2MKSA

Nmr structure of the rrm domain of rbmx from homo sapiens
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding motif protein, X chromosome
publication title NMR structure of the first RRM domain of the protein RBM39 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mksA01
4WFBQ 2A3JA 3U1LA 5IQQA 1M1KT 2M4MA 1FJCA 1WEYA 2M0GB 2QEXS 3G8TA 2VODA 2AYEA 1YJNS 2D9PA 2UP1A 1JMTA 3I55S 3CCRS 1DBDA 4CH1A 1U1QA 2CQ0A 2XSFA 4OZ1A 3S8SA 3V4MA 4TLQA 3CCLS 1X4EA 2XB2D 3MXHP 5CYJA 2EK1A 1WEXA 3CULA 1K73T 1DHMA 3CXCR 2DGUA 2VOOA 1YTYA 1FXLA 1ZH5A 2DGXA 2QFJA 2CQGA 4V19X 4QU7A 1N88A 3UE2A 2F3JA 2DHSA 2JWNA 4WCEQ 1X5SA 1X5PA 2EK6A 2OSRA 4Z2XA 2FC8A 4WIIA 2KVIA 1UP1A 1S79A 3R27A 3J7ZT 4Y00A 5DM7Q 2U1AA 5DDPC 2LKZA 1RK8A 4CIOA 2F9DA 2OTJS 3CC2S 2KM8B 1X4CA 1H6KX 2MZRA 1WHXA 3CCJS 1ZZNA 2LA4A 4QQBA 1VBXA 4C7QA 3L3CA 2CPJA 5IM0A 1WI8A 2G1DA 3R1HA 1B7FA 2M8DB 3PIPQ 3MI7X 1SJRA 3CCQS 2JVOA 2ERRA 1SJFA 3UCGA 1WWHA 3TYTA 2HGNA 2N82B 1X5TA 2DHGA 3VAJA 3G8SA 2DGTA 1WF0A 1VQ8S 3MOJB 1U1RA 2B0GA 2DNYA 1WHYA 1X4AA 3THTA 2KRBA 1YITS 2MSTA 4PRFA 1D8ZA 4WFNQ 2YTCA 1M5OC 2DNKA 5LXYA 3MUMP 2M52A 3R1LA 3UD4P 3VF0B 2DGQA 5D78A 2OSQA 4Y0FA 1K9MT 1SXLA 2MKJA 2J8AA 2MYFA 2RQ4A 2ADCA 2FPHX 1X0FA 5GVQA 4F26A 5GAGU 1ZZFA 3H2UB 3U1MA 2RQCA 2CPHA 2RRBA 5GAEU 1SJ3P 1QM9A 1FHTA 2HZCA 1H2TZ 2CQDA 4IUFA 5ITHA 4C0OC 5D77A 2XS2A 4F25A 2DH9A 3P3DA 1U1LA 3VAMA 3MD1A 2DGSA 4LIRA 4IO9Q 3UCUP 4QPTA 2DISA 1U1MA 3UWTA 1DZ5A 2N3LA 1X4FA 1VQOS 2MKIA 1U1OA 3SMZA 3NMRA 1VQMS 2XNRA 3HHNB 3VAIA 2MY7A 2LQ5A 1OIAA 1UW4A 2LXIA 3CC7S 2DNMA 2DGWA 2DNOA 2MY8A 4FXWA 3CD6S 2DGVA 2DNNA 2N3OA 3OW2R 3Q2SC 3P49B 2MGZB 2DGOA 2KFYA 2JX2A 2F9JA 2OJ3A 2MJNA 2G4BA 3US5A 4WFAQ 5GMKa 2YH0A 3NNHA 4TU8A 1VBYA 4LMZA 2NZ4A 1FT8A 1WI6A 1R8PA 2CPXA 1WF2A 2KM8C 2RNEA 1U1KA 3NS5A 1P27B 4TU9A 3CCSS 1VQ9S 1KD1T 4UY8T 4FXVA 4F02A 5DDQC 1RKJA 2CPZA 1VQPS 5LXRA 2RUGA 1U2FA 2MMYA 1YWXA 3CUNA 2CQIA 2HVZA 2NLWA 3N9UC 3FEXB 2KH9A 2Q79A 3CCVS 3LPYA 2ZJPQ 1WHWA 3DXBA 2QA4S 5H1SV 5GADU 1N54B 3G6ES 1VC6A 2X1BA 2D3OR 2HYIB 1NU4A 3VALA 2CPEA 2K3KA 3SDEB 2LCWA 2RT3A 3NNCA 2VONA 1VQKS 3MDFA 2MGZA 1VQ6S 2CQBA 3MD3A 2MHNA 3P5TL 2YH1A 5HL7Q 4CQ1A 3J7YU 3ZZZA 3UD3P 3SXLA 2JRSA 1W2BR 2MJUA 4PR6A 2E5IA 3G9CA 3IWNC 1M90T 1WELA 2HGLA 1AUDA 1DRZA 4C4WA 3BO2A 1KOOA 1VC5A 4U67Q 1Q82T 2RS2A 2CQ3A 1FNXH 2FHOB 3THPA 2KU7A 2LXUA 1HA1A 2MZSA 5LSOA 1CVJA 1D9AA 2AYGA 1URNA 5LJ3Y 3G96A 1S72S 2CPFA 3DLLQ 3S6EA 1A9NB 2AYBA 2L41A 2MZJA 3B4DA 3H2VE 4EGLA 4M5DB 4RU2A 3HI9A 1VQ7S 1H2UX 3VAKA 2MZQA 3NNAA 4ERDA 2LECA 3P6YC 1Q86T 2MQNA 3UCZP 1WG4A 2PEHA 1G2EA 5CXTA 1WHVA 2E5HA 2PE8A 4W92B 2DK2A 2DH8A 2ZJQQ 2K8GA 3EGZA 5GAHU 2EVZA 2RU3A 2E5JA 2FC9A 1X4BA 3CPWR 3LQVA 3CCUS 2DNZA 1P1TA 2I38A 1IQTA 1UFWA 1OO0B 3Q2TC 2DHAA 2XS7A 2MZ1A 4P6QA 3EX7B 2YKAA 2OTLS 5DM6Q 3D2WA 1L3KA 2MB0B 4ZKAA 2KXNB 3VAFA 3CF5Q 1YI2S 1WF1A 3RW7A 4BS2A 1PO6A 2MPUA 2HGMA 5EN1A 5MLCV 2CQ2A 2MSSA 3CC4S 4CH0S 4QU6A 1X5OA 2DNLA 1VBZA 2KXHA 2DITA 3EGNA 2J76E 2N7CA 1QVFR 2V94A 1U1PA 3K0JA 2KN4A 1HD0A 3S7RA 3G71S 3IRWP 1WG1A 2O3DA 1Q7YT 4ED5A 2M7SA 2L08A 5HO4A 2CJKA 1N52B 5DDRC 2DIVA 3NS6A 3CCMS 5BJRA 2AYMA 2CPIA 3TO8A 1M5VC 1PGZA 2YWKA 2BZ2A 2BOPA 1HD1A 1WEZA 2XS5A 4WF9Q 2MXYA 3VAGA 2MKCA 2I2YA 1JJ2R 3MUTP 2DNRA 2KT5A 2DHXA 3B4MA 2KG1A 1YHQS 1N8RT 2DNHA 2J0QD 5LJ5Y 4YOEA 2MQQA 3I56S 1YJ9S 2DNQA 2DH7A 3ZZYA 5JVGQ 1VQLS 3BEGB 2X1AA 1H2VZ 2KHCA 4LJMA 2KYXA 2E5GA 1SJ4P 1U6BA 3BS9A 2JVRA 2DB1A 4A8XA 5LSLA 1Q81T 1WG5A 4W90B 1FO1A 5FJ4A 2CQ1A 1M5PC 2GO9A 5JVHQ 3CCES 1X4HA 2MQOA 5DETA 1KC8T 1JJHA 2MZTA 1FJEB 2CQCA 2LA6A 1VC0A 3MUVP 2E44A 4WKRA 3CMAS 1NJIT 1BY9A 3MURP 2RVJA 4IOCQ 1OWXA 2MKSA 2DIUA 2CQHA 2LMIA 4PKDB 1QVGR 2KXFA 2XNQA 2DNGA 2RRAA 5IFMA 2LEBA 2X1FA 2L9WA 2FY1A 1SJQA 1M5KC 1U6FA 2VOPA 3PIOQ 3S01A 3JB9k 2ZJRQ 1JJ4A 2SXLA 1XN9A 2ADBA 2WBRA 2OIHA 2MQMA 2DNPA 3CMES 2CPYA 3SDEA 5CA5A 2MKKA 1YIJS 1FJ7A 1VQ5S 2KRRA 1KOHA 1X4GA 2X1GA 4OZ0A 1WTBA 2LYVA 2J0SD 2M88A 2DO4A 3ULHA 2KI2A 1VQ4S 4YUDA 2CQ4A 1NO8A 1YJWS 2RS8A 3VAHA 3CTRA 2M8HA 4YB1P 1HL6A 2GHPA 2U2FA 2M2BA 1UAWA 2DO0A 4TU7A 2MQPA 1F9FA 2D9OA 1R8HA 3BO3A 3BO4A 5DDOC 1O0PA 1U1NA 1KQSR 4IOAQ 2MKHA 2AD9A 2LEAA 2CPDA 2M70A 1VQNS 4J5OA 1X4DA 1K8AT 2MQLA 4UQTA 1OPIA 3FEYB 2KG0A 5IM0B 2M9KA 1A7GE 3RW6A 3TP2A 2CQPA 3G4SS 2G0CA
chains in the Genus database with same CATH superfamily
