2MKSA

Nmr structure of the rrm domain of rbmx from homo sapiens
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA-binding motif protein, X chromosome
publication title NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens
rcsb
source organism Homo sapiens
total genus 12
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mksA01
2DHAA 3UCGA 3G8SA 2CJKA 3S8SA 2GO9A 3EGZA 1YIJS 2KVIA 4OZ0A 1URNA 2VODA 2OTJS 1VQ4S 2MB0B 1P27B 2RU3A 2M8DB 1U1LA 3CF5Q 2LEAA 4M5DB 2OSRA 3CCJS 2QEXS 2CPHA 4TU7A 2DHGA 4C7QA 3G96A 3Q2TC 5DM6Q 5JVHQ 1SJFA 1YWXA 2BOPA 2OIHA 2GHPA 2AYBA 2CPXA 2D9PA 3NS6A 1ZH5A 1X5OA 1VQLS 1WG5A 2EK1A 4Y00A 5DDPC 1NJIT 4WIIA 2DO4A 4ZKAA 2HVZA 2HZCA 1VQMS 1KOOA 3CCQS 1QVGR 1K73T 1XN9A 2XSFA 1FT8A 1WHWA 5GAGU 3B4DA 2VOOA 1S79A 3B4MA 5BJRA 2DK2A 4U67Q 2M0GB 2MZSA 3EGNA 3EX7B 2MPUA 5IM0A 4W92B 2CQPA 1JJ2R 2N3OA 5GADU 3IRWP 1X5TA 2QFJA 1VQKS 1X4DA 2KXNB 2KG0A 5IM0B 5LXYA 3J7ZT 3VAHA 3ZZYA 2DGUA 1UW4A 4LIRA 2HYIB 1X4EA 2K3KA 1FJ7A 5DM7Q 4QU7A 2ERRA 3UWTA 4TLQA 1K9MT 2UP1A 2MQQA 4CH0S 3UCUP 2DNNA 4TU9A 3VAFA 2DNHA 2HGLA 2RT3A 1WELA 1M5PC 2ADCA 2DNZA 2MKHA 3NS5A 1WF1A 1UP1A 2JRSA 3U1MA 2DGWA 2X1AA 2MQOA 2LCWA 1U1KA 1X4AA 2CPIA 3G71S 2MQNA 4CIOA 2CQ1A 1WI8A 1JMTA 3MD3A 3THTA 2F3JA 3R1LA 1QM9A 2DGTA 2RS8A 3UE2A 2M8HA 2M7SA 4PKDB 3J7YU 4IOCQ 1DBDA 1VQNS 1M1KT 3TP2A 1U6BA 4WFNQ 2MXYA 2FC8A 3Q2SC 1SJ4P 1WG4A 5GMKa 2YKAA 3IWNC 2RQCA 3MOJB 5DDRC 2DNYA 1U1OA 1H2UX 2MZTA 1WHVA 2CQGA 2DO0A 1L3KA 1YITS 4WF9Q 1DHMA 2Q79A 2CPDA 3S7RA 3I55S 3MDFA 2ADBA 2VONA 1K8AT 2DITA 3S6EA 4F02A 2E5GA 2I2YA 4YB1P 1FJEB 2VOPA 2F9DA 2PEHA 3RW6A 3HHNB 1SJ3P 3H2VE 2CQCA 3CCMS 2F9JA 2LYVA 2LQ5A 2DGVA 2DISA 1YJ9S 1FNXH 3LQVA 1N88A 2MKJA 3MUTP 2MZ1A 1X4GA 3CMAS 3HI9A 3VALA 1YJWS 1KQSR 4A8XA 2B0GA 3MUVP 2LXUA 2MQMA 2CPZA 3CULA 2K8GA 1WG1A 1VC6A 3VAMA 2M4MA 1WI6A 2PE8A 3BEGB 2G1DA 1X5SA 5GVQA 3CPWR 2J8AA 2MMYA 2E44A 1DZ5A 1F9FA 1VBXA 3CMES 3L3CA 2ZJPQ 5D77A 1Q82T 1VQOS 3SMZA 3K0JA 3CC7S 2KXFA 1H2TZ 2M2BA 2ZJQQ 2OTLS 5EN1A 1X4HA 2SXLA 2X1GA 4F25A 1D8ZA 5DDQC 2CQ2A 2XNQA 3BO2A 3MURP 3SXLA 2G4BA 1S72S 3NNHA 2NLWA 1VQ8S 2MJUA 1SJRA 1O0PA 4WFBQ 2DH7A 3CC4S 3PIPQ 3V4MA 3CCVS 3G9CA 1H6KX 1PO6A 3U1LA 2G0CA 5IFMA 3CD6S 2DIUA 2CQHA 2J76E 1UAWA 2DB1A 2LA4A 2L08A 1NU4A 4Y0FA 4PRFA 2YH1A 1IQTA 3CCRS 4W90B 2LA6A 2WBRA 1D9AA 1HD1A 2DGSA 3VAGA 2KRBA 3MUMP 1YI2S 3CUNA 2DHXA 3NNCA 2X1BA 1W2BR 2O3DA 5LSLA 2KN4A 1BY9A 2MHNA 2JVRA 4QU6A 2CQIA 3NMRA 2CQ4A 2DNPA 2MZJA 2MSTA 2MY7A 3I56S 1WWHA 2MJNA 1WHXA 2CPYA 2L9WA 3H2UB 2KU7A 2MSSA 1WEXA 1N52B 2D3OR 4C0OC 2DIVA 2AYMA 1B7FA 2XS7A 3FEXB 1FJCA 2YH0A 2MKIA 2LECA 2U1AA 1KC8T 2E5JA 2FC9A 2KH9A 2MKSA 4IO9Q 1FHTA 1RK8A 3D2WA 1U2FA 2RNEA 3TO8A 3TYTA 2KYXA 1AUDA 2DNOA 3FEYB 2YWKA 1DRZA 4WKRA 2MYFA 2N3LA 1WEYA 2JWNA 3PIOQ 2EK6A 4V19X 1OPIA 4UY8T 1HD0A 2DNLA 5IQQA 3ULHA 2DNMA 1X0FA 2D9OA 2CQ3A 3BO3A 2KFYA 1YHQS 3NNAA 3CTRA 3THPA 2DNGA 2MKKA 1X4FA 4QPTA 3VAIA 2JX2A 4CH1A 2DGQA 2DNQA 4LJMA 2CQDA 2ZJRQ 2MZRA 1U1MA 2RRBA 1WHYA 2DH9A 3UD4P 2E5IA 3ZZZA 5LJ3Y 1WF0A 2A3JA 2HGMA 5DDOC 5HL7Q 4ED5A 1SXLA 4PR6A 2KG1A 4C4WA 5FJ4A 4CQ1A 3P5TL 2LMIA 2DNKA 1U1QA 5DETA 4IUFA 2BZ2A 1HA1A 5ITHA 3BO4A 3G6ES 1Q86T 2CPJA 2CQBA 1PGZA 2J0SD 1VC0A 5H1SV 1OIAA 2J0QD 2AYEA 3LPYA 1VQ9S 1WF2A 2MQPA 2XNRA 1P1TA 2XS5A 1M90T 1A7GE 2N7CA 2XS2A 4IOAQ 2E5HA 1M5VC 4RU2A 2LKZA 1SJQA 1QVFR 1HL6A 1Q81T 1M5KC 3CCLS 2MQLA 1G2EA 1JJHA 2KXHA 4YUDA 1X4CA 2AYGA 2M88A 2KHCA 3R27A 1VQ6S 4J5OA 1KOHA 4Z2XA 1WEZA 2KT5A 5LSOA 2LXIA 4WCEQ 1N8RT 1FO1A 2RRAA 2U2FA 2L41A 1N54B 3S01A 2MY8A 1Q7YT 4UQTA 4TU8A 1U1NA 4ERDA 2DH8A 2I38A 1M5OC 2RQ4A 2QA4S 2KI2A 3SDEA 2FY1A 4WFAQ 5GAEU 2HGNA 2RS2A 2RUGA 3VAJA 3P49B 2V94A 1FXLA 3SDEB 1VQ7S 1VQPS 2CQ0A 4FXVA 1X5PA 1H2VZ 3G8TA 1R8PA 3BS9A 2FPHX 3P6YC 5MLCV 2EVZA 3N9UC 1A9NB 5CYJA 3US5A 3UCZP 2JVOA 3CC2S 3DXBA 2M9KA 2RVJA 3JB9k 2M52A 2CPFA 1VBZA 3CCSS 4P6QA 2AD9A 1U1RA 3VAKA 1UFWA 4LMZA 4FXWA 2KM8C 1CVJA 2MGZA 3UD3P 2MKCA 2MZQA 1R8HA 5LJ5Y 1WTBA 2CPEA 2DNRA 2NZ4A 3P3DA 3G4SS 2XB2D 2MGZB 2N82B 1U6FA 1ZZNA 2X1FA 2LEBA 2OSQA 5CA5A 1JJ4A 1OO0B 1ZZFA 2DHSA 1VBYA 1KD1T 3OW2R 4YOEA 2KM8B 1U1PA 3VF0B 5LXRA 1VC5A 4EGLA 1X4BA 3DLLQ 3CCUS 3MI7X 5JVGQ 1NO8A 3CCES 4BS2A 1YTYA 2M70A 4F26A 2DGXA 2YTCA 1RKJA 1VQ5S 4QQBA 3CXCR 5HO4A 3RW7A 2OJ3A 2KRRA 4OZ1A 5GAHU 3R1HA 1YJNS 2FHOB 5D78A 2DGOA 3MXHP 5CXTA 1OWXA 3MD1A
chains in the Genus database with same CATH superfamily
