1F3VA

Crystal structure of the complex between the n-terminal domain of tradd and the traf domain of traf2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
HEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mechanism of TRAF signaling revealed by structural and functional analyses of the TRADD-TRAF2 interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
total genus 52
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f3vA00
1F2HA 1F3VA
chains in the Genus database with same CATH superfamily
1RE1B 1S1WB 1S9EB 3K0JA 4DL2A 3I0RA 4M1KA 3QMQA 1PILA 3A3PB 3FQKA 4A8XA 1DQ9A 1DHMA 4ZIVA 2AYEA 3EM1A 4I0WA 4KHMA 2YQ1A 3KUGA 4CDIA 3LOUA 2I0XA 1SJ4P 1U45A 4GVBA 1HBNB 4CLYA 3HXMA 1UJ5A 2V4JA 2RD5C 3ENQA 3VZHA 4O3OA 4OZ0A 5A2QY 1S97A 2QA4G 4WKYA 2UVVA 3M2VB 4EZ6A 1AW0A 1K73T 2GVZA 2QIFA 1M5PC 1N32F 4J9QA 2B4VA 1DBDA 1EP4B 3RB3A 2YKNA 4JI0J 1VQ6S 3H20A 4OYIA 4H4MA 2AIRB 2X51A 3RB0A 2V2VA 3RRGA 1FDAA 2RVJA 4RW7A 1XMOF 3D5MA 4L76A 2HFNA 3DNCA 4ZJQA 1GQEA 5AJ3F 2MQ8A 1M5OC 3ENAA 4Q8EA 2V2QA 1RT1B 3IA0A 3KTQA 3SCJE 3UWTA 4LF5J 3HD1A 4GKKF 1UWBA 2NXCA 5I3UA 4IH5A 1U0SA 1SQFA 1YWXA 2W25A 4Z2XA 4X4OA 2N3LA 3OR2B 4EI2A 4ZVOB 2JNJA 4HYKA 2YKQA 5KG7A 4DV7J 2EW9A 2ZBPA 2V8GA 3AFGA 5DS7A 3DYAA 4FS1A 2CJKA 4K5SA 1TKTB 3CB4A 4PQUA 2JRSA 3UE2A 2DTJA 2PSZA 4QIWD 2E7XA 2OUGA 2BW7A 5D15A 2JC0A 2BKPA 1UETA 1M1GA 2ZC3A 1GXLA 4K2XA 2YX1A 1FNXH 3CUNA 3POTA 1YRUA 1RHKB 3OL8A 4JB8B 3PHTA 1H3DA 1R3NA 1SPBP 3JXOA 4QZVB 2GJFA 5HL7Q 3BZQA 3KDOA 4M5NA 2G0JA 2CQ2A 4K4SA 2NZ4A 1MWZA 3BH7B 4X62F 2W9CA 4QYRA 4WBFA 1J5EF 4K4VA 1MWQA 3OPKA 2YNGB 4RUHA 2K2PA 5F9LA 3KG4A 2DPIA 3HD2A 3LUYA 4NZ6A 3C46A 1S6OA 3CCQS 2LA6A 3D7SB 4AUKA 1VHIA 1U2CA 2R2UA 4LFBJ 2E5LF 1NHKL 2BBEA 3TUIC 4LFAF 1C1CA 2I38A 2MY8A 3G2XA 3KUHA 4LVNP 2XTJP 4X66J 4C8ZA 1KS2A 2KJWA 3BKTA 1NBEB 5BR8J 4JV5J 2DRAA 1OYEA 2OKQA 3R7BB 4IKAA 4IO1A 5LMUJ 4ILLA 1N48A 2CQDA 3T9NA 3D68A 2IPOB 4JI0F 1TL1A 1U6BA 1RTHB 3CC2S 1B0PA 3N0VA 3D1QA 3HKZD 3SCIE 1X9WA 1EB0A 5A6WA 4ZKAA 3SIPB 4NXMJ 1RT6B 2FZGB 2UVUA 4MKYA 1H98A 3FEZA 3DXBA 1MNEA 3QAEA 4ECZA 4LF7F 3VVUA 1X4HA 1Z4UA 3WX4A 4TVAB 2LCWA 1HWJA 3BN7A 4EGLA 2FHJD 2GX8A 1JLBB 3O6QA 1EARA 2R8HA 2DGSA 5KG0A 2B9XA 3MECB 2CPHA 3TJ8A 3FQLA 3HULA 2HYIB 2XS5A 4EBCA 4IG0A 4DV5F 4PWDB 5GMKa 2MQOA 5D3GB 4QW8A 2K1RA 1GMVA 2WTFA 3CMQA 4FF4A 4WZQA 2I5JB 2LXUA 2DJWA 4MK9A 1PJ7A 1Q7LB 2XYPB 2RU3A 3CEDA 2FY8A 1S5ZA 3KK2B 4K4XA 2R4FA 1H7WA 3ILLA 1UKUA 2YKMB 3MD1A 4UOHA 1X5TA 2YWKA 2RHQB 3KJVA 2D9PA 5B09A 3ZNJ1 3T9ZA 4DSLA 3R5DA 2BJ8A 3R6GB 3DOKB 5B0CA 5L39A 1HWLA 1P27B 3M8QB 3S8SA 3QRQA 2V0NA 2CPIA 4ILMA 1DAXA 2F5GA 5IWAJ 2GVDA 2RQKA 2XC9A 3HHNB 3C3LA 1FRLA 3KK3A 2V67A 4JI3F 3A8IA 5KAKA 1WTFA 2RAQA 5DJBA 1QTNB 4J5OA 4WP8A 2Z0GA 1UPMB 3GJSB 5GMDA 2MY7A 4B17A 1ZTTA 1VIOA 4UY8T 1AFIA 3ISZA 4ED7A 4CIOA 1KLMA 2N4CA 3CCTA 1JWWA 1F9FA 4IYQA 2DH8A 4C6AA 3LTOA 4B3OB 1RTIB 2UXBF 4RWXA 1FJ7A 1C0UA 1QE1A 1RT5B 2CPXA 2CWXA 1NHUA 1OPZA 4DUYF 2DY1A 3JYTA 4DWIA 1RT2A 2DIVA 3VV2B 4BDPA 1XNRJ 4NYZA 3GCWP 4F50A 3FJ2A 3PTWA 1ZA1B 3T5LA 3ZZYA 1S0OA 2B4PA 3NMAA 3KHGA 4OL8A 4KO0A 3IGVA 2CNNB 2RDIA 2YVSA 3BV8A 4G1IA 1DJ0A 3RTVA 1PAEX 4DR4F 3OVSA 1WUUA 4LF4F 5HSPA 2JJ4D 3H0PA 3M8SA 2J5AA 4RNMA 2CJXB 1FKPB 1YDLA 1DQAA 5D4NA 1C0TA 1IKVA 4LUBA 1S0NA 1GXUA 1KHVA 3AJ1A 3FC9A 3MZIA 4LBPA 4DL4A 1AFJA 2XCPA 1V9OA 1EHWA 2BQUA 4WZMA 2GVZB 1RA7A 1U8SA 3CD5A 1VYAA 1LWCB 3CJ2A 3ISNC 4JI4J 1RT7B 5KFYA 2UUBJ 1SVDA 3M6UA 4IFYB 2BR0A 1NJYA 1D9FA 1WC0A 3NEKA 4QBUA 4P2XA 5DG8A 1HQ2A 3DRXA 4DR6J 1R8HA 5C7PA 4X65J 2MKCA 3CCSS 2ZVSA 2OPQB 2IJFA 1S0MA 2LDYA 1HNZJ 3QIPB 1YX2A 3TAPA 3DGVA 4IRDA 3PKYA 2C2KB 1T9TA 4LIRA 4OJ1A 1N52B 2R7UA 2OSQA 4KHPF 3UN5A 2ZBIA 3BGLA 4PR6A 4ED4A 1B0VA 1UFWA 1VISA 4U67Q 2VQFF 1TL5A 2GCFA 2MLXA 2C2OB 5GAHU 2PFFB 2DNRA 4DR5F 2E29A 2HMIA 2CVEA 2YH1A 2HNZB 4NCGB 2GMJA 2IC3B 4O3QA 4K4YA 1BQXA 3DRPB 1N36J 1LWCA 4WYWA 4E98A 4QIFA 1S1UA 4JI6F 1QSSA 3K57A 3L7OA 4ZJLA 5U47A 5LXRA 4KY3A 4QYZK 1MG7A 4J9RA 5K14A 5KFAA 4NXNF 2QFIA 1KBRA 1L3SA 4W92B 2BANA 2DB1A 1QDUB 2R2SA 4LFCF 4BLGA 3JTPA 2KYZA 1KLNA 2B6AA 1WSRA 4B3SF 3GIRA 5DRKA 3RR8A 1UJ6A 2I5JA 4DX5A 1TK0A 3B82A 3BQ1A 4G3IA 1X5OA 2LVWA 1HI1A 2UUWA 2EK1A 2CPDA 3E8OA 5HQ8A 3BKUA 5DLFA 5HLFB 1CVJA 4M5MA 3C16B 4O4RA 4WU3A 3FK4A 3OTCA 5BYRA 2YKMA 3ZTSA 2MLZA 3J80Y 1D09B 2H1YA 3ZZPA 4DPXA 2QYCA 4DR3F 3H2UB 2CQGA 4DV3F 1ICEB 2ABYA 5KFZA 1FRXA 2HHHF 3GFZA 3QT7A 3MCSA 2Y1LB 3W2WB 4KGVB 3KXDA 1S1TA 4LSLB 2HGNA 3PW5A 2NS1B 3D54A 4MKAA 4KFBB 2ZBQA 4PG4A 2PMHA 4P75A 3L95X 3ZZOA 4UY85 4Q2LA 2IYIA 1PGZA 4K5RA 3EZOA 2HFUA 1IBLJ 1IKXB 1WJ9A 3RBZA 3K5MA 3CJ4A 2ROPA 2VV5A 4X64J 2A2DA 2XHCA 3ILOA 4OHWA 3K5NA 5CXTA 4DQSA 5C5JA 1N34J 4QR2A 4WCEQ 1FEEA 1OQ6A 3W62A 3W9HA 4FBTA 1WG1A 2E1AA 2PD1A 3DU5A 3IAM9 3MPYA 4EFAC 2P6SA 4DCJB 2D9OA 3KLIA 3JSYA 3M2UA 4P7VA 1D1UA 1PJ6A 3NBPA 4KKOA 2KM8B 1FWLA 4USVA 3AAWB 3DOLA 2HHQA 5EN1A 2FZCB 2B8QA 2K1RB 4MIWA 1DQ8A 4I64A 4NL5A 1FWPA 2AJ1A 4NLOA 4NPOA 2J6TA 1ULRA 3ENWA 1JLAA 3G8SA 4LR7A 1TVRB 2B51A 2E44A 2XWXA 1RTJA 1RAGB 4Q44A 4TN2A 3KLHB 4I2PB 1T3NA 4HDHA 1YJWS 1VQLS 1FTRA 1KP6A 4FPRA 5CZXA 4KYZA 3HSDA 1W2BR 4DV6J 3V6DA 2X1FA 1YSJA 5DO2A 3BBCA 1HIYA 2UUAJ 5CCMA 3EPIA 3KFWX 4DV0J 2UXCJ 5KFVA 3RBDA 4Y6IA 3V5RA 3FUYA 1NSKL 2EFGA 2IIHA 2OPPA 3DLGB 5IC6B 2N3OA 4X4VA 2K06A 2HQFA 3NBPB 1TL3B 3US5A 3TX8A 4JV1A 3GV7B 3JQMA 4FNHA 4ECTA 2NPIA 1MROB 3NS5A 2VA3A 2FVPA 3L4BC 2FTRA 1HFEL 2GV1A 1NSQA 1X9MA 3LO3A 2QC3A 2C2MB 2VB6A 2MEWA 3NXZA 4ITSA 2QT7A 5E33A 4BCAA 3KLHA 2JVRA 5K8PA 1RDRA 4Q5VA 2BKNA 1N6QA 4LMZA 1HL6A 2CIMA 2F40A 3OTOF 5J1NA 2V63A 1CULB 2LKZA 3IBWA 1VQOS 2Y0BB 5CZVA 3F0NA 2YWWA 3MFHA 2F4FA 2YNHB 3AOAA 4H54A 1RWUA 4NA2A 4Q2MA 2V4RA 3VAGA 2HURA 4KO0B 5D0RA 4RZRA 3TANA 3DLBA 1KQFB 4ANDA 1FESA 1VQNS 2ZZTA 2EWHA 2M9KA 2CPZA 3EXCX 1BWEA 3SMZA 4PXEA 2OEJA 1N5QA 4HI1A 1Q8BA 3PYEA 5DZ6A 1CG2A 1JJ4A 3GYXB 3DOMB 2XGPA 1ZPVA 4QWBA 2UUCF 1W26A 4I2QB 3S1TA 1SC1B 1U24A 2HQ3A 5HQLA 3LGNA 3PRVA 4OX7A 5H9EJ 4DR1F 1KEKA 3RJMB 4CO5A 7AT1B 3V6HA 1IKYA 2I6WA 2QN6B 1S76D 3R9LA 1RYRA 3FSIA 2ADBA 3C14A 5IM0B 2HW3A 2RF2A 4C0BA 1U25A 2XULA 2G13A 3GSDA 3IP0A 3L09A 5IT4A 5IV4A 3Q24A 1V3SA 1CLFA 4RKUC 3D4JA 1PBAA 1SJ1A 3J81U 4ED0A 4X4QA 4B9SA 4HH1A 4TU9A 2LQBA 2V9KA 4DG1B 1URNA 4HTIA 2W01A 4HDGA 2XMVA 3L7PA 2QO3A 5M2RA 1WG4A 2LEAA 2KU7A 3DM2A 4YS2A 2FD2A 2AYBA 2FVRA 1BE4A 1JLCA 3CDWA 1S77D 1T9WA 2XGQA 2W8LA 1S4FA 2F9JA 4Z7YA 1WHWA 5L38A 2DITA 2HNZA 2HK3A 4FYDA 3C6TA 3NKYA 2BOPA 4USHA 4RNHA 3SQGA 1S1UB 4R8UB 5KFMA 1NHVA 1SL2A 1U26A 4UF4A 1HBOA 5FLXY 2FUG9 1RACB 4IG3B 5T14A 3QT6A 3PR4A 4KR0B 4L72B 2P9CA 2ZC4A 3BKFA 4MT1A 2C3MA 3M9MB 2A6MA 1OY8A 5FLXU 3OBIA 1CC7A 1X5PA 1NZAA 1HQUB 2GFFA 3ITHA 3OD2A 2JEJA 1UVLA 3ZNUA 4HHJA 4A8MP 3R5GA 2E9ZA 3V81B 3PO4A 1XBWA 3GP9A 3MTJA 2DNKA 3T1HJ 1YTYA 4UUXA 4P9SA 3MCNA 1B3TA 1N32J 4L73A 1R89A 3H5XA 2RRBA 1H73A 2AT1B 3PW0A 1ZZFA 1HNZF 5AXNA 4Y2AA 1SV5A 2CA9A 3MM5A 4CO1A 3WC2A 1KN6A 1OO0B 1X31C 1GMWD 1HKAA 4QJVA 1SB6A 2VBZA 3N01A 3BYPA 1TV6B 1H74A 1SJQA 4B9VA 4KPYA 3M8PA 1RTDB 1NSPA 2RB7A 1EZZB 2MQMA 3UN3A 5CD4A 1TKTA 3HF5A 5KG6A 3H5YA 1XEZA 3PXGa 4ZLJA 2VOOA 2J0WA 3DN9A 3PFEA 1KTVA 4CTAB 2IA6A 3IRXA 3VAHA 4YB1P 5KFLA 3TZYA 4LF9F 1CSJA 1R0CB 4Q8FA 3D67A 1K44A 1NMEB 4FVCA 5IOLA 3Q8RB 1UVMA 3O2IA 3DRRB 4YR3A 1JKHA 2ZH5A 2QMWA 4DFMA 3WHIA 2NLWA 4Z7CA 4FNIA 4F67A 3BQ2A 3Q83A 4LQ3A 4WE1A 4LF4J 3HFKA 4RBVA 1NK5A 3GG0A 4W98A 1UEUA 1F1BB 4WFBQ 1C2PA 2PEHA 3TA0A 1NAQA 4IH6A 2J9EA 1RU2A 1B7YB 1TL7B 3N79A 1UP1A 3R5JB 5J1EA 1UW4A 3TZZA 3NWGA 2XMWA 4PG8A 2OAUA 3THTA 4I6YA 3EGWB 1PJ5A 3W3SA 3FFIA 2ILYA 1VBXA 4RUBA 4UQGA 4OI6A 1VQYA 1S79A 4I2QA 1AUSL 2FJEB 2HHTA 2Q6BA 2FHOB 2R8KA 2UV8G 1BXNA 4PRFA 1B64A 1RISA 2B7BB 4WE1B 3C14B 2BEFA 5IC4B 2DH9A 2ATCB 1W25A 5LJ3Y 3VAJA 3IN5A 4ATNA 3QGPA 2EFVA 4ELVA 1VK8A 4K59A 4ZLPA 3VAIA 2DHGA 2M3DA 3OR1B 5D0HA 4ZCKA 4DZDA 1T05B 4OHZA 3B4MA 4PWDA 2DGVA 3UCGA 4DL7A 3MEDB 3CGIA 1I5OB 2R8GA 1NKBA 2G0IA 3TQ1A 2NYIA 3OFGA 4LQ9A 4LRAA 4LR8A 5KG1A 3Q23A 2E9TA 3D0GE 4NMLA 2D3ZA 3ZZ0A 1NPRA 1OS5A 1IBKF 5B0DA 1WEYA 1P9QC 5K8MA 2MQPA 4N41A 5ETVA 4DBQA 9RUBA 2VONA 4CLKA 1R8BA 1V3ZA 3KOAA 4GKJF 3DRPA 4NZ7A 1A7GE 2L9WA 2VFUA 2GVDB 3MM7A 2XYHB 3LP1B 1IVZA 5A76A 2DXFA 1J5OA 3FBBA 2LLZA 5ADZA 4YY3J 2OD6A 2BA9A 2VC0A 2WVCA 3DLHA 4I4BA 1HQEB 2AJ4A 3DHXA 3I0SA 4KE5A 3GWCA 5F41A 2AX1A 5KFRA 2R7SA 3BF4A 2HVHA 2MQLA 3DI6B 1MU2B 4WWSA 2RDDA 1IBKJ 4HVZA 1C0UB 1QE1B 1RT5A 1HNIA 1SUQB 4LSZB 3THPA 4H4OB 5EDWA 4DR2J 2NREA 1WC1A 4PWUA 4C3MA 5HMWA 4ECXA 3V4IB 4OX9J 1T02A 2GO9A 4KB7A 1RYSA 2VASA 3ZTQA 4YR2A 3I82A 1E6VB 2WSCC 4GRSA 1IBMJ 1WOSA 3P96A 2VBXA 3PCOB 4U9RA 5CH7B 8RUCA 4MFBA 1VDHA 4N8NA 1RWKB 2BJ1A 4X62J 1J5EJ 4O3RA 3MOJB 2VG7B 5A0YA 2ERRA 3M2RB 1NK7A 1JLEA 4P6QA 4Q0BB 3GFYA 3FBEA 4WIQA 3RRKA 2PI4A 2XB2D 2DR7A 5FD1A 3AD9C 2L9DA 2D3UA 2B43A 2GHVC 3D3BJ 3PDNA 1HNWF 4WP3A 2QV6A 2ZKTA 3FEXB 4TNOA 2QGFB 2HS3A 1KD1T 2LQ9A 1N36F 1FERA 1GK8A 2DGTA 2PT0A 2FVCA 4FBUA 2RKIA 4M5DA 2ZH6A 4ZP9A 1UTAA 4M5JA 4YEAA 3HSGA 3UCZP 2IRUA 2DR9A 2QX0A 1WHXA 5KFQA 1SXLA 1QAYA 1WHYA 1R8AA 4ZK7M 1KKHA 2AD9A 3CD6S 2DEJA 2Q3PA 2CJQA 2VBWA 2ZBCA 1WG5A 3MXHP 4PQUB 3BBFA 3JSRA 1S1WA 1S9EA 3NGSA 4RJVA 1K8AT 1SH2A 2CAJA 4DN0A 1P1TA 2NR0A 3QJJA 4OYWA 3BO2A 4L6V3 1NDPA 3Q2SC 4HTJA 2J7UA 3B8HA 2HEKA 4EYIB 2RS8A 1JLGB 1LFWA 3BYRA 1NDKA 2OSRA 2IVYA 1NZ8A 4CO4A 2RS2A 3BR8A 1GTHA 1VRUB 1WC3A 2UUBF 2HBQB 1RWXB 3CCRS 2GQCA 1UZHA 2NXJA 4JI4F 1FRIA 3GFXA 2AJ2A 1JB0C 2XZTB 3WDOA 3T1YJ 4IOAQ 2RHSB 2YKPA 4Y2MA 1AXQA 2XMJA 4M63A 2HHXA 4CTAA 4Y3CA 4YUDA 4C2MA 3QJPA 2RKIB 2AJ0A 2IVMA 3VWSA 3EX7B 3BJYA 3RW7A 2IM3A 1XMQF 4PCQA 4E2FB 3UO0A 4YB7A 2NQPA 4RW6A 3H98A 1MROA 3HI9A 2BZ2A 4RW9B 4Y34A 2CYYA 2AEFA 5LMNJ 3TQEA 2L41A 2JVOA 3EYZA 4AQYF 3RB6A 1REGX 3MEDA 1R31A 3H59A 4ZPVR 3KLFB 5CYQB 3D66A 4DR4J 4U8YA 4GVLA 1UPPA 5I3UB 1FJGF 3S7RA 1VC5A 2F8EX 2H4YB 2XMUA 4RR5A 3LGMA 5HMYA 