZDPA 4UUXA 3A13A 1N36F 4X4PA 5F9NA 3Q24A 1VQPS 1V6HA 3F73A 1VQYA 3GZ7A 1KLMB 2M8DB 3BKTA 2MGZA 4DUYF 4OHYA 2PMHA 2ZKUA 5IS2A 3G96A 4ZPCA 4F50A 3CCJS 2CQ2A 1E6YB 2OPRA 2PMZD 2L08A 1ZYQA 2RDDA 2CPJA 1ZAWA 3QWUA 2LQ9A 3DMJB 4MMOA 3NNCA 3J81U 3NS6A 1NM2A 3QGPA 4IH7A 3K5LA 3RB0A 4LRFA 4X84A 3IRWP 2HW3A 2B8QA 2LDIA 2O66A 4A48A 5AXNA 2RHSB 2J6TA 2CJAA 3CW2C 1VCTA 3LTOA 3RRHA 4DSFA 3OTDA 1RK8A 1H3DA 5KFYA 4IG3B 2HYIB 4UY8T 3IG1B 3C15B 1AUSL 3V6HA 4ITSA 3KK2B 3QT8A 2R7XA 2B4VA 2BX6A 1RB0A 2MQMA 2GIRA 3DLGB 3PR4A 2B7BB 2OP5A 1TUGB 4ZCLA 4WFBQ 2ZH7A 1S6QB 4U9RA 3BQ0A 2N3LA 2ZE2B 3KK3B 1EB0A 3O3LA 4CLKA 3GJRB 2VA2A 4C48A 4BS2A 4FXWA 3UCUP 2ZH2A 2DGTA 3HT3A 4DS4A 2V94A 3AH6A 4HL9A 3MAHA 4PPDA 1HLWA 1J2VA 4UOHA 5DJBA 2ASLA 3HO1A 2YBVA 1WI8A 1DQ8A 2A10A 3AFGA 2ZJRQ 3VZIA 3N79A 2ROGA 5K14A 1NHUA 5THWA 4EBEA 2FVPA 2E5LJ 2LMIA 1RADB 4ES1A 2ZBCA 2E1MC 1BGXT 3GIKA 2FC9A 2DRBA 1YBTA 3RYLA 4X66J 4NXMJ 4GKKF 3Q2TC 1TMJA 1U1RA 4YFUA 2UXCJ 5I4MA 1RAJA 4I6YA 4GKKJ 4NZ6A 3RAXA 2QZ8A 1L5UA 4C8ZA 2HVZA 4QIVA 2NZ4A 1B64A 2XZTB 3C6TB 3N9UC 4LREA 4TKTA 2HQCA 2HBQB 1ZETA 4WTOB 4B08A 5CQGA 1EQ0A 2XYHB 4J9VA 4OFZA 3CTRA 3GU0A 2F3JA 1F9EB 4OYWA 3U1LA 3LGNA 2GV1A 4ECYA 3DCAA 2YNFA 3PX4A 4B3MJ 2WSCC 3Q8UA 1RA6A 1F3FA 4OX6A 5HO4A 1DLOA 4NRTA 5KFSA 3R6LB 3DOKA 1B4SA 3Q89A 1AZSB 5SUHA 3ENQA 3W5YA 6FD1A 5KFJA 3MAQA 3I87A 4MFBB 3VGUA 4J9SA 1S0MA 3GFZA 1JJ4A 1AW0A 4B3TF 3HHNB 3QYYA 3ZTOA 3IFEA 4QW9A 2K2PA 3TJAA 1S5ZA 1FKPA 1WC0A 3QAUA 2W9BB 4DUYJ 3M2UB 3MCNA 4OJ3A 1KQFB 1RTHA 4U7UD 3EPGA 3M32A 2YKMB 1DFDA 2XSJB 1H7WA 3Q0AA 1NK4A 1L3KA 2R42A 3VQSA 3DOMA 1HD0A 4CCHA 2JDJA 3HP6A 3ET6A 1IQTA 4LF4J 1SB6A 1TZ0A 2HSEB 5A8KB 4Q2LA 