2HFOA

Crystal structures of the synechocystis photoreceptor slr1694 reveal distinct structural states related to signaling
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
MSLYRLIYSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYELSDNFFLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Synechocystis photoreceptor Slr1694 reveal distinct structural states related to signaling.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords Activator of photopigment and puc expression
total genus 45
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hfoA01
3HDSA 2XMVA 3HHLC 3HX9A 3CJKB 2HFNA 3LGNA 1FVQA 2EW9A 5B0EA 2OKQA 4YEAA 5T7LA 3IWXA 1FE0A 3CJKA 4EFAC 1KVIA 4FNIA 4HH0A 4Q2MA 4OJ3A 1YJUA 3BN7A 2RMLA 2XMTA 1XBWA 2W4PA 3BF4A 1AW0A 2OMOA 1S6UA 1MWYA 4Y2MA 4YDXA 4DL0C 5B08A 3HHLB 2K2PA 2LDIA 3BDEA 5A6PA 2LQ9A 4A46A 1TZ0A 4OIXA 2AW0A 3BGUA 5B09A 2FTRA 4NL5A 1TL4A 3MCSA 4HI1A 1Y9OA 2QLWA 2ROEA 2ZDPA 3BR8A 3HHLA 5F0WA 1TL5A 2G9OA 3HF5A 2AP6A 1YJVA 2OP5A 1Y3KA 5B0AA 2GCFA 1AFIA 2ASYA 1SB6A 1Q53A 4NPOA 3MZIA 2BUNA 2LXFA 1Y0HA 4Y2KA 3QMQA 1R6YA 2OAUA 2JDJA 2W4CA 2XMKA 3QGPA 2N7YA 2GO8A 1AFJA 4F67A 3BB5A 3T9NA 2KT3A 3TNVA 2KKHA 2IFXA 5B0DA 2HLTA 3HFKA 3KG0A 1FVSA 1CC7A 1N5SA 2QIFA 2IYIA 1S6OA 1FEEA 1URRA 3FGVA 2GGPB 2XMWA 1RJJA 3GZ7A 5B0BA 5B0CA 3FRYA 5KAKA 2PGCA 5T7LB 2GFFA 5A6WA 1YJRA 1KQKA 5IXUA 1CPZA 3LO3A 2KT2A 1VQSA 2BJEA 3VTIA 2RU9A 3TOQA 2BBEA 3TRGA 1JK9B 1Q8LA 1Q8BA 3E8OA 1U7LA 1APSA 1ULRA 1MWZA 2OFGX 1IUJA 3KKFA 5B0FA 2ZDOA 1WD6A 4ZA1A 2HIQA 1OPZA 2VV5A 2CRLA 4A48A 2VH7A 1SI9A 1OQ6A 1LQ9A 1V3ZA 2Q3PA 3DCAA 2N4DA 4HL9A 2L3MA 3LGMA 1YG0A 1GXTA 2IYGA 2QYCA 3BM7A 3K7RA 4A47A 4DPOA 2QLXA 4OJ1A 1FESA 3DXSX 2RILA 1X0PA 3IWLA 1FD8A 1QUPA 4U9RA 1GXUA 2XMUA 3I9ZA 4QOTA 1Q4RA 2FIUA 1VQYA 5K9FA 1P8GA 1W2IA 2OD4A 4FNHA 2BJDA 2ROPA 4OJGA 3F44A 2W4DA 4A4JA 2GA7A 1N5VA 2LQBA 1OSDA 2AJ0A 2HFOA 2PD1A 1YRXA 5F0UA 1JWWA 2XMJA 2GV1A 4HI2A 4OJHA 1CC8A 2FB0A 2K7JA 2XMMA 1TR0A 2HQIA 1YJTA 2OFHX 1X8DA 2FHMA 2RSQA 2AJ1A 2GGPA 3KG1A 5B0GA 3WDOA 2K1RB 1K0VA 4Y2IA 1N5TA 3FMBA 4Q2LA 4ZOSA 1N5QA 3KNGA 2HLUA 3UDCA 1FE4A 2ACYA 2N4CA 2BYCA 2OD6A 4DN9A 1KVJA 1P6TA 1Y3JA 1TUVA 2K7KA 2K1RA 2ROGA 1SQEA 1OQ3A 1X7VA 4HH1A 2KYZA 3HHLD
chains in the Genus database with same CATH superfamily
2DIUA 1XJWB 2KRBA 3DYAB 3LGNA 3W9IA 2KO1A 5B0EA 3M8RA 1VQ5S 2POKA 4N8NA 4W92B 4B08A 3T9ZA 2RMLA 4F4AA 3OHAA 1RAEB 3KDNA 1M1HA 4LRDA 4MFBB 2WW8A 4NRUA 2V8HA 3OXLA 3R1HA 4DDFA 2PIIA 4C8YA 3TWZA 1E6YB 5B08A 4C11A 2NS1B 1Q8IA 5JVHQ 2HNZB 4ZVRB 4H4MB 4NYPA 4ELUA 1TFWA 2ABYA 2CPXA 4Y2CA 2W24A 1H2UX 3F56A 3MCOA 3TYTA 4DR5J 4OI3A 2RRNA 3R6GB 3EZ5A 4ZPTR 1H2VZ 1A6LA 1RT4A 3U1MA 3ZZOA 1HMVB 2RAQA 3MPUB 4FXVA 1DQ9A 4OYXA 4N7TA 3K5LA 2V8PA 1IKWB 2BM0A 3H98A 4CZCA 2VC0A 3GCWP 1CJUB 4I56A 2P5VA 2ZJPQ 2FGOA 3FCHA 4XDCA 3TP2A 4Y2KA 1G2EA 1TK8A 2IDEA 1RK8A 1VQMS 3EGZA 1EQMA 1PAEX 3D0GE 3M6UA 2BEFA 2N82B 1Y7PA 3NNHA 2F1FA 4K7QA 2W8KA 5I3UA 2DGOA 3QLHA 3TZXA 2I8EA 2IFXA 4ICLA 1K73T 4B3OB 3CF5Q 1FXDA 3EGWB 2VBZA 1HI1A 3N5FA 3GILA 1H38A 3GLJA 3GIIA 2HGLA 4YHHJ 1T94A 4BC7A 1RA6A 5H9FJ 4KT0C 5GMKa 3GV5B 3WC2A 1S6OA 2CQHA 1URRA 4QIGA 4L6V3 2L08A 1X4AA 1ZOTA 1RU1A 2B3TB 2QE5A 2Z2LA 4I4BA 1U02A 4XAKA 1KQFB 4A8MP 1SC3B 2GFFA 3GR0A 2CJBA 2BQ3A 3EDRB 2UXDJ 2DHGA 2EK1A 4WYWA 5F9LA 3H4BA 3G6YA 5J2QA 5J2PB 4ED5A 4WKRA 3TRGA 3DRXA 4JI4J 3H5XA 5KFHA 2GMHA 2ZDOA 3PYDA 1VRUA 2B6AA 4ZK7M 4ID5A 2VPWB 1SI9A 4K4YA 4CH0S 4HL9A 3SQGB 2C2EA 2HRUA 3OFGA 3VGUA 1N0VC 3OXFA 5GAEI 3R7BB 1FX4A 3PJ9A 3DXSX 2NXEA 2GAHC 3R5GA 1S97A 3NBPA 3HKWA 4WP3A 1EETA 2BJ3A 3PEJA 3V4IB 1SVDA 2GVZA 2IAJB 4B02A 3I9V9 1S4FA 5DLFA 4LQ3A 3KMQA 1K44A 2ZITA 4WK3A 2XM3A 2DRBA 4RKUC 1R31A 1UJ4A 2V9WA 2HFZA 3MM8A 4OJGA 3VGTA 3AXMA 4NMLA 4QIVA 1NDLA 2D74B 5KFZA 4O0NA 3QT8A 3UD5A 2AJ0A 4RNHA 5J2MA 2LEAA 3C6UB 4USIA 4HI2A 2V0NA 2DNOA 3C6TB 4WYLA 4OMFG 1PGZA 2K7JA 1WKKA 1FJEB 1X4FA 4EYIB 2G1HA 2HWHA 2IVYA 3NS5A 5HVHA 2HQFA 2AJQA 1ZZFA 1S9EA 2UUBF 4U7CA 1O51A 2R7TA 1W26A 2WSFC 5M2UA 4PRFA 2YKMB 3P5BP 3Q8YA 1TAUA 2JFDA 1GTEA 2WAQD 3GJQB 4LSNA 1JX4A 2ZH3A 2K1RA 3MD1A 1HW8A 2XZTB 5D4OA 4ZPWR 3FFIA 2NREA 2P9CA 1MLAA 2VQFJ 4B9LA 1RHQB 2VB6A 3ULHA 1LXJA 2O67A 1Q78A 2VG7B 1AB8A 2HFNA 3JSRA 4NYOA 4PWUA 5D77A 3GB0A 5T7LA 2B9YA 4FXWA 3CJKA 1VIOA 2GMJA 4YFUA 1NB2A 1NHKL 3MMCA 4Q2MA 1BQNB 3TA0A 1F5BA 1V9OA 2BV3A 1F2GA 2BANA 3IXQA 4P7TA 4O44A 2GVDA 1U2FA 3IGVA 2IVFB 3N0VA 1YRTA 2WZ1A 5ETVA 2IM0A 2DNPA 2O66A 3PYEA 6AT1B 3VZHA 2EXUA 1VQNS 2XI2A 4EBDA 3V6DA 2W7PA 4W4MA 4ZP6A 3OD2A 1O6XA 1W25A 4J9OA 1XR6A 2YX1A 3MGJA 3P96A 2CA9A 1XNRF 5JUMA 1MG7A 3GIMA 1YJVA 2HAFA 4RBVA 3BYPA 1LWEB 2J0XA 4NLTA 3TZWA 3UD4P 3PKMA 1RE1B 1B99A 1NPRA 1WHWA 5KFMA 1IBMF 4JI8J 4L3NA 2OAUA 4BWMA 1NDCA 2F4FA 3EZUA 4C7QA 1F6TA 1TMJA 4BC9A 1K47A 4FVMA 4ITSA 5GADI 2APOA 1RWPB 5F8HA 3BB5A 3TUZC 5JXSA 5KFFA 3CC2S 4C8ZA 1RKIA 2PI4A 4CRJA 4CQ1A 1J27A 3I96A 3NCRA 3OSPA 2HQCA 3AD7C 4F3QA 3DHWC 5KFTA 4DV3J 1FWPA 1KLMA 2WBMA 2YNGB 2ZC3A 3BV8A 3IC1A 3EE3A 5FLXU 2VKRA 3MMAA 5KFQA 2V50A 4R5PB 2J6UA 3VQSA 2EWHA 1VLOA 