2MMYA

Solution structure of the rna recognition motif of human taf15
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
GSHMSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TATA-binding protein-associated factor 2N
publication title Structural delineation of stem-loop RNA binding by human TAF15 protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 13
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mmyA01
3EGZA 3EX7B 1WG1A 2DNQA 5IFMA 4PRFA 1WF1A 1M5VC 2L9WA 1YJ9S 1VC5A 2E5JA 2OSRA 2CPZA 1UW4A 1R8PA 3N9UC 5FJ4A 1OPIA 5D78A 3J7YU 2RT3A 1PO6A 1U1KA 1X5SA 2KXNB 3I55S 3G8TA 2RQ4A 2CQ4A 3P49B 2Q79A 1WWHA 2J76E 3MD3A 1X5TA 2N3LA 1UP1A 2CPHA 1S72S 2D9OA 2JVOA 1SJFA 2JRSA 2RU3A 1CVJA 1SJ4P 5JVHQ 1WI8A 2NZ4A 1KD1T 5IM0B 3IRWP 2CQDA 1RK8A 2X1AA 5DDRC 3NNHA 2DH9A 2F9JA 3UE2A 1U1OA 1VC0A 2K3KA 1N88A 2MZTA 2MZ1A 2KM8C 1FNXH 5IM0A 1KQSR 3UWTA 1M5OC 2DK2A 2J0SD 1IQTA 2MZRA 2DHSA 1JMTA 2MZJA 4TU7A 1WELA 2VOPA 1WG4A 1YTYA 4TU9A 1VC6A 2MMYA 1K73T 3UCZP 3R1LA 1DZ5A 4UQTA 2QA4S 1U2FA 2EK6A 2XSFA 5DDQC 3VF0B 2DNYA 1U6FA 3LPYA 1DBDA 3JB9k 2LA6A 2MQOA 2AYGA 3TO8A 1WTBA 3P6YC 1X4CA 2E5GA 3P3DA 3BO2A 1WI6A 4Y0FA 2NLWA 2QEXS 3R27A 4P6QA 1PGZA 1M5KC 2J0QD 3G9CA 1L3KA 3K0JA 4LJMA 2LXUA 2G1DA 3S8SA 1VBXA 1VQNS 1U1LA 1SXLA 3NS6A 1WF2A 3VAMA 4Y00A 1YJNS 4IO9Q 2LEAA 4IUFA 1RKJA 2DNMA 5MLCV 2MYFA 3G8SA 2RQCA 3S7RA 3U1LA 2DGQA 2MSTA 3CCMS 2XNQA 2XS2A 3PIPQ 3H2UB 3TP2A 3MDFA 1OWXA 2M7SA 2CQHA 5LJ3Y 5DM6Q 3CCUS 2M8DB 2MPUA 2L41A 2L08A 1X4HA 3UD4P 1UFWA 2DNRA 3CCJS 2MKJA 3UCGA 5DETA 5CA5A 3G6ES 2OTLS 1OIAA 1FJEB 2DB1A 2M88A 3CC2S 2YTCA 3CCVS 3FEYB 3OW2R 1X0FA 2HGNA 4WFBQ 1SJRA 4CH0S 3VAFA 3LQVA 4ERDA 5DDPC 4ZKAA 3CC4S 1K8AT 2YH1A 1QM9A 2DGOA 1VQPS 1H6KX 1H2VZ 3HI9A 2MGZB 3G4SS 2CPYA 1R8HA 3VAIA 5JVGQ 1URNA 2DHXA 3THTA 1HD0A 1ZH5A 3RW6A 1KC8T 2MHNA 3BS9A 3CF5Q 4BS2A 1U1QA 3IWNC 1X4GA 5H1SV 2DGXA 2JVRA 2MGZA 2DNPA 3EGNA 2KFYA 1HA1A 2MQPA 3B4DA 2OIHA 1DHMA 3UCUP 3CMAS 3RW7A 2KG0A 1JJHA 1YJWS 3BEGB 3UD3P 3TYTA 2LXIA 4QU7A 2MKKA 1W2BR 1WHVA 2KI2A 1A9NB 4F26A 1ZZFA 1VQ6S 2MQNA 1HD1A 1NU4A 1YHQS 2DGVA 5LJ5Y 2KHCA 2AD9A 4PKDB 3NS5A 1VQ4S 2MXYA 2LA4A 2XS7A 2ERRA 2ZJQQ 1X5OA 2WBRA 2RS2A 2VODA 1BY9A 2CPFA 2MKSA 2DHGA 3BO3A 2HVZA 2MKIA 2N7CA 1WF0A 4RU2A 2X1BA 2DGWA 3CUNA 1X4AA 2F9DA 2M4MA 1X4DA 2OSQA 1M1KT 1VQKS 2DNLA 2DO4A 5GAEU 3ZZZA 2AYBA 4U67Q 2MZSA 4WKRA 1VQOS 3DXBA 2M70A 2DNGA 1X5PA 4ED5A 2CQ2A 5GADU 2MQMA 3Q2TC 1NJIT 2VONA 2ADBA 1N52B 2U1AA 1G2EA 1D9AA 3NMRA 2HGMA 2AYMA 4C4WA 1VQ5S 3CMES 2CQ3A 1P1TA 2ADCA 4LIRA 2E5IA 2CQ1A 4FXWA 2RS8A 2LYVA 3HHNB 4PR6A 5GMKa 2JWNA 4LMZA 2DIVA 2MKHA 5CYJA 3MXHP 2CQPA 1F9FA 4OZ0A 2DGUA 1XN9A 2RUGA 4F25A 5LXRA 2M0GB 1H2UX 2HYIB 2DNZA 5IQQA 2DNOA 3U1MA 1QVGR 2KXHA 5HL7Q 1JJ2R 1H2TZ 3CCQS 2FHOB 3US5A 3CTRA 3J7ZT 1Q7YT 4V19X 4IOCQ 1JJ4A 2KRRA 1FJ7A 4FXVA 2MQLA 1Q82T 1KOOA 2MJUA 2VOOA 1X4EA 2RRBA 1WHWA 2CPJA 2DO0A 3DLLQ 2M2BA 3PIOQ 1M5PC 2KXFA 3P5TL 2KH9A 4OZ1A 5HO4A 1VQ8S 2LQ5A 3L3CA 3SDEB 5GAHU 5BJRA 3MD1A 3Q2SC 1SJQA 2HZCA 2J8AA 2DNNA 5LXYA 4W92B 2N82B 4CH1A 3SDEA 1X4FA 1VQLS 2MZQA 2FY1A 2LEBA 4C7QA 2KRBA 1P27B 1WG5A 3R1HA 5D77A 1ZZNA 4TU8A 3SXLA 5DM7Q 2MB0B 2FC9A 2CJKA 2CPIA 2CQCA 3MI7X 2CPEA 4TLQA 1U1RA 4EGLA 2MSSA 2MQQA 3CCRS 4C0OC 2I2YA 2EVZA 1D8ZA 2GO9A 1VBZA 2D9PA 2DH8A 3VAKA 2LCWA 2V94A 3G96A 3CC7S 3S6EA 2DH7A 3CULA 4W90B 2CQGA 1HL6A 2DNKA 2PEHA 1U1PA 1S79A 2KG1A 2BOPA 2DGTA 1UAWA 3FEXB 1WEYA 1A7GE 2LMIA 2B0GA 4UY8T 2DGSA 1FJCA 2MY8A 2FC8A 2CPDA 2G4BA 3SMZA 2GHPA 5CXTA 5LSLA 2SXLA 3MUMP 3D2WA 3VAHA 5ITHA 2DHAA 2DITA 2G0CA 2KVIA 1VQMS 3NNAA 2O3DA 4YOEA 2RRAA 4WFNQ 1FHTA 2M8HA 1N54B 1SJ3P 3BO4A 2HGLA 5DDOC 1Q86T 3MURP 1VQ7S 1YITS 4CIOA 3MUTP 4WCEQ 2AYEA 2DNHA 4J5OA 2D3OR 4WFAQ 1WEZA 4IOAQ 2KM8B 4QPTA 2KN4A 2X1FA 2CQBA 2JX2A 1VQ9S 4QU6A 1YWXA 3VAJA 1DRZA 2XNRA 4WIIA 2XS5A 1M90T 4CQ1A 3CPWR 1Q81T 2ZJRQ 3G71S 1B7FA 2BZ2A 2F3JA 1WEXA 1U6BA 2QFJA 1X4BA 2KT5A 2CQIA 2OTJS 1O0PA 1KOHA 1OO0B 2YKAA 1YI2S 1WHYA 4F02A 3ZZYA 2X1GA 2N3OA 1K9MT 2UP1A 2MJNA 2LKZA 3CXCR 3VALA 2XB2D 3ULHA 1FO1A 2EK1A 1N8RT 1QVFR 3CCLS 1FXLA 3NNCA 2CQ0A 2YH0A 2RVJA 3V4MA 2DIUA 1NO8A 2KU7A 3VAGA 2A3JA 2U2FA 4M5DB 1VBYA 1WHXA 2YWKA 3MOJB 3MUVP 3H2VE 1U1NA 2MKCA 2ZJPQ 2RNEA 2FPHX 2MY7A 2PE8A 5GAGU 5EN1A 4Z2XA 3CCSS 3CD6S 4WF9Q 1FT8A 3I56S 1U1MA 2CPXA 2DISA 5LSOA 5GVQA 4YUDA 1AUDA 2E5HA 4YB1P 4QQBA 1YIJS 3CCES 2M9KA 2LECA 2K8GA 2I38A 2KYXA 2E44A 4A8XA 3B4MA 2OJ3A 3S01A 3THPA 2M52A
chains in the Genus database with same CATH superfamily
