1WC5A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp in presence of bicarbonate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
193
Chain Sequence
MRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
total genus 55
structure length 193
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc5A00
4CLYA 4OYIA 4USTA 4CM0A 1TL7B 4CLZA 2GVDA 4OYZA 3G82A 2GVDB 2WZ1A 4P2XA 3R5GA 3G82B 1FX2A 4CLLA 3C15A 4CLSA 4OYWA 1TL7A 2W01A 1YBTA 1Y11A 3C15B 4OYOA 1AB8A 5IV3A 1CJUA 3MAAA 1CJUB 3MAAB 1WC1A 4WP3A 1CS4A 1AZSA 1CULA 4P2FA 2BW7A 4USVA 1CS4B 1CJKB 1CJVB 4NI2A 1AZSB 1CULB 3MR7A 5D0HA 5D0RA 4WP9A 5D15A 4USWA 3C14B 3C16A 1WC4A 4NI2B 1WC0A 4OYAA 3C16B 4P2MA 4OZ3A 4CLWA 1FX4A 4USUA 3ET6B 4OYMA 4CM2A 5D0GA 1YBUA 1CJKA 2GVZA 4CLUA 1CJVA 1Y10A 4CLFA 2GVZB 3C14A 1CJTB 4OYXA 1YK9A 1WC5A 4OZ2A 4OYPA 1WC3A 3ET6A 2QV6A 5D0EA 1WC6A 3UVJA 4CLPA 4OYBA 4WPAA 3UVJB 1U0HA 1CJTA 5IV4A 1U0HB 4WP8A 4CLTA 4CLKA
chains in the Genus database with same CATH superfamily
1MN7A 4USTA 3DOMA 3A8KA 3BGFA 2JLGA 2ZWOA 1Q86T 2AMCB 2ZE2B 3UR3C 3RGIA 3FVYA 4LQ9A 1ZOTA 3DRPA 3V2UC 2RMLA 2ZUAA 3KG1A 4KAIA 4DR6F 3K5PA 3T5KA 3TUJC 1NK8A 5KFCA 3JSMA 1OPZA 1R6VA 2K3IA 2KVIA 4YMEA 3HK2A 3M9OB 2BE7D 2J8SA 1C0UA 2HHPA 1ZZNA 1U0SA 2C3PA 4QZVB 4MKAA 2LXFA 5C24B 2KRRA 3SDEA 2IHR1 3IAM9 3O6QA 2K2PA 4DV3F 4M5MA 4KTQA 3CIZA 1U8SA 1D8ZA 3JAMU 3CUNA 4O4RA 2FGOA 2QFIA 4OYIA 4YB6A 2GJ2A 1N0VC 3K5OA 1VC5A 4N77A 3NRBA 1YJNS 5B0AA 3T1HF 5HLFA 4OV6A 4ZJOA 1Q79A 4NCBA 3OFHA 3P49B 1FK9B 3GCWP 4ED1A 1TL1A 2CWKA 3OHBA 4A8SA 1ZPWX 4WTOB 4I1TA 2ZHBA 3GTYX 2O01C 1D1UA 2Z30B 4DJBA 4IO1A 3DDIA 1HMVA 3I5AA 3R5CA 4NLXA 5HSPA 3EZ5A 4P7TA 3BS9A 4JV1A 4DOZA 2V4JA 3O44A 3QZ7A 2B4PA 3T5LA 2HFVA 5K8OA 4OI3A 5G4DA 2BJEA 3IR6B 4HKQA 4ILRA 4U95A 4PXBA 2OI2A 1ZH5A 1EP4B 4N76A 2ILZA 5GMKa 4IG0A 1HNVB 3M05A 1LEOA 3SCLE 1VQ8S 1KTQA 3NCRA 1PSDA 2BE2A 4QPXA 4ECWA 3M7VA 1RBOB 5KG1A 3P96A 2AJ1A 1JXLA 2Z57B 1F2GA 2KG1A 3HHLC 1N34J 3BGUA 5CYQB 4IKAA 2JJ4D 3DLHA 1SI9A 2YX4A 1IBMF 5J2PB 3LOUA 2W9BA 1TAUA 5IT9Y 4OZ1A 1AW0A 1D0EA 3VR1A 2C42A 3B4MA 5HANA 4PUOB 3GFXA 3GFYA 3I82A 2C3UA 4GKJF 1R0AB 5KFUA 2JLFA 1BQNB 2UUCF 2UXDJ 2XMMA 4DFKA 2VFTA 3TVKA 3MR5A 2V8VA 2ZH7A 4EO6A 1N5YB 2DR6A 1TL3A 1JLEA 2RUSA 3PACA 3B8HA 1KFSA 1OSDA 1YRXA 1MWYA 3FC9A 2KL8A 5IZHA 5B09A 3VAIA 4ENOA 3N0VA 5CAAA 2N3OA 2YKQA 4I67A 3W5ZA 2YWWA 3OLAA 3MTKA 2XHCA 3BN4A 1VIOA 4FS2A 3R1HA 4ZVSB 4OFZA 4MKBA 1X4DA 1LW0A 2CNKB 1T03A 4E98A 1Q78A 3TA0A 1VQ4S 5E3RA 4Z2XA 3BM7A 2QGFB 2AD9A 1RAJA 1YTYA 1KQFB 1EETB 5M2RA 3D6TB 5J1EB 4QWEA 5IC4B 2XZDB 1X4AA 1CULA 1KC8T 1C0UB 3SYZA 1OPIA 3UNYA 4DSIA 3LAKA 3KLHB 2HVEA 2QFJA 2K8GA 1QAXA 4C8YA 4FXWA 1FT8A 1SV5A 5D0GA 1XMOJ 4MFBA 1S76D 4DF4A 3NS7B 3E2EA 4RPFA 4HH1A 4ED0A 3FMBA 3CJQA 1IN0A 3FBCA 4DG1B 2ADCA 4C97A 2MQNA 2L3MA 1ZTWA 2IJFA 4QCLA 1K0VA 2C2EA 2FC8A 2KT5A 5D4PA 4WU2A 5HLFB 4CLZA 2GVDA 2RE1A 3H2LA 4LF7J 2FVQA 3R5GA 1TL1B 2F4VJ 1X4CA 2OEKA 3OVSA 4AL5A 2Z4PA 4RNFA 2JLEA 2QT7A 1M1GA 4YDXA 2VH7A 4FDFA 2WOMA 4B3OA 3DU5A 2C2RA 4IOAQ 3BH7B 1S0NA 2FLNA 3IR7B 3J81j 4M5KA 2V4JB 1WOSA 4Q0BA 2HQ3A 1NHUA 4NEZA 2EKNA 4OZ3A 3GIJA 1FERA 4X65J 3M32B 1UVJA 2OO4A 1YBUA 2MKCA 2BM0A 4IG0B 3HKZD 2ZHAA 1TK0A 2ZBRA 4BC9A 4PPDA 3GLJA 4I4BA 5T7LA 3FDSA 2R7SA 2MQOA 1ZTTA 2KXFA 3QT6A 4DR6J 1XR6A 4NLTA 1VQ5S 3EICA 4O44B 5M2PA 1URRA 3J7A1 5SZTA 1N33J 4DV1J 1FKOA 4MYUA 1S59A 3VVUA 3HD1A 4ECRA 1I6JA 3NNCA 2OLWA 3EVWA 2F9JA 2FY1A 1VBZA 4O3RA 2CJXB 2AYGA 3TANA 2GIQA 3GJTB 3B78A 5B0BA 5I4MA 4MAKA 4DV3J 1LQ9A 5CA5A 5FJ4A 4IUFA 3EYZA 2FLPA 4TN2A 1NZ8A 2B7CB 2AJ0A 3D0IE 1TL3B 2BEFA 1RT3A 1LK5A 1YRTA 2MSSA 2VKRA 3LPEA 2CDRB 1O6XA 3R9LA 3QRPA 1U26A 2H48B 4P7VA 3FJ2A 2DGXA 4ES1A 5KT5A 4PXDA 2A2DA 5E7OB 1VBXA 1F3VA 2D41A 1T95A 4KQZA 3JYTA 1LW0B 1NM2A 2XLJA 4YY3J 2BA9A 4DZDA 4C8LA 1XNQJ 4CLKA 2RRNA 1M90T 5IC6B 2XLIA 3DLEA 1YJTA 2BBEA 4QYZK 2Z2YB 3MMCA 1ZBTA 3I4PA 3LO3A 1YKWA 2F8EX 3W9HA 3IAS9 2LLZA 4DSLA 3X3UA 1E6YA 3DRRA 4H54A 4WTYA 3GSIA 2R3VA 3W7BA 4BWMA 2QJ3A 1SV5B 2VD3A 3A3OB 2HIYA 5KFMA 5LSLA 1HR0F 2XO6A 1S77D 1KNZA 7AT1B 1TL5A 3EGVA 3NAIA 3QZ8A 2JFDA 4DPOA 1U48A 4LF6J 4K0KF 1IBMJ 2UZAA 2N7CA 4OYXA 3NGSA 3GJSB 3EDRB 2ZH2A 2CQ4A 2R9LA 4B3RF 3CVKA 1NDCA 5EWFA 4DL3A 4HLBA 1RAGB 3PRBA 1Z2LA 2XQCA 2DHXA 4QR0A 3VHQA 1UCNA 4LSNA 1Q8BA 4CM0A 2HS3A 2ZKUA 2BJ1A 2J7UA 2WOMB 4B3OB 4ZKAA 3C8YA 2N7YA 5A6PA 3BQ0A 3R7BB 4GRSA 4P10A 4DL0C 3A13A 2RQCA 4TVAB 4DL6A 1WHXA 4CO1A 4DZ6A 2XMTA 1FXDA 2ZH4A 1BQMA 1HNIA 3M8ZA 5DQGA 2VONA 2XYPB 3OXFA 4HACA 1J27A 5KFJA 1ZETA 4WYLA 3DU6A 3CSKA 2YWHA 3IWXA 4C8NA 3C46A 3BBCA 2ZHOA 3P5TL 1PG5B 1VMBA 3MMBA 2DH8A 5T7LB 3FK4A 4IH7A 3H7HB 4L76A 1PAUB 2POKA 5H1SV 4V19J 4F4XA 2ZH8A 1H3DA 2MPUA 3SXLA 4WK1A 3EPIA 1R8AA 3ZTQA 2RAQA 4OYPA 1FKOB 1IQTA 4RX6A 4CLPA 2F5GA 3MEEB 3G8TA 4ED3A 3G6XA 3IWNC 1LXNA 3VGTA 5KT6A 4X66F 5K8MA 8AT1B 2PEHA 3N6LA 2DNKA 2DNGA 3FZBA 1HKAA 2QLFB 2EXUA 2WHOA 1OQ3A 1HHSA 4RW7A 4DLGA 2IVMA 4P2SA 1FVQA 1F5AA 1DFDA 5I3UB 3VGVA 1XMQF 2HNZB 1HBOB 3N6NA 1SIWB 3BSCA 4LQ3A 2JWNA 1VQLS 4NYPA 1H98A 1U24A 1TUWA 2Q43A 2DXEA 2B9YA 4FYXB 1T05B 2RS8A 4M63A 2UUAF 3JYTB 1IKWB 3I96A 5MLCV 3B6BA 4DQRA 2UV8G 1QDUB 3RUBL 3D54A 4EO8A 3PRVA 4F4WA 5D8HB 2XY5A 2C1EB 4PG7A 4DR1F 3U1MA 3KUHA 2DNRA 3W8PA 2RHSB 3KG0A 3IG1A 2HWTA 3QYYA 3KLGA 1IBCB 3MMCB 1DTTA 4LR8A 2DNHA 1ZAXA 3HVRA 2XI2A 4MMOA 5K8PA 2QG9B 3WDOA 4WIIA 1R0BG 3F0NA 2M70A 1T02A 4DV5F 3AOCA 3EX7B 2XMVA 1E6YB 1FKAF 1WF2A 4FF1A 1VQNS 2Y0SD 3ILIA 2XNRA 3NXZA 4DPTA 2F40A 2K06A 5A76A 2GIRA 1Q5YA 4Q5VA 1K1QA 4RWXA 3P5BP 2CJ9A 2DGUA 2BW7A 2CZ4A 1YIJS 4C9DA 3AOAA 4TYBA 2E44A 2QEXS 3SQGA 1I3OB 3O8WA 2OPPA 4USUA 4DV0F 5KT7A 1NB2A 4CI0B 2BJ8A 1IBKF 1BXNA 1HQEA 3W2WA 1Y9OA 2E5LJ 4YN3B 3QGIA 3OLBA 1QUPA 4KFBA 3TW0A 4DX8H 5FLXY 2WB4A 2XULA 4NCAA 4ER8A 1J2VA 1X5OA 4ZLPA 4XDCA 2XHWA 1T3OA 3BGRB 4J9OA 1HIYA 5CCLA 1BUXA 1M5VC 1WEYA 1HBNB 1QJHA 2JVOA 1HNIB 2GHWA 3NCPA 5DO2A 4DR7F 4KKOA 4Q45A 5L46A 3GP9A 1UPMB 4RBUA 3G6ES 2C2ZB 1ULRA 3QSYB 2PI5A 1JQGA 3MMBB 1WF0A 3M8SA 3FNNA 4X84A 3M9MB 4URQU 3MR7A 3KDNA 4U7CA 3AHPA 1N52B 3V6JA 2IM3A 1B0TA 4J9UE 3PYGA 1VBKA 3D7SB 4OX9F 2XMAA 1IWGA 1PAEX 1PBUA 2PC6A 2XYGB 4QQBA 1JLBB 3M2VA 4RW6A 1NXIA 5K5MA 4HHJA 2YH1A 2G13A 1VFJA 2DITA 5KFHA 3RZAA 1GT8A 2YQ0A 2XYHB 4EU0A 1AFJA 4B08A 2WONB 3OFGA 1HFEL 1HR0J 3OT9A 2CAJA 4ED2A 2FY8A 3W65A 3Q8YA 2V8DA 4G1PA 2WW8A 1F3FA 1F9HA 1QAIA 3GR1A 2CPZA 1TFWA 1REGX 3DLBA 2F9DA 2E9TA 3QT5A 4B3RJ 2MKIA 4HHUA 1U47A 1QD1A 2L9DA 1CJUB 3CCWA 1FRIA 5F9NA 2K3KA 1TU0B 2AW0A 2BW2A 2B9WA 3CCUS 5A0YB 4BBYA 1FRJA 2PE8A 1XR5A 4GC6A 1VJWA 5HQ8A 1B7FA 4CZCA 4MH8A 4ZLJA 4CM2A 1TKZA 2Z0GA 1KVIA 2DR7A 1Y10A 3MURP 5L38A 1QE1A 1ZA1B 2BJDA 1SQEA 2MY7A 4KGZB 2GMJA 2E5JA 4JI1J 3VF0B 1SC3B 3LALA 3M4XA 2PA8D 1IBLF 2MQLA 1TK5A 3RB3A 2G0JA 1TKXB 3KJQB 4XPEA 3MHYA 1P1LA 1YHQS 1QUVA 2FYXA 3QJLA 4FVMA 1HWUA 4WYWA 3KLIA 2BOPA 1R6YA 3SQGB 4WBFA 3TR5A 3J7YU 2NR0A 1RWUA 5LJ5Y 4FYWB 2ZBQA 2AU0A 3DRYA 5HN0A 2VOPA 4LF4F 2ZZTA 2R8JA 4JB8B 2L41A 2DR8A 4RNHA 4I2QA 3TQEA 5AE1A 2ATCB 3H40A 1X4GA 4ZIWA 2LXUA 1HARA 1MMDA 4M95A 2M7SA 4LBIA 4CLFA 4JI5F 4X4PA 1XMQJ 4QWBA 1RQ0A 4ZVEA 1FFWB 4TY9A 4AL6A 3LF0A 2UXCF 3PO4A 2G1HA 2QLWA 4P9SA 3HSDA 3CJ0A 1QSYA 3EWGA 2PMWA 1N8RT 1FCAA 2UUAJ 3O5TB 4DSFA 2OELA 2JEIA 3BKUA 2ZVIA 4KGKA 3N4WA 3EUNA 4B3SF 2U2FA 2DT9A 3WBZA 2WB1D 1XERA 5E3QA 2GO9A 2M8HA 3HKWA 4HT7A 1NHKL 5RUBA 4CLSA 5KFGA 3PHEA 5F8IA 2PMZD 1VGYA 1T3NA 2XMWA 3EZUA 1S6UA 3NS5A 1NSQA 4RBTA 1U02A 8RUCA 3IRWP 4G65A 3EVMA 4C11B 4HH0A 4KT0C 3DKDA 2CJKA 2LP4A 3MTJA 3UWTA 3OL9A 4DV5J 4OZNA 2BV3A 3OD2A 4L73A 1IUJA 2CPXA 4ZVFA 5DJBA 4TQRA 4ID8A 2B56A 2XY6A 3OBIA 3Q8SB 2RH3A 3GIRA 4ECVA 5KFVA 2W2OP 1X60A 1R43A 1LWFA 3HJFA 1EB0A 5KFLA 2A0FB 1RLDA 3DI6A 2LQBA 4QPTA 4IQXA 1SB6A 1WWHA 2YX1A 4WCEQ 1ZM4A 4O3OA 4FNHA 3G9CA 2V2QA 2DIVA 1IBKJ 3EXYA 3IBWA 1K47A 2B8QA 4NOHA 4ATNA 1F9EB 4ZOSA 1GH8A 5IQQA 2EBEA 3I9V9 2FLOA 3UCZP 3MM6A 4NMLA 1LNQA 1DRZA 4USVA 5HROA 4PZVA 4IOCQ 2B4UA 5D0RA 3MPYA 1CVJA 1C4CA 2MKSA 9ATCB 3Q8RB 3R5JB 3SI8A 2MQMA 2C3MA 3PHTA 4C2MA 3WIUA 3UD4P 2R42A 1CC8A 4DQIA 4I7FA 1CJKA 5HJYA 3KG4A 5HJXA 3BJYA 2QC3A 2LQ8A 4YOEA 2C2OB 1V3SA 1XR7A 5T14A 2VBWA 2J9DE 2XTJP 3N5FA 3AD7C 1JLAA 3L09A 1KQKA 2KG0A 2FIUA 3UVJB 2NSCA 4K2XA 1ROFA 1EARA 4CYUB 1VRTA 3PIOQ 4O3QA 2VC0A 3UDCA 2DK2A 4CT8A 2RDIA 1YI2S 2J6TA 1C1BB 2W9CA 4AFFA 1RZMA 1WEZA 3MR2A 4TXSA 1HWJA 4OI6A 1Y11A 3M8YA 3JSRA 2DGVA 4OZ0A 3KOAA 3S6EA 1J5OA 2EC0A 2WSCC 2HAFA 3P4UB 5BYSA 4ITSA 3BR8A 1DAXA 3M6XA 3ZZUA 1PILA 1LWEA 1Y0HA 1WTBA 3TVYA 5HVHA 4G1IA 2NUHA 3KK2A 1QSSA 3T5HA 1KRPA 4M5DA 1WD6A 1IR0A 2GHVC 4OYBA 2E5GA 2H5EA 3TZWA 4IR1A 5HVFA 4R8UB 2KXNB 3ICLA 2X3GA 4RUHA 4TU8A 4WU3A 2XLKA 3GG0A 2C3OA 3BSNA 4DUYF 2KB2A 1RHUB 1J5EF 2B9XA 1HQUA 3BR9A 1Z1ZA 1VIXA 5IT4A 2IRXA 2J0SD 1UZHA 3GZ7A 1QSLA 2NXNA 3RW7A 3TX8A 4DQPA 3JQKA 2IRUA 2AYBA 1B0VA 3GE9A 2NXJA 3RTVA 2E29A 1CEZA 1SBRA 4C7QA 3MM7B 4Y0FA 2HHUA 4AQYJ 1HNXJ 3Q2SC 4YUDA 2GMLA 1IBLJ 1OYEA 2XY7A 4CNZA 4ZDNA 3D68A 5H9FJ 4HTJA 2MQPA 4ILLA 4PEOA 2C2KB 2CZ9A 3GWCA 2CPHA 1RT1B 1UJ6A 3J7AN 3F44A 2BANB 3OQ2A 4EWTA 4U9RA 3DI6B 2V5HG 3ITHB 5H9FK 3N79A 2RS2A 2RKIA 3TZZA 3NBPA 4LF4J 3GU0A 1VC0A 3CJ8A 1LV5A 2GQ2A 2IBOA 3W9IA 1NHVA 3CC2S 3DOLB 4MIBA 1N6QA 3DXBA 3QJJA 2AV5A 4JI5J 3NY0A 5HROB 3CPWR 1AA1B 3OR1B 5GVQA 4C3MA 2UXCJ 2E1RA 4ZP8A 4HT5A 3KJVA 3ENQA 1BWVA 3BKFA 1CJKB 2B9EA 4NI2A 4WE1A 3C16A 2YWKA 2ZITA 3BDPA 1UJ4A 4NXMF 3M2RA 2LEAA 3G2XA 3HULA 2RU3A 1G4CA 2HFNA 1JLAB 2IYGA 4B3SJ 3MM9A 4U7UD 5BYQA 3MPWA 3N6MA 1KVJA 2W25A 3OJUA 1VRTB 2VBYA 4WF9Q 2JRSA 4XPCA 3CMAS 5BXIA 5FDLA 4EK2A 1RSCA 4ZCIA 1CJTA 2IPOB 1TKDA 1S57A 2WSEC 3BDEA 2E1AA 1Q7YT 2CQ0A 2CJQA 1UZDA 1VHIA 4DSEA 1FD8A 3H25A 1J5OB 2J0XA 1NBEB 4HEA9 4UT4A 3QGGA 4WFBQ 1HNZJ 2FGCA 2CADA 2R2RA 1LWEB 4KB7A 5JJBA 4DPXA 4CTAB 2MHEA 3TZYA 2OPSA 1D9DA 1K0TA 1RI7A 4KSEB 2C3YA 2MGZA 5J2NB 3M1VB 4P2MA 3IGNA 1BD6A 1RLCL 4IRKA 1LOUA 2B7BB 1PIEA 1Y00A 2IJNA 1S10A 3KNAA 3UO0A 1NU4A 3D1HA 5GADI 4LR9A 3P8BB 5JMNA 1FD2A 4AYBD 3GYGA 1D9AA 3ZTOA 1U1MA 3IGVA 3ET6A 1IR1A 3NGTA 4ZN3A 4L74A 5HO4A 4A4JA 1HQUB 4WJBA 4BHQA 4IFVA 2RT3A 2ILYA 3VAKA 1RTHB 4EBEA 4IDKA 4ICLA 3KNGA 2Y0BB 1Q5VA 3M9NB 4OYZA 1KQGB 1OQ6A 2VBXA 4X4VA 3A3NB 1F60B 4Q44A 4CRJA 4H4OA 3HHLD 3OTEA 1D3WA 5HAOA 3VAGA 