4H4OB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with (e)-3-(3-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)- 4-fluorophenoxy)-5-fluorophenyl)acrylonitrile (jlj506), a non-nucleoside inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
428
structure length
428
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 103
structure length 428
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4oB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4oB03
2HAIA 2WOMA 1LW2B 1Z4UA 1RT4B 1K1QA 2EC0A 4ID5B 2UVVA 4F4YA 3CIZA 2E9RX 3NMAA 4I7FB 4IFYA 2WCXA 1EETA 3Q8RB 2WTFA 5KFWA 3IN5A 2WONA 2AU0A 1JXLA 5FDLB 3MEGA 1T3NA 2BE2A 1S10A 2UVWA 5EWEA 1RT3B 1S6PA 5KG6A 2B6AB 4ECWA 1VRUB 3KK3B 4DL2A 2DPJA 1GX6A 3DMJB 3T5KA 5KFFA 4Q44A 3PW5A 2C2DA 4ECVA 1D1UA 3MEEA 2ZD1A 5I3UB 3IG1A 4KV8B 1S48A 4K4WA 5J2PB 3ISNC 4FBTA 3DOKB 4ZVEA 5DLFA 4IDKA 1N56A 3ICLA 3V4IA 2I5JB 1C1CB 4EYHB 1RTHB 2B5JA 3DRPA 3CWJA 3PVXA 3N6MA 3OHAA 3RAXA 4J9QA 1LWEA 1EP4B 5EUHA 4RNNA 1QE1A 5L1KA 2IM0A 5K14A 4GC7A 1TKZB 3C6TB 1S6QB 1K1SA 1RAJA 4RU9A 4K4YA 3KMQA 1SUQB 3CDUA 4NLUA 1FKOB 2HNDB 2YNFB 2JC1A 4IR9A 1XR6A 1R0AB 4F4XA 4O3OA 4O3PA 4KSEB 3FQKA 4QWCA 1C0UA 3PW7A 1IKVB 1HNIB 5DG9A 4EBEA 5JUMA 2HNZA 2IAJB 4EO6A 3JSMA 4KHRA 2BR0A 2XGPA 1TVRA 4KO0A 1RA7A 4RNOA 5KG5A 4PQUA 2OPPA 1RTIB 3M8PB 4TXSA 3LAKA 4QW8A 4JV0A 1J5OB 4G1QA 1C2PA 4H4OA 2D3UA 4IKAA 3PR4A 2YNHB 4B3OB 5KFOA 4IG0B 4PUOB 4OL8A 1OS5A 5KFLA 3QIPB 3KK2B 4RNMA 4R8UA 3PJWA 5KT2A 1S9FA 3FQLA 4ZHRA 1DLOA 3H4BA 4YR2A 4QWAA 3NAHA 2ZKUA 3OL6A 3LALA 2VG7A 2VG5A 3I5AA 3N6NA 1UWBA 1FK9B 4KBIA 4NLOA 5KFSA 3VQSA 4QW9A 4LQ9A 5DGAA 4G3IA 4RW6A 4WXOA 2UVRA 4ICLB 1JLQA 1IKWB 3I5CA 3GV8B 3ISND 3KLFA 3GIJA 2FJWA 3PHEA 4KKOA 1RT6A 3KMSA 3IGNA 2E9TA 1KLMB 3KLHA 5KFQA 3HVWA 2VA2A 3GQCA 2RKIA 2OPQB 3PZPA 5KT3A 5HP1B 3HVAA 4NLYA 4ED1A 4J9PA 2FVQA 2W9CB 3HHKA 1WNEA 3QLHA 2D3ZA 2YKMA 4ECTA 2XC9A 2AWZA 4IFYB 1ZTWA 1EETB 2JEGA 2WONB 4Q8FA 1ZTTA 3MEGB 4O4GA 2BE2B 1LWFA 1RTJA 3I0SA 4ED0A 4MKBA 3SFGA 1S6PB 2IM3A 3V6DA 3LP1A 4KFBB 3QGIA 4ZPAA 4QWDA 2ZE2B 2ZD1B 3MEEB 5F8IA 3IG1B 1JLAA 5KT4A 5KFDA 3BQ1A 3HVTA 1T05A 1N6QA 4RNFA 5DG8A 3DRRA 1I6JA 2AGOA 1VRTA 3DRSA 4J9LA 5JXSA 3IS9A 3V4IB 1C0TB 3DRPB 5J2NA 2R8JA 2IM2A 2XI3A 5KG2A 3PR5B 1LWEB 1NHVA 4I2QA 5KFMA 3QZ8A 1C1BA 1QE1B 2CJQA 3MR3A 3M9MB 1IM4A 2ASLA 5C42A 3TVKA 3LP2A 4ECXA 1DTQA 5DQGA 3KLEA 1S1TA 4K4VA 1MU2A 1JLEA 3KHLA 1IKYA 4XPEA 1S1XA 2D41A 5KFVA 4Q43A 2R8KA 4YR0A 4FBUA 2JEJA 3E51A 4MK8A 1C0UB 4I2PA 4LQ3A 3LP0B 2ASDA 4WFZA 3UR0A 3PW2A 3IGVA 4DL6A 2J6SA 3DLKA 2FJXA 5KG0A 1MMLA 3FSIA 3NBPA 4NLXA 3GIMA 4ZMMA 2UUTA 4MK7A 2AGPA 3JSMB 1SH2A 4K4ZA 2IBKA 1HYSA 1TVRB 4MK9A 4NLVA 3H98A 4F50A 3CDEA 1S49A 4H4MB 5C24A 4PQUB 2QV6A 2OPPB 4IG3A 3T19A 4MIAA 2FLPA 4Y34A 4G1QB 4H4OB 4WXWA 1S9GA 5F8MA 4PWDA 2C2EA 1U09A 2W7PA 3I5BA 4R8UB 4ZP9A 2AQ4A 1HQUB 2JLEA 3NGDA 4TYAA 1D0EA 1SV5A 4ZHRB 1DLOB 3SFUA 2W9BA 3V6HA 4XO0A 3RBEA 1RTDB 2VG7B 2VG5B 2B43A 2HNYA 3V81A 5KFEA 5KFAA 4Q8EA 2YNIA 4FS2A 3G6YA 1IKXA 2ALZA 2UVUA 3T5LA 1JLQB 3UDLA 4H54A 5J1EA 3KLFB 2YKNA 4KKOB 1RT6B 1N4LA 1T94A 4ZP8A 2V4QA 2FVSA 3KLHB 4EEYA 5DLGA 2V9WA 3CJ0A 3H2LA 2XCPA 1JLCA 4TQSA 1REVA 2RKIB 2E9ZA 3RB0A 4ED6A 1TV6B 4QPXA 2W7OA 2JC0A 4RW9B 3KJVB 3H5UA 4R0EA 2HMIA 3QLHB 5KFZA 3T1AA 4DL5A 4IRDA 2YKMB 5KG7A 3BSOA 1RT2A 4RZRA 4IH6A 3Q8QB 2AX1A 5DG7A 3N6LA 3RBDA 1JLFA 1RT7A 1LWFB 1RTJB 3OL8A 3I0SB 1W25A 3KLVA 3V6DB 3LP1B 3KK1A 3DOLA 4Q0BA 5CYMB 5HROA 3JYTA 3BSAA 2R2SA 1S9EA 2C22A 2BQ3A 4Y3CA 1JLAB 3NAIA 5KG1A 5T14A 3HVTB 1N6QB 2FJVA 3DRRB 4J9MA 1RT1A 1VRTB 4F4WA 3IS9B 4K4SA 2VA3A 2OPRA 4I7FA 1JLBA 4NLWA 5FDLA 2BRKA 1TP7A 1GX5A 1N5YB 4URSA 2F8EX 4I2QB 5KFYA 1C1BB 3M9NB 1RT3A 4KB7A 4ED2A 5CYQA 4YR3A 2R2TA 1TKTB 3KK3A 5C42B 3BGRB 3LP2B 5HLFB 3DMJA 4MFBB 2ILYA 3D5MA 4KHMA 4TN2A 4DG1A 4URQU 4IH7A 3OL7A 5J2PA 2IMWP 1DTQB 3KLEB 4WZMA 1S1TB 1S1UA 3DLEA 1DTTA 1JLEB 4O4RA 1IKYB 1S1XB 4U7CA 5KFHA 2R8IA 3UQSA 4HYKA 4R5PA 5F8GA 2I5JA 5KFUA 4LSLA 1C1CA 2W9AA 3NL0A 3FDSA 2WOMB 4I2PB 3LANA 3CDWA 4NLQA 5F8LA 4IR1A 1RT5A 2YNGA 3DLKB 4K4TA 2VG6A 4M94A 4ED8A 3OSPA 3NBPB 1S6QA 2OH2A 3OLAA 1SUQA 4LSNA 1HYSB 1FKOA 4RW7A 1RDRA 3DM2A 4DL7A 3C6UA 4NZ0A 2J6UA 1SH0A 1QAIA 3IRXA 5C24B 4J9OA 4ZPBA 4IG3B 4EBDA 2IM1A 2BQUA 1JLGA 3FFIA 1S9GB 5F8JA 1HQEA 3E01A 2D7SA 4PWDB 4NLSA 4IDKB 3H5XA 2CKWA 5J2QA 2WK4A 2B5JB 4TQRA 3T5JA 1SV5B 2OPSA 2GIQA 4O44A 2R8HA 2W9BB 3BQ2A 3RB6A 2HNYB 2W8LA 1HPZA 3V81B 2DPIA 2IC3A 2YNIB 5K14B 5KT7A 4MKAA 4ECQA 3EPIA 5KFJA 3KHHA 3QGGA 3H59A 5L9XA 2RF2A 1TL1A 4TY9A 3V6KA 2YKNB 3DYAA 4IRKA 5KT6A 2C2RA 3CJ5A 4ZP7A 1CSJA 4B3OA 3DI6A 4IG0A 1JLCB 3QO9A 4ZVFA 1REVB 1FKPA 5L1IA 4ED3A 3ITHA 2FLLA 1T03A 2ILZA 5F8NA 2QE5A 4RW8A 2RDJA 3RB3A 2HMIB 5D3GA 5C5JA 2FVRA 3CVKA 2FVPA 1RT2B 3QIDA 4K4XA 1JIHA 2BRLA 4ECRA 2HNZB 1S0NA 5KFPA 3KLGA 3DLGA 4EO8A 5EDWA 3CJ3A 3H4DA 4DL3A 1N48A 2IJFA 1RT7B 4KO0B 5HBMA 3TAMA 1XR7A 3MEDA 2XGQA 3RAQA 3GV7B 3EZUA 3PW0A 3KK1B 2W8KA 1JKHA 3KLIA 5HROB 3JYTB 4KE5A 1TQLA 1S9EB 1ZETA 4XPCA 5KFTA 4IQXA 5DGBA 1RT1B 