2HFOA

Crystal structures of the synechocystis photoreceptor slr1694 reveal distinct structural states related to signaling
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
MSLYRLIYSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYELSDNFFLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator of photopigment and puc expression
publication title Crystal structures of the Synechocystis photoreceptor Slr1694 reveal distinct structural states related to signaling.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 45
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hfoA01
1FE0A 3MZIA 1MWZA 2OFHX 3I9ZA 4HH1A 1KQKA 2IYGA 2W4CA 1CC8A 1N5QA 3IWLA 1SQEA 2XMMA 3BM7A 3TRGA 2GFFA 2HLUA 1YJRA 2K2PA 2KT3A 2ACYA 2BJEA 2XMWA 2GV1A 4HL9A 4U9RA 4Y2MA 3CJKA 5A6PA 2LXFA 3BGUA 3KKFA 2ROPA 4NL5A 1QUPA 1N5VA 2RU9A 2LQ9A 2KYZA 5IXUA 1JK9B 2BBEA 1OSDA 2RILA 3DXSX 1KVJA 1Q8BA 3HX9A 4DPOA 2IYIA 2AJ0A 2GGPB 2LDIA 2VV5A 2OD4A 1CC7A 1U7LA 3FRYA 1OQ3A 2VH7A 2G9OA 2FHMA 3HDSA 4HH0A 1W2IA 2ZDOA 4YDXA 4DL0C 1VQYA 2QLXA 1S6OA 2W4DA 1V3ZA 3F44A 3HHLD 2OAUA 4QOTA 1FE4A 3UDCA 2XMTA 5B0AA 5B08A 3LGNA 1ULRA 2N7YA 1X0PA 2K7KA 4HI2A 2RSQA 1K0VA 2LQBA 3T9NA 4OJ3A 3KG1A 1URRA 2GO8A 3TOQA 1SB6A 2ROGA 1R6YA 1Q8LA 2ZDPA 4Y2IA 3BDEA 1X7VA 4FNIA 5B0FA 1Y0HA 1YJVA 3HHLB 3LO3A 2HLTA 3KG0A 1Y9OA 1VQSA 2XMVA 1TUVA 4OJGA 2KKHA 5B0GA 1GXUA 3E8OA 2XMUA 1JWWA 1AW0A 1RJJA 2ROEA 1WD6A 1FVQA 2BYCA 2Q3PA 3LGMA 5B09A 1P8GA 5T7LB 1KVIA 2GA7A 5B0BA 5A6WA 3HHLA 4OJ1A 2AW0A 1Y3KA 3HHLC 2AJ1A 3IWXA 3QGPA 5B0EA 3FMBA 1SI9A 5K9FA 4A46A 1P6TA 4Y2KA 3FGVA 1TZ0A 2GGPA 2HFOA 1AFJA 1N5SA 3WDOA 5T7LA 1GXTA 1OQ6A 2BUNA 2OFGX 1TL4A 4NPOA 3TNVA 2JDJA 3VTIA 4F67A 2OP5A 1OPZA 2OD6A 1CPZA 2CRLA 4A47A 1Q53A 1AFIA 1IUJA 2KT2A 2GCFA 5KAKA 4HI1A 4YEAA 3K7RA 1APSA 3HFKA 2OMOA 2BJDA 3KNGA 1S6UA 1FESA 2FTRA 1YJTA 3GZ7A 1TL5A 2PD1A 2HIQA 1FD8A 1Q4RA 5F0WA 1XBWA 3QMQA 4EFAC 1Y3JA 1N5TA 4A4JA 2K1RB 2XMJA 3MCSA 5F0UA 2PGCA 3DCAA 4DN9A 3BB5A 5B0CA 1MWYA 1X8DA 4OIXA 2HQIA 2AP6A 2L3MA 4OJHA 2OKQA 2IFXA 1YJUA 1YRXA 4ZOSA 1TR0A 2EW9A 2QIFA 2QLWA 2QYCA 4Q2MA 5B0DA 2ASYA 2XMKA 3CJKB 2FB0A 2FIUA 2N4DA 4Q2LA 2K1RA 4FNHA 1FVSA 1LQ9A 3HF5A 4A48A 3BR8A 3BN7A 2K7JA 2N4CA 2RMLA 2W4PA 1FEEA 3BF4A 4ZA1A 1YG0A 2HFNA
chains in the Genus database with same CATH superfamily
3NXZA 1LWEB 3V6JA 4DR1F 2ZH8A 2E9ZA 4ECQA 2FVQA 2RU9A 2ZZTA 3DLEB 2MKJA 3M30A 3NNAA 3G8TA 4B3MJ 2WW8A 4PG7A 4CI0B 3V6DA 4CH0S 4Y00A 2VV5A 3MCOA 2CQIA 2OELA 5HP1B 4WIQA 4YMEA 3QRQA 4FPRA 1RTDB 2WOMB 4C8LA 1N56A 1X5TA 2QGFB 1REVB 1UEVA 2Q1LA 1U6FA 3MEGB 3CD5A 4IG0A 2ZITA 4KGKA 1RDRA 3W60A 2XS2A 3ET6B 3PR5B 3DI6B 1TUVA 4PYDA 2BQUA 4AFFA 1YKWA 2DXFA 1IM6A 4DCJB 3T9ZA 4MFBB 1GTEA 4Y34A 1TZ0A 4J9NA 3T1AA 4RW9A 2VONA 4CLFA 1RTJA 4I64A 3MUTP 1AFIA 4ZVOB 4MYUA 4J9QA 1A9NB 1U49A 2OPRB 1KNZA 1UFLA 5ETSA 1HBUB 4F36A 3JS9A 1XNQF 2HEKA 5KG4A 3D66A 1RWPB 4G65A 1LWCB 1A6LA 2P6TA 2ZJPQ 4LFAJ 1QE1B 3V5RA 3CWJA 4EMDA 3KK2B 1M5PC 1S99A 4LF4J 3CMAS 4C3LA 5BR8J 2F9DA 2ATLA 4NMLA 3JQKA 1HNZF 1NK6A 3ZZ0A 2BKPA 3MEEB 2MKSA 2DNKA 2VHGA 1TFYA 2Y1RI 2AZ3A 4UOGA 3OTEA 4ZVQB 2BJ9A 2HG4A 1XWLA 5A76A 3JQMA 1PJ5A 4NXMF 2CPXA 2XM3A 5KFMA 2EC2A 3DOLA 4CNYA 3NY0A 1DQ9A 4H4OA 3G6VA 4KV8A 4TY8B 1U48A 2RB7A 3UI3A 1UJ5A 4LF7J 4DV5J 5BYQA 3CO9A 1KONA 4AQYF 2OPPB 5DRKA 4ANCA 4YEAA 1QUVA 4KQZA 2YNHB 3OUYB 4XAKA 3EDQB 5CXTA 2VL1A 1UWAA 2U2FA 2VB6A 1QDUB 2HWIA 4OZNA 4EFAC 2MZQA 2XS7A 2FJWA 4KGMA 1HNWJ 1C2PA 4W98A 5KFVA 1PCAA 4F2RA 2AHOB 3OR1A 1RBOB 1BWEA 1FVSA 1X5OA 2DH7A 3QLHB 3DLGB 1LFPA 1DLOA 3AQPA 4ECRA 3BR9A 1AUSL 2XTJP 1EP4B 2Z56B 2MSSA 1F2HA 1VQ8S 3Q89A 1RWWB 2UU9F 1VCTA 5BYRA 2BACA 1R7IA 1XNRJ 1FE4A 2UV8G 3PKYA 3LGNA 1ULRA 1PKUA 3GG1A 3H25A 1BQNB 3HJFA 5DLGA 4ZVUB 2X7IA 1R8HA 1X4BA 4NLRA 4DI6A 1RT4B 1KQGB 1B7FA 2IBOA 1U1KA 3C8YA 1S97A 2GQ2A 2YTCA 2RVJA 1XR5A 1U2FA 2MQMA 3K59A 3H59A 2DH9A 1N33J 2MMYA 4PG4A 4CLWA 2WTFA 2V6AA 5C2CA 1YRXA 5HVGA 1OYDA 2K1RA 1HLWA 2XI3A 4X66J 2B8QA 4WKYA 4AL6A 3HM9A 5KT2A 3K5PA 1ITPA 3DYAA 6FDRA 5KT5A 1BUXA 3ILIA 3DXSX 4DMZA 1U02A 2GIRA 1B0PA 1H98A 3SCIE 4I2PA 2CZ9A 1F9HA 3M6UA 2ABYA 4UY8T 3U1LA 4DQSA 2HBYB 3HO1A 3DOKB 5EWGA 2NQPA 5FDLA 1N6QA 4USMA 4YS2A 4RW7B 1DTQB 3C6UB 1TP7A 2VG6B 3FRZA 4UOCA 4DR6J 3MEDA 1E6VB 2NZCA 4ZK7M 2HNZB 1S0NA 5DDOC 3LOUA 3HXMA 2IDLA 1Y7PA 4QQBA 2Z4PA 4ZVSB 3D2WA 1H38A 4Y65A 3GMGA 3PYEA 1FFWB 1YWXA 1TKDA 2DNLA 1LQ9A 1NSPA 5IM0B 3H90A 2DVIA 3VGSA 3MMAB 3SQOP 1C0TB 2CQ2A 4O3SA 2H54B 2ROPA 2Z2YB 4G1PA 3SSRA 1JKHB 1NSQA 3SI8A 3IBWA 3MCNA 1Q7LB 3WHIA 3RYLA 3EVOA 2W2MP 3TJAA 2IM2A 3ZZTA 2ZH4A 3BV8A 5E3AA 2XY6A 1B64A 3AB4B 3CJQA 1IQZA 1WD6A 3LGMA 4LFCF 3M1VB 3D1QA 2ZC4A 1KLNA 2EKNA 4U96A 4QR2A 2R2SA 1AFJA 3H5YA 4TVAB 1HNVA 2OD6A 2DNYA 4OMFG 5MAOA 2OMOA 3CF5Q 4NYZA 2QE5A 5LSRA 3S01A 2XNRA 4ZMMA 3BB5A 3DGVA 2Z0GA 2XY7A 4DUYJ 4ZOSA 1UL3A 2A0FB 2FB0A 2LQ5A 5D4PA 4CLYA 2P9EA 1R8PA 4RBTA 5EWEA 1QM9A 2XMWA 1M1GA 1TKXB 3BGUA 3IFEA 1NH8A 3W2VB 5DGBA 4WE1B 2AJQA 5DG7A 2ZH3A 5KG7A 4HTIA 4A8XA 4L75A 2QG9B 2B5JA 3VV2B 1K0VA 3K17A 1UTAA 3QFWA 1X7VA 2DHAA 5IQQA 1Y00A 