4H4OB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with (e)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (jlj506), a non-nucleoside inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
428
structure length
428
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 103
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4oB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB03
3TVKA 4Y34A 3FQKA 1RT3B 1FKPB 3DDKA 4F4WA 2ALZA 3C6TB 4MFBB 3PW0A 1RT7B 4PQUA 3M9NB 4ZVHA 2AU0A 4NLDA 4X2BA 1TKXA 1DTTA 1NNDA 4RNMA 3KLEB 3OSNA 1IKYB 3LP1B 2ZE2B 2VG5B 4K4UA 1C1BA 5EWGA 4WE1B 3PW7A 4RW9A 5J2MB 3GV7B 1HPZA 4M94A 2VG6B 4NLSA 5L1LA 5F9LA 1ZTWA 1RTDB 5L1IA 3PVXA 1REVB 5DG8A 4ECQA 1R0AB 5KFWA 4R0EA 2CKWA 2B5JB 1TKZA 1SH3A 3CDUA 3G6YA 4ED2A 3M8QA 2YNIB 4YR3A 3CIZA 3KLGB 4ECXA 2WONB 4DL5A 5KFCA 3QLHB 1IM4A 5KT2A 4H4MB 1HNIB 5T14A 1QAIA 2R8IA 3GIIA 2ZKUA 4IRKA 5KFLA 3RBEA 2WB4A 3H40A 1WNEA 4RUCA 4ECZA 3H4DA 1TKTA 4NZ0A 2OPPA 1T94A 1BQMB 1HQEA 3MR2A 4I7FB 3MFHA 5J2NB 3GYNA 4XPEA 1TP7A 3V6JA 4QPXA 3SFGA 4RW8A 4MH8A 1ZTTA 2AGQA 4JV2A 3H5XA 4RW6A 4NLGA 3MR6A 3E01B 4LSNA 4PWDA 1VRTB 5KFHA 2E9TA 3V4IB 1DLOB 3NBPA 5KFXA 1TV6A 3M9MB 5DGAA 2BRKA 3QO9A 3LP0A 4JV0A 3KHHA 4J9SA 2JEJA 1RT4B 5KFDA 5DLGA 1LWCA 1C0UB 3SI8A 4ID5A 4U6PA 3MF5A 5KFRA 3KJVB 1XR5A 5DQHA 3KLIA 4ECTA 4IG3B 4O4RA 4ICLB 1N6QA 1XR6A 2AQ4A 3H5YA 3MEDA 4R5PB 4EYIB 4ZMMA 1S1TA 2IC3B 5EWFA 4IQXA 3ICLA 2FVRA 1JLAB 3KLHA 1S1VB 2FVCA 3QYYA 2IM0A 1VRUB 3GIJA 4F50A 3T19A 5HBMB 1SH0A 3I0SA 4ECRA 2OPRA 3QIPB 4WYLA 3TQ1A 4K4XA 2R2RA 2C2RA 1S6QB 4ED3A 3DOKB 5FDLA 3CJ2A 4DEZA 2QV6A 3DM2B 4B3OB 1C0TA 2XI2A 1LWFA 3Q8SB 4J9NA 1W25A 3EZUA 1JLEA 2YNFA 1S10A 5KG7A 4NCGA 3MEGA 4LQ9A 1D1UA 4KBIA 3IS9A 1RTIA 4PQUB 3KLFA 4FS1A 5I3UB 4MK8A 3OL9A 1JLFB 2ILYA 4YR0A 1S0NA 2IAJA 4NYZA 4RW4A 2D7SA 2HMIA 5CYQB 4RNNA 4YR2A 4I2QB 1HPZB 4Q44A 1C1CA 4EBDA 3G6XA 4J9OA 1QE1B 4J9PA 1HYSA 4M95A 1S9GB 3DLGA 2YNGA 3QZ7A 4JV1A 5C42B 1TKZB 4MK7A 4GC6A 1JXLA 3QGGA 4URQU 5J1EB 1EP4A 2OPQA 1D0EA 2JEGA 1UWBA 2UVWA 2ATLA 4O3RA 4J9MA 2UVVA 2HNYA 2HWIA 2BANB 4ZVGA 1SH2A 3I0RA 3CO9A 2AWZA 1SUQB 1FK9B 4K4WA 4IR1A 2HNDA 4O4GB 1K1QA 1HNVB 3KK3A 3UR0A 2DPJA 2GIQA 5F8JA 2VG7B 3PR5B 1TKTB 5C24A 3DLEA 2BR0A 2C2EA 4DL2A 2VA2A 4TQRA 4J9KA 5EWEA 5KFYA 3FSIA 4RZRA 5KT3A 4KHRA 3JSMB 3CWJA 4ED0A 4RW8B 1T03B 5KFAA 4YMEA 4GC7A 2W8LA 2WOMB 3ISND 4RW7B 3H59A 4LSNB 4TXSA 1S9EA 1JLGB 3NBPB 2J6SA 3I5BA 1TV6B 5DQGA 3PW5A 5CYMA 1QAJA 3NAIA 1J5OA 4OL8A 4NLVA 5KT5A 3FFIB 4ZPAA 4DL6A 3V6DA 4R8UA 2E9RX 3IGNA 3IN5A 1MMLA 3DLKA 3HVTA 4Y2AA 4ED1A 2YNHB 5KFMA 3NL0A 2BE2B 5DG9A 4TY9A 3DI6B 2FVQA 1N6QB 1S6PA 5HLFB 4JUZA 4IG0B 1LWEA 3IG1A 2JC0A 2WK4A 3PW4A 4G3IA 1N5YB 1S1TB 3RB3A 3FQLA 3DOLA 1S49A 3BGRA 1JLCB 3KLHB 4IKAA 4IR9A 3BJYA 4NLRA 3DRRA 4IFYA 3I0SB 1LW0B 2R2UA 4XO0A 4RNFA 4J9LA 4WXOA 4Q8EA 3M8PB 1NHVA 5HP1A 5JXSA 3V81B 4KO0B 4KB7A 3MECA 5FDLB 3DMJA 5D3GA 3IGVA 4WFZA 5KFSA 2VA3A 4K4ZA 2XGQA 5KFOA 4H4OA 1XR7A 4IH6A 1RAJA 3V6KA 4KKOB 5HROA 3MEEA 3T5KA 1RT1A 2I5JB 1DTQA 1JLEB 3ITHA 1CSJA 4ZP8A 2ASLA 4O3PA 4RUAA 2ZD1A 3BQ2A 3IS9B 1JKHA 4KV8A 3IRXB 4TN2A 4QWDA 2W9CA 3KLFB 2GC8A 1RT6B 2W9BB 3DRPA 2B6AA 2OPSB 2JC1A 5KFQA 2IAJB 4URSA 1IKXA 4WXWA 5KT7A 1IKWB 3BR9A 3EPGA 2W7PA 3OSPA 3UPFA 4URGA 3TAMA 3GQCA 1C1CB 5J2QA 3JYTB 2R2TA 2ASJA 1U09A 4K50A 3PHEA 2I1RA 2R8KA 3GV5B 1S0OA 3RB6A 4J9RA 4MKAA 4NLPA 3GV8B 4TQSA 1EP4B 1HMVA 2HNZA 2OPQB 4KFBB 4ZHRB 2W9AA 4O44B 1T05A 4MIAA 1MU2B 3NGDA 2BQ3A 4ED7A 2V9WA 2YKNB 2HNYB 4I2PB 3OLAA 5L1JA 4O3SA 1JLQA 3HVAA 3I0RB 2V4QA 1LW2A 3E51A 4U7CA 5C25A 4NLWA 4LSLA 5K14B 3KHRA 2UVUA 4IDKB 3KK3B 4TY8B 4EEYA 1KHVA 4LQ3A 3HHKA 3ISNC 3PW2A 4IH7A 4O3NA 2XC9A 1S1XB 4WZMA 1GX5A 3RAQA 1S1UA 3LALA 5F8HA 4IRDA 4DL7A 3OHBA 2YKMA 4WYWA 1TL1B 2IM3A 5I42A 3T5HA 4Q45A 3KK1A 1TQLA 3QGIA 4O3OA 4PUOA 3PJWA 2JEFA 1EETA 1SV5A 4G1QB 5KG3A 1RT3A 1FKPA 1J5OB 5KFIA 3M9OB 1RTJB 3C6TA 1QUVA 3OL6A 4MFBA 1TVRA 3V6DB 1RT7A 3DYAA 2D41A 3DLKB 4RNHA 2W8KA 2WRMA 1IKYA 3CJ5A 3LP1A 2ZE2A 1RTHA 2FVSA 4WE1A 1TKXB 5J2MA 1DTTB 3IG1B 2VG6A 3KLVA 4MIBA 3GILA 3Q8RB 1REVA 1C1BB 4WZQA 5DGBA 4RW9B 3KHGA 4H54A 4IOBA 2B5JA 1T3NA 5F8NA 4WFYA 4K4TA 4F4YA 4Y2CA 4TYAA 3T5JA 1S9FA 2IA6A 1C2PA 4FBTA 5HP1B 4ZP6A 3FRZA 4EBEA 3QLHA 3DMJB 5D3GB 4ED6A 3M8QB 5KFNA 4WFXA 2HAIA 4H4OB 5KFFA 2J6UA 4MK9A 5HROB 3MEEB 3N6LA 4YP3A 2AGOA 3CJ3A 3BSNA 1N56A 3ITHB 4EO6A 3T1AA 2GIRA 3H4BA 2IM1A 4DL3A 2XGPA 1JKHB 4I7FA 4KV8B 3NKYA 2W9CB 3UQSA 3G86A 3C6UA 5J2NA 3DRPB 1OS5A 3V6HA 2J6TA 2OPPB 4NLTA 2FJWA 5KFJA 1HQEB 1I6JA 3HKWA 3T5LA 5KT4A 2V4RA 3TAMB 2DPIA 3H2LA 2RKIA 1DLOA 3BREA 4YQWA 2BQUA 2BRLA 2D3UA 5L9XA 4RW6B 2V0NA 2XI3A 1NHUA 5C5JA 4PWDB 4EYHB 4EO8A 4QW8A 2QE5A 5KFUA 1N48A 4TYBA 5F8IA 2R2SA 1C0UA 4KSEB 1S97A 3QO9B 3LP0B 3RB4A 1KLMA 4QW9A 3KK2A 1LWCB 1JLQB 4DG1A 4ICLA 5C25B 2IJNA 4ID5B 4NLOA 1RT5A 4LSLB 4R5PA 3KLIB 5KFGA 4ECYA 2IC3A 4KE5A 4ZPCA 4EBCA 1JLAA 1S1VA 3MEDB 1VRUA 4NRTA 3QIPA 4HKQA 2WHOA 5KG6A 5KG1A 3DOKA 3KOAA 2OPRB 5I42B 3BSAA 3N6MA 4O3QA 3KK1B 1IKVA 2RF2A 