3JYTA 3F56A 2J6SA 3EPIA 4F4YA 2BANA 3UFCX 1Y10A 4ELUA 2WOMA 4R25A 4YDDB 2DGUA 4RW7B 2ZZMA 1UL3A 3DU6A 5KFHA 3IS9B 1Q0NA 2H54B 3IP0A 2N4DA 4DR7J 4EK2A 4F4KA 2ZNZA 3J80U 2VOPA 5HMXA 1OYDA 2MJNA 3O5TB 3G8SA 2MZ1A 4ELVA 3MPDA 1HBOB 3BGFA 3KTQA 2UXCF 2MQLA 3B4MA 2GQ2A 1TKDA 3NBPA 4QU7A 3S8SA 5J2QA 4YB7A 2OEJA 2DCUB 1JLAB 4DV0J 1MWQA 2YVSA 5HVHA 3BQ2A 4RU9A 1F6TA 4DV5J 3FQKA 2J0QD 4F4XA 3W9HA 3LA0A 3EVOA 1GTEA 2CAJA 2V2KA 2CPZA 3HD2A 3S7RA 3TNVA 4IRKA 4LR9A 3D0HE 5L46A 2LEPA 1IKWB 1IQZA 1I1GA 4S0MA 1TUVA 2IC3B 2HFSA 4RW7A 5F8MA 2JZ5A 1I6JA 2ZZTA 3G4SS 2KFZA 2Z2MA 4CT8A 2VPYB 5KOXA 2LU2A 2B9YA 5HBMA 1Q16B 2D1CA 1WI6A 2YX1A 2BV3A 1MWZA 2IM2A 2VFRA 4URQU 4C11A 3GV5B 1HNIB 1NEEA 2HRYA 2CQ1A 2PO4A 2MTLA 4DCOB 3VAFA 3O8WA 1IWGA 4DUTA 1UA1A 2XEXA 4LBPA 4OZ1A 3KLGB 4KGVB 4FS2A 2VFTA 3MM9B 4QIFA 4B3MF 2MY7A 3IM9A 3UD3P 4I2PB 2DPJA 2MQ8A 1FESA 3CD5A 3KK1A 1VRUB 1N8RT 2UUAJ 1SJFA 1DBDA 3KLIB 4JI3J 5F41A 4NLTA 4C3KA 2NREA 3OR2B 2YH0A 3A12A 1T95A 3FVYA 3KDOA 4O0NA 2X7IA 2JWNA 5ETSA 3HM9A 3NOGA 4ZKAA 1G2EA 5F8IA 4M5GA 2WRMA 1IR2A 2PDAA 4R5PA 2ATCB 1R6VA 2B43A 3OTBA 1RHRB 5DDQC 2EXUA 2Z2LA 3FRZA 4HHJA 2F1FA 5K8NA 2B9EA 1SKWA 3VHQA 2DNYA 3D0GE 1TV6B 5CYJA 1U0HA 2CPDA 1EP4B 2EBEA 3BEGB 3BF4A 4O44B 3DLKA 2CVEA 3DLGA 5CYQB 1UFKA 2VG6B 1RU2A 3V2UC 3TUZC 3DDIA 4NLVA 2FGOA 3CCRS 1XMOF 1U47A 2ACMA 2GS8A 2JOQA 2K1RA 2ZBRA 3EGZA 1IN0A 1FVQA 3H0PA 4ED3A 1T0TV 3MM8A 4JI4F 4LSNB 2FY1A 2CADA 2H3EB 3H90A 5D4PA 1VI7A 4QWDA 3CWJA 1RSCA 1HQUB 2LA4A 3RR8A 3VZHA 1R8PA 4N41A 3QJJA 2AMCB 4ECVA 2VG5B 1SL1A 1N4LA 1HIYA 4USWA 1RT5A 1WDDA 2O1PA 3ZTQA 3GP9A 2PIIA 2ZUGA 1R89A 5ADZA 2EK1A 5DQHA 3KLEB 4DFPA 1QUPA 2OMLA 4A8KA 4JI1J 3TZXA 