2HFOA

Crystal structures of the synechocystis photoreceptor slr1694 reveal distinct structural states related to signaling
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
MSLYRLIYSSQGIPNLQPQDLKDILESSQRNNPANGITGLLCYSKPAFLQVLEGECEQVNETYHRIVQDERHHSPQIIECMPIRRRNFEVWSMQAITVNDLSTEQVKTLVLKYSGFTTLRPSAMDPEQCLNFLLDIAKIYELSDNFFLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Synechocystis photoreceptor Slr1694 reveal distinct structural states related to signaling.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords Activator of photopigment and puc expression
total genus 45
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hfoA01
2BBEA 2OKQA 3HDSA 1ULRA 2PD1A 3T9NA 5IXUA 2RU9A 2RILA 1U7LA 1QUPA 3E8OA 4Q2MA 4Y2IA 1JWWA 1OPZA 3BR8A 2ZDPA 2VV5A 4OIXA 4A48A 1WD6A 4HI2A 4HH1A 1X7VA 5A6PA 1N5VA 3DXSX 1Y3KA 2GA7A 1SB6A 3KG1A 5B0FA 5F0UA 1VQSA 3CJKB 3CJKA 2K1RB 3LGMA 1FVQA 2BYCA 1W2IA 2AP6A 2KYZA 3TRGA 2QLXA 3HHLA 4FNIA 3WDOA 2KT3A 1MWYA 3HX9A 4EFAC 1AFJA 1V3ZA 2ASYA 2IYIA 2IFXA 4Y2KA 2HIQA 4Y2MA 3BF4A 3GZ7A 2AJ1A 3FMBA 2XMMA 3HF5A 2KKHA 2XMKA 4FNHA 5B09A 1Q53A 2VH7A 4OJ3A 4NPOA 2LDIA 1TUVA 5KAKA 1YRXA 2GV1A 2XMVA 4YEAA 1AW0A 2K2PA 3I9ZA 1CPZA 1YJVA 2ZDOA 2BJDA 3F44A 1CC7A 4HI1A 3TOQA 4QOTA 5B0GA 2HFNA 2N7YA 2GO8A 5K9FA 1K0VA 5T7LB 2LXFA 1OQ3A 3DCAA 2LQ9A 2OMOA 1SI9A 1P8GA 2Q3PA 2EW9A 4DL0C 2K1RA 1Q8BA 4DPOA 2XMTA 5B0AA 2FIUA 3IWXA 2CRLA 4HL9A 3UDCA 2L3MA 3KG0A 2N4DA 1YJRA 3TNVA 4DN9A 1AFIA 3BDEA 4ZA1A 5A6WA 1TR0A 1KQKA 2FTRA 1YG0A 1FEEA 5F0WA 1APSA 5T7LA 2AJ0A 2AW0A 1OQ6A 2PGCA 4OJHA 5B08A 1SQEA 2RMLA 1TZ0A 2G9OA 2ROEA 3BB5A 3QMQA 1Q8LA 1YJTA 2FHMA 2W4CA 4A47A 4F67A 1Y3JA 1KVIA 1X0PA 4A4JA 1X8DA 4Q2LA 1CC8A 1LQ9A 1IUJA 5B0DA 2QLWA 2HFOA 2K7JA 2HQIA 2W4PA 2LQBA 2QIFA 1FE4A 2W4DA 1FD8A 4NL5A 3LGNA 2N4CA 4OJGA 1KVJA 1GXUA 2ACYA 3HHLB 3K7RA 1GXTA 2OAUA 2ROGA 2XMUA 3BM7A 3HFKA 1P6TA 1XBWA 1FE0A 4HH0A 3VTIA 2OFHX 3BGUA 3MZIA 1N5SA 2HLTA 2XMWA 4U9RA 2ROPA 3LO3A 5B0CA 2RSQA 3HHLC 1Q4RA 1VQYA 2GCFA 1TL4A 1URRA 3BN7A 1Y9OA 3MCSA 3FGVA 1N5QA 4YDXA 1TL5A 2QYCA 3IWLA 1RJJA 2BUNA 1N5TA 1OSDA 1Y0HA 1S6OA 2GGPB 5B0BA 1MWZA 2GGPA 2KT2A 2OD6A 2XMJA 1FESA 1JK9B 1FVSA 1YJUA 2OFGX 3FRYA 1S6UA 2JDJA 2OD4A 4OJ1A 2BJEA 5B0EA 4ZOSA 4A46A 2GFFA 1R6YA 2OP5A 2FB0A 3KNGA 3QGPA 2HLUA 3KKFA 3HHLD 2K7KA 2IYGA
chains in the Genus database with same CATH superfamily
4IKAA 5IXUA 2GIFA 3HJVA 1QUPA 3M1VB 1JWWA 1Q8IA 3UD4P 2UUAF 3KLHA 4OLPA 2VV5A 4OMFG 3CCVS 1UA0A 4RW6B 2JEJA 1BQNB 4B9VA 4DSKA 5KG1A 2DH8A 2ZH6A 1T05B 3DLLQ 1KONA 2KZMA 4MH8A 3S7RA 1JLFA 3IS9A 3VAHA 4YR0A 2W9CA 2ZH1A 2V4JB 2EK1A 3LGMA 4I7FB 4NI2A 2CQGA 4NZ0A 2Z2MA 2E9TA 2UZAA 2F8MA 4FNIA 2NLWA 2YKNA 1S4EA 2KT3A 4M5DB 2H54B 3K17A 3OL6A 2MHEA 4X4PA 4TU7A 3OVBA 4J9KA 4UTGA 2HIQA 1N88A 2A2DA 2B5JB 4RWXA 1N54B 3ILIA 3VQSA 3KYLA 4J9UE 4DV4J 1VQ8S 2M5YA 1RISA 2VH7A 1RI7A 2YWEA 4NPOA 2IJFA 3QPIA 4OJ3A 2HNDB 4XAKA 1RSCA 1VIXA 3IXQA 1LXJA 2HS4A 2VG5B 1CJTA 2DXEA 5L1KA 4LSNB 3P96A 1JKHA 3TQEA 2P9EA 3CPWR 1HNWF 1FJGJ 4UZCA 2HBRB 5GAGU 4K4VA 1VRTB 3EVWA 4EGLA 3TWZA 3GSDA 3K57A 1P8GA 2VC1A 4DSLA 3ZZZA 1TMJA 3NY0A 3RJMB 3W2VA 3RRGA 1KTVA 1KLMB 3LANA 4G3IA 3U1MA 2W7OA 3H2VE 2FJDB 3DRPB 3O44A 1SJ1A 4Q0BA 2NXUA 1YVFA 1JIHA 1LWCA 2H5JB 2IM1A 5FLXY 1TR0A 2R2UA 5KTQA 5SUHA 2A6MA 2OSRA 3DXBA 4C3LA 3AB4B 1HBUB 1RT7B 4DFKA 4ZIWA 1T9YA 4OV6A 2JC0A 2LU2A 4WIQA 4QR1A 3AAWB 2B4UA 3UVJB 4KH0B 3FEYB 4ED7A 4ZS6A 3H5XA 1TZ0A 1VQPS 1MMDA 1RLDA 2MY8A 5JJBA 5J2MA 3CT9A 5KFOA 4DUZJ 1RTDA 4LT6A 2BEFA 3I5CA 1X8DA 4NLXA 5F3ZA 4OZ0A 5KFBA 3FFIB 2W8KA 1FFSB 2IJRA 3C2PA 2B0GA 2B56A 3D1OA 1AB8A 1SIZA 4P75A 4C0BA 5A0YB 4Q8FA 3NNCA 3BPSP 4OJGA 1FKOB 3PW0A 1RAAB 2L48A 3M6VA 3NRBA 2XYGB 4M5HA 1WF0A 1S6QA 2Y1IA 4G65A 3MGJA 3KLGB 4OYPA 3HFKA 3ZZOA 4DG1B 4DR1J 1CS4B 4DUYJ 1E6VB 4Y2CA 5C2GA 4GC6A 1NKBA 5ETNA 2CPEA 2DEIA 2POKA 4R25A 3ILLA 3KLVA 3R5AA 3LO3A 3HHLC 3CMAS 5FIIA 3IGNA 1KEKA 2B6AB 3CDBA 2QA4G 3NCRA 3T1YF 5EUHA 3IWLA 2J6SA 3Q8VA 5FDLA 3OXLA 4FPRA 2HS0A 3DLHA 2YNHB 1H7WA 5C5JA 2DGOA 2C2OB 5KFQA 3I82A 1TL3B 3VHQA 1YGYA 1S10A 3EPIA 3EXCX 4ZDNA 4JYAF 4JI3J 2GAHC 2XO6A 2BJEA 2OEKA 2HAIA 4DF4A 2DCUB 3SQGA 2PI4A 3QJJA 4DV3F 1HQEA 2RRNA 4L73A 2AV5A 3AXMA 3RR8A 3NGRA 3KTQA 5KFIA 2J6TA 2FHJD 1NDKA 1UFKA 1GNKA 2KO1A 4OX7A 1U8WA 3K5LA 3JSRA 4WPAA 1KRPA 2B9WA 2DNOA 3I5BA 2JWNA 1MN9A 3TZZA 5DG9A 3MOZA 2CJQA 3FSIA 5LSLA 2FVPA 1WI6A 1LFPA 4DPXA 4ED6A 3M8PA 2WSCC 1OO0B 1CBKA 3LAMA 2VICA 4KPCA 3KLEA 1PIEA 1N5VA 3N6LA 1RWNB 4KAIA 1UJ5A 1WG5A 3AOCA 4QIVA 4ZLNA 1HWUA 4USWA 1VQ5S 2RE1A 2GS8A 4M5IA 1U6ZA 1S4FA 2CAJA 2HRUA 4OYXA 4CLFA 4EWTA 3THTA 5KFEA 4RUCA 3MR5A 1X4BA 3LF0A 2BMBA 4NASA 1BWEA 2VB6A 1CSJA 3Q86A 1DY3A 4I1TA 1N33J 2O67A 3HFZB 2G2OA 4J9NA 1UVMA 2DD8S 3QZ8A 5EN1A 2F4VJ 1T9XA 3W65A 4D3GA 2DITA 3IBWA 1VQ9S 1IBCB 4ZITA 4B3SJ 3HD2A 5J2MB 4A8YA 1NBEB 5K14B 3F44A 1HHQA 1CC7A 3D67A 4OHVA 4IG0A 1VDHA 1Q82T 3CJRA 2IRUA 4CO1A 1C1BB 1RT5B 3RB6A 2ATLA 2W25A 2AYBA 1U0SA 1G1XA 3W5XA 4HDGA 2LQ9A 1NH8A 4IYQA 1V3RA 3G8TA 3I0RB 3GSIA 2FHOB 4LFCJ 4ILRA 3X1LB 2ZBCA 2B5JA 4DSJA 2PFDA 3FZBA 