1IQTA

Solution structure of the c-terminal rna-binding domain of heterogeneous nuclear ribonucleoprotein d0 (auf1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords heterogeneous nuclear ribonucleoprotein D0
publication title Structure of the C-terminal RNA-binding domain of hnRNP D0 (AUF1), its interactions with RNA and DNA, and change in backbone dynamics upon complex formation with DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1iqtA00
2RVJA 2K8GA 4J5OA 1JJ2R 3FEXB 2MSSA 2EVZA 2LA6A 1QM9A 3UCZP 1N54B 5DDOC 5CXTA 2KXHA 1WI8A 1FJ7A 4U67Q 2DHSA 2LMIA 2QEXS 2DNQA 2E5GA 2M8DB 2RT3A 1RK8A 4F25A 2CPFA 2MGZB 1JJ4A 3J7YU 1ZZFA 2D3OR 5IQQA 1WG4A 3VAIA 1DZ5A 1U6BA 3U1LA 2MQQA 3OW2R 3UCGA 2DHGA 2DO4A 1M5KC 2CPXA 1KD1T 2GO9A 1VC6A 3CTRA 2OJ3A 2CQBA 1NU4A 1HD1A 2DNOA 2RS2A 1U2FA 2DNYA 2DB1A 2E5JA 5ITHA 2VOPA 3VAHA 2FC9A 2JVOA 3CD6S 3UD3P 2MY7A 1QVGR 2U2FA 1WHXA 4WCEQ 2DGVA 2I2YA 4CH1A 2FC8A 3EGZA 2U1AA 2AYGA 3MDFA 1WG1A 1WEXA 2LXUA 2KG0A 3JB9k 1X4AA 1FJEB 1Q86T 3G9CA 2J76E 1M1KT 2DNPA 3NMRA 1M5VC 2CPJA 1M5PC 1SJFA 1DRZA 4UQTA 1F9FA 1WEZA 3THTA 3UD4P 1L3KA 2F9JA 4A8XA 3CCVS 3CPWR 1FO1A 4M5DB 3TYTA 5GAEU 2N7CA 2D9OA 1KOHA 4CH0S 4WFBQ 2VODA 1XN9A 3VF0B 4QU7A 1U1PA 2DNGA 1X4GA 1VQNS 3CCRS 4WFAQ 1U6FA 4C7QA 1P1TA 2OTLS 1URNA 2HGNA 2M7SA 2DHXA 4Y0FA 1RKJA 1JJHA 3VAMA 1N88A 2KU7A 3S8SA 2MPUA 2LECA 3MURP 1M5OC 5LSOA 2SXLA 1UFWA 2XS2A 1Q81T 1K8AT 1H2TZ 2G0CA 2MSTA 2CPZA 3MUVP 3G71S 4F02A 4QQBA 3NNHA 3NNCA 3CCES 2YKAA 3D2WA 2ZJPQ 2KRRA 2KN4A 1ZH5A 1K9MT 4UY8T 1VBYA 1D9AA 3I55S 4P6QA 3VAGA 2E5HA 2N3OA 2M70A 2HVZA 2CPDA 3HI9A 2Q79A 3IRWP 2M8HA 1A7GE 5LXYA 1WG5A 2RNEA 3VALA 4IOAQ 2D9PA 2KM8C 2DNMA 2MHNA 3UWTA 2DISA 1JMTA 1HL6A 2O3DA 3MI7X 4IOCQ 2LKZA 1K73T 2MKJA 3CF5Q 2NLWA 5LJ5Y 4PKDB 1VQKS 2N3LA 2FY1A 1A9NB 3BO2A 1UP1A 3TP2A 2DH7A 3BS9A 4EGLA 4TU7A 1WF1A 3UE2A 3MXHP 1WWHA 1P27B 2XB2D 2JX2A 2JVRA 3IWNC 2LXIA 1D8ZA 5IFMA 2CQ2A 2BZ2A 3G8TA 3UCUP 2M52A 2OIHA 2DIUA 2DK2A 1BY9A 1SJRA 3PIPQ 2DO0A 1WI6A 2CQIA 1Q82T 4PRFA 2KHCA 3G6ES 2KH9A 4IUFA 3NS6A 5JVHQ 1U1RA 2CQGA 5CA5A 3EX7B 1M90T 2B0GA 3FEYB 2CQ4A 1N8RT 1YITS 1VC0A 1DBDA 2J8AA 1H2UX 3CC2S 1X5OA 1H6KX 3CMES 3CCMS 1HD0A 2JRSA 1X4HA 2XNQA 1U1KA 1NO8A 2DGSA 2M9KA 2AD9A 2MB0B 2K3KA 2M2BA 5GADU 1WTBA 5GMKa 4TU9A 5DM6Q 2RRAA 2YWKA 3B4DA 3CCLS 2QA4S 2X1FA 3EGNA 2F9DA 3Q2SC 2FHOB 2A3JA 2DGQA 1X5PA 3US5A 1U1LA 4C4WA 4WKRA 2X1BA 1VQ5S 2J0QD 1YWXA 2ZJQQ 3SXLA 2MQNA 2BOPA 4YOEA 3CMAS 1H2VZ 4WF9Q 2MKHA 1U1OA 2MKIA 1OO0B 3CXCR 2ADBA 1X4CA 3S01A 2LQ5A 3BO3A 1VQ6S 5D77A 5GAHU 1IQTA 2RQ4A 1WHVA 3B4MA 3SMZA 2CPYA 2V94A 3LQVA 1WF0A 3THPA 2KRBA 5IM0A 2M0GB 4YB1P 1R8PA 2MQLA 2MZTA 2DHAA 1VQLS 1Q7YT 2CQDA 2RRBA 1OIAA 2DNRA 4IO9Q 1PGZA 1KQSR 2MZSA 1YJ9S 3DXBA 2DNKA 1WHWA 3P49B 5EN1A 3N9UC 2ZJRQ 3RW7A 2LA4A 5H1SV 2KI2A 3MD3A 2XSFA 1VQ4S 4OZ1A 3MD1A 3G8SA 1OWXA 2PE8A 3HHNB 1U1NA 5DETA 1ZZNA 2DGOA 1U1QA 2MZQA 2MXYA 1HA1A 4ED5A 2CPIA 2EK6A 4QU6A 2HGMA 4OZ0A 2KFYA 1WF2A 1N52B 5GVQA 1VBZA 2LEAA 2X1GA 2OTJS 1VQOS 2DIVA 1X4FA 2MZRA 1X0FA 1YI2S 5DM7Q 1WHYA 2L9WA 1NJIT 2MMYA 2XS5A 1W2BR 1SXLA 2YH1A 2NZ4A 1X4EA 5D78A 3S6EA 2KM8B 4Z2XA 5DDRC 1VQ7S 3ZZYA 2CQHA 3NS5A 3MUTP 3V4MA 1YHQS 3VAKA 2MKKA 2LEBA 2VOOA 2DGXA 2DGTA 2DNLA 5IM0B 2HGLA 2MQMA 3L3CA 1G2EA 2CQ0A 1FT8A 2VONA 1CVJA 3R1HA 2XNRA 2OSQA 3CCQS 1FJCA 2MJUA 5DDPC 3P3DA 2J0SD 2MYFA 2DGUA 3ULHA 1VQPS 2AYEA 1SJ4P 2HYIB 5HO4A 1FNXH 1U1MA 4ERDA 1KC8T 4W92B 1SJQA 3VAFA 1AUDA 2LCWA 2L41A 4FXVA 1WELA 2RQCA 1S72S 1YTYA 3NNAA 1R8HA 2DH9A 2DGWA 2DNNA 4FXWA 2EK1A 3I56S 2KXFA 3DLLQ 5HL7Q 3CCJS 1S79A 5MLCV 4LMZA 1VQMS 3K0JA 2OSRA 2RU3A 1VQ9S 2GHPA 4LIRA 1VC5A 1B7FA 1X4BA 3P5TL 2I38A 2DITA 2KG1A 2LYVA 5JVGQ 2DNHA 2MKCA 1X5TA 2RS8A 2MZJA 4Y00A 3CUNA 3BO4A 3RW6A 4WIIA 4QPTA 1FXLA 1WEYA 1X5SA 2MKSA 2RUGA 2MJNA 2KXNB 2KT5A 2QFJA 4F26A 5CYJA 1OPIA 2DNZA 5GAGU 2ERRA 2N82B 3SDEA 3LPYA 1DHMA 2PEHA 3CC7S 4PR6A 4YUDA 1FHTA 1VBXA 3R1LA 2M88A 2HZCA 3TO8A 2MQPA 2CJKA 3S7RA 3PIOQ 2CPEA 2MQOA 2WBRA 1KOOA 5LJ3Y 3CCUS 4CQ1A 5DDQC 2KVIA 2MY8A 3CC4S 2FPHX 4RU2A 3J7ZT 3BEGB 2MGZA 2E44A 2L08A 3CCSS 2UP1A 3MOJB 4BS2A 2G1DA 2ADCA 2AYMA 1YJNS 1QVFR 2CQCA 3P6YC 2X1AA 3G96A 5LSLA 3MUMP 5FJ4A 1YJWS 3R27A 2F3JA 2XS7A 1O0PA 4TLQA 3ZZZA 2AYBA 1UW4A 2MZ1A 2YH0A 3G4SS 3VAJA 5BJRA 3U1MA 4TU8A 4V19X 2CQ1A 2E5IA 4C0OC 4W90B 4CIOA 4ZKAA 2CQPA 2DH8A 1VQ8S 2G4BA 2M4MA 1SJ3P 3H2UB 4LJMA 1PO6A 5LXRA 3CULA 1UAWA 2YTCA 1X4DA 2KYXA 2JWNA 3H2VE 2CPHA 4WFNQ 1YIJS 2CQ3A 3Q2TC 3SDEB
chains in the Genus database with same CATH superfamily
