1F3VA

Crystal structure of the complex between the n-terminal domain of tradd and the traf domain of traf2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
HEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
publication title A novel mechanism of TRAF signaling revealed by structural and functional analyses of the TRADD-TRAF2 interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 52
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f3vA00
1F3VA 1F2HA
chains in the Genus database with same CATH superfamily
5KFOA 3FVYA 1BWVA 2YNHA 4UTGA 4EU0A 4CH7A 2I2YA 1SIWB 3BSCA 5KG3A 2DK2A 2VA3A 2DD8S 1WD6A 4CIOA 3VAKA 1ROFA 4RR5A 4KR0B 3THVA 1PJ6A 1BWEA 3DXSX 1H6KX 5E3RA 4ZVHA 4LSNB 2DGSA 4DL5A 2RRBA 5JXSA 2UVRA 5GAEU 4FS1A 2FPHX 3OXGA 2GIRA 3HD1A 1CVJA 4A48A 4L3NA 4OZ2A 3F44A 1CJKB 3RW7A 3NEKA 1IBKJ 2CG8A 3NNHA 4LIWA 1ZTTA 1HWUA 4OFZA 4X65J 2ZHAA 2LQ5A 5H9FJ 2YQ3A 4KIAA 4DV7J 2B5JA 3W65A 1JLCB 2DT9A 3G6XA 1W7WA 5E41A 4QPXA 3JQJA 2FJAB 2K1RA 5KT3A 1XNQF 4F4ZA 2EBGA 2MZQA 1BD6A 2CPFA 3RTVA 3AD9C 3GG0A 4WK3A 3DLHA 2DEJA 4HR2A 4RW6A 4KRWA 2ZDPA 3M9OB 4O3RA 3SSQA 1NK8A 3HSDA 3W1YC 1FFSB 1RT3A 4O0IA 3NGTA 3D28A 2W9BB 4HT7A 1XR7A 3DM2B 4KHMA 3T1AA 3HXMA 2C2KB 3EICA 1HMVA 2O66A 2E7XA 3LTOA 4O23A 2JC0A 2V6AA 4ANCA 4ES1A 1E6YA 2QSFA 2KFZA 5DGAA 1SV5A 3GJTB 4B3SF 4C8NA 1UVMA 1PIEA 6FD1A 4BWMA 2BBEA 1H3DA 3T9NA 2W01A 1Q0NA 1CS4B 3V5RA 2AMCB 4FKYA 1NB7A 5EDWA 4RUBA 2KHCA 4LF5F 2QGFB 4NI2A 3BPSP 5LOQA 3QAEA 1ZS6A 3UDLA 2JX2A 1AW0A 3VGVA 3HVTB 2W8KA 4ED1A 3OFHA 3OLBA 5J1NA 1R31A 1DARA 2R8GA 4RPFA 2EFVA 1X4DA 5AJ3F 1LXNA 3OL6A 2G1HA 3DLEB 4UOCA 4M5NA 4JI7J 4WIQA 2VFSA 5GADU 4MTPA 2X1FA 1V6HA 3HHLC 3CNQP 2BX6A 3UCUP 1BY9A 4X4PA 3RR8A 1ZA1B 3KUEA 4NLPA 5D0EA 4LF7J 5JMNA 3IFEA 4O0NA 1QJHA 1NHUA 5BYQA 2GQQA 3IXQA 1U6FA 3IM9A 2OSRA 5LJ3Y 4CTAA 2MGZA 2M52A 1S6UA 1D3WA 4KC5A 3I56S 1YITS 2V69A 2AU0A 1OJ4A 2C2NA 4C0HA 1YDLA 2OMOA 2B4PA 3J7ZT 1H0HB 1S1TB 4ZVUB 4R5PB 3CMES 3WIUA 1URNA 4P10A 2JNJA 2XQCA 4LF9J 1JLGB 2D3ZA 1SVDA 4O4RA 1RXOB 3QZ8A 3KDOA 3ZFVA 2PMWA 3G6YA 4IFYA 2E9ZA 4DZDA 3CDWA 4PUOB 3SFGA 5D0HA 2MKYA 2P8IA 3Q22A 1R8HA 5GAGU 5DLGA 2IBOA 2R7WA 4FNHA 3PYFA 1JLBB 3CDUA 2VU5A 4XIUA 2W2MP 2KM8C 4DL3A 2OD4A 3I9ZA 4PEOA 5E2QA 3WX8A 1YG0A 1NSQA 1SH0A 3CE8A 2YKQA 3NXZA 1NKBA 1PILA 1TL3B 3Q83A 3WX4A 4HHUA 2B9YA 1A6LA 4DXLA 3SIPB 4WP8A 4CLTA 4DU7A 5J2QA 3DMJB 4JI5J 2XMJA 2HVIA 3W63A 3HSGA 2QL7B 4URSA 1H74A 1WNEA 2V4JA 3EXYA 4DUTA 4WU2A 3K8VA 1HBNA 4DR7F 4G1QA 1XWLA 3MMBB 4O3QA 3N01A 2NZCA 2IHR1 4DX8H 4OZ1A 2V2VA 3N6NA 2VQFF 3NLCA 2VBXA 1S9FA 1E6VA 4IO9Q 3V6HA 3FNNA 3MMAB 2K3KA 2EEYA 4IOBA 3RUBL 4B9TA 4ED3A 3AJ1A 3OFFA 3CC7S 4K4UA 2PC6A 3KK1B 2D3O1 1RJJA 2QT7A 2ZNYA 3LWLA 3HVRA 3N6MA 3D1QA 1H72C 3CIMA 1M1HA 3D0GE 2ABYA 4L6V3 2YNGB 4ECYA 2UUBF 1VQ6S 4F04B 4CLFA 2XM3A 3BO2A 3FCWA 2R7UA 1B0VA 2F8EX 2OPRA 1YJUA 3U1NA 2I5JA 2NXCA 4P74A 2N7YA 4DQSA 5DETA 2X7IA 1D9FA 2P6TA 1Y9OA 4RNHA 1N6QB 2AEFA 3VZHA 3SCLE 2HGMA 2GMLA 3KDNA 1WKLA 3LAMA 2I8EA 3GR0A 3PFEA 3W2WB 5K14A 3T1YJ 1DQAA 1VQKS 4WZQA 5CYMA 4Y28C 1XBWA 5JVGQ 2LYVA 1S1XA 3IRXB 4ZITA 2V8GA 1WG5A 2LCWA 4RW8B 2CPDA 4CCHA 1KWMA 4OYXA 2OP5A 3RBZA 3D9BA 4OI3A 2YY3A 1N0UA 2AHOB 1J5OA 2CUYA 3GV5B 1L3KA 2RUGA 4JP8A 2RILA 2BACA 3NMRA 1RKIA 4UF4A 4J37A 5L39A 4ECTA 3O5TB 3DFEA 2HBYB 4AT1B 4PKDB 2V4QA 3FFIB 1T0TV 1EZZB 3WZ0A 8ATCB 4NMXA 4OZ5A 4OYPA 4IG3B 4J91A 3POTB 1U49A 2RRNA 3IBWA 1JLEB 3TW0A 1X9WA 2GA7A 4O4GA 1I5OB 1LWEA 4ZK7M 5HVHA 4OZLA 4RW7B 1REVA 3LP0A 5D0GA 4N56A 1VHFA 3QSIA 5K5MA 4KFBA 1VYAA 4NZ7A 2LDIA 3NG8A 3ZNUA 5AXKA 3AOAA 2VG6A 3V81A 3JSMA 3DDKA 1LW0B 4CZCA 5C42A 4LF4J 1U7LA 2CQ4A 2IRUA 4FS2A 5KFGA 4ZVEA 1FX4A 2QA2A 4EWTA 2OFGX 3TNVA 1HNIB 1NSPA 1UA0A 4I6AA 3MEEA 2P2CB 3R5GA 2B3TB 3DOKA 2E5HA 1L5UA 5CAAA 4USWA 3UR0A 1HNXJ 4X66F 4JI1F 3CJKA 4ATNA 3FMBA 3LGHA 3MCSA 4NASA 1RT7A 1NK5A 4DV1J 3D0HE 4ZCMA 2K1RB 4TVAB 3UDEA 2CDRB 3SQOP 4DL0C 4U67Q 2J8AA 4M1KA 1I51B 4F0HA 1VFJA 3CO0P 3UCZP 3C6TB 5FIIA 3BREA 3SQGA 3QJLA 2AV5A 4KHPJ 3Q8RB 2H51B 1YJVA 1OWXA 3EXCX 4F25A 5KFLA 4F67A 2U2FA 4LF8J 3LOUA 1S1UB 2RDJA 5F8HA 4KQZA 5K9FA 4B3OA 2R8KA 1SV5B 4EGLA 4DLEA 4Y34A 5HN0A 1Q7YT 3OTEA 2HQGA 2FJDB 2V8PA 5K8OA 3FBBA 3JSYA 1S6PB 4A8MP 3EM1A 2AX0A 2OH2A 2XWYA 3M9NB 1NEEA 1Q5VA 3D0IE 5G4DA 4ZIWA 1SJ1A 3DLKA 2Y0BB 2PMHA 4YDDB 4F0MA 2KG0A 4DL4A 4W92B 1BGXT 3VR1A 4BC9A 1IKXA 2C22A 4TYAA 4P6QA 1TL5A 1R0AA 4RNNA 2NR0A 1WF0A 1X5PA 2EPIA 2L9NA 2DGXA 5L8RC 4ETXA 3J7AN 2HLTA 1NPRA 4WCEQ 2VFTA 3DRRA 2H4WB 2QC3A 4HI1A 3K17A 1O8BA 3BBCA 2FVSA 5H9EJ 2XSJB 1GQEA 5E3QA 1VC6A 3J7YI 3TZXA 1U48A 4URGA 1KQFB 2KXNB 5F8NA 2BVZA 4N76A 2E5LJ 1UFLA 4P2SA 3IM8A 4AD6A 2ZOGA 2XCPA 1X7VA 2XLJA 3ADAC 1SCJB 5BYSA 3QRRA 1YGYA 1GTHA 1ZBTA 1DTTA 2VPWB 2CQ1A 2NUUG 2MLXA 2ZWPA 3QYYA 5KFJA 1X4HA 3U1LA 4XPEA 1N5VA 4TY9A 7FDRA 1UWBA 2CADA 1UL3A 3G6ES 3HDSA 3DHXA 2OGUA 4B3TJ 2OELA 4ICLA 1Y0HA 3NS6A 2UXBJ 1TK8A 3H0PA 2CDQA 1Y5IB 2OPQA 5HLFA 2O1PA 1IN0A 2XTJP 5T7LB 3M32A 4LT6A 1UJ4A 1XMBA 1UW9A 2H5IB 3F0NA 1QTNB 4DSFA 2CQCA 1OPZA 4N41A 3OHBA 5B0BA 1KOOA 5HMYA 2H4YB 1PBAA 2PMZD 3HHDA 2HK3A 3TZWA 3A3PB 2VICA 4OJHA 1CJVA 3E01B 2F1FA 3ZTSA 2ALYB 5FDLB 4JUZA 2VV5A 3S7RA 2J7UA 1QTMA 1B0PA 1SL1A 3KUGA 1JQGA 2FHMA 4DR4F 4HDHA 4WFAQ 2B4OA 2ZZMA 1HBNB 3RZAA 4G1QB 4ILRA 2UU9F 5ETVA 3NBPA 2DNQA 2HMIA 4TN2A 2F9DA 2YNFA 1F1BB 3CF5Q 4CLZA 4TLRA 4UW2A 1YJ7A 2FHOB 5L1IA 3AB4B 2LXIA 4AE5A 2EVZA 1RTJB 4LQ9A 3NGSA 2WOMA 2M5YA 4U6PA 1Q1KA 1REGX 1HD1A 2XULA 2RU3A 4ANDA 1QM9A 1RDRA 3RAMA 2DHXA 5HK4A 2MJNA 3CO9A 4C9DA 3D68A 4X4UA 5AXNA 2V0NA 3PDNA 5A8WA 1SKRA 3CUNA 4HDGA 1ACMB 3PJ9A 3W3SA 2BEFA 2X3GA 4LSZB 4WPAA 3AJ2A 1N33F 4ELTA 4CH0S 4NOHA 2A6MA 2M4MA 1FJGF 1FRHA 1HHSA 1EETA 5G0RA 5F9LA 3W2VA 5J2MA 1OQ6A 1M5VC 1BUXA 1HWJA 4TU8A 3SV4A 4DV5F 4KKOA 2ZM6F 3HZEA 4KPYA 2HWTA 1TV6B 3EUNA 5BR8J 1FERA 3GG1A 3DRPA 2N4CA 5E3PA 3FRZA 3IN5A 4X62J 1JLQA 3NAHA 3NCQA 2QMWA 4XAKA 3MPVA 2MJUA 4NLXA 1T03A 2YWFA 3THPA 3BV8A 2YBVA 3R7BB 5M2PA 2ASJA 1TUVA 4AYBD 3NS7B 1QE1A 5J2PA 1BQMB 4DPTA 4OMFG 5D8HB 3NRBA 1M0SA 3N79A 3SCJE 1N88A 5IWAJ 3KMQA 4NLQA 2RH3A 4ECRA 1BXNA 1HQEA 3K7RA 2W8LA 5HJYA 1MWYA 5L38A 1GX6A 1RYRA 4QIWD 2K7JA 1C0TB 1S12A 4JI8J 2HHXA 1LKZA 4GVBA 5K8NA 2LLZA 2LQJA 1X9MA 1WC1A 1REVB 1F3FA 1XTZA 1HIYA 3O6QA 3EZOA 4ZCKA 3N5BA 2C42A 3NWGA 4DR5J 2VJUA 4BBYA 3TJ9A 1T02A 3M8SA 3KLEA 3PJWA 3PY8A 3KHHA 3QBCA 5LXYA 3GU0A 2AJ0A 2EKNA 4RUAA 2H65B 4DZ6A 3RW6A 2RNEA 2C2DA 2VB6A 2C3YA 4J9NA 1UVJA 2C2MB 4OYMA 3RR7A 2ZBPA 3TVYA 2W7OA 5IQQA 2B8QA 1RT7B 2F8HA 4OHVA 2PFFB 2DGTA 1YZ6A 3ENAA 5GAHI 2RHQB 2O5DA 3EJMA 3OR1B 3I31A 2YXLA 4P2FA 3HKWA 4DUZF 2O67A 4PRFA 1N5YB 2YWGA 1TMMA 1NK0A 5A2QU 2LECA 3TYTA 3PW5A 2EW9A 4I6YA 3DXBA 1RBLA 4OI2A 4OX6A 4JYAJ 2GVDB 3SQGB 4OX7A 1O6XA 1HYSB 3MMJA 5KFTA 3C15B 3HFZB 3ZTPA 1WWHA 4DV0F 5IC6B 2NCKL 4DPYA 4C6AA 1N36J 1NZAA 5LSLA 1VMBA 3D6MB 3KLHB 2KT2A 4LR9A 4Q8EA 1SIZA 1YLXA 2RJZA 1X5OA 4P52A 4B08A 2YH0A 1RWXB 4OL8A 4I6WA 1UZDA 4DV3F 2HS0A 2RQKA 1AFIA 4MYTA 2DISA 3BBBA 2RRAA 1FKPA 3C8YA 3SXLA 2DNYA 2LEAA 4RWWA 4LRAA 1FFGB 5ETQA 3SDEB 4ZOSA 1Y00A 1B7YB 1WTBA 1IKXB 3DGPA 2DH8A 4DOZA 4DMZA 4JV2A 2WTFA 4F4AA 4L76A 5SZTA 2YPYA 4X64F 3K2YA 2BJDA 4MKBA 3HHEA 4J9UE 3DRRB 3NGRA 1XMOJ 4CNZA 2ILZA 1TKTA 1RAEB 1N34J 2UUCJ 4ELUA 1OMSA 1T9VA 4L75A 3RRHA 1KP6A 5AT1B 3TAQA 2ZEJA 2XO7A 3BJYA 3MECA 3ZTRA 4FNIA 3MGJA 1Y3KA 1S79A 3J81j 3TWZA 2HFVA 2BQRA 3DRXA 2BJ7A 5KT7A 1FESA 5A8KA 3BR8A 4DR3J 4AL6A 3DNCA 1XMQJ 2C28A 1PAUB 3RB4A 1KEKA 2R2SA 2CJ9A 2ZH8A 1K1QA 5KT6A 1H38A 1R0CB 3ILJA 2BW2A 1PC4A 1DHMA 4W90B 2CJQA 3OSPA 2F7VA 2YVSA 4DS4A 2BJEA 1K47A 2G9OA 3HHLA 2EFGA 3DC2A 5EN1A 4PCQA 4JV5J 1VK3A 2EFOA 4NLTA 4ED5A 1OSCA 2OLWA 2JFKA 2JC1A 3TA1A 1ZOTA 5HQ8A 2ZBQA 4ILLA 1FE4A 1U6BA 3ET6A 4CH1A 1VQMS 3MAAB 3LP1A 3KNAA 2JH3A 3UE2A 2GHPA 3TUZC 1YVFA 1VDHA 3M32B 4QOTA 1U2FA 5L9XA 3W62A 2WBRA 3H98A 2JLEA 2DH7A 1RT2B 2EFQA 1F0XA 2X51A 3MOJB 1WELA 2J6UA 2IM1A 1VJQA 5J1EA 1S9EB 1N5TA 3MHYA 3DYAA 3P49B 3KK3B 2CJAA 2DR9A 3R3TA 3HHLD 1CQMA 1VBXA 2PA8D 4PPZA 1SQGA 2RQ4A 1JIHA 4DG1A 2O3DA 4CRJA 1WC4A 3FBFA 5E7OB 3MM8A 4PYDA 3CCMS 2B56A 1EAYC 2YNFB 2UUAF 4ECXA 1K1SA 1KLMA 3QFWA 3CJ8A 2LQ8A 1X4BA 2XMWA 2H1YA 3OLAA 5KFUA 1KONA 1G3OA 2WOMB 1R8BA 2HFOA 3BGUA 3B8HA 3ISNC 5A6WA 4OI0A 2E1MC 4F8RA 1JJCB 3DLGB 5L9NA 4B3SJ 3VALA 3EMTA 5IOLA 1RHMB 3I0RB 1WG4A 2B8PA 2BYCA 1U24A 4LR8A 4JOUA 3BSAA 3OL7A 5A8WB 4LF5J 2NPFA 4EUVA 5CD4H 1UEKA 3FJ2A 5KFMA 5DDRC 4J9LA 4ZCLA 2AEMA 2J9CA 5HROA 2LXFA 3MR3A 3W2VB 4C98A 3T3FA 4EZ6A 4TLQA 4GKKF 5AJ3J 2BE9B 1Q86T 4TKTA 1RT1A 1JKHA 3QRPA 2CA9A 3VAIA 1TQLA 1URRA 2VBYA 1M90T 3IBCB 1YJNS 3GYNA 2Z2YB 4B02A 4JI4J 2CNLB 2WONA 3I82A 3IR5B 3A4TA 1CULB 1UVIA 1C4AA 4A46A 1GX5A 1QE1B 2PT0A 5KFFA 2AJQA 2GQCA 1J2VA 4ZLJA 5D77A 1YRXA 2KN4A 2FHJA 1KQKA 2E44A 4IR9A 1DLOA 2VF3A 2CWXA 1S49A 4OI1A 2FVRA 1V5IB 2HURA 1LW2B 2CZVC 1HQEB 1VQ8S 4I69A 2UVWA 3QWPA 2HNDA 4MK8A 1IR0A 4IG0A 1OY8A 2YKMB 2JZ5A 1HPZB 4LFCF 1FE0A 4WFBQ 1C1BA 2YNIA 4ID8A 4B3RF 2CNNB 3ENWA 5IM0A 4K0KJ 2ZH3A 2B4VA 2J9DE 2QZ8A 2KO1A 2KI2A 1XJWB 4LFBF 1P27B 1RTIA 2MQOA 5LXRA 1V9OA 2B6AA 3D2WA 1NH8A 1T94A 3IR6B 3BQ1A 4NLUA 3UN3A 3FCHA 1VRQC 2FHJD 2DEIA 2J7WA 3V6DB 1D1UA 1RHJB 4YQWA 4K2JA 1Q79A 2HWHA 2M2BA 1FO1A 4IKAA 1PCAA 2K2PA 3CEDA 1NH7A 4Q7AA 1HNZF 1TKZB 5LL6d 3MMCA 5DZ6A 2HRUA 3CD0A 4WE1B 3A8IA 4CLWA 4NA3A 4WP3A 3DRSA 4OYBA 4KH1B 1EARA 3JTOA 4PYAA 3M2RA 4DR7J 4FN5A 1R0BG 5DQIA 5LSOA 1RT6A 1NJXA 4UOFA 4LREA 4KJIA 1RA6A 1WC6A 4N77A 5DQHA 4RBTA 4C7QA 2VQFJ 3CCJS 1FCAA 4DQPA 4NA1A 5B0GA 2ERRA 3R7SB 3PX6A 3KTQA 4DV4F 1DQ9A 4USTA 1NK6A 1DZ5A 3KHLA 3LA0A 5DO2A 3P5BP 5F0UA 4ITSA 1ZM4A 4FF1A 3W9JA 2W2PP 4MIWA 1QVGR 4HEA9 1IKVB 1TMJA 1JLFA 2HKEA 1EIYB 1T9WA 1TVRA 1X4AA 5D0RA 2DHHA 2G2YA 1SKUB 2QLBB 1KR4A 3EDRB 2QRRA 3MD1A 3G82B 3J80Y 4U8YA 1IXKA 4A8YA 3IWLA 4EO6A 3H20A 4LRFA 1U1KA 4N8NA 1DQ8A 3EGZA 4DX7A 2QL9B 3T5LA 4M5JA 4ZVRB 