1F3VA

Crystal structure of the complex between the n-terminal domain of tradd and the traf domain of traf2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
HEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mechanism of TRAF signaling revealed by structural and functional analyses of the TRADD-TRAF2 interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
total genus 52
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f3vA00
1F3VA 1F2HA
chains in the Genus database with same CATH superfamily
3M8ZA 3UR0A 3H7HB 5T41A 5ITHA 1FD2A 2C3YA 2HZCA 4WBFA 4BCAA 1T0TV 4X4OA 2HK2A 3DC2A 1F5CA 3PX0A 2V4RA 3OT9A 3ZNJ1 1R27B 2PI5A 3J80Y 2C2KB 4C8NA 1NH7A 1M5VC 2YPYA 2XZDB 1OYEA 4ZPCA 2K7JA 2VASA 4P72A 2AYBA 2YVSA 1F5AA 2P6SA 3MDFA 4KE5A 4RKUC 2IIHA 2HG4A 4RR5A 4C11B 4ZVPB 4C11A 4DPUA 1RWNB 1SQGA 1YJTA 2DO4A 2AEMA 4OYMA 4RUBA 5D15A 2EBGA 4E98A 5HMWA 4DUZF 3OVBA 1U6FA 1UPPA 3KK3B 1NDLA 3H0PA 4F4ZA 5IT9U 3QPIA 3T6JA 2AF6A 1X5OA 3D0HE 1VQYA 1H3DA 3HHLC 4K4UA 1QE1B 2G1DA 2I6WA 3KWMA 1LQ9A 3PX4A 4XTTA 1AW0A 4Z7YA 4EU0A 3D66A 1BE4A 4IDKB 1XMQJ 3M9MB 1JXEA 1V3RA 3OL9A 8RUCA 3PM9A 3NGRA 4IH7A 4O0IA 4YY3J 1TV6B 3LF0A 4PR6A 2G2OA 4OHYA 1C0TB 2CQGA 1NXIA 2CRLA 1N0VC 4Y2MA 1QDUB 2FJVA 4F7VA 2IY5B 1YDLA 4G1IA 4NMLA 2OD6A 1Y3JA 3OXFA 1S9GB 2HWIA 4A8FA 4I67A 4M8LA 4PWDB 4OHVA 4ZS6A 3GIKA 1JLAB 4RW9B 5J1EB 4KBIA 2MZ1A 4Q2LA 3ZNUA 3BGRA 2VC1A 4URGA 4DMZA 4X65F 2B56A 1RABB 2OEMA 3EGVA 3PW5A 1ZPVA 3AOCA 3LANA 4DV1J 1D9FA 2HSEB 1B4SA 2PSZA 3PO5A 2BW7A 2VBYA 1XMBA 4LBHA 2XLIA 4KHMA 1B7YB 4KGZB 5LMUF 2ADBA 4DR3F 1UW9A 3PW7A 2ZH8A 3I0SA 3M8QA 2KZMA 1RT5B 4A46A 3EZOA 1LWXA 2M5YA 2FQQB 1LOUA 5D77A 1DJ0A 1BXNA 1GXUA 3A4TA 4A8QA 3I4HX 4Q2MA 1NZAA 2HVEA 4U8YA 1BHNA 4XDDA 1S1WA 1YWXA 1Q79A 2PDAA 3IFEA 4MK9A 3I9ZA 3NCQA 3UDEA 2MQPA 3GV5B 1KVJA 3SV4A 3BBCA 1U26A 4NLXA 4EEYA 2VB6A 1JQGA 2XTJP 5IC4B 3W66A 1MMDA 2HGMA 3GMGA 3ETMA 4NI2A 2Y8WA 1J27A 2DTJA 1X7VA 4OJGA 1SKRA 3VQSA 3CD0A 1L3UA 1FRMA 1RT7A 3TQEA 4ED8A 1RWOB 3DYAA 2MJUA 3HT0A 3E2EA 2AGQA 2DK2A 2H54B 1P27B 2VUGA 2WZ1A 1XMOJ 2GQQA 3AXKA 3QAEA 1KFSA 3TVYA 1VCTA 1LKZA 4X4RA 1YJ9S 2KG1A 1JB0C 4WYWA 3VWSA 3ZZPA 3J7ZT 3DLGA 2AJFE 4OX9J 4Q7AA 3J80U 2JJ4D 4NYPA 3MR6A 2CQDA 4H4KC 4B3TJ 4HDGA 4WK3A 3NNAA 1S9EA 4MKVA 3TUPA 1CJTA 4ECUA 4PYDA 3UO0A 3BSNA 2V9KA 1LEOA 5AJ3J 1NB2A 2GNKA 2L48A 4EO8A 1KR4A 3LPYA 3M8WA 3SXLA 4K4WA 4PQUA 2XQCA 1VGYA 1LV5A 4UUXA 1IKWB 2CQ3A 1BGXT 3KOAA 2QMUB 4O3SA 1PYOB 3BEGB 4PG7A 3QWUA 4L76A 4JV5F 4WFXA 1SKSA 1MMLA 1UZDA 1M1HA 3EGZA 4DV5F 1RJJA 1HNWF 2W9AA 1YITS 4ERDA 3UD5A 1AFJA 4K2JA 2XI3A 1X5SA 4ES2A 3GP9A 1HD1A 4KV8B 3LGHA 3D5MA 4FBTA 1EQMA 1JLQB 2F4FA 2LA6A 5B08A 3IWLA 5CCMA 4DSJA 2HFVA 2KJVA 4G3IA 1S4EA 1S99A 4OQJA 4F04B 3UVJB 1DQ9A 5DQGA 3UN3A 3PYGA 2YWEA 3K0JA 3DI6B 3JQKA 4DL3A 3U1MA 1OQ6A 3KLIA 2B8QA 4QJVA 1X0FA 2BEFA 3DM2A 2CG8A 3R3TA 4RW4A 3MTJA 4YQWA 3Q2TC 3H5XA 4OX7A 5F3TA 4DQQA 2DR5A 4DL7A 1RDRA 1HNZF 3C8YA 2W25A 1K0VA 2HFOA 3KJVB 1WD6A 2YH1A 2BANA 2AD9A 3UI3A 1HWIA 2ZEJA 1TAQA 1ACMB 3CJ8A 4ANDA 5IT9Y 1U8WA 3GFHA 2B4VA 2DHGA 4RO0A 2DHAA 1H73A 4K4YA 1RYRA 5GAGU 3US5A 1FXRA 2G2ZA 4ZN1A 1MU2B 4ZPAA 3J7AN 4X4PA 1LWEA 2FUG9 2RQKA 3MF5A 2ZE2A 3SBMA 4YB6A 1H7XA 4EGLA 4C6AA 3M6WA 2VKZG 5GMDA 4J9RA 2UU9F 2IM2A 2V4JA 1TMMA 2XULA 3ILOA 4MFBB 5BYSA 1UEUA 5T7LB 3CIMA 1UETA 3OQ2A 4DPOA 2GIRA 3MFIA 1U0HB 2M7SA 4WFYA 2ZD1A 2RQCA 2KM8B 1X4BA 2XC9A 4QR1A 2QIFA 4NLVA 3VGUA 4U9RA 4LF5J 1YJWS 4F02A 3ZZUA 2DGWA 4CLWA 4CO2A 2FJWA 3R8YA 4OYXA 3MAAB 2ZNZA 1S0NA 1K1SA 4LSLA 3K57A 2R7OA 2A18A 1WHVA 1WOPA 1YVFA 3DDIA 3I31A 3KXDA 4FZVA 5C24B 3CJKA 3MCMA 1NPPA 2XSFA 1HA1A 3FK4A 3BQ1A 1PAUB 1CVJA 2GVDB 4NYZA 1VQ4S 2AKWB 5FIIA 2R4FA 5LL6d 1RUSA 2NYIA 1UVMA 2KH9A 4IOAQ 4ELTA 3DOLB 3IMQJ 2OPQA 4KKOA 4OYOA 2YWWA 2ZZMA 3CGIA 2MLYA 3U7JA 3W64A 2Z57B 3KNGA 5A8RA 4WP9A 4C3MA 1FHTA 3KLFB 3X3UA 2Z0GA 3DOKA 1Q8IA 3T19A 1C1CB 3TANA 2Q1LA 3RGIA 3C16A 3FGVA 3L7PA 3HKWA 4W98A 4QPXA 2DHHA 1CULB 2FB0A 3A8KA 4ILRA 3IBFB 2HLUA 2UVWA 5H9FK 4YS2A 4UOCA 3AT1B 4J37A 1RT4B 1Y9OA 4O23A 1SV5A 4J5OA 3AD7C 3O6QA 4Y6IA 2DITA 4BDPA 1APSA 3TW0A 2HIYA 2HK3A 3MM9A 2AMCB 2BM0A 1YBAA 4U7UK 3BO4A 4LSNB 2FJBB 3NWGA 3UCGA 3SSRA 3KUGA 1T03B 1UMJA 3BGLA 3WIVA 4JI4J 4ZOSA 3ET6A 2QA4G 4C3LA 3H40A 1SJ1A 3MECA 4NX9A 5F9NA 1HBNA 4DFMA 3TO8A 1F9FA 2A6OA 1GFWB 1S1UB 4JI3F 2Z2ZA 1K0TA 1VR6A 3DRRB 1ZPWX 4U96A 5DQHA 1SJ3P 2BANB 2ZBIA 3Q23A 4ED1A 2LMIA 5EX0A 2CFXA 2W7OA 4NXMF 1SXLA 2JC1A 2FLPA 4B3RF 3KK2A 1RGVA 2GQ2A 1ZA1B 3DXSX 2JLGA 4F4KA 5KFUA 1KHVA 2OP5A 3QIPB 3S6EA 3ZZZA 3GG1A 5A8WB 1U6ZA 5BJRA 1Q8KA 4MK8A 1H2VZ 1S9EB 1WEYA 2MQMA 3MMBA 3MM6A 1XERA 3MPVA 2W4PA 2E1AA 4HH0A 1FEEA 2IAJB 4M5GA 2RRNA 4MTPA 4YR2A 2QEXS 1HPZA 1PC5A 5A8RB 1ZZNA 2GHWA 4W92B 2EFQA 4LRDA 3K89A 3F73A 4AL5A 2R42A 5F8MA 4RW8A 4TY8A 4NCGB 3KJQB 5ETMA 3ENVA 3TP2A 3ZO7A 3KLEB 2IA6A 2MZJA 3G86A 1KFDA 4KHPJ 1HBOA 2OPRB 3L95X 4A4JA 5D4PA 2GIQA 4TXSA 3VZHA 4KGXB 3GFZA 1UVNA 4LIWA 1V3SA 1OQ3A 4GC7A 2VOOA 1TTHB 2VFVA 2VONA 2GVZB 1SC4B 2GJ2A 4ID5B 4ZVGA 5ETSA 1FWPA 1QSLA 3QT6A 1CJVB 2IDLA 1KOHA 1GX6A 1L3KA 1XK8A 3NS7B 1RAGB 4H4MA 2MY7A 2CUYA 2QX0A 4DJBA 2IMWP 4YHHF 4HHJA 4LF4J 4KHRA 2XCPA 1KQGB 3WQPA 1Y11A 1RAHB 2QFIA 2W4CA 3NBPA 4ZVRB 4IRDA 3M7VA 3RB0A 1EQ0A 4ZVQB 3C14B 2DNRA 3G8TA 2HQGA 5HQLA 1Z2LA 4DCJB 1FCAA 1S1VB 5F8GA 2YQ0A 3M8PB 5LT5A 3OSNA 2ZJPQ 1VQKS 2DY1A 3HHLB 1NK7A 4JUZA 3KJVA 3LOUA 3SMZA 3OBIA 2R7RA 4DR2F 4IQXA 2DYAA 3BS9A 2E9RX 4NA1A 1XN9A 5MAOA 3P96A 4NPOA 5L1JA 3X1LB 1PC4A 3U1NA 1REVB 1RBOB 4BHQA 2BDPA 3MM8A 4E0DA 4OX8A 2DEIA 1H2UX 1VHIA 2MYFA 5K8NA 3D1HA 2D3UA 4NLDA 4CLFA 1D09B 3E8OA 1RTIA 2OPPA 1U0SA 3K58A 1RHMB 2PGCA 4OYWA 3MM9B 2QLFB 3TEGA 5L9NA 2AU0A 3HFKA 4WJBA 4ZJOA 1Y00A 1CQMA 3CJSA 1S57A 3Q8VA 4LR8A 2Z56B 5DG9A 3DNCA 3L3CA 4LR7A 1WC6A 1CS4A 2V2QA 4LF4F 1CC8A 3D3CJ 2RMLA 4AT1B 4FKYA 5JVHQ 1S5ZA 1FRXA 2UUCF 1YTYA 1Q5VA 2QC3A 3JQMA 4IDKA 4LF9F 4EBCA 1GK8A 5F8LA 3GWCA 4LBPA 4CLTA 1S0MA 1TL1B 1RXOB 2IPOB 1WF2A 3FCHA 3R1LA 2DR9A 1SVDA 2O67A 1HARA 1QAJA 1FVSA 2ALYB 5BR8J 3GYNA 4JI7F 1QAXA 4U8VA 2YQ1A 1TVRB 2HHQA 2H4YB 3TX8A 4DCPB 2Q66A 1WJ9A 2R7WA 4ZPDA 5D8HB 1WWHA 3FBCA 3BYRA 3QGGA 4J9OA 2DNZA 3MM6B 3NS5A 3QBCA 1P1LA 2FC8A 1U8SA 3SV3A 4DL4A 4TQSA 2YWFA 2G4BA 1GEHA 3PY8A 2CJQA 3OTOF 1WTBA 1RT3A 2BX6A 3DKDA 4J91A 3HHKA 4M5DB 1LW2A 3BREA 1RAFB 4YP3A 3T5JA 3JSMA 4ETXA 1I94J 2LLZA 1S0OA 4GKKJ 3JSMB 1CULA 5HI7A 1TFWA 2WW4A 3H2UB 3Q8YA 4DEZA 3CCUS 3RBEA 2CJXB 2LU2A 3PDNA 4P71A 1PG5B 2GVZA 5A0YB 1NEEA 2ASLA 3QRRA 2I38A 4YUDA 1LXNA 2VHGA 2FPHX 3RR7A 6FDRA 2H5IB 2DD8S 3MOJB 2DBBA 1HR0F 2VJVA 2U1AA 4IOCQ 3CO9A 3HD2A 4DR1J 3TI0A 1S9GA 2VL1A 1U49A 2IDEA 4N8NA 2AGOA 1R7IA 1NHUA 2ZUGA 1W2IA 4DUTA 4ECRA 1HBNB 1XR6A 2W2MP 4OFZA 3VAFA 3T5KA 1K73T 4WKRA 4ELVA 1IQZA 1NU4A 5C5JA 3JSYA 4CLYA 3PW4A 1J5OB 1KSPA 2OSQA 2R7UA 3NLCA 3DLKA 4NLTA 3CCVS 2IJNA 4PUOB 1LK7A 4EMDA 1S6UA 2QLBB 2R3VA 8ATCB 2VQEF 1G2EA 3B4MA 2WTFA 4CT8A 3KK2B 2XLKA 3I0RA 3MEGA 5DG7A 1RWKB 4NXNJ 2JFKA 2LYVA 3FEZA 4CLZA 4OI1A 3W61A 4KHPF 4AXJA 1LW0A 5KG1A 1OY6A 5GAEI 2GHVC 2J9EA 4OYZA 1X4FA 1FDAA 4K7QA 4WIIA 3QJJA 2KFNA 1J2VA 3QT5A 2DNNA 4YB1P 4HHUA 1RTIB 2M88A 2YBVA 3VR1A 5HVFA 4YY3F 3OVAA 4NLUA 2EFOA 2VG5A 3MR3A 3JAMU 3QJPA 4LF6F 1ZS6A 4ZLJA 2AEFA 3HK2A 3AA8A 2ROEA 4A8XA 3HHDA 4KFBB 4QWBA 2RRBA 1TUGB 2MKHA 3VAIA 1FA0A 5IFMA 5IT4A 4DWIA 4OIXA 3PR4A 3M6XA 3KHGA 3I5CA 1XNQF 1C4CA 3JTOA 5KFKA 2ASJA 1HW8A 2XS7A 3RAXA 1RT6A 1P1TA 1PILA 1HNXF 4Y28C 3ZZOA 1VIOA 2QZ8A 3TZXA 1U09A 2XSJB 2HNYB 2J9DA 4LSLB 1AZSB 1XTZA 4M5HA 4U7UD 4AXIA 5LMUJ 4ZP6A 3D4JA 3NBPB 4MK7A 2LVWA 2B9EA 4MIWA 1FKPA 4YB7A 2XO6A 4EBEA 3RAQA 2XI2A 3UVJA 3BO2A 3MUMP 4RJVA 4DQRA 3G6XA 1S1XA 3QIDA 3WC2A 1N33F 3DGVA 1VRUB 4BC7A 1CJKB 4ZVTB 5HK4A 2FLLA 3THTA 2VC0A 3BBBA 3SCJE 4USIA 1G6BA 2WHOA 2VV5A 1HBUB 1X4AA 2LDIA 4I2QA 3W2VB 3KLFA 1IR2A 2BVZA 5K14B 2KM8C 3ZZRA 2DHXA 2KRRA 1TFYA 1HMVA 3MM5B 4X2BA 5KOWA 1YJRA 3PRDA 3KLGA 5E33A 2QLXA 3JB9k 2HHHF 1QSSA 1LWCA 4LF2A 1F0XA 3CDWA 3DRSA 3OTCA 4KGVB 2HFZA 1AA1B 1PJ5A 3A3PB 2XHCA 2XMTA 3HHLD 3DGPB 2DGQA 4MYUA 2HURA 3W2WB 2MZRA 3PKYA 3FNNA 2ZH7A 4IO1A 3DHWC 5L9XA 3CMQA 1Q5YA 2COLA 2XBPA 1XMOF 4B3MF 4X66F 3GIIA 1UTAA 4I56A 4NE9C 4KRWA 4A8SA 2GGPB 3G96A 4A8YA 4IR9A 2X3DA 1CS4B 2EW9A 2BXJA 5B0FA 3UPFA 3DI6A 4Y3CA 3P49B 1YHQS 1EHWA 1SBRA 4DS5A 3ENQA 1MN7A 4O4RA 2W9BB 5CYJA 1XNRF 2ZBRA 4Z7CA 1I6JA 3PW2A 3H5SA 5B0BA 3DRRA 5AJ3F 1P8GA 3PV8A 3SDEB 1BQXA 3QATA 5L39A 3QRQA 5IZHA 2R2RA 3GIRA 1PJ7A 1ZAXA 3M2UB 4WCEQ 1SUQB 1S6PB 2BBEA 1X4HA 2F9DA 1KQFB 1X4GA 2JC0A 2MQLA 2PEHA 1BD6A 1WC0A 1WG1A 2XMUA 4Z2XA 1QLNA 2DGTA 4DV1F 4TYAA 4BS2A 1EETB 5GMEA 1CJTB 2F40A 1HPZB 3UNYA 1A0OB 2VICA 1NCLA 1HI1A 1FTRA 1T7PA 2BABA 3EE3A 3D54A 1FE0A 1DTQB 1T9WA 1T3OA 3H8YA 3GU0A 4NCGA 3MTKA 4P2SA 4PABA 1PYTA 1FRLA 5KFRA 5L1KA 3JAMY 3TUJC 3MR5A 1X9MA 5T14A 3W9IA 2V0NA 3GTYX 4Y2CA 1Q82T 5G0RB 3IRWP 5JMNA 4RW6A 2HHVA 4WFZA 4EBDA 2L9WA 3M4XA 4ID5A 2HWTA 1DARA 4KV8A 2ATLA 1RWUA 2QA2A 2P8IA 5E3AA 4PWDA 1R8BA 1NK5A 2HFNA 5CABA 5JUMA 3MR2A 3CJ4A 3KG4A 1WI8A 2BKNA 3CCRS 1BQNB 1N5QA 1ZETA 4NXNF 3GZ7A 1UEVA 1JXLA 2W9BA 5IS2A 2DGUA 2ZH1A 3HHLA 1PO6A 3WX4A 1MROB 2XWXA 3M8PA 2L41A 3D1OA 2XY5A 3IS9A 4N7TA 3UN2A 4DOZA 2DNQA 2C2NA 3SQOP 1MWQA 4H4OA 3MEEA 4I2QB 3WX8A 3MPWA 4F0KA 5KFPA 3OUYA 5L1LA 1N32F 2Q79A 4X4QA 2AIRB 4NLYA 3W60A 3PXGa 2A2DA 2CAJA 2HGNA 1FDBA 4ED4A 4PG8A 5K5MA 3R5GA 2AEJA 1U02A 3DHXA 2V50A 3MMBB 4D3HA 3W2WA 3W62A 1Q8LA 2HNZB 5D0HA 2CQBA 3CJ2A 2YNGB 3NY0A 4QR2A 1S0VA 4F4YA 3I9V9 2UVUA 1E6VA 1CC7A 3EVOA 3IR5B 4LFCJ 4F25A 4ECVA 5E3PA 2HWHA 3CJRA 2RQMA 2OPRA 4WP3A 1HHQA 1WACA 3R97A 4AL6A 3EPGA 2ZH5A 1SJFA 3HM9A 4Y65A 3EJMA 2HAIA 1C4AA 2CPEA 2RNEA 2LQ9A 2ZWOA 2CJAA 1FEHA 2E1RA 4PG6A 4WFNQ 1U6BA 5M2UA 3QSYB 4P7TA 3PJXA 2CPDA 4QWAA 4YMEA 2Y1RI 4W90B 3NGDA 3HJFA 2ZDOA 3CO0P 5SZTA 2IVYA 1RHKB 3CJKB 2C2EA 4KYZA 3JTNA 1KTVA 2NYHA 3MGJA 1EIYB 3TZYA 3IA0A 