1IQTA

Solution structure of the c-terminal rna-binding domain of heterogeneous nuclear ribonucleoprotein d0 (auf1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords heterogeneous nuclear ribonucleoprotein D0
publication title Structure of the C-terminal RNA-binding domain of hnRNP D0 (AUF1), its interactions with RNA and DNA, and change in backbone dynamics upon complex formation with DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1iqtA00
3CPWR 5LJ3Y 1U1MA 5IM0B 2E5HA 1YI2S 1K9MT 4TLQA 3CC2S 3IRWP 2L41A 2F9DA 2L08A 2RU3A 3JB9k 5GAEU 1VBXA 2NLWA 2DNNA 3CCSS 2CPJA 3MOJB 3VAHA 2CQ0A 4WCEQ 3SMZA 1SJRA 1NJIT 1BY9A 1XN9A 4U67Q 1UAWA 3FEYB 1S72S 4W92B 3UD4P 1G2EA 2CQBA 2KG0A 2DGVA 1FO1A 3CD6S 5DM6Q 1SJ4P 2DHSA 2M2BA 3VAMA 2MGZA 2F9JA 1F9FA 2OTLS 2J8AA 2M8DB 3TO8A 2G0CA 1SJQA 4QU6A 3P5TL 2CPFA 2VONA 1VQ6S 4YB1P 2MZQA 1WF0A 5JVHQ 4QU7A 5LSLA 1A9NB 3VF0B 4EGLA 5CA5A 2DNMA 3NNCA 1WHWA 1VBZA 2ADBA 4IUFA 2LCWA 1FJCA 2KXHA 1HL6A 2CQDA 3S7RA 2LQ5A 3P49B 1JJHA 1U1LA 2KHCA 2DNQA 2YH1A 1DRZA 2DGXA 2DNZA 5D78A 4CH0S 1IQTA 1YTYA 2X1GA 2RQCA 1FHTA 5CXTA 1CVJA 5LXRA 1VQMS 2QEXS 2MZSA 1VC0A 1HD0A 1WHYA 2DHGA 3EX7B 2RRAA 3CMES 2KXNB 3CCJS 3CUNA 2ZJRQ 2MKSA 3CF5Q 4F02A 1UP1A 2JRSA 2D9OA 2LYVA 3RW7A 2CPHA 2FC9A 1ZZNA 4F26A 1WEZA 3U1MA 5HO4A 2E5JA 1VQKS 2DISA 3B4DA 5D77A 1OWXA 1ZZFA 3G9CA 2HYIB 2XB2D 2HGLA 1H2UX 3NMRA 2BZ2A 1X4FA 4CIOA 3CULA 3LQVA 1KD1T 1D9AA 2B0GA 2EK6A 3DLLQ 1D8ZA 1L3KA 3MD1A 4W90B 5ITHA 2HGNA 4Y0FA 1P1TA 3UCGA 5DDQC 1Q7YT 3MD3A 1VC6A 2DGQA 4FXVA 2CQPA 3BO2A 1OPIA 3BO4A 1Q81T 2DNGA 2U1AA 1DHMA 1S79A 3CCQS 5FJ4A 2DNHA 2DGSA 3R27A 3SXLA 2X1FA 1N54B 3CXCR 3THPA 5DM7Q 2M0GB 1HD1A 3Q2TC 2LEAA 2CPIA 1K73T 2DNKA 3EGNA 4OZ1A 3MI7X 5JVGQ 2MQQA 1JMTA 3UCUP 1YWXA 1X4EA 2DIUA 3NS5A 3VALA 1SJ3P 1P27B 2MSSA 2MB0B 1FJ7A 1VQOS 2K8GA 1QVGR 2MKHA 2DNYA 3H2VE 1YJ9S 3TP2A 3MXHP 3G8TA 5CYJA 2FPHX 4WIIA 2SXLA 3CC7S 2KH9A 3EGZA 1NU4A 3DXBA 1X0FA 2LEBA 5IQQA 1K8AT 1URNA 3FEXB 1NO8A 1YITS 2CQ3A 2CQ4A 2MQPA 3MURP 3PIOQ 2XS2A 2CPYA 2X1AA 3RW6A 4CH1A 2EVZA 5GVQA 1WELA 2VOPA 2KYXA 2MPUA 2XS7A 4LJMA 5DDOC 5IM0A 2CPXA 1X4BA 2A3JA 4WFBQ 3MUMP 1WHVA 1Q82T 2LA6A 2DH8A 5LSOA 2M7SA 2RT3A 2RNEA 2N82B 2K3KA 1WI8A 1OO0B 4QPTA 1N8RT 3VAFA 2I38A 1X5OA 2HGMA 2F3JA 2MQMA 1N88A 1WEXA 2DK2A 1JJ2R 1X5SA 1RK8A 1PO6A 3OW2R 1X5PA 2DNPA 2ZJPQ 1VQNS 2CQCA 4UQTA 2FC8A 4LMZA 2KVIA 3HHNB 2MZRA 2O3DA 1YJNS 2J0QD 2M88A 3ULHA 2MZTA 3CCVS 2KG1A 2FY1A 3J7ZT 4PKDB 1H2VZ 1H6KX 2OJ3A 1SJFA 2M9KA 1UFWA 1WG5A 1M5OC 2MMYA 1U1NA 2DH9A 2CQ1A 2MKIA 2CJKA 1WTBA 2DNLA 2KFYA 3UE2A 2DITA 3UCZP 2L9WA 4FXWA 4WF9Q 1A7GE 2U2FA 1RKJA 1QVFR 1X4AA 1KOHA 3CTRA 2QA4S 3HI9A 5GMKa 1M5KC 3US5A 2KXFA 3MUVP 1H2TZ 2YWKA 1WG4A 2VODA 3NNAA 1WG1A 2CPDA 4QQBA 5DETA 3BS9A 2RS2A 3G8SA 5MLCV 4YUDA 2V94A 1B7FA 2J0SD 2KI2A 3TYTA 2ERRA 1M5PC 1DZ5A 3H2UB 2MYFA 2LECA 1KQSR 1KC8T 2BOPA 4YOEA 1U1OA 3P6YC 2KM8C 3CCMS 3Q2SC 1QM9A 2LKZA 2D3OR 2MZJA 2KRRA 2DH7A 4V19X 4TU8A 2PE8A 1YIJS 1UW4A 3P3DA 3CCES 2VOOA 2DGUA 2JX2A 2YH0A 3N9UC 2MY7A 3LPYA 3L3CA 3SDEA 2AYMA 2MQNA 5LJ5Y 1VQ5S 4IO9Q 2DGTA 2KRBA 2DHXA 1WI6A 1U1RA 2MJNA 2KM8B 4PRFA 4P6QA 5H1SV 2MY8A 3U1LA 4ZKAA 2N3LA 5LXYA 3CCRS 2MXYA 3VAGA 3NNHA 2CQHA 3IWNC 2OSRA 4BS2A 1DBDA 5HL7Q 1R8PA 2LA4A 1VQ8S 2DGOA 3THTA 2UP1A 5GADU 5GAHU 1HA1A 3UD3P 2I2YA 2JVOA 1VQPS 2AYEA 1VQ7S 2MQOA 2MGZB 2D9PA 2KT5A 2N7CA 1KOOA 1OIAA 3I56S 3G6ES 3VAJA 4C7QA 2E5GA 2M8HA 2AYBA 2CQ2A 2N3OA 5DDPC 2RRBA 2JWNA 2LXUA 3G96A 2NZ4A 3R1HA 1O0PA 2MSTA 3J7YU 3CC4S 5DDRC 4WFNQ 2CPZA 1U1PA 1VC5A 4Y00A 3VAKA 1X4DA 1WF2A 4IOCQ 2ADCA 1X4CA 1SXLA 2G1DA 2E5IA 4A8XA 2MKCA 4WFAQ 2XS5A 4RU2A 2CQIA 2DHAA 3CCLS 2XNRA 2DB1A 3MUTP 1M5VC 4C4WA 2RS8A 2X1BA 2DO4A 2RVJA 3CCUS 5IFMA 1FXLA 2OIHA 2DNOA 1U1QA 2RUGA 3I55S 1U2FA 1WEYA 3MDFA 2MQLA 2GO9A 3ZZYA 4J5OA 2AYGA 3V4MA 2Q79A 2FHOB 2DIVA 1VQLS 4WKRA 2CQGA 1VQ9S 1ZH5A 1X4GA 3B4MA 2PEHA 1FNXH 5EN1A 3BO3A 2EK1A 2ZJQQ 2AD9A 2G4BA 1N52B 1FT8A 1PGZA 4CQ1A 2MHNA 1Q86T 1WHXA 2M4MA 1W2BR 5GAGU 1YJWS 3CMAS 1VBYA 1WF1A 3SDEB 2CPEA 2HVZA 1VQ4S 1U6BA 4TU9A 1X4HA 4ED5A 1AUDA 1U6FA 3S6EA 4IOAQ 2KU7A 2M70A 4Z2XA 1M90T 1FJEB 4ERDA 3BEGB 3G4SS 3K0JA 3VAIA 4UY8T 3S8SA 2OTJS 2OSQA 1X5TA 1JJ4A 2YKAA 1U1KA 3D2WA 2GHPA 4C0OC 2XNQA 4M5DB 2J76E 4PR6A 2LMIA 3S01A 3PIPQ 4F25A 2LXIA 2KN4A 1M1KT 2RQ4A 1WWHA 1R8HA 4TU7A 2WBRA 2YTCA 5BJRA 3G71S 2MKJA 2M52A 3UWTA 2QFJA 3NS6A 2MKKA 2DGWA 2JVRA 2MJUA 2DNRA 2HZCA 3ZZZA 2DO0A 2XSFA 1YHQS 2E44A 4LIRA 4OZ0A 2MZ1A 3R1LA
chains in the Genus database with same CATH superfamily