4NLRA 4O3NA 2WB4A 3I0RA 4ECSA 4J9KA 2OPRB 3QYYA 4Q45A 5EWFA 4TLRA 1JLBB 3KNAA 1UWBB 1HMVA 1HNVA 5J2MA 1QUVA 5EWGA 3GIKA 3MECA 4RUAA 2BANA 3LAMA 4RW6B 4NLDA 1TKXA 4YQWA 2AX0A 5CYQB 5KG4A 1LW0A 4QWEA 1TL3A 4J9SA 1LWCA 1BQNA 4KFBA 4NCGA 2ZE2A 4DG1B 5KG3A 1BQMA 2J6TA 3QZ7A 2R2RA 4MIBA 1RA6A 1S1UB 2WRMA 3DLEB 1DTTB 4RW4A 3BR9A 4RNHA 3SI8A 1RYSA 5C25A 2V4RA 4O3SA 3DDKA 5KT5A 4R5PB 4LSLB 1C0TA 2JEFA 3BJYA 3QGHA 5F8HA 4YMEA 1RT5B 2YNGB 4IFVA 4NRTA 4U6PA 2VG6B 2ASJA 4HKQA 4IRCA 4O4GB 5KFCA 4M95A 5L1JA 3KHRA 4TY8A 3G6VA 4QWBA 3CJ4A 3M8QA 4LSNB 4WE1A 1S0MA 1S1VA 4RW7B 3DM2B 4Y2CA 3C6UB 5I42A 5KFIA 1S1WA 3HKWA 4J9NA 3IRXB 1JLGB 1T05B 3FFIB 4Y2AA 5DQIA 1KHVA 3H40A 2AGQA 1HQEB 3E01B 1LW2A 3DRSB 1RT4A 3LP0A 3M9OB 4X2BA 5J2QB 4ID5A 5J2NB 2OPSB 4O44B 1HARA 3OLBA 3GYNA 2XCAA 3H5SA 1HPZB 2FVCA 4YP3A 2IC3B 2FLNA 1JX4A 2B6AA 1VRUA 1QAJA 3T5HA 4H4MA 2RF2B 1TL1B 5I3UA 4KV8A 3DYAB 3DOKA 4NYZA 5KFNA 1MU2B 3UPFA 3DI6B 2HWIA 3QO9B 2WHOA 1FKPB 1S97A 4O3RA 3MFHA 3ITHB 4ECYA 1XR5A 1HQUA 3EPGA 3Q8PB 1T03B 4ED7A 1RTHA 4ZVGA 2RDIA 4F4ZA 4RW8B 2GIRA 4ECZA 2JEIA 4NLPA 2UUWA 3MR5A 5DQHA 1RTDA 5D3GB 1EP4A 3OSNA 5KFBA 3V6JA 1NNDA 4JV2A 5KFKA 1TKZA 3C6TA 4ZPCA 3KLGB 3DLGB 4NRUA 3MFIA 2O5DA 4WYLA 4K50A 1NHUA 3G6XA 3TAMB 5HBMB 4WFYA 2HNDA 3PJXA 3MEDB 2R8GA 4NLGA 3KOAA 2YNFA 5F9LA 1SH3A 3BSCA 1JKHB 1R0AA 3KLIB 2C28A 3MF5A 5KFXA 4EBCA 5KFGA 2ATLA 1TV6A 4K4UA 4DL4A 4RW9A 3KJVA 4WFXA 1IKVA 3NKYA 4MH8A 1HNIA 3Q8SB 3GV5B 3KHGA 4WYWA 4WZQA 3I0RB 2I1RA 4RUCA 3OHBA 3D28A 2IAJA 1S0OA 3BREA 1HMVB 4IOBA 1HNVB 5J2MB 3BQ0A 2XI2A 3MECB 2BANB 4JUZA 1IKXB 1TKXB 1KHWA 4O3QA 1RYRA 3MTKA 1LW0B 4NLTA 4ZP6A 1TL3B 5J1EB 4ZVHA 4JV1A 1LWCB 1BQNB 1RTIA 3M8PA 4NCGB 5CYMA 1J5OA 3OL9A 2IA6A 1BQMB 3G86A 2YNHA 4IH5A 4PUOA 1S4FA 1YVFA 3QIPA 3KK2A 4TYBA 4RW4B 3RB4A 4EYIB 5C25B 3GIIA 4KAIA 3GILA 3FRZA 4ZPDA 2HWHA 3PW4A 5F9NA 2V0NA 1FK9A 1N5YA 2GC8A 4ECUA 4IFVB 3CO9A 4GC6A 4FS1A 4ICLA 1IKWA 1TKTA 3BGRA 5HLFA 1JLFB 4MFBA 5KFRA 3BSNA 4TY8B 3CJ2A 2BQRA 2XWYA 3M8QB 4WE1B 1KLMA 3MR6A 1S1VB 3MR2A 2R2UA 4DEZA 3H5YA 5I42B 4J9RA 1S1WB 2OPQA 3DOLB 4Q0BB 5HP1A 5L1LA 2W9CA 3TQ1A 2IJNA 4URGA
chains in the Genus database with same CATH superfamily
1G2EA 1APSA 2B9WA 1TFYA 1EKSA 4BBYA 2Z2YB 2HZVA 4DL2A 4KRWA 4F3QA 1I5OB 3ZZRA 4UOFA 4M5GA 3D0IE 1Q4RA 4EYHB 3BH7B 5K14A 5LXRA 3LPYA 3CDUA 3BBFA 3OV7A 3UWTA 3QGPA 1R0AB 3W9JA 2YXLA 2WVCA 4B02A 4OX9F 3HP6A 2XO7A 4DCPB 3JSMA 4Q2MA 1QVFR 1J5OB 1C2PA 4HHHA 3PR4A 1V9OA 4WP9A 3PJWA 4L3KA 1S9FA 1H7WA 5E7OB 2NREA 4ZPWR 4K50A 4WXOA 3KLFA 4OI1A 2FJWA 3CCVS 1AT1B 1Q8IA 2RKIA 1VQ6S 2NZ4A 5HK4A 4LF7F 2PT0A 3D68A 2HHSA 5K8PA 1U26A 5A8KB 2HK3A 5CHCB 3G71S 4UOCA 5JXSA 1MN9A 1MROA 1RHMB 3FVYA 2XI3A 2H65B 3A13A 4USIA 5EHHA 1IBMF 7AT1B 3NNCA 4FDFA 1P9YA 3JAMY 3D1OA 3NWGA 4DL6A 4I4BA 1MMLA 2AEFA 5HI7A 1Y5LB 2IBKA 3HVRA 1UJ6A 3DKDA 3CDEA 3GONA 4G1QB 3PV8A 2HK2A 1B4SA 1U09A 2QA4G 4CLZA 2IMOA 2JFKA 4BDPA 2MKCA 1WI6A 2VFRA 1LOUA 4CDIA 3JQMA 1RQ0A 2UV8A 1T9XA 3RU0A 3PTWA 1CQMA 5ETTA 3EVWA 3G4SS 3T1AA 4DHVA 3UR3C 5CYMB 3AXKA 1RP5A 1RT1A 3C2PA 5I3PA 4B9MA 3H90A 3M9NB 5CYQA 1H0HB 3LP2B 3D5MA 4MFBB 2D9OA 2QLBB 2MZ1A 4RKUC 3RR8A 3KLEB 5CCMA 3N28A 3NL0A 2KN4A 4ZVUB 1K8AT 2QRRA 4B3MJ 5AT1B 3SCLE 2D7SA 3M30A 3AHPA 2KFYA 3OFGA 3C46A 1R0CB 4YB7A 1KFSA 2DPIA 1A6LA 3BGUA 2W7AA 2ZH2A 1TL1A 3LTOA 3W9HA 5GMDA 4X4OA 2ASYA 2DGSA 4OI0A 5CA5A 4ERDA 2M0GB 2VKZG 4P75A 3RBXA 3EZUA 2W8KA 3JSYA 5DGBA 1NMEB 3FJ2A 3DXSX 1VK8A 2WB4A 4ECSA 4EUVA 4HLBA 3SSRA 3MECA 3ISZA 3QRQA 2UU9J 4DG1B 5ETMA 5AJ3F 2V2VA 3K17A 1IWGA 4H4KC 1C0TA 5JJBA 2Y8WA 4ES2A 3TQEA 2GIFA 4PAAA 4ZVRB 3E2EA 3UCGA 3G6VA 1RBAA 1IUJA 4QOTA 4Y2CA 1DY3A 5I42A 3NS7B 5DQIA 3H40A 1UA0A 1HQEB 3AJ1A 3M9OB 4NL5A 5HVGA 2OPSB 2XCAA 3H5SA 1DAXA 1NPRA 5I3UA 1VRQC 2CQBA 3F44A 4CYUA 4LREA 4ZA1A 1HQUA 3Q8PB 3F0NA 4ED7A 4ZVGA 1NK6A 5LXYA 5DQHA 3UD3P 5KFBA 3KUEA 2AJFE 4ANDA 2DITA 2MLZA 4WYLA 4AQYJ 5HBMB 3FZ2A 4NXNF 3D1QA 1F5BA 2D3O1 3NKYA 2MGZA 3BQ0A 5ETSA 1FRIA 3P6YC 2HBYB 3BF4A 4LRCA 1R8CA 1NLKL 1DFDA 5LSLA 4JV5F 4PUOA 2NYHA 1CLFA 5F9NA 1NB7A 2V67A 1IKWA 3H2UB 4DMZA 4DV5J 4CIOA 5BR8F 1FWPA 1F2GA 2EPIA 1UL3A 4QIEA 2WTFA 4USMA 4NX9A 5ADZA 3ELHA 4CI0B 2BABA 2IRXA 4ECWA 3UVJB 2DXFA 4DSFA 1FRJA 5I3QA 5GADU 5HJXA 3ISNC 1N56A 4AT1B 1U0SA 3NP5A 3DRPA 3T1HF 2LQ8A 1QDUB 4L76A 1EQMA 5IQ6A 1KSPA 1XMBA 1RCXB 1SUQB 3TAQA 4OYMA 1X4AA 2DD8S 3GIRA 4O3PA 2X3GA 1U6ZA 5E3QA 4EBEA 1NKCA 4ELUA 2IAJB 2N3LA 4KHRA 3KJNB 4RNOA 5HQLA 4PQUA 4O0IA 2OPPA 4QW8A 3KJQB 4NCAA 5CQGA 2B4PA 5B09A 3Q24A 1KFDA 4LF5J 4ED4A 2R7VA 1E6YA 3I5AA 2RUSA 5DGAA 3FRYA 4ICLB 3GYXB 1JMTA 2VA2A 4LFBJ 2VH7A 2FTRA 4NLYA 4J9PA 2BXJA 1PYSB 1X4HA 2W2NP 5LMNF 1EETB 4NYPA 5T7LB 2CPXA 4W90B 1VDHA 4KFBB 1B0PA 2ZE2B 2YH1A 4WBFA 3IXQA 1MN7A 2DBBA 1WSVA 3QZ8A 5HQMA 2LXIA 5IM0B 2MQOA 2QJ3A 3ILLA 4GO5X 5KFVA 3NXZA 4I2PA 3LP0B 3R97A 3DLKA 2NYIA 4NLXA 1WOSA 1R8HA 1YHQS 3MMBB 3M1VA 1TUWA 3CCSS 2VQEJ 3RGIA 1C4AA 3UCZP 2E5LF 4LF6J 4QIWD 2B43A 3V81A 1WOOA 1RT6B 1X4FA 3G2XA 3T1YJ 1Q8LA 2BJDA 4TQSA 4DPYA 1RLCL 1XNRJ 1ZM2A 4OMFG 4JI5F 