1WC5A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp in presence of bicarbonate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
193
Chain Sequence
MRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
molecule keywords ADENYLATE CYCLASE
total genus 55
structure length 193
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc5A00
2QV6A 3MAAB 4OYZA 4CLKA 3ET6A 4OYMA 1WC3A 2BW7A 4USWA 2GVDB 3MR7A 4P2XA 2WZ1A 4OYPA 4OYXA 3C14B 2W01A 5IV4A 1CULA 4WPAA 1CJUA 1U0HA 1CJKB 1CS4B 1WC0A 4OZ3A 4CLWA 4USTA 1CJTB 1TL7B 5D0HA 4CLTA 4CM0A 4OZ2A 1WC4A 5IV3A 4OYAA 4NI2B 4USVA 4CLPA 2GVZB 1YBUA 1CULB 4OYIA 1Y10A 1U0HB 1CJVA 4CLSA 4WP8A 3R5GA 1WC6A 3C15B 1CJKA 4P2FA 2GVDA 4CLLA 4NI2A 4CLZA 3G82A 3G82B 2GVZA 1FX2A 4OYWA 1Y11A 1YBTA 3UVJA 3MAAA 1CJUB 4OYBA 3C15A 5D0RA 1YK9A 5D0GA 1AZSB 1FX4A 1CJVB 3ET6B 1WC1A 4USUA 5D0EA 1CJTA 4CLFA 3C16B 3C16A 5D15A 4OYOA 4WP9A 1WC5A 1TL7A 4P2MA 4CLYA 4CLUA 3C14A 1AB8A 1CS4A 4WP3A 4CM2A 1AZSA 3UVJB
chains in the Genus database with same CATH superfamily
3D7SB 3DU6A 3BGLA 2AWZA 3KG4A 5I42B 3GV8B 4GMKA 3SDEA 1RAIB 3KNGA 2K7JA 2CNKB 1PCAA 4PXDA 2QG9B 4Q0BB 1VQ4S 1MNEA 3H2LA 5J2NA 4X4UA 1RAJA 4LJMA 3BGRA 5M2PA 1H6KX 1R6VA 2FUG9 4M5IA 5D77A 3ZC4A 4TLRA 2VQFJ 4QWEA 3T41A 3TZXA 3SYZA 2CAJA 3CDEA 3UO0A 1M1KT 2L9NA 4B9SA 2GC8A 4CCHA 4URQU 3GFXA 2WZ1A 4LF2A 4PQAA 1SPBP 1NO8A 2UUTA 3HXMA 2HRYA 4JI0F 4NWBA 3QRRA 4OYPA 5I3QA 2Y3YA 4NPOA 4AYBD 2LEBA 2E44A 3DHXA 3QWPA 5EX0A 1HI8A 3TP2A 3CMAS 4ID8A 4LIWA 2B5JA 4BS2A 2RKIB 3D4JA 2MEWA 3FBEA 3H7HB 4YHHF 1NSAA 2AX0A 3AB2B 2BUNA 4JP8A 4RW9A 4CH7A 3M6VA 5HQMA 3I56S 1APSA 3K89A 3M6UA 4RLEA 4MKBA 1ZH5A 2HNYB 5K20B 2B9YA 1IKWA 4IR9A 1VQ8S 3TX0A 1Q7YT 4LF9F 3C6UB 2P9EA 3J80Y 2VU5A 4NEZA 1PG5B 2MHEA 2Q79A 1YJWS 4NE9C 2NLWA 3TUPA 2ZH2A 3HSDA 3QWUA 1XR6A 5EN1A 2JFDA 2HWTA 3T1HF 4EU0A 2FQQB 1OQ3A 4DFPA 5E33A 4ZHRB 1M5SA 4N77A 3JSYA 2HLUA 4PKDB 3J7ZT 2DXFA 3EM1A 3ITHA 3WIUA 2XY6A 1LWEA 4KGVB 3V6KA 4KO0A 1D8ZA 2VG6A 1I94J 4XAKA 4ED0A 5CXTA 2XHWA 2KG0A 1NKCA 2IY5B 5DETA 1HBUA 2APOA 1E6VB 2RUGA 2YKNB 4L3NA 2BX6A 1K0TA 3KYLA 1QAIA 4C3KA 1V5IB 4PZVA 3D1QA 3KXDA 3GV5B 1T0TV 2C3PA 1S1XA 2IM0A 4AXJA 3NS6A 4DJBA 2HEKA 1R27B 1JLQA 3DOMA 1Z2ZA 2DISA 3G96A 3J7YU 2AKWB 2ZJQQ 4Q45A 5HP1B 2BW2A 2Q6BA 4OI0A 2ACMA 2RJZA 5J2MA 1REVB 2DGWA 1BMQB 2CQ2A 3BQ2A 4KFBB 2AZ1A 2WW4A 3JYTA 1RWKB 2CQIA 2I1RA 5D0RA 2XY7A 3J7YI 1SUQB 1NDLA 4D3GA 3NBPA 5D0GA 3ZTOA 1NKEA 1YRUA 5KG6A 4O3QA 5KAKA 2R8KA 2BV3A 2M2BA 3DRXA 4OX9F 4N56A 4C98A 2KH9A 1U1NA 4F2RA 5F8NA 2UVVA 1FX4A 5AXMA 4B3SJ 2RRBA 1IWAA 2M4MA 5K8OA 1HBOA 2DGQA 1Y4ZB 3IG1B 1QUVA 3QO9A 1N48A 1P27B 2KJVA 2LMIA 4ZP9A 1R31A 4BWMA 3HULA 3D3BJ 2FJXA 4C8KA 1F0XA 1N0UA 1EIYB 1DTQB 4RW6A 4O3PA 1FJCA 5J2MB 1OJ4A 1Y3KA 4RX6A 4DS5A 3HT0A 3OHBA 1NPRA 3PYDA 4LRCA 2NXCA 3CSKA 4PEOA 2D74B 6FD1A 7FD1A 1HYSB 2HSEB 4L76A 4R0JA 1MMNA 4ECYA 4CTAA 1LWXA 1S59A 2F40A 4USHA 2W8LA 4JI1J 4X4SA 2IFXA 1X9MA 1UZHA 1KVIA 1F9HA 3CTRA 3R9LA 3C14A 4WIIA 5L39A 3C3LA 5KFXA 3R2CJ 5U47A 1N52B 3LH2S 1G2EA 4PXCA 2A1BA 4IKAA 1RKJA 3L95X 1JX4A 4OYZA 1EB0A 3ENWA 2PSZA 3EUNA 1WEXA 2JSXA 2EKNA 4EFAC 3QIPA 2XLIA 4ECZA 2U1AA 1JKHA 4JI4J 2G2ZA 3T5HA 2MDAA 2B4OA 4KGMA 4MKYA 3KHLA 1LV5A 4PRFA 1IKYA 1RWNB 3H2UB 2KT2A 4IG3B 2CIMA 1YHQS 4WK3A 4XDDA 4OLOA 4A8SA 5BR8F 4DQPA 1A7GE 1U6FA 3WHIA 3IGNA 4ZLLA 3JSMA 4WZMA 1D0EA 4USWA 2KHCA 3UN3A 2ACYA 1EZZB 4Y34A 5ETSA 3MR7A 1C0TA 2GQCA 4OHYA 4DU8A 4UUWA 4DZDA 3R7NB 2GCFA 2UP1A 1J5OA 4ZPWR 3MTKA 2HHSA 4I2QA 4X62J 2RD5C 4NL5A 3DC2A 3ICLA 4J5OA 5GAHU 5HBMA 2HNDA 3TQEA 2V34A 5CZXA 1KQFB 3IFEA 1TKTB 1FDBA 4DSLA 2C2KB 3DOLB 1YTYA 4HDHA 4N8OA 5KG4A 4KE5A 2BE2B 2OPPA 1VQLS 3MR5A 1FKPA 4P7TA 4ZVRB 3HCXA 5D0HA 4FBTA 4CLTA 3HJFA 1WTFA 4BCAA 2QGFB 5IT0A 1KOHA 3HVWA 2CQDA 4PWDA 4WF9Q 1IKVA 2GIQA 3E01B 5FJ4A 5J2QB 1HW8A 2UVWA 1Q4RA 2I2YA 3OD2A 1TK0A 2R3VA 1RABB 3H59A 5HBMB 4ALZA 1R0AB 5HVGA 2XM3A 1RTIA 2BM0A 2V8HA 4JI1F 2CPZA 5F8LA 2YQ0A 4O0IA 2ASDA 3J7AN 5GADI 3OJUA 2BJ9A 2NYHA 2EK6A 1SC4B 2OPRB 3MI7X 3PJXA 4XTTA 4C7QA 4B9TA 2X3DA 3IC1A 4Z7YA 2A2DA 5IWAJ 5LMNF 3UW1A 3R5CA 4EYIB 1N88A 4DOZA 2HQ3A 3D6HB 3EGWB 2IM2A 4U8YA 4ILMA 1VR6A 4DN9A 2YWWA 1YZ7A 8ATCB 3AQPA 5HSPA 1YDLA 5MAOA 1UWBB 3L7PA 2J9EA 2AJ2A 1XR7A 1DURA 4F67A 4QYRA 1B7YB 1OWXA 3VQSA 2UXBJ 2Z58B 1X5TA 3THTA 3OUYA 1U8SA 4DX8H 4ETZA 1B70B 2LP4A 1L3VA 3CMES 2PGCA 1RWWB 2OLWA 4YHHJ 5DQIA 4PCQA 3UVJA 2YKPA 1VBKA 3PRBA 1RE1B 2I6WA 1NK7A 5CYQB 3N4WA 2NS1B 3NL0A 2JZ5A 3W9HA 1PYOB 2YNGB 4IG0A 4X2BA 3MGJA 1ZA1B 2C2OB 4DSEA 2FZCB 4ECXA 5FLXY 4QIVA 2XGPA 1KSPA 1JLBA 4M5JA 2CQPA 1VQ5S 5LJ3Y 3NNAA 1WUUA 2MJUA 4J9LA 3CWJA 3N0VA 4FYXB 5KFEA 1CSJA 4AT1B 2OPSB 2KU7A 3V4MA 3D9BA 2WTFA 3R7BB 2XMTA 2IRUA 4LRBA 4RR5A 2EFQA 4I4BA 4J91A 2GFFA 2R8JA 4DV3F 1Q79A 1VYAA 2MSTA 1IM6A 4P2SA 4Q7AA 1V3SA 1FKOB 2L3MA 2YKNA 3FSXA 5KFOA 1ZM4A 2MKSA 4NMXA 3R5JB 1UP1A 4PXBA 4FF1A 3W9IA 1VDHA 3H4BA 1FNMA 2HBZB 2VC1A 4CLYA 3MZIA 2K3KA 2H3EB 2DR9A 4JI0J 3NEKA 3D6FB 1Q7LB 2Q1LA 1X4GA 5F0UA 1TUWA 2IAJA 2V68A 3AH6A 4ZVTB 1I51B 2GMLA 4P71A 4A8XA 3KLFB 4DFMA 2XSJA 1CC8A 1NZAA 1BXNA 2B7BB 4WXOA 3OTOJ 4AL7A 4DL2A 4QCLA 2HVIA 2XMAA 1UTAA 3U7JA 3H4DA 3GYNA 2ZJPQ 2R7QA 4HACA 1FDAA 3A8EA 4IOAQ 4B3MF 3DRPB 4A8YA 1TL4A 3CDWA 3QGHA 3QYYA 4C8MA 2XMUA 2HS3A 1R8CA 1U8WA 5JXSA 1RISA 1U1LA 4RJVA 4DCJB 4RUHA 3CCES 2G0IA 3W5XA 3V5RA 2DNHA 3G6ES 3FJ2A 1KQGB 4ZVHA 4RNMA 4KIAA 1RT7A 2BM1A 2AGPA 1UJ6A 3AXKA 1U47A 1R0CB 4DSFA 4DR2F 1NJXA 4WPAA 4Q8EA 1QVGR 2BJDA 1CJKB 3KK1B 4KC5A 3AQOA 4P9SA 2B9EA 4ZPVR 4FDFA 5F8GA 1TR0A 1WHVA 1KHWA 4MKAA 2R7TA 3IBFB 2V69A 2FC8A 1U48A 1NK0A 3GPAA 2BOAA 1RDRA 1S4FA 4YDXA 5A76A 4ZVGA 3MM5B 5KFTA 2WOMA 2DNYA 4PAAA 4UOGA 5E7OB 5J1PA 5KFJA 2OP5A 1SC3B 3ZZZA 4JI5F 2Y1LB 2R7VA 4X66F 2NXUA 5DM6Q 2LCWA 1ZZNA 2XNQA 2HFSA 4JBCA 1HNWF 5C7PA 5KFPA 1WKJA 2D3UA 2QSFA 4GKKJ 2OJ3A 4ZIWA 3GQCA 1S0NA 4HHJA 1YRXA 2VZ9A 2JL9A 1EETB 5LSLA 4TU8A 5KFUA 2LQ5A 1RJJA 3C15B 3ILIA 1SJFA 1IBKJ 1HWLA 2MQQA 4C8OA 5H9FK 3TYTA 3O2IA 2Q43A 2Y0SD 3KUGA 3RB3A 3M7VA 4CLZA 3AXMA 5I3UA 2MKJA 2IA0A 2DCUB 3PFEA 3FBFA 4GVLA 1Y0HA 3AODA 2FJVA 3GIMA 3CCQS 4NYPA 2DYAA 1Z4UA 5E3PA 3Q23A 5KFQA 2YNHB 1LOUA 2V2KA 1H2VZ 2CDRB 2NSCA 2RU3A 2XZWA 3S01A 4LQ9A 2J9CA 1YJNS 4NXNF 2VOPA 1MMDA 4L75A 3I31A 4JI8F 2EBGA 3PHEA 3MR6A 2F4FA 2F9JA 2DEJA 2GO9A 4O0NA 2LA6A 4DSKA 3SQGA 5FDLA 1CC7A 1ZAXA 2CPEA 2HQGA 1IKWB 4DHVA 4ECSA 3V6HA 2C28A 3D68A 3U1NA 4LFAF 4QR0A 3GR1A 3ITHB 5DO2A 1Q1KA 1LW2A 3ZNUA 5C25B 4ILRA 4HHUA 4K4ZA 1KN6A 4FS1A 4OX7A 3QFWA 4NLRA 2MQPA 4EBCA 4OZLA 1I5OB 3DFEA 3NY0A 5AT1B 3OTDA 2CJAA 1TFWA 1T3OA 2B6AA 5J1NA 2HMIA 1UZDA 3V4IB 3FQLA 2YNHA 4KQZA 1F60B 1JLGB 2YX7A 3I32A 4ECWA 2JDJA 1O0PA 1ICEB 2J7KA 2ZOMA 1RT6B 4KV8B 4LSLA 4Y2KA 1WF0A 2VG7B 3HM9A 4DR1F 1W2IA 2I8EA 3NOCA 1M5KC 2HZCA 5KOWA 3MM9A 3C16A 1E6VA 3GG0A 3QSIA 3HVRA 2OPQB 4GC7A 4FBUA 1WOSA 1CEZA 2Y0BB 2VICA 2W25A 3QIDA 1S57A 3WIVA 1C2PA 1S1VB 5A8WB 3C19A 3J81Y 1KS2A 3CDAA 4L74A 3G6XA 1XNQF 1ZYQA 3LWMA 2QN6B 3FRZA 4K8RA 3CCVS 2HFOA 4C2MA 3NMRA 5HMZA 5HROB 1CS4A 3CJ3A 2VH7A 3HD2A 3V81B 3OVAA 3UVJB 5LOQA 3T3FA 1WHYA 3QSYB 4N8NA 1M1HA 2HHTA 4K2JA 4KGXB 4RW8B 4OJGA 1SJ4P 3ADAC 1GTHA 2PI5A 3CB4A 3MEDA 3UCUP 4C9DA 3NCRA 3PTWA 4C48A 1X5PA 2UV8A 1PILA 2ALZA 1B7FA 2HFVA 2GIFA 4F0MA 1RT1B 4QWCA 2ROEA 1HI1A 1SC6A 2YX4A 3OBIA 4QWBA 1GQEA 1VK3A 3D5MA 1JNZB 3RW6A 3BKTA 3AY0A 3DDIA 3QAEA 5HAOA 4DI6A 1NPKA 3K5PA 4H54A 5K8NA 4F2SA 4PQUB 1KOOA 3R1LA 3C2PA 2CWKA 3OFEA 1XK8A 1KFDA 1VRUB 4DV6J 3TNVA 1F5AA 1RTZA 2OPSA 3HZEA 5ETOA 4LFAJ 3U1MA 2CUYA 2KM8B 4KTQA 2ZH1A 2VDIA 3C14B 3HO1A 2L9DA 4Q5VA 1S1UB 5J1EB 2HZVA 1RTHB 1SQFA 4JI2J 4L73A 3CIZA 3O6QA 1S72S 3BF4A 2E5HA 4NLVA 4ELVA 1VQOS 2VJUA 1U1PA 2DNMA 1AUDA 1NBEB 1NDPA 3E3XA 3HX9A 5DQGA 3K5MA 1DRZA 4JI4F 4OQJA 3PVXA 1GMVA 3O44A 1VQPS 4E0DA 4FNIA 4F25A 1NSPA 1TMMA 4DPOA 1HHQA 1RT2B 5IV3A 4ZVSB 4LUBA 3DGVA 2PFDA 4X84A 1K44A 3PZPA 4B3RJ 4OJ3A 4J9SA 2XSJB 2MQNA 2PD1A 2XZTB 3EGVA 3PHTA 1O51A 1PYTA 1YBUA 3MUVP 2VA2A 3W2VB 1TK8A 5E5NA 4JV5F 3UR3C 2D3ZA 2VG5B 1V9OA 5HVFA 2VPZB 1UW4A 4I2QB 2QEXS 4F0KA 2L48A 5ETLA 2V94A 4TNOA 3BQ0A 4GKJF 4NOHA 2GHPA 2FB0A 1XN9A 3M30B 4OI4A 1HI0P 3QT7A 4DV0J 4N5SA 1TKTA 1KC8T 2FJWA 4WZQA 2W4PA 3Q8QB 3TW0A 2ERRA 4DR5F 4LF5J 5KG2A 4V19X 2DRBA 1RBOB 1UFWA 1RAEB 2DEIA 2Q3PA 3ETOA 4K59A 1RWPB 4USKA 3MCMA 3DDNA 4I1TA 3P6YC 1TL3A 3HF5A 2D7SA 2KFYA 3JTPA 4QBUA 3FCHA 4QU6A 2IRYA 2GAHC 1IKVB 2U2FA 2OSQA 3GCWP 3VGUA 3SI8A 3U02A 4QIGA 4DV3J 4ED1A 2V9WA 2R4FA 4F02A 3H2VE 2B51A 3UNGC 2MY7A 1C1CB 3M30A 4OX6A 1LWFA 2K06A 4ZVEA 1N4LA 1B0TA 4TKTA 2CQ0A 5ITHA 3HHNB 2V8GA 2B9XA 1KBRA 4LVNP 2WSEC 3RBDA 4A8KA 1WSVA 4HL9A 3T1YF 3IAS9 2KFNA 3H98A 3N6MA 1FWKA 1U1RA 1R0BG 2D9PA 3H0PA 1AZSB 4X66J 4ZITA 1XBWA 4N47A 5SZTA 2VJVA 3RR7A 1S48A 2GJFA 4GRSA 2JVRA 1ZZFA 4FS2A 1CG2A 1RTIB 3CJQA 5AJ3J 1KDNA 1WORA 3HD1A 2CJBA 2OUGA 3SCKE 3NAHA 3BZQA 4DPTA 2E29A 3EPGA 3MPYA 2IMOA 1W26A 3ZZYA 2LDYA 2XWYA 1U02A 3KLGB 4OV1A 2XQCA 1HR0J 1OY8A 3F73A 5J2NB 4WP9A 1YZ6A 3SSSA 3HPOA 1NJYA 3BR8A 1RQ0A 4I6WA 1HNIB 1S0MA 2XMVA 4DS4A 5IC4B 4DQIA 1TELA 3VAGA 3GILA 4ILLA 1OIAA 2HHQA 4I6YA 2C2NA 2R7RA 4WP3A 1X4AA 4CQ1A 3BV8A 2QLBB 1FVSA 2ZD1B 3ELHA 1GMWA 1B99A 3RGIA 3I55S 4YB1P 3PW5A 2J0QD 2GAGC 1LKZA 2HK2A 7FDRA 4ZLJA 5MLCV 4ZP8A 1KNZA 3KLEA 1RAFB 1U09A 4RW7B 4DCPB 2K7KA 4O4GB 2M3DA 4QR2A 4YB5A 1Q53A 3PIOQ 1U2CA 3CDBA 2W7PA 1HNZJ 4YMEA 2V8PA 2B4UA 2BW7A 1FEHA 2G1HA 4F0HA 2KJWA 3TARA 4EO8A 3CCSS 3C6UA 4MK8A 3BPDA 3NXZA 2HBRB 4A8FA 4KPCA 4N76A 4ED8A 1Y5NB 4I2PA 2DD8S 3D67A 5E41A 1M1GA 2LA4A 2VPWB 4RBTA 2ZNZA 3T6JA 2NYIA 3UR0A 1FKOA 2OPQA 1UW9A 2P2CB 4WYLA 1LWEB 2JLFA 3N5BA 3AB4B 4CYUA 5BJRA 2VG6B 4NCGA 1S6OA 4CO4A 3GIJA 2V2QA 1KQSR 1Q8KA 3BBFA 1RT3B 3OFGA 2W2OP 1IM4A 2YWGA 3DLKB 3U27A 4XPCA 1RP5A 1G1XA 5JJBA 1N8RT 3V2UC 4X4PA 5AE1A 1UA1A 2V4RA 4PR6A 1FRJA 1F9EB 2EW9A 3CT9A 4DPYA 2XCPA 3LW5C 4C8YA 1W2BR 1FE4A 4FPRA 2FLOA 3CC2S 2HGNA 2X1BA 4JV2A 2DXDA 3MEEA 2V63A 2CPYA 1E6YA 1Z2LA 1T9UA 4CLSA 1TMJA 4KR0B 5LSRA 1NJZA 2L9WA 3M6XA 1QY7A 1NKBA 2M7SA 1QSSA 5KG3A 1XNRF 1ZAVA 4I68A 1CJKA 4HLBA 2L41A 2DO0A 3JYTB 3PX0A 1NSKL 4P74A 2F4VF 3UD3P 2UUBJ 3VALA 4KJIA 1SUQA 3M2RB 4A4JA 2JNJA 3BSCA 1Q16B 4OI6A 3MFIA 3K0JA 3ILLA 1RT7B 4BWJA 2HHHF 1IR1A 3W60A 2N3OA 2P6SA 1RWXB 4URSA 3MM5A 3TWZA 