2MMYA

Solution structure of the rna recognition motif of human taf15
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
GSHMSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords TATA-binding protein-associated factor 2N
publication title Structural delineation of stem-loop RNA binding by human TAF15 protein
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mmyA01
3S01A 2QEXS 2N82B 3MURP 3EGZA 1H6KX 3BS9A 1L3KA 2QA4S 2DNZA 2CPYA 1VQNS 3G9CA 3IWNC 5GAEU 4F02A 1ZZFA 2KHCA 3BO2A 2BZ2A 3DLLQ 3VAHA 2MKIA 3J7ZT 2ZJPQ 1U2FA 2RT3A 2JVOA 1WELA 4C4WA 2QFJA 1N52B 4QQBA 1M5KC 4WF9Q 5LJ5Y 1U1LA 1WF2A 2MZTA 2M8DB 3US5A 3UD3P 1YI2S 5CA5A 5GAGU 2CQ1A 2F9JA 3NNAA 2M52A 2KXHA 3I55S 1QVFR 3NNHA 5H1SV 2OSRA 3ZZZA 2CQ0A 2CPEA 1WF1A 1YTYA 2CQ4A 2CPDA 2B0GA 3OW2R 2KN4A 2DNRA 1JMTA 1KOHA 2KH9A 3VAIA 2CQPA 2RUGA 2M2BA 3G96A 1WTBA 2DIVA 2DO4A 1HD1A 5IM0B 3NNCA 2DHXA 2JWNA 3THPA 2I2YA 4WIIA 2YH0A 2CQ3A 2RQCA 4WFNQ 2OTJS 3CCJS 4IOCQ 2DGWA 1SJRA 5D77A 4YUDA 2UP1A 2E44A 2GHPA 4PR6A 1VC6A 1WHXA 5DDRC 3J7YU 3G6ES 3RW7A 2XB2D 3CMES 1DZ5A 4LMZA 2CPIA 3CCMS 1URNA 2J0SD 3P3DA 1D9AA 3VALA 1WG1A 1R8HA 4TU9A 4PKDB 2MY7A 1X4DA 4F25A 1WWHA 1X5OA 3CPWR 3UWTA 1HD0A 3EX7B 4IO9Q 1FJEB 1VQMS 1QM9A 2LA4A 3FEXB 2U1AA 1X5TA 5DM7Q 2DGOA 2F9DA 1H2UX 4J5OA 2EK6A 1WF0A 1XN9A 2RRBA 1WEYA 3ULHA 2LKZA 2MGZB 2N7CA 2BOPA 1DBDA 1WHWA 1M5PC 2ZJQQ 1N8RT 3TP2A 1UP1A 3B4DA 4TU7A 2M0GB 1VQ8S 2VOPA 5DDQC 1Q81T 1OIAA 1VC0A 2RNEA 3MOJB 3CF5Q 3SDEA 1VQPS 2DHGA 1U1QA 2MMYA 2DO0A 3S7RA 1VBZA 2KRRA 3UCGA 5DETA 1IQTA 3SMZA 1BY9A 2VODA 5GMKa 5LSOA 2K8GA 1X4FA 2MKJA 2X1BA 2CQGA 1HA1A 3G71S 2FY1A 1SJFA 3CCRS 1S72S 2L9WA 2RRAA 1VQ9S 1VBYA 2EK1A 1PO6A 1N54B 1JJ2R 1ZH5A 2CPHA 2I38A 5HO4A 2LMIA 2MKSA 3CCSS 1SJQA 2AD9A 4QPTA 2DGSA 4FXVA 1X4EA 2DB1A 2MHNA 1KOOA 5GAHU 2MXYA 1B7FA 2DHSA 2HZCA 2LEAA 2DGXA 1G2EA 1VQOS 2L41A 1VQKS 1U1MA 1AUDA 2MQOA 3BO4A 3CCES 2RS8A 2M4MA 3PIPQ 2LECA 2LCWA 3MD1A 2DH9A 3D2WA 1U1OA 1X4GA 5DM6Q 1VQ5S 3H2VE 1K8AT 2OTLS 1JJHA 4OZ1A 2DITA 2DGTA 5D78A 4RU2A 1WI6A 5JVGQ 2DIUA 1WEXA 2JX2A 2M88A 1DRZA 3Q2TC 1DHMA 2DNLA 1R8PA 1X4BA 3CCUS 4W90B 3G8TA 3CD6S 2YWKA 4Y00A 4P6QA 3U1LA 5EN1A 3CCQS 1YHQS 2FPHX 2G1DA 1SJ3P 2YKAA 1U1NA 2FHOB 1UAWA 1K73T 2DNKA 1M5VC 5ITHA 2DGQA 2LYVA 3FEYB 3MD3A 2J0QD 4LJMA 5IM0A 3CUNA 2FC8A 1SXLA 2MZQA 4CQ1A 5MLCV 1VC5A 1QVGR 2J76E 2KXNB 4F26A 1YJ9S 2MZJA 2G4BA 2CJKA 1O0PA 2O3DA 2HGNA 2KI2A 2DNPA 2U2FA 2OSQA 4CH0S 2JRSA 2D3OR 2MPUA 2HGLA 2D9PA 3MUMP 3HI9A 2DH7A 2PEHA 2KU7A 2MJUA 1WG4A 1RKJA 1WHYA 2LA6A 3LPYA 2K3KA 1FJCA 3P6YC 3S8SA 3IRWP 2ADBA 3CCLS 3I56S 1NO8A 1U6FA 2M7SA 2OIHA 2E5JA 4A8XA 3MDFA 3CC2S 3B4MA 2V94A 1M1KT 3VAJA 2MSSA 2YTCA 3SDEB 3PIOQ 3THTA 1PGZA 2CPJA 2HVZA 4FXWA 5LSLA 1FJ7A 1A9NB 3BEGB 1M90T 3CC4S 2ZJRQ 1FHTA 1FNXH 3MI7X 2XS7A 1X5PA 4LIRA 2MGZA 1NJIT 1M5OC 1X4AA 4ZKAA 2MJNA 2DNYA 3SXLA 4W92B 5IFMA 1P1TA 2CQCA 2CQDA 2KM8C 3P5TL 2HGMA 2XNQA 2NLWA 2KT5A 2KYXA 1U1PA 2DGUA 1HL6A 4ED5A 5GADU 2J8AA 2KG1A 1VQ7S 1S79A 2MQPA 2MQMA 3G8SA 2MZSA 1VQLS 3MUVP 3R1LA 2HYIB 1Q86T 4TLQA 2ADCA 4WFAQ 1U1RA 4C7QA 3Q2SC 1YITS 1OWXA 2CQHA 1D8ZA 2N3OA 4CIOA 2AYBA 2WBRA 5LXYA 4C0OC 1X4HA 4U67Q 1N88A 2RU3A 1UW4A 2CQ2A 3NS5A 1YIJS 2XS2A 2VONA 2DNHA 1P27B 2CPFA 3TYTA 1X4CA 2MQLA 2D9OA 2A3JA 1NU4A 3S6EA 4Z2XA 2MKHA 2CPXA 2RS2A 3LQVA 1YWXA 3CCVS 2X1GA 2PE8A 3DXBA 1RK8A 2VOOA 3UE2A 4WCEQ 4OZ0A 3VAFA 2AYMA 2KVIA 1F9FA 2DHAA 2MSTA 3VF0B 1FXLA 2AYGA 2MB0B 2LXIA 4YOEA 1U6BA 1FO1A 2YH1A 3NMRA 1CVJA 3H2UB 1H2VZ 5CYJA 5LJ3Y 2OJ3A 3ZZYA 1OO0B 3CXCR 2L08A 3MUTP 4QU7A 1U1KA 3R1HA 2DNMA 1OPIA 2GO9A 2M9KA 3CC7S 1WEZA 2M8HA 2RVJA 2E5GA 3G4SS 2KFYA 4CH1A 1SJ4P 2LQ5A 3U1MA 4EGLA 1KC8T 3CULA 4WFBQ 1X0FA 2KXFA 5DDPC 4QU6A 2X1FA 2LXUA 3UCUP 3N9UC 2N3LA 3EGNA 2MZRA 4UQTA 2DNGA 2SXLA 1JJ4A 2JVRA 1YJNS 1KQSR 2ERRA 3CMAS 3TO8A 2EVZA 5DDOC 2DNNA 5CXTA 1H2TZ 4BS2A 1FT8A 3K0JA 1Q82T 4WKRA 2DK2A 4Y0FA 2E5HA 3NS6A 2CQIA 2DH8A 4M5DB 2MYFA 2FC9A 3R27A 4UY8T 2MY8A 1ZZNA 2XSFA 1X5SA 1VBXA 5FJ4A 5HL7Q 1WI8A 3VAGA 5LXRA 1K9MT 2DISA 5IQQA 3VAMA 3BO3A 1W2BR 2XS5A 2MQQA 1WHVA 2RQ4A 1VQ4S 4IUFA 3HHNB 5JVHQ 2X1AA 3V4MA 2DNQA 2Q79A 4TU8A 2G0CA 2MZ1A 2NZ4A 2CQBA 2MKKA 3JB9k 2E5IA 3RW6A 3L3CA 4ERDA 4IOAQ 3UD4P 2AYEA 3CTRA 5BJRA 1A7GE 2M70A 3MXHP 4YB1P 2KG0A 2DGVA 1UFWA 1Q7YT 1YJWS 2KRBA 2LEBA 2DNOA 2F3JA 3UCZP 1VQ6S 3P49B 4V19X 1KD1T 4PRFA 2KM8B 3VAKA 2XNRA 1WG5A 2MQNA 5GVQA 2MKCA 2CPZA
chains in the Genus database with same CATH superfamily