4K4UA 4DWIA 2D3ZA 2YNGA 4I0WA 3OTDA 2DVIA 2OKQA 2CJYB 2ZDPA 2XMUA 2G1DA 3SCJE 1T8EA 4JI4J 3JQMA 1WELA 4YHHJ 3DMJB 4JI6F 3K5LA 5H9EJ 3OUYA 5A8WB 1WNEA 4J9SA 2A10A 1LFWA 1KN6A 3NBPB 5KFKA 1XNRJ 1OY9A 1S9GA 5EWGA 3A3PB 2VV5A 2ZKTA 1NJWA 3FEYB 3K89A 3MMAA 3I0RB 5H9EK 1KP6A 3HFVA 4JI2J 1RHRB 4OI1A 2H1YA 2MHNA 1RT6B 3TAPA 3TUIC 3OL6A 3PW5A 2NS1B 4QU6A 2YXLA 3K17A 1RDRA 1EX8A 1MWQA 2J8AA 2IMWP 1KLNA 1H0HB 5CHCB 4BS2A 2D7SA 2XCPA 4KO0A 1RYRA 2DRBA 3CGIA 3R2DJ 2KT2A 3V6DA 1A9NB 4P74A 4LF2A 3DHXA 3VWSA 3M2RB 5LXRA 5DDRC 4KH0B 2BM1A 2QZ8A 4NMXA 2V6AA 4LFCJ 3MM9B 3CD0A 3SSQA 2B3TB 3P45B 4WFXA 5ETMA 3KJFB 3CO0P 3KK1A 1DURA 1ZYQA 4O4GA 2COLA 1S1WB 2VG7A 1MMLA 1CPZA 3MD1A 3MUTP 4FYDA 1UWAA 2GVZA 2VIHA 2HG4A 1U2FA 2H65B 2HPUA 1YRUA 4NZ7A 1CJTB 3AB4B 2R4FA 1JLCA 3UN3A 5ETTA 3HJVA 5KT4A 1R8CA 1K8AT 2QV6A 3CT9A 1N36F 2ZD1A 3KWMA 2DXFA 2I5JA 3KUGA 3KUEA 1XN9A 2V68A 1SL0A 3G82A 3TP2A 1NJIT 3OW2R 4YB1P 1JKHA 1SCJB 3QIPB 2I0XA 4P72A 4RW9A 1T9VA 3O3LA 3KHRA 2BQ3A 3BBBA 4LIRA 4HVZA 3C15A 2J9EA 2A6OA 4K4WA 3HF5A 2HZAA 4OYOA 1JNZB 5F3ZA 2MGZB 4USKA 3J80Y 2D9OA 3I87A 4K4XA 1EIYB 2NXEA 1V5IB 4DL7A 2VFUA 3HHLA 3F56A 1WC4A 3W1YC 3ILOA 2CQCA 4EYIB 3KJNB 5J1NA 3ET6B 3P3DA 2GHPA 1S6QA 1Y5IB 4FS1A 5CZVA 1RGVA 2MMYA 1FWKA 4KHPF 1HA1A 3TAMB 3MEDA 4ICLB 1TELA 3TX0A 1S9EA 3UN2A 3CCSS 4PQUA 2BJ9A 1OY6A 1TUVA 4BLGA 1URNA 3T3FA 4DR5J 4M5HA 4KHRA 4H4OB 4Y3CA 1KFDA 4PCQA 3CTRA 3FQKA 3TJ9A 1Q16B 2VDHA 3MM5B 4NXMJ 1OJ4A 3E51A 3FQLA 5D4LA 1IJEB 3UD5A 4U6PA 3OTBA 2IVYA 5DGBA 2U1AA 3FCVA 3ZTSA 2J7WA 3KK3B 1R0CB 1TUGB 2H9ZA 5K20B 4X4OA 1ELOA 4DPUA 2V0NA 3D3BJ 4WFYA 3OUYB 4EZ6A 2BABA 4F26A 3RAQA 5E41A 1NH8A 2Q79A 1RTJA 4RLEA 2V69A 2YNIA 5DS7A 1BHNA 2ZM6J 2OJ3A 4KE5A 5I42A 2ABYA 3Q0AA 1S9GB 2XEXA 1F6TA 4EBCA 2EEYA 1NJZA 3I9ZA 2VQFF 3HT0A 4BDPA 3DOKB 1YGYA 3SCKE 2NZ4A 4CT9A 1VDHA 4QR1A 3HXMA 4A8QA 1UAWA 1UVKA 1C1CB 1G2EA 3VAJA 4NWBA 5ITHA 2FVRA 4KO0B 4DI6A 1RTZA 4ILMA 3V6DB 1Q8LA 1U7LA 3W5YA 4X2BA 4J9RA 2V2ZA 2B5JB 2IC3A 4J9MA 3QBCA 2BYCA 1P27B 2FTRA 3BH6B 1WOOA 2Y1LB 3MD3A 3W2VB 1RT7B 1Q81T 1UP1A 1KHWA 3Q8VA 2R2TA 5F9LA 4L72B 1FWLA 5KG2A 3KK1B 4H4MA 1GAOA 4R5PB 4A8OA 5FIIA 1JB0C 4O4GB 5HATA 5LL6d 1WC1A 2GO8A 2AP6A 3S7RA 4F0MA 4YDDB 4WZQA 3MMJA 2IMOA 3N01A 2L08A 4O3PA 2KZZA 3DRSA 3LP2B 5CD4H 2GJFA 5B7WA 3K0JA 3TRGA 2EFNA 3UE2A 5KG5A 2I5JB 3S1TA 5A8KB 5DETA 3NNHA 2BXJA 3MCMA 3GV7B 3K58A 4DV2J 4JP8A 4NLOA 3CEDA 3QRQA 4JUZA 5J2QA 4Y6IA 2Y1JA 2W4DA 4RW9B 4DHVA 3QRRA 2YVSA 3O2IA 2RDJA 1VS3A 4KR0B 5ETPA 2W24A 2D3O1 4JI6J 2IRYA 4KV8B 4LRFA 2R2SA 2ERRA 2HGLA 2P2CB 1KD1T 4KYZA 2M8DB 3M6VA 5KFAA 2ZE2A 1U1NA 1M1KT 3KYLA 4CLLA 4DX6A 1DBDA 1CQMA 3FCHA 4C8ZA 4P52A 3UNGC 4FF2A 1QTNB 1D09B 3FSXA 3HT3A 4F50A 2R8GA 1S6QB 3CD6S 3ZNJ1 1UW9A 2ZH3A 2PDAA 1N5VA 3HVWA 1Y4ZB 3W62A 3MEDB 2AZ3A 1O0PA 1SUQB 4N7TA 3H20A 1F5BA 3JSBA 3D1QA 5ETLA 2XB2D 2R8IA 3RB4A 2W7OA 4UOCA 1B7YB 2YKMA 2WAQD 4UQGA 4KH1B 4FF4A 3IS9B 1U45A 3PZPA 2DNLA 1M1HA 4V19X 4OX8A 2E7XA 2XM3A 3UW1A 4OMFG 4PYDA 1GXTA 3G96A 2M5YA 2AF6A 4N41A 3CCJS 1IVZA 2KFNA 6AT1B 1UMJA 5F8HA 2BQRA 4IG3B 3AXKA 1FK9A 2YNIB 3QPIA 2HQIA 2GQCA 3FGVA 4R25A 5I42B 3BREA 1N36J 4RJVA 3SBMA 2MLXA 1H7XA 1NSPA 2NCKL 5F8NA 2WVEA 1GMUA 2HQGA 4RW4B 3GR0A 2C22A 1MLAA 2XWXA 4QIGA 2EG1A 4DV7F 2ZNYA 3ENVA 2GV1A 1NJYA 2VQEF 2P5VA 1IXKA 1B99A 1LW2A 1EP4A 2I2YA 6FDRA 1HNVA 1T9UA 2ASYA 4CO0A 1JJHA 2OEJA 5J2MB 3R1LA 4B9UA 3F73A 3R5DA 3SEOA 4EI2A 2ZBPA 2OSRA 3NOGA 3D6MB 1YJWS 5D4NA 2CA9A 1HNWJ 2IY5B 1O5JA 3PIPQ 2UU9J 4X4SA 4DCPB 5CYQA 3NG8A 1Q7LB 4ALZA 2PIIA 3NMAA 2ZBCA 1W26A 1DLOA 4NCGB 4FXDA 1A0OB 2DKOB 1TZ0A 2V8GA 2IFXA 2MXYA 2EFGA 4NXNJ 2OFHX 1T0TV 3PO5A 4ZPVR 4DEZA 2YNFB 1R0AA 1HI8A 5D0HA 4PWDB 2FLLA 4N8OA 2ZH6A 2YKPA 4DLEA 3A12A 1S49A 4ELUA 2QYCA 3BPSP 2E7WA 1WORA 4NYZA 4RKUC 5E5NA 3GG1A 1RABB 5BYRA 2WSFC 1K9MT 5F8JA 1N5YA 1SC1B 2EFPA 2HGNA 2A1BA 4OZ2A 4DX5A 2F8HA 4NASA 3Q8PB 4UTGA 2KHDA 3I5BA 1N5QA 4J9KA 4RBVA 1D8YA 2IDLA 4I68A 3TOQA 2DISA 5IM0A 3K57A 1FO1A 1SQFA 3VV2B 4CO2A 2ZJQQ 1FF2A 1RHKB 1F1BB 4LFAF 3BO2A 3X1LB 2VQFJ 2BX6A 4ECQA 3CJSA 4X4NA 2P9EA 1EETA 3EMTA 4V1Ak 5J1EA 2Z58B 3OHAA 3OFFA 4Y65A 3ELHA 4QIFA 3E01B 4P2FA 2DHAA 1WG1A 3KLHA 2J0QD 2HNYB 4FP9A 4AUKA 2OPQA 4IH6A 3T5JA 1RBAA 4KGMA 2YKMB 1YSJA 3EGZA 2VB6A 1OSCA 4K5SA 4OYMA 1SH3A 1S5ZA 2QSWA 2UP1A 2K7JA 1FA0A 1WC5A 1VR6A 4DG1A 5L8RC 1FJGF 1NZAA 3GIMA 4AT1B 2H5JB 4PR6A 3CC7S 2IM0A 3C66A 2KI2A 3NGKA 3HHKA 2MKHA 2BRLA 5A8RB 3LP0B 2HS0A 3N5BA 5KOWA 2OD6A 1Q8KA 2AT1B 2AJQA 3FEXB 3NLCA 1F9FA 5L1KA 1JWWA 3ULHA 4DR3F 2CVEA 3FRYA 2YKOA 2BKPA 4GMKA 3WQPA 4CO5A 1RKIA 2GCFA 2OGUA 3M8PB 2O1PA 2CPJA 5EHHA 4EUVA 4GVBB 3K2YA 5BJRA 2W1BA 4ZVTB 2OD4A 2GX8A 2RUGA 4KBIA 4USWA 4J9LA 1FEHA 4UQTA 4GKKF 1R89A 3M32A 4NA1A 4F67A 4B9NA 1LW2B 1FJCA 2NXUA 3W9JA 5F0UA 2A18A 4LFBF 2Y1RI 4DSKA 2HURA 3NS6A 4O44A 2HWHA 2D9PA 2LEPA 1X4BA 3KMQA 4DV6F 1YJVA 2I9SA 1DLOB 2QMXA 4LBHA 1RT4B 4F02A 3I4HX 2HYIB 2DGOA 2RILA 4DUZF 4LF5F 1EHWA 3K5MA 1S1TB 5D77A 3C6UA 2DH7A 2K7KA 3JQJA 2BUNA 2QYGA 4NA3A 3LW5C 3PM9A 3UD3P 1FJEB 1S79A 3E3XA 2HBRB 3ZZOA 1VQSA 1T9XA 1EZZB 3PW0A 2YNHB 4ED6A 3CDBA 1RISA 4JI0F 1M5OC 3EDQB 1X4EA 4MYTA 4JI3F 5DQHA 3AAWB 1RT5B 2VDIA 4XIUA 1H2UX 5IM0B 2HHHF 4J9VA 1WSRA 2D3OR 4K8RA 4C0OC 2JFKA 1CG2A 4B9TA 3D3CJ 1FXLA 1R31A 1KS2A 1HD1A 4GVLA 4A8YA 2CDQA 4RUBA 5C2GA 5B0EA 3O1LA 4O23A 4CH0S 1H72C 3PV8A 1RADB 3TNVA 5KTQA 6FD1A 4DPYA 1JIHA 4LF9F 2B6AB 4OYWA 1IJFB 2OPQB 2WCXA 3LGHA 1UA1A 3F41A 3GIIA 3AA9A 5KT3A 2E9ZA 4Y34A 2V2KA 3BB5A 5GAHI 2BR0A 1H2TZ 2XS2A 3CB4A 1RAEB 4I2PB 2G2YA 1NSKL 2YWFA 3IM8A 2CXEA 3T1YF 5C2CA 3RBEA 1KR4A 4OHXA 3OL8A 4F2RA 1RE1B 2OMLA 5L9XA 1RA7A 3GILA 5DG8A 2FVSA 4A8KA 1H74A 4C6AA 3MGJA 4GO7X 3IBCB 3QWUA 5IWAF 3CCES 3UDEA 3RU0A 3NAHA 2B4OA 3OSPA 4ID5B 4CWBA 1N5SA 2QA4S 1WG4A 2HRUA 4YEAA 1CBKA 5E33A 1F0XA 2DNOA 4TY8A 3IN5A 5D4OA 2MTLA 3WX8A 2FJDB 3PJWA 2R7XA 1TMJA 2M3DA 1U1QA 1Y5LB 3W60A 1LXJA 4JI7F 3D9BA 1ZAWA 3RAMA 3OSNA 3TO8A 3OXLA 1I94F 1UFWA 3FUYA 1DY3A 1SC6A 3EJMA 2W2NP 1S0MA 3M8QA 1SH2A 2M4MA 3G6YA 3KXDA 4U96A 3T9ZA 5D15A 3RR8A 4DR4F 1ZM9A 3VAFA 4GC7A 1RWMB 2UVVA 3BSOA 3QLHA 4LFAJ 3C6TB 2HMIB 1GMVA 3H98A 2LXIA 3ISND 1AYEA 2KO1A 2MKJA 5CXTA 3LH2S 2MZRA 5GAGI 2XWYA 1FRXA 5HQLA 3MEEA 4Z7YA 3S01A 1WACA 5ETNA 2FDNA 1UPPA 4Y2CA 4N47A 4M5GA 2FZGB 2HVDA 1S97A 3Q22A 2VJVA 1FEEA 1NJXA 3C6UB 2JOQA 4FXVA 4DS5A 4WP8A 1MMNA 4ETXA 1VLYA 3EGNA 2AIRB 2W2QP 2RNEA 5AXMA 1B3TA 1U09A 4OJ3A 4DPWA 2Q66A 2RHQB 5D3GB 1UJ5A 5I3UA 3CJ3A 2HNZA 2DCUB 4NZ0A 1HBOA 1FJGJ 3SFUA 1HPZB 4ZCLA 1IKYA 3SV3A 7FDRA 1Q4RA 4CH7A 1NPKA 2X1AA 1Y3JA 1T05A 3T1HJ 4ANEA 1N4LA 2ZWPA 5CQGA 4G3IA 4QYZJ 4IFYB 1R27B 1IKWA 1V3ZA 2RSQA 4K59A 3SIPB 2KYXA 3L7UA 2AHOB 4CLUA 4DR2F 1T9YA 1MU2A 3M2UB 1U8WA 4FKXA 2RRBA 3MCSA 3QSIA 1SQGA 4W4MA 3T1AA 1R8HA 5LOQA 5CH7B 1QAYA 1JMTA 2XMJA 5KFOA 1OWXA 2CQ1A 2DNMA 5F8LA 2EK6A 2VOOA 5HVGA 2MYFA 4ED4A 3BF4A 2AJ4A 1S1XA 4G1QB 4CQ1A 3ZZ0A 3PEJA 5LJ3Y 2IAJA 5ADZA 1RHMB 3DLKB 5KFFA 4OI4A 4G6VB 1EKSA 1YBAA 3V6HA 1UEUA 3M8WA 2R7RA 4RR5A 2DHSA 3CE8A 3WHIA 3H2VE 2XO7A 2BZ2A 4K4VA 2ZOGA 2DNNA 2QO3A 2X1FA 1S9FA 4JV5F 1G6BA 4DL4A 3CCVS 1W2IA 5GADU 2HSEB 5HBMB 4LF5J 3VAMA 5KFZA 2AX1A 2XSJB 3NKYA 4N56A 4GKJJ 5HMWA 1RYSA 3DGPB 3FKBA 1RCOB 3QAEA 2VFSA 2UUCJ 3MDFA 2JEFA 1CLFA 5ETQA 1YZ6A 2IA0A 4TY8B 1HHQA 3UDVA 3AH6A 4A46A 2BQUA 2BKOA 4WXOA 1NCLA 1EQMA 2DJWA 1U0HB 4CO4A 3BGRA 3R8YA 4KRWA 2KHCA 1UVNA 2OPRB 1HBNA 4DX7A 1PBAA 4MIAA 4K4ZA 2KN4A 2OFGX 3PCOB 1RAFB 4IOBA 2DHGA 1NLKL 4JI0J 3K8VA 4PRFA 2C2NA 2XGPA 4NEYA 3M8QB 5CD4A 3HHEA 4Y2IA 4QW8A 5IXUA 3CCTA 3TAQA 1WEXA 2DYAA 2VPYB 3IFEA 1C0TB 4EBDA 2CPEA 1BE4A 3QLHB 2HBZB 2X1BA 3GFZA 2N4CA 1X7VA 1FKPB 4LF1A 1XQIA 2YBVA 3BO3A 5IS2A 3TQ1A 3SSRA 4JOUA 1Q1KA 4RNNA 1VRUA 2L9WA 1JLBA 4LF9J 1SVDA 2ZVSA 3L3CA 2Y1IA 2RD5C 1FDBA 4J9QA 3CD7A 5AXNA 2R8HA 4F8RA 5LXYA 4MJKA 3H8YA 1N34F 4IRCA 3NGDA 5JVGQ 1KHVA 2GJIA 2PFDA 3GCXP 3LGNA 2WONA 1VQOS 3V4IB 1UKUA 1NO8A 1UVIA 1RWVB 3POTB 2ZH1A 2RDDA 2E9RX 3C2PA 2AEJA 3EZOA 2ZJPQ 1H7WA 1IKYB 1TFYA 3T9NA 1YJRA 4YB5A 2JNJA 1RTDB 1GFWB 2LECA 1FJ7A 4C3KA 2J9DA 5BR8F 1CJUA 2VJUA 3L7PA 4JV0A 5LSRA 4WIQA 2UXDF 1REVA 4FBTA 3QIDA 3R27A 2AX0A 5A0YA 1CS4B 2CNNB 3FBEA 3PVXA 3BYPA 1MU2B 1IKXB 5CYMB 3CMES 2X3DA 4HDGA 4ZJQA 3A8IA 2Z56B 3KHLA 2GW8A 4F4AA 4FZVA 1VQ6S 3A8JA 1JLGA 3QFHA 1EQ0A 4ZHRB 3HSZA 4ETZA 4HDHA 1HI1A 1UEVA 4B9SA 4WKRA 4NYOA 3Q8QB 2GGPB 1I94J 1WC3A 1S1XB 2CPDA 1VCTA 1R3NA 4R0EA 3B4DA 4CO3A 4PAAA 1RWPB 3L7OA 3ZO7A 3CC4S 2VG5B 3IRXB 4DSJA 2CFXA 2IAJB 2KFZA 3US5A 1TKXA 1KOOA 4X64F 1KVKA 1IKVB 2BJ3A 1N54B 3MPDA 2DNZA 5KFSA 3KFWX 1YJ9S 3QQCD 3DN9A 3TEHB 1VISA 2BACA 4Y2MA 4K5RA 3RBZA 4OHWA 2DO4A 2LA4A 2V2VA 1AZSB 4M5NA 1TK8A 2DH9A 3PFOA 4ZPAA 4BWJA 3CF5Q 3PW7A 3JSYA 2FQQB 3QNWB 1HBUA 3CCLS 3K8WA 5KFWA 5A6WA 5KG4A 3PX6A 2UVUA 3HSGA 2QE5A 1VC6A 2VASA 1CJVA 4L3NA 5HMYA 2IDEA 2JL9A 3A1YG 3PY8A 2OTLS 4HR2A 3ETOA 2CQGA 4WPAA 3ZFVA 2KTQA 2YKAA 2RJZA 3THVA 4PYAA 4U7UK 2VUGA 2YKNB 2QTWA 2F65A 4J91A 4CH1A 2YX7A 3HCXA 1TP7A 1FX2A 1D9FA 2ALYB 1FE4A 1TR0A 2C2MB 4PXEA 1OIAA 1Y5NB 1NK4A 3U1NA 4ED8A 2HFOA 3TYTA 2W01A 2CNLB 3BEGB 2CVIA 2PT0A 3AA8A 1KKHA 3DC2A 3MAAB 4X65F 2QLJB 5FD1A 4C11A 2HVHA 2JDJA 4QBUA 2XI3A 1VRUB 3I32A 3SFGA 1XEZA 1LKZA 3I5CA 3I0SB 3U02A 3K59A 2Y3YA 4CCHA 2QA1A 2QIFA 4LJMA 4MK7A 2JH3A 1MROB 2GC8A 3NWGA 2RQKA 2IIHA 1N33F 4DV1F 1JXEA 2FHMA 3C3LA 3EGWB 2CZVC 1C2PA 1FFGB 3IM9A 3AODA 3MR3A 5GAEI 4F4KA 2CQ2A 3ZZZA 4K0KJ 3LPYA 1RK8A 3RJMB 1JNRB 4JV5J 3D0GE 1X9WA 3DDNA 4YB7A 1RHJB 1P9YA 1I1GA 3QAUA 3IO1A 1FRMA 1K44A 1REVB 2DBBA 2MLYA 4P75A 3T6BA 1GXLA 1HBMA 1VK3A 2QX0A 4PG4A 3PYDA 5C25B 1SJ3P 1YBTA 1W7WA 1KLMB 2J7KA 1WI8A 1O8BA 1U4BA 3PKYA 1FWPA 1GEHA 2WVDA 4F3MA 3KLFB 4USHA 2MZ1A 4KPCA 5KOXA 4ZITA 1JLGB 4D3HA 1TVRB 5DG7A 1U25A 1A6LA 3CWJA 2P8IA 3GYNA 5EDWA 4TKTA 3Q24A 1HYSB 2RF2B 3PTWA 3MOJB 1FDNA 4YY3F 3LUYA 4WFZA 4UOGA 3H4DA 1G1XA 3OPKA 1M5KC 1XNQF 2RRAA 4RO0A 2QL5B 2UUWA 3OV7A 4NLWA 3UVJA 2PA3A 1RXOB 4LSLA 3PX4A 4N8NA 1M5HA 1KWMA 3AQPA 2ZJRQ 5SUHA 4CYUA 5KFNA 4Y00A 4C8MA 3DRXA 3ZXWA 3J80U 3W5XA 4O3NA 4Z7CA 3AQOA 1C1BA 4I6WA 2WVCA 1SJ1A 4LVOP 5ETSA 4X66J 3KLEB 3WX4A 3BO4A 4XO0A 3QJPA 4DXLA 3HZGA 1V5VA 2E1CA 2JSXA 2AJ2A 1HBUB 3DM2A 2XG8A 3HO1A 4LF6F 3PDNA 1CJVB 4OLPA 1KBRA 1WKLA 1QVGR 5EN1A 5GMEA 1FNOA 