2LVWA 4CO0A 3GB0A 1P9QC 2ZZNA 3W3SA 5F0UA 3UE2A 2MQPA 1NKCA 1BD6A 2RUGA 1IBMJ 4ZVRB 4YMEA 4DQPA 1SL0A 1QSLA 2C3PA 3M05A 1TL7B 2RD5C 4Y3CA 2NPFA 4YR0A 2CA9A 4PYDA 4CLSA 4A46A 1RYRA 1KP6A 3D2WA 3MF5A 4URSA 2DNQA 2FZKB 3L9ZA 4PXCA 3KLVA 5B0FA 2P9EA 2BOPA 5D4OA 3HK2A 3M30B 4K59A 1BC6A 1L3UA 1ITPA 3OTCA 2AWZA 2Z0GA 3KK2A 2C2EA 3ELHA 3QATA 3FSYA 4OJ1A 1WOSA 3PYDA 3LW5C 4RWWA 4HTJA 1X9SA 3DI6A 1UVMA 1FFWB 2BE9B 2AW0A 1TL3A 4NMXA 4ZPBA 3ZXWA 4DV6F 2I5JA 1A7GE 1FCAA 2YY3A 1HHTP 4LT6A 1TU0B 1Q5YA 4P72A 2XY6A 5BR8F 5GAGU 1RHJB 2FGCA 1UEVA 3IA0A 3OFGA 1FWKA 2AF6A 4WWSA 4CQ1A 5FDLA 1RAEB 2APOA 4O44A 3JXOA 2MJUA 5CYQA 4RUAA 3QT6A 2RS2A 4W4MA 4ZHRB 4G1PA 1CQMA 1Y11A 3HDSA 1IBKJ 1FX4A 5F8HA 5GAHU 4H4MB 4YB6A 3CXCR 1S4EA 1GX5A 3DM2B 4J37A 1FJGJ 2FYXA 3RUBL 5DG9A 2E5HA 2BMBA 5IZHA 5F8GA 1YIJS 5D0HA 2EC2A 4BC7A 1ZM4A 3I9V9 4Z37A 4AUKA 3CCSS 4TU9A 4CLTA 2ZKTA 2MSTA 4ZVOB 3D3CJ 3CO0P 1ZPWX 3RJMB 2KYZA 1MROB 4X65F 1UFLA 3H8YA 2Q79A 3RZAA 4JI2J 2YKMA 2ZBQA 2IY5B 2QA1A 4OYMA 1RT7A 2PE8A 5FLXY 2OKQA 3ZNUA 4DUZJ 5DZ6A 1M90T 1NNDA 3MCSA 3CJSA 4AD6A 2KZMA 1U0SA 2B8PA 1TVRB 2RNEA 4OQJA 4GO7X 2K1RB 4NYPA 4J9MA 5HN0A 1XWLA 3BGRB 3NNHA 3ZTPA 2DB1A 4UOFA 3VAGA 1T11A 2AJ2A 2V2ZA 1LWXA 3TJ8A 3L7OA 2YWEA 4TY8A 1OQ3A 5AXMA 5KT7A 1TV6A 2CQ0A 3D28A 3M1VA 4M5KA 2GHPA 5KG6A 4TN2A 1Y7PA 4CZCA 2HMIB 4OX9J 1KNZA 2M70A 2IVMA 4EMDA 2MXYA 1VJQA 5CYMA 1RP5A 4URGA 2HURA 1N56A 1WC6A 2RU9A 1RWMB 2VC1A 4MYUA 1UPMB 1MMDA 3OHAA 4OYPA 4F67A 4ZLNA 2ACYA 1VR6A 2V8VA 3HKWA 4B02A 4D3HA 4ZCIA 2CPYA 1PC4A 1T9UA 2DGOA 3ETMA 1S1TB 3IRXB 2XMJA 4EO8A 1SL2A 1RTDB 2HIYA 2F40A 3BGUA 3C14A 5K8PA 2WVCA 3ZZPA 2CJXB 3ZZYA 2AEJA 2JEFA 2Y8WA 1X0FA 2ZEJA 