2MMYA

Solution structure of the rna recognition motif of human taf15
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
b'GSHMSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TATA-binding protein-associated factor 2N
publication title Structural delineation of stem-loop RNA binding by human TAF15 protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 13
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mmyA01
2E5HA 2DISA 2LEAA 1ZH5A 2MQNA 1HA1A 1PO6A 4ZKAA 3I55S 1OWXA 2CQ0A 2JVOA 3HHNB 4WIIA 4YUDA 2M4MA 1IQTA 3CD6S 5ITHA 3VAKA 2UP1A 2XNQA 5D77A 3UWTA 2DNLA 2M88A 2LA6A 1PGZA 4FXVA 2VOPA 1D8ZA 2LQ5A 1W2BR 2JX2A 3RW7A 5DM6Q 1M5PC 1WHYA 2MSTA 2K3KA 2DGTA 2E5GA 1YHQS 2HGLA 3MUTP 2MB0B 3NNHA 3DLLQ 2DO0A 5IQQA 2ADBA 1A9NB 2FPHX 4RU2A 3BO2A 3Q2TC 4Z2XA 3SMZA 2DITA 2FHOB 3P3DA 2MKSA 4WFBQ 2CPHA 3I56S 3UD4P 3V4MA 2JWNA 4W92B 1RK8A 3UCZP 2MKIA 2GO9A 2RT3A 3SXLA 2KG1A 1U1QA 2M0GB 2D9OA 2MQLA 3TP2A 2XB2D 4PR6A 5LJ3Y 1CVJA 2SXLA 1JJHA 4EGLA 1VQ4S 1VQOS 2N3OA 3CMES 2OTJS 1DBDA 1X4FA 2MYFA 2CPYA 1SJ3P 5LXRA 3CCJS 1ZZNA 5CYJA 3MXHP 5DETA 1VC6A 2QA4S 2JRSA 2DNPA 5DDQC 2ZJRQ 2X1FA 4F02A 3U1MA 3N9UC 2CQDA 1D9AA 5IFMA 3MURP 1FXLA 4WCEQ 1UW4A 3EGNA 3MUVP 3CC7S 1X5PA 1YITS 2MQPA 2RRAA 1NJIT 1VC5A 1N88A 2MKHA 1QVGR 3CCMS 2G1DA 4QU7A 1X0FA 1WTBA 2HYIB 1SJQA 2M8HA 1WI8A 2MQMA 3VAGA 2OJ3A 2YH0A 4ERDA 1DZ5A 1SJRA 2ERRA 2KG0A 2E44A 3MDFA 2OIHA 1WF2A 2DNYA 3VAMA 1X4GA 3J7ZT 3R1LA 2VOOA 2EK1A 2HGMA 4F26A 2CQBA 3VALA 2OSQA 3EX7B 2M7SA 3TYTA 5IM0B 1R8HA 4C0OC 1K9MT 2RVJA 2F3JA 2MJUA 2MSSA 2MKJA 3PIOQ 1KOOA 3CC4S 2MY8A 2AYGA 5MLCV 2NZ4A 3NNCA 1FJ7A 3CUNA 2RS8A 2DB1A 1UFWA 3JB9k 1X5OA 2DH9A 2N3LA 3MOJB 3FEYB 2V94A 4Y00A 1WHWA 3G6ES 1VQPS 3P6YC 2M9KA 2KXNB 2D3OR 5LXYA 2U1AA 1VQLS 2RRBA 4QQBA 5D78A 2CQ2A 1SXLA 2PE8A 2FC9A 4WFNQ 3G96A 4U67Q 1VQ8S 3CCUS 3CXCR 3S8SA 1U1MA 1NO8A 1FT8A 1U1OA 4Y0FA 2X1BA 3MI7X 2I38A 1P27B 2MZTA 4M5DB 3IRWP 1H2UX 1P1TA 5LSOA 4IOCQ 4WKRA 2M2BA 3LPYA 2CPXA 4OZ0A 1Q81T 1VBYA 1WELA 3DXBA 2F9DA 5BJRA 2CQHA 2MKKA 2KRRA 2AYMA 2AYBA 2RNEA 2RUGA 1WEZA 3MD3A 3NS5A 1YI2S 2DGQA 2DNKA 1R8PA 2FC8A 2J0SD 3HI9A 2DNHA 2KM8C 2AD9A 3OW2R 1WEYA 1HD1A 1VBZA 1VQ7S 3CCES 2MMYA 2MGZA 1VC0A 2E5JA 2LXUA 1N52B 3S01A 2J8AA 2CPIA 5GAGU 2CPZA 1UP1A 1OIAA 1WEXA 4TU8A 1U1NA 1L3KA 1JJ4A 1URNA 2A3JA 5HO4A 5DDOC 1Q82T 2CQ4A 2MJNA 2Q79A 4FXWA 2MZ1A 1U1RA 1N8RT 1FJEB 1WF0A 2KRBA 3VAIA 2DHXA 3G8SA 3UCUP 3IWNC 3THTA 2DHAA 3H2UB 2VONA 4J5OA 4CQ1A 2ZJQQ 2CJKA 2LECA 2G0CA 3VAFA 2DNOA 3S7RA 2DNGA 2MHNA 3LQVA 1VBXA 2YWKA 2MZRA 2LXIA 2CQ3A 2DGVA 5DDRC 2RS2A 3S6EA 3CCSS 3SDEA 2I2YA 2CQPA 5FJ4A 5GAEU 2XS7A 4WF9Q 1X5SA 1VQKS 2HZCA 2BOPA 1KD1T 3CCRS 2MPUA 2XSFA 3VAJA 3CULA 4IUFA 1WG1A 2LA4A 2QEXS 3P5TL 2LEBA 2DGWA 2DGXA 2F9JA 1YJ9S 1KC8T 2E5IA 1N54B 2EVZA 3VF0B 5GADU 3G71S 2DIUA 1KOHA 3CPWR 1U1KA 3D2WA 5JVHQ 4F25A 2FY1A 3B4DA 3CMAS 2DGOA 2KVIA 3P49B 1OPIA 2N7CA 3K0JA 2DNRA 3CCLS 1K8AT 2KT5A 4ED5A 2DIVA 2MKCA 3ULHA 2J0QD 3UD3P 1FJCA 1OO0B 1X4EA 2MY7A 3CCVS 4UY8T 1WF1A 2YKAA 1JMTA 2ZJPQ 3EGZA 1WG5A 1YWXA 2DNNA 4QPTA 5HL7Q 1U1LA 3R1HA 1A7GE 2HGNA 2YTCA 2DH7A 4YB1P 2B0GA 4C4WA 3UCGA 2CQCA 1YTYA 2M8DB 3ZZZA 2AYEA 2M52A 4UQTA 3THPA 2L9WA 1VQMS 5GVQA 1M90T 1VQ9S 3Q2SC 4LMZA 1JJ2R 1M1KT 1B7FA 2YH1A 3BEGB 2U2FA 2LKZA 5LSLA 2CPEA 4IO9Q 5CXTA 3TO8A 2X1GA 1DRZA 2MZQA 2OTLS 3CCQS 1SJFA 2DNMA 2DHSA 2XS2A 1F9FA 1ZZFA 3CC2S 1DHMA 3VAHA 1YIJS 4OZ1A 1K73T 2WBRA 2CPJA 1VQNS 2DO4A 4IOAQ 2EK6A 1RKJA 1SJ4P 4PRFA 2MZSA 1H6KX 2L08A 3US5A 3BS9A 3BO3A 3MD1A 2MGZB 2LMIA 1XN9A 2QFJA 2XS5A 4W90B 3U1LA 1X5TA 1X4DA 2O3DA 5DDPC 3FEXB 1AUDA 1O0PA 2KU7A 2DNZA 2BZ2A 3NMRA 3NS6A 2XNRA 1KQSR 2M70A 4TU7A 4TLQA 1X4BA 4YOEA 1QM9A 1HL6A 3L3CA 3B4MA 2DGSA 4BS2A 4CIOA 1UAWA 3PIPQ 5JVGQ 2MXYA 4A8XA 1H2TZ 3CF5Q 4LJMA 3MUMP 2PEHA 2KM8B 3ZZYA 1S79A 1WWHA 2KHCA 3NNAA 1X4AA 1X4CA 5EN1A 3G9CA 2ADCA 1YJNS 2GHPA 3SDEB 2RQCA 2RU3A 1NU4A 1M5KC 5LJ5Y 3CTRA 1M5OC 1U2FA 2X1AA 5DM7Q 4TU9A 1Q86T 1FO1A 2KFYA 2J76E 2JVRA 1VQ5S 2G4BA 2DK2A 1BY9A 5CA5A 2DNQA 3G4SS 4P6QA 2KXHA 2CPFA 2L41A 2K8GA 2VODA 4QU6A 2CQIA 1Q7YT 1YJWS 1X4HA 2D9PA 4WFAQ 1S72S 2N82B 3BO4A 1VQ6S 4LIRA 1U6BA 1WHVA 1FHTA 1WI6A 2CPDA 2MQOA 1WHXA 2CQGA 4PKDB 2CQ1A 2LYVA 5GMKa 3H2VE 2KH9A 1U6FA 3R27A 3RW6A 1G2EA 2KXFA 2NLWA 5GAHU 2KN4A 2DGUA 1U1PA 2RQ4A 1M5VC 2OSRA 4CH0S 5H1SV 3J7YU 5IM0A 2MQQA 1HD0A 2DH8A 1QVFR 2LCWA 2KYXA 1WG4A 2DHGA 1FNXH 2HVZA 3G8TA 3UE2A 2MZJA 2KI2A 1H2VZ 4V19X 4C7QA 4CH1A
chains in the Genus database with same CATH superfamily