4ZCLA 4DL7A 1KVJA 3P4UB 1LW0B 1H7WA 2HQCA 3PRVA 3IN5A 2DY1A 3RRKA 1K1QA 2VKRA 4JI8J 1S0VA 4ICLA 3M9NB 3MCOA 4CDIA 5C42A 1ZOTA 1DTQA 4RW6B 5G0RB 1UEVA 3SCJE 2YWKA 3QJPA 4MFBB 4DR1J 4X65F 2HHHJ 3GTYX 1YK9A 1T9XA 2YBVA 3Q86A 3LOUA 1RWUA 2DGTA 2ZFHA 1QE1B 2MKKA 1NUEA 2PFFB 3D66A 2LXIA 5KFRA 3ZTSA 4IRCA 2ZH3A 4TY8A 1NK5A 4DV1J 3OL8A 2H4YB 1HWIA 1VQ9S 1VGYA 3R5DA 2KVQE 2J8AA 1X5OA 3AD7C 4UY85 2DCLA 3DDKA 3P45B 3CEDA 5GAGI 4X4TA 1H0HB 4X4OA 1CLFA 1LNQA 1JKHB 3MM8B 5D6GA 3GONA 2DR7A 2HK3A 1DQ8A 1RADB 4FZVA 3SEOA 2KXHA 4OHWA 4K50A 2QJ3A 2DH7A 3MMAB 3PO5A 3M8PA 3R27A 4P2MA 1TL3B 3H5XA 4KH0B 4NA2A 4YS2A 1X9WA 1LW2B 1KKHA 1NDCA 1KLMB 1RT4B 1SQGA 5C25A 3JB9k 1LK5A 4EI2A 1Q0NA 2ILYA 2E9TA 2POKA 1TUVA 2XHCA 3A4TA 1LQ9A 2CPJA 4NZ6A 5KFDA 5KFCA 2NQPA 2YWFA 3EZUA 1VLOA 4M5KA 4QPXA 3Q8PB 4CLKA 1XERA 3POTB 4DQQA 5LMUJ 4NEYA 1C1CA 2IVFB 1H73A 3FC9A 2MSSA 4LFBF 1L3KA 1S1WB 3OXFA 2YVSA 2KYZA 4TU9A 1FJ7A 4KGKA 4OYMA 2LXFA 2B43A 2HNYA 3ZTQA 2R2TA 1FKPB 2R2UA 1RCOB 1WI8A 2QLWA 3S1TA 3RU0A 2VQEJ 2RS2A 2YQ1A 3G2XA 3SFGA 2MQOA 5C2GA 3L3CA 2BJ7A 3JSBA 2CQ3A 4ZOSA 5AXLA 2RAQA 2BQ3A 5C24B 5BXIA 4X65J 5A0YB 2VOOA 4C11A 3HJVA 3A3NB 1S9EB 4NLWA 2CQ1A 4RPFA 4DDFA 4NCAA 2DRAA 2DKOB 3RBZA 3W5YA 4ZHRA 3VZIA 2ZH5A 1CS4B 1R0AA 1MU2A 3MCSA 5LM7E 4NLUA 4CZCA 1ZM2A 3Q8SB 5AXKA 2XY5A 1J5EF 2ZOGA 4KO0B 1GTEA 3CD5A 2W2MP 3M1VA 3MWBA 2M70A 5DDOC 2DGOA 3LWLA 3HZGA 1K8AT 2R8GA 3TANA 3P3DA 3HSJA 2AMCB 2EFOA 2CNOB 4IDKB 4D3HA 4FKYA 1NEEA 3T1YJ 2CQGA 1TUGB 1X4HA 3IS9B 4TQSA 1YLXA 1N33F 4ED3A 3SCIE 5B0AA 2HQDA 2XYHB 1HQUA 1N0VC 3DM2B 1UA0A 1S77D 4LF7F 2EWHA 1DQAA 3NMAA 1Y10A 2K3IA 4DV7J 1W7WA 3NCQA 3W2WA 2DH8A 1T9YA 2WBMA 3NLCA 1N6QB 2LQ9A 2B9WA 2OD6A 4DG1B 2HIQA 2Z2YB 1ROFA 2IBKA 3CMQA 1R6YA 4M94A 4NCBA 2W7OA 3GWCA 3WC2A 1A6LA 2H5EA 5CAAA 4B3MJ 1HQUB 3DM2A 4B02A 5KFIA 2KYXA 2C42A 4OYWA 3PNIA 1JK9B 1NHUA 2RQCA 5LL6d 1S1TA 2QMUB 3MMBB 3OQ2A 2DPJA 2BXJA 3IWLA 1TKZB 3C6TA 3RW7A 2UU9J 1K47A 4JV5J 4Y2CA 2F65A 4PXEA 1N6QA 4DBQA 2ZHOA 5HLFB 1BWEA 3AD8C 3IM8A 3K17A 3WQPA 5KFMA 1PJ7A 3DLHA 3TUZC 1S9GA 4HKQA 5K8MA 3QT6A 4LREA 4EMDA 2J7WA 4HI1A 4KBIA 2C2MB 1QLNA 4LVOP 2JX2A 3N9UC 3FEYB 2I38A 2WW8A 2NCKL 4YR0A 2J5AA 2NXJA 3MD3A 4HT5A 3HVTA 4LF9J 2DVIA 2M0GB 1NM2A 2RNEA 4DUYF 1EHWA 2KN4A 1VFJA 1CJTA 4NA3A 3C6TB 4OJ1A 1GNKA 3KJVB 5D15A 1NNDA 5KFBA 3MMCB 4ITSA 2MGZB 2YY3A 4ZS6A 2HHWA 4KKOA 2HQFA 4HDGA 1SJQA 4BDPA 4ZCMA 4QQBA 2UVUA 3NGUA 3OL9A 2JLEA 3IWXA 2HLTA 5EWGA 2IPOB 2PMZD 3ZFVA 4J37A 4RNOA 2DGXA 2EEYA 5L1KA 4ATNA 1VQYA 2GGPA 4DR5J 1AZSA 4LF5F 1X4DA 5C42B 3BGFA 2O1PA 2XYGB 2Z4PA 4F36A 3OV7A 2FLLA 1JJ2R 1LWFB 4DV2F 4MFBA 2DNQA 3VAFA 2JEFA 4IO1A 5T7LA 3QJLA 1U24A 3NOGA 5EGYA 2MGZA 4E8UA 1J2VA 2MKYA 1SCJB 2QLJB 1WC3A 3AOCA 3QT8A 3CCLS 3KJNB 1IR2A 4F4AA 3KLGA 4M8LA 5KT3A 1HW9A 2DY9A 3HKWA 3PM9A 1Q95G 1XEZA 1MSWD 5GADU 3RB4A 3OW2R 2AJ4A 2BABA 3ONQA 4DL5A 2E9RX 3CE8A 3CCRS 1HNIA 1RUSA 2OHDA 3N79A 3PYEA 2MKHA 1CULA 2IC3B 3T9ZA 4E98A 2VBZA 5J2PB 1HLWA 3UDVA 4RW9B 5EUHA 3D3CJ 1ZAWA 3QLHB 3A3PB 1WACA 1YQHA 3MECB 2P6TA 3VAMA 2AGQA 3DRSA 3TOQA 3ZO7A 4DL4A 2F63A 3PX6A 3HFVA 3BN4A 1NPPA 5B09A 3HDSA 3M8PB 4ZPAA 1G3OA 3TVYA 1FK9B 1SJRA 4RW7A 1PYSB 3TO8A 3B54A 3HI9A 5ETTA 5A2QU 1AFIA 1CQNA 2J8SA 2BRLA 4MK9A 3TA1A 4USVA 1S10A 3D0GE 1A9NB 2CPIA 2QYGA 2ZD1A 3TZYA 3UDLA 2BRKA 4HTIA 3UCZP 3AHPA 3M6WA 2M9KA 1ZETA 2KZMA 2LDIA 1CULB 3KLEB 4J9QA 2XO6A 2D9OA 2RQMA 2EI5A 2QE5A 4LFBJ 3BR9A 4K0KF 3MECA 1NHKL 1YG0A 2N82B 2RT3A 2IDEA 3DRSB 1BD6A 4KY3A 1HQ2A 1N5TA 2FZGB 3AAWB 5FLXU 3NNCA 2D41A 1N33J 1UFLA 2YX1A 3D6MB 4ANEA 1BQNA 3EZ5A 1ZBTA 2O3DA 3M4XA 1MW7A 3GYXB 3H8YA 1O6XA 2C2ZB 2FVCA 3BH6B 3FCWA 1AUSL 5C24A 3PW0A 2DR5A 4C11B 5KFHA 2C3YA 1IN0A 1EQMA 1RT3A 3DI6A 4RZRA 3M8QA 4IFYB 1X4EA 3KLHB 1X0PA 4HH1A 2AIRB 1NK6A 4RUAA 1JWWA 3K8VA 3CCUS 1FEEA 1PSDA 1N5VA 3FQKA 8AT1B 2AHOB 2EXUA 2RQ4A 2X1GA 3MAAA 4KV8A 2FVRA 3TEHB 2FVQA 4P72A 4RWWA 3T1HJ 2ZZNA 1JQGA 3DLKA 2AP6A 3SIPB 1LEOA 3MEEB 3RR8A 2UUCJ 4DPUA 1YJRA 5IS2A 4DSIA 2COLA 2LQ8A 1L3UA 3GZ7A 3D1HA 2ADCA 1Q8IA 4NLSA 3K5OA 2BE7D 1M90T 2HYIB 3T9NA 2KVIA 3GLJA 4WKYA 1IWGA 2G9OA 4UOHA 4DFJA 1ZTTA 1BUXA 4WTYA 1QSYA 4I6AA 2X51A 4OI1A 4CO2A 1GX6A 5L9XA 3VTIA 2ILZA 1TZ0A 2E7VA 1SBRA 3NWRA 2GHWA 2XNRA 3SXLA 2DXEA 5D0EA 2KI2A 3IMQJ 3VF0B 1HYSA 2BKPA 4DUZJ 1SI9A 1SH2A 2IVMA 1FXRA 3R2DJ 4HACB 3GSIA 3BQ1A 3BO4A 1PAEX 3PW7A 3A8IA 1T11A 5ETKA 2KXNB 1OY9A 2CWXA 3LTOA 1B0PA 1UJ4A 3IA0A 3OFHA 3ETMA 3FSIA 2OEMA 1NXIA 5IT9Y 2QFIA 2GV1A 1HWUA 2UUAJ 1IKXB 3CCZA 1S7HA 2B7CB 4CO1A 5EWFA 3NRBA 3QGGA 4JI6F 3Q8VA 4YN3B 1S1TB 4OI3A 4AUKA 1VHFA 1M5VC 1X8DA 1JLCB 4MKVA 2RDJA 1UVJA 4PG7A 3GFZA 5LSOA 4F7VA 3A13A 1VMBA 4NXMF 5HLFA 1T03A 2EG1A 4UZCA 4C97A 3TZWA 4LMZA 5H9EJ 3D0IE 5E3QA 1FTRA 4RW4A 4R8UA 1B3TA 4ELUA 1UMJA 5HJYA 3GJSB 2E1MC 1S97A 4EZ9A 1YI2S 1VIXA 2MKCA 2K1RA 3M2VB 3TJAA 3KK2B 4HVZA 2R8HA 3HVTB 1X5SA 2RHSB 4ZP7A 2FY1A 1N5YB 1R3NA 5ETMA 3UFCX 2W01A 2QA4S 2BR0A 1K73T 3GR0A 4FXWA 3K57A 1M5OC 1EP4B 2AX1A 1U2FA 1JLCA 1U0HA 2ROGA 3OFFA 5H9FJ 4ZN3A 2AJQA 2B8PA 3DOLA 2D3O1 2NREA 1U2RA 2QO3A 3HHKA 3HFZB 1P8GA 4USTA 4RU9A 3K8WA 2EC2A 3IR7B 3KFWX 3T5KA 2C1EB 1X9SA 1L3TA 3DLBA 1GH8A 3KHHA 3I5BA 4AE5A 4FYDA 2CQBA 2AV5A 1S1WA 2BACA 2W2PP 4JI6J 1RB0A 3ZNJ1 1FD8A 1RAHB 1RA7A 3PEHA 2BMBA 2OI2A 3RRGA 3E01A 2D69A 2XB2D 1CPZA 4C0OC 3JTOA 2UXDJ 3CW2C 4ZPBA 1MLAA 3ISND 1SKRA 3CCJS 3F44A 1EP4A 9ATCB 4O3RA 1U0HB 5EDWA 1S4EA 4KHRA 5K9FA 4UT4A 1OPZA 2OPRA 3JQJA 4X4NA 3R5GA 4DR2J 4IUFA 3CCMS 5FDLB 3ISZA 3UPFA 1U6BA 1IQTA 2DK2A 2Y1IA 1BQMA 1DBDA 1SVDA 2HAFA 1UVLA 1JJHA 2RSQA 4TXSA 2VODA 2YKAA 1U0SA 1DLOA 2YNIA 3B4DA 5A0YA 3BS9A 3LP1A 1KQKA 4ED6A 4DF8A 2HS0A 4AXIA 1WWHA 1YIJS 2XGQA 1YWXA 3QMQA 2VIHA 1N36F 2AJ1A 4EUVA 3KOAA 3QRPA 2HBYB 2GJIA 2DIVA 4G3IA 1FX2A 1TKDA 1Y11A 3D54A 2KRRA 1AW0A 3M1VB 4OFZA 2H5JB 4C8NA 1L3SA 5GMEA 1FRXA 4LF7J 1CJUB 3LGHA 5B0EA 1YSJA 4U96A 5KFVA 2PT0A 3PFOA 4DUYJ 1FE0A 4MK7A 3E8OA 3GYGA 3EMTA 4YDDB 1X0FA 2CZ4A 1REGX 2W4DA 4K4VA 2V5HG 5DDQC 4Y6IA 5IT9U 2NXNA 1KVKA 3M05A 2CQCA 2KM8C 1FKAF 3D28A 4P75A 1V6HA 1WELA 5D3GB 2AEFA 2LKZA 4Q2MA 3P5TL 4Y65A 1T9VA 1WOOA 2FHOB 2H9ZA 3VZHA 5JMNA 4J9NA 3VAHA 2HGLA 4MIBA 2UUBF 3LALA 1FRMA 1MMLA 2F7VA 4NLQA 5HJXA 2WAQD 4J9PA 4DV2J 2VFRA 3VHQA 4E2FB 2DH9A 4B9UA 4V19J 2DR6A 1AYEA 3MEDB 1RBLA 3CJ4A 3TRGA 3HMJG 3PDNA 5HVHA 1MROA 2DGVA 2FGOA 5CABA 2KTQA 3SV3A 3H5UA 3WC0A 2LQJA 3ISNC 4H4OB 4O4GA 4RNHA 2KXFA 5DQHA 4TU7A 4CNZA 4LR9A 1Q86T 1VBZA 2GMJA 4ED2A 4DV5F 3G86A 4J9KA 4J9VA 1EJ7L 2IAJB 2B4VA 5CQGA 1VRTB 2ZNYA 3FK4A 3IRXA 3KLIB 3W8PA 3Q22A 1TKZA 4JYAF 1S1UA 4A8OA 1ZA2B 2GA7A 1B4SA 3LP2B 3UD5A 2IYIA 1OO0B 3IGVA 3MHYA 4CI0B 3PIPQ 2P9CA 4CO3A 3BSOA 2DO4A 5ETVA 2MHNA 2Y9HA 3MDFA 4NLPA 4UTGA 4R25A 2GJ2A 3BREA 3OTOF 2CZ9A 3NS7B 4NCGB 2H54B 1N5QA 1IBLF 3UQSA 5KTQA 3T1AA 2GVDB 1H38A 2DJWA 3H90A 3L7OA 3UDCA 1QJHA 5IT4A 4WIQA 1JLQB 2BZ2A 3DOMB 3OVBA 4B3RF 2Z2MA 2W9CA 1Y9OA 4ZVUB 2CG4A 2MLYA 4K4WA 2WB4A 3QZ8A 1GAOA 5IM0B 1HNZF 4KFBA 4U7UK 2MLZA 2JLGA 1WG1A 1ZPWX 5ETRA 5KT7A 4OZ3A 4QYZJ 1FHTA 4Y2IA 1PGZA 3RG6A 3DKDA 3VAKA 2O01C 3NBPB 2VFSA 2D3OR 1FXDA 3AOAA 3R5BA 1JXLA 4F04B 1VJQA 1X31C 2CYYA 4W4MA 4CNYA 3R97A 2XMJA 3BGUA 4NYZA 3HT3A 4F4ZA 2ADBA 2OH2A 2VB6A 5F8IA 3IG1A 4A8QA 3M8YA 4PUOB 3M2RA 3FZ2A 1ITPA 1HL6A 1Y3JA 3OTEA 2ZBCA 2CJQA 1DTTB 1SH3A 2EFVA 1D09B 2XSFA 2ZEJA 2R7XA 4U8VA 2PIIA 2JOQA 3PG9A 3CGIA 3SV4A 3Q89A 3FCVA 4PPDA 3RBXA 2CKWA 4NRUA 5DG9A 2ASJA 2LQBA 2NPIA 4HR2A 4ZIVA 1T03B 4EBEA 1DZ5A 3W63A 1WC6A 4USJC 3ENQA 3S8SA 2CPFA 2CPDA 2F8MA 4K4YA 4P2FA 5L8RC 2VBXA 3QLHA 4HI2A 4CLLA 3PACA 3RB6A 4KHMA 4QU7A 3CULA 2E66A 2V2ZA 4NI2A 5BYRA 3KG1A 4OZJA 3HVAA 1VQSA 2ZVSA 4K4XA 4PUOA 1IJFB 1B0VA 2EFNA 1N5YA 1FK9A 2E5GA 3G82B 4OI2A 2MXYA 3CJTA 4RNNA 4QWDA 2LYVA 1H3DA 5IOLA 4MT1A 2OSRA 2BJEA 4WFZA 2FHJA 3BJYA 5DJBA 2PMHA 1F3VA 3GJTB 4LF4F 1YKWA 3HK2A 2QA2A 3MEKA 2BQUA 1CVJA 4WE1A 2IBOA 3KHRA 5B0CA 3MF5A 2AGOA 1FI4A 4RUBA 2Z56B 3UN2A 4DMZA 5T14A 3K2YA 3GIIA 3TJ8A 2B6AB 3N28A 2Q66A 1FF2A 2L08A 4LBIA 4U67Q 4WK1A 1XMQF 4EO6A 5KFNA 2N4CA 3MR3A 1K9MT 2HNDB 1UPPA 4FN5A 4NASA 3BDPA 4FVMA 4DL6A 2H1YA 1AT1B 3PX4A 5K14A 1RT6A 4LSLB 3ET6B 2NUHA 4JB8B 1U26A 3M8QB 4IFYA 2RE1A 3D2WA 4DQSA 4EGLA 1F2GA 2RQKA 2MLXA 3C16B 1G4CA 3AT1B 3R1HA 1RA6A 2WK4A 3H42A 5A8RA 1PC5A 2JRSA 3NP5A 2ZM6J 4DV1F 2VFVA 2FLNA 5D4NA 4F4KA 1BHNA 2QSWA 4LRDA 1RSCA 3CJ2A 1HBNA 3DI6B 3VCDA 5IZHA 2N4DA 1M5HA 5G4DA 4DXLA 3G6YA 2ZBPA 4ZJLA 5THWA 5KFFA 4B3OB 3V81A 3KJFB 4PABA 5GVQA 1FXLA 2ZC4A 1HKAA 4B08A 1RXOB 4CM2A 4ZLPA 4U7CA 1RK8A 2I9SA 3MAAB 1RZMA 2ZE2B 4QR1A 5F3ZA 3K5LA 3QGPA 1HWKA 2GZOA 4MJKA 3KHGA 4LF4J 5FD1A 3OSNA 2O67A 1YRTA 3W64A 1FNXH 4B3TF 4LF1A 5GAGU 5KG7A 1RT1A 2DNRA 1REVA 2HBQB 2E5JA 4JV1A 4CYUB 5L1LA 4O44B 3W7BA 4ES3A 1XMQJ 4EZ6A 2JC1A 5KG0A 4PQUA 4WWSA 1NZ8A 3DCAA 2KZZA 2Z57B 3OR2A 3FSYA 2LECA 1WF2A 1VQKS 1FRIA 3I9ZA 4IDKA 2R42A 2ZH7A 1XMBA 2C22A 2ZH4A 4PG5A 1F6TA 3QBCA 3WX4A 1C1BB 2WB1D 3IXQA 2BANA 4FYYB 2O5DA 5KT5A 2XMKA 3DLGB 3Q8RB 1XNQJ 1KD1T 3DLEB 2ZE2A 1TL1A 2YWHA 3B78A 3QATA 4IG0B 4L6V3 1GEHA 3A1YG 3KKFA 5HMYA 3MUTP 2R9LA 3GP9A 2DPIA 5RUBA 1F9FA 2WSFC 3NGTA 4MIAA 1J27A 1HHTP 1QVFR 3GU0A 4DLEA 4QYZK 4UQGA 3W2WB 4F4WA 4ZVPB 3FFIA 5I4MA 4C8ZA 4O44A 1X4FA 1LXNA 3OLAA 5AXNA 3G8QA 2FHKA 3H5SA 3LPEA 1RT2A 4F4XA 1WC4A 2PA3A 5EX3A 1UCNA 2F3JA 4LIRA 2W8KA 2HURA 2ZBIA 1RAAB 2OMOA 3I96A 2G2YA 3QGIA 3EYZA 2A3JA 3Q24A 1HR0F 2CXEA 3GMGA 3MPUB 2VONA 1SV5A 3BBBA 1VHIA 3IBCB 4MMOA 3IR6B 4RL1A 5F3TA 2IMWP 5LXYA 1WJ9A 1LW0A 1TL1B 2A0FB 3CO9A 3R5AA 4WJBA 1CJVA 3Q2SC 5AJ3F 4ZK7M 4B9VA 4F3OA 3CD0A 2B0GA 3B8HA 3LP0A 5L46A 5G0RA 2NUUG 3VAJA 3Q2TC 5D78A 2DITA 2P8IA 5KFZA 4JI5J 4W98A 4F3MA 2J6UA 4OHXA 1PKUA 4K5SA 3O8WA 4NX9A 3TAMA 3D1OA 2KO1A 2HFNA 2MYFA 4A47A 1U45A 2QTWA 1R8HA 3PYFA 1NJIT 1FJGJ 1TVRA 4RWXA 2R7SA 2FVSA 5K5MA 2IYGA 2E7XA 3WBZA 5DG7A 2V4JA 4U6PA 1U1OA 3ZXWA 1KONA 4ED5A 4WTOB 1S9FA 2FHJD 1VQ7S 3DRPA 5H9EK 1S0OA 2HAIA 4KGZB 1FJEB 5DLGA 3RJMB 4BLGA 4A8MP 3NGSA 5E3RA 2NPFA 2AJFE 1PBUA 1QAXA 5IXUA 1YITS 1EAYC 2HPUA 3A12A 4JOUA 1DJ0A 2HRUA 1LK7A 3MMAA 3OTBA 3TAMB 2E7WA 1VISA 3EVOA 4J9RA 1BQMB 2DNKA 4LF6J 3OXLA 5KFWA 1VC5A 3N5FA 5B0DA 3CJKB 3I4PA 5HL7Q 3TA2A 4RUCA 3FZBA 2QL7B 2ZWPA 4J90A 3AJ2A 1ZM3A 5M2UA 4IFVB 1PIEA 1UVMA 2ZH6A 4DWIA 2DNLA 3MPVA 