1Y3JA

Solution structure of the copper(i) form of the fifth domain of menkes protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
77
Chain Sequence
NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title An NMR study of the interaction between the human copper(I) chaperone and the second and fifth metal-binding domains of the Menkes protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 14
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y3jA00
1YJVA 1TL5A 1KVJA 1FESA 1N5VA 4U9RA 5A6PA 2ROGA 2GV1A 2AP6A 2GO8A 3HFKA 2HLTA 1TL4A 2LQBA 2OAUA 1YJTA 2K2PA 3HF5A 1YJUA 2FHMA 3MCSA 5B0BA 5F0WA 4OJHA 2G9OA 2KT2A 3CJKA 3FMBA 1P8GA 2HFOA 2RMLA 4ZOSA 2QIFA 2RSQA 2CRLA 3LGMA 1SQEA 3DXSX 3QGPA 4ZA1A 4A4JA 1V3ZA 1CPZA 1S6UA 1QUPA 3HHLA 5A6WA 1R6YA 3BB5A 3HHLD 2BBEA 1OQ3A 4YEAA 5K9FA 2QLWA 1TUVA 1Y0HA 4NPOA 2QYCA 2IFXA 2KKHA 3IWLA 2IYGA 3IWXA 2W4CA 1GXUA 1Q4RA 2GGPB 2L3MA 4DPOA 3K7RA 2OMOA 2ZDOA 1GXTA 2AJ0A 4Q2LA 1FD8A 5B0GA 3BM7A 3FGVA 1ULRA 1VQSA 2ROEA 4Y2MA 1FE4A 2ASYA 4FNHA 4YDXA 4A46A 5B09A 4OJGA 2K1RB 1CC7A 1Q8BA 3I9ZA 4EFAC 1AFIA 4Y2KA 1Y3KA 5B08A 2GCFA 2PGCA 2VH7A 2XMVA 3KNGA 1Y9OA 2LQ9A 2XMKA 3F44A 4HL9A 1WD6A 2XMUA 2OFHX 3FRYA 4HI2A 2OFGX 1KQKA 2HQIA 1FE0A 2ROPA 3BR8A 1OSDA 2XMWA 4NL5A 5B0CA 4HH0A 2RILA 2GGPA 1TZ0A 2LDIA 2OD6A 1RJJA 1Q8LA 2W4PA 3GZ7A 4DL0C 1FEEA 2HIQA 5B0AA 2GA7A 2EW9A 2K7JA 1YJRA 2IYIA 3WDOA 1OQ6A 1CC8A 2FIUA 2FTRA 5KAKA 2QLXA 2XMTA 5B0EA 5B0DA 2K1RA 1SB6A 2N4CA 3HDSA 1MWYA 1APSA 1YRXA 1X0PA 1W2IA 1TR0A 2W4DA 3HX9A 1Y3JA 4QOTA 3TOQA 1Q53A 5IXUA 3LGNA 4HH1A 4OJ1A 1OPZA 3BDEA 5T7LB 1N5TA 1IUJA 1FVSA 2OD4A 1URRA 3BF4A 2ACYA 1VQYA 4A48A 1XBWA 1P6TA 1N5SA 3KG0A 1AFJA 1S6OA 1X8DA 1YG0A 2N7YA 2FB0A 2XMJA 2ZDPA 2JDJA 3QMQA 2KT3A 1JK9B 1MWZA 2OKQA 3DCAA 2HLUA 1LQ9A 2BYCA 4A47A 1AW0A 1X7VA 2AW0A 2BJEA 2OP5A 1K0VA 1KVIA 2LXFA 2BJDA 4DN9A 1N5QA 2N4DA 4Y2IA 4OIXA 2RU9A 3KG1A 3KKFA 5F0UA 3BN7A 3T9NA 3CJKB 4Q2MA 3UDCA 1U7LA 3VTIA 4OJ3A 5B0FA 3MZIA 2XMMA 3TNVA 2KYZA 2Q3PA 3TRGA 5T7LA 1JWWA 3BGUA 3HHLC 4F67A 4HI1A 1SI9A 1FVQA 2GFFA 2HFNA 3HHLB 4FNIA 3E8OA 3LO3A 2K7KA 2BUNA 2AJ1A 2VV5A 2PD1A
chains in the Genus database with same CATH superfamily
3MMAA 1RT3A 1R0AA 2UV8A 1S49A 3MOZA 4OV1A 3VAKA 2GVZB 3ETOA 4ECVA 4NLUA 3MXHP 3CO9A 4C0BA 4A4JA 2YH1A 1V3ZA 2F5GA 4PWWA 4F3QA 5IV4A 1QLNA 1GX5A 1I1GA 1KLMB 2L3MA 1XNRJ 3DMJB 3N28A 3EVWA 4YQWA 1LXJA 2RHSB 2V8PA 2K1RB 1Q8BA 1DTQA 2WVBA 2EFQA 3GCWP 3SI8A 2OPQB 2CPYA 3Q8SB 1PAUB 4ER8A 1VC6A 1VQLS 4J9QA 1PJ7A 4OX9F 2OEKA 1KC8T 1URNA 3IXQA 5B0EA 1BMQB 1PCAA 1TKDA 3RW6A 4P10A 2HHTA 2VQEF 2BVZA 4V19X 4WCEQ 2KO1A 2XWYA 2Y0SD 3V2UC 1AW0A 4M5GA 5D77A 5ETPA 1Q81T 4F4AA 2N3LA 2QYGA 5B0FA 4FBTA 1BWVA 4KH1B 5G0RB 4ENOA 2J6UA 1RKJA 1F5BA 3JAMU 2XULA 4OHZA 3CDBA 2C2RA 2WZ1A 2RMLA 4RW8B 5DLFA 1X5OA 4AXJA 2QLFB 1VS3A 1P1TA 5D0EA 1J5OB 4FN5A 4QIVA 2HVHA 1U1NA 3GYXB 3DGPA 2NSBA 5LM7E 3QLHB 4KHRA 1NJXA 5KFEA 2VFTA 2E5LJ 3OVAA 2ZWOA 4DSLA 3I31A 1SUQA 1S12A 3IS9B 2AJQA 2ZEJA 2G2YA 1UFKA 2HK2A 2C3YA 4DPTA 1WEZA 3AAWB 1ZTTA 2JSXA 3G2XA 4LSNB 4B9TA 3H7HB 2BE7D 3MCNA 4N8OA 1FFSB 3HCXA 1KEKA 2CJ9A 3M1VA 4WBFA 4B9NA 1HNZF 4AL6A 1VHIA 3OTOF 2KVQE 1QAXA 3BPSP 1KBRA 4RBTA 3DOMA 3H2VE 1TV6B 4A8WA 3M30B 2W2PP 4OI2A 2KVIA 4OYAA 1LQ9A 4PG6A 3I56S 1N5QA 2UV8G 4LVOP 2A3JA 2P9EA 5JJBA 4FS1A 1ZM9A 3AJ1A 4KKOB 1VQ4S 4UQGA 3D1QA 2F65A 4OI0A 3B54A 4ZITA 1U1MA 3OL9A 1SV5A 4IRDA 2V8GA 4ZLLA 3LGMA 4ED1A 1JNZB 1R27B 3SCJE 3EXYA 3CE8A 1UA1A 4QR2A 2ZDOA 2RUSA 5LXRA 4DQRA 3VAGA 4A46A 4WP8A 5IM0A 4OLOA 3JXOA 1GXLA 2RAQA 1OO0B 1EETB 3P8BB 4QIGA 1DY3A 2MQPA 1NKEA 2MJNA 2LYVA 3ILIA 3G9CA 3M8ZA 2R2TA 4PXEA 1RTHA 3AJDA 1S1XA 3DRPA 2JLFA 2J9CA 1GEHA 3CD5A 3H5UA 1XMOF 4USMA 3TEGA 4ELVA 3D3CJ 4ED3A 4ILLA 3M6WA 2FY8A 3ZTPA 1RXOB 2BJ8A 2LVWA 2F8EX 4X62J 3G6ES 5BYSA 3UW1A 4XTTA 1TL4A 2IIHA 1IKWB 2E44A 1YJWS 2JVRA 1WSVA 1J27A 3GFYA 2EFNA 4ZPDA 5KFWA 4S0MA 1VGYA 5E3QA 1ULRA 2YKAA 1PJ5A 4OJGA 1U48A 4KHPF 1JLFB 2YBVA 2HFVA 2VG6B 2H4YB 3UO0A 3N6MA 1VYAA 5KFIA 5L9NA 1H2UX 1S1TA 4QW8A 3CJ5A 4B3OA 4V1Ak 2MKYA 4IH6A 4NWBA 5A8RB 1M1GA 1Q16B 3V5RA 1IUJA 2H65B 3DN9A 2ZM6F 3PRDA 1XNQF 3SYZA 3NOCA 1G2EA 3OR2B 4J90A 3W1YC 4EWTA 1FDBA 1U7LA 4FF1A 2P9GA 2MQQA 1YQHA 3UPFA 4CDIA 5KG4A 2IVMA 1AT1B 1MN9A 4DV3J 3ADAC 2GAGC 3MCSA 5AT1B 2QIFA 1QY7A 3FC9A 1TMJA 1X4HA 3H8YA 3PR5B 2DNZA 3BEGB 3GFXA 1V9OA 1H72C 3CDEA 5F8GA 3IBWA 2MLXA 1U4BA 1U1PA 1S9GB 1Q1KA 3LPEA 2YKOA 2HHQA 2M52A 1Y3KA 2DBBA 2VH7A 2XMUA 2XNRA 3CCTA 5HP1A 1WHXA 2YWKA 2ZZTA 4IO9Q 1I5OB 3CC7S 2J5AA 2ADBA 3GR0A 1NLKL 2OI2A 2AJFE 3WDOA 4ICLB 2FVPA 1KRPA 1FWKA 2CQ0A 4LRAA 3CNQP 4IFVB 2V9WA 4ELTA 3M7VA 3CCQS 4QIEA 3OTEA 3CCMS 2KH9A 5D0HA 4ZCKA 2V8DA 4KRWA 1K73T 4NLOA 1K1SA 4I2PB 4B9LA 4ECUA 2NQPA 4J9KA 5IWAJ 1RBAA 2VBYA 3PCOB 5C2CA 4F3OA 1LWCA 1UPPA 2CPXA 2ZBPA 1DLOA 3GIMA 2DR6A 1M5PC 3TA2A 2NYIA 4FS2A 2XCPA 1HQ2A 7FDRA 2IAJB 4RUBA 5J1EB 1FFWB 2I6WA 3H59A 4PQUA 3ILOA 1Q5YA 4N5SA 3PFOA 2GJ2A 3IWXA 5JMNA 4NLVA 4M5LA 3MMCA 3ZZZA 2ZH7A 4DV0F 4CWBA 1N54B 1JLAB 2OH2A 2FYXA 4R8UB 1FK9A 1JXEA 4DSJA 5L8RC 