4PUOB 2XCPA 2IBKA 2R8GA 2UVRA 1EETB 1SV5B 4ECSA 2AX0A 4ZP9A 3LP2A 5KFBA 1S0MA 1C0TB 1LWFB 3LANA 3QZ8A 1TVRB 3DYAB 5I3UA 1S4FA 2YNFB 1JLFA 4NCGB 3MEGB 5KG2A 1RTIB 1RTHB 3PR4A 5KFKA 5CYQA 2EC0A 4MKBA 4ZP7A 4F4ZA 3MR5A 4I2QA 2BQRA 2JEIA 3VQSA 1QE1A 4RW4B 2HMIB 1FKOA 1S9GA 1S48A 2FLNA 3CJ0A 3OL8A 3OLBA 4Q0BA 5KG5A 4Q8FA 1HQUA 5C42A 1HYSB 3N6NA 5J1EA 4KAIA 5KG0A 3DLGB 2YNGB 5KFVA 5KT6A 5L1KA 2BANA 4IFVA 2UUTA 4ECVA 1UWBB 3GIKA 2FVPA 1SUQA 1FK9A 1RT2A 1GX6A 1KHWA 3HVWA 4O4GA 3QGHA 1HNVA 2VG7A 3I5CA 3D28A 2HNDB 2IMWP 3MTKA 1TL3A 3CVKA 5C24B 1JLBA 3C6UB 3DLEB 3DRSA 3SFUA 4FS2A 2IM2A 2R8JA 3JSMA 5J2PA 2WCXA 4ZPBA 1Z4UA 4Y3CA 1T03A 1N4LA 4J9QA 2WOMA 4RW7A 1S1WA 3PZPA 4DL4A 3I5AA 2RKIB 1JLGA 1BQNA 3CJ4A 5DG7A 3NAHA 5KFZA 3CDWA 2HWHA 3CDEA 1S9EB 2R8HA 5F8GA 3FFIA 4K4VA 4XPCA 5CYMB 2RDIA 5DLFA 1KLMB 3KK2B 2YNHA 2FJVA 2BE2A 4DG1B 2FLLA 4R8UB 3DI6A 3RBDA 5HLFA 1K1SA 1YVFA 3HVTB 4IG0A 5KFTA 4QWBA 2B43A 3H5SA 1RT5B 3KLEA 3UDLA 3H98A 3Q8QB 1N5YA 3NMAA 2VG5A 4ZVEA 1S6PB 1JLCA 1RA6A 1LWEB 2D3ZA 3KHLA 3FDSA 4TLRA 2XCAA 1RTDA 3BSCA 5KFEA 1LW0A 3DOLB 4ZVFA 3BGRB 3MFIA 5F8MA 3D5MA 3M8PA 5EDWA 1R0AA 4QWCA 3GIMA 3V81A 4KO0A 2FLPA 3DRRB 4IFYB 3H5UA 2W7OA 3BSOA 2YNIA 3KLGA 2WONA 4ZPDA 1IKVB 2ILZA 3MECB 4KKOA 2RF2B 4H4MA 1HNIA 5KFPA 3KMSA 2I5JA 4ECUA 3LP2B 4ECWA 2C2DA 3OL7A 1RT1B 4RNOA 3IRXA 1DTQB 1RT6A 2W9BA 1RYRA 2OPSA 5DQIA 1JIHA 1BQMA 2ZD1B 5KG4A 1IKWA 4K4YA 2C22A 2B6AB 3QIDA 3EPIA 2E9ZA 3RB0A 3JYTA 1IKXB 3LAKA 3LAMA 1FKOB 4RU9A 4NLYA 4HYKA 3E01A 4Q0BB 2IJFA 1HQUB 1VRTA 5J2QB 3V4IA 4NLUA 1JX4A 1ZETA 5JUMA 2AGPA 2C28A 4KFBA 4ZHRA 5F9NA 4O44A 3BQ0A 3PJXA 1MU2A 1RT4A 2YKNA 3G6VA 3BQ1A 4NLQA 4I2PA 4IFVB 2OH2A 1HMVB 2HNZB 5EUHA 1RT2B 1T05B 4QWAA 2O5DA 4IRCA 1HARA 3KJVA 5K14A 2RDJA 4IG3A 4IDKA 4NRUA 4TY8A 1LW2B 2JLEA 4Q43A 4FBUA 2F8EX 1RDRA 1RA7A 1S1XA 3OHAA 1TL3B 3MR3A 4IH5A 1JLBB 3DRSB 4K4SA 3RAXA 2ASDA 1RYSA 5HBMA 5J2PB 3KNAA 2WTFA 2XWYA 1S1UB 1TL1A 3Q8PB 1S1WB 2CJQA 1S6QA 2AX1A 4QWEA 2YKMB 4KHMA 5F8LA 3KMQA 1BQNB 4G1QA 2UUWA 3DM2A 4B3OA 1RTJA 4F4XA 4NLXA 4ED8A 2FJXA
chains in the Genus database with same CATH superfamily
4Y34A 3P3DA 4KTQA 2MJUA 3HVRA 1RJJA 2JJ4D 3Q22A 3HI9A 3TX8A 1D8YA 3M8ZA 4A8SA 3E2EA 3DLBA 3WDOA 3P8BB 2A6MA 3CDUA 1UVNA 2BW7A 3D6HB 1UVLA 1RBAA 1NM2A 3HHNB 2E1AA 2AW0A 1HQEA 1K0VA 2AEJA 3OTOJ 1OMSA 3H5XA 4NLGA 1RHMB 4PWDA 2NXUA 3K5PA 3CCSS 2CDRB 5FLXU 3R1LA 5DQHA 4CO0A 2FJAB 3MMAB 2UXDF 2IC3B 2LA4A 3L95X 1XMOF 3TQ1A 2C2RA 1S6QB 4Z37A 2FHJA 3CUNA 4Q2MA 3MI7X 1YI2S 1UA0A 4RWWA 1FX2A 4OX7A 3MM7B 3BO4A 4MK8A 3C3LA 1JQGA 2OHDA 2CJXB 5CYQB 4DR3F 2MGZB 2G1DA 1EHWA 5C42B 2UVWA 2PGCA 2WB1D 1HR0F 2EPIA 2HVHA 1FCAA 3VR1A 3B4DA 3GIRA 2DY1A 4UOGA 4P10A 4LF8F 3TO8A 3HX9A 3MCMA 2D3O1 5KT3A 3WBZA 1YDLA 1TK8A 2PMWA 3K5OA 3PFEA 3CD5A 3SV4A 1KTVA 3QBCA 3CD6S 5G0RB 2X1AA 1FJGF 1N88A 5LL6d 3K8VA 4Q8EA 1X4CA 1U45A 1RAJA 1LXJA 2LQBA 4DSJA 4RUAA 3UNGC 2W9CA 2B6AA 3QRRA 3QRPA 3EPGA 2PFFB 3MUTP 2VDHA 2I1RA 5HJYA 4DR1F 4JBCA 1IBLJ 1SL2A 4M5MA 2QMXA 2UU9F 4KQZA 3Q8UA 3DHWC 3BS9A 1S1XB 2HFNA 2R42A 1RTZA 1MNEA 3G6ES 2QMWA 2HFSA 1FRKA 1O0PA 4OV1A 4QYZJ 1TL1B 2VJVA 2M0GB 3J7A1 3LGNA 1E6VA 1NDPA 1KQGB 4KPYA 1YWXA 1BWEA 3CSKA 2DH9A 2IMOA 1WDTA 3MGJA 4H54A 4ZCLA 4LR9A 4FBTA 5HP1B 2W4PA 4LF4J 3M8QB 5KFFA 2H4WB 1B0TA 3OJSA 2JVOA 1JKHB 1U48A 1KWMA 1IWGA 3VZIA 3TNVA 5B7WA 4JI6J 4UQTA 2OSRA 3VVTA 3W1YC 4BWMA 2EBEA 4ID5B 4KGZB 2N82B 1RT5A 3A3OB 4DU8A 2DR5A 1UVMA 2WHOA 5KG6A 3KOAA 4GO5X 4DR7F 3BSAA 3N6MA 3ZZPA 1RISA 4OQJA 2XQCA 2RF2A 3DHXA 5IT9Y 1L5UA 1FVSA 2CPFA 4B3RJ 1UETA 4F0KA 2YNFB 1X5OA 4P2SA 1RTHB 2PSZA 3IWLA 3GTYX 2CNNB 5FJ4A 4RW4B 2MKKA 2RD5C 1KC8T 1NHKL 2W2NP 4KAIA 3R6LB 2ZBQA 3QGHA 2XZTB 1WD6A 2L08A 2XNRA 2MQNA 5D15A 2LEPA 3S6EA 1Z2LA 3I82A 1FFGB 3D0GE 2ZH7A 4XPCA 4YFUA 3P49B 3RBDA 3NMAA 2M8HA 2YX4A 3KYLA 2MHNA 4TLRA 2HWTA 3P96A 2E44A 1DURA 3M8PA 4LBPA 2NQPA 1F0XA 4PG6A 2XMMA 1SJRA 2W9BA 2RIJA 1RYRA 2OPSA 2ROEA 2QLXA 2KU7A 1RAHB 1H7XA 2KDOA 4M5IA 3G8SA 1RT4A 5AE2A 3G6VA 4NLQA 1M5KC 1HI8A 3KJVA 4B3SF 4YN3B 2GHWA 1NKBA 3K59A 3ZNUA 1SC6A 4ZKAA 5LMNF 2Y8YA 4NOHA 2V63A 1AYEA 5M2UA 2CYYA 2IVMA 3O6QA 3C6TB 1RT7B 4ANDA 2OGUA 1G1XA 3GV7B 5E3CA 1QD1A 1RTDB 1WG1A 2PA3A 1U2FA 2BKOA 4DL5A 3TVZA 5CCMA 4CM2A 4IRKA 4I67A 2JX2A 3TW0A 1U1QA 3J7Z5 2AEFA 2VFVA 4DUTA 2P9EA 5J2NB 1PJ6A 2QA1A 3Q23A 1QVGR 4A8OA 3E01B 5IM0A 3EDQB 2PE8A 1CJUA 1Q16B 1EKSA 3U1MA 1BLUA 1R0CB 3LPEA 3SDEA 4EYIB 1CJTA 3US5A 2ACYA 2V4JA 3Q8SB 1W25A 1I94J 5K8PA 3MEGA 4BWJA 2F7VA 4B9SA 2C42A 2KYXA 2ILYA 2XO6A 3BKUA 3CCVS 1SC1B 3NXZA 4LREA 2D69A 4MK7A 4GC6A 1YX2A 1RU1A 1D0EA 3U7JA 1WEXA 1FE4A 4V1Ak 1R7IA 3UFCX 2C2ZB 3C19A 2GHPA 1Q7YT 1VIXA 2KM8C 4JI3F 1LKZA 4WU3A 1W7WA 1XERA 3H59A 1TV6B 3M2VA 2ZC4A 4FVCA 1YITS 2PD1A 2QN6B 5KFMA 4QCLA 5DG9A 1I3OB 5CQGA 3DN9A 2MKYA 4F4KA 3S01A 2FHJD 3GYGA 5T41A 4K0KF 3DRRA 1LW0B 3M32A 3W5ZA 1P8GA 2AIRB 4DN0A 1EKRA 1F9HA 3J7ZT 2J0QD 4LRCA 2ZH1A 4LFBJ 3IRXB 4QR0A 2M70A 5GMEA 1RBLA 2V69A 4DCPB 1HNXJ 1DZ5A 4CI0B 2VICA 3VGSA 4ES1A 4I6YA 1ZA2B 3T5HA 4USHA 3KK1A 1IXKA 2BW2A 