1WC5A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp in presence of bicarbonate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
193
Chain Sequence
MRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
total genus 55
structure length 193
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc5A00
1Y11A 4NI2A 4WP9A 1CULA 3C14B 4CLTA 2BW7A 3G82B 3C15B 3C16B 1YK9A 1CS4A 1TL7B 4CM0A 1YBTA 4CLLA 4USWA 4OYMA 4OYAA 1WC6A 2GVZB 4OYPA 4OYIA 5D15A 3ET6A 1FX4A 4P2MA 4CLYA 1AB8A 5IV4A 4CLKA 1CJVB 1CJTB 4NI2B 4WP3A 3MAAB 1Y10A 4CM2A 4USVA 2W01A 4P2XA 4CLUA 1U0HB 4CLSA 5D0GA 1WC4A 3C14A 1CJKB 1AZSA 2GVDB 4CLFA 3G82A 3C16A 3UVJB 2WZ1A 1TL7A 4P2FA 4USUA 4OZ3A 4OYXA 1CULB 2GVZA 1CJUA 4OYWA 2QV6A 4OYOA 1CS4B 5D0HA 4WP8A 1FX2A 1CJVA 4OYZA 3MR7A 4USTA 1WC0A 3ET6B 1CJTA 4CLPA 1YBUA 3MAAA 1AZSB 3C15A 5D0EA 1WC1A 4CLZA 5D0RA 1CJUB 4OYBA 4CLWA 5IV3A 1U0HA 4OZ2A 1WC5A 3R5GA 1CJKA 2GVDA 1WC3A 4WPAA 3UVJA
chains in the Genus database with same CATH superfamily
4NLPA 5GVQA 5FLXU 3SXLA 2CXEA 2RHSB 2QA2A 3SQGA 5F0UA 3CCTA 4OYAA 3KG4A 1DTTA 3OFHA 4LRCA 1HARA 1WI6A 3GB0A 2HNZB 4EBCA 4BHQA 1AB8A 1RLDA 1RBOB 4L76A 4TQRA 4C7QA 5KT7A 4OJ1A 3P6YC 4F8RA 4WP3A 3MAAB 4M5DB 2I5JB 2HVEA 3IM9A 1RLCL 3QATA 4ANDA 2C3PA 2AD9A 4F7VA 3R7BB 4C97A 2DR6A 5H9FJ 3RW7A 1BMQB 4J7CA 2HWHA 4X65F 2L08A 1TL1A 1JIHA 4ZP8A 3FBEA 1E6YB 4QZVB 1JJHA 3TJ8A 1L5UA 2XI2A 3OVSA 2G0CA 2MKYA 2ZHAA 3CW2C 5B0BA 3HHLD 1FXDA 2FUG9 2M8HA 3BGFA 4RW9A 4FF3A 5K8NA 2MXYA 4ZVSB 2QA4S 1NK6A 2ALZA 5B09A 2UVVA 4YDXA 5F41A 4C8LA 1QAXA 1Q53A 1BXNA 2V2KA 1CS4A 1UFLA 4C8ZA 2RQ4A 5HAOA 2W8KA 2P9GA 2RDDA 1FT8A 2DHAA 1OQ3A 1N5YA 2LEBA 3UE2A 3ZZUA 4NPOA 4X4OA 2JEIA 5EUHA 5HN0A 1GMWD 4IRDA 4ICLA 4CRJA 1U2CA 3K57A 1NSKL 2XLJA 1EP4B 3OTOF 4M5NA 5IC4B 3I32A 3HVTA 2FJDB 3CJ0A 1Q8IA 1N6QA 3SSRA 3GG0A 1DTQA 5I4MA 4KBIA 2E5IA 1VYAA 4CH1A 2J8AA 4USHA 3Q8RB 3RRHA 2KXHA 2KT5A 1WI8A 2DXEA 3SCKE 2V50A 3D6TB 1XMQJ 3BR8A 4PRFA 4J9LA 1S7IA 3ENAA 2FYXA 3THPA 5F8LA 3WHIA 5CYQA 3TAQA 1L3KA 2HZAA 2B8QA 2X3DA 3LF0A 1RT3A 2XZDB 5CD4H 3DRPA 2P9EA 1UKUA 4C8MA 5LMUF 5D77A 2AEMA 2NS1B 1YBTA 4LJMA 2YXLA 1IUJA 1ZTWA 2MMYA 3JSYA 1XQIA 1AROP 4NE9C 1S6OA 4G65A 2U1AA 1KLMA 2OUGA 1FRJA 1JNZB 2CQ0A 2XWYA 3HFZB 2PIIA 5CCLA 2HGMA 5DG9A 1SVDA 4F50A 1AZSA 4EBDA 1RGVA 1JXEA 4KV8B 1F9HA 2XB2D 5THWA 1PGZA 2HHTA 2H48B 4YB1P 2IM2A 2VIHA 2C3MA 3B8HA 3TVZA 1RDRA 2V68A 2WSFC 3MM6B 3MM7A 4EUVA 4JI1F 4O3NA 2HPUA 2PD1A 2NUUG 5DDRC 3TAMA 3LALA 3TARA 1LFPA 2B5JA 4ZVHA 2VBWA 1HYSA 2CAJA 3LP1A 4JI7J 1TKTA 3AOAA 3THVA 1F6TA 2HRTA 3CJKB 4PWUA 2MKSA 3CCES 2GQQA 1MMDA 2GIRA 2DK2A 4JUZA 2CYYA 2B9YA 2FJXA 2B3TB 4UOCA 4A8SA 2KHDA 2GX8A 3CJSA 4WZMA 1RTDB 1S9EB 4LFCJ 2PEBA 3JSMB 2LQBA 1HD1A 3IRXB 1TL7A 3EWGA 2IYGA 7FDRA 4ER8A 1CEZA 1EHWA 4OYWA 3T3FA 3PYFA 3VAKA 4ZPVR 3W8PA 3QNWB 1DQ9A 2EPIA 2JRSA 1EKSA 2OEMA 3NL0A 1Q5YA 2F4VF 4MYUA 2WTFA 5ETVA 5JVGQ 3G6XA 3C46A 4LF8J 3EE3A 4QW9A 4N8OA 4KKOB 2UUBF 1YRXA 1N5VA 3K5MA 2H65B 4F67A 2VH7A 2YNIB 3VGUA 3UNYA 1OS5A 3DHXA 4ID8A 1YK9A 4LUBA 3GIRA 4OYMA 1SBRA 3LGHA 4RUHA 2LYVA 3IBFB 4ED0A 4MKVA 5KFKA 3M2RB 2YKQA 4QWDA 3HKWA 2VC1A 4I67A 1H7XA 1IR2A 4NLXA 4U96A 2V8HA 3TX0A 1P1LA 1G6BA 4WIQA 3X1LB 1E6VB 4U8YA 4NXMJ 5C42A 5KT5A 2OELA 4CZCA 3TQEA 2BJ7A 5M2PA 4M95A 4ZCLA 3VAJA 4GVBA 3T41A 4LSZB 2NLWA 2XMJA 1VIOA 1SJ3P 2XC9A 3T1HJ 3M30B 1SJRA 4LBHA 2J0WA 2VG6B 1HBMA 2ADCA 1Q8BA 2HRYA 4IFVA 1CLFA 4LF6F 5I3UA 1HMVA 4ZKAA 2XMWA 4MYTA 1R8AA 3CUNA 4X64J 1TK8A 2LFVA 5A0YA 2C28A 5J2NA 1VK8A 2CJXB 5K8PA 1RT2A 2MPUA 2PGCA 3C6UA 1QSLA 3QIPB 2JHEA 4WU2A 4M5GA 4DV6F 3S8SA 2Y0SD 2V4JA 1R6VA 2QMWA 3W5XA 3VTIA 5T7LB 5K8MA 4WFYA 1X5PA 1IQZA 4LVOP 2QT7A 1W7WA 5DETA 1M90T 4OJHA 1D8YA 5BYSA 4K4UA 1S1XA 3LP2A 2BVZA 2VD3A 4DX6A 2ACYA 3LW5C 1J27A 1NJXA 3NLCA 4MKYA 1HHTP 2RH3A 1VBYA 3BN7A 2OH2A 3P5TL 5B0GA 2OLWA 4DSIA 4MK7A 1NPPA 3NS5A 3KLEA 1S6QB 4U67Q 4FBTA 3HD2A 5E7OB 2B9XA 2BYCA 1HI1A 1IWAA 3DLEB 3DM2A 1F5CA 4DFJA 3QRRA 4KH0B 4JOUA 4XPEA 2WW8A 1FF2A 2DHHA 3OR2A 3RAXA 1S9FA 6FD1A 3G6YA 3ZZZA 2R9LA 2OIHA 1C0UB 3FGVA 1T03A 3IC1A 2BJDA 3AOBA 3RZAA 2LMIA 2A2DA 3IBWA 5H9FK 4RUAA 2RRBA 4WXOA 2HNYB 5L1JA 2C22A 4DQPA 3L7OA 1CJTB 3DYAA 4WK3A 3B4MA 2NXCA 2YNGB 3E51A 3TA0A 5ETTA 3Q8UA 4DV3F 3FK4A 4HACB 5J2PB 4I69A 1VIXA 4EYIB 4CYUA 3ICLA 2DNMA 2ZM6J 2IIHA 3BQ0A 3IAS9 5I3PA 4MIWA 3VR1A 2A1BA 1NK8A 1Y5LB 2IDEA 3H5YA 2W9CA 2VBYA 2UV8G 2FJEB 3T1YJ 4GKJF 2D3OR 2BANA 4DL6A 1IBMJ 2B4PA 1ZETA 1S1UB 1IKXB 1P9QC 2UUAJ 4K5SA 3K5OA 1A7GE 2R7UA 2O66A 3IS9B 2HHVA 1N0VC 4A8KA 2FZGB 2CWKA 2KVIA 4IH6A 3K7RA 3PX4A 1RCOB 3M4XA 2XS7A 2OSQA 3QLHB 2DH9A 3VALA 1HPZB 1VRTA 3OT9A 1YG0A 4K4TA 3KLIB 2ASJA 2YWEA 2FLLA 1LWCB 5KFJA 2ZJRQ 2L48A 2PDAA 4ZITA 2FJWA 2ZHOA 2WRMA 3DOMB 1RWXB 1X4DA 1Q8KA 3KLHA 1CJUA 3BQ1A 2Z58B 1LW2A 4K59A 5LSLA 4Q0BB 5IFMA 4ZHRB 1U25A 3DDNA 1LEOA 1RHKB 3C6TB 1TUVA 1UFKA 2XYPB 3C3LA 4H4MB 1EZZB 4KJIA 2CPDA 4M8LA 4P2SA 2WVCA 4AD6A 2MGZB 1NJZA 1OYDA 1JJ2R 2FY8A 4O3PA 5KFPA 4O0NA 2GMHA 1GXUA 2KO1A 3N01A 3GP9A 3ADAC 1FRKA 2R7OA 4F26A 3SCIE 3BEGB 2J7KA 1KS2A 2DHSA 2K3KA 5DO2A 2ZOGA 2IBKA 1CG2A 3HD1A 5IZHA 3GR1A 1ULRA 1S77D 5CA5A 2CJBA 3PX6A 3KHLA 1T05B 1JLFB 1IBCB 2RMLA 1KQKA 2KKHA 2BQ3A 1ZAXA 3NKYA 4K8RA 4O44B 1KC8T 3BPDA 4A8XA 4LF4J 1MWZA 4JI8F 4I68A 3VCDA 3GSDA 4X66F 1JLQB 3DNCA 2YWHA 3FZBA 2UVUA 2HS3A 1RT4B 2JVRA 2HVZA 3NOGA 3GJTB 1HL6A 5F8MA 3OPKA 3HSJA 2JLEA 3I56S 4E8UA 3BZQA 2PN6A 3OXGA 1MLAA 3C16B 3N9UC 2X3GA 2YNHA 4P2MA 3TVKA 4CDIA 3CD0A 1N33J 4PWWA 3I96A 2DR9A 5F3TA 4DV1J 2FGOA 1TP7A 3SCLE 2A10A 3U1MA 4DCJB 1RQ0A 5AXNA 3DI6B 2Z57B 2ZE2B 4E0DA 3H5XA 1SL0A 2HVHA 1CJKB 5LM7E 4X4PA 2G13A 1O8BA 1IJEB 2VKZG 1GEHA 2HGNA 4Q7AA 2M3DA 1ZZFA 4WP8A 3IN5A 1WHVA 4DV4F 3MR3A 3PHTA 2EFOA 4QU7A 3RB3A 3HMJG 3FCWA 1NH7A 3LANA 4ILRA 2ZUAA 5ETRA 1LOUA 4JI2J 2O1PA 2PMZD 4FNIA 4OI1A 2PE8A 2OPQA 1XR7A 3Q86A 1S6PB 3NBPA 3T6BA 2VUGA 4FDFA 4WIIA 1ZAWA 1KVIA 4FXDA 3G96A 4JYAJ 3DLHA 4USIA 4MH8A 1X0FA 4O4GB 3PW7A 1ZZNA 4OYPA 2VA3A 2DRDA 1JLAB 4RU9A 3RRGA 1X4FA 2YWWA 4KV8A 4PYAA 2IRXA 5E3QA 2EG1A 3A8EA 1WELA 4Y2IA 3BGLA 3BO4A 1ZTTA 2DY9A 1YDLA 2XO7A 1BLUA 3FDSA 2WVFA 1NJIT 3MM6A 2MHNA 2B43A 1XMOF 1HNWJ 1FJCA 2D1CA 2EFQA 4PG5A 4J9SA 3HM9A 2IJNA 1YJRA 3M8RA 3PEHA 1KFDA 3CB4A 2DGSA 1ITPA 2E1MC 1Q95G 1GQEA 3ZC4A 2M7SA 4PQAA 4OZ2A 3CJKA 4HDGA 5KFXA 4P74A 2W7OA 3LWMA 3ZZPA 3LAMA 1EQ0A 1REGX 2MQNA 4AXJA 4M94A 1RT6B 1NK5A 1SC6A 2JVOA 3PW2A 2E29A 3UWTA 3JB9k 5F8HA 1WACA 1Q82T 2B4UA 5B08A 4EEYA 2AU0A 7FD1A 1BHNA 5KG0A 3MUMP 2D41A 3AXKA 1IJFB 5KFOA 4IOCQ 2AJFE 3AOCA 1XN9A 3UDCA 2MB0B 3QYYA 1G1XA 4URGA 3AD7C 3LP0B 1JJ4A 1CULB 1X8DA 3OR1B 1SC3B 2R7SA 5D0HA 4W90B 4KO0A 4OFZA 4BBYA 5M2UA 4C3LA 4K0KF 1GXLA 2XMUA 3QT7A 4DUZJ 4RUCA 2YNIA 2WSEC 2WVEA 4QPTA 3D5MA 4RJVA 4B17A 2PI4A 2MLZA 1DLOB 1BGXT 3OLBA 1IKVB 3GZ7A 1DQ8A 5IOLA 5L9XA 3LH2S 3JAMY 1VQOS 5DDQC 2LQ9A 4K4ZA 4C3KA 3N6NA 4HH0A 5E5NA 4LREA 4LF1A 3FKBA 3ZZYA 4OHZA 2J9CA 2ZDOA 4ED2A 4UT4A 2DVIA 1N52B 1TELA 1UWBA 3A8IA 4OX7A 2EKYA 1NZ8A 1KQSR 2BKOA 1OYEA 3M8ZA 4O23A 4CNZA 5AXLA 5IT9Y 3NS7B 4ZDNA 2MY7A 3HF5A 4U7UK 1FNOA 4Q2MA 3M30A 5B0EA 5D78A 1SB6A 1RBAA 3GQCA 4M5IA 2RF2B 2W2NP 5HVHA 3KOAA 2B8PA 3KK1B 3CE8A 3B6BA 3W2WB 2EK6A 4LFAF 2KDOA 2FJVA 4DL7A 4USKA 1R8HA 5IQ6A 1RT7B 1U47A 4DHVA 3VQTA 2N7CA 4C8OA 1WC0A 5JUMA 5GAEU 3EJMA 2WCXA 4IG0B 3G8SA 3CDWA 3PM9A 1QSSA 2H4WB 2BOPA 2OPRB 1GNKA 2GCFA 1X9WA 2MKJA 5T7LA 4LR9A 2UU9F 3HT0A 5KFYA 3TUJC 5IM0B 2Q3PA 1RA7A 4Y2KA 2IM1A 3PW5A 4JB8B 4UUXA 2F40A 1VK3A 2FC8A 3N5FA 4N7TA 3PIOQ 3ZZ0A 4XPCA 4HEA9 1DZ5A 2BA9A 1FK9A 1K73T 4D3HA 2XNQA 4NI2B 2XS2A 2IVMA 2IFXA 2HWTA 1AFJA 4NXNF 2VONA 2W4PA 2W7PA 4IH5A 2ZBQA 3QT5A 4RW8B 1DQAA 2D9OA 3MEGB 2DEJA 2QLFB 2Z0GA 2XSJA 4X62J 2FY1A 4LVNP 4B02A 3FCHA 1C0UA 3ZZTA 4F4AA 3QFHA 5BYQA 3G4SS 4FYXB 2FTRA 3GJSB 2C2MB 3MUVP 4LQ9A 1WSVA 2QG9B 4WTOB 1YITS 3MECA 3UDVA 1NK0A 3UCUP 2XS5A 4DV7J 1VQPS 1S1WB 3J81j 2J6TA 1VQ9S 1C4AA 2JLGA 5B0CA 3MFIA 1FRXA 1T95A 1TR0A 2GA7A 2OTLS 4DUYJ 2HFOA 3KK2B 3R8YA 4Q5VA 3QSIA 5J2QB 4JI0J 3MEDB 4DLGA 4Y2CA 2CZ4A 2HIYA 4USVA 2VQEJ 2K1RB 3OL7A 3W65A 1IKWA 4ID5B 1S5ZA 2RB7A 4KTQA 1RTJA 1G7CB 2CQ4A 1ZM3A 3GTYX 4WYWA 1MROA 3O1LA 4P6QA 1EIYB 2OTJS 3CIZA 1S1UA 2MQMA 2N3LA 2R3VA 1IKXA 2DGTA 3BO2A 1YZ7A 3GE9A 1S0VA 1NLKL 3K89A 1RAIB 2G2OA 4CTAB 1NSAA 1HFEL 3PACA 4LRBA 1KVJA 2I8EA 2GVDA 4KPCA 1Q7YT 5BJRA 3OUYB 4U9RA 4NLDA 1L3TA 1U1RA 4UQGA 4YHHJ 2E5LF 1TUGB 3R5BA 2DBBA 3VGTA 4JI6F 1LWEB 5FDLB 5IV4A 5A8KB 3W9HA 1XNQF 1U26A 1YWXA 4H4KA 2YNFA 2KN4A 4TU8A 2ATCB 3ZZRA 3UN5A 1T9UA 4KR0B 1VQ5S 4B3TJ 1VISA 4ZHRA 3NCRA 2UXBF 2RRNA 1TK5A 1Q78A 1XNRF 4PZVA 1JXVA 3C6TA 4NASA 3JYTB 3UN2A 3PR4A 3EDQB 3CJQA 3MHYA 3PW4A 1U8SA 2Q6CA 3AAWB 2CPEA 3RAMA 1N0UA 5KT3A 2E1RA 2H54B 4DR7F 3MM8A 4WKRA 4Z7YA 4EI2A 4P7TA 1WKLA 3MCSA 2ROGA 2VG7B 3H4DA 2J0QD 2KZZA 2J9DA 2AJQA 1HBOB 3KK3B 4I6YA 4O0IA 1OSCA 1ZA1B 4RBVA 3FRYA 2HZCA 4LF5F 4CO2A 4YN3B 2ILZA 5EN1A 4UOFA 4X65J 1T05A 1YLXA 1RKIA 4G3IA 4F4WA 1URNA 5D15A 4AUKA 4DG1B 3PW0A 2IRYA 3NP5A 2CPXA 2MQ8A 5HBMB 2QZ8A 4ELVA 4IOAQ 2O01C 4QJVA 3W3SA 3HFKA 2VASA 1JLQA 3RBZA 3ONQA 4WE1B 3RG6A 3I4HX 1RT4A 1RACB 3VWSA 3N28A 3WX4A 2BOAA 3C19A 2E7XA 2UV8A 2DD8S 3QGIA 4KPYA 4DQSA 1RKJA 1G2EA 1R89A 1NB2A 5I3QA 4OZ1A 1TK0A 2JJ4D 5F3ZA 5D0EA 1FRMA 1S99A 2GNKA 2EVZA 3TUPA 4KC5A 1QM9A 2XGPA 2NYHA 1MG7A 4KGKA 3MCMA 1WC3A 2FVSA 2ZKTA 3OTOJ 4OX9F 3NMRA 3SSQA 2HHXA 5H1SV 4CNYA 3QAEA 3MM5B 1F2HA 3MF5A 1SKWA 3DI6A 3K17A 1HIYA 3M2UA 2ZE2A 3VGSA 3W60A 4DV0F 2MZSA 1T3NA 4DQIA 2EXUA 3D3BJ 4DZ6A 3TVYA 2EKNA 1T11A 3CXCR 1B0TA 2DXFA 1O0PA 2W4CA 3E2EA 2DT9A 5D3GB 1XC9A 5RUBA 2N7YA 2OI2A 3JQKA 1REVA 5LMUJ 4G6VB 1LW0B 1Z2LA 4UY85 4CI0B 4Q2LA 2Z2LA 1S6PA 4PWDB 3GFXA 2GJIA 2YQ1A 4USTA 3GU0A 1QDUB 1YBAA 2VG5B 4C8NA 3X3UA 1JLEB 4DR1F 3M8SA 1V3ZA 4X84A 4O4GA 1JLAA 2A3JA 5KFCA 1D8ZA 1XERA 3R5GA 4NCGA 1TMJA 2AJ0A 2V4QA 3OBIA 4IG3B 2KG1A 2K06A 2HQCA 4HHJA 3C15B 4ES2A 1JJCB 4DL4A 1RWUA 1RTIB 3ILJA 1HI8A 3V81B 1LXNA 1FEEA 4BWJA 4LIRA 1FKAF 5EWFA 1RISA 2Y8YA 3A4TA 4QR0A 2WOMB 4ELTA 3PTWA 1UPPA 2BMBA 4X4UA 2XY7A 1VHFA 2GHVC 3FBCA 1BQMA 4ELUA 4JI1J 1SV5B 4AE5A 3AT1B 1RWNB 3D6HB 3AJDA 4HVZA 4NYZA 2B0GA 2DHXA 4RNFA 4EYHB 1RAEB 4PQUB 4DPXA 1OY8A 3TX8A 1GTHA 2D3O1 2AZ1A 3GMGA 3CMAS 1RZMA 4A46A 1LV5A 4B9TA 4OZ0A 3PJ9A 1NPRA 