3P45B 2B5JB 2RMLA 4FF3A 4Q0BB 2VD3A 2V8DA 1OPIA 3CB4A 4FF1A 2NSCA 2XBPA 4IDKA 4C6AA 3BN4A 5LM7E 4KGMA 2N3LA 2XLJA 4EWTA 3TNVA 2WB1D 4KV8A 1Y3KA 2Y0SD 3M1VA 4K0KJ 4X62F 5J2PA 2VZ9A 3BH6B 3KNAA 4DV7F 1DFDA 1E6YB 4K7QA 4LRFA 4DR4J 1IQTA 4YR0A 1P9YA 4TU7A 4V1Ak 5SZTA 1WG4A 2QA4S 1KWMA 2IJFA 1R6VA 4NZ6A 2ZE2A 1NK6A 3H8YA 1X4CA 4PG7A 4ZVTB 3H90A 3MAQA 1UZHA 2YPYA 5KTQA 5FLXY 2GHWA 3I32A 3GPAA 3SZ2A 3MM7B 1SXLA 2E66A 3VAMA 1RHJB 4JV1A 1RKJA 2LQ8A 4NI2A 2UU9J 3GV5B 3D0GE 2VU5A 1KVJA 1QSLA 2CQHA 4WKYA 2WSCC 3PW7A 3EZUA 3N79A 3PX4A 4L3KA 2F4VJ 1RP5A 1DLOB 4KPCA 3FEYB 3AAWB 4GVBB 3TW0A 1P1LA 4DF8A 3M2VB 8RUCA 3ZTQA 1HD0A 3RW6A 2R7OA 3CF5Q 2HHQA 1NBEB 3LWMA 2MGZA 4K8RA 3OHAA 2ZOGA 3B4DA 2D3ZA 2OIHA 3H42A 4J9RA 4QU7A 2W9AA 2ACYA 5E3PA 3IAS9 5D0GA 3QO9A 4YHHJ 4TYAA 3DRYA 2WBRA 1UJ5A 4DX7A 1RLCL 5KG5A 2AEJA 4DX5A 1QSSA 4JBCA 2CWXA 3OTOJ 1JLCA 3CUNA 1N36F 4EMDA 2BQRA 2DO4A 2EPIA 3ZZZA 3MMCB 3OR2B 3GONA 2VV5A 1HMVA 4DG1A 4NXMF 1FWLA 3RAXA 5B0EA 4ED5A 2CQ2A 3I5BA 1WOPA 1S12A 4M5JA 1PJ5A 3DOMB 3CWJA 4I4BA 2H48B 3H4BA 4PAAA 3CMES 3Q8UA 2GX8A 2IRXA 1R27B 4USVA 5B0CA 2R7VA 1VDHA 1T95A 4DUYJ 4FXWA 2BE2A 1RAIB 2DXDA 1R89A 3EE3A 2JWNA 3IGVA 1D0EA 3NG8A 1PBAA 1E6VB 2O01C 2YKOA 4ZVPB 4HHHA 1SJ1A 2JJ4D 2C2KB 3SEOA 4ZP6A 4LFCF 2B9XA 3W2VA 1X4EA 2RRBA 2HNZA 4QIGA 1VQ8S 2LQ5A 4DR2F 4QYZK 1UVLA 1TZ0A 2MLYA 3CDEA 4RNNA 3PHEA 3SDEA 3KYLA 4DV6F 4L3NA 3HCXA 4R25A 2IA6A 2JDJA 2HWTA 3A3NB 3TVKA 3N5FA 4CTAB 1RE1B 1RWPB 3SCJE 4JI4F 2E7WA 4KPYA 2ZH9A 3M8PB 2OPPB 2EVZA 3T19A 3AFGA 4DJBA 4NCAA 2QX0A 4LQ3A 3PJXA 1WORA 3T6JA 4HDHA 1S1VA 1KBRA 3OUYA 2HQFA 4KQZA 2G13A 4LSLB 1NPRA 5A8WB 4DL2A 4C9DA 2XI2A 3G82B 3TR5A 1FHTA 4RW4B 2UV8A 1RWKB 1S4FA 5HQ8A 4HACA 5A6WA 4BCAA 1U8WA 1N56A 4CQ1A 3CCZA 2IDEA 1FK9A 4DN9A 4DCOB 3CJ2A 4OX7A 1LW0B 1O0PA 4I64A 1N0VC 2BJ1A 1WHYA 5CD4A 2UP1A 4OIXA 1FXLA 3PR5B 3KHGA 3QMQA 4YS2A 2O5DA 2W8LA 4FYDA 4ER8A 3MM8B 4ZVFA 1SQEA 1CJUA 1RWMB 3M32A 1CLFA 2QMUB 3TUJC 1VI7A 1U0HA 2MKCA 3MEDA 4OJHA 3I56S 2V67A 5GVQA 1C1CB 3A8EA 5KOWA 2HLTA 2OMOA 2E7VA 1SI9A 3MM6B 2MLXA 1LOUA 3LOUA 3M8WA 1M5VC 4AL5A 5KFHA 1R8CA 5IXUA 2WVFA 4F4WA 1V9OA 1U1KA 3I55S 2XLKA 3R7BB 2ZITA 4EBCA 4M5LA 2J76E 4QIEA 3K5MA 3PW5A 4F36A 2EEYA 2D9OA 3TA2A 5DO2A 2ATLA 3KUHA 2J0WA 1Y10A 2KTQA 2P2CB 3MPYA 4JI1F 1U1OA 3DRSA 3A13A 2FJAB 2H5IB 5HQLA 2MZRA 3F41A 5C25B 3CW2C 3MCSA 3UCZP 3R1LA 2ZH7A 1U2FA 2EK6A 3FCVA 3DOKA 3P3DA 2C3OA 1RT6B 4J9QA 3MMBB 2J0QD 1EKSA 1U09A 4B3SF 3E3XA 3SCLE 5EDWA 2V4RA 3DDKA 4DS4A 2HHHJ 1JLFA 2DVIA 1ULRA 3U1LA 3NXZA 2XNQA 2W4CA 4JI6J 2X51A 1DQAA 3D3BJ 1TTHB 3A4TA 1A0OB 1LW2B 2DNRA 3DRRA 3HKZD 1QAJA 4X4TA 2BKNA 4UOCA 2XLIA 1T9XA 3PVXA 2LDIA 2UVWA 1Q8IA 3JSRA 5IV4A 3Q8SB 1HI1A 3BS9A 4PYAA 3C2PA 1EX8A 4BC7A 3BQ1A 5U47A 3QWPA 2J9CA 3CMAS 1XMOJ 1PIEA 4FXDA 1WHVA 4H4OA 2H5JB 4RW7A 2E1MC 2AD9A 4CLZA 1JLEB 1YDLA 2ERRA 2YQ3A 3HZEA 2XMUA 4W4MA 2HIYA 1HBOB 2WTFA 3C14A 4DV3J 2LQ9A 4I69A 4ZOSA 3L7OA 2A2CA 5ETLA 3DXBA 2HS3A 4OYOA 3AA8A 1VK3A 4KSEB 2BQ3A 2KT3A 2AV5A 4OZ2A 2FZGB 2X3GA 3H20A 3D54A 1P1TA 5I3PA 3V6DB 3EXCX 1R8BA 3I4HX 3DI6B 2Z56B 2WCXA 1LEOA 2OPQA 1IKXA 4U9RA 2G0IA 3JSYA 4MK7A 4ZS6A 1C2PA 5K20B 4LMZA 4NCBA 5HMZA 1LWCB 3UI3A 3J81j 1Q0NA 4ICLA 2NUUG 1FJ7A 4DUTA 3HHLB 4PWDA 4ZCIA 3B8HA 1JWWA 3C6TB 4JV0A 3T5LA 1BUXA 3FSXA 2HW3A 3IWLA 1RT4A 2JFDA 2UXDJ 2C42A 1CS4A 3R1HA 1F5BA 3FJ2A 3WC2A 2OD6A 3DCAA 4A46A 4ID5A 4IG3A 1HHTP 1R31A 3BKUA 1MU2B 3FK4A 1TQLA 3ZNUA 1S79A 3J7AN 2DGTA 9ATCB 3GP9A 2FZKB 1FXDA 3U27A 4X64J 4WU3A 1XEZA 4BBYA 2HS0A 2PI5A 1FRKA 3ZZUA 4CLWA 3TAPA 2M8HA 1S49A 3MURP 4F50A 1YITS 4U7UK 2AYEA 2QGFB 2KM8B 2E5LJ 4QU6A 1DRZA 4WIIA 4LFAJ 4ILMA 5J1PA 2GGPB 4RUCA 4PPDA 4DF4A 2YKAA 1RBAA 1YI2S 4HEA9 2FDNA 1NLKL 4ZPTR 3WZ0A 3MR6A 1FFSB 4AUKA 1O51A 3VALA 2CJYB 4X4RA 3I0RA 4QIFA 4YY3J 1G6BA 2DY9A 2H3EB 1S0OA 4YB6A 2HSEB 5ETOA 2W9CB 4CH7A 1NDPA 3PO4A 4ALZA 3HSZA 4YUDA 2VA3A 1NAQA 3T1YJ 5HMWA 1YIJS 1X31C 1C0TB 3THPA 1HR0J 1SPBP 2QC3A 5M2RA 3M2RB 4HI2A 4DI6A 1RT5A 4YDXA 3JSMB 1IKYB 3LANA 4NRTA 3QRPA 1OYEA 3OTEA 2J9DE 1N34J 4WP9A 2ZKUA 3JS9A 2CQ4A 3WDOA 2V9WA 3WC0A 1UKUA 1UP1A 4DV2F 3NP5A 3C8YA 1WI8A 2J9DA 3SCIE 4P2FA 4ZVUB 3UE2A 1KQSR 4NLDA 1SC3B 2R2SA 2IMWP 4LF8J 4XO0A 1C0UA 2NXUA 4JI5F 3CJ8A 1TKDA 2B56A 5FDLA 3EGVA 3P6YC 1S1TB 1V3RA 4LVNP 2YKNB 2A2DA 2V8GA 4P6QA 3JTOA 4I1TA 3L9ZA 4CO0A 3PW4A 4DR5J 2VASA 5E5NA 1YJNS 3PRVA 2DNMA 1RAHB 2HWHA 1U02A 2DR5A 2MSTA 4LFBJ 5IZHA 1UCNA 3T3FA 2FLLA 2OHDA 1YRXA 4ECVA 1YQHA 2HFZA 3BZQA 4KKOB 2MKYA 3AJ2A 4C8ZA 1T9TA 3IFEA 1NJWA 4FKYA 2POKA 2MKJA 2VFTA 3D9BA 4ECUA 4GO7X 2M88A 1FRXA 2YTCA 1SJRA 2Z0GA 5KG2A 5CQGA 3R5CA 4DSLA 1CG2A 1ZH5A 1Y9OA 2F4FA 2OH2A 2B4PA 4ZPBA 2IA0A 4DR1F 1WUUA 4IG0B 8AT1B 1N32J 2OO4A 2JOQA 2G2ZA 3DU6A 1A9NB 2KJVA 2MQNA 2FJXA 5HJXA 2R7UA 3UNGC 4XK8C 3HJVA 2ZH8A 1LKZA 3TAMB 4DV0J 2FJBB 2FIUA 5A0YB 2UUCF 3ITHB 3CO0P 5DGAA 1X4DA 3QSYB 1YJUA 3ETMA 3V2UC 2XM3A 2ZC3A 3V6KA 2ROGA 2GJIA 2M70A 5HP1B 1TFWA 4NMXA 2Z58B 1X8DA 3W62A 2MQMA 1WDTA 2ILYA 2DKOB 1IKVA 2AYMA 1JLGA 4CLFA 3MCNA 2FTRA 4DV4J 4DV5J 3KLEA 1H72C 4NLQA 3EVOA 2E7XA 2UUAF 4RKUC 2DNZA 4TQSA 2J6SA 1J27A 1XERA 3DLEB 1L3UA 1UTAA 2YXLA 4FXVA 2UUTA 1REVA 1WHWA 4IFVA 3CGIA 1CULA 1N4LA 3L3CA 1S7HA 2UUBJ 2QLWA 4ZVRB 4ECSA 2F8EX 3D6HB 2LEBA 1F2HA 3NGUA 4ECWA 1TKZA 1B4SA 3SSRA 1B7YB 2YVSA 3MPVA 4LBIA 5I4MA 2VKZG 2KZZA 3CCRS 2EFVA 4DS5A 1D8ZA 2AP6A 4JI0F 2H1YA 2GMJA 4KHPF 1PJ6A 2PSZA 2RF2B 3VWSA 4KGXB 3KHLA 4DHVA 5DG9A 1A7GE 2AX0A 4UY8T 4GKKF 4DR7F 1XMQJ 4MK9A 4Y2AA 4UUXA 1HNXF 2YNFB 3RR8A 2EBEA 3DLKB 3RR7A 2CNKB 1N54B 1Q86T 2YKQA 4IFYB 3WHIA 2IVFB 3GV8B 1Q95G 1GXUA 4DPWA 2PDAA 2XNRA 4MKBA 2HFOA 2VIHA 2F3JA 