1PILA 2VUGA 3FEXB 2HFUA 2MSSA 3ETMA 3H0PA 2ZH4A 4ID5A 3GONA 3R3TA 4DV1F 4P71A 2R8GA 5K8PA 1F3VA 4X62F 4NLXA 4OV6A 3DRSB 4WWSA 2GO9A 5B0BA 3CJKB 4JBCA 4K50A 5IV3A 5GAEI 5FIIA 3HMJG 4ECRA 1QVGR 2CNKB 1QD1A 2DGVA 2I2YA 3JAMU 1L3SA 2NQPA 2DNPA 5HI7A 1VDHA 5IOLA 1M5VC 1TKXB 2AWZA 3MEKA 1F9FA 4DN9A 2AX1A 3EE3A 3M8YA 1O8BA 1LKZA 4RX6A 3SQOP 4CH0S 2P9CA 1V3SA 1J2VA 3X1LB 2BANA 3DHWC 1WC1A 4MT1A 2HK3A 2GX8A 3E2EA 5DQIA 4F4WA 1PC5A 1F1BB 1VK3A 4NI2B 5HVGA 2RB7A 2MSTA 1NK6A 3QYYA 1TVRA 1SL0A 2XTJP 4ALZA 5KTQA 2WB4A 2FJVA 3DRYA 3A8JA 3IXQA 2FZCB 3SSRA 4FKYA 4LF5J 1QLNA 1FEEA 1J5OA 2D9PA 5E3QA 5ETPA 1N56A 2VBWA 3HHLB 2V69A 3AA8A 3PYDA 4O23A 3UW1A 1R0CB 4U8YA 3PEHA 3R5GA 4N8OA 4YB5A 3EICA 1N48A 4FYXB 3IWXA 2M52A 4LIWA 3Q24A 1CBKA 4JI2F 3PIPQ 4LF9J 5KFSA 1WI6A 2OMLA 2Z0GA 1XTZA 3OR1A 3RGIA 3M8WA 3QT7A 2VQEJ 1APSA 1RACB 4DV7J 3V6DB 3CMES 4B08A 2GGPB 2A6MA 3J7A1 5DM6Q 4AUKA 2AJ1A 3CDEA 4U96A 1MSWD 4EBDA 4B9NA 3MM6A 4M1KA 1X5PA 2BQ3A 4DFJA 4CCHA 1VQ5S 2CWKA 1RYRA 1RWXB 1YRTA 2Z2ZA 1N5VA 4AYBD 1WC5A 2MKHA 4OQJA 2AZ1A 2HNZB 2YNIA 2R7UA 2C2RA 1T11A 1Y7PA 1VQLS 1NDCA 4IO9Q 1PGZA 1S9GA 1IWGA 2IVYA 1BHNA 1GAOA 4FYWB 1RXOB 2XMUA 1P9YA 2GMJA 3G8SA 2BE2A 1ZM9A 3I0RB 3B8HA 1N34F 1RT7B 1FF2A 2HGMA 3OBIA 4NE9C 5JMNA 1VHIA 5DM7Q 1T05A 5HK4A 4DR4F 2YKOA 3IA0A 1RT2A 3QT8A 1RKIA 5J2PA 3ITHA 4F36A 2VOOA 2GVZB 1NMEB 3PJXA 1RWMB 4TLRA 3W2VA 3IP0A 2F63A 1AUSL 2P5VA 4IYQA 2QT7A 4MK7A 3M8SA 5HJYA 2QL9B 1T02A 1YTYA 4DX7A 2JEFA 4URSA 1SC1B 2EK1A 3DLLQ 2HQDA 1IKVA 2FHJD 4LMZA 4LR9A 2OSRA 4DCJB 4KFBB 3P5TL 4E98A 3KOAA 1ZPVA 2PEBA 2N7YA 3RAMA 1UZHA 3B78A 2O67A 4OZ3A 3NGRA 1PJ5A 3UDLA 5CYJA 1S0VA 2N82B 3PHEA 3MM7B 3ZXWA 3T9NA 2Y8YA 3TO8A 3PIOQ 3BH6B 2XYPB 1S77D 4PXCA 4K4XA 4EBEA 2BACA 2CJ9A 4A8QA 2DR8A 4RW8B 1SQEA 5T7LB 3W8GA 2CADA 3VGUA 1PC4A 2XY5A 2ABYA 2FJDB 3GV7B 3PHTA 1T94A 1RU1A 1J27A 3U1MA 1OY6A 4Y2KA 1C1BA 4AE5A 4CYUA 5J1EB 1RYSA 1ZBTA 3D28A 1LW0B 3TZYA 3D3CJ 2AGPA 4ZJLA 1LXJA 4M5NA 1VQSA 3QGHA 4NLWA 5CXTA 4OI2A 1D09B 3GSIA 2WONB 5HROA 1QJHA 2WVFA 2BYCA 1U0HA 4OHZA 4DR2F 4HDGA 3OW2R 3SZ2A 4DL5A 4Q2LA 1E6YA 1VI7A 1OQ3A 2DB1A 4DS5A 5HAOA 4IG3A 4JI5F 3GG0A 4ID5B 4OX9F 3UVJA 4DR6F 1AROP 2R7VA 2XLKA 2DY9A 4J9KA 3W9IA 2VD3A 2H1YA 1Q8IA 3DU6A 2R4FA 1HKAA 1S99A 1Q0NA 3TUJC 3H4BA 3D5MA 2IRUA 4O44A 1IQZA 4M8LA 4MK9A 5L1IA 2HAIA 4CZCA 1IBLF 3KLEA 3SCKE 2M8HA 2A6OA 4DPOA 1EKRA 1H7WA 3OLAA 1R89A 2RILA 4DLEA 1CJKA 2XULA 3HFKA 1RABB 3PJ9A 1B0VA 3IM9A 5KT3A 3BGUA 1RT1A 3G8QA 4DSFA 1WF1A 3DDNA 1WWHA 2BANB 4P7VA 2P6TA 3BGFA 4OI0A 4O4GA 4KHPJ 4PG7A 2BZ2A 4BC9A 3CCWA 1BUXA 4ES3A 2Z8QA 2LP4A 2ZOGA 3T6BA 3M2RA 1YK9A 4JB8B 1SV5A 3G6ES 2F8EX 4ZVFA 1M90T 2YNGA 1YVFA 1TVRB 3D1QA 1HIYA 3OTDA 3DM2A 2ZH8A 4V1Ak 3HSGA 1M5HA 1S7HA 3A13A 5GAHI 1TUGB 3GG1A 1RAEB 3JS9A 5GMKa 4TU9A 3PRVA 4GVBA 4ZHRA 1J5OB 3EGNA 2R7SA 3W5ZA 2GVDA 3HHLD 3UQSA 3HFVA 2CDQA 1Y0HA 4ZVGA 2VKZG 4K4ZA 1N4LA 2O5DA 2IMOA 1HNWF 1RT3A 1SH3A 4X65J 2CPYA 2V94A 5F8GA 3ZO7A 3MFIA 1P1LA 4I1TA 2VG5A 3OR1B 4F4XA 4K0KF 5EN1A 2F65A 2ZJRQ 2C22A 3MM5A 5KFBA 2A2DA 4QR2A 2MXYA 3VTIA 3OHAA 4Y28C 1ITPA 1GXUA 3MM6B 4S0MA 2MMYA 5HJXA 1UA1A 2J7WA 3DU5A 4LFAJ 1M0SA 4F2RA 3HT0A 1VQ7S 2OELA 2ZBIA 3NS5A 2JH3A 2YNIB 1T9WA 3KK3A 2DGTA 2MQMA 2VONA 2EBGA 1XMQF 5KG0A 1H72C 1S9GB 1IM4A 4DV4J 2BE2B 1KQGB 3D1OA 4DI6A 1ACMB 2L41A 2NREA 3T1AA 1X8DA 3GP9A 3HFZB 3BH7B 1PJ6A 2ZOMA 1SCJB 2DITA 1HWUA 1T05B 1OYEA 4ECTA 3IS9B 3OFEA 1XMBA 3MZIA 3T5LA 2MKSA 2XI3A 2MJNA 1NNDA 1RT2B 4F26A 3BM7A 2R7OA 2ZVIA 1SB6A 5J2PB 3ITHB 3IBCB 1EARA 1OQ6A 4UZBA 3G82A 2DXDA 3W2VB 3BPSP 1AA1B 1RBLA 1G4CA 4NWBA 2X51A 1YJNS 3RR7A 1Q4RA 1NH8A 1VQYA 4WP9A 4WK3A 1IKVB 4LR7A 2XY6A 4HVZA 2HWHA 1LWFA 4YN3B 2G4BA 2J6TA 4YR2A 4F67A 3QBCA 2BABA 4Q7AA 2NXJA 3KMQA 4ER8A 2EVZA 2HQ3A 1WUUA 2KXHA 1FNOA 1NH7A 4FYYB 1QAIA 3THVA 1F5AA 2QL7B 4TQSA 1RAGB 1BGXT 2MQQA 3MMCA 4HKQA 3ENQA 3PEJA 1R6YA 2VV5A 1B70B 1NU4A 2DNOA 2C2DA 4MIBA 3TVZA 3KUEA 1C1BB 3H59A 2VOPA 4CYUB 3LAKA 4X4TA 5A0YA 4PYAA 2FVQA 4HYKA 4DX6A 1IXKA 1RE1B 2LXUA 4KR0B 1M1KT 1I5OB 3EXCX 3GIKA 1DRZA 3THTA 3HZEA 2AU0A 4CWBA 4L6V3 3A8KA 4URGA 5HROB 4USTA 4ED2A 2CNNB 4I7FA 1IBKJ 4K4UA 2DRBA 3MAHA 3CCRS 1U0HB 4WFAQ 3PW4A 1QSSA 2JFDA 2OTLS 3RYLA 3OR2A 3T5KA 2KU7A 4HT5A 1E6YB 4DV1J 2XS2A 2CNOB 3G71S 4M5IA 2XG8A 4X62J 3ILLA 2KN4A 4YR3A 3LOUA 1VBYA 4X64F 3RB0A 3VAGA 3B54A 5IXUA 4IG3B 3CJRA 4RNMA 4ANCA 5KFEA 1VS3A 3QIPA 3L9ZA 4OX6A 4FBTA 4WFXA 2UUAF 3UVJB 1NKEA 2HHSA 1A0OB 1UJ5A 2BJEA 3IFEA 1CC7A 2OIHA 4YQWA 1WC0A 2VG6A 2PI5A 2DO0A 2V5HG 3LH2S 1BE4A 4HL9A 3RAXA 5KG3A 1F60B 3ZNUA 4TKTA 4O44B 4RZRA 3NOGA 1B99A 1NO8A 1F3FA 1S1UA 3KLEB 3HT3A 5DRKA 2FJWA 2YWKA 2V4QA 1S6QA 3Q2SC 1CJKB 3KTQA 2A3JA 3DGVA 4EWTA 4AT1B 2HHTA 1F0XA 3O5TB 2GCFA 4N7TA 1RT1B 3DLKA 2L9DA 4O4GB 4QWEA 4DPXA 3HF5A 3M9OB 3RB3A 3NGTA 3M2RB 4QPXA 4P73A 4DR5F 2MZTA 1NK9A 1SV5B 2DNRA 3RU0A 2YNGB 4MTPA 2ZC3A 2CJBA 4K4WA 5IZHA 2OPQA 1HI1A 2YKMA 3UDVA 4NX9A 3CD0A 3DM2B 1MLAA 1VQ4S 1GTEA 1PYSB 3BSCA 1HHTP 2DGOA 4Y2AA 4O3OA 4ZHRB 3GJQB 2CPIA 2RUSA 1IKXA 1MN9A 1P6TA 3PY8A 2DIVA 2GVDB 5IC6B 3NL0A 5M2UA 1U8WA 2V8GA 4TN2A 1H73A 5CCMA 1NJYA 3PJWA 1RT3B 3GYGA 4OMFG 3L3CA 3OSNA 1KTVA 2VG5B 3MPYA 3R1HA 2QC3A 3IAS9 3MPUB 2B7BB 1U48A 4KPYA 1OJ4A 5IQ6A 3MM5B 1FNXH 4H4OA 3D3BJ 3VAFA 2BKOA 4L73A 2RQCA 5E3CA 3I56S 3I82A 2GV1A 4R0EA 4PG4A 2C2NA 3K0JA 4B9LA 3BR9A 1FKAF 1FVQA 1N34J 4RUBA 3A12A 3QFHA 3KK3B 2EWHA 1L3UA 3F73A 1BMQB 5T14A 2RDDA 4ZCIA 2CJXB 2KJVA 5DDQC 4UY85 2HZVA 3CC4S 4RU2A 1NXIA 1H98A 5EHHA 2UP1A 2GO8A 1TQLA 1ZA1B 3OL7A 2UVVA 2E1RA 2G1DA 2RJZA 3N28A 5DLFA 1EKSA 2F3JA 2JOQA 1F5CA 1WKJA 5SZTA 4DR1F 3ZZTA 1VMBA 