2BE7D 2XZTB 3KK1A 1S0VA 1B3TA 3DLEA 4C8OA 3IWNC 2XMWA 4OYBA 4QPXA 3BO2A 2DTJA 4XDDA 4PWDB 2UVVA 3MTKA 3PCOB 1JLFA 1AFJA 3DRXA 3QRRA 1EP4A 1UFKA 1GK8A 3B6BA 1RZMA 4Y3CA 1U0SA 5E41A 1HW9A 2GQCA 2UUBF 2JLFA 1RAGB 3O2IA 5T14A 1S1TB 3F56A 5KFQA 4UY85 4LSLA 1LWCB 2W4CA 5ETTA 4ED8A 4QWCA 2UUBJ 1FK9B 1UL3A 1FJGF 1D9AA 2R4FA 4Q7AA 3K17A 1KHWA 4DV0F 3CDWA 3RZAA 2HHHJ 2MY7A 3MR7A 1TUWA 4CT8A 4X2BA 1HD0A 3M6VA 1TP7A 1RT7B 3B8HA 1UW9A 2WW8A 3FEXB 3F41A 2HZAA 4FYVB 4J5OA 1XN9A 1SC4B 4RW7A 4EBEA 3M8YA 4DV0J 4F0KA 4F4KA 4WTOB 1NK8A 2DKOB 1JLEA 2BACA 2OPPB 4LF7J 1TL5A 2ROPA 3LANA 3A8KA 4DL2A 2PMZD 4ZVSB 1HNXJ 5D4OA 4NXMF 5F8GA 5K8MA 2FZGB 1X8DA 2V2QA 3DRRA 4FKYA 2UXDF 5DQIA 1H7XA 4KFBB 5GMKa 3JQKA 5E3CA 1ZH5A 1IKYB 4F4ZA 4NLSA 3EWGA 5LMUJ 1EZZB 2RDJA 2GMLA 2LQ9A 1SQFA 2FGOA 4P74A 2C2DA 1AZSB 2VDHA 3I31A 2KKHA 4L3KA 4D3GA 3N5FA 4KJIA 5LT5A 1M5HA 2F7VA 1S57A 1R31A 1RHRB 3AOAA 2JX2A 4JOUA 1X4BA 3K5OA 3MM5A 4CO5A 3G8TA 1F0XA 3U1LA 4HH1A 3ILLA 5CZXA 3BPSP 4FNIA 1K73T 3D3CJ 3KK3B 4MK9A 3SSQA 1RT1A 3MPYA 4NMLA 2UUWA 2W8KA 1TVRA 2W1BA 2CAJA 1KTVA 1H73A 4R25A 1YJ9S 2G4BA 2C2MB 2VG7B 4L72B 1T7PA 4JI7J 2L9DA 2ZM6F 1FTRA 2CZ4A 2FJBB 1H72C 5E7OB 4PG7A 4NLGA 4Q0BA 1JX4A 1FVSA 4ZVFA 3UR0A 1B0VA 3MDFA 3JXOA 1JLCA 4YQWA 3OLBA 2CDQA 3THTA 5KFAA 3ZTRA 4DMZA 1M90T 4D3HA 4EK2A 1BXNA 4LIRA 2YQ0A 4NX9A 4EUVA 2BMBA 1YVFA 4TQRA 2FVRA 2P9CA 2ZOMA 4O3OA 1SV5A 5CCLA 2EKYA 3OQ2A 3P5TL 4QWEA 3A1YG 2ZNZA 4LF8F 3EGVA 3QBCA 1IJEB 4DG1B 2XZDB 2J6SA 5AE2A 5KFEA 4JI3F 3RAQA 2PFDA 2F4VJ 3G6YA 4IFYA 3TI0A 1J5EJ 2QL7B 1RTJB 2AEFA 3R9LA 4A8SA 3WX8A 4HACB 1Y10A 4TKTA 4PCQA 1WJ9A 2LU1A 2NXCA 1NM2A 2ALZA 3OR1A 3W3SA 1XTZA 2H65B 3MUTP 3HHDA 3OVBA 5A8WA 3MM7A 2BANB 1OPIA 2R8JA 1S1WA 2M8HA 2E5GA 2XYGB 4U9RA 1IKVB 3KTQA 2X3DA 1B99A 1HNVB 3CJ0A 1RGVA 5DGBA 3P8BB 3DLKB 3T41A 1GXLA 2O1PA 3BB5A 5K14B 2JVRA 2B8QA 5IV4A 4IR9A 3LOUA 2ZH5A 2G2YA 4FF4A 2XI2A 1S0MA 3T6JA 1N5YA 1RAJA 4C3LA 4ECYA 2BJ3A 2YBVA 4O23A 4AT1B 3OL6A 4A8WA 2GZOA 1LNQA 1NBEB 1NLKL 2YX7A 3DLGB 3OFFA 1YG0A 4IUFA 5JVHQ 1SBRA 3DC2A 1N5QA 4IOAQ 3RB4A 4ECRA 4UOFA 3BQ0A 1KVJA 4F2SA 2VD3A 4ECXA 1YJWS 4WP3A 2XHCA 1JLBA 1VQ6S 1K1QA 1KD1T 2BW7A 1ZTWA 2RQMA 2ASJA 3C14B 3B54A 4F0MA 1CULA 2VPZB 5ADZA 2Y8YA 5KFNA 1RT4B 4Y28C 4DL3A 2KHCA 3H40A 1ZM2A 2QLBB 2CJYB 2JVOA 3AQPA 4WPAA 1FDAA 1L3SA 3HCXA 4NA2A 5GAGU 2F9JA 4S0MA 3I55S 5HANA 4V19J 1IR2A 4JI4J 4Z7YA 3QQCD 1G3OA 2CQ4A 3LWLA 2I2YA 2AHOB 3QGGA 4DHVA 4Y6IA 4P2MA 3M30A 4PR6A 3NGTA 3VHQA 5DDRC 3RW7A 2XB2D 4DX5A 3GIJA 4M5HA 4CP5A 3D54A 4J90A 3LUYA 3UN2A 1T05B 1U25A 4I2QA 5RUBA 1GQEA 1Q95G 4LRBA 4CLFA 4E98A 3ILJA 5E3AA 1GTHA 3RB0A 4ER8A 3K89A 2RRBA 4ZK7M 3HKZD 1AYEA 3OXLA 1DQAA 4ZVPB 4IKAA 4GVBA 2VOPA 3T5JA 5D4NA 3MOJB 1N4LA 3CF5Q 5D0RA 4RX6A 4DQRA 4RNHA 3DDKA 4F36A 4DCOB 4DV6J 3PX6A 1VBZA 4PG8A 3BDEA 3PX4A 1JXLA 3G71S 3SV3A 3D6TB 3M32B 1SB6A 4USTA 4YR2A 3CCSS 2MEWA 4KR0B 1PAEX 2QZ8A 4CLKA 2GMHA 1UVJA 3IBCB 3KUHA 4P2SA 2E1PA 4DSKA 3G82A 1YJRA 3PIPQ 1XBWA 4WXWA 3D2WA 1F9HA 2R7SA 2XMVA 4K4XA 2XTJP 4H54A 3I0RB 4RU2A 2HVDA 4DPUA 1PBUA 3CCQS 4ZA1A 4DUYF 3M4XA 4PQUB 3GPAA 1E6YB 5BYRA 1LW2A 4FVCA 1TL1B 2W7AA 1HWLA 2AF6A 3DRSB 4KHRA 3RBEA 3KLEA 4YFUA 1QTMA 4ICLA 1CPZA 2KI2A 4ZPDA 2WVCA 1N36J 3GONA 3IR7B 2MJUA 3IG1B 4JI2F 4QYZJ 4MH8A 4PAAA 4NWBA 2QTWA 2C3YA 3M8PB 3WDOA 3VAJA 2MSSA 4HTJA 1VFJA 3MECA 3PV8A 1R0BG 1FDBA 4X66F 2CVEA 1I6JA 4NPOA 4ZKAA 4EZ9A 2K06A 2EW9A 3UD5A 1VLOA 4RW6B 5KG6A 1Q53A 2UXCJ 2EFPA 4ZPVR 1GXUA 1R43A 1REGX 3EMTA 4Y2IA 1VI7A 1U1PA 1KLMB 4ED5A 3OTOJ 5KT2A 1G1XA 4OIXA 3MUVP 4OHYA 3OSNA 4ETXA 3RRHA 1OWXA 1HW8A 2QA2A 1SI9A 3RGIA 2W2MP 2HNZB 1TMMA 4ECVA 1UW4A 2VC0A 1M1HA 4DCJB 1NRKA 2VG6B 5AT1B 2WHOA 3MPUB 2CYYA 3PACA 3T1AA 2GHWA 2PMWA 3M9OB 1ULRA 3PNIA 1IVZA 3CDBA 1S4FA 5CYJA 1C1BA 4OHXA 4RWXA 1VK8A 1R27B 2DEJA 3QIPB 3FVYA 2RIJA 3M1VB 5H9EK 5D3GB 4ZN1A 2RAQA 1WSVA 3I9ZA 5AJ3J 3OSPA 2DR7A 1TZ0A 2OPRA 4QU6A 2J0WA 2HFVA 2QLFB 3NEKA 1T94A 3PX0A 2QN6B 4Y2KA 5DDOC 1R8BA 2JSXA 3PKYA 1HNZF 1U09A 1Q82T 1MU2B 2MYFA 2HIQA 5KFYA 2XO6A 1FKOB 5CD4A 1D9DA 2J7KA 2J7UA 1WI8A 2IM2A 4DR4J 1T9UA 1I3OB 3QAUA 3HHNB 4MAKA 2X1AA 2ZH6A 3L3CA 2GMJA 3NCPA 3GJRB 3L9ZA 3PHEA 3GJSB 3PRDA 4PRFA 1S9GB 3JSMA 1Y11A 1R8AA 2MKCA 1N56A 1F6TA 4RPFA 4NL5A 4YP3A 3M6XA 1R0AA 2OPSA 3BGUA 4K0KF 1GEHA 5LJ5Y 3W61A 2MZTA 4NYPA 3UD3P 3NNAA 2KXHA 4GO7X 4CZCA 3C8YA 1RYRA 3EZUA 4AXJA 3VQTA 1WF1A 3OW2R 3DDNA 3W5YA 5IM0B 2W2PP 2BQRA 2J9DA 2E5LF 1OSDA 3PVXA 4ZJLA 1SJRA 2HAFA 1TKTA 4WKYA 3I96A 2QLXA 2YKNA 2VFSA 2E5LJ 2ZZNA 1OPZA 2CFXA 1HBNB 1TR0A 4MKVA 1QM9A 2U1AA 2KO1A 2R3VA 3W8GA 2N7CA 3UVJA 2PI4A 4XTTA 1RTIB 2B9WA 2VU5A 2VG5B 3D0GE 2AJ0A 3GU0A 2G0JA 3QO9A 3ILOA 4DFJA 2PDAA 1U1QA 1DLOB 5IOLA 4R8UA 6FDRA 4M63A 3ONQA 1KWMA 5DETA 3SMZA 4DU8A 4HTIA 5KFOA 3QSYB 1UVLA 1KFDA 2H51B 2YX1A 5KG3A 3D0HE 1MROB 2VFTA 4CRJA 1XERA 1XMOF 2AZ1A 2R7QA 1B7FA 3VV2B 3CE8A 2HS0A 1F2HA 2H4WB 2MHEA 1Q5YA 3C6TA 2EFGA 3AY0A 2RS8A 1HNWF 1LW0A 4K7QA 4AQYJ 3NOCA 4JYAF 3TX0A 4NLXA 4L73A 2W24A 4OL8A 1KQKA 2IVFB 3C2PA 2YWKA 2WVDA 4LF6F 1YHQS 1RT6B 4OFZA 2YKAA 4DV4J 4WTYA 3T1HF 4ZCIA 4MMOA 4QYZK 1CJUB 4KGZB 2XLJA 3OTCA 3Q0AA 3OL8A 4LF6J 2VA2A 3J7AN 4M5IA 4LRAA 4QBUA 2HQCA 5HQ8A 2RMLA 3LF0A 2NSCA 4ZJOA 1PC5A 3CD0A 3R97A 4LF1A 4EI2A 1IKWA 2I1RA 3MMAB 3B4MA 1NKEA 5A76A 5J2NA 4IRCA 1QSLA 4XDCA 4LF4F 2ZH3A 4GKJF 3MR2A 1CQNA 3UQSA 4N77A 2E1AA 3QMQA 1KP6A 2P9GA 3DLEB 4OYIA 3NWRA 3OHBA 4LR8A 5LM7E 1SVDA 3CNQP 4LF4J 2QO3A 4DN9A 3DLJA 2J9DE 3CJ3A 4CLYA 1JLFB 1EP4B 2N3OA 3EPIA 1B0TA 3HKWA 2DT9A 4A8MP 1VDHA 4DWIA 1UWAA 3GJQB 3TAQA 2RU3A 4ZIVA 2DNHA 2VDIA 2ZOGA 3MPVA 4JI8F 2D9OA 5ETRA 5HVHA 4LSLB 4PYAA 4WK3A 2GV1A 4CO0A 2W7OA 1RHJB 3GFZA 3VAFA 3BJYA 