1SKUB 4P7VA 4USTA 5B0BA 3Q0AA 2QFJA 4RBUA 1B64A 5J2QB 1LXNA 2CZVC 1CPZA 2J9DE 1MU2A 3ZTQA 1UEUA 3LO3A 3MMBA 5DDOC 1P9YA 4NLOA 1IBMJ 2KXNB 1LK7A 5GMDA 3TOQA 1KD1T 3VCDA 5F8JA 1HD1A 3ITHB 1JJ2R 4LF1A 2XYPB 3THPA 3CT9A 5DDQC 1G7CB 1LW0B 2IM2A 3E01B 4TN2A 3QAUA 5IT4A 2KDOA 4BHQA 4WZMA 4KBIA 5IC6B 3HT3A 1C0TB 1LQ9A 1WJ9A 2HQ3A 2L9WA 2IPOB 1MNEA 2V68A 4E2FB 4QWDA 4NLWA 1HBOA 2QYCA 1SV5A 5AXNA 2GQQA 3WC0A 4WTYA 1QD1A 2JNJA 2MQ8A 2XHCA 4YR0A 1HNZF 1KLNA 4JI7J 4LF6F 2XB2D 3RRKA 5CD4A 3BQ2A 4QYRA 3K59A 4DF4A 2KZMA 1GXUA 3DU6A 2OTJS 1EETB 1QLNA 1MU2B 1KHVA 4CIOA 2OH2A 2HHUA 3BYRA 3GYNA 2DKOB 3MM5A 2XTJP 4O3QA 3W2VA 2PN6A 1K1SA 2HFOA 2MJNA 1X9MA 1X4GA 1MN9A 4ED4A 3N5BA 4F0KA 4IH6A 4Y3CA 5FDLB 1VGYA 1HQUA 3D3CJ 1PYSB 1UKUA 3TA2A 3PR4A 5HLFA 2E29A 4KKOB 3DDNA 3SYZA 2RSQA 2CZ9A 2GGPA 3Q22A 2EG2A 3IAS9 3P45B 2HNZA 3ZFVA 4PXEA 5BR8J 2OEJA 4CNZA 4ED2A 3GYGA 3V81B 1Q8KA 3FZBA 2HKEA 3TZYA 1LOUA 3ADAC 3ILIA 3OW2R 2HVZA 2YWKA 4K59A 3R9LA 2J9CA 1UETA 4X4OA 5KFJA 2I5JB 2IY5B 3RAMA 2K7KA 2D3ZA 4NZ6A 3JAMY 1PILA 4I6YA 4ED0A 2IBOA 2ZZNA 1KONA 4N77A 2B5JA 3NGRA 1MMLA 2MKKA 5FDLA 4IG0B 2C2NA 2J6TA 3KLIA 4X62J 3K5MA 4NLYA 2ZH6A 1HYSA 3FSIA 3RYLA 3I56S 4OZ0A 2MQQA 2MGZA 3MAAB 3NAIA 1GEHA 2LDIA 3M9OB 1IKYA 3JQMA 4EGLA 4J9NA 3GV7B 1GFWB 1M5KC 3BKUA 2CNLB 4M5HA 3D68A 3W5YA 3T1YF 4PKDB 1NKEA 1NRKA 3TO8A 3WX8A 3M6VA 2G4BA 4DN0A 3SV3A 1XMQJ 1XTZA 3AQOA 2DD8S 2GC8A 1N56A 1I5OB 4WE1A 2ROEA 2UVWA 5EX0A 1VHIA 2HS3A 5J2MB 3HHKA 3FQLA 3EJMA 5B0AA 1VJQA 2H5EA 3NRBA 4ZVSB 1HWUA 4A8FA 2GJIA 1VFJA 1RXOB 2AHOB 4YY3F 4RW4A 4IDKB 3DU5A 3FBCA 3DOKA 1RTHB 2HURA 2OPPA 3ENAA 4X4QA 5LMUJ 2ADCA 2AJ2A 2UUTA 4ID5B 1C0UA 1EX8A 2J9EA 3ENQA 3M2UA 3PG9A 5CZVA 3TNVA 2VICA 1XNRJ 3IM8A 3Q24A 1VC6A 4LF8F 3BBFA 3CJ8A 3MMAB 1KKHA 1I94J 1R8PA 3AB2B 3HMJG 3OLBA 1Q82T 1HQEB 3TI0A 4ZPVR 4X64F 4RUAA 3GR1A 1RT3A 1SC4B 4I2QA 1WC3A 2NUUG 4I68A 3GG0A 3MM8B 5E3QA 5DGAA 4LF7F 2X51A 4H4KA 2G0JA 2HWTA 1T05A 2DK2A 3AOAA 3HD1A 4RNFA 2KT5A 2GS8A 2FDNA 3GCXP 1J2VA 2P6TA 1RISA 5AXMA 4AT1B 3H25A 5I3QA 1APSA 3BO3A 1FO1A 4RW9A 2IIHA 3B6BA 4ZA1A 4CI0B 3JTOA 1CJVB 1T9UA 2KRRA 4TVAB 4Q45A 3TAQA 3DI6B 2GVZB 1KEKA 4X65J 2DNLA 3BR9A 1V3ZA 2G13A 3KK2B 2RT3A 1FHTA 4QZVB 2CQ1A 4F04B 3BGOP 3F41A 3PY8A 4DXLA 3UCGA 4TKTA 3QRPA 2RILA 3A3NB 3H7HB 5DG9A 4OLPA 2A0FB 4YOEA 2F7VA 1U8SA 3MEDA 4MAKA 1AXQA 2QZ8A 2XCPA 5KT5A 4QQBA 1VQKS 2W9BA 2ZD1A 1FFWB 1PJ6A 2BJDA 4FNHA 2VJUA 4C97A 3PV8A 4OI0A 4XPEA 3BO2A 1CJTB 1ELOA 3MMJA 1XMQF 4EZ6A 1OO0B 1OSDA 1N6QB 1S7IA 4LMZA 4ZIVA 2BE9B 4C11B 2XMJA 3VALA 1CG2A 3RB0A 3HHNB 4FBUA 4FYXB 2HMIB 2XMMA 2RNEA 1NO8A 1PYTA 1X4EA 1DLOA 1WKLA 2HNDA 4G1IA 4F0HA 1TTHB 2K1RB 3HLUA 2UUCJ 1S72S 5C2CA 1CSJA 2KH9A 2HK2A 3SZ2A 1PG5B 2HQDA 2CJAA 2VBYA 2UZAA 1S6PB 4USJC 1L3VA 2NSBA 3G86A 3HVAA 3LP1A 4KGMA 2EBGA 3MFHA 2XZWA 5ETPA 1G4CA 4IFVB 4ZCKA 4QBUA 2AZ3A 1U0SA 1RT2A 2BKOA 2FHJA 4UW2A 5KG3A 3UNYA 5C7PA 4TU7A 3K0JA 3K5PA 1RYSA 1S1WB 2D1CA 1PC5A 2DH7A 2A10A 2F9JA 3OL8A 1D09B 3CCMS 4EFAC 1VQ6S 4DR4J 2OKQA 4DPWA 1PC4A 5D0EA 1KDNA 3QSYB 2LCWA 2ZBRA 3ZZ0A 1KVIA 4FNIA 4FF1A 4EYHB 2XMTA 1HARA 4XIUA 3MM9A 4QJVA 4DSLA 3KG4A 2FJBB 1WHYA 3DLKB 3LP0B 4WK1A 1XMBA 5RUBA 1TK0A 2XHWA 2HHTA 2MZSA 3EICA 1MWYA 2MMYA 4PZVA 2MQMA 3GFZA 4NLGA 4NX9A 1FI4A 4MKVA 4P2FA 2D9PA 1OJ4A 2IA0A 4UZBA 2F65A 2IA6A 5GAGU 1KR4A 2R8KA 4LF5J 4KFBA 4DFPA 1TL1A 3PACA 3BR8A 4X2BA 2KFNA 2NUHA 3LAKA 2JWNA 2Z2ZA 1R8BA 3SDEB 2QA2A 2OSRA 3UVJA 1KTQA 2YQ3A 2B4UA 3NLCA 4J5OA 3QIDA 4D3HA 4C98A 2LXFA 1WEZA 4S0MA 4QW8A 1RWVB 2Z57B 4P75A 2JDJA 2KTQA 2DGSA 2P9GA 3M8QB 4H4OB 1NK6A 1FA0A 3PHEA 2DGVA 4ZJLA 1XNQF 2JLGA 1CVJA 5HVGA 3GQCA 4DV5J 1N34F 3AJ2A 4JI6J 3RJMB 2WBRA 1D9AA 2FC8A 2YWWA 2OJ3A 2B7BB 3TVYA 2E9ZA 2V6AA 4DR7J 2C3UA 3D67A 5HMYA 1PO6A 4NZ7A 4EEYA 1C4CA 2HS0A 3O8WA 4OYPA 4CO5A 1T9WA 1MW7A 1RT2B 1ZZNA 1TKTB 1VC5A 2VA3A 1RWWB 1T9VA 1RCOB 1RJJA 3D9BA 3ZTRA 4CLFA 3CDEA 1ZYQA 5IXUA 2DNMA 3TX0A 2MZ1A 5KG0A 3MEEB 2B4PA 3OR1B 4CDIA 3MXHP 2BBEA 5E2QA 2IM3A 1Q8BA 1Q5VA 2BJ8A 4DV7F 4JI4F 5ETSA 4IUFA 3CPWR 5EN1A 5E7OB 4DS5A 1PCAA 1HL6A 4HLBA 1NK7A 3C3LA 2HS4A 2X1GA 3PFEA 4MJKA 3J81U 4R8UA 1N48A 2CPIA 2UU9F 2EFOA 3O6QA 3PX6A 3JSMA 1LWCB 4DL5A 4HVZA 1XEZA 4A47A 3ENWA 3K8VA 4OX8A 3L9ZA 1KVKA 2IJFA 1F9EB 2J7KA 2MKYA 4OZ2A 3M6XA 3N4WA 1U6FA 2XMUA 1FDDA 2HFVA 2J7UA 3I9ZA 4LBHA 4M5NA 1RTHA 5F41A 2RQCA 2QEXS 1Q5YA 4DPXA 3MPWA 3JXOA 5GVQA 2QV6A 4ECRA 2CQ0A 3F44A 1DARA 5GADU 2E1MC 3GSDA 4FZVA 4HYKA 3PYGA 2CVIA 2HGMA 4GKJF 3ISZA 3PJXA 1K1QA 1FDAA 5F3ZA 2VA2A 1RABB 2Z4PA 3UQSA 2GZOA 2HQIA 2RF2A 1OY8A 1HBOB 2CPFA 2W2NP 3MUMP 3MI7X 4ZKAA 2CNKB 3PX4A 2IRUA 3V2UC 3FSYA 2MLZA 4LSNB 3W5ZA 1TKXA 2MY7A 3MOZA 1YBTA 1HQ2A 3M6WA 5CQGA 4N47A 4ALZA 5D3GA 3CJRA 1CJKB 1OYDA 1Q1KA 1T9TA 4KGKA 4UOGA 1M1GA 1UA0A 2HHHJ 4ILMA 4YR3A 4DHVA 4ZPCA 4C8NA 1TVRA 1CJUA 2Z2MA 3T41A 1FFSB 2EEYA 4HACA 4EBEA 2KYZA 1RT1B 3A13A 4JUZA 1U48A 1T9XA 2C2MB 4Y28C 2R8HA 3MR6A 1FVQA 4YB6A 2GVDB 1NBEB 2V69A 2UV8G 4CTAA 5A8RB 3EYZA 2XY6A 2AMCB 3CTRA 1YJWS 3KXDA 1T3NA 1FTRA 4DR4F 4R5PA 4OYIA 1FF2A 2VC1A 3UDEA 2H48B 1T03A 4ZPDA 2ZFHA 1KLMB 