4FF1A 4GC6A 1NB7A 2KO1A 4HHHA 4LJMA 3SFGA 2R7TA 2YTCA 2Z58B 1YIJS 1JLFA 1XMOJ 2R9LA 2VASA 3NAHA 1FJ7A 1O5JA 2VB6A 2KZZA 3G82B 1KKHA 2M8DB 3OFFA 4RL1A 2D3OR 3R7SB 3GIJA 1DZ5A 1SC4B 3N0VA 1TMJA 4DFKA 2QV6A 1W2IA 2XYHB 1OPZA 4CM2A 1SL1A 3PW5A 3G6XA 1LWFB 1ELOA 1S6UA 2RF2A 4OJGA 4M5KA 2VIHA 1S4EA 4WCEQ 4CH1A 2V34A 4LRDA 4B9SA 1GXTA 2RDIA 2YWGA 4JI4F 3OJSA 1WG1A 3G9CA 2R8KA 3HSDA 2DXEA 4KGMA 2RAQA 1L3KA 5KT6A 4A8YA 3TR5A 1FO1A 3DC2A 4OYAA 3CD7A 4EK2A 4AXIA 3KMSA 2VPWB 2IHR1 5SUHA 3MMCB 1RKJA 3IR7B 5K5MA 4MYTA 3NRBA 3T1YJ 4NXNF 2D1CA 3TQ1A 2NXCA 2KFNA 3C2PA 4DR2J 2OUGA 2KRRA 5A0YB 2HK2A 3PV8A 1RTHA 2W4CA 4RW6A 2YWEA 3IAM9 4Q5VA 3FRYA 3KHRA 4ZITA 4DQSA 4XDCA 4DLGA 2DNMA 3JYTA 3UN5A 2MHNA 1MG7A 3NGDA 4R25A 1XNRF 2VA3A 2I1RA 1HW8A 5BYRA 2MKJA 2NXNA 3CF5Q 4I7FB 1U02A 3D7SB 2FY1A 4NRTA 3EDRB 2JNJA 4JI5J 1JQGA 3OR2B 1P27B 2XB2D 2JX2A 4MJKA 4OX9J 1NK0A 3VR1A 4USIA 1JK9B 4DR6J 2ZUGA 3RR8A 3EX7B 3FEYB 1LK5A 2H5IB 1LK7A 2EFNA 2OD4A 1UVIA 2EC0A 1ULRA 1NK8A 2JRSA 4B3SF 3MFHA 2GQ2A 4DL2A 3QIPB 2AIRB 3RZAA 1TZ0A 3GV8B 3J7Z5 1MN7A 4G6VB 2HLUA 2BOPA 1IBLJ 4O3NA 3G2XA 3CJ2A 2HFVA 2ZFHA 2RRNA 3IM8A 3AD7C 3M8RA 2YPYA 3SMZA 1WF0A 1SVDA 2KRBA 4KRWA 3FSIA 2VG6B 2UXBF 3HVTA 4ZVEA 3TZXA 2FD2A 2IRXA 1HHQA 3WC2A 1RHQB 2J0XA 4WU3A 2KI2A 2A10A 5KFUA 2H4YB 2BJ7A 1S1UB 3OFGA 2ZZNA 1PAEX 1JLBA 2IJNA 2GS8A 2CUYA 2ILZA 4DV0F 2CKWA 4DN0A 4ZMMA 3CJQA 1S6QB 2X1GA 1X0FA 2V50A 3CB4A 2L9WA 4A4JA 2J0WA 3ZC4A 4OYPA 4TXSA 3K59A 3DLKB 1REGX 4OJ1A 3D6MB 2XMMA 2BJ8A 3L95X 2LXFA 2ZDPA 2F4FA 3T9ZA 2OPQB 2DCUB 2YKMB 3H4DA 1S1TA 4C8LA 1HNWJ 2K3IA 2V4JA 5F8NA 2DRAA 2ZM6F 1S6OA 5AE1A 1AUDA 1RT5B 4PG6A 4LRFA 1IKXB 5IT9U 4DBQA 4YS2A 3BZQA 1OSCA 4K0KJ 5HVHA 1YRXA 2R3VA 4QR0A 3POTA 4J91A 5JVGQ 3FBBA 3QMQA 4Y00A 4Q2MA 5D0RA 4X4RA 2KXNB 2Q1LA 1Q78A 1RCOB 1PSDA 2MQPA 4B02A 4M5MA 5C24A 4M5LA 3CGIA 2NS1B 4PEOA 2FLLA 2Y9HA 2N4CA 1S9FA 4DL6A 2OEJA 3C8YA 4H4OB 3G96A 1XNQJ 8ATCB 2Q3PA 1O0PA 3QRQA 1XMQJ 5HLFA 2C2EA 3PW7A 1UVJA 3CIZA 3PO5A 3DOKA 3KFWX 1VYAA 2UV8G 2YWFA 3C3LA 3SIPB 4I64A 1SIZA 5ETRA 4J5OA 2W7AA 2VU5A 1N54B 2XEXA 4WYWA 1WC4A 4U67Q 1T9VA 2QEXS 2DNQA 2C1EB 1RTJA 3VQTA 3BPDA 1RLCL 1HNXF 2XCPA 3KG1A 4Q44A 3WX8A 2ZD1A 1HR0F 5K8NA 2HS4A 3H5SA 5F8HA 5AT1B 3W2WA 2G1HA 1HD1A 1WSVA 3E8OA 4P10A 3O6QA 2OHDA 5T41A 1NZ8A 4F04B 1FWPA 2ZHBA 2AEMA 3EZOA 2EKNA 4PABA 3JB9k 1FJEB 1JLFB 5EUHA 3OVBA 4C3MA 2PA3A 3UD4P 5F8IA 4ZVQB 4GMKA 3OT9A 1XEZA 4JV1A 1Y3KA 3N6LA 2QA1A 2WTFA 3V6JA 2HMIB 4G3IA 3NXZA 1U6FA 4TQRA 3KK2A 3JQKA 1U49A 2V67A 2HG4A 3JTPA 5JUMA 1NSKL 1R27B 4DV6F 4CI0B 3CJ5A 3RJMB 2RF2B 3EPGA 1GMWA 3U7JA 1PBUA 4XPEA 2XMAA 1N36F 2N3OA 3IR5B 5I42A 4RW4A 4MH8A 5LXYA 4HHJA 1GX6A 3GSDA 4LQ9A 4WP8A 3OVSA 3K8VA 5IWAF 2O3DA 1K0VA 3FRZA 5LJ5Y 3BO2A 1UP1A 2HVEA 1ZS6A 3RRKA 4UQGA 4K59A 1NUEA 1REVA 1Q82T 3KUHA 3R5AA 2IJRA 2B0GA 1UEVA 2HPUA 1H6KX 1ZETA 1RTHB 4DV2F 4ZVTB 3HHDA 1O6XA 3SSSA 4RW6B 3V4IA 2ZKTA 4KH1B 3D0IE 2X1FA 1S1XA 4BDPA 3KYLA 1JNZB 3US5A 4X64J 1Y00A 4DPWA 4B3OA 4LQ3A 3W5YA 2IBOA 3N6MA 2QJ3A 2HVIA 2UUAJ 2NSCA 2IDEA 3FQKA 2DHAA 4G1IA 1HW9A 1OSDA 4NLVA 4OJ3A 4JI6F 1FTRA 4X2BA 4FYDA 1JIHA 3WX4A 1C0TA 1WHWA 4PG8A 2IYGA 1ZA2B 4PWWA 3UI3A 4FVCA 2OTJS 3U27A 1V9OA 1YI2S 4JI0F 1WHYA 4RR5A 1IKYA 3KLIA 4WU2A 3KHHA 3C15A 1S59A 2BRKA 2EXUA 2LQ8A 1CJVA 2LEBA 2HFNA 3C16B 3KK1A 4I6YA 2ZC4A 4KHRA 4XPCA 3SFUA 2AYEA 1SJ4P 1U1MA 4W92B 2FJEB 3GIMA 1JLBB 1A6LA 1S72S 4DR5J 2ZWPA 3F44A 5L9NA 3CCJS 1FWLA 2RDJA 1AZSA 1VQ9S 3MGJA 2V8PA 2AJFE 3H90A 1KP6A 4NPOA 1HBUA 3BO4A 4QPTA 1WEYA 1X0PA 3MM8A 3KLFA 1SL2A 2JJ4D 3GFXA 4DZ6A 3CC7S 2GAGC 1AYEA 2ZITA 1LW2A 2CZ4A 4DZDA 3W61A 4HH0A 1XBWA 4C3KA 3CCSS 2UUCF 1S1TB 2DT9A 2V4JB 5L39A 5LSLA 3JSMA 1KQFB 3C14A 3SV4A 1WDTA 1N32F 3M2UA 3POTB 2P8IA 2PMWA 3J7YI 1HBOA 5DQHA 1NJXA 3OQ2A 2VICA 2G2YA 5AXMA 2FJBB 2RVJA 4RUAA 1QM9A 2ZE2A 1VR6A 2R2RA 2B9EA 3FCVA 2E5GA 5C24B 5C2CA 2WHOA 3GYNA 5KFNA 4YB6A 3BN7A 2C3MA 1VLOA 1RHUB 3HLUA 5H9FK 1N5TA 4LRAA 1UEUA 5HLFB 3CJ0A 2NUHA 1Q5VA 1TL7A 3HJFA 1YSJA 2H54B 5AJ3F 3DOKB 3KWMA 3AOCA 1Q8BA 3A4TA 4F3OA 2UXDJ 2AMCB 2FHJA 2ZBPA 2D3ZA 4LVOP 1M5PC 1RGVA 2E1MC 4UQTA 3FBCA 4LSLA 4DFMA 1JKHA 3W5XA 1RTJB 1IJEB 3M9NB 1EB0A 2ZD1B 1VQNS 2ZZMA 3GFHA 2J7KA 3WIUA 2EW9A 2Q6CA 1G6BA 1KLMA 3VAMA 2LDIA 3M8PA 4DMZA 3MURP 3W2WB 1UFWA 1NKCA 1XR6A 2CPZA 4MMOA 2ATCB 8AT1B 4G1QA 3NNCA 1RHRB 4HEA9 3OD2A 1TTHB 3FZBA 2AJ0A 1BWEA 2M70A 4EUVA 2HHWA 1DY3A 2DCLA 1K1SA 4Y2CA 4XIUA 3R97A 2D3O1 5DGBA 1R31A 4J9VA 4YP3A 2BEFA 4ED8A 4WFZA 1RWWB 1HLWA 3HP6A 4JI4J 2OI2A 4LREA 5D15A 3MEEA 3RG6A 3J80Y 3KK2B 5GADI 1HQUA 4O0IA 2R7WA 3UCUP 4BBYA 1SKRA 3I5CA 7FDRA 2ROGA 3PR5B 2WSEC 1X9WA 4RU9A 1HPZA 4KB7A 1D3WA 4KGVB 5KFLA 1LXNA 2J8AA 6FDRA 3MR7A 4AQYF 2FIUA 2M9KA 4PQAA 5I42B 4RW4B 1WTBA 2D3UA 3CDAA 3V6KA 2D41A 1CQNA 1S12A 4NXNJ 3TANA 2HVHA 2BUNA 2P6SA 4WZQA 3OSPA 5LMNF 2B5JA 3E01A 2C2OB 4WFYA 2BM1A 3ILIA 2XM3A 1DAXA 2QYCA 1NDLA 3D68A 1XNRJ 4J9OA 1WD6A 4FYVB 2RRBA 3P49B 2HHHF 1NM2A 2LVWA 3FBEA 4RNFA 3RW7A 2W2PP 3PX6A 2HBYB 5A6WA 4OZ1A 4DUYF 4ZN3A 5DETA 5IC4B 1L3VA 1S1XB 3IG1A 1JB0C 4B9TA 2YXLA 4B3SJ 3PCOB 