2YPYA 2IBKA 4KC5A 3FBFA 1PO6A 2HNDB 1I51B 3IC1A 5BR8J 3NOCA 5ETOA 4X62F 1V9OA 2DEJA 4GO5X 3VZIA 4F4YA 1UETA 1NK9A 2O66A 4R8UA 3Q23A 3I31A 4J9PA 4OZLA 2D3UA 1UVLA 3H2UB 4PG8A 4DR1J 1FESA 3MWBA 2HQDA 3GSDA 2FZCB 3IMQJ 2AEFA 3DOMB 4QW9A 4OIXA 4LRBA 2M0GB 1UFKA 1SIZA 4PWUA 2W7AA 1RBLA 1B70B 1P6TA 4DCOB 4ZP6A 4USMA 2HBYB 4Y2KA 3DRPB 1E6VA 4NLVA 3BBFA 1Q0NA 3MM7A 3TWZA 5AE3A 3V81A 3GV5B 3AJ2A 3PR5B 2KH9A 3JSMB 3T6JA 3VQSA 1QVFR 4FVCA 2G4BA 3IP0A 4MK9A 3OVBA 4X64J 4XAKA 5AJ3F 4YQWA 1RT1A 3R7SB 2CKWA 3HZEA 2CQIA 2BANA 3LWMA 1BC6A 1UW4A 3ITHA 3CJKA 1NH7A 3NP5A 4DV0J 4EYHB 3HVTA 3SDEB 3AT1B 4QU7A 5CZXA 2HIQA 3M6UA 1JLQA 4A8XA 2ZH5A 1HBMB 4MT1A 4CP5A 3BQ1A 2KU7A 5JXSA 4ELVA 1TTHB 1NKCA 5L1JA 1MN9A 2DNYA 3DOLA 1GNKA 3VTIA 4URGA 3PW4A 2LCWA 2R7OA 3OR1A 3SQOP 4J7CA 3FFIA 1N0UA 1ZS6A 2DGWA 1IWAA 3MCNA 2OH2A 3K7RA 3ISNC 4WP3A 4B02A 4DR7J 1G3OA 4UY85 4OL8A 3I6PA 5K9FA 2A6MA 1Q53A 3UDLA 2W2MP 2W8LA 2VFRA 2W4CA 1FX4A 3CCQS 4J5OA 1HMVB 2PEBA 4LSLB 4JBCA 3KKFA 3VALA 4I69A 2LDYA 4PKDB 3TZXA 1X0FA 4RZRA 5B0GA 3MR6A 2ROEA 4OX9J 1XBWA 2LFVA 4HYKA 2HQFA 5B0CA 4OJHA 4ZVGA 2FHKA 2BE2B 3D6HB 1S0VA 2AZ1A 3LANA 3PEHA 3RW6A 3G6VA 2F4FA 2D69A 1BQXA 3DM2B 4DV4F 2ASLA 2JC1A 3TARA 2NPFA 4KY3A 5DRKA 2NLWA 2W9BB 2Z2LA 4CTAA 2NSBA 4PG6A 3HD2A 1SPBP 5DZ6A 2CG4A 4ZVOB 2J0WA 1VRQC 3WC2A 5J2NA 3M1VA 2E5LF 2OTJS 2L9NA 3FRZA 3CNQP 3QO9A 3L4BC 4C48A 1NNDA 2BMBA 2J76E 3HHNB 1WDDA 3FSIA 3CMQA 1JLEB 2NXCA 4ZP9A 1ACMB 2QLXA 1RTHA 3MEGA 1H2VZ 4IQMA 4F04B 3CDWA 1WSVA 1U6BA 2ROGA 2UVWA 2CQDA 3ZZTA 3D0HE 1B4SA 2VODA 1E6VB 2E7VA 2CYYA 2BRKA 1T03B 3CW2C 2XNQA 2MQ8A 1WI6A 5KT2A 3V81B 2QSFA 5HMXA 4UOFA 1WHWA 4ZS6A 1M5SA 3WZ0A 3CJ2A 2HGMA 2ZOFA 2R7WA 4WKYA 2PSZA 1NRKA 1CULB 2MZSA 2UXBF 3DMJA 5A8WA 4C0HA 3I56S 4UW2A 5EGYA 1YVFA 3CJKB 3IR5B 3ZZPA 1M5PC 4YR2A 3HVTB 2ZC4A 5MAOA 2JVRA 4MFBB 1JLQB 4FKYA 5E3PA 4OZ5A 3I0RA 3JTPA 1TV6A 2CIMA 2RVJA 3J81U 3EE3A 3UR0A 1RT6A 2Q1LA 2QMWA 2VL1A 3TJAA 2WW4A 5I3QA 2N82B 2CNOB 3D2WA 4EMDA 3FFIB 2VICA 1K73T 2UVRA 2GVDB 2V67A 4RWWA 3THPA 1WJ9A 4YR3A 3VGSA 2ASDA 4H4KC 4LRAA 4E8UA 4L3KA 4U67Q 1KOHA 1GX5A 4YFUA 4X62J 5F8GA 4ZCKA 4L75A 2FJWA 2R7QA 4F7VA 3RBXA 1OS5A 1S12A 2AYEA 4ZPWR 2MZJA 3MPUB 1S1WA 4Q0BB 5HP1A 1BLUA 4LUBA 4CDIA 1PC4A 5B0DA 2FZKB 2XBPA 4JI1F 3G87A 4NZ6A 1DARA 3EXCX 5E3CA 4S0MA 4R0JA 3OTCA 1JXVA 2X51A 2ZFHA 2QL7B 2CQPA 1X5PA 2Y9HA 2ZZMA 3KHHA 2R7UA 1VOMA 1WDTA 2MKYA 3OVAA 4LT6A 2OIHA 3QIPA 1PYSB 3IXQA 2VZ9A 1VQ7S 2DY1A 3IA0A 5AJ3J 5A2QY 2VA3A 3HVAA 4QOTA 2D74B 3QFWA 1CC7A 5GAHU 1G7CB 5F41A 4K7QA 1WF1A 1NK7A 2CUYA 3N9UC 4M5IA 4QYRA 3VZHA 3CD5A 3TJ8A 5F3TA 3QO9B 3J7Z5 2HEKA 2YY3A 3Q2TC 3TUZC 1JX4A 4AD6A 4NLGA 1RWOB 4AXIA 2MZTA 1X9SA 4OX6A 1RT3B 4ZCMA 1BWEA 1O51A 4QIVA 5CABA 5KFEA 4EZ9A 1U1KA 3MEGB 3TAMA 4DL5A 3H5YA 1SKUB 5AXKA 1SKSA 2GFFA 4J90A 1SKRA 2F8MA 3HFKA 5D0EA 3DFEA 3AOBA 2LQ9A 1OYDA 2CQBA 4B9VA 1NDKA 2VG6A 2VBZA 3CJ5A 4IO9Q 3MM5A 2ZNZA 2CPFA 2KFYA 3DLEB 2FB0A 3AXMA 4LBPA 1NKBA 5AT1B 2V94A 4TLQA 4ZJLA 2AGOA 3KK3A 1RWWB 5DM6Q 3Q86A 4LSZB 1DJ0A 2Y8YA 2FC9A 3D67A 5CCMA 2KJVA 3DRRB 1RUSA 3OJSA 4LIWA 4C3LA 3M30A 1RAOA 5KFPA 4ZPTR 4EFAC 4OJGA 1TV6B 5GAGU 1DQAA 1FTCA 3Q89A 1LWXA 4DV4J 2E66A 5IT9U 3DOKA 1HQ2A 4DMZA 2F63A 2MKKA 3GQCA 3JTOA 2L48A 4XK8C 1C1CA 1FRHA 3CJ4A 2AEMA 3AD8C 3EVOA 4QWCA 2PFFB 2OAUA 1WUUA 4CLTA 2LU2A 4LSNB 2GS8A 3H5UA 2B5JA 2KZMA 3AJ1A 1L3KA 2G0CA 3W2VA 2FVPA 1RT7A 1CSJA 1YLXA 1ICEB 3JAMY 4Q8FA 2EK1A 4DUYJ 3SZ2A 2IJRA 1WKKA 2HK2A 2X1GA 1J5EJ 5B0FA 4R5PA 1L3UA 1LK7A 3NNAA 4B3MF 5DDQC 2XZTB 5HP1B 1UL3A 1BQMB 4HACB 2N4DA 3ETMA 5E3AA 1WC0A 2MB0B 2ACYA 3FSYA 3H5SA 4ES3A 1BGXT 1DQ8A 3LP2A 3OR2A 5JUMA 5KFBA 3DGVA 1WTFA 3DXSX 2YWEA 5A8KA 2BOAA 3DLLQ 3I55S 5D78A 4UUXA 4K4YA 3BPDA 1TL4A 5C5JA 4Q8EA 4KGVB 1Y7PA 1VK8A 2HRYA 4QJVA 2VPWB 2PI4A 2OSQA 3FCWA 1SXLA 2GAGC 4YR0A 1KEKA 2HQCA 2UXBJ 3LP1A 4KV8A 3V4MA 4WZMA 4PQAA 2V4RA 4ERDA 2HFSA 3CO9A 4OV1A 4OQJA 2DNPA 4ZLNA 2FJXA 4RW7B 1QTMA 4UY8T 2OP5A 1ZM2A 5LM7E 1T11A 4NLSA 1L3SA 3GJRB 4PWWA 1YWXA 1FE0A 2FHOB 1SUQA 3GONA 3SV4A 3MFIA 5KFDA 2LDIA 2CQ3A 3QWPA 3AD9C 2Y8WA 4F25A 2MEWA 2UUBF 2HHVA 2APOA 3S8SA 2VG6B 4F0KA 2AWZA 2DB1A 5HL7Q 3IS9A 1KTVA 4ZLLA 1H6KX 1U6FA 2JHEA 1ZM3A 2PGCA 2HHQA 3IG1B 5K8NA 4OX7A 4E2FB 1Q95G 3KLGB 2C28A 1DTTB 2B0GA 3FMWA 3GFHA 3TEGA 3DNCA 2JEGA 1U49A 2QRRA 4DFMA 4ANDA 4K50A 2M2BA 2AGQA 4C8OA 1RT2A 2KM8B 4IG3A 1B0PA 1V6HA 4OZJA 3PJXA 2I8EA 2HFZA 4AQYF 1HNXF 2F7VA 2FHJD 1JJ2R 4M8LA 3D28A 3M30B 2VC1A 1FDDA 2DXDA 2ZZNA 3BQ2A 5D6GA 3TA2A 4MK8A 4ECXA 4WFAQ 4RW4A 1S6PA 4K2JA 3U1LA 1FI4A 5KFIA 2F1FA 5L9NA 1NPPA 2OPPB 2B4VA 5L1LA 3BGLA 1N5TA 2ZH9A 2RB7A 1PYTA 2IVFB 2HWIA 2GAHC 1HQEB 3W2WB 1NK0A 4L6V3 5J2MA 2QA2A 1AXQA 3R3TA 2A2CA 4KFBB 5LT5A 4I6YA 3KDOA 2MLZA 2QN6B 4OI2A 4KPYA 3HI9A 4C4WA 3CIMA 3MM8A 3HMJG 4Q7AA 2VU5A 4NCGA 3U27A 4KKOB 5C42A 1IQZA 2VF3A 4QWDA 2R7TA 1HWIA 3UN5A 2WBMA 1SKWA 2IM2A 3OR2B 2DPJA 2YNFA 2Z8QA 4PWDA 7FD1A 2XMKA 2JEJA 3HM9A 4LMZA 3PR4A 2WK4A 3CCMS 4NLYA 4OYAA 4TU7A 2CJBA 2V8HA 3PX0A 2HAIA 4RU9A 3GIKA 3P6YC 3MI7X 1LFPA 4RUAA 3W3SA 2KDOA 2CWXA 3R97A 1SJRA 2PN6A 3DCAA 1L3TA 5B08A 3LP1B 3M2VB 4RW6B 1WKJA 4ZMMA 3RYLA 4DQQA 1SH0A 4Q43A 1W2BR 3NEKA 3G8SA 3R5AA 4DBQA 2OMOA 2E5HA 3UFCX 2UUTA 1JK9B 2HZCA 1HNZF 3HDSA 4KJIA 1X0PA 2O3DA 3HPOA 3CDAA 4OLOA 1T94A 4XTTA 3R5BA 5IFMA 5L1IA 3W66A 4DS4A 2R2UA 3CXCR 4X4RA 1TL7A 5JVHQ 1AB8A 4DU8A 5IV3A 4M5JA 4NX9A 2ASJA 1KSPA 4F4ZA 4M94A 2BDPA 3E01A 2ZC3A 2HVZA 1NDLA 2BVZA 2HNYA 5C7PA 2FHJA 4DL2A 1UWBA 3NWRA 1RU1A 3FEZA 3R6LB 2A3JA 2DIUA 1U1OA 3AB2B 4I6AA 3QMQA 2UV8A 3DDKA 2O5DA 1NK5A 1U2CA 2V63A 1DQ9A 1TKZB 5DG9A 2V50A 1FVSA 1X31C 2K1RA 1PC5A 1QE1B 1NSAA 1XIQA 3H42A 4B3MJ 2XCAA 3RRHA 1P8GA 5A8RA 3LP0A 2CJAA 1PGZA 2R7VA 2EI5A 1RT2B 2E1MC 4JI8F 4NRTA 2QA4G 3D5MA 1GTEA 3R2CJ 3DLGA 4IH5A 4LF8F 3UQSA 4RL1A 1VBYA 4USJC 2AYMA 3TA1A 2H5IB 2W9AA 2V4QA 1VJQA 4FBUA 2ZDOA 2VHGA 4ZPDA 3OL7A 4NLRA 1NPRA 3M8PA 3CJTA 2PMHA 1SJ4P 2CPYA 2M88A 3UCUP 4JI4F 4NLPA 3J7ZT 4YHHF 1S6PB 4GVBA 2DGTA 3KLIB 1YDLA 5G0RA 1P1TA 2GNKA 4D3GA 2HHTA 2VPXB 2E1PA 2ZUGA 1X4HA 1VQKS 3MCOA 3MUVP 1XNRF 2ADBA 4I2QB 4IR9A 3MF5A 1S1VA 4LRCA 2MZQA 3PJ9A 1VI7A 1OO0B 4NPOA 4JI2F 3MAQA 2CRLA 1UFLA 5GAEU 2ZOMA 1MG7A 1XJWB 1R7IA 2YWGA 1Q8IA 5DLGA 2P9GA 1F2HA 2CPIA 3KLVA 4N5SA 3RBDA 3MM8B 2NPIA 1OY8A 2XZWA 4ZVRB 1VYAA 1SC4B 1HLWA 2CG8A 4KHPJ 1RT4A 4IRDA 1S99A 1SL1A 1NKEA 5M2UA 1HI0P 1PKUA 5C42B 4MIWA 1IM4A 1S1TA 4P2XA 1HWLA 4HI2A 2B51A 2KT3A 2UUBJ 1N48A 3TUPA 2JX2A 1TKTA 3GYXB 4LFCF 4BC7A 4M5LA 1BMQB 2VPZB 2EFVA 2WVBA 1LWCA 4W92B 4F0HA 4U8YA 4KGXB 2ATLA 2YNHA 4ZPCA 4ES2A 4FYYB 4LR7A 2LEBA 4EEYA 4OHYA 2PD1A 5IQ6A 4CLWA 1NAQA 4HTIA 1RAHB 1RWXB 2HVIA 2HLTA 1RT5A 1HHTP 1RKJA 4QIEA 2GIFA 4A8FA 2KM8C 4TYAA 4UZBA 2PO4A 2H4WB 4ZVUB 5T41A 1T7PA 2OEMA 1RAIB 2HZVA 3G71S 3CJRA 1XK8A 2W4PA 1LWFB 1TL7B 2J6SA 2CQHA 1NEEA 2EBGA 4AXJA 5ETKA 1VQ9S 5KFRA 2RQ4A 5L39A 4F3OA 3MAHA 1ZPVA 2WVFA 5HMZA 2B6AA 4P73A 3ISZA 1UWBB 1QM9A 1KONA 1PYOB 3V5RA 4USIA 4PPZA 5FLXU 3BSAA 1Q82T 3TI0A 4I2PA 3PXGa 4DN0A 3DLJA 3MM6B 4HL9A 3A8EA 2K1RB 8ATCB 1RP5A 5KFYA 4HI1A 1XC9A 4ED7A 4C98A 4UOHA 4FN5A 3ENAA 2H3EB 2NYHA 2X7IA 4I7FB 3IWLA 4DR5F 5DZ7A 3GJQB 1YK9A 1MWZA 3DLGB 2VFVA 4RU2A 1HW8A 2NUUG 3AY0A 2RQMA 2NQPA 3HHDA 4NLUA 4AE5A 2W7PA 4ID5A 4FYVB 2J9CA 1N56A 2FJVA 2DY9A 5IOLA 3ONQA 2WZ1A 3ENWA 3MECA 3M6WA 2NREA 3OFEA 2DGQA 1YX2A 5G0RB 2HFUA 2QMUB 1R8PA 5KG7A 3G4SS 2W9CB 4B9LA 4Y2AA 2AJFE 2ZM6F 3C19A 1ZAVA 2KRBA 1TMMA 2GQQA 1C4AA 1FRLA 2YH0A 1NK6A 2I38A 1YG0A 1S1VB 1MW7A 1S7HA 4W90B 4WWSA 5AE2A 2LVWA 4B9MA 4ZP7A 3D6FB 3VVTA 5KFXA 2P6TA 3OTOF 3PFEA 4A8MP 1FNXH 3C6TA 1RCXB 4NLQA 2HMIA 1XTZA 1U1RA 2OHDA 1X5SA 4QIWD 5E2QA 1WHVA 2Z2ZA 2KXHA 3WIVA 2DTJA 2O67A 4P71A 1WOPA 2WBRA 5EX0A 2DCLA 3KMSA 4ECYA 1S48A 3RR7A 3KK2B 2R8KA 3W61A 4M5DB 1JJ4A 4ZIVA 3R7NB 3MZIA 1TKTB 1FDAA 2MQQA 1VLOA 1OMSA 1RACB 4OI0A 2HS4A 2DNQA 2XC9A 5D3GA 2DO0A 4P6QA 2AQ4A 1LWCB 5J1PA 4ECUA 4ZVPB 1HPZA 2FVCA 4K4SA 2F3JA 1N88A 2EPIA 2VKZG 4BCAA 3D1OA 2IYIA 2HHXA 2HK3A 4FNIA 4LRDA 2H51B 4PG5A 4JI8J 5KFQA 5KG6A 4IFYA 4JYAF 4ED5A 4LF8J 3MOZA 4ANCA 1N32F 2I6WA 3VQTA 4I56A 4DV2F 1H38A 2KJWA 3M2UA 5IT0A 1AUDA 2DHHA 3C14A 4UF4A 3W64A 4O3SA 4FF3A 1FNMA 4Q2LA 4RUCA 4DDFA 4DV7J 2Z2MA 5IV4A 2VQEJ 1GXUA 2RKIB 2B43A 1IM6A 2XS7A 1X8DA 3UPFA 4G1QA 1SL2A 1S4FA 4TNOA 1YITS 1UA0A 1JLFA 3DLKA 3IBFB 3GPAA 1ZA2B 3ILJA 5LMNF 1N6QB 1RA6A 2M9KA 3TVZA 5HI7A 4C0BA 2LQ5A 3AFGA 2IM1A 1FXRA 2EKYA 3L9ZA 3HSJA 3KJVB 5CYJA 4PXCA 5HBMA 2EC2A 4NI2B 2DR5A 4WE1B 2V8PA 4MTPA 1KQSR 1T9TA 1WG5A 2BE9B 2WTFA 3C16B 1CQNA 1HD0A 3DYAA 5KG0A 3M8RA 4QR2A 3CDUA 2XSJA 5EUHA 2W2PP 2Q3PA 2DD8S 2ACMA 3DGPA 3ZC4A 1MNEA 2V9WA 3D66A 2BKNA 2JZ5A 4FPRA 1NB7A 2M52A 3MECB 4TLRA 1U0HA 4PABA 5FDLB 3NMRA 2J5AA 2OPRA 5E0OA 3THTA 2MSTA 1M0SA 1F5CA 3H0PA 4ZA1A 3MPVA 4ZVHA 1X5TA 1R8BA 3ILLA 3RB0A 1DTQA 1ZZFA 3PG9A 4NA2A 1BY9A 3RG6A 1C0TA 4WFNQ 3SCIE 1KDNA 3CDEA 4X4QA 1EKRA 1QLNA 2JC0A 1S72S 3H59A 1FKPA 3HLUA 1Y3KA 2HW3A 2OPSB 2YQ3A 3AJDA 4URSA 2Q6CA 4XDDA 5LMUF 4QWAA 4ZPBA 2GZOA 3FBBA 4DCJB 4NLDA 3LWLA 3CCRS 2QL9B 3SMZA 3GV8B 1S7IA 3HFZB 4B3TF 2LMIA 3UI3A 3LAMA 3MUMP 1RAAB 3KHGA 1HNWF 2LQJA 4O0IA 1APSA 1S4EA 2UU9F 4DFJA 2SXLA 4I64A 3JTNA 1NUEA 2LU1A 4IYQA 1AT1B 2N3LA 3V4IA 1MSWD 4IFVB 5HQMA 3POTA 4DUTA 3RAXA 1X9MA 4IDKB 3MFHA 9RUBA 5LSOA 1H73A 4NXNF 2V34A 2LKZA 4OJ1A 1RTDA 1NMEB 1HWKA 3QGPA 3BYRA 3QT7A 3HX9A 1Z2ZA 4MKYA 1SJFA 1S1UA 3ZNUA 1L3VA 2YNGB 1VQPS 1EAYC 4DR3J 2DPIA 1FRKA 1CS4A 2AGPA 4ELTA 1RTIA 2I1RA 3CCZA 5KAKA 2HLUA 3H5XA 1YQHA 1U1LA 1IKXA 2YTCA 5CYMA 1RU2A 1AFIA 3C14B 3PW2A 2H4YB 2MJNA 3Q83A 1DZ5A 3LGMA 4WK3A 3VAHA 1AROP 2NYIA 3EPGA 4ZHRA 1AUSL 1U1PA 2EG2A 3H4BA 2J6UA 5DDPC 2GGPA 2KYZA 4GKKJ 3QGHA 5KG3A 3NGRA 4ZVQB 3VCDA 4Z37A 4ECSA 3MMAB 2ROPA 1QAJA 4LVNP 2VG5A 3IRXA 4LFBJ 1U6ZA 4ECTA 1JLFB 3LQVA 2DRDA 1Z4UA 2RIJA 3RRKA 2W8KA 3HP6A 3OTOJ 4RNMA 4F2SA 3LTOA 1IKVA 3JXOA 2FPHX 4C8KA 1GX6A 2ZEJA 1VHFA 4DV6J 2G9OA 4MKVA 1PJ6A 5K14A 5I3PA 3T41A 4DUZJ 3G86A 4ECZA 2NZCA 5F0WA 3DYAB 4A47A 2KVQE 1AZSA 1IR2A 3BKTA 3N28A 2P9CA 2YPZA 4OHVA 3FZ2A 1PJ5A 2HBQB 3BV8A 1HL6A 4Q2MA 3OXGA 2VG7B 1T9WA 2WRMA 3Q8UA 4RW8A 1GMWD 2GVZB 4B17A 2IA6A 1K1SA 4HHHA 4J37A 4TU9A 1JLCB 3K5NA 4AL7A 4UUWA 1WC6A 1ITPA 4DN9A 4FPIA 3PYEA 4JI3J 2ZD1B 4JYAJ 2YKNA 