3AD9C 1TL3B 4ED4A 3AJ1A 1QE1A 1N36F 2XLKA 3M6XA 3HP6A 4ZIWA 3HHLC 3D2WA 4DR5F 3OV7A 4ZVTB 2FQQB 3PY8A 1U7LA 4ATNA 2QLWA 2SXLA 1U1MA 1RHJB 3HSZA 4Y65A 2FZCB 4P72A 5K9FA 1MMNA 1S76D 2FVQA 2FLPA 3I5AA 3GR0A 3BSCA 4IFYA 3HHEA 2FHOB 4G1IA 2BACA 2DRBA 2EWHA 1BC6A 3KJFB 2CPYA 4NLRA 1AFIA 2UUBJ 1RTZA 9ATCB 4CLSA 4FF4A 3QRPA 1HHQA 4ALZA 3RBEA 3R2DJ 3V4IB 3DRSB 4ZVUB 2JX2A 2P5VA 1QD1A 4QIEA 2VPWB 3R6GB 2KFZA 1NXIA 3PO5A 2P9CA 1WD6A 4K2XA 4M5LA 2Y1IA 4PXBA 2MKIA 4ZIVA 4DFKA 3HT3A 2VJUA 3BDEA 4F3MA 3H5SA 1UW4A 1X31C 2RVJA 3M1VB 3CPWR 1U4BA 2YKNB 4FVMA 1N5SA 4MIAA 3LQVA 3W5YA 3M32B 3LTOA 1ZA2B 3GG1A 3R5DA 2N4DA 5E3CA 2H51B 4MT1A 2WB4A 4TN2A 5KT4A 1HD0A 3M7VA 1AUSL 4ECWA 4AYBD 4LF6J 4LBIA 2MHEA 3K8VA 1UFWA 4ETZA 4UY8T 1IKYA 1JXLA 3A13A 2BRLA 2OEJA 1U0HB 4DI6A 2QRRA 1XBWA 3T5LA 1BWEA 5GADU 4FP9A 1JNRB 4CO1A 3TAPA 4OI3A 3DOLB 3GSIA 3GCXP 5J1PA 2OPRA 1R0BG 4B3RF 3MWBA 3AH6A 4BC9A 4NLSA 4DBQA 3QWPA 1KTVA 1Y4ZB 2YQ0A 2AKWB 3MPWA 5IM0A 4OV1A 4DJBA 3ET6B 4MK9A 3KLGA 4I2QA 2VBXA 2COLA 3WX8A 4CLZA 5DGBA 3IM8A 1R6YA 4ED5A 3WZ0A 3QGGA 1J5OB 1PJ7A 3P5BP 3I5BA 4E98A 4J37A 3DXSX 4NI2A 1M5SA 3CMES 4N76A 2HK2A 2FHMA 1HW8A 3CC7S 1V5VA 2W9BA 1S0NA 2G0IA 3M9NB 2R8IA 5KG1A 3V6KA 2YWGA 2HK3A 2XBPA 2VJVA 3S7RA 2AEFA 3OTDA 5E3AA 4X4SA 3TANA 4BCAA 5CXTA 3RJMB 3MEKA 4L6V3 2AJ2A 2G4BA 4QU6A 1N4LA 2XCAA 1Y9OA 1HNXF 3N79A 2DCUB 3AQOA 4WCEQ 1VQMS 3NS6A 2ZKUA 1KOOA 4DFMA 3DOKA 4NWBA 4R0EA 4PXDA 4FYVB 4U7CA 4FN5A 4TLRA 3RBXA 2GGPA 1WG1A 1S0OA 2M9KA 4KHMA 3PVXA 4YR0A 1FKOA 2X51A 5GAEI 1V3RA 3UN3A 3MMAB 5D0RA 3MR5A 2X1FA 5AXKA 4GC7A 4DXLA 3MUTP 3DKDA 4DV3J 4RUBA 5K14B 2V9KA 1NAQA 3KK2A 2GAGC 3AHPA 2BW7A 3MEDA 2EW9A 2YKMB 2K1RA 4Y6IA 5ETMA 1Q5VA 2G2YA 2WW4A 5GAGU 4QWAA 1B7FA 5G0RB 4P9SA 1LWXA 4LF2A 5DDPC 2DPIA 4GKJJ 2DNZA 4AFFA 1KHVA 3BM7A 1U6BA 4CH7A 3RGIA 3BV8A 3PO4A 3LPEA 2MY8A 3DLKB 3I55S 4J9KA 2GHWA 4DLEA 1RSCA 4JP8A 1P27B 3NNHA 3W63A 3RR8A 5GMEA 4TY8B 1R0AB 1WC1A 1UMJA 2F4FA 4NLGA 2ZBCA 2DHGA 2HBZB 3BSAA 2GJ2A 1NU4A 2DNRA 1WC5A 5A8KA 4OX8A 5IQQA 1I51B 3AA8A 2MLXA 3CCSS 1S1TA 1WOOA 1Y11A 1FRLA 4MFBB 4CP5A 1H3DA 2WHOA 4CH0S 1NHVA 1UETA 3IXQA 2EG2A 2KJVA 1SQEA 1GAOA 4ZPBA 3P3DA 1R27B 1A9NB 1U45A 3JYTA 1M5PC 3DU5A 3H7HB 3A3OB 1SCJB 3VQSA 2YX4A 3DRRB 4RW4B 2JZ5A 4DPWA 3WQPA 2DGQA 3GONA 2HGLA 4IRKA 3V6JA 4NLTA 3FBBA 2G9OA 3PYDA 2XY6A 2GW8A 5AXMA 1XR5A 2AIRB 4QIGA 2R7QA 2OMLA 3R27A 1NPKA 1OY6A 1NRKA 3OFEA 5IC6B 3MEEA 2E9TA 3BGOP 4F0KA 2H5EA 3MAQA 4ZLJA 3KK3A 4NZ7A 2GQCA 2H1YA 1PG5B 3TUZC 1HBNB 2RAQA 4B3SF 5HI7A 3PRDA 1WF0A 1FFGB 1JKHB 4WFXA 5ETLA 1IM6A 3K5PA 5C2GA 2B7BB 5CZVA 3TI0A 1D9FA 4L3KA 2M70A 3R7NB 2ZBPA 4ZVEA 3GIIA 1M5OC 5IV3A 4J9NA 3D6MB 4KSEB 3MFHA 3NCPA 3C8YA 2GO8A 1HQEB 4F04B 2BBEA 3JSBA 2OP5A 2LA6A 3G82B 3EGVA 2DO4A 1FESA 1GMUA 4BS2A 3MMCA 4JI8J 4R5PA 4X66J 4WE1A 5KFTA 3JTPA 3D54A 4FZVA 2VFTA 2ASDA 5C5JA 3KJNB 1C1CB 4GC6A 4LR7A 5JXSA 3VAFA 2XTJP 3GV8B 1U2RA 4I64A 1VBZA 2W8LA 2J6SA 3HHNB 1UA1A 2Q79A 3QIDA 2GAHC 1K8AT 3DC2A 3P8BB 2HBQB 1QY7A 4XDCA 2KXNB 5LJ3Y 3SFGA 3FFIB 3BBBA 4OV6A 2VZ9A 2PEHA 3TW0A 4HHUA 5D3GA 1FA0A 4NRUA 1XJWB 4DV4J 1VBXA 3O8WA 1SPBP 1T9TA 4ZVOB 1ZM4A 3D9BA 4GRSA 2DGVA 4HKQA 4JI3F 4DQQA 1VDHA 4I7FA 1NKCA 2KH9A 3UNGC 1NK7A 2ABYA 2PFFB 5DG8A 1NSPA 4A8OA 2VG5A 3ZTSA 2B9EA 2ERRA 5H9EJ 2CQ1A 1JLEA 5IS2A 3MAHA 3CCMS 2CVIA 4RU2A 3TR5A 3KDNA 4PXCA 1RUSA 1HBUB 1RTHB 4LF8F 2K3IA 4F4XA 1CJVA 1TL5A 2CQIA 4OMFG 1QLNA 2B51A 1TV6B 2QL7B 1VQLS 2V8PA 3C15A 2F5GA 2E7VA 3EUNA 3J81Y 4Q8FA 1NHUA 2XWXA 2BJ9A 3NAHA 5A8WB 2QFJA 4WPAA 1U24A 2F1FA 4RLEA 3C14B 3M8WA 5HO4A 1XMOJ 4CLLA 2V34A 3IGNA 1X9MA 1KR4A 2GVZB 4UQTA 2F9DA 1FX4A 1SJ4P 4NXMF 4DU7A 4J9RA 1QJHA 2CQBA 5LSOA 2ADBA 1X60A 2BE7D 2N3OA 2ZD1A 1O51A 5A2QY 1YJ7A 1FFSB 1UAWA 5CH7B 5HVGA 2JEFA 4C0HA 4K4SA 2IPOB 1T8EA 2UXCF 3T5HA 4N8NA 2PMHA 1GMVA 1SJQA 2K8GA 2ZJQQ 4NLWA 1WDDA 1UZHA 1TL3A 1X4AA 5HQ8A 3M8QB 4TVAB 2A2CA 2MZQA 2J9DE 1Z4UA 3ISZA 5E33A 2HQFA 2ZH4A 4QWCA 1MWYA 3W2VA 5F9NA 1SC1B 4OYBA 2Z4PA 3KNGA 2OPSB 3D0GE 2BE2B 4MIBA 2HAIA 1APSA 2KI2A 4GO7X 5C25B 1X5SA 1BD6A 4FVCA 1F9FA 5D4LA 4ZVGA 1JB0C 3I0RB 1Z2ZA 3G6ES 1DURA 2VPZB 4K0KJ 4KB7A 4ZP7A 1NDKA 4MKAA 4U7UD 1UTAA 1NUEA 1NDCA 2N4CA 4OX6A 1M1HA 2DNKA 2QA1A 2C2RA 2KB2A 5I42B 2CQ2A 4EZ6A 2LDIA 1LFWA 3CTRA 1NKBA 1PJ5A 4B3OB 2W4DA 4ZPAA 1Q0NA 3KTQA 2HIQA 3M1VA 3BGRA 3W9IA 2QN6B 3BPSP 2EC0A 1FKPB 3AQPA 4ES3A 3IWNC 1VMBA 3HK2A 3A8JA 3FSYA 4QR1A 3QBCA 3KJVB 3EVWA 1UP1A 3PIPQ 2Y1LB 1B64A 4HLBA 5CYJA 1WF1A 2I1RA 1WKJA 2H3EB 2VQFJ 3CJ4A 3W9JA 4DN9A 3NGKA 2HG4A 3DGPB 4QWBA 3LOUA 2NZCA 3PJXA 3L4BC 2AW0A 4PUOB 4B9VA 5HSPA 1CBKA 2HLTA 2OMOA 3MTJA 4DX7A 4LSNA 2VFUA 2PT0A 1Y00A 1S9GA 2PA8D 5BXIA 3L7PA 1KONA 3R1LA 4UZBA 2UU9J 5ADZA 4EBEA 3OVBA 1Y5NB 4J9UE 3QT8A 2I9SA 4RNNA 3WC0A 1GH8A 1J5OA 1WORA 4FYYB 2ZNYA 1C1BB 2HMIA 1FE4A 2BUNA 2RQKA 5HROA 2QC3A 5G4DA 4JV0A 2HFUA 4U6PA 3KLFB 2XCPA 4H4OB 4C8KA 2CQCA 1TKDA 4I6WA 2QFIA 4KGMA 2WONB 1HNVB 3W1YC 4KHPF 1IBLF 3DMJB 3TEHB 5DM7Q 4NCAA 2XO6A 1Q16B 2CJKA 4NXNJ 3W61A 1NMEB 4A4JA 3M2VA 1C0TA 2VU5A 3G86A 5KFEA 3H0PA 2MQQA 2XY5A 1S97A 2I6WA 3RTVA 2IA6A 3BF4A 3K58A 3BGUA 2DNOA 3SYZA 1F0XA 4HI2A 4C6AA 6FDRA 4LT6A 5HL7Q 4C98A 3J80Y 4LQ3A 3FC9A 5L1KA 4MAKA 3RR7A 1RT5A 4QIWD 3FRZA 2E9RX 1VOMA 4ANCA 2F7VA 4DSLA 5KFDA 2C2KB 3UVJB 3QT6A 1FE0A 4LFBF 3ZNUA 5GADI 1UJ5A 2QV6A 2M88A 5L46A 3L3CA 4Y34A 3VZHA 4DV5F 1I3OB 1P8GA 2LQJA 2J5AA 3MMBB 4TY9A 1EJ7L 2PSZA 4G1QA 4KY3A 1P1TA 2YPZA 2ZEJA 5ETSA 3MOJB 1RADB 4YB6A 2HHPA 4YEAA 2B4VA 3DCAA 4O3RA 3TZXA 2FVCA 4OQJA 4J9VA 3VGVA 3OXFA 1D1UA 1TL1B 2NUHA 4EFAC 3EX7B 3SI8A 2CNKB 2HHWA 2WBRA 3L95X 3G6VA 1IBKF 2CJQA 2DTJA 3Q23A 3DLKA 2H4YB 3THTA 1Y10A 2KYZA 4CO5A 4KQZA 1QTNB 4NLVA 3CVKA 1ZH5A 2MZTA 2Y1JA 3VAHA 4J91A 4NA1A 1OWXA 1MSWD 4TY8A 1KBRA 4CLFA 2LLZA 3RB4A 5CYMA 1N5QA 5A8RA 1TU0B 2DJWA 1CS4B 3PHEA 2CZVC 3IO1A 4JI6J 3A3PB 4CO4A 2J6UA 1XNQJ 4XIUA 1FI4A 2WVBA 3OD2A 4MFBA 3Q24A 2LEAA 1DJ0A 3VHQA 1D9AA 4WFBQ 5L9NA 3AFGA 1N48A 3EICA 1N5YB 2UXBJ 4N41A 1XNRJ 3HHLB 2FGCA 4EO6A 1AA1B 1L3VA 4TU7A 1VR6A 3CO9A 4HI1A 1U6FA 3LA0A 3HVTB 3UD5A 4DF4A 1FWPA 4DR7J 5DG7A 4USJC 1S59A 5H9EK 3QO9B 3IBCB 4Y2AA 5GAGI 5KAKA 1YJNS 3TEGA 2FLOA 2LECA 5E41A 1GT8A 2UUCF 1YTYA 2DR7A 2OGUA 4LF5J 1RE1B 5A6WA 1B7YB 2CA9A 1JKHA 1QVGR 1ZPVA 2VDIA 2XHCA 1RT3B 3UD4P 2R8HA 3WIUA 3DRPB 2EBEA 1R3NA 3ENVA 2Q66A 3NMAA 2QO3A 1RHUB 1AUDA 4ZPDA 4ECTA 1NJYA 2RHQB 3NGUA 3UO0A 2ATLA 2LCWA 1KLMB 2C3UA 1VI7A 3K2YA 1MW7A 2RE1A 2X7IA 3UDEA 3EXCX 1C1CA 1M5KC 2Y0BB 1RWPB 4RL1A 3QZ8A 1U48A 3CJ2A 1UVNA 2JDJA 4YS2A 4IO9Q 1ACMB 1YRTA 1T7PA 3TO8A 3TZWA 3PYEA 3KG1A 2DGXA 2C2EA 2OAUA 1X0PA 3FEXB 2E44A 5B7WA 3GLJA 2Z2ZA 5DQHA 3CCWA 3HCXA 1FTRA 4DQRA 3GCWP 2XZTB 2G0JA 4ECRA 2W01A 3MOZA 2DO0A 4OX9J 1VFJA 2QL5B 1JLCA 2XYGB 1T0TV 3B78A 3CCUS 2AGQA 5KFRA 3OSPA 5LXYA 2B5JB 4ETXA 2L41A 1T9WA 3DGVA 1FRIA 4DV0J 1VQYA 1TKTB 5EX0A 5J1EB 4IR1A 1X4HA 3CNQP 4IUFA 3U27A 2IY5B 2CNLB 1RU2A 4QYRA 4DZDA 2GJFA 2JFKA 2XLIA 3G71S 1SL1A 5B0AA 2J76E 4BLGA 2CPZA 2DGUA 3C66A 4RW6A 2HZVA 1TL7B 2QX0A 3GWCA 1TKZA 4JV2A 4PEOA 4WF9Q 4A47A 4DR3F 2HQIA 1I1GA 1JLBA 4DR1J 2CQGA 3TRGA 3CWJA 3CDAA 2L9NA 2ALYB 5CCMA 4DDFA 4ED8A 1RTHA 4IRCA 2A0FB 4C11B 2DITA 4MJKA 4L74A 5D4OA 2WB1D 4YY3F 1R43A 1TV6A 2FHJA 2RS2A 3PDNA 1RWWB 2JEJA 1RAJA 3TP2A 1GX6A 4RNMA 3V6DB 5DZ7A 1RJJA 3SMZA 1HWLA 1VLYA 4E2FB 5AE1A 3NWGA 3P45B 4CLWA 2BJEA 3PR5B 1DY3A 5C42B 2ZH6A 1FJGF 4DWIA 5HP1A 5IWAF 5U47A 1HW9A 4GVBB 2DNLA 2YKOA 5KFZA 1SJ1A 2O67A 5C7PA 4ZJQA 1UZDA 1I94F 3MXHP 2MQPA 3QGHA 2IC3A 2P6TA 5HLFA 2YPYA 5CZXA 1WEXA 3B4DA 1RT1A 3GIMA 2Q6BA 5L39A 4IFVB 3BH6B 5I3UB 3CJTA 3G9CA 3SIPB 5A0YB 2PC6A 5J2NB 3ILOA 4FS1A 1N36J 1RT2B 4DR5J 2LEPA 1UPMB 4J9OA 4USUA 2OJ3A 4I4BA 2BE2A 2GIFA 2HNZA 2KM8B 3PXGa 2RU9A 4TLQA 2GV1A 2V4JB 3BB5A 2HNDB 1EB0A 3MAAA 4M5DA 5E3RA 1DFDA 5AJ3F 3IG1B 4RWXA 5CHCB 4NMLA 4NOHA 1YRUA 2I5JA 4WYLA 2NREA 1FDDA 4HR2A 1FNMA 2P6SA 1OY9A 4CT8A 2V0NA 3IFEA 1T3OA 1E6YA 2HQDA 2J7WA 3AJ2A 3FJ2A 4TYBA 2CADA 3E8OA 3H8YA 5KFBA 2ZBIA 3OL9A 4NLYA 2GFFA 1S4EA 4V19X 1EX8A 5E2QA 1KWMA 3VAGA 3T9NA 2F65A 1JLGB 1ZPWX 1FKPA 4DR2F 3KG0A 3DM2B 1S0MA 3BN4A 3ISND 1HI0P 4A8FA 3H4BA 3OR2B 2B56A 5EGYA 2M0GB 1QAYA 2ZJPQ 4OZ5A 3HVAA 3F41A 3HHKA 6AT1B 1S12A 1BWVA 2DXDA 3LO3A 4C4WA 1T03B 1MWQA 1NB7A 4QR2A 4RKUC 3ITHB 3TOQA 3EYZA 2V69A 4KGZB 3BKUA 1EAYC 2ZH8A 2G1DA 4AL7A 4JI4F 3D1OA 3FMBA 2V8GA 5HVFA 1RXOB 4DL2A 3CSKA 1X5TA 1EP4A 1KN6A 3R6LB 1QSYA 4XDDA 3EM1A 4WFAQ 5A6PA 4QIFA 2MKHA 4CYUB 3FQKA 4C0BA 3A3NB 1FCAA 2PI5A 4ECXA 2IJFA 4EK2A 2FC9A 3CCLS 2MLYA 5LJ5Y 1C1BA 2R7WA 5T41A 1K1SA 1UVLA 4LR8A 4AXIA 2M5YA 4EWTA 2XMKA 4CLUA 3A12A 3KLFA 1YSJA 4DPOA 5LSRA 1ROFA 3OLAA 3MI7X 4CCHA 1YJTA 2WONA 3T9ZA 4HL9A 1PJ6A 1LNQA 4O3SA 1YZ6A 4ED7A 4X4VA 4GMKA 2IBOA 3PFEA 1J2VA 2KU7A 2XMMA 2CUYA 4R0JA 4F0HA 2XI3A 1KNZA 2VFRA 1AW0A 5FLXY 3T1AA 1HNXJ 1VRTB 4ZLLA 1VQ6S 2KVQE 2YWFA 3H20A 4RZRA 3H42A 1H0HB 2CQ3A 5F8NA 2FVRA 2OD6A 4PG6A 2YBVA 2DH7A 3Q0AA 1VS3A 3K5NA 3PCOB 4ILLA 1YJ9S 4DS5A 4PCQA 2Y8WA 3ZFVA 3G87A 3OFFA 3KMSA 4YR3A 4P2XA 2HKEA 1O5JA 1RB0A 2IDLA 3I87A 1XMBA 3ILIA 5K5MA 1JX4A 3MMBA 2JH3A 4J5OA 2CZ9A 2CDQA 1U49A 4DS4A 2KXFA 2AYEA 2AMCB 3C2PA 2R2UA 2LXFA 3ELHA 4DFPA 2CVEA 3E01B 2F8EX 4ZVPB 2E1AA 3KHRA 2DEIA 4OHVA 5FD1A 5CD4A 2ZH7A 2LQ8A 2JC0A 3CIMA 1KD1T 3IAM9 1LXJA 1RTDA 5D8HB 1S9EA 3N6MA 3JSMA 4KT0C 2EEYA 1ZBTA 2XG8A 3IRXA 2Y9HA 3I6PA 5T14A 3EPGA 2L3MA 5JJBA 2RSQA 2DGOA 3EPIA 1W26A 3A1YG 2F8HA 2ZDPA 4LF9F 3KLVA 8RUCA 3NWRA 1RHRB 1X5OA 3BKTA 2R7XA 1LKZA 1FO1A 4WK1A 2JSXA 2ZH1A 2BEFA 2R8GA 2WBMA 2CG8A 2FJBB 4P73A 4KKOA 3DLLQ 2DCLA 1RP5A 1H98A 1PAUB 2C2NA 1A0OB 2AJ4A 1U6ZA 1CC7A 2NXJA 3N6LA 4KGXB 1HWUA 2RILA 4OYOA 3SQOP 3M2RA 2YNHB 3HHLA 3PZPA 4USMA 2J9EA 3CT9A 1FERA 1H2UX 2EFPA 1ICEB 1NO8A 1E6VA 4N56A 3MDFA 4UZCA 2FDNA 3QO9A 3RB0A 4PAAA 1V3SA 3UD3P 2RS8A 2R42A 1I6JA 4I1TA 4WP9A 4FNHA 2IM3A 3ENWA 2RDJA 3D4JA 3FEZA 3CCJS 3UQSA 2ZBRA 2BM1A 3JAMU 1KHWA 4WTYA 3BDPA 3CD6S 4AL5A 2VG6A 1YKWA 4TNOA 3NOCA 3ZTRA 1BE4A 4I6AA 3Q89A 5KFSA 8AT1B 4B3SJ 2LU1A 5A76A 4ZJOA 1GMWA 3U7JA 3NRBA 3J7A1 3POTB 5FJ4A 1NKEA 5F9LA 3OFGA 2OPQB 3QIPA 5IT9U 3NBPB 4ZPTR 2KZMA 3H40A 3BBFA 2UVWA 5SUHA 4OI4A 3N0VA 2NXUA 4ZJLA 4ZS6A 1KKHA 1OO0B 2CQDA 2GS8A 4O3QA 4K4XA 4KE5A 2V67A 4FS2A 4B3MF 4DUTA 1TFYA 4IYQA 1SJFA 2V6AA 