4DV0J 2DEJA 2CJYB 3KLGA 1ZPVA 2CQPA 3CB4A 5K20B 1LW0B 2N4DA 1YJRA 1EHWA 2K3IA 1M0SA 4BWJA 4RUHA 4ZA1A 4O3NA 1CJUB 1FRHA 1IBLJ 2KXFA 3KNAA 2BKOA 4LF6F 2MDAA 4I2QA 3TUZC 2GMHA 5CQGA 4RJVA 4FXWA 2OHDA 3V6KA 2YKPA 3NL0A 2DXFA 2NCKL 3BSCA 3HULA 1HHTP 2XSJA 2ZM6F 1YBTA 4TN2A 4MYUA 3MEDA 3CDAA 1QLNA 2Z30B 5DDOC 4NEZA 2CPXA 1Q86T 1T3OA 4F67A 5CYQA 4URSA 4O44A 4EK2A 3DOMA 4ECWA 1VQKS 2K7JA 2ZWOA 3MUTP 3NNHA 3PACA 4JV5F 2EBGA 4YN3B 1REVB 1SKWA 3K5MA 1N36J 3TJ8A 3M6WA 2WB1D 4DX7A 3W8PA 4L6V3 3LP1B 2OAUA 1VC5A 1AXQA 2ROGA 2X1FA 1I3OB 3LP2B 1U2FA 1P6TA 3WIUA 5LMNJ 4ZVEA 4IOAQ 3MMBA 2RH3A 5KFCA 4AFFA 2VOOA 5U47A 4S0MA 1B3TA 1DHMA 2GIQA 2EVZA 4DR4J 4LUBA 1JJ2R 2AU0A 4FXDA 1S6PB 4RBTA 1VK8A 3HFVA 4P74A 3JAMU 2FVQA 3RAMA 3UDLA 3DRSB 4DU7A 3CCSS 3OHBA 3FQLA 4LRAA 2QA1A 2XHCA 1E6YA 4LFBF 1RLCL 3GB0A 3KLEB 3GQCA 1KVIA 4I68A 4O3RA 3JSBA 4OI4A 1XNRJ 3AJ1A 2EK6A 2HVEA 1HQEB 2EFNA 4NWBA 1RWMB 1WUUA 2L41A 3I55S 3GU0A 2RD5C 5DM6Q 2EKYA 3A8JA 3NGSA 2OPSB 3KMSA 2H65B 3OW2R 1ULRA 3CCZA 1ACMB 2RHQB 4LF7F 1U7LA 5ETKA 5FDLB 1H2VZ 2GZOA 3IG1A 1NDLA 1HHSA 2MYFA 4RW7A 4TKTA 3M9OB 3RW6A 4KQZA 4DR6F 2W2PP 1ZBTA 1CLFA 3KG1A 1WC4A 5F0UA 2PO4A 1JNZB 4XPCA 1FDBA 4YDDB 3PIOQ 2XZDB 2XEXA 1M1KT 1N56A 5D3GA 2RDIA 3SQOP 2E7XA 4WFNQ 1LK5A 4J7CA 4ZN1A 4Q5VA 4QPXA 4QYRA 3PYGA 4RWWA 3SQGB 4ZVRB 2IC3B 5A2QY 3VV2B 2E66A 2HHPA 4KFBA 1NM2A 3Q2TC 1SJ4P 3ELHA 5H9FJ 5KAKA 4F50A 3FEXB 2KFYA 4B3MF 5D0HA 3FNNA 5GAHI 1CQMA 3GV5B 2FHJA 1UW9A 2BVZA 2Y0SD 1JKHB 2C1EB 1U24A 3Q83A 2QA2A 2N7YA 4J37A 5K9FA 4CT9A 4QWCA 1PGZA 2QA4S 4ITSA 2VASA 2DR7A 3MAQA 4NCGA 4AQYJ 5D3GB 3EVMA 1PJ6A 3I0RA 2LQ5A 2FPHX 2UUWA 3IO1A 2G1HA 1Q8BA 3FBFA 1U4BA 3C6UA 4PEOA 4JUZA 3ZTSA 1WKKA 4RUBA 1SJFA 2DHGA 1FWLA 1RBOB 2RIJA 3D1QA 3EX7B 2UUBJ 3KDNA 3KG0A 3MMCB 2R8GA 1GX6A 3L4BC 4I2PA 2HNZA 2LLZA 1N4LA 1WOOA 3BDEA 2XG8A 2ZNYA 2EG2A 3H4DA 4WTOB 4HDHA 4CT8A 2MKIA 3MAAB 4ZJQA 2BOAA 3SSRA 4FYXB 2AD9A 4X4NA 4CLTA 2CQ3A 2ZOMA 1YLXA 2G1DA 2H1YA 4X66F 1EP4A 1S0NA 3G2XA 2WSEC 3MMAA 1TL1A 2CPFA 1GAOA 3E01B 4YMEA 1HI0P 1FX2A 1DLOA 3M05A 5IQQA 1D09B 4WTYA 2XSFA 5HVFA 3W62A 2RDJA 1YJTA 4KSEB 2CJKA 1H6KX 4JI8F 1S7HA 4L72B 1NHVA 3R6GB 2HVDA 4A8QA 3JB9k 4ZVOB 2UXCJ 1LW2B 4DL6A 5AXMA 4TQRA 1WG4A 1HKAA 2PA3A 3KHHA 1KVKA 4LF4J 4ELVA 4ID8A 2BKNA 4MMOA 1FT8A 4PXBA 5KFXA 2E5LF 2DGWA 2MZJA 1N32F 2B8PA 2WVDA 2PFFB 1KLNA 2XMUA 1K9MT 1EETB 4NEYA 1FE0A 1FDDA 3IRWP 4OL8A 3NP5A 1IR2A 3VTIA 2OFHX 3MD1A 3THVA 4AXIA 2QO3A 2W24A 2ERRA 3CJ5A 5HSPA 1TKZA 1I94F 2FJEB 3AD7C 1WHXA 3R7SB 2FLLA 2XB2D 1URRA 3LALA 2ADCA 3T1HF 1IBKJ 3P49B 2UXBF 3M7VA 4EZ9A 1F5CA 3BKUA 1H72C 5HVHA 1HMVB 1S1TB 1VBXA 2Q43A 1T7PA 4LF5F 2OPPA 4I7FA 3MCMA 2EFOA 4LBIA 3B4DA 2CZVC 1NSPA 4MAKA 4GC7A 4LF9J 2VFSA 1MWZA 5HQ8A 1QVGR 1WI8A 3DN9A 4WBFA 4KPYA 1JK9B 2BANA 4CM0A 3MR3A 1HNXJ 3FRYA 3IBFB 5B0EA 2OD4A 1C1CA 2VKZG 2R2RA 4UT4A 3H59A 2PN6A 3M30A 5D78A 3US5A 3V2UC 5CD4A 3G4SS 3R1HA 2IM0A 2MZQA 3HT0A 2HLUA 2QEXS 3OLBA 2J0SD 3R2CJ 4X4SA 1QSYA 1CULA 1IJFB 4CRJA 3DI6B 3IRXA 1QSSA 1RT4B 1JLQA 3NWGA 1HWJA 4MK9A 3TARA 1RYSA 3AH6A 3VR1A 1DTQB 3FBBA 1TFWA 4TVAB 2N3OA 1F0XA 3UD3P 1HBNB 2HURA 1FKPB 3CWJA 1T03A 3CCTA 2BA9A 1VYAA 1S9GA 4MT1A 4DZDA 1RKIA 3G82B 3UE2A 1X4AA 1F60B 1S49A 3W2VB 3BBCA 3M32A 1LWFB 4RPFA 2HGNA 2IMWP 2VG7A 4PWWA 1MWYA 2Y8WA 1VS3A 1GEHA 3GJQB 3RTVA 3KK2B 5LMUJ 2ASYA 3VGTA 2ZD1A 3EGZA 5CABA 1OYDA 2FDNA 4CTAB 2FJVA 1YRTA 2VFRA 3CO9A 5HP1B 3RG6A 1T95A 4KY3A 3QSYB 3QWPA 5DDRC 1Q53A 3RRHA 1TQLA 2I0XA 1U1KA 1RT7A 2IVFB 4KC5A 4ZJOA 1H74A 3QNWB 2XWXA 1F2HA 4J9SA 5IT0A 1YI2S 4K5RA 2YH0A 4DXLA 2UP1A 2J7KA 4IG3B 1KC8T 4U8VA 3VWSA 1RTZA 1VISA 4E2FB 2KB2A 3D6TB 1RTHB 4KV8B 4D3HA 3L3CA 4DV1F 3LUYA 1EP4B 1OQ3A 2LXFA 2NPIA 3BZQA 4TLRA 5MLCV 1R0AA 4PUOA 3C16B 3OFHA 3W3SA 3N9UC 3QO9A 2ILYA 1S9FA 2OPRB 3POTA 3AA9A 2HZVA 4J91A 1B70B 3F0NA 4KIAA 2CIMA 3M8YA 3NGTA 5E0OA 1N6QB 2X7IA 4HEA9 4B3TJ 4HL9A 1IQZA 1FJCA 3W9HA 3D9BA 1NMEB 1WOSA 4PABA 2BXJA 2CQ1A 2NPFA 1RHJB 2WVEA 3HHEA 5A6WA 2KM8C 1RB0A 3R1LA 4O3QA 4LJMA 5CZXA 3OTOF 3KUEA 2HHHF 1XTZA 2XYHB 4PPDA 4TU8A 3SCIE 2QTWA 4LF4F 2XNQA 4M5KA 2WHOA 5ETRA 4CQ1A 2LA4A 1KP6A 3CCQS 4OZ3A 2DNGA 4USIA 2ROEA 4I0WA 1UJ4A 1NUEA 1PAUB 2F63A 4NA1A 1P9QC 2H5EA 3HSGA 1KR4A 1LKZA 1SJRA 3S6EA 4ZCIA 4EO6A 2Z8QA 3L7OA 5ETPA 2IIHA 1IUJA 1TL3A 2JZ5A 1Q78A 5IM0A 3C14B 3KJFB 5DDQC 4X4UA 2YNFA 3EXYA 5T41A 3KJVB 3ISNC 2CXEA 5ETOA 8AT1B 4I67A 5LMNF 4WZMA 2JVOA 5AXKA 4K0KJ 2MKYA 2XZTB 5GVQA 3V6DB 2DH7A 4N76A 1TP7A 4OX8A 3FSYA 3H2UB 4WU2A 2YWKA 2KU7A 2AQ4A 2YVSA 1VFJA 3MZIA 4R8UB 2C3MA 4NX9A 3LAKA 4DOZA 1F6TA 4BBYA 5F8IA 1W7WA 1YJ7A 3UCUP 4NZ7A 2E9ZA 2VPYB 3B4MA 4CLZA 5AE3A 3M9MB 3PTWA 5J1PA 1M90T 1A6LA 3BGFA 3ZTOA 4OX9J 2MLZA 5KFGA 5IM0B 1ZM4A 1IBMF 2JC1A 2RQKA 2OD6A 3FFIA 3VQTA 4JI5F 2FVSA 1QTNB 3H8YA 3CC7S 3NAHA 1YRUA 2E5HA 2QMXA 3A3OB 2MTLA 4KO0A 2IVYA 4B3OB 3EJMA 4C8OA 4ETZA 2DKOB 4P71A 2QC3A 2HQGA 3ITHB 3FBEA 2I9SA 3M2VA 2OKQA 1CJUA 5HMZA 3CD7A 2DNKA 4P7TA 2C42A 4RO0A 2CFXA 2J9EA 4TY8A 4DUTA 1U45A 4Q2MA 2AMCB 3MM6B 1R0AB 1U47A 4KE5A 3K5OA 2ZC4A 2MHNA 3CDUA 1HBNA 3THPA 2MY7A 3DLBA 4AE5A 4A8SA 