2DR9A 4KHMA 4RNOA 1N32J 1DTQB 2HHHJ 2G2ZA 3UCGA 3G82B 2QLBB 3B54A 3NL0A 1JKHB 4M1KA 3KTQA 1YJ7A 3MXHP 3RRGA 2GMHA 5GMDA 3C15B 4ZN1A 4DU7A 2HKEA 3MAAA 3H90A 4Y28C 1S0OA 3U7JA 4X4TA 4A48A 3HHLB 1XWLA 3J7YI 1GQEA 3I0SA 2MY8A 4EGLA 2MDAA 5ETVA 4YP3A 1RWNB 2C2DA 4WXWA 4OHZA 3BZQA 1EJ7L 1MROA 3ZZRA 1UTAA 2EVZA 2DEIA 2EFQA 1L5UA 5DDOC 2H54B 5DLFA 5LMNJ 4E0DA 3D4JA 2D1CA 4KIAA 1U2RA 1TQLA 3T1YJ 3BN7A 3W8GA 3PKMA 2MJUA 2HRTA 2FUG9 1S9EB 3NCQA 4PQUB 5KFTA 1UVMA 4YS2A 2LA6A 1HW9A 5C24A 1GK8A 2GA7A 1FTRA 2P6SA 3ADAC 3PNIA 1P9QC 1B64A 4A8WA 1RHQB 2V9KA 2DRAA 3PRDA 5IWAJ 1S1UB 1S6OA 2ZBIA 5AXLA 3T19A 1RTIB 5C25A 3E8OA 2EW9A 1KLMA 2HHWA 4TQSA 5EX3A 1X4FA 1I5OB 5DQIA 5U47A 4DFPA 2Q6BA 3KLFA 2HHSA 1XMBA 4UZCA 4DQSA 2ALZA 1GTHA 1TVRA 1V3RA 1W25A 1DHMA 5HK4A 3BGOP 4JI7J 1RB0A 4WP9A 1HYSA 1RTJB 2RF2A 3PYFA 2B8PA 2G0IA 4F3QA 1YZ7A 3EM1A 4CIOA 5F8MA 2XGQA 2KKHA 4DR4J 3DHWC 5THWA 4CNYA 4NRUA 4O0NA 1YJUA 2BJ7A 2FD2A 5A2QU 2VA2A 1GMWA 4J9NA 1FFSB 3QATA 2G2OA 5LMUJ 1VQMS 5K14B 2XS5A 4NE9C 4CLYA 4LREA 3GMGA 1QY7A 2RU9A 3NGUA 1SJQA 3KLEA 1XMOF 2IC3B 1VQYA 3V6KA 4B3TJ 4X4UA 2E5IA 3GB0A 3JS9A 2AKWB 2DGSA 1A7GE 1UEKA 3J81Y 5DM7Q 4H4MB 3R6GB 3QT8A 5J2PA 4NL5A 3G8QA 5EWEA 2OUGA 4RW8B 3LA0A 3ZTRA 4H4KA 4LF7F 2HNDA 3W63A 4DF8A 5ETRA 4U8VA 4PUOA 2FJAB 1JJCB 2F4VF 3B82A 2XSFA 4K4TA 3MEKA 1RWKB 3DRSB 5DGAA 3RB6A 1NDPA 3ZZYA 1RJJA 4F36A 1BQNA 1TAQA 3SSSA 1WHYA 3JB9k 4W98A 3A4TA 1PJ7A 3VGUA 1PCAA 1FHTA 3CULA 3L95X 4DR2J 4ZK7M 3WC0A 5J2QB 4JV2A 2EWHA 2FJBB 2LYVA 2EFOA 3ZTPA 2FJEB 2YQ1A
chains in the Genus database with same CATH topology
4CLYA 4OYIA 4USTA 4CM0A 1TL7B 4CLZA 2GVDA 4OYZA 3G82A 2GVDB 2WZ1A 4P2XA 3R5GA 3G82B 1FX2A 4CLLA 3C15A 4CLSA 4OYWA 1TL7A 2W01A 1YBTA 1Y11A 3C15B 4OYOA 1AB8A 5IV3A 1CJUA 3MAAA 1CJUB 3MAAB 1WC1A 4WP3A 1CS4A 1AZSA 1CULA 4P2FA 2BW7A 4USVA 1CS4B 1CJKB 1CJVB 4NI2A 1AZSB 1CULB 3MR7A 5D0HA 5D0RA 4WP9A 5D15A 4USWA 3C14B 3C16A 1WC4A 4NI2B 1WC0A 4OYAA 3C16B 4P2MA 4OZ3A 4CLWA 1FX4A 4USUA 3ET6B 4OYMA 4CM2A 5D0GA 1YBUA 1CJKA 2GVZA 4CLUA 1CJVA 1Y10A 4CLFA 2GVZB 3C14A 1CJTB 4OYXA 1YK9A 1WC5A 4OZ2A 4OYPA 1WC3A 3ET6A 2QV6A 5D0EA 1WC6A 3UVJA 4CLPA 4OYBA 4WPAA 3UVJB 1U0HA 1CJTA 5IV4A 1U0HB 4WP8A 4CLTA 4CLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLY A;  4OYI A;  4UST A;  4CM0 A;  1TL7 B;  4CLZ A;  2GVD A;  4OYZ A;  3G82 A;  2GVD B;  2WZ1 A;  4P2X A;  3R5G A;  3G82 B;  1FX2 A;  4CLL A;  3C15 A;  4CLS A;  4OYW A;  1TL7 A;  2W01 A;  1YBT A;  1Y11 A;  3C15 B;  4OYO A;  1AB8 A;  5IV3 A;  1CJU A;  3MAA A;  1CJU B;  3MAA B;  1WC1 A;  4WP3 A;  1CS4 A;  1AZS A;  1CUL A;  4P2F A;  2BW7 A;  4USV A;  1CS4 B;  1CJK B;  1CJV B;  4NI2 A;  1AZS B;  1CUL B;  3MR7 A;  5D0H A;  5D0R A;  4WP9 A;  5D15 A;  4USW A;  3C14 B;  3C16 A;  1WC4 A;  4NI2 B;  1WC0 A;  4OYA A;  3C16 B;  4P2M A;  4OZ3 A;  4CLW A;  1FX4 A;  4USU A;  3ET6 B;  4OYM A;  4CM2 A;  5D0G A;  1YBU A;  1CJK A;  2GVZ A;  4CLU A;  1CJV A;  1Y10 A;  4CLF A;  2GVZ B;  3C14 A;  1CJT B;  4OYX A;  1YK9 A;  1WC5 A;  4OZ2 A;  4OYP A;  1WC3 A;  3ET6 A;  2QV6 A;  5D0E A;  1WC6 A;  3UVJ A;  4CLP A;  4OYB A;  4WPA A;  3UVJ B;  1U0H A;  1CJT A;  5IV4 A;  1U0H B;  4WP8 A;  4CLT A;  4CLK A; 
#chains in the Genus database with same CATH topology
 1MN7 A;  4UST A;  3DOM A;  3A8K A;  3BGF A;  2JLG A;  2ZWO A;  1Q86 T;  2AMC B;  2ZE2 B;  3UR3 C;  3RGI A;  3FVY A;  4LQ9 A;  1ZOT A;  3DRP A;  3V2U C;  2RML A;  2ZUA A;  3KG1 A;  4KAI A;  4DR6 F;  3K5P A;  3T5K A;  3TUJ C;  1NK8 A;  5KFC A;  3JSM A;  1OPZ A;  1R6V A;  2K3I A;  2KVI A;  4YME A;  3HK2 A;  3M9O B;  2BE7 D;  2J8S A;  1C0U A;  2HHP A;  1ZZN A;  1U0S A;  2C3P A;  4QZV B;  4MKA A;  2LXF A;  5C24 B;  2KRR A;  3SDE A;  2IHR 1;  3IAM 9;  3O6Q A;  2K2P A;  4DV3 F;  4M5M A;  4KTQ A;  3CIZ A;  1U8S A;  1D8Z A;  3JAM U;  3CUN A;  4O4R A;  2FGO A;  2QFI A;  4OYI A;  4YB6 A;  2GJ2 A;  1N0V C;  3K5O A;  1VC5 A;  4N77 A;  3NRB A;  1YJN S;  5B0A A;  3T1H F;  5HLF A;  4OV6 A;  4ZJO A;  1Q79 A;  4NCB A;  3OFH A;  3P49 B;  1FK9 B;  3GCW P;  4ED1 A;  1TL1 A;  2CWK A;  3OHB A;  4A8S A;  1ZPW X;  4WTO B;  4I1T A;  2ZHB A;  3GTY X;  2O01 C;  1D1U A;  2Z30 B;  4DJB A;  4IO1 A;  3DDI A;  1HMV A;  3I5A A;  3R5C A;  4NLX A;  5HSP A;  3EZ5 A;  4P7T A;  3BS9 A;  4JV1 A;  4DOZ A;  2V4J A;  3O44 A;  3QZ7 A;  2B4P A;  3T5L A;  2HFV A;  5K8O A;  4OI3 A;  5G4D A;  2BJE A;  3IR6 B;  4HKQ A;  4ILR A;  4U95 A;  4PXB A;  2OI2 A;  1ZH5 A;  1EP4 B;  4N76 A;  2ILZ A;  5GMK a;  4IG0 A;  1HNV B;  3M05 A;  1LEO A;  3SCL E;  1VQ8 S;  1KTQ A;  3NCR A;  1PSD A;  2BE2 A;  4QPX A;  4ECW A;  3M7V A;  1RBO B;  5KG1 A;  3P96 A;  2AJ1 A;  1JXL A;  2Z57 B;  1F2G A;  2KG1 A;  3HHL C;  1N34 J;  3BGU A;  5CYQ B;  4IKA A;  2JJ4 D;  3DLH A;  1SI9 A;  2YX4 A;  1IBM F;  5J2P B;  3LOU A;  2W9B A;  1TAU A;  5IT9 Y;  4OZ1 A;  1AW0 A;  1D0E A;  3VR1 A;  2C42 A;  3B4M A;  5HAN A;  4PUO B;  3GFX A;  3GFY A;  3I82 A;  2C3U A;  4GKJ F;  1R0A B;  5KFU A;  2JLF A;  1BQN B;  2UUC F;  2UXD J;  2XMM A;  4DFK A;  2VFT A;  3TVK A;  3MR5 A;  2V8V A;  2ZH7 A;  4EO6 A;  1N5Y B;  2DR6 A;  1TL3 A;  1JLE A;  2RUS A;  3PAC A;  3B8H A;  1KFS A;  1OSD A;  1YRX A;  1MWY A;  3FC9 A;  2KL8 A;  5IZH A;  5B09 A;  3VAI A;  4ENO A;  3N0V A;  5CAA A;  2N3O A;  2YKQ A;  4I67 A;  3W5Z A;  2YWW A;  3OLA A;  3MTK A;  2XHC A;  3BN4 A;  1VIO A;  4FS2 A;  3R1H A;  4ZVS B;  4OFZ A;  4MKB A;  1X4D A;  1LW0 A;  2CNK B;  1T03 A;  4E98 A;  1Q78 A;  3TA0 A;  1VQ4 S;  5E3R A;  4Z2X A;  3BM7 A;  2QGF B;  2AD9 A;  1RAJ A;  1YTY A;  1KQF B;  1EET B;  5M2R A;  3D6T B;  5J1E B;  4QWE A;  5IC4 B;  2XZD B;  1X4A A;  1CUL A;  1KC8 T;  1C0U B;  3SYZ A;  1OPI A;  3UNY A;  4DSI A;  3LAK A;  3KLH B;  2HVE A;  2QFJ A;  2K8G A;  1QAX A;  4C8Y A;  4FXW A;  1FT8 A;  1SV5 A;  5D0G A;  1XMO J;  4MFB A;  1S76 D;  4DF4 A;  3NS7 B;  3E2E A;  4RPF A;  4HH1 A;  4ED0 A;  3FMB A;  3CJQ A;  1IN0 A;  3FBC A;  4DG1 B;  2ADC A;  4C97 A;  2MQN A;  2L3M A;  1ZTW A;  2IJF A;  4QCL A;  1K0V A;  2C2E A;  2FC8 A;  2KT5 A;  5D4P A;  4WU2 A;  5HLF B;  4CLZ A;  2GVD A;  2RE1 A;  3H2L A;  4LF7 J;  2FVQ A;  3R5G A;  1TL1 B;  2F4V J;  1X4C A;  2OEK A;  3OVS A;  4AL5 A;  2Z4P A;  4RNF A;  2JLE A;  2QT7 A;  1M1G A;  4YDX A;  2VH7 A;  4FDF A;  2WOM A;  4B3O A;  3DU5 A;  2C2R A;  4IOA Q;  3BH7 B;  1S0N A;  2FLN A;  3IR7 B;  3J81 j;  4M5K A;  2V4J B;  1WOS A;  4Q0B A;  2HQ3 A;  1NHU A;  4NEZ A;  2EKN A;  4OZ3 A;  3GIJ A;  1FER A;  4X65 J;  3M32 B;  1UVJ A;  2OO4 A;  1YBU A;  2MKC A;  2BM0 A;  4IG0 B;  3HKZ D;  2ZHA A;  1TK0 A;  2ZBR A;  4BC9 A;  4PPD A;  3GLJ A;  4I4B A;  5T7L A;  3FDS A;  2R7S A;  2MQO A;  1ZTT A;  2KXF A;  3QT6 A;  4DR6 J;  1XR6 A;  4NLT A;  1VQ5 S;  3EIC A;  4O44 B;  5M2P A;  1URR A;  3J7A 1;  5SZT A;  1N33 J;  4DV1 J;  1FKO A;  4MYU A;  1S59 A;  3VVU A;  3HD1 A;  4ECR A;  1I6J A;  3NNC A;  2OLW A;  3EVW A;  2F9J A;  2FY1 A;  1VBZ A;  4O3R A;  2CJX B;  2AYG A;  3TAN A;  2GIQ A;  3GJT B;  3B78 A;  5B0B A;  5I4M A;  4MAK A;  4DV3 J;  1LQ9 A;  5CA5 A;  5FJ4 A;  4IUF A;  3EYZ A;  2FLP A;  4TN2 A;  1NZ8 A;  2B7C B;  2AJ0 A;  3D0I E;  1TL3 B;  2BEF A;  1RT3 A;  1LK5 A;  1YRT A;  2MSS A;  2VKR A;  3LPE A;  2CDR B;  1O6X A;  3R9L A;  3QRP A;  1U26 A;  2H48 B;  4P7V A;  3FJ2 A;  2DGX A;  4ES1 A;  5KT5 A;  4PXD A;  2A2D A;  5E7O B;  1VBX A;  1F3V A;  2D41 A;  1T95 A;  4KQZ A;  3JYT A;  1LW0 B;  1NM2 A;  2XLJ A;  4YY3 J;  2BA9 A;  4DZD A;  4C8L A;  1XNQ J;  4CLK A;  2RRN A;  1M90 T;  5IC6 B;  2XLI A;  3DLE A;  1YJT A;  2BBE A;  4QYZ K;  2Z2Y B;  3MMC A;  1ZBT A;  3I4P A;  3LO3 A;  1YKW A;  2F8E X;  3W9H A;  3IAS 9;  2LLZ A;  4DSL A;  3X3U A;  1E6Y A;  3DRR A;  4H54 A;  4WTY A;  3GSI A;  2R3V A;  3W7B A;  4BWM A;  2QJ3 A;  1SV5 B;  2VD3 A;  3A3O B;  2HIY A;  5KFM A;  5LSL A;  1HR0 F;  2XO6 A;  1S77 D;  1KNZ A;  7AT1 B;  1TL5 A;  3EGV A;  3NAI A;  3QZ8 A;  2JFD A;  4DPO A;  1U48 A;  4LF6 J;  4K0K F;  1IBM J;  2UZA A;  2N7C A;  4OYX A;  3NGS A;  3GJS B;  3EDR B;  2ZH2 A;  2CQ4 A;  2R9L A;  4B3R F;  3CVK A;  1NDC A;  5EWF A;  4DL3 A;  4HLB A;  1RAG B;  3PRB A;  1Z2L A;  2XQC A;  2DHX A;  4QR0 A;  3VHQ A;  1UCN A;  4LSN A;  1Q8B A;  4CM0 A;  2HS3 A;  2ZKU A;  2BJ1 A;  2J7U A;  2WOM B;  4B3O B;  4ZKA A;  3C8Y A;  2N7Y A;  5A6P A;  3BQ0 A;  3R7B B;  4GRS A;  4P10 A;  4DL0 C;  3A13 A;  2RQC A;  4TVA B;  4DL6 A;  1WHX A;  4CO1 A;  4DZ6 A;  2XMT A;  1FXD A;  2ZH4 A;  1BQM A;  1HNI A;  3M8Z A;  5DQG A;  2VON A;  2XYP B;  3OXF A;  4HAC A;  1J27 A;  5KFJ A;  1ZET A;  4WYL A;  3DU6 A;  3CSK A;  2YWH A;  3IWX A;  4C8N A;  3C46 A;  3BBC A;  2ZHO A;  3P5T L;  1PG5 B;  1VMB A;  3MMB A;  2DH8 A;  5T7L B;  3FK4 A;  4IH7 A;  3H7H B;  4L76 A;  1PAU B;  2POK A;  5H1S V;  4V19 J;  4F4X A;  2ZH8 A;  1H3D A;  2MPU A;  3SXL A;  4WK1 A;  3EPI A;  1R8A A;  3ZTQ A;  2RAQ A;  4OYP A;  1FKO B;  1IQT A;  4RX6 A;  4CLP A;  2F5G A;  3MEE B;  3G8T A;  4ED3 A;  3G6X A;  3IWN C;  1LXN A;  3VGT A;  5KT6 A;  4X66 F;  5K8M A;  8AT1 B;  2PEH A;  3N6L A;  2DNK A;  2DNG A;  3FZB A;  1HKA A;  2QLF B;  2EXU A;  2WHO A;  1OQ3 A;  1HHS A;  4RW7 A;  4DLG A;  2IVM A;  4P2S A;  1FVQ A;  1F5A A;  1DFD A;  5I3U B;  3VGV A;  1XMQ F;  2HNZ B;  1HBO B;  3N6N A;  1SIW B;  3BSC A;  4LQ3 A;  2JWN A;  1VQL S;  4NYP A;  1H98 A;  1U24 A;  1TUW A;  2Q43 A;  2DXE A;  2B9Y A;  4FYX B;  1T05 B;  2RS8 A;  4M63 A;  2UUA F;  3JYT B;  1IKW B;  3I96 A;  5MLC V;  3B6B A;  4DQR A;  2UV8 G;  1QDU B;  3RUB L;  3D54 A;  4EO8 A;  3PRV A;  4F4W A;  5D8H B;  2XY5 A;  2C1E B;  4PG7 A;  4DR1 F;  3U1M A;  3KUH A;  2DNR A;  3W8P A;  2RHS B;  3KG0 A;  3IG1 A;  2HWT A;  3QYY A;  3KLG A;  1IBC B;  3MMC B;  1DTT A;  4LR8 A;  2DNH A;  1ZAX A;  3HVR A;  2XI2 A;  4MMO A;  5K8P A;  2QG9 B;  3WDO A;  4WII A;  1R0B G;  3F0N A;  2M70 A;  1T02 A;  4DV5 F;  3AOC A;  3EX7 B;  2XMV A;  1E6Y B;  1FKA F;  1WF2 A;  4FF1 A;  1VQN S;  2Y0S D;  3ILI A;  2XNR A;  3NXZ A;  4DPT A;  2F40 A;  2K06 A;  5A76 A;  2GIR A;  1Q5Y A;  4Q5V A;  1K1Q A;  4RWX A;  3P5B P;  2CJ9 A;  2DGU A;  2BW7 A;  2CZ4 A;  1YIJ S;  4C9D A;  3AOA A;  4TYB A;  2E44 A;  2QEX S;  3SQG A;  1I3O B;  3O8W A;  2OPP A;  4USU A;  4DV0 F;  5KT7 A;  1NB2 A;  4CI0 B;  