4H4OB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with (e)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (jlj506), a non-nucleoside inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
428
structure length
428
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 103
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4oB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB03
2W8KA 4KE5A 2IM2A 1S1XA 1IKVA 4ED2A 3SI8A 2VG5B 3DI6A 3V6DA 2FVQA 3HVWA 4ZVGA 3E01A 3TAMA 1S6PB 4NLGA 3MF5A 5HLFB 3KK2B 1S9GB 2BRKA 4LSNA 2WHOA 4WFZA 3OL7A 5DG9A 1Z4UA 3CJ2A 4RNMA 3MECA 3IS9B 1LWFA 4IDKA 3QZ8A 2AX1A 4K4WA 1LWCA 1TKZA 1HMVB 3V81A 5F8JA 4IRKA 4KBIA 1HQEB 1JLFA 3LAMA 4NRUA 2XWYA 3H4BA 1RT4A 2BE2B 2IJFA 3DM2B 4NZ0A 4O4RA 5KG7A 3BJYA 1LW0B 2R2SA 3D5MA 1EETA 4KO0B 2B6AB 1C0TB 4ZHRB 5C24B 2YNHB 2HWHA 4O4GB 5T14A 1T03B 4MH8A 2W9AA 4O3SA 2BANA 1JXLA 4ID5A 3MR5A 1JLCB 3M9NB 4RNOA 2F8EX 5KFQA 2WCXA 3QGHA 1T3NA 1BQMB 4I2PA 2XGQA 2RF2B 1XR6A 2VG6A 3PR4A 4DEZA 3RB4A 1N5YA 4K4TA 4F4ZA 5DQIA 5KT6A 4X2BA 4TQSA 2JLEA 4ZVFA 2YNFB 3H5XA 4O44B 5HBMB 1RTDA 3VQSA 3EPGA 5FDLA 4IFYB 5EWFA 3M8PB 5CYMB 2OPPB 1TL3A 4RW6A 4LSLB 3I5CA 4QWAA 1R0AB 1W25A 1RA6A 2ALZA 1JLAA 5C42B 4DL5A 4WE1B 1C0UB 1MU2B 1BQNA 1QAJA 4WZMA 1RT7A 3BQ1A 4NLVA 2BQUA 2VG7B 3CJ4A 4RNHA 4DL2A 3UDLA 4O3RA 1FKOA 1RT1A 1FK9A 5J2QB 3MTKA 4NLWA 4U6PA 2W9CA 1FKPA 2IC3B 3MEEB 1NHVA 1DLOB 1S9FA 4PWDA 1DTQA 3BREA 4EEYA 1TVRB 4J9PA 3V4IB 2JEJA 3GIKA 1SH2A 3C6UB 4NLRA 1TQLA 1S1TB 3KLEA 2XC9A 1LW2A 2V4QA 3PW2A 2ZE2B 3IRXA 5KG0A 5DGBA 3RBEA 4R8UA 5KFKA 4GC7A 1SUQB 5KFZA 4NLPA 1TKTA 4LQ9A 3OSPA 4O3NA 1VRTA 4WXOA 1RTHB 2HNZA 3H5SA 3QLHA 4IG3B 1T05B 3FRZA 3LANA 5JXSA 2W7PA 2ILYA 3KHGA 5KFRA 1IKYB 1KHVA 2IA6A 1J5OA 2HMIB 4IR9A 1C1BA 4XPCA 1QUVA 1S49A 5KFSA 4ECUA 1TV6B 1UWBB 3DMJB 1TKXB 3LP0B 4KV8A 1N6QA 1SH0A 2RDIA 3QIDA 5DLGA 2V9WA 3PW4A 2ZD1A 3HVTB 3HVAA 4O3QA 5KFPA 3NBPB 4TQRA 4QPXA 4QW8A 1TL1B 5KFOA 2UVUA 4J9LA 4ICLB 3QZ7A 2DPIA 2JEGA 3CO9A 3UQSA 3V6JA 2D3UA 4IQXA 5C25A 4F4XA 2BR0A 3GV8B 2WB4A 1DTTA 5DG7A 3RB0A 1IKWA 3JSMB 4YQWA 4RNNA 1RT3B 4I2QA 3NAIA 5J1EA 2FVRA 1S1WB 3FSIA 3ITHA 3RB3A 2V4RA 3T5HA 2YNIA 1SV5A 1OS5A 2ILZA 3CJ0A 4DG1B 3CVKA 3H40A 3DLKA 4M95A 3T5JA 4NCGB 1C2PA 1N48A 4EBDA 4ECYA 4K4UA 2HNDB 3N6NA 2B43A 5CYQB 1RTJA 3LP1B 1GX5A 3MFIA 4TYAA 4J9QA 4H4MA 4RU9A 3M9OB 4PQUA 2AGOA 5J2MA 3DLEA 4ZPDA 2IMWP 3PHEA 4KHRA 1RT2A 2C22A 3FFIA 4ZPCA 1C1CB 1KLMB 3LP2A 3OL8A 3DYAA 4TXSA 2R8HA 1RTIB 5F9LA 3KLGB 3KLFB 3KJVB 2XI3A 4EYHB 4DL4A 2JEIA 3I0SB 1I6JA 2O5DA 3GIIA 5KG5A 1RT6A 1HNVA 3KK3A 2YKNB 2AWZA 2YNGA 3QIPA 4NLTA 4J9KA 2R8KA 3DRPA 1HNIB 4G1QA 5D3GB 4H4OA 3UPFA 3BSNA 1S1XB 1REVA 3M8QA 5EUHA 3UR0A 3DI6B 1S48A 3E01B 5KG3A 1S1VA 2IAJA 3CJ5A 1EP4A 4YP3A 3NGDA 4WXWA 5F8MA 4ECQA 4WYWA 1N56A 2D41A 2OPRB 3IG1A 4ECWA 3H2LA 3Q8RB 5KT7A 1ZTWA 3BR9A 1IKXA 4TLRA 4IFVA 3E51A 2B5JA 4WFXA 4NLOA 3N6LA 1LWCB 1TKZB 5KFJA 3V81B 3PJXA 5KFMA 3OL6A 1JLFB 2QV6A 3MFHA 4WYLA 3BGRA 4H54A 2E9TA 4RW7A 2OPSA 1MMLA 3G6XA 4ED3A 2FVPA 4J9SA 4IOBA 2C2DA 5DLFA 2BANB 4ZPAA 3PZPA 4ID5B 1JLBB 5I42B 1KHWA 1S6PA 3OL9A 4RW9A 5HLFA 1RT5B 4NLUA 4TN2A 4K4ZA 4I2PB 2ATLA 3C6TA 1HYSB 5K14B 5EWGA 5J2PA 2VG6B 1N5YB 4J9NA 5KFAA 3IS9A 4K4VA 2WOMA 2XI2A 1RTDB 3HHKA 5FDLB 5I3UB 2IM1A 1HQEA 3QYYA 4RW6B 4QWDA 4J9RA 2D7SA 5HROB 1JLAB 4ED1A 3PR5B 4RW4A 4LQ3A 1BQNB 3QO9A 2IM3A 4KO0A 2B6AA 1C0TA 3ISND 4TY8A 1T03A 4OL8A 4DL6A 2I5JA 1JLCA 3RAXA 3H5UA 4F4YA 1RT1B 1FK9B 4PUOA 2AX0A 3GYNA 1BQMA 4Y2CA 1FKPB 5KT2A 2JC1A 4EBCA 5KFIA 4KKOA 1DTQB 2QE5A 3GV5B 2UVWA 3KK1B 1HARA 1IM4A 1TP7A 2JC0A 4ZVEA 3BQ0A 5JUMA 5L1LA 5HBMA 5KFWA 3KLEB 4IFYA 1LW2B 3M8PA 5CYMA 2OPPA 2WRMA 3D28A 4ZP9A 3IRXB 3GIMA 3GV7B 4Q8FA 3GQCA 4LSLA 2AGPA 3RAQA 2RKIB 3DDKA 1JLEB 1R0AA 3N6MA 2DPJA 4R8UB 4M94A 2CJQA 4MK8A 1JLGA 3G86A 4TYBA 4O3OA 1TKTB 2XGPA 4WE1A 1C0UA 2R2TA 2HNZB 3QLHB 2WONA 1NHUA 4ED8A 1HPZA 4EO8A 2OPQB 5F8GA 1C1BB 2YKMB 4I7FB 1S4FA 5F8IA 4Q43A 1N6QB 1S0OA 3MEDA 2FJXA 3RB6A 1QAIA 3DRRA 4ED7A 4WFYA 1JIHA 2GIQA 1TVRA 4NLQA 3V4IA 2UVVA 3OSNA 3I0RA 3BSOA 4XPEA 3DRSA 1CSJA 5KT3A 5F8LA 2E9ZA 3KLHB 3I5AA 3SFGA 1S0MA 3Q8SB 1S6QB 4KFBB 1S9EA 2HNYB 1LWEB 3H4DA 1SUQA 2V0NA 4NYZA 5KG4A 1RTHA 2RDJA 2FLLA 1RYSA 1DTTB 4MIBA 5KFYA 2UVRA 1IKWB 4B3OA 4ZVHA 4JV0A 2HMIA 5HP1A 3NL0A 4QWEA 3ITHB 5KFEA 5KFHA 4RW8A 1TV6A 3DMJA 3LP0A 1QE1B 1TKXA 2YNIB 1SV5B 3DOLA 1D1UA 3DLGB 4MFBB 2WK4A 5KFDA 2J6UA 3H98A 2R8GA 4Y34A 4DL3A 5F8NA 5L1KA 3HKWA 4EYIB 4IRCA 3TVKA 4MKAA 1TL1A 3EZUA 1RTJB 4EBEA 3OLAA 3KLIA 3EPIA 4PQUB 4YR2A 5F9NA 3GILA 3KNAA 2W9BB 4FS2A 1RT2B 3FFIB 2ASJA 1JKHB 2D3ZA 3NMAA 3BQ2A 4ZP8A 4ED0A 4XO0A 1ZTTA 3CDWA 1D0EA 1RT6B 4K4YA 2R2RA 1HNVB 3KK3B 2YNGB 3QIPB 2VA3A 4R5PA 1JLQA 4G1QB 1HQUB 4DG1A 5KFBA 1REVB 4NCGA 4MIAA 3M8QB 3CIZA 1IKVB 4IG0A 4ZP7A 1YVFA 2AQ4A 3MEGA 3ISNC 2HNDA 3FQKA 3V6DB 2E9RX 4WZQA 3T19A 3PW7A 1EP4B 3TAMB 3OHBA 1S1UA 3JYTA 5J2NA 4TY9A 3BSAA 4Y3CA 3QGGA 3MR6A 4LSNB 4K50A 4IR1A 1C1CA 1IKXB 4Q0BA 4IFVB 4ZP6A 5C5JA 4NLSA 3MECB 1RTIA 3DOKA 1LWFB 4IDKB 