2HFOA

Crystal structures of the synechocystis photoreceptor slr1694 reveal distinct structural states related to signaling
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
MSLYRLIYSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYELSDNFFLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Activator of photopigment and puc expression
publication title Crystal structures of the Synechocystis photoreceptor Slr1694 reveal distinct structural states related to signaling.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 45
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hfoA01
5B0GA 4HH0A 2PGCA 1YJUA 3DXSX 4OIXA 1KVJA 2AP6A 2IFXA 2VH7A 2GCFA 1YJRA 3LO3A 4FNIA 2ROGA 4Y2MA 3MZIA 3TNVA 3TRGA 2OD6A 4Q2LA 4ZOSA 1TR0A 2RSQA 2FIUA 2AJ0A 2OP5A 2HLUA 2GA7A 1MWYA 1W2IA 4OJGA 1FVQA 2QIFA 3TOQA 3KNGA 5F0UA 1LQ9A 2BJDA 2BYCA 5T7LB 4YDXA 3HF5A 2K1RB 4OJ3A 1FE4A 2BJEA 3BB5A 2OFHX 5B0EA 1TUVA 2HQIA 2CRLA 2K2PA 2PD1A 3FRYA 2KYZA 1X8DA 4Q2MA 2OMOA 1APSA 1Y9OA 2N4DA 1OQ3A 2XMVA 2KT2A 3BF4A 2ZDPA 3MCSA 1Q8BA 5KAKA 2JDJA 2ZDOA 3HHLA 1MWZA 2W4PA 1FVSA 3FGVA 3KKFA 4Y2IA 5T7LA 2GGPB 2W4DA 4HH1A 2K1RA 5A6PA 1OSDA 2ASYA 4QOTA 1Y0HA 4OJHA 1N5VA 1JK9B 2BBEA 2RU9A 1Q4RA 2LQBA 3BDEA 1CC7A 1TL5A 3QMQA 1X7VA 2K7JA 3UDCA 5B0FA 1FD8A 2GO8A 2G9OA 2Q3PA 2W4CA 2FB0A 3GZ7A 1FEEA 3LGMA 1JWWA 1SB6A 3F44A 2GGPA 1OPZA 1VQSA 2XMKA 1KQKA 4A4JA 1S6UA 4YEAA 1AFIA 1TL4A 3BM7A 3HDSA 4EFAC 3HX9A 2OD4A 2ROPA 1Y3JA 5B0BA 1P8GA 2LDIA 2LXFA 2XMTA 4HL9A 3KG1A 3QGPA 1AW0A 3HHLD 2XMMA 2VV5A 1V3ZA 2OKQA 4ZA1A 1X0PA 3BR8A 1YJVA 2FHMA 1S6OA 1SI9A 2N7YA 4NL5A 3CJKB 4DL0C 4F67A 3WDOA 4FNHA 1CC8A 1QUPA 1N5QA 1KVIA 5B0DA 1K0VA 2LQ9A 4DPOA 2AJ1A 5IXUA 4DN9A 1YJTA 1Y3KA 5A6WA 4OJ1A 5F0WA 3I9ZA 2HFNA 2OFGX 2FTRA 5B08A 1U7LA 3CJKA 1VQYA 2GFFA 2QLXA 1Q8LA 5B0AA 5K9FA 2AW0A 4Y2KA 2HFOA 1FESA 1RJJA 2XMJA 3HHLC 3LGNA 2IYIA 1IUJA 2RMLA 2XMUA 1YRXA 2HIQA 2ACYA 1WD6A 3BGUA 4HI1A 2K7KA 3DCAA 3IWLA 1YG0A 1R6YA 3T9NA 2OAUA 3HFKA 3KG0A 2L3MA 4NPOA 4U9RA 1GXUA 3HHLB 5B09A 2ROEA 4A46A 1P6TA 1N5SA 3IWXA 3VTIA 1GXTA 1TZ0A 3E8OA 2HLTA 2KKHA 2EW9A 2KT3A 1URRA 5B0CA 2XMWA 4A47A 2N4CA 1AFJA 1XBWA 3K7RA 1CPZA 1OQ6A 2GV1A 1FE0A 1Q53A 3FMBA 4HI2A 2RILA 1SQEA 1ULRA 2QLWA 2BUNA 1N5TA 2QYCA 3BN7A 4A48A 2IYGA
chains in the Genus database with same CATH superfamily
4NLDA 5HLFB 4LF7F 4TYAA 1D8ZA 4GRSA 3B6BA 3KLVA 2YH1A 2HNDA 4I64A 4ZP8A 3N79A 4OJ3A 3I55S 4RW9A 1M5HA 2YKNB 3DNCA 3ZFVA 4OYPA 1ZETA 5E3RA 4CM0A 5K14B 2WVBA 3TQEA 3I5AA 2UV8G 5GAEI 5HK4A 3RRGA 1KNZA 4EZ6A 4CTAB 5K5MA 1QUVA 1VIXA 3C6TB 1NBEB 3MEEA 4ZJQA 1B0TA 4B9NA 1NCLA 5LJ3Y 3GIIA 2G1DA 3ILOA 2B43A 4F3OA 2XO7A 1PAUB 4YDDB 1HHSA 5FDLA 4CM2A 8ATCB 4DS5A 3PIPQ 1KOOA 3ZZRA 1S1WA 1U1OA 1X4HA 1N0UA 4V19J 3SZ2A 3GFHA 3HT3A 2HRTA 5C24B 1ZM4A 4CLTA 2UUWA 2X3GA 2P9CA 1S0NA 3NCQA 2DGVA 5KG5A 2PMWA 2DCLA 2V67A 4PYAA 3O5TB 2MQMA 4HTJA 2FVSA 4LSLB 2K1RB 5IT4A 3IN5A 3UDVA 2WBRA 3I0RB 1APSA 2R2SA 5IC4B 3EGNA 2F4FA 5GAHI 3UVJB 3DU6A 4KFBB 4CLSA 5A76A 2GIQA 1HNIA 2UUBJ 2V8GA 3LWLA 2HZCA 3G8SA 5J1PA 2DNKA 4RPFA 5I3QA 3PW5A 3GQCA 3M4XA 1KVKA 3SMZA 1DY3A 4P6QA 1UP1A 1PYOB 3IS9A 5M2UA 3RW7A 2DHXA 3KHRA 3WZ0A 4PYDA 4NXMF 1VJQA 3B54A 4NWBA 3DM2B 4DPOA 4LF8J 3KLIA 4PG7A 1W2BR 1QAJA 1IM4A 1MU2A 3D0HE 4C7QA 2OSRA 4OI4A 3D0IE 4TY8B 1HD0A 2FJDB 3ZO7A 1GK8A 2M3DA 2VPXB 3VTIA 3PR5B 1AFJA 4J9VA 2EVZA 2V4RA 2YX4A 1S5ZA 5GAEU 2QYCA 2EEYA 1LW0B 2KU7A 3MEKA 3MZIA 3TNVA 2A3JA 1ZAWA 3I6PA 2EG1A 2JZ5A 3MMCA 2EFPA 2ZOFA 2DNLA 4PRFA 4Q44A 5KOWA 2XSJB 3TEGA 2JDJA 3DRSB 3QGHA 4O23A 2DT9A 4J37A 2VOOA 1XTZA 4ED4A 2OTJS 2MB0B 3RAXA 5K8NA 1RT4B 3ZZYA 4JI2F 5D4NA 3R5BA 1EETB 1R89A 5A8RA 3OV7A 3MR2A 1RTZA 2UVWA 4LMZA 2VQFF 1SBRA 1FJGF 4AL7A 3UPFA 5D4PA 4WFZA 1QTMA 1YLXA 4CWBA 5L38A 3LAKA 1JLAB 4X4VA 2E1PA 1M1KT 1RT5B 3D2WA 1HFEL 1WG4A 3DRPA 1KFSA 1L3TA 3OVBA 4OX7A 2AZ3A 4X64F 4GO7X 5GAHU 2VKRA 3CE8A 2YWGA 4DCJB 2RQMA 2QL7B 1C0TB 1SXLA 2NZCA 3RB0A 3Q8QB 1EQMA 4JV2A 2AKWB 4U7UK 4UY8T 2BYCA 1SQFA 1U4BA 3U1MA 2M70A 2GO9A 2OEMA 1RYRA 1MWZA 1JMTA 1NK0A 2KG1A 1EJ7L 1RBLA 5HQLA 1JK9B 2JEIA 1QE1A 2C2EA 2K3KA 2CQDA 2Q3PA 3UWTA 2P6SA 1JXVA 3PX0A 4KO0B 1YHQS 4EFAC 1VRUB 2WONB 3PJXA 3AJDA 2FJXA 4EGLA 3M8QA 2HK3A 2YNFA 4L76A 2DH9A 1C1BA 1CQMA 1N52B 1D9AA 4U7UD 2M9KA 2ZHBA 3DDKA 4N41A 2YBVA 4B3RJ 3Q86A 4CCHA 3U7JA 2OAUA 1YZ7A 4F3QA 2PMZD 1SJQA 3HJVA 2DH7A 4A47A 4ZKAA 1CVJA 4MK7A 4JI5J 2VICA 3NWGA 2KZMA 4S0MA 4YY3J 1JLGA 6AT1B 2U2FA 4JI4J 1VS3A 4QCLA 2M88A 1YIJS 4IOBA 2DVIA 1ZS6A 3GONA 3MD1A 1RWXB 1UL3A 4CDIA 2Y8WA 1Q5VA 5KAKA 2D69A 2IM2A 3J81Y 4NEZA 3IAM9 2DIVA 2A18A 3KXDA 3OSPA 2CZ9A 3G8TA 2RH3A 3GZ7A 4MYTA 1RGVA 3PRDA 3MM9B 4ZP7A 4M1KA 1A7GE 3MMBB 2W7OA 4DG1B 1CULA 3QO9B 1R0CB 5JMNA 1E6YB 1WKKA 5HROB 3IA0A 1JLQA 1C4AA 3FEXB 4FP9A 1WELA 2RRNA 1YG0A 3HZGA 5DDPC 4J5OA 2H5JB 1S4FA 2Q1LA 2V8HA 1T9VA 2ZH9A 1NO8A 2XLKA 5LM7E 5ETSA 4B3OA 1N6QA 3TZWA 1P9QC 1NPRA 1LW2B 4Y2MA 3CD7A 3R27A 5KFNA 4USUA 4NXNF 2WAQD 4DV7F 4HHUA 4K0KF 2CG4A 2N4DA 4LRAA 2R7WA 3MUVP 4ILLA 5AE2A 1PBAA 1U6ZA 4Y2IA 4HDHA 2G0CA 3GJTB 3UDCA 4ZVRB 2RVJA 2IJFA 