2WSEC 1PO6A 2FDNA 4CH0S 1TK8A 4DR5F 1JXLA 2WZ1A 3GQCA 4NXNF 2YWGA 1WG5A 5IXUA 3D54A 5E3PA 1Y9OA 3OVSA 2DTJA 3W66A 4DLEA 2MLXA 1K8AT 1MSWD 2I8EA 2CQDA 2ALYB 2VPWB 2A2DA 3FFIA 4C2MA 3BV8A 2ZFHA 4KV8B 2B9XA 2BE2B 1VQNS 2V8PA 2VQFJ 1TFYA 4Q8FA 4LF6F 2HHVA 4NLUA 4PG8A 1VQ6S 3MEEA 5D0RA 2DGVA 1B0TA 1CJUA 3DYAA 4KHPF 1LK5A 4C8NA 6AT1B 1YK9A 1AFIA 5KG5A 3DRSB 1HI1A 4I68A 3B4DA 4C9DA 2ZOMA 4NLOA 3DN9A 2ZNYA 3KJFB 4KPCA 3UR3C 3J81j 2ATLA 2KM8B 3K2YA 2Q6BA 3M8PB 3LOUA 1PJ5A 3IBFB 5DO2A 1T05A 2F7VA 2ZH5A 1SVDA 1VHFA 4K2XA 3QWPA 3MDFA 1JLGB 2V4JB 2B6AA 4LRCA 3HD1A 3TRGA 4DR2F 2ZWOA 4A8YA 1N6QB 2YTCA 3DLEA 3FQLA 1PCAA 3OXFA 3Q8YA 5ETLA 4FPIA 3V6JA 1F5BA 2W2MP 2MZRA 3CCWA 4PWDA 4M5JA 4NA2A 4DZDA 1TMMA 1RUSA 5C2CA 2KM8C 4ECRA 5E7OB 2DR7A 4PZVA 4CTAA 2FVQA 4OJHA 3P5TL 3KKFA 1CJUB 3EGWB 3AD7C 3VAKA 1PAEX 1YX2A 1B99A 2LFVA 2R3VA 2XMTA 4GKJJ 5LSRA 3OD2A 2HVEA 1B0VA 1FERA 1R8BA 2N4CA 1FO1A 1Q7LB 1YRTA 2B5JB 5E2QA 3UWTA 4H4KC 3T1YF 2OIHA 1D3WA 4JV1A 3PEJA 2FJBB 4RW8B 2O3DA 4DR1F 4LF7F 4ZVHA 3BYRA 3M8QA 4ZJLA 1HNZF 4PG5A 4KPYA 1WEXA 2W9CA 2IJRA 2X3DA 4MT1A 3LPYA 4RLEA 2GX8A 1CQNA 4X4NA 1ZZNA 2KHDA 2VG7B 4ED4A 2DR8A 1LW2B 5GMDA 5C24A 3VGVA 5A8WB 3AAWB 4CO1A 2EK6A 1JLQB 1NK6A 4M1KA 4ZA1A 5HQLA 4OZ2A 5F0WA 4RUHA 2L9DA 5CD4A 4PUOA 4R0EA 4XDDA 3DYAB 1NU4A 2NR0A 1CPZA 1TK5A 4MIWA 4QJVA 2ZM6J 4GMKA 4OLPA 5D15A 5IC6B 4KC5A 3RBZA 2DVIA 1UWBB 2CG8A 2IAJA 1NO8A 2YNFB 2ZOFA 5KFNA 3LP1A 4Q44A 1NJXA 3NAIA 3LGMA 4I6AA 2UVWA 4JBCA 3ILLA 4LBIA 1HNWJ 4NASA 2PD1A 1HPZA 2V2VA 4AT1B 1N48A 4J9LA 4JI3F 2G1DA 5DLFA 1C1CB 2YQ1A 1TL1B 4I7FB 4XDCA 3DLEB 1BQNB 2G0CA 3E3XA 3T9ZA 1UVLA 3KMQA 4BCAA 4X64J 1XERA 4E8UA 5F9LA 4QCLA 2YPYA 