3PACA 2UXCF 1IM6A 2OELA 1HBNA 2JFKA 1ZA2B 2PFFB 2MJNA 2Z2MA 3A8JA 3PEHA 3MFIA 2FLOA 1N0UA 2EC0A 3CD0A 1YVFA 3HHDA 1UWAA 1VCTA 3DC2A 3C6UA 5F8NA 4CO2A 5CCLA 2ZJPQ 4ED0A 4WE1B 4DOZA 3BR8A 4I0WA 1N5TA 1FD8A 1CJTA 2PN6A 4HH0A 4LF4J 3R2CJ 2CIMA 4F3QA 1F60B 3I87A 1RBOB 4K4TA 2E44A 2L9NA 3GE9A 1TUWA 2M52A 2V4QA 2B6AB 3C19A 4XAKA 4PRFA 2FVCA 2FGOA 3VV2B 2J5AA 4KE5A 1RYRA 1F6TA 2HQCA 3K7RA 1PO6A 1X5SA 3G8TA 2RQ4A 3PX0A 2DBBA 1XNRJ 1X9WA 2RU3A 3BB5A 3LP2A 5KFLA 4A4JA 2MTLA 2B51A 5T7LB 1JKHA 5AXNA 4DR3F 1IJFB 1KHWA 1QAIA 2LEPA 2AMCB 4P9SA 2HHTA 2MMYA 1JQGA 1DTQA 2UVUA 4YQWA 1T03B 2B3TB 3UDCA 2XSFA 3VF0B 1Q53A 2ZDOA 4WJBA 4ZJLA 3BO2A 2EFNA 4HDGA 2F1FA 2MQ8A 3FBEA 4PUOB 1B70B 1U1LA 4LR9A 1N5VA 3I9ZA 3JYTA 3H2LA 4AE5A 3S7RA 1FRJA 1RTHA 4R8UA 1W26A 2JZ5A 1NJYA 1DQ9A 1F5AA 3TANA 1OWXA 4P74A 1NPPA 3MAHA 3BH7B 4CYUB 1U2RA 3MEEB 1C1BA 3TJAA 3FMWA 5I3QA 4ERDA 3M30A 4WYWA 4MT1A 1HWJA 4NCGA 3F56A 1URNA 4B02A 1KC8T 2FY8A 1RA7A 2UVVA 3R5GA 1X4GA 2DNPA 3EGNA 4CCHA 3VGVA 4A8FA 3PRDA 1G3OA 4O4RA 3UD3P 2IBKA 1MW7A 4A8KA 1TMMA 5AE3A 4PKDB 5J2PB 3BGFA 3ISNC 1CC7A 1RCOB 4ZPWR 1BY9A 2WAQD 2CPFA 3SV4A 5J2QA 3DM2B 4UOGA 3TUIC 3AXMA 2Z57B 3HVTA 4USIA 5EWFA 2X7IA 1X4AA 2H65B 2LU1A 3KTQA 2OI2A 5K14B 4F3OA 1WC4A 4F2SA 3GU0A 4KB7A 4KHRA 2BKOA 4NL5A 5SUHA 4QPXA 1TL3A 2W7AA 2MEWA 1EQ0A 5LOQA 1TL7A 1MMNA 1OQ6A 3BSAA 3AA9A 3CDAA 2XWXA 1SH2A 1ZM4A 3CJKA 4JI7F 1RQ0A 1HWIA 1UVIA 3D6FB 2W7OA 2H4YB 2BBEA 2RD5C 4F0MA 2ZHOA 4KBIA 2XMJA 1S57A 3OFEA 3SI8A 1V6HA 3G8QA 1RT7B 3HFZB 2GO8A 1I6JA 2IBOA 1UW9A 3IGNA 3KLFA 1EARA 1XJWB 1RHRB 1FKOB 5HO4A 2XMMA 1QD1A 4FF2A 3IRXB 5D4OA 1PSDA 4CH1A 5D0RA 2ASJA 2YQ0A 1RT1A 1RTZA 4J9KA 4Q2LA 4USWA 1NKCA 3BQ2A 3FUYA 4C7QA 3QO9B 4UQGA 4KGKA 2ZOFA 2GQCA 2IDLA 3SXLA 1TK5A 1S9GA 2IVYA 3DGPB 2XGQA 2XSJA 5L39A 5F9LA 3OBIA 5LMNF 4B3TJ 4K50A 1EAYC 4ZIWA 4B3OB 3FEXB 4DL0C 3JQMA 2V5HG 3EM1A 4PG5A 1K1QA 1V3ZA 1RLDA 2ZHBA 1HPZB 1S9FA 3M6XA 1G7CB 2KVIA 2O3DA 2LLZA 1WC3A 4KO0B 3HKWA 5HMXA 4OV6A 2IM0A 2B7CB 2VDIA 2CWKA 3W2WA 4YN3B 3KLIA 2BJ9A 3IM9A 3B54A 2HNDB 3AD7C 4NEYA 3EPIA 1LXNA 4FP9A 5KFMA 2N3OA 3MMAB 4J37A 1H0HB 4A8OA 1W25A 4EK2A 1KTVA 1H3DA 5HROA 4ZMMA 2KYZA 4YR2A 2FJWA 3FEZA 4DSEA 3NNCA 1MROA 3QWUA 1YZ7A 1JXEA 3CJTA 1R8AA 5D4NA 2KU7A 5B09A 4OYZA 1D09B 1U1NA 3N0VA 2MY7A 5EN1A 1YJTA 2HHVA 2ZC4A 3PRBA 4PG4A 1TV6B 1BMQB 4L76A 3AQPA 3RB0A 1TKTB 5K8PA 2ZUAA 3KKFA 3OVSA 4OFZA 4ED4A 4H54A 2RDJA 2VJUA 3GWCA 3M2UB 1HQUA 3UVJA 2GVZA 4MAKA 1S72S 1TUVA 3GFHA 5G0RA 2NZ4A 1M1HA 3OL8A 2QMXA 2F9JA 1RT3A 1U47A 2V4JB 2Q6CA 3W66A 2P6TA 3A8IA 3T1HJ 3SSSA 3GG1A 1Q8KA 2QSWA 2ZWOA 1JNZB 1D9DA 1GNKA 3D28A 5K9FA 3R27A 4WFXA 2GCFA 4DQRA 5BYQA 5KT2A 2D3UA 3R2DJ 4C0HA 1RHKB 4WPAA 2RIJA 3OR1B 2AGPA 1JX4A 3G87A 2I0XA 1WC1A 4EYIB 1U0HB 3GG0A 4FYXB 2MPUA 1SC6A 2QFIA 2HURA 5CA5A 1RI7A 2DB1A 3LO3A 1B0VA 1Z2LA 1KN6A 5J2MA 2RQMA 4GC7A 5F8HA 2DHXA 3EVMA 3QGPA 5DG7A 2WHOA 1J5EF 4CO1A 3W8GA 2XMVA 2RB7A 2G9OA 3TOQA 3FCWA 1HHQA 3EPGA 3WQPA 4C8LA 4TY9A 5D6GA 3ICLA 2BV3A 2IM3A 1FEEA 4DQPA 1RDRA 3TZXA 4FYYB 1MNEA 2MKSA 4OZ5A 3W9IA 4USMA 1R0AA 4CLKA 5B0AA 1M1KT 5EHHA 3PYEA 5L38A 4C11B 5GADI 1FD2A 5DS7A 4Y2KA 5E41A 5L1LA 3M4XA 1H7XA 2HGMA 4F04B 2UXBJ 4KTQA 5HLFB 4Q43A 3W60A 2LQJA 4C98A 1OPZA 3RBXA 3H4DA 2Y8WA 3SYZA 2RS8A 4P71A 7AT1B 4ELTA 1X9SA 1APSA 3HF5A 1OY6A 3KJVA 4AXJA 4Y2MA 1Q82T 4M1KA 3L7UA 5HATA 1WJ9A 1JB0C 3A8KA 3TX0A 1GMWD 3CVKA 3FCHA 3D68A 1IUJA 1LFWA 1D1UA 3VR1A 2KO1A 1I94J 2OP5A 2OUGA 2N82B 3OTCA 3UN3A 2KB2A 1DQ8A 3ZZTA 1OMSA 1X4FA 5KFYA 4DL4A 2XI3A 1VOMA 1NPKA 4U7CA 2PC6A 2FC9A 2XZWA 3ILJA 3LA0A 4RW9A 4C0OC 4K4UA 2QYGA 1U1PA 1JXLA 2GZOA 4RX6A 2WVDA 2B0GA 3UQSA 2Y1LB 3I0SB 3V4IB 1HHSA 4KIAA 5B0BA 3FC9A 2RRAA 3OFHA 4FYVB 5EWGA 4J5OA 3HMJG 4K4XA 4B9SA 1RWWB 3GYXB 3OVAA 1ZPVA 1DARA 1TKXB 2VHGA 1S1WB 2HMIB 2FHKA 3LP1A 3GYNA 1BQMB 1S6QA 2CQIA 2CDQA 2OTJS 1KOHA 1OO0B 2BANB 5KFTA 1WC6A 2K2PA 4LREA 3D1OA 3KJQB 2XEXA 4URSA 3VGUA 4OHWA 3GZ7A 3MR7A 3FFIA 3RYLA 3ILIA 3CJ4A 4DLEA 4X2BA 2CAJA 3MM5A 1KVIA 5GAGU 1P6TA 1RCXB 1VQSA 5BXIA 4M5MA 2Q3PA 4PWWA 2J6UA 4WTOB 1LK7A 4CLUA 2YKMB 1SKSA 3A3OB 1FI4A 2VG5B 1IWAA 4ID5B 2HBRB 3OSNA 5IFMA 2VBXA 2WW8A 5CYQA 3J7YI 3HZGA 4ILRA 5KFXA 1VRTA 2ZBCA 1ZM3A 4I2QB 3P49B 4UTGA 4PQAA 5KT7A 4YP3A 2CVEA 4LF5J 2VF3A 1ZAWA 4WYLA 1NK9A 1T0TV 4ZDNA 5DDRC 1TL1B 3P4UB 4AXIA 1XR5A 1N88A 2HVDA 3QSIA 5IM0A 2DXEA 3TUPA 2IC3B 2IRYA 2Z8QA 5K5MA 1KFDA 2FHJA 1Q5YA 3FZBA 5DDQC 1WI6A 1PJ7A 1PGZA 1LWEB 5B0GA 3S8SA 3ONQA 2AEFA 4MFBB 1WF2A 4X4OA 4O0NA 4RWWA 1IBKF 4FVMA 2IAJB 3MCMA 3UN2A 1RYSA 3PIPQ 4DSFA 3H2UB 3C15B 1S48A 2L08A 4GKJJ 2NXCA 3G6ES 2XHCA 3DMJB 3QQCD 3L4BC 1Q8BA 4TYBA 1HW8A 4Y6IA 1FRIA 5B0DA 4XDDA 2C2ZB 4FF4A 1RU2A 1SH3A 1S6PB 4LRAA 4IQXA 2R8JA 1ZAVA 3BSNA 3HT0A 3KLGB 3CJSA 3T5KA 4OX9F 4NA2A 4IRKA 3M8YA 3N6NA 4J9LA 1EIYB 1FDAA 1YSJA 1CJVA 1RACB 2MKIA 3CE8A 4NRUA 1SKUB 2FVRA 4MIBA 2F9DA 4Y2CA 1JLAB 2GS8A 5AJ3F 2ZKTA 2DNLA 2QLBB 2ROPA 2MZSA 3PV8A 4WKRA 5B08A 3NLCA 2DNGA 3JTPA 3QNWB 4IOBA 4OZNA 4X62J 4DV7J 1NJIT 2ADBA 2HBYB 4DUZF 4EO8A 2APOA 4ZPAA 3C3LA 3T9NA 4WWSA 2NR0A 4OYAA 5HN0A 