3KLFA 3KJVA 3I0SA 5DQHA 5L1IA 4ED6A 3FDSA 2YKNA 3KHRA 2VA2A 2XCAA 2OH2A 1HNIA 1RT4B 5D3GA 1VRUA 5KFCA 4RW7B 4JV2A 3IGNA 2OPSB 1RA7A 5EWEA 1EETB 2J6TA 3OHAA 2VG5A 2FLNA 2W8LA 4ECVA 5KFUA 3Q8QB 5DGAA 4RW9B 4RZRA 4Q45A 3KK2A 1S9GA 5KFLA 5KG6A 2OPRA 4URGA 3C6TB 1XR5A 2BRLA 4ECTA 5J2PB 4NLDA 4JUZA 4QWCA 2WOMB 4R0EA 3TQ1A 2IBKA 3NAHA 2I1RA 2C28A 1HMVA 4YR3A 1GX6A 1TL3B 3CJ3A 4MKBA 1S0NA 2HWIA 1RDRA 2AU0A 1WNEA 3KLVA 2BE2A 3DM2A 4RW4B 1SH3A 1N4LA 3M9MB 3CWJA 3QO9B 4TY8B 1LW0A 4ZHRA 1RT7B 5C24A 2YNHA 2FJWA 4O4GA 3FQLA 4ECRA 1JLBA 2I5JB 5I42A 3CDEA 4KHMA 1RT5A 2WTFA 4PUOB 1FKOB 3CDUA 2W9CB 3QGIA 5KFFA 1HYSA 4KKOB 5K14A 4J9MA 3T5KA 3OLBA 2C2RA 4NLYA 2RF2A 4HYKA 4YMEA 4PWDB 4RUAA 3IN5A 2ASLA 1U09A 2JEFA 3RBDA 1S97A 2CKWA 2YNFA 4O44A 5I3UA 1T94A 5L1JA 4DL7A 4ZPBA 4ECSA 4Q8EA 2BQ3A 4EO6A 3PW5A 3NKYA 3H59A 3PVXA 5HROA 4KB7A 4MK7A 4U7CA 1JLGB 5KT5A 2FLPA 5C42A 2R8IA 2ASDA 1MU2A 3ICLA 1VRTB 3V6KA 2WONB 3KHHA 2XCPA 1RYRA 1HPZB 2VG7A 3LAKA 1J5OB 4K4SA 5J2QA 1XR7A 2IM0A 3MEDB 4KV8B 4O3PA 2IC3A 3DRRB 3MEEA 1DLOA 4IH5A 3I0RB 2ZD1B 3KK1A 5KFVA 2W7OA 3H5YA 4J9OA 4IRDA 3DRSB 3C6UA 3KMSA 3MR2A 1S1TA 3IGVA 2ZE2A 4IKAA 1NNDA 3KHLA 2HAIA 2RKIA 1JLEA 1S9EB 3I5BA 2J6SA 4NRTA 4KAIA 5C25B 2FVSA 3MR3A 3T5LA 4IG3A 1T05A 4RUCA 4B3OB 4FBTA 1IKYA 2OPQA 5HP1B 4I2QB 5J1EB 2YKMA 4I7FA 2IJNA 3GIJA 4IH7A 1K1QA 2C2EA 3KMQA 4RW8B 1UWBA 4YR0A 3DOLB 5EDWA 1RAJA 4MK9A 2UUTA 3DLKB 3HVTA 5KFGA 3T1AA 4F50A 3NBPA 3PJWA 4Q44A 3KLHA 2GC8A 1S6QA 3KLIB 4KFBA 4ICLA 4H4MB 2HNYA 1LWEA 4QW9A 2EC0A 5J2MB 2BQRA 2R8JA 3DLEB 3G6YA 2UUWA 4ECZA 4KSEB 3LP2B 5KFNA 3DYAB 4Y2AA 1K1SA 3KOAA 3JSMA 4NLXA 1RT3A 5DG8A 5L9XA 1S1WA 2FJVA 5KG1A 1S10A 3PW0A 5F8HA 1QE1A 4R5PB 1JLQB 4F4WA 3DRPB 3DLGA 4MFBA 4H4OB 5KT4A 5KFTA 4ECXA 4ZMMA 4RNFA 4IG0B 4URSA 3LALA 3SFUA 3MEGB 3V6HA 2FVCA 2GIRA 1ZETA 1JX4A 1S1VB 2IAJB 5CYQA 3LP1A 1S1UB 5J2NB 3JYTB 2ZKUA 3Q8PB 4G3IA 4URQU 2W9BA 4JV1A 3IG1B 1JKHA 5DQGA 4IH6A 4Q0BB 1KLMA 3BSCA 4GC6A 2B5JB 3DOKB 3G6VA 4FS1A 3KLGA 4FBUA 4K4XA 2R2UA 5KFXA 2AGQA 5KG2A 3BGRB 4QWBA 1HQUA 1VRUB 4HKQA
chains in the Genus database with same CATH superfamily
3SI8A 4HTJA 5LJ3Y 1Q8LA 3EVWA 3CMES 1APSA 4WFZA 1V9OA 3QZ8A 5F8JA 1HQEB 5L38A 2HQGA 2R2SA 1NDKA 3UDCA 4KO0B 1EB0A 3EGVA 2CZVC 1JXLA 4JI4F 3MR5A 3C66A 2D9OA 2Z56B 4EGLA 1FDNA 2VG6A 4C3LA 3R5DA 2DNZA 1R0AB 1RLDA 2P9EA 1QAJA 3W5XA 1S12A 1VC5A 1Y11A 1EZZB 2IC3B 1DLOB 3TZXA 3GONA 3GIKA 3EVOA 4CO4A 3C6UB 1TQLA 2CJBA 4YDDB 1VQSA 4MMOA 1FRJA 2FY8A 2IPOB 4A48A 4D3HA 1X4GA 8RUCA 5JXSA 3LANA 4CLKA 2W7PA 4YB5A 5KFSA 3QNWB 1Y7PA 3LP0B 2V9WA 1RWMB 3QJJA 3CB4A 3R7NB 3HVTB 3J80Y 4J9LA 4LBHA 2P8IA 2OI2A 4B3SF 2YWWA 2BR0A 2V2KA 1X4AA 4I2QA 2BW2A 4LMZA 4ERDA 3T1YF 4X4SA 3RB3A 3DLKA 2CADA 4M5GA 4PCQA 3MUTP 2ZVIA 2CNNB 2HNDB 5E7OB 1R31A 4TNOA 3OR2A 2OELA 5J2MA 3FK4A 1RT2A 5HJXA 1Y10A 4TXSA 3VVUA 4L76A 5GAHI 1S1VA 4YP3A 1NK7A 1YJVA 2R7TA 1X4HA 1VRQC 4U67Q 1TL4A 1GTEA 4JOUA 3NNHA 4QU6A 1WF0A 2FHJA 6FD1A 3BGRA 1EAYC 3GFYA 1O0PA 4A47A 3NOCA 4CO3A 3PJ9A 3JB9k 3UCUP 2C3YA 4I2PB 2ZH6A 3DHWC 3R2DJ 3IS9A 2EBGA 1T8EA 5A0YA 4NA3A 2IM3A 3BDPA 2EFQA 2I5JA 1JLCA 1HNXJ 3IWLA 2J0SD 2UUBJ 2CNOB 3JTNA 3NGKA 5KFIA 3KK1B 3EXYA 4ZP9A 2BUNA 5B0FA 4O3OA 1PYOB 2MQMA 2DNLA 1JJCB 1HD1A 4CLTA 1NPPA 3D3CJ 4B02A 2HIYA 4DX6A 3FGVA 4ZCIA 1QAIA 2UVVA 2L41A 5KT3A 1S0MA 1YI2S 2CQCA 2CQPA 2Z57B 5MLCV 4Y28C 2A18A 2F4VJ 2BJ3A 1KS2A 5HP1A 1NU4A 2VOOA 1SQGA 1AZSA 2R8GA 2M8HA 4EYIB 2QMXA 4ZKAA 2MY7A 2D3O1 1RSCA 2UUAF 4PQUB 4MTPA 1E6VB 2K2PA 2YNGB 5K5MA 2RAQA 2KN4A 1MN7A 1YZ6A 5DJBA 4N56A 4ZP7A 3V6DB 1YZ7A 3OV7A 3BSAA 3A3OB 3MR6A 1C1CA 4IFVB 1IBMJ 4GO7X 2V94A 2ZJRQ 4EUVA 4DR5J 1LFWA 1KEKA 2I0XA 4QZVB 2DCUB 4JYAJ 1D3WA 2BM0A 2LU2A 4NCBA 2ZUAA 2MSSA 4OLPA 3P6YC 2HQIA 4LF8J 4C3MA 2WAQD 5C24A 1P27B 1VC0A 1CS4A 1SC6A 2W2MP 3QGIA 1K9MT 3T5KA 2X7IA 1JNZB 1M90T 2CKWA 1T94A 2Y1RI 3PVXA 2CPJA 1MU2A 1WDDA 3KDNA 2VODA 1WEYA 2C1EB 1VFJA 4PYDA 4DZ6A 5B08A 2MKKA 4OJGA 4Z2XA 3AJ1A 5D77A 1S9EB 4WTYA 4U7UK 3UVJB 5D6GA 2JX2A 2A0FB 4LF5J 3VAKA 3MM7A 3BBCA 2WSCC 2FJDB 2O01C 2GQQA 1KDNA 2QLWA 4A8XA 2QSWA 4KSEB 5MAOA 1HNXF 2XO7A 4KTQA 2BACA 2UUBF 1QE1A 4F4WA 1UEKA 1FDDA 1U1RA 2CWXA 1Y00A 1ZS6A 1JX4A 5CYQA 2ZKUA 2RU3A 1T95A 1U1LA 2NSBA 2AGQA 1B0PA 2PC6A 2CG4A 1HQUA 1VRUB 2ZBRA 1W2BR 2W8KA 1IKVA 4ED2A 1PG5B 2UU9J 4NLGA 1FXDA 1R6YA 4NEZA 3J81j 2Z8QA 4LF7J 4HR2A 1JLFA 2PDAA 2XWYA 3H4BA 3HCXA 5KG7A 4RNOA 2F8EX 3VGTA 2YWGA 1BQMB 5CCLA 1DURA 1ZM2A 2K3KA 4K0KJ 1ZA1B 1RHQB 4DV2J 4QWAA 1TUVA 1RLCL 3PO4A 2GNKA 2RUSA 2ASYA 1TL5A 1J5EJ 3MEEB 1HBNB 4AUKA 1IBMF 3V4IB 2C2KB 2ZE2B 3OJUA 4DR5F 3K17A 4O3NA 4DCOB 1E6YA 2EPIA 2HMIB 1QUVA 1FDBA 1VHIA 3AD8C 1TFYA 3ZZTA 3PW4A 2ZD1A 4PQAA 4CNZA 3MOZA 3D1HA 2DPIA 4LF8F 5C25A 4I1TA 1IBKJ 4RNNA 3NAIA 3KFWX 4P7VA 2V4RA 1SV5A 3CVKA 4NCGB 2YPYA 5A6WA 4EBDA 2B43A 4HHUA 3HM9A 2FYXA 1NKCA 2D9PA 2MKCA 3DOMA 5D0RA 3DYAA 1U6ZA 5E3RA 2MPUA 3C16A 3BBFA 4OZLA 2R8KA 3IC1A 4A46A 3DI6B 1FWPA 2ZNZA 1N0UA 1WDTA 1U47A 4EMDA 4QU7A 4WKRA 4NLOA 5HMXA 4F7VA 1MMLA 1HWJA 4AT1B 3IFEA 2O66A 3TARA 4HLBA 