2D69A 3PVXA 4DHVA 2RSQA 5DDOC 2UUWA 2IVMA 3UVJB 4UOHA 4YEAA 4O3NA 3T1HJ 3W8GA 1FWPA 2ZC4A 3BQ2A 4MFBA 1AXQA 5HJXA 3D3CJ 3MFIA 2G0CA 2DNNA 5C24A 1XQIA 3UCGA 5B7WA 3I5AA 2FZCB 4ID5A 2PDAA 1IR1A 2JRSA 4WYLA 3KJVA 1O51A 2VOPA 1VC5A 2DCLA 3LPYA 2W25A 4ECZA 1BQXA 4Z7YA 4OX9F 2YWWA 4F4YA 4UY8T 1Q82T 4QU7A 2HQIA 1CJTA 4G1IA 2KYZA 3PYEA 2FTRA 2Q79A 1VIXA 1RWNB 3W5ZA 3JSBA 2BOPA 3JQKA 2Y1IA 2WB1D 2QLJB 2DNLA 1T11A 1NJZA 2DR6A 4NCGB 1FVQA 4RNOA 1VJWA 2A6OA 1IQTA 3GFYA 3CJ4A 4FBTA 4KGXB 3UFCX 3JSRA 2BQ3A 2IYIA 2MEWA 5K8PA 3NGDA 4KV8A 3LO3A 4JI3J 4V1Ak 2QYGA 4YY3F 4Y2MA 1R89A 5CABA 3IWXA 2A2CA 2BRKA 1NDPA 2K7KA 1H2VZ 3MEDB 3DOLA 2M0GB 2XYGB 3HHLB 4OLOA 2N4DA 2CAJA 2WSCC 3D5MA 2NQPA 4CLYA 1GXUA 4I2QB 3MTJA 4ZVQB 2R7OA 3MR6A 4TXSA 1KBRA 1WHYA 5GMEA 1RT4A 4XDDA 1QAXA 3OT9A 4O3PA 3CDAA 3ET6B 3M8WA 2FY1A 2AZ3A 5HATA 3I9V9 3CWJA 3W5YA 4ERDA 1D09B 3PW7A 4IFVB 2ADBA 2F4VJ 2HBRB 3HSZA 4DSLA 4LSNA 1UP1A 3UN2A 1EX8A 4X4TA 2NXNA 3HMJG 2R2TA 2F8MA 3HKZD 2FZGB 3DYAB 2WW4A 2BE2A 1CJKA 1IM4A 1Z4UA 2QV6A 2HQCA 1TL7A 2J0SD 2MXYA 4UT4A 5LM7E 3IR7B 2AD9A 2DNOA 2DRAA 1RAIB 2G2ZA 3MM8B 3R5BA 1YBTA 2DNPA 3EE3A 2RS8A 3LPEA 4RWXA 2UVUA 1MNEA 1S48A 3BGOP 5GMKa 3FZ2A 4DSIA 4ZPVR 4EYIB 1BHNA 3DU6A 2ZH9A 1JNRB 2KG1A 3OSNA 2CVIA 3TX0A 2MHEA 2FLOA 1VQ5S 2YKPA 2BJ1A 1NPKA 3C14B 1P9QC 3D67A 2LP4A 4KPCA 2W9BA 1QDUB 3DM2A 2W4PA 4DBQA 4FBUA 2ZC3A 3R7NB 2V2ZA 3TUJC 4NXMF 4RNMA 4J9MA 1UETA 2IDEA 3OXFA 4JB8B 3CXCR 3CIZA 4MAKA 2EXUA 2NS1B 1MG7A 1T3OA 1WG1A 3I5CA 2GJ2A 2UP1A 4HHJA 5GAHU 2GO9A 2WZ1A 2FVPA 4KT0C 2ASLA 5HROB 2DIVA 3GB0A 3RU0A 2HQFA 4NLDA 4F4WA 3L7PA 2LA4A 4M5GA 3ZZ0A 3H7HB 3UI3A 2QX0A 4NX9A 1TAUA 1P6TA 2CRLA 2KL8A 5MAOA 1JJ4A 3HVTA 2V34A 3TEGA 1K73T 1JKHB 1VQPS 3NWRA 3KKFA 2NYHA 4NXNJ 2I9SA 3EWGA 4Q0BB 1NM2A 4ENOA 1F9HA 1XERA 1X4EA 2ZE2B 3CTRA 1ULRA 4WWSA 2IVYA 3U27A 2M3DA 3I0SA 1GMVA 4WIIA 2ZJPQ 4DFJA 1NK7A 2RKIB 1ZM2A 4CO5A 1HW9A 5A6PA 4GO5X 4WU3A 1IBKF 5LSRA 1NBEB 3D4JA 3M8PB 1NHVA 4M5IA 3AODA 3OTOF 1UEVA 1IBMF 4K4WA 3QIDA 4D3HA 3UR3C 5HMZA 3CSKA 4DV7F 4HLBA 2I6WA 3OL8A 3KLFB 1VI7A 4DF4A 2WVEA 2FY8A 2BQUA 3EZUA 4X4SA 1S6QB 2YWKA 5AXLA 1KFSA 1RAFB 3D6TB 3FSIA 1O0PA 4PZVA 4X4NA 5DRKA 1F2GA 5ETTA 5ETMA 1UVNA 3FQLA 2YKNB 2HWIA 1RWPB 2NZ4A 2YNIB 4WZMA 1S1TA 1ELOA 3GYGA 1S7IA 4R5PA 4USVA 3E3XA 2DY9A 5IM0B 2VKRA 2XG8A 4TQRA 4QIGA 4QIEA 2CNKB 1LWCB 2ZH5A 2ROEA 1P1TA 3LAKA 4HVZA 2BOAA 3DN9A 1RT5B 2I0XA 2HVEA 1GAOA 2HZCA 4NEZA 1JLBA 1S6OA 2AF6A 4WKRA 1DTQB 2IM3A 3C6UB 4RUHA 3M8RA 1TP7A 3CGIA 3Q2SC 2QA4G 4DL6A 1HWIA 3PRBA 4FYXB 2RT3A 1MWZA 2WVBA 3KMSA 5AXMA 1PBUA 4KBIA 5IT4A 1TL3A 5K8MA 1NK9A 4G3IA 1D0EA 4ZN3A 3JTNA 2WVCA 4YS2A 3QSYB 1U0SA 4UUWA 1YRTA 4PG7A 1OY6A 5KT2A 1DBDA 2H3EB 1Y3JA 3HPOA 3DRSB 4NZ6A 1WEZA 3G87A 5A2QY 4DR4J 3DMJA 3G8QA 2H48B 3M2RB 1OYDA 3OFGA 2UU9J 3EDQB 3HO1A 2V8HA 5L1LA 1ZZNA 2Z8QA 4JI7F 4URQU 2J6TA 1KHWA 3MMBA 5D4PA 4PG8A 2E5JA 2BANA 2DRBA 3OR2B 1NK4A 1ZA2B 4OJ3A 2WW8A 4LF7F 5IQ6A 1SUQB 4BCAA 3R8YA 1JWWA 1LK7A 2YPZA 1HARA 3GCWP 4NRTA 5IFMA 3I4HX 4PR6A 2RHSB 2AJ2A 1X0FA 4A8OA 2W9CB 3D3BJ 2Z56B 3GIJA 1JLFB 3BN4A 2NREA 3MPYA 4ES3A 4LBPA 3F56A 4RU2A 1VQLS 3KK1A 2CPIA 4X2BA 4HTJA 1U8WA 3PNIA 2VC0A 3FSXA 4DFPA 2PGCA 1N33J 3H2UB 2YNGA 1FI4A 1APSA 1N0VC 1FJGJ 3VAFA 1YBUA 1U1PA 3MEGB 2G0IA 5LJ5Y 2FJWA 1YIJS 4LJMA 2B43A 4K4TA 4MFBB 2ZM6J 4GC7A 1B70B 3QIPB 1YK9A 4PXCA 1K9MT 2ZVIA 4OYAA 1N6QA 2G2OA 3FBCA 3KJVB 3UO0A 5DJBA 2HK2A 1C4CA 2PI4A 3DCAA 3GTYX 3W2WA 5HP1A 3NAIA 4AL5A 5D4OA 4ZPDA 1NNDA 3M8YA 3IRXA 4CNYA 5C7PA 2G13A 4RW8A 1X5SA 4CO0A 5F8JA 5I3UB 2KH9A 4K4YA 1XR5A 1NUEA 3H90A 2F3JA 4JI5F 3N4WA 1FDBA 1Q8IA 3IO1A 4R0JA 4TU7A 2ZH6A 2V4RA 3TZZA 3GE9A 3MCNA 2WRMA 4F50A 4ZDNA 4Q8FA 4U96A 1SJRA 2Z58B 2AGPA 2DCUB 4AQYF 3FFIA 4OX8A 1XNRJ 3PXGa 2ZH2A 4F26A 3GMGA 1F3VA 4IG3A 5MLCV 3POTA 1IQZA 2CPJA 1JLEA 1RT4B 4J5OA 2BUNA 4RW7A 4F3MA 2MQQA 1D9AA 1UWAA 2CXEA 4NPOA 3SSSA 2R4FA 3IS9B 1WACA 1FDNA 2R8IA 3NY0A 4I64A 2VA2A 3IBFB 2MPUA 2HBZB 5E0OA 3BB5A 2FGCA 4F0KA 2XHCA 1LW0A 3A8KA 2YKOA 2Z30B 2VODA 3Q8YA 3NNAA 4ZIVA 1FK9B 3PJXA 1OPIA 2XMAA 1C1CA 4J9SA 1CQNA 1H2UX 1LWFA 4DSJA 2Y1RI 3QPIA 2IPOB 3Q8QB 2B4UA 1RK8A 1QAIA 1DURA 2BE2B 1HNIA 2EG1A 3DLBA 3LWMA 1TL7B 4PAAA 3CJTA 3Q8SB 4M5LA 3VVUA 3GYXB 1XC9A 4QPTA 3MAQA 3GIMA 2ZUAA 3HLUA 2HNYB 4ZLPA 1BC6A 3RYLA 2J5AA 2Y1JA 2RDIA 3TR5A 2VPZB 3KG1A 1S0NA 4CO2A 2IJFA 2JL9A 2HGLA 2JEGA 1ZM9A 3BS9A 3C6TA 4H54A 5KFNA 1KHVA 1FVSA 4OYWA 5B0CA 3ISZA 1WEXA 3AXMA 4H4MB 4TY8A 4DX5A 1OO0B 2QLWA 3X3UA 5CA5A 9RUBA 1S1UA 1HNVA 4IR1A 2HAFA 1TFWA 2D1CA 3G2XA 3R1HA 2L48A 2AYBA 3A12A 4QWCA 4DV3J 4LFAJ 1GEHA 4ZJOA 1S6PA 1JK9B 3GSIA 4MT1A 1EQ0A 2ZBCA 1M5PC 4EZ9A 3ZTOA 4NRUA 5KFYA 3NCPA 5E3AA 4JI6J 1JNZB 3G8SA 3QZ7A 3QO9B 5ETLA 2XEXA 4FYWB 3MM6A 3BGRB 2L08A 4H4OB 1OSDA 2Q3PA 3FCVA 4I2PB 2A10A 1WF1A 2CPXA 1IKWB 4DCPB 2OEJA 1KQSR 5KG2A 3UW1A 4KH0B 3GILA 4LF4F 1FRLA 3LF0A 3HT3A 2N82B 2MSSA 3I0SB 2VZ9A 5IV4A 3EGWB 4RU9A 4UUXA 1LFPA 2XSJA 3MTKA 2GGPB 4U7UD 5C5JA 2OSQA 1CJUA 2PIIA 4B3MF 1FXLA 2HSEB 1OS5A 4NCAA 1HNXF 2QLFB 4RW4A 3H8YA 1T8EA 4FF3A 5CYQA 4DV1F 3MM7B 1UVKA 3ISND 5HAOA 2W2NP 5A8RB 2PN6A 4ZPBA 3MR2A 4AXJA 3BEGB 4DF8A 4WTOB 2RB7A 2J0XA 2DKOB 5IV3A 4PG6A 2DPJA 1FNMA 3VWSA 2QIFA 3GSDA 1FFWB 1PJ5A 2VHGA 3HJVA 2ZD1A 4LF8F 2XI3A 2CZ9A 3PRVA 1D8YA 4KTQA 2BZ2A 2HHPA 1R43A 5LMUF 2KRRA 1VRTB 2MDAA 2FDNA 3MD3A 3A8JA 4NMLA 2Q66A 4QZVB 2K8GA 5T7LA 2ZKTA 4RX6A 4XDCA 3TOQA 3NGKA 1RKJA 1M5OC 4JI0F 4DN9A 4RUCA 1FTCA 1HI1A 2DNKA 1HBMB 1S5ZA 5KFIA 2UXDF 1N5SA 4B9SA 1FX2A 4A8SA 1TZ0A 2DGVA 2E7VA 1F5AA 3CMQA 3PR4A 1RAJA 4FKXA 3K59A 2HNZB 2C3OA 3QFHA 2ZZNA 1R6YA 5CZXA 1LV5A 2C3MA 4N7TA 1AB8A 3E01A 4OV6A 1QD1A 5FDLA 4K50A 2OTLS 4DR1J 2M7SA 2IAJB 2J76E 3GJSB 2C2RA 3JAMU 2VJVA 1L3VA 2UUAJ 3ONQA 2ZDOA 4PQUB 4ECWA 2FLLA 2ASYA 3OBIA 4RL1A 4O44B 5DLFA 2BANB 3G8TA 1KNZA 2YQ0A 2W7PA 1G6BA 2GVZB 2UVVA 2VDIA 1UW4A 2XGPA 4PXEA 3PEJA 2AQ4A 3OL9A 1CBKA 1RTJA 4DR6J 3B54A 3SMZA 4HH1A 4HKQA 3EZ5A 5HBMA 2JOQA 1RQ0A 3A3NB 1HNWF 3KG0A 2R8HA 2MKHA 4GKJF 3PCOB 4ZLNA 1VIOA 5T14A 2GO8A 3D1OA 2R2RA 4J9PA 4KO0B 1Q16B 1EKRA 2GJIA 4FYVB 2EK6A 2VQEF 4C0BA 1WKJA 2R7TA 1VQOS 2X1GA 1KN6A 1RA7A 1TUWA 4OI6A 4GKKJ 1B99A 3S01A 2GAHC 1B64A 2W7AA 4A8FA 1UCNA 3TI0A 5DG9A 5LMNF 3T19A 1C0UA 3BF4A 1SL0A 1ZAWA 3CJ0A 3PIPQ 3WC0A 2D7SA 3GR1A 2LFVA 2OHDA 1TV6A 1TKXB 4C48A 4UQGA 5HP1B 4WF9Q 1LQ9A 3CJSA 1YKWA 1DRZA 2Q6BA 1UJ6A 3BN7A 3W60A 5H9FK 4BLGA 3SCKE 5IT0A 2XO6A 2CQHA 4RZRA 3PKMA 3HCXA 2XBPA 1RUSA 1I94J 5E33A 4ED0A 1BQMA 3VAHA 3NOCA 4MKYA 1PKUA 4OZNA 1RBAA 4WFXA 2B9WA 3G86A 3IRWP 1T9XA 4RLEA 4U9RA 4KHRA 3QRQA 3E2EA 2Y1LB 5E3CA 2AEJA 3WBZA 4LFCJ 2QSWA 3UDCA 3GZ7A 4ED7A 1FRJA 2YX4A 3CD7A 1HBUB 3VQTA 1HR0F 2X1BA 4B3RJ 1UEUA 1FWKA 1UFWA 2R8JA 4LSLB 3M6XA 1C0TA 1RP5A 3GJQB 2PI5A 1VLOA 1YBAA 3VHQA 2U1AA 2BABA 5KFXA 4A8XA 2GQ2A 4QWAA 4ZMMA 3S1TA 1RSCA 3DLJA 3RRGA 1KKHA 3GQCA 4OQJA 3TA2A 3B6BA 2GCFA 2MQ8A 4OZJA 2PD1A 1WDDA 3W8PA 1YI2S 1C1CB 3ILLA 3J7A1 1VLYA 1LWFB 4K5SA 2M8HA 5C2CA 4FVCA 4J9KA 3GWCA 3SBMA 3PM9A 4M5HA 3SYZA 3LGMA 2E9TA 2XHWA 2AGQA 3V6JA 3I96A 3V4IB 3SI8A 5D4LA 5I42B 4ED4A 4UQTA 5CCLA 2K3IA 5ADZA 2C3PA 4D3GA 1KOHA 1F5CA 3UNYA 4ZCIA 2Y0SD 1RTDA 3OR1A 1RWVB 5KG0A 4X62F 1RZMA 4PXBA 4YMEA 4HT5A 1PAEX 1N5YA 1Y11A 4P9SA 3QGIA 1X0PA 5F8LA 3ZO7A 2GVDA 4KB7A 1FT8A 2FUG9 3IGNA 3CJ5A 1HYSA 5KG5A 3C15A 2DO4A 1WOPA 1S76D 3R5AA 1WORA 5BYRA 1T3NA 4TY8B 2F5GA 5J2NB 1MW7A 1HNVB 4B17A 1GXTA 2OUGA 2ZUGA 3CCVS 1P1LA 5IWAF 3MWBA 3KLHA 3IA0A 1WHVA 2WBMA 6AT1B 1HBOB 3L9ZA 2DR5A 2LMIA 1EQMA 1KTQA 1GMUA 4YR0A 2A18A 4WFZA 4YR3A 1NMEB 1U25A 2BW7A 2X3DA 3ZZYA 2GV1A 3SDEA 2KFYA 4CO4A 5IT9U 4OHWA 3PG9A 3MM6B 2H54B 2FGOA 3V6KA 3ICLA 3D54A 2C2OB 2VUGA 3K5NA 2PEHA 1RWKB 4I7FB 2DH9A 4IDKB 3K58A 2IA6A 1X4CA 5B0AA 4KYZA 1FJ7A 2SXLA 2RIJA 3AQOA 4IRKA 5F3TA 1Y4ZB 1GTEA 3L7OA 3JYTB 2RQMA 3PYDA 3D66A 5E5NA 3AHPA 2OAUA 1PO6A 3EPIA 2Z57B 4KGVB 1VQ4S 1CJUB 2LEBA 2QN6B 2XI2A 3Q2TC 3RRKA 4KE5A 2FJBB 2JVOA 3N0VA 4P73A 4RW4B 4YY3J 4X4QA 3HP6A 2XB2D 1MU2A 5CYQB 2MKJA 2XLIA 4AUKA 3OV7A 2XY6A 1HQ2A 2ALZA 2HW3A 3LW5C 2KXFA 3R5JB 3G71S 4EYHB 5CH7B 4C11B 2BKOA 2HFZA 3CD5A 4IOAQ 1AUDA 3BYPA 4IQXA 3KLIB 4PG5A 2OPSA 1FD8A 2RD5C 2ZD1B 1WC0A 1U6ZA 1WSVA 4UOGA 3K0JA 2ZWOA 5KFCA 2L9WA 1VQSA 1QUVA 2DB1A 4DDFA 3RBDA 3MM9B 3MI7X 1HHTP 2YWEA 1Q81T 2J9EA 1N36F 1BQNA 5B0DA 1AROP 1X4FA 1IBLF 3LP2B 2ATLA 3KJFB 2EFPA 4I4BA 3MAAA 1L3SA 4U7UK 2CQ0A 3MDFA 4AXIA 1U0HB 2E1RA 1S0VA 1RCXB 3QGGA 3TZYA 4DPOA 1NJYA 5KFWA 5ETNA 4NLOA 2NSCA 4BHQA 4GVLA 4A8WA 1RT2A 3W7BA 4C4WA 4QR2A 3CMAS 8RUCA 2XSFA 3H5SA 4ZPWR 1UTAA 4LVOP 4DL7A 4E2FB 5CXTA 4N5SA 1S9EA 4NYZA 3Q0AA 4EBEA 4ELVA 3TANA 2FJEB 3KK3A 2ZITA 3HHKA 1S0OA 2V8VA 3GJRB 4UZCA 5B0EA 4EBCA 3RB3A 3MZIA 1VCTA 3DDIA 3T5KA 4C8YA 1IKYB 4Y6IA 3FSYA 3TQEA 2C2ZB 2FIUA 3R2DJ 3K5LA 4USHA 2FD2A 4L3KA 2ZOMA 3EPGA 2M9KA 3BM7A 2MZJA 2V2QA 5F8GA 4ED2A 1SC4B 3PW2A 4F2RA 4NLYA 1N48A 5F0WA 2VG5A 4YB7A 4LBHA 2A0FB 3NP5A 5HL7Q 4DPXA 3EGNA 3CDBA 2MHNA 1Z1ZA 4DR3F 1Q4RA 4ED8A 4ZP8A 1XMQF 1FRXA 4KGZB 4P71A 5HBMB 1U47A 2KTQA 4F3QA 2DO0A 4PPDA 2MY8A 3DLGA 3M8QA 1N5QA 4JI2F 3ILOA 1NZ8A 2E1AA 2ZHBA 4YB6A 1HL6A 3I0RA 4U95A 4LR7A 1QAJA 2G4BA 5EUHA 2AYGA 2ROPA 2XZDB 3OUYA 2MQMA 5KG6A 1Q8LA 1NU4A 3TX8A 4I68A 1S1WB 4K4XA 5L1KA 4JV5F 2QLXA 2AT1B 2RVJA 3HZGA 3BZQA 4XO0A 4OYZA 3C16A 3T41A 2KHDA 3DU5A 1RHUB 1R8PA 1TU0B 1VQYA 5D4NA 2UV8G 1YTYA 3O44A 2RUSA 1VR6A 3FKBA 4IH5A 1C0UB 3K5PA 3TRGA 4K5RA 1U09A 2ACMA 5KOXA 3FEXB 2OPPB 2VBZA 4YFUA 3FQKA 3VGUA 5A0YB 4ES2A 1MROB 1UZHA 3AB2B 3T5HA 2UXCF 5DG7A 5F9NA 4OHXA 3AH6A 4C8ZA 4PWDA 1ZPVA 3IMQJ 3OTOJ 1CULA 1IBMJ 2QJ3A 2OIHA 2XMTA 1QSYA 2RF2A 3ILIA 2QEXS 3ZXWA 1F5BA 1IWAA 2F9JA 3AD7C 2E1CA 2FLNA 2E9RX 1RHRB 4Y3CA 3MM5B 4Q43A 3RJMB 1NPPA 1CG2A 1LW2A 5KFEA 2NUHA 1SC1B 1S4FA 1FKAF 4A8KA 2YKMA 4DUYJ 1HPZA 1NSKL 2V94A 4CP5A 1KLNA 1ZM3A 4HACA 1SKWA 4C8LA 3JQMA 3PX0A 3CD6S 1WHXA 2GIQA 4LRDA 1JLAA 4L72B 1S10A 1KSPA 4YOEA 