3G8SA 4ZK7M 2GO9A 4F0KA 4AT1B 1YIJS 2DPJA 1URNA 3KUEA 2VFVA 1BWVA 3R5DA 1JLBB 2K7KA 4M5GA 2OSRA 2DHGA 1RHQB 2N7YA 2ZHOA 2IHR1 1X5OA 2Y1LB 4NA1A 1IR1A 1JLAA 1R0AB 2WB4A 2D3UA 3SSQA 4PABA 2WHOA 1B4SA 3WBZA 3C6TB 4PUOB 2UXCF 2Q1LA 2J6TA 4E98A 4K4YA 1SVDA 1JJ2R 5KG0A 1HPZB 1X5TA 4TY8B 2BJDA 1NKEA 3HVTB 3ICLA 4HTJA 4AUKA 1EZZB 1FXDA 2Y3YA 4EYHB 2HFNA 4Z37A 2ABYA 2K3KA 2UXBJ 1FE4A 1REVB 1Q8IA 3RAMA 2BYCA 2DNZA 1N5VA 1GK8A 3J7YI 2LCWA 2W4DA 2DGTA 3HT3A 3LH2S 3QAUA 1CJVA 2B9XA 1C1BA 2DEJA 1XTZA 3I9ZA 3MOJB 4YHHF 3UW1A 4C8MA 2OUGA 3HF5A 2ZWPA 3WIUA 4DSEA 2ADBA 4MKBA 2F8HA 1YDLA 3PNIA 4UOHA 4FP9A 5I3QA 4K0KJ 4LF6J 2GFFA 2RJZA 1T94A 2LQ5A 1FNMA 3MM8A 3NCQA 4NMLA 1FNOA 2CG4A 1BQNA 1YJWS 2QL5B 7FDRA 4NRUA 5DS7A 1N34J 4ZLPA 4ETXA 2A10A 4R0JA 1X5SA 4XDDA 1UA0A 5L1KA 3K7RA 2CUYA 3LWLA 2YKMA 2DCLA 3EVWA 1WORA 1U02A 3TZXA 3OTCA 4OZ2A 1O6XA 2CFXA 1JK9B 1N32F 2CQ2A 3CJTA 4ZLNA 2ILZA 1PKUA 2XTJP 2EFVA 1TUVA 3QLHA 1P1LA 4OIXA 4P52A 4Q2LA 1RAFB 1T7PA 2R7SA 2D41A 1UAWA 2DB1A 3BGFA 2GX8A 3BGOP 3DDIA 2PFFB 3HVAA 4ID8A 3GSDA 2IC3A 4HDHA 4UTGA 1W2BR 2MHNA 2ZKTA 2CQIA 4KRWA 3H5SA 4I6YA 2HQFA 1FJCA 1SC1B 1V5VA 2YH0A 2OMLA 4L74A 4DR5J 1M1HA 1RZMA 4NEYA 3LOUA 3HHLC 4X62F 3MCOA 3SSSA 2J9DE 1FFSB 1RXOB 4CLSA 3HFKA 2P9GA 3UDLA 4LQ9A 1VIXA 1TL3A 3AJ2A 2KVQE 1KLMA 2VQFJ 2ZH6A 1BQMB 3JAMY 3V4IA 4CH1A 2HHPA 1N5SA 1HBMB 4NL5A 1GTHA 3V81B 2AGQA 1WF0A 3Q89A 1YBUA 4PR6A 1HW9A 4GKKF 2HRYA 1D9FA 1HA1A 2CPJA 1VC0A 4LREA 1PJ5A 3A8JA 3LPYA 5MAOA 1F9HA 5F3ZA 2Y9HA 1XNQF 1Q7LB 3BBCA 1SJQA 2XWXA 3FBFA 3K57A 1X4CA 3R27A 2WSEC 4U9RA 3GWCA 1HNZF 4JI8F 2YPZA 4RW8B 3M8PB 1IKXB 3W65A 5HROA 1JIHA 2G0IA 1TK8A 2W1BA 3SI8A 1NSQA 5L1JA 2VG5B 2IY5B 4AL7A 4F4XA 1S9FA 3KJQB 3H90A 2DRBA 3AY0A 2YVSA 4RPFA 3JSBA 3HHLD 1U1RA 2E1RA 2KM8C 4C2MA 3KFWX 2DNRA 1R3NA 3TOQA 2XULA 1ZM9A 3VF0B 1BGXT 5BR8J 3IGNA 3AJDA 4CO2A 3DLLQ 1YVFA 4NLGA 4LSNB 2L9NA 4F26A 1VQ5S 3MCNA 1XR5A 3N6LA 4KT0C 2I0XA 4QIVA 2HNDA 4DL6A 1LWCB 3RG6A 2BANA 2XMTA 2KVIA 2X7IA 2EC0A 5K14B 2ZBRA 2JZ5A 3FZ2A 2OEKA 2Q43A 1NH7A 3ETMA 1YWXA 2W9AA 1XMBA 4O4GB 1RWNB 2W01A 5AXNA 4F4AA 2GVZB 1RI7A 1IKYA 1DAXA 2YQ1A 1FKOB 1K73T 1LK5A 2CG8A 1KR4A 1TVRA 2DPIA 4F0HA 4U8VA 2BM0A 2UUBF 4DPYA 2P9EA 1N5YB 4ZP7A 5A6WA 1UW4A 3L7OA 3MPDA 5DM7Q 4KO0B 1C4AA 3MFHA 1K9MT 4YQWA 4J37A 1HI8A 4KB7A 3WZ0A 4CYUB 2R8IA 4P2SA 1HNXF 1AFIA 2WK4A 3QWUA 2JRSA 3R7SB 4M94A 4N77A 2IM0A 4X64F 2BE9B 6FD1A 1IBCB 4CIOA 3T3FA 1JMTA 1B0TA 3R1LA 5E2QA 3J7YU 3OBIA 1U6BA 3NGKA 3BM7A 3ZZRA 4FS2A 2RKIA 4C8OA 2DO0A 2CJBA 1PBUA 4IG3A 1FEHA 2I9SA 2I2YA 3IAM9 5M2RA 1FJEB 3ENVA 3HVRA 4NEZA 1SJ3P 1HWIA 3H2VE 1SV5A 1RKIA 8ATCB 2V0NA 2DISA 3QAEA 3VZHA 1WKLA 1RT1A 4RU9A 1EP4B 2GVDA 1EQ0A 4FN5A 1U26A 3OQ2A 1JLCB 3W9JA 2RUSA 5F41A 3WQPA 1S6OA 1FD8A 1MW7A 2M2BA 2AJ1A 3Q8UA 1RT4A 3MURP 2K1RA 3TRGA 2IRXA 1VRTB 2C2MB 4DR1F 4UY85 3KLHB 2XO6A 4P9SA 3L7PA 1VYAA 3H0PA 2J76E 1RSCA 4I6AA 1NU4A 4RW9B 3WHIA 2JLEA 1IQTA 4ED2A 1GMUA 3AOAA 3ZZ0A 2G9OA 1LW0A 3OL8A 2JL9A 3NCRA 2XSJB 4FYYB 3SEOA 4DG1B 3NNCA 2Z2LA 4JI1F 4R5PA 2JVRA 2XMWA 2HHUA 2V2ZA 1WWHA 1UL3A 1B7FA 1JKHA 5KFSA 2JFKA 6AT1B 4DSJA 2RNEA 1WC5A 5HVFA 2YWKA 1FRMA 4URQU 3I0RA 4HYKA 3FMBA 1NM2A 1NJZA 3PYGA 5IWAF 1S57A 4UY8T 1N5TA 5IQQA 1FRIA 2AJQA 2OPRA 4ZHRA 1HW8A 4LQ3A 4DF4A 4OHXA 4EO6A 2B9EA 2I6WA 4QPTA 2JX2A 5LMUJ 3W2VB 5CABA 5D0RA 4WK3A 1NB2A 4K4WA 2W2MP 1HYSB 4OYBA 1S1TB 3HSGA 2LQJA 3MEDA 2OHDA 3OHAA 5ETNA 4NLRA 2Q3PA 1NSPA 3IN5A 2J0SD 4DV1F 2J9CA 2J0QD 1GTEA 1FTCA 2BQUA 2NR0A 1KN6A 2IYIA 2M88A 5L8RC 2G2ZA 2ZKUA 4DI6A 4NA3A 5GAEI 4TU8A 1MROB 3R6LB 4K50A 1NK6A 3OTOJ 1TV6B 1FESA 3GILA 4RWWA 1H38A 3SDEB 1VQ7S 4NPOA 3G8TA 3BS9A 2FPHX 2WRMA 5I3PA 7FD1A 3PW5A 2GGPA 5C25B 3ZZTA 3KK3A 3J81j 3D6HB 4Z7YA 2MGZA 2MKCA 1S6QA 4ZP6A 3A12A 4Q0BB 3TVZA 5K8MA 2HVDA 4ES2A 5HSPA 2R7QA 4BCAA 1U6ZA 2B7BB 3NOCA 2KJVA 1JLGB 4BC9A 3TJ8A 3CJ5A 1NO8A 3SQOP 1CBKA 4OFZA 4DU8A 4ZVTB 1S1WB 4JI7J 4QJVA 1UWAA 1X0PA 2KL8A 3A3NB 3MCMA 4OZ1A 3DRRB 1NPKA 1GXUA 2FYXA 1RACB 4DV6J 5E5NA 2DHAA 2VH7A 3IR6B 3EGZA 1YKWA 2UXBF 2JEGA 3D5MA 2WVFA 4M5DA 2HWTA 3DI6B 3HSZA 3ENQA 3K59A 1SIZA 2GC8A 3G96A 3Q2TC 3RAQA 3RBZA 3N5FA 2XO7A 2WVBA 2B5JA 1CQNA 4MJKA 4AXIA 5KFCA 3F56A 2MDAA 4WK1A 3AD9C 4RR5A 3MPWA 3X1LB 2W9BA 3RBEA 3CCQS 4Y2IA 4RNFA 2AZ3A 1UTAA 5IV3A 1WUUA 1H7XA 1S7IA 4ZP8A 4JI3J 3CIZA 1X4EA 1IVZA 2BE7D 2PC6A 4LF6F 3ZZPA 3KYLA 3VAFA 3DOLB 1BHNA 3T9ZA 2B4PA 3BH7B 1VJQA 5HVHA 4PWDA 2MKHA 4MIAA 2DJWA 3PVXA 2H54B 1YX2A 1N34F 5KFJA 2HBRB 4DZ6A 3BPSP 3ZTSA 4B3SJ 2DNYA 3M2VA 3FGVA 3KK2A 4XPEA 3O2IA 4HDGA 2XMMA 3S7RA 1U0HA 2DT9A 4ZVHA 4CDIA 3PX0A 1AT1B 1K8AT 3M2RB 2PN6A 5JXSA 3TW0A 2IJRA 2QLJB 1JLQB 2RRNA 1KFSA 2YWEA 1X9MA 3CVKA 1J27A 4NI2B 5HMWA 1C0TB 4FNHA 1HNVA 4U6PA 1TKXA 1N48A 4KGKA 1WOOA 1IWAA 2FVPA 2ZDOA 3RRHA 4Q5VA 3ETOA 4NYOA 1LW2B 1F9FA 4KGVB 3GJQB 1WSRA 3H5UA 1ZPWX 4X65J 5F8GA 4DR5F 1H2TZ 1TKTB 4KE5A 3I9V9 1RYSA 5KOXA 4ZVPB 2A2DA 3Q0AA 2W9CA 1LFWA 3PY8A 3CC4S 2OEJA 3DMJB 2XYPB 4ZPAA 1JLEB 2IRYA 4F3QA 2ZDPA 3CD6S 2VQFF 1CULB 2XCPA 4LFBJ 2X51A 2BDPA 1MWYA 2QC3A 3HFVA 2L9DA 3PRDA 4BBYA 2XYHB 1D8YA 1AUSL 4GMKA 4Q7AA 4LBPA 3ILJA 1C1CB 3BSNA 1FHTA 1RK8A 2H3EB 5E0OA 1ZTWA 3NGRA 2V69A 2A6MA 4WKRA 4LRAA 5J2PA 4J9MA 4IFVA 2RF2A 2N3LA 1WEYA 3HHLA 2XMVA 4ZPBA 2HFUA 5KFYA 4ID5A 2FVRA 2FVSA 4OJ3A 3M32B 4KGXB 5HMZA 4WP3A 1URRA 3I31A 3POTB 3IBWA 3OFGA 2VV5A 4NE9C 3BJYA 1DURA 2IBKA 4BDPA 1KTVA 2CNNB 4FVMA 3QJJA 3PJ9A 2LMIA 3JTOA 3QT7A 2AYEA 3V2UC 5B0DA 1ZS6A 4ZPCA 4OYXA 2OPSB 2J6SA 5BR8F 1NRKA 2XG8A 4M5IA 1S0NA 3C15A 1I6JA 5L9NA 1RADB 1N54B 3S01A 3QSYB 3GFYA 2DEIA 1U1NA 4L73A 1L3UA 2C2EA 1SUQB 2ACMA 5GAEU 1UCNA 3QWPA 5KFXA 2ZH2A 2C3YA 3CCTA 4N8NA 2CPFA 2YWHA 1UVIA 1UFWA 3E8OA 4DF8A 