1CVJA 4S0MA 1SH2A 3BSOA 2R8KA 1D3WA 4X4TA 5AE3A 4F2RA 1TFWA 2W25A 4HYKA 3G8TA 4LF7F 2W7AA 5KG4A 1UW9A 1Q79A 2VPYB 2XMAA 2B9WA 4DCPB 4DR6F 2H9ZA 4NEZA 1IM4A 1SI9A 2ZOFA 1R8BA 4DU8A 1S6QA 3NGSA 2AJ1A 4NX9A 4V19J 3GV7B 1Y5IB 3PG9A 2G1HA 3DLEA 4J90A 1H2VZ 3KDOA 2BJ3A 3M05A 2W2OP 4XO0A 2ZUGA 2Y3YA 1PBAA 3I82A 5J1EA 3SDEB 4ZMMA 4HHHA 3QJJA 3ENQA 4Q43A 5HMYA 1UEUA 4ZP6A 3MTKA 3EZ5A 1WSRA 5LMNF 4EGLA 2AGOA 2NZ4A 3G2XA 2HNYA 3WIVA 1WHYA 1CJTA 3HVWA 2H5IB 1YBUA 4JI3J 2YNGA 4N5SA 1RYSA 2RUGA 1B0VA 3V2UC 4OI0A 2DRAA 2DNHA 1M5VC 5GMDA 3OSNA 4V1Ak 1P9YA 4HACA 4R25A 5J2PA 1WEYA 1W2BR 3KUEA 4IKAA 4Y0FA 3FSXA 3K0JA 2BABA 2E66A 4C11A 3TJ9A 3B82A 4QYZJ 2V8VA 4KO0B 4ZVFA 3D68A 2YH1A 2FB0A 1HNZF 1NCLA 4DR4F 3CJ3A 2E5HA 3V6DA 2CPIA 3FZ2A 1RAFB 3D6FB 1YJWS 1BQNB 3HHDA 3HDSA 4C2MA 3M8PB 2AHOB 1UVMA 2ZC3A 4A8MP 2OEKA 3IS9A 4DMZA 1TUWA 3QLHA 1UWBB 4PG7A 5J2MB 2IYIA 4NLOA 5JMNA 2HVIA 1HPZA 1M1GA 3HZGA 4UOGA 1FDAA 2DY1A 1WDTA 3KLIA 1SIWB 1LWCA 2CNNB 5F0WA 4ED3A 1N32F 5L8RC 3UCZP 2UXCJ 3DOMA 3CC4S 3KMQA 4NRTA 1UEKA 3QGPA 5FIIA 4O3OA 3Q8PB 4K4WA 3ZTQA 4Q0BA 1YI2S 1VC0A 2Q1LA 1WC6A 4R8UB 5IXUA 3S01A 1EKRA 4CWBA 3QMQA 1LK7A 3H25A 4H4MA 3IMQJ 1VQ7S 1J5EF 3MURP 2MGZA 4QIVA 4TYAA 2VKRA 2UXDF 2BV3A 4K7QA 2HNDA 2HHHF 4PPZA 2VF3A 3IG1A 2HQ3A 2V2ZA 5DGAA 5KFUA 5D4PA 1QAIA 4B9LA 2C1EB 1UJ6A 3S6EA 1G4CA 4JV5F 2DNNA 1HNIB 2HWIA 3AB4B 1MNEA 3T5JA 2KG0A 2GQ2A 1RCXB 3F44A 1JLFA 2L9DA 1FK9B 2FHKA 5ETKA 3JQMA 2RQCA 3MPYA 1WOPA 2DYAA 1VHIA 1PYTA 4O44A 1FJEB 3OQ2A 3MCOA 3GIJA 4JI5F 2X1BA 1JLGA 1HR0F 4F25A 1D09B 3OHAA 4M5HA 3QZ7A 4NZ6A 2D69A 2XSJB 5KTQA 1WF2A 4CLKA 2CWXA 3GFZA 1N8RT 1YGYA 2APOA 2W24A 5HK4A 1DBDA 4WBFA 3A8KA 3ITHA 2QMUB 5DLFA 4IR9A 4WXWA 2ZZMA 2R7VA 2VV5A 1RAAB 2RJZA 4GO5X 1U1PA 3MECB 4FXVA 3C16A 4KAIA 2NQPA 1WKKA 2KYXA 1FD8A 2YKAA 2MTLA 1Y0HA 3MGJA 1V6HA 2EFNA 1MMLA 3CCQS 2D3ZA 2ROPA 2R7TA 3R5CA 1K0VA 3IP0A 2LXIA 2KHCA 2YH0A 4J9MA 1CJKA 1IKWB 4CT9A 2HFSA 2POKA 4RBTA 3HULA 3RBDA 1F5AA 3R5JB 3BKFA 3GJQB 1RTJB 2B6AB 4UF4A 3HJFA 2DISA 1F1BB 5KG5A 1MROB 1PIEA 2RT3A 1KP6A 4PG8A 1U0SA 2OFGX 1U8WA 1U1NA 1FWLA 3D28A 4KHPJ 1RAGB 1IBLJ 5AT1B 3GYGA 4ZVQB 2C3OA 2LVWA 2BJ8A 1UCNA 5L38A 2OSRA 4OLPA 1NJWA 3E3XA 3SBMA 3FUYA 2GVDB 1OPZA 2DNPA 2F8MA 4FBUA 2BE9B 3U02A 1FNXH 5KG2A 4DL5A 2CPFA 4WFZA 1TAUA 3BO3A 2CRLA 3KKFA 2LQ5A 4PXEA 1O6XA 2XHWA 4TKTA 2CJYB 2KRBA 4EMDA 2YNFB 3QFWA 4ECQA 3KHGA 2QSFA 2XM3A 5CQGA 1JWWA 4LFBJ 3O2IA 2KL8A 5KFLA 1Q81T 2VHGA 2HHUA 1YX2A 4F4YA 4DV5J 2BX6A 3I5CA 2OPPB 3CO0P 2LKZA 4DPUA 3MM8B 4X4QA 1ZM9A 3PFOA 3UPFA 3BR9A 4ZOSA 3NG8A 3E01A 2LU2A 2ZH3A 3DN9A 4M5KA 2YTCA 4ECYA 4ZN1A 1M0SA 4ZVRB 2C42A 4QCLA 1RT6A 4RPFA 2CJ9A 1KQGB 3Q22A 4N47A 4Q45A 3OVAA 4ANEA 3HPOA 1IBKJ 3S1TA 5GMKa 3GIKA 1XR6A 2I0XA 3SV3A 2QYGA 1RU1A 5M2RA 4DSEA 2F4VJ 1SKRA 2AGPA 1SL2A 3LP0A 1CULA 1UVJA 4PR6A 3OR1A 4QOTA 4L73A 2W2PP 2D74B 3O3LA 3MM9B 2AQ4A 5DQGA 1VQNS 2JEGA 2EI5A 3SV4A 3VVTA 4ZA1A 2MKCA 1DLOA 1IKVA 3CULA 1KEKA 3FEYB 3HI9A 4Z37A 3V4MA 2EK1A 2IM0A 1BY9A 3DLBA 2ZWOA 3L09A 4IOBA 3KXDA 2ZH2A 3T19A 1N34F 3CJ5A 5HJYA 3F56A 4Y3CA 1K47A 1UL3A 4FYDA 3H2VE 2B4OA 2YKPA 1TL4A 3MPDA 4X2BA 3B54A 1H6KX 3H2UB 3CF5Q 1VLOA 5BR8F 1YVFA 3M2UB 2D3UA 1RAHB 2ZH5A 2C2DA 5KFFA 4DF8A 2UUCJ 4QYZK 1F2GA 2RF2A 4IO1A 3OHBA 4PPDA 8ATCB 1FD2A 3D66A 2M2BA 3KK1A 1SIZA 3W2WA 2OHDA 4DV2F 1T02A 1REVB 1IXKA 4PKDB 4J9PA 1U1KA 3NAIA 3POTA 4CM0A 2BW2A 1RT7A 2MQOA 1ZS6A 2NR0A 2GZOA 3M6VA 1HQUB 4J9QA 2D7SA 5F8JA 2E5GA 1QUPA 4IG0A 2RNEA 5CAAA 2R2RA 3WBZA 4XK8C 4BC7A 4DV6J 2JLFA 4AQYF 3OXLA 2HSEB 3D0HE 1UJ4A 2QEXS 3TQ1A 1ZYQA 4A8YA 3FQLA 4CIOA 2VOPA 1WOSA 4NA3A 4NCGB 3HKZD 3BS9A 4A48A 2I2YA 3EGWB 1S1VB 4C8YA 1FHTA 5HQLA 2RKIB 2F9JA 3R3TA 1PBUA 5C24B 3I0SB 3MR2A 4U8VA 5HMXA 4ZN3A 1HWKA 1W25A 1OSDA 4TXSA 1BQMB 4LRDA 1LQ9A 2FD2A 4RW8A 2UVRA 3MEGA 5ETQA 3W66A 5LXRA 4ZCKA 2V94A 5KFMA 4K50A 4GKKF 2PFDA 3SDEA 4WZQA 3KJQB 4I2PB 4TQSA 1FDNA 3O6QA 4NL5A 3AB2B 3QWUA 4Q44A 1F5BA 3ZNJ1 1S48A 4OHYA 4YMEA 2BQRA 2LP4A 1PO6A 3ZXWA 1S1WA 3D67A 1QE1B 2AZ3A 1WHXA 4OLOA 1Q7LB 4NA2A 4KFBB 1XTZA 3GPAA 1XWLA 2IJRA 2CQHA 1H74A 2DNGA 2QLXA 3KUGA 4DR3J 3M6UA 2NXEA 1VBKA 5J2QA 2CPJA 4IFYB 1SKSA 4ID5A 4WFNQ 2OO4A 3QPIA 2HFZA 4YY3J 4L3NA 4K4VA 1GX5A 1GK8A 2LXUA 5DQIA 2MJUA 4P75A 1BQNA 1RI7A 3M8PA 4OYIA 1NDPA 2MZJA 2KT2A 4DL0C 4M5MA 5KT6A 2QTWA 3IR7B 3P49B 2ASLA 4N77A 4OHXA 3ETMA 3BH7B 3FCVA 1VRUB 4CTAA 1RBLA 1S79A 5DLGA 5J2MA 4KYZA 2KM8C 5D0GA 1FJGJ 3UW1A 5KFNA 5IWAJ 3OUYA 3Q8VA 3WDOA 4ECVA 4OJGA 3KNAA 2PO4A 3CJRA 1YHQS 4U95A 2EBGA 1I94J 2HQGA 1Y3KA 2JL9A 1HQ2A 3W62A 1IR0A 1LWEA 5FDLA 5EWEA 2V2QA 3HVRA 5KFVA 1QAJA 3GYXB 2VODA 5KFHA 2VQFF 2MZ1A 1HA1A 3CCVS 3KFWX 5DM6Q 2V4RA 4R8UA 2JOQA 1IKYB 1SXLA 1FFWB 5HATA 4MKBA 5DJBA 1SUQB 3QQCD 3HX9A 3UCGA 3AD8C 2AEJA 2DKOB 2DB1A 4QQBA 1T9XA 4NMXA 1EARA 2NPIA 2XQCA 3R97A 2VG7A 2IRUA 2ZVIA 5AJ3J 4LIWA 5DS7A 3KLGB 2HBRB 4I2QB 3BQ2A 3M9MB 1XMQF 1HBOA 1KSPA 4M1KA 1U02A 1HNIA 2ASYA 1TVRB 3PJWA 2I38A 1Y3JA 4YQWA 4OHWA 2NYIA 3RU0A 3VF0B 1YJVA 4KIAA 1QTMA 1YQHA 4P2FA 2FLNA 1B3TA 3AODA 4DG1A 2NSBA 3FMWA 1FX2A 2W9BB 1NDLA 1WHWA 3QSYB 5HBMA 4C9DA 3LWLA 3D1QA 1RHMB 2BQUA 3K8WA 4F0MA 1TMMA 2GO9A 1WTFA 4DR2J 2HRUA 1XEZA 2JWNA 4BWMA 5IT0A 2K7JA 1B70B 1FEHA 3TYTA 2CFXA 2P2CB 4HDHA 4QW8A 1WTBA 1VJWA 1VQKS 4H54A 2ILYA 1T9VA 1BQXA 4FF2A 4ERDA 1ZAVA 4USWA 3EZOA 1NEEA 4NZ0A 3D3CJ 4I56A 3PKYA 1JQGA 3DOKB 2A6MA 2CG4A 4QPXA 4DSKA 4JI4J 3NGTA 2GHPA 4IDKB 2GGPB 1CQMA 3RRKA 1N5TA 1GTEA 3MD3A 1FKOB 2XSFA 1DAXA 2RQMA 2ZZNA 3PV8A 1YJUA 1KOHA 2QLBB 5KOXA 3MM5A 4A8WA 2W2MP 3ZZOA 3DLJA 1KRPA 4JI7F 2CQPA 2FJAB 3ETOA 1VRQC 3DLGB 2B6AA 2QIFA 1H38A 3MPVA 4DEZA 5MAOA 1IVZA 4OI6A 2J8SA 2VICA 3HO1A 4JV1A 4YFUA 1R8PA 3NCQA 1RWOB 4YB5A 3NY0A 3KWMA 4LFCF 1LW0A 2AV5A 2K7KA 3IR6B 4PWDA 2IVYA 3Q8QB 1VQSA 3FSIA 1CPZA 5HMWA 3PYGA 3VV2B 5D6GA 2HS0A 3UR3C 5KG6A 1ELOA 2J0SD 3MCNA 2UUTA 2GC8A 3DXBA 1NK9A 3EZUA 1Z1ZA 1WC4A 3FNNA 4IG3A 1S10A 1R7IA 4O4RA 4LMZA 3I9V9 2ZC4A 3OTEA 1S1TB 1RTIA 1BUXA 2UP1A 1V5IB 5ETOA 3CCRS 3V81A 1FTCA 3BREA 4L72B 4ZLNA 4M5JA 5KG3A 4B9MA 2W1BA 2WOMA 3Q2SC 3SSSA 2UUWA 1SV5A 3OL6A 2HHSA 2OPPA 1U1QA 1U09A 1H72C 1NZAA 3H59A 3OJUA 4URQU 1WUUA 5KFWA 2E1PA 3AA9A 2HFNA 1LWFB 2HW3A 3EXYA 3J81U 3MEEB 2AX1A 4PQUA 2VBZA 3T1HF 4F3OA 4PG4A 3V5RA 2XMTA 2R7RA 1W2IA 2JC1A 1NM2A 3F73A 2WK4A 2GIQA 4X64F 3J7YU 1L3UA 5GAHU 2Z56B 4KGVB 4ZP9A 2A18A 3BYPA 2MSTA 1IN0A 5A2QU 5JVHQ 1OJ4A 3ULHA 2WZ1A 3UI3A 3EGNA 1B99A 3PKMA 3ISNC 1B4SA 1FWKA 2B7CB 4LF9J 3MMCB 3OTCA 2DIVA 3BSNA 4IQMA 4C3MA 3RUBL 3CJ8A 4R5PB 2AYGA 3BYRA 3MPUB 1TKXB 3H5UA 4RNOA 3MM9A 1AYEA 3H98A 4GVLA 4W4MA 2VFSA 5L1LA 2VDHA 4DCOB 2YX1A 3V4IA 3DRSA 4CO3A 2CDRB 2JFDA 1WJ9A 4F2SA 1IQTA 1NH8A 4Z7CA 2QMXA 2Y1RI 3H2LA 2M52A 4KRWA 2BZ2A 4QBUA 4B9SA 5B0DA 4LSLB 2FIUA 2F63A 2OKQA 3R5AA 1X7VA 4IQXA 2DPJA 2HEKA 1PYOB 2Z8QA 2YKNA 4NCBA 2MEWA 4EZ9A 3TA1A 1KVKA 4F36A 1WEZA 3DU6A 1UA0A 3M32A 3TWZA 1ZM2A 4Y2MA 1MU2B 4EO8A 4X4NA 1WWHA 4DL3A 3SCJE 2O5DA 4DOZA 3CGIA 1F3VA 3I9ZA 2V9WA 1F60B 3HFVA 1F9EB 4LFAJ 2D9PA 1HLWA 3MZIA 5K8OA 4FF1A 4I7FB 2V8DA 1HQUA 4UOHA 1C4CA 3TJAA 1U0HA 1FXRA 5HMZA 4NYPA 4M63A 3JXOA 3KYLA 5F8IA 2QL9B 3DOLA 2LA4A 2X1AA 4CLTA 3LGNA 2V5HG 3NGRA 1S6UA 4UTGA 3Q83A 1GXTA 3U1LA 3W64A 3CDBA 2ZM6F 3ET6A 4OZLA 2K2PA 3PEJA 1CJVB 4B3MJ 1R0CB 1XIQA 1QUVA 2PMWA 1I5OB 2ZVSA 3T1YF 4TU9A 4ZK7M 1S1VA 1IBMF 3MD1A 2RKIA 1RAOA 5C24A 3I0SA 1HWIA 4P10A 4LF7J 2FVPA 3IRWP 4DR6J 2UUAF 1R31A 1VQ4S 2ZHBA 3GFHA 4AT1B 4WWSA 4OJ3A 5C2CA 4HTJA 2HURA 1KLNA 1VC6A 4ITSA 1EETB 2ACMA 1NK4A 4F4ZA 4D3GA 2ZD1B 3GV5B 5KFAA 4W98A 2QE5A 2HVDA 1Y7PA 2MYFA 3CDEA 4RW7B 1GFWB 2XYHB 2VL1A 4I2PA 3P4UB 1Q1KA 1Q8LA 1PC4A 4EU0A 3PNIA 3GFYA 5LMNJ 2IAJB 2HFVA 3IGVA 2GMJA 2WSCC 4CLYA 4ZPCA 3UR0A 1YIJS 2DNYA 2PA3A 2RIJA 4KFBA 2XZWA 3MMAA 2KRRA 5BYRA 3W2VB 3SQGB 2DIUA 4Q8EA 1R8CA 1DTTB 5K14A 1CQNA 2MZRA 4DSJA 1MN9A 2EC2A 4ECZA 1U1LA 3K59A 1N56A 3T5KA 3J80U 3J7Z5 1D0EA 2YKMA 2E1CA 5EDWA 2AP6A 4CO0A 4RWWA 3W8GA 2AYMA 2Q43A 2VPXB 1UEVA 1MN7A 4OYZA 2YY3A 5G0RA 1HNZJ 4DR4J 5MLCV 1X4EA 2OD4A 2RU3A 2RRAA 5KFIA 1OPIA 1FVSA 2LDYA 4F3QA 1NNDA 3LGMA 2R2SA 4YOEA 2YWKA 1VRUA 4DN0A 1TZ0A 4FXWA 3KHHA 3EGZA 1X4BA 4LF4F 4RW9B 3BGRB 4ES1A 5KOWA 2M8DB 1R0AA 4OI2A 1FXLA 3HSGA 1SQGA 4NYOA 1M5HA 2W2QP 4ED1A 2E5LJ 2C3YA 4ECSA 1OIAA 1N32J 3JS9A 3SEOA 2BKPA 5KT2A 1VJQA 2NPFA 1S57A 3RYLA 1OQ6A 2CIMA 4OZ3A 1TTHB 2DR8A 5K20B 1FRHA 2KT3A 2AT1B 2HS4A 2ROEA 3NNCA 3MR7A 3DRRA 1SUQA 4RW4A 5L1IA 4ICLB 4B9UA 3AY0A 5EX3A 1N33F 1K1QA 2QSWA 1VCTA 1J5EJ 2QYCA 4LSNB 3TZYA 1U2FA 2O3DA 1S49A 3MMJA 1N6QB 4DV1F 3RW6A 1S9GB 3O5TB 1DTQB 2UXDJ 1LK5A 1WG4A 3VAMA 4IH7A 4FKYA 3TZZA 4YR2A 2HHHJ 1Q86T 3OJSA 5KFGA 4YP3A 1KTQA 4K4YA 3VVUA 3HJVA 1VC5A 4JV5J 1QVFR 3UDLA 2N82B 1TVRA 1HBNA 1WNEA 2HMIB 7AT1B 5CYQB 1S72S 5HROB 2NXNA 2HAFA 1Q4RA 2MKKA 2CJAA 2A6OA 4RBUA 4F02A 3QJLA 4ZCMA 1UVIA 4JI2F 2C2ZB 1JMTA 1RABB 1DHMA 4NEYA 4URSA 2ZFHA 3JTOA 1HQEA 4JI5J 1UVKA 3G82A 3M2VB 1HR0J 3R2CJ 3M9OB 4LBPA 2H5JB 1RA6A 1L3SA 1FDBA 4OYXA 1C0TB 4JYAF 4RX6A 2IA0A 2ZH9A 4BDPA 5E0OA 2F3JA 3IWLA 3R9LA 3ZO7A 4C0OC 3EVOA 1XK8A 5CABA 1AZSB 4OZJA 2E9ZA 3GJRB 1VGYA 5DZ6A 1DRZA 2BKNA 2ZNZA 2KFYA 3D7SB 4NLUA 3H90A 1RT5B 4UW2A 5SZTA 2Z30B 4IDKA 2ZITA 2CPHA 3HXMA 4DX8H 4PYDA 3R7SB 3K5LA 2DGWA 2EFGA 1HNWF 2CNOB 3CMQA 3CD7A 1G3OA 3JQJA 4HH1A 3MM7B 2FPHX 5LL6d 3Q2TC 4YUDA 1FJ7A 1IR1A 3F0NA 4KH1B 5AE2A 3CD5A 3OW2R 3FFIA 3TAMB 1IWGA 2P8IA 2R4FA 3TA2A 4I0WA 2MJNA 4ZPWR 3J7ZT 3HLUA 1HYSB 4G1QB 4WKYA 1EQMA 3N5BA 1N54B 3M6WA 2QGFB 3LP1B 4HT7A 4P7VA 2VC0A 3ILLA 2DH8A 1RWKB 2ZOMA 3DLGA 4FPRA 3DHWC 2G2ZA 1JK9B 2R8JA 4H4KC 3KUHA 2AYBA 3LUYA 2NSCA 2KTQA 5ETPA 2FHJD 5KG7A 2YVSA 2IMOA 2VOOA 1T94A 2JNJA 3SFUA 2BJ1A 5D4NA 5HJXA 3MR6A 3IR5B 2ZZTA 4FYWB 4PABA 3BJYA 2BDPA 5LT5A 3O44A 1C2PA 5HQMA 3CCZA 1HBUA 4YB7A 5CYMB 4HTIA 5A8RB 4XAKA 1UWAA 3DFEA 4Y00A 1VQ8S 1A6LA 3ZTPA 4Y28C 4OL8A 2BM0A 5ITHA 4DUZF 3DDKA 2YX7A 1URRA 4QWEA 1H73A 3V6HA 3US5A 5A8WA 1NBEB 3JSRA 3P96A 3C14A 4DX5A 2V2VA 3J7AN 2HLUA 2CKWA 2RDIA 2V63A 3DRXA 4UUWA 3D0IE 2GVZA 5ETNA 1H2TZ 2R2TA 3VAIA 3I4PA 1DARA 1P6TA 1WG5A 3GYNA 3DDIA 1LWFA 1RWVB 2X1GA 2XNRA 4XTTA 5F8GA 4FKXA 2C2OB 1H7WA 1HKAA 2ZWPA 1B0PA 5EWGA 4LRFA 4LRAA 1U1OA 1RHQB 3LAKA 3W5ZA 4RNHA 1HBMB 2U2FA 2QJ3A 1PYSB 1HWJA 1PKUA 1PCAA 1HMVB 4MMOA 