1CEZA 2J0QD 2EC2A 2BM1A 4N7TA 1L3TA 1MMLA 1ZAWA 4F7VA 4WJBA 2ZM6J 3Q8QB 1JLBA 5THWA 3MURP 1F0XA 2A18A 1R6YA 3OFHA 5HBMB 4M94A 3E2EA 2AJQA 2FJAB 2VHGA 3F41A 1VC6A 4N47A 4RW6B 4OYPA 2KFYA 2HNYB 4O44B 2VA2A 1VBYA 5D3GA 1GX5A 1PG5B 1OSCA 3KJNB 5A8WA 2CQ0A 2DPJA 3OL7A 4ECQA 2H9ZA 2HZCA 2Z57B 4ID8A 4C4WA 2KB2A 3IO1A 2HS4A 1SQGA 4USJC 2MKIA 4OI2A 1KWMA 2COLA 2Z4PA 1IUJA 4F4XA 4P74A 2XWYA 4CH0S 1U1KA 2HVZA 1IXKA 1DY3A 2DISA 3LPYA 5KFEA 2WK4A 4DV7F 2WHOA 3HCXA 4A4JA 4J90A 1IWGA 4IUFA 2M7SA 2QG9B 5C2CA 4CQ1A 2HBZB 1JNRB 4OX9F 3I9ZA 4RPFA 2V69A 4I2PA 4NLQA 5L1LA 3HJVA 1MW7A 2EKYA 4JI1F 1JLCB 4UZBA 4JUZA 1C1BB 3QATA 3CULA 1WI6A 4LF2A 3RAXA 4DFPA 2VPWB 5J2MA 1U49A 3SQOP 4IOBA 3WIUA 3U1MA 1X4CA 3T3FA 3CIMA 3K2YA 3UFCX 4QIVA 4M5IA 2NSCA 3G4SS 1IKWA 2HVEA 3SV4A 4YY3F 2OIHA 2YNIB 4BWJA 1TKZA 4U7CA 2HBYB 4D3HA 2BQRA 5F8LA 3T1HF 3DGPA 3WIVA 2M2BA 2DNMA 1QSLA 2IAJB 1GTEA 1JLQB 4F3QA 5C42B 4X4SA 3I5CA 2WB1D 5ETSA 5LMUF 4P10A 2RU9A 1AA1B 1Z2LA 1KOHA 3HZEA 3KK1B 3BR9A 4KFBA 2XS2A 1CQNA 3CCUS 4LFAJ 4DQIA 4XDDA 1WHVA 2L9NA 4UUWA 5KFPA 2YX4A 4QU7A 2BRKA 3HHLC 4LFBF 2JFDA 4WTYA 5EX3A 3ZXWA 4O3SA 5MLCV 1FXDA 2JLEA 4WFZA 1K9MT 1QAJA 2M4MA 2QFJA 3CJ5A 2KT3A 1ELOA 1OY6A 4I6AA 2R7QA 4LVOP 5ETPA 5FDLB 1HYSB 4HHHA 3M2VA 1IQTA 1YQHA 3ADAC 3TEHB 5DZ7A 2VPZB 3C6UA 3NNAA 2R8IA 3KNAA 3A12A 4L75A 2HRUA 5J2NB 2NUHA 3MM9B 3UI3A 1VQSA 1SJRA 1GEHA 2XO6A 2KRRA 2F63A 1R43A 1RT4A 1Q7YT 5DQGA 1P8GA 2C22A 2DD8S 2MQNA 5IQQA 4YDDB 2K7KA 3EPGA 5DDOC 1VHFA 3LAKA 4WIIA 2CZVC 3GJTB 2HBRB 4Q43A 1QTMA 3CJ3A 4FKYA 1RT1A 3OFEA 5B0GA 2OEMA 4EUVA 2HQIA 1DLOA 4DSEA 3PKMA 2XY6A 5A8RA 1FO1A 1LXJA 3TO8A 4NCGA 4RNNA 3G8TA 3R8YA 2AQ4A 2HZVA 2OTLS 3QRRA 3HMJG 3NY0A 5T7LB 4NA3A 3R5AA 2G2ZA 1IR1A 2ZHAA 1S72S 2PMWA 4HKQA 5IT9U 1XMOJ 1MSWD 2K8GA 3DM2B 4OQJA 4MIBA 2MZ1A 4W4MA 1FJEB 2A1BA 1UAWA 1M0SA 4RX6A 3EVMA 4U7UD 1XN9A 3G6VA 3ZTOA 1FF2A 4ZHRB 4C8LA 4NASA 1N6QB 3FDSA 1PCAA 3D2WA 3GJRB 2XHWA 4OZ2A 2DNQA 2FY1A 2OJ3A 4IFYA 2MZRA 4ZPBA 5KFNA 4ED2A 1DLOB 2W24A 1J2VA 1PYSB 3NGDA 3RB4A 3HVTB 3MEEA 1H72C 1I3OB 2Z8QA 4O4GA 5EHHA 5I3QA 2FLLA 4QU6A 3PRBA 2MDAA 2NPFA 2LXFA 1JJHA 2MPUA 2YWGA 1VJQA 1YZ7A 2IM1A 2FZKB 5LSLA 5M2PA 4HT7A 4DMZA 1UCNA 4CLFA 3I9V9 4K2JA 1ZBTA 2E5HA 1W7WA 2GQ2A 2BVZA 1Y11A 4G1PA 3N28A 3QYYA 4MMOA 3VGTA 2DRDA 2MKJA 3ZFVA 1S48A 3C15A 2DVIA 1UVIA 1TL1B 4K0KF 2KXNB 2SXLA 4IDKB 4B3TF 1L3KA 1HR0F 3U1LA 2IMWP 4UQTA 1LWEA 3DMJA 5GAGU 2IJNA 1LNQA 1RJJA 4TU8A 1REVB 3PVXA 4NWBA 4ZCIA 5IXUA 1ZETA 3QWUA 3NCQA 4DV4F 3MUMP 2MKHA 5GADU 2WOMB 2UVWA 3GJQB 3TZWA 1N5YA 1PYTA 2ZWPA 3MM6B 3G6XA 1WACA 2HNYA 2MJUA 2Y3YA 2BANB 3M1VA 3R97A 5C42A 5KG2A 3G6ES 3Q0AA 4O3PA 4QYZJ 2HAFA 2AKWB 4USIA 4OI0A 1WC6A 3JSMA 2PE8A 3T5JA 3D1OA 3GV5B 2CFXA 2ZUGA 1CJVA 4F4WA 4EWTA 1HQEA 3QZ8A 2CNLB 2RDJA 2FJWA 3SCKE 3PFOA 1CJUA 1U09A 3C15B 2FIUA 1WF1A 1N0UA 2PC6A 4ZVSB 5HMZA 1YJVA 3CD0A 3OQ2A 4PPDA 3CCMS 4ZDNA 2J76E 3K5PA 3KJVB 3VZIA 2B5JB 4JI2F 1B70B 4ZVTB 2XY7A 2C2EA 1N88A 4I68A 1JLFB 1IBCB 4J9UE 3JAMU 1PC4A 3QGGA 1DZ5A 3D0HE 2VFSA 1S7HA 4URGA 1S1XA 2HFVA 5BXIA 1OIAA 1LW0A 4OYMA 2Z2MA 4DL5A 1VGYA 1G2EA 1VR6A 3JAMY 3LP2B 4ICLA 4JYAJ 4PPZA 1KVKA 2GA7A 3O44A 3W9JA 5KFUA 5A2QU 2VC1A 3GU0A 4PKDB 3BDEA 5JXSA 2BE7D 3PACA 4ZJOA 3TAMA 3QRPA 4MKVA 2HZAA 5AXLA 1M5SA 3KLIB 4DEZA 1NB2A 3DLKB 1YGYA 2RUGA 2QZ8A 4C3KA 1TMJA 3OHAA 2BE2A 1YHQS 1NKEA 3SFUA 1PBUA 4J7CA 3QQCD 3OFFA 2C2RA 4O3NA 4F4KA 4JYAF 5L9XA 1FHTA 5CYMA 1VBKA 2C3OA 4XDCA 4OHYA 5H9EK 2OLWA 1CC8A 1C1CB 3DRSA 1XTZA 3J7YU 3KK1A 1RB0A 4OJGA 4ZS6A 5HMXA 4N77A 1KQGB 3GMGA 2DO4A 2LP4A 1HLWA 2VKZG 3ZTRA 4JI2J 4LFCJ 3QAUA 4A48A 3J7Z5 1BWVA 3KLEA 5F8JA 1FEHA 1LW2B 2NXNA 3EICA 3OTOJ 3GILA 1N33F 3TW0A 1LWFB 4G6VB 4DSJA 4OYOA 1NH8A 2CDQA 4KV8B 4NLGA 1Q1KA 2CZ9A 3ZZRA 4BC7A 1LXNA 1ZPWX 2VG6A 3SDEB 2ZH9A 1YJ9S 3TAQA 2M8DB 2OELA 3B54A 4PYDA 2UP1A 1FFSB 5C24B 5CYMB 2LECA 4C7QA 4C8YA 1NNDA 2L08A 2YQ0A 2W4PA 2ACMA 2WVBA 2EBEA 5HROA 2UXCF 4C0OC 3N9UC 3HSZA 2YX7A 1RAIB 1BUXA 1CULA 2W4CA 3I6PA 1WF0A 4P52A 1Y7PA 3W5YA 3KWMA 1HI8A 3BO3A 1HNXF 3GYNA 4M5GA 4F3OA 1P6TA 4YR0A 3R1HA 4IDKA 2KDOA 1SUQA 1FK9B 3PYDA 2M70A 1ITPA 3V6KA 4DUZJ 3W5XA 2HK2A 2BOAA 2MSTA 3G82A 3K8WA 2PA3A 2DNLA 3MOZA 1OYDA 3QNWB 3QO9B 1NLKL 1LOUA 2VFTA 3SYZA 5KFFA 4NRUA 2W1BA 3BREA 2XG8A 1RBLA 4CLZA 4LBIA 5A8KA 4RUCA 1DTTB 4ALZA 2O1PA 3GR0A 4L74A 2RQCA 2MXYA 2AGPA 2DGXA 6FDRA 1RT6A 1JQGA 3E3XA 1Q81T 4Y2KA 4DQQA 1Y5NB 1ZYQA 3TUJC 3BS9A 3GV8B 4LF7J 5MAOA 1MMNA 3GFHA 1ZH5A 1S1VA 5F8IA 5D0GA 2GJ2A 3KHRA 4ECUA 5IS2A 3JYTB 2ROEA 2FQQB 2ZOGA 2CKWA 3HP6A 4CWBA 2B5JA 2VICA 1WWHA 1YG0A 3KG0A 3MEGB 4I56A 1FRMA 3NNCA 3RR7A 4B08A 4JV5F 3SZ2A 3MM8A 1YJ7A 4DI6A 4QIEA 4M5LA 3TJ9A 3WC0A 4X66F 3Q8YA 3LALA 2VODA 4WP9A 1HA1A 1VQ5S 3QLHA 2PMZD 1JLGA 1TL4A 3BEGB 1SL1A 1FDBA 4HI2A 3H8YA 4R5PA 2D74B 3NCRA 5F3ZA 2QA4S 3MUVP 3M8QA 3VAKA 3R3TA 3MWBA 2HRYA 4ZOSA 3EVWA 1RT7A 3UDCA 4TYAA 1XERA 3UD3P 3U1NA 1GXTA 3NMRA 1X0PA 2J9DA 3J7ZT 1WEZA 1N54B 3CW2C 3DOKA 4ZVFA 4AFFA 2ZKUA 1VLYA 5F8HA 2KYXA 4UOGA 4J9PA 4ED3A 4P73A 5HP1A 2UXDJ 2KZZA 5H9FK 4B3MF 3LQVA 5I4MA 4DR5J 2DNZA 2GIQA 2KVQE 3MM5B 5ETMA 1HBNA 1TFWA 4HEA9 5KFGA 4FXWA 4ETZA 1KSPA 2VL1A 1FDDA 3HPOA 1SC3B 2XNQA 4DPWA 3HT0A 3GIMA 4DS4A 2HAIA 3MGJA 5CYJA 3MF5A 1KVJA 1H38A 3GCXP 3IWLA 3QGIA 1ZAVA 2DYAA 4FVMA 4DV1J 4RNFA 1Y4ZB 2H48B 2ZJQQ 2DXDA 1SIWB 1QVFR 2QL9B 1ROFA 3PW4A 1HWUA 1NCLA 2GC8A 1T05A 2H4WB 1PKUA 2J0SD 3NAIA 4QWDA 1JXLA 4RU9A 5AXMA 2IY5B 1A0OB 5B0AA 3TAMB 1QAIA 4OFZA 2ZH8A 4X4NA 1PAUB 2UUTA 4A46A 2CWKA 2VOPA 2E7WA 2ZE2A 2ZHOA 3NGUA 3AOBA 4ZP6A 3HHLA 5CHCB 4K50A 2ZH4A 3DDIA 4CO2A 5AE2A 2DHSA 4NLYA 2EFPA 3KUEA 1K47A 2V9WA 1WI8A 2FHKA 5J1EB 3FEYB 4O0IA 5E5NA 5KFDA 2ATLA 3GR1A 1YI2S 2BM0A 4V1Ak 4DPUA 4YP3A 4OMFG 4MJKA 2DRBA 1X0FA 3FSXA 4KGZB 1OMSA 4I6WA 2HHUA 1S1TB 4LSLA 1KHWA 1FFGB 4ZVEA 1VRTA 2DGUA 5IFMA 1NK6A 2ZH2A 2I1RA 5E0OA 1GFWB 3C2PA 2C3UA 3POTB 3LWMA 3R2CJ 1Y00A 3D6TB 2F4VJ 1HBUB 4BC9A 1X5SA 2X1BA 3AA8A 1UEKA 2CQBA 1I6JA 3MR5A 1UA0A 4KC5A 3HHDA 2O66A 3A8EA 3QIPA 3HFVA 4JP8A 3NL0A 4QWCA 2JH3A 3OXLA 4ANEA 1UW9A 3G71S 3T1AA 2IHR1 4TYBA 1T8EA 3M32B 3LH2S 3MCMA 2RF2B 2YY3A 2AHOB 3SV3A 1NO8A 2GGPB 3Q8UA 4JI3J 3RUBL 2MGZB 4P72A 2XEXA 1SKRA 5KFIA 4V19J 3BGUA 4U7UK 2H65B 2HGLA 4YDXA 2MSSA 1U1QA 2ASDA 3NWRA 4QPTA 1TUWA 5GMEA 4NCAA 2FJDB 4KPCA 3X3UA 4DLEA 4R0EA 4GVBB 4NMXA 2A2CA 5ETOA 5HQMA 2QJ3A 3CJKA 1WC4A 2XQCA 3H5SA 4XAKA 5D78A 2B6AB 3CIZA 4OZ3A 4R5PB 2DCUB 2DKOB 2RH3A 2YPYA 2DCLA 4DF8A 3PY8A 3EGVA 2DO0A 4C97A 5C2GA 1KONA 4DV5J 1UFLA 1NJIT 2KHDA 4HT5A 5ETLA 1URRA 1X60A 2HFZA 5E3QA 2F3JA 4RNOA 2PIIA 1QAXA 1ZAXA 4FDFA 3FCHA 3UQSA 5LMNF 4MK7A 2VKRA 4ECSA 5J2NA 1X4BA 1RBOB 2QSWA 2IM2A 3Q8PB 3O5TB 4NX9A 1IJFB 2KJVA 4ZIWA 5FIIA 2XBPA 3V81A 4HACA 4OYXA 2FLPA 1TU0B 2DNGA 2C42A 3GQCA 1U0HA 1CJVB 4K4TA 3CDAA 1R8PA 3MR7A 1BMQB 3CJKB 1M90T 2BACA 3VVTA 3G86A 1Z1ZA 4KBIA 1HWIA 2NYHA 1RWOB 2RUSA 3BM7A 3MD3A 4OV1A 5FJ4A 1TK5A 1WKJA 1F9HA 1CQMA 2F1FA 4CRJA 2XMAA 2CPEA 3TWZA 1JLEB 5KOWA 2Y1JA 4PXBA 2HFSA 3QLHB 1EP4A 2C2DA 5IT9Y 2IAJA 2YWEA 4M5KA 3R7NB 1X4FA 2ACYA 5L1JA 3IS9A 3W2VB 3KLGB 4X84A 1Q4RA 1NK9A 1U1PA 2OMOA 1R0AB 5KG4A 4NLWA 4CNZA 4AXJA 1BC6A 1DTQB 1QM9A 3CF5Q 3CCZA 2NXEA 3M9NB 2MB0B 2VIHA 3AD7C 2QL7B 2LFVA 4CH7A 2OI2A 3Q22A 1RWWB 2OPSA 4DL6A 1RZMA 2C28A 2EXUA 2W7PA 3J7AN 5F0WA 4ZVPB 5DQHA 2OFHX 2WCXA 4ER8A 2KT2A 5HP1B 2Q43A 3EVOA 2LQJA 1JXVA 5LT5A 1DARA 3TRGA 3AJDA 1FKPA 1S57A 2FC9A 1RTHA 1VS3A 3N5BA 2MMYA 3H2LA 3ISND 4OYZA 4ZITA 5H9FJ 3UW1A 4CCHA 1RWMB 4OZ1A 4GKKJ 3UVJA 3C8YA 2YNHA 4CI0B 2HHWA 1T7PA 1M1HA 1SC4B 1LWFA 1U4BA 4LRDA 2R7OA 3SQGB 2XLKA 1K0VA 3W1YC 3MM7B 3C16A 1J27A 3EZ5A 3DRYA 2ALYB 1H0HB 1WD6A 2BKOA 2V50A 5B7WA 1YITS 1HWKA 1X8DA 2YNGA 4QQBA 2IDEA 4WYLA 2X3DA 1FCAA 1JNZB 2J9CA 5A8RB 2N82B 4WFAQ 5RUBA 1PIEA 3K59A 3ITHB 1BQMA 3I0SB 4OLPA 4PG7A 4DPOA 1R0BG 2RQ4A 5LSOA 5J2QA 5J1PA 1KC8T 4B9NA 5HROB 1ZOTA 3JQJA 4NE9C 3L3CA 1VCTA 1WORA 2ASYA 1I94J 4JI5J 2V8HA 3IG1A 4C8KA 2ROGA 3CT9A 4AD6A 1NB7A 4LSNB 4P2FA 3QSIA 3UD5A 2GIFA 5AJ3J 5C25B 4N76A 2QMXA 2MJNA 1P9YA 1BD6A 1NSAA 6FD1A 5KFOA 5GADI 3IC1A 4U6PA 1VK3A 2JHEA 1EKSA 3MAQA 3J7A1 4USUA 1YZ6A 3M2UB 4M95A 4RO0A 2V5HG 3KG1A 4DX6A 2W8KA 4F4YA 2GMHA 2XSFA 2ZWOA 4NLDA 5HVHA 3HVTA 2JFKA 1FD8A 3MEEB 4N56A 3W5ZA 2XNRA 1Q8KA 4MIAA 4DN9A 4RW8A 2IBOA 4FYWB 1BQMB 4YMEA 2ZHBA 1U47A 4IG0B 3CJQA 3UDEA 4X4UA 1JLAB 3BGRA 1FFWB 1SH0A 1F3VA 4WKRA 3W66A 1X4AA 5JJBA 3K58A 2PO4A 4DUTA 1JIHA 1P1LA 5SUHA 1XMBA 3M6XA 4GMKA 4XPCA 2ZJPQ 4AL7A 2GHWA 1K1SA 5C25A 3FKBA 2VJVA 1LQ9A 3MI7X 3SFGA 3FBFA 2Q79A 4RW4A 2JSXA 4DFJA 1RCXB 2KI2A 2OPRA 3P3DA 3Q2TC 5HVFA 4ZLLA 3TVYA 3M9OB 1QUVA 1RXOB 3P5BP 2OPPB 3NGKA 1CBKA 3C19A 4UZCA 3MEGA 2H5IB 2GAHC 4EBEA 2M52A 3G8QA 2MHEA 3MM6A 1TUGB 3U27A 2C2NA 2E1PA 4M8LA 2FGOA 3MM9A 2G2OA 1RQ0A 5E3RA 5E3AA 2JEGA 1A9NB 1EIYB 1E6YB 3LANA 4OX8A 2APOA 2G1HA 1YVFA 4KQZA 4G1QA 4DDFA 3PX4A 4RBTA 1FJGJ 5HI7A 4DCPB 3BSOA 2IVFB 1F5AA 4EO8A 3FZ2A 2G4BA 2X3GA 4OYAA 1YJNS 1HHTP 2YKAA 4WF9Q 2BRLA 1RAEB 4DF4A 2A6OA 4AT1B 2VU5A 1UMJA 2E1RA 1XMQJ 4HR2A 3JTOA 2AF6A 5I3PA 2VQEF 5BJRA 5AT1B 3GYGA 1RTJB 2AEJA 3R5BA 3SSSA 4DXLA 4FXVA 3RBEA 4PUOB 3R1LA 1Z2ZA 1UEVA 2E66A 2VZ9A 3ICLA 2NZCA 2JWNA 2D1CA 2K3IA 1TELA 1RHMB 3CO0P 4I67A 3DDNA 2FHMA 2UV8A 1HBMB 1E6YA 3NG8A 4J9SA 4ECYA 1VQ4S 3G9CA 2HMIB 1SJ3P 3WQPA 4DV1F 2BXJA 4OYBA 4J37A 1RADB 4A8QA 1VRUA 2XMTA 3PNIA 4TQRA 2BE9B 1U8WA 2VJUA 3QFHA 1ZM3A 5B08A 4X2BA 1S6PA 1RTZA 1H2UX 2R9LA 3SSQA 4M5HA 4IFVA 1MMDA 4B3RF 2W2PP 5G4DA 1TL7A 4OZNA 3CMAS 2PFDA 2PI5A 2B56A 3R6LB 2RE1A 4J91A 3R7SB 3GTYX 3V6JA 1HMVA 1IM4A 4OI4A 1KNZA 2CZ4A 1L3VA 5DETA 1HNWJ 2C1EB 1EQMA 2CJAA 2KN4A 4TY9A 4FN5A 3UNYA 3I4HX 5HVGA 5KTQA 2OO4A 2KFZA 4DPYA 3D28A 2WONA 1G6BA 4AYBD 3PZPA 1Q53A 4NI2B 2ALZA 1FKAF 1IR0A 4F04B 2P2CB 2XMKA 3H2VE 1APSA 3P8BB 2QMUB 2ASJA 3KDNA 1AT1B 2B4UA 4LBHA 2LQ8A 3MMCA 3MR3A 3I0RB 1RWVB 2GQQA 1NH7A 3IM8A 4K4ZA 2XY5A 5EWFA 