1CQMA 2DYAA 2ZH1A 1TL1B 4URGA 4F36A 4KSEB 2UP1A 4BBYA 1SV5A 1Q0NA 1SIWB 1NK6A 4FYDA 5A8WA 1HQEA 5CYQA 3QYYA 4NYOA 2PIIA 1FFSB 4TKTA 5K14A 3RJMB 1HPZB 3FJ2A 1SC6A 3OHAA 4WIIA 1YJTA 3J7ZT 2GW8A 2RQMA 2HZVA 4QBUA 1RAFB 1HQ2A 2D69A 5J1EB 2J0XA 4R5PB 3JQMA 4P71A 3I0SB 4DR2F 3RBDA 4TYBA 4A4JA 4X4VA 4IH7A 1T03B 2KRBA 1HQUA 4KE5A 3OXLA 3MUMP 1UJ6A 2BJEA 3DGPA 2K1RA 2CAJA 2RQ4A 2DRAA 4LRAA 2GMJA 2DEIA 2W9CB 2GQQA 5C24A 3MMAB 4ZP7A 2N3LA 4OMFG 2XBPA 1X4FA 4NL5A 1IBMJ 3HHNB 1YVFA 2IBKA 1F6TA 3V4IA 2OPSA 4L74A 2DGWA 3CJKA 5KFMA 4RLEA 1K47A 2BKPA 3PRBA 1KLMB 1BQMA 4L6V3 4DV6J 2HW3A 2CZ4A 4P52A 2C22A 4DL7A 3N6LA 4P2SA 3HF5A 1RT7B 2H65B 1KD1T 4JV5F 4M5IA 1SH3A 5KT2A 4OYXA 1RT3A 4HH0A 2C2OB 3IM8A 3M8WA 3FEXB 3PR4A 4NA1A 1WHWA 5LMNF 2X1BA 1UWAA 3EXYA 3BH6B 3FSYA 3ZTSA 3DDKA 1NHUA 3MDFA 5F3TA 3UD3P 2OPPA 3QGIA 1DQ9A 2AP6A 2HGLA 4DDFA 3D6FB 2UVUA 2CQ3A 3MAAB 5M2PA 5HMXA 2VKRA 3MAHA 3GG1A 3I0RB 1J5EF 4OZ2A 5IOLA 2HQGA 3H7HB 1UVMA 2HEKA 3LGHA 1AFJA 4I0WA 3KDNA 1JX4A 4DL5A 1EZZB 2R9LA 1YK9A 3LA0A 2EFNA 1WTFA 5AXLA 3THVA 3OFEA 3KK3A 3IR6B 2FJXA 1DTQB 1FK9B 2R8KA 2RU3A 5KFAA 4K2XA 4OHVA 1Q5YA 1NJZA 4H4OA 1WUUA 3AY0A 3CO0P 1BD6A 3JTOA 1CG2A 4USMA 3MECA 3L7PA 2MB0B 4J9NA 2FZGB 1RSCA 1QE1A 1XWLA 1NMEB 4OHWA 5I4MA 2V94A 3BBBA 2KN4A 1Q7YT 4ZVSB 3ISND 1I51B 2L08A 1RJJA 2QLBB 3IS9A 5HLFB 5DDRC 3NS6A 4R8UA 2AYMA 3DOKA 1RZMA 3WBZA 4RUAA 5KG2A 4LR7A 3OTOF 1UPPA 1Y3JA 4MH8A 4DUYF 2KG1A 3RYLA 1UWBA 3D0HE 2XI3A 3KLGA 2KHCA 4EEYA 3HD1A 5KFXA 4FBTA 3SCIE 2BANA 1Q81T 3AODA 5E33A 2NUHA 2W8KA 4FXDA 3ICLA 4WKRA 2KZZA 3OXFA 1UJ5A 1VLOA 2UXDJ 1ZM3A 4ED8A 3HFVA 1RT6B 1D9DA 2L9WA 1RYSA 3SV4A 3EZUA 5I3PA 4LBIA 4I2PB 1XN9A 3PACA 2WBRA 1XIQA 1HBOB 2W7AA 2DR8A 1Y9OA 2KRRA 3RRGA 2AIRB 2J0SD 2DO4A 1Q4RA 2G1HA 4AUKA 2GHPA 1F5CA 2WSFC 1UAWA 2R7WA 2CFXA 2EG2A 2YQ1A 4XPCA 1H74A 4FZVA 2HWTA 1CJTB 2M9KA 3HD2A 1NJWA 2OMOA 3MEDB 4J9OA 3ILOA 3DM2B 2B5JB 4ZVHA 3AA9A 1I3OB 2VG6A 5ETOA 1YJNS 3HCXA 3POTB 1A0OB 1H73A 5J2QB 1R0AA 2H51B 2ZNYA 1FKPA 3T1YJ 1X4EA 4PXCA 3AQOA 4HHJA 2V9WA 4V19X 3BJYA 2PI5A 3DRRA 4DCOB 3DMJA 2ROGA 1RP5A 1WDTA 1UP1A 4ICLB 4C8MA 1GX5A 1LW2B 1PC5A 2MZRA 1S9EA 5D0EA 3RRKA 4QIEA 3R1HA 2UU9J 2EBEA 2Y0SD 1TL1A 3W61A 2HBZB 1ZETA 4MK8A 1VQ8S 1WHYA 2FDNA 1OQ3A 3ISZA 3PXGa 3QWUA 4ETZA 1T9VA 2E1PA 4ES2A 2CZVC 2ZUGA 3MPUB 2H4WB 1WKJA 5IWAF 2A10A 1N4LA 3WIUA 4M5LA 3MMBA 1TUGB 2YNGB 3QJPA 4HTIA 1H2TZ 1WACA 3KHHA 2UV8A 3TZXA 1U1MA 3UWTA 4LFCJ 4O0NA 2ZC4A 4NEZA 4KY3A 1VQMS 4KT0C 3I87A 3H5SA 1T03A 1CSJA 5AXKA 4LT6A 4Q8EA 2OELA 4HACB 1ACMB 4O3PA 3HHLD 2DGOA 3LO3A 2C2NA 3QT5A 4ZS6A 1VYAA 4JOUA 3GIIA 2DHHA 1IBMF 3EVOA 2Q43A 4N8NA 3M8ZA 4I56A 3KJVA 3MCMA 2BM1A 4F02A 2DXEA 1RKJA 2W9CA 3JQKA 3SBMA 2HNZA 2NLWA 3MMAA 2Q79A 1VC6A 4DV6F 2PMZD 4YB7A 3AD8C 4MKVA 3LP1B 3FRZA 1V5VA 4C2MA 1JWWA 2VV5A 2EKYA 3P5TL 3GMGA 3NOGA 1IR1A 2VG7B 1N0VC 3SXLA 4KIAA 1KEKA 1AUDA 1TQLA 1RU2A 1LXNA 1KVIA 4B08A 5KFEA 3C6TB 1MSWD 1SJ1A 5G4DA 2EKNA 4I69A 3CEDA 1J2VA 2AZ1A 4FF1A 1JLCB 4RU2A 1H2UX 3NNAA 2X3GA 3A3NB 2B4OA 2DVIA 2PEHA 3A3PB 2KB2A 4OYWA 5FIIA 5EWEA 2C2MB 4FYVB 4Y2IA 2ZHOA 2DXDA 1RWNB 2DNZA 3ZTRA 1R0CB 3RAQA 4DCJB 3I4HX 4K4SA 3BZQA 1FKAF 5DM6Q 5ETVA 2OLWA 2RDIA 2CNOB 3QIDA 2YNFA 4DSLA 2VDHA 2YKPA 3MAAA 4N56A 1S6PA 3RW7A 4BS2A 3I0RA 1X5OA 2AEMA 1VBZA 1LWXA 2DITA 4UUWA 1U1PA 2WSEC 1HD0A 3J80Y 4OYIA 2J6SA 5LMUJ 3UN5A 3GSIA 2QX0A 5BJRA 1DTQA 1MN7A 2XI2A 1NK5A 4DL4A 2FUG9 3DHXA 4DFJA 2QYCA 3E51A 2DBBA 1WSVA 4NZ0A 2IJNA 3KMSA 3IWLA 4RJVA 3MM8B 3HHKA 1NNDA 4WU3A 3U7JA 5KFOA 2HWHA 2WB1D 2JVRA 4A8XA 4ZHRB 5C2GA 3UDLA 1YZ7A 2CQ1A 3CCES 1FJEB 3GJQB 1JLQB 4CLLA 1WNEA 1RTHB 5HJYA 1TL5A 3F41A 2B9WA 1TKZB 2ZUAA 4QYZK 2CJAA 5KG7A 3RBZA 2ILYA 5IS2A 4OZNA 1RAIB 3T1AA 1FVQA 2ZH7A 2YY3A 1RWUA 3VTIA 2RAQA 2PEBA 1DLOB 3ZZ0A 1FJ7A 1F2GA 4OZ0A 1RYRA 2CJBA 3M6VA 2IYGA 3LGMA 2YKNB 3V6HA 3DOLA 1Y3KA 4YB1P 1M1GA 2JEJA 1YLXA 4ZPWR 1VQNS 2E66A 4RUBA 3TP2A 3L09A 1RT6A 1J5OA 3Q24A 1F9HA 1TU0B 1S1XB 4L3KA 4I2PA 4XTTA 2JFDA 4DG1A 2COLA 1HBOA 4IG3B 1IKXA 1T9UA 3TI0A 1X31C 1X5PA 2OSRA 2QRRA 4UZCA 2LKZA 2FY8A 4O3NA 4I4BA 3UVJB 3ENQA 2RKIB 3T1YF 2V8GA 4C7QA 2EI5A 4L76A 5CH7B 3M8PB 3KNAA 3VGUA 2HLUA 2M8DB 3MEDA 3DM2A 4CT9A 4MIAA 1IBCB 2JVOA 4MFBA 1B7YB 1TTHB 1WF0A 2E5LF 3GP9A 3POTA 3J80U 4WFNQ 4YFUA 4NLPA 1C1CB 5LXYA 4YDDB 3R1LA 3EPIA 1K9MT 3A1YG 2VJVA 2XSJA 2UU9F 3FCHA 1AROP 2HFVA 3HVTA 4JI0J 1OS5A 2ZHAA 3O2IA 4AXIA 3EUNA 2WZ1A 4DS5A 4EU0A 3NMRA 2XNRA 4FNHA 2NREA 2OPRB 4P75A 1RAHB 3MEEB 2N3OA 1RISA 2XMWA 2W7OA 4FS1A 3C14A 2JX2A 2OJ3A 2KT3A 2FJBB 4Q45A 3NNHA 3AJ2A 1TZ0A 4E0DA 3AOBA 3QSIA 1R8PA 1NUEA 2BXJA 2JLFA 1C4CA 4NLOA 3LGNA 4FXVA 3PNIA 2CPZA 5J1PA 4ED6A 5H1SV 4J37A 2D3OR 3W2WA 2HHHJ 2K3KA 1TAUA 4RBUA 3BYRA 3W5YA 1MWZA 2MQ8A 1NSKL 3EM1A 4CNYA 1UVKA 5L39A 2RF2B 4UQGA 3HULA 5J2PB 4RNOA 3QRRA 2DY1A 4LRCA 3RBEA 2KO1A 3MFHA 1URNA 3RR8A 3BGRB 3S6EA 1HI1A 4OYMA 3JSMA 2L41A 4F3MA 3PW2A 3R7BB 1G2EA 3CJTA 1FD2A 2XG8A 1HW8A 2L48A 2E5JA 2B4PA 1HHTP 1Y5LB 2WOMB 3I31A 2XS7A 2QL9B 2CNLB 2HBRB 2BACA 2VKZG 4UUXA 1RHRB 3PV8A 2C3PA 3BSAA 2ZDOA 1U48A 2MPUA 1Y5IB 3C6TA 4J7CA 3EGNA 2HHSA 4IFVB 1UETA 1JLCA 3IRWP 1IM4A 2PGCA 3PDNA 2LDYA 4HHUA 1VI7A 2FYXA 3H5UA 4XO0A 1TP7A 1S7HA 2HS0A 5KG5A 1LK7A 2Y3YA 3CJ2A 2QSWA 2WHOA 2MQQA 2HS4A 4C8NA 2LQ8A 3MTKA 3RB3A 2AX0A 1C0UB 2QFIA 1AXQA 5JVGQ 4N41A 1EKRA 5LSLA 2HHPA 1NB7A 1EETA 4X4RA 3BBFA 1M5PC 4ED1A 1HWUA 2BJ3A 5JVHQ 2WONB 4J9KA 1H72C 3M2VB 4UOHA 1GAOA 2V34A 2Y1JA 2W4CA 3KHGA 1IN0A 1WC5A 2RSQA 1FA0A 1EJ7L 1H98A 4F50A 3SQOP 2LEBA 3R6GB 1WOSA 1N5VA 2JLEA 1Q8IA 3HKZD 2DNPA 3MM8A 3F0NA 2BRKA 5A8RA 3Q0AA 3PM9A 4OYPA 5LSRA 4DPOA 4ZHRA 4TQRA 5CZXA 4USKA 2U2FA 2DO0A 1R6YA 3MCOA 4LSLB 1KQSR 3W7BA 2F65A 2LEAA 1JLQA 3A3OB 1RTHA 4HEA9 5IM0B 3FUYA 