1WC5A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp in presence of bicarbonate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
193
Chain Sequence
b'MRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
total genus 55
structure length 193
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc5A00
4OYWA 2GVDA 1YBUA 5D0GA 4CLLA 4CLTA 1FX2A 2W01A 1FX4A 3G82A 3MR7A 4CLSA 1AB8A 1U0HB 1TL7B 3C16A 4P2MA 1Y11A 4OYPA 1WC6A 4CLFA 1WC1A 1CS4B 3ET6A 4CLYA 3C15A 1YK9A 4WP8A 2GVDB 3MAAA 5D0HA 3UVJA 1CJTB 4CLUA 4OYZA 4USWA 1CJKA 4WP9A 4CM2A 1CJVA 3G82B 3C16B 4USVA 4WP3A 4OYIA 1CULA 2GVZA 4USUA 4CLPA 4NI2A 4P2XA 3ET6B 3C15B 4OZ2A 3C14A 3R5GA 4CLKA 3UVJB 1WC0A 5D0EA 1CJKB 1AZSA 4OYMA 1WC5A 5D15A 1CJVB 5IV4A 4P2FA 4OYOA 4WPAA 4OYXA 1YBTA 5D0RA 5IV3A 1CJUA 1CS4A 4OZ3A 4CLWA 2QV6A 3C14B 4CM0A 1CJTA 3MAAB 4OYAA 2WZ1A 1WC4A 1AZSB 4OYBA 2BW7A 4USTA 1U0HA 1TL7A 1CJUB 4CLZA 1WC3A 1CULB 2GVZB 1Y10A 4NI2B
chains in the Genus database with same CATH superfamily
2DNKA 3OUYB 2GVDA 1RWOB 2WBMA 2FHOB 4RW8B 5K8OA 2DNMA 5EHHA 3R1HA 5B09A 2RJZA 1X5OA 1QY7A 4O3RA 5F8HA 1PYTA 2R7RA 5DDOC 1VS3A 1VQPS 2RHQB 4LF4F 1B0VA 4B9LA 2UU9F 3OL8A 5DRKA 4OYIA 5A8WA 2LQ9A 2L3MA 2E5LF 3DI6B 3L7PA 4OI0A 4OHWA 2VG5A 2V94A 1HBUB 3NCQA 1S0VA 2DNPA 2VQEJ 2KFZA 4A4JA 3Q8RB 2HNYA 2J0QD 5LXYA 2B6AA 1T03B 1CJTA 4X66F 1WOPA 2CPXA 3PJWA 3W5YA 3WQPA 4IFVB 1AZSB 4IYQA 2R8JA 3DLKB 2YNHA 1URNA 1IKXB 4ECRA 1HWJA 1WKJA 3CSKA 3BQ2A 2IA6A 2ZZMA 5JXSA 3S8SA 5ETTA 2OD4A 2QE5A 2FVCA 4P2MA 4RW6B 1R43A 1TZ0A 2O3DA 1LK5A 3RB6A 3RR7A 3NOGA 1REVB 5FDLB 5IT0A 1S1UA 4KO0A 3PFOA 1XR5A 1RXOB 4LBIA 1SJ3P 4X4UA 4RZRA 1Q8KA 3NXZA 2ADCA 3HVRA 2V9WA 1MN9A 2L48A 3GFZA 3DHWC 3KLEB 3DLLQ 3AD7C 3M6VA 1E6VA 3IM9A 5MAOA 5J2QB 3K0JA 2W2NP 4LR9A 3V6DB 1WC5A 1HD0A 1APSA 3ZZRA 2WONB 3M8QA 3JB9k 4HHUA 2DGVA 1BMQB 2X1BA 2HNDA 4UUWA 1WUUA 4FYYB 2HPUA 2IC3B 4EU0A 4JI6F 1Q8BA 5L1LA 5AJ3J 2WOMB 1WNEA 4LT6A 2VQFF 2WVFA 2UZAA 3V81B 2JLEA 3AJ2A 5KFOA 3DRPB 4N5SA 3X3UA 1HBNB 2E1MC 1N5YA 2Z2ZA 4R5PA 2GNKA 4NRTA 4N8OA 1V9OA 1J2VA 2XO6A 4ZS6A 2N3LA 2CJBA 4DR7F 1E6YA 2YBVA 4BS2A 1IR0A 2YWHA 5K5MA 3PTWA 4DV4J 2V8DA 3GIIA 4LSNA 2IVFB 2ZH2A 2VONA 2HHHJ 3AA9A 2RVJA 2IMWP 4LF9F 4LF6J 1VQNS 3Q8YA 2OTLS 3ITHB 2ADBA 4JI2F 4K4WA 2DGWA 5HMXA 3MEGB 3W60A 1JLQA 4DV7F 4F50A 3LP1B 2KXFA 1B0TA 1KBRA 5H1SV 4DDFA 4EO6A 3MUVP 3SV3A 4PWUA 4OZ1A 3UW1A 1DJ0A 1XNRJ 3I82A 2EBGA 1RBAA 3W8GA 3N9UC 2R42A 2WB4A 4CO1A 4WYLA 5F0WA 2EFQA 5BJRA 1N0VC 3MEEB 2V5HG 1HW9A 2EC0A 5I3PA 1ZYQA 3A8JA 4GKKF 4EZ6A 4KQZA 2RQMA 1TK5A 3D1QA 4ZVOB 3MOJB 2DIUA 1LWEB 4FYWB 3OSPA 2XMMA 1S0NA 5HVFA 3N4WA 3M2VB 5MLCV 4DU7A 2CZ9A 2VPXB 1NPPA 1X0PA 3ZFVA 3IAS9 2MQQA 1N5SA 5KFWA 4IQXA 4QQBA 2B5JA 1HNIB 4PG4A 3KMQA 1RAOA 1FESA 1BY9A 2RH3A 3LANA 1OSDA 1BQNA 1CC7A 2DNQA 4DR4J 4X4TA 4L75A 3DU5A 3D6HB 3CD5A 1YLXA 3KK1A 1FKAF 2MHNA 1NSAA 3CCVS 4DR5J 2BW7A 3JSMA 1GMUA 4UQTA 2ZDPA 2QEXS 1C1BB 1NNDA 2XHWA 3JYTB 4IG3B 1WOOA 2EFGA 1ICEB 5BYSA 1TQLA 4XDDA 3NWGA 2DRDA 3CF5Q 3BPDA 3DOMB 3AJ1A 5K14A 4U6PA 2EC2A 4MKBA 5E3AA 5D8HB 4BWMA 4JI0F 5ETKA 2FLNA 1FI4A 1SPBP 2WK4A 1WHYA 3UD4P 4TU8A 2CPIA 3IFEA 3NAHA 4KRWA 4WYWA 2YNGA 2BVZA 4K5SA 2BOAA 5K8PA 1HWLA 4M63A 2DH9A 4OZNA 1K44A 2ASDA 5CYMA 2FHMA 4UW2A 2DNOA 1Q7LB 4KFBA 3L9ZA 3I0RA 1X7VA 3DGPA 5B0FA 2CADA 4WE1B 1AT1B 4MJKA 2V63A 5D3GB 3MMAA 3BGRA 5HMZA 4OJ3A 1SKUB 1CSJA 3KLGB 2ZUGA 1XNQJ 2BM1A 4MIAA 3NNAA 4OHYA 2O5DA 2E9ZA 3CJ2A 1GXUA 3MMJA 4YY3J 1S12A 3I31A 3PHTA 4IKAA 2AYBA 4CM2A 1OY8A 5J1EA 2Z8QA 4TKTA 1GEHA 1R0AB 1N6QB 1OJ4A 2DCLA 2QJ3A 1D3WA 1DURA 3SXLA 1S9FA 4JUZA 3SYZA 3TAPA 4DG1A 2ZZTA 3HHLA 3G4SS 2ZNYA 2HWTA 2CUYA 4B9TA 2SXLA 4IH6A 4O44A 4ZK7M 1IKWA 4DV1F 3LOUA 4QYZK 3GFHA 2RQCA 4JI1J 2UV8A 1IJFB 2AU0A 5CXTA 2J9CA 1Q86T 1RA7A 4NZ6A 2IJNA 2ZBCA 5M2UA 4WIIA 1RKIA 4TNOA 1RE1B 2ZH8A 3MR7A 4Y2MA 1NK4A 4DL2A 2MSTA 2NCKL 1S10A 1KSPA 1HYSA 1FJEB 3MMCA 3VV2B 1C4CA 4F3MA 4R8UB 2RILA 4X65F 1SL1A 2VG7B 3PYDA 3D1HA 3ZZYA 2HAFA 2RMLA 4F04B 3ENQA 4ECXA 2QFIA 3NGSA 3IWNC 4P2XA 5M2PA 2Z56B 1X9MA 1LK7A 3PIOQ 3MPYA 3RJMB 5LJ3Y 2YTCA 3KUEA 4OMFG 1TUVA 5HQLA 4CLWA 7FDRA 3M8PB 1NJIT 2VBYA 3J80U 1T9WA 3V6KA 2MKIA 1S48A 2F8MA 1CULB 5C42B 3W2WB 2DY9A 4TXSA 3R6GB 3QJPA 4P75A 3U7JA 3CCWA 2KZZA 4CLTA 5KG3A 1RABB 5GVQA 1MMDA 5F9LA 4LFAF 1RTIB 2Y8WA 2VF3A 3CD7A 1TAUA 4QW9A 1VQOS 2IBKA 1GMVA 4J90A 3T3FA 1LWFB 5IC4B 3LALA 4E0DA 4Z2XA 5F3TA 1VYAA 3TX8A 1OIAA 2OJ3A 2F8EX 1W2IA 1VQYA 4MIWA 5F9NA 3DOLA 2GO8A 2IRUA 2XSJA 4QR2A 3TZYA 3NLCA 4LFAJ 2CVIA 3BF4A 5ETQA 4J9VA 3EM1A 4LFCJ 1SVDA 1BD6A 4LRDA 4NYOA 4QZVB 1AUDA 2ASYA 4OI1A 3PFEA 2F9JA 1SXLA 3KNAA 1FE4A 1FCAA 3I6PA 4UY85 5ADZA 4K4VA 4OHZA 5T7LB 4Y2AA 2KXNB 1DTQA 2MLZA 4P9SA 1D8ZA 4B02A 5HAOA 1BHNA 2QA4S 1CG2A 3VAIA 4X4RA 2HHPA 1IBKF 4M94A 2M7SA 3DRSB 1NJXA 4C8KA 4ILRA 2XNQA 2YKNA 3HJVA 3BJYA 3QWUA 2JLFA 3IN5A 4CO2A 2ZOGA 2BXJA 3EUNA 1N5TA 1SC4B 4F4WA 5CCMA 2LXUA 2EBEA 2ZD1B 1RT6A 2VDIA 3HVWA 3DFEA 4ZVFA 4ECQA 3MM7A 2Y0SD 4K5RA 1Q5VA 2HSEB 3O44A 2AYGA 2K7KA 5KFEA 2UUAJ 2B0GA 3CPWR 5KG7A 2H3EB 4OX8A 3RG6A 2FHJA 2GO9A 4QW8A 3FEXB 1TMMA 2V69A 4LRBA 3U1NA 1N4LA 1H2UX 1TFWA 4E98A 3PW7A 2BJ1A 2LQJA 2EW9A 3GJQB 3CJQA 2FJBB 2GC8A 1JLCB 2GA7A 3QT8A 4QR0A 5LMNF 3QWPA 3NBPA 1X60A 2H4WB 2BJ7A 1R8AA 3DLGB 1UL3A 5T41A 1T8EA 1LW0B 2Z57B 3ENWA 4R0EA 2ZH3A 5D78A 4WFBQ 1EP4B 4LFBF 2FZKB 4DQQA 1IBCB 1TKXB 1YJUA 2QYGA 3DLJA 2VHGA 3GTYX 2DD8S 1S1TA 2HS4A 3QT6A 5C2GA 4UOCA 5JUMA 2J6UA 3QLHB 1RTHA 2HW3A 2W2MP 1KFSA 3TZZA 2JC0A 1CJKB 5CYQA 1S1XA 2OPPB 3RAMA 4H4MB 2IVMA 4MYUA 1YBTA 5D0RA 2CQ2A 3QFHA 1LNQA 1AUSL 3IO1A 3C6UB 1MMLA 3D28A 5KFKA 4WK3A 2ZH7A 4ED8A 1X4BA 4F7VA 1RU1A 2PO4A 3DDIA 2CWXA 2KT5A 4P52A 2FVSA 4O3PA 4X62F 4CT8A 1UTAA 2G13A 4EFAC 2CG4A 3E01A 3LUYA 2N82B 3D66A 1M5OC 2RF2B 4QCLA 4GO7X 3TZWA 4O3SA 4EUVA 3OFFA 4ZP8A 3DRRA 1U6ZA 3NS6A 2DNHA 2HVHA 4MIBA 2VPWB 3T1YF 4IRDA 4M5HA 4RU2A 4DX5A 1ZAXA 2VPYB 1VRTA 2OPSB 3R5JB 4GKJF 4S0MA 2RU3A 2NPFA 3D2WA 1TV6B 3NOCA 3RGIA 5LL6d 4GVBA 1HNZJ 1NH7A 3Q24A 4C3KA 2HHVA 4NI2B 4KHRA 3UD3P 1U24A 4B3OA 5KFHA 3GCWP 3FZBA 3I56S 1NJWA 4RW7B 1NK8A 3HSGA 1Y9OA 1K9MT 2GX8A 4WFNQ 1K73T 3GWCA 4V19J 1YBAA 2DCUB 3ZTPA 4KB7A 3S01A 4ZVGA 2YX4A 3CMES 1TTHB 1OY9A 4D3GA 4USUA 3FKBA 3FJ2A 4I2QA 5JVHQ 2G1DA 1YJ7A 2B3TB 1X4HA 1XBWA 3HHNB 1GX6A 2BBEA 5AXMA 2EFPA 5I3UA 3NNHA 4OYMA 4ZP9A 4O3OA 3DMJB 1NKBA 2BQ3A 3DKDA 4OZ3A 1FFWB 2IVYA 2K06A 1KQFB 2APOA 2ALYB 2VA3A 4CYUA 3GJSB 1L5UA 4E2FB 2OMLA 1R8PA 4WFAQ 1DY3A 1RHMB 4OYBA 3KUHA 4Q5VA 3OR2B 2D3O1 3FFIA 1JLAA 3NP5A 1FFSB 2DITA 2XZDB 1FKOA 4O4GA 1HQEA 1SKRA 1RT5B 2M4MA 3HHEA 6FDRA 5KFTA 3B4MA 1ZBTA 3BO4A 1WTBA 2IAJB 5DG7A 1NB7A 2MXYA 1U2RA 3KFWX 1VOMA 4LMZA 4J9SA 1T02A 4QWCA 2QA4G 5I4MA 1H7XA 3FDSA 3R1LA 2XWYA 2CPFA 1U1KA 4XDCA 1XMBA 2EG1A 3ET6B 3I32A 3B54A 4PWWA 3C14A 4PXDA 2CXEA 4MMOA 1EETA 2HHUA 5LSLA 5DLGA 2BX6A 1ZOTA 3KLFB 1QJHA 3GIKA 4DLEA 5BYQA 2PC6A 3BGFA 4ZCIA 1UJ6A 4I6YA 3M2UB 1SH3A 1YG0A 5LSOA 1MW7A 4F4XA 3M32B 1D09B 2WZ1A 1XR6A 3W9IA 3IGNA 2CRLA 4PWDB 1HKAA 1QAJA 1VHIA 1Y10A 3R6LB 5JVGQ 4NCBA 1KVIA 2XGPA 2HQFA 5HP1A 2AQ4A 1XJWB 1S9GB 4AQYJ 5HLFA 4UUXA 1U6BA 5BXIA 1TUGB 1U45A 1Y5NB 2ZWPA 1WHXA 3D0HE 1B3TA 3IR6B 5GAGU 5A8KB 3DRXA 1M5HA 1KOHA 2GVDB 3D54A 4H4OA 1OPIA 4RNFA 4CRJA 4I7FA 4ZITA 4NASA 3ZZPA 1S6QB 3QT5A 2BKNA 2CQHA 4TVAB 2ZH1A 3LAKA 1OQ3A 1RAIB 3OUYA 1FFGB 4YB5A 3L09A 3UO0A 1WC0A 2LLZA 4RW8A 3H2UB 3THTA 2WCXA 2UUCJ 1RP5A 3BDEA 2DXEA 2FLLA 4PG6A 2NS1B 1JKHA 5A8WB 5HROB 4G1QA 1B4SA 2MZRA 3JSRA 2VG5B 4P6QA 1R0BG 1PC5A 2V4QA 2HG4A 1C1CA 5KAKA 2HNYB 2A0FB 2GVZB 2D7SA 3MAQA 3QRRA 1HBMA 2OKQA 2YKQA 4ELVA 1RWWB 3PO4A 4PCQA 1Z2ZA 2C1EB 2YNHB 5B0BA 1UWAA 2E66A 2RB7A 4NLQA 3K5OA 1N8RT 1MLAA 1VGYA 2O1PA 4OJ1A 1S1VA 3TJ9A 4P73A 4M95A 2KRBA 2HFNA 3IM8A 4QPTA 2ALZA 1MN7A 2HFUA 3E8OA 3IS9A 4K7QA 1FKPA 1VQ5S 2NXEA 1S1UB 3J80Y 4DFMA 3Q89A 2FDNA 3NCPA 2H5IB 3UD5A 4RW6A 4BC7A 2KVQE 1U1LA 2M5YA 5FDLA 4RJVA 4AT1B 4B3TF 3HJFA 2RRNA 3OVSA 2D41A 4X4VA 4OX9J 3JSYA 4L73A 2ZH5A 2QRRA 3UNGC 4N47A 2HNDB 4RBUA 3CDAA 4ED2A 1QSLA 2KN4A 3CB4A 4UQGA 4F2SA 1Q16B 5A0YA 5ITHA 3HZEA 2WONA 2PMZD 4OYPA 4C9DA 2KL8A 3R5AA 3JQKA 4Y00A 2VG6B 3BZQA 5AT1B 5CD4A 3GV8B 5AE2A 1Y5IB 4NLDA 2ATLA 1IBMJ 4CO3A 4AL7A 1N5YB 2GZOA 4R5PB 2IM3A 2FB0A 5HSPA 3V81A 2AYMA 1RAFB 1Q79A 3ENVA 2HK3A 1HQUB 5KFUA 1BQMA 3CO9A 4PYAA 3LO3A 5IT9U 4X84A 3RBDA 5GAHU 3TUJC 2UVUA 2M3DA 1B0PA 2R2SA 2HQCA 1FRIA 2AGOA 3T5HA 4ECUA 1YRUA 4DSIA 1FRMA 3Q0AA 5GAEU 3AXMA 3HKWA 1RAHB 4B08A 3SFUA 2VC0A 3A8IA 2ILYA 2E9TA 2IMOA 3Q2TC 1JLQB 3CCTA 4AYBD 1H6KX 3VAHA 2EFOA 4Y65A 4O3QA 4MTPA 3MM8A 4DPXA 5LMUJ 3KUGA 2NQPA 3ITHA 5H9EJ 2Y3YA 2CQIA 2KTQA 4J91A 3I5AA 2ZM6F 4Z7CA 2DBBA 2XSFA 1N36J 1CJVA 1FRKA 4HTIA 2XS2A 1NSQA 5BR8J 1IM4A 2ZZNA 4F02A 4B3RJ 2YQ1A 2XNRA 3ILLA 3FBCA 2QLJB 4U67Q 3FRYA 1VIOA 2DVIA 3CCSS 2C3MA 2MJNA 4I4BA 1NDPA 5IXUA 4QWBA 5HVHA 4OZ0A 3BQ0A 2MDAA 4I64A 5KFJA 2E5JA 4ZA1A 3NWRA 1ZETA 3MEEA 4ECZA 1A9NB 3R3TA 3CCUS 3W63A 3W61A 3BYPA 2G0CA 4JI8J 3IXQA 2EK6A 4EI2A 4FF4A 4NLXA 3WZ0A 3T41A 3KXDA 1VFJA 4RL1A 1BQNB 3FSIA 3RAQA 1TKTA 2FIUA 1WTFA 2ILZA 2NXJA 3TARA 1VC0A 2HHSA 4I69A 1UP1A 5A8RB 1X0FA 4DR6F 5KOWA 5D0HA 4F8RA 4DV3F 1UA0A 3ZNJ1 4JYAJ 2UUBJ 5IWAJ 1C1BA 1Q82T 4RO0A 2HBRB 1Q95G 3JYTA 1HI8A 3E51A 5K14B 5ETSA 3L3CA 3HSJA 3EPIA 1EARA 1KDNA 2ZHAA 2R7TA 1OQ6A 3FBBA 2VV5A 4HH0A 2W1BA 2HFOA 2O01C 4K2XA 1RCOB 1YJWS 1DTTA 2DGTA 4WKRA 1NPKA 2FJEB 1M5VC 2B4PA 4X4NA 2YNGB 1YWXA 2OTJS 2ZOMA 4YR2A 2CNOB 2FHJD 3TOQA 3IRWP 1RHQB 2NZCA 3PO5A 1U0HA 5T14A 2QZ8A 1F5BA 1Q0NA 2V0NA 3OXLA 2YQ0A 1OS5A 4P72A 2HURA 4KFBB 1UVMA 2CNNB 3DGPB 3LH2S 3QQCD 2CPJA 4P74A 3IGVA 3BDPA 3DXBA 4BWJA 3BGRB 4M5LA 3CCLS 1IJEB 2RRAA 2XM3A 4DV0F 1RWXB 2XB2D 1T11A 4JB8B 3UN5A 5B0CA 1RYSA 1FJ7A 4P2SA 4H54A 5D3GA 2COLA 1LOUA 4CLKA 2UVVA 3KLGA 3UDEA 3TJ8A 4Q45A 2KXHA 2DTJA 2D74B 3TYTA 5J1EB 3RRHA 1FHTA 1AXQA 1O5JA 4WIQA 1F1BB 2VFRA 2VU5A 2NUUG 3CJ8A 4M5GA 4DWIA 1N52B 1PIEA 4QWDA 4A8KA 3HHLB 2MQLA 3T5JA 3EGNA 3MEKA 3R2CJ 1VLYA 4O44B 1N6QA 2HBYB 2ROGA 2V9KA 1IKWB 2BJEA 3D6MB 2YWEA 2W01A 1S4FA 3GFXA 2QLXA 4IG0A 2QC3A 3KJNB 2XMUA 3ZTSA 4UOGA 3DNCA 1PO6A 4ILLA 1RAEB 1N88A 1RDRA 3DXSX 3NRBA 1NH8A 1HYSB 2Y8YA 2JRSA 3MM9A 3K17A 4DR1F 3FSYA 2LFVA 5DO2A 3CDEA 1S49A 2JFDA 3H42A 1HNWF 5KFMA 2AHOB 5HJXA 3AQPA 