1WC5A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp in presence of bicarbonate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
193
Chain Sequence
MRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
molecule keywords ADENYLATE CYCLASE
total genus 55
structure length 193
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc5A00
1U0HB 3C14B 4P2FA 3C15B 4OZ3A 1AZSA 3R5GA 5D0HA 1CJVA 5IV3A 4CLLA 1CJTB 1TL7B 1CULA 4WP3A 5D0RA 3G82A 1Y11A 2QV6A 4USUA 4CLZA 4OYWA 1YBUA 4OYPA 3MAAB 3C16B 1AZSB 2GVZB 4OYZA 1CJUA 1YBTA 4WP9A 1YK9A 4CLWA 4OYIA 2BW7A 4CLUA 5IV4A 1Y10A 4CLTA 1CJVB 3C14A 4WPAA 3UVJA 3C15A 2GVZA 2GVDB 3UVJB 1CS4B 4CLYA 4P2XA 2GVDA 4OYMA 5D0EA 4CM0A 5D15A 1AB8A 1CJKB 3ET6B 4OZ2A 4NI2A 1CULB 3ET6A 4CLKA 3C16A 4CLSA 1WC0A 4OYOA 1CS4A 3MR7A 2WZ1A 4USWA 1CJTA 4OYXA 4OYBA 4USVA 4CLFA 4CLPA 2W01A 4CM2A 1TL7A 1U0HA 3G82B 1WC6A 3MAAA 1FX2A 4WP8A 1WC3A 4OYAA 1CJKA 1CJUB 1WC5A 4USTA 5D0GA 4NI2B 1WC1A 4P2MA 1WC4A 1FX4A
chains in the Genus database with same CATH superfamily
2IBOA 3HDSA 4N5SA 3D1OA 2GS8A 5KFYA 2Z0GA 4AT1B 1JMTA 2BANB 3CD5A 3OL9A 4LQ9A 3PCOB 3W7BA 4JOUA 3GV7B 2DGQA 5HMYA 5G0RB 2K1RA 3TX8A 1NHVA 2DHAA 2OPSA 3VAFA 1PYSB 4OV1A 2XO7A 2I9SA 5D0HA 3TAMB 5LMNF 2KL8A 3TEGA 2MKIA 2HZVA 4PR6A 1JJCB 3UO0A 3LQVA 3E2EA 2KFNA 1DLOA 3IXQA 4QPTA 4ZVHA 4DU7A 2N3OA 4WCEQ 3OL6A 1VJWA 4C6AA 5KFOA 2X1AA 3QJPA 1CULA 1IUJA 1N33F 4M5KA 2AJFE 1SV5A 1SIWB 1X4DA 3HVTB 2V4QA 2UUTA 2R8KA 2VIHA 4OJGA 3R2DJ 5DQHA 4A8MP 4OYWA 2FJAB 2PMZD 2GHPA 2D69A 3ITHA 6FD1A 4PWDA 4LSZB 2DH7A 2QT7A 3MEDA 2VDHA 2H5JB 1UVLA 3H42A 2IJRA 2YWFA 2VPXB 3CD7A 1RT3B 1TKTB 3QFHA 2DKOB 4CT9A 3W3SA 2UUBJ 1CEZA 2BE2B 2HBRB 2GIFA 4ELVA 4C8YA 4AQYJ 3BSAA 2YNGA 1Q8KA 2I5JA 2KJWA 4NOHA 2DR8A 5KFFA 3OJUA 4QBUA 1DARA 4YP3A 3UCZP 1F2HA 1YVFA 2RB7A 1J5OA 4U7UD 1F5BA 2F4FA 5KFAA 1GEHA 3P45B 4MFBA 3AB4B 4X4RA 4TQSA 5HLFB 1HBMB 1JJHA 4U7UK 1VQ4S 3TZWA 1YRXA 1GXTA 4CO3A 1D0EA 4KPYA 4J9RA 1U1RA 1F1BB 2VKRA 2IA6A 2QL7B 2F3JA 3UVJA 1IBKF 1TV6B 3QO9A 3HHLB 2IRUA 3SXLA 3J81U 4F3MA 2B9YA 2AGOA 1MSWD 4K4UA 4B08A 3HKZD 4ECQA 3MOJB 1VGYA 2ZVIA 1SPBP 1IR2A 2IC3B 4OYMA 5HP1A 3CE8A 1YQHA 4JI7F 1T95A 2QFJA 3D67A 9ATCB 1VQNS 1EKRA 5BR8F 3IP0A 3IRXB 2H5EA 2YQ1A 4ANEA 2LKZA 1RT1A 2FGOA 2B6AB 2NSCA 1X8DA 3M9MB 3EPGA 4NLGA 2LQ9A 1XQIA 4I2PA 1FTRA 1FWKA 5DQGA 3RW7A 1FO1A 1N52B 1GT8A 1TR0A 5HANA 1UMJA 4HH0A 1IN0A 3FZBA 4X84A 3PM9A 1M5HA 1XR6A 5KG3A 1JKHB 4LSLB 2QN6B 2J8AA 2DRDA 1HPZB 4U95A 3RRKA 4QWAA 1SXLA 4DPWA 1S72S 2EI5A 1N5TA 2C1EB 4W98A 3QPIA 2MZQA 1S10A 1PYTA 4NLSA 4MIAA 3KLIB 5F0WA 5GAGU 2WK4A 4KO0B 4WU2A 2H48B 4ALZA 4CLPA 3CDEA 3HFVA 3PJXA 3R27A 4FVCA 2YBVA 4K4VA 1RKIA 1T9UA 2ZHBA 2R8JA 2DITA 2CNNB 3SQGB 4M5DA 4JI3J 1UJ5A 2W1BA 1UCNA 2HK2A 3W5YA 3K2YA 2DY1A 4JB8B 2JC0A 1VQ7S 3KJNB 1XNRJ 4G6VB 1VK8A 2RIJA 4ANCA 4B9LA 2OI2A 1IQTA 4BBYA 4B3OA 5J1PA 1HQEA 2JL9A 2V68A 1NXIA 2EFPA 1NCLA 2CUYA 1CBKA 2EK6A 4RUHA 4LSNA 4J9LA 1FKAF 2M8DB 1WC4A 4HEA9 4P73A 4IUFA 2ALZA 4JYAJ 1H74A 3R5JB 1S1UB 2YH1A 1WNEA 5B0CA 1LKZA 4DQPA 4J9SA 3DOLA 1XMOF 1T05B 1AROP 2IM2A 3AD7C 2B51A 1JXLA 3ILIA 4ZIWA 5F8NA 2P2CB 1XWLA 1FCAA 1NHKL 3C14B 2APOA 2A10A 4P2FA 1T94A 1K0TA 3FDSA 4DSIA 3BGFA 3DGPB 1W2IA 1S79A 3GFXA 2VASA 3IGNA 5CQGA 2KM8B 3A8EA 3C6UB 4LBPA 4B9SA 4C8OA 1RTJB 3OTOF 2W25A 1G4CA 2VPYB 3OVAA 4JI8F 2HQCA 3W66A 1C0UA 2HWIA 2I1RA 3FBBA 4JI6F 4ZLJA 2DNRA 1VQ6S 3R2CJ 4ED5A 4IR9A 2GGPB 3KNGA 3NKYA 3QGGA 2V9KA 3NXZA 2JSXA 4RUCA 1IBLJ 4KV8A 1KTVA 1CC7A 2DVIA 5EWFA 1R8PA 1EQMA 2VUGA 4X4VA 4JI7J 4DV3J 3WBZA 3QWPA 2V2VA 2Y0SD 4P2SA 4ZJLA 1O6XA 2IVYA 2V2QA 2GQCA 1KLMA 5LT5A 5GAGI 3K5NA 3MDFA 3O44A 1AYEA 2J8SA 2O01C 2BV3A 4PXBA 3PRBA 2ZOMA 4PEOA 3S1TA 5J1EB 3OXFA 5D4LA 3CCQS 4CCHA 2YKMB 4GMKA 2C22A 2XB2D 3H98A 3CO0P 1EETB 2ZKTA 1JNZB 2DO0A 3NAIA 4IDKB 2QG9B 3IGVA 3B82A 4WP9A 1UP1A 2LYVA 2W24A 3SQOP 4FBUA 3QRPA 1FE4A 4DUZJ 2B5JB 2LDYA 1HQ2A 3KHGA 2UUWA 3AXMA 4HDHA 1VQLS 1UFLA 2RUGA 1PC5A 4ZPWR 2EFVA 4UZCA 3J81Y 3PTWA 2BW7A 2VFUA 4A8XA 1LW2A 1SCJB 2BZ2A 4TXSA 4NXMF 2PDAA 2QLJB 1RADB 4DS4A 2Z2YB 4O44B 2G9OA 2RT3A 1HBMA 3H8YA 3QGHA 3LP1B 5E3CA 2J7KA 4C3LA 1Z4UA 2V4RA 1TMMA 4C9DA 5AXNA 1U1MA 2HHHF 3OSNA 1CS4B 1KN6A 4EYHB 1H73A 1AUSL 2W4CA 2I0XA 1MU2A 1P9YA 4OJ1A 3PKMA 1RE1B 4NZ7A 3OL8A 1QJHA 4V19J 3CJKB 1YZ6A 1N5SA 3Q2SC 1SJ4P 4OZ2A 1SJ1A 1FRKA 3KJQB 3E01A 2ROPA 4TKTA 1NDKA 3R7BB 2RDDA 4CLKA 2CZ9A 1EP4A 3BQ1A 1HR0J 2UXDF 4MJKA 4HVZA 2V9WA 2DR5A 1HIYA 1DURA 5KG6A 3GIKA 4DR5J 1SI9A 4A8YA 1F2GA 2W2PP 1BQNA 3OXLA 2HIYA 1RA7A 4IFYA 4I64A 1CS4A 1N0VC 4DV7F 2MDAA 2JVRA 1Q82T 4NPOA 3DHWC 4DV3F 3T19A 1HQUB 2VBYA 4OYXA 3RAQA 4RW9B 2E5GA 4KHPJ 3GQCA 3I5AA 4NLPA 4TQRA 1XNQJ 3CDAA 4WIQA 2ZH4A 5CZXA 5KOWA 5IQ6A 4C11B 1TZ0A 3PX6A 2YNIB 3EVMA 3DC2A 2MY8A 2MGZA 4QW9A 4DSLA 1AT1B 2QLWA 4X4UA 5IT4A 2KM8C 2HIQA 4F4ZA 2ZFHA 4ZIVA 3J81j 2G2YA 2DBBA 3TX0A 4RNNA 3BBBA 4U8YA 3M4XA 3P6YC 5DQIA 1RT4A 2QC3A 1GTHA 5F3ZA 2ACYA 3I82A 3U27A 3WIVA 2WONB 2Y1IA 5L1LA 3NNCA 2M4MA 2GJFA 4OMFG 2RRBA 2XBPA 3ILLA 2MKYA 4OX6A 2NZ4A 3J7AN 1EZZB 1BE4A 5JMNA 4ZVQB 5KT7A 3W64A 1RCOB 2DD8S 2G0IA 1WG5A 4LF8J 2QLXA 4H4MB 3RB0A 1N4LA 2E44A 4LF2A 4C3KA 4FF1A 1RWVB 1VIOA 1IKWA 4UQGA 1RHQB 4Y2CA 2PA8D 4QU7A 2RF2B 1MWQA 3HT3A 1WWHA 5HBMA 4PYAA 4FNHA 2HLTA 4DL7A 4NXMJ 1IXKA 3UE2A 5LM7E 1F3FA 4RBUA 2ZNZA 1M5SA 1WACA 2BRKA 1URNA 2CZ4A 3HLUA 3FNNA 2F8MA 1GMUA 2NUHA 5LJ3Y 1TAUA 3M30A 4QJVA 3KLGA 3PJ9A 3ZXWA 1TL7B 2XWXA 4FN5A 3L4BC 4V19X 3CUNA 1MG7A 5D0RA 3W9HA 3M8SA 2GGPA 3A8KA 4I4BA 2C2DA 1CLFA 1AFJA 4GKJJ 5M2RA 1T11A 3CTRA 1S5ZA 4C0BA 1WELA 1R8CA 4B3RF 1YBUA 1JLGB 2E7XA 3K0JA 1PIEA 1UAWA 3D0GE 2Z57B 5JVHQ 2N3LA 5F8IA 3KHRA 4H4KA 3BB5A 5J1EA 4B3OB 5EUHA 2FUG9 5CZVA 3FVYA 1JLBA 4B3MF 1QUVA 4U7CA 3OQ2A 4P74A 5K5MA 1UW9A 3CCWA 4MFBB 4FF2A 2MKJA 3L9ZA 2QL9B 5SUHA 2V34A 5F9NA 2K2PA 2WSEC 4IH5A 3KLEB 3R1LA 1NPKA 5HO4A 4N8OA 2NZCA 1H6KX 1CC8A 3MM8B 4LRBA 1M5PC 1NDLA 4UY85 4KH1B 2WBRA 4K5RA 4PXEA 1XJWB 3AD9C 2HNYB 3OFFA 3R5DA 4WPAA 4DQQA 1EJ7L 4R25A 5IT9U 2KT2A 2B9EA 1DQAA 1M0SA 2JEFA 4PQUA 2YX1A 3OLAA 2AMCB 5F0UA 4WFNQ 3C6UA 4Z7CA 5EDWA 2F9DA 2DNGA 1BHNA 5HVFA 4OLPA 2ZBPA 2DPJA 4WFAQ 3D1HA 1U1PA 4C8LA 1JLEB 3HVTA 2R7TA 3G2XA 2EPIA 5FJ4A 1DRZA 4A48A 2E1MC 3I9ZA 1WDDA 5CCLA 2HQDA 2B7BB 2LEPA 2Z58B 3DRXA 1WSVA 1XNRF 3ZC4A 2EC0A 4ITSA 1AA1B 5B0AA 4YHHF 2AX0A 5K14A 3NNAA 5E0OA 4ZP7A 2C3MA 4LSLA 1VQOS 5ETMA 1RTDA 2AYEA 2AX1A 3OTBA 2XSJB 4HLBA 2OFHX 2Q6CA 3NWGA 3PX4A 2E1RA 2Z2ZA 3RBEA 4A47A 5HLFA 1Y7PA 5KFDA 3DXBA 4IO9Q 1B4SA 4W90B 4Z37A 2OMLA 1FNXH 3VAIA 4IOAQ 5I3UA 4YB6A 3JAMU 4C11A 3QSIA 4C8NA 1FKPB 1U02A 2R7OA 1HNVA 2ALYB 1ULRA 1B0PA 2YNIA 3DRYA 2IRYA 4F3QA 2XMWA 1NH8A 4LIRA 1ROFA 2R42A 4XAKA 4R5PB 2PI4A 1RWUA 3CVKA 3DLLQ 2FIUA 1UPMB 3DDNA 2ZD1B 2XMMA 4KPCA 4ANDA 4ETXA 4Y0FA 1X5SA 3FBEA 3JSMA 1WHYA 1HNXF 4FBTA 2RS8A 4YOEA 2MSSA 4NI2B 2YWKA 3VAKA 1TVRA 1YJTA 2AT1B 4USJC 1H38A 2OO4A 3W2VA 3UR0A 2MLYA 4CNYA 1S7IA 2I5JB 1IKVB 2BJEA 2L9DA 3W5XA 4AYBD 3LWLA 1YHQS 5KFEA 2HHHJ 2CQGA 1U4BA 1PCAA 1G7CB 1VCTA 1RAIB 3L7UA 4Y34A 4YB7A 2C28A 1K8AT 4ECSA 1OIAA 1OY6A 1YX2A 3T1HF 1RT7B 2XYHB 5B0DA 3BGRA 1H2VZ 3JB9k 2ATLA 4O23A 2MLXA 1RBLA 4DXLA 2CQIA 5FDLA 2YX4A 1HMVB 7FDRA 3PIOQ 3M9NB 1C0UB 2C2RA 2HHTA 1WEXA 4I0WA 1TV6A 4DOZA 3EZUA 5E5NA 3VZHA 2G1DA 1RT5A 3M8PB 3IG1A 1L3UA 4V1Ak 2WHOA 2JH3A 4MK7A 2ZJRQ 2OFGX 3G82A 4WP3A 3VGVA 5IT0A 1JQGA 2ZH2A 4DSFA 3R6GB 1S6UA 2RSQA 2MSTA 4KGZB 4NMLA 3UDLA 3VQTA 3IBFB 2ZVSA 4U67Q 2FDNA 2V2KA 3MTKA 1R27B 3BKUA 2J6TA 3PNIA 3MCMA 1M5VC 5E33A 3MAAB 2DNKA 3MM7A 5CYMA 2CQ3A 4NYPA 1EQ0A 4EWTA 2FHJD 4RBVA 4IDKA 1FK9A 5AXLA 5ADZA 2EBEA 5IWAJ 3Q8SB 3KK2B 4LFCJ 1N33J 4R0JA 5DO2A 1URRA 1YBTA 4NLXA 3LH2S 3MMCB 1NK9A 2J0WA 2MQLA 5GMDA 3QZ7A 3MR2A 2ZBCA 3IN5A 1CG2A 1R6YA 4QR1A 3MFIA 3W61A 4X62J 5C24A 4FXVA 3D6FB 2IBKA 1NMEB 5LMNJ 2FC9A 2L08A 2DEIA 1D9DA 3H5XA 1OY8A 5A0YB 4F4WA 4CLTA 5KG4A 4LREA 3OTCA 1N36J 5HL7Q 4D3GA 4DV2J 1X0FA 1RHUB 4L76A 5B0FA 1UWBB 2V2ZA 1WKLA 4FYDA 4ID5B 4G1PA 1RACB 1TFWA 1KQGB 2GVDA 3VAMA 2ADBA 3QRQA 2BXJA 3KHLA 3E51A 4FXDA 2IM0A 3I56S 3DN9A 4KBIA 1NNDA 4O0NA 4XIUA 3AOCA 2XQCA 3M30B 3FEXB 4RW6A 2QEXS 1FFSB 2C2KB 5KFZA 5C24B 3OVSA 3ET6A 4M5MA 2MQQA 2ZUGA 4MT1A 2JEJA 4KHPF 4LF1A 2HW3A 5JVGQ 1KQKA 1S9EA 1PJ6A 3OR2B 1Q53A 5KG7A 1WTFA 2KT5A 2RMLA 3SI8A 4JI3F 2W2NP 3DM2A 3KJVB 3D9BA 2NSBA 3CW2C 3ILOA 1KQSR 3PHTA 4KKOB 4J9NA 3SFUA 1L3VA 5D78A 4RW4B 5T7LB 1IKXA 5F8JA 4GC7A 1RTJA 1R0AB 4HTJA 1SJQA 3UN5A 4X62F 3FQKA 3TO8A 4KFBB 4MIBA 1VDHA 4USVA 2CG4A 2F4VF 5KFQA 2UUCJ 4ZS6A 5KFMA 5F8MA 1S9GA 4NLDA 1SC3B 1TQLA 1YRUA 1FI4A 2B6AA 2HAFA 3MMAA 3R6LB 3WZ0A 4CM2A 4DI6A 5GADI 1E6YB 3FKBA 2D3ZA 2UVWA 1UVJA 3A8JA 4FKXA 2RU9A 3MM5B 1N32J 3N4WA 1HI8A 4ED2A 1R6VA 2F1FA 3DLGB 1IKYA 2EG1A 1I94F 1GX6A 3O8WA 3EGZA 5KFNA 2HVIA 1KOOA 2NXCA 2C3UA 3AJDA 1R0AA 4J37A 4RW8B 4YEAA 2HGMA 3Q8RB 4P71A 3MUTP 2ZH3A 4OHZA 3TRGA 1KBRA 3NP5A 4JI4J 2KN4A 3N9UC 4ZITA 2J5AA 3LOUA 3QIDA 3QT6A 2HNDA 4LMZA 3EGWB 4N76A 3P96A 1WF0A 4URQU 3I0RB 1XC9A 3LALA 2LA4A 4USMA 4IFYB 3C15B 3UN2A 1IJFB 2X51A 1SL0A 1YJ7A 1HHTP 4O44A 3FRYA 1Z2ZA 5IM0B 2FJEB 1FJ7A 4URGA 3KYLA 4AUKA 2JJ4D 5KT5A 3M8RA 1HNWJ 2IJFA 4NLYA 3T6BA 4CO4A 4DV6F 1Q8BA 4N47A 3HJFA 3ZO7A 2XZWA 4ZDNA 2DXDA 2OPQB 1HHQA 3KK1A 4NASA 3HI9A 4YY3F 1Q78A 4F7VA 4DN9A 1KSPA 1TTHB 1Y11A 3MPDA 4ID8A 5DRKA 3ZZYA 4CLZA 5CA5A 2F63A 3CCZA 2G2ZA 2VZ9A 3EMTA 3UDVA 2UVVA 4F8RA 1EP4B 1V5IB 2DIVA 2J9CA 3FRZA 4IG3A 1RWKB 2CQDA 4CT8A 5HMZA 1NKCA 2KFYA 1C1BB 1GMVA 3IS9B 4DS5A 2HQGA 2ZD1A 3CGIA 3EM1A 2FVQA 2ABYA 1U47A 1YSJA 2LQ5A 2FJDB 2RQ4A 4Q45A 2F4VJ 2DNOA 2XMJA 3O1LA 5HI7A 4CLWA 1M90T 1JXVA 3I4PA 2V8VA 2H1YA 1H72C 3FMWA 3IA0A 4ZN3A 4CO5A 1JXEA 1L5UA 4TY8B 3ADAC 3H4BA 2FYXA 5ETVA 1XR5A 4PQAA 1RDRA 2C3PA 3DHXA 1N88A 3ENAA 4K50A 3PRVA 3BGOP 2R7RA 2E1AA 3TI0A 5C42A 1RTHA 1YJRA 5L9XA 4CLYA 3S6EA 2BABA 2BJ7A 3DI6B 1NB2A 1B70B 3FBFA 3UD5A 4JI0F 1FJGJ 1APSA 1XNQF 1VQMS 1U1QA 2MQNA 2R9LA 3DYAA 5J2PB 3UW1A 2L9WA 5I42B 4J9MA 2IAJA 3O3LA 1JLQA 4LVNP 2GIRA 2C3YA 5J2MB 5DM7Q 3BH7B 3BBFA 4X65J 4HHUA 4NLTA 1S6OA 2EVZA 4OZ5A 2BACA 1S9EB 2EG2A 3IAS9 4J9QA 3JTNA 3CT9A 1X4GA 5E7OB 2CJXB 1JLBB 1FESA 4L72B 2F8HA 5C42B 2VJVA 2VQEJ 2DRAA 1HBUB 4O3SA 5HBMB 1S1TB 4IKAA 2HK3A 1PBUA 1TL1B 2RILA 3GYNA 3M8YA 4USWA 3RGIA 2CFXA 1S99A 