4WBFA 4B3TF 3U02A 2H9ZA 2L9WA 4JYAF 4NRUA 1UWBA 3GWCA 3LP2B 4MKBA 1YJVA 1SI9A 1GAOA 3OJSA 1DQAA 2X7IA 1CJTA 2YNIA 1RB0A 5CHCB 2PFFB 2RE1A 2YPYA 5F0WA 1YWXA 3RRKA 4PWWA 3HO1A 1PO6A 3I0SB 2KM8C 3OFFA 4X66F 1SC3B 3CDWA 3LQVA 2CQIA 1WC5A 4ANCA 1VDHA 3VHQA 3HKWA 2DHGA 2HHTA 4KB7A 5E5NA 5D4LA 1TKZB 3EZOA 4MKVA 5ETTA 4P2XA 4RLEA 3H0PA 2IC3A 1TK8A 2CVIA 4CYUB 1GH8A 4RL1A 3FBFA 1PSDA 2BJEA 1F5CA 1S1VB 1TUVA 3RJMB 1RT2A 3RR8A 3TA0A 5A2QU 3W1YC 2C3PA 3KDNA 1TU0B 4O3OA 4JI1F 2ZOGA 1IBMF 1EAYC 1DTTA 5A8WA 5IM0B 2JC1A 2HVZA 2B9XA 3SSSA 1R27B 3MR5A 4MIWA 5KFHA 3PKMA 3FMWA 1JLBB 1GQEA 4J9OA 2DYAA 1C0UA 1WI6A 3UR3C 1C1CB 1JXEA 3M8WA 4TQSA 4X4QA 2XYPB 3IFEA 2N3OA 4X4PA 1J2VA 1XMQJ 2V8PA 4OHVA 3KLHB 1UCNA 3RAQA 2YH0A 2CNKB 2GAGC 4A8SA 4ZPTR 2AEFA 1WG1A 2MKJA 1WC1A 3BGLA 1XBWA 3ET6B 4DEZA 1UA0A 4JP8A 2JEFA 1RHJB 4A8FA 3W2VA 3DLEA 3HP6A 1REVA 2JLEA 1F2HA 4DQQA 2W01A 2YKQA 3Q8PB 2LKZA 4WFAQ 2DR8A 4PKDB 2LA6A 5C42B 4RW8A 2XYHB 3NGDA 1X31C 2W7AA 2J9DE 3AQPA 3MURP 4TVAB 1X9MA 3NGRA 3S8SA 3G82A 3GYGA 4ETZA 1F6TA 1ZPWX 5ETKA 1HI0P 2V5HG 2VG7B 1TKTA 1FKAF 3OR2A 4O4GB 2HNYB 3ENWA 3H4DA 2QMUB 2KO1A 2NXJA 1V3SA 5KFGA 1NH7A 3F56A 1K0VA 3VAJA 5IXUA 4IR1A 1XNRJ 2UUBF 2ZNYA 1RAAB 3QWUA 4OZNA 2I1RA 4V1Ak 1RE1B 4C9DA 4NI2A 2JEGA 1CPZA 3F41A 1UPMB 1HNZJ 2GIFA 3W64A 1ZZFA 1RTDA 1F3FA 2HBYB 5A8KA 4LF8F 2JNJA 2GVZA 2M52A 3MM7B 3NGTA 4ZOSA 2ZH8A 1CLFA 2W2NP 3EWGA 1BQMA 1BQNA 3VVUA 2P9EA 4OHYA 1S7IA 2AEJA 1IQZA 4OYWA 3MAQA 3U1LA 1S49A 4UOFA 3PCOB 1H2UX 1OPZA 4H4MA 4Y2AA 2FHKA 4PWUA 1R0AA 2PDAA 3M6VA 5KFMA 4Y0FA 2ZE2B 4Y00A 3OTBA 2AV5A 3JS9A 1VBYA 1QAXA 2I38A 4GKJJ 3IGVA 3IWXA 1VQNS 2AEMA 4IG0A 3G8QA 4WE1B 1CJVB 2HQGA 4P2FA 1UJ6A 1ZPVA 4MK9A 3AA9A 4X84A 2CQ2A 4FPRA 1RA6A 1KSPA 1N32J 3NLCA 2IVYA 4OJHA 2W1BA 3Q2TC 2VA2A 4NE9C 2DHSA 2OJ3A 4BCAA 1VQ5S 2FB0A 1VCTA 1VJWA 4KAIA 3T1AA 1VHFA 2KG0A 4ATNA 1ZZNA 3L3CA 4F02A 3GV8B 1S1UA 3OSNA 4IKAA 1WJ9A 1SJ3P 2FHMA 1TKXA 2HMIB 3M30B 5CABA 3J7AN 4ZIWA 3TVKA 1VLYA 1VRTB 3V5RA 1JLCB 3I87A 5DETA 4QYZJ 2MZQA 1X60A 2QLXA 3H40A 2C1EB 2BANB 4RNFA 3NAIA 5KT5A 3JTOA 4OHWA 2W9BB 2D3ZA 2Y1JA 4ZVSB 1DQ8A 5C2CA 3QFWA 4J9MA 1NJIT 4JOUA 3BREA 4OYAA 1KVJA 4DX6A 3G2XA 4ES3A 4PEOA 2R7UA 3L09A 1HBMB 3B8HA 2AJFE 3K5NA 2EFVA 3KNGA 1S48A 3R5JB 4B3RF 4BC9A 2O67A 4N56A 4HT7A 3ZNJ1 3N4WA 4B3MJ 1HBNA 2NYHA 3CJ4A 3CWJA 2W4DA 3CDBA 1N5VA 2AGOA 4JI5F 2MZ1A 4ED5A 5SZTA 1UVNA 2Z57B 1FD8A 4YY3F 4NMLA 4JI4F 3W2WB 4LRBA 3DHWC 3UN2A 2WCXA 5DQIA 3P6YC 5AXKA 5D3GB 2W25A 1P27B 3NMAA 3M2UB 3LPEA 2GMHA 1IR1A 4QWDA 3HVTA 3IXQA 2ZH2A 4J9QA 4Q7AA 2HNDB 4KV8A 3M6UA 2ALYB 4OL8A 5BYQA 4RW9B 3FCHA 3KLFA 1MROA 1CQNA 4NLGA 1NK4A 3TZXA 3MCMA 2MMYA 5HBMB 5L1KA 3IBWA 3BO2A 4ELVA 5B0GA 2VH7A 3D68A 3T19A 4D3GA 1AZSA 4CO0A 2DBBA 2IJNA 3K5LA 3BB5A 3CCUS 3MEEB 3MM5A 3JAMU 5BYSA 5CCLA 2EWHA 3X3UA 5KFWA 4UUWA 4YN3B 4H4KC 1K1QA 3LA0A 1N56A 2DPIA 2XLIA 2PC6A 1MMDA 3DN9A 4O0IA 1S6UA 4X65J 2YKPA 2ZC4A 4Q8FA 3QJLA 2GJ2A 1U2FA 1V5IB 4J9PA 2OKQA 1HLWA 3KLGA 3W63A 3CJKB 2IM0A 4F0KA 5LOQA 1NJWA 1LWFA 2H4WB 2XY7A 1R8AA 4WKYA 1T0TV 3BEGB 3LGNA 1UEVA 3DMJA 2AJ2A 2FJBB 3HHNB 4L75A 1U1KA 1FXDA 2KXNB 3G87A 1HNIB 4RW7A 2QL9B 4O44B 4YR3A 3MEDA 2PGCA 2UVUA 1Q0NA 1YJRA 3TZYA 2BABA 2XQCA 3HPOA 1U1MA 2K2PA 2EG2A 3MM8B 5JJBA 1IR0A 1S4EA 4NLUA 1UVLA 5A0YA 3HVWA 4LT6A 4WIIA 4DL6A 2MQOA 3LGMA 2BDPA 1Y5IB 1KTVA 5HQ8A 3TARA 4I2QA 2DY1A 4FXVA 4QR0A 2N82B 4LRFA 1VQMS 4H4OA 1NEEA 1SQGA 1U24A 4MFBA 1EP4A 1YGYA 2HHUA 5L1JA 4YR0A 1H98A 3J7YI 3V4IB 2HFNA 2W9CA 1RJJA 3MMCB 5KFCA 3VV2B 3PHTA 1IBLJ 4YFUA 1ITPA 4JI7J 3A8EA 3KK3A 2KJVA 3CC7S 2WSEC 3UI3A 4N8NA 1MMNA 4ID5B 2R42A 4CLPA 2JVRA 2CKWA 1XMQF 1ZAVA 1QY7A 2ROGA 3R2DJ 4R8UB 4Y65A 2Z2LA 3I4HX 3HK2A 4MK8A 5IFMA 5CCMA 3VQTA 3FBBA 2Y0SD 1A6LA 2XS2A 1SH2A 1NDPA 4OLOA 5G4DA 3CCMS 1GMWA 1HBUB 3ZTSA 3SV4A 4CO2A 3KK1A 1KC8T 2ACMA 1Q5YA 2GMJA 4M5KA 4DR7J 4WCEQ 3DLHA 1HQUA 3GE9A 4UQGA 1SCJB 3W8GA 3EGVA 1G7CB 1U7LA 3A8IA 1NM2A 3RR7A 4WZMA 2QT7A 2Z4PA 4B9TA 1R6YA 4Z7YA 1Y11A 3L95X 2I2YA 2HVHA 1T02A 4ZLNA 1KLNA 4FDFA 3LANA 3OTEA 2GAHC 4Y28C 4DR1J 4KGKA 4CIOA 1XNRF 5LT5A 2VU5A 3I9V9 5MAOA 1T8EA 5F0UA 4IRCA 2AX1A 3QYYA 1KLMB 4DL7A 3J7YU 1C1BB 4B9LA 1OSDA 1HNZF 3W5ZA 4TU7A 2HQ3A 1U47A 3CJQA 4OYZA 1P8GA 2F4VF 4K59A 3GYXB 4QWCA 1AW0A 1UVMA 1RT6A 4OX9J 1NRKA 4J7CA 4DFKA 1LNQA 1JLGB 2KHCA 2DKOB 3UN3A 1F9HA 3QSYB 3AAWB 1MSWD 4KPCA 4Q5VA 1PYTA 5D4OA 4LQ3A 4WF9Q 1H38A 3EGZA 4K5RA 3AT1B 4LIWA 3RG6A 2F8EX 1SKRA 1LK7A 3SCLE 1UPPA 2VKZG 4K5SA 2EBEA 1P1LA 1KEKA 4DX5A 5D15A 3AXKA 5MLCV 2DJWA 1VC5A 4O0NA 4CT9A 1VQ7S 1D09B 1T05A 4TKTA 3KMSA 3DRYA 3FFIA 1YDLA 1NKEA 4GKJF 1M0SA 3C19A 4YUDA 1CEZA 2CJ9A 2ZDPA 3C15A 5HL7Q 2CQ4A 2MYFA 3DDIA 4PCQA 4RUAA 3GV7B 2XYGB 2MZTA 2CNLB 4U6PA 4EMDA 3G4SS 3OVAA 4ZCKA 4N76A 1MNEA 3IG1B 1WI8A 2DEJA 1S97A 2LXFA 1U1LA 4Q0BA 5I3UB 1RWNB 4FF1A 2LU1A 3BR8A 2ZH7A 2Z2MA 4F3MA 3MM6A 3THTA 2KFYA 2VG5A 1N32F 4XPEA 3QJPA 3DLLQ 4K4ZA 2MJNA 2IAJA 2MHNA 2FJVA 2CZVC 4RBVA 4HDGA 4C11A 2FY1A 1P1TA 2FLPA 2L3MA 1SL1A 4RNOA 1KRPA 2HLTA 4DLEA 1WHVA 1HW8A 1LKZA 2ZJPQ 3CT9A 4U67Q 1N54B 4QIWD 2BRKA 3EUNA 4DPYA 