1NSQA 2IHR1 1PSDA 5LOQA 3M8QA 4W92B 1HHSA 3FVYA 3C6UB 4FPIA 3QJPA 3AXMA 2OFHX 1OMSA 1FVQA 3TUIC 2RUSA 1M1KT 2OPSA 2WVDA 4CM2A 3NXZA 3L7UA 1KQFB 5C25A 3L9ZA 3N4WA 1RK8A 2IVFB 4A8QA 4DPTA 1F3FA 1TKXA 3I0RA 2NCKL 3IA0A 4DPYA 3BBCA 3LPYA 1RYRA 3NEKA 1K44A 1SC4B 3GILA 1S1XB 3LP2B 3IWXA 4OZNA 1CSJA 3OTBA 5I42A 2BRKA 3T6JA 3Q8YA 2YQ3A 5B0FA 2UZAA 4B9NA 2MSSA 1N34J 2AWZA 4B3OA 1SH0A 3R1HA 4LSLA 4ZCIA 3QRQA 3ZTOA 3EDRB 4B08A 3KLEB 3WC2A 1JLCB 3OL8A 3QAUA 4MTPA 4G1PA 4P52A 2KFNA 4F4KA 2RD5C 3UFCX 4MK8A 5DRKA 5BR8J 5IT4A 4X62F 2Z2YB 1S4FA 4AL6A 4Z2XA 2IMWP 3PRBA 1KFSA 9RUBA 1N88A 2BR0A 4ED6A 3HZEA 3KJVA 1MU2A 2FZKB 5KFQA 2E5JA 4ECUA 1T9YA 4RR5A 2XMVA 4HT5A 4CQ1A 4YDDB 3J7YI 5GAHI 5E3PA 2QLJB 4DV2J 3DGPA 4L75A 1TAQA 2AF6A 5HANA 4DV7F 4PUOA 3DYAB 4WJBA 2DR5A 4ILMA 4RW6B 4OIXA 2AX0A 3TNVA 2M4MA 1S7HA 4NLQA 2KJWA 1AT1B 1CC8A 1TKZB 5J1NA 1PAEX 4C48A 2Z2MA 3SZ2A 4AQYJ 4DUYF 4RO0A 4DSFA 4WU3A 3HSDA 2VA2A 3CDUA 1JLBB 2HHQA 2J7UA 4B3RJ 2XGQA 4JI0F 2VQEF 3NNAA 4KHRA 3PX0A 2L9WA 1K9MT 2MQLA 1K0TA 1SQFA 3RB6A 5EHHA 2W9CB 3RAQA 1SH3A 4H4OA 2BANB 3VZIA 1D9DA 4X4RA 3U1NA 2E7WA 1X4CA 2QA4G 1HNVA 3G8QA 4JBCA 1SKUB 1X4GA 3DMJA 4P71A 4K2JA 1PILA 2WAQD 2XEXA 2XULA 1PC5A 2DNQA 2J0XA 2W9AA 4ZLPA 2MDAA 1EETA 4ENOA 1RWMB 1X9SA 3FBFA 5HP1B 2VFVA 3EMTA 5DDOC 4YHHF 3W7BA 4GKKJ 2HYIB 3NGDA 2BXJA 4K5RA 4RW7A 3Q8SB 3PRVA 3CEDA 2GMLA 2HBYB 3I31A 4CLPA 1TQLA 3DRYA 3JTNA 2IC3B 3EVMA 5HLFB 1KDNA 1RT1B 2IAJA 1AXQA 3M8YA 2EFVA 3KLHB 1CJUB 1LW2B 3CC2S 1V9OA 4B3TF 1ZOTA 2VB6A 3D1HA 1NHKL 3UVJA
chains in the Genus database with same CATH topology
1Y11A 4NI2A 4WP9A 1CULA 3C14B 4CLTA 2BW7A 3G82B 3C15B 3C16B 1YK9A 1CS4A 1TL7B 4CM0A 1YBTA 4CLLA 4USWA 4OYMA 4OYAA 1WC6A 2GVZB 4OYPA 4OYIA 5D15A 3ET6A 1FX4A 4P2MA 4CLYA 1AB8A 5IV4A 4CLKA 1CJVB 1CJTB 4NI2B 4WP3A 3MAAB 1Y10A 4CM2A 4USVA 2W01A 4P2XA 4CLUA 1U0HB 4CLSA 5D0GA 1WC4A 3C14A 1CJKB 1AZSA 2GVDB 4CLFA 3G82A 3C16A 3UVJB 2WZ1A 1TL7A 4P2FA 4USUA 4OZ3A 4OYXA 1CULB 2GVZA 1CJUA 4OYWA 2QV6A 4OYOA 1CS4B 5D0HA 4WP8A 1FX2A 1CJVA 4OYZA 3MR7A 4USTA 1WC0A 3ET6B 1CJTA 4CLPA 1YBUA 3MAAA 1AZSB 3C15A 5D0EA 1WC1A 4CLZA 5D0RA 1CJUB 4OYBA 4CLWA 5IV3A 1U0HA 4OZ2A 1WC5A 3R5GA 1CJKA 2GVDA 1WC3A 4WPAA 3UVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y11 A;  4NI2 A;  4WP9 A;  1CUL A;  3C14 B;  4CLT A;  2BW7 A;  3G82 B;  3C15 B;  3C16 B;  1YK9 A;  1CS4 A;  1TL7 B;  4CM0 A;  1YBT A;  4CLL A;  4USW A;  4OYM A;  4OYA A;  1WC6 A;  2GVZ B;  4OYP A;  4OYI A;  5D15 A;  3ET6 A;  1FX4 A;  4P2M A;  4CLY A;  1AB8 A;  5IV4 A;  4CLK A;  1CJV B;  1CJT B;  4NI2 B;  4WP3 A;  3MAA B;  1Y10 A;  4CM2 A;  4USV A;  2W01 A;  4P2X A;  4CLU A;  1U0H B;  4CLS A;  5D0G A;  1WC4 A;  3C14 A;  1CJK B;  1AZS A;  2GVD B;  4CLF A;  3G82 A;  3C16 A;  3UVJ B;  2WZ1 A;  1TL7 A;  4P2F A;  4USU A;  4OZ3 A;  4OYX A;  1CUL B;  2GVZ A;  1CJU A;  4OYW A;  2QV6 A;  4OYO A;  1CS4 B;  5D0H A;  4WP8 A;  1FX2 A;  1CJV A;  4OYZ A;  3MR7 A;  4UST A;  1WC0 A;  3ET6 B;  1CJT A;  4CLP A;  1YBU A;  3MAA A;  1AZS B;  3C15 A;  5D0E A;  1WC1 A;  4CLZ A;  5D0R A;  1CJU B;  4OYB A;  4CLW A;  5IV3 A;  1U0H A;  4OZ2 A;  1WC5 A;  3R5G A;  1CJK A;  2GVD A;  1WC3 A;  4WPA A;  3UVJ A; 
#chains in the Genus database with same CATH topology
 4NLP A;  5GVQ A;  5FLX U;  3SXL A;  2CXE A;  2RHS B;  2QA2 A;  3SQG A;  5F0U A;  3CCT A;  4OYA A;  3KG4 A;  1DTT A;  3OFH A;  4LRC A;  1HAR A;  1WI6 A;  3GB0 A;  2HNZ B;  4EBC A;  4BHQ A;  1AB8 A;  1RLD A;  1RBO B;  4L76 A;  4TQR A;  4C7Q A;  5KT7 A;  4OJ1 A;  3P6Y C;  4F8R A;  4WP3 A;  3MAA B;  4M5D B;  2I5J B;  2HVE A;  3IM9 A;  1RLC L;  3QAT A;  4AND A;  2C3P A;  2AD9 A;  4F7V A;  3R7B B;  4C97 A;  2DR6 A;  5H9F J;  3RW7 A;  1BMQ B;  4J7C A;  2HWH A;  4X65 F;  2L08 A;  1TL1 A;  1JIH A;  4ZP8 A;  3FBE A;  1E6Y B;  4QZV B;  1JJH A;  3TJ8 A;  1L5U A;  2XI2 A;  3OVS A;  2G0C A;  2MKY A;  2ZHA A;  3CW2 C;  5B0B A;  3HHL D;  1FXD A;  2FUG 9;  2M8H A;  3BGF A;  4RW9 A;  4FF3 A;  5K8N A;  2MXY A;  4ZVS B;  2QA4 S;  1NK6 A;  2ALZ A;  5B09 A;  2UVV A;  4YDX A;  5F41 A;  4C8L A;  1QAX A;  1Q53 A;  1BXN A;  2V2K A;  1CS4 A;  1UFL A;  4C8Z A;  2RQ4 A;  5HAO A;  2W8K A;  2P9G A;  2RDD A;  1FT8 A;  2DHA A;  1OQ3 A;  1N5Y A;  2LEB A;  3UE2 A;  3ZZU A;  4NPO A;  4X4O A;  2JEI A;  5EUH A;  5HN0 A;  1GMW D;  4IRD A;  4ICL A;  4CRJ A;  1U2C A;  3K57 A;  1NSK L;  2XLJ A;  1EP4 B;  3OTO F;  4M5N A;  5IC4 B;  3I32 A;  3HVT A;  2FJD B;  3CJ0 A;  1Q8I A;  1N6Q A;  3SSR A;  3GG0 A;  1DTQ A;  5I4M A;  4KBI A;  2E5I A;  1VYA A;  4CH1 A;  2J8A A;  4USH A;  3Q8R B;  3RRH A;  2KXH A;  2KT5 A;  1WI8 A;  2DXE A;  3SCK E;  2V50 A;  3D6T B;  1XMQ J;  3BR8 A;  4PRF A;  4J9L A;  1S7I A;  3ENA A;  2FYX A;  3THP A;  5F8L A;  3WHI A;  5CYQ A;  3TAQ A;  1L3K A;  2HZA A;  2B8Q A;  2X3D A;  3LF0 A;  1RT3 A;  2XZD B;  5CD4 H;  3DRP A;  2P9E A;  1UKU A;  4C8M A;  5LMU F;  5D77 A;  2AEM A;  2NS1 B;  1YBT A;  4LJM A;  2YXL A;  1IUJ A;  1ZTW A;  2MMY A;  3JSY A;  1XQI A;  1ARO P;  4NE9 C;  1S6O A;  4G65 A;  2U1A A;  1KLM A;  2OUG A;  1FRJ A;  1JNZ B;  2CQ0 A;  2XWY A;  3HFZ B;  2PII A;  5CCL A;  2HGM A;  5DG9 A;  1SVD A;  4F50 A;  1AZS A;  4EBD A;  1RGV A;  1JXE A;  4KV8 B;  1F9H A;  2XB2 D;  5THW A;  1PGZ A;  2HHT A;  2H48 B;  4YB1 P;  2IM2 A;  2VIH A;  2C3M A;  3B8H A;  3TVZ A;  1RDR A;  2V68 A;  2WSF C;  3MM6 B;  3MM7 A;  4EUV A;  4JI1 F;  4O3N A;  2HPU A;  2PD1 A;  2NUU G;  5DDR C;  3TAM A;  3LAL A;  3TAR A;  1LFP A;  2B5J A;  4ZVH A;  2VBW A;  1HYS A;  2CAJ A;  3LP1 A;  4JI7 J;  1TKT A;  3AOA A;  3THV A;  1F6T A;  2HRT A;  3CJK B;  4PWU A;  2MKS A;  3CCE S;  2GQQ A;  1MMD A;  2GIR A;  2DK2 A;  4JUZ A;  2CYY A;  2B9Y A;  2FJX A;  2B3T B;  4UOC A;  4A8S A;  2KHD A;  2GX8 A;  3CJS A;  4WZM A;  1RTD B;  1S9E B;  4LFC J;  2PEB A;  3JSM B;  2LQB A;  1HD1 A;  3IRX B;  1TL7 A;  3EWG A;  2IYG A;  7FDR A;  4ER8 A;  1CEZ A;  1EHW A;  4OYW A;  3T3F A;  3PYF A;  3VAK A;  4ZPV R;  3W8P A;  3QNW B;  1DQ9 A;  2EPI A;  2JRS A;  1EKS A;  2OEM A;  3NL0 A;  1Q5Y A;  2F4V F;  4MYU A;  2WTF A;  5ETV A;  5JVG Q;  3G6X A;  3C46 A;  4LF8 J;  3EE3 A;  4QW9 A;  4N8O A;  4KKO B;  2UUB F;  1YRX A;  1N5V A;  3K5M A;  2H65 B;  4F67 A;  2VH7 A;  2YNI B;  3VGU A;  3UNY A;  1OS5 A;  3DHX A;  4ID8 A;  1YK9 A;  4LUB A;  3GIR A;  4OYM A;  1SBR A;  3LGH A;  4RUH A;  2LYV A;  3IBF B;  4ED0 A;  4MKV A;  5KFK A;  3M2R B;  2YKQ A;  4QWD A;  3HKW A;  2VC1 A;  4I67 A;  1H7X A;  1IR2 A;  4NLX A;  4U96 A;  2V8H A;  3TX0 A;  1P1L A;  1G6B A;  4WIQ A;  3X1L B;  1E6V B;  4U8Y A;  4NXM J;  5C42 A;  5KT5 A;  2OEL A;  4CZC A;  3TQE A;  2BJ7 A;  5M2P A;  4M95 A;  4ZCL A;  3VAJ A;  4GVB A;  3T41 A;  4LSZ B;  2NLW A;  2XMJ A;  1VIO A;  1SJ3 P;  2XC9 A;  3T1H J;  3M30 B;  1SJR A;  4LBH A;  2J0W A;  2VG6 B;  1HBM A;  2ADC A;  1Q8B A;  2HRY A;  4IFV A;  1CLF A;  4LF6 F;  5I3U A;  1HMV A;  4ZKA A;  2XMW A;  4MYT A;  1R8A A;  3CUN A;  4X64 J;  1TK8 A;  2LFV A;  5A0Y A;  2C28 A;  5J2N A;  1VK8 A;  2CJX B;  5K8P A;  1RT2 A;  2MPU A;  2PGC A;  3C6U A;  1QSL A;  3QIP B;  2JHE A;  4WU2 A;  4M5G A;  4DV6 F;  3S8S A;  2Y0S D;  2V4J A;  1R6V A;  2QMW A;  3W5X A;  3VTI A;  5T7L B;  5K8M A;  4WFY A;  1X5P A;  1IQZ A;  4LVO P;  2QT7 A;  1W7W A;  5DET A;  1M90 T;  4OJH A;  1D8Y A;  5BYS A;  4K4U A;  1S1X A;  3LP2 A;  2BVZ A;  2VD3 A;  4DX6 A;  2ACY A;  3LW5 C;  1J27 A;  1NJX A;  3NLC A;  4MKY A;  1HHT P;  2RH3 A;  1VBY A;  3BN7 A;  2OH2 A;  3P5T L;  5B0G A;  2OLW A;  4DSI A;  4MK7 A;  1NPP A;  3NS5 A;  3KLE A;  1S6Q B;  4U67 Q;  4FBT A;  3HD2 A;  5E7O B;  2B9X A;  2BYC A;  1HI1 A;  1IWA A;  3DLE B;  3DM2 A;  1F5C A;  4DFJ A;  3QRR A;  4KH0 B;  4JOU A;  4XPE A;  2WW8 A;  1FF2 A;  2DHH A;  3OR2 A;  3RAX A;  1S9F A;  6FD1 A;  3G6Y A;  3ZZZ A;  2R9L A;  2OIH A;  1C0U B;  3FGV A;  1T03 A;  3IC1 A;  2BJD A;  3AOB A;  3RZA A;  2LMI A;  2A2D A;  3IBW A;  5H9F K;  4RUA A;  2RRB A;  4WXO A;  2HNY B;  5L1J A;  2C22 A;  4DQP A;  3L7O A;  1CJT B;  3DYA A;  4WK3 A;  3B4M A;  2NXC A;  2YNG B;  3E51 A;  3TA0 A;  5ETT A;  3Q8U A;  4DV3 F;  3FK4 A;  4HAC B;  5J2P B;  4I69 A;  1VIX A;  4EYI B;  4CYU A;  3ICL A;  2DNM A;  2ZM6 J;  2IIH A;  3BQ0 A;  3IAS 9;  5I3P A;  4MIW A;  3VR1 A;  2A1B A;  1NK8 A;  1Y5L B;  2IDE A;  3H5Y A;  2W9C A;  2VBY A;  2UV8 G;  2FJE B;  3T1Y J;  4GKJ F;  2D3O R;  2BAN A;  4DL6 A;  1IBM J;  2B4P A;  1ZET A;  1S1U B;  1IKX B;  1P9Q C;  2UUA J;  4K5S A;  3K5O A;  1A7G E;  2R7U A;  2O66 A;  3IS9 B;  2HHV A;  1N0V C;  4A8K A;  2FZG B;  2CWK A;  2KVI A;  4IH6 A;  3K7R A;  3PX4 A;  1RCO B;  3M4X A;  2XS7 A;  2OSQ A;  3QLH B;  2DH9 A;  3VAL A;  1HPZ B;  1VRT A;  3OT9 A;  1YG0 A;  4K4T A;  3KLI B;  2ASJ A;  2YWE A;  2FLL A;  1LWC B;  5KFJ A;  2ZJR Q;  2L48 A;  2PDA A;  4ZIT A;  2FJW A;  2ZHO A;  2WRM A;  3DOM B;  1RWX B;  1X4D A;  1Q8K A;  3KLH A;  1CJU A;  3BQ1 A;  2Z58 B;  1LW2 A;  4K59 A;  5LSL A;  4Q0B B;  5IFM A;  4ZHR B;  1U25 A;  3DDN A;  1LEO A;  1RHK B;  3C6T B;  1TUV A;  1UFK A;  2XYP B;  3C3L A;  4H4M B;  1EZZ B;  4KJI A;  2CPD A;  4M8L A;  4P2S A;  2WVC A;  4AD6 A;  2MGZ B;  1NJZ A;  1OYD A;  1JJ2 R;  2FY8 A;  4O3P A;  5KFP A;  4O0N A;  2GMH A;  1GXU A;  2KO1 A;  3N01 A;  3GP9 A;  3ADA C;  1FRK A;  2R7O A;  4F26 A;  3SCI E;  3BEG B;  2J7K A;  1KS2 A;  2DHS A;  2K3K A;  5DO2 A;  2ZOG A;  2IBK A;  1CG2 A;  3HD1 A;  5IZH A;  3GR1 A;  1ULR A;  1S77 D;  5CA5 A;  2CJB A;  3PX6 A;  3KHL A;  1T05 B;  1JLF B;  1IBC B;  2RML A;  1KQK A;  2KKH A;  2BQ3 A;  1ZAX A;  3NKY A;  4K8R A;  4O44 B;  1KC8 T;  3BPD A;  4A8X A;  4LF4 J;  1MWZ A;  4JI8 F;  4I68 A;  3VCD A;  3GSD A;  4X66 F;  1JLQ B;  3DNC A;  2YWH A;  3FZB A;  2UVU A;  2HS3 A;  1RT4 B;  2JVR A;  2HVZ A;  3NOG A;  3GJT B;  1HL6 A;  5F8M A;  3OPK A;  3HSJ A;  2JLE A;  3I56 S;  4E8U A;  3BZQ A;  2PN6 A;  3OXG A;  1MLA A;  3C16 B;  3N9U C;  2X3G A;  2YNH A;  4P2M A;  3TVK A;  4CDI A;  3CD0 A;  1N33 J;  4PWW A;  3I96 A;  2DR9 A;  5F3T A;  4DV1 J;  2FGO A;  1TP7 A;  3SCL E;  2A10 A;  3U1M A;  4DCJ B;  1RQ0 A;  5AXN A;  3DI6 B;  2Z57 B;  2ZE2 B;  4E0D A;  3H5X A;  1SL0 A;  2HVH A;  1CJK B;  5LM7 E;  4X4P A;  2G13 A;  1O8B A;  1IJE B;  2VKZ G;  1GEH A;  2HGN