3DM2A 3KUHA 1JLBA 1IKYB 3GIIA 3IRXA 4NMLA 1HKAA 3HHEA 1HA1A 1XTZA 3K5LA 2KB2A 1RWOB 3HHNB 4WIIA 5HANA 2EC2A 1OQ6A 7AT1B 3UO0A 5ITHA 2UP1A 2NUUG 5AE3A 2OPRB 4LBHA 3MOZA 4MKYA 1EB0A 1EIYB 1CJKA 2DGTA 4I6WA 1S76D 4B3SF 4JI4F 3M2UB 3R5GA 2J8SA 3IR5B 3DRYA 1NB2A 1Y5LB 2I5JB 1J2VA 2FGCA 1FKOB 2CJXB 4FBTA 2KG1A 1U1QA 4HACB 2QTWA 3MMAA 3M6VA 1D8YA 3KG4A 3PW4A 2GV1A 1RHUB 4PXBA 2YWWA 3ZTPA 1TK0A 3PV8A 1QUPA 2AU0A 3MMBA 1KLNA 4N47A 2CAJA 5DDQC 1VHFA 1VRTB 4WIQA 3MPDA 5IFMA 1F9EB 4ECQA 3IWLA 1QUVA 4AFFA 2HHWA 3V2UC 3CVKA 2MKHA 4OV6A 2DCLA 1C0TA 2EW9A 1RHMB 1WI8A 1WD6A 4GMKA 2OO4A 2OH2A 2IJRA 4TY8B 1UCNA 1SJRA 4NPOA 2KG0A 3MECB 2KFNA 4K2XA 4WWSA 2UUAJ 4Y28C 1MG7A 3DRRA 4ILMA 4HHHA 2CQBA 3VALA 3DHXA 2OELA 4P2XA 3S1TA 2M7SA 3M6XA 1OY6A 2F3JA 1ZM2A 4OHWA 2MSSA 2J0WA 5IOLA 3VGTA 4WPAA 1CPZA 2HSEB 4I64A 2LQBA 4OZ5A 1HNVA 2ZC3A 3HD1A 2EFOA 4DI6A 4FXDA 1FNMA 1U1MA 1NO8A 3O44A 2VBYA 5EWFA 3OJUA 2CG4A 3IAS9 4ECTA 2QLBB 2VA3A 2KRRA 2WVCA 1YRXA 4UOCA 1RAIB 2J0SD 2DNHA 3PCOB 2EFGA 3FKBA 5IV3A 1FI4A 1RAOA 1N52B 2CPZA 2UXDJ 4KH1B 2WAQD 5HQMA 4CLZA 3PJ9A 2IVYA 3G8SA 1S1TA 3U1NA 4ZPVR 2RHQB 3OTOF 4YY3F 5DZ7A 2CWXA 2R2TA 1HNXF 5BYQA 2V4QA 4ID5B 3PR4A 2H5IB 3CCRS 4I2QB 3SZ2A 4DV3J 3KXDA 4LFCF 3JTPA 2DGWA 1TQLA 3VQTA 4HI1A 4B3RF 3MM9B 3VF0B 1U1KA 3Q8VA 4WJBA 1FESA 1TL3B 2XMVA 1WOPA 5D4PA 3DNCA 3RB0A 2RU9A 2XULA 4QWCA 5J2QA 4U95A 4R5PB 3MR3A 3T1AA 5IWAF 2ZOGA 5JMNA 3BBFA 3AB2B 5LMNF 3CB4A 1U1LA 2HGNA 3J7A1 3DOKB 3UCGA 2AYEA 2LEPA 2HBRB 1MSWD 4NXMJ 2W2OP 1UWAA 4EU0A 1GXTA 3IO1A 4DV6J 2FZCB 2XMMA 1WC5A 2EXUA 2KFZA 4YR2A 3PEJA 3CWJA 5K8MA 1NSKL 1EQMA 4CLPA 3H59A 4ZK7M 4MMOA 3K58A 1RKJA 4Q5VA 1GT8A 4DX8H 2BE2B 1U49A 2LMIA 1VHIA 2JSXA 5DDPC 3DOMB 5L1IA 5KT5A 1VK3A 2IBOA 3DYAA 2Z56B 4ZLLA 1JKHA 1ZETA 1DFDA 1XK8A 4Q45A 4HH0A 2CZVC 3TQ1A 1AW0A 3R6GB 4LF6J 1NK9A 1IKXA 1Y3JA 3MUMP 2RIJA 3IR7B 3TRGA 4C9DA 2DCUB 1T7PA 4ILLA 5KG0A 1Q86T 4K5SA 3TWZA 3TA1A 4LF4J 3NMAA 2GJFA 1IBKJ 3ZZPA 4K0KF 2RHSB 3ILIA 3EVMA 3ZTQA 3UW1A 4PG8A 2NR0A 2QO3A 3J81U 1EP4A 4RNOA 1HYSB 1M5VC 3MEGB 4ATNA 2LCWA 5CCLA 5C2GA 2HNZA 3JTNA 5M2UA 3GB0A 1LNQA 2HNDB 1S0OA 3JQMA 3RR7A 4ANDA 2V63A 1MMNA 2E1CA 3CDUA 3FQLA 4C6AA 2YX7A 1IQTA 3LP1A 3IGVA 2Q66A 4K4VA 2B4PA 1TL1A 2LQ5A 1WHYA 3J81Y 5HVHA 3TAMB 3QFWA 3T1HJ 1XC9A 4A8QA 1ZM9A 3OR1B 3J80Y 3QRQA 4Z7YA 2AJQA 4DG1A 2MKIA 3R9LA 1FK9B 3JTOA 1S10A 4OI0A 5B08A 2G0JA 5KFJA 3MXHP 3I96A 2JRSA 3D1OA 2FVRA 3OSPA 3ZZUA 4R8UB 1TK5A 4QIVA 4DXLA 1N4LA 1N88A 2GC8A 2IDLA 3VAGA 4H4MB 3DFEA 3LWLA 3D5MA 2CA9A 4X64F 2UUCJ 2JLGA 1T05A 3L7PA 3HT0A 4NXNJ 4OZNA 1VFJA 2CADA 4FPRA 3BBCA 2PFDA 3ET6B 1J5OB 2K7JA 1XMQJ 1RAAB 4ZVTB 2MY8A 4A48A 1TL5A 4CO4A 3LGNA 1T0TV 5AJ3F 5HMWA 1VR6A 1UETA 4DBQA 2P9CA 3TZXA 1SQGA 3BN4A 5KFZA 5HATA 4DZDA 1BD6A 1OY8A 4NEYA 4U96A 1U1OA 1TELA 4Y0FA 4C11A 2VH7A 4Y2IA 3MAAB 5KFUA 3IRWP 4WKRA 3MF5A 2UVUA 5IT0A 2OGUA 2VKZG 3R2CJ 2AYMA 1EQ0A 2VIHA 2HMIB 3HX9A 2DGQA 1FERA 1JNZB 4USKA 3CT9A 3R5AA 4B02A 1D09B 2YWFA 3W61A 1PYTA 2CPIA 3ENQA 1NSPA 2KT2A 2GVDB 5L8RC 3SV3A 3SQGA 1L3KA 2B43A 2V8DA 4LQ9A 3NBPB 3SBMA 3CJSA 4KIAA 2DHXA 1F5BA 3GYNA 2EC0A 1RT7B 3PYFA 4ZPAA 1D9FA 2ZJQQ 4NZ6A 2MHNA 3FBBA 4B3OB 4X4VA 2MZRA 3VHQA 4USMA 2UV8G 2CQPA 1RHRB 1KD1T 2HFZA 4J9VA 1LQ9A 3J81j 4RWXA 4C3MA 2QEXS 3TZWA 3PG9A 4DV7F 4DR7J 4PQUB 3H5SA 1HLWA 3I0SA 2HS3A 1HI0P 2QLWA 2FJWA 3QO9B 4OYXA 4ID8A 1UL3A 2HZAA 3I0RB 2IA0A 1S9GA 2C2MB 2J0XA 2GGPB 1JXLA 2ZJPQ 3BYRA 2W9CB 3QBCA 1A7GE 4ANEA 1BQNA 4F0KA 5EUHA 4NZ7A 4C4WA 1C4AA 2PGCA 4FBUA 3I6PA 1JLEA 4WU3A 5B0FA 3N28A 5M2PA 2QV6A 1M1KT 3DI6A 2WB4A 3OFGA 5GADI 4ZPWR 1RAJA 1GAOA 5DLGA 3HCXA 3T5KA 4C8ZA 4NLXA 3FVYA 2BRLA 1ZA1B 1GMWA 2K2PA 4OX9J 2HHTA 3RB6A 3UPFA 2L08A 3QT6A 1K1SA 3BS9A 4DV4J 3DMJB 2DRDA 5KFBA 3M8ZA 1Y3KA 2O3DA 1TK8A 2FJEB 5HAOA 3NMRA 4H54A 4PAAA 1X4BA 4TLQA 4WFYA 1ACMB 4PPDA 2BQUA 2DHHA 1NJZA 3DC2A 2MXYA 5D0RA 4RLEA 3DN9A 4LJMA 3X3UA 3R97A 3ZFVA 3M30B 1W2IA 3MM6A 3G9CA 3ILOA 3F56A 1UEUA 3A8EA 1TAUA 3TAQA 2GVZA 2J7KA 1U2FA 3NKYA 2UXCF 3GG0A 2GHVC 1RT4B 1SC6A 2ZOFA 4IQXA 4ELVA 1WSVA 2WONB 2EWHA 3A13A 1ZYQA 1SI9A 3EVOA 4G6VB 3JSRA 3BREA 1U2RA 1LEOA 2ALYB 1KTVA 5B0BA 3K2YA 2KL8A 2JEJA 2Z2ZA 4X65F 5KG4A 2QN6B 4LQ3A 1BUXA 2DGUA 4CH7A 2LLZA 2DTJA 5A8KA 5BYSA 4BLGA 3HPOA 2KI2A 2ZD1B 4KQZA 5IZHA 5BR8F 4V19X 3CJKA 2AP6A 2ATLA 4DR6F 2M4MA 4Q43A 3T5JA 1Q8BA 4MFBA 2DR9A 3WX4A 5D77A 4RUCA 3UWTA 3D3BJ 1D8ZA 2JX2A 3GJQB 3MFHA 4EK2A 5B0CA 2E9ZA 1LK5A 2H4YB 5C7PA 1RWMB 2FPHX 2X3GA 3W65A 1R89A 1CJVA 2BJ3A 1UVIA 3SMZA 1KBRA 2UUWA 3GJRB 2MKSA 4WXOA 4KH0B 3BQ0A 1RK8A 3VGSA 2BM1A 1FJGJ 2MHEA 5AE2A 4RO0A 2VDHA 1YRTA 3TP2A 3HZEA 4IDKA 4IQMA 4GC6A 4RW8A 1VQOS 2GHWA 1WKLA 4KGVB 1RWUA 2XY7A 3PRDA 5CYJA 2B6AB 2ZJRQ 3FZ2A 2RILA 1D9AA 3H5YA 3OXLA 4QJVA 1UW4A 1HBOA 5F8LA 4JI1F 1JJCB 2XBPA 2YPZA 3AY0A 1B7YB 2HYIB 1XNRJ 3EPGA 3G6YA 4DLEA 4EWTA 1RE1B 3EXYA 3VV2B 5KFLA 1OY9A 4QWEA 2J6UA 4RL1A 3TVYA 4F26A 4NLTA 5KT4A 1NK5A 1FFSB 4HL9A 4LF8J 4WU2A 1F9HA 4OYPA 3G6ES 1PAEX 2XGQA 3BBBA 4NYPA 1TVRA 4M5JA 4U67Q 3S8SA 2R7TA 2BKOA 3MR5A 5KFRA 4ZDNA 2MZTA 3OUYA 2HHSA 4Y3CA 2M2BA 4OZ0A 5HLFA 1VBYA 5IXUA 2F9DA 2ZFHA 4URSA 4ITSA 2P5VA 1FRMA 1REVA 5E3PA 4JV5J 5D4OA 2VB6A 4HHUA 4NWBA 3FNNA 2ZZMA 1H7WA 2LXUA 3OSNA 1Z4UA 4EZ9A 2A3JA 1UA1A 1JLAA 2MZ1A 3K5NA 1UJ5A 5KFKA 3MEEB 4CTAB 3THTA 1OSDA 4ZA1A 3UN3A 2Q6CA 3ZTOA 4DSKA 2LECA 2UXBJ 2LXIA 2DGVA 2DR7A 5ETPA 1DTTA 2VBWA 2B9WA 2CIMA 3M32B 1BQXA 4PG7A 2AZ3A 5CZVA 2E5IA 3HSJA 4EYIB 5KOXA 4P74A 5F0UA 4DL2A 1T9WA 4L73A 3KLIB 5LM7E 3CCLS 4OIXA 1M1HA 4KGZB 2IJNA 4P7TA 2YKAA 3O2IA 1RT3B 3O3LA 2Z4PA 4QPTA 3MM8B 1QTNB 3H90A 2KDOA 3BH6B 1FRLA 3QGHA 4X2BA 4K4WA 5K14A 4LT6A 