2UUBF 1YHQS 1CC8A 2IVFB 5KFHA 1TU0B 4AFFA 3US5A 2X51A 3K89A 2PFDA 1U8WA 5L38A 1JLCA 1WOSA 3MAQA 2AD9A 4DR7J 3QYYA 4RO0A 4ERDA 4DQPA 5HLFA 2HFNA 3J7ZT 1TK5A 3FBBA 2V4QA 1UVJA 3I0RA 2AMCB 2R9LA 1RUSA 4ANEA 5HMWA 2I8EA 3BYRA 5KFYA 1QSSA 2BE9B 3IR5B 4CT9A 4IFYA 4RNNA 2GGPB 4R5PB 5KG3A 1DAXA 3KK1B 1JJCB 2JL9A 4LRDA 2ZE2A 2OFHX 1J5EJ 4F0MA 4NXMF 3KLHB 1MNEA 1LK5A 5L1IA 1RT2B 1NKCA 2XMTA 1QTMA 3CDWA 2IBKA 3Q8PB 3TWZA 4I7FA 2CJKA 1MN7A 4RWXA 1W2BR 2NYHA 2VC1A 3PJ9A 1XJWB 3TAQA 1JNRB 2HZCA 3F0NA 5GAEU 2IY5B 4ZHRA 3UR3C 1HQUB 2DGVA 4M5HA 1FNXH 3H90A 4QJVA 3RB3A 5ETKA 4F4KA 1U47A 2J8SA 4MK8A 1H2VZ 1TKXA 4ZPVR 4YB7A 4ZS6A 3TX0A 2HQCA 3LP2A 2AV5A 1TFYA 2V69A 4PCQA 4DFPA 1RI7A 2KZMA 5C2GA 3QAUA 3DLGA 2RQKA 1S57A 3TEHB 1UP1A 3CWJA 2C2NA 3RUBL 5C42B 1HNVA 4E0DA 1Q78A 2B9XA 2RHQB 2B3TB 1KQKA 2BJ9A 3SCIE 3EDQB 4B9UA 3QRRA 3PO5A 4LBPA 2L9WA 4DQQA 1NM2A 4CI0B 2MPUA 2HQDA 2WCXA 2XB2D 4CH1A 3M8QB 1M90T 1DQ8A 4H4MB 2HRYA 2BJDA 4BLGA 3SMZA 3AJ2A 2FD2A 4MKAA 2V6AA 3ENAA 4K0KJ 4AE5A 4OHWA 1X60A 1C0UA 3HHLC 3FEYB 2XI3A 2YNGB 5EHHA 5L1KA 1N48A 2ZC3A 4P9SA 2QMWA 3C6UA 2R7UA 5GVQA 1QSLA 4NYPA 2B4UA 3PHTA 3OVSA 4DPWA 5BR8J 4PWDA 2ZJQQ 4KGVB 2UU9J 4O23A 2AWZA 1F0XA 4AT1B 4EO8A 3GMGA 4KBIA 5KG6A 1N5YB 3TAMB 3N01A 3WHIA 1QSYA 2IA0A 3NWGA 3TJ9A 2AJ0A 5IS2A 3M8RA 4RU2A 4HI2A 1FJGF 4ED6A 5J1PA 1RDRA 3R5GA 3MM5B 1Z2LA 1HA1A 1HBMB 3IWNC 3AXKA 1SKRA 1LWFB 1Z1ZA 4X84A 4OYOA 1R8CA 3QT7A 3DLKB 3UI3A 4DV2J 5GAGU 1RYSA 2HZVA 3A1YG 5C25A 1U0HB 2NPIA 2HHVA 3C3LA 4LSLB 3MPDA 4TU7A 3C14A 4CQ1A 2WONA 4A8OA 3LO3A 3JTOA 3DOKB 1FO1A 3IRWP 3TO8A 1UZHA 1B0TA 1NPKA 3KJVA 4CLTA 5A8WA 1WC3A 2JEJA 3H5SA 4DV7J 1LWEA 4ECRA 4DV4F 4M5IA 2EG2A 1RTIB 4ED5A 4ECQA 5K14A 4CYUB 4NX9A 1IR2A 2CVIA 4TQSA 3BM7A 3I0SB 2QZ8A 4LFBJ 4TYBA 2IHR1 4DV5F 4WE1B 1AROP 2XMWA 2AYBA 4NCBA 1P27B 2DNOA 3W63A 2F4VJ 1KQGB 1O5JA 1C4CA 2N4CA 3V6DA 1FFGB 1SXLA 3TOQA 4ZK7M 3QZ7A 4TN2A 4DX6A 4F4WA 3NGKA 3JTNA 2HFUA 3G4SS 3TQEA 1RWXB 1NSKL 2MQLA 3H0PA 3ZNUA 2OP5A 1HHTP 4WXOA 1FI4A 3C46A 4ZVGA 4JV5J 4L3NA 1YBUA 3QIDA 1JWWA 4OYMA 1RT4A 1AZSA 1X4EA 5DM6Q 4PYAA 2VG5A 1KN6A 3I5BA 2FJBB 4BHQA 2ZNYA 4X2BA 3FMBA 1RCXB 1S1WA 2UVRA 1FJ7A 4YN3B 3RAQA 3S6EA 4YR3A 2DGUA 1UJ4A 4YEAA 6FDRA 2ZH9A 2YNHB 4Q8FA 2W8LA 3V6KA 5I42B 4ED8A 2CFXA 1BLUA 4X66J 2WB4A 3IGNA 4V19J 1SH3A 4C3KA 2MY7A 4DPUA 3WX8A 4MIAA 1YTYA 3ITHB 4P7VA 2CQBA 4JI0J 3POTB 4B02A 3A8KA 4OZ1A 3BGLA 5C7PA 4J37A 4P2XA 4P74A 2DKOB 2A1BA 3D4JA 4B3SJ 1JKHA 1F6TA 2A18A 3BGFA 4GC7A 2CNLB 4KFBB 1NH8A 4C0OC 1N5TA 1HQEA 5ETOA 1VQYA 5DG9A 4CH7A 1BY9A 1F9HA 1FRLA 2B6AB 1QVGR 2NLWA 1WC1A 2FHJD 2AIRB 4MT1A 4WYLA 4U67Q 4C8OA 2ZHOA 2YWGA 5EDWA 2YH0A 2U1AA 2N82B 3HJVA 2OAUA 2RD5C 1TUWA 3AD7C 3OW2R 1KHVA 3FQKA 4I0WA 3FFIA 1W7WA 4HT7A 2B8PA 3M8PB 3CMAS 1FX4A 1SJ1A 2WOMA 1EQMA 4K2XA 4FYDA 1U02A 4DUYF 5F9NA 2HURA 4DUTA 3OUYB 3NRBA 4LF6F 2M8DB 4ILRA 3SEOA 1VBKA 3GILA 2JC0A 3GFHA 2IMWP 2DISA 3MMJA 5CYMB 3OVBA 1LW2B 5KFRA 1A7GE 2IJNA 2DCLA 1L3KA 2PE8A 3JYTB 1BE4A 4NLSA 4A47A 1WF2A 4IH7A 2B4VA 4NASA 5AE1A 1ZM3A 5FDLB 1BQNA 3JSYA 2YWFA 5KFAA 1MU2B 4QBUA 1T94A 3DRYA 1JLGB 3D1OA 2X3DA 2RRAA 4XIUA 2J7WA 3ZZUA 3OFEA 2AKWB 3C6TA 4KB7A 2WBMA 4QYZK 2PDAA 4X4UA 5CD4H 1QUPA 1FF2A 2OPRA 3WQPA 3DU5A 2ZH5A 1TVRA 3WZ0A 1OYDA 2OMOA 3D5MA 1S1UA 3W7BA 1S59A 3NNAA 1PBAA 1CC7A 3PY8A 1VFJA 2HWIA 2VPZB 3DDKA 4KC5A 3MPUB 4HYKA 3UD5A 2BKPA 3ZZRA 1WG4A 2FLPA 3ILJA 2R2UA 4NA1A 1HYSA 4JI8J 1OYEA 3QJJA 2A10A 5EWGA 2R8HA 4KY3A 2NZCA 2OKQA 3SCLE 2XGQA 1N32J 1T03B 2G0CA 2IM1A 4G1PA 2GQ2A 3SSRA 1RBLA 3Q86A 2WVCA 4U7UK 4X64F 2XZDB 3KHHA 1B4SA 4F4ZA 5H1SV 1U8SA 2VG7A 2C2OB 3D54A 4OI4A 3TZWA 2MZQA 1S7IA 3IRXB 2HMIA 5ETQA 5H9EK 5HVFA 4GKJJ 2R7SA 1VIOA 2W1BA 3CJTA 5IV3A 2DNGA 1B0PA 1GXTA 2QMUB 1S6QB 1RGVA 2ROEA 2M70A 2VKZG 3I5AA 4CO0A 5D3GA 1M5OC 1TELA 2KN4A 2ALYB 1S1VA 3CTRA 2CQ3A 1H7XA 1F9EB 3N5FA 4KV8B 4DQIA 2G2ZA 3Q2SC 3MECA 4LF5F 1XEZA 1FDNA 1M1HA 5DGBA 5GAHU 1CULB 5KOXA 3HZEA 2XGPA 2LXUA 2HAFA 1YX2A 2C3UA 4ZDNA 3RW7A 1FVSA 1H74A 5ETLA 4Q7AA 3R5DA 1YZ6A 3LH2S 2C2KB 2AF6A 4KGXB 2ZKUA 1VK8A 4PXDA 3MAAB 2ZNZA 3UCGA 2FY1A 4QWAA 4WWSA 4KE5A 4OX8A 3HZGA 5GADU 3I82A 3NBPA 3J80Y 3UNYA 4L74A 1S79A 3CMES 4LFAJ 2RSQA 1RTDA 2LU2A 1LNQA 2AYMA 3BGRA 3BS9A 2XSJA 1IM6A 4QYZJ 4YP3A 1FNMA 4YB5A 1LKZA 2FLLA 2F4FA 1FJEB 5KFDA 5LJ5Y 3LWMA 3EX7B 4DPOA 4IR9A 2GVZA 2KM8C 2KU7A 4PEOA 3KHLA 1G6BA 2E5IA 3M2RB 1NZAA 1X5SA 1R8AA 3GLJA 1KLMA 4F2SA 3R9LA 2JNJA 4O3PA 3OTCA 4CZCA 5MAOA 3DMJA 3R2DJ 1VRTB 1IQTA 5LSOA 1NKBA 2AX1A 2K1RA 3G6VA 3ENWA 4DV6J 4OMFG 5D4LA 3QZ8A 3LF0A 1WDTA 3H25A 4CTAB 3R7SB 1HNIB 1Q7LB 2BABA 1M5VC 1NUEA 5IM0B 2XY5A 3FJ2A 5LMNJ 3J80U 4HL9A 3MFHA 2UUWA 4Y00A 3E2EA 3WX4A 3MM8B 1OIAA 1RTHB 2NCKL 4A8MP 3AOBA 2WAQD 4DN0A 5G0RA 3DLEB 1CEZA 1UMJA 4HVZA 5JUMA 2GAHC 3PJXA 1N33F 2VOOA 3B78A 5HMXA 3W65A 1H38A 4USVA 4Q2LA 4KT0C 2EFOA 3HSZA 4RW8A 4ZP6A 3M9NB 3MUVP 1HPZB 2RE1A 3Q23A 1J5OA 3VWSA 1A0OB 2HVZA 1KOOA 3QLHA 2R4FA 1N56A 2AJ4A 1TMMA 1R89A 4DU7A 1TL3B 3GZ7A 1Q8LA 2EW9A 1R6VA 4BS2A 4GVBB 3IS9A 5KFXA 1FT8A 4F4XA 3R5CA 4QQBA 4LR8A 1XR6A 2C3MA 1RISA 