1Y3JA

Solution structure of the copper(i) form of the fifth domain of menkes protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
77
Chain Sequence
NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
publication title An NMR study of the interaction between the human copper(I) chaperone and the second and fifth metal-binding domains of the Menkes protein
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y3jA00
4FNHA 5A6PA 1Q4RA 2IYIA 2K2PA 2FHMA 2LXFA 2OD6A 2RMLA 1Q8BA 1KQKA 1URRA 3TNVA 2K1RB 2QIFA 1YJRA 2PD1A 4Y2IA 1FE0A 1JK9B 4HH1A 4OJ1A 1K0VA 1VQSA 1S6UA 1AFIA 4HL9A 2PGCA 2Q3PA 4DL0C 1S6OA 2FTRA 4ZA1A 2XMJA 3HHLC 2GCFA 1YJUA 1WD6A 3HX9A 4NL5A 1Y3JA 2L3MA 2W4PA 2HLUA 2HLTA 4OJ3A 4A48A 2IFXA 3BDEA 1AFJA 4FNIA 1P8GA 3KNGA 2QLWA 5K9FA 5B08A 3MCSA 1ULRA 2JDJA 5A6WA 2XMVA 5B09A 2OP5A 3BN7A 2OFHX 2LQBA 4Q2MA 4DN9A 1OSDA 2OAUA 2N7YA 2HQIA 2RILA 2OFGX 2LDIA 1YJVA 1KVJA 2HIQA 1JWWA 1OQ3A 2XMTA 3BB5A 3BF4A 3FRYA 5B0BA 1N5SA 1TZ0A 2HFOA 3IWLA 4Q2LA 1VQYA 3WDOA 2BJDA 1IUJA 1X8DA 2W4DA 1SI9A 1N5VA 2K7JA 3E8OA 4F67A 5KAKA 5B0EA 2XMKA 3BR8A 2FB0A 1YG0A 2VH7A 2EW9A 1CC8A 2AW0A 3HHLA 3LO3A 2N4CA 2K7KA 5IXUA 3MZIA 1MWYA 5T7LA 2ROEA 1FE4A 2GGPA 3KG1A 3HHLB 1CC7A 2GA7A 5F0UA 4HH0A 4OJGA 2G9OA 5B0CA 3T9NA 2AJ1A 4YDXA 3CJKA 5B0DA 5T7LB 1N5TA 4A46A 1KVIA 1P6TA 2GGPB 4A47A 2OMOA 3HFKA 4ZOSA 1RJJA 2KYZA 1N5QA 2FIUA 3LGMA 3DXSX 1APSA 1TL5A 1TL4A 2BJEA 2ZDPA 3VTIA 3TRGA 4OIXA 1X7VA 3HDSA 2W4CA 4EFAC 1Y0HA 4QOTA 1V3ZA 1FESA 1FEEA 1Y3KA 2N4DA 1GXTA 2BYCA 4Y2MA 4YEAA 4A4JA 1XBWA 2XMMA 1SQEA 2GV1A 3F44A 2KT3A 3BM7A 3IWXA 3FGVA 2QLXA 1CPZA 2XMWA 3KG0A 1OQ6A 2BBEA 1Y9OA 3QGPA 2HFNA 1Q8LA 4HI1A 2OD4A 2ZDOA 1GXUA 2AP6A 1Q53A 3LGNA 1FD8A 1TUVA 1X0PA 1TR0A 1SB6A 2KT2A 1W2IA 1LQ9A 3I9ZA 2IYGA 2OKQA 2XMUA 4DPOA 3BGUA 1U7LA 2ASYA 4NPOA 2GO8A 3QMQA 4HI2A 5F0WA 1FVQA 3CJKB 3TOQA 4Y2KA 2RU9A 3FMBA 3UDCA 1OPZA 1AW0A 3DCAA 1QUPA 5B0AA 2KKHA 3GZ7A 3HF5A 1MWZA 2QYCA 2ACYA 3K7RA 1R6YA 2ROGA 2AJ0A 2RSQA 4OJHA 2LQ9A 4U9RA 1YRXA 3HHLD 1YJTA 2VV5A 2K1RA 2BUNA 5B0FA 5B0GA 2CRLA 1FVSA 3KKFA 2ROPA 2GFFA