4P7VA 3VGSA 3C6TA 1LEOA 3N6NA 2C3PA 4HACA 4ZPAA 2BDPA 3WDOA 2PEBA 3BPSP 3CCRS 1JJ2R 2QL7B 4NL5A 2K1RA 1B99A 2IJFA 4U95A 3MEDA 5DG8A 1MROA 1YJ9S 2RUSA 1YIJS 3NS5A 5E5NA 4DZ6A 4ZJLA 4ED1A 3CCMS 4AL6A 1WI6A 1Y0HA 4MT1A 2UXBJ 1HARA 2CNKB 1R0CB 2R7QA 3M8PA 3C8YA 2QG9B 3B82A 1KN6A 4XIUA 2C42A 2H1YA 1W2BR 4C0HA 4LR8A 2J76E 1P6TA 3TANA 4DHVA 3UR0A 4WFZA 2HBQB 1CULA 3BSOA 1JQGA 3W2WA 2FPHX 1EQMA 2DNZA 1S6OA 1EJ7L 5EGYA 4OZJA 4Q7AA 1PKUA 2V2ZA 4Q2MA 3HI9A 2R8HA 1J27A 1I5OB 3CJSA 2E7WA 2W9BA 1RTZA 4R25A 1ZTWA 3MMBA 2BR0A 1A6LA 1WG4A 4ELTA 2XSJB 1LWFA 2JNJA 4Y28C 2XLIA 2DR5A 2XY5A 5CD4H 3GLJA 3EGWB 1YZ7A 3PVXA 4TYBA 2VB6A 3AAWB 5GADU 1UPPA 1BUXA 4KSEB 5H9FK 5CQGA 3G6ES 1NDCA 1FX2A 2DH7A 1ZA1B 2CPDA 1B70B 4USHA 3PDNA 4C4WA 2XQCA 5DETA 3VAGA 4ZLPA 1DTQB 4U8YA 2I0XA 3FZ2A 3QIDA 1Q4RA 2DO4A 3X1LB 5KFZA 1RTJA 2KKHA 4WP9A 2RS2A 1F5AA 5JMNA 2ZBQA 2W4DA 4FVMA 3T1AA 3R7NB 2YKNB 1MWZA 1GMWA 1D9AA 2EPIA 4ZCLA 2MKSA 1G6BA 3BM7A 1NDKA 4MH8A 5CH7B 1FDDA 1TKDA 3DRSA 2CQ1A 1FO1A 2UXCJ 3AXKA 3F0NA 1SV5A 3SCLE 1Q7YT 1S6UA 2QMXA 2LEAA 2V2VA 2Y1JA 2ZD1A 1HA1A 3HSDA 3W2VA 3NNCA 1AROP 4IOAQ 1NK5A 3ISND 3CCQS 3WX4A 2QFJA 3PKMA 2RKIB 2E5IA 2OLWA 4L3KA 1K47A 2BANA 1F2GA 4DV5J 2J5AA 1UEVA 4ELUA 2GIFA 3NBPB 1DAXA 1G2EA 5IFMA 4WFYA 4WXWA 3TUIC 2Y9HA 1JLCA 3UDLA 2GMHA 5B0AA 1OYEA 3GIJA 1VRUB 3M7VA 3CIZA 2DPIA 4EWTA 2PMWA 1RT2A 2HS3A 3T19A 3QT7A 3ZZUA 2KG1A 3AQOA 2G9OA 1YGYA 2DGSA 2I5JB 4G1PA 3DLGA 2CDRB 3IP0A 4ZVHA 2DJWA 3CD6S 2OELA 4I56A 3D6TB 3VZIA 1S1TB 2RHSB 2VC1A 3D0IE 2C2RA 5FLXU 1RHRB 1IVZA 5DQIA 1RTHB 1EP4A 3LPEA 2NUHA 3BGOP 5CYQB 2K8GA 1NKEA 3SIPB 1U09A 1S1XB 4CT9A 4IO1A 1JLBB 3BBFA 1S72S 4X4SA 4CI0B 1RLDA 4ES3A 2HQDA 4O0IA 3HX9A 1JJHA 4NA2A 4KPYA 4B17A 3GZ7A 4IR9A 3QLHA 4DV2J 2DIVA 4J9QA 4PG5A 3ICLA 1X4AA 1FX4A 1U26A 3G8TA 1V6HA 2YKPA 3PV8A 2OIHA 2Z2MA 2HHXA 2KFNA 1SQEA 2V67A 3FC9A 4WXOA 3ZTQA 4K0KJ 1RTDA 3N28A 1CLFA 2R4FA 2KDOA 2CJXB 2IDLA 2BABA 3ELHA 2CA9A 2XI2A 2B8QA 3OTOJ 2CYYA 4C98A 1YVFA 2DGQA 1F5CA 3D9BA 1P8GA 2WAQD 3THVA 4ECTA 3J81U 2HMIA 2NYHA 4YHHF 3JAMU 4KHMA 4GVLA 2RU9A 3SSSA 4NLRA 4DFPA 4L3NA 1VBXA 1NZAA 2RQKA 4X4PA 1N32J 3PJ9A 3WIUA 5KFRA 4YFUA 3DN9A 1VRTB 4NXNF 2VL1A 5GMEA 4HI1A 1I6JA 1JLEA 4GVBB 2ZE2A 2LA6A 4CLSA 3M2RB 1YJRA 1RADB 1XK8A 3SCKE 4C11A 4CLYA 2FZGB 4YB6A 3M8WA 4B3OB 3V6JA 3H5SA 5J2MA 4OI6A 4OYZA 3SQGA 2QMUB 4A8SA 3BEGB 1T94A 3OL9A 4J9RA 3SV4A 2RS8A 2N7YA 1BWVA 4ANDA 3BGLA 5CHCB 3MFIA 4JI4F 1ZM3A 2J0WA 3A3PB 4NI2A 2CVEA 3ULHA 3ZZTA 3PW2A 4DQRA 1V3SA 1FRLA 4MK8A 1F3VA 4HL9A 3KHGA 5L8RC 1FF2A 3G86A 4YB7A 2BUNA 4I2QB 2JH3A 3D0GE 3PR5B 3MCNA 4AUKA 4A48A 1REGX 3FCWA 3Q8QB 4WU2A 5I3UB 2QLFB 2BE2A 2CG8A 4YUDA 1TMJA 4ZPBA 2J9EA 4JI3F 4NXMF 3GV5B 2IIHA 3TVYA 2NR0A 2X51A 1UVKA 3FFIB 1JLAB 4DX7A 2AZ1A 1HNXJ 1WDDA 4FBTA 3EVWA 2UP1A 1J5EJ 1FKOB 4O4GB 3CIMA 1FWKA 1VLOA 3TA1A 2MLXA 1O0PA 1RBOB 5D4LA 1AFJA 3PY8A 3FK4A 3HLUA 2ROEA 4ECWA 2AJFE 2MQPA 3KDNA 1KVJA 3TQ1A 3K7RA 2ZNZA 2KHDA 1SIZA 1PAUB 2IHR1 5I42A 4DS4A 3OQ2A 1XMQF 3IRXA 2GJ2A 3MDFA 4GC7A 1SH0A 2IAJA 3AJDA 2AD9A 2A10A 3V2UC 5F8GA 1VC5A 1GT8A 2WVBA 3D3BJ 3C14B 1EIYB 4X64F 3MR2A 3CNQP 2BQRA 3H4BA 2XCPA 3A12A 2HWHA 2K3KA 1S76D 4UOHA 4PQAA 3BQ1A 2OPQB 3NGTA 2H54B 1VI7A 1U48A 4ES2A 4JV5J 1VBYA 3UN3A 4LF5F 5L1JA 4Q8EA 1SUQA 3KK2A 4LSLA 4ZPDA 2CQ4A 4JI7F 1NLKL 2DR8A 4QIEA 5HBMB 1RT3B 2QLBB 3C15A 2FYXA 4WTYA 3M2UA 4YOEA 2O67A 2LXFA 3IC1A 5M2RA 5HLFB 1U25A 2CDQA 4QOTA 1SJQA 4RUCA 1VBZA 3FMBA 2GJIA 3LW5C 2FLPA 4H4OB 4Y3CA 2U2FA 2JHEA 2JOQA 2VIHA 2D3ZA 2F65A 3LGMA 4O23A 2QL9B 1FDBA 2G2ZA 2UUWA 5KFSA 1DRZA 4F4KA 3W62A 2PIIA 1QUVA 3OSNA 1EKRA 3E2EA 3W66A 5KT3A 2LVWA 2MQ8A 3EPGA 1S6QA 3NG8A 2VQEF 1JKHB 1PYSB 3LWLA 4J9OA 2EKNA 4HVZA 4RNHA 4G1QB 4CLLA 4QR1A 4WZMA 3G6VA 1SIWB 1C1CB 3C19A 5KFCA 2EXUA 4EMDA 1HBMB 5HROA 2AW0A 3N6MA 2NZ4A 1GTHA 1VQ8S 2XMTA 5F8NA 2HFVA 2IBOA 4ICLB 3NS7B 4UZBA 5LM7E 3EXYA 2BJ9A 1N5QA 2GVZA 4TY9A 2R7OA 2JEIA 2XI3A 1U6FA 4DR3J 5DQGA 3R5GA 3KHLA 2LQ8A 4KJIA 1UPMB 1S1VB 2B51A 2QTWA 4Y0FA 3PR4A 1CPZA 4L76A 3CJTA 4C2MA 1D9FA 4LQ9A 3HXMA 1H0HB 2ABYA 3CJKA 3IS9B 4YR3A 3OPKA 2QV6A 2EVZA 1FKPB 2J0SD 2OHDA 3D3CJ 1I51B 1K1QA 4W98A 1WORA 3QIPA 2HYIB 1KQSR 1S6PB 3TVKA 2XG8A 3K89A 1SBRA 1BLUA 3TEGA 3TNVA 2DK2A 4F26A 4I68A 2HQ3A 2HWIA 1T9XA 2K3IA 3POTA 4CCHA 2C3OA 3TAQA 2QMWA 5AJ3F 1ZM2A 4C0OC 1M1KT 4DQSA 2JEJA 5A0YB 4FKXA 1QVGR 3QO9A 4RWWA 3N5BA 1YSJA 1RKJA 4PKDB 5HI7A 4YB1P 4NYZA 5CAAA 3FNNA 4NLVA 4XTTA 1FRXA 1OPZA 2MZTA 4DV6J 3CO0P 1WEYA 1EZZB 4YMEA 3PRVA 2VG6A 1N56A 2MSSA 4DV4F 1PG5B 5EUHA 4DFKA 4ZHRA 2CZVC 1BQMB 1H74A 2OFGX 2HHHF 3BBCA 4LF6F 3BO2A 2HGLA 3GE9A 2H48B 4WU3A 3TAMB 3EXCX 1W26A 3EICA 1YX2A 4ZKAA 1HQUA 2ZEJA 1SH2A 3EVMA 4LUBA 3I9V9 1CBKA 1RT7A 4UTGA 1OO0B 2J9DA 4CLFA 2CKWA 2I1RA 2F5GA 2FD2A 3H8YA 4DSLA 1TVRA 2DPJA 2DXFA 2DNGA 2GQ2A 1XNRF 4HHJA 2ZKTA 2UXDJ 3MM8B 1DZ5A 3MWBA 1TKZA 2VH7A 3TWZA 1JNRB 1AW0A 5E7OB 3SSRA 2Q66A 2XLJA 3CJ0A 3TVZA 5KFNA 2E7VA 2DGXA 1CJVB 1XQIA 5E3RA 4W90B 2E1AA 1PGZA 4JOUA 5EWGA 3WBZA 2EEYA 2HNZA 2ZH6A 4Y2KA 1N34J 3IG1B 1OWXA 4BC9A 1VQ9S 2ZBIA 3VGUA 4ZN1A 3KWMA 4MFBA 2A6MA 3AD8C 3TW0A 4FXDA 4TYAA 1SJ1A 2BW2A 2GGPA 3OLAA 4DR4F 1U49A 4DX8H 3M8SA 2AGQA 1WSRA 4DJBA 3AOCA 4DR5F 4RU9A 1JLFA 2OSRA 4PUOA 1TKTB 3N6LA 2GMLA 3M6UA 3OXGA 4RW9B 1C0TA 1C2PA 2AEMA 1VBKA 4ED3A 1HI1A 4USMA 4C3LA 3Q2SC 1BWEA 1EX8A 3BBBA 1UEKA 4Q8FA 5FLXY 3OJUA 1D1UA 1XEZA 3MTKA 4URSA 1F2HA 4HT7A 1RU2A 1GMWD 2CJYB 5A8RA 1WOSA 1S7IA 4Y6IA 1MMNA 2XULA 1IKYA 4ED7A 4OYAA 4DPYA 3A4TA 4DSEA 1IKVA 4ZVTB 5IZHA 1F3FA 3HHLC 2WB1D 4WZQA 4B3MJ 4RR5A 1GXTA 1DTTB 4CH1A 2CNLB 2XMJA 1QSSA 4NA1A 1S1WB 4J9PA 4O3NA 1TFYA 1XIQA 1HLWA 1KONA 3OD2A 1S57A 4DXLA 2LDIA 1TL1A 1RWNB 3GG1A 1U0HB 5HVGA 2C2KB 5KFAA 2R2RA 2B9WA 3C2PA 2WVDA 2HHWA 4OX6A 2VICA 3IBWA 2EKYA 1XNQF 2JJ4D 1UMJA 4PPDA 3J81Y 1UJ5A 2FC8A 4DL0C 5DQHA 2BKOA 4C8MA 3JAMY 1EAYC 3R5DA 4ED4A 1U1QA 4NCGA 4YY3F 1YJNS 3HHDA 3SFGA 3IA0A 4LF7J 1ZA2B 1F0XA 2FY8A 3J7YU 1ZM9A 5SUHA 1M5SA 4QYZJ 1PJ5A 5D4NA 3QRPA 3T5LA 3OV7A 3RAXA 4RUAA 1TK0A 5HMYA 4NZ0A 3PEHA 4WFXA 4QIGA 3NMRA 4RNMA 1KHVA 2RIJA 2NREA 4JI1F 3WX8A 2DHGA 4PRFA 4DS5A 1FA0A 4ECSA 4DL7A 1G7CB 1ZPWX 1I94J 2BQUA 1WEXA 2KT2A 1IN0A 4A8FA 3R9LA 4WP8A 1C4AA 3BYRA 2ZBRA 3GSDA 2P6TA 2W7OA 2UVWA 1UJ4A 1HHQA 1FJGJ 3M05A 2DH8A 1VISA 4IG0B 1GXLA 4ETZA 2B43A 3P49B 1DBDA 3EGVA 1G1XA 3QYYA 1AYEA 2HLTA 4UZCA 5C25A 2PA8D 5F41A 1CJUA 1DFDA 3QGPA 2XYHB 4OV1A 3OW2R 1QAXA 1RISA 3MM9B 3KMSA 4DCPB 3MR3A 3OR1A 3LF0A 4NMLA 2MHEA 2ROPA 3HT0A 4A8XA 2EFNA 4HTJA 1TL7A 3HULA 4C8NA 4XK8C 3ZO7A 3C6TB 3H40A 2JFKA 2DXDA 3MCSA 4HACB 4U8VA 5K20B 5U47A 4CIOA 1XR7A 4CP5A 1D8YA 1NK7A 1RGVA 3NKYA 4B9MA 3CDBA 4ZCMA 1VIXA 2K1RB 1H72C 1N0UA 3ZXWA 3MEDB 4DUYF 3MR5A 3NL0A 5F0UA 3I87A 2XY6A 1MROB 2VPZB 2N7CA 1Q8IA 1WI8A 1S0OA 5J2NB 2VFTA 2YKMB 3K2YA 2CQ0A 3L7UA 1T3OA 1S4EA 5FD1A 2HRYA 2YNFA 3BS9A 3MECA 3WIVA 2WHOA 3N79A 3R27A 3QAEA 5B7WA 2YWWA 2M8DB 1WF0A 2VOOA 1T9UA 1RACB 4C0BA 4DUYJ 1IBLJ 4MKYA 3MAAB 2JEGA 4OHXA 3LWMA 4ZDNA 3GYGA 5HO4A 1HWIA 5AE1A 2W9BB 2JVOA 1CEZA 3HM9A 4Q43A 4NEYA 1R31A 5HK4A 3MMBB 4LFCF 1O51A 2F40A 4NLUA 3Q8SB 2ZJPQ 3VHQA 2M52A 1NPRA 1GK8A 1LXJA 3QAUA 2ACYA 2V68A 2V50A 4BHQA 1AB8A 1T7PA 1L3UA 1X4EA 1AFIA 4YDXA 4URGA 1KQGB 2OP5A 2ZJQQ 2E1CA 3PZPA 4DSKA 3G87A 3IWLA 2R2UA 3DM2A 3M9NB 2M88A 4LF8J 4OZ2A 2MZJA 1B7YB 3DCAA 4KHPJ 2R7XA 1RTJB 3I55S 3SSQA 2CZ4A 2J7WA 4OLOA 3PM9A 1UKUA 1T0TV 2ZVSA 2B56A 5SZTA 1LWXA 2N4CA 3GJTB 4F4ZA 3PEJA 2AJ2A 3J7A1 3B6BA 1V5IB 1Q5YA 1PJ7A 2GQQA 4RKUC 2KJWA 4IQMA 2UUAF 4FNIA 5EX0A 4B9NA 6FD1A 5A6WA 3JQJA 2FJAB 1RHKB 1SV5B 4OI2A 4H4KC 3S6EA 4I1TA 3MGJA 2V4JA 4ES1A 3LGNA 4Q0BA 1XERA 4HYKA 3GR1A 4ANEA 2LQBA 3W2VB 1NHUA 1RWMB 3T1HJ 1X5SA 4PYDA 1QAYA 4KKOA 4K50A 4F36A 2G0IA 2WSFC 1RWVB 2P9CA 4CO5A 3CCJS 4FPRA 1KP6A 2BANB 4KGXB 2QA2A 4EGLA 4IRKA 9RUBA 1TL4A 3GMGA 3MAHA 1QUPA 2MLYA 1KLMB 3PIPQ 2RKIA 4XO0A 4ZCKA 4OI4A 4WPAA 3CDUA 2O66A 1ROFA 1NXIA 1LQ9A 4OV6A 3V4IB 3C46A 2A18A 4M5IA 1RT2B 3F41A 4PPZA 3MPWA 4DR2J 2LMIA 4LIWA 3GFYA 2VZ9A 4O0NA 4LQ3A 3P3DA 3VZHA 1JIHA 1PBUA 1HR0J 1VRUA 5KFLA 3R8YA 3QGIA 3HKZD 2GHPA 1DHMA 1A7GE 3KNGA 2I5JA 1XMOJ 2CJQA 4AE5A 4A46A 1Y11A 4X2BA 3G6YA 2HZCA 1L3VA 3W3SA 4NPOA 2WSCC 3JTOA 3SDEA 3O1LA 3SQOP 2MEWA 1JLBA 4F0KA 2BRKA 1IQTA 4DCOB 1KNZA 3MZIA 1F9FA 1BQXA 5J2PB 3DDNA 1RTDB 4H4KA 4RWXA 4WWSA 1O6XA 2ERRA 3DU6A 1F9EB 4HH1A 4C8OA 3S7RA 2F4VJ 5ETRA 4ER8A 3T5KA 4KGZB 3L4BC 1M1HA 3R2DJ 3R97A 3D1OA 5KFQA 2KJVA 2HMIB 2HZAA 4ZPCA 3AHPA 1QD1A 9ATCB 4CQ1A 4F2RA 2I38A 4XAKA 2C3YA 1S59A 4B3SJ 5KT4A 3DYAA 5E3PA 2UUTA 3G8QA 3SCIE 8AT1B 3OFHA 1HNZF 3PYGA 3OLBA 1JWWA 2MY8A 5C24A 4IRCA 4ETXA 4JV1A 3MM6B 1DQ8A 4ED5A 1JB0C 2LDYA 1JLEB 2MKCA 3VAFA 4DL4A 1SC1B 2ZE2B 5GAGI 3LQVA 1JXVA 4WP3A 4LRFA 4EO8A 5IS2A 4C11B 1ZZFA 1K0TA 1TL5A 1UFKA 3CTRA 2QN6B 2PEHA 3CJRA 5BYRA 5J2MB 2EWHA 1T9YA 3SQGB 2DRAA 1TELA 1QVFR 2V4RA 2H65B 3M2RA 1GAOA 4DX6A 3OL7A 3M6WA 4F67A 1UFWA 5FIIA 4KY3A 3AB4B 3QRQA 1FD2A 2E5GA 4IH7A 3LA0A 1JLGA 2ZHOA 2OEJA 4LVNP 1VJQA 2I2YA 2Y1LB 1T95A 1FTRA 4YR0A 1FNOA 1U1MA 3H5UA 1LW2A 5CABA 4QU7A 2ZKUA 1F60B 4LF4J 3LTOA 2BZ2A 4QU6A 1QDUB 3P45B 2BE2B 3ISNC 3G82A 2GFFA 2UU9J 3AOBA 3BGUA 2RE1A 3RB0A 5JJBA 3MTJA 3N0VA 2E5LJ 1J5OB 1NB2A 3UN2A 4YN3B 3EGZA 2AV5A 2DEJA 3KJVA 1NKCA 4DQPA 1FWPA 3MURP 1PILA 5F8IA 4OJGA 3PG9A 3GG0A 4N8NA 1NZ8A 4X66J 4LSZB 4KTQA 1VQ6S 1UWBA 2V8VA 4I0WA 3VR1A 2J8AA 3H2LA 3HFZB 4DBQA 2AZ3A 3CC2S 3CJ3A 3DHXA 3ILJA 1RWUA 3EZ5A 1X4DA 2XCAA 3MR6A 4ZLJA 5I42B 3B4DA 3IRXB 2DGUA 5KG4A 2ZDOA 2VJUA 4USTA 2FC9A 1RUSA 4EBCA 1WG1A 2NXCA 4QPXA 3CMAS 2OEMA 3HMJG 2BE9B 1D0EA 2B7BB 4J37A 3GV7B 4AXIA 3EX7B 3LP2B 2XYPB 2CQGA 3NGUA 1KFDA 3QJJA 3HVAA 3G71S 4GO5X 1NSKL 2X1AA 3A8KA 3K5PA 2KFYA 3FCHA 4UT4A 1VQLS 1NAQA 4AQYF 1UZDA 1SUQB 3KK2B 4LSLB 3EDRB 2KYXA 4C8LA 5GMDA 3MPDA 4FF3A 3C15B 2OPQA 4EBDA 1IR2A 4ZLLA 2GS8A 2ZJRQ 4K4XA 4JI6J 3WC2A 4EYIB 3AB2B 2IA0A 3CT9A 3PRBA 3BSNA 1YHQS 3ENAA 2B9YA 1RT3A 5HBMA 4W4MA 2YPZA 3D4JA 3EE3A 2VQFJ 3E3XA 4TQSA 2A1BA 1N54B 3GILA 2FVPA 1LFPA 3CJ5A 2DHSA 1XN9A 3BH7B 3KHRA 2DNLA 4EZ9A 2UUCF 5GAHI 4V19X 2ZWOA 2W25A 2QA1A 1JXLA 4TU9A 1MWQA 1NDLA 2YKOA 4IFYB 3KHHA 1S7HA 2Y0BB 2NXUA 4JV2A 4LF2A 5GAEI 5L9XA 1R8HA 4J5OA 2MKKA 2A2CA 3KLIB 3LGHA 1Q81T 4DR7J 2IM1A 2RNEA 3H25A 3EVOA 2BM0A 