1RWWB 2EG2A 3THTA 4M5DB 1SB6A 4XPCA 4J9QA 2XC9A 4P7VA 2V8DA 3VAJA 2BR0A 4XTTA 1X4GA 2EK1A 1K0VA 4DR2F 3V6DA 2BRLA 4LF6F 1WI8A 3OVAA 2DRDA 1F2HA 4C3MA 3SEOA 4ED6A 4ILMA 2IC3B 2L9DA 4U8VA 5HVFA 1FXDA 1KVJA 4FF4A 1TKZA 2ZBRA 1T9TA 1ZPWX 4WE1A 4DV2F 1I3OB 3U7JA 2CJYB 3DHWC 3BGFA 1TTHB 4P2XA 3NCRA 3ITHB 5H9EK 4HI2A 1RTDB 3E51A 1CEZA 1JJHA 1G1XA 4JI4F 2IJNA 2R7VA 3CVKA 3VAGA 4OIXA 2XMVA 2BDPA 2AJFE 5T41A 5EHHA 1VC0A 3GONA 3ENQA 4PABA 2KKHA 5THWA 3Q23A 2EC2A 2XZWA 5JUMA 1HWKA 1QY7A 3CJ3A 5B09A 1DAXA 1TKDA 3CC4S 4BC7A 1MN7A 3ZZTA 3O8WA 4PWWA 3GFXA 2MZ1A 3PV8A 2R7QA 2XNRA 4DV6F 1IKVA 3LGNA 9ATCB 1R3NA 1J27A 4C0OC 2IM2A 4R25A 1VS3A 1NCLA 2DY1A 1UVLA 2J0WA 3DOMA 5EX0A 3G82A 2IIHA 2BXJA 4K0KF 4WFNQ 2VPYB 1RLDA 2DR8A 1LEOA 1JXEA 3UVJA 3TVZA 4Q2LA 4ZPTR 3R97A 5KFQA 3CW2C 4MIAA 4ZJQA 1BE4A 2LVWA 2V9WA 2J9DA 5HQLA 1SJ4P 2CQDA 3L4BC 4LRBA 3M6WA 3PW4A 3KUHA 2VFRA 3MXHP 2FVCA 3QQCD 5DS7A 2AJ1A 2HS3A 4ZP7A 3DI6B 3FK4A 2OTJS 2PSZA 4NCBA 4NCGA 5CCMA 1MU2B 2DHAA 4FXVA 1F9FA 2ZVSA 1XR6A 5D15A 1HQUB 1RWMB 4CLKA 3EGVA 2Q1LA 2HHHJ 1WKKA 4AL7A 1VQ9S 1S59A 1FTRA 4AQYJ 2VD3A 2AWZA 3OQ2A 3CCUS 1FKOB 2QFIA 1W2BR 3MEDA 3CULA 2VC1A 4F3OA 2OPSB 3UPFA 1MMDA 3PZPA 7AT1B 2MQLA 4RW9A 3SCIE 3CB4A 4MKVA 2GMHA 4E0DA 1BQNB 3H5UA 2YQ1A 3QGPA 3VV2B 3KLGB 4I2QA 1RLCL 1KRPA 3M4XA 2MKCA 2HQDA 1CC7A 1UPMB 3GPAA 1U4BA 4ZS6A 5KFKA 1FRMA 4C2MA 3J7Z5 1J5EF 4QJVA 3HSJA 5EWEA 1N54B 3HI9A 4BDPA 4F36A 1QSLA 5L46A 2FVQA 1TAQA 5J1PA 4IFVA 2DHGA 1GMWA 4M63A 4DJBA 2E5GA 4B9UA 4DEZA 4NLRA 4R8UB 4U7CA 5KFSA 4ANEA 3BO3A 2M8DB 3T1HF 5L1JA 2GNKA 3PHTA 3QATA 5GMDA 1RI7A 3JAMY 1M5HA 4ZHRB 2Y8WA 1RISA 3H2LA 5RUBA 4X4RA 3JTPA 1XNQJ 3WHIA 4FYYB 4LRCA 3I55S 2W4CA 1RWOB 4J90A 3M9MB 1F6TA 2P9GA 2HFNA 4IRCA 3CDEA 4CLPA 2HHSA 5ETKA 2VG5B 3A1YG 1WSRA 1AZSB 4DQQA 3VAMA 3LUYA 5HO4A 3KK2B 3T6BA 2IFXA 1RYSA 3MUMP 3G96A 2Y9HA 1VRUA 1MWQA 1GMWD 2HVZA 2EWHA 2FB0A 3C14A 5KFRA 4JI3F 2JWNA 3GP9A 2ZH1A 4P2MA 2MMYA 3M8QB 2OEMA 3V4MA 4P75A 4QQBA 4USKA 1SH3A 2YNHB 1Q95G 2AYEA 3AQPA 3OUYB 2XMUA 2VASA 2RMLA 3TQ1A 1X9SA 1WJ9A 2KVIA 3AA8A 2FC8A 1NLKL 1JXVA 1XN9A 4ZPAA 1SH2A 3OJUA 8AT1B 3P45B 3C16B 1R27B 1Y7PA 1YZ7A 3PACA 1VBYA 2QL5B 4HHHA 2QA1A 2XY7A 5D6GA 4NLGA 2PE8A 3HK2A 3AAWB 1FD2A 5KOWA 2CQ3A 4ZVPB 2W1BA 2VL1A 2LQ9A 3P4UB 4Q0BA 2F4VF 3QAUA 3MEKA 3PR5B 3K5MA 2ZE2A 3IAS9 3H40A 2HHVA 2KZMA 2KU7A 2EC0A 4PWDB 3EVWA 4B3MJ 2CQIA 1S1VA 2RKIA 2RF2B 3TO8A 3O2IA 3M8PA 2B5JB 4Y2CA 2PEBA 2GIFA 3V2UC 3PEHA 1RAAB 3US5A 2I38A 4OV1A 5DDQC 4KY3A 4MYUA 2EI5A 1VQNS 1X5TA 3KLFA 3CC2S 2NYIA 1KTVA 4RW6B 2LDYA 1S6QA 5CYJA 4CYUA 3WQPA 1RT3B 3EVOA 3H4DA 2YKNA 5K20B 1HMVB 4EEYA 2CJBA 4HACB 2CPHA 1B0TA 1E6YB 2VG7A 1Z2LA 2QO3A 3QNWB 5DGBA 3AFGA 2DTJA 5KFPA 5LMUJ 1JLAB 3J7YU 2AW0A 1W2IA 1LWCA 1PC5A 3JS9A 3P6YC 2V50A 2FZKB 2V63A 4ZP6A 6FDRA 1AYEA 2EFNA 1RT5A 4A4JA 4JI0J 4I67A 4NI2B 3CT9A 2UXDJ 7FD1A 3BR9A 1T9YA 1IVZA 3SV3A 1DTQA 3C6UA 2FYXA 4QYZK 3NOGA 1CLFA 4H4KC 2FJVA 3J80U 2MSTA 4V19J 1M1KT 1C2PA 4V19X 2POKA 1GFWB 4NZ0A 4FDFA 2BKPA 3U02A 4J9RA 3IAM9 4RO0A 4YHHF 1TL1A 4OYIA 4NXNF 1B3TA 4DPWA 3KOAA 1F60B 4CM0A 1NB2A 2V5HG 4Y2KA 1EP4A 1QAYA 3B4DA 4K59A 5KFZA 2Q6CA 2R3VA 3AXKA 3M30A 1RHQB 2DBBA 1HWLA 1YHQS 2BA9A 1RHKB 2J0QD 3BO4A 3MFHA 3OR2A 3H5YA 2HQ3A 5DDPC 3IWNC 5FD1A 4CTAB 3PW0A 2MGZB 1YJ9S 2CNOB 1SUQA 1T05A 1NKCA 1LXJA 3BDEA 3DGVA 4EI2A 1HNWJ 4Q2MA 2QMXA 4GKJJ 1JX4A 4ZP9A 3UD3P 2E66A 2V68A 2Q43A 3HULA 2W9CA 3N5FA 2UUBJ 5EX3A 2DXDA 2ZJQQ 2COLA 1Z2ZA 5HI7A 2VQEJ 5ITHA 4B9NA 5IT9Y 3DOMB 2MZSA 4IFYB 2CQ2A 1UKUA 4DCJB 4TNOA 1L3TA 3MEGA 3ZZZA 4IH6A 4OHYA 1IM6A 5HSPA 4YB1P 5LMNJ 3CCLS 4L74A 2HYIB 2JVRA 3K89A 1JJ2R 3QIPA 1N4LA 1GK8A 3GFHA 3HT0A 4USUA 2CPEA 2R42A 1FRIA 4DFKA 2GZOA 3MF5A 1LFWA 4Q5VA 1SQFA 1S97A 4Z37A 2OO4A 1HD0A 2GHWA 5BXIA 4C8KA 2CPZA 3I4PA 1DY3A 4M5KA 2QE5A 2W2QP 3A3OB 5J2QB 2W24A 4OJ1A 5KFVA 3BYRA 3KWMA 2JEFA 3F73A 2JLGA 3W61A 2DXEA 5KG4A 5I3UA 1NRKA 2DHSA 1HA1A 3IP0A 4WP9A 2VFVA 3HX9A 2V4JB 2DVIA 3GIIA 2GS8A 3NNCA 2QG9B 3TUIC 4ZKAA 3G6VA 1Y5LB 4FPIA 3M6VA 1HR0J 5ETOA 5A76A 1JMTA 2M88A 2VH7A 2Y8YA 1RTHA 3M2VA 3Q8VA 3W9IA 5H1SV 1VK8A 3J81U 4RW9B 1E6VB 1NHKL 2HHTA 1X31C 3MPUB 4WFYA 1KC8T 1S0MA 5KFAA 2ZNZA 4NYPA 2HS4A 3AY0A 3K8WA 2QFJA 2CYYA 4BS2A 3Q86A 1AFJA 3ZTQA 1WI6A 5KFBA 1M5KC 4C3LA 2H5EA 5HMXA 4QR1A 3MURP 1RAOA 4DSEA 4DPUA 2DGOA 4ZN1A 3IS9A 1AA1B 1N8RT 5DQGA 2OPRB 3CPWR 1PYSB 4GO7X 4ZVGA 3R5DA 2MLYA 3O1LA 2I5JB 3BKUA 2FHKA 1TL4A 1FK9A 3L09A 4MMOA 2B7CB 2HPUA 1KD1T 2RAQA 1TELA 4CT9A 4DU8A 4USIA 3RBEA 4X66J 4JI1J 1TFYA 4DFMA 2NXEA 3MCOA 3DKDA 5B0FA 2KB2A 1YJTA 1RU1A 1NAQA 3FUYA 4M5MA 2KJWA 5K14B 4NYOA 2B9EA 3ZZOA 4NA2A 3L3CA 3TA0A 5BJRA 5CYMB 4LF2A 2RS2A 2R7SA 3BKTA 3HFVA 4QU6A 3GFZA 4J7CA 2KT3A 3NGUA 1S1XB 2WK4A 2LU1A 3HVWA 2HNYA 3QJJA 2HVDA 2QTWA 2DNGA 2CJXB 3MPWA 1HI0P 1PSDA 1RBOB 1U1OA 1KVIA 1ZZFA 2F40A 1PJ7A 2MKSA 1J5OB 3TVKA 4Y0FA 1YJRA 4FYDA 3OVSA 3R5CA 4ZJLA 1VRUB 4QIVA 4BWJA 5D3GA 3P5TL 3Q8PB 1TR0A 5F8MA 4DL2A 4USMA 2AYMA 4IOCQ 2OMLA 4H4MA 1GNKA 3M2UA 4GC6A 1N32F 1S77D 2VPXB 1SBRA 4MK7A 1YX2A 5F41A 2KT5A 3FZBA 2N3OA 3N6LA 1XNRF 5HMWA 4O4GB 1LWEB 3M1VA 3LP0B 3AOBA 4M8LA 3W66A 3VF0B 4KFBB 4ECVA 4DQIA 3QT8A 2CJKA 2VG6B 4J9VA 3QO9A 3NMAA 3V81B 3JSMB 2M70A 2OEKA 3BGRA 3CCQS 5C42B 1ZAVA 4H4OA 2CIMA 3FRYA 2CPYA 3L7UA 4I2PA 1Y5NB 2BKNA 2QA4S 1IKWA 3TUPA 4Y2AA 2GMJA 2MKKA 1NDLA 5ETSA 1XEZA 3MEEB 3ZZUA 2PFDA 3DOKB 2ZJRQ 2XS7A 2OFHX 1RACB 4YR2A 1PG5B 3CCZA 1S1VB 2L41A 4Q44A 3BDPA 3CJKB 4K4ZA 1V5VA 2GGPA 4C97A 2HEKA 4TQSA 3QMQA 1RAGB 2L3MA 3HD2A 2IDLA 4X65F 4G6VB 4CLLA 2ROGA 1RTZA 2V67A 3RBXA 4WK1A 2VDHA 3ULHA 4RJVA 3MM7A 2FLPA 3M8ZA 3PHEA 1KDNA 1NDKA 5A8RA 3ZZPA 1PYOB 4CYUB 2DJWA 1A9NB 2YH1A 2BMBA 1Y10A 5C2GA 4LMZA 4E98A 4USJC 3K5OA 2OD6A 2UUTA 2WSFC 2HRYA 1KFDA 2D9OA 2A3JA 5EGYA 3C46A 2VG7B 1L3UA 4B3OB 4IRDA 1ICEB 1R7IA 5ETRA 3RAQA 1GXLA 3GCXP 5KG7A 1IBLJ 2GC8A 2B51A 3FC9A 2ZFHA 4I0WA 2CVEA 2MLZA 1U45A 1UAWA 3QT7A 4PXDA 2XLKA 1RABB 5KFHA 4LFAF 4WKYA 4XK8C 3DLKB 5M2UA 1VRTA 1TK0A 1H7WA 3VTIA 1VHIA 1GT8A 3G9CA 1MMNA 3AA9A 3MAHA 2AZ1A 4WBFA 3HFKA 1NSAA 4QWBA 1HBMA 3BQ0A 4QYZJ 4W98A 3UN5A 1NJWA 4JI6F 1R0AB 4ZVTB 1U2RA 1LOUA 2D74B 3VGTA 3CCRS 5FJ4A 2WVFA 1RWUA 3ZNJ1 2HNZA 2KYXA 1YQHA 1TL1B 2R2UA 1SL2A 5DM7Q 2BV3A 2AKWB 3R2CJ 4MH8A 1ZH5A 2IMWP 4PQAA 1XK8A 4NL5A 1EP4B 3B78A 2IAJA 5FLXU 2BJ9A 4WYWA 1WDTA 3P96A 2EKYA 1VQ7S 4PQUA 3M30B 2MZRA 3Q89A 4F4KA 1H98A 3IG1A 4O44A 2VFUA 1WOOA 2Z4PA 2XS5A 1UJ5A 1QUPA 1JB0C 1S9GA 2GVZA 2E1PA 1T05B 1DTTB 3I5BA 3OW2R 3VZIA 1FJEB 2J8SA 4JI2J 4EK2A 4K7QA 4NLWA 2MY7A 2HVHA 5C25A 2C2EA 3P8BB 2MB0B 3GIRA 2CQGA 3NL0A 2BM1A 1UWBB 4QWEA 1RGVA 4DI6A 2WAQD 1ZYQA 1HW8A 1IJFB 2DNMA 4K2XA 5F8IA 4KO0A 4ALZA 1VISA 4ICLB 4YN3B 4LF9F 3O3LA 1IUJA 5I3QA 1XIQA 4K4VA 4J9OA 3H25A 5HLFB 2OPQB 2YTCA 2PO4A 2IRXA 4IH7A 3MPDA 3LALA 4DV5J 4YDXA 1KVKA 4ECQA 3FGVA 4RBUA 1WUUA 1HLWA 4IUFA 5CZVA 5KT4A 3HHNB 4K4SA 1YSJA 3W64A 2UXCJ 4ZVOB 3KLVA 1TKXA 4QBUA 4QW8A 2BE7D 2CG4A 2GFFA 2KDOA 1DFDA 1CJVB 3H5XA 3RB0A 3M6UA 3OTBA 2A2DA 1N56A 3E8OA 2X1AA 2AJ4A 1R6VA 3VQSA 4NE9C 2QYCA 4HL9A 5EWGA 2J7KA 2JLFA 2D9PA 2IM0A 2KZZA 2FQQB 4Y65A 1WHWA 1IBCB 2P9CA 3VCDA 2G0JA 3RG6A 4DR1F 3GV8B 3NBPB 2HMIB 1TUGB 2MZTA 4TU9A 1RTHB 4OLPA 1FJCA 1S72S 5HQMA 2VKZG 3M2VB 2AX1A 2D3UA 5HVGA 4B9LA 1HBUA 4FXDA 3SFUA 2E7WA 1A0OB 2ADCA 3KXDA 4N47A 4LSLA 4L73A 3RB6A 2R9LA 4LQ3A 4DR6F 2B7BB 3T6JA 1V3RA 1WF2A 2DYAA 2MTLA 2K06A 1V3SA 4G1PA 5HANA 2CZ4A 5SUHA 4FP9A 1OIAA 4DR2J 4LF6J 2XS2A 2W4DA 2D3OR 2BJ8A 2LXUA 3OJSA 1Q8BA 1EETB 3C3LA 5G0RB 3SZ2A 5J2MB 2R7XA 3LQVA 1T7PA 2KXHA 4KKOB 4WJBA 4DV2J 1G4CA 3V4IA 4WTYA 3DRPB 4CO1A 1QLNA 5I42A 4DUZJ 2H5JB 1JLQB 4IO1A 3TAMA 1T03B 4ZLLA 1B4SA 2HG4A 3T1YF 2P9EA 3S8SA 1NO8A 1M5SA 4CQ1A 4ZVSB 1FDAA 3OTDA 4F2SA 1P9YA 3AT1B 2B0GA 5J2PB 1U2CA 3FEZA 2YWHA 1U02A 4RNFA 3OD2A 4DV0J 4ER8A 2JJ4D 2ZKUA 2IMOA 1U1MA 4IQMA 3TJAA 5D3GB 1I94F 3IC1A 5GAEI 2KVQE 2WCXA 1IR2A 1UA1A 2XCAA 2E5IA 5J2NA 4KGKA 5KTQA 3M2UB 5JVHQ 4DV6J 1WC5A 4ETZA 2ZH4A 4KAIA 3KG4A 4Z7CA 4OZ3A 4WXOA 1HFEL 2VONA 4GVBB 3QGHA 1HBOA 2P6SA 1T9UA 1YJWS 4Y2IA 5B08A 1U1NA 1FWLA 1BLUA 3M1VB 5IXUA 1LWXA 3QJPA 3BPDA 4RBVA 3HM9A 4WXWA 4MIBA 4GMKA 4X64J 3BH7B 1RB0A 3VGSA 4CI0B 1RCOB 2ZOFA 4I7FA 1FF2A 3W5XA 5EWFA 4IDKA 4PWUA 2OKQA 3KLEB 2FJXA 2AGOA 2MYFA 4RKUC 1S99A 5KAKA 3JYTA 2HBQB 1PGZA 2F4FA 3GV7B 3I87A 2DXFA 1RAHB 5U47A 4N8OA 2HAIA 1NXIA 2RU9A 2YKAA 2MKIA 1FXRA 3D7SB 2JEIA 4OZ0A 2WVDA 2DGUA 2Z2LA 5DG8A 2UZAA 3U1MA 2I1RA 2EBEA 1SQEA 1GH8A 4I56A 2IJRA 5KG1A 1FEEA 4X4OA 3OHAA 4DSKA 2GHVC 1MMLA 1R8CA 1AUSL 5ETPA 1SC3B 1D8ZA 1FNXH 2XWXA 3QT6A 1VOMA 1IWGA 2HIYA 1SXLA 2Z0GA 4LIRA 4C11A 2XYHB 3KLIA 3KHRA 3PX4A 4KHPF 3OPKA 4CM2A 1ZETA 4Z2XA 3CJRA 3MM9A 3DDNA 2CFXA 2IRYA 1FHTA 3LANA 1J5EJ 3UD4P 4O3OA 1H2TZ 5GADI 2JDJA 2RDDA 2ZBIA 3LP2A 2HFSA 1LNQA 2JEJA 2IBKA 4W4MA 4DS5A 1FKPB 4DN0A 3MUTP 4CLSA 4A8QA 1U0HA 3PO4A 2CKWA 2DGWA 3DGPB 4PG4A 1EKSA 3EX7B 1B7FA 3EYZA 2YX7A 2LU2A 2BJ3A 4R0EA 3NS5A 3CCWA 3UWTA 1SJ3P 1OY9A 2A1BA 1SI9A 1ZAXA 1TKTB 1MSWD 3M05A 2CWKA 3T5JA 2FC9A 3B82A 4EBDA 1KS2A 1S57A 1IKYA 3MECB 2W2OP 5JJBA 1O5JA 3C2PA 4CLUA 4H4KA 5GAGI 3IG1B 4NWBA 1Q53A 2ATCB 4CO3A 2HFUA 5A8KB 3UD5A 2VOOA 2J6SA 1S9GB 2E5LF 2KFNA 4OJGA 4LVNP 4DWIA 3QLHA 3C66A 3JXOA 4NEYA 3UQSA 1ZTWA 5LT5A 5C25B 1BMQB 2CQPA 2HRTA 2F63A 4Q45A 3ZZRA 3AJDA 4LUBA 2XY5A 1MLAA 2KRBA 2PA3A 2AP6A 5I3PA 4TYBA 1OQ3A 4B9MA 1IJEB 1A7GE 2XNQA 3FMWA 4DQRA 3H2VE 2JSXA 1WOSA 1S1WA 4QW9A 1FEHA 1QSSA 2HLUA 3GIKA 4B3TF 3LP1B 4G65A 1Q78A 1OYEA 2UXBF 2BM0A 1V3ZA 4S0MA 1DJ0A 3OFEA 1YRUA 3D6FB 2G1DA 3R1LA 4O3SA 2W9AA 1ITPA 2F65A 2OPPA 3FDSA 5J1EB 1EJ7L 2GW8A 4ECUA 3ENVA 5A0YA 1U8SA 1NDCA 1MROA 1R8AA 4JV1A 4F02A 2ZZTA 4E8UA 3Q24A 2XZTB 5DM6Q 1VGYA 1HI8A 1U26A 3IGVA 4X4VA 4EMDA 2Y3YA 3BH6B 4DG1B 2KM8B 3MR5A 3BSOA 3CCSS 2WSEC 1U1LA 2O01C 1JLCA 1W25A 4JBCA 4UY85 2RQCA 1KLMB 3MM5A 1FNOA 3J81Y 3OVBA 4HYKA 1SC6A 4MJKA 2D41A 2ASDA 3ETMA 