4HT5A 1OQ6A 3KUEA 2PA3A 3OSPA 3ZZRA 4KTQA 2ZH1A 2W25A 3K17A 2VG6B 4DMZA 4B02A 4K2XA 1BY9A 2RAQA 5K14B 2AMCB 3RRKA 1X9WA 2AHOB 1QE1B 1SJ4P 2M2BA 2W7PA 5KFFA 5KT5A 4JI6F 1TP7A 1E6VA 1N5SA 3B78A 3EVWA 4DR1F 3A13A 3I82A 3MMBB 1WF0A 4QU7A 2DNMA 2GVZA 1S5ZA 2OEJA 3BSCA 3OD2A 2WK4A 3OR1A 4O4GB 4JV5F 2RF2B 1IQTA 1EX8A 4PPZA 4ZPAA 4RW7B 3CJRA 3J7YI 1HWUA 4LT6A 2UVWA 1IM6A 1TL7A 1X31C 1S6OA 5KFNA 3N01A 3KJVB 4QIVA 3BSOA 4DV3J 1JKHB 3CUNA 3W8GA 3JSYA 5CZXA 3ICLA 4TY8B 2Z30B 4OYAA 3DYAB 1S6QA 1FJGF 2BZ2A 3V81B 4ZJQA 2HQDA 4CO0A 1NMEB 2R7XA 3IAS9 3KLGA 2B6AB 4RUAA 2V2QA 5J2QA 1JLFB 1TKTA 2DGQA 1REGX 3SQGA 2FUG9 3C6TB 3ZTSA 2G0JA 4DUZJ 3MWBA 2M0GB 2GZOA 1SJ1A 4OZ1A 3UR3C 1HHSA 3IR6B 2PFDA 3OVBA 1FDBA 1HNZJ 4IH7A 2LEPA 5HMYA 3PKYA 4DL5A 5KFWA 4DEZA 2BDPA 5E2QA 2G0IA 2OMOA 2AT1B 1Q8LA 1NO8A 2ROEA 1CJUA 4DPUA 1RYSA 4KSEB 4J9RA 4O44B 4OYXA 5EDWA 5HQMA 3N5FA 4KRWA 2FLNA 1IBLJ 3BH6B 1N8RT 3FMWA 4X65F 5AT1B 2CJXB 2GVZB 2HURA 3PEHA 2QFIA 3OR1B 1PILA 2BQ3A 2JJ4D 1N5YB 2PN6A 1CULB 2V9KA 3R2DJ 2ZC3A 1B0PA 4DL4A 2DNLA 2U2FA 5K8NA 2BABA 2NXUA 3AOBA 2RS2A 1VOMA 4DR3F 2L9NA 4UQGA 3JXOA 3M1VA 4C8ZA 2D3OR 5E3QA 3SQGB 3OFGA 4GKJJ 1SBRA 1R27B 1UW4A 3BKTA 4ELVA 2VIHA 1PCAA 5LMNF 4USWA 3LPYA 3V6JA 1WNEA 5LJ5Y 3NCQA 1NK8A 4O3QA 1VBKA 3BBCA 2ZBQA 2AGPA 1I1GA 4LFBJ 4NCAA 1EHWA 4QPXA 3BR9A 2GIQA 4CLPA 2OSRA 1O6XA 1CJUB 1S1UB 1VQ8S 1T03A 4HL9A 4FNIA 3LA0A 1U0HA 3TNVA 4M5GA 4OIXA 4XAKA 4X4VA 4EO8A 2I9SA 2RU9A 4DV1J 1U1PA 1W26A 3EXYA 2VG7A 3FMBA 4DR4F 2B43A 2ASYA 3GTYX 1MN9A 1V9OA 3GR1A 2IRUA 4ECVA 3EGVA 2RVJA 2ZH9A 2ABYA 4KH1B 1VQLS 5F9LA 3M1VB 2IDLA 4FKXA 1B64A 2F8EX 3GPAA 1N34J 2FJXA 1XR7A 3J81Y 2CKWA 3CWJA 3FRZA 1EZZB 3ENWA 4DSLA 4URGA 4ED1A 4EEYA 4R25A 2I8EA 2ASJA 1ZS6A 4OYMA 1ITPA 3PYDA 4DR5J 1BWEA 4OHVA 4QR2A 1R0BG 1T03B 3B82A 2CRLA 3OR2B 3R5AA 3O5TB 5BJRA 3OV7A 1HBUA 2VFVA 4I56A 5KFAA 3W62A 5JUMA 1HWKA 2FJWA 4ELTA 1YI2S 1TZ0A 3D54A 2RU3A 2F5GA 3HXMA 4A48A 2HNZB 4JYAJ 3FEYB 3KNAA 4HACB 4DSJA 1UEKA 1FO1A 3VZHA 3RAMA 3VAMA 4X84A 2HAFA 3MEGA 3QATA 1J5OB 1NSQA 5C24A 4JI2F 3ILLA 2OPRA 2R2SA 1R7IA 2W2QP 1N0VC 1RWOB 5KFEA 2IMOA 4KR0B 2CJAA 2W8LA 2LXFA 3GIJA 2K06A 1FHTA 1OS5A 3E51A 1CVJA 2FZGB 2A2CA 2V63A 3PYGA 1HD0A 4DX7A 4QWCA 3CCJS 3HVTA 4LFCJ 5F9NA 3HVWA 1ULRA 1MMLA 2VFRA 4F26A 1OWXA 3G9CA 1B4SA 3NMRA 4F36A 4NLDA 5E33A 3CCZA 4B3SF 3FCWA 3MD1A 3C6UA 2A6OA 3GFXA 3HM9A 2NUHA 4EZ6A 2XZWA 2UVVA 5HVGA 3FVYA 3BO4A 2RDIA 2XWYA 2LQBA 3ZZOA 4ZHRB 1N54B 4DHVA 5E3PA 1U0SA 4FPRA 1HLWA 2MQQA 2QYCA 4LF7F 2J7WA 2N4DA 2HHXA 1VQOS 4JOUA 4QJVA 2IJRA 3CC7S 4ICLA 4O0IA 1F1BB 1HNVA 1WELA 3QLHA 4JUZA 4EK2A 5F3TA 2DR8A 4LF8J 5IM0A 4WFBQ 4ALZA 3MEGB 5EWGA 3QJLA 5C24B 4NCBA 2OPRB 3MCSA 4DQSA 1ROFA 3JYTA 1X5PA 3T1AA 2IDEA 4I67A 4ZIWA 2B8QA 2MZRA 1WKLA 2EC0A 4LF4J 1SJFA 4HH0A 3DLEB 7AT1B 2CQ1A 3UE2A 2WSEC 3ZNJ1 2YQ0A 1LW0A 3MUVP 1WG1A 4QQBA 1B0TA 4K8RA 4QOTA 3OQ2A 4U9RA 3ZZTA 3VGTA 3P96A 5CYMB 1SKWA 3H2UB 1KEKA 5HP1A 1KC8T 2QSWA 1F5CA 1HWIA 2EFVA 2C2NA 3QMQA 1X9SA 4TU8A 2VQFJ 2HFZA 4KBIA 2J6TA 3ITHA 2CJBA 1FRJA 1KVJA 3BR8A 2HRYA 1W25A 2WBMA 3OXLA 3KJQB 3BGFA 1V5IB 4ICLB 3BYPA 4OLOA 2AEFA 5IT4A 4C8NA 1DBDA 5HL7Q 3CIMA 3V2UC 4OX6A 1SQEA 2XI3A 3QLHB 3OL8A 2V5HG 3VHQA 2WCXA 1JLAA 2XQCA 4EBEA 2C1EB 2MQOA 4DSIA 1XWLA 1KOOA 1KHWA 2R7WA 2F8MA 3BQ2A 2LU2A 4LBIA 5LL6d 1S12A 4PG6A 4ZJLA 5CD4H 2C3MA 5DDRC 4LSZB 2NXCA 2HIQA 4L73A 2UUAF 5A6PA 2Z57B 2OKQA 1TL1A 1LW0B 1O51A 1ZETA 1X9MA 3EJMA 1NZ8A 2JL9A 1U1QA 3DRYA 2RUGA 2DRAA 1WEYA 2RMLA 2MQLA 2VF3A 4J9PA 4N7TA 3FC9A 1N5VA 1VLOA 2FHOB 1N33J 3HJFA 2PI5A 3RB3A 1MU2A 4HLBA 2AD9A 2G4BA 1HNXJ 4G65A 3GWCA 5F3ZA 2HNDA 1YJWS 4B3MF 3KK2A 2XMKA 4OYIA 2R7SA 4EYHB 1QTMA 2OSQA 2W8KA 3BGLA 2QC3A 3ENAA 1AUSL 1R6YA 2OPSA 5A6WA 3RR8A 5CD4A 1NKEA 4F25A 4UT4A 1AZSB 4RUCA 2HHWA 1HW9A 1Q7LB 1UEVA 2ZKUA 3CPWR 5LJ3Y 3HZEA 3ZTRA 3LTOA 1S1TA 1P1LA 5E0OA 2NLWA 4LF2A 2V69A 3DFEA 1FTRA 2HIYA 5FIIA 2ZM6F 3SSRA 4WCEQ 1IWGA 3M30A 2D3O1 4PG8A 5F8GA 1CJTA 3QT5A 2UV8G 4ED7A 5G0RA 3JQKA 1HI0P 1S59A 2DHSA 1VYAA 3TJAA 1TL1B 4V19J 2CPFA 1Q5YA 3JTOA 2KL8A 1CPZA 4P2MA 4CLZA 1XR5A 1FWPA 3PW0A 4USKA 1LV5A 2DNZA 4BBYA 2F1FA 2KJWA 1BXNA 2VZ9A 1MU2B 2GCFA 2XCPA 4BHQA 2EFGA 3D1HA 1MROA 3C15A 2IYIA 4OJ1A 1Q8IA 3KK2B 3DLGA 3W3SA 3RW7A 5AE3A 4DV5J 4OI4A 1VQKS 3G6XA 4QZVB 4JP8A 3L95X 2EK6A 3MM8B 4HTIA 1YJVA 2OPSB 3M8PB 4PWDA 3CD0A 3UCGA 2YX4A 1S1WA 4OLPA 3PO5A 1TQLA 1Q81T 1S79A 2MTLA 2OPPA 3I0SA 2OFGX 3SFUA 1YJUA 3H90A 3SXLA 4HEA9 3OPKA 4DSEA 4WP3A 2HWHA 4KFBA 3I5CA 5DZ7A 2EBEA 1P27B 4JI6J 1KRPA 1VGYA 1IKWB 5J1EB 3QGPA 4I6AA 1ZM2A 4RUHA 3M30B 1FX2A 3FQKA 1CJTB 2J9CA 1YITS 2EPIA 1YBUA 1T9XA 1IR2A 2XY6A 1JLCA 4JV5J 1G3OA 5G0RB 4ED6A 4PXCA 3MCOA 3RAQA 4IFYB 1TKXB 1FERA 3MM6A 2RNEA 4M5IA 4ED0A 1OYDA 3W5ZA 2PMWA 2IPOB 3C46A 1JJ2R 1NBEB 1X5SA 3NP5A 1FJGJ 1FWKA 3QWUA 1A6LA 1FRLA 4C8KA 3OFEA 1KN6A 2I1RA 2KVIA 4CO2A 2J0QD 4U95A 4X62J 1KQGB 2QO3A 2LLZA 2B7CB 1UFWA 2BKOA 1MROB 2E66A 1MWZA 1PG5B 3C15B 3DRRA 3T1HF 2HLTA 3LP2A 3B6BA 2L9WA 4WF9Q 3DLGB 5KFQA 4NLSA 1HIYA 1EB0A 1S1XB 2AX1A 1R0CB 3QIPB 1R8BA 5IT9U 3W7BA 2MKYA 3ETMA 2ERRA 4PG4A 3J7A1 2RKIA 4PWDB 4YOEA 1QDUB 5HATA 2LKZA 1CC7A 1S1WB 5CH7B 2DH7A 1VR6A 1DJ0A 4DV7F 2XZTB 3I0SB 1K1QA 3QZ7A 2AYMA 4DLGA 3P4UB 4KFBB 4OJHA 3FFIA 5K8MA 3OUYB 6AT1B 3I9V9 3PHEA 5GMDA 3EE3A 3LGNA 2MLXA 4H4KA 4YQWA 1RQ0A 5KFCA 3A8EA 4X65J 3MTKA 4BS2A 1LEOA 2CVIA 2KT2A 2VBYA 3M2RA 4DX8H 5KFPA 4Q2LA 3DGVA 2GS8A 3NAHA 2ZH3A 3D3CJ 2ACMA 5IS2A 1DQ8A 4ANCA 3M8WA 2PSZA 4DS5A 4ZOSA 3WDOA 1NSAA 5DDPC 4OI0A 4Y65A 4ZLJA 3TW0A 4DQIA 4LRBA 3RBXA 4WZQA 4M5JA 2IAJA 3NMAA 2XS5A 3DRRB 1NKBA 3RG6A 3LP2B 1Y3JA 4ETXA 