1GMUA 1SKSA 3DYAA 4B9TA 2DEIA 2HHUA 1H3DA 4Y2MA 4FKXA 3R5GA 2UXCJ 1A0OB 2VG6A 4DX7A 1C1BB 3A1YG 4G65A 5DGBA 3BBBA 2XZWA 2IA6A 3M1VA 1LFPA 3CEDA 3DMJB 3T41A 3U27A 3HZGA 2SXLA 1YTYA 1N5SA 2IM1A 4C8KA 3BEGB 4LRAA 1UA1A 2J6TA 4ES2A 1VK8A 4IO9Q 3NCRA 2QE5A 1KFSA 3AB2B 4ZLPA 2DR8A 3R7NB 4L3NA 2OELA 4U96A 4KE5A 2KG0A 2Q1LA 1U02A 1TU0B 4ZJLA 2ZM6J 2D3OR 1SC3B 1WI6A 1QJHA 1SB6A 1K73T 3MAAB 4PUOB 2KFNA 5LJ5Y 5HMZA 2XYHB 3LP2A 5I3UA 5K9FA 2LDYA 5AXLA 3CCUS 3OLBA 2HQDA 1YJ9S 3CO0P 3M6UA 3W5XA 2LQJA 5BR8F 3CT9A 1FK9A 3NWRA 3B54A 2VDIA 2F1FA 1HNVA 3QQCD 3ZTSA 4QIFA 1E6YB 1MMDA 4DPUA 4DR5F 4J9QA 1QSYA 1JLGA 1PSDA 3CJ4A 4QIVA 4G1PA 5A8RB 5LT5A 4U9RA 2BE2A 1RZMA 2JFDA 4S0MA 2FLLA 2RQMA 5HQ8A 1K1SA 3C16B 3OXLA 1RA6A 1FRXA 3BV8A 3MFIA 3HSGA 1PYTA 1ZM2A 3KMSA 4Q5VA 1K9MT 4ECUA 4WP3A 3SCJE 2NXEA 4EFAC 1HL6A 4UQGA 2E9ZA 4BHQA 1CLFA 3M4XA 1G2EA 4EZ9A 3DLJA 1UEVA 3PJXA 2RAQA 1U6BA 2DHGA 2V8DA 1T05B 3GG1A 4WFBQ 4NRUA 2P9CA 4ID8A 3TEGA 1YJ7A 3H2VE 2IDEA 2DIUA 3RAXA 2ASDA 2AJ2A 1Q8BA 1BQNB 3QPIA 4JI7F 3MOJB 5B0AA 1QAXA 4NZ7A 3DDIA 4NLDA 1TKXA 5EWGA 2F65A 5RUBA 4RO0A 3PX0A 2B9WA 5A8WA 4OLPA 1R6YA 3W66A 4YR3A 1HWIA 3CIZA 2DXFA 1MSWD 3QLHB 1HNIB 1QAIA 5KFLA 3MOZA 1YRUA 1XIQA 1WC3A 4JB8B 2KXHA 2HIYA 3PHTA 4TU9A 1RP5A 4RW8A 3HHDA 4LSNA 3RBZA 2AT1B 2BRKA 3HDSA 3LP0A 4M5DB 3MPYA 2E7XA 1LWCA 1AA1B 2DNOA 5BXIA 4R5PB 3KG4A 2IM0A 3N01A 2WAQD 3KWMA 1M5SA 1WUUA 3M7VA 2EFNA 3PX4A 4J9NA 4DX5A 5U47A 1WKKA 1FO1A 5IQQA 5KG7A 4LQ9A 2M52A 1NLKL 3O3LA 1S0NA 5KOXA 3DNCA 3G6XA 2E7VA 1EB0A 3OXGA 2V94A 1X4HA 2DR7A 1FKAF 3VZHA 2DPJA 2VG7B 3R2DJ 4F36A 3VQTA 2AYMA 1O5JA 3AOBA 3ZZ0A 2FHOB 4EWTA 1NJWA 4L6V3 4C3MA 3PW5A 4ATNA 1QAJA 1HWJA 2VOPA 1IQTA 1Y0HA 3DLKA 5FLXY 2MY7A 1LWEA 4OHWA 3I56S 4Q2LA 1ZM9A 4PWUA 4WK1A 2H5JB 4KKOB 1LXNA 3T5KA 1NJYA 2I5JB 3IS9B 2QL7B 5KT7A 3BR9A 3N0VA 2ASJA 4WTYA 5IV4A 3TQEA 3EZ5A 3P5TL 4MIAA 2X1BA 2DH8A 3HVAA 4ZVRB 1K0TA 5C25A 3NRBA 2KT2A 2CWXA 3KG1A 1KR4A 4WWSA 2KB2A 1AZSA 2YKMA 1UW9A 4Q45A 4MKVA 5KFIA 1QUVA 1UPMB 5ETPA 4N47A 3KXDA 4CYUB 2RE1A 4DFKA 4JI4F 2ZE2A 2G4BA 3GILA 4B3MJ 2B5JA 4HEA9 4ZPTR 2HS4A 1D3WA 1WC0A 4ED6A 4WPAA 4K5SA 2HAIA 1T8EA 3MEEB 4PYDA 1KSPA 4DV0J 2EW9A 2LVWA 3G86A 4FPIA 3OVBA 4ERDA 2V4RA 3TAMB 1T02A 2D3UA 4ANCA 1KLMA 2EWHA 5CCLA 2IRUA 2V67A 3M2RA 1JLQB 4ICLA 2RRAA 2ZBRA 4LSLB 2HRUA 2ZNZA 1MW7A 1UFWA 1IBMF 4DR2F 2K8GA 1X0FA 2JVRA 2IPOB 2BUNA 3GONA 1SBRA 1EETB 2B9EA 2N3LA 1J5EJ 4ECSA 1EQMA 1WG4A 2E29A 1L3VA 1FKOA 2YVSA 5AXMA 2XMKA 2ZWPA 4RWXA 4WP9A 2YNGB 1NK6A 3EXYA 1U1MA 1DAXA 3ISZA 5E0OA 3W61A 1FDNA 3PEHA 1NH7A 2BACA 3CCWA 1TL3A 3C6UB 3JQJA 2D9PA 3BN7A 3CC4S 1Q79A 3X1LB 3B78A 4USWA 1DQAA 1S9EB 3CE8A 3MMBB 3BO2A 5DLFA 3CTRA 4DG1B 3FRYA 4DHVA 2ZH2A 4JV5J 1PAUB 1JLCA 1X5TA 3KHLA 3UD5A 1BD6A 4DOZA 1NKCA 4RKUC 2KXFA 3D5MA 2IYIA 3DOMA 2FLPA 3NS5A 1NK8A 4WF9Q 2RNEA 4ZPDA 4ZLJA 1J2VA 4DU7A 1KS2A 5ITHA 1TL4A 5MLCV 3W5YA 2BDPA 2GVDB 1HD0A 4RU9A 1ZETA 2O67A 4YB5A 3ET6B 4CDIA 2MQOA 2UP1A 1RT2B 1HARA 3EM1A 3OVSA 3EWGA 2MLYA 2DVIA 3OHAA 3MR3A 4DUYJ 2ROGA 2CQ4A 2R3VA 1BE4A 2GX8A 1S6QA 1O51A 2MZ1A 2RT3A 4HTIA 5LSOA 2C1EB 3SSQA 4C2MA 1UEKA 2U1AA 2J9DE 2KL8A 4RW9A 1NDLA 2HQFA 3CJQA 2L41A 3P6YC 1HNWJ 1T9YA 3L09A 5T14A 4C11A 1V5IB 4NPOA 2VUGA 2BOAA 2OEMA 4AD6A 2WBMA 1IJFB 4J5OA 1L3SA 2DGTA 4V19J 2MPUA 2E9TA 2OSQA 3DGVA 3TP2A 1VCTA 4IG3B 4P2XA 4O4RA 1VQ4S 4ZPWR 3H5YA 2Y0BB 4IQXA 3ICLA 5L38A 5ETVA 4FF1A 1S1VB 5HBMB 2DHXA 2GMLA 3QJLA 2XLJA 3DOKB 3VWSA 3K5LA 4NWBA 5E7OB 2DISA 1LWFA 4ZCMA 1RTIA 3PXGa 5HI7A 1FRHA 2CQIA 4M95A 2BBEA 3DLGA 3W9IA 1TKZB 1H2TZ 4URQU 5J1EB 4O3RA 3WX4A 1VFJA 3PX6A 1SUQB 3UR0A 4JI2J 2BR0A 1Y5IB 1VBYA 3TR5A 4RW7B 9ATCB 1U6FA 4OZ3A 4OYZA 4B9UA 1MMLA 5IXUA 4ED1A 4HVZA 4CM0A 3DI6B 2VOOA 4P7TA 2HZAA 1RHUB 3RB3A 1UJ4A 5E3AA 4IR9A 4WIQA 3G71S 4IFYA 4J9LA 5HP1A 1YRXA 2Y0SD 3V6KA 4ECXA 3BQ2A 5IC6B 1JKHA 3KLFB 5HVFA 2QEXS 1SC4B 1IKXA 2DO4A 5HATA 3JQKA 4L75A 4K50A 2R8KA 1HMVA 2OPQB 3GCWP 4KFBB 2BQ3A 2KH9A 3NMRA 4I2PB 2BM1A 1U1OA 3KK3B 5E3QA 3KUGA 4XAKA 2CDQA 4X4PA 3PRDA 1S1UA 5F8HA 2EKYA 1UMJA 4CLUA 4F0HA 1H74A 3X3UA 1CBKA 3TVYA 1N5VA 4MFBA 1V3ZA 3OTOF 5MAOA 1IKYA 1RTHA 3W8GA 2FY8A 1DTTB 3IG1B 3Q8RB 1FRMA 1U26A 4WFYA 4LF6J 1MWQA 1Q81T 2O3DA 1LK5A 4C3KA 4YP3A 1YK9A 1XNQF 4DSLA 3V6HA 1C4CA 3UQSA 3DRPB 1U49A 4NLTA 4OJ1A 5IQ6A 2H5IB 3G87A 2XI3A 5IWAJ 4KIAA 4GVLA 2CWKA 3M6WA 1Q82T 4BBYA 1LV5A 2MKJA 1JLAA 2CAJA 8AT1B 3D0IE 1PC4A 2YWWA 4CT8A 1T9WA 4HH1A 4NA3A 5GADU 3JSBA 3E3XA 4A8YA 4NCGB 3P45B 4UY85 2HW3A 3VQSA 1CJVB 1QE1A 4X4SA 3CJ0A 2COLA 3M30B 5A6WA 1CULB 4LJMA 3FZBA 3EGZA 4QU6A 1FA0A 1SPBP 4M8LA 4ZVTB 3D4JA 2ZVIA 1VLOA 3CCTA 5IT0A 1KFDA 4DSKA 1HWKA 2ZZMA 1B7FA 1SJ1A 5F8GA 1BUXA 2QFIA 5CYMB 3AODA 4TNOA 4KT0C 1YVFA 2XSJB 1OSDA 3DRXA 1YSJA 2WSFC 1RTDA 2ZJQQ 3BGRB 3NNAA 1NU4A 2HPUA 5BYQA 5KFPA 1U2RA 1JXEA 1TL7A 4RL1A 2QC3A 2BZ2A 2MKSA 4L73A 2HHTA 4K4YA 5E2QA 1JWWA 5HK4A 1S99A 3E01A 2IJFA 5J2QB 3BDPA 1B7YB 3ADAC 4LF7F 2ZITA 4IDKA 4UW2A 1H0HB 3SMZA 4DV1F 4H4KA 1XJWB 2R7SA 4LF4F 3ONQA 3HJVA 4NI2B 4FPRA 3TJ9A 4PEOA 2BVZA 4R0JA 4OJGA 