4B3OB 1CC8A 4KT0C 2DY1A 1CJUA 1EQ0A 5ETQA 2E5LF 4F50A 4K7QA 1KEKA 1HQ2A 3M8QA 2RKIA 2F8HA 2E7WA 3HCXA 5IV4A 3I9ZA 5CQGA 1C0TB 4NASA 3MPVA 1PYOB 3TARA 2OLWA 1U45A 1FFGB 4IR1A 4FXVA 2UXBJ 3NNAA 1IKWA 5CZVA 4ZLPA 2DNNA 1F5BA 4NI2A 3K17A 3HXMA 5J1NA 2RU3A 3SI8A 1WC6A 3AH6A 1S76D 1RA6A 1CLFA 2B51A 3CE8A 1MROB 2RS8A 3Q22A 3KLIB 1KS2A 2YNFA 2RUGA 4HHUA 4DV0J 4H4KA 3C15B 1MMNA 1RAOA 1CJVB 5KG1A 2IM1A 1VBXA 3KK1B 4JV0A 2APOA 3ZTRA 4KH0B 1U47A 4CQ1A 2XBPA 2PD1A 2OGUA 2WVEA 3PW0A 2V2VA 4DQRA 2AYMA 4DPTA 2CQCA 1LEOA 3H5YA 2I5JA 5FJ4A 2UV8A 3ZZZA 4CP5A 1AZSB 3I96A 4IRDA 5RUBA 2YX1A 4IQXA 2M5YA 1VQ8S 2ZM6J 2M4MA 3H2UB 1HBUB 1T8EA 3H2VE 1JLGA 2FHMA 2V6AA 3CVKA 4A8KA 3MM8B 3TWZA 5KFQA 4IR9A 3CDUA 1XWLA 4QJVA 4C8NA 1UVNA 1VFJA 1LW2B 5KFWA 2NYHA 1T03A 3MCMA 2MLZA 1JJ4A 3L7PA 2ZH7A 4DSEA 1UL3A 2WVCA 4NA3A 2FZKB 3JSMB 3KJQB 4DX5A 4J9UE 3UCGA 2DHGA 1DLOA 4LFCF 3C14B 3GILA 5HQMA 4CO1A 3MPDA 2BKNA 2R7RA 5ITHA 4CM0A 4EI2A 3M2UB 1HBOB 4ED4A 2NUUG 1D0EA 4NLTA 2E1PA 2PI4A 1WEXA 3W9HA 3CDWA 4FZVA 3NMRA 3RRGA 2C3PA 2CPJA 2ZE2B 1TL5A 2W2OP 4PQUA 2AT1B 3TYTA 1RB0A 5KT7A 4QU7A 4JOUA 1AB8A 3PRBA 2PMHA 1JJHA 4ANEA 1DQ9A 2VG7A 2G0JA 1NSPA 3TX0A 5LSOA 1HNXJ 1TL7B 2PN6A 1RAAB 4FS1A 3JXOA 3FEZA 1Y5NB 4X4NA 2DR6A 4NEYA 2C2MB 4OYWA 1HR0J 4J9NA 1EP4A 3J80U 2EPIA 4EEYA 2CPDA 1XR5A 1LQ9A 4DPUA 2OPPA 1Q79A 2HHXA 4LSLB 3QZ8A 8RUCA 1JKHB 4ECWA 4QWAA 3BQ0A 4TYBA 2W4DA 4CO3A 2QA2A 4PKDB 4OV1A 4ZLNA 4X4QA 1SQFA 5IS2A 4J9QA 5F9LA 1KLMB 1UEKA 4X4VA 3M8PB 1MMDA 4KSEB 4G1QB 3DGPA 4JV2A 2XHWA 3SCJE 1LWEA 3K2YA 4B3MJ 2K3KA 2M2BA 3D4JA 2EFPA 3D66A 4DV6J 2NZCA 4KKOA 2X3GA 1RJJA 1N36J 2GMLA 1BD6A 4F4KA 3GR0A 3MEEB 3CCTA 3JSBA 2RQ4A 1HQUB 5IWAJ 1TL3A 5IM0A 4UW2A 5DS7A 1U4BA 2HBZB 2EBEA 1HPZB 4DDFA 1NHKL 1Q8KA 2MLYA 1SH0A 3N9UC 1F2HA 1GMWD 2XSFA 1OWXA 5B0AA 1KQKA 2BVZA 1N0VC 2EK6A 3WDOA 1WOSA 3UR0A 3OXFA 2AX0A 4DV2J 1Y3JA 3KLHA 1W2BR 2B5JB 4A8FA 3E01B 2VDHA 3ZZYA 4U7UD 2YKQA 4NYOA 1GNKA 2DRDA 5D3GA 1UTAA 2DNLA 1UPMB 1DQ8A 1RA7A 2MJUA 1Y11A 2J0SD 4HACA 1TUWA 2VDIA 2LCWA 1FCAA 3KNGA 2ZH2A 4JI6J 3AXMA 1SH2A 3VGVA 3IG1B 1C2PA 4DUZJ 2C2KB 3DXSX 3FCHA 1KLNA 2F5GA 1X4BA 4WXOA 2I38A 1X5TA 3TQEA 3OV7A 4YR0A 3MR5A 1CJUB 1S1VA 2ZZTA 5GAGU 3HVWA 2XZTB 3ONQA 1FERA 3M8QB 5F8MA 2RKIB 3JQMA 4NLRA 4JI0J 2CPEA 4N56A 1HMVA 7AT1B 3M2VA 2L08A 1KVIA 3I5BA 2BXJA 5B7WA 1X7VA 3LP1A 4Z7YA 1JLCA 3UR3C 5EX3A 3PRDA 4ZPBA 1GT8A 4KQZA 3R27A 3HSZA 1IKWB 2XS7A 4TLQA 4I6AA 2P2CB 4NA2A 4N76A 6AT1B 4RNOA 3QT6A 2XWYA 2DH8A 4UOFA 2YNFB 2UZAA 4JYAF 4ZPDA 4QW8A 2GIQA 5E3AA 3DFEA 1T9YA 3B82A 4KGZB 3AFGA 4IO1A 3PDNA 2RT3A 1RK8A 1H0HB 2WBMA 1WG4A 2DXFA 3W1YC 4F2SA 3A8IA 1TR0A 2I5JB 2WOMA 3CSKA 1PAUB 3W60A 2KJWA 3M6XA 1FE0A 2M3DA 2UUCJ 2KHDA 2UUBF 4NLSA 3VCDA 3NBPA 3BQ1A 3NMAA 5IT0A 3MDFA 1KVKA 1JLGB 1HWJA 5CHCB 4J9RA 4EFAC 4RBTA 3QT5A 2BJ3A 2Z56B 5B0CA 1N32J 3H20A 1FE4A 1T3OA 2N7CA 1T03B 4DL7A 4I68A 1U2CA 4RW7A 2ACYA 5F8LA 2KT2A 1P1TA 1URNA 2DHXA 2HRYA 4Y0FA 1DLOB 1N33F 3BB5A 1KHVA 1MWZA 2Y1IA 3ET6A 2E9RX 1H2TZ 4O3RA 1DTQA 3AY0A 3VHQA 1G7CB 3CCES 2YKAA 2WK4A 3EUNA 1U8SA 3O3LA 1K9MT 3DHXA 3I55S 4ED6A 4P6QA 2UXCF 1GK8A 2HRUA 5HN0A 2YQ1A 4USJC 2KTQA 4CLKA 3GTYX 5CAAA 2XMJA 1WG5A 3W64A 5EDWA 2HQCA 4PQUB 2IMWP 2IA0A 1JMTA 5AJ3J 4I6WA 3DMJA 2LKZA 3IS9A 5F0UA 4QBUA 1A9NB 2I6WA 1WORA 4TU7A 2OAUA 3WIVA 5E3RA 2LXIA 4PUOA 4TYAA 1QDUB 2B3TB 3T1HF 2VG7B 2R2UA 2FZGB 4EYHB 1BY9A 1SJRA 3Q8VA 2FLPA 4IUFA 2X7IA 1DURA 5M2RA 4JUZA 2QMXA 2XMWA 1EP4B 1FRIA 1RT4B 1NK4A 5KFZA 2XO7A 3QPIA 2OPPB 2ASDA 1T9XA 2Y1JA 4CO2A 4Q8FA 3PFEA 3KG4A 3CMAS 4LRBA 2HWIA 2VQEF 2BX6A 4DV7F 3LQVA 4NLPA 2DBBA 3OHBA 1FRHA 1RBOB 3LAMA 1V5IB 2Z2YB 3PYFA 5KT5A 4X4SA 3OTCA 2JLEA 4F0KA 2B56A 2E9ZA 5I3UA 1FKPA 1YJ9S 2DNKA 3DGPB 4GVLA 3C19A 3LTOA 5H1SV 1LWEB 1FRLA 3HHNB 1PBAA 5HQLA 4M95A 3I0SA 2KT3A 4ETXA 4K4SA 4AL7A 1M1HA 2PIIA 1R8AA 2MZRA 4KKOB 2NZ4A 4NLQA 5D78A 3S6EA 4C8YA 2BOAA 3HVRA 1SIWB 4EO8A 4LSZB 1NHVA 1YHQS 1TL3B 2DGXA 5IM0B 1MW7A 2MQ8A 1UVMA 2CAJA 1WOPA 5LMNJ 4C11A 1FJCA 1XJWB 3HSJA 2FVCA 3H98A 5KFMA 4ZVSB 5CYQA 3J81Y 3G87A 4MKAA 1NBEB 1RAHB 2GHWA 4PWDA 4FXWA 3QFWA 2K06A 4JV5F 2HHHJ 1NDKA 4LIRA 3PX4A 3KLHB 1ZAVA 4CLUA 1Y5LB 2DNHA 4DUYJ 2MZJA 1EZZB 2YVSA 3RW6A 4WIIA 1VGYA 2QG9B 2ZH3A 3D0GE 1FI4A 2HBQB 4M94A 1FWKA 3GWCA 3A8EA 2DR7A 5D3GB 1XC9A 4HTIA 3D0HE 2M88A 3KJVA 4LF1A 9ATCB 2BDPA 1RI7A 3FVYA 3PG9A 1HI8A 4MIAA 3RTVA 2E44A 3H8YA 4HACB 1Y4ZB 4FS2A 1S1WA 2BQRA 2E5LJ 3AOAA 4YY3F 3FBFA 3FJ2A 1RWNB 4CLTA 4FDFA 3LW5C 4ZJOA 3DRRA 1BQNA 1F9EB 3ENAA 4JP8A 3TAPA 3M1VA 1U6ZA 2CQ1A 2OFGX 4C0OC 1L3TA 4NL5A 2FUG9 4ZKAA 2A0FB 3AB2B 3P4UB 5LXRA 4K4VA 3FMWA 2BE9B 1QE1A 2GMHA 1S1VB 4ECZA 3QGGA 2ZH9A 1JJ2R 1TV6A 3KLGA 4MKBA 2Z30B 1BWVA 2GNKA 4BLGA 2F7VA 1HMVB 4AL6A 3M2VB 2VQFF 3LP1B 1JLCB 1X60A 5J2QA 2CPXA 3CTRA 2IM2A 5D0EA 5CABA 2F4VF 2QMUB 1R8BA 2C28A 5AXNA 3ZZUA 2FC9A 1D8YA 1SI9A 3G6YA 2XSJA 4B3RF 4UUWA 3KKFA 1X4AA 3A3PB 2E1AA 1F6TA 3DKDA 2VZ9A 1TP7A 4JI8F 4X84A 3TA1A 4WFBQ 3QGPA 2G13A 3QRRA 3ISNC 3ADAC 1PIEA 4HI2A 1QSLA 3TNVA 3MTJA 2WOMB 4YFUA 4LF7J 1M5OC 2G0CA 3BKTA 1S5ZA 2DR9A 1KFDA 5E5NA 