2FVCA 1BMQB 5LL6d 2I38A 3CDBA 3HHEA 4K4YA 4CLFA 2GC8A 3BZQA 3CCMS 3GJSB 1TK8A 1RAOA 3DYAB 5J2PA 5EN1A 1X5PA 2O1PA 2XG8A 1C1CA 4RX6A 4OI1A 2QSWA 1TL7A 2BANA 2UV8A 1HBNA 1X7VA 3T5JA 3GPAA 3VVTA 5ETOA 1S9FA 3CMES 3S7RA 2KXFA 3HHDA 3NOCA 4A4JA 5A0YA 3X3UA 3LP2B 3L7PA 1ZM9A 1BQXA 1M1HA 2VG6B 3D0HE 3LGNA 3BR9A 2HFUA 4DZDA 4ZKAA 5EWGA 5FD1A 1FDNA 1JLGA 1MLAA 2DNZA 1X5OA 4DF8A 3UD4P 4NCBA 2GQQA 3IBCB 1QTMA 1WEZA 4JYAF 2ZNYA 2FC8A 2OD4A 3CWJA 3M8ZA 2F65A 3M2UA 2CVIA 3DCAA 4J91A 1A7GE 1P6TA 4DBQA 2ACMA 1VRTB 3PW7A 4H4KC 1DBDA 3O6QA 5ETPA 3Q22A 1L3TA 2FLPA 1IWGA 1YITS 2AWZA 1PYOB 1S6PB 1T9TA 2G1HA 1C2PA 4RKUC 3TZZA 5J2NA 1FNOA 3V6DA 2X1FA 4JI2F 5KFHA 4PWDB 2AJ1A 2PFDA 4LRCA 3ZTRA 1TAQA 3KLFB 2BUNA 2VICA 3V6JA 1YTYA 2J76E 2ZH8A 2UP1A 4ZVUB 3UNYA 5HJYA 4QWDA 4YR0A 1N8RT 1JLFA 1Z1ZA 3IG1B 1ZBTA 5E3PA 2J0XA 3N28A 3N6NA 1FVQA 3NCPA 5KFCA 3J7YU 3BO4A 4GVLA 2HG4A 2YKNA 4MTPA 3KG0A 2AYBA 2D3UA 3OL7A 2XTJP 4F3OA 4ZCMA 1U6BA 1QSLA 2HVHA 2I8EA 4H4MA 1K44A 3H2LA 3Q8YA 4R5PA 4CDIA 4F2RA 3HP6A 3D1QA 4ED4A 2D74B 2X3DA 4NXNF 1I51B 4DN0A 3CCSS 4DCJB 1VQYA 4J9PA 1FFWB 2W7PA 3FJ2A 1J5EJ 4NRUA 1LK7A 3LA0A 1UA1A 3D3CJ 3MZIA 4OYZA 3SIPB 2XM3A 1CJUA 4C8MA 2CPXA 3D6HB 4PABA 2QRRA 4QYRA 2J6SA 2HEKA 2HFNA 2YNHA 4K4WA 4DL5A 1JJ2R 3GFZA 3QT7A 2XSJA 1Y5NB 3BEGB 1D3WA 2A1BA 1RT6A 4C7QA 1S4FA 2W9CB 1ZM2A 3GMGA 3VZIA 3TARA 1HNWF 1S7HA 1AUDA 5C2CA 5F8HA 2B9XA 4LFBF 3BGRB 3H40A 2VG5A 4F36A 2A2CA 1YJ9S 1Y10A 2OIHA 1DTQA 2KVIA 1PAUB 3R5CA 1U25A 3C15A 3GV5B 2GVZA 2NREA 2E5LF 1P27B 4YMEA 4OZ0A 1TL4A 2JX2A 2X1GA 2RKIA 3I5BA 4ED0A 1T9YA 1S1XB 4NXNJ 3D54A 3KLHB 1NH7A 1NSAA 4ECXA 4OI0A 3L3CA 2BKPA 5DJBA 3EX7B 3ET6B 1AXQA 2LQBA 1U8SA 1LQ9A 4KE5A 3QJLA 1ZAVA 2CYYA 4TLQA 2NXJA 4ZVPB 3W5ZA 1BC6A 3BDPA 3ZZPA 2VC1A 1B64A 2OD6A 1SQGA 3A13A 5B0EA 2YPYA 2EXUA 1QE1A 4R0EA 4DX5A 2XCPA 7FD1A 4EUVA 2PMHA 3CC7S 3VVUA 3E3XA 3KTQA 2LCWA 2X7IA 2R4FA 4EYIB 2HKEA 2DXEA 3K17A 2EC2A 2W2OP 3JTPA 3CCRS 4OZLA 1UJ6A 1S9GB 2QTWA 1VBZA 5GAEU 1L3SA 3MAQA 4UOCA 3HZEA 4E2FB 3GR1A 4B17A 1X4CA 4WU3A 5J1NA 2H3EB 4ZHRB 3TAQA 2HHSA 3UQSA 2E5HA 4M5JA 4AL6A 1FX2A 5DZ6A 4WP8A 4LFAF 1UWBA 2YKPA 2ZHAA 1RYSA 3BM7A 4ZA1A 1X4FA 2EKYA 3A3PB 3CJ0A 4RBTA 4ZPBA 3NG8A 3I5CA 1O5JA 4LFAJ 3T9ZA 2B3TB 3OR1A 1WKKA 1R8HA 3GU0A 3R7NB 1VQSA 3FCWA 2DPIA 4IR1A 1H0HB 2JZ5A 2LDIA 5D0GA 2B56A 2FZGB 4RW6B 5KFBA 3GJTB 5F3TA 3T5HA 3R1HA 4PPDA 4KGVB 4NCAA 4RNFA 1JLAA 1T03A 1HWKA 2YY3A 4I2PB 3GR0A 3C6TA 2H51B 3JQKA 2OEJA 3EE3A 2C42A 2GA7A 3RAMA 3NWRA 1K1QA 1Q5YA 3FSXA 4B9MA 2GO9A 2JOQA 4Y3CA 5ETLA 4IRDA 3MEGA 4DV2F 5I42A 1K0VA 4KKOA 1PILA 4J9OA 3BYPA 1C0TB 1NDPA 2DB1A 4K8RA 2Z2LA 5DDRC 5H9EJ 1JIHA 2QE5A 4OZ1A 4JV2A 4ED7A 1XTZA 1S0NA 4UF4A 3VAJA 4LRDA 5GVQA 1FJEB 4CLLA 4UW2A 2R2SA 4RU2A 2VPZB 2R8GA 3DU5A 4L73A 3TQ1A 3NS5A 2ZJQQ 3W2VB 3Q89A 3W8GA 5K8OA 1NU4A 2HFZA 1IKVA 2WBMA 4DR6F 1MROB 4ICLB 4FP9A 1VHFA 3B6BA 3IRXA 4HR2A 2YVSA 4JV5J 2CQ0A 2HRYA 1Q79A 2CQHA 1T0TV 4A8OA 3MPVA 1WOPA 2HZAA 2NXUA 3GIIA 2GO8A 2AW0A 4NE9C 1IBCB 4OV6A 4DR1J 2E7VA 3EZOA 3MOZA 3PX0A 3GLJA 1RT3A 1TKTA 1WI8A 2XMKA 5KFXA 1N54B 2KDOA 2XEXA 3AB2B 1R3NA 2XI2A 3HD1A 3M32B 4P75A 1BUXA 2L9NA 2OGUA 2OEKA 5CYQB 4FZVA 4DV6J 4QPXA 3GIRA 5CABA 4X4QA 3DDIA 4NYOA 3TAPA 3FC9A 3IBWA 1SVDA 2OLWA 1HA1A 1NK0A 2BJ9A 4DR3J 2NXNA 1RBAA 1RU2A 1O8BA 1YRTA 3BV8A 3GCXP 4NEZA 4ZVFA 2MKCA 3H5UA 4DL3A 5CHCB 4QQBA 3POTB 2NUUG 5IT9Y 1PKUA 4RR5A 1VLOA 3TJAA 2QA2A 3KUHA 1DTQB 2YWWA 1NDCA 4UY8T 4DZ6A 3S8SA 3UVJB 1B3TA 1F60B 4ECYA 4DR4F 3LW5C 4JI4F 4RO0A 1UVKA 1Q7YT 1V9OA 3N5FA 3JS9A 4RW9A 3GJQB 3I9V9 4DHVA 2GMLA 2HSEB 2J7WA 4WYWA 2KI2A 4AXIA 1SL2A 2LQJA 4L74A 2AV5A 4ES1A 1XMQJ 2WOMA 4FYYB 3VR1A 1X4HA 5A8KB 2UXCJ 2VOPA 2O3DA 4IH6A 2CQPA 3JYTB 2DISA 2XZTB 4ZPCA 2HNDB 3KDOA 3ENQA 1KS2A 4IFVB 1OJ4A 4C0OC 2H5IB 2NLWA 2ZWPA 1YJNS 1GTEA 1S48A 3TAMA 4UOHA 4ZPVR 5HQMA 4ZCLA 2HHWA 2EW9A 3LP0A 4CH7A 5THWA 2COLA 4N56A 4DV4F 3MR7A 2AHOB 3QJJA 1LWCB 2B4VA 4A8FA 4O3NA 1YLXA 5IM0A 1UFWA 3EDRB 4QR2A 1WJ9A 4WE1A 3PR5B 1LWFA 3DOMA 4J90A 2H4YB 5KT2A 4NLQA 3AOAA 3TA0A 4QWEA 1TMJA 4LT6A 1DQ8A 3RUBL 3M05A 1EIYB 3LP1A 1UVNA 1FXLA 1TUVA 1VFJA 4ZVOB 2BDPA 5G4DA 3PJWA 2UU9F 1U6FA 5C25B 2HHVA 4YB5A 3OUYA 1NZAA 1RK8A 5AT1B 1KLNA 2DGUA 1HW9A 4HI1A 2H4WB 2HS4A 2HNZA 1Y9OA 4ZJOA 4OYAA 4JV5F 5T7LA 4K59A 5KFWA 4P9SA 4TU7A 3PRDA 4MKVA 4P2MA 4LF5F 3IR5B 3PV8A 2AZ1A 1ZA1B 3RB3A 3WX8A 2HQ3A 4JUZA 3QSYB 3OFEA 3FSIA 1NK7A 2CRLA 1RLDA 3PG9A 1ZZFA 1K47A 2AYGA 4K0KF 5FLXY 1KFSA 3B4MA 5D4NA 4O3PA 2KH9A 3W9IA 1HL6A 4KT0C 3MM6B 1D9AA 4LR9A 5C25A 4HACA 3DLHA 4DFMA 1CPZA 3W2WA 3HMJG 1N5VA 4IOBA 1DY3A 1HBOA 1HKAA 4B9NA 1VC0A 2AYMA 3AA8A 4ID5A 2YQ3A 1B0TA 4X65F 1DHMA 3DLGA 3FBCA 2RRNA 3EDQB 4MK9A 4NA2A 3V4MA 3B78A 2ILZA 4AD6A 1JX4A 1ZH5A 3T9NA 4OLOA 2BQ3A 2R7VA 1VQ8S 3MCSA 2ASDA 5K8PA 3DI6A 4LF5J 3Q8PB 4PUOB 2ZZNA 3RR7A 2CDRB 3LGMA 1KQFB 2OTLS 3WDOA 5K20B 3QBCA 2MB0B 3DRRB 1VR6A 3MM6A 1WG4A 3LP2A 4X2BA 2KHDA 4O3OA 1UEVA 2A18A 1SH2A 2B4OA 2DH9A 2VG6A 2FY1A 5CD4H 1SC1B 2U1AA 1Q86T 2HYIB 4B3RJ 1F9FA 2RQCA 3FEYB 3VHQA 3RB4A 2UXCF 3HJVA 4FXWA 4DCPB 1H3DA 1QD1A 3UWTA 2CZVC 1U1OA 2RVJA 1HLWA 1QM9A 4QYZJ 2XWYA 5MLCV 2ZITA 4UOFA 1NZ8A 1RP5A 3CDWA 4ZP9A 3ZTQA 1KVIA 3IAM9 1NAQA 1D09B 1F6TA 3QIPA 4TYAA 2CKWA 2V69A 3G86A 1T9VA 4QIEA 2GQ2A 3NEKA 2EKNA 4PYDA 4B02A 3C6TB 3HFKA 2NR0A 3CD6S 2ZOFA 4KIAA 4ECZA 4X64J 1KVJA 3K58A 2M9KA 4DSKA 4F4YA 4Q2LA 1QAYA 4ETZA 2OH2A 3ZNJ1 4Q7AA 3H20A 2CNOB 2LXFA 3I4HX 2XNRA 2ZDOA 3HHLD 3LPYA 4URSA 3EXCX 1NPPA 1ZYQA 1HYSA 1ICEB 4UUWA 1VOMA 2LA6A 4U8VA 3T6JA 2P9EA 3MD1A 5BR8J 3CIMA 1C4CA 2Q6BA 3BN7A 5DM6Q 4NCGA 4YUDA 2XULA 3GV8B 4DV5J 3U1MA 3BH6B 1K1SA 5I3UB 3BGUA 2CADA 3C16A 4QIVA 2UV8G 4CLSA 4J9UE 3DLBA 2MLZA 2VFTA 1U1KA 1OMSA 5KG5A 1NJXA 4WWSA 4F0MA 4KGXB 1VC6A 2M2BA 2ZUAA 2OSQA 3W63A 2JLGA 1U7LA 2IM1A 1TKZB 3TVKA 2RF2A 2XZDB 3FCHA 1BQNB 1DAXA 3JSMB 2H65B 2DR7A 1QUPA 3G96A 2LU1A 4DX6A 1OPIA 2I6WA 3EZ5A 3OPKA 2PN6A 1N5QA 4F4AA 5GAEI 1NKEA 3DLEA 1Q8LA 4NCGB 1TL5A 2HRUA 2VG5B 3JQJA 4K2JA 5B09A 5JJBA 4GO7X 3KMQA 3NGDA 2YKAA 4HHJA 3R9LA 3QYYA 4PPZA 5HROB 3IWNC 4QYZK 3NY0A 1YKWA 2OKQA 3DRSA 1LOUA 1SC6A 3MAHA 5LJ5Y 3AH6A 1NJWA 2BRLA 4CZCA 4WK1A 4XO0A 2AU0A 3C2PA 3SCJE 2OPRB 2K8GA 4X4PA 4JI1F 2MEWA 1XBWA 2B8PA 2WB1D 2CPEA 2FHOB 4IYQA 4USTA 4RZRA 1KFDA 3M9OB 3RBDA 2J0SD 3MURP 2GNKA 2W9BA 2JEGA 3DLEB 4F04B 4ED8A 3K5PA 5L39A 3P49B 1HD0A 3DRPB 4JI5F 2UXBF 2PSZA 3K8WA 2P9CA 3OJSA 3J80Y 1KP6A 1KWMA 1RI7A 3D5MA 3SCLE 3IR7B 3M8QB 1NK5A 1IR1A 3V2UC 1LXJA 4AL5A 1YGYA 4H54A 2WSCC 3VGUA 4ZCKA 1NB7A 2M8HA 4C0HA 1N34J 1RAGB 4JI2J 3KOAA 1QAXA 1CQMA 3ONQA 4ZP8A 2AF6A 2OMOA 4LR8A 4AXJA 1SL1A 1FWPA 2DHXA 2DHGA 4M5HA 4PG7A 4PRFA 2RNEA 4RW4A 4EO8A 1JNRB 4GVBA 4YS2A 3M6WA 4KV8B 2F7VA 5EHHA 5K8MA 3UNGC 4FF4A 2J9DA 1WHWA 2Q1LA 3KKFA 4D3HA 2R7XA 2X1BA 3NMRA 3VALA 4DV0F 4M95A 1BD6A 4NA1A 2FHKA 2K1RB 2D3OR 3HX9A 2AKWB 1M5KC 2YKMA 4HHHA 4FF3A 2B7CB 3SCKE 1YJVA 2WW8A 1HBUA 4DV5F 4CH0S 2CQCA 2BJDA 5BYSA 1REVB 3KG1A 1WHXA 3MR5A 2AQ4A 1JLAB 1RWXB 2W2MP 3CJRA 2SXLA 4G3IA 4GKKF 2XSFA 3Q8UA 2OPPB 4ILRA 1J27A 3M7VA 3QLHB 3CULA 3F73A 3NRBA 1D9FA 4OI2A 5J2QA 1MN7A 3NMAA 2BMBA 2VF3A 3DLKB 5ETTA 7AT1B 1S49A 1U48A 8RUCA 3CCLS 3F41A 4CLUA 3ICLA 3R97A 3OR2A 3M6XA 1CJVB 2DGWA 3B4DA 2Q79A 4YN3B 4PG8A 5BJRA 4WFBQ 3OHBA 2YWEA 3P5BP 3W2WB 1NBEB 2MKSA 3U1LA 5HQLA 2F40A 1WSRA 2HQIA 3D4JA 1GMWA 4L3KA 5B08A 2FZCB 3Q8VA 3TQEA 5KFTA 4B3SJ 3MPYA 5A6PA 2Y0BB 5M2PA 1KD1T 2ZH1A 3PIPQ 3OR1B 3NLCA 2WTFA 3CO9A 2LMIA 4I69A 3OXGA 3LAKA 4UUXA 1T9WA 5T41A 4NI2A 1DQ9A 2DH8A 4XDCA 3RJMB 1G3OA 1QY7A 2OPQA 1YWXA 4KO0A 5BXIA 2IIHA 2GW8A 2MQMA 3IO1A 3I0SA 4YFUA 2IA0A 2AJQA 1LW0B 1VISA 5KFRA 2HHPA 2R7UA 3OT9A 2EK1A 3VQSA 1SC4B 1RUSA 1UW4A 3DFEA 3DNCA 2GHVC 1NJYA 3M6UA 4ILLA 3TJ9A 1UVIA 4TYBA 1KTQA 1S1XA 5DG8A 2EWHA 1YI2S 3PKYA 3RW6A 2GJ2A 1LWFB 1NSPA 3DOMB 4OYBA 3JTOA 3FFIB 2W7OA 2R8HA 1OO0B 1S1UA 2K7JA 2GAGC 1KR4A 1S6QA 2V63A 2IVFB 4DPUA 4JV1A 4P7TA 4XK8C 3J7A1 3NAHA 2VFSA 1WUUA 5CCMA 3CXCR 2CWXA 4LR7A 3BGLA 3DOKA 2B0GA 1Y5LB 1NM2A 2R2TA 3LAMA 2QO3A 1HWIA 1WF1A 3HSZA 3T41A 2DRBA 5H9FK 3UDCA 1CJUB 3G6XA 2AEFA 4BS2A 1V5VA 1MWYA 3US5A 4ES2A 3DDKA 4RW7B 4C3MA 2R7SA 1I1GA 2PGCA 2WOMB 4DJBA 2HMIB 1B7YB 3ZZTA 4LF4J 1IVZA 1GH8A 3DKDA 2W2QP 4X4TA 3SSRA 4N77A 3C19A 3CJ5A 1U0HB 2HHQA 1FD2A 1LNQA 3EJMA 4KGKA 4S0MA 4P7VA 3SMZA 3CB4A 4ZK7M 4B9VA 5DLFA 2UU9J 2CQ2A 4KYZA 4KSEB 4DV7J 2MMYA 3ILJA 3M2VA 3POTA 3UCUP 2R2UA 1P8GA 1C1BA 5HVGA 2DGOA 1NSQA 1VRUA 3SSQA 4YHHJ 2W9AA 2C2EA 4LF9F 3QNWB 1FKOA 1N0UA 1IR0A 2A3JA 2CWKA 2OHDA 3FEZA 4PG6A 4Y6IA 2PEBA 1NUEA 2OEMA 2Z2MA 5JXSA 5SZTA 3R5AA 3BR8A 2CPYA 4CO1A 2HMIA 2KXNB 1T03B 1Q7LB 3KXDA 4M5NA 1VQ5S 3D7SB 1D8YA 1DLOB 3GSDA 1IWAA 4WFYA 2A6MA 4F26A 2DYAA 1DTTB 2CVEA 3HM9A 3PXGa 2XS2A 5IC6B 1FTCA 4EZ9A 2QV6A 1T02A 4XDDA 3K5OA 1Q0NA 1JLCA 2HS3A 5K14B 4OHVA 1C0TA 4ECVA 1YZ7A 4Q0BB 1PO6A 4O3QA 3ELHA 3J7ZT 3PVXA 1V3RA 1NK8A 2HBQB 1UEUA 3JXOA 1GNKA 5A8RA 1WDTA 3A1YG 4QZVB 5ITHA 1MWZA 4UQTA 1RT2B 2LEAA 5ETQA 4M5LA 4CYUA 3I0RA 2MZ1A 1VHIA 2W4PA 4J9VA 3RRHA 2EEYA 1FA0A 1RXOB 2CPHA 3K89A 1N5YA 4DR7F 4PG5A 4UOGA 2D7SA 5E3AA 2DNPA 4O4GA 2XY6A 5HQ8A 1VC5A 4WIIA 5A8WB 4WKYA 3R3TA 5KFGA 1B0VA 2QA1A 3ISZA 4BC7A 1IJEB 3AJ2A 4XPEA 1IBMJ 2HHUA 5A2QU 3ZTSA 3OFGA 1RKJA 3TUPA 2OPSB 4EFAC 3CCES 1ZTTA 2CQBA 3CJ4A 2MQ8A 2IVMA 5KFIA 1JLFB 4CM0A 2P8IA 4N41A 2VFRA 2DCLA 3KNAA 5K9FA 5ETKA 3BSCA 2CNLB 2FD2A 4EK2A 2O5DA 3H5YA 2DO4A 3I31A 4RNOA 1HHSA 3PW2A 1HNZF 1N5YB 1KVKA 4ZPDA 3PW5A 4IRCA 3ENWA 4IG0A 1UEKA 4WJBA 4AE5A 2N4DA 2BOAA 3GJRB 1HNIA 1WC0A 3D0IE 3NGRA 2VQFJ 4IRKA 3CJ2A 4CIOA 4N8NA 3I0SB 1ZPWX 1N56A 2HFSA 2EFGA 5AE3A 1WI6A 1HMVA 2Z4PA 3F56A 2Y1LB 5IQQA 2KG1A 3KJVA 3W62A 1HBOB 1Q95G 1RJJA 2PT0A 3L95X 1FVSA 1CJTA 4FYVB 2WONA 4Y28C 1JKHA 4DUTA 5D3GB 1X31C 4OZJA 5I3QA 3IM9A 4ZLPA 3GIJA 3NL0A 3OLBA 4QW8A 4OI3A 1OQ6A 4HYKA 5LXRA 4TY9A 3K5LA 6AT1B 2IPOB 1N6QA 3TP2A 1BY9A 3KDNA 4WZQA 4LFCF 2M70A 3I96A 4PXDA 2DGVA 5L46A 1WKJA 2Z8QA 3HD2A 1WC6A 2PE8A 1WHVA 2CNKB 3TUZC 2XLIA 5EX0A 2E5JA 2ZZTA 4DPOA 1JK9B 4MYUA 4X4SA 2W9BB 4QWCA 2BA9A 4DLEA 1RA6A 2KVQE 3BQ2A 2HWHA 5D6GA 2M0GB 1Z2LA 5HATA 4DWIA 1IKYB 5H9EK 3V4IA 1T3NA 2RDIA 3QWUA 2VG7A 3EPIA 4C48A 5LXYA 3K59A 2V8GA 2ZBIA 3MI7X 1X0PA 1ZA2B 3PDNA 2KHCA 1Y5IB 2RH3A 1R0CB 1HI1A 1OSCA 2AJ0A 3PR4A 