3NS5A 2DKOB 4ZVPB 1LWFB 1RTJB 1URNA 4CM2A 2VFTA 3KK1A 3CCWA 4Q0BA 2CNLB 1Y10A 3U1LA 1YJTA 4KQZA 4DR2F 3I82A 3N4WA 4X4RA 2CG4A 2XBPA 4URSA 4TLQA 4J7CA 1WF1A 3OPKA 5J2PA 1O8BA 4WZMA 4J91A 3K5NA 1S1XB 1K0TA 1ROFA 3HFVA 3ZXWA 2MHNA 2JDJA 3FDSA 5IT4A 1F2HA 1YJVA 4IR1A 4K4TA 3NBPB 3RAMA 5B7WA 2ZBPA 2ZNZA 3I4PA 1ICEB 3FFIA 2MB0B 4NLSA 2VPYB 4ES1A 1A0OB 2P6TA 3FCHA 4E0DA 4DX6A 5BYQA 4IG0A 1Z2LA 3QBCA 3N01A 5DDRC 1X9MA 1U6BA 3RB3A 4JP8A 3QT8A 1LK7A 2FVPA 3SDEB 1JIHA 4ECRA 1BWEA 2LQBA 1I94J 1JJHA 3EGVA 4KE5A 2LQ9A 2XYHB 3MWBA 4J37A 5IXUA 2XMMA 3K8WA 1VC6A 1HNVA 1HQ2A 2OSRA 1R6YA 1DZ5A 2Y1RI 3L3CA 4DV3F 5IZHA 4MIBA 4RNHA 3UE2A 3CCRS 3VF0B 3AA9A 1VIOA 3OFFA 2VG6B 4HKQA 3MGJA 5K20B 4DPOA 3TO8A 2RU3A 1H6KX 4F3MA 8RUCA 3ET6A 4WU3A 2OMOA 5BYRA 3FGVA 3R5DA 2FLNA 3BDPA 4H4MA 4CNZA 1RHUB 4ZJLA 5GAHU 3NGRA 1FTCA 4EI2A 5IC4B 2YKQA 4ECZA 4ELTA 3O6QA 4I1TA 4ILRA 1NNDA 3R1LA 4ZPCA 3D2WA 5E3RA 3PJXA 3W2VA 3BSCA 1Q8KA 5D4OA 4BS2A 1JB0C 3MUTP 3NGKA 2KVQE 3Q8SB 1HBMB 3NMRA 4RWXA 2LEAA 5D77A 4DR4J 3CSKA 1RWOB 2LU2A 3PO4A 3MTKA 4NLTA 1EIYB 1R8AA 5J1EB 1N8RT 1RTIA 3M8PA 1S4EA 3HD1A 1W2IA 2ZH9A 1NZ8A 3OFHA 2V0NA 4F26A 3CO9A 2DRAA 2CNKB 3P4UB 4J9RA 1T9UA 2VFSA 3CJKB 2OI2A 2CZ9A 2R7RA 1JNZB 3VZHA 2IJRA 2AU0A 3Q8RB 3PEHA 1P8GA 4OJHA 4K7QA 4P9SA 2FHMA 3WDOA 2OTLS 3JSBA 1VRUB 2J6TA 4DZ6A 7FD1A 1SJ4P 2YPYA 4A8MP 5FIIA 4Y0FA 4KYZA 1E6VA 4JI6J 2R7TA 2ZHOA 1S6QB 2KHCA 1VMBA 5HSPA 4CT9A 4RU9A 1NK7A 4P7VA 2BW2A 1EQ0A 4KSEB 2F4VF 4QWCA 1KN6A 5JUMA 1LKZA 3MXHP 1FRKA 3M32A 2DNRA 5CD4A 4JV0A 2EBEA 1WELA 1YBAA 3BBBA 4RPFA 3KK2B 4RNMA 4L3NA 4ZVSB 2XB2D 4OYPA 2YX7A 4Q2LA 3MUVP 3CGIA 3ISND 3ENWA 4KKOA 3HJVA 1KLMB 2R7OA 3BH6B 1YZ7A 4MMOA 3A12A 1U8WA 4ILLA 3QLHA 4ECTA 1IN0A 1UJ4A 2QL5B 3Q23A 4UTGA 3I0SA 5HMZA 2Z30B 3AFGA 3Q83A 3LP1A 2ZJQQ 1PO6A 4PCQA 2NXCA 3IS9A 3CCZA 3I55S 1YI2S 1ZA1B 5KG2A 3HMJG 1NHVA 4I2QA 4YDDB 1EJ7L 5C42A 1L3SA 2QSFA 2H1YA 2DHAA 3EUNA 5DQGA 1X31C 1JLEA 2MQPA 1IKYA 4XPEA 4B3SF 2QL7B 2GGPA 2MZSA 4C98A 4ZCKA 4MK7A 3O3LA 3JSMB 2V8PA 4LRAA 3CW2C 1RI7A 4LF4J 3W66A 1OIAA 3HHDA 2NUUG 1VQPS 2Q79A 2ZBIA 2GFFA 3GJTB 3M8WA 4ZVTB 5ETPA 3KLFB 2RRAA 1FI4A 3H2LA 4FVMA 2RKIB 4GVBB 2YY3A 3KJVB 3IO1A 3DN9A 4C11A 3CCQS 4X4PA 2AX1A 3M2VA 2RAQA 2VBYA 1S9EA 5A2QU 2MKHA 4K4SA 1MROB 1WF2A 1JLBA 3I96A 1R0BG 2AEJA 1AW0A 4LJMA 3BGRB 4ITSA 4D3HA 1QVGR 4I67A 4LFAF 2DNZA 2WOMB 4F0KA 5M2PA 4TKTA 4ED8A 2CPYA 1OO0B 1T02A 1Q8BA 2NPIA 3C6UA 2PC6A 2MZTA 4DQSA 5D15A 2P8IA 3E01A 5EGYA 2IIHA 2DNKA 1ZBTA 1FJ7A 3RB6A 2POKA 2NPFA 1HIYA 2BMBA 2HWTA 1WTBA 2HKEA 3SSSA 1XNQJ 4ZVFA 2ILZA 3GFHA 5DO2A 4DOZA 5THWA 3R8YA 3RRKA 2HNZB 3DXBA 2QSWA 3KKFA 2OO4A 2FGCA 1ZPVA 3GV7B 2CYYA 3KUHA 1RT1B 4ER8A 1N33F 4O3NA 1M5VC 5EWFA 1MWZA 1UWBB 3GIKA 3CC2S 3MHYA 5CYQB 1BWVA 2RQ4A 5C25A 2MZRA 4XDCA 2V94A 3THTA 4HDGA 2BX6A 4ZIWA 2JVRA 3CJ4A 2DEJA 3V2UC 2C1EB 2KZZA 4PYAA 1LW2A 3DRSB 4PKDB 2WVDA 1H74A 1RWXB 3PX4A 3RTVA 2UXCF 4CZCA 3GYNA 2FVCA 4RBTA 2ZVIA 2IDLA 1T0TV 1Y4ZB 4M5MA 1TL1B 3AOAA 1Q81T 4I56A 3UPFA 2HWIA 1V5IB 4P2FA 1IR1A 4LUBA 2CQ4A 1WHWA 1RWVB 2DH9A 1PGZA 1HD0A 2EK1A 4ZLPA 3G6XA 1U47A 5H9FJ 2HLUA 5F9LA 1KVKA 5KFGA 4C8YA 3WIUA 2HFUA 2HURA 4KGXB 4N77A 3L7OA 1GNKA 3KHGA 3OHBA 3MDFA 3MECB 2ZC3A 4DV1J 2X1BA 3IA0A 3AY0A 4ZP6A 2J8AA 4OX6A 1HNZF 3S1TA 2GW8A 1S4FA 1U49A 4NOHA 4ZPDA 1U24A 4M8LA 2DNYA 4DUYF 4PR6A 3MOJB 1D8YA 1KDNA 3JB9k 5I42B 1ZA2B 1BHNA 1RAEB 5GADI 2YBVA 4IFYA 2VJUA 1T3NA 3PIOQ 3E8OA 5KG6A 2IVYA 2XS7A 4X4VA 2F63A 5I3UB 4K4WA 1VQ9S 2E1CA 4CYUB 4JI8J 1NK5A 4F04B 1PC4A 4B9NA 1XMQF 2CJAA 4GO7X 2MKKA 1MG7A 4F4XA 2QLJB 2MGZB 2VJVA 1CPZA 4LSZB 4LF8J 1QAYA 2K06A 3HSJA 3PO5A 1YLXA 4OI2A 4CWBA 3QAUA 4PUOB 1SCJB 3OXLA 3Q0AA 4Y2IA 4DV6F 3NAHA 2W2MP 1N36J 4X65F 2DNPA 5AXKA 1IKWB 4WK3A 4KT0C 2P2CB 2IVFB 4CLYA 2J5AA 1FDNA 3PRBA 2UUCJ 1WNEA 2J7KA 2JEGA 1PBUA 1B64A 4JI2F 1X5PA 3NOCA 4JI3F 2IM3A 3V6DA 2GX8A 1Y3JA 3I4HX 1T05A 1VI7A 3HPOA 3DRPB 2GQQA 2R8JA 4C6AA 2L48A 4ECXA 2QG9B 1UWAA 3MM5A 4K4VA 5LL6d 2QMWA 4Y65A 4Q43A 3E51A 2E7WA 1FRXA 4F0HA 2ASDA 4V1Ak 2LP4A 4GKKJ 1YJNS 1NU4A 2G1DA 4PQUB 2OPPB 2MQMA 5EX0A 4OHYA 2CXEA 4OX7A 1TZ0A 2W7PA 1TKDA 4B08A 2JLEA 3GJSB 4XO0A 1E6YB 2OJ3A 2QIFA 4DV0F 2HNYA 3BO3A 1QM9A 3D67A 1RWWB 3T5LA 2O3DA 2G0CA 2B8QA 3ENQA 3MAAA 1FVQA 2HW3A 3J80U 2EKYA 3BSOA 1NDKA 3Q8QB 4L75A 2ZDOA 3G82A 1JLFA 3MCNA 2CQ2A 2RT3A 2FJVA 4J9MA 1GX5A 1VQMS 1N5YB 1IBKJ 2XMKA 2CNNB 3F56A 4LVNP 4OLOA 3K5OA 1NJYA 3UQSA 1Y00A 2I5JA 1UP1A 2C3UA 4I2PB 3DLKB 5ETOA 1NJXA 3N5FA 4HI1A 4LSNA 1RDRA 3M1VB 4A4JA 4DR5J 2Z57B 1QAIA 4ZPBA 3GE9A 1OWXA 3MM7A 1HFEL 1NCLA 2XLJA 2B5JB 3VAJA 3V81B 3PNIA 1HLWA 4ECQA 4X64F 2M3DA 2HBRB 3GSDA 4DUZF 1IQZA 3V6KA 4CT8A 1WKKA 3N5BA 3G6ES 3D4JA 3CULA 1KEKA 4I68A 3CVKA 3U7JA 3QIDA 2GMLA 1X7VA 1XR7A 2V4JA 2AJ4A 3PG9A 2XGQA 3KK1B 4GVLA 4OX9J 1ZETA 3BM7A 5ETRA 4F36A 4TLRA 3VQTA 3THPA 4DU7A 1IR2A 4QYZK 3NG8A 4P71A 3DDKA 5C2CA 1I51B 4C8MA 4M5LA 1FE4A 2DY1A 2L41A 4WE1A 1S1VA 2BKNA 1KC8T 4EZ9A 1O5JA 3FFIB 1MMNA 2CG8A 4RBUA 2QLXA 1HARA 3CNQP 4F4KA 3G87A 2FHJD 3KG0A 3HT3A 3MD3A 1NK9A 4ZCLA 3RUBL 3K89A 