4I56A 2KVIA 5HROA 2HBYB 1TL3A 2LXIA 4C8KA 1CVJA 2YQ1A 3NAHA 1HQEA 5KOXA 4AXIA 1ZS6A 4B3SF 3CC7S 2RVJA 3ISNC 2KT2A 2LQ5A 3WHIA 1P9YA 2ZFHA 3HHLD 2F4FA 4NLUA 5IZHA 2Y1LB 2X1FA 5D6GA 4RW7B 3LP1A 2F40A 5D0GA 1IN0A 4L6V3 1TUVA 1PYSB 4ECQA 3PM9A 2YKOA 4CO1A 2HPUA 2L3MA 4YR3A 2CQIA 2DH8A 1EB0A 4QIVA 3GIIA 4DSIA 1VBXA 4LQ9A 4OZ5A 5M2RA 3DRRB 2ATLA 5C25A 4P10A 1ELOA 3D9BA 4J9SA 2ROGA 5C42A 4DV3F 1JLQA 3EXCX 1Q7YT 3HHLA 4V19X 3CSKA 3HSDA 1MMNA 2C3UA 1SKWA 3HVTA 4WBFA 2QMWA 4DV3J 2KZZA 4CM2A 1IBCB 1D0EA 4F50A 2EXUA 5EWFA 1PIEA 1U4BA 2BZ2A 2DYAA 3QFWA 2ZJPQ 5CHCB 4RZRA 4ETZA 3MM5B 1YSJA 3ZZRA 1NCLA 4OI0A 1U49A 3NNHA 2H5EA 3N4WA 3FSYA 1YTYA 3KKFA 1RWXB 2XCAA 2HWIA 2WSCC 4FPIA 1RT1B 3PYEA 1TVRB 2ZZTA 2V8DA 3L7OA 3FBEA 4J9PA 2BUNA 2AIRB 1Y7PA 4HI1A 3T5LA 3CCMS 4Q0BB 3OXFA 1KNZA 3N5BA 1SQGA 3O6QA 2ZD1A 3O3LA 4OJ1A 4Q5VA 3CPWR 1JLCB 1YDLA 1I5OB 1N5SA 3I6PA 4ATNA 3PR5B 2GAHC 3EE3A 3UDCA 3QIDA 4X4TA 4M94A 2BOPA 3IN5A 2V8VA 1QE1A 1SV5B 3WC2A 4DL7A 4C8NA 4IQXA 3EPGA 2BOAA 1I94J 5LMNF 1VOMA 2HFSA 1ZM4A 2ZEJA 4TXSA 3UCGA 3UDEA 5B0CA 2ZH4A 2R7UA 2OMLA 3GCXP 3PW4A 3QGHA 2FY1A 4Z7CA 3DOKA 2C2OB 3QLHA 5KG1A 2DBBA 5CABA 1JLGA 1MWYA 2UU9F 2RJZA 3QYYA 3OR1B 3RYLA 2Q3PA 4EEYA 4ZPBA 5A8WB 3MM7B 5DJBA 2C2NA 1S1WB 2VFVA 4QIEA 1U7LA 3W2VA 2B7BB 2QIFA 2FPHX 3H90A 3MHYA 3TJ9A 2BM0A 4HT5A 2HS4A 1V5VA 3J7YI 1S0NA 2R42A 1YJ7A 2J0QD 2IMOA 4USHA 1N5YB 3GB0A 4ZVUB 2ZH8A 3GFYA 2DHHA 2DNPA 3NP5A 1PYOB 4KO0A 5I3QA 3P6YC 1LV5A 2HVIA 3I0SA 1OJ4A 1SIZA 2FLLA 4F8RA 4NXNJ 4HHHA 4PEOA 2IVMA 3V6JA 1JKHA 2IFXA 5H9FJ 1PGZA 1A9NB 1JLBB 2UUCF 2VJUA 1GFWB 4DSLA 1YJVA 1NK7A 2VFUA 2MJNA 2DNYA 3K2YA 3V6HA 1CULB 4DI6A 3N6NA 5G0RA 3P5BP 3RJMB 2HBZB 2XC9A 2R8HA 2ZC3A 3QGIA 3R3TA 3ZZTA 4NE9C 4R0EA 3K8WA 3SCIE 2W2QP 5BR8F 3WZ0A 3BKTA 1EAYC 1P8GA 2B56A 1WTFA 2V8GA 1Z1ZA 2CPXA 3E8OA 1J5OA 2LDIA 3M30B 4O3PA 3TARA 4F4XA 1R3NA 4AL7A 5DQHA 2C2ZB 3V4IA 4ZVQB 2IJRA 3IA0A 2M5YA 3P96A 4I2QB 2GO9A 2Q6BA 1ZAWA 5C5JA 4KT0C 2J9CA 2HQDA 2BJ9A 2XZWA 2VV5A 4CLLA 2X3GA 3W8PA 2EVZA 3A3NB 1I51B 3HPOA 2VIHA 4GVBB 4WKRA 3OXGA 3NS6A 3X3UA 3EICA 2QV6A 5DS7A 3KHHA 5LXRA 1HI1A 4LSNA 2JZ5A 2HAIA 2OHDA 4OZNA 4DQSA 4NYZA 5KFHA 2GHVC 4LBHA 5ETLA 3Q24A 3GV8B 4W4MA 3NKYA 4B9MA 2D41A 1B70B 3HSGA 2PC6A 1T03A 2KM8B 2UZAA 5KFKA 5GVQA 2DO4A 3CJSA 3D3BJ 1T3OA 3EGZA 3GIKA 3G82B 2HQ3A 4Q8FA 1VGYA 2JC0A 5DLFA 3DXSX 1S1VA 1PC4A 4B08A 2VHGA 1WELA 2XMKA 1X9SA 4KAIA 1NH8A 5I3UA 2CQ1A 1ZAXA 2EC0A 1PBAA 5AE3A 2Y1IA 2W7PA 2CIMA 3MFHA 4USUA 4CM0A 5LSRA 2RUGA 2DIVA 1F9EB 1LW2B 2E1RA 3W9HA 2DJWA 4WWSA 2EG2A 2GCFA 1RABB 4IOCQ 3JSYA 4MFBA 3BV8A 3KLEB 4KYZA 1VC6A 4ICLB 2HFZA 2E7VA 4DPWA 4DR7J 1Y9OA 3CDAA 1K0VA 2A6MA 3GP9A 4X62F 1S6QA 2LDYA 1S59A 1M1GA 4GKKJ 2JJ4D 4URQU 1PYTA 2J6TA 1N5VA 2ZBCA 3MECB 2OGUA 4X62J 3QAEA 2P8IA 4YHHF 5K8PA 2FHKA 2BV3A 3CDEA 4LF2A 3T1YJ 1X9WA 3TUJC 4ED1A 2M3DA 1ACMB 4A47A 1OIAA 1TAUA 4MTPA 1F5BA 1XK8A 4DDFA 4Q2LA 4F04B 1YRTA 2DHGA 4O44A 3UW1A 4OI6A 2FYXA 5KT7A 3TANA 3M9NB 1Q1KA 2YWGA 1HWJA 1RUSA 4X4NA 1SJFA 1ZOTA 4Y2CA 5BYSA 2YVSA 4X4QA 4Y2MA 3FGVA 5DLGA 3EGWB 1RXOB 4B9LA 4JBCA 2ILYA 3D28A 3MM6A 1C1BB 1SCJB 1CC8A 4YDXA 2M88A 2MLYA 3LGMA 3KNAA 4NCGA 3HFZB 2J0XA 1FRKA 4OYXA 1W2IA 2OPRB 3KLHA 3FEYB 1FVQA 2O01C 1X9MA 2HLTA 4K2XA 5HLFA 4QIWD 1P6TA 3NCQA 3A3PB 2IA6A 1IBKJ 2YNHA 4FYYB 2ATCB 3MUMP 1YK9A 3N01A 4RU9A 3S8SA 8ATCB 2VQEF 2QMUB 2GO8A 3G6VA 4KBIA 3CT9A 3DI6A 2R8GA 2VQEJ 3L95X 2VQFF 4LFAF 2MGZA 3JSMB 4NZ7A 1TQLA 4J9VA 2Z2MA 1NK6A 2HNYA 4LRCA 2KM8C 3OT9A 5DG8A 2VQFJ 2KT5A 4LFAJ 1R0AB 2OPSB 1GMWD 1H98A 3D67A 2NQPA 3IAM9 2IM1A 4KY3A 1RTHA 2AT1B 2GIRA 1BUXA 1VHFA 5KG5A 2K2PA 2BEFA 2CQ2A 2QG9B 3NS5A 3NOGA 3SFGA 1YIJS 4P7TA 3DCAA 1KTQA 1RACB 1XIQA 2Z57B 2Q1LA 4KIAA 5CYQA 1Y4ZB 2FVQA 3H7HB 1TKTB 1QAXA 3KUGA 1U0HA 2YKNB 2YH1A 1WKLA 3NMRA 2OJ3A 4PWWA 2FGCA 3GMGA 1QD1A 2L9NA 1WEZA 4WZMA 2HHTA 4LVOP 1GMWA 3DMJA 2HHXA 3D6HB 4EGLA 3GFXA 2VKZG 1BQMA 2KXFA 2IRXA 3TEHB 1HYSB 2LXUA 1TTHB 2VBXA 3EGNA 3IC1A 3UVJB 3I4HX 4P71A 4U6PA 3QO9B 2HQFA 3NL0A 2DR9A 1IWGA 2G2OA 2V68A 2O66A 4R8UB 4QJVA 2MQQA 1HKAA 3PYDA 1WORA 3M6UA 4UT4A 2NXJA 3NY0A 3UDVA 4L3NA 2C3PA 4ERDA 4I2PA 5L39A 2DPIA 3CTRA 5BJRA 3MXHP 5CH7B 1N32F 4FYWB 2BABA 2W25A 3OJSA 4IRKA 2QEXS 1S1XA 1VK3A 1DY3A 4C11A 3R5CA 1GMUA 3C6TB 2CPYA 1FRIA 1YKWA 2AMCB 1LW0B 2DXDA 5I4MA 5IS2A 2C2KB 2MKIA 2RT3A 1NJZA 1N52B 2PD1A 1U1LA 4P2XA 5A0YA 3KLVA 3KLIA 5IT0A 5H1SV 5A6PA 3JQMA 3AT1B 3ZZ0A 2KYZA 1T8EA 1XNQJ 3M2VA 1XR7A 3HVAA 2ROEA 1YBAA 2PI5A 2XI3A 2E9RX 4F3MA 4DUZF 2YNIA 4H4MA 4RW8A 2R7XA 1YRUA 1NJWA 1URNA 2HK3A 1FXRA 2OPQA 5B0FA 1IKXA 4ILRA 1JNZB 4YY3J 1IKWB 4DUZJ 2FJWA 1HQ2A 4WFXA 3UWTA 1KHVA 1H0HB 1FJEB 3G8QA 4URGA 4DF4A 2DGOA 5J2NB 1Q8IA 2Q6CA 3PTWA 4DR1F 3A8JA 5LOQA 1VQ8S 2BKOA 5DZ7A 1Q81T 2FY8A 3HZEA 2RNEA 5F3ZA 4UTGA 4JI0J 4RNOA 3KWMA 4WU3A 4M5LA 1JWWA 5HMWA 1IQTA 1V9OA 5LSOA 4IG0A 1AXQA 3RBZA 2BJEA 4ID5A 4DS4A 4X4RA 4ZPWR 1KOOA 3LW5C 4DQQA 3HD2A 3Q8RB 4V1Ak 3O1LA 4A8KA 5HROB 2LCWA 3MD1A 1TL3B 4PWUA 4KQZA 3KJVA 1TAQA 3NS7B 5SZTA 1HQEB 2XWXA 3I87A 2OTLS 3NBPA 1JJHA 4OZ1A 4B9SA 2V4RA 2EG1A 