1F3VA

Crystal structure of the complex between the n-terminal domain of tradd and the traf domain of traf2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
HEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAI
publication title A novel mechanism of TRAF signaling revealed by structural and functional analyses of the TRADD-TRAF2 interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09034 TRADD_N TRADD, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TRADD, N-terminal domain 1f3vA00
1F3VA 1F2HA
chains in the Genus database with same CATH superfamily
2FJWA 4Q0BA 2DH8A 2CNOB 4DL7A 1YSJA 4NZ7A 2HSEB 5D78A 1RDRA 3SZ2A 3DDIA 2ZJPQ 4JV0A 2HVEA 4IFYA 3EM1A 3AXMA 1TL1B 1S59A 3OL7A 4JI2J 2ZD1A 1OJ4A 2F9DA 2CQIA 4LT6A 1XMOF 1VRUA 1FWLA 1UZHA 4DSJA 3IMQJ 4K0KJ 3ZZTA 1GEHA 2HHQA 1H74A 1S7HA 5HROB 4QWBA 2PFFB 3HZGA 5IOLA 3LP0A 4CLUA 1IKVB 1BMQB 3W2VB 2V2ZA 2QMXA 2LYVA 1XN9A 5FD1A 2ZH5A 3TO8A 1EQ0A 1FRLA 4TU9A 4N5SA 2RF2B 1F2GA 1F5CA 1IBCB 3MPVA 2VB6A 3G8QA 1D09B 1JLCB 2OFGX 4CLLA 3RBZA 4ANEA 2ZH6A 3U1NA 4WTOB 1LW0B 1SQGA 3HFKA 3ZNUA 2RAQA 1RAGB 2FHJA 4EGLA 2HNDA 1HR0F 4QR0A 3VTIA 2MHEA 3A8IA 2W9AA 4IYQA 1Y00A 3T1YJ 4ZA1A 3NP5A 4URSA 2KM8B 4OHYA 5D4LA 4ZVRB 1S10A 4NZ6A 4Z37A 2BE7D 2LXIA 3HSDA 5L9NA 1UWBB 4H54A 1S0MA 2Z58B 2ATLA 2D69A 3N0VA 2QO3A 3HLUA 4NLGA 1RT2B 1I6JA 2EFNA 2DHXA 2YH1A 4ZPDA 1GMWD 3H4DA 2RMLA 2VASA 1VBZA 4H4MA 5G0RB 2RVJA 1AUDA 1KFSA 5ETVA 3W5XA 3DLEB 1A6LA 2OEMA 4O4GA 3KHGA 2OIHA 1FDDA 2L08A 4U8YA 4FDFA 3VALA 1CULB 2OSQA 2FPHX 1DTQA 1JXVA 3H8YA 4NLYA 2V94A 1K73T 4EYIB 4J9VA 4RX6A 2LQBA 2AWZA 2X3GA 2CG8A 2GCFA 3BF4A 3PV8A 2R7WA 1G6BA 4CH7A 2UUAJ 3RRGA 4CO3A 1HNXF 4K4UA 3DLLQ 5CH7B 1H7WA 2AZ1A 5CYQA 4A8XA 1URNA 4LRFA 1RU1A 2PA8D 1KLNA 3QNWB 2DT9A 1RTDA 1ZETA 2J9CA 2IJRA 3G8SA 3QWUA 4G6VB 4FF1A 1JB0C 1RT4A 3NGKA 2WW8A 1HBUB 3M8YA 3PG9A 1C4AA 4F3MA 1FWKA 2UVWA 4WE1B 1UJ6A 3IBFB 2Q43A 2PI5A 2L9DA 4CWBA 1N5QA 1UAWA 3QFWA 2HHVA 5HVGA 4CLFA 5J1EA 2YKAA 2JFDA 3LPYA 2KZZA 3L7PA 4WFYA 5LJ5Y 1YJ7A 1HBNA 2HQCA 3TX8A 1S99A 1FJGF 3W62A 1NJIT 3JXOA 1B99A 3PW0A 1OO0B 3IXQA 2FLPA 3KFWX 3GG1A 3PRDA 3E01A 1PC5A 2GGPB 5IM0A 4YFUA 1CJVB 1KQGB 2LP4A 2Z2ZA 2FJVA 1VDHA 3E8OA 3MOZA 1IR1A 1HI8A 2ATCB 4NMXA 2NQPA 2YBVA 4ZHRB 1K1SA 3UFCX 4ZJLA 2M2BA 3CTRA 4FNIA 4L3NA 2OELA 1APSA 4Q2LA 1KONA 1WELA 4V19X 3M2VB 4DX7A 2XS5A 4RW8B 3MMBA 4B3RF 4DUZF 2DRBA 2NYHA 4O44A 2EWHA 4B9MA 4DZ6A 2B7CB 1RTIB 5A0YA 1GMUA 1JLEB 2KRRA 3FBEA 2V8PA 1V3SA 2DTJA 1BE4A 3D0HE 1WHVA 3VAKA 3T5LA 5B7WA 3DRPA 3DLHA 2YTCA 3AHPA 4IH7A 2RRBA 1I51B 3GV8B 1UA0A 1RCOB 3TX0A 2P8IA 4WTYA 1FJEB 4PYAA 2UU9F 2R7SA 4I7FB 1QSSA 1HI0P 3F73A 3TAPA 4BLGA 1S6PA 3K57A 5KG2A 4OJ3A 2CZVC 3H2VE 3CMAS 3UDCA 4U7CA 4DFPA 2V4JA 4DV6F 2HHTA 1MSWD 1IBLJ 4DZDA 4Y00A 2UP1A 2HIYA 3G82A 5EX3A 4ZKAA 1JJ4A 1R0BG 2J76E 2V6AA 4OI2A 1MNEA 2QLBB 5IQQA 1J2VA 2FGCA 1U4BA 1R6VA 3RAXA 3M6XA 2VHGA 4RNHA 2AMCB 2LQ9A 3BV8A 4LF6J 3UNGC 4TYAA 2XZWA 4N77A 1KSPA 4GKKJ 5K8PA 2IM0A 2HQDA 3FEZA 3TA2A 4OX9F 4U96A 2DEIA 4DG1A 2XLKA 1N5YB 1DY3A 4QW9A 3A3OB 3BR8A 3PHEA 1RADB 3IWXA 3FVYA 4I6AA 4WFBQ 2BBEA 3MHYA 3NBPA 2Q1LA 2AU0A 4PR6A 1VISA 4C0OC 2VC0A 2MQOA 4OV6A 2J0SD 3MCSA 2XY5A 2XHCA 3M6WA 3PYDA 2WVDA 1M5KC 2MSTA 2VL1A 2VFSA 5K14A 4LJMA 3GYGA 4B08A 3TUJC 1KHWA 4IDKA 1NBEB 2VDHA 3HMJG 2V2KA 4DR1J 1JLGB 1R7IA 4C9DA 4MMOA 3BS9A 2QA2A 3I5CA 3MM8B 2B0GA 1MU2B 4NA2A 4N47A 4K5RA 4DV3J 2VA3A 4A8SA 2N4DA 4CYUB 3GR1A 4PWDB 4AXIA 4DR4J 4DR2F 4RW6A 3QLHB 1RU2A 3W8PA 4EO8A 2ZE2A 3OV7A 3AA8A 1V3ZA 2C28A 1X60A 4B9VA 1XWLA 2VFUA 1N36J 3EGNA 4PCQA 2UUCF 1OQ3A 2I6WA 3BBFA 3E2EA 1N33F 2ILYA 5KFGA 2R7UA 1SV5A 3FZ2A 4IFVA 4QU6A 2DR7A 2DCLA 5IV4A 1S6QA 4FVCA 1SJ4P 2KFYA 3CC7S 1T03B 2I5JA 3CB4A 3OTCA 5KFCA 1U6BA 2BANA 1HWUA 1R3NA 2VOOA 2CQHA 1UW4A 2KU7A 4ES2A 3QATA 3AH6A 5LT5A 3J7YI 2WTFA 5C25B 3OPKA 3MCOA 2DGOA 2KKHA 4LF1A 2PC6A 4UT4A 2G2OA 1TL1A 4LFCJ 4KGZB 3PO4A 1VQNS 2UXBF 3A1YG 2FC8A 3J7Z5 3IRWP 1YQHA 3LGNA 2J5AA 3BO2A 2L48A 4CLZA 4F0HA 4JI3F 4QWCA 1SC6A 2QA4G 3J7AN 4KKOB 4YDDB 2MPUA 3MR5A 1LK5A 1KRPA 4MKYA 5HROA 2OEJA 4A8OA 4H4OB 3CCWA 4UTGA 5J1NA 1IKVA 3W2VA 3BSAA 2Z56B 1IM4A 3GFZA 5HVHA 4ATNA 3NS5A 4RPFA 2MY8A 1WNEA 5F9NA 4JI1F 1I5OB 2OMLA 1P8GA 2F3JA 3BGOP 1OSCA 1RSCA 3V6HA 4WP9A 1RE1B 2RF2A 4QWEA 1D9DA 3N6LA 5B0FA 2YX4A 2KHDA 2OO4A 2CNNB 1RQ0A 4X62F 2IVYA 3FRZA 4DV0F 4NLXA 3VAGA 3KUEA 4I4BA 3EYZA 1JLCA 2BVZA 1R27B 3HKZD 3TYTA 1U25A 4CH0S 2VONA 4EO6A 1RACB 2QGFB 1VC5A 1LW0A 1X5SA 4B3TJ 4ED1A 1LV5A 4FBTA 3CC2S 4ITSA 3EWGA 4K4VA 2PEBA 1PYOB 3M8PB 1HNVB 4RNNA 3TW0A 3K59A 1RB0A 4WK3A 2ZDOA 1RP5A 1U8SA 3MM6B 4YY3J 3ZXWA 4EI2A 1Q5YA 1QVFR 3DU5A 3SQOP 3KDNA 2R2TA 4WF9Q 1J5EF 4QOTA 3FBFA 1UWBA 2YX1A 4XO0A 3LWLA 2B6AB 4YEAA 2WBMA 1RBAA 3H90A 2IY5B 1WSVA 1RT2A 4DEZA 1RWOB 4B9UA 2J7UA 5G0RA 1C0TB 2CPXA 1VR6A 4MK9A 3CCTA 3IGVA 3UD3P 3M8QB 2PDAA 4J37A 3C14B 2A1BA 2HQ3A 1HHTP 1RKIA 4CTAB 3DLEA 1U2CA 1YBAA 1C2PA 2GIFA 3A3NB 4WIIA 4ZCIA 2LEBA 1CULA 3MAAB 1WORA 2YWKA 4P74A 2D7SA 3CW2C 1QLNA 1HPZB 2OPRB 1N32F 3QPIA 3BSCA 3DRXA 3J7ZT 5KFRA 4I56A 4X64J 1Q95G 4QR2A 4U9RA 4Q43A 1P6TA 4TQRA 2XMUA 3CIMA 1H7XA 1TL7B 2HGNA 2MQLA 3WBZA 3C8YA 4X4TA 2XQCA 1PO6A 4WJBA 4BC7A 2KM8C 2ABYA 1Y3JA 1G1XA 4ZJQA 2DXEA 3ENWA 1HNIB 1ZPVA 1UZDA 2Z57B 4HH0A 3U7JA 5AE3A 3H40A 5KFJA 3PCOB 2OTLS 3PY8A 4DUYF 2QTWA 1YG0A 2HRTA 3EUNA 4F0KA 2EFGA 1HBUA 3I5BA 3W66A 3D0IE 3VF0B 3RB4A 3CDWA 1JNRB 3CD5A 1UA1A 3U1LA 1RWPB 2VODA 4ZPCA 3FSXA 2BM0A 2PD1A 3WX4A 4M5JA 5D8HB 2HHHJ 1WG4A 4NXMF 3PJXA 2H5EA 1CBKA 3QT6A 2B4OA 1M5SA 5IC4B 5F8NA 4DL4A 2HEKA 1WTFA 1WF2A 4GRSA 3L4BC 3R9LA 4KC5A 3TWZA 2NZCA 3R6GB 3I4PA 4TKTA 4EEYA 4Q8EA 4DSIA 4HT5A 2G0IA 4DV7F 5I3UB 1KOOA 1XNQF 2GGPA 1RLCL 1CJVA 3GQCA 1FEEA 3DI6B 2YKNB 4ZHRA 2IMWP 1OY9A 2EK1A 3I56S 2GMLA 3Q2SC 1M5PC 2V69A 1VLYA 1J5OB 2V8DA 2IDEA 3M2VA 5KFAA 3LALA 4RW8A 3J80Y 4S0MA 1HW8A 3T9ZA 2BJEA 2MQMA 2LQ8A 4DBQA 1RTIA 3G96A 2GA7A 1JLEA 2Q6CA 3IG1B 1WKJA 3AOCA 4FNHA 2WSCC 5F9LA 2XCAA 5IT4A 3OQ2A 1T9YA 1FFWB 2KH9A 1V5IB 3RG6A 3CC4S 2CJ9A 2F65A 1C1CB 1Z2LA 3PEJA 1GTEA 1RTJB 1CVJA 3Q0AA 4ZS6A 3SCIE 4I7FA 1KVIA 5F0WA 3GONA 3DGPB 4ZIVA 5L9XA 3M8ZA 1IKWB 4CLWA 4WFAQ 4AL6A 3DRSB 4C97A 3O3LA 5CA5A 2G13A 2VOPA 1RK8A 5JVGQ 3UPFA 4KBIA 1RBOB 5IT9U 3POTA 3ZTOA 2VJVA 4WKYA 3CCJS 1BQXA 4Y34A 5DG8A 2V68A 3DLKB 3NAHA 4DU7A 2QL9B 3V6KA 4CT9A 2PT0A 2V63A 1FRXA 2E9ZA 4ERDA 3LAMA 4PG4A 4J9MA 2J0XA 4RUBA 1CEZA 4J9LA 1YDLA 4Y6IA 2XMJA 2QSWA 5ETNA 3KLEB 3RB3A 2GVDB 1N5YA 3SCKE 2OHDA 2VPWB 3DLJA 3WIVA 1NXIA 3JYTB 2NXCA 3BBCA 3NAIA 3H5YA 2VBZA 2P5VA 2WVEA 2NS1B 4ECTA 2AGQA 5HQMA 2HFOA 4WYWA 2FVCA 3BGRB 3TJ8A 2O1PA 3NGTA 4U67Q 1FRMA 2EI5A 3KLVA 3MAQA 4P52A 4ED8A 2BOPA 7FD1A 1M5HA 3ZO7A 2R3VA 2VIHA 3MM7B 3KK2B 2HLTA 2HG4A 4YN3B 2OI2A 3DRRB 3ILLA 1TTHB 2ZNZA 2UVVA 2FTRA 3NG8A 3RR7A 3UO0A 1NKCA 4OYBA 1JLGA 4R8UB 1EZZB 2HFUA 2B51A 3QGGA 1IBMF 3MM8A 1RABB 1MU2A 2QYCA 2H54B 3M8SA 4K4WA 3UD5A 2MKKA 2AEJA 4M1KA 4CYUA 4F36A 1C0UB 5LSRA 4PWDA 3GYXB 1HLWA 2W01A 5LMNJ 4TY9A 3QLHA 4OZLA 2W4DA 1P9YA 3B54A 2XMTA 3NCQA 4JI8F 3W5ZA 1RHQB 4Y2KA 4ZN3A 1L3VA 2IAJB 3MECB 1RAFB 2MLZA 2AYGA 1RCXB 4DV5J 1WOOA 1NLKL 1UP1A 4IOAQ 4ZK7M 3ZZ0A 4PZVA 1T03A 5A8RB 3M6UA 4EU0A 1SIZA 1RZMA 4OI0A 4G65A 3D4JA 3UR3C 4BHQA 4LF5F 1RWXB 5EX0A 3R27A 1PAEX 1ELOA 2Y8YA 1S12A 4JI6J 5KFIA 5C25A 5HSPA 1NB7A 3OFGA 5A8WB 4EFAC 5F8JA 3MR6A 2HBRB 3L7UA 3H4BA 4J9SA 5KFHA 4CI0B 3TVZA 3S7RA 4OZ5A 2PIIA 1TL3B 1FJ7A 4DSFA 3BQ1A 5KFSA 1YWXA 4KKOA 3TRGA 4DX5A 2KJWA 2MJUA 5HQLA 1AYEA 1FWPA 4J9KA 3AT1B 4H4OA 5I3PA 4ED7A 2QMWA 2EW9A 1JLQB 4YS2A 2X51A 4USTA 4TNOA 2V0NA 2X3DA 1CSJA 3BGLA 2NYIA 1XMQJ 1SL1A 1EKSA 3GV5B 1A0OB 2OPQB 1VQPS 4OI4A 2M7SA 4P7TA 4C98A 2MEWA 3CMES 4DL2A 1XIQA 1SH0A 2EXUA 3DLGB 3P3DA 4N8NA 2NXJA 1AFJA 1HNWJ 1FI4A 2FGOA 3GIRA 2W1BA 3IR5B 1VQMS 2FZGB 5LM7E 4HDHA 3B4MA 2LLZA 2DYAA 4KH0B 3M32B 4FF4A 1CQMA 2RH3A 4KO0B 4LF9J 3M8PA 1HNVA 4AQYF 2EFQA 2ZHBA 2V2VA 3PZPA 2NLWA 3CMQA 1U24A 1ZAXA 5BYSA 3MM6A 1IBKJ 4NCGB 2JEGA 4DV2F 2EG1A 1VI7A 4GC6A 1FFSB 1SXLA 4HT7A 4QYZJ 3C66A 2B6AA 2XZTB 2XNRA 2AGOA 4U6PA 2DR5A 5DRKA 2XYPB 5AXLA 2CQ4A 3C16B 2LKZA 3OL6A 1C0TA 2HGMA 4O0IA 4OLOA 4GKJJ 2EPIA 3M8QA 2B4UA 3C14A 1WWHA 4CTAA 1ZZFA 3SV4A 3D0GE 2JL9A 3MAAA 1JXLA 2A2DA 3J80U 4HHJA 1S48A 3K7RA 2RJZA 2OPRA 1F60B 2UUWA 2HVIA 4ZPBA 4DR2J 4GMKA 2LA6A 2CQ0A 3WX8A 1TL7A 2HS3A 4B3SJ 2J7WA 2DNQA 4CP5A 3DXBA 2ZH7A 1CLFA 4ES1A 3EDQB 3VWSA 4NLWA 3M2RB 1WUUA 3QJLA 4DL5A 3R5JB 1X5TA 1HNIA 5L1JA 2R7XA 4O23A 1U1LA 3BGFA 1MWQA 4PG7A 2A6OA 5JXSA 3PRVA 4USUA 4FXWA 5L39A 1VIXA 2ACMA 1ZBTA 1VQ8S 1NSAA 1QE1B 1PC4A 5DQHA 3MMJA 1RT6B 4MKBA 2HNYB 3QGHA 3TNVA 5KG0A 4MIAA 4M95A 1FF2A 5HO4A 4NPOA 4RU2A 5L46A 1SCJB 2G0JA 3PR5B 5IS2A 3JAMY 2Q66A 3PTWA 1GXUA 2HKEA 5ETKA 4A8YA 3FRYA 4O3QA 3KUHA 1Y7PA 3UW1A 5I3UA 2ZJRQ 2WSFC 2MJNA 1GFWB 3U27A 2DBBA 3L7OA 4N7TA 2BR0A 1PYTA 3AODA 4LFAJ 2XLJA 3DI6A 4NYPA 5MLCV 2FHMA 1EHWA 4G3IA 3PXGa 2RS2A 1VK3A 2YKNA 4YR3A 3OJUA 3CJKB 3PFEA 4NLDA 3TZYA 5T14A 2AYBA 1J5OA 5EHHA 3HXMA 3UN2A 1PYSB 4LR7A 5C2GA 2FJBB 3QAEA 4O3NA 1ZYQA 2XCPA 2RILA 2FD2A 3TZXA 4F4XA 1BY9A 1SQEA 1NCLA 1B64A 3IG1A 1U2FA 2CQDA 2GVZA 3CDEA 3ETMA 3DOLB 4JI2F 2CPDA 1R8AA 4DL6A 3V2UC 2DO4A 1OIAA 3FCWA 1C1CA 1RTJA 1HQUB 1JK9B 2OLWA 1SBRA 4K0KF 3N5BA 5D3GB 5FDLB 5EDWA 3PEHA 3DGPA 3RJMB 3S1TA 1IKWA 2JRSA 2J9EA 1ZA1B 3DRSA 2Q3PA 5U47A 4WFXA 3TAQA 2PFDA 2DNLA 3N79A 3WHIA 1XR7A 5C42B 2FC9A 1B7FA 2R9LA 2XS7A 1XBWA 3CT9A 2FUG9 3DLKA 4A48A 1NDKA 7FDRA 4C3MA 4UQTA 2VBWA 4W4MA 1X9MA 2VPXB 4MIBA 2GC8A 2JLEA 4C8LA 2C22A 1UCNA 3ELHA 3JQJA 3SQGB 2KXNB 1M1HA 2LEPA 3MEGB 3GSIA 2C3PA 1S49A 2KVIA 3BQ2A 1NZ8A 1VJWA 3KLEA 1U0SA 1U1RA 2G2ZA 2GVDA 2J9DE 2HBZB 2OP5A 4DCPB 3K17A 3Q24A 4Z2XA 2MQ8A 3LQVA 3NKYA 3Q8YA 4ZIWA 3JYTA 1CPZA 4DL0C 1FKOB 3T1YF 5E0OA 2DR8A 3BGRA 4U8VA 1DQ9A 4OYMA 4W98A 4DPXA 2ASDA 3T19A 2CJBA 2R8HA 3GJQB 2E1PA 3N4WA 3MM7A 3KK2A 4OV1A 2L41A 2AJ4A 3DRRA 