A;  4Q7A A;  2M3D A;  1ZZF A;  4WP8 A;  3IN5 A;  1WHV A;  4DV4 F;  3MR3 A;  3PHT A;  2EFO A;  4QU7 A;  3RB3 A;  3HMJ G;  3FCW A;  1NH7 A;  3LAN A;  4ILR A;  2ZUA A;  5ETR A;  1LOU A;  4JI2 J;  2O1P A;  2PMZ D;  4FNI A;  4OI1 A;  2PE8 A;  2OPQ A;  1XR7 A;  3Q86 A;  1S6P B;  3NBP A;  3T6B A;  2VUG A;  4FDF A;  4WII A;  1ZAW A;  1KVI A;  4FXD A;  3G96 A;  4JYA J;  3DLH A;  4USI A;  4MH8 A;  1X0F A;  4O4G B;  3PW7 A;  1ZZN A;  4OYP A;  2VA3 A;  2DRD A;  1JLA B;  4RU9 A;  3RRG A;  1X4F A;  2YWW A;  4KV8 A;  4PYA A;  2IRX A;  5E3Q A;  2EG1 A;  3A8E A;  1WEL A;  4Y2I A;  3BGL A;  3BO4 A;  1ZTT A;  2DY9 A;  1YDL A;  2XO7 A;  1BLU A;  3FDS A;  2WVF A;  1NJI T;  3MM6 A;  2MHN A;  2B43 A;  1XMO F;  1HNW J;  1FJC A;  2D1C A;  2EFQ A;  4PG5 A;  4J9S A;  3HM9 A;  2IJN A;  1YJR A;  3M8R A;  3PEH A;  1KFD A;  3CB4 A;  2DGS A;  1ITP A;  2E1M C;  1Q95 G;  1GQE A;  3ZC4 A;  2M7S A;  4PQA A;  4OZ2 A;  3CJK A;  4HDG A;  5KFX A;  4P74 A;  2W7O A;  3LWM A;  3ZZP A;  3LAM A;  1EQ0 A;  1REG X;  2MQN A;  4AXJ A;  4M94 A;  1RT6 B;  1NK5 A;  1SC6 A;  2JVO A;  3PW2 A;  2E29 A;  3UWT A;  3JB9 k;  5F8H A;  1WAC A;  1Q82 T;  2B4U A;  5B08 A;  4EEY A;  2AU0 A;  7FD1 A;  1BHN A;  5KG0 A;  3MUM P;  2D41 A;  3AXK A;  1IJF B;  5KFO A;  4IOC Q;  2AJF E;  3AOC A;  1XN9 A;  3UDC A;  2MB0 B;  3QYY A;  1G1X A;  4URG A;  3AD7 C;  3LP0 B;  1JJ4 A;  1CUL B;  1X8D A;  3OR1 B;  1SC3 B;  2R7S A;  5D0H A;  4W90 B;  4KO0 A;  4OFZ A;  4BBY A;  5M2U A;  4C3L A;  4K0K F;  1GXL A;  2XMU A;  3QT7 A;  4DUZ J;  4RUC A;  2YNI A;  2WSE C;  2WVE A;  4QPT A;  3D5M A;  4RJV A;  4B17 A;  2PI4 A;  2MLZ A;  1DLO B;  1BGX T;  3OLB A;  1IKV B;  3GZ7 A;  1DQ8 A;  5IOL A;  5L9X A;  3LH2 S;  3JAM Y;  1VQO S;  5DDQ C;  2LQ9 A;  4K4Z A;  4C3K A;  3N6N A;  4HH0 A;  5E5N A;  4LRE A;  4LF1 A;  3FKB A;  3ZZY A;  4OHZ A;  2J9C A;  2ZDO A;  4ED2 A;  4UT4 A;  2DVI A;  1N52 B;  1TEL A;  1UWB A;  3A8I A;  4OX7 A;  2EKY A;  1NZ8 A;  1KQS R;  2BKO A;  1OYE A;  3M8Z A;  4O23 A;  4CNZ A;  5AXL A;  5IT9 Y;  3NS7 B;  4ZDN A;  2MY7 A;  3HF5 A;  4U7U K;  1FNO A;  4Q2M A;  3M30 A;  5B0E A;  5D78 A;  1SB6 A;  1RBA A;  3GQC A;  4M5I A;  2RF2 B;  2W2N P;  5HVH A;  3KOA A;  2B8P A;  3KK1 B;  3CE8 A;  3B6B A;  3W2W B;  2EK6 A;  4LFA F;  2KDO A;  2FJV A;  4DL7 A;  4USK A;  1R8H A;  5IQ6 A;  1RT7 B;  1U47 A;  4DHV A;  3VQT A;  2N7C A;  4C8O A;  1WC0 A;  5JUM A;  5GAE U;  3EJM A;  2WCX A;  4IG0 B;  3G8S A;  3CDW A;  3PM9 A;  1QSS A;  2H4W B;  2BOP A;  2OPR B;  1GNK A;  2GCF A;  1X9W A;  2MKJ A;  5T7L A;  4LR9 A;  2UU9 F;  3HT0 A;  5KFY A;  3TUJ C;  5IM0 B;  2Q3P A;  1RA7 A;  4Y2K A;  2IM1 A;  3PW5 A;  4JB8 B;  4UUX A;  2F40 A;  1VK3 A;  2FC8 A;  3N5F A;  4N7T A;  3PIO Q;  3ZZ0 A;  4XPC A;  4HEA 9;  1DZ5 A;  2BA9 A;  1FK9 A;  1K73 T;  4D3H A;  2XNQ A;  4NI2 B;  2XS2 A;  2IVM A;  2IFX A;  2HWT A;  1AFJ A;  4NXN F;  2VON A;  2W4P A;  2W7P A;  4IH5 A;  2ZBQ A;  3QT5 A;  4RW8 B;  1DQA A;  2D9O A;  3MEG B;  2DEJ A;  2QLF B;  2Z0G A;  2XSJ A;  4X62 J;  2FY1 A;  4LVN P;  4B02 A;  3FCH A;  1C0U A;  3ZZT A;  4F4A A;  3QFH A;  5BYQ A;  3G4S S;  4FYX B;  2FTR A;  3GJS B;  2C2M B;  3MUV P;  4LQ9 A;  1WSV A;  2QG9 B;  4WTO B;  1YIT S;  3MEC A;  3UDV A;  1NK0 A;  3UCU P;  2XS5 A;  4DV7 J;  1VQP S;  1S1W B;  3J81 j;  2J6T A;  1VQ9 S;  1C4A A;  2JLG A;  5B0C A;  3MFI A;  1FRX A;  1T95 A;  1TR0 A;  2GA7 A;  2OTL S;  4DUY J;  2HFO A;  3KK2 B;  3R8Y A;  4Q5V A;  3QSI A;  5J2Q B;  4JI0 J;  3MED B;  4DLG A;  4Y2C A;  2CZ4 A;  2HIY A;  4USV A;  2VQE J;  2K1R B;  3OL7 A;  3W65 A;  1IKW A;  4ID5 B;  1S5Z A;  2RB7 A;  4KTQ A;  1RTJ A;  1G7C B;  2CQ4 A;  1ZM3 A;  3GTY X;  4WYW A;  1MRO A;  3O1L A;  4P6Q A;  1EIY B;  2OTJ S;  3CIZ A;  1S1U A;  2MQM A;  2N3L A;  2R3V A;  1IKX A;  2DGT A;  3BO2 A;  1YZ7 A;  3GE9 A;  1S0V A;  1NLK L;  3K89 A;  1RAI B;  2G2O A;  4CTA B;  1NSA A;  1HFE L;  3PAC A;  4LRB A;  1KVJ A;  2I8E A;  2GVD A;  4KPC A;  1Q7Y T;  5BJR A;  3OUY B;  4U9R A;  4NLD A;  1L3T A;  1U1R A;  4UQG A;  4YHH J;  2E5L F;  1TUG B;  3R5B A;  2DBB A;  3VGT A;  4JI6 F;  1LWE B;  5FDL B;  5IV4 A;  5A8K B;  3W9H A;  1XNQ F;  1U26 A;  1YWX A;  4H4K A;  2YNF A;  2KN4 A;  4TU8 A;  2ATC B;  3ZZR A;  3UN5 A;  1T9U A;  4KR0 B;  1VQ5 S;  4B3T J;  1VIS A;  4ZHR A;  3NCR A;  2UXB F;  2RRN A;  1TK5 A;  1Q78 A;  1XNR F;  4PZV A;  1JXV A;  3C6T A;  4NAS A;  3JYT B;  3UN2 A;  3PR4 A;  3EDQ B;  3CJQ A;  3MHY A;  3PW4 A;  1U8S A;  2Q6C A;  3AAW B;  2CPE A;  3RAM A;  1N0U A;  5KT3 A;  2E1R A;  2H54 B;  4DR7 F;  3MM8 A;  4WKR A;  4Z7Y A;  4EI2 A;  4P7T A;  1WKL A;  3MCS A;  2ROG A;  2VG7 B;  3H4D A;  2J0Q D;  2KZZ A;  2J9D A;  2AJQ A;  1HBO B;  3KK3 B;  4I6Y A;  4O0I A;  1OSC A;  1ZA1 B;  4RBV A;  3FRY A;  2HZC A;  4LF5 F;  4CO2 A;  4YN3 B;  2ILZ A;  5EN1 A;  4UOF A;  4X65 J;  1T05 A;  1YLX A;  1RKI A;  4G3I A;  4F4W A;  1URN A;  5D15 A;  4AUK A;  4DG1 B;  3PW0 A;  2IRY A;  3NP5 A;  2CPX A;  2MQ8 A;  5HBM B;  2QZ8 A;  4ELV A;  4IOA Q;  2O01 C;  4QJV A;  3W3S A;  3HFK A;  2VAS A;  1JLQ A;  3RBZ A;  3ONQ A;  4WE1 B;  3RG6 A;  3I4H X;  1RT4 A;  1RAC B;  3VWS A;  3N28 A;  3WX4 A;  2BOA A;  3C19 A;  2E7X A;  2UV8 A;  2DD8 S;  3QGI A;  4KPY A;  4DQS A;  1RKJ A;  1G2E A;  1R89 A;  1NB2 A;  5I3Q A;  4OZ1 A;  1TK0 A;  2JJ4 D;  5F3Z A;  5D0E A;  1FRM A;  1S99 A;  2GNK A;  2EVZ A;  3TUP A;  4KC5 A;  1QM9 A;  2XGP A;  2NYH A;  1MG7 A;  4KGK A;  3MCM A;  1WC3 A;  2FVS A;  2ZKT A;  3OTO J;  4OX9 F;  3NMR A;  3SSQ A;  2HHX A;  5H1S V;  4CNY A;  3QAE A;  3MM5 B;  1F2H A;  3MF5 A;  1SKW A;  3DI6 A;  3K17 A;  1HIY A;  3M2U A;  2ZE2 A;  3VGS A;  3W60 A;  4DV0 F;  2MZS A;  1T3N A;  4DQI A;  2EXU A;  3D3B J;  4DZ6 A;  3TVY A;  2EKN A;  1T11 A;  3CXC R;  1B0T A;  2DXF A;  1O0P A;  2W4C A;  3E2E A;  2DT9 A;  5D3G B;  1XC9 A;  5RUB A;  2N7Y A;  2OI2 A;  3JQK A;  1REV A;  5LMU J;  4G6V B;  1LW0 B;  1Z2L A;  4UY8 5;  4CI0 B;  4Q2L A;  2Z2L A;  1S6P A;  4PWD B;  3GFX A;  2GJI A;  2YQ1 A;  4UST A;  3GU0 A;  1QDU B;  1YBA A;  2VG5 B;  4C8N A;  3X3U A;  1JLE B;  4DR1 F;  3M8S A;  1V3Z A;  4X84 A;  4O4G A;  1JLA A;  2A3J A;  5KFC A;  1D8Z A;  1XER A;  3R5G A;  4NCG A;  1TMJ A;  2AJ0 A;  2V4Q A;  3OBI A;  4IG3 B;  2KG1 A;  2K06 A;  2HQC A;  4HHJ A;  3C15 B;  4ES2 A;  1JJC B;  4DL4 A;  1RWU A;  1RTI B;  3ILJ A;  1HI8 A;  3V81 B;  1LXN A;  1FEE A;  4BWJ A;  4LIR A;  1FKA F;  5EWF A;  1RIS A;  2Y8Y A;  3A4T A;  4QR0 A;  2WOM B;  4ELT A;  3PTW A;  1UPP A;  2BMB A;  4X4U A;  2XY7 A;  1VHF A;  2GHV C;  3FBC A;  1BQM A;  4ELU A;  4JI1 J;  1SV5 B;  4AE5 A;  3AT1 B;  1RWN B;  3D6H B;  3AJD A;  4HVZ A;  4NYZ A;  2B0G A;  2DHX A;  4RNF A;  4EYH B;  1RAE B;  4PQU B;  4DPX A;  1OY8 A;  3TX8 A;  1GTH A;  2D3O 1;  2AZ1 A;  3GMG A;  3CMA S;  1RZM A;  4A46 A;  1LV5 A;  4B9T A;  4OZ0 A;  3PJ9 A;  1NPR A;  3AD9 C;  1TL3 B;  4ED4 A;  3AJ1 A;  1QE1 A;  1N36 F;  2XLK A;  3M6X A;  3HP6 A;  4ZIW A;  3HHL C;  3D2W A;  4DR5 F;  3OV7 A;  4ZVT B;  2FQQ B;  3PY8 A;  1U7L A;  4ATN A;  2QLW A;  2SXL A;  1U1M A;  1RHJ B;  3HSZ A;  4Y65 A;  2FZC B;  4P72 A;  5K9F A;  1MMN A;  1S76 D;  2FVQ A;  2FLP A;  3I5A A;  3GR0 A;  3BSC A;  4IFY A;  3HHE A;  2FHO B;  4G1I A;  2BAC A;  2DRB A;  2EWH A;  1BC6 A;  3KJF B;  2CPY A;  4NLR A;  1AFI A;  2UUB J;  1RTZ A;  9ATC B;  4CLS A;  4FF4 A;  3QRP A;  1HHQ A;  4ALZ A;  3RBE A;  3R2D J;  3V4I B;  3DRS B;  4ZVU B;  2JX2 A;  2P5V A;  1QD1 A;  4QIE A;  2VPW B;  3R6G B;  2KFZ A;  1NXI A;  3PO5 A;  2P9C A;  1WD6 A;  4K2X A;  4M5L A;  2Y1I A;  4PXB A;  2MKI A;  4ZIV A;  4DFK A;  3HT3 A;  2VJU A;  3BDE A;  4F3M A;  3H5S A;  1UW4 A;  1X31 C;  2RVJ A;  3M1V B;  3CPW R;  1U4B A;  2YKN B;  4FVM A;  1N5S A;  4MIA A;  3LQV A;  3W5Y A;  3M32 B;  3LTO A;  1ZA2 B;  3GG1 A;  3R5D A;  2N4D A;  5E3C A;  2H51 B;  4MT1 A;  2WB4 A;  4TN2 A;  5KT4 A;  1HD0 A;  3M7V A;  1AUS L;  4ECW A;  4AYB D;  4LF6 J;  4LBI A;  2MHE A;  3K8V A;  1UFW A;  4ETZ A;  4UY8 T;  1IKY A;  1JXL A;  3A13 A;  2BRL A;  2OEJ A;  1U0H B;  4DI6 A;  2QRR A;  1XBW A;  3T5L A;  1BWE A;  5GAD U;  4FP9 A;  1JNR B;  4CO1 A;  3TAP A;  4OI3 A;  3DOL B;  3GSI A;  3GCX P;  5J1P A;  2OPR A;  1R0B G;  4B3R F;  3MWB A;  3AH6 A;  4BC9 A;  4NLS A;  4DBQ A;  3QWP A;  1KTV A;  1Y4Z B;  2YQ0 A;  2AKW B;  3MPW A;  5IM0 A;  4OV1 A;  4DJB A;  3ET6 B;  4MK9 A;  3KLG A;  4I2Q A;  2VBX A;  2COL A;  3WX8 A;  4CLZ A;  5DGB A;  3IM8 A;  1R6Y A;  4ED5 A;  3WZ0 A;  3QGG A;  1J5O B;  1PJ7 A;  3P5B P;  3I5B A;  4E98 A;  4J37 A;  3DXS X;  4NI2 A;  1M5S A;  3CME S;  4N76 A;  2HK2 A;  2FHM A;  1HW8 A;  3CC7 S;  1V5V A;  2W9B A;  1S0N A;  2G0I A;  3M9N B;  2R8I A;  5KG1 A;  3V6K A;  2YWG A;  2HK3 A;  2XBP A;  2VJV A;  3S7R A;  2AEF A;  3OTD A;  5E3A A;  4X4S A;  3TAN A;  4BCA A;  5CXT A;  3RJM B;  3MEK A;  4L6V 3;  2AJ2 A;  2G4B A;  4QU6 A;  1N4L A;  2XCA A;  1Y9O A;  1HNX F;  3N79 A;  2DCU B;  3AQO A;  4WCE Q;  1VQM S;  3NS6 A;  2ZKU A;  1KOO A;  4DFM A;  3DOK A;  4NWB A;  4R0E A;  4PXD A;  4FYV B;  4U7C A;  4FN5 A;  4TLR A;  3RBX A;  2GGP A;  1WG1 A;  1S0O A;  2M9K A;  4KHM A;  3PVX A;  4YR0 A;  1FKO A;  2X51 A;  5GAE I;  1V3R A;  3UN3 A;  3MMA B;  5D0R A;  3MR5 A;  2X1F A;  5AXK A;  4GC7 A;  4DXL A;  3MUT P;  3DKD A;  4DV3 J;  4RUB A;  5K14 B;  2V9K A;  1NAQ A;  3KK2 A;  2GAG C;  3AHP A;  2BW7 A;  3MED A;  2EW9 A;  2YKM B;  2K1R A;  4Y6I A;  5ETM A;  1Q5V A;  2G2Y A;  2WW4 A;  5GAG U;  4QWA A;  1B7F A;  5G0R B;  4P9S A;  1LWX A;  4LF2 A;  5DDP C;  2DPI A;  4GKJ J;  2DNZ A;  4AFF A;  1KHV A;  3BM7 A;  1U6B A;  4CH7 A;  3RGI A;  3BV8 A;  3PO4 A;  3LPE A;  2MY8 A;  3DLK B;  3I55 S;  4J9K A;  2GHW A;  4DLE A;  1RSC A;  4JP8 A;  1P27 B;  3NNH A;  3W63 A;  3RR8 A;  5GME A;  4TY8 B;  1R0A B;  1WC1 A;  1UMJ A;  2F4F A;  4NLG A;  2ZBC A;  2DHG A;  2HBZ B;  3BSA A;  2GJ2 A;  1NU4 A;  2DNR A;  1WC5 A;  5A8K A;  4OX8 A;  5IQQ A;  1I51 B;  3AA8 A;  2MLX A;  3CCS S;  1S1T A;  1WOO A;  1Y11 A;  1FRL A;  4MFB B;  4CP5 A;  1H3D A;  2WHO A;  4CH0 S;  1NHV A;  1UET A;  3IXQ A;  2EG2 A;  2KJV A;  1SQE A;  1GAO A;  4ZPB A;  3P3D A;  1R27 B;  1A9N B;  1U45 A;  3JYT A;  1M5P C;  3DU5 A;  3H7H B;  3A3O B;  1SCJ B;  3VQS A;  