3J7Z5 4FXVA 4HKQA 1DTTB 2DT9A 5F0UA 4DV6J 3CCSS 4ZN3A 1RBAA 1B0TA 3VVTA 1X60A 2K3IA 3E51A 3G82B 4ICLA 2I0XA 2B5JA 5FLXY 4A8KA 3BKUA 2RILA 2C2RA 3KK3A 2NZ4A 1RT3B 5GADI 3TQ1A 5HP1A 2D9OA 2MSTA 1JJHA 2K7KA 1C1CA 4BLGA 2VF3A 2RVJA 1RWVB 5A2QU 3RRHA 3B82A 2GS8A 2MXYA 5J2QB 1YQHA 3D7SB 3MEDB 4DZDA 1IKVB 2BKOA 3HO1A 2ZHBA 3HVRA 3FCVA 5JXSA 1GAOA 3BB5A 4IYQA 1VMBA 2B9WA 4RW7A 2MEWA 4OJ1A 2GFFA 1HWJA 5CQGA 4CO3A 1HHSA 3HSDA 5ETNA 1M5SA 2EKNA 2YNGA 3PFOA 3DCAA 4J9VA 1FKAF 4KC5A 3GFXA 2FJAB 3T1AA 2IRXA 1X5TA 4DL0C 1VQ7S 1SI9A 3GJTB 3E3XA 3R5AA 2AYMA 3WHIA 5J1PA 2MKKA 2FY8A 4A8WA 2OPSA 1XQIA 4RWWA 5IQ6A 2HHSA 2H4WB 1IBKF 3HXMA 2JVRA 5HROB 2OAUA 2VBXA 1RHUB 4R5PB 1MWYA 4OLPA 2X1AA 4G1PA 2YX7A 3F44A 1RQ0A 2IRYA 2AZ1A 4U95A 3NEKA 5B0DA 2W8KA 5D3GB 3HDSA 4ZPWR 5H1SV 2QTWA 3OHAA 5KG5A 2ABYA 1VOMA 3N0VA 3N4WA 3QGIA 2UP1A 3TJAA 4ED0A 2VFSA 2B6AB 2EC2A 1R6VA 1SIZA 4IH6A 4A8OA 2ALZA 1JK9B 2V63A 2J7UA 2YKAA 3BH6B 4F26A 1QVFR 1TK5A 1IR1A 2DHSA 3JQJA 1Q7YT 3MCSA 1SL2A 3PYDA 3PIOQ 1LWEB 1CLFA 1CJUA 3HP6A 1G7CB 3T9NA 1NSKL 1FNMA 1T9XA 2E66A 5E2QA 2GO9A 4X62J 3QZ7A 1ZA2B 4GKJF 1Y3KA 3ISNC 3TUZC 2HBRB 5KFDA 1NSPA 3M1VB 1IKWA 4URQU 3QWPA 2ZD1B 2BRLA 2YWHA 2KYXA 1UFKA 2F65A 4KB7A 3EVMA 2R7QA 3RRGA 4OZ0A 2DO0A 1TL4A 2JWNA 1C1BB 1FWKA 2NS1B 1NJXA 1N33J 2ZVSA 4IH5A 1UJ4A 2FC9A 2GJFA 2XYGB 4ZA1A 3K8VA 3M6UA 4M5NA 2ZHOA 2R8KA 3TAQA 2FGOA 3RU0A 2WCXA 2NUHA 3KNAA 2HFSA 3R2CJ 2Y0SD 2BJEA 4RW9A 1N36F 4J9NA 4B9NA 2LP4A 3M8YA 1VQ5S 2UUBF 4FYVB 4KY3A 2EXUA 5DZ7A 2FJXA 1K9MT 2ACYA 2P9CA 1WTFA 1RHRB 2BMBA 1URNA 2GZOA 4ES3A 2RT3A 2HAFA 3W65A 3GSIA 3N6MA 4GRSA 1I5OB 1F3FA 4JI2F 4AUKA 2VH7A 4YB5A 3UCZP 1VRTA 4TY9A 5FLXU 4OI3A 1FDDA 2EPIA 4OX9F 4M5IA 1NK6A 1M5OC 4DX5A 2PD1A 2CKWA 1F5BA 2LU1A 3C19A 4DG1A 5C2GA 2B9XA 4WK1A 1DURA 3K5LA 4LF6J 3OR1A 3ITHB 3BF4A 3HSGA 4PG5A 2MTLA 5KTQA 5EGYA 3U02A 4NLQA 2GCFA 1FFGB 2A2CA 2J76E 4LF9J 4YEAA 1WHYA 4F67A 1OYDA 2IM0A 1TKTA 3CCZA 3H42A 2GC8A 2GIFA 4IFVB 4PAAA 1CJVA 1S10A 1Q86T 5IC6B 1UA0A 3HCXA 2UUTA 5G4DA 3OR2A 4O3PA 3GLJA 2CQCA 1Z4UA 1VK8A 4BWMA 1UZHA 1IM6A 3LA0A 3BPSP 4AQYJ 2PMZD 2OELA 1RT2B 1N5SA 1F9EB 1ZM9A 3DYAB 3T3FA 3IGNA 1DAXA 3QNWB 2XY7A 4WXOA 2QE5A 5KG4A 2VDIA 3I82A 4Y0FA 4Z37A 3QFWA 3PZPA 1GMWD 3FDSA 3RB6A 1IBLF 2XM3A 1B7FA 5LXYA 1YRUA 4KGMA 3ZZ0A 3GE9A 1H38A 5KFXA 2WAQD 3P8BB 2VD3A 2RDJA 2MHNA 2MKIA 3GJQB 1UFWA 3TUIC 2P2CB 1FKPB 3A13A 4USWA 4DFPA 5DRKA 3BH7B 4ATNA 5AXNA 1B0VA 4RNNA 4DUYJ 2I9SA 5F0WA 1VYAA 2VBWA 3DU6A 3UCUP 2YKNB 1KS2A 3DLEB 2IC3A 3LTOA 4OV1A 3T1HF 2B7CB 3N79A 3W8PA 4ZCIA 4DL5A 1Q78A 3QQCD 4DDFA 2VA2A 2B8PA 2IM3A 1S72S 1LFPA 1ROFA 1WKJA 3FZ2A 4NLGA 3CULA 2IVMA 2CVIA 4A48A 4B3RJ 4BWJA 4QU7A 2KT2A 4KPCA 3OLBA 4QW9A 3IN5A 3Q2SC 1U2CA 2J9DE 4NEYA 5KFMA 4DV2F 2UXCJ 2KYZA 4XDCA 5CYQB 2O01C 4BC9A 2HS0A 2Y1LB 3P5TL 2MZSA 4QYZK 1OS5A 1QAYA 1QY7A 4C8MA 5E7OB 1JLBA 4J7CA 3O2IA 4DSFA 5HVGA 3H4DA 3TJ9A 2M9KA 2CQPA 2L3MA 1KQKA 4MIAA 2M3DA 2O66A 5KG0A 1R6YA 3HZEA 5C25B 2BJ8A 2LA4A 2CPZA 2V67A 4OYBA 4QYRA 2KHCA 2KXHA 5KFZA 3W5XA 4DPYA 3RBXA 4ZLPA 2ZC4A 2EFGA 5GVQA 1EARA 1RAOA 2Z4PA 5K20B 4R5PA 1ICEB 4Q5VA 2Q6CA 1DY3A 3GSDA 5E3RA 3H5YA 5F8NA 2LQBA 1WF0A 3ELHA 1WF1A 1MNEA 2CDQA 4FKXA 2QYCA 2QYGA 2XGQA 2UVRA 2AJ1A 3QO9B 5KAKA 3DOKB 4ECSA 1FXDA 4URSA 4I2PA 1DLOB 3T6BA 5C42B 1TL3B 2ZM6J 2LEAA 5HSPA 4FNHA 3CD6S 3KLGB 1MU2A 3AHPA 3MUVP 1PBUA 4RWXA 2DVIA 1YZ7A 2XS2A 3D9BA 1JXVA 3GILA 4QOTA 5AT1B 4ZVFA 2V4QA 2RS2A 3E01B 4DU8A 1HNXJ 4IG0B 5L1IA 3PYEA 2F1FA 3OSPA 1RU2A 2YNHB 2CWKA 1Y5NB 2ZWPA 2RS8A 1TZ0A 4IG3A 2DCLA 1GQEA 1ELOA 3GV7B 4YOEA 3RB4A 2ROGA 4LF7F 1NRKA 3D1QA 4KPYA 4M95A 4OJ3A 3TR5A 1Q16B 4L3KA 1WG5A 2DR8A 3OXGA 4DSKA 1BWVA 1TKZB 5HBMB 1ZAVA 3J7YI 3M9NB 2FJDB 3D6MB 2XSJA 2KKHA 3P5BP 4DI6A 5AE1A 2AYGA 2ADCA 3MR7A 1IM4A 4LMZA 3OLAA 4OJHA 3CXCR 4I7FA 2C2DA 4ED7A 5HLFB 2UXBJ 1SJRA 2FHMA 3QT7A 1U2RA 1T94A 2QG9B 1S6PA 3VHQA 1RTJA 4YR0A 2GQCA 4ZVUB 2E5JA 1GH8A 2DEJA 4XAKA 4R0EA 3AH6A 3ISND 1X9WA 3UE2A 1UVIA 1GMWA 5GAEU 2ERRA 5ETPA 3QJLA 4Y2AA 2PFFB 1HWUA 4CM0A 3RG6A 1EJ7L 2F9JA 2V6AA 3ULHA 1S76D 1R0AB 1UJ6A 4PQUB 5CA5A 2FHJD 4ZVSB 2BQRA 1JLCB 1HBMB 1JLEB 2KRBA 2F4VJ 3FKBA 4RBUA 3NMRA 1X31C 3HFVA 4N8OA 4MJKA 1GT8A 1Z2ZA 5CCLA 2R7VA 1MWZA 4MKAA 2XNRA 5G0RA 2WBRA 5LMNJ 1RWPB 3K2YA 3ENAA 3R5DA 4IO9Q 1KLNA 4EYIB 2RHSB 3V6DA 3CCQS 1XNRJ 1JLQA 4DL2A 2D41A 2ILZA 4HL9A 2MY8A 2MPUA 1WC3A 3H98A 3LGMA 2E44A 2IMOA 1QUPA 3C6TB 4KAIA 4F3OA 4TU8A 2YKPA 1C0UB 1UKUA 5DGAA 4ZITA 1X4EA 3I96A 9ATCB 1RT7B 2DXEA 3HJVA 5KT7A 1NKEA 2VA3A 4I6YA 1C2PA 3FSIA 2W7AA 1Q1KA 1YGYA 4P10A 4ZP7A 2AW0A 2IVFB 1KD1T 1H98A 2M2BA 3PYFA 3OTBA 3R27A 3VAKA 3TZWA 3EM1A 1M0SA 1JJ4A 1WNEA 3B8HA 1FF2A 3HSJA 1RTZA 2KB2A 3D0GE 1KOOA 3HZGA 3MM7B 1HI8A 1HYSA 1T8EA 5HQMA 2AWZA 5AE3A 4RBTA 3QZ8A 3IC1A 2HMIB 2HHPA 4X65J 4ZMMA 2WSCC 3QIPA 4YR3A 2GA7A 3RB3A 1U1KA 4C8YA 1KP6A 2D69A 5B09A 2C2MB 4DV2J 3AJDA 1RACB 2RE1A 3MM8B 4QQBA 1WHWA 1RAJA 3SSQA 5I42B 4B3OA 4C8LA 3IRXA 3THVA 5A8KB 3ICLA 4XPEA 1A6LA 1RU1A 4WYLA 4UY8T 2VG6B 2XS5A 5KOXA 1XIQA 1B0PA 2OEJA 2OPPB 2PT0A 2X3GA 5CH7B 3GCWP 3RUBL 2F8MA 3KLEA 2WVCA 3IM9A 4RW8B 2EG2A 2QRRA 4YDDB 1VI7A 3OJUA 2XWYA 3HSZA 1BUXA 2GX8A 4K59A 1X9SA 2PC6A 4DPXA 3FJ2A 2IYGA 4PG4A 4C0OC 4FYDA 1U25A 1HNVA 4DN0A 3D67A 2P5VA 4DS4A 1SQFA 1T3NA 1FTCA 3FFIB 2RF2B 4OYPA 3KTQA 3PIPQ 1CQNA 1RE1B 3S1TA 1N6QB 1RWWB 1R89A 2DIUA 1T9VA 2M52A 3A3NB 4CLLA 3CCJS 4PQAA 1U4BA 1JMTA 4I7FB 3K8WA 2J0WA 5JVGQ 2C3OA 1YZ6A 3H2VE 1KTQA 3GR0A 4DV3J 1T05B 4DR6J 3DRPA 2AJ0A 2J6SA 4K0KJ 1QM9A 2KFZA 2WONB 2PO4A 3NRBA 1XEZA 4OZJA 5KFEA 5DZ6A 2OKQA 1I51B 1S1XB 5DQIA 4IFYA 4WZQA 2HQCA 3NS6A 4B3SF 2R7TA 2NXEA 2QLJB 4QIEA 4RZRA 2Z8QA 3EUNA 1J5OA 2AZ3A 1YJVA 2FJEB 4IQMA 2W1BA 1O5JA 5KT5A 4V19J 3M2VA 1OY9A 1U47A 5E5NA 3C3LA 2LXIA 3PTWA 4LFBF 4DLGA 3QRPA 3H5UA 1H6KX 1REVA 3MMAB 4K4XA 3DOMA 5L38A 2BQUA 2JZ5A 1JKHA 3CCWA 3KG1A 3M30B 2UUCJ 1ZZFA 3DRSB 3PEHA 4TNOA 2K3KA 2W2NP 3R5CA 2NXCA 5EWFA 4FS2A 3RRKA 2MMYA 3B4DA 2W01A 4O44A 4OX6A 5IWAF 2LQ5A 1QTNB 4ZLLA 1IKXA 2ZJQQ 4QZVB 4ZP8A 2E5LF 2J0QD 2DGXA 2YNHA 3THPA 4EFAC 4J9MA 4DQPA 2H5EA 1VQSA 1NPKA 2V2VA 2H65B 2D74B 3CT9A 1S9FA 1YRTA 1S1UA 3G6ES 3K5OA 4B9TA 3Q83A 4KIAA 1VS3A 1G3OA 1VRQC 2OEKA 1TP7A 2RH3A 5EX3A 1SB6A 3K5PA 4L3NA 4GC6A 1EZZB 4PRFA 2EK1A 2LXFA 4F2SA 1Y7PA 4ZPBA 1DRZA 4CM2A 1AZSA 2D3ZA 4QCLA 2B6AA 2WVDA 3ZTPA 3F41A 1VQOS 2BACA 1QJHA 2JDJA 4LFAJ 2BR0A 4NZ7A 4CLPA 4PYAA 4I64A 3W5YA 1RTJB 3HFZB 2V9WA 3V6KA 1T02A 5SUHA 1S6QA 5F9LA 2IBOA 5J2MA 4FBUA 4M1KA 3HVTB 1IN0A 4HDHA 2EK6A 4FYYB 3KYLA 4FPRA 3G71S 1B99A 1HQEA 4NLOA 5ETKA 3VAJA 4Q45A 4HTJA 3V81A 3CDEA 3NGKA 5DJBA 1JNZB 4R0JA 2W2QP 1REGX 2DH7A 1U1RA 1LW2B 5KT6A 1JLEA 2J5AA 4DQSA 1NDKA 2K2PA 1QSYA 3IR6B 2RAQA 4G6VB 4MAKA 5ETLA 3DFEA 2JL9A 2W2PP 4I68A 4ZHRB 4JI6J 1N0UA 1WSVA 2BUNA 2MZTA 2M8DB 3A8EA 1HNIA 5I3UA 2HVIA 2HKEA 4I6WA 4WPAA 2B4UA 3R9LA 3CJ5A 1ZM3A 4DLEA 5C24A 2MKYA 1S7IA 3LGNA 3UQSA 3JYTA 2W8LA 4P2MA 4ECXA 1RTDB 1RTDA 3KMQA 1TKDA 4ECTA 2OUGA 2ZZTA 2O5DA 1RADB 1G4CA 1N52B 4PXDA 5KFOA 1W2BR 5F8JA 1XWLA 4USMA 2BRKA 1P6TA 7FDRA 2NREA 1FJGF 2G2YA 4O4GA 3K7RA 1S1VA 2BE9B 3PRVA 3CE8A 3K5NA 5KFYA 1WC5A 2RD5C 4USKA 2VG7B 3POTB 2PMHA 3TAMA 3Q8QB 4LJMA 2RDIA 1VC5A 2HVHA 1WDTA 2MGZB 9RUBA 3FBBA 4MMOA 2VIHA 4JI0J 3I0RB 3MEGB 1H72C 3OR1B 4OZNA 5AXLA 4C48A 3GB0A 2DRBA 3CJ3A 1K8AT 4QBUA 1UVKA 3ZZYA 1LXJA 2ZH3A 3TAPA 1VQNS 4DSLA 5FDLA 4DR4J 1I3OB 3UR3C 2DXDA 2FGCA 3V6JA 3PVXA 5BYQA 4ANEA 3DXBA 4USUA 1JJCB 4LBIA 2E1PA 4HYKA 4DX7A 4IUFA 2HFUA 2KL8A 2CNKB 1I94F 4GKKF 1RWMB 1VBKA 4B17A 1TK0A 3C15A 2YH0A 4UUWA 2W4DA 3PW0A 3H90A 3KDOA 4B02A 1F1BB 3MZIA 4ZJQA 1U1MA 4N41A 1WUUA 4ID8A 4C7QA 2KU7A 5LSOA 3EYZA 2R2TA 3CC2S 2CZVC 2HS4A 3W8GA 3GQCA 3LUYA 3UN5A 1BC6A 1RAAB 1FFWB 2GMHA 4KO0A 3SDEA 1DQAA 1HL6A 4U67Q 4QIVA 5CHCB 3LWLA 4PKDB 1T05A 3PACA 4WU3A 1BY9A 4DU7A 3M2RA 3HPOA 1IWAA 3M2RB 3AFGA 1R0CB 4LT6A 5J2PB 5GAGI 3C14A 4ZIVA 1XJWB 1H74A 1T11A 1TL5A 3Q24A 2KDOA 3EPIA 4LQ3A 1IWGA 2JFDA 2QLWA 4CP5A 4ELUA 4OYIA 2XLJA 3H4BA 1NLKL 2CPJA 2D9PA 2DR6A 4E8UA 3BV8A 3AB2B 4G1QB 1EP4A 1VJQA 4MYTA 4G1QA 5B0EA 1B64A 3KHLA 2FZKB 2NXNA 5IV3A 4ITSA 1VQLS 2CQIA 3DDNA 4J9SA 3W7BA 3MURP 1LNQA 3IBCB 4DUYF 2G1HA 4NWBA 2CJKA 4ER8A 3DGPA 3PHTA 2JLFA 2YKQA 4I4BA 5KT3A 5E0OA 1X5PA 2B4OA 2AJ4A 2H48B 4IFVA 4CH7A 2N7CA 1V5VA 2W24A 3O1LA 5L8RC 5D6GA 2OTLS 2XMWA 1AROP 2YNFB 1IBLJ 4UZCA 2DNGA 2ROPA 2CNLB 2JH3A 4YDXA 3CMES 4ILLA 2GMJA 2KFYA 1XNQJ 1FRKA 1TUWA 2A0FB 2IJFA 4FXDA 1IVZA 4CLKA 3N6NA 2N82B 2VQFJ 1N88A 1VJWA 3MAHA 1CJKA 3IR7B 2P9GA 1NAQA 1SIWB 2DNKA 2SXLA 1NBEB 1T9YA 2YX1A 4UOFA 3J7YU 1HI0P 1SPBP 4JI1J 4QYZJ 4OYAA 5C7PA 4TU7A 2WSFC 4DF8A 4C3KA 4GVLA 1SUQA 4N47A 5KFNA 1KONA 2RU3A 3MM5A 3TWZA 1M1KT 4PPDA 1X0PA 1ZM4A 2QT7A 4X84A 5FD1A 1WC1A 2HLTA 5D0GA 4X64J 2RIJA 4DV0F 3GJSB 1LWCB 3FEXB 1UWBA 2CXEA 4DZ6A 5F8HA 3MFHA 3RBDA 5J2PA 5KFFA 3IRXB 4RBVA 1H7WA 1IBCB 1RHJB 1TKTB 2QA1A 4HVZA 3LP0B 4ICLB 3TRGA 4CYUB 4WWSA 3SCKE 3NGTA 4NZ0A 4LRAA 4TY8B 3HF5A 1NSQA 5K8MA 4IRKA 1T03A 1MMNA 3FC9A 1D1UA 4QR0A 3FCWA 7FD1A 3EVWA 1JLFB 1UWAA 4FP9A 4Q43A 2HHUA 4Y34A 1FK9A 1KLMA 3TEHB 4CQ1A 4MKYA 4F36A 3I6PA 4N56A 1A9NB 3L7UA 3K17A 2Y9HA 3HHNB 1JNRB 4GO5X 3G8SA 1JLBB 4JI5J 4QU6A 2HBQB 4PWWA 1OSCA 3SCIE 3C6UA 1N56A 5KFSA 2HNYA 4NCAA 3S01A 2JNJA 2OGUA 4DR5J 1RP5A 1OIAA 4M5MA 3DLBA 2RSQA 4UQGA 1WKLA 2J0XA 1Y5IB 1MG7A 3BKFA 3LW5C 1FX2A 3QT8A 5E3CA 2GV1A 4ZDNA 1TL7B 3N5FA 4C98A 2ZUAA 1TR0A 1AXQA 1TL7A 1KEKA 5HLFA 2V5HG 2NPIA 3BGRB 1SC6A 3UD3P 1BQMA 5CZVA 2R2SA 2OPQB 4I1TA 1VRUA 4ZVHA 3HVTA 5HANA 1DFDA 4I6AA 1KBRA 1XR5A 2EFNA 5L46A 2J6TA 4PWUA 4LRCA 3G82A 5HL7Q 4JV1A 4RX6A 2YKMB 4QWDA 3C46A 4UTGA 4WP8A 4B9VA 5IV4A 4X62F 4B9MA 3PCOB 3UDVA 3OVSA 2NSBA 3L9ZA 3T1YJ 2L08A 1ZH5A 4OI2A 3SCLE 5KG6A 1KHWA 1RT1B 2QV6A 2XMJA 4OI4A 2BQ3A 4B9SA 1ZBTA 4F4XA 2LEPA 2ZOMA 3R5BA 4QPTA 3EMTA 4K4ZA 1RT5A 3QAUA 1YIJS 1KRPA 1SJ4P 1P9QC 5ETVA 4DR7F 1F3VA 2XG8A 