3NEKA 3KNAA 1LFPA 3HP6A 1TUWA 2JVRA 4X2BA 1P1TA 2ZDPA 3TZWA 2N3LA 5DDQC 5CCMA 2XSFA 4AXJA 4ALZA 4RW9B 1VRTB 2O01C 2KXFA 1FXDA 1NK5A 4R8UA 2OUGA 1NU4A 4YDXA 1K1QA 4ZVEA 4C2MA 4NMLA 2CADA 3PX6A 1Q1KA 1T95A 2AQ4A 1YI2S 1C0UA 4X4VA 5L1IA 3IS9B 3OW2R 1LWCB 1RAJA 4LF7J 4NLQA 4M94A 2WVCA 4EK2A 3CPWR 2UUAF 5LOQA 3MECA 2ZKTA 4M5LA 2BX6A 3US5A 4BWMA 5A6PA 4DSKA 1X5OA 3TJAA 3G6XA 2P9CA 4KYZA 2MKYA 2JX2A 5F3TA 1S9EB 3MF5A 2FJXA 3HFVA 2LMIA 5A8RA 5G4DA 3ZFVA 3HFZB 2OGUA 4QZVB 2G4BA 3GILA 2YNIB 1U49A 1NJWA 4ZPAA 4J7CA 4DR3J 4JUZA 3MZIA 3ZZZA 3OVBA 2EBEA 1ZA2B 5GADU 3X1LB 2B5JB 2CYYA 1GMVA 4M5GA 1U47A 1VQYA 5A8WA 3FFIB 5K8OA 5GAEU 2Y1LB 4OZ1A 5ETRA 1WDTA 4DFMA 3AQOA 3MPWA 3WQPA 5ETMA 1NK4A 6AT1B 3I0RB 3H25A 5D77A 4KY3A 2HS0A 1TL3A 4C3LA 3QAUA 4YHHJ 1I94J 3QO9A 1QUPA 2HQGA 4KFBB 2BEFA 3NCPA 1FJCA 3FQKA 4X84A 4JP8A 1JLQA 3K8WA 1TKXB 2ZJQQ 3BKUA 4USHA 4WZMA 2RDJA 1JWWA 1VQSA 4NXNJ 2HNZB 5KTQA 2OPQA 2BJ1A 3MCNA 4EZ6A 3MFHA 4N41A 4E8UA 5KFVA 2FVQA 3DLGA 1N34J 2KXHA 1WC4A 4AFFA 1BC6A 1LW2B 3O1LA 4LR9A 3QWPA 5IT0A 4WFZA 3HSJA 4ZLPA 2CZ4A 3RB6A 3TOQA 2Y9HA 2DISA 3ILJA 3OTOJ 5HQ8A 1YTYA 1D9AA 2AD9A 1FE0A 3GWCA 3M32A 4KO0A 2KHCA 2VU5A 4CO5A 2GJFA 5B0AA 5E7OB 5D4PA 1TMJA 1QSYA 3KOAA 2EVZA 1SKUB 1JLBB 4UY85 4NCGA 2HBYB 1NRKA 1RGVA 1R8CA 4NCAA 1PILA 2FLLA 4ZCMA 5H9FK 2NPIA 4P2SA 5I3QA 4KHMA 2DHHA 3GTYX 1IBLF 3EPIA 4ED3A 3C16A 3UR0A 1KTQA 4A8MP 3R7SB 4HEA9 4J9UE 2YKOA 4OYPA 3MR2A 2YY3A 1YJNS 3SXLA 5FIIA 4YP3A 4D3HA 4RL1A 3BZQA 2JEJA 3H98A 2CWXA 2PGCA 4F50A 3UE2A 3RRHA 4Q2MA 2C3UA 3CO0P 3IBCB 1JJCB 3W9IA 2HW3A 4LF6F 2Q79A 1WDDA 3HHKA 4HI2A 1UVKA 1MW7A 2KI2A 4J9QA 5D6GA 3NS6A 4GKKF 2F4VJ 4OJHA 4CZCA 4X4SA 1NK7A 3BYRA 3I96A 4HYKA 1NNDA 3HHDA 5D4NA 2IRUA 2K7JA 2HQIA 3M2RA 1F1BB 1T9VA 5AE2A 3SFUA 1WKLA 2WZ1A 3JS9A 4K50A 4ED2A 2R8GA 3G86A 3OD2A 5J1PA 1T3OA 1C4CA 3EZ5A 1F0XA 1TL4A 2QFIA 2H1YA 3VV2B 2RU3A 3D66A 2K1RB 1HQ2A 3T3FA 3PJWA 4CLPA 1WJ9A 2HWTA 1TKZB 4JI7J 3Q86A 1BXNA 2KT5A 2QZ8A 3AD8C 3NY0A 1FERA 3LA0A 1QE1A 1XR5A 4DR1F 4J9PA 4KB7A 3K2YA 2VPYB 4C3KA 2B9EA 1UETA 1RT6A 4X4RA 4CDIA 2HNYA 5CYJA 1Q86T 1WD6A 1F3VA 1NUEA 3BO4A 4O3SA 3SBMA 5J2PB 4DR4F 4JYAJ 5B0GA 1VJQA 5HMXA 1Y3KA 3OR1B 2QX0A 2GJ2A 4MK8A 1FRIA 3TP2A 2CQPA 4ED4A 2COLA 2Y1IA 1TMMA 1N36F 1WI6A 1X5PA 2CRLA 2DGSA 4CLKA 1YBUA 1GH8A 2OKQA 1NK9A 3I9V9 3B8HA 3PYFA 3CJKA 2CQ2A 1EAYC 3Q89A 1GMWA 4USKA 4C0BA 3EXCX 4F4YA 1S72S 1CJTB 2RHSB 4QYRA 2CUYA 2VC1A 2I2YA 2HFVA 5C7PA 1SL0A 1KLMB 1XEZA 4MFBB 1DQAA 1S9GB 2ZUAA 2CZ9A 4USVA 3DOLA 1KWMA 5LXYA 3PKYA 4LFCF 1KN6A 3LANA 4URGA 4B3OB 3ZC4A 3QJJA 4WP3A 2ZZMA 5HBMB 3FJ2A 4USJC 1KDNA 1LOUA 2HLUA 3AD9C 5D3GA 1XNRJ 5FDLA 1N56A 3EGZA 4I2PB 3FC9A 1VQ7S 1JNZB 4LMZA 3I4HX 1B70B 3WC0A 5IXUA 2YX7A 4TU8A 2D3O1 4MYUA 5HMWA 3O2IA 2YQ1A 3HVTB 4KGKA 3R7NB 1R31A 1SJ1A 5H9FJ 2WOMB 3G2XA 4ID5B 4ID8A 2LEAA 5C42A 1HD1A 1AB8A 1Y4ZB 2ZBPA 2W2QP 2DHAA 2JLFA 1U48A 5FLXU 4OZ2A 3N28A 1S57A 3FSYA 2VICA 3K5OA 3T6BA 1JX4A 3MUVP 3RGIA 4OL8A 2M9KA 4EBDA 1G2EA 2KDOA 1WC6A 3LWMA 1FVSA 1TUGB 4JI5J 3W7BA 2IRXA 2BUNA 3SQGA 2DGQA 5KFKA 3MEGA 2XYHB 2PN6A 3D6FB 4DN0A 1YBTA 2B4PA 3D54A 4WP8A 1B4SA 2P2CB 1Q16B 4B3TF 2DHSA 3F44A 2FLNA 4L73A 4CNYA 4M5KA 2CPHA 4M5MA 3CNQP 2W2OP 4UW2A 3W2WB 2XS2A 3ADAC 2PI4A 1S77D 5K9FA 1R8PA 1FKOA 5KFEA 1VQ6S 4I1TA 1GK8A 4YY3F 5A2QU 2WONB 1RAEB 5F3ZA 4Y2MA 1VQLS 1O51A 2D74B 3RR8A 4DPOA 3E3XA 1FD8A 1HI1A 4J91A 3QYYA 1FESA 3PHTA 5DGAA 3W9HA 1IKYB 1U1KA 3T41A 2V9WA 3NNHA 2KO1A 2MZSA 2ZNYA 2ZOFA 4ZVGA 4HKQA 4RW9A 5M2RA 1EKRA 2VKRA 1VRTA 3ETOA 1OYEA 1T94A 2P6TA 1CS4B 4Y0FA 2F8MA 1V5VA 1F9HA 4DCJB 4BDPA 4YUDA 1Q81T 3D6HB 2EFVA 3IS9A 1XTZA 3R2DJ 2VG7B 4NI2B 3I6PA 1NZAA 4TQSA 4AT1B 5BJRA 1YJTA 1LWCA 5F8HA 3CCSS 2AX1A 3O5TB 4Q44A 4X64F 3P5TL 3PW5A 2QFJA 2DPIA 2DEJA 2VPZB 5KT3A 4ZVPB 4ANCA 3VZHA 3UDLA 1FHTA 2D1CA 5EWEA 2H4WB 2JSXA 3CULA 4N8OA 4ICLA 4C8NA 1IR0A 1S9EA 2CIMA 3THTA 5GAGU 4HTIA 1R89A 2DR9A 2GV1A 3DU6A 2V34A 1QSLA 5D15A 3SDEB 2YNIA 4OZ0A 3W64A 3GZ7A 4JV1A 1LWEB 4USWA 2VG6B 4BWJA 2MQPA 4ZP9A 3KLFB 2B5JA 1G3OA 4J90A 2BE9B 3CVKA 4EYHB 3FFIA 2HHHF 4B9SA 4DR5J 2V8HA 4OYZA 2BJDA 2BACA 5K20B 2ZVIA 3I0RA 2QSFA 2XY7A 4B9TA 4P71A 4IRCA 2PE8A 2M8HA 5ETTA 2E5GA 3UDEA 1U1MA 3QGPA 2ZUGA 4KFBA 3WZ0A 1DAXA 3RBEA 2UXCJ 5KAKA 1TKXA 4TYBA 3FMBA 1PBUA 4L6V3 3PR4A 1DLOB 2C2RA 3GP9A 1FKAF 2C42A 2GMHA 4FF3A 3GJSB 2HNZA 2VA2A 3N5FA 2LFVA 4NWBA 3FDSA 2KB2A 3BJYA 3MPYA 3V81B 4ZP8A 2FIUA 4O3RA 3DOKB 4FXVA 4GO7X 5LSOA 1LW2A 4M8LA 2CDQA 1O5JA 1L3TA 5HJXA 3UNYA 1UW9A 4DR6J 3S8SA 2QIFA 4QIWD 2MXYA 3K5MA 4OX6A 2JEIA 2E1CA 3M4XA 4DS5A 2K3KA 1NH7A 4CM0A 3LOUA 1JLBA 1KHVA 2LVWA 4OYXA 3EVWA 1X31C 2G2YA 3UQSA 5HK4A 4YB1P 2HYIB 1R8BA 1OSDA 4L74A 2LECA 5H9EJ 1X4CA 1KNZA 4RUAA 2GQCA 1F9FA 1SJ3P 3M05A 3CJTA 4WZQA 1X4HA 4JI0J 1JKHB 5H1SV 2FY1A 3J81j 1UFWA 1S9FA 1MWYA 4Z7CA 4KGMA 1TK8A 3ISND 2E29A 3UN3A 1TZ0A 2CJAA 3KLHB 2MKHA 2VG5B 5CAAA 1AW0A 2E7XA 1Y5NB 2PMWA 1UVNA 3CEDA 1OWXA 1U6FA 2KVQE 3O8WA 2DNZA 3OHBA 2ADCA 1HKAA 1Y11A 3KNGA 3Q2TC 5D4OA 4OI1A 3RZAA 3A4TA 1HBOA 5KFNA 2XBPA 3PACA 2CWKA 4X4UA 2GS8A 3TEHB 3OL9A 2JVOA 5EUHA 4ETZA 2NUUG 2R7QA 4NEYA 2RU9A 4MH8A 2BQ3A 3LTOA 2HAFA 1NJYA 2ZH3A 5FJ4A 1B0PA 2K1RA 3RB0A 2KFNA 1TKZA 2WBRA 3FGVA 5A8KB 1JIHA 3HHLB 2VQFJ 4CLTA 3C3LA 2ZZNA 5E33A 4F04B 2AYEA 2BOAA 1U45A 1EX8A 1N52B 4FPIA 3HD2A 3T1HJ 3CDAA 2RQ4A 3VZIA 4RZRA 4W90B 1WHWA 4N76A 5J2PA 1VQ5S 5LMNF 2HPUA 4FS2A 3O6QA 3OR1A 4JI4J 1JJ2R 4FS1A 3GCWP 4MIWA 5DQGA 5MAOA 3DYAB 2SXLA 2BE2B 2PMHA 2ASYA 4NLOA 1SC3B 1WHXA 4LRDA 3HK2A 3TVKA 5SZTA 3TAMB 2KFZA 3ZZOA 4A8KA 4DV5F 4C7QA 1YLXA 4YQWA 2EKYA 4IR9A 2ASLA 3FCVA 2H5IB 2HS4A 3LP2B 2ZBQA 2Y1JA 4XAKA 3VCDA 4DJBA 4ECZA 1OPZA 5AXKA 4DR7J 4DU8A 1CJTA 3D3BJ 1MMDA 2DK2A 4P72A 2AIRB 1EQMA 2BM1A 4ZVFA 3W5YA 5DDRC 1VQ4S 3BH7B 4PUOB 1QJHA 4PYDA 1S4FA 4BBYA 4JI6F 1FNMA 4MFBA 3J81Y 1YZ7A 1ZPWX 1U2RA 2KYZA 2MYFA 3D5MA 3EXYA 4KHPJ 1NJXA 4Q0BB 2XMMA 3OFFA 4ZVUB 3EVOA 3I9ZA 2MZRA 2E5IA 3MMAB 4B3OA 2AHOB 1HQEB 3BEGB 5HBMA 3JTNA 4YB7A 5HVFA 4C8MA 2BYCA 3IFEA 1VC6A 4K4ZA 4ANDA 3IM9A 4I2PA 2R7RA 2JC1A 2XWXA 3JSRA 4IR1A 2HFSA 2E66A 5LMUJ 5DGBA 3DLBA 2MQQA 3BN4A 4C11B 1PGZA 1SH3A 2E1RA 3HVTA 3BKTA 2WOMA 3M30B 5KG6A 4ID5A 4ILLA 3FMWA 3V4MA 5KT2A 2OMOA 1XMQF 2V2QA 5KFZA 5DM7Q 4DPWA 2KT3A 5KT6A 1K47A 4ZVHA 4ZDNA 3KG1A 5F8IA 1TFYA 2GZOA 5AJ3J 1GX6A 4F2SA 1HNWF 1HD0A 4C8YA 4EZ9A 4CO1A 4RKUC 5B09A 4QWAA 5J2MB 3DMJB 2NSCA 4C8ZA 2DPJA 2AW0A 1S6UA 4C0HA 4HHUA 3CD7A 3SFGA 2G0CA 4LF9F 1SKSA 3W2WA 1WF1A 2AV5A 4FVMA 3E51A 2Z8QA 2PEHA 5T41A 3JSBA 5KFLA 1IBKF 2WONA 4FBUA 2LDYA 1K8AT 2E9TA 3R5AA 1S6OA 2KT2A 3QJPA 2IHR1 2B43A 2NXUA 3VAHA 4LFBJ 1T9WA 4PQUB 2MQNA 3GB0A 5BR8J 3LGMA 3BN7A 1BQNB 4ED0A 4WU2A 1IUJA 2QEXS 4NRUA 2NUHA 4BCAA 4GKJF 2EK6A 2ZC3A 3MR7A 3BSOA 1J27A 1CS4A 3V6JA 1F3FA 2R2SA 2WSEC 4PPDA 2K7KA 3TANA 2YQ3A 3AFGA 1IM6A 2V9KA 3ULHA 2VG7A 4NI2A 2DB1A 2J6SA 1HARA 2XMAA 1RWVB 5CZVA 5CXTA 4KV8B 4LVNP 1UVJA 3P96A 3QIPB 1QVGR 2MKIA 1HWIA 2JDJA 3EGVA 4IG0B 4B3SF 1VBKA 3V6DB 4IRDA 2EG2A 4RW4B 1KP6A 1R0AB 3CCQS 4X4PA 1R43A 1Z2ZA 5K8MA 2QL5B 1WEZA 1ZM9A 5B0CA 2F63A 4UOHA 4LF8J 3ZTSA 5DDPC 1RHJB 4CLYA 1VQOS 4JV5J 3TARA 1L3UA 4AE5A 2UUBJ 1WOSA 4OI3A 2CVIA 3SDEA 3VGTA 1VYAA 3BPDA 4OIXA 2M3DA 4DSLA 3X3UA 1LWEA 1MROB 2VG6A 5M2UA 3CCRS 2VF3A 4YMEA 3RUBL 4C4WA 3GSDA 3CJSA 3KLFA 4AUKA 1T9TA 2AEFA 1B0TA 2H9ZA 4CO4A 4X4QA 4OZNA 4DV4J 3N9UC 1W25A 2DY9A 2MY7A 4DL3A 2CAJA 3SSQA 4DMZA 2BQUA 1X9SA 5IC6B 2ZHOA 2QLFB 2WHOA 4PG8A 3GFXA 2R7OA 3GCXP 3B6BA 4ZVTB 3OBIA 4WPAA 4PG6A 4PQAA 2V50A 4LREA 1S4EA 4LFAF 3A13A 3NL0A 2RQKA 1NMEB 2AJFE 1TFWA 5I42B 1DLOA 2PSZA 2YWHA 2KJVA 4M5HA 5HN0A 5DJBA 4DUTA 1CJKB 3FSIA 3C15B 4WXOA 1X4GA 4F7VA 2DO0A 3KJNB 3KUGA 3V81A 3LUYA 2GIQA 4O3PA 3TZZA 2FY8A 1RJJA 3DOKA 5DG7A 2IPOB 5C24B 2W4PA 2BJ8A 4TU7A 2IVFB 1GT8A 1EARA 4P10A 1TV6B 2YKMB 2MDAA 4RR5A 3KK1B 2BABA 1NAQA 2BW7A 3IP0A 3UCGA 3FCHA 2HIQA 1UPPA 1HWLA 2E9RX 3Q8SB 4OZ3A 1Y5LB 3EDRB 2ZHAA 3KLGB 1LNQA 1TK5A 3CJQA 3Q8VA 2XI3A 2W8KA 4RWWA 4F67A 1R8HA 1SKRA 4X66J 3V4IB 2JZ5A 1ULRA 1M1KT 3MEKA 4A8FA 1Q82T 1SJQA 2A18A 3BDPA 4CNZA 3I87A 4IOBA 1PG5B 2K8GA 4P2XA 1N5VA 5GAHI 3PVXA 3IWNC 1S1VB 1G4CA 3NGDA 1JKHA 3A8KA 1JXEA 1TKTB 4ZPWR 1AA1B 3JTPA 2A3JA 3H5UA 4C6AA 1ZM2A 4I67A 1OY6A 3MAHA 3IGNA 2WK4A 3QFHA 3KLHA 4K59A 3VQTA 4J9RA 2VG5A 2U2FA 4KTQA 2FYXA 1TAUA 5DETA 4WBFA 1BWVA 4P7VA 3KG0A 5KFBA 3SYZA 1S1UB 1XC9A 3J81U 4OYAA 1UKUA 4PWWA 1VBXA 3BKFA 4UF4A 4K4TA 4F4AA 3AA9A 4LBHA 2QV6A 1GQEA 4WK1A 1XMBA 3OTEA 1VIOA 1CC7A 3JTOA 4DOZA 2NSBA 2EEYA 3P8BB 4ZP7A 2LA4A 1Q8IA 4CIOA 3G8TA 3GYNA 4KJIA 2C2OB 4X65J 1S1TB 3ZZRA 2WB1D 3ENQA 5A8KA 3HHLA 2ZC4A 3L09A 4XPCA 1W7WA 3TI0A 1LWXA 2M4MA 4WE1A 1RTZA 4XDDA 4KPYA 3J7A1 4DSEA 3D1QA 1B0VA 1RT5B 2W7PA 2HVHA 2GAGC 2YXLA 2HAIA 4OHXA 4RNMA 3IBWA 1D3WA 2B3TB 1U02A 4TN2A 4LIRA 3EGWB 3DYAA 1G7CB 4ZOSA 1U6ZA 4LF7F 2BE2A 4PEOA 1UMJA 2ZOGA 1DTTB 3CIZA 3TAMA 2X1AA 2QE5A 5CHCB 1HIYA 1M5VC 2FVPA 1BD6A 1DHMA 1A7GE 1RYSA 2P6SA 1VC0A 3LP2A 1XQIA 4DQQA 2VBXA 4ES3A 1VOMA 5BYRA 2ZH4A 2H48B 5HI7A 2B8QA 5E2QA 4K2JA 4B3MJ 2PMZD 1WEYA 1GTHA 1N5TA 4QR1A 1SJFA 3ONQA 1O6XA 4P2MA 2BV3A 1R6YA 4DR3F 1OS5A 4PUOA 2E44A 3FNNA 5HATA 4L3KA 1TUVA 1QAJA 1WC0A 3L9ZA 3OXFA 2E5LJ 1AZSB 2OPSB 4UOFA 1XERA 4NL5A 3D1OA 1RT7B 1IWGA 3KJVB 3CCVS 1MN7A 3N01A 2C3OA 2MB0B 3MMAA 1T3NA 1HQEA 3L3CA 2FVSA 1BLUA 2CPZA 2OD4A 3BQ0A 1NM2A 1U7LA 3UVJB 2ROPA 1DJ0A 3L95X 2IM1A 2EBGA 1EETB 2W2MP 4A4JA 4YHHF 4J9NA 4WU3A 4ILRA 2W9CB 1I94F 2Y0SD 4C11A 3OLBA 3T5HA 4FF2A 3QGIA 1IVZA 3M30A 2XHWA 3IN5A 4M5NA 2R8KA 3IA0A 1H2VZ 1H73A 2FJAB 2UUTA 2YNHB 3G4SS 4NXNF 4TXSA 2OFHX 3DFEA 3I31A 2R7VA 3MXHP 3VGVA 2CPEA 4R0EA 2IJFA 3CDBA 3FK4A 1YIJS 1N34F 5KFPA 1U0HB 3K8VA 1NPKA 2XSJB 4AL7A 2B7BB 3VVUA 1UVIA 2P9GA 1SB6A 3N6NA 4PG5A 1YJ9S 3LP1B 4MTPA 5J2MA 3DMJA 1AXQA 2O67A 4OYWA 5KT5A 3OTOF 3HDSA 1NKEA 3CGIA 1JLFB 3I5AA 2UV8G 2JH3A 1F9EB 2XULA 4IH6A 2PO4A 2ZKUA 1VHIA 3QRRA 2V4QA 1M0SA 