3IWLA 1Y4ZB 1FRJA 2YKOA 1T05A 1RT1B 3ZZUA 4DCOB 4DSJA 4EBDA 1KNZA 4FKYA 2V8DA 2IY5B 2FPHX 2RS2A 1QE1B 4HH1A 4U96A 3ZZZA 4BWMA 3SEOA 2ZBRA 2VV5A 4QOTA 4DFJA 5KFKA 2KYZA 2QGFB 2QLFB 4BHQA 4E8UA 1NKBA 1O51A 2B4UA 2CPZA 2MYFA 3GP9A 2LXUA 3R5BA 5CH7B 5HVHA 2RDJA 1TKDA 4HT7A 3CCJS 4MH8A 2CJ9A 2YNHB 4HTIA 2BX6A 2V67A 2NYIA 1RTIA 3GYXB 2Q43A 3JSYA 1R8BA 4KRWA 4OI4A 1FWLA 1SQEA 2U2FA 3TZXA 1VIXA 2C2OB 2ROGA 3PACA 2RUSA 2XHCA 4A8QA 4GKJF 3KFWX 2O67A 3RG6A 4DL6A 3CJSA 3CJQA 5IFMA 1A0OB 4OHYA 2AEMA 3T3FA 3SCIE 2RRAA 1FRLA 2BJ1A 2JHEA 1U45A 1R0BG 2DNMA 1D8ZA 1FK9B 1AZSB 2L48A 3C16B 1TUGB 2XYPB 2HLUA 1F9EB 3IFEA 1X4EA 3LP0B 1ZZNA 3HHNB 1FEHA 3EVWA 3HT0A 4KHRA 5KG0A 2YNFB 5KFPA 2ADCA 2ZDPA 4WYLA 4WF9Q 4LRAA 4PXCA 2VFVA 1PGZA 3QGPA 4OL8A 1KDNA 4DR3F 1U2RA 4TVAB 2KRRA 1GMWD 3EUNA 2KFZA 1UZHA 4LF9J 3I32A 2H9ZA 1IM4A 3LO3A 1ZM4A 1ZAXA 5G0RA 1X9SA 1FDAA 5KT4A 1SJRA 1W7WA 3GZ7A 5IOLA 3IM8A 3TYTA 4ENOA 5CAAA 1HWJA 3CCUS 1S0MA 4M94A 5IC4B 1RAHB 3PO4A 3FGVA 1RHMB 5F8GA 3MMBA 2IYIA 4ZPTR 4QWBA 1RHKB 4I56A 1RAFB 2IC3A 1RWNB 3M2VB 4PAAA 3PY8A 4ZJQA 5DGBA 1HARA 2ZM6J 3RRGA 3CF5Q 2N4CA 3RR8A 2CQ1A 1SIZA 4F2SA 1B7FA 1AB8A 1FRXA 1UETA 1TELA 1U2FA 4I7FA 2F9JA 1S97A 3F44A 3OBIA 1PC4A 1H98A 1QDUB 4NEYA 1X5TA 2DNQA 1UVMA 4ZPAA 4ILMA 3NS7B 3FK4A 3M6VA 1S1WA 1ZM3A 2D9OA 2P5VA 3OV7A 1W25A 2GFFA 4CO0A 4ICLA 4ES3A 3TEHB 4JI8J 2M3DA 2GX8A 4IG0B 4DX7A 3CCVS 2FJXA 2WVFA 4WK3A 5AXKA 4RWWA 3PFEA 3K7RA 2CJAA 3RBZA 3TVYA 2BR0A 2DXFA 4ZLLA 2YNGB 4EBCA 3G9CA 1T7PA 1NLKL 1UKUA 4IQMA 5D4PA 1U24A 4KFBA 5LSRA 4YR3A 3DLKA 1R43A 4OHXA 4EMDA 3UD3P 2Y8YA 2LP4A 3QAEA 5H1SV 2BKOA 4N7TA 1XIQA 1GK8A 2YX7A 3AAWB 4LRFA 4Z7YA 1BLUA 4EO6A 1Q5VA 1PG5B 1UTAA 2CJKA 4OJHA 1S59A 2G2OA 5KFLA 5KT3A 4O4GB 4USHA 4LQ3A 4LFBJ 4K4TA 1RAJA 2VQFF 2EFNA 4I2QB 3NCQA 3PYGA 5FIIA 3KLHA 2HGLA 2MTLA 4YR2A 5K8NA 1CJKA 5HK4A 4Y2KA 1BXNA 2KTQA 2G13A 1RT5B 2MZRA 1S12A 1WORA 4AFFA 5CXTA 1FX4A 2E1PA 2VBXA 4NLRA 3ULHA 3N01A 2XY7A 1VBKA 3TZYA 4I67A 3T5LA 1MROA 2G0CA 1BWVA 4O0IA 2JFDA 1LV5A 4ER8A 1FKPA 1VBXA 1RT6B 3R8YA 3DMJB 4C4WA 1F5AA 1GAOA 3OW2R 3T1HJ 1FHTA 5F9LA 4EI2A 4C8KA 2WVEA 1RTHB 2ZH9A 4OJ3A 3C3LA 2XMAA 2Q66A 1OY9A 3B8HA 2HFOA 1CJVA 3K5MA 1M5OC 1FFGB 4WKRA 3UN3A 1VBYA 3PEJA 1DZ5A 4DV1J 3HKWA 5AJ3J 1LWCA 2CJBA 3KK1B 4C8ZA 3QATA 2UVUA 4C98A 3GSIA 1VYAA 4O4RA 2DNLA 4FYWB 4ZHRA 3O5TB 2Y8WA 1SQFA 3VAGA 2LECA 3OSPA 1QSYA 1HNXJ 1JLCB 2DGXA 4M63A 4MKBA 3MR6A 4DL2A 3RB6A 2XI3A 4C97A 1R7IA 1RWPB 4IG3B 2XYGB 1H2UX 4K5SA 4DFKA 2FLNA 4OYPA 3MM9A 4WBFA 1TKZA 3G6ES 1XK8A 2BQUA 1T8EA 1IBKJ 3ENVA 4RW7A 3FMBA 4OQJA 4DQIA 2G0JA 2GZOA 4I6AA 1TKXA 2CJQA 4EGLA 3ZZ0A 3G4SS 2C2MB 3V5RA 4XTTA 3HSJA 2ZM6F 2CPIA 4OYIA 1Q8IA 1U2CA 1NEEA 2B9WA 5A8WA 1LEOA 2CIMA 5F8LA 3G6YA 2FJWA 1YJUA 4BWJA 2W9CA 2NCKL 4AQYF 2KT3A 5A8KA 3V81B 4KTQA 3ETMA 1TL3B 3JYTA 4FS1A 2CPFA 3ITHB 4HACB 1YG0A 4W4MA 3BKFA 4ECUA 4KHMA 5AE2A 2WW4A 4RJVA 2OPRA 1RCXB 2WVDA 1MU2B 3G8SA 5RUBA 1YJWS 3Q2TC 4DUYF 2DR6A 3CSKA 3O2IA 2IFXA 4E98A 2M7SA 2P6TA 3SFGA 2C2NA 2FJBB 4BLGA 2PFFB 3G6VA 2DT9A 4MKAA 4ZVGA 3E01B 2ERRA 4LF6J 3I6PA 1G6BA 1REGX 3DRPA 3EWGA 3BBCA 3GTYX 5A76A 3LTOA 2VH7A 2KG0A 2FHJA 4JI1J 4DR7J 4G1QA 1W2BR 4F02A 3BYRA 5DG9A 2G4BA 3NNHA 2QLBB 1RSCA 2OELA 4RNHA 2JWNA 3OD2A 3CD0A 2DCUB 3SSSA 5FLXU 3OUYB 1WTBA 3I55S 3TUIC 2GAHC 3GILA 1NK4A 1EETA 3PO5A 4ELUA 3MEGB 4DR2J 2HURA 2KYXA 2Z56B 1NO8A 3QFWA 2FQQB 3MM5A 1RU1A 3BKTA 4OYOA 3DGPA 2FLLA 1P1LA 3ISNC 4K2XA 2K3KA 1M1KT 1FRIA 4RW8A 5EWEA 1LW2B 1PAEX 4M1KA 3H2VE 4DUZF 4A46A 4B3MJ 2BM1A 1HBNB 1H7WA 4MAKA 5KAKA 3QZ8A 1LWXA 2KO1A 3BF4A 3D6TB 2W01A 3MHYA 3EYZA 2MY7A 2BW2A 2XHWA 3DXSX 2XMTA 2RE1A 3JAMY 1U09A 1M1GA 2R3VA 4LJMA 3WC0A 3DM2B 3BO3A 3W65A 4JV0A 3AQOA 3PW4A 4USIA 3V6KA 1KLMB 1TU0B 5I4MA 4IH7A 3BO2A 3V6HA 3PZPA 2BOPA 2XMUA 4J7CA 4EZ6A 1N48A 1WC5A 3H2UB 5D8HB 2C2ZB 1PJ5A 2VG7B 2FLOA 1WC1A 2W4DA 1EHWA 3QAUA 3WIUA 3HK2A 4MK8A 4GRSA 1LWEA 4KAIA 3THTA 1OSDA 4DG1A 3LANA 5LMUJ 4Q8FA 4WXWA 2MQPA 4X4OA 2UUAF 3FZ2A 2CXEA 2V94A 2FY8A 1ZPVA 2XS7A 2MKKA 4LF7F 1Y0HA 3PEHA 5M2UA 3RBXA 3BSOA 2VQEF 4JBCA 5HMWA 1SJFA 1QAJA 4NYZA 2FGCA 2QA4G 4NWBA 1U0SA 1FXDA 2VKZG 4K4XA 1HQEB 2HZCA 4LF7J 2H54B 4Q2MA 3NS6A 2FHMA 2OSRA 3OHAA 4F0KA 2OJ3A 3HO1A 3IRWP 2B43A 3RAXA 2GV1A 4F0HA 1FDDA 3QMQA 2N7CA 2R2RA 4K4SA 3Q86A 3QRRA 3NGUA 3M2RB 3HULA 1C4AA 3THVA 5ETSA 4Q8EA 1V3SA 3DOLB 5KFUA 2CPJA 1YBAA 5KFSA 4JI0J 5HMXA 4NZ6A 2M5YA 2PA3A 2AP6A 3TANA 3CIZA 2MPUA 4P52A 5D77A 4TN2A 1WF2A 2CDQA 2Q3PA 5IZHA 3NOGA 2ZBQA 2XLKA 3KUGA 3AJ1A 1UPPA 3UPFA 1JWWA 3H0PA 2HAIA 1EB0A 2E5LJ 4PZVA 8AT1B 5IXUA 2EFOA 4NLUA 2MXYA 4ECWA 2VBZA 4ED6A 2VA2A 3C46A 2V6AA 3QT5A 1J2VA 3AD8C 4Y00A 5KTQA 4NL5A 3WC2A 2ZE2B 1RABB 2IYGA 1T3OA 4KB7A 1H2TZ 2MHEA 3AQPA 1TKXB 1SH3A 2MHNA 4CWBA 3KLIA 4A8KA 1CVJA 3P5TL 4PQUB 1TVRB 2V0NA 5E3QA 3WHIA 1R31A 2JLEA 2KKHA 1VRQC 1JB0C 1RQ0A 1Y3KA 2JLFA 3OTDA 4L75A 4NMXA 3TJ8A 3HSGA 1N36F 3M8QA 4LVOP 2WRMA 5B0GA 2MGZB 4Q0BA 1X4BA 2QMUB 3R7SB 1EX8A 4R8UB 4QIWD 2FTRA 2UVRA 2OP5A 3GYGA 1ELOA 4CQ1A 1F0XA 2QL5B 4P2XA 4DSEA 1AFIA 3BS9A 2BVZA 3DLJA 1E6VB 3M1VA 1BGXT 4K0KJ 4EBEA 2NYHA 1OS5A 1RT4B 1D1UA 1FRMA 4CYUB 1XR7A 2PO4A 4YY3J 4LF6F 5IWAF 3W8PA 1CULB 4X66F 2XO6A 3RYLA 4KY3A 1DFDA 2GJIA 4XPCA 4Q43A 1XERA 2VJUA 3SV4A 2VODA 2A2DA 3GFYA 2XC9A 4G1QB 1WG1A 2YH0A 2LLZA 1ZTWA 5DETA 2IMWP 3J7YI 2GMJA 2E5IA 2CQ4A 2YNFA 4R8UA 2AGPA 3EGVA 3MEDB 3HPOA 4RUBA 3H7HB 4OX7A 1FD8A 5MAOA 1OYEA 3JSBA 2DR9A 3MF5A 2E29A 3MCOA 2QZ8A 3W9JA 4BCAA 4OX8A 2Z30B 4L3NA 2F5GA 1U6ZA 2FVSA 1SKWA 3NBPB 1K73T 5EX3A 3VV2B 4DV4J 3MECA 4LBIA 1UWAA 2JC1A 5DDOC 4FPRA 1VMBA 1L3KA 2RU3A 1A9NB 3S01A 1NRKA 3MMAB 2IRXA 3D28A 3HZGA 4B3SF 1S6PA 2WVCA 5A6WA 1RAAB 5J2NB 1TL3A 3V6DB 3N5BA 3IR6B 4UT4A 2ZWOA 4FS2A 1SJ3P 3HHLA 2RQKA 2ZH6A 4B9TA 1S57A 4LF4F 1OPZA 3SYZA 5CYJA 1FF2A 4TU8A 1F9HA 2DHSA 2YKNB 1Y3JA 2PD1A 4NRTA 1IM6A 5HN0A 1X9WA 4M5IA 2FZKB 1LWEB 4ZOSA 4DV1F 1N6QB 4DR4J 2HRTA 3ZTOA 3DMJA 1MMLA 4QR0A 3D68A 4MIWA 3CJ8A 2KRBA 4E0DA 2J9DE 1KOHA 2QFIA 3BN4A 4GKKJ 1FRHA 2YWGA 1WOSA 3LGHA 1RTDB 2OUGA 4LIWA 1FNMA 4NLWA 3AY0A 4OZ3A 3EICA 2NPFA 4ZN1A 3LWMA 1RAEB 4QU6A 3R5GA 1KRPA 2VONA 2NS1B 1GFWB 2AD9A 3T1YF 2AJ4A 4QCLA 2PC6A 3FUYA 4FYXB 4HT5A 5A2QY 3TVZA 1ITPA 5DG7A 4RL1A 2FVRA 4F50A 3MFHA 5LSOA 3SZ2A 1UA0A 2E1CA 2OPPA 2ASYA 3P4UB 3FFIA 4I6WA 2VB6A 3G8QA 4WXOA 3T5KA 1MW7A 4YDXA 2RD5C 4EEYA 1O0PA 1W26A 4ED1A 1HNIB 3D6MB 5D4OA 4NA3A 3CC4S 4CP5A 1SKUB 3KJFB 3CCTA 3DRRA 3NGTA 2V5HG 4B3TJ 3KK3A 1S1WB 3EVOA 4KC5A 3PYFA 2Y3YA 5GMEA 3DOKB 2PI5A 3OTEA 1QSSA 3G8TA 4TLRA 2GVZB 3N0VA 2R8IA 4P6QA 2J6UA 2DY9A 2HQFA 3NGSA 4Y2AA 4FNIA 1VI7A 3ZTPA 1FE0A 3MEKA 4DL4A 5HP1B 1V3ZA 2JNJA 3J7Z5 2XMVA 1U8WA 1V6HA 2CPDA 3BPDA 3CJ3A 3TNVA 2XNQA 2N82B 3KLGB 4LF8F 3H59A 2E66A 1NK6A 3T1YJ 2V8HA 3QT8A 4DG1B 2W8LA 3X1LB 5KT6A 4X4NA 2BJ3A 1CQNA 5BYRA 4ZVTB 3PFOA 5LSLA 2XGPA 2QSFA 2JFKA 3MEEA 3HXMA 2D1CA 2EFQA 3RTVA 2Y1JA 2HPUA 2B8QA 3SDEB 4TY8A 4ZLNA 1T9XA 3C14A 4UTGA 3THPA 2KZZA 4AL7A 3KMSA 3DRSB 1UL3A 2GVDB 2IM3A 2FB0A 2ASJA 1IBLF 4A8SA 4ZCIA 4B3TF 5GADU 1UJ4A 4TU9A 5D15A 2MQOA 4RUAA 2BYCA 1HNZJ 4F4KA 2YPZA 1CJKB 3DGVA 3HCXA 2HBZB 3Q24A 4CRJA 1EKSA 2GIQA 2LQ8A 2PMWA 5L1IA 1RGVA 4I6YA 2XLJA 4DU8A 4RU9A 2DJWA 2YQ0A 3VTIA 1RYRA 2A6OA 2RJZA 4IFVA 6FDRA 1DTTA 1G2EA 4DPXA 1VJQA 4DLGA 4M5DB 1SH0A 2GCFA 4NZ0A 5ETRA 3GFHA 3U1NA 2L3MA 5J2MA 3KK2A 4DQRA 1F3VA 3A3NB 4M5GA 1NHUA 1RT7A 2ILYA 1HI0P 2HFVA 1LFWA 2WZ1A 4GO5X 1SUQB 1Q81T 4DQSA 4ZVSB 4YB1P 4BDPA 5E2QA 2MZTA 1YDLA 3F0NA 4ZVRB 4H4OA 3ISND 3L7OA 5B7WA 5DDPC 2ZZMA 1UZDA 1PBAA 2P6SA 2VL1A 1U0HA 3C66A 4OFZA 2OTJS 2POKA 1N34F 3G82B 3K57A 1XN9A 3MECB 3J80U 5IS2A 1EAYC 1S1VB 2E9ZA 2LXIA 5HROA 4B9UA 1BQMA 2V4JB 3GONA 2KJVA 3I87A 3HVWA 1HWLA 3D66A 3KG4A 1WC3A 2NPIA 2WAQD 1TUWA 2WB4A 1ZAWA 2Y1RI 4JI5J 3MCNA 1NSKL 4I1TA 1XMQF 1QLNA 3MM9B 2DNNA 4F67A 3JQMA 1TK5A 5KG2A 2W8KA 1Y00A 3TW0A 1KEKA 1SUQA 1S76D 1RWOB 3ZZOA 3QIPB 2BE2A 4JP8A 5AXMA 4Y65A 2HVDA 1LW0A 2K7KA 2QMWA 3CJKA 3M2UB 3MM8A 1I3OB 4DUYJ 3GB0A 2UXBJ 3IC1A 2E9RX 3T1AA 4OIXA 3JSRA 3C8YA 4CNZA 1DJ0A 1X9MA 1J5OB 1LXNA 1GQEA 1S1VA 4RLEA 3HHLC 2HHXA 1RTZA 2KXHA 2YWHA 3UDEA 1YIJS 4IOCQ 2DHHA 1RWMB 2K3IA 1FJCA 2RQMA 4I2QA 5EGYA 5DLGA 4DF4A 1SBRA 2ZC3A 3BPSP 5DZ7A 4DX8H 2HVEA 2UZAA 1RBOB 3GG1A 2VOOA 1X60A 2EBGA 4G65A 4ATNA 5L9NA 3HHKA 5C2GA 1WEYA 2X3GA 3MGJA 4YQWA 3EGNA 1CJTB 2D3O1 3VCDA 4PUOA 5D3GA 3M8WA 4FPIA 2K06A 1OQ3A 3CMQA 3ZNUA 1E6YA 4HDGA 2N7YA 2YTCA 1FT8A 3BREA 2Y9HA 2LU2A 1SV5B 2MKHA 1RHRB 4WTYA 4USUA 2V50A 3G71S 1GXUA 1HR0F 1IQZA 1PJ7A 1JJ4A 2QA4S 2NXEA 3OTOJ 4OI6A 3TR5A 1MMDA 1WD6A 5KOXA 3TA1A 3KHHA 4O3RA 1AW0A 2J7UA 4K7QA 4ZP6A 2CAJA 2ZKUA 2KU7A 3Q23A 4Q5VA 2C3OA 3H4DA 3KUEA 1VK3A 4KH0B 5HSPA 5GAHU 2VU5A 2HVZA 3VF0B 3P3DA 1OWXA 2FJVA 4FDFA 1IKXB 2I2YA 4HKQA 1QVFR 1MNEA 3PW0A 3QLHA 5DS7A 5J2QB 2D41A 1S6QB 4PWWA 4ZMMA 3AFGA 4Z2XA 2D9PA 3EXYA 4RPFA 2VA3A 4KJIA 5B0BA 2LVWA 3MPWA 3UR3C 1B99A 4PWUA 4X64F 2VD3A 2CJYB 3SDEA 1E6VA 1GX5A 1RZMA 3M1VB 3KLFA 1Q4RA 1R89A 2L41A 3TOQA 3E8OA 2QJ3A 2RKIB 1NJZA 2IHR1 1VLYA 2V8PA 1RISA 2DGTA 2VDIA 4OX9J 3OVBA 3N79A 3TA2A 4DPTA 3MR3A 4KR0B 4LSNB 1JLQB 3AODA 4NX9A 5E3RA 8ATCB 2LFVA 2MJUA 3W1YC 2ZJPQ 5KFVA 1KHVA 1QAIA 1OYDA 1S0OA 3LPEA 3A8IA 4J5OA 3GG0A 2RAQA 4ERDA 2BE9B 1U1NA 1XEZA 3IMQJ 2A0FB 1IBMF 3IS9A 3U02A 1GXLA 3VGSA 3KK3B 2ZE2A 4P72A 1Q1KA 2GHWA 4NLOA 5HJXA 4WFZA 1RT2A 3A4TA 3VWSA 3A3OB 1BWEA 1NPRA 2DNYA 1RLCL 2QMXA 3M8PA 3TWZA 5C7PA 3NBPA 1VRUB 1MMNA 3MD3A 3K8VA 4USKA 2MZSA 4MYTA 1FKOB 5BYQA 1C1CB 2HBYB 3WX4A 4DFPA 1SB6A 3ETOA 3HVAA 3Q8QB 3AOBA 4DR2F 3HFZB 5E41A 2KZMA 2B4PA 2ROEA 3MAAA 3MXHP 2F8EX 4WFXA 3HVRA 2BKNA 4QIFA 3UFCX 3GCWP 3VAHA 1U49A 1REVA 3GWCA 1TK0A 2BM0A 1VQKS 3PHEA 3MWBA 3QGIA 3MMCA 1NJIT 1EARA 2NQPA 5H9FJ 2AEJA 3FSYA 4CI0B 4CO2A 4DEZA 5KG1A 1A6LA 5I3PA 2DIUA 3VGTA 5C5JA 4WE1B 1F5CA 5A8RB 3Q0AA 3N6MA 1VQ9S 4LUBA 1RTIB 2DK2A 4F25A 4DDFA 1U26A 4ELTA 3V81A 2JDJA 1ACMB 4OHWA 1HFEL 2HWTA 3QO9B 2M52A 2RHQB 2UUBF 1LK5A 3DU6A 1U1LA 4U6PA 2AJ2A 1AZSA 1HQUA 2BQRA 3QQCD 4DR5F 2IMOA 3AHPA 1X4AA 5GAHI 3W60A 3MMJA 5IV3A 3AXKA 2UXDJ 4M8LA 1FERA 3B54A 4X66J 4RNMA 4GC6A 3CDUA 2YXLA 4MMOA 4IO1A 5L8RC 3MUMP 3P8BB 2LEBA 2AIRB 4K4ZA 2DNHA 1ZOTA 4YDDB 4ECTA 2ZC4A 4H4OB 3UCGA 4TNOA 2J9EA 2DTJA 2QX0A 4UZBA 1FDBA 2PEHA 5LOQA 2ZOGA 2M88A 