1BC6A 2YH1A 1CULB 5CHCB 3WZ0A 3SFGA 2AJ1A 2ZHAA 2QG9B 4KYZA 3QIDA 4DFKA 4IG3A 2DO4A 3EGWB 2JOQA 3AHPA 1GXUA 3OFFA 2QYCA 3A3PB 2RMLA 1XN9A 3BN7A 4H4KC 1HQEB 4KSEB 5D0GA 1NB7A 1Q4RA 1DTQB 1S6QA 1GX5A 5T7LB 3R5DA 1AZSB 2OD6A 4PXDA 3CJ4A 5A8RB 4CNZA 3I87A 4KV8A 2G1HA 3SDEB 1HI1A 2VFUA 3PYDA 3I32A 2DK2A 4U8VA 2VG6B 2VODA 4WTYA 1RBAA 2HQDA 3VGUA 2QGFB 3NGRA 3VQSA 4WFAQ 4QR1A 1SKRA 2FVSA 1I3OB 2FJAB 5IC4B 3I5CA 3AJ1A 2J9CA 5EX3A 1GQEA 1LOUA 3G82A 2JNJA 1G2EA 1UW9A 4HTJA 4CM0A 1XMOJ 4CH0S 4ZS6A 4Y2MA 3H4BA 4F0HA 4O4RA 3HFVA 4IYQA 2GFFA 5J2MB 3W64A 4C7QA 2YBVA 4J9KA 4M63A 3I5AA 3BDEA 3V6HA 4DSFA 4P2MA 1TKXA 4PXEA 4WE1A 1K0VA 4F8RA 1RT2A 1K1QA 1JK9B 3MR7A 3D6HB 4FYDA 1A6LA 3VCDA 4TQSA 3BJYA 3NWGA 4RU9A 4B9TA 4WZMA 4OJHA 2OD4A 1Q7LB 1U0SA 2XB2D 4WTOB 1F3VA 1VQ4S 5IQ6A 4GKKJ 2VG7A 1VLOA 4JUZA 1S1XA 4EMDA 1TKZB 4QW8A 1U45A 2VFVA 2RSQA 4DUYF 2MQ8A 1P8GA 2NZCA 5DLFA 1T03B 2VPWB 3CC7S 1N36J 2HWHA 1VQSA 2MLZA 2G1DA 2GQCA 1NK4A 5E41A 3ETOA 4M5IA 2YH0A 1N5TA 3W2WA 1PJ6A 2W7AA 2GQQA 4Q0BB 2R2UA 3MDFA 4A8KA 1QAXA 2IIHA 2R2RA 4KPYA 4Q8EA 2HHUA 4NYZA 4F36A 4UY85 4ZVOB 5J1EA 2NZ4A 1RHJB 3GP9A 3BPSP 4KHMA 3Q83A 1F6TA 2UUAF 3UVJA 1SIWB 2HRUA 1R6YA 2V94A 1CC8A 4QYRA 4ZLNA 2ZOMA 3MCOA 3MMCA 4ZVFA 4DQIA 1R0BG 2R7UA 3KK2A 2FC9A 2DEJA 4OI4A 3CCUS 2FVQA 2WVFA 1QAJA 2V2ZA 5LSOA 4OJ3A 2CPXA 5ETKA 2AHOB 3LALA 1QDUB 4FN5A 2R8KA 3QZ8A 5SZTA 1Q1KA 4DSEA 1WEZA 1WKKA 1HWUA 3P4UB 3KK3B 1M0SA 1Z1ZA 1HD1A 1VBZA 2ASYA 3AFGA 3CCES 2MMYA 3OLAA 1S12A 1CJTB 1WORA 2Q43A 3OD2A 3H7HB 3AXKA 4U8YA 1HMVB 2R7QA 1SC4B 5KG6A 1JLFA 1RTJA 1QLNA 2HAIA 1N6QB 3UCUP 2BR0A 4KHPJ 3HVTB 4YS2A 4DR4J 2DNGA 3RRKA 2RS2A 5G4DA 2UXDF 3C16B 4XDCA 2Z2LA 4KKOA 3SYZA 1Q79A 9ATCB 4YP3A 3BGOP 3AA8A 4USWA 1TFYA 3D66A 4RW6A 1RAEB 1M1GA 4ZJLA 4IRKA 4CDIA 3UD3P 3UR3C 4OI2A 3EGZA 4PWUA 1JLBB 1YWXA 3IRXB 3LTOA 5ETTA 4MIBA 2B0GA 2W7PA 1YTYA 4FKXA 4R0EA 1QAIA 1C4CA 1VOMA 1JJ2R 3OTBA 1CJKB 4CO5A 2HQ3A 1Q78A 1ZZFA 4CLFA 4IFYB 3VAHA 4ELTA 2E66A 2R7RA 1U7LA 3QGPA 3CO0P 4LBPA 2PA8D 3C66A 4F04B 2R3VA 1T94A 2W8KA 4DV6F 4LF9J 3MMAB 4UZCA 1X4DA 4USTA 2KU7A 2BV3A 3TW0A 4HKQA 6FD1A 1H7XA 3EZOA 3RBXA 3TNVA 3MMBB 2VD3A 3UN2A 2PEHA 2QLFB 2NUHA 1T9UA 3ETMA 4DWIA 4WFXA 5CYQB 2A10A 2ADCA 1GK8A 4HI2A 2RQCA 3HZGA 3CDWA 3NGUA 2RRNA 3IS9A 3GV7B 2CPFA 1FFWB 1X9MA 4YHHJ 4LIRA 1WHVA 4DMZA 3K59A 5H9EJ 1U6FA 3JYTB 1VJWA 2KN4A 3HFZB 4LF4F 1FRJA 1I51B 1Y11A 3K5OA 3F44A 1AB8A 2XSJA 5IM0A 2B9YA 2HVDA 4V1Ak 2OKQA 4KTQA 1U0HA 2JC1A 5J2NA 2RF2A 1PO6A 5C2CA 4BC7A 4X62F 1DLOA 5DG8A 3CJ2A 4OZJA 2LA6A 5E5NA 2J6SA 2NS1B 4OYZA 1M5PC 2IM0A 1F5CA 5IQQA 4RNNA 4DSLA 5A6PA 4QYZJ 3EJMA 3TA0A 2ZE2A 3DGPA 1RWVB 3RTVA 4S0MA 4XPCA 3QQCD 1FX4A 2HZVA 1S1TB 3LO3A 4H4OA 4NLUA 3T1HF 1FTCA 4WYLA 1URRA 4F7VA 1Q95G 5F0WA 4ECWA 2MYFA 4DS5A 1F3FA 5LXRA 5DETA 2DNPA 4F02A 3GYGA 3IFEA 2FLPA 4DQPA 1S57A 3AD9C 3MM7A 3QZ7A 4P9SA 4U6PA 1WNEA 1QVGR 4DPWA 1SJQA 4ECVA 4FYWB 4E0DA 3ICLA 4P2SA 2IAJA 3C6TA 4MTPA 3BR9A 1SC1B 3NOCA 5LMNJ 4ANCA 4A8MP 3W9JA 3TI0A 3C6UA 1R8HA 2BJEA 1R8AA 3HO1A 1HQUB 1BGXT 2ZH6A 4Y00A 2F4FA 3HHLA 3V4IB 5DG7A 2FY8A 2M9KA 1PC5A 7FD1A 2FD2A 1XMQF 2KHDA 1JLGA 3FBEA 5HMZA 5KFDA 2FVPA 1FT8A 1TL4A 4B9VA 4IOCQ 2C2OB 3H20A 2B56A 2UUBJ 1T9VA 3TX8A 1DQAA 1TV6B 3DYAB 2GZOA 4O3OA 2GIRA 2CRLA 1JKHB 1S9EA 1KS2A 2MGZA 1NXIA 3RR8A 2C2DA 1IKXB 2ZWOA 4CO1A 3QRRA 8RUCA 1P9YA 1G3OA 1JJ4A 5HO4A 4OX8A 1XQIA 2Q79A 4DPUA 3PVXA 2DR6A 5G0RA 3MTJA 3W8GA 3CIZA 1XIQA 1QE1A 4FVMA 3H42A 2PMZD 3T41A 4K0KJ 2XS7A 1X5SA 3M6WA 3VAJA 1ZTTA 5C24A 2BJ9A 4UUWA 3BQ2A 1EARA 1H98A 1KOHA 2XI2A 1H72C 1EP4B 4IFVA 1RYSA 5JVHQ 5F3ZA 1EJ7L 2FY1A 3RRGA 4I2PB 1RWXB 2R42A 1LWEA 4ZVHA 3NAIA 2DNRA 4ECZA 3W3SA 3C15A 5KG7A 2YNIA 3NXZA 1JMTA 4DPYA 2BBEA 3B8HA 4QR0A 3TEHB 3GJTB 3OR2A 4DU7A 1S1VA 4R0JA 3BKUA 3HSGA 2IC3A 1TL1B 2U2FA 1DRZA 2KT3A 3MEDA 2GCFA 4C0HA 1X0PA 1YIJS 1SVDA 2HS4A 1GXLA 2BEFA 4DG1B 2YNFA 5F8IA 4MJKA 3PX0A 3I4HX 3MD1A 4NCGB 4P71A 4CO3A 1JWWA 3C3LA 2VUGA 4IR1A 3L3CA 3PW2A 2DGSA 2WW4A 2LVWA 3D67A 4ICLA 2W8LA 4FF1A 1I6JA 2KHCA 5EN1A 1NKEA 4FYXB 5IC6B 5H9FK 1M5OC 4ZITA 3K17A 4RWWA 4DCOB 3KHHA 5IT9U 4HLBA 4AD6A 4PWDA 3G4SS 1SKUB 2ZZTA 3Q8UA 5F8GA 2ZH1A 1RBLA 4C8MA 3CMQA 1LK7A 4C3KA 2NXUA 3PDNA 4PKDB 1AT1B 3H25A 2YWEA 3H2VE 3SI8A 2KXFA 1TAQA 3HFKA 3UNGC 1U1PA 2BW7A 4X84A 1XBWA 2EPIA 3QIPB 4L3KA 5KFPA 1LXJA 5T41A 2KYXA 2PN6A 2H5JB 3PHTA 3PHEA 3HF5A 3T9NA 3KJFB 3MZIA 2NYIA 3JQKA 1UMJA 5E2QA 2GIFA 3CW2C 1ZH5A 2YQ0A 2DPJA 4O0IA 3E2EA 4C11B 4QWDA 4NI2A 4U7UD 4DCPB 2WSCC 2WTFA 2QL7B 3SEOA 1TUGB 4CLLA 2HNYB 4DN0A 5HBMA 2KJVA 3N0VA 2ADBA 1B99A 1RTHA 1NPKA 2HQIA 4TKTA 4OI3A 2FHOB 4DQSA 4G65A 1R8BA 2DXFA 4DDFA 2POKA 1FA0A 1S6OA 5KFMA 3OPKA 1YJVA 1X7VA 1RGVA 5SUHA 3OHAA 2QE5A 1FJGF 8AT1B 4MIWA 3ZZRA 4EFAC 1SQEA 4FS1A 1WC3A 1H38A 4WCEQ 2ZUAA 4FPIA 2ZVIA 2HLUA 3QGGA 1H3DA 3FBCA 5I3PA 4OHZA 3IBCB 1RTDA 1I5OB 2E5LJ 3FDSA 3GSIA 4HT5A 3TANA 3W1YC 1N5YA 2G13A 3BPDA 3DHWC 4ZCLA 4C0OC 5E3RA 1NRKA 3WBZA 3OXGA 1NCLA 2AYGA 1JNRB 3GIJA 2CFXA 5MLCV 1JLEB 3JS9A 1VGYA 4J9QA 2XHCA 1UFWA 3NOGA 1HR0J 3KNGA 3DI6B 2GJIA 3WC0A 1U6ZA 