4KGVB 3B6BA 3QZ7A 1HBUB 3V81A 3HHNB 3PJ9A 3BPSP 3MFHA 3HHLC 1Q1KA 5HL7Q 1R0CB 2KFNA 4QR0A 1EZZB 2VH7A 4USUA 2UXDF 1BE4A 3DLLQ 4USTA 3DHXA 4QYRA 4OZ1A 3GJRB 2AZ1A 1S97A 3LGMA 2I5JA 1EP4A 3BYRA 1XNQF 3AOBA 2BMBA 5CZXA 1TVRB 3C16B 3AHPA 3R5AA 1S9EB 2ZEJA 2HFSA 3OL6A 1WG5A 1WOSA 3FQKA 2GHVC 2QA4G 1FNMA 5HBMA 4X64F 2UZAA 1FCAA 3PG9A 2I2YA 3G6XA 4ZN1A 2LCWA 3KMSA 2Z2ZA 1YBUA 3BBCA 2DH7A 4AL6A 4W90B 2DNKA 3QAEA 2RU9A 5IWAF 4QWEA 3ZTSA 2IJNA 1GMWA 1SL1A 4LFAF 1RJJA 2JSXA 4DV1F 2SXLA 1UJ6A 2ZBPA 4PPZA 2GAHC 2RILA 2YNHB 1N36J 4B9UA 1HWKA 4C97A 5GMEA 4N8OA 5C42A 4OHVA 4NXMJ 4X4NA 1U0SA 1FVSA 2OEKA 3MECA 2FUG9 2BABA 3MEGA 1T9UA 2O1PA 1NHKL 2QO3A 4K4ZA 4H4MA 4P75A 2XB2D 2CQ0A 1YRUA 2O66A 3G6YA 2EWHA 4YFUA 2HFVA 2CJXB 5ETSA 2I6WA 3MUVP 4LRDA 1PILA 2N4CA 5KG4A 3DXSX 3F0NA 4KFBB 5F0WA 4P52A 5KFIA 5HVGA 5LSOA 3QZ8A 1OS5A 2QN6B 4LFCJ 4WIQA 1FESA 3W3SA 4ELVA 2CFXA 1KQGB 3SQGA 5F3TA 3S01A 1N48A 5ETQA 3NAHA 4DR2J 4C0BA 3K57A 2L9WA 2E5JA 2ZD1B 3N9UC 2B5JA 4Q0BA 3PKMA 4O44B 4LF8F 4HHJA 4ED6A 3EJMA 4BC9A 4ZK7M 3VTIA 4FPRA 3GQCA 4JI3F 2R3VA 2JRSA 1RWXB 3AD8C 2HVEA 3NRBA 2K3IA 4JI4J 1FKAF 1RK8A 4JP8A 4NLTA 5JMNA 4QOTA 4A8QA 3IN5A 2DHSA 3OHBA 3OL7A 3TEGA 1CSJA 1Y4ZB 1NK4A 2BVZA 1E6YA 3DYAB 5IQ6A 2HQ3A 3NAIA 3HVWA 2LA6A 2B9YA 2QEXS 1NM2A 1KLMB 1TL5A 2GMHA 5BYRA 1M5KC 1IBCB 4NXNF 3K0JA 4ZITA 1QUPA 1VQNS 1MWZA 4KGZB 3D3CJ 3VVUA 3MM7A 2Y1RI 3C6UB 2CZ9A 5RUBA 4P2MA 5DM6Q 3HT3A 5BYSA 2M8DB 2YY3A 1CJTB 1FFGB 3M8QB 2F40A 1TR0A 3SQOP 5D3GB 3CC2S 1RT2B 3VAFA 2EFQA 3LQVA 2OEMA 2V0NA 5DDPC 1WKJA 5C2GA 2HHPA 5L9XA 1KQKA 2WW4A 4GVBA 1H2VZ 4TN2A 1SQFA 4U7UD 1VK8A 5HMYA 3M2VA 1J2VA 4URGA 4IR1A 5KFKA 1KDNA 2MKKA 1W2BR 2Z2LA 2WOMA 2R7QA 1N6QA 1Q78A 3M6UA 1DAXA 5LMUJ 4GRSA 2DY1A 4YB7A 1GK8A 3HDSA 3K5OA 4OI1A 1RHMB 4C8NA 1HI0P 2DYAA 4QZVB 5K8MA 2NQPA 1DTQB 2DGWA 4F3MA 5GAEI 1U24A 2WVEA 2CDRB 4DQSA 4DV5F 1UWBB 4JI1J 1X5PA 3OR2A 4Q7AA 5KFFA 5A6PA 1NK0A 2KJWA 2XO6A 3M6WA 1SUQB 3LWLA 2ZNYA 1NZ8A 3MR2A 4LIRA 3U7JA 4ZLJA 4JI2F 5F41A 3DOMA 1IBMJ 4RW6B 3GCWP 5E3QA 3BGRB 4K4SA 2HAIA 4B3RJ 4UF4A 4B3SJ 3SFGA 1ACMB 3CCQS 1C4AA 1N5YB 1E6VA 4NCGB 3CD5A 3RB4A 3AD9C 6FD1A 2M2BA 1Y7PA 2GIQA 2COLA 4WZMA 3NBPB 1RAFB 1BQXA 3MD1A 2J8AA 1WSRA 1Q7LB 3D4JA 1M1GA 3CJ3A 4CLPA 4W92B 2XG8A 1RTJB 4B9VA 1EETB 1IJEB 1WC0A 4KC5A 2ZH6A 2CJKA 4CTAA 1XMQF 2CPEA 4FPIA 2OMLA 1Q5VA 2V94A 1FRLA 1JLBB 2DEIA 3FDSA 2HLUA 1HBMB 3M8PA 4BLGA 5KFQA 3VQTA 2X3DA 4G3IA 5H9EK 3ENWA 4ETZA 1HNIA 3VCDA 4QWDA 4PYDA 3MUMP 3MTJA 1BD6A 4CO3A 3M7VA 4PG6A 1IN0A 2D69A 3UO0A 3RBEA 2F63A 5A8WA 4RW8B 1CEZA 2D3OR 3G82A 1FTCA 4LF6J 2ALZA 2GVDB 2V68A 2V8HA 3CPWR 2PMHA 2W2QP 3G71S 2Y3YA 1HNVB 3M9MB 1WEXA 1IWGA 1FE4A 5MAOA 3QYYA 2XY5A 1W2IA 3EICA 1LW0A 1BLUA 3LUYA 3G2XA 4CDIA 3MMJA 3FSYA 1U45A 3VAGA 5EWEA 4I6YA 1WHXA 1B0TA 4B3MF 2QL5B 3MM8A 3Q86A 1FKPB 4WF9Q 3J80U 3OLBA 4L75A 1NK7A 3TQ1A 4OI0A 3W9HA 4F4YA 4X65F 1C1CA 1LWFB 2JLEA 1SH0A 1MLAA 5CYMB 1LWXA 5IS2A 4DU7A 3QRRA 3N5BA 2AGOA 4MH8A 3DN9A 3MM6A 2HNYB 3BPDA 1AT1B 2JLGA 2XTJP 4USJC 1Y11A 5G4DA 2ZWPA 4ZVQB 1Y5NB 5HVHA 4ZVEA 2ZNZA 4V19J 1B0PA 1SJ4P 1HYSB 1KD1T 1F1BB 1WKLA 3ENVA 4QYZJ 5DQHA 5AE1A 2MZTA 2YWEA 4WXOA 1HFEL 2YNGB 1IR2A 1JMTA 1MMLA 3TA0A 4YR3A 2WSFC 1F2GA 3T6BA 4YB5A 1Y5LB 5C25A 2R8KA 2AYGA 4OV1A 4C8MA 4J9PA 4JV5F 2VFRA 4KRWA 1GAOA 2LXUA 1RT6A 2WONB 2KHDA 3MMBA 1S6UA 1VYAA 1VLOA 1NUEA 2QL7B 1HIYA 4DCJB 3IS9B 5IT9U 1XC9A 1GMVA 3B78A 3VZIA 3POTB 3MDFA 4TKTA 1HNZF 4F8RA 1FE0A 3EDRB 4OYWA 5KG3A 1FJEB 1CPZA 2EKYA 1KKHA 1FXRA 1LW2A 1AZSB 1YRTA 2H5EA 1K8AT 1T3OA 2HBZB 3ILOA 1JJCB 1BQNB 4URQU 1U1QA 2HK2A 2MQPA 5KT4A 1HQUB 2KG0A 2CG8A 5KFWA 1NB7A 3OJUA 4FZVA 4CI0B 2JLFA 1ITPA 2OPSB 1KFSA 3HLUA 4IRDA 3BN7A 1VQ4S 3E01B 3JXOA 2JL9A 4OX8A 2ZBQA 2XMAA 2X1BA 1MMDA 1D9FA 2OSQA 1HBOA 4PQUB 4DV2J 3HSJA 1NH8A 1S5ZA 3HVRA 2ZBIA 1U8SA 1N33J 2BW7A 3BGUA 4U95A 3VVTA 3MEKA 5M2PA 2D1CA 3QFWA 1VIXA 1NHVA 3JQKA 5HQMA 4JI5J 4FNIA 1VGYA 4PR6A 3V6DA 3DI6A 3AY0A 4CT9A 1S59A 4P2XA 5DLGA 1IKWB 1SB6A 4RR5A 1FDBA 3AOAA 5L1JA 1V3SA 1ZAXA 1UVJA 1S76D 1LWCA 4FBUA 3US5A 4LQ9A 3CTRA 4V19X 4Y28C 2XY6A 3KJFB 2VA2A 2VG7B 1UEUA 4JOUA 5GAHI 2KH9A 2XYHB 3C6TA 2QTWA 1T05B 2RKIB 3ZTPA 3UN5A 4D3HA 1VJQA 3J81U 3R6GB 4EEYA 4LF9F 4X66F 3RRGA 2LXFA 2ZH1A 4JUZA 2MZQA 4DL7A 4Z7YA 5DLFA 4PWUA 2VICA 4R5PB 5KFAA 4ZA1A 3V6JA 4KT0C 2F8MA 2HPUA 4O4GB 5JUMA 3KDNA 3N6LA 3NGSA 1U1RA 5T14A 4DR1J 2PT0A 1ZTTA 4ECZA 1QE1B 2MLZA 4OX6A 2YNIB 1HL6A 3IG1B 2BOPA 1MU2A 5IOLA 2PFDA 3BSCA 5E3AA 1FJCA 1AYEA 2RE1A 2ROEA 3IR7B 1DJ0A 3VAHA 4NYZA 2FVSA 2R8GA 1J5OB 2UUCJ 4ZPDA 4WCEQ 1CQMA 5F0UA 1S7IA 3KK1B 2X1FA 2CQBA 1VQ9S 3KLVA 5KFRA 3IBCB 4B9MA 1S99A 4ZJOA 3HSGA 1X4BA 5B0FA 2YWFA 2R2RA 1SC1B 4GVLA 2GGPA 6FDRA 2F65A 3RRHA 2LKZA 2OFGX 5DJBA 2GIFA 3CXCR 1IBLF 2MHEA 2EK1A 4JYAF 5IC6B 2GC8A 3CSKA 3T9ZA 1T11A 2XCAA 2UUAJ 3R7NB 1FDNA 2K1RB 2XC9A 3RZAA 4B9LA 2FPHX 1EKRA 1UVKA 3QJLA 2J0XA 2CPXA 1XMBA 2DISA 3PM9A 2YQ1A 2FJVA 3QIDA 4Q45A 1NH7A 3UDEA 4F4KA 2Q43A 1C0TA 2NZCA 5KG7A 3M2RA 3JSMA 3KOAA 1RA6A 4J9SA 1WWHA 3BF4A 1RUSA 1I3OB 1WSVA 5F8LA 3RU0A 1SJFA 2VPZB 2FVPA 