3H7HB 2CQ0A 3SCLE 3KOAA 2LKZA 2APOA 5F8JA 2FUG9 4Y65A 3VCDA 5KFFA 4DL4A 4NLQA 3ZNUA 2XLJA 3HHLA 4HHJA 2MKJA 1VJWA 4PUOB 3DDKA 1RWOB 4EFAC 1M5VC 3PKMA 1V3ZA 2WOMA 4EYHB 5DGAA 3N79A 2W7PA 2ZH7A 4K4WA 2VBZA 3FMBA 2IDEA 1S76D 4GVBA 2KKHA 1C2PA 5KG5A 1RK8A 1HPZA 4F4WA 4ECRA 2GHVC 5J2QB 4RNFA 5BR8F 3MR6A 3GLJA 1YJWS 1JXVA 1K1QA 2IM2A 1R0CB 3DOKA 4LR9A 5H1SV 3PW2A 1VBYA 2AYGA 4WFYA 3DMJA 4WFBQ 3MEDB 3JQMA 4FBUA 5GAHU 4QOTA 1OIAA 1MWQA 4NLRA 1YJNS 4M8LA 5CYMA 4MFBB 3HP6A 3QRRA 4K4ZA 1K0VA 4ZVHA 3CJ4A 1JNRB 1JLCB 5KFUA 1TL7A 4NMLA 4EYIB 5KT6A 4FYYB 4ILLA 3ZZ0A 1T3NA 1UP1A 4CLPA 5J1EA 3MURP 1FI4A 1S5ZA 1KD1T 3QSIA 4JI5J 1EAYC 2DTJA 1JJCB 1KHVA 1OYEA 3HCXA 3IMQJ 5KFNA 4ER8A 1VRUB 5IWAF 1M5OC 2YKMA 3QAUA 4F2RA 1IKVA 3HI9A 4M5JA 3EZUA 1TAQA 2P5VA 2ZE2B 1RDRA 3CW2C 4C3KA 3N4WA 3KWMA 1FEEA 1RACB 4OHZA 7FDRA 2HKEA 3PO5A 5KFMA 2M8HA 4DL3A 3LW5C 4X2BA 5DZ6A 1S99A 4YFUA 4IFYA 1R8PA 3G9CA 4GKKJ 1P1LA 2KDOA 4MJKA 4LIRA 4ZP8A 4U8YA 5K14A 3J7ZT 1X9SA 1N5YB 4X64F 3DOLB 4NLDA 4CH0S 2LMIA 2RVJA 4MYTA 4OZ5A 5KG7A 2QMWA 1PKUA 1P27B 1RTDB 3MFHA 1BGXT 3N0VA 2HHQA 2W4DA 1J27A 1HQ2A 1KQGB 2ZUGA 4OX9F 4NRTA 5CCLA 1T8EA 2VG6A 5EWFA 1QSLA 4CCHA 3EUNA 3I56S 2RDDA 4DCOB 4DV3J 1U1LA 2L9WA 4ZPTR 3QGIA 2R7UA 4M1KA 1DQAA 1VGYA 2ZBQA 3S01A 1C0TB 3GIKA 2VQEJ 2DRAA 5KFKA 1UFLA 2D9OA 2Q1LA 4WYWA 3ZO7A 1U1NA 4NXNF 1UVNA 1YDLA 3R27A 4WU3A 4YDXA 4FF1A 3F56A 3I5AA 4DUZF 4G1QA 1EQ0A 2BUNA 4G6VB 4O4GB 4P73A 3J7YU 1RT1B 2HMIA 2GGPA 4PCQA 4DQSA 5ETMA 4UOHA 4JI6J 4GKJJ 1NPKA 1J5OB 3J81j 1S1UA 1NB7A 3R5BA 4RNOA 4DR3F 3VAKA 3T3FA 1R6YA 1VHFA 3KK2A 1VRQC 1IWGA 1TUGB 1S0VA 1O5JA 4OI6A 1NEEA 3BO2A 3PW5A 3ENVA 3LOUA 5ETVA 3OHAA 3T9NA 2QX0A 3L7PA 3KK1B 2RU9A 3F73A 2CQCA 1XMOJ 1JXEA 2WW4A 4WE1B 3W1YC 1UZHA 5E3RA 1D9DA 3PEJA 4FDFA 4Q43A 4DV5F 4F4AA 2UXDJ 4TYBA 2ZZMA 3G8QA 3R5DA 3TZWA 4FF3A 3PYDA 5DETA 3DOMB 4GO7X 4ZKAA 1WTBA 4HTIA 4HKQA 2MQLA 4JBCA 2QLXA 3TRGA 1QE1A 3JS9A 2E44A 4CYUB 5HLFB 1YJ9S 3FKBA 2HFSA 4LF2A 1REVA 3PR5B 2OJ3A 3SSQA 2FHKA 2VPWB 3AQOA 5K8MA 1U1MA 2H48B 2MPUA 3WQPA 2RRAA 2DPJA 5IT4A 1HNIA 3MEGA 1UCNA 3SFUA 4Q45A 1SH0A 3W5YA 2R8JA 4USVA 4NOHA 5KFHA 4UZBA 1BMQB 4B9SA 2GV1A 1KWMA 2XMVA 1AW0A 1IKWB 1PYTA 2G2ZA 2GVDB 2SXLA 4I6AA 1YJVA 3MM5A 4H54A 5C24B 2J8AA 2E1CA 1Q95G 1UW4A 2HHVA 2CQ2A 1NSAA 1T94A 2X51A 2R7OA 2HFNA 1HI1A 5EWGA 3NOCA 2HRYA 1SL1A 3NMAA 1T0TV 4M94A 4KHPF 2A18A 5DGBA 4XDDA 2F40A 3BO4A 2GMLA 4O4GA 1B0TA 1SKRA 1P9YA 2B4PA 2VPZB 2W2MP 4YP3A 4USMA 4C8ZA 2J7UA 2DIVA 2B7BB 4KGVB 3DRPA 5HI7A 2CJAA 3Q89A 3MPDA 2U1AA 3O5TB 3CMQA 3TNVA 5KOXA 3IGVA 2FGCA 5GMDA 1U1RA 4PXCA 4NXMJ 4HYKA 2KJWA 4I64A 2HBQB 4A8MP 1IKXB 2GVDA 2EEYA 3TW0A 2OPSA 4QIEA 4FPIA 4PQUA 4FYVB 2AJ0A 3UQSA 2RHSB 4G1QB 4XK8C 5FLXU 3EGVA 3SMZA 1X31C 2MLXA 2QL5B 5KG0A 1VC0A 3DMJB 2GO9A 3LP0A 3AHPA 4IFYB 4P10A 4LF9F 4Z7YA 4DSEA 4B9TA 3TEGA 1FDNA 2V8VA 3ENAA 3OR2B 3H0PA 3BQ0A 2V0NA 1VC6A 1XR6A 5M2PA 3QRPA 1GT8A 4DZ6A 3DGPA 1Q5YA 2YXLA 5J2NA 2V5HG 3ZZUA 5RUBA 1C0UB 3MEEB 4NL5A 2IC3A 5HANA 5KFLA 5KG4A 2N4CA 5LJ3Y 1JX4A 4KO0B 1HD0A 2FJWA 2DR6A 2VQFJ 4QWDA 2VG7B 4AL7A 5KG2A 4CLLA 3IA0A 1UZDA 1IKXA 1HR0F 1RCXB 2VHGA 1XBWA 1RZMA 4DFJA 1HD1A 1BQMA 1R31A 3TJAA 1IKYA 1RHKB 1UWBA 2DO4A 4M5NA 4KJIA 2PIIA 3LP2A 3GILA 2XC9A 4CP5A 2IVMA 2EFPA 1MNEA 4IH7A 4C2MA 3G6XA 2RQMA 3TANA 1HBMA 2EBEA 4ZLLA 4WK1A 4EEYA 4X64J 2HS3A 3W5ZA 1H7XA 3DOLA 5BYQA 3M8ZA 5J2NB 2CG8A 2W9CB 2W2QP 4QYZJ 1V9OA 4Y0FA 1S6QB 1FESA 3KFWX 4QPTA 3GWCA 1TELA 2CQIA 3FRZA 4N7TA 4ECVA 1ZA1B 3FCHA 4PG6A 3CF5Q 5I3UA 1S48A 2DHAA 2F3JA 2DNMA 3RB4A 4CLSA 1S97A 4Q8EA 4ZPVR 2KM8B 4E8UA 2DNNA 4IO9Q 5KFWA 3BN4A 1QE1B 2V4QA 3KKFA 4DR5J 3OD2A 4BLGA 3SCKE 4RNHA 1XNRF 2NZ4A 4LR8A 3HDSA 4DWIA 3CVKA 4F4KA 2HHUA 4Y2IA 2G13A 1S1XA 3SYZA 1OPZA 1PG5B 2CPZA 2BJ7A 3A3NB 4U6PA 2ZVSA 2HQCA 1EX8A 4IH5A 3JYTB 1ELOA 4HT7A 2CPYA 1FRJA 1GTHA 2OGUA 3FDSA 3PCOB 4J9VA 1FWPA 3E3XA 4WFZA 4F26A 4ZMMA 3W8GA 2XLKA 3HHNB 1UFWA 3PYFA 1RXOB 5LXYA 3LTOA 3T19A 2YKOA 2W9AA 4X4OA 5K5MA 2QLJB 4J9MA 1WWHA 4XIUA 3Q8SB 3TAMA 3X3UA 3PZPA 1ZETA 1OPIA 4DR2F 4FVMA 3P5TL 2K2PA 2LYVA 1I94J 4OZ1A 5JUMA 4QIGA 4LF7J 3MM9B 2QN6B 4HLBA 1TVRA 1PJ5A 2BV3A 3EE3A 1CQNA 3M2RA 5B0GA 5DS7A 3TVZA 1GXLA 2B6AA 3R7BB 3QZ7A 3BH6B 3R5CA 1U0HA 1H98A 5BYRA 5I3UB 2J7WA 4F4ZA 4LR7A 5HK4A 1IQTA 1LWXA 1Y4ZB 3QYYA 2VA2A 4DBQA 2E9RX 1YHQS 2VDHA 5E7OB 2YWWA 2DXDA 2H4WB 5EX0A 3U1LA 4Q0BB 4FF4A 5B0AA 4ID5B 1ZPWX 3B82A 3H20A 4IRDA 3GFZA 3DHWC 1FWKA 4XTTA 5LM7E 3V6DA 3PDNA 3NKYA 1HW9A 3C6UB 1FKOA 3CJ3A 3TYTA 2GJ2A 2D41A 1NJIT 2C3OA 1KDNA 4OZJA 2AEMA 5D0EA 5DQGA 3J81U 2VBXA 1MN7A 1ROFA 4OV1A 1S7IA 2UVUA 3GG0A 1APSA 5T7LA 5I42A 1KKHA 3KUGA 1T9WA 2KI2A 1HBOA 1RHMB 2BM1A 2VFVA 3DLEB 3KG4A 4K7QA 5B08A 4IO1A 3WIVA 3H40A 3HSJA 4QWBA 3BB5A 3QAEA 1NRKA 5F8HA 1PCAA 5DG7A 3QFWA 4QZVB 3Q24A 1O6XA 4RZRA 4AXJA 3TZXA 4OI3A 4EBCA 3HMJG 1RT3A 1X0PA 5DG8A 1DURA 3T1HJ 1LQ9A 1PO6A 4ES1A 1IBKF 3QLHB 2QLWA 3H2LA 2HFOA 3EGWB 2HRTA 1UWAA 2DVIA 1HLWA 2LQBA 2QIFA 3HLUA 1HBMB 2VUGA 4L3KA 5KFPA 4DQQA 1FEHA 2C2MB 4PXDA 1JB0C 1GX5A 1R7IA 3M1VA 1SJQA 1U1PA 3AY0A 3SBMA 5HQLA 2DIUA 3MPVA 2PSZA 