3NBPB 2CJQA 1D9AA 3KHLA 4ZIWA 4LFCJ 2HVZA 2YX4A 1A7GE 1EQMA 2J7UA 1VJWA 2KM8C 3ICLA 4Q45A 4ZPWR 2XMVA 2LQ9A 4QWCA 1IVZA 3LP2A 4RW7B 3OTOJ 2IFXA 3BS9A 2XGQA 4UUXA 3SCIE 5KFRA 2O01C 3IWNC 3QWPA 3ET6B 3FC9A 1FJGF 1RAJA 1J5EF 4PZVA 2R8JA 1DTQB 4NMLA 3NS6A 5JVHQ 1FK9A 1DBDA 1H2UX 4DSIA 3TUZC 1X5OA 3BBFA 2J9DA 2ZH6A 4EZ9A 5K14A 4LBIA 2HFZA 3DMJB 1DFDA 4USWA 3SXLA 4Q0BA 1T0TV 3R5DA 3K7RA 5EWEA 5D77A 3B4MA 4PUOB 2OMOA 3A1YG 3JQJA 1SC3B 3E51A 4YB1P 2QTWA 3R5CA 2OFHX 4UTGA 2HHPA 3MMBA 1ZZNA 1VCTA 2AW0A 1NRKA 3OL8A 1U1QA 1KVJA 1N52B 2B4OA 2KDOA 4F4YA 4I2QA 2QZ8A 4ITSA 2GJ2A 3PXGa 2QL5B 5THWA 3FZ2A 3J81U 4GC7A 4Z2XA 2EC2A 4DQQA 2EG1A 3FQLA 2FQQB 1CSJA 4ZDNA 4YDXA 1HBMA 2ILYA 5KG2A 2GAHC 4TY9A 4DFPA 1G2EA 4ZK7M 3CCQS 1DARA 5I3UB 1FKPB 1YBAA 2CZVC 2IRYA 4X66F 1B3TA 1N0UA 2DGUA 1VQPS 3PTWA 4OLOA 2YKPA 4DXLA 3D9BA 4YHHF 2OP5A 4XTTA 1N5YA 3GIIA 2AGQA 1ROFA 4ZLJA 2KYZA 5A8RA 1R8HA 3BV8A 3I0SB 4QIEA 3BN4A 2KXFA 3CJTA 2BE7D 3GIRA 3D67A 2C3OA 1B7FA 3DDIA 1Y10A 4FNHA 4IRKA 2B8PA 2VA2A 5I3QA 4URQU 3RB4A 1X5SA 1U09A 3DDKA 1MU2A 4MFBA 4DV4F 2DPIA 5BYQA 1S49A 2NXUA 1OMSA 5H9FJ 5GMDA 1EAYC 1K1QA 2MQOA 4C11B 5B0FA 3GFYA 2FVRA 1SJ1A 1RADB 2FPHX 1VJQA 2WRMA 3I4HX 3QWUA 3SSQA 3WC0A 2FGOA 4USUA 5CYQB 4NCBA 3P6YC 1RBAA 4OYXA 4KC5A 1YJWS 3VV2B 2H48B 4K2XA 1EX8A 3ZZOA 4PWDB 3MCOA 3PKMA 1AT1B 2ZWOA 1Q7LB 1TKZB 2VPYB 2AEFA 4C97A 5ETTA 1RHJB 1S6PA 3CULA 1HNIA 2KYXA 2CPHA 1AFJA 3V6HA 3HHLC 2E7XA 3Q2TC 3NNHA 4QCLA 2LA6A 2WZ1A 1QTNB 3KJVB 2Y1LB 3IGVA 1NPRA 5LL6d 4HLBA 4UF4A 2DTJA 4F25A 3ZNJ1 1S1WB 5KFFA 1PG5B 3VAIA 2W7OA 2W2NP 4BWJA 2BBEA 2GHVC 3DRRB 3W8PA 2CYYA 1BQNB 1VC6A 5F3TA 1FX2A 2OJ3A 2YX7A 3QATA 1IBMF 4QZVB 2DKOB 3M1VB 1U2FA 2WB1D 3I4PA 2JVOA 1T95A 2MY7A 3NLCA 1WHXA 4OYZA 1QE1B 3BF4A 1Q86T 2KB2A 1TV6B 1S57A 3KLGB 1SJFA 3CIMA 2C2ZB 2B8QA 2CA9A 3BKFA 4YMEA 4GO7X 4RJVA 3R8YA 4CLSA 2IJFA 2B4UA 4ICLA 1ZM3A 3VF0B 4JYAJ 2VFVA 1Q95G 2QMWA 2E29A 3A3OB 2J9EA 4KYZA 1NZAA 3Q8QB 5IT4A 5J2QB 3FGVA 2MLXA 1QUPA 4ZP8A 4H4MA 4CLWA 3H25A 4FF2A 3BDPA 1Q81T 3IGNA 4DUTA 3MR3A 1ZH5A 1RAFB 4UY8T 2XSJB 4C9DA 1S0NA 1RT5A 4JI2J 2QLJB 2Q79A 1GQEA 1SKUB 2GIFA 3DNCA 4CLFA 3VALA 2Y0BB 5KFGA 2UUBJ 2DISA 4RUHA 1GXLA 2W2MP 2HS0A 3IC1A 5KFDA 3DN9A 4FXDA 2CZ9A 3TP2A 4EGLA 1RWKB 3EVWA 4CLLA 1DTTA 3MXHP 4OI4A 1D8ZA 2V4RA 2A1BA 2W9AA 1OS5A 2OPSA 4K4TA 1ZAXA 4TNOA 2HZAA 1I51B 3I9V9 2KH9A 1U1RA 5CA5A 4U95A 5LOQA 2RH3A 4ED7A 1B64A 3CC2S 2CDRB 2XNQA 1N33J 2QFIA 1U1KA 1EHWA 1TELA 4NLUA 2IDLA 3OVAA 5JXSA 2YWWA 2F9DA 2F1FA 2W9BA 3CD5A 4P75A 1C0UA 3LP2B 4I2PA 2UXCJ 1JXVA 4YOEA 1SKWA 4LBPA 3TA2A 5A8WA 2XI2A 1UJ4A 1KR4A 1FDAA 1YKWA 3GB0A 3KDOA 3M7VA 1R8PA 5IT9Y 4DR4J 3B6BA 1OIAA 4ELVA 2JEIA 1FK9B 1MWYA 3VGSA 3DXBA 5L1KA 3R5JB 4BC7A 4KIAA 2VPXB 3NGSA 3MD1A 3AOBA 3T1HJ 2V2ZA 4DWIA 4HH1A 3KJFB 3PX0A 5K14B 1HA1A 3MEGA 2AJ4A 3EGWB 2QX0A 4IFYA 3C6TA 5EWFA 5DLGA 1X4FA 4OYIA 3MOZA 1X4EA 4Q0BB 3D6FB 4IG0A 3N6NA 4WIQA 1RU2A 3V4MA 4LUBA 2FJAB 3GYXB 2GW8A 1F9HA 2RD5C 2YWHA 3GJSB 2HGLA 3UD5A 2KZMA 4NRUA 1SQGA 2FLOA 5EWGA 3AAWB 4QR1A 3ULHA 2HMIA 2HYIB 4IFVA 3K57A 2BR0A 2JL9A 1K0TA 5K8OA 1KC8T 4GKJF 1ZTTA 3MMBB 4CT8A 1ZAWA 3T3FA 5D6GA 4OZ5A 4DU7A 1S79A 4I2QB 4DCOB 1VC5A 3QAEA 5KFVA 2Z2LA 5KFYA 1UJ6A 2BM0A 4ED1A 1HBMB 3FCWA 4N8NA 1DHMA 2UUTA 4Y2IA 4YUDA 2WW8A 1GX5A 5A76A 2BJ9A 2V63A 2W8LA 2HKEA 1JLAA 3J7ZT 3BEGB 4WPAA 4CTAA 4FPRA 2JLGA 5LM7E 1QVFR 3NWRA 1FXRA 1N5YB 3MUMP 4TY8A 1NAQA 5A8RB 2KFZA 2YKNA 1W25A 3MCNA 2YH0A 7FD1A 2DR5A 3G86A 4PWUA 1IR2A 3MAAA 3MCSA 3OXLA 1FEHA 1R0BG 4C8KA 2QN6B 2FDNA 3P8BB 1B0PA 1MU2B 4MFBB 3BDEA 1HFEL 1PCAA 4WXWA 4JV5J 1FRXA 2J6SA 3ISND 2LU2A 2POKA 3VVUA 2DHSA 2VJUA 3T19A 1D1UA 4QWBA 5E2QA 3LGNA 3O44A 1PYTA 1YDLA 4OI6A 1LFWA 5D4NA 1ZTWA 3G6VA 5E41A 5FLXU 2XZWA 1FKOA 3TJAA 5DGAA 2VJVA 1XMOF 3I31A 4CT9A 2E5JA 1WOOA 2GC8A 2Y3YA 3CD6S 4YY3J 2FVSA 5A6PA 1S6PB 3TW0A 1HNIB 2HNYA 1UKUA 5D0HA 1QAXA 2KG0A 1ZOTA 3NAIA 2J76E 4DQPA 3TJ9A 2EFVA 1WACA 2RSQA 3V81A 4R8UA 5HP1A 3CCVS 3X3UA 3QJPA 4OI3A 1YQHA 1WKLA 5GAEU 1NK7A 1LNQA 2A2CA 3R6GB 1HNVA 2BW2A 4DR7F 1NSAA 1FD2A 3N4WA 3DLHA 3C16A 2G0IA 4O4RA 3V2UC 3LWMA 2R8IA 5J2NA 1C1CA 2H9ZA 2VQFJ 4F02A 3D2WA 2ZJPQ 3Q8YA 4QOTA 5KG6A 2HNDA 3R9LA 5H9EJ 4U8VA 3HI9A 1BQMA 4YEAA 3IRWP 2F4VJ 1LOUA 4C0HA 3MAQA 4A8MP 4ZN1A 3ENVA 4ZLLA 1WTFA 2GJIA 1KONA 4ICLB 4B3RJ 2N3LA 2E7VA 2P9EA 2ASJA 2DH7A 3CO0P 2WW4A 4QWDA 3T1YF 4B3TF 4J9SA 3SCLE 4EMDA 5IFMA 1R0AA 3G8TA 2DIUA 2DK2A 2JLFA 3QSYB 1IBCB 4H4MB 4JI8J 3IBFB 3BR8A 2CQGA 1H74A 2W9CA 2DEIA 3GR1A 4KHMA 4Y2MA 4C98A 3CCMS 1HD0A 3ILJA 4KE5A 2PO4A 1D9FA 3EJMA 2DGQA 1L5UA 1VRTA 2UVWA 4ZP6A 4Z37A 1DTTB 1RAIB 3NG8A 4M5GA 2XYGB 2OPSB 3FFIA 3LGMA 4RBUA 2ZDOA 5CYMA 1WSRA 4ZPVR 2HLTA 3DI6A 2COLA 2QGFB 1FD8A 1TL1A 4KJIA 3EMTA 2IBKA 4KGKA 4IQMA 2ALZA 1FJGJ 1J5EJ 3IMQJ 2VH7A 4QU6A 2VF3A 5HVFA 1X31C 5DZ6A 4CDIA 2W9BB 5C2GA 3EVOA 4XO0A 1VQOS 1ICEB 3Q8PB 1C0UB 4HT7A 2XS5A 4I2PB 1TK8A 3P5BP 5HQ8A 1R6VA 3C66A 1O51A 2JC0A 3Q8SB 3VVTA 4WJBA 5A8WB 3FUYA 1S9EA 4O3QA 3HM9A 2BKPA 1RSCA 4L74A 4IDKA 1YJUA 5KG4A 1CVJA 3LUYA 4FP9A 2OSQA 4DSJA 3AQPA 2MYFA 4O3PA 4CLPA 