chains in the Genus database with same CATH superfamily
4OQJA 2CJXB 4I7FA 4Y2IA 3CCRS 3RR8A 2QL7B 1HBUB 1RAIB 1TVRB 1MSWD 1VDHA 4N7TA 3N01A 5HMYA 3D3CJ 4PPDA 1JLEA 2J6UA 4YR0A 1WKLA 2DEJA 4DR4J 2JWNA 1JJCB 5FIIA 1LK5A 1FCAA 3M1VB 4ZKAA 4MT1A 4C7QA 3FKBA 2V4QA 2JC0A 2ZC3A 3M8ZA 2BJ9A 1I1GA 3MPUB 2GIQA 2AT1B 1M5OC 2KH9A 3DRPB 4ZIVA 4MK9A 4IFYB 4DS4A 4FYDA 5HP1A 1EQ0A 2MKHA 4EGLA 1Q5YA 2FB0A 4J37A 3IAM9 2YQ0A 1IJFB 2YWKA 3CW2C 4XK8C 3T3FA 2C2KB 2XMAA 2V67A 3DOMB 1LW2B 2GMJA 5D0EA 4A46A 3CD6S 1Y11A 5D4LA 1LKZA 3K59A 4I1TA 2XNRA 1FNOA 4B3TJ 1K1QA 4HLBA 3BGLA 3ZZPA 3O6QA 4RW9B 3RBDA 2BZ2A 2QYCA 1I6JA 1N0VC 3QT5A 3HVWA 4X66J 1H2UX 2YNIA 5E5NA 4C8MA 1HBNA 1W7WA 2VG7A 2ZH4A 3T41A 2L41A 2QFIA 3KJVA 2CJ9A 3CMAS 3QO9B 4I64A 3ZTPA 3ICLA 3O5TB 2XGQA 3BN7A 1EIYB 5DDPC 1XK8A 4JOUA 1VI7A 2GW8A 3M05A 1FRJA 1TL7B 1RHMB 4IKAA 2VONA 1XEZA 3BYPA 1BD6A 3BJYA 2G9OA 2DB1A 2SXLA 2CJYB 3I32A 2BJEA 2WW4A 3SFGA 3EZ5A 1GXTA 1JQGA 3W9IA 1P27B 5HI7A 3N6MA 4ZPTR 5LMUF 4NE9C 1RHUB 2A2DA 4M5JA 1KHVA 2LQ8A 3NS5A 3PNIA 2OI2A 2W7PA 4NLDA 3D1QA 1B0TA 3HO1A 3U1LA 1NXIA 3FCWA 2Z0GA 1LWEB 4RUCA 5B0GA 1X4GA 2K1RB 2A18A 4IOCQ 2P9CA 1KOHA 1UEKA 2FVCA 5F8HA 2DPJA 4FZVA 4MFBA 4P73A 1S4FA 2HS4A 4ZS6A 4IH6A 1JMTA 5DG7A 2GQCA 3HLUA 2WCXA 1NCLA 1EETA 2GQQA 4P2FA 1QLNA 3R7BB 1S79A 5EWEA 3IRXB 1MMDA 3BBCA 1YSJA 2ZM6F 4DI6A 4EYHB 2VG6A 1UP1A 1OWXA 2Y1RI 4HH0A 3K5NA 4LRAA 3CJ4A 4M94A 2ILYA 4CDIA 3QATA 4G1QB 2KT3A 1RGVA 1PJ6A 1L3KA 4C8NA 4CLKA 3NG8A 2B4OA 1WWHA 4BHQA 3GIIA 4CT9A 5DQGA 4B08A 2CQGA 1DRZA 2AJ0A 2M70A 2VV5A 2WAQD 1IR2A 4OJ1A 3UVJA 2E9RX 5A6PA 2UVWA 4O0IA 3DLEB 4DV4F 3MR5A 3PDNA 4NA3A 4FF1A 1KRPA 