1HYSB 1U24A 2ZWPA 2COLA 2QYCA 3M2RB 1HQEA 1KQKA 3TQEA 1T9UA 4KO0A 3S7RA 3I56S 1RT1B 1FK9B 2AX0A 1DTQB 3ENQA 4RX6A 4USKA 5E3QA 3W1YC 4DFPA 1K73T 3GV7B 1R0AA 2MSTA 1JLGA 3U1NA 3AOAA 2PSZA 3AODA 4R0JA 4E98A 1ZZFA 5F8IA 2IRXA 4NLQA 2C2ZB 2RS8A 4LF7F 2E9ZA 1A0OB 4UZCA 4ANCA 4Z37A 4KIAA 4ZVHA 3IR6B 3T1HJ 3R2CJ 4MIWA 3LP0A 1RBLA 1D1UA 4MFBB 2WK4A 2V4JA 4K0KF 2HKEA 3TVKA 2CFXA 5DM7Q 1N36J 3RU0A 2JH3A 1WOOA 4XO0A 4DCJB 3QIPB 4PXEA 1J5EF 2HNDA 2X3DA 1RWUA 3DRXA 3GR1A 4Q0BA 2J9EA 1CJUA 3NLCA 3NGRA 3MUVP 1RAEB 4RWWA 5AXMA 2R7XA 2BDPA 3E8OA 1M5PC 1EETB 4W98A 2FLNA 1FE0A 5BYRA 2JHEA 1FRKA 2ZFHA 1VQ8S 4E0DA 4RZRA 2DGVA 4NLDA 2APOA 2LFVA 3MI7X 3NS6A 1IBKF 2C28A 2OKQA 1S0NA 3CJ3A 2CWKA 2BE2A 3D7SB 4P9SA 4UT4A 2GGPB 5SUHA 3UCZP 4DPXA 2JEFA 3I82A 1CC8A 4DL7A 1GXLA 2VBXA 3SIPB 1KD1T 1J5OB 1U0HA 5J2QA 1XR7A 3KK1A 3JTOA 1LNQA 3KHLA 4OZ2A 2MQNA 3I5BA 1TELA 4IG3A 3J7YI 2ZC3A 1KSPA 4OZ1A 2CIMA 1RAJA 2DGUA 1T9YA 2F8MA 1QAYA 4F50A 2HQCA 1V3ZA 4PEOA 1VLOA 2ACMA 4E2FB 2IIHA 2DR5A 4QJVA 2AJFE 1S1WA 3DRPB 2UXDF 3W2VA 2CZ4A 2XMVA 4URSA 2KRRA 3HFVA 3IG1B 1TU0B 2XBPA 1E6VA 1F1BB 1BWVA 2X51A 4MYUA 5ITHA 2Y1JA 1RCOB 4FNIA 3ZZRA 4DPWA 3SV3A 1HA1A 3V6DA 3W9IA 5IT9Y 3LOUA 1OMSA 2MKSA 1SBRA 1ZM3A 4F8RA 4HEA9 3OL7A 4OYMA 3T1HF 1HMVB 5FLXU 2Z30B 5HQLA 3OW2R 4IYQA 4K8RA 1KONA 3BGUA 5E2QA 5KFQA 1BHNA 1FI4A 5D4LA 2XSJB 5U47A 2KRBA 4I68A 4DL2A 4PPDA 1U2CA 1Q1KA 1LK7A 1UFWA 1S1TB 4RU2A 3HHEA 3PIPQ 4HI2A 3QLHA 5HAOA 1RAOA 2KZZA 1PAUB 3HD1A 2FZCB 3G8SA 3SBMA 1EKSA 2HZCA 3L95X 1KOHA 2XLKA 1X9MA 3G4SS 1Y3JA 2P5VA 4DUYJ 3FNNA 3L4BC 3KJVB 1SVDA 2DNKA 5KG5A 3KK3A 1HI8A 4CLWA 5KOWA 1F0XA 2FJBB 3WC2A 2C42A 1EP4A 3W60A 1SJRA 4DLGA 3Q8RB 2HHUA 2MQQA 2ABYA 5T41A 4WYLA 1UP1A 4RW7A 5B09A 3OTBA 4Y0FA 1GQEA 2VJUA 2DITA 4KH0B 3VF0B 4ID5B 1KHWA 4ZCMA 4PRFA 2EFPA 3WHIA 1UVMA 1D9DA 2C3MA 5E3PA 1H7WA 4BWJA 5HROB 2HGLA 2XLJA 2MHEA 1BQMA 1FKPB 2DXEA 1H74A 4LFBJ 4EWTA 4BS2A 5JUMA 2DD8S 3GIMA 4AL5A 1HIYA 3EYZA 1UJ4A 4DR3F 4B9TA 2XS5A 4ED8A 2E7XA 2B8QA 4M5KA 3O44A 2AIRB 1HBNA 4PR6A 3V4IA 2M7SA 3SSQA 1PYTA 2W7AA 5LXYA 1AT1B 1LWEB 2H5JB 4NXMJ 4JI7F 2XHWA 3EE3A 4W92B 2ZDPA 2DVIA 1NSPA 1BY9A 2ACYA 2HMIA 2W4PA 3MWBA 4QWEA 3OR1B 3DXBA 3HKWA 3VR1A 2AW0A 2J7WA 5ETSA 2CPEA 2OEJA 4WFAQ 4N76A 5F9NA 5I4MA 1H3DA 3QBCA 2W2QP 2KO1A 3EGZA 2HVZA 3E2EA 1JLQA 5IC4B 3ZTSA 4IOAQ 4NCGA 1NH8A 3M8QB 4LT6A 5HO4A 2Z0GA 3KJQB 2HRYA 1IKXB 4B9LA 5M2UA 5DQHA 4X64J 2RVJA 3DCAA 2J8SA 3Q8QB 1F6TA 2KYXA 5J2PB 1FD2A 2KXHA 1MWZA 1JXVA 3OFEA 2RHQB 4MYTA 1U6FA 2XLIA 1TL3B 3EVMA 1PAEX 2PA8D 1LW0A 3JQJA 2JRSA 4I67A 2LKZA 4DUYF 1N5TA 4OJ1A 1ELOA 4PYAA 1PJ7A 2DNOA 1HYSA 2OTLS 4DUZJ 1GFWB 4FDFA 1L3KA 1RYRA 1WKJA 4KPCA 4HH0A 4J37A 2FVSA 2JVRA 1T05A 1NSAA 4NZ6A 1WHWA 1K1QA 3DDNA 2GJFA 3PDNA 3CT9A 4DQPA 4MK9A 2AEFA 4O0NA 2BABA 3L3CA 4ICLA 3A3PB 4ECZA 3M4XA 2ZH3A 4OJ3A 4Y2AA 1OPIA 3CJRA 1ZAWA 1NEEA 2LYVA 3IBWA 1RKIA 4MFBA 2RILA 2FJEB 2V63A 4DR2J 3SFUA 5IT0A 2HQFA 2WVDA 2XG8A 3LGNA 1KLMA 2HRUA 4NL5A 3KLGA 4FBUA 2MKHA 3HD2A 3M05A 4DX7A 3TUJC 3PR4A 4HKQA 4KE5A 2GJIA 4B3MF 1S9GB 4OX8A 4NXMF 2RIJA 1JXEA 3QJLA 2BJ7A 2DNGA 4P74A 3MMCB 1YITS 2M4MA 3CEDA 1GXTA 1T9TA 1Y4ZB 2PE8A 2PFFB 1Q82T 2BQRA 1EETA 1WHYA 3HKZD 2YNHB 2GQCA 1UJ6A 2WCXA 4DDFA 2M5YA 1RK8A 2HFUA 4DEZA 2LQJA 3IBFB 4ZVFA 2DIVA 3AJ2A 5CHCB 3M8PB 4NCAA 2E44A 2CNKB 3OJSA 3PNIA 3SQGB 1C0UB 1BQNA 3BN7A 3RR8A 3HSGA 2QJ3A 2W01A 4LSZB 2EFGA 3AHPA 2GMHA 3N01A 2F5GA 2L08A 2ZM6J 3MMBB 3CC7S 5ETRA 1TKTA 1RTHB 1VLYA 3KHGA 2DYAA 1J5OA 4IR9A 5THWA 5DLGA 1RWNB 4OIXA 4TQRA 1SI9A 4LF6J 3IRWP 1Q79A 4C98A 4Q2MA 4NASA 1FNXH 4YQWA 1RT3B 3POTA 4UZBA 2GVDA 4DUZF 4LRDA 3PRBA 3BF4A 1HI0P 3LP1B 2I8EA 1FX4A 1SL0A 2AGOA 3BBBA 2NCKL 3OL8A 1GH8A 1RTIB 1X7VA 2WSFC 2YVSA 3ILJA 4X2BA 5ETMA 3GIIA 4ANDA 1FD8A 2AWZA 3DRPA 4WP3A 2CVIA 1S48A 2VQFJ 5KTQA 4WXWA 2V8GA 2RHSB 3IG1A 4M5JA 4YB6A 2DK2A 3TA1A 3C15A 4WFXA 1X60A 3N6LA 1LWCB 4DHVA 2YTCA 2ROGA 3KNGA 4CH1A 1XMOJ 3G6XA 1RXOB 4KQZA 4C9DA 5HQMA 2H1YA 1RT5B 2LXFA 2YPZA 1IJFB 3R6LB 5F3ZA 3C3LA 1VR6A 2XO6A 1PYSB 4DS4A 4OZJA 4GO5X 2E1MC 2KB2A 1HNWF 1JLAB 4ED1A 4QQBA 2ZITA 1HHTP 1YJTA 3O2IA 2FHKA 4RBTA 4JI3J 5B0DA 2VFSA 2VH7A 3CC2S 2VFVA 1VK8A 2BBEA 1HBUB 1Y5IB 1DHMA 5BYSA 3EGNA 2XSJA 1NHKL 3CC4S 2DH8A 4Q43A 3NOGA 1UW9A 1CEZA 2CPDA 3SYZA 2BJEA 2ZH4A 4KFBB 2LCWA 5ETNA 2YKOA 2DHSA 1H6KX 3GMGA 1RYSA 4MIBA 1IR1A 5RUBA 3J80U 1HLWA 4ZIVA 4MKAA 5K20B 2EEYA 2DHHA 3GILA 4FS2A 3NMAA 3BQ2A 2IY5B 3HPOA 2YBVA 1R8PA 3ZZZA 3FQKA 4B3TJ 2I38A 4USJC 2YY3A 3KJVA 5E3CA 3JQKA 2IYIA 4JV2A 1IR0A 2FHOB 3PYEA 2J6TA 2VG5A 1FFWB 2MXYA 4ZVUB 2OGUA 2NYIA 1XR5A 5IT4A 2M2BA 2AJ0A 3NCQA 2W25A 2WOMB 5HMWA 2KFZA 2V5HG 1F5CA 2N3LA 4DXLA 3DM2A 4TY8B 2ZHAA 1Q4RA 2YX1A 3FBFA 1H73A 4X4QA 2FQQB 4ZVTB 3D67A 3LQVA 5GAEI 2C3PA 1GMVA 5HROA 4OZNA 3Q83A 1VQ6S 2KI2A 1JQGA 2VQFF 1U8WA 5ETKA 1DJ0A 3LTOA 1DZ5A 1QTNB 2W7OA 3K5NA 2UXBJ 3SEOA 4ELVA 3ENVA 3CDBA 4C8ZA 4NYOA 5ADZA 4O23A 1XMOF 2RRBA 1B0VA 2G0IA 3KMQA 1FDAA 5IV4A 3NS5A 3NBPA 1HWUA 1Q53A 1LWEA 2GZOA 4EK2A 2CQIA 1RADB 2B7CB 3JSMA 1N54B 2J9DE 3MM5A 3ILIA 