3OVAA 2KO1A 1HW9A 4NLRA 2W7OA 4TKTA 3K5LA 4DR2F 1KFSA 1GH8A 1SIZA 5K14B 3GONA 2BJEA 3TUPA 3DC2A 1VIXA 3HZGA 1IM6A 5GVQA 2P5VA 4QIGA 4WFXA 3RU0A 3KMSA 1OY9A 3M6WA 4RLEA 5DG7A 5CD4H 5E3PA 3OSNA 2R2RA 5DM7Q 4WFYA 4J9KA 4J9OA 4OV6A 1HD1A 2QLFB 1N5SA 2RRNA 4DQRA 1C4AA 1LK7A 5ETRA 1M5KC 2KVIA 5KT7A 3FZBA 1X4GA 3GLJA 4I69A 1FXRA 1VOMA 2GNKA 2W4DA 2KXFA 3CDEA 1BHNA 5EWEA 3CJTA 3G6YA 3MPWA 5KT6A 3LP0B 1N0VC 2C3PA 4P2MA 4CP5A 3LP1A 1SJFA 3MAAB 3AB4B 3CJRA 1NDLA 4IO9Q 3THVA 1MWYA 3NS7B 2I8EA 1UVKA 4H4OA 3UDVA 2RT3A 4DQPA 3WX8A 1FA0A 2CRLA 2YNFA 1AROP 3TA2A 4CM0A 1S10A 1Y9OA 3G87A 4EYHB 1AUDA 5AE3A 1UZDA 4DUZF 2E1CA 3AODA 2HLTA 2V8PA 3VALA 5L9NA 2E7VA 4ZN3A 4I7FA 4Y2CA 4MTPA 2XZWA 2ASLA 1GMWA 2X7IA 1AZSA 3S01A 2RNEA 4WK3A 2KG0A 4ID5B 2HQGA 2ZITA 5LOQA 1RAJA 1RHQB 4N5SA 1B7FA 3RBXA 5K8OA 5EGYA 2ZDOA 4PXCA 1M1KT 1PC5A 2VDHA 2PN6A 3KHHA 3HSJA 4CLLA 2HHVA 2BABA 1S9GA 3GB0A 3LP0A 2ILZA 5KG3A 3L9ZA 2P9GA 3U7JA 3M05A 5HO4A 3PR5B 5CYQA 3F56A 1CJUB 2VG7A 2QYGA 3V2UC 2MTLA 4QW9A 2Y1RI 1EETA 4DV0F 1Y5LB 3QZ7A 3MDFA 3TEGA 4M5DB 4DU8A 2DGQA 3UCUP 4HHUA 5L46A 1KRPA 2W2NP 2Z58B 2V4QA 1GX6A 1SKSA 1WNEA 2PEBA 4ZVRB 4DV4J 2KL8A 1KVIA 2F8HA 3TNVA 4D3GA 3B4DA 2W9BA 2J6SA 1BLUA 3EJMA 3OR1A 1S6UA 4TY8B 5IV3A 3DRRA 2O5DA 3N5FA 2G9OA 1Q86T 1VJWA 1LEOA 3T41A 3LW5C 3W61A 3VGVA 2DXEA 1YIJS 3IGNA 4Y28C 5DDRC 2E9RX 3J80U 2WBMA 4PXDA 1RABB 1B0TA 2CQ1A 2IRXA 4BWMA 5E41A 2P6TA 4Q7AA 1N34F 2GW8A 2H51B 4DV2J 3UR0A 4IOCQ 1N8RT 4X64F 3DLEB 4DL0C 5EWGA 2EPIA 1Q82T 1H7XA 5K9FA 3I55S 4ILRA 3HHLD 4RW9A 3OLBA 3JSBA 3K8VA 3FBCA 3VCDA 3IM9A 4R0JA 4DSIA 4PAAA 1T9UA 2YH0A 1RBAA 1TK8A 2VF3A 1DFDA 4CLPA 2JL9A 3QGHA 1GAOA 4TXSA 3ZC4A 3PW2A 4QR0A 3DOMA 2B7CB 4MYUA 3C6TB 1TAQA 3CCWA 2WRMA 4KV8A 3HT3A 5J2PA 2QE5A 3ENVA 3PIPQ 5LXYA 3RZAA 1F2HA 1YBAA 4IG3A 1KQKA 3HVAA 3OTEA 1FKOB 4C11A 1S1VB 3NLCA 5IQ6A 3AD8C 4CYUA 2CJ9A 3PX0A 2CPYA 2YNIA 2BJ7A 3KK3B 3DLEA 2QSFA 4P2SA 1NJXA 1U02A 4F2SA 3NS6A 1U1OA 3NP5A 3N6LA 2WVFA 3E01A 4F4AA 4ZPWR 3MM8B 1SBRA 2QTWA 4MFBB 3FCWA 2V34A 4O0NA 4JI6J 1VBZA 2NSBA 2Z56B 4KGMA 4Q0BA 3OTDA 5GAGI 2BW2A 2DNPA 1I51B 1ZS6A 3FMBA 2AYMA 3AQOA 3MEKA 2R7TA 1U2FA 1ACMB 3N6NA 3D6HB 4KTQA 3IFEA 3BBBA 3QJLA 4LREA 2AX0A 2B9YA 2YKOA 1NEEA 1L5UA 5GAHI 2BJDA 3AOCA 3X1LB 2IJRA 1CJTB 3U02A 1HR0J 3EGZA 2CG8A 3K89A 4QR1A 2D69A 2MZQA 3QWPA 4DU7A 1DTTA 3ETMA 2R3VA 2UVRA 3H90A 4NCBA 2KH9A 2AZ1A 3TP2A 3W60A 5D4OA 2DK2A 2R7WA 1WKKA 1RCOB 3GIJA 3QFWA 2JEFA 1TFYA 2KTQA 3PEJA 2N7CA 3J81Y 1U7LA 4FYXB 9ATCB 2VQEJ 2Z2YB 4KAIA 1VQKS 3JS9A 3NOCA 3VQTA 2UUCJ 2D3O1 3OL9A 3VTIA 4AL6A 1VRQC 4F0KA 1IWAA 4C98A 1RWNB 2CXEA 1XC9A 2AP6A 2DH7A 3FCVA 3Q86A 2M88A 2ZOFA 2ZZMA 4K4WA 4YQWA 2XM3A 1TKZB 5KFCA 4DR7F 2VH7A 4F25A 4A8FA 2FDNA 4CO3A 4IQMA 4TY8A 2QLJB 2RMLA 2CPJA 2YKNB 3I87A 4NYPA 2PGCA 2WSEC 3PEHA 4H4KC 4UW2A 4LJMA 2Z30B 3V4MA 4DUYJ 3HX9A 4U96A 2D7SA 1FWKA 2VG6B 4KGXB 4L3NA 3SDEA 4LF8J 1IKYB 1TP7A 1AZSB 3HHLB 2CPFA 3DLKA 4ED6A 1Q5YA 3K7RA 3PG9A 5C24A 3J7YI 2B4OA 1R8CA 3LA0A 1JK9B 1O0PA 1YBUA 1M5VC 3MMBB 3O8WA 3Q8SB 2HWIA 1CS4B 3R27A 5KFHA 4NLPA 3DYAB 3MUTP 3EWGA 5F0UA 3DRSB 4ZP7A 5K5MA 5J2QB 3QPIA 3I96A 3BO4A 4NEYA 4ZPTR 2D3OR 3L7UA 4B02A 2R42A 3OV7A 3IG1B 2EC0A 2HSEB 4ELUA 1FK9A 1FVSA 5A8WB 3M30B 3OVBA 5J2PB 1T9YA 3QO9A 1WELA 3ZZUA 2NXUA 4UTGA 4F36A 5HLFA 3CTRA 4NLUA 2HVDA 2KT5A 5T7LA 3PIOQ 3TARA 4RU2A 1X4EA 1IBMF 1S0VA 1S99A 3O1LA 1U6FA 4USKA 2K3KA 2ZFHA 3HFZB 2HLUA 2HQDA 4DHVA 2H54B 2AZ3A 1U1MA 2EBGA 4JOUA 4CLWA 1F3FA 2CQ4A 4C0HA 3I31A 2HVIA 4NLXA 3RAMA 2J8AA 4F2RA 1T9VA 2VFRA 4JI5F 4NRTA 1RHUB 4GO7X 4RBUA 2UZAA 4CH1A 1HNIB 2VPXB 3W64A 4URSA 4PYAA 1D3WA 3SSRA 4KH0B 1JJCB 3D6MB 2JOQA 1XK8A 1UVNA 4DX8H 3EDQB 3M7VA 4DCOB 2CVIA 4ECVA 4RW4B 1SI9A 4ZP8A 4X4TA 2BJ9A 3NOGA 3MR2A 4ED1A 2QA1A 1D9AA 4DSKA 7FDRA 1B4SA 1CJTA 1M5HA 3OW2R 3G82B 2Q1LA 1TKDA 1F60B 1S12A 1F2GA 4FKXA 3MMAB 4CLSA 5F8MA 1N4LA 2DNHA 5CA5A 2OMLA 4JI1J 4LR9A 4J9LA 4JBCA 4ZA1A 4IR1A 4CLTA 3V6DB 3SXLA 4H4MB 3NGTA 1KLMB 4OLOA 2CADA 1LK5A 2H5EA 4G1QB 1QD1A 1ZZNA 1U48A 3A8JA 5GAEI 4C11B 1FXLA 4AXIA 3AHPA 3BN4A 2BQ3A 2WVEA 4R8UA 2IM0A 1FRHA 3S6EA 1XJWB 5AXKA 2ZH1A 4UOCA 1RGVA 4DFKA 3RGIA 4B3SJ 2CNKB 1UWBB 4LF6F 2BE2B 2CQIA 2V94A 2WB4A 2W7AA 3UD4P 2CJYB 3RW6A 1D8YA 3FRYA 2AV5A 4S0MA 4XPEA 2W2QP 1G7CB 1S59A 3MPUB 1UVJA 4CO0A 1RU1A 2G2YA 4H4KA 3NAHA 1LKZA 2W2OP 5IZHA 3VGUA 5DDQC 3CSKA 1XIQA 3T6JA 3AJ2A 3OJUA 1SKUB 4FP9A 1C1BA 1D9DA 2HIYA 4NEZA 1NKCA 4B3RJ 1RT4B 3IR7B 1JXEA 5DM6Q 1FD2A 4C8MA 1F9EB 2WW4A 3TUZC 3VAMA 3Q8VA 5G0RB 3TR5A 1R0AA 2D41A 2ZM6F 2HFOA 2C2ZB 4XIUA 1RTDA 4LF8F 2ZBRA 1RHRB 4LF5F 4FYYB 4V19X 4FF2A 5DQIA 2FJBB 2ADCA 1NK0A 3PJXA 2W9CB 2HKEA 1UJ4A 4RWWA 3TA1A 8ATCB 3JTNA 4WTOB 4ZCLA 2FJVA 4YB6A 1BGXT 3HM9A 1IR2A 2WVDA 3AQPA 4EEYA 3BGOP 2CQCA 1T0TV 4I1TA 3PRDA 2VD3A 4PG5A 3VQSA 2YBVA 2I9SA 3CVKA 3JQKA 4DR7J 5A6PA 1UA1A 3J81j 1TVRA 4B9LA 2DEIA 1RT3B 4RW7B 1U0HB 7FD1A 4PG6A 2DGWA 1HMVB 2MQQA 1OWXA 5IT0A 2ZH3A 2CQHA 6AT1B 1RAAB 2O01C 3M8RA 3ZO7A 4ZN1A 1O6XA 3BPDA 1IKVB 3ETOA 4UOFA 1V6HA 1Q5VA 4DOZA 4F26A 4ZLNA 2AYGA 4USMA 3T1YF 5L1IA 2ZJRQ 2RRAA 3HK2A 2HWTA 2QA2A 3ONQA 3KYLA 2W9AA 2JLFA 2JC1A 4ETXA 3RRHA 2A3JA 3C6UB 2WBRA 3QT8A 3T5KA 2IFXA 3MTKA 4YHHJ 2HGMA 2CUYA 2LA4A 2LXIA 2W9BB 2B9EA 4BHQA 4ELTA 1XNRF 2MZJA 2JEIA 3QIDA 4URQU 4DSFA 5KFJA 2J6UA 2FLOA 1V5IB 2WW8A 4FF3A 3BSCA 3FNNA 4K7QA 3K17A 2DHHA 5B0BA 4LRCA 2E1MC 1S9FA 1IN0A 2OPSB 4Y2IA 1YKWA 3KNGA 1TQLA 1S49A 2W2MP 3DHWC 3DI6A 2OD4A 3K5OA 3KLEB 2XSJA 3ILIA 3VF0B 2MGZA 1D0EA 1EQ0A 3GPAA 3TOQA 5KT4A 2FC8A 3TX0A 4WU2A 3EDRB 4ERDA 3BB5A 1NRKA 1HBOB 2GS8A 4Q45A 2QEXS 3A8KA 3NNHA 1RHJB 3IR6B 2DGOA 2EKNA 1X9SA 4KHRA 2IMOA 1CJKA 2EG2A 4FXDA 1VQMS 3GZ7A 1ZA2B 3A1YG 2ZEJA 3CJ8A 3MHYA 3OT9A 3W63A 5D0EA 1IKXA 4LF6J 4QOTA 2VFVA 4EO6A 4OI3A 2V4JB 4ZHRA 3BGRB 1O51A 3TVZA 5CAAA 3B78A 1T3OA 2JLGA 4F4ZA 2YNFB 3H7HB 3M8PB 2Z2ZA 1PSDA 1SCJB 1T94A 4ZVGA 4EU0A 4KRWA 4XO0A 1UFKA 4I7FB 1H6KX 3FSYA 3MAHA 4LT6A 4XTTA 1F6TA 4BBYA 1YJUA 3MECA 4ZVHA 4A47A 4A8WA 1KQSR 4WK1A 4B9MA 2VDIA 4JI8J 1F5CA 2HHPA 4WFNQ 2E5IA 2ZDPA 1I94F 1HARA 4A8OA 5KT3A 4KT0C 4OZJA 4PQAA 2LDIA 1N56A 2LEPA 1FNMA 4DR1J 1KDNA 4CT8A 3EXYA 4E8UA 2KXHA 4OZLA 4ES2A 4WXWA 1SQEA 4MH8A 4ZPAA 4CZCA 5DLGA 3PJ9A 4JI7J 4NXMF 5M2UA 1RK8A 2M5YA 4C8NA 3CCJS 4DV2F 2FB0A 3KK2A 1JKHB 5LM7E 3ZTPA 1LWEB 4GO5X 4TQSA 4GKJJ 2CG4A 3UDLA 3ZZZA 3I56S 1Q16B 2OEKA 2V6AA 3DLGA 4F0HA 3DDKA 5BR8F 1E6VA 1RI7A 2GZOA 5JUMA 3I4PA 3M8ZA 3MMAA 1HD0A 3HVRA 2FVSA 2ZUAA 1KR4A 1Q78A 3M1VB 3BH6B 3FFIB 5KOXA 2KM8C 2EFQA 1RSCA 3FMWA 3HVWA 3TVKA 1MN7A 1S4EA 2GJIA 1TUVA 1NU4A 3OLAA 4ECWA 3CO9A 2OH2A 3DGPB 4PUOA 5T41A 2XYGB 5LSRA 4ECRA 1EJ7L 5KFKA 4YN3B 3CJSA 2MHNA 3PHEA 3H40A 4HACB 4C3LA 1K1QA 3BGFA 4B3OA 3CXCR 4ES3A 3PM9A 3TJAA 2OP5A 2YWFA 5HK4A 5HANA 2UXDF 1A6LA 4F02A 3AXKA 2OPRB 4KSEB 2R8JA 1QLNA 4LIWA 4K4UA 2HG4A 1YJRA 1KOOA 1SKWA 2EFOA 4ZCMA 3LGHA 3W8GA 1VQPS 2PA8D 2P9EA 2G0CA 3BSAA 3NCPA 4NZ0A 1OQ3A 5FDLA 3W7BA 3GG1A 4UT4A 1FRKA 1LW0B 3DKDA 1AYEA 1X7VA 1FT8A 1VRTB 2V8VA 5L1KA 1UL3A 3UVJB 4DV6F 3C66A 3M4XA 3KHLA 1HHSA 4MAKA 1SH3A 5G0RA 3RAQA 1S9GB 3CE8A 4A8YA 4IRKA 3IS9B 4JV0A 3CCES 3SI8A 3I5AA 1YRXA 2HS0A 2PDAA 2L48A 3IWXA 1EETB 3D6FB 2QLBB 1MN9A 2WONB 2V68A 2F8MA 1QUPA 1RLCL 2VBYA 2ZZNA 4F3MA 1QJHA 2GGPA 4DG1A 5CABA 2X1AA 1XR6A 3MMBA 2KHCA 3NGRA 3T19A 3P45B 4EMDA 1U1LA 2ZOMA 1TKXA 2F7VA 3EMTA 2KG1A 4LRFA 1JX4A 3QSYB 1LV5A 2ZE2B 4LF9J 5JMNA 1GMUA 3D0IE 1IBLF 1TAUA 1DURA 3DU6A 2O3DA 4NLVA 2MYFA 1U6ZA 3W8PA 1RKIA 1IJEB 3PW7A 1S6QB 3IMQJ 1NK8A 2V8DA 3EE3A 3HHKA 1T11A 2IC3A 4KGKA 2B0GA 2AGOA 2V2ZA 2Y1IA 1KFDA 4PZVA 2QLXA 5KFTA 2E5JA 2RIJA 3UN2A 1N5YB 3N6MA 2XI3A 3QBCA 4DV3J 2I2YA 1AB8A 5D8HB 3F44A 2K7JA 2EEYA 2F9DA 3R5CA 1XQIA 4NLTA 2ZD1A 3T5HA 3GSIA 1U1NA 1JLQA 1IQZA 2X1GA 3D1HA 1FJCA 4Y0FA 3TYTA 1VQ8S 1TKXB 1U1RA 1FNOA 2UU9J 1HNXJ 4GC6A 1VQ9S 4WPAA 1RLDA 2Y8YA 4C48A 5JVHQ 3CNQP 5HN0A 2AGQA 2B9WA 3N4WA 2RSQA 4Z37A 4IRCA 4E0DA 2IDLA 1X4DA 4NXNJ 3P5TL 5SZTA 4IQXA 1TV6A 2ZVIA 1S6QA 1OPIA 1JMTA 2IYGA 2HIQA 4LRBA 3VAFA 4RUAA 1C4CA 2AWZA 3SEOA 3DMJB 1FKOA 1MLAA 1WOOA 2LMIA 5F8GA 3AY0A 3M6VA 2OTJS 3I32A 5KG5A 4HL9A 3LP2A 4ICLB 4NYOA 2VQFJ 5DDPC 1LWXA 1Q0NA 1WDDA 3CCLS 1N33J 4USWA 3A13A 2RQMA 5CQGA 3E01B 4KHPJ 1HQUA 4RW8B 4DJBA 2HNDA 1W2IA 2A0FB 1XWLA 2N7YA 3KKFA 4ANCA 4B9TA 1D8ZA 2BX6A 4PWWA 3OSPA 4TLRA 3KJQB 1HPZB 4OX6A 3CDUA 3H4DA 3OR2A 4FPIA 4TU7A 4OHVA 2O67A 3EZUA 3UNGC 2WSFC 1XNQF 2OFGX 2WAQD 5KT5A 2QRRA 3JB9k 3H25A 1CS4A 2LU2A 4DPTA 3SCLE 1TTHB 4ZVQB 2CJBA 1N5TA 3ELHA 4CT9A 3KLFA 2CQ3A 2BJ3A 3GE9A 5DG9A 3KMQA 1RWPB 4P7TA 4B9UA 1RP5A 1HBMA 2VG5B 2RILA 1NJWA 4DX7A 3WBZA 2EFNA 2YXLA 5JVGQ 1FI4A 2XI2A 3FVYA 3LF0A 5HJXA 2B3TB 3LPEA 1XNQJ 2CQPA 4FF1A 2EG1A 4JV2A 3T6BA 1NK4A 1EKRA 2FJXA 4DZ6A 4J9MA 4C8OA 5HJYA 1U2RA 5I42A 3A4TA 1UWAA 2HQCA 3IXQA 5HATA 2J0XA 4C9DA 5IM0A 1Q79A 3AA9A 5KFSA 1R6VA 3P6YC 3BPSP 4A8KA 2DBBA 1EAYC 2DIUA 2J7KA 3AB2B 4U95A 5D4PA 4O4GB 1RAHB 1YBTA 4ZPCA 5ITHA 4R25A 1WEXA 3IR5B 1FX4A 2V2KA 4F0MA 2FVQA 4F8RA 4PEOA 5B0EA 5DGAA 4B3MJ 4EZ9A 5L8RC 2BV3A 3ET6A 1VFJA 2VG5A 3AT1B 4X4RA 1C0TB 2B8PA 4P71A 5D77A 4FS2A 3BQ0A 4QCLA 1SC6A 2YQ3A 4LSNA 2DT9A 1HW8A 2POKA 1Y10A 2HPUA 1T95A 3OUYB 4NA1A 4TLQA 2R2TA 2R7RA 1VLOA 4NLSA 4J9NA 3DLLQ 3G96A 4ED8A 2JDJA 1VI7A 2AMCB 1H2TZ 1REVA 3M32A 1NM2A 1Y5IB 4K8RA 5EX0A 2UUAF 2XS7A 4DL3A 1FE4A 1HNVB 3D3CJ 1S6PB 3PYGA 2FYXA 2EVZA 1T9XA 2H3EB 4EK2A 3W9IA 4B3TJ 2OPQA 2IA0A 2FLNA 3HO1A 1RA6A 1FDNA 2OHDA 5J2MB 4K0KJ 2YTCA 4HLBA 2DNNA 2Y0SD 1BQNA 2DHAA 3ET6B 4MKBA 5CCLA 3FRZA 1ZTWA 2M0GB 1T03B 1NPKA 3PV8A 4G65A 5B0FA 2Q6CA 2IBKA 1G1XA 3V4IA 2KFNA 3OUYA 2U2FA 4KKOB 1SV5B 4ZMMA 2KKHA 1PO6A 4KJIA 1OJ4A 4OZ5A 4OIXA 1B99A 4Y00A 3D9BA 5AE1A 2BDPA 4NI2A 1WKLA 3E51A 3MR6A 1Q8LA 2NCKL 3B6BA 1ZM2A 3HLUA 4WXOA 1HNVA 5DGBA 5A0YB 4HH0A 4N8OA 3TI0A 3CC7S 2HHSA 3VGSA 4RL1A 5LJ5Y 1LFPA 1S1XB 3PJWA 1HBUA 3AH6A 5K20B 3TZXA 1RUSA 5GAEU 1FE0A 1QY7A 