4Q7AA 1RCOB 5T7LB 4FYXB 5GAHI 2Y9HA 4ECZA 5D0GA 4LQ9A 5HO4A 4ZCLA 2W01A 5KAKA 1NK5A 2GIFA 4Y3CA 1X0FA 4F26A 3PIOQ 3CDAA 3FK4A 2BQRA 2WB1D 4KIAA 1Z1ZA 2ACMA 5EUHA 3M9NB 4F25A 3NGTA 3W66A 1YJUA 4X4UA 1S6QA 1AB8A 3GIMA 4DV0J 3CIZA 1XK8A 4A48A 3KHHA 1YG0A 1TUWA 4GKKJ 2YKMA 3BSNA 5GMEA 1RA7A 1UVKA 2XSJB 4B3OA 4O4RA 5JJBA 2BJEA 2YKNA 5HLFA 2G0CA 1UWBB 1Y5LB 2VICA 2R7OA 4RW8B 4B3MF 3O5TB 3M2RB 2RIJA 4RWXA 5IFMA 4CZCA 1FWLA 3CJ5A 3C66A 3M8QA 3HZGA 2CUYA 4JP8A 2UXBJ 1QSYA 1M5VC 4LF2A 1D0EA 4NRTA 3US5A 4PEOA 2EG2A 5A8KB 5ETRA 3GV5B 2HHXA 3GFHA 1H3DA 2RF2B 3QIDA 4ED4A 4Z7YA 3QZ7A 2MYFA 2L41A 2BW7A 2BRKA 2AU0A 2GVZA 4F50A 4LFAF 4PG5A 1TU0B 4FNHA 4A8YA 1VRQC 4LBIA 4BDPA 1NAQA 4LF4F 2GV1A 1PO6A 5BR8F 2E29A 4AD6A 4LUBA 3B54A 1VC5A 4URSA 1XIQA 1URNA 3PV8A 3QSIA 1S1WB 4FXDA 1R8AA 2ZBCA 4K4YA 3DLEA 2YWKA 4DL0C 3U1MA 1UAWA 3W9JA 4PWWA 2D3ZA 4KE5A 3OR2B 5HP1A 3PW2A 1OY8A 1RAEB 2RRAA 3T9NA 2IJRA 2HNDB 1RTDA 2WOMA 2UZAA 3GJRB 4ELVA 1R8CA 4TNOA 1Q86T 4CQ1A 2CFXA 1SC3B 3R6LB 2GAHC 1S1UB 1PJ6A 3G2XA 4MKVA 3H0PA 3ET6A 4ED3A 4LF7F 4DV5F 1AROP 1S10A 3BS9A 1ZM9A 5J2NA 1NHKL 2PI4A 2Y0SD 1RLDA 1L5UA 3IMQJ 3GCXP 5IWAJ 4AE5A 1HNWF 3RB0A 2OPRA 2NLWA 4IFVB 3RB6A 3LP2B 2FY1A 5JVGQ 5CD4H 3GIRA 2LA4A 4RUAA 1RABB 5ETLA 4B9MA 3V81B 3P45B 5IC4B 3QJPA 1QE1A 2JL9A 4EO8A 2EFQA 4E98A 2H5JB 1NDPA 1DZ5A 1YGYA 4ED2A 2YQ3A 3K8VA 4RKUC 2B43A 3ETOA 2BM0A 3LGHA 1XNRF 2XCAA 3I31A 2MPUA 3MEEA 1JLBA 4AT1B 3B8HA 3KLGB 3ZO7A 1HHTP 1X4FA 3TUIC 4ZLNA 2B4OA 4J91A 1N0UA 5D15A 1IBCB 1WG5A 5IT9U 3LAKA 4BWMA 3PM9A 4WP9A 1H74A 2XO6A 2XZTB 1RTHA 1KTQA 3MAHA 3MM8A 3KK3B 2R2TA 1C0UB 1N33F 2ZVSA 4P2MA 2YWHA 4DF4A 2HAFA 2YNHA 1KS2A 1S77D 2NR0A 3SZ2A 2C3YA 2IM1A 2H51B 4X66F 3D3BJ 1OY9A 3R5BA 1XERA 5HBMA 1QLNA 5LSLA 3IN5A 3LWMA 1RAFB 4PYAA 3R7SB 3QLHA 3DLGA 5E3CA 1HMVB 2C3PA 1JK9B 3UQSA 1EIYB 4ID5B 1NJYA 3TZYA 2OH2A 3NGKA 2HZVA 2VQFJ 1SPBP 2N7YA 2XWYA 4TQRA 3BREA 2F63A 2BVZA 2EFPA 5BYSA 5F8JA 2BOAA 1BQNA 2XMUA 4ED8A 4WJBA 1T9TA 4DR6F 1VQ9S 2AJ1A 2BM1A 3IRXB 2ALYB 4DFJA 2AYGA 2DHHA 4NOHA 6AT1B 1S1TB 1RT4A 3SDEB 3L4BC 1KBRA 3KLVA 3KLHB 4TU8A 2V8VA 2AWZA 3MPUB 1W26A 3VAFA 4TKTA 2ZHAA 4CT9A 3MD3A 3CO0P 2CDQA 5AT1B 4IR9A 1ZA2B 4GC7A 3VGTA 1UEUA 4IFYB 3S8SA 4ZLPA 3TZWA 2R7TA 1TELA 4RLEA 3BSCA 4L6V3 1G2EA 2AJ2A 3TA2A 2AF6A 3MM9B 1IQTA 5DS7A 1HNXJ 1DRZA 3UO0A 2OO4A 3BGOP 1S7HA 3CCQS 4N41A 2VBZA 1L3UA 1VHIA 2MZRA 3T5LA 2VD3A 4I56A 4DU7A 5HAOA 1PSDA 3NGRA 2YXLA 3DLHA 2I38A 1VQOS 4FVCA 4RUBA 2PA8D 4WK3A 3M8RA 4Y2KA 4EEYA 1S7IA 4RW7A 1DTQA 3H2VE 2VG6A 1CEZA 2JDJA 2DNNA 3CD6S 4B9UA 1GQEA 3RAMA 3GR1A 1E6VA 5GMDA 3R7NB 3NMRA 2HNZA 2AJFE 3T6BA 3FQKA 4J90A 4I6YA 2Q6CA 1PYTA 4DUYF 1WKKA 1FKPB 2J7UA 2WBRA 3W8PA 3B82A 3NS7B 3Q24A 1XMBA 3I96A 2BKNA 3TX8A 2VPWB 3TANA 1SKWA 4OZ3A 5IM0A 2QEXS 3MMAA 1R89A 1C0TA 5KFUA 2HNYA 1KVJA 1T03A 2OPSB 3MR2A 5DQHA 1JKHA 2Z2LA 1FDBA 3HHLD 2UXDJ 3UDCA 4IO1A 3MI7X 1LWXA 1KR4A 3CDUA 5CABA 1JJCB 5D78A 1WEXA 4IH6A 3KG0A 3QT7A 1AW0A 2DISA 2V9WA 1GMWD 2DGXA 3L09A 3D1OA 2OJ3A 2GW8A 3M1VA 3FDSA 2W8KA 5HN0A 4ZPDA 3VAMA 3EE3A 2HAIA 3C16B 5G0RB 4B9LA 5J2PB 2PMHA 4OHZA 4DLEA 4DV0F 4C8KA 2ADCA 4OV1A 3HF5A 4GKKF 4LF9J 1VQ5S 3L95X 4M63A 5F8GA 5A6PA 1DQ8A 1IR1A 4K4SA 4DL7A 2R7SA 1GT8A 1XJWB 4DV4J 1FJGJ 1RBLA 5KG5A 1RLCL 1NSAA 3N6NA 4N5SA 3W2VA 2M70A 2GC8A 2OEMA 4ETXA 4WE1A 2CQGA 4KH0B 5ETVA 5I42A 1Q81T 1JLCB 2E5JA 2V2ZA 2UXBF 1KOHA 1KFDA 3KOAA 1VQMS 1QY7A 5FLXY 5B09A 5KFSA 1HBOB 3K0JA 1NK0A 3OFFA 2MQNA 3D67A 1VC6A 2P2CB 5T7LA 2C2ZB 3VVUA 2ZOGA 1U6ZA 4OLOA 3QFHA 1K44A 2HIQA 2FZKB 1WDTA 1B3TA 1H7XA 4PPDA 5RUBA 4W92B 1EKRA 4NLSA 1FJEB 3CCUS 2QL7B 1T0TV 4K4UA 4PKDB 3CTRA 4J9MA 2JC0A 3PZPA 5SZTA 2RMLA 2W4PA 8ATCB 1K0TA 1KQFB 4DPTA 3W8GA 3HD1A 3N6MA 3EYZA 2QZ8A 4IOCQ 1N5VA 4G1IA 2JZ5A 2XSJA 1N5YB 3Q2TC 2VFVA 4C97A 1T94A 1UWBA 3CVKA 4RW8A 2RQKA 3TAQA 5DZ6A 3M2RA 4ZVFA 4NLWA 2NS1B 3NOGA 1B99A 2KXFA 5B0FA 3KYLA 4I6WA 2C2RA 1BMQB 4P6QA 2RJZA 4CLKA 1UFWA 3I87A 3D4JA 4N77A 3UD3P 1QVFR 4DSFA 2R42A 2RD5C 3BGRB 4FF3A 1SIWB 1T05B 3W65A 2FHJD 3BQ0A 5IWAF 5A8KA 4FYWB 1FTCA 2B7CB 4AXIA 3RRGA 1PC5A 3BO3A 3PTWA 2L3MA 3TQ1A 7AT1B 1GTHA 1W7WA 2IVFB 2RF2A 2V8DA 1MROB 3PJXA 2IA6A 3CDWA 3TAMA 3CGIA 3C15B 4KFBA 1E6YB 3NGDA 4WPAA 3Q86A 1MMDA 3OTBA 2RRNA 1H72C 3MEKA 3UN5A 2MGZB 4CM0A 2ALZA 3G6YA 5KG2A 3FSXA 3H2LA 1HQUB 2E5IA 1W2IA 3B6BA 3OVSA 2VPYB 3A13A 4DL3A 4U7UK 3G8QA 1HWKA 4UZCA 1S1WA 3H4DA 2A2DA 3GJQB 1RT2B 2DJWA 1HW9A 1UVIA 5HJXA 3KG1A 4TYBA 4ECXA 3Q8RB 1YJVA 3UDVA 4HDGA 3NKYA 3OR2A 2XMVA 1VS3A 3MM5B 2QYGA 2BE9B 2HNDA 4K2JA 4FYDA 1VJQA 3QGGA 3GWCA 4M1KA 3KTQA 3T3FA 3RW7A 3RZAA 1K9MT 1QTNB 1KLMB 3KMQA 3ZZOA 2NXJA 1S1UA 4O44B 3AODA 1CBKA 3I82A 1RAOA 2KHCA 1FESA 5D4NA 4PXBA 4WKRA 3D0HE 2QIFA 4Q2MA 2NXEA 4TU9A 3AD7C 1NLKL 2ASLA 1S5ZA 4KTQA 1VYAA 4IFVA 2P9CA 3LP2A 3PIPQ 4LFBJ 4HACB 3JAMU 4PAAA 3R27A 4NLGA 4DDFA 3V81A 2UUBJ 3MECB 3UDLA 3IGVA 3R2DJ 1S9EB 2VQFF 5GAGI 4MTPA 2M9KA 1R0BG 5C24A 2FZGB 1MU2B 1HHSA 2DY9A 2G0IA 2HS0A 3FBEA 3GQCA 3CCVS 2FVRA 2HVDA 1WC6A 3A12A 4N76A 2H4WB 4HHJA 3OTCA 2Y1JA 5IS2A 1U4BA 2E1RA 2IY5B 2KJVA 1RKIA 3TVZA 4M94A 