3FMBA 3H25A 4LREA 1XC9A 3M05A 4JV5J 1WORA 2E5GA 4C8ZA 3BN7A 3DLJA 3D6HB 4R8UB 1IKXB 1RZMA 5CD4A 2QMWA 2XMMA 5HAOA 4MFBA 1VK3A 2CPYA 4HHHA 4NL5A 2C2OB 2HQFA 4ZPVR 1FI4A 3OR2B 5A76A 4UY85 1AUSL 4Q8EA 3K59A 2D7SA 1UFLA 2ZC3A 2CG4A 2HQ3A 5J1EA 4CTAA 3DMJB 4DR6F 4JYAJ 2I5JB 2HZAA 2UXDJ 2BJ9A 2XZTB 2DGSA 1FESA 2IYIA 3RAMA 4DX6A 3KK1A 2D3OR 2RF2A 4DV7J 1UL3A 1XR7A 4DPWA 3MXHP 2UUAF 1WOOA 2M4MA 3QMQA 5E3QA 1O0PA 3CPWR 3W1YC 4DUZJ 3MWBA 5AXKA 4DR1F 3JXOA 3LWMA 5EHHA 5HVHA 1MLAA 1F60B 1TVRA 3CSKA 3IP0A 3DLGB 2HMIA 2MLXA 1U45A 5DDRC 1TQLA 2A3JA 2UVVA 4TQRA 4ED5A 2CJBA 2KO1A 1EAYC 2X1GA 5EWEA 5KG2A 5H9EK 4CT9A 4HT5A 3NKYA 3FVYA 1F2HA 2MQOA 3CCTA 2ZE2B 3HVAA 2CA9A 2NPFA 2E1MC 1EX8A 2DKOB 1VRTB 2LXUA 2ZBCA 5U47A 2LFVA 3KDNA 4USJC 5CAAA 2KXFA 2WOMA 4LF8F 2VPZB 4J9KA 2NR0A 2Z30B 2FZGB 3MMAA 4OZ5A 2G0IA 2GHPA 3AD8C 3MPDA 2VODA 1KLMB 4CLUA 2MB0B 5A0YA 1NHVA 4NCBA 3FFIA 4TLQA 2AP6A 2LECA 1WDDA 4GKJJ 2MQ8A 3C6UB 3IG1A 1T9UA 2ZHAA 1PJ6A 2Y1IA 3BR9A 2YNFA 3B78A 3CCMS 4J9QA 4ED6A 2VOPA 4FYXB 3RR8A 1CSJA 2E29A 2E5IA 2YTCA 1JJ2R 2GMLA 1WC4A 2PI4A 2IFXA 4UZBA 1S6OA 3CB4A 3U1LA 2WBMA 2PEBA 1X4CA 1BQNA 4ILMA 5KFVA 3H2LA 4TKTA 3A8JA 3CMAS 3LP2B 1PKUA 2F63A 3JTPA 4B9UA 4USVA 2AX1A 2B43A 3HKZD 4NMXA 1MROA 2CJ9A 4NLPA 3KLHB 3H20A 2OI2A 1NJIT 3M2VB 5HJYA 2J7WA 2YXLA 4IKAA 5DGBA 2AJ2A 4NZ6A 4ZVOB 2KT3A 4FS1A 2H1YA 3LP1A 5HMZA 3M9OB 5J2NA 3NGUA 4EK2A 1IJFB 1PIEA 4YFUA 2V8GA 2J7KA 3OFFA 2ZDPA 1CG2A 1F9HA 2FHJA 2IC3B 1NZ8A 2J8SA 4JI2J 2VG6A 1N54B 4OZ3A 1B3TA 2XCAA 4CZCA 3BM7A 4F4WA 2MHEA 2V94A 5K9FA 1GTHA 3I5AA 4Y2IA 5LOQA 1SJQA 3OHBA 2DPJA 1N32J 2DNHA 3WC0A 3KMSA 1VBXA 3M1VA 1K47A 2DNYA 2GAHC 3WBZA 3CD5A 2FD2A 3QYYA 5DLFA 4LFBJ 1RLCL 5RUBA 3Q8SB 2BZ2A 2RUSA 2ZBQA 1ULRA 3NOGA 4N77A 5D78A 3VALA 2DH8A 4DV4J 2XY6A 1D0EA 2PN6A 3C66A 3ILLA 1D9DA 4P2XA 2VPYB 2Y8YA 1M5KC 1DHMA 2ZH4A 3H59A 4LFCF 2QSFA 3N9UC 3ZXWA 2FHKA 2HBYB 2PE8A 4ZCKA 3V4IA 4J90A 4LF7J 1AYEA 4USHA 1SH0A 4QIWD 3G2XA 3ZTSA 3PEJA 4S0MA 1BQMB 5KG7A 4HLBA 2ZH9A 1QUVA 1Q95G 1WSRA 2OTJS 4NYOA 1FJCA 2BE7D 3MUTP 5IT0A 2R8HA 1Q81T 1UVJA 5IWAJ 2LQJA 3GR1A 3KHRA 3F0NA 3NG8A 1M1GA 3BSOA 3W9JA 2EI5A 1WELA 4XK8C 4FF3A 1YK9A 4NRUA 2VG5B 4JBCA 4YN3B 4O3OA 4J9LA 1VLYA 3JSBA 5CYMA 5DS7A 3ZFVA 5H9EJ 3BO3A 2H5JB 2YQ3A 3T9ZA 2IJRA 4RUCA 3OJSA 1NKBA 3T5HA 4MKBA 2JEIA 2QGFB 4NLSA 2JOQA 2EG1A 2X51A 2CQ0A 5THWA 2DY9A 5GADU 4ANCA 2C22A 2JEJA 1PCAA 5HN0A 4X4TA 3CUNA 5DM7Q 1RCOB 4ETZA 1KVIA 3FSYA 1RKIA 2CVEA 7AT1B 2HRYA 3HI9A 4BBYA 3A12A 2KJWA 2PA8D 5HATA 4JI8J 2HQIA 2EC0A 3MEKA 3W3SA 3NP5A 2WRMA 2R7SA 1OSDA 2KVIA 3J81j 3JYTB 1SCJB 2V8PA 3CCES 4NXMJ 2HHXA 2ZOFA 2YPZA 2I5JA 1A7GE 3MECB 1FDNA 3PJ9A 4ZCMA 3DMJA 2KZZA 4RPFA 2FTRA 1NDPA 1S49A 3PHEA 4QWEA 2DRAA 3KJNB 1KKHA 3WIUA 1YJ7A 2CIMA 3CDBA 4PPZA 3RTVA 3VAMA 2DCUB 1S48A 5D3GA 1MSWD 3TAMB 4TU9A 1AB8A 3W9HA 5C2CA 1K44A 2W7PA 1DLOA 2R8IA 4HI2A 4EZ9A 3VCDA 2OLWA 1Y0HA 5M2RA 4ZKAA 4Q44A 1S1TB 4GO7X 4JOUA 4WTYA 4PZVA 5DETA 5J2MB 4HI1A 5DLGA 2WVEA 3R6LB 1VIXA 2LCWA 3EXCX 3N6LA 2DIVA 3NAIA 3AJ1A 1R31A 1VLOA 1WG4A 2F8EX 2HIQA 1IJEB 4OI6A 2QFJA 3DLEA 2WW8A 2APOA 2KHDA 1SH2A 1D8ZA 5BYRA 4IG0A 3FEYB 3E01A 4ZP9A 3LP0A 4CYUA 3PX6A 1OY8A 5LSRA 3LQVA 2CDRB 1VQMS 2N4CA 5F8IA 1T95A 3BGOP 2RKIA 4JI0F 2R8GA 3W5ZA 3SI8A 3MCOA 4RNMA 5EWGA 1OPIA 1GX5A 5CYQA 4KJIA 1NM2A 4CTAB 1S59A 1J5EF 4C9DA 3ILJA 1IKVA 3GYXB 1N48A 4EWTA 1HNVB 3BSAA 2NSCA 1HNIB 5I3UB 4JV2A 1TL1A 4LF1A 1ZTTA 2C1EB 2V8VA 2PFDA 4E2FB 3LH2S 1Y5LB 2AHOB 4RUHA 4P75A 2H51B 4P2FA 4V19X 2MDAA 4AQYF 2BV3A 2JRSA 4J9UE 4CH1A 2RHQB 3OL6A 2PMWA 2IHR1 2ZNYA 2LQ8A 1VQ8S 2YNIA 3O8WA 1H2TZ 3DLLQ 2B7BB 1SC1B 1F6TA 3BGUA 3TJ8A 2KG0A 4TN2A 4K2XA 3DM2B 4LQ9A 2XEXA 3EDRB 4RW4B 1D3WA 3L4BC 1HQEB 4C97A 4CH0S 3Q8PB 5ADZA 1AUDA 4DR4F 3SFGA 2XZWA 2E9ZA 2YKMA 5EUHA 2RDDA 2E5LJ 1UP1A 1L3SA 5HQ8A 3DLHA 3SFUA 4ZLNA 3QFHA 5KFJA 1HW9A 2NCKL 3A1YG 4DV6F 1GNKA 3CD7A 4M5JA 4F4AA 5CD4H 1RTHA 1SH3A 3QSIA 1K1QA 3HLUA 3V4MA 1IBMF 3T1HJ 2CNNB 3GJRB 1UJ5A 4PXEA 3I4PA 4RW6B 2VFTA 3JSRA 2RU9A 5ETTA 2HNZA 5A8KA 2KTQA 4MIBA 1Q53A 3OFEA 4P7VA 4C0BA 2A6MA 1IQTA 4CRJA 2C3MA 4RLEA 2YWKA 2HZVA 3P4UB 5T7LA 5BR8F 2GGPA 3G4SS 1SL0A 2UXCF 2XO7A 4H54A 2BOPA 3RYLA 3FBFA 4X4SA 3D68A 2GJIA 3L7OA 3LAMA 4W4MA 4F3MA 1UPMB 3VGTA 3VZIA 1W7WA 2HHTA 4K4SA 1Y4ZB 4B3SJ 1S7HA 4I0WA 4CO0A 2FVRA 3EGWB 3M6VA 3POTA 4LUBA 4UW2A 3PR5B 4NASA 5GAHI 2DJWA 1U1QA 1NPRA 3CC7S 5KG3A 3M2UA 1E6YA 1ZOTA 1U1LA 2O1PA 5DDOC 4DSEA 2GAGC 4N76A 2F4VF 1UWBB 2Q3PA 3ZZTA 5B0GA 5EDWA 2RB7A 2Z2MA 2MQQA 1KWMA 4KR0B 4RU2A 1FVQA 4G65A 3CJTA 4AL7A 1OWXA 3NXZA 4NEZA 2VPXB 1HBUA 4ZIWA 4B9LA 4UT4A 1L5UA 1GXLA 1NHKL 1YLXA 2EEYA 1P9YA 2VBZA 4LFAF 1YKWA 1EB0A 2KT5A 3NGSA 1KQSR 3UNGC 1JLCA 4JI4F 4CWBA 4UOHA 4NA2A 2VKRA 5CZXA 1TKZA 3DRXA 3OFGA 5HBMA 3RW6A 1CEZA 5A2QY 3BGFA 1TKXB 4X4NA 3I56S 2QL9B 3D0IE 2AQ4A 1U2FA 1VFJA 1AFIA 2MKJA 5IOLA 3IAM9 5KFHA 1FO1A 3G8QA 1RAEB 2OO4A 3LALA 1ITPA 4FNIA 2ASYA 5DDPC 1AT1B 3A3OB 5F41A 3C6TA 1IR0A 3VQTA 2ACMA 2VQEJ 4EYHB 4DXLA 3ET6B 2AV5A 2OMOA 2JHEA 3G87A 3BQ0A 4D3GA 1NDCA 1NMEB 2BE2A 1V3ZA 2WVBA 1GMVA 2G9OA 3AOAA 4HACA 4KH1B 1FJ7A 3DN9A 4QIFA 5EN1A 4GMKA 5HJXA 5H9FJ 3J81Y 3OL7A 1MN9A 3LP2A 2W9CA 2NXJA 3MMCB 2HHWA 1YI2S 4USTA 2N7YA 4ES1A 1KC8T 4I2PB 4K4TA 3HVWA 4AYBD 3TA1A 4ENOA 5HMXA 2R9LA 2MGZA 4Q8FA 4WTOB 2UUBJ 2XYPB 3G6VA 2AGPA 1X4DA 2DISA 3OTEA 1LW0B 3MI7X 2FZCB 4N5SA 2O3DA 1RTHB 3R7BB 4P73A 3DU5A 2FVPA 1KDNA 4C4WA 3CTRA 1J5EJ 1VQ6S 3ZC4A 3I87A 4JI5F 2BA9A 2B4PA 2CPHA 2PIIA 5BXIA 3EXYA 3VF0B 4OHXA 1VHFA 3HX9A 1S97A 2R2UA 4C8KA 2F3JA 4IG3B 3D28A 3R7SB 1JLGB 5D4NA 2DRDA 1Y10A 4EO6A 2DPIA 2LEBA 2DR7A 1FE4A 4FF4A 2AJQA 2VFRA 1D9AA 4DV3F 1FRJA 3BQ2A 1R0BG 2DNLA 2XYHB 2F8HA 3VAGA 3I5BA 2N4DA 1FKOA 1XBWA 4OHZA 2FLNA 4RL1A 3N28A 1ZAWA 3KUEA 3EZUA 3BR8A 4IRCA 1S79A 5LJ5Y 3MAAA 1KVKA 3VTIA 3CDUA 3GPAA 2J6UA 2HVZA 3MOZA 1RA6A 4HR2A 2M0GB 3WDOA 1TELA 3M8SA 2NQPA 1RISA 4WE1B 2CQ1A 3T1YF 3M8RA 2KVQE 1U7LA 5KFAA 5A6WA 1OPZA 2YX4A 2QL5B 2WONA 3DOLA 4KKOB 5LSLA 1CJUB 3TYTA 4ECZA 5AXMA 3SYZA 4IR1A 2FIUA 2IA0A 4JI1F 3MD1A 3SQGB 1Z1ZA 1HNZJ 4CNZA 4J9PA 3EGNA 4DR7J 1WOSA 3KKFA 4CLSA 1HKAA 4WF9Q 3MMCA 3RJMB 1WEXA 3V81B 3AODA 3G6YA 1RT1A 3CJ0A 3O5TB 2KI2A 6AT1B 5KFQA 1HR0J 1N5TA 2RKIB 3F56A 4LRBA 4C2MA 1TU0B 4NLWA 5C42A 1VQPS 1T9TA 3P45B 3Q22A 3NNCA 3DOMB 3UWTA 3NMAA 5DO2A 4DX8H 1OMSA 2ATCB 3SSSA 5JJBA 4DHVA 4DV7F 5IM0A 4R8UA 4ALZA 1PYSB 2VZ9A 3NWRA 2V2KA 2VFUA 3SIPB 3SEOA 2V34A 3PNIA 1IKYB 1LK5A 4FN5A 1NH8A 4KQZA 1HWKA 1L3TA 5C25A 4DSIA 5DDQC 1RHQB 2DB1A 2V68A 3ONQA 3S7RA 8AT1B 1FJEB 3GIMA 2JX2A 5HROA 2WVFA 2ZBPA 3KLIB 1FKOB 4HACB 4AFFA 4RU9A 4ECWA 5LMNF 3KUHA 2QSWA 1N5YB 2CYYA 2V8HA 3VV2B 1B70B 3AXMA 4F0MA 2I2YA 4QW8A 2IBKA 3KJFB 3IS9B 3ZTQA 2ZJRQ 2OJ3A 3QO9A 5AE2A 2UU9J 3FZBA 5KFWA 1N34F 1EKSA 3FMWA 3ZTRA 3MAQA 2QA4S 1UEKA 2BJ3A 2CJYB 2GW8A 1TL3A 1S6QB 2ILYA 1NSAA 3P3DA 3RZAA 4XIUA 3BJYA 1JKHB 3M30A 4RNHA 1FJGJ 3BN4A 3LP1B 5J2NB 1XMQF 2ZKTA 1YRXA 3MPYA 2R8JA 4B3OB 1DQ8A 3M32B 3MHYA 4WFBQ 2OMLA 2AX0A 1V6HA 2V4JB 2WSEC 2L9NA 2RQ4A 4FYWB 3TA2A 3NOCA 4CIOA 1JWWA 2EKYA 4O3QA 3EDQB 3GFYA 2BM1A 3CEDA 5CYMB 4RNFA 2FVCA 1RWXB 4X64F 2BOAA 4L74A 3MMJA 2DXFA 4F50A 5GMKa 2HQDA 3Q0AA 1Q8BA 4JV0A 3Q8UA 4M63A 1VISA 4ZK7M 4DPTA 1SC3B 1RT2A 4P9SA 2FHOB 2WB1D 3D6FB 3P6YC 2QJ3A 4KSEB 5MLCV 3NCPA 1FFSB 3BZQA 3NL0A 3OV7A 1FRIA 1LFWA 3MPUB 3FUYA 1G1XA 2QO3A 2UUWA 3J81U 1OJ4A 2B9YA 1TAUA 5KT2A 3V4IB 2BJ7A 4KTQA 3OL8A 2DGVA 1SKUB 5E41A 4H4KA 3V6HA 3R2DJ 1YX2A 2NXUA 3GV8B 3B6BA 5K8OA 1C0UA 2VJUA 4CO1A 4WXWA 2MSSA 1FXLA 2HW3A 3PKMA 1LWFB 2PA3A 2EFPA 2UUAJ 4NRTA 2IAJA 4IFYB 2KN4A 3RW7A 1EKRA 3SZ2A 2Y3YA 3JS9A 2P6TA 3L09A 1ZTWA 2HRTA 3BBFA 1JX4A 4FF1A 4K5SA 1EP4B 3MEEB 1DTQA 3MM7A 4LRFA 3IGVA 4X66J 2P9EA 1HFEL 1HMVB 4JI6F 3OXLA 2V2ZA 4DFKA 3AB4B 3GG0A 3I0SB 3M8QB 4JP8A 3VVUA 4EI2A 2KXNB 1N8RT 4FPIA 3BPDA 1F2GA 3KHHA 4M5KA 2VU5A 3UW1A 1RI7A 4TYBA 2D3O1 3R6GB 4K4VA 4JB8B 4NA3A 4DV4F 5D4OA 2HYIB 1W26A 5IM0B 4OHWA 4LR9A 1NJZA 2NUUG 1SKWA 3Q86A 2MQNA 1RLDA 1ZYQA 3UD4P 4U6PA 2EVZA 2M8HA 4M5LA 1VBYA 4KGKA 3GIJA 4OL8A 3GCXP 1RK8A 1U24A 2DNMA 3HHEA 4FVMA 5I3QA 3D2WA 1YJNS 2BYCA 1NK4A 1JLAA 4KFBA 3W63A 4DBQA 1NUEA 4DQIA 2NLWA 3FSXA 2XGPA 1CBKA 3O3LA 3RBZA 1YSJA 3CNQP 2G0JA 4PXCA 3TNVA 4ZHRA 1N5YA 3FQLA 4HT7A 2E5HA 4AD6A 4Q0BB 3CVKA 3T41A 1IUJA 1NK9A 4CCHA 2I1RA 1M5HA 4KO0B 4O3RA 2ZKUA 3D3BJ 3LAKA 1UVLA 1HYSB 2AT1B 1RAIB 2K06A 1S1TA 3OTDA 4LVNP 2E1CA 1RKJA 2UZAA 4ECQA 1W25A 2VQFF 2UXDF 5A8WA 3PFEA 4DL6A 1HIYA 3EICA 4DCOB 2WB4A 2L9DA 3M32A 4ECYA 4HTIA 4OZLA 4L6V3 4K5RA 1FT8A 3TVKA 4DR3J 2CWXA 3KG0A 5FJ4A 1WI6A 4CI0B 4KH0B 1GMUA 3EWGA 3AQOA 2CQ2A 4FXWA 1OO0B 4ZCLA 3TOQA 4GVBB 1HBOB 2CQ4A 1GXTA 2JVOA 4HH1A 3R7NB 5GAHU 4YHHJ 1U1NA 3TVZA 2QL7B 3A8IA 4EZ6A 1N5VA 3CCLS 4MT1A 2CNOB 4NLRA 3IO1A 4OLOA 3NAHA 1FD8A 4RW7B 4TLRA 3UDLA 4CO5A 6FD1A 2N3OA 3KLHA 1DZ5A 2JEFA 3ISZA 1RT6B 2ZITA 4F8RA 2DNPA 1RT4A 1KNZA 1TK8A 3NNHA 1TV6A 4A47A 1D8YA 3FBEA 5ETOA 2DNOA 2Q6BA 3Q8RB 4P74A 2HBZB 4LF8J 5HMYA 2VPWB 4WE1A 3O44A 2OPSB 3R5JB 2ZH6A 3AQPA 3DRPB 4U7CA 4A8MP 1N34J 2IRUA 2B3TB 3IWNC 2YNIB 4UQTA 4DV0J 2MLZA 5IQQA 1Q7LB 3LPEA 5D0RA 2HEKA 5I4MA 5IXUA 2Z58B 1U1OA 4QWCA 5D4LA 2W9CB 1RA7A 1YJUA 3AY0A 1GTEA 2B51A 4B08A 4CNYA 2XB2D 2R7XA 3VGVA 3HULA 3DLKB 2HPUA 4DR5F 1CPZA 5HP1B 2J9CA 5B0AA 3OUYB 1NK0A 3N5BA 2XNQA 4P52A 4H4OB 4P6QA 2RRAA 3ENWA 4K0KF 2FLOA 3CDAA 3FQKA 3PO4A 2E7VA 1HWLA 2HVDA 2QN6B 1VC6A 5KT4A 3TZZA 5A6PA 2FVQA 3OD2A 2DGOA 2MKSA 2LKZA 4LVOP 3PG9A 1ZM2A 2YKNA 4CO4A 2E9TA 2B0GA 4UOGA 3OTOJ 1SV5B 1NNDA 1O6XA 2YWGA 2Z2YB 3LO3A 1V5IB 2HRUA 4K8RA 4OZ1A 1YBUA 1TUVA 4F0HA 4LSNA 2ZH2A 2C42A 4C8OA 1WKKA 3D6TB 3OFHA 1U1PA 3QLHB 1RCXB 1JLGA 1U0HA 2MZQA 2ZOGA 1JLFA 3IM8A 4FF2A 4GVBA 2BJDA 4ZVEA 1HQUB 5K8PA 1PGZA 2HHHJ 2HGLA 2ZVIA 3CWJA 3R1HA 4XPCA 3MD3A 3I32A 4QIGA 1HD0A 2AYEA 2CPFA 4TVAB 3AAWB 2WK4A 2H3EB 1UA1A 3C2PA 4L75A 3VAHA 4DFJA 1M5PC 1FX4A 1YG0A 3VGSA 2XMKA 