4A8WA 1UVJA 3LP1A 1L3SA 3QATA 5J2NA 4P71A 3TRGA 1VQPS 1RTJB 2Y9HA 2VODA 1X4FA 5IT9Y 3W61A 2BACA 1XN9A 1SUQB 3JB9k 3TAQA 2BQRA 3VGVA 2J5AA 1DTQB 1FX4A 3NNCA 2LQBA 1CC7A 2YKNA 1Q79A 1Q95G 2B7BB 4B9UA 2VFUA 3ZZ0A 3V6DA 2Z8QA 5K14A 2KL8A 5IT0A 1WF1A 2V2VA 1WDDA 4NA2A 3PX4A 1T9WA 1D8YA 2RAQA 4CTAA 2AU0A 1UA1A 2DHHA 3DOLB 4B3MF 3PR4A 4DOZA 1PJ7A 2VFRA 2IC3B 4EBEA 3C6TA 2PI4A 1IUJA 5F8HA 1RT2B 2B9WA 2WB4A 4URGA 2NS1B 1T9YA 4MMOA 3PV8A 2WRMA 2HHHJ 2BKPA 2ZUAA 4R5PB 2B6AB 3H59A 1ZH5A 2Y1RI 3WC2A 1SJ1A 1H2TZ 2A1BA 2PEBA 3W9JA 2D9OA 4DSIA 1S6QB 2HVIA 4DV5J 2MPUA 2FIUA 4OZ5A 1C0UB 5C24A 2DRBA 3O44A 4DR2J 1L3KA 1Y00A 3MR3A 3NP5A 1ZA2B 2UUTA 4Q2MA 3BS9A 4JV5J 1XNQJ 2YKMB 2DNMA 2GQ2A 1T03A 1N48A 4LSLA 2K1RA 3M6XA 2RUGA 3I0RA 2HS0A 5H9FJ 1JWWA 4WPAA 3UVJA 5CYJA 4E8UA 3NBPB 2IM3A 3IGNA 2V6AA 4ZPAA 2WSCC 3W2VB 3DLEB 5DLFA 3NMRA 3M2VB 2OI2A 4YHHJ 1SJRA 5B08A 1S72S 1Q8LA 1NKCA 2O01C 4ZCIA 4ZPDA 3DM2A 2W2PP 3H2VE 4FF3A 1X5OA 4NLRA 3ISZA 2HQFA 3D3CJ 4OZLA 4ECXA 3G82B 2XMWA 1OPIA 1EIYB 4OHZA 2ZZMA 5D77A 1MN7A 3VAHA 2J7WA 5KFLA 2BEFA 2QX0A 1B0PA 1G3OA 1LW0A 1IBCB 3FQKA 3M05A 4ENOA 2D7SA 2HGNA 1FNOA 2LU2A 3OW2R 3FC9A 3BDEA 5J2MB 2XSJA 5AXNA 2ZWOA 5U47A 2FHJA 5HVGA 1N88A 3CPWR 2KRRA 1RHRB 5CYMB 1NHUA 3FKBA 1RT4A 4KKOB 3PJWA 1XJWB 2N7YA 1EETA 5BXIA 4YS2A 1RTDB 1TFYA 3OXLA 2RQCA 5A8KB 2GVZB 2HURA 2XY5A 1RACB 5F3ZA 3K57A 5ETPA 3IWNC 1BGXT 1R8BA 5K9FA 1NU4A 1IWAA 1W25A 1JLAA 1F5BA 3CXCR 2NPFA 4K50A 1RT5A 1I51B 3SQGB 4OZ0A 3W5YA 1GXTA 5E0OA 4WYLA 2AD9A 4DFMA 2Q6BA 2ASDA 3G71S 2FVRA 2EI5A 4KPYA 1JLFA 4BLGA 3LWMA 2RD5C 2M8HA 1T95A 5LJ5Y 1VC6A 1NJXA 3U27A 4G6VB 1F3VA 1C0TA 1D0EA 1FRJA 5CZVA 3AQOA 1RBAA 2IDLA 4WP3A 2CNNB 1IBLF 4JI7F 3TVYA 4DZ6A 4AUKA 4BWMA 3JSYA 3T1HJ 2I0XA 2HVEA 3RU0A 4I69A 3A3PB 4LFCJ 4DCOB 2KT5A 1FDBA 4P2SA 2XMMA 2W2MP 2V8VA 4KO0A 1VRUA 2WONA 4CH0S 5KFUA 4G1PA 4DN9A 5A6WA 4K7QA 1KONA 3H5XA 2FTRA 1JJHA 2DGOA 5EX3A 2MY7A 1F9FA 5IV4A 1Z2LA 4WKRA 1TUGB 2GIRA 1CBKA 4RNMA 2YPZA 4K4XA 4DR7F 1TV6B 4B17A 1Z2ZA 5GMEA 3M8RA 4Q2LA 4DXLA 2D3OR 2J8AA 4Y3CA 1S1UB 4L3NA 2G0IA 2VB6A 4QYRA 3RW6A 1YJWS 3ETMA 4GVLA 2JL9A 1FDAA 5LSOA 2KT2A 4DPTA 1DFDA 1Q8BA 2LXIA 1VC0A 1TP7A 1I94J 4ZVHA 5KFDA 4XAKA 1PCAA 3CVKA 4DR1F 2E1CA 1AUDA 1RAIB 4LFAJ 1WC6A 2FPHX 1JB0C 2CZ4A 4J90A 1JJ2R 1DRZA 4ZMMA 4B9MA 3TQ1A 3AD8C 4KIAA 2LECA 3SCJE 3PRVA 3MM9A 5KFPA 2VC0A 3ISND 3G96A 3KYLA 3MMBA 3QO9A 1E6YA 4CLWA 1SH0A 1EB0A 2X1GA 3GIMA 4U7CA 4X4NA 5HN0A 4ALZA 3GSDA 3CCTA 3Q89A 4CLYA 2CUYA 2F7VA 4CLZA 1RDRA 4OX9F 1GXLA 4LF9J 4WXWA 4MIAA 1RADB 1VK8A 3K0JA 3QRQA 3FBCA 4NLXA 2ZH3A 2WTFA 5F8JA 3MWBA 4DU7A 3SBMA 1LW2A 1PC5A 3TJ9A 4Y34A 3B78A 5L9XA 1Q4RA 3W66A 3FCVA 2E29A 2AWZA 1VRQC 2QL5B 2AT1B 4DL2A 1EZZB 4H4KA 5DS7A 1LFWA 3ILIA 3ZZUA 3A3NB 2BW2A 2J9DA 2OMLA 3TYTA 2ZUGA 2KN4A 3Q8RB 1VOMA 1N34J 3FVYA 4ILMA 4LRDA 2BA9A 3T5LA 4G1QB 3BH6B 2V4JB 3FUYA 4DL3A 3AJ2A 4RZRA 1TTHB 3KHLA 2XNQA 2N4CA 1JNZB 3V4MA 3MGJA 4I2PB 1EHWA 4HI2A 2ZJRQ 3I0SA 1RTIB 1PBUA 3R9LA 1FKOA 1TKZA 2BW7A 2G1HA 3C46A 3CIMA 3HKZD 4CYUA 1BY9A 3EDRB 2KHDA 2G0JA 4CI0B 2Z0GA 2DIUA 3M9OB 1S1VA 2J76E 3DLGA 4A8XA 1TL3B 4LF6J 2VFSA 5E2QA 1XR7A 5D0HA 2QA2A 3B82A 1WORA 2BJ3A 3GU0A 2PSZA 3Q24A 5CYQA 2W8LA 5HATA 2RQKA 1VQKS 4RW7B 3EVOA 3R5DA 4UOCA 2L41A 1X0PA 1S1XB 1JLBA 2IHR1 1K9MT 3PY8A 1C1CA 4NZ6A 1ZA1B 4DSFA 5KTQA 4ED6A 4DPWA 2HZAA 2E9ZA 3ZTRA 3KG0A 4I56A 2DR7A 3Q2SC 1NDLA 2RKIA 1M5KC 2V2QA 3CCLS 5DZ7A 1F0XA 1HMVA 2KT3A 1HWKA 2XZTB 2VQFJ 1VBZA 5T41A 2IRXA 1SQEA 3RBDA 4KT0C 2XSFA 9ATCB 2F63A 3ET6A 3QZ8A 4YDXA 4OI0A 1XWLA 2DGSA 2YQ1A 5H9EK 3LP0B 3NWRA 3ZTOA 3MCSA 3HHLA 3QGGA 3WC0A 2HHHF 3PIOQ 4DUYJ 3WQPA 5C42A 3TEHB 2DPJA 2Y0BB 2W9CB 4GVBB 4OI6A 1D9DA 4FN5A 1RUSA 2QN6B 4DLGA 2JFDA 4DV5F 3P49B 2P6TA 1D9FA 2FVPA 2VG7A 4DR2F 4YB1P 5CZXA 4O4GA 4JV5F 2HNYA 1XNQF 3IC1A 4M5IA 2CA9A 2I9SA 4QIVA 5H1SV 3SDEB 2VOPA 4RU9A 1L5UA 4CO4A 3C6UB 4FS2A 1NZAA 4F50A 3IR5B 3T1YF 2K7KA 3IWLA 3TWZA 4ZP6A 4LUBA 3OL6A 3V6JA 1RT3B 1B99A 2C22A 1NNDA 1OY6A 4DI6A 4YHHF 4FNIA 4M5DB 1RAFB 2Z2ZA 3D6HB 4OJGA 3IAS9 3O3LA 4L3KA 2XMVA 3HM9A 2ZJQQ 2ZHAA 4TY9A 4Y2CA 2RU9A 3GFYA 1TL5A 2AMCB 4PR6A 2BQ3A 1DHMA 2AYEA 3EPGA 2H54B 3TP2A 5J2QA 3AB4B 1S1TB 2ZH5A 3CC4S 5DM6Q 2QGFB 4TN2A 1S9GA 4ZCMA 2DGWA 2L48A 5CAAA 2G2OA 4C8OA 3W7BA 2FJEB 2ZE2A 2CWXA 2WVCA 4X4TA 3CCJS 3H2LA 4HT5A 4KC5A 1R8HA 1QVFR 2HHWA 4K4UA 1IKWB 2A6MA 2G2ZA 3K5PA 2R9LA 1OWXA 2DB1A 4TLRA 5DDOC 2FLLA 3PFOA 2KRBA 1B3TA 4WE1A 3BKTA 1U26A 3UDEA 1CJVA 1H2VZ 1UW9A 1U1QA 4DS4A 3P5BP 2YNGA 2VL1A 4CRJA 3FZ2A 1NMEB 2AYMA 3EICA 5KG0A 1VQ4S 2ZNZA 4ZVOB 1FK9B 2ATCB 1VMBA 2DNNA 2BRLA 2IBOA 4AL5A 3HDSA 2HVDA 2XMTA 2CJBA 5LMUF 4JI0J 2UXCJ 2V9KA 1CJKB 2RB7A 3L7UA 4DFJA 1IKVB 4TYBA 2J6TA 2RT3A 1YJTA 4PXEA 3T5JA 1T05B 3M30A 3FCWA 2LP4A 3T1HF 1M5VC 2YXLA 1VRTA 1JLCA 1A9NB 1HHQA 5T14A 3PM9A 2ROEA 5E3QA 1T7PA 4LFCF 2C2NA 1YBAA 1SC4B 5IOLA 2OEJA 1MW7A 2GV1A 5ETMA 2PIIA 4X4RA 1YJUA 1U1PA 4C3KA 1GTHA 2C3OA 2DNZA 3D7SB 5KFFA 2KJWA 4JB8B 2Z2YB 1VQOS 5KT6A 1UFLA 1HBMA 3KWMA 2MGZA 3QFHA 5KG6A 3W9HA 4GMKA 2DR5A 2FDNA 2R2RA 1KWMA 2EKYA 2CPXA 2NZ4A 4PPZA 5GMKa 