2CJYB 4KC5A 3FKBA 5CABA 3M8YA 1TKZA 3QT7A 4B02A 2F8HA 2W2QP 3B82A 4JI1J 2D9PA 2YX4A 5E3AA 4QYZJ 1DLOA 3JYTB 2E9ZA 3W1YC 2BQUA 3R5JB 3HFKA 2CQGA 4RWWA 2YKNA 4FKYA 3UNGC 3UE2A 4EFAC 4WCEQ 4RZRA 3W9JA 1GXUA 3R27A 1N32J 1FE0A 2PC6A 1R27B 4DU8A 2VPYB 3ZC4A 5H9EJ 2Y8YA 2FJWA 2O1PA 3DRYA 4PWDB 4ZVQB 2HK2A 3LPEA 1SJRA 1FWLA 1S1XA 3IBCB 4KO0B 3K8WA 3VAJA 1REVB 3MOJB 1XJWB 1MROB 5CD4A 3KK1B 3M6WA 4PRFA 2JSXA 1RXOB 2C3YA 4X84A 3VCDA 5CHCB 4JI7J 2F4VF 3CDUA 4YR2A 4ZCKA 5D78A 2DXFA 3MM9A 4DQQA 1RQ0A 3EGVA 2E7XA 3UDEA 3H2UB 1V3SA 2UUCJ 3D6MB 1VQSA 2B6AB 2M5YA 1X0PA 1T9YA 1L3VA 1WORA 2RKIA 2IDEA 5G0RB 2JDJA 4MYUA 4IO9Q 3M8PA 4DSKA 1L3TA 3TEGA 4OIXA 1U45A 2MLYA 1LK5A 3C19A 3A8EA 2MY8A 1T05B 2DNNA 4PG8A 3Q2SC 1OSDA 2MGZB 4MYTA 4JI0F 1C1CA 1S48A 4HR2A 3M1VA 3AAWB 1NDLA 5KFYA 1WI6A 1H38A 2J8SA 5KG1A 1XMBA 2YNHA 4IH6A 4LRFA 3QGGA 3OR1B 5DDQC 2X7IA 4Q2LA 3WX8A 3CUNA 1RU1A 2VG5B 1BQNB 1KDNA 2QA4S 4MIWA 2HRYA 1NK7A 2OPRA 1TL7B 2R8GA 4USIA 2HMIB 3HSGA 1BUXA 3CCTA 3MR7A 3MEEA 4NA2A 4F3QA 1Q8LA 2CQBA 3KNGA 3NGSA 3T5LA 1W2BR 3GU0A 1REGX 2V2ZA 1YDLA 2EG1A 4Q0BB 3QGPA 1VC5A 4NA3A 4TNOA 5HMWA 2MZSA 1K0TA 1S1TB 2HHHF 1C4AA 3T41A 3KYLA 3DLLQ 2GGPB 5KG6A 1Y4ZB 4B3OB 3B4DA 1O5JA 3Q8RB 4B9TA 4C98A 3UCZP 1VJWA 5CXTA 3CJRA 3JAMY 3LTOA 4UOFA 2GCFA 1D3WA 3SCKE 4DFPA 3Q2TC 1OO0B 4NPOA 3LP2A 1RB0A 5J2PA 4DR1J 3KK2B 5I3UB 1IBKJ 2A6OA 2XGPA 4LQ3A 2H5EA 2J0WA 2V50A 4OX9J 1BQXA 3DU5A 2JZ5A 3HK2A 2D74B 3PX4A 3MGJA 3SSRA 1U0HB 4UT4A 3K89A 5JUMA 3PEHA 4PXDA 3C6UA 5L1JA 1CJUB 4A8YA 4R0EA 2QC3A 1P1LA 2J0QD 5LJ5Y 3HHEA 3V2UC 3M6UA 2Q66A 3PYGA 2IJFA 3OBIA 2EEYA 5L8RC 5BR8F 1RAEB 2FHJA 5DZ6A 2V4QA 4W90B 1IUJA 3MCNA 5EWGA 1DQAA 4P9SA 2EC0A 1S1WA 1S10A 2AJ4A 5A76A 3NRBA 2QLXA 3TARA 5F8MA 2ASYA 3VQTA 4CO2A 3K5LA 5IFMA 3KLIB 3RB4A 3VZHA 2XCAA 3HO1A 2VOPA 5D0HA 3WC0A 7FD1A 4F04B 4I6WA 2Y1RI 1C0UA 4FVCA 2CADA 1VQ5S 3H5XA 2BJ7A 2Z56B 4KYZA 5HMYA 1RWVB 3GJTB 3ZZUA 1U24A 3OJSA 2OAUA 4QPXA 2M8HA 1FDAA 2WONA 3M2VA 4ECUA 2NPIA 3IGNA 1RT4B 3LAKA 4UQTA 3KTQA 3FEYB 5D15A 4N8OA 1YJ7A 1GMWD 4ID8A 2JOQA 3NAIA 4FKXA 3G8TA 3PJ9A 4KGKA 4CH1A 5M2UA 3TZWA 2RMLA 1K73T 2V6AA 4J9PA 1ZH5A 4LF7J 4CTAB 3JAMU 3ZNJ1 1B4SA 4WFXA 1YZ6A 4ZVGA 3N4WA 4JI1F 2FJDB 1AZSB 3T1HJ 2QLJB 1VBXA 1LWEB 5IM0A 3M2UB 4YP3A 3AA8A 1EIYB 3CCQS 2K06A 2H1YA 2Z2YB 1X5TA 1IKWB 4XK8C 4AXJA 1FRMA 1N32F 3AOAA 2HVEA 2HZAA 4W98A 2HHWA 5KG3A 3IR5B 2WTFA 1M5OC 4H4KC 2F8EX 3JYTA 4CT8A 3J7AN 2FPHX 2HRUA 1ZZFA 1IWGA 5GAEU 4Q43A 4F4AA 1Z1ZA 2CNKB 2XS2A 2JEFA 1KQGB 3AJ1A 5F41A 4JI7F 4PWDA 4X62J 2V5HG 1HMVB 1U1OA 4KO0A 4AQYJ 1REVA 4UOCA 4KPCA 4BLGA 1MROA 2UUCF 5JMNA 3KK1A 5KFBA 3BKFA 5KT6A 2KFZA 2VD3A 3C16B 2R2TA 3HXMA 4XPEA 2G4BA 1UVJA 1EHWA 2E7VA 2W2OP 3UW1A 4CLPA 4LMZA 1R31A 3O6QA 1FEHA 4Q44A 1N5SA 1QUVA 4USVA 2R2RA 3WHIA 1FRLA 2QN6B 3ONQA 4C0BA 3OVSA 2QYGA 4BDPA 1U2FA 1U26A 5G0RA 3BR9A 4DX5A 5C2CA 1B70B 3VALA 3W62A 3SDEB 3PHTA 4K5RA 1T05A 2VONA 1VQKS 2HNDB 4ES3A 7AT1B 2MGZA 1PILA 1HNVB 3FDSA 3DRPA 1UVLA 1KNZA 4DV1J 3AHPA 2QA2A 1DRZA 3CDAA 1ZPWX 4NCAA 4C4WA 1KOOA 4U67Q 1H7WA 2P6SA 1TUWA 1FNXH 2KU7A 3V81B 1RA6A 1SI9A 4CI0B 4P7TA 5KTQA 1NK0A 4WPAA 1P9QC 1C2PA 2N4CA 5ETSA 2JNJA 4O23A 3MMJA 2VG5A 3V6DB 3UN3A 3BQ0A 1Q86T 2DR7A 2PDAA 1SKRA 1TL7A 4DU7A 1TL3B 1MN9A 3SV3A 2FC9A 4U6PA 3NGUA 1NB2A 3CD7A 3IRXB 2I38A 5FD1A 4ZCLA 2EFVA 2GHWA 1NZ8A 3NEKA 5DG9A 2AJQA 5RUBA 3U27A 1GMVA 4DR5J 4Q0BA 1G3OA 3F56A 4LF1A 1GTEA 1S1TA 5KOWA 2F8MA 5HJXA 2FLPA 2GGPA 4WYLA 4DN0A 2VUGA 1UFKA 2AEJA 2C3MA 4N77A 4IRDA 3OVBA 4K4VA 1RABB 4LF4J 4H4MB 3E01A 4DR1F 2NSCA 2YXLA 2ZM6F 3DYAB 1IBKF 4WF9Q 2JL9A 3FCVA 5C42A 3HT3A 5FLXY 5KFSA 3TW0A 1K0VA 2BE2B 4OX9F 3TNVA 5C25B 2W2NP 1U0SA 3CO9A 2DNQA 1MU2B 3GV5B 3OFGA 2PFDA 5CZVA 2E5GA 2R7QA 4NXMJ 3R97A 3QJJA 5I3UA 3HLUA 1CPZA 4BWJA 5K8OA 2GO9A 1RTIB 4LSNB 1HHSA 2IY5B 3H42A 1PAUB 2MZTA 1R6VA 4HH1A 3D3CJ 4K4YA 3PRDA 1CS4B 1HYSB 4JI4J 2WB4A 1YBAA 2XNQA 2DNGA 4F0KA 2EWHA 2KTQA 1SQEA 3KMQA 2XZTB 3PIOQ 4WP3A 2Z30B 1N36J 4HT7A 1YIJS 4A8OA 3GV8B 5D4OA 1S76D 1KOHA 2LYVA 4CZCA 4LSZB 3NWRA 4ZMMA 3VAHA 4OV6A 1PBUA 3NGKA 3NBPB 1LFPA 4EO8A 1BGXT 1RLDA 5KFNA 4MAKA 1EQ0A 5K8NA 3GILA 4IO1A 1YRTA 3LUYA 3TZYA 2CQPA 2XWXA 4WFBQ 2AJ1A 4I7FB 4C3KA 4M63A 1VFJA 2WBMA 5A8KB 4DR7J 4QWEA 4PCQA 2EK1A 5BYRA 1S0MA 3H25A 3CNQP 3DN9A 4QU7A 2XO6A 3R2DJ 2FC8A 1QJHA 3MPWA 2XHWA 1LV5A 3TA1A 3CJ8A 1WOOA 4CIOA 4ELTA 3H4DA 4BC7A 3PW5A 1F2HA 3T19A 1X4CA 1KFDA 1ZM2A 1JNRB 1WHXA 5E2QA 4DV7J 5IV4A 2OUGA 1YSJA 4LF7F 4GKKJ 3IMQJ 3A8JA 3Q22A 5F8NA 3TX8A 3UCGA 3BREA 1C1BA 1B0PA 1RT2B 1YITS 1NPPA 1BXNA 3DOMB 4ZVRB 2PT0A 3T1HF 2GQCA 1SH2A 1VHIA 2DGQA 4CTAA 4ECWA 2MYFA 1YX2A 3I9ZA 3R5DA 5FLXU 5CYMB 3U1MA 4IH5A 3EJMA 4OX6A 1AZSA 3HFZB 1F9EB 4ZN1A 4FYYB 3MD1A 1LWEA 1RWOB 1S0NA 1SH0A 1S49A 4OX7A 1C0TB 2GO8A 1LW0B 4RBVA 1VQOS 2V2QA 1IKWA 1XBWA 1OIAA 2LXIA 5ADZA 2HHTA 2HAFA 4J9RA 3BGLA 1N48A 2RUSA 3B54A 1PC4A 4ZK7M 1CULB 1SVDA 4LVNP 5KOXA 3NAHA 4X62F 3SI8A 1VBYA 4O44A 4DQSA 5H9FK 1FT8A 2XGQA 2OEKA 4AQYF 2MDAA 1FJGF 1APSA 2ZHBA 4EZ6A 2HWIA 3GIRA 1HBUB 5A6PA 2CRLA 4YQWA 1HMVA 