5B08A 3VAMA 3F41A 5M2PA 3K58A 3QRPA 2YWWA 1ZOTA 3ET6B 1QAYA 5CQGA 5GAHU 4PQUA 3R5GA 4CO0A 5JUMA 2GO9A 2F5GA 1IXKA 1BQNA 1GXTA 4OHWA 4C48A 1YJRA 2QJ3A 3PNIA 2CJXB 4E2FB 1H0HB 2IA6A 1NSQA 3AOBA 2VZ9A 3IRXB 3KMSA 3SIPB 5DLFA 3NMRA 2PA3A 3LW5C 2CQ3A 2MZJA 4K5SA 3K5PA 1ZAWA 2F4VF 2RDDA 4KV8A 1TL5A 2DXFA 1ZTTA 3QIPA 3H5XA 1VS3A 5HMZA 4HH1A 2D9OA 4IG0A 1D9FA 1RI7A 3V6DA 3PYGA 2YKQA 2MTLA 4RW4A 1R0AA 1PJ5A 1T05B 2XMKA 3D6TB 5KG3A 3GLJA 4QIFA 3H0PA 4CQ1A 4I6WA 2W4CA 2DHGA 4Y2CA 3C19A 5F8GA 4BS2A 3H2UB 2ZH9A 5B0EA 3KHHA 2FHOB 4JI7F 1NHKL 1MROA 2RS8A 4UZCA 2IFXA 1S0OA 4RBUA 2CJYB 4NLSA 1NH8A 3EPGA 4F3QA 1V3RA 1KD1T 2FZCB 1TVRB 3NGRA 1X0PA 5KFUA 5A76A 2BZ2A 4LIWA 5IWAJ 4B17A 2RSQA 4EBCA 4JYAF 1WC5A 1X7VA 2LDIA 3NGSA 2ALYB 4I6YA 2L9NA 1FFGB 4Q45A 4XK8C 2MZQA 4QCLA 4ZMMA 1SH2A 4FZVA 2OD6A 2F7VA 3KMQA 4RBTA 5KT4A 5I42A 3BO3A 2I9SA 1ROFA 3T6JA 2EFPA 2QRRA 3R1HA 1RHKB 2XYGB 2QT7A 4P6QA 1CJKA 3C15A 2F1FA 1HHQA 4ER8A 2X1FA 4XDCA 5T7LB 2J8SA 3S01A 2A6MA 2HBQB 1H72C 3GPAA 3MDFA 3DDKA 1REVB 3PIOQ 3MURP 1QTNB 5C24A 2POKA 3KHRA 3HHLD 3TR5A 2M5YA 2HQFA 3BPSP 1TV6A 2YKMA 4HVZA 1CG2A 3KK1A 4DV1J 3H5SA 1U26A 3HPOA 3CJ3A 2P9EA 2O3DA 4KR0B 5EN1A 3S6EA 3M8RA 2AKWB 4NLUA 1TP7A 1UVLA 2IBKA 2NCKL 4RJVA 1IQZA 4CCHA 2RUSA 3KLGA 4Q8FA 4DFKA 4Q7AA 1XNRF 2W7AA 2WAQD 3T5JA 2DNHA 4B9LA 4KH1B 2MMYA 3HD1A 3V4IA 2O5DA 3IWLA 2UVUA 1K9MT 2J6UA 5HP1B 1ZAVA 3SCJE 2XMVA 3DXSX 2UXDJ 1VK8A 4I68A 2AJQA 1S1VA 2HZAA 5JVHQ 3ITHB 1TKTA 3POTB 4O0NA 5ETSA 3VGUA 1BHNA 3DRYA 4U7UK 4KGXB 3B78A 3ENAA 3CDUA 1B7YB 5EWFA 5F41A 4JI5F 1BUXA 2N7CA 2ZFHA 3GU0A 3HVAA 4L76A 3BBBA 2Z2LA 4PRFA 4K2XA 1YRTA 3QT8A 3HI9A 3MEEB 1S1UA 1HPZA 3NGUA 1UJ4A 2I38A 1JLAB 2BXJA 4RUCA 2MLXA 2HHWA 2MLYA 4NYZA 4K4YA 1Z4UA 4F4ZA 1NKBA 1KQFB 4V1Ak 2RKIB 3MEDB 4NRTA 1Q0NA 3OFEA 4DWIA 4ECXA 1S79A 2EKNA 2H51B 4NOHA 4ZN1A 4W92B 4PPZA 1S1TA 1EJ7L 4RW7B 3BREA 1TELA 3EJMA 3MM9B 4DXLA 1IJEB 4CRJA 3MFIA 5KOWA 1YX2A 1GAOA 1NHVA 3LH2S 4EBEA 4DCOB 2DNOA 2MGZB 3W8GA 3AQPA 1RT5A 1ACMB 3G6ES 3CJ4A 3A12A 3RBXA 1Q7YT 5KG1A 2HWHA 3M1VB 5GADI 2KZMA 2O66A 4WKRA 4G1IA 1VQ9S 1P27B 1KFDA 2QA4S 4IG3B 3W9JA 3NRBA 4F0MA 5GAEI 2B8PA 4C8OA 1T02A 2ZM6F 4LRBA 4B9NA 4JB8B 2W24A 3M8WA 2YH0A 2OJ3A 4MK7A 4LQ9A 3CJ0A 5IQ6A 1DTTA 3CCUS 1T0TV 4OZJA 1QDUB 3D67A 2FHJD 1RWMB 5IT9Y 4ZVSB 3KXDA 2B9YA 5E3RA 1HMVB 4ZLJA 3IC1A 3R1LA 2QYGA 3JSMB 1ZZNA 5DZ7A 8RUCA 2CNLB 5AXNA 4ZVOB 2R2UA 2JEFA 2I8EA 2X1BA 3HSZA 1U1OA 3QBCA 1UVMA 2J9DA 3FQLA 1UFLA 3KLIB 3SV3A 1AZSA 2OPSA 2NPFA 1NDPA 4DPYA 1RT7A 3KJVA 2LQJA 4I2QB 3Q23A 2FZKB 1D0EA 2CQCA 2J0QD 1Y5IB 2QG9B 4DR5F 1JQGA 5KFDA 2F8EX 3IAM9 2CXEA 5KFXA 4QIVA 1KBRA 2C2NA 3UVJA 1E6VB 1EETA 1UPMB 3W3SA 2W9CA 2IMOA 2GMJA 4IH5A 4FYXB 1N4LA 2ZWOA 1PSDA 3Q83A 4ZPVR 4KGVB 3P6YC 3HVRA 4LRCA 2APOA 1PBAA 2UXCF 1YK9A 5L1KA 5ETOA 4XPEA 4FKYA 3OHAA 2YNHA 3U02A 7AT1B 4UOGA 4A46A 3F56A 2F9JA 4IKAA 1AT1B 5GMEA 2C2MB 5LSLA 3NNAA 1KR4A 2L3MA 1N6QB 1KVKA 1N0UA 2ZBRA 1S1WB 1RTHB 1U0HA 2XSJA 1RHRB 2IDLA 4JV2A 2E7VA 3LP1A 1L5UA 1REGX 5L38A 2D9PA 4DR6F 1SIWB 3JSYA 4KHRA 3NLCA 1JLFA 1EP4B 1WF0A 4R0JA 3KWMA 3UDVA 2W2PP 2MZTA 3HHNB 5DLGA 2ZITA 3BGUA 4ELUA 4M5IA 2FJEB 3HKWA 3RTVA 4O4RA 1FKPB 2XGQA 3HSGA 1L3SA 3KK3B 1KQSR 2DD8S 2VQEJ 1KEKA 2KL8A 3ET6A 4ZCKA 3T9NA 3GG0A 4P73A 5KFOA 4ZLLA 2H65B 5ADZA 1FCAA 1VRQC 1RKJA 2ZVSA 1ITPA 2H5JB 2RRNA 1YGYA 2IC3B 4JI0F 5KG7A 3EMTA 3IRXA 3FBCA 3CD0A 3P4UB 1YKWA 4LF4J 4LF2A 1M90T 2H3EB 4MJKA 2G1HA 4URQU 1RT1B 4LSLB 3D6MB 4DQPA 4UOCA 2E5JA 2F4FA 4IO9Q 4ECWA 2RRAA 1HNZJ 1KQKA 4YR0A 3K5NA 3OR2B 4F26A 4R5PB 1DZ5A 2AJ0A 1FE4A 1T05A 1TKDA 1QUVA 3ZZYA 3EE3A 1UWAA 2IAJA 2BQRA 3RYLA 3NNCA 1T8EA 1CC8A 4GVBB 2KYXA 2LXFA 5AT1B 3R5DA 3U1MA 3ZTRA 2XB2D 3AJ1A 3NWRA 2V4RA 1RHMB 4ED6A 1B3TA 2AP6A 4OFZA 5E3PA 5ITHA 1YVFA 3NOCA 4I64A 4QU7A 2CPFA 2RQCA 4NLPA 2VQFF 1DURA 2HWIA 5CD4A 1HA1A 2B4VA 4FYYB 5E3CA 1BGXT 1KTVA 1I1GA 3VAFA 4OYIA 3AJ2A 1FNOA 2WCXA 3T1HF 5EGYA 2DIVA 1TVRA 3MPUB 4EMDA 1Y10A 2I1RA 2BRLA 2LCWA 1V6HA 4F02A 2F8HA 1BQMB 4MKVA 4KPCA 1SJRA 2V8VA 3UCZP 3SEOA 1DARA 2RE1A 1YRUA 4JI4F 5LL6d 1OMSA 4KAIA 2DH9A 4Y28C 4O3OA 3TA1A 1AROP 4M63A 3Q8UA 1XMOJ 1V9OA 2MHNA 1D1UA 5KFYA 3D9BA 1SI9A 2VKZG 4AYBD 1RLDA 2C2EA 2DNYA 2NXNA 1S0NA 4Y3CA 5T7LA 2HMIB 3THPA 2YQ0A 4DR7F 5C5JA 1FT8A 3HCXA 1SUQB 4OJ1A 1S76D 2XGPA 4ZCLA 1CQNA 1QD1A 1REVA 1YJVA 1AFIA 4LR8A 2HRUA 4WFNQ 5F0UA 3J7YU 3RW6A 4TLRA 1YJWS 2CG4A 4H4KA 1Q8LA 5C2CA 4KHPF 4Z7YA 3OTBA 3DOMB 4J5OA 2C3MA 3D28A 1IJFB 1PKUA 3A3PB 3P49B 2MKJA 3EVMA 2GVZB 2L9WA 1VCTA 5CZXA 4P2FA 3JQKA 1SQFA 2GX8A 4M5DB 1OYDA 1RT3B 2D3OR 2ZBIA 3OT9A 3G71S 5LMUF 1HR0J 3W63A 1T11A 3JAMU 5HP1A 1LEOA 2RUGA 5KFMA 1W2IA 5SUHA 2C3YA 2FQQB 1D8ZA 3HM9A 3CCLS 5F8LA 1RWKB 3ITHA 2BKOA 2HZVA 2GIRA 4TLQA 4RBVA 4NA3A 5BXIA 2U1AA 1LKZA 2QA1A 3R3TA 2JWNA 1H38A 1FX4A 3BYPA 2DJWA 3PJ9A 2FB0A 3GJTB 2DXDA 1M5OC 5AJ3F 1LXNA 3Q22A 4H4KC 1F2HA 3DHWC 3MEEA 4USIA 2ROEA 1K0TA 9ATCB 1TR0A 1VLOA 3A8EA 1RISA 2QLWA 3O44A 1JLAA 2VV5A 4QW8A 4DX8H 1LK7A 1YRXA 3NCRA 3PDNA 2RKIA 3MEDA 3R5BA 2DRAA 3PIPQ 2CJKA 2JC0A 2IA0A 5KFTA 1HNXJ 4I0WA 2YNFB 4LFBF 2N82B 4USMA 2ZH1A 1QTMA 4QYZK 4LQ3A 5BR8F 4RW7A 4F25A 2YKPA 3MM9A 5GAGI 3CJ8A 1UEVA 4B02A 1O8BA 3OUYB 1F6TA 5THWA 4PXCA 1VQKS 2B9WA 2MGZA 2CQ1A 2CPIA 2DRDA 3CF5Q 4K4XA 3MMCB 4NE9C 4KE5A 3M1VA 2RIJA 5HLFB 2CKWA 4DQSA 2KTQA 2X7IA 3WIUA 2YWFA 3GIJA 4IG3A 3DM2B 1ZTWA 1RXOB 2OAUA 5DQIA 2OEKA 4Y65A 3WDOA 2VDIA 5L1LA 2DNNA 4KSEB 3R6LB 1FXRA 3HO1A 2C2KB 2MSSA 1FJGJ 1YJUA 2FJDB 4HACB 2B9XA 2Z0GA 4X4NA 2DNKA 4WWSA 4HDGA 5HANA 4LF8F 1N54B 3AJDA 1HMVA 5EWGA 5CYMB 5E5NA 4A8QA 4YB5A 3JSMA 3HF5A 3OSNA 2IYIA 3OLAA 3OL8A 1FXLA 3QQCD 1S5ZA 2HGLA 4JV5F 2J0WA 1JMTA 3CJ5A 3F0NA 2UUBF 2FDNA 2V67A 1WHYA 3GFYA 3DN9A 1Q7LB 2XY6A 2IM2A 3BB5A 4ZVQB 2XI2A 5JMNA 2M0GB 3KLIA 1F5BA 2M52A 3LF0A 1HYSB 4B3RJ 1MLAA 4DUZJ 3AB4B 1VHFA 2GHPA 1LQ9A 4I2QA 3DC2A 2WW4A 2ADBA 4OLPA 3MD3A 4DV4F 2DKOB 2ZH8A 1Y9OA 1UEUA 2GHWA 1N0VC 4IUFA 4Y2IA 2Z30B 2DGVA 1E6VA 4ELTA 3VAJA 1HQUA 3NOGA 3M9MB 4LRAA 4PXEA 1Z1ZA 1VFJA 3C6TB 1T9UA 2FLOA 3W65A 4FP9A 1X8DA 2AJ2A 1JJHA 3FUYA 2ALZA 4K8RA 1NJZA 2UU9J 3QZ8A 1NPRA 3TVYA 3QO9B 4D3GA 2RHQB 1ZH5A 3RRKA 1HHSA 3D1HA 3VGSA 1C1BB 3JQMA 3OSPA 1GNKA 2DR6A 1N6QA 4DV6J 1S1WA 4QJVA 1RTHA 4TY8B 1N8RT 2A2CA 3ISNC 2LU2A 4DHVA 4IQMA 2W2NP 3CO9A 4OHVA 4HTJA 1S1XB 4F2RA 2K3IA 2BA9A 1EP4A 1QAXA 2WB4A 1OPIA 2XMWA 2OSRA 1FK9B 4OX9J 4DFJA 2MKSA 3D68A 5K5MA 1FKPA 1ZS6A 3KK3A 4NZ0A 3I0SB 1Q78A 1F5AA 2AF6A 4PAAA 4X66F 2DGUA 3EZOA 4RNOA 3P45B 3CCMS 2JLGA 2E5HA 2XWYA 1OY8A 2BKPA 5J2NB 1Q53A 4UQGA 2B56A 5K8NA 3B4DA 3KKFA 3KDOA 4ED5A 4LSNB 2BJ7A 2IC3A 4G1PA 3CJ2A 4IOCQ 4Q5VA 1I3OB 5KG4A 3ILOA 2HVZA 3I32A 1W2BR 3BM7A 4DI6A 2UZAA 5CCLA 1FVQA 4MYTA 1WKKA 1N5SA 1RT1A 1QM9A 4GC7A 4QIGA 3IO1A 3PX0A 4LSLA 3IAS9 1RAIB 1KKHA 3H7HB 1CJUB 2Y0BB 1HW9A 3D2WA 4G1QB 3HX9A 3IM8A 2G9OA 3OR2A 4HR2A 4PWUA 4A47A 2CA9A 4R5PA 2ZM6J 1S0VA 3FEXB 3RU0A 2M8DB 5ETQA 2QN6B 1HWJA 4U95A 3HT3A 4CLSA 1RAAB 4GVBA 3SSSA 3MM5B 2UUCJ 3EICA 2H4YB 2JFKA 3HT0A 3HJVA 1PAUB 1N33J 5RUBA 3W61A 1MN9A 2R2RA 2W9BB 1NDLA 3MTJA 4X65F 5LXRA 3TUZC 4DN9A 4PXDA 3PYEA 4UUXA 1XR6A 1ZM3A 2ACYA 3K5LA 4LVOP 5CABA 5HL7Q 2DVIA 2XEXA 4RNFA 1YHQS 4DQIA 2RT3A 3PRBA 3MR3A 1BQMA 3CJRA 2G1DA 3FZBA 3M2UB 4QPXA 2W25A 1T7PA 2C2DA 1NSPA 2HHPA 2BMBA 1NK8A 2YNGB 2HFNA 1KS2A 2IJNA 4LUBA 3HJFA 2UXBJ 4WXWA 3OVSA 2VH7A 2YWEA 5DG9A 4FXDA 3MI7X 4JI3J 1K44A 1XJWB 4NEZA 2XO7A 3M7VA 2HMIA 4X4OA 2D3ZA 4L72B 2JJ4D 1SUQA 4B3MF 3H42A 2DH7A 5KG5A 1FRKA 1QY7A 4JI1J 1HFEL 2I0XA 2E7WA 2E5LF 3DOMA 2Y1RI 3TJ9A 4X62J 4AL5A 4DV0J 2V5HG 1FEHA 1KC8T 3OXGA 4K4SA 2EC0A 4M5DA 1RT3A 2AYMA 2KN4A 1Q79A 3GE9A 2GO8A 6FDRA 1M1GA 4ELVA 3TQEA 3M9NB 2DNRA 1VBYA 5DZ6A 4WIQA 3MTKA 3BH6B 4ILMA 1NSKL 3R7BB 3T1AA 3CXCR 4ECSA 2OPPB 1NDCA 3TUIC 3Q8RB 1SKWA 1J5EJ 1A9NB 1MMNA 3AY0A 3T5KA 3RW7A 3SCLE 3AAWB 1FRJA 2JHEA 3KJFB 4JBCA 3C6UB 4V19J 3H2LA 1GX5A 1RHUB 2HHXA 3ZZUA 4OMFG 2DIUA 3FBBA 1W26A 1E6YB 4A8WA 1H98A 3CD6S 3P5BP 2XTJP 1U8WA 2DCUB 2ASJA 4MKAA 1IN0A 4KQZA 2AT1B 3EZUA 3UCUP 4ECVA 1N32J 3MOJB 4E98A 2XZDB 3CE8A 4ZP6A 1PIEA 3DHXA 4TVAB 2EC2A 2YNFA 3B82A 3QMQA 2RD5C 5IZHA 1LWFB 3VVTA 2FHKA 4FYVB 1XK8A 4CH1A 2AGPA 4DUYJ 3OTDA 3OUYA 2HHSA 2GQ2A 5B0DA 4MT1A 1H6KX 1KVJA 4I69A 1GXLA 5AE1A 1IKXB 3MMCA 1U1PA 3DGVA 2J8AA 2W7OA 5HLFA 1SC4B 2R8JA 1SC1B 1NHUA 4QWDA 2VFVA 3MUTP 3DM2A 3G6YA 4NXMJ 6FD1A 4UUWA 2RQMA 1NK6A 3LPEA 2RDIA 2R8IA 3ILIA 1X4BA 2BKNA 3MWBA 3RAQA 4HACA 4ECQA 1N48A 4CO2A 2NZ4A 4DV7J 1XNQJ 5CYMA 5JJBA 2XNQA 3PW7A 2V8GA 5FLXY 3UI3A 2HK2A 4ICLB 3RBDA 1WTBA 3C46A 4OQJA 4F8RA 5D0GA 3G9CA 5ETPA 5J2QB 3W60A 1LXJA 4GO5X 3M9OB 4NA1A 3H59A 4PKDB 1HYSA 1KLMA 3K0JA 1HBMB 4KRWA 3IR7B 3DNCA 1RA6A 1S9GA 2BW2A 2NXEA 1NK0A 1FTRA 5IWAF 1UL3A 2GQQA 4XTTA 4ZLNA 4PXBA 5HAOA 4DX6A 3N6MA 4IFYB 5A2QY 3ZTQA 2XO6A 2IVMA 4DPTA 2ZD1B 2IIHA 2XG8A 3C6TA 1H3DA 1H2TZ 1VRUB 3GV7B 1S97A 4QIEA 3C2PA 1X9WA 5DS7A 4FKXA 3H20A 1FO1A 4DQRA 3OFHA 1L3KA 3SMZA 1C1BA 2CFXA 4ETXA 4ENOA 3NMAA 3R8YA 2QLXA 3LP0B 3MGJA 2JOQA 2MKCA 2FVRA 1Y0HA 4EUVA 4C8KA 4TY8A 2AZ3A 4HHHA 2LXUA 3Q8PB 3BDEA 4P9SA 2VBYA 1OQ6A 1S1XA 4FYWB 4DV1F 1O0PA 4U7UD 2C2ZB 3W1YC 2VJUA 2ROGA 1U1QA 2Z2MA 1UJ5A 3GR0A 1IQTA 4EWTA 1UFKA 2M70A 4FPRA 1FK9A 2IYGA 3KHLA 4NYOA 2ZOMA 1U09A 4JOUA 2N3OA 2D3UA 1RWWB 5CD4H 3I0SA 4DLEA 2HNDB 3GIIA 2C1EB 3KJQB 2KRBA 4OX8A 2BRKA 5E3AA 3BSNA 3FEYB 3MPDA 1PJ6A 2BDPA 1SL2A 3IR6B 4AD6A 3UD4P 3MUMP 2UXDF 1RAHB 1S7IA 3G6VA 3Q8QB 1P9QC 5HJYA 1IKYA 5J2NA 4OJGA 2EFOA 3GJRB 2CDRB 1YZ6A 4LSNA 1SPBP 1R0CB 2NR0A 2D41A 1H2UX 3KTQA 4ZJOA 5A6WA 2CVEA 1WOPA 3DKDA 1RAOA 5KFWA 1QAIA 4OHZA 4DS4A 3CCZA 1UEKA 4E0DA 1YITS 3PO5A 1TU0B 1BWEA 3HULA 4K7QA 4H4MB 1FRHA 1PJ7A 2ZBCA 1FDAA 2HVDA 2AX0A 1IBMJ 4XIUA 2XLIA 4O4GB 3PX4A 4RO0A 1RYRA 1CJUA 2ZEJA 3BR9A 3R2CJ 4G1QA 1DTQB 5IV3A 2IM3A 2Y3YA 2DNGA 4J9OA 3PW2A 4JI8J 3NWGA 1X4EA 2F40A 1WI8A 1HBOB 4NASA 4HLBA 3OJSA 4ECRA 3THVA 5D0EA 5D0RA 2Z4PA 