2O5DA 1R7IA 2F9JA 1RWMB 4WTOB 3KJVB 3W2WA 3CD6S 4L6V3 2H1YA 2R7QA 1I94F 3CD5A 2QYGA 3RB6A 5D3GA 2Y1LB 3FNNA 3OUYB 3M2UA 1X5TA 2CADA 1KD1T 2IYIA 2ZBPA 1YJNS 4LFAF 2FZKB 5HANA 3E8OA 1NPPA 2IVFB 2YWKA 2XM3A 2LXUA 3K7RA 2VA3A 3KOAA 3R97A 3V6DB 3KLEB 2FJWA 2J0XA 2KFZA 4EUVA 5HBMA 1AXQA 1NXIA 4PUOB 1UAWA 1FT8A 2VJVA 3G6YA 5LSLA 2E7VA 2ZDOA 1TELA 4ECVA 4NZ7A 3PNIA 4LF9F 1HBOB 4XPCA 4QW8A 2R7OA 1VLOA 1JIHA 1QAYA 4U8VA 2MQQA 3DU5A 2GHWA 1VBXA 1UJ4A 5KG1A 2GX8A 2X1AA 3Q23A 2HKEA 3D1QA 5G0RB 2QFJA 2FVCA 2C2OB 4NLYA 1Y3KA 1H72C 3KDOA 2H3EB 1UFKA 4NLOA 3CJKA 4LVNP 1FESA 4J9LA 2HIQA 3DCAA 1LOUA 4L72B 5KFJA 4H54A 2Z56B 2KYXA 1N5SA 1T03B 4ZIVA 3AJ1A 4G1IA 1S0OA 4P2MA 3AH6A 4EYIB 3KJQB 1XQIA 3H5SA 1V3RA 3EMTA 3R6LB 1I3OB 4IO1A 1U6BA 3MAHA 1JNRB 4O44A 3LF0A 1DURA 2QIFA 1N34F 3AOAA 3VAIA 5T7LB 1KTQA 3R1LA 5JXSA 2A2DA 1WC0A 4C4WA 4F4WA 1FVSA 2HSEB 1S9EB 4DR3J 3MTKA 5IS2A 3MM8A 3QPIA 2V50A 3AA8A 1X5PA 1PJ6A 1MN9A 4N5SA 2WOMB 2ZBCA 4J9UE 5KG4A 2LDIA 1HI8A 3S1TA 1FO1A 4F25A 2Q6CA 1YX2A 2CAJA 1BD6A 3I56S 3MI7X 4URSA 3HHEA 3CW2C 1AA1B 3VQSA 3D4JA 2O1PA 3J81j 3CB4A 4LF6F 2HBZB 3IM9A 3QSIA 3V4IA 1U49A 4DV0J 2LFVA 4WYWA 2J0QD 1TK5A 4OYBA 2P9GA 5KG3A 3KFWX 3CD0A 2XI2A 3A8KA 5A2QY 1T11A 4ECWA 2DNPA 1CJUB 5JUMA 4ID5A 3TOQA 2AYBA 1N5YB 5BYRA 1ZTTA 3T3FA 3LALA 2OPSB 2V2KA 4R8UA 1YK9A 1WEYA 2RHQB 3CEDA 1E6VB 2F8HA 1ZTWA 1U48A 2GO8A 3CF5Q 1HWIA 4C8NA 4M63A 2V9WA 3PO5A 2WVDA 4FVCA 4DU8A 4YP3A 1HBUA 1MLAA 1VQ8S 4CLUA 1JLFB 4DCPB 4DUYF 2IJRA 3ULHA 1SPBP 3GILA 4OV1A 2J9EA 3OQ2A 3G9CA 3R7BB 4ETXA 2R7RA 3GCWP 4ZLJA 1V6HA 2QRRA 3Q8YA 3SYZA 3PO4A 3QBCA 3CJ0A 1Q53A 2JRSA 4ZVPB 2XC9A 2CPYA 2MXYA 2QV6A 1HNWJ 3KHHA 2F1FA 3TAPA 4IH7A 3TUZC 2DNYA 3VWSA 5CH7B 4NCBA 3CCRS 4MKYA 5EWFA 4MH8A 2XCPA 1KBRA 3K17A 1LK5A 4HH1A 1EX8A 5F8NA 5L46A 4ZS6A 4DV1J 4F26A 3IMQJ 2NXEA 1SL0A 1KLMA 4CO1A 3M8YA 4KTQA 3M9MB 4J9NA 2LYVA 1S79A 2FJAB 1RLCL 1Y7PA 3P4UB 3Q8UA 1R6VA 3OHAA 4NEYA 3AOCA 5HO4A 3CJTA 2E44A 1T9XA 2V94A 5L8RC 4QW9A 3TX0A 4MAKA 1O5JA 2VPZB 3OL8A 1FA0A 3UE2A 4FBTA 1KHWA 2MZSA 2GQQA 4GC7A 4RBTA 5DLGA 2W9AA 3M8ZA 3H42A 3NG8A 1JLEA 2RILA 4MYUA 2VHGA 1H7XA 1KDNA 2DNGA 4DPUA 5L9NA 5DRKA 4Q45A 5KFKA 2KDOA 6FDRA 1RSCA 4O4RA 5KG7A 3FSIA 3O2IA 2E5JA 3ENQA 1RWPB 4WZQA 3OHBA 7FD1A 3PRBA 2DISA 3M8PB 1TFWA 5HJXA 4NRTA 1RAGB 4FYVB 1AUSL 4DQSA 3FSXA 4J9SA 5HSPA 3DOKB 3IG1A 4ED7A 3HVAA 1O6XA 4ZLPA 1M90T 4BBYA 1GEHA 3HHKA 5I3UA 2HQCA 2XO6A 1NAQA 4DZDA 1UMJA 2IVMA 3H25A 2EC0A 2R7SA 3AFGA 2HQDA 3OL9A 4JI0F 2UXCF 1YRUA 2MKHA 3UCUP 4M5LA 2GVDB 2YNHA 4NLTA 3ZZTA 4C8KA 1YTYA 5HMXA 4WU3A 3DRRB 2V63A 2XWXA 3G6XA 3BSAA 5F8LA 3N01A 2DGQA 4ED2A 4J9KA 3LGHA 3UW1A 4CH7A 1NSQA 1RHQB 4HACB 1GNKA 2X51A 1HARA 3T6BA 1RTJA 2OEKA 3POTB 3SCIE 1V9OA 4NCGB 1X9SA 4QU6A 2ATLA 3K58A 2PE8A 4P52A 4NLQA 1SUQA 2RDIA 2UUCJ 3NOCA 4WJBA 2DY9A 3W62A 2CQHA 4K8RA 1DTQA 3ZC4A 3HX9A 3QNWB 1QSSA 2MDAA 2C2DA 2EPIA 3LUYA 2LDYA 3PFEA 1FKOB 3R6GB 3CJRA 4OZJA 5LSRA 2OH2A 5B0AA 3DOLA 4DQRA 2X3DA 1WSRA 1REGX 2F65A 2XMUA 2KI2A 2CQ1A 3P45B 4NCAA 4NYZA 4UZBA 3AB2B 1HWUA 1QLNA 2QLFB 1Y5LB 1Q82T 1UW4A 3DLGB 2G13A 5DQGA 1VGYA 2E5LF 2VBWA 3DXSX 4YB6A 2L08A 4R5PA 2B6AA 2CQCA 5CYQB 4CLKA 4JI6J 1NHKL 2PA3A 3K2YA 5KT2A 5DO2A 1S6QA 1U6FA 3BF4A 3W9IA 1SIWB 3DLKB 3BJYA 3M9NB 2B4UA 1S0MA 2IBKA 4AT1B 2H51B 1XR6A 8AT1B 1VHIA 2HWIA 2J0WA 3ETOA 4K4VA 2G9OA 2W4CA 1ZAXA 2YKMA 2E7WA 2JSXA 4C6AA 2RKIB 2WVFA 2NLWA 1HMVB 5EWEA 3DOMB 1K1SA 4WP8A 3CSKA 3Q83A 1KFDA 2HIYA 2YX7A 3EXYA 3NY0A 4F67A 2FC9A 3NBPA 1YI2S 2HWHA 2N7CA 3OT9A 2NR0A 2GZOA 4ECTA 3M2VA 2XGPA 3I32A 4AQYF 4NPOA 2XULA 3HHLB 1B7FA 1ICEB 2CPDA 3BDPA 1UKUA 3VGUA 4X4OA 3VGTA 1S10A 3MPUB 4AE5A 3J7Z5 3JAMY 4HH0A 2NXNA 1RWUA 2E9RX 3TO8A 1J5OB 4IYQA 3B4MA 3NNHA 3AOBA 2EFGA 2WVEA 2XY6A 2WHOA 2MKKA 1IN0A 5C2GA 1TK0A 2XS7A 4I67A 2HGLA 1KOHA 3CC2S 1FDNA 4DV2J 3BPSP 2CFXA 3AY0A 2CDRB 1X4BA 1SV5B 1SB6A 4EYHB 2ASLA 4QPXA 2BM0A 2KFNA 5KFAA 5J2MA 1HR0J 1HNXJ 1H7WA 4EU0A 3BSNA 3R5CA 4RO0A 4NL5A 3A12A 2W7PA 2XBPA 2J6SA 1N5QA 4BHQA 3IRXB 2WK4A 2ZHOA 5CYMA 4DR3F 3UCZP 1FERA 1OO0B 2D9PA 4KKOA 3ZXWA 1R3NA 2C28A 2ZH1A 2XHWA 5AJ3J 2F4VJ 5IWAJ 2CPJA 2EW9A 3EDQB 3MCNA 3SQGA 4F7VA 4AYBD 5EHHA 3C3LA 5J2QB 3N9UC 4Z2XA 1MWYA 4USVA 4Z37A 4KGMA 1T94A 2VD3A 1VQ6S 3BBCA 3VVTA 4LFBJ 2IPOB 5B0EA 1S9GB 4DV0F 2ZH4A 4ZVGA 2XZDB 3NXZA 4B02A 2AJQA 4B9SA 3AODA 4KGZB 1NK8A 3AXMA 2ASYA 3DFEA 4P74A 2Z30B 3JYTB 2DNQA 4KBIA 2R7TA 3NS7B 4Z7CA 2DR9A 5HMWA 1QD1A 4RW6A 3ZTPA 2ZBRA 1KQFB 1G6BA 3H5YA 4FNHA 5HP1A 3PYFA 3OD2A 1SC6A 2ERRA 4PG6A 1RT1A 1S99A 3MECB 3UNYA 2HK2A 1OY9A 2F9DA 1WKLA 3D1OA 2VFVA 2E5GA 2W24A 2YNGB 3GLJA 3GV5B 4QWAA 1X5SA 1IKXB 4KJIA 2OPRA 3N0VA 5KFIA 4LF1A 2JFKA 1XR5A 3U1NA 2CG8A 4W98A 3LO3A 2PT0A 4QYZK 1QJHA 4ZP9A 3AD7C 4N47A 1JKHB 1TV6A 5FIIA 3G6VA 3WHIA 1D3WA 2SXLA 2RDJA 3PYGA 3RBZA 5J1NA 2KH9A 4HEA9 3H4BA 1QDUB 2RUSA 4LR8A 3SV3A 3BGFA 4C3LA 5KT7A 1HNWF 3ITHB 3DRXA 4RU2A 2L9NA 2D41A 3AHPA 4ZA1A 2RS8A 3QRPA 2QC3A 1KVIA 1WHYA 1T9UA 3DLBA 3GYNA 1NSAA 4DV1F 3LW5C 3TUPA 5ETOA 3HFKA 6FD1A 2MGZB 2W2QP 2W2OP 3L4BC 1X4AA 4EEYA 1YQHA 5KT3A 2HFSA 4QBUA 2B4VA 