1WWHA 3O3LA 2D1CA 4LJMA 5HMWA 1SKWA 2G0JA 5DGBA 2XC9A 1HD1A 4HEA9 2IM2A 2C2OB 2B4UA 3QZ7A 4HDGA 4LF9J 2X1FA 3WHIA 2AEJA 2J7UA 3MD3A 1VQKS 1X5TA 4G6VB 1FVQA 4JI2J 4LRAA 2OUGA 2RD5C 5LXRA 5C7PA 4DV7J 5HATA 1KLNA 2QGFB 1KQKA 4F3OA 4G3IA 2AYEA 2C2ZB 2MQNA 5KT6A 3M8RA 2W9CA 2HK2A 3TA2A 7FD1A 1VK8A 4CM0A 1RSCA 2FHKA 1X9SA 2V6AA 3TJAA 4ICLA 3I4HX 4OL8A 2D9PA 1VQMS 3PKYA 3HHKA 3TZXA 1H2VZ 3CJKB 1S97A 1BXNA 1NSPA 1JK9B 4LVOP 2GAHC 3J7Z5 2J7KA 4NE9C 4FYVB 2MMYA 2EG2A 1S79A 4GKKJ 3QIPB 2DB1A 1LWCA 4EK2A 1RT4B 2HVEA 4DF4A 1RB0A 4OX9F 2DEIA 2B8PA 3W1YC 2P2CB 4JBCA 2JDJA 2BJ3A 3QPIA 4KGVB 2XMVA 3AODA 3IAM9 4YP3A 3POTB 4HLBA 4WF9Q 4ECVA 2MGZB 1FRJA 1S6PA 3GYNA 2RSQA 3HVTA 3GP9A 4DQIA 3K58A 3FEYB 5I3QA 1EQ0A 1ZM4A 2IPOB 2F9DA 2E29A 3HHLD 1IBMF 1FXLA 3H7HB 2KB2A 3A13A 5THWA 3QO9B 3VALA 3W5XA 5IV3A 4CNYA 2BJ8A 3D5MA 3D68A 3I4PA 3HK2A 1TAQA 1XC9A 2R7WA 2R3VA 6AT1B 1TL3B 3OT9A 4TN2A 1V5VA 4OJHA 1T3NA 1RJJA 4DN0A 4JP8A 1WC3A 3M1VA 2VFSA 4YS2A 3CD0A 1U8WA 1S5ZA 1Z2LA 5D0GA 2L9WA 2M70A 3G2XA 2LEBA 4ZHRB 5KFDA 2C3UA 4JI0J 1H3DA 2X3DA 5G0RA 3I5CA 2R7UA 1VJWA 1CS4B 4AL5A 4ZPVR 1NM2A 1ZAVA 2HZVA 2HIQA 1CC8A 2JWNA 3UQSA 1RT7B 1MU2A 5LMUF 4G1IA 4F25A 1UEUA 5D4OA 3TAMA 1TVRB 2AMCB 5DM7Q 2Z2YB 2XTJP 4GMKA 4G65A 2CPZA 5ETOA 5D15A 1N36F 2YX1A 5BR8F 1TKZB 1WF1A 4B3RF 4I67A 2ASLA 2E44A 2G4BA 3QSIA 5DJBA 5K8NA 2W7AA 2ZVIA 3GU0A 1S9EA 3SBMA 2WW4A 1U4BA 1OMSA 4PZVA 1F6TA 1WHWA 3T9ZA 2D3OR 1CVJA 1KC8T 3OHAA 4URQU 1FE0A 4FP9A 4ENOA 3KG1A 1K1SA 2HNZB 4CZCA 4FF1A 1W7WA 1JXEA 2RAQA 4NLGA 2HRTA 3BB5A 4JI8F 5KFVA 2ATCB 1KTVA 2HQGA 4JV0A 1NCLA 1R6VA 4MFBB 3I5BA 4QWAA 4LBHA 2AJ1A 2GGPB 1NUEA 3IG1A 4CLUA 2IY5B 1WSVA 2L41A 3FMWA 3TQEA 3TR5A 5DS7A 1FJCA 1JLFB 4A8OA 3I96A 4PUOB 3AT1B 3BKUA 1RZMA 3RTVA 2F4FA 4DV1J 3M9OB 1C0TB 2LU1A 3EZOA 2BA9A 1U2FA 2W2QP 4JYAF 4DCJB 5ETPA 3PACA 2UUBF 4QBUA 4FDFA 5IWAF 5GMKa 2AJ4A 4ED6A 4DOZA 4F3QA 4W92B 2DNNA 3VAKA 3IMQJ 4RW9A 3VVTA 2K2PA 1X4GA 4GRSA 3HPOA 2IM0A 2M0GB 3I9ZA 1ITPA 4QJVA 4IUFA 1M1GA 2GIQA 5HN0A 4RBTA 3A3NB 2FJDB 1IKYB 5C2CA 3GSIA 4X65J 4PG7A 2QIFA 1IKVB 1YZ6A 3O2IA 1WKLA 4RW4A 1PAEX 2LP4A 3BH6B 1PCAA 2VD3A 2OMOA 1HPZA 5AXKA 2MZSA 1PC4A 4U7UD 3T9NA 3IR7B 5L1KA 4YQWA 5L39A 3H98A 1HL6A 2H5EA 4FF2A 1TL1B 3HP6A 2CPHA 1S1WA 3OTCA 4ZVEA 2VBWA 1YQHA 3MM5A 2G1HA 2HHTA 2B9EA 3KLVA 2XMAA 4NCGB 4IOCQ 4EYHB 2GV1A 5HL7Q 3W64A 2P6SA 2QYCA 4DLGA 1UA1A 2J0XA 3ADAC 3H2VE 3TEHB 2HEKA 4FNHA 3Q8PB 1NO8A 3W7BA 3IBFB 1UCNA 2EI5A 2RDDA 2XMWA 1P9YA 3GIMA 5B08A 1H98A 3Q23A 2HFZA 2ZOFA 4KYZA 1IQZA 2AP6A 4ECYA 3P8BB 5GADI 1X8DA 2C2EA 3EMTA 1G3OA 2VDHA 3PYEA 4Q2LA 4ITSA 4PQUB 3P5TL 3UVJA 4RNNA 3MHYA 1HMVB 3N5FA 3SEOA 4K4YA 1HWUA 1VK3A 3FSXA 5E33A 4QIVA 3UI3A 1RT1B 1FK9A 2YX7A 2WW8A 3H59A 3CCZA 4K4SA 3DOKB 1H2TZ 4ID5B 4K4ZA 4LR7A 4OYXA 3FCVA 3U1LA 1D9DA 3SI8A 4USIA 4C97A 4LREA 1KTQA 1R27B 1Y3KA 3C66A 2Q6BA 4NLWA 3VVUA 2E5HA 4K59A 1HW8A 4U9RA 2NYIA 2R7SA 1IBKJ 1U47A 5C25B 1Y5LB 1CJUB 4CLZA 5DGAA 4WJBA 2H4YB 1QAIA 1CQMA 3OR1B 4NMXA 2DHXA 1TL7B 3OVBA 1K8AT 2EFVA 3R5CA 1N33F 3THPA 5KG0A 4DUZF 3BV8A 3W5ZA 1PBAA 2PE8A 2R2TA 4M5DA 3CE8A 5KG2A 2UXBF 2YNIA 3UR3C 1VQSA 1C0UB 3TP2A 3NGDA 4UOFA 3Q22A 2HKEA 1NEEA 4X4OA 3LP0B 3HF5A 3MXHP 2CPYA 5IV4A 2C2MB 2XY7A 4B9VA 5DG9A 1F9HA 2RUGA 4FS1A 1KKHA 5KG5A 3ETOA 5LMNJ 1N33J 2PT0A 2YNFB 4DUZJ 3MECB 4LIRA 2KG0A 3JQMA 4LBPA 1SCJB 4TY8A 5DZ6A 2B7CB 4KE5A 4ZPWR 5DDQC 4DF8A 2W8LA 4NLOA 5J2NA 2YKMA 3CWJA 1VRQC 2JLGA 3FVYA 4PABA 1ULRA 3CCES 1SJFA 2BMBA 4USVA 1MG7A 3K5LA 5H9FJ 1EKSA 1YRXA 4BDPA 4LFBJ 2PDAA 4AD6A 3GONA 2V8GA 2FGCA 4MK9A 2XWXA 3TRGA 3MAAA 3SCJE 5LJ5Y 1VDHA 3DLEB 2R8IA 3UWTA 5EDWA 1NK0A 4PAAA 3FEZA 4DSFA 3JXOA 4M5NA 4I2PA 1WKKA 1GTEA 1T05A 1JJCB 1I3OB 5K8MA 2N4DA 3M8ZA 5E41A 4FXWA 3DM2B 3L7OA 1B7FA 1TUWA 3ZTOA 2YH1A 1IWGA 1HIYA 4X62J 3J7ZT 3H4DA 1U1OA 3EWGA 4KV8B 2DY1A 4AFFA 3US5A 5J1NA 2ZC3A 2V2QA 5IM0B 2JSXA 4OLPA 2UXCF 3KK3A 2LXIA 2Q3PA 1U2CA 1Y00A 3PX0A 2E1PA 1GFWB 3M4XA 1HNVA 1P27B 3J81j 2F8HA 1QM9A 2U1AA 5HQ8A 5CA5A 2AKWB 2PI4A 2H5JB 2YXLA 4FPIA 2MYFA 1HHSA 1PJ6A 3T1YJ 3HFVA 5E0OA 2V4JB 4Q0BB 1DLOB 2FUG9 4MYTA 3RU0A 4YEAA 1HBOA 3B78A 1P9QC 4GKJJ 2RT3A 2P8IA 4ZPTR 3KJFB 4DV5F 2GCFA 3PYFA 4KKOB 3FUYA 5IQQA 4N77A 3QMQA 1GNKA 2FJXA 1YJTA 2ZFHA 4PR6A 2GAGC 4P2FA 2VFVA 3KLHB 1Y7PA 1Q1KA 1U02A 1Q78A 1FVSA 1S99A 2CWKA 3RRGA 4K2JA 2W24A 4DPOA 3GJRB 2CQDA 2OI2A 4ALZA 2HHQA 2OAUA 4WCEQ 5DDPC 5KFFA 4IDKB 4OHVA 2WVCA 1SI9A 3MUMP 1KLMA 3IBCB 4U96A 4U7CA 3C16A 3QSYB 1FXRA 4MAKA 2L9NA 3F44A 3V4IA 4N76A 2AWZA 2R7VA 4DV2F 2DHHA 2CJKA 2LKZA 4DPTA 2DR9A 2IFXA 1QSYA 4QIWD 1U0SA 4A47A 2CQBA 3P96A 3SMZA 4LF1A 3GQCA 2OPRA 3VTIA 4N56A 1UW9A 1N48A 3SDEB 4K0KF 1YTYA 2L9DA 3I0SA 3OTOF 2L08A 2XYGB 1DARA 4NEZA 4C8YA 3RBXA 3O5TB 2MKHA 1QE1B 4PXEA 2V8PA 3VAJA 2V2KA 1FXDA 2R9LA 3PW0A 3MF5A 3CW2C 3HZGA 1Q53A 1NU4A 3M8YA 2JEFA 1G4CA 5J2PA 4CTAA 1L3SA 2X3GA 1N32F 4ATNA 5D77A 4KAIA 3CJ4A 1O8BA 2E1RA 5IT9Y 1M5PC 2FJWA 2C2DA 3VGTA 5L9NA 3KDOA 3M30A 2RRBA 2ACMA 2XO7A 1YK9A 3O6QA 2KZMA 3CC4S 3DYAB 1ZH5A 4NLSA 1KHWA 2QSFA 1WF2A 4KH1B 5C24B 1BE4A 1PYOB 5K9FA 2MPUA 1U1NA 3C3LA 3OFEA 2Y1RI 2I6WA 4ZIWA 1WG5A 1UVNA 2AGPA 1HFEL 3MFHA 4EBEA 4N41A 3U27A 1NHKL 4WK1A 3MM6A 2KU7A 5DZ7A 3HO1A 1NRKA 4F4YA 3GB0A 5A2QU 4FYXB 3QZ8A 3OFGA 1V3ZA 2G2YA 1VQ4S 1BC6A 4KGMA 1SL0A 3SZ2A 1I1GA 3W8PA 1JLGB 2OSQA 4RLEA 1UVLA 4WKYA 4PEOA 3KJQB 1RYRA 4FVCA 1R8BA 2D3UA 2B6AB 3DI6A 1CJTB 1LW2B 4WTOB 4L72B 5AXLA 3QATA 4USWA 3BO3A 3DLBA 1HBUA 2XMKA 2K7JA 3G82B 4OQJA 2Z0GA 2OD6A 3HFKA 1HNXF 2RQ4A 1J5EF 1T03A 2UV8G 1FT8A 2FZCB 3VCDA 4U7UK 5KFBA 3KJVB 2KO1A 2FLOA 4IFVA 1AZSA 3RUBL 2KM8B 3DLKA 2IRYA 2X1GA 3RBEA 1IKXA 2GJFA 3RBZA 5LOQA 4Q44A 4C6AA 2LA4A 1J5OA 2GMJA 2DGOA 1K0VA 1UWBB 2BACA 4KO0B 2AT1B 2W9AA 3PW5A 4A8WA 5E3QA 3EYZA 5G4DA 1RQ0A 4DEZA 2W4CA 4CDIA 2F3JA 3ZC4A 3T6BA 4E8UA 3NMAA 4UY8T 2JZ5A 4NYPA 2AX1A 1E6VB 2A2DA 2BOPA 1REVA 4CO0A 3R7BB 3MPUB 1A0OB 4DSJA 2MY7A 4A8MP 5LSRA 2H9ZA 2LQ5A 3M8QB 1QLNA 2LECA 3KLEA 3PJXA 4RPFA 1YRTA 3VF0B 5J2QA 2VFUA 2HLUA 1CQNA 2W7PA 1FNMA 1RHUB 4RNOA 4JV5F 3V6DA 2N3OA 2CFXA 2PFFB 2C28A 2IDEA 4DL6A 4CLPA 4L6V3 3G9CA 2VOPA 1X31C 3LP2A 4B3TJ 2IC3A 5B0GA 3ONQA 5F3ZA 2ZBPA 5EX3A 4M5KA 2BRLA 2DRBA 1UFLA 2WOMA 2BYCA 4ZIVA 5RUBA 1VQ7S 3DRPA 3BSCA 5KT7A 1E6YB 1HBNA 2P9GA 2KI2A 2LCWA 3PCOB 1RWKB 4ZN3A 2JC1A 2Z58B 4N7TA 2AF6A 5IC6B 2HGMA 2B4OA 8RUCA 2ZHBA 3D6FB 5L38A 4RBVA 3UDCA 3HT3A 4QWEA 4J9LA 3U1MA 4LSNB 2UVRA 2YWGA 4DFJA 3RW6A 1R6YA 1Q8LA 5J1PA 2AX0A 4DZDA 2PGCA 1OSCA 2YQ3A 4DPUA 3OTEA 3FBEA 1JNZB 3BKTA 4MKVA 4C48A 2GHWA 3G6XA 3OHBA 4WBFA 2VKRA 2KRRA 1LFWA 3V6HA 4IFYA 4BBYA 1NK9A 2ZC4A 1B64A 1X4CA 5KG1A 3MEGA 1WHVA 3KLIA 1OY6A 4CH7A 2AEFA 3FQKA 3LP1A 1VHFA 3F73A 4NLYA 1IM6A 3PHEA 1GQEA 2YWFA 4XPEA 3UCUP 2AJ0A 2R8KA 4DR3F 3WC0A 1R8CA 3K5MA 3BSAA 3HCXA 2OH2A 2M9KA 5ETLA 3JS9A 3OXFA 4NZ7A 3FRZA 2YWKA 4KR0B 1RAJA 2YPYA 1NJZA 5IQ6A 3DRYA 5C5JA 5B0EA 4ZMMA 4USKA 2E7XA 3A8EA 2W9CB 3V5RA 5DM6Q 1WEZA 2KT3A 4K4TA 3A3OB 2ZM6J 4O4RA 5EWEA 2J6SA 2HS0A 3QJLA 3AA8A 2B5JB 3RZAA 1LWEA 2DR6A 1DQ9A 4CNZA 3PW4A 3M2VA 3PNIA 3K5NA 5KOXA 5H9EK 1FD8A 2HIYA 1LWCB 4DMZA 3KK1B 1GX5A 2LEPA 3JSMB 1HNIA 2I9SA 5ETVA 4TLRA 3AFGA 5D0EA 4DL3A 1KOOA 1JMTA 2QO3A 4ZVSB 4YDDB 2ZUAA 1RT4A 1IWAA 3O8WA 3HVTB 4USJC 3QGGA 4CH0S 1S0MA 2HRUA 3G8SA 4IG3A 3VQSA 5KFIA 1QTNB 2OO4A 3MCMA 4ZP7A 5IOLA 2MGZA 1YDLA 2DNYA 3ZZ0A 4DV6F 2FVRA 1LXNA 4DR6J 3DOMA 1FERA 4ZVRB 1ELOA 4DU8A 5ETNA 4P7TA 4J7CA 1RLCL 3RRKA 1U8SA 4DV3J 2XS7A 2DT9A 4HKQA 1UW4A 3M1VB 1YKWA 2A6OA 3MPVA 1ACMB 3VAMA 4AXJA 5CYMB 4HHHA 1ZZNA 1KD1T 2C22A 2Z2LA 2PA3A 1TL3A 2XEXA 1R7IA 1XTZA 3CXCR 3I0RB 4F0MA 4M5JA 5G0RB 1W25A 3QNWB 1IXKA 3MMAB 5AXNA 1U1PA 4GC6A 1P1TA 1L3KA 4UF4A 1SL2A 1FEEA 3DDKA 3F56A 4WE1A 2XGQA 1MU2B 2UXDF 1CS4A 4HDHA 3VGVA 3JSBA 3UE2A 5A76A 2MZ1A 2BEFA 2LU2A 2FTRA 3J7YI 3W9JA 1Y4ZB 2MQMA 4OZLA 3K59A 1RA6A 1SJ4P 1DQAA 4KBIA 4OFZA 3HD1A 3V4MA 3Q8VA 4RUHA 3CGIA 1S9EB 2V8HA 1N34F 3TA0A 1RHJB 3PXGa 4DV0J 2FQQB 4DG1B 3FBFA 2IYIA 1TR0A 2B4VA 5KG6A 3RYLA 5F8MA 1R0AA 1M90T 3BR9A 3R7SB 2F63A 4RX6A 3CUNA 3MCOA 4C8ZA 2IRXA 5CZVA 4FN5A 1X5PA 3ZZOA 1OYDA 4ED0A 2HVIA 4A8QA 2POKA 2Q79A 3S1TA 2J9DE 5B0DA 1LV5A 1IR1A 2Q6CA 3BREA 1HHTP 3HSZA 4Z7YA 2JL9A 4DL5A 2VBXA 3W65A 4BCAA 3KG4A 1AA1B 4V1Ak 1ZPVA 3U02A 3CULA 2XBPA 3MMCB 3L95X 1R89A 3LPYA 1VMBA 3GCXP 2BE7D 2YKAA 2VODA 4JI5F 1RCXB 2CJ9A 1NJYA 2Z4PA 3RW7A 4NWBA 5E3CA 3ZNUA 1Z4UA 3NAIA 2KYZA 4NA3A 5IT4A 3UCGA 4R8UA 1EB0A 3UNYA 2PMHA 2HVZA 2PFDA 2VG7A 3GR0A 4B3MF 3J7AN 5D6GA 3MOZA 1WC6A 2XZTB 4KIAA 1UVIA 4DR1J 1HI0P 4F4AA 4NCAA 4JI5J 4XPCA 4RW4B 2WRMA 2CQ3A 1HNWJ 2HGNA 2OEKA 1HPZB 5KT2A 3EDQB 5HQMA 1VCTA 1H7WA 5EWFA 1KS2A 3N01A 3R5BA 3D67A 1FEHA 1TP7A 2BV3A 1FRHA 3QBCA 2JX2A 1SB6A 3GPAA 2B9XA 3W9HA 4OIXA 3ZZZA 5C42A 3ILIA 2HFSA 4RUBA 3H0PA 2X7IA 3H5YA 3P6YC 3MM5B 4LF7F 4C3MA 3MI7X 2LYVA 1RTIA 3FQLA 1ZS6A 4I6WA 4IOBA 2H51B 1RI7A 2NSCA 4HT5A 4ERDA 3DOLB 3VQTA 4NX9A 2FVQA 2A3JA 2FGOA 4BLGA 2CJAA 1V3RA 2FJVA 1X9WA 5E2QA 2NSBA 2ZH4A 3RR8A 2MKYA 4PXCA 2MZQA 2VA2A 2GHVC 5HANA 3BKFA 2CIMA 1I94F 1M5KC 1KVKA 4J9UE 1SKSA 3UVJB 2DNRA 4PXBA 3ZTRA 4NRUA 4MKAA 5CZXA 1MSWD 4Y2CA 2W2OP 2VUGA 5A2QY 3AD9C 1FJGF 2D9OA 3H20A 4PQUA 5DDRC 1FK9B 5T7LA 4B9UA 2RDIA 2F7VA 2ASJA 4FYDA 2V34A 1HMVA 1NMEB 4I6AA 3AH6A 3AY0A 3UDVA 1WD6A 3PX6A 1RT6B 8ATCB 2KHCA 1RT1A 2W4PA 2GQCA 2RDJA 3DOKA 2M8HA 4ILMA 3MM7B 4ID5A 1UAWA 1JJ4A 2G2OA 1UVJA 3GIRA 2IYGA 1H38A 5AE3A 3DLHA 2J6TA 1R3NA 2PI5A 4Y34A 2VJVA 2CAJA 2HAIA 3M9MB 1RK8A 4IO9Q 2R8GA 3K8VA 4M5DB 4IR1A 4NOHA 3VWSA 3BR8A 1HWKA 2GW8A 1WDTA 3EJMA 2NPIA 2YNIB 2KVIA 4TLQA 3P5BP 2YH0A 1FNXH 4M8LA 1UZHA 3FGVA 4K8RA 1FDAA 1YJVA 3G96A 3A1YG 3NGKA 4KT0C 2WBRA 1C0UA 2HVDA 4TU7A 3QFWA 1IBLF 1LW0A 1QTMA 4IH5A 3CVKA 4TY8B 2XS5A 1VC6A 3LP0A 2DO0A 3ETMA 2J8SA 1KRPA 4M1KA 1TKXA 2WSEC 1JX4A 4ZJQA 2F1FA 1TU0B 3DC2A 5EN1A 3CMQA 2E9RX 1X4FA 2ZITA 1BGXT 1T9TA 3EZUA 4M5MA 3NGRA 1CJKA 3PX4A 2OPPA 4H4MA 2D69A 4FS2A 3NEKA 1T9VA 4HR2A 1TK8A 3UPFA 3MUTP 2AIRB 4KH0B 3C6UA 3UFCX 4FKYA 2VASA 2OFHX 2OGUA 4OI3A 3E01B 2W2PP 4NLPA 4DPWA 1VR6A 3KYLA 3K57A 4LF8F 4P71A 4I2PB 1FTCA 2BJDA 4KHPF 3DLEA 1T05B 1Y3JA 3JTNA 4KGKA 1WC4A 1EHWA 4FBUA 2XHCA 3DRRB 1FDNA 2EK1A 4ZLNA 1IUJA 2DKOB 3TX0A 1U7LA 4PG8A 3HDSA 3TI0A 1RAAB 1YBUA 2HQIA 1U1RA 2RF2A 1FWLA 