4IH5A 1FFGB 1HNVA 3B4MA 2GHVC 4PG8A 3T6BA 3RZAA 2M8DB 3WZ0A 5KFGA 2PO4A 4AQYJ 3L7UA 2G0JA 4H4MA 5T7LB 4ECUA 3MAHA 2N3LA 3NAIA 4RKUC 1NSQA 1VBYA 5HK4A 2JEIA 1IBMJ 1TL7A 2HW3A 2W7AA 1D9AA 4F50A 4I64A 1RU2A 2D1CA 1JMTA 4DN0A 4R5PA 1WHXA 3A8KA 4DR6J 2A2CA 2MQLA 5E0OA 1S99A 1PJ6A 4J9UE 5IQ6A 2QFJA 3GG1A 3CF5Q 2QV6A 2RVJA 3M8RA 3VAIA 1YJ7A 2ZDPA 4M63A 2VQFF 1N34J 1EETA 3OUYB 2DHAA 2G2OA 1HNVB 2BE9B 2VPYB 2X3GA 3ENAA 1FO1A 5GMKa 5GAHI 4IQXA 5B7WA 4WE1B 1WOPA 4ZCIA 2R2RA 4C0BA 2W2QP 2WHOA 2FJAB 5CYQA 3T19A 3VGSA 4H4MB 2MPUA 4LF6F 4B17A 1TKXB 2CVIA 1A0OB 4LR8A 2G1DA 5EWEA 1NJWA 3RYLA 1XQIA 2W9AA 2UZAA 2NR0A 3JQKA 1HPZB 2X1AA 1OSCA 1KWMA 4FYWB 3HSGA 4JUZA 3CNQP 4ZLNA 3KUEA 5CH7B 3QRQA 2RH3A 4I2PB 3IO1A 2J9DA 5CZVA 1RKIA 2VBYA 4F4YA 4IO9Q 4B3TJ 1Q78A 3KK3B 3TQ1A 4GKJJ 1SJ1A 2NSBA 4LR7A 4B9LA 2PC6A 1VRTA 4NA1A 2MJNA 2B5JB 2RB7A 4OZ5A 3IRXB 3KLIA 2YNFA 1NCLA 3ZZPA 1N54B 3FBBA 1TU0B 2VL1A 3H20A 4GVBB 5HO4A 2V0NA 2XULA 4C0HA 3GIRA 2LLZA 4Q8FA 1T3NA 2E1PA 1Y5IB 2EFGA 1F5CA 2AT1B 3DYAB 3MEGB 4EK2A 5LJ5Y 1EQ0A 3HHLA 2DHSA 4M1KA 2JEJA 1IVZA 2F5GA 4OYAA 1JLGA 3BN7A 5E3CA 4DR3J 2AQ4A 2PMWA 5LMNJ 4DUZF 2E1CA 2DIUA 4YB7A 2QMWA 5HMWA 1ZS6A 2A10A 2GNKA 2OO4A 2VG7A 3FNNA 1M0SA 2KKHA 2UUWA 4K7QA 4C3MA 4ZN1A 3KLHA 3MOJB 1YJVA 1UVKA 3TUJC 3MR2A 4DV7F 1E6YB 5C2CA 2LU1A 3GSDA 4GVBA 3V6DA 1S1VA 5A8WA 4KRWA 4WBFA 1WI6A 5KT6A 2GVDA 1HFEL 1S79A 2ZUGA 3H40A 4M5LA 2BDPA 3ZZRA 5HN0A 3LF0A 1RHJB 1VIOA 2AW0A 4TN2A 2WVDA 4ZMMA 4IOBA 2OIHA 1RACB 2F9DA 2ZC3A 4LF8J 3KDOA 2DTJA 2BANB 4M5NA 2IJNA 1DY3A 1JB0C 2KL8A 1NLKL 2IJRA 4CT8A 3SFUA 1BQXA 1S1XB 4RO0A 5L38A 1IQZA 2ZH8A 2PA8D 4HT7A 4J9OA 2CRLA 1VQ6S 2HHVA 2FJDB 4AFFA 3KTQA 3IAM9 4ICLB 3EXCX 4WFYA 1FERA 1DTTA 4EYHB 2B56A 2MZTA 3I5CA 2UXCJ 1YVFA 1TL5A 1U49A 3V6DB 2SXLA 4OHVA 2FVPA 3G9CA 4JI3J 4W90B 4YQWA 1TK5A 3VGTA 4HHHA 4PPZA 4ZJQA 1SC1B 2C2RA 3M32A 2AJ0A 1V3RA 2W9BA 2FY8A 1FRHA 1SV5B 3DLLQ 4LFCJ 2J0WA 4DR4J 1AROP 1QSLA 2Q6CA 5J1EA 2M52A 1RTHA 5AE2A 2WOMB 1IXKA 4LT6A 3Q8UA 2CJ9A 8RUCA 4QOTA 3KMSA 2ATLA 1DFDA 1YJ9S 2ZBRA 4G65A 2UUCF 3AJDA 3P8BB 4GKKF 1KHVA 4C4WA 5HQLA 3DOKA 4DEZA 1SXLA 3DXSX 1C4CA 2OFGX 3I9V9 2PDAA 5F0WA 3TVZA 9RUBA 5JUMA 2R8IA 4ZPCA 1D9DA 2ASLA 3R7SB 4FPIA 4OYOA 4A8WA 4IH6A 3I5AA 4GO7X 4UOCA 3MMJA 3QPIA 4OHZA 1I3OB 2V8DA 2FJBB 3BO3A 4ED4A 1KLMA 2Y1RI 3FKBA 1JNRB 4OV6A 5ETNA 4WYWA 3RTVA 3W2VA 1UEKA 4CIOA 2VG5A 2AYMA 2J0XA 5CHCB 4YOEA 2KT3A 3CJSA 4Y0FA 4DQRA 4C6AA 2BKNA 2AF6A 4CRJA 1D9FA 5IFMA 1FRLA 2BJ3A 4OZNA 4Y00A 2R7UA 2IC3A 4BBYA 4ANCA 5DGBA 1WEZA 2YKOA 3ET6A 1XTZA 2VA3A 3DHWC 1IKYB 2QA1A 2XTJP 4IG3A 1LWCA 2FLPA 1EARA 3M2UB 5F8MA 3BBCA 2QC3A 3QFHA 3RAXA 2BOPA 1X4CA 5HATA 2XO7A 4QIFA 2FGCA 5T41A 3ZZOA 2C2DA 2F8EX 2QL5B 3BH7B 3DN9A 5K14B 1T9WA 3G4SS 1FDDA 1Q8BA 1S9EA 4JI3F 2XEXA 4DLGA 2FD2A 4L72B 4OX8A 1SQEA 5I42A 1I94F 2VDHA 2EG2A 1NMEB 4KSEB 1RGVA 3SDEB 2XMMA 2OFHX 5GMDA 5A8RB 2ZHAA 4J9MA 2KFZA 2DGUA 3PYGA 2MZ1A 1IJEB 1UAWA 1RLCL 1FWLA 2LU2A 4YY3J 2QIFA 1RTJB 2F1FA 3MD1A 3TJ9A 1HBNB 5GAEU 1TL7B 3M2UA 1FFSB 4KT0C 4ZCKA 5CCLA 4OZ2A 1G7CB 3GFYA 4P10A 3B82A 2G0CA 3NG8A 3NNHA 2E9ZA 1HWJA 3WDOA 3EGZA 4PWDB 1IBKF 2CQ4A 1FDNA 4P6QA 4KAIA 3ULHA 2K2PA 1KTVA 3PR5B 2W2NP 3HSZA 2QT7A 1BLUA 5C5JA 4ZVQB 2DNGA 1GMUA 1TAUA 4ES2A 3V6JA 3AA8A 3GJRB 5IC6B 2FJEB 2XLJA 3I87A 2X7IA 5DGAA 1NB7A 5E2QA 2GQ2A 4ES1A 5A2QY 4RW8A 1ZPVA 5L1IA 5HI7A 3CCTA 3DMJB 4QW8A 4WFNQ 1QTMA 5LT5A 2ZHBA 5ETPA 2HGMA 4K4UA 4FYVB 3UNYA 4Y2AA 5ETQA 2C3MA 1C1BA 2W24A 1U1QA 1RLDA 2H48B 4TYAA 3NWGA 3Q83A 2OAUA 4WU3A 1HNXJ 1FVQA 3K7RA 1MN9A 3CJ0A 3MM7B 1T02A 2UV8G 4ECRA 3F0NA 3MMBA 3UWTA 4DX5A 3K5NA 2DBBA 1BWVA 2YNFB 2CADA 3OJSA 2IDLA 3IP0A 1S5ZA 2VKZG 2HHUA 3SSQA 1N34F 1N56A 2G4BA 5DG8A 2FIUA 5DZ7A 2J6SA 2WBRA 3PO4A 2XS5A 4TYBA 2N7YA 3VVTA 1XNRJ 1VC6A 2R7OA 3M8SA 4WU2A 3E2EA 1VK8A 5B0FA 2O66A 1RWOB 3GCXP 1FFWB 3LA0A 4FKXA 3PKYA 3LQVA 4H4OA 3P49B 2XC9A 3DXBA 2RU9A 3GFHA 1T94A 2MY8A 2PI4A 4WXWA 4AD6A 5DZ6A 4CP5A 4ER8A 1IKXA 2W1BA 3RUBL 1RTDA 1CJVB 5HP1A 2Y8WA 2CZVC 3MM7A 3R8YA 1OSDA 4EEYA 1YGYA 3T5JA 2Z0GA 1WKKA 3LANA 1JIHA 2XMWA 3LPYA 1R89A 3MXHP 3E51A 5DRKA 2A18A 3MMCA 2PE8A 4ZVFA 2ZH9A 1PJ5A 4WFAQ 2HRTA 3MPWA 5KFSA 4NLXA 5BYSA 4FXDA 2XZDB 3LGNA 2ZOFA 4X64J 1HBMA 4B9MA 4MYTA 2VUGA 2EVZA 3VWSA 1BGXT 1HBOB 1WG4A 1AB8A 2ROPA 2GGPB 2X1FA 2W9CB 3ILOA 1J5EJ 2P5VA 1VLYA 3RRHA 6FDRA 4KH1B 1U1KA 3CC4S 4XK8C 4DL0C 3Q0AA 1NU4A 4WFBQ 2FZKB 1IUJA 5DLFA 4O3OA 3UN5A 3MUMP 3J7A1 1HQEB 4R0EA 2XLKA 2ZZMA 3EWGA 3I6PA 1ACMB 3CJ5A 2VPXB 3R6GB 4CTAB 2QL9B 1EX8A 1V5VA 3CD6S 4FNHA 2UXBF 2CPHA 5KG1A 2KRBA 4JYAJ 3PCOB 1F3FA 1K1SA 4IQMA 4ZP6A 2YKMA 5L1JA 2XI2A 4RU2A 1SL1A 4IFVA 2RIJA 1UPMB 3AJ1A 1T9TA 1WHWA 1CBKA 2AEJA 4A46A 3DRYA 3QIPB 3OL7A 3EXYA 4O4RA 4DF4A 4RBUA 4BC7A 1VOMA 3I0RB 5KFAA 4IOCQ 1RI7A 2E5LJ 1EKSA 2IRXA 2BYCA 4ZPTR 1KR4A 3VVUA 3AFGA 4MTPA 1TV6A 3ENVA 3OR1A 3AOBA 4P7VA 1C0TB 2VHGA 3CXCR 2EPIA 3TR5A 2RF2B 2QMXA 3M8WA 4NI2B 1TKXA 2FPHX 5F8JA 1LFWA 2EKYA 1S6PA 2GVZB 4TY9A 3RAMA 4H4KC 2WVCA 2DB1A 3SQOP 2QRRA 2RKIA 4OYIA 2CJKA 4XO0A 3B6BA 1FA0A 1URRA 1JXVA 4JI7J 1SIWB 2JHEA 4DL3A 3X3UA 4OZ1A 3N6NA 2W4CA 2IM1A 4FP9A 3TA0A 3UCGA 5CA5A 4NYOA 4CO5A 2WSCC 3CJ8A 4UW2A 3MAQA 4X4RA 5M2RA 3TI0A 1RT4A 3LUYA 3TVKA 1Q81T 4KHPJ 1KFSA 3U1LA 1S76D 2ZJRQ 2DGSA 2WCXA 4NLYA 2HZAA 2RF2A 2B4PA 1GXTA 2IJFA 2RUSA 2GO8A 1C0UB 4ID5B 3IWNC 1G6BA 2R2SA 2GVZA 4I7FA 2H5IB 4G6VB 1Q5YA 2ZKTA 3POTA 5F9NA 4URGA 1M5PC 4UF4A 4I56A 3QAUA 3FVYA 3SCLE 3O1LA 5LMUF 1ELOA 2MQMA 2BKOA 4OYBA 3FEZA 3HKZD 5KT2A 3NGDA 1TQLA 3BPSP 2NXEA 1QUPA 4DV4J 3HLUA 1AXQA 2E1RA 2C3OA 1I6JA 4I67A 1VQMS 2ZBQA 2DNNA 2E1AA 3G71S 4I69A 4DR4F 2VF3A 1Y5LB 4KYZA 2DT9A 4Q2LA 4O3NA 2IIHA 3MURP 3C8YA 3PJ9A 5CD4H 4I7FB 5EHHA 1GXLA 1KTQA 3H25A 2LEAA 1RHUB 5KOXA 3KDNA 3BYRA 2WVEA 4USUA 4ETXA 4FF3A 5D4PA 2CJXB 3PEJA 3QT5A 4HH0A 1R43A 4LSNB 1N5SA 3BKFA 1TP7A 2JFKA 3BYPA 3BO2A 1UVNA 5L9NA 3THVA 3QNWB 3W5ZA 3MM6B 1JLBB 1MN7A 1XR5A 2J76E 3IRWP 2ATCB 1WC5A 2LXUA 2RILA 2Z8QA 4HYKA 4PWUA 4CLUA 3H5YA 4B9NA 3KMQA 4RBVA 4L3KA 2BA9A 3QO9B 3CIMA 4K2XA 1WEYA 4O23A 1S12A 1QD1A 1VS3A 2W9BB 1H74A 2C3UA 1XWLA 3CO0P 3ZTPA 3FBCA 1LXJA 1SIZA 1Z1ZA 3NKYA 1RHKB 3VR1A 4CH1A 1D3WA 1SJ3P 3DLEA 3UE2A 4LSNA 2HVEA 3TX8A 1OS5A 1DQ9A 3FMBA 1SL2A 3BKUA 2JVOA 3CDUA 3CVKA 3DNCA 3L4BC 3MFHA 3MM6A 1FD2A 1XJWB 2GX8A 4ECQA 2CPXA 4YEAA 1R8AA 1T05A 2WVFA 4HTJA 1FWPA 4NRTA 3M9MB 4QJVA 4TVAB 4QW9A 4C8LA 3TZZA 1GX5A 3TEGA 4Q43A 4K4TA 5E3AA 4IRKA 3S6EA 3CD7A 2H51B 1QE1A 3NS5A 4PYAA 5B0BA 3GE9A 4G1PA 4OYXA 3BSAA 4M5DB 2HS4A 2V50A 1H7XA 1RHMB 1VRQC 2JH3A 1F1BB 1RHRB 4K0KJ 2CG8A 1BE4A 2BJ8A 4Z37A 4GO5X 2Y8YA 2AYEA 3QZ7A 1WNEA 2YWEA 5A6WA 4XPEA 5KT4A 2K8GA 3W9JA 3KNAA 3ZTRA 2XYPB 1R7IA 3DLJA 1HHSA 2RHQB 5KFLA 1I1GA 1L5UA 2UVRA 1RT5A 2GMHA 2QZ8A 4ENOA 1O5JA 1QAYA 3MOZA 1WKLA 4B3OA 3EE3A 2CA9A 3KUHA 3EX7B 1D8YA 1UWAA 2MZRA 5CYMA 3PKMA 2FHMA 2I5JA 3OT9A 4QPTA 2GIRA 2RS8A 3EZOA 1SH0A 2IM3A 3T5LA 1JLEA 3R3TA 5D4LA 2BE2A 2OPPB 4PG4A 4Q44A 2OELA 4WP8A 2EK1A 1R8BA 1NB2A 2M88A 2FDNA 3OVSA 2J0SD 4P52A 2LFVA 2HFUA 3TAQA 3GIKA 3AD9C 2RDIA 4TLQA 3QQCD 3DGPB 3VQTA 4Y28C 4UOFA 2V6AA 4WFXA 3NGRA 1NK4A 2XCAA 2MQ8A 4ELTA 3P96A 4OZ0A 1N32J 5DDRC 2KB2A 4ZDNA 1RWMB 4NMLA 3CJKA 3W65A 4DUTA 1RAOA 2RDDA 2F4VJ 1D1UA 2B8QA 2HVHA 3I0RA 4AQYF 3DRRB 4RNFA 5A8KB 4NLGA 1WD6A 2E5IA 2YH1A 2J9DE 2RRNA 2N7CA 1P9YA 3C15A 1SB6A 3CCWA 3FEXB 3W3SA 4DZ6A 3OR1B 1HMVA 3EGNA 1YJTA 4MYUA 4FF4A 2GQQA 2M5YA 4Q0BA 4UZBA 1BC6A 4YUDA 4H4KA 5I3UB 3LGMA 1WTBA 2BQRA 4DR6F 2YTCA 4DR7F 3DMJA 1IBLJ 5D3GA 4QIEA 1SL0A 4XIUA 1DHMA 3EICA 5K8PA 1FT8A 4X64F 2G13A 1GFWB 3US5A 2KT5A 5HQ8A 1Q82T 4LQ3A 1NHVA 2ALYB 2V2VA 1OY6A 3W66A 1MWZA 1GK8A 2P9GA 4PYDA 2YNGA 3DRRA 4X4VA 5BYQA 3SQGB 1B64A 4CLFA 4AL6A 1NAQA 3UDEA 1MROB 1ULRA 2HVDA 4Y3CA 3NGKA 4ZVOB 1FESA 3TAPA 3RAQA 4WCEQ 2OGUA 3EVMA 1IR0A 4PG6A 2VFTA 3BSNA 3CC7S 3G6VA 3C46A 1F2HA 2LEPA 1TTHB 2PEHA 1U6ZA 4DX7A 1UKUA 4U9RA 4I0WA 2YKQA 3SMZA 3IR5B 4OMFG 5BR8J 1WDDA 3V4IA 2DHXA 1HPZA 4Y2MA 2KDOA 5F9LA 4Z7CA 4U7UD 2PEBA 1UETA 5H1SV 1S6QB 4DV0F 3I0SA 2EFPA 1XMOJ 2IA6A 3MM9B 4GC6A 4LRFA 2UU9F 5DM7Q 1FTCA 1JXEA 1JLFB 1DAXA 1UL3A 3HFKA 2B3TB 2CDQA 3W62A 2CQHA 1VJWA 4DX6A 1AA1B 2Z2LA 3AA9A 3FFIB 3CPWR 1VCTA 1WSRA 1HBUB 1OQ6A 1RU1A 4ZPDA 4P2XA 2YPYA 7AT1B 1T7PA 2J7UA 3DYAA 2MZQA 1KRPA 1KLNA 3BDEA 2CNNB 4LFCF 4ANDA 5HROA 1S9GB 4DSJA 4QWAA 1HBMB 1RYSA 3A3OB 5IM0A 2PN6A 5IV4A 5FIIA 2EC0A 2HHXA 1CQMA 3I0SB 2FC9A 2XBPA 4JV0A 2HWHA 4W92B 4XDCA 1S6UA 1LFPA 2DNPA 2MZJA 4CH0S 3KLVA 4G1QA 3IBWA 3VV2B 2V67A 3LP0B 4FF2A 1CJTB 1X4BA 4QZVB 3KJVA 1HD1A 1BY9A 3D0HE 2WRMA 3FMWA 2XS7A 4CM0A 2ASYA 5HMXA 3J80U 4KKOB 4YP3A 2ZM6F 4CLPA 1HARA 4DV6F 2CFXA 3EPIA 2OEKA 3MCNA 2VQEF 2J6TA 1NH7A 4P73A 2OTLS 3GB0A 3OPKA 2YPZA 5CD4A 3KG0A 5I3PA 4F26A 4YY3F 3JSRA 2HVZA 1H72C 4DU7A 2BJ1A 2R7WA 1HQEA 4EWTA 3L09A 4YFUA 3A8JA 1PO6A 1YBAA 4JI2F 2OD4A 4IH7A 4KB7A 2QLFB 2A6OA 4LBPA 2IVYA 2NZCA 2UXDF 1ZM9A 2HKEA 2CNLB 2GS8A 2V9KA 2GW8A 2YKMB 5CYJA 4LF8F 2BEFA 3EDQB 3UI3A 1NRKA 4ECVA 2C2EA 2Z30B 1N36J 2UUAF 2VASA 1OPIA 1FJGF 2I0XA 3G82A 3MTJA 4BHQA 1Q8LA 5LXRA 2WONB 2QLXA 1VC0A 1NDKA 4IRDA 2UXCF 3FUYA 1YBTA 4MIWA 3PR4A 4NXMJ 4K5RA 4RW4B 4R8UB 1HNWJ 4JI7F 1TV6B 3W1YC 5J2PA 5JVHQ 4F8RA 2XG8A 2HWIA 1KP6A 1RHQB 4F3QA 4DPXA 2CVEA 3JQMA 1VQNS 3PW4A 4OJHA 1HNXF 2LVWA 5B0GA 1N32F 3OL6A 1WDTA 1S6PB 5SUHA 3TUIC 3M9OB 1U4BA 3JSMB 4YR3A 1RAGB 5DDPC 2ZVIA 3BEGB 4R5PB 4V1Ak 5JVGQ 2WONA 3EJMA 3G87A 4M5MA 2VC0A 1T95A 1J5OB 1WC1A 1C0UA 4ID5A 1QTNB 3EVWA 5IWAF 3J81j 2WVBA 2ZZTA 4ZJOA 3QJJA 2BVZA 2HQIA 2YH0A 3LAMA 2DRDA 3N01A 3KJQB 3MM8A 3O5TB 1HIYA 3DGPA 3J81U 3C66A 3JXOA 3F41A 6AT1B 2MZSA 1K0VA 4M5GA 4OLPA 4CT9A 4U95A 4B3SF 4UY8T 1URNA 2QA4G 4OL8A 3LAKA 4YB6A 4X62F 2ZITA 3PY8A 5AE3A 1BQNB 4DCOB 4M95A 1Y7PA 3W61A 1T8EA 2VV5A 4FVCA 3GV7B 4LSZB 2HMIB 4KHPF 3OHAA 3FDSA 5A8KA 2Y1JA 3I82A 3FGVA 4HEA9 4N41A 3KK3A 1S49A 2MKIA 1HA1A 1HMVB 3G8TA 2VBWA 1UEUA 4A48A 4EBDA 5ADZA 5IQQA 1JJCB 1GMWD 2V8VA 5KFKA 1DLOB 2H65B 2YNIB 4BC9A 1RTJA 1NK8A 3LP1B 1IBCB 4ECTA 4NXNJ 3OR2B 5J2QA 2DHHA 3OXGA 2IHR1 2JEGA 3MEGA 2ABYA 3HHLB 3K58A 1P9QC 3W8GA 4DV4F 2FYXA 3Q8YA 3ZZTA 3N6LA 3DLGA 2M8HA 3PV8A 1UWBA 3SZ2A 4MAKA 1TAQA 1RYRA 2AEMA 2RRAA 4AL5A 1CJUA 1H2UX 1PAUB 1SKWA 4C3LA 4PWWA 2MTLA 4USIA 5A6PA 1WC0A 4CLWA 3JAMY 