3CJRA 3I4PA 3D9BA 4KJIA 1F9FA 2J9EA 2HGLA 4L76A 4UY8T 3N79A 4ELUA 2B3TB 3FEXB 5J2MB 4DQPA 4EI2A 3T1YJ 4JI6F 3OTCA 1N54B 5B0EA 2WVDA 2V8GA 3BKTA 4ED2A 5HO4A 1VMBA 4AQYJ 2OD6A 9RUBA 3BGFA 2OLWA 3H4DA 3HSDA 3ZO7A 1BQMB 1YHQS 4Z7YA 3WZ0A 3B8HA 2AGQA 1DLOB 3ZNJ1 2L9NA 1TV6A 2YXLA 3ENWA 2OTLS 3MD3A 3AOAA 3W3SA 5EWFA 2FVCA 1FI4A 1WC4A 2R7UA 1RWUA 2QV6A 1VQ9S 2CNKB 2DGWA 4YDXA 2X1FA 1XQIA 4MAKA 2HSEB 1VBKA 1HPZB 2G0IA 4CQ1A 3C46A 4HI2A 1SCJB 5B0GA 4EMDA 3VAJA 2GHVC 1WF0A 2HWIA 4OLOA 2BANB 2YBVA 3FGVA 4O4GB 5T7LA 4ENOA 2GFFA 5F8JA 3PEJA 1MG7A 3TJAA 2DB1A 2RVJA 3CJTA 4OL8A 4NLVA 2VASA 1FERA 1U7LA 1K8AT 4ALZA 1HIYA 2JLGA 1S6PA 1F6TA 4JUZA 2ZOGA 1H98A 4N76A 4TKTA 3UNYA 3BJYA 3BGLA 4RNFA 4IUFA 3DMJA 3IGVA 1RT1A 1Q5YA 1IBKJ 4ELVA 3LW5C 5HAOA 3AA8A 2ZD1A 4TN2A 4J37A 6AT1B 2JC1A 5KFQA 4HL9A 4URSA 3OSPA 3GQCA 2J7WA 1C1CB 4QIGA 3JYTB 3F44A 2LQ5A 2K3KA 2D9OA 4ED7A 1CS4A 1UKUA 5L1JA 1PILA 3MPVA 2YKOA 1HWUA 4TY8B 2M8DB 2XMWA 4O3NA 2BJEA 3LO3A 4LF5F 1QM9A 3W2VB 4WYWA 2W4CA 3MAAA 3MM8B 4O3OA 4PUOA 1NDKA 1RT3A 1S6OA 1VQSA 5FIIA 4ZVPB 1PYSB 3OR2B 2HG4A 3LP1A 4QU7A 4OI6A 1S0VA 5HMYA 4WZQA 1QSLA 2C2MB 2KFYA 3UD3P 4X4QA 5D3GB 5CD4H 4ZOSA 4H4OB 5HROB 4LVOP 4DF8A 1SJ3P 3NLCA 2WVEA 2UUBF 3SIPB 2J8SA 2QYCA 2AEMA 5IS2A 2A1BA 4EO8A 4QW8A 2FYXA 5A8RA 5F8IA 2XG8A 2WSEC 3C16A 4NLOA 5HMWA 1KP6A 3C14A 3G96A 4YDDB 2BEFA 3ILIA 1IN0A 1VOMA 5ETOA 4M5GA 3MXHP 4O3QA 2VZ9A 4W98A 5KFBA 3QZ8A 4D3GA 3MAQA 2E5LF 3PR4A 2ABYA 2F5GA 1G3OA 3I4HX 1S9GA 2DRBA 4X65J 1UWBB 4WKYA 2NPIA 1X5PA 4CLLA 4ZCIA 1DRZA 1YZ6A 1X4FA 1BQNA 2W2QP 4OHYA 3NY0A 2EVZA 3GMGA 3RTVA 2IHR1 3G8QA 3TUPA 4MTPA 2PN6A 3PCOB 2LU1A 4PPZA 1N36J 2KG1A 2AMCB 3GFYA 3HVTB 3H5SA 1YKWA 4ZVEA 1YBUA 1HBMA 3N5FA 3V2UC 2W1BA 1B0PA 3UVJA 1FHTA 3HSZA 4KO0A 2EXUA 3H5UA 5LSRA 4CNYA 4OJHA 3MZIA 3CMES 1K44A 1HNIA 5KAKA 1NPKA 1OY8A 1JIHA 1IKWA 3Q2SC 3VVUA 3QIDA 4QYZK 4CP5A 1KEKA 2ZVSA 4I69A 4I68A 2YKNA 4KYZA 2LU2A 3S8SA 5CHCB 2Y8WA 2IY5B 2GJ2A 2RDJA 2M9KA 1LW2B 3Q24A 1NJXA 2OEJA 4J9UE 4ETZA 4IH5A 2H54B 3TUZC 2CJQA 4KHMA 2I9SA 1N34J 1A9NB 2XULA 1FKPB 2NUHA 2QZ8A 2LYVA 2ERRA 1NNDA 3UO0A 1APSA 4WE1B 2YWEA 5I3QA 2WW8A 1REVB 4HDHA 1RUSA 4R0EA 2CKWA 2ZH5A 1IM6A 5AJ3F 2YNIB 1RK8A 1Q8LA 5D4NA 4LFAJ 1WDDA 2J8AA 2WB4A 3WIUA 2NR0A 1EX8A 2DGUA 4LIWA 1VR6A 1T94A 4I7FB 2KTQA 1YGYA 1X7VA 2NCKL 4B9MA 5KFHA 4CTAA 5F3TA 2N7CA 5DGAA 2UV8G 2HHWA 2CG8A 2HS0A 2XWXA 2CZ4A 4ECTA 3MF5A 5IOLA 2LKZA 3UI3A 1SL1A 4ZS6A 1W2BR 3EX7B 4B3OB 4I6WA 2JRSA 2R7XA 3KJQB 3IS9A 2DR6A 1AT1B 1SKUB 2Z58B 1MROB 3QZ7A 2OP5A 5E41A 3THVA 4PXBA 4K4WA 4IR1A 2A3JA 2ZUAA 4DLEA 5DDPC 4X62F 2KN4A 3ZFVA 3DLEA 2VA2A 4TU8A 2B9YA 2QLBB 3AD7C 2DHAA 4DQSA 3J80Y 2AJFE 2JFKA 4HACB 2XYPB 4BC7A 4C0OC 3BPDA 2F8MA 1ULRA 4IG0B 2JC0A 2WK4A 3DOLA 2ZH8A 4DDFA 2Q6CA 4XO0A 3QWUA 4YY3J 4OZ2A 3MEEA 2B4VA 4RPFA 3PYGA 1DTQA 1CSJA 2OFGX 1AFJA 4JYAF 4QWDA 2R7TA 5CXTA 4QJVA 3TAMA 2H4YB 4NXNF 1VHIA 4PG4A 3JAMY 4J9RA 1WEYA 4NLPA 5KTQA 3LWMA 2DGQA 1JLQA 2Z2YB 2CNLB 4NLWA 1J27A 4LSLA 1PJ7A 2E66A 4GKJF 2A0FB 4DL7A 5DZ6A 2UUCF 3M6VA 3L3CA 2J0SD 1RQ0A 3HT0A 1EETA 2DD8S 1J5OB 4UOHA 3GWCA 3OL6A 1F9EB 2PMHA 3GJSB 1VBXA 2HURA 2F4FA 4A8QA 2PEBA 3MTJA 2BE9B 4NXMF 3FBFA 3T5JA 3ETMA 7AT1B 2DEJA 3CDAA 2CQBA 3O2IA 5KFNA 4OZJA 4Y00A 4CT9A 4U8YA 4LR8A 2HYIB 4KV8B 3C6UA 3AXMA 2OPPB 4ZLLA 3HKWA 2R9LA 4RW6B 3MMBA 3Q8YA 1C0UA 1Y9OA 4DG1A 3IR6B 4LVNP 3HULA 4OX9F 1KRPA 4OX6A 4NRTA 2AJ0A 1YJVA 5GAEI 3DGPB 1NK9A 2XCPA 4OZ1A 3BKFA 2F8HA 1LFWA 1S4FA 2VU5A 4MIWA 1FRJA 1M5PC 2GVDA 2AZ1A 3VV2B 4MKBA 4OJ3A 4ZP7A 5K8NA 3MM9A 1FDAA 4A8MP 1HYSB 2NXNA 5GAGU 5IT4A 3W2WB 4Y0FA 1RT2A 4DPWA 2HNDB 3MWBA 1ZOTA 1Q4RA 1WTFA 2O01C 3HJFA 5C24B 3NWGA 4ZPBA 4QR1A 5JMNA 4CO3A 1GAOA 3I5AA 1R6VA 2L9WA 1RCOB 2BJDA 2WSCC 3DC2A 4PAAA 3SEOA 1N32F 5HLFA 3Q0AA 4PG5A 1EIYB 1N5YA 5ETMA 5H1SV 1MWYA 3L7OA 4DV2J 4QWCA 4HHUA 3BSOA 4O0IA 3CF5Q 1VK3A 2KO1A 3HT3A 4YHHJ 4ECWA 4NASA 1HBUA 4NCBA 4V19X 1WORA 5K8MA 2J9CA 2CJBA 2C28A 4X66J 2M7SA 3GSDA 2HGMA 2QL9B 4IG3A 3UE2A 3MMCB 4J9VA 4DV4F 5HBMA 2WTFA 2XWYA 1Q78A 3TJ8A 3C15A 2FJXA 3TVKA 3M2UB 2ALZA 3M9NB 4MT1A 2HFUA 2Q43A 4A4JA 2UXDJ 5KFWA 1TKZA 4OZNA 3VGVA 3KLGB 2WONB 1XMOJ 5KFCA 4H4MB 2HKEA 2VQEF 3PG9A 4I1TA 4A48A 5FD1A 3D7SB 3BPSP 3MPWA 4DV5F 3GYNA 4XPEA 1NK4A 3TA0A 4P71A 4DR3J 1S72S 3KHHA 2XZDB 1DQ8A 4J91A 2YPZA 1VQMS 2VKZG 1YG0A 3SI8A 2GGPA 3LQVA 3KLIA 2J76E 3GG0A 3NOCA 3A13A 3MEDA 4ZMMA 1HR0J 1F1BB 3QYYA 4AXIA 1VRUB 2V8PA 3IR7B 4LF8J 1UEUA 3QIPB 2WVBA 3CJ2A 4GRSA 2NPFA 4PZVA 1HHQA 5A8KB 1S10A 2HFVA 4PQUB 2VFTA 3KLFA 3OL9A 5JVGQ 2HMIA 4DZ6A 1VQ7S 1LWXA 4G6VB 2CUYA 1U6ZA 2OPQA 1FJGJ 3CNQP 4BS2A 1SKWA 1IVZA 4X64J 4JV5F 1TUVA 3KK3A 2KJVA 3PR5B 1SQGA 3HPOA 3KDOA 1TK5A 3S1TA 2B56A 5KFAA 1T03B 2QSFA 2DBBA 2D1CA 2A2DA 3MHYA 3EMTA 1XNRF 4R8UA 2E9RX 2YNHB 3NGTA 1LK7A 2VPZB 2UU9J 3IG1A 2KZZA 2WZ1A 4G3IA 1N33J 1KVJA 3M6XA 2G9OA 4Z2XA 4X4TA 3MECA 1XTZA 1C4AA 1FFWB 3OTDA 3ELHA 4C4WA 3BN4A 4N8NA 1U47A 1JLEB 1M1KT 2ASLA 4NEYA 1B4SA 4RLEA 3DU6A 3DRPA 1DHMA 3DKDA 2W7PA 4NA1A 1YJRA 2B51A 3RB6A 2HNZA 2CPDA 4ZHRB 