1XR5A 3DDNA 4F4ZA 1F6TA 4NLPA 1IBMJ 4ELVA 4ZS6A 3J7A1 4AFFA 2OSQA 2HHUA 5M2UA 1S6OA 4AE5A 3LGMA 4K4UA 2XM3A 2KH9A 1Q5YA 2YWKA 1HNVB 1F1BB 4XDDA 5C2GA 1FE0A 1IKXB 1T95A 4ZVHA 3GMGA 2ZH4A 2QLWA 2X51A 1YVFA 3V5RA 1GXTA 4KAIA 2FJAB 2HWHA 4X4NA 3TZYA 2JZ5A 4FXVA 3MI7X 2BQRA 1AUDA 3H5YA 4B3TF 3TQ1A 2IJNA 5F3TA 2V5HG 2I8EA 3ET6B 2VHGA 4F4YA 2UVVA 5ETKA 4AL7A 2KZMA 4NCBA 4DU8A 1S10A 1VQ4S 4KC5A 2DPJA 4PZVA 3D7SB 1FFSB 2G2YA 4TVAB 5A0YB 3TA0A 3IR6B 2CPFA 3V4IA 1C1CB 4ZOSA 1UA1A 3IWXA 1BE4A 5L1KA 3QRRA 3SZ2A 1FKOB 5H9EK 5LJ5Y 2MQ8A 3W2VB 3FQKA 5GMKa 1M5OC 2Z8QA 3OTEA 1HNWF 2J9CA 1LXNA 5IC6B 1TVRA 1R6VA 1RTIB 3M8PB 1RU2A 4B3OB 2DGOA 5KFLA 4R8UA 4ZHRA 3LALA 1U8SA 4RW6A 4FPIA 1SI9A 2I2YA 4KHPF 2ZKTA 2HZAA 3W64A 1U2FA 3EXYA 3QPIA 2J0SD 2U1AA 2XC9A 2L9NA 1GAOA 4OHZA 4MKBA 3SFGA 4CH7A 4QWDA 3CJTA 1ZOTA 3TR5A 3HCXA 3K58A 4LRBA 2YQ1A 3FBCA 1E6VB 1X5TA 2AV5A 2HS3A 1GMUA 5AJ3J 4OZLA 9RUBA 1RAOA 4TU7A 3B82A 4CNYA 4CH1A 5GAEI 3LWMA 2UUBF 1FXDA 5H1SV 5HVHA 3HHNB 1Y5IB 3NWRA 2UXDF 3H98A 3HSZA 2MLYA 1VQ8S 3LWLA 2CPDA 4QPTA 2KL8A 2DNMA 4EFAC 3TYTA 1VQNS 1FDAA 2CQIA 1IM6A 1WUUA 3SQGA 4KKOB 2V4QA 2ROEA 2V9WA 1P1LA 2XCPA 1G3OA 2DYAA 1N5VA 4RW9B 4ZJQA 2RQCA 3EYZA 3SXLA 3FEYB 4PABA 3QLHB 3VALA 1IJEB 3I6PA 3M6XA 2MDAA 1B99A 3C14A 3CTRA 4AYBD 1CC8A 1RT7A 3OL8A 2YKAA 3I0SB 4PEOA 1VR6A 1ULRA 3LP1B 3U1MA 4Y3CA 2CWKA 5F0UA 4C97A 2BJ1A 4DV7F 3IS9B 3U02A 2PI5A 1VQ5S 3HX9A 4I2QB 4JV5J 5C42B 2A10A 2VOOA 2IMWP 2IBOA 1JLEB 1IKYB 5E0OA 2GGPB 1FDBA 2FY8A 1YK9A 3HHLC 3MD1A 4DXLA 5BR8J 1X9SA 1EZZB 2DCLA 4F7VA 3MM8A 2DR7A 2ATCB 2G13A 2N7YA 4DJBA 2CKWA 4F2RA 2ADBA 3CF5Q 4BC9A 1WKJA 2DXEA 2C2RA 5CZVA 3T1HJ 1FKPA 2Q43A 4PG5A 3CCLS 1PC5A 4C11B 5CYJA 3IBFB 1EX8A 4K4XA 3H20A 1CJVB 1NHKL 2IJFA 3TAMA 1L3UA 4WPAA 4X84A 3W61A 2Y1IA 5IFMA 3BN7A 1S9EB 1S57A 4LMZA 3GFZA 1U1OA 3A4TA 1JLBB 3HHLA 5AXMA 1TKXA 2PMWA 4J9SA 1BQNA 1LXJA 1SQFA 2R7SA 2GO9A 1T9WA 3HXMA 4JI7F 4OI4A 3GG0A 4ZLLA 1Q53A 3HKZD 4P10A 3C6UB 4NEZA 5LMNJ 3E01B 3QNWB 1RACB 3FBEA 5A2QY 4USHA 2ZVSA 2M4MA 3SMZA 1PILA 1QAJA 2HSEB 2F8HA 2YTCA 4RR5A 5FLXU 2XZDB 4O3RA 2O01C 4CP5A 1N34J 3VAKA 2LA4A 4DSJA 2QFIA 5D4LA 4JYAF 3D6MB 2E1MC 3E3XA 4P6QA 2ZH6A 3QWPA 2L9WA 4DL4A 3EZOA 1IKVA 2XEXA 4MH8A 4YOEA 1L3VA 2ZH7A 1V5VA 4FN5A 3NCQA 5ETNA 4O3QA 2DO0A 5CYMA 3OL9A 3OBIA 2E5LJ 5C25B 3MTJA 4KGZB 1V3ZA 4CLWA 4MFBA 3ZTOA 4DFPA 1OJ4A 5L1LA 4DPTA 1B7YB 4E98A 4JI5J 1LW2B 2HQIA 2I6WA 3I31A 4I7FB 1JXLA 2B4UA 1ITPA 5KFFA 4DR2J 3HDSA 3FK4A 3DGPB 1J2VA 2BVZA 3KG4A 4IOCQ 3M6WA 1Q5VA 4KY3A 5IV3A 1GTEA 3RW7A 5B08A 1LWEA 2IM0A 4GC7A 2K3KA 1SJRA 4PG4A 3CJRA 4FYYB 4Z37A 1XR6A 3AA8A 1TU0B 2Y8YA 1YBUA 3R1HA 3G96A 2VFVA 4FYXB 1NPPA 4BWMA 1TMJA 1LWXA 1LK5A 1WC0A 4IRDA 4OL8A 5A6WA 4E8UA 3OVSA 2VG7A 4KBIA 3ZTQA 3S01A 3NGTA 4DN9A 2E9TA 5CD4H 4PWUA 2UV8G 4ED1A 4OHVA 4IFYB 3R2DJ 1FRLA 1UTAA 4DQRA 1JLAA 2K2PA 3CCJS 5DG8A 4L72B 4LR9A 4OZNA 5HN0A 2QA2A 2IM2A 2LEPA 3D54A 3OR1A 3PR5B 2R4FA 1F5AA 3DFEA 1C1BA 3SIPB 4DV3J 4NA2A 5A6PA 3K57A 3KFWX 4UY85 2R8KA 2JEJA 1SL0A 3GIMA 4JI1F 5I4MA 4HDHA 4ZPVR 3QMQA 1KP6A 1RTZA 4AXJA 3TVYA 4DI6A 1PG5B 3TEHB 2ZBCA 2C2EA 4MKYA 3CCES 4TYAA 2AHOB 2GVDA 2W9BA 3VAFA 3UN5A 3Q8VA 2YQ3A 3W3SA 1IQTA 5DLGA 3D6HB 1L3KA 1FVSA 5KFZA 4DL5A 3VAMA 1TL5A 3VV2B 1VLOA 3KLVA 4ZJOA 1G1XA 4N8OA 3V6DB 3GJRB 4FF3A 3JYTA 2C22A 3NAIA 4A8KA 2DH7A 1FNOA 3VAHA 4ILMA 2Y1LB 1UVJA 1UKUA 2CFXA 4ED2A 2QA4S 2FZKB 1VQKS 1DRZA 3LO3A 3O5TB 3MM5B 1DTTA 4FYVB 4M5HA 5KFHA 4CRJA 4R5PA 2RMLA 1XMOF 1Y7PA 8AT1B 2Z0GA 1SUQA 4CLFA 3OTCA 2J6UA 1UZDA 1FEEA 5BJRA 2MQLA 5F8JA 2NZCA 2W25A 4M5DA 4TQRA 3T5JA 3BQ2A 5G0RA 2HNYB 3DC2A 3CJ8A 3TZXA 5KT6A 3MAAB 3QO9A 1PIEA 3NOGA 1T03A 2FHKA 2QE5A 2FVRA 2V50A 2BRLA 4WIQA 3G82B 4RO0A 3BZQA 1X5SA 4KJIA 2F4VJ 3RAQA 4OJ3A 3AD9C 3HHLD 2VDIA 4IQXA 4J9KA 4LFCF 1H3DA 2G0JA 3H42A 2V2QA 4C8LA 1TL3A 4NCGA 2W4PA 4KFBA 2ZE2A 5KG3A 3I9ZA 2VBWA 3OW2R 3FC9A 3CJSA 2QO3A 4RW4A 3MZIA 3J7ZT 3SI8A 5DZ6A 2G9OA 3M6VA 4IRCA 5KFCA 1GFWB 1R89A 4LSNB 1N54B 2DO4A 1PAEX 2FGOA 3MM7B 3LP0A 5D0HA 2M7SA 1Q78A 2UXBF 1XJWB 4W92B 2BE7D 2XY6A 1TK8A 3T5HA 4KV8A 5HJYA 3CD7A 3HFZB 2C3PA 3W5XA 2R7XA 1RLDA 1NKBA 2QGFB 5B0DA 2E5HA 4U95A 7FDRA 2AD9A 2AF6A 2L9DA 3C6TA 4DSLA 3UNYA 2JWNA 3B4MA 4B3SJ 4LIWA 1NO8A 4NLGA 2V4JB 2YNFA 1G4CA 1X4CA 1Y11A 2V8DA 5G4DA 2I1RA 1YSJA 3BO2A 3KYLA 2YPZA 2J9DA 2MKYA 3GILA 4HTIA 4X4TA 2KXFA 3M8ZA 2CQ0A 1WHXA 3GG1A 2CVEA 5KTQA 2KVIA 2V8HA 5KFRA 2E1AA 4WE1B 1S1VB 2FD2A 3L9ZA 2AP6A 4U67Q 3HF5A 3IWNC 3A8JA 1MWYA 1K1QA 2E9RX 2WCXA 3MEGA 2H54B 1RT3B 3KK3B 2K7KA 4G1IA 3KNGA 4HR2A 3UDCA 5RUBA 2XTJP 1R43A 4DV4F 1KQSR 1QE1A 2BM0A 2RRBA 3P8BB 1VISA 1RAJA 4LFAJ 2WBRA 3ILOA 2MXYA 1CBKA 1WI8A 2ZZNA 1D9AA 4EO6A 3A3NB 2HHQA 2V34A 2F4FA 2Z4PA 4IKAA 3L09A 2KFNA 3POTA 4Z2XA 2CAJA 4ZK7M 4KH1B 1KBRA 1REGX 3N6NA 3M05A 4NWBA 4JI0F 1F9HA 1RHRB 1X4EA 3D0HE 5KAKA 1FX2A 4JI4F 2HHHF 4LBPA 1S79A 4I64A 2VOPA 3EICA 2V63A 4DWIA 5MAOA 4ZPAA 1N33J 1NSAA 2RHSB 3HVTA 2IYIA 3FEXB 4DS4A 5IT9Y 3V4IB 2CJQA 4K0KF 1NSQA 4B9TA 3A8KA 2KKHA 1UFKA 4B3MF 4KPYA 1VQSA 1WOPA 2VC1A 1TVRB 1S7IA 