1HNZF 5F8HA 3B4MA 2FVCA 1R8CA 3KDOA 4GC6A 2B5JB 3G6VA 4DV3F 4K4XA 3L9ZA 4X4TA 1DAXA 2NUHA 1WEXA 5CD4H 1FT8A 1GMWA 2FVQA 3K5OA 3KK2B 3VAJA 2BRKA 3NWGA 3CCQS 1YBTA 2CDQA 4OHXA 2HWTA 1U45A 3P5BP 1XQIA 1Q81T 3TAPA 3GG0A 4FYDA 4MH8A 4LRFA 2QLXA 2AJ1A 2D74B 3VQSA 3IM8A 1TL3A 3MD3A 4LSLB 5KOXA 2Z4PA 4DQQA 1HI1A 3NG8A 4B3TF 2E1CA 3J81Y 4O3RA 2GO8A 4G1IA 1NHVA 4ETZA 1TVRB 3PG9A 3RW7A 4YUDA 1KVKA 1LW2A 3PW2A 3SDEA 4DQRA 4DPOA 3BGOP 2X1BA 1IKYB 3CMAS 4ECUA 2ALZA 3NRBA 2CNLB 2IVMA 1N34J 2K8GA 4QW8A 5KFOA 2XSFA 1SJ3P 4RBUA 1O51A 4FZVA 2BX6A 2HAFA 1DTTA 2FVRA 1P1LA 4OHVA 2QLFB 2ZOFA 1C2PA 1Z2LA 4OYZA 1TR0A 4RUBA 1L3SA 3BB5A 4QYZJ 2WB1D 4P73A 1Q7LB 1SIWB 3W64A 1RT6A 4M5HA 2YKNB 3OPKA 2D69A 1RAAB 2KXNB 4M5NA 2I2YA 3W7BA 5KAKA 3FEXB 4ECQA 1XNQJ 2BYCA 4DR6F 1NSKL 3J7Z5 3N0VA 3RUBL 1DQ9A 3NS7B 5FJ4A 2OPSA 1P6TA 4RW9A 2C2MB 3NWRA 5LMUJ 2ZC4A 3ZTQA 4DR4J 4RUHA 2QRRA 3KG1A 2Y8YA 1S6OA 3PR5B 2VBZA 3LH2S 1UPPA 3MD1A 4NI2B 3HZEA 1BC6A 3GV5B 4TU9A 1W26A 3M8PA 1RAGB 1NH7A 2H4WB 4ZLJA 1C0UA 3SCLE 3GLJA 4JP8A 1U1MA 4CQ1A 3MEDA 3RB6A 1R27B 1RU2A 1K47A 3DRSA 2ZZMA 1RABB 3EWGA 3MMBA 1FTCA 1RTHA 3RZAA 2EWHA 2KVQE 3DFEA 3DLGB 1SKUB 4WCEQ 2F3JA 4Y34A 3KLIA 4CP5A 3KNAA 3FFIB 4F2SA 2K3IA 2UXCJ 5AXNA 4X62F 4ZLPA 1X5PA 1TTHB 1CJTA 1NZ8A 3QT8A 1N32J 4NWBA 3HFKA 4BWMA 1YG0A 3OHBA 3THTA 3NGTA 3QGGA 2IVYA 4PG8A 2ZUGA 1RTIA 5L39A 2BVZA 2OH2A 2XCAA 2AMCB 1XMQJ 2MZRA 3X1LB 2BJ9A 3MPVA 3MAAA 5KFUA 5IC6B 1WG5A 4OYXA 4P75A 1NPRA 2V2VA 2VBYA 5H9FK 2NREA 1Y5LB 4F4AA 3CWJA 4ZHRA 5CH7B 2VONA 1RBAA 5E5NA 1RT5A 2HS3A 2CPFA 2ROEA 5L1JA 3IO1A 2AEJA 2E1PA 2HQDA 2LECA 3D68A 1NDPA 4F04B 2VG7A 1XNQF 4M63A 2ZH8A 2AYEA 1HBUA 3MR2A 4UF4A 5G4DA 2QL5B 3GG1A 5DZ6A 2VUGA 3WX4A 3PHTA 4RUCA 3PIOQ 2AKWB 5LMUF 4RW8B 5CAAA 3G82A 1L3VA 1JB0C 4UOCA 3VWSA 1OY6A 4KFBA 4L74A 3TR5A 3I96A 2DH7A 1D09B 1NZAA 3TJAA 4N8OA 2U2FA 1WF1A 3QAUA 4W4MA 1H38A 4RNFA 3V6HA 1FXRA 4LF2A 2DH9A 1C4CA 4L73A 4ATNA 1SJQA 4FYWB 2NXCA 1M1GA 1BXNA 2MLZA 5SZTA 3D6TB 2IM2A 3KJNB 1CULB 3CMQA 3E01A 3HJVA 4P2SA 5DG9A 1T02A 3BV8A 1CLFA 3JSRA 4B9MA 4KBIA 3TANA 3BJYA 2W9AA 1OO0B 3LO3A 4ZVOB 2UXCF 1N5YA 1VMBA 5ETQA 4X4RA 4O44B 2N7CA 3EPGA 2QA1A 2CA9A 1N32F 2YQ1A 1B3TA 4NLVA 4JI1F 3KYLA 2W2NP 1UVNA 5LXRA 2QLJB 3Q22A 5AJ3F 3TEGA 3SQOP 3UWTA 1F60B 1D8ZA 2PIIA 1VJWA 4LUBA 1UCNA 4N7TA 1X9WA 1SUQB 5KFZA 1XMQF 2HNZA 4PG5A 3ILOA 3LGMA 1MMNA 2KXFA 5F41A 4C6AA 2BKNA 3CW2C 4N47A 3H42A 1N6QA 2DNMA 5H1SV 1H72C 4DQIA 2WZ1A 2I9SA 3GPAA 4QCLA 4ZJQA 1DQAA 2UVUA 2LP4A 2MKJA 5DG7A 1IKWA 1YSJA 3F56A 4AYBD 2KM8B 3M6UA 2QFIA 3BS9A 3N6NA 3JTPA 3P4UB 4KJIA 2E7WA 2LDIA 3MFIA 3TI0A 1NUEA 4ZPDA 4DR1J 3PYDA 2EI5A 1HNIB 5D3GB 5EUHA 1T11A 4YDXA 4AQYF 4C8LA 5AE3A 2B5JA 2ZNYA 5G0RB 3K7RA 4LRBA 5IT9U 1M0SA 1VQOS 1F5BA 3PZPA 3G9CA 4DJBA 2MKYA 3FC9A 2VG6B 1YK9A 4C8YA 2IMOA 4J9NA 3IR7B 5I3UB 2YQ0A 3GYXB 3LF0A 2J76E 4J9RA 2XB2D 5AE2A 5J1PA 4CI0B 1YJ9S 1S10A 2PMZD 2QE5A 1YGYA 4LSLA 1N88A 2N3OA 1SJ4P 4MK8A 4XDCA 4V19X 3ZTPA 2WONA 3J7AN 4EO8A 4FPIA 5GMEA 4WFYA 1JIHA 1TVRA 4LR9A 4N77A 1A9NB 4L3KA 3I5AA 1SB6A 1PJ6A 2RDJA 2Y3YA 2BOAA 1QUPA 4FNHA 4UOHA 1GXUA 4RR5A 3U1LA 2BMBA 4EBEA 3OR2B 3MPDA 4LIRA 4CWBA 2QEXS 1RT2B 3CUNA 4KGZB 2R7RA 3FKBA 3KJFB 4A8QA 4AFFA 1FRMA 2HVIA 4ZA1A 3MEGA 3ISNC 4PPZA 4WZQA 1V3SA 4DPYA 3RJMB 4JI8J 4FXVA 2PFDA 3CCJS 2GMLA 3DOKA 4ZCLA 1SQFA 3J7ZT 2YKNA 2GFFA 3CIMA 2DTJA 4QBUA 3QATA 2KKHA 5C2GA 2OFHX 3D1OA 4LF4J 1MMDA 2MMYA 2CPXA 2EVZA 1SH3A 5A0YB 2FJWA 4O4GA 4ECRA 2I5JB 3CJKA 5A76A 1R6VA 3CDUA 2BKOA 5KFFA 4IRKA 4NLYA 4YMEA 3ZZOA 2GHWA 4EO6A 1R0CB 4KB7A 5KT5A 1H7XA 1IN0A 2YX4A 1PC5A 5BR8J 1KLNA 3MAQA 1YX2A 3GFXA 4IRDA 1P1TA 3FZBA 2HBRB 2NXNA 3WDOA 3T5LA 1VK3A 5HP1B 3QFHA 3HT0A 1VGYA 3R9LA 3Q8YA 5KFGA 5LJ5Y 2VD3A 2G0CA 1S4EA 3TOQA 5K8MA 3UNGC 3PY8A 1K1SA 1AUSL 2V34A 4USVA 3Q8UA 3I87A 3DLGA 4H4OB 1QAXA 3CE8A 3TWZA 1XC9A 4URQU 1WI8A 3UNYA 2CUYA 4FS1A 2P2CB 2C3UA 2R2UA 3NGSA 1MWQA 4J9UE 3N28A 2VHGA 2JSXA 2OMOA 5EHHA 1UVLA 4RBVA 2CJXB 3CJ2A 1NJIT 3V81A 1BLUA 1OPZA 3GTYX 2A2DA 5IOLA 1C0TB 5C24B 1SXLA 4QIEA 1OJ4A 1CS4B 3PXGa 2B8PA 3NP5A 2DR9A 4GKKJ 2JL9A 2DGTA 2NXJA 1RTDA 1PILA 2ADBA 1MU2B 5IM0B 4CO5A 1WACA 3WZ0A 3UDLA 4ZVSB 4JI8F 4L3NA 1FWKA 3GJRB 2MYFA 1MN9A 2HEKA 3ET6A 2BE9B 3DLHA 3JSYA 4NA1A 4WXOA 1S49A 1NJYA 2RB7A 4OI4A 4LF4F 3DLLQ 3MM7B 5F0UA 4ZK7M 5KFPA 2AYMA 1EJ7L 4C0BA 4KH1B 3QZ7A 3AFGA 3TP2A 3W9HA 3DGPB 4J5OA 2B9WA 2RQCA 4LRAA 2CAJA 5GAEU 2F8HA 1REGX 2ILZA 2W2OP 1BQXA 3CJ0A 3H40A 4K2XA 1VJQA 2IA0A 3T6BA 4ECYA 5CYQB 3QSIA 4TYAA 3M9OB 2DRBA 2V8VA 5BR8F 1AROP 3BGFA 2M70A 3FBCA 4RJVA 3UPFA 4ZVRB 1PO6A 2FC8A 1NAQA 3UR0A 2J7KA 2K7JA 2ZOMA 4CO2A 5F8MA 7FDRA 1IXKA 3S1TA 3MCOA 4CLUA 3O5TB 4NXNF 4A8OA 1JLFB 4CLLA 2F1FA 2VDIA 4ED3A 1CULA 3AXKA 4TN2A 1G2EA 3G6ES 3HHKA 4YY3F 2QO3A 2K7KA 2VV5A 1RE1B 3GYNA 2L3MA 2UVWA 2E5LJ 4OYWA 5IV3A 3RAQA 2JJ4D 3G86A 3VAMA 2RQMA 1RP5A 3HLUA 4ILLA 1B64A 2HHHF 1YJ7A 2AP6A 2HRTA 2VC1A 1FNMA 2HNYB 3D4JA 1SUQA 2DT9A 3WC0A 4ID8A 2QFJA 2B4OA 2FGCA 1FJCA 1VQ4S 3FEZA 1SV5B 2QYGA 2JLFA 4FXDA 5L8RC 2J0WA 1GK8A 5LMNJ 