3OLBA 3OSPA 4Z2XA 1MU2B 2YXLA 2QX0A 3S7RA 2EBEA 2RMLA 2ZDOA 1AFJA 1JLAB 2JWNA 2Z2ZA 2NZ4A 1RWVB 2JC0A 3BM7A 2VD3A 1C4AA 2V4QA 2AYBA 1VRUA 1IBMF 2HG4A 4K4SA 2A6MA 1OMSA 3JTNA 5B08A 1TFYA 3NCPA 1RBAA 4NLOA 3R6LB 1GXUA 3IS9A 1T05B 1MG7A 1P6TA 1S6QA 5CCMA 1UFKA 2HNZB 2E5LF 4FXVA 4MH8A 1FCAA 1P1LA 4LBHA 5KFYA 4DPWA 2HFZA 4TQRA 4DFKA 2AU0A 2XS2A 4G1IA 1JLFA 3JAMU 1OYDA 3RBEA 2OTJS 4S0MA 5F8HA 1H2TZ 1ZTWA 1YX2A 5F41A 1JLAA 1F5BA 3SBMA 3IM9A 4ZKAA 1EKRA 2ZKUA 3HHDA 3O3LA 4X4QA 4DG1A 3PW2A 1NH8A 2HHPA 1W25A 2MMYA 4DR7J 1NK9A 2XI3A 3M32B 1P1TA 3HHLD 3LO3A 1XC9A 4M5DA 4DV5J 1TVRB 3ZZ0A 5HANA 2YQ3A 4OIXA 2KG1A 5D8HB 2K1RB 3M2VA 4OX9J 1X7VA 3GJQB 2DNOA 3KK2A 3LP2A 2JJ4D 2HNZA 4O3SA 1RTDB 2V4JB 2QYCA 4N7TA 4IR1A 5CYMB 3ZZUA 2ZUAA 3BB5A 1QM9A 3I4HX 1WG5A 4G1QB 3J7Z5 2H4WB 1UVIA 4M5HA 1XMOF 3DOKB 1DARA 4IYQA 3SSRA 1V3ZA 1RT5B 4NLTA 3PJWA 4CO0A 1JJ4A 3P5BP 4NZ0A 4UUXA 1JLEB 1PC4A 3ILJA 2OMLA 3G8SA 4YR2A 4NLDA 1PBAA 1MWYA 1Q5VA 5DS7A 1U25A 1VBXA 2XWXA 1H98A 1X60A 3CUNA 4ZA1A 4ED7A 3KLFA 3X1LB 1WF1A 2I5JB 1FNOA 3RB0A 1OYEA 4DR3F 3HHLC 1O8BA 2ZWOA 3KWMA 1SKSA 1YJUA 1UJ5A 2OEJA 1GT8A 3M8ZA 4NZ7A 1KEKA 1Y00A 4ERDA 4WKRA 5GAEI 3L9ZA 2MB0B 4UQTA 3HP6A 3JS9A 1QAJA 2OKQA 1QDUB 3CJRA 3BGOP 3DU5A 3PRDA 4J7CA 3BGRB 1U1MA 3UD4P 2CJYB 1U7LA 1LWCB 1HD0A 1SKUB 2HIYA 1RCXB 1VI7A 2F8HA 3FRYA 3HHEA 2KHDA 3D6TB 3WX8A 1S7IA 3OTCA 4LRAA 1R8PA 2AZ3A 3THPA 2AD9A 1FRKA 5KG5A 3K59A 4QIWD 4USMA 4TY8B 2DHGA 2FTRA 2VFUA 4KPYA 2BBEA 4CWBA 3MPDA 1MWQA 2DR8A 1XIQA 2AYGA 2DNZA 3F56A 3KK1A 5D4OA 3PXGa 3EDRB 3VGVA
chains in the Genus database with same CATH topology
2QV6A 3MAAB 4OYZA 4CLKA 3ET6A 4OYMA 1WC3A 2BW7A 4USWA 2GVDB 3MR7A 4P2XA 2WZ1A 4OYPA 4OYXA 3C14B 2W01A 5IV4A 1CULA 4WPAA 1CJUA 1U0HA 1CJKB 1CS4B 1WC0A 4OZ3A 4CLWA 4USTA 1CJTB 1TL7B 5D0HA 4CLTA 4CM0A 4OZ2A 1WC4A 5IV3A 4OYAA 4NI2B 4USVA 4CLPA 2GVZB 1YBUA 1CULB 4OYIA 1Y10A 1U0HB 1CJVA 4CLSA 4WP8A 3R5GA 1WC6A 3C15B 1CJKA 4P2FA 2GVDA 4CLLA 4NI2A 4CLZA 3G82A 3G82B 2GVZA 1FX2A 4OYWA 1Y11A 1YBTA 3UVJA 3MAAA 1CJUB 4OYBA 3C15A 5D0RA 1YK9A 5D0GA 1AZSB 1FX4A 1CJVB 3ET6B 1WC1A 4USUA 5D0EA 1CJTA 4CLFA 3C16B 3C16A 5D15A 4OYOA 4WP9A 1WC5A 1TL7A 4P2MA 4CLYA 4CLUA 3C14A 1AB8A 1CS4A 4WP3A 4CM2A 1AZSA 3UVJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QV6 A;  3MAA B;  4OYZ A;  4CLK A;  3ET6 A;  4OYM A;  1WC3 A;  2BW7 A;  4USW A;  2GVD B;  3MR7 A;  4P2X A;  2WZ1 A;  4OYP A;  4OYX A;  3C14 B;  2W01 A;  5IV4 A;  1CUL A;  4WPA A;  1CJU A;  1U0H A;  1CJK B;  1CS4 B;  1WC0 A;  4OZ3 A;  4CLW A;  4UST A;  1CJT B;  1TL7 B;  5D0H A;  4CLT A;  4CM0 A;  4OZ2 A;  1WC4 A;  5IV3 A;  4OYA A;  4NI2 B;  4USV A;  4CLP A;  2GVZ B;  1YBU A;  1CUL B;  4OYI A;  1Y10 A;  1U0H B;  1CJV A;  4CLS A;  4WP8 A;  3R5G A;  1WC6 A;  3C15 B;  1CJK A;  4P2F A;  2GVD A;  4CLL A;  4NI2 A;  4CLZ A;  3G82 A;  3G82 B;  2GVZ A;  1FX2 A;  4OYW A;  1Y11 A;  1YBT A;  3UVJ A;  3MAA A;  1CJU B;  4OYB A;  3C15 A;  5D0R A;  1YK9 A;  5D0G A;  1AZS B;  1FX4 A;  1CJV B;  3ET6 B;  1WC1 A;  4USU A;  5D0E A;  1CJT A;  4CLF A;  3C16 B;  3C16 A;  5D15 A;  4OYO A;  4WP9 A;  1WC5 A;  1TL7 A;  4P2M A;  4CLY A;  4CLU A;  3C14 A;  1AB8 A;  1CS4 A;  4WP3 A;  4CM2 A;  1AZS A;  3UVJ B; 
#chains in the Genus database with same CATH topology
 3D7S B;  3DU6 A;  3BGL A;  2AWZ A;  3KG4 A;  5I42 B;  3GV8 B;  4GMK A;  3SDE A;  1RAI B;  3KNG A;  2K7J A;  2CNK B;  1PCA A;  4PXD A;  2QG9 B;  4Q0B B;  1VQ4 S;  1MNE A;  3H2L A;  5J2N A;  4X4U A;  1RAJ A;  4LJM A;  3BGR A;  5M2P A;  1H6K X;  1R6V A;  2FUG 9;  4M5I A;  5D77 A;  3ZC4 A;  4TLR A;  2VQF J;  4QWE A;  3T41 A;  3TZX A;  3SYZ A;  2CAJ A;  3CDE A;  3UO0 A;  1M1K T;  2L9N A;  4B9S A;  2GC8 A;  4CCH A;  4URQ U;  3GFX A;  2WZ1 A;  4LF2 A;  4PQA A;  1SPB P;  1NO8 A;  2UUT A;  3HXM A;  2HRY A;  4JI0 F;  4NWB A;  3QRR A;  4OYP A;  5I3Q A;  2Y3Y A;  4NPO A;  4AYB D;  2LEB A;  2E44 A;  3DHX A;  3QWP A;  5EX0 A;  1HI8 A;  3TP2 A;  3CMA S;  4ID8 A;  4LIW A;  2B5J A;  4BS2 A;  2RKI B;  3D4J A;  2MEW A;  3FBE A;  3H7H B;  4YHH F;  1NSA A;  2AX0 A;  3AB2 B;  2BUN A;  4JP8 A;  4RW9 A;  4CH7 A;  3M6V A;  5HQM A;  3I56 S;  1APS A;  3K89 A;  3M6U A;  4RLE A;  4MKB A;  1ZH5 A;  2HNY B;  5K20 B;  2B9Y A;  1IKW A;  4IR9 A;  1VQ8 S;  3TX0 A;  1Q7Y T;  4LF9 F;  3C6U B;  2P9E A;  3J80 Y;  2VU5 A;  4NEZ A;  1PG5 B;  2MHE A;  2Q79 A;  1YJW S;  4NE9 C;  2NLW A;  3TUP A;  2ZH2 A;  3HSD A;  3QWU A;  1XR6 A;  5EN1 A;  2JFD A;  2HWT A;  3T1H F;  4EU0 A;  2FQQ B;  1OQ3 A;  4DFP A;  5E33 A;  4ZHR B;  1M5S A;  4N77 A;  3JSY A;  2HLU A;  4PKD B;  3J7Z T;  2DXF A;  3EM1 A;  3ITH A;  3WIU A;  2XY6 A;  1LWE A;  4KGV B;  3V6K A;  4KO0 A;  1D8Z A;  2VG6 A;  1I94 J;  4XAK A;  4ED0 A;  5CXT A;  2XHW A;  2KG0 A;  1NKC A;  2IY5 B;  5DET A;  1HBU A;  2APO A;  1E6V B;  2RUG A;  2YKN B;  4L3N A;  2BX6 A;  1K0T A;  3KYL A;  1QAI A;  4C3K A;  1V5I B;  4PZV A;  3D1Q A;  3KXD A;  3GV5 B;  1T0T V;  2C3P A;  1S1X A;  2IM0 A;  4AXJ A;  3NS6 A;  4DJB A;  2HEK A;  1R27 B;  1JLQ A;  3DOM A;  1Z2Z A;  2DIS A;  3G96 A;  3J7Y U;  2AKW B;  2ZJQ Q;  4Q45 A;  5HP1 B;  2BW2 A;  2Q6B A;  4OI0 A;  2ACM A;  2RJZ A;  5J2M A;  1REV B;  2DGW A;  1BMQ B;  2CQ2 A;  3BQ2 A;  4KFB B;  2AZ1 A;  2WW4 A;  3JYT A;  1RWK B;  2CQI A;  2I1R A;  5D0R A;  2XY7 A;  3J7Y I;  1SUQ B;  1NDL A;  4D3G A;  3NBP A;  5D0G A;  3ZTO A;  1NKE A;  1YRU A;  5KG6 A;  4O3Q A;  5KAK A;  2R8K A;  2BV3 A;  2M2B A;  3DRX A;  4OX9 F;  4N56 A;  4C98 A;  2KH9 A;  1U1N A;  4F2R A;  5F8N A;  2UVV A;  1FX4 A;  5AXM A;  4B3S J;  2RRB A;  1IWA A;  2M4M A;  5K8O A;  1HBO A;  2DGQ A;  1Y4Z B;  3IG1 B;  1QUV A;  3QO9 A;  1N48 A;  1P27 B;  2KJV A;  2LMI A;  4ZP9 A;  1R31 A;  4BWM A;  3HUL A;  3D3B J;  2FJX A;  4C8K A;  1F0X A;  1N0U A;  1EIY B;  1DTQ B;  4RW6 A;  4O3P A;  1FJC A;  5J2M B;  1OJ4 A;  1Y3K A;  4RX6 A;  4DS5 A;  3HT0 A;  3OHB A;  1NPR A;  3PYD A;  4LRC A;  2NXC A;  3CSK A;  4PEO A;  2D74 B;  6FD1 A;  7FD1 A;  1HYS B;  2HSE B;  4L76 A;  4R0J A;  1MMN A;  4ECY A;  4CTA A;  1LWX A;  1S59 A;  2F40 A;  4USH A;  2W8L A;  4JI1 J;  4X4S A;  2IFX A;  1X9M A;  1UZH A;  1KVI A;  1F9H A;  3CTR A;  3R9L A;  3C14 A;  4WII A;  5L39 A;  3C3L A;  5KFX A;  3R2C J;  5U47 A;  1N52 B;  3LH2 S;  1G2E A;  4PXC A;  2A1B A;  4IKA A;  1RKJ A;  3L95 X;  1JX4 A;  4OYZ A;  1EB0 A;  3ENW A;  2PSZ A;  3EUN A;  1WEX A;  2JSX A;  2EKN A;  4EFA C;  3QIP A;  2XLI A;  4ECZ A;  2U1A A;  1JKH A;  4JI4 J;  2G2Z A;  3T5H A;  2MDA A;  2B4O A;  4KGM A;  4MKY A;  3KHL A;  1LV5 A;  4PRF A;  1IKY A;  1RWN B;  3H2U B;  2KT2 A;  4IG3 B;  2CIM A;  1YHQ S;  4WK3 A;  4XDD A;  4OLO A;  4A8S A;  5BR8 F;  4DQP A;  1A7G E;  1U6F A;  3WHI A;  3IGN A;  4ZLL A;  3JSM A;  4WZM A;  1D0E A;  4USW A;  2KHC A;  3UN3 A;  2ACY A;  1EZZ B;  4Y34 A;  5ETS A;  3MR7 A;  1C0T A;  2GQC A;  4OHY A;  4DU8 A;  4UUW A;  4DZD A;  3R7N B;  2GCF A;  2UP1 A;  1J5O A;  4ZPW R;  3MTK A;  2HHS A;  4I2Q A;  4X62 J;  2RD5 C;  4NL5 A;  3DC2 A;  3ICL A;  4J5O A;  5GAH U;  5HBM A;  2HND A;  3TQE A;  2V34 A;  5CZX A;  1KQF B;  3IFE A;  1TKT B;  1FDB A;  4DSL A;  2C2K B;  3DOL B;  1YTY A;  4HDH A;  4N8O A;  5KG4 A;  4KE5 A;  2BE2 B;  2OPP A;  1VQL S;  3MR5 A;  1FKP A;  4P7T A;  4ZVR B;  3HCX A;  5D0H A;  4FBT A;  4CLT A;  3HJF A;  1WTF A;  4BCA A;  2QGF B;  5IT0 A;  1KOH A;  3HVW A;  2CQD A;  4PWD A;  4WF9 Q;  1IKV A;  2GIQ A;  3E01 B;  5FJ4 A;  5J2Q B;  1HW8 A;  2UVW A;  1Q4R A;  2I2Y A;  3OD2 A;  1TK0 A;  2R3V A;  1RAB B;  3H59 A;  5HBM B;  4ALZ A;  1R0A B;  5HVG A;  2XM3 A;  1RTI A;  2BM0 A;  2V8H A;  4JI1 F;  2CPZ A;  5F8L A;  2YQ0 A;  4O0I A;  2ASD A;  3J7A N;  5GAD I;  3OJU A;  2BJ9 A;  2NYH A;  2EK6 A;  1SC4 B;  2OPR B;  3MI7 X;  3PJX A;  4XTT A;  4C7Q A;  4B9T A;  2X3D A;  3IC1 A;  4Z7Y A;  2A2D A;  5IWA J;  5LMN F;  3UW1 A;  3R5C A;  4EYI B;  1N88 A;  4DOZ A;  2HQ3 A;  3D6H B;  3EGW B;  2IM2 A;  4U8Y A;  4ILM A;  1VR6 A;  4DN9 A;  2YWW A;  1YZ7 A;  8ATC B;  3AQP A;  5HSP A;  1YDL A;  5MAO A;  1UWB B;  3L7P A;  2J9E A;  2AJ2 A;  1XR7 A;  1DUR A;  4F67 A;  4QYR A;  1B7Y B;  1OWX A;  3VQS A;  2UXB J;  2Z58 B;  1X5T A;  3THT A;  3OUY A;  1U8S A;  4DX8 H;  4ETZ A;  1B70 B;  2LP4 A;  1L3V A;  3CME S;  2PGC A;  1RWW B;  2OLW A;  4YHH J;  5DQI A;  4PCQ A;  3UVJ A;  2YKP A;  1VBK A;  3PRB A;  1RE1 B;  2I6W A;  1NK7 A;  5CYQ B;  3N4W A;  2NS1 B;  3NL0 A;  2JZ5 A;  3W9H A;  1PYO B;  2YNG B;  4IG0 A;  4X2B A;  3MGJ A;  1ZA1 B;  2C2O B;  4DSE A;  2FZC B;  4ECX A;  5FLX Y;  4QIV A;  2XGP A;  1KSP A;  1JLB A;  4M5J A;  2CQP A;  1VQ5 S;  5LJ3 Y;  3NNA A;  1WUU A;  2MJU A;  4J9L A;  3CWJ A;  3N0V A;  4FYX B;  5KFE A;  1CSJ A;  4AT1 B;  2OPS B;  2KU7 A;  3V4M A;  3D9B A;  2WTF A;  3R7B B;  2XMT A;  2IRU A;  4LRB A;  4RR5 A;  2EFQ A;  4I4B A;  4J91 A;  2GFF A;  2R8J A;  4DV3 F;  1Q79 A;  1VYA A;  2MST A;  1IM6 A;  4P2S A;  4Q7A A;  1V3S A;  1FKO B;  2L3M A;  2YKN A;  3FSX A;  5KFO A;  1ZM4 A;  2MKS A;  4NMX A;  3R5J B;  1UP1 A;  4PXB A;  4FF1 A;  3W9I A;  1VDH A;  3H4B A;  1FNM A;  2HBZ B;  2VC1 A;  4CLY A;  3MZI A;  2K3K A;  2H3E B;  2DR9 A;  4JI0 J;  3NEK A;  3D6F B;  1Q7L B;  2Q1L A;  1X4G A;  5F0U A;  1TUW A;  2IAJ A;  2V68 A;  3AH6 A;  4ZVT B;  1I51 B;  2GML A;  4P71 A;  4A8X A;  3KLF B;  4DFM A;  2XSJ A;  1CC8 A;  1NZA A;  1BXN A;  2B7B B;  4WXO A;  3OTO J;  4AL7 A;  4DL2 A;  4QCL A;  2HVI A;  2XMA A;  1UTA A;  3U7J A;  3H4D A;  3GYN A;  2ZJP Q;  2R7Q A;  4HAC A;  1FDA A;  3A8E A;  4IOA Q;  4B3M F;  3DRP B;  4A8Y A;  1TL4 A;  3CDW A;  3QGH A;  3QYY A;  4C8M A;  2XMU A;  2HS3 A;  1R8C A;  1U8W A;  5JXS A;  1RIS A;  1U1L A;  4RJV A;  4DCJ B;  4RUH A;  3CCE S;  2G0I A;  3W5X A;  3V5R A;  2DNH A;  3G6E S;  3FJ2 A;  1KQG B;  4ZVH A;  4RNM A;  4KIA A;  1RT7 A;  2BM1 A;  2AGP A;  1UJ6 A;  3AXK A;  1U47 A;  1R0C B;  4DSF A;  4DR2 F;  1NJX A;  4WPA A;  4Q8E A;  1QVG R;  2BJD A;  1CJK B;  3KK1 B;  4KC5 A;  3AQO A;  4P9S A;  2B9E A;  4ZPV R;  4FDF A;  5F8G A;  1TR0 A;  1WHV A;  1KHW A;  4MKA A;  2R7T A;  3IBF B;  2V69 A;  2FC8 A;  1U48 A;  1NK0 A;  3GPA A;  2BOA A;  1RDR A;  1S4F A;  4YDX A;  5A76 A;  4ZVG A;  3MM5 B;  5KFT A;  2WOM A;  2DNY A;  4PAA A;  4UOG A;  5E7O