3I0RB 2ZWOA 2FJXA 2XLJA 4NASA 4E0DA 3KK3A 1WG1A 1PYSB 4TLQA 3THVA 1TR0A 4ZPAA 4USIA 2FLPA 3Q23A 5J1PA 1X5PA 5KTQA 3V4MA 2WBMA 3PW4A 1RZMA 3KDNA 5K8NA 3FCWA 4OI0A 1QUPA 3MPVA 1TMJA 3ZC4A 1HPZB 4OV6A 1BE4A 4ZKAA 2R8GA 5GAHU 1HNXF 1CLFA 2PMWA 1HL6A 2NPFA 3JTNA 3AFGA 4ID5A 4HHHA 3FVYA 2HZCA 3Q8QB 2BDPA 5F8HA 2J9CA 2YQ0A 3LH2S 4P52A 3E8OA 2DNRA 5DQIA 1O5JA 3KJFB 2RKIB 1SI9A 5DG8A 5ETMA 3ULHA 3ENAA 1TL3A 2CRLA 4LQ3A 3IRXA 3OL6A 1S1TA 3SDEA 1MG7A 3RU0A 5MLCV 3PFOA 2PGCA 2ZUAA 1X8DA 2QA4G 2W9BB 3VZIA 1NNDA 3NWGA 3KLHA 2IIHA 2W9CA 2XLKA 3M8PB 1NB2A 1F5AA 2LKZA 1FA0A 1YK9A 4HH1A 1S79A 2DY1A 2HFZA 4DX7A 5JUMA 1F3FA 1U1MA 3NOCA 5AXLA 3TEHB 1RWMB 5T14A 2HHQA 2XLIA 4LSLB 1SH3A 4ALZA 2PE8A 1VIOA 4LRDA 4IFYA 2UXDF 3LF0A 5F8NA 1ZA1B 2CJAA 3TR5A 1T11A 3MM9A 2PMZD 2BA9A 4BCAA 2YX4A 5CQGA 2JH3A 2MQ8A 5L38A 1U26A 4Y0FA 1M0SA 4C8ZA 2G0JA 3QAEA 3NS5A 4J9SA 4C0HA 1RT6B 2KTQA 3VWSA 3U7JA 2R8KA 1RBAA 2G13A 3JAMY 1KSPA 2YKAA 1OY6A 2VG5B 2F8HA 3UR0A 4ZPBA 4HT7A 2JLEA 4ZP6A 1HI8A 2C22A 2VDIA 4C3MA 2A18A 3L7UA 1F9FA 4P74A 2CG8A 4LF9F 1JLEA 1T02A 1MWZA 2VFTA 1FKPA 2C3MA 4DFMA 2BABA 2DEIA 3UWTA 4QPTA 2KI2A 4DV4F 3NCQA 3EGVA 1FJGF 1EZZB 3BQ2A 4RU2A 4HLBA 1G6BA 3MTKA 3BYPA 2OPSA 4H54A 5AE1A 1VLYA 3A3PB 5KFPA 4ELUA 3RJMB 2K8GA 4J9RA 4C8NA 1Q16B 2PN6A 2X51A 5JMNA 4CM2A 1HBMB 1FRHA 1B0TA 4ZLJA 2XNQA 4PQUA 1OQ6A 1NJWA 2WW4A 1GAOA 3FFIB 3MUMP 4I1TA 4F3QA 3I9V9 1DQAA 1CJVB 1IKXB 2UVWA 4M5DB 1WEYA 1KWMA 4KH1B 4D3HA 2QA2A 2EPIA 4LSZB 3PW0A 4O3OA 4OYZA 2YY3A 2RHQB 3C16A 2XI2A 3RGIA 4DZ6A 5G0RA 4RBVA 1FJCA 3GB0A 5HMXA 3CIMA 5K14B 2HWHA 1WF2A 3SQGA 3VAHA 3QJLA 4ED6A 1VBZA 2LQJA 1U1PA 2D9OA 4YDDB 3FRYA 3MR7A 2R7RA 2QV6A 4LSNB 2OI2A 2B0GA 1MN9A 2GQQA 3KLFB 3IA0A 4DOZA 4KY3A 1NK8A 1HW8A 3N5FA 1OSCA 1AZSA 4FBTA 4L72B 3L9ZA 4OJGA 2XGQA 1ZAXA 4ETZA 2HIYA 3PYGA 2WVBA 4DSLA 1WNEA 4ILLA 2CWKA 1PIEA 3W2WA 1S1VA 4JV1A 3SIPB 1HBOA 1Z2ZA 4NMXA 2DK2A 1Q79A 1RAHB 2Q79A 3W5YA 2BJDA 1WF0A 4C2MA 4TYAA 1U09A 2UV8A 1R8BA 1N0VC 1XQIA 2A10A 2IRYA 4USTA 3H40A 4OJHA 3IRWP 3M2VB 2IVYA 4Q2LA 1EB0A 1S49A 4DV6J 1YRTA 4JBCA 4WK1A 4OZLA 2E1AA 4WU2A 5HMWA 1M90T 2N82B 4TXSA 5D77A 3LALA 2LFVA 3SSSA 2AJ0A 1LEOA 4PCQA 2JX2A 4KPCA 2RHSB 4IYQA 1NJIT 1FFGB 2F8EX 3W9HA 2MKYA 4DN0A 2XHCA 3G6ES 1NCLA 1F3VA 1JNRB 3WC2A 4ES3A 4CRJA 5A0YA 2W9AA 3G71S 1K1QA 4RBUA 4CDIA 4L73A 5C7PA 5B0EA 1HWUA 1VJWA 3M8YA 1IJFB 3AA8A 5CYJA 4IR1A 3OPKA 4I67A 1R31A 4B9SA 3U02A 3GZ7A 2B9YA 2NUUG 3PEJA 1HYSB 4ED0A 2DD8S 3BGRA 4H4MB 1ZAWA 4Y2AA 4NLTA 3Q8SB 2XEXA 1SH2A 4DR5J 2K7JA 3CSKA 2HBZB 4LFBF 4IRKA 1MROA 5HSPA 4JI1J 3C15A 1E6YA 2E1PA 2UUBF 1F6TA 1SQFA 1FXDA 4TY9A 4M95A 2ZJQQ 2RQ4A 1JNZB 3ZZZA 2MGZA 2Q6BA 2QLXA 4QIWD 4ZJOA 3W5ZA 1IWAA 1HQUA 1PBUA 2QFIA 1V3RA 3P8BB 4ZCKA 2JC1A 1M1HA 2B6AA 1RT2A 3QT6A 3RTVA 4GKJJ 2DIVA 1JWWA 4PXCA 4MIWA 4DR3J 2V4QA 3FJ2A 2ATCB 3CJRA 4KHPJ 5F8IA 5K9FA 3IWXA 3M4XA 4M5GA 3MM5A 4QIGA 2J0QD 4RNNA 3K57A 2UP1A 4WTYA 2NSCA 3TVKA 1KLMA 2WVCA 1YDLA 1UA0A 4O44A 1X9SA 1UKUA 5F8MA 5KOXA 3KJNB 1QAIA 1HI0P 2XYGB 2EW9A 5D0EA 3QNWB 3VCDA 3E3XA 3I9ZA 3G96A 2VKZG 3ZTPA 1RHMB 3DU6A 2HLUA 4ES2A 2PFFB 3UDEA 2YQ1A 3C2PA 3BZQA 3TVYA 3U1NA 3ITHB 3CCES 3FCVA 3CMES 1UZHA 4CH7A 4HACA 2VC1A 1U7LA 3I5AA 2NXUA 3AB2B 4Q8EA 4NLPA 2F40A 4K8RA 3SBMA 3TOQA 2NYIA 3D6HB 1S9EA 2AJ4A 3BKFA 1ZZFA 3RB4A 5KFXA 2AMCB 3UE2A 2C42A 1DBDA 1MU2A 2GS8A 1VRUB 2GGPA 2QLFB 4C0BA 1JLFB 3LPYA 2KU7A 3GSDA 3IR5B 1CQNA 3AY0A 5ITHA 2XGPA 3CUNA 2YPYA 4EWTA 3QSYB 3CJ0A 3BBCA 3BPDA 4OL8A 3AOAA 1MWYA 1SBRA 4IQXA 3I0RA 1VQ4S 5B0DA 4I2PB 2EVZA 2ZHBA 2FC9A 3KFWX 4XPEA 2KG1A 4OYOA 4ES1A 3FEZA 4RNOA 1WJ9A 2N3LA 2AYMA 1WC0A 3L3CA 1IKYB 1U2RA 5JVHQ 3R5GA 1FDDA 1DFDA 3Q8PB 4A8QA 1HPZA 1HNIB 3AH6A 2XWXA 1FDAA 1UP1A 2K7KA 5GADI 3VR1A 2WSEC 1SB6A 3PRBA 3QYYA 2YKOA 2ZBQA 2QT7A 5AE3A 1VI7A 3ZZRA 1R0AB 5ETPA 3HULA 1B4SA 3FKBA 1JJ4A 2JRSA 2MQLA 4QWEA 2GNKA 1F2GA 2WVEA 1N34J 1VQ6S 4YB7A 2RKIA 1IXKA 4M5IA 2JFDA 3KK1B 1LNQA 4WYLA 4X65J 4F8RA 4G1QA 3DNCA 2R2UA 1UZDA 4GO7X 2WSCC 1U8SA 2OKQA 4ED1A 1NBEB 2FIUA 2FQQB 1N54B 2O66A 4J9VA 3NL0A 2RAQA 4M5NA 2J0XA 1QVGR 2W9BA 4CO3A 1WI6A 3M8PA 2X3DA 3OL8A 2BKOA 2CAJA 4IH7A 2BANB 3QBCA 4ZIWA 1FCAA 1FRMA 4IH5A 1HNVB 5DDQC 4K59A 4LIRA 3V6KA 4DFPA 3I6PA 1YSJA 2QA1A 2X1AA 2MHNA 4IKAA 5F9LA 5KFJA 4ZVPB 3BSAA 4LIWA 2M7SA 3LUYA 4KGZB 2GA7A 4NA3A 3MAQA 1U1NA 1Q78A 2L08A 2QC3A 4FPIA 4XDCA 2CPIA 4F67A 3RBDA 1B70B 4S0MA 1RT7B 2KXNB 2GMJA 1KKHA 4X4OA 1Q4RA 2P5VA 3IXQA 4NXNJ 4CO1A 3GR0A 4TU7A 3KUEA 2O1PA 2E7VA 2VG5A 3OXLA 4OHWA 3KJVB 2XMMA 3P5BP 1SV5A 5ETOA 1VQNS 2HGMA 3MFIA 2NREA 1JLGA 3X3UA 3DM2B 2CJXB 5HQ8A 2QO3A 2BJ1A 2IJNA 2BJ3A 2XMTA 3CJ3A 5LXYA 1C1BB 1WSVA 1N52B 4Y2IA 3GYNA 3F41A 5IT4A 5KFOA 2XC9A 4UTGA 2FUG9 3QRRA 2JEFA 2OMLA 2E66A 2C2KB 4OYMA 2FJAB 4GMKA 5DDRC 4JI4J 4CWBA 2YKMB 3A8EA 3ISNC 2HRTA 3IBFB 1HBMA 2KYXA 3IM8A 1RTIB 1SQGA 1O0PA 2VFRA 5E5NA 1RGVA 4Z7CA 3C19A 5KG3A 3FFIA 3R5DA 2IRUA 1U1OA 4YR2A 4FYVB 1CJVA 1IKXA 1RHJB 4M5DA 1CG2A 2VA3A 4LRBA 4ZA1A 3P6YC 4DV6F 4P72A 3D68A 3GLJA 5GAGU 1RHKB 1SH0A 1BGXT 4HT5A 2PT0A 4ENOA 5KG6A 1OWXA 3EPIA 5KOWA 5K14A 3M8WA 