2DNNA 2YNGA 1RKJA 4PPZA 4Y2MA 2ZE2A 2ASDA 4KFBB 4LR7A 5LT5A 4B9NA 4FF3A 1CS4B 4RW6A 4M63A 1F5AA 4X4UA 2AYEA 5IOLA 5IQ6A 5B09A 5JJBA 4NLDA 4J9RA 3G8SA 2XCAA 4F0MA 2AWZA 5KG5A 3K2YA 4F8RA 1YRUA 5KFXA 4NASA 1JLEB 2HVEA 4GC6A 3TA1A 1Q53A 4IOAQ 1VBXA 5M2RA 4P6QA 1FX2A 4LT6A 1R27B 2A6OA 4DL7A 4PWDB 2DGXA 3S8SA 3I82A 3MM6B 4USUA 4CLKA 3A3PB 2AGPA 3ZO7A 4F7VA 1QSSA 1U49A 1Y5LB 2H5JB 2CQ3A 2W2PP 3AXKA 4OHWA 4X4PA 5LL6d 5H9EK 2DCLA 3KK3A 2KZZA 2KJWA 2WHOA 5M2PA 3EDQB 4LFAF 4K2JA 4USMA 1YWXA 2IAJA 4Z37A 3UDLA 2U2FA 4KY3A 1NM2A 3I6PA 4MKAA 4P10A 4B9TA 1IJFB 2BA9A 3W60A 4ZP9A 2C2OB 4DCPB 2GGPB 3CCES 2V4QA 3UW1A 3OL9A 3MPVA 1O0PA 4U8VA 2ZHBA 1WKJA 2I9SA 2FHKA 4FYDA 3DMJB 2XC9A 2WCXA 4XDDA 2M88A 3MF5A 4O0IA 4G1PA 1R8HA 3CMES 3GIJA 1YITS 2QJ3A 3NG8A 4RNNA 1NSKL 2HSEB 2FLNA 2H54B 2BR0A 2ZJQQ 1LWCA 1OIAA 1WD6A 5KG1A 2DBBA 4KGXB 1RT5B 4K5SA 3MEDB 2HHPA 2ALZA 1OQ6A 4OYWA 2GIRA 1FNMA 2I6WA 3UN2A 3DGPB 4E98A 3LGMA 5HROA 1U6BA 4X4VA 2OEMA 3BM7A 4U9RA 4DUYF 3CJ0A 1TUWA 1JNRB 1D8YA 3DRSA 4ES3A 1NNDA 3IGNA 3IWLA 5A8WA 3MECB 3MPYA 2QSFA 4I7FA 4TY8A 2CPDA 2RQ4A 2DR7A 2GIQA 2EK6A 1X4DA 2VQFF 1DFDA 4IRKA 2XBPA 3T1AA 3LUYA 2JHEA 4JV5J 3MD3A 4DLGA 4DR5F 2PD1A 1PJ7A 1R89A 2BE2B 2KN4A 1Q7YT 4M95A 4DR1J 2RH3A 1RDRA 4LRBA 3ZNUA 5MAOA 1Q0NA 1SXLA 1U1MA 1WC4A 4DS4A 4NMXA 5HBMA 2CJKA 5HI7A 1K0VA 1HNWF 3HJVA 4O3OA 2ERRA 3FMBA 1UP1A 2VKZG 3PM9A 1SQFA 1S1VA 4JBCA 3OL7A 2XI3A 3DRRA 1S6QB 5JMNA 5FLXY 1TU0B 2Z8QA 1FE4A 1JXEA 4HT5A 2ZH1A 2VG6A 3ONQA 2DPIA 3ET6A 5THWA 2XZDB 4USWA 1T02A 3M2UB 3OR1A 5CH7B 1YX2A 1F5CA 3KLIB 2XSJB 4OZLA 5L38A 2B56A 3HM9A 2D3UA 3V6JA 4LF4F 4Q0BB 2DH8A 5GMEA 2PSZA 4JI0F 2ZH9A 4LSLB 3KLEB 1UA1A 3IWXA 4PAAA 3N79A 3S6EA 1RA7A 2GW8A 2GIFA 2R4FA 1Q16B 4I69A 2G0CA 3BN7A 5EX3A 2DXEA 2CQ2A 2B9WA 2W4PA 2QLJB 2XYHB 4Q5VA 2OMOA 9ATCB 1FWKA 4U8YA 4ZMMA 2WONA 4QPXA 2DXDA 1FD2A 1HIYA 2VDIA 2YKMA 3QGGA 3QYYA 3W66A 1VBZA 1QSYA 5BXIA 2FVQA 4WE1B 1S6QA 3PKYA 1YIJS 5HANA 3RU0A 4YY3J 4N76A 2VF3A 3R7SB 4YB1P 2W7AA 4QU6A 4CYUB 3I0RA 5CA5A 2QGFB 2XO7A 3OTEA 2VU5A 3GJRB 5C42B 3KMSA 5AE2A 1QY7A 2XYGB 3FNNA 3Q8SB 2FLPA 3ETOA 1RHJB 2WVCA 3SCIE 4CLLA 2GJ2A 4G3IA 1AFIA 3GU0A 3D1HA 1UFKA 5D4PA 5T41A 2NPIA 2RF2B 3UNGC 5BR8F 4URQU 1CULB 3IS9B 3ZZRA 5KG2A 1JLFA 3GONA 4CO0A 1AT1B 3G8QA 3TAPA 3NNAA 1M90T 2WONB 1MMDA 2MXYA 4ECSA 4UY8T 1GH8A 2ACMA 3NBPB 4K4WA 1J5EF 2H1YA 3T6JA 2YKNA 3DOMB 4PPDA 5DLGA 3CSKA 3PW2A 2ZZMA 4ETZA 4M5MA 4DV2J 1RT3B 4FPIA 2LLZA 4P72A 4LRFA 1EAYC 1HBNB 2G2OA 3N01A 3UWTA 2DHXA 1UFWA 1N5SA 3G9CA 4ZP7A 3E01A 3HZEA 3LOUA 4ECQA 1UVLA 4OHYA 2DTJA 2XMWA 3MM5B 3V6KA 1KHWA 1X5PA 4RPFA 1S48A 1KTVA 2CADA 2J8AA 4DCOB 4LFCJ 3EMTA 4NA2A 1VRTB 1NH8A 3PJWA 4R8UB 2O3DA 2NXUA 2KT2A 3M8QA 4P9SA 3FDSA 4G65A 1YLXA 3EVWA 5CAAA 2ZM6J 1AZSA 2R3VA 3CO0P 3CVKA 4ZVTB 3R8YA 4QWCA 3DC2A 3CB4A 1NK4A 1GX6A 1P9QC 1HWJA 2CXEA 1NJZA 1VIXA 4RW8B 1S1UA 4EBCA 3CDWA 3W7BA 3M30A 1TKXB 1WOPA 3N6NA 3HSJA 4U7UK 1M1KT 4KHPJ 2CQIA 1AFJA 1JLGA 1U0HA 1HWKA 1WWHA 2K8GA 4NZ0A 5CD4H 4I6AA 4DU7A 3SQGA 4C4WA 4RR5A 3T5KA 3W8PA 5KTQA 3MAQA 5K9FA 3D66A 5KFKA 3BBCA 2FIUA 3UDVA 2W1BA 3WQPA 5A8WB 3RRHA 3V6HA 3R2CJ 4ZITA 1VRQC 1I3OB 4CLTA 3MTJA 1R0CB 3M32B 4KJIA 1NHUA 4A4JA 2GA7A 1N5VA 1OSCA 3GIKA 5AJ3F 2DHHA 2ZJRQ 3DLEA 2KYXA 3EWGA 2HHSA 2WW4A 1BUXA 4CT8A 4NE9C 1JXVA 2MKHA 3D6FB 1UVKA 4CNYA 2LKZA 4JI1F 4PR6A 1WORA 3KLHA 3OTBA 2R2TA 4RW6B 4ZOSA 3PEHA 1UJ5A 4NLUA 2R7WA 1FKPA 4P2SA 1WHVA 3PW7A 2IM1A 2AYGA 1HI8A 3ILLA 4Q0BA 1UPMB 4DMZA 1TUGB 3FEZA 4PQUA 1Y3JA 3M1VB 3SCKE 2B51A 2I38A 3DLGA 2VFTA 1A7GE 2H9ZA 3HX9A 4USKA 3DHXA 3A8JA 1QTMA 1DURA 4YEAA 1WF2A 3RRGA 2Y8WA 3DLEB 2GHWA 5E41A 1M5VC 3EM1A 4GO5X 4HH0A 2HYIB 1ZETA 1FTCA 2PEHA 4IQMA 4NLXA 1ZM9A 2AD9A 1VMBA 1RBAA 2KB2A 1FK9A 4F36A 4HHHA 4NLQA 4F2SA 3RW6A 1Q81T 3UD3P 5LXYA 3MEGA 2K3IA 2L48A 4WPAA 4WTOB 5A6PA 1RLCL 4BS2A 2HAIA 1DHMA 2MQLA 2Z58B 4JOUA 5U47A 5HL7Q 4HHUA 3H40A 2W7OA 1S0MA 1DTTA 4EO8A 3ZZPA 2WVBA 4N8OA 2FHJD 3QWPA 4OI2A 4PWWA 4Z2XA 3AFGA 2G1DA 1IXKA 2MDAA 1RAJA 3PRDA 1N88A 4EUVA 4DR2J 2F3JA 1S9FA 1B70B 4W90B 3V4IA 3O3LA 4LR9A 4JI6F 4C48A 2HIYA 1FERA 1DLOB 1UEVA 4WU3A 2AKWB 2CKWA 3MHYA 3G6VA 3VGVA 2OLWA 2CWKA 2V94A 1YTYA 1N33J 3SMZA 2RIJA 1QUVA 3SSSA 1R0AA 2DR6A 1H98A 2ZE2B 3BGFA 3DYAA 3PCOB 4CLPA 2N7YA 2RQKA 3DRRB 4RL1A 1H74A 1U45A 2DEJA 3CCSS 1AUSL 3FJ2A 1B0VA 5L9NA 3WHIA 5A2QY 2O01C 2DGWA 4WFZA 1N4LA 3CDBA 1DTQB 3QIPB 2HEKA 3T1YJ 2Y1JA 1QDUB 1RAIB 1V6HA 1WEYA 3AY0A 4KPCA 1D9DA 3KLVA 2QIFA 4Y2AA 3HKZD 2QX0A 2F9DA 2FJVA 2QTWA 1NMEB 2WB1D 1FEEA 1VCTA 3M7VA 4Y65A 3TEGA 1X0FA 1EQ0A 3GZ7A 1RU2A 2YWEA 3CJ2A 4B9MA 4DL4A 2CFXA 2IJNA 2HGNA 1S5ZA 4OYOA 3TVKA 1G6BA 4MYTA 3BSNA 4J9SA 1HBUA 4F4WA 2QL7B 7FD1A 5EHHA 1NSAA 1EB0A 3TJAA 3U1NA 1ZAXA 4HHJA 4NLVA 3CDUA 2VIHA 2YQ1A 2Y1IA 4XTTA 1VOMA 2EBEA 3SSRA 4DV3F 2VFSA 3M2VA 4DI6A 1N32F 3HVTB 1ULRA 1MWZA 1IUJA 2QRRA 3MR3A 3I4PA 2AEMA 1OPZA 4P71A 2CRLA 3TQEA 3BEGB 4OHZA 4ZCLA 2JLFA 5CXTA 2YNIB 4RUBA 4F26A 2ATLA 3T6BA 3BPSP 2WOMA 3S01A 1ZTWA 1U47A 4DPOA 4NCAA 3QLHB 2CNOB 4OJ1A 5IC4B 1UWBB 1WDTA 1DZ5A 3GFHA 4FS1A 1IKYB 5DS7A 2E5HA 