1N52B 3CCES 2VIHA 4ZA1A 2NLWA 2N7CA 5KFDA 5AE1A 4LFBJ 2IY5B 4MKAA 1I1GA 1VBKA 3RGIA 4KSEB 4ZVFA 4OYOA 4QR0A 3QT5A 5DZ7A 3X1LB 2YX1A 4F4XA 3A13A 3CJQA 2HIQA 4UZBA 4M5DA 3WIVA 1NJIT 2ACYA 1CS4A 3H59A 2DNHA 1Q7LB 4GRSA 3I6PA 3I32A 3FBEA 4ECSA 2V9KA 2MQNA 2WHOA 2XMMA 1HNZJ 4C3KA 2XGQA 3M7VA 1RU2A 1WEYA 3DLLQ 3GLJA 4YHHJ 1AT1B 1RT1B 4OI4A 2IC3A 2C1EB 4K8RA 2DNZA 2OI2A 2LA6A 2GJFA 4QWDA 2APOA 3PKYA 2JFDA 4YB5A 3CJ2A 3TAMB 2N3LA 3DLEA 2HHQA 2WONB 2UV8A 3ITHA 3OXLA 5BR8F 3VVTA 3EVMA 1P8GA 4DX6A 3W9HA 1LK5A 2NSBA 3TEHB 2P5VA 1M1GA 2ILYA 3H42A 3KHGA 4OHZA 2OJ3A 1SJFA 3CCTA 4IYQA 3TJ8A 2MQPA 2ZH7A 4EFAC 1CPZA 3BBFA 4DV4J 1DLOB 3RAXA 1H7XA 3T9ZA 3MOZA 5GVQA 3AOCA 2IA0A 5D78A 4CT8A 1KQGB 2HNDB 1EB0A 4FZVA 4IG0B 4MK9A 3KJQB 1CC8A 2LEPA 4LF1A 1C1BB 4FXWA 1RADB 3PFOA 4CDIA 2WB4A 3G4SS 2ZHOA 2V2KA 4DUYF 3DRYA 1JLGA 2NPIA 3PRDA 4JI8F 4KGMA 4C8OA 3B4MA 1UPPA 2B9XA 1RTIB 1HHQA 1Q5YA 4YUDA 4PUOA 2B6AB 4QCLA 4FF2A 1W26A 3TP2A 2IVFB 1SPBP 1S4EA 4HTIA 3HJFA 1F9EB 4ZPCA 2DR7A 4FVMA 3C19A 4DR5F 4OX9J 5IC4B 3R6GB 1S7HA 2CQBA 2HHUA 4I1TA 2Z2ZA 3SSRA 4QIFA 3H4BA 3K57A 1HKAA 4CWBA 3MMCB 3KYLA 2R7RA 3PO5A 3R27A 4P7TA 4HH0A 3DI6A 3BGLA 3FEYB 4LBIA 3HF5A 4EO8A 4M95A 1Q8KA 1CSJA 1H73A 5CQGA 1EHWA 1RE1B 1RT6B 2GAGC 4NLSA 2LKZA 2RE1A 2XMKA 3Q8UA 2H9ZA 1HQUA 1U1QA 2DGQA 2IYGA 1WTFA 3OTCA 1K44A 2DPIA 3PIOQ 2NXUA 1T95A 2DNRA 1JXLA 4JV0A 3HVAA 3ELHA 4JYAF 5CD4A 1FKOA 1FRKA 4P72A 2DIUA 3MCMA 3MMAA 3WDOA 2HZAA 2KJVA 1UFKA 3JB9k 5IS2A 1NKEA 1G2EA 2NXJA 3KLGA 3N9UC 1TVRB 3KNGA 1SKSA 1UMJA 3PTWA 5IZHA 4FPRA 2HHWA 4DCOB 3PYGA 3F41A 3LH2S 4YP3A 1I6JA 5M2RA 3R6LB 2GX8A 2HZVA 1X8DA 4F7VA 1PYTA 5F3ZA 1G7CB 4M94A 3QWUA 2Z2MA 5AE3A 3D1HA 4R8UA 1K8AT 3UDVA 3KJNB 5C24B 2VBWA 2AIRB 4ID5B 1U1RA 3R9LA 5FLXY 3ZC4A 1QVFR 4ZHRA 4A47A 1WC3A 3BKFA 2HGNA 1CJTB 2XYPB 2DITA 2JHEA 3AD8C 1XMOF 5I4MA 1FA0A 1SJQA 1YWXA 5KT5A 3MR7A 1VBZA 1N34F 2UUCF 4B9VA 1X60A 3D6HB 4Y00A 2QMUB 3L95X 3S6EA 3KFWX 3UNGC 4AFFA 4DLGA 3P3DA 4KV8B 4NLVA 1AZSA 3TAPA 4QYRA 3MUVP 1FDDA 5AE2A 3WC2A 3QLHB 3BSNA 3KK2A 3ETOA 4C8MA 1MN9A 2E29A 3A8EA 4NXMJ 1N32J 1D9DA 3NKYA 5CHCB 3TARA 2C3UA 2LQBA 4X84A 1K0TA 2HHHF 3N28A 3DOLB 1TK5A
chains in the Genus database with same CATH topology
1F3VA 1F2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3V A;  1F2H A; 
#chains in the Genus database with same CATH topology
 5KFO A;  3FVY A;  1BWV A;  2YNH A;  4UTG A;  4EU0 A;  4CH7 A;  2I2Y A;  1SIW B;  3BSC A;  5KG3 A;  2DK2 A;  2VA3 A;  2DD8 S;  1WD6 A;  4CIO A;  3VAK A;  1ROF A;  4RR5 A;  4KR0 B;  3THV A;  1PJ6 A;  1BWE A;  3DXS X;  1H6K X;  5E3R A;  4ZVH A;  4LSN B;  2DGS A;  4DL5 A;  2RRB A;  5JXS A;  2UVR A;  5GAE U;  4FS1 A;  2FPH X;  3OXG A;  2GIR A;  3HD1 A;  1CVJ A;  4A48 A;  4L3N A;  4OZ2 A;  3F44 A;  1CJK B;  3RW7 A;  3NEK A;  1IBK J;  2CG8 A;  3NNH A;  4LIW A;  1ZTT A;  1HWU A;  4OFZ A;  4X65 J;  2ZHA A;  2LQ5 A;  5H9F J;  2YQ3 A;  4KIA A;  4DV7 J;  2B5J A;  3W65 A;  1JLC B;  2DT9 A;  3G6X A;  1W7W A;  5E41 A;  4QPX A;  3JQJ A;  2FJA B;  2K1R A;  5KT3 A;  1XNQ F;  4F4Z A;  2EBG A;  2MZQ A;  1BD6 A;  2CPF A;  3RTV A;  3AD9 C;  3GG0 A;  4WK3 A;  3DLH A;  2DEJ A;  4HR2 A;  4RW6 A;  4KRW A;  2ZDP A;  3M9O B;  4O3R A;  3SSQ A;  1NK8 A;  3HSD A;  3W1Y C;  1FFS B;  1RT3 A;  4O0I A;  3NGT A;  3D28 A;  2W9B B;  4HT7 A;  1XR7 A;  3DM2 B;  4KHM A;  3T1A A;  3HXM A;  2C2K B;  3EIC A;  1HMV A;  2O66 A;  2E7X A;  3LTO A;  4O23 A;  2JC0 A;  2V6A A;  4ANC A;  4ES1 A;  1E6Y A;  2QSF A;  2KFZ A;  5DGA A;  1SV5 A;  3GJT B;  4B3S F;  4C8N A;  1UVM A;  1PIE A;  6FD1 A;  4BWM A;  2BBE A;  1H3D A;  3T9N A;  2W01 A;  1Q0N A;  1CS4 B;  3V5R A;  2AMC B;  4FKY A;  1NB7 A;  5EDW A;  4RUB A;  2KHC A;  4LF5 F;  2QGF B;  4NI2 A;  3BPS P;  5LOQ A;  3QAE A;  1ZS6 A;  3UDL A;  2JX2 A;  1AW0 A;  3VGV A;  3HVT B;  2W8K A;  4ED1 A;  3OFH A;  3OLB A;  5J1N A;  1R31 A;  1DAR A;  2R8G A;  4RPF A;  2EFV A;  1X4D A;  5AJ3 F;  1LXN A;  3OL6 A;  2G1H A;  3DLE B;  4UOC A;  4M5N A;  4JI7 J;  4WIQ A;  2VFS A;  5GAD U;  4MTP A;  2X1F A;  1V6H A;  3HHL C;  3CNQ P;  2BX6 A;  3UCU P;  1BY9 A;  4X4P A;  3RR8 A;  1ZA1 B;  3KUE A;  4NLP A;  5D0E A;  4LF7 J;  5JMN A;  3IFE A;  4O0N A;  1QJH A;  1NHU A;  5BYQ A;  2GQQ A;  3IXQ A;  1U6F A;  3IM9 A;  2OSR A;  5LJ3 Y;  4CTA A;  2MGZ A;  2M52 A;  1S6U A;  1D3W A;  4KC5 A;  3I56 S;  1YIT S;  2V69 A;  2AU0 A;  1OJ4 A;  2C2N A;  4C0H A;  1YDL A;  2OMO A;  2B4P A;  3J7Z T;  1H0H B;  1S1T B;  4ZVU B;  4R5P B;  3CME S;  3WIU A;  1URN A;  4P10 A;  2JNJ A;  2XQC A;  4LF9 J;  1JLG B;  2D3Z A;  1SVD A;  4O4R A;  1RXO B;  3QZ8 A;  3KDO A;  3ZFV A;  2PMW A;  3G6Y A;  4IFY A;  2E9Z A;  4DZD A;  3CDW A;  4PUO B;  3SFG A;  5D0H A;  2MKY A;  2P8I A;  3Q22 A;  1R8H A;  5GAG U;  5DLG A;  2IBO A;  2R7W A;  4FNH A;  3PYF A;  1JLB B;  3CDU A;  2VU5 A;  4XIU A;  2W2M P;  2KM8 C;  4DL3 A;  2OD4 A;  3I9Z A;  4PEO A;  5E2Q A;  3WX8 A;  1YG0 A;  1NSQ A;  1SH0 A;  3CE8 A;  2YKQ A;  3NXZ A;  1NKB A;  1PIL A;  1TL3 B;  3Q83 A;  3WX4 A;  4HHU A;  2B9Y A;  1A6L A;  4DXL A;  3SIP B;  4WP8 A;  4CLT A;  4DU7 A;  5J2Q A;  3DMJ B;  4JI5 J;  2XMJ A;  2HVI A;  3W63 A;  3HSG A;  2QL7 B;  4URS A;  1H74 A;  1WNE A;  2V4J A;  3EXY A;  4DUT A;  4WU2 A;  3K8V A;  1HBN A;  4DR7 F;  4G1Q A;  1XWL A;  3MMB B;  4O3Q A;  3N01 A;  2NZC A;  2IHR 1;  4DX8 H;  4OZ1 A;  2V2V A;  3N6N A;  2VQF F;  3NLC A;  2VBX A;  1S9F A;  1E6V A;  4IO9 Q;  3V6H A;  3FNN A;  3MMA B;  2K3K A;  2EEY A;  4IOB A;  3RUB L;  4B9T A;  4ED3 A;  3AJ1 A;  3OFF A;  3CC7 S;  4K4U A;  2PC6 A;  3KK1 B;  2D3O 1;  1RJJ A;  2QT7 A;  2ZNY A;  3LWL A;  3HVR A;  3N6M A;  3D1Q A;  1H72 C;  3CIM A;  1M1H A;  3D0G E;  2ABY A;  4L6V 3;  2YNG B;  4ECY A;  2UUB F;  1VQ6 S;  4F04 B;  4CLF A;  2XM3 A;  3BO2 A;  3FCW A;  2R7U A;  1B0V A;  2F8E X;  2OPR A;  1YJU A;  3U1N A;  2I5J A;  2NXC A;  4P74 A;  2N7Y A;  4DQS A;  5DET A;  2X7I A;  1D9F A;  2P6T A;  1Y9O A;  4RNH A;  1N6Q B;  2AEF A;  3VZH A;  3SCL E;  2HGM A;  2GML A;  3KDN A;  1WKL A;  3LAM A;  2I8E A;  3GR0 A;  3PFE A;  3W2W B;  5K14 A;  3T1Y J;  1DQA A;  1VQK S;  4WZQ A;  5CYM A;  4Y28 C;  1XBW A;  5JVG Q;  2LYV A;  1S1X A;  3IRX B;  4ZIT A;  2V8G A;  1WG5 A;  2LCW A;  4RW8 B;  2CPD A;  4CCH A;  1KWM A;  4OYX A;  2OP5 A;  3RBZ A;  3D9B A;  4OI3 A;  2YY3 A;  1N0U A;  2AHO B;  1J5O A;  2CUY A;  3GV5 B;  1L3K A;  2RUG A;  4JP8 A;  2RIL A;  2BAC A;  3NMR A;  1RKI A;  4UF4 A;  4J37 A;  5L39 A;  4ECT A;  3O5T B;  3DFE A;  2HBY B;  4AT1 B;  4PKD B;  2V4Q A;  3FFI B;  1T0T V;  1EZZ B;  3WZ0 A;  8ATC B;  4NMX A;  4OZ5 A;  4OYP A;  4IG3 B;  4J91 A;  3POT B;  1U49 A;  2RRN A;  3IBW A;  1JLE B;  3TW0 A;  1X9W A;  2GA7 A;  4O4G A;  1I5O B;  1LWE A;  4ZK7 M;  5HVH A;  4OZL A;  4RW7 B;  1REV A;  3LP0 A;  5D0G A;  4N56 A;  1VHF A;  3QSI A;  5K5M A;  4KFB A;  1VYA A;  4NZ7 A;  2LDI A;  3NG8 A;  3ZNU A;  5AXK A;  3AOA A;  2VG6 A;  3V81 A;  3JSM A;  3DDK A;  1LW0 B;  4CZC A;  5C42 A;  4LF4 J;  1U7L A;  2CQ4 A;  2IRU A;  4FS2 A;  5KFG A;  4ZVE A;  1FX4 A;  2QA2 A;  4EWT A;  2OFG X;  3TNV A;  1HNI B;  1NSP A;  1UA0 A;  4I6A A;  3MEE A;  2P2C B;  3R5G A;  2B3T B;  3DOK A;  2E5H A;  1L5U A;  5CAA A;  4USW A;  3UR0 A;  1HNX J;  4X66 F;  4JI1 F;  3CJK A;  4ATN A;  3FMB A;  3LGH A;  3MCS A;  4NAS A;  1RT7 A;  1NK5 A;  4DV1 J;  3D0H E;  4ZCM A;  2K1R B;  4TVA B;  3UDE A;  2CDR B;  3SQO P;  4DL0 C;  4U67 Q;  2J8A A;  4M1K A;  1I51 B;  4F0H A;  1VFJ A;  3CO0 P;  3UCZ P;  3C6T B;  5FII A;  3BRE A;  3SQG A;  3QJL A;  2AV5 A;  4KHP J;  3Q8R B;  2H51 B;  1YJV A;  1OWX A;  3EXC X;  4F25 A;  5KFL A;  4F67 A;  2U2F A;  4LF8 J;  3LOU A;  1S1U B;  2RDJ A;  5F8H A;  4KQZ A;  5K9F A;  4B3O A;  2R8K A;  1SV5 B;  4EGL A;  4DLE A;  4Y34 A;  5HN0 A;  1Q7Y T;  3OTE A;  2HQG A;  2FJD B;  2V8P A;  5K8O A;  3FBB A;  3JSY A;  1S6P B;  4A8M P;  3EM1 A;  2AX0 A;  2OH2 A;  2XWY A;  3M9N B;  1NEE A;  1Q5V A;  3D0I E;  5G4D A;  4ZIW A;  1SJ1 A;  3DLK A;  2Y0B B;  2PMH A;  4YDD B;  4F0M A;  2KG0 A;  4DL4 A;  4W92 B;  1BGX T;  3VR1 A;  4BC9 A;  1IKX A;  2C22 A;  4TYA A;  4P6Q A;  1TL5 A;  1R0A A;  4RNN A;  2NR0 A;  1WF0 A;  1X5P A;  2EPI A;  2L9N A;  2DGX A;  5L8R C;  4ETX A;  3J7A N;  2HLT A;  1NPR A;  4WCE Q;  2VFT A;  3DRR A;  2H4W B;  2QC3 A;  4HI1 A;  3K17 A;  1O8B A;  3BBC A;  2FVS A;  5H9E J;  2XSJ B;  1GQE A;  5E3Q A;  1VC6 A;  3J7Y I;  3TZX A;  1U48 A;  4URG A;  1KQF B;  2KXN B;  5F8N A;  2BVZ A;  4N76 A;  2E5L J;  1UFL A;  4P2S A;  3IM8 A;  4AD6 A;  2ZOG A;  2XCP A;  1X7V A;  2XLJ A;  3ADA C;  1SCJ B;  5BYS A;  3QRR A;  1YGY A;  1GTH A;  1ZBT A;  1DTT A;  2VPW B;  2CQ1 A;  2NUU G;  2MLX A;  2ZWP A;  3QYY A;  5KFJ A;  1X4H A;  3U1L A;  4XPE A;  1N5V A;  4TY9 A;  7FDR A;  1UWB A;  2CAD A;  1UL3 A;  3G6E S;  3HDS A;  3DHX A;  2OGU A;  4B3T J;  2OEL A;  4ICL A;  1Y0H A;  3NS6 A;  2UXB J;  1TK8 A;  3H0P A;  2CDQ A;  1Y5I B;  2OPQ A;  5HLF A;  2O1P A;  1IN0 A;  2XTJ P;  5T7L B;  3M32 A;  4LT6 A;  1UJ4 A;  1XMB A;  1UW9 A;  2H5I B;  3F0N A;  1QTN B;  4DSF A;  2CQC A;  1OPZ A;  4N41 A;  3OHB A;  5B0B A;  1KOO A;  5HMY A;  2H4Y B;  1PBA A;  2PMZ D;  3HHD A;  2HK3 A;  3TZW A;  3A3P B;  2VIC A;  4OJH A;  1CJV A;  3E01 B;  2F1F A;  3ZTS A;  2ALY B;  5FDL B;  4JUZ A;  2VV5 A;  3S7R A;  2J7U A;  1QTM A;  1B0P A;  1SL1 A;  3KUG A;  1JQG A;  2FHM A;  4DR4 F;  4HDH A;  4WFA Q;  2B4O A;  2ZZM A;  1HBN B;  3RZA A;  4G1Q B;  4ILR A;  2UU9 F;  5ETV A;  3NBP A;  2DNQ A;  2HMI A;  4TN2 A;  2F9D A;  2YNF A;  1F1B B;  3CF5 Q;  4CLZ A;  4TLR A;  4UW2 A;  1YJ7 A;  2FHO B;  5L1I A;  3AB4 B;  2LXI A;  4AE5 A;  2EVZ A;  1RTJ B;  4LQ9 A;  3NGS A;  2WOM A;  2M5Y A;  4U6P A;  1Q1K A;  1REG X;  1HD1 A;  2XUL A;  2RU3 A;  4AND A;  1QM9 A;  1RDR A;  3RAM A;  2DHX A;  5HK4 A;  2MJN A;  3CO9 A;  4C9D A;  3D68 A;  4X4U A;  5AXN A;  