3H90A 5M2PA 1D0EA 4K4YA 1CBKA 4R5PA 2KTQA 5CABA 3MPYA 3B6BA 2WW4A 3T19A 2CPZA 2Y8WA 1JJ4A 2ZZTA 5C5JA 3ZZYA 4FP9A 4ED6A 1IWAA 2MQLA 4XK8C 1HNIA 3I4HX 2CQGA 5D3GA 5EX0A 1RA7A 4ZDNA 4QR2A 2DNNA 1FJEB 2EW9A 2CRLA 1ZAVA 3VAHA 2EBEA 1FA0A 1PCAA 5G0RA 3TQ1A 2I1RA 1GX6A 5AT1B 4K7QA 2V2ZA 3M9MB 1OY8A 3V4MA 3M7VA 4KHMA 1XMBA 1KQFB 2OSRA 4OV1A 8AT1B 2ASLA 2VZ9A 5I3UA 3BEGB 1NB2A 1RWVB 2LQ8A 2DISA 1JLGB 5C42A 1UEVA 1KVIA 4X4OA 4OMFG 3LAKA 4N8NA 2JOQA 2P6SA 4HTIA 2J8AA 3MPUB 2YH1A 3A12A 2O1PA 1ZM4A 2ZDOA 2M52A 1RHJB 3M1VA 2C2EA 3ZTRA 3GIJA 4IH7A 2CJAA 1HW8A 2V4JB 3T1AA 2HYIB 2GCFA 1OY9A 2HVEA 3TVYA 2KM8C 1U49A 3G2XA 2MGZB 2BA9A 4NOHA 4F02A 2L9DA 5GAGU 2ZH2A 4GVLA 2E5LF 4PG4A 4ENOA 4UUWA 3KG4A 4ZJOA 4Q0BB 3GCXP 1KVJA 1CJUB 1TK0A 8ATCB 2AYBA 4QIFA 1TK8A 1UVJA 3QRRA 4ITSA 3F0NA 4DV5J 1MG7A 2W4DA 4ZOSA 4NMXA 4RNMA 4K4WA 4BC9A 1FWLA 3LAMA 2BE2B 4M5IA 3ZZPA 3UD5A 3IXQA 3QGHA 1KKHA 1TL7B 4DZDA 2A1BA 4LVNP 3H5XA 5HBMB 2LQBA 5FDLA 5CYMB 3GCWP 1AFIA 1RA6A 2QMUB 3FCVA 3HHLD 1WKKA 5C2CA 1PSDA 5L46A 1U0HB 5J2QB 2DIUA 2HVHA 2VDHA 3IWXA 2XC9A 4LRCA 3OXFA 1FEHA 4G1PA 2VPYB 4KPYA 3ETMA 4LQ9A 2HGNA 1H2TZ 2RE1A 4IG3B 4PG6A 2ILYA 2FPHX 4S0MA 3R7BB 5KFRA 2MKIA 2A2CA 3WBZA 3DMJB 1SH0A 1UFLA 4CCHA 3HVAA 3EM1A 4DLEA 1IBCB 1WF2A 1T3OA 1S7IA 3GSDA 3AT1B 3RB0A 3Q2SC 1S1WB 1P8GA 3T5HA 3W2VB 2YWKA 1N48A 3GYGA 1WTBA 4CYUA 2E1AA 3ZC4A 4DL4A 2O5DA 3GP9A 1W7WA 1M1HA 5HVGA 4H4OA 5H9EK 4L72B 4FVMA 1REVA 1KQSR 2CXEA 2J5AA 2UZAA 2XULA 1CC7A 2D41A 4BBYA 3LW5C 4LR7A 2AEMA 1NK8A 2QV6A 3D0GE 2GMJA 1Y0HA 2DO0A 2MZJA 2XMKA 4J9SA 2C2DA 4ZPAA 2W2PP 1T9VA 2CPHA 1VIXA 4C8MA 5IQ6A 3C6TA 1K8AT 3QJPA 2B3TB 3TUZC 2PMHA 3N5BA 3OTEA 4I6YA 2D7SA 1NK4A 1YQHA 4GVBA 5DETA 5E3AA 1C0TA 3QT7A 3VAIA 3HO1A 3AXMA 1KWMA 1HARA 2AD9A 2R7VA 2XYPB 2LEBA 3VZHA 4FYVB 4M94A 1SIZA 2XGPA 3ISZA 3J81U 5IM0A 5A2QY 3QLHB 4E8UA 2FD2A 1R7IA 4LREA 3W3SA 3I0RA 3KLHB 5D4OA 3D6FB 4U9RA 4P52A 3L7OA 1RQ0A 3NL0A 5D8HB 5AXKA 2XY6A 5D78A 2H51B 1YRXA 2W9BB 3DGPA 4F0HA 1RHMB 2OP5A 4O0IA 3VAGA 3KK3B 4F0MA 4RKUC 4MIAA 4PWWA 2EK6A 2GAHC 3CNQP 2OSQA 2XQCA 1EP4B 1S1UA 3JYTA 3SCIE 1MROA 4LSNB 2PN6A 3G87A 3KXDA 3R3TA 3PRVA 2Y0BB 1NRKA 4RW7B 3CO0P 4B3RJ 2HK3A 3T41A 1WTFA 4Q45A 1HBMA 3M6WA 4DL0C 2F4VF 2G0JA 4JUZA 4TU8A 2HHSA 1RDRA 4CDIA 3HFZB 2HS0A 2AJ4A 1N4LA 2R4FA 2V2QA 3RTVA 1FE4A 2XMJA 2Y0SD 3CULA 4PWDB 4RUAA 3EMTA 4GMKA 1S97A 4R25A 4A4JA 5GMKa 2DEIA 4ZPBA 4AXIA 3CGIA 2MZSA 3TEHB 3PACA 3V6KA 4USIA 2Y9HA 3RGIA 4ELTA 2O67A 3GFHA 3F73A 4X65J 3IGVA 1Y9OA 4ER8A 1LXNA 4JYAF 3KUGA 3HJFA 2CQHA 4EU0A 4IOCQ 2A6MA 5DDPC 2CQBA 2E1RA 2JLGA 2HNYA 3CCES 3DLEB 1OSCA 5DO2A 1RWPB 2E66A 2FJVA 2KYZA 3MM9B 1JLQB 4U8YA 4RL1A 3E3XA 1LXJA 2GIRA 1YKWA 4Q2LA 2IAJB 2J0XA 3N5FA 1OIAA 1OQ3A 4MKYA 1S0VA 1D8YA 1S99A 4JI6J 5KG2A 4WF9Q 1X31C 1T7PA 1ROFA 4X4PA 2KDOA 3I9ZA 1UA0A 3AQPA 1SKSA 3TZWA 1XERA 4WJBA 3P8BB 1HR0J 4LF5F 2DR7A 4P6QA 2OEMA 4U8VA 1LW0B 2ZWOA 2HWHA 1NK0A 4PZVA 3RRKA 4O3SA 1URRA 1X5SA 1NO8A 4YN3B 4D3GA 2HZAA 1ACMB 4ILMA 2WW8A 4IFYB 4Q5VA 1Q86T 2AV5A 2J0QD 4UQTA 1KP6A 3OXGA 1H98A 3PV8A 1WI6A 1XNRJ 2JEJA 4NLRA 4EFAC 3IRXA 1PIEA 1Q5YA 4EZ9A 2VASA 4R8UA 2JFKA 1T05B 4B3RF 2UU9F 2MZQA 5ETLA 2H54B 1FERA 5IXUA 4FN5A 3GFZA 1FFGB 1TL1B 4ICLB 1RWKB 4F4XA 2LMIA 1RWXB 2ZZNA 2MY8A 4HL9A 1FF2A 3WIVA 1MW7A 1GX5A 4DV2F 2R3VA 4DN9A 1KLMB 1RACB 2MGZA 3DU5A 3KLGB 4EYHB 2JEIA 2VJVA 2FUG9 5JVHQ 1HNVA 2CZ9A 2HLUA 4G1QA 2IFXA 3BSNA 2VFUA 1F3FA 3K5PA 4X65F 4HACA 1Y3KA 3SZ2A 1ZTWA 3M32A 1JJHA 5JVGQ 4V1Ak 2HPUA 1QTMA 3HHLA 2R7QA 1URNA 4H54A 3P3DA 6AT1B 2E9TA 5GVQA 2QTWA 5CZVA 5E33A 2VU5A 3MCMA 1SJFA 5I42B 4HH1A 3I55S 5CA5A 5LSLA 5E0OA 1UVIA 5KFAA 3CDAA 4K4VA 2ZHBA 1N33J 1QM9A 1BQNB 1XJWB 4F4YA 4Y2CA 2RU9A 1TL7A 1U1NA 4LF9J 2DNHA 4P7TA 5L1LA 5HBMA 5CYMA 4CO1A 4JI6F 2E5HA 1TKTB 2M0GB 3THPA 1FESA 3CCVS 1HPZA 2YKMB 4I7FB 2QT7A 3U7JA 1S0OA 1AFJA 1R89A 2GIQA 1ZOTA 4ELUA 1HR0F 3AOBA 3U02A 3IR5B 5KFYA 4B3OA 1HBOB 3POTB 3DMJA 2PD1A 3DOLA 2H5IB 2V9KA 2GVDB 3H98A 4OYIA 1YHQS 5A8WA 5CZXA 3TYTA 3OLAA 2ASJA 4P2FA 2B0GA 1N8RT 1ZTTA 2VFRA 2NPIA 2R2RA 1I3OB 3O8WA 3RR7A 4PXDA 1XNRF 2AQ4A 1YVFA 4PKDB 2E9RX 4K50A 5EX3A 3C15B 3K5MA 3W61A 3FDSA 5HL7Q 1U1PA 1FX2A 1WG1A 3RAMA 2PEBA 4ZVPB 4FYXB 2W8LA 1RAIB 5HN0A 1VIOA 3ZZ0A 3KG0A 2BRLA 4UTGA 1VOMA 1DQ8A 4C0OC 1UWAA 4USMA 3MM8A 4PABA 2BJ8A 2GHPA 3B82A 4JB8B 2QA2A 3M2VA 1RT7B 3RG6A 4YS2A 3D0HE 1N36F 4X4UA 2W9CB 4G65A 3RBXA 2RF2A 1QSSA 2J9CA 3KUHA 2YNFA 3R7SB 4DI6A 1DFDA 2BQ3A 3NKYA 3NCRA 3AA8A 3DU6A 4WFBQ 4I69A 4DU8A 2N4CA 2OHDA 3TW0A 1VQMS 2XYHB 1F9HA 1UWBA 3SSRA 4DN0A 3KLHA 3QWPA 2XS7A 3I4PA 1N33F 2R8JA 3KWMA 1EQMA 1YJRA 1FXLA 4QOTA 4ZMMA 3GE9A 4EI2A 2ERRA 3Q8PB 2W9BA 2RH3A 3GIRA 4OZ3A 1H0HB 3O6QA 2UV8G 5KFXA 4I6WA 1NXIA 4J9QA 3BH6B 1S1XA 2VG5B 1X5OA 2RNEA 4LSNA 1V3RA 2Q6BA 1LQ9A 4DSKA 3P5TL 5LM7E 1X4BA 1SKRA 2IJFA 3DM2B 3IP0A 2RQ4A 2B6AB 3C8YA 2WVFA 3T1YJ 4KRWA 3G96A 3X3UA 4RW6A 2H48B 1KTVA 4WPAA 4ANEA 3BQ1A 2FGOA 4KT0C 1S6UA 3IAS9 3UI3A 2RS2A 4PWDA 5AXLA 4KC5A 3KLEA 2QMWA 4OHYA 4C4WA 1WORA 5DGBA 4DOZA 3I9V9 4NE9C 1FRIA 3OSPA 