1SH2A 4O3RA 2ZOMA 4LSNA 4KQZA 2RDIA 2KZZA 1U1LA 4LBIA 3EGVA 5IOLA 2CIMA 1E6YA 3DHWC 4KH0B 4ZVSB 4DSFA 5EX3A 1WI6A 2VB6A 4LR9A 1TV6A 2EK6A 3M30A 2PD1A 3HD2A 5A8KB 3NCPA 1KKHA 4DV1F 2FHMA 4UUXA 1ZA2B 4OX9J 4HHUA 2WHOA 3NNHA 3AOAA 2QLBB 3E3XA 4KKOA 1U25A 3LANA 4JBCA 2MYFA 4DR5F 2VQEJ 3TUIC 5AXNA 3FCVA 4A8XA 4N76A 4WIQA 1ZAVA 4P75A 1Y9OA 2QTWA 4DR6F 3LW5C 1NDPA 4U7CA 3H4BA 3R5BA 2QL7B 2ZHAA 1UTAA 4M1KA 1KS2A 5B0DA 5DETA 1SKUB 1ZYQA 3PHEA 4MKBA 5ETNA 1IBLF 2IJFA 1RWOB 4HH1A 4JI6F 4ELUA 1EETA 3NGDA 4TU8A 2DNYA 2VICA 4C3MA 1C4AA 4ANCA 1Q95G 1Y4ZB 4DF8A 4X65F 3RB4A 3DXBA 4UUWA 2QFJA 2DO4A 5GAEI 3BYPA 1RAEB 4KSEB 4H4OB 2C2ZB 3G86A 1JLBB 3HF5A 2KT2A 4KYZA 4QYRA 1I94F 4ZA1A 4ED7A 3W2VB 1U2FA 1T9VA 3QJPA 4DCJB 1FKAF 1REVB 2QSWA 1HNZJ 1S4FA 3OTOJ 3IWLA 3M2VB 1IKWA 1NHKL 4DHVA 3R97A 1U1RA 4G1QA 4OYWA 1Q82T 2Z56B 3NGSA 3W60A 1RAIB 4DBQA 4BDPA 4KPYA 2QMXA 3PEJA 1GMWD 1JLFA 2P6SA 2CWXA 2VIHA 2DEJA 3F41A 2VG6A 1S48A 2D74B 1CJVB 3X3UA 3MM7B 1N34F 3JSMB 1VI7A 2KHCA 2BEFA 4LF8F 3KG1A 3MMCB 5A8RA 2Q6CA 3QGIA 1PILA 3U1NA 4WFZA 4EZ9A 1ZETA 3CIZA 2J76E 3QT8A 3A3OB 3GJTB 3OR2A 4DFKA 3TZYA 2W7PA 3AHPA 1UWBB 4YMEA 3BR9A 4JI5F 2EEYA 1RWUA 2IDLA 1EKSA 3C15B 4BBYA 1W26A 2FZCB 1FA0A 1VQOS 2XO6A 2DRAA 2JEGA 4WU2A 2X1BA 5DQHA 2XI2A 1FRJA 3DLBA 3M8SA 3W8PA 4XO0A 1NK0A 4EFAC 3I9ZA 4DLEA 2YPYA 3B6BA 1XMOJ 3MCMA 1LWXA 2Q79A 2OELA 2HYIB 1T0TV 4WPAA 2ZH8A 1U6ZA 3I0RB 3IGVA 4JI1F 1UW4A 1S9GA 1NXIA 3A3PB 1MWYA 4D3HA 2DGXA 3QIPB 5E5NA 2NUUG 5F8IA 1OPZA 4RX6A 2W8KA 3IM9A 3EVOA 2WSFC 3DOLB 3C19A 2OSQA 4ICLA 2HRUA 4RPFA 1K0VA 2WB1D 3BKUA 5EN1A 2F63A 3LWLA 3VTIA 2CPHA 2XMMA 4AD6A 4IFVA 5GAGI 4XK8C 1QUVA 5FLXY 1NSQA 1WWHA 4KHPJ 1NH7A 5HO4A 2LKZA 4KGZB 1KVKA 4I2PA 2WRMA 3RAMA 2BKOA 4ZPWR 3CCWA 2RU3A 2UVWA 1F3VA 1NSAA 4MMOA 2ZM6J 1XNQJ 4IYQA 2PO4A 2IAJA 4LJMA 4NLRA 5J1EA 1MLAA 3CD6S 4JV1A 2XTJP 3F44A 3SV4A 4DEZA 1C1BB 2V2KA 3NCRA 1VQKS 3KLFB 4H4KC 2MKKA 1UWAA 1JLAA 1HARA 4R8UA 4BWJA 1AXQA 4NLYA 4TQRA 3T6BA 2LXFA 3HI9A 2ACMA 4DL3A 3ZO7A 4A8QA 5FLXU 4CO2A 1GT8A 4H54A 2DNNA 2RNEA 3GIJA 2WK4A 4E8UA 3OFHA 2V34A 2XWXA 4QW9A 2HQFA 2YNFB 4HTJA 2X3GA 3B4DA 4I64A 3SFUA 3N6LA 3LTOA 3PX0A 4USUA 3HHLD 1OQ3A 3Q2TC 1FXDA 3CCJS 4LIRA 4Y65A 2PI4A 3U1MA 1QD1A 2BQ3A 1O6XA 7AT1B 2YWWA 3TANA 3KNGA 3QGHA 2XHCA 1OSDA 5DQGA 2VQFF 5DLGA 2GGPA 4R5PA 3OLAA 3O3LA 7FD1A 2VONA 2JFDA 3KK1A 4O44B 2E1MC 3GWCA 1FD2A 1O8BA 1Q8IA 1N6QB 3EYZA 5HK4A 3H2UB 1TL7A 4P2FA 3I6PA 3KLHA 1Q79A 4CT8A 5DRKA 1RT2A 2UVVA 4YB6A 4U96A 2V67A 2FJAB 4NYOA 1ZH5A 1NBEB 4RW4B 6AT1B 4R0EA 3HLUA 3TVZA 4DV0J 1IBMF 1OY9A 5HQMA 4DCPB 4ED2A 3O1LA 3MWBA 4JI3F 1LXNA 1HQUA 4J9MA 1D0EA 3VHQA 2UUBJ 2CNNB 2DHSA 4UOHA 1HBOB 3MR5A 1B3TA 4M5MA 1VIXA 4CCHA 1HD0A 2VPXB 3M6VA 1VQ5S 5CCLA 2BXJA 3BSCA 2V2QA 4YDDB 3EPGA 4IG3B 3GIRA 4CNYA 2WONB 2MQ8A 4QIFA 3BR8A 4LR7A 3I96A 1RHUB 3IR7B 3HJFA 3UCUP 4QIWD 1VISA 4EZ6A 2EXUA 1VQNS 3LGHA 5C42A 3ZC4A 2L9NA 2BRLA 1T95A 2KG1A 1U09A 2F3JA 1S76D 3AD8C 4JV0A 5A2QY 5LMUF 2YNIB 4LRBA 3CC4S 3OTBA 3UDCA 5ETSA 2VOPA 3HSJA 3PZPA 4I2QB 1GAOA 3M8QA 4P73A 4H4MA 3Q8VA 5GMEA 1XR7A 4M63A 4NXMJ 3V4IB 1IWGA 1TK0A 3KUEA 3TP2A 5K5MA 4NI2B 1BXNA 3G82B 1CPZA 2YNGA 3P96A 2VFRA 3T1AA 3BZQA 1NRKA 2IDEA 4ZVRB 5CYQB 1UEUA 4J91A 4LF4J 2ILZA 3QO9B 3VGTA 4P2MA 2HBQB 2C3OA 5BXIA 4WZMA 3VVUA 5B09A 5HJYA 3EJMA 4ES1A 3UDVA 2VBXA 1WKJA 3I32A 4MIBA 3EXCX 3VGVA 1N5YA 4HH0A 3TAMA 4NA3A 2Y1IA 3T41A 1RT7B 4JI4F 1NEEA 4CLSA 3FMWA 1QAIA 4YY3F 2QL9B 5K8OA 3QWPA 4ECZA 2DITA 1DJ0A 3KHRA 5CA5A 5A2QU 1EKRA 2XMJA 3MM5A 4B3TF 4NCGB 1HBMA 4OV6A 2EI5A 4OYZA 3FBEA 1LWFA 3TNVA 2E5LF 2DTJA 1UFLA 1H73A 4M8LA 3DLKA 2HVIA 2JC1A 3CD7A 4HDGA 4QWCA 4J9RA 3UVJB 1U0HA 2CPJA 4LSLA 1WEYA 1MMDA 4NMLA 4OX7A 4U8YA 2KXNB 3ET6B 1H0HB 5HBMB 2JVOA 3DOKA 2AU0A 2HSEB 3N79A 2DR7A 1LOUA 1X9WA 3UWTA 3OV7A 4J9SA 5LSLA 1X5TA 4IG0B 3DKDA 1RTIA 3MPYA 2XMKA 4CYUA 1YJ7A 3VQSA 4G1IA 2HG4A 2DNMA 3M2UB 1PO6A 2BE2B 4NRTA 2CQGA 2M8HA 3I0SA 1WF1A 3DDNA 3IC1A 3NGUA 2ZWPA 2UXDF 2D3UA 3F73A 1RLCL 4WE1A 3FFIB 3NY0A 2M2BA 1VQ8S 5GAHI 4LBHA 1UW9A 3FUYA 1RAOA 3FCWA 4TLQA 4K59A 4PZVA 2OTLS 2AEJA 5DG8A 2HIYA 5KFQA 2M5YA 5DJBA 4C8ZA 2ZH6A 3U7JA 5GADI 3SDEB 2DT9A 3DLHA 2HQGA 1G3OA 3MEEB 2DHHA 4HTIA 2Z58B 3G87A 3GYNA 2R42A 3KHGA 2P2CB 2YNHA 2P9CA 3CO0P 5I42A 2W2NP 3A3NB 3CJ8A 4N8NA 5J2NB 3L3CA 5F8LA 3ITHA 1SCJB 4ZJOA 1E6VB 3KTQA 3CCVS 3POTA 3AD9C 1R3NA 5IXUA 1M5HA 3GR1A 4OJ1A 1U6FA 3D7SB 3MEKA 2KT3A 2J0XA 4DV4J 1NB7A 1KQFB 2DRBA 5DG7A 1H2TZ 1S1UB 3PG9A 2FJDB 2MMYA 4KFBA 3IMQJ 5M2RA 3QJLA 3D28A 1WTBA 5E0OA 3I55S 4DV5J 2DK2A 1Q0NA 1K9MT 4LIWA 2B6AA 3MEGB 1PYOB 3A8JA 2CG8A 4P72A 4B3RF 1FX2A 3H5XA 4CLYA 4N56A 1BUXA 3PYEA 4ITSA 4C4WA 3PX6A 3FVYA 5K9FA 3J81Y 3HULA 2YQ1A 4YFUA 1RAJA 3FZ2A 3K17A 1CJKB 1NB2A 1LV5A 5CXTA 3RYLA 2Y9HA 4J9LA 4PXBA 4C8KA 1K0TA 3M8PA 2LQ9A 3MHYA 4NEZA 2PMWA 4PPZA 4ECYA 1PC4A 4PPDA 4A8YA 3V81A 3HVTB 1SB6A 3BSOA 3OUYA 3BJYA 2OLWA 1H98A 1YJNS 3DI6B 1JXVA 5D6GA 1FTRA 2MZTA 3EE3A 4USKA 2WW4A 5DDQC 1HBNB 3KG0A 1YSJA 4Z7CA 2DHGA 2YY3A 5B7WA 2FPHX 3A8EA 2VASA 5CYMA 3KKFA 3ZZYA 3ULHA 2HEKA 1D9AA 