3GONA 2R4FA 3VZHA 1KEKA 2EI5A 3B4MA 3J7YU 2CNKB 4WFAQ 4KBIA 3H8YA 3CB4A 4C11B 5HROB 4C8MA 4F7VA 3KLFA 2AX0A 4QIFA 2LQ8A 3PYFA 5DDPC 2GX8A 3M2UB 4BC7A 4F0HA 2E1MC 1EHWA 3KXDA 1YX2A 3EPGA 2FJDB 3KWMA 4UQGA 3HFKA 4K50A 1V3SA 1FD8A 3GV8B 1IM4A 1MW7A 2ZH7A 5EGYA 2AEFA 4PXDA 3FZBA 4DR5F 2AZ1A 3FZ2A 2DTJA 1KHWA 3M2VA 1X4HA 3IAM9 4JI1F 3HLUA 1WOOA 3G4SS 2CWXA 5HATA 2EBEA 2RRBA 4NLOA 4Q0BB 4WFZA 4ZCMA 2V67A 4RJVA 4ECYA 3HDSA 5ADZA 2V8HA 4F04B 5J2NB 2DYAA 2UUTA 3PJWA 1S6PB 4NZ7A 4FVMA 1WSRA 2HLTA 4L74A 4GKJF 1G3OA 2DNGA 3U27A 4DR3F 1BD6A 5KFWA 5ETKA 1TL7A 2HWTA 3IBCB 2R7UA 4DSEA 4JV2A 4KHPF 5IV3A 4RWWA 1EETB 2VFUA 2LU1A 2FPHX 4B3SJ 2CQHA 4KYZA 1RACB 2R8JA 4O3NA 4ZDNA 4NE9C 2VF3A 4NLUA 3UNYA 3NCPA 1JMTA 1B0VA 1NZAA 1QAXA 5HL7Q 5KFNA 1HYSA 4H4MA 3FBBA 1JLBB 2N4CA 2ZH5A 4W90B 3PFEA 2W4CA 2AGOA 3CT9A 2E9TA 3HVAA 1FX4A 3FNNA 2DNPA 3HMJG 4IUFA 3GILA 5GVQA 5J1EB 2DRDA 1RTHB 3MM8B 3CD7A 3G82B 2KL8A 2HK3A 2E9RX 3GCWP 4DFKA 3PG9A 1Q8LA 1ZOTA 4MJKA 3MF5A 1YRUA 3K5NA 1Q0NA 2KN4A 3QATA 1FNXH 1J5OB 3D28A 3ZZUA 5B0BA 4CO5A 1LK7A 4WP8A 4OI1A 1N88A 4O0NA 5HBMB 5C42A 3EMTA 4DV2J 2N7CA 4BBYA 4QW8A 1T9YA 3NCRA 5D4LA 3J81Y 2XBPA 3EZOA 3ZFVA 1FEHA 3I32A 2PEHA 2AKWB 4AL5A 4ZLLA 3WX4A 4I7FB 3PCOB 2CQ4A 4EBDA 3UR3C 3KHLA 4LRFA 4K0KJ 2K2PA 3MAAB 2ACYA 4ZVGA 4QWAA 1UVNA 1CC7A 3ENVA 4PABA 5L1IA 1HQEA 3SYZA 1PAEX 3ITHA 4I69A 4YY3J 1PILA 2DBBA 3OL9A 1SKRA 3WBZA 1I5OB 4ZPTR 2G4BA 4DXLA 2MKCA 4X4SA 1TKZB 4X4QA 1QSLA 3IR6B 2PSZA 1I51B 2XS5A 2OEKA 4HHUA 3MR6A 3C46A 4WIIA 1SKSA 2RQMA 1ZZNA 1N34F 2I8EA 2ZD1B 4YR3A 4ILRA 4OLPA 1NZ8A 1NPPA 4P7TA 1GNKA 1UVMA 1VRUA 2E44A 2FTRA 1JLFA 4DR4J 1HHQA 5F0WA 1FF2A 4X65F 1NDLA 4NWBA 4CIOA 2PI5A 4RZRA 3DCAA 3G9CA 2M5YA 1F0XA 4DX8H 1LW2B 1SUQB 2VBWA 4FZVA 1ZTTA 1H2VZ 1P27B 5KG1A 1WKLA 2CJKA 1SC1B 2CJQA 2GJIA 4EK2A 4A8KA 1LXNA 1IBMJ 2UUAJ 4LRAA 1DURA 2PFDA 3T5HA 3A3NB 1OQ3A 4B9TA 1RHQB 1IKYA 1L3TA 3ZTOA 3THTA 2Z57B 1UEKA 3QWUA 3P96A 3BYRA 1HNIA 4K5RA 3EM1A 4LF6J 3ETMA 1C4CA 5M2UA 5IC6B 2ZWPA 3FMBA 3DRRB 3KLEB 1R0AA 3BN4A 1WELA 3D9BA 1D3WA 4C48A 3MM6B 2HBQB 3FMWA 1MWQA 5KFHA 2J76E 2JLFA 2F65A 3PHEA 1RA6A 2HNYB 1Q1KA 1T03B 4NXNF 2XMJA 1NKEA 4TQSA 2H3EB 5L9XA 5LT5A 2FZCB 4QR0A 1O6XA 1IBLJ 3KK1A 4A8SA 1VRTB 1TVRB 2LEBA 2J6TA 1KDNA 1F9EB 2UUWA 2MZ1A 1K1SA 3MFHA 2CQBA 2WB4A 4WZMA 2GFFA 2BW2A 3OFGA 3ZXWA 3IAS9 2JEIA 5FJ4A 5HVFA 2B7BB 1SL0A 1HWIA 1EQMA 4QIVA 2MLZA 2FHOB 4LMZA 4QPXA 4B08A 2EG1A 2XYHB 2BANA 3FQLA 5F8LA 3BJYA 1N48A 4DX5A 3T5JA 1XR6A 5L9NA 2ZKTA 3H2UB 4J37A 4OHVA 3BKUA 2JEGA 1I6JA 3O3LA 1AUDA 1IBKJ 1ZS6A 3OFHA 4JI4F 4JI2J 4DU8A 1P6TA 3E2EA 4LBPA 4USUA 2E5GA 1OPZA 2CQ0A 1HFEL 1RT7A 1NDCA 5DM6Q 1KFSA 3DLJA 2V68A 3VVTA 2HS4A 3IS9A 5I3QA 2ZBRA 2UVUA 4Q8FA 3BBBA 5I42B 4ZPVR 4YB1P 2ZKUA 1MSWD 4DSKA 3RBEA 3GIKA 3KJVA 4X4VA 2QMUB 1T9UA 3LPEA 2M8DB 3CJTA 3S7RA 3IG1B 4DX6A 1RAAB 2HVEA 3OT9A 1T8EA 4N8OA 2YNIB 4Q43A 3D1HA 3PKMA 1HKAA 2DO4A 3BEGB 1UPPA 3DM2A 2HVZA 4ECTA 1C1BA 1VQSA 4G3IA 2L48A 3H7HB 1FVQA 1P8GA 3H4BA 1VOMA 1TAQA 2RT3A 2NCKL 4A8FA 4PRFA 4K4ZA 2QJ3A 3DHWC 3WX8A 2POKA 1IVZA 5CYMA 4TLRA 3TO8A 3M32A 1VQLS 4G6VB 4U8YA 1RTIA 4A4JA 2EEYA 2AP6A 4RW6B 1U1LA 2V94A 4EBCA 3NRBA 5HVHA 5E41A 4FKXA 2YKPA 5KFCA 1GMWA 2HZAA 3KKFA 3OXGA 1NEEA 4ECUA 2AGQA 4OZ5A 5LJ3Y 3VAJA 3C6TB 3H98A 2VH7A 2A1BA 2W2NP 5EX3A 2PO4A 5B08A 1D9AA 4O3RA 2ZNZA 2QL9B 3GFXA 1URRA 1XEZA 2HQDA 2WVDA 3LAMA 4J9OA 1N32J 1VMBA 4ZPCA 2HVHA 4NEYA 4C11A 1NXIA 3TAMB 4DL2A 5HROA 3H5XA 4KFBB 4DHVA 3J7A1 2DNZA 5D6GA 4LR8A 2CZ4A 4B3SF 1O51A 4ID8A 1FDNA 1YITS 4OHYA 1XN9A 1TK5A 2ZM6J 2KT2A 3M2UA 3KNGA 1K47A 4ZHRB 2DNQA 2C28A 3F56A 1EAYC 2B3TB 2HQGA 2YNGA 4PG6A 4MK7A 2FDNA 2MY8A 1U8WA 1IR0A 2Z2MA 3OSPA 3N0VA 1VK3A 2LXFA 5GADU 1BQXA 2HFVA 4LT6A 3CCSS 1EKSA 5H9EJ 3RUBL 5GAEU 1AT1B 1D1UA 1NSKL 1NKCA 5HMYA 1P1TA 1JX4A 2J8AA 5KFZA 1CULB 4FF2A 4DSJA 3HHEA 3W62A 4X4TA 4Q0BA 1IR2A 1D09B 4I0WA 1J2VA 3V2UC 5K8PA 1GH8A 3V4IA 4CLSA 5IZHA 1RT1B 3GFZA 1S6PA 2EK6A 1CSJA 3H5UA 1UJ6A 3AXMA 2XZWA 4PUOA 2V5HG 2KFYA 4RX6A 5H9EK 2R9LA 4W4MA 3T19A 2D69A 4DV2F 3NWRA 2G2OA 3ISZA 5HK4A 5M2RA 3MR3A 1EETA 5E2QA 2GCFA 4XPCA 4LVNP 4YHHJ 1X31C 3OLAA 5F0UA 4DWIA 2YPZA 3NGSA 5C25B 2GHVC 3BQ1A 3OD2A 5CZVA 3R1HA 2GAGC 1LV5A 1S4EA 3BF4A 2H5IB 3UN3A 2CQDA 2OFHX 4K0KF 2O3DA 1CC8A 3R3TA 3VF0B 5C24B 1WHVA 3CDBA 3M6VA 2EFVA 2J6UA 3P4UB 3CDEA 4KO0B 1S72S 3TZXA 4QYZJ 1RCXB 2ZFHA 4HDHA 4QU7A 2V4RA 4YY3F 3HSDA 5CD4A 5J1EA 3BKTA 1J27A 2NPIA 1RT5B 3G82A 2F4FA 2UVVA 2FVSA 4JOUA 3GYGA 2HS3A 3FGVA 5LSOA 5J2QB 5AXMA 1J5OA 2Y3YA 3N9UC 4P71A 3DKDA 4RNFA 4N56A 3QIPB 3RAQA 1Q53A 4I68A 3EICA 4DR4F 2DR9A 1IKWA 1RSCA 3PEHA 8AT1B 2ZC3A 3UD5A 2IYGA 3PVXA 1IBMF 2UUAF 1ZM4A 5M2PA 2KT3A 4I7FA 1DY3A 2ADBA 3PW5A 3HP6A 3CCRS 4OYPA 3VALA 1BC6A 4OI3A 1H2TZ 3MAAA 4FYYB 8RUCA 5KFEA 3W61A 1TL3B 2PEBA 4R8UB 2L9DA 2U1AA 5BXIA 3TA0A 1M5HA 2DIUA 2KRBA 3SXLA 3SFGA 4LF6F 3NNHA 2FY8A 4F4YA 1TKZA 1J5EJ 4RR5A 2L9WA 2ZOFA 5A6WA 2W9CB 2O5DA 1X4GA 2IMWP 3M05A 3AXKA 1LW0B 3W64A 1JJHA 4HI1A 1Q82T 1VHFA 4PWUA 4C8YA 2ZD1A 1KQSR 1RXOB 3HCXA 2CDRB 3TUZC 2HHPA 1GEHA 1IBLF 3OXFA 2B51A 1FRXA 