4KQZA 2CG8A 2P9GA 3G87A 3H90A 4PG4A 4DL0C 4DMZA 2HNYA 3OFHA 4ED3A 2JRSA 9RUBA 3CC2S 1P9QC 2CA9A 3MMBB 2ZH7A 4IQXA 3Q83A 1BQMB 1FXRA 2V4JA 4I68A 4PCQA 3KLVA 2WCXA 3AA9A 3L09A 4P10A 5AE1A 2QYCA 2ASLA 1UFKA 5ETNA 4EU0A 2JVOA 1VQPS 1XMBA 4Y2IA 5L1KA 4J9KA 2HS0A 3MUVP 1YK9A 3M2RA 5AJ3F 1JLEA 1HW8A 1MN9A 2VBWA 2ATCB 1KONA 3M32A 5CYQA 3WQPA 2B5JA 4RWXA 1K9MT 1S77D 2JEIA 1HWUA 1RHJB 3NCRA 2R7QA 4C2MA 1ZS6A 5JUMA 2BE7D 1S4EA 5IV4A 1Q16B 3LF0A 5CD4A 4Q44A 1KC8T 1SKSA 2RHSB 1KHWA 1I6JA 5U47A 2XY5A 2AGQA 3CNQP 3SBMA 1HD1A 1SKRA 3SV3A 3ZZRA 1QVGR 1G1XA 2KB2A 1LFPA 3H5SA 2MJNA 4Y2MA 5D0EA 5DDQC 2QIFA 4ECRA 4WZMA 1CSJA 2DEJA 2R7WA 2QYGA 3MTJA 5T14A 3D2WA 2YKQA 4OX9F 5DGAA 3ZFVA 1WOOA 1P1TA 4DR1F 2BBEA 3FCVA 4W92B 1I94J 3V4IB 5L38A 4JI6J 1TFYA 4L6V3 2E9TA 2WVBA 1N32F 4OZNA 4MKYA 4CH1A 3N6LA 3CPWR 3HSDA 1VRTA 1HNVB 3IWXA 4KGMA 1RWWB 3PYEA 1IKWB 1FEEA 4WTOB 3TUJC 2IJNA 3MM7B 3FQLA 4HL9A 5CYMB 1HPZA 3A12A 4NLVA 2MZJA 3CJTA 3CMAS 1HYSB 4DR6J 3CEDA 4F4XA 4DPYA 1KKHA 2AZ3A 4U9RA 3UI3A 1PSDA 4BC9A 2VC0A 3KLEA 2GMHA 2UUAJ 2UUCF 1TP7A 3PYDA 2VPWB 4CTAB 5LMUF 3HF5A 1XMOJ 2O66A 3U7JA 3MEEB 5F41A 5L1JA 1I5OB 2BJ8A 2BEFA 2J0QD 4A8WA 3SQGA 2IAJB 2OAUA 2XS5A 5GMKa 3KWMA 4PKDB 3AT1B 4QIGA 2XGQA 2XCAA 3BJYA 3NGKA 1VS3A 2E7WA 2HGNA 1RB0A 1H7XA 2WSFC 4FVMA 4HI2A 3H25A 2ZHOA 2ZH5A 4ZVEA 1J5EF 1R8AA 3BQ0A 1ZETA 2IDLA 2DGSA 4G1IA 5HAOA 3GIMA 2ZEJA 1QTNB 2IDEA 5KFJA 3BSNA 5FDLB 1S1TA 4I7FB 3MPUB 3RZAA 2VHGA 1S0VA 2HNZB 1TL1A 4DV0J 4LBHA 2FVPA 2W7AA 1FJGF 3RU0A 4CTAA 3BDEA 3D3BJ 4GVBB 3GE9A 3LUYA 2PIIA
chains in the Genus database with same CATH topology
1U0HB 3C14B 4P2FA 3C15B 4OZ3A 1AZSA 3R5GA 5D0HA 1CJVA 5IV3A 4CLLA 1CJTB 1TL7B 1CULA 4WP3A 5D0RA 3G82A 1Y11A 2QV6A 4USUA 4CLZA 4OYWA 1YBUA 4OYPA 3MAAB 3C16B 1AZSB 2GVZB 4OYZA 1CJUA 1YBTA 4WP9A 1YK9A 4CLWA 4OYIA 2BW7A 4CLUA 5IV4A 1Y10A 4CLTA 1CJVB 3C14A 4WPAA 3UVJA 3C15A 2GVZA 2GVDB 3UVJB 1CS4B 4CLYA 4P2XA 2GVDA 4OYMA 5D0EA 4CM0A 5D15A 1AB8A 1CJKB 3ET6B 4OZ2A 4NI2A 1CULB 3ET6A 4CLKA 3C16A 4CLSA 1WC0A 4OYOA 1CS4A 3MR7A 2WZ1A 4USWA 1CJTA 4OYXA 4OYBA 4USVA 4CLFA 4CLPA 2W01A 4CM2A 1TL7A 1U0HA 3G82B 1WC6A 3MAAA 1FX2A 4WP8A 1WC3A 4OYAA 1CJKA 1CJUB 1WC5A 4USTA 5D0GA 4NI2B 1WC1A 4P2MA 1WC4A 1FX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0H B;  3C14 B;  4P2F A;  3C15 B;  4OZ3 A;  1AZS A;  3R5G A;  5D0H A;  1CJV A;  5IV3 A;  4CLL A;  1CJT B;  1TL7 B;  1CUL A;  4WP3 A;  5D0R A;  3G82 A;  1Y11 A;  2QV6 A;  4USU A;  4CLZ A;  4OYW A;  1YBU A;  4OYP A;  3MAA B;  3C16 B;  1AZS B;  2GVZ B;  4OYZ A;  1CJU A;  1YBT A;  4WP9 A;  1YK9 A;  4CLW A;  4OYI A;  2BW7 A;  4CLU A;  5IV4 A;  1Y10 A;  4CLT A;  1CJV B;  3C14 A;  4WPA A;  3UVJ A;  3C15 A;  2GVZ A;  2GVD B;  3UVJ B;  1CS4 B;  4CLY A;  4P2X A;  2GVD A;  4OYM A;  5D0E A;  4CM0 A;  5D15 A;  1AB8 A;  1CJK B;  3ET6 B;  4OZ2 A;  4NI2 A;  1CUL B;  3ET6 A;  4CLK A;  3C16 A;  4CLS A;  1WC0 A;  4OYO A;  1CS4 A;  3MR7 A;  2WZ1 A;  4USW A;  1CJT A;  4OYX A;  4OYB A;  4USV A;  4CLF A;  4CLP A;  2W01 A;  4CM2 A;  1TL7 A;  1U0H A;  3G82 B;  1WC6 A;  3MAA A;  1FX2 A;  4WP8 A;  1WC3 A;  4OYA A;  1CJK A;  1CJU B;  1WC5 A;  4UST A;  5D0G A;  4NI2 B;  1WC1 A;  4P2M A;  1WC4 A;  1FX4 A; 
#chains in the Genus database with same CATH topology
 2IBO A;  3HDS A;  4N5S A;  3D1O A;  2GS8 A;  5KFY A;  2Z0G A;  4AT1 B;  1JMT A;  2BAN B;  3CD5 A;  3OL9 A;  4LQ9 A;  3PCO B;  3W7B A;  4JOU A;  3GV7 B;  2DGQ A;  5HMY A;  5G0R B;  2K1R A;  3TX8 A;  1NHV A;  2DHA A;  2OPS A;  3VAF A;  1PYS B;  4OV1 A;  2XO7 A;  2I9S A;  5D0H A;  3TAM B;  5LMN F;  2KL8 A;  3TEG A;  2MKI A;  2HZV A;  4PR6 A;  1JJC B;  3UO0 A;  3LQV A;  3E2E A;  2KFN A;  1DLO A;  3IXQ A;  4QPT A;  4ZVH A;  4DU7 A;  2N3O A;  4WCE Q;  3OL6 A;  1VJW A;  4C6A A;  5KFO A;  2X1A A;  3QJP A;  1CUL A;  1IUJ A;  1N33 F;  4M5K A;  2AJF E;  1SV5 A;  1SIW B;  1X4D A;  3HVT B;  2V4Q A;  2UUT A;  2R8K A;  2VIH A;  4OJG A;  3R2D J;  5DQH A;  4A8M P;  4OYW A;  2FJA B;  2PMZ D;  2GHP A;  2D69 A;  3ITH A;  6FD1 A;  4PWD A;  4LSZ B;  2DH7 A;  2QT7 A;  3MED A;  2VDH A;  2H5J B;  1UVL A;  3H42 A;  2IJR A;  2YWF A;  2VPX B;  3CD7 A;  1RT3 B;  1TKT B;  3QFH A;  2DKO B;  4CT9 A;  3W3S A;  2UUB J;  1CEZ A;  2BE2 B;  2HBR B;  2GIF A;  4ELV A;  4C8Y A;  4AQY J;  3BSA A;  2YNG A;  1Q8K A;  2I5J A;  2KJW A;  4NOH A;  2DR8 A;  5KFF A;  3OJU A;  4QBU A;  1DAR A;  4YP3 A;  3UCZ P;  1F2H A;  1YVF A;  2RB7 A;  1J5O A;  4U7U D;  1F5B A;  2F4F A;  5KFA A;  1GEH A;  3P45 B;  4MFB A;  3AB4 B;  4X4R A;  4TQS A;  5HLF B;  1HBM B;  1JJH A;  4U7U K;  1VQ4 S;  3TZW A;  1YRX A;  1GXT A;  4CO3 A;  1D0E A;  4KPY A;  4J9R A;  1U1R A;  1F1B B;  2VKR A;  2IA6 A;  2QL7 B;  2F3J A;  3UVJ A;  1IBK F;  1TV6 B;  3QO9 A;  3HHL B;  2IRU A;  3SXL A;  3J81 U;  4F3M A;  2B9Y A;  2AGO A;  1MSW D;  4K4U A;  4B08 A;  3HKZ D;  4ECQ A;  3MOJ B;  1VGY A;  2ZVI A;  1SPB P;  1IR2 A;  2IC3 B;  4OYM A;  5HP1 A;  3CE8 A;  1YQH A;  4JI7 F;  1T95 A;  2QFJ A;  3D67 A;  9ATC B;  1VQN S;  1EKR A;  5BR8 F;  3IP0 A;  3IRX B;  2H5E A;  2YQ1 A;  4ANE A;  2LKZ A;  1RT1 A;  2FGO A;  2B6A B;  2NSC A;  1X8D A;  3M9M B;  3EPG A;  4NLG A;  2LQ9 A;  1XQI A;  4I2P A;  1FTR A;  1FWK A;  5DQG A;  3RW7 A;  1FO1 A;  1N52 B;  1GT8 A;  1TR0 A;  5HAN A;  1UMJ A;  4HH0 A;  1IN0 A;  3FZB A;  4X84 A;  3PM9 A;  1M5H A;  1XR6 A;  5KG3 A;  1JKH B;  4LSL B;  2QN6 B;  2J8A A;  2DRD A;  1HPZ B;  4U95 A;  3RRK A;  4QWA A;  1SXL A;  4DPW A;  1S72 S;  2EI5 A;  1N5T A;  2C1E B;  4W98 A;  3QPI A;  2MZQ A;  1S10 A;  1PYT A;  4NLS A;  4MIA A;  3KLI B;  5F0W A;  5GAG U;  2WK4 A;  4KO0 B;  4WU2 A;  2H48 B;  4ALZ A;  4CLP A;  3CDE A;  3HFV A;  3PJX A;  3R27 A;  4FVC A;  2YBV A;  4K4V A;  1RKI A;  1T9U A;  2ZHB A;  2R8J A;  2DIT A;  2CNN B;  3SQG B;  4M5D A;  4JI3 J;  1UJ5 A;  2W1B A;  1UCN A;  2HK2 A;  3W5Y A;  3K2Y A;  2DY1 A;  4JB8 B;  2JC0 A;  1VQ7 S;  3KJN B;  1XNR J;  4G6V B;  1VK8 A;  2RIJ A;  4ANC A;  4B9L A;  2OI2 A;  1IQT A;  4BBY A;  4B3O A;  5J1P A;  1HQE A;  2JL9 A;  2V68 A;  1NXI A;  2EFP A;  1NCL A;  2CUY A;  1CBK A;  2EK6 A;  4RUH A;  4LSN A;  4J9L A;  1FKA F;  2M8D B;  1WC4 A;  4HEA 9;  4P73 A;  4IUF A;  2ALZ A;  4JYA J;  1H74 A;  3R5J B;  1S1U B;  2YH1 A;  1WNE A;  5B0C A;  1LKZ A;  4DQP A;  4J9S A;  3DOL A;  1XMO F;  1T05 B;  1ARO P;  2IM2 A;  3AD7 C;  2B51 A;  1JXL A;  3ILI A;  4ZIW A;  5F8N A;  2P2C B;  1XWL A;  1FCA A;  1NHK L;  3C14 B;  2APO A;  2A10 A;  4P2F A;  1T94 A;  1K0T A;  3FDS A;  4DSI A;  3BGF A;  3DGP B;  1W2I A;  1S79 A;  3GFX A;  2VAS A;  3IGN A;  5CQG A;  2KM8 B;  3A8E A;  3C6U B;  4LBP A;  4B9S A;  4C8O A;  1RTJ B;  3OTO F;  2W25 A;  1G4C A;  2VPY B;  3OVA A;  4JI8 F;  2HQC A;  3W66 A;  1C0U A;  2HWI A;  2I1R A;  3FBB A;  4JI6 F;  4ZLJ A;  2DNR A;  1VQ6 S;  3R2C J;  4ED5 A;  4IR9 A;  2GGP B;  3KNG A;  3NKY A;  3QGG A;  2V9K A;  3NXZ A;  2JSX A;  4RUC A;  1IBL J;  4KV8 A;  1KTV A;  1CC7 A;  2DVI A;  5EWF A;  1R8P A;  1EQM A;  2VUG A;  4X4V A;  4JI7 J;  4DV3 J;  3WBZ A;  3QWP A;  2V2V A;  2Y0S D;  4P2S A;  4ZJL A;  1O6X A;  2IVY A;  2V2Q A;  2GQC A;  1KLM A;  5LT5 A;  5GAG I;  3K5N A;  3MDF A;  3O44 A;  1AYE A;  2J8S A;  2O01 C;  2BV3 A;  4PXB A;  3PRB A;  2ZOM A;  4PEO A;  3S1T A;  5J1E B;  3OXF A;  5D4L A;  3CCQ S;  4CCH A;  2YKM B;  4GMK A;  2C22 A;  2XB2 D;  3H98 A;  3CO0 P;  1EET B;  2ZKT A;  1JNZ B;  2DO0 A;  3NAI A;  4IDK B;  2QG9 B;  3IGV A;  3B82 A;  4WP9 A;  1UP1 A;  2LYV A;  2W24 A;  3SQO P;  4FBU A;  3QRP A;  1FE4 A;  4DUZ J;  2B5J B;  2LDY A;  1HQ2 A;  3KHG A;  2UUW A;  3AXM A;  4HDH A;  1VQL S;  1UFL A;  2RUG A;  1PC5 A;  4ZPW R;  2EFV A;  4UZC A;  3J81 Y;  3PTW A;  2BW7 A;  2VFU A;  4A8X A;  1LW2 A;  1SCJ B;  2BZ2 A;  4TXS A;  4NXM F;  2PDA A;  2QLJ B;  1RAD B;  4DS4 A;  2Z2Y B;  4O44 B;  2G9O A;  2RT3 A;  1HBM A;  3H8Y A;  3QGH A;  3LP1 B;  5E3C A;  2J7K A;  4C3L A;  1Z4U A;  2V4R A;  1TMM A;  4C9D A;  5AXN A;  1U1M A;  2HHH F;  3OSN A;  1CS4 B;  1KN6 A;  4EYH B;  1H73 A;  1AUS L;  2W4C A;  2I0X A;  1MU2 A;  1P9Y A;  4OJ1 A;  3PKM A;  1RE1 B;  4NZ7 A;  3OL8 A;  1QJH A;  4V19 J;  3CJK B;  1YZ6 A;  1N5S A;  3Q2S C;  1SJ4 P;  4OZ2 A;  1SJ1 A;  1FRK A;  3KJQ B;  3E01 A;  2ROP A;  4TKT A;  1NDK A;  3R7B B;  2RDD A;  4CLK A;  2CZ9 A;  1EP4 A;  3BQ1 A;  1HR0 J;  2UXD F;  4MJK A;  4HVZ A;  2V9W A;  2DR5 A;  1HIY A;  1DUR A;  5KG6 A;  3GIK A;  4DR5 J;  1SI9 A;  4A8Y A;  1F2G A;  2W2P P;  1BQN A;  3OXL A;  2HIY A;  1RA7 A;  4IFY A;  4I64 A;  1CS4 A;  1N0V C;  4DV7 F;  2MDA A;  2JVR A;  1Q82 T;  4NPO A;  3DHW C;  4DV3 F;  3T19 A;  1HQU B;  2VBY A;  4OYX A;  3RAQ A;  4RW9 B;  2E5G A;  4KHP J;  3GQC A;  3I5A A;  4NLP A;  4TQR A;  1XNQ J;  3CDA A;  4WIQ A;  2ZH4 A;  5CZX A;  5KOW A;  5IQ6 A;  4C11 B;  1TZ0 A;  3PX6 A;  2YNI B;  3EVM A;  3DC2 A;  2MY8 A;  2MGZ A;  4QW9 A;  4DSL A;  1AT1 B;  2QLW A;  4X4U A;  5IT4 A;  2KM8 C;  2HIQ A;  4F4Z A;  2ZFH A;  4ZIV A;  3J81 j;  2G2Y A;  2DBB A;  3TX0 A;  4RNN A;  3BBB A;  4U8Y A;  3M4X A;  3P6Y C;  5DQI A;  1RT4 A;  2QC3 A;  1GTH A;  5F3Z A;  2ACY A;  3I82 A;  3U27 A;  3WIV A;  2WON B;  2Y1I A;  5L1L A;  3NNC A;  2M4M A;  2GJF A;  4OMF G;  2RRB A;  2XBP A;  3ILL A;  2MKY A;  4OX6 A;  2NZ4 A;  3J7A N;  1EZZ B;  1BE4 A;  5JMN A;  4ZVQ B;  5KT7 A;  3W64 A;  1RCO B;  2DD8 S;  2G0I A;  1WG5 A;  4LF8 J;  2QLX A;  4H4M B;  3RB0 A;  1N4L A;  2E44 A;  4LF2 A;  4C3K A;  4FF1 A;  1RWV B;  1VIO A;  1IKW A;  4UQG A;  1RHQ B;  4Y2C A;  2PA8 D;  4QU7 A;  2RF2 B;  1MWQ A;  3HT3 A;  1WWH A;  5HBM A;  4PYA A;  4FNH A;  2HLT A;  4DL7 A;  4NXM J;  1IXK A;  3UE2 A;  5LM7 E;  1F3F A;  4RBU A;  2ZNZ A;  1M5S A;  1WAC A;  2BRK A;  1URN A;  2CZ4 A;  3HLU A;  3FNN A;  2F8M A;  1GMU A;  2NUH A;  5LJ3 Y;  1TAU A;  3M30 A;  4QJV A;  3KLG A;  3PJ9 A;  3ZXW A;  1TL7 B;  2XWX A;  4FN5 A;  3L4B C;  4V19 X;  3CUN A;  1MG7 A;  5D0R A;  3W9H A;  3M8S A;  2GGP A;  3A8K A;  4I4B A;  2C2D A;  1CLF A;  1AFJ A;  4GKJ J;  5M2R A;  1T11 A;  3CTR A;  1S5Z A;  4C0B A;  1WEL A;  1R8C A;  4B3R F;  1YBU A;  1JLG B;  2E7X A;  3K0J A;  1PIE A;  1UAW A;  3D0G E;  2Z57 B;  5JVH Q;  2N3L A;  5F8I A;  3KHR A;  4H4K A;  3BB5 A;  5J1E A;  4B3O B;  5EUH A;  