3R5CA 3P3DA 4MK9A 2X1FA 4QYRA 2HRUA 2YNHB 1VBYA 2RILA 2J8SA 4QZVB 3A3OB 4EGLA 2DKOB 4USJC 1C0UA 3R2CJ 1DARA 1MNEA 2PMHA 4YB7A 1TP7A 2IMWP 2GMHA 4USKA 3IAS9 3R1HA 1BD6A 1EJ7L 2CZ4A 4LF4J 1JB0C 2VG7B 1RTJB 3DDKA 4ZITA 4M95A 3NBPA 4KH0B 5H9EK 4U7UD 3N79A 2GIQA 4C98A 2M8DB 3GMGA 4KHPJ 2O67A 1IBMJ 3E01A 2XGQA 2NSCA 5DGAA 1Z2ZA 1AYEA 1R8BA 3Q86A 4H4MA 2AYBA 4B17A 3A3PB 5KFQA 2ZC3A 4DJBA 4A8SA 4RBUA 1VQMS 2AHOB 2AGPA 1JLAB 2XSFA 3LA0A 3J80Y 3BYRA 3SCJE 4P72A 1TMJA 5AXLA 3RJMB 2EEYA 4OJHA 3DNCA 1G7CB 3IRXA 4QW8A 3TI0A 2IFXA 2HLTA 3AD7C 4KPCA 3ET6A 2VB6A 3CGIA 2HSEB 2HHHJ 2HS3A 4RNOA 1EETA 3OL7A 3HKWA 5KFVA 3MEKA 1NDLA 1SI9A 4CT8A 4ATNA 2CPIA 2OKQA 1I51B 3IS9A 3MD3A 3RZAA 2IM1A 1N36J 4FVCA 4LT6A 3D66A 1CJVB 2AWZA 4WU2A 3IWNC 4JB8B 1C1BB 3GJTB 4X4PA 5HP1A 2CZVC 3TAPA 1YITS 3F44A 1LEOA 2VONA 1Q53A 3S6EA 2E7XA 2VOPA 3QYYA 3PX4A 3BZQA 2R2RA 2F9DA 2PEHA 5EX3A 1UKUA 3CCMS 3BR8A 1LWFA 2ILYA 4RX6A 4RUBA 3MM8B 3M6VA 2OEMA 1BQNB 5CD4H 4EBEA 3I5AA 2RB7A 1T9VA 2KT2A 3VQTA 3R5BA 1VC6A 2YX1A 4DEZA 1WI6A 2JH3A 3B8HA 1RBAA 4ELTA 2VPYB 5F0UA 2MLZA 4C0HA 1S97A 5ETRA 2YKMB 1RGVA 4YP3A 1RU1A 2O01C 4DFJA 3BO2A 1XC9A 4B3RJ 3DOMA 3ILOA 3QPIA 1VQ8S 2YKPA 3QLHB 4RUAA 5L1LA 4ILRA 4F04B 3NWGA 3H7HB 5E3PA 1B0PA 3D0IE 4Y0FA 4ZVRB 2VD3A 5LMUF 4W90B 2LA6A 5IT0A 4FKYA 5C24A 3MUMP 1RTHA 2VUGA 4LRDA 1D3WA 2IC3B 2MY7A 3ELHA 3DGPA 3I5BA 2B9WA 3NS7B 1Z2LA 4ZN1A 5B7WA 2VKRA 3JSYA 4AL6A 2XWYA 2C22A 1FE0A 3AA8A 1KWMA 1VCTA 1N0UA 4O3OA 1RCXB 1TL3B 2FJAB 4USIA 1KLMB 1QTNB 3M8ZA 3FQLA 5THWA 3V4IB 2UVWA 3UNYA 3V6DA 1Q4RA 2ZNZA 3L7UA 4YR0A 4LF1A 1PYOB 1SXLA 5ETTA 2FJWA 2FDNA 5K20B 2W8KA 1LXNA 1ZETA 2BZ2A 4ZLJA 3IA0A 4A8KA 5KT5A 1PCAA 4MAKA 3G87A 1VQ9S 4F8RA 1NNDA 4YN3B 1Q16B 4A8QA 1CEZA 2IA0A 3OJUA 1A7GE 3AT1B 1ZM4A 2YNIA 1KBRA 2J7UA 1PAUB 5FLXY 2EXUA 2QX0A 3WDOA 4J9SA 3ILIA 1KVIA 3EYZA 1WEZA 2KT5A 3QBCA 2XGPA 4JI7F 1V3ZA 1IM4A 1RA7A 2VBZA 4YB6A 3K17A 1ZAVA 3D6FB 1D09B 3E3XA 2QA4S 4DV6F 2H5JB 5BYQA 2RS2A 2CJQA 4FF4A 4FXVA 5HROB 4IH5A 2OO4A 4OHWA 4Y28C 3MR2A 2OFGX 3NCPA 1R6YA 3W8PA 3MTKA 4KGMA 5F8JA 1H3DA 1U24A 4JP8A 3W7BA 3H25A 3VV2B 1MN9A 5KFDA 3C8YA 1U1PA 4PEOA 3KLFA 4W4MA 3GTYX 4A47A 5JVGQ 2K3IA 1YTYA 2OPQA 3U02A 1TU0B 1TL5A 1OQ6A 5D78A 2ZH3A 3HXMA 4ZDNA 2HNDB 2ZNYA 4C97A 2QG9B 2BANB 1QSLA 5I3UA 1S99A 4DXLA 5DM6Q 1H73A 3V6JA 4Y00A 3IBCB 3MAHA 1NEEA 1U47A 2HQDA 2OI2A 4B3SF 2GAGC 1IKYB 3OD2A 1S79A 4ETZA 1H74A 4Q8EA 4W92B 1TVRB 1FDDA 3WX8A 4K5RA 3J7ZT 1WDDA 4X84A 3EM1A 3MAAA 5CYQA 4ED1A 2ZH5A 3MEEA 1S77D 1ZAXA 4OI4A 4ED7A 3GIRA 4ZVFA 3PHTA 5DGBA 1S6UA 3NS5A 4OYIA 1UW9A 4DPWA 5DLGA 3M8RA 3CJQA 3PEHA 4ED3A 1R0BG 3A8KA 4IOCQ 2K06A 2EBGA 2FC8A 4CO5A 3UNGC 1KVJA 1S76D 2RKIB 4MFBA 5EUHA 1TK5A 3NGTA 4QBUA 3AB4B 5KTQA 4IG3B 3PG9A 3NXZA 5M2UA 2JLGA 2CQCA 2HHWA 2DGVA 4RNMA 2B3TB 1SV5B 4LFBF 4G65A 3MGJA 3CMAS 2DR5A 4A8XA 3BPDA 3UQSA 1WC3A 2K8GA 2D7SA 3VAMA 3ZXWA 3JTPA 1RT1B 5D4PA 4YEAA 3MMCA 2GVDB 2V2QA 2OFHX 3UDEA 2KXFA 2CAJA 4F67A 4C3MA 1LFPA 3KMSA 2AP6A 1R8CA 4PYAA 1RT4B 5HJYA 1ZPVA 2K1RB 3AODA 2F7VA 1H6KX 4RNHA 3UN5A 2DIUA 4OMFG 5F8LA 2QMUB 4NMXA 1J2VA 1SCJB 1CJTA 4K2XA 4YMEA 2KRBA 1K47A 1CSJA 2UUWA 1LW0B 2QN6B 1OMSA 2VJUA 3KHLA 1P9YA 2HZVA 5L9XA 4R5PB 3OXGA 4KC5A 2ACYA 1V3RA 2GW8A 2MSSA 5B0FA 3KK1B 1RTZA 1GMWD 2XS7A 3TA2A 1HR0J 1JKHB 2FTRA 2E7VA 2FLPA 3R8YA 1U2FA 3D2WA 3TYTA 1AUDA 2DNOA 4DSKA 1RDRA 4HH0A 4D3HA 1RWUA 3I0RB 1IJFB 3IM8A 4LF9J 4KPYA 2D9OA 1P6TA 3NNAA 3CTRA 2OPRB 4ZHRB 1TFYA 2VFRA 1RT3A 2AQ4A 5LMNJ 2MZRA 5ETQA 1S0VA 1U1MA 2DH9A 2E5IA 2B4OA 5DDOC 1SL2A 5AXKA 4NLYA 3C14A 2ZBQA 3RTVA 2YPYA 4ECVA 4IUFA 1SKWA 3M7VA 3MEDB 4BLGA 5B09A 4A8OA 1B64A 3D9BA 2UUCJ 2XS5A 3EDRB 2MLXA 1M90T 4JV1A 1AZSA 2E5HA 4IH7A 3OFHA 4O44A 4QYZJ 1QVFR 1G2EA 2AYGA 3K5LA 5IZHA 4USMA 2VDHA 3H5XA 3HJFA 4USTA 3BV8A 4J9QA 2MY8A 1UMJA 4ERDA 4LF4F 1S4EA 3W66A 2ZVSA 3SYZA 1DLOA 4ZIVA 4Y34A 4OX6A 1IBMF 2CIMA 2XLJA 2JVOA 1YZ6A 2GMJA 2GGPB 2JNJA 2E9ZA 2VBYA 4B9VA 2BKPA 4P6QA 3KK3B 4ZVUB 2NZ4A 2XB2D 2MGZB 4EO8A 1ZZNA 1S6QB 4H4KC 2OSQA 1PSDA 5IC4B 1G3OA 4Q43A 2BJ7A 4RKUC 4Y3CA 5D4LA 1JXVA 4QQBA 1PC5A 3BGRA 4ZPTR 3M8QA 4WBFA 5A8RA 2KHDA 3NLCA 2KRRA 4I67A 2J0XA 2CJAA 1YLXA 2V50A 1N0VC 3LAMA 4CO3A 1Q5VA 3HLUA 3TR5A 2OTJS 3RR7A 1VQ4S 2HHHF 2NYIA 2FHJD 2Y1IA 2B56A 2LEAA 3I4PA 4LFAJ 4M5DB 1SJ1A 2QEXS 4TU7A 4C7QA 4ECQA 2W2QP 4NLVA 1CC8A 4GC7A 1QSYA 1T03A 3MPVA 1VQLS 2B5JB 5DDPC 3G2XA 1IR0A 3W5YA 1NJIT 3W9HA 2HHTA 3ZTQA 3IGVA 1RISA 2QE5A 1XN9A 1E6VA 3PRBA 3KDOA 2W9BB 3EPGA 5DLFA 2AJ2A 4U67Q 3EX7B 4G6VB 1F6TA 1WDTA 5GADU 4KYZA 4DL0C 3QFWA 2GHVC 4N76A 1AA1B 2E9RX 1Y3JA 2HRTA 2Z58B 2CVIA 5IOLA 1TAUA 1MMDA 4TLQA 1CJKA 3D0GE 2E1PA 2W7PA 2VICA 2OAUA 2KFNA 4ZIWA 3R5AA 3D67A 1WF1A 4PWDB 2HFVA 3CD7A 3NEKA 3H42A 5IXUA 3THTA 3DRPA 4ZJOA 2CJYB 3DN9A 1NK7A 3R5JB 4RW4A 3TAMA 3M2VB 2PMWA 3W3SA 4W98A 3KK2B 3H4DA 2YKNA 3MEGA 3ISZA 3W8GA 4B3RF 1U0HB 3GIKA 2KT3A 2NREA 5L39A 2LU1A 2GQQA 4QR0A 3A8IA 4MT1A 1EIYB 1YK9A 2RIJA 5BYSA 1VK8A 1OYEA 3HI9A 3W62A 4HH1A 1HMVA 1RA6A 2NYHA 5J2MA 4IOBA 1HNVB 1TKXB 5ETPA 4H4OA 3IMQJ 2EC2A 1NDPA 