2YX4 A;  3DRR B;  4RW4 B;  2JZ5 A;  4DPW A;  3WQP A;  2DGQ A;  3GON A;  2HGL A;  4IRK A;  3V6J A;  4NLT A;  3FBB A;  2G9O A;  3PYD A;  2XY6 A;  2GW8 A;  5AXM A;  1XR5 A;  2AIR B;  4QIG A;  2R7Q A;  2OML A;  3R27 A;  1NPK A;  1OY6 A;  1NRK A;  3OFE A;  5IC6 B;  3MEE A;  2E9T A;  3BGO P;  4F0K A;  2H5E A;  3MAQ A;  4ZLJ A;  3KK3 A;  4NZ7 A;  2GQC A;  2H1Y A;  1PG5 B;  3TUZ C;  1HBN B;  2RAQ A;  4B3S F;  5HI7 A;  3PRD A;  1WF0 A;  1FFG B;  1JKH B;  4WFX A;  5ETL A;  1IM6 A;  3K5P A;  5C2G A;  2B7B B;  5CZV A;  3TI0 A;  1D9F A;  4L3K A;  2M70 A;  3R7N B;  2ZBP A;  4ZVE A;  3GII A;  1M5O C;  5IV3 A;  4J9N A;  3D6M B;  4KSE B;  3MFH A;  3NCP A;  3C8Y A;  2GO8 A;  1HQE B;  4F04 B;  2BBE A;  3JSB A;  2OP5 A;  2LA6 A;  3G82 B;  3EGV A;  2DO4 A;  1FES A;  1GMU A;  4BS2 A;  3MMC A;  4JI8 J;  4R5P A;  4X66 J;  4WE1 A;  5KFT A;  3JTP A;  3D54 A;  4FZV A;  2VFT A;  2ASD A;  5C5J A;  3KJN B;  1C1C B;  4GC6 A;  4LR7 A;  5JXS A;  3VAF A;  2XTJ P;  3GV8 B;  1U2R A;  4I64 A;  1VBZ A;  2W8L A;  2J6S A;  3HHN B;  1UA1 A;  2Q79 A;  3QID A;  2GAH C;  1K8A T;  3DC2 A;  3P8B B;  2HBQ B;  1QY7 A;  4XDC A;  2KXN B;  5LJ3 Y;  3SFG A;  3FFI B;  3BBB A;  4OV6 A;  2VZ9 A;  2PEH A;  3TW0 A;  4HHU A;  5D3G A;  1FA0 A;  4NRU A;  1XJW B;  4DV4 J;  1VBX A;  3O8W A;  1SPB P;  1T9T A;  4ZVO B;  1ZM4 A;  3D9B A;  4GRS A;  2DGV A;  4HKQ A;  4JI3 F;  4DQQ A;  1VDH A;  4I7F A;  1NKC A;  2KH9 A;  3UNG C;  1NK7 A;  2ABY A;  2PFF B;  5DG8 A;  1NSP A;  4A8O A;  2VG5 A;  3ZTS A;  2B9E A;  2ERR A;  5H9E J;  2CQ1 A;  1JLE A;  5IS2 A;  3MAH A;  3CCM S;  2CVI A;  4RU2 A;  3TR5 A;  3KDN A;  4PXC A;  1RUS A;  1HBU B;  1RTH B;  4LF8 F;  2K3I A;  4F4X A;  1CJV A;  1TL5 A;  2CQI A;  4OMF G;  1QLN A;  2B51 A;  1TV6 B;  2QL7 B;  1VQL S;  2V8P A;  3C15 A;  2F5G A;  2E7V A;  3EUN A;  3J81 Y;  4Q8F A;  1NHU A;  2XWX A;  2BJ9 A;  3NAH A;  5A8W B;  2QFJ A;  4WPA A;  1U24 A;  2F1F A;  4RLE A;  3C14 B;  3M8W A;  5HO4 A;  1XMO J;  4CLL A;  2V34 A;  3IGN A;  1X9M A;  1KR4 A;  2GVZ B;  4UQT A;  2F9D A;  1FX4 A;  1SJ4 P;  4NXM F;  4DU7 A;  4J9R A;  1QJH A;  2CQB A;  5LSO A;  2ADB A;  1X60 A;  2BE7 D;  2N3O A;  2ZD1 A;  1O51 A;  5A2Q Y;  1YJ7 A;  1FFS B;  1UAW A;  5CH7 B;  5HVG A;  2JEF A;  4C0H A;  4K4S A;  2IPO B;  1T8E A;  2UXC F;  3T5H A;  4N8N A;  2PMH A;  1GMV A;  1SJQ A;  2K8G A;  2ZJQ Q;  4NLW A;  1WDD A;  1UZH A;  1TL3 A;  1X4A A;  5HQ8 A;  3M8Q B;  4TVA B;  2A2C A;  2MZQ A;  2J9D E;  1Z4U A;  3ISZ A;  5E33 A;  2HQF A;  2ZH4 A;  4QWC A;  1MWY A;  3W2V A;  5F9N A;  1SC1 B;  4OYB A;  2Z4P A;  3KNG A;  2OPS B;  3D0G E;  2BE2 B;  4MIB A;  2HAI A;  1APS A;  2KI2 A;  4GO7 X;  5C25 B;  1X5S A;  1BD6 A;  4FVC A;  1F9F A;  5D4L A;  4ZVG A;  1JB0 C;  3I0R B;  1Z2Z A;  3G6E S;  1DUR A;  2VPZ B;  4K0K J;  4KB7 A;  4ZP7 A;  1NDK A;  4MKA A;  4U7U D;  1UTA A;  1NUE A;  1NDC A;  2N4C A;  4OX6 A;  1M1H A;  2DNK A;  2QA1 A;  2C2R A;  2KB2 A;  5I42 B;  2CQ2 A;  4EZ6 A;  2LDI A;  1LFW A;  3CTR A;  1NKB A;  1PJ5 A;  4B3O B;  2W4D A;  4ZPA A;  1Q0N A;  3KTQ A;  2HIQ A;  3M1V A;  3BGR A;  3W9I A;  2QN6 B;  3BPS P;  2EC0 A;  1FKP B;  3AQP A;  4ES3 A;  3IWN C;  1VMB A;  3HK2 A;  3A8J A;  3FSY A;  4QR1 A;  3QBC A;  3KJV B;  3EVW A;  1UP1 A;  3PIP Q;  2Y1L B;  1B64 A;  4HLB A;  5CYJ A;  1WF1 A;  2I1R A;  1WKJ A;  2H3E B;  2VQF J;  3CJ4 A;  3W9J A;  4DN9 A;  3NGK A;  2HG4 A;  3DGP B;  4QWB A;  3LOU A;  2NZC A;  3PJX A;  3L4B C;  2AW0 A;  4PUO B;  4B9V A;  5HSP A;  1CBK A;  2HLT A;  2OMO A;  3MTJ A;  4DX7 A;  4LSN A;  2VFU A;  2PT0 A;  1Y00 A;  1S9G A;  2PA8 D;  5BXI A;  3L7P A;  1KON A;  3R1L A;  4UZB A;  2UU9 J;  5ADZ A;  4EBE A;  3OVB A;  1Y5N B;  4J9U E;  3QT8 A;  2I9S A;  4RNN A;  3WC0 A;  1GH8 A;  1J5O A;  1WOR A;  4FYY B;  2ZNY A;  1C1B B;  2HMI A;  1FE4 A;  2BUN A;  2RQK A;  5HRO A;  2QC3 A;  5G4D A;  4JV0 A;  2HFU A;  4U6P A;  3KLF B;  2XCP A;  4H4O B;  4C8K A;  2CQC A;  1TKD A;  4I6W A;  2QFI A;  4KGM A;  2WON B;  1HNV B;  3W1Y C;  4KHP F;  1IBL F;  3DMJ B;  3TEH B;  5DM7 Q;  4NCA A;  2XO6 A;  1Q16 B;  2CJK A;  4NXN J;  3W61 A;  1NME B;  4A4J A;  3M2V A;  1C0T A;  2VU5 A;  3G86 A;  5KFE A;  3H0P A;  2MQQ A;  2XY5 A;  1S97 A;  2I6W A;  3RTV A;  2IA6 A;  3BF4 A;  3K58 A;  3BGU A;  2DNO A;  3SYZ A;  1F0X A;  4HI2 A;  4C6A A;  6FDR A;  4LT6 A;  5HL7 Q;  4C98 A;  3J80 Y;  4LQ3 A;  3FC9 A;  5L1K A;  4MAK A;  3RR7 A;  1RT5 A;  4QIW D;  3FRZ A;  2E9R X;  1VOM A;  4ANC A;  2F7V A;  4DSL A;  5KFD A;  2C2K B;  3UVJ B;  3QT6 A;  1FE0 A;  4LFB F;  3ZNU A;  5GAD I;  1UJ5 A;  2QV6 A;  2M88 A;  5L46 A;  3L3C A;  4Y34 A;  3VZH A;  4DV5 F;  1I3O B;  1P8G A;  2LQJ A;  2J5A A;  3MMB B;  4TY9 A;  1EJ7 L;  2PSZ A;  4G1Q A;  4KY3 A;  1P1T A;  2YPZ A;  2ZEJ A;  5ETS A;  3MOJ B;  1RAD B;  4YB6 A;  2HHP A;  4YEA A;  2B4V A;  3DCA A;  4O3R A;  3TZX A;  2FVC A;  4OQJ A;  4J9V A;  3VGV A;  3OXF A;  1D1U A;  1TL1 B;  2NUH A;  4EFA C;  3EX7 B;  3SI8 A;  2CNK B;  2HHW A;  2WBR A;  3L95 X;  3G6V A;  1IBK F;  2CJQ A;  2DTJ A;  3Q23 A;  3DLK A;  2H4Y B;  3THT A;  1Y10 A;  2KYZ A;  4CO5 A;  4KQZ A;  1QTN B;  4NLV A;  3CVK A;  1ZH5 A;  2MZT A;  2Y1J A;  3VAH A;  4J91 A;  4NA1 A;  1OWX A;  1MSW D;  4TY8 A;  1KBR A;  4CLF A;  2LLZ A;  3RB4 A;  5CYM A;  1N5Q A;  5A8R A;  1TU0 B;  2DJW A;  1CS4 B;  3PHE A;  2CZV C;  3IO1 A;  4JI6 J;  3A3P B;  4CO4 A;  2J6U A;  1XNQ J;  4XIU A;  1FI4 A;  2WVB A;  3OD2 A;  4MFB A;  3Q24 A;  2LEA A;  1DJ0 A;  3VHQ A;  1D9A A;  4WFB Q;  5L9N A;  3AFG A;  1N48 A;  3EIC A;  1N5Y B;  2UXB J;  4N41 A;  1XNR J;  3HHL B;  2FGC A;  4EO6 A;  1AA1 B;  1L3V A;  4TU7 A;  1VR6 A;  3CO9 A;  4HI1 A;  1U6F A;  3LA0 A;  3HVT B;  3UD5 A;  4DF4 A;  1FWP A;  4DR7 J;  5DG7 A;  4USJ C;  1S59 A;  5H9E K;  3QO9 B;  3IBC B;  4Y2A A;  5GAG I;  5KAK A;  1YJN S;  3TEG A;  2FLO A;  2LEC A;  5E41 A;  1GT8 A;  2UUC F;  1YTY A;  2DR7 A;  2OGU A;  4LF5 J;  1RE1 B;  5A6W A;  1B7Y B;  2CA9 A;  1JKH A;  1QVG R;  1ZPV A;  2VDI A;  2XHC A;  1RT3 B;  3UD4 P;  2R8H A;  3WIU A;  3DRP B;  2EBE A;  1R3N A;  3ENV A;  2Q66 A;  3NMA A;  2QO3 A;  1RHU B;  1AUD A;  4ZPD A;  4ECT A;  1NJY A;  2RHQ B;  3NGU A;  3UO0 A;  2ATL A;  2LCW A;  1KLM B;  2C3U A;  1VI7 A;  3K2Y A;  1MW7 A;  2RE1 A;  2X7I A;  3UDE A;  3EXC X;  1C1C A;  1M5K C;  2Y0B B;  1RWP B;  4RL1 A;  3QZ8 A;  1U48 A;  3CJ2 A;  1UVN A;  2JDJ A;  4YS2 A;  4IO9 Q;  1ACM B;  1YRT A;  1T7P A;  3TO8 A;  3TZW A;  3PYE A;  3KG1 A;  2DGX A;  2C2E A;  2OAU A;  1X0P A;  3FEX B;  2E44 A;  5B7W A;  3GLJ A;  2Z2Z A;  5DQH A;  3CCW A;  3HCX A;  1FTR A;  4DQR A;  3GCW P;  2XZT B;  2G0J A;  4ECR A;  2W01 A;  3MOZ A;  2DO0 A;  4OX9 J;  1VFJ A;  2QL5 B;  1JLC A;  2XYG B;  1T0T V;  3B78 A;  3CCU S;  2AGQ A;  5KFR A;  3OSP A;  5LXY A;  2B5J B;  4ETX A;  2L41 A;  1T9W A;  3DGV A;  1FRI A;  4DV0 J;  1VQY A;  1TKT B;  5EX0 A;  5J1E B;  4IR1 A;  1X4H A;  3CNQ P;  4IUF A;  3U27 A;  2IY5 B;  2CNL B;  1RU2 A;  4QYR A;  4DZD A;  2GJF A;  2JFK A;  2XLI A;  3G71 S;  1SL1 A;  5B0A A;  2J76 E;  4BLG A;  2CPZ A;  2DGU A;  3C66 A;  4RW6 A;  2HZV A;  1TL7 B;  2QX0 A;  3GWC A;  1TKZ A;  4JV2 A;  4PEO A;  4WF9 Q;  4A47 A;  4DR3 F;  2HQI A;  1I1G A;  1JLB A;  4DR1 J;  2CQG A;  3TRG A;  3CWJ A;  3CDA A;  2L9N A;  2ALY B;  5CCM A;  4DDF A;  4ED8 A;  1RTH A;  4IRC A;  2A0F B;  4C11 B;  2DIT A;  4MJK A;  4L74 A;  5D4O A;  2WB1 D;  4YY3 F;  1R43 A;  1TV6 A;  2FHJ A;  2RS2 A;  3PDN A;  1RWW B;  2JEJ A;  1RAJ A;  3TP2 A;  1GX6 A;  4RNM A;  3V6D B;  5DZ7 A;  1RJJ A;  3SMZ A;  1HWL A;  1VLY A;  4E2F B;  5AE1 A;  3NWG A;  3P45 B;  4CLW A;  2BJE A;  3PR5 B;  1DY3 A;  5C42 B;  2ZH6 A;  1FJG F;  4DWI A;  5HP1 A;  5IWA F;  5U47 A;  1HW9 A;  4GVB B;  2DNL A;  2YKO A;  5KFZ A;  1SJ1 A;  2O67 A;  5C7P A;  4ZJQ A;  1UZD A;  1I94 F;  3MXH P;  2MQP A;  3QGH A;  2IC3 A;  2P6T A;  5HLF A;  2YPY A;  5CZX A;  1WEX A;  3B4D A;  1RT1 A;  3GIM A;  2Q6B A;  5L39 A;  4IFV B;  3BH6 B;  5I3U B;  3CJT A;  3G9C A;  3SIP B;  5A0Y B;  2PC6 A;  5J2N B;  3ILO A;  4FS1 A;  1N36 J;  1RT2 B;  4DR5 J;  2LEP A;  1UPM B;  4J9O A;  4USU A;  2OJ3 A;  4I4B A;  2BE2 A;  2GIF A;  2HNZ A;  2KM8 B;  3PXG a;  2RU9 A;  4TLQ A;  2GV1 A;  2V4J B;  3BB5 A;  2HND B;  1EB0 A;  3MAA A;  4M5D A;  5E3R A;  1DFD A;  5AJ3 F;  3IG1 B;  4RWX A;  5CHC B;  4NML A;  4NOH A;  1YRU A;  2I5J A;  4WYL A;  2NRE A;  1FDD A;  4HR2 A;  1FNM A;  2P6S A;  1OY9 A;  4CT8 A;  2V0N A;  3IFE A;  1T3O A;  1E6Y A;  2HQD A;  2J7W A;  3AJ2 A;  3FJ2 A;  4TYB A;  2CAD A;  3E8O A;  3H8Y A;  5KFB A;  2ZBI A;  3OL9 A;  4NLY A;  2GFF A;  1S4E A;  4V19 X;  1EX8 A;  5E2Q A;  1KWM A;  3VAG A;  3T9N A;  2F65 A;  1JLG B;  1ZPW X;  1FKP A;  4DR2 F;  3KG0 A;  3DM2 B;  1S0M A;  3BN4 A;  3ISN D;  1HI0 P;  4A8F A;  3H4B A;  3OR2 B;  2B56 A;  5EGY A;  2M0G B;  1QAY A;  2ZJP Q;  4OZ5 A;  3HVA A;  3F41 A;  3HHK A;  6AT1 B;  1S12 A;  1BWV A;  2DXD A;  3LO3 A;  4C4W A;  1T03 B;  1MWQ A;  1NB7 A;  4QR2 A;  4RKU C;  3ITH B;  3TOQ A;  3EYZ A;  2V69 A;  4KGZ B;  3BKU A;  1EAY C;  2ZH8 A;  2G1D A;  4AL7 A;  4JI4 F;  3D1O A;  3FMB A;  2V8G A;  5HVF A;  1RXO B;  4DL2 A;  3CSK A;  1X5T A;  1EP4 A;  1KN6 A;  3R6L B;  1QSY A;  4XDD A;  3EM1 A;  4WFA Q;  5A6P A;  4QIF A;  2MKH A;  4CYU B;  3FQK A;  4C0B A;  3A3N B;  1FCA A;  2PI5 A;  4ECX A;  2IJF A;  4EK2 A;  2FC9 A;  3CCL S;  2MLY A;  5LJ5 Y;  1C1B A;  2R7W A;  5T41 A;  1K1S A;  1UVL A;  4LR8 A;  4AXI A;  2M5Y A;  4EWT A;  2XMK A;  4CLU A;  3A12 A;  3KLF A;  1YSJ A;  4DPO A;  5LSR A;  1ROF A;  3OLA A;  3MI7 X;  4CCH A;  1YJT A;  2WON A;  3T9Z A;  4HL9 A;  1PJ6 A;  1LNQ A;  4O3S A;  1YZ6 A;  4ED7 A;  4X4V A;  4GMK A;  2IBO A;  3PFE A;  1J2V A;  2KU7 A;  2XMM A;  2CUY A;  4R0J A;  4F0H A;  2XI3 A;  1KNZ A;  2VFR A;  1AW0 A;  5FLX Y;  3T1A A;  1HNX J;  1VRT B;  4ZLL A;  1VQ6 S;  2KVQ E;  2YWF A;  3H20 A;  4RZR A;  3H42 A;  1H0H B;  2CQ3 A;  5F8N A;  2FVR A;  2OD6 A;  4PG6 A;  2YBV A;  2DH7 A;  3Q0A A;  1VS3 A;  3K5N A;  3PCO B;  4ILL A;  1YJ9 S;  4DS5 A;  4PCQ A;  2Y8W A;  3ZFV A;  3G87 A;  3OFF A;  3KMS A;  4YR3 A;  4P2X A;  2HKE A;  1O5J A;  1RB0 A;  2IDL A;  3I87 A;  1XMB A;  3ILI A;  5K5M A;  1JX4 A;  3MMB A;  2JH3 A;  