4DQIA 4PZVA 3C15B 2RT3A 3LW5C 5F8LA 3GYXB 3C16A 4RW7B 1U02A 1U2CA 2GIFA 1NSPA 2DJWA 1TMJA 2HFNA 4WBFA 4UTGA 1RHUB 2KVQE 1KVKA 2XC9A 3HVRA 3N5FA 4Z37A 1T94A 2CPFA 4CLWA 3UPFA 3FEZA 4DV3F 4RL1A 1RWXB 1VQ7S 5SUHA 1N33J 1GH8A 3MMCA 3D0GE 3DRSB 2IFXA 1ROFA 2NXEA 4P2MA 4WK3A 5CYQB 2E29A 1Y10A 2HNDA 3QFWA 1HNVA 1FKOB 1UW9A 4L3NA 2XLIA 4FPIA 3H8YA 1WF1A 2A2CA 5BXIA 3V81A 4PG7A 4KHRA 4ZVFA 1X9MA 4GRSA 3V6DA 2M7SA 4ES1A 4DR5F 2CJ9A 4U8VA 3GLJA 2JLGA 4A8MP 1K1SA 6AT1B 1TL3A 1HQUB 4DPXA 4A47A 3NMAA 3FSXA 2DNRA 2HFUA 2Y1LB 4ZLJA 3IRXA 2K1RB 3Q8YA 2WRMA 4LR9A 2B7BB 3DNCA 4TQSA 1TMMA 4LF4F 3EVWA 3IC1A 3NS7B 4F2SA 1XEZA 1DURA 4WJBA 3DLEB 2V2KA 5DQIA 4PG6A 3GZ7A 3J7A1 7FDRA 4ECRA 3PW4A 2MTLA 3V4IB 5E3RA 2QMUB 4NXMF 4QYRA 2YPZA 3BPDA 3Q86A 1BQMB 2BE2A 5C25A 1TUVA 1X4GA 5HK4A 1G7CB 4JI4F 1GXTA 1J27A 2OD6A 4D3HA 2OFGX 1IKYB 3NCRA 4GVBB 3HVAA 1RTIA 4LSNA 4LREA 3AXMA 4DSIA 3SIPB 3QWPA 1U1NA 2BE7D 3T5KA 1N36F 1CS4A 1HYSA 4CLYA 1QAYA 4RUHA 2RE1A 4ECXA 4PPZA 3TAQA 2GIRA 3M9MB 5IQQA 1HARA 1WEYA 2QEXS 4X4TA 1SL0A 2VODA 4F4YA 2D3ZA 3ZFVA 4RX6A 1OPZA 1F5BA 3MPVA 1I1GA 2A2DA 1S0OA 4EWTA 3IO1A 1AA1B 2IDLA 3R5AA 1YTYA 4AD6A 1ZAVA 2DGXA 2DPIA 1FX4A 3KFWX 3H98A 3B8HA 5HSPA 1QDUB 1T9WA 1V9OA 1HI8A 5E0OA 2U1AA 2F9DA 1VK3A 4DR7F 5KFRA 1DY3A 2VBWA 3L3CA 3D0IE 5F3ZA 4NRUA 5ETNA 2HSEB 1MMNA 3CCWA 1VRTB 3O5TB 3I32A 5DLFA 4H4OB 4P2FA 1SC1B 2W01A 4KJIA 3MECB 5A8KA 3MM5B 1TKDA 4XDDA 5T7LA 2YTCA 1QE1B 3MOZA 4KGZB 4A48A 4DR4J 4Y0FA 1SXLA 3CVKA 4KQZA 2IHR1 3SCLE 4KGMA 1SJ3P 2CQDA 3GE9A 2Y8WA 5ITHA 1EAYC 3D9BA 3L7OA 4NCBA 2Q1LA 4DPUA 5J2NA 1Y5NB 4OHZA 5KT7A 3LH2S 4LVOP 2D3O1 1RCXB 4FVMA 3I5AA 1UWBB 2ATLA 3CJ4A 1CJKA 4YB5A 1RT2A 2DNOA 4FXWA 3DOMA 2BANB 3PG9A 4Q5VA 4F67A 5ETPA 4DUYJ 4WFAQ 2YH0A 1D1UA 3MF5A 2NXUA 5CYMA 3MEGB 4USWA 1ZM9A 4IRCA 2XYGB 5B0FA 1SKWA 5LXRA 1LNQA 4JI2J 3FZBA 3K58A 2YKOA 2AWZA 4I64A 4OYOA 1C0TA 1N54B 5DQGA 1LW0A 1K44A 5E41A 5D4LA 2AZ3A 1U25A 1NKEA 1HFEL 5IC4B 1LOUA 3A12A 3SCJE 4DX8H 3DFEA 3NKYA 5IT0A 3ZTOA 5HI7A 3NOCA 2J7KA 1E6VB 1AUSL 5LOQA 1CULA 3G9CA 2H4YB 1S6OA 1ZS6A 1N5YA 2QT7A 2E1RA 2O01C 3R8YA 3O44A 5KFIA 2CJXB 2XULA 4M5NA 5LJ3Y 3G96A 4I6YA 3IWXA 1FTRA 2Q6CA 1YGYA 1XMOJ 2MZJA 3ENWA 4BHQA 3M2RB 4I2QA 2LECA 4OZ3A 1OY6A 4ZPCA 3B6BA 2V8PA 2YWWA 3C15A 4USUA 2K8GA 2ZJQQ 4ANDA 1NDKA 3CCUS 4LUBA 4RW9B 2R2UA 4RW7A 1BWVA 1UFWA 1JB0C 1RAAB 3DMJB 4ITSA 4NLUA 3M32B 2HFOA 1N33F 5F8HA 1T3OA 2VQEJ 2C2ZB 2CWKA 1AT1B 1Q53A 2DR6A 4DFKA 2ZKTA 5A0YB 5D4PA 2GS8A 4LRDA 1O51A 4JP8A 4PWWA 1S5ZA 1NDCA 4C8LA 1M5VC 3DRSA 3PO5A 4K4WA 1PGZA 1TKXB 2IJRA 4E8UA 2FIUA 4USTA 1Q95G 3O8WA 2K2PA 1YHQS 4DV5F 1FKOA 4HI2A 2BOAA 3ZZYA 1UJ4A 3H4BA 2KT2A 3MMBB 1IWAA 1EKSA 2Z0GA 1X8DA 2VASA 2VFUA 1Z2LA 5DETA 4J9LA 5IWAJ 3U1NA 3JS9A 3QO9B 4CO5A 4X2BA 2LMIA 5HROB 2RRAA 1JLEB 4DN9A 3N6MA 4RU9A 1SJQA 1M1HA 2ASLA 2BBEA 2ZJRQ 3OJUA 1G1XA 1NBEB 2E7WA 5IXUA 3M8QB 3Q83A 5CA5A 3K17A 4RW8B 2X1GA 2KI2A 1P9YA 1DQ8A 1RHKB 3KJVB 1NK9A 4Q7AA 3J7Z5 1FESA 2HNZB 3CTRA 1ZYQA 3DLEA 4J90A 3AH6A 2AD9A 1K8AT 1X4DA 3M30B 1X7VA 3G86A 4B3SJ 3RW6A 2RQKA 2CNNB 4JI5J 4NCGB 3CMQA 4V19J 1KQKA 2FVQA 2XHCA 3D3BJ 2PI4A 4QZVB 2Y9HA 4OZ1A 5KFLA 4B9VA 1WEXA 2AT1B 2UUWA 5HQ8A 1XR6A 1N88A 1IKYA 2JWNA 4GVBA 1S1UA 1S9GA 1N6QB 2XQCA 4WE1B 4IR9A 2OTJS 2CG4A 2YKQA 1HWLA 2C3OA 4USHA 4MK9A 3TVKA 3IR7B 3BKUA 3JSYA 4YEAA 3W3SA 2ZC3A 3G8SA 2ZD1A 1RA7A 4JUZA 3GCXP 1X4AA 4FYWB 4M5GA 2YNFB 2W9BB 4KFBB 1S6PB 1RWPB 5AE1A 3FMBA 1RAOA 5GAGU 4WZMA 3LALA 4LFBJ 4AL7A 1QM9A 5F9LA 5HANA 4IUFA 3G87A 5DG8A 1ZBTA 3QATA 5B0BA 2DGSA 1PKUA 1GT8A 4DR4F 1VRTA 2DD8S 5F0WA 4LFAF 2DTJA 2HKEA 4LF5J 3MM5A 4J9QA 3R7NB 1UZDA 4MJKA 2F9JA 2VFVA 1RDRA 4C8KA 5EWFA 1RAGB 4DV4J 4DFMA 1JNZB 4ILRA 2QLFB 2XZDB 1YG0A 3AB2B 3RGIA 1FFWB 2KH9A 3CCVS 1NCLA 1W2IA 3SSSA 3PHEA 4ELVA 1LKZA 4OV1A 4ANEA 4DQPA 3AFGA 2VL1A 4NI2B 2I6WA 4YHHJ 4CO0A 1S1VB 2H3EB 4O3SA 4DOZA 2MHNA 1YJVA 5HL7Q 1GK8A 1DJ0A 4JI2F 2JEIA 3DOLB 2MJUA 2OD4A 2BMBA 1NKBA 1YBUA 1RLCL 3MEGA 2G0JA 2RD5C 2AYGA 2PA8D 3GCWP 4AE5A 4YN3B 4PPDA 1PCAA 1VISA 1J5OB 4ERDA 5T41A 3P6YC 2F1FA 1NHKL 2MQNA 3TX0A 2VC1A 2OEMA 4DG1B 2IRXA 2I9SA 4JV2A 1WHVA 4P72A 2BKOA 4JB8B 1X4BA 4RO0A 5B0AA 4ED7A 1VIXA 1IKXB 3I5CA 1E6VA 1XMOF 4NRTA 4JV0A 5K9FA 2YKAA 4AL5A 1L3KA 4IFYA 3CD5A 4RNMA 3TANA 1R0BG 2V0NA 3AOCA 2F63A 9ATCB 4QU6A 1QVFR 1WG1A 3LF0A 4DLEA 3M2RA 4MFBB 2XMTA 4D3GA 5LL6d 1NKCA 4F8RA 3DKDA 2UVVA 3I9V9 3HHDA 2YWEA 4QWAA 2VQEF 3E2EA 4ZVTB 3BDPA 2FVCA 4RW9A 3B4MA 2DHXA 1N8RT 2XSJB 1IVZA 4ZN3A 4UZBA 3PYEA 3D5MA 3UDCA 3GB0A 2E5LJ 3M32A 4M1KA 5F8GA 2Z4PA 4PG5A 3ZTPA 1KHVA 1WG5A 3HVTB 1FF2A 1Y00A 2MQOA 3MR6A 3DLKB 2UUBF 5A0YA 3KLVA 3DU6A 1PYSB 1MG7A 3VGSA 2HBYB 2NXNA 4HLBA 1PSDA 3K7RA 4NMLA 4NLDA 2YQ0A 1TKXA 4K8RA 4TN2A 3D1OA 3C14B 2ADBA 3TUZC 1UEKA 1IR2A 4Y2AA 2B56A 4LQ9A 3BB5A 1D09B 3EDRB 2V4JA 4DZDA 4YUDA 2CQ4A 1VQ4S 4FP9A 2FZKB 3D28A 3MZIA 2J5AA 3GQCA 5L9NA 2N4DA 1D8YA 3QO9A 1S12A 1OPIA 3W2WB 2KG0A 5E5NA 3HHLA 1A7GE 5HROA 3HKWA 4M5DA 3UQSA 1JLEA 2G2ZA 1M1KT 1RKIA 4Y2CA 2RH3A 2GV1A 2WVBA 1D9FA 3M8QA 4DQRA 2P6TA 2YVSA 