2FUG 9;  5CZV A;  3FVY A;  1JLB A;  4B3M F;  1QUV A;  4U7C A;  3OQ2 A;  4P74 A;  5K5M A;  1UW9 A;  3CCW A;  4MFB B;  4FF2 A;  2MKJ A;  3L9Z A;  2QL9 B;  5SUH A;  2V34 A;  5F9N A;  2K2P A;  2WSE C;  4IH5 A;  3KLE B;  3R1L A;  1NPK A;  5HO4 A;  4N8O A;  2NZC A;  1H6K X;  1CC8 A;  3MM8 B;  4LRB A;  1M5P C;  1NDL A;  4UY8 5;  4KH1 B;  2WBR A;  4K5R A;  4PXE A;  1XJW B;  3AD9 C;  2HNY B;  3OFF A;  3R5D A;  4WPA A;  4DQQ A;  1EJ7 L;  4R25 A;  5IT9 U;  2KT2 A;  2B9E A;  1DQA A;  1M0S A;  2JEF A;  4PQU A;  2YX1 A;  3OLA A;  2AMC B;  5F0U A;  4WFN Q;  3C6U A;  4Z7C A;  5EDW A;  2F9D A;  2DNG A;  1BHN A;  5HVF A;  4OLP A;  2ZBP A;  2DPJ A;  4WFA Q;  3D1H A;  1U1P A;  4C8L A;  1JLE B;  3HVT A;  2R7T A;  3G2X A;  2EPI A;  5FJ4 A;  1DRZ A;  4A48 A;  2E1M C;  3I9Z A;  1WDD A;  5CCL A;  2HQD A;  2B7B B;  2LEP A;  2Z58 B;  3DRX A;  1WSV A;  1XNR F;  3ZC4 A;  2EC0 A;  4ITS A;  1AA1 B;  5B0A A;  4YHH F;  2AX0 A;  5K14 A;  3NNA A;  5E0O A;  4ZP7 A;  2C3M A;  4LSL A;  1VQO S;  5ETM A;  1RTD A;  2AYE A;  2AX1 A;  3OTB A;  2XSJ B;  4HLB A;  2OFH X;  2Q6C A;  3NWG A;  3PX4 A;  2E1R A;  2Z2Z A;  3RBE A;  4A47 A;  5HLF A;  1Y7P A;  5KFD A;  3DXB A;  4IO9 Q;  1B4S A;  4W90 B;  4Z37 A;  2OML A;  1FNX H;  3VAI A;  4IOA Q;  5I3U A;  4YB6 A;  3JAM U;  4C11 A;  3QSI A;  4C8N A;  1FKP B;  1U02 A;  2R7O A;  1HNV A;  2ALY B;  1ULR A;  1B0P A;  2YNI A;  3DRY A;  2IRY A;  4F3Q A;  2XMW A;  1NH8 A;  4LIR A;  1ROF A;  2R42 A;  4XAK A;  4R5P B;  2PI4 A;  1RWU A;  3CVK A;  3DLL Q;  2FIU A;  1UPM B;  3DDN A;  2ZD1 B;  2XMM A;  4KPC A;  4AND A;  4ETX A;  4Y0F A;  1X5S A;  3FBE A;  3JSM A;  1WHY A;  1HNX F;  4FBT A;  2RS8 A;  4YOE A;  2MSS A;  4NI2 B;  2YWK A;  3VAK A;  1TVR A;  1YJT A;  2AT1 B;  4USJ C;  1H38 A;  2OO4 A;  3W2V A;  3UR0 A;  2MLY A;  4CNY A;  1S7I A;  2I5J B;  1IKV B;  2BJE A;  2L9D A;  3W5X A;  4AYB D;  3LWL A;  1YHQ S;  5KFE A;  2HHH J;  2CQG A;  1U4B A;  1PCA A;  1G7C B;  1VCT A;  1RAI B;  3L7U A;  4Y34 A;  4YB7 A;  2C28 A;  1K8A T;  4ECS A;  1OIA A;  1OY6 A;  1YX2 A;  3T1H F;  1RT7 B;  2XYH B;  5B0D A;  3BGR A;  1H2V Z;  3JB9 k;  2ATL A;  4O23 A;  2MLX A;  1RBL A;  4DXL A;  2CQI A;  5FDL A;  2YX4 A;  1HMV B;  7FDR A;  3PIO Q;  3M9N B;  1C0U B;  2C2R A;  2HHT A;  1WEX A;  4I0W A;  1TV6 A;  4DOZ A;  3EZU A;  5E5N A;  3VZH A;  2G1D A;  1RT5 A;  3M8P B;  3IG1 A;  1L3U A;  4V1A k;  2WHO A;  2JH3 A;  4MK7 A;  2ZJR Q;  2OFG X;  3G82 A;  4WP3 A;  3VGV A;  5IT0 A;  1JQG A;  2ZH2 A;  4DSF A;  3R6G B;  1S6U A;  2RSQ A;  2MST A;  4KGZ B;  4NML A;  3UDL A;  3VQT A;  3IBF B;  2ZVS A;  4U67 Q;  2FDN A;  2V2K A;  3MTK A;  1R27 B;  3BKU A;  2J6T A;  3PNI A;  3MCM A;  1M5V C;  5E33 A;  3MAA B;  2DNK A;  3MM7 A;  5CYM A;  2CQ3 A;  4NYP A;  1EQ0 A;  4EWT A;  2FHJ D;  4RBV A;  4IDK A;  1FK9 A;  5AXL A;  5ADZ A;  2EBE A;  5IWA J;  3Q8S B;  3KK2 B;  4LFC J;  1N33 J;  4R0J A;  5DO2 A;  1URR A;  1YBT A;  4NLX A;  3LH2 S;  3MMC B;  1NK9 A;  2J0W A;  2MQL A;  5GMD A;  3QZ7 A;  3MR2 A;  2ZBC A;  3IN5 A;  1CG2 A;  1R6Y A;  4QR1 A;  3MFI A;  3W61 A;  4X62 J;  5C24 A;  4FXV A;  3D6F B;  2IBK A;  1NME B;  5LMN J;  2FC9 A;  2L08 A;  2DEI A;  1D9D A;  3H5X A;  1OY8 A;  5A0Y B;  4F4W A;  4CLT A;  5KG4 A;  4LRE A;  3OTC A;  1N36 J;  5HL7 Q;  4D3G A;  4DV2 J;  1X0F A;  1RHU B;  4L76 A;  5B0F A;  1UWB B;  2V2Z A;  1WKL A;  4FYD A;  4ID5 B;  4G1P A;  1RAC B;  1TFW A;  1KQG B;  2GVD A;  3VAM A;  2ADB A;  3QRQ A;  2BXJ A;  3KHL A;  3E51 A;  4FXD A;  2IM0 A;  3I56 S;  3DN9 A;  4KBI A;  1NND A;  4O0N A;  4XIU A;  3AOC A;  2XQC A;  3M30 B;  3FEX B;  4RW6 A;  2QEX S;  1FFS B;  2C2K B;  5KFZ A;  5C24 B;  3OVS A;  3ET6 A;  4M5M A;  2MQQ A;  2ZUG A;  4MT1 A;  2JEJ A;  4KHP F;  4LF1 A;  2HW3 A;  5JVG Q;  1KQK A;  1S9E A;  1PJ6 A;  3OR2 B;  1Q53 A;  5KG7 A;  1WTF A;  2KT5 A;  2RML A;  3SI8 A;  4JI3 F;  2W2N P;  3DM2 A;  3KJV B;  3D9B A;  2NSB A;  3CW2 C;  3ILO A;  1KQS R;  3PHT A;  4KKO B;  4J9N A;  3SFU A;  1L3V A;  5D78 A;  4RW4 B;  5T7L B;  1IKX A;  5F8J A;  4GC7 A;  1RTJ A;  1R0A B;  4HTJ A;  1SJQ A;  3UN5 A;  4X62 F;  3FQK A;  3TO8 A;  4KFB B;  4MIB A;  1VDH A;  4USV A;  2CG4 A;  2F4V F;  5KFQ A;  2UUC J;  4ZS6 A;  5KFM A;  5F8M A;  1S9G A;  4NLD A;  1SC3 B;  1TQL A;  1YRU A;  1FI4 A;  2B6A A;  2HAF A;  3MMA A;  3R6L B;  3WZ0 A;  4CM2 A;  4DI6 A;  5GAD I;  1E6Y B;  3FKB A;  2D3Z A;  2UVW A;  1UVJ A;  3A8J A;  4FKX A;  2RU9 A;  3MM5 B;  1N32 J;  3N4W A;  1HI8 A;  4ED2 A;  1R6V A;  2F1F A;  3DLG B;  1IKY A;  2EG1 A;  1I94 F;  1GX6 A;  3O8W A;  3EGZ A;  5KFN A;  2HVI A;  1KOO A;  2NXC A;  2C3U A;  3AJD A;  1R0A A;  4J37 A;  4RW8 B;  4YEA A;  2HGM A;  3Q8R B;  4P71 A;  3MUT P;  2ZH3 A;  4OHZ A;  3TRG A;  1KBR A;  3NP5 A;  4JI4 J;  2KN4 A;  3N9U C;  4ZIT A;  2J5A A;  3LOU A;  3QID A;  3QT6 A;  2HND A;  4LMZ A;  3EGW B;  4N76 A;  3P96 A;  1WF0 A;  4URQ U;  3I0R B;  1XC9 A;  3LAL A;  2LA4 A;  4USM A;  4IFY B;  3C15 B;  3UN2 A;  1IJF B;  2X51 A;  1SL0 A;  1YJ7 A;  1HHT P;  4O44 A;  3FRY A;  1Z2Z A;  5IM0 B;  2FJE B;  1FJ7 A;  4URG A;  3KYL A;  4AUK A;  2JJ4 D;  5KT5 A;  3M8R A;  1HNW J;  2IJF A;  4NLY A;  3T6B A;  4CO4 A;  4DV6 F;  1Q8B A;  4N47 A;  3HJF A;  3ZO7 A;  2XZW A;  4ZDN A;  2DXD A;  2OPQ B;  1HHQ A;  3KK1 A;  4NAS A;  3HI9 A;  4YY3 F;  1Q78 A;  4F7V A;  4DN9 A;  1KSP A;  1TTH B;  1Y11 A;  3MPD A;  4ID8 A;  5DRK A;  3ZZY A;  4CLZ A;  5CA5 A;  2F63 A;  3CCZ A;  2G2Z A;  2VZ9 A;  3EMT A;  3UDV A;  2UVV A;  4F8R A;  1EP4 B;  1V5I B;  2DIV A;  2J9C A;  3FRZ A;  4IG3 A;  1RWK B;  2CQD A;  4CT8 A;  5HMZ A;  1NKC A;  2KFY A;  1C1B B;  1GMV A;  3IS9 B;  4DS5 A;  2HQG A;  2ZD1 A;  3CGI A;  3EM1 A;  2FVQ A;  2ABY A;  1U47 A;  1YSJ A;  2LQ5 A;  2FJD B;  2RQ4 A;  4Q45 A;  2F4V J;  2DNO A;  2XMJ A;  3O1L A;  5HI7 A;  4CLW A;  1M90 T;  1JXV A;  3I4P A;  2V8V A;  2H1Y A;  1H72 C;  3FMW A;  3IA0 A;  4ZN3 A;  4CO5 A;  1JXE A;  1L5U A;  4TY8 B;  3ADA C;  3H4B A;  2FYX A;  5ETV A;  1XR5 A;  4PQA A;  1RDR A;  2C3P A;  3DHX A;  1N88 A;  3ENA A;  4K50 A;  3PRV A;  3BGO P;  2R7R A;  2E1A A;  3TI0 A;  5C42 A;  1RTH A;  1YJR A;  5L9X A;  4CLY A;  3S6E A;  2BAB A;  2BJ7 A;  3DI6 B;  1NB2 A;  1B70 B;  3FBF A;  3UD5 A;  4JI0 F;  1FJG J;  1APS A;  1XNQ F;  1VQM S;  1U1Q A;  2MQN A;  2R9L A;  3DYA A;  5J2P B;  3UW1 A;  2L9W A;  5I42 B;  4J9M A;  2IAJ A;  3O3L A;  1JLQ A;  4LVN P;  2GIR A;  2C3Y A;  5J2M B;  5DM7 Q;  3BH7 B;  3BBF A;  4X65 J;  4HHU A;  4NLT A;  1S6O A;  2EVZ A;  4OZ5 A;  2BAC A;  1S9E B;  2EG2 A;  3IAS 9;  4J9Q A;  3JTN A;  3CT9 A;  1X4G A;  5E7O B;  2CJX B;  1JLB B;  1FES A;  4L72 B;  2F8H A;  5C42 B;  2VJV A;  2VQE J;  2DRA A;  1HBU B;  4O3S A;  5HBM B;  1S1T B;  4IKA A;  2HK3 A;  1PBU A;  1TL1 B;  2RIL A;  3GYN A;  3M8Y A;  4USW A;  3RGI A;  2CFX A;  1S99 A;  2FVC A;  1BMQ B;  5LL6 d;  2I38 A;  3CDB A;  3HHE A;  4K4Y A;  4CLF A;  2GC8 A;  3BZQ A;  3CCM S;  3GJS B;  1TK8 A;  1RAO A;  3DYA B;  5J2P A;  5EN1 A;  1X5P A;  2O1P A;  2XG8 A;  1C1C A;  4RX6 A;  4OI1 A;  2QSW A;  1TL7 A;  2BAN A;  2UV8 A;  1HBN A;  1X7V A;  3T5J A;  3GPA A;  3VVT A;  5ETO A;  1S9F A;  3CME S;  3S7R A;  2KXF A;  3HHD A;  3NOC A;  4A4J A;  5A0Y A;  3X3U A;  3LP2 B;  3L7P A;  1ZM9 A;  1BQX A;  1M1H A;  2VG6 B;  3D0H E;  3LGN A;  3BR9 A;  2HFU A;  4DZD A;  4ZKA A;  5EWG A;  5FD1 A;  1FDN A;  1JLG A;  1MLA A;  2DNZ A;  1X5O A;  4DF8 A;  3UD4 P;  4NCB A;  2GQQ A;  3IBC B;  1QTM A;  1WEZ A;  4JYA F;  2ZNY A;  2FC8 A;  2OD4 A;  3CWJ A;  3M8Z A;  2F65 A;  3M2U A;  2CVI A;  3DCA A;  4J91 A;  1A7G E;  1P6T A;  4DBQ A;  2ACM A;  1VRT B;  3PW7 A;  4H4K C;  1DBD A;  3O6Q A;  5ETP A;  3Q22 A;  1L3T A;  2FLP A;  1IWG A;  1YIT S;  2AWZ A;  1PYO B;  1S6P B;  1T9T A;  2G1H A;  1C2P A;  4RKU C;  3TZZ A;  5J2N A;  1FNO A;  3V6D A;  2X1F A;  4JI2 F;  5KFH A;  4PWD B;  2AJ1 A;  2PFD A;  4LRC A;  3ZTR A;  1TAQ A;  3KLF B;  2BUN A;  2VIC A;  3V6J A;  1YTY A;  2J76 E;  2ZH8 A;  2UP1 A;  4ZVU B;  3UNY A;  5HJY A;  4QWD A;  4YR0 A;  1N8R T;  1JLF A;  1Z1Z A;  3IG1 B;  1ZBT A;  5E3P A;  2J0X A;  3N28 A;  3N6N A;  1FVQ A;  3NCP A;  5KFC A;  3J7Y U;  3BO4 A;  4GVL A;  2HG4 A;  2YKN A;  4MTP A;  3KG0 A;  2AYB A;  2D3U A;  3OL7 A;  2XTJ P;  4F3O A;  4ZCM A;  1U6B A;  1QSL A;  2HVH A;  2I8E A;  4H4M A;  1K44 A;  3H2L A;  3Q8Y A;  4R5P A;  4CDI A;  4F2R A;  3HP6 A;  3D1Q A;  4ED4 A;  2D74 B;  2X3D A;  4NXN F;  1I51 B;  4DN0 A;  3CCS S;  4DCJ B;  1VQY A;  4J9P A;  1FFW B;  2W7P A;  3FJ2 A;  1J5E J;  4NRU A;  1LK7 A;  3LA0 A;  1UA1 A;  3D3C J;  3MZI A;  4OYZ A;  3SIP B;  2XM3 A;  1CJU A;  4C8M A;  2CPX A;  3D6H B;  4PAB A;  2QRR A;  4QYR A;  2J6S A;  2HEK A;  2HFN A;  2YNH A;  4K4W A;  4DL5 A;  1JJ2 R;  3GFZ A;  3QT7 A;  2XSJ A;  1Y5N B;  3BEG B;  1D3W A;  2A1B A;  1RT6 A;  4C7Q A;  1S4F A;  2W9C B;  1ZM2 A;  3GMG A;  3VZI A;  3TAR A;  1HNW F;  1S7H A;  1AUD A;  5C2C A;  5F8H A;  2B9X A;  4LFB F;  3BGR B;  3H40 A;  2VG5 A;  4F36 A;  2A2C A;  1YJ9 S;  1Y10 A;  2OIH A;  1DTQ A;  2KVI A;  1PAU B;  3R5C A;  1U25 A;  3C15 A;  3GV5 B;  2GVZ A;  2NRE A;  2E5L F;  1P27 B;  4YME A;  4OZ0 A;  1TL4 A;  2JX2 A;  2X1G A;  2RKI A;  3I5B A;  4ED0 A;  1T9Y A;  1S1X B;  4NXN J;  3D54 A;  3KLH B;  1NH7 A;  1NSA A;  4ECX A;  4OI0 A;  3L3C A;  2BKP A;  5DJB A;  3EX7 B;  3ET6 B;  1AXQ A;  2LQB A;  1U8S A;  1LQ9 A;  4KE5 A;  3QJL A;  1ZAV A;  2CYY A;  4TLQ A;  2NXJ A;  4ZVP B;  3W5Z A;  1BC6 A;  3BDP A;  3ZZP A;  2VC1 A;  1B64 A;  2OD6 A;  1SQG A;  3A13 A;  5B0E A;  2YPY A;  2EXU A;  1QE1 A;  4R0E A;  4DX5 A;  2XCP A;  7FD1 A;  4EUV A;  2PMH A;  3CC7 S;  3VVU A;  3E3X A;  3KTQ A;  2LCW A;  2X7I A;  2R4F A;  4EYI B;  2HKE A;  2DXE A;  3K17 A;  2EC2 A;  2W2O P;  3JTP A;  3CCR S;  4OZL A;  1UJ6 A;  1S9G B;  2QTW A;  1VBZ A;  5GAE U;  1L3S A;  3MAQ A;  4UOC A;  3HZE A;  4E2F B;  3GR1 A;  4B17 A;  1X4C A;  4WU3 A;  5J1N A;  2H3E B;  4ZHR B;  3TAQ A;  2HHS A;  3UQS A;  2E5H A;  4M5J A;  4AL6 A;  1FX2 A;  5DZ6 A;  4WP8 A;  4LFA F;  1UWB A;  2YKP A;  2ZHA A;  1RYS A;  3BM7 A;  4ZA1 A;  1X4F A;  2EKY A;  3A3P B;  3CJ0 A;  4RBT A;  4ZPB A;  3NG8 A;  3I5C A;  1O5J A;  4LFA J;  3T9Z A;  2B3T B;  3OR1 A;  1WKK A;  1R8H