4CNZA 3NNCA 4IO9Q 4KB7A 1BLUA 4WZQA 1UW4A 1S0OA 1LW2A 1SUQA 2WK4A 5D8HB 3HJVA 2YWFA 2ZOMA 2Y8YA 3ONQA 3K5MA 1S0MA 4PR6A 2CPDA 3GV7B 2A6MA 1ELOA 1FNMA 1NM2A 3VQSA 1UA1A 1Q5VA 1TK8A 3EUNA 3HFVA 4CLUA 4EYIB 3TZZA 4ERDA 3C3LA 1OO0B 1FI4A 1QD1A 2BYCA 1IBKF 4B3RJ 3HK2A 2Z2ZA 4CLPA 4JI2F 5L1JA 1JLEB 5LXRA 1RWVB 2JSXA 2ZH6A 3W5XA 3DRRA 3KLEA 4Y28C 4UOHA 3HPOA 2YH1A 2YX1A 1Q95G 3PRDA 3MM6A 2V9KA 1TQLA 1WI8A 4DL4A 2FVPA 5IT9Y 3J7AN 1VRTA 1TVRA 2HQFA 3MUVP 4BWJA 1WC3A 1WOPA 4Y6IA 3AOCA 3W7BA 2IYIA 4EZ6A 2VPXB 4HH0A 4PQUB 1RB0A 1QAYA 3PX4A 1JLAB 3V6HA 3I0SA 4MYTA 2GMLA 2AYEA 3W3SA 3PNIA 5LL6d 4K4TA 3ZTSA 4DV3J 2WCXA 3QGIA 1M5OC 3QGHA 4QR1A 4MH8A 1JXVA 1JXEA 4JV0A 7FDRA 5E33A 3MPWA 5KFIA 2MXYA 3MR5A 3G6XA 2OSRA 5F41A 3EGZA 3SFUA 3NP5A 2K06A 1VDHA 1Q8IA 2OP5A 4NI2A 2P8IA 1OJ4A 3SQGB 3JSBA 2QSWA 2BR0A 4ZP8A 2JHEA 4OX6A 5L8RC 4USKA 1RWXB 3MTJA 2HMIB 2P6SA 4DL6A 2Z30B 1AZSB 1WUUA 4KHRA 3A4TA 4ITSA 3AD9C 1YJWS 5CAAA 1FD2A 3VGUA 3MM7B 1Y11A 3VGVA 2W2PP 2BBEA 4QW9A 4DZDA 4OHXA 3MMJA 3HSGA 3W2WB 1S1VB 4NYOA 3LANA 4RL1A 1JIHA 4OZ2A 2E5LJ 5B0AA 4QCLA 3IG1A 3IM9A 4MK9A 2YNIA 5CYQA 3CULA 2WVFA 1N32F 2CVEA 2M52A 4NLQA 4ZJLA 4KKOB 2HHVA 3I56S 4Y2CA 4YUDA 4ZJQA 1LOUA 2J8SA 4R0EA 1GXLA 4V1Ak 4JB8B 4NPOA 2ZM6F 3ILJA 1NUEA 1Y4ZB 4DQQA 4CLTA 2EFGA 3W1YC 4LR7A 2Z58B 3OQ2A 2VG7A 5D4OA 1R3NA 2ZNYA 5KG0A 4RW6A 4JI6J 1FK9B 1EX8A 1UW9A 5A0YB 2XCPA 3RRHA 3RR8A 1RYRA 3PY8A 2MQOA 1NHVA 2WONA 2RS8A 1OSDA 4EBEA 2IRXA 3KLIB 4R25A 1K8AT 1V3ZA 1ZYQA 2MKIA 3ENQA 3HHDA 3C6TA 4AUKA 1X0PA 3R6GB 4HI2A 3D3CJ 2ZDPA 2AD9A 4FNIA 3R8YA 4IOBA 2D41A 1MMNA 2KHDA 3PJ9A 4KRWA 3J7Z5 5KFQA 2XULA 3BO2A 4XDDA 4B17A 3CC2S 2ZUGA 4DPUA 2OSQA 4ED7A 3P5TL 1N36J 1CPZA 3CEDA 2W7AA 4YB6A 4YHHF 4P7VA 1X9WA 2DO0A 1TL5A 2DT9A 2BE7D 2GJFA 1TTHB 3O44A 2UVRA 2GZOA 2VA2A 2KT5A 3PX6A 4U67Q 2FLNA 1JB0C 4J7CA 1R0CB 1NU4A 4ZHRA 4ICLB 1SL2A 1TKTA 2Y0BB 5KFAA 5A8WA 3MGJA 2EBGA 3SSQA 1H73A 2MKKA 4MKAA 2B6AB 4J9LA 1U0HB 4ANEA 1SJFA 4OX7A 3T6JA 3SCLE 3A8IA 3I5BA 2Q66A 4RNMA 2IM0A 2FJBB 4NZ6A 4ZN3A 2I0XA 2IAJB 1SJ1A 2EWHA 1V6HA 1NDKA 3TP2A 3QO9B 5H9FJ 2OHDA 4FXVA 5KT6A 1HA1A 5J2MB 1H0HB 1SIZA 4JI3J 4J9PA 4EO6A 2L9NA 2O01C 1NRKA 1CULA 4NLXA 1ZM2A 2KFZA 2JEJA 1D8ZA 2RS2A 4B9NA 5B0GA 2ROEA 3GG0A 1RHRB 4B02A 2CPJA 2IHR1 2QLJB 1PGZA 3Q83A 5KFLA 1RT1A 2F7VA 4YOEA 1VBYA 2BJ7A 4KPYA 3P49B 2J9EA 1U1RA 4YB5A 5H9FK 3D7SB 3GJSB 1S76D 1IWGA 3MOZA 3JYTB 2DGQA 5KFTA 5F3TA 5L1LA 5EX0A 4QU6A 1L3KA 5C25A 2HURA 4A8MP 3BM7A 2VJUA 4U9RA 3GJTB 2CPYA 2WRMA 1YJNS 2CNLB 3JSMA 2VOOA 2GGPB 5FIIA 4IDKA 4E8UA 4OFZA 4MIAA 4KO0A 2AGPA 1R6VA 4U95A 1Y5IB 3J7YI 4WFXA 1Q7YT 1G1XA 2C2MB 2EK1A 3UFCX 5AJ3J 1HWJA 2AX1A 4NX9A 2OTLS 5E3PA 2FJVA 4GRSA 3RW6A 2KKHA 3GFYA 2JNJA 1J5EF 1PYOB 5CA5A 5KFFA 4NZ0A 3TARA 1RT5A 5CCLA 3QGPA 2IJFA 3QT5A 4K4XA 4DV1J 2MQPA 4DQPA 4AL7A 4KT0C 3LP1B 1SKUB 4A47A 3DFEA 1P1LA 2RE1A 4BHQA 5J2QA 1D9DA 4LVOP 2DR8A 3A3OB 4WYWA 3SEOA 4OX8A 1VBKA 3N28A 3GYXB 3QIPA 4DPWA 5DLFA 3W9IA 4B9VA 2QYCA 4URGA 3A1YG 1SC6A 3CJKB 2BRLA 4JUZA 1U45A 1C1CB 3K58A 3O6QA 3UW1A 1KP6A 2DH8A 2OPQB 1FHTA 2HHTA 4WTOB 4XIUA 2F9JA 2UUCJ 4CYUB 1DAXA 4X64J 4ANDA 4ZP9A 3PXGa 3ZZPA 2OAUA 4WF9Q 4JI0J 4ZS6A 1NH7A 2IM3A 1UVLA 1IKVB 4G1QB 4R8UA 1FRKA 3RAXA 4DPXA 1DTTB 4B3RF 1VLOA 3NG8A 5U47A 3PYDA 2PDAA 4RNHA 1VGYA 3ZTRA 4U8VA 3T5KA 2VKRA 1LW0A 2WAQD 2MLXA 3Q8YA 2YX7A 1DJ0A 1FX2A 1FXRA 1WF1A 4H4KC 3QAUA 4CLLA 4HR2A 1RKJA 4DG1B 1CJKB 2MZJA 3CJ8A 2J0SD 1KQKA 1IJEB 5I3UB 1GX5A 1FERA 3I4HX 3BSOA 2B56A 4DPYA 2AYBA 4ED5A 3MMCB 5CH7B 3IC1A 5F9NA 2I1RA 4PWDB 3HSZA 5LJ5Y 1HR0J 3I4PA 1LWEA 1S0VA 1YJ7A 4DV3F 3LA0A 3DN9A 2XMAA 2VFSA 3LTOA 5CHCB 4NLDA 1NK4A 4Z37A 4N47A 4EZ9A 4F0MA 1SV5B 3X1LB 3DLLQ 4I4BA 1REVA 3KDOA 2B9WA 2CQ3A 2AQ4A 3CCMS 1TL1B 3MEGA 3CPWR 5K20B 3MCSA 1JLGB 3FUYA 3GU0A 3DI6A 3G8SA 1RAIB 2MY7A 3Q8UA 2ASYA 4CO0A 3MOJB 3HI9A 5AXNA 4MFBA 1BQMB 4LF1A 3BR8A 1F5BA 1FJ7A 3FBCA 4L3KA 2R7VA 2B4UA 3OVAA 2D3UA 1VQ7S 2BEFA 4I2QB 9RUBA 1YJ9S 1HBUA 2OEJA 4NLYA 3TA1A 4FF1A 1N4LA 3CCWA 1LWCA 4NLVA 5KFRA 2W4DA 3F73A 2E5LF 1ZH5A 2FGOA 4U6PA 1S1XB 3OHBA 1XR7A 2LEPA 4OJ3A 3KK2A 2DR7A 1FWPA 2ILYA 1JLAA 4USVA 2BJ8A 4RU9A 2RDIA 4KGXB 2Q3PA 3DHXA 2PA3A 2KRRA 1H6KX 4CCHA 1I1GA 3HHLC 2MEWA 4F4XA 3LP0B 2I5JB 4L3NA 3CJ2A 1KHVA 2FGCA 4X4NA 1YJTA 2YVSA 3E51A 3KMSA 2DXDA 4BS2A 1M1KT 2YNFB 4WXOA 1NK9A 4IOAQ 5IT0A 5IQ6A 4TY8A 1YQHA 1X60A 3PDNA 1K73T 4DSIA 2WHOA 5EHHA 2BV3A 4IG3B 5SUHA 1S4FA 3BN7A 4JI6F 4CO4A 3ENWA 5KFYA 4WWSA 3D5MA 4Q5VA 2CJ9A 2OPPA 2ZH2A 3DDNA 1G7CB 3G86A 2HMIA 3OUYA 2ASJA 2I6WA 2XQCA 1P9QC 5K5MA 1DHMA 2IC3B 1UJ4A 5K8MA 1VIXA 5ETNA 3N4WA 2J5AA 3MM7A 3SCKE 4P9SA 1SXLA 2FD2A 1L3VA 3QQCD 1TV6B 2LQBA 3D6TB 2CJBA 2VC0A 1NKBA 1X5SA 4DS5A 1NPKA 5EWFA 4R0JA 3MURP 1S12A 3R5CA 1EP4A 4PXEA 3WQPA 3MD1A 2ZJRQ 1N36F 4KKOA 4F4AA 3PX0A 2YWWA 4MKBA 5HI7A 5E3QA 2G1HA 3DRPB 1QSSA 2NSBA 2QLWA 1WTBA 3FCHA 1U1QA 3EJMA 1FEEA 1UPMB 4UF4A 1U0SA 2VJVA 2W7PA 3UPFA 4K4WA 3RRKA 4QIEA 2JWNA 4LRCA 3MCMA 5FLXU 1FK9A 4LBHA 1TL7B 2MB0B 2R7WA 2HPUA 1SCJB 1T9VA 2LEAA 4V19X 2ZDOA 1P9YA 2B8PA 1RAJA 4OYXA 1RT3B 3EGWB 2DB1A 4XK8C 