2DHAA 5A6PA 3D7SB 1WACA 2NLWA 1NK6A 5FJ4A 5LT5A 4ZVUB 1WELA 3Q83A 4ID8A 4X4QA 3P4UB 2P9EA 3KK3B 5KFGA 4KV8A 3NCRA 2QLWA 1LKZA 1HNVB 3IWXA 5L46A 4YHHJ 1MWYA 2GIRA 5IM0A 2OPSA 2PSZA 3T1HF 5KTQA 3IR5B 1YI2S 3K8WA 1TV6A 2M2BA 1YITS 5D4PA 3OTDA 2MTLA 3Q8UA 1KEKA 3NY0A 3CEDA 3HD2A 4R0JA 2XZWA 2Q43A 5ETMA 1HBOB 4F0HA 2QSWA 3OL6A 4NXNJ 3OBIA 4K4UA 1ZTTA 1RBLA 4TQRA 1SC3B 3UCZP 1N5VA 4CWBA 2QT7A 2MJUA 1DLOA 4B9SA 2P5VA 4ZJOA 2PD1A 4RW7A 4OX7A 2JVRA 4DI6A 5CCLA 3DGVA 2YY3A 2Y1IA 3Q86A 2DISA 1ZAWA 1SQGA 1P1LA 1MNEA 4ZVQB 4DR2F 3ILOA 1KWMA 2HBZB 3AOAA 3OVAA 2MKJA 4DUTA 3CC7S 1M0SA 4Y2IA 2NXNA 4QYRA 4JI4J 1PSDA 4DN9A 5F8JA 3KTQA 1HR0F 2CQCA 3RB4A 2PN6A 1S77D 4CYUB 3KLHA 1H73A 4L74A 4KC5A 3BN4A 2W8KA 1XMOF 3TO8A 2YVSA 4C7QA 1SQFA 2XLKA 2KH9A 3DMJA 3C16B 3LAMA 4MK7A 4J9KA 4EEYA 2MB0B 4FZVA 1HQEB 1HQ2A 4IDKA 4KPCA 1WJ9A 3KG0A 3H5XA 3CDWA 4OZ5A 2CQPA 4ANCA 1RWPB 1NBEB 1UETA 2BKPA 3OR2A 1SC6A 2OPRB 4CO4A 2WVEA 4JI3J 4NXMJ 2IJRA 3B8HA 5KFPA 1RT5A 4NLTA 5KFXA 3OTBA 4A8YA 3T6JA 3QGHA 2DR7A 2QX0A 4D3HA 3I0SB 2AJQA 2DYAA 4Z37A 5HJYA 3MD1A 4OYWA 1KR4A 4FXVA 4HI2A 2C2NA 3PRDA 1EETB 2F4VF 1Z1ZA 3ISZA 1SJRA 5CYJA 5DLFA 1L3TA 3M6XA 5F8LA 2VBZA 4J9MA 1WC1A 1GH8A 3ET6A 2Q1LA 3TUZC 7AT1B 2QL5B 4CTAB 4B3SF 1QE1A 2CPEA 3JTPA 5KT5A 1RAGB 1XMQJ 5KFYA 1XWLA 3KLFA 3KKFA 2MQOA 3M30B 4X64J 1NHVA 3RB3A 5HP1B 4ZOSA 3M32A 5L1IA 4ZP6A 3H90A 2KM8C 3TUPA 4PWDA 4OYOA 2I8EA 4J9NA 3GYXB 1URRA 4ZVPB 4LRCA 1S9GA 4LF5J 4I7FB 3KOAA 2VKZG 4P10A 2Z30B 3OJSA 2ZH9A 4QIFA 4JI7J 2WTFA 3BN7A 2FY1A 5A8KA
chains in the Genus database with same CATH topology
4OYWA 2GVDA 1YBUA 5D0GA 4CLLA 4CLTA 1FX2A 2W01A 1FX4A 3G82A 3MR7A 4CLSA 1AB8A 1U0HB 1TL7B 3C16A 4P2MA 1Y11A 4OYPA 1WC6A 4CLFA 1WC1A 1CS4B 3ET6A 4CLYA 3C15A 1YK9A 4WP8A 2GVDB 3MAAA 5D0HA 3UVJA 1CJTB 4CLUA 4OYZA 4USWA 1CJKA 4WP9A 4CM2A 1CJVA 3G82B 3C16B 4USVA 4WP3A 4OYIA 1CULA 2GVZA 4USUA 4CLPA 4NI2A 4P2XA 3ET6B 3C15B 4OZ2A 3C14A 3R5GA 4CLKA 3UVJB 1WC0A 5D0EA 1CJKB 1AZSA 4OYMA 1WC5A 5D15A 1CJVB 5IV4A 4P2FA 4OYOA 4WPAA 4OYXA 1YBTA 5D0RA 5IV3A 1CJUA 1CS4A 4OZ3A 4CLWA 2QV6A 3C14B 4CM0A 1CJTA 3MAAB 4OYAA 2WZ1A 1WC4A 1AZSB 4OYBA 2BW7A 4USTA 1U0HA 1TL7A 1CJUB 4CLZA 1WC3A 1CULB 2GVZB 1Y10A 4NI2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYW A;  2GVD A;  1YBU A;  5D0G A;  4CLL A;  4CLT A;  1FX2 A;  2W01 A;  1FX4 A;  3G82 A;  3MR7 A;  4CLS A;  1AB8 A;  1U0H B;  1TL7 B;  3C16 A;  4P2M A;  1Y11 A;  4OYP A;  1WC6 A;  4CLF A;  1WC1 A;  1CS4 B;  3ET6 A;  4CLY A;  3C15 A;  1YK9 A;  4WP8 A;  2GVD B;  3MAA A;  5D0H A;  3UVJ A;  1CJT B;  4CLU A;  4OYZ A;  4USW A;  1CJK A;  4WP9 A;  4CM2 A;  1CJV A;  3G82 B;  3C16 B;  4USV A;  4WP3 A;  4OYI A;  1CUL A;  2GVZ A;  4USU A;  4CLP A;  4NI2 A;  4P2X A;  3ET6 B;  3C15 B;  4OZ2 A;  3C14 A;  3R5G A;  4CLK A;  3UVJ B;  1WC0 A;  5D0E A;  1CJK B;  1AZS A;  4OYM A;  1WC5 A;  5D15 A;  1CJV B;  5IV4 A;  4P2F A;  4OYO A;  4WPA A;  4OYX A;  1YBT A;  5D0R A;  5IV3 A;  1CJU A;  1CS4 A;  4OZ3 A;  4CLW A;  2QV6 A;  3C14 B;  4CM0 A;  1CJT A;  3MAA B;  4OYA A;  2WZ1 A;  1WC4 A;  1AZS B;  4OYB A;  2BW7 A;  4UST A;  1U0H A;  1TL7 A;  1CJU B;  4CLZ A;  1WC3 A;  1CUL B;  2GVZ B;  1Y10 A;  4NI2 B; 
#chains in the Genus database with same CATH topology
 2DNK A;  3OUY B;  2GVD A;  1RWO B;  2WBM A;  2FHO B;  4RW8 B;  5K8O A;  2DNM A;  5EHH A;  3R1H A;  5B09 A;  2RJZ A;  1X5O A;  1QY7 A;  4O3R A;  5F8H A;  1PYT A;  2R7R A;  5DDO C;  1VS3 A;  1VQP S;  2RHQ B;  4LF4 F;  1B0V A;  4B9L A;  2UU9 F;  3OL8 A;  5DRK A;  4OYI A;  5A8W A;  2LQ9 A;  2L3M A;  2E5L F;  3DI6 B;  3L7P A;  4OI0 A;  4OHW A;  2VG5 A;  2V94 A;  1HBU B;  3NCQ A;  1S0V A;  2DNP A;  2VQE J;  2KFZ A;  4A4J A;  3Q8R B;  2HNY A;  2J0Q D;  5LXY A;  2B6A A;  1T03 B;  1CJT A;  4X66 F;  1WOP A;  2CPX A;  3PJW A;  3W5Y A;  3WQP A;  4IFV B;  1AZS B;  4IYQ A;  2R8J A;  3DLK B;  2YNH A;  1URN A;  1IKX B;  4ECR A;  1HWJ A;  1WKJ A;  3CSK A;  3BQ2 A;  2IA6 A;  2ZZM A;  5JXS A;  3S8S A;  5ETT A;  2OD4 A;  2QE5 A;  2FVC A;  4P2M A;  4RW6 B;  1R43 A;  1TZ0 A;  2O3D A;  1LK5 A;  3RB6 A;  3RR7 A;  3NOG A;  1REV B;  5FDL B;  5IT0 A;  1S1U A;  4KO0 A;  3PFO A;  1XR5 A;  1RXO B;  4LBI A;  1SJ3 P;  4X4U A;  4RZR A;  1Q8K A;  3NXZ A;  2ADC A;  3HVR A;  2V9W A;  1MN9 A;  2L48 A;  3GFZ A;  3DHW C;  3KLE B;  3DLL Q;  3AD7 C;  3M6V A;  1E6V A;  3IM9 A;  5MAO A;  5J2Q B;  3K0J A;  2W2N P;  4LR9 A;  3V6D B;  1WC5 A;  1HD0 A;  1APS A;  3ZZR A;  2WON B;  3M8Q A;  3JB9 k;  4HHU A;  2DGV A;  1BMQ B;  2X1B A;  2HND A;  4UUW A;  1WUU A;  4FYY B;  2HPU A;  2IC3 B;  4EU0 A;  4JI6 F;  1Q8B A;  5L1L A;  5AJ3 J;  2WOM B;  1WNE A;  4LT6 A;  2VQF F;  2WVF A;  2UZA A;  3V81 B;  2JLE A;  3AJ2 A;  5KFO A;  3DRP B;  4N5S A;  3X3U A;  1HBN B;  2E1M C;  1N5Y A;  2Z2Z A;  4R5P A;  2GNK A;  4NRT A;  4N8O A;  1V9O A;  1J2V A;  2XO6 A;  4ZS6 A;  2N3L A;  2CJB A;  4DR7 F;  1E6Y A;  2YBV A;  4BS2 A;  1IR0 A;  2YWH A;  5K5M A;  3PTW A;  4DV4 J;  2V8D A;  3GII A;  4LSN A;  2IVF B;  2ZH2 A;  2VON A;  2HHH J;  3AA9 A;  2RVJ A;  2IMW P;  4LF9 F;  4LF6 J;  1VQN S;  3Q8Y A;  2OTL S;  3ITH B;  2ADB A;  4JI2 F;  4K4W A;  2DGW A;  5HMX A;  3MEG B;  3W60 A;  1JLQ A;  4DV7 F;  4F50 A;  3LP1 B;  2KXF A;  1B0T A;  1KBR A;  5H1S V;  4DDF A;  4EO6 A;  3MUV P;  3SV3 A;  4PWU A;  4OZ1 A;  3UW1 A;  1DJ0 A;  1XNR J;  3I82 A;  2EBG A;  1RBA A;  3W8G A;  3N9U C;  2R42 A;  2WB4 A;  4CO1 A;  4WYL A;  5F0W A;  2EFQ A;  5BJR A;  1N0V C;  3MEE B;  2V5H G;  1HW9 A;  2EC0 A;  5I3P A;  1ZYQ A;  3A8J A;  4GKK F;  4EZ6 A;  4KQZ A;  2RQM A;  1TK5 A;  3D1Q A;  4ZVO B;  3MOJ B;  2DIU A;  1LWE B;  4FYW B;  3OSP A;  2XMM A;  1S0N A;  5HVF A;  3N4W A;  3M2V B;  5MLC V;  4DU7 A;  2CZ9 A;  2VPX B;  1NPP A;  1X0P A;  3ZFV A;  3IAS 9;  2MQQ A;  1N5S A;  5KFW A;  4IQX A;  4QQB A;  2B5J A;  1HNI B;  4PG4 A;  3KMQ A;  1RAO A;  1FES A;  1BY9 A;  2RH3 A;  3LAN A;  1OSD A;  1BQN A;  1CC7 A;  2DNQ A;  4DR4 J;  4X4T A;  4L75 A;  3DU5 A;  3D6H B;  3CD5 A;  1YLX A;  3KK1 A;  1FKA F;  2MHN A;  1NSA A;  3CCV S;  4DR5 J;  2BW7 A;  3JSM A;  1GMU A;  4UQT A;  2ZDP A;  2QEX S;  1C1B B;  1NND A;  2XHW A;  3JYT B;  4IG3 B;  1WOO A;  2EFG A;  1ICE B;  5BYS A;  1TQL A;  4XDD A;  3NWG A;  2DRD A;  3CF5 Q;  3BPD A;  3DOM B;  3AJ1 A;  5K14 A;  4U6P A;  2EC2 A;  4MKB A;  5E3A A;  5D8H B;  4BWM A;  4JI0 F;  5ETK A;  2FLN A;  1FI4 A;  1SPB P;  2WK4 A;  1WHY A;  3UD4 P;  4TU8 A;  2CPI A;  3IFE A;  3NAH A;  4KRW A;  4WYW A;  2YNG A;  2BVZ A;  4K5S A;  2BOA A;  5K8P A;  1HWL A;  4M63 A;  2DH9 A;  4OZN A;  1K44 A;  2ASD A;  5CYM A;  2FHM A;  4UW2 A;  2DNO A;  1Q7L B;  4KFB A;  3L9Z A;  3I0R A;  1X7V A;  3DGP A;  5B0F A;  2CAD A;  4WE1 B;  1AT1 B;  4MJK A;  2V63 A;  5D3G B;  3MMA A;  3BGR A;  5HMZ A;  4OJ3 A;  1SKU B;  1CSJ A;  3KLG B;  2ZUG A;  1XNQ J;  2BM1 A;  4MIA A;  3NNA A;  4OHY A;  2O5D A;  2E9Z A;  3CJ2 A;  1GXU A;  3MMJ A;  4YY3 J;  1S12 A;  3I31 A;  3PHT A;  4IKA A;  2AYB A;  4CM2 A;  1OY8 A;  5J1E A;  2Z8Q A;  4TKT A;  1GEH A;  1R0A B;  1N6Q B;  1OJ4 A;  2DCL A;  2QJ3 A;  1D3W A;  1DUR A;  3SXL A;  1S9F A;  4JUZ A;  3SYZ A;  3TAP A;  4DG1 A;  2ZZT A;  3HHL A;  3G4S S;  2ZNY A;  2HWT A;  2CUY A;  4B9T A;  2SXL A;  4IH6 A;  4O44 A;  4ZK7 M;  1IKW A;  4DV1 F;  3LOU A;  4QYZ K;  3GFH A;  2RQC A;  4JI1 J;  2UV8 A;  1IJF B;  2AU0 A;  5CXT A;  2J9C A;  1Q86 T;  1RA7 A;  4NZ6 A;  2IJN A;  2ZBC A;  5M2U A;  4WII A;  1RKI A;  4TNO A;  1RE1 B;  2ZH8 A;  3MR7 A;  4Y2M A;  1NK4 A;  4DL2 A;  2MST A;  2NCK L;  1S10 A;  1KSP A;  1HYS A;  1FJE B;  3MMC A;  3VV2 B;  1C4C A;  4F3M A;  4R8U B;  2RIL A;  4X65 F;  1SL1 A;  2VG7 B;  3PYD A;  3D1H A;  3ZZY A;  2HAF A;  2RML A;  4F04 B;  3ENQ A;  4ECX A;  2QFI A;  3NGS A;  3IWN C;  4P2X A;  5M2P A;  2Z56 B;  1X9M A;  1LK7 A;  3PIO Q;  3MPY A;  3RJM B;  5LJ3 Y;  2YTC A;  3KUE A;  4OMF G;  1TUV A;  5HQL A;  4CLW A;  7FDR A;  3M8P B;  1NJI T;  2VBY A;  3J80 U;  1T9W A;  3V6K A;  2MKI A;  1S48 A;  2F8M A;  1CUL B;  5C42 B;  3W2W B;  2DY9 A;  4TXS A;  3R6G B;  3QJP A;  4P75 A;  3U7J A;  3CCW A;  2KZZ A;  4CLT A;  5KG3 A;  1RAB B;  5GVQ A;  1MMD A;  5F9L A;  4LFA F;  1RTI B;  2Y8W A;  2VF3 A;  3CD7 A;  1TAU A;  4QW9 A;  1VQO S;  2IBK A;  1GMV A;  4J90 A;  3T3F A;  1LWF B;  5IC4 B;  3LAL A;  4E0D A;  4Z2X A;  5F3T A;  1VYA A;  3TX8 A;  1OIA A;  2OJ3 A;  2F8E X;  1W2I A;  1VQY A;  4MIW A;  5F9N A;  3DOL A;  2GO8 A;  2IRU A;  2XSJ A;  4QR2 A;  3TZY A;  3NLC A;  4LFA J;  2CVI A;  3BF4 A;  5ETQ A;  4J9V A;  3EM1 A;  4LFC J;  1SVD A;  1BD6 A;  4LRD A;  4NYO A;  4QZV B;  1AUD A;  2ASY A;  4OI1 A;  3PFE A;  2F9J A;  1SXL A;  3KNA A;  1FE4 A;  1FCA A;  3I6P A;  4UY8 5;  5ADZ A;  4K4V A;  4OHZ A;  5T7L B;  4Y2A A;  2KXN B;  1DTQ A;  2MLZ A;  4P9S A;  1D8Z A;  4B02 A;  5HAO A;  1BHN A;  2QA4 S;  1CG2 A;  3VAI A;  4X4R A;  2HHP A;  1IBK F;  4M94 A;  2M7S A;  3DRS B;  1NJX A;  4C8K A;  4ILR A;  2XNQ A;  2YKN A;  3HJV A;  3BJY A;  3QWU A;  2JLF A;  3IN5 A;  4CO2 A;  2ZOG A;  2BXJ A;  3EUN A;  1N5T A;  1SC4 B;  4F4W A;  5CCM A;  2LXU A;  2EBE A;  2ZD1 B;  1RT6 A;  2VDI A;  3HVW A;  3DFE A;  4ZVF A;  4ECQ A;  3MM7 A;  2Y0S D;  4K5R A;  1Q5V A;  2HSE B;  3O44 A;  2AYG A;  2K7K A;  5KFE A;  2UUA J;  2B0G A;  3CPW R;  5KG7 A;  2H3E B;  4OX8 A;  3RG6 A;  2FHJ A;  2GO9 A;  4QW8 A;  3FEX B;  1TMM A;  2V69 A;  4LRB A;  3U1N A;  1N4L A;  1H2U X;  1TFW A;  4E98 A;  3PW7 A;  2BJ1 A;  2LQJ A;  2EW9 A;  3GJQ B;  3CJQ A;  2FJB B;  2GC8 A;  1JLC B;  2GA7 A;  3QT8 A;  4QR0 A;  5LMN F;  3QWP A;  3NBP A;  1X60 A;  2H4W B;  2BJ7 A;  1R8A A;  3DLG B;  1UL3 A;  5T41 A;  1T8E A;  1LW0 B;  2Z57 B;  3ENW A;  4R0E A;  2ZH3 A;  5D78 A;  4WFB Q;  1EP4 B;  4LFB F;  2FZK B;  4DQQ A;  1IBC B;  1TKX B;  1YJU A;  2QYG A;  3DLJ A;  2VHG A;  3GTY X;  2DD8 S;  1S1T A;  2HS4 A;  3QT6 A;  5C2G A;  4UOC A;  5JUM A;  2J6U A;  3QLH B;  1RTH A;  2HW3 A;  2W2M P;  1KFS A;  3TZZ A;  2JC0 A;  1CJK B;  5CYQ A;  1S1X A;  2OPP B;  3RAM A;  4H4M B;  2IVM A;  4MYU A;  1YBT A;  5D0R A;  2CQ2 A;  3QFH A;  1LNQ A;  1AUS L;  3IO1 A;  3C6U B;  1MML A;  3D28 A;  5KFK A;  4WK3 A;  2ZH7 A;  4ED8 A;  1X4B A;  4F7V A;  1RU1 A;  2PO4 A;  3DDI A;  2CWX