A;  3GU0 A;  3R7N B;  1VQS A;  3FCW A;  2DPI A;  4IR1 A;  1H0H B;  2JZ5 A;  2LDI A;  5D0G A;  2B56 A;  2FZG B;  4RW6 B;  5KFB A;  3GJT B;  5F3T A;  3T5H A;  3R1H A;  4PPD A;  4KGV B;  4NCA A;  4RNF A;  1JLA A;  1T03 A;  1HWK A;  2YY3 A;  4I2P B;  3GR0 A;  3C6T A;  2H51 B;  3JQK A;  2OEJ A;  3EE3 A;  2C42 A;  2GA7 A;  3RAM A;  3NWR A;  1K1Q A;  1Q5Y A;  3FSX A;  4B9M A;  2GO9 A;  2JOQ A;  4Y3C A;  5ETL A;  4IRD A;  3MEG A;  4DV2 F;  5I42 A;  1K0V A;  4KKO A;  1PIL A;  4J9O A;  3BYP A;  1C0T B;  1NDP A;  2DB1 A;  4K8R A;  2Z2L A;  5DDR C;  5H9E J;  1JIH A;  2QE5 A;  4OZ1 A;  4JV2 A;  4ED7 A;  1XTZ A;  1S0N A;  4UF4 A;  3VAJ A;  4LRD A;  5GVQ A;  1FJE B;  4CLL A;  4UW2 A;  2R2S A;  4RU2 A;  2VPZ B;  2R8G A;  3DU5 A;  4L73 A;  3TQ1 A;  3NS5 A;  2ZJQ Q;  3W2V B;  3Q89 A;  3W8G A;  5K8O A;  1NU4 A;  2HFZ A;  1IKV A;  2WBM A;  4DR6 F;  1MRO B;  4ICL B;  4FP9 A;  1VHF A;  3B6B A;  3IRX A;  4HR2 A;  2YVS A;  4JV5 J;  2CQ0 A;  2HRY A;  1Q79 A;  2CQH A;  1T0T V;  4A8O A;  3MPV A;  1WOP A;  2HZA A;  2NXU A;  3GII A;  2GO8 A;  2AW0 A;  4NE9 C;  1IBC B;  4OV6 A;  4DR1 J;  2E7V A;  3EZO A;  3MOZ A;  3PX0 A;  3GLJ A;  1RT3 A;  1TKT A;  1WI8 A;  2XMK A;  5KFX A;  1N54 B;  2KDO A;  2XEX A;  3AB2 B;  1R3N A;  2XI2 A;  3HD1 A;  3M32 B;  4P75 A;  1BUX A;  2L9N A;  2OGU A;  2OEK A;  5CYQ B;  4FZV A;  4DV6 J;  4QPX A;  3GIR A;  5CAB A;  4X4Q A;  3DDI A;  4NYO A;  3TAP A;  3FC9 A;  3IBW A;  1SVD A;  2OLW A;  1HA1 A;  1NK0 A;  2BJ9 A;  4DR3 J;  2NXN A;  1RBA A;  1RU2 A;  1O8B A;  1YRT A;  3BV8 A;  3GCX P;  4NEZ A;  4ZVF A;  2MKC A;  3H5U A;  4DL3 A;  5CHC B;  4QQB A;  3POT B;  2NUU G;  5IT9 Y;  1PKU A;  4RR5 A;  1VLO A;  3TJA A;  2QA2 A;  3KUH A;  1DTQ B;  2YWW A;  1NDC A;  4UY8 T;  4DZ6 A;  3S8S A;  3UVJ B;  1B3T A;  1F60 B;  4ECY A;  4DR4 F;  3LW5 C;  4JI4 F;  4RO0 A;  1UVK A;  1Q7Y T;  1V9O A;  3N5F A;  3JS9 A;  4RW9 A;  3GJQ B;  3I9V 9;  4DHV A;  2GML A;  2HSE B;  2J7W A;  4WYW A;  2KI2 A;  4AXI A;  1SL2 A;  2LQJ A;  4L74 A;  2AV5 A;  4ES1 A;  1XMQ J;  2WOM A;  4FYY B;  3VR1 A;  1X4H A;  5A8K B;  2UXC J;  2VOP A;  2O3D A;  4IH6 A;  2CQP A;  3JYT B;  2DIS A;  2XZT B;  4ZPC A;  2HND B;  3KDO A;  3ENQ A;  1KS2 A;  4IFV B;  1OJ4 A;  4C0O C;  2H5I B;  2NLW A;  2ZWP A;  1YJN S;  1GTE A;  1S48 A;  3TAM A;  4UOH A;  4ZPV R;  5HQM A;  4ZCL A;  2HHW A;  2EW9 A;  3LP0 A;  4CH7 A;  5THW A;  2COL A;  4N56 A;  4DV4 F;  3MR7 A;  2AHO B;  3QJJ A;  1LWC B;  2B4V A;  4A8F A;  4O3N A;  1YLX A;  5IM0 A;  1UFW A;  3EDR B;  4QR2 A;  1WJ9 A;  4WE1 A;  3PR5 B;  1LWF A;  3DOM A;  4J90 A;  2H4Y B;  5KT2 A;  4NLQ A;  3AOA A;  3TA0 A;  4QWE A;  1TMJ A;  4LT6 A;  1DQ8 A;  3RUB L;  3M05 A;  1EIY B;  3LP1 A;  1UVN A;  1FXL A;  1TUV A;  1VFJ A;  4ZVO B;  2BDP A;  5G4D A;  3PJW A;  2UU9 F;  1U6F A;  5C25 B;  2HHV A;  4YB5 A;  3OUY A;  1NZA A;  1RK8 A;  5AT1 B;  1KLN A;  2DGU A;  1HW9 A;  4HI1 A;  2H4W B;  2HS4 A;  2HNZ A;  1Y9O A;  4ZJO A;  4OYA A;  4JV5 F;  5T7L A;  4K59 A;  5KFW A;  4P9S A;  4TU7 A;  3PRD A;  4MKV A;  4P2M A;  4LF5 F;  3IR5 B;  3PV8 A;  2AZ1 A;  1ZA1 B;  3RB3 A;  3WX8 A;  2HQ3 A;  4JUZ A;  3QSY B;  3OFE A;  3FSI A;  1NK7 A;  2CRL A;  1RLD A;  3PG9 A;  1ZZF A;  1K47 A;  2AYG A;  4K0K F;  5FLX Y;  1KFS A;  3B4M A;  5D4N A;  4O3P A;  2KH9 A;  3W9I A;  1HL6 A;  4KT0 C;  3MM6 B;  1D9A A;  4LR9 A;  5C25 A;  4HAC A;  3DLH A;  4DFM A;  1CPZ A;  3W2W A;  3HMJ G;  1N5V A;  4IOB A;  1DY3 A;  1HBO A;  1HKA A;  4B9N A;  1VC0 A;  2AYM A;  3AA8 A;  4ID5 A;  2YQ3 A;  1B0T A;  4X65 F;  1DHM A;  3DLG A;  3FBC A;  2RRN A;  3EDQ B;  4MK9 A;  4NA2 A;  3V4M A;  3B78 A;  2ILZ A;  4AD6 A;  1JX4 A;  1ZH5 A;  3T9N A;  4OLO A;  2BQ3 A;  2R7V A;  1VQ8 S;  3MCS A;  2ASD A;  5K8P A;  3DI6 A;  4LF5 J;  3Q8P B;  4PUO B;  2ZZN A;  3RR7 A;  2CDR B;  3LGM A;  1KQF B;  2OTL S;  3WDO A;  5K20 B;  3QBC A;  2MB0 B;  3DRR B;  1VR6 A;  3MM6 A;  1WG4 A;  3LP2 A;  4X2B A;  2KHD A;  4O3O A;  1UEV A;  2A18 A;  1SH2 A;  2B4O A;  2DH9 A;  2VG6 A;  2FY1 A;  5CD4 H;  1SC1 B;  2U1A A;  1Q86 T;  2HYI B;  4B3R J;  1F9F A;  2RQC A;  3FEY B;  3VHQ A;  3RB4 A;  2UXC F;  3HJV A;  4FXW A;  4DCP B;  1H3D A;  1QD1 A;  3UWT A;  2CZV C;  1U1O A;  2RVJ A;  1HLW A;  1QM9 A;  4QYZ J;  2XWY A;  5MLC V;  2ZIT A;  4UOF A;  1NZ8 A;  1RP5 A;  3CDW A;  4ZP9 A;  3ZTQ A;  1KVI A;  3IAM 9;  1NAQ A;  1D09 B;  1F6T A;  3QIP A;  4TYA A;  2CKW A;  2V69 A;  3G86 A;  1T9V A;  4QIE A;  2GQ2 A;  3NEK A;  2EKN A;  4PYD A;  4B02 A;  3C6T B;  3HFK A;  2NR0 A;  3CD6 S;  2ZOF A;  4KIA A;  4ECZ A;  4X64 J;  1KVJ A;  3K58 A;  2M9K A;  4DSK A;  4F4Y A;  4Q2L A;  1QAY A;  4ETZ A;  2OH2 A;  3ZNJ 1;  4Q7A A;  3H20 A;  2CNO B;  2LXF A;  3I4H X;  2XNR A;  2ZDO A;  3HHL D;  3LPY A;  4URS A;  3EXC X;  1NPP A;  1ZYQ A;  1HYS A;  1ICE B;  4UUW A;  1VOM A;  2LA6 A;  4U8V A;  3T6J A;  2P9E A;  3MD1 A;  5BR8 J;  3CIM A;  1C4C A;  2Q6B A;  3BN7 A;  5DM6 Q;  4NCG A;  4YUD A;  2XUL A;  3GV8 B;  4DV5 J;  3U1M A;  3BH6 B;  1K1S A;  5I3U B;  3BGU A;  2CAD A;  3C16 A;  4QIV A;  2UV8 G;  4CLS A;  4J9U E;  3DLB A;  2MLZ A;  2VFT A;  1U1K A;  1OMS A;  5KG5 A;  1NJX A;  4WWS A;  4F0M A;  4KGX B;  1VC6 A;  2M2B A;  2ZUA A;  2OSQ A;  3W63 A;  2JLG A;  1U7L A;  2IM1 A;  1TKZ B;  3TVK A;  2RF2 A;  2XZD B;  3FCH A;  1BQN B;  1DAX A;  3JSM B;  2H65 B;  2DR7 A;  1QUP A;  3G96 A;  2LU1 A;  4DX6 A;  1OPI A;  2I6W A;  3EZ5 A;  3OPK A;  2PN6 A;  1N5Q A;  4F4A A;  5GAE I;  1NKE A;  3DLE A;  1Q8L A;  4NCG B;  1TL5 A;  2HRU A;  2VG5 B;  3JQJ A;  4K2J A;  5B09 A;  5JJB A;  4GO7 X;  3KMQ A;  3NGD A;  2YKA A;  4HHJ A;  3R9L A;  3QYY A;  4PPZ A;  5HRO B;  3IWN C;  4QYZ K;  3NY0 A;  1YKW A;  2OKQ A;  3DRS A;  1LOU A;  1SC6 A;  3MAH A;  5LJ5 Y;  3AH6 A;  1NJW A;  2BRL A;  4CZC A;  4WK1 A;  4XO0 A;  2AU0 A;  3C2P A;  3SCJ E;  2OPR B;  2K8G A;  4X4P A;  4JI1 F;  2MEW A;  1XBW A;  2B8P A;  2WB1 D;  2CPE A;  2FHO B;  4IYQ A;  4UST A;  4RZR A;  1KFD A;  3M9O B;  3RBD A;  2J0S D;  3MUR P;  2GNK A;  2W9B A;  2JEG A;  3DLE B;  4F04 B;  4ED8 A;  3K5P A;  5L39 A;  3P49 B;  1HD0 A;  3DRP B;  4JI5 F;  2UXB F;  2PSZ A;  3K8W A;  2P9C A;  3OJS A;  3J80 Y;  1KP6 A;  1KWM A;  1RI7 A;  3D5M A;  3SCL E;  3IR7 B;  3M8Q B;  1NK5 A;  1IR1 A;  3V2U C;  1LXJ A;  4AL5 A;  1YGY A;  4H54 A;  2WSC C;  3VGU A;  4ZCK A;  1NB7 A;  2M8H A;  4C0H A;  1N34 J;  1RAG B;  4JI2 J;  3KOA A;  1QAX A;  1CQM A;  3ONQ A;  4ZP8 A;  2AF6 A;  2OMO A;  4LR8 A;  4AXJ A;  1SL1 A;  1FWP A;  2DHX A;  2DHG A;  4M5H A;  4PG7 A;  4PRF A;  2RNE A;  4RW4 A;  4EO8 A;  1JNR B;  4GVB A;  4YS2 A;  3M6W A;  4KV8 B;  2F7V A;  5EHH A;  5K8M A;  3UNG C;  4FF4 A;  2J9D A;  1WHW A;  2Q1L A;  3KKF A;  4D3H A;  2R7X A;  2X1B A;  3NMR A;  3VAL A;  4DV0 F;  4M95 A;  1BD6 A;  4NA1 A;  2FHK A;  2K1R B;  2D3O R;  3HX9 A;  2AKW B;  1M5K C;  2YKM A;  4HHH A;  4FF3 A;  2B7C B;  3SCK E;  1YJV A;  2WW8 A;  1HBU A;  4DV5 F;  4CH0 S;  2CQC A;  2BJD A;  5BYS A;  1REV B;  3KG1 A;  1WHX A;  3MR5 A;  2AQ4 A;  1JLA B;  1RWX B;  2W2M P;  3CJR A;  2SXL A;  4G3I A;  4GKK F;  2XSF A;  3Q8U A;  2OPP B;  4ILR A;  1J27 A;  3M7V A;  3QLH B;  3CUL A;  3F73 A;  3NRB A;  1D9F A;  4OI2 A;  5J2Q A;  1MN7 A;  3NMA A;  2BMB A;  2VF3 A;  3DLK B;  5ETT A;  7AT1 B;  1S49 A;  1U48 A;  8RUC A;  3CCL S;  3F41 A;  4CLU A;  3ICL A;  3R97 A;  3OR2 A;  3M6X A;  1CJV B;  2DGW A;  3B4D A;  2Q79 A;  4YN3 B;  4PG8 A;  5BJR A;  4WFB Q;  3OHB A;  2YWE A;  3P5B P;  3W2W B;  1NBE B;  2MKS A;  3U1L A;  5HQL A;  2F40 A;  1WSR A;  2HQI A;  3D4J A;  1GMW A;  4L3K A;  5B08 A;  2FZC B;  3Q8V A;  3TQE A;  5KFT A;  4B3S J;  3MPY A;  5A6P A;  2Y0B B;  5M2P A;  1KD1 T;  2ZH1 A;  3PIP Q;  3OR1 B;  3NLC A;  2WTF A;  3CO9 A;  2LMI A;  4I69 A;  3OXG A;  3LAK A;  4UUX A;  1T9W A;  5T41 A;  4NI2 A;  1DQ9 A;  2DH8 A;  4XDC A;  3RJM B;  1G3O A;  1QY7 A;  2OPQ A;  1YWX A;  4KO0 A;  5BXI A;  2IIH A;  2GW8 A;  2MQM A;  3IO1 A;  3I0S A;  4YFU A;  2IA0 A;  2AJQ A;  1LW0 B;  1VIS A;  5KFR A;  2HHP A;  2R7U A;  3OT9 A;  2EK1 A;  3VQS A;  1SC4 B;  1RUS A;  1UW4 A;  3DFE A;  3DNC A;  2GHV C;  1NJY A;  3M6U A;  4ILL A;  3TJ9 A;  1UVI A;  4TYB A;  1KTQ A;  1S1X A;  5DG8 A;  2EWH A;  1YI2 S;  3PKY A;  3RW6 A;  2GJ2 A;  1LWF B;  1NSP A;  3DOM B;  4OYB A;  3JTO A;  3FFI B;  2W7O A;  2R8H A;  1OO0 B;  1S1U A;  2K7J A;  2GAG C;  1KR4 A;  1S6Q A;  2V63 A;  2IVF B;  4DPU A;  4JV1 A;  4P7T A;  4XK8 C;  3J7A 1;  3NAH A;  2VFS A;  1WUU A;  5CCM A;  3CXC R;  2CWX A;  4LR7 A;  3BGL A;  3DOK A;  2B0G A;  1Y5L B;  1NM2 A;  2R2T A;  3LAM A;  2QO3 A;  1HWI A;  1WF1 A;  3HSZ A;  3T41 A;  2DRB A;  5H9F K;  3UDC A;  1CJU B;  3G6X A;  2AEF A;  4BS2 A;  1V5V A;  1MWY A;  3US5 A;  4ES2 A;  3DDK A;  4RW7 B;  4C3M A;  2R7S A;  1I1G A;  2PGC A;  2WOM B;  4DJB A;  2HMI B;  1B7Y B;  3ZZT A;  4LF4 J;  1IVZ A;  1GH8 A;  3DKD A;  2W2Q P;  4X4T A;  3SSR A;  4N77 A;  3C19 A;  3CJ5 A;  1U0H B;  2HHQ A;  1FD2 A;  1LNQ A;  3EJM A;  4KGK A;  4S0M A;  4P7V A;  3SMZ A;  3CB4 A;  4ZK7 M;  4B9V A;  5DLF A;  2UU9 J;  2CQ2 A;  4KYZ A;  4KSE B;  4DV7 J;  2MMY A;  3ILJ A;  3M2V A;  3POT A;  3UCU P;  2R2U A;  1P8G A;  1C1B A;  5HVG A;  2DGO A;  1NSQ A;  1VRU A;  3SSQ A;  4YHH J;  2W9A A;  2C2E A;  4LF9 F;  3QNW B;  1FKO A;  1N0U A;  1IR0 A;  2A3J A;  2CWK A;  2OHD A;  3FEZ A;  4PG6 A;  4Y6I A;  2PEB A;  1NUE A;  2OEM A;  2Z2M A;  5JXS A;  5SZT A;  3R5A A;  3BR8 A;  2CPY A;  4CO1 A;  2HMI A;  2KXN B;  1T03 B;  1Q7L B;  3KXD A;  4M5N A;  1VQ5 S;  3D7S B;  1D8Y A;  1DLO B;  3GSD A;  1IWA A;  4WFY A;  2A6M A;  4F26 A;  2DYA A;  1DTT B;  2CVE A;  3HM9 A;  3PXG a;  2XS2 A;  5IC6 B;  1FTC A;  4EZ9 A;  2QV6 A;  1T02 A;  4XDD A;  3K5O A;  1Q0N A;  1JLC A;  2HS3 A;  5K14 B;  4OHV A;  1C0T A;  4ECV A;  1YZ7 A;  4Q0B B;  1PO6 A;  4O3Q A;  3ELH A;  3J7Z T;  3PVX A;  1V3R A;  1NK8 A;  2HBQ B;  1UEU A;  3JXO A;  1GNK A;  5A8R A;  1WDT A;  3A1Y G;  4QZV B;  5ITH A;  1MWZ A;  4UQT A;  1RT2 B;  2LEA A;  5ETQ A;  4M5L A;  4CYU A;  3I0R A;  2MZ1 A;  1VHI A;  2W4P A;  4J9V A;  3RRH A;  2EEY A;  1FA0 A;  1RXO B;  2CPH A;  3K89 A;  1N5Y A;  4DR7 F;  4PG5 A;  4UOG A;  2D7S A;  5E3A A;  2DNP A;  4O4G A;  2XY6 A;  5HQ8 A;  