8AT1B 2IRYA 3CXCR 4RW8A 2Z57B 1XNRF 2E9RX 3L9ZA 3HPOA 2B8QA 4H4KA 4B3SF 3JSMB 1Q79A 3H59A 4JI5F 3GFYA 2ZZNA 2DT9A 5DM7Q 3ILJA 2JH3A 3CC2S 3A8KA 4RNHA 1VIOA 3CCJS 4L75A 1ZZNA 1R7IA 3M30A 1FNMA 1WI8A 4I1TA 1B7FA 3SZ2A 3QLHA 3PIPQ 5GAEI 3O3LA 4A8FA 3PTWA 4NCGA 4PYDA 2K3IA 4K0KF 3OSPA 1SUQB 1D8ZA 1W7WA 4DZ6A 4CYUA 2M52A 1T0TV 3EMTA 2OSQA 3EZ5A 4RW4A 1PG5B 2J8AA 2QLWA 3D54A 3G8QA 1N6QA 3P5BP 4WE1A 2IPOB 1GEHA 2YWFA 4OJGA 3QT6A 1Q1KA 1ZTTA 1RBAA 4DSJA 1SC3B 2MKIA 3KKFA 2J6TA 4LFBF 1IJFB 2V8VA 5F0UA 4P73A 5EDWA 2CJQA 2W9BA 3KLHA 4KFBA 3UN2A 1EETB 1FRKA 2CYYA 2RB7A 1TVRB 2XEXA 5DG7A 1NSQA 4PABA 4PUOB 3EXCX 2AEFA 3EVMA 3LWLA 1WF2A 2EBGA 4LF5F 1VQPS 1YWXA 2CG8A 4ZJLA 5FDLB 3ZNUA 2DCUB 3FZ2A 5B0CA 2C2RA 1SKSA 4DV4F 1HBNA 2DRBA 4EYHB 2R7TA 4DV0F 5A8RB 3TAMB 2QTWA 1URRA 2D41A 2VFTA 3MD3A 2Q6BA 2AF6A 4CM2A 3J7YU 4LRBA 3R9LA 5CAAA 4G1QA 2OEJA 3IWNC 1QAJA 1M90T 3BO2A 3K2YA 4ZDNA 3C66A 3G6VA 2Z2MA 2QG9B 4C8YA 1MLAA 2HAIA 5D4NA 4YHHF 3AD9C 2ZBIA 1FTCA 3T5HA 2AYBA 3CDEA 3HI9A 4OYZA 2ZH4A 2FTRA 4RW6A 4QWBA 3OSNA 3TR5A 3HSDA 4W4MA 2H5JB 1CC8A 2PE8A 4NI2A 3OFHA 2ZOGA 1S1VA 2IBOA 2ZKUA 4QWDA 3OL7A 4IDKB 5IZHA 4EK2A 3NGRA 2MZ1A 1WC6A 3EX7B 2OTLS 1TK0A 4B9LA 3Q8PB 3RRHA 3CF5Q 4CH7A 4F4WA 1R43A 2YNIB 2CQ2A 2O67A 2DNLA 4E2FB 1VMBA 3KJNB 3P96A 4IYQA 1FXDA 3N5BA 1N52B 2IMWP 2AGOA 4NYZA 3BGFA 3F73A 3M9NB 1GQEA 2PFFB 2KZMA 1WEZA 1BWEA 2P9GA 3MUTP 3MM9B 4LIWA 3D66A 4NOHA 3QMQA 4NLRA 5KFKA 4ZVUB 3OXGA 3K5MA 2BJDA 2F4VJ 4F4KA 2FQQB 4EZ9A 1X4HA 3OPKA 3M05A 4QW8A 3HVWA 2MKSA 4ILLA 1EX8A 2ZH3A 2OI2A 1YRUA 3ET6B 3H5YA 4RNFA 1RAJA 4F0MA 2WSCC 4ILMA 3CJ0A 4GO5X 3M1VB 2LXFA 4PXBA 4C6AA 3C2PA 5HQMA 1SCJB 2YNHB 1ZAXA 1I6JA 2QA1A 1ZA2B 3AXKA 3RTVA 1T9TA 3GJRB 2MQPA 2XY5A 1O0PA 3DLKA 4IOAQ 4O4GA 1QD1A 3N79A 1IR0A 3VGVA 4K4XA 2ZOFA 3MWBA 1CQNA 2YQ3A 3CSKA 1R89A 5HVFA 4HVZA 3HZGA 1FJCA 3WX4A 3I6PA 2LVWA 1KVJA 4QIGA 1JMTA 3CCRS 2CQ0A 3PZPA 1H0HB 2XSFA 3JSRA 4TLQA 3CCLS 1EP4B 1AFIA 4GO7X 4CO4A 2QFJA 5KFCA 3R6LB 2DHSA 3ILLA 1JLAB 3T6BA 4DSEA 4Y00A 1VBKA 3D1QA 4QR2A 2HHUA 2BRLA 2CPJA 3Q23A 3MI7X 2IMOA 3BN4A 4YR3A 1DFDA 2OGUA 3K5NA 3LP2B 1V6HA 1F5AA 2C2EA 2J9CA 1F3VA 4NLTA 4Y3CA 4ECVA 3P8BB 3NP5A 4ID5A 4F26A 5K20B 3OR2A 2RQCA 2PSZA 2EFQA 1HNZF 4IG0A 1E6YB 1U1LA 5KFGA 3C6UB 2BKNA 3CW2C 3Q8UA 2NS1B 1GNKA 2ROPA 4K7QA 3MR5A 4DL6A 2ZZMA 3QAUA 1SUQA 1TR0A 3TVYA 1WC1A 3IFEA 4BC9A 1MMDA 1SQFA 2VU5A 2A0FB 2AKWB 4EYIB 3US5A 4M5MA 4TYAA 4TU8A 2VJUA 1S1WB 3ELHA 5AJ3J 3R3TA 5BR8J 3NS5A 4QWCA 4DF4A 2B9YA 2JFKA 1JKHA 3QNWB 2MMYA 1M0SA 2ZH5A 4DV2J 1QSYA 4DUZJ 2D1CA 2IC3A 2KDOA 4YR0A 5ETQA 1RTJA 2BJ1A 3CT9A 5LT5A 2EFGA 2LQ9A 2BM0A 4WFYA 3T6JA 4ECZA 5IV3A 4DLGA 2BQ3A 2CA9A 2JRSA 1TVRA 3I4PA 4PUOA 3OT9A 1UMJA 1S72S 4J9VA 6FD1A 3PJWA 2KL8A 3HSJA 2UVWA 4DCPB 3H2VE 3FQKA 1FRHA 5FDLA 2C2KB 3OL8A 1PJ7A 3W8GA 1NSAA 2V8DA 3QGHA 4DWIA 5GAHU 3TAMA 4HHHA 4B3TJ 4U96A 5F8IA 3LQVA 4ZPTR 2VBZA 5DZ7A 3R2CJ 1DARA 3AB4B 3FMWA 3UDVA 1QUPA 3VVUA 4PXEA 2VF3A 2CXEA 1RACB 4P74A 4JI6F 4OL8A 4YS2A 3DC2A 2M3DA 3QZ8A 3GR0A 2AHOB 3CCMS 4K5SA 3TO8A 2ZE2B 2YWKA 2BZ2A 3IG1B 2IA0A 5DJBA 4OI6A 1A6LA 1CJVB 4KBIA 5B0GA 4IDKA 3R7SB 5GMDA 4NEYA 1HW9A 2FLLA 4E98A 3M4XA 2R7SA 1SJ4P 4QOTA 2DB1A 4ZLNA 2YNIA 2IA6A 3VV2B 3PY8A 3IAM9 3IN5A 2QV6A 4K4ZA 4JV1A 1NJIT 5L46A 2BABA 4DSFA 3SEOA 3RAMA 3V5RA 5BYSA 2JC0A 3BDEA 4FYXB 4OI4A 4WIQA 2BA9A 2VHGA 3AQPA 3CWJA 4Y34A 3TAPA 2HLTA 3PYDA 3LP0B 1WTBA 4C3MA 4P2XA 2M88A 4ZPVR 3KJFB 1T3NA 1H3DA 2R8JA 4N5SA 2KFNA 5J2MB 4ATNA 3TJAA 3OFFA 1KP6A 2O5DA 1HKAA 1S9FA 2DKOB 4AL6A 4F4ZA 4HT5A 3ET6A 1Q16B 4OZ5A 5D0RA 4QR1A 3DRPB 2AYEA 3F44A 2C42A 1RADB 1EQMA 4B3MJ 5KT3A 4ZPBA 3LAMA 3V4MA 2AQ4A 1FNOA 3CULA 3D6HB 3W5XA 2ZWOA 5L1LA 4DMZA 1S99A 2WVDA 4Z2XA 4EUVA 4U7CA 1WJ9A 4C8ZA 2W24A 1VRUB 2PMHA 2WCXA 4X64J 1O8BA 5B7WA 3FSIA 5KFTA 5I42B 2L9DA 1NZAA 2ACYA 2L3MA 4USJC 2ERRA 3ISNC 1F0XA 1X9WA 2GMHA 1JXVA 5EUHA 2V68A 1RT5B 1EP4A 4ZCIA 2XM3A 2XYPB 5KG0A 2WAQD 3GPAA 1JLAA 5IT9Y 2P9CA 2G13A 2HZCA 5D77A 3FBBA 3VAMA 3E01B 4DXLA 1WC4A 2ZBRA 1HNXF 1S97A 2DISA 2MKYA 5C42B 2B9XA 1FE4A 1F60B 3VAIA 2GVDA 1RGVA 1UW4A 4F2RA 2HIQA 3W2VB 2IM2A 1XMQF 3OTCA 3UR0A 1NJYA 4CP5A 4FF4A 2ZM6J 4LF6J 5GMKa 2R8IA 3CJ3A 2V9KA 3JTPA 2CPXA 2KM8C 2IM1A 3C8YA 4Y6IA 4U7UD 1E6YA 1JQGA 2RUGA 2CQIA 2RHQB 2HVZA 3P4UB 4IRKA 3PFOA 2WVFA 4DS4A 3G6ES 3IA0A 1OSCA 4NZ7A 2G9OA 1VK8A 1Q78A 4QCLA 4KB7A 4WTOB 1R8CA 5AJ3F 4IOBA 1WDDA 3FVYA 3TWZA 3QZ7A 2YH1A 3QBCA 4ANCA 4DV2F 4DUZF 1WELA 4NXNJ 2UUTA 5IQ6A 5AE2A 2VA3A 1HPZA 1A9NB 2HQIA 3D4JA 4EGLA 2JJ4D 3R5GA 4KR0B 4X4PA 2XY7A 5C5JA 2QGFB 1WG4A 2J9EA 2BVZA 4N76A 2VICA 4CO1A 1IKVB 4C9DA 5J1EA 2DK2A 4R5PA 3OLAA 3I0SA 4QIFA 4P10A 3OTEA 3GV7B 2EW9A 1M5SA 4KTQA 4M5KA 1FXRA 4Z7CA 2ZOMA 3GWCA 2IIHA 1GMWA 1V3ZA 5IT4A 4CH0S 1UCNA 4WKYA 4B3TF 4U7UK 3VWSA 1ELOA 4EBDA 4BCAA 2CPIA 1C1BB 1VDHA 2ZDPA 1R8BA 3D67A 4ENOA 5IT9U 2E1CA 4PQAA 1Z2ZA 4NZ6A 3NLCA 1UVNA 3D6TB 4CWBA 4F7VA 4KHPJ 2I2YA 3FK4A 3KUEA 2O66A 4URQU 4WU2A 4K59A 1H2VZ 2CVIA 1X9SA 2ZFHA 3N6NA 4ZVPB 4LR8A 1FRIA 3HHLC 5CCLA 5FJ4A 1KLMA 4CLZA 3GJSB 2QA4G 