2QV6A 3TP2A 2AW0A 4WXWA 1H73A 3FSYA 5B0EA 2UXCJ 4R8UB 3NGDA 4ZN1A 3EGWB 4ALZA 4ZHRB 3GP9A 1RTDB 3VR1A 3P5BP 4DFMA 5J1EA 2E9ZA 2ZDPA 2LKZA 2HHWA 2CA9A 2LCWA 1S76D 3N6LA 3M2RA 4FXDA 2SXLA 4M1KA 4N47A 5T14A 3KUGA 2G2ZA 4USWA 3MM6B 3BS9A 1SJ3P 1HNZJ 1RKIA 2EVZA 3ZTPA 1YIJS 3DHXA 1H7XA 3PHTA 3K5PA 2B9EA 3MOZA 3ZFVA 2HGNA 4DUYJ 3LANA 1RT5A 1S6QA 2OFHX 1CC7A 2EK6A 1YDLA 2B9YA 3V4MA 2IM1A 1VS3A 4ZVOB 3KJFB 1GMWA 2R8HA 3W1YC 5HVFA 5KFJA 3SQGB 2NXJA 3PRDA 3DYAA 1N32F 1U1RA 3DI6A 1XMQJ 1YQHA 2FLLA 3G8QA 2H51B 1DBDA 1YJWS 1FXLA 2AYMA 1T11A 1RT7B 2A2DA 4U7UK 3KLIA 2CJKA 1NDPA 3QQCD 1DQAA 4ZLNA 5J2MA 1IVZA 4DFJA 3W7BA 1AFJA 3S6EA 1LW0A 1NDCA 5C7PA 3QJLA 4CO3A 3VGUA 4DCOB 4DV6J 2WSCC 1WEYA 3TRGA 3X3UA 4X65J 4DQQA 3IFEA 1SKSA 4DR1J 3TW0A 4OI3A 3QT6A 1XN9A 2PMZD 5E41A 1WC3A 3M2UA 3MM8B 3WIVA 2FJDB 1VBYA 2AGQA 4Y2AA 1RK8A 4JI2J 3BGLA 2W1BA 4JI3J 2HIYA 4X4SA 3D6TB 3K59A 5LOQA 3IR7B 2QX0A 5K5MA 4O0NA 3HK2A 4CCHA 1FKPB 3MEKA 4ECYA 2AJ2A 2DJWA 2UUWA 3OSNA 4X4UA 3R7NB 4AD6A 3TAMB 3AQOA 4WFYA 1VJQA 4Y28C 2R8GA 3WBZA 4P2MA 2YWEA 1S12A 4GVBA 2MSTA 2OKQA 3KJVA 2HFNA 4OLPA 1F0XA 2ZFHA 4DLGA 1UEVA 2DNLA 1UETA 3HHLB 1TKXB 1KHWA 1BQNB 2G4BA 3TAPA 3QJPA 4MIWA 4DV0J 5DETA 4LFBF 4FPRA 4Q5VA 3WX8A 4FP9A 3BGRA 2QMUB 5D4PA 2R2UA 4OYOA 1SIZA 2IY5B 1HBOA 2WOMA 1Z4UA 4DDFA 2AZ3A 3CIZA 3TANA 1J27A 3VGTA 3BPDA 4ZVEA 2XHCA 3P96A 2GJFA 1U1PA 4DR7F 2BJ7A 3O8WA 3KMQA 1D9FA 1SXLA 3R5JB 3UFCX 3NRBA 2W2PP 1IKVB 2A1BA 1UJ5A 4DSEA 1FXRA 2J8SA 2HNZA 4A8QA 1HR0F 1U4BA 2D3UA 1EB0A 5KT2A 1FD2A 3W2WA 5H9FK 3H4BA 4X64J 2OEKA 1RISA 4DUZJ 1UWBA 2PFFB 3X1LB 3VQSA 1WWHA 1JLQA 2YKPA 2JH3A 3NS6A 1R3NA 4DSKA 2W4CA 2MLXA 2MKSA 2NUHA 3AODA 1LQ9A 4M63A 1M5HA 2HBZB 5KT4A 1I6JA 1BMQB 1VRTA 3DRSA 2ADCA 2KDOA 5IS2A 4PQAA 2C2KB 4HVZA 4B3RJ 1LWEB 2JJ4D 5KFMA 3Q89A 1SL2A 4C2MA 4M5NA 1WHYA 1Q95G 1GXUA 3JAMU 3VVUA 3Q86A 5CH7B 1S1TA 2MHEA 1DARA 1XWLA 4FNHA 2FJEB 4K4ZA 1RWPB 1HBNA 1M5PC 4L74A 1PAUB 2PIIA 2BOPA 4ZVQB 1YTYA 1SV5A 2VG7B 2YNIA 3G6YA 2QZ8A 1XTZA 2Y9HA 2JVOA 2JRSA 2ZH3A 3VTIA 1I94F 4ED6A 3W65A 5KG7A 1RT2A 1XERA 4QZVB 1W26A 3SEOA 1FERA 3EMTA 2C2ZB 1P27B 1BGXT 1S6UA 2QL9B 3BKFA 1JLAB 1CULB 1U48A 2BRKA 3OR1B 1RBLA 1C1BB 3WX4A 5HLFB 4MYUA 1N88A 4QIFA 1CJKB 2R8IA 1U2CA 2W9AA 4QU7A 3CDWA 3ZNJ1 1M1HA 3PX0A 3M4XA 1QUPA 3ZZZA 1PJ5A 4EBDA 2VKRA 3H5XA 2WK4A 2GVDB 2DHSA 2W9BB 2X3DA 4OIXA 4X4QA 1IWAA 2B0GA 2Y0SD 3ITHA 2XWXA 1D8ZA 3LW5C 5F8NA 1Q82T 2MJNA 3EGZA 1WD6A 3TX8A 2CJ9A 1MWQA 2QN6B 1ZAXA 3H2VE 2DCUB 3JYTB 1HNWJ 2RSQA 2XMTA 3FKBA 2I9SA 4C48A 5EWGA 3LAMA 1JJ2R 3HHEA 1GQEA 4N41A 2VASA 3QZ7A 1DTTB 4O3SA 2DHXA 4R5PB 8ATCB 5F8HA 4KHPJ 5L1JA 1N5TA 4QWBA 2KTQA 3PFEA 4DX7A 2X1AA 4M5DB 2HG4A 5G0RB 2J7UA 2B6AA 3N9UC 3QRPA 4YS2A 4ZIVA 3QO9B 1S97A 1T03B 1RTHA 1MLAA 4NPOA 4A48A 2IDEA 1RSCA 4I0WA 4F67A 4OX8A 1JJCB 2C28A 1FJGJ 2UUBJ 2HPUA 1WSRA 3HT0A 2HEKA 5A8WB 1XQIA 4DS5A 2RS2A 1TL3B 4JV1A 4NCGB 3C66A 5BYSA 3G86A 1NJZA 1NUEA 5HMXA 3BEGB 4RW4B 3RZAA 2DH8A 2RE1A 3GIIA 4K5SA 1N5YA 2R42A 1EARA 1ZM4A 3R9LA 4RU2A 2XWYA 2ACYA 2EFGA 2LXUA 3R5GA 4DV2J 1SC4B 4R0JA 5FDLB 4RBVA 1SB6A 3GR1A 1S6PA 4C0OC 1GX6A 3DMJB 4Q44A 4DV7J 4KV8B 3K5LA 2CIMA 3PEJA 2B5JA 2MTLA 3MMCA 4HT7A 3C6TB 1H2TZ 2ACMA 3LGHA 4CLPA 2YNFB 2JC1A 2AZ1A 2IA0A 3ETMA 3ENAA 3PW7A 4MT1A 3US5A 3W8GA 3BKTA 4J9UE 1HNXF 4RJVA 2ZEJA 2BR0A 3W8PA 1S7HA 5KG5A 2B4VA 3GR0A 5KFOA 2XNRA 1DQ9A 3W5ZA 4WU2A 2QYGA 1DLOA 4D3GA 4NLOA 3SCKE 4G3IA 2OFGX 5D4NA 2E7VA 3GQCA 4LF2A 3C19A 4A46A 2DR5A 4W98A 3ZO7A 3TX0A 2WAQD 2AIRB 2MYFA 4Q8FA 3MEGB 3CPWR 2RDDA 2VBZA 3SSQA 3BV8A 2AGOA 3P45B 3DRRA 2D74B 3T3FA 3EGNA 2HLTA 1QE1B 2GQ2A 3EVMA 1KLNA 3R7SB 3PJ9A 4JI7J 2B51A 1RJJA 2MQQA 3EVOA 2RH3A 2M52A 1UFWA 1YRTA 2HRYA 1H2VZ 2UUTA 1HYSA 1D09B 3ZTRA 3AJ2A 4IG3A 4MIAA 1CJTB 4QYRA 3POTB 1NM2A 2NQPA 4ANCA 3SFUA 3V6HA 1IBCB 2XY5A 3RBEA 2J76E 2PFDA 2ERRA 1IKXA 4H54A 1T3OA 1EAYC 4ZP8A 3I87A 2H9ZA 1NK4A 2MZQA 1JLCA 4NZ7A 1TV6B 4JYAJ 4PWWA 4OYAA 3IBWA 2E66A 1GK8A 3BSAA 2R2SA 3HVTB 2KFZA 3ETOA 4YB6A 1U6FA 4V19X 2C2OB 2LDYA 2XO6A 1TKTB 3HZEA 2ILYA 1YWXA 4URQU 3TA2A 5A0YA 1SC6A 2KYXA 3DLEA 1JQGA 4C8ZA 1C1CA 4YY3F 4A8FA 3FNNA 4M94A 3K0JA 4OV1A 1UVKA 1FKOA 3ZC4A 2DISA 2ZJRQ 1SJFA 3GFXA 2KI2A 1XEZA 2B7CB 4MKAA 2M8DB 4YB1P 2PN6A 3DDIA 4KIAA 4B3OA 5L38A 4EMDA 4DX8H 2XY7A 4DL3A 3T41A 3M2RB 4KO0B 4UQGA 3W9IA 3NNHA 1FKAF 4HH0A 4EZ6A 1FF2A 3G8TA 2JOQA 4Q45A 1NSKL 2ZOMA 5AE3A 1Z1ZA 4NLDA 2A2CA 1ZYQA 5KG4A 4QWEA 1F9FA 1VQ7S 1VHFA 3ONQA 4WP8A 2EC2A 4YMEA 1RT5B 4HEA9 3CCTA 4QYZJ 4U6PA 5DDOC 4O4GB 3RJMB 2BKPA 3OJSA 3WZ0A 3AH6A 4CTAB 4WKYA 2FUG9 3HKWA 4A47A 1PBAA 3D9BA 1GXLA 5F0WA 5IQQA 3OLBA 2X7IA 3A8EA 1FCAA 1XBWA 1LNQA 3DYAB 4C9DA 4NYZA 4W4MA 1WC6A 1MU2B 4PRFA 3DI6B 2WHOA 1AYEA 3BB5A 2PMHA 2VL1A 3MFIA 2O5DA 3AB4B 3KLIB 5ETQA 3MF5A 4RW9A 4WFXA 4JI1J 5E3CA 4RLEA 1HNIA 5CXTA 3R3TA 1KQGB 1JXVA 5J2MB 5ETVA 1LW0B 2OUGA 3R5AA 2M88A 2LXFA 2Y0BB 2DNHA 3QIPA 1UFLA 3RB4A 3KXDA 4HHUA 2FC8A 2XLKA 2DNNA 2GC8A 2VD3A 4FS1A 3I32A 2HVIA 3M2UB 2OPQA 3DOLB 5HP1A 3BN4A 2C3MA 4URGA 2HAIA 2CVIA 4DUTA 4BLGA 3M8RA 1HW9A 5KFWA 