3K0JA 3H5SA 2IA6A 4A8SA 1NBEB 2Q1LA 3ZZUA 3NBPB 1A6LA 4USWA 1X4FA 4DQSA 1UPMB 4QPXA 2JEGA 3UQSA 4LFAJ 2CQ3A 3DRYA 5I3PA 3JSMB 1XWLA 3MM5B 2DHAA 1WKLA 1K0VA 3SMZA 3W2WB 1MNEA 1RTJA 2ZBPA 4I0WA 3K58A 3DLEA 4USUA 2VICA 2HFVA 1ZH5A 2EK1A 1QY7A 4WTOB 2QZ8A 3MM9A 4Y2MA 2IAJA 4QPTA 3NGDA 3K57A 2OPRB 1VDHA 4U96A 5KFJA 1FHTA 5KFMA 2DKOB 3FRYA 2FVPA 2IHR1 2OO4A 1RISA 4K4ZA 4BC7A 3CCSS 3THVA 2H65B 2UUAJ 4DFKA 4RW4A 4MAKA 3QO9A 2XS2A 4GRSA 4DUTA 3OTCA 4KKOA 2NXEA 1WOPA 1IM4A 4FF2A 1T9WA 4IFYA 1LW2B 2WRMA 3SDEB 1GAOA 3NXZA 1EKRA 2R2TA 3BPSP 1M5KC 4JI5J 2MEWA 2RT3A 3CXCR 4XPEA 2NUUG 4YOEA 2YX7A 1S6QB 3Q23A 1VQLS 3MAHA 5KG4A 1DTTB 5HVHA 1N5VA 2GJ2A 1G3OA 3DXSX 2UV8A 1UJ5A 4OX7A 3VQTA 1TL1A 3EZUA 3D54A 3I32A 2WVCA 2RQKA 3QWUA 1RT6B 3WQPA 5LL6d 4MT1A 1VQYA 4LFBF 3FCWA 4IG0A 2IDEA 1KQGB 2B4VA 5J2NA 2GW8A 3AD9C 5D15A 3K8VA 1KTQA 4IDKB 3TA2A 2DNPA 5AE1A 2VA2A 4X4NA 4WIQA 3BKTA 3VV2B 1TK5A 3IGNA 2OPSB 1O8BA 4RW9B 2H4YB 4LFAF 4M5DA 1IUJA 2DY9A 4QWCA 3BR8A 4NEYA 5ETOA 5HI7A 1YBUA 2XEXA 2OFGX 2DGWA 3KLVA 4C8OA 3R5JB 1RUSA 1KR4A 3A8JA 4ETXA 4PXBA 2VC0A 5I42A 1FRXA 1YLXA 4HVZA 4C2MA 5HANA 1IQZA 4J9MA 4HYKA 4QYRA 2A10A 5CYJA 1F9FA 2OD6A 1VRTB 3ULHA 5EGYA 1BGXT 2LEPA 2Y1LB 2IM0A 3MEDB 2XZTB 2ZH1A 4OYAA 2KVIA 3DRSB 1RWWB 1CJVB 1XK8A 4F36A 1EIYB 1B70B 1X4CA 1Q0NA 4X64F 2D1CA 4KAIA 2MDAA 4FBTA 3TZYA 5J1EB 2YKMA 4I7FA 4ES3A 2XTJP 4CH0S 4M5LA 3PJWA 3DLBA 1FCAA 3TJ9A 3KLIB 1TUWA 2B51A 3D6HB 1HBOA 4NLXA 5L9XA 1CJTB 3AH6A 4NYPA 3BDEA 3W62A 2VOPA 4OYOA 4KYZA 2GA7A 2L48A 2AZ1A 5DQGA 4PAAA 4QIWD 4JI5F 3OD2A 4DSFA 1O6XA 3H59A 4CO0A 1G7CB 2F9DA 4DV0J 3M8SA 3D9BA 2CQDA 3MAAB 1KOOA 1U1OA 2PI4A 4P2MA 1FVQA 1Z4UA 3F41A 3ZNUA 3GU0A 5CXTA 1TKZA 4XDDA 2Z2ZA 2QN6B 2G2OA 3D5MA 4ZHRB 1S59A 2BANA 2CJYB 2M8DB 2OUGA 2JLEA 2VBWA 3S8SA 5CD4A 4NZ7A 5H9FJ 3QGPA 4WZMA 4DR2F 1RT7A 4QIVA 2VG7B 3IAM9 2W9CA 2F40A 2Z58B 2MJUA 3TNVA 2R42A 4DFJA 3RBEA 3NMRA 2EFOA 3FRZA 2Q43A 4UY85 1C1BA 4XPCA 2FIUA 2QA4G 3CPWR 3QIDA 1TKXB 3G82B 1AXQA 3S6EA 1U1KA 1FJGJ 2DR6A 2VKZG 4WK3A 2EG1A 1SQEA 5BXIA 2YKAA 2GAGC 1L3TA 3ITHA 1X9SA 2YNIA 4DG1B 4RPFA 3T5JA 2PMWA 5CQGA 1MLAA 5A6PA 3M8WA 3VALA 3S01A 5LSOA 3WX8A 2C22A 1FTRA 2EKNA 4UUXA 3BN4A 3P96A 3W9JA 2IYGA 4AE5A 2NPFA 3E01B 2ZM6F 1M1KT 3H2LA 1ZBTA 1VQKS 2ZEJA 3D6MB 3HSJA 3FMWA 4IOBA 5DLFA 3UE2A 2CPIA 2N4DA 2ZJQQ 4LF6F 3UN2A 2ATLA 1N5YB 3QSYB 3MXHP 3A13A 2XI2A 4FPRA 4YB7A 2B6AA 4OL8A 4DL6A 2JZ5A 2HK2A 4PUOA 2GVZA 1X8DA 5HK4A 1SC4B 2K1RA 1WC6A 2XNRA 1JLEB 1KFSA 3BGLA 4HHJA 4DV0F 2CQ4A 2HNZB 1C4AA 4PXCA 2OPQB 1YJUA 1P9QC 4Z7CA 5B7WA 1N6QB 3PX0A 3DRRA 3DKDA 2LLZA 2KG0A 2CG8A 3PEHA 1NJWA 4DPUA 1Q78A 1MWYA 3HVRA 2V0NA 3R6GB 3OFGA 3VVTA 2FLLA 1AB8A 1IKWB 2GQ2A 1YJNS 2VIHA 4JV0A 3MMAB 1PJ5A 1FNOA 5KFEA 5KFDA 3MM6B 2PO4A 2B4PA 1B7FA 3EPIA 4OI0A 3G8TA 3GJSB 1UW4A 2JDJA 4JI3F 3W2WA 4GKJJ 2ZH9A 3TAMB 5DDRC 4DPTA 2AZ3A 3B4DA 4YEAA 3CD0A 4CZCA 2EC2A 1LWFB 2X1AA 1FEEA 2GO9A 1WSVA 7AT1B 2FC9A 1K0TA 5KFCA 2XMMA 1FJGF 1T9XA 2HG4A 3M6XA 1PGZA 1VQ5S 5KFLA 2OPRA 4URGA 3UDVA 3C46A 1Q8BA 3LWLA 4C48A 2DRDA 3R5GA 2GV1A 2RJZA 3FVYA 4A8KA 1WC1A 2UXDJ 1U09A 4DS5A 4B9UA 1U26A 2WONB 1R8BA 3OFHA 2XNQA 4P72A 2IC3A 1DLOA 4J9OA 4OJHA 3C6UA 5A2QU 4CLFA 4DV4J 1ZAXA 3K5LA 4NRTA 2Z2MA 3NNAA 3N79A 2LVWA 4CLPA 4P71A 3PEJA 2ADCA 4FKXA 3HVTA 2MQ8A 3N9UC 3VCDA 4HT7A 3SXLA 1S6QA 4HDHA 2GX8A 4QW9A 2B9EA 1WG4A 4RLEA 4I6AA 4JV5J 3L7UA 2DGXA 2YH0A 3SCKE 3MEGB 4PG7A 1HWIA 1H2UX 3CCMS 2VQEJ 2G2ZA 2ZOGA 3DOKB 3Q89A 5DRKA 1F2GA 5HQ8A 2UUCJ 1YDLA 3PKMA 4WU3A 2WBRA 2UXBF 4OX6A 4F2RA 3HVWA 4A8YA 3TRGA 3BKFA 2BJ1A 3PFOA 4IDKA 1RKJA 1WJ9A 3CCTA 4OYBA 2NZ4A 3MZIA 3BO2A 4O4GB 2BEFA 3CJKB 4I2PA 1QVFR 4AL7A 4F4ZA 5DQIA 2OPPB 3QPIA 4N5SA 4CIOA 4GKJF 2MLYA 1P9YA 2EXUA 2GS8A 4RNHA 2QL9B 1BWEA 2VPZB 3MTKA 5HMYA 1WC0A 4WU2A 3LPYA 2FJAB 2V4QA 1CVJA 4LBIA 3JSBA 2FTRA 1PKUA 5GAGI 1VRTA 2I6WA 4J90A 2BXJA 4Y65A 2XY7A 1Q7YT 4LFCJ 2BW7A 1L3UA 1CJVA 2ROPA 2AF6A 5J1NA 2HIQA 3HF5A 1WHVA 4IQXA 4USTA 1NKEA 2WB4A 1UL3A 1VI7A 5J1EA 3FSIA 4F3OA 4M95A 4RWXA 4PQUA 3JS9A 3OVBA 1NCLA 4KHRA 2KHCA 1ZPVA 2AJQA 1XIQA 1KFDA 4OQJA 2YNGA 1VQ7S 3MTJA 4DR3J 5B0GA 4DV4F 4FKYA 2V6AA 2H9ZA 3D1QA 4IFVA 3V81B 2M88A 1FVSA 2LA6A 1UZHA 4JI7J 4BCAA 1N34F 3HHDA 2FLOA 4ES1A 2AYGA 2L9NA 5EWGA 5K14B 1OWXA 3V2UC 1DRZA 1RTDB 1T0TV 4AXJA 3QYYA 4DX8H 4JV5F 2V8PA 3HSZA 3BYPA 3M8RA 1N0VC 3UD3P 3PKYA 1ITPA 3H5UA 2R7OA 5KT2A 2VQEF 2LDYA 2V69A 3IMQJ 3QMQA 2Z2LA 3ET6B 4Q8FA 4F0KA 3A1YG 3N4WA 3RRHA 3DDKA 2Y1IA 2UUCF 4UW2A 1WD6A 2HHPA 1NK5A 4B9SA 4UY8T 3CD6S 1IR2A 1NHUA 2JNJA 2MLXA 1S4FA 5FD1A 7FD1A 2AHOB 3D3BJ 4ED7A 4OLOA 3D2WA 1CJKB 1UVKA 5D0EA 2NYHA 4WK1A 3QRQA 1RHKB 1S9EA 3UN5A 3UVJA 2MQPA 2KG1A 2Q66A 2UVRA 3IM9A 2LEAA 2GHVC 1D9FA 1VBXA 3AJDA 2SXLA 4DR4F 5LSRA 1TKXA 4KGXB 3KTQA 3R1HA 3OVAA 3V5RA 1Q8KA 4C97A 4QR1A 4YR2A 4UOFA 1S76D 2M9KA 4ZP8A 3CDWA 4BLGA 2KFYA 3RYLA 4DG1A 5K9FA 1ZZNA 4BHQA 3PW7A 1RI7A 4J7CA 4ZP6A 1UFKA 3AB2B 2FY1A 4I56A 1VRUA 4LFCF 4ZLLA 5EWEA 3EDRB 3FSXA 3H25A 4Q7AA 2E5GA 5F3TA 1OQ6A 2J9DA 4R0EA 1U02A 3MOJB 4LR8A 4YR3A 2AU0A 1I1GA 