7FDRA 3A8IA 3ZTPA 2X1BA 4NLXA 4MK9A 4IH5A 4WJBA 5KG4A 3OVSA 2QGFB 1U2FA 4IH6A 3V4MA 2RKIB 3MOZA 3QT8A 3TZWA 3M8SA 1PJ7A 2M4MA 1PSDA 2YKQA 4DL2A 3CMAS 2GAHC 3FFIB 2R7QA 2Z56B 1I5OB 3VAIA 5HLFA 2HMIB 2NXNA 3OLBA 4WTOB 1T9UA 1BQNA 3C19A 2XNQA 2VFUA 2EBGA 4K2JA 1U48A 2HWIA 4NLWA 3K5NA 1S77D 2JVRA 4OX7A 3AODA 2BR0A 2VDHA 3BREA 3KUGA 3CD6S 3J7Z5 2PIIA 4DR4J 2OUGA 3QO9A 3IRWP 3PJWA 4ZVGA 4TN2A 5L9XA 4WE1B 4IOBA 2CPJA 4DV4F 4JI4F 4ER8A 1R89A 4RO0A 2HW3A 2IAJB 5FLXU 5F0WA 3ISNC 2GW8A 2CUYA 2ZBRA 1FDDA 3OL7A 1RADB 3T5KA 2BQRA 2XYPB 4OMFG 1Y10A 1NAQA 3FQLA 2CQDA 2QLWA 4AXIA 4ZPVR 3AQPA 4LSLA 1WHYA 2MKSA 4FBUA 1UP1A 3D1OA 2KDOA 3NEKA 4J9KA 1I94F 3CJ4A 1N4LA 2XMWA 1DLOA 4DL3A 4PEOA 3GIMA 2C2EA 1BQNB 2P6SA 1S10A 3M32B 1WSRA 1F9HA 1YSJA 2IY5B 1LOUA 3EDQB 2RRNA 2HVDA 1VC6A 2JNJA 3BV8A 1TUWA 1TELA 5FJ4A 3ELHA 1HD1A 2MHEA 5JVGQ 4Y3CA 4KY3A 2MB0B 1IKYB 2EKNA 2HVEA 4O3NA 4JBCA 3TX8A 2V50A 4KYZA 5DS7A 4JI2J 2SXLA 3EGZA 2XYGB 2IBOA 3LP0B 3PY8A 2V34A 2C2DA 2XS2A 2G9OA 2ATCB 3ZZUA 4LRFA 2B5JB 4QIWD 2VA3A 2JZ5A 3M8ZA 2YQ1A 3R3TA 2RT3A 1DQ9A 1LK5A 2MQMA 2YXLA 1WEXA 2Y0SD 1VQNS 1D09B 5HQ8A 2QZ8A 4J90A 4KQZA 2FY1A 1S99A 4B3SJ 5CAAA 1LFWA 4LSLB 4MJKA 1M5OC 4A4JA 4BC9A 3IG1A 1RAEB 4ECWA 4FVCA 1QVFR 2ZH7A 3KOAA 5GMKa 1DLOB 2CAJA 3UDVA 1TAUA 1V5VA 3MMAA 4LF7J 4ZPTR 4CWBA 2MDAA 3J81j 3DDIA 3CCES 4X4QA 4OI6A 4Z37A 1QSYA 1GX5A 4N5SA 1HYSA 3TWZA 1K1SA 2J8SA 2G1HA 1VJWA 3NOCA 1RYRA 5KFZA 3UVJA 1VJQA 5EUHA 5EGYA 4I69A 4AD6A 3IWNC 1RTJA 4GC6A 4E0DA 4EU0A 3SI8A 2F4VF 2JOQA 3BN4A 1X7VA 4CM2A 4QWDA 4RNHA 3DC2A 3QGGA 2BACA 2Q6CA 3EWGA 1TV6B 3QGIA 1NPKA 4MKBA 1HBNA 3S1TA 3A3OB 5FDLA 2N7YA 3R2CJ 3FBCA 3IXQA 2XULA 3GB0A 4USUA 1Q8KA 3NCPA 3SV4A 1NLKL 1X4CA 4RW4A 4USVA 3RR7A 4YB5A 3PRVA 2XYHB 5BR8F 2VL1A 3IG1B 3G6VA 4ZCLA 4CNYA 4AL6A 1H72C 4MFBA 1BD6A 4X4TA 2AEJA 2AW0A 3KLFA 2X7IA 1VQSA 3SQOP 1UW9A 4DL6A 3OJUA 3Q22A 3TZYA 2J7UA 5DG9A 4YMEA 1VQ9S 1FNXH 2YWFA 2MHNA 1N56A 2QE5A 3EPIA 2WW8A 1HYSB 3D0GE 1U6FA 1M90T 4ERDA 5DGBA 4YFUA 3UVJB 3NGTA 3DOMA 2AQ4A 2GHPA 4NLVA 3NL0A 1HQEA 4KT0C 5DG7A 4DPWA 3KK3B 2F40A 3GV8B 1TKZA 2KN4A 1NKCA 4J9QA 2EG2A 2YTCA 4KB7A 1Z2LA 2ZH6A 1P9YA 2YBVA 2FVCA 2C3PA 5D0GA 3ZZZA 2UUAJ 4ZN3A 4OZ0A 5D0RA 1RWNB 4IRKA 1HBNB 5I3PA 2L41A 4K7QA 3UR0A 4XPCA 2EI5A 2HQCA 4G1QB 5FDLB 3AHPA 4QW9A 3VAHA 2JSXA 3D0IE 5T14A 1WC6A 2AKWB 1NSKL 1SH3A 4RW4B 3N79A 4NA2A 3OXGA 2YNGA 4MK8A 2ASDA 2OTLS 3OLAA 4I2QA 4MFBB 3M8YA 4BCAA 4B3MJ 3BBFA 2CNOB 3IGNA 3KLFB 4EZ9A 1A9NB 3VF0B 4M1KA 3M2UA 2VHGA 5MAOA 1FJCA 3KDNA 2KFZA 2DGXA 3FCHA 2QMUB 3GFHA 2F4FA 3H5YA 4IQXA 2ZWPA 1VQMS 1JXVA 4K4TA 2P9GA 3RGIA 2JRSA 2LYVA 4Q0BA 5KG0A 3W2WA 1EAYC 3I32A 2RHQB 4PQUA 2DXDA 3PRDA 2HGLA 2C3UA 4Q43A 1X4FA 2HG4A 5T7LA 3AOAA 5E3RA 3IAM9 2HWTA 3BBBA 4WXWA 3SCLE 1HQEB 5ITHA 4Z7CA 1UFKA 1WOPA 4DQQA 1TTHB 3EMTA 4LQ9A 2HBRB 4JV2A 1D0EA 3L4BC 1ZYQA 2VPYB 1HQUA 2ZM6J 1F5AA 2V6AA 2FVSA 2HNYA 2F63A 2CZ4A 2LEAA 3MGJA 3A12A 1F0XA 2RB7A 1T7PA 2N4CA 2K8GA 2W7AA 1T05A 2HBYB 5IC6B 2FPHX 1NM2A 4PZVA 4P75A 3FEXB 3B8HA 4A8WA 2MQPA 4K50A 5DQHA 2EC2A 3PZPA 1S76D 5GVQA 4DN0A 2YNGB 1UEUA 2I5JA 5KFVA 4F0HA 4A8FA 2O66A 5C42A 4F3OA 4DCJB 3OXFA 2B56A 2DH8A 1TL3A 1DURA 2AGQA 1PYOB 1W2IA 2HHTA 3M2UB 2J6UA 4IDKA 2BJ1A 1QTNB 1RAOA 3KXDA 5M2PA 4P9SA 3ULHA 5DQIA 3MMCA 4DWIA 3W5YA 3D5MA 2BM0A 4OZJA 1YBTA 3JSMB 4Z7YA 4DX5A 1JWWA 3M2VB 1FRKA 2NQPA 3MAAA 2CPDA 5I4MA 1EARA 5T7LB 3CT9A 5F8JA 2CJQA 4JI1J 1Q78A 2BYCA 3H5SA 4LQ3A 4FDFA 3H5XA 3CE8A 4LR7A 3ZNUA 1IBMJ 3HT0A 1HQUB 2OLWA 2DGUA 2JX2A 3JS9A 3W60A 3ISZA 4YDDB 2Y9HA 2A10A 2R2TA 1V3ZA 3N0VA 3P5BP 3QGHA 1T05B 1NJWA 6FDRA 4DV3F 2BXJA 4BDPA 1YKWA 3GCXP 2BANA 3ZFVA 4OI3A 5K8PA 2A6MA 1VIXA 2OI2A 2R8HA 2X51A 3D9BA 5C42B 2D1CA 1N32F 4NLQA 3BSNA 1MMDA 5LT5A 1TL3B 3GJSB 2NZCA 3T1HJ 4CT8A 3N6MA 2V8PA 1NZAA 4FPIA 4MKAA 4DUZF 2LQ8A 1H74A 5AE2A 3CC4S 5KG3A 4Y00A 4DFPA 2XM3A 3W5XA 2K2PA 3VGVA 2HQIA 1SXLA 2I6WA 1C1CB 2UUCJ 4RU2A 1R8CA 2XNRA 1Y7PA 3TUPA 1FFSB 2VV5A 4DV7J 3WBZA 2GA7A 3M6VA 2FVPA 5IFMA 2L3MA 2DVIA 2HHHF 5B0BA 4E2FB 5HROA 1GX6A 2AJ4A 2IBKA 1ZH5A 4I7FA 4ED8A 3VTIA 5IWAF 1IBLF 3N6NA 2NXEA 2PDAA 2FTRA 2ZD1B 1URRA 3HX9A 3H20A 1FJEB 2DPJA 3DOKA 1X60A 2C2OB 3DLKB 3MAHA 2DBBA 1KLNA 4ZP9A 3V6HA 3CJTA 2V2VA 1FI4A 5HMXA 4OYBA 1GFWB 4UOCA 1NRKA 3D6MB 3ZTOA 4LIRA 2IVFB 4IRCA 4CRJA 5DQGA 1U25A 3WC2A 3U7JA 2F9DA 4LRDA 5GAEU 4LF6J 3CVKA 4NX9A 3BJYA 4WWSA 1TKDA 1VRUA 1RUSA 1CJKB 2YKOA 5B0DA 2XSJB 4CP5A 3KLEA 4XTTA 5J2PA 1JLEA 5DM6Q 4CLSA 1KONA 3AD9C 4ZVEA 2XLJA 1XMOF 1VQ6S 4YB1P 4QIGA 4USIA 2WTFA 2ADBA 1YRTA 3O44A 4OX8A 3E8OA 5D6GA 5HROB 3I5AA 2HHUA 1ZBTA 3P49B 2KHCA 5IT0A 2FHKA 3DRPA 4NZ6A 2NPIA 4I7FB 2UVRA 4NXNF 3IO1A 4C6AA 2IA0A 4NE9C 4NOHA 4N76A 2V4QA 3CF5Q 3U1MA 1ZPVA 1Y11A 1ZZFA 3DOKB 4R0JA 3KG4A 1RAJA 3F73A 4MKYA 1UVLA 5KFUA 1H38A 1EKRA 3PNIA 4Y0FA 1AFJA 4LF9F 1VHFA 4DV4J 3L9ZA 4JI4J 1MNEA 2DGSA 2IVMA 1UZHA 4LF5F 3TJ8A 3MR2A 1F3VA 2YVSA 3NAIA 4OI2A 4F4WA 1S6PA 1Y3KA 1K0VA 2C3YA 3H2VE 4ZLPA 1YJ9S 1N34F 2CXEA 5KG5A 4ECZA 1NU4A 2YY3A 4YB6A 2ZHAA 5K8OA 2V4JA 4RL1A 3MURP 1MG7A 1I3OB 1TUGB 5IV3A 1QD1A 4CH1A 