4IOCQ 1MU2B 5GAHU 3R8YA 4DCOB 4ZN3A 5CZXA 4EEYA 2WW4A 3TZWA 2XC9A 4W92B 4IRDA 1OIAA 3VGTA 2RB7A 2D41A 2X51A 4F2RA 1P1LA 5EHHA 3ZZTA 4TYAA 3M30A 2RQCA 4DR7J 1FXDA 1OJ4A 2EK6A 1RABB 3N6LA 5DDOC 2AGOA 5HANA 3CJ3A 3DU5A 3T1AA 4K2JA 2KYZA 5D0RA 1HQEB 4K7QA 1OQ6A 3K0JA 4OI2A 2JZ5A 1QDUB 2FD2A 4EYHB 4PWDB 2Q66A 2VODA 4QW9A 5HQMA 1WEZA 2K2PA 2IJNA 2FJDB 1R3NA 4EBCA 3ZTPA 2NZ4A 2GA7A 2NREA 3D0HE 5I42B 1WC1A 4KH0B 4RBTA 1GTEA 1MN9A 4MYTA 4C97A 4DUZF 1Y11A 1S7IA 4P6QA 2IIHA 2LDIA 1H2UX 2P2CB 3JSYA 4C8MA 2GVZA 2HS3A 3F41A 4NZ6A 1OPZA 2IDLA 3OXFA 2FVPA 1FEHA 3MCOA 3VAMA 1X9MA 1NEEA 3KTQA 2WCXA 1RAAB 1PAEX 1RKJA 4EZ6A 3A8IA 4JI1F 4B9LA 4QWBA 2B43A 2VHGA 1UL3A 4YUDA 3Q8QB 1JB0C 2QRRA 4ZN1A 4B3SJ 1EJ7L 1QUPA 3V81A 4NL5A 4NYOA 5LMNJ 2ILZA 2RJZA 1EARA 2P5VA 1HHTP 3TAPA 3TZZA 1BQMA 4HT7A 1FXLA 2B6AB 2DYAA 1YBAA 3OV7A 3BBFA 1W2IA 2CG4A 3T1HF 4O44A 2YWHA 3OTEA 5K14A 1RU2A 4CO2A 2XTJP 4HDGA 4ZPVR 1HBNB 1U1LA 3C2PA 3W64A 4RUHA 2CVIA 1VQ8S 1JXVA 3GJTB 2QL5B 5BYRA 1KVIA 1TKDA 3PW0A 1UPPA 4ZVHA 3V5RA 2GO9A 2GW8A 4K4UA 4HI1A 1HPZA 2EK1A 3PVXA 1RBOB 5L1IA 2PA8D 1VHFA 1R0BG 1TR0A 4DX8H 2CRLA 3RBEA 2YKPA 3BM7A 1TFYA 1UWAA 2ZHOA 3HFVA 2RHQB 5HJXA 2JDJA 2UXBF 4ZA1A 1NSQA 5F41A 3OFFA 1ZZFA 3AB4B 3TA1A 1NZ8A 4U6PA 1XR5A 1Y5NB 3NP5A 4OYBA 4ZCKA 3T19A 3WIVA 3H25A 2OPRA 4WYLA 3DFEA 2HZCA 5KOWA 4RJVA 1Y00A 1IBCB 1C0TA 2XI2A 2OTJS 2V9KA 3T6JA 2C2NA 3OW2R 2CQPA 2F9JA 4FS1A 4XTTA 4N41A 4QR2A 3NS6A 2UV8A 1C1CA 1FJEB 1JXLA 3LUYA 2HRYA 3PIOQ 2AWZA 4L72B 1V3RA 1TKTB 1CQMA 3K5MA 3KDNA 4FZVA 2XY6A 5GMDA 3J81U 5LJ3Y 3ISND 2BM0A 2HHPA 3UR3C 1FD2A 5DZ7A 2DCLA 4QBUA 3IGNA 1LNQA 2Y1IA 4TY9A 4F25A 2BJ1A 3I31A 1S1TB 3FQLA 2BX6A 1SQEA 4WXOA 3M8PB 3BDEA 1RADB 3CMQA 5D3GA 5E5NA 3UW1A 3SQGB 4H4OA 4IH6A 5HROA 3GPAA 1Y7PA 1TL5A 2A6OA 2W9BB 2OPSB 1V3SA 4PXEA 3GP9A 1OYDA 5HQLA 2OD4A 3QT8A 4HLBA 2AD9A 1EP4B 1RACB 1AUSL 3IXQA 2MQQA 1KD1T 3W7BA 3E51A 5B08A 3VAIA 2VJUA 3KHRA 3RBXA 4LQ3A 1BY9A 3OFHA 1S77D 4LF1A 4DLGA 1R89A 3HD1A 3CCJS 2AYGA 2Q79A 4CIOA 2Z56B 2G2OA 1HNZF 2ROPA 2N4CA 7FDRA 4C98A 2KXNB 2IFXA 3D6FB 1WF1A 4B3TF 1VGYA 3QJJA 2J6UA 1ZYQA 4PYAA 2HGNA 3BSNA 4F0MA 4F02A 3NKYA 1GXTA 4A8FA 3T5LA 1P1TA 4AL6A 1PYOB 2PC6A 2R2SA 4KSEB 1CJUB 2A18A 5BR8J 1CJKA 5HSPA 3SCKE 3MCNA 1U1KA 1OWXA 1CJTB 2OKQA 4DR5J 2IBKA 1RHJB 4AT1B 2V4JB 2DY9A 3J81j 1JLFA 3A12A 4M5LA 3MEGB 3EGWB 1WHVA 1S4EA 3AAWB 1R31A 2GO8A 2DIVA 4Q7AA 1M5HA 1F3VA 3R5DA 4DZDA 2IMWP 2O1PA 1BHNA 2CADA 3NEKA 2R8JA 5AXKA 4R25A 2RKIB 4RBUA 3FFIA 4W90B 3M2VB 2RDIA 1ICEB 1EQ0A 4JOUA 1IUJA 3QT6A 3AD9C 2JOQA 3FDSA 3D1QA 5IZHA 2VBXA 3DRRB 2W7OA 3EJMA 2YNIA 3E8OA 2XY7A 5LXRA 4F67A 4CO4A 3FK4A 4JI7J 2HVDA 2CPXA 1S79A 2XS5A 1OQ3A 2OO4A 1WKLA 4NLYA 4NLUA 3J7YI 4DR6F 4AYBD 3UN2A 3WQPA 4BDPA 4IRCA 3EVOA 2Z2LA 2BJ3A 4K4SA 2L3MA 1VC5A 2H5EA 1NBEB 3KNAA 1XEZA 3PACA 3Q8PB 1FE0A 4QWEA 2AX1A 4E2FB 2XHWA 5LMUF 4B3OA 2Y9HA 1RTJA 3R7BB 3FQKA 2PI5A 2NUUG 3OTBA 4Y2KA 2GAHC 3AOCA 2VG5B 3PW7A 3LTOA 2VG6B 4NLSA 2VB6A 3PKYA 4FNIA 1KOOA 2HQGA 2V5HG 3M1VB 5K5MA 2NYIA 3WC0A 5KT2A 2ZKUA 2Y1JA 2J7UA 3VAHA 3HHLA 3B4MA 1N0UA 3DXSX 1T9UA 2RQ4A 3HLUA 1YJWS 3SV3A 4QPXA 1UFLA 1VRTB 5DETA 3DLLQ 2W2PP 4J9SA 2ZOMA 4JI5F 4AL7A 2KM8B 4XIUA 3ZZYA 2ZKTA 2XM3A 3IAS9 4F50A 1KLNA 3A8JA 4ETXA 4ECRA 2MYFA 2MEWA 4K4XA 1H72C 3D67A 8RUCA 2CQDA 1DQ9A 1V5VA 1N0VC 4C3LA 2XMAA 2AJQA 3EZUA 1CPZA 2X1GA 1D1UA 3MM5B 4USVA 5I3UB 1UVIA 2B4PA 2RQKA 4LFCF 1O6XA 4FP9A 2CXEA 1P9QC 2Q6BA 4JV1A 3BO3A 2XS7A 2DRAA 3UN5A 4DV6J 1MWZA 4C8NA 2CIMA 3R5AA 3B6BA 3CCLS 1FK9B 4AUKA 3JTPA 2Z57B 1K1QA 1HNVB 4FF2A 4LT6A 4GVBA 3IM8A 4MKYA 2W8LA 2XLKA 4M5HA 2UZAA 1RAEB 1P27B 3R97A 1JLGB 3I5BA 3MCSA 1J5OA 1T9VA 2E5JA 4DL6A 1NPPA 2BE2B 1ZA1B 3K5NA 2XY5A 4FXDA 2CVEA 4IKAA 1T95A 2KT3A 5IC4B 1N8RT 1WI8A 5FDLB 2XGQA 1GH8A 1ZH5A 4K59A 4ZP8A 4KV8A 3BZQA 2HLTA 4DR4F 3NCPA 2IAJB 2DNNA 4URGA 4JI4J 2AF6A 1ZBTA 2VFSA 3OPKA 1N34F 3UDCA 4MYUA 5EX3A 3NGDA 2FPHX 2CPJA 2V4QA 1TELA 1DARA 4I6AA 2UVUA 1KHVA 3PW2A 1FNMA 3R6GB 2R7WA 4RU2A 2VKRA 4CLTA 2IM3A 3FBBA 2K1RA 3V6DB 4RNHA 1BWVA 2WRMA 1TKXB 4PABA 1ZAXA 1T3NA 2ZZTA 3OT9A 4F4YA 4DR2J 5HVHA 1ZPVA 4USIA 4WFXA 5DS7A 4QYRA 4EO6A 4DV7F 1OS5A 2FB0A 1VC6A 1U8WA 2H9ZA 3H2LA 3AT1B 5CYJA 3H90A 1VQPS 1S97A 2JHEA 3LP0B 2M4MA 1LWCB 1GMVA 2Y1RI 4N7TA 2YX1A 1KQKA 1PC5A 3PDNA 4OYMA 3FMWA 4WTOB 1PKUA 1HHSA 4ZP9A 2DGSA 4P2FA 4PRFA 2NLWA 5KG2A 1AFIA 2CQCA 2IRXA 4J7CA 4F4ZA 2LFVA 4I2QA 3G8TA 3OBIA 1Z1ZA 1FEEA 5KG5A 2VBWA 5G4DA 5KG0A 1KNZA 5KT6A 3OQ2A 3FJ2A 5AE1A 4PQAA 1RGVA 5D0EA 3I5CA 3D28A 1M1GA 3MTKA 2EBGA 3THPA 3JSMA 4C8ZA 1G6BA 2YH0A 2WOMA 3L9ZA 3PZPA 2V68A 4I0WA 3CDWA 4OV6A 1RAFB 5I4MA 2PT0A 1RWPB 4USTA 1D09B 1QY7A 2ZNYA 2MTLA 5KFTA 1JNZB 2MSSA 4B02A 1RLCL 1LWEB 2XCAA 2Y1LB 1G4CA 2VONA 3KLGA 2WONA 3FMBA 4H4MA 2NS1B 1FESA 4OI1A 2JNJA 4RNOA 1TAQA 3IWXA 1RT6A 2P9GA 3SSRA 2X3DA 1WHXA 3KKFA 4FNHA 1RKIA 2MKIA 3G82B 4HYKA 1JX4A 1HQUB 2AKWB 2XMJA 5A6PA 3GR0A 2YH1A 1Q95G 3D66A 4IFVB 1S57A 3BH6B 2MJNA 4QWAA 3CJ8A 1ZM4A 3UDVA 4DSIA 4Q43A 1P9YA 1H6KX 3DRSB 1NAQA 2HAFA 3FC9A 4USJC 2C2KB 1AZSB 