4IKAA 5DZ6A 1UVNA 5A8RB 3IRWP 4QR2A 4O0IA 1OSDA 4ECQA 2IJRA 4JI0J 2MZ1A 4KHPJ 2OFHX 3HO1A 1GQEA 3QLHB 4MYUA 1B3TA 3Q24A 3UR0A 4TU9A 3QRQA 1VIOA 4UOFA 4GKKJ 3SSQA 1HNXJ 3LPYA 1ZPWX 2VG6B 1DBDA 1U49A 1NSPA 2QLFB 1H38A 3H0PA 5KFVA 1GTHA 1S1TA 4WBFA 2YKNA 1BWVA 1NJZA 3Q22A 5J1EB 3PR4A 1NXIA 3OQ2A 4TQRA 4ANEA 3D1HA 1ZBTA 2UXCJ 4NASA 2EFOA 4OZ3A 1X4HA 1R3NA 5HVFA 1O5JA 2NXEA 3E8OA 5DETA 4KKOA 4HL9A 2FLNA 2AGQA 3GB0A 3QGIA 5C24B 1FNOA 4ZCMA 3MZIA 2AJ2A 2DGOA 1VQPS 3THTA 1PCAA 3FBBA 4BS2A 2GNKA 4DSIA 3IWNC 2JVRA 3R6LB 4LSNA 4F4AA 4J9VA 4E8UA 4IG0A 3OPKA 3ZO7A 2DGVA 3N4WA 2W9BB 5LJ5Y 4CLLA 2FD2A 4IH7A 1U7LA 1XBWA 1Y3JA 3TJ9A 3TUZC 3PDNA 3BO3A 5AXLA 3WX4A 2PIIA 4USHA 3TAMA 2F5GA 4M5NA 3AJ1A 5A0YA 3ITHA 4U67Q 3FGVA 2EC2A 2H51B 3GIKA 4DR3J 3QIPB 1O8BA 1CC8A 1HQEB 1YBAA 2JEJA 4FS1A 5HP1A 2ASDA 3KG1A 1UJ4A 2NXNA 5H9FJ 5E0OA 1RADB 2NXJA 4ZP9A 1FRMA 5A8KB 2QV6A 4RUBA 5GMKa 3M9NB 3K8WA 2EBGA 2HYIB 1BWEA 2DHHA 3CIZA 1JJ4A 2KRRA 4QIVA 3PCOB 2C1EB 2VQFF 3MM9B 3DLEA 2CPJA 3R97A 3OLAA 1LXJA 4JI8F 4EUVA 4EBEA 3LAMA 3MGJA 3GIJA 3U1NA 5L46A 4OYIA 7FD1A 1T3NA 4EGLA 4B9NA 4U6PA 3DOLB 2L3MA 3RTVA 2QLJB 3FBCA 4F2RA 1HNWF 2AJ0A 3T41A 4IR9A 3DLJA 2KG1A 3RAQA 3LP0B 2L9DA 1RTDB 2RF2A 3BGOP 3EUNA 2AX1A 4A8MP 3CMQA 2PEBA 5CXTA 5LSLA 2WB4A 5ITHA 2OPRB 1VQMS 2ZUGA 3Q8PB 2YNFA 1VRUA 3GYGA 5DDOC 4KR0B 1S77D 3ENAA 3DLKA 3HHEA 4IOAQ 5LL6d 3V81B 5D15A 2CKWA 4R0EA 2BZ2A 4NLGA 4BHQA 3ELHA 1U6BA 3DLGA 2XY7A 4KJIA 4FNHA 4LBPA 1NEEA 3ZZYA 3PJWA 4ECYA 4G1QB 4AQYF 4MKVA 1L5UA 4RO0A 1UA1A 4ZIVA 3GCXP 1QAYA 1RWOB 4WK1A 3BKFA 4JI7J 4M5DB 2OGUA 3K2YA 3KWMA 5FIIA 2K7KA 3AOCA 1U1MA 2GA7A 1YJ7A 2BXJA 1B64A 1F0XA 4WE1A 4DLGA 3KK3A 5HBMB 3KUGA 2P6SA 3DRPB 4DX6A 1AA1B 1YJ9S 3DGVA 1R0BG 2CPZA 4DEZA 1R8PA 5FJ4A 4RUHA 5HJYA 2B6AA 2RHQB 3TAQA 2BM1A 1YKWA 3BSOA 2KVQE 1CVJA 4EZ6A 2YKPA 4A47A 4QBUA 2R9LA 5JVHQ 5E7OB 2CQDA 1KR4A 3NNHA 3QT7A 4WFZA 1S0MA 1NKBA 3KG0A 3QT5A 4HTIA 4N47A 5T7LA 3NGKA 1FNXH 4X4UA 1M5OC 2DK2A 5LMNJ 2ZZTA 2BRLA 2IMOA 3ZC4A 1PKUA 4DPOA 1VRQC 3QGHA 4NA3A 2C22A 2FJEB 1WTBA 4DFMA 5KG6A 4NE9C 1T03A 1DTTB 2W2PP 3Q8QB 2I9SA 3OXFA 4UW2A 4DQQA 3QATA 2QIFA 3QBCA 1V5VA 4IO9Q 2R42A 4IUFA 3W7BA 3G8SA 1SV5B 2PMZD 4PUOA 5J2NB 4FYWB 2HBQB 2BUNA 2JC1A 1ZTWA 3LALA 3IC1A 3ZTRA 2HVIA 1WDDA 4MTPA 2OTLS 5F9NA 1VHFA 2ZBRA 3OW2R 3KG4A 4K4YA 2XQCA 4WFBQ 3ZXWA 4CYUA 4DWIA 2AJ4A 1S1UB 1SVDA 3PW2A 1U26A 2JHEA 3O2IA 4ID8A 1YG0A 3NOCA 4X4QA 5JVGQ 4I7FB 2W7PA 4FN5A 1ICEB 2HQIA 5H1SV 3GJQB 5KFOA 5KG0A 3PY8A 3PNIA 3ZFVA 1RTIA 2C3UA 3IBWA 2KI2A 7FDRA 4F26A 3S1TA 1JK9B 3MAAB 2KHCA 5KFBA 2J7UA 3FRYA 2HVHA 2VPWB 1ZS6A 3PKYA 1VMBA 2RHSB 4PXBA 2DHGA 3Q8RB 1NK5A 2K06A 4F7VA 4TY8B 3DLHA 2QMWA 3DM2A 3ETOA 4OYMA 1NSAA 4RJVA 2V2ZA 3ADAC 5GADU 5K14A 4LR8A 5I42B 1G2EA 1HWLA 2CYYA 3J80Y 1VQ5S 1Z2ZA 3OSPA 2WVCA 1F3FA 3RGIA 3W5ZA 2HRUA 1YK9A 5CYJA 3D1QA 4F25A 1PG5B 4K4VA 2C3MA 2KXHA 1HQ2A 2KZMA 5DQGA 3CEDA 3ET6B 3J7ZT 2DT9A 5L8RC 1RT7A 4XPEA 4L74A 1VHIA 4C8YA 4OJ3A 3DDNA 3GV7B 2ZH4A 1SQGA 4M5IA 5E33A 1FKOA 5LXYA 2WOMB 1KEKA 1N6QB 3RG6A 3CO9A 3IRXA 4ZHRB 3NL0A 3H5SA 5JXSA 1XK8A 3MCOA 2MB0B 4ED2A 1TL4A 1FX4A 5KT3A 1VBZA 2IM1A 1J5EJ 2XULA 4OI6A 5KFCA 4LF7F 3DGPA 4CNZA 1UAWA 4PXDA 2BW2A 5HAOA 5IT9Y 4B3OA 2OLWA 4K4WA 1GH8A 1Z4UA 3ISZA 1MN7A 2DITA 2G0CA 2ZM6F 1OJ4A 3M8SA 3NKYA 1HPZA 3TARA 4ES2A 1WEZA 3I5CA 2KN4A 3ZNJ1 1S1XA 1UFLA 3NGTA 2V2QA 3I96A 2GMLA 2D41A 1WACA 1PAEX 3LPEA 5ETVA 2FQQB 4KO0A 4W98A 4IQMA 5CH7B 2C2EA 2KT5A 3O3LA 4M95A 1T94A 3BQ0A 1F9HA 2RQKA 2HNDA 4NLPA 5BR8F 4ZP8A 3MMAA 4CLSA 5HK4A 2A3JA 1JLQB 2B7BB 1UPPA 3QGGA 1VBKA 3FQLA 4OYXA 1RWNB 4HVZA 4HHUA 2B4OA 2ZVSA 1TV6A 3MPUB 1RABB 4DQIA 2IHR1 3VGSA 1TKTA 4C3MA 3UNYA 4IDKB 2VDHA 5D78A 2D3O1 1BGXT 3J7YU 4FKXA 2HKEA 4Q44A 1HNIB 3MD3A 1RXOB 4KV8B 3M1VB 4Y2IA 2CNOB 2C2DA 3CNQP 3M2UA 2PD1A 1BHNA 3HSDA 1TK8A 3HHKA 1U25A 2OD4A 3WBZA 5L1KA 1YZ6A 2ZE2B 4RZRA 4J9OA 2Q6BA 2RAQA 2V4JA 4YDDB 4F4XA 1FJGF 1XR7A 4RUAA 2MQOA 2ZHAA 4MKAA 2NLWA 5T41A 5E3CA 5KFZA 4NI2B 4XTTA 3J81Y 3NS6A 3KLHA 3V5RA 1N5SA 2BJEA 5MLCV 4WXWA 3GSIA 3CCMS 4Z37A 4P10A 2GFFA 2PA8D 3OR1A 3CCUS 4A8SA 4LRBA 3OV7A 3W63A 4IH5A 3N6MA 3QAUA 3GJTB 1KONA 5ETKA 3OXLA 1IXKA 2E1AA 5J1NA 3HI9A 2MGZB 2CPYA 2VJVA 2IPOB 5LMUF 3DNCA 2OEJA 1PYTA 2BOAA 3G86A 3UCUP 3RW7A 5DGBA 3BEGB 2VQEF 1AFIA 3GMGA 2HRYA 2QZ8A 3P5BP 1UEKA 1K47A 2B4UA 3HX9A 3NS5A 2MXYA 3KK2A 2RS2A 3W61A 1GFWB 1JLCB 3PFEA 1EQMA 1TU0B 3IR5B 4PXEA 3EMTA 4RU2A 3DDIA 3BR9A 1HMVB 4DG1B 1ZETA 1VQKS 2AYBA 1IBMF 3SBMA 2P9EA 2AU0A 5F8JA 4C3KA 4CM0A 2VONA 4C11A 1IM4A 1N52B 4DR6F 3LW5C 3NMRA 4B3RF 3F73A 1NNDA 2BE2B 3D66A 4HT7A 1Y5IB 2DRDA 1T02A 4NWBA 1ZM2A 2J7KA 5HLFA 1VISA 4O3NA 4DZ6A 2VUGA 2QYCA 2DGUA 1XN9A 2RUGA 3SIPB 3PHTA 2DRAA 2RJZA 3D0IE 3W2VB 1IBKJ 3NY0A 5EX3A 4IOCQ 3LTOA 1I5OB 2HNZB 4CWBA 5EUHA 1PYOB 3IO1A 4WP3A 1U2CA 2BM0A 1T9YA 5ETTA 1Z1ZA 3SDEB 3DKDA 5BJRA 1ZM9A 1SJQA 4QR1A 4L6V3 4QIWD 4KH1B 1VQLS 2FHJD 5D77A 4TU8A 1Q16B 1RHQB 1S0NA 3PYFA 1FERA 3OD2A 1S4EA 2EKNA 3GIRA 2E9TA 4TLQA 4K0KF 2GO9A 2D9PA 2DH8A 2LQBA 3S6EA 1S1VB 3HFVA 3OUYB 4DR4F 2YWGA 3KDOA 4Y34A 4OX9J 