1KLNA 4CO1A 5KFJA 2UXBJ 1N6QA 4LF6F 1B7YB 2D41A 4B3TF 3MR7A 1CS4B 3PEJA 2OJ3A 1T02A 2WSFC 1ZETA 2B4UA 1U1PA 2BJDA 2E1CA 1HQUB 1Q7LB 1GMUA 2PFFB 3MR3A 3RBXA 1L3TA 1E6YA 1HNXJ 2FJWA 4IQMA 3KLIB 2YQ3A 3BREA 1MWYA 3Q86A 2W25A 5HSPA 3BSCA 1VQ5S 4X66F 2V2ZA 2D74B 1OIAA 2V8VA 1S0MA 3AD9C 2X1AA 3CJTA 1VK8A 5HAOA 2DR5A 3THVA 4L6V3 2DGWA 1RZMA 2ZUAA 1OJ4A 2WONA 4A8KA 1FTRA 2GHPA 2BA9A 4DR1F 2NZ4A 3QSYB 4RL1A 3GSDA 4WPAA 1FERA 4FYXB 3PXGa 3CUNA 4LSNA 3OFGA 3EGNA 3CDBA 2DNNA 4NMLA 4F0HA 3NCPA 5DDOC 5E3PA 1VQOS 3L95X 1YIJS 2OFHX 5AT1B 3OSPA 3F41A 4AL7A 4Q2LA 2RD5C 4LRBA 4DLEA 2DT9A 2OUGA 5J2QB 1SQGA 3RG6A 3DLKA 4KQZA 2GA7A 4W90B 5CD4H 4ZCLA 3QNWB 3ZZTA 5FJ4A 4ECXA 3SYZA 2D9OA 5HJXA 2F8EX 1OQ6A 4C8OA 1ZM2A 4F7VA 3PZPA 2EWHA 3GP9A 3QGGA 2NPIA 2AX1A 2R7SA 2ZITA 4OFZA 3TR5A 4Q0BA 2WBMA 5EWGA 4V19J 3C2PA 2E66A 3K7RA 1WACA 1NJZA 2IJNA 3K57A 3S01A 1GX6A 4NOHA 4DJBA 1X31C 4KHMA 2MKYA 3QT8A 1RE1B 1HBMA 1B0PA 1YJUA 4ZLLA 4OYBA 1S12A 1NB2A 4CP5A 3OBIA 1JLCA 4DX6A 4LMZA 4WXWA 1JLBA 4PZVA 4W4MA 2LDYA 3E3XA 4C8LA 3OFEA 1IBLJ 2NXEA 1PAEX 4K50A 2M7SA 1R0BG 2MSTA 2MZQA 1DJ0A 3W65A 2I1RA 2ADCA 2XBPA 5L38A 2CYYA 1U2CA 2C2EA 2HNZA 3DXSX 5AXKA 4RW4A 4J9SA 2E44A 1Y0HA 3CULA 5J2NB 2FC8A 3G87A 1YX2A 3BKFA 5EUHA 4WYLA 4LIWA 3TP2A 4UOHA 3DC2A 3EICA 4LUBA 1WOOA 2R7VA 1RCXB 5E3RA 1YRXA 4BCAA 1YTYA 1ZZFA 3Q8SB 4CWBA 2BKPA 1IKWB 5A76A 1ZA2B 2IM3A 2J9DE 3JAMU 3FMWA 5KT3A 1J5OA 3MPVA 4FBUA 1KOOA 3LOUA 3MUVP 4DSKA 2P6SA 1SKSA 2MKSA 1T9XA 2B9YA 1S0NA 3C46A 3KLEA 3M4XA 2XI2A 1RU2A 3J80U 1KR4A 5CYMA 2M0GB 5IXUA 2KXNB 2XWXA 1P6TA 3K5OA 2C42A 4ZJLA 1RHRB 3U7JA 4QZVB 4ZCKA 1JJ4A 1JXVA 3HULA 1RISA 5HP1B 4NXNF 4KV8A 4K4TA 3HVTB 2V94A 1RK8A 4RNOA 4GMKA 1FX4A 2BKNA 1D9AA 2VBYA 1KQGB 1PC5A 2H51B 2XMUA 3ZFVA 3LPEA 4X4SA 5BJRA 1C2PA 3IMQJ 1TMMA 5KG0A 3KKFA 2QO3A 4DG1B 1OSCA 2EPIA 2FHMA 1FFWB 3OR1A 1VQSA 1AUSL 4QIVA 