2V0N A;  3PDN A;  5A8W A;  1SKR A;  3CUN A;  4HDG A;  1ACM B;  3PJ9 A;  3W3S A;  2BEF A;  2X3G A;  4LSZ B;  4WPA A;  3AJ2 A;  1N33 F;  4ELT A;  4CH0 S;  4NOH A;  2A6M A;  2M4M A;  1FJG F;  1FRH A;  1HHS A;  1EET A;  5G0R A;  5F9L A;  3W2V A;  5J2M A;  1OQ6 A;  1M5V C;  1BUX A;  1HWJ A;  4TU8 A;  3SV4 A;  4DV5 F;  4KKO A;  2ZM6 F;  3HZE A;  4KPY A;  2HWT A;  1TV6 B;  3EUN A;  5BR8 J;  1FER A;  3GG1 A;  3DRP A;  2N4C A;  5E3P A;  3FRZ A;  3IN5 A;  4X62 J;  1JLQ A;  3NAH A;  3NCQ A;  2QMW A;  4XAK A;  3MPV A;  2MJU A;  4NLX A;  1T03 A;  2YWF A;  3THP A;  3BV8 A;  2YBV A;  3R7B B;  5M2P A;  2ASJ A;  1TUV A;  4AYB D;  3NS7 B;  1QE1 A;  5J2P A;  1BQM B;  4DPT A;  4OMF G;  5D8H B;  3NRB A;  1M0S A;  3N79 A;  3SCJ E;  1N88 A;  5IWA J;  3KMQ A;  4NLQ A;  2RH3 A;  4ECR A;  1BXN A;  1HQE A;  3K7R A;  2W8L A;  5HJY A;  1MWY A;  5L38 A;  1GX6 A;  1RYR A;  4QIW D;  2K7J A;  1C0T B;  1S12 A;  4JI8 J;  2HHX A;  1LKZ A;  4GVB A;  5K8N A;  2LLZ A;  2LQJ A;  1X9M A;  1WC1 A;  1REV B;  1F3F A;  1XTZ A;  1HIY A;  3O6Q A;  3EZO A;  4ZCK A;  3N5B A;  2C42 A;  3NWG A;  4DR5 J;  2VJU A;  4BBY A;  3TJ9 A;  1T02 A;  3M8S A;  3KLE A;  3PJW A;  3PY8 A;  3KHH A;  3QBC A;  5LXY A;  3GU0 A;  2AJ0 A;  2EKN A;  4RUA A;  2H65 B;  4DZ6 A;  3RW6 A;  2RNE A;  2C2D A;  2VB6 A;  2C3Y A;  4J9N A;  1UVJ A;  2C2M B;  4OYM A;  3RR7 A;  2ZBP A;  3TVY A;  2W7O A;  5IQQ A;  2B8Q A;  1RT7 B;  2F8H A;  4OHV A;  2PFF B;  2DGT A;  1YZ6 A;  3ENA A;  5GAH I;  2RHQ B;  2O5D A;  3EJM A;  3OR1 B;  3I31 A;  2YXL A;  4P2F A;  3HKW A;  4DUZ F;  2O67 A;  4PRF A;  1N5Y B;  2YWG A;  1TMM A;  1NK0 A;  5A2Q U;  2LEC A;  3TYT A;  3PW5 A;  2EW9 A;  4I6Y A;  3DXB A;  1RBL A;  4OI2 A;  4OX6 A;  4JYA J;  2GVD B;  3SQG B;  4OX7 A;  1O6X A;  1HYS B;  3MMJ A;  5KFT A;  3C15 B;  3HFZ B;  3ZTP A;  1WWH A;  4DV0 F;  5IC6 B;  2NCK L;  4DPY A;  4C6A A;  1N36 J;  1NZA A;  5LSL A;  1VMB A;  3D6M B;  3KLH B;  2KT2 A;  4LR9 A;  4Q8E A;  1SIZ A;  1YLX A;  2RJZ A;  1X5O A;  4P52 A;  4B08 A;  2YH0 A;  1RWX B;  4OL8 A;  4I6W A;  1UZD A;  4DV3 F;  2HS0 A;  2RQK A;  1AFI A;  4MYT A;  2DIS A;  3BBB A;  2RRA A;  1FKP A;  3C8Y A;  3SXL A;  2DNY A;  2LEA A;  4RWW A;  4LRA A;  1FFG B;  5ETQ A;  3SDE B;  4ZOS A;  1Y00 A;  1B7Y B;  1WTB A;  1IKX B;  3DGP A;  2DH8 A;  4DOZ A;  4DMZ A;  4JV2 A;  2WTF A;  4F4A A;  4L76 A;  5SZT A;  2YPY A;  4X64 F;  3K2Y A;  2BJD A;  4MKB A;  3HHE A;  4J9U E;  3DRR B;  3NGR A;  1XMO J;  4CNZ A;  2ILZ A;  1TKT A;  1RAE B;  1N34 J;  2UUC J;  4ELU A;  1OMS A;  1T9V A;  4L75 A;  3RRH A;  1KP6 A;  5AT1 B;  3TAQ A;  2ZEJ A;  2XO7 A;  3BJY A;  3MEC A;  3ZTR A;  4FNI A;  3MGJ A;  1Y3K A;  1S79 A;  3J81 j;  3TWZ A;  2HFV A;  2BQR A;  3DRX A;  2BJ7 A;  5KT7 A;  1FES A;  5A8K A;  3BR8 A;  4DR3 J;  4AL6 A;  3DNC A;  1XMQ J;  2C28 A;  1PAU B;  3RB4 A;  1KEK A;  2R2S A;  2CJ9 A;  2ZH8 A;  1K1Q A;  5KT6 A;  1H38 A;  1R0C B;  3ILJ A;  2BW2 A;  1PC4 A;  1DHM A;  4W90 B;  2CJQ A;  3OSP A;  2F7V A;  2YVS A;  4DS4 A;  2BJE A;  1K47 A;  2G9O A;  3HHL A;  2EFG A;  3DC2 A;  5EN1 A;  4PCQ A;  4JV5 J;  1VK3 A;  2EFO A;  4NLT A;  4ED5 A;  1OSC A;  2OLW A;  2JFK A;  2JC1 A;  3TA1 A;  1ZOT A;  5HQ8 A;  2ZBQ A;  4ILL A;  1FE4 A;  1U6B A;  3ET6 A;  4CH1 A;  1VQM S;  3MAA B;  3LP1 A;  3KNA A;  2JH3 A;  3UE2 A;  2GHP A;  3TUZ C;  1YVF A;  1VDH A;  3M32 B;  4QOT A;  1U2F A;  5L9X A;  3W62 A;  2WBR A;  3H98 A;  2JLE A;  2DH7 A;  1RT2 B;  2EFQ A;  1F0X A;  2X51 A;  3MOJ B;  1WEL A;  2J6U A;  2IM1 A;  1VJQ A;  5J1E A;  1S9E B;  1N5T A;  3MHY A;  3DYA A;  3P49 B;  3KK3 B;  2CJA A;  2DR9 A;  3R3T A;  3HHL D;  1CQM A;  1VBX A;  2PA8 D;  4PPZ A;  1SQG A;  2RQ4 A;  1JIH A;  4DG1 A;  2O3D A;  4CRJ A;  1WC4 A;  3FBF A;  5E7O B;  3MM8 A;  4PYD A;  3CCM S;  2B56 A;  1EAY C;  2YNF B;  2UUA F;  4ECX A;  1K1S A;  1KLM A;  3QFW A;  3CJ8 A;  2LQ8 A;  1X4B A;  2XMW A;  2H1Y A;  3OLA A;  5KFU A;  1KON A;  1G3O A;  2WOM B;  1R8B A;  2HFO A;  3BGU A;  3B8H A;  3ISN C;  5A6W A;  4OI0 A;  2E1M C;  4F8R A;  1JJC B;  3DLG B;  5L9N A;  4B3S J;  3VAL A;  3EMT A;  5IOL A;  1RHM B;  3I0R B;  1WG4 A;  2B8P A;  2BYC A;  1U24 A;  4LR8 A;  4JOU A;  3BSA A;  3OL7 A;  5A8W B;  4LF5 J;  2NPF A;  4EUV A;  5CD4 H;  1UEK A;  3FJ2 A;  5KFM A;  5DDR C;  4J9L A;  4ZCL A;  2AEM A;  2J9C A;  5HRO A;  2LXF A;  3MR3 A;  3W2V B;  4C98 A;  3T3F A;  4EZ6 A;  4TLQ A;  4GKK F;  5AJ3 J;  2BE9 B;  1Q86 T;  4TKT A;  1RT1 A;  1JKH A;  3QRP A;  2CA9 A;  3VAI A;  1TQL A;  1URR A;  2VBY A;  1M90 T;  3IBC B;  1YJN S;  3GYN A;  2Z2Y B;  4B02 A;  4JI4 J;  2CNL B;  2WON A;  3I82 A;  3IR5 B;  3A4T A;  1CUL B;  1UVI A;  1C4A A;  4A46 A;  1GX5 A;  1QE1 B;  2PT0 A;  5KFF A;  2AJQ A;  2GQC A;  1J2V A;  4ZLJ A;  5D77 A;  1YRX A;  2KN4 A;  2FHJ A;  1KQK A;  2E44 A;  4IR9 A;  1DLO A;  2VF3 A;  2CWX A;  1S49 A;  4OI1 A;  2FVR A;  1V5I B;  2HUR A;  1LW2 B;  2CZV C;  1HQE B;  1VQ8 S;  4I69 A;  2UVW A;  3QWP A;  2HND A;  4MK8 A;  1IR0 A;  4IG0 A;  1OY8 A;  2YKM B;  2JZ5 A;  1HPZ B;  4LFC F;  1FE0 A;  4WFB Q;  1C1B A;  2YNI A;  4ID8 A;  4B3R F;  2CNN B;  3ENW A;  5IM0 A;  4K0K J;  2ZH3 A;  2B4V A;  2J9D E;  2QZ8 A;  2KO1 A;  2KI2 A;  1XJW B;  4LFB F;  1P27 B;  1RTI A;  2MQO A;  5LXR A;  1V9O A;  2B6A A;  3D2W A;  1NH8 A;  1T94 A;  3IR6 B;  3BQ1 A;  4NLU A;  3UN3 A;  3FCH A;  1VRQ C;  2FHJ D;  2DEI A;  2J7W A;  3V6D B;  1D1U A;  1RHJ B;  4YQW A;  4K2J A;  1Q79 A;  2HWH A;  2M2B A;  1FO1 A;  4IKA A;  1PCA A;  2K2P A;  3CED A;  1NH7 A;  4Q7A A;  1HNZ F;  1TKZ B;  5LL6 d;  3MMC A;  5DZ6 A;  2HRU A;  3CD0 A;  4WE1 B;  3A8I A;  4CLW A;  4NA3 A;  4WP3 A;  3DRS A;  4OYB A;  4KH1 B;  1EAR A;  3JTO A;  4PYA A;  3M2R A;  4DR7 J;  4FN5 A;  1R0B G;  5DQI A;  5LSO A;  1RT6 A;  1NJX A;  4UOF A;  4LRE A;  4KJI A;  1RA6 A;  1WC6 A;  4N77 A;  5DQH A;  4RBT A;  4C7Q A;  2VQF J;  3CCJ S;  1FCA A;  4DQP A;  4NA1 A;  5B0G A;  2ERR A;  3R7S B;  3PX6 A;  3KTQ A;  4DV4 F;  1DQ9 A;  4UST A;  1NK6 A;  1DZ5 A;  3KHL A;  3LA0 A;  5DO2 A;  3P5B P;  5F0U A;  4ITS A;  1ZM4 A;  4FF1 A;  3W9J A;  2W2P P;  4MIW A;  1QVG R;  4HEA 9;  1IKV B;  1TMJ A;  1JLF A;  2HKE A;  1EIY B;  1T9W A;  1TVR A;  1X4A A;  5D0R A;  2DHH A;  2G2Y A;  1SKU B;  2QLB B;  1KR4 A;  3EDR B;  2QRR A;  3MD1 A;  3G82 B;  3J80 Y;  4U8Y A;  1IXK A;  4A8Y A;  3IWL A;  4EO6 A;  3H20 A;  4LRF A;  1U1K A;  4N8N A;  1DQ8 A;  3EGZ A;  4DX7 A;  2QL9 B;  3T5L A;  4M5J A;  4ZVR B;  2D69 A;  3PVX A;  4DHV A;  2RSQ A;  5DDO C;  2UUW A;  2IVM A;  3UVJ B;  4UOH A;  4YEA A;  4O3N A;  3T1H J;  3W8G A;  1FWP A;  2ZC4 A;  3BQ2 A;  4MFB A;  1AXQ A;  5HJX A;  3D3C J;  3MFI A;  2G0C A;  2DNN A;  5C24 A;  1XQI A;  3UCG A;  5B7W A;  3I5A A;  2FZC B;  4ID5 A;  2PDA A;  1IR1 A;  2JRS A;  4WYL A;  3KJV A;  1O51 A;  2VOP A;  1VC5 A;  2DCL A;  3LPY A;  2W25 A;  4ECZ A;  1BQX A;  4Z7Y A;  4OX9 F;  2YWW A;  4F4Y A;  4UY8 T;  1Q82 T;  4QU7 A;  2HQI A;  1CJT A;  4G1I A;  2KYZ A;  3PYE A;  2FTR A;  2Q79 A;  1VIX A;  1RWN B;  3W5Z A;  3JSB A;  2BOP A;  3JQK A;  2Y1I A;  2WB1 D;  2QLJ B;  2DNL A;  1T11 A;  1NJZ A;  2DR6 A;  4NCG B;  1FVQ A;  4RNO A;  1VJW A;  2A6O A;  1IQT A;  3GFY A;  3CJ4 A;  4FBT A;  4KGX B;  3UFC X;  3JSR A;  2BQ3 A;  2IYI A;  2MEW A;  5K8P A;  3NGD A;  4KV8 A;  3LO3 A;  4JI3 J;  4V1A k;  2QYG A;  4YY3 F;  4Y2M A;  1R89 A;  5CAB A;  3IWX A;  2A2C A;  2BRK A;  1NDP A;  2K7K A;  1H2V Z;  3MED B;  3DOL A;  2M0G B;  2XYG B;  3HHL B;  4OLO A;  2N4D A;  2CAJ A;  2WSC C;  3D5M A;  2NQP A;  4CLY A;  1GXU A;  4I2Q B;  3MTJ A;  4ZVQ B;  2R7O A;  3MR6 A;  4TXS A;  1KBR A;  1WHY A;  5GME A;  1RT4 A;  4XDD A;  1QAX A;  3OT9 A;  4O3P A;  3CDA A;  3ET6 B;  3M8W A;  2FY1 A;  2AZ3 A;  5HAT A;  3I9V 9;  3CWJ A;  3W5Y A;  4ERD A;  1D09 B;  3PW7 A;  4IFV B;  2ADB A;  2F4V J;  2HBR B;  3HSZ A;  4DSL A;  4LSN A;  1UP1 A;  3UN2 A;  1EX8 A;  4X4T A;  2NXN A;  3HMJ G;  2R2T A;  2F8M A;  3HKZ D;  2FZG B;  3DYA B;  2WW4 A;  2BE2 A;  1CJK A;  1IM4 A;  1Z4U A;  2QV6 A;  2HQC A;  1TL7 A;  2J0S D;  2MXY A;  4UT4 A;  5LM7 E;  3IR7 B;  2AD9 A;  2DNO A;  2DRA A;  1RAI B;  2G2Z A;  3MM8 B;  3R5B A;  1YBT A;  2DNP A;  3EE3 A;  2RS8 A;  3LPE A;  4RWX A;  2UVU A;  1MNE A;  1S48 A;  3BGO P;  5GMK a;  3FZ2 A;  4DSI A;  4ZPV R;  4EYI B;  1BHN A;  3DU6 A;  2ZH9 A;  1JNR B;  2KG1 A;  3OSN A;  2CVI A;  3TX0 A;  2MHE A;  2FLO A;  1VQ5 S;  2YKP A;  2BJ1 A;  1NPK A;  3C14 B;  1P9Q C;  3D67 A;  2LP4 A;  4KPC A;  2W9B A;  1QDU B;  3DM2 A;  2W4P A;  4DBQ A;  4FBU A;  2ZC3 A;  3R7N B;  2V2Z A;  3TUJ C;  4NXM F;  4RNM A;  4J9M A;  1UET A;  2IDE A;  3OXF A;  4JB8 B;  3CXC R;  3CIZ A;  4MAK A;  2EXU A;  2NS1 B;  1MG7 A;  1T3O A;  1WG1 A;  3I5C A;  2GJ2 A;  2UP1 A;  4HHJ A;  5GAH U;  2GO9 A;  2WZ1 A;  2FVP A;  4KT0 C;  2ASL A;  5HRO B;  2DIV A;  3GB0 A;  3RU0 A;  2HQF A;  4NLD A;  4F4W A;  3L7P A;  2LA4 A;  4M5G A;  3ZZ0 A;  3H7H B;  3UI3 A;  2QX0 A;  4NX9 A;  1TAU A;  1P6T A;  2CRL A;  2KL8 A;  5MAO A;  1JJ4 A;  3HVT A;  2V34 A;  3TEG A;  1K73 T;  1JKH B;  1VQP S;  3NWR A;  3KKF A;  2NYH A;  4NXN J;  2I9S A;  3EWG A;  4Q0B B;  1NM2 A;  4ENO A;  1F9H A;  1XER A;  1X4E A;  2ZE2 B;  3CTR A;  1ULR A;  4WWS A;  2IVY A;  3U27 A;  2M3D A;  3I0S A;  1GMV A;  4WII A;  2ZJP Q;  4DFJ A;  1NK7 A;  2RKI B;  1ZM2 A;  4CO5 A;  1HW9 A;  5A6P A;  4GO5 X;  4WU3 A;  1IBK F;  5LSR A;  1NBE B;  3D4J A;  3M8P B;  1NHV A;  4M5I A;  3AOD A;  3OTO F;  1UEV A;  1IBM F;  4K4W A;  3QID A;  4D3H A;  3UR3 C;  5HMZ A;  3CSK A;  4DV7 F;  4HLB A;  2I6W A;  3OL8 A;  3KLF B;  1VI7 A;  4DF4 A;  2WVE A;  2FY8 A;  2BQU A;  3EZU A;  4X4S A;  1S6Q B;  2YWK A;  5AXL A;  1KFS A;  1RAF B;  3D6T B;  3FSI A;  1O0P A;  4PZV A;  4X4N A;  5DRK A;  1F2G A;  5ETT A;  5ETM A;  1UVN A;  3FQL A;  2YKN B;  2HWI A;  1RWP B;  2NZ4 A;  2YNI B;  4WZM A;  1S1T A;  