2CQDA 1DQ8A 5GAEU 3JTPA 3OD2A 1S48A 3GTYX 3F41A 3CD6S 2DEIA 2MZJA 2P9CA 1RBOB 2ZBRA 3CDBA 2HS0A 4DLEA 1IBLJ 1YGYA 3J7YI 1Q0NA 1XMOJ 4O3OA 3BYRA 2FDNA 5DG9A 3TOQA 1CJVA 4CQ1A 1QSLA 2W2QP 4H4OA 1B70B 3ZNUA 4NASA 1K73T 3FQLA 1KTQA 3CD5A 2VG5A 2O66A 4YHHJ 2DHGA 4OYZA 3KMSA 5KFQA 3CDAA 2HFZA 3JQKA 4HH1A 4C8KA 1AZSB 1HBOB 1JXEA 2IYGA 1X5OA 5AXLA 4C8NA 2BDPA 2P6SA 3QGIA 3MR7A 3K7RA 2K7JA 2VODA 4LFCJ 5GAGI 3SV3A 3MR3A 3M9MB 2HRUA 3VGSA 1IM4A 2E29A 1HHQA 3A1YG 5KOWA 2ABYA 4YR0A 2RRNA 1SQEA 2R3VA 3IGVA 4HTJA 1MW7A 3I9V9 2J0QD 2GMJA 1S49A 3T19A 4Y34A 3B8HA 3VWSA 1S9GA 2UXBJ 4ZP9A 1UZHA 3LF0A 2D1CA 2M70A 5DM6Q 2ZOFA 3W2WB 1U45A 4ZDNA 5KFEA 1TTHB 1HWLA 1RXOB 5D0EA 1JLQB 1PYTA 3R6GB 1U0HA 1N5SA 4NMLA 3CO0P 1VFJA 4R0EA 2RNEA 1I3OB 4WJBA 1N52B 4IH6A 4FZVA 1W25A 4A8XA 1TL7B 5HROA 4U8VA 1VRTB 3TUJC 4I7FA 2DNQA 1X8DA 3TEGA 4CLSA 4NXMF 2EBGA 2Q6CA 3U27A 4DSIA 4JBCA 1S1TB 5L39A 5U47A 3DGPA 2YNGA 1R8BA 4LBHA 4X66F 1FFWB 3R5BA 1Y5NB 3CMQA 2OH2A 1YJUA 4Z7CA 1HBNB 1JWWA 3VAIA 4RUBA 3C16A 2BQUA 3EJMA 3EE3A 2ZJPQ 1CS4A 5J2QA 2XZWA 2JHEA 2VPZB 4FKYA 1SV5B 4ZKAA 1DURA 1NH8A 1GH8A 1VGYA 1HPZA 2YNIB 3MCOA 3MMJA 3EPIA 1H98A 2RF2A 4TY9A 4C3MA 4DV4J 4TU8A 2AYBA 5D3GA 3PY8A 4CLKA 1RT2B 3CJ3A 3H4DA 1JKHA 2CJYB 1TQLA 2XNQA 1F3VA 3M8YA 1KS2A 1HMVA 2CQ1A 5L46A 4CM0A 4BWJA 2C3YA 1RHJB 2P9EA 2KRBA 5ITHA 1RAIB 4P73A 4USUA 2VDHA 3N79A 4JI0J 1J5EF 2W01A 3CC4S 2ASJA 1SKWA 4JI4J 4BCAA 3M8QA 2HHHJ 5KFIA 4HT5A 1U1MA 4F3OA 3PYEA 2Q3PA 2ZH8A 1RT4A 1TELA 3BO4A 2F9DA 3D3BJ 2ZHBA 3QWUA 1OQ6A 2DTJA 3UO0A 1YJ7A 4QCLA 4GKJF 1ZAVA 4CO0A 1NXIA 5A8RA 3MFHA 3ITHB 3GPAA 3T6JA 2RVJA 1KOOA 4K0KJ 2DXDA 3FEZA 4JV2A 2FIUA 3PACA 3D3CJ 1NHUA 2KXHA 2DGUA 2H48B 3L7UA 2PA8D 3CXCR 1K47A 5KFXA 2QC3A 1D3WA 1FDDA 3DHWC 3GV5B 4WYWA 5GMEA 2B7BB 2ZBQA 4WFAQ 4KPCA 2KXNB 5K8MA 3PCOB 2HRTA 1FD8A 4LF1A 4GC6A 2CNOB 4PG7A 3QAEA 2AT1B 2CPZA 3HFKA 4XAKA 4X62F 3OTOF 2GCFA 4UF4A 2YVSA 1U1LA 1BUXA 1YRUA 2BE2A 1AB8A 3MCMA 3RYLA 2B6AB 4A8SA 1NK8A 2AJQA 2M9KA 3DLBA 1RTHB 2PE8A 5HANA 1T7PA 1GEHA 3NCPA 2JNJA 1QLNA 2F9JA 4IR9A 3J81U 2XYGB 5DJBA 2LVWA 3VAGA 2XG8A 5JMNA 2NXUA 2MQNA 1NSPA 1P1TA 1RAHB 1IR0A 2WSEC 2XGPA 4NMXA 2FC9A 4OZ2A 2LYVA 2IFXA 1VBXA 5CCLA 2CADA 2HHTA 3KDNA 2OEJA 1FJEB 2E5GA 4QWAA 2ZKUA 1M1KT 3ADAC 2DRDA 1FESA 3L7PA 1N32J 3I5CA 3PHEA 4UT4A 3N0VA 3IGNA 3HVWA 2E5JA 3JTNA 3HVAA 3ZZUA 2HQ3A 2CQGA 2YKMA 2AWZA 4H4KA 3L95X 4ED0A 4F0MA 9ATCB 1S6PB 2LLZA 3IBCB 1NZAA 5F8IA 4CO1A 1N6QA 2HQDA 2YWHA 3AOBA 2X1GA 3HD2A 2OD4A 4F8RA 3MMCB 4NYOA 5F41A 3OQ2A 4PXDA 1DTQA 2ZH1A 4DZDA 2ZWPA 6FD1A 4MJKA 1VHIA 3FSIA 3LQVA 2AGPA 1WEZA 3QT7A 4NLVA 1CVJA 2DVIA 1FNXH 2AQ4A 5HO4A 1DLOB 1HWUA 1JJ4A 4DQPA 2HFSA 1CJUA 3MAHA 4ETZA 1REVA 4WIIA 2K1RA 3GCXP 3H5UA 4G1PA 3TUZC 1S77D 2F7VA 3CMES 2RQKA 5CAAA 4OZ1A 2GJ2A 1KNZA 5B0FA 4P74A 4LF7J 1B7FA 1IJFB 3TZZA 2A3JA 3DRRB 1U1QA 4QIGA 1X9WA 2N4DA 1NH7A 3AQPA 1RT3A 3KK3A 3OTDA 3SV4A 1IXKA 4I6WA 2RIJA 3UDVA 1SIWB 5KFUA 4LSLA 4LBIA 3DLHA 2H4WB 3EDRB 1HYSB 4WFBQ 3DM2A 4NZ0A 2FQQB 4IG3B 4ES3A 2FZGB 4IDKB 1ZH5A 3R2CJ 2GIQA 3DU5A 1Y9OA 2HZCA 1N34F 2IC3A 1EKRA 3QGGA 3H59A 4MTPA 3MM9A 4CLLA 1YZ6A 3SCJE 1JLCB 4XIUA 1BC6A 4DR7J 1SKRA 2BE9B 2XHWA 1UEKA 1S0NA 5EDWA 4FNIA 1SQGA 1RABB 3S7RA 1SKUB 1RGVA 1T9YA 4ZITA 2AYEA 3SQOP 2RD5C 1HR0J 4NLRA 1ACMB 1T9TA 2RILA 1NEEA 5K8NA 3QYYA 2HVHA 2JL9A 1OMSA 3V6JA 2KJWA 2AX0A 1VQOS 1A7GE 3IR5B 4PPDA 2R2RA 1HI8A 3DLEB 2ALYB 2ZUAA 5E3PA 1U1KA 3BJYA 3ZZYA 3H8YA 4K59A 4Y00A 3CB4A 4OZ3A 2VBXA 2HHPA 4PG6A 1G7CB 1TL4A 2X1FA 4ID5A 3NY0A 5J2NB 2GVZA 2Z2ZA 1JX4A 2VV5A 2GHPA 1Q7LB 2NCKL 4DN0A 3MR5A 1RTDA 4KR0B 2AJ1A 1UMJA 3EXCX 3LOUA 1T9VA 1U1NA 1YJRA 3CE8A 1VLYA 3MURP 2W24A 3RG6A 4JUZA 3AJDA 1QAXA 4UZCA 2DR8A 4Y2KA 2LQ5A 3MM6A 2ZHAA 3OVAA 4OZJA 4WP3A 4UUWA 3HO1A 2HQGA 3GJQB 2F1FA 1UPMB 1C4CA 3UCUP 4F25A 6AT1B 2JX2A 4GMKA 4U96A 1MMDA 2B3TB 3J81j 3PW5A 2C2DA 3GU0A 2BOAA 3MEEA 2ZD1A 3IG1A 3EDQB 3LGNA 4QJVA 3ILIA 1DHMA 1RZMA 4DR3F 2VPXB 3MAQA 2RHQB 1K1SA 3R27A 4ID8A 2GA7A 2GV1A 3C15A 1C0UA 4C0HA 4I69A 2DK2A 1HNIB 3I56S 2FZCB 2K3IA 4NXNJ 1PCAA 2B56A 2CDQA 4TXSA 3LAKA 1GTHA 2FLOA 3QIPB 1K0VA 3PKMA 3OL6A 1I1GA 3EX7B 1NRKA 5KFSA 1OY8A 3HI9A 2C2NA 2UVRA 4TU9A 1CQNA 2CDRB 3GIJA 4ZCMA 3P3DA 1HBUA 1V3RA 3GB0A 2H4YB 2OPQB 2ZM6F 3PZPA 5HP1B 2D3ZA 5FJ4A 3HULA 3R7BB 3HLUA 4PG8A 4DR6F 2GAHC 2XS2A 3FMBA 3BQ1A 1VYAA 3ZZ0A 5LJ3Y 2ASLA 2CUYA 4QR1A 2RJZA 2EXUA 4HACA 5B0GA 4ZN3A 3B6BA 2BA9A 6FDRA 4F50A 3TUPA 2ZNYA 4OYWA 4DL0C 3J7Z5 4H4OB 2UUAF 3HZGA 4PWDA 3I5BA 3IM9A 1D0EA 3M7VA 2J0XA 2VG5B 2GZOA 2EWHA 4C8OA 2YKNA 3G9CA 3A3PB 4NZ6A 2LDIA 2WZ1A 2W7OA 3A8IA 2VQFF 2EG2A 1L5UA 1QY7A 4NI2A 4FF4A 5D6GA 2V8GA 2MEWA 4AUKA 2KJVA 2HAFA 3VGVA 4NLWA 1BD6A 1TK5A 2R2TA 3OL7A 3G8SA 3QSIA 1NDLA 2CZ4A 1B0VA 1P6TA 1HKAA 4K2XA 3CUNA 5HL7Q 1N5QA 1SJQA 1S9GB 1PKUA 1RU1A 2BACA 1Q1KA 3SCIE 1S0VA 5K14B 3WC0A 5LMUF 1NPKA 2VFUA 2KO1A 3MPWA 2Q6BA 1U0HB 4IRKA 2XSJA 1ZZNA 4ZP7A 5L1IA 4OI6A 4KGVB 2RDJA 5D78A 1YG0A 2BZ2A 1NKEA 1HWKA 5KFPA 3DLGA 2VB6A 3AAWB 1QTNB 1N48A 2OEMA 3MEDA 3M6UA 3CMAS 3D0GE 5HROB 1HNXJ 5KFTA 1V6HA 