3HCXA 3ISND 2B9YA 4MH8A 3CPWR 5EWFA 4A8YA 4U95A 3KLGA 4F4WA 4LRFA 4Z7CA 1S10A 2Z2ZA 1WOPA 4JI2J 1HWLA 1RWXB 3TUZC 4NLSA 3LP2A 4X62J 3DLJA 5HMYA 1FFGB 1T02A 5KG1A 4DPUA 2FB0A 1SJRA 2W9CB 3G9CA 1TL4A 1J5OA 3FBEA 2J6UA 4PRFA 2YH1A 4HACA 2BM1A 3GR1A 1SC4B 2X1BA 5HQ8A 1BY9A 4C8KA 8AT1B 2MZJA 2MSTA 3K8WA 4IO1A 1N52B 4C0OC 1OYDA 1B7YB 2MKIA 1H0HB 2KH9A 4A48A 5CAAA 4IO9Q 3HZGA 4DQQA 2HLUA 1F5BA 1S1UA 2XBPA 4KAIA 5J2PB 4LR8A 2LFVA 2QRRA 4IFVB 2RF2B 3LP0A 4NZ0A 5C42A 2HAIA 3HHLB 2FVCA 4DSLA 3ENAA 2KFYA 2BXJA 1RUSA 1WD6A 4ID5B 4C3KA 1H72C 3GPAA 4DX8H 4IR9A 1FDAA 2BVZA 4NA2A 1F1BB 2RAQA 3MMBA 4NYPA 4B02A 5ITHA 2IJNA 3SSRA 4FYXB 4LVOP 3V5RA 1RAEB 1FWLA 3B82A 3QO9A 4IOAQ 2LKZA 2HWIA 1K1QA 1Q81T 4WZQA 4JYAJ 1HIYA 2YBVA 1VQ6S 2OD4A 4FF3A 5J2QA 3C15B 2GHWA 3PKMA 4U7UK 2CNKB 4UQTA 2JEIA 3SIPB 3CJ4A 1M5OC 2O5DA 4DU7A 4CI0B 4PWUA 1PBAA 4YDXA 2R7XA 5MLCV 1YJTA 4KGZB 1QAIA 3DXBA 3TVKA 2KZZA 5HMXA 3HK2A 2H1YA 2FY8A 3EJMA 3PW4A 2IRUA 4DR3J 1ZOTA 3P45B 1RBLA 3O8WA 3QJLA 3AA9A 2KM8B 1UWBA 2DY9A 5DZ6A 1NKBA 1R7IA 1C0UB 3BKTA 2BE2A 1YQHA 3MF5A 2DXEA 2FZGB 3CXCR 3PACA 1XQIA 1U2RA 3VZIA 1O8BA 2DTJA 4CNZA 4L3KA 3NBPB 1FVQA 2RDDA 1R0CB 3UN3A 1BE4A 3E01B 3OTDA 2HHXA 2XM3A 1KHWA 3QRRA 3CJ8A 2E1AA 3NS6A 2E5LF 4H4MB 3IG1A 5LM7E 2GQCA 4CWBA 5A76A 2R8JA 2N4DA 2QMXA 1WC4A 4Y65A 3H20A 1FT8A 1VISA 1OS5A 3CDWA 2IVFB 2ROEA 4LIRA 3WC0A 1EARA 2C28A 3GG0A 3IRXB 1F2HA 3FUYA 4JV0A 4QCLA 3N6MA 3U1NA 3C3LA 3ET6B 5KT4A 3QRQA 1EETB 1PG5B 3G71S 3EXYA 2MQNA 3EGVA 3OXFA 2VQEJ 4U8YA 5ETKA 4DUYJ 1ZM3A 5L1IA 3R5GA 3IS9B 4PKDB 2IMOA 1VQNS 4N5SA 4M5MA 1WHVA 2J5AA 3U7JA 5HP1B 4CLLA 1RHMB 2RHSB 4DR1J 1RHJB 1YJ7A 2FGCA 4K4XA 2ZH9A 1QAYA 1GX6A 4DQRA 2F9JA 4NLDA 3JYTA 1X7VA 1YJ9S 1MSWD 4NLOA 2R7TA 1LWFB 3T1YJ 3GZ7A 3TUPA 3FSXA 4CLPA 2WTFA 3K89A 4EFAC 4DCJB 2CXEA 3KKFA 1WG1A 4NLPA 3BEGB 1S5ZA 2ZE2A 2E44A 5K5MA 3PKYA 1HR0F 2DD8S 5D77A 4NLUA 3AB2B 3G6VA 2SXLA 3HHKA 4J9PA 2VC0A 4P71A 4C8YA 2NLWA 3T5LA 3TZWA 1APSA 3UDCA 3PIPQ 1I1GA 3DOMB 2V9KA 4PG6A 3GG1A 2LA4A 4N56A 2C3MA 4IG0A 5DZ7A 1EKRA 5LMNF 1EB0A 2F65A 1JLFA 3QJPA 5C24B 2XMAA 1G6BA 2VDIA 1RTHB 2CRLA 5A8WA 4H54A 2FQQB 1UVMA 1OSDA 1ROFA 1T9XA 5AJ3J 3DGPB 2E5JA 2FC9A 4ANCA 2YKQA 2UUCF 5I42A 2W25A 1X8DA 4DLEA 3UD5A 2P5VA 1EKSA 3ULHA 2R7RA 2CQ3A 4I1TA 5KFKA 5C5JA 3EE3A 4DQSA 4KTQA 1GEHA 1MN7A 4K4UA 3I96A 3Q8SB 2A3JA 3V6DB 3P5TL 5CYMA 1DTQA 3R7BB 2NUHA 2DHHA 1WJ9A 5J1EA 2B43A 1U45A 4AQYJ 5H1SV 1U49A 5KT6A 3LPEA 3M9NB 4RBTA 4ZJLA 2XS2A 1GNKA 2XY5A 3CCLS 2MQLA 2CKWA 2YNIB 4OX8A 3HSJA 2ASJA 5D15A 2KHCA 4J5OA 1QD1A 2RRAA 4XTTA 3LP1A 1SH3A 4FS1A 2XMKA 3W64A 2R7OA 4TQSA 5M2PA 1MMNA 4PPZA 2ZH4A 2H5EA 2VPZB 1FXLA 4ER8A 2MHEA 1R8PA 3CDBA 4UUXA 2R2SA 4FNIA 2BR0A 2VIHA 3CDUA 4G1QA 1IXKA 4LFAF 4RUCA 2KTQA 4A46A 2M9KA 5CCLA 1VBKA 1T0TV 5CZVA 3PDNA 2FIUA 4I4BA 2KO1A 4NLWA 4K4VA 3UO0A 2V8PA 2N82B 4CP5A 4B3OA 4NCAA 3Q23A 2QL7B 3BBFA 4DX7A 1X9WA 3SV4A 4WWSA 4QR2A 3KLFB 5GAHI 1RJJA 3W60A 4L3NA 3I0SA 3DCAA 1V6HA 3PX6A 1YJNS 3HVWA 3AXKA 2DGOA 4F3OA 4QWEA 5CXTA 3RB4A 4FBUA 2HS0A 3TA0A 1P27B 4TKTA 3SFUA 2WONA 2VF3A 1VIOA 4LF8J 2I8EA 1TQLA 1Q8KA 1S9GB 5E41A 5B0AA 2EFQA 1KOOA 2HVEA 4D3GA 3PO5A 3B4DA 2YWWA 3GLJA 4RNNA 1GT8A 2PI5A 3ZO7A 2WVCA 3NY0A 2V8GA 2D1CA 5KG5A 3L4BC 4F4KA 4CM2A 3MAAB 5CYQB 1PYTA 2JHEA 4ZVQB 1RTDA 4OZJA 3MEEB 4DL7A 1RLCL 3N4WA 2BW7A 2CDQA 2MQOA 4M1KA 7AT1B 4RBVA 2ROGA 2F8EX 3T6BA 1T05A 1QUPA 3T5JA 4LBHA 1T9YA 3Q2SC 2WW8A 1I3OB 4WFYA 3V6HA 4P10A 4F7VA 3CJ0A 2B6AA 4JI2F 2LEPA 5D0EA 1Y4ZB 3I55S 4MFBB 1T9TA 1RHUB 3DLGA 3LO3A 3HDSA 5H9FJ 4BWJA 4CLFA 5IV4A 3LQVA 1LKZA 2H5IB 3WIVA 1YRUA 5HN0A 2AJFE 2B8PA 4NCGA 1XK8A 4X4NA 2WB1D 3PR5B 1C4CA 1A0OB 2MMYA 3MMCB 4JUZA 2JC1A 5C7PA 1SPBP 4PG8A 1QSSA 3K0JA 3CC7S 4K59A 4QPXA 1X4HA 2BEFA 2K2PA 3MM9A 5ADZA 2VU5A 1F5CA 5FDLA 1HNWJ 2YX4A 1SB6A 1RWKB 1UA1A 3DXSX 5DJBA 3NL0A 4RO0A 2R8HA 5D0HA 1WC1A 4O4RA 5LOQA 4X4RA 1R31A 1CJUA 1R89A 2CWKA 2ZOMA 5J2NA 1CJTB 1SIWB 2RDJA 3CO0P 3KLVA 2H65B 1VLOA 1NZAA 2CQ4A 2DNPA 3MECA 4Y2CA 1FKPA 2G0JA 5KFBA 2HHQA 2NCKL 5T7LA 2J7WA 4QR1A 5HAOA 2U1AA 2LECA 2JFDA 3I4HX 3TO8A 3M8WA 1KQFB 2GIRA 4JYAF 4ITSA 1RWWB 2YKOA 2DXDA 3N28A 3UDVA 3C66A 1X4FA 1S0OA 5BXIA 1Y00A 2DGQA 3EVMA 4LJMA 4KBIA 1RT3B 3ZZZA 3J81Y 2HAFA 1AB8A 3OLBA 5DRKA 2Y0SD 1NJYA 3C14B 3D1HA 1U0SA 5CD4A 4ZVEA 1XBWA 4DR3F 4XK8C 1P1TA 2VFUA 2DY1A 4O3SA 5KFNA 2GIFA 4GVBA 1S1XA 1AZSB 3HT0A 4O44B 3J7AN 4IDKA 1VJWA 5F8MA 1X60A 5AE3A 1FO1A 2DRDA 2U2FA 2L41A 3MR3A 2NXUA 2UV8A 3I82A 3QATA 5A8KA 5ETVA 4G1IA 1Q95G 3AJ1A 2H4YB 2NXCA 1DLOB 3P6YC 2EVZA 3JB9k 2M52A 4GKJJ 1GXTA 1HWJA 2GJIA 4LMZA 3UD3P 3R97A 4J9UE 3LF0A 1WTBA 3NGUA 2OMOA 1QAXA 5T14A 5CA5A 1JJ4A 1OO0B 5U47A 3MMJA 5LXRA 1VC5A 4OV6A 1NUEA 1JJCB 4Q45A 4UT4A 2OPPA 4X4QA 5IT9U 1ICEB 4X66J 2ZZNA 3K5MA 2GNKA 2NXNA 5GAHU 3BGRB 3M8QB 5A8RB 1LQ9A 1U25A 1FCAA 4DV3F 2AX1A 4FF2A 3OFEA 3JS9A 4ECRA 3GJSB 3G6XA 1TL1A 2H4WB 1Q8LA 2DR6A 4AFFA 3BSOA 2BQRA 1MWZA 4K4ZA 1IJEB 5HI7A 2VQEF 2KDOA 2ATLA 1WG5A 4JOUA 4DUYF 3Q8YA 1T03B 1WTFA 8RUCA 4WYWA 2HVZA 1ELOA 2HZCA 3HJVA 1E6VB 5HATA 5GMDA 2H48B 