1M90T 4CDIA 2UV8A 5KFCA 4PUOA 1Q4RA 3ETOA 1JIHA 3U27A 4PCQA 1R8HA 4Q0BA 4DF4A 2BJ1A 3S8SA 2HNDA 4NOHA 2X1FA 4F3QA 2GVDA 3OW2R 1VDHA 2GO8A 3AD9C 4M94A 1QD1A 1E6YB 3BYPA 1RSCA 3GYGA 4HEA9 4LSZB 4EUVA 2OH2A 3J7A1 1BLUA 1IBMJ 4AE5A 1EETA 2K1RA 2C2ZB 3EX7B 2ZZNA 1YBTA 3TX0A 3Q89A 3QGHA 4X4UA 2B5JB 3SQGA 1R43A 3G9CA 2JSXA 3MCNA 3CC4S 2RUGA 1VBZA 4L73A 5CXTA 1R8CA 4M5DA 4R25A 4DG1B 3IXQA 2BKPA 2X1BA 3BKTA 1WHXA 3C16B 3IAS9 2CPXA 5ETQA 3HMJG 1NKCA 2A10A 2EWHA 1HQ2A 1HBMA 1QE1A 4K50A 1X8DA 1S12A 2ZFHA 3ITHA 4PEOA 1QAIA 2DH9A 2X7IA 4ED3A 3AJ2A 2CQHA 4MH8A 2E7WA 2XHWA 2XMVA 5LJ3Y 2MKCA 3PJWA 4O44B 5DG8A 1N6QA 4UF4A 3ADAC 2C3PA 2K8GA 3IG1B 1WEZA 1KN6A 2HS3A 2V8DA 3KLVA 4JI7J 3CIZA 2OD4A 4IOBA 4OV6A 4DV5J 4Y2KA 3B54A 2J8AA 4LF5F 3FRZA 2F7VA 2BE2B 2G0CA 1FNOA 3TARA 1UAWA 2I8EA 1RB0A 2FYXA 2OSRA 3EZ5A 2H9ZA 3N01A 3QGPA 2ASDA 2A1BA 3UFCX 2D1CA 2OFGX 2YY3A 1I1GA 4O3NA 2JLEA 3HT3A 2LDYA 3K5MA 1V9OA 2Y1JA 4WU2A 1HHTP 5I42A 3AA9A 4FVCA 4OI0A 2QMXA 1URRA 2EFVA 2V69A 2YKOA 3NCRA 2N3LA 5KFGA 3IWXA 5KFIA 3TA0A 5LXRA 5LM7E 1BMQB 2VDHA 5F3ZA 4XO0A 1L3VA 1S77D 5J1NA 5KFLA 4I69A 1H0HB 1O51A 2CADA 2WOMB 4JI8F 2Y0BB 4NI2B 4ZJLA 2BW2A 2C28A 3C15B 2F5GA 2OIHA 1MW7A 1R3NA 1S4FA 2OFHX 3MEDA 5M2PA 1IBKJ 4O0NA 1R8PA 5KFTA 2J0SD 1C1BA 3IBWA 2NZCA 2JEGA 1TKXA 4V1Ak 2OHDA 4LIRA 3V6DB 2G13A 1NO8A 3ZTOA 3DRYA 1C0TA 1Q0NA 3ILIA 5B0CA 2HNDB 1UW4A 4ZPTR 3V2UC 4DR2J 1FWLA 2C3UA 4RNOA 1R8AA 1NB7A 4JYAF 1BWEA 2FY1A 4JI3J 1QVGR 1DTTA 1UCNA 2CZ4A 3CJQA 2ZM6F 3CW2C 1FERA 2K1RB 3T5LA 1N4LA 2FDNA 2U2FA 3PRBA 3UDCA 1LWFA 4L72B 1FRHA 1U48A 4O4GB 1DBDA 4RUAA 1QTMA 2RJZA 1VQ9S 3BDPA 2EBEA 2FVSA 5K14A 2VG7A 1PAEX 4PXBA 3W2VA 5D0EA 5I3PA 4B3MJ 2E7XA 2CZ9A 2XMAA 1R0AA 4KT0C 2CPIA 3BDEA 1RBLA 4B3TF 1O8BA 1SQEA 2IM1A 3CF5Q 4FDFA 5J2QA 1IXKA 2M70A 3BSCA 2Z2LA 4DN9A 4Y00A 3AOBA 3I55S 1NJWA 1PSDA 3FRYA 2W2OP 4OZ2A 5FDLB 3KFWX 1VC0A 5KFBA 5DM6Q 1SL1A 4WFAQ 1S1WB 4WZMA 4ED2A 2POKA 4X4VA 3WZ0A 1E6VB 3HD1A 1NJYA 3QLHA 4WIQA 4H4MB 2MJNA 1NK8A 4WKYA 4OMFG 5B7WA 4F2RA 1IKYA 1PBAA 3DDKA 2UV8G 1HNWJ 4C0HA 1HQUA 2UXBF 1FK9B 1HLWA 2Q43A 1TMJA 5HO4A 1RYSA 1N36J 3V5RA 5ETRA 3KK1B 3GONA 1FNXH 3OPKA
chains in the Genus database with same CATH topology
1F3VA 1F2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3V A;  1F2H A; 
#chains in the Genus database with same CATH topology
 3M8Z A;  3UR0 A;  3H7H B;  5T41 A;  5ITH A;  1FD2 A;  2C3Y A;  2HZC A;  4WBF A;  4BCA A;  1T0T V;  4X4O A;  2HK2 A;  3DC2 A;  1F5C A;  3PX0 A;  2V4R A;  3OT9 A;  3ZNJ 1;  1R27 B;  2PI5 A;  3J80 Y;  2C2K B;  4C8N A;  1NH7 A;  1M5V C;  2YPY A;  2XZD B;  1OYE A;  4ZPC A;  2K7J A;  2VAS A;  4P72 A;  2AYB A;  2YVS A;  1F5A A;  2P6S A;  3MDF A;  4KE5 A;  4RKU C;  2IIH A;  2HG4 A;  4RR5 A;  4C11 B;  4ZVP B;  4C11 A;  4DPU A;  1RWN B;  1SQG A;  1YJT A;  2DO4 A;  2AEM A;  4OYM A;  4RUB A;  5D15 A;  2EBG A;  4E98 A;  5HMW A;  4DUZ F;  3OVB A;  1U6F A;  1UPP A;  3KK3 B;  1NDL A;  3H0P A;  4F4Z A;  5IT9 U;  3QPI A;  3T6J A;  2AF6 A;  1X5O A;  3D0H E;  1VQY A;  1H3D A;  3HHL C;  4K4U A;  1QE1 B;  2G1D A;  2I6W A;  3KWM A;  1LQ9 A;  3PX4 A;  4XTT A;  1AW0 A;  4Z7Y A;  4EU0 A;  3D66 A;  1BE4 A;  4IDK B;  1XMQ J;  3M9M B;  1JXE A;  1V3R A;  3OL9 A;  8RUC A;  3PM9 A;  3NGR A;  4IH7 A;  4O0I A;  4YY3 J;  1TV6 B;  3LF0 A;  4PR6 A;  2G2O A;  4OHY A;  1C0T B;  2CQG A;  1NXI A;  2CRL A;  1N0V C;  4Y2M A;  1QDU B;  2FJV A;  4F7V A;  2IY5 B;  1YDL A;  4G1I A;  4NML A;  2OD6 A;  1Y3J A;  3OXF A;  1S9G B;  2HWI A;  4A8F A;  4I67 A;  4M8L A;  4PWD B;  4OHV A;  4ZS6 A;  3GIK A;  1JLA B;  4RW9 B;  5J1E B;  4KBI A;  2MZ1 A;  4Q2L A;  3ZNU A;  3BGR A;  2VC1 A;  4URG A;  4DMZ A;  4X65 F;  2B56 A;  1RAB B;  2OEM A;  3EGV A;  3PW5 A;  1ZPV A;  3AOC A;  3LAN A;  4DV1 J;  1D9F A;  2HSE B;  1B4S A;  2PSZ A;  3PO5 A;  2BW7 A;  2VBY A;  1XMB A;  4LBH A;  2XLI A;  4KHM A;  1B7Y B;  4KGZ B;  5LMU F;  2ADB A;  4DR3 F;  1UW9 A;  3PW7 A;  2ZH8 A;  3I0S A;  3M8Q A;  2KZM A;  1RT5 B;  4A46 A;  3EZO A;  1LWX A;  2M5Y A;  2FQQ B;  1LOU A;  5D77 A;  1DJ0 A;  1BXN A;  1GXU A;  3A4T A;  4A8Q A;  3I4H X;  4Q2M A;  1NZA A;  2HVE A;  4U8Y A;  1BHN A;  4XDD A;  1S1W A;  1YWX A;  1Q79 A;  2PDA A;  3IFE A;  4MK9 A;  3I9Z A;  3NCQ A;  3UDE A;  2MQP A;  3GV5 B;  1KVJ A;  3SV4 A;  3BBC A;  1U26 A;  4NLX A;  4EEY A;  2VB6 A;  1JQG A;  2XTJ P;  5IC4 B;  3W66 A;  1MMD A;  2HGM A;  3GMG A;  3ETM A;  4NI2 A;  2Y8W A;  1J27 A;  2DTJ A;  1X7V A;  4OJG A;  1SKR A;  3VQS A;  3CD0 A;  1L3U A;  1FRM A;  1RT7 A;  3TQE A;  4ED8 A;  1RWO B;  3DYA A;  2MJU A;  3HT0 A;  3E2E A;  2AGQ A;  2DK2 A;  2H54 B;  1P27 B;  2VUG A;  2WZ1 A;  1XMO J;  2GQQ A;  3AXK A;  3QAE A;  1KFS A;  3TVY A;  1VCT A;  1LKZ A;  4X4R A;  1YJ9 S;  2KG1 A;  1JB0 C;  4WYW A;  3VWS A;  3ZZP A;  3J7Z T;  3DLG A;  2AJF E;  4OX9 J;  4Q7A A;  3J80 U;  2JJ4 D;  4NYP A;  3MR6 A;  2CQD A;  4H4K C;  4B3T J;  4HDG A;  4WK3 A;  3NNA A;  1S9E A;  4MKV A;  3TUP A;  1CJT A;  4ECU A;  4PYD A;  3UO0 A;  3BSN A;  2V9K A;  1LEO A;  5AJ3 J;  1NB2 A;  2GNK A;  2L48 A;  4EO8 A;  1KR4 A;  3LPY A;  3M8W A;  3SXL A;  4K4W A;  4PQU A;  2XQC A;  1VGY A;  1LV5 A;  4UUX A;  1IKW B;  2CQ3 A;  1BGX T;  3KOA A;  2QMU B;  4O3S A;  1PYO B;  3BEG B;  4PG7 A;  3QWU A;  4L76 A;  4JV5 F;  4WFX A;  1SKS A;  1MML A;  1UZD A;  1M1H A;  3EGZ A;  4DV5 F;  1RJJ A;  1HNW F;  2W9A A;  1YIT S;  4ERD A;  3UD5 A;  1AFJ A;  4K2J A;  2XI3 A;  1X5S A;  4ES2 A;  3GP9 A;  1HD1 A;  4KV8 B;  3LGH A;  3D5M A;  4FBT A;  1EQM A;  1JLQ B;  2F4F A;  2LA6 A;  5B08 A;  3IWL A;  5CCM A;  4DSJ A;  2HFV A;  2KJV A;  4G3I A;  1S4E A;  1S99 A;  4OQJ A;  4F04 B;  3UVJ B;  1DQ9 A;  5DQG A;  3UN3 A;  3PYG A;  2YWE A;  3K0J A;  3DI6 B;  3JQK A;  4DL3 A;  3U1M A;  1OQ6 A;  3KLI A;  2B8Q A;  4QJV A;  1X0F A;  2BEF A;  3DM2 A;  2CG8 A;  3R3T A;  4RW4 A;  3MTJ A;  4YQW A;  3Q2T C;  3H5X A;  4OX7 A;  5F3T A;  4DQQ A;  2DR5 A;  4DL7 A;  1RDR A;  1HNZ F;  3C8Y A;  2W25 A;  1K0V A;  2HFO A;  3KJV B;  1WD6 A;  2YH1 A;  2BAN A;  2AD9 A;  3UI3 A;  1HWI A;  2ZEJ A;  1TAQ A;  1ACM B;  3CJ8 A;  4AND A;  5IT9 Y;  1U8W A;  3GFH A;  2B4V A;  2DHG A;  4RO0 A;  2DHA A;  1H73 A;  4K4Y A;  1RYR A;  5GAG U;  3US5 A;  1FXR A;  2G2Z A;  4ZN1 A;  1MU2 B;  4ZPA A;  3J7A N;  4X4P A;  1LWE A;  2FUG 9;  2RQK A;  3MF5 A;  2ZE2 A;  3SBM A;  4YB6 A;  1H7X A;  4EGL A;  4C6A A;  3M6W A;  2VKZ G;  5GMD A;  4J9R A;  2UU9 F;  2IM2 A;  2V4J A;  1TMM A;  2XUL A;  3ILO A;  4MFB B;  5BYS A;  1UEU A;  5T7L B;  3CIM A;  1UET A;  3OQ2 A;  4DPO A;  2GIR A;  3MFI A;  1U0H B;  2M7S A;  4WFY A;  2ZD1 A;  2RQC A;  2KM8 B;  1X4B A;  2XC9 A;  4QR1 A;  2QIF A;  4NLV A;  3VGU A;  4U9R A;  4LF5 J;  1YJW S;  4F02 A;  3ZZU A;  2DGW A;  4CLW A;  4CO2 A;  2FJW A;  3R8Y A;  4OYX A;  3MAA B;  2ZNZ A;  1S0N A;  1K1S A;  4LSL A;  3K57 A;  2R7O A;  2A18 A;  1WHV A;  1WOP A;  1YVF A;  3DDI A;  3I31 A;  3KXD A;  4FZV A;  5C24 B;  3CJK A;  3MCM A;  1NPP A;  2XSF A;  1HA1 A;  3FK4 A;  3BQ1 A;  1PAU B;  1CVJ A;  2GVD B;  4NYZ A;  1VQ4 S;  2AKW B;  5FII A;  2R4F A;  5LL6 d;  1RUS A;  2NYI A;  1UVM A;  2KH9 A;  4IOA Q;  4ELT A;  3DOL B;  3IMQ J;  2OPQ A;  4KKO A;  4OYO A;  2YWW A;  2ZZM A;  3CGI A;  2MLY A;  3U7J A;  3W64 A;  2Z57 B;  3KNG A;  5A8R A;  4WP9 A;  4C3M A;  1FHT A;  3KLF B;  3X3U A;  2Z0G A;  3DOK A;  1Q8I A;  3T19 A;  1C1C B;  3TAN A;  2Q1L A;  3RGI A;  3C16 A;  3FGV A;  3L7P A;  3HKW A;  4W98 A;  4QPX A;  2DHH A;  1CUL B;  2FB0 A;  3A8K A;  4ILR A;  3IBF B;  2HLU A;  2UVW A;  5H9F K;  4YS2 A;  4UOC A;  3AT1 B;  4J37 A;  1RT4 B;  1Y9O A;  4O23 A;  1SV5 A;  4J5O A;  3AD7 C;  3O6Q A;  4Y6I A;  2DIT A;  4BDP A;  1APS A;  3TW0 A;  2HIY A;  2HK3 A;  3MM9 A;  2AMC B;  2BM0 A;  1YBA A;  4U7U K;  3BO4 A;  4LSN B;  2FJB B;  3NWG A;  3UCG A;  3SSR A;  3KUG A;  1T03 B;  1UMJ A;  3BGL A;  3WIV A;  4JI4 J;  4ZOS A;  3ET6 A;  2QA4 G;  4C3L A;  3H40 A;  1SJ1 A;  3MEC A;  4NX9 A;  5F9N A;  1HBN A;  4DFM A;  3TO8 A;  1F9F A;  2A6O A;  1GFW B;  1S1U B;  4JI3 F;  2Z2Z A;  1K0T A;  1VR6 A;  3DRR B;  1ZPW X;  4U96 A;  5DQH A;  1SJ3 P;  2BAN B;  2ZBI A;  3Q23 A;  4ED1 A;  2LMI A;  5EX0 A;  2CFX A;  2W7O A;  4NXM F;  1SXL A;  2JC1 A;  2FLP A;  4B3R F;  3KK2 A;  1RGV A;  2GQ2 A;  1ZA1 B;  3DXS X;  2JLG A;  4F4K A;  5KFU A;  1KHV A;  2OP5 A;  3QIP B;  3S6E A;  3ZZZ A;  3GG1 A;  5A8W B;  1U6Z A;  5BJR A;  1Q8K A;  4MK8 A;  1H2V Z;  1S9E B;  1WEY A;  2MQM A;  3MMB A;  3MM6 A;  1XER A;  3MPV A;  2W4P A;  2E1A A;  4HH0 A;  1FEE A;  2IAJ B;  4M5G A;  2RRN A;  4MTP A;  4YR2 A;  2QEX S;  1HPZ A;  1PC5 A;  5A8R B;  1ZZN A;  2GHW A;  4W92 B;  2EFQ A;  4LRD A;  3K89 A;  3F73 A;  4AL5 A;  2R42 A;  5F8M A;  4RW8 A;  4TY8 A;  4NCG B;  3KJQ B;  5ETM A;  3ENV A;  3TP2 A;  3ZO7 A;  3KLE B;  2IA6 A;  2MZJ A;  3G86 A;  1KFD A;  4KHP J;  1HBO A;  2OPR B;  3L95 X;  4A4J A;  5D4P A;  2GIQ A;  4TXS A;  3VZH A;  4KGX B;  3GFZ A;  1UVN A;  4LIW A;  1V3S A;  1OQ3 A;  4GC7 A;  2VOO A;  1TTH B;  2VFV A;  2VON A;  2GVZ B;  1SC4 B;  2GJ2 A;  4ID5 B;  4ZVG A;  5ETS A;  1FWP A;  1QSL A;  3QT6 A;  1CJV B;  2IDL A;  1KOH A;  1GX6 A;  1L3K A;  1XK8 A;  3NS7 B;  1RAG B;  4H4M A;  2MY7 A;  2CUY A;  2QX0 A;  4DJB A;  2IMW P;  4YHH F;  4HHJ A;  4LF4 J;  4KHR A;  2XCP A;  1KQG B;  3WQP A;  1Y11 A;  1RAH B;  2QFI A;  2W4C A;  3NBP A;  4ZVR B;  4IRD A;  3M7V A;  3RB0 A;  1EQ0 A;  4ZVQ B;  3C14 B;  2DNR A;  3G8T A;  2HQG A;  5HQL A;  1Z2L A;  4DCJ B;  1FCA A;  1S1V B;  5F8G A;  2YQ0 A;  3M8P B;  5LT5 A;  3OSN A;  2ZJP Q;  1VQK S;  2DY1 A;  3HHL B;  1NK7 A;  4JUZ A;  3KJV A;  3LOU A;  3SMZ A;  3OBI A;  2R7R A;  4DR2 F;  4IQX A;  2DYA A;  3BS9 A;  2E9R X;  4NA1 A;  1XN9 A;  5MAO A;  3P96 A;  4NPO A;  5L1J A;  3X1L B;  1PC4 A;  3U1N A;  1REV B;  1RBO B;  4BHQ A;  2BDP A;  3MM8 A;  4E0D A;  4OX8 A;  