1WNEA 2PT0A 2KJVA 2O3DA 1J27A 3OQ2A 3M2UB 2EFVA 2H5EA 1FKOB 3OLBA 1GTHA 5HVFA 1VQNS 4OZ5A 4ZJLA 4ECSA 3W8PA 2VKRA 3MPWA 2DXDA 3VAFA 2R8IA 2ASDA 4C3KA 3KHHA 2RRNA 4RO0A 4HI1A 4KV8B 3MEEA 4MJKA 4X84A 1WWHA 3U1MA 2CPYA 1S77D 2ZE2A 4B3MJ 1JLEA 3SSSA 2QA4S 2J6SA 4A8WA 2MHNA 2OPQA 4KR0B 2IJNA 5ETVA 2BV3A 1WC4A 4Q44A 3ZFVA 2Q3PA 4H4MB 1NK9A 1EQ0A 3G6YA 1AYEA 3VZIA 3MMJA 5DG8A 3MMAA 3B54A 4DV1J 4R5PB 1HL6A 2YQ3A 1YTYA 3GZ7A 3MM6A 4F67A 3LALA 1WSRA 2HURA 1TMMA 3OBIA 1KBRA 4ZS6A 3AB4B 3BSCA 3NNCA 3EXCX 2YXLA 2VPWB 3EZ5A 3DI6A 3TAMA 2ZHOA 2KT3A 3C14B 4ZIWA 4WFNQ 1SL2A 1LWFA 3BO4A 1TFWA 1R8HA 3OT9A 4OHZA 2G13A 3VGUA 1GMWD 1ICEB 3BO3A 1XR6A 1LEOA 1QSYA 4HDGA 1W2IA 5GAHU 3GB0A 3M2RA 5A8KB 2HVDA 5LT5A 5C42B 3QT5A 3Q86A 3A8EA 1F3VA 1NSQA 4NLWA 1WC3A 1RT1A 1FK9A 4U6PA 1Q5VA 1DTQA 3K8WA 4J9PA 1U48A 1NDLA 5KG0A 5KFKA 4YFUA 4WP8A 3MEKA 3UFCX 4K4UA 4KGKA 3M1VB 1PBUA 1Q16B 1LV5A 2HHVA 2RDIA 1S5ZA 1IBLJ 1KN6A 2HBZB 3H20A 3R5CA 3CO9A 2D3UA 3DGVA 1HD0A 3GV8B 2ZBIA 3FCHA 2OLWA 1H2VZ 1HNWJ 1AUDA 2HHXA 1I94J 4B9VA 4NMLA 4ZITA 4ZPCA 2DBBA 2XM3A 3KLFB 4L6V3 1M5OC 3QIPA 2B9XA 2LXUA 3PX4A 4DCPB 1Q95G 3CJ5A 5IQQA 1R43A 2PGCA 1NPKA 4OFZA 1UKUA 3BR9A 2HQ3A 4YB1P 4U7UD 3OL6A 3R97A 2G4BA 5D0HA 4IO1A 3JAMY 3OL9A 2XMUA 4AL6A 4DF8A 3A8IA 1HFEL 4USHA 5FDLB 2IM1A 4QWDA 2ZH5A 4DV1F 1RB0A 4LQ3A 2HW3A 1WHXA 1FKAF 1CG2A 2GGPA 2NSCA 1X0PA 3RAXA 1QSLA 2MZTA 2W24A 2JC1A 3W65A 4EBCA 4DR1F 4K5RA 5DM6Q 2OPPA 2FDNA 2AGPA 3CJQA 2QLBB 3OUYB 1N5QA 4F3MA 1U2FA 3FUYA 3ONQA 4EZ6A 1SCJB 3JXOA 5F8LA 2E7VA 3H4DA 1QLNA 1HHSA 4TLQA 2POKA 4ZPVR 2BZ2A 2J6UA 4K59A 3CSKA 1NJZA 3HK2A 4IRCA 1FJ7A 4C0HA 3ETOA 4CYUB 1UMJA 4P10A 2C3OA 1VS3A 2HLTA 2DO4A 1BD6A 1WUUA 3O1LA 3D66A 1REVB 5A8RB 1QDUB 4DX5A 2WSEC 1CPZA 4M5MA 2F7VA 3PCOB 2MQOA 1HQ2A 1JJ2R 3KHRA 2R9LA 1DARA 5H9EJ 1IBLF 4ECVA 4FF3A 2XZDB 5DGAA 3C6TB 4ECTA 3TZZA 3LPEA 3OFFA 3NAHA 2AJ2A 1HMVA 4C7QA 1RAFB 3CJ8A 4GVBB 5IS2A 1I94F 1HNZJ 1QD1A 5K14A 1S79A 1Z1ZA 3IN5A 1RU1A 2VB6A 3NEKA 3EICA 3BM7A 4Q8EA 5B0CA 4U7CA 2MZ1A 3IBCB 1B7YB 2RMLA 3TX8A 4DV3J 1L5UA 4CM0A 4IH5A 3I0RB 3CJSA 2F65A 1S1TA 5HSPA 1RCXB 2DY1A 3FBBA 1B99A 3H7HB 2DGQA 3HHNB 2QX0A 2DHGA 5EDWA 3TUPA 1IM6A 4CLYA 1CJKA 2OTJS 1UZDA 2GC8A 3MR7A 1G4CA 4IO9Q 4QIGA 3CD5A 2NQPA 1BE4A 1KNZA 4DWIA 3FJ2A 2P9GA 2EG2A 1S1UB 3JYTB 1MROB 2QIFA 4OI1A 3OTDA 3CCZA 4LIWA 2V50A 3BPDA 2JWNA 3PM9A 1F2HA 1S6PB 3R8YA 1HBMB 2F63A 2E5IA 2WHOA 3P45B 4NRUA 4NZ0A 1JWWA 2IRYA 1T03B 3SV4A 4ID5A 3MURP 3GSIA 1T3NA 3P49B 2DNYA 3RB4A 3H0PA 4TQSA 5GADI 5EWFA 2HBYB 3I5CA 4DL5A 3GJQB 4WE1B 2V67A 2IBOA 4U95A 2QG9B 3M2UA 4F3QA 1NJXA 3AA9A 1FKOA 1FKPA 2MJNA 2OD4A 2LXIA 4FVCA 2C2OB 1AW0A 1Q8IA 2NXUA 2ZJPQ 2YWFA 1IVZA 1D9AA 2YKQA 4DR6J 2B7BB 1KHVA 3QAEA 3TO8A 2R7SA 1GT8A 1U1QA 4KV8A 1GNKA 1G1XA 4NPOA 1LFPA 3VHQA 1TMJA 1NMEB 3V6JA 3B78A 4DSJA 3TJ8A 3DN9A 2CQ2A 1OS5A 4GKKF 3OR1A 2G1DA 5IWAJ 2HZVA 4H4MA 5HJYA 5F9LA 4XIUA 5GMDA 5I3QA 4NLTA 3CJTA 4LVOP 1SKWA 3Q0AA 1RHRB 1S72S 3M8QA 1BMQB 2PEHA 4ECWA 2ALYB 3PRDA 1IKXA 4ZVQB 2ZBQA 2BE7D 3LGHA 3PJXA 1XN9A 1HWLA 3T6JA 3AQOA 3PO5A 2XWXA 5EN1A 3CCWA 1JLBB 3NY0A 3C14A 5J2PA 3C2PA 3HT3A 2HBQB 2CQ1A 3ISND 4X62J 1IQTA 2X1FA 1ULRA 1AA1B 4ZVEA 3BQ0A 3ILLA 2PI5A 5A8KA 3IRXB 4WP9A 2DPJA 4HHHA 3N6MA 4R8UB 4ZPTR 4Y00A 4CTAB 3Q2TC 4ZLNA 4W90B 4Y6IA 2K06A 1J2VA 1CSJA 4WWSA 2XYGB 2OIHA 3W5YA 4NYZA 3MGJA 3QT6A 2CJKA 3KUEA 5B0AA 2R7WA 1A7GE 2KZMA 3CTRA 3CCLS 3EDQB 4J91A 1XEZA 2DHXA 1VC6A 4BDPA 4I4BA 1JKHB 3I31A 1YIJS 4IUFA 3FEYB 1HNVB 4KY3A 2VA3A 4G1QB 1TUGB 3K89A 3J7YU 4HACB 3H2UB 1RTZA 4NLSA 3MECB 3M32B 3KLFA 3VTIA 1RBOB 2OMLA 2OAUA 2RRAA 2DGOA 2P9CA 2KJWA 3HHLB 1RT4B 3OHAA 3ADAC 1F9EB 1S9GA 5KG6A 4KGMA 1HW9A 3MMCA 9RUBA 3M30B 2IBKA 4NA2A 1IJEB 1S57A 4C11B 2HS4A 2V68A 5IWAF 2YNHA 3FQLA 5JMNA 3CDEA 2CDRB 4V19J 2WTFA 2C2RA 5LMNF 1N52B 4DV6J 3RBDA 3HDSA 4CLSA 4MKVA 1R8AA 4MK7A 3SQGA 3ICLA 4JI2J 1HPZB 4K4SA 1OYEA 1V5VA 2B9YA 4JBCA 2XMTA 4OX9J 5HMZA 3QRPA 3OUYA 4DFMA 3G8QA 1NKBA 4UOGA 2Q79A 1B4SA 4B3OB 1YWXA 1TZ0A 3DOLB 1U7LA 4Y2KA 3R27A 5A8WB 2HHTA 4FF1A 2CYYA 2UUWA 3LP2B 5KFNA 1RT3A 3ENAA 2ZKTA 4CRJA 2J7UA 1HKAA 4ECXA 4K5SA 4P2XA 2KU7A 1Y5NB 4JI1J 2DEJA 4TKTA 3LP1A 4G3IA 3FMBA 1ZPWX 2DNQA 2EKYA 2V8DA 1RAHB 5AJ3J 5M2RA 3CF5Q 5T7LB 3MDFA 1ZYQA 1NDCA 1TKDA 2L9WA 4L75A 3ZO7A 5A8RA 4ZVGA 3RRGA 5HLFB 4A8FA 1U25A 1LWCA 3MM8B 4H4KA 2RDDA 3DNCA 4O4RA 3M2VB 1V5IB 5T14A 1V6HA 4FXWA 4M1KA 3M9NB 1B0TA 5BYQA 2IDLA 3T9ZA 2RF2B 5KT6A 2W1BA 2YNFB 2NS1B 2VL1A 3EGWB 1ZM9A 1W25A 1JLAA 2KHDA 4Y2IA 4UQGA 2BQUA 1YRUA 3HULA 2CQ0A 4LF1A 3R1LA 3HZGA 3BREA 1CQMA 2PA3A 5CCMA 3NCPA 4F26A 1RHUB 4NLPA 4AQYJ 4Z7YA 3TVZA 3H5YA 1SC3B 4J9VA 4DV5F 2HHWA 3G71S 2DNRA 1TV6B 1UWBB 3MHYA 1U8SA 4O3QA 4WIIA 3DC2A 3Q8VA 2RSQA 1JNRB 4DU7A 4ZCKA 5DS7A 3OVSA 3CD7A 3Q24A 2FB0A 3UW1A 2V8HA 1K44A 4DV6F 1VBZA 1SC1B 3W63A 1U0SA 1VISA 4RU9A 1JMTA 3PHEA 3JQMA 4JI2F 2R8HA 2XI3A 2YKPA 3I0SB 2G9OA 1YBAA 2DXFA 4H4KC 1S1XB 2IJRA 4OX9F 1NK6A 5D4NA 4B9NA 3ZNJ1 1QVGR 5KT7A 1RJJA 3E51A 3US5A 2MB0B 2FZKB 3MUMP 3BZQA 3A4TA 2EFNA 1S6PA 1TAQA 4PWUA 