1ELO A;  3GYG A;  1S7I A;  4R5P A;  4USV A;  3E3X A;  2DY9 A;  5IM0 B;  2VKR A;  2XG8 A;  4TQR A;  4QIG A;  4QIE A;  2CNK B;  1LWC B;  2ZH5 A;  2ROE A;  1P1T A;  3LAK A;  4HVZ A;  2BOA A;  3DN9 A;  1RT5 B;  2I0X A;  2HVE A;  1GAO A;  2HZC A;  4NEZ A;  1JLB A;  1S6O A;  2AF6 A;  4WKR A;  1DTQ B;  2IM3 A;  3C6U B;  4RUH A;  3M8R A;  1TP7 A;  3CGI A;  3Q2S C;  2QA4 G;  4DL6 A;  1HWI A;  3PRB A;  4FYX B;  2RT3 A;  1MWZ A;  2WVB A;  3KMS A;  5AXM A;  1PBU A;  4KBI A;  5IT4 A;  1TL3 A;  5K8M A;  1NK9 A;  4G3I A;  1D0E A;  4ZN3 A;  3JTN A;  2WVC A;  4YS2 A;  3QSY B;  1U0S A;  4UUW A;  1YRT A;  4PG7 A;  1OY6 A;  5KT2 A;  1DBD A;  2H3E B;  1Y3J A;  3HPO A;  3DRS B;  4NZ6 A;  1WEZ A;  3G87 A;  5A2Q Y;  4DR4 J;  3DMJ A;  3G8Q A;  2H48 B;  3M2R B;  1OYD A;  3OFG A;  2UU9 J;  3EDQ B;  3HO1 A;  2V8H A;  5L1L A;  1ZZN A;  2Z8Q A;  4JI7 F;  4URQ U;  2J6T A;  1KHW A;  3MMB A;  5D4P A;  4PG8 A;  2E5J A;  2BAN A;  2DRB A;  3OR2 B;  1NK4 A;  1ZA2 B;  4OJ3 A;  2WW8 A;  4LF7 F;  5IQ6 A;  1SUQ B;  4BCA A;  3R8Y A;  1JWW A;  1LK7 A;  2YPZ A;  1HAR A;  3GCW P;  4NRT A;  5IFM A;  3I4H X;  4PR6 A;  2RHS B;  2AJ2 A;  1X0F A;  4A8O A;  2W9C B;  3D3B J;  2Z56 B;  3GIJ A;  1JLF B;  3BN4 A;  2NRE A;  3MPY A;  4ES3 A;  4LBP A;  3F56 A;  4RU2 A;  1VQL S;  3KK1 A;  2CPI A;  4X2B A;  4HTJ A;  1U8W A;  3PNI A;  2VC0 A;  3FSX A;  4DFP A;  2PGC A;  1N33 J;  3H2U B;  2YNG A;  1FI4 A;  1APS A;  1N0V C;  1FJG J;  3VAF A;  1YBU A;  1U1P A;  3MEG B;  2G0I A;  5LJ5 Y;  2FJW A;  1YIJ S;  4LJM A;  2B43 A;  4K4T A;  4MFB B;  2ZM6 J;  4GC7 A;  1B70 B;  3QIP B;  1YK9 A;  4PXC A;  1K9M T;  2ZVI A;  4OYA A;  1N6Q A;  2G2O A;  3FBC A;  3KJV B;  3UO0 A;  5DJB A;  2HK2 A;  1C4C A;  2PI4 A;  3DCA A;  3GTY X;  3W2W A;  5HP1 A;  3NAI A;  4AL5 A;  5D4O A;  4ZPD A;  1NND A;  3M8Y A;  3IRX A;  4CNY A;  5C7P A;  2G13 A;  4RW8 A;  1X5S A;  4CO0 A;  5F8J A;  5I3U B;  2KH9 A;  4K4Y A;  1XR5 A;  1NUE A;  3H90 A;  2F3J A;  4JI5 F;  3N4W A;  1FDB A;  1Q8I A;  3IO1 A;  4R0J A;  4TU7 A;  2ZH6 A;  2V4R A;  3TZZ A;  3GE9 A;  3MCN A;  2WRM A;  4F50 A;  4ZDN A;  4Q8F A;  4U96 A;  1SJR A;  2Z58 B;  2AGP A;  2DCU B;  4AQY F;  3FFI A;  4OX8 A;  1XNR J;  3PXG a;  2ZH2 A;  4F26 A;  3GMG A;  1F3V A;  4IG3 A;  5MLC V;  3POT A;  1IQZ A;  2CPJ A;  1JLE A;  1RT4 B;  4J5O A;  2BUN A;  4RW7 A;  4F3M A;  2MQQ A;  1D9A A;  1UWA A;  2CXE A;  4NPO A;  3SSS A;  2R4F A;  3IS9 B;  1WAC A;  1FDN A;  2R8I A;  3NY0 A;  4I64 A;  2VA2 A;  3IBF B;  2MPU A;  2HBZ B;  5E0O A;  3BB5 A;  2FGC A;  4F0K A;  2XHC A;  1LW0 A;  3A8K A;  2YKO A;  2Z30 B;  2VOD A;  3Q8Y A;  3NNA A;  4ZIV A;  1FK9 B;  3PJX A;  1OPI A;  2XMA A;  1C1C A;  4J9S A;  1CQN A;  1H2U X;  1LWF A;  4DSJ A;  2Y1R I;  3QPI A;  2IPO B;  3Q8Q B;  2B4U A;  1RK8 A;  1QAI A;  1DUR A;  2BE2 B;  1HNI A;  2EG1 A;  3DLB A;  3LWM A;  1TL7 B;  4PAA A;  3CJT A;  3Q8S B;  4M5L A;  3VVU A;  3GYX B;  1XC9 A;  4QPT A;  3MAQ A;  3GIM A;  2ZUA A;  3HLU A;  2HNY B;  4ZLP A;  1BC6 A;  3RYL A;  2J5A A;  2Y1J A;  2RDI A;  3TR5 A;  2VPZ B;  3KG1 A;  1S0N A;  4CO2 A;  2IJF A;  2JL9 A;  2HGL A;  2JEG A;  1ZM9 A;  3BS9 A;  3C6T A;  4H54 A;  5KFN A;  1KHV A;  1FVS A;  4OYW A;  5B0C A;  3ISZ A;  1WEX A;  3AXM A;  4H4M B;  4TY8 A;  4DX5 A;  1OO0 B;  2QLW A;  3X3U A;  5CA5 A;  9RUB A;  1S1U A;  1HNV A;  4IR1 A;  2HAF A;  1TFW A;  2D1C A;  3G2X A;  3R1H A;  2L48 A;  2AYB A;  3A12 A;  4QWC A;  4DV3 J;  4LFA J;  1GEH A;  4ZJO A;  1S6P A;  1JK9 B;  3GSI A;  4MT1 A;  1EQ0 A;  2ZBC A;  1M5P C;  4EZ9 A;  3ZTO A;  4NRU A;  5KFY A;  3NCP A;  5E3A A;  4JI6 J;  1JNZ B;  3G8S A;  3QZ7 A;  3QO9 B;  5ETL A;  2XEX A;  4FYW B;  3MM6 A;  3BGR B;  2L08 A;  4H4O B;  1OSD A;  2Q3P A;  3FCV A;  4I2P B;  2A10 A;  1WF1 A;  2CPX A;  1IKW B;  4DCP B;  2OEJ A;  1KQS R;  5KG2 A;  3UW1 A;  4KH0 B;  3GIL A;  4LF4 F;  1FRL A;  3LF0 A;  3HT3 A;  2N82 B;  2MSS A;  3I0S B;  2VZ9 A;  5IV4 A;  3EGW B;  4RU9 A;  4UUX A;  1LFP A;  2XSJ A;  3MTK A;  2GGP B;  4U7U D;  5C5J A;  2OSQ A;  1CJU A;  2PII A;  4B3M F;  1FXL A;  2HSE B;  1OS5 A;  4NCA A;  1HNX F;  2QLF B;  4RW4 A;  3H8Y A;  1T8E A;  4FF3 A;  5CYQ A;  4DV1 F;  3MM7 B;  1UVK A;  3ISN D;  5HAO A;  2W2N P;  5A8R B;  2PN6 A;  4ZPB A;  3MR2 A;  4AXJ A;  3BEG B;  4DF8 A;  4WTO B;  2RB7 A;  2J0X A;  2DKO B;  5IV3 A;  4PG6 A;  2DPJ A;  1FNM A;  3VWS A;  2QIF A;  3GSD A;  1FFW B;  1PJ5 A;  2VHG A;  3HJV A;  2ZD1 A;  4LF8 F;  2XI3 A;  2CZ9 A;  3PRV A;  1D8Y A;  4KTQ A;  2BZ2 A;  2HHP A;  1R43 A;  5LMU F;  2KRR A;  1VRT B;  2MDA A;  2FDN A;  3MD3 A;  3A8J A;  4NML A;  2Q66 A;  4QZV B;  2K8G A;  5T7L A;  2ZKT A;  4RX6 A;  4XDC A;  3TOQ A;  3NGK A;  1RKJ A;  1M5O C;  4JI0 F;  4DN9 A;  4RUC A;  1FTC A;  1HI1 A;  2DNK A;  1HBM B;  1S5Z A;  5KFI A;  2UXD F;  1N5S A;  4B9S A;  1FX2 A;  4A8S A;  1TZ0 A;  2DGV A;  2E7V A;  1F5A A;  3CMQ A;  3PR4 A;  1RAJ A;  4FKX A;  3K59 A;  2HNZ B;  2C3O A;  3QFH A;  2ZZN A;  1R6Y A;  5CZX A;  1LV5 A;  2C3M A;  4N7T A;  1AB8 A;  3E01 A;  4OV6 A;  1QD1 A;  5FDL A;  4K50 A;  2OTL S;  4DR1 J;  2M7S A;  2IAJ B;  2J76 E;  3GJS B;  2C2R A;  3JAM U;  2VJV A;  1L3V A;  2UUA J;  3ONQ A;  2ZDO A;  4PQU B;  4ECW A;  2FLL A;  2ASY A;  3OBI A;  4RL1 A;  4O44 B;  5DLF A;  2BAN B;  3G8T A;  1KNZ A;  2YQ0 A;  2W7P A;  1G6B A;  2GVZ B;  2UVV A;  2VDI A;  1UW4 A;  2XGP A;  4PXE A;  3PEJ A;  2AQ4 A;  3OL9 A;  1CBK A;  1RTJ A;  4DR6 J;  3B54 A;  3SMZ A;  4HH1 A;  4HKQ A;  3EZ5 A;  5HBM A;  2JOQ A;  1RQ0 A;  3A3N B;  1HNW F;  3KG0 A;  2R8H A;  2MKH A;  4GKJ F;  3PCO B;  4ZLN A;  1VIO A;  5T14 A;  2GO8 A;  3D1O A;  2R2R A;  4J9P A;  4KO0 B;  1Q16 B;  1EKR A;  2GJI A;  4FYV B;  2EK6 A;  2VQE F;  4C0B A;  1WKJ A;  2R7T A;  1VQO S;  2X1G A;  1KN6 A;  1RA7 A;  1TUW A;  4OI6 A;  4GKK J;  1B99 A;  3S01 A;  2GAH C;  1B64 A;  2W7A A;  4A8F A;  1UCN A;  3TI0 A;  5DG9 A;  5LMN F;  3T19 A;  1C0U A;  3BF4 A;  1SL0 A;  1ZAW A;  3CJ0 A;  3PIP Q;  3WC0 A;  2D7S A;  3GR1 A;  2LFV A;  2OHD A;  1TV6 A;  1TKX B;  4C48 A;  4UQG A;  5HP1 B;  4WF9 Q;  1LQ9 A;  3CJS A;  1YKW A;  1DRZ A;  2Q6B A;  1UJ6 A;  3BN7 A;  3W60 A;  5H9F K;  4BLG A;  3SCK E;  5IT0 A;  2XO6 A;  2CQH A;  4RZR A;  3PKM A;  3HCX A;  2XBP A;  1RUS A;  1I94 J;  5E33 A;  4ED0 A;  1BQM A;  3VAH A;  3NOC A;  4MKY A;  1PKU A;  4OZN A;  1RBA A;  4WFX A;  2B9W A;  3G86 A;  3IRW P;  1T9X A;  4RLE A;  4U9R A;  4KHR A;  3QRQ A;  3E2E A;  2Y1L B;  5E3C A;  2AEJ A;  3WBZ A;  4LFC J;  2QSW A;  3UDC A;  3GZ7 A;  4ED7 A;  1FRJ A;  2YX4 A;  3CD7 A;  1HBU B;  3VQT A;  1HR0 F;  2X1B A;  4B3R J;  1UEU A;  1FWK A;  1UFW A;  2R8J A;  4LSL B;  3M6X A;  1C0T A;  1RP5 A;  3GJQ B;  2PI5 A;  1VLO A;  1YBA A;  3VHQ A;  2U1A A;  2BAB A;  5KFX A;  4A8X A;  2GQ2 A;  4QWA A;  4ZMM A;  3S1T A;  1RSC A;  3DLJ A;  3RRG A;  1KKH A;  3GQC A;  4OQJ A;  3TA2 A;  3B6B A;  2GCF A;  2MQ8 A;  4OZJ A;  2PD1 A;  1WDD A;  3W8P A;  1YI2 S;  1C1C B;  3ILL A;  3J7A 1;  1VLY A;  1LWF B;  4K5S A;  2M8H A;  5C2C A;  4FVC A;  4J9K A;  3GWC A;  3SBM A;  3PM9 A;  4M5H A;  3SYZ A;  3LGM A;  2E9T A;  2XHW A;  2AGQ A;  3V6J A;  3I96 A;  3V4I B;  3SI8 A;  5D4L A;  5I42 B;  4ED4 A;  4UQT A;  5CCL A;  2K3I A;  5ADZ A;  2C3P A;  4D3G A;  1KOH A;  1F5C A;  3UNY A;  4ZCI A;  2Y0S D;  1RTD A;  3OR1 A;  1RWV B;  5KG0 A;  4X62 F;  1RZM A;  4PXB A;  4YME A;  4HT5 A;  1PAE X;  1N5Y A;  1Y11 A;  4P9S A;  3QGI A;  1X0P A;  5F8L A;  3ZO7 A;  2GVD A;  4KB7 A;  1FT8 A;  2FUG 9;  3IGN A;  3CJ5 A;  1HYS A;  5KG5 A;  3C15 A;  2DO4 A;  1WOP A;  1S76 D;  3R5A A;  1WOR A;  5BYR A;  1T3N A;  4TY8 B;  2F5G A;  5J2N B;  1MW7 A;  1HNV B;  4B17 A;  1GXT A;  2OUG A;  2ZUG A;  3CCV S;  1P1L A;  5IWA F;  3MWB A;  3KLH A;  3IA0 A;  1WHV A;  2WBM A;  6AT1 B;  1HBO B;  3L9Z A;  2DR5 A;  2LMI A;  1EQM A;  1KTQ A;  1GMU A;  4YR0 A;  2A18 A;  4WFZ A;  4YR3 A;  1NME B;  1U25 A;  2BW7 A;  2X3D A;  3ZZY A;  2GV1 A;  3SDE A;  2KFY A;  4CO4 A;  5IT9 U;  4OHW A;  3PG9 A;  3MM6 B;  2H54 B;  2FGO A;  3V6K A;  3ICL A;  3D54 A;  2C2O B;  2VUG A;  3K5N A;  2PEH A;  1RWK B;  4I7F B;  2DH9 A;  4IDK B;  3K58 A;  2IA6 A;  1X4C A;  5B0A A;  4KYZ A;  1FJ7 A;  2SXL A;  2RIJ A;  3AQO A;  4IRK A;  5F3T A;  1Y4Z B;  1GTE A;  3L7O A;  3JYT B;  2RQM A;  3PYD A;  3D66 A;  5E5N A;  3AHP A;  2OAU A;  1PO6 A;  3EPI A;  2Z57 B;  4KGV B;  1VQ4 S;  1CJU B;  2LEB A;  2QN6 B;  2XI2 A;  3Q2T C;  3RRK A;  4KE5 A;  2FJB B;  2JVO A;  3N0V A;  4P73 A;  4RW4 B;  4YY3 J;  4X4Q A;  3HP6 A;  2XB2 D;  1MU2 A;  5CYQ B;  2MKJ A;  2XLI A;  4AUK A;  3OV7 A;  2XY6 A;  1HQ2 A;  2ALZ A;  2HW3 A;  3LW5 C;  2KXF A;  3R5J B;  3G71 S;  4EYH B;  5CH7 B;  4C11 B;  2BKO A;  2HFZ A;  3CD5 A;  4IOA Q;  1AUD A;  3BYP A;  4IQX A;  3KLI B;  4PG5 A;  2OPS A;  1FD8 A;  2RD5 C;  2ZD1 B;  1WC0 A;  1U6Z A;  1WSV A;  4UOG A;  3K0J A;  2ZWO A;  5KFC A;  2L9W A;  1VQS A;  1QUV A;  2DB1 A;  4DDF A;  3RBD A;  3MM9 B;  3MI7 X;  1HHT P;  2YWE A;  1Q81 T;  2J9E A;  1N36 F;  1BQN A;  5B0D A;  1ARO P;  1X4F A;  1IBL F;  3LP2 B;  2ATL A;  3KJF B;  2EFP A;  4I4B A;  3MAA A;  1L3S A;  4U7U K;  2CQ0 A;  3MDF A;  4AXI A;  1U0H B;  2E1R A;  1S0V A;  1RCX B;  3QGG A;  3TZY A;  4DPO A;  1NJY A;  5KFW A;  5ETN A;  4NLO A;  2NSC A;  4BHQ A;  4GVL A;  4A8W A;  1RT2 A;  3W7B A;  4C4W A;  4QR2 A;  3CMA S;  8RUC A;  2XSF A;  3H5S A;  4ZPW R;  1UTA A;  4LVO P;  4DL7 A;  4E2F B;  5CXT A;  4N5S A;  1S9E A;  4NYZ A;  3Q0A A;  4EBE A;  4ELV A;  3TAN A;  2FJE B;  3KK3 A;  2ZIT A;  3HHK A;  1S0O A;  2V8V A;  3GJR B;  4UZC A;  5B0E A;  4EBC A;  3RB3 A;  3MZI A;  1VCT A;  3DDI A;  3T5K A;  4C8Y A;  1IKY B;  4Y6I A;  3FSY A;  3TQE A;  2C2Z B;  2FIU A;  3R2D J;  3K5L A;  4USH A;  2FD2 A;  4L3K A;  2ZOM A;  3EPG A;  2M9K A;  3BM7 A;  2MZJ A;  2V2Q A;  5F8G A;  4ED2 A;  1SC4 B;  3PW2 A;  4F2R A;  4NLY A;  