2CPJA 1YBUA 2QSWA 1F0XA 1Q4RA 1S0OA 1QM9A 2CDQA 2MB0B 2MPUA 2WVDA 1P8GA 2CJQA 4J7CA 4LBIA 3OBIA 3HHDA 3V5RA 1R0BG 4LREA 5KT6A 3Q8VA 4QR0A 4ED7A 1U1QA 4DR7F 4RU2A 3CJTA 4M5LA 3FKBA 3TX8A 3OJSA 1UAWA 1ZPWX 3KOAA 4A8SA 1C1BB 2E5JA 3JTPA 3ZTOA 4AXJA 2R7XA 4QIEA 3A8EA 1NDPA 1UVJA 2W2OP 4QYZJ 1DAXA 4DZ6A 3AA9A 5LJ5Y 3QGHA 3BSAA 5KFNA 4P2XA 1BD6A 4MIBA 3THVA 2KFZA 3M8PA 1YJ7A 2A3JA 2OD6A 2WVFA 2DR9A 1H2TZ 1YQHA 3V81A 1WSVA 2OPRA 3T5HA 3BZQA 1AZSB 2LVWA 4DSKA 2YKPA 1SJ3P 2AEFA 2PC6A 4U96A 1E6VA 3BH7B 3MM6A 2E9TA 3TAMA 4DG1A 3S1TA 2M8HA 3IG1A 3K5OA 4DV1J 2CNNB 4C8KA 2BACA 5D0RA 3C6UA 2JLEA 2PI5A 2VOOA 4I2QB 2A18A 3W9HA 3I5CA 3I0RB 4YN3B 4O3RA 2BOPA 4IG0A 4WF9Q 1URNA 2YPZA 2C28A 4PYDA 4FDFA 4DZDA 2PFFB 7FDRA 3M8YA 2VBWA 4DL0C 2QT7A 1JLAB 4WBFA 3IP0A 3OTDA 3LWMA 4KRWA 2ZVSA 4NWBA 4ED8A 4E0DA 2WSEC 2P6SA 1VBYA 4MKYA 3JB9k 1TL7A 2F8MA 2C3OA 3B4MA 3BPDA 2VZ9A 2OMLA 3BGUA 5D4LA 1RB0A 5A8KA 5EDWA 1QSLA 1FJGJ 3BS9A 5CHCB 1Y9OA 1S12A 3M4XA 4NOHA 1RHRB 2YWFA 2J7WA 4I0WA 3PFOA 4KYZA 4C6AA 4XPCA 3KLEA 4AQYF 3MR2A 2UVVA 1IJEB 2DEIA 1J5EJ 2Y9HA 4MT1A 4RNOA 3QRRA 3CCTA 3FC9A 1M5SA 5B7WA 4YUDA 4ZCMA 1UFLA 2NXJA 5E3AA 4JV1A 4O23A 5G4DA 1C1BA 3W61A 4R25A 2DY1A 2NYHA 2W4CA 1HFEL 3LW5C 4RWWA 8RUCA 1OS5A 2HHHF 1ZH5A 2NXCA 1GQEA 4OYMA 2E5GA 3T5LA 2MQPA 1S1XB 3HVRA 5DQIA 4ZP8A 2ZWOA 4LRCA 4DF8A 1GK8A 4TYAA 1N5YA 3W8GA 2V2VA 1NK5A 2RU3A 2XY5A 2QC3A 4B3MJ 2LU2A 1U1KA 4WFXA 2BJ9A 5KFVA 1CC7A 3VR1A 1V5IB 4GVBB 4O4RA 5LSOA 1HYSB 4B3SF 3IO1A 5DDRC 3K58A 1Z2LA 2RHQB 5KFGA 3KK3B 2UVUA 2X3DA 1AA1B 1LNQA 2DGQA 2J76E 4QIWD 4Z7CA 5HMXA 2QN6B 1YJRA 3UO0A 3IBCB 4D3GA 1FEHA 4RUHA 2FY1A 3CIMA 1H7XA 3DOLA 3RBEA 4F4XA 3TARA 2HHQA 2Z0GA 1VLYA 4FS2A 1R7IA 2M70A 3RBDA 2KG0A 3VQTA 2BE7D 2ZKUA 2Y3YA 2EI5A 2FJWA 4IO1A 1V3SA 1I51B 5IQQA 2MKSA 3J80U 5IS2A 2Y0SD 4MIWA 3CCJS 2IHR1 4OI6A 1NU4A 5DG8A 1N33F 1SCJB 2H4YB 3OR2A 2ZEJA 3R27A 2DNZA 5I42A 4PXBA 1YBAA 3X1LB 4LRAA 4JYAJ 3W2WB 2WSCC 1WC0A 2Q79A 4OHXA 3M9MB 5A2QU 3J81Y 1FXRA 2XO6A 5F8GA 1KP6A 2C3YA 4UUWA 2CUYA 4NI2B 2LEBA 2KXHA 3E51A 4KHPF 3NOGA 2ROPA 3J7A1 3DKDA 1SPBP 2L41A 4TLQA 1ZA2B 1KWMA 4YP3A 3C15B 1O5JA 3J7YU 2DJWA 2H5IB 4G1QB 1OYEA 5L8RC 2Y1RI 2EFPA 2Y1LB 2YVSA 3DOKB 5HVFA 1VK3A 3WZ0A 1XIQA 1HNVB 4PUOA 4GKKJ 1S76D 4ZVQB 4NXMJ 5DQGA 4F3OA 3KDOA 3LP2B 4MK8A 5IM0A 1S1XA 3VAHA 1UJ6A 3GV8B 1YZ7A 2JFKA 2FC9A 2KHDA 2KL8A 4TU8A 2CG8A 1RTZA 2E1CA 3BKFA 2VG5A 3M2RA 1BE4A 3CEDA 3C2PA 1KVJA 1E6VB 1IBLJ 2QA1A 1TUVA 2BKPA 3QT6A 4MK9A 1OQ3A 4K2XA 4CH7A 4EI2A 3PO5A 2CDRB 2CYYA 5DZ6A 5L9XA 3WIUA 1CJKA 1IKVA 2AJ4A 1NH7A 4LBPA 3US5A 2YWHA 2R7SA 2BJ1A 3QWUA 1U25A 3NS6A 1IM6A 1NAQA 5K20B 3P6YC 2F4VF 2V2KA 3C14A 2B9XA 1PBAA 3MMCB 3CCVS 1S59A 3AA8A 1CEZA 4B3OA 2CVEA 4FVCA 3DRYA 4ZHRA 5KFWA 3K89A 2A2CA 2SXLA 2HZAA 4IRDA 3M8WA 1H6KX 3HHEA 3M1VA 4Y00A 5I3UB 1FJ7A 2FTRA 3CNQP 3CD5A 4DFJA 2IMWP 2HMIA 2PMWA 2QLWA 4DV6J 3ISNC 3BREA 4CTAB 1IWAA 2M52A 1X31C 3V4MA 1XC9A 3D7SB 2OP5A 5J1PA 3CO9A 3D0HE 2VFRA 2IC3B 5H1SV 2OELA 1TP7A 1K8AT 2FLLA 3TUPA 2EFNA 2ZKTA 1UZHA 2BX6A 3A12A 3HULA 1RTDA 2QG9B 2ZOFA 1F3FA 4DLEA 2BUNA 4DWIA 2FLOA 2YKAA 3LP1B 3AAWB 2E1AA 4X4RA 4FP9A 3QGPA 1VS3A 3LTOA 4IKAA 1M5PC 2DRAA 4Q43A 1Y5IB 3CJQA 4JI2J 2MJUA 3D5MA 2DO0A 2FD2A 3NOCA 3PRBA 4LF4J 1M0SA 4WFYA 2CQBA 2XNRA 3OFHA 1TV6A 1E6YA 4JI0J 2ZM6F 4KAIA 1U1LA 3SBMA 3M8SA 1AUDA 4DSIA 3MECA 5HO4A 5DRKA 2ZUGA 3PX0A 3FVYA 1VQOS 1RTIA 3CJ5A 1RT6A 2DGUA 3MAHA 2NZCA 1VHFA 4MTPA 2KM8B 3RR7A 2XGPA 1VBKA 2ZZTA 3DLJA 3FBEA 1IKVB 1FRKA 3G2XA 4CWBA 2JEJA 4J90A 4KQZA 1FKPB 2GHPA 3OFEA 5A0YB 5K8MA 4PQAA 5MLCV 5EWFA 1S1UB 3E3XA 2JH3A 4DV1F 1HLWA 3A4TA 3IAM9 2I1RA 2K06A 5E3PA 4P2MA 5HBMB 3QBCA 5J2NA 5ETTA 3FCWA 4ES1A 4F02A 3ZZZA 4LFBJ 4O3NA 1HQEA 2AF6A 2OUGA 2VH7A 1U26A 2HPUA 1NUEA 2V34A 5EUHA 5ADZA 2L3MA 3I31A 5D15A 3IRXA 3TEHB 4X4TA 2ZH8A 3GFXA 2OTLS 2DRDA 2YNHA 4PG8A 3NGKA 2ZH5A 3TR5A 1GX5A 3TW0A 4OI1A 1WC1A 3R5BA 4OV1A 5KG4A 2MY8A 3DRPB 3DM2B 5LJ3Y 4ZJOA 3BO4A 1NK0A 4QOTA 4DR6J 1WI6A 1FCAA 4HDGA 2MHEA 3P4UB 1UW9A 1OY6A 3GG1A 4F3MA 5KFYA 1EP4A 2HWIA 3DOMA 3D1QA 1SH3A 2VDHA 2OPQB 3QO9B 2GQ2A 1NLKL 3A8IA 4ID8A 4KGZB 4X84A 5G0RB 3NMAA 1GMWD 3KUHA 3I4HX 4MYUA 1D9FA 1TKZB 2V5HG 4L3KA 4IRCA 4DX8H 2RS2A 4PCQA 2HK3A 3P3DA 1EHWA 2OPSB 5I4MA 4C8LA 3HP6A 2VOPA 1KFDA 3AB4B 1VRTA 3UDCA 5H9FK 1HBMB 3H20A 4NEZA 4NYZA 1Q95G 2E7WA 4FYYB 2ATCB 2MTLA 3KUEA 1IKXA 2IMOA 3ISND 4KO0B 2EVZA 3ZC4A 5DDPC 3Q8PB 2XMVA 1Q7LB 3PO4A 1RWUA 3FRZA 2I0XA 3IBWA 1QAIA 5KFRA 4GO7X 3L7UA 1JLQB 2MQNA 3DLGB 4MFBA 1YJUA 1FNOA 1SH2A 2YKNB 2KHCA 3PDNA 4R0JA 2QFIA 1UPPA 3MM7B 4WWSA 2HNDB 3UFCX 5HSPA 1RAAB 2MQOA 1FKAF 1AW0A 1SH0A 2ZOGA 3G71S 2HG4A 1BXNA 2VG6B 3EVOA 4YDXA 2CQPA 5KFPA 2DGTA 1N36J 2DB1A 3R5JB 3OUYB 2K2PA 2W2MP 1HWLA 4C8MA 2XS2A 4AXIA 4DL3A 2HHWA 4NLRA 2RQMA 4L75A 5ETLA 4F2RA 3QRQA 1O8BA 4X66F 4UY85 3AODA 1LW2A 2C3PA 2PMHA 1FJCA 3LQVA 1IBCB 5F8NA 1Q79A 2MZJA 3HXMA 5KT4A 2MSTA 1RHKB 3ILJA 2X3GA 1TL5A 2YBVA 3IG1B 2G9OA 2YNIA 2YY3A 2NSCA 1Z1ZA 2VPZB 3CJSA 3HF5A 4M5JA 4PG4A 5HQMA 1D1UA 4NCBA 3D2WA 1SJFA 1KNZA 1BLUA 3Q86A 3UN3A 3FBBA 4TQSA 1QJHA 2R7QA 