3N0VA 5IXUA 4YR0A 4M5GA 2AJ4A 4PG5A 1AW0A 3ZZOA 1FFSB 2FQQB 5J1EA 5ITHA 3LP1B 4ANDA 3EXYA 3QWUA 4CQ1A 1L3VA 2ZVSA 4LIWA 3Q8SB 3H5UA 3FCHA 3OTBA 3KUEA 5D0HA 4HEA9 3CJTA 2E7WA 2QX0A 2OP5A 1NPRA 1WHYA 2XEXA 4JP8A 4K59A 5C25B 1U6FA 2B51A 1HR0J 3NRBA 4DV7J 1TV6A 5C42B 4ELUA 3R2CJ 3EVMA 1AROP 1JLQB 4NLTA 1KEKA 3VGSA 4OX8A 3HHLB 4MT1A 3DRYA 2HKEA 4H4OA 3HVTB 3AXMA 4W92B 1N33F 2KFZA 2OD4A 3POTA 3EJMA 1P1TA 2IPOB 2HGMA 2RSQA 4DL6A 1X0PA 3DGPA 2QYCA 4O3QA 2KFNA 3G8SA 4ED2A 2D74B 3SSRA 2V6AA 3F73A 1YITS 3PZPA 2WBRA 2CVIA 4M5KA 3R5GA 3TW0A 2AZ3A 3QJLA 2DXFA 4QIGA 2WVFA 3CD5A 3S6EA 1RT2A 3UN3A 1WNEA 3MEEA 3ZTOA 4CWBA 5I3PA 2MSTA 3D68A 2DRBA 4IOBA 4HYKA 1QAJA 3CXCR 5K8NA 2J5AA 1FA0A 2HLUA 1LEOA 2IC3A 2ZD1B 2KL8A 4B3TJ 3BN4A 2B43A 4JV0A 2B3TB 1UJ4A 1Q78A 4OQJA 2PIIA 2C3OA 4CLPA 4ZLJA 1CBKA 3VQSA 2NUHA 2J9EA 3EUNA 5HSPA 1QE1B 1XR5A 1WC4A 4LF5F 1KONA 2AU0A 1GAOA 1WOSA 3FKBA 5CAAA 3DHXA 3TJ8A 5A8RA 2G0CA 3LTOA 4WIQA 1HBUA 1SUQA 3DOKB 4XK8C 5EHHA 3R6LB 9RUBA 2F3JA 3QLHB 2APOA 2HURA 3MAQA 1JLGB 3CCZA 4URSA 3OJUA 4R0JA 1YBUA 1JIHA 1ZZFA 3TZYA 4K4YA 1GMVA 1EHWA 4RW9A 3JAMY 2AGQA 4O4GA 4LQ3A 4WF9Q 1KVKA 4MJKA 4R5PA 3L09A 3ISND 5EX0A 4ZVGA 3GJTB 1B64A 3W2VB 5IWAF 2RDIA 4J9LA 2WVBA 3R7BB 1BE4A 2B0GA 2W01A 2YPYA 4ZVEA 3NNCA 3CDUA 2GAGC 2A2DA 2CQ3A 4ED4A 2GQ2A 2DGWA 3ENAA 4CO4A 1XJWB 3A12A 2YPZA 4KO0B 2EC2A 1MNEA 3RU0A 4IQMA 3D5MA 4DFMA 3D0IE 1GTEA 3C3LA 4KKOA 2D3ZA 1RAOA 3C46A 1WWHA 1RWPB 2H4YB 5L9XA 4OYWA 1VQMS 1JKHB 2LA4A 5DM7Q 1RWUA 2F9DA 3GCWP 1FNOA 2B4UA 3ULHA 1OYEA 4ID8A 2PO4A 1RWWB 2ZUAA 1SC6A 2CADA 4LBPA 1YRXA 1Z4UA 3HHLC 4N76A 1RWMB 4H4KA 5G0RB 3EVOA 2ZH1A 3UI3A 3RUBL 4CDIA 3E3XA 1BY9A 3MTJA 2CQGA 1TKDA 4DJBA 2B5JA 1PO6A 2EK1A 1JJ2R 4KPCA 3PHTA 2I38A 2XHWA 3OL9A 3O5TB 3NGRA 3SCJE 3Q8PB 3K8VA 1JJCB 2A10A 4Q45A 1J5OB 1F2GA 1PJ6A 2H48B 1U1MA 1QLNA 5ETQA 4K4UA 3HVRA 5JJBA 2WSEC 3V4IB 3P45B 1U1OA 4PPZA 2EWHA 1NJYA 2Q66A 1K8AT 4GC6A 4RBVA 2Q43A 1NK9A 3K5LA 1H3DA 2VBYA 3HSZA 5B09A 2G1DA 1IBLJ 3GYXB 5HJYA 2HRUA 3IM8A 3PXGa 2LYVA 4ANEA 4X65F 4ED3A 2LQBA 4KE5A 4UZCA 2VBWA 2ZWPA 4P2FA 4ZCMA 2BR0A 1I1GA 4HH0A 2DR8A 2D3OR 4C48A 2DH7A 2YY3A 2K1RA 2DRDA 3LPYA 3IBWA 2G0IA 5A2QY 1K0TA 5F8HA 5DG7A 2F63A 2OIHA 2ZHAA 1AUSL 2W8LA 4U7UD 4O4RA 1SQEA 1OQ3A 3I5BA 4JI5F 3EM1A 2BRLA 1FHTA 2C3MA 1T03B 3HJVA 4WYWA 3J80U 1VS3A 4DV1J 4DSJA 3MEGA 3DLBA 3BKUA 4BC7A 1HHQA 2XCPA 2DGUA 2JFKA 3SV4A 1X7VA 1S1VB 2MQMA 4RKUC 3ZTQA 4K4ZA 4WFAQ 5KFVA 4N5SA 1NAQA 5I3UB 2CQHA 2HQGA 1KDNA 4IDKB 4FYDA 3IM9A 4A8OA 1N88A 4NLWA 4TY9A 2CRLA 5KFBA 4DXLA 3IR6B 4USWA 4RW4A 2ZKUA 4ZS6A 1H74A 2AW0A 1D9FA 1FWLA 1ICEB 1FNMA 4MFBB 5EUHA 1WC6A 2AYMA 1F9FA 4C6AA 3UNYA 1NK0A 2MB0B 4OLOA 2IHR1 5LJ3Y 1SKSA 5HVGA 4PYDA 1S6QB 4HL9A 1RTZA 2OEMA 3BM7A 2VC1A 1U02A 1FRMA 5D4LA 3LO3A 1KC8T 4WXOA 2HHHF 3AD8C 3CULA 2ILZA 4YB5A 2UUTA 5IT9Y 2K7JA 3AXKA 3IMQJ 3TAPA 2MZRA 2RQKA 3QJPA 1NDCA 5CXTA 1H2TZ 1NDLA 3K0JA 4LF7F 3PKMA 3AB2B 4MIBA 3PJWA 1RAAB 1S48A 1K47A 4O44B 1HNXF 1UVMA 3UDLA 1S6PA 1WHVA 2AQ4A 4K8RA 2AKWB 5K5MA 3UD4P 1RWOB 5CCMA 3DDIA 1G6BA 3HDSA 1NB2A 4ECSA 5LMUF 3GV7B 2MQNA 2D3UA 3DM2A 4Y65A 2HW3A 3BS9A 4USIA 2VPXB 2DY9A 3TVYA 1DTQA 1VQNS 4RNFA 1KR4A 1Q5VA 2NPIA 3MM6B 1HNIA 2ZOFA 3MFIA 2R7VA 2JEFA 3JS9A 1J2VA 3DRPA 5F0UA 2DCUB 3N6MA 4AUKA 3Q22A 2QGFB 3ICLA 2KTQA 1AZSA 1F3FA 3TZXA 4NCGB 2HEKA 2HFUA 1VRUA 2F65A 2CPDA 5J2PA 2DNRA 1QSSA 3KLHB 2MKYA 4BBYA 2DHXA 4B3RJ 4CYUA 2YH0A 2B4VA 5M2UA 5HLFB 3W2WA 5D77A 2XLIA 2XYPB 2YNHB 1S9FA 1SKRA 4QZVB 5J2QA 3VWSA 3BQ1A 1RSCA 4JI7F 4KB7A 4Q8EA 1HHSA 1NKBA 1GXTA 4OHWA 1HARA 4M8LA 1RJJA 4I69A 1GX6A 2UVRA 1CJKA 3R2DJ 3GE9A 1NSQA 2N4CA 4IR1A 3DI6B 1FXDA 2GW8A 2HVHA 4NZ6A 3J80Y 2W9AA 1G7CB 2MGZB 2BM1A 1NPKA 2CG8A 3V81A 1N8RT 1U48A 2HHSA 3G6XA 1FESA 3MAAA 5F41A 1UA1A 2I0XA 2JL9A 5FLXU 1RTHB 4G65A 2VODA 1RP5A 4UOHA 2VBZA 2GFFA 2F4VF 2L9WA 3I82A 1J5EF 4GO5X 1EQ0A 1BHNA 2AD9A 1Q79A 4NYOA 5FIIA 2ZHBA 3PFOA 4I1TA 3OUYA 5CYQB 4U8YA 4CCHA 1R7IA 5IV3A 1U0HB 5ETKA 3QT6A 3RG6A 2LECA 1IBMJ 2FVPA 1KS2A 3LH2S 3AOBA 3T3FA 2DGTA 4CI0B 1WI6A 5JVGQ 3OTEA 4QR2A 1DHMA 3DMJB 2FLPA 3KDNA 3AD7C 4U96A 3KG0A 4PUOA 1CEZA 1WDDA 2BA9A 4RBTA 1BQMB 4J9MA 5F9LA 3EYZA 1M5VC 5EX3A 4P7VA 4KSEB 5F8JA 3L7PA 5E33A 5B0BA 2YNGA 2BANA 4FXDA 1UPMB 1AT1B 4U95A 4MK7A 2KXNB 3HULA 3QSIA 1RT3A 1T0TV 2IRUA 2B4PA 2XWYA 2PFFB 1RKJA 1V3ZA 1CG2A 4U7CA 5EDWA 5H9EJ 1AB8A 4I6YA 2BKPA 3PW0A 4I2PB 2JOQA 5F8NA 3RRGA 3HJFA 2Y1RI 1FRXA 4G1QA 4FXWA 5LSLA 1U45A 3CC4S 4F2RA 2HK2A 4EBCA 4ZMMA 4PPDA 3R5JB 1S1XB 4FBTA 5AE1A 4C11B 3SXLA 4G1IA 3C66A 1KKHA 2CQCA 4KRWA 1MN7A 3PR4A 3BREA 2UUAF 3K59A 1R6YA 8AT1B 2ZDOA 1HL6A 1Z2ZA 4KGVB 4DPYA 3W60A 4I64A 2Z4PA 3F0NA 2W2NP 3KDOA 5A0YB 2JH3A 1D8ZA 3KLIB 4NI2A 2UUAJ 2AYBA 5LXYA 4U67Q 4JI4F 4DR5J 4B3MJ 2VONA 3CJKA 4IFVA 3M2VB 2DXEA 2CWKA 2H5JB 4QWAA 2G9OA 3ETOA 3HP6A 3CB4A 2YNIB 4H4MB 4KHPJ 1N6QA 1U6BA 1FO1A 4RW8B 2Z56B 1VR6A 3SQOP 1U1KA 2NREA 4DFPA 3FCVA 2OPQB 3OFEA 1IKXB 2ABYA 4EYIB 4B9VA 4DU7A 2IMWP 5B0AA 1N48A 1RB0A 2A0FB 3NLCA 1O5JA 4RR5A 1VISA 1DQ8A 2RUSA 4ED7A 4JI6F 2X7IA 2DK2A 4Y0FA 1TL7A 