1VC5 A;  4WII A;  5A8W B;  4WKY A;  3R3T A;  5KFG A;  1B0V A;  2QA1 A;  3ISZ A;  4BC7 A;  1IJE B;  3AJ2 A;  4XPE A;  1IBM J;  2HHU A;  5A2Q U;  3ZTS A;  3OFG A;  1RKJ A;  3TUP A;  2OPS B;  4EFA C;  3CCE S;  1ZTT A;  2CQB A;  3CJ4 A;  2MQ8 A;  2IVM A;  5KFI A;  1JLF B;  4CM0 A;  2P8I A;  4N41 A;  2VFR A;  2DCL A;  3KNA A;  5K9F A;  5ETK A;  3BSC A;  2CNL B;  2FD2 A;  4EK2 A;  2O5D A;  3H5Y A;  2DO4 A;  3I31 A;  4RNO A;  1HHS A;  3PW2 A;  1HNZ F;  1N5Y B;  1KVK A;  4ZPD A;  3PW5 A;  4IRC A;  3ENW A;  4IG0 A;  1UEK A;  4WJB A;  4AE5 A;  2N4D A;  2BOA A;  3GJR B;  1HNI A;  1WC0 A;  3D0I E;  3NGR A;  2VQF J;  4IRK A;  3CJ2 A;  4CIO A;  4N8N A;  3I0S B;  1ZPW X;  1N56 A;  2HFS A;  2EFG A;  5AE3 A;  1WI6 A;  1HMV A;  2Z4P A;  3F56 A;  2Y1L B;  5IQQ A;  2KG1 A;  3KJV A;  3W62 A;  1HBO B;  1Q95 G;  1RJJ A;  2PT0 A;  3L95 X;  1FVS A;  1CJT A;  4FYV B;  2WON A;  4Y28 C;  1JKH A;  4DUT A;  5D3G B;  1X31 C;  4OZJ A;  5I3Q A;  3IM9 A;  4ZLP A;  3GIJ A;  3NL0 A;  3OLB A;  4QW8 A;  4OI3 A;  1OQ6 A;  4HYK A;  5LXR A;  4TY9 A;  3K5L A;  6AT1 B;  2IPO B;  1N6Q A;  3TP2 A;  1BY9 A;  3KDN A;  4WZQ A;  4LFC F;  2M70 A;  3I96 A;  4PXD A;  2DGV A;  5L46 A;  1WKJ A;  2Z8Q A;  3HD2 A;  1WC6 A;  2PE8 A;  1WHV A;  2CNK B;  3TUZ C;  2XLI A;  5EX0 A;  2E5J A;  2ZZT A;  4DPO A;  1JK9 B;  4MYU A;  4X4S A;  2W9B B;  4QWC A;  2BA9 A;  4DLE A;  1RA6 A;  2KVQ E;  3BQ2 A;  2HWH A;  5D6G A;  2M0G B;  1Z2L A;  5HAT A;  4DWI A;  1IKY B;  5H9E K;  3V4I A;  1T3N A;  2RDI A;  3QWU A;  2VG7 A;  3EPI A;  4C48 A;  5LXY A;  3K59 A;  2V8G A;  2ZBI A;  3MI7 X;  1X0P A;  1ZA2 B;  3PDN A;  2KHC A;  1Y5I B;  2RH3 A;  1R0C B;  1HI1 A;  1OSC A;  2AJ0 A;  3PR4 A;  3IWL A;  1Y4Z B;  1FRJ A;  2YKO A;  1T05 A;  1RT1 B;  3ZZU A;  4DCO B;  4DSJ A;  4EBD A;  1KNZ A;  4FKY A;  2V8D A;  2IY5 B;  2FPH X;  2RS2 A;  1QE1 B;  4HH1 A;  4U96 A;  3ZZZ A;  4BWM A;  3SEO A;  2ZBR A;  2VV5 A;  4QOT A;  4DFJ A;  5KFK A;  2KYZ A;  2QGF B;  2QLF B;  4BHQ A;  4E8U A;  1NKB A;  1O51 A;  2B4U A;  2CPZ A;  2MYF A;  3GP9 A;  2LXU A;  3R5B A;  5CH7 B;  5HVH A;  2RDJ A;  1TKD A;  4HT7 A;  3CCJ S;  4MH8 A;  2CJ9 A;  2YNH B;  4HTI A;  2BX6 A;  2V67 A;  2NYI A;  1RTI A;  3GYX B;  2Q43 A;  3JSY A;  1R8B A;  4KRW A;  4OI4 A;  1FWL A;  1SQE A;  2U2F A;  3TZX A;  1VIX A;  2C2O B;  2ROG A;  3PAC A;  2RUS A;  2XHC A;  4A8Q A;  4GKJ F;  3KFW X;  2O67 A;  3RG6 A;  4DL6 A;  3CJS A;  3CJQ A;  5IFM A;  1A0O B;  4OHY A;  2AEM A;  3T3F A;  3SCI E;  2RRA A;  1FRL A;  2BJ1 A;  2JHE A;  1U45 A;  1R0B G;  2DNM A;  1D8Z A;  1FK9 B;  1AZS B;  2L48 A;  3C16 B;  1TUG B;  2XYP B;  2HLU A;  1F9E B;  3IFE A;  1X4E A;  3LP0 B;  1ZZN A;  3HHN B;  1FEH A;  3EVW A;  3HT0 A;  4KHR A;  5KG0 A;  2YNF B;  5KFP A;  2ADC A;  2ZDP A;  4WYL A;  4WF9 Q;  4LRA A;  4PXC A;  2VFV A;  1PGZ A;  3QGP A;  4OL8 A;  1KDN A;  4DR3 F;  1U2R A;  4TVA B;  2KRR A;  1GMW D;  3EUN A;  2KFZ A;  1UZH A;  4LF9 J;  3I32 A;  2H9Z A;  1IM4 A;  3LO3 A;  1ZM4 A;  1ZAX A;  5G0R A;  1X9S A;  1FDA A;  5KT4 A;  1SJR A;  1W7W A;  3GZ7 A;  5IOL A;  3IM8 A;  3TYT A;  4ENO A;  5CAA A;  1HWJ A;  3CCU S;  1S0M A;  4M94 A;  5IC4 B;  1RAH B;  3PO4 A;  3FGV A;  1RHM B;  5F8G A;  3MMB A;  2IYI A;  4ZPT R;  4QWB A;  1RHK B;  4I56 A;  1RAF B;  2IC3 A;  1RWN B;  3M2V B;  4PAA A;  3PY8 A;  4ZJQ A;  5DGB A;  1HAR A;  2ZM6 J;  3RRG A;  3CF5 Q;  2N4C A;  3RR8 A;  2CQ1 A;  1SIZ A;  4F2S A;  1B7F A;  1AB8 A;  1FRX A;  1UET A;  1TEL A;  1U2F A;  4I7F A;  2F9J A;  1S97 A;  3F44 A;  3OBI A;  1PC4 A;  1H98 A;  1QDU B;  4NEY A;  1X5T A;  2DNQ A;  1UVM A;  4ZPA A;  4ILM A;  3NS7 B;  3FK4 A;  3M6V A;  1S1W A;  1ZM3 A;  2D9O A;  2P5V A;  3OV7 A;  1W25 A;  2GFF A;  4CO0 A;  4ICL A;  4ES3 A;  3TEH B;  4JI8 J;  2M3D A;  2GX8 A;  4IG0 B;  4DX7 A;  3CCV S;  2FJX A;  2WVF A;  4WK3 A;  5AXK A;  4RWW A;  3PFE A;  3K7R A;  2CJA A;  3RBZ A;  3TVY A;  2BR0 A;  2DXF A;  4ZLL A;  2YNG B;  4EBC A;  3G9C A;  1T7P A;  1NLK L;  1UKU A;  4IQM A;  5D4P A;  1U24 A;  4KFB A;  5LSR A;  4YR3 A;  3DLK A;  1R43 A;  4OHX A;  4EMD A;  3UD3 P;  2Y8Y A;  2LP4 A;  3QAE A;  5H1S V;  2BKO A;  4N7T A;  1XIQ A;  1GK8 A;  2YX7 A;  3AAW B;  4LRF A;  4Z7Y A;  1BLU A;  4EO6 A;  1Q5V A;  1PG5 B;  1UTA A;  2CJK A;  4OJH A;  1S59 A;  2G2O A;  5KFL A;  5KT3 A;  4O4G B;  4USH A;  4LQ3 A;  4LFB J;  4K4T A;  1RAJ A;  2VQF F;  2EFN A;  4I2Q B;  3NCQ A;  3PYG A;  5FII A;  3KLH A;  2HGL A;  2MTL A;  4YR2 A;  5K8N A;  1CJK A;  5HK4 A;  4Y2K A;  1BXN A;  2KTQ A;  2G13 A;  1RT5 B;  2MZR A;  1S12 A;  1WOR A;  4AFF A;  5CXT A;  1FX4 A;  2E1P A;  2VBX A;  4NLR A;  3ULH A;  3N01 A;  2XY7 A;  1VBK A;  3TZY A;  4I67 A;  3T5L A;  1MRO A;  2G0C A;  1BWV A;  4O0I A;  2JFD A;  1LV5 A;  4ER8 A;  1FKP A;  1VBX A;  1RT6 B;  3R8Y A;  3DMJ B;  4C4W A;  1F5A A;  1GAO A;  3OW2 R;  3T1H J;  1FHT A;  5F9L A;  4EI2 A;  4C8K A;  2WVE A;  1RTH B;  2ZH9 A;  4OJ3 A;  3C3L A;  2XMA A;  2Q66 A;  1OY9 A;  3B8H A;  2HFO A;  1CJV A;  3K5M A;  1M5O C;  1FFG B;  4WKR A;  3UN3 A;  1VBY A;  3PEJ A;  1DZ5 A;  4DV1 J;  3HKW A;  5AJ3 J;  1LWC A;  2CJB A;  3KK1 B;  4C8Z A;  3QAT A;  2UVU A;  4C98 A;  3GSI A;  1VYA A;  4O4R A;  2DNL A;  4FYW B;  4ZHR A;  3O5T B;  2Y8W A;  1SQF A;  3VAG A;  2LEC A;  3OSP A;  1QSY A;  1HNX J;  1JLC B;  2DGX A;  4M63 A;  4MKB A;  3MR6 A;  4DL2 A;  3RB6 A;  2XI3 A;  4C97 A;  1R7I A;  1RWP B;  4IG3 B;  2XYG B;  1H2U X;  4K5S A;  4DFK A;  2FLN A;  4OYP A;  3MM9 A;  4WBF A;  1TKZ A;  3G6E S;  1XK8 A;  2BQU A;  1T8E A;  1IBK J;  3ENV A;  4RW7 A;  3FMB A;  4OQJ A;  4DQI A;  2G0J A;  2GZO A;  4I6A A;  1TKX A;  2CJQ A;  4EGL A;  3ZZ0 A;  3G4S S;  2C2M B;  3V5R A;  4XTT A;  3HSJ A;  2ZM6 F;  2CPI A;  4OYI A;  1Q8I A;  1U2C A;  1NEE A;  2B9W A;  5A8W A;  1LEO A;  2CIM A;  5F8L A;  3G6Y A;  2FJW A;  1YJU A;  4BWJ A;  2W9C A;  2NCK L;  4AQY F;  2KT3 A;  5A8K A;  3V81 B;  4KTQ A;  3ETM A;  1TL3 B;  3JYT A;  4FS1 A;  2CPF A;  3ITH B;  4HAC B;  1YG0 A;  4W4M A;  3BKF A;  4ECU A;  4KHM A;  5AE2 A;  2WW4 A;  4RJV A;  2OPR A;  1RCX B;  2WVD A;  1MU2 B;  3G8S A;  5RUB A;  1YJW S;  3Q2T C;  4DUY F;  2DR6 A;  3CSK A;  3O2I A;  2IFX A;  4E98 A;  2M7S A;  2P6T A;  3SFG A;  2C2N A;  2FJB B;  4BLG A;  2PFF B;  3G6V A;  2DT9 A;  4MKA A;  4ZVG A;  3E01 B;  2ERR A;  4LF6 J;  3I6P A;  1G6B A;  1REG X;  3DRP A;  3EWG A;  3BBC A;  3GTY X;  5A76 A;  3LTO A;  2VH7 A;  2KG0 A;  2FHJ A;  4JI1 J;  4DR7 J;  4G1Q A;  1W2B R;  4F02 A;  3BYR A;  5DG9 A;  2G4B A;  3NNH A;  2QLB B;  1RSC A;  2OEL A;  4RNH A;  2JWN A;  3OD2 A;  3CD0 A;  2DCU B;  3SSS A;  5FLX U;  3OUY B;  1WTB A;  3I55 S;  3TUI C;  2GAH C;  3GIL A;  1NK4 A;  1EET A;  3PO5 A;  4ELU A;  3MEG B;  4DR2 J;  2HUR A;  2KYX A;  2Z56 B;  1NO8 A;  3QFW A;  2FQQ B;  3MM5 A;  1RU1 A;  3BKT A;  4OYO A;  3DGP A;  2FLL A;  1P1L A;  3ISN C;  4K2X A;  2K3K A;  1M1K T;  1FRI A;  4RW8 A;  5EWE A;  1LW2 B;  1PAE X;  4M1K A;  3H2V E;  4DUZ F;  4A46 A;  4B3M J;  2BM1 A;  1HBN B;  1H7W A;  4MAK A;  5KAK A;  3QZ8 A;  1LWX A;  2KO1 A;  3BF4 A;  3D6T B;  2W01 A;  3MHY A;  3EYZ A;  2MY7 A;  2BW2 A;  2XHW A;  3DXS X;  2XMT A;  2RE1 A;  3JAM Y;  1U09 A;  1M1G A;  2R3V A;  4LJM A;  3WC0 A;  3DM2 B;  3BO3 A;  3W65 A;  4JV0 A;  3AQO A;  3PW4 A;  4USI A;  3V6K A;  1KLM B;  1TU0 B;  5I4M A;  4IH7 A;  3BO2 A;  3V6H A;  3PZP A;  2BOP A;  2XMU A;  4J7C A;  4EZ6 A;  1N48 A;  1WC5 A;  3H2U B;  5D8H B;  2C2Z B;  1PJ5 A;  2VG7 B;  2FLO A;  1WC1 A;  2W4D A;  1EHW A;  3QAU A;  3WIU A;  3HK2 A;  4MK8 A;  4GRS A;  1LWE A;  4KAI A;  3THT A;  1OSD A;  4DG1 A;  3LAN A;  5LMU J;  4Q8F A;  4WXW A;  2MQP A;  4X4O A;  2UUA F;  3FZ2 A;  2CXE A;  2V94 A;  2FY8 A;  1ZPV A;  2XS7 A;  2MKK A;  4LF7 F;  1Y0H A;  3PEH A;  5M2U A;  3RBX A;  3BSO A;  2VQE F;  4JBC A;  5HMW A;  1SJF A;  1QAJ A;  4NYZ A;  2FGC A;  2QA4 G;  4NWB A;  1U0S A;  1FXD A;  2VKZ G;  4K4X A;  1HQE B;  2HZC A;  4LF7 J;  2H54 B;  4Q2M A;  3NS6 A;  2FHM A;  2OSR A;  3OHA A;  4F0K A;  2OJ3 A;  3HO1 A;  3IRW P;  2B43 A;  3RAX A;  2GV1 A;  4F0H A;  1FDD A;  3QMQ A;  2N7C A;  2R2R A;  4K4S A;  3Q86 A;  3QRR A;  3NGU A;  3M2R B;  3HUL A;  1C4A A;  3THV A;  5ETS A;  4Q8E A;  1V3S A;  3DOL B;  5KFU A;  2CPJ A;  1YBA A;  5KFS A;  4JI0 J;  5HMX A;  4NZ6 A;  2M5Y A;  2PA3 A;  2AP6 A;  3TAN A;  3CIZ A;  2MPU A;  4P52 A;  5D77 A;  4TN2 A;  1WF2 A;  2CDQ A;  2Q3P A;  5IZH A;  3NOG A;  2ZBQ A;  2XLK A;  3KUG A;  3AJ1 A;  1UPP A;  3UPF A;  1JWW A;  3H0P A;  2HAI A;  1EB0 A;  2E5L J;  4PZV A;  8AT1 B;  5IXU A;  2EFO A;  4NLU A;  2MXY A;  4ECW A;  2VBZ A;  4ED6 A;  2VA2 A;  3C46 A;  2V6A A;  3QT5 A;  1J2V A;  3AD8 C;  4Y00 A;  5KTQ A;  4NL5 A;  3WC2 A;  2ZE2 B;  1RAB B;  2IYG A;  1T3O A;  4KB7 A;  1H2T Z;  2MHE A;  3AQP A;  1TKX B;  1SH3 A;  2MHN A;  4CWB A;  3KLI A;  4A8K A;  1CVJ A;  3P5T L;  4PQU B;  1TVR B;  2V0N A;  5E3Q A;  3WHI A;  1R31 A;  2JLE A;  2KKH A;  1VRQ C;  1JB0 C;  1RQ0 A;  1Y3K A;  2JLF A;  3OTD A;  4L75 A;  4NMX A;  3TJ8 A;  3HSG A;  1N36 F;  3M8Q A;  4LVO P;  2WRM A;  5B0G A;  2MGZ B;  4Q0B A;  1X4B A;  2QMU B;  3R7S B;  1EX8 A;  4R8U B;  4QIW D;  2FTR A;  2UVR A;  2OP5 A;  3GYG A;  1ELO A;  4CQ1 A;  1F0X A;  2QL5 B;  4P2X A;  4DSE A;  1AFI A;  3BS9 A;  2BVZ A;  3DLJ A;  1E6V B;  3M1V A;  1BGX T;  4K0K J;  4EBE A;  2NYH A;  1OS5 A;  1RT4 B;  1D1U A;  1FRM A;  4CYU B;  1XR7 A;  2PO4 A;  4YY3 J;  4LF6 F;  5IWA F;  3W8P A;  1CUL B;  4X66 F;  2XO6 A;  3RYL A;  4KY3 A;  1DFD A;  2GJI A;  4XPC A;  4Q43 A;  1XER A;  2VJU A;  3SV4 A;  2VOD A;  2A2D A;  3GFY A;  2XC9 A;  4G1Q B;  1WG1 A;  2YH0 A;  2LLZ A;  1ZTW A;  5DET A;  2IMW P;  3J7Y I;  2GMJ A;  2E5I A;  2CQ4 A;  2YNF A;  4R8U A;  2AGP A;  3EGV A;  3MED B;  3HPO A;  4RUB A;  3H7H B;  4OX7 A;  1FD8 A;  5MAO A;  1OYE A;  3JSB A;  2DR9 A;  3MF5 A;  2E29 A;  3MCO A;  2QZ8 A;  3W9J A;  4BCA A;  4OX8 A;  2Z30 B;  4L3N A;  2F5G A;  1U6Z A;  2FVS A;  1SKW A;  3NBP B;  1K73 T;  5EX3 A;  3VV2 B;  4DV4 J;  3MEC A;  4LBI A;  1UWA A;  2JC1 A;  5DDO C;  4FPR A;  1VMB A;  1L3K A;  2RU3 A;  1A9N B;  3S01 A;  1NRK A;  3MMA B;  2IRX A;  3D28 A;  3HZG A;  4B3S F;  1S6P A;  2WVC A;  5A6W A;  1RAA B;  5J2N B;  1TL3 A;  