2KHDA 1G6BA 4N8NA 1AXQA 3TJ8A 1OY9A 4QR0A 2JFDA 2BANA 4EWTA 4YQWA 3OUYA 1LWCA 2WRMA 2XMVA 1TUVA 4PYDA 3DGVA 3QGHA 1A9NB 1WG5A 2LA6A 2YNGB 4RL1A 4J9VA 2M2BA 4U7UD 1WJ9A 2RUGA 1RAFB 3NCRA 2RU9A 3C16B 1KHVA 1CS4B 5J2QB 3QFHA 2F8MA 4F4AA 2KM8C 4EK2A 1HD1A 3FUYA 1RE1B 1HPZB 4OHXA 5MLCV 1FX4A 2RF2B 2F3JA 5KFNA 2GNKA 1RKJA 3MMAA 2P9GA 5B0CA 2DGQA 2JEIA 1WDTA 4YN3B 3DLJA 1WEXA 5D3GB 2LFVA 1TKZA 1DJ0A 4FXWA 2O1PA 4NRUA 2EFOA 3UD5A 2HNDA 3FCVA 3KOAA 4YFUA 2PEBA 1JKHB 3Q22A 3AXMA 3W63A 2WVFA 1AUSL 1FHTA 1HMVB 3R5CA 2V8VA 2IA6A 2HHVA 1CULA 3FRZA 2EFQA 2M8HA 1FK9A 2WVEA 1R8PA 2CQHA 5B0BA 4B17A 5HATA 5HLFA 3SYZA 1URRA 3M8QB 2GS8A 4LF9F 2Q1LA 1K44A 2GMHA 4G6VB 5KOXA 1CJKA 2DR9A 5DRKA 1AFIA 1RT4B 3LA0A 2YWGA 3IN5A 2WONA 1W7WA 3PDNA 4ANEA 1D1UA 4ECVA 5L8RC 2R7QA 4KGKA 4UOHA 5DLFA 4LRDA 4XK8C 1Q16B 2KT3A 5A8RB 3CWJA 5AE1A 4LVOP 3BKUA 4FVCA 1WG4A 4DBQA 1CG2A 3PM9A 2ROGA 1LFPA 1FTRA 2DIUA 4YY3J 1ZS6A 3M30B 4I6YA 2U2FA 4IO1A 4YEAA 4R25A 4IYQA 5E5NA 2FHJA 1SJ1A 4Y6IA 2N3OA 1LEOA 1F5CA 4LQ9A 4K2JA 2MMYA 1NBEB 1D9DA 2G1HA 3KLHA 2H5EA 2FVQA 2V2ZA 1TFWA 3AD7C 2BE2B 2WBMA 1X60A 3OXGA 4J9LA 2XQCA 1C0TB 3P49B 2BJEA 4RX6A 2OAUA 2FYXA 2JLFA 2YH0A 1ZPWX 3D66A 3BBCA 2CPHA 4FKXA 4FF2A 1ZM3A 1M90T 5IWAF 1M5SA 4WFZA 3C3LA 1S99A 2H5IB 3EM1A 2OLWA 5J1PA 3K5MA 3BYPA 1OQ3A 2AKWB 3UI3A 1Q79A 1HQUB 1B0TA 1Y3KA 5A8WA 4Q8EA 1O0PA 2ALZA 2XULA 3MPVA 1N4LA 2FVSA 1FFGB 1TMMA 3J81Y 2HMIA 1FNMA 5HMYA 2D69A 2YKMB 3VVTA 1RWUA 3TJ9A 3J80Y 3JXOA 1OYEA 2HQCA 2F40A 2BQ3A 1N6QB 4N7TA 5AE2A 5GVQA 2IVMA 4F4WA 1RHQB 1UEUA 2OPRA 5FDLA 4DR1F 3DMJA 4TN2A 4IH7A 1DTQB 2FB0A 3UD4P 4NLQA 5F8LA 1PYOB 2ZOGA 1Y0HA 2KG1A 4QU6A 2Q66A 4A8WA 4DL7A 3TARA 2MKIA 3IRXA 5JVHQ 4J9OA 2PDAA 2DGVA 3FZBA 1WKLA 1UAWA 2FPHX 4O44A 2ZWOA 2W8LA 2UVUA 5KT7A 2UP1A 1ZZFA 5L9XA 1YITS 1CJUB 1HHSA 1CSJA 1REVB 2NSBA 4DF4A 1VBZA 3Q2TC 2K1RB 4FYDA 2DGTA 3ULHA 1NK0A 3KLGA 4EO8A 1FEHA 1H38A 1R27B 1UW4A 3PW0A 3K8VA 4XPCA 2B4OA 4OV6A 2E7XA 2IHR1 1F60B 4UZBA 3I0RA 3DLLQ 5LM7E 4ETXA 1M0SA 1QUVA 4P7TA 1BQMA 2V4RA 4OQJA 5E2QA 3BGFA 4LSLB 2DNOA 2BJ8A 4S0MA 4QBUA 4NRTA 5DM7Q 3Q8UA 5T41A 4KTQA 3DM2B 3TVZA 1SBRA 1XK8A 1S1WA 4J9NA 2G2OA 3EWGA 2DRBA 4QQBA 4X2BA 4U9RA 2ZZTA 2WVBA 2APOA 3DNCA 2IC3B 2C42A 4UQTA 3MM9B 2J7WA 1X0PA 2KT2A 1CJTA 2KT5A 3DOKA 1YBTA 2BEFA 2HGLA 1UVNA 3RR7A 3BR8A 1EP4A 3DU6A 3Q8YA 2COLA 4N56A 2LQJA 3D1HA 2BUNA 4IOAQ 1F3FA 5L9NA 2VICA 1TV6A 2AMCB 2R7WA 1RWMB 4WZQA 3GLJA 3RW6A 2OD6A 1WC1A 4L73A 2EG1A 3W62A 4MAKA 4AL6A 2L08A 2YNHA 3IM8A 4P52A 3A3OB 1Z2ZA 4IH5A 1EHWA 1OPZA 3SBMA 2DY9A 2V68A 1TKTA 3CD0A 3BSNA 3CJ2A 3MR6A 2VC0A 4Q0BB 2W9CA 3DOMA 3KWMA 4ID5B 3NMAA 2GVZB 2UVWA 4ENOA 4B3RF 2F65A 3T5KA 5J2PB 5ETLA 2GHWA 5E33A 3ICLA 3QSYB 2EI5A 4NXMJ 3PVXA 3OHAA 1FWKA 4LR7A 4NLUA 4CLTA 4U8YA 1WORA 2G0IA 4X66J 2VIHA 1JNRB 3KDOA 3H25A 5GAHI 2LECA 3CC7S 2HVEA 2DHHA 2XYPB 3B54A 1FRHA 4KO0A 1RA7A 3RBZA 3NGSA 3OR2A 4CO5A 3OFEA 5D0RA 2W4DA 4WKRA 1S5ZA 2NXEA 4IG0B 1OS5A 2UU9F 2A6MA 1X4DA 2EKNA 2YX1A 1OYDA 1XIQA 4OFZA 3GV8B 3H0PA 1KKHA 2GQCA 1GMVA 3MUMP 2MY8A 3UN3A 1K9MT 1SC3B 4M5KA 1ZTTA 4O4GA 4M5IA 4CTAA 4XTTA 3TJAA 2ZD1B 3MEEB 4PPZA 3IG1B 5IT9U 3BPSP 1SC1B 4P2SA 1NAQA 4F2SA 5B0AA 4USVA 2VUGA 3DCAA 1M5KC 3TUIC 4OJGA 1J5EJ 3VCDA 2DB1A 1MU2A 2D41A 2WW8A 4AQYF 2LEBA 4MK8A 3C15B 1C0UB 3PW2A 5KG0A 4M5JA 4P72A 2ZC4A 2DGWA 1FWLA 4H4MB 5C24A 2B8PA 1Q86T 1YJ9S 5F8MA 2OTJS 4GKJJ 4FS2A 4DX5A 4DPUA 3IC1A 2E1RA 1QD1A 4EEYA 1HBUB 3CJ0A 2HBQB 4OYXA 4DV5F 2MPUA 3HM9A 1R31A 3RBDA 2OP5A 3WQPA 3DOLA 2V6AA 4USJC 2QMXA 2J9DE 1HI0P 5DDPC 4USTA 1TP7A 2XZTB 2F8EX 4YR3A 4K5RA 4KHMA 2HS4A 4C7QA 1S1UA 2EW9A 4U7CA 4BC7A 2CPJA 4HACB 1PJ6A 3HJFA 2N82B 1N0VC 2ROPA 4RW7A 1FT8A 4X62J 1KVIA 2J9EA 3OTOJ 3QFWA 1JLGA 2NLWA 1JK9B 4PWDB 3F73A 1YX2A 4LF5F 2YKNB 2PO4A 3KTQA 3L4BC 3B78A 3EZ5A 4RW8A 1UVLA 2GAGC 1FJGF 3K2YA 3M32B 2VONA 4NI2B 1P9QC 4B9SA 2QTWA 4KGMA 1AZSA 4WK1A 2CWXA 3WC2A 1PSDA 2Z56B 3TI0A 3MPDA 2VPWB 3T9ZA 4EGLA 4TNOA 2IRYA 1TAQA 4G65A 3PIPQ 1OSDA 3ZZTA 2OELA 3DRYA 2XS5A 4IFVA 4C0BA 3PKYA 4M95A 4DV2F 4TY8A 3KG1A 4NE9C 1KQFB 4KH0B 4WTOB 5JVGQ 1VBKA 3TZWA 5D8HB 2CQCA 2VQEF 1FO1A 3J7YU 4LF6F 2FHOB 2YKOA 3GCWP 2EFPA 2XSJB 3J7AN 5FLXY 2XLIA 3T1YF 2CQPA 2CPIA 3W60A 3U1NA 4HI2A 5K9FA 3DLGB 1XNRF 5FD1A 1U7LA 3MEDB 3OXFA 2CZVC 1R0AA 4UW2A 1KWMA 2PD1A 2L3MA 3TA1A 3D28A 1S0OA 4IOBA 1YRXA 2N4CA 2GJIA 2XI2A 2BANB 1RWKB 3OUYB 1LWCB 1TL7A 1TAUA 1J5OA 3O2IA 3BGOP 2UZAA 3RRHA 3M2VB 2KG0A 1KRPA 2PGCA 4K8RA 5GAGU 4NA3A 4B9LA 1QTMA 4O23A 2EC0A 4L6V3 1TR0A 2Y3YA 2RQMA 2FY1A 3ZTSA 2NXNA 5A8KA 2QEXS 4FBTA 2C2MB 5IT0A 3MMAB 2RB7A 2I0XA 3N6MA 3RAXA 5EUHA 4RNNA 4OZ0A 1TKZB 1RCOB 1FA0A 1RWNB 2BJ3A 2HNDB 5K8OA 2GHVC 1KTVA 3JS9A 3UW1A 3MPYA 5D0GA 2HVZA 4LRFA 4Y2MA 2BM1A 4G1QA 3AT1B 2XMUA 3IP0A 3UNGC 3CEDA 5EN1A 1FK9B 5LSRA 4N76A 2H3EB 2XMWA 4QW9A 4DF8A 2OHDA 4FYWB 2KM8B 2EFNA 2DIVA 3GFYA 2HVDA 2LU1A 2GO8A 1M1GA 2A6OA 3TWZA 4CLUA 3S8SA 3W5YA 2VZ9A 1ZTWA 1H2UX 4AL5A 4B9VA 2WONB 4DCJB 1YKWA 4B3TJ 5J1NA 1KONA 1GMWD 4RNFA 3PYGA 2E5IA 3QT5A 4PXCA 4OYBA 2WB1D 3P5TL 1KR4A 4DPXA 