3THVA 2U1AA 3PEHA 1LKZA 2BJ1A 1HNIA 1YX2A 2HVEA 4QWBA 2K7KA 2R7XA 3OQ2A 3M05A 5J1NA 1IBLJ 3M2VA 4N5SA 2AYBA 3AQOA 5KOWA 2HK3A 2HFOA 4WP9A 1RT6B 4I1TA 4ZPDA 5D0HA 2E1PA 3V81B 1S0MA 5CQGA 3F73A 5FDLA 1VIXA 4UF4A 4PCQA 2ZBCA 3L7UA 1WEXA 4DV1F 2NREA 4ZVUB 4MYUA 1PYSB 2KRBA 3MM6B 4ZCKA 5KG1A 1YKWA 4J5OA 2IRYA 3OTEA 1V9OA 3NL0A 3DLKA 1NK8A 1SQFA 1MW7A 4KFBA 2MPUA 2Y0BB 3DLGA 1R0AA 2X7IA 2KVQE 4IH6A 2UXBF 4P52A 1L3VA 3JSMB 2J9EA 4PYDA 3TVZA 4F25A 4P7VA 4ZVEA 3CJ0A 2CNKB 4CO0A 2AF6A 5KTQA 1RWWB 3GV8B 2DGOA 3M8QA 2KT5A 4LRCA 1IM6A 3QAUA 2W4CA 4NLSA 3RGIA 2MY7A 4AL5A 4OJGA 4MKVA 3TA2A 4DR6J 1QD1A 4J9MA 2QLJB 1Y9OA 1UFLA 3BF4A 2FHJA 3AODA 3RBDA 4MFBB 3AH6A 5GVQA 3N6LA 4YFUA 4IH7A 4OFZA 3E51A 5LSLA 2ABYA 1NZAA 1B4SA 3G87A 4BCAA 3MGJA 3BV8A 5J2PB 4Z37A 2CXEA 1CJVB 4ZHRA 3R5CA 1SJ4P 1ELOA 4JP8A 1Q16B 1UEVA 3M2UA 2CZ4A 2AJ0A 4AL7A 4Y65A 4IDKB 1JLQB 4UOFA 4RW8B 1KSPA 3CCTA 3EYZA 3IBWA 1NJXA 1S6PA 2HRYA 2WSEC 1AYEA 2NXNA 4OYBA 4A8XA 3CF5Q 4J9SA 3KJQB 1KP6A 3IGNA 1WWHA 4Y6IA 3RYLA 3NAHA 1RA7A 1HBOB 4DV0J 3SV4A 4QZVB 5KFHA 1VRTA 5A76A 1BY9A 4GRSA 1ZS6A 1E6YA 1YJWS 4DN9A 2NSBA 3N5BA 1EKSA 3C2PA 2D9PA 4F2RA 1AXQA 1XR5A 3PYGA 3EE3A 2RUSA 3EZ5A 2AMCB 1YLXA 4OZ2A 3RW6A 2ROPA 2NLWA 3IWXA 3VVTA 4UOHA 2EG1A 5H1SV 1HD0A 2DH8A 3DGVA 1QVFR 2FHMA 2VA2A 1FNXH 3PRBA 1ZAXA 2MZJA 1IKWA 3M8PA 2LEAA 1TVRB 4ZKAA 2G0IA 3NG8A 3VR1A 3ZNUA 4N7TA 3OUYB 1HPZB 4TN2A 2IA6A 4DX6A 6FDRA 5HLFB 1KFSA 1W2BR 4RW9B 1LFWA 3H5UA 4LSZB 2E1MC 5D4LA 3MAQA 1REVB 3LWMA 3RRHA 2VPZB 2LU1A 3GE9A 4RU2A 4EBCA 3BO2A 4RW4B 1S1UA 1S49A 2CPHA 3UD4P 2RQKA 4RUAA 4DHVA 2V9WA 3KHGA 5C5JA 4IO1A 1U24A 2M0GB 2D9OA 3RB4A 4PR6A 3D4JA 4DJBA 1JJHA 4EGLA 8ATCB 3G6XA 1I94F 3PJXA 2EFPA 3UQSA 1DTTB 3V6KA 3P45B 4KGKA 4DPOA 2ZH4A 3W63A 4MK9A 1U4BA 2FZGB 4WXWA 1NKCA 3MURP 1TMJA 1V3RA 2VC1A 4GKKF 4ID5A 2UVWA 4I2QA 3GPAA 1G4CA 4ED6A 2EI5A 1WTBA 2M8HA 2V0NA 2BANA 3FMWA 1N5VA 2C2NA 3QJPA 2XYHB 2EEYA 3PTWA 4YDDB 1RDRA 2DD8S 5ETSA 2I0XA 3J7ZT 3R1LA 3IG1B 2AGPA 3G6VA 2MJUA 4K4XA 2W7OA 1T02A 3CC4S 2COLA 3PYEA 4QR2A 4BWJA 1O6XA 5J1PA 3NNCA 1SH3A 2VV5A 2RDJA 4DPXA 4OZLA 4UW2A 1FKPB 1VQLS 3QWPA 3D0IE 5D78A 4WFNQ 4IG3B 2ZH2A 1U02A 2YQ1A 4YB5A 4M8LA 1RXOB 1NK0A 1T9YA 2F7VA 2QSWA 3BKFA 3P8BB 2BXJA 4WK1A 1FDNA 3OHBA 1SL2A 3CD5A 2AGOA 1S6QB 1V3SA 4O3QA 1KVIA 4PABA 2VL1A 2J8AA 3DOMA 4AUKA 1NAQA 1U1NA 1FRIA 4KV8B 2ROGA 4EO6A 3N6NA 3ZC4A 3PW7A 2G0CA 5K9FA 3VAFA 1VBXA 2YWKA 3CD0A 2ZDOA 3CCSS 4B17A 3EICA 5GAEU 1VDHA 2Z2YB 3A8IA 4X4SA 1S7IA 2XSFA 4IUFA 3KKFA 2JL9A 3ZO7A 4KHPF 2IHR1 3DU5A 4DR4F 3G82B 1RAFB 3HHLC 1RU2A 2HHQA 1RAGB 2DXDA 1FXRA 4OV1A 4AXIA 1LWFA 1JXVA 1IR0A 1MMDA 2FYXA 2DIVA 4K4ZA 4ENOA 1HYSA 3HVWA 1XERA 2F8MA 3U02A 2ZITA 4K8RA 1ZBTA 2Y1JA 1WG5A 2Q1LA 4ED2A 1PBAA 5HL7Q 2D41A 3KLEA 1RKIA 2YNGB 3DKDA 2XCAA 2LQJA 5HVFA 2YY3A 5KFFA 4K4UA 2H9ZA 2ZKUA 1YJRA 4USUA 4WE1B 4OYAA 1RT2B 3D6MB 3KUEA 4F0MA 5KFCA 4PRFA 4M5DA 4NOHA 4K59A 3BO3A 1MU2B 3WX8A 1FVSA 1S6UA 1RT1A 2VG7B 3W5ZA 2VG5B 3AOAA 4DUYJ 2XMUA 2QMWA 5CH7B 1MN9A 2QA2A 4LF9F 3LP0A 2AWZA 3KFWX 3MPWA 3VZHA 1X4AA 3KLVA 1YJNS 4XTTA 5DM7Q 1KTQA 2PO4A 2HIQA 1IM4A 2JH3A 4R8UA 4NA1A 1ULRA 1RA6A 4ZJOA 2IBKA 3NWRA 2ZH8A 4H4MA 2ZBPA 4LREA 4USJC 3NCQA 1QAYA 4JI7F 3MCNA 4JI0J 5IV4A 5J1EB 1KNZA 4YHHF 4O44B 5IS2A 2EG2A 1J5OA 4A8WA 4G3IA 4NLQA 4RBTA 3KLHA 2QMXA 4QBUA 2XWYA 2H1YA 3KK2B 4WZQA 4GO7X 5KFXA 1UA0A 1N0UA 3M2RB 1PSDA 2K3IA 5F8JA 1HWKA 4DV2F 1YHQS 4N41A 3MAAA 3H40A 1FTRA 1KONA 2J7WA 2DKOB 2XLIA 3Q2TC 5A8WA 2DITA 3Q8SB 1YDLA 4WFZA 2GO9A 1FKAF 4DS4A 3CJRA 1K0TA 3EPIA 1JLFB 1RTJB 3E01A 2JHEA 5LJ3Y 2SXLA 2GVDA 5GMEA 2Q6BA 3NBPA 2OI2A 1LW2B 3GIKA 5C25A 4IR9A 1FX2A 4KKOB 2V2QA 2XY5A 4C8LA 3HKZD 1B64A 4CLWA 4CLKA 1RHKB 1X0FA 4B9UA 3GYXB 3GILA 1IXKA 1RACB 4ZN1A 2E44A 2DNYA 3A8JA 1VJQA 4CYUA 4OYMA 3I0RA 5ETQA 4FNIA 2VBZA 1UVMA 2GGPA 2MKJA 3PIOQ 3KUGA 4F4AA 4TY9A 3LUYA 4ZVSB 3CUNA 2W9CA 2DB1A 4BDPA 4BWMA 2DH9A 3PX4A 3FBFA 2YKQA 2YQ3A 1FE4A 4JV0A 3CXCR 3EUNA 1WJ9A 1MMLA 1ZOTA 3OXFA 5DJBA 1UTAA 2G2OA 1NNDA 2MKKA 3I5BA 3NS5A 2KYZA 4FF4A 2B8QA 4ZIWA 2ZUGA 2A2DA 1VQ7S 3DMJA 2E5JA 2R4FA 4LBIA 2UV8A 2UUBF 3ZZTA 4RX6A 2F5GA 1U8WA 1SL0A 1FWLA 2VONA 1VMBA 2NXJA 2VBXA 2LQ8A 4L72B 3BB5A 3M8WA 4TYBA 4U7UK 2LDIA 5HP1A 4P73A 1JX4A 1MWQA 3AXMA 4RNMA 3PY8A 4JBCA 2DY9A 1YJ9S 4YQWA 4W4MA 1KVJA 5BYRA 5EDWA 1FD2A 3HLUA 4J9LA 2XSJB 4USIA 1HFEL 1D1UA 2D7SA 3GIRA 1K8AT 3IC1A 4E98A 1HWIA 1T3OA 4G1QA 2VFTA 4MAKA 1TUWA 1U0HB 4X62J 3D68A 2RF2B 3J80U 2ZD1A 1DLOB 4OX6A 1N34F 1M90T 3M9OB 2V9KA 5CD4H 1B7FA 4L6V3 1SCJB 3TO8A 2GX8A 2O66A 1E6VA 3T3FA 1BXNA 2BRKA 2DNMA 3PRVA 1M5SA 1L3UA 4ZMMA 5E7OB 4IG0A 4HT7A 2L48A 1Y7PA 2AW0A 2DRAA 3ITHB 4RW7B 4F67A 2C42A 4DUZJ 1UVJA 4H4OB 3M8SA 3FCHA 3FK4A 2M70A 4TU7A 1QM9A 1NDCA 4A8OA 4DL3A 4A8FA 1UAWA 4P2FA 3PIPQ 5RUBA 2XMAA 3K8WA 3SFUA 1HBUB 5KFWA 3JQJA 1SUQA 3RZAA 3MM7B 2HHHF 5LJ5Y 3CTRA 2I1RA 4QIFA 2IAJB 2K8GA 3HHDA 1WSRA 1REGX 2G2ZA 2N82B 3C14A 1U6BA 1WI6A 4CWBA 2KH9A 3C6UB 2GA7A 3PFOA 3CO9A 2GQ2A 1PJ5A 3GFZA 2ZBRA 2EKNA 2MKYA 3LGMA 1FNOA 4I69A 1W7WA 3HHLB 3MPVA 4RPFA 1H2VZ 1JLGB 2E5HA 5DQGA 