4JI7J 5KT7A 3F44A 2P9GA 1FKOB 4GVBB 2KZMA 2XHWA 1M5SA 4LREA 4JI3F 3KLIA 4F4ZA 2G2YA 1KD1T 3POTB 2D3O1 1WHWA 1UFKA 4CTAB 1WC5A 2GQCA 3K5LA 3M6XA 3UVJB 2HHHJ 2CZVC 1HIYA 2VODA 4M5HA 3UCGA 1QAJA 1TUGB 3TNVA 3T1HJ 4O4GB 4FS2A 4OI4A 3TWZA 3DOKA 3ADAC 2HGNA 5BJRA 3NGUA 1WACA 3HHNB 3TAPA 4OIXA 2HSEB 4KSEB 4MK8A 4NA2A 3C6UA 3KUHA 3DGPB 3DOMB 4OZ0A 1X4AA 3S6EA 2ILZA 2H5EA 2DR5A 2CKWA 4ICLA 4QWBA 4NRUA 2W25A 3TRGA 3BBFA 9ATCB 3EX7B 1HD1A 1V5VA 3GIJA 4UQTA 1XMOJ 4AXJA 1WEZA 2F4VJ 2R8IA 2KVIA 1A7GE 1FO1A 1FTRA 2RILA 1U0HA 1RE1B 1T95A 4ZN1A 4OZJA 5C42B 2HQ3A 3RG6A 4MAKA 2F1FA 3J81j 2B9EA 3CC4S 2IAJA 2HHWA 2NZ4A 1H7WA 2H9ZA 2IVMA 4EI2A 3EVMA 2HRYA 5AJ3F 3QO9A 2VU5A 2DGOA 2F3JA 5J2MA 2OGUA 4FKYA 3A8JA 4DV1F 3QT8A 3RBZA 2YWGA 1UETA 2V2KA 4QBUA 3AJDA 4ECSA 1W25A 4QWDA 4QYRA 4MT1A 2Q43A 1HQEB 1YBTA 3DRYA 1GMVA 1CS4B 3IGNA 2V4JB 3JYTA 2G1DA 3D6MB 3IO1A 2BOPA 5D3GB 4HVZA 2B4PA 1JXLA 2CA9A 5DZ7A 2M4MA 1FWKA 1WC4A 3OTDA 1I94J 4ZVHA 3OJSA 2UUCF 4X64F 5EN1A 4J5OA 3DMJB 1FFSB 2X1BA 1RUSA 4WBFA 3T1YJ 2BMBA 2ZEJA 4JI0F 4O3QA 3NMAA 2KO1A 4KC5A 7FD1A 1KOOA 1U24A 4CP5A 2XB2D 4IRDA 1TKXA 1IN0A 3CNQP 2C3OA 2DGVA 1JQGA 3CE8A 1NHUA 1Q5YA 4A46A 3VAKA 4U7CA 4DQRA 4EYHB 2DHGA 2LLZA 5E7OB 4ZIVA 3KG4A 2H1YA 1LK5A 2LDYA 3I55S 3LP1A 3CCLS 4DLGA 3ZTQA 4P2XA 2IPOB 4ZPWR 1FRIA 2UXCJ 4KJIA 4URQU 1PAUB 1PG5B 1MLAA 2R2RA 1FRLA 5CCMA 4P10A 3Q0AA 1FE0A 2OUGA 4UT4A 2M3DA 1BY9A 2ZH1A 3PW7A 2V0NA 3CJKA 3HVRA 1C1CA 2CJYB 3CD0A 2RUGA 5IXUA 4HKQA 3JTPA 2OPQA 1NB7A 5KFDA 5GAEI 2E7XA 2GMHA 3OHAA 4M5KA 2K3KA 4TN2A 3UCZP 3ELHA 1HR0F 4IRCA 4CYUA 1Z2LA 2M0GB 1TAUA 2ZBPA 3CJSA 3CCTA 1WG4A 1NMEB 1IKVA 4FBUA 2MKHA 3EZUA 3I5CA 1VQKS 1YZ7A 3TUJC 1DTTA 3CC7S 1MNEA 2M8HA 4ZVEA 2JLGA 4MIBA 4OYAA 3SV4A 2CPEA 2GVDB 1S9GB 3FBFA 5A8RB 1N5TA 2PC6A 2HBRB 1FRJA 3LWLA 2HW3A 2MZSA 3PO5A 4HTJA 1ZPVA 2BQ3A 2C2OB 4HEA9 2HFSA 2IBKA 2V34A 4Y2MA 4FS1A 4DG1A 1CJKA 1KC8T 2KFNA 1U2CA 1FT8A 1N8RT 4DV7J 3WC0A 5I3UA 2QMXA 4FN5A 3BPSP 4X84A 3N01A 4J9UE 1L3SA 4C4WA 4ELTA 1JLQB 1S6OA 2C1EB 4DR7J 4UZBA 2VASA 3MXHP 2HHUA 3MPYA 2RSQA 3MMCA 3W63A 5KT4A 1LWFB 1SJ4P 4PWDA 1RU2A 1VK8A 3IS9B 1XTZA 2DGTA 4DCOB 4AYBD 3HKZD 2DKOB 3Q22A 3O2IA 1Y10A 1D9FA 2LXIA 1LKZA 5T41A 3AD8C 3CW2C 2AIRB 3OV7A 5DG9A 2H48B 2YWEA 5AE2A 4LJMA 2V63A 5KFKA 1TL1A 3B78A 3D0GE 2AEJA 2NYHA 4LR9A 3QWPA 4P2SA 2C2DA 1BQMA 4NL5A 2D3OR 4HYKA 4I6AA 2YH0A 2I9SA 2MLYA 3RR7A 2CIMA 1M5KC 4YR0A 2DEJA 4P75A 1RWKB 3NLCA 2HRUA 2NUHA 1SC4B 4I2QA 3TUPA 2CADA 5CYMB 4P73A 1SJRA 2V2VA 2CXEA 3AQOA 2EFOA 3H42A 2LXUA 4C8OA 3M32B 2GO8A 4YQWA 4ATNA 3HHLB 4K5SA 4MMOA 3LO3A 4DJBA 1S1XA 4PZVA 1OPIA 3MWBA 1RJJA 2DXEA 4O23A 2QN6B 1Q8KA 1ZETA 4LF5J 2AV5A 3FEYB 1YBUA 3HD2A 2CG4A 4C9DA 1BWVA 1QJHA 3LP0A 2I5JA 3DRSB 3KLGA 4RUCA 3EDRB 2KM8C 1CJUB 3DLKB 2IA0A 4OYBA 4QWCA 1FXLA 1I3OB 4A8WA 2YNFA 1VFJA 4C6AA 4UUXA 2EFNA 2R8HA 3IWLA 4Q45A 4X4PA 1NJXA 2J0WA 4IG3A 3SV3A 1XMQJ 2KYZA 4Q44A 1C0UA 3J80U 1KRPA 3BDPA 2BXJA 1A0OB 1Q8BA 3HX9A 3KHRA 4E2FB 3ICLA 2FC8A 4JI7F 3DDKA 3UNGC 2IC3A 2J9DA 2J7WA 3QRPA 3A8KA 2G2ZA 3KUGA 5DETA 2BZ2A 1TV6A 2K3IA 1V5IB 2W8LA 4DR2J 1RHUB 1HMVA 2HHHF 2YNGB 1Y3KA 4YFUA 2I2YA 5H1SV 2BUNA 3T1HF 3OLBA 2ZE2B 1S6UA 2N3OA 3OL7A 2DNOA 4NCGB 2QSFA 2KH9A 3MDFA 2MSTA 4DN9A 3B4DA 3BO4A 4UY85 2XMKA 2ZBIA 2N4DA 2V50A 3S1TA 2HGLA 5THWA 3DRPA 1C4AA 1ICEB 2QLBB 3J7ZT 3V4IB 2H65B 4C7QA 5HMZA 5E3RA 1U6BA 1XMOF 4QZVB 3LQVA 2F4VF 2V8GA 3WIUA 3N6LA 3D6FB 3TEGA 4PG8A 4PUOB 2QA4S 2J7KA 2HHSA 1YIJS 2E5HA 5KFGA 2Z8QA 1RT3A 1PJ7A 3K2YA 1FKOA 4QJVA 4GVBA 4WFNQ 4LF8J 1UVJA 4ER8A 3JB9k 4JI5J 2F8MA 3M8SA 1XC9A 5AXKA 2FJEB 3IWNC 3POTA 1RP5A 1MMLA 4CTAA 2VQEJ 2BE2B 4JV5J 2KDOA 2DPJA 3C14B 3DDIA 1CJTB 3UVJA 2CPZA 1Y5NB 3NAHA 1APSA 1GFWB 3BGLA 3QPIA 1RU1A 3E01B 1FNOA 4C98A 2ZZMA 2GHWA 3UN2A 2Y1IA 2R7XA 3M6WA 1T7PA 4O4GA 2IMOA 2DRAA 1T9XA 5C2GA 3BGFA 4ZVTB 4UOFA 1YVFA 3ZNJ1 1CVJA 2RQCA 3MZIA 2W2QP 1EQ0A 5LMNJ 3DGPA 3DOMA 3P3DA 4HL9A 4NCBA 2R7QA 1I94F 1CQMA 1AA1B 2LQ9A 4X4RA 4IQMA 4RW4B 3OTOJ 2V8PA 2LDIA 2VZ9A 3R97A 3T1YF 4USWA 4UW2A 4OI2A 1TMMA 2W1BA 3ISND 1S57A 4RPFA 2D7SA 2MTLA 3R1LA 3TYTA 1IKWB 1Y9OA 1ROFA 1B7YB 2C2NA 2H4YB 1VC0A 1HBNB 2AW0A 3MHYA 2LU2A 3OW2R 2R3VA 1FKAF 1GXTA 4ECWA 4JYAJ 1ZPWX 2NXNA 5LMUJ 4OQJA 3R7BB 2A2CA 1RWUA 5DQGA 1WHYA 4UUWA 3J80Y 3ZNUA 3Q2SC 2XZDB 2CPHA 3BH6B 4JI8J 2UXCF 1F1BB 3OFEA 3R5JB 1Z4UA 5CZXA 2LYVA 4PPZA 1WWHA 2JVOA 3F0NA 4K7QA 4R5PB 5C5JA 1CS4A 1N5QA 2D74B 2V4JA 3GSIA 3PR4A 1W2BR 3ILOA 5D3GA 2GHPA 2RNEA 2RU3A 1YHQS 3R9LA 3QZ8A 2MJUA 4O3PA 1LFWA 1RTZA 5J2PA 3MMBB 2DCLA 1T3NA 2COLA 3KJQB 4J9KA 3DMJA 1YTYA 3D54A 2OTJS 2EKYA 5EDWA 1RAGB 2DPIA 3EZ5A 2KXHA 3TW0A 2FYXA 3K5OA 2CQ1A 2X3GA 3VQTA 3PO4A 1EARA 3LW5C 3UCUP 5JXSA 3HVTB 3IR7B 3NBPB 3NAIA 1VR6A 5J1NA 1X4DA 2CVIA 2XO7A 1JLCA 2DITA 4GO5X 1XBWA 2FLLA 2HQIA 1YLXA 3N79A 4EUVA 4N7TA 3RB3A 3SCJE 3BH7B 3FSIA 3CJ4A 2VIHA 3M30B 1YJRA 3V6DB 4XO0A 4V19J 4DV7F 4OX9J 1LXJA 1ZBTA 2AT1B 3AHPA 1X4EA 2QTWA 3H5SA 5D0RA 3EWGA 4OYIA 2V2QA 4ZITA 2X1GA 3FSYA 4B3TJ 4DR7F 5LM7E 4IG0B 1RI7A 3O1LA 5LOQA 2HVIA 2CQCA 4WFYA 5KT3A 3DXBA 3IP0A 1R6YA 3EXYA 2DGWA 