1N48 A;  5F0W A;  2VG5 A;  4YB7 A;  4LBH A;  2A0F B;  3NP5 A;  5HL7 Q;  4DPX A;  3EGN A;  3CDB A;  2MHN A;  1Z1Z A;  4DR3 F;  1Q4R A;  4ED8 A;  4ZP8 A;  1XMQ F;  1FRX A;  4KGZ B;  4P71 A;  5HBM B;  1U47 A;  2KTQ A;  4F3Q A;  2DO0 A;  4PPD A;  2MY8 A;  3DLG A;  3M8Q A;  1N5Q A;  4JI2 F;  3ILO A;  1NZ8 A;  2E1A A;  2ZHB A;  4YB6 A;  1HL6 A;  3I0R A;  4U95 A;  4LR7 A;  1QAJ A;  2G4B A;  5EUH A;  2AYG A;  2ROP A;  2XZD B;  3OUY A;  2MQM A;  5KG6 A;  1Q8L A;  1NU4 A;  3TX8 A;  4I68 A;  1S1W B;  4K4X A;  5L1K A;  4JV5 F;  2QLX A;  2AT1 B;  2RVJ A;  3HZG A;  3BZQ A;  4XO0 A;  4OYZ A;  3C16 A;  3T41 A;  2KHD A;  3DU5 A;  1RHU B;  1R8P A;  1TU0 B;  1VQY A;  5D4N A;  2UV8 G;  1YTY A;  3O44 A;  2RUS A;  1VR6 A;  3FKB A;  4IH5 A;  1C0U B;  3K5P A;  3TRG A;  4K5R A;  1U09 A;  2ACM A;  5KOX A;  3FEX B;  2OPP B;  2VBZ A;  4YFU A;  3FQK A;  3VGU A;  5A0Y B;  4ES2 A;  1MRO B;  1UZH A;  3AB2 B;  3T5H A;  2UXC F;  5DG7 A;  5F9N A;  4OHX A;  3AH6 A;  4C8Z A;  4PWD A;  1ZPV A;  3IMQ J;  3OTO J;  1CUL A;  1IBM J;  2QJ3 A;  2OIH A;  2XMT A;  1QSY A;  2RF2 A;  3ILI A;  2QEX S;  3ZXW A;  1F5B A;  1IWA A;  2F9J A;  3AD7 C;  2E1C A;  2FLN A;  2E9R X;  1RHR B;  4Y3C A;  3MM5 B;  4Q43 A;  3RJM B;  1NPP A;  1CG2 A;  1LW2 A;  5KFE A;  2NUH A;  1SC1 B;  1S4F A;  1FKA F;  4A8K A;  2YKM A;  4DUY J;  1HPZ A;  1NSK L;  2V94 A;  4CP5 A;  1KLN A;  1ZM3 A;  4HAC A;  1SKW A;  4C8L A;  3JQM A;  3PX0 A;  3CD6 S;  1WHX A;  2GIQ A;  4LRD A;  1JLA A;  4L72 B;  1S10 A;  1KSP A;  4YOE A;  1RWW B;  2EG2 A;  3THT A;  4M5D B;  1SB6 A;  4XPC A;  4J9Q A;  2XC9 A;  4P7V A;  2V8D A;  3VAJ A;  2BR0 A;  4XTT A;  1X4G A;  2EK1 A;  1K0V A;  4DR2 F;  3V6D A;  2BRL A;  4LF6 F;  1WI8 A;  3OVA A;  2DRD A;  1F2H A;  4C3M A;  3SEO A;  4ED6 A;  4ILM A;  2IC3 B;  2L9D A;  4U8V A;  5HVF A;  1FXD A;  1KVJ A;  4FF4 A;  1TKZ A;  2ZBR A;  1T9T A;  1ZPW X;  4WE1 A;  4DV2 F;  1I3O B;  3U7J A;  2CJY B;  3DHW C;  3BGF A;  1TTH B;  4P2X A;  3NCR A;  3ITH B;  5H9E K;  4HI2 A;  1RTD B;  3E51 A;  1CEZ A;  1JJH A;  1G1X A;  4JI4 F;  2IJN A;  2R7V A;  3CVK A;  3VAG A;  4OIX A;  2XMV A;  2BDP A;  2AJF E;  5T41 A;  5EHH A;  1VC0 A;  3GON A;  3ENQ A;  4PAB A;  2KKH A;  5THW A;  3Q23 A;  2EC2 A;  2XZW A;  5JUM A;  1HWK A;  1QY7 A;  3CJ3 A;  5B09 A;  1DAX A;  1TKD A;  3CC4 S;  4BC7 A;  1MN7 A;  3ZZT A;  3O8W A;  4PWW A;  3GFX A;  2MZ1 A;  3PV8 A;  2R7Q A;  2XNR A;  4DV6 F;  1IKV A;  3LGN A;  9ATC B;  1R3N A;  1J27 A;  4C0O C;  2IM2 A;  4R25 A;  1VS3 A;  1NCL A;  2DY1 A;  1UVL A;  2J0W A;  3DOM A;  5EX0 A;  3G82 A;  2IIH A;  2BXJ A;  4K0K F;  4WFN Q;  2VPY B;  1RLD A;  2DR8 A;  1LEO A;  1JXE A;  3UVJ A;  3TVZ A;  4Q2L A;  4ZPT R;  3R97 A;  5KFQ A;  3CW2 C;  4MIA A;  4ZJQ A;  1BE4 A;  2LVW A;  2V9W A;  2J9D A;  5HQL A;  1SJ4 P;  2CQD A;  3L4B C;  4LRB A;  3M6W A;  3PW4 A;  3KUH A;  2VFR A;  3MXH P;  2FVC A;  3QQC D;  5DS7 A;  2AJ1 A;  2HS3 A;  4ZP7 A;  3DI6 B;  3FK4 A;  2OTJ S;  2PSZ A;  4NCB A;  4NCG A;  5CCM A;  1MU2 B;  2DHA A;  4FXV A;  1F9F A;  2ZVS A;  1XR6 A;  5D15 A;  1HQU B;  1RWM B;  4CLK A;  3EGV A;  2Q1L A;  2HHH J;  1WKK A;  4AL7 A;  1VQ9 S;  1S59 A;  1FTR A;  4AQY J;  2VD3 A;  2AWZ A;  3OQ2 A;  3CCU S;  1FKO B;  2QFI A;  1W2B R;  3MED A;  3CUL A;  2VC1 A;  4F3O A;  2OPS B;  3UPF A;  1MMD A;  3PZP A;  7AT1 B;  2MQL A;  4RW9 A;  3SCI E;  3CB4 A;  4MKV A;  2GMH A;  4E0D A;  1BQN B;  3H5U A;  2YQ1 A;  3QGP A;  3VV2 B;  3KLG B;  4I2Q A;  1RLC L;  1KRP A;  3M4X A;  2MKC A;  2HQD A;  1CC7 A;  1UPM B;  3GPA A;  1U4B A;  4ZS6 A;  5KFK A;  1FRM A;  4C2M A;  3J7Z 5;  1J5E F;  4QJV A;  3HSJ A;  5EWE A;  1N54 B;  3HI9 A;  4BDP A;  4F36 A;  1QSL A;  5L46 A;  2FVQ A;  1TAQ A;  5J1P A;  4IFV A;  2DHG A;  1GMW A;  4M63 A;  4DJB A;  2E5G A;  4B9U A;  4DEZ A;  4NLR A;  4R8U B;  4U7C A;  5KFS A;  4ANE A;  3BO3 A;  2M8D B;  3T1H F;  5L1J A;  2GNK A;  3PHT A;  3QAT A;  5GMD A;  1RI7 A;  3JAM Y;  1M5H A;  4ZHR B;  2Y8W A;  1RIS A;  3H2L A;  5RUB A;  4X4R A;  3JTP A;  1XNQ J;  3WHI A;  4FYY B;  4LRC A;  3I55 S;  2W4C A;  1RWO B;  4J90 A;  3M9M B;  1F6T A;  2P9G A;  2HFN A;  4IRC A;  3CDE A;  4CLP A;  2HHS A;  5ETK A;  2VG5 B;  3A1Y G;  1WSR A;  1AZS B;  4DQQ A;  3VAM A;  3LUY A;  5HO4 A;  3KK2 B;  3T6B A;  2IFX A;  1RYS A;  3MUM P;  3G96 A;  2Y9H A;  1VRU A;  1MWQ A;  1GMW D;  2HVZ A;  2EWH A;  2FB0 A;  3C14 A;  5KFR A;  4JI3 F;  2JWN A;  3GP9 A;  2ZH1 A;  4P2M A;  2MMY A;  3M8Q B;  2OEM A;  3V4M A;  4P75 A;  4QQB A;  4USK A;  1SH3 A;  2YNH B;  1Q95 G;  2AYE A;  3AQP A;  3OUY B;  2XMU A;  2VAS A;  2RML A;  3TQ1 A;  1X9S A;  1WJ9 A;  2KVI A;  3AA8 A;  2FC8 A;  1NLK L;  1JXV A;  1XN9 A;  4ZPA A;  1SH2 A;  3OJU A;  8AT1 B;  3P45 B;  3C16 B;  1R27 B;  1Y7P A;  1YZ7 A;  3PAC A;  1VBY A;  2QL5 B;  4HHH A;  2QA1 A;  2XY7 A;  5D6G A;  4NLG A;  2PE8 A;  3HK2 A;  3AAW B;  1FD2 A;  5KOW A;  2CQ3 A;  4ZVP B;  2W1B A;  2VL1 A;  2LQ9 A;  3P4U B;  4Q0B A;  2F4V F;  3QAU A;  3MEK A;  3PR5 B;  3K5M A;  2ZE2 A;  3IAS 9;  3H40 A;  2HHV A;  2KZM A;  2KU7 A;  2EC0 A;  4PWD B;  3EVW A;  4B3M J;  2CQI A;  1S1V A;  2RKI A;  2RF2 B;  3TO8 A;  3O2I A;  3M8P A;  2B5J B;  4Y2C A;  2PEB A;  2GIF A;  3V2U C;  3PEH A;  1RAA B;  3US5 A;  2I38 A;  4OV1 A;  5DDQ C;  4KY3 A;  4MYU A;  2EI5 A;  1VQN S;  1X5T A;  3KLF A;  3CC2 S;  2NYI A;  1KTV A;  4RW6 B;  2LDY A;  1S6Q A;  5CYJ A;  4CYU A;  3WQP A;  1RT3 B;  3EVO A;  3H4D A;  2YKN A;  5K20 B;  1HMV B;  4EEY A;  2CJB A;  4HAC B;  2CPH A;  1B0T A;  1E6Y B;  2VG7 A;  1Z2L A;  2QO3 A;  3QNW B;  5DGB A;  3AFG A;  2DTJ A;  5KFP A;  5LMU J;  1JLA B;  3J7Y U;  2AW0 A;  1W2I A;  1LWC A;  1PC5 A;  3JS9 A;  3P6Y C;  2V50 A;  2FZK B;  2V63 A;  4ZP6 A;  6FDR A;  1AYE A;  2EFN A;  1RT5 A;  4A4J A;  4JI0 J;  4I67 A;  4NI2 B;  3CT9 A;  2UXD J;  7FD1 A;  3BR9 A;  1T9Y A;  1IVZ A;  3SV3 A;  1DTQ A;  3C6U A;  2FYX A;  4QYZ K;  3NOG A;  1CLF A;  4H4K C;  2FJV A;  3J80 U;  2MST A;  4V19 J;  1M1K T;  1C2P A;  4V19 X;  2POK A;  1GFW B;  4NZ0 A;  4FDF A;  2BKP A;  3U02 A;  4J9R A;  3IAM 9;  4RO0 A;  4YHH F;  1TL1 A;  4OYI A;  4NXN F;  1B3T A;  4DPW A;  3KOA A;  1F60 B;  4CM0 A;  1NB2 A;  2V5H G;  4Y2K A;  1EP4 A;  1QAY A;  3B4D A;  4K59 A;  5KFZ A;  2Q6C A;  2R3V A;  3AXK A;  3M30 A;  1RHQ B;  2DBB A;  1HWL A;  1YHQ S;  2BA9 A;  1RHK B;  2J0Q D;  3BO4 A;  3MFH A;  3OR2 A;  3H5Y A;  2HQ3 A;  5DDP C;  3IWN C;  5FD1 A;  4CTA B;  3PW0 A;  2MGZ B;  1YJ9 S;  2CNO B;  1SUQ A;  1T05 A;  1NKC A;  1LXJ A;  3BDE A;  3DGV A;  4EI2 A;  1HNW J;  4Q2M A;  2QMX A;  4GKJ J;  1JX4 A;  4ZP9 A;  3UD3 P;  2E66 A;  2V68 A;  2Q43 A;  3HUL A;  2W9C A;  3N5F A;  2UUB J;  5EX3 A;  2DXD A;  2ZJQ Q;  2COL A;  1Z2Z A;  5HI7 A;  2VQE J;  5ITH A;  4B9N A;  5IT9 Y;  3DOM B;  2MZS A;  4IFY B;  2CQ2 A;  1UKU A;  4DCJ B;  4TNO A;  1L3T A;  3MEG A;  3ZZZ A;  4IH6 A;  4OHY A;  1IM6 A;  5HSP A;  4YB1 P;  5LMN J;  3CCL S;  4L74 A;  2HYI B;  2JVR A;  3K89 A;  1JJ2 R;  3QIP A;  1N4L A;  1GK8 A;  3GFH A;  3HT0 A;  4USU A;  2CPE A;  2R42 A;  1FRI A;  4DFK A;  2GZO A;  3MF5 A;  1LFW A;  4Q5V A;  1SQF A;  1S97 A;  4Z37 A;  2OO4 A;  1HD0 A;  2GHW A;  5BXI A;  4C8K A;  2CPZ A;  3I4P A;  1DY3 A;  4M5K A;  2QE5 A;  2W2Q P;  3A3O B;  5J2Q B;  2W24 A;  4OJ1 A;  5KFV A;  3BYR A;  3KWM A;  2JEF A;  3F73 A;  2JLG A;  3W61 A;  2DXE A;  5KG4 A;  5I3U A;  1NRK A;  2DHS A;  1HA1 A;  3IP0 A;  4WP9 A;  2VFV A;  3HX9 A;  2V4J B;  2DVI A;  3GII A;  2GS8 A;  3NNC A;  2QG9 B;  3TUI C;  4ZKA A;  3G6V A;  1Y5L B;  4FPI A;  3M6V A;  1HR0 J;  5ETO A;  5A76 A;  1JMT A;  2M88 A;  2VH7 A;  2Y8Y A;  1RTH A;  3M2V A;  3Q8V A;  3W9I A;  5H1S V;  1VK8 A;  3J81 U;  4RW9 B;  1E6V B;  1NHK L;  2HHT A;  1X31 C;  3MPU B;  4WFY A;  1KC8 T;  1S0M A;  5KFA A;  2ZNZ A;  4NYP A;  2HS4 A;  3AY0 A;  3K8W A;  2QFJ A;  2CYY A;  4BS2 A;  3Q86 A;  1AFJ A;  3ZTQ A;  1WI6 A;  5KFB A;  1M5K C;  4C3L A;  2H5E A;  5HMX A;  4QR1 A;  3MUR P;  1RAO A;  4DSE A;  4DPU A;  2DGO A;  4ZN1 A;  3IS9 A;  1AA1 B;  1N8R T;  5DQG A;  2OPR B;  3CPW R;  1PYS B;  4GO7 X;  4ZVG A;  3R5D A;  2MLY A;  3O1L A;  2I5J B;  3BKU A;  2FHK A;  1TL4 A;  1FK9 A;  3L09 A;  4MMO A;  2B7C B;  2HPU A;  1KD1 T;  2RAQ A;  1TEL A;  4CT9 A;  4DU8 A;  4USI A;  3RBE A;  4X66 J;  4JI1 J;  1TFY A;  4DFM A;  2NXE A;  3MCO A;  3DKD A;  5B0F A;  2KB2 A;  1YJT A;  1RU1 A;  1NAQ A;  3FUY A;  4M5M A;  2KJW A;  5K14 B;  4NYO A;  2B9E A;  3ZZO A;  4NA2 A;  3L3C A;  3TA0 A;  5BJR A;  5CYM B;  4LF2 A;  2RS2 A;  2R7S A;  3BKT A;  3HFV A;  4QU6 A;  3GFZ A;  4J7C A;  2KT3 A;  3NGU A;  1S1X B;  2WK4 A;  2LU1 A;  3HVW A;  2HNY A;  3QJJ A;  2HVD A;  2QTW A;  2DNG A;  2CJX B;  3MPW A;  1HI0 P;  1PSD A;  1RBO B;  1U1O A;  1KVI A;  1ZZF A;  2F40 A;  1PJ7 A;  2MKS A;  1J5O B;  3TVK A;  4Y0F A;  1YJR A;  4FYD A;  3OVS A;  3R5C A;  4ZJL A;  1VRU B;  4QIV A;  4BWJ A;  5D3G A;  3P5T L;  3Q8P B;  1TR0 A;  5F8M A;  4DL2 A;  4USM A;  2AYM A;  4IOC Q;  2OML A;  4H4M A;  1GNK A;  3M2U A;  4GC6 A;  1N32 F;  1S77 D;  2VPX B;  1SBR A;  4MK7 A;  1YX2 A;  5F41 A;  2KT5 A;  3FZB A;  2N3O A;  3N6L A;  1XNR F;  5HMW A;  4O4G B;  1LWE B;  3M1V A;  3LP0 B;  3AOB A;  4M8L A;  3W66 A;  3VF0 B;  4KFB B;  4ECV A;  4DQI A;  3QT8 A;  2CJK A;  2VG6 B;  4J9V A;  3QO9 A;  3NMA A;  3V81 B;  3JSM B;  2M70 A;  2OEK A;  3BGR A;  3CCQ S;  5C42 B;  1ZAV A;  4H4O A;  2CIM A;  3FRY A;  2CPY A;  3L7U A;  4I2P A;  1Y5N B;  2BKN A;  2QA4 S;  1IKW A;  3TUP A;  4Y2A A;  2GMJ A;  2MKK A;  1NDL A;  5ETS A;  1XEZ A;  3MEE B;  3ZZU A;  2PFD A;  3DOK B;  2ZJR Q;  2XS7 A;  2OFH X;  1RAC B;  4YR2 A;  1PG5 B;  3CCZ A;  1S1V B;  2L41 A;  4Q44 A;  3BDP A;  3CJK B;  4K4Z A;  1V5V A;  2GGP A;  4C97 A;  2HEK A;  4TQS A;  3QMQ A;  1RAG B;  2L3M A;  3HD2 A;  2IDL A;  4X65 F;  4G6V B;  4CLL A;  2ROG A;  1RTZ A;  2V67 A;  