3HHEA 4WYLA 3MM5A 4NLVA 3I55S 3CCES 1FDBA 1IR2A 1WACA 3TQ1A 4LBIA 3M6VA 4DF4A 2W9BA 1NPPA 3KYLA 1VMBA 4DPUA 1RWUA 5CYQB 1DFDA 4F3OA 5F8MA 3WC2A 5L8RC 1RWNB 3AOAA 5KFQA 2N4CA 2NREA 3VQSA 3R97A 1MWZA 5KT7A 1RTDB 3PFOA 5I4MA 4LF5J 4NLRA 1RT4B 4ZPTR 2VFRA 1NEEA 2DNPA 1SVDA 4P75A 4R25A 1Q5VA 4N56A 3LO3A 3I82A 3ENVA 4Y2AA 3M2UA 4DV3F 2MZ1A 2YNGA 1WC3A 5D0HA 5J1EB 2BJ9A 4LBPA 1PCAA 4HL9A 2ZZTA 2A0FB 4ECYA 1DRZA 1HBNB 1WG5A 1KOHA 1X4AA 4YR2A 4UY8T 2Y8WA 5BYQA 4FN5A 2YWGA 2VD3A 3E01B 3AXKA 3A8JA 3GIKA 3PW4A 2R7TA 2R42A 2K2PA 2QL7B 2CJQA 5IM0B 4RWXA 4OI6A 4F4KA 4QQBA 3ZNJ1 2VFTA 1WEXA 4ECUA 1X4DA 1FNXH 3AD7C 4NX9A 2HHUA 2E1MC 2GFFA 2XC9A 1EB0A 4DLGA 1RUSA 2UVRA 3MMBB 1NO8A 4IO1A 4O44B 2LU1A 4KT0C 2VUGA 1WG1A 2RB7A 5HMYA 2E1AA 3ICLA 3QT7A 5A0YB 4NLTA 4IRKA 2M88A 1Q4RA 4RU9A 2BJ3A 4FYDA 3QT5A 2KG1A 4PABA 3JB9k 3CSKA 5GMDA 4DF8A 3MD1A 2CQGA 2J6TA 2ZWPA 3VHQA 4YOEA 2DNMA 3DRPB 3RAMA 5KFFA 1FDNA 2LQ5A 4GVLA 2WVBA 4AQYJ 3QSYB 8AT1B 3QIDA 1ZM4A 2CPJA 2OPPA 2Z2YB 3R5CA 3HZEA 3ISZA 4DV2J 5E3QA 2XM3A 2A10A 1P1LA 4MAKA 1WC1A 3GFHA 1S6PB 1IWAA 3NS7B 1FX2A 8ATCB 2CPYA 5IFMA 2V4JB 3TA0A 1URRA 2HRYA 3C6UA 1X4FA 2KG0A 3G82B 3EX7B 1ICEB 3PKMA 4IQXA 1E6YA 2J7KA 3MCMA 2R4FA 3AB2B 5GVQA 2HZCA 2OH2A 2DITA 5DDOC 4QBUA 3NXZA 3GIMA 3QZ7A 2CNKB 3UWTA 3OVAA 3LGHA 2OTJS 2JNJA 2DGXA 1Q8BA 4DG1B 2K06A 4DDFA 2GHVC 2N7YA 3SSRA 2AJ1A 2VQEF 4RUHA 2AEMA 1VGYA 2HURA 1MG7A 4ZITA 4F4WA 1D8YA 2ZH2A 3NBPB 4NCBA 2WVFA 2DY1A 1LWFA 1Q8KA 2W8LA 5GMKa 5E41A 5H9EK 4RLEA 4HI1A 2YVSA 4KIAA 1DBDA 3V5RA 4WCEQ 1DQ8A 5K14B 3OXLA 2YPZA 4OX7A 3ZTPA 5DO2A 3VR1A 5B0BA 1EIYB 2QC3A 2IBOA 2GW8A 5LJ3Y 4IDKB 1IKXA 3CUNA 4LF4F 3D3CJ 4CT8A 1K0VA 3VAIA 3SI8A 3D7SB 2HFZA 2DGWA 3ZZPA 9RUBA 3CWJA 1MMLA 2QLJB 2X1GA 2YPYA 3DDNA 1X0FA 5DM6Q 3FKBA 3TEGA 2GJIA 4BC9A 1HNZF 3PM9A 2Q6BA 2IRYA 1AUSL 4OYOA 1T9XA 2QMUB 3KG4A 4RW6B 2WRMA 2GAHC 2CQBA 1FTCA 1TAQA 4LSZB 2ZE2B 4YB6A 3TUPA 4L75A 3HVWA 3DCAA 2GNKA 2RNEA 1NB2A 3GMGA 4CM2A 1U1NA 1N88A 1HWKA 2ERRA 1SV5B 4IFVB 1RA7A 4QPTA 5KOXA 4UZBA 3LAKA 3K89A 1FD2A 2UV8A 3UN5A 1WSRA 3QSIA 1S6QB 1UTAA 2ILZA 5AXMA 3QRQA 5J2QA 2HK3A 3HHLC 3G87A 2DGTA 2I5JB 1FA0A 1RBLA 1TQLA 1TK0A 2BANB 1LFWA 1HBMA 1HL6A 5ETLA
chains in the Genus database with same CATH topology
1F3VA 1F2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3V A;  1F2H A; 
#chains in the Genus database with same CATH topology
 2FJW A;  4Q0B A;  2DH8 A;  2CNO B;  4DL7 A;  1YSJ A;  4NZ7 A;  2HSE B;  5D78 A;  1RDR A;  3SZ2 A;  3DDI A;  2ZJP Q;  4JV0 A;  2HVE A;  4IFY A;  3EM1 A;  3AXM A;  1TL1 B;  1S59 A;  3OL7 A;  4JI2 J;  2ZD1 A;  1OJ4 A;  2F9D A;  2CQI A;  4LT6 A;  1XMO F;  1VRU A;  1FWL A;  1UZH A;  4DSJ A;  3IMQ J;  4K0K J;  3ZZT A;  1GEH A;  2HHQ A;  1H74 A;  1S7H A;  5HRO B;  4QWB A;  2PFF B;  3HZG A;  5IOL A;  3LP0 A;  4CLU A;  1IKV B;  1BMQ B;  3W2V B;  2V2Z A;  2QMX A;  2LYV A;  1XN9 A;  5FD1 A;  2ZH5 A;  3TO8 A;  1EQ0 A;  1FRL A;  4TU9 A;  4N5S A;  2RF2 B;  1F2G A;  1F5C A;  1IBC B;  3MPV A;  2VB6 A;  3G8Q A;  1D09 B;  1JLC B;  2OFG X;  4CLL A;  3RBZ A;  4ANE A;  2ZH6 A;  3U1N A;  4WTO B;  1LW0 B;  1SQG A;  3HFK A;  3ZNU A;  2RAQ A;  1RAG B;  2FHJ A;  4EGL A;  2HND A;  1HR0 F;  4QR0 A;  3VTI A;  2MHE A;  3A8I A;  2W9A A;  4IYQ A;  1Y00 A;  3T1Y J;  4ZA1 A;  3NP5 A;  4URS A;  2KM8 B;  4OHY A;  5D4L A;  4ZVR B;  1S10 A;  4NZ6 A;  4Z37 A;  2BE7 D;  2LXI A;  3HSD A;  5L9N A;  1UWB B;  4H54 A;  1S0M A;  2Z58 B;  2ATL A;  2D69 A;  3N0V A;  2QO3 A;  3HLU A;  4NLG A;  1RT2 B;  1I6J A;  2EFN A;  2DHX A;  2YH1 A;  4ZPD A;  1GMW D;  3H4D A;  2RML A;  2VAS A;  1VBZ A;  4H4M A;  5G0R B;  2RVJ A;  1AUD A;  1KFS A;  5ETV A;  3W5X A;  3DLE B;  1A6L A;  2OEM A;  4O4G A;  3KHG A;  2OIH A;  1FDD A;  2L08 A;  4U8Y A;  4FDF A;  3VAL A;  1CUL B;  2OSQ A;  2FPH X;  1DTQ A;  1JXV A;  3H8Y A;  4NLY A;  2V94 A;  1K73 T;  4EYI B;  4J9V A;  4RX6 A;  2LQB A;  2AWZ A;  2X3G A;  2CG8 A;  2GCF A;  3BF4 A;  3PV8 A;  2R7W A;  1G6B A;  4CH7 A;  2UUA J;  3RRG A;  4CO3 A;  1HNX F;  4K4U A;  3DLL Q;  5CH7 B;  1H7W A;  2AZ1 A;  5CYQ A;  4A8X A;  1URN A;  4LRF A;  1RU1 A;  2PA8 D;  1KLN A;  3QNW B;  2DT9 A;  1RTD A;  1ZET A;  2J9C A;  2IJR A;  3G8S A;  3QWU A;  4G6V B;  4FF1 A;  1JB0 C;  1RT4 A;  3NGK A;  2WW8 A;  1HBU B;  3M8Y A;  3PG9 A;  1C4A A;  4F3M A;  1FWK A;  2UVW A;  4WE1 B;  1UJ6 A;  3IBF B;  2Q43 A;  2PI5 A;  2L9D A;  4CWB A;  1N5Q A;  1UAW A;  3QFW A;  2HHV A;  5HVG A;  4CLF A;  5J1E A;  2YKA A;  2JFD A;  3LPY A;  2KZZ A;  3L7P A;  4WFY A;  5LJ5 Y;  1YJ7 A;  1HBN A;  2HQC A;  3TX8 A;  1S99 A;  1FJG F;  3W62 A;  1NJI T;  3JXO A;  1B99 A;  3PW0 A;  1OO0 B;  3IXQ A;  2FLP A;  3KFW X;  3GG1 A;  3PRD A;  3E01 A;  1PC5 A;  2GGP B;  5IM0 A;  4YFU A;  1CJV B;  1KQG B;  2LP4 A;  2Z2Z A;  2FJV A;  1VDH A;  3E8O A;  3MOZ A;  1IR1 A;  1HI8 A;  2ATC B;  4NMX A;  2NQP A;  2YBV A;  4ZHR B;  1K1S A;  3UFC X;  4ZJL A;  2M2B A;  3CTR A;  4FNI A;  4L3N A;  2OEL A;  1APS A;  4Q2L A;  1KON A;  1WEL A;  4V19 X;  3M2V B;  4DX7 A;  2XS5 A;  4RW8 B;  3MMB A;  4B3R F;  4DUZ F;  2DRB A;  2NYH A;  4O44 A;  2EWH A;  4B9M A;  4DZ6 A;  2B7C B;  1RTI B;  5A0Y A;  1GMU A;  1JLE B;  2KRR A;  3FBE A;  2V8P A;  1V3S A;  2DTJ A;  1BE4 A;  3D0H E;  1WHV A;  3VAK A;  3T5L A;  5B7W A;  3DRP A;  3DLH A;  2YTC A;  3AHP A;  4IH7 A;  2RRB A;  1I51 B;  3GV8 B;  1UA0 A;  1RCO B;  3TX0 A;  2P8I A;  4WTY A;  1FJE B;  4PYA A;  2UU9 F;  2R7S A;  4I7F B;  1QSS A;  1HI0 P;  3F73 A;  3TAP A;  4BLG A;  1S6P A;  3K57 A;  5KG2 A;  4OJ3 A;  2CZV C;  3H2V E;  3CMA S;  3UDC A;  4U7C A;  4DFP A;  2V4J A;  4DV6 F;  2HHT A;  1MSW D;  1IBL J;  4DZD A;  4Y00 A;  2UP1 A;  2HIY A;  3G82 A;  5EX3 A;  4ZKA A;  1JJ4 A;  1R0B G;  2J76 E;  2V6A A;  4OI2 A;  1MNE A;  2QLB B;  5IQQ A;  1J2V A;  2FGC A;  1U4B A;  1R6V A;  3RAX A;  3M6X A;  2VHG A;  4RNH A;  2AMC B;  2LQ9 A;  3BV8 A;  4LF6 J;  3UNG C;  4TYA A;  2XZW A;  4N77 A;  1KSP A;  4GKK J;  5K8P A;  2IM0 A;  2HQD A;  3FEZ A;  3TA2 A;  4OX9 F;  4U96 A;  2DEI A;  4DG1 A;  2XLK A;  1N5Y B;  1DY3 A;  4QW9 A;  3A3O B;  3BR8 A;  3PHE A;  1RAD B;  3IWX A;  3FVY A;  4I6A A;  4WFB Q;  2BBE A;  3MHY A;  3NBP A;  2Q1L A;  2AU0 A;  4PR6 A;  1VIS A;  4C0O C;  2VC0 A;  2MQO A;  4OV6 A;  2J0S D;  3MCS A;  2XY5 A;  2XHC A;  3M6W A;  3PYD A;  2WVD A;  1M5K C;  2MST A;  2VL1 A;  2VFS A;  5K14 A;  4LJM A;  3GYG A;  4B08 A;  3TUJ C;  1KHW A;  4IDK A;  1NBE B;  2VDH A;  3HMJ G;  2V2K A;  4DR1 J;  1JLG B;  1R7I A;  4C9D A;  4MMO A;  3BS9 A;  2QA2 A;  3I5C A;  3MM8 B;  2B0G A;  1MU2 B;  4NA2 A;  4N47 A;  4K5R A;  4DV3 J;  2VA3 A;  4A8S A;  2N4D A;  4CYU B;  3GR1 A;  4PWD B;  4AXI A;  4DR4 J;  4DR2 F;  4RW6 A;  3QLH B;  1RU2 A;  3W8P A;  4EO8 A;  2ZE2 A;  3OV7 A;  3AA8 A;  1V3Z A;  2C28 A;  1X60 A;  4B9V A;  1XWL A;  2VFU A;  1N36 J;  3EGN A;  4PCQ A;  2UUC F;  1OQ3 A;  2I6W A;  3BBF A;  3E2E A;  1N33 F;  2ILY A;  5KFG A;  2R7U A;  1SV5 A;  3FZ2 A;  4IFV A;  4QU6 A;  2DR7 A;  2DCL A;  5IV4 A;  1S6Q A;  4FVC A;  1SJ4 P;  2KFY A;  3CC7 S;  1T03 B;  2I5J A;  3CB4 A;  3OTC A;  5KFC A;  1U6B A;  2BAN A;  1HWU A;  1R3N A;  2VOO A;  2CQH A;  1UW4 A;  2KU7 A;  4ES2 A;  3QAT A;  3AH6 A;  5LT5 A;  3J7Y I;  2WTF A;  5C25 B;  3OPK A;  3MCO A;  2DGO A;  2KKH A;  4LF1 A;  2PC6 A;  4UT4 A;  2G2O A;  1TL1 A;  4LFC J;  4KGZ B;  3PO4 A;  1VQN S;  2UXB F;  3A1Y G;  2FC8 A;  3J7Z 5;  3IRW P;  1YQH A;  3LGN A;  2J5A A;  3BO2 A;  2L48 A;  4CLZ A;  4F0H A;  4JI3 F;  4QWC A;  1SC6 A;  2QA4 G;  3J7A N;  4KKO B;  4YDD B;  2MPU A;  3MR5 A;  1LK5 A;  1KRP A;  4MKY A;  5HRO A;  2OEJ A;  4A8O A;  4H4O B;  3CCW A;  4UTG A;  5J1N A;  1IKV A;  3W2V A;  3BSA A;  2Z56 B;  1IM4 A;  3GFZ A;  5HVH A;  4ATN A;  3NS5 A;  4RPF A;  2MY8 A;  1WNE A;  5F9N A;  4JI1 F;  1I5O B;  2OML A;  1P8G A;  2F3J A;  3BGO P;  1OSC A;  1RSC A;  3V6H A;  4WP9 A;  1RE1 B;  2RF2 A;  4QWE A;  1D9D A;  3N6L A;  5B0F A;  2YX4 A;  2KHD A;  2OO4 A;  2CNN B;  1RQ0 A;  4X62 F;  2IVY A;  3FRZ A;  4DV0 F;  4NLX A;  3VAG A;  3KUE A;  4I4B A;  3EYZ A;  1JLC A;  2BVZ A;  1R27 B;  3HKZ D;  3TYT A;  1U25 A;  4CH0 S;  2VON A;  4EO6 A;  1RAC B;  2QGF B;  1VC5 A;  1LW0 A;  1X5S A;  4B3T J;  4ED1 A;  1LV5 A;  4FBT A;  3CC2 S;  4ITS A;  3EWG A;  4K4V A;  2PEB A;  1PYO B;  3M8P B;  1HNV B;  4RNN A;  3TW0 A;  3K59 A;  1RB0 A;  4WK3 A;  2ZDO A;  1RP5 A;  1U8S A;  3MM6 B;  4YY3 J;  3ZXW A;  4EI2 A;  1Q5Y A;  1QVF R;  3DU5 A;  3SQO P;  3KDN A;  2R2T A;  4WF9 Q;  1J5E F;  4QOT A;  3FBF A;  1UWB A;  2YX1 A;  4XO0 A;  3LWL A;  2B6A B;  4YEA A;  2WBM A;  1RBA A;  3H90 A;  2IY5 B;  1WSV A;  1RT2 A;  4DEZ A;  1RWO B;  4B9U A;  2J7U A;  5G0R A;  1C0T B;  2CPX A;  1VR6 A;  4MK9 A;  3CCT A;  3IGV A;  3UD3 P;  3M8Q B;  2PDA A;  4J37 A;  3C14 B;  2A1B A;  2HQ3 A;  1HHT P;  1RKI A;  4CTA B;  3DLE A;  1U2C A;  1YBA A;  1C2P A;  2GIF A;  3A3N B;  4WII A;  4ZCI A;  2LEB A;  1CUL A;  3MAA B;  1WOR A;  2YWK A;  4P74 A;  2D7S A;  3CW2 C;  1QLN A;  1HPZ B;  2OPR B;  1N32 F;  3QPI A;  3BSC A;  3DRX A;  3J7Z T;  5KFR A;  4I56 A;  4X64 J;  1Q95 G;  4QR2 A;  4U9R A;  4Q43 A;  1P6T A;  4TQR A;  2XMU A;  3CIM A;  1H7X A;  1TL7 B;  2HGN A;  2MQL A;  3WBZ A;  3C8Y A;  4X4T A;  2XQC A;  1PO6 A;  4WJB A;  4BC7 A;  2KM8 C;  2ABY A;  1Y3J A;  1G1X A;  4ZJQ A;  2DXE A;  3ENW A;  1HNI B;  1ZPV A;  1UZD A;  2Z57 B;  4HH0 A;  3U7J A;  5AE3 A;  3H40 A;  5KFJ A;  3PCO B;  2OTL S;  3PY8 A;  4DUY F;  2QTW A;  1YG0 A;  2HRT A;  3EUN A;  4F0K A;  2EFG A;  1HBU A;  3I5B A;  3W66 A;  3D0I E;  3VF0 B;  3RB4 A;  3CDW A;  1JNR B;  3CD5 A;  1UA1 A;  3U1L A;  1RWP B;  2VOD A;  4ZPC A;  3FSX A;  2BM0 A;  2PD1 A;  3WX4 A;  4M5J A;  5D8H B;  2HHH J;  1WG4 A;  4NXM F;  3PJX A;  2H5E A;  1CBK A;  3QT6 A;  2B4O A;  1M5S A;  5IC4 B;  5F8N A;  4DL4 A;  2HEK A;  1WTF A;  1WF2 A;  4GRS A;  3L4B