A;  2KT5 A;  4P52 A;  2FVS A;  4O3P A;  4X62 F;  4CT8 A;  1UTA A;  2G13 A;  4EFA C;  2CG4 A;  3E01 A;  3LUY A;  2N82 B;  3D66 A;  1M5O C;  2RF2 B;  4QCL A;  4GO7 X;  3TZW A;  4O3S A;  4EUV A;  3OFF A;  4ZP8 A;  3DRR A;  1U6Z A;  3NS6 A;  2DNH A;  2HVH A;  4MIB A;  2VPW B;  3T1Y F;  4IRD A;  4M5H A;  4RU2 A;  4DX5 A;  1ZAX A;  2VPY B;  1VRT A;  2OPS B;  3R5J B;  4GKJ F;  4S0M A;  2RU3 A;  2NPF A;  3D2W A;  1TV6 B;  3NOC A;  3RGI A;  5LL6 d;  4GVB A;  1HNZ J;  1NH7 A;  3Q24 A;  4C3K A;  2HHV A;  4NI2 B;  4KHR A;  3UD3 P;  1U24 A;  4B3O A;  5KFH A;  3GCW P;  3FZB A;  3I56 S;  1NJW A;  4RW7 B;  1NK8 A;  3HSG A;  1Y9O A;  1K9M T;  2GX8 A;  4WFN Q;  1K73 T;  3GWC A;  4V19 J;  1YBA A;  2DCU B;  3ZTP A;  4KB7 A;  3S01 A;  4ZVG A;  2YX4 A;  3CME S;  1TTH B;  1OY9 A;  4D3G A;  4USU A;  3FKB A;  3FJ2 A;  4I2Q A;  5JVH Q;  2G1D A;  1YJ7 A;  2B3T B;  1X4H A;  1XBW A;  3HHN B;  1GX6 A;  2BBE A;  5AXM A;  2EFP A;  5I3U A;  3NNH A;  4OYM A;  4ZP9 A;  4O3O A;  3DMJ B;  1NKB A;  2BQ3 A;  3DKD A;  4OZ3 A;  1FFW B;  2IVY A;  2K06 A;  1KQF B;  2APO A;  2ALY B;  2VA3 A;  4CYU A;  3GJS B;  1L5U A;  4E2F B;  2OML A;  1R8P A;  4WFA Q;  1DY3 A;  1RHM B;  4OYB A;  3KUH A;  4Q5V A;  3OR2 B;  2D3O 1;  3FFI A;  1JLA A;  3NP5 A;  1FFS B;  2DIT A;  2XZD B;  1FKO A;  4O4G A;  1HQE A;  1SKR A;  1RT5 B;  2M4M A;  3HHE A;  6FDR A;  5KFT A;  3B4M A;  1ZBT A;  3BO4 A;  1WTB A;  2IAJ B;  5DG7 A;  1NB7 A;  2MXY A;  1U2R A;  3KFW X;  1VOM A;  4LMZ A;  4J9S A;  1T02 A;  4QWC A;  2QA4 G;  5I4M A;  1H7X A;  3FDS A;  3R1L A;  2XWY A;  2CPF A;  1U1K A;  4XDC A;  1XMB A;  2EG1 A;  3ET6 B;  3I32 A;  3B54 A;  4PWW A;  3C14 A;  4PXD A;  2CXE A;  4MMO A;  1EET A;  2HHU A;  5LSL A;  5DLG A;  2BX6 A;  1ZOT A;  3KLF B;  1QJH A;  3GIK A;  4DLE A;  5BYQ A;  2PC6 A;  3BGF A;  4ZCI A;  1UJ6 A;  4I6Y A;  3M2U B;  1SH3 A;  1YG0 A;  5LSO A;  1MW7 A;  4F4X A;  3M32 B;  1D09 B;  2WZ1 A;  1XR6 A;  3W9I A;  3IGN A;  2CRL A;  4PWD B;  1HKA A;  1QAJ A;  1VHI A;  1Y10 A;  3R6L B;  5JVG Q;  4NCB A;  1KVI A;  2XGP A;  2HQF A;  5HP1 A;  2AQ4 A;  1XJW B;  1S9G B;  4AQY J;  5HLF A;  4UUX A;  1U6B A;  5BXI A;  1TUG B;  1U45 A;  1Y5N B;  2ZWP A;  1WHX A;  3D0H E;  1B3T A;  3IR6 B;  5GAG U;  5A8K B;  3DRX A;  1M5H A;  1KOH A;  2GVD B;  3D54 A;  4H4O A;  1OPI A;  4RNF A;  4CRJ A;  4I7F A;  4ZIT A;  4NAS A;  3ZZP A;  1S6Q B;  3QT5 A;  2BKN A;  2CQH A;  4TVA B;  2ZH1 A;  3LAK A;  1OQ3 A;  1RAI B;  3OUY A;  1FFG B;  4YB5 A;  3L09 A;  3UO0 A;  1WC0 A;  2LLZ A;  4RW8 A;  3H2U B;  3THT A;  2WCX A;  2UUC J;  1RP5 A;  3BDE A;  2DXE A;  2FLL A;  4PG6 A;  2NS1 B;  1JKH A;  5A8W B;  5HRO B;  4G1Q A;  1B4S A;  2MZR A;  3JSR A;  2VG5 B;  4P6Q A;  1R0B G;  1PC5 A;  2V4Q A;  2HG4 A;  1C1C A;  5KAK A;  2HNY B;  2A0F B;  2GVZ B;  2D7S A;  3MAQ A;  3QRR A;  1HBM A;  2OKQ A;  2YKQ A;  4ELV A;  1RWW B;  3PO4 A;  4PCQ A;  1Z2Z A;  2C1E B;  2YNH B;  5B0B A;  1UWA A;  2E66 A;  2RB7 A;  4NLQ A;  3K5O A;  1N8R T;  1MLA A;  1VGY A;  2O1P A;  4OJ1 A;  1S1V A;  3TJ9 A;  4P73 A;  4M95 A;  2KRB A;  2HFN A;  3IM8 A;  4QPT A;  2ALZ A;  1MN7 A;  2HFU A;  3E8O A;  3IS9 A;  4K7Q A;  1FKP A;  1VQ5 S;  2NXE A;  1S1U B;  3J80 Y;  4DFM A;  3Q89 A;  2FDN A;  3NCP A;  2H5I B;  3UD5 A;  4RW6 A;  4BC7 A;  2KVQ E;  1U1L A;  2M5Y A;  5FDL A;  4RJV A;  4AT1 B;  4B3T F;  3HJF A;  2RRN A;  3OVS A;  2D41 A;  4X4V A;  4OX9 J;  3JSY A;  4L73 A;  2ZH5 A;  2QRR A;  3UNG C;  4N47 A;  2HND B;  4RBU A;  3CDA A;  4ED2 A;  1QSL A;  2KN4 A;  3CB4 A;  4UQG A;  4F2S A;  1Q16 B;  5A0Y A;  5ITH A;  3HZE A;  2WON A;  2PMZ D;  4OYP A;  4C9D A;  2KL8 A;  3R5A A;  3JQK A;  4Y00 A;  2VG6 B;  3BZQ A;  5AT1 B;  5CD4 A;  3GV8 B;  5AE2 A;  1Y5I B;  4NLD A;  2ATL A;  1IBM J;  4CO3 A;  4AL7 A;  1N5Y B;  2GZO A;  4R5P B;  2IM3 A;  2FB0 A;  5HSP A;  3V81 A;  2AYM A;  1RAF B;  1Q79 A;  3ENV A;  2HK3 A;  1HQU B;  5KFU A;  1BQM A;  3CO9 A;  4PYA A;  3LO3 A;  5IT9 U;  4X84 A;  3RBD A;  5GAH U;  3TUJ C;  2UVU A;  2M3D A;  1B0P A;  2R2S A;  2HQC A;  1FRI A;  2AGO A;  3T5H A;  4ECU A;  1YRU A;  4DSI A;  1FRM A;  3Q0A A;  5GAE U;  3AXM A;  3HKW A;  1RAH B;  4B08 A;  3SFU A;  2VC0 A;  3A8I A;  2ILY A;  2E9T A;  2IMO A;  3Q2T C;  1JLQ B;  3CCT A;  4AYB D;  1H6K X;  3VAH A;  2EFO A;  4Y65 A;  4O3Q A;  4MTP A;  3MM8 A;  4DPX A;  5LMU J;  3KUG A;  2NQP A;  3ITH A;  5H9E J;  2Y3Y A;  2CQI A;  2KTQ A;  4J91 A;  3I5A A;  2ZM6 F;  4Z7C A;  2DBB A;  2XSF A;  1N36 J;  1CJV A;  1FRK A;  4HTI A;  2XS2 A;  1NSQ A;  5BR8 J;  1IM4 A;  2ZZN A;  4F02 A;  4B3R J;  2YQ1 A;  2XNR A;  3ILL A;  3FBC A;  2QLJ B;  4U67 Q;  3FRY A;  1VIO A;  2DVI A;  3CCS S;  2C3M A;  2MJN A;  4I4B A;  1NDP A;  5IXU A;  4QWB A;  5HVH A;  4OZ0 A;  3BQ0 A;  2MDA A;  4I64 A;  5KFJ A;  2E5J A;  4ZA1 A;  3NWR A;  1ZET A;  3MEE A;  4ECZ A;  1A9N B;  3R3T A;  3CCU S;  3W63 A;  3W61 A;  3BYP A;  2G0C A;  4JI8 J;  3IXQ A;  2EK6 A;  4EI2 A;  4FF4 A;  4NLX A;  3WZ0 A;  3T41 A;  3KXD A;  1VFJ A;  4RL1 A;  1BQN B;  3FSI A;  3RAQ A;  1TKT A;  2FIU A;  1WTF A;  2ILZ A;  2NXJ A;  3TAR A;  1VC0 A;  2HHS A;  4I69 A;  1UP1 A;  5A8R B;  1X0F A;  4DR6 F;  5KOW A;  5D0H A;  4F8R A;  4DV3 F;  1UA0 A;  3ZNJ 1;  4JYA J;  2UUB J;  5IWA J;  1C1B A;  1Q82 T;  4RO0 A;  2HBR B;  1Q95 G;  3JYT A;  1HI8 A;  3E51 A;  5K14 B;  5ETS A;  3L3C A;  3HSJ A;  3EPI A;  1EAR A;  1KDN A;  2ZHA A;  2R7T A;  1OQ6 A;  3FBB A;  2VV5 A;  4HH0 A;  2W1B A;  2HFO A;  2O01 C;  4K2X A;  1RCO B;  1YJW S;  1DTT A;  2DGT A;  4WKR A;  1NPK A;  2FJE B;  1M5V C;  2B4P A;  4X4N A;  2YNG B;  1YWX A;  2OTJ S;  2ZOM A;  4YR2 A;  2CNO B;  2FHJ D;  3TOQ A;  3IRW P;  1RHQ B;  2NZC A;  3PO5 A;  1U0H A;  5T14 A;  2QZ8 A;  1F5B A;  1Q0N A;  2V0N A;  3OXL A;  2YQ0 A;  1OS5 A;  4P72 A;  2HUR A;  4KFB B;  1UVM A;  2CNN B;  3DGP B;  3LH2 S;  3QQC D;  2CPJ A;  4P74 A;  3IGV A;  3BDP A;  3DXB A;  4BWJ A;  3BGR B;  4M5L A;  3CCL S;  1IJE B;  2RRA A;  2XM3 A;  4DV0 F;  1RWX B;  2XB2 D;  1T11 A;  4JB8 B;  3UN5 A;  5B0C A;  1RYS A;  1FJ7 A;  4P2S A;  4H54 A;  5D3G A;  2COL A;  1LOU A;  4CLK A;  2UVV A;  3KLG A;  3UDE A;  3TJ8 A;  4Q45 A;  2KXH A;  2DTJ A;  2D74 B;  3TYT A;  5J1E B;  3RRH A;  1FHT A;  1AXQ A;  1O5J A;  4WIQ A;  1F1B B;  2VFR A;  2VU5 A;  2NUU G;  3CJ8 A;  4M5G A;  4DWI A;  1N52 B;  1PIE A;  4QWD A;  4A8K A;  3HHL B;  2MQL A;  3T5J A;  3EGN A;  3MEK A;  3R2C J;  1VLY A;  4O44 B;  1N6Q A;  2HBY B;  2ROG A;  2V9K A;  1IKW B;  2BJE A;  3D6M B;  2YWE A;  2W01 A;  1S4F A;  3GFX A;  2QLX A;  4IG0 A;  2QC3 A;  3KJN B;  2XMU A;  3ZTS A;  4UOG A;  3DNC A;  1PO6 A;  4ILL A;  1RAE B;  1N88 A;  1RDR A;  3DXS X;  3NRB A;  1NH8 A;  1HYS B;  2Y8Y A;  2JRS A;  3MM9 A;  3K17 A;  4DR1 F;  3FSY A;  2LFV A;  5DO2 A;  3CDE A;  1S49 A;  2JFD A;  3H42 A;  1HNW F;  5KFM A;  2AHO B;  5HJX A;  3AQP A;  4P7V A;  3VGS A;  3C6T A;  1LEO A;  3N6N A;  2C3P A;  4HAC A;  4ZPA A;  2BDP A;  3WDO A;  2PEB A;  3BPS P;  3CCR S;  1JJ2 R;  2QL7 B;  4NL5 A;  2K1R A;  1B99 A;  2IJF A;  4U95 A;  3MED A;  5DG8 A;  1MRO A;  1YJ9 S;  2RUS A;  1YIJ S;  3NS5 A;  5E5N A;  4DZ6 A;  4ZJL A;  4ED1 A;  3CCM S;  4AL6 A;  1WI6 A;  1Y0H A;  4MT1 A;  2UXB J;  1HAR A;  2CNK B;  1R0C B;  2R7Q A;  3M8P A;  3C8Y A;  2QG9 B;  3B82 A;  1KN6 A;  4XIU A;  2C42 A;  2H1Y A;  1W2B R;  4C0H A;  4LR8 A;  2J76 E;  1P6T A;  3TAN A;  4DHV A;  3UR0 A;  4WFZ A;  2HBQ B;  1CUL A;  3BSO A;  1JQG A;  3W2W A;  2FPH X;  1EQM A;  2DNZ A;  1S6O A;  1EJ7 L;  5EGY A;  4OZJ A;  4Q7A A;  1PKU A;  2V2Z A;  4Q2M A;  3HI9 A;  2R8H A;  1J27 A;  1I5O B;  3CJS A;  2E7W A;  2W9B A;  1RTZ A;  4R25 A;  1ZTW A;  3MMB A;  2BR0 A;  1A6L A;  1WG4 A;  4ELT A;  2XSJ B;  1LWF A;  2JNJ A;  4Y28 C;  2XLI A;  2DR5 A;  2XY5 A;  5CD4 H;  3GLJ A;  3EGW B;  1YZ7 A;  3PVX A;  4TYB A;  2VB6 A;  3AAW B;  5GAD U;  1UPP A;  1BUX A;  4KSE B;  5H9F K;  5CQG A;  3G6E S;  1NDC A;  1FX2 A;  2DH7 A;  1ZA1 B;  2CPD A;  1B70 B;  4USH A;  3PDN A;  4C4W A;  2XQC A;  5DET A;  3VAG A;  4ZLP A;  1DTQ B;  4U8Y A;  2I0X A;  3FZ2 A;  3QID A;  1Q4R A;  2DO4 A;  3X1L B;  5KFZ A;  1RTJ A;  2KKH A;  4WP9 A;  2RS2 A;  1F5A A;  5JMN A;  2ZBQ A;  2W4D A;  4FVM A;  3T1A A;  3R7N B;  2YKN B;  1MWZ A;  1GMW A;  1D9A A;  2EPI A;  4ZCL A;  2MKS A;  1G6B A;  3BM7 A;  1NDK A;  4MH8 A;  5CH7 B;  1FDD A;  1TKD A;  3DRS A;  2CQ1 A;  1FO1 A;  2UXC J;  3AXK A;  3F0N A;  1SV5 A;  3SCL E;  1Q7Y T;  1S6U A;  2QMX A;  2LEA A;  2V2V A;  2Y1J A;  2ZD1 A;  1HA1 A;  3HSD A;  3W2V A;  3NNC A;  1ARO P;  4IOA Q;  1NK5 A;  3ISN D;  3CCQ S;  3WX4 A;  2QFJ A;  3PKM A;  2RKI B;  2E5I A;  2OLW A;  4L3K A;  1K47 A;  2BAN A;  1F2G A;  4DV5 J;  2J5A A;  1UEV A;  4ELU A;  2GIF A;  3NBP B;  1DAX A;  1G2E A;  5IFM A;  4WFY A;  4WXW A;  3TUI C;  2Y9H A;  1JLC A;  3UDL A;  2GMH A;  5B0A A;  1OYE A;  3GIJ A;  1VRU B;  3M7V A;  3CIZ A;  2DPI A;  4EWT A;  2PMW A;  1RT2 A;  2HS3 A;  3T19 A;  3QT7 A;  3ZZU A;  2KG1 A;  3AQO A;  2G9O A;  1YGY A;  2DGS A;  2I5J B;  4G1P A;  3DLG A;  2CDR B;  3IP0 A;  4ZVH A;  2DJW A;  3CD6 S;  2OEL A;  4I56 A;  3D6T B;  3VZI A;  1S1T B;  2RHS B;  2VC1 A;  3D0I E;  2C2R A;  5FLX U;  1RHR B;  1IVZ A;  5DQI A;  1RTH B;  1EP4 A;  3LPE A;  2NUH A;  3BGO P;  5CYQ B;  2K8G A;  1NKE A;  3SIP B;  1U09 A;  1S1X B;  4CT9 A;  4IO1 A;  1JLB B;  3BBF A;  1S72 S;  4X4S A;  4CI0 B;  1RLD A;  4ES3 A;  2HQD A;  4O0I A;  3HX9 A;  1JJH A;  4NA2 A;  4KPY A;  4B17 A;  3GZ7 A;  4IR9 A;  3QLH A;  4DV2 J;  2DIV A;  4J9Q A;  4PG5 A;  3ICL A;  1X4A A;  1FX4 A;  1U26 A;  3G8T A;  1V6H A;  2YKP A;  3PV8 A;  2OIH A;  2Z2M A;  2HHX A;  2KFN A;  1SQE A;  2V67 A;  3FC9 A;  4WXO A;  3ZTQ A;  4K0K J;  1RTD A;  3N28 A;  1CLF A;  2R4F A;  2KDO A;  2CJX B;  2IDL A;  2BAB A;  3ELH A;  2CA9 A;  2XI2 A;  2B8Q A;  3OTO J;  2CYY A;  4C98 A;  1YVF A;  2DGQ A;  1F5C A;  3D9B A;  1P8G A;  2WAQ D;  3THV A;  4ECT A;  3J81 U;  2HMI A;  2NYH A;  4YHH F;  3JAM U;  4KHM A;  4GVL A;  2RU9 A;  3SSS A;  4NLR A;  4DFP A;  4L3N A;  1VBX A;  1NZA A;  2RQK A;  4X4P A;  1N32 J;  3PJ9 A;  3WIU A;  5KFR A;  4YFU A;  3DN9 A;  1VRT B;  4NXN F;  2VL1 A;  5GME A;  4HI1 A;  1I6J A;  1JLE A;  4GVB B;  2ZE2 A;  2LA6 A;  