1KONA 1VQKS 3C16A 2NS1B 2KG0A 5K8PA 1L3VA 1NCLA 1B99A 4URGA 4NRTA 5IS2A 4URSA 1VS3A 2DGUA 2AGOA 2PO4A 2HIQA 4QU7A 3EMTA 3UWTA 2OGUA 3ITHA 5FD1A 2LQBA 2RT3A 4LFCJ 1CJKB 1WELA 2HIYA 3GCXP 2VZ9A 4YB5A 2R7UA 3T1YF 1UP1A 2KB2A 3K8VA 5KG7A 4HT7A 3HZEA 3Q8VA 2Z2YB 3DRPB 1M1KT 2X3GA 1XIQA 5DDRC 1TUWA 2IVMA 1EHWA 4QWDA 1TL7A 4LSZB 3DHWC 4RW4B 3TAMB 4P73A 2L3MA 3FJ2A 2VFSA 2YX7A 2YKNB 2KZMA 3MEGB 2XY6A 4ICLA 3RW6A 2DXFA 3MAQA 1VRUA 4I2QA 4QW9A 2WVEA 1X4GA 3HM9A 3FFIB 2V63A 4GO7X 4RL1A 1HMVB 4Y2MA 3KHRA 4JI4J 5J2MB 2M4MA 2J0WA 4H4OB 2QIFA 2IJFA 1LK7A 1RT2A 3ENWA 4HL9A 2PA3A 1FRLA 2Q6CA 1DZ5A 5AJ3F 3CMES 4L75A 1DQ9A 3KLGB 5EN1A 5KOWA 2CADA 1BWEA 3T6JA 3VQSA 3NNHA 1HHQA 2EKNA 3EZUA 5KFOA 3SV3A 3LP2B 1L3TA 1KTQA 2PD1A 3I6PA 3DRSA 1DQAA 3E51A 4X2BA 1SQFA 1VQSA 1J5OB 3D1OA 3HFZB 4EYIB 4N8OA 2FZKB 4CLUA 2DGSA 4AXJA 4HACB 1OY9A 3KLEA 3CUNA 1QAJA 2QA4G 4OZ5A 3CDAA 1YSJA 4EMDA 4NZ7A 2CPYA 2ZM6J 2KU7A 4ECTA 2FD2A 2GJ2A 4HHUA 4AQYF 1PC4A 1RTIA 1BLUA 3DC2A 1RABB 4I64A 2HBQB 3I5CA 4WXOA 1NAQA 5D4OA 2HW3A 1Z1ZA 1RHKB 4ECXA 4LR7A 5DG8A 1IR2A 1NLKL 5KFIA 1S1UB 2Z8QA 4C11A 3OPKA 4ZMMA 1VK3A 3LP0B 5C42B 3BQ2A 2V67A 2RH3A 3THPA 2W2NP 4YY3J 3VAIA 4OX7A 3CE8A 4DFMA 5LJ3Y 4CQ1A 1UVKA 2J9EA 1VDHA 3GV5B 3MMBB 4OYWA 1Y0HA 2CQBA 1FJGF 2ZBPA 2XNRA 1RAAB 1YJUA 2R2UA 2XMUA 5FLXU 1N4LA 1H7WA 4K2JA 1U4BA 5KFZA 3QO9B 3OSPA 2NXEA 4HVZA 4OZLA 2G2YA 4Z2XA 3CJ2A 1FRKA 5J2QB 1SQEA 4JV5J 1BXNA 2I1RA 2F4FA 2JDJA 1HNIA 2CNLB 2XZWA 2D3ZA 4QOTA 1L5UA 4HKQA 4WE1A 3OR1A 3GFHA 1R6VA 1QE1B 3GE9A 1EX8A 4UF4A 4LF8F 2HBZB 1JX4A 4DV7J 2MZQA 3Q8QB 4E0DA 5G0RA 3G4SS 1U6FA 4KKOA 3FZBA 3DLKA 3BKUA 4LIWA 2DR8A 4DR4F 1K0VA 3HD2A 1UWBB 4PWWA 1BQXA 5A0YA 1M1GA 2HFOA 4QYZK 1JNZB 1F0XA 2Z57B 4DWIA 4EWTA 1NZ8A 3MD1A 4JI6J 1YJRA 2CJKA 1KDNA 4DCPB 5IQ6A 4PCQA 1U1LA 1XMQJ 2ATCB 3CF5Q 1WKKA 3FC9A 4DDFA 4PPDA 1RWMB 5D4NA 3R7NB 2UVUA 1HWKA 3A8EA 3ZTRA 4C8LA 4UOCA 4DCOB 3IG1B 1QVGR 2AKWB 1WHWA 5F8HA 3TX0A 5BJRA 4ZLLA 1YRXA 3CCWA 5IM0A 2IBOA 3CSKA 2QFJA 4IQMA 3OVSA 2D3O1 3BSCA 4M5KA 2RHQB 2GJFA 3LALA 1LWEA 1FJ7A 4DFPA 2P9CA 1TUGB 2V2KA 3MCSA 2BRLA 3FBCA 2ADCA 5CHCB 2HQ3A 2DGWA 2YXLA 5KFFA 2E9TA 4GVLA 2BABA 4N47A 3DM2A 1ZBTA 3Q8RB 2V68A 3DU5A 2JC0A 1V9OA 4CO1A 2V34A 4WTYA 3KJVA 1L3KA 1ZA1B 4I68A 3MDFA 3VVTA 2DITA 1HNWF 2E5GA 4GC6A 1TKDA 4C48A 4DV5J 3B78A 1S7HA 4OI2A 4DSIA 3JYTB 1RU2A 2MZ1A 2CPZA 3R2DJ 1B3TA 3FDSA 4FDFA 2GA7A 3MM7A 4DV0J 2J8AA 4OLOA 1WC6A 2RDIA 2ZE2B 3SQGA 3BREA 2C2ZB 3BQ0A 3CJSA 1XWLA 3K2YA 3FCWA 2ASYA 5JUMA 3UI3A 4LBIA 2XNQA 1S12A 2V6AA 1JNRB 5IT4A 4Q2MA 2MJUA 4RZRA 3JQKA 1GX5A 4ED4A 3OT9A 4RLEA 4KFBA 5IFMA 3O44A 2AF6A 4QIFA 3FCHA 1N6QA 3MOZA 2B8QA 2F63A 4R25A 2XZDB 4IG0B 1TTHB 4DQPA 2HFSA 3RGIA 1VHIA 4DZDA 1JLFB 5J1PA 2O3DA 3NMRA 2E7WA 4LRCA 3H2UB 5A8WB 4DX5A 3DRYA 3LWMA 4S0MA 3MR5A 1KQKA 4F2SA 3KXDA 3NRBA 1F2GA 4QIEA 2HKEA 5I42B 3RBDA 2XEXA 5HBMA 1FRXA 3N01A 1OPIA 2RE1A 3QZ8A 5EWGA 4WYLA 1X0FA 4OYMA 3MMAA 3KMQA 4OLPA 2X3DA 1ACMB 2WVDA 4F4YA 2RRBA 4ILMA 1SKUB 3BSAA 3TVYA 2HGMA 3TEHB 1S9EA 1SL1A 2OD6A 2AEJA 2KG1A 5ETLA 4NASA 2JLFA 1FDBA 3CT9A 5CYMB 1DTQB 4DBQA 2UUTA 4GKJF 1PGZA 3W5XA 4YR3A 2Z30B 5J1EB 3M1VA 1OIAA 3DRXA 2B4UA 2IDLA 1B70B 3ZNUA 2NPFA 2NUUG 2Q66A 3K5OA 1HBUA 4LF5J 4DFKA 3LANA 3FK4A 3QT5A 1H98A 3CW2C 4I56A 2EG1A 2XHWA 1NK0A 4X66F 1WOSA 2DH8A 3LP1B 4ZVSB 2KI2A 4KQZA 1VFJA 4WFAQ 3MPUB 5RUBA 2FHKA 3OFFA 1A9NB 4IR1A 2R7VA 4NLQA 3GP9A 1NB7A 4G1QB 1Y7PA 4NOHA 2AD9A 5G4DA 3VAKA 4DV4J 2HEKA 4QWAA 3QIDA 3ONQA 2A0FB 3J7A1 1GXLA 3L95X 4B3OB 2XMJA 1F60B 2CDRB 3MI7X 3M6XA 2Y8YA 1Q1KA 4ES1A 2V4JA 3ZZUA 5E33A 4DMZA 4WP9A 3V6KA 3I0SB 3D0HE 5I4MA 4R8UA 2HURA 4DN9A 4KH1B 4LFCF 3RYLA 4ECSA 3P8BB 4AE5A 4X4VA 2WONB 2CPXA 2AMCB 3GIMA 2HFZA 2C2OB 1HQEA 3DKDA 4O3QA 1S6PA 2HK3A 3QMQA 5KFPA 2VOOA 2I5JA 2R7WA 3B4MA 1M5HA 2DK2A 5CQGA 1UEKA 4DS5A 3CJKA 3MM6A 4ZPWR 2A2CA 3IRWP 4ZVGA 3N6NA 2QO3A 4WPAA 3QIPA 3VWSA 3IBFB 2ZH1A 1HQUA 1CC7A 2ZZTA 3DGVA 4OI0A 2AX0A 3EICA 4EZ9A 1RTDB 2FGOA 5B0BA 4C9DA 4MK7A 1PIEA 3MHYA 2IAJA 1U1KA 2QSWA 3TJ9A 1X4AA 2K7JA 3DOKA 4JI4F 1QM9A 3BGLA 4WFXA 2M8HA 1T05B 3O6QA 5E3AA 2MQ8A 2MZTA 2CQGA 4NXMF 3BBBA 4X4UA 5A2QU 2ZUGA 4WF9Q 3TQ1A 3RR8A 2B6AB 3H59A 5L38A 1U7LA 3BR9A 4NZ6A 3L09A 1SKSA 4P2XA 3DLGB 3GV8B 3HHNB 2NPIA 3UVJA 3JSRA 4HT5A 4Y6IA 3T1AA 1N88A 3OR2A 2QYGA 5EWEA 4ENOA 2MQMA 1IKVA 4LUBA 2H9ZA 4NCGB 2VA2A 4B3MJ 3GONA 1IM6A 5KG4A 3KHGA 3BN4A 3U27A 1TMMA 1IWGA 2ZM6F 5DG7A 3NOGA 3PJXA 3KUHA 4G3IA 2APOA 2V2VA 3L3CA 2O1PA 3GIIA 3W2WA 1D8ZA 3BN7A 2RQKA 4TNOA 3MM9B 1O0PA 5FDLB 3V4MA 1PO6A 4V19J 3D7SB 2CNOB 3VGSA 3T41A 3DYAA 4JI5J 4YY3F 3CCRS 3AD8C 2WBRA 3TANA 1RAGB 3VAGA 1LOUA 1UZHA 1CJUB 5HLFA 5J2NB 4DR7J 5LSLA 3IR5B 3GJRB 1DJ0A 3MECB 4CRJA 1FKPB 4DPOA 5HANA 3TNVA 5T7LB 1KC8T 2YY3A 1UETA 4PQAA 4MKYA 2BA9A 1U2CA 3PIOQ 2EK6A 1UPMB 4CLYA 3ZFVA 4J9KA 1D9DA 1R43A 3TA1A 3J7Z5 4ALZA 5HJXA 1FD2A 2HS4A 5LT5A 1O51A 4B3TJ 4JV5F 4EBCA 4OHZA 1SKRA 5B0GA 3FSYA 4OHVA 3BDPA 4I2PA 2UVVA 5DG9A 6FDRA 4WZMA 3OLAA 2HVIA 3HMJG 5E7OB 5DETA 4MK8A 3KG0A 1Q86T 2VBWA 2AJ0A 3TX8A 4J9NA 1W2IA 