2YKMB 3KMQA 4G1QA 2G1HA 3TEHB 3LGMA 3POTA 5DDQC 4PQUA 4DQQA 5L46A 2ZE2B 2VV5A 3QMQA 2HK3A 2MZSA 2X7IA 2FUG9 4P52A 1X9SA 2B5JB 2CJKA 2V2QA 1X4AA 3DRYA 4USMA 4OHZA 3K57A 3MR2A 4N5SA 2BOPA 2KKHA 3L4BC 2R7VA 4ZITA 2QSWA 5KFXA 1SVDA 3QO9A 1QAYA 3A3NB 5KFRA 3M2RB 3HSJA 4ICLB 2N7YA 3KUEA 4P9SA 2LEAA 3FBCA 4HR2A 2E7WA 1SH0A 3GFZA 4P74A 1JLEA 2HK2A 4UOFA 2C3MA 1AUDA 2G0CA 4P75A 1URRA 4RNNA 4KHPF 3OR1B 3HHEA 1SI9A 3FZ2A 2JEGA 3ZZUA 2POKA 3HHLD 4Y6IA 1SH2A 3CO9A 1UVJA 2C2EA 1R27B 4KHRA 4J90A 1NMEB 1U0HA 3IM9A 2W2MP 2J6SA 5CD4A 5KT5A 2Z0GA 3TANA 4HHJA 3QNWB 2C3PA 5ADZA 2OMOA 3I87A 4JI8F 1JLCB 3KLHB 2LXUA 2I0XA 4YB6A 3DOMB 1WWHA 4X66F 2YPYA 4CNZA 4OHVA 5B0FA 1L3UA 3HD2A 2V50A 1NSKL 4O3PA 4M1KA 2H65B 2YKAA 3OUYA 3N9UC 3CCES 4FXVA 2I2YA 3GV8B 3NNCA 2AYEA 1OYEA 3QWPA 4U7CA 1NXIA 3DDNA 4IH7A 1XNQJ 3GFHA 5I42A 3MUVP 4C8LA 3PJWA 2B9XA 3J81Y 5KG3A 5ETQA 3QFWA 4FYWB 4NYPA 3GJRB 4MIBA 3W9JA 4RW9B 3UCZP 2HHHF 3TYTA 1S9FA 4ILMA 4LUBA 1NK7A 4C11B 1HA1A 2GIRA 4DL3A 3K89A 4WCEQ 1I6JA 4FYXB 1GT8A 3UD4P 1RWVB 5C5JA 5DO2A 4XDDA 3CMAS 4GMKA 2GJIA 3ZZRA 1NDCA 4CLWA 4OFZA 3VALA 2GJFA 3MMAA 2IC3A 2ZDPA 4ZPCA 3RU0A 2MZQA 3FBEA 4BCAA 1XMQF 4HKQA 2RMLA 1SV5B 3PIPQ 4X64F 1S0MA 1LWFB 3MM7A 1TVRB 1RTIB 3HXMA 5CYQA 4RUBA 2MGZA 4O0NA 3NS7B 4Q8FA 5C42A 2OI2A 3DLGB 4ECVA 1U24A 2W24A 3J80U 4OYOA 1N33F 4DPOA 3RRHA 2WBRA 4WU2A 5AE3A 1HBNA 4LF9F 2EFOA 2P6TA 4DL4A 2DGOA 4GKKF 3HFKA 3K8WA 3CDEA 2EG1A 1RB0A 3H42A 3SCIE 2V2ZA 4DFMA 2R7QA 4LF7J 4CH1A 2EI5A 3ENVA 2FHMA 2D3ZA 5G0RA 3R27A 1ZAVA 4CO1A 4DV1J 3LH2S 4EUVA 1RAOA 4IFYB 5F0UA 4NEZA 4U7UD 1R8HA 2QGFB 4ZVSB 4DQRA 1VJWA 4ED4A 3JAMU 1RCXB 1IKXB 3PYEA 2GIFA 3PFOA 2IYGA 1HMVB 2DNZA 2O5DA 2V8VA 4USKA 5B0CA 5L9NA 1T0TV 1RDRA 1S1XA 1HI0P 4FVMA 1YLXA 1S1UB 1TL1A 4I4BA 2G2ZA 3KJFB 4PKDB 4M5NA 4MFBB 3AFGA 1IKYB 2HHSA 2OMLA 4ES3A 5ETKA 5DG8A 2AHOB 3M8QA 1MLAA 1X60A 3QT7A 1IM4A 3K7RA 3R9LA 1X31C 1TKTA 2HEKA 4NZ0A 3T9NA 4OYIA 4C6AA 1PG5B 4MH8A 1A6LA 7FD1A 2LQ8A 4KRWA 4FN5A 2EC2A 1M5VC 3K17A 4ID5A 4OHXA 3CD0A 2FLOA 1S1TA 2R7OA 1BC6A 4EK2A 1JLAB 2R7RA 2ATCB 3VGUA 3SQGA 3AQPA 3ETOA 1VDHA 2YNFA 3RR8A 1TMJA 2HHQA 1GTHA 4RW4A 4Y65A 1QE1B 2H3EB 3QGGA 1EP4A 2J7KA 2ZDOA 3HK2A 3EYZA 1UP1A 1XBWA 4UUWA 4UZBA 4TQRA 2KHCA 4RZRA 3TWZA 5IFMA 3D68A 1FFSB 4KR0B 2Z8QA 4C8YA 2HVIA 4M5JA 3NBPB 3SZ2A 4H4KC 4K5RA 3MM6B 2DNQA 2NYHA 3D2WA 3IN5A 1F5AA 4ZVUB 1Q53A 3EDRB 3JQMA 4DPXA 3AH6A 1XC9A 1X5SA 1DBDA 3IWNC 2FZKB 3I0SB 1UZDA 1NB2A 3BR8A 4LF5J 3RW7A 4WFZA 5KFSA 2FZCB 5KFOA 3B82A 5E3RA 1NO8A 1TL7B 1RHQB 1OY9A 3MD1A 2ZC3A 2R2TA 4RX6A 2V2VA 1FWPA 1F2HA 2VPWB 3SCLE 3FCWA 1KQFB 3FEZA 3CIMA 3PM9A 4IDKB 3NGKA 4F8RA 4WZMA 1GX5A 5I3PA 1B64A 4WKRA 1FF2A 3AJDA 2UUBJ 3N28A 2Y3YA 2DXEA 3ENQA 3C6TA 1KBRA 4X4OA 2HQ3A 1RT7A 2NXCA 3HO1A 2E1CA 4DSFA 4F4AA 3QT5A 2E1RA 1IBLF 4DS5A 3PTWA 3W65A 4XDCA 5A76A 3FRZA 4EBEA 4F3MA 5L39A 1MN7A 1TUWA 1BQXA 4CCHA 3ITHB 3H4BA 1L3KA 3NGSA 5J2NA 3FCHA 4PXCA 2E5LJ 5KT4A 3GB0A 4P73A 2RKIA 1GMWA 5L9XA 1VISA 1S5ZA 2QTWA 5KFUA 4FF3A 2AV5A 3RB4A 1WHYA 2ZBCA 2MB0B 2V2KA 3W9HA 4ECYA 4ZVQB 2GCFA 4FXWA 2F40A 4CLPA 3L7PA 5B0BA 4C9DA 3JTOA 1Q5VA 4ILRA 3CULA 2KHDA 4FKYA 2GMJA 2ASYA 1PJ5A 1LQ9A 4ED5A 2AJ1A 1VQ6S 1WTBA 4P2MA 3Q2TC 3HVWA 1VC0A 4IYQA 5T7LB 3SFUA 4OI4A 2IM2A 2QA2A 4Y3CA 3IFEA 4WK3A 3MMJA 4ZJQA 3SXLA 1WC6A 5DG7A 4B3RF 1HKAA 2MXYA 2KFZA 3KK2B 2BYCA 1VQLS 4F7VA 4WFNQ 1SIWB 3D6MB 2OAUA 3H98A 2VG5A 4LRBA 1S6PB 4DV3J 1LW0A 4ZVFA 4RBVA 2VPYB 1S6UA 1HQ2A 2J9DA 1X8DA 4BC9A 1WG5A 1RT1B 3IRXA 5ETRA 1REGX 1NSPA 3EE3A 3PNIA 2ZD1B 3BF4A 2A2CA 2DNHA 2GS8A 2QLWA 4Q0BB 1VRTA 2EFPA 4DPYA 5JUMA 3I55S 1UJ5A 2G13A 5EUHA 3AQOA 1B70B 5AJ3J 1CS4B 1RA7A 3CJKB 4DFJA 4DF4A 1Q0NA 5J2PB 2KVQE 1OO0B 5A2QY 4OZLA 2QLFB 1RT3B 4OYWA 1FT8A 4KH1B 8ATCB 3MM5A 3VHQA 2VIHA 3QAEA 3KLEB 1VIOA 1M5OC 3LP1B 1C1BA 1FTRA 4F4XA 2QLJB 2LEBA 1GFWB 1IR1A 2NSBA 1R0AB 2DO0A 1F3FA 1D9AA 2WVCA 5HL7Q 1Q7LB 3AJ2A 3MFHA 2ZH3A 1X4DA 3O5TB 1YZ7A 4JV2A 3CGIA 1R8AA 3M9MB 1B3TA 2BKPA 2YWFA 2HHVA 1RWWB 3T9ZA 4OI0A 4PG7A 1XR6A 3C14B 4OIXA 1CC8A 2FVRA 4X62J 4Y2IA 4FF4A 4AL5A 5FDLA 2K06A 5F0WA 2M5YA 3T6BA 1T11A 3R2CJ 3O44A 5HN0A 4DWIA 2MY8A 2IAJA 3Q86A 4J9OA 4J9PA 1S9GB 1OPIA 2GMHA 3RJMB 4A47A 1E6YA 4L74A 3FNNA 2IVYA 4NMLA 5EWEA 4JYAJ 2QIFA 2GNKA 2CQGA 4CLKA 1I94F 4NXNJ 3VF0B 2NZCA 1FNXH 1Q8IA 3V6DA 3VTIA 4F3OA 1XMBA 4Y2AA 3R3TA 2QX0A 2Z2MA 1HBMB 4LMZA 3UVJB 5CAAA 4GKJJ 1NSAA 4KO0B 2UUCJ 2MZTA 5D77A 2P6SA 4K4ZA 1NRKA 4QIWD 3QSIA 2O66A 5E33A 3QSYB 4WXWA 1IKWB 4O23A 1SJ4P 4NXMJ 2AYBA 2YWGA 1T05A 3TOQA 1XN9A 3LOUA 4LR7A 4UTGA 2YKNB 5ETSA 4O3SA 2PDAA 3ZC4A 3EVMA 6FD1A 4ILLA 5H9FK 2LLZA 2UUAJ 3OHBA 5J1PA 3LPYA 2FDNA 3EICA 3TAQA 4LFBF 4MJKA 5A0YB 3TRGA 2F4VJ 3HFZB 2W8KA 1IR2A 4K2XA 1HBOB 3KLVA 1HNXF 1HWLA 4KC5A 3Q83A 4OX9J 2A10A 2CPZA 2PI4A 1SXLA 3QRQA 4ZP6A 3QLHA 2HQIA 3UWTA 1WSRA 2J0WA 2BV3A 2EKNA 2XYGB 3H20A 2RDDA 3THTA 2RU3A 4M5DA 2I6WA 4CTAB 2UXCF 2JH3A 4R5PA 1R8CA 2X3GA 5KG1A 3F73A 4DV6F 3M8SA 2AX0A 2EFGA 3D1OA 4A46A 2RU9A 2DNGA 3HCXA 1GXLA 2EC0A 2KRBA 1N32J 2JEIA 3G82A 1HQUA 3N6NA 1CEZA 