2DEI A;  1H2U X;  1VHI A;  2MYF A;  5K8N A;  3D1H A;  2D3U A;  4NLD A;  4CLF A;  1D09 B;  3E8O A;  1RTI A;  2OPP A;  1U0S A;  3K58 A;  1RHM B;  2PGC A;  4OYW A;  3MM9 B;  2QLF B;  3TEG A;  5L9N A;  2AU0 A;  3HFK A;  4WJB A;  4ZJO A;  1Y00 A;  1CQM A;  3CJS A;  1S57 A;  3Q8V A;  4LR8 A;  2Z56 B;  5DG9 A;  3DNC A;  3L3C A;  4LR7 A;  1WC6 A;  1CS4 A;  2V2Q A;  4LF4 F;  1CC8 A;  3D3C J;  2RML A;  4AT1 B;  4FKY A;  5JVH Q;  1S5Z A;  1FRX A;  2UUC F;  1YTY A;  1Q5V A;  2QC3 A;  3JQM A;  4IDK A;  4LF9 F;  4EBC A;  1GK8 A;  5F8L A;  3GWC A;  4LBP A;  4CLT A;  1S0M A;  1TL1 B;  1RXO B;  2IPO B;  1WF2 A;  3FCH A;  3R1L A;  2DR9 A;  1SVD A;  2O67 A;  1HAR A;  1QAJ A;  1FVS A;  2ALY B;  5BR8 J;  3GYN A;  4JI7 F;  1QAX A;  4U8V A;  2YQ1 A;  1TVR B;  2HHQ A;  2H4Y B;  3TX8 A;  4DCP B;  2Q66 A;  1WJ9 A;  2R7W A;  4ZPD A;  5D8H B;  1WWH A;  3FBC A;  3BYR A;  3QGG A;  4J9O A;  2DNZ A;  3MM6 B;  3NS5 A;  3QBC A;  1P1L A;  2FC8 A;  1U8S A;  3SV3 A;  4DL4 A;  4TQS A;  2YWF A;  2G4B A;  1GEH A;  3PY8 A;  2CJQ A;  3OTO F;  1WTB A;  1RT3 A;  2BX6 A;  3DKD A;  4J91 A;  3HHK A;  4M5D B;  1LW2 A;  3BRE A;  1RAF B;  4YP3 A;  3T5J A;  3JSM A;  4ETX A;  1I94 J;  2LLZ A;  1S0O A;  4GKK J;  3JSM B;  1CUL A;  5HI7 A;  1TFW A;  2WW4 A;  3H2U B;  3Q8Y A;  4DEZ A;  3CCU S;  3RBE A;  2CJX B;  2LU2 A;  3PDN A;  4P71 A;  1PG5 B;  2GVZ A;  5A0Y B;  1NEE A;  2ASL A;  3QRR A;  2I38 A;  4YUD A;  1LXN A;  2VHG A;  2FPH X;  3RR7 A;  6FDR A;  2H5I B;  2DD8 S;  3MOJ B;  2DBB A;  1HR0 F;  2VJV A;  2U1A A;  4IOC Q;  3CO9 A;  3HD2 A;  4DR1 J;  3TI0 A;  1S9G A;  2VL1 A;  1U49 A;  2IDE A;  4N8N A;  2AGO A;  1R7I A;  1NHU A;  2ZUG A;  1W2I A;  4DUT A;  4ECR A;  1HBN B;  1XR6 A;  2W2M P;  4OFZ A;  3VAF A;  3T5K A;  1K73 T;  4WKR A;  4ELV A;  1IQZ A;  1NU4 A;  5C5J A;  3JSY A;  4CLY A;  3PW4 A;  1J5O B;  1KSP A;  2OSQ A;  2R7U A;  3NLC A;  3DLK A;  4NLT A;  3CCV S;  2IJN A;  4PUO B;  1LK7 A;  4EMD A;  1S6U A;  2QLB B;  2R3V A;  8ATC B;  2VQE F;  1G2E A;  3B4M A;  2WTF A;  4CT8 A;  3KK2 B;  2XLK A;  3I0R A;  3MEG A;  5DG7 A;  1RWK B;  4NXN J;  2JFK A;  2LYV A;  3FEZ A;  4CLZ A;  4OI1 A;  3W61 A;  4KHP F;  4AXJ A;  1LW0 A;  5KG1 A;  1OY6 A;  5GAE I;  2GHV C;  2J9E A;  4OYZ A;  1X4F A;  1FDA A;  4K7Q A;  4WII A;  3QJJ A;  2KFN A;  1J2V A;  3QT5 A;  2DNN A;  4YB1 P;  4HHU A;  1RTI B;  2M88 A;  2YBV A;  3VR1 A;  5HVF A;  4YY3 F;  3OVA A;  4NLU A;  2EFO A;  2VG5 A;  3MR3 A;  3JAM U;  3QJP A;  4LF6 F;  1ZS6 A;  4ZLJ A;  2AEF A;  3HK2 A;  3AA8 A;  2ROE A;  4A8X A;  3HHD A;  4KFB B;  4QWB A;  2RRB A;  1TUG B;  2MKH A;  3VAI A;  1FA0 A;  5IFM A;  5IT4 A;  4DWI A;  4OIX A;  3PR4 A;  3M6X A;  3KHG A;  3I5C A;  1XNQ F;  1C4C A;  3JTO A;  5KFK A;  2ASJ A;  1HW8 A;  2XS7 A;  3RAX A;  1RT6 A;  1P1T A;  1PIL A;  1HNX F;  4Y28 C;  3ZZO A;  1VIO A;  2QZ8 A;  3TZX A;  1U09 A;  2XSJ B;  2HNY B;  2J9D A;  4LSL B;  1AZS B;  1XTZ A;  4M5H A;  4U7U D;  4AXI A;  5LMU J;  4ZP6 A;  3D4J A;  3NBP B;  4MK7 A;  2LVW A;  2B9E A;  4MIW A;  1FKP A;  4YB7 A;  2XO6 A;  4EBE A;  3RAQ A;  2XI2 A;  3UVJ A;  3BO2 A;  3MUM P;  4RJV A;  4DQR A;  3G6X A;  1S1X A;  3QID A;  3WC2 A;  1N33 F;  3DGV A;  1VRU B;  4BC7 A;  1CJK B;  4ZVT B;  5HK4 A;  2FLL A;  3THT A;  2VC0 A;  3BBB A;  3SCJ E;  4USI A;  1G6B A;  2WHO A;  2VV5 A;  1HBU B;  1X4A A;  2LDI A;  4I2Q A;  3W2V B;  3KLF A;  1IR2 A;  2BVZ A;  5K14 B;  2KM8 C;  3ZZR A;  2DHX A;  2KRR A;  1TFY A;  1HMV A;  3MM5 B;  4X2B A;  5KOW A;  1YJR A;  3PRD A;  3KLG A;  5E33 A;  2QLX A;  3JB9 k;  2HHH F;  1QSS A;  1LWC A;  4LF2 A;  1F0X A;  3CDW A;  3DRS A;  3OTC A;  4KGV B;  2HFZ A;  1AA1 B;  1PJ5 A;  3A3P B;  2XHC A;  2XMT A;  3HHL D;  3DGP B;  2DGQ A;  4MYU A;  2HUR A;  3W2W B;  2MZR A;  3PKY A;  3FNN A;  2ZH7 A;  4IO1 A;  3DHW C;  5L9X A;  3CMQ A;  1Q5Y A;  2COL A;  2XBP A;  1XMO F;  4B3M F;  4X66 F;  3GII A;  1UTA A;  4I56 A;  4NE9 C;  4KRW A;  4A8S A;  2GGP B;  3G96 A;  4A8Y A;  4IR9 A;  2X3D A;  1CS4 B;  2EW9 A;  2BXJ A;  5B0F A;  3UPF A;  3DI6 A;  4Y3C A;  3P49 B;  1YHQ S;  1EHW A;  1SBR A;  4DS5 A;  3ENQ A;  1MN7 A;  4O4R A;  2W9B B;  5CYJ A;  1XNR F;  2ZBR A;  4Z7C A;  1I6J A;  3PW2 A;  3H5S A;  5B0B A;  3DRR A;  5AJ3 F;  1P8G A;  3PV8 A;  3SDE B;  1BQX A;  3QAT A;  5L39 A;  3QRQ A;  5IZH A;  2R2R A;  3GIR A;  1PJ7 A;  1ZAX A;  3M2U B;  4WCE Q;  1SUQ B;  1S6P B;  2BBE A;  1X4H A;  2F9D A;  1KQF B;  1X4G A;  2JC0 A;  2MQL A;  2PEH A;  1BD6 A;  1WC0 A;  1WG1 A;  2XMU A;  4Z2X A;  1QLN A;  2DGT A;  4DV1 F;  4TYA A;  4BS2 A;  1EET B;  5GME A;  1CJT B;  2F40 A;  1HPZ B;  3UNY A;  1A0O B;  2VIC A;  1NCL A;  1HI1 A;  1FTR A;  1T7P A;  2BAB A;  3EE3 A;  3D54 A;  1FE0 A;  1DTQ B;  1T9W A;  1T3O A;  3H8Y A;  3GU0 A;  4NCG A;  3MTK A;  4P2S A;  4PAB A;  1PYT A;  1FRL A;  5KFR A;  5L1K A;  3JAM Y;  3TUJ C;  3MR5 A;  1X9M A;  5T14 A;  3W9I A;  2V0N A;  3GTY X;  4Y2C A;  1Q82 T;  5G0R B;  3IRW P;  5JMN A;  4RW6 A;  2HHV A;  4WFZ A;  4EBD A;  2L9W A;  3M4X A;  4ID5 A;  2HWT A;  1DAR A;  4KV8 A;  2ATL A;  1RWU A;  2QA2 A;  2P8I A;  5E3A A;  4PWD A;  1R8B A;  1NK5 A;  2HFN A;  5CAB A;  5JUM A;  3MR2 A;  3CJ4 A;  3KG4 A;  1WI8 A;  2BKN A;  3CCR S;  1BQN B;  1N5Q A;  1ZET A;  4NXN F;  3GZ7 A;  1UEV A;  1JXL A;  2W9B A;  5IS2 A;  2DGU A;  2ZH1 A;  3HHL A;  1PO6 A;  3WX4 A;  1MRO B;  2XWX A;  3M8P A;  2L41 A;  3D1O A;  2XY5 A;  3IS9 A;  4N7T A;  3UN2 A;  4DOZ A;  2DNQ A;  2C2N A;  3SQO P;  1MWQ A;  4H4O A;  3MEE A;  4I2Q B;  3WX8 A;  3MPW A;  4F0K A;  5KFP A;  3OUY A;  5L1L A;  1N32 F;  2Q79 A;  4X4Q A;  2AIR B;  4NLY A;  3W60 A;  3PXG a;  2A2D A;  2CAJ A;  2HGN A;  1FDB A;  4ED4 A;  4PG8 A;  5K5M A;  3R5G A;  2AEJ A;  1U02 A;  3DHX A;  2V50 A;  3MMB B;  4D3H A;  3W2W A;  3W62 A;  1Q8L A;  2HNZ B;  5D0H A;  2CQB A;  3CJ2 A;  2YNG B;  3NY0 A;  4QR2 A;  1S0V A;  4F4Y A;  3I9V 9;  2UVU A;  1E6V A;  1CC7 A;  3EVO A;  3IR5 B;  4LFC J;  4F25 A;  4ECV A;  5E3P A;  2HWH A;  3CJR A;  2RQM A;  2OPR A;  4WP3 A;  1HHQ A;  1WAC A;  3R97 A;  4AL6 A;  3EPG A;  2ZH5 A;  1SJF A;  3HM9 A;  4Y65 A;  3EJM A;  2HAI A;  1C4A A;  2CPE A;  2RNE A;  2LQ9 A;  2ZWO A;  2CJA A;  1FEH A;  2E1R A;  4PG6 A;  4WFN Q;  1U6B A;  5M2U A;  3QSY B;  4P7T A;  3PJX A;  2CPD A;  4QWA A;  4YME A;  2Y1R I;  4W90 B;  3NGD A;  3HJF A;  2ZDO A;  3CO0 P;  5SZT A;  2IVY A;  1RHK B;  3CJK B;  2C2E A;  4KYZ A;  3JTN A;  1KTV A;  2NYH A;  3MGJ A;  1EIY B;  3TZY A;  3IA0 A;  3J7Z 5;  4FXV A;  4HKQ A;  1DTT B;  2DT9 A;  5F0U A;  4DV6 J;  3CCS S;  4ZN3 A;  1RBA A;  1B0T A;  3VVT A;  1X60 A;  2K3I A;  3E51 A;  3G82 B;  4ICL A;  2I0X A;  2B5J A;  5FLX Y;  4A8K A;  3BKU A;  2RIL A;  2C2R A;  3KK3 A;  2NZ4 A;  1RT3 B;  5GAD I;  3TQ1 A;  5HP1 A;  2D9O A;  2MST A;  1JJH A;  2K7K A;  1C1C A;  4BLG A;  2VF3 A;  2RVJ A;  1RWV B;  5A2Q U;  3RRH A;  3B82 A;  2GS8 A;  2MXY A;  5J2Q B;  1YQH A;  3D7S B;  3MED B;  4DZD A;  1IKV B;  2BKO A;  3HO1 A;  2ZHB A;  3HVR A;  3FCV A;  5JXS A;  1GAO A;  3BB5 A;  4IYQ A;  1VMB A;  2B9W A;  4RW7 A;  2MEW A;  4OJ1 A;  2GFF A;  1HWJ A;  5CQG A;  4CO3 A;  1HHS A;  3HSD A;  5ETN A;  1M5S A;  2EKN A;  2YNG A;  3PFO A;  3DCA A;  4J9V A;  1FKA F;  4KC5 A;  3GFX A;  2FJA B;  3T1A A;  2IRX A;  1X5T A;  4DL0 C;  1VQ7 S;  1SI9 A;  3GJT B;  3E3X A;  3R5A A;  2AYM A;  3WHI A;  5J1P A;  2MKK A;  2FY8 A;  4A8W A;  2OPS A;  1XQI A;  4RWW A;  5IQ6 A;  2HHS A;  2H4W B;  1IBK F;  3HXM A;  2JVR A;  5HRO B;  2OAU A;  2VBX A;  1RHU B;  4R5P B;  1MWY A;  4OLP A;  2X1A A;  4G1P A;  2YX7 A;  3F44 A;  1RQ0 A;  2IRY A;  2AZ1 A;  4U95 A;  3NEK A;  5B0D A;  2W8K A;  5D3G B;  3HDS A;  4ZPW R;  5H1S V;  2QTW A;  3OHA A;  5KG5 A;  2ABY A;  1VOM A;  3N0V A;  3N4W A;  3QGI A;  2UP1 A;  3TJA A;  4ED0 A;  2VFS A;  2B6A B;  2EC2 A;  1R6V A;  1SIZ A;  4IH6 A;  4A8O A;  2ALZ A;  1JK9 B;  2V63 A;  2J7U A;  2YKA A;  3BH6 B;  4F26 A;  1QVF R;  1TK5 A;  1IR1 A;  2DHS A;  3JQJ A;  1Q7Y T;  3MCS A;  1SL2 A;  3PYD A;  3PIO Q;  1LWE B;  1CLF A;  1CJU A;  3HP6 A;  1G7C B;  3T9N A;  1NSK L;  1FNM A;  1T9X A;  2E66 A;  5E2Q A;  2GO9 A;  4X62 J;  3QZ7 A;  1ZA2 B;  4GKJ F;  1Y3K A;  3ISN C;  3TUZ C;  2HBR B;  5KFD A;  1NSP A;  3M1V B;  1IKW A;  4URQ U;  3QWP A;  2ZD1 B;  2BRL A;  2YWH A;  2KYX A;  1UFK A;  2F65 A;  4KB7 A;  3EVM A;  2R7Q A;  3RRG A;  4OZ0 A;  2DO0 A;  1TL4 A;  2JWN A;  1C1B B;  1FWK A;  2NS1 B;  1NJX A;  1N33 J;  2ZVS A;  4IH5 A;  1UJ4 A;  2FC9 A;  2GJF A;  2XYG B;  4ZA1 A;  3K8V A;  3M6U A;  4M5N A;  2ZHO A;  2R8K A;  3TAQ A;  2FGO A;  3RU0 A;  2WCX A;  2NUH A;  3KNA A;  2HFS A;  3R2C J;  2Y0S D;  2BJE A;  4RW9 A;  1N36 F;  4J9N A;  4B9N A;  2LP4 A;  3M8Y A;  1VQ5 S;  2UUB F;  4FYV B;  4KY3 A;  2EXU A;  5DZ7 A;  2FJX A;  1K9M T;  2ACY A;  2P9C A;  1WTF A;  1RHR B;  2BMB A;  1URN A;  2GZO A;  4ES3 A;  2RT3 A;  2HAF A;  3W65 A;  3GSI A;  3N6M A;  4GRS A;  1I5O B;  1F3F A;  4JI2 F;  4AUK A;  2VH7 A;  4YB5 A;  3UCZ P;  1VRT A;  4TY9 A;  5FLX U;  4OI3 A;  1FDD A;  2EPI A;  4OX9 F;  4M5I A;  1NK6 A;  1M5O C;  4DX5 A;  2PD1 A;  2CKW A;  1F5B A;  2LU1 A;  3C19 A;  4DG1 A;  5C2G A;  2B9X A;  4WK1 A;  1DUR A;  3K5L A;  4LF6 J;  3OR1 A;  3ITH B;  3BF4 A;  3HSG A;  4PG5 A;  2MTL A;  5KTQ A;  5EGY A;  3U02 A;  4NLQ A;  2GCF A;  1FFG B;  2A2C A;  2J76 E;  4LF9 J;  4YEA A;  1WHY A;  4F67 A;  1OYD A;  2IM0 A;  1TKT A;  3CCZ A;  3H42 A;  2GC8 A;  2GIF A;  4IFV B;  4PAA A;  1CJV A;  1S10 A;  1Q86 T;  5IC6 B;  1UA0 A;  3HCX A;  2UUT A;  5G4D A;  3OR2 A;  4O3P A;  3GLJ A;  2CQC A;  1Z4U A;  1VK8 A;  4BWM A;  1UZH A;  1IM6 A;  3LA0 A;  3BPS P;  4AQY J;  2PMZ D;  2OEL A;  1RT2 B;  1N5S A;  1F9E B;  1ZM9 A;  3DYA B;  3T3F A;  3IGN A;  1DAX A;  3QNW B;  2XY7 A;  4WXO A;  2QE5 A;  5KG4 A;  2VDI A;  3I82 A;  4Y0F A;  4Z37 A;  3QFW A;  3PZP A;  1GMW D;  3FDS