2BJ8 A;  1IBK F;  1BXN A;  1HQE A;  3W2W A;  1Y9O A;  2E5L J;  4YN3 B;  3QGI A;  3OLB A;  1QUP A;  4KFB A;  3TW0 A;  4DX8 H;  5FLX Y;  2WB4 A;  2XUL A;  4NCA A;  4ER8 A;  1J2V A;  1X5O A;  4ZLP A;  4XDC A;  2XHW A;  1T3O A;  3BGR B;  4J9O A;  1HIY A;  5CCL A;  1BUX A;  1M5V C;  1WEY A;  1HBN B;  1QJH A;  2JVO A;  1HNI B;  2GHW A;  3NCP A;  5DO2 A;  4DR7 F;  4KKO A;  4Q45 A;  5L46 A;  3GP9 A;  1UPM B;  4RBU A;  3G6E S;  2C2Z B;  1ULR A;  3QSY B;  2PI5 A;  1JQG A;  3MMB B;  1WF0 A;  3M8S A;  3FNN A;  4X84 A;  3M9M B;  4URQ U;  3MR7 A;  3KDN A;  4U7C A;  3AHP A;  1N52 B;  3V6J A;  2IM3 A;  1B0T A;  4J9U E;  3PYG A;  1VBK A;  3D7S B;  4OX9 F;  2XMA A;  1IWG A;  1PAE X;  1PBU A;  2PC6 A;  2XYG B;  4QQB A;  1JLB B;  3M2V A;  4RW6 A;  1NXI A;  5K5M A;  4HHJ A;  2YH1 A;  2G13 A;  1VFJ A;  2DIT A;  5KFH A;  3RZA A;  1GT8 A;  2YQ0 A;  2XYH B;  4EU0 A;  1AFJ A;  4B08 A;  2WON B;  3OFG A;  1HFE L;  1HR0 J;  3OT9 A;  2CAJ A;  4ED2 A;  2FY8 A;  3W65 A;  3Q8Y A;  2V8D A;  4G1P A;  2WW8 A;  1F3F A;  1F9H A;  1QAI A;  3GR1 A;  2CPZ A;  1TFW A;  1REG X;  3DLB A;  2F9D A;  2E9T A;  3QT5 A;  4B3R J;  2MKI A;  4HHU A;  1U47 A;  1QD1 A;  2L9D A;  1CJU B;  3CCW A;  1FRI A;  5F9N A;  2K3K A;  1TU0 B;  2AW0 A;  2BW2 A;  2B9W A;  3CCU S;  5A0Y B;  4BBY A;  1FRJ A;  2PE8 A;  1XR5 A;  4GC6 A;  1VJW A;  5HQ8 A;  1B7F A;  4CZC A;  4MH8 A;  4ZLJ A;  4CM2 A;  1TKZ A;  2Z0G A;  1KVI A;  2DR7 A;  1Y10 A;  3MUR P;  5L38 A;  1QE1 A;  1ZA1 B;  2BJD A;  1SQE A;  2MY7 A;  4KGZ B;  2GMJ A;  2E5J A;  4JI1 J;  3VF0 B;  1SC3 B;  3LAL A;  3M4X A;  2PA8 D;  1IBL F;  2MQL A;  1TK5 A;  3RB3 A;  2G0J A;  1TKX B;  3KJQ B;  4XPE A;  3MHY A;  1P1L A;  1YHQ S;  1QUV A;  2FYX A;  3QJL A;  4FVM A;  1HWU A;  4WYW A;  3KLI A;  2BOP A;  1R6Y A;  3SQG B;  4WBF A;  3TR5 A;  3J7Y U;  2NR0 A;  1RWU A;  5LJ5 Y;  4FYW B;  2ZBQ A;  2AU0 A;  3DRY A;  5HN0 A;  2VOP A;  4LF4 F;  2ZZT A;  2R8J A;  4JB8 B;  2L41 A;  2DR8 A;  4RNH A;  4I2Q A;  3TQE A;  5AE1 A;  2ATC B;  3H40 A;  1X4G A;  4ZIW A;  2LXU A;  1HAR A;  1MMD A;  4M95 A;  2M7S A;  4LBI A;  4CLF A;  4JI5 F;  4X4P A;  1XMQ J;  4QWB A;  1RQ0 A;  4ZVE A;  1FFW B;  4TY9 A;  4AL6 A;  3LF0 A;  2UXC F;  3PO4 A;  2G1H A;  2QLW A;  4P9S A;  3HSD A;  3CJ0 A;  1QSY A;  3EWG A;  2PMW A;  1N8R T;  1FCA A;  2UUA J;  3O5T B;  4DSF A;  2OEL A;  2JEI A;  3BKU A;  2ZVI A;  4KGK A;  3N4W A;  3EUN A;  4B3S F;  2U2F A;  2DT9 A;  3WBZ A;  2WB1 D;  1XER A;  5E3Q A;  2GO9 A;  2M8H A;  3HKW A;  4HT7 A;  1NHK L;  5RUB A;  4CLS A;  5KFG A;  3PHE A;  5F8I A;  2PMZ D;  1VGY A;  1T3N A;  2XMW A;  3EZU A;  1S6U A;  3NS5 A;  1NSQ A;  4RBT A;  1U02 A;  8RUC A;  3IRW P;  4G65 A;  3EVM A;  4C11 B;  4HH0 A;  4KT0 C;  3DKD A;  2CJK A;  2LP4 A;  3MTJ A;  3UWT A;  3OL9 A;  4DV5 J;  4OZN A;  2BV3 A;  3OD2 A;  4L73 A;  1IUJ A;  2CPX A;  4ZVF A;  5DJB A;  4TQR A;  4ID8 A;  2B56 A;  2XY6 A;  3OBI A;  3Q8S B;  2RH3 A;  3GIR A;  4ECV A;  5KFV A;  2W2O P;  1X60 A;  1R43 A;  1LWF A;  3HJF A;  1EB0 A;  5KFL A;  2A0F B;  1RLD A;  3DI6 A;  2LQB A;  4QPT A;  4IQX A;  1SB6 A;  1WWH A;  2YX1 A;  4WCE Q;  1ZM4 A;  4O3O A;  4FNH A;  3G9C A;  2V2Q A;  2DIV A;  1IBK J;  3EXY A;  3IBW A;  1K47 A;  2B8Q A;  4NOH A;  4ATN A;  1F9E B;  4ZOS A;  1GH8 A;  5IQQ A;  2EBE A;  3I9V 9;  2FLO A;  3UCZ P;  3MM6 A;  4NML A;  1LNQ A;  1DRZ A;  4USV A;  5HRO A;  4PZV A;  4IOC Q;  2B4U A;  5D0R A;  3MPY A;  1CVJ A;  1C4C A;  2MKS A;  9ATC B;  3Q8R B;  3R5J B;  3SI8 A;  2MQM A;  2C3M A;  3PHT A;  4C2M A;  3WIU A;  3UD4 P;  2R42 A;  1CC8 A;  4DQI A;  4I7F A;  1CJK A;  5HJY A;  3KG4 A;  5HJX A;  3BJY A;  2QC3 A;  2LQ8 A;  4YOE A;  2C2O B;  1V3S A;  1XR7 A;  5T14 A;  2VBW A;  2J9D E;  2XTJ P;  3N5F A;  3AD7 C;  1JLA A;  3L09 A;  1KQK A;  2KG0 A;  2FIU A;  3UVJ B;  2NSC A;  4K2X A;  1ROF A;  1EAR A;  4CYU B;  1VRT A;  3PIO Q;  4O3Q A;  2VC0 A;  3UDC A;  2DK2 A;  4CT8 A;  2RDI A;  1YI2 S;  2J6T A;  1C1B B;  2W9C A;  4AFF A;  1RZM A;  1WEZ A;  3MR2 A;  4TXS A;  1HWJ A;  4OI6 A;  1Y11 A;  3M8Y A;  3JSR A;  2DGV A;  4OZ0 A;  3KOA A;  3S6E A;  1J5O A;  2EC0 A;  2WSC C;  2HAF A;  3P4U B;  5BYS A;  4ITS A;  3BR8 A;  1DAX A;  3M6X A;  3ZZU A;  1PIL A;  1LWE A;  1Y0H A;  1WTB A;  3TVY A;  5HVH A;  4G1I A;  2NUH A;  3KK2 A;  1QSS A;  3T5H A;  1KRP A;  4M5D A;  1WD6 A;  1IR0 A;  2GHV C;  4OYB A;  2E5G A;  2H5E A;  3TZW A;  4IR1 A;  5HVF A;  4R8U B;  2KXN B;  3ICL A;  2X3G A;  4RUH A;  4TU8 A;  4WU3 A;  2XLK A;  3GG0 A;  2C3O A;  3BSN A;  4DUY F;  2KB2 A;  1RHU B;  1J5E F;  2B9X A;  1HQU A;  3BR9 A;  1Z1Z A;  1VIX A;  5IT4 A;  2IRX A;  2J0S D;  1UZH A;  3GZ7 A;  1QSL A;  2NXN A;  3RW7 A;  3TX8 A;  4DQP A;  3JQK A;  2IRU A;  2AYB A;  1B0V A;  3GE9 A;  2NXJ A;  3RTV A;  2E29 A;  1CEZ A;  1SBR A;  4C7Q A;  3MM7 B;  4Y0F A;  2HHU A;  4AQY J;  1HNX J;  3Q2S C;  4YUD A;  2GML A;  1IBL J;  1OYE A;  2XY7 A;  4CNZ A;  4ZDN A;  3D68 A;  5H9F J;  4HTJ A;  2MQP A;  4ILL A;  4PEO A;  2C2K B;  2CZ9 A;  3GWC A;  2CPH A;  1RT1 B;  1UJ6 A;  3J7A N;  3F44 A;  2BAN B;  3OQ2 A;  4EWT A;  4U9R A;  3DI6 B;  2V5H G;  3ITH B;  5H9F K;  3N79 A;  2RS2 A;  2RKI A;  3TZZ A;  3NBP A;  4LF4 J;  3GU0 A;  1VC0 A;  3CJ8 A;  1LV5 A;  2GQ2 A;  2IBO A;  3W9I A;  1NHV A;  3CC2 S;  3DOL B;  4MIB A;  1N6Q A;  3DXB A;  3QJJ A;  2AV5 A;  4JI5 J;  3NY0 A;  5HRO B;  3CPW R;  1AA1 B;  3OR1 B;  5GVQ A;  4C3M A;  2UXC J;  2E1R A;  4ZP8 A;  4HT5 A;  3KJV A;  3ENQ A;  1BWV A;  3BKF A;  1CJK B;  2B9E A;  4NI2 A;  4WE1 A;  3C16 A;  2YWK A;  2ZIT A;  3BDP A;  1UJ4 A;  4NXM F;  3M2R A;  2LEA A;  3G2X A;  3HUL A;  2RU3 A;  1G4C A;  2HFN A;  1JLA B;  2IYG A;  4B3S J;  3MM9 A;  4U7U D;  5BYQ A;  3MPW A;  3N6M A;  1KVJ A;  2W25 A;  3OJU A;  1VRT B;  2VBY A;  4WF9 Q;  2JRS A;  4XPC A;  3CMA S;  5BXI A;  5FDL A;  4EK2 A;  1RSC A;  4ZCI A;  1CJT A;  2IPO B;  1TKD A;  1S57 A;  2WSE C;  3BDE A;  2E1A A;  1Q7Y T;  2CQ0 A;  2CJQ A;  1UZD A;  1VHI A;  4DSE A;  1FD8 A;  3H25 A;  1J5O B;  2J0X A;  1NBE B;  4HEA 9;  4UT4 A;  3QGG A;  4WFB Q;  1HNZ J;  2FGC A;  2CAD A;  2R2R A;  1LWE B;  4KB7 A;  5JJB A;  4DPX A;  4CTA B;  2MHE A;  3TZY A;  2OPS A;  1D9D A;  1K0T A;  1RI7 A;  4KSE B;  2C3Y A;  2MGZ A;  5J2N B;  3M1V B;  4P2M A;  3IGN A;  1BD6 A;  1RLC L;  4IRK A;  1LOU A;  2B7B B;  1PIE A;  1Y00 A;  2IJN A;  1S10 A;  3KNA A;  3UO0 A;  1NU4 A;  3D1H A;  5GAD I;  4LR9 A;  3P8B B;  5JMN A;  1FD2 A;  4AYB D;  3GYG A;  1D9A A;  3ZTO A;  1U1M A;  3IGV A;  3ET6 A;  1IR1 A;  3NGT A;  4ZN3 A;  4L74 A;  5HO4 A;  4A4J A;  1HQU B;  4WJB A;  4BHQ A;  4IFV A;  2RT3 A;  2ILY A;  3VAK A;  1RTH B;  4EBE A;  4IDK A;  4ICL A;  3KNG A;  2Y0B B;  1Q5V A;  3M9N B;  4OYZ A;  1KQG B;  1OQ6 A;  2VBX A;  4X4V A;  3A3N B;  1F60 B;  4Q44 A;  4CRJ A;  4H4O A;  3HHL D;  3OTE A;  1D3W A;  5HAO A;  3VAG A;  4K4U A;  4DWI A;  2D3Z A;  2YNG A;  4I0W A;  3OTD A;  2DVI A;  2OKQ A;  2CJY B;  2ZDP A;  2XMU A;  2G1D A;  3SCJ E;  1T8E A;  4JI4 J;  3JQM A;  1WEL A;  4YHH J;  3DMJ B;  4JI6 F;  3K5L A;  5H9E J;  3OUY A;  5A8W B;  1WNE A;  4J9S A;  2A10 A;  1LFW A;  1KN6 A;  3NBP B;  5KFK A;  1XNR J;  1OY9 A;  1S9G A;  5EWG A;  3A3P B;  2VV5 A;  2ZKT A;  1NJW A;  3FEY B;  3K89 A;  3MMA A;  3I0R B;  5H9E K;  1KP6 A;  3HFV A;  4JI2 J;  1RHR B;  4OI1 A;  2H1Y A;  2MHN A;  1RT6 B;  3TAP A;  3TUI C;  3OL6 A;  3PW5 A;  2NS1 B;  4QU6 A;  2YXL A;  3K17 A;  1RDR A;  1EX8 A;  1MWQ A;  2J8A A;  2IMW P;  1KLN A;  1H0H B;  5CHC B;  4BS2 A;  2D7S A;  2XCP A;  4KO0 A;  1RYR A;  2DRB A;  3CGI A;  3R2D J;  2KT2 A;  3V6D A;  1A9N B;  4P74 A;  4LF2 A;  3DHX A;  3VWS A;  3M2R B;  5LXR A;  5DDR C;  4KH0 B;  2BM1 A;  2QZ8 A;  4NMX A;  2V6A A;  4LFC J;  3MM9 B;  3CD0 A;  3SSQ A;  2B3T B;  3P45 B;  4WFX A;  5ETM A;  3KJF B;  3CO0 P;  3KK1 A;  1DUR A;  1ZYQ A;  4O4G A;  2COL A;  1S1W B;  2VG7 A;  1MML A;  1CPZ A;  3MD1 A;  3MUT P;  4FYD A;  1UWA A;  2GVZ A;  2VIH A;  2HG4 A;  1U2F A;  2H65 B;  2HPU A;  1YRU A;  4NZ7 A;  1CJT B;  3AB4 B;  2R4F A;  1JLC A;  3UN3 A;  5ETT A;  3HJV A;  5KT4 A;  1R8C A;  1K8A T;  2QV6 A;  3CT9 A;  1N36 F;  2ZD1 A;  3KWM A;  2DXF A;  2I5J A;  3KUG A;  3KUE A;  1XN9 A;  2V68 A;  1SL0 A;  3G82 A;  3TP2 A;  1NJI T;  3OW2 R;  4YB1 P;  1JKH A;  1SCJ B;  3QIP B;  2I0X A;  4P72 A;  4RW9 A;  1T9V A;  3O3L A;  3KHR A;  2BQ3 A;  3BBB A;  4LIR A;  4HVZ A;  3C15 A;  2J9E A;  2A6O A;  4K4W A;  3HF5 A;  2HZA A;  4OYO A;  1JNZ B;  5F3Z A;  2MGZ B;  4USK A;  3J80 Y;  2D9O A;  3I87 A;  4K4X A;  1EIY B;  2NXE A;  1V5I B;  4DL7 A;  2VFU A;  3HHL A;  3F56 A;  1WC4 A;  3W1Y C;  3ILO A;  2CQC A;  4EYI B;  3KJN B;  5J1N A;  3ET6 B;  3P3D A;  2GHP A;  1S6Q A;  1Y5I B;  4FS1 A;  5CZV A;  1RGV A;  2MMY A;  1FWK A;  4KHP F;  1HA1 A;  3TAM B;  3MED A;  4ICL B;  1TEL A;  3TX0 A;  1S9E A;  3UN2 A;  3CCS S;  4PQU A;  2BJ9 A;  1OY6 A;  1TUV A;  4BLG A;  1URN A;  3T3F A;  4DR5 J;  4M5H A;  4KHR A;  4H4O B;  4Y3C A;  1KFD A;  4PCQ A;  3CTR A;  3FQK A;  3TJ9 A;  1Q16 B;  2VDH A;  3MM5 B;  4NXM J;  1OJ4 A;  3E51 A;  3FQL A;  5D4L A;  1IJE B;  3UD5 A;  4U6P A;  3OTB A;  2IVY A;  5DGB A;  2U1A A;  3FCV A;  3ZTS A;  2J7W A;  3KK3 B;  1R0C B;  1TUG B;  2H9Z A;  5K20 B;  4X4O A;  1ELO A;  4DPU A;  2V0N A;  3D3B J;  4WFY A;  3OUY B;  4EZ6 A;  2BAB A;  4F26 A;  3RAQ A;  5E41 A;  1NH8 A;  2Q79 A;  1RTJ A;  4RLE A;  2V69 A;  2YNI A;  5DS7 A;  1BHN A;  2ZM6 J;  2OJ3 A;  4KE5 A;  5I42 A;  2ABY A;  3Q0A A;  1S9G B;  2XEX A;  1F6T A;  4EBC A;  2EEY A;  1NJZ A;  3I9Z A;  2VQF F;  3HT0 A;  4BDP A;  3DOK B;  1YGY A;  3SCK E;  2NZ4 A;  4CT9 A;  1VDH A;  4QR1 A;  3HXM A;  4A8Q A;  1UAW A;  1UVK A;  1C1C B;  1G2E A;  3VAJ A;  4NWB A;  5ITH A;  2FVR A;  4KO0 B;  4DI6 A;  1RTZ A;  4ILM A;  3V6D B;  1Q8L A;  1U7L A;  3W5Y A;  4X2B A;  4J9R A;  2V2Z A;  2B5J B;  2IC3 A;  4J9M A;  3QBC A;  2BYC A;  1P27 B;  2FTR A;  3BH6 B;  1WOO A;  2Y1L B;  3MD3 A;  3W2V B;  1RT7 B;  1Q81 T;  1UP1 A;  1KHW A;  3Q8V A;  2R2T A;  5F9L A;  4L72 B;  1FWL A;  5KG2 A;  3KK1 B;  4H4M A;  1GAO A;  4R5P B;  4A8O A;  5FII A;  1JB0 C;  4O4G B;  5HAT A;  5LL6 d;  1WC1 A;  2GO8 A;  2AP6 A;  3S7R A;  4F0M A;  4YDD B;  4WZQ A;  3MMJ A;  