3KLEB 1M0SA 3WIUA 1JLEB 2XS7A 2KO1A 1KP6A 1ZTWA 1N6QA 2JEIA 2LA6A 2BX6A 2QN6B 3ENVA 5SZTA 1S4EA 3OT9A 2I38A 1D1UA 4HTJA 1K44A 1PO6A 3OW2R 2MEWA 1RCOB 3Q8RB 4L3NA 3ENQA 4ZVSB 3MF5A 2OGUA 2UUBJ 5FLXY 2MMYA 2GMJA 3UCZP 1NJXA 1GT8A 4MKVA 4F2SA 1H2TZ 4JYAF 1FRHA 3V6DA 3D28A 3G8SA 3AB4B 4JI8J 1M5PC 2QMWA 4IG0A 3W9HA 3IRXA 2HRTA 5KFKA 3IWXA 1KQSR 4NLYA 3Q2SC 2XC9A 2MZJA 2PE8A 5B0EA 4BLGA 5THWA 3GR0A 4LSNA 5J2MB 2MY7A 3HDSA 4RNMA 1M1HA 1RBLA 2VUGA 1CJVB 3KKFA 3MM7A 3W65A 4DPOA 4DDFA 4ZKAA 2N3LA 4M5DA 2NPFA 4LFCF 3T41A 2AX0A 4MIWA 2XMTA 5J2NA 2ZKTA 2BKPA 3IMQJ 1IM4A 1RISA 5A76A 2DHHA 2YWEA 2QA4G 1N6QB 1VQPS 2RH3A 3JSBA 2MGZB 3MAQA 2HFVA 4J9MA 3G6ES 5D4OA 4C7QA 4CH7A 3FNNA 2LXUA 2DEJA 2XMVA 1IQZA 2IRXA 2MSTA 2JEJA 3O2IA 3W2VB 2NR0A 1N48A 5DO2A 3DN9A 3J80U 4WYLA 2BW2A 3R5BA 4YY3F 4LVOP 3TAQA 5HK4A 3V6DB 3X3UA 2OIHA 2DNOA 5F8IA 2ZE2A 4IG0B 4P10A 1TK8A 3T6BA 2GO9A 4KHPF 3QQCD 5LSRA 3GE9A 4LVNP 4KHRA 3VGUA 1Q86T 3NY0A 3H4DA 4LSNB 1IR1A 1RT3B 5ETOA 2PMZD 2F4VJ 3WC0A 2YNFA 4FF2A 2DCLA 1EP4A 5T41A 3S8SA 4LF4F 1JJ4A 3EICA 4IFVB 3MM7B 1SI9A 2YKAA 3L7OA 1CBKA 4M5DB 3SCIE 1Q95G 2BRLA 3O6QA 2ZZNA 3H7HB 1YK9A 5J2NB 4HI1A 3CO9A 3UWTA 1RHKB 2DGWA 1IJEB 4ELUA 2QRRA 4ZCKA 2DO0A 1U1MA 5BR8J 2IMWP 2E5HA 1K9MT 1AA1B 2F65A 5KFLA 4ZVHA 3K8VA 1RT7B 1GMWD 2OEKA 3E01A 2A1BA 1F2GA 3MOJB 2Z2LA 4PXDA 4ZS6A 3DKDA 2AGOA 2IM1A 3UDCA 3WQPA 2VQEJ 1S48A 2C2MB 3PKMA 2KG0A 1JIHA 1U6ZA 5KG1A 1QSSA 3HCXA 2F9JA 3DRXA 4X4PA 4JI7F 3DOLA 3OFHA 4ZMMA 2H3EB 1GK8A 2V8VA 4B08A 3SSSA 2ZE2B 2XMJA 3T19A 3KHRA 5B0GA 2RQCA 3ETOA 4KGZB 2V68A 1U02A 4J9SA 1GQEA 2BVZA 4EMDA 1BLUA 3DM2B 2XWXA 2OO4A 1GEHA 3RUBL 1NK6A 1HMVA 2ZJRQ 1T9YA 3HSDA 3NWGA 2YNFB 2GGPA 1RTIA 4DI6A 1FCAA 3MR5A 1EP4B 3I87A 2R9LA 1CS4A 1D8ZA 4CLTA 2VC1A 1Z1ZA 1N5QA 2JDJA 2PEBA 3RU0A 1L5UA 3GYGA 3PJXA 3BO2A 5AJ3J 3ONQA 4DF4A 3I0RA 4RNOA 2PGCA 2DNKA 1JMTA 5HBMA 1X4EA 3T9NA 2J0XA 1JLBB 3KK1A 2MKHA 3E01B 4N47A 1RT1A 4M5NA 5CYJA 3ET6B 4LREA 4I68A 2E1MC 4AXJA 3PJ9A 3R6LB 1R43A 1NHKL 1LWFA 3RW6A 1IKXA 3ILIA 4O3PA 4EFAC 4IG3A 2RQMA 3DHXA 3PFEA 2N82B 4CTAB 2JEGA 1WI8A 4A8QA 4M5HA 5HMZA 4XK8C 1SB6A 3D3BJ 1RU2A 3PW7A 3MPYA 5K14A 1H0HB 4UQTA 5KT4A 2VICA 2C2KB 2KG1A 2ZHBA 4PUOB 4C3KA 5HVHA 1HMVB 1PJ5A 2IFXA 5KTQA 1KOHA 2CFXA 3H5UA 1JLGA 2R8IA 1RTIB 2QA4S 3US5A 3UD5A 1O5JA 2BQUA 3CJQA 1U4BA 1BQXA 4O4GA 1DZ5A 2RF2A 1KKHA 3KJNB 4RW7A 4CO3A 4YB7A 5F8NA 1QM9A 2ZZMA 1NB2A 2C3OA 1AXQA 4CO1A 3A1YG 1C0TA 3I0RB 4USHA 4TY8A 3DYAA 3KLHA 2VDIA 3L3CA 5F41A 5LOQA 4WKYA 2PMHA 4R0EA 4UUXA 1VQ5S 3GU0A 4GRSA 4FYVB 3KK1B 2B4PA 2B6AA 2MY8A 4C8LA 2H51B 2UUWA 5EWEA 2Y3YA 5I42B 1JLFA 3OTCA 1DQAA 4DV5F 3C6TA 5AXLA 1SKUB 2LA4A 5ETVA 5C2CA 4YHHF 4JV1A 3C16B 2UU9F 1REVB 3M8QB 5F8MA 1DTQB 2AYEA 1BE4A 1SUQB 2EFOA 4KKOA 3D67A 5HMWA 2QG9B 3Q8PB 3T5LA 4RBVA 2WW4A 3KLIB 4DV0J 4F0KA 1RWMB 4F4AA 4CLWA 4NYOA 5GAEI 1L3UA 4JB8B 4O44A 3Q8UA 2CIMA 3MEEA 3SCKE 4KV8B 4HT7A 2G1DA 4DBQA 2V0NA 4UY85 2CQIA 1CQNA 4X66F 3CDUA 1JLGB 1XEZA 4IYQA 4G6VB 4DR7F 1RB0A 3SYZA 3IBCB 3QJJA 1R8AA 1N5YA 1CULA 1S4FA 5KFTA 2XO6A 2ZJQQ 4H4KC 4CQ1A 1HARA 2NCKL 3ADAC 4J91A 1C0TB 1AYEA 5H9EJ 3KLHB 2CPEA 3CB4A 4P72A 1UPPA 3RRHA 4X62F 5D15A 1N32J 4ID8A 3DDKA 3W61A 5IOLA 5KFJA 1L3SA 4W98A 2J76E 4G3IA 3BQ1A 2Q1LA 5D4LA 3PW5A 1M1KT 2FY8A 3M7VA 2VASA 2NSBA 3KHGA 3RTVA 4FF3A 2QTWA 3E2EA 2R42A 4KKOB 3CC2S 3PRBA 3EZ5A 2L08A 2E7VA 5F8HA 4EUVA 1S1UA 4PWUA 2HHHJ 2RUSA 3MEEB 1S97A 1G2EA 1F5BA 1WDDA 2AF6A 3DI6B 1S9FA 1R0AB 1Q0NA 1TU0B 2M8DB 5IWAJ 5GADI 2KZZA 2KTQA 1SJQA 1CLFA 5GAHI 3LAMA 2C22A 3KG1A 1Y4ZB 2YX7A 5CA5A 3NNCA 1RT6A 3VQTA 4IUFA 4DUTA 2LCWA 2W4CA 2KXHA 1HL6A 1FEEA 2QLFB 4ZPCA 1YTYA 1RT2B 2BJ3A 1KNZA 3GSIA 2RRAA 5CCMA 2QLBB 1M5SA 3CGIA 1ZZNA 1RLCL 2DISA 3X1LB 2BJDA 3FDSA 3QIDA 4ECXA 7FD1A 1RT5A 2R7TA 4LBHA 1I6JA 4B3TJ 1FKAF 1FKPB 1UVKA 1HHTP 2ZC4A 3FSIA 2GV1A 2OPQB 2XCAA 5KFOA 1UFLA 2BJEA 3CXCR 1RKIA 5LMUF 4CLLA 3EGNA 1YJRA 1YWXA 4RW6B 3NS5A 1SJ3P 1F6TA 2MSSA 1QVGR 1XMOJ 1FKOB 1IVZA 4WIIA 1BWVA 2P2CB 1TL5A 2CG8A 2D41A 3OR2A 2QJ3A 3PIOQ 2X1AA 3L09A 2R2RA 5HJXA 1M5HA 3E3XA 3O8WA 1ZAVA 4NXNJ 2VFTA 2ILYA 4B17A 4M5LA 2R7RA 2ZZTA 5ETRA 4FXDA 4QPTA 4L3KA 4FN5A 2XTJP 1RT6B 1N88A 2DK2A 2HNZA 1TUVA 1RK8A 3MEDB 2CQCA 2W4PA 3H2LA 3Q8QB 2FC8A 4HACA 2RJZA 1RWKB 5D3GA 3MECB 2YNHB 1S0NA 4URQU 4IQMA 2M9KA 2QSFA 2IA6A 2MKIA 4LF9J 1J5OA 4HDHA 4Q44A 4NLUA 4DR2J 1PBAA 3KJFB 1M5KC 5DETA 3BS9A 2YKNB 4LF5J 4O3OA 1RT5B 3RAXA 4H54A 3PW2A 1S9GB 5LM7E 1RAIB 1Q53A 2W2OP 4E98A 4QW8A 3CJ3A 3P6YC 1HQ2A 4WP9A 1HI1A 2KRRA 3P3DA 4DG1A 2AJ0A 1FE0A 2VPZB 2YH0A 1WC1A 5E41A 3R6GB 1B3TA 3H42A 1T9VA 3MZIA 3J7AN 5A8RA 4KJIA 3K89A 3POTB 4PXEA 4C97A 2XI2A 3L7PA 3RB6A 1VFJA 3HJVA 4NLOA 2E1CA 2CNKB 5A8KA 2DXFA 3T1YF 4ZHRA 3THTA 2UP1A 4DR6F 4U7UD 3WX8A 3M9OB 1NPPA 5F8LA 1YQHA 4C2MA 1OIAA 3A3PB 2ZBPA 5KAKA 3AT1B 4FVMA 4C3MA 1PBUA 3G87A 4NWBA 3J7YU 2EWHA 3PACA 5D3GB 3PR5B 1XERA 3QBCA 4LRCA 5L46A 2E5IA 1U24A 2MKCA 2RILA 3OHAA 3MUTP 3GSDA 1CEZA 2E1RA 1M5VC 3SEOA 1NNDA 4C4WA 1RWUA 1HBMB 6FD1A 3W9IA 4R5PA 3PG9A 3TQ1A 4FF4A 3HULA 1IXKA 1LWEA 3QFWA 2FHMA 3GYNA 4O3SA 