3VCDA 3KNGA 2I5JB 2MLYA 5AJ3J 2DKOB 1DZ5A 2KN4A 2E9RX 1BE4A 1M1HA 2GVDA 2QMUB 1S1TA 2XNQA 2AIRB 1RTDA 4LF9F 1ZS6A 3HHLC 3I6PA 2XS5A 2WBRA 7FDRA 4OJGA 1S1XB 2VBWA 4PAAA 4MKAA 4GRSA 5HSPA 2DHXA 1RISA 1WG4A 2HKEA 1OY8A 1VYAA 3MMCA 3AB4B 2MGZB 1N5YB 3NEKA 4JI7F 1IKYA 2BANB 3TUPA 4R8UB 3M1VB 4DMZA 1Y5IB 5C42B 5IV3A 1DY3A 2DITA 3QRQA 4QYZJ 3NS5A 1BMQB 1OYEA 1XTZA 4YHHF 5A6WA 4TY8B 4X4QA 1KEKA 4MK9A 3M8RA 3G8TA 4Z7YA 2FVSA 4FPRA 3T1HJ 4YHHJ 1APSA 2Y0BB 4ZPDA 1S1UB 3UN5A 1R0BG 3W7BA 2HNYB 3W2WB 1Q86T 2W9CB 1MLAA 1BLUA 1HWUA 1NBEB 2H48B 2C3MA 4OHXA 4PWUA 2PI5A 5LXRA 1IBCB 1NSAA 3ZZUA 2XTJP 4PG4A 2XO6A 3UNYA 1TTHB 2FTRA 3MUMP 4ILLA 3PRVA 3M2RA 3JB9k 1E6YA 2X1GA 1FE4A 3G6XA 4X4VA 2HHQA 4NL5A 2JFKA 2R2RA 2V4RA 1PYSB 3I82A 1CJTA 1FKOA 1HA1A 2IBOA 4MIBA 4DL3A 2PI4A 4B9NA 5E3RA 3UO0A 1X8DA 4DR3F 2OAUA 4RU2A 4PRFA 1S6OA 4IFVA 2R7UA 4MTPA 2VUGA 2CQGA 3JSMA 4WBFA 1NK9A 1P9YA 5G4DA 4DF8A 2OPQB 1FRHA 1ZM3A 2JC1A 1WD6A 4YY3J 2FHJA 8ATCB 1NDCA 3FRYA 1KQGB 2ZM6F 1X4GA 4OLOA 1EZZB 2ZH8A 2UU9J 1VIOA 2XNRA 1T9XA 2W2PP 3KLEA 4L75A 4ZVQB 4GO5X 2ZUAA 2MYFA 3QSYB 1TL3B 3SV3A 1JLBA 3ZTSA 2KHCA 3F0NA 3D6MB 1OO0B 3GLJA 5G0RA 1GMWD 1O5JA 3MURP 2HGNA 1S10A 3LP2B 2UXDJ 4O3PA 1WHVA 3HVWA 4O23A 4PXDA 3VAHA 2D9OA 1E6VA 1EKRA 1S1VB 3IAM9 3TOQA 3EDQB 2DNGA 1T3NA 1F3VA 2B0GA 4K4SA 2XLIA 2ADBA 3EZ5A 3T5KA 4HI2A 4FP9A 2DXFA 2C3OA 2FY8A 2MQNA 1DTQB 2FQQB 3CCZA 2YWHA 3N4WA 3KG4A 2Z56B 3MD3A 2ILYA 5LL6d 5KFWA 1Q82T 4JI0J 1WKKA 2XHCA 1YI2S 4RUBA 4LF5J 2MKCA 2W7PA 2B3TB 3T6JA 2CYYA 2ZWPA 3ZZTA 2J9CA 2F4VF 1UZDA 2DNOA 1X5TA 3GYXB 3KLHA 3FZ2A 4O3OA 4JI0F 2RQCA 4KHRA 2E5LF 2KT5A 1VMBA 3DRRB 2CJKA 4CO3A 3GWCA 1IKVA 3DDNA 3K89A 2VKZG 