2NXEA 5ETNA 2UVRA 1SJQA 5LT5A 1S97A 1JX4A 1WELA 2ASYA 4DPYA 3MEGB 3HULA 2ZHAA 4OI1A 4IFYB 3C6TB 4L75A 4F0MA 5A2QY 2AV5A 2QO3A 1Y5IB 2FVPA 4G65A 4DV5F 4C0BA 3EDQB 1VHFA 4ELTA 1FXLA 3ELHA 4IG0B 1Z4UA 4Z7CA 4P2XA 1WKKA 1YBTA 4ATNA 1MMLA 3L7UA 4RKUC 2CJKA 3K8WA 2XQCA 2G2ZA 4NCAA 4HTJA 3LO3A 2KVIA 1S0MA 2MGZA 1RWOB 4IFVB 4BS2A 1JLEA 3MM9A 3K5LA 4PXDA 2W1BA 2NR0A 1N5SA 1UW4A 4LFBF 4X66J 3VZIA 4TU8A 2E5IA 2QLFB 1QAJA 3UN2A 4K5RA 4YHHJ 3AJ2A 1UVKA 3M4XA 2EEYA 4U7CA 3OPKA 1YJVA 2CQ3A 3QJJA 2Q6BA 4UOCA 1ZM4A 2JHEA 3H42A 1WI8A 1XNQF 1GEHA 2LMIA 4RW9A 1E6VA 2H65B 2OEKA 1JLAB 4CTAB 5IQQA 5ETKA 4WE1A 2YNHA 1I94F 1TFWA 3U1LA 2R7QA 4TY8B 2B9WA 2DO4A 2YKNB 2H51B 3OXGA 2X3DA 2GA7A 2W7PA 1B0TA 3MAAB 5KFKA 2ZBCA 2GJFA 4L3KA 3QIDA 2FC8A 3EGZA 1DQAA 2AZ3A 4CO4A 4PG5A 3BGRA 3TZWA 2XZDB 4IKAA 3M30A 2OD6A 1HHSA 3H7HB 2AF6A 4CLZA 4F3QA 4J7CA 1KOHA 1Q53A 4K5SA 3AJ1A 5F3ZA 2PMZD 2W24A 5K8MA 3JTOA 4CO0A 2ALYB 2HGNA 1W26A 3W65A 3PKYA 1HQEA 2VBZA 2CXEA 1FKOB 2MPUA 1I3OB 4WP3A 3TAMA 5E3PA 2PGCA 2QE5A 3SQGA 2HNYB 1RHKB 2CJAA 2XHCA 2GQCA 3QLHA 2I9SA 1IBMJ 5I3PA 1R3NA 2XC9A 3V81B 2BA9A 4R8UB 5HP1B 1IJFB 2DHHA 3MI7X 4IOCQ 1YG0A 1MROA 4D3HA 1UW9A 4NZ0A 1HNZF 3EZUA 3WBZA 1RP5A 1HNVB 1TUVA 2K7JA 3UE2A 4DL3A 2B7CB 2VKRA 2V2QA 1GTHA 3D6HB 1LV5A 4PRFA 5J2NB 1C1CB 3UDCA 3MWBA 2CNLB 3CT9A 1N8RT 1K44A 2LFVA 5ETMA 3LA0A 3LWLA 2HNDB 4OHXA 2W01A 5F8JA 1BQMB 4DG1A 5HANA 1UPPA 4F4AA 1SKSA 2ASLA 1WC3A 4LF6F 2FJXA 4ZVPB 5HATA 2X1BA 2C3UA 2BQUA 1IUJA 2VL1A 3PNIA 1Z1ZA 2MTLA 1YZ6A 2MKIA 1HYSA 3BO3A 1HI0P 5GAHU 2WVDA 1IQTA 2Z57B 4NZ7A 4DSLA 1R0AB 2HIQA 3QZ7A 3MR6A 3VZHA 1Q7YT 1U26A 4OIXA 4I69A 2W9CB 1I1GA 4FKXA 1NKBA 2PE8A 3HD2A 4RNHA 1JNRB 3QSIA 5KAKA 4H54A 2FB0A 1VBZA 4L3NA 1JXEA 1LWCA 4M5JA 1MNEA 4FVMA 2WAQD 1SXLA 5LMUF 1VRTB 2ZOFA 1RWUA 1FTCA 3EXYA 2B4PA 2I8EA 2CQHA 2V8VA 1GMUA 4ILRA 2HHVA 2ATLA 4ILMA 3T41A 1GFWB 4ZVHA 3FFIB 5CYMB 5A2QU 1FT8A 4OJHA 4OZLA 5ADZA 3N5BA 3DI6B 5DDPC 2WVBA 1ZYQA 3FSYA 2E1CA 1TL1B 3GJRB 4DV3F 2W4PA 2DYAA 4Y65A 4C2MA 2DH9A 4J37A 1U0SA 4USVA 5F0WA 3PVXA 2P9GA 3M6VA 3QO9A 5KOWA 1OY8A 5BXIA 2XMTA 4NCGA 3GCWP 1RTDA 1IN0A 1PJ7A 4G1PA 1S9EB 1OPIA 2V68A 3SDEA 1UCNA 4DR1J 4PR6A 4IDKB 4YB7A 3L7OA 1KN6A 5JJBA 3ZTPA 2LQBA 2AGOA 1OYDA 3RRHA 1HWIA 4R0JA 4QYRA 2ADCA 4ES2A 2BRLA 1CS4A 2YQ3A 3NY0A 3V5RA 3Q0AA 3K58A 2AYBA 4GVBB 2Y8WA 4A47A 4NYZA 5BJRA 3AQOA 4V19X 1UWAA 5ETOA 2FYXA 1LFPA 4DL0C 5A8KA 5K20B 4LRCA 1LWXA 4P2FA 4GKJJ 2GIRA 1FDDA 1UAWA 2RMLA 4ZCKA 5BYSA 4QYZJ 5CCLA 4NEZA 3KLVA 5KFTA 4M5DA 1BLUA 2ZEJA 4CNYA 2QA4G 5D8HB 2MGZB 4KGXB 5G4DA 3AJDA 3EYZA 1JLEB 3MM9B 3TOQA 2XLIA 5E33A 2EG2A 2FTRA 4LT6A 4C8ZA 3BQ2A 3VAHA 3BREA 3GLJA 3UD3P 2U2FA 2VFRA 4RNNA 4DQIA 3H5UA 1KNZA 5L1JA 2AYGA 2ZVSA 4Q8EA 4EU0A 1EETA 1UWBA 2F9JA 4RW9B 3CPWR 4CO5A 2UU9F 1E6VB 1RHMB 3IN5A 2D9OA 1FFWB 2MHEA 4JI1F 3DLGA 2QLXA 2BMBA 4WE1B 2KL8A 2YNHB 4TVAB 5KFHA 3BGLA 1Q5YA 5KT2A 5HMZA 2OEMA 2D7SA 4Y34A 3CWJA 1FRJA 2UXDF 2SXLA 2QYGA 3K89A 4X4UA 2LDYA 1K8AT 2DVIA 2Y0SD 2J5AA 3DLEA 4M5HA 3AD8C 4RWXA 2F40A 3DLJA 3BGRB 3NCPA 3PR4A 2RHSB 2HBRB 3JSYA 2B6AA 2HFSA 3M30B 2ZUAA 2NPIA 3W66A 3VGTA 2B9YA 4DCPB 5G0RA 3HHEA 1VQKS 2O66A 4ES1A 2CIMA 4KTQA 2NCKL 3EPIA 2JEJA 3W62A 3NCQA 2JVRA 1HQEB 3TAQA 3E3XA 2H4WB 3TAMB 1P8GA 3JTNA 5D4OA 1RCXB 2H3EB 5HMYA 4ANDA 2CWXA 5C7PA 4DR7J 4LF8F 2IIHA 3SQGB 1TKTA 3K5OA 4EBCA 1X4HA 1CEZA 4MYUA 1NJWA 2R42A 2IC3A 3QLHB 3VWSA 4OFZA 3C46A 4ZCMA 5DO2A 2LEPA 4LBHA 2RRAA 3B4DA 3CCLS 1FX4A 4OYOA 3NGUA 4B9VA 3C6UA 2J0QD 4N5SA 3O1LA 3NEKA 4NXMF 5KFCA 4ZA1A 3S01A 4CRJA 3WQPA 3LALA 2LQJA 3TEHB 3DOMA 1KTQA 3PACA 1W7WA 1CQMA 2MZSA 1HWLA 5L1LA 4IH6A 3W63A 2BV3A 4B3TJ 4F7VA 4ECUA 1S7IA 3DOLA 4DG1B 1NCLA 4PPZA 1FRMA 4ED5A 4CNZA 4OHYA 4OZ0A 4J9MA 3GFZA 1V5VA 5DG8A 2PT0A 2GZOA 4CH7A 5L9XA 1KSPA 4N47A 1HYSB 4D3GA 3FDSA 2LLZA 3HHKA 1RDRA 1FFSB 4Q43A 4KPCA 3IR6B 2XNRA 3CJSA 3O2IA 3IWLA 1NB2A 3BBCA 3T6JA 3UNYA 1C4AA 3GJTB 4I4BA 2RQMA 5CD4A 1UFKA 3HPOA 5GAGI 4NOHA 5KOXA 2JZ5A 3BBBA 4UT4A 4NZ6A 1NPPA 1LWCB 1ZPWX 1VQMS 4FNIA 1YJRA 2AJ2A 1OY9A 3MF5A 2KG1A 2ZHOA 4JI3F 2NSBA 3OUYA 1FRKA 4RBVA 1Y9OA 1YLXA 1PKUA 1VRUA 2B9XA 1H7XA 2HFOA 2YQ0A 4DS4A 3LANA 3PW2A 3H5XA 2HZCA 2K1RA 3N01A 4DF8A 3S7RA 2WBRA 1KOOA 5LJ3Y 2HQGA 1YBUA 2DPJA 2HWTA 2L48A 3MOJB 2XWXA 5EX0A 3NP5A 2EI5A 2X1AA 1VLYA 3RBXA 2YY3A 1TAUA 5GMEA 2RQKA 4OHWA 3QO9B 3FSXA 1H38A 2EFOA 1WJ9A 4CIOA 1U24A 2VHGA 4NCGB 1M5SA 5KFXA 1RTDB 1RT4A 1X4DA 4ELUA 3H2LA 4JI7F 3SDEB 3ENWA 1VBKA 5DDOC 4X4PA 3L09A 4DV5J 5HBMA 1ZZFA 1KWMA 2PFDA 1JWWA 3EZ5A 3Q89A 4KBIA 3R7BB 4WKYA 4FF3A 1CS4B 4ID8A 4ED0A 3O8WA 1X9SA 3GV5B 5ETSA 3GZ7A 2RS2A 5A8KB 3GPAA 3R2DJ 3ZTQA 2U1AA 4HR2A 4ZPTR 1SC6A 4LFBJ 4USKA 5E0OA 2HURA 1K47A 4ZPAA 3F41A 3KXDA 4M5DB 4KAIA 5H9EK 2VODA 3BGOP 2CVIA 1VIXA 1X4GA 4OZNA 1SPBP 3I5AA 2RE1A 4MAKA 1GMVA 4WTYA 4P2SA 2QLBB 2IA6A 3S8SA 3QRPA 1RTIA 4KV8A 1QUVA 5I4MA 4DL4A 1I94J 2JEGA 3OTEA 2AKWB 3HDSA 3EWGA 1P9QC 2IPOB 2J8SA 2VFSA 2ZBRA 3CO9A 4O3SA 1NSQA 1M1GA 2JC1A 1EETB 4RUCA 1YX2A 5FD1A 1UWBB 1VRQC 4OX8A 3UWTA 1HL6A 3PZPA 3ETOA 3I6PA 3RBEA 3RUBL 2OKQA 3DLGB 4A48A 2RHQB 