A;  3RB6 A;  1IBL F;  2XM3 A;  1B7F A;  5LXY A;  1YRU A;  4KGM A;  3ZZ0 A;  3GE9 A;  1H38 A;  5KFX A;  2WAQ D;  3P8B B;  2VD3 A;  2RDJ A;  2MHN A;  2MKI A;  3GJQ B;  1UFW A;  3TUI C;  2P2C B;  1FKP B;  3A13 A;  4USW A;  4DFP A;  5DRK A;  3BH7 B;  4ATN A;  5AXN A;  1B0V A;  4RNN A;  4DUY J;  2I9S A;  5F0W A;  1VYA A;  2VBW A;  3DU6 A;  3UCU P;  2YKN B;  1KS2 A;  3DLE B;  2IC3 A;  3LTO A;  4OV1 A;  3T1H F;  2B7C B;  3N79 A;  3W8P A;  4ZCI A;  4DL5 A;  1Q78 A;  3QQC D;  4DDF A;  2VA2 A;  2B8P A;  2IM3 A;  1S72 S;  1LFP A;  1ROF A;  1WKJ A;  3FZ2 A;  4NLG A;  3CUL A;  2IVM A;  2CVI A;  4A48 A;  4B3R J;  4BWJ A;  4QU7 A;  2KT2 A;  4KPC A;  3OLB A;  4QW9 A;  3IN5 A;  3Q2S C;  1U2C A;  2J9D E;  4NEY A;  5KFM A;  4DV2 F;  2UXC J;  2KYZ A;  4XDC A;  5CYQ B;  2O01 C;  4BC9 A;  2HS0 A;  2Y1L B;  3P5T L;  2MZS A;  4QYZ K;  1OS5 A;  1QAY A;  1QY7 A;  4C8M A;  5E7O B;  1JLB A;  4J7C A;  3O2I A;  4DSF A;  5HVG A;  3H4D A;  3TJ9 A;  2M9K A;  2CQP A;  2L3M A;  1KQK A;  4MIA A;  2M3D A;  2O66 A;  5KG0 A;  1R6Y A;  3HZE A;  5C25 B;  2BJ8 A;  2LA4 A;  2CPZ A;  2V67 A;  4OYB A;  4QYR A;  2KHC A;  2KXH A;  5KFZ A;  3W5X A;  4DPY A;  3RBX A;  4ZLP A;  2ZC4 A;  2EFG A;  5GVQ A;  1EAR A;  1RAO A;  2Z4P A;  5K20 B;  4R5P A;  1ICE B;  4Q5V A;  2Q6C A;  1DY3 A;  3GSD A;  5E3R A;  3H5Y A;  5F8N A;  2LQB A;  1WF0 A;  3ELH A;  1WF1 A;  1MNE A;  2CDQ A;  4FKX A;  2QYC A;  2QYG A;  2XGQ A;  2UVR A;  2AJ1 A;  3QO9 B;  5KAK A;  3DOK B;  4ECS A;  1FXD A;  4URS A;  4I2P A;  1DLO B;  3T6B A;  5C42 B;  1TL3 B;  2ZM6 J;  2LEA A;  5HSP A;  4FNH A;  3CD6 S;  3KLG B;  1MU2 A;  3AHP A;  3MUV P;  1PBU A;  4RWX A;  2DVI A;  1YZ7 A;  2XS2 A;  3D9B A;  1JXV A;  3GIL A;  4QOT A;  5AT1 B;  4ZVF A;  2V4Q A;  2RS2 A;  3E01 B;  4DU8 A;  1HNX J;  4IG0 B;  5L1I A;  3PYE A;  2F1F A;  3OSP A;  1RU2 A;  2YNH B;  2CWK A;  1Y5N B;  2ZWP A;  2RS8 A;  1TZ0 A;  4IG3 A;  2DCL A;  1GQE A;  1ELO A;  3GV7 B;  4YOE A;  3RB4 A;  2ROG A;  4LF7 F;  1NRK A;  3D1Q A;  4KPY A;  4M95 A;  4OJ3 A;  3TR5 A;  1Q16 B;  4L3K A;  1WG5 A;  2DR8 A;  3OXG A;  4DSK A;  1BWV A;  1TKZ B;  5HBM B;  1ZAV A;  3J7Y I;  3M9N B;  2FJD B;  3D6M B;  2XSJ A;  2KKH A;  3P5B P;  4DI6 A;  5AE1 A;  2AYG A;  2ADC A;  3MR7 A;  1IM4 A;  4LMZ A;  3OLA A;  4OJH A;  3CXC R;  4I7F A;  2C2D A;  4ED7 A;  5HLF B;  2UXB J;  1SJR A;  2FHM A;  3QT7 A;  1U2R A;  1T94 A;  2QG9 B;  1S6P A;  3VHQ A;  1RTJ A;  4YR0 A;  2GQC A;  4ZVU B;  2E5J A;  1GH8 A;  2DEJ A;  4XAK A;  4R0E A;  3AH6 A;  3ISN D;  1X9W A;  3UE2 A;  1UVI A;  1GMW A;  5GAE U;  2ERR A;  5ETP A;  3QJL A;  4Y2A A;  2PFF B;  1HWU A;  4CM0 A;  3RG6 A;  1EJ7 L;  2F9J A;  2V6A A;  3ULH A;  1S76 D;  1R0A B;  1UJ6 A;  4PQU B;  5CA5 A;  2FHJ D;  4ZVS B;  2BQR A;  1JLC B;  1HBM B;  1JLE B;  2KRB A;  2F4V J;  3FKB A;  4RBU A;  3NMR A;  1X31 C;  3HFV A;  4N8O A;  4MJK A;  1GT8 A;  1Z2Z A;  5CCL A;  2R7V A;  1MWZ A;  4MKA A;  2XNR A;  5G0R A;  2WBR A;  5LMN J;  1RWP B;  3K2Y A;  3ENA A;  3R5D A;  4IO9 Q;  1KLN A;  4EYI B;  2RHS B;  3V6D A;  3CCQ S;  1XNR J;  1JLQ A;  4DL2 A;  2D41 A;  2ILZ A;  4HL9 A;  2MY8 A;  2MPU A;  1WC3 A;  3H98 A;  3LGM A;  2E44 A;  2IMO A;  1QUP A;  3C6T B;  4KAI A;  4F3O A;  4TU8 A;  2YKP A;  1C0U B;  1UKU A;  5DGA A;  4ZIT A;  1X4E A;  3I96 A;  9ATC B;  1RT7 B;  2DXE A;  3HJV A;  5KT7 A;  1NKE A;  2VA3 A;  4I6Y A;  1C2P A;  3FSI A;  2W7A A;  1Q1K A;  1YGY A;  4P10 A;  4ZP7 A;  2AW0 A;  2IVF B;  1KD1 T;  1H98 A;  2M2B A;  3PYF A;  3OTB A;  3R27 A;  3VAK A;  3TZW A;  3EM1 A;  1M0S A;  1JJ4 A;  1WNE A;  3B8H A;  1FF2 A;  3HSJ A;  1RTZ A;  2KB2 A;  3D0G E;  1KOO A;  3HZG A;  3MM7 B;  1HI8 A;  1HYS A;  1T8E A;  5HQM A;  2AWZ A;  5AE3 A;  4RBT A;  3QZ8 A;  3IC1 A;  2HMI B;  2HHP A;  4X65 J;  4ZMM A;  2WSC C;  3QIP A;  4YR3 A;  2GA7 A;  3RB3 A;  1U1K A;  4C8Y A;  1KP6 A;  2D69 A;  5B09 A;  2C2M B;  4DV2 J;  3AJD A;  1RAC B;  2RE1 A;  3MM8 B;  4QQB A;  1WHW A;  1RAJ A;  3SSQ A;  5I42 B;  4B3O A;  4C8L A;  3IRX A;  3THV A;  5A8K B;  3ICL A;  4XPE A;  1A6L A;  1RU1 A;  4WYL A;  4UY8 T;  2VG6 B;  2XS5 A;  5KOX A;  1XIQ A;  1B0P A;  2OEJ A;  2OPP B;  2PT0 A;  2X3G A;  5CH7 B;  3GCW P;  3RUB L;  2F8M A;  3KLE A;  2WVC A;  3IM9 A;  4RW8 B;  2EG2 A;  2QRR A;  4YDD B;  1VI7 A;  3OJU A;  2XWY A;  3HSZ A;  1BUX A;  2GX8 A;  4K59 A;  1X9S A;  2PC6 A;  4DPX A;  3FJ2 A;  2IYG A;  4PG4 A;  4C0O C;  4FYD A;  1U25 A;  1HNV A;  4DN0 A;  3D67 A;  2P5V A;  4DS4 A;  1SQF A;  1T3N A;  1FTC A;  3FFI B;  2RF2 B;  4OYP A;  3KTQ A;  3PIP Q;  1CQN A;  1RE1 B;  3S1T A;  1N6Q B;  1RWW B;  1R89 A;  2DIU A;  1T9V A;  2M52 A;  3A3N B;  4CLL A;  3CCJ S;  4PQA A;  1U4B A;  1JMT A;  4I7F B;  3K8W A;  2J0W A;  5JVG Q;  2C3O A;  1YZ6 A;  3H2V E;  1KTQ A;  3GR0 A;  4DV3 J;  1T05 B;  4DR6 J;  3DRP A;  2AJ0 A;  2J6S A;  4K0K J;  1QM9 A;  2KFZ A;  2WON B;  2PO4 A;  3NRB A;  1XEZ A;  4OZJ A;  5KFE A;  5DZ6 A;  2OKQ A;  1I51 B;  1S1X B;  5DQI A;  4IFY A;  4WZQ A;  2HQC A;  3NS6 A;  4B3S F;  2R7T A;  2NXE A;  2QLJ B;  4QIE A;  4RZR A;  2Z8Q A;  3EUN A;  1J5O A;  2AZ3 A;  1YJV A;  2FJE B;  4IQM A;  2W1B A;  1O5J A;  5KT5 A;  4V19 J;  3M2V A;  1OY9 A;  1U47 A;  5E5N A;  3C3L A;  2LXI A;  3PTW A;  4LFB F;  4DLG A;  3QRP A;  3H5U A;  1H6K X;  1REV A;  3MMA B;  4K4X A;  3DOM A;  5L38 A;  2BQU A;  2JZ5 A;  1JKH A;  3CCW A;  3KG1 A;  3M30 B;  2UUC J;  1ZZF A;  3DRS B;  3PEH A;  4TNO A;  2K3K A;  2W2N P;  3R5C A;  2NXC A;  5EWF A;  4FS2 A;  3RRK A;  2MMY A;  3B4D A;  2W01 A;  4O44 A;  4OX6 A;  5IWA F;  2LQ5 A;  1QTN B;  4ZLL A;  1IKX A;  2ZJQ Q;  4QZV B;  4ZP8 A;  2E5L F;  2J0Q D;  2DGX A;  2YNH A;  3THP A;  4EFA C;  4J9M A;  4DQP A;  2H5E A;  1VQS A;  1NPK A;  2V2V A;  2H65 B;  2D74 B;  3CT9 A;  1S9F A;  1YRT A;  1S1U A;  3G6E S;  3K5O A;  4B9T A;  3Q83 A;  4KIA A;  1VS3 A;  1G3O A;  1VRQ C;  2OEK A;  1TP7 A;  2RH3 A;  5EX3 A;  1SB6 A;  3K5P A;  4L3N A;  4GC6 A;  1EZZ B;  4PRF A;  2EK1 A;  2LXF A;  4F2S A;  1Y7P A;  4ZPB A;  1DRZ A;  4CM2 A;  1AZS A;  2D3Z A;  4QCL A;  2B6A A;  2WVD A;  3ZTP A;  3F41 A;  1VQO S;  2BAC A;  1QJH A;  2JDJ A;  4LFA J;  2BR0 A;  4NZ7 A;  4CLP A;  4PYA A;  4I64 A;  3W5Y A;  1RTJ B;  3HFZ B;  2V9W A;  3V6K A;  1T02 A;  5SUH A;  1S6Q A;  5F9L A;  2IBO A;  5J2M A;  4FBU A;  4M1K A;  3HVT B;  1IN0 A;  4HDH A;  2EK6 A;  4FYY B;  3KYL A;  4FPR A;  3G71 S;  1B99 A;  1HQE A;  4NLO A;  5ETK A;  3VAJ A;  4Q45 A;  4HTJ A;  3V81 A;  3CDE A;  3NGK A;  5DJB A;  1JNZ B;  4R0J A;  2W2Q P;  1REG X;  2DH7 A;  1U1R A;  1LW2 B;  5KT6 A;  1JLE A;  2J5A A;  4DQS A;  1NDK A;  2K2P A;  1QSY A;  3IR6 B;  2RAQ A;  4G6V B;  4MAK A;  5ETL A;  3DFE A;  2JL9 A;  2W2P P;  4I68 A;  4ZHR B;  4JI6 J;  1N0U A;  1WSV A;  2BUN A;  2MZT A;  2M8D B;  3A8E A;  1HNI A;  5I3U A;  2HVI A;  2HKE A;  4I6W A;  4WPA A;  2B4U A;  3R9L A;  3CJ5 A;  1ZM3 A;  4DLE A;  5C24 A;  2MKY A;  1S7I A;  3LGN A;  3UQS A;  3JYT A;  2W8L A;  4P2M A;  4ECX A;  1RTD B;  1RTD A;  3KMQ A;  1TKD A;  4ECT A;  2OUG A;  2ZZT A;  2O5D A;  1RAD B;  1G4C A;  1N52 B;  4PXD A;  5KFO A;  1W2B R;  5F8J A;  1XWL A;  4USM A;  2BRK A;  1P6T A;  7FDR A;  2NRE A;  1FJG F;  2G2Y A;  4O4G A;  3K7R A;  1S1V A;  2BE9 B;  3PRV A;  3CE8 A;  3K5N A;  5KFY A;  1WC5 A;  2RD5 C;  4USK A;  2VG7 B;  3POT B;  2PMH A;  3TAM A;  3Q8Q B;  4LJM A;  2RDI A;  1VC5 A;  2HVH A;  1WDT A;  2MGZ B;  9RUB A;  3FBB A;  4MMO A;  2VIH A;  4JI0 J;  3I0R B;  3MEG B;  1H72 C;  3OR1 B;  4OZN A;  5AXL A;  4C48 A;  3GB0 A;  2DRB A;  3CJ3 A;  1K8A T;  4QBU A;  1UVK A;  3ZZY A;  1LXJ A;  2ZH3 A;  3TAP A;  1VQN S;  4DSL A;  5FDL A;  4DR4 J;  1I3O B;  3UR3 C;  2DXD A;  2FGC A;  3V6J A;  3PVX A;  5BYQ A;  4ANE A;  3DXB A;  4USU A;  1JJC B;  4LBI A;  2E1P A;  4HYK A;  4DX7 A;  4IUF A;  2HFU A;  2KL8 A;  2CNK B;  1I94 F;  4GKK F;  1RWM B;  1VBK A;  4B17 A;  1TK0 A;  3C15 A;  2YH0 A;  4UUW A;  2W4D A;  3PW0 A;  3H90 A;  3KDO A;  4B02 A;  1F1B B;  3MZI A;  4ZJQ A;  1U1M A;  4N41 A;  1WUU A;  4ID8 A;  4C7Q A;  2KU7 A;  5LSO A;  3EYZ A;  2R2T A;  3CC2 S;  2CZV C;  2HS4 A;  3W8G A;  3GQC A;  3LUY A;  3UN5 A;  1BC6 A;  1RAA B;  1FFW B;  2GMH A;  4KO0 A;  3SDE A;  1DQA A;  1HL6 A;  4U67 Q;  4QIV A;  5CHC B;  3LWL A;  4PKD B;  1T05 A;  3PAC A;  4WU3 A;  1BY9 A;  4DU7 A;  3M2R A;  3HPO A;  1IWA A;  3M2R B;  3AFG A;  1R0C B;  4LT6 A;  5J2P B;  5GAG I;  3C14 A;  4ZIV A;  1XJW B;  1H74 A;  1T11 A;  1TL5 A;  3Q24 A;  2KDO A;  3EPI A;  4LQ3 A;  1IWG A;  2JFD A;  2QLW A;  4CP5 A;  4ELU A;  4OYI A;  2XLJ A;  3H4B A;  1NLK L;  2CPJ A;  2D9P A;  2DR6 A;  4E8U A;  3BV8 A;  3AB2 B;  4G1Q B;  1EP4 A;  1VJQ A;  4MYT A;  4G1Q A;  5B0E A;  1B64 A;  3KHL A;  2FZK B;  2NXN A;  5IV3 A;  4ITS A;  1VQL S;  2CQI A;  3DDN A;  4J9S A;  3W7B A;  3MUR P;  1LNQ A;  3IBC B;  4DUY F;  2G1H A;  4NWB A;  2CJK A;  4ER8 A;  3DGP A;  3PHT A;  2JLF A;  2YKQ A;  4I4B A;  5KT3 A;  5E0O A;  1X5P A;  2B4O A;  2AJ4 A;  2H48 B;  4IFV A;  4CH7 A;  2N7C A;  1V5V A;  2W24 A;  3O1L A;  5L8R C;  5D6G A;  2OTL S;  2XMW A;  1ARO P;  2YNF B;  1IBL J;  4UZC A;  2DNG A;  2ROP A;  2CNL B;  2JH3 A;  4YDX A;  3CME S;  4ILL A;  2GMJ A;  2KFY A;  1XNQ J;  1FRK A;  1TUW A;  2A0F B;  2IJF A;  4FXD A;  1IVZ A;  4CLK A;  3N6N A;  2N82 B;  2VQF J;  1N88 A;  1VJW A;  3MAH A;  1CJK A;  3IR7 B;  2P9G A;  1NAQ A;  1SIW B;  2DNK A;  2SXL A;  1NBE B;  1T9Y A;  2YX1 A;  4UOF A;  3J7Y U;  1HI0 P;  1SPB P;  4JI1 J;  4QYZ J;  4OYA A;  5C7P A;  4TU7 A;  2WSF C;  4DF8 A;  4C3K A;  4GVL A;  1SUQ A;  4N47 A;  5KFN A;  1KON A;  2RU3 A;  3MM5 A;  3TWZ A;  1M1K T;  4PPD A;  1X0P A;  1ZM4 A;  2QT7 A;  4X84 A;  5FD1 A;  1WC1 A;  2HLT A;  5D0G A;  4X64 J;  2RIJ A;  4DV0 F;  3GJS B;  1LWC B;  3FEX B;  1UWB A;  2CXE A;  4DZ6 A;  5F8H A;  3MFH A;  3RBD A;  5J2P A;  5KFF A;  3IRX B;  4RBV