1LW2A 5D3GB 5CZVA 2QT7A 4P71A 1VQMS 2KRRA 2GFFA 3EVMA 3Q89A 3JYTA 2VA2A 1FDAA 1WHWA 4LF7F 2FJEB 4OYXA 3J7AN 2E5GA 5FDLA 3SZ2A 2CWKA 1RQ0A 3J81U 2DNPA 4ZVUB 2K8GA 4CO1A 1MU2A 1IJFB 2QLWA 2QO3A 3U1LA 1VJQA 1JLGA 2YTCA 5DO2A 3VGUA 3OXGA 5IT4A 4Y2MA 1WOOA 4XAKA 1Y7PA 3ZNJ1 3EWGA 1XIQA 3V6JA 4KAIA 2WSEC 2KT5A 2DPJA 4ED4A 2OEMA 1L5UA 2C42A 1TZ0A 2Y8WA 1F5CA 3LPYA 1X0PA 1JX4A 1IM4A 2D3OR 2UXCF 1PKUA 2F9DA 5EUHA 4DN9A 3MTKA 1N0UA 3DYAB 4X4NA 4Y2CA 3OL8A 4EYHB 4NRUA 3PRBA 4EI2A 4IOCQ 4DUYJ 2V2VA 3GIKA 4LF6J 2BJ7A 2DPIA 2H4WB 1L3VA 3PXGa 1T03A 5LOQA 5KG0A 2AZ1A 4PG5A 2AX0A 3UR0A 2DGSA 3BPDA 3D6MB 4HHJA 2CVEA 2VZ9A 4QPTA 2J9DA 2QJ3A 1AA1B 4CLUA 2J6SA 2EBEA 3IRXA 2JFKA 2MKCA 2DH8A 2YKPA 2EPIA 3A8IA 4UZCA 4W4MA 2QE5A 2Z2YB 4ILMA 4IR1A 4QU6A 4P7TA 1S6QA 4WTYA 1BHNA 3I4PA 2ZITA 1XK8A 5F8JA 1YVFA 5FD1A 2VBZA 1FXLA 3Q8RB 4JP8A 1WJ9A 3CJ2A 4KV8A 4DR2F 3JQJA 3OJUA 2AGPA 1S72S 3HHDA 1DQAA 1AUSL 1CULA 4ZVPB 4Q2MA 5KT6A 3GJQB 4RJVA 1RBOB 4CO3A 1QAJA 1OY6A 5LT5A 2MSTA 5ETTA 2RKIB 4JB8B 1VRQC 3L7PA 4PWUA 3MAAA 1RAAB 3C8YA 3R3TA 4DSIA 1AYEA 1WDDA 4FXDA 3M32B 3OR1B 2FVRA 5HATA 2GS8A 2V94A 4DJBA 3VGSA 2BM1A 2ZUAA 1U6BA 2MDAA 2ZBIA 1QAYA 4J7CA 1E6YB 3VZIA 3AY0A 1WKKA 2C3PA 1MWQA 5KFVA 3WIUA 4Q44A 5HAOA 1UFWA 2QLJB 3VF0B 4RU9A 1OQ6A 1IWAA 3CJ4A 4X64J 4PG8A 2EVZA 2JHEA 2ATLA 1RTJB 1X4BA 3M2RA 5DM7Q 3D6FB 5HN0A 4TY8B 2KYXA 3D6TB 2KFYA 1QDUB 1S0OA 1TTHB 3HT0A 2B5JA 4OYIA 3NG8A 4C97A 1VRTA 2V68A 2J9EA 2X1FA 2IPOB 1FTCA 4J9UE 2R2SA 1NCLA 2CQHA 1QM9A 1HHQA 1FVQA 4K50A 1RWWB 2GJFA 2BUNA 1FRIA 3AH6A 5K8NA 2R7OA 4ECSA 4CTAA 3IG1B 2ATCB 5LSRA 3UDLA 3R5AA 4UZBA 4A8SA 1HNIA 3EZUA 3GIIA 5HSPA 2I9SA 1U1OA 3KYLA 2V8VA 2FZKB 4LF5J 3LALA 2V9KA 2OEJA 1SIWB 3IAS9 3MM8A 3PV8A 5J2PB 4JI7F 2XG8A 1UVNA 2C2MB 1I6JA 2OMLA 4O3OA 4ZKAA 4ZVOB 3DLEA 4K5RA 1FJCA 4OI6A 5JVGQ 1F1BB 4F0KA 4PAAA 3RBEA 1DHMA 1HPZA 3MD1A 3J7YU 3HO1A 4ZJQA 3BDEA 2W9CB 3KJFB 3CULA 1TL3A 3AB2B 3WC2A 1HMVB 2OSRA 2N7YA 3K57A 2AGQA 4GVBA 2DNQA 3PFEA 2ZH2A 3OBIA 2HS3A 3BBFA 3BN4A 4GKKF 3DRRB 2YXLA 2RS2A 4G1QB 1A6LA 5M2UA 3JB9k 4MIWA 4ALZA 1EX8A 4QCLA 1XR5A 2VA3A 1RTZA 1XQIA 5J2QB 3PR4A 5F41A 2NSCA 4O3NA 3P45B 4Y3CA 4WFBQ 2K3KA 3F56A 5IC4B 2DCUB 1TAQA 5A8KA 4MYUA 4MYTA 2XZTB 2O3DA 3JS9A 3RR8A 3QGGA 3AODA 1NPRA 1JLQB 4DPXA 1EZZB 5KG2A 2Q1LA 5E33A 2ZBQA 3FNNA 4A8FA 2U2FA 3VVTA 4LF1A 4IQMA 3IO1A 1FE0A 5H9FK 1ITPA 4FDFA 2FLOA 4ZVHA 2DY1A 2FTRA 2Q6BA 4DS5A 1DZ5A 3ELHA 1S0NA 2B7BB 2DH7A 3PW4A 4GO5X 4KGKA 2V5HG 4ZVQB 4D3GA 1YITS 5KT5A 4DQSA 4N7TA 1GK8A 3D67A 1D09B 1IVZA 1N33J 3CJKB 4EBCA 3D3BJ 2QA4S 2FJXA 5F9LA 1WNEA 3HHLB 1SC4B 2K7KA 3PRVA 2KDOA 3T5LA 2ROGA 3R7NB 2CDQA 4J9VA 3MM9B 1NK9A 4TY9A 3GP9A 2H9ZA 1GMVA 5CD4A 3IM8A 2GO9A 2E9RX 1PYSB 3VQTA 2L08A 2HHWA 1K8AT 5AXKA 1RABB 3CVKA 4H4OA 1JLBA 1WORA 1LW0B 3MDFA 2W7OA 3HKWA 4Y34A 1UVKA 3W2VA 1NJIT 4PR6A 1REVA 3TX8A 1FCAA 4DI6A 4MK7A 2NXCA 3M2VA 3QFWA 4Z2XA 3KUHA 4O4RA 4ID5B 1FRXA 2DR9A 1YWXA 4HLBA 4Q0BB 2DGQA 4UTGA 2C22A 3MOJB 3NAIA 3ISND 1X4FA 4DV1J 3BKTA 4ZPCA 1TK8A 3IN5A 2ZJPQ 4NYZA 2DGTA 3M8WA 2MLYA 3R2CJ 2R8KA 5L1JA 4F4YA 2Z0GA 4DR5J 1NK4A 2XLJA 1CJVA 1MROB 2ZH1A 3MM7A 4IOBA 3GG1A 1V6HA 3JSMA 3MPWA 2BJ3A 1NDCA 1FRKA 4DR6J 1U1QA 3CEDA 3AA8A 3OT9A 3PKYA 2DNHA 3THTA 1SQGA 4EK2A 2CPFA 4LREA 2ABYA 4R25A 2JZ5A 4X4PA 2GMLA 1VC5A 3ONQA 3BQ0A 1IBLJ 4OHVA 4JI6J 1UWBA 4ZCMA 5EWEA 2G2OA 4WK3A 1NMEB 3C15A 3LP1B 2GIRA 2GHPA 2OFGX 4X65J 2K06A 2FHOB 2RRBA 1NO8A 2K7JA 2QLXA 1KR4A 3W5YA 3DM2B 4OQJA 2W4DA 4DDFA 2R8GA 2JLEA 2FLNA 1HD1A 3LP0B 1I94J 3HHKA 1KVIA 3D1HA 2RF2B 1RT1B 3SSSA 4RW6B 2J0WA 3TVKA 2CQDA 2VKRA 3QIPA 2IC3B 3QT6A 3HMJG 5J2MB 3M9OB 2CADA 3DOLA 3T1HF 3ZZOA 1FESA 2A2CA 4OHXA 3O8WA 4NA2A 4UOFA 4BC9A 4RWWA 4AQYF 3FBFA 3GV5B 2W2MP 3ETMA 3BDPA 3G6YA 2I1RA 2N3OA 1TL7B 3TI0A 1UJ6A 1WG5A 1TKZA 3HVAA 1GXUA 4PYDA 1HNWF 2XYHB 4RKUC 4YUDA 1R0BG 1VK3A 2PI5A 1HHSA 2GW8A 2MKHA 1N34J 1RAGB 1VQ6S 3THPA 1Q5VA 1EARA 2QL5B 3GB0A 3TVYA 4CO4A 2W7AA 4DG1B 4YR0A 4LF8J 1T02A 2IJRA 2QV6A 5F3TA 1S5ZA 3JQKA 4USHA 5BYRA 1FXRA 1B70B 4JUZA 5K8MA 3PW7A 4C8LA 4CLWA 1C1BA 2HGNA 4JI5J 3GE9A 2J6TA 4TVAB 3TA0A 4EUVA 5E7OB 3LAMA 3O6QA 1I51B 3KLFA 4JV2A 4KGMA 5CH7B 4LT6A 2BANB 1VCTA 2E7XA 2YWEA 4LSZB 3W9HA 4C7QA 3GV7B 2VFUA 3HM9A 4JI1J 3Q8UA 2E5JA 4DL7A 1S6UA 2CPDA 1R8PA 2FQQB 1IKXB 3KOAA 4HACB 3OTDA 2PA3A 2ALZA 1VQ9S 2VODA 4OZNA 3VAIA 1T9TA 2YNFA 1JQGA 5LXYA 4OZJA 3L4BC 3PO4A 2B56A 3OFFA 4K8RA 3Q8YA 4ZIWA 4J5OA 1T3OA 3BV8A 1RLDA 1Y00A 1D9FA 3NMRA 4ZLPA 2B0GA 3T1YF 2GA7A 3PTWA 4G3IA 2OTJS 2CJYB 3C66A 3T6JA 4OZ3A 3ZZPA 1YGYA 2DRDA 3RB6A 2IM0A 2LEAA 5D4PA 2D1CA 1IXKA 4O44A 5RUBA 2NXEA 2HHHF 4GKJF 1N6QA 5I3QA 3M05A 3KG4A 2DGWA 1T9YA 1U24A 1UETA 3W9IA 2ERRA 3RU0A 4I6AA 1EQ0A 3QATA 4Y6IA 4RW4A 1T9WA 4F50A 3PVXA 1X9SA 1KNZA 1KOHA 1FKOB 1Q7YT 2ZUGA 1WUUA 1PSDA 2IYGA 2ZD1B 4PG4A 4ZP8A 4UOCA 4QR1A 4ECTA 3BH7B 3VV2B 1HBOA 3MR3A 1SC1B 3OQ2A 4BWMA 1M0SA 2IMOA 5EGYA 4MAKA 1RA7A 3P5TL 3RZAA 4DL6A 3PYDA 2MKSA 4O0IA 1YJRA 1Y10A 2ZJRQ 2QRRA 3FZBA 4A8KA 2JH3A 4IG3A 3PJWA 1ZOTA 3GCXP 1S6PB 4LFAF 1X4CA 2MZSA 1N0VC 4OL8A 4K4SA 2FHJA 