4W98A 1JLQA 1HNVA 4NPOA 4KGVB 5ETRA 2OSQA 3KLGB 1VQ4S 4PUOB 1Y0HA 3QT5A 4LVNP 1RI7A 1RT7B 1RACB 1YI2S 5KT3A 4GRSA 2XNQA 4YDDB 1S99A 1U6ZA 2QA4S 2G0IA 2KKHA 4OZNA 3AQPA 5A8RA 3K8WA 4ECTA 4K50A 2R7VA 3CXCR 3Q8QB 3HFKA 5L39A 1U2CA 2IBKA 1C0TA 3MEKA 3ZZTA 2Q43A 5HMZA 2HVHA 1B0TA 1T03B 1HBUB 2O1PA 1HNXJ 2EKYA 2GO9A 3H42A 1XN9A 2AYMA 4FXDA 3M32A 1H7WA 4MIAA 3VZIA 2W25A 1G1XA 1REVA 1CQMA 2R2SA 4AL7A 4MMOA 4B3TF 3UR0A 2HQGA 1LV5A 3UN5A 3MWBA 3R5DA 1FXLA 2FHOB 3MPDA 5C5JA 4FKXA 4BWJA 2D3OR 3PXGa 2FVCA 2LXIA 5CCMA 1S0VA 1JK9B 1NPKA 3R97A 1U7LA 3LALA 4DQSA 2AEJA 2BMBA 4KV8A 5EWGA 2OFGX 3G82B 2NCKL 5F3TA 2BQUA 4ILLA 2RDIA 5A76A 2FVSA 3Q2SC 2B9EA 1IBKF 4B3RJ 5GAEU 3KYLA 2Q3PA 2CQDA 2IRYA 4KTQA 2OPPB 3QAEA 1WOOA 1FWLA 5D0GA 5IWAJ 2AJFE 4DBQA 4MKBA 1YKWA 1GXTA 2VPXB 1MROB 2V8VA 2YNFA 4CLUA 5L1JA 3U02A 1FESA 1TKTA 1YJ9S 2JX2A 1X0PA 2IVMA 3OV7A 1J5OB 4FN5A 1FD8A 4PG5A 2LQ8A 5AXKA 1KS2A 3NP5A 1JLAA 2XLIA 1N36F 3H5UA 3DRSB 3HSZA 2ZC4A 1W2IA 3NCPA 3PZPA 2NXNA 4JP8A 3D4JA 2W9BB 3KJNB 3G87A 2DCUB 3SI8A 1X5TA 5AXLA 4DX6A 3L95X 3SQOP 2M4MA 5EWEA 2VPYB 2XG8A 1XR7A 3LGHA 4ED3A 1RAHB 2HVIA 3OSNA 1HPZA 2FB0A 1WF1A 1ZTTA 3KG1A 2FJDB 4DR6F 3OR2B 2FHMA 3H8YA 2AV5A 5I3PA 2MKIA 1L3SA 2MZRA 1I1GA 5KOXA 4Q8FA 2XLKA 2D7SA 1VQLS 1C4AA 4JI8F 4EO6A 4ECVA 4ERDA 1H72C 4IOBA 2DHAA 4UQGA 2QLBB 2ACYA 3ELHA 1S6PA 3OQ2A 4JI3J 3HVWA 3J81j 4QU7A 3FFIB 3HFZB 4DR1F 3FEYB 4P52A 2LU1A 4DR3J 1CS4A 1SQEA 2ROGA 7AT1B 1GXLA 4Q8EA 4FF2A 3ET6B 1BMQB 4OX9F 3I5AA 3CJKB 4X65F 1BC6A 5LMNF 3PW5A 5ETQA 2HBZB 2EW9A 1N54B 1HQUB 5CCLA 2BW2A 1NK8A 4WIIA 3W2VB 3TZZA 3KLFB 3EGVA 3KWMA 4BLGA 1WELA 4M5KA 4TYBA 3AT1B 2N7CA 1UVNA 2VFVA 3HFVA 3B78A 2DY9A 4GKKF 3JSYA 3RB4A 3IBFB 5C24A 3BDEA 4HACB 1GMWA 2IDLA 4K8RA 4X4SA 2Y8YA 3BGRB 1R43A 2LQ9A 2B43A 2QL9B 1TZ0A 4OIXA 1QVGR 3CULA 1EP4B 3IWNC 1KQSR 2Z2YB 1U2RA 2AYBA 4WJBA 2B5JB 3NKYA 4QPTA 1UL3A 2AP6A 4UOFA 2YXLA 4DFKA 4OX9J 4C3KA 2HHXA 4QR2A 1ITPA 2F4VJ 5CYQA 4ECYA 2HVDA 3FZ2A 3HVTA 2GX8A 1QE1A 3KJQB 4KIAA 3LF0A 4ZDNA 3R3TA 4FF4A 4CLZA 5IT0A 2R8IA 2FY8A 2XMKA 2LQ5A 3HI9A 2ZHOA 4CLSA 5LM7E 1PYOB 4F67A 1U09A 1DTTB 3A1YG 2BRLA 1U1RA 1N34J 5JVGQ 3CCQS 2KT3A 1B3TA 3OXGA 5D8HB 3VGSA 2PT0A 3EGNA 4RNMA 4UOHA 4CO2A 3AD9C 4B17A 4ELVA 4ZJQA 2E7VA 3OTCA 3RG6A 4QWEA 4WXOA 3CC7S 3FCVA 4QCLA 1JJHA 3T1HJ 1VRUB 1WF0A 3R6LB 4RUCA 2IYIA 1T7PA 1U8WA 3LA0A 3RUBL 1WG1A 3JQJA 5J2NB 1RWOB 2E1PA 2MLXA 4UTGA 3TJ8A 5KFAA 2ALYB 2WOMB 4JV2A 5BYRA 5L1LA 2UP1A 1FFGB 5T14A 1G3OA 3C66A 3MUVP 4IR1A 1MSWD 3CE8A 4YMEA 3VTIA 1K9MT 2UXBJ 1BY9A 4WKYA 3BN4A 4ENOA 3T3FA 2FVRA 4ICLB 3JAMU 1LWXA 4RW4B 4ZVUB 5GAHI 4WCEQ 4DFMA 2FZGB 4OZJA 4V19J 1IVZA 3FMWA 2ZNZA 1JLBA 2H65B 1VC0A 2HIQA 2R42A 2Z56B 3DOLB 3N6LA 2VBXA 3N28A 4NCGA 3DM2A 4YB5A 3MR5A 1NJIT 3N9UC 4PWDA 5KFOA 3SEOA 1WG5A 1HW9A 1JLFB 3UCZP 1YG0A 2B7CB 2ILZA 3B82A 3J7ZT 3JYTB 1UZDA 1IQZA 1L5UA 3C46A 1HA1A 2M5YA 4OL8A 3QZ8A 2UXCJ 2CJXB 3MURP 2NZ4A 4LJMA 1IR2A 2RRBA 1QUPA 1WG4A 1WUUA 4FPRA 1BWVA 1VQYA 3DMJA 2VODA 2RKIA 4P74A 2RDDA 4A8OA 5F8MA 3KHGA 2PA3A 3OTOJ 2F40A 4BCAA 1JJCB 2BANB 4L76A 2CWXA 2VL1A 3SIPB 4DX7A 3CDAA 5K8NA 1HNXF 2YPYA 4DU8A 4A8QA 4C3MA 3H2LA 4Y34A 4OJHA 1UVMA 2NLWA 4M5IA 2A6MA 2COLA 4LSLA 4DPUA 5ETNA 4K4UA 2OFHX 1YJTA 1VQ8S 2KM8C 4LFCF 5DG7A 3NGDA 5A8KB 4L72B 3IRWP 1LFPA 1N52B 1W7WA 1S4EA 3JQKA 3KNGA 2R9LA 3C8YA 5HP1A 1NHVA 3CJ3A 1XMOJ 5BJRA 3D6MB 2N4CA 3VAIA 4C2MA 2PFDA 2DT9A 5DO2A 4K4TA 4O4GB 1RP5A 3NS7B 2DHSA 4NLPA 2WB4A 3ZTSA 5ETKA 2EFGA 4EWTA 1TVRB 2U1AA 3OTOF 1ICEB 3S7RA 3Q89A 5LMNJ 1JWWA 4ZVFA 4LF8J 1SIWB 3HDSA 4OI4A 2HRYA 2BQRA 3NNCA 1B4SA 3GPAA 3CCZA 2YKOA 4ZVEA 5KFIA 4Q44A 2W9AA 4IO9Q 2BE2A 4RJVA 4DQPA 3M9NB 3DDKA 4NXNF 4IH7A 2OPSA 2QMXA 2J5AA 4U7UD 2EKNA 1NJYA 4JV0A 1RYRA 1SKRA 1NB7A 2YWGA 3IR5B 1PKUA 3C16B 4ELTA 2CPYA 3UR3C 2A2DA 4UF4A 1KOOA 3FK4A 4M5DA 4IQXA 4DUYJ 4MK7A 4A46A 4IFVA 3BQ1A 1VQ7S 1WTBA 4HTJA 2YH0A 3ZTPA 3OLAA 1F60B 1S7HA 2GAGC 4ZLNA 4JV5F 5CYMA 3UPFA 2C42A 3POTA 3D1OA 4ZHRB 3KFWX 2ZDPA 3QGIA 4DR2F 1VQ9S 4JI2F 2LQJA 3N6MA 3IM9A 3PVXA 3K17A 2LDYA 2B6AB 4KSEB 5IT9Y 1HNIB 2ASYA 4TLRA 1Y10A 4C9DA 1RADB 5SZTA 1MMNA 2DH9A 3QMQA 2R7RA 1FKOB 4F4ZA 4ER8A 4M8LA 3RAXA 2HFUA 1HI0P 3NGSA 2C2ZB 4O3PA 4B3RF 1U4BA 1FT8A 3R5AA 4ZLPA 5D4NA 5I42B 2FQQB 3GP9A 2JVOA 4PXCA 4E8UA 2HLTA 2ZNYA 4I64A 2XS5A 3G4SS 3KK2A 5K8OA 1XERA 1IWGA 5G0RA 4UQTA 2DXFA 3RW7A 5KFLA 3LWLA 4GC7A 5A0YA 2ZBIA 2CJ9A 4KC5A 5LOQA 5D78A 2W8LA 3NL0A 3LANA 5HATA 2OPQA 3QO9A 3MCNA 4ZLJA 1UWAA 2DR5A 2AQ4A 1X4CA 2XWXA 3AOBA 4PEOA 3M8PB 4R0EA 5A6WA 5T7LB 2XLJA 1W2BR 3D3BJ 3HD2A 4DPYA 1HNWJ 4LF9F 4Q7AA 1GMUA 3SXLA 4DL6A 2XSJA 3H5SA 1JLBB 2RU9A 1PAUB 4A8KA 4KPYA 4CT9A 3E8OA 4IFYB 1NCLA 4OYBA 4EZ9A 3BBBA 3D0IE 1SL2A 4LIWA 3SFGA 5B0FA 3CD0A 1RQ0A 1RWKB 2DNHA 2HBQB 2VV5A 1JXLA 2R7UA 3NEKA 4GVBA 4NRTA 1S0NA 2ZHAA 4OQJA 2VD3A 1RT5A 3DCAA 5FD1A 4UT4A 3L7OA 1FDNA 1U24A 3OT9A 3H59A 3PRVA 2MKJA 3CWJA 5KFEA 4N56A 3OJUA 2RJZA 3K7RA 4RBTA 4JI5F 2ADBA 2R2UA 1RTDB 5DETA 3AH6A 2RKIB 1YZ6A 1XK8A 1Z4UA 2XSFA 3CMAS 5BYSA 3J80Y 1DRZA 5KT7A 1WI8A 1JMTA 6FD1A 2DYAA 3J7YI 5HK4A 3IR7B 