2CQCA 1VC0A 3MUVP 2HFSA 4OZLA 3H0PA 3J81j 3MURP 1RT7A 1Q8BA 2ZE2A 4DF8A 3IG1A 2X1FA 3E3XA 3ZZOA 1U6FA 1JJ4A 4EMDA 1CJVA 4RPFA 1I94J 2I1RA 4O44B 2HHQA 2W8LA 1MMLA 1RBLA 4KH0B 3LANA 1S4FA 3TUIC 4M5JA 1HL6A 5KT5A 1U49A 5B09A 5DDOC 1JK9B 4DX6A 5KFZA 5KG4A 2W2PP 1B0VA 1FJGJ 2BX6A 4B9SA 1N5QA 3S1TA 1Y7PA 4I68A 2M4MA 1R3NA 3E8OA 4GC7A 2VH7A 1PJ5A 4YB6A 1FK9A 3ILIA 3ITHB 5HQLA 4B3RJ 5CYJA 3LP0A 3GFZA 5K5MA 1PYOB 5KFQA 3UI3A 2ASDA 1YKWA 1FWKA 4J9SA 2CDRB 2ALZA 4WK1A 4UOGA 2UZAA 2DY9A 1FERA 5J2MA 1JLGB 3MMCB 4B3MF 1PIEA 1IBLJ 1H6KX 2LA4A 4QQBA 1T8EA 5GAGI 1UVIA 5HVHA 2G1DA 1SB6A 4DV3J 4NLQA 4X4NA 1X60A 1DTTB 1SJFA 4X65J 1AW0A 5HLFA 3IGVA 3MCSA 1U1RA 4HYKA 3VR1A 5A2QY 4M8LA 4IR1A 1RTDB 4X64F 3PEJA 1ZM4A 1RUSA 2VA2A 1JLFB 3W65A 1DAXA 2Z58B 2MKJA 2Q3PA 2ADCA 5KFWA 2KKHA 3HM9A 1S7IA 5SZTA 1B0TA 4NMXA 2V2VA 2RRBA 2UXDF 4CLKA 1S0VA 5A6WA 1U47A 1VRUA 1HWKA 5H9EK 4DUTA 1TELA 2R42A 2OP5A 4LIRA 5I42A 1BHNA 2YX7A 2PD1A 2FJEB 2EXUA 4FPRA 4OFZA 1RWKB 2XYHB 6FDRA 4ZP9A 5L9XA 2BJ9A 1FX2A 1RT5A 2FGCA 2BV3A 3FQLA 4TVAB 3W60A 3TOQA 3KG1A 3TZZA 2HPUA 4NYPA 3JTNA 2NZ4A 3N28A 1U2RA 4P7VA 1YJRA 1MW7A 3CCSS 1OQ6A 4UY8T 3A8IA 1JXLA 5HAOA 2R7RA 3CJSA 4LF6F 4DPYA 1HWIA 3P45B 1N34J 1P6TA 5GADU 1KTVA 1NK4A 2XTJP 5CD4H 1GMUA 3PFEA 1CJTA 2B5JA 3W2VA 5JJBA 2NQPA 4BWMA 2RJZA 1HNIB 4M5HA 4CQ1A 1KBRA 3L4BC 3I96A 5J2QA 2CVEA 4KAIA 1JIHA 4R25A 3GIMA 3B78A 2XMMA 3BH7B 3ETMA 4C97A 1TFWA 3CCZA 4CM0A 5HMZA 3GYGA 3AD7C 4B17A 2GQ2A 4GKJJ 2MZQA 3DRXA 4G1PA 3VAKA 5J1NA 4UY85 4ICLA 1LW2A 1WKLA 2ZH2A 4NXNF 1B64A 2ACMA 3G82B 1NH8A 1VGYA 3CPWR 4A8KA 5KFVA 1P1TA 2IM0A 1KKHA 4AYBD 2HQFA 1NRKA 4NLSA 3D2WA 1CLFA 2W2MP 4QJVA 3VAFA 5A2QU 2GVZB 3M9OB 3W5ZA 3OTBA 2KXHA 4HL9A 4LFCF 2MLXA 3K0JA 5EX0A 2YNGA 1KQFB 1FCAA 1IKVA 5K8MA 3BV8A 5F8JA 2ALYB 2C1EB 4HI1A 5T7LB 2BYCA 2XS5A 1NJXA 2XY6A 1L5UA 4LF8J 2DH7A 4DEZA 3BEGB 3DDIA 2LQJA 2L9NA 4HACA 3BS9A 4YY3J 4WP8A 4OI1A 3BQ2A 5EGYA 1LEOA 1KR4A 1SQGA 2B3TB 9RUBA 5J2NB 2VZ9A 4KHPF 3I5BA 2LA6A 2E44A 3CMAS 1BY9A 2XCPA 1OWXA 1NEEA 3T3FA 2DIUA 2GAHC 2JC1A 1CJKB 3BQ1A 1N5TA 4GC6A 1NPRA 2FY1A 3ENAA 2RDDA 3S01A 1B3TA 3JB9k 1QAXA 1EARA 3CDWA 3W64A 4OYAA 2MQMA 2CPYA 3BKTA 3OL9A 4AFFA 4CNZA 3LP1A 2GIQA 3QPIA 2YBVA 2VDIA 3ADAC 3NGTA 1CBKA 4M95A 2VG7A 4ECQA 2AGQA 4CLSA 2ZVIA 2RS8A 1W25A 2D9OA 3BO3A 5ETKA 3GFHA 1I94F 1PYTA 1XERA 2XMUA 3SFGA 5AXMA 3N0VA 3U1LA 2YPYA 4KKOB 2BW7A 1N5YB 1UL3A 5E3QA 2W9AA 3MXHP 1DHMA 2W4PA 3IP0A 3SFUA 1FXLA 2QMXA 1O6XA 5DO2A 2OMLA 5LMUF 2BDPA 3PW0A 3I82A 4RWXA 4C3LA 1IQZA 4I2QB 1RK8A 4FDFA 1NM2A 3SQGB 5EHHA 3DGVA 2ZBQA 4O3RA 4B3RF 1JLBB 3KUHA 5E7OB 2Z2ZA 3CDBA 5KFUA 5CQGA 2DCLA 2DGTA 2PO4A 4F3OA 3ITHA 1TAQA 2DNYA 2GJIA 2MSTA 3BGOP 3HDSA 1IBLF 1TV6B 1LWFB 2Z2LA 1KONA 4MKYA 3K8VA 4O3QA 3VF0B 3CD0A 3VGTA 1KLNA 1FVSA 1YBTA 4X65F 1KRPA 1V3RA 3BF4A 3BYPA 1JLGA 4C0OC 5GMEA 2KJWA 1U09A 4B9NA 1DZ5A 2HVDA 1DTTA 4I67A 1HIYA 4ALZA 2QMWA 2OHDA 4DPWA 1H7XA 4XDCA 3MTJA 2DGVA 1RTDA 2GX8A 2KFYA 3W63A 3HMJG 1NHVA 2POKA 1JLFA 4A8SA 4K2JA 2KHDA 3UD5A 2XLJA 3DCAA 4DV5J 5KT4A 4Z7YA 4OHYA 1ICEB 1FDDA 2EPIA 2RNEA 4FF2A 3J7YI 2QZ8A 3OV7A 1XR7A 1TK5A 4F0HA 4DBQA 4X4SA 2HNYB 4CDIA 2CPEA 1IXKA 2IVYA 1N0UA 4NWBA 4NE9C 2LCWA 2G2YA 3NNCA 4RBTA 4A46A 1NK8A 4C0HA 1UEUA 4DR6J 3ZZZA 1Y0HA 2HQDA 4WFZA 1N34F 2HQ3A 3TVZA 3UR3C 3KXDA 1D9AA 2OFHX 4IG3A 1QLNA 3QQCD 1QSLA 2VPWB 3TA2A 1NDPA 2HRTA 2V4RA 2OH2A 1OY8A 2HS3A 2QL7B 1SIZA 3CIZA 4ETXA 3H2LA 4NASA 1KN6A 3UVJA 3BM7A 2GFFA 4PWUA 2DH8A 3FGVA 3PCOB 4ZLLA 4ZITA 2WVCA 3GTYX 2VB6A 2NYIA 4X4QA 2F4FA 5LM7E 1HNIA 1IQTA 1TKTB 2KJVA 4GKJF 1S1UB 1S9GB 3VHQA 1KWMA 2V8HA 1FWPA 4O4RA 3BBCA 1PO6A 5EN1A 3Q8VA 3CC4S 2F7VA 2B9EA 3PVXA 3IM9A 3FNNA 2I5JB 3PYFA 3OL6A 3G71S 4A8QA 4OI2A 3KDOA 1BLUA 5HO4A 3FC9A 2ZD1B 1UA1A 4ELUA 3G82A 2NXJA 1RCOB 2ABYA 2MHEA 2YWGA 2RIJA 3VAGA 2MKCA 1JJ2R 2DNHA 2HVIA 4YOEA 3DLHA 1KFSA 4Y2MA 1VQLS 2KYXA 4B9UA 2WVEA 1HBMB 4JI3J 1BMQB 2ASJA 2HURA 2RILA 1FO1A 2GVZA 3IBWA 1JJHA 2EFOA 4NLXA 3ZZRA 4LF8F 3TA0A 4O3OA 2CQHA 1S77D 4ZVEA 1QVGR 1TK8A 4LF9J 3VVTA 4YY3F 4DHVA 1M5KC 3MR2A 4CLUA 3BGUA 2XMKA 5DRKA 4LFAJ 2IRUA 4XAKA 4HTJA 3A13A 3M7VA 3ULHA 1S59A 4GVLA 1NO8A 1OY9A 2RF2A 1YJWS 1KTQA 1D0EA 5ETMA 4OJ3A 4WYWA 2XMVA 1F9FA 1R8HA 3BO4A 2MKHA 1SKUB 1VS3A 5ETLA 4FBUA 3BGRA 4L73A 4DL2A 4ZOSA 2G0CA 1MWYA 4ER8A 4K4UA 1RTZA 2CDQA 5ETRA 4JI8J 2ZWPA 1VLYA 2ZNZA 3I55S 1DBDA 3S8SA 3FBCA 2ZH9A 2VPXB 2VIHA 4NLWA 2LLZA 2CZ9A 4J91A 4IQXA 1S6QB 2WOMA 2HFZA 4OJ1A 4C11B 5IC6B 2IM3A 2VFSA 1XK8A 2KVIA 2LEPA 3H40A 2KM8B 3ETOA 2ZEJA 3Q8QB 3DI6B 4UF4A 2FHJD 1OMSA 1I5OB 4IFVA 2BEFA 3L7UA 1WD6A 3ZO7A 1WWHA 4G6VB 2N82B 4KKOA 3DLJA 2B0GA 2VPZB 4XIUA 3THTA 4IFYB 3DLBA 1XTZA 1TL4A 3DHWC 2G2OA 5CCMA 2ZH6A 1LWCB 1NPKA 4KGXB 5B0DA 4NLGA 5H9FJ 2ZVSA 2FVPA 2GMLA 2CPHA 1K1QA 1HWJA 3SQGA 2DH9A 1JLBA 1FFGB 2FHMA 3HJVA 4DL3A 3VZIA 4C8OA 1XQIA 1UZHA 4OI3A 3SMZA 1JJCB 1VOMA 2B4VA 4MMOA 3CD6S 2NCKL 2NYHA 3OW2R 4ZJOA 2FVSA 1TV6A 1LWFA 2MJNA 3NWGA 3C46A 2AMCB 1Y11A 2YWHA 3M6XA 1CEZA 5HBMB 1JXEA 4B9MA 2ZZTA 3AJDA 3NCPA 5KFHA 1IJEB 1XNQJ 2V69A 