2CQ2A 4C48A 4IFVA 6FDRA 3D3BJ 4NCAA 1NUEA 2VG7A 2ZM6F 2YX7A 1P6TA 3DRSA 3DLEB 1GMWD 1YBTA 1F60B 1AXQA 2R8HA 4PPDA 3CB4A 5CZVA 3UDLA 1YJNS 1SL0A 4DCJB 2ALYB 4LRDA 3BSCA 3DOLB 2W01A 3Q89A 4HTJA 5EDWA 1WOSA 4DV4J 3ZZZA 5D78A 4LIRA 4KKOA 3A8KA 1M90T 2I5JA 2MLXA 2QYGA 4C0BA 3KFWX 1DTQB 3VCDA 4NX9A 2RS2A 1VRQC 4X4RA 5ETNA 3LAMA 1CC7A 3GZ7A 4DFPA 2AGPA 2YWKA 1S76D 3HKZD 2L9DA 1YJUA 1S59A 1DJ0A 1V9OA 1WELA 2F8EX 2VQEJ 4ZVOB 1MMNA 1JLBB 5GADI 2W2OP 1RYSA 1X4EA 2V8HA 2PO4A 3W62A 4DV5J 4C8OA 3GSIA 4ED8A 1TUGB 5LOQA 1SQFA 4CYUA 4KPCA 4X2BA 4RNMA 4GO7X 2FZGB 1HI1A 1A7GE 3OR1A 4ECQA 3AY0A 1UCNA 2MLZA 4JI0J 2DRDA 3G6YA 2R8IA 4ZIVA 2K3IA 4KGMA 3H40A 1WNEA 1UTAA 2HVEA 5AXNA 2BMBA 3VAFA 3UDEA 2VBZA 4OZ0A 3HM9A 4CLSA 3KJNB 3V4IB 2DJWA 2QFJA 4MMOA 5KFDA 3M8WA 1URNA 1C0UB 3W63A 1SJFA 1NK5A 1VQYA 2QG9B 1FWLA 4WFAQ 3KLHA 5EGYA 4YB7A 1WSVA 2FC9A 4DL0C 3LF0A 4NA2A 3DM2B 1WKJA 2PMZD 3I9ZA 2C3UA 4KBIA 4IOAQ 2BJ9A 1XNRJ 4M5KA 3KG0A 4NYZA 1WOOA 2D7SA 3EZOA 2ZH9A 3MM9B 2CQ1A 4LBHA 2YNGA 3GU0A 1I51B 1H73A 1YJTA 4QQBA 2ZHBA 3WC2A 3QFHA 2R4FA 2GIQA 5D0HA 2OJ3A 4OX8A 3CCMS 1GNKA 4ZLNA 1Q86T 2E1MC 4ED0A 4GC7A 1XWLA 4UUXA 2XMVA 1S9EA 2FJBB 1UW4A 2FTRA 3NAIA 4PG8A 5C2CA 3NL0A 3PJ9A 2AZ3A 1N6QB 5HLFB 4LRFA 3H7HB 2FC8A 1N5YB 2IRYA 5CABA 3GLJA 2CJAA 2B7CB 5F3ZA 1FVQA 1FD8A 5DRKA 2ZBIA 1HW8A 2EG2A 1XR7A 3IC1A 2B4UA 2VQFJ 2GC8A 4G1IA 4ELTA 1V6HA 2XNQA 4USUA 1PIEA 3UPFA 1ZZNA 1HBUB 3PRBA 3IBCB 5DDRC 3PHEA 2DT9A 1S0OA 4MKAA 3ET6A 1KONA 2W4DA 3BB5A 2GQCA 2HNYB 2JSXA 2QT7A 3I0RB 4CWBA 4Y28C 3ISNC 3FUYA 2F9DA 2F63A 3QGIA 4F26A 1SV5A 2Q3PA 3H2UB 3UN3A 5BJRA 3C15B 4DSEA 1TVRA 2G0JA 2MDAA 2YQ3A 5K20B 2FVSA 4K4TA 4Y2CA 3NCQA 2V6AA 3MPUB 1FTCA 2EFVA 3ULHA 1I1GA 1N56A 1ACMB 1VQOS 3OD2A 4DUZJ 3C66A 2RH3A 2BQUA 1NKEA 2V0NA 3G4SS 3R1HA 4B17A 2GGPB 2CJYB 3KLIB 5KFGA 2EEYA 4B3MF 1S1VA 2GAGC 3MEDB 1BMQB 3DOKA 2ACMA 4AE5A 1U0SA 2KJWA 4DV0F 3QJPA 2CZVC 2QJ3A 2LCWA 4F2SA 3LANA 3CD7A 1LOUA 2FGCA 2RHSB 4JI1J 2KRRA 2BQRA 2HMIB 1H2VZ 1S48A 2FLNA 5J1EA 2EFQA 1FRLA 1SUQA 2HFZA 2M2BA 1U8SA 3CVKA 1BXNA 1Z4UA 2OUGA 4RW7A 2ZEJA 1J5EF 3NAHA 4I64A 2ADCA 2PEHA 3R5BA 1CQNA 3T1HJ 4R8UB 1T3OA 3DI6A 2DNYA 4YOEA 5LXYA 1NZAA 1H38A 1N5QA 2DHHA 4W4MA 1IKVB 3MECB 3M8RA 3OVAA 2C2DA 3OL7A 2LXFA 2MQLA 3VAGA 5DQIA 4DMZA 4HHHA 3RB0A 1R43A 3LAKA 2J0XA 3K2YA 4I56A 4KFBA 2GQ2A 1VQKS 3D3CJ 4I2PA 2HNZB 2ZWOA 3CXCR 1JNRB 2V34A 2JLEA 4X4VA 3QATA 5EX0A 4ER8A 2CZ9A 1S1WB 1NPRA 5F8LA 3ILJA 1JJHA 5CA5A 2UXBJ 4PXDA 2ADBA 2PIIA 4DR1J 4F4WA 3OJUA 2RS8A 1DTTA 4WP8A 3OSNA 1U1PA 3IAM9 2B4OA 3ZTOA 1ZTWA 3EUNA 3PKMA 3IP0A 1DFDA 2HQCA 3GIIA 3EGVA 2VBYA 4DUYF 2CFXA 3R5JB 4PWWA 1TP7A 3V6JA 5D4OA 3MR6A 1FWKA 1TTHB 3NBPA 1RSCA 4HT5A 2JEJA 3MM6A 5DLGA 4N8OA 1Y3JA 2VL1A 3PYDA 1ZPWX 3AA9A 2DGXA 1T9TA 1RWXB 1HNWF 3I0SA 4E0DA 1DY3A 4ED3A 2CQHA 2VFUA 2MZRA 3R5CA 1KDNA 4CO5A 3RRKA 1ELOA 1YQHA 4TU7A 4NCGA 5HMXA 2NXJA 1NH8A 4WJBA 1CJVA 2GVZB 5EN1A 4NMXA 4YR2A 5H9EK 3DLHA 2LECA 2F3JA 1CULA 4J9MA 4ZVGA 1NB7A 2DH7A 1TFWA 4ANEA 2VD3A 1S7HA 4PCQA 4J9KA 2CNOB 3PY8A 2I8EA 5M2RA 3I96A 4UT4A 2LXIA 3PO4A 4QPTA 2CA9A 2KVIA 2MKCA 4TXSA 5IV3A 5CYMA 5L8RC 4CLFA 4TLQA 2XSJA 3DXBA 3ZZOA 2DCUB 3CDBA 2C2OB 1AW0A 3D54A 3A4TA 1S49A 3BGRA 1HFEL 1TMMA 5D0GA 1NHVA 3V81B 4KB7A 2D74B 2VA3A 2RUSA 4JI2F 3ITHA 1FDDA 5GAEU 1HNZJ 2LA6A 1SIZA 5J2QA 2XBPA 3MURP 1JJCB 2PFDA 4O44B 2NSCA 3JXOA 2V9WA 3OLAA 4TVAB 2HLUA 4B3TJ 4E98A 5K14B 2K7KA 5JJBA 4NI2A 4X84A 3SBMA 1S12A 2JEFA 2E1PA 3M9OB 3EVWA 1RAGB 5THWA 4F04B 1H7WA 4CH7A 3W8PA 2CPHA 2RSQA 2FQQB 2CPEA 4QOTA 1QTMA 5J2MA 1R8BA 4IOBA 3GJQB 3H0PA 5HVGA 1F2GA 2K7JA 2CJ9A 3RZAA 2C3OA 2DTJA 4XK8C 2W9CB 1JJ4A 3Q8VA 2E5HA 2HVZA 5GMKa 4N56A 2ZJRQ 1DLOA 1EAYC 2BRLA 3M8YA 1NHUA 1FRIA 5ETTA 3KK2A 3FCVA 3IBWA 4LF6F 2KZMA 1WOPA 4KY3A 2OPRB 3BH7B 4OMFG 3O8WA 1C0TB 4WIIA 3UCUP 1E6VB 2DK2A 4NE9C 2CQ0A 4N77A 5KFKA 1RLDA 4OYAA 3PV8A 5IWAF 5H9FJ 1VYAA 4Q0BA 4U67Q 5D4PA 2HBQB 1EZZB 2BA9A 5KFVA 2BANA 4AXJA 3GIKA 4O4GA 2IA0A 3FEYB 3CJKA 3BYPA 5J2PA 1HD1A 1N4LA 2U2FA 2HWHA 3TUIC 4OYPA 4DR6J 3FVYA 3HP6A 4ECZA 1RT5B 3KLEA 2DNKA 2HBZB 3TI0A 2VC0A 4RR5A 3W60A 5KFEA 1L3TA 5M2PA 1R0AA 3GIMA 3NGUA 4JI3J 1B99A 1RWNB 3M05A 3TZYA 2JWNA 3FSYA 2MHEA 2RF2B 1QLNA 3IBFB 5LMUJ 4UF4A 2B8PA 5KG4A 5K8OA 3R7SB 3EPIA 3JYTA 4K0KJ 1OY6A 2DNPA 3QGPA 5F9NA 2OH2A 2GQQA 4TY8A 1ZAWA 1JMTA 3OFGA 3NNHA 2VH7A 1D8ZA 3IA0A 4IO1A 4OI3A 3W2VA 5SUHA 2DNLA 2DR9A 3MM8A 1YIJS 1KTQA 4NLXA 2Z4PA 4B9VA 2YTCA 3OR2A 5GAGI 4JI5J 2H1YA 3D1HA 2ZFHA 3AXKA 1SH3A 4DBQA 3K58A 5C2GA 1F5CA 3JS9A 2E5GA 3TX0A 4QIEA 3N4WA 1UJ6A 1GEHA 1RWMB 2N4DA 4OYXA 1LEOA 3SFGA 4LFCJ 5LSLA 5SZTA 1JJ2R 3RUBL 2MSTA 4KGKA 1KKHA 1N5TA 4JV0A 1RT4B 3EGNA 2BABA 3RYLA 1IWAA 3KJVB 5D6GA 2B8QA 1RWKB 2DNMA 1CVJA 3T1YF 2AQ4A 1CJKB 3RAMA 2XLIA 2R2RA 3ILOA 4AQYF 3A8EA 2E5IA 3DCAA 1Y4ZB 1W26A 2YQ0A 4QZVB 4DQIA 1JLFB 5C7PA 5D4LA 4EBDA 1UZHA 4Q44A 2MKHA 1PBUA 3FSXA 2DITA 1UWBA 2ATLA 1T7PA 5AT1B 1UVKA 2DKOB 3P4UB 1K47A 3TZXA 1Q8KA 4DV3F 2LQ9A 3FSIA 2AJ4A 3CCZA 4DR4J 4YMEA 4KGVB 5IM0B 2FJEB 2JL9A 3FFIB 5A0YA 4ZPAA 4B9NA 