1B7FA 8AT1B 1UWBA 3QIPA 4KE5A 4K4VA 3POTB 1S1TA 4O44B 3Q8RB 5GAHU 5H9EJ 4OYZA 3KK1A 3OL6A 3C14B 3QNWB 3FQKA 1JQGA 1UTAA 4F25A 5F0UA 1IR1A 3CD7A 4I1TA 1T95A 4XK8C 1S10A 2JZ5A 5DM6Q 4RW8A 2NQPA 1P27B 3IFEA 1R0AB 2ASJA 1CULA 3IS9A 2V4JA 2ZBCA 2YNFB 4AUKA 2V2ZA 2AJ1A 1JLGB 2E5IA 3Q8UA 2WTFA 4Y2IA 1N5TA 3VF0B 3UI3A 1NJXA 4JYAF 5IWAF 3GE9A 1X4HA 4DEZA 3W65A 2UUBJ 2GMLA 5IZHA 1EARA 1CQNA 2OO4A 4DOZA 3KHLA 3CCLS 3PW4A 2V2QA 3GMGA 5ETMA 3T1HF 1ZAWA 1WC6A 1SBRA 2MYFA 4EMDA 5J2PA 3HK2A 1V3RA 1Z2ZA 1JLEA 2B0GA 4ZVHA 4CLYA 4ZVPB 5C2GA 3BQ0A 1TKDA 3MMBB 2J0QD 2XULA 1FE0A 2D41A 4IG3A 3H5YA 2UXBF 1X5OA 3LP2A 4OJ3A 5E33A 3A3OB 2QA4G 2CQGA 3QJPA 1KOHA 1SUQB 1LEOA 2ILYA 2JJ4D 2J9DA 2FZKB 5D0HA 4DL2A 3QPIA 5GAGI 1RHUB 2PMZD 3C16A 3U27A 4IDKA 2I2YA 5CYMB 4K4ZA 2FJAB 3CCRS 4NLSA 3K5NA 1U1OA 2LA4A 3B8HA 4ILRA 4WXWA 1OMSA 3MCMA 4ZN3A 2BABA 4NL5A 4HI1A 4ZIWA 2F5GA 4TQRA 4YHHF 3F0NA 5KT2A 2DNRA 2YX7A 3HHLA 1F2HA 1YK9A 2RUGA 2C2RA 5AT1B 1CBKA 4RW7A 4OX7A 4USVA 1H3DA 1TAQA 1Y3KA 4ECXA 1N6QA 1Y5NB 3NGUA 3W2WA 3KLFA 1B7YB 2KFYA 3W1YC 2JRSA 1RAGB 2G2YA 4J9MA 2UXDF 2KJVA 2MGZB 4V1Ak 2JEIA 2HHVA 1D0EA 4F4KA 1EJ7L 3D6TB 3R1LA 5E3RA 4N41A 4NCGB 1ZA1B 3G96A 3P49B 1HHSA 2UUWA 4OFZA 4RW9B 4OX6A 2DNYA 4J9QA 2AZ1A 2BDPA 3L09A 2RB7A 1KC8T 3L4BC 4EU0A 1S49A 4DV2F 2V8DA 3KG0A 1F1BB 5AE3A 2IRXA 4URSA 1FRMA 1DQAA 1WSRA 2FZCB 4ZLLA 3OUYA 5LMUF 2M2BA 4DUZJ 2DIVA 4UZCA 4K0KF 4WFBQ 1T3OA 3FSXA 4I6WA 2E1RA 1ROFA 2BZ2A 4AD6A 3TJ9A 1S79A 1ZM2A 2VHGA 1KQKA 2CPEA 3Q83A 3CD6S 3LH2S 1MWQA 2YTCA 3ICLA 1HHQA 1VR6A 4ANEA 1LW0A 1X5SA 1NKCA 2J6SA 1HNZJ 2UUAF 2CQCA 4LF6J 2PDAA 3I5BA 1SJ4P 1RBLA 3PIOQ 1UVIA 1TL3B 2VG5B 1JKHA 3M2RB 4IH5A 4I67A 2MZQA 2D9OA 2OGUA 1SC6A 3I87A 4ATNA 1S1VB 1UW4A 3GIRA 4GMKA 3VV2B 1AYEA 3I32A 4WIQA 2AGOA 2DPJA 4C8OA 3OVBA 2HRTA 3IN5A 1LK5A 2RUSA 2YQ0A 4QW9A 3KJVB 2P9EA 5HQLA 4FBTA 5F8IA 5IT9U 9RUBA 1U0HB 2MZTA 1OPIA 2P8IA 1TL7B 5BYQA 2JL9A 4HR2A 2F8EX 2KU7A 3R5CA 4ANCA 1L3KA 4M1KA 3MR7A 2CZ4A 1VQPS 4JI1J 4ZS6A 1S9GA 2OD4A 3VAKA 1B0PA 2YNHB 3UCUP 3NWRA 2UU9J 4V19X 1BQXA 1ZPVA 3MM9B 4NI2A 5KFSA 2LQBA 2RHSB 5C25A 4B3SJ 1YRXA 3RAQA 1JLCB 3DRPA 2JOQA 5C24B 2KG1A 4DCJB 3H0PA 2HNYB 1GTHA 2V8GA 4DV6F 4ECUA 3HZGA 1EIYB 1CC8A 3TAMB 4DG1B 3O5TB 1S1WA 2MHNA 2W2QP 1ACMB 1X8DA 2MEWA 3DLKA 3LP0A 4LIRA 3UE2A 3WDOA 3SV4A 2AX1A 2ZOMA 4WFNQ 2XY7A 2V63A 3CJ4A 4KR0B 3CCUS 2FVPA 4B3TJ 3BKTA 1N5QA 4IYQA 4X62F 5KFBA 3EPGA 3ILOA 1D8ZA 1LKZA 1DTQA 3QJJA 2D3O1 4NXNJ 4AQYJ 1FRHA 2J0WA 3GSIA 1Q86T 4CYUA 1FRIA 1HNIA 1YSJA 4CO1A 4YR2A 3MDFA 1C0UB 2E7XA 3AOCA 1F9FA 5E5NA 4C0HA 4PQUB 4AYBD 3SDEA 3Q23A 2A1BA 4LFAJ 4F4YA 5ETOA 5IV4A 2FPHX 1JB0C 2W01A 3RZAA 4LF9J 3LPEA 1SUQA 1TL1B 3SCLE 3G8TA 1YGYA 3O1LA 2X1BA 3ENVA 3ZZUA 1VJWA 3E2EA 1XBWA 3BGRA 2M8DB 2DR8A 3W62A 1HBMA 4DV0F 1HD0A 3RBZA 3J7AN 4B9VA 1KN6A 2M0GB 1SC1B 2DNQA 2UV8A 3GFYA 4G6VB 2EC0A 3RGIA 1DY3A 2BRKA 3EZOA 8ATCB 4YB7A 3OVSA 1LWEA 2BJ7A 1YDLA 3WX4A 1IKWA 6FDRA 1KFSA 4H4OA 2Q6BA 1TL4A 2XEXA 3MCSA 5HLFB 1NZAA 3BH6B 3LAMA 4DPTA 2HFSA 4PG6A 1NSQA 1BHNA 2MSSA 5FIIA 1NJWA 5IM0B 2EG1A 4I2PA 4IR9A 1CJVA 3MM7A 2X1AA 1RTJA 4PABA 1SB6A 2W9CB 2R8JA 2LMIA 4L74A 2V4JB 1OY9A 1WOSA 1RAOA 3NCQA 2FJEB 4HTIA 1S9GB 1RT4B 4IFYA 5HMWA 5L1KA 1R6YA 5K14A 4H4KC 3BSCA 4GKJJ 1P1LA 3CC4S 2GO8A 3CGIA 3CIZA 2JSXA 5D6GA 1SL0A 4DV4F 4ECZA 1KRPA 2R7OA 3AJ1A 4J9LA 1BQNA 4U67Q 1R6VA 3KHHA 3KHRA 2GQCA 2I5JA 2K3KA 3ITHA 3TVZA 1TQLA 1U1NA 4Y6IA 4X66J 1FVSA 1VISA 4ED6A 3M30B 1RHMB 5HAOA 1JIHA 4J9PA 4FKYA 3VWSA 1M5HA 1RWMB 2BVZA 4IG3B 3G6XA 1RZMA 3P8BB 4Z7YA 5DZ7A 1WC5A 1FRLA 3JSMB 4ZN1A 1L3UA 4M94A 3HCXA 1SJ1A 2BXJA 4ZVOB 1TELA 1ZM4A 5K8PA 4DSFA 2ZUAA 1J5OA 2AGQA 1T11A 1T8EA 4KHMA 2M3DA 2C1EB 3VAGA 1NZ8A 4K4SA 1GMVA 3KKFA 3WIVA 2WVEA 3TANA 1MN7A 2DVIA 4G1QA 3THTA 1XWLA 1NK9A 1QVFR 2F8HA 1TMMA 1DJ0A 1VYAA 5J1EA 1ZS6A 5F9NA 4F50A 1TFYA 2QL5B 1R3NA 3DLLQ 5E0OA 2UVRA 3MOJB 3KJVA 1GAOA 2LEPA 2R2RA 4X4NA 1BQMA 5K5MA 2RS8A 1WEXA 2NR0A 3Q2TC 1CJTA 3EXCX 5HJXA 1SJRA 1QAXA 4PG7A 2Q66A 1Y00A 3ETMA 4KV8B 1DBDA 2JC0A 3GWCA 4NA1A 4DJBA 3P5TL 1YHQS 1XR5A 4URGA 3V6DB 2M7SA 1NSPA 1F3VA 4I2PB 4QIFA 3H2VE 4H54A 2LECA 2RVJA 1XNQJ 1EKSA 1IBLF 2B4OA 3G6ES 1R8CA 5B0GA 3JTNA 1RWNB 3ZZYA 4A8XA 2NPFA 2OHDA 4O4GA 2OEKA 4KH0B 3AJDA 4Q2LA 2N3LA 3UVJB 4DX5A 2JEGA 2UUAJ 3I0SB 2DNGA 5KFCA 4JI7F 2VG7A 4M5GA 2C3MA 2VQEJ 2J8SA 4FYWB 4WP8A 1NKBA 1X9SA 4RLEA 3T5JA 4RZRA 3EPIA 3QATA 1RTIB 2Q6CA 3H2UB 4ANDA 1A0OB 2VJVA 1N8RT 5AE1A 3VAJA 3VVUA 1HR0F 4KKOA 3HHLC 1UMJA 1HPZB 3IA0A 4LR8A 1GNKA 2CQ4A 4J91A 3QSIA 3QFHA 2GJFA 4NEYA 4CCHA 3EXYA 4LF5F 1A9NB 2UXCF 4B9UA 4IOCQ 3DLHA 2LP4A 1X60A 3BF4A 4RX6A 3PR5B 3DN9A 5DGBA 1PJ5A 1VI7A 4Y0FA 1S6UA 3MUTP 4DV0J 3NWGA 3FEXB 2P2CB 2E5LF 2X1FA 4QWAA 2EC2A 3D6HB 3RB6A 1QAYA 2Y0BB 3KNAA 3D54A 4DQIA 1VDHA 5EGYA 1BGXT 1RUSA 4C0OC 5DM7Q 2H3EB 4AFFA 2C2DA 4HKQA 1F9HA 4KH1B 3SSQA 1ZAVA 5J1EB 3HJFA 4RWXA 2ZWPA 4DV7J 4DQRA 3FUYA 4K5RA 2OIHA 1JLCA 5HP1B 3R2DJ 1M5OC 4ETXA 3RR8A 3L7PA 2DO4A 4H4MA 2EFVA 4OYAA 5E3CA 4HDHA 4O3SA 3M2VB 1K0TA 1PSDA 1SQGA 4LSZB 2ASLA 2GNKA 3B4DA 4L73A 2CIMA 4J9KA 2X7IA 1XQIA 