5L38A 3TI0A 4RR5A 2ZHAA 4KTQA 3BREA 3NWGA 1QE1B 1FNMA 4HR2A 1LWCB 4J9NA 1N34F 2HHUA 2HZCA 5H9FK 4IUFA 1HMVA 1HMVB 1P1LA 2HQ3A 3QSIA 3TX0A 2Q43A 3IMQJ 2H5EA 5I3QA 3W9IA 5DQGA 3CMAS 4DSLA 1T3OA 2DPIA 3N5BA 1CJKA 2OO4A 2FUG9 1IKVB 3PW0A 2OJ3A 3JQMA 2BVZA 2OD6A 2OPQA 3PNIA 2P5VA 4ZIVA 2A18A 3EDRB 4OIXA 3IGVA
chains in the Genus database with same CATH topology
3WBZA 3MMJA 2F8HA 4RNOA 2KFYA 3H5YA 1F60B 1Z2ZA 1U48A 4KKOA 2EPIA 2V4QA 2LLZA 3G71S 3GV7B 1LWFA 4NRUA 2RDJA 1MMLA 3QZ7A 3V4MA 2XMVA 3ISND 4ECZA 2IRUA 4FF2A 1S7HA 3TA0A 2HHTA 3K5MA 3CC2S 4UW2A 1RT7B 3LAMA 2AP6A 2EFOA 5A8RA 2UXDF 4NLXA 2RDIA 3DRPB 5KFFA 4DS5A 3K5OA 2BUNA 1KHVA 1Q81T 3UW1A 1U6BA 4ID5A 1XR7A 2EFVA 2YKNB 4LSNA 5L1LA 1FDAA 4XK8C 5J2NA 4A4JA 1GXTA 2F9DA 1LW0A 4M5DB 1J5OB 1WEZA 4J9KA 4ETXA 4USJC 1D8ZA 4DJBA 3BO2A 2D3OR 2ZHOA 4B9UA 2Y0SD 1X9MA 3H2UB 1NK7A 3MECA 2BW2A 2VV5A 4X4TA 3V4IB 4NPOA 1DHMA 1S6PB 1H7XA 2K8GA 3CJKA 1KTQA 2EFGA 1DTTB 3PXGa 3N6NA 3PJXA 1VC5A 4HTIA 4PWDB 2Z8QA 2MQQA 2R7SA 4AXJA 5B09A 1FDNA 1FDBA 2KT2A 3PO5A 3NCRA 3NGKA 3CJ3A 4EYHB 4HI1A 1H98A 1U2FA 3Q8QB 2M9KA 3I31A 1C0TA 3CSKA 3NCPA 5EWGA 4LFCF 2YNIA 1T03A 4MYTA 1LQ9A 4KJIA 3DNCA 1HW9A 1IKXB 1C1BB 2Q1LA 2EKYA 1HNIA 2IVYA 2QRRA 4EUVA 2W4CA 3R5CA 4KO0A 5KFBA 4IOCQ 1SH0A 3LUYA 4ZPAA 4Y6IA 4WU3A 3QLHA 2BXJA 2IYIA 3QLHB 2GQQA 1YITS 4N47A 2HLTA 2VH7A 1LXNA 2QA4S 1RI7A 2AJFE 2M5YA 5HI7A 4WE1A 3ENVA 5DDPC 1KRPA 3ICLA 1YVFA 5KFUA 2B4PA 5AXLA 1FJEB 1ZH5A 2XZWA 4ZOSA 4YR2A 2CVIA 1TQLA 1FT8A 3LF0A 3M8QB 3MHYA 2QA4G 3OL9A 1VBZA 2BQUA 4KSEB 1SIZA 2FIUA 4B3SF 3C3LA 2JLEA 5JJBA 3LP0B 1U1KA 3IO1A 3CDEA 3OXGA 5CCMA 1J5EF 2BQRA 4ZVGA 4JI1F 2LQBA 4AQYF 3QO9A 5HMYA 3FSIA 