C;  3R9L A;  4KC5 A;  3TWZ A;  2NZC A;  3R6G B;  3I4P A;  4TKT A;  4EEY A;  4Q8E A;  4DSI A;  4HT5 A;  2G0I A;  4DV7 F;  5I3U B;  1KOO A;  1XNQ F;  2GGP A;  1RLC L;  1CJV A;  3GQC A;  1FEE A;  3DI6 B;  2YKN B;  4ZHR A;  2IMW P;  1OY9 A;  2EK1 A;  3I56 S;  2GML A;  3Q2S C;  1M5P C;  2V69 A;  1VLY A;  1J5O B;  2V8D A;  2IDE A;  3M2V A;  5KFA A;  3LAL A;  4RW8 A;  3J80 Y;  4S0M A;  1HW8 A;  3T9Z A;  2BJE A;  2MQM A;  2LQ8 A;  4DBQ A;  1RTI A;  3G96 A;  2GA7 A;  1JLE A;  2Q6C A;  3IG1 B;  1WKJ A;  3AOC A;  4FNH A;  2WSC C;  5F9L A;  2XCA A;  5IT4 A;  3OQ2 A;  1T9Y A;  1FFW B;  2KH9 A;  1V5I B;  3RG6 A;  3CC4 S;  2CJ9 A;  2F65 A;  1C1C B;  1Z2L A;  3PEJ A;  1GTE A;  1RTJ B;  1CVJ A;  3Q0A A;  4ZS6 A;  3SCI E;  4I7F A;  1KVI A;  5F0W A;  3GON A;  3DGP B;  4ZIV A;  5L9X A;  3M8Z A;  1IKW B;  4CLW A;  4WFA Q;  4AL6 A;  3DRS B;  4C97 A;  3O3L A;  5CA5 A;  2G13 A;  2VOP A;  1RK8 A;  5JVG Q;  3UPF A;  4KBI A;  1RBO B;  5IT9 U;  3POT A;  3ZTO A;  2VJV A;  4WKY A;  3CCJ S;  1BQX A;  4Y34 A;  5DG8 A;  2V68 A;  3DLK B;  3NAH A;  4DU7 A;  2QL9 B;  3V6K A;  4CT9 A;  2PT0 A;  2V63 A;  1FRX A;  2E9Z A;  4ERD A;  3LAM A;  4PG4 A;  4J9M A;  2J0X A;  4RUB A;  1CEZ A;  4J9L A;  1YDL A;  4Y6I A;  2XMJ A;  2QSW A;  5ETN A;  3KLE B;  3RB3 A;  2GVD B;  1N5Y A;  3SCK E;  2OHD A;  2VPW B;  3DLJ A;  3WIV A;  1NXI A;  3JYT B;  2NXC A;  3BBC A;  3NAI A;  3H5Y A;  2VBZ A;  2P5V A;  2WVE A;  2NS1 B;  4ECT A;  2AGQ A;  5HQM A;  2HFO A;  4WYW A;  2FVC A;  3BGR B;  3TJ8 A;  2O1P A;  3NGT A;  4U67 Q;  1FRM A;  2EI5 A;  3KLV A;  3MAQ A;  4P52 A;  4ED8 A;  2BOP A;  7FD1 A;  1M5H A;  3ZO7 A;  2R3V A;  2VIH A;  3MM7 B;  3KK2 B;  2HLT A;  2HG4 A;  4YN3 B;  2OI2 A;  3DRR B;  3ILL A;  1TTH B;  2ZNZ A;  2UVV A;  2FTR A;  3NG8 A;  3RR7 A;  3UO0 A;  1NKC A;  4OYB A;  1JLG A;  4R8U B;  1EZZ B;  2HFU A;  2B51 A;  3QGG A;  1IBM F;  3MM8 A;  1RAB B;  1MU2 A;  2QYC A;  2H54 B;  3M8S A;  4K4W A;  3UD5 A;  2MKK A;  2AEJ A;  4M1K A;  4CYU A;  4F36 A;  1C0U B;  5LSR A;  4PWD A;  3GYX B;  1HLW A;  2W01 A;  5LMN J;  4TY9 A;  3QLH A;  4OZL A;  2W4D A;  1P9Y A;  3B54 A;  2XMT A;  3NCQ A;  4JI8 F;  3W5Z A;  1RHQ B;  4Y2K A;  4ZN3 A;  1L3V A;  2IAJ B;  3MEC B;  1RAF B;  2MLZ A;  2AYG A;  1RCX B;  4DV5 J;  1WOO A;  1NLK L;  1UP1 A;  4IOA Q;  4ZK7 M;  3ZZ0 A;  4PZV A;  1T03 A;  5A8R B;  3M6U A;  4EU0 A;  1SIZ A;  1RZM A;  4OI0 A;  4G65 A;  3D4J A;  3UR3 C;  4BHQ A;  4LF5 F;  1RWX B;  5EX0 A;  3R27 A;  1PAE X;  1ELO A;  2Y8Y A;  1S12 A;  4JI6 J;  5KFI A;  5C25 A;  5HSP A;  1NB7 A;  3OFG A;  5A8W B;  4EFA C;  5F8J A;  3MR6 A;  2HBR B;  3L7U A;  3H4B A;  4J9S A;  5KFH A;  4CI0 B;  3TVZ A;  3S7R A;  4OZ5 A;  2PII A;  1TL3 B;  1FJ7 A;  4DSF A;  3BQ1 A;  5KFS A;  1YWX A;  4KKO A;  3TRG A;  4DX5 A;  2KJW A;  2MJU A;  5HQL A;  1AYE A;  1FWP A;  4J9K A;  3AT1 B;  4H4O A;  5I3P A;  4ED7 A;  2QMW A;  2EW9 A;  1JLQ B;  4YS2 A;  2X51 A;  4UST A;  4TNO A;  2V0N A;  2X3D A;  1CSJ A;  3BGL A;  2NYI A;  1XMQ J;  1SL1 A;  1EKS A;  3GV5 B;  1A0O B;  2OPQ B;  1VQP S;  4OI4 A;  2M7S A;  4P7T A;  4C98 A;  2MEW A;  3CME S;  4DL2 A;  1XIQ A;  1SH0 A;  2EXU A;  3DLG B;  3P3D A;  4N8N A;  2NXJ A;  1AFJ A;  1HNW J;  1FI4 A;  2FGO A;  3GIR A;  2W1B A;  3IR5 B;  1VQM S;  2FZG B;  5LM7 E;  4HDH A;  3B4M A;  2LLZ A;  2DYA A;  4KH0 B;  3M32 B;  4FF4 A;  1CQM A;  2RH3 A;  4KO0 B;  4LF9 J;  3M8P A;  1HNV A;  4AQY F;  2EFQ A;  2ZHB A;  2V2V A;  3PZP A;  2NLW A;  3CMQ A;  1U24 A;  1ZAX A;  5BYS A;  3MM6 A;  1IBK J;  4NCG B;  2JEG A;  4DV2 F;  2EG1 A;  1VI7 A;  4GC6 A;  1FFS B;  1SXL A;  4HT7 A;  4QYZ J;  3C66 A;  2B6A A;  2XZT B;  2XNR A;  2AGO A;  4U6P A;  2DR5 A;  5DRK A;  2XYP B;  5AXL A;  2CQ4 A;  3C16 B;  2LKZ A;  3OL6 A;  1C0T A;  2HGM A;  4O0I A;  4OLO A;  4GKJ J;  2EPI A;  3M8Q A;  2B4U A;  3C14 A;  1WWH A;  4CTA A;  1ZZF A;  3SV4 A;  3D0G E;  2JL9 A;  3MAA A;  1JXL A;  2A2D A;  3J80 U;  4HHJ A;  1S48 A;  3K7R A;  2RJZ A;  2OPR A;  1F60 B;  2UUW A;  2HVI A;  4ZPB A;  4DR2 J;  4GMK A;  2LA6 A;  2CQ0 A;  3WX8 A;  1TL7 A;  2HS3 A;  4B3S J;  2J7W A;  2DNQ A;  4CP5 A;  3DXB A;  2ZH7 A;  1CLF A;  4ES1 A;  3EDQ B;  3VWS A;  4NLW A;  3M2R B;  1WUU A;  3QJL A;  4DL5 A;  3R5J B;  1X5T A;  1HNI A;  5L1J A;  2R7X A;  4O23 A;  1U1L A;  3BGF A;  1MWQ A;  4PG7 A;  2A6O A;  5JXS A;  3PRV A;  4USU A;  4FXW A;  5L39 A;  1VIX A;  2ACM A;  1ZBT A;  1VQ8 S;  1NSA A;  1QE1 B;  1PC4 A;  5DQH A;  3MMJ A;  1RT6 B;  4MKB A;  2HNY B;  3QGH A;  3TNV A;  5KG0 A;  4MIA A;  4M95 A;  1FF2 A;  5HO4 A;  4NPO A;  4RU2 A;  5L46 A;  1SCJ B;  2G0J A;  3PR5 B;  5IS2 A;  3JAM Y;  2Q66 A;  3PTW A;  1GXU A;  2HKE A;  5ETK A;  4A8Y A;  3FRY A;  4O3Q A;  3KUH A;  1Y7P A;  3UW1 A;  5I3U A;  2ZJR Q;  2WSF C;  2MJN A;  1GFW B;  3U27 A;  2DBB A;  3L7O A;  4N7T A;  2BR0 A;  1PYT A;  3AOD A;  4LFA J;  2XLJ A;  3DI6 A;  4NYP A;  5MLC V;  2FHM A;  1EHW A;  4G3I A;  3PXG a;  2RS2 A;  1VK3 A;  2YKN A;  4YR3 A;  3OJU A;  3CJK B;  3PFE A;  4NLD A;  3TZY A;  5T14 A;  2AYB A;  1J5O A;  5EHH A;  3HXM A;  3UN2 A;  1PYS B;  4LR7 A;  5C2G A;  2FJB B;  3QAE A;  4O3N A;  1ZYQ A;  2XCP A;  2RIL A;  2FD2 A;  3TZX A;  4F4X A;  1BY9 A;  1SQE A;  1NCL A;  1B64 A;  3IG1 A;  1U2F A;  2CQD A;  2GVZ A;  3CDE A;  3ETM A;  3DOL B;  4JI2 F;  2CPD A;  1R8A A;  4DL6 A;  3V2U C;  2DO4 A;  1OIA A;  3FCW A;  1C1C A;  1RTJ A;  1HQU B;  1JK9 B;  2OLW A;  1SBR A;  4K0K F;  3N5B A;  5D3G B;  5FDL B;  5EDW A;  3PEH A;  3DGP A;  3RJM B;  3S1T A;  1IKW A;  2JRS A;  2J9E A;  1ZA1 B;  3DRS A;  2Q3P A;  5U47 A;  4WFX A;  3TAQ A;  2PFD A;  2DNL A;  3N79 A;  3WHI A;  1XR7 A;  5C42 B;  2FC9 A;  1B7F A;  2R9L A;  2XS7 A;  1XBW A;  3CT9 A;  2FUG 9;  3DLK A;  4A48 A;  1NDK A;  7FDR A;  4C3M A;  4UQT A;  2VBW A;  4W4M A;  1X9M A;  2VPX B;  4MIB A;  2GC8 A;  2JLE A;  4C8L A;  2C22 A;  1UCN A;  3ELH A;  3JQJ A;  3SQG B;  2KXN B;  1M1H A;  2LEP A;  3MEG B;  3GSI A;  2C3P A;  1S49 A;  2KVI A;  3BQ2 A;  1NZ8 A;  1VJW A;  3KLE A;  1U0S A;  1U1R A;  2G2Z A;  2GVD A;  2J9D E;  2HBZ B;  2OP5 A;  4DCP B;  3K17 A;  3Q24 A;  4Z2X A;  2MQ8 A;  3LQV A;  3NKY A;  3Q8Y A;  4ZIW A;  3JYT A;  1CPZ A;  4DL0 C;  1FKO B;  3T1Y F;  5E0O A;  2DR8 A;  3BGR A;  4U8V A;  1DQ9 A;  4OYM A;  4W98 A;  4DPX A;  2ASD A;  3T19 A;  2CJB A;  2R8H A;  3GJQ B;  2E1P A;  3N4W A;  3MM7 A;  3KK2 A;  4OV1 A;  2L41 A;  2AJ4 A;  3DRR A;  3NEK A;  3KNA A;  1LFP A;  3HP6 A;  1TUW A;  2JVR A;  4X2B A;  1P1T A;  2ZDP A;  3TZW A;  2N3L A;  5DDQ C;  5CCM A;  2XSF A;  4AXJ A;  4ALZ A;  4RW9 B;  1VRT B;  2O01 C;  2KXF A;  1FXD A;  1NK5 A;  4R8U A;  2OUG A;  1NU4 A;  4YDX A;  1K1Q A;  4ZVE A;  4C2M A;  4NML A;  2CAD A;  3PX6 A;  1Q1K A;  1T95 A;  2AQ4 A;  1YI2 S;  1C0U A;  4X4V A;  5L1I A;  3IS9 B;  3OW2 R;  1LWC B;  1RAJ A;  4LF7 J;  4NLQ A;  4M94 A;  2WVC A;  4EK2 A;  3CPW R;  2UUA F;  5LOQ A;  3MEC A;  2ZKT A;  4M5L A;  2BX6 A;  3US5 A;  4BWM A;  5A6P A;  4DSK A;  1X5O A;  3TJA A;  3G6X A;  2P9C A;  4KYZ A;  2MKY A;  2JX2 A;  5F3T A;  1S9E B;  3MF5 A;  2FJX A;  3HFV A;  2LMI A;  5A8R A;  5G4D A;  3ZFV A;  3HFZ B;  2OGU A;  4QZV B;  2G4B A;  3GIL A;  2YNI B;  1U49 A;  1NJW A;  4ZPA A;  4J7C A;  4DR3 J;  4JUZ A;  3MZI A;  3ZZZ A;  3OVB A;  2EBE A;  1ZA2 B;  5GAD U;  3X1L B;  2B5J B;  2CYY A;  1GMV A;  4M5G A;  1U47 A;  1VQY A;  5A8W A;  3FFI B;  5K8O A;  5GAE U;  2Y1L B;  4OZ1 A;  5ETR A;  1WDT A;  4DFM A;  3AQO A;  3MPW A;  3WQP A;  5ETM A;  1NK4 A;  6AT1 B;  3I0R B;  3H25 A;  5D77 A;  4KY3 A;  2HS0 A;  1TL3 A;  4C3L A;  3QAU A;  4YHH J;  1I94 J;  3QO9 A;  1QUP A;  2HQG A;  4KFB B;  2BEF A;  3NCP A;  1FJC A;  3FQK A;  4X84 A;  4JP8 A;  1JLQ A;  3K8W A;  1TKX B;  2ZJQ Q;  3BKU A;  4USH A;  4WZM A;  2RDJ A;  1JWW A;  1VQS A;  4NXN J;  2HNZ B;  5KTQ A;  2OPQ A;  2BJ1 A;  3MCN A;  4EZ6 A;  3MFH A;  4N41 A;  4E8U A;  5KFV A;  2FVQ A;  3DLG A;  1N34 J;  2KXH A;  1WC4 A;  4AFF A;  1BC6 A;  1LW2 B;  3O1L A;  4LR9 A;  3QWP A;  5IT0 A;  4WFZ A;  3HSJ A;  4ZLP A;  2CZ4 A;  3RB6 A;  3TOQ A;  2Y9H A;  2DIS A;  3ILJ A;  3OTO J;  5HQ8 A;  1YTY A;  1D9A A;  2AD9 A;  1FE0 A;  3GWC A;  3M32 A;  4KO0 A;  2KHC A;  2VU5 A;  4CO5 A;  2GJF A;  5B0A A;  5E7O B;  5D4P A;  1TMJ A;  1QSY A;  3KOA A;  2EVZ A;  1SKU B;  1JLB B;  4UY8 5;  4NCG A;  2HBY B;  1NRK A;  1RGV A;  1R8C A;  4NCA A;  1PIL A;  2FLL A;  4ZCM A;  5H9F K;  2NPI A;  4P2S A;  5I3Q A;  4KHM A;  2DHH A;  3GTY X;  1IBL F;  3EPI A;  4ED3 A;  3C16 A;  3UR0 A;  1KTQ A;  4A8M P;  3R7S B;  4HEA 9;  4J9U E;  2YKO A;  4OYP A;  3MR2 A;  2YY3 A;  1YJN S;  3SXL A;  5FII A;  4YP3 A;  4D3H A;  4RL1 A;  3BZQ A;  2JEJ A;  3H98 A;  2CWX A;  2PGC A;  4F50 A;  3UE2 A;  3RRH A;  4Q2M A;  2C3U A;  3CO0 P;  3IBC B;  1JJC B;  3W9I A;  2HW3 A;  4LF6 F;  2Q79 A;  1WDD A;  3HHK A;  4HI2 A;  1UVK A;  1MW7 A;  2KI2 A;  4J9Q A;  5D6G A;  3NS6 A;  4GKK F;  2F4V J;  4OJH A;  4CZC A;  4X4S A;  1NK7 A;  3BYR A;  3I96 A;  4HYK A;  1NND A;  3HHD A;  5D4N A;  2IRU A;  2K7J A;  2HQI A;  3M2R A;  1F1B B;  1T9V A;  5AE2 A;  3SFU A;  1WKL A;  2WZ1 A;  3JS9 A;  4K50 A;  4ED2 A;  2R8G A;  3G86 A;  3OD2 A;  5J1P A;  1T3O A;  1C4C A;  3EZ5 A;  1F0X A;  1TL4 A;  2QFI A;  2H1Y A;  3VV2 B;  2RU3 A;  3D66 A;  2K1R B;  1HQ2 A;  3T3F A;  3PJW A;  4CLP A;  1WJ9 A;  2HWT A;  1TKZ B;  4JI7 J;  3Q86 A;  1BXN A;  2KT5 A;  2QZ8 A;  3AD8 C;  3NY0 A;  1FER A;  3LA0 A;  1QE1 A;  1XR5 A;  4DR1 F;  4J9P A;  4KB7 A;  3K2Y A;  2VPY B;  4C3K A;  2B9E A;  1UET A;  1RT6 A;  4X4R A;  4CDI A;  2HNY A;  5CYJ A;  1Q86 T;  1WD6 A;  1F3V A;  1NUE A;  3BO4 A;  4O3S A;  3SBM A;  5J2P B;  4DR4 F;  4JYA J;  5B0G A;  1VJQ A;  5HMX A;  1Y3K A;  3OR1 B;  2QX0 A;  2GJ2 A;  4MK8 A;  1FRI A;  3TP2 A;  2CQP A;  4ED4 A;  2COL A;  2Y1I A;  1TMM A;  1N36 F;  1WI6 A;  1X5P A;  2CRL A;  2DGS A;  