2B4VA 1IKXB 2XWYA 3C15A 2WRMA 3B54A 4KO0A 3T9NA 3NAHA 3TUIC 5L1IA 4K4XA 3CCWA 4LUBA 2AIRB 5LSRA 3NMRA 2C2KB 3F73A 1RCXB 5B0DA 4EK2A 2CJYB 4KHRA 3MEGB 1FRXA 1ZBTA 2DISA 3GYXB 2OI2A 3NXZA 2XMAA 3VAMA 4B3MF 1WTFA 4A8WA 3GTYX 1C2PA 4RU9A 5CABA 2FJXA 2H51B 4ZPAA 3W9JA 3OFFA 1UEKA 2J0SD 4WZQA 1RSCA 4B9SA 3NY0A 3L3CA 4U6PA 3GJTB 2B8QA 2BKNA 2PGCA 2DITA 2F63A 3OPKA 5KAKA 3BJYA 2KVQE 4I7FB 4TY8B 5KFDA 3DI6A 3J7Z5 5HN0A 4ECWA 4JI5J 4OHVA 4NXMF 3VVTA 1SKWA 4DSJA 2ZBPA 1TV6B 4YS2A 1Q8LA 2PO4A 3CMQA 4USHA 1FJGF 1JJ4A 3JSBA 1WDDA 4WP9A 4DR3F 1RAFB 2HZCA 1HR0J 1V5VA 1QTNB 2CAJA 4ZPBA 2V4RA 3OVAA 3I55S 4C0BA 1SL1A 2AU0A 2GHVC 2IYGA 3A8KA 3EVMA 2QLXA 1S1TB 1SIZA 2ZVIA 4X64J 1RTJB 2CPHA 4J9VA 3PTWA 3DDIA 4AE5A 1S77D 3W5XA 1SJQA 2YX4A 3DGVA 3PW0A 1QAJA 3X3UA 3HO1A 4OV6A 3ZXWA 5KG7A 3MAAA 2V67A 1YVFA 4LF7J 1RBOB 3BGLA 4OZ3A 4XO0A 2L9NA 3JYTA 2M9KA 3KUGA 2KI2A 1L3TA 5KFUA 2IC3A 4QR1A 4ED1A 1HMVA 4UOCA 2ZH4A 1FRJA 5LXRA 2WK4A 4RW7B 2GV1A 2XQCA 2N3OA 1LFWA 3HT0A 3SFUA 1ZM3A 2LA6A 2G2ZA 3M05A 5IFMA 3DXBA 2RE1A 1QE1B 3C19A 1TK5A 2LXUA 3KTQA 4UUXA 3MEEA 5KOWA 1HKAA 4GVLA 1WNEA 1AROP 4P73A 3WBZA 5DQHA 3HSDA 4DUTA 2BM1A 4CLWA 1H73A 1S57A 3G82A 2BYCA 2NYIA 3I0SA 3RBXA 1FNXH 1RT1A 2H4WB 3QJLA 2VUGA 4RO0A 1N0UA 5F8LA 4J37A 1KSPA 1PBUA 4HH1A 4M5DB 4ZVGA 2C22A 1LWFA 1C1CB 2R8GA 3T19A 1FKOA 1I94F 3R7NB 1BWEA 4OZ5A 1CLFA 3DLBA 1FK9B 2XGQA 2JEFA 2FGCA 4TU9A 2IJRA 4ES2A 5ITHA 4LF2A 2RDJA 2CPZA 1NXIA 1HBNA 3C6TA 4CH1A 1WHXA 3AD8C 1RGVA 4BBYA 2HZVA 2UUCF 5FJ4A 3HHLB 1IBKJ 1P1TA 4PXDA 1BQMB 3KJFB 3H90A 3K57A 2EPIA 2OPRB 5AJ3J 2AW0A 4FYVB 2YH1A 1N32J 4YQWA 3TQ1A 1MROA 4LVOP 3IRXB 5F0WA 4J9UE 2AX0A 5K14B 2V9KA 2QMWA 1R8AA 4AL6A 1JNZB 1VK8A 3QT7A 5L46A 1T0TV 2E66A 1X9WA 2GCFA 3NGTA 3LPYA 4TNOA 1JKHB 3PNIA 4NA3A 3IR6B 3MZIA 4CO4A 3DGPA 1T9YA 4TY9A 5HROB 4DUZF 2MKCA 1Y4ZB 2LYVA 3W64A 2KVIA 2VASA 5DJBA 3U1LA 4KB7A 1LW2B 1FDBA 2FYXA 3GJSB 3O44A 5HJYA 5D3GB 4BDPA 2QLFB 2QYGA 3D28A 1IQTA 2L9DA 1TKZA 3ZNJ1 2VONA 5SUHA 5CZXA 2PEBA 4A8YA 1IN0A 2HNYA 3IMQJ 1KBRA 4N5SA 3EUNA 1HHTP 3BDPA 5CYJA 2VQEF 3FGVA 2E44A 3KK1B 5B0CA 3CUNA 3FRYA 1RT6B 2HBYB 3DFEA 2DNKA 2RRAA 1KQGB 4QYZK 2E9RX 1DQ8A 4HT7A 2D69A 1OWXA 4JB8B 1XMOF 1PIEA 1VQSA 2BJEA 2VFUA 1RT7A 2ZBQA 3MFIA 2HW3A 3O2IA 1I6JA 4C3LA 1HWIA 1N5YB 3KLGA 2RD5C 1IR0A 4K0KJ 1U1PA 5HQ8A 4A48A 2O5DA 3JS9A 1REGX 2Z30B 2N4DA 3TUJC 1REVB 4DSEA 2AT1B 2B8PA 4QWBA 3KLHB 1RLDA 1TL3A 3BSOA 4TXSA 5C42A 5J1NA 3QFWA 4DQQA 2ZD1B 2LFVA 4JI3F 1NPPA 2JC1A 2PA8D 3U7JA 1UCNA 4MH8A 3VAFA 3W63A 2BW7A 2Q1LA 5C25B 3DNCA 3PHTA 4HEA9 4ZCIA 3QQCD 3MTKA 2XS7A 1IM4A 4PYAA 1SV5B 2JVRA 4OZ1A 4CO3A 3QZ7A 2W4DA 5CYQB 2QO3A 2PE8A 3H4DA 2ZH2A 2ZH7A 3SCJE 2QMUB 4DV4J 3M8ZA 4LQ9A 2E5LJ 1D3WA 3PYFA 1TR0A 2KXFA 4U95A 2YKQA 4CM2A 3RTVA 2W9CA 3AHPA 1H0HB 1GT8A 1RWXB 3VHQA 5LSLA 4WU2A 1WACA 2FUG9 2HLUA 2HBRB 1Y11A 1T05B 2BOAA 1X4BA 4CP5A 4DN9A 2MLYA 3EX7B 1SKSA 2EFQA 3HPOA 1C1CA 1EZZB 1LWFB 1S9EB 1P6TA 3FBFA 5KG6A 4CM0A 4WFAQ 1NEEA 3RB3A 3PIPQ 4AL5A 1EKRA 3HSGA 5IV3A 2CG4A 1X7VA 1YJNS 3CW2C 4DV5F 4LFBF 1NDKA 3OHBA 3W3SA 4OLOA 3HHLD
chains in the Genus database with same CATH topology
2DIUA 2KRBA 3DYAB 3LGNA 3M8RA 2KO1A 5B0EA 1VQ5S 2POKA 4N8NA 4W92B 4B08A 3T9ZA 2RMLA 3OHAA 4MFBB 1N34F 4NRUA 2WW8A 3R1HA 2V8HA 3OXLA 4DDFA 2PIIA 4C8YA 1E6YB 5B08A 4C11A 2NS1B 1Q8IA 5JVHQ 2HNZB 4H4MB 4NYPA 4ELUA 1TFWA 2ABYA 2CPXA 4Y2CA 2W24A 1H2UX 3F56A 3TYTA 4OI3A 2RRNA 3EZ5A 4ZPTR 1H2VZ 1A6LA 1RT4A 3U1MA 3ZZOA 1HMVB 4FXVA 1DQ9A 3K5LA 1IKWB 2BM0A 3H98A 4CZCA 2VC0A 4I56A 2P5VA 2ZJPQ 2FGOA 3FCHA 4XDCA 3TP2A 4Y2KA 1G2EA 1TK8A 1RK8A 1VQMS 3EGZA 3D0GE 3M6UA 2N82B 1Y7PA 3NNHA 2F1FA 2W8KA 5I3UA 2DGOA 3QLHA 2I8EA 2IFXA 4ICLA 1K73T 4B3OB 3CF5Q 1FXDA 3EGWB 2VBZA 1HI1A 3N5FA 3GILA 1H38A 3GIIA 2HGLA 1T94A 4BC7A 1RA6A 5H9FJ 4KT0C 5GMKa 3GV5B 3WC2A 1S6OA 2CQHA 1URRA 4QIGA 4L6V3 2L08A 1X4AA 1ZOTA 2B3TB 2Z2LA 2QE5A 4I4BA 4XAKA 1KQFB 4A8MP 2GFFA 3GR0A 2CJBA 2BQ3A 2DHGA 2EK1A 4WYWA 5F9LA 3H4BA 3G6YA 5J2QA 5J2PB 4WKRA 3TRGA 3DRXA 3H5XA 5KFHA 2GMHA 2ZDOA 1VRUA 2B6AA 4ZK7M 4ID5A 2VPWB 1SI9A 4K4YA 4CH0S 4HL9A 3SQGB 2C2EA 2HRUA 3OFGA 1N0VC 3OXFA 5GAEI 3DXSX 1S97A 3NBPA 3HKWA 1EETA 3PEJA 3V4IB 5DLFA 2IAJB 4B02A 4LQ3A 3I9V9 1S4FA 3KMQA 2ZITA 4WK3A 2DRBA 2V9WA 4RKUC 1R31A 1UJ4A 2HFZA 3MM8A 4OJGA 4NMLA 4QIVA 5KFZA 2D74B 2AJ0A 4RNHA 5J2MA 2LEAA 3C6UB 4USIA 4HI2A 2V0NA 2DNOA 3C6TB 4WYLA 4OMFG 1PGZA 2K7JA 1FJEB 1X4FA 4EYIB 2HWHA 2IVYA 3NS5A 2AJQA 1ZZFA 1S9EA 2UUBF 4U7CA 1O51A 2WSFC 5M2UA 4PRFA 2YKMB 1TAUA 2JFDA 1GTEA 2WAQD 4LSNA 1JX4A 2ZH3A 2K1RA 3MD1A 1HW8A 5D4OA 4ZPWR 2NREA 3FFIA 4B9LA 2P9CA 2VB6A 3ULHA 1LXJA 2O67A 1Q78A 2VG7B 4NYOA 2HFNA 3JSRA 4PWUA 5D77A 5T7LA 3GB0A 5I3QA 2B9YA 4FXWA 3CJKA 1VIOA 2GMJA 4YFUA 3MMCA 4Q2MA 1BQNB 3TA0A 1F5BA 1V9OA 2BV3A 1F2GA 2BANA 3IXQA 4P7TA 4O44A 1U2FA 3IGVA 2IVFB 3N0VA 1YRTA 2IM0A 2DNPA 2O66A 3VZHA 1VQNS 2XI2A 4EBDA 3V6DA 2W7PA 4ZP6A 1W25A 4J9OA 1XR6A 2YX1A 3MGJA 3P96A 1XNRF 5JUMA 3GIMA 1YJVA 4RBVA 1LWEB 2J0XA 4NLTA 3UD4P 3PKMA 1WHWA 5KFMA 1IBMF 4L3NA 2OAUA 4BWMA 3EZUA 4C7QA 4BC9A 4FVMA 4ITSA 5GADI 