1EAYC 5ADZA 5DRKA 4LR9A 1IR2A 2JLEA 3T6BA 2ZH3A 2XNQA 1LXNA 4RR5A 2K3KA 4MKBA 2ZHBA 4DSJA 3D0HE 2M3DA 3NNHA 5KFYA 2DO0A 1S9EB 4ALZA 3W9HA 3P3DA 1VCTA 5KFAA 1HHQA 2W01A 3V4MA 4E2FB 5C42B 2RT3A 3PFEA 5G0RB 2OAUA 2IPOB 4KC5A 3FCVA 5I3UA 4JI2J 2BM0A 1QE1B 1YBTA 5THWA 1YSJA 5AXNA 4DL5A 2QIFA 1RLDA 2AJ2A 2LQ9A 2BQRA 4LSNB 2C3YA 2HKEA 2E7WA 1X5PA 4CNYA 2MQPA 2K1RB 2IM1A 4IFVB 3QRPA 5K8PA 2V8VA 4QU7A 2B4OA 3K57A 2HFUA 5EWGA 1F60B 1YQHA 3C15B 3HJVA 5GAGI 2DRBA 1NDKA 2DR8A 3EX7B 1J27A 4A47A 4JI3F 2RVJA 3OR2B 4DZ6A 5EGYA 3OL6A 1S1VB 4MT1A 3P5BP 4I6AA 4N76A 3ENVA 2CVEA 2E5LF 1NH8A 3MM8A 3TR5A 1X5OA 3M4XA 5HJYA 4FNHA 3I31A 5LMUJ 2R8IA 2J5AA 1AFIA 3RAMA 4NRTA 2B7CB 2X1BA 3R7BB 4PPZA 1S48A 1HR0F 3QLHA 3CE8A 3LPYA 4CLYA 1TU0B 1CS4B 2RNEA 4B3MJ 5CYMA 2DNKA 3HI9A 1N56A 4KJIA 4ZIVA 1VQYA 1FE0A 5L46A 5F9NA 1HHTP 1NEEA 3KJVB 2JFDA 2FLNA 1X9SA 2AJFE 5GAGU 4ICLB 1IBLF 1TKTB 5AE1A 5DDOC 3HULA 3IWNC 3HDSA 5AXLA 5K8OA 3TOQA 2VZ9A 1KEKA 3V5RA 1S1WA 4F3QA 4J9UE 3H4DA 3W66A 1HNWJ 4CZCA 4DL4A 2WRMA 2BJ7A 3SDEA 2YKNB 3DRPA 2DXEA 3ZTRA 1Y10A 1Z2ZA 3CGIA 3D6FB 2XO6A 4K5RA 3GLJA 4DQRA 3AOCA 2F65A 3CJQA 1N54B 5F8NA 4Z7CA 5HN0A 5GADU 3G71S 2CG8A 2DIUA 4U9RA 1YGYA 1IQZA 2AEJA 5CAAA 1WTFA 2V5HG 1RTIA 3QJJA 2BE9B 4AL6A 1WF1A 1CJUB 3Q0AA 5D8HB 3PKYA 1NKBA 5D0EA 2ZZNA 3R5JB 2WVBA 4YB1P 2V4RA 2APOA 1GTEA 2M8DB 5J2MA 4NI2B 1QSLA 3O1LA 4FF2A 3ENWA 5HMYA 3E3XA 1PIEA 3FSXA 3KK1A 3U7JA 5D4NA 3FGVA 2OEMA 5CCMA 4FDFA 2XS2A 1SKWA 1KHWA 1C2PA 1RTHB 1K73T 4IOAQ 2YWHA 3BSAA 4B9SA 2VFSA 1WDTA 4M5KA 4ZCIA 1M5HA 1YRUA 3PACA 3W2VB 5KFQA 2Y8YA 4M1KA 4QPXA 2XNRA 1BWVA 1EETB 2GMHA 1TL7A 1Q0NA 2BYCA 3MM5B 2A18A 2FLLA 3KLFA 1FFGB 4YB6A 3G86A 5E3QA 1O8BA 1KQKA 4CLTA 2WOMA 4KE5A 2QSFA 3W5XA 5LSRA 1S4EA 5CA5A 2L41A 2FVCA 1I1GA 3HK2A 3I4PA 4O3NA 4KBIA 1RTDB 3B6BA 3BO4A 2X51A 3M9MB 5KFVA 2PMHA 4DV0F 3SSQA 1RQ0A 2MQOA 1N5YB 3GU0A 3Q8QB 4Q0BA 5CD4A 3EMTA 3QATA 4FZVA 2P9GA 5DQHA 4NLWA 1SH2A 3TX0A 4CO2A 2H48B 1NLKL 4ELUA 4DR5J 3SCLE 3V6DA 1TKDA 2H5EA 3EDQB 2WVDA 2BOAA 4ED4A 3QMQA 1HNIB 1NDLA 1AUSL 4YUDA 2Q3PA 3M2VB 3CDEA 1N5QA 2VOPA 4X4QA 3BM7A 4HDGA 3MUTP 2MB0B 5GAHI 3DLLQ 5BXIA 1A9NB 3H0PA 5FDLB 4Z2XA 2BVZA 4DV1J 5A6WA 3MR6A 5DGBA 2IVMA 2VQFJ 2YKMA 1YVFA 3QAEA 2LP4A 1CJTA 2CJQA 4MYTA 2VQEJ 4ED0A 2A2CA 2D1CA 2CDRB 4NE9C 3OVSA 4QWAA 3CMES 2HWIA 1DBDA 3DLKB 2XZDB 1SJ3P 4KFBB 3I82A 2QA4S 3A1YG 2VFRA 1Q53A 1R0AB 3N9UC 5H9EK 1R3NA 3EGVA 5B7WA 3NCPA 2HRTA 2GO8A 1FWKA 3IA0A 3RUBL 3OLBA 5E3AA 1VC5A 3CCMS 3TZZA 2PMWA 3JSYA 2OIHA 1HW9A 2HBYB 1MROB 2DT9A 2OSQA 4M94A 2DY1A 4JOUA 2V6AA 3TYTA 2J9DE 2L9NA 1U8SA 1KOOA 2O67A 4ZOSA 1U2CA 4MKAA 3JB9k 3FEZA 3TEGA 3KJNB 1Y5NB 1HW8A 1FXDA 4F3MA 1TTHB 3FFIA 4ZVRB 1TR0A 4QYZK 2FHKA 4ZHRB 1KHVA 3OTDA 5KG5A 2HWTA 1O51A 5KT6A 4IFYA 2P6SA 2GMLA 2CQHA 3EWGA 2JJ4D 5KG3A 2KKHA 2L3MA 3IM9A 1HARA 3B82A 4LFAJ 1S6PB 3BYPA 4PUOA 2Y1LB 3UDVA 3TVKA 2CQ4A 3OL8A 4KAIA 5F8MA 2DVIA 3VAIA 4IRCA 3OVBA 2ZWPA 1WACA 1U47A 5ETNA 4NLDA 1YZ6A 4ZP7A 2PT0A 3KTQA 5EHHA 3V6JA 3S6EA 5CYQA 4DPTA 2MDAA 4LF5F 1TFWA 1SL1A 1E6YB 4ZLPA 4CRJA 1V6HA 3P5TL 1NDPA 1NM2A 5A0YA 1JQGA 3M7VA 1DARA 3WQPA 5K8NA 3D2WA 2IJFA 3B4DA 2RQMA 2C3OA 2BW2A 2KVIA 3JYTA 1FDDA 4DOZA 2OPQA 1H0HB 1IKWB 4Q2LA 3SCIE 3TUZC 3M8PB 3ONQA 1RT5B 4IKAA 2C2KB 4O3PA 2CQCA 2M52A 2MLYA 2ZDPA 4UQGA 3FCWA 2FJDB 2Y9HA 4MK7A 4IO9Q 2NPIA 1FRKA 5U47A 3CCQS 1SJFA 1CEZA 3TAPA 5ETOA 3W5YA 4DSIA 1X60A 1WC0A 1S1UB 5FLXU 1H6KX 4DF4A 3HXMA 3LOUA 2I8EA 3US5A 4LF2A 1I94J 4KY3A 5KG2A 4W90B 2OPPA 2DNZA 3ZXWA 3GQCA 1OJ4A 2A6MA 4DLGA 2PFFB 2XHWA 2VC0A 3UI3A 4GVBB 2BACA 1VBKA 5DO2A 2O01C 3LANA 3NNAA 1X4CA 4NA2A 4Y2CA 4H4KA 1SIZA 1N32J 5FLXY 3MAHA 2BANB 1VLYA 2RKIB 1WKJA 4JI8J 4TVAB 2V4JA 1LFPA 3H5XA 4DX5A 4HR2A 1VQ6S 1T95A 2XG8A 3M8YA 1C1CB 2PSZA 1UJ4A 2HVZA 1W26A 4X4UA 1PILA 2H54B 4JI0F 1HQUA 1KFDA 2HW3A 4OI6A 2V34A 3R3TA 3V4IA 1T8EA 2DYAA 2OPSB 3MPYA 2DNLA 3GR0A 4FXVA 1R31A 4F4KA 1Y5IB 3CEDA 2HGLA 4F4ZA 1N33F 3R5BA 2W1BA 1R27B 4J91A 3E8OA 1BLUA 3I56S 2QMUB 1TV6A 2PDAA 3SXLA 1VRUA 3QWUA 1FEEA 4NLOA 2BMBA 4V19J 1CVJA 1S7HA 1T9XA 2OTJS 4LF7J 4MIAA 1WC4A 2ZBIA 1RBOB 2IYGA 1VC6A 3DU6A 1VIOA 1U25A 1Y4ZB 2YX4A 5E3CA 2XZTB 1PCAA 2ZM6F 3M1VA 3K8VA 3L4BC 4UUXA 5M2RA 3KMQA 4HDHA 3CCWA 1IBMJ 1LWFB 2FHJD 3KOAA 2XMTA 3C19A 1KWMA 4RKUC 2JLFA 5I4MA 4I2PA 4A4JA 1NK7A 2FJXA 4TNOA 2BJDA 3KLEB 1TZ0A 3RU0A 4C0BA 2QT7A 2DR5A 5KFEA 3CJ3A 1UKUA 1ZPWX 3DM2B 3Q24A 1DQ8A 1SV5A 3JSBA 4WP8A 2KXNB 4X66J 2XI3A 2B5JA 3NGDA 4QQBA 3NS7B 2NCKL 3RBEA 1T11A 4DR1J 4I67A 3GWCA 4M5DB 3GSDA 3MMJA 1Q81T 1J5EJ 5LT5A 1HIYA 2W2QP 2FB0A 2W2MP 2H3EB 1RT1B 3B54A 2FC8A 4DL0C 5CABA 4EZ6A 4XIUA 2OMLA 1WC1A 4NCGA 3S01A 3ISZA 1OIAA 1URNA 3LP0B 1Q82T 1NMEB 4ZPTR 1N8RT 1WF0A 2R8JA 4DR3J 2DHAA 3OTCA 2ZVSA 2XC9A 2MTLA 3RBZA 2A0FB 2ALZA 5I3QA 2I2YA 5FJ4A 3D7SB 3DRSA 2AKWB 4NCAA 4JI7J 1V3ZA 2LA4A 3SCKE 1C0TB 2ASLA 2F9JA 3T9ZA 2CKWA 4YR0A 4Y2AA 4DR2F 2ATCB 2EFVA 4JV2A 3DRRB 2N7CA 2FGOA 3OL9A 4K7QA 4ED5A 1JIHA 4X4TA 3KLHB 3BR8A 1RTZA 3QIPA 1QJHA 3FRYA 3AOBA 2HLTA 2DH7A 1HNVB 3FJ2A 1G7CB 2UZAA 1YBUA 4UQTA 4LRBA 2FLOA 4DV2J 3PX6A 