2UV8G 4TY8B 1JLBB 1TKXA 2KT5A 3DC2A 4U7UK 1T05A 3FZ2A 3ZTQA 3QBCA 4KGXB 1QY7A 1M5SA 4O0NA 4RW8A 4ZIVA 2V34A 2EI5A 1VQYA 4C8KA 1VQ6S 4WXWA 1DTTB 1FFGB 4KKOA 3OFEA 5A8RB 4OYBA 3CCES 3CGIA 4KV8A 3ZFVA 5DO2A 3MWBA 2IA6A 4H4KA 1GMUA 5JXSA 1NDPA 1N5TA 4ZCLA 3T5HA 3QO9B 1SIWB 4KGKA 1TKDA 2UUAJ 1YQHA 2AGPA 2QL7B 3C6TB 4GVBB 2UVWA 3PXGa 1IJEB 1H2TZ 2GHPA 1NJWA 2OPQB 4FS2A 1Q81T 4RR5A 2YNFB 1PBUA 4Q44A 2BANB 4FKXA 1D3WA 2XO7A 1GTEA 3SV4A 4ED3A 1HQUB 3H5UA 4PXEA 3I87A 4V1Ak 2XM3A 2R8IA 5JVHQ 1ZTWA 2RB7A 2AX1A 2ZHAA 4AL5A 4X4RA 2IRYA 3DU6A 3MM7B 4C9DA 1AFJA 5IV4A 3OJUA 4Y00A 5EWEA 2HFUA 2GAGC 2DGUA 2LQJA 2PEHA 2XHWA 1U8SA 3PFEA 3JAMY 2LECA 2E7WA 2LXIA 4BC9A 3K8VA 3V81B 2UU9F 4USKA 3NAIA 4NLWA 3TVYA 4A48A 1AT1B 1RHQB 1WD6A 1WELA 2V2QA 2YX1A 4X4QA 4YB1P 1YWXA 3DLKA 1W2BR 3GCWP 1KLMA 1A0OB 2RAQA 1UAWA 2A3JA 3WX8A 3TAQA 1U48A 2HSEB 4F7VA 3T41A 1SC1B 1VMBA 1X5TA 2NYIA 1X4CA 1SXLA 2E1MC 2PMWA 3MTJA 3CJKB 1CEZA 1VI7A 2BZ2A 4ETXA 1HI8A 1X4EA 2HVZA 2JFDA 3C46A 3AOBA 2DJWA 5A2QU 3D6HB 2JLGA 3QIPB 2RKIA 5K8PA 1S1WA 2HK2A 2HHWA 1RT6B 2E1AA 2I5JB 5KFTA 4R8UA 1EKRA 1DQ9A 2OELA 1NK6A 5HP1A 3EYZA 1U02A 2ZDOA 4XO0A 2JEGA 5MAOA 3CCLS 2HHHJ 1FKPA 2IJNA 1T03B 4F2SA 2C2KB 4DCPB 1RWKB 4QR2A 4CM2A 2CVIA 2HZCA 4EU0A 6FD1A 4FS1A 4LFAJ 4ANDA 1XC9A 4JI2F 4JI1J 2DRDA 4C4WA 4FF2A 2CPDA 1ZTTA 4LQ9A 3BBFA 3OVAA 3J80Y 3BGOP 5CD4H 4LVOP 2NQPA 2HWIA 4LSLB 2DGTA 2WTFA 4LQ3A 1UL3A 4C8NA 4DR7J 3DRYA 5KT7A 2NSCA 3T5KA 3QRQA 1RT6A 1MROB 2HGLA 3HZEA 2B8QA 4JI8J 4DPYA 3VZHA 2CVEA 3Q23A 1R3NA 1RTJA 2O01C 3T6JA 4DN9A 2XYPB 4P2MA 5E2QA 4DQRA 1AFIA 1ITPA 3IAM9 1B0PA 3ISND 1NHUA 3QWUA 1YG0A 2R7QA 1VQMS 1QVFR 2KH9A 4CI0B 1UVKA 1U0HB 3A1YG 1BQNA 2D9PA 3J81Y 2DISA 1GFWB 3CMES 3IG1B 1YTYA 4JI7J 5HROB 2ZC3A 1WEYA 3EVOA 4JV0A 1BUXA 3W9IA 1N48A 1AYEA 2HZAA 1U1OA 4CO0A 5EGYA 1N33F 2L08A 1TKZB 4OQJA 1F3FA 4DV5J 2OPRA 3POTB 1TK0A 4BDPA 4J9RA 1IVZA 2AX0A 1S12A 2ZJPQ 4ECQA 3MD3A 1HQUA 2NXJA 3W64A 3AA8A 1FE4A 2BE2B 2YQ0A 3BGRB 1K0TA 2R2TA 2ATCB 4C8LA 1IBMJ 3FVYA 1RTJB 3Q8UA 4P52A 5A8KA 3J7YI 3OFGA 5I42B 3K7RA 1FNOA 3C66A 1UWBB 4FZVA 1UEUA 2CZ4A 3GIMA 4ECUA 1IBLF 3M8QA 3ZZTA 1A7GE 1EETA 5L39A 2YY3A 5F8GA 4JI0J 1ZM2A 4RLEA 3CJQA 1PYOB 2P2CB 2NXCA 2C2DA 4O0IA 4WFAQ 5I4MA 4MKVA 4C98A 5A8RA 2NREA 2CDRB 3BN7A 3RW7A 1G2EA 4B08A 3BS9A 1WSRA 1N5QA 3B78A 4LRFA 4C6AA 2DR8A 1CJKA 1S77D 4R0JA 3PHTA 3TA1A 3CDEA 3EDRB 5C25A 5L9NA 1FKAF 1NJXA 3FUYA 3C14A 4ICLA 4F4XA 5H9EK 2NR0A 4N77A 2J9CA 3QLHA 2MZ1A 1F2GA 1FVSA 2RJZA 2YKAA 3ENWA 4MKBA 1R43A 3RBDA 5A8KB 4DV7F 5AE2A 3OL9A 1DQ8A 4ZPWR 1XQIA 2OPQA 2BJ8A 4C11B 2QT7A 5KFAA 1RAEB 4URQU 3SFGA 3UNGC 4TNOA 3C3LA 5K8NA 3DDNA 1TV6B 4F02A 2JOQA 2QRRA 4KBIA 4LREA 5HMYA 1WJ9A 1RTIA 1NKEA 1ZM9A 2XY7A 2HFVA 2YNIB 3PV8A 1NSQA 2OPPB 4IRCA 3A12A 5A76A 3MMAB 2IPOB 4GO5X 4DU8A 2M4MA 4OIXA 2RT3A 2XWYA 2F4VF 1IWAA 4ZPAA 4JI4J 5A6PA 2BW7A 2GA7A 3GR1A 1SB6A 1F5AA 2V9KA 5THWA 2BOPA 2GJIA 5DRKA 2CPHA 1RE1B 2P6SA 3P3DA 2BX6A 1F9FA 3D3BJ 1FJ7A 4M5GA 1KBRA 2PA8D 3MFIA 2FJAB 3ZTPA 3AFGA 4OHWA 5HQMA 2HVHA 2ZEJA 3PO4A 3V4IB 2HBZB 1JLQB 1KFDA 2ABYA 2B9YA 3LPEA 4EO8A 5E41A 2L9NA 4EI2A 4H4MB 4X4VA 3DKDA 3B6BA 1W26A 3H25A 2W2OP 1YRXA 3GYGA 3HKWA 5L1IA 2ZM6J 2VQEF 3I9ZA 2KG0A 1NB2A 1FTRA 2HPUA 1HBOB 1NZAA 3DLEA 1RAIB 2FC8A 1S6PA 2CJXB 2DNYA 1M5PC 3DCAA 2Y1RI 4YY3F 4DV2J 4TLQA 2PMHA 4IRKA 1X60A 3VF0B 3QFHA 4JI1F 3OJSA 4ECYA 2D3ZA 1X5OA 1BE4A 3VVUA 5GAEI 4UUXA 1N36F 2O5DA 1JLEA 4UF4A 4WZQA 2FQQB 3BYRA 2G0JA 5GAGI 2XGPA 1CJVB 1HNVB 3GV8B 4DLGA 3UCZP 1DJ0A 2M2BA 1UVJA 1X0FA 5J1NA 2BE2A 3B8HA 1KQKA 3M6UA 3H5YA 5IFMA 1WF2A 3DI6A 2N3LA 2YQ1A 3IRXB 5D0GA 2R7TA 1NK4A 3J80U 3DRSA 2PGCA 2DGSA 3D54A 3BSNA 2NXEA 1D9AA 2ZHOA 5HROA 1LV5A 1DTTA 4KKOB 4JI0F 2MKKA 3DRRA 2HIYA 2MQPA 4PG4A 2ZH9A 1KQFB 2W7AA 1V5IB 4ED8A 1OMSA 2F65A 2VFTA 5HMXA 3PX6A 2DHXA 1NK8A 2E5LJ 4C8YA 1FXLA 3LPYA 5E3PA 2VZ9A 3UDVA 1FJEB 3DFEA 2EFGA 4ZP7A 4LFCF 2JJ4D 5A8WB 1LK7A 2GMJA 3HSDA 2KHDA 2WVFA 5F8NA 4Y2AA 2YKNB 4MK7A 2G4BA 5C2CA 1RWWB 4Z37A 1NSKL 1XMQF 1T9TA 4U95A 2ACMA 2JH3A 4F3MA 4OHXA 4DR3J 1OY8A 2UXBJ 4I2QB 2HHTA 2RUSA 4GVLA 1TUWA 2QYGA 3JTNA 2QL9B 3K89A 1K8AT 1DZ5A 3K5PA 3I4HX 1WNEA 1TL4A 2D3UA 2VU5A 3IAS9 5AT1B 5J2PA 1TAUA 2RU3A 2CQ4A 3H42A 3FGVA 4DR1F 1NH7A 1T9VA 2ZOGA 2B4OA 4LMZA 5KFSA 1TVRB 3M2RB 3OVSA 4MIBA 4K4SA 1M1HA 1Y11A 1WTFA 4A8KA 4NXNJ 4ZJLA 1Y0HA 2Z4PA 2N82B 4PYDA 4ECZA 2XMAA 3G6ES 1EKSA 1FDAA 1KOHA 2G0CA 3JSYA 3ZC4A 5KOWA 5I3PA 2P6TA 2HK3A 2PDAA 3D3CJ 2GC8A 3TX0A 4RBVA 4X65J 2M9KA 1XERA 1TTHB 4DR2J 1UA1A 1SBRA 2RKIB 1J5OA 3ILJA 4WF9Q 3BKTA 4WP3A 2KXHA 2PMZD 9ATCB 3BH7B 3DGVA 3CO0P 5G0RA 1Q5VA 2C3PA 5EDWA 2O66A 2M70A 5E33A 1XR5A 4E98A 4RX6A 2H4YB 2IM3A 2V8PA 2F8HA 3PM9A 3K59A 3JTOA 4ED2A 1QAJA 1WEXA 2FLOA 2JRSA 4HI2A 3K0JA 2BW2A 2ZBPA 5IC6B 1NJZA 5B7WA 5I3QA 5LMUF 3IP0A 2XTJP 3G71S 2C2RA 3NGDA 3AB2B 1Y7PA 2CNKB 2UUBF 2AP6A 2Y9HA 3WDOA 2V8GA 3F41A 3PRVA 4DEZA 2UUCJ 2XNRA 2DH9A 1T02A 5KFRA 5EHHA 3LWMA 4O3SA 5F9LA 2YNGA 1ZOTA 3QIDA 4LVNP 2IYIA 4NYPA 4AQYF 4Y2MA 3CCMS 4K4XA 6AT1B 3UN2A 2XMMA 3GR0A 3W9JA 4IDKB 6FDRA 1N32J 3G6VA 4K2JA 1HPZB 3GMGA 