2DGSA 3ZTOA 2FC8A 4LF6F 3DU5A 4LSZB 5F3ZA 2GHPA 4DX8H 2DHAA 4CRJA 1H74A 4HACB 4Q8FA 3I0SA 3V4IA 4EFAC 8ATCB 2ATCB 2D7SA 1UA0A 5K8NA 2ACMA 3RBDA 5AJ3J 3H5XA 2BJ3A 1FK9B 4AT1B 3BYPA 1M90T 3TVZA 1Q81T 2UU9F 2A10A 2RH3A 2YX1A 4DUZJ 2OAUA 3OJSA 3J7Z5 4IRCA 1TKXA 2D74B 1S1WA 4I6WA 2HMIA 2HS4A 1XTZA 4I67A 1BQMA 3CIMA 2JEFA 2F4VF 2BE9B 1NSKL 2QA2A 1FO1A 4RNMA 2BANA 1CJUB 3M32B 3GLJA 2IIHA 3CJ5A 1NO8A 3HD2A 1H73A 3MEDB 4CO5A 2RUSA 3TZYA 3TI0A 3Q8VA 1K1SA 3KJNB 1K0VA 2RNEA 3EZ5A 3CCSS 3AXKA 4L72B 4B17A 4YB1P 1UEVA 2I38A 3ISND 3B4MA 2YKMA 2DNQA 2ZH5A 4YHHF 2VG5A 1VC5A 2OSRA 2V8VA 3Q89A 2HZAA 3CCWA 1SKWA 3HFKA 1FWKA 1XNQJ 5E3RA 1GT8A 3OTOF 4RNOA 2W24A 3K5PA 5L1IA 4DU8A 4ENOA 3TZZA 1KS2A 4I2QA 3DRXA 4P72A 3DRSB 4UT4A 2P9GA 4ZJQA 3UR3C 3HVAA 1FTRA 1RWUA 4QCLA 2ZZNA 2G0JA 4PZVA 1EJ7L 1KSPA 1TL1A 4DSJA 4FBTA 2V2VA 1VR6A 3DOKB 5IWAJ 4ECTA 2W2MP 2IC3A 4U8YA 2NSBA 2HHXA 2YX7A 4DUYF 1U6FA 4DV1J 1GX6A 3TO8A 2ASLA 4Y0FA 4AYBD 1WNEA 3JAMU 4OQJA 1JLFB 4LJMA 3CT9A 3NCPA 2XGPA 3DHWC 1K44A 1LWEA 2Z30B 2RQCA 2V9KA 2DGQA 2KT2A 3N01A 4MFBA 2HG4A 2B8QA 1GMUA 1FDDA 3DRRB 2RSQA 2IAJA 5DZ7A 3CCJS 3C15A 4DPXA 3UCGA 2J9EA 4KH0B 2PO4A 4KY3A 4ANDA 3Q23A 4ELUA 2HGNA 1IQZA 3FKBA 1WKKA 2Y0BB 3CC4S 4M8LA 3DMJA 3HULA 1R8HA 3K59A 3TWZA 4EI2A 2MHNA 4RBTA 5CZVA 1HKAA 4E2FB 3EVWA 5KT6A 4H4OB 4RW7B 2CZ4A 1YJWS 1S6PA 3BKTA 2HQGA 3H7HB 3PEJA 5H9FK 1SL2A 3G6VA 4NLRA 3KLGA 4NZ7A 4G1PA 4KAIA 2LA4A 2ZJQQ 2B43A 1LQ9A 4OHXA 2VODA 3C14B 2XYPB 4ZVSB 1N33F 1KNZA 1EHWA 5F8GA 1PBUA 2GJFA 1ZOTA 4JI3J 3TRGA 4RBUA 5GAEU 3NGDA 4NOHA 1JLAA 1PYSB 5ETPA 2NPFA 4DCPB 4WZQA 1T9VA 1S0VA 4DFKA 4WTYA 3E51A 1RAJA 2OPQB 4C2MA 1IKXB 4C4WA 2ADCA 1NK8A 2DR6A 4ETXA 3M9OB 4RLEA 4ZVOB 2HHUA 4ED1A 2HIQA 2HK3A 4E98A 1OYDA 1HBUA 2CQPA 5LT5A 3HM9A 4ICLB 4NXNJ 4PEOA 2DNOA 4PWDB 2M3DA 3RJMB 2FHOB 3AODA 2CNLB 2KKHA 2VOOA 1M5PC 2W1BA 3P5TL 5KT5A 3IM8A 3R5DA 4DL3A 4P73A 1RT4B 1RAGB 4LSNB 2IM2A 4MK8A 1CS4B 4HTJA 1XR6A 1CJKA 2NYHA 2KRBA 3FSIA 1TVRA 2VFSA 3C16A 4N8NA 1S9EA 4IG3B 1K0TA 3I6PA 4FDFA 1R43A 4NEZA 3VAKA 3G96A 4N7TA 2VPXB 2AW0A 1IR1A 2YPZA 3CULA 4X4VA 2W2OP 3NWGA 1UL3A 1R7IA 4NLOA 4OYBA 1KLNA 2G4BA 3FBFA 5I3UA 1RKIA 3D2WA 2AIRB 2P9CA 3AB4B 5KAKA 3JTNA 5ETRA 4QPTA 2YNHA 2E1CA 2F8HA 4TVAB 2BX6A 2HHHF 1B7FA 4DSKA 3C46A 2AWZA 4JI6F 2AHOB 2CNNB 3H25A 2V6AA 3IAM9 3I0RB 4GC6A 1JNRB 4NLVA 3E2EA 3BV8A 1NKEA 4JI2J 1N8RT 3CJRA 2YH0A 2RVJA 4DFPA 1M0SA 2AQ4A 1F3VA 4PXCA 3PX6A 3MOJB 3JSBA 4OLOA 1Y00A 3TX8A 3SV3A 4J91A 3QFHA 2CA9A 2XYGB 5K8OA 3P8BB 1XMOF 3FVYA 4QQBA 4KFBA 1NHUA 3CCES 4N5SA 4P7VA 2K8GA 1B99A 1RT5B 5CAAA 4A8XA 2N4DA 3H98A 2LU2A 3AT1B 3I5AA 4PABA 3RB3A 3UD5A 2FYXA 2RT3A 1MG7A 1UPMB 4F4ZA 3M05A 2ZD1A 1G4CA 1W7WA 4M5HA 4DV3F 1RSCA 2CPHA 2WVBA 2JVOA 4N41A 4O44A 4AFFA 1VRUB 3CDBA 1C0UB 2QE5A 4B08A 3F44A 2J0SD 1FFWB 5IC4B 2MZJA 5FDLB 1YTYA 3X1LB 3WIUA 1DZ5A 1ZYQA 2VPYB 2DNYA 3DLGB 5A76A 3HK2A 3DYAA 4MYTA 5KOXA 3GR1A 2GQ2A 2YWWA 3G9CA 1VBXA 1KLMA 1L3TA 5ETNA 4Y00A 5F8MA 2LEAA 4XDCA 3GIMA 2CZVC 2MYFA 2JNJA 2ZH3A 1KTQA 3EWGA 2M7SA 3HPOA 3V6HA 3AH6A 2HEKA 1QTMA 3GFXA 4ZLPA 2R2TA 3M6VA 4UUWA 4UZCA 3UPFA 1X0FA 3KK3B 2AJ1A 3M8QA 4CT8A 1M5HA 4I2PA 4CLYA 1T7PA 5D3GA 2YH1A 1RT2A 1H6KX 2YWHA 2QL9B 4WU2A 3G4SS 2FVQA 4RL1A 1SKRA 5JJBA 4B3MJ 2KFYA 2DCUB 3MTKA 1RAOA 2GQQA 3TYTA 1TAQA 3T5JA 4X65J 3OFGA 1MN9A 1RU1A 2XS7A 3LF0A 3CDUA 4HLBA 1TUGB 1WF0A 3VZHA 3R5BA 4N77A 3RB6A 2M4MA 4Y3CA 2ASYA 4HH1A 2E5LF 5KFUA 3OFFA 2VBYA 1IKVB 4RWXA 2CJQA 1JLGB 1UWBA 2U1AA 4NLSA 4L73A 2M5YA 4MMOA 3KLEB 2RDIA 2KL8A 3LGHA 4M5GA 2E5IA 2L48A 1SUQA 4YY3F 3MPWA 5LSRA 3KMQA 1JIHA 4OZ0A 2DTJA 4JV5J 2M0GB 1P9QC 2NPIA 3IXQA 3U1MA 4RW6A 1QVGR 2HAFA 1JJ2R 1H2TZ 3BGRA 3BJYA 1REVB 4H4KC 1S6OA 4IFVB 2C2RA 1TMJA 3T1YF 1CULB 2WSEC 3IBFB 1QTNB 1N5YA 2WK4A 1HR0F 5C5JA 1HNZJ 4RBVA 2J6TA 4DZDA 1RTIB 5GAHU 4B9TA 1QUVA 3NOGA 5A2QU 3Q2SC 6AT1B 3D7SB 5D0HA 3NBPA 4EZ9A 4M94A 1AUSL 1N34F 4J9UE 4I6AA 4UOHA 2B8PA 4DPTA 1TKZB 1SC4B 3A12A 3ZZRA 1WD6A 1MWQA 2ZOMA 4U96A 4BWMA 1RTJA 2CUYA 5KFJA 3AJDA 3H40A 4OJ1A 1VQYA 3VGTA 3CDWA 1EETA 2C3YA 4O23A 2CPIA 4MIAA 3Q8YA 1V5IB 2BEFA 4DV6J 4C48A 3CC7S 4OZLA 5C2CA 2R7WA 2H54B 4Q8EA 2YBVA 1JLBA 1HBMA 4NX9A 4M5KA 2E9RX 3D6MB 2VKRA 4A8WA 3WIVA 2ZVIA 3NNAA 2E9ZA 4WFNQ 2VBZA 2CXEA 4DFJA 4C3LA 4DR5F 3KNGA 1A6LA 1PAUB 3VAJA 4RW8A 3RUBL 2ZJRQ 4LFBF 2EFPA 1FWPA 1HBNB 1UVMA 3SFUA 2CJ9A 2QFJA 4K2XA 2GVDA 3QT8A 1HNVA 1FVQA 4KYZA 3ULHA 3U02A 1RWVB 3V4MA 2C2MB 2HRTA 1QAXA 4X84A 2EXUA 4DL5A 5D4PA 4OYPA 3NWRA 4NYOA 3CD6S 1FT8A 1N32F 1PC5A 1DLOA 1FKPA 2XHWA 3GR0A 2XZDB 3TA1A 2LECA 2Q66A 2KYXA 4LR7A 3EGZA 3TZWA 1AROP 1WF1A 4DPYA 1LWFA 1JXVA 5CYMA 4DV0F 3OTBA 4LF9J 4X66J 2K7JA 1KP6A 3I9V9 2HNYA 2XMKA 3J7A1 3NCRA 3LP2B 2C3PA 4Q2MA 3CJ0A 2BACA 1JKHB 3MHYA 5D0EA 1LV5A 4EU0A 3W65A 1HYSA 3PXGa 3UWTA 1S1XB 1T9WA 4OHZA 1K73T 3MPDA 2YNGA 5KFEA 4DV4F 4HT5A 4Q5VA 4MKYA 3GJSB 3MMCA 3HHLD 1FX2A 4IO1A 4RU9A 4HKQA 1N5QA 2B4VA 1VFJA 3GTYX 4HI1A 3JYTB 2IY5B 1RTHB 1FF2A 2QJ3A 4R8UB 5H9EJ 3CCTA 2WONA 4XIUA 3IMQJ 5DG8A 2XS2A 2ZDPA 1UZDA 4K2JA 3IS9A 1YX2A 3PW0A 1C1BB 4QWBA 2E29A 