2QTWA 3C2PA 3NNAA 3KHGA 3GTYX 2DNHA 2E5IA 5LMNJ 2XLJA 4FZVA 5J1EB 1FRMA 1RP5A 2HLUA 3CO9A 3SIPB 3GG0A 2BM1A 4O3QA 1WACA 3H98A 4B9VA 1B70B 4P10A 3QT8A 1RABB 5HMZA 2QLBB 1Q1KA 4PABA 4BWJA 4QOTA 4CNZA 1F2GA 2IRYA 3TAMB 1O8BA 5F3TA 2MY8A 4UW2A 1XERA 5HVHA 1S9FA 2B9YA 2JOQA 4RJVA 2CQBA 1WHWA 2VZ9A 3CJSA 4IQMA 3KG1A 1SIZA 4ZJLA 3QT5A 2DTJA 1TMMA 2ZZNA 3W5XA 2CXEA 4C2MA 3FEZA 1N36J 1ELOA 5EWGA 2K06A 1B7YB 2JC0A 1RKIA 3HI9A 2GJIA 2XEXA 3IR6B 2AHOB 2RNEA 3N28A 4KHPJ 1K73T 1JJ4A 2F5GA 3CIZA 2C3YA 1Q78A 3F73A 3MXHP 4G1QA 2OPPB 1IR2A 1QSLA 2C2KB 2QSFA 1OIAA 3P3DA 5C7PA 2V4JA 1SVDA 2IFXA 2Z58B 1VI7A 1FRKA 3BBBA 4I2PA 1RTIA 1N0VC 4WK1A 1RWWB 2BQUA 3CJ8A 4AXJA 1HHTP 3A13A 2P8IA 3FGVA 2HNZB 3OFHA 3ZTQA 2E5HA 2ZITA 3RBXA 1IXKA 1SKWA 3PX6A 3QWPA 4HL9A 4OFZA 2QMWA 1TL3A 4X4UA 1S6PB 4B08A 2UVRA 1FJEB 2E7XA 3OTOJ 2OO4A 1RQ0A 2X1FA 2H65B 1Z1ZA 2UUCF 1S1XA 3PACA 2NSBA 3GJRB 4KYZA 1UTAA 3RTVA 4RW4B 2IDEA 3QIDA 4PXBA 3M7VA 2DR6A 2CPZA 4X4SA 2VPYB 3D6FB 1LV5A 2GHPA 4DX8H 2MQ8A 1FDDA 5AE3A 4LIRA 1OYDA 1XC9A 2B4OA 2CQ3A 2V68A 3MF5A 2GS8A 3CMQA 2BE2B 4EK2A 5AXLA 1EKSA 2DGTA 3BGOP 4OZ3A 4CLLA 1FD2A 2AGQA 2BKOA 2NCKL 1LEOA 1WG5A 3LP0A 5FD1A 4PG4A 3SEOA 4GVBA 2OD4A 4JI6F 1NJZA 3TUJC 3EZUA 3Q0AA 1U25A 4NLPA 5CD4A 2OHDA 4BDPA 2XTJP 3C16B 4FKYA 3H90A 4WP9A 1NSPA 4YQWA 2PEHA 3HHLC 4JI8J 2J8SA 4IFVB 1RTHB 1T3NA 1CS4B 2HHXA 3E3XA 3SDEA 1HYSB 5GADI 2I5JB 3C6UA 4LF4J 1U09A 1X4CA 3BSCA 4DUZJ 3BGRB 2B7CB 1N5TA 3UNGC 3MR7A 2PO4A 3G86A 4A48A 1TL7B 1RT3A 3NAHA 2YWEA 3GSIA 3CTRA 3L7PA 3FRYA 4M5DA 3RYLA 4UOGA 2EC2A 4LR9A 2K3IA 3M32A 3GIJA 3KKFA 2GGPB 3A3OB 2DO0A 4WIQA 2Y8YA 1UZHA 3BYPA 2C2RA 3WBZA 4YEAA 1Q7YT 4TNOA 2VPWB 4F2RA 3QQCD 5J2PB 2B0GA 1F5AA 5ITHA 2NUUG 4RNHA 4LBIA 4OI3A 2OLWA 4ZVUB 3J80U 1HNVA 4DX7A 1IJEB 1S1TA 3HSJA 9RUBA 1BWEA 3I9ZA 5CQGA 1RCXB 5B7WA 4DV2F 1VQYA 4NX9A 3BYRA 4Y2KA 2FD2A 2QG9B 2R8IA 2Y3YA 1NHVA 2FY8A 1U8SA 2GMLA 5B09A 1TZ0A 2VG6B 1HR0F 2HS4A 1HNXF 7AT1B 3GP9A 2J9CA 2ZC3A 1C4CA 2FVQA 3JXOA 3CCQS 2QLWA 3BN7A 1IKWA 3MOJB 4URQU 3HFVA 4C0HA 4DN0A 4DR5J 4PPDA 4I0WA 4E0DA 2GA7A 3ZZZA 3NRBA 3ISNC 4KE5A 3HZEA 3IBCB 3DXBA 5AJ3F 5IWAF 2L9DA 2AGPA 1BUXA 1ZM9A 1R31A 2GW8A 5K8PA 2MKIA 4EZ9A 1WUUA 1WOOA 1X7VA 1PG5B 4IFYB 3I96A 3FBEA 4F4XA 1P9YA 5GADU 3PW4A 1Z4UA 4I1TA 1FEHA 1FK9A 4LFBF 4EBCA 1JLEB 3UFCX 2IM1A 2AYGA 3CCSS 2DGUA 2BJ8A 1FRHA 3KJNB 1CJKA 3FDSA 1IKVA 3BN4A 3SCKE 3CMAS 4HI1A 4IDKB 3ONQA 4ZK7M 2PMHA 1NUEA 2B5JB 1IKYB 1DBDA 4AXIA 1YKWA 4C8LA 3V2UC 2VC1A 3VAGA 3PYDA 4R0JA 2RSQA 2JVOA 5KFRA 1LXJA 1AB8A 1TAQA 3H5UA 4XDDA 2LA4A 4ZHRA 2BXJA 2UUAF 2CJKA 2COLA 1YRTA 5DGAA 5FLXY 2OTLS 3DYAA 2DHAA 2QA4S 2VQEJ 5BR8J 2LMIA 2RJZA 1TL1B 4DF8A 1XIQA 2HFZA 3QMQA 4C8MA 3MMAB 3PDNA 3UD5A 5DZ6A 1QM9A 3TJ8A 4FXWA 4F8RA 1C2PA 4YR2A 5F8GA 1YZ6A 1H74A 1HKAA 3PYEA 2YNHB 3PEJA 4OHXA 1G2EA 2A2CA 3VAFA 5DJBA 3WDOA 1RAHB 5I3PA 3H7HB 2AJ1A 4USJC 4ECRA 3KJVA 3UD4P 4DR6F 3G6ES 2HFUA 1Q8IA 5F9NA 1MMLA 1H3DA 4C3MA 3PJ9A 1U45A 3OUYA 1WOPA 3DI6B 2NXCA 1VQ9S 4ZPCA 2J6UA 1U0HA 5F8IA 1RT7B 2HEKA 2V4QA 3HLUA 1OQ6A 3HULA 4WK3A 4OV6A 4TU9A 2YWHA 3MR6A 3CMES 2MKYA 2IYGA 5KFVA 4P7TA 3L9ZA 3X1LB 2YKOA 1FVQA 3QZ7A 4XTTA 3RB4A 3JSMB 4IRKA 4RBUA 3KLEA 1FKPB 2CRLA 4DBQA 1WF0A 4F36A 3HD1A 4IH5A 4PUOA 4OYIA 2EFQA 4L73A 2WSFC 3K8VA 1HD1A 2DRAA 1X4DA 4PG5A 3R7SB 5F8MA 2UXBF 5LMNF 2EKNA 4NA1A 3BKFA 1TL4A 1RI7A 1YBUA 3QAEA 1HBOA 1H6KX 1FNMA 2HS3A 1XK8A 2DXDA 2YY3A 4DV3J 4DL0C 3R7NB 1MG7A 2WW4A 3VAKA 3LOUA 1RBOB 3QIPB 1RU2A 1SH3A 1U2CA 1DZ5A 3P5TL 5G0RA 2ZM6J 1FFGB 2HBQB 5IZHA 2RMLA 2DGXA 1F60B 4IO9Q 1ZBTA 5H9FK 3MDFA 2M0GB 2XS5A 2RRBA 2BOPA 4ZCLA 4NMXA 3R3TA 2ASJA 5DDQC 2FQQB 4ED1A 3F0NA 3BSOA 1N36F 1DAXA 4I68A 3JSBA 2BR0A 4ZN3A 3KNAA 1MWQA 1FI4A 3T1YJ 1S77D 4KHPF 2MEWA 4IOAQ 4I7FB 2ZKTA 1DLOB 5E3AA 5T7LA 2ZFHA 2FLNA 1W7WA 1S9EA 2RF2A 3GR0A 1LWEA 2MSSA 4RNNA 4ES1A 4DV4J 2NQPA 2V69A 1KHVA 2AIRB 2BOAA 1OYEA 2WOMA 3OR1B 1HI1A 2UVVA 4OLPA 2J7UA 3I31A 3M6WA 3V6HA 2HWTA 1HQEB 3K5MA 1ACMB 3ZZOA 4A46A 4IR9A 1PYSB 2QA4G 4F0HA 2BE7D 1T9TA 3TVZA 2QEXS 5EUHA 3KK2B 2NPIA 2QZ8A 4QU7A 3OTOF 3O8WA 2B9EA 3OBIA 3EPIA 3BKUA 3MOZA 1NDKA 3DGPB 4LQ9A 4F4AA 2AJ0A 3HSZA 2HHQA 4J9RA 1U1RA 5IQQA 4JI3J 2OFHX 4ZVEA 2DXFA 4IG3B 1CJUA 1U02A 2C2MB 4XK8C 1N5YA 2I8EA 1NK9A 4UY85 3PXGa 1JX4A 1IJFB 4BS2A 2OPSA 1M5OC 2D3UA 1R8CA 5DGBA 1XMOJ 1O0PA 3R5GA 3J81U 4FF4A 3BM7A 2ADCA 1SL2A 1E6VA 2BKNA 2ZH6A 1EKRA 3CCWA 3TX8A 5L39A 4PXCA 3PZPA 5EGYA 4DJBA 2ZVSA 3MEGB 3E2EA 4USTA 3MTJA 5E33A 1DJ0A 5M2PA 5LMUJ 1WSVA 5DG9A 1HWJA 1FE0A 1URNA 3C14B 3JSRA 1K44A 2B3TB 2C3UA 4PQUB 3KG4A 4ZDNA 5KFYA 2HRYA 2OP5A 4FPIA 4JI8F 4RW6B 1FE4A 3UDLA 1L3VA 4K4TA 4TU8A 2JH3A 5KFOA 2OMOA 5HP1B 2P5VA 1OQ3A 3UCGA 2R8KA 3TA2A 3H20A 4DUTA 5EN1A 4LF4F 5C25A 1RT1B 3GCXP 5A6PA 4DUZF 2UU9J 4CZCA 4FYXB 4A8KA 2VBXA 3MAAB 1TUWA 4PAAA 5AT1B 2OPRB 1I6JA 3ZZPA 5CA5A 3D6MB 1PJ5A 1UFWA 2E9TA 2PI5A 2CPEA 3OTDA 4P73A 4YOEA 3M2RB 5DM7Q 1BMQB 4JV1A 2FHOB 5IV3A 1GMWD 2VONA 2C2ZB 1AROP 1NK7A 2FZGB 4KRWA 1WD6A 3WX8A 2H5IB 1ROFA 5BJRA 3NL0A 1IQTA 4DQPA 1BXNA 4PG8A 2UZAA 2JJ4D 4CLFA 1HPZB 2ZD1B 5ETQA 4DSEA 