1KD1T 2XMJA 1U25A 3IAS9 1RUSA 1RHKB 3LP2A 5E3AA 3KLEA 4J5OA 4FBUA 2BBEA 3NGUA 2J6SA 1XC9A 1KOHA 1SH2A 4WF9Q 3M8SA 4RUHA 2Z58B 2FLPA 4DR4F 1F9EB 1WDDA 3H7HB 5KFAA 2DNGA 2KYZA 4MYTA 3KLHB 5HQ8A 2HFVA 1FJCA 3RB0A 2D9PA 4A8OA 3JSRA 4A8YA 1B3TA 3DRXA 1WG1A 5DG7A 2C3OA 1OPIA 4HHJA 4P2XA 1HL6A 3GSIA 3C8YA 3B4DA 2R9LA 2VU5A 1WF0A 4KB7A 2PSZA 4JI6F 4DG1A 2JLGA 2HFOA 3ILJA 4RWWA 4PXEA 4HYKA 5F8GA 4N5SA 1BXNA 2D3OR 2P5VA 2NR0A 3OLAA 4YUDA 2V9KA 1HQEA 2H5JB 2OPSA 2UXDJ 3UDEA 3FSXA 2F5GA 3LPEA 3KHHA 2KRRA 3CJ5A 2OIHA 2YX4A 4ED3A 1U02A 4DR3J 5A76A 2HMIB 1O6XA 1N0UA 1AA1B 1LFWA 5HBMA 5M2RA 2PA3A 3CJQA 1TUGB 1SVDA 2IRUA 2V69A 2OPRB 1QJHA 3KNAA 2VA3A 4RUAA 4B9UA 1Q7YT 5LT5A 3BR9A 3UN2A 1VQLS 4IUFA 2CJBA 4ED5A 5SZTA 3NEKA 4EU0A 1H72C 2VF3A 2MJUA 2ZM6J 2HGMA 2NS1B 2CJXB 3IRXB 3RRGA 3BDEA 2KB2A 3GWCA 2PI4A 1T05B 3VZIA 3O1LA 4LF4F 4O44B 5F3ZA 4DR6J 3NNAA 4YP3A 5DZ7A 4YDXA 3UVJA 3D6FB 1LV5A 2KU7A 2QT7A 3O44A 3PFOA 1IBLF 3EPGA 2RDIA 2GIRA 2HQFA 4LR8A 3AB2B 3KLGB 3OJUA 3MPUB 1SH3A 4EBCA 1WC4A 3I0RB 3IRWP 3T9NA 4GRSA 2IAJA 1SL1A 2BKOA 3HSGA 1VC5A 2UUAJ 2HIQA 4YHHF 3IWLA 1QSYA 1BQMB 4OYIA 2B9XA 1X0FA 3PW4A 2ZUGA 2Z2MA 3PRVA 4ICLA 1RAAB 3GZ7A 1JLFB 2E44A 2J0WA 2DGXA 1AROP 1S1WB 2V2KA 2VQFJ 4NEYA 2YWFA 1R7IA 1ZM9A 1EETA 5T7LA 5EWEA 1ZAWA 4CO2A 3WHIA 3DOKB 2OMLA 1UVIA 4IDKA 3FBBA 2I5JB 4QR2A 4HL9A 1XNQF 4J9QA 1EP4B 4CH0S 5LSOA 4K4YA 2DR6A 1KQKA 1HA1A 5IM0A 1O51A 2YQ0A 4WTYA 1NB2A 3PYDA 1FRMA 3CCMS 5HAOA 3MMBA 1VK3A 2A18A 2E1PA 2AEMA 2I38A 2FJBB 3IAM9 5CABA 2YNHB 1VQYA 3JQJA 1X4GA 4V19J 1OY6A 2BJ9A 4OZ5A 2QYCA 4YR2A 5LMUJ 3TNVA 1X4BA 3ZZOA 2LMIA 1RT6A 1HWJA 5KT3A 2IPOB 2W9CB 2MY7A 3HHKA 2R7UA 2RS8A 1RAGB 3DOMB 3T6BA 1GT8A 2Y1JA 4Q7AA 2W2OP 1VCTA 1LWFA 1RTJA 5SUHA 3CCUS 2K8GA 3JTOA 5KFDA 5IOLA 4LT6A 3QATA 5J2NA 1MNEA 4USKA 1RB0A 4ZLJA 5AXNA 1WACA 3TVKA 1S59A 3KHLA 1S1XA 2QLFB 4LQ3A 1TK0A 3UR0A 1V3SA 3VHQA 2FJXA 3NBPA 3OVBA 4ZMMA 3FCWA 1VJWA 4MK9A 1WTFA 2JEFA 3OR2B 2YWWA 4DV1F 5HMWA 1WC5A 1UVMA 1QSSA 2EEYA 1BQXA 1U2RA 2QA1A 1HI1A 2WW4A 3UDLA 1BLUA 2OGUA 2AYGA 1T94A 1KVJA 3HSDA 2M5YA 1VIXA 4QPXA 2JC0A 3ZZPA 2ZH5A 4UUXA 1UPPA 3SDEA 4RZRA 3ENVA 1L3TA 5EX3A 4OJ1A 2CPEA 5KG1A 4QIVA 4CO4A 3AOCA 4JB8B 5KFYA 4C3LA 1VC0A 4JI8F 1UCNA 5DDQC 4I6AA 2MSSA 2N7CA 3CT9A 1SPBP 4O4RA 4Z7YA 2VG6A 3OSPA 4LF9J 3MCSA 2O67A 3PXGa 1MSWD 4LF8F 2CRLA 1SH0A 5C24B 1ELOA 2JSXA 3PYFA 1S72S 4BHQA 1UW9A 4IQMA 4F02A 2PEHA 3IMQJ 1N36F 4JOUA 1HHTP 5DS7A 2BV3A 5BXIA 2Z2LA 2UUCF 2NSCA 3R6LB 5C5JA 4C4WA 4PXBA 2EFVA 3Q2SC 2WSFC 3AD8C 3LH2S 4DQIA 3FBFA 4UY8T 3NLCA 1HBMA 2AJ0A 1NJIT 4RW6B 3PX6A 4E2FB 1W2BR 2HYIB 1RA6A 1S1UB 1RYSA 5KT5A 3THVA 1NJWA 4IO9Q 1PJ7A 4C3KA 1CEZA 4LIRA 3KHRA 1S0MA 4OHWA 4RW7B 3CIMA 4GKKF 2ZZMA 2HHXA 4ZCIA 1JLGB 1T8EA 3CJKA 2DT9A 5H9EJ 4YB5A 1VRUA 2QFJA 2MKJA 5CZXA 4RW8B 5KFKA 3OTBA 5IWAJ 3GYGA 2A0FB 1BY9A 2ATLA 2BW7A 4FF1A 4MKVA 4RUCA 1OSCA 3BREA 1HW8A 4WWSA 1RYRA 4WCEQ 4J90A 2XMAA 1IBKF 4ATNA 1HWIA 5IV4A 4DFKA 3KK2A 2CQ3A 4TYBA 4EYIB 3QJJA 4WFNQ 3FMWA 3OT9A 2ZITA 3LUYA 2BYCA 4ECUA 4IFVB 3C14B 2XSFA 4UOGA 4DPWA 4TY8B 1KLMA 1WHVA 3MR2A 4DEZA 1VOMA 1RADB 4ZPTR 4AXIA 4NA1A 4DR5F
chains in the Genus database with same CATH topology
2V5HG 1G2EA 1APSA 2B9WA 2EFGA 2LXUA 5DRKA 1AFIA 1RT4B 1TFYA 2I8EA 2UVVA 4F4YA 4BBYA 4AL7A 2KZMA 4R0JA 2YWGA 3IN5A 2WONA 5FDLB 4RBVA 1SB6A 4NCBA 1S10A 3GR1A 1VQ4S 4KC5A 1S6PA 4DL2A 2DPJA 4C0OC 1GX6A 3DMJB 4KRWA 4F3QA 4Q44A 3PDNA 4ECVA 1D1UA 4KV8B 5L8RC 2R7QA 5A0YB 3ZZRA 3TA0A 4KGKA 5DLFA 3K5LA 3IR6B 2CPFA 2CIMA 4XK8C 1Q16B 2KT3A 5A8RB 3D0IE 3V4IA 1Q4RA 1C1CB 3PEJA 4EYHB 2B5JA 3CWJA 4ZOSA 5AE1A 1UA1A 3IWXA 4LVOP 3MMCA 4HT7A 5L1KA 5K14A 5LXRA 3C6TB 4FVCA 1WG4A 3SZ2A 4DBQA 3LPYA 1CG2A 3CDUA 1H2TZ 3PM9A 1FKOB 2ROGA 1LFPA 3OV7A 5LJ5Y 1FTRA 2YNFB 2DIUA 3W2VB 2JC1A 3UWTA 3QGPA 1R0AB 2IA0A 3FQKA 5GMKa 1M5OC 3PW7A 2Z8QA 3OTEA 4B02A 4OX9F 3US5A 1HNWF 3M30B 3HP6A 2XO7A 1HNXF 4I6YA 2J9CA 1LXNA 2U2FA 3JSMA 4Q2MA 2BR0A 4IO1A 1QVFR 1TVRA 1S7HA 5KG5A 4YEAA 1RTIB 3M8PB 2B4VA 1J5OB 1C2PA 3GR0A 4R25A 3PR4A 4IYQA 5E5NA 4B3OB 5KFOA 1V9OA 2DGOA 5KFLA 1DQ9A 2XNRA 4R8UA 3PJWA 2FHJA 4WU2A 1S9FA 1H7WA 4ZHRA 1DLOA 5E7OB 2NREA 1SJ1A 4ZPWR 1UVNA 4Y6IA 2N3OA 3LALA 1U8SA 4D3GA 4K50A 1F5CA 4NLOA 3SCKE 4G3IA 4LQ9A 2OFGX 4RW6A 4WXOA 5D4NA 1SI9A 2MMYA 2I2YA 3KLFA 4OI1A 2FJWA 3CCVS 1D9DA 3KLHA 4KHPF 2H5EA 3GQCA 2ZKTA 1Q8IA 2RKIA 1VQ6S 4A46A 2DR5A 2FVQA 2NZ4A 1U2FA 2WAQD 4LF7F 3EXYA 3QPIA 1TFWA 2J0SD 2PT0A 2U1AA 2XC9A 2HHSA 2L9NA 1GAOA 4OHZA 5K8PA 2MYFA 4Q8FA 3MEGB 2BE2B 3CPWR 2VBZA 2WBMA 4MKBA 1U26A 3SFGA 3SSQA 5A8KB 4CH7A 4QWDA 2AGOA 1ZOTA 3DRRA 5CHCB 3OXGA 3TR5A 3G71S 4UOCA 5JXSA 4J9LA 2D74B 3T3FA 3EGNA 2HLTA 3K58A 1C0TB 1MROA 3P49B 3FVYA 2XI3A 2BJEA 1E6VB 1X5TA 4RX6A 2AV5A 1QE1B 2OAUA 4USIA 2GQ2A 2HS3A 1KLNA 2JLFA 2B51A 5EHHA 1RJJA 2YH0A 4OZLA 1IBMF 3NNCA 2MQQA 1ZPWX 2CPHA 4TU7A 3B82A 4FF2A 2RH3A 1ZM3A 2M52A 3JAMY 1UFWA 4CNYA 5IWAF 4CH1A 1M90T 3D1OA 5GAEI 3LWMA 1YRTA 2HRYA 3NWGA 1M5SA 4WFZA 1H2VZ 4DL6A 2UUBF 4I4BA 1FXDA 1MMLA 5H1SV 3C3LA 1S99A 2UUTA 3HHNB 5HI7A 1Y5LB 2IBKA