2HWHA 3L95X 5HMYA 3K8WA 1V5VA 4DR1F 1WSRA 1YJVA 3MAHA 2O66A 4ZIVA 2FJVA 2CNKB 4Q8EA 2QGFB 2YNIA 4LRFA 3MEDB 2VQFJ 4FXWA 4I2QA 3QGPA 4NXNF 3K5MA 3TUPA 5KFLA 3H5YA 2EFVA 2POKA 4F25A 1UVMA 4DMZA 2G0IA 3TARA 4M5DB 2W9AA 3JSBA 3V4IA 1ZM2A 1VRUB 2HNZB 4DV6F 2CZVC 1VQSA 4NI2A 3G82A 2PGCA 3DFEA 1T05B 5CYQA 3W8GA 3PW0A 5B0CA 3QO9A 5C5JA 2BW2A 2LDIA 1RJJA 1MMLA 2CQ1A 1IBMJ 4JYAJ 3MM6B 2HPUA 3GJSB 4HEA9 4JI3J 1HBUB 1ZPWX 2M4MA 1HR0F 2YX7A 1ELOA 3KK2B 4DFMA 1LEOA 3NS5A 4Y2IA 2D9OA 1RT7A 2DEIA 3SV3A 4O0NA 4OJ3A 4UY8T 4WP3A 2KFZA 3M6UA 2X1AA 3GPAA 1KVJA 4NCGA 1CVJA 3HFKA 1TP7A 2LQBA 2W9BB 2IRYA 2Z4PA 4DUZJ 3BBBA 3K5PA 4NZ6A 2VJUA 4FKYA 3SQOP 2E1PA 5KFBA 2XLKA 4NPOA 3CUNA 3UVJA 2XLIA 3LQVA 2KM8B 1EP4B 3OHAA 3JAMY 3ET6A 3BO3A 1CJUB 5HBMA 4TU9A 1RB0A 5LMUJ 4X4TA 4FVMA 3VAJA 1YI2S 2OPSB 4RR5A 4B9SA 2D3ZA 2B9YA 3UN2A 2DXFA 4IG0A 4CLFA 1W2IA 1GH8A 3G96A 1Y11A 2Z30B 4F2RA 3M2UA 3HT3A 5IQ6A 1XBWA 2BE2A 4ZMMA 1MWZA 2XEXA 3L09A 2GIFA 1ZAXA 1PYTA 1U2RA 2DNRA 2DXDA 5DDRC 4HKQA 3PW2A 4P52A 2XS5A 1B99A 1TL1B 2HNYB 3S1TA 1N5VA 2RDJA 2YX4A 3NKYA 3MPVA 3V81B 1K1QA 3BREA 4IRKA 4URQU 3IFEA 2BACA 2X7IA 1YRTA 1HIYA 3K5NA 1HNXF 3UNGC 2YPZA 4MTPA 4JI4J 2Y3YA 5HI7A 4YY3J 1N36F 3RBZA 1KLNA 3D2WA 4FVCA 2ASYA 1PAEX 4B3TJ 4URGA 3SDEA 2CDRB 1NHUA 4B08A 1S10A 3MEEA 1DARA 2KXFA 2I2YA 2D3O1 5KAKA 2E7WA 1H7WA 4OI1A 4ZN1A 1OPIA 2DXEA 2IRXA 2VL1A 5I3PA 1JJ2R 1U49A 1SH0A 4TKTA 5ITHA 5J2NA 2M7SA 2QG9B 3HHEA 2VFSA 3MR7A 1S4EA 3KJNB 4B9MA 2J7KA 1E6VA 1G1XA 1CSJA 4HI1A 2CPEA 5KFTA 3GONA 1IR0A 3JTPA 1R8HA 4FKXA 3KNAA 1NJWA 4NZ0A 5B0BA 2G4BA 5CHCB 3OHBA 1K47A 2B4PA 2F40A 1LFWA 4L72B 4ZPBA 2LMIA 2UXDJ 3SXLA 2J8AA 1TKTB 3MEGA 3THVA 3N0VA 3KK3A 3EMTA 4U95A 2Z2LA 2R8IA 3SFGA 1KFDA 5D8HB 2EC2A 2V4JB 1CJKA 3U02A 3EGZA 1RHQB 3NMAA 2FDNA 1F60B 1OY8A 1NU4A 4B3MF 1RT6B 3RG6A 1OJ4A 1FHTA 3KUGA 5IZHA 2LCWA 1YRXA 2ZC4A 3I5CA 4WIIA 2E5HA 1ZBTA 4IH5A 5A0YB 3HVWA 5DS7A 1Q86T 4LF2A 1S6OA 1X9MA 3J7YI 2E1RA 3HVTA 1T9UA 5HVGA 5F0UA 3BN7A 3DI6A 4L75A 1X0FA 3RRHA 3LA0A 4YHHF 2EFGA 2L48A 2IA6A 1HBNA 4I6WA 3X1LB 1KD1T 2XYPB 1S9EB 1GNKA 1RWPB 2RB7A 2RS8A 2PA8D 2CJXB 1Y0HA 2ADCA 2NXJA 1G4CA 4CNZA 2P5VA 4OZ0A 4F0HA 2RT3A 3R27A 1X4GA 1SL0A 1F9FA 3AA9A 3D9BA 4M95A 4F7VA 3BSAA 1IKVB 1SJ3P 2N7CA 1YBTA 1RU2A 4DZDA 2E1AA 1APSA 2UUCF 1VQPS 1KDNA 1X31C 1Y3JA 4B3RJ 2IRUA 4WFNQ 5KFZA 2FB0A 2B4OA 3OXLA 5GMKa 5C24B 1VMBA 4CIOA 2C1EB 3KLGB 2QX0A 2MEWA 1SL2A 2C2EA 3AFGA 3W5ZA 2QEXS 3CXCR 1VBXA 2HVDA 4FXVA 3DYAA 1B7FA 3EUNA 3W2WB 4O3QA 3RGIA 4DFJA 1BC6A 4YS2A 5DDPC 2A6MA 3A12A 2QYCA 2X1GA 2B5JB 2G0JA 3AT1B 3P6YC 1XMQJ 3GYGA 4LRCA 3Q83A 4Y2KA 2FVCA 5HROB 3BGOP 3H98A 1FKPB 4FF3A 4U8VA 3CCUS 5AE3A 2IM3A 3GQCA 1KHWA 4UW2A 2CZ9A 3NAHA 2RRNA 4DF4A 4WU3A 4LF7J 3SBMA 3LGNA 3MCOA 2HS4A 2LLZA 3KLEB 1C0TB 3DCAA 1XN9A 2N4DA 2XY6A 3MR2A 1P9QC 3NGRA 5HL7Q 3I4HX 1HKAA 5F3ZA 5IT9Y 3CD0A 4ZLNA 2ZOFA 2AJ1A 5H9EJ 3ZTOA 3V6HA 2BMBA 2PN6A 3ISZA 4X4VA 3OLBA 2FVQA 3DLLQ 2CQCA 3MI7X 1TUVA 4C98A 2RKIA 4C11B 2M3DA 1Y5NB 2DR8A 1CS4B 5D0GA 2F8MA 4DSKA 2UXCJ 5E3PA 4ANDA 1R0CB 1REGX 2M88A 3H4DA 3M32A 3OR1A 2FHKA 2XMAA 4F04B 4KR0B 1B0VA 2FGCA 2PSZA 1YJ9S 4UY85 3NWRA 1YRUA 1W25A 2QN6B 2RDDA 4WFAQ 1GMWA 1NDKA 1Q53A 2HNDB 4PABA 5T7LB 4E2FB 5IT0A 4DR4F 2GMHA 1SKWA 3QRQA 1HWIA 2JDJA 4RW7B 3Q8QB 2HLUA 1SIZA 2AW0A 4PUOB 2H1YA 5IT9U 4IDKB 2CAJA 1RTJA 4F8RA 3HKZD 4TY8A 3GTYX 4MKVA 5D78A 5U47A 3O5TB 1WHYA 1OSCA 3OFGA 3ZZ0A 3PYGA 4CLLA 2FUG9 3KWMA 4OYPA 1SQEA 1P1LA 1R6YA 3GU0A 2COLA 3D66A 2I38A 2W4CA 2B9EA 3IG1A 3D6HB 1DTTB 3GSDA 3K7RA 1WKLA 2E9TA 1F3FA 2YKNB 2V50A 1D9DA 3Q22A 4DR2J 2E7VA 2HHPA 4DL5A 3VAMA 1KTQA 2KL8A 1S0VA 2JJ4D 1BGXT 5J2PA 1BQMB 2D69A 1RE1B 1WTFA 2AQ4A 2BV3A 1HWLA 2YX1A 5F8MA 1TR0A 4QOTA 4IQXA 4ETXA 5KFFA 3S8SA 2ACYA 5A76A 1FRHA 4C0HA 2CZ4A 2PMHA 1PIEA 2OJ3A 3OXFA 4I68A 2JOQA 2W9CA 3UQSA 4LF4F 1WI8A 4FPIA 1HMVA 2O67A 2UZAA 4U7UD 1SC6A 1H6KX 4NLWA 3QNWB 3DGVA 4ZOSA 5KFNA 3DRRA 4F02A 4XPEA 1EIYB 1FRMA 4IUFA 2E29A 5J2QA 2QA4G 1UZDA 2QA2A 1RZMA 2GVDB 1JLEB 4FF4A 1RADB 4LFCF 3T3FA 5ETVA 3CCSS 4EGLA 2PEBA 2GZOA 2VDIA 1JLQA 3N6NA 2F1FA 4RUAA 2UXBF 4XDCA 2MB0B 1LFPA 3DRXA 1RT5A 2LDYA 1U0SA 3MMBB 4MH8A 1HI1A 1SJFA 4N47A 4K4YA 5L39A 3KXDA 4OZLA 2HGMA 2KI2A 4ZPAA 4RZRA 5I3UB 3K0JA 2Q3PA 4UT4A 4JI7J 2NS1B 2BA9A 1A9NB 2BQUA 4HHHA 4Z7YA 5D4OA 5KFOA 2B43A 1WC5A 3FSXA 3CJKA 2EWHA 4AL5A 2ZKTA 3HHLA 1SBRA 2KJWA 4LUBA 1BQXA 2JLGA 2KKHA 1UPMB 4K4VA 1NPPA 3MM9A 2VPYB 4GVLA 3R1HA 1FE4A 2KFNA 1CJTB 2HVEA 3CJ0A 2GC8A 1WC4A 4IRCA 3CW2C 2BJ1A 4GKKJ 3S01A 2OD6A 3Q24A 2JRSA 2EK1A 1LW0A 4WYWA 1D8ZA 5L9XA 4ED0A 1F2GA 2UUAF 3RTVA 1X8DA 4RW9B 1TKZB 4ID5A 4Y28C 3DRSB 3M6XA 4Q0BA 1VDHA 5IQQA 1IR1A 1Z4UA 1UA0A 4W98A 4F67A 4DX5A 1FERA 4M94A 2MLZA 3MURP 2OPPB 3DHXA 3B82A 5EX0A 2WVFA 2PC6A 3L9ZA 3W66A 2F9JA 4LF9F 5D15A 5E2QA 3FDSA 1MROA 3SQGB 3KFWX 4DPYA 3BB5A 1EHWA 2VJVA 1BWEA 2RIJA 2I5JB 4W90B 3NP5A 1UCNA 4MFBB 4RNMA 5KOWA 3GFZA 3EDRB 3HP6A 2KTQA 2A6OA 2O5DA 1TFWA 1RHJB 2HQIA 4RLEA 2EFPA 2MKIA 3FQLA 3BKFA 2IVYA 2BOPA 5D4NA 4ZJLA 4AXIA 3LP1A 3VAHA 5D0RA 2LFVA 4A48A 3TYTA 1ZPVA 