4Y6IA 3MPDA 1CSJA 2CNOB 3S6EA 4A8YA 1G1XA 2H4YB 4RKUC 1HA1A 3QGIA 3E01B 2YWWA 2QA1A 1NB7A 4HHJA 1RWVB 3LPYA 3HFZB 4WFBQ 3MPVA 1FWPA 3SSQA 3V81A 4DR5F 3NEKA 3M8PA 3FEYB 4DL4A 1X9WA 3OL7A 2HAFA 1TVRA 5HI7A 4IOCQ 2DD8S 2HHPA 3DOKA 1KQGB 3PEHA 2KTQA 3T5KA 1NZ8A 3W3SA 4FKXA 2OFGX 5LXRA 1X0FA 2Q66A 4MT1A 3VGSA 1KP6A 3H8YA 2RIJA 2WBMA 3NCPA 4LBHA 3JQJA 4PXDA 2GVDA 3IRWP 3KTQA 1U0SA 1HQ2A 5HAOA 3OXGA 2BV3A 5D0GA 4O3NA 3DRRA 3ELHA 3HHDA 2J7KA 4LVOP 2CQGA 3DKDA 1VYAA 4GO5X 4QWBA 4NYOA 2BJ9A 2CPFA 4XO0A 2NXUA 4TXSA 4HACA 1Y5NB 2CJQA 3N5FA 5AXMA 4LRCA 3POTA 3HMJG 4NCGA 1HWLA 5K8OA 2DO4A 1RAOA 4DR4J 3CCZA 2XG8A 1Y3JA 3QGPA 1FNXH 1HL6A 3I4PA 4A8OA 2ZBQA 4CP5A 2JX2A 3MUMP 2YQ3A 2VQEF 5BR8F 3CGIA 2F3JA 5FDLB 4OI1A 3K8WA 4K4WA 3VCDA 3N5BA 2ADBA 1S1WB 2CYYA 3BGUA 4FF2A 4WFNQ 3GPAA 1FXRA 2HPUA 1J5EJ 5KFBA 1VFJA 4ILRA 4ZLLA 3D5MA 2EXUA 3PTWA 4AL6A 4JBCA 3D6TB 4MIBA 5HJYA 4OIXA 3FQLA 2CPIA 3SFUA 3TI0A 3VZIA 4M5JA 2N3LA 2BJ7A 2LEBA 1L3UA 4DMZA 3CJ5A 2VIHA 3VR1A 4W92B 1RWKB 2R2UA 5KFEA 4KSEB 5ADZA 1FJ7A 4F4YA 4KR0B 2CQPA 1OY8A 5IC6B 3IS9B 4Q43A 1IM6A 1VQSA 3DLKA 3CO0P 4P7VA 3O1LA 2D3O1 4I6YA 3BBFA 3TW0A 1K0TA 3KLIB 2VV5A 3DGVA 1MU2B 3KJFB 2BMBA 4ZITA 1JJCB 4AD6A 3DOMA 5HVFA 3O6QA 2VFTA 2OPQA 3CDUA 2QMXA 1PILA 4CT8A 1EQ0A 1SJFA 2MZJA 2VF3A 2EK6A 3HSGA 1JXLA 3M8SA 5THWA 4IUFA 1FCAA 4F04B 4DV3F 3FMBA 3PW2A 3BPDA 3ILLA 3IP0A 3MHYA 3WIVA 4DV6J 4ICLA 3D3BJ 1OJ4A 2DNOA 4EO6A 3GB0A 3QT7A 2ZM6F 3HJFA 1GX6A 4EWTA 3UN5A 2PN6A 1OMSA 4USHA 1J5OA 4FBUA 4OZ2A 1TAUA 1LFPA 1Y4ZB 5A8RB 3MMJA 3TANA 1D1UA 1BE4A 2JWNA 2WW8A 2O3DA 4WU2A 2XMKA 1WTBA 3BV8A 4PWDA 1RCOB 4P9SA 4ER8A 1SV5A 3LTOA 1Q81T 4JV0A 3OLAA 3DRPB 2BVZA 2MJUA 3GR1A 2UP1A 1NSKL 3CJ2A 3NGKA 1TQLA 3DHXA 3IRXA 1T3OA 2D74B 4OX6A 4XIUA 2JEJA 4OMFG 4U9RA 3M32B 4DV4F 4ES2A 3IO1A 4ERDA 4LF2A 2H48B 2DCUB 3CJ3A 2GQCA 2HHSA 3ADAC 5I4MA 4OI2A 4I6WA 2G4BA 1BQXA 3EX7B 5RUBA 1LWCA 1K8AT 8RUCA 1RKJA 3T9ZA 2RRAA 1QE1B 3FK4A 4NA3A 1HNVB 4LSNA 1FRIA 4C0OC 4L74A 2H5EA 3GFXA 5D6GA 5B0FA 3M8QB 1X4EA 3EVMA 2LLZA 2YNFB 2JHEA 3W65A 1WC3A 1YJ9S 4JI3F 3R5AA 3JYTA 3DDNA 1LXNA 1S6OA 5KG2A 3GJQB 1QUPA 3M1VA 1GT8A 5I42A 2MTLA 2JLFA 1RWOB 1RXOB 4ECYA 4Q8EA 1RHMB 2FHJD 4NASA 4RWXA 2X1BA 4M5HA 4HHHA 5F41A 3ENVA 1ZM3A 2E1MC 4KQZA 1XMOF 3PKYA 2R4FA 4HKQA 3MECA 4D3HA 1UETA 2POKA 1WF2A 5CD4H 4C48A 2BZ2A 2IMOA 5HMYA 1UVIA 1IKXA 2EFOA 2EK1A 3P8BB 2MHEA 1BLUA 2YKAA 1NH8A 4FS1A 5DG7A 1X8DA 1Y9OA 2E66A 1QVGR 2HHVA 5KFZA 2QSWA 4C97A 3N6LA 1JKHA 4DSKA 1Y0HA 5EDWA 2QLJB 1N33J 2QE5A 3SSRA 2V8DA 5D0RA 2DEIA 3HD2A 1CULB 2K8GA 1AFIA 2ZEJA 2LCWA 3GG1A 1V3ZA 1NK6A 1JLQB 3NS6A 1S7HA 3ITHA 2OGUA 4CQ1A 1WEZA 4QR1A 1S57A 4B3SJ 2M2BA 3D9BA 2UU9F 1JQGA 4ZHRB 2AW0A 3AD9C 3QRRA 3CDAA 2M5YA 3DYAB 4B3OB 1NB2A 1N6QB 4K4YA 3OFEA 4CO3A 3FZBA 1UEUA 2ILYA 3BQ2A 4DWIA 2ZKUA 3A8JA 1U2RA 4N8OA 3CUNA 3HT0A 2APOA 5E41A 2FLOA 1PKUA 4N7TA 4U8YA 1FRXA 5KFXA 2KYZA 1CG2A 5J1EA 3CCES 3I82A 3LH2S 4PQAA 4CO5A 2U1AA 3QLHA 2PA8D 4HYKA 2IIHA 2E5LJ 2K7JA 1UWBB 2BX6A 4USKA 3I5BA 5HLFA 1QAIA 1SKUB 1KQKA 2MLYA 5L1IA 4RR5A 3PG9A 1FWLA 2GC8A 3TAMA 1U0HB 4M5MA 4ITSA 1CJTB 2YNIB 4ZVQB 1UZDA 1KR4A 4W4MA 2IY5B 3THVA 2C3MA 1WHXA 2AQ4A 4QIFA 2AZ1A 5C5JA 4RUBA 4UQTA 2LQJA 1K47A 1W26A 4NOHA 2VDIA 2ILZA 1V5VA 4UTGA 3GJSB 3OFGA 4J91A 1M1HA 2B4PA 2KZZA 4RUCA 3JTPA 1VBKA 3TJAA 4LF5J 3GMGA 2OPPA 3Q22A 3CULA 1GMVA 3EYZA 1PAEX 4OYXA 3HF5A 4I6AA 4ECUA 4AQYJ 1IBKJ 2R8JA 4ELUA 2KVQE 1DTTB 5A8WB 2IRUA 2HW3A 3SXLA 3TZZA 2CJYB 4WXOA 3BQ1A 1LWXA 3N6NA 2FZCB 1NJYA 1H0HB 2ZWPA 4BC7A 2HNZA 1FFWB 4KGXB 4U95A 4C0BA 2CDQA 2MLXA 4X62J 2OELA 1AYEA 5IQ6A 3IM8A 2KXHA 4R25A 4QPTA 3R2CJ 1FXLA 4NLSA 4K2JA 1IVZA 1Q86T 3NOGA 1S6PA 2RHSB 3T41A 4KFBA 1S59A 4ECSA 1ZYQA 5LL6d 4DR4F 4M94A 3D54A 2PFDA 1U1NA 1UVKA 5KOXA 1REVB 3BH7B 1FRLA 4RW4A 2J0SD 4YB7A 4DPXA 5JVGQ 4RW8B 2VBYA 2RF2B 4X65F 1LWEB 2XCAA 3CCVS 1W2IA 1YSJA 3EE3A 4O3RA 1F1BB 1LQ9A 1UJ5A 4C8YA 4TY8A 1J5EF 4M8LA 3PHEA 4ZVTB 3CDEA 4ECZA 3RUBL 1Y10A 5LXYA 4GC6A 2IMWP 1TKTB 4KH1B 2BE2A 1VR6A 3OR2B 3ILJA 2WB1D 3RRHA 2M7SA 4WTYA 3OJUA 3L7OA 2XZWA 2HYIB 4MKAA 3PVXA 1WTFA 2CJXB 4G3IA 2LEAA 3R1HA 4NLVA 4DFPA 2LQ8A 3VF0B 1YBTA 2LQ9A 3T5HA 3DRSA 2GJFA 1OSCA 2DH8A 3RZAA 3EM1A 4RUHA 2QFIA 2XMJA 4QIGA 4KHMA 2EBGA 4NI2B 3C16A 3J7ZT 3S7RA 4IH6A 3T6JA 4IFVA 2QJ3A 1RTHA 5KFTA 1CS4A 3MCOA 1RAJA 1ULRA 1BQMB 1HYSA 1BQNB 2I5JA 1B0VA 2ABYA 2DXEA 4NLWA 1GMUA 3BGRA 4CH1A 1FTRA 1BWVA 4GKKJ 2BJDA 3BO4A 1TL7A 2LEPA 3D67A 4H4MB 2O66A 4F0MA 1FJCA 1R0AB 3SFGA 3HCXA 4OYOA 2UXDJ 5ETVA 4DV6F 1FEEA 2ZBIA 2GGPA 2E1AA 2GNKA 3ICLA 3NCRA 1R0BG 3HHLD 5ETLA 2FYXA 1I5OB 3EXCX 2P2CB 4OX8A 4F4KA 5J2PA 1H73A 4O3SA 1SC1B 4LR7A 5FLXU 2MQPA 1M1GA 2CJAA 2XHCA 4EO8A 1S12A 4IG0B 4CNYA 1Q7LB 3Q8SB 4TLQA 4F2SA 1FHTA 4KHRA 5C25B 3BQ0A 3RGIA 2FC8A 1OS5A 2FGOA 1ZM2A 3QJJA 1U8WA 1VISA 2AF6A 2G2YA 2VG6A 1BHNA 4QR2A 5KFSA 3JQMA 1NKBA 2PD1A 1G4CA 4WWSA 4WFXA 1FFSB 4FYDA 3TR5A 5HQMA 2BBEA 1DQ9A 1WOSA 1RAEB 2XMAA 5IT9U 1GTEA 2ZZTA 3F44A 4M95A 3E51A 3MPWA 5GVQA 1TKXB 4FYWB 3PW0A 4IFYA 3C66A 2CPHA 4QJVA 1Q16B 4QIEA 4LF7J 3DC2A 2DRDA 2MKCA 3WX4A 4AFFA 