2MZSA 2AJFE 1J5OB 4QWAA 1RAFB 4MK8A 1WF2A 5ETKA 3WZ0A 2HNDB 2QLWA 3CWJA 3R2DJ 2YPZA 4CM2A 1BQNB 1WDTA 5E7OB 1T03A 2GIRA 1QSYA 3PO5A 3CPWR 4YFUA 3OHBA 1HYSA 4CYUB 4BS2A 1HPZA 4DR3J 2HRTA 2WZ1A 3DXSX 1YRTA 4ID5A 3LAMA 5LL6d 2E5LJ 5KT2A 4OJ3A 1O5JA 4U8VA 5ETTA 2A10A 2LU1A 2N4DA 2XCAA 1CPZA 1F5BA 1N5VA 2DHXA 2E5GA 2JX2A 3AXMA 3DLJA 3P4UB 4X4PA 1KTQA 1PYOB 1VMBA 3IBCB 4OHXA 3HJFA 1JJ2R 2ZNZA 4LF1A 2XMMA 2DR5A 4DS5A 5E2QA 1RT3A 1NJZA 5HAOA 1FTCA 2MZTA 3MAAA 3MPVA 2C3YA 4AE5A 2EI5A 3EGNA 2CDRB 5ETNA 1VC0A 3W2VA 5D4LA 1WSVA 5ETQA 3KLGA 1LW2A 3M8WA 4ZVUB 3H42A 3ULHA 5KFWA 1NUEA 3H5UA 2HWHA 2BUNA 1IKWB 1WOPA 3I5BA 1DTQA 2RJZA 3UR3C 4IR9A 2BYCA 3CMES 2U1AA 1H2VZ 1JLFA 3KJFB 2J7WA 1O8BA 2AEMA 4FZVA 3A3OB 3RYLA 3MMJA 2AW0A 2ZNYA 3PYFA 1Q8IA 5BYSA 1G3OA 2CNOB 3LWLA 5K8NA 4IFVB 4XK8C 1QVGR 2GMLA 2J8SA 1L3UA 3RG6A 4PABA 4ENOA 2YWHA 3OXGA 5EUHA 1VQ7S 2GO8A 3CC4S 1EX8A 4OJHA 1ZM4A 4MYTA 2VUGA 2FPHX 1ZM9A 3Q89A 8AT1B 4X65F 2FHJA 2EK6A 2MLYA 1RKJA 3HHEA 4DR6F 4OI1A 3F73A 3H4BA 2FGCA 3ZZTA 2MKKA 3M30A 4YB5A 2Z2LA 3KLVA 3DFEA 2G1DA 2DR8A 4YOEA 2JZ5A 1NXIA 3GIKA 1GNKA 3HDSA 4A8SA 4FYVB 4JI7F 1V3RA 1YK9A 2HHHJ 1BY9A 4IH7A 1XR5A 5HBMA 1TL3A 4CNYA 2XO7A 1HI0P 1NDCA 3OJSA 3SBMA 1YJTA 4KH1B 2GAGC 1CJKB 1HHQA 4O44A 4QPXA 2XLIA 2H5JB 3MPDA 4JI8F 3IWNC 3HKWA 2L3MA 3IBFB 3A3NB 4GC7A 4AL5A 3VHQA 2LEBA 2LQ5A 2NUUG 5KFXA 1FVQA 4KIAA 1NPPA 4J9VA 4L3KA 4W90B 5I42B 4AQYJ 4ED5A 3EUNA 3MCOA 3OL6A 2DNOA 1XR7A 2XLJA 3GIIA 1RAOA 1Y3JA 1G4CA 3UPFA 4QWEA 1WTBA 3OTBA 1SL0A 1MU2A 2Y9HA 1V5VA 2MKYA 2XZDB 2Y8WA 5F8NA 5F3TA 1DRZA 2M8HA 3BDPA 2UXBJ 2ZH7A 4ZPDA 1K0TA 5F9NA 1R27B 4EBDA 1TR0A 2P8IA 1Y3KA 4O23A 3JSMB 3BSNA 2BMBA 2F65A 2WOMA 3QT5A 2AU0A 5H1SV 2LYVA 4NOHA 1R7IA 2R7VA 2DNYA 2DR6A 1Y0HA 3MFIA 1YLXA 1WC5A 3CDBA 2IRYA 3M2RA 2KZMA 1OSDA 4Y65A 1S7IA 5IWAF 3CCVS 3ILJA 5KFBA 3FGVA 2KRBA 3NRBA 3W2WA 1I1GA 2UU9F 3M8YA 3O3LA 1TZ0A 5E3CA 1FX2A 1GT8A 4CLUA 1RTIA 1TMMA 1FRJA 2VPYB 3MMCB 2XSJB 2J9DE 3IAS9 2Q66A 2R7XA 3DOLB 3IRXB 2DY9A 2OGUA 3CD7A 3CJ0A 1RT2B 4USTA 2F4VF 5A8KB 1Q95G 5BYQA 3PX6A 3P49B 3VR1A 4DLGA 4YHHF 2QL5B 5D6GA 2ZD1B 2MKSA 3OXFA 3IRWP 3W65A 4ES1A 3DCAA 2GHPA
chains in the Genus database with same CATH topology
1F2HA 1F3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2H A;  1F3V A; 
#chains in the Genus database with same CATH topology
 1RE1 B;  1S1W B;  1S9E B;  3K0J A;  4DL2 A;  3I0R A;  4M1K A;  3QMQ A;  1PIL A;  3A3P B;  3FQK A;  4A8X A;  1DQ9 A;  1DHM A;  4ZIV A;  2AYE A;  3EM1 A;  4I0W A;  4KHM A;  2YQ1 A;  3KUG A;  4CDI A;  3LOU A;  2I0X A;  1SJ4 P;  1U45 A;  4GVB A;  1HBN B;  4CLY A;  3HXM A;  1UJ5 A;  2V4J A;  2RD5 C;  3ENQ A;  3VZH A;  4O3O A;  4OZ0 A;  5A2Q Y;  1S97 A;  2QA4 G;  4WKY A;  2UVV A;  3M2V B;  4EZ6 A;  1AW0 A;  1K73 T;  2GVZ A;  2QIF A;  1M5P C;  1N32 F;  4J9Q A;  2B4V A;  1DBD A;  1EP4 B;  3RB3 A;  2YKN A;  4JI0 J;  1VQ6 S;  3H20 A;  4OYI A;  4H4M A;  2AIR B;  2X51 A;  3RB0 A;  2V2V A;  3RRG A;  1FDA A;  2RVJ A;  4RW7 A;  1XMO F;  3D5M A;  4L76 A;  2HFN A;  3DNC A;  4ZJQ A;  1GQE A;  5AJ3 F;  2MQ8 A;  1M5O C;  3ENA A;  4Q8E A;  2V2Q A;  1RT1 B;  3IA0 A;  3KTQ A;  3SCJ E;  3UWT A;  4LF5 J;  3HD1 A;  4GKK F;  1UWB A;  2NXC A;  5I3U A;  4IH5 A;  1U0S A;  1SQF A;  1YWX A;  2W25 A;  4Z2X A;  4X4O A;  2N3L A;  3OR2 B;  4EI2 A;  4ZVO B;  2JNJ A;  4HYK A;  2YKQ A;  5KG7 A;  4DV7 J;  2EW9 A;  2ZBP A;  2V8G A;  3AFG A;  5DS7 A;  3DYA A;  4FS1 A;  2CJK A;  4K5S A;  1TKT B;  3CB4 A;  4PQU A;  2JRS A;  3UE2 A;  2DTJ A;  2PSZ A;  4QIW D;  2E7X A;  2OUG A;  2BW7 A;  5D15 A;  2JC0 A;  2BKP A;  1UET A;  1M1G A;  2ZC3 A;  1GXL A;  4K2X A;  2YX1 A;  1FNX H;  3CUN A;  3POT A;  1YRU A;  1RHK B;  3OL8 A;  4JB8 B;  3PHT A;  1H3D A;  1R3N A;  1SPB P;  3JXO A;  4QZV B;  2GJF A;  5HL7 Q;  3BZQ A;  3KDO A;  4M5N A;  2G0J A;  2CQ2 A;  4K4S A;  2NZ4 A;  1MWZ A;  3BH7 B;  4X62 F;  2W9C A;  4QYR A;  4WBF A;  1J5E F;  4K4V A;  1MWQ A;  3OPK A;  2YNG B;  4RUH A;  2K2P A;  5F9L A;  3KG4 A;  2DPI A;  3HD2 A;  3LUY A;  4NZ6 A;  3C46 A;  1S6O A;  3CCQ S;  2LA6 A;  3D7S B;  4AUK A;  1VHI A;  1U2C A;  2R2U A;  4LFB J;  2E5L F;  1NHK L;  2BBE A;  3TUI C;  4LFA F;  1C1C A;  2I38 A;  2MY8 A;  3G2X A;  3KUH A;  4LVN P;  2XTJ P;  4X66 J;  4C8Z A;  1KS2 A;  2KJW A;  3BKT A;  1NBE B;  5BR8 J;  4JV5 J;  2DRA A;  1OYE A;  2OKQ A;  3R7B B;  4IKA A;  4IO1 A;  5LMU J;  4ILL A;  1N48 A;  2CQD A;  3T9N A;  3D68 A;  2IPO B;  4JI0 F;  1TL1 A;  1U6B A;  1RTH B;  3CC2 S;  1B0P A;  3N0V A;  3D1Q A;  3HKZ D;  3SCI E;  1X9W A;  1EB0 A;  5A6W A;  4ZKA A;  3SIP B;  4NXM J;  1RT6 B;  2FZG B;  2UVU A;  4MKY A;  1H98 A;  3FEZ A;  3DXB A;  1MNE A;  3QAE A;  4ECZ A;  4LF7 F;  3VVU A;  1X4H A;  1Z4U A;  3WX4 A;  4TVA B;  2LCW A;  1HWJ A;  3BN7 A;  4EGL A;  2FHJ D;  2GX8 A;  1JLB B;  3O6Q A;  1EAR A;  2R8H A;  2DGS A;  5KG0 A;  2B9X A;  3MEC B;  2CPH A;  3TJ8 A;  3FQL A;  3HUL A;  2HYI B;  2XS5 A;  4EBC A;  4IG0 A;  4DV5 F;  4PWD B;  5GMK a;  2MQO A;  5D3G B;  4QW8 A;  2K1R A;  1GMV A;  2WTF A;  3CMQ A;  4FF4 A;  4WZQ A;  2I5J B;  2LXU A;  2DJW A;  4MK9 A;  1PJ7 A;  1Q7L B;  2XYP B;  2RU3 A;  3CED A;  2FY8 A;  1S5Z A;  3KK2 B;  4K4X A;  2R4F A;  1H7W A;  3ILL A;  1UKU A;  2YKM B;  3MD1 A;  4UOH A;  1X5T A;  2YWK A;  2RHQ B;  3KJV A;  2D9P A;  5B09 A;  3ZNJ 1;  3T9Z A;  4DSL A;  3R5D A;  2BJ8 A;  3R6G B;  3DOK B;  5B0C A;  5L39 A;  1HWL A;  1P27 B;  3M8Q B;  3S8S A;  3QRQ A;  2V0N A;  2CPI A;  4ILM A;  1DAX A;  2F5G A;  5IWA J;  2GVD A;  2RQK A;  2XC9 A;  3HHN B;  3C3L A;  1FRL A;  3KK3 A;  2V67 A;  4JI3 F;  3A8I A;  5KAK A;  1WTF A;  2RAQ A;  5DJB A;  1QTN B;  4J5O A;  4WP8 A;  2Z0G A;  1UPM B;  3GJS B;  5GMD A;  2MY7 A;  4B17 A;  1ZTT A;  1VIO A;  4UY8 T;  1AFI A;  3ISZ A;  4ED7 A;  4CIO A;  1KLM A;  2N4C A;  3CCT A;  1JWW A;  1F9F A;  4IYQ A;  2DH8 A;  4C6A A;  3LTO A;  4B3O B;  1RTI B;  2UXB F;  4RWX A;  1FJ7 A;  1C0U A;  1QE1 A;  1RT5 B;  2CPX A;  2CWX A;  1NHU A;  1OPZ A;  4DUY F;  2DY1 A;  3JYT A;  4DWI A;  1RT2 A;  2DIV A;  3VV2 B;  4BDP A;  1XNR J;  4NYZ A;  3GCW P;  4F50 A;  3FJ2 A;  3PTW A;  1ZA1 B;  3T5L A;  3ZZY A;  1S0O A;  2B4P A;  3NMA A;  3KHG A;  4OL8 A;  4KO0 A;  3IGV A;  2CNN B;  2RDI A;  2YVS A;  3BV8 A;  4G1I A;  1DJ0 A;  3RTV A;  1PAE X;  4DR4 F;  3OVS A;  1WUU A;  4LF4 F;  5HSP A;  2JJ4 D;  3H0P A;  3M8S A;  2J5A A;  4RNM A;  2CJX B;  1FKP B;  1YDL A;  1DQA A;  5D4N A;  1C0T A;  1IKV A;  4LUB A;  1S0N A;  1GXU A;  1KHV A;  3AJ1 A;  3FC9 A;  3MZI A;  4LBP A;  4DL4 A;  1AFJ A;  2XCP A;  1V9O A;  1EHW A;  2BQU A;  4WZM A;  2GVZ B;  1RA7 A;  1U8S A;  3CD5 A;  1VYA A;  1LWC B;  3CJ2 A;  3ISN C;  4JI4 J;  1RT7 B;  5KFY A;  2UUB J;  1SVD A;  3M6U A;  4IFY B;  2BR0 A;  1NJY A;  1D9F A;  1WC0 A;  3NEK A;  4QBU A;  4P2X A;  5DG8 A;  1HQ2 A;  3DRX A;  4DR6 J;  1R8H A;  5C7P A;  4X65 J;  2MKC A;  3CCS S;  2ZVS A;  2OPQ B;  2IJF A;  1S0M A;  2LDY A;  1HNZ J;  3QIP B;  1YX2 A;  3TAP A;  3DGV A;  4IRD A;  3PKY A;  2C2K B;  1T9T A;  4LIR A;  4OJ1 A;  1N52 B;  2R7U A;  2OSQ A;  4KHP F;  3UN5 A;  2ZBI A;  3BGL A;  4PR6 A;  4ED4 A;  1B0V A;  1UFW A;  1VIS A;  4U67 Q;  2VQF F;  1TL5 A;  2GCF A;  2MLX A;  2C2O B;  5GAH U;  2PFF B;  2DNR A;  4DR5 F;  2E29 A;  2HMI A;  2CVE A;  2YH1 A;  2HNZ B;  4NCG B;  2GMJ A;  2IC3 B;  4O3Q A;  4K4Y A;  1BQX A;  3DRP B;  1N36 J;  1LWC A;  4WYW A;  4E98 A;  4QIF A;  1S1U A;  4JI6 F;  1QSS A;  3K57 A;  3L7O A;  4ZJL A;  5U47 A;  5LXR A;  4KY3 A;  4QYZ K;  1MG7 A;  4J9R A;  5K14 A;  5KFA A;  4NXN F;  2QFI A;  1KBR A;  1L3S A;  4W92 B;  2BAN A;  2DB1 A;  1QDU B;  2R2S A;  4LFC F;  4BLG A;  3JTP A;  2KYZ A;  1KLN A;  2B6A A;  1WSR A;  4B3S F;  3GIR A;  5DRK A;  3RR8 A;  1UJ6 A;  2I5J A;  4DX5 A;  1TK0 A;  3B82 A;  3BQ1 A;  4G3I A;  1X5O A;  2LVW A;  1HI1 A;  2UUW A;  2EK1 A;  2CPD A;  3E8O A;  5HQ8 A;  3BKU A;  5DLF A;  5HLF B;  1CVJ A;  4M5M A;  3C16 B;  4O4R A;  4WU3 A;  3FK4 A;  3OTC A;  5BYR A;  2YKM A;  3ZTS A;  2MLZ A;  3J80 Y;  1D09 B;  2H1Y A;  3ZZP A;  4DPX A;  2QYC A;  4DR3 F;  3H2U B;  2CQG A;  4DV3 F;  1ICE B;  2ABY A;  5KFZ A;  1FRX A;  2HHH F;  3GFZ A;  3QT7 A;  3MCS A;  2Y1L B;  3W2W B;  4KGV B;  3KXD A;  1S1T A;  4LSL B;  2HGN A;  3PW5 A;  2NS1 B;  3D54 A;  4MKA A;  4KFB B;  2ZBQ A;  4PG4 A;  2PMH A;  4P75 A;  3L95 X;  3ZZO A;  4UY8 5;  4Q2L A;  2IYI A;  1PGZ A;  4K5R A;  3EZO A;  2HFU A;  1IBL J;  1IKX B;  1WJ9 A;  3RBZ A;  3K5M A;  3CJ4 A;  2ROP A;  2VV5 A;  4X64 J;  2A2D A;  2XHC A;  3ILO A;  4OHW A;  3K5N A;  5CXT A;  4DQS A;  5C5J A;  1N34 J;  4QR2 A;  4WCE Q;  1FEE A;  1OQ6 A;  3W62 A;  3W9H A;  4FBT A;  1WG1 A;  2E1A A;  2PD1 A;  3DU5 A;  3IAM 9;  3MPY A;  4EFA C;  2P6S A;  4DCJ B;  2D9O A;  3KLI A;  3JSY A;  3M2U A;  4P7V A;  1D1U A;  1PJ6 A;  3NBP A;  4KKO A;  2KM8 B;  1FWL A;  4USV A;  3AAW B;  3DOL A;  2HHQ A;  5EN1 A;  2FZC B;  2B8Q A;  2K1R B;  4MIW A;  1DQ8 A;  4I64 A;  4NL5 A;  1FWP A;  2AJ1 A;  4NLO A;  4NPO A;  2J6T A;  1ULR A;  3ENW A;  1JLA A;  3G8S A;  4LR7 A;  1TVR B;  2B51 A;  2E44 A;  2XWX A;  1RTJ A;  1RAG B;  4Q44 A;  4TN2 A;  3KLH B;  4I2P B;  1T3N A;  4HDH A;  1YJW S;  1VQL S;  1FTR A;  1KP6 A;  4FPR A;  5CZX A;  4KYZ A;  3HSD A;  1W2B R;  4DV6 J;  3V6D A;  2X1F A;  1YSJ A;  5DO2 A;  3BBC A;  1HIY A;  2UUA J;  5CCM A;  3EPI A;  3KFW X;  4DV0 J;  2UXC J;  5KFV A;  3RBD A;  4Y6I A;  3V5R A;  3FUY A;  1NSK L;  2EFG A;  2IIH A;  2OPP A;  3DLG B;  5IC6 B;  2N3O A;  4X4V A;  2K06 A;  2HQF A;  3NBP B;  1TL3 B;  3US5 A;  3TX8 A;  4JV1 A;  3GV7 B;  3JQM A;  4FNH A;  4ECT A;  2NPI A;  1MRO B;  3NS5 A;  2VA3 A;  2FVP A;  3L4B C;  2FTR A;  1HFE L;  2GV1 A;  1NSQ A;  1X9M A;  3LO3 A;  2QC3 A;  2C2M B;  2VB6 A;  2MEW A;  3NXZ A;  4ITS A;  2QT7 A;  5E33 A;  4BCA A;  3KLH A;  2JVR A;  5K8P A;  1RDR A;  4Q5V A;  2BKN A;  