1SKUB 2N7CA 4DL3A 3HHKA 1RA6A 4PQUA 2WB4A 3MGJA 1Q78A 2FVSA 1X4EA 4WBFA 5THWA 4RWWA 4ZVRB 3B78A 2FJEB 3KG4A 3LAKA 2NLWA 4E98A 2GO9A 4O3RA 3W1YC 2ZJQQ 5G0RA 3KJVB 3PO5A 2CA9A 1S9EA 1OPIA 3CC7S 3CDWA 1LWFB 2Z2MA 1I51B 4QOTA 1VOMA 2IDLA 3ILLA 1REVA 4LSLA 3CCUS 3KUHA 4HEA9 2Z2LA 1NK7A 3ULHA 3FCHA 4B9SA 2XYPB 4NCGA 1X0PA 2GAHC 3AOAA 2KT2A 1DTTA 4DPOA 4NPOA 2W7AA 1HNVA 4Y2KA 1KTQA 3CPWR 5KFGA 1HD1A 3TZXA 1LWXA 1WG1A 3CTRA 3DM2B 5E3QA 2LXFA 1U0HA 4HH1A 4O4RA 5DZ7A 1KLMA 2FYXA 3R97A 3IA0A 2VICA 3QZ7A 4RBTA 1Y3JA 4RO0A 4ZN3A 2R2SA 5DS7A 3IG1A 2R7XA 1HBOA 4USKA 1FKPB 2J7UA 1NK0A 2RILA 3MCNA 4PXEA 3R2CJ 4DSFA 4DR5F 2HK3A 4F4KA 3M6XA 5A8RA 1K9MT 2DGQA 4AL5A 3D6TB 4CQ1A 1UCNA 4ID5A 3GCWP 4MFBB 4PG4A 2HNDA 4DV1F 1R31A 1N5TA 4YY3J 2PO4A 4GRSA 4I68A 4ZVFA 2IM0A 4WIQA 2MZRA 1S97A 3UN2A 2OPPB 3PX4A 2ERRA 2GHWA 1VBYA 2QEXS 3SZ2A 4R8UB 1SC4B 2XSJA 4HI2A 2PMWA 4C6AA 2DNOA 5B0AA 4ZN1A 2UXDJ 2V34A 2HNYA 4KJIA 1R8PA 2Y1LB 2YKOA 3I5BA 2XS5A 2VIHA 4AT1B 3LPYA 2ZWPA 1YBAA 4ELUA 2JLEA 2YX1A 1GAOA 3FSIA 1HARA 4C4WA 2IFXA 1BUXA 4OYAA 4FNIA 5K8PA 2F9DA 5AE3A 1UFLA 2HQFA 2IC3B 1DURA 3VAGA 4OHWA 4M63A 2DNHA 4DMZA 3BR8A 2AJQA 3PM9A 2G0IA 3UCUP 4HTIA 2I5JA 1N6QB 1YRUA 2ZZNA 5C24A 4TYAA 3CJKA 2BMBA 1FNXH 3PJXA 1EKSA 3DLGA 3ZNUA 3BGRA 1LFWA 5KOWA 2XZWA 4DZDA 2YKMA 1MU2B 1HHTP 2VQEJ 3K0JA 1RDRA 5GADI 5JMNA 2EFOA 1FRHA 3CCWA 3QWUA 4ER8A 3FCVA 2ATLA 1TK8A 2GJ2A 2AF6A 1RHJB 1N88A 3BEGB 3SFUA 3FNNA 1MMNA 6FDRA 4ZPAA 3LWLA 4NMXA 4J9LA 3G82A 4I2PA 1T8EA 4F3MA 3HJVA 4OLPA 4Y00A 3M2RB 2C3UA 4MH8A 2PGCA 2DEIA 2EKYA 4PG8A 1IQTA 2XNQA 1LXNA 1TU0B 3MM7B 4DSLA 4F4ZA 3IGNA 4ATNA 2DYAA 2K7JA 2KXFA 1U0SA 2E5LJ 4LSNB 1MLAA 4GKKJ 2MZTA 1F9EB 4D3HA 4AL6A 4PKDB 5DM7Q 2KI2A 3J81U 2ZZTA 3VF0B 4OLOA 2CPJA 5HMWA 5HROA 4DV5J 4BC7A 5KFTA 2CQIA 2OHDA 4KPCA 1E6VA 3DLKB 4CO0A 3PW0A 4TKTA 4HHHA 3CD7A 3MTJA 1U7LA 1S7IA 1SCJB 