4CLS A;  3M2R B;  1YJR A;  1RAD B;  1XK8 A;  3SCK E;  4C11 A;  4CLY A;  2FZG B;  4YB6 A;  3M8W A;  4B3O B;  3V6J A;  3H5S A;  5J2M A;  4OI6 A;  4OYZ A;  3SQG A;  2QMU B;  4A8S A;  3BEG B;  1T94 A;  3OL9 A;  4J9R A;  3SV4 A;  2RS8 A;  2N7Y A;  1BWV A;  4AND A;  3BGL A;  5CHC B;  3MFI A;  4JI4 F;  1ZM3 A;  2J0W A;  3A3P B;  4NI2 A;  2CVE A;  3ULH A;  3ZZT A;  3PW2 A;  4DQR A;  1V3S A;  1FRL A;  4MK8 A;  1F3V A;  4HL9 A;  3KHG A;  5L8R C;  1FF2 A;  3G86 A;  4YB7 A;  2BUN A;  4I2Q B;  2JH3 A;  3D0G E;  3PR5 B;  3MCN A;  4AUK A;  4A48 A;  1REG X;  3FCW A;  3Q8Q B;  4WU2 A;  5I3U B;  2QLF B;  2BE2 A;  2CG8 A;  4YUD A;  1TMJ A;  4ZPB A;  2J9E A;  4JI3 F;  4NXM F;  3GV5 B;  2IIH A;  3TVY A;  2NR0 A;  2X51 A;  1UVK A;  3FFI B;  1JLA B;  4DX7 A;  2AZ1 A;  1HNX J;  1WDD A;  4FBT A;  3EVW A;  2UP1 A;  1J5E J;  1FKO B;  4O4G B;  3CIM A;  1FWK A;  1VLO A;  3TA1 A;  2MLX A;  1O0P A;  1RBO B;  5D4L A;  1AFJ A;  3PY8 A;  3FK4 A;  3HLU A;  2ROE A;  4ECW A;  2AJF E;  2MQP A;  3KDN A;  1KVJ A;  3TQ1 A;  3K7R A;  2ZNZ A;  2KHD A;  1SIZ A;  1PAU B;  2IHR 1;  5I42 A;  4DS4 A;  3OQ2 A;  1XMQ F;  3IRX A;  2GJ2 A;  3MDF A;  4GC7 A;  1SH0 A;  2IAJ A;  3AJD A;  2AD9 A;  2A10 A;  3V2U C;  5F8G A;  1VC5 A;  1GT8 A;  2WVB A;  3D3B J;  3C14 B;  1EIY B;  4X64 F;  3MR2 A;  3CNQ P;  2BQR A;  3H4B A;  2XCP A;  3A12 A;  2HWH A;  2K3K A;  1S76 D;  4UOH A;  4PQA A;  3BQ1 A;  2OPQ B;  3NGT A;  2H54 B;  1VI7 A;  1U48 A;  4ES2 A;  4JV5 J;  1VBY A;  3UN3 A;  4LF5 F;  5L1J A;  4Q8E A;  1SUQ A;  3KK2 A;  4LSL A;  4ZPD A;  2CQ4 A;  4JI7 F;  1NLK L;  2DR8 A;  4QIE A;  5HBM B;  1RT3 B;  2QLB B;  3C15 A;  2FYX A;  4WTY A;  3M2U A;  4YOE A;  2O67 A;  2LXF A;  3IC1 A;  5M2R A;  5HLF B;  1U25 A;  2CDQ A;  4QOT A;  1SJQ A;  4RUC A;  1VBZ A;  3FMB A;  2GJI A;  3LW5 C;  2FLP A;  4H4O B;  4Y3C A;  2U2F A;  2JHE A;  2JOQ A;  2VIH A;  2D3Z A;  2F65 A;  3LGM A;  4O23 A;  2QL9 B;  1FDB A;  2G2Z A;  2UUW A;  5KFS A;  1DRZ A;  4F4K A;  3W62 A;  2PII A;  1QUV A;  3OSN A;  1EKR A;  3E2E A;  3W66 A;  5KT3 A;  2LVW A;  2MQ8 A;  3EPG A;  1S6Q A;  3NG8 A;  2VQE F;  1JKH B;  1PYS B;  3LWL A;  4J9O A;  2EKN A;  4HVZ A;  4RNH A;  4G1Q B;  4CLL A;  4QR1 A;  4WZM A;  3G6V A;  1SIW B;  1C1C B;  3C19 A;  5KFC A;  2EXU A;  4EMD A;  1HBM B;  5HRO A;  2AW0 A;  3N6M A;  2NZ4 A;  1GTH A;  1VQ8 S;  2XMT A;  5F8N A;  2HFV A;  2IBO A;  4ICL B;  3NS7 B;  4UZB A;  5LM7 E;  3EXY A;  2BJ9 A;  1N5Q A;  2GVZ A;  4TY9 A;  2R7O A;  2JEI A;  2XI3 A;  1U6F A;  4DR3 J;  5DQG A;  3R5G A;  3KHL A;  2LQ8 A;  4KJI A;  1UPM B;  1S1V B;  2B51 A;  2QTW A;  4Y0F A;  3PR4 A;  1CPZ A;  4L76 A;  3CJT A;  4C2M A;  1D9F A;  4LQ9 A;  3HXM A;  1H0H B;  2ABY A;  3CJK A;  3IS9 B;  4YR3 A;  3OPK A;  2QV6 A;  2EVZ A;  1FKP B;  2J0S D;  2OHD A;  3D3C J;  1I51 B;  1K1Q A;  4W98 A;  1WOR A;  3QIP A;  2HYI B;  1KQS R;  1S6P B;  3TVK A;  2XG8 A;  3K89 A;  1SBR A;  1BLU A;  3TEG A;  3TNV A;  2DK2 A;  4F26 A;  4I68 A;  2HQ3 A;  2HWI A;  1T9X A;  2K3I A;  3POT A;  4CCH A;  2C3O A;  3TAQ A;  2QMW A;  5AJ3 F;  1ZM2 A;  4C0O C;  1M1K T;  4DQS A;  2JEJ A;  5A0Y B;  4FKX A;  1QVG R;  3QO9 A;  4RWW A;  3N5B A;  1YSJ A;  1RKJ A;  4PKD B;  5HI7 A;  4YB1 P;  4NYZ A;  5CAA A;  3FNN A;  4NLV A;  4XTT A;  1FRX A;  1OPZ A;  2MZT A;  4DV6 J;  3CO0 P;  1WEY A;  1EZZ B;  4YME A;  3PRV A;  2VG6 A;  1N56 A;  2MSS A;  4DV4 F;  1PG5 B;  5EUH A;  4DFK A;  4ZHR A;  2CZV C;  1BQM B;  1H74 A;  2OFG X;  2HHH F;  3BBC A;  4LF6 F;  3BO2 A;  2HGL A;  3GE9 A;  2H48 B;  4WU3 A;  3TAM B;  3EXC X;  1W26 A;  3EIC A;  1YX2 A;  4ZKA A;  1HQU A;  2ZEJ A;  1SH2 A;  3EVM A;  4LUB A;  3I9V 9;  1CBK A;  1RT7 A;  4UTG A;  1OO0 B;  2J9D A;  4CLF A;  2CKW A;  2I1R A;  2F5G A;  2FD2 A;  3H8Y A;  4DSL A;  1TVR A;  2DPJ A;  2DXF A;  2DNG A;  2GQ2 A;  1XNR F;  4HHJ A;  2ZKT A;  2UXD J;  3MM8 B;  1DZ5 A;  3MWB A;  1TKZ A;  2VH7 A;  3TWZ A;  1JNR B;  1AW0 A;  5E7O B;  3SSR A;  2Q66 A;  2XLJ A;  3CJ0 A;  3TVZ A;  5KFN A;  2E7V A;  2DGX A;  1CJV B;  1XQI A;  5E3R A;  4W90 B;  2E1A A;  1PGZ A;  4JOU A;  5EWG A;  3WBZ A;  2EEY A;  2HNZ A;  2ZH6 A;  4Y2K A;  1N34 J;  3IG1 B;  1OWX A;  4BC9 A;  1VQ9 S;  2ZBI A;  3VGU A;  4ZN1 A;  3KWM A;  4MFB A;  2A6M A;  3AD8 C;  3TW0 A;  4FXD A;  4TYA A;  1SJ1 A;  2BW2 A;  2GGP A;  3OLA A;  4DR4 F;  1U49 A;  4DX8 H;  3M8S A;  2AGQ A;  1WSR A;  4DJB A;  3AOC A;  4DR5 F;  4RU9 A;  1JLF A;  2OSR A;  4PUO A;  1TKT B;  3N6L A;  2GML A;  3M6U A;  3OXG A;  4RW9 B;  1C0T A;  1C2P A;  2AEM A;  1VBK A;  4ED3 A;  1HI1 A;  4USM A;  4C3L A;  3Q2S C;  1BWE A;  1EX8 A;  3BBB A;  1UEK A;  4Q8F A;  5FLX Y;  3OJU A;  1D1U A;  1XEZ A;  3MTK A;  4URS A;  1F2H A;  4HT7 A;  1RU2 A;  1GMW D;  2CJY B;  5A8R A;  1WOS A;  1S7I A;  4Y6I A;  1MMN A;  2XUL A;  1IKY A;  4ED7 A;  4OYA A;  4DPY A;  3A4T A;  4DSE A;  1IKV A;  4ZVT B;  5IZH A;  1F3F A;  3HHL C;  2WB1 D;  4WZQ A;  4B3M J;  4RR5 A;  1GXT A;  1DTT B;  4CH1 A;  2CNL B;  2XMJ A;  1QSS A;  4NA1 A;  1S1W B;  4J9P A;  4O3N A;  1TFY A;  1XIQ A;  1HLW A;  1KON A;  3OD2 A;  1S57 A;  4DXL A;  2LDI A;  1TL1 A;  1RWN B;  3GG1 A;  1U0H B;  5HVG A;  2C2K B;  5KFA A;  2R2R A;  2B9W A;  3C2P A;  2WVD A;  2HHW A;  4OX6 A;  2VIC A;  3IBW A;  2EKY A;  1XNQ F;  2JJ4 D;  1UMJ A;  4PPD A;  3J81 Y;  1UJ5 A;  2FC8 A;  4DL0 C;  5DQH A;  2BKO A;  4C8M A;  3JAM Y;  1EAY C;  3R5D A;  4ED4 A;  1U1Q A;  4NCG A;  4YY3 F;  1YJN S;  3HHD A;  3SFG A;  3IA0 A;  4LF7 J;  1ZA2 B;  1F0X A;  2FY8 A;  3J7Y U;  1ZM9 A;  5SUH A;  1M5S A;  4QYZ J;  1PJ5 A;  5D4N A;  3QRP A;  3T5L A;  3OV7 A;  3RAX A;  4RUA A;  1TK0 A;  5HMY A;  4NZ0 A;  3PEH A;  4WFX A;  4QIG A;  3NMR A;  4RNM A;  1KHV A;  2RIJ A;  2NRE A;  4JI1 F;  3WX8 A;  2DHG A;  4PRF A;  4DS5 A;  1FA0 A;  4ECS A;  4DL7 A;  1G7C B;  1ZPW X;  1I94 J;  2BQU A;  1WEX A;  2KT2 A;  1IN0 A;  4A8F A;  3R9L A;  4WP8 A;  1C4A A;  3BYR A;  2ZBR A;  3GSD A;  2P6T A;  2W7O A;  2UVW A;  1UJ4 A;  1HHQ A;  1FJG J;  3M05 A;  2DH8 A;  1VIS A;  4IG0 B;  1GXL A;  4ETZ A;  2B43 A;  3P49 B;  1DBD A;  3EGV A;  1G1X A;  3QYY A;  1AYE A;  2HLT A;  4UZC A;  5C25 A;  2PA8 D;  5F41 A;  1CJU A;  1DFD A;  3QGP A;  2XYH B;  4OV1 A;  3OW2 R;  1QAX A;  1RIS A;  3MM9 B;  3KMS A;  4DCP B;  3MR3 A;  3OR1 A;  3LF0 A;  4NML A;  2MHE A;  2ROP A;  3HT0 A;  4A8X A;  2EFN A;  4HTJ A;  1TL7 A;  3HUL A;  4C8N A;  4XK8 C;  3ZO7 A;  3C6T B;  3H40 A;  2JFK A;  2DXD A;  3MCS A;  4HAC B;  4U8V A;  5K20 B;  5U47 A;  4CIO A;  1XR7 A;  4CP5 A;  1D8Y A;  1NK7 A;  1RGV A;  3NKY A;  4B9M A;  3CDB A;  4ZCM A;  1VIX A;  2K1R B;  1H72 C;  1N0U A;  3ZXW A;  3MED B;  4DUY F;  3MR5 A;  3NL0 A;  5F0U A;  3I87 A;  2XY6 A;  1MRO B;  2VPZ B;  2N7C A;  1Q8I A;  1WI8 A;  1S0O A;  5J2N B;  2VFT A;  2YKM B;  3K2Y A;  2CQ0 A;  3L7U A;  1T3O A;  1S4E A;  5FD1 A;  2HRY A;  2YNF A;  3BS9 A;  3MEC A;  3WIV A;  2WHO A;  3N79 A;  3R27 A;  3QAE A;  5B7W A;  2YWW A;  2M8D B;  1WF0 A;  2VOO A;  1T9U A;  1RAC B;  4C0B A;  4DUY J;  1IBL J;  4MKY A;  3MAA B;  2JEG A;  4OHX A;  3LWM A;  4ZDN A;  3GYG A;  5HO4 A;  1HWI A;  5AE1 A;  2W9B B;  2JVO A;  1CEZ A;  3HM9 A;  4Q43 A;  4NEY A;  1R31 A;  5HK4 A;  3MMB B;  4LFC F;  1O51 A;  2F40 A;  4NLU A;  3Q8S B;  2ZJP Q;  3VHQ A;  2M52 A;  1NPR A;  1GK8 A;  1LXJ A;  3QAU A;  2ACY A;  2V68 A;  2V50 A;  4BHQ A;  1AB8 A;  1T7P A;  1L3U A;  1X4E A;  1AFI A;  4YDX A;  4URG A;  1KQG B;  2OP5 A;  2ZJQ Q;  2E1C A;  3PZP A;  4DSK A;  3G87 A;  3IWL A;  2R2U A;  3DM2 A;  3M9N B;  2M88 A;  4LF8 J;  4OZ2 A;  2MZJ A;  1B7Y B;  3DCA A;  4KHP J;  2R7X A;  1RTJ B;  3I55 S;  3SSQ A;  2CZ4 A;  2J7W A;  4OLO A;  3PM9 A;  1UKU A;  1T0T V;  2ZVS A;  2B56 A;  5SZT A;  1LWX A;  2N4C A;  3GJT B;  4F4Z A;  3PEJ A;  2AJ2 A;  3J7A 1;  3B6B A;  1V5I B;  1Q5Y A;  1PJ7 A;  2GQQ A;  4RKU C;  2KJW A;  4IQM A;  2UUA F;  4FNI A;  5EX0 A;  4B9N A;  6FD1 A;  5A6W A;  3JQJ A;  2FJA B;  1RHK B;  1SV5 B;  4OI2 A;  4H4K C;  3S6E A;  4I1T A;  3MGJ A;  2V4J A;  4ES1 A;  3LGN A;  4Q0B A;  1XER A;  4HYK A;  3GR1 A;  4ANE A;  2LQB A;  3W2V B;  1NHU A;  1RWM B;  3T1H J;  1X5S A;  4PYD A;  1QAY A;  4KKO A;  4K50 A;  4F36 A;  2G0I A;  2WSF C;  1RWV B;  2P9C A;  4CO5 A;  3CCJ S;  4FPR A;  1KP6 A;  2BAN B;  4KGX B;  2QA2 A;  4EGL A;  4IRK A;  9RUB A;  1TL4 A;  3GMG A;  3MAH A;  1QUP A;  2MLY A;  1KLM B;  3PIP Q;  2RKI A;  4XO0 A;  4ZCK A;  4OI4 A;  4WPA A;  3CDU A;  2O66 A;  1ROF A;  1NXI A;  1LQ9 A;  4OV6 A;  3V4I B;  3C46 A;  2A18 A;  4M5I A;  1RT2 B;  3F41 A;  4PPZ A;  3MPW A;  4DR2 J;  2LMI A;  4LIW A;  3GFY A;  2VZ9 A;  4O0N A;  4LQ3 A;  3P3D A;  3VZH A;  1JIH A;  1PBU A;  1HR0 J;  1VRU A;  5KFL A;  3R8Y A;  3QGI A;  3HKZ D;  2GHP A;  1DHM A;  1A7G E;  3KNG A;  2I5J A;  1XMO J;  2CJQ A;  4AE5 A;  4A46 A;  1Y11 A;  4X2B A;  3G6Y A;  2HZC A;  1L3V A;  3W3S A;  4NPO A;  2WSC C;  3JTO A;  3SDE A;  3O1L A;  3SQO P;  2MEW A;  1JLB A;  4F0K A;  2BRK A;  1IQT A;  4DCO B;  1KNZ A;  3MZI A;  1F9F A;  1BQX A;  5J2P B;  3DDN A;  1RTD B;  4H4K A;  4RWX A;  4WWS A;  1O6X A;  2ERR A;  3DU6 A;  1F9E B;  4HH1 A;  4C8O A;  3S7R A;  2F4V J;  5ETR A;  4ER8 A;  3T5K A;  4KGZ B;  3L4B C;  1M1H A;  3R2D J;  3R97 A;  3D1O A;  5KFQ A;  2KJV A;  2HMI B;  2HZA A;  4ZPC A;  3AHP A;  1QD1 A;  9ATC B;  4CQ1 A;  4F2R A;  2I38 A;  4XAK A;  2C3Y A;  1S59 A;  4B3S J;  5KT4 A;  3DYA A;  5E3P A;  2UUT A;  3G8Q A;  3SCI E;  8AT1 B;  3OFH A;  1HNZ F;  3PYG A;  3OLB A;  1JWW A;  2MY8 A;  5C24 A;  4IRC A;  4ETX A;  4JV1 A;  3MM6 B;  1DQ8 A;  4ED5 A;  1JB0 C;  2LDY A;  1JLE B;  2MKC A;  3VAF A;  4DL4 A;  1SC1 B;  2ZE2 B;  5GAG I;  3LQV A;  1JXV A;  4WP3 A;  4LRF A;  4EO8 A;  5IS2 A;  4C11 B;  1ZZF A;  1K0T A;  1TL5 A;  1UFK A;  3CTR A;  2QN6 B;  2PEH A;  3CJR A;  5BYR A;  5J2M B;  2EWH A;  1T9Y A;  3SQG B;  2DRA A;  1TEL A;  1QVF R;  2V4R A;  2H65 B;  3M2R A;  1GAO A;  4DX6 A;  3OL7 A;  3M6W A;  4F67 A;  1UFW A;  5FII A;  4KY3 A;  3AB4 B;  3QRQ A;  1FD2 A;  2E5G A;  4IH7 A;  3LA0 A;  1JLG A;  2ZHO A;  2OEJ A;  4LVN P;  1VJQ A;  2I2Y A;  2Y1L B;  1T95 A;  1FTR A;  4YR0 A;  1FNO A;  1U1M A;  3H5U A;  1LW2 A;  5CAB A;  4QU7 A;  2ZKU A;  1F60 B;  4LF4 J;  3LTO A;  