1CC7A 3R27A 2PT0A 4F3OA 1X5SA 3MMCA 1TMJA 2FHJD 5FLXY 2CZVC 1EETA 3U1NA 2XS5A 3FJ2A 1UEVA 3BH7B 1FWPA 4DV6F 4JI6J 1LFPA 4CTAA 5KG0A 4CO2A 7AT1B 3LALA 2DRAA 2IBOA 3SQGA 2RD5C 4IG0B 3U27A 1V3RA 2M70A 2DGVA 4ID5B 1N0VC 4DR3J 4DR6J 3VAKA 3W9IA 3MR5A 3PY8A 4NA3A 3A8IA 3BPDA 2UVUA 1RI7A 3S1TA 2UXBF 4EFAC 1L5UA 1T9VA 1Z2LA 1ITPA 4B3OA 3KJVB 2GIQA 3IO1A 3FRYA 1WACA 4GMKA 3NBPB 3Q8VA 1U2FA 1M5KC 3ELHA 2UXBJ 2FHJA 1UA0A 2BBEA 3FQLA 3GG0A 3AJ1A 2ZBQA 2YWHA 4LREA 1DFDA 1HIYA 3W66A 2C22A 2CQ0A 2AP6A 2HSEB 4A8YA 3TUZC 1KOHA 5J1EB 1WTBA 2BDPA 5F3TA 1IR1A 2FLNA 3THPA 2CG4A 1Q8BA 2HG4A 2RQCA 3C15A 2RE1A 4IH6A 2OUGA 3HO1A 4C98A 3I4PA 1TFWA 1N36F 3P3DA 2LXFA 3Q89A 1HPZA 3QATA 2IAJA 4O0NA 2NR0A 3TOQA 2YKMA 1S77D 3GYGA 4DF8A 2H1YA 1LK5A 1TV6B 3KOAA 1PJ5A 2XQCA 3ENWA 2NYHA 1S99A 4LBIA 2B8PA 5E5NA 1WHWA 4H4OB 2IVYA 1QUVA 4TU7A 3POTB 2HFNA 2UXCF 3V5RA 4JV5J 3MEDA 3DGPB 3M6WA 4WZQA 3HLUA 1RCOB 2ZVIA 1C2PA 3OTOF 4LR7A 5SUHA 2EKNA 4ILLA 1VBYA 3RTVA 4LF9J 4QWBA 1VBKA 3OD2A 2KVQE 2LMIA 3EZOA 3M7VA 2F1FA 2XMTA 1X4EA 1RT2B 1FDDA 2LQJA 4OLPA 1AUDA 3MEEB 2WK4A 4N7TA 1RA6A 2DH9A 5DM6Q 2A1BA 1NMEB 2WOMA 1Q4RA 2IC3B 1NNDA 3IWXA 1E6VA 2YWFA 1SC1B 2XO7A 1QSYA 2WCXA 2NS1B 1RWVB 4A48A 4NZ0A 5AJ3F 1B7YB 3GR1A 2V63A 2WRMA 4LJMA 3CUNA 2HMIA 3HMJG 1M5SA 3ZZUA 1JXVA 4LUBA 1QVGR 2J76E 1NSAA 2HQIA 3ISZA 2W2OP 2P5VA 1C0UB 3UPFA 2QFIA 1RWNB 2W9BA 1XMQJ 3U7JA 1M0SA 3ZFVA 1OYDA 2IIHA 1FJCA 1HI8A 3K5NA 4DR4F 1UCNA 5A8RB 2IYIA 2E5JA 4DV5F 1UWBA 4A8XA 1MLAA 3CC2S 1FWKA 1YZ6A 1HBUB 1T9XA 1SUQB 2D1CA 3SDEB 1UZDA 2E1MC 5E0OA 4C8ZA 3CJ5A 1FNXH 3TJAA 3AJDA 4B02A 4KGMA 4QR0A 2HHVA 4DV5J 1NK5A 2GVZA 5IFMA 4RO0A 3C16A 4Y2AA 1U8WA 3RBDA 4RW9B 4O4GB 2KG1A 2IYGA 1VQ7S 4ZVOB 3WIVA 3LP2A 3D1OA 3R1LA 4FYXB 2CJ9A 4R5PB 4EWTA 4CNZA 2F8EX 1X4HA 2Y9HA 4OJ3A 1RBAA 5EWGA 1K44A 3PRBA 5KFRA 1W7WA 2MQLA 2ZH9A 3PW5A 2LLZA 2V2ZA 2AJ2A 1YWXA 2XGPA 1PILA 1RK8A 1AFIA 4WCEQ 5HMZA 2HHUA 3M2UA 1VMBA 3AQOA 1RA7A 1VRTA 3M2RA 4YOEA 4WU2A 7FDRA 3BGOP 5AXKA 2WONA 4B9NA 1GX5A 2BJ8A 4KKOB 4KH0B 2V8HA 1A0OB 3GIMA 3QT8A 1ZPVA 3TAMA 1H38A 1MWQA 2GA7A 3JYTA 4MYTA 1JLAA 3E51A 2R2TA 1YJNS 3K7RA 3CMAS 2FJAB 3TO8A 3ET6A 1NSKL 3D6MB 4WFYA 2QMXA 3DOMA 2F8HA 4LT6A 2XBPA 2XMAA 4DV2J 4F4YA 3ZTSA 4OZLA 1ZZNA 4QW8A 3SIPB 3W64A 2WSFC 4TVAB 2J6UA 3QT5A 1RTIA 2PGCA 5ETPA 3KHGA 2V9WA 4YB1P 2B5JB 2KG0A 2DR6A 3V2UC 2DNOA 3BF4A 1RCXB 4LFCF 3BQ2A 2N82B 1WOPA 3FZ2A 1RDRA 4K4TA 3C19A 5D8HB 4TYBA 5GMEA 4LFCJ 4AQYF 1S76D 4N41A 3GWCA 5E3RA 2PA8D 2JHEA 3KXDA 3BSCA 4WJBA 1WF2A 2M52A 3GSIA 3N28A 2ZKTA 1QVFR 3WC0A 4ILMA 2P6TA 4UUWA 3F44A 4DV4F 2W9CA 1LXNA 4ED0A 2JWNA 3H2LA 3FK4A 2POKA 2V67A 2BVZA 1NZ8A 5HN0A 3CMES 2K1RB 4DSEA 1A6LA 2J0SD 3IGNA 5KFLA 4XAKA 2H9ZA 4OYPA 2FJEB 4HT7A 1EARA 4PXEA 1H2UX 2XLKA 1WF0A 4ZP8A 2GGPA 3KLGA 2ZJQQ 3TP2A 5KFPA 3KFWX 1TFYA 3MEGB 2M0GB 2EBEA 2XY7A 3SCLE 4F4WA 4KTQA 5MAOA 1RT5A 4KGXB 4Q44A 2OO4A 2KRRA 2NPFA 3KK1B 1TK5A 5T7LA 2X1BA 2HNDA 4B9UA 1T95A 1RWKB 1HWKA 2LEPA 4BCAA 4RW4B 2MKSA 3PEHA 3TA0A 1D09B 2DB1A 1MMLA 2MXYA 3M9MB 4ZVRB 3N79A 1HI0P 4YDDB 1OY8A 1FDNA 3MAHA 3NAIA 1CS4A 1X4GA 4BWMA 1VQ5S 4IRDA 1TKXA 4ZN3A 4DPXA 2FJVA 2FTRA 3Q2TC 4W90B 1QY7A 1FEEA 3SYZA 3ZZPA 5EGYA 2A6OA 2CJQA 4YN3B 1T3NA 1KQGB 2OFGX 4E2FB 5MLCV 3DOLA 4WP9A 4WYLA 2CJKA 1F3VA 2V8PA 2OSQA 2HGLA 1FJGJ 4C8YA 1S6PB 4H4KC 3PW2A 2HHQA 1JLEB 3SBMA 3I56S 1NO8A 3TZWA 3D7SB 1VJQA 3K5PA 5ETNA 2XY5A 1V6HA 2HVZA 2ZJRQ 3TEGA 4ES1A 3AD9C 1JNRB 5ETVA 1X4AA 3DM2B 2QYGA 1MW7A 1Q8LA 1F5CA 1GNKA 1DTQB 1PKUA 1WSRA 1ZM3A 5F8IA 4WP8A 2NLWA 3ADAC 1HNIB 1FRLA 2W4DA 1DURA 1YX2A 2C2RA 4NXMJ 3RR7A 1SH2A 2VH7A 5GADU 2DR5A 4CNYA 3DRPB 4LR9A 2UXDJ 4JUZA 1ROFA 1GH8A 1U1RA 1ZYQA 4C2MA 4OJHA 4K2JA 4HDGA 1VRUB 5J2PB 3CD7A 6FD1A 4A46A 4FF1A 2GIFA 4CYUB 1C0TA 4E0DA 2ZNYA 3KMQA 2EFVA 2MKHA 2YWWA 3W2WB 1QDUB 4MKBA 2DCLA 2AYGA 5J2QB 3FBFA 3R1HA 4DN0A 1P9QC 5T41A 3DYAA 1KVIA 1BLUA 1Q0NA 1CJKB 1L3UA 2N7YA 5GMDA 1X0FA 2V4QA 2K7KA 3N9UC 3IRXA 3OFGA 1FKAF 1U24A 3V81B 1WC1A 1EIYB 1VQSA 2CWXA 2WB4A 4N47A 1RQ0A 3MAAB 2J8SA 2ZM6J 1I94F 3VAGA 1NHKL 1D8YA 3KNGA 5IC4B 3UN5A 3NWGA 2BKNA 5L1JA 3RW6A 4KHMA 4DL0C 2CNLB 4ANCA 2BQ3A 1SJ1A 2VF3A 1S4EA 3OUYB 1H6KX 4NLOA 4HR2A 1L3KA 4IFYB 3OTDA 2AWZA 4UF4A 4LF8J 5GAEU 3SEOA 2VICA 4ECUA 1ZPWX 2KJWA 2CNKB 3HK2A 4K4SA 2ZITA 2OH2A 3KLFA 4IYQA 3I32A 1NKCA 3ILIA 1RU1A 4ECWA 4ZP9A 2C28A 3BKFA 4JI3J 3US5A 1YI2S 4PUOB 1QAYA 3AB4B 3Q8YA 4N8NA 3A3OB 4CH7A 3H4DA 5B08A 2FD2A 5HAOA 2M2BA 3G96A 2ASYA 4HVZA 3R5DA 2YNGB 4EBDA 4WIIA 1HLWA 4WFNQ 5HMXA 2EFNA 3T6BA 4Q2MA 1RT3B 4IH5A 2B6AA 4IG3A 2CNOB 1ZA1B 5I42A 1DZ5A 3BN7A 4LMZA 3HFVA 5KFJA 4J9QA 3G2XA 3OVAA 4UOCA 1OQ6A 4FNHA 4Q43A 1X4DA 5C2CA 1S9EA 4NXNF 4G1QB 3AHPA 2XMUA 1YGYA 3K57A 2KB2A 2BE9B 2QE5A 4ZVTB 1VCTA 3ZTPA 1DJ0A 3HSJA 4AL5A 1REVA 4M5DA 4K50A 5L1KA 4XIUA 1BD6A 2MMYA 3BGRA 3KK2A 3S7RA 3HHKA 3AOCA 4OYAA 4CLSA 2K8GA 4TLRA 4I7FA 4NI2B 3QFHA 2KZMA 2QLJB 3A8EA 1VQ9S 4USJC 2DEIA 4UZBA 2CPHA 4U8VA 3CJKB 1SL0A 4IFVB 2I6WA 2DGSA 5GAHU 1XEZA 2DGXA 2V5HG 3GG1A 2PSZA 3OR2A 3H98A 4DFKA 4K4WA 3C6UA 2V4JA 3HFKA 2C2EA 3GFHA 1N6QB 