1N6Q A;  4LMZ A;  1HL6 A;  2CIM A;  2F40 A;  3OTO F;  5J1N A;  2V63 A;  1CUL B;  2LKZ A;  3IBW A;  1VQO S;  2Y0B B;  5CZV A;  3F0N A;  2YWW A;  3MFH A;  2F4F A;  2YNH B;  3AOA A;  4H54 A;  1RWU A;  4NA2 A;  4Q2M A;  2V4R A;  3VAG A;  2HUR A;  4KO0 B;  5D0R A;  4RZR A;  3TAN A;  3DLB A;  1KQF B;  4AND A;  1FES A;  1VQN S;  2ZZT A;  2EWH A;  2M9K A;  2CPZ A;  3EXC X;  1BWE A;  3SMZ A;  4PXE A;  2OEJ A;  1N5Q A;  4HI1 A;  1Q8B A;  3PYE A;  5DZ6 A;  1CG2 A;  1JJ4 A;  3GYX B;  3DOM B;  2XGP A;  1ZPV A;  4QWB A;  2UUC F;  1W26 A;  4I2Q B;  3S1T A;  1SC1 B;  1U24 A;  2HQ3 A;  5HQL A;  3LGN A;  3PRV A;  4OX7 A;  5H9E J;  4DR1 F;  1KEK A;  3RJM B;  4CO5 A;  7AT1 B;  3V6H A;  1IKY A;  2I6W A;  2QN6 B;  1S76 D;  3R9L A;  1RYR A;  3FSI A;  2ADB A;  3C14 A;  5IM0 B;  2HW3 A;  2RF2 A;  4C0B A;  1U25 A;  2XUL A;  2G13 A;  3GSD A;  3IP0 A;  3L09 A;  5IT4 A;  5IV4 A;  3Q24 A;  1V3S A;  1CLF A;  4RKU C;  3D4J A;  1PBA A;  1SJ1 A;  3J81 U;  4ED0 A;  4X4Q A;  4B9S A;  4HH1 A;  4TU9 A;  2LQB A;  2V9K A;  4DG1 B;  1URN A;  4HTI A;  2W01 A;  4HDG A;  2XMV A;  3L7P A;  2QO3 A;  5M2R A;  1WG4 A;  2LEA A;  2KU7 A;  3DM2 A;  4YS2 A;  2FD2 A;  2AYB A;  2FVR A;  1BE4 A;  1JLC A;  3CDW A;  1S77 D;  1T9W A;  2XGQ A;  2W8L A;  1S4F A;  2F9J A;  4Z7Y A;  1WHW A;  5L38 A;  2DIT A;  2HNZ A;  2HK3 A;  4FYD A;  3C6T A;  3NKY A;  2BOP A;  4USH A;  4RNH A;  3SQG A;  1S1U B;  4R8U B;  5KFM A;  1NHV A;  1SL2 A;  1U26 A;  4UF4 A;  1HBO A;  5FLX Y;  2FUG 9;  1RAC B;  4IG3 B;  5T14 A;  3QT6 A;  3PR4 A;  4KR0 B;  4L72 B;  2P9C A;  2ZC4 A;  3BKF A;  4MT1 A;  2C3M A;  3M9M B;  2A6M A;  1OY8 A;  5FLX U;  3OBI A;  1CC7 A;  1X5P A;  1NZA A;  1HQU B;  2GFF A;  3ITH A;  3OD2 A;  2JEJ A;  1UVL A;  3ZNU A;  4HHJ A;  4A8M P;  3R5G A;  2E9Z A;  3V81 B;  3PO4 A;  1XBW A;  3GP9 A;  3MTJ A;  2DNK A;  3T1H J;  1YTY A;  4UUX A;  4P9S A;  3MCN A;  1B3T A;  1N32 J;  4L73 A;  1R89 A;  3H5X A;  2RRB A;  1H73 A;  2AT1 B;  3PW0 A;  1ZZF A;  1HNZ F;  5AXN A;  4Y2A A;  1SV5 A;  2CA9 A;  3MM5 A;  4CO1 A;  3WC2 A;  1KN6 A;  1OO0 B;  1X31 C;  1GMW D;  1HKA A;  4QJV A;  1SB6 A;  2VBZ A;  3N01 A;  3BYP A;  1TV6 B;  1H74 A;  1SJQ A;  4B9V A;  4KPY A;  3M8P A;  1RTD B;  1NSP A;  2RB7 A;  1EZZ B;  2MQM A;  3UN3 A;  5CD4 A;  1TKT A;  3HF5 A;  5KG6 A;  3H5Y A;  1XEZ A;  3PXG a;  4ZLJ A;  2VOO A;  2J0W A;  3DN9 A;  3PFE A;  1KTV A;  4CTA B;  2IA6 A;  3IRX A;  3VAH A;  4YB1 P;  5KFL A;  3TZY A;  4LF9 F;  1CSJ A;  1R0C B;  4Q8F A;  3D67 A;  1K44 A;  1NME B;  4FVC A;  5IOL A;  3Q8R B;  1UVM A;  3O2I A;  3DRR B;  4YR3 A;  1JKH A;  2ZH5 A;  2QMW A;  4DFM A;  3WHI A;  2NLW A;  4Z7C A;  4FNI A;  4F67 A;  3BQ2 A;  3Q83 A;  4LQ3 A;  4WE1 A;  4LF4 J;  3HFK A;  4RBV A;  1NK5 A;  3GG0 A;  4W98 A;  1UEU A;  1F1B B;  4WFB Q;  1C2P A;  2PEH A;  3TA0 A;  1NAQ A;  4IH6 A;  2J9E A;  1RU2 A;  1B7Y B;  1TL7 B;  3N79 A;  1UP1 A;  3R5J B;  5J1E A;  1UW4 A;  3TZZ A;  3NWG A;  2XMW A;  4PG8 A;  2OAU A;  3THT A;  4I6Y A;  3EGW B;  1PJ5 A;  3W3S A;  3FFI A;  2ILY A;  1VBX A;  4RUB A;  4UQG A;  4OI6 A;  1VQY A;  1S79 A;  4I2Q A;  1AUS L;  2FJE B;  2HHT A;  2Q6B A;  2FHO B;  2R8K A;  2UV8 G;  1BXN A;  4PRF A;  1B64 A;  1RIS A;  2B7B B;  4WE1 B;  3C14 B;  2BEF A;  5IC4 B;  2DH9 A;  2ATC B;  1W25 A;  5LJ3 Y;  3VAJ A;  3IN5 A;  4ATN A;  3QGP A;  2EFV A;  4ELV A;  1VK8 A;  4K59 A;  4ZLP A;  3VAI A;  2DHG A;  2M3D A;  3OR1 B;  5D0H A;  4ZCK A;  4DZD A;  1T05 B;  4OHZ A;  3B4M A;  4PWD A;  2DGV A;  3UCG A;  4DL7 A;  3MED B;  3CGI A;  1I5O B;  2R8G A;  1NKB A;  2G0I A;  3TQ1 A;  2NYI A;  3OFG A;  4LQ9 A;  4LRA A;  4LR8 A;  5KG1 A;  3Q23 A;  2E9T A;  3D0G E;  4NML A;  2D3Z A;  3ZZ0 A;  1NPR A;  1OS5 A;  1IBK F;  5B0D A;  1WEY A;  1P9Q C;  5K8M A;  2MQP A;  4N41 A;  5ETV A;  4DBQ A;  9RUB A;  2VON A;  4CLK A;  1R8B A;  1V3Z A;  3KOA A;  4GKJ F;  3DRP A;  4NZ7 A;  1A7G E;  2L9W A;  2VFU A;  2GVD B;  3MM7 A;  2XYH B;  3LP1 B;  1IVZ A;  5A76 A;  2DXF A;  1J5O A;  3FBB A;  2LLZ A;  5ADZ A;  4YY3 J;  2OD6 A;  2BA9 A;  2VC0 A;  2WVC A;  3DLH A;  4I4B A;  1HQE B;  2AJ4 A;  3DHX A;  3I0S A;  4KE5 A;  3GWC A;  5F41 A;  2AX1 A;  5KFR A;  2R7S A;  3BF4 A;  2HVH A;  2MQL A;  3DI6 B;  1MU2 B;  4WWS A;  2RDD A;  1IBK J;  4HVZ A;  1C0U B;  1QE1 B;  1RT5 A;  1HNI A;  1SUQ B;  4LSZ B;  3THP A;  4H4O B;  5EDW A;  4DR2 J;  2NRE A;  1WC1 A;  4PWU A;  4C3M A;  5HMW A;  4ECX A;  3V4I B;  4OX9 J;  1T02 A;  2GO9 A;  4KB7 A;  1RYS A;  2VAS A;  3ZTQ A;  4YR2 A;  3I82 A;  1E6V B;  2WSC C;  4GRS A;  1IBM J;  1WOS A;  3P96 A;  2VBX A;  3PCO B;  4U9R A;  5CH7 B;  8RUC A;  4MFB A;  1VDH A;  4N8N A;  1RWK B;  2BJ1 A;  4X62 J;  1J5E J;  4O3R A;  3MOJ B;  2VG7 B;  5A0Y A;  2ERR A;  3M2R B;  1NK7 A;  1JLE A;  4P6Q A;  4Q0B B;  3GFY A;  3FBE A;  4WIQ A;  3RRK A;  2PI4 A;  2XB2 D;  2DR7 A;  5FD1 A;  3AD9 C;  2L9D A;  2D3U A;  2B43 A;  2GHV C;  3D3B J;  3PDN A;  1HNW F;  4WP3 A;  2QV6 A;  2ZKT A;  3FEX B;  4TNO A;  2QGF B;  2HS3 A;  1KD1 T;  2LQ9 A;  1N36 F;  1FER A;  1GK8 A;  2DGT A;  2PT0 A;  2FVC A;  4FBU A;  2RKI A;  4M5D A;  2ZH6 A;  4ZP9 A;  1UTA A;  4M5J A;  4YEA A;  3HSG A;  3UCZ P;  2IRU A;  2DR9 A;  2QX0 A;  1WHX A;  5KFQ A;  1SXL A;  1QAY A;  1WHY A;  1R8A A;  4ZK7 M;  1KKH A;  2AD9 A;  3CD6 S;  2DEJ A;  2Q3P A;  2CJQ A;  2VBW A;  2ZBC A;  1WG5 A;  3MXH P;  4PQU B;  3BBF A;  3JSR A;  1S1W A;  1S9E A;  3NGS A;  4RJV A;  1K8A T;  1SH2 A;  2CAJ A;  4DN0 A;  1P1T A;  2NR0 A;  3QJJ A;  4OYW A;  3BO2 A;  4L6V 3;  1NDP A;  3Q2S C;  4HTJ A;  2J7U A;  3B8H A;  2HEK A;  4EYI B;  2RS8 A;  1JLG B;  1LFW A;  3BYR A;  1NDK A;  2OSR A;  2IVY A;  1NZ8 A;  4CO4 A;  2RS2 A;  3BR8 A;  1GTH A;  1VRU B;  1WC3 A;  2UUB F;  2HBQ B;  1RWX B;  3CCR S;  2GQC A;  1UZH A;  2NXJ A;  4JI4 F;  1FRI A;  3GFX A;  2AJ2 A;  1JB0 C;  2XZT B;  3WDO A;  3T1Y J;  4IOA Q;  2RHS B;  2YKP A;  4Y2M A;  1AXQ A;  2XMJ A;  4M63 A;  2HHX A;  4CTA A;  4Y3C A;  4YUD A;  4C2M A;  3QJP A;  2RKI B;  2AJ0 A;  2IVM A;  3VWS A;  3EX7 B;  3BJY A;  3RW7 A;  2IM3 A;  1XMQ F;  4PCQ A;  4E2F B;  3UO0 A;  4YB7 A;  2NQP A;  4RW6 A;  3H98 A;  1MRO A;  3HI9 A;  2BZ2 A;  4RW9 B;  4Y34 A;  2CYY A;  2AEF A;  5LMN J;  3TQE A;  2L41 A;  2JVO A;  3EYZ A;  4AQY F;  3RB6 A;  1REG X;  3MED A;  1R31 A;  3H59 A;  4ZPV R;  3KLF B;  5CYQ B;  3D66 A;  4DR4 J;  4U8Y A;  4GVL A;  1UPP A;  5I3U B;  1FJG F;  3S7R A;  1VC5 A;  2F8E X;  2H4Y B;  2XMU A;  4RR5 A;  3LGM A;  5HMY A;  1CEZ A;  2J0Q D;  2EC2 A;  2BM1 A;  4N7T A;  1L3T A;  1MML A;  1ZAW A;  4F7V A;  4WJB A;  2ZM6 J;  3Q8Q B;  1JLB A;  5THW A;  3MUR P;  1F0X A;  2A18 A;  1R6Y A;  3OFH A;  5HBM B;  4M94 A;  3E2E A;  2AJQ A;  2FJA B;  2VHG A;  3F41 A;  1VC6 A;  4N47 A;  4RW6 B;  4OYP A;  2KFY A;  2HNY B;  4O44 B;  2VA2 A;  1VBY A;  5D3G A;  1GX5 A;  1PG5 B;  1OSC A;  3KJN B;  5A8W A;  2CQ0 A;  2DPJ A;  3OL7 A;  4ECQ A;  2H9Z A;  2HZC A;  2Z57 B;  4ID8 A;  4C4W A;  2KB2 A;  3IO1 A;  2HS4 A;  1SQG A;  4USJ C;  2MKI A;  4OI2 A;  1KWM A;  2COL A;  2Z4P A;  1IUJ A;  4F4X A;  4P74 A;  2XWY A;  4CH0 S;  1U1K A;  2HVZ A;  1IXK A;  1DY3 A;  2DIS A;  3LPY A;  5KFE A;  2WK4 A;  4DV7 F;  2WHO A;  3HCX A;  4A4J A;  4J90 A;  1IWG A;  4IUF A;  2M7S A;  2QG9 B;  5C2C A;  4CQ1 A;  2HBZ B;  1JNR B;  4OX9 F;  3I9Z A;  4RPF A;  2V69 A;  4I2P A;  4NLQ A;  5L1L A;  3HJV A;  1MW7 A;  2EKY A;  4JI1 F;  1JLC B;  4UZB A;  4JUZ A;  1C1B B;  3QAT A;  3CUL A;  1WI6 A;  4LF2 A;  3RAX A;  4DFP A;  2VPW B;  5J2M A;  1U49 A;  3SQO P;  4IOB A;  3WIU A;  3U1M A;  1X4C A;  3T3F A;  3CIM A;  3K2Y A;  3UFC X;  4QIV A;  4M5I A;  2NSC A;  3G4S S;  1IKW A;  2HVE A;  3SV4 A;  4YY3 F;  2OIH A;  2YNI B;  4BWJ A;  1TKZ A;  4U7C A;  2HBY B;  4D3H A;  2BQR A;  5F8L A;  3T1H F;  3DGP A;  3WIV A;  2M2B A;  2DNM A;  1QSL A;  2IAJ B;  1GTE A;  1JLQ B;  4F3Q A;  5C42 B;  4X4S A;  3I5C A;  2WB1 D;  5ETS A;  5LMU F;  4P10 A;  2RU9 A;  1AA1 B;  1Z2L A;  1KOH A;  3HZE A;  3KK1 B;  3BR9 A;  4KFB A;  2XS2 A;  1CQN A;  3CCU S;  4LFA J;  4DQI A;  4XDD A;  1WHV A;  2L9N A;  4UUW A;  5KFP A;  2YX4 A;  4QU7 A;  2BRK A;  3HHL C;  4LFB F;  2JFD A;  4WTY A;  5EX3 A;  3ZXW A;  4O3S A;  5MLC V;  1FXD A;  2JLE A;  4WFZ A;  1K9M T;  1QAJ A;  2M4M A;  2QFJ A;  3CJ5 A;  2KT3 A;  1ELO A;  1OY6 A;  4I6A A;  2R7Q A;  4LVO P;  5ETP A;  5FDL B;  1HYS B;  4HHH A;  3M2V A;  1IQT A;  1YQH A;  3ADA C;  3TEH B;  5DZ7 A;  2VPZ B;  3C6U A;  3NNA A;  2R8I A;  3KNA A;  3A12 A;  4L75 A;  2HRU A;  5J2N B;  2NUH A;  3MM9 B;  3UI3 A;  1VQS A;  1SJR A;  1GEH A;  2XO6 A;  2KRR A;  2F63 A;  1R43 A;  1RT4 A;  1Q7Y T;  5DQG A;  1P8G A;  2C22 A;  2DD8 S;  2MQN A;  5IQQ A;  4YDD B;  2K7K A;  3EPG A;  5DDO C;  1VHF A;  3LAK A;  4WII A;  2CZV C;  3GJT B;  2HBR B;  4Q43 A;  1QTM A;  3CJ3 A;  4FKY A;  1RT1 A;  3OFE A;  5B0G A;  2OEM A;  4EUV A;  2HQI A;  1DLO A;  4DSE A;  3PKM A;  2XY6 A;  5A8R A;  1FO1 A;  1LXJ A;  3TO8 A;  4NCG A;  4RNN A;  3G8T A;  3R8Y A;  2AQ4 A;  2HZV A;  2OTL S;  3QRR A;  3HMJ G;  3NY0 A;  5T7L B;  4NA3 A;  3R5A A;  2G2Z A;  1IR1 A;  2ZHA A;  1S72 S;  2PMW A;  4HKQ A;  5IT9 U;  1XMO J;  1MSW D;  2K8G A;  3DM2 B;  4OQJ A;  4MIB A;  2MZ1 A;  4W4M A;  1FJE B;  2A1B A;  1UAW A;  1M0S A;  4RX6 A;  3EVM A;  4U7U D;  1XN9 A;  3G6V A;  3ZTO A;  1FF2 A;  4ZHR B;  4C8L A;  4NAS A;  1N6Q B;  3FDS A;  1PCA A;  3D2W A;  3GJR B;  2XHW A;  4OZ2 A;  2DNQ A;  2FY1 A;  2OJ3 A;  4IFY A;  2MZR A;  4ZPB A;  5KFN A;  4ED2 A;  1DLO B;  2W24 A;  1J2V A;  1PYS B;  3NGD A;  3RB4 A;  3HVT B;  3MEE A;  1H72 C;  1I3O B;  2Z8Q A;  4O4G A;  5EHH A;  5I3Q A;  2FLL A;  4QU6 A;  3PRB A;  2MDA A;  2NPF A;  2LXF A;  1JJH A;  2MPU A;  2YWG A;  1VJQ A;  1YZ7 A;  2IM1 A;  2FZK B;  5LSL A;  5M2P A;  4HT7 A;  4DMZ A;  1UCN A;  4CLF A;  3I9V 9;  4K2J A;  1ZBT A;  2E5H A;  1W7W A;  2GQ2 