3O1LA 3NGRA 3POTA 3UD4P 2UUBF 1UFWA 3M30B 1OIAA 1IBLJ 2JEGA 2HFNA 1HARA 4JYAJ 2JC0A 4CH0S 2EG1A 1NDCA 1QM9A 1AZSA 2P8IA 1OQ3A 2H4WB 1H7WA 3OVBA 1HA1A 1TAUA 2UVRA 3T5HA 1DHMA 1NJXA 1BQNA 1D8YA 4UY85 2BE7D 2I8EA 4X4SA 2EG2A 1OY8A 1YHQS 1RISA 5J2QB 2Z4PA 2OPSA 3HVTB 3E01A 2HVZA 2OPPA 2N7CA 4O3OA 4ED7A 4I68A 4J7CA 3LGNA 4AD6A 5AXMA 1TL3B 4G6VB 4PQUA 3QJPA 2AJFE 3L09A 2XZTB 4LSLA 3GIIA 3KLHB 2BR0A 1TL7B 4RW4A 1M5SA 1XIQA 3FZ2A 3CJKB 2CQ1A 1GX5A 1NDLA 2PI4A 1BC6A 4QWCA 2DIVA 2W4PA 2QLXA 1AW0A 5LXRA 1H2UX 1UETA 5IQQA 5CD4H 4QJVA 2IFXA 3KLFB 4LF4F 1IKWA 2ILZA 2W25A 2MQLA 2A18A 3C66A 4ZVGA 3PIOQ 2VL1A 2KXFA 4MIWA 3W9JA 2CRLA 2VG7A 1YJRA 5FLXU 2FLPA 1RT1B 2O67A 4OL8A 1T05A 4F0HA 2RKIA 4LBHA 2F7VA 1X9MA 1KHVA 1S9GB 5CABA 4BDPA 2P5VA 1ZZNA 1XNRF 3KK2B 2Y8YA 2XSJB 1EB0A 2CJAA 4WK3A 3UW1A 9RUBA 4R5PA 3JAMY 4CLTA 4O4GA 1XQIA 3D0HE 1TP7A 3QPIA 5IT0A 3UFCX 2AEMA 1GEHA 3EDQB 1QE1A 4ZCLA 4YMEA 2YNIA 3IG1A 2CPDA 3K8VA 2N7YA 3SMZA 2R8IA 3KXDA 3L7PA 2DCLA 2DJWA 1SIWB 4HR2A 2DNHA 4WFAQ 4ZLNA 3ZZ0A 4EBDA 3W2WB 1J5OA 1YWXA 3KLIB 2XS5A 1KVKA 3ENQA 3KK1A 4ZLLA 2VBWA 1YGYA 1D3WA 4ES3A 1RBLA 5HROB 1MROB 2ABYA 2FJDB 4ZPVR 3H5YA 1QY7A 4NZ0A 4DBQA 4S0MA 2B9EA 1RB0A 2U2FA 2QSFA 4P7TA 2G2OA 3ZZOA 2BJ8A 2DR9A 2GJ2A 1VJWA 2PE8A 4Z2XA 2R7RA 5KG1A 2K1RA 2WBMA 1AUDA 1U48A 2V69A 2VQFJ 1GTEA 3PZPA 3O8WA 1WG1A 4FVCA 4JI8J 1UW4A 3KFWX 3BREA 2V34A 3QT6A 3UVJB 2KXNB 2GVZB 3MR5A 2NS1B 2Y9HA 3L95X 2Q79A 5G0RB 5KFSA 3I82A 1WC5A 2ZFHA 1WOOA 5EX0A 3HP6A 3NCQA 3KHRA 3RBZA 1RT3B 1RZMA 2R7SA 2PMWA 3Q83A 1JLEA 4QW8A 4ES1A 2H9ZA 1VC0A 2K3KA 4ECRA 5A8RA 2CVIA 1HNWJ 1WELA 2VOPA 5KFPA 2FZCB 3AB2B 3W5YA 2ZH2A 3W8PA 1U4BA 3QLHA 4ZP7A 2V63A 1FA0A 4X4PA 3BDPA 2QRRA 2VG6A 1L3KA 1NCLA 2NYIA 4DN0A 5DQIA 1UFKA 3LH2S 5AT1B 3EXYA 1I1GA 2Z2YB 2MDAA 4EYHB 5J1EA 1QSYA 4O3SA 3TP2A 4DDFA 3B82A 2GV1A 3IR6B 2Y1JA 5J2MB 1SL0A 4AQYJ 5GMDA 1GXTA 2AJQA 4JV2A 4ZPCA 3HHLA 3IWXA 5C24A 1RHUB 3MR3A 4J9MA 2DR7A 3D67A 3GFZA 4ILLA 4ED3A 1OSCA 3UDVA 2BA9A 5THWA 3O5TB 1JJHA 4C8KA 4B3TF 4OI3A 2R8HA 1NU4A 1FEHA 3BDEA 2BQUA 1R0AB 1HWUA 1X5OA 2AF6A 4G65A 2W9BA 4AL7A 3BGLA 4G1IA 1Q79A 1O6XA 4ED8A 4WFYA 4F67A 3DFEA 2CG4A 4FS2A 2A6MA 2GAGC 2B9WA 4GMKA 2HWIA 1KRPA 3RAMA 4Y65A 3QIPA 4ANCA 2DPIA 1MWYA 1HQEA 2C2OB 3P96A 2XMWA 4LRCA 3EGWB 4K5RA 5A8KA 3KJVB 2NUHA 2LFVA 4OJGA 1I51B 1HW9A 1FRHA 3K89A 2BYCA 1RGVA 3WX8A 3IA0A 5DRKA 4O3PA 4KHMA 1OY9A 4ATNA 2HZVA 2VFVA 2ALYB 1F9EB 4RNHA 2DO0A 1YLXA 4M63A 4CNYA 3MM9A 2W9CA 1NZAA 3BM7A 3ILLA 4H4KA 1TK0A 3M8ZA 3PTWA 3W1YC 1DY3A 4ZVHA 2Q1LA 3JQJA 2CADA 2FY1A 2ZZMA 2C28A 4RW9B 5EGYA 5ADZA 4O3RA 5D4LA 2CQCA 1ROFA 1G1XA 3MI7X 2EFGA 1T8EA 5D8HB 2MSSA 4C8OA 2E1RA 2DD8S 1IKYA 1X60A 5HI7A 5B7WA 1WTFA 4UZBA 3N28A 3DOLA 3T1HF 2LDYA 4IYQA 1WEYA 3R8YA 3RRKA 3GSDA 2R4FA 1BXNA 2J8SA 1SCJB 4N76A 3LP0A 2HFUA 4DXLA 5KFNA 2LP4A 1L3VA 1RTDA 1TELA 1YJVA 2XCPA 1SJ3P 2R7TA 2HGLA 4GO5X 2RDDA 1QLNA 4Z7CA 2OPRA 3EZOA 3OT9A 4DR7J 2HHSA 4R0JA 2WRMA 3LP1B 4IH6A 1S6QB 3FRZA 3BBBA 2W01A 2DPJA 3TVYA 2VC0A 1C4CA 3R5JB 2FHMA 1R6YA 2V2KA 4F02A 4CZCA 1K9MT 1HI8A 3ZZPA 3CCLS 2QA1A 3FFIB 2V8PA 1NDKA 4G1QA 1CBKA 3MM5B 3D5MA 3EYZA 4A48A 1VBYA 3H2VE 1AFJA 1GXLA 3SCKE 5KFDA 1CJKB 1Y0HA 4M5DA 2FB0A 4XPCA 4E0DA 3W5XA 4NLWA 2DXFA 3I4PA 2E5HA 4O3QA 1NB2A 2A1BA 3O6QA 2M9KA 3OTDA 5CYQB 4TNOA 3EX7B 2OKQA 2W4DA 2Y1IA 1VRTB 4K5SA 3FNNA 4A8YA 5CCMA 2UV8G 1YBTA 3DRPA 5AE2A 1AB8A 3MWBA 1Q4RA 2IVMA 4TXSA 2E1PA 2BJ7A 1X5TA 4D3GA 5I3UB 1SIZA 3KUEA 5IM0B 3HXMA 2X1AA 2DRBA 3H59A 2DH9A 5IV3A 2EW9A 4ITSA 2KM8C 4LVOP 1PC4A 2FGCA 2NREA 4LF7J 2G2YA 2UXBF 2JH3A 4NLXA 1CQNA 1VC6A 2C2NA 4USKA 4UQTA 2EI5A 1MSWD 4OI2A 3JB9k 2E5GA 2I1RA 1URRA 4P2SA 2ZM6J 5F8IA 5A2QY 3DLBA 2G1DA 2W2NP 1DTTA 3CJQA 3D6TB 3GILA 1REGX 2DEJA 2HQDA 2VFUA 5L9NA 3M8RA 4ZCKA 1SV5A 5J2NA 5LJ3Y 2JEIA 2L41A 4NPOA 3H5UA 3FMBA 5BR8J 1I94F 1DURA 3CCVS 2VB6A 4NLUA 2XWYA 2NCKL 2XO7A 4ZKAA 3PYDA 2KFZA 1RAEB 2GIRA 3VAIA 1S1UA 5C7PA 3PO5A 2DGXA 2DR8A 4OLPA 3R3TA 4I7FA 1QJHA 2W8KA 1X0PA 5E2QA 3K17A 2BJDA 2LXIA 4OHYA 1ZZFA 1VQ6S 1HD1A 3X3UA 3OL9A 1CJVB 3VHQA 3HD1A 3MAAA 2BDPA 3THVA 4LUBA 4QWAA 2VC1A 4I56A 3GFYA 4DL6A 1HLWA 4BWJA 1S10A 3R9LA 2WZ1A 4TLRA 3LAKA 2A6OA 3O44A 4N56A 4TY8A 4JB8B 1X7VA 4F0KA 3PFOA 2R2UA 1VQOS 3Q2TC 1D9AA 2RRNA 1F5CA 2LVWA 1NSQA 2CQ3A 5I42A 4ECXA 3PYGA 4IFYA 1FJGJ 3HJFA 2LYVA 5M2UA 4DPUA 2MKHA 5FD1A 2IRUA 3TEHB 3MXHP 1F9FA 2CJBA 3R7SB 1IVZA 2G1HA 1ZA1B 2A0FB 4NMLA 2QT7A 5AXKA 4I2PB 1Q7YT 3QJJA 1KOOA 2MJUA 1LK5A 3ET6A 2I5JB 3VQSA 1EP4B 3OXGA 3TJ8A 3TQEA 2R7XA 4NLYA 2AT1B 2HZCA 4HYKA 4K59A 2DNNA 2UUWA 3AQOA 2QG9B 3Q0AA 2AZ3A 2KDOA 3UDLA 3K58A 1P27B 5ETMA 3NS7B 4ZN3A 5IT4A 4ZHRA 3W64A 5DM7Q 1P8GA 4LF5F 4QW9A 2J7WA 5CHCB 2MQQA 5HSPA 4RNFA 4OZJA 5KFGA 3A1YG 1VS3A 4LIWA 2VQEJ 3T1AA 2YX4A 1NRKA 2PA3A 2CQGA 2PEHA 1LFPA 1RAAB 4CO4A 4EO6A 2LMIA 1ELOA 2XMTA 4CM2A 2MY8A 2PGCA 4DMZA 4LF2A 4LT6A 4YOEA 3BO4A 1VQ7S 3KHHA 2V50A 1U6ZA 4CIOA 3MUTP 3I31A 5C42B 1VLYA 1QDUB 2JX2A 4YEAA 4CP5A 3MECB 1NMEB 3MEGB 1UMJA 1H98A 3K5NA 3NEKA 2BRKA 3BBFA 4OI4A 2AKWB 1XWLA 1KQFB 1SBRA 4H4MB 3K5LA 4DR6J 4LF1A 2X1GA 4GKJF 4PCQA 4U8VA 2IYIA 1TFYA 1QVFR 4J9NA 3MF5A 3CD7A 2DIUA 4RPFA 1IR0A 1Q8LA 2HHWA 3A3PB 4J90A 2YWKA 4NA1A 5GAGI 3MOZA 4NYPA 4WP8A 2BKPA 1JLQA 2IYGA 4PG8A 1LNQA 3NMAA 4MJKA 5HANA 3SQGB 3MEEA 4OMFG 1AXQA 1L3SA 3IP0A 2GW8A 2OJ3A