4J5O A;  2CZ9 A;  2CDQ A;  1U49 A;  4DS4 A;  2KXF A;  2AYE A;  2AMC B;  3C2P A;  2R2U A;  2LXF A;  3ELH A;  4DFP A;  2CVE A;  3E01 B;  2F8E X;  4ZVP B;  2E1A A;  3KHR A;  2DEI A;  4OHV A;  5FD1 A;  5CD4 A;  2ZH7 A;  2LQ8 A;  2JC0 A;  3CIM A;  1KD1 T;  3IAM 9;  1LXJ A;  1RTD A;  5D8H B;  1S9E A;  3N6M A;  3JSM A;  4KT0 C;  2EEY A;  1ZBT A;  2XG8 A;  3IRX A;  2Y9H A;  3I6P A;  5T14 A;  3EPG A;  2L3M A;  5JJB A;  2RSQ A;  2DGO A;  3EPI A;  1W26 A;  3A1Y G;  2F8H A;  2ZDP A;  4LF9 F;  3KLV A;  8RUC A;  3NWR A;  1RHR B;  1X5O A;  3BKT A;  2R7X A;  1LKZ A;  1FO1 A;  4WK1 A;  2JSX A;  2ZH1 A;  2BEF A;  2R8G A;  2WBM A;  2CG8 A;  2FJB B;  4P73 A;  4KKO A;  3DLL Q;  2DCL A;  1RP5 A;  1H98 A;  1PAU B;  2C2N A;  1A0O B;  2AJ4 A;  1U6Z A;  1CC7 A;  2NXJ A;  3N6L A;  4KGX B;  1HWU A;  2RIL A;  4OYO A;  3SQO P;  3M2R A;  2YNH B;  3HHL A;  3PZP A;  4USM A;  2J9E A;  3CT9 A;  1FER A;  1H2U X;  2EFP A;  1ICE B;  1NO8 A;  1E6V A;  4N56 A;  3MDF A;  4UZC A;  2FDN A;  3QO9 A;  3RB0 A;  4PAA A;  1V3S A;  3UD3 P;  2RS8 A;  2R42 A;  1I6J A;  4I1T A;  4WP9 A;  4FNH A;  2IM3 A;  3ENW A;  2RDJ A;  3D4J A;  3FEZ A;  3CCJ S;  3UQS A;  2ZBR A;  2BM1 A;  3JAM U;  1KHW A;  4WTY A;  3BDP A;  3CD6 S;  4AL5 A;  2VG6 A;  1YKW A;  4TNO A;  3NOC A;  3ZTR A;  1BE4 A;  4I6A A;  3Q89 A;  5KFS A;  8AT1 B;  4B3S J;  2LU1 A;  5A76 A;  4ZJO A;  1GMW A;  3U7J A;  3NRB A;  3J7A 1;  3POT B;  5FJ4 A;  1NKE A;  5F9L A;  3OFG A;  2OPQ B;  3QIP A;  5IT9 U;  3NBP B;  4ZPT R;  2KZM A;  3H40 A;  3BBF A;  2UVW A;  5SUH A;  4OI4 A;  3N0V A;  2NXU A;  4ZJL A;  4ZS6 A;  1KKH A;  1OO0 B;  2CQD A;  2GS8 A;  4O3Q A;  4K4X A;  4KE5 A;  2V67 A;  4FS2 A;  4B3M F;  4DUT A;  1TFY A;  4IYQ A;  1SJF A;  2V6A A;  1CVJ A;  4S0M A;  1SH2 A;  3BSO A;  2R8K A;  1D3W A;  4X4T A;  5AE3 A;  4F2R A;  1TFW A;  2W25 A;  4HYK A;  3G8T A;  4LF7 F;  2W7A A;  5KG4 A;  1UW9 A;  1Q79 A;  2VPY B;  2XMA A;  2B9W A;  4DCP B;  4DR6 F;  2H9Z A;  4NEZ A;  1IM4 A;  1SI9 A;  2ZOF A;  1R8B A;  4DU8 A;  1S6Q A;  3NGS A;  2AJ1 A;  4NX9 A;  4V19 J;  3GV7 B;  1Y5I B;  3PG9 A;  2G1H A;  3DLE A;  4J90 A;  1H2V Z;  3KDO A;  2BJ3 A;  3M05 A;  2W2O P;  4XO0 A;  2ZUG A;  2Y3Y A;  1PBA A;  3I82 A;  5J1E A;  3SDE B;  4ZMM A;  4HHH A;  3QJJ A;  3ENQ A;  4Q43 A;  5HMY A;  1UEU A;  4ZP6 A;  3MTK A;  3EZ5 A;  1WSR A;  5LMN F;  4EGL A;  2AGO A;  2NZ4 A;  3G2X A;  2HNY A;  3WIV A;  1WHY A;  1CJT A;  3HVW A;  2H5I B;  1YBU A;  4JI3 J;  2YNG A;  4N5S A;  1RYS A;  2RUG A;  1B0V A;  3V2U C;  4OI0 A;  2DRA A;  2DNH A;  1M5V C;  5GMD A;  3OSN A;  4V1A k;  1P9Y A;  4HAC A;  4R25 A;  5J2P A;  1WEY A;  1W2B R;  3KUE A;  4IKA A;  4Y0F A;  3FSX A;  3K0J A;  2BAB A;  2E66 A;  4C11 A;  3TJ9 A;  3B82 A;  4QYZ J;  2V8V A;  4KO0 B;  4ZVF A;  3D68 A;  2YH1 A;  2FB0 A;  1HNZ F;  1NCL A;  4DR4 F;  3CJ3 A;  2E5H A;  3V6D A;  2CPI A;  3FZ2 A;  1RAF B;  3D6F B;  1YJW S;  1BQN B;  3HHD A;  3HDS A;  4C2M A;  3M8P B;  2AHO B;  1UVM A;  2ZC3 A;  4A8M P;  2OEK A;  3IS9 A;  4DMZ A;  1TUW A;  3QLH A;  1UWB B;  4PG7 A;  5J2M B;  2IYI A;  4NLO A;  5JMN A;  2HVI A;  1HPZ A;  1M1G A;  3HZG A;  4UOG A;  1FDA A;  2DY1 A;  1WDT A;  3KLI A;  1SIW B;  1LWC A;  2CNN B;  5F0W A;  4ED3 A;  1N32 F;  5L8R C;  3UCZ P;  2UXC J;  3DOM A;  3CC4 S;  3KMQ A;  4NRT A;  1UEK A;  3QGP A;  5FII A;  4O3O A;  3Q8P B;  4K4W A;  3ZTQ A;  4Q0B A;  1YI2 S;  1VC0 A;  2Q1L A;  1WC6 A;  4R8U B;  5IXU A;  3S01 A;  1EKR A;  4CWB A;  3QMQ A;  1LK7 A;  3H25 A;  4H4M A;  3IMQ J;  1VQ7 S;  1J5E F;  3MUR P;  2MGZ A;  4QIV A;  4TYA A;  2VKR A;  2UXD F;  2BV3 A;  4K7Q A;  2HND A;  2HHH F;  4PPZ A;  2VF3 A;  3IG1 A;  2HQ3 A;  2V2Z A;  5DGA A;  5KFU A;  5D4P A;  1QAI A;  4B9L A;  2C1E B;  1UJ6 A;  3S6E A;  1G4C A;  4JV5 F;  2DNN A;  1HNI B;  2HWI A;  3AB4 B;  1MNE A;  3T5J A;  2KG0 A;  2GQ2 A;  1RCX B;  3F44 A;  1JLF A;  2L9D A;  1FK9 B;  2FHK A;  5ETK A;  3JQM A;  2RQC A;  3MPY A;  1WOP A;  2DYA A;  1VHI A;  1PYT A;  4O44 A;  1FJE B;  3OQ2 A;  3MCO A;  3GIJ A;  4JI5 F;  2X1B A;  1JLG A;  1HR0 F;  4F25 A;  1D09 B;  3OHA A;  4M5H A;  3QZ7 A;  4NZ6 A;  2D69 A;  2XSJ B;  5KTQ A;  1WF2 A;  4CLK A;  2CWX A;  3GFZ A;  1N8R T;  1YGY A;  2APO A;  2W24 A;  5HK4 A;  1DBD A;  4WBF A;  3A8K A;  3ITH A;  2QMU B;  5DLF A;  4IR9 A;  4WXW A;  2ZZM A;  2R7V A;  2VV5 A;  1RAA B;  2RJZ A;  4GO5 X;  1U1P A;  3MEC B;  4FXV A;  3C16 A;  4KAI A;  2NQP A;  1WKK A;  2KYX A;  1FD8 A;  2YKA A;  2MTL A;  1Y0H A;  3MGJ A;  1V6H A;  2EFN A;  1MML A;  3CCQ S;  2D3Z A;  2ROP A;  2R7T A;  3R5C A;  1K0V A;  3IP0 A;  2LXI A;  2KHC A;  2YH0 A;  4J9M A;  1CJK A;  1IKW B;  4CT9 A;  2HFS A;  2POK A;  4RBT A;  3HUL A;  3RBD A;  1F5A A;  3R5J B;  3BKF A;  3GJQ B;  1RTJ B;  2B6A B;  4UF4 A;  3HJF A;  2DIS A;  1F1B B;  5KG5 A;  1MRO B;  1PIE A;  2RT3 A;  1KP6 A;  4PG8 A;  1U0S A;  2OFG X;  1U8W A;  1U1N A;  1FWL A;  3D28 A;  4KHP J;  1RAG B;  1IBL J;  5AT1 B;  3GYG A;  4ZVQ B;  2C3O A;  2LVW A;  2BJ8 A;  1UCN A;  5L38 A;  2OSR A;  4OLP A;  1NJW A;  3E3X A;  3SBM A;  3FUY A;  2GVD B;  1OPZ A;  2DNP A;  2F8M A;  4FBU A;  2BE9 B;  3U02 A;  1FNX H;  5KG2 A;  4DL5 A;  2CPF A;  4WFZ A;  1TAU A;  3BO3 A;  2CRL A;  3KKF A;  2LQ5 A;  4PXE A;  1O6X A;  2XHW A;  4TKT A;  2CJY B;  2KRB A;  4EMD A;  2YNF B;  3QFW A;  4ECQ A;  3KHG A;  2QSF A;  2XM3 A;  5CQG A;  1JWW A;  4LFB J;  3O2I A;  2KL8 A;  5KFL A;  1Q81 T;  2VHG A;  2HHU A;  1YX2 A;  4F4Y A;  4DV5 J;  2BX6 A;  3I5C A;  2OPP B;  3CO0 P;  2LKZ A;  4DPU A;  3MM8 B;  4X4Q A;  1ZM9 A;  3PFO A;  3UPF A;  3BR9 A;  4ZOS A;  3NG8 A;  3E01 A;  2LU2 A;  2ZH3 A;  3DN9 A;  4M5K A;  2YTC A;  4ECY A;  4ZN1 A;  1M0S A;  4ZVR B;  2C42 A;  4QCL A;  1RT6 A;  4RPF A;  2CJ9 A;  1KQG B;  3Q22 A;  4N47 A;  4Q45 A;  3OVA A;  4ANE A;  3HPO A;  1IBK J;  3S1T A;  5GMK a;  3GIK A;  1XR6 A;  2I0X A;  3SV3 A;  2QYG A;  1RU1 A;  5M2R A;  4DSE A;  2F4V J;  1SKR A;  2AGP A;  1SL2 A;  3LP0 A;  1CUL A;  1UVJ A;  4PR6 A;  3OR1 A;  4QOT A;  4L73 A;  2W2P P;  2D74 B;  3O3L A;  3MM9 B;  2AQ4 A;  5DQG A;  1VQN S;  2JEG A;  2EI5 A;  3SV4 A;  3VVT A;  4ZA1 A;  2MKC A;  1DLO A;  1IKV A;  3CUL A;  1KEK A;  3FEY B;  3HI9 A;  4Z37 A;  3V4M A;  2EK1 A;  2IM0 A;  1BY9 A;  3DLB A;  2ZWO A;  3L09 A;  4IOB A;  3KXD A;  2ZH2 A;  3T19 A;  1N34 F;  3CJ5 A;  5HJY A;  3F56 A;  4Y3C A;  1K47 A;  1UL3 A;  4FYD A;  3H2V E;  2B4O A;  2YKP A;  1TL4 A;  3MPD A;  4X2B A;  3B54 A;  1H6K X;  3H2U B;  3CF5 Q;  1VLO A;  5BR8 F;  1YVF A;  3M2U B;  2D3U A;  1RAH B;  2ZH5 A;  2C2D A;  5KFF A;  4DF8 A;  2UUC J;  4QYZ K;  1F2G A;  2RF2 A;  4IO1 A;  3OHB A;  4PPD A;  8ATC B;  1FD2 A;  3D66 A;  2M2B A;  3KK1 A;  1SIZ A;  3W2W A;  2OHD A;  4DV2 F;  1T02 A;  1REV B;  1IXK A;  4PKD B;  4J9P A;  1U1K A;  3NAI A;  3POT A;  4CM0 A;  2BW2 A;  1RT7 A;  2MQO A;  1ZS6 A;  2NR0 A;  2GZO A;  3M6V A;  1HQU B;  4J9Q A;  2D7S A;  5F8J A;  2E5G A;  1QUP A;  4IG0 A;  2RNE A;  5CAA A;  2R2R A;  3WBZ A;  4XK8 C;  4BC7 A;  4DV6 J;  2JLF A;  4AQY F;  3OXL A;  2HSE B;  3D0H E;  1UJ4 A;  2QEX S;  3TQ1 A;  1ZYQ A;  4A8Y A;  3FQL A;  4CIO A;  2VOP A;  1WOS A;  4NA3 A;  4NCG B;  3HKZ D;  3BS9 A;  4A48 A;  2I2Y A;  3EGW B;  1S1V B;  4C8Y A;  1FHT A;  5HQL A;  2RKI B;  2F9J A;  3R3T A;  1PBU A;  5C24 B;  3I0S B;  3MR2 A;  4U8V A;  5HMX A;  4ZN3 A;  1HWK A;  1W25 A;  1OSD A;  4TXS A;  1BQM B;  4LRD A;  1LQ9 A;  2FD2 A;  4RW8 A;  2UVR A;  3MEG A;  5ETQ A;  3W66 A;  5LXR A;  4ZCK A;  2V94 A;  5KFM A;  4K50 A;  4GKK F;  2PFD A;  3SDE A;  4WZQ A;  3KJQ B;  4I2P B;  4TQS A;  1FDN A;  3O6Q A;  4NL5 A;  3AB2 B;  3QWU A;  4Q44 A;  1F5B A;  3ZNJ 1;  1S48 A;  4OHY A;  4YME A;  2BQR A;  2LP4 A;  1PO6 A;  3ZXW A;  1S1W A;  3D67 A;  1QE1 B;  2AZ3 A;  1WHX A;  4OLO A;  1Q7L B;  4NA2 A;  4KFB B;  1XTZ A;  3GPA A;  1XWL A;  2IJR A;  2CQH A;  1H74 A;  2DNG A;  2QLX A;  3KUG A;  4DR3 J;  3M6U A;  2NXE A;  1VBK A;  5J2Q A;  2CPJ A;  4IFY B;  1SKS A;  4ID5 A;  4WFN Q;  2OO4 A;  3QPI A;  2HFZ A;  4YY3 J;  4L3N A;  4K4V A;  1GX5 A;  1GK8 A;  2LXU A;  5DQI A;  2MJU A;  4P75 A;  1BQN A;  1RI7 A;  3M8P A;  4OYI A;  1NDP A;  2MZJ A;  2KT2 A;  4DL0 C;  4M5M A;  5KT6 A;  2QTW A;  3IR7 B;  3P49 B;  2ASL A;  4N77 A;  4OHX A;  3ETM A;  3BH7 B;  3FCV A;  1VRU B;  4CTA A;  1RBL A;  1S79 A;  5DLG A;  5J2M A;  4KYZ A;  2KM8 C;  5D0G A;  1FJG J;  3UW1 A;  5KFN A;  5IWA J;  3OUY A;  3Q8V A;  3WDO A;  4ECV A;  4OJG A;  3KNA A;  2PO4 A;  3CJR A;  1YHQ S;  4U95 A;  2EBG A;  1I94 J;  2HQG A;  1Y3K A;  2JL9 A;  1HQ2 A;  3W62 A;  1IR0 A;  1LWE A;  5FDL A;  5EWE A;  2V2Q A;  3HVR A;  5KFV A;  1QAJ A;  3GYX B;  2VOD A;  5KFH A;  2VQF F;  2MZ1 A;  1HA1 A;  3CCV S;  3KFW X;  5DM6 Q;  2V4R A;  4R8U A;  2JOQ A;  1IKY B;  1SXL A;  1FFW B;  5HAT A;  4MKB A;  5DJB A;  1SUQ B;  3QQC D;  3HX9 A;  3UCG A;  3AD8 C;  2AEJ A;  2DKO B;  2DB1 A;  4QQB A;  1T9X A;  4NMX A;  1EAR A;  2NPI A;  2XQC A;  3R97 A;  2VG7 A;  2IRU A;  2ZVI A;  5AJ3 J;  4LIW A;  5DS7 A;  3KLG B;  2HBR B;  4I2Q B;  3BQ2 A;  3M9M B;  1XMQ F;  1HBO A;  1KSP A;  4M1K A;  1U02 A;  1HNI A;  2ASY A;  1TVR B;  3PJW A;  2I38 A;  1Y3J A;  4YQW A;  4OHW A;  2NYI A;  3RU0 A;  3VF0 B;  1YJV A;  4KIA A;  1QTM A;  1YQH A;  4P2F A;  2FLN A;  1B3T A;  3AOD A;  4DG1 A;  2NSB A;  3FMW A;  1FX2 A;  2W9B B;  1NDL A;  1WHW A;  3QSY B;  5HBM A;  4C9D A;  3LWL A;  3D1Q A;  1RHM B;  2BQU A;  3K8W A;  4F0M A;  1TMM A;  2GO9 A;  1WTF A;  4DR2 J;  2HRU A;  1XEZ A;  2JWN A;  4BWM A;  5IT0 A;  2K7J A;  1B70 B;  1FEH A;  3TYT A;  2CFX A;  2P2C B;  4HDH A;  4QW8 A;  1WTB A;  1VJW A;  1VQK S;  4H54 A;  2ILY A;  1T9V A;  1BQX A;  4FF2 A;  4ERD A;  1ZAV A;  4USW A;  3EZO A;  1NEE A;  4NZ0 A;  3D3C J;  4I56 A;  3PKY A;  1JQG A;  3DOK B;  2A6M A;  2CG4 A;  4QPX A;  4DSK A;  4JI4 J;  3NGT A;  2GHP A;  4IDK B;  2GGP B;  1CQM A;  3RRK A;  1N5T A;  1GTE A;  3MD3 A;  1FKO B;  2XSF A;  1DAX A;  2RQM A;  2ZZN A;  3PV8 A;  1YJU A;  1KOH A;  2QLB B;  5KOX A;  3MM5 A;  4A8W A;  2W2M P;  3ZZO A;  3DLJ A;  1KRP A;  4JI7 F;  2CQP A;  2FJA B;  3ETO A;  1VRQ C;  3DLG B;  2B6A A;  2QIF A;  1H38 A;  3MPV A;  4DEZ A;  5MAO A;  1IVZ A;  4OI6 A;  2J8S A;  2VIC A;  3HO1 