4DV7F 2WBMA 3M30A 4OYOA 2IPOB 3UR0A 4J7CA 3NGSA 1QLNA 3I32A 1E6YA 1IQZA 4RU2A 4RJVA 1U8WA 2PGCA 4GVBB 3AQPA 1S1XB 2OLWA 2AEMA 2NZCA 4IDKB 4C6AA 4P2MA 4CLTA 1FEEA 2I38A 4OV1A 2RQ4A 2YNFA 4NXNJ 2FY1A 2JJ4D 2HGNA 4R0EA 3H40A 4JI6F 2V94A 5A8KB 1AROP 2CQ0A 1F5AA 1HKAA 1RAHB 1XMQF 2JEJA 2HNZA 3US5A 3KK1A 3T9NA 3OTEA 4WJBA 1XNRF 3VHQA 2WOMA 3OHBA 1R8HA 2E5LJ 2HG4A 2D74B 3JTNA 4O3NA 1S4FA 3K58A 2B7CB 4OHYA 1IKWA 1X4BA 3Q8PB 3CCUS 1RT7A 2GZOA 3CCES 4MIWA 2DR9A 5KFHA 1RAJA 4UZCA 2OPPB 4E2FB 1NK8A 5HO4A 1KNZA 2FJVA 3PO4A 1VOMA 4B9NA 3MPYA 4RUHA 1XR6A 1KVKA 4CLWA 2MB0B 1U48A 1FERA 3T5HA 2W24A 2ASDA 1DTTA 4Q44A 1HQ2A 4B9TA 3MM5A 1TL1B 2PMZD 4DS4A 2EK1A 2HNYA 1TK0A 1K0TA 4TY9A 3SBMA 4OI3A 2RMLA 1XERA 3K5PA 2GQ2A 5KFTA 4CTAA 2MTLA 2R3VA 2Z0GA 2UXDJ 4DR2J 3W61A 3SCKE 3CEDA 1PYSB 3TEGA 2MZSA 3EGNA 2MPUA 2WW4A 2W2PP 4OJ1A 2KXNB 1NMEB 1HLWA 1CQMA 3C16B 3T19A 4F4ZA 2XQCA 1X31C 4DV5F 4CH0S 5K9FA 1Y5IB 1OJ4A 3D68A 3ITHB 1JXEA 1TKZA 4M5LA 2RU9A 1NSAA 4OX9J 2DYAA 3IWLA 2F3JA 2FJDB 4RW7A 2RS8A 4ILLA 1RWOB 4DV0F 2MXYA 2C2DA 5GMKa 4TLRA 1FRHA 1U1OA 3EPIA 2NQPA 2AV5A 2AJ4A 4PXEA 4FPIA 1TL7B 3CWJA 2CJXB 5F3TA 1LV5A 4X4TA 1UFLA 2IM2A 3PEJA 1GQEA 3KLIA 3B54A 2LYVA 4ICLB 4L72B 3NP5A 5F8NA 4BC7A 3GR0A 1RT6A 1VRUB 3HHDA 2QJ3A 3TZZA 4I2QB 2QFIA 3DLEA 4BHQA 5B0EA 5FIIA 2DRAA 1Q79A 2IIHA 3CULA 1IBLJ 5KT3A 3PV8A 1UFKA 3EUNA 1W25A 4JBCA 1TFWA 1UJ4A 1Y5NB 3AXMA 1RT2B 3PW2A 3IC1A 1NK4A 4YS2A 4L6V3 1RBOB 2G4BA 3SFGA 2FLOA 3BGUA 4DR6J 3NKYA 2IVYA 2WAQD 3G82A 2DH7A 5CH7B 3W1YC 5K8NA 4K0KF 2LDIA 3CCVS 4CLZA 1KEKA 2AIRB 3DRSB 4FXDA 4FZVA 3KTQA 1D9AA 1HHTP 2BQ3A 5F9NA 5H9FK 2F4VJ 1Q0NA 2ZVIA 1TELA 3KLEB 2KN4A 2KJWA 4QU6A 3I56S 2NSBA 1WHXA 3PHEA 3VGTA 2MEWA 4IQXA 4M5HA 3BYPA 2MKSA 2KYXA 1RTIB 1AFJA 2Y8WA 2VASA 4B08A 1DRZA 4PQUA 2B4VA 5HQMA 4LF5F 2MYFA 4WP8A 1J5EJ 5DQIA 3VR1A 4I6WA 1HBOA 2DNMA 1UPPA 4C11B 3H98A 3O5TB 2DNGA 3K5NA 2ZFHA 2VFTA 2HZAA 5C2GA 1VQYA 1KSPA 1T9WA 4C8ZA 1MMLA 1RT5A 3M2UA 2ZWOA 3HPOA 4K7QA 1R8AA 4O23A 1NJWA 4DV4F 3M6UA 1RYRA 2W2OP 4XDCA 3AH6A 3PW7A 2HMIA 5KFRA 1HL6A 4HEA9 1JJHA 2KXHA 3BH6B 3JSMA 1NSKL 2YNGA 3ISNC 2BJEA 4WCEQ 3KNGA 4OYPA 3OUYA 1HI0P 3IO1A 2R42A 1LXJA 4DX6A 4OYAA 2QLBB 1HNIB 3N9UC 3TUIC 3L9ZA 3UCZP 3MFIA 2KFZA 4WE1B 2RVJA 3OR1B 1KP6A 2F8MA 4OI6A 1T11A 4FXWA 1CVJA 2CPEA 2CJ9A 1NK5A 1IN0A 3NG8A 5ETSA 5G0RB 1ZZFA 3LGHA 3HSDA 4KKOB 9RUBA 3DLKB 1OPZA 2EKYA 2M70A 2LDYA 4QWCA 5A0YB 4USUA 3FRZA 3TJAA 4A8MP 3KG1A 4LSLA 1ZM2A 3UCGA 5F9LA 3S8SA 3IM9A 2RU3A 5AE1A 4ZCKA 5E3QA 2ZZMA 2C1EB 1YJVA 4A4JA 3CDEA 4U96A 2GHPA 3PFEA 2ZD1A 3T5KA 2AW0A 1ZH5A 4EEYA 1VMBA 2YQ3A 2PI4A 4AYBD 2WSFC 2FHMA 2C42A 1Q78A 2R2TA 2VG6A 2UUAJ 4P2FA 2FVQA 2IYGA 2CA9A 3UFCX 4Y2KA 2CQPA 3MWBA 1FX2A 5IM0B 4CZCA 2Z4PA 4HTIA 3NGDA 4DLGA 2CWXA 2B51A 2PT0A 1PAEX 5KT7A 3LGNA 5D3GA 4XPCA 1LWEB 3AAWB 1P8GA 4TU9A 2DNHA 3NWRA 4X4OA 1W7WA 2NXJA 3U1MA 3PCOB 1FWPA 2PSZA 4B3MF 4RW6A 3EVOA 4KV8A 2VA3A 5F8IA 2M7SA 3D6TB 1LWXA 3TP2A 3PYEA 3DM2B 1TZ0A 2GCFA 5L46A 3RRGA 4WKYA 4EU0A 4OQJA 3TAQA 1VHFA 3KJVB 3H5YA 3LW5C 1MLAA 3GFZA 5IT9Y 4K4SA 2EWHA 2BKOA 4ZVOB 1S0MA 3OXLA 1F3VA 5KFLA 2FLLA 4J9OA 3AHPA 3JAMU 1QDUB 4DL3A 3C6UA 4JI5F 1JWWA 2PA8D 4F3MA 2HWHA 2FJBB 3VALA 2B0GA 2GMLA 2LXUA 4DR7F 3PTWA 2G2OA 4ZJQA 3WX4A 4DQIA 3TWZA 1V3SA 4FYVB 2Z56B 2R8KA 3MM7B 2ZBIA 3BDEA 1VQOS 2EFGA 1XMOJ 2ZC4A 3SQGB 2ZOGA 4O3PA 2ZJQQ 3DLBA 4M8LA 1L3SA 1G1XA 3IXQA 1V5IB 2XI3A 1K44A 3DFEA 1FA0A 4ED6A 4LVNP 4PG5A 3P4UB 4KFBB 1T95A 3A13A 3CD0A 4B3TF 4FYDA 4N41A 1N6QB 3HHEA 5BYRA 5KFGA 2LXFA 3FRYA 4G1PA 1RB0A 1QJHA 3NAIA 3CNQP 1NBEB 3QGGA 3IP0A 1FF2A 2AYMA 2RD5C 2PFDA 2HQGA 4F2RA 2XLKA 2ROPA 3PM9A 3IWXA 3FNNA 3KNAA 1TAQA 3BB5A 3M8YA 1IBKJ 4NX9A 2Z2MA 5DO2A 4C0BA 4ED0A 4V19X 5HBMB 3LAKA 2DNLA 1XEZA 3H4BA 3FKBA 1KLNA 1SQGA 4ECYA 3C19A 3RAXA 5AE2A 3GCWP 3MMAB 4NXNF 2CZ9A 3J81U 4I7FA 5SUHA 3QT8A 2W4PA 5HL7Q 1GFWB 4IFYA 1S9EB 2DNKA 1U1QA 4CCHA 1UVNA 1ITPA 3BO4A 4CM0A 3OJSA 3LTOA 1MU2A 4P7TA 1IUJA 4J9VA 2MQPA 3M1VB 5HK4A 1S1VA 3GSIA 2W7OA 3QGPA 4IYQA 4I69A 4ZA1A 2F1FA 4DHVA 1HBUB 3IR7B 3VGVA 1N8RT 4DV2J 1FK9A 3GQCA 2UZAA 5E3RA 3QQCD 4DOZA 4NLTA 2V8HA 4JI0J 1FRJA 4DV3J 1REGX 2E29A 1H2VZ 4UW2A 2ALZA 2PDAA 1HHSA 4JV2A 4HI2A 4PAAA 2GS8A 4MIBA 2LQ8A 2GO8A 4CO0A 2V8VA 3WC2A 5LJ5Y 1HBNA 2A6OA 5DQHA 1KD1T 1Y9OA 1K1SA 3EXCX 3CJ3A 2UXDF 1KS2A 4DR2F 3GV7B 1CS4A 4LRBA 4ZCLA 2F40A 4BS2A 1R27B 3SCLE 2YTCA 5LL6d 2ZUAA 2V4JB 4WIQA 2FUG9 5K8OA 1T8EA 3UR3C 2BJ1A 4CLKA 1GMWA 3OTOF 2QT7A 1U09A 2ZBCA 3CO9A 3PR4A 2ZH8A 1JLBA 3PFOA 4R8UB 4M63A 3OTBA 3R9LA 4ZPVR 4TN2A 2BJ8A 3UN2A 5JVHQ 2BOPA 4OX9F 1QUVA 2Q6BA 4DUZJ 1FTRA 2V4QA 1R0AA 2HK2A 1UEVA 4KY3A 4ZKAA 1HQEB 3C6TA 4YDDB 4PUOA 1SC6A 4LF7J 1S6PB 3Q24A 5F0WA 4HHHA 3T1HJ 3QFHA 1HPZA 2M0GB 2G13A 2I5JB 4TY8A 3HVTA 4X4SA 2ZITA 3D3BJ 3F73A 3M05A 3CJKB 3MM6B 1N56A 5JMNA 3VAHA 1YZ7A 4ZP9A 4ELVA 3QIPB 1REVA 1HQUB 2XI2A 5KG2A 1N33J 3KG4A 2RQMA 2IAJB 1IBLF 2E1MC 3UE2A 3DOKB 4PXDA 1DY3A 2AEFA 2A1BA 4OYZA 3BF4A 4EBDA 4OZ3A 1CG2A 1WG4A 4DL4A 1FFWB 2EG2A 2YKAA 2RQCA 1C2PA 2Y1JA 3HP6A 4HI1A 1NXIA 4KJIA 5KAKA 