5J2QA 2LDIA 3BO3A 3TUPA 1FCAA 2KVIA 3MECB 5CH7B 1MW7A 4C0HA 2C28A 1NAQA 2QG9B 3PY8A 2XCAA 2GIRA 4YQWA 1RU2A 4OI0A 3U1NA 3TJ9A 1RBAA 1EQMA 2WRMA 3NWRA 4KRWA 2BJ9A 1J2VA 4I6WA 5LL6d 4CNZA 5C24A 1IXKA 1K44A 2CZ9A 3KJNB 4NYOA 2UXDF 4FYDA 2LXUA 1RT2B 4QWAA 1SI9A 5KT5A 1F3VA 5E3CA 3PHEA 2ZZTA 1NLKL 3QGGA 2P9GA 5AXLA 4M5MA 4G1IA 1RWPB 2BACA 2YNGB 3IWXA 1YZ6A 4NMXA 3GFHA 5D8HB 4WYLA 2R7WA 3M6XA 3NS7B 1SCJB 3GE9A 4ZVFA 3OUYB 4OYIA 1M1GA 1R8BA 3IM8A 2CQBA 2J5AA 3ITHA 2DR9A 1HNWJ 2ZE2A 3KDOA 4HHUA 2DCLA 1FJGF 3EGNA 2IAJA 3G86A 4C3MA 4J5OA 5LT5A 3MI7X 2Z2YB 1N8RT 3KLHB 3PR4A 4TY9A 2C2EA 3KLIA 2WONB 3AT1B 2OLWA 1EARA 4GMKA 3RGIA 3V6JA 2YNHA 1T11A 1AA1B 3MM9A 2KN4A 1R8CA 5B0DA 4L74A 1YITS 1NHKL 4HT5A 2R2SA 1QTMA 2MGZB 3RB3A 1ZAXA 2AJQA 4WP9A 2M0GB 1MU2A 4L76A 4Q7AA 4URGA 5KFDA 2HG4A 4YR2A 2HBYB 2YTCA 3FC9A 2F7VA 3BQ2A 1KVJA 3OL7A 4WJBA 1GXTA 1C0UA 2D74B 2Z58B 3MEEA 4QU7A 3IFEA 3FMWA 3NCPA 4MTPA 2GW8A 2D3O1 2CDQA 1QJHA 4LF8F 2CG4A 3GONA 1F9EB 2OO4A 2EC0A 4U9RA 1ZAVA 3DLKB 3J7Z5 5IC4B 2COLA 2MZRA 3GFXA 4DX5A 5IV3A 2CQHA 3HVWA 1OSCA 1XEZA 3UDEA 3IWNC 3R2DJ 4JV5J 4PWDB 2B51A 1F5BA 1JJHA 1WOPA 2LA6A 2QYCA 3T9ZA 5ADZA 1RT2A 3QATA 2ZJQQ 4DV6F 4LFAF 1DARA 1NO8A 1RT1A 1WG1A 1WKJA 2HMIB 3HJFA 1V3SA 1SC3B 2QJ3A 3OPKA 1I5OB 2FGOA 3T6BA 1X5SA 1XIQA 3AOAA 3CNQP 4HR2A 4A46A 9RUBA 1S1UB 4B3RF 3CD5A 4C8MA 3I32A 1YSJA 4ZCKA 2ASJA 3D66A 2GQCA 2NSBA 4OI2A 4UQGA 2Z57B 5D77A 4CYUA 1FK9B 5AXNA 1D0EA 1S59A 2QFJA 3R5JB 2IYGA 3P5BP 2IAJB 2GNKA 2OSQA 2RILA 4B3MJ 2M52A 1K73T 3PX4A 2ALZA 1SL2A 3M4XA 2MEWA 4C7QA 4OYWA 2KL8A 1OY6A 4QIFA 3VVTA 1Q7LB 3ET6B 1IM4A 4IQMA 1N34F 1FF2A 1WC6A 3I6PA 1JLFB 1WACA 2KYZA 3O6QA 3SI8A 3SXLA 2ZH4A 1IR1A 4U96A 4P6QA 4BHQA 1RABB 5BR8J 4ECXA 5GAEU 4QU6A 1SQGA 2MQNA 4HTJA 4X84A 4Y2KA 4QWEA 1NXIA 3HSZA 3GZ7A 4EBEA 1FRXA 2Q6CA 3DHXA 5B09A 2PEBA 5C42A 3VAIA 1CS4A 1TUVA 5BXIA 3N5FA 2LVWA 2D69A 1LNQA 2MZSA 1WDTA 2BJDA 5CYMB 1UEKA 1YZ7A 2HFZA 2NS1B 2ZFHA 3ILOA 2QMUB 3R7NB 2PI5A 3ONQA 1B7FA 2B9XA 5HLFA 4CH1A 3RAQA 2W8LA 2V4JA 2E5IA 1U09A 4NI2B 2DT9A 4N8NA 3CJSA 3OQ2A 2ADBA 5GMKa 4DX8H 2VL1A 2ZVIA 2V63A 3M8QB 4UOGA 2BKPA 2OMLA 3D7SB 3H98A 2CJ9A 2L3MA 2W01A 3M2UB 4QW9A 4NXMF 4ID5A 4KGZB 2AJFE 3V6HA 3PVXA 3CCWA 3CULA 4WWSA 1Q1KA 1YBUA 5L1JA 5H9FK 2KXNB 5FD1A 1Z2LA 1VLOA 2FTRA 5F0WA 5IQ6A 1LOUA 1LXNA 2R3VA 1ZZFA 2BE7D 3RR7A 2W1BA 4ERDA 2V2VA 3MM8B 4OJHA 4ES2A 3TQ1A 4O4RA 1N5YA 1KSPA 3LP0B 3NLCA 3PJ9A 4GRSA 1WEZA 3CTRA 4EBDA 5HMWA 1L3SA 1S72S 4NLUA 3TUIC 1AZSB 2I38A 2GX8A 1SUQA 2FZKB 2D3OR 4ZPDA 1QAYA 1URNA 2W4PA 1X9MA 4JYAJ 2V2KA 1RAOA 5IZHA 2JVRA 1D9FA 4MIWA 3TUJC 3QIPA 4UUWA 2RQCA 1HFEL 4KB7A 3NBPB 4XPEA 1L5UA 2HWHA 3HHLB 2DGXA 1HR0J 4DF8A 2C3UA 2MJNA 4HVZA 3MM6A 4MKYA 4WXOA 3UR3C 4DDFA 3BM7A 4AD6A 4HACB 4EZ6A 5DQIA 1RTIB 1S0MA 2MQMA 2Y3YA 3N01A 4R5PA 4V19X 3HHDA 3H5SA 2DGVA 2J9DA 1BQXA 3CJ2A 3ETOA 2UUCF 4YOEA 3K8WA 3Q8PB 4USHA 2GCFA 2JX2A 2WAQD 2MQOA 1R8HA 4LSNA 1KS2A 1Y9OA 4DUYF 3HD1A 3MCSA 4RW8B 4RNMA 4WE1A 3DLGA 3KLFB 2EC2A 3TAPA 1YIJS 4E0DA 4Y6IA 2VQFF 1WC1A 3BPDA 5D15A 5B0BA 1OJ4A 1Z4UA 3OTEA 4CO4A 2CNNB 2CJBA 2J8SA 3DYAB 3MDFA 3UFCX 2I1RA 2WBRA 3BBBA 4J9LA 2I8EA 4B3OA 3V4IA 4QR0A 4Y3CA 3KJVA 3ISZA 3SEOA 2FD2A 3L95X 3NGKA 4NZ6A 1BLUA 2I6WA 1H3DA 2ZH3A 1GK8A 3OBIA 1RWUA 4KH1B 4ANEA 4C0OC 1ZA2B 5LOQA 4F3QA 1O0PA 1KTQA 2KYXA 1N6QA 2BBEA 1HBUA 4G1PA 1W25A 4B3RJ 2PD1A 4OHYA 3ULHA 4WCEQ 2FLPA 2OEMA 5KT2A 2WBMA 4F4YA 1B7YB 3EZOA 3BQ1A 2YH1A 1B4SA 4JV1A 1SJ3P 1I51B 1RU1A 4RW6A 4NCBA 2ZKUA 3O1LA 4MIAA 4HH1A 5DJBA 2FC9A 1SH3A 1Y3KA 1JLGA 2OUGA 3R8YA 4IQXA 3OXFA 1X5PA 3BGRA 1XMBA 1R27B 4ZVTB 5IOLA 3OV7A 1NK5A 4X65F 3OSPA 3N5BA 3AD8C 4PG7A 4NE9C 3UNYA 3GJSB 3HXMA 3EDQB 1VRTA 4CLKA 3L09A 3WZ0A 4ZPCA 4WKYA 2R7XA 3MOJB 5E5NA 2JEFA 3BF4A 2AJ1A 1RHUB 4LFBJ 3CJ0A 3MM8A 3OTBA 2J0XA 4QJVA 2RUGA 3ENQA 3QT8A 1HA1A 4OYZA 3IN5A 4W90B 3BGLA 4YEAA 2HQFA 3A8IA 3UN5A 1DFDA 1RUSA 1TKTB 2R42A 2ZUAA 2VFUA 2YWFA 5F3TA 4IUFA 1LWCB 1Z2ZA 4PG5A 2NZCA 1CJKB 1DLOB 2BABA 2XLIA 1FHTA 1TMMA 2MLYA 1OS5A 1V6HA 3VAFA 4F36A 1UVIA 3J7A1 4IFVA 5T7LB 3JQJA 2HQDA 4DSFA 1E6YB 2UV8A 4M5DA 2J0QD 3QJPA 2IBOA 3TA0A 1LWEB 2V94A 3CCRS 1WORA 2MKCA 3Q0AA 2M88A 4DL0C 2LP4A 3C16A 4DV7J 4DPOA 3GYXB 2CNOB 4CO2A 4CLWA 3MTKA 1S1WB 4JI6F 4RU9A 1WC3A 2OTJS 3RAXA 3MAHA 2XS7A 4QBUA 1IM6A 2DNZA 1X4FA 2E7VA 5ETTA 1RAJA 2E1PA 4X4TA 3C15B 3GV7B 3I0SB 1MROA 2VG5A 2DY9A 3TR5A 3KHGA 2YNIA 1TKTA 5HVGA 3MXHP 1NCLA 2EG1A 2A0FB 2V4RA 3CCUS 1U1QA 2V2ZA 1HARA 2KG1A 1B64A 1H0HB 3BREA 4LIWA 1CULB 1HWLA 2JHEA 3PJWA 3PKYA 4KTQA 3SDEA 3CIZA 2BQUA 5LSRA 3BV8A 1FO1A 1HYSB 2RMLA 2IDLA 3I96A 4B9LA 5CAAA 2BJ3A 4P72A 3AODA 2FHMA 1RWVB 3P45B 4A47A 1D1UA 4PWUA 4LSLA 1FERA 1AZSA 1CC8A 1FFWB 1ICEB 1NPPA 2CWXA 5DLGA 3NS5A 2R9LA 1VOMA 2E29A 2HQIA 1RP5A 3PW7A 4KT0C 2GVZB 1Y5IB 4X66J 3LGNA 3W66A 1CG2A 4YHHJ 3GIRA 3C15A 1WF1A 4XDCA 2Q79A 4C97A 2ACYA 3VAGA 2E5JA 2ZITA 3DYAA 4KR0B 1WSVA 2QE5A 3TA2A 3E2EA 4K4YA 2KFNA 4B9UA 4USUA 4R5PB 3S8SA 2XMWA 4UY85 2HNZB 2DNRA 4OZLA 5JVGQ 1Q4RA 2Y8YA 2FY8A 4EUVA 2G2YA 1S1XB 2VF3A 2MQ8A 1S0OA 3M8WA 3KK3A 1PC5A 4RW4B 1QAXA 4I6YA 