A;  1H7W A;  1IBC B;  1RHJ B;  1TKT B;  2QA1 A;  4HVZ A;  3LP0 B;  4ICL B;  3TRG A;  4CYU B;  4WWS A;  3SCK E;  3NGT A;  4NZ0 A;  4LRA A;  4TY8 B;  3HF5 A;  1NSQ A;  5K8M A;  4IRK A;  1T03 A;  1MMN A;  3FC9 A;  1D1U A;  4QR0 A;  3FCW A;  7FD1 A;  3EVW A;  1JLF B;  1UWA A;  4FP9 A;  4Q43 A;  2HHU A;  4Y34 A;  1FK9 A;  1KLM A;  3TEH B;  4CQ1 A;  4MKY A;  4F36 A;  3I6P A;  4N56 A;  1A9N B;  3L7U A;  3K17 A;  2Y9H A;  3HHN B;  1JNR B;  4GO5 X;  3G8S A;  1JLB B;  4JI5 J;  4QU6 A;  2HBQ B;  4PWW A;  1OSC A;  3SCI E;  3C6U A;  1N56 A;  5KFS A;  2HNY A;  4NCA A;  3S01 A;  2JNJ A;  2OGU A;  4DR5 J;  1RP5 A;  1OIA A;  4M5M A;  3DLB A;  2RSQ A;  4UQG A;  1WKL A;  2J0X A;  1Y5I B;  1MG7 A;  3BKF A;  3LW5 C;  1FX2 A;  3QT8 A;  5E3C A;  2GV1 A;  4ZDN A;  1TL7 B;  3N5F A;  4C98 A;  2ZUA A;  1TR0 A;  1AXQ A;  1TL7 A;  1KEK A;  5HLF A;  2V5H G;  2NPI A;  3BGR B;  1SC6 A;  3UD3 P;  1BQM A;  5CZV A;  2R2S A;  2OPQ B;  4I1T A;  1VRU A;  4ZVH A;  3HVT A;  5HAN A;  1DFD A;  4I6A A;  1KBR A;  1XR5 A;  2EFN A;  5L46 A;  2J6T A;  4PWU A;  4LRC A;  3G82 A;  5HL7 Q;  4JV1 A;  4RX6 A;  2YKM B;  4QWD A;  3C46 A;  4UTG A;  4WP8 A;  4B9V A;  5IV4 A;  4X62 F;  4B9M A;  3PCO B;  3UDV A;  3OVS A;  2NSB A;  3L9Z A;  3T1Y J;  2L08 A;  1ZH5 A;  4OI2 A;  3SCL E;  5KG6 A;  1KHW A;  1RT1 B;  2QV6 A;  2XMJ A;  4OI4 A;  2BQ3 A;  4B9S A;  1ZBT A;  4F4X A;  2LEP A;  2ZOM A;  3R5B A;  4QPT A;  3EMT A;  4K4Z A;  1RT5 A;  3QAU A;  1YIJ S;  1KRP A;  1SJ4 P;  1P9Q C;  5ETV A;  4DR7 F;  1F3V A;  2XG8 A;  3FMB A;  3H25 A;  4LRE A;  1XC9 A;  3M05 A;  4JV5 J;  1WOR A;  2E5G A;  4C8Z A;  3BN7 A;  3DLJ A;  3D6H B;  4R8U B;  1IKX B;  1RZM A;  5CD4 A;  2QMW A;  2XMM A;  5HAO A;  4MFB A;  1VK3 A;  2CPY A;  4HHH A;  4NL5 A;  2C2O B;  2HQF A;  4ZPV R;  1FI4 A;  3OR2 B;  5A76 A;  4UY8 5;  1AUS L;  4Q8E A;  3K59 A;  2D7S A;  1UFL A;  2ZC3 A;  2CG4 A;  2HQ3 A;  5J1E A;  4CTA A;  3DMJ B;  4DR6 F;  4JYA J;  2I5J B;  2HZA A;  2UXD J;  2BJ9 A;  2XZT B;  2DGS A;  1FES A;  2IYI A;  3RAM A;  4DX6 A;  3KK1 A;  2D3O R;  2RF2 A;  4DV7 J;  1UL3 A;  1XR7 A;  4DPW A;  3MXH P;  2UUA F;  1WOO A;  2M4M A;  3QMQ A;  5E3Q A;  1O0P A;  3CPW R;  3W1Y C;  4DUZ J;  3MWB A;  5AXK A;  4DR1 F;  3JXO A;  3LWM A;  5EHH A;  5HVH A;  1MLA A;  1F60 B;  1TVR A;  3CSK A;  3IP0 A;  3DLG B;  2HMI A;  2MLX A;  1U45 A;  5DDR C;  1TQL A;  2A3J A;  2UVV A;  4TQR A;  4ED5 A;  2CJB A;  2KO1 A;  1EAY C;  2X1G A;  5EWE A;  5KG2 A;  5H9E K;  4CT9 A;  4HT5 A;  3NKY A;  3FVY A;  1F2H A;  2MQO A;  3CCT A;  2ZE2 B;  3HVA A;  2CA9 A;  2NPF A;  2E1M C;  1EX8 A;  2DKO B;  1VRT B;  2LXU A;  2ZBC A;  5U47 A;  2LFV A;  3KDN A;  4USJ C;  5CAA A;  2KXF A;  2WOM A;  4LF8 F;  2VPZ B;  4J9K A;  2NR0 A;  2Z30 B;  2FZG B;  3MMA A;  4OZ5 A;  2G0I A;  2GHP A;  3AD8 C;  3MPD A;  2VOD A;  1KLM B;  4CLU A;  2MB0 B;  5A0Y A;  1NHV A;  4NCB A;  3FFI A;  4TLQ A;  2AP6 A;  2LEC A;  1WDD A;  4GKJ J;  2MQ8 A;  3C6U B;  3IG1 A;  1T9U A;  2ZHA A;  1PJ6 A;  2Y1I A;  3BR9 A;  2YNF A;  3B78 A;  3CCM S;  4J9Q A;  4ED6 A;  2VOP A;  4FYX B;  3RR8 A;  1CSJ A;  2E29 A;  2E5I A;  2YTC A;  1JJ2 R;  2GML A;  1WC4 A;  2PI4 A;  2IFX A;  4UZB A;  1S6O A;  3CB4 A;  3U1L A;  2WBM A;  2PEB A;  1X4C A;  1BQN A;  4ILM A;  5KFV A;  3H2L A;  4TKT A;  3A8J A;  3CMA S;  3LP2 B;  1PKU A;  2F63 A;  3JTP A;  4B9U A;  4USV A;  2AX1 A;  2B43 A;  3HKZ D;  4NMX A;  1MRO A;  2CJ9 A;  4NLP A;  3KLH B;  3H20 A;  2OI2 A;  1NJI T;  3M2V B;  5HJY A;  2J7W A;  2YXL A;  4IKA A;  5DGB A;  2AJ2 A;  4NZ6 A;  4ZVO B;  2KT3 A;  4FS1 A;  2H1Y A;  3LP1 A;  5HMZ A;  3M9O B;  5J2N A;  3NGU A;  4EK2 A;  1IJF B;  1PIE A;  4YFU A;  2V8G A;  2J7K A;  3OFF A;  2ZDP A;  1CG2 A;  1F9H A;  2FHJ A;  2IC3 B;  1NZ8 A;  2J8S A;  4JI2 J;  2VG6 A;  1N54 B;  4OZ3 A;  1B3T A;  2XCA A;  4CZC A;  3BM7 A;  4F4W A;  2MHE A;  2V94 A;  5K9F A;  1GTH A;  3I5A A;  4Y2I A;  5LOQ A;  1SJQ A;  3OHB A;  2DPJ A;  1N32 J;  2DNH A;  3WC0 A;  3KMS A;  1VBX A;  3M1V A;  1K47 A;  2DNY A;  2GAH C;  3WBZ A;  3CD5 A;  2FD2 A;  3QYY A;  5DLF A;  4LFB J;  1RLC L;  5RUB A;  3Q8S B;  2BZ2 A;  2RUS A;  2ZBQ A;  1ULR A;  3NOG A;  4N77 A;  5D78 A;  3VAL A;  2DH8 A;  4DV4 J;  2XY6 A;  1D0E A;  2PN6 A;  3C66 A;  3ILL A;  1D9D A;  4P2X A;  2VPY B;  2Y8Y A;  1M5K C;  1DHM A;  2ZH4 A;  3H59 A;  4LFC F;  2QSF A;  3N9U C;  3ZXW A;  2FHK A;  2HBY B;  2PE8 A;  4ZCK A;  3V4I A;  4J90 A;  4LF7 J;  1AYE A;  4USH A;  1SH0 A;  4QIW D;  3G2X A;  3ZTS A;  3PEJ A;  4S0M A;  1BQM B;  5KG7 A;  4HLB A;  2ZH9 A;  1QUV A;  1Q95 G;  1WSR A;  2OTJ S;  4NYO A;  1FJC A;  2BE7 D;  3MUT P;  5IT0 A;  2R8H A;  1Q81 T;  1UVJ A;  5IWA J;  2LQJ A;  3GR1 A;  3KHR A;  3F0N A;  3NG8 A;  1M1G A;  3BSO A;  3W9J A;  2EI5 A;  1WEL A;  4XK8 C;  4FF3 A;  1YK9 A;  4NRU A;  2VG5 B;  4JBC A;  4YN3 B;  4O3O A;  4J9L A;  1VLY A;  3JSB A;  5CYM A;  5DS7 A;  3ZFV A;  5H9E J;  3BO3 A;  2H5J B;  2YQ3 A;  3T9Z A;  2IJR A;  4RUC A;  3OJS A;  1NKB A;  3T5H A;  4MKB A;  2JEI A;  2QGF B;  4NLS A;  2JOQ A;  2EG1 A;  2X51 A;  2CQ0 A;  5THW A;  2DY9 A;  5GAD U;  4ANC A;  2C22 A;  2JEJ A;  1PCA A;  5HN0 A;  4X4T A;  3CUN A;  5DM7 Q;  1RCO B;  4ETZ A;  1KVI A;  3FSY A;  1RKI A;  2CVE A;  7AT1 B;  2HRY A;  3HI9 A;  4BBY A;  3A12 A;  2KJW A;  2PA8 D;  5HAT A;  4JI8 J;  2HQI A;  2EC0 A;  3MEK A;  3W3S A;  3NP5 A;  2WRM A;  2R7S A;  1OSD A;  2KVI A;  3J81 j;  3JYT B;  1SCJ B;  2V8P A;  3CCE S;  4NXM J;  2HHX A;  2ZOF A;  2YPZ A;  2I5J A;  1A7G E;  3MEC B;  1FDN A;  3PJ9 A;  4ZCM A;  3DMJ A;  2KZZ A;  4RPF A;  2FTR A;  1NDP A;  1S49 A;  3PHE A;  4QWE A;  2DRA A;  3KJN B;  1KKH A;  3WIU A;  1YJ7 A;  2CIM A;  3CDB A;  4PPZ A;  3RTV A;  3VAM A;  2DCU B;  1S48 A;  5D3G A;  1MSW D;  3TAM B;  4TU9 A;  1AB8 A;  3W9H A;  5C2C A;  1K44 A;  2W7P A;  1DLO A;  2R8I A;  4HI2 A;  4EZ9 A;  3VCD A;  2OLW A;  1Y0H A;  5M2R A;  4ZKA A;  4Q44 A;  1S1T B;  4GO7 X;  4JOU A;  4WTY A;  4PZV A;  5DET A;  5J2M B;  4HI1 A;  5DLG A;  2WVE A;  3R6L B;  1VIX A;  2LCW A;  3EXC X;  3N6L A;  2DIV A;  3NAI A;  3AJ1 A;  1R31 A;  1VLO A;  1WG4 A;  2F8E X;  2HIQ A;  1IJE B;  4OI6 A;  2QFJ A;  3DLE A;  2WW8 A;  2APO A;  2KHD A;  1SH2 A;  1D8Z A;  5BYR A;  4IG0 A;  3FEY B;  3E01 A;  4ZP9 A;  3LP0 A;  4CYU A;  3PX6 A;  1OY8 A;  5LSR A;  3LQV A;  2CDR B;  1VQM S;  2N4C A;  5F8I A;  1T95 A;  3BGO P;  2RKI A;  4JI0 F;  2R8G A;  3W5Z A;  3SI8 A;  3MCO A;  4RNM A;  5EWG A;  1OPI A;  1GX5 A;  5CYQ A;  4KJI A;  1NM2 A;  4CTA B;  1S59 A;  1J5E F;  4C9D A;  3ILJ A;  1IKV A;  3GYX B;  1N48 A;  4EWT A;  1HNV B;  3BSA A;  2NSC A;  1HNI B;  5I3U B;  4JV2 A;  1TL1 A;  4LF1 A;  1ZTT A;  2C1E B;  2V8V A;  2PFD A;  4E2F B;  3LH2 S;  1Y5L B;  2AHO B;  4RUH A;  4P75 A;  2H51 B;  4P2F A;  4V19 X;  2MDA A;  4AQY F;  2BV3 A;  2JRS A;  4J9U E;  4CH1 A;  2RHQ B;  3OL6 A;  2PMW A;  2IHR 1;  2ZNY A;  2LQ8 A;  1VQ8 S;  2YNI A;  3O8W A;  1H2T Z;  3DLL Q;  2B7B B;  1SC1 B;  1F6T A;  3BGU A;  3TJ8 A;  2KG0 A;  4TN2 A;  4K2X A;  3DM2 B;  4LQ9 A;  2XEX A;  3EDR B;  4RW4 B;  1D3W A;  3L4B C;  1HQE B;  4C97 A;  4CH0 S;  3Q8P B;  5ADZ A;  1AUD A;  4DR4 F;  3SFG A;  2XZW A;  2E9Z A;  2YKM A;  5EUH A;  2RDD A;  2E5L J;  1UP1 A;  1L3S A;  5HQ8 A;  3DLH A;  3SFU A;  4ZLN A;  3QFH A;  5KFJ A;  1HW9 A;  2NCK L;  3A1Y G;  4DV6 F;  1GNK A;  3CD7 A;  4M5J A;  4F4A A;  5CD4 H;  1RTH A;  1SH3 A;  3QSI A;  1K1Q A;  3HLU A;  3V4M A;  1IBM F;  3T1H J;  2CNN B;  3GJR B;  1UJ5 A;  4PXE A;  3I4P A;  4RW6 B;  2VFT A;  3JSR A;  2RU9 A;  5ETT A;  2HNZ A;  5A8K A;  2KTQ A;  4MIB A;  1Q53 A;  3OFE A;  4P7V A;  4C0B A;  2A6M A;  1IQT A;  4CRJ A;  2C3M A;  4RLE A;  2YWK A;  2HZV A;  3P4U B;  5T7L A;  5BR8 F;  2GGP A;  3G4S S;  1SL0 A;  2UXC F;  2XO7 A;  4H54 A;  2BOP A;  3RYL A;  3FBF A;  4X4S A;  3D68 A;  2GJI A;  3L7O A;  3LAM A;  4W4M A;  4F3M A;  1UPM B;  3VGT A;  3VZI A;  1W7W A;  2HHT A;  4K4S A;  1Y4Z B;  4B3S J;  1S7H A;  4I0W A;  4CO0 A;  2FVR A;  3EGW B;  3M6V A;  3POT A;  4LUB A;  4UW2 A;  3PR5 B;  4NAS A;  5GAH I;  2DJW A;  1U1Q A;  1NPR A;  3CC7 S;  5KG3 A;  3M2U A;  1E6Y A;  1ZOT A;  1U1L A;  2O1P A;  5DDO C;  4DSE A;  2GAG C;  4N76 A;  2F4V F;  1UWB B;  2Q3P A;  3ZZT A;  5B0G A;  5EDW A;  2RB7 A;  2Z2M A;  2MQQ A;  1KWM A;  4KR0 B;  4RU2 A;  1FVQ A;  4G65 A;  3CJT A;  4AL7 A;  1OWX A;  3NXZ A;  4NEZ A;  2VPX B;  1HBU A;  4ZIW A;  4B9L A;  4UT4 A;  1L5U A;  1GXL A;  1NHK L;  1YLX A;  2EEY A;  1P9Y A;  2VBZ A;  4LFA F;  1YKW A;  1EB0 A;  2KT5 A;  3NGS A;  1KQS R;  3UNG C;  1JLC A;  4JI4 F;  4CWB A;  4UOH A;  4NA2 A;  2VKR A;  5CZX A;  1TKZ A;  3DRX A;  3OFG A;  5HBM A;  3RW6 A;  1CEZ A;  5A2Q Y;  3BGF A;  1TKX B;  4X4N A;  3I56 S;  2QL9 B;  3D0I E;  2AQ4 A;  1U2F A;  1VFJ A;  1AFI A;  2MKJ A;  5IOL A;  3IAM 9;  5KFH A;  1FO1 A;  3G8Q A;  1RAE B;  2OO4 A;  3LAL A;  1ITP A;  4FNI A;  2ASY A;  5DDP C;  1AT1 B;  3A3O B;  5F41 A;  3C6T A;  1IR0 A;  3VQT A;  2ACM A;  2VQE J;  4EYH B;  4DXL A;  3ET6 B;  2AV5 A;  2OMO A;  2JHE A;  3G87 A;  3BQ0 A;  4D3G A;  1NDC A;  1NME B;  2BE2 A;  1V3Z A;  2WVB A;  1GMV A;  2G9O A;  3AOA A;  4HAC A;  4KH1 B;  1FJ7 A;  3DN9 A;  4QIF A;  5EN1 A;  4GMK A;  5HJX A;  5H9F J;  3J81 Y;  3OL7 A;  1MN9 A;  3LP2 A;  2W9C A;  2NXJ A;  3MMC B;  2HHW A;  1YI2 S;  4UST A;  2N7Y A;  4ES1 A;  1KC8 T;  4I2P B;  4K4T A;  3HVW A;  4AYB D;  3TA1 A;  4ENO A;  5HMX A;  2R9L A;  2MGZ A;  4Q8F A;  4WTO B;  2UUB J;  2XYP B;  3G6V A;  2AGP A;  1X4D A;  2DIS A;  3OTE A;  1LW0 B;  3MI7 X;  2FZC B;  4N5S A;  2O3D A;  1RTH B;  3R7B B;  4P73 A;  3DU5 A;  2FVP A;  1KDN A;  4C4W A;  3CTR A;  1J5E J;  1VQ6 S;  3ZC4 A;  3I87 A;  4JI5 F;  2BA9 A;  2B4P A;  2CPH A;  2PII A;  5BXI A;  3EXY A;  3VF0 B;  4OHX A;  1VHF A;  3HX9 A;  1S97 A;  2R2U A;  4C8K A;  2F3J A;  4IG3 B;  3D28 A;  