2HW3A 3W61A 3W5YA 3OUYB 1CJTB 4KGVB 3CCES 1JK9B 9ATCB 4YY3F 4ZVQB 1JNRB 1B70B 3CWJA 2UZAA 4BLGA 3PW2A 5ITHA 3C6UB 1XMOF 4R25A 5HANA 4DR7J 1Y10A 3M8YA 2AYEA 4JBCA 2QLJB 4CYUB 1CQNA 1Y5NB 1KBRA 3W62A 3QRRA 1VQYA 3MM9B 4RW8A 2PMZD 3PTWA 4DSEA 1HBMB 2PEHA 4WFZA 3Q8QB 4FKXA 2UXDF 4R0JA 4OJGA 3EDQB 1Q1KA 1S1UA 2EG1A 1CJUA 1JLCB 2W2QP 2I2YA 3I55S 1QD1A 2ZE2B 2YTCA 2V6AA 2CZ9A 2YKNA 1XBWA 1FJGJ 1HPZB 3RGIA 2BBEA 3JTNA 5JVGQ 3I5AA 1P1LA 3FEZA 4OZ1A 1LK7A 5D4NA 1SB6A 1XERA 3OTEA 1V3SA 4C98A 1HNZJ 4JI1J 3PW4A 1QUPA 4HTJA 4E8UA 1GTEA 3GV7B 3DHXA 3S6EA 1NH8A 3HZGA 1TKXB 5F8MA 1U6FA 2NS1B 1RT2B 1F2HA 3M8SA 1HI1A 1OS5A 1JJ2R 2HQ3A 5FLXU 4DL4A 4FBTA 2RIJA 4N8OA 3SQOP 4B3SJ 4G65A 2IJFA 4LREA 3RR7A 2VQEF 2DHAA 3QZ8A 5J1NA 3RB0A 4LF2A 1XNQJ 3CCZA 3Q2TC 2NXCA 2NZCA 1UL3A 2CADA 2V63A 3PRDA 1GT8A 3PV8A 3V4IA 3NWRA 3CXCR 2DNLA 3DLLQ 2KVIA 3CEDA 3DNCA 4Z7YA 3H25A 1XNRF 2HVIA 1G6BA 2DK2A 2YWHA 2EFPA 4BBYA 2BYCA 3KLEB 3EUNA 3RW6A 3MECA 2J9CA 1YGYA 5CYMB 2L48A 3AQOA 2DPIA 1VRTA 2JSXA 2JLGA 3LP0A 5B7WA 3MEEA 2K2PA 1WOPA 3G8SA 1VLYA 3OHBA 1RWNB 2HAIA 1NAQA 2WW8A 2QYGA 1RAHB 4HYKA 4DV5F 3A4TA 1FRIA 4ZVUB 5HVGA 1HYSA 2XZTB 1ROFA 3NNAA 1SI9A 2CZVC 2VC1A 1AT1B 2E7WA 4NLTA 3MR2A 4FXDA 4PQUB 3CGIA 3DDKA 3ETOA 3KG1A 4OI2A 4LSZB 2W2MP 3DRRB 1V6HA 2DXEA 8ATCB 3KTQA 4KTQA 2G0JA 1AA1B 5D6GA 4R5PA 1FKAF 2KB2A 2VBZA 2WB1D 5EN1A 3FBFA 5G0RB 3UQSA 3Q2SC 2BJ3A 2Z58B 2VPZB 4U7CA 2QC3A 2HKEA 4M1KA 2DHXA 2OSRA 4CLSA 4FS1A 1W26A 3MMCB 1RTJA 1RBAA 2QIFA 2FVRA 4I0WA 2OPSB 1K0VA 1S6UA 2KN4A 4LFBJ 4NCGB 3KLGA 3AJ2A 3GFXA 5IS2A 1T05A 2E1AA 3UNGC 1HNVB 5KFWA 1FJGF 4B9VA 2XYGB 2JDJA 3TAMA 1OYEA 2IY5B 1IWAA 1T7PA 2IBKA 2OFGX 3KDOA 1REGX 2JVRA 2BR0A 5CYJA 1KLMB 5B0EA 1HNZF 4F4YA 4JI1F 1JIHA 1S6QA 2K7KA 4CT8A 1TL3B 4PYAA 1KHWA 3W64A 4ECVA 1LWCA 4AE5A 3HVRA 3PVXA 4B3SF 4QWBA 3PFEA 2C3MA 1Y9OA 2IJRA 1XNQF 1C4AA 4EYIB 