3RBX A;  4WK1 A;  2VDH A;  3ULH A;  4RJV A;  3MM7 A;  2FLP A;  3M8Z A;  3PHE A;  1KDN A;  1NDK A;  5A8R A;  3ZZP A;  1PYO B;  4CYU B;  2DJW A;  1A9N B;  2YH1 A;  2BMB A;  1Y10 A;  5C2G A;  4LMZ A;  4E98 A;  4USJ C;  3K5O A;  2OD6 A;  2UUT A;  2WSF C;  2HRY A;  1KFD A;  2D9O A;  2A3J A;  5EGY A;  3C46 A;  2VG7 B;  1L3U A;  4B3O B;  4IRD A;  1ICE B;  1R7I A;  5ETR A;  3RAQ A;  1GXL A;  3GCX P;  5KG7 A;  1IBL J;  2GC8 A;  2B51 A;  3FC9 A;  2ZFH A;  4I0W A;  2CVE A;  2MLZ A;  1U45 A;  1UAW A;  3QT7 A;  4PXD A;  2XLK A;  1RAB B;  5KFH A;  4LFA F;  4WKY A;  4XK8 C;  3DLK B;  5M2U A;  1VRT A;  1TK0 A;  1H7W A;  3VTI A;  1VHI A;  1GT8 A;  3G9C A;  1MMN A;  3AA9 A;  3MAH A;  2AZ1 A;  4WBF A;  3HFK A;  1NSA A;  4QWB A;  1HBM A;  3BQ0 A;  4QYZ J;  4W98 A;  3UN5 A;  1NJW A;  4JI6 F;  1R0A B;  4ZVT B;  1U2R A;  1LOU A;  2D74 B;  3VGT A;  3CCR S;  5FJ4 A;  2WVF A;  1RWU A;  3ZNJ 1;  2HNZ A;  2KYX A;  1YQH A;  1TL1 B;  2R2U A;  1SL2 A;  5DM7 Q;  2BV3 A;  2AKW B;  3R2C J;  4MH8 A;  1ZH5 A;  2IMW P;  4PQA A;  1XK8 A;  4NL5 A;  1EP4 B;  3B78 A;  2IAJ A;  5FLX U;  2BJ9 A;  4WYW A;  1WDT A;  3P96 A;  2EKY A;  1VQ7 S;  4PQU A;  3M30 B;  2MZR A;  3Q89 A;  4F4K A;  1H98 A;  3IG1 A;  4O44 A;  2VFU A;  1WOO A;  2Z4P A;  2XS5 A;  1UJ5 A;  1QUP A;  1JB0 C;  1S9G A;  2GVZ A;  2E1P A;  1T05 B;  1DTT B;  3I5B A;  3OW2 R;  3VZI A;  1FJE B;  2J8S A;  4JI2 J;  4EK2 A;  4K7Q A;  4NLW A;  2MY7 A;  2HVH A;  5C25 A;  2C2E A;  3P8B B;  2MB0 B;  3GIR A;  2CQG A;  3NL0 A;  2BM1 A;  1UWB B;  4QWE A;  1RGV A;  4DI6 A;  2WAQ D;  1ZYQ A;  1HW8 A;  1IJF B;  2DNM A;  4K2X A;  5F8I A;  4KO0 A;  4ALZ A;  1VIS A;  4ICL B;  4YN3 B;  4LF9 F;  3O3L A;  1IUJ A;  5I3Q A;  1XIQ A;  4K4V A;  4J9O A;  3H25 A;  5HLF B;  2OPQ B;  2YTC A;  2PO4 A;  2IRX A;  4IH7 A;  3MPD A;  3LAL A;  4DV5 J;  4YDX A;  1KVK A;  4ECQ A;  3FGV A;  4RBU A;  1WUU A;  1HLW A;  4IUF A;  5CZV A;  5KT4 A;  3HHN B;  4K4S A;  1YSJ A;  3W64 A;  2UXC J;  4ZVO B;  3KLV A;  1TKX A;  4QBU A;  4QW8 A;  2BE7 D;  2CG4 A;  2GFF A;  2KDO A;  1DFD A;  1CJV B;  3H5X A;  3RB0 A;  3M6U A;  3OTB A;  2A2D A;  1N56 A;  3E8O A;  2X1A A;  2AJ4 A;  1R6V A;  3VQS A;  4NE9 C;  2QYC A;  4HL9 A;  5EWG A;  2J7K A;  2JLF A;  2D9P A;  2IM0 A;  2KZZ A;  2FQQ B;  4Y65 A;  1WHW A;  1IBC B;  2P9C A;  3VCD A;  2G0J A;  3RG6 A;  4DR1 F;  3GV8 B;  3NBP B;  2HMI B;  1TUG B;  2MZT A;  4TU9 A;  1RTH B;  4OLP A;  1FJC A;  1S72 S;  5HQM A;  2VKZ G;  3M2V B;  2AX1 A;  2D3U A;  5HVG A;  4B9L A;  1HBU A;  4FXD A;  3SFU A;  2E7W A;  1A0O B;  2ADC A;  3KXD A;  4N47 A;  4LSL A;  4L73 A;  3RB6 A;  2R9L A;  4LQ3 A;  4DR6 F;  2B7B B;  3T6J A;  1V3R A;  1WF2 A;  2DYA A;  2MTL A;  2K06 A;  1V3S A;  4G1P A;  5HAN A;  2CZ4 A;  5SUH A;  4FP9 A;  1OIA A;  4DR2 J;  4LF6 J;  2XS2 A;  2W4D A;  2D3O R;  2BJ8 A;  2LXU A;  3OJS A;  1Q8B A;  1EET B;  3C3L A;  5G0R B;  3SZ2 A;  5J2M B;  2R7X A;  3LQV A;  1T7P A;  2KXH A;  4KKO B;  4WJB A;  4DV2 J;  1G4C A;  3V4I A;  4WTY A;  3DRP B;  4CO1 A;  1QLN A;  5I42 A;  4DUZ J;  2H5J B;  1JLQ B;  4IO1 A;  3TAM A;  1T03 B;  4ZLL A;  1B4S A;  2HG4 A;  3T1Y F;  2P9E A;  3S8S A;  1NO8 A;  1M5S A;  4CQ1 A;  4ZVS B;  1FDA A;  3OTD A;  4F2S A;  1P9Y A;  3AT1 B;  2B0G A;  5J2P B;  1U2C A;  3FEZ A;  2YWH A;  1U02 A;  4RNF A;  3OD2 A;  4DV0 J;  4ER8 A;  2JJ4 D;  2ZKU A;  2IMO A;  1U1M A;  4IQM A;  3TJA A;  5D3G B;  1I94 F;  3IC1 A;  5GAE I;  2KVQ E;  2WCX A;  1IR2 A;  1UA1 A;  2XCA A;  2E5I A;  5J2N A;  4KGK A;  5KTQ A;  3M2U B;  5JVH Q;  4DV6 J;  1WC5 A;  4ETZ A;  2ZH4 A;  4KAI A;  3KG4 A;  4Z7C A;  4OZ3 A;  4WXO A;  1HFE L;  2VON A;  4GVB B;  3QGH A;  1HBO A;  2P6S A;  1T9U A;  1YJW S;  4Y2I A;  5B08 A;  1U1N A;  1FWL A;  1BLU A;  3M1V B;  5IXU A;  1LWX A;  3QJP A;  3BPD A;  4RBV A;  3HM9 A;  4WXW A;  4MIB A;  4GMK A;  4X64 J;  3BH7 B;  1RB0 A;  3VGS A;  4CI0 B;  1RCO B;  2ZOF A;  4I7F A;  1FF2 A;  3W5X A;  5EWF A;  4IDK A;  4PWU A;  2OKQ A;  3KLE B;  2FJX A;  2AGO A;  2MYF A;  4RKU C;  1S99 A;  5KAK A;  3JYT A;  2HBQ B;  1PGZ A;  2F4F A;  3GV7 B;  3I87 A;  2DXF A;  1RAH B;  5U47 A;  4N8O A;  2HAI A;  1NXI A;  2RU9 A;  2YKA A;  2MKI A;  1FXR A;  3D7S B;  2JEI A;  4OZ0 A;  2WVD A;  2DGU A;  2Z2L A;  5DG8 A;  2UZA A;  3U1M A;  2I1R A;  2EBE A;  1SQE A;  1GH8 A;  4I56 A;  2IJR A;  5KG1 A;  1FEE A;  4X4O A;  3OHA A;  4DSK A;  2GHV C;  1MML A;  1R8C A;  1AUS L;  5ETP A;  1SC3 B;  1D8Z A;  1FNX H;  2XWX A;  3QT6 A;  1VOM A;  1IWG A;  2HIY A;  1SXL A;  2Z0G A;  4LIR A;  4C11 A;  2XYH B;  3KLI A;  3KHR A;  3PX4 A;  4KHP F;  3OPK A;  4CM2 A;  1ZET A;  4Z2X A;  3CJR A;  3MM9 A;  3DDN A;  2CFX A;  2IRY A;  1FHT A;  3LAN A;  1J5E J;  3UD4 P;  4O3O A;  1H2T Z;  5GAD I;  2JDJ A;  2RDD A;  2ZBI A;  3LP2 A;  2HFS A;  1LNQ A;  2JEJ A;  2IBK A;  4W4M A;  4DS5 A;  1FKP B;  4DN0 A;  3MUT P;  4CLS A;  4A8Q A;  1U0H A;  3PO4 A;  2CKW A;  2DGW A;  3DGP B;  4PG4 A;  1EKS A;  3EX7 B;  1B7F A;  3EYZ A;  2YX7 A;  2LU2 A;  2BJ3 A;  4R0E A;  3NS5 A;  3CCW A;  3UWT A;  1SJ3 P;  1OY9 A;  2A1B A;  1SI9 A;  1ZAX A;  1TKT B;  1MSW D;  3M05 A;  2CWK A;  3T5J A;  2FC9 A;  3B82 A;  4EBD A;  1KS2 A;  1S57 A;  1IKY A;  3MEC B;  2W2O P;  5JJB A;  1O5J A;  3C2P A;  4CLU A;  4H4K A;  5GAG I;  3IG1 B;  4NWB A;  1Q53 A;  2ATC B;  4CO3 A;  2HFU A;  5A8K B;  3UD5 A;  2VOO A;  2J6S A;  1S9G B;  2E5L F;  2KFN A;  4OJG A;  4LVN P;  4DWI A;  3QLH A;  3C66 A;  3JXO A;  4NEY A;  3UQS A;  1ZTW A;  5LT5 A;  5C25 B;  1BMQ B;  2CQP A;  2HRT A;  2F63 A;  4Q45 A;  3ZZR A;  3AJD A;  4LUB A;  2XY5 A;  1MLA A;  2KRB A;  2PA3 A;  2AP6 A;  5I3P A;  4TYB A;  1OQ3 A;  4B9M A;  1IJE B;  1A7G E;  2XNQ A;  3FMW A;  4DQR A;  3H2V E;  2JSX A;  1WOS A;  1S1W A;  4QW9 A;  1FEH A;  1QSS A;  2HLU A;  3GIK A;  4B3T F;  3LP1 B;  4G65 A;  1Q78 A;  1OYE A;  2UXB F;  2BM0 A;  1V3Z A;  4S0M A;  1DJ0 A;  3OFE A;  1YRU A;  3D6F B;  2G1D A;  3R1L A;  4O3S A;  2W9A A;  1ITP A;  2F65 A;  2OPP A;  3FDS A;  5J1E B;  1EJ7 L;  2GW8 A;  4ECU A;  3ENV A;  5A0Y A;  1U8S A;  1NDC A;  1MRO A;  1R8A A;  4JV1 A;  4F02 A;  2ZZT A;  4E8U A;  3Q24 A;  2XZT B;  5DM6 Q;  1VGY A;  1HI8 A;  1U26 A;  3IGV A;  4X4V A;  4EMD A;  2Y3Y A;  3BH6 B;  4DG1 B;  2KM8 B;  3MR5 A;  3BSO A;  3CCS S;  2WSE C;  1U1L A;  2O01 C;  1JLC A;  1W25 A;  4JBC A;  4UY8 5;  2RQC A;  1KLM B;  3MM5 A;  1FNO A;  3J81 Y;  3OVB A;  4HYK A;  1SC6 A;  4MJK A;  2D41 A;  2ASD A;  3ETM A;  1N52 B;  3CCE S;  2VIH A;  4ZA1 A;  2NLW A;  2N7C A;  5KFD A;  5AE1 A;  4LFB J;  2IY5 B;  4MKA A;  1I1G A;  1VBK A;  3RGI A;  4KSE B;  4ZVF A;  4OYO A;  4QR0 A;  3QT5 A;  5DZ7 A;  3X1L B;  2YX1 A;  4F4X A;  3A13 A;  3CJQ A;  2HIQ A;  4UZB A;  4M5D A;  3WIV A;  1NJI T;  2ACY A;  1CS4 A;  3H59 A;  2DNH A;  1Q7L B;  4GRS A;  3I6P A;  3I32 A;  3FBE A;  4ECS A;  2V9K A;  2MQN A;  2WHO A;  2XMM A;  1HNZ J;  4C3K A;  2XGQ A;  3M7V A;  1RU2 A;  1WEY A;  3DLL Q;  3GLJ A;  4YHH J;  1AT1 B;  1RT1 B;  4OI4 A;  2IC3 A;  2C1E B;  4K8R A;  2DNZ A;  2OI2 A;  2LA6 A;  2GJF A;  4QWD A;  2APO A;  3PKY A;  2JFD A;  4YB5 A;  3CJ2 A;  3TAM B;  2N3L A;  3DLE A;  2HHQ A;  2WON B;  2UV8 A;  3ITH A;  3OXL A;  5BR8 F;  3VVT A;  3EVM A;  1P8G A;  4DX6 A;  3W9H A;  1LK5 A;  2NSB A;  3TEH B;  2P5V A;  1M1G A;  2ILY A;  3H42 A;  3KHG A;  4OHZ A;  2OJ3 A;  1SJF A;  3CCT A;  4IYQ A;  3TJ8 A;  2MQP A;  2ZH7 A;  4EFA C;  1CPZ A;  3BBF A;  4DV4 J;  1DLO B;  3RAX A;  1H7X A;  3T9Z A;  3MOZ A;  5GVQ A;  3AOC A;  2IA0 A;  5D78 A;  4CT8 A;  1KQG B;  2HND B;  1EB0 A;  4FZV A;  4IG0 B;  4MK9 A;  3KJQ B;  1CC8 A;  2LEP A;  4LF1 A;  1C1B B;  4FXW A;  1RAD B;  3PFO A;  4CDI A;  2WB4 A;  3G4S S;  2ZHO A;  2V2K A;  4DUY F;  3DRY A;  1JLG A;  2NPI A;  3PRD A;  4JI8 F;  4KGM A;  4C8O A;  3B4M A;  1UPP A;  2B9X A;  1RTI B;  1HHQ A;  1Q5Y A;  4YUD A;  4PUO A;  2B6A B;  4QCL A;  4FF2 A;  1W26 A;  3TP2 A;  2IVF B;  1SPB P;  1S4E A;  4HTI A;  3HJF A;  1F9E B;  4ZPC A;  2DR7 A;  4FVM A;  3C19 A;  4DR5 F;  4OX9 J;  5IC4 B;  3R6G B;  1S7H A;  2CQB A;  2HHU A;  4I1T A;  2Z2Z A;  3SSR A;  4QIF A;  3H4B A;  3K57 A;  1HKA A;  4CWB A;  3MMC B;  3KYL A;  2R7R A;  3PO5 A;  3R27 A;  4P7T A;  4HH0 A;  3DI6 A;  3BGL A;  3FEY B;  4LBI A;  3HF5 A;  4EO8 A;  4M95 A;  1Q8K A;  1CSJ A;  1H73 A;  5CQG A;  1EHW A;  1RE1 B;  1RT6 B;  2GAG C;  4NLS A;  2LKZ A;  2RE1 A;  2XMK A;  3Q8U A;  2H9Z A;  1HQU A;  1U1Q A;  2DGQ A;  2IYG A;  1WTF A;  3OTC A;  1K44 A;  2DPI A;  3PIO Q;  2NXU A;  1T95 A;  2DNR A;  1JXL A;  4JV0 A;  3HVA A;  3ELH A;  4JYA F;  5CD4 A;  1FKO A;  1FRK A;  4P72 A;  2DIU A;  3MCM A;  3MMA A;  3WDO A;  2HZA A;  2KJV A;  1UFK A;  3JB9 k;  5IS2 A;  1NKE A;  1G2E A;  2NXJ A;  3KLG A;  3N9U C;  1TVR B;  3KNG A;  1SKS A;  1UMJ A;  3PTW A;  5IZH A;  4FPR A;  2HHW A;  4DCO B;  3PYG A;  3F41 A;  3LH2 S;  4YP3 A;  1I6J A;  5M2R A;  3R6L B;  2GX8 A;  2HZV A;  1X8D A;  4F7V A;  1PYT A;  5F3Z A;  1G7C B;  4M94 A;  3QWU A;  2Z2M A;  5AE3 A;  3D1H A;  4R8U A;  1K8A T;  3UDV A;  3KJN B;  5C24 B;  2VBW A;  2AIR B;  4ID5 B;  1U1R A;  3R9L A;  5FLX Y;  3ZC4 A;  1QVF R;  4ZHR A;  4A47 A;  1WC3 A;  3BKF A;  2HGN A;  1CJT B;  2XYP B;  2DIT A;  2JHE A;  3AD8 C;  1XMO F;  5I4M A;  1FA0 A;  1SJQ A;  1YWX A;  5KT5 A;  3MR7 A;  1VBZ A;  1N34 F;  2UUC F;  4B9V A;  1X60 A;  3D6H B;  4Y00 A;  2QMU B;  3L95 X;  3S6E A;  3KFW X;  3UNG C;  4AFF A;  4DLG A;  3P3D A;  4KV8 B;  4NLV A;  1AZS A;  3TAP A;  4QYR A;  3MUV P;  1FDD A;  5AE2 A;  3WC2 A;  3QLH B;  3BSN A;  3KK2 A;  3ETO A;  4C8M A;  1MN9 A;  2E29 A;  3A8E A;  4NXM J;  1N32 J;  1D9D A;  3NKY A;  5CHC B;  3TAR A;  2C3U A;  2LQB A;  4X84 A;  1K0T A;  2HHH F;  3N28 A;  3DOL B;  1TK5 A; 
#chains in the Genus database with same CATH homology
 1F3V A;  1F2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...