A;  4JV1 A;  4YFU A;  1R8P A;  3NCQ A;  1RWO B;  4YB5 A;  3NY0 A;  3KWM A;  4LFC F;  1LW0 A;  2AV5 A;  2K7K A;  3IR6 B;  4PWD A;  2IVY A;  3Q8Q B;  1VQS A;  3FSI A;  1CPZ A;  5HMW A;  3PYG A;  3VV2 B;  5D6G A;  2HS0 A;  3UR3 C;  5KG6 A;  1ELO A;  2J0S D;  3MCN A;  2UUT A;  2GC8 A;  3DXB A;  1NK9 A;  3EZU A;  1Z1Z A;  1WC4 A;  3FNN A;  4IG3 A;  1S10 A;  1R7I A;  4O4R A;  4LMZ A;  3I9V 9;  2ZC4 A;  3OTE A;  1S1T B;  1RTI A;  1BUX A;  2UP1 A;  1V5I B;  5ETO A;  3CCR S;  3V81 A;  1FTC A;  3BRE A;  4L72 B;  4ZLN A;  4M5J A;  5KG3 A;  4B9M A;  2W1B A;  2WOM A;  3Q2S C;  3SSS A;  2UUW A;  1SV5 A;  3OL6 A;  2HHS A;  2OPP A;  1U1Q A;  1U09 A;  1H72 C;  1NZA A;  3H59 A;  3OJU A;  4URQ U;  1WUU A;  5KFW A;  2E1P A;  3AA9 A;  2HFN A;  1LWF B;  2HW3 A;  3EXY A;  3J81 U;  3MEE B;  2AX1 A;  4PQU A;  2VBZ A;  3T1H F;  4F3O A;  4PG4 A;  3V5R A;  2XMT A;  2R7R A;  1W2I A;  2JC1 A;  1NM2 A;  3F73 A;  2WK4 A;  2GIQ A;  4X64 F;  3J7Y U;  1L3U A;  5GAH U;  2Z56 B;  4KGV B;  4ZP9 A;  2A18 A;  3BYP A;  2MST A;  1IN0 A;  5A2Q U;  5JVH Q;  1OJ4 A;  3ULH A;  2WZ1 A;  3UI3 A;  3EGN A;  1B99 A;  3PKM A;  3ISN C;  1B4S A;  1FWK A;  2B7C B;  4LF9 J;  3MMC B;  3OTC A;  2DIV A;  3BSN A;  4IQM A;  4C3M A;  3RUB L;  3CJ8 A;  4R5P B;  2AYG A;  3BYR A;  3MPU B;  1TKX B;  3H5U A;  4RNO A;  3MM9 A;  1AYE A;  3H98 A;  4GVL A;  4W4M A;  2VFS A;  5L1L A;  2VDH A;  4DCO B;  2YX1 A;  3V4I A;  3DRS A;  4CO3 A;  2CDR B;  2JFD A;  1WJ9 A;  4F2S A;  1IQT A;  1NH8 A;  4Z7C A;  2QMX A;  2Y1R I;  3H2L A;  2M52 A;  4KRW A;  2BZ2 A;  4QBU A;  4B9S A;  5B0D A;  4LSL B;  2FIU A;  2F63 A;  2OKQ A;  3R5A A;  1X7V A;  4IQX A;  2DPJ A;  2HEK A;  1PYO B;  2Z8Q A;  2YKN A;  4NCB A;  2MEW A;  4EZ9 A;  3TA1 A;  1KVK A;  4F36 A;  1WEZ A;  3DU6 A;  1UA0 A;  3M32 A;  3TWZ A;  1ZM2 A;  4Y2M A;  1MU2 B;  4EO8 A;  4X4N A;  1WWH A;  4DL3 A;  3SCJ E;  2O5D A;  4DOZ A;  3CGI A;  1F3V A;  3I9Z A;  2V9W A;  1F60 B;  3HFV A;  1F9E B;  4LFA J;  2D9P A;  1HLW A;  3MZI A;  5K8O A;  4FF1 A;  4I7F B;  2V8D A;  1HQU A;  4UOH A;  1C4C A;  3TJA A;  1U0H A;  1FXR A;  5HMZ A;  4NYP A;  4M63 A;  3JXO A;  3KYL A;  5F8I A;  2QL9 B;  3DOL A;  2LA4 A;  2X1A A;  4CLT A;  3LGN A;  2V5H G;  3NGR A;  1S6U A;  4UTG A;  3Q83 A;  1GXT A;  3U1L A;  3W64 A;  3CDB A;  2ZM6 F;  3ET6 A;  4OZL A;  2K2P A;  3PEJ A;  1CJV B;  4B3M J;  1R0C B;  1XIQ A;  1QUV A;  2PMW A;  1I5O B;  2ZVS A;  3T1Y F;  4TU9 A;  4ZK7 M;  1S1V A;  1IBM F;  3MD1 A;  2RKI A;  1RAO A;  5C24 A;  3I0S A;  1HWI A;  4P10 A;  4LF7 J;  2FVP A;  3IRW P;  4DR6 J;  2UUA F;  1R31 A;  1VQ4 S;  2ZHB A;  3GFH A;  4AT1 B;  4WWS A;  4OJ3 A;  5C2C A;  4HTJ A;  2HUR A;  1KLN A;  1VC6 A;  4ITS A;  1EET B;  2ACM A;  1NK4 A;  4F4Z A;  4D3G A;  2ZD1 B;  3GV5 B;  5KFA A;  4W98 A;  2QE5 A;  2HVD A;  1Y7P A;  2MYF A;  3CDE A;  4RW7 B;  1GFW B;  2XYH B;  2VL1 A;  4I2P A;  3P4U B;  1Q1K A;  1Q8L A;  1PC4 A;  4EU0 A;  3PNI A;  3GFY A;  5LMN J;  2IAJ B;  2HFV A;  3IGV A;  2GMJ A;  2WSC C;  4CLY A;  4ZPC A;  3UR0 A;  1YIJ S;  2DNY A;  2PA3 A;  2RIJ A;  4KFB A;  2XZW A;  3MMA A;  2KRR A;  5BYR A;  3W2V B;  3SQG B;  2DIU A;  4Q8E A;  1R8C A;  1DTT B;  5K14 A;  1CQN A;  2MZR A;  4DSJ A;  1MN9 A;  2EC2 A;  4ECZ A;  1U1L A;  3K59 A;  1N56 A;  3T5K A;  3J80 U;  3J7Z 5;  1D0E A;  2YKM A;  2E1C A;  5EDW A;  2AP6 A;  4CO0 A;  4RWW A;  3W8G A;  2AYM A;  2Q43 A;  2VPX B;  1UEV A;  1MN7 A;  4OYZ A;  2YY3 A;  5G0R A;  1HNZ J;  4DR4 J;  5MLC V;  1X4E A;  2OD4 A;  2RU3 A;  2RRA A;  5KFI A;  1OPI A;  1FVS A;  2LDY A;  4F3Q A;  1NND A;  3LGM A;  2R2S A;  4YOE A;  2YWK A;  1VRU A;  4DN0 A;  1TZ0 A;  4FXW A;  3KHH A;  3EGZ A;  1X4B A;  4LF4 F;  4RW9 B;  3BGR B;  4ES1 A;  5KOW A;  2M8D B;  1R0A A;  4OI2 A;  1FXL A;  3HSG A;  1SQG A;  4NYO A;  1M5H A;  2W2Q P;  4ED1 A;  2E5L J;  2C3Y A;  4ECS A;  1OIA A;  1N32 J;  3JS9 A;  3SEO A;  2BKP A;  5KT2 A;  1VJQ A;  2NPF A;  1S57 A;  3RYL A;  1OQ6 A;  2CIM A;  4OZ3 A;  1TTH B;  2DR8 A;  5K20 B;  1FRH A;  2KT3 A;  2AT1 B;  2HS4 A;  2ROE A;  3NNC A;  3MR7 A;  3DRR A;  1SUQ A;  4RW4 A;  5L1I A;  4ICL B;  4B9U A;  3AY0 A;  5EX3 A;  1N33 F;  1K1Q A;  2QSW A;  1VCT A;  1J5E J;  2QYC A;  4LSN B;  3TZY A;  1U2F A;  2O3D A;  1S49 A;  3MMJ A;  1N6Q B;  4DV1 F;  3RW6 A;  1S9G B;  3O5T B;  1DTQ B;  2UXD J;  1LK5 A;  1WG4 A;  3VAM A;  4IH7 A;  4FKY A;  3TZZ A;  4YR2 A;  2HHH J;  1Q86 T;  3OJS A;  5KFG A;  4YP3 A;  1KTQ A;  4K4Y A;  3VVU A;  3HJV A;  1VC5 A;  4JV5 J;  1QVF R;  3UDL A;  2N82 B;  1TVR A;  1HBN A;  1WNE A;  2HMI B;  7AT1 B;  5CYQ B;  1S72 S;  5HRO B;  2NXN A;  2HAF A;  1Q4R A;  2MKK A;  2CJA A;  2A6O A;  4RBU A;  4F02 A;  3QJL A;  4ZCM A;  1UVI A;  4JI2 F;  2C2Z B;  1JMT A;  1RAB B;  1DHM A;  4NEY A;  4URS A;  2ZFH A;  3JTO A;  1HQE A;  4JI5 J;  1UVK A;  3G82 A;  3M2V B;  1HR0 J;  3R2C J;  3M9O B;  4LBP A;  2H5J B;  1RA6 A;  1L3S A;  1FDB A;  4OYX A;  1C0T B;  4JYA F;  4RX6 A;  2IA0 A;  2ZH9 A;  4BDP A;  5E0O A;  2F3J A;  3IWL A;  3R9L A;  3ZO7 A;  4C0O C;  3EVO A;  1XK8 A;  5CAB A;  1AZS B;  4OZJ A;  2E9Z A;  3GJR B;  1VGY A;  5DZ6 A;  1DRZ A;  2BKN A;  2ZNZ A;  2KFY A;  3D7S B;  4NLU A;  3H90 A;  1RT5 B;  4UW2 A;  5SZT A;  2Z30 B;  4IDK A;  2ZIT A;  2CPH A;  3HXM A;  4DX8 H;  4PYD A;  3R7S B;  3K5L A;  2DGW A;  2EFG A;  1HNW F;  2CNO B;  3CMQ A;  3CD7 A;  1G3O A;  3JQJ A;  4HH1 A;  3MM7 B;  2FPH X;  5LL6 d;  3Q2T C;  4YUD A;  1FJ7 A;  1IR1 A;  3F0N A;  4KH1 B;  5AE2 A;  3CD5 A;  3OW2 R;  3FFI A;  3TAM B;  1IWG A;  2P8I A;  2R4F A;  3TA2 A;  4I0W A;  2MJN A;  4ZPW R;  3J7Z T;  3HLU A;  1HYS B;  4G1Q B;  4WKY A;  1EQM A;  3N5B A;  1N54 B;  3M6W A;  2QGF B;  3LP1 B;  4HT7 A;  4P7V A;  2VC0 A;  3ILL A;  2DH8 A;  1RWK B;  2ZOM A;  3DLG A;  4FPR A;  3DHW C;  2G2Z A;  1JK9 B;  2R8J A;  4H4K C;  3KUH A;  2AYB A;  3LUY A;  2NSC A;  2KTQ A;  5ETP A;  2FHJ D;  5KG7 A;  2YVS A;  2IMO A;  2VOO A;  1T94 A;  2JNJ A;  3SFU A;  2BJ1 A;  5D4N A;  5HJX A;  3MR6 A;  3IR5 B;  2ZZT A;  4FYW B;  4PAB A;  3BJY A;  2BDP A;  5LT5 A;  3O44 A;  1C2P A;  5HQM A;  3CCZ A;  1HBU A;  4YB7 A;  5CYM B;  4HTI A;  5A8R B;  4XAK A;  1UWA A;  3DFE A;  4Y00 A;  1VQ8 S;  1A6L A;  3ZTP A;  4Y28 C;  4OL8 A;  2BM0 A;  5ITH A;  4DUZ F;  3DDK A;  2YX7 A;  1URR A;  4QWE A;  1H73 A;  3V6H A;  3US5 A;  5A8W A;  1NBE B;  3JSR A;  3P96 A;  3C14 A;  4DX5 A;  2V2V A;  3J7A N;  2HLU A;  2CKW A;  2RDI A;  2V63 A;  3DRX A;  4UUW A;  3D0I E;  2GVZ A;  5ETN A;  1H2T Z;  2R2T A;  3VAI A;  3I4P A;  1DAR A;  1P6T A;  1WG5 A;  3GYN A;  3DDI A;  1LWF A;  1RWV B;  2X1G A;  2XNR A;  4XTT A;  5F8G A;  4FKX A;  2C2O B;  1H7W A;  1HKA A;  2ZWP A;  1B0P A;  5EWG A;  4LRF A;  4LRA A;  1U1O A;  1RHQ B;  3LAK A;  3W5Z A;  4RNH A;  1HBM B;  2U2F A;  2QJ3 A;  1PYS B;  1HWJ A;  1PKU A;  1PCA A;  1HMV B;  4MMO A;  1NSQ A;  2IHR 1;  1PSD A;  5LOQ A;  3M8Q A;  4W92 B;  1HHS A;  3FVY A;  3C6U B;  4FPI A;  3QJP A;  3AXM A;  2OFH X;  1OMS A;  1FVQ A;  3TUI C;  2RUS A;  1M1K T;  2OPS A;  2WVD A;  4CM2 A;  3NXZ A;  3L7U A;  1KQF B;  5C25 A;  3L9Z A;  3N4W A;  1RK8 A;  2IVF B;  4A8Q A;  4DPT A;  1F3F A;  1TKX A;  3I0R A;  2NCK L;  3IA0 A;  4DPY A;  3BBC A;  3LPY A;  1RYR A;  3NEK A;  1K44 A;  1SC4 B;  3GIL A;  1S1X B;  3LP2 B;  3IWX A;  4OZN A;  1CSJ A;  3OTB A;  5I42 A;  2BRK A;  3T6J A;  3Q8Y A;  2YQ3 A;  5B0F A;  2UZA A;  4B9N A;  2MSS A;  1N34 J;  2AWZ A;  4B3O A;  1SH0 A;  3R1H A;  4LSL A;  4ZCI A;  3QRQ A;  3ZTO A;  3EDR B;  4B08 A;  3KLE B;  3WC2 A;  1JLC B;  3OL8 A;  3QAU A;  4MTP A;  4G1P A;  4P52 A;  2KFN A;  4F4K A;  2RD5 C;  3UFC X;  4MK8 A;  5DRK A;  5BR8 J;  5IT4 A;  4X62 F;  2Z2Y B;  1S4F A;  4AL6 A;  4Z2X A;  2IMW P;  3PRB A;  1KFS A;  9RUB A;  1N88 A;  2BR0 A;  4ED6 A;  3HZE A;  3KJV A;  1MU2 A;  2FZK B;  5KFQ A;  2E5J A;  4ECU A;  1T9Y A;  4RR5 A;  2XMV A;  4HT5 A;  4CQ1 A;  4YDD B;  3J7Y I;  5GAH I;  5E3P A;  2QLJ B;  4DV2 J;  3DGP A;  4L75 A;  1TAQ A;  2AF6 A;  5HAN A;  4DV7 F;  4PUO A;  3DYA B;  4WJB A;  2DR5 A;  4ILM A;  4RW6 B;  4OIX A;  2AX0 A;  3TNV A;  2M4M A;  1S7H A;  4NLQ A;  2KJW A;  1AT1 B;  1CC8 A;  1TKZ B;  5J1N A;  1PAE X;  4C48 A;  2Z2M A;  3SZ2 A;  4AQY J;  4DUY F;  4RO0 A;  4DSF A;  4WU3 A;  3HSD A;  2VA2 A;  3CDU A;  1JLB B;  2HHQ A;  2J7U A;  4B3R J;  2XGQ A;  4JI0 F;  2VQE F;  3NNA A;  4KHR A;  3PX0 A;  2L9W A;  1K9M T;  2MQL A;  1K0T A;  1SQF A;  3RB6 A;  5EHH A;  2W9C B;  3RAQ A;  1SH3 A;  4H4O A;  2BAN B;  3VZI A;  1D9D A;  4X4R A;  3U1N A;  2E7W A;  1X4C A;  2QA4 G;  1HNV A;  3G8Q A;  4JBC A;  1SKU B;  1X4G A;  3DMJ A;  4P71 A;  4K2J A;  1PIL A;  2WAQ D;  2XEX A;  2XUL A;  1PC5 A;  2DNQ A;  2J0X A;  2W9A A;  4ZLP A;  2MDA A;  1EET A;  4ENO A;  1RWM B;  1X9S A;  3FBF A;  5HP1 B;  2VFV A;  3EMT A;  5DDO C;  4YHH F;  3W7B A;  4GKK J;  2HYI B;  3NGD A;  2BXJ A;  4K5R A;  4RW7 A;  3Q8S B;  3PRV A;  3CED A;  2GML A;  2HBY B;  3I31 A;  4CLP A;  1TQL A;  3DRY A;  3JTN A;  2IC3 B;  3EVM A;  5HLF B;  1KDN A;  1RT1 B;  2IAJ A;  1AXQ A;  3M8Y A;  2EFV A;  3KLH B;  1CJU B;  1LW2 B;  3CC2 S;  1V9O A;  4B3T F;  1ZOT A;  2VB6 A;  3D1H A;  1NHK L;  3UVJ A; 
#chains in the Genus database with same CATH homology
 1Y11 A;  4NI2 A;  4WP9 A;  1CUL A;  3C14 B;  4CLT A;  2BW7 A;  3G82 B;  3C15 B;  3C16 B;  1YK9 A;  1CS4 A;  1TL7 B;  4CM0 A;  1YBT A;  4CLL A;  4USW A;  4OYM A;  4OYA A;  1WC6 A;  2GVZ B;  4OYP A;  4OYI A;  5D15 A;  3ET6 A;  1FX4 A;  4P2M A;  4CLY A;  1AB8 A;  5IV4 A;  4CLK A;  1CJV B;  1CJT B;  4NI2 B;  4WP3 A;  3MAA B;  1Y10 A;  4CM2 A;  4USV A;  2W01 A;  4P2X A;  4CLU A;  1U0H B;  4CLS A;  5D0G A;  1WC4 A;  3C14 A;  1CJK B;  1AZS A;  2GVD B;  4CLF A;  3G82 A;  3C16 A;  3UVJ B;  2WZ1 A;  1TL7 A;  4P2F A;  4USU A;  4OZ3 A;  4OYX A;  1CUL B;  2GVZ A;  1CJU A;  4OYW A;  2QV6 A;  4OYO A;  1CS4 B;  5D0H A;  4WP8 A;  1FX2 A;  1CJV A;  4OYZ A;  3MR7 A;  4UST A;  1WC0 A;  3ET6 B;  1CJT A;  4CLP A;  1YBU A;  3MAA A;  1AZS B;  3C15 A;  5D0E A;  1WC1 A;  4CLZ A;  5D0R A;  1CJU B;  4OYB A;  4CLW A;  5IV3 A;  1U0H A;  4OZ2 A;  1WC5 A;  3R5G A;  1CJK A;  2GVD A;  1WC3 A;  4WPA A;  3UVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...