2IMO A;  3N01 A;  2L08 A;  4O3P A;  2KZZ A;  3DRS A;  3LP2 B;  5CD4 H;  2GJF A;  5B7W A;  3K0J A;  3TRG A;  2EFN A;  3UE2 A;  5KG5 A;  2I5J B;  3S1T A;  5A8K B;  5DET A;  3NNH A;  2BXJ A;  3MCM A;  3GV7 B;  3K58 A;  4DV2 J;  4JP8 A;  4NLO A;  3CED A;  3QRQ A;  4JUZ A;  5J2Q A;  4Y6I A;  2Y1J A;  2W4D A;  4RW9 B;  4DHV A;  3QRR A;  2YVS A;  3O2I A;  2RDJ A;  1VS3 A;  4KR0 B;  5ETP A;  2W24 A;  2D3O 1;  4JI6 J;  2IRY A;  4KV8 B;  4LRF A;  2R2S A;  2ERR A;  2HGL A;  2P2C B;  1KD1 T;  4KYZ A;  2M8D B;  3M6V A;  5KFA A;  2ZE2 A;  1U1N A;  1M1K T;  3KYL A;  4CLL A;  4DX6 A;  1DBD A;  1CQM A;  3FCH A;  4C8Z A;  4P52 A;  3UNG C;  4FF2 A;  1QTN B;  1D09 B;  3FSX A;  3HT3 A;  4F50 A;  2R8G A;  1S6Q B;  3CD6 S;  3ZNJ 1;  1UW9 A;  2ZH3 A;  2PDA A;  1N5V A;  3HVW A;  1Y4Z B;  3W62 A;  3MED B;  2AZ3 A;  1O0P A;  1SUQ B;  4N7T A;  3H20 A;  1F5B A;  3JSB A;  3D1Q A;  5ETL A;  2XB2 D;  2R8I A;  3RB4 A;  2W7O A;  4UOC A;  1B7Y B;  2YKM A;  2WAQ D;  4UQG A;  4KH1 B;  4FF4 A;  3IS9 B;  1U45 A;  3PZP A;  2DNL A;  1M1H A;  4V19 X;  4OX8 A;  2E7X A;  2XM3 A;  3UW1 A;  4OMF G;  4PYD A;  1GXT A;  3G96 A;  2M5Y A;  2AF6 A;  4N41 A;  3CCJ S;  1IVZ A;  2KFN A;  6AT1 B;  1UMJ A;  5F8H A;  2BQR A;  4IG3 B;  3AXK A;  1FK9 A;  2YNI B;  3QPI A;  2HQI A;  2GQC A;  3FGV A;  4R25 A;  5I42 B;  3BRE A;  1N36 J;  4RJV A;  3SBM A;  2MLX A;  1H7X A;  1NSP A;  2NCK L;  5F8N A;  2WVE A;  1GMU A;  2HQG A;  4RW4 B;  3GR0 A;  2C22 A;  1MLA A;  2XWX A;  4QIG A;  2EG1 A;  4DV7 F;  2ZNY A;  3ENV A;  2GV1 A;  1NJY A;  2VQE F;  2P5V A;  1IXK A;  1B99 A;  1LW2 A;  1EP4 A;  2I2Y A;  6FDR A;  1HNV A;  1T9U A;  2ASY A;  4CO0 A;  1JJH A;  2OEJ A;  5J2M B;  3R1L A;  4B9U A;  3F73 A;  3R5D A;  3SEO A;  4EI2 A;  2ZBP A;  2OSR A;  3NOG A;  3D6M B;  1YJW S;  5D4N A;  2CA9 A;  1HNW J;  2IY5 B;  1O5J A;  3PIP Q;  2UU9 J;  4X4S A;  4DCP B;  5CYQ A;  3NG8 A;  1Q7L B;  4ALZ A;  2PII A;  3NMA A;  2ZBC A;  1W26 A;  1DLO A;  4NCG B;  4FXD A;  1A0O B;  2DKO B;  1TZ0 A;  2V8G A;  2IFX A;  2MXY A;  2EFG A;  4NXN J;  2OFH X;  1T0T V;  3PO5 A;  4ZPV R;  4DEZ A;  2YNF B;  1R0A A;  1HI8 A;  5D0H A;  4PWD B;  2FLL A;  4N8O A;  2ZH6 A;  2YKP A;  4DLE A;  3A12 A;  1S49 A;  4ELU A;  2QYC A;  3BPS P;  2E7W A;  1WOR A;  4NYZ A;  4RKU C;  5E5N A;  3GG1 A;  1RAB B;  5BYR A;  2WSF C;  1K9M T;  5F8J A;  1N5Y A;  1SC1 B;  2EFP A;  2HGN A;  2A1B A;  4OZ2 A;  4DX5 A;  2F8H A;  4NAS A;  3Q8P B;  4UTG A;  2KHD A;  3I5B A;  1N5Q A;  4J9K A;  4RBV A;  1D8Y A;  2IDL A;  4I68 A;  3TOQ A;  2DIS A;  5IM0 A;  3K57 A;  1FO1 A;  1SQF A;  3VV2 B;  4CO2 A;  2ZJQ Q;  1FF2 A;  1RHK B;  1F1B B;  4LFA F;  3BO2 A;  3X1L B;  2VQF J;  2BX6 A;  4ECQ A;  3CJS A;  4X4N A;  2P9E A;  1EET A;  3EMT A;  4V1A k;  5J1E A;  2Z58 B;  3OHA A;  3OFF A;  4Y65 A;  3ELH A;  4QIF A;  3E01 B;  4P2F A;  2DHA A;  1WG1 A;  3KLH A;  2J0Q D;  2HNY B;  4FP9 A;  4AUK A;  2OPQ A;  4IH6 A;  3T5J A;  1RBA A;  4KGM A;  2YKM B;  1YSJ A;  3EGZ A;  2VB6 A;  1OSC A;  4K5S A;  4OYM A;  1SH3 A;  1S5Z A;  2QSW A;  2UP1 A;  2K7J A;  1FA0 A;  1WC5 A;  1VR6 A;  4DG1 A;  5L8R C;  1FJG F;  1NZA A;  3GIM A;  4AT1 B;  2H5J B;  4PR6 A;  3CC7 S;  2IM0 A;  3C66 A;  2KI2 A;  3NGK A;  3HHK A;  2MKH A;  2BRL A;  5A8R B;  3LP0 B;  2HS0 A;  3N5B A;  5KOW A;  2OD6 A;  1Q8K A;  2AT1 B;  2AJQ A;  3FEX B;  3NLC A;  1F9F A;  5L1K A;  1JWW A;  3ULH A;  4DR3 F;  2CVE A;  3FRY A;  2YKO A;  2BKP A;  4GMK A;  3WQP A;  4CO5 A;  1RKI A;  2GCF A;  2OGU A;  3M8P B;  2O1P A;  2CPJ A;  5EHH A;  4EUV A;  4GVB B;  3K2Y A;  5BJR A;  2W1B A;  4ZVT B;  2OD4 A;  2GX8 A;  2RUG A;  4KBI A;  4USW A;  4J9L A;  1FEH A;  4UQT A;  4GKK F;  1R89 A;  3M32 A;  4NA1 A;  4F67 A;  4B9N A;  1LW2 B;  1FJC A;  2NXU A;  3W9J A;  5F0U A;  2A18 A;  4LFB F;  2Y1R I;  4DSK A;  2HUR A;  3NS6 A;  4O44 A;  2HWH A;  2D9P A;  2LEP A;  1X4B A;  3KMQ A;  4DV6 F;  1YJV A;  2I9S A;  1DLO B;  2QMX A;  4LBH A;  1RT4 B;  4F02 A;  3I4H X;  2HYI B;  2DGO A;  2RIL A;  4DUZ F;  4LF5 F;  1EHW A;  3K5M A;  1S1T B;  5D77 A;  3C6U A;  2DH7 A;  2K7K A;  3JQJ A;  2BUN A;  2QYG A;  4NA3 A;  3LW5 C;  3PM9 A;  3UD3 P;  1FJE B;  1S79 A;  3E3X A;  2HBR B;  3ZZO A;  1VQS A;  1T9X A;  1EZZ B;  3PW0 A;  2YNH B;  4ED6 A;  3CDB A;  1RIS A;  4JI0 F;  1M5O C;  3EDQ B;  1X4E A;  4MYT A;  4JI3 F;  5DQH A;  3AAW B;  1RT5 B;  2VDI A;  4XIU A;  1H2U X;  5IM0 B;  2HHH F;  4J9V A;  1WSR A;  2D3O R;  4K8R A;  4C0O C;  2JFK A;  1CG2 A;  4B9T A;  3D3C J;  1FXL A;  1R31 A;  1KS2 A;  1HD1 A;  4GVL A;  4A8Y A;  2CDQ A;  4RUB A;  5C2G A;  5B0E A;  3O1L A;  4O23 A;  4CH0 S;  1H72 C;  3PV8 A;  1RAD B;  3TNV A;  5KTQ A;  6FD1 A;  4DPY A;  1JIH A;  4LF9 F;  2B6A B;  4OYW A;  1IJF B;  2OPQ B;  2WCX A;  3LGH A;  1UA1 A;  3F41 A;  3GII A;  3AA9 A;  5KT3 A;  2E9Z A;  4Y34 A;  2V2K A;  3BB5 A;  5GAH I;  2BR0 A;  1H2T Z;  2XS2 A;  3CB4 A;  1RAE B;  4I2P B;  2G2Y A;  1NSK L;  2YWF A;  3IM8 A;  2CXE A;  3T1Y F;  5C2C A;  3RBE A;  1KR4 A;  4OHX A;  3OL8 A;  4F2R A;  1RE1 B;  2OML A;  5L9X A;  1RA7 A;  3GIL A;  5DG8 A;  2FVS A;  4A8K A;  1H74 A;  4C6A A;  3MGJ A;  4GO7 X;  3IBC B;  3QWU A;  5IWA F;  3CCE S;  3UDE A;  3RU0 A;  3NAH A;  2B4O A;  3OSP A;  4ID5 B;  4CWB A;  1N5S A;  2QA4 S;  1WG4 A;  2HRU A;  4YEA A;  1CBK A;  5E33 A;  1F0X A;  2DNO A;  4TY8 A;  3IN5 A;  5D4O A;  2MTL A;  3WX8 A;  2FJD B;  3PJW A;  2R7X A;  1TMJ A;  2M3D A;  1U1Q A;  1Y5L B;  3W60 A;  1LXJ A;  4JI7 F;  3D9B A;  1ZAW A;  3RAM A;  3OSN A;  3TO8 A;  3OXL A;  1I94 F;  1UFW A;  3FUY A;  1DY3 A;  1SC6 A;  3EJM A;  2W2N P;  1S0M A;  3M8Q A;  1SH2 A;  2M4M A;  3G6Y A;  3KXD A;  4U96 A;  3T9Z A;  5D15 A;  3RR8 A;  4DR4 F;  1ZM9 A;  3VAF A;  4GC7 A;  1RWM B;  2UVV A;  3BSO A;  3QLH A;  4LFA J;  3C6T B;  2HMI B;  1GMV A;  3H98 A;  2LXI A;  3ISN D;  1AYE A;  2KO1 A;  2MKJ A;  5CXT A;  3LH2 S;  2MZR A;  5GAG I;  2XWY A;  1FRX A;  5HQL A;  3MEE A;  4Z7Y A;  3S01 A;  1WAC A;  5ETN A;  2FDN A;  1UPP A;  4Y2C A;  4N47 A;  4M5G A;  2FZG B;  2HVD A;  1S97 A;  3Q22 A;  2VJV A;  1FEE A;  1NJX A;  3C6U B;  2JOQ A;  4FXV A;  4DS5 A;  4WP8 A;  1MMN A;  4ETX A;  1VLY A;  3EGN A;  2AIR B;  2W2Q P;  2RNE A;  5AXM A;  1B3T A;  1U09 A;  4OJ3 A;  4DPW A;  2Q66 A;  2RHQ B;  5D3G B;  1UJ5 A;  5I3U A;  3CJ3 A;  2HNZ A;  2DCU B;  4NZ0 A;  1HBO A;  1FJG J;  3SFU A;  1HPZ B;  4ZCL A;  1IKY A;  3SV3 A;  7FDR A;  1Q4R A;  4CH7 A;  1NPK A;  2X1A A;  1Y3J A;  1T05 A;  3T1H J;  4ANE A;  1N4L A;  2ZWP A;  5CQG A;  4G3I A;  4QYZ J;  4IFY B;  1R27 B;  1IKW A;  1V3Z A;  2RSQ A;  4K59 A;  3SIP B;  2KYX A;  3L7U A;  2AHO B;  4CLU A;  4DR2 F;  1T9Y A;  1MU2 A;  3M2U B;  1U8W A;  4FKX A;  2RRB A;  3MCS A;  3QSI A;  1SQG A;  4W4M A;  3T1A A;  1R8H A;  5LOQ A;  5CH7 B;  1QAY A;  1JMT A;  2XMJ A;  5KFO A;  1OWX A;  2CQ1 A;  2DNM A;  5F8L A;  2EK6 A;  2VOO A;  5HVG A;  2MYF A;  4ED4 A;  3BF4 A;  2AJ4 A;  1S1X A;  4G1Q B;  4CQ1 A;  3ZZ0 A;  3PEJ A;  5LJ3 Y;  2IAJ A;  5ADZ A;  1RHM B;  3DLK B;  5KFF A;  4OI4 A;  4G6V B;  1EKS A;  1YBA A;  3V6H A;  1UEU A;  3M8W A;  2R7R A;  4RR5 A;  2DHS A;  3CE8 A;  3WHI A;  3H2V E;  2XO7 A;  2BZ2 A;  4K4V A;  2ZOG A;  2DNN A;  2QO3 A;  2X1F A;  1S9F A;  4JV5 F;  1G6B A;  4DL4 A;  3CCV S;  1W2I A;  5GAD U;  2HSE B;  5HBM B;  4LF5 J;  3VAM A;  5KFZ A;  2AX1 A;  2XSJ B;  3NKY A;  4N56 A;  4GKJ J;  5HMW A;  1RYS A;  3DGP B;  3FKB A;  1RCO B;  3QAE A;  2VFS A;  2UUC J;  3MDF A;  2JEF A;  1CLF A;  5ETQ A;  1YZ6 A;  2IA0 A;  4TY8 B;  1HHQ A;  3UDV A;  3AH6 A;  4A46 A;  2BQU A;  2BKO A;  4WXO A;  1NCL A;  1EQM A;  2DJW A;  1U0H B;  4CO4 A;  3BGR A;  3R8Y A;  4KRW A;  2KHC A;  1UVN A;  2OPR B;  1HBN A;  4DX7 A;  1PBA A;  4MIA A;  4K4Z A;  2KN4 A;  2OFG X;  3PCO B;  1RAF B;  4IOB A;  2DHG A;  1NLK L;  4JI0 J;  3K8V A;  4PRF A;  2C2N A;  2XGP A;  4NEY A;  3M8Q B;  5CD4 A;  3HHE A;  4Y2I A;  4QW8 A;  5IXU A;  3CCT A;  3TAQ A;  1WEX A;  2DYA A;  2VPY B;  3IFE A;  1C0T B;  4EBD A;  2CPE A;  1BE4 A;  3QLH B;  2HBZ B;  2X1B A;  3GFZ A;  2N4C A;  1X7V A;  1FKP B;  4LF1 A;  1XQI A;  2YBV A;  3BO3 A;  5IS2 A;  3TQ1 A;  3SSR A;  4JOU A;  1Q1K A;  4RNN A;  1VRU A;  2L9W A;  1JLB A;  4LF9 J;  1SVD A;  2ZVS A;  3L3C A;  2Y1I A;  2RD5 C;  1FDB A;  4J9Q A;  3CD7 A;  5AXN A;  2R8H A;  4F8R A;  5LXY A;  4MJK A;  3H8Y A;  1N34 F;  4IRC A;  3NGD A;  5JVG Q;  1KHV A;  2GJI A;  2PFD A;  3GCX P;  3LGN A;  2WON A;  1VQO S;  3V4I B;  1UKU A;  1NO8 A;  1UVI A;  1RWV B;  3POT B;  2ZH1 A;  2RDD A;  2E9R X;  3C2P A;  2AEJ A;  3EZO A;  2ZJP Q;  1H7W A;  1IKY B;  1TFY A;  3T9N A;  1YJR A;  4YB5 A;  2JNJ A;  1RTD B;  1GFW B;  2LEC A;  1FJ7 A;  4C3K A;  2J9D A;  5BR8 F;  1CJU A;  2VJU A;  3L7P A;  4JV0 A;  5LSR A;  4WIQ A;  2UXD F;  1REV A;  4FBT A;  3QID A;  3R27 A;  2AX0 A;  5A0Y A;  1CS4 B;  2CNN B;  3FBE A;  3PVX A;  3BYP A;  1MU2 B;  1IKX B;  5CYM B;  3CME S;  2X3D A;  4HDG A;  4ZJQ A;  3A8I A;  2Z56 B;  3KHL A;  2GW8 A;  4F4A A;  4FZV A;  1VQ6 S;  3A8J A;  1JLG A;  3QFH A;  1EQ0 A;  4ZHR B;  3HSZ A;  4ETZ A;  4HDH A;  1HI1 A;  1UEV A;  4B9S A;  4WKR A;  4NYO A;  3Q8Q B;  2GGP B;  1I94 J;  1WC3 A;  1S1X B;  2CPD A;  1VCT A;  1R3N A;  4R0E A;  3B4D A;  4CO3 A;  4PAA A;  1RWP B;  3L7O A;  3ZO7 A;  3CC4 S;  2VG5 B;  3IRX B;  4DSJ A;  2CFX A;  2IAJ B;  2KFZ A;  3US5 A;  1TKX A;  1KOO A;  4X64 F;  1KVK A;  1IKV B;  2BJ3 A;  1N54 B;  3MPD A;  2DNZ A;  5KFS A;  3KFW X;  1YJ9 S;  3QQC D;  3DN9 A;  3TEH B;  1VIS A;  2BAC A;  4Y2M A;  4K5R A;  3RBZ A;  4OHW A;  2DO4 A;  2LA4 A;  2V2V A;  1AZS B;  4M5N A;  1TK8 A;  2DH9 A;  3PFO A;  4ZPA A;  4BWJ A;  3CF5 Q;  3PW7 A;  3JSY A;  2FQQ B;  3QNW B;  1HBU A;  3CCL S;  3K8W A;  5KFW A;  5A6W A;  5KG4 A;  3PX6 A;  2UVU A;  3HSG A;  2QE5 A;  1VC6 A;  2VAS A;  1CJV A;  4L3N A;  5HMY A;  2IDE A;  2JL9 A;  3A1Y G;  3PY8 A;  2OTL S;  4HR2 A;  3ETO A;  2CQG A;  4WPA A;  3ZFV A;  2KTQ A;  2YKA A;  2RJZ A;  3THV A;  4PYA A;  4U7U K;  2VUG A;  2YKN B;  2QTW A;  2F65 A;  4J91 A;  4CH1 A;  2YX7 A;  3HCX A;  1TP7 A;  1FX2 A;  1D9F A;  2ALY B;  1FE4 A;  1TR0 A;  2C2M B;  4PXE A;  1OIA A;  1Y5N B;  1NK4 A;  3U1N A;  4ED8 A;  2HFO A;  3TYT A;  2W01 A;  2CNL B;  