1R31A 3QYYA 1RAHB 3DLEA 1TMJA 4PAAA 3SFGA 4N8OA 3EVMA 3H0PA 4DG1B 2W9BA 1C4AA 3O1LA 1NB7A 5KG6A 2C2ZB 5KFMA 2KHDA 1VBYA 1HBOB 2HVZA 5L8RC 1VQ4S 1U6BA 2FIUA 2JEFA 4DZDA 5A8RB 3AD7C 3BYRA 5CYMA 3I31A 4FYDA 2AZ3A 4QR1A 4CNZA 4JV0A 3KMQA 1DTTB 1DAXA 2NYIA 2YWWA 5A8KB 5E5NA 3G71S 4YS2A 2HZVA 3BPDA 2MJUA 1H3DA 1N0UA 2HZCA 1NDPA 4RW9B 3FKBA 4ZP6A 3K8WA 3W1YC 1WOOA 4YY3J 2Y1IA 3LALA 2BJ7A 4YR0A 2A0FB 3ZTQA 3MR3A 4W92B 4KHPJ 1XMBA 1Z2ZA 1Q8BA 4ZPWR 3JAMU 1PJ6A 3U1NA 1LKZA 1F9FA 1QY7A 1OJ4A 1LW2B 4Y2AA 3K59A 4R5PB 2DY9A 3M6WA 3HKZD 1LWEB 1WC4A 3UN3A 3MM5B 4CH0S 4B9VA 4U7CA 3PHTA 2B7BB 4QWEA 1YZ7A 2W9BB 1RE1B 3J80Y 4KAIA 2EKYA 2FLLA 3CNQP 1WTFA 1BQMB 1UZDA 3TUJC 1HHQA 4RX6A 4F3QA 1UVNA 3K57A 4DCPB 2IRYA 5A0YB 2HFUA 1V3SA 3R27A 1IBCB 3TA1A 3Q86A 5DM7Q 2W2MP 4NLRA 2XMUA 4YN3B 1TL4A 1AW0A 5ETKA 4JI7J 1VIOA 1WDTA 1ZM3A 4C98A 4ENOA 1FTCA 2V8HA 1AZSA 4C8YA 1NXIA 3A4TA 5F0UA 3N6LA 5B7WA 4G1IA 1X4BA 4KHMA 1QLNA 2ZOMA 3W8PA 1OO0B 3I5BA 1HNIA 4ETZA 2HGMA 1GTEA 2BM1A 3G6YA 2DJWA 3KMSA 4Q2MA 4Q8FA 5CHCB 3DGPA 2WVCA 4OZ3A 3CCVS 1JXEA 1J5EF 1WG5A 1ICEB 1RGVA 4HHHA 2ZWOA 2OEMA 4B3OA 4PG5A 1SIWB 3IM8A 4FXWA 2LDIA 1RKJA 3OHBA 1YX2A 3PW4A 1WUUA 5MLCV 1HNWF 3NGUA 5DG8A 2BMBA 3TYTA 1QAIA 1RAFB 1G4CA 3UDLA 4DSKA 3CCMS 1ELOA 2IJFA 3TOQA 2GHWA 4M95A 3JTNA 2WAQD 2HBZB 3MM8A 3MR7A 3KWMA 1H7XA 3M8PA 4RUBA 4KH0B 2CZ9A 5KT6A 1QJHA 3DMJA 4ZJOA 4NXMF 4WK3A 3NGSA 2H5IB 1FDNA 2UXCF 3MCMA 3CMQA 1IBKJ 1PC4A 5I3UB 1IKWA 5J1EA 1HNIB 2G13A 3MPVA 4Q45A 2CQ2A 3ZXWA 2NZ4A 4NI2B 1O0PA 2COLA 2GJ2A 5IXUA 4WFNQ 3DGPB 4L75A 1N5TA 3UN5A 4FYXB 2HHPA 4IFYA 1H98A 1TKXA 2P6TA 3R7SB 5L1LA 1T11A 4B3OB 4E8UA 2K7KA 2LQ9A 3CCUS 2EFQA 2AV5A 1NCLA 3C2PA 1W7WA 3BZQA 2B9EA 3I9ZA 3R9LA 2HQGA 4H4OB 2AYGA 4DL0C 2YPYA 1WORA 2V8GA 3GMGA 3D6HB 3DHWC 1B99A 2W9CB 4ILLA 3FGVA 3DLHA 4EWTA 2FVRA 5DLGA 1S1XA 2FZCB 1WACA 3CW2C 3NCRA 4WXOA 4YHHJ 3K2YA 3QIPA 5L9NA 4IOAQ 4H4MA 2M70A 3LO3A 1ZA2B 2UU9J 4F4ZA 4UY8T 2W2PP 1XMQF 3AAWB 1LFPA 1WOSA 4O4RA 3DMJB 4OV1A 3QWPA 2GQ2A 4TU7A 4HHUA 2MKJA 2NS1B 4WU2A 2XSFA 2ALYB 4JI1F 3R1LA 5BYQA 1GMUA 1LWCA 3OUYA 4N77A 1IBMF 4TLQA 2AU0A 4AFFA 4X66J 3VCDA 2HQ3A 2H1YA 4P73A 2CWKA 9ATCB 1RTZA 4DR7J 1DY3A 5ETLA 1QAYA 2BOAA 1N36F 2G2OA 2H5JB 3B54A 2H54B 2OELA 4F4KA 2ZOFA 1C1BB 3UQSA 2ZVIA 1SV5B 4IRDA 1IKVA 3CCTA 5JVHQ 3HD2A 3UDEA 5LSLA 3GP9A 5CABA 1LXNA 2EFPA 3S7RA 2DRDA 2OD6A 2EEYA 3PV8A 4YR2A 1SKSA 2DNQA 1DRZA 1WD6A 3OL9A 1LXJA 4CT9A 2MZSA 1VC0A 2QV6A 2KXNB 3VVUA 5DGAA 2D9OA 4A8MP 4X4RA 4H4MB 3QJPA 4QCLA 2HYIB 1FNMA 1JK9B 3OL6A 5D0EA 2B0GA 3RB4A 1RHMB 2P9EA 2UUCF 1Q4RA 1FD2A 1P1TA 2WRMA 1SC1B 1NK9A 2CQPA 1UWBB 1OPIA 1DHMA 5JMNA 1JNRB 4X4NA 3Q2TC 1LWCB 2R7UA 2HMIA 1K73T 3C8YA 4MTPA 2Y0BB 4Q7AA 2DNYA 5ETSA 2DXEA 1RABB 3GFYA 1X0FA 3PYEA 3QNWB 2E9RX 1URNA 5IQ6A 3OTDA 2AJ2A 4OL8A 1E6YB 4XIUA 1Q82T 1IKVB 3VGSA 1UJ5A 3UN2A 2HHQA 4LR8A 2BJ8A 4WE1A 3UW1A 2F3JA 3IM9A 4USJC 2ZDPA 3JSRA 1XJWB 2M88A 4FF1A 1GH8A 3RBDA 1H2VZ 2AWZA 4AT1B 2KZMA 1U1NA 3MPWA 3TA2A 2KFYA 4LF6F 4DFJA 1GMWA 1XIQA 5C7PA 1S7IA 1A7GE 1QUVA 4QYZK 3CTRA 3PR4A 4RWWA 4ECYA 1L3TA 5LMUJ 1B70B 4YP3A 4Y2KA 1YBAA 2LECA 1U1OA 3BKUA 2ALZA 4DU7A 3IFEA 4V19X 2ZHOA 2R8KA 4ZN1A 5G4DA 4B9UA 4QBUA 2MQNA 4DLEA 4QYRA 3G82B 4OX9F 1WI6A 2LQJA 3KNGA 4J9NA 2KM8B 3CJKA 3M32A 1O8BA 1YVFA 1KTQA 1CC8A 4J37A 3HKWA 5LXYA 2FHJD 3IWLA 3NNHA 1U7LA 4KE5A 4OHXA 2RSQA 1GXLA 1I51B 5ETMA 4DN9A 2I2YA 2JVOA 3BN7A 2KT5A 1IKYA 1PC5A 1UVJA 2NXJA 1E6VB 2Z2YB 1U2RA 2BV3A 2JWNA 5D4PA 3LP0A 3LH2S 4LR9A 1S0MA 4ZPDA 1TFWA 4QR0A 1MW7A 4NMXA 3I96A 3TRGA 2B5JA 3K5PA 2W01A 1TL7B 4PQAA 3QAUA 3T5HA 3T6JA 4I1TA 4OYWA 2VC0A 5B09A 1FXLA 2V8DA 4RNNA 1S6QB 3N4WA 1KBRA 3I55S 4WIQA 4J5OA 2J5AA 2W7OA 3KLGB 2Q3PA 4DJBA 1X4GA 2EK1A 2W1BA 2R8JA 5J2QB 1TKTB 4QWAA 3D1QA 3T1YJ 4J9UE 4DR6J 2KU7A 2PI4A 2VKZG 4DF8A 3CJKB 1X5TA 2UUBF 3GJTB 2M3DA 3M9MB 3PIPQ 2L9DA 4P74A 1UTAA 3TZZA 2IYGA 2M52A 2FGOA 3TANA 1KVKA 4JI8F 3C14A 3RRGA 1YJ7A 3GILA 4B9LA 4K4UA 3EM1A 3HD1A 3UO0A 4A8YA 3CCSS 5D8HB 2DR9A 3T9ZA 3R5DA 4JI3F 1KQKA 4MYTA 4CCHA 3CJ2A 1TV6A 2J8AA 2XO7A 2G0CA 4OI1A 4QU6A 3TAMA 1NDLA 2R8GA 4EGLA 3BQ0A 8AT1B 1IR0A 4ANDA 2B3TB 2H4WB 1GXTA 1SQFA 3HP6A 4LFAF 2C2RA 4F02A 3HHDA 1TK0A 4ZITA 2CDQA 5D77A 2WB4A 2ZNZA 1AFIA 1RA6A 2XB2D 1H2UX 5AXMA 4RZRA 4CIOA 2B4OA 1ACMB 2NSCA 4KIAA 4JI5F 3HLUA 1KD1T 1RBOB 4NLTA 3R8YA 2VFSA 4D3GA 3FSXA 4KO0A 1RU1A 5HJYA 4DUYF 4RBTA 3NGDA 3CCQS 1FRXA 4HDGA 1HPZA 2IIHA 3EDRB 3HZGA 2GQQA 3C14B 3CCWA 3NGKA 1U0HB 3QSYB 1ZOTA 2A2DA 3TP2A 3KK3A 1NJZA 5D0HA 1RLDA 4PWWA 4AQYJ 1S7HA 3HHEA 2Q66A 1OQ3A 1RAAB 3HFZB 2VG7B 2GQCA 2EG1A 5E3CA 3TAMB 2M7SA 2RD5C 2R7VA 3NRBA 4G1QA 3KLVA 1B7YB 1YGYA 1X5OA 3KHHA 4DFKA 3NKYA 1UJ6A 5ETPA 4LMZA 4X64J 9RUBA 2MZTA 3OTEA 3RYLA 2B9XA 3KDOA 2VH7A 3RBEA 2VKRA 4BC7A 4C48A 4K4VA 3JAMY 2DITA 4TVAB 3GLJA 3TZXA 3FJ2A 2KXFA 3SV3A 2YWKA 3CEDA 2VODA 3NNAA 1U8SA 3CD7A 2VQEF 1UKUA 1UL3A 3T3FA 4I0WA 3HHLD 4KO0B 2UUTA 3AFGA 2O1PA 2Z2ZA 1ZTTA 1T94A 1NK0A 1JXLA 1ZM4A 4B9MA 1KFDA 2VOOA 1C0UA 2J9DA 1HPZB 3RZAA 3GIRA 5H9EK 3N9UC 1HBUB 2ZDOA 1FFGB 2RHSB 2POKA 3AH6A 2HK2A 5C25A 