2UV8A 2V2ZA 2DNRA 5AE1A 3D28A 3QT6A 4EBDA 1UEKA 1AT1B 1FWKA 2HBRB 3HVRA 1RLDA 4DG1A 1NDCA 4IDKA 4TQRA 2MLZA 2OIHA 3RBEA 2R2TA 3V81B 5HROA 4ECQA 3UR0A 2Y1IA 4ZPWR 2B5JA 2R8HA 2YQ0A 1HBNB 1IKYA 1TVRB 4MJKA 3H2UB 3EZ5A 1HW9A 3MPYA 4E2FB 3VZHA 4C98A 4DL5A 3C8YA 1TL1A 3US5A 4USWA 5B0BA 3HVTB 3W60A 3MMAA 4KY3A 5GMDA 1EARA 4KV8B 3D1HA 4N77A 5B0DA 1RU1A 3KLFB 4KGVB 1N33F 1MROB 4HTIA 2V0NA 1PC4A 3UQSA 2B56A 2A0FB 3MUTP 5KFQA 1ZOTA 1SJ4P 4DQIA 5L1LA 3T9NA 1M5SA 5E3PA 4M5GA 1O51A 4P75A 1BC6A 2BJ1A 3BR9A 2RS2A 2F40A 1RA7A 1GFWB 3LP2A 1AZSB 2FUG9 3CNQP 3DI6A 4USIA 2MKSA 2YWFA 3K59A 4B3SF 1Q8KA 1RT7A 3MM5B 1A0OB 5ETNA 2RQ4A 2C42A 2CVEA 3UO0A 4NXMJ 4UF4A 4RWWA 2F8MA 3KUHA 2R7XA 2YTCA 5DQHA 1F9EB 3JSMA 4ID8A 1FKPA 2E1RA 4V19X 4NZ0A 4LJMA 1GX5A 5K8MA 3P96A 2VASA 3K89A 5ETRA 4IRDA 3KLGB 5F9LA 2JLGA 2M4MA 2B8QA 2OSQA 4ZJOA 4RX6A 1LWFB 3FSYA 2XWYA 3TUIC 3DMJB 3THPA 1RISA 4OJ1A 1VK3A 3BO3A 2NUHA 2A10A 3R8YA 2B51A 2MQNA 5IM0A 4M5NA 1YRXA 1WDTA 2LVWA 4R0EA 3VALA 3QIPA 3MEDB 1HIYA 2HG4A 5GAGI 1WNEA 2Q43A 3I5CA 1YITS 4U96A 1RK8A 1N4LA 4ED3A 3LAMA 2GCFA 4JI2J 4MTPA 3KLHA 1RYSA 1S76D 3KUEA 2RDDA 3KMQA 4G65A 1FF2A 1RHUB 5A0YB 1R43A 1FJGJ 4LREA 1WEXA 2EFNA 1RZMA 2W4PA 3W8PA 3VAMA 3OVSA 4I2QB 2KB2A 4DSJA 4I7FA 2OPQB 5KT4A 2IA6A 1DLOA 4H4OB 5DG8A 2A6OA 4LF5F 4QWEA 1RHKB 2LQ5A 4MFBB 2AX0A 1EP4B 4X64J 3WIUA 2ZOMA 4ANDA 3GIRA 4UOHA 3RB3A 1FX2A 2HFVA 1IBKF 4IQXA 1CC8A 2AJ4A 2XGQA 2VJUA 4ICLB 4ZPBA 2D1CA 3KUGA 1R8PA 2YX1A 5E3CA 1QTNB 3OR1A 4DF4A 4UUXA 2OUGA 2B8PA 4I4BA 3KK3B 5H9EJ 3J7A1 2NYIA 2R3VA 1GXUA 1TMJA 3EGWB 3ENAA 2I6WA 1URRA 4X62F 4LBPA 1HQEA 5JVHQ 4ED8A 5E7OB 4YB5A 3KK2A 4KH0B 4PWDB 4JUZA 2XB2D 3DLJA 1FTCA 1QSYA 1B4SA 4WFYA 3DGPA 3D0GE 4UT4A 2DK2A 1SKSA 1TKDA 2XNRA 1X4GA 1IWGA 4E98A 2HAIA 4IG3A 3KK1B 5DDRC 4ED0A 2R7VA 2MSTA 2MZRA 3MM7A 4A8MP 1N8RT 5GAGU 3OLBA 5D8HB 1HQUB 1M5PC 4USMA 2M8DB 3ZNUA 3NS5A 3IR7B 2WZ1A 1PGZA 3D66A 4FVMA 1S0VA 3A4TA 1LWCB 4OZ1A 5CXTA 2ALZA 4X2BA 2XI3A 4QZVB 5FJ4A 2MQLA 3MEGA 4LSNB 4HLBA 1P6TA 2GHVC 1I1GA 2DITA 3HSDA 2V34A 5B0CA 5D78A 4ZPVR 2KXFA 3K5OA 5D0EA 2Q79A 1DARA 4K4SA 2OD6A 3OPKA 4DDFA 1J27A 3C14A 4LSZB 1KS2A 1UWAA 4P72A 4ZN1A 4PQUA 3M1VB 5I42B 3EJMA 2HGMA 5M2RA 3JQKA 3NGSA 1VIOA 2ZVIA 4ANEA 1RT6B 2RU3A 2KVIA 2ROPA 4GKKF 3A1YG 2UUAJ 1YJ7A 3MAAA 4O3PA 3FJ2A 1KQSR 1WKJA 4EI2A 2VDHA 1B64A 4OYMA 1WWHA 4FXDA 2UXDF 2GFFA 3OTCA 3M2RA 1PIEA 4K2XA 3RAMA 2ACYA 4NXNJ 3MFHA 2YVSA 3N6MA 3Q8VA 3PW7A 3V6KA 4DV7J 4ELTA 4K0KJ 3MD3A 2R8GA 3OXFA 2KKHA 4HR2A 3NKYA 2HMIA 2BUNA 4A8QA 3SI8A 1NPKA 4YMEA 2AP6A 3FFIB 4B3TJ 3JTNA 3NGUA 2NSCA 1TR0A 4DR6J 3TA1A 3C15B 3BZQA 4JYAJ 5SUHA 2NREA 4HVZA 2CIMA 2HQIA 1HPZA 2ZD1A 2BANA 1NLKL 4DHVA 2FGCA 2W9BA 3UD3P 4OQJA 4F4ZA 3QAUA 3HXMA 2VUGA 2HZVA 1WC4A 2CWKA 3FRZA 2QO3A 4Q0BB 2W8KA 2VBZA 3J80Y 3EVWA 4A4JA 3SQOP 4DSLA 3E01A 3MM6B 4UZCA 2VG5B 4C8ZA 7FDRA 4X66J 4W90B 1NK5A 2IAJB 1XMBA 3B4DA 3GIKA 1KN6A 1XEZA 4C11B 2BE9B 3IBFB 3S01A 4FYYB 4PZVA 2HFOA 2HRUA 3GFZA 1KKHA 2UXBJ 2IA0A 3MFIA 4NYPA 4ZVFA 1YVFA 5EX0A 2CQ0A 1VQLS 3QLHB 3LP1B 5J2NB 5K20B 2KM8B 4JI1J 1IBMJ 4QQBA 4XDCA
chains in the Genus database with same CATH topology
4NLDA 1UVJA 5HLFB 4LF7F 2XWXA 4PXDA 3G6XA 3BSAA 3LP1A 1L3SA 4TYAA 5J2NA 1D8ZA 5F8LA 3N01A 3TRGA 3IRWP 2DGQA 1RTJB 3KLVA 1VQPS 4ED2A 2YH1A 3KTQA 4J9KA 2HNDA 4I64A 2VODA 3OXGA 2BV3A 3UW1A 1X4FA 4O3NA 4CH7A 4ZP8A 3DRRA 5IT9Y 3HHDA 2J7KA 3N79A 4OJ3A 2BACA 1XN9A 1SUQB 4LVOP 1GNKA 2X51A 1HARA 3I55S 3JB9k 2CQGA 3T6BA 4RW9A 3TAQA 1M5HA 1RTJA 2YKNB 3DNCA 3POTB 3SCIE 1V9OA 4NCGB 1X9SA 4QU6A 2BQRA 2ATLA 4GO5X 4QWBA 3ZFVA 2PE8A 2J5AA 1DTQB 3K58A 1ZETA 4NYOA 5E3RA 4NLQA 2CPFA 4XO0A 2NXUA 4TXSA 3NNCA 1SUQA 5K14B 1Y5NB 2CJQA 2LQBA 3N5FA 3I5AA 2RDIA 4WJBA 1CC7A 2YKNA 2UV8G 5AXMA 3POTA 1Q79A 3HMJG 2B7BB 2CQHA 4NCGA 1HWLA 4B9UA 5GAEI 5K8OA 1DTQA 2DO4A 3RRGA 3ZC4A 2VFUA 3ZZ0A 3CCZA 2Z8QA 3V6DA 1KNZA 4EZ6A 5K14A 4CTAB 2XG8A 3HX9A 5IT0A 5K5MA 1WF1A 1Y3JA 1QUVA 1VIXA 4NA2A 3QGPA 3PX4A 1QSSA 1FNXH 1HL6A 3C6TB 2MDAA 2C2DA 2EPIA 3I4PA 1D8YA 3LUYA 4A8OA 4CTAA 2AU0A 1UA1A 3DOLB 3MEEA 3MUMP 2JX2A 4B3MF 1B0TA 3PR4A 2YQ3A 2VQEF 4B9NA 4DOZA 5BR8F 3CGIA 2VFRA 5LJ3Y 2F3JA 3GIIA 2G1DA 2IC3B 5FDLB 3K8WA 4OI1A 2LDYA 2B43A 3PFEA 4F3OA 4EBEA 3C6TA 4K4WA 1FKOB 2XO7A 4OZJA 3VCDA 3N5BA 5LSRA 2OH2A 5B0AA 3DOLA 2ADBA 1S1WB 4DQRA 2PI4A 4YDDB 1IUJA 1HHSA 2XMUA 2CYYA 2CQ1A 2KI2A 3BGUA 4NYZA 5FDLA 1FXRA 5F8HA 4WFNQ 4NCAA 1RT2B 2B9WA 2HPUA 4DS5A 5KFBA 2WB4A 1VFJA 4ILRA 4URGA 3AB2B 2NS1B 1HWUA 3PIPQ 3D5MA 1KOOA 4MMOA 1QLNA 3ZZRA 3PV8A 1S1WA 1U1OA 2WRMA 1X4HA 1N0UA 4V19J 4AL6A 3SZ2A 3GFHA 4JBCA 4R5PB 3HT3A 2B6AB 3H59A 1Y5LB 1ZH5A 2Y1RI 1Q82T 3WC2A 1UW4A 3DLGB 2G13A 1SJ1A 5DQGA 5C24B 1H2TZ 4MIBA 1ZM4A 1VGYA 2UUWA 2X3GA 2P9CA 1S0NA 2E5LF 2VBWA 3NCQA 2DGVA 3DXSX 2A1BA 4YB6A 4OIXA 5KG5A 2L08A 3FQLA 2CPIA 2D9OA 4DSIA 1S6QB 4R5PA 2B6AA 2HVIA 2MPUA 2DCLA 2CQCA 2FIUA 3SFUA 4OZ5A 5CYQB 1C0UB 5C24A 3O5TB 3TI0A 2MQMA 4HTJA 3VZIA 2DRBA 2FVSA 2N3LA 4LSLB 2K1RB 2PA3A 5IT4A 3O44A 3IN5A 3K2YA 5KT2A 2WBRA 2LEBA 1L3UA 1L3KA 1S6QA 5DO2A 4DMZA 3CJ5A 1Y00A 3MR3A 3NP5A 