2A3JA 4NLUA 1NM2A 1FFSB 3OTOJ 3EZOA 2WOMA 2DR8A 5IFMA 1HWKA 2A6OA 4RW6B 2KT5A 1WELA 4X4VA 4TVAB 1UEUA 2HFSA 2WVBA 4TY8A 1T03A 2ZH7A 1F5AA 3FZ2A 3ZTOA 2QL7B 1M5SA 2JC0A 2RD5C 1LKZA 1N5SA 5KFWA 3KLEB 3D28A 3UO0A 3GQCA 2RKIB 2YWEA 4WE1A 3GJTB 2XHCA 4ALZA 5F8GA 3AD7C 3HMJG 2FJXA 1SPBP 4OZ0A 2ZBCA 3VGSA 3M8YA 3OSNA 2AT1B 3SFGA 1M5HA 1OSDA 2NZCA 3IA0A 1KRPA 3L7PA 4DMZA 3UD4P 2FHMA 5B0BA 1RZMA 2HFZA 3BH7B 4ZN3A 5F8NA 5L1KA 3TAQA 1RTJB 3PYGA 2LU1A 1LOUA 2D3ZA 4ED0A 3LUYA 1R0BG 2R7UA 5D4PA 1SJ1A 3O3LA 4OI6A 5KFBA 4ZN1A 2IVFB 2N7YA 4TY9A 4Y3CA 1LK5A 1WOSA 4LJMA 4I64A 3PTWA 2NLWA 3TA0A 1FO1A 2FZGB 1PC4A 5FLXY 2BOPA 3KK2A 3U27A 5C7PA 1WEZA 5B0EA 4MKBA 1SL1A 2KT2A 4RW4B 3QO9B 2RUGA 1JLBA 3CCRS 3GR0A 2ATCB 1GEHA 4KKOB 2DJWA 9ATCB 4IQMA 2X3GA 2VFTA 3RBZA 3PW5A 2X1GA 3OXLA 2XCPA 3L09A 4AD6A 4B08A 4O3PA 5ETPA 2XY5A 1LWXA 5KFVA 3BKUA 1X5TA 2VF3A 3KMSA 1NNDA 2LQ5A 2VPXB 3B8HA 1FRLA 3D0IE 4OV6A 4CTAA 1IKYA 2LQ9A 2IRUA 4I2QB 2H3EB 1XBWA 1VYAA 4YR0A 2Z2YB 2F4FA 2UUTA 3DLKB 4OHWA 3OTOF 1WC5A 4M8LA 4QYZK 3W66A 5D0GA 5J2MB 2M3DA 3A8KA 4KHPJ 3T3FA 2B56A 1NLKL 3EX7B 1YRTA 5KG1A 3PW0A 2P6TA 2BM1A 4IG0B 2U1AA 4CH7A 3J7A1 1S1VB 5J2NB 1JKHA 4CNYA 3R5AA 3BGRB 2BKPA 2JFDA 3M8ZA 4ED5A 3MF5A 2GIFA 4ZPWR 4HT5A 3PYFA 4M5DB 1I51B 1S7HA 1M5VC 3MECA 3IS9B 1FRHA 2AX1A 1VQ9S 3DHXA 1RT4A 3M6VA 2NR0A 2N82B 1JLCB 4TU7A 2XZWA 2F9JA 2XGQA 2XMAA 4K4TA 1UTAA 2QGFB 3H8YA 3M30A 2CJ9A 1EARA 4G6VB 4C11A 2FHJD 3C19A 3ZXWA 3IWNC 3CJ4A 4KGVB 4NI2A 3AOCA 1S9FA 4WBFA 4EEYA 3GWCA 1SH2A 3I6PA 4ES2A 3PX6A 1TAUA 2DCLA 1VCTA 1DBDA 2JVOA 2LA4A 4GC7A 4DF4A 2ZVSA 4K2JA 4NXNJ 3RW6A 4DSEA 2HFOA 4OI2A 5ETTA 3EUNA 1AZSB 4C8KA 4B17A 1U6BA 1Z2ZA 2G2YA 4CT8A 3FBEA 4YY3J 2KL8A 3HXMA 4CLZA 4WKYA 2IMWP 3FFIA 1C1CB 3LP2A 3LA0A 1O5JA 1CQNA 1I6JA 2WVEA 4J9KA 3HP6A 2OEKA 3HHLC 5KG3A 3A3NB 4DV7J 3MCSA 4WYWA 1N56A 4ED4A 2HSEB 1VBKA 2HHHJ 4TLRA 1UAWA 5T7LA 5L9NA 1TKZB 3UDEA 2B4UA 3T9NA 3MFHA 1RWOB 1DY3A 3AY0A 2BANB 1U2RA 1HHQA 5HLFA 1GMUA 1X0FA 3KKFA 4KHPF 4YHHJ 1MSWD 1U4BA 5K8PA 3UR3C 2QC3A 1VHFA 3BYRA 2E5JA 2HGMA 4DR7J 3HI9A 5K8NA 4JI0J 4X66J 1VQPS 3QQCD 1TP7A 1KC8T 3TX0A 2XMWA 2CJQA 4TYBA 3SCJE 3MCNA 4LBPA 4DSIA 1C1BB 3UN3A 4XAKA 3BSOA 4N41A 3LWMA 6FDRA 2DRAA 3Q8SB 5DZ7A 3HX9A 5GADU 1RGVA 3ITHB 2HHQA 4RW8A 1TV6A 5KFHA 3FSYA 1QE1B 2YNIB 3ELHA 3PFEA 4DL3A 5JJBA 1X4DA 4JI4J 1PBAA 2OJ3A 1QJHA 1HQUB 1EHWA 4LF9F 3CIZA 1IKVB 2BJDA 5IZHA 4FF4A 4QR0A 4A8MP 4F4KA 1EX8A 4IR1A 2KFNA 3I0SA 5L1IA 3ENWA 3DLJA 1YJWS 3QFWA 2D3OR 4C8NA 2Q6CA 3UCGA 4XTTA 3NGUA 2DB1A 1OYDA 4DBQA 1G6BA 2HWIA 4B3SJ 3JAMU 3CCUS 3K2YA 2UP1A 2HFNA 2KH9A 4PUOB 5HATA 2MTLA 4OYPA 2W4CA 4CT9A 2GVZB 3AAWB 4O44A 2K1RB 1I5OB 5DDQC 2FLPA 1NB7A 3EJMA 1E6YB 2YWHA 3H2VE 4NX9A 4DV7F 3DRRB 2ZD1B 3W8GA 1ZA2B 3HSDA 1R3NA 1JK9B 4F25A 4IKAA 2HAIA 2RKIA 3R5BA 2WBMA 5C25B 3VGVA 5LOQA 2DGSA 2E29A 3MR3A 3K59A 2CVEA 1UA1A 4FYYB 1X4EA 4YHHF 5E41A 1VBYA 4DSLA 2EC0A 3DOMB 4DR7F 3DYAB 3KOAA 5DDOC 3C16B 5K8OA 4JI0F 4X66F 1UETA 5FIIA 5KT4A 5KFTA 3WIUA 1BUXA 2QSFA 1ZETA 5BJRA 2G1HA 4CM2A 3TUIC 1XTZA 4JV1A 4IH6A 2C2NA 1IWGA 5F0WA 3DDIA 4QWBA 4ILRA 3F44A 4OI3A 3W5ZA
chains in the Genus database with same CATH topology
1WEXA 2VPWB 5CD4H 1FT8A 3EZ5A 1T7PA 1ROFA 4X4PA 3SI8A 2KDOA 3DI6A 3I9ZA 2FVQA 4HTJA 5LJ3Y 1UA0A 3TAMA 1Q8LA 2ZHOA 3K5OA 3KK2B 3VAJA 2BRKA 3AQPA 3NWGA 3CCQS 2KT3A 3CMES 1APSA 4WFZA 1SKSA 4WFNQ 1SL2A 1V9OA 2CDQA 4OHXA 1LWFA 2HWTA 1XERA 3QZ8A 4WJBA 3BO4A 1U45A 1TFWA 1R8HA 5F8JA 4OHZA 1HQEB 1Q81T 5L38A 4LF5F 2G13A 2DR7A 4P6QA 3TAPA 3GG0A 1LW0B 2R2SA 3UDCA 4KO0B 2HWHA 1NK0A 4FYDA 3RRKA 4MH8A 4O3SA 1URRA 1X5SA 2CZVC 1JXLA 4JI4F 3MR5A 1NO8A 3C66A 2D9OA 2QLXA 3BO3A 4D3GA 2AJ1A 4EGLA 2D74B 1FDNA 1XR6A 2VG6A 4C3LA 1QSYA 3R5DA 4HDGA 1W2IA 5GAHU 2DNZA 4ILMA 2WW8A 3VQSA 3GB0A 4IFYB 4Q5VA 3M2RA 5A8KB 1TL3A 3MD3A 1Q86T 4LSLB 1R0AB 5KOXA 2AV5A 2Z4PA 5LT5A 5C42B 2P9EA 4DQQA 1HI1A 2J0QD 4UQTA 1QAJA 3A8EA 3NG8A 3OXGA 4B3TF 1H98A 2E1CA 3J81Y 4O3RA 2GO8A 1VC5A 4NLWA 1RT1A 1FK9A 4U6PA 2IC3B 4G1IA 1NHVA 3PV8A 1DLOB 1WI6A 1DTQA 4ETZA 1TVRB 3K8WA 3RW7A 4J9PA 2JEJA 3GIKA 4CO4A 3C6UB 4NLRA 1TQLA 2CJBA 4YUDA 4YDDB 1U48A 1LW2A 3PW2A 4EFAC 1VQSA 3IRXA 4MMOA 3SDEA 5KG0A 1FRJA 4DQRA 4DPOA 4EZ9A 2VASA 4A48A 4R8UA 5KFKA 2JFKA 4D3HA 4YFUA 1X4GA 2X1BA 3MEKA 3UFCX 4K4UA 1T05B 5JXSA 3LANA 4B3RF 2W7PA 4YB5A 1IKYB 4KGKA 3M1VB 3CMAS 2UU9F 5KFSA 1Q16B 4ECUA 1Y7PA 1LV5A 3LP0B 2MZQA 3NRBA 2ALZA 2V9WA 2HHVA 1FERA 2RDIA 2IVMA 3QJJA 3CB4A 5IXUA 4FN5A 3HVTB 1KN6A 3H20A 3J80Y 3GFZA 2K8GA 3R5CA 4QW8A 1TL1B 5KFOA 4J9LA 4ICLB 2XSFA 3CO9A 4B3SF 1SJ3P 2D3UA 4RBUA 4F4XA 1HD0A 1O51A 4FZVA 2LMIA 2BR0A 3GV8B 2ZZNA 2V2KA 1X4AA 1DTTA 2ZBIA 4I2QA 2BW2A 3FCHA 4LMZA 2FVRA 1P1LA 2MY8A 2OLWA 3T1YF 4ERDA 1H2VZ 4X4SA 4OHVA 3RB3A 2ZOFA 1AUDA 3DLKA 3MUTP 4PCQA 1C2PA 4HL9A 1Z2LA 1FF2A 2HHXA 2HNDB 1MW7A 1TR0A 1GX5A 3BB5A 5E7OB 1R31A 4TNOA 4DV2F 1L3SA 4B9VA 3OR2A 4QYZJ 2WB1D 4DN9A 5J2MA 4NMLA 1Q7LB 1RT2A 4ZPCA 1KLMB 2DBBA 1SIWB 2MGZA 4TXSA 3DU5A 3KLGB 3KLFB 4L6V3 4EYHB 1M5OC 2JEIA 2FUG9 5JVHQ 1RT6A 1HNVA 2YKNB