3LWLA 4IO1A 2D74B 4ZCMA 4P6QA 3ZZPA 4KPYA 3GONA 1SPBP 2KKHA 3NG8A 3PFOA 2MXYA 3VAGA 4UZBA 3G2XA 1Y5IB 2JHEA 2ZOGA 2APOA 2VBZA 3KHLA 4XDDA 4K4ZA 4A8KA 1MWYA 2DPIA 4K4YA 1HA1A 1J5EJ 1VQ7S 2D9PA 4DL7A 5L38A 3I56S 2M8HA 2V9WA 2RRBA 2F8HA 5AJ3F 1D8YA 4GMKA 3HFVA 3HK2A 3FK4A 3R5GA 4C8OA 1HNWJ 2CPZA 5HSPA 1R3NA 1TMMA 3Q89A 1P6TA 4A46A 4OZ2A 2KB2A 2DHAA 2DEIA 3IA0A 3HVTB 1BMQB 3W9JA 1SL0A 3K5OA 3OTBA 4UW2A 1YLXA 3QPIA 3TA0A 4ATNA 1AT1B 4P2XA 2H4YB 2VA2A 2CQGA 5IZHA 3C6UB 3GYXB 3JSMA 1C0UB 4DXLA 5B0CA 4X4UA 4NXMJ 3M2VA 5H9FJ 2PA8D 5KT2A 2UXCJ 2Y1JA 1S57A 2WVEA 3BEGB 5C25B 1F2HA 2OTJS 2VJUA 1U09A 3BH7B 4EO6A 2H9ZA 3FSYA 3PX4A 1LQ9A 4K59A 2OAUA 3F0NA 1T8EA 2AEMA 1HNVB 4OZLA 3FBFA 5IM0B 1ZA1B 3LF0A 4U7UK 3TVYA 1T9TA 4Y34A 3JB9k 1VBXA 3OTOJ 1T02A 2B9YA 3JYTB 1UAWA 2Z8QA 4FP9A 4ED2A 4ZLLA 5SUHA 2UXBJ 4U8YA 1Z4UA 3P5TL 5C2GA 1T95A 1TFYA 1FE4A 3F44A 2PFFB 1WSVA 3OSNA 1SC3B 4OQJA 3DU5A 3CSKA 1XMQJ 3ZC4A 1C1CA 1MMNA 5HP1B 5CXTA 5KT3A 2C28A 2IJNA 1VS3A 2UXDF 2YNIA 4DV0F 4NZ0A 2FC9A 3ITHB 3DDNA 4UOGA 1NSPA 4AYBD 4Y2IA 4P2FA 3D66A 3VZIA 3DLLQ 3PCOB 1YDLA 4L72B 1Q7YT 3VR1A 2ZITA 2PO4A 2DT9A 2HFSA 1MLAA 3V6KA 2ATLA 2ZD1A 3DLJA 2UVUA 5B0AA 2X1FA 2JFDA 1UA1A 1QAXA 3UPFA 1N36J 2CJYB 3DLKA 1K47A 4OYOA 1JLAB 3H4BA 1HR0J 4G1PA 2V4RA 3R5JB 1LNQA 1BGXT 3EPGA 1M1GA 1JNZB 4OZNA 2KH9A 4ECUA 1K8AT 3IS9A 4MIAA 2CQ3A 3TVZA 2XMMA 4B9TA 3C66A 2CZVC 3ISND 4LJMA 2RIJA 4M5MA 4DS4A 4IR1A 3LANA 3OJSA 2E9ZA 4C0HA 3VAFA 2O5DA 1NH8A 4URSA 3UFCX 4NLGA 4MK7A 4C3LA 4NA3A 1S0VA 2ZJPQ 1CJKA 3BKFA 5DRKA 2XSJA 1G7CB 1TAQA 1U26A 4DU8A 2KT3A 1XR6A 2QIFA 3LGHA 1UPMB 1VLYA 4PKDB 1J2VA 1H6KX 2D3UA 1FEHA 4V1Ak 1V6HA 3G86A 4JI0F 3LW5C 2YNIB 4PYAA 1XBWA 2HNDB 3HI9A 4GKKF 3SSQA 1EQMA 2BEFA 4ED3A 2V94A 3C3LA 1XNRF 1FRIA 2IM2A 3IBFB 2BE2A 4F4YA 5KOWA 4ZVPB 2MLZA 3KUHA 3HHLC 3VVTA 4MAKA 1RZMA 3JQMA 3IR5B 4BWJA 4AE5A 5KG2A 1VHIA 3OFFA 4ECQA 3TAPA 2ZNYA 5IT9Y 1KHVA 1XNQF 3W63A 1U1RA 2FJDB 3SIPB 3U1LA 1S1TB 1S1VA 5B0FA 1VK8A 3EGWB 3CCRS 4OHYA 4ANEA 4DR1J 3IS9B 3CO0P 2OP5A 1DFDA 2CVEA 4YDXA 2ACYA 1JQGA 4XDCA 3EZUA 1UA0A 4B3TF 2BE9B 3WHIA 5HVFA 4A8SA 2DD8S 3WZ0A 1VRTA 4OHWA 2J9DE 2OMLA 2E5GA 2OD4A 3G96A 1BC6A 1VCTA 1UVMA 3FUYA 5L1JA 1KFSA 2R2UA 1EETA 2E7WA 4P7VA 1FVSA 5EX0A 2ZFHA 3GFZA 3IGVA 2Q43A 1LWXA 2K3IA 2RS8A 1U49A 2O01C 3RJMB 4D3HA 4DV2F 2BUNA 1H73A 1RWWB 2BE2B 3TR5A 4OX9J 3ZZYA 3A8JA 2AJ1A 4WKRA 1Q16B 4F3MA 1WHXA 3KTQA 1WF1A 2OPPB 2LVWA 1APSA 4DFMA 3AJDA 1BHNA 1S1VB 4C0OC 4WFXA 3PEJA 3BGUA 4CO5A 4DR2F 4DSFA 2E29A 4ECRA 3AXKA 4GVBA 4DPTA 1NJYA 1U8WA 5J2MA 1SVDA 5KFDA 2YWHA 2W2NP 2MZ1A 3Q23A 3M9NB 1JLCB 4L76A 1YHQS 5L1KA 3M8RA 4USMA 1VRTB 1CJVA 2YKMA 1FK9A 5BYSA 2QT7A 3MM6B 2QL5B 3D6FB 1RP5A 2ZH5A 4RPFA 2VBXA 1SJRA 4FYWB 4F8RA 2XBPA 4DR3J 1EETB 2DR6A 1OSDA 1FXDA 1FX4A 3OVAA 2JFKA 2MGZA 4CDIA 1NEEA 3V4IA 2XHCA 3D0HE 2ROPA 1QSLA 2BA9A 4MH8A 5LMNJ 5KFHA 2OFHX 1WHWA 5CYQA 3W2VA 5D78A 4LBPA 3IR7B 4Q8EA 1QAJA 5LXRA 2QLXA 3CMES 4I64A 3PYFA 4MT1A 1DARA 1F60B 2HKEA 2QA1A 1MSWD 2GIRA 1GAOA 3CULA 2Z58B 1KDNA 3M4XA 4F50A 2E5LF 1CQMA 1L3KA 4HHJA 2FQQB 3CDAA 4ED4A 2FLPA 4GVBB 3MMJA 4WFYA 1SH2A 4TKTA 2R4FA 1RT3A 1AROP 4JI3J 1VK3A 4P71A 3M2RB 5DJBA 2FYXA 3THPA 3ILJA 5KFRA 3ZZ0A 4PYDA 2CPIA 3TEGA 1RWPB 1KWMA 2YKMB 4IFVA 1FK9B 4DPXA 1NDCA 2WONA 2FVQA 3MXHP 3G8TA 3HHKA 2Y1RI 3DXBA 3AB2B 4M63A 5A8WA 3GIKA 2Z0GA 2ZH4A 4F67A 5K20B 4MIBA 2MPUA 5DDOC 1ZPWX 2D7SA 4PXBA 1NK5A 3V4IB 4K4SA 2Y1LB 4LFAJ 1RT7A 3VQSA 1PKUA 5CYQB 3G8QA 4HH1A 1Y5NB 3DRSA 2HAIA 3HVRA 4PPDA 1SIZA 4JI5J 4J7CA 1S9EA 1EIYB 1WJ9A 4Y6IA 2DH9A 2P8IA 2CJKA 2JC1A 1WTBA 2FDNA 3DLBA 1X4AA 4DUYJ 2XLIA 2WOMA 4OFZA 4DV6F 1SC4B 1KSPA 5HLFB 2XEXA 2L48A 3Q8VA 2DKOB 3DM2A 1YIJS 1RTDA 4F4XA 4R8UA 1D9FA 4ZVOB 3SDEA 2MLYA 1PAEX 2XZDB 4M94A 5GMEA 4ZVUB 2WONB 4PRFA 3QO9B 3CJ0A 2NREA 2HEKA 2P9CA 4TYAA 4CYUA 3DNCA 1X8DA 2GJFA 4U8VA 4KGKA 2ZEJA 5A8WB 1R8PA 2QLJB 5D4NA 2DGOA 2DR5A 4NLPA 1OY8A 4ZVFA 4YEAA 1XC9A 4WZMA 3JTPA 2N7CA 1JLBA 4NEYA 3CJSA 3ET6A 2N3OA 4CLUA 3NS7B 3DRSB 3FBBA 1HW8A 3NLCA 1S9EB 4KGVB 5E3AA 5CCLA 2X3DA 4C8MA 3PX6A 1IUJA 4WFAQ 3MPUB 4CTAA 5A2QU 1EQ0A 2CYYA 1HWLA 2P5VA 2WOMB 1F3FA 1OY6A 3D4JA 4KC5A 2FD2A 5HANA 4Y2CA 3NWRA 1G6BA 1PYTA 4PUOA 4N56A 2Q79A 1FWLA 4KPCA 4ZVTB 2PEHA 5EN1A 4TLRA 4K0KF 1RTDB 3MFIA 1W2BR 5GAGU 4R8UB 4C0BA 4ES1A 3WIVA 3GV5B 3SDEB 3HVAA 4NL5A 4DPYA 4ED5A 1KLMA 1EJ7L 3S6EA 1RCXB 4USTA 2M5YA 1RHUB 3DCAA 2WSCC 4CYUB 3D2WA 1RT4A 3F41A 1HWJA 2WVBA 3P8BB 4WPAA 4PR6A 2KJVA 2LMIA 3S01A 2LXIA 3A8KA 2FGCA 2WBRA 4ZA1A 2LP4A 4I6YA 3PX0A 2AJQA 4J9LA 4KGMA 1YRXA 3LPEA 3Q0AA 1UCNA 3GG1A 2XY7A 2E44A 1KR4A 3QZ8A 1RTHA 3NGRA 5I42A 4A47A 1RXOB 3BGOP 2XGPA 3KFWX 2HVIA 4P7TA 1NJIT 4U67Q 3C16A 3UD4P 1REVA 1HKAA 3NOGA 2KVQE 3HF5A 3M8QA 3A3NB 2B51A 1DTQA 2HHSA 2GMLA 1FVQA 3QSIA 2JLEA 1SUQA 4GVLA 1JX4A 3AD8C 1WC5A 1T0TV 2FHJA 3KLIA 5K9FA 4HYKA 2R7OA 2E1AA 1PIEA 2BBEA 1FRMA 3AJ1A 1G1XA 2H65B 1IBKF 3SBMA 3P45B 3EYZA 4RNFA 3MMAB 4KV8A 3H98A 4ZIVA 1L3VA 3N28A 4WK1A 3EX7B 5CQGA 3MR6A 2WVFA 4UF4A 2CPHA 3TEHB 1KLMB 3B4DA 2BKNA 4OZ5A 3TI0A 4FS2A 3LUYA 2RDJA 2V67A 1Y5LB 