4LRCA 3HM9A 4DV4F 3OTDA 1U49A 4O44B 3V5RA 2XZWA 5CA5A 2YKQA 3FJ2A 3PYEA 4V19J 2Z0GA 4CIOA 4PR6A 3WBZA 2P8IA 1SUQB 5C25B 1VBKA 3Q2SC 3RBXA 2LEPA 4NYZA 5T14A 2XULA 1S79A 4OJ1A 2DHHA 3HPOA 2BDPA 1BHNA 3FQKA 3OTCA 2VJVA 2FB0A 5ETQA 2AYEA 1RYRA 2ZH2A 2OIHA 1FRIA 1D8ZA 1SC4B 3MECA 2OEJA 4CZCA 3T1YJ 3CEDA 3MM7A 1L3UA 4PQUB 1KN6A 2KRRA 3DLGB 3KLFA 2I5JA 1RAGB 2B4VA 2GQ2A 5HBMB 2K3KA 1RA7A 2DK2A 4DL5A 2V9WA 2AKWB 4DPWA 4FBTA 1DRZA 3QJLA 3VALA 2F4FA 4IR9A 4DI6A 2Y1LB 3R9LA 4RKUC 1LW2A 4F0MA 3DRXA 2JNJA 4OZ2A 2R7VA 1KQSR 1W2IA 3GP9A 4I4BA 5HATA 4DFPA 3LH2S 1U6BA 3RBEA 4MK8A 3HX9A 3TAMB 4NLVA 4KGMA 2BM0A 2K06A 3A8KA 2GHWA 4JOUA 4J90A 4NLTA 3G6YA 2HVIA 3OTOJ 4UQTA 5J2PB 2FZGB 1HIYA 3IC1A 2NUUG 2WSFC 2EXUA 1O51A 2IRXA 4OYAA 1MG7A 3ZXWA 4PG8A 5JMNA 2ZH8A 5DLFA 1HWKA 4W98A 4YS2A 3LQVA 2X1GA 4H4MA 1CPZA 5HL7Q 3P8BB 1JLGB 1RGVA 2X1BA 1MMNA 4KFBB 5KG3A 4ZN3A 1G4CA 4IG3A 1HMVA 1S1TA 5GMEA 3NXZA 3TOQA 3UI3A 1FNXH 4UY8T 3OR1B 1N0UA 4DCJB 2GO8A 3D0IE 1BY9A 3IM9A 3QT7A 4LF6J 4RUAA 4DR6J 3MR7A 4EMDA 2DYAA 5KG6A 2JLEA 4IOBA 1RQ0A 3VGVA 5KFVA 1KNZA 2K1RA 4NCGB 1I1GA 2QSFA 2R8HA 2R7SA 1VRUA 3OSNA 2FIUA 3BDPA 3TVKA 2AJ4A 3FBCA 2AZ1A 3UDCA 3RB0A 3Q8RB 1U2CA 3N6NA 3UW1A 2ZWPA 2OH2A 4M95A 3GJRB 3CIMA 2HHSA 2H9ZA 3CD6S 1Q7YT 3A4TA 3N28A 3R6LB 1U25A 2MKSA 5FJ4A 4DG1A 3MCNA 4DMZA 5F9NA 2FYXA 3CE8A 4WK3A 2A10A 4GKJF 2C3YA 2YWHA 4JI3F 1FK9A 1GH8A 3BSAA 4IDKA 3OR1A 1FXDA 1DTQA 1PSDA 3A3PB 3O2IA 5ETLA 2R7RA 5E3QA 4B9NA 4FP9A 3R3TA 3W61A 3DM2B 2YX4A 1EB0A 1TL1B 3E01A 4YB6A 3PX0A 3HVTB 4RU2A 2VODA 4NLSA 4RBUA 4AYBD 4DV1J 2QV6A 2ZHBA 1TFYA 1WHVA 3Q8YA 1FRLA 4OFZA 1VIOA 3ET6A 2LU1A 1QM9A 2FJBB 1KOOA 2BRLA 3T1AA 3M8RA 4DLEA 4O3OA 1MMLA 3GFYA 1U2RA 1UMJA 3ZNJ1 3TZYA 1VQNS 4ILMA 1FTCA 1PYSB 2ZD1B 2DR5A 4DFMA 3HT3A 2AIRB 8RUCA 4F0KA 1XR7A 2E1RA 4OI1A 4F0HA 2BRKA 4KYZA 3TP2A 2QLFB 3MMBB 3ZZYA 2FJXA 4X62J 4N8OA 1PJ7A 2ROPA 3D6MB 3UO0A 2RS2A 3D0HE 1ZH5A 2BR0A 2LEAA 4USTA 3R97A 1WHWA 2PT0A 3BR9A 1N34J 1C0TA 3HO1A 3HK2A 4ECTA 3PIPQ 3C6TA 3D4JA 2F8EX 2FVCA 4OYMA 3MUMP 2XMJA 2KT2A 1WHYA 2WB4A 3DU5A 4A8OA 5HN0A 4ED0A 3NNAA 2HAFA 1S6UA 5C42B 4F3OA 1SQFA 3ADAC 4DX6A 1MU2B 2BJ1A 3U27A 2OP5A 2ZH5A 4MKAA 1G3OA 4P7VA 4PAAA 3UWTA 2MSTA 1VCTA 3HHLD 2HNDA 2QFIA 5GADU 4TQSA 4K4TA 1OY9A 2M8DB 2VC0A 1XNQF 2DB1A 4YB7A 4PRFA 4JP8A 4LRBA 1BQMB 2RF2B 4DV0F 1X9WA 2BQ3A 2VA3A 2WONA 2AT1B 4C48A 1DAXA 3CCJS 3U02A 5IT9U 4N56A 4ZVPB 1PBAA 1XNQJ 1U26A 3JYTA 4RW7B 5L1LA 1RWXB 3MPYA 3D1HA 1VJQA 5D4PA 3W2WB 2HHXA 1VQSA 1VLYA 2B3TB 1G6BA 2F9JA 4H4OA 2PE8A 3UD5A 1RKJA 3Q8QB 3GTYX 4B3TF 4PQAA 3TO8A 1HNIB 3MEGB 3EPGA 1WC5A 1I6JA 4K5SA 2UVVA 4K50A 4KHRA 3DLJA 1BD6A 3WC0A 2IFXA 4N41A 1YKWA 1IKWA 3MUVP 1KHWA 5G0RB 3UVJA 2Y0BB 2HEKA 4NLYA 2ASLA 1E6VA 1M5HA 4UOCA 3DM2A 3MHYA 3JTPA 4A8XA 3W63A 4JV2A 1VBZA 4CDIA 3DDIA 4PWDA 2RQ4A 3FCVA 3SDEB 1BXNA 4WIIA 1H73A 3AXKA 2AZ3A 3MM5B 4YY3J 4DV2F 3SIPB 5A0YA 3A13A 2KFZA 4L3NA 4WFXA 4OX6A 1H2UX 4OYOA 2R4FA 2MMYA 3JSMA 1JMTA 5KT4A 3TI0A 2Q3PA 1FNMA 2D1CA 2AYMA 2YQ3A 2MQQA 3P4UB 3DRRB 4BS2A 4ECSA 3UCGA 2CRLA 1VR6A 5SZTA 2BQRA 2UVRA 2ZNZA 2L9DA 2VG6B 3SZ2A 3T5LA 3Q22A 3NS6A 1UETA 3LGHA 2KRBA 5M2UA 3VZIA 3BJYA 2Z56B 5DQHA 2V50A 1TV6A 2IY5B 4F8RA 4JI7F 2MXYA 4LBHA 1UVLA 5LSOA 1VQ7S 3HZGA 3U7JA 1L3TA 2DPIA 1Q79A 4NLGA 5E3AA 5CYQB 4ELUA 1VHIA 2XQCA 2G9OA 1REGX 4DN0A 2X3GA 3A8EA 4U7CA 4CH7A 5BYSA 2J9DE 4NLPA 5D4LA 2VPXB 2VBYA 3D5MA 3D6FB 2GQQA 4Q2LA 3W7BA 3JSMB 2Z2LA 2MB0B 4H4OB 2HQ3A 3K58A 2MKHA 4JI2J 1N0VC 3QT5A 3C19A 3PFOA 4DR7F 1Z1ZA 2CQDA 3CJ8A 3LP1A 1FD8A 2O1PA 2ZBRA 3WX4A 2XY6A 3JQKA 1VQLS 2KTQA 3MPWA 1GXUA 5D4NA 3M2UA 4ES3A 4DS5A 3LWLA 3NCQA 2DY1A 1O8BA 4BC7A 2IMOA 5J1EB 1ZYQA 3ZTRA 2UUTA 1YK9A 3C8YA 3PG9A 3KK1A 3MMJA 3R5GA 1N5SA 2HLTA 2UU9J 1XN9A 3IR6B 1RHRB 3MCOA 3O3LA 1LFWA 3W2WA 2RSQA 2OTLS 1F1BB 3KLIB 1JQGA 1V5VA 3NOGA 4LF8J 1RT5A 1SKUB 2LQ8A 4O3PA 4IG0B 1TL5A 4AUKA 3GG1A 3V4MA 1RJJA 1C4CA 5M2RA 4ED4A 4CO5A 1TL7B 2YBVA 3HVTA 4LRDA 3VGSA 1S6OA 2GGPB 2MGZA 1XWLA 3W60A 4QCLA 1YJUA 2ILZA 4UOFA 3OFFA 2YKMB 4BCAA 3BYPA 4ZOSA 4CNYA 4ZP6A 3HKZD 3TEHB 4DHVA 1HL6A 4F04B 5L46A 2KZZA 1RA6A 3KHLA 1X4DA 3EZ5A 4RL1A 2EPIA 2H51B 2QLBB 4OLOA 5ITHA 1J5EJ 4DL7A 3GIJA 1EIYB 3O8WA 4Z7CA 3N6MA 1BWVA 1H38A 1VK3A 3K2YA 2XSJB 1YBAA 3GJTB 3NG8A 1QUVA 5BJRA 4P9SA 3KHRA 3PW4A 2M3DA 1J5EF 4DL2A 2KHCA 7FD1A 2A1BA 1X7VA 2P9CA 2U2FA 3DXSX 4ZPBA 2XY5A 4H4KC 1PAEX 5L38A 5AJ3J 2E5GA 3CJKA 4ZP9A 4QYZK 2A2CA 2JL9A 3HHKA 3RUBL 4B02A 3UR0A 2OI2A 3I0SA 3P6YC 2I2YA 1SKSA 1GMWA 1UJ6A 2IA0A 3ZZPA 3CC4S 3NMRA 4DSIA 2DRBA 4OZNA 3QGHA 2RF2A 1GMVA 1R0BG 1HWIA 2CA9A 2LDYA 3CDWA 2M7SA 3MPUB 4FVCA 3PJXA 3TX8A 2XMKA 2HGMA 5KFJA 2VJUA 4FYWB 2ALYB 3MR2A 4WP8A 4KHMA 3UN3A 5C7PA 2VBWA 4P2XA 4U7UD 1SL0A 1FXRA 1EZZB 3D28A 4I56A 4N47A 4Z2XA 2J6UA 4HI1A 2W2NP 1WKLA 1QD1A 2AF6A 4Y28C 1P1TA 2XCPA 2AGOA 4LF1A 2B9EA 4L75A 2C2ZB 5F41A 3M9NB 1JLEB 4UW2A 1S9EB 3GCXP 4QW8A 4YHHF 4ZVGA 3RBZA 3D2WA 1T9UA 5D4OA 2LFVA 1JLCA 1HNZJ 4I2PB 1Q0NA 2WOMB 3WHIA 2PC6A 2EFVA 4DQPA 2CPIA 2WK4A 1FRMA 4DQIA 5D0RA 5A8WA 2MSSA 1NU4A 2XS2A 1R6VA 1IR0A 1Q16B 2BE9B 2VDIA 3DOKB 