2BZ2 A;  4QU6 A;  1QDU B;  3P45 B;  2BE2 B;  3ISN C;  3G82 A;  2GFF A;  2UU9 J;  3AOB A;  3BGU A;  2RE1 A;  3RB0 A;  5JJB A;  3MTJ A;  3N0V A;  2E5L J;  1J5O B;  1NB2 A;  3UN2 A;  4YN3 B;  3EGZ A;  2AV5 A;  2DEJ A;  3KJV A;  1NKC A;  4DQP A;  1FWP A;  3MUR P;  1PIL A;  5F8I A;  4OJG A;  3PG9 A;  3GG0 A;  4N8N A;  1NZ8 A;  4X66 J;  4LSZ B;  4KTQ A;  1VQ6 S;  1UWB A;  2V8V A;  4I0W A;  3VR1 A;  2J8A A;  3H2L A;  3HFZ B;  4DBQ A;  2AZ3 A;  3CC2 S;  3CJ3 A;  3DHX A;  3ILJ A;  1RWU A;  3EZ5 A;  1X4D A;  2XCA A;  3MR6 A;  4ZLJ A;  5I42 B;  3B4D A;  3IRX B;  2DGU A;  5KG4 A;  2ZDO A;  2VJU A;  4UST A;  2FC9 A;  1RUS A;  4EBC A;  1WG1 A;  2NXC A;  4QPX A;  3CMA S;  2OEM A;  3HMJ G;  2BE9 B;  1D0E A;  2B7B B;  4J37 A;  3GV7 B;  4AXI A;  3EX7 B;  3LP2 B;  2XYP B;  2CQG A;  3NGU A;  1KFD A;  3QJJ A;  3HVA A;  3G71 S;  4GO5 X;  1NSK L;  2X1A A;  3A8K A;  3K5P A;  2KFY A;  3FCH A;  4UT4 A;  1VQL S;  1NAQ A;  4AQY F;  1UZD A;  1SUQ B;  3KK2 B;  4LSL B;  3EDR B;  2KYX A;  4C8L A;  5GMD A;  3MPD A;  4FF3 A;  3C15 B;  2OPQ A;  4EBD A;  1IR2 A;  4ZLL A;  2GS8 A;  2ZJR Q;  4K4X A;  4JI6 J;  3WC2 A;  4EYI B;  3AB2 B;  2IA0 A;  3CT9 A;  3PRB A;  3BSN A;  1YHQ S;  3ENA A;  2B9Y A;  1RT3 A;  5HBM A;  4W4M A;  2YPZ A;  3D4J A;  3EE3 A;  2VQF J;  3E3X A;  4TQS A;  2A1B A;  1N54 B;  3GIL A;  2FVP A;  1LFP A;  3CJ5 A;  2DHS A;  1XN9 A;  3BH7 B;  3KHR A;  2DNL A;  4EZ9 A;  2UUC F;  5GAH I;  4V19 X;  2ZWO A;  2W25 A;  2QA1 A;  1JXL A;  4TU9 A;  1MWQ A;  1NDL A;  2YKO A;  4IFY B;  3KHH A;  1S7H A;  2Y0B B;  2NXU A;  4JV2 A;  4LF2 A;  5GAE I;  5L9X A;  1R8H A;  4J5O A;  2MKK A;  2A2C A;  3KLI B;  3LGH A;  1Q81 T;  4DR7 J;  2IM1 A;  2RNE A;  3H25 A;  3EVO A;  2BM0 A;  1WWH A;  3O3L A;  2D1C A;  4LJM A;  5HMW A;  1SKW A;  2G0J A;  5DGB A;  2XC9 A;  1HD1 A;  4HEA 9;  2IM2 A;  2C2O B;  2B4U A;  3QZ7 A;  4HDG A;  4LF9 J;  2X1F A;  3WHI A;  2AEJ A;  2J7U A;  3MD3 A;  1VQK S;  1X5T A;  4G6V B;  1FVQ A;  4JI2 J;  4LRA A;  2OUG A;  2RD5 C;  5LXR A;  5C7P A;  4DV7 J;  5HAT A;  1KLN A;  2QGF B;  1KQK A;  4F3O A;  4G3I A;  2AYE A;  2C2Z B;  2MQN A;  5KT6 A;  3M8R A;  2W9C A;  2HK2 A;  3TA2 A;  7FD1 A;  1VK8 A;  4CM0 A;  1RSC A;  2FHK A;  1X9S A;  2V6A A;  3TJA A;  4ICL A;  3I4H X;  4OL8 A;  2D9P A;  1VQM S;  3PKY A;  3HHK A;  3TZX A;  1H2V Z;  3CJK B;  1S97 A;  1BXN A;  1NSP A;  1JK9 B;  4LVO P;  2GAH C;  3J7Z 5;  2J7K A;  4NE9 C;  4FYV B;  2MMY A;  2EG2 A;  1S79 A;  4GKK J;  3QIP B;  2DB1 A;  1LWC A;  4EK2 A;  1RT4 B;  2HVE A;  4DF4 A;  1RB0 A;  4OX9 F;  2DEI A;  2B8P A;  3W1Y C;  2P2C B;  4JBC A;  2JDJ A;  2BJ3 A;  3QPI A;  4KGV B;  2XMV A;  3AOD A;  3IAM 9;  4YP3 A;  3POT B;  4HLB A;  4WF9 Q;  4ECV A;  2MGZ B;  1FRJ A;  1S6P A;  3GYN A;  2RSQ A;  3HVT A;  3GP9 A;  4DQI A;  3K58 A;  3FEY B;  5I3Q A;  1EQ0 A;  1ZM4 A;  2IPO B;  2F9D A;  2E29 A;  3HHL D;  1IBM F;  1FXL A;  3H7H B;  2KB2 A;  3A13 A;  5THW A;  3QO9 B;  3VAL A;  3W5X A;  5IV3 A;  4CNY A;  2BJ8 A;  3D5M A;  3D68 A;  3I4P A;  3HK2 A;  1TAQ A;  1XC9 A;  2R7W A;  2R3V A;  6AT1 B;  1TL3 B;  3OT9 A;  4TN2 A;  1V5V A;  4OJH A;  1T3N A;  1RJJ A;  4DN0 A;  4JP8 A;  1WC3 A;  3M1V A;  2VFS A;  4YS2 A;  3CD0 A;  1U8W A;  1S5Z A;  1Z2L A;  5D0G A;  2L9W A;  2M70 A;  3G2X A;  2LEB A;  4ZHR B;  5KFD A;  2C3U A;  4JI0 J;  1H3D A;  2X3D A;  5G0R A;  3I5C A;  2R7U A;  1VJW A;  1CS4 B;  4AL5 A;  4ZPV R;  1NM2 A;  1ZAV A;  2HZV A;  2HIQ A;  1CC8 A;  2JWN A;  3UQS A;  1RT7 B;  1MU2 A;  5LMU F;  4G1I A;  4F25 A;  1UEU A;  5D4O A;  3TAM A;  1TVR B;  2AMC B;  5DM7 Q;  2Z2Y B;  2XTJ P;  4GMK A;  4G65 A;  2CPZ A;  5ETO A;  5D15 A;  1N36 F;  2YX1 A;  5BR8 F;  1TKZ B;  1WF1 A;  4B3R F;  4I67 A;  2ASL A;  2E44 A;  2G4B A;  3QSI A;  5DJB A;  5K8N A;  2W7A A;  2ZVI A;  3GU0 A;  1S9E A;  3SBM A;  2WW4 A;  1U4B A;  1OMS A;  4PZV A;  1F6T A;  1WHW A;  3T9Z A;  2D3O R;  1CVJ A;  1KC8 T;  3OHA A;  4URQ U;  1FE0 A;  4FP9 A;  4ENO A;  3KG1 A;  1K1S A;  2HNZ B;  4CZC A;  4FF1 A;  1W7W A;  1JXE A;  2RAQ A;  4NLG A;  2HRT A;  3BB5 A;  4JI8 F;  5KFV A;  2ATC B;  1KTV A;  2HQG A;  4JV0 A;  1NCL A;  1R6V A;  4MFB B;  3I5B A;  4QWA A;  4LBH A;  2AJ1 A;  2GGP B;  1NUE A;  3IG1 A;  4CLU A;  2IY5 B;  1WSV A;  2L41 A;  3FMW A;  3TQE A;  3TR5 A;  5DS7 A;  1FJC A;  1JLF B;  4A8O A;  3I96 A;  4PUO B;  3AT1 B;  3BKU A;  1RZM A;  3RTV A;  2F4F A;  4DV1 J;  3M9O B;  1C0T B;  2LU1 A;  3EZO A;  2BA9 A;  1U2F A;  2W2Q P;  4JYA F;  4DCJ B;  5ETP A;  3PAC A;  2UUB F;  4QBU A;  4FDF A;  5IWA F;  5GMK a;  2AJ4 A;  4ED6 A;  4DOZ A;  4F3Q A;  4W92 B;  2DNN A;  3VAK A;  3IMQ J;  4RW9 A;  3VVT A;  2K2P A;  1X4G A;  4GRS A;  3HPO A;  2IM0 A;  2M0G B;  3I9Z A;  1ITP A;  4QJV A;  4IUF A;  1M1G A;  2GIQ A;  5HN0 A;  4RBT A;  3A3N B;  2FJD B;  1IKY B;  5C2C A;  3GSI A;  4X65 J;  4PG7 A;  2QIF A;  1IKV B;  1YZ6 A;  3O2I A;  1WKL A;  4RW4 A;  1PAE X;  2LP4 A;  3BH6 B;  1PCA A;  2VD3 A;  2OMO A;  1HPZ A;  5AXK A;  2MZS A;  1PC4 A;  4U7U D;  3T9N A;  3IR7 B;  5L1K A;  4YQW A;  5L39 A;  3H98 A;  1HL6 A;  2H5E A;  4FF2 A;  1TL1 B;  3HP6 A;  2CPH A;  1S1W A;  3OTC A;  4ZVE A;  2VBW A;  1YQH A;  3MM5 A;  2G1H A;  2HHT A;  2B9E A;  3KLV A;  2XMA A;  4NCG B;  4IOC Q;  4EYH B;  2GV1 A;  5HL7 Q;  3W64 A;  2P6S A;  2QYC A;  4DLG A;  1UA1 A;  2J0X A;  3ADA C;  3H2V E;  3TEH B;  2HEK A;  4FNH A;  3Q8P B;  1NO8 A;  3W7B A;  3IBF B;  1UCN A;  2EI5 A;  2RDD A;  2XMW A;  1P9Y A;  3GIM A;  5B08 A;  1H98 A;  3Q23 A;  2HFZ A;  2ZOF A;  4KYZ A;  1IQZ A;  2AP6 A;  4ECY A;  3P8B B;  5GAD I;  1X8D A;  2C2E A;  3EMT A;  1G3O A;  2VDH A;  3PYE A;  4Q2L A;  4ITS A;  4PQU B;  3P5T L;  3UVJ A;  4RNN A;  3MHY A;  1HMV B;  3N5F A;  3SEO A;  4K4Y A;  1HWU A;  1VK3 A;  3FSX A;  5E33 A;  4QIV A;  3UI3 A;  1RT1 B;  1FK9 A;  2YX7 A;  2WW8 A;  3H59 A;  3CCZ A;  4K4S A;  3DOK B;  1H2T Z;  4ID5 B;  4K4Z A;  4LR7 A;  4OYX A;  3FCV A;  3U1L A;  1D9D A;  3SI8 A;  4USI A;  4C97 A;  4LRE A;  1KTQ A;  1R27 B;  1Y3K A;  3C66 A;  2Q6B A;  4NLW A;  3VVU A;  2E5H A;  4K59 A;  1HW8 A;  4U9R A;  2NYI A;  2R7S A;  1IBK J;  1U47 A;  5C25 B;  1Y5L B;  1CJU B;  4CLZ A;  5DGA A;  4WJB A;  2H4Y B;  1QAI A;  1CQM A;  3OR1 B;  4NMX A;  2DHX A;  1TL7 B;  3OVB A;  1K8A T;  2EFV A;  3R5C A;  1N33 F;  3THP A;  5KG0 A;  4DUZ F;  3BV8 A;  3W5Z A;  1PBA A;  2PE8 A;  2R2T A;  4M5D A;  3CE8 A;  5KG2 A;  2UXB F;  2YNI A;  3UR3 C;  1VQS A;  1C0U B;  3TP2 A;  3NGD A;  4UOF A;  3Q22 A;  2HKE A;  1NEE A;  4X4O A;  3LP0 B;  3HF5 A;  3MXH P;  2CPY A;  5IV4 A;  2C2M B;  2XY7 A;  4B9V A;  5DG9 A;  1F9H A;  2RUG A;  4FS1 A;  1KKH A;  5KG5 A;  3ETO A;  5LMN J;  1N33 J;  2PT0 A;  2YNF B;  4DUZ J;  3MEC B;  4LIR A;  2KG0 A;  3JQM A;  4LBP A;  1SCJ B;  4TY8 A;  5DZ6 A;  2B7C B;  4KE5 A;  4ZPW R;  5DDQ C;  4DF8 A;  2W8L A;  4NLO A;  5J2N A;  2YKM A;  3CWJ A;  1VRQ C;  2JLG A;  3FVY A;  4PAB A;  1ULR A;  3CCE S;  1SJF A;  2BMB A;  4USV A;  1MG7 A;  3K5L A;  5H9F J;  1EKS A;  1YRX A;  4BDP A;  4LFB J;  2PDA A;  4AD6 A;  3GON A;  2V8G A;  2FGC A;  4MK9 A;  2XWX A;  3TRG A;  3MAA A;  3SCJ E;  5LJ5 Y;  1VDH A;  3DLE B;  2R8I A;  3UWT A;  5EDW A;  1NK0 A;  4PAA A;  3FEZ A;  4DSF A;  3JXO A;  4M5N A;  4I2P A;  1WKK A;  1GTE A;  1T05 A;  1JJC B;  1I3O B;  5K8M A;  2N4D A;  3M8Z A;  5E41 A;  4FXW A;  3DM2 B;  3L7O A;  1B7F A;  1TUW A;  3ZTO A;  2YH1 A;  1IWG A;  1HIY A;  4X62 J;  3J7Z T;  3H4D A;  1U1O A;  3EWG A;  4KV8 B;  2DY1 A;  4AFF A;  3US5 A;  5J1N A;  2ZC3 A;  2V2Q A;  5IM0 B;  2JSX A;  4OLP A;  2UXC F;  3KK3 A;  2LXI A;  2Q3P A;  1U2C A;  1Y00 A;  3PX0 A;  2E1P A;  1GFW B;  3M4X A;  1HNV A;  1P27 B;  3J81 j;  2F8H A;  1QM9 A;  2U1A A;  5HQ8 A;  5CA5 A;  2AKW B;  2PI4 A;  2H5J B;  2YXL A;  4FPI A;  2MYF A;  1HHS A;  1PJ6 A;  3T1Y J;  3HFV A;  5E0O A;  2V4J B;  4Q0B B;  1DLO B;  2FUG 9;  4MYT A;  3RU0 A;  4YEA A;  1HBO A;  3B78 A;  1P9Q C;  4GKJ J;  2RT3 A;  2P8I A;  4ZPT R;  3KJF B;  4DV5 F;  2GCF A;  3PYF A;  4KKO B;  3FUY A;  5IQQ A;  4N77 A;  3QMQ A;  1GNK A;  2FJX A;  1YJT A;  2ZFH A;  4PR6 A;  2GAG C;  4P2F A;  2VFV A;  3KLH B;  1Y7P A;  1Q1K A;  1U02 A;  1Q78 A;  1FVS A;  1S99 A;  2CWK A;  3RRG A;  4K2J A;  2W24 A;  4DPO A;  3GJR B;  2CQD A;  2OI2 A;  4ALZ A;  2HHQ A;  2OAU A;  4WCE Q;  5DDP C;  5KFF A;  4IDK B;  4OHV A;  2WVC A;  1SI9 A;  3MUM P;  1KLM A;  3IBC B;  4U96 A;  4U7C A;  3C16 A;  3QSY B;  1FXR A;  4MAK A;  2L9N A;  3F44 A;  3V4I A;  4N76 A;  2AWZ A;  2R7V A;  4DV2 F;  2DHH A;  2CJK A;  2LKZ A;  4DPT A;  2DR9 A;  2IFX A;  1QSY A;  4QIW D;  1U0S A;  4A47 A;  2CQB A;  3P96 A;  3SMZ A;  4LF1 A;  3GQC A;  2OPR A;  3VTI A;  4N56 A;  1UW9 A;  1N48 A;  3SDE B;  4K0K F;  1YTY A;  2L9D A;  3I0S A;  3OTO F;  2L08 A;  2XYG B;  1DAR A;  4NEZ A;  4C8Y A;  3RBX A;  3O5T B;  2MKH A;  1QE1 B;  4PXE A;  2V8P A;  3VAJ A;  2V2K A;  1FXD A;  2R9L A;  3PW0 A;  3MF5 A;  3CW2 C;  3HZG A;  1Q53 A;  1NU4 A;  3M8Y A;  2JEF A;  1G4C A;  5J2P A;  4CTA A;  1L3S A;  2X3G A;  1N32 F;  4ATN A;  5D77 A;  4KAI A;  3CJ4 A;  1O8B A;  2E1R A;  5IT9 Y;  1M5P C;  2FJW A;  2C2D A;  3VGT A;  5L9N A;  3KDO A;  3M30 A;  2RRB A;  2ACM A;  2XO7 A;  1YK9 A;  3O6Q A;  2KZM A;  3CC4 S;  3DYA B;  1ZH5 A;  4NLS A;  1KHW A;  2QSF A;  1WF2 A;  4KH1 B;  5C24 B;  1BE4 A;  1PYO B;  5K9F A;  2MPU A;  1U1N A;  3C3L A;  3OFE A;  2Y1R I;  2I6W A;  4ZIW A;  1WG5 A;  1UVN A;  2AGP A;  1HFE L;  3MFH A;  4EBE A;  4N41 A;  3U27 A;  1NHK L;  4WK1 A;  3MM6 A;  2KU7 A;  5DZ7 A;  3HO1 A;  1NRK A;  4F4Y A;  3GB0 A;  5A2Q U;  4FYX B;  3QZ8 A;  3OFG A;  1V3Z A;  2G2Y A;  1VQ4 S;  1BC6 A;  4KGM A;  1SL0 A;  3SZ2 A;  1I1G A;  3W8P A;  1JLG B;  2OSQ A;  4RLE A;  1UVL A;  4WKY A;  4PEO A;  3KJQ B;  1RYR A;  4FVC A;  1R8B A;  2D3U A;  2B6A B;  3DI6 A;  1CJT B;  1LW2 B;  4WTO B;  4L72 B;  5AXL A;  3QAT A;  4USW A;  3BO3 A;  3DLB A;  1HBU A;  2XMK A;  2K7J A;  3G82 B;  4OQJ A;  2Z0G A;  2OD6 A;  3HFK A;  1HNX F;  2RQ4 A;  1J5E F;  1T03 A;  2UV8 G;  1FT8 A;  2FZC B;  3VCD A;  4U7U K;  5KFB A;  3KJV B;  2KO1 A;  2FLO A;  4IFV A;  1AZS A;  3RUB L;  2KM8 B;  3DLK A;  2IRY A;  2X1G A;  3RBE A;  1IKX A;  2GJF A;  3RBZ A;  5LOQ A;  4Q44 A;  4C6A