1IKVA 4KO0A 4KGXB 3HKWA 3DDNA 1TMMA 2YKPA 4O3RA 5HI7A 5A8WB 3HT3A 1XNQF 3PKMA 2HNYA 5FIIA 1HBNA 2P2CB 1B0PA 4OX7A 3RG6A 3E01B 2BDPA 4HYKA 1C0UA 3KHRA 2GMJA 2PIIA 4NLVA 1O0PA 2D69A 3WDOA 1KQSR 3O8WA 2BKNA 4YOEA 5C25B 4DFPA 1YJTA 1GX6A 2ZH5A 2B7BB 4B3TJ 5JVGQ 3W60A 1F0XA 1H2TZ 3AD7C 4DUZF 2WSFC 2F1FA 3ELHA 3CNQP 3D3CJ 4ZVGA 4PG5A 1SJ1A 2NSCA 2W25A 3QGIA 4TU9A 3HP6A 2WHOA 2JVRA 1VQ5S 2G4BA 1RISA 1NK6A 3BQ1A 2D74B 4FKYA 2B4VA 3TJ8A 2WVEA 4CYUB 3QPIA 3H2LA 5EWEA 1IWGA 2VJUA 1HNZJ 2QL9B 1NSAA 5J2QB 1C1BA 4F4YA 2FUG9 1IJFB 2R8HA 5B0DA 3N79A 1FCAA 1OYDA 1BE4A 2F8EX 2HHVA 2JVOA 3OV7A 3F41A 3DLHA 2MEWA 2YKOA 2ZH7A 3RAQA 4O4GA 5HSPA 4CT9A 3ZTSA 1AA1B 5DM6Q 2MSTA 1KKHA 1UEKA 4P72A 2JC0A 1SC3B 4DQQA 4LUBA 2Z2MA 4PQAA 5DG9A 4LFBF 1RT6A 2JWNA 1X9WA 2UVRA 2CZ9A 3UCZP 4ZVPB 2N4CA 1YJUA 3V81A 5I42A 4OMFG 3LAMA 3KWMA 2XWXA 2E1AA 4FS2A 2IMWP 2E1RA 3DOLA 4UTGA 1FVQA 5MAOA 3BGRA 1FF2A 2OEJA 1GMUA 2MLXA 4YR3A 3QFHA 5HP1B 1U26A 4L76A 4I56A 3QNWB 1GFWB 4NYOA 4JI2F 2RRAA 1NJIT 2AGQA 1NJYA 2LXFA 4MK8A 1S99A 1IR1A 1HQ2A 3BKTA 2V8GA 3JSMA 4G1QB 4M5GA 2EBGA 4C8OA 4J9PA 1K9MT 3LP2A 3VTIA 1N34J 5F41A 2W4DA 4ZPCA 2HNZB 3HMJG 3PR5B 2CJ9A 3SSRA 4B08A 5KFTA 2N3LA 3HVRA 1PYOB 1E6VB 3GTYX 2QL5B 3QSIA 3LP1B 4X4NA 4I6YA 2E9RX 4PWWA 4CLSA 3HJFA 2BUNA 2DJWA 3D54A 4IG0B 4DFMA 4I0WA 4O0NA 5J2PA 2HHXA 1WELA 3BGUA 4FF3A 4L75A 5LMUF 4RJVA 3UN5A 2DPIA 5HVGA 3SQOP 4NZ0A 3CDBA 2C3UA 3CIMA 1JLQA 3PM9A 2HHPA 1UP1A 2QC3A 4TU8A 2ZNZA 2KZZA 3T1YF 2HHHJ 4B3MF 1KVKA 1SUQB 4OYWA 4JV1A 2F4VJ 2AX1A 4CQ1A 3S7RA 1PC4A 2IDEA 2CQ3A 5L39A 3IMQJ 3CCZA 3BGLA 5DGAA 2Y1RI 1RU1A 3C14B 3CULA 1LWXA 4KR0B 3JXOA 4N8OA 1HNWF 1UVLA 1S59A 4UZBA 1LWCA 4AQYJ 1ZA2B 1T05B 2VF3A 5D3GA 4DX7A 3K0JA 2FJBB 3AD8C 3R8YA 2ROEA 5KFSA 1K47A 1FJCA 1OO0B 3TUIC 4JI6J 5B0AA 2VPYB 4K4SA 2YXLA 2ZC4A 1MLAA 2G9OA 3BSNA 3NRBA 4GO5X 2WZ1A 3ZZZA 3CJ5A 3Q23A 4URQU 4I4BA 1OSCA 2V67A 2LKZA 2JDJA 2CPEA 2H65B 5B0GA 3DCAA 2C1EB 1HPZA 3GIMA 2J6TA 1NUEA 3AJDA 3DLEA 1NPPA 5HQLA 1DHMA 5ETLA 4RW9A 1G1XA 4CT8A 1IN0A 3AT1B 2QJ3A 3HD2A 4YMEA 2NYHA 4RW4A 2VPXB 3Q86A 3J7YI 3MWBA 1APSA 4LSLA 5I3UB 3SQGB 3Q22A 5HROA 2WCXA 3D9BA 4K4TA 1BHNA 1LW0A 5AXMA 1HL6A 2ILYA 2Y8WA 1RCXB 4I7FA 1S79A 5KFIA 2Y0SD 5L9XA 3BGFA 2V2KA 4F4XA 2AV5A 4GKJF 1M5KC 1NU4A 1XWLA 1RJJA 1NH7A 4LRAA 2AZ1A 2EFNA 1G6BA 1VK8A 2XM3A 2RAQA 2C22A 3H98A 1X4HA 3I0SB 1JXEA 4JI5J 4JI3J 4NCBA 1S9GB 5GMKa 2QA1A 3GCWP 3A12A 3R27A 3NGKA 1RP5A 2CWKA 1CQMA 2O5DA 3IG1A 2ACMA 1BQMA 2V69A 3J7YU 2DHGA 2HG4A 1XR6A 1BQNB 3FQKA 3I9ZA 1KLMA 3KLGA 3U27A 3TQEA 1FKPA 2XMKA 3CD6S 3MEKA 3QLHB 1HBMA 3VAKA 2XEXA 2M88A 1PGZA 4Y34A 4M95A 6AT1B 4DR5F 4XAKA 4DFJA 3RW7A 5CYMB 3ADAC 4LF1A 4RBVA 3J7AN 2W24A 1YZ7A 4DL6A 2P8IA 3FUYA 1S9FA 3POTA 4RUHA 2C2RA 5D15A 3ILJA 1B70B 4QIEA 1UWBA 4YN3B 3EXCX 3LH2S 4C8KA 2EBEA 1EHWA 1S1WB 3QSYB 1JLCA 1X4FA 3OL7A 3MR2A 2W9BA 5KT2A 3DRPB 2R2SA 1L5UA 2CPYA 3CCJS 2VQFF 2PEBA 2GVZB 2I6WA 4FVCA 3OJSA 4G1PA 2KO1A 2VQEF 2B4UA 4ED3A 1FXLA 1CG2A 2WBMA 4DV5F 1F5AA 4ZJQA 3L95X 2C2ZB 3IXQA 2MQMA 2XGPA 4KRWA 4ERDA 4OQJA 2GAGC 2XY6A 3QT8A 1RTIB 2EK1A 1DURA 3UFCX 5A8KB 2GNKA 1FRXA 2YNHA 1RLCL 2JEFA 1BWEA 2HFSA 1QSYA 2VICA 4OYIA 2YNGA 3CJKB 3KK1B 2IVFB 2R9LA 4QIGA 2AEMA 5LXYA 4JB8B 1IKYA 1R6VA 4OI1A 1DAXA 2UU9F 1VQ8S 2BA9A 1UZHA 1WC6A 4ZVQB 3KDOA 4IOBA 1YG0A 4WBFA 5F3TA 5CZXA 3BDPA 2OPRA 3DXBA 2C28A 1F2HA 1WOSA 3NY0A 3MD3A 5D6GA 2DBBA 1YI2S 1R8CA 4Y2KA 2AD9A 5K5MA 1MU2A 4LRFA 1TL7B 4LVOP 2I5JA 4F2SA 1FKOA 4ED7A 2VG5A 3DLJA 5L1KA 3KLFB 2XYGB 4MH8A 2IFXA 4HACA 3QJLA 4XPEA 3VZIA 3CDAA 4LFAF 4HEA9 2WOMB 2D3O1 3D1HA 4X4PA 5DDRC 1PG5B 1TUVA 4M5HA 4FP9A 1WDDA 5KFNA 3JAMU 1VRQC 3D28A 1VQKS 2BOPA 2LFVA 1H73A 3EZUA 1ICEB 2AX0A 2AJ4A 3AB4B 1CSJA 5F8HA 2XLJA 1ROFA 2V68A 2F40A 1HWJA 5JJBA 2R7WA 3CMAS 4TY8A 1SBRA 3P49B 1OPIA 3MECA 1T3NA 3K89A 2MKCA 2J0QD 3CJ8A 1X8DA 4UY8T 4O44A 3V6DB 3CSKA 2P9EA 2DNNA 2VDIA 3JAMY 2YTCA 4K4YA 3K5PA 4DUTA 2L9WA 1LV5A 3OT9A 4DL7A 2B3TB 1OQ3A 5CXTA 3ISNC 4RNFA 4JYAJ 3M2RA 3K7RA 4RZRA 4DCJB 3CC2S 2FTRA 1XMBA 3GR1A 4RBUA 2EK6A 4ES3A 4URGA 4ETZA 2HEKA 1O5JA 2WW8A 3P96A 2YKMB 4W98A 1OYEA 3AJ2A 4EBDA 3SSSA 1AUDA 5K20B 4N56A 1B0TA 1KR4A 1JLAB 2EKYA 2ZHOA 4CIOA 1L3TA 4QIWD 2R7OA 3L7OA 2RE1A 2AEFA 1LW2A 3ZZYA 4EI2A 3PW0A 4N77A 2RU3A 1FO1A 4ED1A 4J90A 1RADB 4NASA 5LL6d 4EO8A 2B51A 3KDNA 2IM3A 4DV3F 2CQ1A 1N32F 2FIUA 1VYAA 3MM9A 3J7Z5 4KPCA 1OMSA 4JI8F 1VISA 4AT1B 2VU5A 1TL3A 2OSRA 2HQCA 3VGVA 2PI5A 4L74A 1UPPA 3UE2A 2Y3YA 1RI7A 4R5PA 4J9OA 3FFIB 2HVHA 1L3SA 4IH5A 1F1BB 2DISA 1GMWD 2MQNA 5K14B 3I55S 4B3SJ 1OWXA 2V2VA 4JI4J 3DOKA 1D0EA 4ZP6A 3AQPA 3C46A 2AT1B 4A46A 2J7UA 2V50A 1NBEB 2HAFA 4NXMF 2OMOA 2E5GA 4D3GA 2BABA 3G8QA 4X4RA 2VKRA 4XK8C 3RAXA 4W92B 4PUOB 2BE2A 3WHIA 3TJ9A 2IM2A 2Z0GA 3IP0A 3M8RA 4OLPA 4LF5J 4PYAA 2IYIA 3M6UA 1OS5A 4F4WA 4DF8A 2ZEJA 1S97A 1AFJA 3O5TB 4LF6F 5A0YB 2C3MA 3MUVP 1YITS 3DXSX 3QYYA 4NRUA 4EBEA 4LF7F 2QZ8A 3D1QA 3MFIA 3ILLA 1WUUA 2OJ3A 2ZKTA 2GIQA 1NHUA 1WF2A 2OPQB 3M9NB 2RJZA 4WYWA 4FYVB 1IBKF 1XEZA 2VASA 2HGMA 5LOQA 1FDAA 3NEKA 2HFVA 4B9MA 3EDRB 4OLOA 1MWYA 