4LBPA 3G8SA 4DR4F 1AUDA 1HNXF 3M8PB 2F5GA 1OQ6A 2ZJRQ 3KK3B 5CCMA 4MFBA 5IS2A 3I4PA 4Y34A 3SSSA 4W4MA 1Q8LA 2J76E 2AEFA 2W4CA 4J9QA 2RNEA 1NNDA 3ETMA 4U67Q 1QAIA 5K8OA 4LF5J 5L9XA 4K0KF 1L3VA 2WVBA 1D8YA 2X1AA 2A6OA 3EM1A 4AT1B 2JSXA 4CLYA 1XJWB 2ZBIA 4M63A 3S1TA 5AE1A 5LXRA 1HNZF 1JLAA 1WDDA 3RYLA 3M8SA 1NZ8A 3EMTA 1S57A 2HNYA 2NYHA 1N52B 1Y5LB 1AROP 1UEVA 1LW0A 2DO0A 2XBPA 3VGUA 2N7CA 1LEOA 2W9BA 4B9MA 3FEZA 3L7UA 4ENOA 2VD3A 4JB8B 3GIIA 8ATCB 4HH0A 2LEBA 4W92B 1IKYB 4ZLPA 1JJ4A 4LSZB 3WC2A 1K1SA 3QQCD 4PYAA 4YB5A 5LJ5Y 1B99A 1SVDA 2LCWA 3FSXA 4O23A 5B0CA 4J9OA 1C4AA 2WVCA 1FRKA 3T5JA 4FKYA 1QDUB 2DHSA 1ZZNA 3VAMA 2FVRA 1VQ4S 4A8WA 4DV6J 1YX2A 4NLOA 2F9DA 2DNHA 1RADB 2DNQA 1SC6A 2AJ2A 2DBBA 2YPYA 3AD9C 4BWMA 4ZHRA 1ZAWA 4USJC 1S9EA 1LWEA 1S1VA 4ICLB 2DNPA 2MJUA 1Y10A 3H90A 3OT9A 5ETSA 4IR1A 3OR2A 1X4HA 2ZZNA 3G87A 5IT9Y 3FCWA 1OWXA 3IBCB 1MSWD 2EKNA 1UPMB 4ZVSB 5AJ3F 2H3EB 1XK8A 3QGPA 1CJVA 1HNVA 4M5LA 2DNLA 1XMQJ 1MLAA 3KUHA 1G7CB 3I31A 1EJ7L 2J0WA 2K7KA 2V67A 3I9V9 4NA2A 2RRBA 4PZVA 4P2FA 1NJYA 5KFZA 2YPZA 5DZ7A 3E8OA 5CXTA 4WKRA 5DDPC 3NGUA 1S9GB 3D0GE 3BR8A 1NK0A 2ZDPA 4B3SF 1HYSA 4YUDA 3AJDA 1DBDA 4QIWD 2WZ1A 4TU9A 2HYIB 2HW3A 3HVAA 2VIHA 5B0FA 4JI4F 1S1VB 2FY1A 2GVZA 3OL8A 3CD0A 1SPBP 2K1RB 1PILA 1UPPA 1XMOF 1FVQA 2BYCA 2V8HA 4PPZA 3G96A 4K59A 4RW4A 4NRUA 3RRKA 3GPAA 3B54A 4RNNA 2UXCF 1BC6A 5KFYA 2FZCB 2KJVA 1Q8KA 2HNYB 1TK5A 2JEIA 2AEJA 4C11A 2CPJA 3HF5A 1FX4A 1B0VA 3CJTA 4FNHA 2F1FA 4IH6A 4DPUA 2WW8A 4TXSA 1NKCA 2IBKA 1Y5NB 4FXVA 1F9HA 4PKDB 4K2XA 1RTHA 4CLUA 3IS9B 3EWGA 1IKVB 2Z2ZA 4ZLJA 4X62F 2XS5A 2V69A 2ZOFA 4FN5A 4I69A 3OXGA 4RW9A 4CWBA 1NPRA 2HWTA 3CUNA 2MZTA 1R89A 1GMWD 3PEHA 2AWZA 2OMOA 5KT3A 1UKUA 5DM7Q 2CNLB 2EW9A 4P2SA 1HW8A 3KJQB 2XMTA 2NXNA 2V68A 3OUYA 2XGQA 2EWHA 2G0IA 2YX7A 2RS8A 3E51A 1FA0A 2B43A 4ZK7M 2Q66A 3H4BA 1SV5A 2EFQA 2XI3A 1C1CB 1WC0A 2DGQA 4DJBA 5F8LA 3CC2S 4NA3A 2Q6BA 5EX3A 1Y00A 3IR7B 3VAJA 1CVJA 5HBMA 4R0EA 4N5SA 3BSOA 1L3KA 1AUSL 4HHHA 4IOCQ 1NK9A 1M5KC 5L8RC 7AT1B 3OLAA 2AW0A 1IN0A 2VOPA 1X4GA 2QGFB 4RW9B 1C1BA 2CADA 4J9PA 1KFSA 1SQEA 2QSWA 4IFVB 1K47A 3QMQA 3KXDA 3V81A 4B17A 4A8FA 4ELTA 2VONA 4KHPJ 1A9NB 1Y3JA 2IHR1 1VQOS 4A4JA 1CJTB 3LA0A 1FD2A 2B7CB 2XI2A 3MF5A 3ICLA 4TYAA 4ZCMA 5HJYA 5IWAJ 4YR3A 5F8MA 1SH2A 1LWFA 1RAHB 3QT6A 4DS4A 5CYJA 5H9EJ 2NUHA 3G82A 3IR5B 3M30B 3MEKA 2KVQE 5CHCB 4ANCA 4ZHRB 2C22A 1SV5B 2CUYA 1RBLA 3NBPA 2V8DA 4ZVUB 3MMCA 3SCJE 4DPTA 3CXCR 4QQBA 4GKKF 2O3DA 4HACA 3FK4A 4ATNA 5HJXA 1RT4A 2AHOB 2CWKA 3MAAA 1JLBA 1TKXB 3BGUA 1U6FA 3M2VB 3HVRA 4DR5F 2CKWA 3AJ2A 4ED5A 1NDCA 2WCXA 3BKFA 2QZ8A 5GADI 2VKRA 4NCAA 5HO4A 2JLFA 4ZVQB 3UPFA 4AL6A 4ED1A 2FLNA 3PRDA 2Y1JA 1ZS6A 4K4UA 1TU0B 2ZKTA 1ZM3A 1JLAB 3DGPB 2JFKA 1UTAA 3M32B 3NEKA 1OSDA 1R8AA 2C2NA 4ALZA 1RCOB 1RAFB 3AQPA 3GYNA 5HAOA 4F25A 1JXLA 2D7SA 2CYYA 3BEGB 3ZZRA 2W9BB 2OFGX 3EICA 2AGQA 3DNCA 1NK7A 2JDJA 1PC4A 1RT3B 3J7AN 4K8RA 3D68A 2V6AA 2GFFA 4CTAA 3RZAA 3JXOA 3CSKA 2ASDA 5CZVA 3KNGA 2GJFA 3KMQA 2H5IB 5D6GA 2X3DA 3K5NA 3PRBA 2YWGA 1TK8A 5G4DA 3RU0A 3PNIA 4CO3A 3SV3A 3L9ZA 2R8KA 1GQEA 2K8GA
chains in the Genus database with same CATH topology
4IKAA 5IXUA 1QUPA 3M1VB 1JWWA 1Q8IA 3UD4P 2UUAF 3KLHA 4OLPA 2VV5A 4OMFG 3CCVS 1UA0A 4RW6B 2JEJA 1BQNB 4B9VA 4DSKA 5KG1A 2DH8A 2ZH6A 1T05B 3DLLQ 1KONA 2KZMA 4MH8A 3S7RA 1JLFA 3IS9A 3VAHA 4YR0A 2W9CA 2ZH1A 2V4JB 2EK1A 3LGMA 4I7FB 2CQGA 4NZ0A 2Z2MA 2E9TA 2UZAA 2F8MA 4FNIA 2NLWA 2YKNA 2KT3A 4M5DB 3OL6A 2MHEA 4X4PA 4TU7A 3OVBA 4J9KA 2HIQA 1N88A 2A2DA 2B5JB 4RWXA 1N54B 3VQSA 3KYLA 1VQ8S 2M5YA 1RISA 2VH7A 1RI7A 2YWEA 4NPOA 2IJFA 3QPIA 4OJ3A 2HNDB 4XAKA 1VIXA 3IXQA 1LXJA 2HS4A 2VG5B 5L1KA 4LSNB 3P96A 1JKHA 3CPWR 2P9EA 1HNWF 5GAGU 4K4VA 1VRTB 4EGLA 3GSDA 3K57A 1P8GA 2VC1A 4DSLA 3ZZZA 3W2VA 3RRGA 1KTVA 1KLMB 3LANA 4G3IA 3U1MA 2W7OA 3H2VE 2FJDB 3DRPB 3O44A 1SJ1A 4Q0BA 2NXUA 1YVFA 1JIHA 1LWCA 2IM1A 5FLXY 2R2UA 1TR0A 5KTQA 5SUHA 2OSRA 3DXBA 4C3LA 3AB4B 1HBUB 1RT7B 4DFKA 2JC0A 2LU2A 4QR1A 3AAWB 2B4UA 4ED7A 3FEYB 4ZS6A 3H5XA 1TZ0A 1VQPS 1MMDA 2MY8A 5JJBA 5J2MA 3CT9A 5KFOA 1RTDA 4LT6A 4NLXA 3I5CA 1X8DA 5F3ZA 2W8KA 4OZ0A 5KFBA 3FFIB 3C2PA 2B0GA 2B56A 3D1OA 4C0BA 1SIZA 5A0YB 3NNCA 4OJGA 1FKOB 3PW0A 3NRBA 2L48A 3M6VA 1WF0A 1S6QA 2Y1IA 3MGJA 3KLGB 4Q8FA 3HFKA 3ZZOA 4DG1B 1E6VB 4Y2CA 4GC6A 1NKBA 2CPEA 2POKA 4R25A 3KLVA 3R5AA 3LO3A 3HHLC 3CMAS 5FIIA 3IGNA 1KEKA 2B6AB 3CDBA 2QA4G 3NCRA 3T1YF 5EUHA 3IWLA 2J6SA 5FDLA 3OXLA 4FPRA 2HS0A 3DLHA 2YNHB 1H7WA 5C5JA 2DGOA 5KFQA 3I82A 1TL3B 1YGYA 1S10A 3EPIA 3EXCX 4ZDNA 4JYAF 2BJEA 2PI4A 2HAIA 4DF4A 2DCUB 3SQGA 3QJJA 4DV3F 1HQEA 2RRNA 2AV5A 3RR8A 3KTQA 5KFIA 2J6TA 2FHJD 2KO1A 4OX7A 1GNKA 3K5LA 1KRPA 3JSRA 2B9WA 2DNOA 3I5BA 2JWNA 5DG9A 3MOZA 2CJQA 3FSIA 5LSLA 2FVPA 1WI6A 1LFPA 4ED6A 3M8PA 2WSCC 1OO0B 3LAMA 3KLEA 3N6LA 1N5VA 5F8LA 4KAIA 1UJ5A 1WG5A 4QIVA 1HWUA 1VQ5S 2RE1A 5KFEA 1U6ZA 1S4FA 2HRUA 4RUCA 4K50A 4EWTA 3THTA 3MR5A 1X4BA 3LF0A 1BWEA 2VB6A 1CSJA 4I1TA 2O67A 4J9NA 1UVMA 2DD8S 3QZ8A 5EN1A 2DITA 3IBWA 1VQ9S 5J2MB 4A8YA 5K14B 3F44A 1CC7A 4OHVA 4IG0A 1Q82T 2IRUA 4CO1A 1C1BB 1RT5B 