1YBAA 3T41A 4DUZJ 5E0OA 4RW9B 1RTJB 1U25A 4O0IA 1N5YA 2HFUA 4OJ1A 4GVLA 3TJ8A 2QX0A 4C3KA 3CMQA 4WXWA 4X62J 1V9OA 1MN7A 1IUJA 3M9MB 1U47A 2RUSA 1D8YA 1Y3JA 3DU5A 1HQ2A 2GVDA 1BXNA 1S9GA 4H4KA 5A2QU 5A8RA 4X2BA 3HFZB 4KGVB 2QL5B 3GP9A 3I0SB 3H20A 4CT8A 2ZVIA 3OBIA 5ETTA 4DR1J 2GJ2A 2XY5A 1T05A 3DC2A 1VBXA 3GTYX 2D9PA 2G9OA 2ZHOA 2FVCA 4NI2B 4KR0B 3DOLB 1KN6A 4H4OB 4KV8B 2DHSA 1JLQA 4FP9A 3N5BA 3THPA 1SJQA 2APOA 1S48A 4OZ1A 2Y1LB 3VHQA 4DQIA 4FF4A 1LWFA 2KVQE 2VBYA 1WKJA 1ZAVA 3TQEA 4LF5F 4F4WA 2M2BA 3WDOA 4WU3A 1GK8A 3D0IE 5I4MA 3OSNA 3JQJA 2OIHA 3HHKA 2W7OA 1HI1A 2VUGA 4WCEQ 3OR1B 4M5LA 2LVWA 4CH1A 1XNQJ 2EC0A 4BLGA 4C0OC 4RUHA 2QRRA 1DLOB 4FDFA 2RDDA 2BX6A 2ASDA 2J9DE 5CYQB 4F3MA 1XMQF 4GC6A 1SVDA 1RISA 1HNZJ 3MPDA 2HKEA 1YI2S 4DPOA 4YP3A 3DLBA 3JTOA 1NJZA 5KFBA 1VQYA 2ERRA 5HQMA 3EVWA 2J6SA 3EXCX 4NXMJ 3HZEA 4ECVA 1OIAA 2C2EA 2VG7B 4USJC 1DARA 3OVBA 2DNMA 3HT3A 2D1CA 4DR2F 2QMWA 3FEXB 2DR6A 2F5GA 1WOSA 3HHLA 2KJWA 1HARA 1F60B 2MJNA 3NS6A 4BC9A 2VBXA 4NCAA 5DM7Q 2CYYA 4AQYJ 3MECA 4EGLA 1KTVA 5IV4A 2KM8B 1OS5A 1T3OA 2WONB 4KHMA 1RK8A 2K1RB 2FLOA 2YBVA 2SXLA 3DRSA 2VPZB 3DRXA 1NO8A 1CJUA 3DLKA 3DYAB 2HFNA 4U7UD 1WORA 3JSRA 2YKQA 2B9XA 6FD1A 4WP3A 2JVRA 3O8WA 1RYSA 1AXQA 2DCUB 2GIQA 3VAGA 4ILMA 1AYEA 2AEMA 1TK0A 1VQPS 4CO2A 2UU9J 2FHMA 3SMZA 1PBAA 5GMKa 4CLZA 1WHXA 2XSFA 4OYWA 2V69A 5FDLB 1N6QB 3PRVA 2CPFA 4LF8F 3GIIA 3HT0A 3AAWB 3MEDB 4XTTA 4JI5F 3VAIA 1TKTB 5I3PA 5D0HA 5A2QY 5HQLA 5A8WB 2VQEF 5DJBA 1O8BA 4JV5F 5FD1A 2OFGX 1S9FA 4DBQA 3K7RA 1G4CA 2PD1A 2W24A 3RBXA 1HD0A 2MZTA 2LMIA 4NEZA 2ZE2A 4NCGA 3KHGA 2HQCA 1OYEA 1R43A 4ZVRB 1BHNA 5LMNF 1EJ7L 2WSFC 1VISA 1HWLA 3AOBA 3M7VA 2A6OA 3KNAA 3OTOF 4DEZA 2KB2A 1PC4A 2DHXA 2E7WA 3TX0A 2PIIA 3R5AA 4YDXA 1GMUA 1ACMB 4QOTA 3M8ZA 4RO0A 1X4CA 2ROGA 4KAIA 3FC9A 3GPAA 1RQ0A 5L46A 2ZZNA 3R2CJ 2IDEA 4Z2XA 2XYPB 4LSLA 2KG0A 2LP4A 4K4VA 2VOPA 1SL1A 3TJ9A 4JYAF 5IOLA 2KZZA 5LMUF 2GO9A 2BE2A 4EU0A 4F4KA 3Q8VA 4PQAA 3C14A 5G4DA 4N8NA 1CJTA 1T9WA 3GE9A 3K89A 4NA1A 4MKYA 3QMQA 4JI8F 3JSMB 4IDKB 5B0CA 1RWNB 2HK2A 2XG8A 3E01A 1JJ2R 1H2UX 5DO2A 1KVKA 4YN3B 1REGX 2LECA 2FHJA 1RT6A 1SQEA 1WC1A 4A8OA 3PACA 4M8LA 2JJ4D 1WDDA 1X9MA 2EXUA 1OMSA 3UD4P 1F5CA 2B5JB 2CQPA 2OD4A 4DS4A 3TI0A 2CNOB 1R27B 4RW4A 2JFKA 4DF8A 4QYZK 3G87A 4WFBQ 3HSJA 2Y8WA 2RDJA 4USHA 2DRBA 3ZZYA 4DCPB 4LFCJ 3M9OB 4ZP7A 3HKWA 3ILLA 4F2SA 3K8WA 2DGUA 2HFOA 5HJYA 1N5SA 2M88A 1HBNA 3VTIA 2RH3A 3L7OA 3CXCR 4D3GA 4M5JA 1YZ6A 1WTFA 1S6QB 4F0KA 3L7PA 2VDHA 2X1FA 3OJUA 1SJ3P 2IFXA 3JXOA 4B3OB 2JOQA 2YKNB 5HLFB 5L1KA 2O67A 1RADB 5B7WA 2LA6A 4F3OA 2ZH9A 1NK7A 4M5MA 3AJ1A 4R5PA 4OX9F 1NPRA 4NYPA 3PHTA 3AA9A 4L76A 2DGSA 3M8QB 4F02A 4ZCIA 4B3TF 3CCZA 2FHKA 2W2OP 2B4VA 1TFWA 2MQQA 3WZ0A 3EGNA 3J81U 3BDEA 1Y0HA 2MHEA 3MMBA 4K2XA 2HYIB 3AT1B 4DUZF 1UMJA 5ETQA 2MDAA 1UCNA 1GXUA 5L39A 3AJ2A 1KVIA 1GX6A 5F3ZA 3WIVA 2NXCA 3HVWA 4X62F 2LCWA 1TL4A 2WZ1A 1ZTWA 4LSNA 5HANA 2A3JA 2C3UA 1S59A 2QFJA 3HVTA 2E1CA 2GVZB 3QJJA 1ZM3A 3NBPA 4FXWA 4OI6A 4DL5A 4DUTA 2CNNB 3NEKA 5DGAA 4P2FA 3CCJS 3JSYA 2OLWA 1QTMA 5K8OA 1RWOB 2DNHA
chains in the Genus database with same CATH topology
2ZKUA 1X5PA 5J1PA 2CKWA 1LWEB 4ICLA 5KTQA 3V6JA 4QWBA 3V4MA 4NRUA 1MSWD 2WBMA 2W25A 3TRGA 3PW4A 4DSKA 4DR1F 5K8NA 2ZH8A 2E9ZA 3RBEA 4ECQA 2FVQA 4OI0A 1QUPA 3GIKA 3EX7B 2RU9A 2PI5A 1HD1A 3DLEB 2MKJA 3MPVA 3GIJA 3KJVA 4UQTA 3M30A 3ZC4A 1HPZB 1WEZA 4AXJA 3NNAA 3G8TA 4X4VA 2R8IA 2KVIA 1A7GE 1FO1A 1FTRA 2WW8A 2RILA 4PG7A 4CI0B 2M8DB 3V6DA 4CH0S 1T95A 3S7RA 3IG1B 4Y00A 2VV5A 5HP1B 2CQIA 4ZKAA 2R8GA 4OZJA 1T8EA 5C42B 2HQ3A 4YMEA 5GAHU 1HNXF 4MAKA 4N8OA 2F1FA 4FPRA 1RTDB 2YNIB 2WOMB 4Q43A 3CC4S 4C8LA 1N56A 1X5TA 1HL6A 2IAJA 3D1HA 3PKMA 1H7WA 2H9ZA 2NPFA 2NZ4A 2DO4A 2HHWA 2IVMA 3JTNA 1REVB 1UEVA 4ID5A 3BEGB 2Q1LA 2HRYA 1U6FA 5AJ3F 3DM2A 2HZCA 3FVYA 3MEGB 3QO9A 3Q8QB 3CD5A 2BDPA 4IG0A 2J9CA 2ZITA 4KGKA 5F8HA 2DGOA 2F3JA 2HVZA 1RDRA 4ECTA 3LH2S 2XS2A 5J2MA 3PR5B 1C1BA 3DI6B 1VQSA 4G3IA 2L48A 1TUVA 2BQUA 3E8OA 2DNRA 1FVQA 5DQIA 1P8GA 4AFFA 3H4BA 1VOMA 1TAQA 3T9ZA 1O5JA 4MFBB 2RKIB 2RT3A 1GTEA 4Y34A 1SI9A 4A8FA 4PRFA 4K4ZA 1TZ0A 4J9NA 5DG8A 3DHWC 3ULHA 3T1AA 4RW9A 4DV1F 2POKA 2VONA 1RTJA 4I64A 2YWGA 5CYMA 3MUTP 1TL3A 4TLRA 2CRLA 1UETA 2V2KA 1AFIA 3TO8A 4LQ3A 4MYUA 4J9QA 1A9NB 1U49A 3IRXA 2OPRB 1KNZA 1UFLA 4QBUA 1HBUB 3OL6A 4ECSA 3M32A 1W25A 4G6VB 1VQLS 1S1TA 4QWDA 3SDEA 1XNQF 3RU0A 5MLCV 1RTIA 4A4JA 5KG4A 4QYRA 3PFOA 2PGCA 2Q43A 1LWCB 1X8DA 2AP6A 1HQEB 4RW6B 2W9BB 3VZIA 2QA4G 1U1LA 3DRYA 1NNDA 2V94A 3NWGA 3IGNA 3KLHA 1A6LA 2P6TA 2ZJPQ 4EBCA 2V4JB 2W9CA 3NRBA 3JYTA 2XLKA 1QE1B 2G1DA 3M8PB 1F5AA 5E41A 3V5RA 2LKZA 3IO1A 3CWJA 1FA0A 3KK2B 4HH1A 2BOPA 1S79A 1M5PC 5D3GB 4HVZA 2B4PA 1JXLA 2YKPA 2HFZA 5KFCA 5JUMA 1S99A 1U1MA 3KKFA 3CMAS 4C3LA 2M4MA 2F9DA 2ATLA 5AXLA 3OTDA 3OXGA 1NEEA 5T14A 4ECUA 4NMLA 4ZVHA 2AGQA 1HNZF 2HHQA 1NK6A 2XLIA 4LSLB 1SH3A 3ZZ0A 4OZ5A 5LJ3Y 3VAJA 3OJSA 2UUCF 4ALZA 2PE8A 1VIOA 3C6TB 3MEEB 4X64F 2MKSA 5EN1A 2DNKA 3H98A 4J5OA 2Y1RI 3DMJB 2VH7A 1TFYA 2A1BA 2X1BA 4IFYA 2UXDF 3LF0A 4JI0F 5F8NA 4O3QA 3OTEA 