A;  2BVZ A;  1Y11 A;  4G1P A;  3N28 A;  3QYY A;  4MMO A;  3VGT A;  2DRD A;  2MKJ A;  3ZFV A;  1S48 A;  3C15 A;  2DVI A;  1UVI A;  1TL1 B;  4K0K F;  2KXN B;  2SXL A;  4IDK B;  4B3T F;  1L3K A;  1HR0 F;  3U1L A;  2IMW P;  4UQT A;  1LWE A;  3DMJ A;  5GAG U;  2IJN A;  1LNQ A;  1RJJ A;  4TU8 A;  1REV B;  3PVX A;  4NWB A;  4ZCI A;  5IXU A;  1ZET A;  3QWU A;  3NCQ A;  4DV4 F;  3MUM P;  2MKH A;  5GAD U;  2WOM B;  2UVW A;  3GJQ B;  3TZW A;  1N5Y A;  1PYT A;  2ZWP A;  3MM6 B;  3G6X A;  1WAC A;  2HNY A;  2MJU A;  2Y3Y A;  2BAN B;  3M1V A;  3R97 A;  5C42 A;  5KG2 A;  3G6E S;  3Q0A A;  4O3P A;  4QYZ J;  2HAF A;  2AKW B;  4USI A;  4OI0 A;  1WC6 A;  3JSM A;  2PE8 A;  3T5J A;  3D1O A;  3GV5 B;  2CFX A;  2ZUG A;  1CJV A;  4F4W A;  4EWT A;  1HQE A;  3QZ8 A;  2CNL B;  2RDJ A;  2FJW A;  3SCK E;  3PFO A;  1CJU A;  1U09 A;  3C15 B;  2FIU A;  1WF1 A;  1N0U A;  2PC6 A;  4ZVS B;  5HMZ A;  1YJV A;  3CD0 A;  3OQ2 A;  4PPD A;  3CCM S;  4ZDN A;  2J76 E;  3K5P A;  3KJV B;  3VZI A;  2B5J B;  4JI2 F;  1B70 B;  4ZVT B;  2XY7 A;  2C2E A;  1N88 A;  4I68 A;  1JLF B;  1IBC B;  4J9U E;  3JAM U;  1PC4 A;  3QGG A;  1DZ5 A;  3D0H E;  2VFS A;  1S7H A;  4URG A;  1S1X A;  2HFV A;  5BXI A;  1OIA A;  1LW0 A;  4OYM A;  2Z2M A;  4DL5 A;  1VGY A;  1G2E A;  1VR6 A;  3JAM Y;  3LP2 B;  4ICL A;  4JYA J;  4PPZ A;  1KVK A;  2GA7 A;  3O44 A;  3W9J A;  5KFU A;  5A2Q U;  2VC1 A;  3GU0 A;  4PKD B;  3BDE A;  5JXS A;  2BE7 D;  3PAC A;  4ZJO A;  3TAM A;  3QRP A;  4MKV A;  2HZA A;  5AXL A;  1M5S A;  3KLI B;  4DEZ A;  1NB2 A;  3DLK B;  1YGY A;  2RUG A;  2QZ8 A;  4C3K A;  1TMJ A;  3OHA A;  2BE2 A;  1YHQ S;  1NKE A;  3SFU A;  1PBU A;  4J7C A;  3QQC D;  3OFF A;  2C2R A;  4O3N A;  4F4K A;  4JYA F;  5L9X A;  1FHT A;  5CYM A;  1VBK A;  2C3O A;  4XDC A;  4OHY A;  5H9E K;  2OLW A;  1CC8 A;  1C1C B;  3DRS A;  1XTZ A;  3J7Y U;  3KK1 A;  1RB0 A;  4OJG A;  4ZS6 A;  5HMX A;  4N77 A;  1KQG B;  3GMG A;  2DO4 A;  2LP4 A;  1HLW A;  2VKZ G;  3ZTR A;  4JI2 J;  4LFC J;  3QAU A;  4A48 A;  3J7Z 5;  1BWV A;  3KLE A;  5F8J A;  1FEH A;  1LW2 B;  2NXN A;  3EIC A;  3OTO J;  3GIL A;  1N33 F;  3TW0 A;  1LWF B;  4G6V B;  4DSJ A;  4OYO A;  1NH8 A;  2CDQ A;  4KV8 B;  4NLG A;  1Q1K A;  2CZ9 A;  3ZZR A;  4BC7 A;  1LXN A;  1ZPW X;  2VG6 A;  3SDE B;  2ZH9 A;  1YJ9 S;  3TAQ A;  2M8D B;  2OEL A;  3B54 A;  4PYD A;  2UP1 A;  1FFS B;  5C24 B;  5CYM B;  2LEC A;  4C7Q A;  4C8Y A;  1NND A;  2L08 A;  2YQ0 A;  2W4P A;  2ACM A;  2WVB A;  2EBE A;  5HRO A;  2UXC F;  4C0O C;  3N9U C;  3HSZ A;  2YX7 A;  1RAI B;  1BUX A;  1CUL A;  2W4C A;  3I6P A;  1WF0 A;  4P52 A;  1Y7P A;  3W5Y A;  3KWM A;  1HI8 A;  3BO3 A;  1HNX F;  3GYN A;  4M5G A;  4F3O A;  1P6T A;  4YR0 A;  3R1H A;  4IDK A;  2KDO A;  1SUQ A;  1FK9 B;  3PYD A;  2M70 A;  1ITP A;  3V6K A;  4DUZ J;  3W5X A;  2HK2 A;  2BOA A;  2MST A;  3G82 A;  3K8W A;  2PA3 A;  2DNL A;  3MOZ A;  1OYD A;  3QNW B;  3QO9 B;  1NLK L;  1LOU A;  2VFT A;  3SYZ A;  5KFF A;  4NRU A;  2W1B A;  3BRE A;  2XG8 A;  1RBL A;  4CLZ A;  4LBI A;  5A8K A;  4RUC A;  1DTT B;  4ALZ A;  2O1P A;  3GR0 A;  4L74 A;  2RQC A;  2MXY A;  2AGP A;  2DGX A;  6FDR A;  1RT6 A;  1JQG A;  3E3X A;  1Q81 T;  4Y2K A;  4DQQ A;  1Y5N B;  1ZYQ A;  3TUJ C;  3BS9 A;  3GV8 B;  4LF7 J;  5MAO A;  1MMN A;  3GFH A;  1ZH5 A;  1S1V A;  5F8I A;  5D0G A;  2GJ2 A;  3KHR A;  4ECU A;  5IS2 A;  3JYT B;  2ROE A;  2FQQ B;  2ZOG A;  2CKW A;  3HP6 A;  4CWB A;  2B5J A;  2VIC A;  1WWH A;  1YG0 A;  3KG0 A;  3MEG B;  4I56 A;  1FRM A;  3NNC A;  3RR7 A;  4B08 A;  4JV5 F;  3SZ2 A;  3MM8 A;  1YJ7 A;  4DI6 A;  4QIE A;  4M5L A;  3TJ9 A;  3WC0 A;  4X66 F;  3Q8Y A;  3LAL A;  2VOD A;  4WP9 A;  1HA1 A;  1VQ5 S;  3QLH A;  2PMZ D;  1JLG A;  1TL4 A;  3BEG B;  1SL1 A;  1FDB A;  4HI2 A;  3H8Y A;  4R5P A;  2D74 B;  3NCR A;  5F3Z A;  2QA4 S;  3MUV P;  3M8Q A;  3VAK A;  3R3T A;  3MWB A;  2HRY A;  4ZOS A;  3EVW A;  1RT7 A;  3UDC A;  4TYA A;  1XER A;  3UD3 P;  3U1N A;  1GXT A;  3NMR A;  1X0P A;  2J9D A;  3J7Z T;  1WEZ A;  1N54 B;  3CW2 C;  3DOK A;  4ZVF A;  4AFF A;  2ZKU A;  1VLY A;  5F8H A;  2KYX A;  4UOG A;  4J9P A;  4ED3 A;  4P73 A;  5HP1 A;  2UXD J;  2KZZ A;  5H9F K;  4B3M F;  3LQV A;  5I4M A;  4DR5 J;  2DNZ A;  2GIQ A;  2KVQ E;  3MM5 B;  5ETM A;  1HBN A;  1TFW A;  4HEA 9;  5KFG A;  4FXW A;  4ETZ A;  1KSP A;  2VL1 A;  1FDD A;  3HPO A;  1SC3 B;  2XNQ A;  4DPW A;  3HT0 A;  3GIM A;  4DS4 A;  2HAI A;  3MGJ A;  5CYJ A;  3MF5 A;  1KVJ A;  1H38 A;  3GCX P;  3IWL A;  3QGI A;  1ZAV A;  2DYA A;  4FVM A;  4DV1 J;  4RNF A;  1Y4Z B;  2H48 B;  2ZJQ Q;  2DXD A;  1SIW B;  1QVF R;  2QL9 B;  1ROF A;  3PW4 A;  1HWU A;  1NCL A;  2GC8 A;  1T05 A;  2H4W B;  1PKU A;  2J0S D;  3NAI A;  4QWD A;  1JXL A;  4RU9 A;  5AXM A;  2IY5 B;  1A0O B;  5B0A A;  3TAM B;  1QAI A;  4OFZ A;  2ZH8 A;  4X4N A;  1PAU B;  2UUT A;  4A46 A;  2CWK A;  2VOP A;  2E7W A;  2ZE2 A;  2ZHO A;  3NGU A;  3AOB A;  4ZP6 A;  3HHL A;  5CHC B;  4K50 A;  2ZH4 A;  3DDI A;  4CO2 A;  5AE2 A;  2DHS A;  4NLY A;  2EFP A;  3KUE A;  1K47 A;  2V9W A;  1WI8 A;  2FHK A;  5J1E B;  3FEY B;  4O0I A;  5E5N A;  5KFD A;  2ATL A;  3GR1 A;  1YI2 S;  2BM0 A;  4V1A k;  4DPU A;  4YP3 A;  4OMF G;  4MJK A;  2DRB A;  1X0F A;  3FSX A;  4KGZ B;  1OMS A;  4I6W A;  2HHU A;  1S1T B;  4LSL A;  1KHW A;  1FFG B;  4ZVE A;  1VRT A;  2DGU A;  5IFM A;  1NK6 A;  2ZH2 A;  2I1R A;  5E0O A;  1GFW B;  3C2P A;  2C3U A;  3POT B;  3LWM A;  3R2C J;  1Y00 A;  3D6T B;  2F4V J;  1HBU B;  4BC9 A;  1X5S A;  2X1B A;  3AA8 A;  1UEK A;  2CQB A;  1I6J A;  3MR5 A;  1UA0 A;  4KC5 A;  3HHD A;  2O66 A;  3A8E A;  3QIP A;  3HFV A;  4JP8 A;  3NL0 A;  4QWC A;  2JH3 A;  3OXL A;  4ANE A;  1UW9 A;  3G71 S;  3T1A A;  2IHR 1;  4TYB A;  1T8E A;  3M32 B;  3LH2 S;  3MCM A;  2RF2 B;  2YY3 A;  2AHO B;  3SV3 A;  1NO8 A;  2GGP B;  3Q8U A;  4JI3 J;  3RUB L;  2MGZ B;  4P72 A;  2XEX A;  1SKR A;  5KFI A;  4V19 J;  3BGU A;  4U7U K;  2H65 B;  2HGL A;  4YDX A;  2MSS A;  1U1Q A;  2ASD A;  3NWR A;  4QPT A;  1TUW A;  5GME A;  4NCA A;  2FJD B;  4KPC A;  3X3U A;  4DLE A;  4R0E A;  4GVB B;  4NMX A;  2A2C A;  5ETO A;  5HQM A;  2QJ3 A;  3CJK A;  1WC4 A;  2XQC A;  3H5S A;  4XAK A;  5D78 A;  2B6A B;  3CIZ A;  4OZ3 A;  4R5P B;  2DCU B;  2DKO B;  2RH3 A;  2YPY A;  2DCL A;  4DF8 A;  3PY8 A;  3EGV A;  2DO0 A;  4C97 A;  5C2G A;  1KON A;  4DV5 J;  1UFL A;  1NJI T;  2KHD A;  4HT5 A;  5ETL A;  1URR A;  1X60 A;  2HFZ A;  5E3Q A;  2F3J A;  4RNO A;  2PII A;  1QAX A;  1ZAX A;  4FDF A;  3FCH A;  3UQS A;  5LMN F;  4MK7 A;  2VKR A;  4ECS A;  5J2N A;  1X4B A;  1RBO B;  2QSW A;  2IM2 A;  3Q8P B;  3O5T B;  4NX9 A;  1IJF B;  2KJV A;  4ZIW A;  5FII A;  2XBP A;  3V81 A;  4HAC A;  4OYX A;  2FLP A;  1TU0 B;  2DNG A;  2C42 A;  3GQC A;  1U0H A;  1CJV B;  4K4T A;  3CDA A;  1R8P A;  3MR7 A;  1BMQ B;  3CJK B;  1M90 T;  2BAC A;  3VVT A;  3G86 A;  1Z1Z A;  4KBI A;  1HWI A;  2NYH A;  1RWO B;  2RUS A;  3BM7 A;  3MD3 A;  4OV1 A;  5FJ4 A;  1TK5 A;  1WKJ A;  1F9H A;  1CQM A;  2F1F A;  4CRJ A;  2XMA A;  2CPE A;  3TWZ A;  1JLE B;  5KOW A;  2Y1J A;  4PXB A;  2HFS A;  3QLH B;  1EP4 A;  2C2D A;  5IT9 Y;  2IAJ A;  2YWE A;  4M5K A;  3R7N B;  1X4F A;  2ACY A;  5L1J A;  3IS9 A;  3W2V B;  3KLG B;  4X84 A;  1Q4R A;  1NK9 A;  1U1P A;  2OMO A;  1R0A B;  5KG4 A;  4NLW A;  4CNZ A;  4AXJ A;  1BC6 A;  1DTQ B;  1QM9 A;  3CF5 Q;  3CCZ A;  2NXE A;  3M9N B;  2MB0 B;  2VIH A;  3AD7 C;  2QL7 B;  2LFV A;  4CH7 A;  2OI2 A;  3Q22 A;  1RWW B;  2OPS A;  4DL6 A;  1RZM A;  2C28 A;  2EXU A;  2W7P A;  3J7A N;  5F0W A;  4ZVP B;  5DQH A;  2OFH X;  2WCX A;  4ER8 A;  2KT2 A;  5HP1 B;  2Q43 A;  3EVO A;  2LQJ A;  1JXV A;  5LT5 A;  1DAR A;  3TRG A;  3AJD A;  1FKP A;  1S57 A;  2FC9 A;  1RTH A;  1VS3 A;  3N5B A;  2MMY A;  3H2L A;  3ISN D;  4OYZ A;  4ZIT A;  5H9F J;  3UW1 A;  4CCH A;  1RWM B;  4OZ1 A;  4GKK J;  3UVJ A;  3C8Y A;  2YNH A;  4CI0 B;  2HHW A;  1T7P A;  1M1H A;  1SC4 B;  1LWF A;  1U4B A;  4LRD A;  2R7O A;  3SQG B;  2XLK A;  1K0V A;  3W1Y C;  3MM7 B;  3C16 A;  1J27 A;  3EZ5 A;  3DRY A;  2ALY B;  1H0H B;  1WD6 A;  2BKO A;  2V50 A;  5B7W A;  1YIT S;  1HWK A;  1X8D A;  2YNG A;  4QQB A;  2IDE A;  4WYL A;  2X3D A;  1FCA A;  1JNZ B;  2J9C A;  5A8R B;  2N82 B;  4WFA Q;  5RUB A;  1PIE A;  3K59 A;  3ITH B;  1BQM A;  3I0S B;  4OLP A;  4PG7 A;  4DPO A;  1R0B G;  2RQ4 A;  5LSO A;  5J2Q A;  5J1P A;  1KC8 T;  4B9N A;  5HRO B;  1ZOT A;  3JQJ A;  4NE9 C;  3L3C A;  1VCT A;  1WOR A;  2ASY A;  1I94 J;  4JI5 J;  2V8H A;  3IG1 A;  4C8K A;  2ROG A;  3CT9 A;  4AD6 A;  1NB7 A;  4LSN B;  4P2F A;  3QSI A;  3UD5 A;  2GIF A;  5AJ3 J;  5C25 B;  4N76 A;  2QMX A;  2MJN A;  1P9Y A;  1BD6 A;  1NSA A;  6FD1 A;  5KFO A;  5GAD I;  3IC1 A;  4U6P A;  1VK3 A;  2JHE A;  1EKS A;  3MAQ A;  3J7A 1;  4USU A;  1YZ6 A;  3M2U B;  4M95 A;  4RO0 A;  2V5H G;  3KG1 A;  4DX6 A;  2W8K A;  4F4Y A;  2GMH A;  2XSF A;  2ZWO A;  4NLD A;  5HVH A;  3HVT A;  2JFK A;  1FD8 A;  3MEE B;  4N56 A;  3W5Z A;  2XNR A;  1Q8K A;  4MIA A;  4DN9 A;  4RW8 A;  2IBO A;  4FYW B;  1BQM B;  4YME A;  2ZHB A;  1U47 A;  4IG0 B;  3CJQ A;  3UDE A;  4X4U A;  1JLA B;  3BGR A;  1FFW B;  1SH0 A;  1F3V A;  4WKR A;  3W66 A;  1X4A A;  5JJB A;  3K58 A;  2PO4 A;  4DUT A;  1JIH A;  1P1L A;  5SUH A;  1XMB A;  3M6X A;  4GMK A;  4XPC A;  2ZJP Q;  4AL7 A;  2GHW A;  1K1S A;  5C25 A;  3FKB A;  2VJV A;  1LQ9 A;  3MI7 X;  3SFG A;  3FBF A;  2Q79 A;  4RW4 A;  2JSX A;  4DFJ A;  1RCX B;  2KI2 A;  2OPR A;  3P3D A;  3Q2T C;  5HVF A;  4ZLL A;  3TVY A;  3M9O B;  1QUV A;  1RXO B;  3P5B P;  2OPP B;  3NGK A;  1CBK A;  3C19 A;  4UZC A;  3MEG A;  2H5I B;  2GAH C;  4EBE A;  2M52 A;  3G8Q A;  2MHE A;  3MM6 A;  1TUG B;  3U27 A;  2C2N A;  2E1P A;  4M8L A;  2FGO A;  3MM9 A;  2G2O A;  1RQ0 A;  5E3R A;  5E3A A;  2JEG A;  1A9N B;  1EIY B;  1E6Y B;  3LAN A;  4OX8 A;  2APO A;  2G1H A;  1YVF A;  4KQZ A;  4G1Q