3RB6A 2ATLA 2W25A 2AYBA 1G1XA 4HDGA 2LQ9A 1NH8A 4IYQA 1V3RA 3G8TA 3I0RB 2FHOB 4ILRA 3X1LB 2ZBCA 2B5JA 4DSJA 3FZBA 3KLGA 1ZPVA 2CQPA 3CB4A 1LW0B 2N4DA 1YJRA 2K3IA 1M0SA 4BWJA 4RUHA 4ZA1A 4O3NA 1FRHA 2KXFA 3KNAA 4LF6F 2MDAA 4I2QA 3TUZC 2GMHA 5CQGA 4FXWA 3V6KA 2YKPA 3NL0A 3BSCA 1HHTP 2XSJA 2ZM6F 4TN2A 4MYUA 3MEDA 3CDAA 1QLNA 5DDOC 2CPXA 1Q86T 1T3OA 4F67A 5CYQA 4URSA 4O44A 3DOMA 4ECWA 1VQKS 2K7JA 3MUTP 3NNHA 3PACA 4JV5F 2EBGA 1REVB 1SKWA 3K5MA 3M6WA 2WB1D 4L6V3 3LP1B 2OAUA 1VC5A 1AXQA 2ROGA 2X1FA 3LP2B 1U2FA 1P6TA 4ZVEA 4IOAQ 3MMBA 2RH3A 5KFCA 4AFFA 5U47A 1DHMA 2GIQA 2EVZA 4LUBA 1JJ2R 2AU0A 4FXDA 1S6PB 4RBTA 1VK8A 2FVQA 3RAMA 3UDLA 3DRSB 3CCSS 3OHBA 3FQLA 2QA1A 1E6YA 3GB0A 3KLEB 3GQCA 1KVIA 4I68A 4O3RA 3JSBA 4OI4A 3AJ1A 2EK6A 1HQEB 2EFNA 4NWBA 2L41A 3I55S 2RD5C 5DM6Q 2EKYA 2OPSB 3KMSA 3OW2R 1ULRA 3CCZA 4LF7F 1U7LA 5FDLB 1H2VZ 3IG1A 4TKTA 1HHSA 2MYFA 4RW7A 3M9OB 3RW6A 4KQZA 4DR6F 1ZBTA 1CLFA 3KG1A 5F0UA 2PO4A 1JNZB 4XPCA 1FDBA 4YDDB 3PIOQ 1M1KT 2XEXA 1N56A 5D3GA 2RDIA 2E7XA 4WFNQ 1LK5A 4Q5VA 4QPXA 4QYRA 4RWWA 3SQGB 2IC3B 5A2QY 2E66A 2HHPA 4KFBA 3Q2TC 1SJ4P 5H9FJ 4F50A 5KAKA 4B3MF 3FEXB 2KFYA 2HHVA 3GV5B 3FNNA 5GAHI 1CQMA 2FHJA 2Y0SD 2BVZA 1JKHB 1U24A 2QA2A 2N7YA 4J37A 5K9FA 4CT9A 4QWCA 1PGZA 2QA4S 4ITSA 2VASA 2DR7A 3MAQA 4NCGA 5D3GB 3I0RA 2LQ5A 2FPHX 2UUWA 3IO1A 1Q8BA 1U4BA 3C6UA 4JUZA 1SJFA 2DHGA 3D1QA 3EX7B 2RIJA 2R8GA 3MMCB 3KG0A 1GX6A 4I2PA 2HNZA 2LLZA 1N4LA 3BDEA 2XG8A 2ZNYA 2EG2A 3H4DA 4HDHA 4CT8A 2MKIA 3SSRA 2AD9A 4X4NA 2CQ3A 2ZOMA 2G1DA 4X66F 1EP4A 1S0NA 2WSEC 3MMAA 1TL1A 2CPFA 1GAOA 3E01B 4YMEA 1HI0P 1DLOA 3M05A 5IQQA 4WTYA 2XSFA 2RDJA 1YJTA 4KSEB 2CJKA 1H6KX 4JI8F 1S7HA 4L72B 1NHVA 4A8QA 3JB9k 1LW2B 4DL6A 5AXMA 4TQRA 1WG4A 2PA3A 3KHHA 4ELVA 4ID8A 4MMOA 4PXBA 1FT8A 5KFXA 2E5LF 2DGWA 2MZJA 1N32F 2PFFB 1KLNA 2XMUA 1K9MT 1EETB 1FE0A 1FDDA 3IRWP 4OL8A 3NP5A 3VTIA 2OFHX 3MD1A 3THVA 4AXIA 2QO3A 2W24A 2ERRA 3CJ5A 1TKZA 1I94F 2FJEB 2XB2D 1WHXA 2FLLA 1URRA 3LALA 2ADCA 3T1HF 3P49B 2UXBF 4EZ9A 1F5CA 4LF5F 1HMVB 1S1TB 1VBXA 2Q43A 1T7PA 2OPPA 4I7FA 4GC7A 2EFOA 3B4DA 2CZVC 4MAKA 2VFSA 1MWZA 5HQ8A 1QVGR 1WI8A 3DN9A 4KPYA 1JK9B 2BANA 3MR3A 4IR9A 3FRYA 5B0EA 2OD4A 1C1CA 2VKZG 2R2RA 3H59A 2PN6A 3M30A 5D78A 3US5A 3V2UC 3G4SS 3R1HA 2IM0A 2MZQA 2HLUA 2QEXS 3OLBA 2J0SD 4X4SA 1QSYA 1IJFB 3DI6B 3IRXA 1QSSA 1RT4B 1JLQA 3NWGA 1HWJA 4MK9A 3TARA 1RYSA 3AH6A 3VR1A 1DTQB 1TFWA 2N3OA 1F0XA 3UD3P 1HBNB 1FKPB 3CWJA 1T03A 3CCTA 2BA9A 1S9GA 1RKIA 3UE2A 1X4AA 1F60B 1S49A 3W2VB 3M32A 1LWFB 2HGNA 2VG7A 1MWYA 1VS3A 3RTVA 3KK2B 2ASYA 2ZD1A 3EGZA 2FDNA 4CTAB 2FJVA 1YRTA 2VFRA 3CO9A 5HP1B 1T95A 3QWPA 5DDRC 1Q53A 3RRHA 1TQLA 2I0XA 1U1KA 1RT7A 2IVFB 4KC5A 1YI2S 2XWXA 4J9SA 5IT0A 4K5RA 2YH0A 2UP1A 2J7KA 4IG3B 1KC8T 3VWSA 2KB2A 4KV8B 1RTHB 4D3HA 4DV1F 3L3CA 3LUYA 1EP4B 1OQ3A 2LXFA 2NPIA 3BZQA 4TLRA 5MLCV 1R0AA 4PUOA 3OFHA 3W3SA 3N9UC 3QO9A 2ILYA 1S9FA 2OPRB 3POTA 3AA9A 5E0OA 4KIAA 2CIMA 1N6QB 4HEA9 4HL9A 1IQZA 1FJCA 2BXJA 2CQ1A 2NPFA 3HHEA 5A6WA 2KM8C 3R1LA 4O3QA 4LJMA 5CZXA 3OTOF 2HHHF 1XTZA 4PPDA 4TU8A 3SCIE 4LF4F 2XNQA 2WHOA 4CQ1A 2LA4A 3CCQS 2DNGA 4USIA 2ROEA 4I0WA 1UJ4A 4NA1A 1P9QC 2H5EA 1KR4A 1LKZA 1SJRA 3S6EA 4ZCIA 4EO6A 2Z8QA 3L7OA 1IUJA 1TL3A 2JZ5A 1Q78A 5IM0A 5DDQC 4X4UA 2YNFA 3EXYA 5T41A 3KJVB 3ISNC 4I67A 4WZMA 5LMNF 2JVOA 5AXKA 5GVQA 3V6DB 2DH7A 4N76A 1TP7A 4OX8A 3FSYA 3H2UB 4WU2A 2YWKA 2KU7A 2AQ4A 2YVSA 1VFJA 3MZIA 4R8UB 2C3MA 4NX9A 3LAKA 4DOZA 4BBYA 5F8IA 3UCUP 4NZ7A 2E9ZA 2VPYB 3B4MA 5AE3A 3M9MB 1M90T 5J1PA 1A6LA 3BGFA 5IM0B 5KFGA 1ZM4A 1IBMF 2JC1A 2RQKA 2OD6A 3FFIA 3VQTA 4JI5F 2FVSA 3H8YA 3CC7S 3NAHA 1YRUA 2E5HA 2QMXA 4KO0A 4B3OB 2IVYA 4C8OA 4ETZA 3ITHB 2I9SA 3M2VA 2OKQA 2IMWP 5HMZA 3CD7A 2DNKA 4P7TA 2C42A 4TY8A 2CFXA 2J9EA 1U45A 4Q2MA 1R0AB 3MM6B 1U47A 4KE5A 3K5OA 2ZC4A 2MHNA 3CDUA 1HBNA 3THPA 2MY7A 3DLBA 4AE5A 4A8SA 2CQ0A 3SCLE 3KOAA 2LKZA 2APOA 5F8JA 2FUG9 4Y65A 3VCDA 5KFFA 4DL4A 4NLQA 2XLJA 3HHLA 4HHJA 2MKJA 1VJWA 4PUOB 3DDKA 4EFAC 1M5VC 3PKMA 1V3ZA 2WOMA 4EYHB 5DGAA 3N79A 2W7PA 2ZH7A 4K4WA 2VBZA 3FMBA 1S76D 2KKHA 1C2PA 5KG5A 1RK8A 1HPZA 4F4WA 4ECRA 2GHVC 5J2QB 4RNFA 5BR8F 3MR6A 1YJWS 1K1QA 2IM2A 3DOKA 3PW2A 1VBYA 2AYGA 4WFYA 3DMJA 4WFBQ 3MEDB 4FBUA 5GAHU 4QOTA 1OIAA 4NLRA 1YJNS 4M8LA 5CYMA 4MFBB 3HP6A 1K0VA 4K4ZA 4ZVHA 3CJ4A 1JNRB 1JLCB 5KFUA 4NMLA 4EYIB 5KT6A 4ILLA 3ZZ0A 1T3NA 1UP1A 5J1EA 3MURP 1KD1T 2DTJA 1KHVA 5KFNA 1VRUB 5IWAF 1M5OC 2YKMA 3QAUA 4F2RA 1IKVA 3HI9A 3EZUA 1TAQA 2P5VA 2ZE2B 1RDRA 4C3KA 3N4WA 3KWMA 1FEEA 4OHZA 7FDRA 3PO5A 5KFMA 2M8HA 4DL3A 3LW5C 4X2BA 1S99A 4YFUA 4IFYA 1R8PA 3G9CA 1P1LA 2KDOA 4MJKA 4LIRA 4ZP8A 5K14A 3J7ZT 1X9SA 1N5YB 3DOLB 4NLDA 4CH0S 2LMIA 2RVJA 4MYTA 4OZ5A 5KG7A 2QMWA 1P27B 1RTDB 3MFHA 1BGXT 3N0VA 2HHQA 2W4DA 2ZUGA 1KQGB 4OX9F 4NRTA 5CCLA 1T8EA 2VG6A 5EWFA 1QSLA 4CCHA 3EUNA 3I56S 1U1LA 2L9WA 4ZPTR 3QGIA 2R7UA 4M1KA 1DQAA 1VGYA 3S01A 3GIKA 1C0TB 2DRAA 5KFKA 1UFLA 2D9OA 2Q1LA 4WYWA 4NXNF 1UVNA 3R27A 4WU3A 4YDXA 4FF1A 3F56A 3I5AA 4DUZF 4G1QA 2BUNA 4G6VB 4O4GB 3J7YU 1RT1B 2HMIA 2GGPA 4PCQA 4DQSA 1J5OB 1S1UA 1NB7A 3R5BA 4RNOA 4DR3F 3VAKA