B;  5J1P A;  5KFJ A;  2OP5 A;  1SC3 B;  3ZZZ A;  4JI5 F;  2Y1L B;  2R7V A;  4X66 F;  2NXU A;  5DM6 Q;  2LCW A;  1ZZN A;  2XNQ A;  2HFS A;  4JBC A;  1HNW F;  5C7P A;  5KFP A;  1WKJ A;  2D3U A;  2QSF A;  4GKK J;  2OJ3 A;  4ZIW A;  3GQC A;  1S0N A;  4HHJ A;  1YRX A;  2VZ9 A;  2JL9 A;  1EET B;  5LSL A;  4TU8 A;  5KFU A;  2LQ5 A;  1RJJ A;  3C15 B;  3ILI A;  1SJF A;  1IBK J;  1HWL A;  2MQQ A;  4C8O A;  5H9F K;  3TYT A;  3O2I A;  2Q43 A;  2Y0S D;  3KUG A;  3RB3 A;  3M7V A;  4CLZ A;  3AXM A;  5I3U A;  2MKJ A;  2IA0 A;  2DCU B;  3PFE A;  3FBF A;  4GVL A;  1Y0H A;  3AOD A;  2FJV A;  3GIM A;  3CCQ S;  4NYP A;  2DYA A;  1Z4U A;  5E3P A;  3Q23 A;  5KFQ A;  2YNH B;  1LOU A;  2V2K A;  1H2V Z;  2CDR B;  2NSC A;  2RU3 A;  2XZW A;  3S01 A;  4LQ9 A;  2J9C A;  1YJN S;  4NXN F;  2VOP A;  1MMD A;  4L75 A;  3I31 A;  4JI8 F;  2EBG A;  3PHE A;  3MR6 A;  2F4F A;  2F9J A;  2DEJ A;  2GO9 A;  4O0N A;  2LA6 A;  4DSK A;  3SQG A;  5FDL A;  1CC7 A;  1ZAX A;  2CPE A;  2HQG A;  1IKW B;  4DHV A;  4ECS A;  3V6H A;  2C28 A;  3D68 A;  3U1N A;  4LFA F;  4QR0 A;  3GR1 A;  3ITH B;  5DO2 A;  1Q1K A;  1LW2 A;  3ZNU A;  5C25 B;  4ILR A;  4HHU A;  4K4Z A;  1KN6 A;  4FS1 A;  4OX7 A;  3QFW A;  4NLR A;  2MQP A;  4EBC A;  4OZL A;  1I5O B;  3DFE A;  3NY0 A;  5AT1 B;  3OTD A;  2CJA A;  1TFW A;  1T3O A;  2B6A A;  5J1N A;  2HMI A;  1UZD A;  3V4I B;  3FQL A;  2YNH A;  4KQZ A;  1F60 B;  1JLG B;  2YX7 A;  3I32 A;  4ECW A;  2JDJ A;  1O0P A;  1ICE B;  2J7K A;  2ZOM A;  1RT6 B;  4KV8 B;  4LSL A;  4Y2K A;  1WF0 A;  2VG7 B;  3HM9 A;  4DR1 F;  1W2I A;  2I8E A;  3NOC A;  1M5K C;  2HZC A;  5KOW A;  3MM9 A;  3C16 A;  1E6V A;  3GG0 A;  3QSI A;  3HVR A;  2OPQ B;  4GC7 A;  4FBU A;  1WOS A;  1CEZ A;  2Y0B B;  2VIC A;  2W25 A;  3QID A;  1S57 A;  3WIV A;  1C2P A;  1S1V B;  5A8W B;  3C19 A;  3J81 Y;  1KS2 A;  3CDA A;  4L74 A;  3G6X A;  1XNQ F;  1ZYQ A;  3LWM A;  2QN6 B;  3FRZ A;  4K8R A;  3CCV S;  2HFO A;  4C2M A;  3NMR A;  5HMZ A;  5HRO B;  1CS4 A;  3CJ3 A;  2VH7 A;  3HD2 A;  3V81 B;  3OVA A;  3UVJ B;  5LOQ A;  3T3F A;  1WHY A;  3QSY B;  4N8N A;  1M1H A;  2HHT A;  4K2J A;  4KGX B;  4RW8 B;  4OJG A;  1SJ4 P;  3ADA C;  1GTH A;  2PI5 A;  3CB4 A;  3MED A;  3UCU P;  4C9D A;  3NCR A;  3PTW A;  4C48 A;  1X5P A;  2UV8 A;  1PIL A;  2ALZ A;  1B7F A;  2HFV A;  2GIF A;  4F0M A;  1RT1 B;  4QWC A;  2ROE A;  1HI1 A;  1SC6 A;  2YX4 A;  3OBI A;  4QWB A;  1GQE A;  1VK3 A;  3D5M A;  1JNZ B;  3RW6 A;  3BKT A;  3AY0 A;  3DDI A;  3QAE A;  5HAO A;  4DI6 A;  1NPK A;  3K5P A;  4H54 A;  5K8N A;  4F2S A;  4PQU B;  1KOO A;  3R1L A;  3C2P A;  2CWK A;  3OFE A;  1XK8 A;  1KFD A;  1VRU B;  4DV6 J;  3TNV A;  1F5A A;  1RTZ A;  2OPS A;  3HZE A;  5ETO A;  4LFA J;  3U1M A;  2CUY A;  2KM8 B;  4KTQ A;  2ZH1 A;  2VDI A;  3C14 B;  3HO1 A;  2L9D A;  4Q5V A;  1S1U B;  5J1E B;  2HZV A;  1RTH B;  1SQF A;  4JI2 J;  4L73 A;  3CIZ A;  3O6Q A;  1S72 S;  3BF4 A;  2E5H A;  4NLV A;  4ELV A;  1VQO S;  2VJU A;  1U1P A;  2DNM A;  1AUD A;  1NBE B;  1NDP A;  3E3X A;  3HX9 A;  5DQG A;  3K5M A;  1DRZ A;  4JI4 F;  4OQJ A;  3PVX A;  1GMV A;  3O44 A;  1VQP S;  4E0D A;  4FNI A;  4F25 A;  1NSP A;  1TMM A;  4DPO A;  1HHQ A;  1RT2 B;  5IV3 A;  4ZVS B;  4LUB A;  3DGV A;  2PFD A;  4X84 A;  1K44 A;  3PZP A;  4B3R J;  4OJ3 A;  4J9S A;  2XSJ B;  2MQN A;  2PD1 A;  2XZT B;  3EGV A;  3PHT A;  1O51 A;  1PYT A;  1YBU A;  3MUV P;  2VA2 A;  3W2V B;  1TK8 A;  5E5N A;  4JV5 F;  3UR3 C;  2D3Z A;  2VG5 B;  1V9O A;  5HVF A;  2VPZ B;  1UW4 A;  4I2Q B;  2QEX S;  4F0K A;  2L48 A;  5ETL A;  2V94 A;  4TNO A;  3BQ0 A;  4GKJ F;  4NOH A;  2GHP A;  2FB0 A;  1XN9 A;  3M30 B;  4OI4 A;  1HI0 P;  3QT7 A;  4DV0 J;  4N5S A;  1TKT A;  1KC8 T;  2FJW A;  4WZQ A;  2W4P A;  3Q8Q B;  3TW0 A;  2ERR A;  4DR5 F;  4LF5 J;  5KG2 A;  4V19 X;  2DRB A;  1RBO B;  1UFW A;  1RAE B;  2DEI A;  2Q3P A;  3ETO A;  4K59 A;  1RWP B;  4USK A;  3MCM A;  3DDN A;  4I1T A;  3P6Y C;  1TL3 A;  3HF5 A;  2D7S A;  2KFY A;  3JTP A;  4QBU A;  3FCH A;  4QU6 A;  2IRY A;  2GAH C;  1IKV B;  2U2F A;  2OSQ A;  3GCW P;  3VGU A;  3SI8 A;  3U02 A;  4QIG A;  4DV3 J;  4ED1 A;  2V9W A;  2R4F A;  4F02 A;  3H2V E;  2B51 A;  3UNG C;  2MY7 A;  1C1C B;  3M30 A;  4OX6 A;  1LWF A;  2K06 A;  4ZVE A;  1N4L A;  1B0T A;  4TKT A;  2CQ0 A;  5ITH A;  3HHN B;  2V8G A;  2B9X A;  1KBR A;  4LVN P;  2WSE C;  3RBD A;  4A8K A;  1WSV A;  4HL9 A;  3T1Y F;  3IAS 9;  2KFN A;  3H98 A;  3N6M A;  1FWK A;  1U1R A;  1R0B G;  2D9P A;  3H0P A;  1AZS B;  4X66 J;  4ZIT A;  1XBW A;  4N47 A;  5SZT A;  2VJV A;  3RR7 A;  1S48 A;  2GJF A;  4GRS A;  2JVR A;  1ZZF A;  4FS2 A;  1CG2 A;  1RTI B;  3CJQ A;  5AJ3 J;  1KDN A;  1WOR A;  3HD1 A;  2CJB A;  2OUG A;  3SCK E;  3NAH A;  3BZQ A;  4DPT A;  2E29 A;  3EPG A;  3MPY A;  2IMO A;  1W26 A;  3ZZY A;  2LDY A;  2XWY A;  1U02 A;  3KLG B;  4OV1 A;  2XQC A;  1HR0 J;  1OY8 A;  3F73 A;  5J2N B;  4WP9 A;  1YZ6 A;  3SSS A;  3HPO A;  1NJY A;  3BR8 A;  1RQ0 A;  4I6W A;  1HNI B;  1S0M A;  2XMV A;  4DS4 A;  5IC4 B;  4DQI A;  1TEL A;  3VAG A;  3GIL A;  4ILL A;  1OIA A;  2HHQ A;  4I6Y A;  2C2N A;  2R7R A;  4WP3 A;  1X4A A;  4CQ1 A;  3BV8 A;  2QLB B;  1FVS A;  2ZD1 B;  3ELH A;  1GMW A;  1B99 A;  3RGI A;  3I55 S;  4YB1 P;  3PW5 A;  2J0Q D;  2GAG C;  1LKZ A;  2HK2 A;  7FDR A;  4ZLJ A;  5MLC V;  4ZP8 A;  1KNZ A;  3KLE A;  1RAF B;  1U09 A;  4RW7 B;  4DCP B;  2K7K A;  4O4G B;  2M3D A;  4QR2 A;  4YB5 A;  1Q53 A;  3PIO Q;  1U2C A;  3CDB A;  2W7P A;  1HNZ J;  4YME A;  2V8P A;  2B4U A;  2BW7 A;  1FEH A;  2G1H A;  4F0H A;  2KJW A;  3TAR A;  4EO8 A;  3CCS S;  3C6U A;  4MK8 A;  3BPD A;  3NXZ A;  2HBR B;  4A8F A;  4KPC A;  4N76 A;  4ED8 A;  1Y5N B;  4I2P A;  2DD8 S;  3D67 A;  5E41 A;  1M1G A;  2LA4 A;  2VPW B;  4RBT A;  2ZNZ A;  3T6J A;  2NYI A;  3UR0 A;  1FKO A;  2OPQ A;  1UW9 A;  2P2C B;  4WYL A;  1LWE B;  2JLF A;  3N5B A;  3AB4 B;  4CYU A;  5BJR A;  2VG6 B;  4NCG A;  1S6O A;  4CO4 A;  3GIJ A;  2V2Q A;  1KQS R;  1Q8K A;  3BBF A;  1RT3 B;  3OFG A;  2W2O P;  1IM4 A;  2YWG A;  3DLK B;  3U27 A;  4XPC A;  1RP5 A;  1G1X A;  5JJB A;  1N8R T;  3V2U C;  4X4P A;  5AE1 A;  1UA1 A;  2V4R A;  4PR6 A;  1FRJ A;  1F9E B;  2EW9 A;  3CT9 A;  4DPY A;  2XCP A;  3LW5 C;  4C8Y A;  1W2B R;  1FE4 A;  4FPR A;  2FLO A;  3CC2 S;  2HGN A;  2X1B A;  4JV2 A;  2DXD A;  3MEE A;  2V63 A;  2CPY A;  1E6Y A;  1Z2L A;  1T9U A;  4CLS A;  1TMJ A;  4KR0 B;  5LSR A;  1NJZ A;  2L9W A;  3M6X A;  1QY7 A;  1NKB A;  2M7S A;  1QSS A;  5KG3 A;  1XNR F;  1ZAV A;  4I68 A;  1CJK A;  4HLB A;  2L41 A;  2DO0 A;  3JYT B;  3PX0 A;  1NSK L;  4P74 A;  2F4V F;  3UD3 P;  2UUB J;  3VAL A;  4KJI A;  1SUQ A;  3M2R B;  4A4J A;  2JNJ A;  3BSC A;  1Q16 B;  4OI6 A;  3MFI A;  3K0J A;  3ILL A;  1RT7 B;  4BWJ A;  2HHH F;  1IR1 A;  3W60 A;  2N3O A;  2P6S A;  1RWX B;  4URS A;  3MM5 A;  3TWZ A;  4ZCL A;  4DL7 A;  1KVJ A;  3P4U B;  1LW0 B;  1H7W A;  2HQC A;  3PRV A;  3IN5 A;  2DY1 A;  3RRK A;  1K1Q A;  2VKR A;  4JI8 J;  1S0V A;  4ICL A;  3M9N B;  3MCO A;  4CDI A;  5C42 A;  1ZOT A;  1DTQ A;  4RW6 B;  5G0R B;  1UEV A;  3SCJ E;  2YWK A;  3QJP A;  4MFB B;  4DR1 J;  4X65 F;  2HHH J;  3GTY X;  1YK9 A;  1T9X A;  2YBV A;  3Q86 A;  3LOU A;  1RWU A;  2DGT A;  2ZFH A;  1QE1 B;  2MKK A;  1NUE A;  2PFF B;  3D66 A;  2LXI A;  5KFR A;  3ZTS A;  4IRC A;  2ZH3 A;  4TY8 A;  1NK5 A;  4DV1 J;  3OL8 A;  2H4Y B;  1HWI A;  1VQ9 S;  1VGY A;  3R5D A;  2KVQ E;  2J8A A;  1X5O A;  3AD7 C;  4UY8 5;  2DCL A;  3DDK A;  3P45 B;  3CED A;  5GAG I;  4X4T A;  1H0H B;  4X4O A;  1CLF A;  1LNQ A;  1JKH B;  3MM8 B;  5D6G A;  3GON A;  2DR7 A;  2HK3 A;  1DQ8 A;  1RAD B;  4FZV A;  3SEO A;  2KXH A;  4OHW A;  4K50 A;  2QJ3 A;  2DH7 A;  3MMA B;  3PO5 A;  3M8P A;  3R27 A;  4P2M A;  1TL3 B;  3H5X A;  4KH0 B;  4NA2 A;  4YS2 A;  1X9W A;  1LW2 B;  1KKH A;  1NDC A;  1KLM B;  1RT4 B;  1SQG A;  5C25 A;  3JB9 k;  1LK5 A;  4EI2 A;  1Q0N A;  2ILY A;  2E9T A;  2POK A;  1TUV A;  2XHC A;  3A4T A;  1LQ9 A;  2CPJ A;  4NZ6 A;  5KFD A;  5KFC A;  2NQP A;  2YWF A;  3EZU A;  1VLO A;  4M5K A;  4QPX A;  3Q8P B;  4CLK A;  1XER A;  3POT B;  4DQQ A;  5LMU J;  4NEY A;  1C1C A;  2IVF B;  1H73 A;  3FC9 A;  2MSS A;  4LFB F;  1L3K A;  1S1W B;  3OXF A;  2YVS A;  2KYZ A;  4TU9 A;  1FJ7 A;  4KGK A;  4OYM A;  2LXF A;  2B43 A;  2HNY A;  3ZTQ A;  2R2T A;  1FKP B;  2R2U A;  1RCO B;  1WI8 A;  2QLW A;  3S1T A;  3RU0 A;  2VQE J;  2RS2 A;  2YQ1 A;  3G2X A;  3SFG A;  2MQO A;  5C2G A;  3L3C A;  2BJ7 A;  3JSB A;  2CQ3 A;  4ZOS A;  5AXL A;  2RAQ A;  2BQ3 A;  5C24 B;  5BXI A;  4X65 J;  5A0Y B;  2VOO A;  4C11 A;  3HJV A;  3A3N B;  1S9E B;  4NLW A;  2CQ1 A;  4RPF A;  4DDF A;  4NCA A;  2DRA A;  2DKO B;  3RBZ A;  3W5Y A;  4ZHR A;  3VZI A;  2ZH5 A;  1CS4 B;  1R0A A;  1MU2 A;  3MCS A;  5LM7 E;  4NLU A;  4CZC A;  1ZM2 A;  3Q8S B;  5AXK A;  2XY5 A;  1J5E F;  2ZOG A;  4KO0 B;  1GTE A;  3CD5 A;  2W2M P;  3M1V A;  3MWB A;  2M70 A;  5DDO C;  2DGO A;  3LWL A;  3HZG A;  1K8A T;  2R8G A;  3TAN A;  3P3D A;  3HSJ A;  2AMC B;  2EFO A;  2CNO B;  4IDK B;  4D3H A;  4FKY A;  1NEE A;  3T1Y J;  2CQG A;  1TUG B;  1X4H A;  3IS9 B;  4TQS A;  1YLX A;  1N33 F;  4ED3 A;  3SCI E;  5B0A A;  2HQD A;  2XYH B;  1HQU A;  1N0V C;  3DM2 B;  1UA0 A;  1S77 D;  4LF7 F;  2EWH A;  1DQA A;  3NMA A;  1Y10 A;  2K3I A;  4DV7 J;  1W7W A;  3NCQ A;  3W2W A;  2DH8 A;  1T9Y A;  2WBM A;  3NLC A;  1N6Q B;  2LQ9 A;  2B9W A;  2OD6 A;  4DG1 B;  2HIQ A;  2Z2Y B;  1ROF A;  2IBK A;  3CMQ A;  1R6Y A;  4M94 A;  4NCB A;  2W7O A;  3GWC A;  3WC2 A;  1A6L A;  2H5E A;  5CAA A;  4B3M J;  1HQU B;  3DM2 A;  4B02 A;  5KFI A;  2KYX A;  2C42 A;  4OYW A;  3PNI A;  1JK9 B;  1NHU A;  2RQC A;  5LL6 d;  1S1T A;  2QMU B;  3MMB B;  3OQ2 A;  2DPJ A;  2BXJ A;  3IWL A;  1TKZ B;  3C6T A;  3RW7 A;  2UU9 J;  1K47 A;  4JV5 J;  4Y2C A;  2F65 A;  4PXE A;  1N6Q A;  4DBQ A;  2ZHO A;  5HLF B;  1BWE A;  3AD8 C;  3IM8 A;  3K17 A;  3WQP A;  5KFM A;  1PJ7 A;  3DLH A;  3TUZ C;  1S9G A;  4HKQ A;  5K8M A;  3QT6 A;  4LRE A;  4EMD A;  2J7W A;  4HI1 A;  4KBI A;  2C2M B;  1QLN A;  4LVO P;  2JX2 A;  3N9U C;  3FEY B;  2I38 A;  2WW8 A;  2NCK L;  4YR0 A;  2J5A A;  2NXJ A;  3MD3 A;  4HT5 A;  3HVT A;  4LF9 J;  2DVI A;  2M0G B;  1NM2 A;  2RNE A;  4DUY F;  1EHW