3GV5B 1RWNB 1IBMF 1QTMA 3MEGA 2JFKA 2CJYB 3HVAA 2FDNA 2W9AA 2ASDA 2D3OR 4CM2A 2HNDA 2RRBA 5ETVA 4UT4A 2CQ2A 1SXLA 4NEZA 1TKXB 1V5IB 4QCLA 1Y00A 2I38A 4C97A 2QRRA 3PXGa 4X66F 3B78A 3BSOA 2XLKA 2OPPB 3GG1A 3TAMA 3ITHA 4RW7A 4ZP9A 4DR1F 3OTOJ 3OR1A 2RDIA 4YY3J 5B09A 2LDYA 1Q8KA 4RUBA 1HNXJ 1PBUA 1J5EF 1EKRA 1D9DA 5ETRA 4FXWA 2CJAA 1U1RA 1S1XB 4USHA 1NPRA 4LFCJ 3O6QA 3H2UB 5EX0A 3T5HA 1FK9A 1GEHA 2E7VA 1HBUA 4B3RJ 4Q44A 5GMDA 3UDEA 4WP3A 1JB0C 1MNEA 2YPYA 2V4JB 2HZCA 3IAM9 4ETXA 4DR3F 1WG1A 3OVAA 3Q8RB 2UUTA 9RUBA 3W2WB 4AYBD 3GFYA 1CBKA 2XTJP 4ED8A 2A6OA 1CC7A 5IWAJ 2PI4A 3IR6B 2F63A 1RUSA 3SCJE 5JXSA 3MPUB 4C48A 2PC6A 3ULHA 1X4EA 2H51B 3CCVS 5KT3A 2UUCF 3ET6A 4NXNF 2IMOA 3UVJB 3LPEA 3EVWA 2HBQB 3MMCB 1AROP 2JZ5A 4OL8A 3THPA 1VQMS 2XCPA 1N33J 1P1LA 2X1GA 2MZQA 4B9NA 2PA3A 5AXKA 2GAHC 2WBRA 5T14A 2CPJA 5E0OA 1KQGB 1NHVA 2CDQA 2GJ2A 1FDBA 4LR7A 3N4WA 1VRUB 1DY3A 2W2NP 3A4TA 2W4PA 3QT7A 1QY7A 2HMIA 5C42A 4ES1A 2RH3A 1TP7A 2X3DA 2R7VA 2CNLB 3HSDA 1U48A 4KGMA 2ZM6J 1FEHA 1IJEB 5KFGA 3FC9A 3N5FA 1RT7A 4J37A 2HQGA 1WOOA 2L9DA 4LSNA 2J76E 3M1VB 4B3OA 4B3TF 3HM9A 4KHRA 4OHVA 3W8PA 4OHXA 1RB0A 4Q2MA 3ZZOA 2OHDA 2K1RA 3FZBA 5IT4A 4RW6B 2Z8QA 3GZ7A 3SIPB 2YVSA 2LYVA 2GS8A 3IBFB 4PQUA 4ECXA 4I68A 3WC2A 4PG4A 3QO9A 4DR7F 4U7CA 2RQ4A 1N0VC 1B3TA 3KHLA 3W7BA 2MQQA 3D6TB 3R2DJ 1HNZF 3BSCA 4O23A 1SV5B 3EM1A 2E7XA 2B5JB 2V8PA 1CQNA 5B0EA 1UVKA 3UDLA 3RB3A 1R7IA 2CVIA 1F2GA 1RAHB 4NLYA 4YB7A 5AT1B 3WIVA 4Q7AA 1KDNA 1P9QC 1UPMB 4WKYA 3GJSB 5A2QU 2V8HA 3T5LA 1CS4A 4C8YA 5ETMA 3VWSA 3LW5C 2N4DA 4OX9F 2XZWA 2A1BA 3KJVA 3CD7A 3GFXA 2LU2A 2EFQA 3KYLA 1ZTWA 1KN6A 1TKTA 2OEKA 3GCXP 4DV4F 3AA9A 3LA0A 4NX9A 1RABB 2NPFA 7FDRA 3DRSB 1UVNA 5HQ8A 2X1FA 3BH7B 2NXCA 3U1MA 4X64J 2CQDA 3M30A 4USVA 3IS9B 4CLUA 5A2QY 4ECSA 2YKNA 2O1PA 2HIYA 1V5VA 4DR2J 3TZYA 1RHQB 2ZH9A 3DLBA 1RT4A 3PO4A 2WONA 1DZ5A 2OUGA 3WIUA 5KT7A 5AJ3J 2BJ8A 1MWZA 2D3UA 2VOOA 4ZCMA 2QA4G 4M5LA 4G1IA 3IN5A 5IM0B 2IY5B 3G2XA 4LIWA 3MTKA 3TJAA 1CJUA 5IT9Y 1GMVA 2RS8A 1IKVB 3F0NA 5J2NB 4KO0B 2E9TA 3NLCA 1Y0HA 4KB7A 5L9NA 2RB7A 1P6TA 3FSIA 1ZPVA 1YJ7A 1XNQJ 2PE8A 3G96A 2D3ZA 4R25A 5HMXA 1HBNB 4WK3A 1H2UX 1P1TA 3MCSA 2I9SA 1A0OB 3NGSA 5F9LA 2ILZA 1C0UB 2IRUA 2RUGA 2HS0A 3IM8A 2XO7A 3VVUA 2ZE2B 4LRDA 3DGPB 4OJ1A 2KM8C 4D3HA 2HBZB 3OW2R 1WEYA 3QT5A 1ZM3A 3W2VA 5DS7A 2ACYA 2MJNA 4NL5A 1EETA 4EYHB 4DV7J 1Q8IA 3PJWA 4Q8FA 2DNOA 3KG1A 3MM5A 3LQVA 4M5MA 4CCHA 4AE5A 1GH8A 2F8HA 2JEIA 2B6AA 4DEZA 2F4VF 2LEBA 1IBCB 3KNAA 2DGXA 4ILRA 4CI0B 2JEGA 3C6TB 3UR0A 3OFEA 2EVZA 4C2MA 2CYYA 3C8YA 4HTIA 1C1BB 1EX8A 3OBIA 1NJWA 2YWGA 5L1JA 3AAWB 1XNRF 2XYPB 2Z30B 1X31C 2W2PP 2YX1A 4A8YA 4OYOA 4AQYF 3FSYA 3PZPA 1PJ7A 4PG6A 1FWPA 1ZM4A 1ZAWA 2RDDA 2CUYA 1KQFB 2HFNA 4LMZA 4O4GB 4JI6F 3KG0A 4LF8F 1YBAA 2OTLS 3N6MA 2DHSA 1F9FA 2XMJA 4LFBJ 1XR7A 1VQNS 2J9DA 2NXEA 4GC7A 4XO0A 2R8GA 5I42B 1D3WA 2MGZB 1RSCA 2QFJA 4LR8A 3DOLB 1X5TA 4TXSA 5JUMA 2Z58B 3BGRB 2BZ2A 3NS6A 3UNYA 1YK9A 2UXCJ 3B4MA 2BE7D 4BS2A 2OLWA 3KMSA 4JV5F 4PZVA 2B9EA 3MEEA 4CTAA 4P10A 3HHKA 2X1AA 2KFYA 2UVVA 4PEOA 3GMGA 2BKPA 4X65J 5C24B 2FZKB 4OZ3A 4P6QA 4QU6A 1Q8LA 1Q7YT 2BX6A 3M32A 4GVLA 1S72S 1VI7A 1FD8A 1FHTA 3N01A 2Z57B 1ZAVA 1Q5VA 3ENAA 4YDXA 1LWEB 3I9V9 3W9IA 3LP2B 2QLXA 5BR8J 1S4FA 4ZN3A 2Y1IA 1MROA 2HURA 3KLIA 5HK4A 2YNIB 3T19A 2VJVA 1RWKB 4FYYB 4JI5F 1WG4A 4NMXA 2VHGA 2CNNB 1ITPA 4CH1A 1RT3A 2IC3B 2CQ0A 3ZZ0A 1VS3A 4HH1A 3A8KA 3MEDB 1NHKL 3LF0A 1K44A 4B9LA 4OHYA 4ZPBA 5KFOA 3ISND 1W25A 3PW5A 1CULA 2YNFB 2ZBQA 4QW9A 2R7SA 1R43A 4WFBQ 3T1YJ 1Q5YA 1QSSA 2KTQA 2MQLA 5KAKA 1UJ6A 3Q89A 1RCOB 4DU8A 1RYRA 1S0VA 1HQEA 1Z2LA 1CLFA 4JI1J 1DTQA 2N3OA 2C2EA 4XDDA 3CJTA 2HVIA 5T7LA 2RD5C 1S77D 1ZZNA 4TYAA 3A3OB 4C3LA 1AZSA 5A8RA 1H74A 3EGNA 3OFHA 4PWDB 4PXCA 4ES2A 3UD5A 1RZMA 1LWCB 2DEIA 4ECRA 4YEAA 5D3GB 2VG6A 4F50A 2ERRA 3VAMA 1X4GA 2G2YA 1GTHA 3Q8PB 2PD1A 4RNHA 4IRDA 2OFHX 1SB6A 2QFIA 1SPBP 4J7CA 3TUJC 3R7NB 2HPUA 2B8PA 1FJ7A 1OPZA 1RT5A 1GNKA 1XMOF 3MOJB 3FEYB 1WHWA 1PKUA 1VQPS 3P6YC 4X4OA 3DLEB 1SKSA 1DJ0A 4P75A 5DQIA 1FRHA 1U09A 3T6JA 3A3NB 3MI7X 1UFKA 1P27B 1R0CB 5HBMB 1IWAA 4EUVA 3R6LB 4UOGA 3LGHA 2HQFA 5BJRA 2XMWA 3GONA 4LSLB 4TQRA 3H8YA 1R8PA 5HROB 4BHQA 1LW0B 1B0VA 2H4WB 1VC0A 1NSQA 4I7FB 2QYGA 4GKJJ 1FJEB 4HVZA 3PNIA 1T9TA 3NGTA 1UZDA 1IVZA 4E8UA 4GVBA 2CJKA 4ZLJA 2FJVA 2KZMA 3MCMA 4O3SA 1TKZA 2CNOB 4WF9Q 3ZNJ1 2B9XA 3HSZA 1S0NA 2AQ4A 1DQ9A 2IRXA 4K50A 2OFGX 1HHSA 4NLPA 1T03A 2RKIA 1KC8T 3W62A 1PAUB 3MHYA 1N48A 3NP5A 3TUPA 2WB1D 4CP5A 3CPWR 4KT0C 4ER8A 1N5SA 5H9FJ 1N36F 3LAKA 1BQMB 4ECYA 1XJWB 4TLRA 1C1CA 5DZ6A 4AXJA 3HHLD 4ZP8A 1IUJA 1MN7A 1KLMB 4J9NA 3KLGB 3L09A 2FQQB 2OP5A 3R1HA 5GAEI 4C8NA 1HBMB 1VQ9S 4QOTA 3Q2SC 2NQPA 3BEGB 2ASJA 2OPSA 4J9RA 2KJWA 4NA3A 3FRZA 4L3NA 4OZ1A 3POTB 4NLGA 4NLRA 2N7YA 2GW8A 2MZSA 1UWBB 3GFHA 4ECUA 3DRXA 3Q8YA 3TARA 3L9ZA 4JYAF 3FMBA 2XS5A 2M5YA 3U1LA 4BBYA 3FEXB 3KK3A 2E29A 1SH0A 2ZNYA 1JLCB 3R7SB 2W9BB 3RJMB 1HI8A 3X1LB 2CJBA 4DV5J 2P6TA 1HMVA 2KM8B 4N8NA 5L1LA 1N6QA 2GHPA 3DDIA 5E33A 3HVTA 4LVNP 2HK2A 2XQCA 3DLGB 4BC9A 2DNQA 3C16A 2KXHA 4F3OA 2CQIA 2AIRB 5HJXA 1S5ZA 4K2JA 2WK4A 2CPDA 1RWPB 1WHXA 1EZZB 2CQGA 3DDKA 1BMQB 4HHJA 2QX0A 3M8QB 5FD1A 1NZ8A 2YNHB 2K06A 5GAHU 2C3PA 1KRPA 4C98A 4M5NA 1HWLA 2BQ3A 5L38A 4EEYA 3D0GE 3PO5A 3G8TA 3UDCA 3NCRA 3BZQA 4A8SA 2UU9J 3K5MA