3V6D B;  3N5B A;  3IR6 B;  4UT4 A;  2ZWO A;  4FS2 A;  1SJ3 P;  3HHL A;  2RQK A;  2ZH6 A;  4B9T A;  1S57 A;  4LF4 F;  1OPZ A;  3SYZ A;  5CYJ A;  1FF2 A;  4TU8 A;  1F9H A;  2DHS A;  2YKN B;  1Y3J A;  2PD1 A;  4NRT A;  1IM6 A;  5HN0 A;  1X9W A;  4M5I A;  2FZK B;  1LWE B;  4ZOS A;  4DV1 F;  1N6Q B;  4DR4 J;  2HRT A;  3ZTO A;  3DMJ A;  1MML A;  4QR0 A;  3D68 A;  4MIW A;  3CJ8 A;  2KRB A;  4E0D A;  2J9D E;  1KOH A;  2QFI A;  3BN4 A;  4GKK J;  1FRH A;  2YWG A;  1WOS A;  3LGH A;  1RTD B;  2OUG A;  4LIW A;  1FNM A;  4NLW A;  3AY0 A;  4OZ3 A;  3EIC A;  2NPF A;  4ZN1 A;  3LWM A;  1RAE B;  4QU6 A;  3R5G A;  1KRP A;  2VON A;  2NS1 B;  1GFW B;  2AD9 A;  3T1Y F;  2AJ4 A;  4QCL A;  2PC6 A;  3FUY A;  4FYX B;  4HT5 A;  5A2Q Y;  3TVZ A;  1ITP A;  5DG7 A;  4RL1 A;  2FVR A;  4F50 A;  3MFH A;  5LSO A;  3SZ2 A;  1UA0 A;  2E1C A;  2OPP A;  2ASY A;  3P4U B;  3FFI A;  4I6W A;  2VB6 A;  3G8Q A;  4WXO A;  3T5K A;  1MW7 A;  4YDX A;  2RD5 C;  4EEY A;  1O0P A;  1W26 A;  4ED1 A;  1HNI B;  3D6M B;  5D4O A;  4NA3 A;  3CC4 S;  4CP5 A;  1SKU B;  3KJF B;  3CCT A;  3DRR A;  3NGT A;  2V5H G;  4B3T J;  3KK3 A;  1S1W B;  3EVO A;  4KC5 A;  3PYF A;  2Y3Y A;  5GME A;  3DOK B;  2PI5 A;  3OTE A;  1QSS A;  3G8T A;  4TLR A;  2GVZ B;  3N0V A;  2R8I A;  4P6Q A;  2J6U A;  2DY9 A;  2HQF A;  3NGS A;  4Y2A A;  4FNI A;  1VI7 A;  3ZTP A;  1FE0 A;  3MEK A;  4DL4 A;  5HP1 B;  1V3Z A;  2JNJ A;  3J7Z 5;  2XMV A;  1U8W A;  1V6H A;  2CPD A;  3BPD A;  3CJ3 A;  3TNV A;  2XNQ A;  2N82 B;  3KLG B;  4LF8 F;  3H59 A;  2E66 A;  1NK6 A;  3T1Y J;  2V8H A;  3QT8 A;  4DG1 B;  2W8L A;  3X1L B;  5KT6 A;  4X4N A;  2BJ3 A;  1CQN A;  5BYR A;  4ZVT B;  3PFO A;  5LSL A;  2XGP A;  2QSF A;  2JFK A;  3MEE A;  3HXM A;  2D1C A;  2EFQ A;  3RTV A;  2Y1J A;  2HPU A;  2B8Q A;  3SDE B;  4TY8 A;  4ZLN A;  1T9X A;  3C14 A;  4UTG A;  3THP A;  2KZZ A;  4AL7 A;  3KMS A;  3DRS B;  1UL3 A;  2GVD B;  2IM3 A;  2FB0 A;  2ASJ A;  1IBL F;  4A8S A;  4ZCI A;  4B3T F;  5GAD U;  1UJ4 A;  4TU9 A;  5D15 A;  2MQO A;  4RUA A;  2BYC A;  1HNZ J;  4F4K A;  2YPZ A;  1CJK B;  3DGV A;  3HCX A;  2HBZ B;  3Q24 A;  4CRJ A;  1EKS A;  2GIQ A;  2LQ8 A;  2PMW A;  5L1I A;  1RGV A;  4I6Y A;  2XLJ A;  4DU8 A;  4RU9 A;  2DJW A;  2YQ0 A;  3VTI A;  1RYR A;  2A6O A;  2RJZ A;  4IFV A;  6FDR A;  1DTT A;  1G2E A;  4DPX A;  1VJQ A;  4DLG A;  4M5D B;  1SH0 A;  2GCF A;  4NZ0 A;  5ETR A;  3GFH A;  3U1N A;  2L3M A;  5J2M A;  3KK2 A;  4DQR A;  1F3V A;  3A3N B;  4M5G A;  1NHU A;  1RT7 A;  2ILY A;  1HI0 P;  2HFV A;  1LFW A;  2WZ1 A;  4GO5 X;  1SUQ B;  1Q81 T;  4DQS A;  4ZVS B;  4YB1 P;  4BDP A;  5E2Q A;  2MZT A;  1YDL A;  3F0N A;  4ZVR B;  4H4O A;  3ISN D;  3L7O A;  5B7W A;  5DDP C;  2ZZM A;  1UZD A;  1PBA A;  2P6S A;  2VL1 A;  1U0H A;  3C66 A;  4OFZ A;  2OTJ S;  2POK A;  1N34 F;  3G82 B;  3K57 A;  1XN9 A;  3MEC B;  3J80 U;  5IS2 A;  1EAY C;  1S1V B;  2E9Z A;  2LXI A;  5HRO A;  4B9U A;  1BQM A;  2V4J B;  3GON A;  2KJV A;  3I87 A;  3HVW A;  1HWL A;  3D66 A;  3KG4 A;  1WC3 A;  2NPI A;  2WAQ D;  1TUW A;  2WB4 A;  1ZAW A;  2Y1R I;  4JI5 J;  3MCN A;  1NSK L;  4I1T A;  1XMQ F;  1QLN A;  3MM9 B;  2DNN A;  4F67 A;  3JQM A;  1TK5 A;  5KG2 A;  2W8K A;  1Y00 A;  3TW0 A;  1KEK A;  1SUQ A;  1S76 D;  1RWO B;  3ZZO A;  3QIP B;  2BE2 A;  4JP8 A;  5AXM A;  4Y65 A;  2HVD A;  1LW0 A;  2K7K A;  2QMW A;  3CJK A;  3M2U B;  3MM8 A;  1I3O B;  4DUY J;  3GB0 A;  2UXB J;  3IC1 A;  2E9R X;  3T1A A;  4OIX A;  3JSR A;  3C8Y A;  4CNZ A;  1DJ0 A;  1X9M A;  1J5O B;  1LXN A;  1GQE A;  1S1V A;  4RLE A;  3HHL C;  2HHX A;  1RTZ A;  2KXH A;  2YWH A;  3UDE A;  1YIJ S;  4IOC Q;  2DHH A;  1RWM B;  2K3I A;  1FJC A;  2RQM A;  4I2Q A;  5EGY A;  5DLG A;  4DF4 A;  1SBR A;  2ZC3 A;  3BPS P;  5DZ7 A;  4DX8 H;  2HVE A;  2UZA A;  1RBO B;  3GG1 A;  2VOO A;  1X60 A;  2EBG A;  4G65 A;  4ATN A;  5L9N A;  3HHK A;  5C2G A;  1WEY A;  2X3G A;  3MGJ A;  4YQW A;  3EGN A;  1CJT B;  2D3O 1;  3VCD A;  4PUO A;  5D3G A;  3M8W A;  4FPI A;  2K06 A;  1OQ3 A;  3CMQ A;  3ZNU A;  1E6Y A;  4HDG A;  2N7Y A;  2YTC A;  1FT8 A;  3BRE A;  2Y9H A;  2LU2 A;  1SV5 B;  2MKH A;  1RHR B;  4WTY A;  4USU A;  2V50 A;  3G71 S;  1GXU A;  1HR0 F;  1IQZ A;  1PJ7 A;  1JJ4 A;  2QA4 S;  2NXE A;  3OTO J;  4OI6 A;  3TR5 A;  1MMD A;  1WD6 A;  5KOX A;  3TA1 A;  3KHH A;  4O3R A;  1AW0 A;  2J7U A;  4K7Q A;  4ZP6 A;  2CAJ A;  2ZKU A;  2KU7 A;  3Q23 A;  4Q5V A;  2C3O A;  3H4D A;  3KUE A;  1VK3 A;  4KH0 B;  5HSP A;  5GAH U;  2VU5 A;  2HVZ A;  3VF0 B;  3P3D A;  1OWX A;  2FJV A;  4FDF A;  1IKX B;  2I2Y A;  4HKQ A;  1QVF R;  1MNE A;  3PW0 A;  3QLH A;  5DS7 A;  5J2Q B;  2D41 A;  1S6Q B;  4PWW A;  4ZMM A;  3AFG A;  4Z2X A;  2D9P A;  3EXY A;  4RPF A;  2VA3 A;  4KJI A;  5B0B A;  2LVW A;  3MPW A;  3UR3 C;  1B99 A;  4PWU A;  4X64 F;  2VD3 A;  2CJY B;  3SDE A;  1E6V A;  1GX5 A;  1RZM A;  3M1V B;  3KLF A;  1Q4R A;  1R89 A;  2L41 A;  3TOQ A;  3E8O A;  2QJ3 A;  2RKI B;  1NJZ A;  2IHR 1;  1VLY A;  2V8P A;  1RIS A;  2DGT A;  2VDI A;  4OX9 J;  3OVB A;  3N79 A;  3TA2 A;  4DPT A;  3MR3 A;  4KR0 B;  4LSN B;  1JLQ B;  3AOD A;  4NX9 A;  5E3R A;  8ATC B;  2LFV A;  2MJU A;  3W1Y C;  2ZJP Q;  5KFV A;  1KHV A;  1QAI A;  1OYD A;  1S0O A;  3LPE A;  3A8I A;  4J5O A;  3GG0 A;  2RAQ A;  4ERD A;  2BE9 B;  1U1N A;  1XEZ A;  3IMQ J;  2A0F B;  1IBM F;  3IS9 A;  3U02 A;  1GXL A;  3VGS A;  3KK3 B;  2ZE2 A;  4P72 A;  1Q1K A;  2GHW A;  4NLO A;  5HJX A;  4WFZ A;  1RT2 A;  3A4T A;  3VWS A;  3A3O B;  1BWE A;  1NPR A;  2DNY A;  1RLC L;  2QMX A;  3M8P A;  3TWZ A;  5C7P A;  3NBP A;  1VRU B;  1MMN A;  3MD3 A;  3K8V A;  4USK A;  2MZS A;  4MYT A;  1FKO B;  5BYQ A;  1C1C B;  2HBY B;  3WX4 A;  4DFP A;  1SB6 A;  3ETO A;  3HVA A;  3Q8Q B;  3AOB A;  4DR2 F;  3HFZ B;  5E41 A;  2KZM A;  2B4P A;  2ROE A;  3MAA A;  3MXH P;  2F8E X;  4WFX A;  3HVR A;  2BKN A;  4QIF A;  3UFC X;  3GCW P;  3VAH A;  1U49 A;  1REV A;  3GWC A;  1TK0 A;  2BM0 A;  1VQK S;  3PHE A;  3MWB A;  3QGI A;  3MMC A;  1NJI T;  1EAR A;  2NQP A;  5H9F J;  2AEJ A;  3FSY A;  4CI0 B;  4CO2 A;  4DEZ A;  5KG1 A;  1A6L A;  5I3P A;  2DIU A;  3VGT A;  5C5J A;  4WE1 B;  1F5C A;  5A8R B;  3Q0A A;  3N6M A;  1VQ9 S;  4LUB A;  1RTI B;  2DK2 A;  4F25 A;  4DDF A;  1U26 A;  4ELT A;  3V81 A;  2JDJ A;  1ACM B;  4OHW A;  1HFE L;  2HWT A;  3QO9 B;  2M52 A;  2RHQ B;  2UUB F;  1LK5 A;  3DU6 A;  1U1L A;  4U6P A;  2AJ2 A;  1AZS A;  1HQU A;  2BQR A;  3QQC D;  4DR5 F;  2IMO A;  3AHP A;  1X4A A;  5GAH I;  3W60 A;  3MMJ A;  5IV3 A;  3AXK A;  2UXD J;  4M8L A;  1FER A;  3B54 A;  4X66 J;  4RNM A;  4GC6 A;  3CDU A;  2YXL A;  4MMO A;  4IO1 A;  5L8R C;  3MUM P;  3P8B B;  2LEB A;  2AIR B;  4K4Z A;  2DNH A;  1ZOT A;  4YDD B;  4ECT A;  2ZC4 A;  4H4O B;  3UCG A;  4TNO A;  2J9E A;  2DTJ A;  2QX0 A;  4UZB A;  1FDB A;  2PEH A;  5LOQ A;  2ZOG A;  2M88 A;  4KQZ A;  2CG8 A;  2P9G A;  3G87 A;  3H90 A;  4PG4 A;  4DL0 C;  4DMZ A;  2HNY A;  3OFH A;  4ED3 A;  2JRS A;  9RUB A;  3CC2 S;  1P9Q C;  2CA9 A;  3MMB B;  2ZH7 A;  4IQX A;  3Q83 A;  1BQM B;  1FXR A;  2V4J A;  4I68 A;  4PCQ A;  3KLV A;  2WCX A;  3AA9 A;  3L09 A;  4P10 A;  5AE1 A;  2QYC A;  2ASL A;  1UFK A;  5ETN A;  4EU0 A;  2JVO A;  1VQP S;  1XMB A;  4Y2I A;  5L1K A;  4J9K A;  2HS0 A;  3MUV P;  1YK9 A;  3M2R A;  5AJ3 F;  1JLE A;  1HW8 A;  1MN9 A;  2VBW A;  2ATC B;  1KON A;  3M32 A;  5CYQ A;  3WQP A;  2B5J A;  4RWX A;  1K9M T;  1S77 D;  2JEI A;  1HWU A;  1RHJ B;  3NCR A;  2R7Q A;  4C2M A;  1ZS6 A;  5JUM A;  2BE7 D;  1S4E A;  5IV4 A;  1Q16 B;  3LF0 A;  5CD4 A;  4Q44 A;  1KC8 T;  1SKS A;  2RHS B;  1KHW A;  1I6J A;  5U47 A;  2XY5 A;  2AGQ A;  3CNQ P;  3SBM A;  1HD1 A;  1SKR A;  3SV3 A;  3ZZR A;  1QVG R;  1G1X A;  2KB2 A;  1LFP A;  3H5S A;  2MJN A;  4Y2M A;  5D0E A;  5DDQ C;  2QIF A;  4ECR A;  4WZM A;  1CSJ A;  2DEJ A;  2R7W A;  2QYG A;  3MTJ A;  5T14 A;  3D2W A;  2YKQ A;  4OX9 F;  5DGA A;  3ZFV A;  1WOO A;  1P1T A;  4DR1 F;  2BBE A;  3FCV A;  4W92 B;  1I94 J;  3V4I B;  5L38 A;  4JI6 J;  1TFY A;  4L6V 3;  2E9T A;  2WVB A;  1N32 F;  4OZN A;  4MKY A;  4CH1 A;  3N6L A;  3CPW R;  3HSD A;  1VRT A;  1HNV B;  3IWX A;  4KGM A;  1RWW B;  3PYE A;  1IKW B;  1FEE A;  4WTO B;  3TUJ C;  2IJN A;  3MM7 B;  3FQL A;  4HL9 A;  5CYM B;  1HPZ A;  3A12 A;  4NLV A;  2MZJ A;  3CJT A;  3CMA S;  1HYS B;  4DR6 J;  3CED A;  4F4X A;  4DPY A;  1KKH A;  2AZ3 A;  4U9R A;  3UI3 A;  1PSD A;  4BC9 A;  2VC0 A;  3KLE A;  2GMH A;  2UUA J;  2UUC F;  1TP7 A;  3PYD A;  2VPW B;  4CTA B;  5LMU F;  3HF5 A;  1XMO J;  2O66 A;  3U7J A;  3MEE B;  5F41 A;  5L1J A;  1I5O B;  2BJ8 A;  2BEF A;  2J0Q D;  4A8W A;  3SQG A;  2IAJ B;  2OAU A;  2XS5 A;  5GMK a;  3KWM A;  4PKD B;  3AT1 B;  4QIG A;  2XGQ A;  2XCA A;  3BJY A;  3NGK A;  1VS3 A;  2E7W A;  2HGN A;  1RB0 A;  1H7X A;  2WSF C;  4FVM A;  4HI2 A;  3H25 A;  2ZHO A;  2ZH5 A;  4ZVE A;  1J5E F;  1R8A A;  3BQ0 A;  1ZET A;  2IDL A;  2DGS A;  4G1I A;  5HAO A;  3GIM A;  2ZEJ A;  1QTN B;  2IDE A;  5KFJ A;  3BSN A;  5FDL B;  1S1T A;  4I7F B;  3MPU B;  3RZA A;  2VHG A;  1S0V A;  2HNZ B;  1TL1 A;  4DV0 J;  4LBH A;  2FVP A;  2W7A A;  1FJG F;  3RU0 A;  4CTA A;  3BDE A;  3D3B J;  4GVB B;  3GE9 A;  3LUY A;  2PII A; 
#chains in the Genus database with same CATH homology
 1U0H B;  3C14 B;  4P2F A;  3C15 B;  4OZ3 A;  1AZS A;  3R5G A;  5D0H A;  1CJV A;  5IV3 A;  4CLL A;  1CJT B;  1TL7 B;  1CUL A;  4WP3 A;  5D0R A;  3G82 A;  1Y11 A;  2QV6 A;  4USU A;  4CLZ A;  4OYW A;  1YBU A;  4OYP A;  3MAA B;  3C16 B;  1AZS B;  2GVZ B;  4OYZ A;  1CJU A;  1YBT A;  4WP9 A;  1YK9 A;  4CLW A;  4OYI A;  2BW7 A;  4CLU A;  5IV4 A;  1Y10 A;  4CLT A;  1CJV B;  3C14 A;  4WPA A;  3UVJ A;  3C15 A;  2GVZ A;  2GVD B;  3UVJ B;  1CS4 B;  4CLY A;  4P2X A;  2GVD A;  4OYM A;  5D0E A;  4CM0 A;  5D15 A;  1AB8 A;  1CJK B;  3ET6 B;  4OZ2 A;  4NI2 A;  1CUL B;  3ET6 A;  4CLK A;  3C16 A;  4CLS A;  1WC0 A;  4OYO A;  1CS4 A;  3MR7 A;  2WZ1 A;  4USW A;  1CJT A;  4OYX A;  4OYB A;  4USV A;  4CLF A;  4CLP A;  2W01 A;  4CM2 A;  1TL7 A;  1U0H A;  3G82 B;  1WC6 A;  3MAA A;  1FX2 A;  4WP8 A;  1WC3 A;  4OYA A;  1CJK A;  1CJU B;  1WC5 A;  4UST A;  5D0G A;  4NI2 B;  1WC1 A;  4P2M A;  1WC4 A;  1FX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...