2Q79A 2CPDA 1Y5LB 4JI3F 4DR6F 1OY8A 4F02A 5EHHA 2FZCB 3P5BP 4PG7A 1YBAA 3HO1A 2HHSA 3RRKA 3UVJB 4P75A 2H51B 2CVEA 1CLFA 3FMWA 3OR2B 1KQSR 2MLYA 2F4VF 3BKFA 4C8NA 1S9GA 2DR7A 2JSXA 3OL6A 1IKVB 3VGUA 1NH8A 5GADI 4MKAA 3ZNJ1 1ZAWA 3D28A 2XC9A 2FHJA 4F25A 1I94J 2WSCC 3CJRA 4XIUA 2QYCA 3W2WB 2VC1A 1J5EF 4USVA 2LVWA 4WFBQ 3MZIA 1HFEL 3FCVA 2HVHA 1RQ0A 1X9SA 2BBEA 4KR0B 1YG0A 3DYAB 4TXSA 1YI2S 5ETOA 2DHXA 5HQLA 5EDWA 3SZ2A 3TQEA 5HLFB 4BWMA 1ZYQA 4NCBA 3KWMA 1T3OA 3KJNB 2ZH7A 2D3OR 1NHKL 4UOFA 4FBTA 4KSEB 1U8SA 1FJGJ 4X65F 2XCAA 4ZCMA 1FVSA 1N5QA 3FEYB 1KKHA 2XY7A 2VJVA 1HARA 4H4KA 3ZC4A 1VRQC 3Q22A 9ATCB 1O5JA 3CD5A 4KHRA 1HD0A 5AXMA 1BQMA 3H2LA 4K4TA 1KFDA 4UZBA 2DVIA 3M9MB 5C2CA 1HBMA 3N0VA 3PXGa 3TZYA 2OPQB 3M8SA 2BRKA 3V81A 3D4JA 2RSQA 2ZJRQ 2J9DA 1UZDA 4WXWA 5DQGA 1Y3KA 1Q8BA 5FJ4A 1M5SA 2A18A 2ALYB 4I2PB 1A6LA 2PEBA 4Y2AA 5I3UB 1UVJA 3PJWA 1NK9A 1XJWB 1WF2A 3M30B 3KUGA 4QIWD 4L76A 2ZEJA 2C2RA 1RAOA 1M5VC 3KOAA 4DR4J 1E6YB 3AOBA 2XYGB 1PJ7A 1FX4A 5LSOA 4M5NA 2LXIA 5J1NA 4RW8A 3M8PA 4CNYA 1IKXA 2KKHA 5KFMA 4FF1A 2F5GA 3GFXA 3OSNA 4TYBA 3PW0A 3FQKA 2RUGA 2P8IA 4DSFA 2YNFB 2VG5A 1X5PA 1D0EA 4B9SA 2HNZB 1Y10A 3CCSS 5T41A 3C46A 1BC6A 2WOMB 2LEBA 2VBXA 3QZ7A 2QZ8A 2R9LA 4J9RA 1RAIB 4LSNA 2LP4A 1IKWB 4HLBA 2UUAF 3NMAA 1VLYA 2YWFA 3X3UA 1SH0A 1AXQA 1RT7B 1LWCA 3C2PA 2V8DA 3RU0A 3O1LA 1WKJA 4U7CA 3M9OB 4RWXA 1GAOA 3MXHP 5KFAA 2QL9B 3G6YA 5K14A 2VODA 1NPPA 3PZPA 2CPHA 4USHA 4O4GA 1DTTB 2BMBA 3MM5B 2GVZA 5EX0A 4KIAA 2D9PA 3RUBL 5GAGI 1KQGB 2DO4A 1FKOA 3B6BA 2HNYB 1S59A 1UJ6A 3GYGA 2UVRA 2CYYA 4CTAB 1YBTA 4DUTA 2N3OA 1N5YA 1X4DA 5LXYA 5KG3A 3THVA 2UU9J 4NWBA 3ZZYA 4KO0A 2HYIB 4A8WA 5D8HB 5KFEA 4TQRA 2J7KA 2Y0BB 3GYXB 5KFUA 2EI5A 2Y1RI 2UP1A 3UCUP 2DNNA 4KHPF 4CYUA 2HGLA 4ZS6A 1M5PC 4PG4A 1TKZB 3KJFB 1TR0A 3N5BA 1DFDA 1S48A 4ZN3A 2JOQA 2EPIA 4IH6A 4O0NA 4RW7B 1SJ4P 1SC3B 4K8RA 2UXCJ 4MMOA 1H2UX 2BOAA 1EQMA 1XMOF 2C3UA 4CH7A 1RCOB 1RP5A 1UJ5A 4FPRA 1FWKA 5A6PA 4YB1P 3A4TA 2QLXA 1WC0A 2QLWA 4GO5X 3CB4A 5D6GA 3KLIB 1FNXH 2L48A 2MKJA 2D69A 4J9LA 2V4RA 1RT6B 2M3DA 4NLXA 3DLEB 3MUVP 1LNQA 1EP4A 4IKAA 1WSVA 2LLZA 3DDNA 2V5HG 3O3LA 1N36F 1JLCA 1SH2A 4F36A 2ASLA 5AT1B 5GVQA 2M5YA 3D6MB 4XAKA 2IDEA 2QV6A 3PYFA 4YHHJ 4DL2A 3GYNA 2ZJPQ 3R3TA 1Q5YA 1Q82T 3SMZA 2BX6A 4K5SA 2OTLS 4J91A 1VRTA 2X1GA 1T9UA 3KLHA 1RE1B 2QLFB 1IBKF 1OSCA 4WFZA 4YR2A 4EUVA 2AT1B 3G82B 2HQIA 4RW9A 1VI7A 4ES3A 3JQJA 2L08A 5CZXA 1W26A 1QTMA 3FBBA 2XSJA 3VVUA 1JXLA 1HD1A 4DG1A 3ZTPA 1FDNA 1NKCA 2WZ1A 4HR2A 5CCMA 4IRKA 3AQOA 4ZCIA 2JEFA 2UV8G 2L9WA 5IC6B 1WEXA 2DIVA 5GMEA 3FEXB 4LR9A 1YGYA 4NYZA 2QMWA 1N32J 2VPXB 2GV1A 5A2QY 4PQUB 3RB0A 3EWGA 4I0WA 2N4CA 1HBOB 4DV2F 3HX9A 2W8LA 1M0SA 3W2VA 3FFIA 2AZ1A 4JI0F 1NHUA 2CQDA 2R4FA 1WHYA 2OH2A 1HYSA 4XO0A 3UD4P 1S1TA 5KG6A 4C4WA 1BMQB 1RT5B 3M2UB 4PYDA 2BJ3A 3CIMA 2BUNA 3G6ES 3FSIA 3RB3A 3J80U 2N7CA 3ILLA 4OL8A 3OL9A 2HMIB 3Q83A 3QNWB 1VGYA 2VHGA 1XR7A 3JSMB 4HHJA 5H9EJ 1MROA 3KHHA 2YNGB 1WNEA 1VR6A 1TV6A 3OUYB 3SDEA 3VAJA 4YFUA 3M4XA 5C25A 3TARA 2XLIA 3HULA 2PIIA 4GKKJ 2OP5A 4B9LA 3CC2S 1NDKA 2BACA 2XZTB 4E8UA 4C3LA 4Q0BA 4DUZF 3JQMA 4EK2A 3W5ZA 2DBBA 3EDQB 3GB0A 4P74A 1XNQJ 3OW2R 4YOEA 4LF7F 1JLGA 3FEZA 2C2NA 2ZHAA 3MR7A 2FJXA 3T1HF 3QGIA 4MTPA 1S1WA 4QIGA 2W7AA 1PILA 1NHVA 1HNZJ 4JI8J 3DRRA 3RW7A 2OJ3A 3IFEA 4UOGA 2EBEA 5SZTA 2MKYA 1OWXA 2HHVA 4MKVA 3DI6A 4OZ0A 4LSLB 4USWA 2P6TA 1RHRB 2HBYB 5B08A 3CCJS 1HWUA 3EZOA 4TYAA 1SJFA 1N33F 1D1UA 2OIHA 3VCDA 4DPTA 2KYZA 1OY6A 2ZD1B 4WIIA 4O3RA 5HVGA 4MYTA 5GAGU 2QTWA 4AL5A 3P96A 3DHXA 4M5JA 3A1YG 1ULRA 4NXMJ 2VG6B 3PRVA 2FLNA 1QY7A 4O0IA 3QGHA 2POKA 1T3NA 1FXRA 4EI2A 2ERRA 3DOLA 2MQQA 5D3GB 1QE1A 4OJGA 3E2EA 1NJXA 2OELA 2IM3A 4AD6A 1S49A 2X1AA 5LSRA 3NAHA 2CQ1A 1WI8A 1MWQA 2R8GA 4PXBA 4ZPDA 3RBXA 1DBDA 1CPZA 2LQ9A 4RW6B 2EFOA 3BQ1A 4WFNQ 4KV8B 1Z4UA 2ZHBA 2HPUA 4IRCA 2EFPA 2IA6A 4ED8A 3CMQA 1EAYC 1DHMA 1I94F 3M2RA 1RWPB 4B9UA 4N7TA 2UUBJ 1KHVA 2VKZG 2VL1A 1JLQA 2E66A 3KDNA 3TUJC 4FYWB 2V9WA 3UPFA 1AW0A 3C6UB 3MUTP 4NI2A 3S1TA 1C0TA 1HNXJ 4ZOSA 1FKAF 4EZ6A 3AFGA 4X64J 2QSFA 2QA2A 2PE8A 5E3CA 3DLHA 2G1DA 1LW2A 3F0NA 4WTOB 2HQCA 3RB6A 3SCIE 1VBXA 3ADAC 1RLDA 3R6GB 1KRPA 1ZA2B 1TKTA 4OI1A 5DDQC 3SXLA 1NPRA 4ANDA 4LF2A 1S72S 3DMJA 3ZZOA 3MR6A 2AU0A 1JLEA 1P9QC 1B0VA 2XHCA 2DCUB 5B0CA 1Y11A 3U1LA 3QT6A 2G0CA 4ECWA 1RWVB 1CULA 2CQHA 1MG7A 4A8FA 2G1HA 3LUYA 2WCXA 3FVYA 3EZ5A 1I5OB 4MYUA 2EFNA 1F3FA 4CT9A 4CO4A 2O66A 5JJBA 2BKNA 3LGMA 2EW9A 2FJEB 4DN0A 1YRTA 4DPXA 2MJNA 1C1CA 1OQ3A 4GRSA 3G86A 4F50A 3HD1A 3W9IA 2YWGA 4FKXA 2JWNA 1FI4A 3I87A 2QA1A 2COLA 3BO3A 3M32A 1YHQS 2BV3A 2MKKA 2BE2B 3POTA 2E1CA 3G8QA 2W4CA 3GIJA 2DNQA 2VPWB 4OZNA 1BUXA 1F9EB 4I7FB 4JI1J 4TVAB 4ED5A 4J90A 1UVLA 4ECZA 3VTIA 3DU6A 2C3PA 4V1Ak 1PJ6A 1JQGA 4IFYB 4ECUA 1XNRJ 2YQ0A 3OV7A 5ETMA 3H8YA 3W63A 2OPSA 1MU2B 4UUWA 3OVBA 4B9MA 3JXOA 3D54A 3GU0A 1G4CA 3D1QA 1S1VB 3PYDA 4QWBA 3M6WA 5KT2A 3OVAA 1M5KC 1SL0A 4YUDA 5IWAJ 4LF9F 2ZOFA 1KOHA 1NDCA 3F41A 5D0GA 3D3CJ 1UEUA 1GMVA 3EGWB 1Q7YT 2C2KB 1SUQA 4PXCA 1FK9B 4P7VA 2BJ9A 1WACA 3P49B 1VQPS 1ZTTA 5CYJA 2BW2A 5KFWA 2GAHC 3HKZD 1VBZA 5EGYA 1GH8A 4DV1J 2YNHA 4UQGA 4KHMA 1HBNB 2DHSA 1SBRA 4Q8FA 4ELUA 2P6SA 3ZTOA 3AOCA 4DL5A 2P2CB 4WU3A 3QRPA 1CS4B 2LU2A 3QSIA 2DGXA 1RKJA 2C3OA 4IRDA 2VG7A 1RTJA 2UU9F 1HI1A 2FHOB 4ANEA 1DQ8A 3CCZA 4PZVA 4F0MA 2QGFB 3MTJA