4CLK A;  1YBU A;  1GH8 A;  2OKQ A;  1NK9 A;  3I9V 9;  3B8H A;  3PYF A;  3CJK A;  2CQ2 A;  1EAY C;  3Q89 A;  1GMW A;  4USK A;  4C0B A;  3EXC X;  4F4Y A;  1S72 S;  1CJT B;  2RHS B;  4QYR A;  2CUY A;  2VC1 A;  2I2Y A;  2HFV A;  5C7P A;  1SL0 A;  1KLM B;  1XEZ A;  4MFB B;  1DQA A;  1S9G B;  2ZUA A;  2CZ9 A;  4USV A;  3DOL A;  1KWM A;  5LXY A;  3PKY A;  4LFC F;  1KN6 A;  3LAN A;  4URG A;  4B3O B;  3ZC4 A;  3QJJ A;  4WP3 A;  2ZZM A;  5HBM B;  3FJ2 A;  4USJ C;  1KDN A;  1LOU A;  2HLU A;  3AD9 C;  5D3G A;  1XNR J;  5FDL A;  1N56 A;  3EGZ A;  4I2P B;  3FC9 A;  1VQ7 S;  1JNZ B;  4LMZ A;  3I4H X;  1B70 B;  3WC0 A;  5IXU A;  2YX7 A;  4TU8 A;  2D3O 1;  4MYU A;  5HMW A;  3O2I A;  2YQ1 A;  3HVT B;  4KGK A;  3R7N B;  1R31 A;  1SJ1 A;  5H9F J;  2WOM B;  3G2X A;  4ID5 B;  4ID8 A;  2LEA A;  5C42 A;  1HD1 A;  1AB8 A;  1Y4Z B;  2ZBP A;  2W2Q P;  2DHA A;  2JLF A;  1U48 A;  5FLX U;  4OZ2 A;  3N28 A;  1S57 A;  3FSY A;  2VIC A;  3K5O A;  3T6B A;  1JX4 A;  3MUV P;  3RGI A;  4OL8 A;  2M9K A;  4EBD A;  1G2E A;  2KDO A;  1WC6 A;  3LWM A;  1FVS A;  1TUG B;  4JI5 J;  3W7B A;  2IRX A;  2BUN A;  3SQG A;  2DGQ A;  5KFK A;  3MEG A;  2XYH B;  2PN6 A;  3D6F B;  4DN0 A;  1YBT A;  2B4P A;  3D54 A;  4WP8 A;  1B4S A;  2P2C B;  1Q16 B;  4B3T F;  2DHS A;  3F44 A;  2FLN A;  4L73 A;  4CNY A;  4M5K A;  2CPH A;  4M5M A;  3CNQ P;  2W2O P;  4UW2 A;  3W2W B;  2XS2 A;  3ADA C;  2PI4 A;  1S77 D;  5K9F A;  1R8P A;  1FKO A;  5KFE A;  1VQ6 S;  4I1T A;  1GK8 A;  4YY3 F;  5A2Q U;  2WON B;  1RAE B;  5F3Z A;  4Y2M A;  1VQL S;  1O51 A;  2D74 B;  3RR8 A;  4DPO A;  3E3X A;  1FD8 A;  1HI1 A;  4J91 A;  3QYY A;  1FES A;  3PHT A;  5DGA A;  3W9H A;  1IKY B;  1U1K A;  3T41 A;  2V9W A;  3NNH A;  2KO1 A;  2MZS A;  2ZNY A;  2ZOF A;  4ZVG A;  4HKQ A;  4RW9 A;  5M2R A;  1EKR A;  2VKR A;  1VRT A;  3ETO A;  1OYE A;  1T94 A;  2P6T A;  1CS4 B;  4Y0F A;  2F8M A;  1V5V A;  1F9H A;  4DCJ B;  4BDP A;  4YUD A;  1Q81 T;  3D6H B;  2EFV A;  3IS9 A;  1XTZ A;  3R2D J;  2VG7 B;  4NI2 B;  3I6P A;  1NZA A;  4TQS A;  4AT1 B;  5BJR A;  1YJT A;  1LWC A;  5F8H A;  3CCS S;  2AX1 A;  3O5T B;  4Q44 A;  4X64 F;  3P5T L;  3PW5 A;  2QFJ A;  2DPI A;  2DEJ A;  2VPZ B;  5KT3 A;  4ZVP B;  4ANC A;  3VZH A;  3UDL A;  1FHT A;  2D1C A;  5EWE A;  2H4W B;  2JSX A;  3CUL A;  4N8O A;  4ICL A;  4C8N A;  1IR0 A;  1S9E A;  2CIM A;  3THT A;  5GAG U;  4HTI A;  1R89 A;  2DR9 A;  2GV1 A;  3DU6 A;  2V34 A;  1QSL A;  5D15 A;  3SDE B;  2YNI A;  4OZ0 A;  3W64 A;  3GZ7 A;  4JV1 A;  1LWE B;  4USW A;  2VG6 B;  4BWJ A;  2MQP A;  4ZP9 A;  3KLF B;  2B5J A;  1G3O A;  4J90 A;  2BE9 B;  3CVK A;  4EYH B;  3FFI A;  2HHH F;  4B9S A;  4DR5 J;  2V8H A;  4OYZ A;  2BJD A;  2BAC A;  5K20 B;  2ZVI A;  3I0R A;  2QSF A;  2XY7 A;  4B9T A;  4P71 A;  4IRC A;  2PE8 A;  2M8H A;  5ETT A;  2E5G A;  3UDE A;  1U1M A;  3QGP A;  2ZUG A;  4KFB A;  3WZ0 A;  1DAX A;  3RBE A;  2UXC J;  5KAK A;  1TKX A;  4TYB A;  3FMB A;  1PBU A;  4L6V 3;  3PR4 A;  1DLO B;  2C2R A;  3GP9 A;  1FKA F;  2C42 A;  2GMH A;  4FF3 A;  3GJS B;  2HNZ A;  2VA2 A;  3N5F A;  2LFV A;  4NWB A;  3FDS A;  2KB2 A;  3BJY A;  3MPY A;  3V81 B;  4ZP8 A;  2FIU A;  4O3R A;  3DOK B;  4FXV A;  4GO7 X;  5LSO A;  1LW2 A;  4M8L A;  2CDQ A;  1O5J A;  1L3T A;  5HJX A;  3UNY A;  1UW9 A;  4DR6 J;  3S8S A;  2QIF A;  4QIW D;  2MXY A;  3K5M A;  4OX6 A;  2JEI A;  2E1C A;  3M4X A;  4DS5 A;  2K3K A;  1NH7 A;  4CM0 A;  3LOU A;  1JLB A;  1KHV A;  2LVW A;  4OYX A;  3EVW A;  1X31 C;  2G2Y A;  3UQS A;  5HK4 A;  4YB1 P;  2HYI B;  1R8B A;  1OSD A;  4L74 A;  2LEC A;  5H9E J;  1X4C A;  1KNZ A;  4RUA A;  2GQC A;  1F9F A;  1SJ3 P;  3M05 A;  3CJT A;  4WZQ A;  1X4H A;  4JI0 J;  1JKH B;  5H1S V;  2FY1 A;  3J81 j;  1UFW A;  1S9F A;  1MWY A;  4Z7C A;  4KGM A;  1TK8 A;  3ISN D;  2E29 A;  3UN3 A;  1TZ0 A;  2CJA A;  3KLH B;  2MKH A;  2VG5 B;  5CAA A;  1AW0 A;  2E7X A;  1Y5N B;  2PMW A;  1UVN A;  3CED A;  1OWX A;  1U6F A;  2KVQ E;  3O8W A;  2DNZ A;  3OHB A;  2ADC A;  1HKA A;  1Y11 A;  3KNG A;  3Q2T C;  5D4O A;  4OI1 A;  3RZA A;  3A4T A;  1HBO A;  5KFN A;  2XBP A;  3PAC A;  2CWK A;  4X4U A;  2GS8 A;  3TEH B;  3OL9 A;  2JVO A;  5EUH A;  4ETZ A;  2NUU G;  2R7Q A;  4NEY A;  2RU9 A;  4MH8 A;  2BQ3 A;  3LTO A;  2HAF A;  1NJY A;  2ZH3 A;  5FJ4 A;  1B0P A;  2K1R A;  3RB0 A;  2KFN A;  1TKZ A;  2WBR A;  3FGV A;  5A8K B;  1JIH A;  3HHL B;  2VQF J;  4CLT A;  3C3L A;  2ZZN A;  5E33 A;  4F04 B;  2AYE A;  2BOA A;  1U45 A;  1EX8 A;  1N52 B;  4FPI A;  3HD2 A;  3T1H J;  3CDA A;  2RQ4 A;  3VZI A;  4RZR A;  4W90 B;  1WHW A;  4N76 A;  5J2P A;  1VQ5 S;  5LMN F;  2HPU A;  4FS2 A;  3O6Q A;  3OR1 A;  4JI4 J;  1JJ2 R;  4FS1 A;  3GCW P;  4MIW A;  5DQG A;  5MAO A;  3DYA B;  2SXL A;  2BE2 B;  2PMH A;  2ASY A;  4NLO A;  1SC3 B;  1WHX A;  4LRD A;  3HK2 A;  3TVK A;  5SZT A;  3TAM B;  2KFZ A;  3ZZO A;  4A8K A;  4DV5 F;  4C7Q A;  1YLX A;  4YQW A;  2EKY A;  4IR9 A;  2ASL A;  3FCV A;  2H5I B;  2HS4 A;  3LP2 B;  2ZBQ A;  2Y1J A;  4XAK A;  3VCD A;  4DJB A;  4ECZ A;  1OPZ A;  5AXK A;  4DR7 J;  4DU8 A;  1CJT A;  3D3B J;  1MMD A;  2DK2 A;  4P72 A;  2AIR B;  1EQM A;  2BM1 A;  4ZVF A;  3W5Y A;  5DDR C;  1VQ4 S;  3BH7 B;  4PUO B;  1QJH A;  4PYD A;  1S4F A;  4BBY A;  4JI6 F;  1FNM A;  4MFB A;  3J81 Y;  1YZ7 A;  1ZPW X;  1U2R A;  2KYZ A;  2MYF A;  3D5M A;  3EXY A;  4KHP J;  1NJX A;  4Q0B B;  2XMM A;  3OFF A;  4ZVU B;  3EVO A;  3I9Z A;  2MZR A;  2E5I A;  3MMA B;  4B3O A;  2AHO B;  1HQE B;  3BEG B;  5HBM A;  3JTN A;  4YB7 A;  5HVF A;  4C8M A;  2BYC A;  3IFE A;  1VC6 A;  4K4Z A;  4AND A;  3IM9 A;  4I2P A;  2R7R A;  2JC1 A;  2XWX A;  3JSR A;  4IR1 A;  2HFS A;  2E66 A;  5LMU J;  5DGB A;  3DLB A;  2MQQ A;  3BN4 A;  4C11 B;  1PGZ A;  1SH3 A;  2E1R A;  3HVT A;  3BKT A;  2WOM A;  3M30 B;  5KG6 A;  4ID5 A;  4ILL A;  3FMW A;  3V4M A;  5KT2 A;  2OMO A;  1XMQ F;  2V2Q A;  5KFZ A;  5DM7 Q;  4DPW A;  2KT3 A;  5KT6 A;  1K47 A;  4ZVH A;  4ZDN A;  3KG1 A;  5F8I A;  1TFY A;  2GZO A;  5AJ3 J;  1GX6 A;  4F2S A;  1HNW F;  1HD0 A;  4C8Y A;  4EZ9 A;  4CO1 A;  4RKU C;  5B09 A;  4QWA A;  5J2M B;  3DMJ B;  2NSC A;  4C8Z A;  2DPJ A;  2AW0 A;  1S6U A;  4C0H A;  4HHU A;  3CD7 A;  3SFG A;  2G0C A;  4LF9 F;  1SKS A;  3W2W A;  1WF1 A;  2AV5 A;  4FVM A;  3E51 A;  2Z8Q A;  2PEH A;  5T41 A;  3JSB A;  5KFL A;  1IBK F;  2WON A;  4FBU A;  2LDY A;  1K8A T;  2E9T A;  3R5A A;  1S6O A;  2KT2 A;  3QJP A;  2IHR 1;  2B43 A;  2NXU A;  3VAH A;  4LFB J;  1T9W A;  4PQU B;  2MQN A;  3GB0 A;  5BR8 J;  3LGM A;  3BN7 A;  1BQN B;  4ED0 A;  4WU2 A;  1IUJ A;  2QEX S;  4NRU A;  2NUH A;  4BCA A;  4GKJ F;  2EK6 A;  2ZC3 A;  3MR7 A;  3BSO A;  1J27 A;  1CS4 A;  3V6J A;  1F3F A;  2R2S A;  2WSE C;  4PPD A;  2K7K A;  3TAN A;  2YQ3 A;  3AFG A;  1IM6 A;  2V9K A;  3ULH A;  2VG7 A;  4NI2 A;  2DB1 A;  2J6S A;  1HAR A;  2XMA A;  1RWV B;  5CZV A;  5CXT A;  4KV8 B;  4LVN P;  1UVJ A;  3P96 A;  3QIP B;  1QVG R;  2MKI A;  1HWI A;  2JDJ A;  3EGV A;  4IG0 B;  4B3S F;  1VBK A;  3V6D B;  4IRD A;  2EG2 A;  4RW4 B;  1KP6 A;  1R0A B;  3CCQ S;  4X4P A;  1R43 A;  1Z2Z A;  5K8M A;  2QL5 B;  1WEZ A;  1ZM9 A;  5B0C A;  2F63 A;  4UOH A;  4LF8 J;  3ZTS A;  5DDP C;  1RHJ B;  4CLY A;  1VQO S;  4JV5 J;  3TAR A;  1L3U A;  4AE5 A;  2UUB J;  1WOS A;  4OI3 A;  2CVI A;  3SDE A;  3VGT A;  1VYA A;  3BPD A;  4OIX A;  2M3D A;  4DSL A;  3X3U A;  1LWE A;  1MRO B;  2VG6 A;  5M2U A;  3CCR S;  2VF3 A;  4YME A;  3RUB L;  4C4W A;  3GSD A;  3CJS A;  3KLF A;  4AUK A;  1T9T A;  2AEF A;  1B0T A;  2H9Z A;  4CO4 A;  4X4Q A;  4OZN A;  4DV4 J;  3N9U C;  1W25 A;  2DY9 A;  2MY7 A;  4DL3 A;  2CAJ A;  3SSQ A;  4DMZ A;  2BQU A;  1X9S A;  5IC6 B;  2ZHO A;  2QLF B;  2WHO A;  4PG8 A;  3GFX A;  2R7O A;  3GCX P;  3B6B A;  4ZVT B;  3OBI A;  4WPA A;  4PG6 A;  4PQA A;  2V50 A;  4LRE A;  1S4E A;  4LFA F;  3A13 A;  3NL0 A;  2RQK A;  1NME B;  2AJF E;  1TFW A;  5I42 B;  1DLO A;  2PSZ A;  2YWH A;  2KJV A;  4M5H A;  5HN0 A;  5DJB A;  4DUT A;  1CJK B;  3FSI A;  3C15 B;  4WXO A;  1X4G A;  4F7V A;  2DO0 A;  3KJN B;  3KUG A;  3V81 A;  3LUY A;  2GIQ A;  4O3P A;  3TZZ A;  2FY8 A;  1RJJ A;  3DOK A;  5DG7 A;  2IPO B;  5C24 B;  2W4P A;  2BJ8 A;  4TU7 A;  2IVF B;  1GT8 A;  1EAR A;  4P10 A;  1TV6 B;  2YKM B;  2MDA A;  4RR5 A;  3KK1 B;  2BAB A;  1NAQ A;  2BW7 A;  3IP0 A;  3UCG A;  3FCH A;  2HIQ A;  1UPP A;  1HWL A;  2E9R X;  3Q8S B;  4OZ3 A;  1Y5L B;  3EDR B;  2ZHA A;  3KLG B;  1LNQ A;  1TK5 A;  3CJQ A;  3Q8V A;  2XI3 A;  2W8K A;  4RWW A;  4F67 A;  1R8H A;  1SKR A;  4X66 J;  3V4I B;  2JZ5 A;  1ULR A;  1M1K T;  3MEK A;  4A8F A;  1Q82 T;  1SJQ A;  2A18 A;  3BDP A;  4CNZ A;  3I87 A;  4IOB A;  1PG5 B;  2K8G A;  4P2X A;  1N5V A;  5GAH I;  3PVX A;  3IWN C;  1S1V B;  1G4C A;  3NGD A;  1JKH A;  3A8K A;  1JXE A;  1TKT B;  4ZPW R;  1AA1 B;  3JTP A;  2A3J A;  3H5U A;  4C6A A;  1ZM2 A;  4I67 A;  1OY6 A;  3MAH A;  3IGN A;  2WK4 A;  3QFH A;  3KLH A;  4K59 A;  3VQT A;  4J9R A;  2VG5 A;  2U2F A;  4KTQ A;  2FYX A;  1TAU A;  5DET A;  4WBF A;  1BWV A;  4P7V A;  3KG0 A;  5KFB A;  3SYZ A;  1S1U B;  1XC9 A;  3J81 U;  4OYA A;  1UKU A;  4PWW A;  1VBX A;  3BKF A;  4UF4 A;  4K4T A;  4F4A A;  3AA9 A;  4LBH A;  2QV6 A;  1GQE A;  4WK1 A;  1XMB A;  3OTE A;  1VIO A;  1CC7 A;  3JTO A;  4DOZ A;  2NSB A;  2EEY A;  3P8B B;  4ZP7 A;  2LA4 A;  1Q8I A;  4CIO A;  3G8T A;  3GYN A;  4KJI A;  2C2O B;  4X65 J;  1S1T B;  3ZZR A;  2WB1 D;  3ENQ A;  5A8K A;  3HHL A;  2ZC4 A;  3L09 A;  4XPC A;  1W7W A;  3TI0 A;  1LWX A;  2M4M A;  4WE1 A;  1RTZ A;  4XDD A;  4KPY A;  3J7A 1;  4DSE A;  3D1Q A;  1B0V A;  1RT5 B;  2W7P A;  2HVH A;  2GAG C;  2YXL A;  2HAI A;  4OHX A;  4RNM A;  3IBW A;  1D3W A;  2B3T B;  1U02 A;  4TN2 A;  4LIR A;  3EGW B;  3DYA A;  1G7C B;  4ZOS A;  1U6Z A;  4LF7 F;  2BE2 A;  4PEO A;  1UMJ A;  2ZOG A;  1DTT B;  3CIZ A;  3TAM A;  2X1A A;  2QE5 A;  5CHC B;  1HIY A;  1M5V