4X4SA 3PX4A 1NK7A 3DM2A 2AYEA 2DY9A 4JI2F 1BD6A 3G8TA 3AXMA 3LP0A 2GHVC 1EAYC 4BCAA 4ETZA 4USIA 3UD3P 2YVSA 2GO8A 2OO4A 5BYQA 2RF2A 1RT1A 4RW6A 2IC3A 3MTJA 3HSGA 4Y0FA 1VHFA 5J2MA 2DNLA 2MY8A 5FIIA 2NXNA 2HZAA 4Q45A 1TAUA 5AJ3F 4IKAA 4K4UA 1QE1B 2B51A 5B08A 4W92B 4OLPA 2BQRA 4EBEA 2HFSA 2XS7A 2HIQA 1JJ4A 4CM0A 3GG0A 4DG1A 4KTQA 3AQPA 1KWMA 5DZ7A 3E01B 1IBKF 3EZ5A 1B7YB 2BYCA 4PXCA 1C1CB 1VR6A 4Q5VA 4N41A 2MZJA 2PFFB 4C3LA 2APOA 1ZTWA 2H3EB 3VCDA 2P6TA 3NOGA 2RUGA 2W25A 1UEVA 3KLIB 3TA1A 5CYJA 1JIHA 5T41A 2BANA 2HQ3A 2ZVSA 3CJSA 4NLPA 2ZHBA 2YKMA 3PACA 2EG1A 2XY7A 4DR3F 3T5JA 4L73A 9ATCB 3JSRA 3H20A 3C16B 3UCZP 4O3SA 1T11A 1IKXA 4HACA 4DX8H 2K3IA 1K44A 2R7WA 2D41A 4KO0B 2XC9A 2HAIA 1HW8A 4DL0C 1FEEA 1NK5A 1RCOB 5SZTA 3P3DA 3T1HJ 2YKQA 1NZ8A 3FKBA 2HBZB 4AQYJ 5THWA 1XNRF 5KFUA 2AYGA 1ICEB 1RAHB 3KDNA 2HFZA 2KB2A 4UQTA 1WC6A 3RB0A 2Z8QA 4DL4A 3SSQA 3J7Z5 2XYGB 4ECWA 2MGZB 1HNWJ 2MXYA 3RRGA 1TUGB 2VV5A 3MUMP 6FD1A 2BDPA 4CLZA 2GV1A 2J0SD 1YJTA 2GQCA 2DB1A 3EICA 4DWIA 5IC6B 1KP6A 2J9DE 2GIQA 2V4RA 2NUHA 2H5EA 5KTQA 4WKRA 1ROFA 4C6AA 2FJWA 2KRBA 3DDIA 2XMVA 4M5KA 1FKOA 5KT4A 2ZD1A 1IKYB 2KXHA 9RUBA 1YBAA 3P5BP 5JVHQ 1RAFB 5IFMA 4ATNA 5L1LA 2NPFA 4O4GB 5M2PA 2AEFA 3HX9A 5HMZA 1TQLA 3HVRA 2J7UA 4FBUA 5E3RA 3R8YA 3R6LB 1RKIA 3MMAB 4OX6A 1RT3B 2LA6A 3VAFA 1R0AB 1NSPA 4NLQA 2LQ5A 3TRGA 4RL1A 4RNOA 4IO1A 2D9PA 1S6PA 1RWKB 2WW8A 2RQ4A 2RJZA 1NAQA 1S9FA 3LAKA 2DGOA 3BH6B 2CPIA 2VUGA 3T1YJ 2E9ZA 1V5IB 1DTQB 2AZ3A 2C28A 3PKMA 3BQ2A 2RQCA 2DYAA 3MEDA 3A13A 3WIVA 2VFVA 4GRSA 4FNHA 1XMBA 4QWDA 2HW3A 1GQEA 4KPCA 3FRYA 2NZ4A 2HHHJ 2Y1JA 3TQ1A 4M5DA 1VRUA 3EM1A 2HNZA 1NK8A 2FIUA 2R7TA 3CIMA 4LVNP 2AEMA 3CSKA 4F3MA 1X5PA 1T05A 1URRA 1DRZA 1MG7A 1AFJA 3CJQA 1FJGJ 2MTLA 2ASJA 4FPRA 3MM6A 2OIHA 4DU8A 1HBUA 3E51A 3PEHA 3BGUA 5KT2A 2H5JB 3DGPB 3KK2A 2D7SA 4RBUA 3RBXA 2AP6A 3MF5A 3M9MB 4FF2A 4OJHA 3D0GE 1S7HA 2UP1A 4USTA 1SUQB 4L6V3 2XQCA 5KFJA 3RAXA 2JEFA 2DHXA 5ADZA 3NS7B 2CA9A 2W9BA 1T9XA 3WBZA 2BOAA 4X62F 3M1VB 1U2CA 3ENQA 4R0JA 3AQOA 3K58A 2HHXA 2LXIA 1MW7A 3DOMB 1D8YA 4DR1J 1EP4A 5KFKA 4GO7X 4C8MA 1UVLA 4F36A 4ZP9A 1CJUA 2LEBA 1WEXA 3IBCB 3R6GB 3IAM9 4DOZA 1P9YA 1S0MA 2QC3A 1RU1A 2OPSA 3CC2S 4NXNJ 1YG0A 3ICLA 4TXSA 3OPKA 1SC3B 3NL0A 2HGLA 4TYAA 3KK3B 1SV5B 3CPWR 2BR0A 3ZTSA 4I69A 1JJHA 4ZVEA 3CMQA 2XO7A 2OPQA 2DVIA 2EC0A 2B9WA 2ZOGA 4U9RA 4GC6A 1HWJA 2HLTA 2Y1LB 1KSPA 3R1LA 3OD2A 4E98A 3FSIA 3VR1A 1TL1A 2HNYA 2O1PA 1C2PA 3D68A 1Z2ZA 1CQMA 1HR0J 2KG0A 2PIIA 4G6VB 1FEHA 2VPWB 3HK2A 4EMDA 4DV3F 1S1XB 2B8QA 2GCFA 3DRPB 4CLPA 2ZH3A 4J9PA 1GFWB 2JEIA 3NNCA 2Y0BB 2HKEA 1R8BA 2BZ2A 3NEKA 1HLWA 3MUTP 3W5XA 4WXWA 2OD4A 3LOUA 3TUZC 2ZH4A 2ZDPA 1D1UA 4ZP7A 4NMXA 4C8YA 3DLJA 4FP9A 2CJQA 4EEYA 3FEXB 4MJKA 8RUCA 1SPBP 2KYZA 1PC5A 3PIPQ 3K8VA 1SVDA 4CP5A 3EGWB 2R7QA 4KJIA 1NHVA 4U6PA 1RA6A 1QTNB 2L9DA 4I1TA 1V3RA 1FWLA 2LP4A 2HS0A 2IM2A 2P8IA 3QBCA 1NJZA 4ES2A 1RHRB 2VC0A 5KG5A 2W01A 4DSEA 3G71S 2DO0A 2VDHA 4CH0S 1KQSR 4UOGA 2DHAA 1QJHA 2WBRA 1Q4RA 1WACA 4M5NA 1MMNA 1S1TB 5IWAF 1PJ6A 2H48B 5B0GA 3QSYB 4P2SA 2R8JA 4B3OB 3HXMA 3CT9A 3KDOA 1GTEA 1RWNB 1TKTA 3DC2A 1DQ9A 4WJBA 3P4UB 2MZRA 4X4RA 2ZBRA 1WC0A 2XBPA 2H54B 4KIAA 2XSFA 3V4MA 2V4JA 4FYVB 4WP9A 1P6TA 1RHMB 3N9UC 1N88A 1RT6A 2BX6A 3ZXWA 3T5KA 2BJEA 1HNXJ 2H51B 4FZVA 1N36J 3BO2A 5A0YA 1X4DA 3NS6A 1UKUA 4ZVTB 1SI9A 4FNIA 3E8OA 1HWUA 2Y1RI 3C2PA 4ID8A 3CDAA 3KMQA 1XTZA 1EJ7L 2CG4A 3FEZA 5GMDA 3FK4A 4I56A 4DR7F 3ZTQA 2A2DA 4QWEA 4J9OA 2KJVA 5HP1B 1S9EA 1UJ5A 1X4AA 3T9ZA 2ASLA 3Q0AA 3IP0A 1CQNA 1RACB 1D3WA 1AFIA 2ZZMA 2AGOA 1OWXA 2HWTA 3EGNA 2PEHA 4C9DA 5B0AA 5KG7A 3ZZTA 3OJSA 3TW0A 3PIOQ 3O44A 2EKNA 2CJAA 2MSSA 2HBYB 3QRPA 3BF4A 1SJRA 3UE2A 3W64A 2CUYA 2JX2A 1IKVA 4PG7A 2O01C 3QMQA 1LWCB 1DLOB 5E3AA 2LEPA 4OIXA 1J5EF 3PNIA 3BO4A 4QR0A 5KFMA 3TJAA 4ZN3A 3TAPA 2Y8YA 2G1DA 5KFSA 1B64A 3FBCA 5SUHA 2CKWA 1U45A 4PQUB 1HW9A 3M4XA 1KFSA 4LQ3A 5C24A 3VALA 3G6XA 2Z57B 3PW5A 3UN3A 3KLGA 4GMKA 4B3MJ 8AT1B 5E3CA 5JXSA 1FK9B 1HWKA 2R7VA 2AHOB 2XS2A 1HI8A 2IFXA 1RP5A 5MLCV 1FNOA 3W2WA 3NGTA 4I4BA 2DIUA 4IOAQ 5LJ3Y 2MQMA 3J81j 2ZZNA 2MHEA 2LQ8A 2OUGA 3CCLS 2NREA 5L46A 2ROPA 3H2LA 2W4PA 3FRZA 1JLCB 4URSA 4YHHJ 3HDSA 3ENVA 1ZZFA 5HROA 2W24A 3OL7A 5HLFB 1FKPA 1XWLA 2DNKA 1RWVB 2V0NA 1PBUA 1X7VA 3ILLA 4CLKA 4RBVA 5FJ4A 5T14A 1DURA 1HFEL 1LK7A 3KLEA 1C0TA 4PKDB 3UN5A 4DXLA 1YLXA 3ZTRA 3FCHA 2WSCC 4IFYB 3QWUA 3B4MA 3MD3A 2PT0A 3HFZB 4FYYB 4AYBD 2NR0A 3W61A 2OHDA 4DCOB 4WK1A 2ZE2B 2HK3A 1JXLA 2UUCJ 4L3KA 2M9KA 3GJRB 3OSPA 5K20B 4K0KF 1UAWA 3PDNA 3CB4A 3ZFVA 3HHNB 3HFVA 1OS5A 4DZ6A 1FD8A 2ZBCA 4LQ9A 3P49B 2DH9A 3WC0A 5KFCA 3R5JB 2XCAA 4I7FB 3QPIA 3J7A1 4M5JA 1R43A 4C11A 2CYYA 5BR8F 1CS4A 3SIPB 2CJBA 2IYIA 3BQ1A 3UD4P 2UU9F 4ZLJA 1UVIA 3K5OA 3N5BA 4ZHRB 3ISNC 2F8HA 1GTHA 1IBCB 4PQAA 1TKXB 1O51A 2R3VA 1OMSA 3LP2B 3DU6A 4H4KA 5DQIA 3QSIA 2HNDA 4QPXA 3MZIA 5T7LA 1NK6A 5E41A 4F26A 2Q66A 1N8RT 3D0IE 3K2YA 4EU0A 4RW7A 1TL5A 2VU5A 3O2IA 2AT1B 4EYIB 3DLGB 1VJWA 4PUOA 1JMTA 2VD3A 1CG2A 4IDKA 1VQ7S 1P8GA 2SXLA 1RT5B 1NJYA 4DV2F 1HNVB 1KTVA 4C8NA 4JOUA 