3R7S B;  1JLG B;  5D4N A;  2DRD A;  1Y10 A;  4EO6 A;  2DPI A;  2LEB A;  2DR7 A;  1FE4 A;  4FF4 A;  2AJQ A;  2VFR A;  1D9A A;  4DV3 F;  1FRJ A;  3BQ2 A;  1R0B G;  2DNL A;  2XYH B;  2F8H A;  3VAG A;  3I5B A;  2N4D A;  1FKO A;  1XBW A;  4OHZ A;  2FLN A;  4RL1 A;  3N28 A;  1ZAW A;  3KUE A;  3EZU A;  3BR8 A;  4IRC A;  1S79 A;  5LJ5 Y;  3MAA A;  1KVK A;  3VTI A;  3CDU A;  3GPA A;  2J6U A;  2HVZ A;  3MOZ A;  1RA6 A;  4HR2 A;  2M0G B;  3WDO A;  1TEL A;  3M8S A;  2NQP A;  1RIS A;  4WE1 B;  2CQ1 A;  3T1Y F;  3M8R A;  2KVQ E;  1U7L A;  5KFA A;  5A6W A;  1OPZ A;  2YX4 A;  2QL5 B;  2WON A;  3DOL A;  4KKO B;  5LSL A;  1CJU B;  3TYT A;  4ECZ A;  5AXM A;  3SYZ A;  4IR1 A;  2FIU A;  2IA0 A;  4JI1 F;  3MD1 A;  3SQG B;  1Z1Z A;  1HNZ J;  4CNZ A;  4J9P A;  3EGN A;  4DR7 J;  1WOS A;  3KKF A;  4CLS A;  1HKA A;  4WF9 Q;  3MMC A;  3RJM B;  1WEX A;  3V81 B;  3AOD A;  3G6Y A;  1RT1 A;  3CJ0 A;  3O5T B;  2KI2 A;  6AT1 B;  5KFQ A;  1HR0 J;  1N5T A;  2RKI B;  3F56 A;  4LRB A;  4C2M A;  1TU0 B;  4NLW A;  5C42 A;  1VQP S;  1T9T A;  3P45 B;  3Q22 A;  3NNC A;  3DOM B;  3UWT A;  3NMA A;  5DO2 A;  4DX8 H;  1OMS A;  2ATC B;  3SSS A;  5JJB A;  4DHV A;  4DV7 F;  5IM0 A;  4R8U A;  4ALZ A;  1PYS B;  2VZ9 A;  3NWR A;  2V2K A;  2VFU A;  3SIP B;  3SEO A;  2V34 A;  3PNI A;  1IKY B;  1LK5 A;  4FN5 A;  1NH8 A;  4KQZ A;  1HWK A;  1L3T A;  5C25 A;  4DSI A;  5DDQ C;  1RHQ B;  2DB1 A;  2V68 A;  3ONQ A;  3S7R A;  8AT1 B;  1FJE B;  3GIM A;  2JX2 A;  5HRO A;  2WVF A;  2ZBP A;  3KLI B;  1FKO B;  4HAC B;  4AFF A;  4RU9 A;  4ECW A;  5LMN F;  3KUH A;  2QSW A;  1N5Y B;  2CYY A;  2V8H A;  3VV2 B;  1B70 B;  3AXM A;  4F0M A;  2I2Y A;  4QW8 A;  2IBK A;  3KJF B;  3IS9 B;  3ZTQ A;  2ZJR Q;  2OJ3 A;  3QO9 A;  5AE2 A;  2UU9 J;  3FZB A;  5KFW A;  1N34 F;  1EKS A;  3FMW A;  3ZTR A;  3MAQ A;  2QA4 S;  1UEK A;  2BJ3 A;  2CJY B;  2GW8 A;  1TL3 A;  1S6Q B;  2ILY A;  1NSA A;  3P3D A;  3RZA A;  4XIU A;  3BJY A;  1JKH B;  3M30 A;  4RNH A;  1FJG J;  3BN4 A;  3LP1 B;  5J2N B;  1XMQ F;  2ZKT A;  1YRX A;  3MPY A;  2R8J A;  4B3O B;  1DQ8 A;  3M32 B;  3MHY A;  4WFB Q;  2OML A;  2AX0 A;  1V6H A;  2V4J B;  2WSE C;  2L9N A;  2RQ4 A;  4FYW B;  3TA2 A;  3NOC A;  4CIO A;  1JWW A;  2EKY A;  4O3Q A;  3EDQ B;  3GFY A;  2BM1 A;  3CED A;  5CYM B;  4RNF A;  2FVC A;  1RWX B;  4X64 F;  2BOA A;  4L74 A;  3MMJ A;  2DXF A;  4F50 A;  5GMK a;  2HQD A;  3Q0A A;  1Q8B A;  4JV0 A;  3Q8U A;  4M63 A;  1VIS A;  4ZK7 M;  4DPT A;  1SC3 B;  1RT2 A;  4P9S A;  2FHO B;  2WB1 D;  3D6F B;  3P6Y C;  2QJ3 A;  4KSE B;  5MLC V;  3NCP A;  1FFS B;  3BZQ A;  3NL0 A;  3OV7 A;  1FRI A;  1LFW A;  3MPU B;  3FUY A;  1G1X A;  2QO3 A;  2UUW A;  3J81 U;  1OJ4 A;  2B9Y A;  1TAU A;  5KT2 A;  3V4I B;  2BJ7 A;  4KTQ A;  3OL8 A;  2DGV A;  1SKU B;  5E41 A;  4H4K A;  3V6H A;  3R2D J;  1YX2 A;  2NXU A;  3GV8 B;  3B6B A;  5K8O A;  1C0U A;  2VJU A;  4CO1 A;  4WXW A;  2MSS A;  1FXL A;  2HW3 A;  3PKM A;  1LWF B;  2PA3 A;  2EFP A;  2UUA J;  4NRT A;  2IAJ A;  4IFY B;  2KN4 A;  3RW7 A;  1EKR A;  3SZ2 A;  2Y3Y A;  3JS9 A;  2P6T A;  3L09 A;  1ZTW A;  2HRT A;  3BBF A;  1JX4 A;  4FF1 A;  4K5S A;  1EP4 B;  3MEE B;  1DTQ A;  3MM7 A;  4LRF A;  3IGV A;  4X66 J;  2P9E A;  1HFE L;  1HMV B;  4JI6 F;  3OXL A;  2V2Z A;  4DFK A;  3AB4 B;  3GG0 A;  3I0S B;  3M8Q B;  4JP8 A;  3VVU A;  4EI2 A;  2KXN B;  1N8R T;  4FPI A;  3BPD A;  1F2G A;  3KHH A;  4M5K A;  2VU5 A;  3UW1 A;  1RI7 A;  4TYB A;  2D3O 1;  3R6G B;  4K4V A;  4JB8 B;  4NA3 A;  4DV4 F;  5D4O A;  2HYI B;  1W26 A;  5IM0 B;  4OHW A;  4LR9 A;  1NJZ A;  2NUU G;  1SKW A;  3Q86 A;  2MQN A;  1RLD A;  1ZYQ A;  3UD4 P;  4U6P A;  2EVZ A;  2M8H A;  4M5L A;  1VBY A;  4KGK A;  3GIJ A;  4OL8 A;  3GCX P;  1RK8 A;  1U24 A;  2DNM A;  3HHE A;  4FVM A;  5I3Q A;  3D2W A;  1YJN S;  2BYC A;  1NK4 A;  1JLA A;  4KFB A;  3W63 A;  4DBQ A;  1NUE A;  4DQI A;  2NLW A;  3FSX A;  2XGP A;  1CBK A;  3O3L A;  3RBZ A;  1YSJ A;  3CNQ P;  2G0J A;  4PXC A;  3TNV A;  4ZHR A;  1N5Y A;  3FQL A;  4HT7 A;  2E5H A;  4AD6 A;  4Q0B B;  3CVK A;  3T41 A;  1IUJ A;  1NK9 A;  4CCH A;  2I1R A;  1M5H A;  4KO0 B;  4O3R A;  2ZKU A;  3D3B J;  3LAK A;  1UVL A;  1HYS B;  2AT1 B;  1RAI B;  2K06 A;  1S1T A;  3OTD A;  4LVN P;  2E1C A;  1RKJ A;  2UZA A;  4ECQ A;  1W25 A;  2VQF F;  2UXD F;  5A8W A;  3PFE A;  4DL6 A;  1HIY A;  3EIC A;  4DCO B;  2WB4 A;  2L9D A;  3M32 A;  4ECY A;  4HTI A;  4OZL A;  4L6V 3;  4K5R A;  1FT8 A;  3TVK A;  4DR3 J;  2CWX A;  3KG0 A;  5FJ4 A;  1WI6 A;  4CI0 B;  4KH0 B;  1GMU A;  3EWG A;  3AQO A;  2CQ2 A;  4FXW A;  1OO0 B;  4ZCL A;  3TOQ A;  4GVB B;  1HBO B;  2CQ4 A;  1GXT A;  2JVO A;  4HH1 A;  3R7N B;  5GAH U;  4YHH J;  1U1N A;  3TVZ A;  2QL7 B;  3A8I A;  4EZ6 A;  1N5V A;  3CCL S;  4MT1 A;  2CNO B;  4NLR A;  3IO1 A;  4OLO A;  3NAH A;  1FD8 A;  4RW7 B;  4TLR A;  3UDL A;  4CO5 A;  6FD1 A;  2N3O A;  3KLH A;  1DZ5 A;  2JEF A;  3ISZ A;  1RT6 B;  2ZIT A;  4F8R A;  2DNP A;  1RT4 A;  1KNZ A;  1TK8 A;  3NNH A;  1TV6 A;  4A47 A;  1D8Y A;  3FBE A;  5ETO A;  2DNO A;  2Q6B A;  3Q8R B;  4P74 A;  2HBZ B;  4LF8 J;  5HMY A;  2VPW B;  4WE1 A;  3O44 A;  2OPS B;  3R5J B;  2ZH6 A;  3AQP A;  3DRP B;  4U7C A;  4A8M P;  1N34 J;  2IRU A;  2B3T B;  3IWN C;  2YNI B;  4UQT A;  4DV0 J;  2MLZ A;  5IQQ A;  1Q7L B;  3LPE A;  5D0R A;  2HEK A;  5I4M A;  5IXU A;  2Z58 B;  1U1O A;  4QWC A;  5D4L A;  2W9C B;  1RA7 A;  1YJU A;  3AY0 A;  1GTE A;  2B51 A;  4B08 A;  4CNY A;  2XB2 D;  2R7X A;  3VGV A;  3HUL A;  3DLK B;  2HPU A;  4DR5 F;  1CPZ A;  5HP1 B;  2J9C A;  5B0A A;  3OUY B;  1NK0 A;  3N5B A;  2XNQ A;  4P52 A;  4H4O B;  4P6Q A;  2RRA A;  3ENW A;  4K0K F;  2FLO A;  3CDA A;  3FQK A;  3PO4 A;  2E7V A;  1HWL A;  2HVD A;  2QN6 B;  1VC6 A;  5KT4 A;  3TZZ A;  5A6P A;  2FVQ A;  3OD2 A;  2DGO A;  2MKS A;  2LKZ A;  4LVO P;  3PG9 A;  1ZM2 A;  2YKN A;  4CO4 A;  2E9T A;  2B0G A;  4UOG A;  3OTO J;  1SV5 B;  1NND A;  1O6X A;  2YWG A;  2Z2Y B;  3LO3 A;  1V5I B;  2HRU A;  4K8R A;  4OZ1 A;  1YBU A;  1TUV A;  4F0H A;  4LSN A;  2ZH2 A;  2C42 A;  4C8O A;  1WKK A;  3D6T B;  3OFH A;  1U1P A;  3QLH B;  1RCX B;  1JLG A;  1U0H A;  2MZQ A;  2ZOG A;  1JLF A;  3IM8 A;  4FF2 A;  4GVB A;  2BJD A;  4ZVE A;  1HQU B;  5K8P A;  1PGZ A;  2HHH J;  2HGL A;  2ZVI A;  3CWJ A;  3R1H A;  4XPC A;  3MD3 A;  3I32 A;  4QIG A;  1HD0 A;  2AYE A;  2CPF A;  4TVA B;  3AAW B;  2WK4 A;  2H3E B;  1UA1 A;  3C2P A;  4L75 A;  3VAH A;  4DFJ A;  1M5P C;  1FX4 A;  1YG0 A;  3VGS A;  2XMK A;  1M90 T;  4CDI A;  2UV8 A;  5KFC A;  4PUO A;  1Q4R A;  3ETO A;  1JIH A;  3U27 A;  4PCQ A;  1R8H A;  4Q0B A;  4DF4 A;  2BJ1 A;  3S8S A;  2HND A;  4NOH A;  2X1F A;  4F3Q A;  2GVD A;  3OW2 R;  1VDH A;  2GO8 A;  3AD9 C;  4M94 A;  1QD1 A;  1E6Y B;  3BYP A;  1RSC A;  3GYG A;  4HEA 9;  4LSZ B;  4EUV A;  2OH2 A;  3J7A 1;  1BLU A;  1IBM J;  4AE5 A;  1EET A;  2K1R A;  2C2Z B;  3EX7 B;  2ZZN A;  1YBT A;  3TX0 A;  3Q89 A;  3QGH A;  4X4U A;  2B5J B;  3SQG A;  1R43 A;  3G9C A;  2JSX A;  3MCN A;  3CC4 S;  2RUG A;  1VBZ A;  4L73 A;  5CXT A;  1R8C A;  4M5D A;  4R25 A;  4DG1 B;  3IXQ A;  2BKP A;  2X1B A;  3BKT A;  1WHX A;  3C16 B;  3IAS 9;  2CPX A;  5ETQ A;  3HMJ G;  1NKC A;  2A10 A;  2EWH A;  1HQ2 A;  1HBM A;  1QE1 A;  4K50 A;  1X8D A;  1S12 A;  2ZFH A;  3ITH A;  4PEO A;  1QAI A;  2DH9 A;  2X7I A;  4ED3 A;  3AJ2 A;  2CQH A;  4MH8 A;  2E7W A;  2XHW A;  2XMV A;  5LJ3 Y;  2MKC A;  3PJW A;  4O44 B;  5DG8 A;  1N6Q A;  4UF4 A;  3ADA C;  2C3P A;  2K8G A;  3IG1 B;  1WEZ A;  1KN6 A;  2HS3 A;  2V8D A;  3KLV A;  4JI7 J;  3CIZ A;  2OD4 A;  4IOB A;  4OV6 A;  4DV5 J;  4Y2K A;  3B54 A;  2J8A A;  4LF5 F;  3FRZ A;  2F7V A;  2BE2 B;  2G0C A;  1FNO A;  3TAR A;  1UAW A;  2I8E A;  1RB0 A;  2FYX A;  2OSR A;  3EZ5 A;  2H9Z A;  3N01 A;  3QGP A;  2ASD A;  2A1B A;  3UFC X;  2D1C A;  2OFG X;  2YY3 A;  1I1G A;  4O3N A;  2JLE A;  3HT3 A;  2LDY A;  3K5M A;  1V9O A;  2Y1J A;  4WU2 A;  1HHT P;  5I42 A;  3AA9 A;  4FVC A;  4OI0 A;  2QMX A;  1URR A;  2EFV A;  2V69 A;  2YKO A;  3NCR A;  2N3L A;  5KFG A;  3IWX A;  5KFI A;  3TA0 A;  5LXR A;  5LM7 E;  1BMQ B;  2VDH A;  5F3Z A;  4XO0 A;  1L3V A;  1S77 D;  5J1N A;  5KFL A;  4I69 A;  1H0H B;  1O51 A;  2CAD A;  2WOM B;  4JI8 F;  2Y0B B;  4NI2 B;  4ZJL A;  2BW2 A;  2C28 A;  3C15 B;  2F5G A;  2OIH A;  1MW7 A;  1R3N A;  1S4F A;  2OFH X;  3MED A;  5M2P A;  1IBK J;  4O0N A;  1R8P A;  5KFT A;  2J0S D;  1C1B A;  3IBW A;  2NZC A;  2JEG A;  1TKX A;  4V1A k;  2OHD A;  4LIR A;  3V6D B;  2G13 A;  1NO8 A;  3ZTO A;  3DRY A;  1C0T A;  1Q0N A;  3ILI A;  5B0C A;  2HND B;  1UW4 A;  4ZPT R;  3V2U C;  4DR2 J;  1FWL A;  2C3U A;  4RNO A;  1R8A A;  1NB7 A;  4JYA F;  1BWE A;  2FY1 A;  4JI3 J;  1QVG R;  1DTT A;  1UCN A;  2CZ4 A;  3CJQ A;  2ZM6 F;  3CW2 C;  1FER A;  2K1R B;  3T5L A;  1N4L A;  2FDN A;  2U2F A;  3PRB A;  3UDC A;  1LWF A;  4L72 B;  1FRH A;  1U48 A;  4O4G B;  1DBD A;  4RUA A;  1QTM A;  2RJZ A;  1VQ9 S;  3BDP A;  2EBE A;  2FVS A;  5K14 A;  2VG7 A;  1PAE X;  4PXB A;  3W2V A;  5D0E A;  5I3P A;  4B3M J;  2E7X A;  2CZ9 A;  2XMA A;  1R0A A;  4KT0 C;  2CPI A;  3BDE A;  1RBL A;  4B3T F;  1O8B A;  1SQE A;  2IM1 A;  3CF5 Q;  4FDF A;  5J2Q A;  1IXK A;  2M70 A;  3BSC A;  2Z2L A;  4DN9 A;  4Y00 A;  3AOB A;  3I55 S;  1NJW A;  1PSD A;  3FRY A;  2W2O P;  4OZ2 A;  5FDL B;  3KFW X;  1VC0 A;  5KFB A;  5DM6 Q;  1SL1 A;  4WFA Q;  1S1W B;  4WZM A;  4ED2 A;  2POK A;  4X4V A;  3WZ0 A;  1E6V B;  3HD1 A;  1NJY A;  3QLH A;  4WIQ A;  4H4M B;  2MJN A;  1NK8 A;  4WKY A;  4OMF G;  5B7W A;  4F2R A;  1IKY A;  1PBA A;  3DDK A;  2UV8 G;  1HNW J;  4C0H A;  1HQU A;  2UXB F;  1FK9 B;  1HLW A;  2Q43 A;  1TMJ A;  5HO4 A;  1RYS A;  1N36 J;  3V5R A;  5ETR A;  3KK1 B;  3GON A;  1FNX H;  3OPK A; 
#chains in the Genus database with same CATH homology
 1F3V A;  1F2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...