2LU1A 2GJIA 5ADZA 2O67A 1RT4B 2IC3A 2JH3A 5DDQC 4RJVA 3MD3A 1U45A 2B4VA 4FXVA 1SL2A 1TK5A 1RTJB 2CNLB 2AZ1A 1FDAA 4K4WA 2OHDA 1RTHB 3Q8SB 3UCUP 3UI3A 3VALA 4NASA 4HI2A 3QRPA 1RWXB 2ZVSA 2XHWA 5HI7A 3EZOA 4L74A 1IN0A 2YQ3A 3MM9A 2VPWB 1VISA 2VOPA 3MTJA 1OPZA 5LSOA 4Y28C 2UXDJ 3U02A 5K5MA 4ZP7A 2B9WA 3FRYA 4DQRA 4Q5VA 3HHNB 2O3DA 1SQGA 1FFWB 4ITSA 3DI6A 2XGQA 1R0AA 1BUXA 3UNGC 1YJTA 3H40A 4NEZA 1QUPA 2GMHA 3MHYA 1RHQB 4ZLNA 1WG4A 2DYAA 1UETA 3MPDA 2J0SD 5U47A 4A8OA 3N5BA 3PM9A 3D68A 2MYFA 1RT2A 2IC3B 2BOPA 2HLUA 4M8LA 3DOMB 5BYRA 2DRBA 2KM8C 3KYLA 2HZAA 3TVKA 4YR3A 4TYBA 3EXCX 1TKZB 2CG4A 3CD5A 1T3OA 2FJAB 1RHRB 4B3RF 3LGMA 4DZ6A 4Y2MA 2WB1D 4IO9Q 5L1IA 2G2ZA 1FKPA 4N41A 4XPEA 3AA8A 2HQFA 1B0VA 2AP6A 4ZP8A 1EKSA 2HBQB 2J0WA 1IJFB 3MM9B 2OPQA 2GO8A 1FD8A 4J9VA 3K7RA 1WC0A 1NK4A 1K0TA 4NRTA 4UZCA 4RW6A 4OJ3A 4JI0J 4EBCA 2R3VA 4OJGA 4I2QB 1SKRA 3AY0A 3VAJA 1FKOA 3PTWA 1KS2A 1Q1KA 4GKKJ 1ZAWA 1VC5A 1XNRJ 4TXSA 4FYYB 1WF2A 4UOFA 3EVOA 1MWQA 3LAKA 3ILOA 2E1PA 4FS1A 5DLFA 3AXMA 1F9EB 2IM0A 1NDKA 3PVXA 2HHVA 4Q0BB 3W2WB 3H25A 2WHOA 4PQUB 3MEDA 4N8NA 1XNQJ 3MECA 2YNHA 3BO3A 4ZCIA 4IR9A 1N52B 2BJ9A 1J27A 5ETQA 1XK8A 2C42A 4TNOA 5ETTA 2UV8A 3R7NB 3HT3A 1YZ6A 4ES2A 1RBAA 1X4HA 2HNYB 2YKNA 5JXSA 3G4SS 3K0JA 5AE1A 1S9GA 3GJRB 2QA2A 2OH2A 4K4XA 5FD1A 1U1KA 2GX8A 4F04B 4ID5A 4NYZA 4ZVRB 2RQ4A 2X3GA 3AA9A 4TQSA 3NXZA 3DU6A 3HPOA 3NS6A 4WTYA 1U47A 2ZBCA 2I5JB 5B08A 3T5JA 1RSCA 3HHLA 3BPSP 3POTA 3CDEA 2VU5A 4OYZA 1Q79A 3WX4A 2DNNA 5KOXA 5M2RA 5I3QA 3IBWA 4IDKB 2CQ0A 4DV2J 5KG7A 3V5RA 2ASLA 3O3LA 1GXUA 1D3WA 2KYZA 2DGVA 2CDRB 3MMCB 2CA9A 4IKAA 4LIWA 3Q83A 4ECTA 1HNZF 1WC3A 2FJBB 3HSGA 1SC6A 4DX6A 1Y0HA 4RW8A 4ILRA 3MAAB 4K5RA 2K1RA 2K7JA 1S0OA 2LQ5A 1JJHA 1U1LA 5KFXA 3CJ5A 2DY1A 4I4BA 2DHGA 2VBWA 2YPZA 4F7VA 1HBMA 3VWSA 2QL7B 4F0MA 1WEZA 2E5JA 1GTHA 4OHZA 3FBEA 1D9AA 2JLFA 4UUWA 4ID5B 4CLYA 4W90B 1CSJA 3D6TB 2BANB 4K5SA 2DNGA 2QMXA 1HBOA 2DNHA 4ZPBA 1T9WA 1V3RA 1NUEA 3TUIC 3HHLB 2BRKA 3MI7X 5HQLA 1NK7A 5KFYA 2WZ1A 1Q5VA 1FJ7A 2XMAA 1GNKA 4MYUA 1DTTA 1ZAXA 4GKJF 4W4MA 4WU3A 1WKKA 2Z2MA 2WSFC 2CQ4A 2GIFA 2Z4PA 4TQRA 3K58A 3IP0A 3UNYA 3BB5A 2EVZA 4RW9A 2KYXA 2E9TA 2VPXB 1GMVA 2CPXA 2HS4A 5ETNA 1WHVA 3GQCA 3R7BB 4LFBF 4X2BA 2RQKA 2DCUB 2K3KA 2D3ZA 4RR5A 4RW8B 3GV7B 5CZVA 2K1RB 3GG0A 4L6V3 2Q6BA 2DNPA 3U27A 4KGXB 5KFBA 1JLQA 1RACB 1YJNS 3J7ZT 3QT6A 2E5LJ 2OJ3A 2ZUGA 4CI0B 1VMBA 3J81U 2Y8YA 1Y00A 5DZ6A 4P2SA 2B4UA 3GCWP 1LW2A 4O23A 1D9DA 3D7SB 1FNOA 1SH0A 3NBPA 3AJ2A 4DV1F 4ZK7M 3MM5A 2VG5A 2HSEB 2EW9A 2G2YA 4ILMA 4GO7X 4NYPA 3QFHA 2GFFA 3CJ8A 3TX0A 4HR2A 3L7UA 3CIZA 5H9FK 4LUBA 8RUCA 1BQMA 2KRBA 2DHXA 5GAGI 1HFEL 2MJNA 1OMSA 5H1SV 8ATCB 3DXSX 4BWMA 4GO5X 3MFHA 4O0NA 5A0YA 1VRUB 2HS0A 2HRUA 2PC6A 2NUUG 3SCJE 3LWMA 4LRAA 2CJ9A 5GADU 4RU9A 5C5JA 3R97A 4ECSA 5GAHU 2J9EA 3UD3P 5J2PB 3AQOA 4DR5F 2FJVA 2DR7A 1I94J 4EI2A 3M6UA 4DV6J 1JLQB 2BE7D 4WYWA 3VAKA 5KFIA 1X4DA 3M05A 3DRPB 3AOCA 3K5LA 1FESA 4B9NA 4OV6A 2DB1A 2I0XA 4NRUA 5AXNA 1YG0A 2ZBIA 4AQYF 3NBPB 2HFNA 2Y8WA 2VG5B 1AB8A 1TR0A 3MEKA 3B4MA 1FT8A 4OYPA 1PGZA 5J1PA 5EWFA 5EHHA 2EFNA 2AIRB 3W64A 2H48B 4CLKA 3EUNA 2GVDA 1AUDA 2J7KA 4X64F 4RKUC 4M5KA 2CWXA 5AXKA 1S6PB 1X0PA 3VV2B 4CM0A 3K5MA 4DOZA 3LP1A 2YX1A 1KVIA 4FKYA 2IM3A 1WWHA 4J9OA 3GIIA 3W66A 5J1NA 1KQFB 2V4JB 2W4DA 2MKKA 4C11A 3THVA 5HAOA 2DNRA 1S49A 2AJFE 3HFKA 5BXIA 5RUBA 3HMJG 4NPOA 1TVRA 3H8YA 2J6SA 2IHR1 4X4SA 3FCVA 1RAGB 3I6PA 2XG8A 3SMZA 1XN9A 3PDNA 3BGRA 3I4HX 1S72S 4LF1A 2QYGA 2CQBA 5I3UA 4F2RA 4WFZA 3TQEA 4K0KJ 1KTVA 3TO8A 3Q8YA 5EX3A 2VONA 4X4OA 4HVZA 2MZQA 4QYZJ 1UMJA 2FZKB 4NI2A 2XLKA 3IN5A 2F7VA 1VBZA 3OBIA 1H7WA 2YH1A 2PD1A 4B9SA 1VI7A 2PT0A 3IRXB 2X1GA 4LF8F 1PAUB 2VB6A 2GC8A 2QEXS 4I2PA 1FA0A 1NH7A 2KFNA 4UTGA 5A2QY 2GVDB 5HO4A 4HKQA 5L39A 2HK3A 3M6XA 2FLOA 3KG0A 3LQVA 4H4OA 1YRUA 3LP1B 1FF2A 2ILZA 4FBTA 1XQIA 2HGNA 2W9CA 4PG7A 3ZO7A 1NHVA 4C9DA 2UZAA 4RBUA 2U1AA 2QX0A 1WKJA 4C11B 3RBZA 1S6UA 1OYEA 1P9QC 1OY9A 2DIUA 1TVRB 1ZM9A 2LDYA 3TARA 2HPUA 1T3NA 2EXUA 1LK7A 2VQFF 2LEBA 5IQQA 3RB0A 3BGRB 2V2KA 2CNNB 2FB0A 2CPYA 4CO4A 3SZ2A 1R6VA 1MN7A 2ZUAA 4NCGA 3MUMP 2A3JA 3H59A 1RI7A 3R5CA 1P8GA 1UWAA 2DTJA 1JB0C 2V2ZA 3CDWA 3BF4A 3BM7A 1SCJB 4QIEA 1U2CA 4PABA 4I2PB 1C1BA 1SV5A 1FXRA 2H5EA 2D69A 3OTOF 3MCNA 3HSJA 4EYIB 5KFSA 3CDBA 4YUDA 1B7FA 2LFVA 2KI2A 4XO0A 2YWGA 4ES3A 1UJ4A 4TY9A 4MMOA 4NA1A 2UXBF 2BW7A 3HO1A 1RA7A 4QIFA 3PO4A 1CG2A 2WVDA 2JC0A 3I4PA 3LOUA 2DGTA 2MQ8A 3QRQA 3TJ9A 5E7OB 4PCQA 2NYHA 1VQYA 1NHUA 1N33F 4S0MA 2ROGA 4ZDNA 1HNXF 2RE1A 2CQHA 4P52A 1NPRA 1UWBA 5KT7A 3QT7A 4U6PA 3IC1A 3GZ7A 2HVHA 2RDDA 3JQJA 4NCGB 2YKPA 4QWBA 2FJEB 5JJBA 1HI8A 5KFGA 2VJVA 3F56A 4DQPA 3DOLB 2AYBA 4DCOB 1JJCB 2HS3A 1VDHA 4NMLA 2ZH8A 3R1HA 4FNHA 2VG6A 4CLFA 4WP8A 1Y9OA 4AL5A 4O3RA 1RWVB 1RDRA 4UOHA 1SL1A 1E6YA 5HN0A 4IOCQ 2ADCA 1QE1A 1HR0F 3HSZA 4A8XA 4CZCA 2IVYA 3BDEA 3CCLS 3Q24A 4ZVQB 3BSAA 1A0OB 4I6WA 4RWXA 2CADA 3FZ2A 2VD3A 2DO4A 3GJQB 3MMBA 4B3RJ 2E7XA 2GGPB 2W24A 5IC4B 2GHVC 4EBDA 2GAGC 2A18A 3MDFA 4RLEA 1CS4B 1PYSB 2DIVA 1IWAA 2HFOA 3KJVA 3FEZA 1C2PA 1JKHA 4U96A 1OSCA 3PXGa 4NZ7A 4TU9A 4FZVA 4Z2XA 3QRRA 3QAEA 3TUZC 3V81A 4WBFA 5HBMB 1XTZA 1RHJB 2ZH2A 1C4CA 2W9AA 5M2UA 1RT1B 2B8PA 5IV4A 1VRQC 1R8HA 1UVIA 2QFJA 2QL9B 1LWFB 2GNKA 4AL7A 3FZBA 1RJJA 2XY5A 3BDPA 1IKXB 3G82A 2JLGA 4IG3B 4GC7A 4AUKA