2HFOA 3HVTA 1HBOA 2FVQA 4DJBA 3SDEB 4A8XA 1U4BA 3C8YA 5JXSA 2W7AA 2YY3A 1IR0A 2C3YA 1ZS6A 2DGVA 1D9DA 1G7CB 4D3HA 2M3DA 1RAIB 4UZCA 3HHLC 1XK8A 3BYRA 4B08A 3LA0A 3NOGA 2W9AA 4U95A 5ETLA 1LW2A 2YKQA 3RRGA 2CPIA 4DV7J 4P7VA 3JB9k 5IT9U 3KUHA 3BBCA 1IBKF 4X4NA 3P5BP 1FKPA 2G2YA 1RTJB 3I9V9 2KI2A 3CJ5A 2XS2A 4WE1A 4AFFA 1REVA 3KHGA 3I32A 2ZOFA 5F8NA 3M32B 2MZJA 4UOCA 2RRBA 4MK9A 3V4MA 2CPYA 4ZK7M 3WX8A 4I7FA 2XEXA 3HHLB 3AD8C 1PO6A 2FJWA 3TA2A 2DPIA 4YQWA 4ZIWA 3O1LA 1ROFA 4TYBA 2N3OA 3CJSA 3D6TB 2QMUB 3RG6A 4DX6A 3KK1B 2AP6A 4C0HA 3F0NA 3DYAB 3IRWP 2BJ8A 2ZH4A 4F3QA 1U2CA 4P72A 3FKBA 1MROA 5GAHI 4YB1P 1VQ5S 2GZOA 3H8YA 2UUTA 3ZTQA 4PR6A 1KHWA 4CH0S 4X4UA 1N52B 1BGXT 2RUGA 5B09A 3TARA 2ZBPA 1JLBA 4FS2A 2BE7D 4GVBB 4HACA 3ENAA 4U7UK 5KFZA 2HHXA 3AJ1A 2HIQA 3PYFA 4IG0A 2ZHAA 2HZVA 5D8HB 2ZZNA 1FDBA 3S7RA 5F8MA 1T9XA 2QO3A 4X65F 1NJZA 4CLYA 2HBYB 2H48B 3VAKA 1JK9B 2BXJA 1WACA 3LP2B 4CZCA 2DNRA 3EXCX 3N5BA 2GV1A 2H51B 1RI7A 2UUAF 1U25A 3CPWR 1IQZA 4E8UA 2VFRA 3V4IA 4L3KA 1FNOA 2Z30B 3BQ1A 1N36F 2F4VF 4DN9A 3GYXB 3QAUA 2OIHA 5BYSA 4A8KA 3BGOP 1Y3KA 1GK8A 3KNGA 5LM7E 1RXOB 1QVFR 4FYVB 2UUWA 3DM2A 1M0SA 5JVHQ 2IVFB 3DDKA 2OEKA 2K1RB 1HW9A 1WC5A 2AU0A 3RW6A 5L1LA 4M94A 2XB2D 5F9LA 3T3FA 3HMJG 4RUCA 2Z2ZA 2OPPA 2ZH6A 3CW2C 2HRTA 3GCXP 2QA4S 1RHRB 3PO5A 3IR5B 1ZTTA 4RW6A 4KHPJ 2VPXB 3G9CA 2W25A 4HH0A 2FIUA 2RILA 5DJBA 2RRNA 4FDFA 1N6QA 1D9FA 2FY1A 2DXDA 1OSCA 5GVQA 3GIJA 3TUJC 2BJ7A 3DGPA 1X9WA 4BLGA 2P8IA 4CRJA 4LFAF 4DEZA 4LSZB 4M63A 2B7BB 4U8VA 4FYYB 3SSSA 3LGHA 4YR0A 4I2QB 4LBIA 5A8WB 1HYSA 1KN6A 1IBMJ 4JI8J 1NJIT 3W2WA 1IJEB 3GR1A 3ILLA 2UVVA 4CLZA 2HNYA 3IO1A 3I0RA 1Z2ZA 1UAWA 2HNDA 3CC2S 1RHKB 3CCQS 5C24A 1SJQA 4DL2A 2HBRB 3HF5A 5KFYA 3UCGA 3JSMB 3CWJA 4RW8B 2WOMB 4LSNB 5DQGA 3WHIA 2VC1A 2BKNA 3CC7S 5CH7B 3PW4A 2APOA 4NLRA 4DXLA 2R2UA 1GQEA 1X0PA 3G2XA 3U02A 3NG8A 3ZXWA 1I5OB 3BGUA 1RWOB 1Q1KA 2OFHX 3MPDA 2JLFA 2FHKA 2DHSA 1YRTA 1RT6B 4ZDNA 4YEAA 1AB8A 4LF2A 1FX4A 2XHCA 1VLYA 1U09A 1GXUA 4WBFA 3GV5B 3ZTRA 4TQSA 3JSRA 2HHHJ 3NGRA 2B0GA 4ZJOA 3MMCA 1RE1B 3HHKA 3SYZA 3LWLA 5A2QU 1FXRA 5J1NA 3RAQA 3LALA 4JI0F 4YY3F 1VS3A 1ZM3A 1U1RA 2MQMA 5H9EJ 1TQLA 3U1LA 2ZJPQ 4G1QB 3M2UA 3HZEA 3DLKB 1CG2A 3POTB 1U1NA 1PGZA 1HLWA 1VQNS 1PCAA 1R8PA 1VI7A 1WF2A 1QTNB 1C2PA 3I6PA 1O8BA 1XMQJ 4IQMA 3MUMP 1QSSA 1B0VA 2XGPA 3F56A 1X4BA 5DM6Q 5KFJA 4Z7CA 4EU0A 3BREA 3GFXA 1N48A 2XSFA 1AROP 2XMUA 3QO9B 3RR7A 5E3PA 2ZUGA 5C25B 3J7YU 1KVKA 1VRUA 3QIPA 1TZ0A 4YS2A 1FJ7A 2KT5A 4LF9J 2L48A 1VJQA 2VF3A 1Y5LB 1IKVA 2UVRA 2FGOA 2R8GA 4DS4A 5A8KA 4GKKJ 4FYDA 2CQ3A 4DPTA 2J5AA 2IJRA 3MR5A 3PRVA 3OL8A 2WVFA 3JTNA 5L1KA 5DM7Q 4DI6A 1GX6A 1Y10A 2YQ1A 4C7QA 4K8RA 2MQ8A 3CCRS 5B0DA 3IMQJ 3MDFA 1T03A 1S1WA 4OZ5A 1UFKA 3SQOP 2M88A 2IBOA 1U0HB 4K4VA 3GE9A 2VQFF 1KLMB 1KOHA 1FJCA 2YNHA 2FJVA 1PBAA 1TAUA 2MQPA 2I38A 1VBZA 3A3PB 3MR7A 3L7UA 1ITPA 1SKRA 2QA4G 4JP8A 1X4GA 3AHPA 2LMIA 1NK0A 1M1HA 2C22A 3OUYB 3MEKA 1FKOB 3U1NA 1WJ9A 3MAHA 1WHWA 4ZHRA 1F5BA 3BQ0A 1NCLA 1MU2A 2MMYA 2LP4A 1KQSR 3RGIA 2XMTA 4FBUA 4EGLA 4DV2F 4A8WA 1TL3B 4KGXB 3J7AN 4ITSA 2XO7A 1TK0A 4YHHF 3OFEA
chains in the Genus database with same CATH topology
4Y34A 3FQKA 3P3DA 3I4PA 4KTQA 4KJIA 2MJUA 2PI5A 3HVRA 1RJJA 1F9FA 4X2BA 2JJ4D 3Q22A 2J9EA 2HGLA 2NUUG 4RNMA 3OTBA 3HI9A 4GO7X 4Y2KA 3N79A 3TX8A 4ELUA 4UY8T 2VG5B 2B3TB 3FEXB 1D8YA 3PW7A 5J2MB 4DQPA 2VG6B 1HI1A 4NLSA 4A8SA 1A7GE 2VB6A 3E2EA 3OR1A 3WDOA 3PKYA 4ECQA 3DLBA 4JI6F 3AY0A 3OTCA 1N54B 4FNIA 5B0EA 1KOOA 2V5HG 2V8GA 3CDUA 3G6YA 4ED2A 3M1VB 5K5MA 2NYIA 3WC0A 5HO4A 1UVNA 1VMBA 5KT2A 2R8IA 1UVLA 2ZKUA 2K3IA 4KGMA 2Y1JA 2J7UA 2OD6A 3HHNB 2E1AA 2AW0A 3H40A 1WNEA 3BGFA 3VAHA 2OLWA 3H4DA 3HHLA 3B4MA 5AXNA 1N0UA 3DXSX 1BQMB 1YHQS 1HQEA 1K0VA 2RQ4A 3HLUA 1YJWS 3SV3A 3VAFA 3WZ0A 2VBZA 3B8HA 4QPXA 1UFLA 2AGQA 4OZ0A 3HM9A 3H5XA 4NLGA 4PWDA 2NXUA 3K5PA 1VRTB 5DETA 3V4IB 1DLOB 3DLLQ 2L9NA 2DJWA 1TV6A 3CCSS 2QFJA 4MMOA 4J9SA 5KFDA 3ENWA 2OTLS 2ZOMA 1URNA 1C0UB 3R1LA 3MD3A 4JI5F 4AL7A 2KM8B 4XIUA 5DQHA 3W3SA 3ZZYA 1SJFA 4CO0A 2FJAB 3MMAB 2ZKTA 2UXDF 1NK5A 2IC3B 5EWFA 1VQYA 4WFAQ 2LA4A 3IAS9 3KLHA 4F50A 2FVCA 1KLNA 5EGYA 4ECRA 4YB7A 4ETXA 3L95X 2FC9A 2MYFA 1XMOF 3TQ1A 4K4XA 2C2RA 1S6QB 4Z37A 2FHJA 3CUNA 1RWUA 2R7UA 4Q2MA 4DL0C 3LF0A 4NA2A 2QV6A 1VQ9S 3MI7X 1YI2S 1UA0A 3DM2B 1DQ9A 2CQDA 1N0VC 4C3LA 4RWWA 2AJQA 2PMZD 3EZUA 2DGWA 4YDXA 1CPZA 2X1GA 3I9ZA 4OX7A 2C3UA 1D1UA 4KBIA 2X1FA 3MM5B 3MM7B 3BO4A 4IOAQ 4MAKA 5I3UB 4MK8A 2B4PA 2RQKA 3C3LA 1UVIA 3KG0A 4LFCF 4NYZA 2D7SA 5CYQB 4FP9A 4DR3F 1HPZB 4CQ1A 1P9QC 2ZH9A 4HI2A 3C46A 2MGZB 2G1DA 3MM9B 2CQ1A 2YNGA 2Q6BA 4JV1A 3BO3A 5C42B 5B0GA 2XS7A 3VAJA 2UVWA 2DRAA 2GHVC 1WF0A 1YJTA 1MWZA 4C8NA 2HWIA 4OLOA 2BANB 4QQBA 2ZHBA 2CIMA 2PGCA 2WB1D 3WC2A 3R5AA 3CCLS 1FK9B 4AUKA 3FGVA 1HR0F 2EPIA 3JTPA 2HVHA 1FCAA 3VR1A 2R4FA 4O4GB 5T7LA 1K1QA 1HNVB 2GFFA 3B4DA 2GIQA 5F8JA 2OJ3A 3PEJA 4OX8A 4FF2A 4LF8F 3TO8A 3HX9A 4LT6A 3CCMS 4MKYA 1GNKA 5KT3A 1Q86T 3WBZA 2E1MC 4ED0A 4GC7A 1XWLA 4UUXA 2W8LA 2XLKA 2UZAA 1P27B 2XMVA 1S9EA