2DY1A 1NB7A 4FF3A 4XPEA 4NCBA 4C3KA 3DKDA 5KG2A 2QLWA 1WEXA 2CZ9A 4WK1A 3B78A 4P6QA 4RUAA 3CWJA 3RRKA 2E66A 4KGKA 3GILA 3ETMA 4HKQA 4ED6A 1O8BA 2MZQA 3PG9A 4LSZB 1YZ7A 3HVWA 3KJQB 4LVNP 3V6DA 1TL7B 3I9V9 2U2FA 3MMCB 3AA9A 4ZP7A 3W9JA 5J1PA 1EETB 4ZITA 4PXCA 4MIAA 4I6AA 4CTAB 4M1KA 5CYMA 3SQGB 4RBUA 3GTYX 1M1KT 3PIOQ 3CMQA 4LFBF 2XM3A 2DPJA 4EZ6A 2XMJA 3LGHA 4RLEA 3FBBA 3THVA 3SCKE 2H5IB 5AXMA 4N8OA 3UFCX 5L8RC 1T11A 4DCPB 4LFBJ 3IFEA 2CQDA 4B3OB 4TNOA 2XNQA 3X1LB 2KYXA 1CLFA 1U8SA 1Y5NB 3LP0A 2MZSA 5F9NA 2ADCA 1HQUA 4C7QA 2D7SA 3I5CA 3OL7A 2UV8A 3DNCA 3ZNJ1 3MPWA 5A6WA 1HBOA 2IJNA 2NXUA 3H42A 3H5SA 5L1IA 3ZO7A 4DQPA 1X4CA 3CJQA 4AFFA 3C15B 2ZZMA 1LOUA 2RS2A 2XSJA 1UEKA 3QT7A 2IBKA 2RKIA 3LAKA 3K58A 4DUTA 4DR7F 4ZHRA 2WB1D 4KV8A 1HPZB 2IAJB 2DNMA 3LPEA 5JXSA 2YKMB 1UPPA 2KFYA 1SJ4P 1CJTA 1PAUB 4OHVA 4GKKF 3FZBA 5KFXA 4DUYJ 3W5ZA 5DDPC 5KFCA 2HRTA 1RYSA 4UQTA 1RTDA 1S0OA 3MCNA 3T1YF 5K9FA 4DLEA 3OPKA 4RUBA 1S1UA 2CA9A 3E2EA 4ELVA 3MEDB 2OFHX 4JI2J 5J1NA 3CO0P 2DISA 2G1HA 3MPDA 1FKPA 3VAMA 2RQ4A 4RUCA 2E9ZA 3QJJA 2MKKA 3T5KA 4YB7A 3WBZA 2P9EA 1PCAA 4X66J 3JTPA 3JTNA 1NUEA 1NHVA 2FVSA 1WG5A 2V50A 2H54B 2OKQA 2YQ3A 2DNZA 3QGPA 1FFGB 5B0DA 3BGLA 2WOMB 4DL5A 3J7ZT 3UR3C 2BYCA 4AD6A 2BE2A 3H4BA 4NLQA 1E6VB 3IS9A 4ZOSA 4FS2A 1RHQB 2QT7A 3FDSA 1RE1B 1NJXA 1HMVA 3BBCA 3W1YC 4YB6A 3KYLA 4DX6A 2VASA 3NMAA 2HMIB 3Q8UA 2ZC4A 3QWPA 2VA3A 4YUDA 2E44A 2GHPA 3J81j 4X4VA 3SI8A 1IBKF 4FS1A 3Q83A 2W9BB 2ZWOA 2CPIA 3CIZA 3M8QA 4PKDB 3SZ2A 1UWBB 4F25A 3BYPA 4NRUA 1CJVA 3IAS9 1VIOA 4B9TA 3CIMA 3PO5A 5CZVA 1RHKB 1NPPA 1HNZJ 2GVZB 3G87A 1MWZA 3TQEA 3J7Z5 3C16B 5K8OA 5KFZA 4M5MA 4F3QA 2R2RA 2AGPA 2C1EB 3LP2B 5ETSA 1ZM9A 3AA8A 4I4BA 1FX2A 1HA1A 1WDTA 1S12A 1RU2A 2VZ9A 3QRQA 4QCLA 2JEJA 1ZA2B 2MHNA 3I5AA 3FUYA 4TN2A 2B4OA 2L41A 1J27A 1T02A 3W62A 3M2UB 2M4MA 1VRTB 3M2RB 3H2VE 4K0KJ 2WONB 2IDLA 3MM9A 3KG1A 5KFMA 5D78A 1FFWB 2LU2A 5FD1A 4DX7A 3TAMB 3VCDA 2NYIA 3JYTB 1WC3A 4LRDA 4C8MA 2CDRB 1WC5A 1U6ZA 5C2GA 1TELA 1JLAB 4OMFG 2DGQA 2ZBPA 5B7WA 1SXLA 1UETA 2H3EB 3ET6B 3KG4A 3DOMB 4OJGA 4F26A 3CJ4A 3D66A 4JV1A 1U47A 1HYSA 1CQMA 3E01A 2RHSB 3D1HA 3Q8QB 3CCLS 3PFEA 1KFSA 1FRJA 2ASLA 2DD8S 2M7SA 5ETOA 1HWIA 3LAMA 3VTIA 1FJ7A 4EO8A 1D3WA 1RHUB 2XS7A 1NJIT 1XC9A 5D0EA 3GQCA 3NCRA 2D69A 5U47A 2EPIA 4UW2A 1XNRF 2ASDA 4F0HA 2MQPA 3MCSA 4ECTA 2MQ8A 3PEJA 3VZHA 3VR1A 4OYOA 1TL4A 4QR1A 1XNRJ 4C0OC 4ZVHA 4YEAA 2W9CB 4EMDA 1XMOJ 2LVWA 1P27B 1XNQF 3TYTA 2ZE2A 2FZCB 2HHWA 4OX9F 2A2CA 3MWBA 4O3NA 1HNWJ 4FN5A 4ZLNA 1R8CA 4JYAJ 1FEHA 1H2VZ 4ZCLA 4OX9J 4HHUA 2GVDA 4DPTA 4YS2A 2V0NA 1S5ZA 1C1CA 5B0EA 4YY3F 5AXNA 3T1HJ 2N3LA 3FNNA 3VVUA 2SXLA 3BDPA 2GGPB 3HM9A 3KLGB 4I0WA 1QJHA 4CLZA 2NXNA 2HIYA 2CJXB 1LWFA 4Y34A 2MY8A 2XSFA 1UMJA 1RT5B 4JI0F 1NHUA 1W2BR 4P52A 3PJ9A 1RAEB 4BLGA 1KRPA 5T7LB 2NZ4A 6AT1B 3NGSA 2WTFA 2HNDB 1WKJA 4J37A 3PRVA 4O3SA 4GKJJ 3OBIA 4C0HA 2B9EA 3H5XA 5B0GA 2CPZA 1UKUA 3S01A 2BQUA 3D4JA 1YJTA 1S6UA 3MCMA 4WE1A 4DL4A 3TQ1A 3JSRA 4F02A 5AXLA 1CS4B 1TKXB 3VAHA 4ES2A 4ZLLA 4X64F 2M8DB 1LFWA 5HMYA 2OSRA 3ZZZA 1LWXA 1JMTA 5IQ6A 3VAIA 2CQPA 3GSDA 1Q7LB 4X64J 4FP9A 4JI8J 5IT4A 1UVIA 1XMBA 4ZPAA 5CD4H 3DOLB 1FI4A 4GC7A 4NA1A 1PSDA 5HVFA 2EFOA 1WHXA 4ECZA 1UFLA 1EX8A 3O8WA 3FC9A 2ACMA 1DAXA 3NGUA 4B3SJ 2DVIA 3BBFA 1BQNA 1R8HA 4HHJA 2R2SA 5HATA 2COLA 1X5OA 2VPWB 4IO9Q 1HR0F 4DV7F 4RNMA 3M8RA 2EK6A 2MDAA 5C24A 1SKUB 1WEYA 1M5PC 1UP1A 3B4DA 5DDQC 3RBXA 1VC0A 4HDHA 4ZJQA 5KT6A 5JMNA 2WBMA 5KG7A 1X4FA 3KJFB 2WAQD 4PZVA 4AE5A 4FVMA 5HO4A 3GR0A 3H8YA 4IO1A 1C0TB 1FF2A 4L75A 4P72A 4NLRA 4OYZA 4AYBD 1G2EA 1VQOS 2R9LA 3WIUA 5KT3A 2R8IA 3L7UA 3CCES 2P2CB 1TKZA 2Z2ZA 1HBMA 4LRFA 3DYAB 2RRNA 2IM0A 5HBMA 4I68A 2HHPA 1HWUA 4B3TF 3EVWA 1SL1A 2FHOB 4PQAA 1OS5A 4DS5A 5DO2A 3IRXB 1NK4A 2WVEA 2OMOA 3MMBA 4DLGA 3LA0A 5DZ6A 2JDJA 2BW2A 1DTTA 4OX7A 2O3DA 2IM3A 3TA2A 3VGVA 1RAFB 4B17A 2PMHA 2JRSA 2FVCA 3PW7A 4ZP6A 1WG4A 4YMEA 4OYMA 3IRWP 2Y0SD 4M5NA 5ETMA 2ZH7A 5A8KA 2CJBA 3JSBA 3FCWA 3IXQA 2BX6A 2V94A 2GQQA 3H0PA 2O5DA 1O6XA 2CPJA 3IWLA 3EZ5A 3A4TA 1PJ7A 4KH1B 2RB7A 1IUJA 3MGJA 5LMNJ 4RJVA 4DX8H 2EFQA 5KAKA 1JK9B 4XPCA 3KLFB 1WOOA 4G3IA 2JLGA 9ATCB 4PXDA 2MLZA 1T9WA 4J91A 3ITHA 4TQSA 2R7TA 1UJ6A 3QPIA 3H20A 2JEGA 2YNFA 5L46A 2BRKA 2FHMA 1IWAA 2AV5A 4FDFA 1URRA 4E8UA 4BC9A 2CKWA 3VGUA 1NU4A 4W98A 2UU9J 1BWVA 2ZUGA 3CCVS 3DXBA 1JB0C 2D3O1 4ZPTR 2B6AB 4IG3B 3GZ7A 5I42B 1FXLA 1UVKA 4FF2A 5HJXA 3ZZYA 2L08A 1N5TA 1QTNB 2Z2LA 2M9KA 3BYRA 1L3TA 1S9EB 3K5MA 1YJUA 2YKQA 4IH7A 2GC8A 4KC5A 4ZLPA 5J2MA 5C7PA 1WD6A 3J7A1 4ALZA 2Z30B 4TYAA 3I0SB 2DNNA 1U2RA 1V3SA 2IA0A 1REVB 2AX0A 4M5DB 3NGKA 3OVSA 5L9NA 4P73A 5KT4A 3KK2B 1EJ7L 3BGRB 3D1QA 1H7WA 1SPBP 5HK4A 2Q79A 2E7XA 2MZ1A 4I7FB 2QA1A 1T9YA 2AYEA 3R6GB 1RAHB 1UFWA 2HS3A 2UUCJ 4P9SA 4A4JA 2LP4A 3R8YA 3P49B 4DZ6A 3MURP 2BJDA 3OR2B 3C6UB 3DU6A 3KJNB 2V4JB 2QSWA 3G9CA 1MN9A 2HVEA 4DBQA 2F8MA 3VZIA 1FTCA 2N4DA 3IBFB 3FFIA 3DN9A 3RB3A 4HLBA 4OZ2A 3MOZA 3T9ZA 4C3MA 2ZBIA 1FCAA 3CJ8A 4EYHB 5BR8J 4OHZA 2KH9A 1IBLF 4DEZA 4J9KA 3MM8A 2VUGA 2JC1A 5KFGA 2YWEA 3CCJS 