2P2CB 1VQ9S 2FB0A 4G1IA 3EYZA 5MAOA 2V63A 4EBEA 2AGPA 2H5IB 4OYBA 4LSLA 3LPYA 3DXBA 3CIMA 4WTYA 1KHWA 1MWQA 5KFFA 2UUBJ 1NU4A 1SPBP 2HVHA 1GTHA 1RT1B 3T5JA 3KLEB 2X51A 3GIKA 3D7SB 3K57A 5KFPA 2V4JB 1VQ6S 2RU9A 3OUYB 3HX9A 2PN6A 1Q7LB 1ZPVA 5GAHI 1AYEA 1Q82T 4RR5A 3PO4A 2J7WA 4MK7A 3THPA 2LXUA 1T7PA 3PX6A 2WW4A 2BE9B 3LWMA 1CVJA 2IVFB 2ZITA 3HHLB 4ZIWA 4ECTA 2R2SA 3CB4A 4KRWA 4M5DB 2WW8A 2YKMB 1XR5A 4DR6F 3EGWB 4YDXA 4AT1B 2HNYA 1IM6A 2R7XA 3NCQA 5JXSA 1UA0A 1OJ4A 3EPGA 3NGDA 1QY7A 4A8WA 4G3IA 2GC8A 3T9NA 2CKWA 1YRXA 2R4FA 4ZKAA 2KXNB 5AE3A 3C3LA 2FD2A 1UKUA 2HGMA 5MLCV 4Y28C 1XNRJ 1EB0A 2OPQB 3MR3A 1G4CA 3QLHB 2A18A 3A4TA 2R7OA 4RKUC 3FBFA 2B6AA 4OQJA 3WDOA 3JXOA 1HHQA 1HD1A 3BSNA 3QFHA 4KV8B 1U4BA 4EI2A 4CYUB 5KFDA 1WOPA 1HR0J 4QIVA 4PEOA 4RW4B 1TKTA 3I56S 1YJ9S 3FBEA 2X1AA 4K0KJ 4LJMA 2FZCB 5HN0A 3QIPB 4MT1A 1VCTA 2X3DA 2W4DA 4KH1B 3CJ5A 1HLWA 2AW0A 3GIJA 3MEKA 4OHXA 2FJVA 4Y2KA 1FD8A 2I5JA 4U95A 4IOCQ 3PJXA 3DDNA 3OR1A 2KXFA 4ED0A 4JI3F 3KLHB 1BQNA 2C28A 1GX6A 2OIHA 3QSYB 4NX9A 2GAGC 2AJ2A 2B4UA 3J81Y 3CMES 2HMIA 5F9NA 3H20A 5ETTA 3H90A 1HBMA 3JSBA 2R3VA 4LF9F 2IVMA 4QW9A 3L95X 4Y65A 2NXCA 3KG4A 2M2BA 4TU7A 3HT0A 3CE8A 4OZJA 1LQ9A 4RUCA 3OLBA 2CPDA 4ZA1A 2NR0A 3D68A 1HBNB 4J9UE 5L1IA 4B3OA 2R8HA 4MIBA 1PBAA 2A3JA 2M0GB 1UTAA 4G1QB 5I3QA 3EICA 3NY0A 1WKKA 2LP4A 1Q5VA 4DV0J 4PQUB 2DGUA 2VOOA 3KWMA 2P9EA 2IYIA 4WXOA 2B8PA 2VBXA 2J9DE 2VQFJ 2F3JA 1X5SA 1W26A 2EK6A 5D3GB 4JI8F 1S79A 4WWSA 1YJUA 2K7JA 3CGIA 5D0GA 4RW6B 3KK2A 2D3UA 3M8RA 1KS2A 1ITPA 5D8HB 1HNWJ 2BR0A 3IAS9 4DPTA 1ZAWA 4NLVA 3OD2A 3W66A 3TYTA 1U0HA 5D6GA 4KPYA 2XO7A 1CJUA 3TUPA 3KLFB 2NSBA 4ECYA 2DNKA 2W1BA 2D7SA 4QR0A 3TEHB 4CLFA 1S6QA 2GNKA 4FN5A 4WXWA 4C11A 2LU1A 4ZP8A 5GVQA 4F4XA 1VR6A 2NZCA 2B51A 2GJFA 1FHTA 3G6XA 1N56A 3QJLA 3NG8A 3K59A 3DI6A 3UCUP 1LXJA 5U47A 3W9IA 2LFVA 2MY7A 2LQ5A 1G6BA 2DNMA 2MLZA 3PRVA 3D1HA 5L1KA 3OTDA 2F5GA 2IAJB 2UXBJ 3KLIA 4DL0C 3W9HA 2GZOA 1LWCA 1PJ6A 2QO3A 2JEGA 2B7CB 4TY8B 4DR3J 4FF3A 3O1LA 2HQCA 2VC0A 3GYNA 1S4EA 1P27B 1WC3A 3J81U 3OQ2A 5DLGA 1WC0A 1RBOB 3X1LB 1QAIA 3N9UC 2RHSB 3TJ8A 3V6JA 1UPMB 2AX1A 2ZJPQ 3R5BA 1RT4A 2HYIB 2G0IA 4JYAJ 5DGBA 1T9XA 1XNQF 3DXSX 5E3CA 3OVAA 2NPFA 5K8PA 3FFIB 2ROEA 4N47A 3BPSP 2E5IA 2KYZA 2GA7A 2RS2A 2Y0BB 5HBMA 5B08A 4OLPA 1F3FA 1FI4A 4OJHA 3GFXA 4O4GB 5LSOA 4HDHA 1GFWB 2K7KA 1NXIA 3RAXA 2A1BA 2DRDA 4CCHA 4WP9A 1NLKL 1TFYA 1UEVA 2FLNA 2GHVC 3MPYA 3TQ1A 1RT1A 2E5HA 4ECSA 3M2UA 3KLEA 2EVZA 3DLGB 3MM7B 5EX3A 2UUAJ 3GR1A 1U8SA 3OUYA 2DHAA 1HI0P 3Q89A 4X4OA 5L38A 2GJ2A 4X66J 2LDIA 2RRNA 1YI2S 2JHEA 2MSSA 4HDGA 4OI0A 2H9ZA 1U8WA 2B43A 3S7RA 5AXNA 3AT1B 2O3DA 1SC4B 3KJQB 4ED5A 4ZCMA 4CO3A 2YKMA 2CJKA 2DIVA 3ZTQA 2I0XA 1YQHA 2HHXA 2KT5A 3HP6A 5HP1B 2J6UA 4TXSA 1ZA1B 4M94A 3RG6A 4ID5B 1BE4A 3OR2B 3BN7A 3WC2A 3MM6B 2HHVA 2H54B 2OKQA 2CWXA 2E1AA 1XC9A 4IG0B 1ULRA 1Z4UA 1R8AA 4O0IA 2UXCJ 2OPQA 3KUGA 2AJ0A 5DS7A 3PX0A 1HR0F 3T9ZA 3EZOA 5BYQA 1S57A 1SL2A 4MKAA 3G6YA 4ED3A 2CIMA 5AT1B 3QT8A 1HNZJ 4KV8A 4DV1F 4R0JA 1OYEA 3FCWA 3WZ0A 1M5HA 2SXLA 2EFPA 1SV5B 4OLOA 3RZAA 5HATA 5A8WB 2J7UA 4HKQA 3SDEA 1HQEB 2MKKA 1U7LA 3TRGA 3QIPA 2OO4A 3GSDA 5K14B 4G65A 2C3UA 1JKHB 2HK3A 2UV8G 2BUNA 4ZPAA 3UNYA 2IC3B 4I6AA 2QIFA 4MTPA 4PAAA 3RBXA 1ZOTA 1QSSA 2A6MA 1RTJB 4J5OA 4EBCA 2MQLA 1L3UA 3TQEA 1Q8KA 3GONA 5B0EA 2R7UA 3KHLA 1U1QA 4ZIVA 1FDBA 2LQBA 3K5PA 2XB2D 3GG0A 4LF2A 4TY9A 4UW2A 5C7PA 4GMKA 3RUBL 2LU2A 3DGPB 8ATCB 4DR2J 3M8SA 1LFWA 3PR5B 3MPDA 1U6ZA 5DDPC 2P8IA 4N7TA 5C24B 1RWMB 3PW7A 4JBCA 1QTNB 2VQFF 2HGNA 2DHGA 2OPSB 3V6KA 4ED2A 3LOUA 2BW2A 3CJKB 4H4MA 3WIVA 4X4UA 1CC7A 3RR7A 2I8EA 3DYAA 1NAQA 3UO0A 4PQUA 4URSA 3UD4P 1HNWF 4EO6A 4MKBA 2XLKA 3G2XA 2DPJA 1MU2A 1X0FA 4Q2MA 2HIYA 4LBPA 4J9MA 2FVRA 5D3GA 3BR8A 2C2DA 3QAEA 2BQRA 3PKMA 4U8YA 1SBRA 5KFJA 2R7VA 4KHMA 4F25A 3RB6A 3P3DA 3KHRA 1ZTWA 2Y1IA 2DR9A 2NUUG 1RT3B 4JI6J 1RHQB 4QPTA 2AU0A 1PAEX 3HSZA 3VQSA 3JQJA 3WQPA 3CC7S 4K4TA 4JV5J 3BSOA 4DI6A 3MAQA 3CJQA 2HG4A 3HJFA 3P49B 3Q8SB 5GADI 5T14A 3KLFA 1FEEA 4L72B 1S6UA 2OPPB 5LMNJ 1VJQA 4KGVB 4FS2A 2AV5A 2ATCB 4U9RA 5KAKA 2RDJA 1QTMA 1U1KA 3N01A 4TU9A 2ZBPA 3ENVA 2UXBF 2WK4A 3RB0A 2QSFA 4WZQA 3W8PA 3NBPA 4K50A 3KK3B 1RWWB 4ZLPA 4DR3F 1GXLA 1J5EJ 2APOA 3OHBA 2EC2A 2IAJA 1L3SA 3R5CA 2ILZA 4I7FA 1B99A 2UVRA 2P5VA 4ZJQA 2PA3A 4PR6A 4TY8A 2E1MC 1RHJB 2QE5A 2HBQB 4CLTA 2FHOB 2QL5B 4S0MA 1HA1A 4DV7F 4ED4A 4JYAF 2FHKA 1VHFA 4GKKF 3SYZA 1UFLA 4LBHA 4IQMA 2FGOA 2CUYA 2V67A 1T95A 2MEWA 2XZWA 3MHYA 3IS9B 3X3UA 4R8UB 2AJFE 3DOKB 2VBYA 4W92B 1RHMB 4ZPDA 4Q8FA 3EGZA 5E3PA 2H48B 2VFRA 1P8GA 4ZVOB 3TUJC 3FFIA 3IXQA 3ZZPA 3K5OA 5THWA 3HZEA 4ZP6A 8RUCA 4P6QA 3KLGB 4CRJA 1BC6A 3FRYA 3EDQB 4QIWD 1VQYA 2J9DA 3ZXWA 3SSQA 3OTOJ 5DGAA 1T02A 4YMEA 2DEJA 2J76E 2N7CA 4PYAA 4C48A 3NXZA 2UUAF 1VRQC 4DJBA 4X66F 1OYDA 2BOPA 1KSPA 3BSCA 3KOAA 3NL0A 3DLGA 3MM7A 2MXYA 1FDNA 1FRJA 2XMAA 4V1Ak 1RI7A 4IKAA 2ZH8A 1V5IB 3IBFB 2XMJA 3QRPA 2FJAB 1U6BA 3RU0A 3U02A 4DX7A 1NH7A 1RE1B 5M2RA 1KC8T 3UFCX 5HVGA 3EWGA 2RVJA 4RNNA 2GVDB 2FLOA 5DQHA 4PKDB 1FRXA 1AB8A 2YX1A 1HBUA 1HNXJ 2QJ3A 2XWYA 1MNEA 3ZZTA 2VG6B 3KG0A 2W25A 2UXCF 5HP1A 1R0AB 2DR5A 1FKPB 4FNIA 4TLRA 3TJ9A 2F40A 4NLYA 2BJ8A 3MM6A 1XMQJ 2E9TA 3DRRB 2PMWA 4OX8A 4PG4A 3MFIA 1F1BB 1WSRA 1T11A 2N7YA 2M70A 3QRQA 1S9EB 1SL1A 4H54A 2ZBCA 3PKYA 2Z8QA 2W7PA 3EE3A 3G4SS