A;  4DDF A;  3PX4 A;  4RBT A;  1FJG J;  5HI7 A;  4DCP B;  3BSO A;  2IVF B;  1F5A A;  4EO8 A;  3FZ2 A;  2G4B A;  2X3G A;  4OYA A;  1YJN S;  1HHT P;  2YKA A;  4WF9 Q;  2BRL A;  1RAE B;  4DF4 A;  2A6O A;  4AT1 B;  2VU5 A;  1UMJ A;  2E1R A;  1XMQ J;  4HR2 A;  3JTO A;  2AF6 A;  5I3P A;  2VQE F;  5BJR A;  5AT1 B;  3GYG A;  1RTJ B;  2AEJ A;  3R5B A;  3SSS A;  4DXL A;  4FXV A;  3RBE A;  4PUO B;  3R1L A;  1Z2Z A;  1UEV A;  2E66 A;  2VZ9 A;  3ICL A;  2NZC A;  2JWN A;  2D1C A;  2K3I A;  1TEL A;  1RHM B;  3CO0 P;  4I67 A;  3DDN A;  2FHM A;  2UV8 A;  1HBM B;  1E6Y A;  3NG8 A;  4J9S A;  4ECY A;  1VQ4 S;  3G9C A;  2HMI B;  1SJ3 P;  3WQP A;  4DV1 F;  2BXJ A;  4OYB A;  4J37 A;  1RAD B;  4A8Q A;  1VRU A;  2XMT A;  3PNI A;  4TQR A;  2BE9 B;  1U8W A;  2VJU A;  3QFH A;  1ZM3 A;  5B08 A;  4X2B A;  1S6P A;  1RTZ A;  1H2U X;  2R9L A;  3SSQ A;  4M5H A;  4IFV A;  1MMD A;  4B3R F;  2W2P P;  5G4D A;  1TL7 A;  4OZN A;  3CMA S;  2PFD A;  2PI5 A;  2B56 A;  3R6L B;  2RE1 A;  4J91 A;  3R7S B;  3GTY X;  3V6J A;  1HMV A;  1IM4 A;  4OI4 A;  1KNZ A;  2CZ4 A;  1L3V A;  5DET A;  1HNW J;  2C1E B;  1EQM A;  2CJA A;  2KN4 A;  4TY9 A;  4FN5 A;  3UNY A;  3I4H X;  5HVG A;  5KTQ A;  2OO4 A;  2KFZ A;  4DPY A;  3D28 A;  2WON A;  1G6B A;  4AYB D;  3PZP A;  1Q53 A;  4NI2 B;  2ALZ A;  1FKA F;  1IR0 A;  4F04 B;  2P2C B;  2XMK A;  3H2V E;  1APS A;  3P8B B;  2QMU B;  2ASJ A;  3KDN A;  1AT1 B;  2B4U A;  4LBH A;  2LQ8 A;  3MMC A;  3MR3 A;  3I0R B;  1RWV B;  2GQQ A;  1NH7 A;  3IM8 A;  4K4Z A;  2XY5 A;  5EWF A;  3OVA A;  2KO1 A;  1HW9 A;  4NLR A;  2W7O A;  4TKT A;  3K5L A;  4DR2 F;  1KFS A;  1GH8 A;  1SIZ A;  5K14 B;  3GON A;  2BJE A;  3TUP A;  3DC2 A;  1VIX A;  3HZG A;  1IM6 A;  5GVQ A;  2P5V A;  4QIG A;  4WFX A;  3RU0 A;  3KMS A;  1OY9 A;  3M6W A;  4RLE A;  5DG7 A;  5CD4 H;  5E3P A;  3OSN A;  2R2R A;  5DM7 Q;  4WFY A;  4J9K A;  4J9O A;  4OV6 A;  1HD1 A;  2QLF B;  1N5S A;  2RRN A;  4DQR A;  1C4A A;  1LK7 A;  5ETR A;  1M5K C;  2KVI A;  5KT7 A;  3FZB A;  1X4G A;  3GLJ A;  4I69 A;  1FXR A;  1VOM A;  2GNK A;  2W4D A;  2KXF A;  3CDE A;  1BHN A;  5EWE A;  3CJT A;  3G6Y A;  3MPW A;  5KT6 A;  3LP0 B;  1N0V C;  2C3P A;  4P2M A;  4CP5 A;  3LP1 A;  1SJF A;  3MAA B;  3AB4 B;  3CJR A;  1NDL A;  4IO9 Q;  3THV A;  1MWY A;  3NS7 B;  2I8E A;  1UVK A;  4H4O A;  3UDV A;  2RT3 A;  4DQP A;  3WX8 A;  1FA0 A;  2CRL A;  2YNF A;  1ARO P;  3TA2 A;  4CM0 A;  1S10 A;  1Y9O A;  3G87 A;  4EYH B;  1AUD A;  5AE3 A;  1UZD A;  4DUZ F;  2E1C A;  3AOD A;  2HLT A;  2V8P A;  3VAL A;  5L9N A;  2E7V A;  4ZN3 A;  4I7F A;  4Y2C A;  4MTP A;  2XZW A;  2ASL A;  1GMW A;  2X7I A;  1AZS A;  3S01 A;  2RNE A;  4WK3 A;  2KG0 A;  4ID5 B;  2HQG A;  2ZIT A;  5LOQ A;  1RAJ A;  1RHQ B;  4N5S A;  1B7F A;  3RBX A;  5K8O A;  5EGY A;  2ZDO A;  4PXC A;  1M1K T;  1PC5 A;  2VDH A;  2PN6 A;  3KHH A;  3HSJ A;  4CLL A;  2HHV A;  2BAB A;  1S9G A;  3GB0 A;  3LP0 A;  2ILZ A;  5KG3 A;  3L9Z A;  2P9G A;  3U7J A;  3M05 A;  5HO4 A;  3PR5 B;  5CYQ A;  3F56 A;  1CJU B;  2VG7 A;  2QYG A;  3V2U C;  2MTL A;  4QW9 A;  2Y1R I;  1EET A;  4DV0 F;  1Y5L B;  3QZ7 A;  3MDF A;  3TEG A;  4M5D B;  4DU8 A;  2DGQ A;  3UCU P;  4HHU A;  5L46 A;  1KRP A;  2W2N P;  2Z58 B;  2V4Q A;  1GX6 A;  1SKS A;  1WNE A;  2PEB A;  4ZVR B;  4DV4 J;  2KL8 A;  1KVI A;  2F8H A;  3TNV A;  4D3G A;  3B4D A;  2W9B A;  2J6S A;  1BLU A;  3EJM A;  3OR1 A;  1S6U A;  4TY8 B;  5IV3 A;  3DRR A;  2O5D A;  3N5F A;  2G9O A;  1Q86 T;  1VJW A;  1LEO A;  3T41 A;  3LW5 C;  3W61 A;  3VGV A;  2DXE A;  1YIJ S;  3IGN A;  4Y28 C;  5DDR C;  2E9R X;  3J80 U;  2WBM A;  4PXD A;  1RAB B;  1B0T A;  2CQ1 A;  2IRX A;  4BWM A;  5E41 A;  2P6T A;  4Q7A A;  1N34 F;  2GW8 A;  2H51 B;  4DV2 J;  3UR0 A;  4IOC Q;  1N8R T;  4X64 F;  3DLE B;  4DL0 C;  5EWG A;  2EPI A;  1Q82 T;  1H7X A;  5K9F A;  3I55 S;  4ILR A;  3HHL D;  4RW9 A;  3OLB A;  3JSB A;  3K8V A;  3FBC A;  3VCD A;  3IM9 A;  4R0J A;  4DSI A;  4PAA A;  1T9U A;  2YH0 A;  1RBA A;  1TK8 A;  2VF3 A;  1DFD A;  4CLP A;  2JL9 A;  3QGH A;  1GAO A;  4TXS A;  3ZC4 A;  3PW2 A;  4QR0 A;  3DOM A;  2B7C B;  4MYU A;  3C6T B;  1TAQ A;  3CCW A;  2WRM A;  4KV8 A;  3HT3 A;  5J2P A;  2QE5 A;  3ENV A;  3PIP Q;  5LXY A;  3RZA A;  1F2H A;  1YBA A;  4IG3 A;  1KQK A;  3HVA A;  3OTE A;  1FKO B;  4C11 A;  1S1V B;  3NLC A;  5IQ6 A;  3AD8 C;  4CYU A;  2CJ9 A;  3PX0 A;  2CPY A;  2YNI A;  2BJ7 A;  3KK3 B;  3DLE A;  2QSF A;  4P2S A;  1NJX A;  1U02 A;  4F2S A;  3NS6 A;  1U1O A;  3NP5 A;  3N6L A;  2WVF A;  3E01 A;  4F4A A;  4ZPW R;  3MM8 B;  1SBR A;  2QTW A;  4MFB B;  3FCW A;  2V34 A;  4O0N A;  4JI6 J;  1VBZ A;  2NSB A;  2Z56 B;  4KGM A;  4Q0B A;  3OTD A;  5GAG I;  2BW2 A;  2DNP A;  1I51 B;  1ZS6 A;  3FMB A;  2AYM A;  3AQO A;  3MEK A;  2R7T A;  1U2F A;  1ACM B;  3N6N A;  3D6H B;  4KTQ A;  3IFE A;  3BBB A;  3QJL A;  4LRE A;  2AX0 A;  2B9Y A;  2YKO A;  1NEE A;  1L5U A;  5GAH I;  2BJD A;  3AOC A;  3X1L B;  2IJR A;  1CJT B;  3U02 A;  1HR0 J;  3EGZ A;  2CG8 A;  3K89 A;  4QR1 A;  2D69 A;  2MZQ A;  3QWP A;  4DU7 A;  1DTT A;  3ETM A;  2R3V A;  2UVR A;  3H90 A;  4NCB A;  2KH9 A;  2AZ1 A;  3TP2 A;  3W60 A;  5D4O A;  2DK2 A;  2R7W A;  1WKK A;  1RCO B;  3GIJ A;  3QFW A;  2JEF A;  1TFY A;  2KTQ A;  3PEJ A;  2N7C A;  3J81 Y;  1U7L A;  4FYX B;  9ATC B;  2VQE J;  2Z2Y B;  4KAI A;  1VQK S;  3JS9 A;  3NOC A;  3VQT A;  2UUC J;  2D3O 1;  3OL9 A;  3VTI A;  4AL6 A;  1VRQ C;  4F0K A;  1IWA A;  4C98 A;  1RWN B;  2CXE A;  1XC9 A;  2AP6 A;  2DH7 A;  3FCV A;  3Q86 A;  2M88 A;  2ZOF A;  2ZZM A;  4K4W A;  4YQW A;  2XM3 A;  1TKZ B;  5KFC A;  4DR7 F;  2VH7 A;  4F25 A;  4A8F A;  2FDN A;  4CO3 A;  4IQM A;  4TY8 A;  2QLJ B;  2RML A;  2CPJ A;  2YKN B;  3I87 A;  4NYP A;  2PGC A;  2WSE C;  3PEH A;  4H4K C;  4UW2 A;  4LJM A;  2Z30 B;  3V4M A;  4DUY J;  3HX9 A;  4U96 A;  2D7S A;  1FWK A;  2VG6 B;  4KGX B;  4L3N A;  3SDE A;  4LF8 J;  1IKY B;  1TP7 A;  1AZS B;  3HHL B;  2CPF A;  3DLK A;  4ED6 A;  1Q5Y A;  3K7R A;  3PG9 A;  5C24 A;  3J7Y I;  2B4O A;  1R8C A;  3LA0 A;  1JK9 B;  1O0P A;  1YBU A;  1M5V C;  3MMB B;  3O8W A;  3Q8S B;  2HWI A;  1CS4 B;  3R27 A;  5KFH A;  4NLP A;  3DYA B;  3MUT P;  3EWG A;  5F0U A;  3DRS B;  4ZP7 A;  5K5M A;  5J2Q B;  3QPI A;  3I96 A;  3BO4 A;  4NEY A;  4ZPT R;  2D3O R;  3L7U A;  4B02 A;  2R42 A;  3OV7 A;  3IG1 B;  2EC0 A;  2HSE B;  4ELU A;  1FK9 A;  1FVS A;  5A8W B;  3M30 B;  3OVB A;  5J2P B;  1T9Y A;  3QO9 A;  1WEL A;  3ZZU A;  2NXU A;  4UTG A;  4F36 A;  5HLF A;  3CTR A;  4NLU A;  2HVD A;  2KT5 A;  5T7L A;  3PIO Q;  3TAR A;  4RU2 A;  1X4E A;  1IBM F;  1S0V A;  1S99 A;  3O1L A;  1U6F A;  4USK A;  2K3K A;  2ZFH A;  3HFZ B;  2HLU A;  2HQD A;  4DHV A;  2H54 B;  2AZ3 A;  1U1M A;  2EBG A;  4JOU A;  4CLW A;  1F3F A;  2CQ4 A;  4C0H A;  3I31 A;  2HVI A;  4NLX A;  3RAM A;  2J8A A;  4F2R A;  1T9V A;  2VFR A;  4JI5 F;  4NRT A;  1RHU B;  4GO7 X;  4RBU A;  2UZA A;  4CH1 A;  1HNI B;  2VPX B;  3W64 A;  4URS A;  4PYA A;  1D3W A;  3SSR A;  4KH0 B;  1JJC B;  3D6M B;  2JOQ A;  1XK8 A;  1UVN A;  4DX8 H;  3EDQ B;  3M7V A;  4DCO B;  2CVI A;  4ECV A;  4RW4 B;  1SI9 A;  4ZP8 A;  4X4T A;  2BJ9 A;  3NOG A;  3MR2 A;  4ED1 A;  2QA1 A;  1D9A A;  4DSK A;  7FDR A;  1B4S A;  1CJT A;  1M5H A;  3OW2 R;  3G82 B;  2Q1L A;  1TKD A;  1F60 B;  1S12 A;  1F2G A;  4FKX A;  3MMA B;  4CLS A;  5F8M A;  1N4L A;  2DNH A;  5CA5 A;  2OML A;  4JI1 J;  4LR9 A;  4J9L A;  4JBC A;  4ZA1 A;  4IR1 A;  4CLT A;  3V6D B;  3SXL A;  4H4M B;  3NGT A;  1KLM B;  4OLO A;  2CAD A;  1LK5 A;  2H5E A;  4G1Q B;  1QD1 A;  1ZZN A;  1U48 A;  3A8J A;  5GAE I;  4C11 B;  1FXL A;  4AXI A;  3AHP A;  3BN4 A;  2BQ3 A;  2WVE A;  4R8U A;  2IM0 A;  1FRH A;  3S6E A;  1XJW B;  5AXK A;  2ZH1 A;  4UOC A;  1RGV A;  4DFK A;  3RGI A;  4B3S J;  2CNK B;  1UWB B;  4LF6 F;  2BE2 B;  2CQI A;  2V94 A;  2WB4 A;  2W7A A;  3UD4 P;  2CJY B;  3RW6 A;  1D8Y A;  3FRY A;  2AV5 A;  4S0M A;  4XPE A;  2W2Q P;  1G7C B;  1S59 A;  3MPU B;  1UVJ A;  4CO0 A;  1RU1 A;  2G2Y A;  4H4K A;  3NAH A;  1LKZ A;  2W2O P;  5IZH A;  3VGU A;  5DDQ C;  3CSK A;  1XIQ A;  3T6J A;  3AJ2 A;  3OJU A;  1SKU B;  4FP9 A;  1C1B A;  1D9D A;  2HIY A;  4NEZ A;  1NKC A;  4B3R J;  1RT4 B;  3IR7 B;  1JXE A;  5DM6 Q;  1FD2 A;  4C8M A;  1F9E B;  2WW4 A;  3TUZ C;  3VAM A;  3Q8V A;  5G0R B;  3TR5 A;  1R0A A;  2D41 A;  2ZM6 F;  2HFO A;  2C2Z B;  4XIU A;  1RTD A;  4LF8 F;  2ZBR A;  1RHR B;  4LF5 F;  4FYY B;  4V19 X;  4FF2 A;  5DQI A;  2FJB B;  2ADC A;  1NK0 A;  3PJX A;  2W9C B;  2HKE A;  1UJ4 A;  4RWW A;  3TA1 A;  8ATC B;  3JTN A;  4WTO B;  4ZCL A;  2FJV A;  4YB6 A;  1BGX T;  3HM9 A;  1IR2 A;  2WVD A;  3AQP A;  4EEY A;  3BGO P;  2CQC A;  1T0T V;  4I1T A;  3PRD A;  2VD3 A;  4PG5 A;  3VQS A;  2YBV A;  2I9S A;  3CVK A;  3JQK A;  4DR7 J;  5A6P A;  1UA1 A;  3J81 j;  1TVR A;  4B9L A;  2DEI A;  1RT3 B;  4RW7 B;  1U0H B;  7FD1 A;  4PG6 A;  2DGW A;  1HMV B;  2MQQ A;  1OWX A;  5IT0 A;  2ZH3 A;  2CQH A;  6AT1 B;  1RAA B;  2O01 C;  3M8R A;  3ZO7 A;  4ZN1 A;  1O6X A;  3BPD A;  1IKV B;  3ETO A;  4UOF A;  1V6H A;  1Q5V A;  4DOZ A;  4F26 A;  4ZLN A;  2AYG A;  4USM A;  3T1Y F;  5L1I A;  2ZJR Q;  2RRA A;  3HK2 A;  2HWT A;  2QA2 A;  3ONQ A;  3KYL A;  2W9A A;  2JLF A;  2JC1 A;  4ETX A;  3RRH A;  2A3J A;  3C6U B;  2WBR A;  3QT8 A;  3T5K A;  2IFX A;  3MTK A;  4YHH J;  2HGM A;  2CUY A;  2LA4 A;  2LXI A;  2W9B B;  2B9E A;  4BHQ A;  4ELT A;  1XNR F;  2MZJ A;  2JEI A;  3QID A;  4URQ U;  4DSF A;  5KFJ A;  2J6U A;  2FLO A;  1V5I B;  2WW8 A;  4FF3 A;  3BSC A;  3FNN A;  4K7Q A;  3K17 A;  2DHH A;  5B0B A;  4LRC A;  2E1M C;  1S9F A;  1IN0 A;  2OPS B;  4Y2I A;  1YKW A;  3KNG A;  1TQL A;  1S49 A;  2W2M P;  3DHW C;  3DI6 A;  2OD4 A;  3K5O A;  3KLE B;  2XSJ A;  3ILI A;  3VF0 B;  2MGZ A;  1D0E A;  1EQ0 A;  3GPA A;  3TOQ A;  5KT4 A;  2FC8 A;  3TX0 A;  4WU2 A;  3EDR B;  4ERD A;  