5EX3A 2PO4A 5B08A 1D9AA 3NMAA 2HG4A 2CJAA 4O3RA 3TR5A 1XWLA 2KO1A 2ZNZA 3GFXA 4NXMF 4KC5A 2CPXA 3MM9A 2PMZD 1URRA 2BA9A 4BCAA 2YX4A 7FD1A 1KOOA 5CQGA 5KFMA 1XEZA 1U24A 2XB2D 2JH3A 4IRDA 3DOLA 1TKXA 4CNYA 3LAMA 5L38A 1IN0A 4J9OA 1DQ9A 1VMBA 4H4OA 3G6VA 4KV8A 4TY8B 4ZPCA 1U26A 2C3OA 2HVHA 4Y0FA 2DGVA 3CE8A 1M0SA 1U48A 4C8ZA 1NHUA 2RB7A 3QAEA 3UI3A 4C11A 3TAMB 3NS5A 4A46A 4J9SA 4DL2A 5HROA 4C0HA 3H5XA 1UJ5A 4KFBB 3VAKA 4DHVA 3J7A1 2DNZA 5D6GA 4U7CA 4DQRA 2CZ4A 5BYQA 1RT6B 3CO9A 4B3SF 4EYHB 3VWSA 2KTQA 1O51A 1KONA 4AQYF 2OPPB 5DRKA 3U7JA 4ID8A 1FDNA 2R8KA 2DHGA 1YITS 4OHYA 2LLZA 5E7OB 1XN9A 1TK5A 2G13A 2KT2A 3KG4A 3M2UA 4YEAA 1QUVA 4KQZA 2YNHB 3KNGA 3OUYB 4XAKA 5CXTA 2VL1A 3JAMY 4ZHRB 1LK5A 2LDYA 2U2FA 2VB6A 1KSPA 2HWIA 2YKAA 4OZNA 3I55S 4EFAC 3LP1A 3CCLS 4DLGA 2VG5B 2F8HA 2MZQA 3UR0A 2XS7A 2FJWA 4ZPWR 4KGMA 4ZPBA 2DNQA 1FRIA 4HT7A 2JLEA 4ZP6A 1HI8A 4KJIA 2C22A 4URQU 2C28A 3F56A 2B3TB 1C2PA 5KFVA 4F2RA 2R2RA 3OR1A 4C3MA 2A18A 2YNGA 1BWEA 4PG6A 1F9FA 4MK7A 1FRLA 1FVSA 2FDNA 1JLEA 1X5OA 5CCMA 2DH7A 4LF9F 1T02A 3QLHB 3Q0AA 2MY8A 3DLGB 1FE0A 1IR0A 1MWZA 2VFTA 2M3DA 1BY9A 1FKPA 2C3MA 2ZH1A 3PW7A 2V0NA 2Z2MA 3CJKA 3OSPA 3HVRA 3N0VA 1VK3A 4DFMA 2BABA 1LFPA 1C1CA 2LXFA 5GADU 1BQXA 1DLOA 3AQPA 3UWTA 4LT6A 3CD0A 2RUGA 4ECRA 3BR9A 4QPTA 2KI2A 3JTPA 3NCQA 5IXUA 4DV4F 4HKQA 3CCSS 1FJGF 2OPQA 5H9EJ 5GAEU 1EP4B 1NB7A 5KFDA 5GAEI 2MSSA 1VQ8S 1D1UA 2E7XA 2UU9F 2GMHA 1NKCA 5HMYA 1P1TA 3BQ2A 1JX4A 2J8AA 4RU2A 3OHAA 5KFZA 2K3KA 4HLBA 4TN2A 1G6BA 5BYRA 3UCZP 4FF2A 2BACA 4DSJA 3HHEA 1R7IA 3MTKA 4X4TA 2OPSA 4Q0BA 1FE4A 1HR0F 2UV8G 3PKYA 4IRCA 3LGNA 4H54A 1ULRA 3GG1A 3H25A 1Z2LA 1BQNB 2M0GB 5AE1A 5DLGA 3HJFA 4I0WA 1TAUA 1VLYA 1J2VA 3V2UC 5K8PA 1GH8A 5KFPA 3V4IA 4ELUA 3CCTA 2K8GA 4J9RA 5IZHA 4C8NA 1Q16B 1RT1B 2X51A 2PN6A 3GFZA 1WG4A 1S6PA 2EK6A 1CSJA 1R8HA 1X4BA 4NLRA 3H5UA 1UJ6A 1HBMB 1FRHA 1RT4B 1IKVA 4FBUA 1KQGB 1B0TA 1B7FA 2IBOA 2XZWA 4PUOA 2V5HG 2KFYA 2MKHA 3EZUA 3I5CA 4RX6A 1U1KA 1VQKS 3TUJC 3C8YA 2R9LA 1DTTA 3CC7S 2XNQA 1MNEA 4PQUA 2M8HA 2GQ2A 3T19A 4ZVEA 1S97A 4DV2F 1OQ6A 2JLGA 2YTCA 1NJWA 2RVJA 1GAOA 1XR5A 3FFIB 1U2FA 4MIBA 3MUMP 2MQMA 3ISZA 5M2RA 3MR3A 1EETA 4I1TA 5E2QA 2GCFA 3K59A 4F3QA 3SV4A 3H59A 2DH9A 2CPEA 3I9V9 4LVNP 4XPCA 1S9GB 1DQAA 1IKXB 2UVWA 2MMYA 4M5DB 4PG4A 3OLAA 5A8RB 2WTFA 1N5TA 1WEYA 5F0UA 4DWIA 2PC6A 5C25B 1FRJA 2GHVC 1YRXA 3LWLA 3BQ1A 2HW3A 2MZSA 3PO5A 4D3HA 2QA2A 5CZVA 3R1HA 2K1RA 2EPIA 3PW0A 1LV5A 4HTJA 3BF4A 1ZPVA 2CQDA 4O3OA 2BQ3A 2XI3A 2YY3A 2OFHX 4K0KF 4HEA9 2XI2A 2O3DA 1CC8A 3R3TA 3VF0B 5C24B 5G0RA 2IBKA 1WHVA 4WKYA 4AL6A 4RBVA 3HM9A 1FJCA 4Y2MA 3CDBA 3GB0A 3M6VA 5KT2A 5HMXA 4FS1A 4DG1A 3K5PA 1KC8T 2EFVA 3CIMA 2J6UA 2KFNA 3DYAA 5K14B 3CDEA 1FT8A 2HWHA 6FDRA 1WF2A 5KT5A 3SQGA 3VAHA 4KO0B 1N8RT 3QJLA 4ED6A 1VBZA 1S72S 3WC0A 5I3UA 2QMXA 4FN5A 4QYZJ 3DXSX 2LQJA 4DMZA 1U1PA 4X84A 2ZFHA 3N01A 2GIRA 2D9OA 4HDHA 4YDDB 4QU7A 3FRYA 1L3SA 4C4WA 4ELTA 1B0PA 2V4RA 1H98A 4YY3F 1JLQB 3SCIE 1S6OA 2R7RA 2QV6A 4LSNB 4I2PA 2B0GA 2VASA 3MXHP 2HHUA 2GQQA 3M6UA 3KLFB 3MPYA 2ABYA 2RSQA 5J1EA 3MMCA 4UY8T 3U1LA 3IA0A 4DQSA 5KT4A 4DOZA 3HO1A 1NK8A 1HW8A 2NPIA 3DOKB 3N5FA 1OSCA 4FBTA 1LWFB 5EWGA 1SJ4P 1RT5B 4PWDA 2NQPA 5FDLA 4L72B 1N6QA 4OJGA 2XGQA 1ZAXA 2UVVA 4RW7B 4ETZA 2FVSA 1DTQB 3C6UB 1VK8A 3IS9B 1TP7A 1XTZA 2VG6B 4DSLA 3FRZA 4UOCA 1WNEA 2DGTA 4ILLA 4JOUA 3HKZD 4AYBD 3Q22A 2HS3A 3FGVA 3O2IA 5LSOA 3MEDA 1D9FA 1E6VB 2LXIA 5J2QB 5AXMA 4ZK7M 2HNZB 1S0NA 1J5OA 1LKZA 5DDOC 5T41A 3W2WA 1S1VA 3N9UC 4JV1A 3LOUA 1HBOA 4RNFA 4N56A 1Z2ZA 3HXMA 3QIPB 3RAQA 1Q53A 2DK2A 1Q79A 4I68A 2Q79A 1Y7PA 4QQBA 2BJDA 1WF0A 4DR4F 4C2MA 2DR9A 4TYAA 2Z4PA 1U09A 3OV7A 5DG9A 2UV8A 1R8BA 1N0VC 2YWEA 2A10A 2IRYA 1IKWA 5AE2A 3H40A 4LJMA 4OJHA 3D2WA 5KFKA 3IRWP 1TL1A 3M2VB 4Y65A 1H38A 3B78A 3D0GE 3GMGA 3PEHA 2IVYA 1YWXA 2ZC3A 2DNLA 4Q2LA 1TKDA 3QWPA 1LQ9A 5IM0B 2DVIA 1S49A 2IYGA 3MMAB 3PVXA 1YRTA 4JBCA 4WK1A 1IBMF 2UUAF 1ZM4A 5M2PA 4P2SA 2KT3A 1C0TB 2E1AA 4I7FA 2CQ2A 4OZLA 4WU2A 5HMWA 3PW5A 2ADBA 2C2DA 1M90T 4O3SA 1BQMA 2ROPA 4NL5A 2N82B 4HYKA 2D3OR 4I6AA 4G1PA 4TXSA 3SSRA 5D77A 2YH0A 3HP6A 2I9SA 1JKHB 3CCRS 3SI8A 3VALA 3RR7A 1BC6A 3LALA 4OI3A 3IBWA 1H2TZ 2CIMA 1M5KC 1Q7LB 4YR0A 3SSSA 2AJ0A 3NLCA 2HRUA 2NUHA 4PCQA 2JX2A 4I2QA 5CYMB 5KFEA 4IYQA 1SJRA 1NJIT 1TL3B 3RYLA 4R8UB 2F8EX 2L9DA 2IM2A 4DN0A 3AQOA 3ZZTA 2U1AA 2ZH4A 2EFOA 2LXUA 5E3AA 3G6ES 4C8OA 3M32B 2XY6A 2GO8A 3TA0A 1JNRB 1M5HA 2DIUA 4ES3A 4YQWA 4ATNA 3WC2A 5A0YA 1B64A 2KRBA 3SXLA 3HHLB 3SFGA 4K5SA 4MMOA 4LF6F 3LO3A 4DJBA 4B3OA 1S1XA 3AB4B 1IQZA 1OPIA 3MWBA 2W9AA 3G71S 3NNHA 1K1QA 1RJJA 4F4YA 1WD6A 1TKZA 3LGMA 4RBUA 4LFCF 3M1VB 2L9WA 3D1QA 2ZC4A 2ZOFA 1KLNA 5A6WA 2W9CB 2O5DA 1X4GA 4QR2A 2R2SA 5B0EA 2IMWP 1HWUA 1VJWA 4O23A 1AFJA 1IJFB 3H5YA 3M05A 1ZETA 1LW0B 3AA8A 5CYJA 2AV5A 4IR1A 3OPKA 3FEYB 4I67A 1HNVA 2OD6A 1JJHA 2DNYA 1R31A 4B9SA 2CG4A 4OMFG 5MAOA 4C9DA 4HI1A 1Q82T 1VHFA 3U02A 4PWUA 2OMOA 4C8YA 3GZ7A 3CF5Q 4NYZA 1QJHA 2B9YA 3LP0A 2I5JA 3DRSB 2QE5A 2ZD1A 5LSRA 1KQSR 3KLGA 2NUUG 3PEJA 3S01A 4RUCA 2XNRA 1HYSB 3TUZC 4ED0A 2DD8S 3BGRA