chains in the Genus database with same CATH topology
2JOQA 1CQMA 3NAIA 3U1LA 2ZH1A 1M1KT 1TL1B 1RKIA 3G8TA 4Y2CA 4URGA 2RH3A 4KKOB 2GV1A 4KSEB 2UP1A 4KGKA 4BBYA 1D9FA 1SV5A 4CH1A 1SIWB 3M8QA 5M2UA 2P6TA 2YVSA 4DQRA 1NK6A 1N5YB 4FYDA 5A8WA 1UL3A 5E3QA 1HQEA 5CYQA 2W9AA 2IRYA 3QYYA 4NYOA 3MXHP 2RMLA 1K73T 1DHMA 2PIIA 2W4PA 3CXCR 4RW8A 4J9PA 3SFUA 1XNRF 2E9RX 4TKTA 1FXLA 1ZH5A 5K14A 4CTAB 3HPOA 2QMXA 4H4KA 4B3SF 1HPZB 4WFXA 5DO2A 2OMLA 4ZVGA 3JSMB 5LMUF 1Q79A 3H59A 2BDPA 4JI5F 3FJ2A 1SC6A 3GFYA 2ZZNA 2DT9A 3OHAA 3PW0A 4WIIA 1YJTA 3J7ZT 5DM7Q 3N4WA 3I82A 4RWXA 2GW8A 1IQZA 4C3LA 4I2QB 4JI1F 2RQMA 2JH3A 1RK8A 2FJDB 4QBUA 3CC2S 3SQGB 5EHHA 4RNHA 1VIOA 3CCJS 4O3RA 1ZZNA 4B3RF 1VBXA 1JLBB 1R7IA 3M30A 1LWEB 5E7OB 1FNMA 5J1EB 5IM0A 2J0XA 1WI8A 4R5PB 3M2UB 4I1TA 1B7FA 4YP3A 3AA8A 3SZ2A 3I0SB 3QLHA 3PIPQ 4DR2F 3CDBA 5GAEI 3RBDA 4TYBA 3O3LA 4A4JA 3CCQS 5KFUA 4A8FA 4NCGA 5CQGA 4X4VA 1X5TA 2DCLA 1IKWB 2DGTA 2K3IA 4K0KF 4IH7A 2PO4A 4F3OA 4XK8C 4AXJA 1FRMA 1N32F 3ITHA 1TAQA 2DNYA 3OSPA 2GJIA 1SUQB 1T03B 2KRBA 2MSTA 1D8ZA 2HHWA 3HDSA 1HQUA 5KG3A 1IBLF 3IR5B 2WTFA 1TV6B 1M5OC 4H4KC 1LWFB 2F8EX 2Z2LA 3OXLA 4KE5A 3MUMP 1KONA 3JYTA 4MKYA 2M52A 1UJ6A 3K8VA 2BJEA 3DGPA 4O3QA 4CT8A 3VF0B 3CD0A 2K1RA 2OSQA 3EZ5A 4RW4A 1KLNA 2J8AA 2RQ4A 1FVSA 2FPHX 2HRUA 2DRAA 1ZZFA 4X65F 1KRPA 1V3RA 2QLWA 3D54A 3BF4A 3G8QA 5GAEU 1N6QA 4WE1A 1JLGA 4Q43A 2YWFA 2GMJA 4OJGA 1Z1ZA 4C0OC 2XS2A 2W9CB 2JEFA 2GQQA 5C24A 1KQGB 1Q1KA 2KJWA 1ZTTA 3AJ1A 3MMAB 1U09A 4ZP7A 5F41A 1DZ5A 2N3LA 4B9NA 4DSJA 4JI7F 2V5HG 4PWDA 1HMVB 4OMFG 1DTTA 2XBPA 1X4FA 4I67A 2MKIA 4NL5A 4ALZA 1U1OA 4KO0A 3KKFA 2QMWA 3HHNB 1YVFA 2J6TA 2IBKA 1REVA 3V4IA 4UOCA 2OPSA 1H7XA 4XDCA 1MROA 2UUCF 4LFBF 1IJFB 2DGWA 3CJKA 2V8VA 3MTJA 4RLEA 5KFMA 2DGVA 5F0UA 3KK1A 5KFBA 5EDWA 5KT6A 2CJQA 2VD3A 1RTDA 2KFZA 2W9BA 3KLHA 2GX8A 4KFBA 2KFYA 3PRBA 2R2TA 3HXMA 4XPEA 1EETB 1FRKA 3HMJG 1NHVA 2CYYA 2POKA 1KLMB 2G4BA 1BQMA 1UVJA 4L6V3 1JLFA 4A8SA 2RB7A 2KHDA 2XLJA 3DCAA 1TVRB 2XEXA 3UW1A 5DG7A 2HW3A 2CZ4A 5KT4A 4LMZA 4PUOB 4OHYA 3EXCX 1R31A 2C22A 1FDDA 3O6QA 4DL7A 2EPIA 3LWLA 1WF2A 1FEHA 4Q44A 1N5SA 1QUVA 2RNEA 3N6LA 4P2SA 2R2RA 4FF2A 3HF5A 1RT7B 1FRLA 2EBGA 2QZ8A 3ONQA 3J7YI 4C0BA 1KD1T 4LF5F 4JV5F 3OVSA 3OV7A 1VQPS 1SH3A 5KT2A 4BDPA 1U2FA 1YWXA 1U26A 1RT3A 4HH0A 5G0RA 5FDLB 1XR7A 3BR9A 3FEXB 2DCUB 3PR4A 4NA1A 1TK5A 3FZ2A 1WHWA 5LMNF 4DBQA 4X4SA 5B0CA 2HNYB 2X1BA 2C2RA 1SKSA 3VALA 3EXYA 2CPEA 3FSYA 1IXKA 2IVYA 4DV4F 1N0UA 1HBNA 4NWBA 4EYHB 2DRBA 2R7TA 3SDEB 2LCWA 4DV0F 4K5RA 5A8RB 1T05A 3NNCA 2VONA 4RBTA 3TAMB 3DDKA 4A46A 1NK8A 1VQKS 2HNDB 4ES3A 1NHUA 4C0HA 3MDFA 2MGZA 1PILA 1URRA 1UEUA 1HNVB 2D41A 2VFTA 3MD3A 3FDSA 3DRPA 1UVLA 2Q6BA 1KNZA 2AF6A 3ZZZA 5F3TA 3J7YU 3UD3P 3AHPA 2OPPA 2QA2A 3QGIA 1DQ9A 2AP6A 1Y0HA 4G1QA 3IWNC 1QAJA 1M90T 4WFZA 2HGLA 1DRZA 3CDAA 1ZPWX 4DDFA 4NCAA 4C4WA 1N34F 3BO2A 1KOOA 4U67Q 1H7WA 2UVUA 2CQ3A 2HQ3A 2P6SA 3K2YA 4ZDNA 3TVZA 1FNXH 3C66A 5M2PA 2KU7A 3G6VA 3V81B 1RA6A 3UR3C 2VKRA 5HMXA 3MAHA 1SI9A 4CI0B 1D9AA 2Z2MA 2HAIA 2OFHX 4P7TA 3GG1A 4IG3A 5KTQA 3I0RB 1QLNA 4C8YA 1NK0A 1J5EF 5D4NA 4YHHF 1QSLA 1P9QC 2ZBIA 1C2PA 2N4CA 1FTCA 2VPWB 3T5HA 2AYBA 1UVMA 4O23A 3TA2A 2V4RA 2OH2A 3CDEA 3HI9A 3MMJA 2VG5A 3V6DB 1AFJA 2HS3A 4I0WA 1JX4A 4DL5A 3BQ0A 2ZH4A 2R9LA 1Q86T 1SIZA 2FTRA 3CIZA 4RW6A 2EFNA 4ETXA 1WTFA 5AXLA 4QWBA 3THVA 3H2LA 3OFEA 3KK3A 3OSNA 3IR6B 2FJXA 1KN6A 3TR5A 1DTQB 1FK9B 2DR7A 2PDAA 1SKRA 2R8KA 3BM7A 1CC8A 2GFFA 4PWUA 2PE8A 2DH8A 3OFHA 3FGVA 1TL3B 2ZOGA 2RU3A 1S1VA 2IBOA 2ZKUA 3SV3A 2FC9A 4U6PA 3CD7A 5KFAA 4K2XA 4OHVA 2VB6A 2NYIA 4QWDA 3IRXB 3OL7A 4IDKB 2I38A 4X4QA 4H4OA 5FD1A 4ZCLA 2EFVA 3AY0A 1NJZA 1HNIA 2GHWA 1IQTA 1BD6A 3JTOA 5IZHA 1CG2A 1TKTB 5DG9A 2AJQA 2KJVA 3U27A 3MECA 3L7PA 2MZ1A 4GKJF 1S1UB 3EX7B 4Q0BA 1G3OA 1S9GB 2OTLS 1TK0A 3F56A 2MB0B 4B9LA 4J9NA 3Q8PB 3RRHA 3CF5Q 2V8HA 4CH7A 4O4RA 1GTEA 1R43A 4F4WA 1QE1A 2YNIB 1PO6A 1S1TA 5KOWA 5EN1A 2CQ2A 2F8MA 2FLPA 2F7VA 2O67A 3CC4S 1XWLA 2DNLA 3PVXA 4OHWA 5I4MA 2GGPA 3FNNA 4WYLA 2I5JB 2V94A 4DN0A 1VMBA 2VUGA 2KN4A 3P96A 3OL6A 3G71S 4A8QA 4OI2A 1Q7YT 4IYQA 1FXDA 3N5BA 2C3MA 1BLUA 3ISND 4N77A 4IRDA 5HO4A 2L08A 1RJJA 3OVBA 4K4VA 1N52B 3IS9A 2IMWP 5HLFB 5DDRC 3NS6A 4R8UA 2AGOA 2ZD1B 2AYMA 3DOKA 4NYZA 1UA1A 4ELUA 4H4MB 3WBZA 3BGFA 4RUAA 3E01A 3F73A 4DR1F 2NSCA 5KG2A 3M9NB 2ABYA 2ZM6F 1GQEA 3DYAB 2PFFB 3OTOF 1IBKF 2MHEA 2YWGA 2KZMA 2RIJA 1WEZA 4WF9Q 2JL9A 4M5DA 3UQSA 1Y3JA 3VAGA 5C42A 4MH8A 1BWEA 2MKCA 2P9GA 4DUYF 3HT3A 1JJ2R 5FLXY 3MUTP 5KFSA 3TW0A 2KG1A 1K0VA 2DNHA 3RYLA 2HVIA 1UWBA 2BE2B 3MM9B 4OX9F 3TNVA 5C25B 4YOEA 3D0HE 2XI3A 4LIWA 3CO9A 2DNQA 3DLHA 1MU2B 1KFSA 4NOHA 4Y2MA 1VQLS 3QMQA 3KLGA 3GV5B 3OFGA 2KHCA 4NLRA 2KYXA 5KFKA 4EEYA 4B9UA 5CZVA 2E5GA 2R7QA 5KFXA