4ID5B 5KFRA 3NRBA 3H90A 2HNDB 5E3CA 2HBRB 4RNHA 3GZ7A 4DR2J 3G4SS 2CQCA 4PG6A 1PYTA 1GMVA 4RKUC 2NYHA 3D6HB 1RYRA 3SCLE 1A9NB 2B8PA 3A3NB 5CXTA 4DL2A 1UVJA 3THPA 1FRXA 2OP5A 5EGYA 3C66A 1HQEA 1NNDA 2J7WA 1WHWA 2VB6A 1DBDA 4YB6A 3HHNB 4WP8A 1K0TA 2GC8A 2O67A 3KMQA 4J5OA 4IFVB 1I94J 3TVKA 3SCJE 4OMFG 5J2PA 3AT1B 1WKJA 4M5DA 4DX7A 2X51A 2XZDB 4TYBA 2I5JB 1QAYA 5C24B 4EI2A 3CJKB 1HR0F 4EU0A 2J9DA 4JI4J 2Y8WA 4Z37A 3US5A 4ZLPA 4CLTA 1RACB 4GVBA 3W9JA 3H40A 5IM0A 3M8WA 4ERDA 3DI6A 2UUCJ 2HHXA 2MLZA 2N7YA 4EZ9A 1KEKA 4WFAQ 1X4FA 3OXFA 2N4CA 4LJMA 1IBKJ 3BPDA 3H4BA 1YHQS 1FE4A 1JLQA 2XO7A 4QIGA 1T9WA 4C48A 2W4CA 1FK9B 4LFBF 2K3KA 1Y3KA 2K3IA 1VQ6S 2D1CA 3R2DJ 2H4YB 3VAJA 3ZXWA 3DOLA 1FFSB 1KONA 4C9DA 1Q53A 1NK9A 3QT6A 1UVMA 3GYGA 4CLLA 4HT5A 2DXDA 3E01A 5E0OA 4OX9J 3M32A 4Q43A 4HACB 1DQ9A 1E6VB 4EWTA 1U8WA 2FUG9 2YNFB 3L7PA 3HT3A 3M9MB 4A8YA 3AODA 5B08A 3RYLA 2OEMA 3GSIA 2VZ9A 3RRHA 3OFFA 4C2MA 3Q22A 1OQ3A 4A8WA 4C11B 1VGYA 1VLOA 1IUJA 2W4DA 5DG8A 4I2QA 1H7XA 3OL7A 2LMIA 2V69A 2XMKA 1VFJA 3RB6A 3FC9A 4DR2F 5BYSA 3ONQA 1IR0A 2ROEA 1EB0A 2QFJA 3PY8A 4UQTA 4WFYA 4PWWA 2CNLB 1N36J 3CO0P 1VISA 3I31A 3D1HA 5IT4A 2R8GA 3VTIA 3G71S 4X62J 1SQEA 2H65B 3FGVA 4DFKA 3FJ2A 4ZVTB 1RT7A 3C3LA 4NI2A 1F3VA 5L9NA 3W63A 2GJFA 2BM0A 5GAGU 5J1PA 1T3OA 3PHTA 1HIYA 2RB7A 2HQDA 2YX7A 2FLPA 5HVHA 2YPYA 1KQSR 3KHRA 5C7PA 4NLXA 1AZSA 3M30A 2ZEJA 4USMA 2KFZA 5K14A 2VFTA 3NCRA 1I94F 3TWZA 2HFVA 4DL0C 3M8PA 4PABA 1VC6A 2YNGA 4KO0B 1RWPB 3DOKA 5DGBA 1WEZA 1G1XA 3EGVA 6AT1B 2RAQA 2C1EB 4OV6A 4DN0A 2IMWP 3FRZA 5KFBA 4PPZA 4LT6A 2AW0A 4ZP9A 3BV8A 2F4VF 2CWXA 1TV6B 1WORA 4FYVB 3OLBA 2GGPB 2RS8A 5GVQA 2ZNYA 4DF4A 2FIUA 1Z2ZA 4WTYA 4ED0A 3RTVA 2FC9A 3G9CA 4QYZJ 1FDBA 1NKEA 5CZXA 1PKUA 1SBRA 4JI8J 3TUZC 3TVYA 1CG2A 3VAFA 3HKWA 5FDLB 2IYGA 4USVA 3GQCA 4HHUA 3D0IE 2EC0A 5F8NA 2A0FB 4I6WA 4O23A 2J6SA 4BWMA 