3NCQA 2MDAA 1QVGR 1Y5NB 1V3RA 1M0SA 1U24A 4WFZA 4N8OA 3LO3A 3MZIA 4ZDNA 1S6QA 2E5GA 4WKYA 5KFOA 2AQ4A 2ZJQQ 2P9CA 3CJ4A 2BM0A 1JLFB 3S6EA 5E3CA 3PW2A 2C2RA 1YHQS 2BRKA 5FIIA 4MJKA 4A47A 4Q45A 2RB7A 4F25A 4XIUA 2C28A 3H5XA 3AB2B 1XK8A 4ED0A 2HPUA 1MU2A 4OZ5A 4DSKA 2FC8A 2GMJA 1NJWA 1FNOA 4F26A 3KHRA 2LQJA 2ASJA 1CEZA 1S79A 4A8XA 4Y2CA 1WG1A 2HS3A 1XC9A 1HW8A 4KGMA 1OPIA 1S1WB 3QIPA 1K9MT 1WF0A 2W7AA 3BM7A 1X5SA 1AFJA 1U8SA 3KYLA 2MKJA 3W2VB 4F3OA 1IKXA 1C1BA 3OBIA 4OMFG 3AJ2A 5A0YA 3L09A 1FJGF 5DGBA 1VC6A 2RQKA 4NCGA 3MOZA 2QE5A 3THTA 3M2RB 5T14A 2FLNA 2AYBA 2CPFA 1Z2LA 3IC1A 7FD1A 3BSNA 4W92B 4LMZA 4QQBA 3I5CA 2QFJA 4IQXA 3O44A 4CIOA 1UVIA 5EN1A 2RILA 1LKZA 3MEDB 4ED6A 3FJ2A 2R2UA 1HYSB 4ZMMA 2VFVA 4OZ0A 1R0AA 5KFQA 3AQOA 3IR5B 3D1QA 5T7LA 2D9PA 3HLUA 2KXFA 1S4FA 3U27A 1HBUA 3CDBA 1HQEA 2A1BA 1UAWA 4DV1F 1A9NB 2P6TA 2VB6A 2UUAF 5KG1A 1LWFB 4KV8A 2ZJPQ 3GG0A 3MPWA 3NKYA 2E5JA 2HHSA 2CJ9A 4KO0B 4LVNP 3ETOA 1FXRA 1NK8A 1N33F 1FRLA 1LOUA 1H2VZ 1N5SA 3U1NA 4WFAQ 3NLCA 1RYSA 1BQMB 1P27B 3IWLA 4WK1A 4JV5F 2KFNA 2UZAA 2HNDB 3KLFB 1HYSA 3FEYB 3RW7A 1U09A 1HQUA 2NUHA 4L3NA 5KFPA 1SKRA 2J7KA 2QO3A 3M2VA 5CHCB 2GJIA 3TX8A 3SDEB 1RKIA 2UU9F 3PV8A 2DBBA 3DMJA 2RKIB 2J9DE 4J5OA 4YR3A 2BJDA 2W8KA 3MMBB 2JHEA 3THPA 5L9NA 5A0YB 2Y1IA 5F8NA 4RUCA 3V4IA 1HPZB 3SFUA 4DSEA 1RKJA 1QAIA 2BJEA 2VKRA 1FRMA 1QM9A 2CDQA 1C0UB 3GSDA 2HWTA 2IAJB 4OZLA 4RW4A 4IYQA 5I3UA 3MTJA 2VOOA 1ZAXA 2AV5A 3MMBA 4WXOA 1ZTTA 3BGRA 2ASDA 1D1UA 3V81B 3GILA 3KJVA 1ROFA 4DN0A 3SDEA 4IOBA 3BSCA 3PJWA 4QZVB 1R3NA 2QEXS 2JX2A 3MM6B 3CD7A 4F3MA 2ZJRQ 1FF2A 2EG2A 2FVPA 3D1OA 1ZBTA 5DQIA 2UUBF 1MROA 4ECTA 4WCEQ 4USHA 2VFSA 5K5MA 3GFHA 4X4RA 