C;  2FVP A;  1BD6 A;  1DHM A;  1A7G E;  1RYS A;  2P6S A;  1VC0 A;  3LP2 A;  1XQI A;  4DQQ A;  2VBX A;  4ES3 A;  1VOM A;  5BYR A;  2ZH4 A;  2H48 B;  5HI7 A;  2B8Q A;  5E2Q A;  4K2J A;  4B3M J;  2PMZ D;  1WEY A;  1GTH A;  1N5T A;  4QR1 A;  1SJF A;  3ONQ A;  1O6X A;  4P2M A;  2BV3 A;  1R6Y A;  4DR3 F;  1OS5 A;  4PUO A;  2E44 A;  3FNN A;  5HAT A;  4L3K A;  1TUV A;  1QAJ A;  1WC0 A;  3L9Z A;  3OXF A;  2E5L J;  1AZS B;  2OPS B;  4UOF A;  1XER A;  4NL5 A;  3D1O A;  1RT7 B;  1IWG A;  3KJV B;  3CCV S;  1MN7 A;  3N01 A;  2C3O A;  2MB0 B;  3MMA A;  1T3N A;  1HQE A;  3L3C A;  2FVS A;  1BLU A;  2CPZ A;  2OD4 A;  3BQ0 A;  1NM2 A;  1U7L A;  3UVJ B;  2ROP A;  1DJ0 A;  3L95 X;  2IM1 A;  2EBG A;  1EET B;  2W2M P;  4A4J A;  4YHH F;  4J9N A;  4WU3 A;  4ILR A;  2W9C B;  1I94 F;  2Y0S D;  4C11 A;  3OLB A;  3T5H A;  4FF2 A;  3QGI A;  1IVZ A;  3M30 A;  2XHW A;  3IN5 A;  4M5N A;  2R8K A;  3IA0 A;  1H2V Z;  1H73 A;  2FJA B;  2UUT A;  2YNH B;  3G4S S;  4NXN F;  4TXS A;  2OFH X;  3DFE A;  3I31 A;  2R7V A;  3MXH P;  3VGV A;  2CPE A;  4R0E A;  2IJF A;  3CDB A;  3FK4 A;  1YIJ S;  1N34 F;  5KFP A;  1U0H B;  3K8V A;  1NPK A;  2XSJ B;  4AL7 A;  2B7B B;  3VVU A;  1UVI A;  2P9G A;  1SB6 A;  3N6N A;  4PG5 A;  1YJ9 S;  3LP1 B;  4MTP A;  5J2M A;  3DMJ A;  1AXQ A;  2O67 A;  4OYW A;  5KT5 A;  3OTO F;  3HDS A;  1NKE A;  3CGI A;  1JLF B;  3I5A A;  2UV8 G;  2JH3 A;  1F9E B;  2XUL A;  4IH6 A;  2PO4 A;  2ZKU A;  1VHI A;  3QRR A;  2V4Q A;  1M0S A;  5B08 A;  3VAM A;  3F41 A;  5M2P A;  3K58 A;  3QRP A;  2YWW A;  1ZOT A;  3ET6 B;  1QAY A;  5CQG A;  5GAH U;  4PQU A;  3R5G A;  4CO0 A;  5JUM A;  2GO9 A;  2F5G A;  1IXK A;  1BQN A;  1GXT A;  4OHW A;  4C48 A;  1YJR A;  2QJ3 A;  3PNI A;  2CJX B;  4E2F B;  1H0H B;  2IA6 A;  1NSQ A;  3AOB A;  2VZ9 A;  3IRX B;  3KMS A;  3SIP B;  5DLF A;  3NMR A;  2PA3 A;  3LW5 C;  2CQ3 A;  2MZJ A;  4K5S A;  3K5P A;  1ZAW A;  2F4V F;  2RDD A;  4KV8 A;  1TL5 A;  2DXF A;  1ZTT A;  3QIP A;  3H5X A;  1VS3 A;  5HMZ A;  4HH1 A;  2D9O A;  4IG0 A;  1D9F A;  1RI7 A;  3V6D A;  3PYG A;  2YKQ A;  2MTL A;  4RW4 A;  1R0A A;  1PJ5 A;  1T05 B;  2XMK A;  3D6T B;  5KG3 A;  3GLJ A;  4QIF A;  3H0P A;  4CQ1 A;  4I6W A;  2W4C A;  2DHG A;  4Y2C A;  3C19 A;  5F8G A;  4BS2 A;  3H2U B;  2ZH9 A;  5B0E A;  3KHH A;  2FHO B;  4JI7 F;  1NHK L;  1MRO A;  2RS8 A;  4UZC A;  2IFX A;  1S0O A;  4RBU A;  2CJY B;  4NLS A;  1NH8 A;  3EPG A;  4F3Q A;  1V3R A;  1KD1 T;  2FZC B;  1TVR B;  3NGR A;  1X0P A;  5KFU A;  5A76 A;  2BZ2 A;  4LIW A;  5IWA J;  4B17 A;  2RSQ A;  4EBC A;  4JYA F;  1WC5 A;  1X7V A;  2LDI A;  3NGS A;  2ALY B;  4I6Y A;  2L9N A;  1FFG B;  4Q45 A;  4XK8 C;  2MZQ A;  4QCL A;  4ZMM A;  1SH2 A;  4FZV A;  2OD6 A;  2F7V A;  3KMQ A;  4RBT A;  5KT4 A;  5I42 A;  3BO3 A;  2I9S A;  1ROF A;  3T6J A;  2EFP A;  2QRR A;  3R1H A;  1RHK B;  2XYG B;  2QT7 A;  4P6Q A;  1CJK A;  3C15 A;  2F1F A;  1HHQ A;  4ER8 A;  2X1F A;  4XDC A;  5T7L B;  2J8S A;  3S01 A;  2A6M A;  2HBQ B;  1H72 C;  3GPA A;  3MDF A;  3DDK A;  1REV B;  3PIO Q;  3MUR P;  1QTN B;  5C24 A;  2POK A;  3KHR A;  3HHL D;  3TR5 A;  2M5Y A;  2HQF A;  3BPS P;  1TV6 A;  2YKM A;  4HVZ A;  1CG2 A;  3KK1 A;  4DV1 J;  3H5S A;  1U26 A;  3HPO A;  3CJ3 A;  2P9E A;  2O3D A;  4KR0 B;  5EN1 A;  3S6E A;  3M8R A;  2AKW B;  4NLU A;  1TP7 A;  1UVL A;  2IBK A;  2NCK L;  4RJV A;  1IQZ A;  4CCH A;  2RUS A;  3KLG A;  4Q8F A;  4DFK A;  4Q7A A;  1XNR F;  2W7A A;  2WAQ D;  3T5J A;  2DNH A;  4B9L A;  4KH1 B;  2MMY A;  3HD1 A;  3V4I A;  2O5D A;  3IWL A;  2UVU A;  1K9M T;  2J6U A;  5HP1 B;  1ZAV A;  3SCJ E;  2XMV A;  3DXS X;  2UXD J;  1VK8 A;  4I68 A;  2AJQ A;  1S1V A;  2HZA A;  5JVH Q;  3ITH B;  1TKT A;  3POT B;  4O0N A;  5ETS A;  3VGU A;  1BHN A;  3DRY A;  4U7U K;  4KGX B;  3B78 A;  3ENA A;  3CDU A;  1B7Y B;  5EWF A;  5F41 A;  4JI5 F;  1BUX A;  2N7C A;  2ZFH A;  3GU0 A;  3HVA A;  4L76 A;  3BBB A;  2Z2L A;  4PRF A;  4K2X A;  1YRT A;  3QT8 A;  3HI9 A;  3MEE B;  1S1U A;  1HPZ A;  3NGU A;  1UJ4 A;  2I38 A;  1JLA B;  2BXJ A;  4RUC A;  2MLX A;  2HHW A;  2MLY A;  4NYZ A;  4K4Y A;  1Z4U A;  4F4Z A;  1NKB A;  1KQF B;  4V1A k;  2RKI B;  3MED B;  4NRT A;  1Q0N A;  3OFE A;  4DWI A;  4ECX A;  1S79 A;  2EKN A;  2H51 B;  4NOH A;  4ZN1 A;  4W92 B;  4PPZ A;  1S1T A;  1EJ7 L;  4RW7 B;  3BRE A;  1TEL A;  3EJM A;  3MM9 B;  4DXL A;  1IJE B;  4CRJ A;  3MFI A;  5KOW A;  1YX2 A;  1GAO A;  1NHV A;  3LH2 S;  4EBE A;  4DCO B;  2DNO A;  2MGZ B;  3W8G A;  3AQP A;  1RT5 A;  1ACM B;  3G6E S;  3CJ4 A;  3A12 A;  3RBX A;  1Q7Y T;  5KG1 A;  2HWH A;  3M1V B;  5GAD I;  2KZM A;  2O66 A;  4WKR A;  4G1I A;  1VQ9 S;  1P27 B;  1KFD A;  2QA4 S;  4IG3 B;  3W9J A;  3NRB A;  4F0M A;  5GAE I;  2B8P A;  4C8O A;  1T02 A;  2ZM6 F;  4LRB A;  4B9N A;  4JB8 B;  2W24 A;  3M8W A;  2YH0 A;  2OJ3 A;  4MK7 A;  4LQ9 A;  3CJ0 A;  5IQ6 A;  1DTT A;  3CCU S;  1T0T V;  4OZJ A;  1QDU B;  3D67 A;  2FHJ D;  1RWM B;  5IT9 Y;  4ZVS B;  3KXD A;  2B9Y A;  5E3R A;  1HMV B;  4ZLJ A;  3IC1 A;  3R1L A;  2QYG A;  3JSM B;  1ZZN A;  5DZ7 A;  8RUC A;  2CNL B;  5AXN A;  4ZVO B;  2R2U A;  2JEF A;  2I8E A;  2X1B A;  3HSZ A;  1U1O A;  3QBC A;  1UVM A;  2J9D A;  3FQL A;  1UFL A;  3KLI B;  3SV3 A;  1AZS A;  2OPS A;  2NPF A;  1NDP A;  4DPY A;  1RT7 A;  3KJV A;  2LQJ A;  4I2Q B;  3Q23 A;  2FZK B;  1D0E A;  2CQC A;  2J0Q D;  1Y5I B;  2QG9 B;  4DR5 F;  1JQG A;  5KFD A;  2F8E X;  3IAM 9;  2CXE A;  5KFX A;  4QIV A;  1KBR A;  2C2N A;  3UVJ A;  1E6V B;  1EET A;  1UPM B;  3W3S A;  2W9C A;  2IMO A;  2GMJ A;  4IH5 A;  4FYX B;  1N4L A;  2ZWO A;  1PSD A;  3Q83 A;  4ZPV R;  4KGV B;  3P6Y C;  3HVR A;  4LRC A;  2APO A;  1PBA A;  2UXC F;  1YK9 A;  5L1K A;  5ETO A;  4XPE A;  4FKY A;  3OHA A;  2YNH A;  3U02 A;  7AT1 B;  4UOG A;  4A46 A;  3F56 A;  2F9J A;  4IKA A;  1AT1 B;  5GME A;  2C2M B;  5LSL A;  3NNA A;  1KR4 A;  2L3M A;  1N6Q B;  1KVK A;  1N0U A;  2ZBR A;  1S1W B;  1RTH B;  1U0H A;  2XSJ A;  1RHR B;  2IDL A;  4JV2 A;  2E7V A;  3LP1 A;  1L5U A;  1REG X;  5L38 A;  2D9P A;  4DR6 F;  1SIW B;  3JSY A;  4KHR A;  3NLC A;  1JLF A;  1EP4 B;  1WF0 A;  4R0J A;  3KWM A;  3UDV A;  2W2P P;  2MZT A;  3HHN B;  5DLG A;  2ZIT A;  3BGU A;  4ELU A;  4M5I A;  2FJE B;  3HKW A;  3RTV A;  4O4R A;  1FKP B;  2XGQ A;  3HSG A;  1L3S A;  3KK3 B;  1KQS R;  2DD8 S;  2VQE J;  1KEK A;  2KL8 A;  3ET6 A;  4ZCK A;  3T9N A;  3GG0 A;  4P73 A;  5KFO A;  4ZLL A;  2H65 B;  5ADZ A;  1FCA A;  1VRQ C;  1RKJ A;  2ZVS A;  1ITP A;  2H5J B;  2RRN A;  1YGY A;  2IC3 B;  4JI0 F;  5KG7 A;  3EMT A;  3IRX A;  3FBC A;  3CD0 A;  3P4U B;  1YKW A;  4LF4 J;  4LF2 A;  1M90 T;  2H3E B;  4MJK A;  2G1H A;  4URQ U;  1RT1 B;  4LSL B;  3D6M B;  4DQP A;  4UOC A;  2E5J A;  2F4F A;  4IO9 Q;  4ECW A;  2RRA A;  1HNZ J;  1KQK A;  4YR0 A;  3K5N A;  3OR2 B;  4F26 A;  4R5P B;  1DZ5 A;  2AJ0 A;  1FE4 A;  1T05 A;  1TKD A;  1QUV A;  3ZZY A;  3EE3 A;  1UWA A;  2IAJ A;  2BQR A;  3RYL A;  3NNC A;  1T8E A;  1CC8 A;  4GVB B;  2KYX A;  2LXF A;  5AT1 B;  3R5D A;  3U1M A;  3ZTR A;  2XB2 D;  3AJ1 A;  3NWR A;  2V4R A;  1RHM B;  4ED6 A;  1B3T A;  2AP6 A;  4OFZ A;  5E3P A;  5ITH A;  1YVF A;  3NOC A;  4I64 A;  4QU7 A;  2CPF A;  2RQC A;  4NLP A;  2VQF F;  1DUR A;  2HWI A;  5CD4 A;  1HA1 A;  2B4V A;  4FYY B;  5E3C A;  1BGX T;  1KTV A;  1I1G A;  3VAF A;  4OYI A;  3AJ2 A;  1FNO A;  2WCX A;  3T1H F;  5EGY A;  2DIV A;  1TVR A;  3MPU B;  4EMD A;  1Y10 A;  2I1R A;  2BRL A;  2LCW A;  1V6H A;  4F02 A;  2F8H A;  1BQM B;  4MKV A;  4KPC A;  1SJR A;  2V8V A;  3UCZ P;  3SEO A;  1DAR A;  2RE1 A;  1YRU A;  4JI4 F;  5LL6 d;  1OMS A;  4KAI A;  2DH9 A;  4Y28 C;  4O3O A;  3TA1 A;  1ARO P;  4M63 A;  3Q8U A;  1XMO J;  1V9O A;  2MHN A;  1D1U A;  5KFY A;  3D9B A;  1SI9 A;  2VKZ G;  4AYB D;  1RLD A;  2C2E A;  2DNY A;  2NXN A;  1S0N A;  4Y3C A;  5T7L A;  2HMI B;  3THP A;  2YQ0 A;  4DR7 F;  5C5J A;  1FT8 A;  3HCX A;  1SUQ B;  4OJ1 A;  1S76 D;  2XGP A;  4ZCL A;  1CQN A;  1QD1 A;  1REV A;  1YJV A;  1AFI A;  4LR8 A;  2HRU A;  4WFN Q;  5F0U A;  3J7Y U;  3RW6 A;  4TLR A;  1YJW S;  2CG4 A;  4H4K A;  1Q8L A;  5C2C A;  4KHP F;  4Z7Y A;  3OTB A;  3DOM B;  4J5O A;  2C3M A;  3D28 A;  1IJF B;  1PKU A;  3A3P B;  3P49 B;  2MKJ A;  3EVM A;  2GVZ B;  2L9W A;  1VCT A;  5CZX A;  4P2F A;  3JQK A;  1SQF A;  2GX8 A;  4M5D B;  1OYD A;  1RT3 B;  2D3O R;  2ZBI A;  3OT9 A;  3G71 S;  5LMU F;  1HR0 J;  3W63 A;  1T11 A;  3JAM U;  5HP1 A;  1LEO A;  2RUG A;  5KFM A;  1W2I A;  5SUH A;  2C3Y A;  2FQQ B;  1D8Z A;  3HM9 A;  3CCL S;  5F8L A;  1RWK B;  3ITH A;  2BKO A;  2HZV A;  2GIR A;  4TLQ A;  4RBV A;  4NA3 A;  5BXI A;  2U1A A;  1LKZ A;  2QA1 A;  3R3T A;  2JWN A;  1H38 A;  1FX4 A;  3BYP A;  2DJW A;  3PJ9 A;  2FB0 A;  3GJT B;  2DXD A;  1M5O C;  5AJ3 F;  1LXN A;  3Q22 A;  4H4K C;  1F2H A;  3DHW C;  3MEE A;  4USI A;  2ROE A;  1K0T A;  9ATC B;  1TR0 A;  1VLO A;  3A8E A;  1RIS A;  2QLW A;  3O44 A;  1JLA A;  2VV5 A;  4QW8 A;  4DX8 H;  1LK7 A;  1YRX A;  3NCR A;  3PDN A;  2RKI A;  3MED A;  3R5B A;  2DRA A;  3PIP Q;  2CJK A;  2JC0 A;  2IA0 A;  5KFT A;  1HNX J;  4I0W A;  2YNF B;  4LFB F;  2N82 B;  4USM A;  2ZH1 A;  1QTM A;  4QYZ K;  4LQ3 A;  5BR8 F;  4RW7 A;  4F25 A;  2YKP A;  3MM9 A;  5GAG I;  3CJ8 A;  1UEV A;  4B02 A;  1O8B A;  3OUY B;  1F6T A;  5THW A;  4PXC A;  1VQK S;  2B9W A;  2MGZ A;  2CQ1 A;  2CPI A;  2DRD A;  3CF5 Q;  4K4X A;  3MMC B;  4NE9 C;  4KE5 A;  3M1V A;  2RIJ A;  5HLF B;  2CKW A;  4DQS A;  2KTQ A;  2X7I A;  3WIU A;  2YWF A;  3GIJ A;  4IG3 A;  3DM2 B;  1ZTW A;  1RXO B;  2OAU A;  5DQI A;  2OEK A;  4Y65 A;  3WDO A;  2VDI A;  5L1L A;  2DNN A;  4KSE B;  3R6L B;  1FXR A;  3HO1 A;  2C2K B;  2MSS A;  1FJG J;  1YJU A;  2FJD B;  4HAC B;  2B9X A;  2Z0G A;  4X4N A;  2DNK A;  4WWS A;  4HDG A;  5HAN A;  4LF8 F;  1N54 B;  3AJD A;  1HMV A;  5EWG A;  5CYM B;  5E5N A;  4A8Q A;  4YB5 A;  3JSM A;  3HF5 A;  