2XCAA 1RQ0A 4PCQA 1BQXA 2CQ2A 3N5FA 2Q43A 2MKYA 4V19J 1RT6A 2VC0A 3OJUA 2Z4PA 4A8OA 4K2JA 1YITS 3DLEB 4NLDA 5EGYA 1QAYA 2MB0B 1AXQA 3CEDA 3KG0A 4AD6A 4L72B 2B6AB 5DZ7A 2QA4S 2W25A 4PPDA 4ZIVA 1YWXA 5G0RB 2ZJQQ 4LSNA 4E2FB 4B9UA 5D0GA 1B7YB 4ZCLA 4P52A 1UFLA 3CXCR 1RUSA 3UNGC 1X4CA 3GMGA 3EVMA 2W8KA 3THPA 3NCRA 2M0GB 4B3MF 5L46A 4NLGA 4B17A 4ZVUB 4F8RA 1HNZJ 1G3OA 1KQSR 4EZ6A 2N4DA 1TKTB 4P7TA 2IC3B 4U6PA 1FESA 3NKYA 3AODA 1UMJA 2HQIA 3HJVA 4KO0A 1C4CA 1WF2A 5GVQA 3F0NA 3M8ZA 2HEKA 5ETLA 3C6UB 3Q23A 3DYAA 5BR8F 4U7UK 2YH1A 3M32A 3HZGA 4L76A 1KRPA 4DR3F 5DG9A 1UZDA 5AXKA 5B09A 2C42A 2AQ4A 4LF6J 4LF4F 3MPWA 3OFHA 3NOCA 2ACMA 1JLQA 3UN3A 2HQFA 5MAOA 3DOMB 3I32A 3P3DA 1CULA 2HW3A 3QGIA 3GCXP 4USMA 4GKKF 3DOLB 2O1PA 5CZXA 2DGWA 1RWPB 5C42A 3JYTB 6FD1A 2GHPA 4X4OA 4KY3A 2MKCA 3QJLA 1B4SA 4DX8H 4PXBA 1XIQA 5F41A 2DNZA 2ERRA 2IM0A 1ZM2A 2H5JB 2D74B 3LPYA 3TI0A 4FBUA 3OL9A 1FHTA 2IAJA 4J9LA 2ZH1A 4WYLA 5LMUJ 3D1HA 2V8HA 2AHOB 5B0DA 2XGPA 2HVDA 3GQCA 4DUZF 2W2QP 4MKVA 1MWQA 3LPEA 1YJTA 2R2SA 3TZZA 3ZTSA 3K5PA 2UVUA 3ZFVA 1N5QA 4IH5A 1IR1A 4WTOB 4DV3J 3OUYB 1R7IA 3UFCX 2JWNA 2A18A 2IVFB 4WFNQ 1VRUB 2IM3A 5KT4A 3DRPA 1QSYA 3BSNA 2K8GA 3UCZP 1HBNA 2K1RB 5FDLA 1JJCB 1VOMA 3HVTB 4PAAA 4AXJA 2CPFA 3JSRA 5AE3A 4BHQA 2E66A 3LP0A 2OH2A 1M5KC 1KD1T 2L3MA 4DU8A 1TK5A 4LF5F 1R43A 1N6QA 4OZ2A 4ZPCA 3CDBA 3M9MB 5D4PA 2ROEA 4MKYA 1FA0A 2JSXA 3PFOA 5B0GA 2HIYA 2WCXA 1CJTA 2ZBQA 4P72A 1S4FA 1T3NA 1Q8LA 4A8WA 1EIYB 4LF9F 4A8SA 5CH7B 4FF4A 2EFQA 5HBMB 2DNGA 3SEOA 4LF2A 5DG7A 4BWMA 2ROPA 2M7SA 2MDAA 1N88A 3W7BA 3HK2A 2KKHA 3CCZA 2LECA 2E9TA 2V8DA 4ECXA 1TFYA 3MUVP 1U25A 4QIWD 3MEDA 1T9TA 4J90A 2E5HA 4HI1A 3GE9A 1YZ7A 3RBZA 2V0NA 2FLNA 1FDBA 4IOAQ 3TJ8A 4ECSA 1SUQA 2I0XA 2ZH5A 4AQYJ 2NLWA 2GQQA 3IRXA 1VK8A 5K9FA 3GU0A 4YDDB 5LSRA 5KFJA 4IOBA 3DLBA 4QIVA 2UU9J 2Q66A 3MMJA 5B0EA 4BCAA 4ZS6A 4EYIB 4XK8C 1RTIB 1T9UA 2CJYB 2AP6A 4JI1J 4KV8B 3BSAA 3OTBA 3MHYA 4CLYA 1VC0A 2XY7A 5DQGA 1RISA 1RTZA 5D4LA 3AD9C 4ZP9A 1XK8A 1Q1KA 4O0NA 2DGSA 3EGVA 2XO6A 3HD1A 5C25A 2PA8D 2G2OA 2OPRA 1TKZA 4IRCA 3WHIA 3FK4A 2IYIA 3PYGA 3NWGA 4C48A 1F2GA 1UA0A 5J2MA 2V9WA 4WKRA 1H2VZ 1OO0B 2ADBA 3S1TA 2ZNYA 2LQ5A 4XAKA 1YRUA 3J81j 1WHVA 5KFAA 2CVEA 4WZMA 3J7AN 1RT6B 2CQDA 4USHA 4ENOA 3BJYA 2JDJA 3DRXA 4NA1A 3T5JA 1AW0A 2YBVA 4DHVA 2LA4A 3QQCD 5ETVA 5L8RC 1U1NA 4DEZA 4W98A 1Z2LA 3PM9A 2KFYA 3HKZD 2L9NA 3U1NA 2LEAA 3MMAA 4LF8J 2R7XA 1RWVB 4LSNB 4R5PA 4K8RA 4AL5A 1VISA 3KNAA 2NYIA 3VQSA 4P2MA 1UVLA 4GRSA 4N41A 3AB4B 2VFTA 2HAFA 3TUIC 2CQ0A 1YGYA 3NGKA 2EFGA 2WSFC 4U9RA 4NXMJ 4E8UA 3PO4A 4ILLA 3NS7B 3U02A 4ERDA 2PDAA 1G1XA 4KO0B 4RPFA 5HL7Q 5MLCV 4NLYA 2Z2MA 4WK1A 3W9JA 3DYAB 4MIWA 2LYVA 2VPZB 3M32B 2ZKUA 2PC6A 1U2RA 3MECA 4OLPA 2KT5A 2PSZA 2QFJA 4RLEA 1X9MA 3AHPA 4C8MA 9RUBA 3CJ8A 2HSEB 1KFSA 1YJ7A 1JLQB 1REVB 4I0WA 3CCUS 2MY8A 1CULB 4ECQA 4QIFA 4QYZK 3QNWB 1D9DA 4XDDA 1KHWA 1CG2A 2BJDA 3IO1A 2DD8S 3SBMA 3DRSA 3HX9A 4C8OA 1TU0B 3V4IB 5C42B 2MZ1A 3CJKA 2C3YA 2Y1RI 4K4YA 5C5JA 2KVQE 3KUGA 1NDPA 4W90B 2UUWA 3Q86A 5HMXA 1R8CA 4J9PA 3T5HA 4A46A 5AE2A 1TAQA 1EJ7L 3QAUA 1WDDA 3OLBA 3R2CJ 1AFIA 1TKXA 2IAJB 3KJNB 3ILOA 4Y3CA 4JI3J 1HWKA 2QSWA 4UOGA 3K5MA 5B08A 1TMMA 3J7YU 2NPFA 2K7KA 3PYEA 1V6HA 2EKYA 2FY8A 1S48A 3Q8UA 1U6BA 2D69A 3ZTOA 3AT1B 4W4MA 2V2KA 4OZJA 2G9OA 2MEWA 1NJZA 2R8HA 1BXNA 3R5BA 2JFKA 2CQBA 3SYZA 4ED3A 4HDHA 1IM6A 2DNYA 3BYRA 1T7PA 1KDNA 1IKYB 4N77A 3CMQA 1S10A 3L4BC 3Q83A 2B4VA 4OL8A 1RLDA 1URRA 3DRPB 3BYPA 4RWWA 4ECVA 1DJ0A 3BSOA 1HARA 1WEZA 1HBNB 4KHPF 5FDLB 4DSKA 3TUPA 1RZMA 4A8XA 3HHLA 4UZCA 4GO5X 4PXEA 1NK5A 1XERA 5F9NA 4LVNP 2V9KA 1XN9A 1S0OA 1U1PA 3HO1A 4JI7J 5KFOA 1JXLA 3CJ3A 4C7QA 3LP0B 2QRRA 5L38A 3FKBA 2CG4A 2H5EA 2CG8A 4QW9A 3JAMY 5HSPA 2VFUA 4C6AA 2PFFB 4Y6IA 1N6QB 3DCAA 1QY7A 5HMWA 4QQBA 4NYPA 1V3ZA 1QTMA 3V6DA 2CFXA 2GGPA 2FHKA 2F8MA 1TKDA 2VC1A 3KLFB 1CJTB 2J6UA 3FNNA 2XLJA 1IR0A 2RNEA 4X65F 3TVYA 3OL6A 4LF7F 3CJ4A 3SV3A 1K73T 4I67A 1U7LA 3LGHA 4RO0A 3RAQA 5AXLA 2WSCC 4OYMA 4FN5A 3BKUA 2HHQA 3TX8A 3A3NB 2FGCA 4F3MA 1FNMA 4EO6A 2HNZA 2XMKA 3KHGA 5CD4H 2CQIA 2IVMA 1IWAA 2KHCA 3FMBA 3HKWA 4F0HA 3HVAA 2CQ4A 2LU1A 1GH8A 3N79A 3MEDB 5J1PA 5KG7A 2VBYA 4DOZA 5M2PA 4OX7A 2AD9A 4LFAF 2VBXA 5GADU 3D6TB 3OTOF 3I0RA 4ZJQA 3R6LB 1RT7A 5KFPA 2HRTA 2FHOB 2IY5B 3MTKA 1SUQB 3TVKA 1U1LA 4C4WA 1H3DA 3CNQP 2MQNA 4NMXA 4WF9Q 3IRXB 4ZP7A 3WZ0A 1U1OA 1FDNA 1VQ6S 1VIOA 3M6WA 3MR2A 4P9SA 3ZZPA 4LR8A 2MQLA 1Q16B 2GVZA 1V3RA 4AFFA 1UETA 3UPFA 3MD3A 5C25B 4OYBA 2MZQA 2OPRB 2HHUA 2QIFA 1NHUA 5E7OB 1BC6A 4M63A 3F56A 4KFBA 1XQIA 5J2MB 1TK0A 4H4KC 3TEGA 3LF0A 1NJIT 1SBRA 3EM1A 3I87A 1CPZA 1Z2ZA 5DJBA 2KM8B 2AEJA 3UO0A 3TRGA 4ETZA 5U47A 3TA0A 5DDRC 3M05A 3K5NA 3MUTP 2QSFA 2J9DE 3VAKA 2MKKA 3D54A 4QIGA 3MM7A 4E0DA 4I56A 2DEJA 2K2PA 1WNEA 3M6UA 3ISZA 1NEEA 1TL4A 4RW8A 4IH7A 4B9MA 5HO4A 3Q8RB 5T7LA 4PYDA 4MK8A 4ZVRB 3W3SA 3P45B 3P96A 2RIJA 1NLKL 1NPKA 2AJQA 4P74A 1I6JA 2B43A 3MMAB 3UDEA 2GFFA 3H40A 4DJBA 2RU9A 4R5PB 5J1EA 3RBDA 4NLOA 4C3LA 3CUNA 2HS3A 1LW0A 2PEHA 3RB6A 5KFIA 2OO4A 3R1LA 5FLXY 3AA9A 4ZOSA 5BR8J 2CRLA 4ZVOB 2WONA 2BJ1A 4WBFA 4DR3J 5KG5A 4ECYA 2ZNZA 3R7NB 2R2TA 2QLWA 1KBRA 3AXKA 3ZZ0A 4LF4J 3ZZRA 3KDNA 4F4ZA 3CW2C 2DJWA 3G4SS 3VAJA 1FVSA 4OHVA 1XR7A 4FPIA 2CQPA 1SJ3P 1PO6A 4DF4A 3IBWA 4GKKJ 3MECB 2BW7A 1IBKF 2YPZA 2J9CA 1FXDA 4UOHA