3BEG B;  2CVI A;  2PT0 A;  3AA8 A;  1KKH A;  3DC2 A;  3MAA B;  4X65 F;  2QLJ B;  5FD1 A;  4C11 A;  2HVH A;  2JDJ A;  4QBU A;  2XI3 A;  1VRU B;  3I32 A;  3SFG A;  1XEZ A;  1LKZ A;  3I5C A;  3I0S B;  3U02 A;  3K59 A;  2Y3Y A;  4CCH A;  2QA1 A;  2QIF A;  4LJM A;  4MK7 A;  2JH3 A;  1MRO B;  2GC8 A;  3NWG A;  2RQK A;  2IIH A;  1N33 F;  4DV1 F;  1JXE A;  2FHM A;  3C3L A;  3EGW B;  2CZV C;  1C2P A;  1FFG B;  3IM9 A;  3AOD A;  3MR3 A;  5GAE I;  4F4K A;  2CQ2 A;  3ZZZ A;  4K0K J;  3LPY A;  1RK8 A;  3RJM B;  1JNR B;  4JV5 J;  3D0G E;  1X9W A;  3DDN A;  4YB7 A;  1RHJ B;  1P9Y A;  1I1G A;  3QAU A;  3IO1 A;  1FRM A;  1K44 A;  1REV B;  2DBB A;  2MLY A;  4P75 A;  3T6B A;  1GXL A;  1HBM A;  1VK3 A;  2QX0 A;  4PG4 A;  3PYD A;  5C25 B;  1SJ3 P;  1YBT A;  1W7W A;  1KLM B;  2J7K A;  1WI8 A;  1O8B A;  1U4B A;  3PKY A;  1FWP A;  1GEH A;  2WVD A;  4F3M A;  3KLF B;  4USH A;  2MZ1 A;  4KPC A;  5KOX A;  4ZIT A;  1JLG B;  4D3H A;  1TVR B;  5DG7 A;  1U25 A;  1A6L A;  3CWJ A;  2P8I A;  3GYN A;  5EDW A;  4TKT A;  3Q24 A;  1HYS B;  2RF2 B;  3PTW A;  3MOJ B;  1FDN A;  4YY3 F;  3LUY A;  4WFZ A;  4UOG A;  3H4D A;  1G1X A;  3OPK A;  1M5K C;  1XNQ F;  2RRA A;  4RO0 A;  2QL5 B;  2UUW A;  3OV7 A;  4NLW A;  3UVJ A;  2PA3 A;  1RXO B;  4LSL A;  3PX4 A;  4N8N A;  1M5H A;  1KWM A;  3AQP A;  2ZJR Q;  5SUH A;  4CYU A;  5KFN A;  4Y00 A;  4C8M A;  3DRX A;  3ZXW A;  3J80 U;  3W5X A;  4O3N A;  4Z7C A;  3AQO A;  1C1B A;  4I6W A;  2WVC A;  1SJ1 A;  4LVO P;  5ETS A;  4X66 J;  3KLE B;  3WX4 A;  3BO4 A;  4XO0 A;  3QJP A;  4DXL A;  3HZG A;  1V5V A;  2E1C A;  2JSX A;  2AJ2 A;  1HBU B;  3DM2 A;  2XG8 A;  3HO1 A;  4LF6 F;  3PDN A;  1CJV B;  4OLP A;  1KBR A;  1WKL A;  1QVG R;  5EN1 A;  5GME A;  1FNO A;  2YPY A;  2IBK A;  4KC5 A;  3FBF A;  1PO6 A;  2HND B;  1I51 B;  3IC1 A;  5BR8 J;  3NOC A;  5ETO A;  4X62 F;  1V9O A;  2DEJ A;  4GO5 X;  3VZI A;  4F4Y A;  1UET A;  1NK9 A;  2O66 A;  4R8U A;  3Q23 A;  3I31 A;  4J9P A;  4OZL A;  2D3U A;  1UVL A;  3H2U B;  4PG8 A;  4DR1 J;  1FES A;  3MWB A;  2HQD A;  3GSD A;  2FZC B;  3IMQ J;  2AEF A;  3DOM B;  4QW9 A;  4OIX A;  4LRB A;  2M0G B;  1UFK A;  1SIZ A;  4PWU A;  2W7A A;  1RBL A;  1B70 B;  1P6T A;  4DCO B;  4ZP6 A;  4USM A;  2HBY B;  4Y2K A;  3DRP B;  1E6V A;  4NLV A;  3BBF A;  1Q0N A;  3MM7 A;  3TWZ A;  5AE3 A;  3V81 A;  3GV5 B;  3AJ2 A;  3PR5 B;  2KH9 A;  3JSM B;  3T6J A;  3VQS A;  1QVF R;  4FVC A;  2G4B A;  3IP0 A;  4MK9 A;  3OVB A;  4X64 J;  4XAK A;  5AJ3 F;  4YQW A;  1RT1 A;  3R7S B;  2CKW A;  3HZE A;  2CQI A;  2BAN A;  3LWM A;  1BC6 A;  1UW4 A;  3ITH A;  3CJK A;  1NH7 A;  3NP5 A;  4DV0 J;  4EYH B;  3HVT A;  3SDE B;  3AT1 B;  4QU7 A;  5CZX A;  2HIQ A;  3M6U A;  1JLQ A;  4A8X A;  2ZH5 A;  1HBM B;  4MT1 A;  4CP5 A;  3BQ1 A;  2KU7 A;  5JXS A;  4ELV A;  1TTH B;  1NKC A;  5L1J A;  1MN9 A;  2DNY A;  3DOL A;  1GNK A;  3VTI A;  4URG A;  3PW4 A;  2LCW A;  2R7O A;  3OR1 A;  3SQO P;  4J7C A;  3FFI A;  1N0U A;  1ZS6 A;  2DGW A;  1IWA A;  3MCN A;  2OH2 A;  3K7R A;  3ISN C;  4WP3 A;  4B02 A;  4DR7 J;  1G3O A;  4UY8 5;  4OL8 A;  3I6P A;  5K9F A;  2A6M A;  1Q53 A;  3UDL A;  2W2M P;  2W8L A;  2VFR A;  2W4C A;  1FX4 A;  3CCQ S;  4J5O A;  1HMV B;  2PEB A;  4LSL B;  4JBC A;  3KKF A;  3VAL A;  4I69 A;  2LDY A;  4PKD B;  3TZX A;  1X0F A;  4RZR A;  5B0G A;  3MR6 A;  2ROE A;  4OX9 J;  1XBW A;  2LFV A;  4HYK A;  2HQF A;  5B0C A;  4OJH A;  4ZVG A;  2FHK A;  2BE2 B;  3D6H B;  1S0V A;  2AZ1 A;  3LAN A;  3PEH A;  3RW6 A;  3G6V A;  2F4F A;  2D69 A;  1BQX A;  3DM2 B;  4DV4 F;  2ASL A;  2JC1 A;  3TAR A;  2NPF A;  4KY3 A;  5DRK A;  2NLW A;  2W9B B;  2Z2L A;  4CTA A;  2NSB A;  4PG6 A;  3HD2 A;  1SPB P;  5DZ6 A;  2CG4 A;  4ZVO B;  2J0W A;  1VRQ C;  3WC2 A;  5J2N A;  3M1V A;  2E5L F;  2OTJ S;  2L9N A;  3FRZ A;  3CNQ P;  3QO9 A;  3L4B C;  4C48 A;  1NND A;  2BMB A;  2J76 E;  3HHN B;  1WDD A;  3FSI A;  3CMQ A;  1JLE B;  2NXC A;  4ZP9 A;  1ACM B;  2QLX A;  1RTH A;  3MEG A;  1H2V Z;  4IQM A;  4F04 B;  3CDW A;  1WSV A;  1U6B A;  2ROG A;  2UVW A;  2CQD A;  3ZZT A;  3D0H E;  1B4S A;  2VOD A;  1E6V B;  2E7V A;  2CYY A;  2BRK A;  1T03 B;  3CW2 C;  2XNQ A;  2MQ8 A;  1WI6 A;  5KT2 A;  3V81 B;  2QSF A;  5HMX A;  4UOF A;  1WHW A;  4ZS6 A;  1M5S A;  3WZ0 A;  3CJ2 A;  2HGM A;  2ZOF A;  2R7W A;  4WKY A;  2PSZ A;  1NRK A;  1CUL B;  2MZS A;  2UXB F;  3DMJ A;  5A8W A;  4C0H A;  3I56 S;  4UW2 A;  5EGY A;  1YVF A;  3CJK B;  3IR5 B;  3ZZP A;  1M5P C;  4YR2 A;  3HVT B;  2ZC4 A;  5MAO A;  2JVR A;  4MFB B;  1JLQ B;  4FKY A;  5E3P A;  4OZ5 A;  3I0R A;  3JTP A;  1TV6 A;  2CIM A;  2RVJ A;  3J81 U;  3EE3 A;  3UR0 A;  1RT6 A;  2Q1L A;  2QMW A;  2VL1 A;  3TJA A;  2WW4 A;  5I3Q A;  2N82 B;  2CNO B;  3D2W A;  4EMD A;  3FFI B;  2VIC A;  1K73 T;  2UVR A;  2GVD B;  2V67 A;  4RWW A;  3THP A;  1WJ9 A;  4YR3 A;  3VGS A;  2ASD A;  4H4K C;  4LRA A;  4E8U A;  4L3K A;  4U67 Q;  1KOH A;  1GX5 A;  4YFU A;  4X62 J;  5F8G A;  4ZCK A;  4L75 A;  2FJW A;  2R7Q A;  4F7V A;  3RBX A;  1OS5 A;  1S12 A;  2AYE A;  4ZPW R;  2MZJ A;  3MPU B;  1S1W A;  4Q0B B;  5HP1 A;  1BLU A;  4LUB A;  4CDI A;  1PC4 A;  5B0D A;  2FZK B;  2XBP A;  4JI1 F;  3G87 A;  4NZ6 A;  1DAR A;  3EXC X;  5E3C A;  4S0M A;  4R0J A;  3OTC A;  1JXV A;  2X51 A;  2ZFH A;  2QL7 B;  2CQP A;  1X5P A;  2Y9H A;  2ZZM A;  3KHH A;  2R7U A;  1VOM A;  1WDT A;  2MKY A;  3OVA A;  4LT6 A;  2OIH A;  3QIP A;  1PYS B;  3IXQ A;  2VZ9 A;  1VQ7 S;  2DY1 A;  3IA0 A;  5AJ3 J;  5A2Q Y;  2VA3 A;  3HVA A;  4QOT A;  2D74 B;  3QFW A;  1CC7 A;  5GAH U;  1G7C B;  5F41 A;  4K7Q A;  1WF1 A;  1NK7 A;  2CUY A;  3N9U C;  4M5I A;  4QYR A;  3VZH A;  3CD5 A;  3TJ8 A;  5F3T A;  3QO9 B;  3J7Z 5;  2HEK A;  2YY3 A;  3Q2T C;  3TUZ C;  1JX4 A;  4AD6 A;  4NLG A;  1RWO B;  4AXI A;  2MZT A;  1X9S A;  4OX6 A;  1RT3 B;  4ZCM A;  1BWE A;  1O51 A;  4QIV A;  5CAB A;  5KFE A;  4EZ9 A;  1U1K A;  3MEG B;  3TAM A;  4DL5 A;  3H5Y A;  1SKU B;  5AXK A;  1SKS A;  2GFF A;  4J90 A;  1SKR A;  2F8M A;  3HFK A;  5D0E A;  3DFE A;  3AOB A;  2LQ9 A;  1OYD A;  2CQB A;  4B9V A;  1NDK A;  2VG6 A;  2VBZ A;  3CJ5 A;  4IO9 Q;  3MM5 A;  2ZNZ A;  2CPF A;  2KFY A;  3DLE B;  2FB0 A;  3AXM A;  4LBP A;  1NKB A;  5AT1 B;  2V94 A;  4TLQ A;  4ZJL A;  2AGO A;  3KK3 A;  1RWW B;  5DM6 Q;  3Q86 A;  4LSZ B;  1DJ0 A;  2Y8Y A;  2FC9 A;  3D67 A;  5CCM A;  2KJV A;  3DRR B;  1RUS A;  3OJS A;  4LIW A;  4C3L A;  3M30 A;  1RAO A;  5KFP A;  4ZPT R;  4EFA C;  4OJG A;  1TV6 B;  5GAG U;  1DQA A;  1FTC A;  3Q89 A;  1LWX A;  4DV4 J;  2E66 A;  5IT9 U;  3DOK A;  1HQ2 A;  4DMZ A;  2F63 A;  2MKK A;  3GQC A;  3JTO A;  2L48 A;  4XK8 C;  1C1C A;  1FRH A;  3CJ4 A;  2AEM A;  3AD8 C;  3EVO A;  4QWC A;  2PFF B;  2OAU A;  1WUU A;  4CLT A;  2LU2 A;  4LSN B;  2GS8 A;  3H5U A;  2B5J A;  2KZM A;  3AJ1 A;  1L3K A;  2G0C A;  3W2V A;  2FVP A;  1RT7 A;  1CSJ A;  1YLX A;  1ICE B;  3JAM Y;  4Q8F A;  2EK1 A;  4DUY J;  3SZ2 A;  2IJR A;  1WKK A;  2HK2 A;  2X1G A;  1J5E J;  5B0F A;  4R5P A;  1L3U A;  1LK7 A;  3NNA A;  4B3M F;  5DDQ C;  2XZT B;  5HP1 B;  1UL3 A;  1BQM B;  4HAC B;  2N4D A;  3ETM A;  5E3A A;  1WC0 A;  2MB0 B;  2ACY A;  3FSY A;  3H5S A;  4ES3 A;  1BGX T;  1DQ8 A;  3LP2 A;  3OR2 A;  5JUM A;  5KFB A;  3DGV A;  1WTF A;  3DXS X;  2YWE A;  5A8K A;  2BOA A;  3DLL Q;  3I55 S;  5D78 A;  4UUX A;  4K4Y A;  3BPD A;  1TL4 A;  5C5J A;  4Q8E A;  4KGV B;  1Y7P A;  1VK8 A;  2HRY A;  4QJV A;  2VPW B;  2PI4 A;  2OSQ A;  3FCW A;  1SXL A;  2GAG C;  4YR0 A;  1KEK A;  2HQC A;  2UXB J;  3LP1 A;  4KV8 A;  3V4M A;  4WZM A;  4PQA A;  2V4R A;  4ERD A;  2HFS A;  3CO9 A;  4OV1 A;  4OQJ A;  2DNP A;  4ZLN A;  2FJX A;  4RW7 B;  1QTM A;  4UY8 T;  2OP5 A;  1ZM2 A;  5LM7 E;  1T11 A;  4NLS A;  1L3S A;  3GJR B;  4PWW A;  1YWX A;  1FE0 A;  2FHO B;  1SUQ A;  3GON A;  3SV4 A;  3MFI A;  5KFD A;  2LDI A;  2CQ3 A;  3QWP A;  3AD9 C;  2Y8W A;  4F25 A;  2MEW A;  2UUB F;  2HHV A;  2APO A;  3S8S A;  2VG6 B;  4F0K A;  2AWZ A;  2DB1 A;  5HL7 Q;  3IS9 A;  1KTV A;  4ZLL A;  1H6K X;  1U6F A;  2JHE A;  1ZM3 A;  2PGC A;  2HHQ A;  3IG1 B;  5K8N A;  4OX7 A;  4E2F B;  1Q95 G;  3KLG B;  2C28 A;  1DTT B;  2B0G A;  3FMW A;  3GFH A;  3TEG A;  3DNC A;  2JEG A;  1U49 A;  2QRR A;  4DFM A;  4AND A;  4K50 A;  2M2B A;  2AGQ A;  4C8O A;  1RT2 A;  2KM8 B;  4IG3 A;  1B0P A;  1V6H A;  4OZJ A;  3PJX A;  2I8E A;  2HFZ A;  4AQY F;  1HNX F;  2F7V A;  2FHJ D;  1JJ2 R;  4M8L A;  3D28 A;  3M30 B;  2VC1 A;  1FDD A;  2DXD A;  2ZZN A;  3BQ2 A;  5D6G A;  3TA2 A;  4MK8 A;  4ECX A;  4WFA Q;  4RW4 A;  1S6P A;  4K2J A;  3U1L A;  1FI4 A;  5KFI A;  2F1F A;  5L9N A;  1NPP A;  2OPP B;  2B4V A;  5L1L A;  3BGL A;  1N5T A;  2ZH9 A;  2RB7 A;  1PYT A;  2IVF B;  2HWI A;  2GAH C;  1HQE B;  3W2W B;  1NK0 A;  4L6V 3;  5J2M A;  2QA2 A;  1AXQ A;  3R3T A;  2A2C A;  4KFB B;  5LT5 A;  4I6Y A;  3KDO A;  2MLZ A;  2QN6 B;  4OI2 A;  4KPY A;  3HI9 A;  4C4W A;  3CIM A;  3MM8 A;  3HMJ G;  4Q7A A;  2VU5 A;  4NCG A;  3U27 A;  4KKO B;  5C42 A;  1IQZ A;  2VF3 A;  4QWD A;  2R7T A;  1HWI A;  3UN5 A;  2WBM A;  1SKW A;  2IM2 A;  3OR2 B;  2DPJ A;  2YNF A;  2Z8Q A;  4PWD A;  7FD1 A;  2XMK A;  2JEJ A;  3HM9 A;  4LMZ A;  3PR4 A;  2WK4 A;  3CCM S;  4NLY A;  4OYA A;  4TU7 A;  2CJB A;  2V8H A;  3PX0 A;  2HAI A;  4RU9 A;  3GIK A;  3P6Y C;  3MI7 X;  1LFP A;  4RUA A;  3W3S A;  2KDO A;  2CWX A;  3R97 A;  1SJR A;  2PN6 A;  3DCA A;  1L3T A;  5B08 A;  3LP1 B;  3M2V B;  4RW6 B;  1WKJ A;  4ZMM A;  3RYL A;  4DQQ A;  1SH0 A;  4Q43 A;  1W2B R;  3NEK A;  3G8S A;  3R5A A;  4DBQ A;  2OMO A;  2E5H A;  3UFC X;  2UUT A;  1JK9 B;  2HZC A;  1HNZ F;  3HDS A;  4KJI A;  1X0P A;  2O3D A;  3HPO A;  3CDA A;  4OLO A;  1T94 A;  4XTT A;  3R5B A;  5IFM A;  5L1I A;  3W66 A;  4DS4 A;  2R2U A;  3CXC R;  4X4R A;  1TL7 A;  5JVH Q;  1AB8 A;  4DU8 A;  5IV3 A;  4M5J A;  4NX9 A;  2ASJ A;  1KSP A;  4F4Z A;  4M94 A;  2BDP A;  3E01 A;  2ZC3 A;  2HVZ A;  1NDL A;  2BVZ A;  2HNY A;  5C7P A;  2FHJ A;  4DL2 A;  1UWB A;  3NWR A;  1RU1 A;  3FEZ A;  3R6L B;  2A3J A;  2DIU A;  1U1O A;  3AB2 B;  4I6A A;  3QMQ A;  2UV8 A;  3DDK A;  2O5D A;  1NK5 A;  1U2C A;  2V63 A;  1DQ9 A;  1TKZ B;  5DG9 A;  2V50 A;  1FVS A;  1X31 C;  2K1R A;  1PC5 A;  1QE1 B;  1NSA A;  1XIQ A;  3H42 A;  4B3M