chains in the Genus database with same CATH topology
2E5HA 3DM2A 3GIIA 1JLBA 1IKYB 2JC1A 3IRXA 4NMLA 5DQGA 2RF2A 3HHEA 5J2NA 1HA1A 3KLGA 1PO6A 3U27A 1XTZA 5ADZA 3K5LA 2KB2A 4BC7A 1FKPA 5DRKA 4X62F 3HHNB 4WIIA 2XMKA 1DLOA 1OQ6A 5DG8A 2JLEA 3CD6S 3MEKA 3QLHB 1HBMA 5ITHA 3T6BA 2NUUG 2ZH3A 2XNQA 3VAKA 2UP1A 3CJ2A 5AE3A 2XEXA 2M88A 2LA6A 2OPRB 4OZJA 4Y34A 5E5NA 1PGZA 4M95A 1LXNA 3MOZA 4DR5F 4XAKA 2NS1B 2J6SA 4MKYA 4DFJA 3RW7A 1M5PC 5CYMB 2K3KA 2DGTA 2IM0A 4MKBA 2ZHBA 4DSJA 4RBVA 1F5CA 2W24A 3D0HE 4I6WA 2M3DA 1S76D 3NNHA 5KFYA 4B3SF 4DL6A 2DO0A 5IQQA 3C3LA 4RNNA 4DSLA 4JI4F 1S9EB 4ALZA 3M2UB 3IR5B 1S9FA 3POTA 5A6PA 4QYZJ 4RUHA 3TA0A 3DRYA 3P3DA 2C2RA 1Y5LB 2I5JB 5KFAA 1J2VA 2FGCA 3V4MA 1FKOB 2ZE2A 3DGPA 4QIEA 5C42B 3RTVA 2RT3A 1UWBA 4FBTA 2KG1A 1U1QA 4XPCA 3PFEA 3EXCX 3LH2S 5G0RB 2OAUA 1S1TB 4C8KA 3LO3A 2EBEA 3MMAA 4H4OA 4NLUA 3T1HF 3M6VA 1FTCA 4KC5A 4WYLA 1D8YA 3KG4A 3PW4A 5I3UA 1URRA 2GV1A 1S1WB 2BM0A 1QE1B 5F0WA 5THWA 4PXBA 4ECWA 1TK0A 1JLCA 1X4FA 3OL7A 3MR2A 2W9BA 2MYFA 1QUPA 3PV8A 2AU0A 5KT2A 4DS5A 3DRPB 2R2SA 1L5UA 2CPYA 3MMBA 5LXRA 1YSJA 2VQFF 3CCJS 5DETA 1KLNA 4N47A 5AXNA 4DL5A 4FVCA 2QIFA 3OJSA 2BQRA 2DNPA 2LQ9A 4G1PA 5DDQC 4F02A 1VHFA 1VRTB 4LSNB 2C3YA 2KO1A 2VQEF 2B4UA 4ED3A 5IFMA 1FXLA 1CG2A 2WBMA 4DV5F 1F5AA 3IFEA 2FLPA 2E7WA 4DQPA 4ECQA 1X5PA 4CNYA 2MQPA 3MM7A 2K1RB 1QUVA 3IWLA 4AFFA 3QZ7A 2IM1A 2HHWA 3L95X 3V2UC 4U6PA 1WNEA 4IFVB 3CVKA 2MKHA 5K8PA 1QVGR 2DCLA 3IXQA 2V8VA 4QU7A 1C0TA 2EW9A 1SJQA 2B4OA 1WI8A 1WD6A 2MQMA 4ECVA 3K57A 2XGPA 4KRWA 4GMKA 2OO4A 4ERDA 2OH2A 4E0DA 3ICLA 5EWGA 4P2SA 2IAJA 3C6TA 4OQJA 4TY8B 1F60B 1SJRA 4NPOA 2KG0A 1YQHA 4MTPA 3BR9A 3MECB 2XY6A 2KFNA 4K2XA 5GAGI 1RTIB 2DRBA 2EK1A 4Y28C 4A8MP 2DR8A 3DRRA 4ILMA 1DURA 3TI0A 2CQBA 3VALA 3DHXA 3UFCX 3C6UA 3S1TA 2M7SA 3EX7B 3M6XA 4A47A 4JI3F 1R8HA 5A8KB 2GNKA 2RVJA 2F3JA 1ZM2A 4OHWA 2MSSA 1FRXA 2YNHA 2BJEA 2J0WA 3OR2B 5EGYA 2JEFA 1CPZA 3OL6A 1R8AA 1BWEA 3HO1A 1S1VB 1HQUB 4I64A 1BGXT 2LQBA 4I6AA 1QSYA 3ENVA 4N76A 2CVEA 4OZ5A 2E5LF 1NH8A 3MM8A 3TR5A 1X5OA 2ZH6A 1HNVA 2YNGA 4Y00A 3CJKB 3KK1B 3HHLA 3V4IB 2IVFB 5DG7A 3M4XA 2ZC3A 4QIGA 2R9LA 2M9KA 4FNHA 1PC5A 5LXYA 3I31A 2R8IA 2J5AA 7FD1A 1AFIA 2EFOA 2FD2A 1XMQF 3RAMA 2KHDA 1JLGA 5HMZA 1IKYA 4OI1A 5KFDA 1DAXA 4FXDA 2UU9F 1VQ8S 4NRTA 1FNMA 2FVPA 1U1MA 1NO8A 1FT8A 1TL4A 2B7CB 2BA9A 3O44A 2VBYA 5EWFA 2X1BA 4B9VA 4PPZA 1S48A 3OJUA 4IOCQ 1HR0F 3QLHA 4IOBA 2CG4A 3CE8A 1YG0A 3LPYA 5F3TA 5CZXA 3BDPA 3H20A 3IAS9 2OPRA 3DXBA 4ECTA 2B56A 2VA3A 2C28A 2KRRA 2RNEA 5CYMA 1YRXA 3MD3A 4UOCA 3TX8A 5D6GA 1DQAA 1TV6B 1R8CA 2DBBA 2DNKA 4Y2KA 1YI2S 2J0SD 3DYAB 2DNHA 3HI9A 2AD9A 1N56A 4KJIA 1VQYA 4O3OA 1FE0A 2EFGA 2CRLA 1JKHB 2GIRA 5K5MA 5F9NA 1S9EA 1KS2A 1HHTP 2MGZA 1MU2A 3RR8A 1NEEA 3KJVB 2JFDA 2FLNA 4LVOP 1X9SA 1N52B 2AJFE 2C2DA 1IKXB 2I5JA 2CPZA 4CO1A 5GAGU 4ICLB 2WAQD 1FKOA 4F2SA 1IBLF 4ED7A 2VG5A 1JJ4A 1G3OA 1TKTB 5AE1A 5HO4A 4OX8A 5DDOC 2Q79A 3DLJA 5L1KA 3KLFB 4MH8A 3PVXA 2IFXA 2IVYA 5G0RA 3G8SA 3MTJA 1S1TA 3IWNC 3HDSA 3QJLA 5AXLA 3U1NA 4ZPVR 5K8OA 3OTOF 3TOQA 4XPEA 3CIZA 2VZ9A 3CDAA 3VZIA 4LFAF 4HEA9 1KEKA 4YY3F 3V5RA 1S1WA 2WOMB 4F3QA 3D1HA 3H4DA 1QE1A 4X4PA 4FVMA 4CZCA 5DDRC 4DL4A 2R2TA 1HNXF 2PMZD 1TUVA 2WRMA 4FP9A 5BYQA 3SDEA 2YKNB 5KFNA 2XS7A 3DRPA 2V4QA 1X5SA 3D28A 4ID5B 3PR4A 2BOPA 1VQKS 3CCRS 4I2QB 3SZ2A 3M6WA 3VAJA 1Z2ZA 1ZTTA 3CGIA 4LFCF 3EZUA 3JTPA 5C24A 4K5RA 2DGWA 2AX0A 2AJ4A 3AB4B 1TQLA 3VQTA 4DQRA 1CSJA 5F8HA 2XLJA 4HI1A 1ROFA 4UUWA 3MM9B 3BQ2A 4B3RF 1N54B 5F8NA 3VF0B 5HN0A 2F40A 5GADU 1HWJA 3G71S 1H98A 2DIUA 1KOHA 2XI2A 4U9RA 1U1KA 1RYSA 1EP4B 4IFVA 4WJBA 1FESA 5JVHQ 5F3ZA 1YGYA 5JJBA 2FY1A 1TL3B 3RRGA 1IQZA 2XMVA 2R7WA 4I2PB 3CMAS 1LWEA 4TY8A 1SBRA 4ZVHA 3P49B 1OPIA 5D4PA 3DNCA 3NAIA 2DNRA 3MECA 2RU9A 3RB0A 2XULA 4QWCA 1T3NA 4ECZA 3W3SA 5KG7A 5J2QA 2MKCA 1WTFA 2V5HG 2J0QD 4R5PB 3MR3A 1RTIA 3QJJA 1X8DA 4AL6A 2YNIA 4UY8T 1WF1A 4O44A 3V6DB 3T1AA 1JMTA 3CSKA 3Q0AA 5D8HB 5IWAF 2P9EA 2DNNA 2ZOGA 3PKYA 5LMNF 2BBEA 3AB2B 1NKBA 3B8HA 3CB4A 4QR0A 3JAMY 1U1LA 2HGNA 2YTCA 2ZZNA 4YB1P 3J7A1 3OR2A 3DOKB 2V4RA 2APOA 1GTEA 3UCGA 2M8DB 4K4YA 5J2MA 2AYEA 2LEPA 1QSLA 3K5PA 1S1VA 4R0JA 1MSWD 2L9WA 3O1LA 4FF2A 3ENWA 2IC3A 1LV5A 5HMYA 3E3XA 1TL1B 4EU0A 4DL7A 2U2FA 1GXTA 2B3TB 1OQ3A 3FSXA 3IO1A 5CXTA 3KK1A 3U7JA 5D4NA 3FGVA 2XMMA 1DRZA 2KT3A 3ISNC 3MEDA 2KFZA 4RNFA 4YR2A 2GCFA 3M2RA 3PEJA 5CCMA 3CWJA 3K7RA 4C0HA 4RZRA 2XS2A 1X0PA 1SKWA 1KHWA 5K8MA 3CC2S 1YIJS 1C2PA 1RTHB 2FTRA 1K73T 1XMBA 3GR1A 3H59A 4ZK7M 4MMOA 3K58A 4IOAQ 2YWHA 2HS4A 4RBUA 1GXLA 2EK6A 1RKJA 4ES3A 4Q5VA 1GT8A 4URGA 4DX8H 4ETZA 3BSAA 4B9SA 1O5JA 4DG1B 2VFSA 2BE2B 2YNFA 2WW8A 3P96A 2YKMB 5F8IA 4MJKA 3PX0A 3I4HX 1U49A 3AJ2A 4EBDA 3MD1A 4ZCIA 1M5HA 3SSSA 2LMIA 1YRUA 4NCGB 2JSXA 3PACA 3W2VB 5KFQA 5DDPC 4CO3A 5L1IA 1JWWA 1AUDA 5KT5A 1VK3A 4N56A