chains in the Genus database with same CATH topology
1PILA 2VUGA 4J5OA 3FEXB 1TV6A 1JJ2R 2MSSA 2W7AA 3KLGA 4MKBA 1N54B 2XEXA 2ZH4A 4ID5A 4WYWA 4U67Q 2QEXS 2DNQA 2GNKA 3KLVA 5KFTA 3R3TA 1RTJA 4DV1F 3VQTA 4M5DA 1BLUA 4CNYA 2F7VA 1HMVB 2QA4G 1HNXF 2XCPA 5D8HB 3KG1A 2MGZB 3M2VB 4AL6A 2R8GA 5G4DA 4Q44A 2ZD1A 3EYZA 2VQFF 5K8PA 1JLEB 3LP1B 3MM9B 5K8NA 1HR0F 4X62F 1JLCB 2HS4A 4NLXA 3TOQA 3DRSB 5J2QA 3H5SA 2CPXA 2GO9A 2XLIA 5E33A 3CTRA 2IM2A 5B0BA 5F8HA 2EG2A 2FTRA 2F4VF 3CJKB 3W2WA 1R8BA 2C28A 1HD1A 3E8OA 4JBCA 4LT6A 4K50A 5AXNA 3O6QA 4C8ZA 5T41A 5GAEI 3BQ2A 5FIIA 3VAHA 3ZZUA 3BREA 2FC9A 3HMJG 1D8YA 3UD3P 4ECRA 1QVGR 2U2FA 2VFRA 4RNNA 2DGVA 2ZHBA 2I2YA 4DQIA 3H5UA 1KNZA 1SI9A 5L1JA 3G6YA 2AYGA 2XSJA 2ZVSA 4B3RF 4UUWA 3JB9k 3KKFA 1X4AA 1FJEB 4Q8EA 1JLFB 4EU0A 1L3SA 5EUHA 2DNPA 2NQPA 3OVBA 4C3MA 5HI7A 1EETA 1M5VC 1TKXB 2AWZA 1UWBA 2PA3A 3MEKA 1F9FA 3UD4P 4DN9A 5F8IA 2AX1A 2E1AA 2F9JA 1O8BA 4GMKA 4RW9B 3CPWR 4CO5A 2UU9F 1E6VB 2VZ9A 1XEZA 1LKZA 3IN5A 1TP7A 4JV1A 4RX6A 1Y3KA 2D9OA 3N6LA 4X84A 4JI8F 3TA1A 4CH0S 4WFBQ 3QGPA 2G13A 2MHEA 1V3SA 2P9CA 4JI1F 3ISNC 3DLGA 2QLXA 1J2VA 2QA1A 2WTFA 4WE1B 3V6JA 2HMIB 2YNHB 4G3IA 3X1LB 4HI2A 1QSLA 1U6FA 3TNVA 3MTJA 5KFHA 3BGLA 2BANA 3DHWC 4TQRA 2WOMB 3KK2A 2GX8A 4YFUA 1U49A 3E2EA 5DQIA 5KT2A 4F4WA 5HMZA 1PC5A 2D7SA 2HG4A 3CWJA 4Y34A 1FRJA 1VK3A 2UXDF 1M5OC 2SXLA 2RB7A 4X4UA 2LDYA 1K8AT 3JTPA 2G0CA 5JUMA 1R27B 2MSTA 1NK6A 2DVIA 2DR9A 2Y0SD 4DV6F 4CI0B 3QYYA 1TVRA 1KFDA 2J5AA 3CJ5A 1SL0A 2RF2B 3EPGA 5E5NA 5KTQA 4ALZA 3NBPB 2WB4A 2CJQA 3DLEA 3U7JA 2FJVA 4RWXA 4XPEA 1N36F 2F40A 1D9AA 3KHLA 3DRYA 2N3OA 3DLJA 3BGRB 2HVZA 3IR5B 3IXQA 3NCPA 3SSRA 3PR4A 5I42A 4RW4A 2YX4A 4MH8A 1A7GE 5LXYA 3JSYA 4HHJA 1GX6A 3GSDA 1QLNA 4LQ9A 2B6AA 1FEEA 2J7UA 1VJWA 2D9PA 3M30B 2KM8C 3OVSA 1J5OA 3K8VA 5IWAF 5E3QA 3ICLA 4Q45A 2VBWA 1N56A 3HHLB 2NPIA 4ZPWR 2O3DA 3AA8A 4O23A 3UW1A 1K0VA 2XMVA 2LQ9A 3FRZA 2B9YA 4QWCA 5G0RA 3HHEA 5LJ5Y 3LP2A 3PEHA 2O66A 1VQKS 4RW7B 4ES1A 2IFXA 4N8OA 3BO2A 1UP1A 4YB5A 2CIMA 3BS9A 4KTQA 1N48A 2XGQA 4UUXA 3SCIE 3EPIA 2JEJA 5KFRA 3NCQA 2O01C 2JVRA 3IWXA 3IWNC 1HQEB 3RRKA 3TAQA 3QWPA 2M52A 3E3XA 4LIWA 3Q24A 4UQGA 4K59A 1FJGF 1RAJA 4JI2F 3PIPQ 5KFSA 1REVA 1WI6A 1J5EF 1Q82T 2OMLA 3TAMB 3R5AA 1DTQB 1P8GA 4NMLA 2R8JA 3JTNA 5D4OA 3NS6A 5JVHQ 2Z0GA 1XTZA 2B0GA 3OR1A 5HMYA 1UEVA 1FK9A 1DBDA 1H2UX 4DSIA 3TUZC 1APSA 2HPUA 1X5OA 4LF8F 3SQGB 1H6KX 1TKTA 3V6DB 1ZETA 3CMES 1RTHB 4DV2F 4B08A 2J9DA 3K5OA 4EBCA 1X4HA 1CEZA 2ZH6A 2GGPB 4MYUA 3HHDA 1NJWA 3SSSA 2IC3A 3QLHB 4RW6B 4OFZA 3VWSA 3J7A1 3C46A 4ZCMA 3V4IA 5DO2A 2ZKTA 4EZ9A 5DM6Q 2LEPA 5K14A 2RRAA 4AUKA 2AJ1A 3B4DA 3CCLS 3D0IE 2HFZA 2X1FA 1S1XA 4BDPA 3CDEA 1MSWD 3KYLA 4EBDA 4B9NA 1JNZB 3MM6A 4M1KA 1X5PA 2BQ3A 3DMJB 3US5A 4B9VA 1DFDA 4DFJA 3C6UA 4CCHA 1VQ5S 2J0QD 3SXLA 1RYRA 1Y00A 4N5SA 1YRTA 4Q0BA 4B3OA 4LQ3A 3R5DA 1N5VA 3K7RA 4AYBD 3O1LA 2MKHA 4NXMF 5KFCA 4ZA1A 5EWEA 3S01A 4OQJA 2IBOA 5D77A 2HNZB 3N6MA 3B4MA 2YNIA 4PUOB 3LALA 2R7UA 2OMOA 3A1YG 2C2RA 2HVIA 1Y7PA 3E51A 4YB1P 2LQJA 2NSCA 3FQKA 2DHAA 1VQLS 4G1IA 1HW9A 1OSDA 4NLVA 4OJ3A 4JI6F 1FTRA 4X2BA 4FYDA 1JIHA 3DOMA 1KTQA 3PACA 3R5CA 3WX4A 4IO9Q 1PGZA 1CQMA 1C0TA 2MZSA 1S9GA 1HWLA 1WHWA 5L1LA 4IH6A 2IVYA 2OFHX 2BV3A 1GAOA 2XMUA 2GMJA 4PG8A 2HHPA 3G8SA 4ECUA 2BE2A 1ZM9A 2IYGA 3MMBA 1ZZNA 2AW0A 3DOLA 3I0RB 3B8HA 4DG1B 1NRKA 3OL8A 1N34F 4PPZA 1U1QA 1FRMA 4ED5A 1KVJA 4CNZA 1RT7B 1FF2A 2HGMA 4OHYA 4OZ0A 1N52B 2B4OA 2KDOA 4J9MA 4F4YA 3GFZA 4FVCA 3UI3A 3U27A 2OTJS 4I2QA 1V9OA 3OBIA 2QZ8A 1YI2S 5DM7Q 5DG8A 2PT0A 4ITSA 4JI0F 1WHYA 2GJ2A 1T05A 3PXGa 4CH7A 5THWA 5L9XA 1IKYA 3FZ2A 4DR4F 2YKOA 3IA0A 4GC7A 4Z2XA 3KLIA 4DQQA 1KSPA 2EG1A 4WU2A 3FQLA 1CSJA 4N47A 1RT2A 4ZDNA 1HYSB 4D3GA 3FDSA 4YDXA 2LLZA 3KHHA 1RKIA 3HHKA 2BRKA 1HBMA 2ILYA 5J2PA 3ITHA 2LEBA 2HFNA 5KG2A 2VOOA 1RDRA 4TY9A 4Q43A 4DFPA 3KK1A 1G2EA 3IR6B 4ZK7M 2XNRA 4I6YA 2ZC4A 1DARA 3CCQS 3O2IA 5I3UB 4KHRA 1FKPB 4XPCA 3IWLA 3PJXA 3SFUA 1YBAA 4TLRA 3W2VA 2CZVC 2IRYA 4X66F 3T6JA 1N0UA 2DGUA 1C4AA 1VQPS 2AYEA 2P5VA 1SJ4P 4I4BA 2RQMA 4OLOA 4IYQA 2YKPA 4YHHF 2QT7A 4MK7A 1U1MA 3M8SA 3HPOA 4W92B 2FJEB 2OP5A 5GAGI 1N5YA 3GIMA 3GIIA 1JLBB 2AGQA 1ROFA 1A6LA 2KYZA 4NOHA 1T02A 2JZ5A 5A8RA 1R8HA 5KOXA 1YTYA 1S72S 4QIEA 3I0SB 2JEFA 3BN4A 4URSA 4NZ6A 3F44A 2EK1A 2KXFA 3DLLQ 5L9NA 3CCJS 1IKVA 2FHJD 4LMZA 2RDJA 1LWCB 1ZPWX 1VQMS 2OSRA 1VQ9S 2C3OA 4FNIA 4KFBB 1B7FA 1YJRA 3P5TL 3MGJA 3MF5A 4E98A 2KG1A 3KOAA 2AJFE 4FNHA 4IRKA 1ZPVA 2ZHOA 4JI3F 4NPOA 2N7YA 2NSBA 3OUYA 1FRKA 2VA2A 5I3QA 4RBVA 4URQU 1HBUA 3RAMA 3BO4A 3B78A 1Y9OA 3RB4A 4QPTA 1WEYA 1X5SA 2O67A 1U09A 3DDKA 1X0PA 3UDLA 5CYJA 3MM8A 3KLFA 1MU2A 1VRUA 1SL2A 4MFBA 2B9XA 1S0VA 2N82B 3PHEA 4DV4F 1H7XA 5BYQA 2DPIA 2JJ4D 2HFOA 1S49A 3GFXA 3CC7S 2NXUA 4DS4A 3LANA 3PW2A 3MM7B 3T9NA 3H5XA 2HZCA 2K1RA 3N01A 2ZITA <