3BB5 A;  1NRK A;  1HBO B;  2GS8 A;  4Q45 A;  2QEX S;  3A8K A;  3NNH A;  1RHJ B;  3IR6 B;  2DGO A;  2EKN A;  1X9S A;  4KHR A;  2IMO A;  1CJK A;  2EG2 A;  4FXD A;  1VQM S;  3GZ7 A;  1ZA2 B;  3A1Y G;  2ZEJ A;  3CJ8 A;  3MHY A;  3OT9 A;  3W63 A;  5D0E A;  1IKX A;  4LF6 J;  4QOT A;  2VFV A;  4EO6 A;  4OI3 A;  2V4J B;  4ZHR A;  3BGR B;  1O51 A;  3TVZ A;  5CAA A;  3B78 A;  1T3O A;  2JLG A;  4F4Z A;  2YNF B;  3H7H B;  3M8P B;  2Z2Z A;  1PSD A;  1SCJ B;  1T94 A;  4ZVG A;  4EU0 A;  4KRW A;  4XO0 A;  1UFK A;  4I7F B;  1H6K X;  3FSY A;  3MAH A;  4LT6 A;  4XTT A;  1F6T A;  4BBY A;  1YJU A;  3MEC A;  4ZVH A;  4A47 A;  4A8W A;  1KQS R;  4WK1 A;  4B9M A;  2VDI A;  4JI8 J;  1F5C A;  2HHP A;  4WFN Q;  2E5I A;  2ZDP A;  1I94 F;  1HAR A;  4A8O A;  5KT3 A;  4KT0 C;  4OZJ A;  4PQA A;  2LDI A;  1N56 A;  2LEP A;  1FNM A;  4DR1 J;  1KDN A;  4CT8 A;  3EXY A;  4E8U A;  2KXH A;  4OZL A;  4ES2 A;  4WXW A;  1SQE A;  4MH8 A;  4ZPA A;  4CZC A;  5DLG A;  3PJ9 A;  4JI7 J;  4NXM F;  5M2U A;  1RK8 A;  2M5Y A;  4C8N A;  3CCJ S;  4DV2 F;  2FB0 A;  3KK2 A;  1JKH B;  5LM7 E;  3ZTP A;  1LWE B;  4GO5 X;  4TQS A;  4GKJ J;  2CG4 A;  3UDL A;  3ZZZ A;  3I56 S;  1Q16 B;  2OEK A;  2V6A A;  3DLG A;  4F0H A;  3DDK A;  5BR8 F;  1E6V A;  1RI7 A;  2GZO A;  5JUM A;  3I4P A;  3M8Z A;  3MMA A;  1HD0 A;  3HVR A;  2FVS A;  2ZUA A;  1KR4 A;  1Q78 A;  3M1V B;  3BH6 B;  3FFI B;  5KOX A;  2KM8 C;  2EFQ A;  1RSC A;  3FMW A;  3HVW A;  3TVK A;  1MN7 A;  1S4E A;  2GJI A;  1TUV A;  1NU4 A;  3OLA A;  4ECW A;  3CO9 A;  2OH2 A;  3DGP B;  4PUO A;  5T41 A;  2XYG B;  5LSR A;  4ECR A;  1EJ7 L;  5KFK A;  4YN3 B;  3CJS A;  2MHN A;  3PHE A;  3H40 A;  4HAC B;  4C3L A;  1K1Q A;  3BGF A;  4B3O A;  3CXC R;  4ES3 A;  3PM9 A;  3TJA A;  2OP5 A;  2YWF A;  5HK4 A;  5HAN A;  2UXD F;  1A6L A;  4F02 A;  3AXK A;  2OPR B;  4KSE B;  2R8J A;  1QLN A;  4LIW A;  4K4U A;  2HG4 A;  1YJR A;  1KOO A;  1SKW A;  2EFO A;  4ZCM A;  3LGH A;  3W8G A;  1VQP S;  2PA8 D;  2P9E A;  2G0C A;  3BSA A;  3NCP A;  4NZ0 A;  1OQ3 A;  5FDL A;  3W7B A;  3GG1 A;  4UT4 A;  1FRK A;  1LW0 B;  3DKD A;  1AYE A;  1X7V A;  1FT8 A;  1VRT B;  2V8V A;  5L1K A;  1UL3 A;  3UVJ B;  4DV6 F;  3C66 A;  3M4X A;  3KHL A;  1HHS A;  4MAK A;  1SH3 A;  5G0R A;  3RAQ A;  1S9G B;  3CE8 A;  4A8Y A;  4IRK A;  3IS9 B;  4JV0 A;  3CCE S;  3SI8 A;  3I5A A;  1YRX A;  2HS0 A;  2PDA A;  2L48 A;  3IWX A;  1EET B;  3D6F B;  2QLB B;  1MN9 A;  2WON B;  2V68 A;  2F8M A;  1QUP A;  1RLC L;  2VBY A;  2ZZN A;  4F3M A;  1QJH A;  2GGP A;  4DG1 A;  5CAB A;  2X1A A;  1XR6 A;  3MMB A;  2KHC A;  3NGR A;  3T19 A;  3P45 B;  4EMD A;  1U1L A;  2ZOM A;  1TKX A;  2F7V A;  3EMT A;  2KG1 A;  4LRF A;  1JX4 A;  3QSY B;  1LV5 A;  2ZE2 B;  4LF9 J;  5JMN A;  1GMU A;  3D0I E;  1IBL F;  1TAU A;  1DUR A;  3DU6 A;  2O3D A;  4NLV A;  2MYF A;  1U6Z A;  3W8P A;  1RKI A;  1IJE B;  3PW7 A;  1S6Q B;  3IMQ J;  1NK8 A;  2V8D A;  3EE3 A;  3HHK A;  1T11 A;  2IC3 A;  4KGK A;  2B0G A;  2AGO A;  2V2Z A;  2Y1I A;  1KFD A;  4PZV A;  2QLX A;  5KFT A;  2E5J A;  2RIJ A;  3UN2 A;  1N5Y B;  3N6M A;  2XI3 A;  3QBC A;  4DV3 J;  2I2Y A;  1AB8 A;  5D8H B;  3F44 A;  2K7J A;  2EEY A;  2F9D A;  3R5C A;  1XQI A;  4NLT A;  2ZD1 A;  3T5H A;  3GSI A;  1U1N A;  1JLQ A;  1IQZ A;  2X1G A;  3D1H A;  1FJC A;  4Y0F A;  3TYT A;  1VQ8 S;  1TKX B;  1U1R A;  1FNO A;  2UU9 J;  1HNX J;  4GC6 A;  1VQ9 S;  4WPA A;  1RLD A;  2Y8Y A;  4C48 A;  5JVH Q;  3CNQ P;  5HN0 A;  2AGQ A;  2B9W A;  3N4W A;  2RSQ A;  4Z37 A;  4IRC A;  4E0D A;  2IDL A;  1X4D A;  4NXN J;  3P5T L;  5SZT A;  4IQX A;  1TV6 A;  2ZVI A;  1S6Q A;  1OPI A;  1JMT A;  2IYG A;  2HIQ A;  4LRB A;  3VAF A;  4RUA A;  1C4C A;  2AWZ A;  3SEO A;  3DMJ B;  1FKO A;  1MLA A;  1WOO A;  2LMI A;  5F8G A;  3AY0 A;  3M6V A;  2OTJ S;  3I32 A;  5KG5 A;  4HL9 A;  3LP2 A;  4ICL B;  4NYO A;  2VQF J;  5DDP C;  1LWX A;  1Q0N A;  1WDD A;  3CCL S;  1N33 J;  4USW A;  3A13 A;  2RQM A;  5CQG A;  3E01 B;  4KHP J;  1HQU A;  4RW8 B;  4DJB A;  2HND A;  1W2I A;  2A0F B;  1XWL A;  2N7Y A;  3KKF A;  4ANC A;  4B9T A;  1D8Z A;  2BX6 A;  4PWW A;  3OSP A;  4TLR A;  3KJQ B;  1HPZ B;  4OX6 A;  3CDU A;  3H4D A;  3OR2 A;  4FPI A;  4TU7 A;  4OHV A;  2O67 A;  3EZU A;  3UNG C;  2WSF C;  1XNQ F;  2OFG X;  2WAQ D;  5KT5 A;  2QRR A;  3JB9 k;  3H25 A;  1CS4 A;  2LU2 A;  4DPT A;  3SCL E;  1TTH B;  4ZVQ B;  2CJB A;  1N5T A;  3ELH A;  4CT9 A;  3KLF A;  2CQ3 A;  2BJ3 A;  3GE9 A;  5DG9 A;  3KMQ A;  1RWP B;  4P7T A;  4B9U A;  1RP5 A;  1HBM A;  2VG5 B;  2RIL A;  1NJW A;  4DX7 A;  3WBZ A;  2EFN A;  2YXL A;  5JVG Q;  1FI4 A;  2XI2 A;  3FVY A;  3LF0 A;  5HJX A;  2B3T B;  3LPE A;  1XNQ J;  2CQP A;  4FF1 A;  2EG1 A;  4JV2 A;  3T6B A;  1NK4 A;  1EKR A;  2FJX A;  4DZ6 A;  4J9M A;  4C8O A;  5HJY A;  1U2R A;  5I42 A;  3A4T A;  1UWA A;  2HQC A;  3IXQ A;  5HAT A;  2J0X A;  4C9D A;  5IM0 A;  1Q79 A;  3AA9 A;  5KFS A;  1R6V A;  3P6Y C;  3BPS P;  4A8K A;  2DBB A;  1EAY C;  2DIU A;  2J7K A;  3AB2 B;  4U95 A;  5D4P A;  4O4G B;  1RAH B;  1YBT A;  4ZPC A;  5ITH A;  4R25 A;  1WEX A;  3IR5 B;  1FX4 A;  2V2K A;  4F0M A;  2FVQ A;  4F8R A;  4PEO A;  5B0E A;  5DGA A;  4B3M J;  4EZ9 A;  5L8R C;  2BV3 A;  3ET6 A;  1VFJ A;  2VG5 A;  3AT1 B;  4X4R A;  1C0T B;  2B8P A;  4P71 A;  5D77 A;  4FS2 A;  3BQ0 A;  4QCL A;  1SC6 A;  2YQ3 A;  4LSN A;  2DT9 A;  1HW8 A;  2POK A;  1Y10 A;  2HPU A;  1T95 A;  3OUY B;  4NA1 A;  4TLQ A;  2R2T A;  2R7R A;  1VLO A;  4NLS A;  4J9N A;  3DLL Q;  3G96 A;  4ED8 A;  2JDJ A;  1VI7 A;  2AMC B;  1H2T Z;  1REV A;  3M32 A;  1NM2 A;  1Y5I B;  4K8R A;  5EX0 A;  2UUA F;  2XS7 A;  4DL3 A;  1FE4 A;  1HNV B;  3D3C J;  1S6P B;  3PYG A;  2FYX A;  2EVZ A;  1T9X A;  2H3E B;  4EK2 A;  3W9I A;  4B3T J;  2OPQ A;  2IA0 A;  2FLN A;  3HO1 A;  1RA6 A;  1FDN A;  2OHD A;  5J2M B;  4K0K J;  2YTC A;  4HLB A;  2DNN A;  2Y0S D;  1BQN A;  2DHA A;  3ET6 B;  4MKB A;  5CCL A;  3FRZ A;  1ZTW A;  2M0G B;  1T03 B;  1NPK A;  3PV8 A;  4G65 A;  5B0F A;  2Q6C A;  2IBK A;  1G1X A;  3V4I A;  2KFN A;  3OUY A;  2U2F A;  4KKO B;  1SV5 B;  4ZMM A;  2KKH A;  1PO6 A;  4KJI A;  1OJ4 A;  4OZ5 A;  4OIX A;  1B99 A;  4Y00 A;  3D9B A;  5AE1 A;  2BDP A;  4NI2 A;  1WKL A;  3E51 A;  3MR6 A;  1Q8L A;  2NCK L;  3B6B A;  1ZM2 A;  3HLU A;  4WXO A;  1HNV A;  5DGB A;  5A0Y B;  4HH0 A;  4N8O A;  3TI0 A;  3CC7 S;  2HHS A;  3VGS A;  4RL1 A;  5LJ5 Y;  1LFP A;  1S1X B;  3PJW A;  1HBU A;  3AH6 A;  5K20 B;  3TZX A;  1RUS A;  5GAE U;  1FE0 A;  1QY7 A;  2MZS A;  2AJF E;  1J5O B;  4QWA A;  1RAF B;  4MK8 A;  1WF2 A;  5ETK A;  3WZ0 A;  2HND B;  2QLW A;  3CWJ A;  3R2D J;  2YPZ A;  4CM2 A;  1BQN B;  1WDT A;  5E7O B;  1T03 A;  2GIR A;  1QSY A;  3PO5 A;  3CPW R;  4YFU A;  3OHB A;  1HYS A;  4CYU B;  4BS2 A;  1HPZ A;  4DR3 J;  2HRT A;  2WZ1 A;  3DXS X;  1YRT A;  4ID5 A;  3LAM A;  5LL6 d;  2E5L J;  5KT2 A;  4OJ3 A;  1O5J A;  4U8V A;  5ETT A;  2A10 A;  2LU1 A;  2N4D A;  2XCA A;  1CPZ A;  1F5B A;  1N5V A;  2DHX A;  2E5G A;  2JX2 A;  3AXM A;  3DLJ A;  3P4U B;  4X4P A;  1KTQ A;  1PYO B;  1VMB A;  3IBC B;  4OHX A;  3HJF A;  1JJ2 R;  2ZNZ A;  4LF1 A;  2XMM A;  2DR5 A;  4DS5 A;  5E2Q A;  1RT3 A;  1NJZ A;  5HAO A;  1FTC A;  2MZT A;  3MAA A;  3MPV A;  2C3Y A;  4AE5 A;  2EI5 A;  3EGN A;  2CDR B;  5ETN A;  1VC0 A;  3W2V A;  5D4L A;  1WSV A;  5ETQ A;  3KLG A;  1LW2 A;  3M8W A;  4ZVU B;  3H42 A;  3ULH A;  5KFW A;  1NUE A;  3H5U A;  2HWH A;  2BUN A;  1IKW B;  1WOP A;  3I5B A;  1DTQ A;  2RJZ A;  3UR3 C;  4IR9 A;  2BYC A;  3CME S;  2U1A A;  1H2V Z;  1JLF A;  3KJF B;  2J7W A;  1O8B A;  2AEM A;  4FZV A;  3A3O B;  3RYL A;  3MMJ A;  2AW0 A;  2ZNY A;  3PYF A;  1Q8I A;  5BYS A;  1G3O A;  2CNO B;  3LWL A;  5K8N A;  4IFV B;  4XK8 C;  1QVG R;  2GML A;  2J8S A;  1L3U A;  3RG6 A;  4PAB A;  4ENO A;  2YWH A;  3OXG A;  5EUH A;  1VQ7 S;  2GO8 A;  3CC4 S;  1EX8 A;  4OJH A;  1ZM4 A;  4MYT A;  2VUG A;  2FPH X;  1ZM9 A;  3Q89 A;  8AT1 B;  4X65 F;  2FHJ A;  2EK6 A;  2MLY A;  1RKJ A;  3HHE A;  4DR6 F;  4OI1 A;  3F73 A;  3H4B A;  2FGC A;  3ZZT A;  2MKK A;  3M30 A;  4YB5 A;  2Z2L A;  3KLV A;  3DFE A;  2G1D A;  2DR8 A;  4YOE A;  2JZ5 A;  1NXI A;  3GIK A;  1GNK A;  3HDS A;  4A8S A;  4FYV B;  4JI7 F;  1V3R A;  1YK9 A;  2HHH J;  1BY9 A;  4IH7 A;  1XR5 A;  5HBM A;  1TL3 A;  4CNY A;  2XO7 A;  1HI0 P;  1NDC A;  3OJS A;  3SBM A;  1YJT A;  4KH1 B;  2GAG C;  1CJK B;  1HHQ A;  4O44 A;  4QPX A;  2XLI A;  2H5J B;  3MPD A;  4JI8 F;  3IWN C;  3HKW A;  2L3M A;  3IBF B;  3A3N B;  4GC7 A;  4AL5 A;  3VHQ A;  2LEB A;  2LQ5 A;  2NUU G;  5KFX A;  1FVQ A;  4KIA A;  1NPP A;  4J9V A;  4L3K A;  4W90 B;  5I42 B;  4AQY J;  4ED5 A;  3EUN A;  3MCO A;  3OL6 A;  2DNO A;  1XR7 A;  2XLJ A;  3GII A;  1RAO A;  1Y3J A;  1G4C A;  3UPF A;  4QWE A;  1WTB A;  3OTB A;  1SL0 A;  1MU2 A;  2Y9H A;  1V5V A;  2MKY A;  2XZD B;  2Y8W A;  5F8N A;  5F3T A;  1DRZ A;  2M8H A;  3BDP A;  2UXB J;  2ZH7 A;  4ZPD A;  1K0T A;  5F9N A;  1R27 B;  4EBD A;  1TR0 A;  2P8I A;  1Y3K A;  4O23 A;  3JSM B;  3BSN A;  2BMB A;  2F65 A;  2WOM A;  3QT5 A;  2AU0 A;  5H1S V;  2LYV A;  4NOH A;  1R7I A;  2R7V A;  2DNY A;  2DR6 A;  1Y0H A;  3MFI A;  1YLX A;  1WC5 A;  3CDB A;  2IRY A;  3M2R A;  2KZM A;  1OSD A;  4Y65 A;  1S7I A;  5IWA F;  3CCV S;  3ILJ A;  5KFB A;  3FGV A;  2KRB A;  3NRB A;  3W2W A;  1I1G A;  2UU9 F;  3M8Y A;  3O3L A;  1TZ0 A;  5E3C A;  1FX2 A;  1GT8 A;  4CLU A;  1RTI A;  1TMM A;  1FRJ A;  2VPY B;  3MMC B;  2XSJ B;  2J9D E;  3IAS 9;  2Q66 A;  2R7X A;  3DOL B;  3IRX B;  2DY9 A;  2OGU A;  3CD7 A;  3CJ0 A;  1RT2 B;  4UST A;  2F4V F;  5A8K B;  1Q95 G;  5BYQ A;  3PX6 A;  3P49 B;  3VR1 A;  4DLG A;  4YHH F;  2QL5 B;  5D6G A;  2ZD1 B;  2MKS A;  3OXF A;  3IRW P;  3W65 A;  4ES1 A;  3DCA A;  2GHP A; 
#chains in the Genus database with same CATH homology
 1F2H A;  1F3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...