J;  2XCA A;  3RRH A;  1P8G A;  5A8R A;  3LP0 A;  2CJA A;  1PGZ A;  2R7V A;  2EI5 A;  1RT2 B;  2E1M C;  4JI8 F;  4NRT A;  2QA4 G;  3D5M A;  1GTE A;  3R2C J;  3DLG A;  4IH5 A;  4LF8 F;  3UQS A;  4RL1 A;  1VBY A;  4USJ C;  2AYM A;  3TA1 A;  2H5I B;  2W9A A;  2V4Q A;  1VJQ A;  4FBU A;  2ZDO A;  2VHG A;  4ZPD A;  3OL7 A;  4NLR A;  1NPR A;  3M8P A;  3CJT A;  2PMH A;  1SJ4 P;  2CPY A;  2M88 A;  3UCU P;  4JI4 F;  4NLP A;  3J7Z T;  4YHH F;  1S6P B;  4GVB A;  2DGT A;  3KLI B;  1YDL A;  5G0R A;  1P1T A;  2GNK A;  4D3G A;  2HHT A;  2VPX B;  2E1P A;  2ZUG A;  1X4H A;  1VQK S;  3MCO A;  3MUV P;  1XNR F;  2ADB A;  4I2Q B;  4IR9 A;  3MF5 A;  1S1V A;  4LRC A;  2MZQ A;  3PJ9 A;  1VI7 A;  1OO0 B;  4NPO A;  4JI2 F;  3MAQ A;  2CRL A;  1UFL A;  5GAE U;  2ZOM A;  1MG7 A;  1XJW B;  1R7I A;  2YWG A;  1Q8I A;  5DLG A;  2P9G A;  1F2H A;  2CPI A;  3KLV A;  4N5S A;  3RBD A;  3MM8 B;  2NPI A;  1OY8 A;  2XZW A;  4ZVR B;  1VYA A;  1SC4 B;  1HLW A;  2CG8 A;  4KHP J;  1RT4 A;  4IRD A;  1S99 A;  1SL1 A;  1NKE A;  5M2U A;  1HI0 P;  1PKU A;  5C42 B;  4MIW A;  1IM4 A;  1S1T A;  4P2X A;  1HWL A;  4HI2 A;  2B51 A;  2KT3 A;  2UUB J;  1N48 A;  3TUP A;  2JX2 A;  1TKT A;  3GYX B;  4LFC F;  4BC7 A;  4M5L A;  1BMQ B;  2VPZ B;  2EFV A;  2WVB A;  1LWC A;  4W92 B;  4F0H A;  4U8Y A;  4KGX B;  2ATL A;  2YNH A;  4ZPC A;  4ES2 A;  4FYY B;  4LR7 A;  2LEB A;  4EEY A;  4OHY A;  2PD1 A;  5IQ6 A;  4CLW A;  1NAQ A;  4HTI A;  1RAH B;  1RWX B;  2HVI A;  2HLT A;  1RT5 A;  1HHT P;  1RKJ A;  4QIE A;  2GIF A;  4A8F A;  2KM8 C;  4TYA A;  4UZB A;  2PO4 A;  2H4W B;  4ZVU B;  5T41 A;  1T7P A;  2OEM A;  1RAI B;  2HZV A;  3G71 S;  3CJR A;  1XK8 A;  2W4P A;  1LWF B;  1TL7 B;  2J6S A;  2CQH A;  1NEE A;  2EBG A;  4AXJ A;  5ETK A;  1VQ9 S;  5KFR A;  2RQ4 A;  5L39 A;  4F3O A;  3MAH A;  1ZPV A;  2WVF A;  5HMZ A;  2B6A A;  4P73 A;  3ISZ A;  1UWB B;  1QM9 A;  1KON A;  1PYO B;  3V5R A;  4USI A;  4PPZ A;  5FLX U;  3BSA A;  1Q82 T;  3TI0 A;  4I2P A;  3PXG a;  4DN0 A;  3DLJ A;  3MM6 B;  4HL9 A;  3A8E A;  2K1R B;  8ATC B;  1RP5 A;  5KFY A;  4HI1 A;  1XC9 A;  4ED7 A;  4C98 A;  4UOH A;  4FN5 A;  3ENA A;  2H3E B;  2NYH A;  2X7I A;  4I7F B;  3IWL A;  4DR5 F;  5DZ7 A;  3GJQ B;  1YK9 A;  1MWZ A;  3DLG B;  2VFV A;  4RU2 A;  1HW8 A;  2NUU G;  3AY0 A;  2RQM A;  2NQP A;  3HHD A;  4NLU A;  4AE5 A;  2W7P A;  4ID5 A;  4FYV B;  2J9C A;  1N56 A;  2FJV A;  2DY9 A;  5IOL A;  3ONQ A;  2WZ1 A;  3ENW A;  3MEC A;  3M6W A;  2NRE A;  3OFE A;  2DGQ A;  1YX2 A;  5G0R B;  2HFU A;  2QMU B;  1R8P A;  5KG7 A;  3G4S S;  2W9C B;  4B9L A;  4Y2A A;  2AJF E;  2ZM6 F;  3C19 A;  1ZAV A;  2KRB A;  1TMM A;  2GQQ A;  1C4A A;  1FRL A;  2YH0 A;  1NK6 A;  2I38 A;  1YG0 A;  1S1V B;  1MW7 A;  1S7H A;  4W90 B;  4WWS A;  5AE2 A;  2LVW A;  4B9M A;  4ZP7 A;  3D6F B;  3VVT A;  5KFX A;  2P6T A;  3OTO F;  3PFE A;  4A8M P;  1FNX H;  3C6T A;  1RCX B;  4NLQ A;  2HMI A;  1XTZ A;  1U1R A;  2OHD A;  1X5S A;  4QIW D;  5E2Q A;  1WHV A;  2Z2Z A;  2KXH A;  3WIV A;  2DTJ A;  2O67 A;  4P71 A;  1WOP A;  2WBR A;  5EX0 A;  2DCL A;  3KMS A;  4ECY A;  1S48 A;  3RR7 A;  3KK2 B;  2R8K A;  3W61 A;  4M5D B;  1JJ4 A;  4ZIV A;  3R7N B;  3MZI A;  1TKT B;  1FDA A;  2MQQ A;  1VLO A;  1OMS A;  1RAC B;  4OI0 A;  2HS4 A;  2DNQ A;  2XC9 A;  5D3G A;  2DO0 A;  4P6Q A;  2AQ4 A;  1LWC B;  5J1P A;  4ECU A;  4ZVP B;  1HPZ A;  2FVC A;  4K4S A;  2F3J A;  1N88 A;  2EPI A;  2VKZ G;  4BCA A;  3D1O A;  2IYI A;  2HHX A;  2HK3 A;  4FNI A;  4LRD A;  2H51 B;  4PG5 A;  4JI8 J;  5KFQ A;  5KG6 A;  4IFY A;  4JYA F;  4ED5 A;  4LF8 J;  3MOZ A;  4ANC A;  1N32 F;  2I6W A;  3VQT A;  4I56 A;  4DV2 F;  1H38 A;  2KJW A;  3M2U A;  5IT0 A;  1AUD A;  2DHH A;  3C14 A;  4UF4 A;  3W64 A;  4O3S A;  4FF3 A;  1FNM A;  4Q2L A;  4RUC A;  4DDF A;  4DV7 J;  2Z2M A;  5IV4 A;  2VQE J;  1GXU A;  2RKI B;  2B43 A;  1IM6 A;  2XS7 A;  1X8D A;  3UPF A;  4G1Q A;  1SL2 A;  1S4F A;  4TNO A;  1YIT S;  1UA0 A;  1JLF A;  3DLK A;  3IBF B;  3GPA A;  1ZA2 B;  3ILJ A;  5LMN F;  1N6Q B;  1RA6 A;  2M9K A;  3TVZ A;  5HI7 A;  4C0B A;  2LQ5 A;  3AFG A;  2IM1 A;  1FXR A;  2EKY A;  3L9Z A;  3HSJ A;  3KJV B;  5CYJ A;  4PXC A;  5HBM A;  2EC2 A;  4NI2 B;  2DR5 A;  4WE1 B;  2V8P A;  4MTP A;  1KQS R;  1T9T A;  1WG5 A;  2BE9 B;  2WTF A;  3C16 B;  1CQN A;  1HD0 A;  3DYA A;  5KG0 A;  3M8R A;  4QR2 A;  3CDU A;  2XSJ A;  5EUH A;  2W2P P;  2Q3P A;  2DD8 S;  2ACM A;  3DGP A;  3ZC4 A;  1MNE A;  2V9W A;  3D66 A;  2BKN A;  2JZ5 A;  4FPR A;  1NB7 A;  2M52 A;  3MEC B;  4TLR A;  1U0H A;  4PAB A;  5FDL B;  3NMR A;  2J5A A;  2OPR A;  5E0O A;  3THT A;  2MST A;  1M0S A;  1F5C A;  3H0P A;  4ZA1 A;  3MPV A;  4ZVH A;  1X5T A;  1R8B A;  3ILL A;  3RB0 A;  1DTQ A;  1ZZF A;  3PG9 A;  4NA2 A;  1BY9 A;  3RG6 A;  1C0T A;  4WFN Q;  3SCI E;  1KDN A;  3CDE A;  4X4Q A;  1EKR A;  1QLN A;  2JC0 A;  1S72 S;  3H59 A;  1FKP A;  3HLU A;  1Y3K A;  2HW3 A;  2OPS B;  2YQ3 A;  3AJD A;  4URS A;  2Q6C A;  4XDD A;  5LMU F;  4QWA A;  4ZPB A;  2GZO A;  3FBB A;  4DCJ B;  4NLD A;  3LWL A;  3CCR S;  2QL9 B;  3SMZ A;  3GV8 B;  1S7I A;  3HFZ B;  4B3T F;  2LMI A;  3UI3 A;  3LAM A;  3MUM P;  1RAA B;  3KHG A;  1HNW F;  2LQJ A;  4O0I A;  1APS A;  1S4E A;  2UU9 F;  4DFJ A;  2SXL A;  4I64 A;  3JTN A;  1NUE A;  2LU1 A;  4IYQ A;  1AT1 B;  2N3L A;  3V4I A;  1MSW D;  4IFV B;  5HQM A;  3POT A;  4DUT A;  3RAX A;  1X9M A;  4IDK B;  3MFH A;  9RUB A;  5LSO A;  1H73 A;  4NXN F;  2V34 A;  2LKZ A;  4OJ1 A;  1RTD A;  1NME B;  1HWK A;  3QGP A;  3BYR A;  3QT7 A;  3HX9 A;  1Z2Z A;  4MKY A;  1SJF A;  1S1U A;  3ZNU A;  1L3V A;  2YNG B;  1VQP S;  1EAY C;  4DR3 J;  2DPI A;  1FRK A;  1CS4 A;  2AGP A;  4ELT A;  1RTI A;  2I1R A;  3CCZ A;  5KAK A;  2HLU A;  3H5X A;  1YQH A;  1U1L A;  1IKX A;  2YTC A;  5CYM A;  1RU2 A;  1AFI A;  3C14 B;  3PW2 A;  2H4Y B;  2MJN A;  3Q83 A;  1DZ5 A;  3LGM A;  4WK3 A;  3VAH A;  1ARO P;  2NYI A;  3EPG A;  4ZHR A;  1AUS L;  1U1P A;  2EG2 A;  3H4B A;  2J6U A;  5DDP C;  2GGP A;  2KYZ A;  4GKK J;  3QGH A;  5KG3 A;  3NGR A;  4ZVQ B;  3VCD A;  4Z37 A;  4ECS A;  3MMA B;  2ROP A;  1QAJ A;  4LVN P;  2VG5 A;  3IRX A;  4LFB J;  1U6Z A;  4ECT A;  1JLF B;  3LQV A;  2DRD A;  1Z4U A;  2RIJ A;  3RRK A;  2W8K A;  3HP6 A;  3OTO J;  4RNM A;  4F2S A;  3LTO A;  1IKV A;  3JXO A;  2FPH X;  4C8K A;  1GX6 A;  2ZEJ A;  1VHF A;  4DV6 J;  2G9O A;  4MKV A;  1PJ6 A;  5K14 A;  5I3P A;  3T41 A;  4DUZ J;  3G86 A;  4ECZ A;  2NZC A;  5F0W A;  3DYA B;  4A47 A;  2KVQ E;  1AZS A;  1IR2 A;  3BKT A;  3N28 A;  2P9C A;  2YPZ A;  4OHV A;  3FZ2 A;  1PJ5 A;  2HBQ B;  3BV8 A;  1HL6 A;  4Q2M A;  3OXG A;  2VG7 B;  1T9W A;  2WRM A;  3Q8U A;  4RW8 A;  1GMW D;  2GVZ B;  4B17 A;  2IA6 A;  1K1S A;  4HHH A;  4J37 A;  4TU9 A;  1JLC B;  3K5N A;  4AL7 A;  4UUW A;  1WC6 A;  1ITP A;  4DN9 A;  4FPI A;  3PYE A;  4JI3 J;  2ZD1 B;  4JYA J;  2YKN A;  2DR9 A;  4KHM A;  4RNO A;  1N32 J;  1DTQ B;  2HHH J;  2G2Z A;  3UCG A;  3G82 B;  2QLB B;  3B54 A;  3NL0 A;  1JKH B;  4M1K A;  3KTQ A;  1YJ7 A;  3MXH P;  3RRG A;  2GMH A;  5GMD A;  3C15 B;  4ZN1 A;  4DU7 A;  2HKE A;  3MAA A;  3H90 A;  4Y28 C;  1S0O A;  3U7J A;  4X4T A;  4A48 A;  3HHL B;  1XWL A;  3J7Y I;  1GQE A;  3I0S A;  2MY8 A;  4EGL A;  2MDA A;  5ETV A;  4YP3 A;  1RWN B;  2C2D A;  4WXW A;  4OHZ A;  3BZQ A;  1EJ7 L;  1MRO A;  3ZZR A;  1UTA A;  2EVZ A;  2DEI A;  2EFQ A;  1L5U A;  5DDO C;  2H54 B;  5DLF A;  5LMN J;  4E0D A;  3D4J A;  2D1C A;  4KIA A;  1U2R A;  1TQL A;  3T1Y J;  3BN7 A;  3W8G A;  3PKM A;  2MJU A;  2HRT A;  2FUG 9;  1S9E B;  3NCQ A;  4PQU B;  5KFT A;  1UVM A;  4YS2 A;  2LA6 A;  1HW9 A;  5C24 A;  1GK8 A;  2GA7 A;  1FTR A;  2P6S A;  3ADA C;  3PNI A;  1P9Q C;  1B64 A;  4A8W A;  1RHQ B;  2V9K A;  2DRA A;  3PRD A;  5IWA J;  1S1U B;  1S6O A;  2ZBI A;  5AXL A;  3T19 A;  1RTI B;  5C25 A;  3E8O A;  2EW9 A;  1KLM A;  2HHW A;  4TQS A;  5EX3 A;  1X4F A;  1I5O B;  5DQI A;  5U47 A;  4DFP A;  2Q6B A;  3KLF A;  2HHS A;  1XMB A;  4UZC A;  4DQS A;  2ALZ A;  1GTH A;  1TVR A;  1V3R A;  1W25 A;  1DHM A;  5HK4 A;  3BGO P;  4JI7 J;  1RB0 A;  4WP9 A;  1HYS A;  1RTJ B;  2RF2 A;  3PYF A;  2B8P A;  2G0I A;  4F3Q A;  1YZ7 A;  3EM1 A;  4CIO A;  5F8M A;  2XGQ A;  2KKH A;  4DR4 J;  3DHW C;  5THW A;  4CNY A;  4NRU A;  4O0N A;  1YJU A;  2BJ7 A;  2FD2 A;  5A2Q U;  2VA2 A;  1GMW A;  4J9N A;  1FFS B;  3QAT A;  2G2O A;  5LMU J;  1VQM S;  5K14 B;  2XS5 A;  4NE9 C;  4CLY A;  4LRE A;  3GMG A;  1QY7 A;  2RU9 A;  3NGU A;  1SJQ A;  3KLE A;  1XMO F;  2IC3 B;  1VQY A;  3V6K A;  4B3T J;  4X4U A;  2E5I A;  3GB0 A;  3JS9 A;  2AKW B;  2DGS A;  1A7G E;  1UEK A;  3J81 Y;  5DM7 Q;  4H4M B;  3R6G B;  3QT8 A;  5J2P A;  4NL5 A;  3G8Q A;  5EWE A;  2OUG A;  4RW8 B;  3LA0 A;  3ZTR A;  4H4K A;  4LF7 F;  2HND A;  3W63 A;  4DF8 A;  5ETR A;  4U8V A;  4PUO A;  2FJA B;  1JJC B;  2F4V F;  3B82 A;  2XSF A;  4K4T A;  3MEK A;  1RWK B;  3DRS B;  5DGA A;  3RB6 A;  1NDP A;  3ZZY A;  1RJJ A;  4F36 A;  1BQN A;  1TAQ A;  3SSS A;  1WHY A;  3JB9 k;  4W98 A;  3A4T A;  1PJ7 A;  3VGU A;  1PCA A;  1FHT A;  3CUL A;  3L95 X;  4DR2 J;  4ZK7 M;  3WC0 A;  5J2Q B;  4JV2 A;  2EWH A;  2FJB B;  2LYV A;  2EFO A;  3ZTP A;  2FJE B;  2YQ1 A; 
#chains in the Genus database with same CATH homology
 4CLY A;  4OYI A;  4UST A;  4CM0 A;  1TL7 B;  4CLZ A;  2GVD A;  4OYZ A;  3G82 A;  2GVD B;  2WZ1 A;  4P2X A;  3R5G A;  3G82 B;  1FX2 A;  4CLL A;  3C15 A;  4CLS A;  4OYW A;  1TL7 A;  2W01 A;  1YBT A;  1Y11 A;  3C15 B;  4OYO A;  1AB8 A;  5IV3 A;  1CJU A;  3MAA A;  1CJU B;  3MAA B;  1WC1 A;  4WP3 A;  1CS4 A;  1AZS A;  1CUL A;  4P2F A;  2BW7 A;  4USV A;  1CS4 B;  1CJK B;  1CJV B;  4NI2 A;  1AZS B;  1CUL B;  3MR7 A;  5D0H A;  5D0R A;  4WP9 A;  5D15 A;  4USW A;  3C14 B;  3C16 A;  1WC4 A;  4NI2 B;  1WC0 A;  4OYA A;  3C16 B;  4P2M A;  4OZ3 A;  4CLW A;  1FX4 A;  4USU A;  3ET6 B;  4OYM A;  4CM2 A;  5D0G A;  1YBU A;  1CJK A;  2GVZ A;  4CLU A;  1CJV A;  1Y10 A;  4CLF A;  2GVZ B;  3C14 A;  1CJT B;  4OYX A;  1YK9 A;  1WC5 A;  4OZ2 A;  4OYP A;  1WC3 A;  3ET6 A;  2QV6 A;  5D0E A;  1WC6 A;  3UVJ A;  4CLP A;  4OYB A;  4WPA A;  3UVJ B;  1U0H A;  1CJT A;  5IV4 A;  1U0H B;  4WP8 A;  4CLT A;  4CLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...