chains in the Genus database with same CATH topology
2ZNYA 1FCAA 1ZM2A 3UCGA 5F9LA 3G8SA 4ZK7M 3S8SA 2GO9A 4C97A 4DV3F 1YIJS 2AX1A 4FF2A 2DPJA 1URNA 3OFEA 2BANB 2RU3A 1QSLA 5AE1A 4ZCKA 5E3QA 5I3UA 2VFVA 4ECRA 3R5DA 1JLBB 3G6XA 1S99A 1TL1A 2K7KA 2ZZMA 2OSRA 2DHGA 1Q8LA 5DM6Q 4AFFA 1YJVA 4A4JA 3CDEA 3BSOA 2N7YA 2BQRA 2GHPA 1MWZA 3PFEA 2ZHOA 2IHR1 2ZD1A 3T5KA 2AW0A 1ZH5A 4K4ZA 1X5OA 1IJEB 5HI7A 2VQEF 2KDOA 2ATLA 1WG5A 4JOUA 4EEYA 1VMBA 4Y00A 3V6JA 4DUYF 4NA1A 1T03B 2YQ3A 2PI4A 1WTFA 3MAHA 4WYWA 1JLAA 2HVZA 4AYBD 1ELOA 1NEEA 2HZCA 2WSFC 1U47A 2FHMA 2WB4A 2D3UA 1R0AB 2C42A 3SSQA 1Q78A 2WHOA 3WBZA 4B3SF 3C6TB 1IKYB 4PUOB 1S79A 2R2TA 2UXCF 1E6VB 2Q1LA 2VG6A 2J6TA 4ETZA 4E98A 2FVQA 2IYGA 3UFCX 4K4YA 4Q8EA 4Y2KA 4W92B 2CQPA 1TVRB 5KG0A 1JJ2R 3MWBA 1KONA 1HPZB 1X5TA 1VQKS 1FDDA 2NS1B 4TY8B 2KG0A 5K8PA 2BJDA 4CZCA 4K5RA 3HVTB 3ICLA 5IM0B 1NKEA 1L3VA 2Z4PA 4HTIA 3NGDA 4DLGA 4URGA 4HTJA 4NRTA 4URSA 2B51A 2PT0A 4AUKA 5IS2A 3J7ZT 4X84A 1FXDA 1VS3A 2DGUA 5KT7A 3LGNA 2HFNA 5CYQA 4EYHB 4ED1A 4Z37A 2ZH5A 2ABYA 2K3KA 2AGOA 2PO4A 2HIQA 4QU7A 5D3GA 3MEEA 4XPCA 3UWTA 1LWEB 1S77D 3AAWB 1ZAXA 1P8GA 3ITHA 4OI4A 4TU9A 4ED7A 2DNHA 1FE4A 5FD1A 2LQBA 1REVB 2RT3A 1WELA 4ZVFA 1Q8IA 3RAMA 4X4OA 2VZ9A 4YB5A 2BYCA 5DGBA 2R7UA 1S6UA 2DNZA 3T1YF 3NS5A 1UP1A 1N5VA 3U1MA 2KB2A 3K8VA 5KG7A 5DLGA 2LCWA 3HZEA 4HT7A 3J7YI 3M8RA 2PSZA 4B3MF 2W4DA 3PEHA 4ED3A 4RW6A 2DGTA 3HT3A 3LH2S 4KV8A 2VA3A 3QAUA 2M7SA 5F8IA 4IOCQ 3DRPB 1M1KT 2B9XA 2X3GA 3TP2A 1C1BA 2EBGA 2FC8A 4CO5A 1XTZA 3DM2B 1TZ0A 2GCFA 3UNGC 3I9ZA 3MOJB 5DDRC 3RRGA 4WKYA 1KVJA 4YHHF 4EU0A 2IVMA 4QWDA 4OQJA 1S76D 3UW1A 3TAQA 2RKIB 4C8MA 4MFBA 3DHWC 4RW4B 5EUHA 1TK5A 1VHFA 3TAMB 3HF5A 3KJVB 3H5YA 2L3MA 3FJ2A 4DSEA 3LW5C 3AB4B 3GFZA 4QBUA 5KTQA 2ADBA 5IT9Y 4IG3B 2VFSA 4MKBA 4K4SA 2EWHA 2YX7A 2F8HA 2YKNB 3PNIA 2KZMA 1S0MA 3MEGB 3OXLA 4FP9A 5KFLA 5I3QA 2XY6A 4J9OA 2FLLA 4ICLA 3RW6A 5M2UA 3AHPA 2JLGA 2CQCA 2GFFA 2RJZA 3MAQA 1T94A 2HHWA 2LQ5A 1FNMA 4DL3A 2DGVA 1VRUA 3MM8A 2B3TB 4RNMA 3C6UA 1SV5B 4JI5F 4I2QA 1JWWA 2PA8D 3NCQA 4NMLA 4QW9A 1FNOA 4LFBF 2CG4A 4F3MA 1BQNA 2HWHA 2FJBB 1X4GA 3MGJA 3HM9A 3CMAS 3VALA 1YJWS 2DR5A 3FFIB 4A8XA 2B0GA 2GMLA 2LXUA 4GO7X 3UQSA 1HMVB 7FDRA 4DR7F 4Y2MA 2K8GA 3KHRA 4NRUA 5DS7A 5J2MB 3WX4A 2D7SA 4ETXA 2M4MA 4ZLPA 2A10A 3VAMA 4DQIA 3JTPA 1RT1B 4R0JA 5D4PA 4YEAA 3MMCA 2J0WA 1V3SA 1X5SA 4H4OB 2QIFA 4XDDA 5L1KA 1UA0A 2IJFA 1LK7A 1RT2A 3K7RA 3ENWA 3LWLA 2R8KA 3MM7B 4HL9A 2PA3A 1FRLA 2Q6CA 1DZ5A 2YKMA 5AJ3F 2DCLA 3CMES 2ZBIA 3BDEA 2OFHX 1DQ9A 3OTCA 3KLGB 1VQOS 2EFGA 2CFXA 2ZC4A 3SQGB 2ZOGA 4O3PA 2KXFA 2ZJQQ 1JK9B 3DLBA 5EN1A 5KOWA 1N32F 4F67A 4M8LA 1L3SA 1G1XA 4C3MA 3IXQA 1BWEA 1LFPA 2CQ2A 3KMSA 2AP6A 2ILZA 3T6JA 2XI3A 2EFVA 1R8CA 1TUVA 3VQSA 1RT4B 3QLHA 3NNHA 1P1LA 1ZPVA 2K1RB 3EZUA 5KFOA 3DFEA 3LP2B 4OIXA 4Q2LA 3SV3A 1FA0A 1T7PA 1L3TA 2R7SA 2F7VA 1KTQA 1H6KX 4RNHA 2PD1A 4LVNP 4ED6A 3I6PA 3DRSA 1DQAA 3E51A 4X2BA 2D41A 4PG5A 1VQSA 2DIUA 1UAWA 2DB1A 3BGFA 2GX8A 4OMFG 1J5OB 4KFBB 1T95A 5F8LA 3D1OA 4EYIB 1J2VA 3CD0A 4B3TF 4FYDA 4K2XA 4N8OA 4N41A 1N6QB 4YMEA 3HHEA 2PFFB 2DGSA 5BYRA 4AXJA 2KRBA 5KFGA 3HVAA 1CSJA 2UUWA 2LXFA 3FRYA 4ID8A 3KLEA 3CUNA 1LW0B 1QAJA 2QA4G 3GSDA 2IC3A 4G1PA 4HDHA 1W2BR 3KHLA 1QJHA 3NAIA 2MHNA 2ZKTA 2CQIA 5L9XA 4OZ5A 3CDAA 4R5PB 4KRWA 3H5SA 3OXGA 4KC5A 1YSJA 2ACYA 3QGGA 1V3RA 4NZ7A 2CPYA 4I6YA 2KU7A 2GW8A 2MSSA 4ECTA 5B0FA 2FD2A 2GJ2A 3KK1B 1FF2A 2AYMA 2RD5C 4AQYF 2XS7A 1FJCA 2YH0A 2OMLA 3TA2A 1PC4A 4F2RA 2XLKA 1JKHB 2ROPA 3PM9A 1RTIA 2FTRA 3IWXA 3D2WA 1U2FA 2FLPA 3TYTA 1BLUA 1AUDA 3DC2A 3FNNA 2DNOA 3LOUA 4I64A 3I5CA 4DSKA 4WXOA 1RDRA 1TAQA 4HH0A 3BB5A 1NAQA 3KNAA 3HHLC 4X62F 3SSSA 2J9DE 5D4OA 2HW3A 4D3HA 1Z1ZA 1RWUA 4NX9A 4ECXA 5DG8A 2Z2MA 3HFKA 1IJFB 3I0RB 5DO2A 2P9GA 1S1UB 2Z8QA 5KFIA 4C0BA 4ED0A 5HBMB 4C11A 4V19X 3LAKA 2DNLA 1XEZA 3UDLA 3OPKA 4KPYA 4ZMMA 3H4BA 4LQ9A 2D9OA 1VK3A 1VIXA 1TL3A 3LP0B 3AJ2A 1KLNA 5C42B 3BQ2A 1KLMA 2RH3A 1P6TA 3NNAA 3CTRA 3THPA 2ZH6A 2OPRB 4ECYA 1BQMB 3JAMY 3RAXA 5AE2A 4ZHRB 1TFYA 3VAIA 3MMAB 4OX7A 3V4IA 4CH1A 2HHPA 4NXNF 1N5SA 1HBMB 4NL5A 1GTHA 2VFRA 1RT3A 2AQ4A 3CE8A 4I7FA 2MZRA 5SUHA 1U1MA 1S0VA 2DH9A 3V81B 2AGQA 4DFMA 2E5IA 2B4OA 2W4PA 1WF0A 5LJ3Y 5DDOC 5AXKA 1SL2A 5HL7Q 4PR6A 1HW9A 4GKKF 4CQ1A 4IFYA 1UVKA 4NLYA 2HRYA 1S9EB 2DNKA 2J9EA 1U1QA 4CCHA 3RTVA 3GV5B 1D9FA 4ECVA 4IUFA 1UVNA 1HA1A 3MMBB 1SKWA 3BO4A 1Y0HA 2CPJA 2CQBA 3MEDB 1VC0A 3OJSA 1FJGF 1MU2A 4P7TA 1IUJA 3LPYA 5MAOA 2MQPA 5B09A 2XNRA 4A8OA 1B64A 3M1VB 5F3ZA 1YJUA 2XS5A 2R2UA 1S1VA 2XMUA 2W7OA 1XNQF 1N4LA 1M90T 4JV1A 1H7WA 1Q7LB 3QGPA 2E5HA 4IH7A 3OFHA 4IYQA 4O44A 4QYZJ 1U4BA 1SJQA 4I69A 4ZA1A 5KFZA 2XWXA 2F1FA 3QO9B 4DHVA 3OSPA 1QVFR 1G2EA 3K57A 2AYGA 1X4CA 1HBUB 3K5LA 5IZHA 4HVZA 4OZLA 3IR7B <