chains in the Genus database with same CATH topology
2N4DA 3H98A 2B5JB 2RMLA 2LU2A 3KKFA 3OVSA 4FF3A 4Q0BB 3I5AA 4F4KA 2Q43A 4OFZA 1C0TA 3RB3A 2VD3A 4H54A 2V8DA 2RDJA 1OPIA 3CB4A 2RT3A 3GWCA 5KG7A 4FF1A 3M2RA 2NSCA 3JSMA 2XBPA 3KOAA 1RA6A 4F4ZA 4IDKA 3M05A 2ZD1A 3BN4A 4J9SA 1WWHA 3BF4A 3M2UB 1HQUA 4KGMA 4DV3F 2N3LA 5F8LA 4MAKA 2CPHA 1S72S 2JVOA 3RU0A 4N41A 1SJFA 4O44A 1TUVA 2XLJA 2VPZB 3GFHA 5G0RA 3TNVA 4EWTA 2FVPA 2NZ4A 2WB1D 4IKAA 4KV8A 1Y3KA 2Y0SD 3M1VA 1UVNA 5A8RB 3IRWP 4QR2A 3OL8A 4AFFA 4O0IA 1OSDA 1VRUB 4ECQA 2QMXA 3CDBA 2F9JA 4X62F 5J2PA 2VZ9A 3KNAA 1RT3A 1C0UB 4DV7F 1U47A 2MZ1A 1DFDA 1E6YB 2QE5A 4B08A 3F44A 2J0SD 1IQTA 2V4JB 2OFHX 4YR0A 3HO1A 1GQEA 2Q6CA 2MZJA 3QLHB 2P6TA 4TU7A 4MYUA 5FDLB 3Q24A 5SZTA 1WG4A 1YTYA 3X1LB 3UR0A 4TU9A 1DZ5A 1ZYQA 3SSSA 1VIOA 3GG1A 2QA4S 2VPYB 2IJFA 4NZ6A 3SSQA 2QSWA 2ZE2A 2DNYA 1JNZB 3DLGB 1NK6A 3LPYA 1ZPWX 2VG6B 1DBDA 1D9DA 3HK2A 3DYAA 3H8YA 1GNKA 1X4CA 4PG7A 3D28A 4MYTA 5KOXA 5K9FA 3GR1A 1U49A 3MAQA 3R27A 4WFXA 2GCFA 4DQRA 1H38A 5KTQA 2GQ2A 5FLXY 2GHWA 5KFVA 3I32A 3G9CA 5BYQA 1GTHA 1S1TA 3SZ2A 5KT2A 2D3UA 2YKNA 3MM7B 1KLMA 1VBXA 1L3TA 1SXLA 2E66A 1NJZA 4C0HA 3VAMA 4Y00A 5F8MA 3Q22A 2LEAA 2RIJA 5J1EB 4XDCA 3OR1B 3GIMA 2AGPA 1RKJA 1JX4A 4JV1A 2CZVC 2MYFA 2I0XA 3PR4A 3OQ2A 4TQRA 2ZH3A 3GV5B 4EYIB 3D1HA 1ZBTA 1KTQA 3D0GE 1KVJA 3GG0A 2M7SA 1QSLA 2CQHA 2EFOA 3HPOA 2MPUA 3V6HA 4WKYA 3AH6A 2WSCC 1SC6A 3PW7A 1X4HA 1R3NA 3EZUA 3N79A 3GFXA 3PX4A 1O5JA 3E8OA 1QTMA 5DETA 4KKOA 5CA5A 1RI7A 4ZLPA 4HL9A 2R2TA 3M6VA 4UUWA 1RP5A 2FLNA 1DLOB 2DB1A 3LO3A 3UPFA 1B0VA 1Z2LA 3KK3B 2AJ1A 3FEYB 2AGQA 3M8QA 1X0FA 3GB0A 3AAWB 3QGIA 3TW0A 1KN6A 5C24B 1FNOA 4CT8A 5J2MA 1M5HA 4I2PA 4ZCMA 1T7PA 5D3GA 2YH1A 1P1LA 3MZIA 2DGOA 4DF8A 1RT2A 1VQPS 1H6KX 2RQMA 2YWHA 3M2VB 4WU2A 3G4SS 2FVQA 4GC7A 5F8HA 2DHXA 3THTA 1HD0A 3RW6A 2R7OA 1SKRA 3CF5Q 2HHQA 4BS2A 2GNKA 4DSIA 3IWNC 3QGPA 5JJBA 3LWMA 2JVRA 2MGZA 3OHAA 5DG7A 2KFYA 2WHOA 2ZOGA 2DCUB 1J5EF 3B4DA 4CO1A 2D3ZA 2OIHA 2XMVA 3MTKA 4J9RA 2RB7A 2G9OA 2GQQA 3TOQA 4LSNA 3EPGA 3TYTA 1TAQA 3T5JA 4QU7A 4C8LA 4E8UA 4IG0A 4TY9A 3OFGA 3OPKA 2W9AA 5D6GA 2ACYA 3ICLA 2BV3A 2DGVA 3N4WA 2IM3A 5LJ5Y 2W9BB 1FEEA 4DQPA 5E3PA 3IAS9 1RDRA 3QO9A 2FD2A 4IH7A 2XS7A 3LF0A 1U7LA 1XBWA 1Y3JA 4TYAA 3DRYA 2WBRA 1UJ5A 3CDUA 4HLBA 1MNEA 2MKSA 3TUZC 5KG5A 4OZ5A 1QSSA 3PDNA 3BO3A 4JBCA 5AXLA 3WX4A 1R0AA 1WF0A 3VZHA 1JLCA 3R5BA 2PIIA 4N77A 4USHA 3TAMA 3RB6A 3CUNA 5B0AA 1N36F 2M4MA 4Y3CA 3AJ1A 2ASYA 1M1KT 4HH1A 2BQRA 2E5LF 5KFUA 5A0YA 5EHHA 2DO4A 2EPIA 3ITHA 3ZZZA 3MMCB 3OR2B 4U67Q 3FGVA 5L38A 3OFFA 2VV5A 1HMVA 2VBYA 4DG1A 4NXMF 4C11B 5GADI 3GIKA 1FD2A 5DS7A 4Y2KA 1IKVB 3RAXA 5B0EA 4RWXA 3QIPB 1O8BA 5E41A 4ED5A 2CQ2A 5L1LA 2CJQA 3I5BA 1CC8A 1JLGB 1HQEB 1UWBA 1YBAA 2U1AA 3M4XA 2JEJA 4FS1A 5HP1A 1H7XA 2HGMA 2ASDA 3KG1A 3CWJA 4I4BA 4NLSA 4KTQA 5HLFB 2M5YA 4MMOA 1UJ4A 3KLEB 3H4BA 3CMES 2RDIA 4Q43A 2GX8A 2IRXA 1R27B 2LQJA 5H9FJ 5E0OA 1OPZA 4C98A 2E5IA 5B0CA 4ZP9A 2R7VA 2L48A 1FRMA 3H4DA 5A8KB 1T95A 1SUQA 4YY3F 2QV6A 4FXWA 2BE2A 2RS8A 3SYZA 3MPWA 5LSRA 5GMKa 1R89A 4ELTA 3KMQA 2JWNA 3M9NB 1JIHA 3IGVA 3K8WA 4OZ0A 1X9SA 2DTJA 1APSA 1D0EA 2M0GB 3HF5A 1P9QC 2NPIA 3NG8A 2EBGA 2HYIB 1E6VB 3IXQA 3U1MA 4RW6A 2O01C 1QVGR 2YKOA 1JJ2R 3KJVA 1H2TZ 3BGRA 3BJYA 1REVB 4H4KC 1S6OA 1SJ1A 2JJ4D 4AXJA 1BWEA 4IFVB 3SEOA 3CIZA 4ZP6A 2C2RA 1JJ4A 2KRRA 4Y2MA 4QIVA 4LFCF 3T1YF 2B9XA 4M1KA 2WSEC 1Q82T 3W2VA 2VQFF 3MM9B 1N5YA 1X4EA 3DLEA 2RRBA 1JB0C 2CPJA 2WK4A 2HNZA 4QIGA 1HR0F 5C5JA 3OLAA 1VQ8S 3CVKA 2LQ5A 4RBVA 2J6TA 3FCHA 4DR2F 1LXJA 1RTIB 5GAHU 4JI8F 4B9TA 4EUVA 1IUJA 1QUVA 1UVLA 3Q2SC 1LFWA 1D1UA 1TZ0A 3VR1A 2KO1A 3NBPA 3CDEA 4EBEA 4EZ9A 2OP5A 3LAMA 2N82B 3OTCA 3PHEA 4I6AA 3SDEA 4RNNA 1N34F 3KYLA 4DV6F 1TKZB 2KB2A 1DQ8A 4L3NA 3ZZTA 1X4FA 4R25A 3ZZRA 1WD6A 3MGJA 3GIJA 2IA6A 2JDJA 2HWTA 5KFYA 3U1NA 4DL4A 3TVKA 3N5FA 4CTAB 2ZOMA 2XI3A 4BWMA 1RTJA 1VOMA 5KFJA 3H40A 4U7CA 4OJ1A 7FD1A 1VQYA 2PC6A 3SCJE 3CDWA 2FC9A 4JI4F 1EETA 2E7WA 2C3YA 2XZWA 4O23A 2CPIA 1T3NA 4KPYA 2ZH9A 3M8PB 4MIAA 4RW9A 2OPPB 4EGLA 4B9NA 4C0OC 2EVZA 3T19A 4U6PA 4DJBA 4K4UA 4NCAA 3DOLB 2L3MA 3RTVA 3CC7S 4LQ3A 3PJXA 4OZLA 4F2RA 2R7WA 1HNWF 2AJ0A 4IR9A 4Q8EA 1U1PA 3DLJA 1JXLA 2KG1A 3RAQA 1JLBA 3LP0B 2L9DA 4RX6A 1RTDB 3T6JA 4HDHA 1S1VA 1HBMA 3OUYA 2B0GA 3UQSA 2RF2A 4NX9A 4KQZA 3EUNA 2G13A 2AX1A 2E9RX 4A8MP 2VKRA 4LSLB 3I0SB 3V4IB 5A8WB 5CXTA 4DL2A 5LSLA 1HHSA 4C9DA 2WB4A 5ITHA 4A8WA 2XI2A 4KIAA 2OPRB 1VQMS 3NNAA 2ZUGA 5B0BA 2E9ZA 3TR5A 2RRAA 4WFNQ 2VBZA 1FHTA 3OFHA 5EWGA 3Q8PB 2YNFA 4RW4B 1VRUA 5DDOC 4KR0B 1S77D 4DFJA 2UV8A 3DLKA 1S4FA 3HHEA 4J5OA 4IOAQ 3HMJG 5LL6d 4C3LA 5HQ8A 5A6WA 4K4XA 3V81B 4B9SA 2CKWA 4DR5F 4BCAA 3KNGA 1A6LA 3VAJA 4RW8A 3GYXB 3OVAA 1ZPVA 1N56A 4R0EA 4CQ1A 2ZJRQ 3CCZA 4LFBF 2EFPA 1DARA 1HBNB 1TKXB 1UVMA 2BZ2A 1S1WB 2HMIB 1FK9A 4NLGA