2APOA 5F8HA 3BB5A 3TUZC 5JXSA 5KFFA 3CC2S 4C8ZA 1RKIA 2PI4A 4CQ1A 3I96A 3NCRA 3OSPA 4F3QA 3DHWC 5KFTA 1KLMA 2WBMA 2YNGB 2ZC3A 3IC1A 2VKRA 3MMAA 5KFQA 4R5PB 2J6UA 3VQSA 2EWHA 3Q0AA 4P7VA 5B0BA 1L3SA 2QFJA 1B64A 4RBUA 5J2QB 1LXNA 2CZVC 1CPZA 2J9DE 1MU2A 1UEUA 3LO3A 3MMBA 5DDOC 4NLOA 2KXNB 1LK7A 3TOQA 1KD1T 3VCDA 5F8JA 1HD1A 3ITHB 1JJ2R 3THPA 3CT9A 5DDQC 1G7CB 1LW0B 2IM2A 3E01B 4TN2A 3QAUA 5IT4A 2KDOA 4BHQA 4WZMA 4KBIA 3HT3A 1C0TB 1LQ9A 2HQ3A 2L9WA 1MNEA 4QWDA 4NLWA 1HBOA 2QYCA 1SV5A 5AXNA 2GQQA 3WC0A 4WTYA 1HNZF 4YR0A 4LF6F 1KLNA 2KZMA 2XB2D 3RRKA 3BQ2A 4QYRA 3K59A 4DF4A 1GXUA 3DU6A 2OTJS 1EETB 1QLNA 1MU2B 1KHVA 4CIOA 2OH2A 2HHUA 3GYNA 3MM5A 4O3QA 3W2VA 2PN6A 1K1SA 2HFOA 2MJNA 1X9MA 1X4GA 3N5BA 4IH6A 4Y3CA 5FDLB 1VGYA 1HQUA 3TA2A 1UKUA 3PR4A 5HLFA 2E29A 4KKOB 3DDNA 3SYZA 2RSQA 2GGPA 3Q22A 2EG2A 3IAS9 2HNZA 3ZFVA 4PXEA 4CNZA 4ED2A 3V81B 3FZBA 1LOUA 3OW2R 2HVZA 2YWKA 4K59A 4X4OA 2J9CA 1UETA 5KFJA 2I5JB 3RAMA 2K7KA 2D3ZA 4NZ6A 3JAMY 1PILA 4I6YA 4ED0A 2IBOA 2ZZNA 1KONA 4N77A 2B5JA 1MMLA 2MKKA 5FDLA 4IG0B 2J6TA 3KLIA 3K5MA 4NLYA 2ZH6A 1HYSA 3FSIA 3RYLA 3I56S 4OZ0A 2MQQA 2MGZA 3NAIA 2LDIA 3M9OB 1IKYA 4EGLA 4J9NA 1M5KC 3GV7B 3T1YF 4PKDB 1NKEA 1NRKA 3TO8A 3M6VA 2G4BA 4DN0A 3SV3A 1XTZA 3AQOA 2DD8S 2GC8A 1N56A 4WE1A 2ROEA 2UVWA 5EX0A 2HS3A 5J2MB 3HHKA 3FQLA 5B0AA 2H5EA 3NRBA 1HWUA 4A8FA 2GJIA 1VFJA 4YY3F 4RW4A 4IDKB 3DU5A 3DOKA 1RTHB 2OPPA 4X4QA 2ADCA 2UUTA 4ID5B 1C0UA 2J9EA 3ENQA 3M2UA 3TNVA 5CZVA 3Q24A 1VC6A 4LF8F 3MMAB 1R8PA 3AB2B 3HMJG 3OLBA 1HQEB 3TI0A 4ZPVR 4X64F 4RUAA 3GR1A 1RT3A 4I2QA 2NUUG 5E3QA 4I68A 3GG0A 3MM8B 5DGAA 4LF7F 2X51A 4H4KA 2HWTA 1T05A 2DK2A 4RNFA 2KT5A 2FDNA 1J2VA 2P6TA 1RISA 5AXMA 3H25A 1APSA 3BO3A 1FO1A 4RW9A 4CI0B 4ZA1A 3JTOA 2KRRA 3TAQA 4Q45A 3DI6B 1FHTA 1KEKA 2DNLA 3BR9A 1V3ZA 2G13A 2RT3A 4QZVB 2CQ1A 3F41A 3PY8A 3UCGA 4TKTA 2RILA 5DG9A 4OLPA 4YOEA 2F7VA 1U8SA 3MEDA 4MAKA 1AXQA 2QZ8A 5KT5A 4QQBA 1VQKS 2W9BA 2ZD1A 4FNHA 2BJDA 3PV8A 4OI0A 4C97A 4XPEA 3BO2A 1ELOA 3MMJA 4EZ6A 1XMQF 4LMZA 1OO0B 1OSDA 1N6QB 4C11B 2XMJA 3VALA 1CG2A 3RB0A 3HHNB 4FBUA 2HMIB 2XMMA 2RNEA 1NO8A 1X4EA 2HNDA 1DLOA 4G1IA 2K1RB 3HLUA 1S72S 2KH9A 1CSJA 3SZ2A 1L3VA 1BWEA 2CJAA 2VBYA 2UZAA 1S6PB 4USJC 2NSBA 3G86A 3HVAA 3LP1A 4KGMA 2EBGA 3MFHA 2XZWA 4IFVB 4ZCKA 4QBUA 2FHJA 3KK2A 1RT2A 4K0KF 4UW2A 4TU7A 5KG3A 3K0JA 3K5PA 1RYSA 1S1WB 2D1CA 1PC5A 2DH7A 2A10A 2F9JA 3OL8A 3CCMS 1VQ6S 4EFAC 2OKQA 1PC4A 2LCWA 3ZZ0A 1KVIA 4FNIA 4EYHB 2XMTA 1HARA 4XIUA 3MM9A 4QJVA 4DSLA 3KG4A 2FJBB 1WHYA 3DLKB 3LP0B 4WK1A 1XMBA 1TK0A 2XHWA 2HHTA 2MZSA 1MWYA 2MMYA 2MQMA 3GFZA 4NLGA 4NX9A 2D9PA 2IA0A 2IA6A 5GAGU 1KR4A 2R8KA 4KFBA 4DFPA 1TL1A 3PACA 3BR8A 4X2BA 2KFNA 2NUHA 3LAKA 2JWNA 1R8BA 3SDEB 2QA2A 2OSRA 1KTQA 2YQ3A 2B4UA 3NLCA 4J5OA 3QIDA 4D3HA 4C98A 2LXFA 1WEZA 4QW8A 2JDJA 2DGSA 2P9GA 3M8QB 4H4OB 1NK6A 1FA0A 3PHEA 2DGVA 1XNQF 2JLGA 1CVJA 3GQCA 3AJ2A 2WBRA 1D9AA 2FC8A 2OJ3A 2B7BB 3TVYA 2E9ZA 2C3UA 5HMYA 1PO6A 4NZ7A 4EEYA 1C4CA 2HS0A 3O8WA 1ZZNA 4CO5A 1VC5A 1MW7A 1RT2B 2VA3A 1TKTB 1RJJA 3CDEA 1ZYQA 5IXUA 2DNMA 2MZ1A 5KG0A 3MEEB 2B4PA 3OR1B 3MXHP 2BBEA 5E2QA 2IM3A 1Q8BA 4DV7F 4JI4F 4IUFA 5EN1A 3CPWR 5E7OB 4DS5A 1NK7A 1HL6A 4HLBA 3C3LA 2HS4A 2X1GA 3PFEA 4MJKA 1N48A 4R8UA 2CPIA 2UU9F 2EFOA 3O6QA 3PX6A 3JSMA 1LWCB 4DL5A 4HVZA 1XEZA 4A47A 3ENWA 3K8VA 4OX8A 2IJFA 2J7KA 3M6XA 3N4WA 1U6FA 2XMUA 1FDDA 2J7UA 3I9ZA 4U9RA 5F41A 5CA5A 1RTHA 2RQCA 2QEXS 3MPWA 5GVQA 2QV6A 4ECRA 2CQ0A 3F44A 1DARA 5GADU 2E1MC 3GSDA 4FZVA 4HYKA 2CVIA 2HGMA 4GKJF 3ISZA 3PJXA 1K1QA 1FDAA 5F3ZA 2VA2A 2Z4PA 3UQSA 2HQIA 2RF2A 3MUMP 1HBOB 2CPFA 3MI7X 4ZKAA 3PX4A 2IRUA 3V2UC 3FSYA 4LSNB 4ALZA 1TKXA 2MY7A 3MOZA 3M6WA 5CQGA 4N47A 5D3GA 1Q1KA 1UA0A 4KGKA 4ILMA 4YR3A 4DHVA 4ZPCA 4C8NA 1TVRA 2Z2MA 4EBEA 2KYZA 1RT1B 4JUZA 1U48A 4Y28C 2R8HA 3MR6A 1FVQA 4YB6A 2UV8G 4CTAA 2XY6A 3EYZA 5A8RB 3CTRA 1T3NA 1YJWS 1FTRA 4R5PA 1FF2A 2VC1A 1T03A 4ZPDA 2ZFHA 1KLMB 2DNNA 2YNGA 1RKJA 4PPZA 4Y2MA 2ZE2A 2ASDA 4KFBB 5LT5A 4B9NA 4FF3A 4RW6A 4M63A 1F5AA 4X4UA 2AYEA 5IQ6A 5B09A 5JJBA 4NLDA 4J9RA 3G8SA 2XCAA 2AWZA 5KG5A 3K2YA 4F8RA 1YRUA 5KFXA 1JLEB 4GC6A 3TA1A 1Q53A 4IOAQ 1VBXA 5M2RA 4P6QA 4LT6A 1R27B 4DL7A 4PWDB 2DGXA 3S8SA 3I82A 3MM6B 2AGPA 1QSSA 1U49A 1Y5LB 4X4PA 2CQ3A 4OHWA 5LL6d 2DCLA 3KK3A 2KZZA 2KJWA 2WHOA 5M2PA 4LFAF 4Z37A 1YWXA 2IAJA 3UDLA 2U2FA 4B9TA 3I6PA 4MKAA 1IJFB 2BA9A 4ZP9A 2GGPB 3CCES 2V4QA 3UW1A 3OL9A 3MPVA 1O0PA 2ZHBA 2I9SA 2FHKA 4FYDA 3DMJB 2XC9A 2WCXA 4XDDA 2M88A 3MF5A 4O0IA 4G1PA 1R8HA 3CMES 3GIJA 1YITS 3NG8A 4RNNA 2FLNA 2BR0A 2ZJQQ 1LWCA 1OIAA 1WD6A 5KG1A 2DBBA 1RT5B 4K5SA 3MEDB 2HHPA 2ALZA 1OQ6A 2GIRA 1FNMA 4E98A 5HROA 3LGMA 1U6BA 4X4VA 3BM7A 4DUYF 3CJ0A 1JNRB 1D8YA 3DRSA 4ES3A 1NNDA 3IGNA 3IWLA 5A8WA 3MECB 3MPYA 2QSFA 4I7FA 4TY8A 2CPDA 2RQ4A 2DR7A 2GIQA 2EK6A 1X4DA 2VQFF 1DFDA 4IRKA 2XBPA 3T1AA 3LUYA 2JHEA 3MD3A 4DLGA 4DR5F 2PD1A 1R89A 2BE2B 2KN4A 1Q7YT 4M95A 2RH3A 1RDRA 5MAOA 1SXLA 1U1MA 4DS4A 5HBMA 2CJKA 5HI7A 1K0VA 1HNWF 4O3OA 2ERRA 3FMBA 1UP1A 2VKZG 3PM9A 4JBCA 1S1VA 3OL7A 1NB7A 2XI3A 3DRRA 1S6QB 5FLXY 2Z8QA 1FE4A 1JXEA 4HT5A