A;  2KN4 A;  1VFJ A;  1CJT A;  4NA3 A;  3C6T B;  4OJ1 A;  1GNK A;  3KJV B;  5D15 A;  1NND A;  5KFB A;  3MMC B;  4ITS A;  2MGZ B;  2YY3 A;  4ZS6 A;  2HHW A;  4KKO A;  2HQF A;  4HDG A;  1SJQ A;  4BDP A;  4ZCM A;  4QQB A;  2UVU A;  3NGU A;  3OL9 A;  2JLE A;  3IWX A;  2HLT A;  5EWG A;  2IPO B;  2PMZ D;  3ZFV A;  4J37 A;  4RNO A;  2DGX A;  2EEY A;  5L1K A;  4ATN A;  1VQY A;  2GGP A;  4DR5 J;  1AZS A;  4LF5 F;  1X4D A;  5C42 B;  3BGF A;  2O1P A;  2XYG B;  2Z4P A;  4F36 A;  3OV7 A;  2FLL A;  1JJ2 R;  1LWF B;  4DV2 F;  4MFB A;  2DNQ A;  3VAF A;  2JEF A;  4IO1 A;  5T7L A;  3QJL A;  1U24 A;  3NOG A;  5EGY A;  2MGZ A;  4E8U A;  1J2V A;  2MKY A;  1SCJ B;  2QLJ B;  1WC3 A;  3AOC A;  3QT8 A;  3CCL S;  3KJN B;  1IR2 A;  4F4A A;  3KLG A;  4M8L A;  5KT3 A;  1HW9 A;  2DY9 A;  3HKW A;  3PM9 A;  1Q95 G;  1XEZ A;  1MSW D;  5GAD U;  3RB4 A;  3OW2 R;  2AJ4 A;  2BAB A;  3ONQ A;  4DL5 A;  2E9R X;  3CE8 A;  3CCR S;  1HNI A;  1RUS A;  2OHD A;  3N79 A;  3PYE A;  2MKH A;  1CUL A;  2IC3 B;  3T9Z A;  4E98 A;  2VBZ A;  5J2P B;  1HLW A;  3UDV A;  4RW9 B;  5EUH A;  3D3C J;  1ZAW A;  3QLH B;  3A3P B;  1WAC A;  1YQH A;  3MEC B;  2P6T A;  3VAM A;  2AGQ A;  3DRS A;  3TOQ A;  3ZO7 A;  4DL4 A;  2F63 A;  3PX6 A;  3HFV A;  3BN4 A;  1NPP A;  5B09 A;  3HDS A;  3M8P B;  4ZPA A;  1G3O A;  3TVY A;  1FK9 B;  1SJR A;  4RW7 A;  1PYS B;  3TO8 A;  3B54 A;  3HI9 A;  5ETT A;  5A2Q U;  1AFI A;  1CQN A;  2J8S A;  2BRL A;  4MK9 A;  3TA1 A;  4USV A;  1S10 A;  3D0G E;  1A9N B;  2CPI A;  2QYG A;  2ZD1 A;  3TZY A;  3UDL A;  2BRK A;  4HTI A;  3UCZ P;  3AHP A;  3M6W A;  2M9K A;  1ZET A;  2KZM A;  2LDI A;  1CUL B;  3KLE B;  4J9Q A;  2XO6 A;  2D9O A;  2RQM A;  2EI5 A;  2QE5 A;  4LFB J;  3BR9 A;  4K0K F;  3MEC A;  1NHK L;  1YG0 A;  2N82 B;  2RT3 A;  2IDE A;  3DRS B;  1BD6 A;  4KY3 A;  1HQ2 A;  1N5T A;  2FZG B;  3AAW B;  5FLX U;  3NNC A;  2D41 A;  1N33 J;  1UFL A;  2YX1 A;  3D6M B;  4ANE A;  1BQN A;  3EZ5 A;  1ZBT A;  2O3D A;  3M4X A;  1MW7 A;  3GYX B;  3H8Y A;  1O6X A;  2C2Z B;  2FVC A;  3BH6 B;  3FCW A;  1AUS L;  5C24 A;  3PW0 A;  2DR5 A;  4C11 B;  5KFH A;  2C3Y A;  1IN0 A;  1EQM A;  1RT3 A;  3DI6 A;  4RZR A;  3M8Q A;  4IFY B;  1X4E A;  3KLH B;  1X0P A;  4HH1 A;  2AIR B;  1NK6 A;  4RUA A;  1JWW A;  3K8V A;  3CCU S;  1FEE A;  1PSD A;  1N5V A;  3FQK A;  8AT1 B;  2AHO B;  2EXU A;  2RQ4 A;  2X1G A;  3MAA A;  4KV8 A;  2FVR A;  3TEH B;  2FVQ A;  4P72 A;  4RWW A;  3T1H J;  2ZZN A;  1JQG A;  3DLK A;  2AP6 A;  3SIP B;  1LEO A;  3MEE B;  3RR8 A;  2UUC J;  4DPU A;  1YJR A;  5IS2 A;  4DSI A;  2COL A;  2LQ8 A;  1L3U A;  3GZ7 A;  3D1H A;  2ADC A;  1Q8I A;  4NLS A;  3K5O A;  2BE7 D;  1M90 T;  2HYI B;  3T9N A;  2KVI A;  3GLJ A;  4WKY A;  1IWG A;  2G9O A;  4UOH A;  4DFJ A;  1ZTT A;  1BUX A;  4WTY A;  1QSY A;  4I6A A;  2X51 A;  4OI1 A;  4CO2 A;  1GX6 A;  5L9X A;  3VTI A;  2ILZ A;  1TZ0 A;  2E7V A;  1SBR A;  3NWR A;  2GHW A;  2XNR A;  3SXL A;  2DXE A;  5D0E A;  2KI2 A;  3IMQ J;  3VF0 B;  1HYS A;  2BKP A;  4DUZ J;  1SI9 A;  1SH2 A;  2IVM A;  1FXR A;  3R2D J;  4HAC B;  3GSI A;  3BQ1 A;  3BO4 A;  1PAE X;  3PW7 A;  3A8I A;  1T11 A;  5ETK A;  2KXN B;  1OY9 A;  2CWX A;  3LTO A;  1B0P A;  1UJ4 A;  3IA0 A;  3OFH A;  3ETM A;  3FSI A;  2OEM A;  1NXI A;  5IT9 Y;  2QFI A;  2GV1 A;  1HWU A;  2UUA J;  1IKX B;  3CCZ A;  1S7H A;  2B7C B;  4CO1 A;  5EWF A;  3NRB A;  3QGG A;  4JI6 F;  3Q8V A;  4YN3 B;  1S1T B;  4OI3 A;  4AUK A;  1VHF A;  1M5V C;  1X8D A;  1JLC B;  4MKV A;  2RDJ A;  1UVJ A;  4PG7 A;  3GFZ A;  5LSO A;  4F7V A;  3A13 A;  1VMB A;  4NXM F;  5HLF A;  1T03 A;  2EG1 A;  4UZC A;  4C97 A;  3TZW A;  4LMZ A;  5H9E J;  3D0I E;  5E3Q A;  1FTR A;  4RW4 A;  4R8U A;  1B3T A;  4ELU A;  1UMJ A;  5HJY A;  3GJS B;  2E1M C;  1S97 A;  4EZ9 A;  1YI2 S;  1VIX A;  2MKC A;  2K1R A;  3M2V B;  3TJA A;  3KK2 B;  4HVZ A;  2R8H A;  3HVT B;  1X5S A;  2RHS B;  4ZP7 A;  2FY1 A;  1N5Y B;  1R3N A;  5ETM A;  3UFC X;  2W01 A;  2QA4 S;  2BR0 A;  1K73 T;  3GR0 A;  4FXW A;  3K57 A;  1M5O C;  1EP4 B;  2AX1 A;  1U2F A;  1JLC A;  1U0H A;  2ROG A;  3OFF A;  5H9F J;  4ZN3 A;  2AJQ A;  2B8P A;  3DOL A;  2D3O 1;  2NRE A;  1U2R A;  2QO3 A;  3HHK A;  3HFZ B;  1P8G A;  4UST A;  4RU9 A;  3K8W A;  2EC2 A;  3IR7 B;  3KFW X;  3T5K A;  2C1E B;  1X9S A;  1L3T A;  3DLB A;  1GH8 A;  3KHH A;  3I5B A;  4AE5 A;  4FYD A;  2CQB A;  2AV5 A;  1S1W A;  2BAC A;  2W2P P;  4JI6 J;  1RB0 A;  3ZNJ 1;  1FD8 A;  1RAH B;  1RA7 A;  3PEH A;  2BMB A;  2OI2 A;  3RRG A;  3E01 A;  2D69 A;  2XB2 D;  1CPZ A;  4C0O C;  3JTO A;  2UXD J;  3CW2 C;  4ZPB A;  1MLA A;  3ISN D;  1SKR A;  3CCJ S;  3F44 A;  1EP4 A;  9ATC B;  4O3R A;  1U0H B;  5EDW A;  1S4E A;  4KHR A;  5K9F A;  4UT4 A;  1OPZ A;  2OPR A;  3JQJ A;  4X4N A;  3R5G A;  4DR2 J;  4IUF A;  3CCM S;  5FDL B;  3ISZ A;  3UPF A;  1U6B A;  1IQT A;  2DK2 A;  2Y1I A;  1BQM A;  1DBD A;  1SVD A;  2HAF A;  1UVL A;  1JJH A;  2RSQ A;  4TXS A;  2VOD A;  2YKA A;  1U0S A;  1DLO A;  2YNI A;  3B4D A;  5A0Y A;  3BS9 A;  3LP1 A;  1KQK A;  4ED6 A;  4DF8 A;  2HS0 A;  4AXI A;  1WWH A;  1YIJ S;  2XGQ A;  1YWX A;  3QMQ A;  2VIH A;  1N36 F;  2AJ1 A;  4EUV A;  3KOA A;  3QRP A;  2HBY B;  2GJI A;  2DIV A;  4G3I A;  1FX2 A;  1TKD A;  1Y11 A;  3D54 A;  2KRR A;  1AW0 A;  3M1V B;  4OFZ A;  2H5J B;  4C8N A;  1L3S A;  5GME A;  1FRX A;  4LF7 J;  1CJU B;  3LGH A;  5B0E A;  1YSJ A;  4U96 A;  5KFV A;  2PT0 A;  3PFO A;  4DUY J;  1FE0 A;  4MK7 A;  3E8O A;  3GYG A;  3EMT A;  4YDD B;  1X0F A;  2CZ4 A;  1REG X;  2W4D A;  4K4V A;  2V5H G;  5DDQ C;  4Y6I A;  5IT9 U;  2NXN A;  1KVK A;  3M05 A;  2CQC A;  2KM8 C;  1FKA F;  3D28 A;  4P75 A;  1V6H A;  1WEL A;  5D3G B;  2AEF A;  2LKZ A;  4Q2M A;  3P5T L;  4Y65 A;  1T9V A;  1WOO A;  2FHO B;  2H9Z A;  3VZH A;  5JMN A;  4J9N A;  3VAH A;  2HGL A;  4MIB A;  2UUB F;  3LAL A;  1FRM A;  1MML A;  2F7V A;  4NLQ A;  5HJX A;  2WAQ D;  4J9P A;  4DV2 J;  2VFR A;  3VHQ A;  4E2F B;  2DH9 A;  4B9U A;  4V19 J;  2DR6 A;  1AYE A;  3MED B;  1RBL A;  3CJ4 A;  3TRG A;  3HMJ G;  3PDN A;  5HVH A;  1MRO A;  2DGV A;  2FGO A;  5CAB A;  2KTQ A;  3SV3 A;  3H5U A;  3WC0 A;  2LQJ A;  3ISN C;  4H4O B;  4O4G A;  4RNH A;  2KXF A;  5DQH A;  4TU7 A;  4CNZ A;  4LR9 A;  1Q86 T;  1VBZ A;  2GMJ A;  4ED2 A;  4DV5 F;  3G86 A;  4J9K A;  4J9V A;  1EJ7 L;  2IAJ B;  2B4V A;  5CQG A;  1VRT B;  2ZNY A;  3FK4 A;  3IRX A;  3KLI B;  3W8P A;  3Q22 A;  1TKZ A;  4JYA F;  1S1U A;  4A8O A;  1ZA2 B;  2GA7 A;  1B4S A;  3LP2 B;  3UD5 A;  2IYI A;  1OO0 B;  3IGV A;  3MHY A;  4CI0 B;  3PIP Q;  2P9C A;  4CO3 A;  3BSO A;  2DO4 A;  5ETV A;  2MHN A;  2Y9H A;  3MDF A;  4NLP A;  4UTG A;  4R25 A;  2GJ2 A;  3BRE A;  3OTO F;  2CZ9 A;  3NS7 B;  4NCG B;  2H54 B;  1N5Q A;  1IBL F;  3UQS A;  5KTQ A;  3T1A A;  2GVD B;  1H38 A;  2DJW A;  3H90 A;  3L7O A;  3UDC A;  1QJH A;  5IT4 A;  4WIQ A;  1JLQ B;  2BZ2 A;  3DOM B;  3OVB A;  4B3R F;  2Z2M A;  2W9C A;  1Y9O A;  4ZVU B;  2CG4 A;  2MLY A;  4K4W A;  2WB4 A;  3QZ8 A;  1GAO A;  5IM0 B;  1HNZ F;  4KFB A;  4U7U K;  2MLZ A;  2JLG A;  1WG1 A;  1ZPW X;  5ETR A;  5KT7 A;  4OZ3 A;  4QYZ J;  1FHT A;  4Y2I A;  1PGZ A;  3RG6 A;  3DKD A;  3VAK A;  2O01 C;  3NBP B;  2VFS A;  2D3O R;  1FXD A;  3AOA A;  3R5B A;  1JXL A;  4F04 B;  1VJQ A;  1X31 C;  2CYY A;  4W4M A;  4CNY A;  3R97 A;  2XMJ A;  3BGU A;  4NYZ A;  3HT3 A;  4F4Z A;  2ADB A;  2OH2 A;  2VB6 A;  5F8I A;  3IG1 A;  4A8Q A;  3M8Y A;  4PUO B;  3M2R A;  3FZ2 A;  1ITP A;  1HL6 A;  1Y3J A;  3OTE A;  2ZBC A;  2CJQ A;  1DTT B;  1SH3 A;  2EFV A;  1D09 B;  2XSF A;  2ZEJ A;  2R7X A;  4U8V A;  2PII A;  2JOQ A;  3PG9 A;  3CGI A;  3SV4 A;  3Q89 A;  3FCV A;  4PPD A;  3RBX A;  2CKW A;  4NRU A;  5DG9 A;  2ASJ A;  2LQB A;  2NPI A;  4HR2 A;  4ZIV A;  1T03 B;  4EBE A;  1DZ5 A;  3W63 A;  1WC6 A;  4USJ C;  3ENQ A;  3S8S A;  2CPF A;  2CPD A;  2F8M A;  4K4Y A;  4P2F A;  5L8R C;  2VBX A;  3QLH A;  4HI2 A;  4CLL A;  3PAC A;  3RB6 A;  4KHM A;  4QU7 A;  3CUL A;  2E66 A;  2V2Z A;  4NI2 A;  5BYR A;  3KG1 A;  4OZJ A;  3HVA A;  1VQS A;  2ZVS A;  4K4X A;  4PUO A;  1IJF B;  1B0V A;  2EFN A;  1N5Y A;  1FK9 A;  2E5G A;  3G82 B;  4OI2 A;  2MXY A;  3CJT A;  4RNN A;  4QWD A;  2LYV A;  1H3D A;  5IOL A;  4MT1 A;  2OSR A;  2BJE A;  4WFZ A;  2FHJ A;  3BJY A;  5DJB A;  2PMH A;  1F3V A;  3GJT B;  4LF4 F;  1YKW A;  3HK2 A;  2QA2 A;  3MEK A;  2BQU A;  1CVJ A;  4WE1 A;  2IBO A;  3KHR A;  5B0C A;  3MF5 A;  2AGO A;  1FI4 A;  4RUB A;  2Z56 B;  3UN2 A;  4DMZ A;  5T14 A;  3K2Y A;  3GII A;  3TJ8 A;  2B6A B;  3N28 A;  2Q66 A;  1FF2 A;  2L08 A;  4LBI A;  4U67 Q;  4WK1 A;  1XMQ F;  4EO6 A;  5KFN A;  2N4C A;  3MR3 A;  1K9M T;  2HND B;  1UPP A;  4FN5 A;  4NAS A;  3BDP A;  4FVM A;  4DL6 A;  2H1Y A;  1AT1 B;  3PX4 A;  5K14 A;  1RT6 A;  4LSL B;  3ET6 B;  2NUH A;  4JB8 B;  1U26 A;  3M8Q B;  4IFY A;  2RE1 A;  3D2W A;  4DQS A;  4EGL A;  1F2G A;  2RQK A;  2MLX A;  3C16 B;  1G4C A;  3AT1 B;  3R1H A;  1RA6 A;  2WK4 A;  3H42 A;  5A8R A;  1PC5 A;  2JRS A;  3NP5 A;  2ZM6 J;  4DV1 F;  2VFV A;  2FLN A;  5D4N A;  4F4K A;  1BHN A;  2QSW A;  4LRD A;  1RSC A;  3CJ2 A;  1HBN A;  3DI6 B;  3VCD A;  5IZH A;  2N4D A;  1M5H A;  5G4D A;  4DXL A;  3G6Y A;  2ZBP A;  4ZJL A;  5THW A;  5KFF A;  4B3O B;  3V81 A;  3KJF B;  4PAB A;  5GVQ A;  1FXL A;  2ZC4 A;  1HKA A;  4B08 A;  1RXO B;  4CM2 A;  4ZLP A;  4U7C A;  1RK8 A;  2I9S A;  3MAA B;  1RZM A;  2ZE2 B;  4QR1 A;  5F3Z A;  3K5L A;  3QGP A;  1HWK A;  2GZO A;  4MJK A;  3KHG A;  4LF4 J;  5FD1 A;  3OSN A;  2O67 A;  1YRT A;  3W64 A;  1FNX H;  4B3T F;  4LF1 A;  5GAG U;  5KG7 A;  1RT1 A;  2DNR A;  1REV A;  2HBQ B;  2E5J A;  4JV1 A;  4CYU B;  5L1L A;  4O44 B;  3W7B A;  4ES3 A;  1XMQ J;  4EZ6 A;  2JC1 A;  5KG0 A;  4PQU A;  4WWS A;  1NZ8 A;  3DCA A;  2KZZ A;  2Z57 B;  3OR2 A;  3FSY A;  2LEC A;  1WF2 A;  1VQK S;  1FRI A;  3I9Z A;  4IDK A;  2R42 A;  2ZH7 A;  1XMB A;  2C22 A;  2ZH4 A;  4PG5 A;  1F6T A;  3QBC A;  3WX4 A;  1C1B B;  2WB1 D;  3IXQ A;  2BAN A;  4FYY B;  2O5D A;  5KT5 A;  2XMK A;  3DLG B;  3Q8R B;  1XNQ J;  1KD1 T;  3DLE B;  2ZE2 A;  1TL1 A;  2YWH A;  3B78 A;  3QAT A;  4IG0 B;  4L6V 3;  1GEH A;  3A1Y G;  3KKF A;  5HMY A;  3MUT P;  2R9L A;  3GP9 A;  2DPI A;  5RUB A;  1F9F A;  2WSF C;  3NGT A;  