4NLXA 4RNHA 4K4ZA 4USJC 3GSIA 3R7BB 3UFCX 2XZWA 4K7QA 1R31A 4C48A 2RILA 1DTTA 2J0QD 4DV7F 2YKNA 3RR7A 4HDHA 3CF5Q 2DR5A 4NLDA 4KHMA 4PRFA 3CCZA 3TZXA 3MGJA 1H3DA 2DD8S 2UVUA 5CABA 1C0UB 5KT3A 2QSFA 1PGZA 1GMUA 4LFBF 3C6UB 5ETMA 1BQMA 3I87A 3T9NA 2F7VA 1CBKA 4RUHA 2F4VF 5HJXA 2GMJA 4PWDB 1N5SA 2WVEA 1T7PA 3BSNA 1AB8A 3IBFB 2G13A 2YWHA 2G9OA 2Z2ZA 5HANA 4ECXA 2CRLA 4ZCIA 1L3SA 2LA4A 2QA1A 1ZAWA 1YDLA 5F8HA 4JYAF 1QVFR 4JV5F 4DR4J 2ASDA 3LUYA 3FGVA 4YDXA 1U1KA 2RQMA 2ILYA 3T19A 3L7UA 1ZZNA 3B8HA 1RYRA 4OYBA 2NXUA 1MSWD 1HL6A 3CCES 1N4LA 1DFDA 1YK9A 3TJ8A 2GVDA 5C25B 4DL2A 2HBRB 1JLEA 3EZOA 2CXEA 4X66F 3C14B 3TR5A 4DUZF 5J1NA 2JWNA 4JI0F 2RU9A 4FYWB 3KJVB 3SCKE 3MMBA 2L41A 1DBDA 3OSNA 3H40A 5A8WB 1RSCA 2FC9A 4DX7A 1LWEB 4QWBA 4B3SF 5K14B 2I0XA 3BBCA 1M5SA 1YIJS 3M8YA 1S97A 1VLYA 2GNKA 4NLGA 1VBZA 5I3UA 4NZ7A 1RWMB 1SKSA 3MFIA 1WF0A 5A6WA 2MQOA 1Y5LB 4OZ5A 5ETRA 1PG5B 4AL7A 2MQNA 1UL3A 5H9FJ 5BJRA 5KG1A 2VF3A 3GV8B 3V6DB 4OHYA 1WD6A 3D0HE 3I9V9 5KT7A 4OFZA 2CNOB 5HVHA 2LQJA 1ZA1B 1CJTA 3PM9A 4HT5A 2MZ1A 2EBGA 1U26A 3DNCA 3KMSA 2E1CA 1L3TA 1WELA 4WKYA 1RT4B 1AZSB 3T5HA 4ES3A 3W9JA 2VG5B 5HQLA 2A0FB 4MK9A 4AUKA 2GQQA 4K5SA 4I67A 1S1WB 4K4WA 2G1HA 4LMZA 4WFXA 1F5AA 3HSDA 1L3UA 4RW9A 5G4DA 4LFCJ 1YKWA 2M0GB 4YB1P 3DRSA 1YJUA 5AXLA 2FC8A 4P6QA 2HFOA 2GHWA 4Y2AA 3DXSX 2PMZD 1V3SA 4DS4A 2Z2MA 2UXBJ 4XPCA 4X4QA 2MHNA 2OPPA 2GX8A 1N52B 1NNDA 2FVSA 2LECA 1JKHB 1WHVA 3SQGA 2CQPA 3KLVA 5AE2A 2GJIA 2C2DA 1HQEB 4NL5A 2I5JA 5KFPA 3IA0A 1AUDA 4MFBA 1XC9A 2V8HA 2CQIA 4QZVB 1J2VA 1YZ7A 1ZS6A 4OZ2A 2YKMB 4TNOA 3CCRS 2BKNA 4G65A 4YR2A 4Q43A 3HPOA 3HD1A 4RUCA 1XERA 3NXZA 5CQGA 2MKJA 1WOPA 2CPZA 4J9NA 3TZZA 4TLRA 1VLOA 4YOEA 4JI8F 1I3OB 3S7RA 2K2PA 2WOMB 3U27A 4I6YA 3IR6B 3EPIA 2V2ZA 4WF9Q 1S99A 2QFIA 1T3NA 2FZGB 3K5LA 2BBEA 3QQCD 2HHUA 4K4TA 1N32F 2UUAJ 3W3SA 4QU7A 2UUTA 1S77D 4BC7A 2W2QP 2WVDA 2HHSA 4HR2A 4DLGA 4ZCLA 2B7CB 2XNQA 3AOCA 5CAAA 2YQ0A 2WTFA 1ZM4A 1G7CB 5DZ6A 1Q8KA 2Q43A 3G8SA 3KJQB 1QE1A 5F8NA 3H42A 4EBDA 1BQNB 3CJ3A 4LF9J 1RK8A 3CGIA 4CRJA 1JK9B 1NDLA 3NCQA 2FGOA 4K4XA 1F2HA 2BRKA 4USWA 8ATCB 3C6TB 2HRTA 5HQ8A 2OPRB 3E01A 2LU1A 2R2RA 2EKYA 1HI0P 1SJ4P 3G8QA 2BM0A 2YQ3A 1TVRB 1C1CA 1Y5IB 2IBOA 3A4TA 5K8PA 4X4OA 1VC0A 1IJEB 2R7XA 3MR6A 1FWPA 1KONA 4B17A 3KLIA 4NLTA 5DDOC 4CM2A 4ZVFA 2CQ4A 1HYSB 1ACMB 3QAEA 1SL1A 3W62A 1EB0A 4NE9C 4JI2J 1UEKA 3QFHA 2DIVA 5AXMA 4N77A 4NEYA 1WG1A 5I4MA 1T8EA 3K59A 3C16A 4EO6A 2XHWA 2DJWA 2E66A 4KO0A 3UDEA 3OL6A 1RHKB 4NOHA 4WFYA 1M5KC 1GX6A 3RJMB 3RBDA 1IQZA 1R7IA 2XM3A 3TUJC 4Z37A 2VG7B 4WTOB 2V63A 2ZVIA 2HMIB 5AJ3J 4RNFA 1XMQF 5A6PA 4FYXB 2RVJA 2AJ2A 5F0WA 2MGZA 1O0PA 1VOMA 4B9VA 2MJUA 3CJRA 3VZHA 5LL6d 1S1VB 4CO5A 4UF4A 2KHDA 3PYFA 3FSYA 5LMNF 1JB0C 1IBKJ 3MECB 4C2MA 1IN0A 3AB4B 2R7RA 1VBYA 5CCMA 4OI3A 2VHGA 3CDUA 4ZPTR 1M1KT 3QT5A 4K2JA 2VBWA 2BW7A 4MKYA 1SJQA 5EWFA 3L7OA 3NLCA 5CZXA 2H5IB 4NCAA 1IKYA 1CLFA 4WZQA 3N4WA 2W2OP 5KFGA 3RRKA 3NBPB 2OGUA 2CQ2A 4O4GA 1SQFA 2RH3A 4L76A 1RTDB 4DR3J 3JQMA 3BGRB 2ZFHA 2XSJB 5DGAA 4XDDA 1FDDA
chains in the Genus database with same CATH topology
3MMAA 5A8KB 3NCPA 3JSMA 3MPWA 1RT3A 1R0AA 2RUGA 2W25A 2UV8A 1FRKA 1UEVA 4DV1F 1U1QA 3KLIB 1S49A 3MOZA 3TA1A 2FHMA 3CEDA 1JIHA 3AA8A 4UUXA 5T41A 5CYJA 4OV1A 3VAKA 3PKYA 3ETOA 4ECVA 2DNHA 4NLUA 3THTA 3MXHP 3CO9A 4C0BA 2WHOA 4A4JA 2YH1A 1V3ZA 2CPFA 3NNHA 2ABYA 2BANA 3E3XA 4F3QA 2HQ3A 4KKOA 1U25A 2ZVSA 3LANA 4R25A 1GX5A 4JBCA 2JZ5A 4X4PA 2GMLA 4NLPA 1I1GA 3ONQA 2MYFA 2ZHBA 1VC5A 3BQ0A 1KLMB 2YKMA 4DR5F 3PACA 2EG1A 4OHVA 1UWBA 2XY7A 4ZCMA 2L3MA 4DR3F 3TUIC 3DMJB 5EWEA 3T5JA 3N28A 5AXNA 4YQWA 1LXJA 4A8XA 4WK3A 4N76A 2K1RB 1Q8BA 1ZAVA 3JSRA 3H20A 1DTQA 1Y9OA 2EFQA 3LP1B 3UCZP 4O3SA 2GIRA 2GHPA 3SI8A 2OFGX 4DR6F 1IKXA 2OPQB 4DX8H 3LW5C 2K3IA 2CPYA 2R7WA 2D41A 2FHOB 2RRBA 1NO8A 4U7CA 3Q8SB 4KO0B 3R5BA 2XC9A 3H4BA 1VC6A 1VQLS 2HAIA 1HW8A 2ZHAA 4DL0C 1FEEA 4J9QA 1NK5A 4OX9F 4M1KA 2K7JA 1KC8T 1KS2A 1URNA 2QLXA 3IXQA 1KR4A 5B0EA 5SZTA 5B0DA 5DETA 3P3DA 1ZYQA 3DM2B 3PHEA 4OQJA 4MKBA 2YKQA 2W4DA 1TKDA 4DDFA 1IBLF 2IJFA 2R8GA 2JLEA 2FLNA 4JI6F 4HH1A 4ELUA 3RW6A 1EETA 2HHTA 5THWA 2VQEF 2BVZA 3NGDA 5KFUA 2AYGA 4TU8A 1XNRF 1HD1A 2DNYA 3LP0B 4WCEQ 4C3MA 4V19X 2KO1A 2XWYA 2Y0SD 2HFZA 3V2UC 2KB2A 3HHKA 1C4AA 1AW0A 4UQTA 5D77A 1Y4ZB 3D1HA 1KVIA 3RB0A 2Z8QA 4DL4A 3SSQA 1Q81T 2RF2B 1RT1B 3SSSA 3J7Z5 4DF8A 4RW6B 2J0WA 2N3LA 3TVKA 4X65F 4ECWA 2CQDA 2VKRA 3QIPA 2MGZB 3RB4A 5B0FA 2IC3B 3DXBA 4UUWA 4FBTA 2MXYA 3RRGA 3HMJG 5J2MB 3M9OB 2QFJA 5G0RB 2J6UA 2DO4A 5GAEI 3DOLA 2VV5A 3MUMP 6FD1A 1RKJA 3T1HF 2BDPA 3ZZOA 1FESA 1F5BA 2A2CA 4OHXA 4KSEB 2GV1A 3O8WA 4NA2A 2XULA 4H4OB 4OHZA 2J0SD 1YJTA 2GQCA 3G86A 1JLBB 3HF5A 4BC9A 3CDBA 4RWWA 4AQYF 2KT2A 2DB1A 2C2RA 2RMLA 4RW8B 4DWIA 5DLFA 3GV5B 1X5OA 4QYRA 4AXJA 1I94F 1VS3A 2J9DE 4ZA1A 1P1TA 4ED7A 1J5OB 3W2VB 3BDPA 4FN5A 4QIVA 3G6YA 2GIQA 2HVHA 2I1RA 2N3OA 1U2FA 1U1NA 3GYXB 3DGPA 2NSBA 3TI0A 3QLHB 3QJPA 1FKAF 1UJ6A 1REVB 2QSWA 4KHRA 1NJXA 5KFEA 1WG5A 2VFTA 1S4FA 1TKZA 3IWLA 3OVAA 3HVAA 1GXUA 1HNWF 3M2VB 4RKUC 2V4RA 