2XMKA 5L9XA 1M5KC 2DHSA 3HI9A 4I2QB 1S97A 1HWLA 2VG6A 1HARA 1DQAA 2H9ZA 4C98A 2ZH1A 4HLBA 4J9OA 3W2VA 4MK8A 4H4MA 4NX9A 1JXEA 4JI6F 3R5AA 1WF2A 3OV7A 2E5IA 4YOEA 2IM0A 5HQ8A 3E2EA 4DF4A 4ECUA 1E6VB 4RWXA 5KG3A 1WHYA 5L1IA 1G6BA 3H4DA 4NYOA 3MEDA 5KFAA 1HBMB 1KONA 2CFXA 1HBMA 1WELA 4IO9Q 1S6UA 4C8MA 1RTJA 5J2QB 1TL5A 2HNYA 1YSJA 3W2WA 5KFDA 1YJNS 1UETA 4ZVEA 2NSCA 1D9FA 1BQMA 2K7KA 2IMWP 2FLLA 1X5PA 2JVOA 3PW4A 4ELTA 2I9SA 3DLJA 3TVZA 3R1HA 3VQTA 3AA9A 1MNEA 3I0RB 3PR5B 4I67A 2HHWA 5CH7B 5GVQA 2JSXA 1N5QA 3QO9B 5C42A 4ERDA 1S1WA 3LALA 1CC7A 2IJNA 3HHLD 3QIPB 3F44A 4Y2IA 1IBMF 2DNLA 2B4OA 2WB4A 3PEHA 3BN7A 2OLWA 3H20A 3M4XA 1QAXA 4TNOA 2KG1A 2KB2A 3OR1B 2N3OA 1X4FA 1YRUA 4KHMA 2YX7A 4XO0A 2UVRA 2CQBA 2MKIA 1YJ9S 3ULHA 1VGYA 2IYGA 4U67Q 3QJLA 4LJMA 3FCHA 4E0DA 2NLWA 1FVSA 5DM6Q 3GIIA 4J9RA 4ED2A 4RW6A 4WKRA 3KJVB 4AFFA 4FXVA 5EX3A 3WZ0A 5AJ3F 2C22A 1HI8A 4PG7A 4NCGB 1NKBA 1PSDA 1M5OC 1O51A 4PQUA 1HI0P 1IR0A 2DISA 2HNZA 3PACA 5C25A 4LVOP 3OSPA 1GT8A 2KDOA 4FVCA 4ZP6A 1DRZA 2CPXA 2M4MA 1KQSR 4ICLB 3C46A 2KU7A 3SQGA 3RAQA 4Y34A 2ILZA 5J2MB 1IBKF 2GJ2A 5GAGI 5EUHA 4B9SA 2DNRA 2GGPA 2DJWA 2X1BA 1B0PA 2CZ4A 3CCLS 3OHBA 4M5DA 1U7LA 5LJ5Y 4LQ3A 4TU8A 3JSYA 4NWBA 4X62F 3J80Y 3KK1B 4Y65A 4LFBF 4AL6A 1YRXA 1Q78A 4O0IA 2D74B 3KLFA 2XGPA 5E33A 4C0OC 3ZC4A 1Y3KA 3H98A 3MR6A 5DS7A 5BYRA 4DR6F 3I4PA 4JUZA 5DG8A 1Y00A 2J6UA 2R7VA 4KGKA 2OPSA 2LKZA 3FNNA 3CEDA 1CVJA 3H5SA 4RW8A 5B7WA 4WZQA 3HF5A 4ZPTR 1KR4A 3DOKB 3JAMY 4MH8A 2D3UA 2KJVA 5HL7Q 5MLCV 1XR6A 5D4NA 2Y1RI 3CB4A 4OI0A 3F41A 3H25A 3VF0B 4ZHRA 2M3DA 3TARA 2HQIA 1R31A 4UQGA 5DGAA 1RDRA 1KTVA 4NLGA 1V3ZA 2WTFA 3L7PA 3NGDA 2KTQA 2QLXA 3BO3A 1ZTWA