A;  2LA4 A;  1J5O A;  2GMJ A;  2DGO A;  1K0V A;  1UWB B;  2BAC A;  4KO0 B;  2AT1 B;  2W9A A;  3PW5 A;  4A8W A;  5E3Q A;  3EYZ A;  5G4D A;  1RQ0 A;  4DEZ A;  2W4C A;  4CDI A;  2F3J A;  3ZC4 A;  3T6B A;  4E8U A;  3NMA A;  4UY8 T;  2JZ5 A;  4NYP A;  2AX1 A;  1E6V B;  2A2D A;  2BOP A;  1REV A;  4CO0 A;  3R7B B;  3MPU B;  1A0O B;  4DSJ A;  2MY7 A;  4A8M P;  5LSR A;  2H9Z A;  2LQ5 A;  3M8Q B;  1QLN A;  2LEC A;  3KLE A;  3PJX A;  4RPF A;  1YRT A;  3VF0 B;  5J2Q A;  2VFU A;  2HLU A;  1CQN A;  2W7P A;  1FNM A;  1RHU B;  4RNO A;  4JV5 F;  3V6D A;  2N3O A;  2CFX A;  2PFF B;  2C28 A;  2IDE A;  4DL6 A;  4CLP A;  4L6V 3;  3G9C A;  2VOP A;  1X31 C;  3LP2 A;  4B3T J;  2IC3 A;  5B0G A;  3ONQ A;  5F3Z A;  2ZBP A;  5EX3 A;  4M5K A;  2BRL A;  2DRB A;  1UFL A;  2WOM A;  2BYC A;  4ZIV A;  5RUB A;  1VQ7 S;  3DRP A;  3BSC A;  5KT7 A;  1E6Y B;  1HBN A;  2P9G A;  2KI2 A;  2LCW A;  3PCO B;  1RWK B;  4ZN3 A;  2JC1 A;  2Z58 B;  4N7T A;  2AF6 A;  5IC6 B;  2HGM A;  2B4O A;  8RUC A;  2ZHB A;  3D6F B;  5L38 A;  4RBV A;  3UDC A;  3HT3 A;  4QWE A;  4J9L A;  3U1M A;  4LSN B;  2UVR A;  2YWG A;  4DFJ A;  3RW6 A;  1R6Y A;  1Q8L A;  5J1P A;  2AX0 A;  4DZD A;  2PGC A;  1OSC A;  2YQ3 A;  4DPU A;  3OTE A;  3FBE A;  1JNZ B;  3BKT A;  4MKV A;  4C48 A;  2GHW A;  3G6X A;  3OHB A;  4WBF A;  2VKR A;  2KRR A;  1LFW A;  3V6H A;  4IFY A;  4BBY A;  1NK9 A;  2ZC4 A;  1B64 A;  1X4C A;  5KG1 A;  3MEG A;  1WHV A;  3KLI A;  1OY6 A;  4CH7 A;  2AEF A;  3FQK A;  3LP1 A;  1VHF A;  3F73 A;  4NLY A;  1IM6 A;  3PHE A;  1GQE A;  2YWF A;  4XPE A;  3UCU P;  2AJ0 A;  2R8K A;  4DR3 F;  3WC0 A;  1R8C A;  3K5M A;  3BSA A;  3HCX A;  2OH2 A;  2M9K A;  5ETL A;  3JS9 A;  3OXF A;  4NZ7 A;  3FRZ A;  2YWK A;  4KR0 B;  1RAJ A;  2YPY A;  1NJZ A;  5IQ6 A;  3DRY A;  5C5J A;  5B0E A;  4ZMM A;  4USK A;  2E7X A;  3A8E A;  2W9C B;  3V5R A;  5DM6 Q;  1WEZ A;  2KT3 A;  4K4T A;  3A3O B;  2ZM6 J;  4O4R A;  5EWE A;  2J6S A;  2HS0 A;  3QJL A;  3AA8 A;  2B5J B;  3RZA A;  1LWE A;  2DR6 A;  1DQ9 A;  4CNZ A;  3PW4 A;  3M2V A;  3PNI A;  3K5N A;  5KOX A;  5H9E K;  1FD8 A;  2HIY A;  1LWC B;  4DMZ A;  3KK1 B;  1GX5 A;  2LEP A;  3JSM B;  1HNI A;  2I9S A;  5ETV A;  4TLR A;  3AFG A;  5D0E A;  4DL3 A;  1KOO A;  1JMT A;  2QO3 A;  4ZVS B;  4YDD B;  2ZUA A;  1RT4 A;  1IWA A;  3O8W A;  3HVT B;  4USJ C;  3QGG A;  4CH0 S;  1S0M A;  2HRU A;  3G8S A;  4IG3 A;  3VQS A;  5KFI A;  1QTN B;  2OO4 A;  3MCM A;  4ZP7 A;  5IOL A;  2MGZ A;  1YDL A;  2DNY A;  3ZZ0 A;  4DV6 F;  2FVR A;  1LXN A;  4DR6 J;  3DOM A;  1FER A;  4ZVR B;  1ELO A;  4DU8 A;  5ETN A;  4P7T A;  4J7C A;  1RLC L;  3RRK A;  1U8S A;  4DV3 J;  2XS7 A;  2DT9 A;  4HKQ A;  1UW4 A;  3M1V B;  1YKW A;  2A6O A;  3MPV A;  1ACM B;  3VAM A;  4AXJ A;  5CYM B;  4HHH A;  1ZZN A;  1KD1 T;  2C22 A;  2Z2L A;  2PA3 A;  1TL3 A;  2XEX A;  1R7I A;  1XTZ A;  3CXC R;  3I0R B;  4F0M A;  4M5J A;  5G0R B;  1W25 A;  3QNW B;  1IXK A;  3MMA B;  5AXN A;  1U1P A;  4GC6 A;  1P1T A;  1L3K A;  4UF4 A;  1SL2 A;  1FEE A;  3DDK A;  3F56 A;  4WE1 A;  2XGQ A;  1MU2 B;  2UXD F;  1CS4 A;  4HDH A;  3VGV A;  3JSB A;  3UE2 A;  5A76 A;  2MZ1 A;  2BEF A;  2LU2 A;  2FTR A;  3J7Y I;  3W9J A;  1Y4Z B;  2MQM A;  4OZL A;  3K59 A;  1RA6 A;  1SJ4 P;  1DQA A;  4KBI A;  4OFZ A;  3HD1 A;  3V4M A;  3Q8V A;  4RUH A;  3CGI A;  1S9E B;  2V8H A;  1N34 F;  3TA0 A;  1RHJ B;  3PXG a;  4DV0 J;  2FQQ B;  4DG1 B;  3FBF A;  2IYI A;  1TR0 A;  2B4V A;  5KG6 A;  3RYL A;  5F8M A;  1R0A A;  1M90 T;  3BR9 A;  3R7S B;  2F63 A;  4RX6 A;  3CUN A;  3MCO A;  4C8Z A;  2IRX A;  5CZV A;  4FN5 A;  1X5P A;  3ZZO A;  1OYD A;  4ED0 A;  2HVI A;  4A8Q A;  2POK A;  2Q79 A;  3S1T A;  2J9D E;  5B0D A;  1LV5 A;  1IR1 A;  2Q6C A;  3BRE A;  1HHT P;  3HSZ A;  4Z7Y A;  2JL9 A;  4DL5 A;  2VBX A;  3W65 A;  4BCA A;  3KG4 A;  1AA1 B;  4V1A k;  1ZPV A;  3U02 A;  3CUL A;  2XBP A;  3MMC B;  3L95 X;  1R89 A;  3LPY A;  1VMB A;  3GCX P;  2BE7 D;  2YKA A;  2VOD A;  4JI5 F;  1RCX B;  2CJ9 A;  1NJY A;  2Z4P A;  3RW7 A;  4NWB A;  5E3C A;  3ZNU A;  1Z4U A;  3NAI A;  2KYZ A;  4NA3 A;  5IT4 A;  3UCG A;  4R8U A;  1EB0 A;  3UNY A;  2PMH A;  2HVZ A;  2PFD A;  2VG7 A;  3GR0 A;  4B3M F;  3J7A N;  5D6G A;  3MOZ A;  1WC6 A;  2XZT B;  4KIA A;  1UVI A;  4DR1 J;  1HI0 P;  4F4A A;  4NCA A;  4JI5 J;  4XPC A;  4RW4 B;  2WRM A;  2CQ3 A;  1HNW J;  2HGN A;  2OEK A;  1HPZ B;  5KT2 A;  3EDQ B;  5HQM A;  1VCT A;  1H7W A;  5EWF A;  1KS2 A;  3N01 A;  3R5B A;  3D67 A;  1FEH A;  1TP7 A;  2BV3 A;  1FRH A;  3QBC A;  2JX2 A;  1SB6 A;  3GPA A;  2B9X A;  3W9H A;  4OIX A;  3ZZZ A;  5C42 A;  3ILI A;  2HFS A;  4RUB A;  3H0P A;  2X7I A;  3H5Y A;  3P6Y C;  3MM5 B;  4LF7 F;  4C3M A;  3MI7 X;  2LYV A;  1RTI A;  3FQL A;  1ZS6 A;  4I6W A;  4IOB A;  2H51 B;  1RI7 A;  2NSC A;  4HT5 A;  4ERD A;  3DOL B;  3VQT A;  4NX9 A;  2FVQ A;  2A3J A;  2FGO A;  4BLG A;  2CJA A;  1V3R A;  2FJV A;  1X9W A;  5E2Q A;  2NSB A;  2ZH4 A;  3RR8 A;  2MKY A;  4PXC A;  2MZQ A;  2VA2 A;  2GHV C;  5HAN A;  3BKF A;  2CIM A;  1I94 F;  1M5K C;  1KVK A;  4J9U E;  1SKS A;  3UVJ B;  2DNR A;  4PXB A;  3ZTR A;  4NRU A;  4MKA A;  5CZX A;  1MSW D;  4Y2C A;  2W2O P;  2VUG A;  5A2Q Y;  3AD9 C;  1FJG F;  2D9O A;  3H20 A;  4PQU A;  5DDR C;  1FK9 B;  5T7L A;  4B9U A;  2RDI A;  2F7V A;  2ASJ A;  4FYD A;  2V34 A;  1HMV A;  1NME B;  4I6A A;  3AH6 A;  3AY0 A;  3UDV A;  1WD6 A;  3PX6 A;  1RT6 B;  8ATC B;  2KHC A;  1RT1 A;  2W4P A;  2GQC A;  2RDJ A;  3DOK A;  2M8H A;  4ILM A;  3MM7 B;  4ID5 A;  1UAW A;  1JJ4 A;  2G2O A;  1UVJ A;  3GIR A;  2IYG A;  1H38 A;  5AE3 A;  3DLH A;  2J6T A;  1R3N A;  2PI5 A;  4Y34 A;  2VJV A;  2CAJ A;  2HAI A;  3M9M B;  1RK8 A;  4IO9 Q;  2R8G A;  3K8V A;  4M5D B;  4IR1 A;  4NOH A;  3VWS A;  3BR8 A;  1HWK A;  2GW8 A;  1WDT A;  3EJM A;  2NPI A;  2YNI B;  2KVI A;  4TLQ A;  3P5B P;  2YH0 A;  1FNX H;  4M8L A;  1UZH A;  3FGV A;  4K8R A;  1FDA A;  1YJV A;  3G96 A;  3A1Y G;  3NGK A;  4KT0 C;  2WBR A;  1C0U A;  2HVD A;  4TU7 A;  3QFW A;  1IBL F;  1LW0 A;  1QTM A;  4IH5 A;  3CVK A;  4TY8 B;  2XS5 A;  1VC6 A;  3LP0 A;  2DO0 A;  3ETM A;  2J8S A;  1KRP A;  4M1K A;  1TKX A;  2WSE C;  1JX4 A;  4ZJQ A;  2F1F A;  1TU0 B;  3DC2 A;  5EN1 A;  3CMQ A;  2E9R X;  1X4F A;  2ZIT A;  1BGX T;  1T9T A;  3EZU A;  4M5M A;  3NGR A;  1CJK A;  3PX4 A;  2OPP A;  4H4M A;  2D69 A;  4FS2 A;  3NEK A;  1T9V A;  4HR2 A;  1TK8 A;  3UPF A;  3MUT P;  2AIR B;  4KH0 B;  3C6U A;  3UFC X;  4FKY A;  2VAS A;  2OFH X;  2OGU A;  4OI3 A;  3E01 B;  2W2P P;  4NLP A;  4DPW A;  1VR6 A;  3KYL A;  3K57 A;  4LF8 F;  4P71 A;  4I2P B;  1FTC A;  2BJD A;  4KHP F;  3DLE A;  1T05 B;  1Y3J A;  3JTN A;  4KGK A;  1WC4 A;  1EHW A;  4FBU A;  2XHC A;  3DRR B;  1FDN A;  2EK1 A;  4ZLN A;  1IUJ A;  2DKO B;  3TX0 A;  1U7L A;  4PG8 A;  3HDS A;  3TI0 A;  1RAA B;  1YBU A;  2HQI A;  1U1R A;  2RF2 A;  1FWL A;  2DHA A;  5A6P A;  3D7S B;  1WAC A;  2NLW A;  1NK6 A;  5FJ4 A;  5LT5 A;  4ZVU B;  1WEL A;  3Q83 A;  4ID8 A;  4X4Q A;  3P4U B;  2P9E A;  3KK3 B;  5KFG A;  4KV8 A;  3NCR A;  2QLW A;  1LKZ A;  1HNV B;  3IWX A;  5L46 A;  4YHH J;  1MWY A;  2GIR A;  5IM0 A;  2OPS A;  2PSZ A;  3T1H F;  5KTQ A;  3IR5 B;  1YI2 S;  3K8W A;  1TV6 A;  2M2B A;  1YIT S;  5D4P A;  3OTD A;  2MTL A;  3Q8U A;  1KEK A;  3NY0 A;  3CED A;  3HD2 A;  4R0J A;  2XZW A;  2Q43 A;  5ETM A;  1HBO B;  4F0H A;  2QSW A;  3OL6 A;  4NXN J;  3OBI A;  4K4U A;  1ZTT A;  1RBL A;  4TQR A;  1SC3 B;  3UCZ P;  1N5V A;  4CWB A;  2QT7 A;  2MJU A;  1DLO A;  4B9S A;  2P5V A;  4ZJO A;  2PD1 A;  4RW7 A;  4OX7 A;  2JVR A;  4DI6 A;  5CCL A;  3DGV A;  2YY3 A;  2Y1I A;  3Q86 A;  2DIS A;  1ZAW A;  1SQG A;  1P1L A;  1MNE A;  4ZVQ B;  4DR2 F;  3ILO A;  1KWM A;  2HBZ B;  3AOA A;  3OVA A;  2MKJ A;  4DUT A;  3CC7 S;  1M0S A;  4Y2I A;  2NXN A;  4QYR A;  4JI4 J;  1PSD A;  4DN9 A;  5F8J A;  3KTQ A;  1HR0 F;  2CQC A;  3RB4 A;  2PN6 A;  1S77 D;  4CYU B;  3KLH A;  1H73 A;  4L74 A;  4KC5 A;  3BN4 A;  2W8K A;  1XMO F;  3TO8 A;  2YVS A;  4C7Q A;  1SQF A;  2XLK A;  2KH9 A;  3DMJ A;  3C16 B;  3LAM A;  4MK7 A;  4J9K A;  4EEY A;  2MB0 B;  4FZV A;  1HQE B;  1HQ2 A;  4IDK A;  4KPC A;  1WJ9 A;  3KG0 A;  3H5X A;  3CDW A;  4OZ5 A;  2CQP A;  4ANC A;  1RWP B;  1NBE B;  1UET A;  2BKP A;  3OR2 A;  1SC6 A;  2OPR B;  4CO4 A;  2WVE A;  4JI3 J;  4NXM J;  2IJR A;  3B8H A;  5KFP A;  1RT5 A;  4NLT A;  5KFX A;  3OTB A;  4A8Y A;  3T6J A;  3QGH A;  2DR7 A;  2QX0 A;  4D3H A;  3I0S B;  2AJQ A;  2DYA A;  4Z37 A;  5HJY A;  3MD1 A;  4OYW A;  1KR4 A;  4FXV A;  4HI2 A;  2C2N A;  3PRD A;  1EET B;  2F4V F;  1Z1Z A;  3ISZ A;  1SJR A;  5CYJ A;  5DLF A;  1L3T A;  3M6X A;  5F8L A;  2VBZ A;  4J9M A;  1WC1 A;  1GH8 A;  3ET6 A;  2Q1L A;  3TUZ C;  7AT1 B;  2QL5 B;  4CTA B;  4B3S F;  1QE1 A;  2CPE A;  3JTP A;  5KT5 A;  1RAG B;  1XMQ J;  5KFY A;  1XWL A;  3KLF A;  3KKF A;  2MQO A;  3M30 B;  4X64 J;  1NHV A;  3RB3 A;  5HP1 B;  4ZOS A;  3M32 A;  5L1I A;  4ZP6 A;  3H90 A;  2KM8 C;  3TUP A;  4PWD A;  4OYO A;  2I8E A;  4J9N A;  3GYX B;  1URR A;  4ZVP B;  4LRC A;  1S9G A;  4LF5 J;  4I7F B;  3KOA A;  2VKZ G;  4P10 A;  2Z30 B;  3OJS A;  2ZH9 A;  4QIF A;  4JI7 J;  2WTF A;  3BN7 A;  2FY1 A;  5A8K A; 
#chains in the Genus database with same CATH homology
 4OYW A;  2GVD A;  1YBU A;  5D0G A;  4CLL A;  4CLT A;  1FX2 A;  2W01 A;  1FX4 A;  3G82 A;  3MR7 A;  4CLS A;  1AB8 A;  1U0H B;  1TL7 B;  3C16 A;  4P2M A;  1Y11 A;  4OYP A;  1WC6 A;  4CLF A;  1WC1 A;  1CS4 B;  3ET6 A;  4CLY A;  3C15 A;  1YK9 A;  4WP8 A;  2GVD B;  3MAA A;  5D0H A;  3UVJ A;  1CJT B;  4CLU A;  4OYZ A;  4USW A;  1CJK A;  4WP9 A;  4CM2 A;  1CJV A;  3G82 B;  3C16 B;  4USV A;  4WP3 A;  4OYI A;  1CUL A;  2GVZ A;  4USU A;  4CLP A;  4NI2 A;  4P2X A;  3ET6 B;  3C15 B;  4OZ2 A;  3C14 A;  3R5G A;  4CLK A;  3UVJ B;  1WC0 A;  5D0E A;  1CJK B;  1AZS A;  4OYM A;  1WC5 A;  5D15 A;  1CJV B;  5IV4 A;  4P2F A;  4OYO A;  4WPA A;  4OYX A;  1YBT A;  5D0R A;  5IV3 A;  1CJU A;  1CS4 A;  4OZ3 A;  4CLW A;  2QV6 A;  3C14 B;  4CM0 A;  1CJT A;  3MAA B;  4OYA A;  2WZ1 A;  1WC4 A;  1AZS B;  4OYB A;  2BW7 A;  4UST A;  1U0H A;  1TL7 A;  1CJU B;  4CLZ A;  1WC3 A;  1CUL B;  2GVZ B;  1Y10 A;  4NI2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...