3I0RB 2UUTA 1U6FA 4Q2MA 3VR1A 4W92B 1APSA 3BS9A 5KFEA 2R2SA 3BF4A 4KSEB 2R2UA 5ADZA 1SIWB 3EGNA 1FJ7A 2YKMB 2DNMA 5GAHI 2GQ2A 1T03A 3DLKB 1N48A 4LSLA 2K1RA 3DU6A 4KFBB 3M9NB 3BJYA 4F4YA 2B4UA 4KR0B 2CQPA 1S0MA 2GIQA 2IBKA 3M6XA 1HNIA 2V8GA 2RUGA 1XR6A 3I0RA 3LWLA 2HZCA 3G8SA 2HWIA 2J0WA 3IS9B 4Q43A 3ETOA 5J1PA 2DNKA 4K4VA 2G9OA 2W4CA 1ZAXA 2HS0A 2YKMA 5H9FJ 5I3QA 2E7WA 1JWWA 3PW5A 3GQCA 2JSXA 1VQSA 3DLKA 3M4XA 5CYJA 4E8UA 4P7VA 2RKIB 3O1LA 3SMZA 4P6QA 2NLWA 1HMVB 5EWEA 3NBPB 4I6YA 1UP1A 2IM3A 3IS9A 5M2UA 3IGNA 3RW7A 3TW0A 2DHXA 1K0TA 3KHRA 3WZ0A 4NXMF 1K1SA 3KLIB 2VV5A 3CSKA 4ZPAA 1KFDA 2YX7A 3EXYA 1MU2B 2WSCC 4NWBA 3W2VB 4F67A 2FC9A 3DLEB 5DLFA 3NBPA 3DM2B 3NMRA 3M2VB 4DPOA 1YI2S 3DOMA 3KLIA 4PG7A 2HWHA 1W2BR 1QAJA 1IM4A 2N7CA 1MU2A 1SJRA 3D0HE 5B08A 3O6QA 4C7QA 2VFTA 1S72S 1Q8LA 1NKCA 2OSRA 4OI4A 2OPQA 2NR0A 2O01C 3D0IE 3CDUA 4ZPDA 4ZCIA 4ECTA 2QMXA 3DM2A 4TY8B 3M2VA 3H2VE 4FF3A 1HD0A 1PILA 2XGPA 1X5OA 3I32A 4NLRA 4CT8A 2FJDB 4AQYF 1SJFA 3ISZA 4NPOA 2MZJA 2EK6A 2M3DA 2VPXB 2XULA 3HHLB 1B7FA 3VTIA 1JXLA 3PR5B 2CPDA 4OZLA 4ECXA 3BDPA 3M8SA 1UKUA 5THWA 4IUFA 2XMWA 1AFJA 4X4OA 1OPIA 1FCAA 2EVZA 4OHZA 2V4RA 4DV3F 1S10A 3FMBA 2YX4A 4AE5A 2ZZMA 5D77A 3VAHA 3PW2A 5GAEU 3J7Z5 2QYCA 3JAMY 4HH0A 1LW0B 3MHYA 1RWUA 2E9RX 2J7WA 2KU7A 3MEKA 4ICLA 5KFLA 3MZIA 3TNVA 3TO8A 1J5OB 2DNOA 4IYQA 4EO6A 3B4MA 2A3JA 3GB0A 3HJFA 2ZM6F 3NNHA 1GX6A 4EWTA 1B0PA 1G3OA 1ZAWA 2EG1A 3I6PA 2JZ5A 1LW0A 3MMCA 2PN6A 2EFPA 2ZOFA 2EFGA 2DNLA 3FQKA 4USHA 4PRFA 1J5OA 4FBUA 3M05A 4Q44A 2XY6A 1TAUA 5KOWA 2WHOA 2XSJB 2MKKA 2JDJA 1IN0A 3DRSB 1TK0A 3QGHA 4O23A 2DT9A 4J37A 2XS7A 2VOOA 4I67A 2D7SA 1LFPA 1XTZA 1Y4ZB 2HGNA 1FNOA 2LU2A 2HGLA 5A8RB 1KOHA 3OW2R 3BDEA 3CC2S 3MMJA 1FDNA 5J2MB 3TANA 1D1UA 2CFXA 2XSJA 2JWNA 5AXNA 2OTJS 3AY0A 3RAXA 2WW8A 1X4BA 2MB0B 2O3DA 5K8NA 1SV5B 1RT4B 1SB6A 3ZZYA 5U47A 4WU2A 4JI2F 2FHJA 2XMKA 5D4NA 1N88A 1WTBA 4EYHB 2ASLA 3R5BA 1EETB 1R89A 2BM0A 4QPXA 5KFAA 2KFNA 5A8RA 4PWDA 3CPWR 5J2MA 2KRRA 5CYMB 1NHUA 3OV7A 3MR2A 1H7WA 4EU0A 2UVWA 4LMZA 2VQFF 1SV5A 3BSNA 1RT4A 3R5CA 1SBRA 4KKOB 3PJWA 4NL5A 2N7YA 1EETA 1RTDB 1Q81T 4JV0A 3OLAA 2W7PA 1TFYA 1FJGF 3DRPB 2XBPA 2J6SA 4AL7A 3OXLA 3UPFA 1N5QA 5D4PA 4WFZA 3IRXB 4BHQA 5A8KB 2RQCA 1QTMA 2WK4A 2ZHOA 3LAKA 5CYMA 2BVZA 5L38A 4DR3F 3UCZP 2MJUA 1FERA 1JLAB 4X4VA 1OO0B 2XY5A 2D9PA 4KKOA 5F3ZA 1M1KT 3GR1A 2UP1A 1RT5B 3D2WA 3K57A 3IWNC 1HFEL 1BGXT 1R8BA 1WG4A 3CJ2A 3DRPA 1TQLA 3NGKA 1R3NA 5K9FA 3DHXA 1KFSA 1L3TA 3IRXA 2C28A 1T3OA 2D74B 3OVBA 1NU4A 4OX7A 2ZH1A 4OX6A 4XIUA 2XHWA 1W25A 2JEJA 1JLAA 1F5BA 4OMFG 4U9RA 3CXCR 2NPFA 4X64F 4K50A 4GO7X 1RT5A 3M32B 3SQGB 4OZ0A 5GAHU 2VKRA 1GXTA 3CE8A 5E0OA 2YWGA 4ES2A 4WYLA 4DV4F 2CPJA 2EW9A 4DFMA 2AD9A 2Q6BA 3IO1A 4ERDA 2ASDA 2DCUB 3G71S 2RQMA 2FVRA 2EI5A 3CJ3A 4KPYA 2GQCA 2HHSA 1C0TB 1SXLA 3RB0A 3SQGA 1JLFA 3LWMA 3Q8QB 2RD5C 4AYBD 5I4MA 4OI2A 5EHHA 2M8HA 4I6WA 2G4BA 1T95A 1BQXA 5LJ5Y 1VC6A 1NJXA 3U27A 3C3LA 3EX7B 5J2QB 3N9UC 4G6VB 1LWCA 4Z2XA 1K8AT 1MWYA 4JV2A 4Z37A 1C0TA 1RKJA 1D0EA 3T9ZA 4KGMA 1T94A 4U7UK 4UY8T 2BYCA 1FRJA 1U4BA 5CZVA 2VD3A 3U1MA 2M70A 3AQOA 1VQ6S 5B0EA 1S9GB 1QE1B 4NA3A 4DV0F 2RRAA 1HNVB 4ZVGA 2ZH4A 2GO9A 1IBLF 4B02A 4LSNA 1FRIA 1RYRA 2AJQA 4B9SA 1MWZA 4JI7F 1JMTA 1NK0A 1NK8A 2KG1A 3TVYA 2ASYA 3DFEA 4C0OC 1JK9B 4AUKA 2JEIA 4BWMA 1QE1A 2H5EA 3GFXA 3JSYA 5D6GA 2C2EA 2K3KA 2CQDA 5B0FA 2Q3PA 3UWTA 2I0XA 2P6SA 3PX0A 3JYTB 2DNQA 3RU0A 4KO0B 4KBIA 2R7TA 4I69A 3M8QB 1X4EA 1YHQS 4EFAC 2LLZA 1VRUB 2WONB 2YNFB 3PJXA 2JHEA 2DR9A 2KT5A 1FDBA 4P2SA 5HMWA 2XMMA 1YJ9S 4JI3F 3R5AA 4RW6A 3JYTA 3DDNA 2FJXA 2V8VA 1LXNA 1S6OA 4KO0A 5KG2A 4EGLA 3M8QA 1KQFB 1G6BA 3H5YA 4FNHA 1QUPA 5HP1A 3M1VA 1VRUA 1GT8A 2WONA 2YNFA 4CH0S 5I42A 2JLFA 5KFUA 1SC6A 4G1PA 2DH9A 4DN9A 4PG6A 1C1BA 1CQMA 1N52B 1RT1A 5A6WA 4ECYA 2ERRA 1D9AA 4Q8EA 1KONA 1S99A 3MECB 2FHJD 3H5XA 2FTRA 1JJHA 2M9KA 3DDKA 2ZHBA 4RWXA 2X1BA 5F41A 2F9DA 2DGOA 3ENVA 1ZM3A 2E1MC 3D1OA 5EX3A 4KQZA 4N41A 2VFVA 1XMOF 2E5GA 2MY7A 2W24A 2YNGB 3PKYA 3GV5B 4CCHA 2R4FA 3U7JA 4QWAA 4HKQA 2OAUA 1X5SA 1F9FA 3MECA 1IKXB 4D3HA 4F3QA 4KJIA 2PMZD 2POKA 1UETA 1SJQA 2OPRA 2DH7A 1Z2LA 1WF2A 3N0VA 4WKRA 2GIRA 5KFIA 5CD4H 4A47A 2JFKA 2BZ2A 4RNMA 2IMOA 4ZKAA 5HMYA 1CVJA 4MK7A 2KZMA 1UVIA 1IKXA 3NWGA 4K4XA 4DR7F 1TV6B 1XR5A 2EFOA 2EK1A 3U1NA 4B17A 1JLGA 1Z2ZA 1FHTA 2MHEA 3LO3A 2U2FA 1BLUA 1VS3A 3M8RA 4Q2LA 2PT0A 2M88A 2YKAA 1YIJS 4QCLA 2D3OR 2J8AA 1QJHA 4Y3CA 4IOBA 1S1UB 4ZP9A 4N47A 2DVIA 1JKHB 1TV6A 1NH8A 5FIIA 4L3NA 3MD1A 4FS1A 5DG7A 3G6VA 2VB6A 4QYRA 3RW6A 1YJWS 1UL3A 1X8DA 2JL9A 1Y9OA 1FDAA 2E66A 5LSOA 1QVGR 1D3WA 2KT2A 2SXLA 2HHVA 1DFDA 1Q8BA 5KFZA 2QSWA 5KAKA 2IM2A 2LXIA 3J81Y 4C97A 2RDJA 3IAM9 3N6LA 1JKHA 2DIVA 1VC0A 1TP7A 2A18A 4DSKA 4ZVHA 5J1NA 2KH9A 5KFDA 4HEA9 1Y0HA 5EDWA 4XAKA 3H4BA 3OSPA 2QE5A 3SSRA 2V8DA 3G8TA 2RH3A 3CVKA 4DR1F 3GZ7A 2E1CA 3SV3A 3BGFA 4C3LA 1AUDA 4MYTA 5KT7A 2K8GA 1RGVA 1HNWF 2FPHX 1JB0C 1AFIA 2CZ4A 3ITHB 3MM9B 3PRDA 3DRXA 4ZP7A 1JJ2R 4M1KA 1DRZA 4RU2A 2L9NA 1A7GE 4ZMMA 2LCWA 2D41A 3MMBB 2W7OA 4DG1B 3GG1A 1V3ZA 4B9MA 3QO9B 3AHPA