3OSN A;  2IYI A;  3OLA A;  3OL8 A;  1FXL A;  3QQC D;  1S5Z A;  2HGL A;  4JV5 F;  2J0W A;  1JMT A;  3CJ5 A;  3F0N A;  2UUB F;  2FDN A;  2V67 A;  1WHY A;  3GFY A;  3DN9 A;  1Q7L B;  2XY6 A;  2IM2 A;  3BB5 A;  4ZVQ B;  2XI2 A;  5JMN A;  2M0G B;  3KLI A;  1F5B A;  2M52 A;  3LF0 A;  1HYS B;  4B3R J;  1MLA A;  4DUZ J;  3AB4 B;  1VHF A;  2GHP A;  1LQ9 A;  4I2Q A;  3DC2 A;  2WW4 A;  2ADB A;  4OLP A;  3MD3 A;  4DV4 F;  2DKO B;  2ZH8 A;  1Y9O A;  1UEU A;  2GHW A;  1N0V C;  4IUF A;  4Y2I A;  2Z30 B;  2DGV A;  1E6V A;  4ELT A;  3VAJ A;  1HQU A;  3NOG A;  3M9M B;  4LRA A;  4PXE A;  1Z1Z A;  1VFJ A;  3C6T B;  1T9U A;  2FLO A;  3W65 A;  4FP9 A;  1X8D A;  2AJ2 A;  1JJH A;  3FUY A;  2ALZ A;  4K8R A;  1NJZ A;  2UU9 J;  3QZ8 A;  1NPR A;  3TVY A;  3QO9 B;  4D3G A;  2RHQ B;  1ZH5 A;  3RRK A;  1HHS A;  3D1H A;  3VGS A;  1C1B B;  3JQM A;  3OSP A;  1GNK A;  2DR6 A;  1N6Q A;  4DV6 J;  1S1W A;  4QJV A;  1RTH A;  4TY8 B;  1N8R T;  2A2C A;  3ISN C;  2LU2 A;  4DHV A;  4IQM A;  2W2N P;  3CO9 A;  4OHV A;  4HTJ A;  1S1X B;  4F2R A;  2K3I A;  2BA9 A;  1EP4 A;  1QAX A;  2WB4 A;  1OPI A;  2XMW A;  2OSR A;  1FK9 B;  4OX9 J;  4DFJ A;  2MKS A;  3D68 A;  5K5M A;  1FKP A;  1ZS6 A;  3KK3 A;  4NZ0 A;  3I0S B;  1Q78 A;  1F5A A;  2AF6 A;  4PAA A;  4X66 F;  2DGU A;  3EZO A;  4RNO A;  3P45 B;  3CCM S;  2JLG A;  2E5H A;  2XWY A;  1OY8 A;  2BKP A;  5J2N B;  1Q53 A;  4UQG A;  2B56 A;  5K8N A;  3B4D A;  3KKF A;  3KDO A;  4ED5 A;  4LSN B;  2BJ7 A;  2IC3 A;  4G1P A;  3CJ2 A;  4IOC Q;  4Q5V A;  1I3O B;  5KG4 A;  3ILO A;  2HVZ A;  3I32 A;  1W2B R;  3BM7 A;  4DI6 A;  2UZA A;  5CCL A;  1FVQ A;  4MYT A;  1WKK A;  1N5S A;  1RT1 A;  1QM9 A;  4GC7 A;  4QIG A;  3IO1 A;  3PX0 A;  4LSL A;  3IAS 9;  1RAI B;  1KKH A;  3H7H B;  1CJU B;  2Y0B B;  1HW9 A;  3D2W A;  4G1Q B;  3HX9 A;  3IM8 A;  2G9O A;  3OR2 A;  4HR2 A;  4PWU A;  4A47 A;  2CA9 A;  4R5P A;  2ZM6 J;  1S0V A;  3FEX B;  3RU0 A;  2M8D B;  5ETQ A;  2QN6 B;  1HWJ A;  4U95 A;  3HT3 A;  4CLS A;  1RAA B;  4GVB A;  3SSS A;  3MM5 B;  2UUC J;  3EIC A;  2H4Y B;  2JFK A;  3HT0 A;  3HJV A;  1PAU B;  1N33 J;  5RUB A;  3W61 A;  1MN9 A;  2R2R A;  2W9B B;  1NDL A;  3MTJ A;  4X65 F;  5LXR A;  3TUZ C;  4DN9 A;  4PXD A;  3PYE A;  4UUX A;  1XR6 A;  1ZM3 A;  2ACY A;  3K5L A;  4LVO P;  5CAB A;  5HL7 Q;  2DVI A;  2XEX A;  4RNF A;  1YHQ S;  4DQI A;  2RT3 A;  3PRB A;  3MR3 A;  1BQM A;  3CJR A;  2G1D A;  3FZB A;  3M2U B;  4QPX A;  2W25 A;  1T7P A;  2C2D A;  1NSP A;  2HHP A;  2BMB A;  1NK8 A;  2YNG B;  2HFN A;  1KS2 A;  2IJN A;  4LUB A;  3HJF A;  2UXB J;  4WXW A;  3OVS A;  2VH7 A;  2YWE A;  5DG9 A;  4FXD A;  3MI7 X;  4JI3 J;  1K44 A;  1XJW B;  4NEZ A;  2XO7 A;  3M7V A;  2HMI A;  4X4O A;  2D3Z A;  4L72 B;  2JJ4 D;  1SUQ A;  4B3M F;  3H42 A;  2DH7 A;  5KG5 A;  1FRK A;  1QY7 A;  4JI1 J;  1HFE L;  2I0X A;  2E7W A;  2E5L F;  3DOM A;  2Y1R I;  3TJ9 A;  4X62 J;  4AL5 A;  4DV0 J;  2V5H G;  1FEH A;  1KC8 T;  3OXG A;  4K4S A;  2EC0 A;  4M5D A;  1RT3 A;  2AYM A;  2KN4 A;  1Q79 A;  3GE9 A;  2GO8 A;  6FDR A;  1M1G A;  4ELV A;  3TQE A;  3M9N B;  2DNR A;  1VBY A;  5DZ6 A;  4WIQ A;  3MTK A;  3BH6 B;  4ILM A;  1NSK L;  3R7B B;  3T1A A;  3CXC R;  4ECS A;  2OPP B;  1NDC A;  3TUI C;  3Q8R B;  1SKW A;  1J5E J;  1A9N B;  1MMN A;  3AY0 A;  3T5K A;  3RW7 A;  3SCL E;  3AAW B;  1FRJ A;  2JHE A;  3KJF B;  4JBC A;  3C6U B;  4V19 J;  3H2L A;  1GX5 A;  1RHU B;  2HHX A;  3ZZU A;  4OMF G;  2DIU A;  3FBB A;  1W26 A;  1E6Y B;  4A8W A;  1H98 A;  3CD6 S;  3P5B P;  2XTJ P;  1U8W A;  2DCU B;  2ASJ A;  4MKA A;  1IN0 A;  4KQZ A;  2AT1 B;  3EZU A;  3UCU P;  4ECV A;  1N32 J;  3MOJ B;  4E98 A;  2XZD B;  3CE8 A;  4ZP6 A;  1PIE A;  3DHX A;  4TVA B;  2EC2 A;  2YNF A;  3B82 A;  3QMQ A;  2RD5 C;  5IZH A;  1LWF B;  3VVT A;  2FHK A;  4FYV B;  1XK8 A;  4CH1 A;  2AGP A;  4DUY J;  3OTD A;  3OUY A;  2HHS A;  2GQ2 A;  5B0D A;  4MT1 A;  1H6K X;  1KVJ A;  4I69 A;  1GXL A;  5AE1 A;  1IKX B;  3MMC A;  1U1P A;  3DGV A;  2J8A A;  2W7O A;  5HLF A;  1SC4 B;  2R8J A;  1SC1 B;  1NHU A;  4QWD A;  2VFV A;  3MUT P;  3DM2 A;  3G6Y A;  4NXM J;  6FD1 A;  4UUW A;  2RQM A;  1NK6 A;  3LPE A;  2RDI A;  2R8I A;  3ILI A;  1X4B A;  2BKN A;  3MWB A;  3RAQ A;  4HAC A;  4ECQ A;  1N48 A;  4CO2 A;  2NZ4 A;  4DV7 J;  1XNQ J;  5CYM A;  5JJB A;  2XNQ A;  3PW7 A;  2V8G A;  5FLX Y;  3UI3 A;  2HK2 A;  4ICL B;  3RBD A;  1WTB A;  3C46 A;  4OQJ A;  4F8R A;  5D0G A;  3G9C A;  5ETP A;  5J2Q B;  3W60 A;  1LXJ A;  4GO5 X;  3M9O B;  4NA1 A;  3H59 A;  4PKD B;  1HYS A;  1KLM A;  3K0J A;  1HBM B;  4KRW A;  3IR7 B;  3DNC A;  1RA6 A;  1S9G A;  2BW2 A;  2NXE A;  1NK0 A;  1FTR A;  5IWA F;  1UL3 A;  2GQQ A;  4XTT A;  4ZLN A;  4PXB A;  5HAO A;  4DX6 A;  3N6M A;  4IFY B;  5A2Q Y;  3ZTQ A;  2XO6 A;  2IVM A;  4DPT A;  2ZD1 B;  2IIH A;  2XG8 A;  3C6T A;  1H3D A;  1H2T Z;  1VRU B;  3GV7 B;  1S97 A;  4QIE A;  3C2P A;  1X9W A;  5DS7 A;  4FKX A;  3H20 A;  1FO1 A;  4DQR A;  3OFH A;  1L3K A;  3SMZ A;  1C1B A;  2CFX A;  4ETX A;  4ENO A;  3NMA A;  3R8Y A;  2QLX A;  3LP0 B;  3MGJ A;  2JOQ A;  2MKC A;  2FVR A;  1Y0H A;  4EUV A;  4C8K A;  4TY8 A;  2AZ3 A;  4HHH A;  2LXU A;  3Q8P B;  3BDE A;  4P9S A;  2VBY A;  1OQ6 A;  1S1X A;  4FYW B;  4DV1 F;  1O0P A;  4U7U D;  2C2Z B;  3W1Y C;  2VJU A;  2ROG A;  1U1Q A;  2Z2M A;  1UJ5 A;  3GR0 A;  1IQT A;  4EWT A;  1UFK A;  2M70 A;  4FPR A;  1FK9 A;  2IYG A;  3KHL A;  4NYO A;  2ZOM A;  1U09 A;  4JOU A;  2N3O A;  2D3U A;  1RWW B;  5CD4 H;  3I0S A;  4DLE A;  2HND B;  3GII A;  2C1E B;  3KJQ B;  2KRB A;  4OX8 A;  2BRK A;  5E3A A;  3BSN A;  3FEY B;  3MPD A;  1PJ6 A;  2BDP A;  1SL2 A;  3IR6 B;  4AD6 A;  3UD4 P;  3MUM P;  2UXD F;  1RAH B;  1S7I A;  3G6V A;  3Q8Q B;  1P9Q C;  5HJY A;  1IKY A;  5J2N A;  4OJG A;  2EFO A;  3GJR B;  2CDR B;  1YZ6 A;  4LSN A;  1SPB P;  1R0C B;  2NR0 A;  2D41 A;  1H2U X;  3KTQ A;  4ZJO A;  5A6W A;  2CVE A;  1WOP A;  3DKD A;  1RAO A;  5KFW A;  1QAI A;  4OHZ A;  4DS4 A;  3CCZ A;  1UEK A;  4E0D A;  1YIT S;  3PO5 A;  1TU0 B;  1BWE A;  3HUL A;  4K7Q A;  4H4M B;  1FRH A;  1PJ7 A;  2ZBC A;  1FDA A;  2HVD A;  2AX0 A;  1IBM J;  4XIU A;  2XLI A;  4O4G B;  3PX4 A;  4RO0 A;  1RYR A;  1CJU A;  2ZEJ A;  3BR9 A;  3R2C J;  4G1Q A;  1DTQ B;  5IV3 A;  2IM3 A;  2Y3Y A;  2DNG A;  4J9O A;  3PW2 A;  4JI8 J;  3NWG A;  1X4E A;  2F40 A;  1WI8 A;  1HBO B;  4NAS A;  4HLB A;  3OJS A;  4ECR A;  3THV A;  5D0E A;  5D0R A;  2Z4P A;  3HHE A;  4WYL A;  3MM5 A;  4NLV A;  3I55 S;  3CCE S;  1FDB A;  1IR2 A;  1WAC A;  3TQ1 A;  4LBI A;  3M6V A;  4DF4 A;  2W9B A;  1NPP A;  3KYL A;  1VMB A;  4DPU A;  1RWU A;  5CYQ B;  1DFD A;  4F3O A;  5F8M A;  3WC2 A;  5L8R C;  1RWN B;  3AOA A;  5KFQ A;  2N4C A;  2NRE A;  3VQS A;  3R97 A;  1MWZ A;  5KT7 A;  1RTD B;  3PFO A;  5I4M A;  4LF5 J;  4NLR A;  1RT4 B;  4ZPT R;  2VFR A;  1NEE A;  2DNP A;  1SVD A;  4P75 A;  4R25 A;  1Q5V A;  4N56 A;  3LO3 A;  3I82 A;  3ENV A;  4Y2A A;  3M2U A;  4DV3 F;  2MZ1 A;  2YNG A;  1WC3 A;  5D0H A;  5J1E B;  2BJ9 A;  4LBP A;  1PCA A;  4HL9 A;  2ZZT A;  2A0F B;  4ECY A;  1DRZ A;  1HBN B;  1WG5 A;  1KOH A;  1X4A A;  4YR2 A;  4UY8 T;  2Y8W A;  5BYQ A;  4FN5 A;  2YWG A;  2VD3 A;  3E01 B;  3AXK A;  3A8J A;  3GIK A;  3PW4 A;  2R7T A;  2R42 A;  2K2P A;  2QL7 B;  2CJQ A;  5IM0 B;  4RWX A;  4OI6 A;  4F4K A;  4QQB A;  3ZNJ 1;  2VFT A;  1WEX A;  4ECU A;  1X4D A;  1FNX H;  3AD7 C;  4NX9 A;  2HHU A;  2E1M C;  2GFF A;  2XC9 A;  1EB0 A;  4DLG A;  1RUS A;  2UVR A;  3MMB B;  1NO8 A;  4IO1 A;  4O44 B;  2LU1 A;  4KT0 C;  2VUG A;  1WG1 A;  2RB7 A;  5HMY A;  2E1A A;  3ICL A;  3QT7 A;  5A0Y B;  4NLT A;  4IRK A;  2M88 A;  1Q4R A;  4RU9 A;  2BJ3 A;  4FYD A;  3QT5 A;  2KG1 A;  4PAB A;  3JB9 k;  3CSK A;  5GMD A;  4DF8 A;  3MD1 A;  2CQG A;  2J6T A;  2ZWP A;  3VHQ A;  4YOE A;  2DNM A;  3DRP B;  3RAM A;  5KFF A;  1FDN A;  2LQ5 A;  4GVL A;  2WVB A;  4AQY J;  3QSY B;  8AT1 B;  3QID A;  1ZM4 A;  2CPJ A;  2OPP A;  2Z2Y B;  3R5C A;  3HZE A;  3ISZ A;  4DV2 J;  5E3Q A;  2XM3 A;  2A10 A;  1P1L A;  4MAK A;  1WC1 A;  3GFH A;  1S6P B;  1IWA A;  3NS7 B;  1FX2 A;  8ATC B;  2CPY A;  5IFM A;  2V4J B;  3TA0 A;  1URR A;  2HRY A;  3C6U A;  1X4F A;  2KG0 A;  3G82 B;  3EX7 B;  1ICE B;  3PKM A;  4IQX A;  1E6Y A;  2J7K A;  3MCM A;  2R4F A;  3AB2 B;  5GVQ A;  2HZC A;  2OH2 A;  2DIT A;  5DDO C;  4QBU A;  3NXZ A;  3GIM A;  3QZ7 A;  2CNK B;  3UWT A;  3OVA A;  3LGH A;  2OTJ S;  2JNJ A;  2DGX A;  1Q8B A;  4DG1 B;  2K06 A;  4DDF A;  2GHV C;  2N7Y A;  3SSR A;  2AJ1 A;  2VQE F;  4RUH A;  2AEM A;  1VGY A;  2HUR A;  1MG7 A;  4ZIT A;  4F4W A;  1D8Y A;  2ZH2 A;  3NBP B;  4NCB A;  2WVF A;  2DY1 A;  1LWF A;  1Q8K A;  2W8L A;  5GMK a;  5E41 A;  5H9E K;  4RLE A;  4HI1 A;  2YVS A;  4KIA A;  1DBD A;  3V5R A;  4WCE Q;  1DQ8 A;  5K14 B;  3OXL A;  2YPZ A;  4OX7 A;  3ZTP A;  5DO2 A;  3VR1 A;  5B0B A;  1EIY B;  2QC3 A;  2IBO A;  2GW8 A;  5LJ3 Y;  4IDK B;  1IKX A;  3CUN A;  4LF4 F;  3D3C J;  4CT8 A;  1K0V A;  3VAI A;  3SI8 A;  3D7S B;  2HFZ A;  2DGW A;  3ZZP A;  9RUB A;  3CWJ A;  1MML A;  2QLJ B;  2X1G A;  2YPY A;  3DDN A;  1X0F A;  5DM6 Q;  3FKB A;  3TEG A;  2GJI A;  4BC9 A;  1HNZ F;  3PM9 A;  2Q6B A;  2IRY A;  1AUS L;  4OYO A;  1T9X A;  2QMU B;  3KG4 A;  4RW6 B;  2WRM A;  2GAH C;  2CQB A;  1FTC A;  1TAQ A;  4LSZ B;  2ZE2 B;  4YB6 A;  3TUP A;  4L75 A;  3HVW A;  3DCA A;  2GNK A;  2RNE A;  1NB2 A;  3GMG A;  4CM2 A;  1U1N A;  1N88 A;  1HWK A;  2ERR A;  1SV5 B;  4IFV B;  1RA7 A;  4QPT A;  5KOX A;  4UZB A;  3LAK A;  3K89 A;  1FD2 A;  2UV8 A;  3UN5 A;  1WSR A;  3QSI A;  1S6Q B;  1UTA A;  2ILZ A;  5AXM A;  3QRQ A;  5J2Q A;  2HK3 A;  3HHL C;  3G87 A;  2DGT A;  2I5J B;  1FA0 A;  1RBL A;  1TQL A;  1TK0 A;  2BAN B;  1LFW A;  1HBM A;  1HL6 A;  5ETL A; 
#chains in the Genus database with same CATH homology
 1F3V A;  1F2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...