3V6DB 4NASA 5F0WA 5HP1A 1LWEA 4XO0A 2VFRA 2BJ1A 3R5BA 3KHLA 4PABA 2I5JA 3HZGA 1WG1A 1Y00A 5FDLA 2ZBRA 2LFVA 5CYMB 2BJ7A 3M05A 3DLHA 4FKXA 3IGVA 1XWLA 4UUXA 4J9NA 5E3PA 1N34F 3CCWA 4LSNB 3BR9A 2EEYA 7FD1A 1DQ9A 4DV1F 1SH3A 1N34J 3R7NB 2RF2A 2FLOA 5D15A 2Y8WA 5G4DA 3LP0B 2GJIA 3TRGA 2DO0A 3GIRA 1KBRA 4X84A 1HQUB 2KDOA 2IY5B 3BBBA 1OMSA 2Z2YB 3DU5A 4TY8A 5LL6d 1N54B 3UNGC 1HBOB 2CXEA 3NG8A 4K4VA 2HBRB 4QPTA 2HZCA 3WX4A 2LEAA 2AEMA 1VQKS 2XSJB 2R7RA 4IDKA 1MG7A 3FBCA 1KQFB 1KSPA 4FBUA 2RKIB 4BDPA 1U2CA 3H59A 1F1BB 4ZHRB 1NDPA 4KV8B 3BSNA 4PWDA 3EDRB 1DRZA 1CJTB 1N0UA 4C97A 4PG6A 2GS8A 1SJ3P 3CVKA 4RUHA 1VIXA 1FRHA 5DQGA 1RTDB 1S1TA 4OZ3A 1UZHA 4FPRA 2OLWA 1LWCA 3VVTA 2MZJA 5KG4A 1S1UB 3Q86A 2HGNA 3CEDA 1QAIA 3DGVA 2D9PA 1XQIA 2AJFE 3GV5B 1FK9A 1FKPB 1GT8A 2K3KA 5M2PA 4NMXA 2FB0A 1G4CA 3W65A 1RT7A 5BYQA 1RKIA 3BEGB 4YHHJ 2ZH2A 3MI7X 1VHIA 1JXEA 3H5YA 4ZCKA 2X51A 2OPPA 2ZHOA 3CCTA 2VKRA 2AGOA 1FE0A 1YBTA 1X31C 2BE2B 5THWA 1Q86T 2NXEA 2V2KA 3IS9B 3J81U 4KFBA 3FRZA 1FD2A 4CIOA 3SSSA 3RAXA 1OY9A 1DARA 2V69A 1HMVB 2B9XA 4GVLA 2LQ8A 1IKYA 1LK7A 3AODA 1PG5B 4B3RF 2F5GA 3LQVA 4EU0A 2PE8A 4KPYA 3UE2A 2EI5A 2DHAA 3VF0B 1SH0A 1NH7A 1TK8A 3W5XA 1OO0B 3GYNA 2VJVA 4QU7A 4J9OA 3M8QB 1SIWB 3MF5A 3G4SS 3U1MA 1ZBTA 2XYHB 1APSA 1CJVB 5KTQA 5H9FK 3UCUP 3LGNA 3KK3A 1BWEA 2ERRA 4BS2A 2CNNB 2MLXA 2FC9A 3HT3A 2VG7A 4PG4A 5HL7Q 1XR6A 1Y0HA 2JLEA 5IQQA 3BO3A 3CW2C 1FD8A 1AA1B 1LKZA 5EWEA 1VQ4S 4F4AA 5KFDA 3TVKA 3V4MA 2CQBA 2HNYB 1A7GE 3TX8A 2QA4G 3AH6A 4OZJA 1LXJA 4C8LA 3RB6A 4FZVA 3SFUA 2QC3A 1UVNA 2LEBA 1W26A 4JB8B 2EBGA 2JNJA 3MCOA 1C4CA 4A8QA 3IP0A 2FJXA 3L4BC 1B4SA 1IBMF 4DG1A 3MM9B 4C4WA 4OV6A 1Q16B 4C9DA 4J7CA 1NSPA 2I9SA 3WQPA 4QWDA 1K1SA 2CPEA 1RTJA 3NXZA 2KN4A 4ELTA 3ZNUA 4HACA 4G6VB 4NLDA 1S49A 2OTJS 3AJ2A 3CJ2A 3B82A 5L38A 1FX4A 3J7YU 3G6ES 1ZETA 2GJ2A 2OEJA 4C0BA 3E01B 1SL2A 3GLJA 3VALA 3ENQA 2XULA 3EX7B 1IKVA 1X5TA 1HNVA 3AFGA 5D4PA 3DLKA 2GJFA 5K14A 2OAUA 1R6VA 2FJDB 1DBDA 2FZKB 1ZAVA 5F8LA 2G2ZA 2XGQA 3TR5A 3NGDA 3TA1A 1VQPS 4UOGA 5K20B 3DLGA 3J81Y 2V34A 1NEEA 2MTLA 3IR5B 5L1LA 1W25A 4I67A 3CCRS 1S72S 4ITSA 2RRAA 1N32J 3H25A 4DR5F 4ES3A 1SJQA 4B3MF 3UO0A 2ZE2B 3U02A 4FXVA 3HF5A 3C14A 1X60A 3HHEA 5KFUA 2Z0GA 2MQOA 1RT4A 4MYUA 2AJ1A 4ENOA 1U26A 4KHPF 1C4AA 3AAWB 3T19A 1RLCL 2DITA 2E9TA 2GVDB 5E3QA 2DIUA 4USMA 2DNLA 2IDEA 4K5RA 1C1CB 4JI1F 5EN1A 2PEBA 1IQZA 4OI4A 1U1NA 1UAWA 3JQJA 2DNKA 1UJ5A 3T5HA 3MD3A 2E29A 2HBQB 3TVZA 2R7WA 4MKAA 4JI1J 2RILA 4MKYA 1HHTP 3PDNA 4X4PA 1LWFB 3EDQB 5DRKA 3HI9A 2KU7A 3QRPA 1T05A 4EO6A 2ALYB 2P6SA 4QW9A 2A18A 2NUUG 4RL1A 5KFWA 3O44A 3ZXWA 4CLUA 4RNNA 3QZ7A 1X5PA 4DR3F 4ZPCA 4DR1J 2KJVA 1M5OC 3PJXA 4DR6F 2BXJA 2WW4A 2XG8A 3FEZA 4WE1B 1YQHA 3PYGA 1RBLA 1QUPA 3TZZA 2QSFA 2J8AA 1S79A 3CJRA 2OELA 1T9TA 2HYIB 4TLQA 4U7UK 3LWMA 2O67A 2XY6A 5KFTA 2HRYA 1IJFB 3M32A 3BSOA 2XS2A 2FUG9 2CPFA 3FSIA 5HQLA 2FDNA 2YX4A 4Z2XA 3JAMU 4JV2A 1UTAA 4OZ0A 3W63A 1S10A 2QRRA 1VLYA 1KLNA 1BC6A 3I0RA 1BQNB 3HD1A 4NLYA 2VB6A 3R7SB 1NDKA 4OI2A 5KFSA 3PO4A 5C24B 4PQUA 1E6YA 3FMWA 2DNGA 5KOWA 1JJ4A 2CUYA 1TL1A 3MR6A 2QL5B 1FT8A 1WKKA 3DRSA 2E5HA 1CSJA 4USKA 4BHQA 2IJFA 2UV8G 2RDDA 4CLWA 4JV5F 3CGIA 2HFOA 3IG1A 2UVWA 3FSXA 3BR8A 1R0CB 3P4UB 4UQGA 3VGTA 3M8PA 2K3IA 3JB9k 4CT9A 3CO9A 2QL9B 4USVA 3N6LA 4LF9F 3UCZP 3OLAA 1BQXA 3TNVA 3A13A 2XNRA 3QZ8A 5GADI 2YKPA 2RHQB 2GNKA 3FMBA 5HI7A 2NSBA 1N33J 4DPOA 3BSAA 4DOZA 4RW6A 4ZDNA 1LQ9A 2QA4S 1S6OA 3BGFA 1TKZB 1D1UA 2VPYB 1HBMB 3V6KA 2C42A 3DLLQ 1KLMA 4L74A 2QFJA 4N56A 4QQBA 5HBMB 4ZIWA 5CA5A 4MK8A 2HNZA 4PXBA 2AX1A 1TK0A 2I8EA 1HD1A 3BZQA 3MMBB 4Z37A 2W4PA 3JTOA 2VG6A 1VRQC 4F7VA 3KHRA 3M8SA 1IM4A 1DTTB 4HI2A 2CJAA 2J7WA 2UP1A 4BWJA 2R8KA 2B7CB 1NXIA 2R7OA 4QOTA 4O3RA 1XMQF 4M95A 2NCKL 3QIPA 3M1VA 4TU9A 5A8KB 1VYAA 2HZVA 1FE4A 5D3GA 1NZAA 1TU0B 1Y3JA 4OV1A 5F8MA 3T9NA 4NLPA 1C0UA 3FQKA 2LKZA 1RAIB 1MMDA 4LF5J 2B9YA 3TUIC 5A2QU 1MU2A 3OHAA 3MZIA 3SDEA 4NOHA 1FKOA 3OFHA 2GX8A 1TUGB 2KT3A 2YXLA 1VQYA 1RADB 4NEYA 1EKSA 4DSFA 4P75A 1OSCA 3QNWB 2MKJA 1IXKA 1IR0A 3ITHB 5HQMA 2YNFB 5GAEI 1BGXT 5JUMA 4X4SA 1UEUA 1S9GA 2JEIA 2DHSA 3G86A 1IM6A 1Y3KA 1SC3B 2KHDA 3R5AA 3BO4A 1V5IB 4L76A 4F67A 2NZCA 3MEKA 5KFIA 3CCUS 1R8PA 3CD6S 4Y00A 5IWAJ 3M8ZA 3DFEA 1EKRA 4G1PA 5J2MB 1RBOB 1WUUA 5IM0A 2Y0BB 2FC8A 2WZ1A 1VJWA 3HX9A 1VC5A 3KMSA 3M8WA 3ENVA 1O0PA 1S7IA 2OI2A 4WFZA 4CH0S 1KN6A 4DV2F 4CLTA 2MPUA 4X4UA 4DQIA 2PEHA 2LA6A 1P1LA 5IT9U 2ADBA 2Z8QA 1OY6A 5IC6B 3TWZA 1RLDA 1B0PA 4NLVA 1HBNA 4X4OA 4M5JA 3HXMA 2ACYA 2YTCA 1MSWD 5DGAA 3MMJA 2Z58B 2JFDA 2VL1A 2AJQA 2Y1JA 3MR3A 1RISA 2VG5A 1O51A 2AEJA 2E1CA 4NCAA 3DHWC 1JQGA 2OD6A 5KFFA 4GRSA 1S7HA 3FFIB 3RAMA 4J9UE 1DLOA 2RH3A 4I6WA 2XMMA 4J9RA 1VQLS 1HFEL 2PA3A 1EQMA 5BXIA 3Q2SC 3TUPA 4QIFA 5GAHI 2G13A 3W7BA 3RR8A 1ZTTA 2FIUA 5GAGI 4OI3A 1MROA 2OEKA 3MM8B 5DG9A 1FERA 3PYFA 1BMQB 2A3JA 2R2UA 3Q23A 5HP1B 1YLXA 3OV7A 5CQGA 2X1GA 1Y5LB 2VOOA 1LWEB 4CO3A 1F60B 3H2UB 4DZDA 4DR2F 5E2QA 2I5JB 1WC0A 5FDLB 5KT5A 1R89A 4CH1A 2QJ3A 4NRTA 4RWWA 2ZDPA 4WFBQ 1RT6A 4K5SA 4DR2J 4X65J 4OI1A 1CJUA 1KQSR 3HT0A 4OX6A 2IRYA 8RUCA 2HWHA 3ZC4A 2PN6A 4UY8T 3D6FB 2RF2B 4QYRA 5FJ4A 1F5AA 2Y3YA 1K9MT 4AL6A 2HWTA 2DNQA 4TU8A 1Y5IB 4NEZA 1S97A 2E5IA 3MMAA 4MIWA 4TY8B 2V2VA 4JI5J 1Q8KA 2KRBA 4O0IA 4A8FA 2RU9A 2V9KA 3BH6B 1RHMB 2L48A