4YUDA 4DSLA 2NUHA 1VK3A 2H5EA 1IKWA 1HHSA 5KTQA 2PI5A 3I31A 4WKRA 1ROFA 1SUQA 3IS9B 4DHVA 2GW8A 2AJQA 2MKHA 1VQ6S 3THPA 3GB0A 2FJWA 2KRBA 1U1RA 2XMVA 4G1QA 3TVYA 4CO4A 2W7AA 4DG1B 1Q82T 4YR0A 2C3YA 1FKOA 1T02A 1WEZA 3AAWB 5KT4A 2QV6A 1ZTTA 5F3TA 2ZD1A 2JSXA 1IKYB 4DBQA 2KXHA 4LSNB 4B9TA 4BDPA 1YBAA 4N8OA 5JVHQ 4USHA 4KPYA 5BYRA 1KEKA 1FXRA 2CJ9A 3M1VA 5IFMA 4ATNA 2QMXA 5L1LA 4B9NA 3PEJA 4JUZA 2NPFA 1HNZF 4O4GB 1JLFA 2P6SA 5K8MA 5M2PA 4AL6A 3PW7A 4C8LA 3OTOF 3HX9A 5HMZA 1QAXA 1TQLA 3F41A 3HVRA 2VG6A 1S48A 2J7UA 4RBTA 2D74B 3DOMA 1C1BA 4FBUA 3H2VE 2HGNA 3X3UA 3GE9A 1TV6B 3MM7B 2J6TA 5E3RA 3TA0A 4EUVA 4A8WA 1RKIA 1N34F 3M30B 4OI2A 5E7OB 3MMAB 2KVIA 3LAMA 4OX6A 1LQ9A 3JSMB 1RT3B 1VI7A 2LA6A 3VAFA 1R0AB 3O6QA 4PG6A 2KHCA 3KLFA 1N5QA 2UV8G 4LVOP 3I56S 4JV2A 2A3JA 2P9EA 3KG1A 3MMCB 4LF8F 4NLQA 5A8RA 2Q6CA 5JJBA 2LQ5A 3QGIA 3TRGA 1PILA 4KGMA 3U1NA 5CH7B 4WFZA 4RNOA 4LT6A 4FS1A 4IO1A 4EZ9A 2D9PA 1ZM9A 1FDDA 1S6PA 3AJ1A 3CIZA 1ZETA 2BANB 2WW8A 4KKOB 2J76E 2RQ4A 2E7XA 2YWEA 1VQ4S 4UQGA 3D1QA 3OR2A 4DFKA 2RJZA 4OI0A 1NAQA 1S9FA 3LAKA 2DGOA 2W7PA 3AHPA 1UWBB 1U1MA 3OL9A 4YMEA 1SV5A 4IRDA 3BR9A 2CPIA 2V8GA 4JI5F 4C7QA 3GV7B 2VFUA 2VUGA 3HM9A 3LGMA 4ED1A 1JNZB 2E9ZA 1R27B 2E5JA 4DL7A 1RWUA 1S6UA 2CPDA 1DTQB 3SCJE 3EXYA 2C28A 4BBYA 1R8PA 3CE8A 3PKMA 1IKXB 3KOAA 3BQ2A 3OTDA 2PA3A 1UA1A 2RQCA 1FA0A 1VQOS 2ALZA 1VQ9S 2VODA 4OZNA 3VAIA 4QR2A 2YNFA 2DRAA 2JEGA 2ZDOA 3MEDA 4WU2A 2X1BA 5LXYA 5DQHA 4OZJA 2XI2A 5LXRA 1FRJA 3DLBA 2VFVA 4DQRA 3VAGA 3M8SA 4FNHA 1XMBA 4A46A 4XO0A 3PO4A 2B56A 3OFFA 3I9ZA 4EFAC 4QWDA 4DLEA 1NK0A 1GQEA 2HW3A 5IM0A 4OLOA 3FRYA 4J5OA 1GXLA 2Q79A 2NZ4A 1T3OA 2Y1JA 1OO0B 1EETB 2HYIB 4QIGA 2ZH8A 2MQPA 1NKEA 2MJNA 3TQ1A 1U6ZA 1Y00A 2LYVA 4M5DA 1D9FA 3NMRA 4ZLPA 3I0RB 3G9CA 3IGVA 1VRUA 2B0GA 3T1YF 2GA7A 2R2TA 4JI1F 4G3IA 2OTJS 2HNZA 4PXEA 1NK8A 1UW4A 1S9GA 2FIUA 3C66A 2R7TA 1RTHA 3T6JA 3CIMA 4LVNP 1MWYA 1S1XA 4D3HA 2DGXA 3CSKA 3QIPB 5E5NA 3DRPA 2NUUG 4F3MA 3ZZPA 1X5PA 1T05A 5F8IA 1OPZA 1YGYA 4RX6A 2JLFA 2J9CA 2W8KA 1URRA 2IM0A 3RB6A 2LEAA 1DRZA 5D4PA 2WSFC 1AFJA 2D1CA 3DOLB 1IXKA 3CD5A 2ASJA 2OSQA 3H5UA 4ICLA 2HRUA 4O44A 1XMOF 1K0VA 2WB1D 4FPRA 3MM6A 2HHHF 2OIHA 4ELVA 4ED3A 4ILLA 5EN1A 1HBUA 3M6WA 4GKJF 1N6QA 3E51A 3VTIA 2CPHA 3LWLA 5I3QA 2XMMA 3PEHA 4IFVA 3M05A 5GAGI 3BGUA 4XK8C 3KG4A 2DGWA 1QUVA 2LVWA 2F8EX 5KT2A 3G6ES 1U24A 1UETA 3UW1A 5BYSA 5FLXY 3KK2A 2D7SA 1WWHA 2ERRA 4RBUA 1NH7A 5HO4A 3RU0A 2AP6A 2LKZA 4I6AA 1TL4A 3MF5A 3M9MB 4FF2A 4OJHA 3D0GE 1IKWB 2WRMA 4I2PA 1S7HA 2E44A 1YJWS 4Y6IA 2UP1A 1SUQB 2JVRA 3RAMA 4RW4A 4L6V3 4ZPWR 3CCWA 4F50A 3PVXA 5KFJA 1X9SA 3RAXA 2JEFA 3GFYA 2RU3A 2UVWA 1KNZA 2EFNA 1KOHA 2DHXA 5ADZA 4ZPDA 5KFWA 1FKOB 1Q7YT 2ZUGA 1PSDA 2IYGA 2ZD1B 4MMOA 4PG4A 1VGYA 2W9BA 4ZP8A 5E3QA 4UOCA 3WBZA 4QR1A 4ECTA 4IYQA 1ULRA 2PO4A 2IAJA 2YKAA 4LJMA 4X62F 3M1VB 4NLRA 5J1EA 4OJGA 3CD6S 3ENQA 4R0JA 1U48A 4JV1A 1HBOA 3AQOA 3K58A 4KHPF 1JLFB 3F44A 3MR3A 2HHXA 3SV4A 2LXIA 3OQ2A 1MW7A 2VG6B 4BWMA 4DEZA 1M0SA 1C1BB 2IMOA 5EGYA 4MAKA 3N6MA 1RA7A 2V2KA 3NCRA 3P5TL 3RZAA 4DL6A 5KFIA 2MKSA 5L9NA 1H2UX 1S1TA 4O0IA 1YJRA 4QW8A 2ZJRQ 1D8YA 3CJ5A 1VQKS 2QRRA 3FZBA 1EP4A 4B3OA 3KLFB 4H4KC 5KFKA 2MKKA 4GO7X 4C8MA 1UVLA 4IH6A 4NWBA 4ZP9A 5A8RB 1JLAA 2LEBA 1HARA 4A8KA 1WEXA 1Q16B 2JH3A 4IG3A 4R8UA 3PJWA 3IAM9 1IUJA 3V5RA 4DOZA 1S0MA 1ZOTA 3DN9A 2ZM6F 3PRDA 1XNQF 2OPSA 4BWJA 1S6PB 4LFAF 3CC2S 1YG0A 3SYZA 1X4CA 1AXQA 2MZSA 3ICLA 4NLYA 4TXSA 1N0VC 3OPKA 1G2EA 3NL0A 3OR2B 2HGLA 4TQRA 4EWTA 4OL8A 3T6BA 4TYAA 2FHJA 1FDBA 4K4SA 2LXFA 3KK3B 2HWHA 3HI9A 1SV5B 4DL3A 4A8QA 1U7LA 4FF1A 3CPWR 4CO2A 3L95X 4I69A 2BR0A 1GT8A 1JJHA 2P9GA 2MQQA 4ZVEA 5HMYA 1YQHA 3K8WA 4H54A 3UPFA 2DNNA 2RNEA 2OPQA 2XO7A 2DVIA 2EC0A 4DR1F 3GIJA 2WK4A 2B9WA 2ZOGA 5KG4A 2IVMA 4E8UA 3OFHA 1YJVA 2XWXA 4QW9A 4U9RA 4GC6A 3MAHA 2O66A 1HWJA 2HLTA 2FJVA 4Q8EA 2YNIA 3MCSA 2YNFB 1KSPA 4HTJA 3MEDB 3R1LA 2QIFA 1QY7A 2X3GA 3B4DA 4I64A 3SFUA 3N6LA 4FXWA 4I2QA 3QGPA 3PX0A 4NXNF 3K5MA 4E98A 1X4HA 3H8YA 3FSIA 3VR1A 1TL1A 3HHLD 3PR5B 5KFLA 2HNYA 1OQ3A 2O1PA 3H5YA 2EFVA 3Q2TC 2DNZA 3BEGB 2POKA 3GFXA 1FXDA 4F25A 1V9OA 1C2PA 3CDEA 4DMZA 5F8GA 4LIRA 1Z2ZA 4Y65A 3CCJS 3TARA 1UVMA 3IBWA 4M5DB 1CQMA 2PI4A 2W9AA 3JSBA 3U1MA 3V4IA 1ZM2A 2BQ3A 1VRUB 2KG0A 2PIIA 2HNZB 4DV6F 4G6VB 1U4BA 1U1PA 1FEHA 1S9GB 1Q1KA 1VQSA 2CZVC 2VPWB 3HK2A 2YKOA 2HHQA 4DV3F 2M52A 3TANA 1S1XB 1Y3KA 2GCFA 2DBBA 2PGCA 2VH7A 3DFEA 3KNGA 2XMUA 3DRPB 3QGHA 2XNRA 3CCTA 2ZH3A 5HP1A 1T05B 1WHXA 2YWKA 5CYQA 1OSDA 3PW0A 4J9PA 5DQGA 4IO9Q 2JEIA 2VQFF 5B0CA 5DLGA 3CC7S 3NNCA 3QO9A 5C5JA 2BW2A 2GGPA 4R5PA 3OLAA 2J5AA 2LDIA 3O3LA 1RJJA 7FD1A 2ADBA 2VONA 3GR0A 1R8BA 2AJFE 2JFDA 3WDOA 4ICLB 1MMLA 3KK1A 4O44B 2FVPA 1KRPA 2CQ1A 2E1MC 2BZ2A 3GWCA 1FD2A 3MM6B 2HPUA 1O8BA 1Q8IA 2CQ0A 3MUTP 4HEA9 1HBUB 1ZPWX 2M4MA 1N6QB 3EYZA 3H2UB 4IFVB 2V9WA 4WXWA 4ELTA 2OD4A 3I6PA 3KLHA 1HR0F 3LOUA 3CCQS 4QIEA 3OTEA 2YX7A 1ELOA 3TUZC 1Q79A 2ZH4A 3CCMS 3KK2B 2ZDPA 4CT8A 5DRKA 1RT2A 2KH9A 1D1UA 4ZP7A 4ZCKA 4DFMA 2V8DA 3NS5A 4C8YA 3DLJA 4FP9A 4YB6A 2UVVA 2CJQA 4Y2IA