4MIA A;  1J27 A;  1HHT P;  1QVF R;  3GU0 A;  4DLE A;  4QYZ K;  4UQG A;  3W2W B;  4F4W A;  4ZVP B;  3FFI A;  5I4M A;  4C8Z A;  4O44 A;  1X4F A;  1LXN A;  3OLA A;  5AXN A;  3G8Q A;  2FHK A;  3H5S A;  3LPE A;  1RT2 A;  4F4X A;  1WC4 A;  2PA3 A;  5EX3 A;  1UCN A;  2F3J A;  4LIR A;  2W8K A;  2HUR A;  2ZBI A;  1RAA B;  2OMO A;  3I96 A;  2G2Y A;  3QGI A;  3EYZ A;  2A3J A;  3Q24 A;  1HR0 F;  2CXE A;  3GMG A;  3MPU B;  2VON A;  1SV5 A;  3BBB A;  1VHI A;  3IBC B;  4MMO A;  3IR6 B;  4RL1 A;  5F3T A;  2IMW P;  5LXY A;  1WJ9 A;  1LW0 A;  1TL1 B;  2A0F B;  3CO9 A;  3R5A A;  4WJB A;  1CJV A;  3Q2S C;  5AJ3 F;  4ZK7 M;  4B9V A;  4F3O A;  3CD0 A;  2B0G A;  3B8H A;  3LP0 A;  5L46 A;  5G0R A;  2NUU G;  3VAJ A;  3Q2T C;  5D78 A;  2DIT A;  2P8I A;  5KFZ A;  4JI5 J;  4W98 A;  4F3M A;  2J6U A;  4OHX A;  1PKU A;  4K5S A;  3O8W A;  4NX9 A;  3TAM A;  3D1O A;  2KO1 A;  2HFN A;  2MYF A;  4A47 A;  1U45 A;  2QTW A;  1R8H A;  3PYF A;  1NJI T;  1FJG J;  1TVR A;  4RWX A;  2R7S A;  2FVS A;  5K5M A;  2IYG A;  2E7X A;  3WBZ A;  5DG7 A;  2V4J A;  4U6P A;  1U1O A;  3ZXW A;  1KON A;  4ED5 A;  4WTO B;  1S9F A;  2FHJ D;  1VQ7 S;  3DRP A;  5H9E K;  1S0O A;  2HAI A;  4KGZ B;  1FJE B;  5DLG A;  3RJM B;  4BLG A;  4A8M P;  3NGS A;  5E3R A;  2NPF A;  2AJF E;  1PBU A;  1QAX A;  5IXU A;  1YIT S;  1EAY C;  2HPU A;  3A12 A;  4JOU A;  1DJ0 A;  2HRU A;  1LK7 A;  3MMA A;  3OTB A;  3TAM B;  2E7W A;  1VIS A;  3EVO A;  4J9R A;  1BQM B;  2DNK A;  4LF6 J;  3OXL A;  5KFW A;  1VC5 A;  3N5F A;  5B0D A;  3CJK B;  3I4P A;  5HL7 Q;  3TA2 A;  4RUC A;  3FZB A;  2QL7 B;  2ZWP A;  4J90 A;  3AJ2 A;  1ZM3 A;  5M2U A;  4IFV B;  1PIE A;  1UVM A;  2ZH6 A;  4DWI A;  2DNL A;  3MPV A;  4IH5 A;  1FFG B;  1HNV A;  3B4M A;  2GHV C;  4PG8 A;  3T6B A;  3RZA A;  2M8D B;  3WZ0 A;  5KFG A;  2PO4 A;  4AQY J;  3L7U A;  2G0J A;  4H4M A;  5T7L B;  4ECU A;  3MAH A;  2N3L A;  3NAI A;  4RKU C;  1NSQ A;  1VBY A;  5HK4 A;  2JEI A;  1IBM J;  1TL7 A;  2HW3 A;  2W7A A;  1D9A A;  4F50 A;  4I64 A;  1RU2 A;  2D1C A;  1JMT A;  4DN0 A;  4R5P A;  1WHX A;  3A8K A;  4DR6 J;  2A2C A;  2MQL A;  5E0O A;  1S99 A;  1PJ6 A;  4J9U E;  5IQ6 A;  2QFJ A;  3GG1 A;  3CF5 Q;  2QV6 A;  2RVJ A;  3M8R A;  3VAI A;  1YJ7 A;  2ZDP A;  4M63 A;  2VQF F;  1N34 J;  1EET A;  3OUY B;  2DHA A;  2G2O A;  1HNV B;  2BE9 B;  2VPY B;  2X3G A;  3ENA A;  1FO1 A;  5GMK a;  5GAH I;  4IQX A;  5B7W A;  4WE1 B;  1WOP A;  4ZCI A;  2R2R A;  4C0B A;  2W2Q P;  2WHO A;  2FJA B;  5CYQ A;  3T19 A;  3VGS A;  4H4M B;  2MPU A;  4LF6 F;  4B17 A;  1TKX B;  2CVI A;  1A0O B;  4LR8 A;  2G1D A;  5EWE A;  1NJW A;  3RYL A;  1XQI A;  2W9A A;  2UZA A;  2NR0 A;  3JQK A;  1HPZ B;  2X1A A;  1OSC A;  1KWM A;  4FYW B;  3HSG A;  4JUZ A;  3CNQ P;  4ZLN A;  3KUE A;  5CH7 B;  3QRQ A;  2RH3 A;  4I2P B;  3IO1 A;  2J9D A;  5CZV A;  1RKI A;  2VBY A;  4F4Y A;  4IO9 Q;  4B3T J;  1Q78 A;  3KK3 B;  3TQ1 A;  4GKJ J;  1SJ1 A;  2NSB A;  4LR7 A;  4B9L A;  2PC6 A;  1VRT A;  4NA1 A;  2MJN A;  2B5J B;  2RB7 A;  4OZ5 A;  3IRX B;  3KLI A;  2YNF A;  1NCL A;  3ZZP A;  1N54 B;  3FBB A;  1TU0 B;  2VL1 A;  3H20 A;  4GVB B;  5HO4 A;  2V0N A;  2XUL A;  4C0H A;  3GIR A;  2LLZ A;  4Q8F A;  1T3N A;  2E1P A;  1Y5I B;  2EFG A;  1F5C A;  2AT1 B;  3DYA B;  3MEG B;  4EK2 A;  5LJ5 Y;  1EQ0 A;  3HHL A;  2DHS A;  4M1K A;  2JEJ A;  1IVZ A;  2F5G A;  4OYA A;  1JLG A;  3BN7 A;  5E3C A;  4DR3 J;  2AQ4 A;  2PMW A;  5LMN J;  4DUZ F;  2E1C A;  2DIU A;  4YB7 A;  2QMW A;  5HMW A;  1ZS6 A;  2A10 A;  2GNK A;  2OO4 A;  2VG7 A;  3FNN A;  1M0S A;  2KKH A;  2UUW A;  4K7Q A;  4C3M A;  4ZN1 A;  3KLH A;  3MOJ B;  1YJV A;  1UVK A;  3TUJ C;  3MR2 A;  4DV7 F;  1E6Y B;  5C2C A;  2LU1 A;  3GSD A;  4GVB A;  3V6D A;  1S1V A;  5A8W A;  4KRW A;  4WBF A;  1WI6 A;  5KT6 A;  2GVD A;  1HFE L;  1S79 A;  2ZUG A;  3H40 A;  4M5L A;  2BDP A;  3ZZR A;  5HN0 A;  3LF0 A;  1RHJ B;  1VIO A;  2AW0 A;  4TN2 A;  2WVD A;  4ZMM A;  4IOB A;  2OIH A;  1RAC B;  2F9D A;  2ZC3 A;  4LF8 J;  3KDO A;  2DTJ A;  2BAN B;  4M5N A;  2IJN A;  1DY3 A;  1JB0 C;  2KL8 A;  1NLK L;  2IJR A;  4CT8 A;  3SFU A;  1BQX A;  1S1X B;  4RO0 A;  5L38 A;  1IQZ A;  2ZH8 A;  2PA8 D;  4HT7 A;  4J9O A;  2CRL A;  1VQ6 S;  2HHV A;  2FJD B;  4AFF A;  3KTQ A;  3IAM 9;  4ICL B;  3EXC X;  4WFY A;  1FER A;  1DTT A;  4EYH B;  2B56 A;  2MZT A;  3I5C A;  2UXC J;  1YVF A;  1TL5 A;  1U49 A;  3V6D B;  2SXL A;  4OHV A;  2FVP A;  3G9C A;  4JI3 J;  4W90 B;  4YQW A;  1TK5 A;  3VGT A;  4HHH A;  4PPZ A;  4ZJQ A;  1SC1 B;  2C2R A;  3M32 A;  2AJ0 A;  1V3R A;  2W9B A;  2FY8 A;  1FRH A;  1SV5 B;  3DLL Q;  4LFC J;  2J0W A;  4DR4 J;  1ARO P;  1QSL A;  2Q6C A;  5J1E A;  2M52 A;  1RTH A;  5AE2 A;  2WOM B;  1IXK A;  4LT6 A;  3Q8U A;  2CJ9 A;  8RUC A;  4QOT A;  3KMS A;  2ATL A;  1DFD A;  1YJ9 S;  2ZBR A;  4G65 A;  2UUC F;  3AJD A;  3P8B B;  4GKK F;  1KHV A;  4C4W A;  5HQL A;  3DOK A;  4DEZ A;  1SXL A;  3DXS X;  1C4C A;  2OFG X;  3I9V 9;  2PDA A;  5F0W A;  3TVZ A;  9RUB A;  5JUM A;  2R8I A;  4ZPC A;  1D9D A;  2ASL A;  3R7S B;  4FPI A;  4OYO A;  4A8W A;  4IH6 A;  3I5A A;  4GO7 X;  4UOC A;  3MMJ A;  3QPI A;  4OHZ A;  1I3O B;  2V8D A;  2FJB B;  3BO3 A;  4ED4 A;  1KLM A;  2Y1R I;  3FKB A;  1JNR B;  4OV6 A;  5ETN A;  4WYW A;  3RTV A;  3W2V A;  1UEK A;  4CIO A;  2VG5 A;  2AYM A;  2J0X A;  5CHC B;  4YOE A;  2KT3 A;  3CJS A;  4Y0F A;  4DQR A;  4C6A A;  2BKN A;  2AF6 A;  4CRJ A;  1D9F A;  5IFM A;  1FRL A;  2BJ3 A;  4OZN A;  4Y00 A;  2R7U A;  2IC3 A;  4BBY A;  4ANC A;  5DGB A;  1WEZ A;  2YKO A;  3ET6 A;  1XTZ A;  2VA3 A;  3DHW C;  1IKY B;  2QA1 A;  2XTJ P;  4IG3 A;  1LWC A;  2FLP A;  1EAR A;  3M2U B;  5F8M A;  3BBC A;  2QC3 A;  3QFH A;  3RAX A;  2BOP A;  1X4C A;  5HAT A;  2XO7 A;  4QIF A;  2FGC A;  5T41 A;  3ZZO A;  2C2D A;  2F8E X;  2QL5 B;  3BH7 B;  3DN9 A;  5K14 B;  1T9W A;  3G4S S;  1FDD A;  1Q8B A;  1S9E A;  4JI3 F;  2XEX A;  4DLG A;  2FD2 A;  4L72 B;  4OX8 A;  1SQE A;  5I42 A;  1I94 F;  2VDH A;  2EG2 A;  1NME B;  4KSE B;  1RGV A;  3SDE B;  2XMM A;  2OFH X;  5GMD A;  5A8R B;  2ZHA A;  4J9M A;  2KFZ A;  2DGU A;  3PYG A;  2MZ1 A;  1IJE B;  1UAW A;  1RLC L;  1FWL A;  2LU2 A;  4YY3 J;  2QIF A;  1RTJ B;  2F1F A;  3MD1 A;  3TJ9 A;  1HBN B;  5GAE U;  1TL7 B;  3M2U A;  1FFS B;  4KT0 C;  4ZCK A;  5CCL A;  4OZ2 A;  1G7C B;  3GFY A;  4P10 A;  3B82 A;  2G0C A;  3NG8 A;  3NNH A;  2E9Z A;  1HWJ A;  3WDO A;  3EGZ A;  4PWD B;  1IBK F;  2CQ4 A;  1FDN A;  4P6Q A;  4KAI A;  3ULH A;  2K2P A;  1KTV A;  3PR5 B;  2W2N P;  3HSZ A;  2QT7 A;  1BLU A;  5C5J A;  4ZVQ B;  2DNG A;  1GMU A;  1TAU A;  4ES2 A;  3V6J A;  3AA8 A;  3GJR B;  5IC6 B;  2FJE B;  2XLJ A;  3I87 A;  2X7I A;  5DGA A;  1NB7 A;  5E2Q A;  2GQ2 A;  4ES1 A;  5A2Q Y;  4RW8 A;  1ZPV A;  5L1I A;  5HI7 A;  3CCT A;  3DMJ B;  4QW8 A;  4WFN Q;  1QTM A;  5LT5 A;  2ZHB A;  5ETP A;  2HGM A;  4K4U A;  4FYV B;  3UNY A;  4Y2A A;  5ETQ A;  2C3M A;  1C1B A;  2W24 A;  1U1Q A;  1RLD A;  2H48 B;  4TYA A;  3NWG A;  3Q83 A;  2OAU A;  4WU3 A;  1HNX J;  1FVQ A;  3K7R A;  1MN9 A;  3CJ0 A;  3MM7 B;  1T02 A;  2UV8 G;  4ECR A;  3F0N A;  3MMB A;  3UWT A;  4DX5 A;  3K5N A;  2DBB A;  1BWV A;  2YNF B;  2CAD A;  3OJS A;  2IDL A;  3IP0 A;  1S5Z A;  2VKZ G;  2HHU A;  3SSQ A;  1N34 F;  1N56 A;  2G4B A;  5DG8 A;  2FIU A;  5DZ7 A;  2J6S A;  2WBR A;  3PO4 A;  2XS5 A;  4TYB A;  2N7Y A;  3VVT A;  1XNR J;  1VC6 A;  2R7O A;  3M8S A;  4WU2 A;  3E2E A;  1VK8 A;  5B0F A;  2O66 A;  1RWO B;  3GCX P;  1FFW B;  3LA0 A;  4FKX A;  3PKY A;  3LQV A;  4H4O A;  3P49 B;  2XC9 A;  3DXB A;  2RU9 A;  3GFH A;  1T94 A;  2MY8 A;  2PI4 A;  4WXW A;  4AD6 A;  5DZ6 A;  4CP5 A;  4ER8 A;  1IKX A;  2W1B A;  3RUB L;  1RTD A;  1CJV B;  5HP1 A;  2Y8W A;  2CZV C;  3MM7 A;  3R8Y A;  1OSD A;  4EEY A;  1YGY A;  3T5J A;  2Z0G A;  1WKK A;  3LAN A;  1JIH A;  2XMW A;  3LPY A;  1R89 A;  3MXH P;  3E51 A;  5DRK A;  2A18 A;  3MMC A;  2PE8 A;  4ZVF A;  2ZH9 A;  1PJ5 A;  4WFA Q;  2HRT A;  3MPW A;  5KFS A;  4NLX A;  5BYS A;  4FXD A;  2XZD B;  3LGN A;  2ZOF A;  4X64 J;  1HBM A;  4B9M A;  4MYT A;  2VUG A;  2EVZ A;  3VWS A;  1BGX T;  1HBO B;  1WG4 A;  1AB8 A;  2ROP A;  2GGP B;  2X1F A;  2W9C B;  3ILO A;  1J5E J;  2P5V A;  1VLY A;  3RRH A;  6FDR A;  4KH1 B;  1U1K A;  3CC4 S;  4XK8 C;  4DL0 C;  3Q0A A;  1NU4 A;  4WFB Q;  2FZK B;  1IUJ A;  5DLF A;  4O3O A;  3UN5 A;  3MUM P;  3J7A 1;  1HQE B;  4R0E A;  2XLK A;  2ZZM A;  3EWG A;  3I6P A;  1ACM B;  3CJ5 A;  2VPX B;  3R6G B;  4CTA B;  2QL9 B;  1EX8 A;  1V5V A;  3CD6 S;  4FNH A;  2UXB F;  2CPH A;  5KG1 A;  2KRB A;  4JYA J;  3PCO B;  1F3F A;  1K1S A;  4IQM A;  4ZP6 A;  2YKM A;  5L1J A;  2XI2 A;  4RU2 A;  1SL1 A;  4IFV A;  2RIJ A;  1UPM B;  3AJ1 A;  1T9T A;  1WHW A;  1CBK A;  2AEJ A;  4A46 A;  3DRY A;  3QIP B;  3OL7 A;  3EXY A;  4O4R A;  4DF4 A;  4RBU A;  4BC7 A;  1VOM A;  3I0R B;  5KFA A;  4IOC Q;  1RI7 A;  2E5L J;  1EKS A;  2IRX A;  2BYC A;  4ZPT R;  1KR4 A;  3VVU A;  3AFG A;  4MTP A;  1TV6 A;  3ENV A;  3OR1 A;  3AOB A;  4P7V A;  1C0T B;  2VHG A;  3CXC R;  2EPI A;  3TR5 A;  2RF2 B;  2QMX A;  3M8W A;  4NI2 B;  1TKX A;  2FPH X;  5F8J A;  1LFW A;  2EKY A;  1S6P A;  2GVZ B;  4TY9 A;  3RAM A;  4H4K C;  2WVC A;  2DB1 A;  3SQO P;  2QRR A;  2RKI A;  4OYI A;  2CJK A;  4XO0 A;  3B6B A;  1FA0 A;  1URR A;  1JXV A;  4JI7 J;  1SIW B;  2JHE A;  4DL3 A;  3X3U A;  4OZ1 A;  3N6N A;  2W4C A;  2IM1 A;  4FP9 A;  3TA0 A;  3UCG A;  5CA5 A;  4NYO A;  4CO5 A;  2WSC C;  3CJ8 A;  4UW2 A;  3MAQ A;  4X4R A;  5M2R A;  3TI0 A;  1RT4 A;  3LUY A;  3TVK A;  1Q81 T;  4KHP J;  1KFS A;  3U1L A;  1S76 D;  2ZJR Q;  2DGS A;  2WCX A;  4NLY A;  2HZA A;  2RF2 A;  2B4P A;  1GXT A;  2IJF A;  2RUS A;  2GO8 A;  1C0U B;  4ID5 B;  3IWN C;  1G6B A;  2R2S A;  2GVZ A;  4I7F A;  2H5I B;  4G6V B;  1Q5Y A;  2ZKT A;  3POT A;  5F9N A;  4URG A;  1M5P C;  4UF4 A;  4I56 A;  3QAU A;  3FVY A;  3SCL E;  3O1L A;  5LMU F;  1ELO A;  2MQM A;  2BKO A;  4OYB A;  3FEZ A;  3HKZ D;  5KT2 A;  3NGD A;  1TQL A;  3BPS P;  2NXE A;  1QUP A;  4DV4 J;  3HLU A;  1AXQ A;  2E1R A;  2C3O A;  1I6J A;  4I67 A;  1VQM S;  2ZBQ A;  2DNN A;  2E1A A;  3G71 S;  4I69 A;  4DR4 F;  2VF3 A;  1Y5L B;  4KYZ A;  2DT9 A;  4Q2L A;  4O3N A;  2IIH A;  3MUR P;  3C8Y A;  3PJ9 A;  