chains in the Genus database with same CATH topology
3S01A 2BQUA 1T3OA 1S6UA 1YJTA 2UVUA 1RI7A 3S1TA 3GIKA 3EGZA 2UXBF 3KK1A 4WE1A 4DL4A 3TQ1A 1S0VA 3JSRA 4EFAC 2HQ3A 4Q8FA 3DLEA 4C8OA 3IWNC 1L5UA 1Z2LA 4B3OA 2XMWA 1VGYA 4F02A 5AXLA 3KJVB 2GIQA 4QPXA 3BO2A 2DTJA 2JC0A 1TKXB 4XDDA 5DLFA 3IO1A 3VAHA 3FRYA 1WACA 3DXSX 4GMKA 4ES2A 3NBPB 1U2FA 1S1VA 1PC4A 4B08A 4PWDB 4X64F 2UVVA 3MTKA 1WELA 2XMKA 1M5KC 1JLFA 1AFJA 1X9SA 2FHJA 1UA0A 2BBEA 3FQLA 3GG0A 4KAIA 3DRXA 1NH8A 2M8DB 5I3UA 1LFWA 1EP4A 5HMYA 2CQ1A 3AJ1A 1ZAXA 2YWHA 1DFDA 2EC0A 5AE3A 2Y1IA 2C22A 2W7PA 2CIMA 2OSRA 3ZZZA 2CQ0A 4Y3CA 3MFHA 2AP6A 4A8YA 3TUZC 5LSRA 1JMTA 1KOHA 5IQ6A 5J1EB 2CQPA 2RUGA 3VAIA 5E41A 1WTBA 3GSDA 1HW9A 1Q7LB 1LW2B 2DIVA 2GQCA 4FP9A 2JLFA 2E1RA 3O2IA 5GVQA 5F3TA 5IT4A 2DJWA 5T14A 2BDPA 1S1TB 2EG2A 2GCFA 2FLNA 3F56A 3THPA 5KFQA 2CG4A 1Q8BA 1UVIA 2HG4A 1XMBA 4UY85 2RQCA 4ZPAA 5CD4H 4IOCQ 3JSYA 3DOLB 4LSLA 2RE1A 4IH6A 1LWCB 2W4CA 4MFBA 4GC7A 3KLEB 4NA1A 1VC6A 4ED8A 1PSDA 4ICLB 2EFOA 1WHXA 4ECZA 2HFZA 3HO1A 1UFLA 3O8WA 4QWCA 4C98A 3I4PA 1TFWA 1FK9B 1DAXA 1UL3A 1Y9OA 1N36F 3CDAA 3P3DA 1FJGF 1D9AA 2LXFA 2R4FA 4Q7AA 1K0VA 1HPZA 4X62F 2DVIA 2IAJA 1KHWA 1S6QA 2LDYA 2NR0A 3TOQA 1BQNA 1R8HA 4HHJA 2R2SA 4DV0F 2YKMA 3CDWA 1S77D 3RZAA 4DF8A 1LK5A 2MY7A 2COLA 4CT8A 2JJ4D 4X2BA 1X5OA 1TV6B 1HD0A 2VPWB 3M6VA 4IO9Q 4URQU 1HR0F 1TP7A 4DV7F 1RT7B 3B8HA 3FEXB 2WW8A 3KOAA 2J6TA 4RNMA 3F41A 3M8RA 1N5VA 2ZBCA 3MECB 4J5OA 2EK6A 3ENWA 2MDAA 5C24A 1XN9A 4RW7A 1WEYA 3QAEA 4EBEA 1S99A 4YHHF 5K8PA 2FHKA 2BV3A 3CDEA 5E5NA 1WHWA 4H4OB 2IVYA 1M5PC 1NK8A 4F4KA 1JLEA 1X9WA 1QUVA 1UP1A 2BACA 2OPPB 3B4DA 3TUJC 3POTB 4TU7A 2M3DA 4ED1A 1TL5A 2HFNA 4A47A 5DDQC 2UXCF 3V5RA 1OIAA 2ROPA 3LANA 1VC0A 1TAUA 4MTPA 1F5BA 4DL2A 1XK8A 2PMZD 4DDFA 4HDHA 4Q2LA 3MEDA 1YRTA 3M6WA 5D4OA 4WZQA 2DHGA 4O44A 3UW1A 3HLUA 4NXMF 4OI6A 5F8GA 5K8MA 1C2PA 3OTOF 5KT6A 5KT7A 1X8DA 3DRRA 3TANA 2UXDF 2WBMA 5DQIA 1H7XA 4KFBB 5GMKa 5KG7A 3M9NB 5SUHA 1Q1KA 2YWGA 1X4FA 1HWJA 2WAQD 5E3CA 4X4NA 1SJFA 4ILLA 1VBYA 1ZOTA 1ZH5A 4Y2CA 4AE5A 3RTVA 5BYSA 1IKYB 4QWBA 4F4ZA 4NLSA 2YVSA 4FVMA 5HO4A 3GR0A 4X4QA 2LMIA 4Y2MA 3H8YA 2RDJA 4IO1A 2CPZA 3FGVA 2F1FA 2XMTA 1C0TB 1FF2A 2GMLA 2LQ9A 1X4EA 1RT2B 2FGOA 1FDDA 2C2DA 4NLRA 5DLGA 3EGWB 4AYBD 1G2EA 4B9LA 1VQOS 2LQJA 2R9LA 4JBCA 4OLPA 1AUDA 3MEEB 5KT3A 2R8IA 2WK4A 3CCES 3I31A 2ILYA 2KKHA 1TKZA 3D28A 1HBMA 4D3GA 3N5FA 1RA6A 2DH9A 4KJIA 5LT5A 1M5HA 5DM6Q 3MM6A 2F7VA 1C1BB 2A1BA 1R31A 2WOMA 1Q4RA 1CC8A 3DYAB 2IC3B 1NNDA 2RRNA 3IWXA 4YDXA 1E6VA 2JX2A 2M88A 2IM0A 4JOUA 5HBMA 2YWFA 1X4BA 3K5OA 3MM5A 4CO5A 3G8TA 2XO7A 1F0XA 1QSYA 2WCXA 2HHPA 1HWUA 2NS1B 3LGMA 4I68A 3U1LA 4NCGA 4B3TF 4HH1A 3KNAA 2J0XA 1FRKA 4A48A 4NZ0A 5CZXA 1SL1A 1W2IA 2OPRB 2FHOB 4FNIA 4PQAA 5AJ3F 1K73T 1OS5A 4DS5A 5DO2A 3KK3B 3IRXB 3KLHA 3GR1A 1NK4A 4MK9A 3FEYB 2OMOA 2WRMA 3MMBA 4LJMA 3CUNA 1FVQA 4DLGA 2HMIA 3HMJG 3SSQA 1RT1A 2O01C 3MPYA 1X9MA 1M5SA 4NMLA 2UUWA 3ZZUA 2HLTA 2W8KA 4LUBA 2JDJA 1TVRA 2BW2A 4K2XA 1DTTA 1QVGR 5HLFA 4QIWD 1P6TA 2J76E 1KTVA 4OX7A 4R25A 1YJ9S 2HQIA 3ISZA 3NCQA 2G4BA 2IA6A 2P5VA 1C0UB 2O3DA 2IM3A 2YNHA 2VG7B 3TA2A 4L72B 4B17A 3UPFA 2PMHA 1T7PA 2L9DA 2JRSA 2W9BA 3MUMP 2ZM6F 3U7JA 2FVCA 3PW7A 1FTRA 1M0SA 2CZ4A 3ZFVA 2FJBB 1WG4A 4ZP6A 5E7OB 4YMEA 3N01A 4PG7A 4NLGA 4Q0BA 4RU9A 1FJCA 3S8SA 2Y0SD 3IRWP 2VQEF 1HI8A 1JX4A 3K5NA 4DR4F 1FVSA 4ZVFA 2ZH7A 5A8KA 5A8RB 3UR0A 2IYIA 1B0VA 2CJBA 2E5JA 2GO8A 1UWBA 3IXQA 3JSBA 4A8XA 3G6VA 4DV5F 3MDFA 3CC2S 4KBIA 1JLCA 4YQWA 2V94A 2GQQA 1HBUB 3CT9A 3DI6A 1SUQB 2D1CA 3OLBA 2CDQA 3SDEB 2O5DA 3THTA 5KFAA 2CPJA 2E1MC 3IWLA 4DMZA 2R8GA 3EZ5A 1M90T 5E0OA 4C8ZA 4D3HA 3CJ5A 1FNXH 3L95X 4LIRA 2VQFF 4LFAF 4B02A 4KGMA 4QR0A 2MGZA 4NX9A 4EUVA 3JSMB 4NZ7A 1YVFA 4TQRA 2HHVA 2RB7A 1IUJA 1NK5A 2FVRA 2P9CA 2ZOMA 1TQLA 5IFMA 2Z2MA 3MGJA 4O3OA 1SV5A 5CCLA 1NK6A 2HNYA 2EKYA 4DX8H 4Y2AA 2KM8C 3OQ2A 3P5TL 5DG8A 4QWEA 3A1YG 2EFQA 3RBDA 5KAKA 2ZNZA 4LF8F 2KT5A 4RW9B 1JK9B 1R0AB 2OPSB 4O4GB 1IJEB 2KG1A 2IYGA 4DG1B 1VQ7S 1H98A 4XPCA 3KLFB 3LP2A 3D1OA 3R1LA 2CJ9A 3IAM9 2NQPA 2IM1A 1RTHA 4R5PB 2J6SA 4G3IA 2JLGA 5AE2A 5KFEA 2GIRA 4JI3F 4PXDA 3RAQA 1VHFA 3G6YA 4EWTA 4CNZA 3ITHA 4IFYA 4TQSA 2R7TA 2F8EX 5KG5A 2K2PA 1X4HA 3TI0A 1UJ6A 1RTJB 3QPIA 3H20A 4OJ3A 2JEGA 2CQ2A 2YNFA 3NS5A 5EWGA 3SFGA 1YIJS 2BRKA 2FHMA 4P7TA 4A8SA 3PRBA 5KFRA 2AV5A 3DCAA 1URRA 4E8UA 2MQLA 4BC9A 2CKWA 1KTQA 1NU4A 4TKTA 2ZH9A 3PW5A 2LLZA 2Q1LA 4KIAA 5CYQA 4PCQA 1Y4ZB 1YWXA 2ZUGA 2XGPA 1PILA 3CCVS 2LU1A 2FVQA 3DXBA 1RK8A 1AFIA 4WCEQ 5HMZA 1JB0C 2HHUA 3M2UA 1TKTB 1QAXA 1VMBA 3AQOA 1RA7A 4ZPTR 2B6AB 2ALZA 1VRTA 4IG3B 3GZ7A 5I42B 1FXLA 1UVKA 3M2RA 3OR1A 4FF2A 2YKNB 4YOEA 4WU2A 3W3SA 2YH1A 3NMRA 7FDRA 1XTZA 5AXKA 2OJ3A 2FGCA 3ZZYA 2L08A 3MUTP 3HHDA 3GMGA 1N5TA 2WONA 4B9NA 3OVBA 5A8WA 1GX5A 3MM7A 2BANB 4KKOB 1OPIA 2Z2LA