chains in the Genus database with same CATH topology
4ZP6A 4HT5A 1OQ6A 4IRKA 1VRTB 3K8WA 2PA3A 2YKMA 1FK9A 1HBNB 5I3PA 5BYSA 2QT7A 2L41A 3MM6B 3UR0A 3OSPA 3ZZRA 4XPCA 2EI5A 4KTQA 2Y1IA 4G1QB 2ZH1A 5FDLB 2W25A 1RP5A 3AHPA 2VG6B 4QW9A 4DMZA 2ZH5A 3VAHA 2VBXA 3LALA 1SJRA 4B02A 4K2XA 1BY9A 5K14B 4F8RA 2JSXA 3D0IE 5T14A 2XBPA 4YR0A 3MR3A 4W92B 1EETB 3RRKA 1X9WA 1SH3A 1QE1B 1XMBA 4RW4B 1OSDA 3N79A 4NA2A 3OXGA 1FXDA 1Z2ZA 1Q8BA 3OVAA 2YNGA 4ZPWR 1SJ4P 2M2BA 4MK8A 2JFKA 2MGZA 2W7PA 3U1NA 1LKZA 2ASDA 1F9FA 1NEEA 2OTLS 5KFFA 1QY7A 4JI6F 5KT5A 3OLAA 1TP7A 4I2QA 1E6VA 3V4IA 1LW2B 4MFBB 1N5SA 4Y2AA 3B78A 3D0HE 4DR1F 2ROPA 3I82A 3MMBB 3K59A 1QSLA 4R5PB 4BCAA 1WF0A 4QU7A 2BA9A 3M6WA 4MH8A 3IGNA 5KFHA 3KLFB 4EZ9A 2OFHX 3VF0B 4M1KA 3HKZD 1A9NB 2DNMA 3M2UA 1WHWA 1LWEB 3BSCA 5CYQA 5MAOA 1FJCA 2WK4A 3W2VA 3OR1A 3MM5B 2DGXA 3FCHA 4O4GB 5D78A 4CH0S 2KFZA 4JV5F 2RF2B 1IQTA 4ZPAA 4PPZA 4B9VA 4U7CA 3GFHA 3IR7B 4RW7B 3J7YI 4Q8EA 1HWUA 4LT6A 3H5YA 2B7BB 4QWEA 1QAJA 2UVWA 4IQXA 5LXRA 1S6OA 5KFNA 3N01A 3KJVB 1VQMS 2QLXA 4QIVA 2W9BB 3BSOA 3CMES 3J80Y 4I64A 4K4TA 4KAIA 1JKHB 2P9GA 1DARA 3CUNA 1F60B 3JSYA 2QA1A 2JRSA 5CZXA 2LYVA 1MSWD 3ICLA 4Q0BA 2EKYA 5KG0A 3W2WA 4TY8B 2GIRA 3I32A 2FLLA 3DYAB 4PQUA 1S6QA 1FJGF 3PRDA 1WTFA 2HGLA 1BQMB 1GAOA 2C3UA 4Q43A 2BZ2A 1X4FA 2HG4A 3V81B 3CULA 5T7LA 4CO0A 2R7XA 3TUJC 5E3RA 3M4XA 3IAM9 4RX6A 3IAS9 4F50A 3KLGA 2E5LF 4F3QA 2HWTA 4WXWA 1CQMA 3SCLE 1L3KA 1HQEB 2B6AB 1UVNA 5ITHA 4RUAA 4HHJA 3CDAA 2FLPA 4DQQA 5J2QA 3K57A 4LQ9A 1JLFB 1TKTA 2DGQA 3MMJA 4WFYA 1D0EA 4JV2A 1ZYQA 1SH2A 2VPYB 3SQGA 1HQUA 4TKTA 1F5AA 2FUG9 2IRYA 2R4FA 3C6TB 1RT3A 5A0YB 2FVSA 1V3SA 1AROP 1VK3A 2HNYA 3R27A 3M2RB 3TA1A 5DJBA 3MWBA 2CZ4A 3THPA 5KFRA 3ZZ0A 5DM7Q 2M0GB 2LEAA 3MGJA 2CPIA 4NLRA 1SJ1A 2XMUA 4OZ1A 1F0XA 1TL4A 2YKMB 4IFVA 1HHSA 2RB7A 1FK9B 3IR6B 3UR3C 1AW0A 1VIOA 3OVBA 1T7PA 2WONA 2N4CA 2K8GA 1FDBA 2W7AA 4IH7A 1T05A 2FVQA 2LEPA 3MXHP 5HMYA 3HHKA 3G8TA 3PKYA 2FPHX 4DL5A 5KFWA 1ZM3A 4C98A 4DEZA 2Y1RI 3DXBA 2BDPA 3AB2B 5E2QA 2OMOA 4M63A 1FTCA 2V8HA 5A8WA 1Q8LA 3GIKA 2Z0GA 3FEXB 3B8HA 1NO8A 4A8WA 2ROEA 2ZH4A 4C8YA 2MQPA 4K50A 5DQHA 3PZPA 1S76D 4F67A 1RYSA 4KSEB 5GVQA 4J9RA 4O44B 4MIBA 5F0UA 2YNGB 4DN0A 2MPUA 3N6LA 1UEUA 5B7WA 2I5JA 5KFVA 4A8FA 2O66A 4G1IA 5DDOC 1X4BA 1ZPWX 5C42A 4F3OA 4KHMA 5EDWA 2D7SA 4PXBA 1QLNA 3OXFA 1NK5A 2B56A 2DH8A 3V4IB 4K4SA 2ZOMA 1TL3A 1RT7A 1OO0B 3N5FA 4KRWA 3I5BA 1DURA 3VQSA 2AGQA 1HNIA 1N8RT 2FLNA 1W2IA 3FMWA 4ETZA 4X65F 2HHTA 2HGMA 1GTEA 3M2UB 2J6UA 4IDKA 5CYQB 2BM1A 3G8QA 3G6YA 3PEHA 4HH1A 1Y5NB 3DRSA 2HAIA 3HVRA 2DJWA 3OR1B 3KMSA 1PILA 4PPDA 1SIZA 5M2PA 4Q2MA 4Q8FA 1S9EA 3DGPA 5CHCB 3ULHA 3CCVS 2BQ3A 2JJ4D 1N5YB 2PN6A 1JXEA 2V9KA 4Y6IA 1J5EF 5DQIA 3MMCA 4DWIA 2ZC3A 1WG5A 3D5MA 2DH9A 1B0PA 2CJKA 1RGVA 2JC1A 4DL4A 1WTBA 2DNLA 2FDNA 4B3OA 4PG5A 1SIWB 2BM0A 4FXWA 2U2FA 2LDIA 4OZJA 5K8NA 3OHBA 3JSMB 2BABA 1RKJA 3DLBA 1X4AA 1JWWA 3M2VB 1FRKA 2NQPA 2XLIA 2WOMA 2NXUA 2CPDA 4OFZA 3PW4A 5I4MA 2RS2A 1VOMA 4DR3F 4DV6F 2L9NA 5T7LB 3CT9A 5MLCV 1KSPA 1HNWF 5DG8A 3TYTA 1QAIA 5HLFB 5F8JA 2CJQA 2XEXA 1Q78A 4UQGA 2BYCA 3H5SA 4LQ3A 2L48A 3H5XA 3CE8A 3UDLA 4DSKA 3CCMS 3M1VA 1ELOA 4C8ZA 2IJFA 2D3OR 3TOQA 5E3QA 3DM2A 2GHWA 3SQGB 1HQUB 4M95A 3OFGA 1YIJS 1SBRA 1R27B 1UW4A 4ELVA 2OLWA 1RTDA 5LMNF 2DGUA 3JTNA 2JX2A 2WAQD 4F4XA 4R8UA 3LPYA 3ISZA 4YDDB 3V6JA 1WNEA 1D9FA 3SDEA 5LJ5Y 2A10A 3NCQA 1NK8A 2R2TA 4O3QA 1V3ZA 3N0VA 4M94A 3QGHA 2WONB 3MM8A 4PRFA 2AGPA 1T05B 1I1GA 3KWMA 3QO9B 4NCAA 1H7XA 3M8PA 3CJ0A 1NJWA 6FDRA 4DV3F 4TYAA 2P9CA 2NREA 2BXJA 4QPXA 4BDPA 3DNCA 1X8DA 5KT6A 3BR9A 4KGKA 1QJHA 2GIQA 3DMJA 2BANA 5A8WB 3ZFVA 2OSRA 4OI3A 1R8PA 4NXMF 1S1UB 4WK3A 1VQ8S 5K8PA 1T03A 5D4NA 4HL9A 2DGOA 1FDNA 1VIXA 2UXCF 2DR5A 4NLPA 2R8HA 4ZVFA 2X51A 4YEAA 5C42B 1XC9A 2D1CA 4WZMA 1N32F 4NLQA 3BSNA 4FNIA 1MMDA 1PC4A 5I3UB 5LT5A 3JTPA 2N7CA 1JLBA 1TL3B 3TNVA 1IKWA 4CT8A 1HNIB 2G13A 3MPVA 5J1EA 3N6MA 1NZAA 4Q45A 2CQ2A 4MKAA 2N3OA 4OIXA 4XAKA 2NZ4A 1O0PA 2COLA 3DRSB 4DUZF 4X4VA 4EO8A 3CC4S 2I9SA 5AE2A 2GJ2A 1HW8A 5IXUA 2RU9A 3NLCA 1S9EB 4WFNQ 5E3AA 1U1PA 5KG3A 5CCLA 4Y00A 4DFPA 1N5TA 3EXYA 2K2PA 4C8MA 2VG7A 2HQIA 1SXLA 2HHPA 3FMBA 3PX6A 1C1CB 1IUJA 4IFYA 1H98A 4WFAQ 1TKXA 2P6TA 4RU2A 4DR4F 2B43A 5L1LA 4B3OB 1R8CA 2ASYA 4E8UA 2XNRA 1Y7PA 4CTAA 1V9OA 2K7KA 3GR1A 2LQ9A 2VV5A 2IRUA 2CYYA 3WBZA 4ECVA 1HWLA 2GA7A 3M6VA 2P5VA 2WOMB 2FVPA 2RVJA 3CCUS 2EFQA 5IFMA 2ZH9A 2L3MA 2AV5A 3C2PA 3BZQA 2DVIA 4KC5A 2FD2A 2HHHF 3I9ZA 5B0BA 2ABYA 5HROA 4Y2CA 1GX6A 2AJ4A 1G6BA 4H4OB 2IBKA 2AYGA 4PUOA 4N56A 4DL0C 2Q79A 1VQLS 5F9LA 3M1VB 1ZH5A 4I7FA 4ED8A 2V8GA 2PEHA 3GMGA 4TLRA 3VTIA 5EN1A 1B64A 3DHWC 4K0KF 2F8EX 2W9CB 4ILLA 5IWAF 3FGVA 3N6NA 1IBLF 1RTDB 3MFIA 2FJXA 1XR7A 1W2BR 3J81Y 3DLHA 5GAGU 4EWTA 2FVRA 4R8UB 4C0BA 2CKWA 3CWJA 2PDAA 4ES1A 5DLGA 1S1XA