5CD4 H;  4I7F B;  5EHH A;  1GXL A;  1KTQ A;  3H25 A;  2LEA A;  1RHU B;  5KOX A;  3KDN A;  3BYR A;  2WVE A;  4USU A;  4ETX A;  4FF3 A;  5D4P A;  2CJX B;  3PEJ A;  3QT5 A;  4HH0 A;  1R43 A;  4LSN B;  1N5S A;  3BKF A;  1TP7 A;  2JFK A;  3BYP A;  3BO2 A;  1UVN A;  5L9N A;  3THV A;  3QNW B;  3W5Z A;  3MM6 B;  1JLB B;  1MN7 A;  1XR5 A;  2J76 E;  3IRW P;  2ATC B;  1WC5 A;  2LXU A;  2RIL A;  2Z8Q A;  4HYK A;  4PWU A;  4CLU A;  3H5Y A;  4B9N A;  3KMQ A;  4RBV A;  4L3K A;  2BA9 A;  3QO9 B;  3CIM A;  4K2X A;  1WEY A;  4O23 A;  1S12 A;  1QD1 A;  1VS3 A;  2W9B B;  1H74 A;  2C3U A;  1XWL A;  3CO0 P;  3ZTP A;  3FBC A;  1LXJ A;  1SIZ A;  1Z1Z A;  3NKY A;  1RHK B;  3VR1 A;  4CH1 A;  1D3W A;  1SJ3 P;  3DLE A;  3UE2 A;  4LSN A;  2HVE A;  3TX8 A;  1OS5 A;  1DQ9 A;  3FMB A;  1SL2 A;  3BKU A;  2JVO A;  3CDU A;  3CVK A;  3DNC A;  3L4B C;  3MFH A;  3MM6 A;  1FD2 A;  1XJW B;  2GX8 A;  4ECQ A;  2CPX A;  4YEA A;  1R8A A;  1T05 A;  2WVF A;  4HTJ A;  1FWP A;  4NRT A;  3M9M B;  4QJV A;  4TVA B;  4QW9 A;  4C8L A;  3TZZ A;  1GX5 A;  3TEG A;  4Q43 A;  4K4T A;  5E3A A;  4IRK A;  3S6E A;  3CD7 A;  2H51 B;  1QE1 A;  3NS5 A;  4PYA A;  5B0B A;  3GE9 A;  4G1P A;  4OYX A;  3BSA A;  4M5D B;  2HS4 A;  2V50 A;  1H7X A;  1RHM B;  1VRQ C;  2JH3 A;  1F1B B;  1RHR B;  4K0K J;  2CG8 A;  1BE4 A;  2BJ8 A;  4Z37 A;  4GO5 X;  2Y8Y A;  2AYE A;  3QZ7 A;  1WNE A;  2YWE A;  5A6W A;  4XPE A;  5KT4 A;  2K8G A;  3W9J A;  3KNA A;  3ZTR A;  2XYP B;  1R7I A;  3DLJ A;  1HHS A;  2RHQ B;  5KFL A;  1I1G A;  1L5U A;  2UVR A;  1RT5 A;  2GMH A;  2QZ8 A;  4ENO A;  1O5J A;  1QAY A;  3MOZ A;  1WKL A;  4B3O A;  3EE3 A;  2CA9 A;  3KUH A;  3EX7 B;  1D8Y A;  1UWA A;  2MZR A;  5CYM A;  3PKM A;  2FHM A;  2I5J A;  3OT9 A;  4QPT A;  2GIR A;  2RS8 A;  3EZO A;  1SH0 A;  2IM3 A;  3T5L A;  1JLE A;  3R3T A;  5D4L A;  2BE2 A;  2OPP B;  4PG4 A;  4Q44 A;  2OEL A;  4WP8 A;  2EK1 A;  1R8B A;  1NB2 A;  2M88 A;  2FDN A;  3OVS A;  2J0S D;  4P52 A;  2LFV A;  2HFU A;  3TAQ A;  3GIK A;  3AD9 C;  2RDI A;  4TLQ A;  3QQC D;  3DGP B;  3VQT A;  4Y28 C;  4UOF A;  2V6A A;  4WFX A;  3NGR A;  1NK4 A;  2XCA A;  2MQ8 A;  4ELT A;  3P96 A;  4OZ0 A;  1N32 J;  5DDR C;  2KB2 A;  4ZDN A;  1RWM B;  4NML A;  3CJK A;  3W65 A;  4DUT A;  1RAO A;  2RDD A;  2F4V J;  1D1U A;  2B8Q A;  2HVH A;  3I0R A;  4AQY F;  3DRR B;  4RNF A;  5A8K B;  4NLG A;  1WD6 A;  2E5I A;  2YH1 A;  2J9D E;  2RRN A;  2N7C A;  1P9Y A;  3C15 A;  1SB6 A;  3CCW A;  3FEX B;  3W3S A;  4DZ6 A;  3OR1 B;  1HMV A;  3EGN A;  1YJT A;  4MYU A;  4FF4 A;  2GQQ A;  2M5Y A;  4Q0B A;  4UZB A;  1BC6 A;  4YUD A;  4H4K A;  5I3U B;  3LGM A;  1WTB A;  2BQR A;  4DR6 F;  2YTC A;  4DR7 F;  3DMJ A;  1IBL J;  5D3G A;  4QIE A;  1SL0 A;  4XIU A;  1DHM A;  3EIC A;  5K8P A;  1FT8 A;  4X64 F;  2G13 A;  1GFW B;  3US5 A;  2KT5 A;  5HQ8 A;  1Q82 T;  4LQ3 A;  1NHV A;  2ALY B;  2V2V A;  1OY6 A;  3W66 A;  1MWZ A;  1GK8 A;  2P9G A;  4PYD A;  2YNG A;  3DRR A;  4X4V A;  5BYQ A;  3SQG B;  1B64 A;  4CLF A;  4AL6 A;  1NAQ A;  3UDE A;  1MRO B;  1ULR A;  2HVD A;  4Y3C A;  3NGK A;  4ZVO B;  1FES A;  3TAP A;  3RAQ A;  4WCE Q;  2OGU A;  3EVM A;  1IR0 A;  4PG6 A;  2VFT A;  3BSN A;  3CC7 S;  3G6V A;  3C46 A;  1F2H A;  2LEP A;  1TTH B;  2PEH A;  1U6Z A;  4DX7 A;  1UKU A;  4U9R A;  4I0W A;  2YKQ A;  3SMZ A;  3IR5 B;  4OMF G;  5BR8 J;  1WDD A;  3V4I A;  2DHX A;  1HPZ A;  4Y2M A;  2KDO A;  5F9L A;  4Z7C A;  4U7U D;  2PEB A;  1UET A;  5H1S V;  1S6Q B;  4DV0 F;  3I0S A;  2EFP A;  1XMO J;  2IA6 A;  3MM9 B;  4GC6 A;  4LRF A;  2UU9 F;  5DM7 Q;  1FTC A;  1JXE A;  1JLF B;  1DAX A;  1UL3 A;  3HFK A;  2B3T B;  2CDQ A;  3W62 A;  2CQH A;  1VJW A;  4DX6 A;  1AA1 B;  2Z2L A;  3AA9 A;  3FFI B;  3CPW R;  1VCT A;  1WSR A;  1HBU B;  1OQ6 A;  1RU1 A;  4ZPD A;  4P2X A;  2YPY A;  7AT1 B;  1T7P A;  2J7U A;  3DYA A;  2MZQ A;  1KRP A;  1KLN A;  3BDE A;  2CNN B;  4LFC F;  4AND A;  5HRO A;  1S9G B;  4DSJ A;  4QWA A;  1HBM B;  1RYS A;  3A3O B;  5IM0 A;  2PN6 A;  5IV4 A;  5FII A;  2EC0 A;  2HHX A;  1CQM A;  3I0S B;  2FC9 A;  2XBP A;  4JV0 A;  2HWH A;  4W92 B;  4XDC A;  1S6U A;  1LFP A;  2DNP A;  2MZJ A;  4CH0 S;  3KLV A;  4G1Q A;  3IBW A;  3VV2 B;  2V67 A;  3LP0 B;  4FF2 A;  1CJT B;  1X4B A;  4QZV B;  3KJV A;  1HD1 A;  1BY9 A;  3D0H E;  2WRM A;  3FMW A;  2XS7 A;  4CM0 A;  2ASY A;  5HMX A;  3J80 U;  4KKO B;  4YP3 A;  2ZM6 F;  4CLP A;  1HAR A;  4DV6 F;  2CFX A;  3EPI A;  2OEK A;  3MCN A;  2VQE F;  2J6T A;  1NH7 A;  4P73 A;  2OTL S;  3GB0 A;  3OPK A;  2YPZ A;  5CD4 A;  3KG0 A;  5I3P A;  4F26 A;  4YY3 F;  3JSR A;  2HVZ A;  1H72 C;  4DU7 A;  2BJ1 A;  2R7W A;  1HQE A;  4EWT A;  3L09 A;  4YFU A;  3A8J A;  1PO6 A;  1YBA A;  4JI2 F;  2OD4 A;  4IH7 A;  4KB7 A;  2QLF B;  2A6O A;  4LBP A;  2IVY A;  2NZC A;  2UXD F;  1ZM9 A;  2HKE A;  2CNL B;  2GS8 A;  2V9K A;  2GW8 A;  2YKM B;  5CYJ A;  4LF8 F;  2BEF A;  3EDQ B;  3UI3 A;  1NRK A;  4ECV A;  2C2E A;  2Z30 B;  1N36 J;  2UUA F;  2VAS A;  1OPI A;  1FJG F;  2I0X A;  3G82 A;  3MTJ A;  4BHQ A;  1Q8L A;  5LXR A;  2WON B;  2QLX A;  1VC0 A;  1NDK A;  4IRD A;  2UXC F;  3FUY A;  1YBT A;  4MIW A;  3PR4 A;  4NXM J;  4K5R A;  4RW4 B;  4R8U B;  1HNW J;  4JI7 F;  1TV6 B;  3W1Y C;  5J2P A;  5JVH Q;  4F8R A;  2XG8 A;  2HWI A;  1KP6 A;  1RHQ B;  4F3Q A;  4DPX A;  2CVE A;  3JQM A;  1VQN S;  3PW4 A;  4OJH A;  1HNX F;  2LVW A;  5B0G A;  1N32 F;  3OL6 A;  1WDT A;  1S6P B;  5SUH A;  3TUI C;  3M9O B;  1U4B A;  3JSM B;  4YR3 A;  1RAG B;  5DDP C;  2ZVI A;  3BEG B;  4R5P B;  4V1A k;  5JVG Q;  2WON A;  3EJM A;  3G87 A;  4M5M A;  2VC0 A;  1T95 A;  1J5O B;  1WC1 A;  1C0U A;  4ID5 A;  1QTN B;  3EVW A;  5IWA F;  3J81 j;  2WVB A;  2ZZT A;  4ZJO A;  3QJJ A;  2BVZ A;  2HQI A;  2YH0 A;  3LAM A;  2DRD A;  3N01 A;  3KJQ B;  3MM8 A;  3O5T B;  1HIY A;  3DGP A;  3J81 U;  3C66 A;  3JXO A;  3F41 A;  6AT1 B;  2MZS A;  1K0V A;  4M5G A;  4OLP A;  4CT9 A;  4U95 A;  4B3S F;  4UY8 T;  1URN A;  2QA4 G;  4OL8 A;  3LAK A;  4YB6 A;  4X62 F;  2ZIT A;  3PY8 A;  5AE3 A;  1BQN B;  4DCO B;  4M95 A;  1Y7P A;  3W61 A;  1T8E A;  2VV5 A;  4FVC A;  3GV7 B;  4LSZ B;  2HMI B;  4KHP F;  3OHA A;  3FDS A;  5A8K A;  2Y1J A;  3I82 A;  3FGV A;  4HEA 9;  4N41 A;  3KK3 A;  1S49 A;  2MKI A;  1HA1 A;  1HMV B;  3G8T A;  2VBW A;  1UEU A;  4A48 A;  4EBD A;  5ADZ A;  5IQQ A;  1JJC B;  1GMW D;  2V8V A;  5KFK A;  1DLO B;  2H65 B;  2YNI B;  4BC9 A;  1RTJ A;  1NK8 A;  3LP1 B;  1IBC B;  4ECT A;  4NXN J;  3OR2 B;  5J2Q A;  2DHH A;  3OXG A;  2IHR 1;  2JEG A;  3MEG A;  2ABY A;  3HHL B;  3K58 A;  1P9Q C;  3W8G A;  4DV4 F;  2FYX A;  3Q8Y A;  3ZZT A;  3N6L A;  3DLG A;  2M8H A;  3PV8 A;  1UWB A;  3SZ2 A;  4MAK A;  1TAQ A;  1RYR A;  2AEM A;  2RRA A;  4AL5 A;  1CJU A;  1H2U X;  1PAU B;  1SKW A;  4C3L A;  4PWW A;  2MTL A;  4USI A;  5A6P A;  1WC0 A;  4CLW A;  3JAM Y;  3OLB A;  3OSP A;  4Z2X A;  1MU2 B;  2YXL A;  2QX0 A;  3S7R A;  2EBE A;  2RML A;  2ZDO A;  1AFJ A;  1JLA B;  2JWN A;  2Z2Z A;  2NZ4 A;  1RWV B;  2JC0 A;  3BM7 A;  2VD3 A;  1C4A A;  2V4Q A;  2AYB A;  1VRU A;  1IBM F;  2HG4 A;  4K4S A;  2A6M A;  1OMS A;  3JTN A;  5B08 A;  1TFY A;  3NCP A;  1RBA A;  4NLO A;  3R6L B;  1GXU A;  3IS9 A;  1T05 B;  1MG7 A;  1P6T A;  1S6Q A;  5CCM A;  1UFK A;  2HNZ B;  2E5L F;  4FXV A;  4MH8 A;  1FCA A;  1P1L A;  4LBH A;  5KFY A;  4DPW A;  2HFZ A;  4TQR A;  4DFK A;  2AU0 A;  2XS2 A;  4G1I A;  1JLF A;  3JAM U;  1OYD A;  3RBE A;  2OTJ S;  4S0M A;  5F8H A;  1H2T Z;  1ZTW A;  1YX2 A;  5F41 A;  1JLA A;  1F5B A;  3SBM A;  3IM9 A;  4ZKA A;  1EKR A;  2ZKU A;  3HHD A;  3O3L A;  4X4Q A;  4DG1 A;  3PW2 A;  1NH8 A;  2HHP A;  1W25 A;  2MMY A;  4DR7 J;  1NK9 A;  2XI3 A;  3M32 B;  1P1T A;  3HHL D;  3LO3 A;  1XC9 A;  4M5D A;  4DV5 J;  1TVR B;  3ZZ0 A;  5HAN A;  2YQ3 A;  4OIX A;  2KG1 A;  5D8H B;  2K1R B;  3M2V A;  4OX9 J;  1X7V A;  3GJQ B;  2DNO A;  3KK2 A;  3LP2 A;  2JJ4 D;  2HNZ A;  4O3S A;  1RTD B;  2V4J B;  2QYC A;  4N7T A;  4IR1 A;  5CYM B;  3ZZU A;  2ZUA A;  3BB5 A;  1QM9 A;  3I4H X;  1WG5 A;  4G1Q B;  3J7Z 5;  2H4W B;  1UVI A;  4M5H A;  1XMO F;  3DOK B;  1DAR A;  4IYQ A;  3SSR A;  1V3Z A;  1RT5 B;  4NLT A;  3PJW A;  4CO0 A;  1JJ4 A;  3P5B P;  4NZ0 A;  4UUX A;  1JLE B;  1PC4 A;  3ILJ A;  2OML A;  3G8S A;  4YR2 A;  4NLD A;  1PBA A;  1MWY A;  1Q5V A;  5DS7 A;  1U25 A;  1VBX A;  2XWX A;  1H98 A;  1X60 A;  3CUN A;  4ZA1 A;  4ED7 A;  3KLF A;  3X1L B;  1WF1 A;  2I5J B;  1FNO A;  3RB0 A;  1OYE A;  4DR3 F;  3HHL C;  1O8B A;  2ZWO A;  3KWM A;  1SKS A;  1YJU A;  1UJ5 A;  2OEJ A;  1GT8 A;  3M8Z A;  4NZ7 A;  1KEK A;  1Y00 A;  4ERD A;  4WKR A;  5GAE I;  3L9Z A;  2MB0 B;  4UQT A;  3HP6 A;  3JS9 A;  1QAJ A;  2OKQ A;  1QDU B;  3CJR A;  3BGO P;  3DU5 A;  3PRD A;  4J7C A;  3BGR B;  1U1M A;  3UD4 P;  2CJY B;  1U7L A;  1LWC B;  1HD0 A;  1SKU B;  2HIY A;  1RCX B;  1VI7 A;  2F8H A;  3FRY A;  3HHE A;  2KHD A;  3D6T B;  3WX8 A;  1S7I A;  3OTC A;  4LRA A;  1R8P A;  2AZ3 A;  3THP A;  2AD9 A;  1FRK A;  5KG5 A;  3K59 A;  4QIW D;  4USM A;  4TY8 B;  2DHG A;  2FTR A;  2VFU A;  4KPY A;  2BBE A;  4CWB A;  3MPD A;  1MWQ A;  2DR8 A;  1XIQ A;  2AYG A;  2DNZ A;  3F56 A;  3KK1 A;  5D4O A;  3PXG a;  3EDR B;  3VGV A; 
#chains in the Genus database with same CATH homology
 2QV6 A;  3MAA B;  4OYZ A;  4CLK A;  3ET6 A;  4OYM A;  1WC3 A;  2BW7 A;  4USW A;  2GVD B;  3MR7 A;  4P2X A;  2WZ1 A;  4OYP A;  4OYX A;  3C14 B;  2W01 A;  5IV4 A;  1CUL A;  4WPA A;  1CJU A;  1U0H A;  1CJK B;  1CS4 B;  1WC0 A;  4OZ3 A;  4CLW A;  4UST A;  1CJT B;  1TL7 B;  5D0H A;  4CLT A;  4CM0 A;  4OZ2 A;  1WC4 A;  5IV3 A;  4OYA A;  4NI2 B;  4USV A;  4CLP A;  2GVZ B;  1YBU A;  1CUL B;  4OYI A;  1Y10 A;  1U0H B;  1CJV A;  4CLS A;  4WP8 A;  3R5G A;  1WC6 A;  3C15 B;  1CJK A;  4P2F A;  2GVD A;  4CLL A;  4NI2 A;  4CLZ A;  3G82 A;  3G82 B;  2GVZ A;  1FX2 A;  4OYW A;  1Y11 A;  1YBT A;  3UVJ A;  3MAA A;  1CJU B;  4OYB A;  3C15 A;  5D0R A;  1YK9 A;  5D0G A;  1AZS B;  1FX4 A;  1CJV B;  3ET6 B;  1WC1 A;  4USU A;  5D0E A;  1CJT A;  4CLF A;  3C16 B;  3C16 A;  5D15 A;  4OYO A;  4WP9 A;  1WC5 A;  1TL7 A;  4P2M A;  4CLY A;  4CLU A;  3C14 A;  1AB8 A;  1CS4 A;  4WP3 A;  4CM2 A;  1AZS A;  3UVJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...