2ZH8A 2ATCB 2FLOA 1R8BA 3H5UA 1X4HA 1RWVB 2L9WA 4NLSA 3W3SA 2BJ7A 4LF7J 2NXUA 5LL6d 2PE8A 3DLJA 3B54A 2U2FA 1VRTB 2DGVA 1FRMA 3PYFA 2AX0A 1X5OA 4CO4A 5KFXA 2MQPA 5IC4B 2VFRA 5B0BA 2H54B 3LAMA 5DQIA 1N5VA 2FGOA 3AH6A 1RXOB 1BQXA 1W2BR 4DQIA 3MURP 4DHVA 2UUBF 1BXNA 2DIUA 1SJ1A 4OX9F 4LF8J 3NS7B 1S6PB 1NSQA 3W2VA 3R27A 4QPTA 5D3GA 3I0SB 1YZ6A 2MY7A 3I6PA 2V2QA 3UR3C 4CLUA 1S1TB 1EARA 3W2WA 2QLFB 4ZVOB 1LXJA 4DCPB 1T9TA 2CQ2A 1N32J 3MM8A 2ZH9A 2JJ4D 3B6BA 2R7WA 4KH0B 4NLOA 2V2VA 4NLUA 5E7OB 3WHIA 4FN5A 2V2KA 1NDPA 3BO4A 2AIRB 4R5PB 1N5YB 3P6YC 2KO1A 1U1QA 3DRSA 4RPFA 2M88A 4DS5A 2OEJA 2MHEA 1MROB 2MMYA 4I67A 2CXEA 4DCOB 2DNMA 4X62F 4CLPA 3CJ5A 2H48B 4Q2MA 1NBEB 3QPIA 2B0GA 1YJVA 3S7RA 3VAKA 1GTHA 1U8SA 4KR0B 3SCIE 2HBZB 2HFZA 2IAJA 1F6TA 2HWTA 2IA6A 3LO3A 2C2ZB 2FHOB 4WFXA 1T05B 2B6AA 2U1AA 1H74A 3EPIA 2ASDA 4DL6A 2D3OR 3PYEA 2E5JA 2Q1LA 3MD3A 4X4RA 2VUGA 1H72C 3POTA 4HKQA 1JJHA 2YWFA 1MN9A 2R8HA 4GO5X 1TKZA 1F0XA 4Q8FA 3HSZA 2CVIA 3O1LA 2XY7A 5L1JA 2NR0A 3P5TL 2QJ3A 4R0EA 1YJTA 4ZP8A 3LP1A 4IO9Q 1UWBA 2O1PA 2ROPA 2MLXA 4JI6F 4UUWA 3M2UB 5I4MA 2BDPA 4RLEA 1XR6A 1R27B 1C0UA 4ZA1A 1F2GA 3EPGA 3RUBL 1QTNB 2HK2A 4TY9A 2EFVA 2CPYA 3A12A 1VIXA 5A6WA 4QWAA 4L76A 4A8QA 4JI8F 2RHQB 2PIIA 1RWWB 2LQJA 4PXBA 1DTQA 2F65A 4ZIWA 2FD2A 2CPXA 4CZCA 3R9LA 3PYGA 1EHWA 3RJMB 2IDEA 5KT5A 3HFZB 1J5EF 1TL1A 2DITA 4QWCA 4YR3A 2RF2A 3NGRA 2HHPA 1OY9A 1HQEB 2DGTA 3C14B 3ENQA 3R6GB 4Y2MA 5C2CA 4O4GA 4LF7F 2KM8C 3SDEA 4ED2A 3T6JA 4M5MA 4HI1A 1JLFB 4MKYA 2FHJD 3RRGA 5DJBA 2WOMA 1PGZA 1RT4A 2CQ3A 2V4JA 3W8GA 4Y0FA 5KG1A 1MWZA 4ILMA 4TU7A 5DRKA 2GFFA 4X84A 4HT7A 5J2PB 3CCTA 4LF8F 2DNGA 5J1EA 3W7BA 3KNAA 2BJ8A 3RAXA 1DHMA 1WC6A 4ZMMA 4RW7A 1KTVA 2KJVA 2RQMA 3SCKE 5IT0A 3NY0A 2W9CA 1QTMA 1N5SA 3PACA 4UQGA 3BS9A 1N32F 5HLFA 1TQLA 5GAHU 1VQ4S 4GVBB 2CFXA 2L9DA 5IM0B 2JEIA 1K1SA 1S1WB 1VBZA 4M5GA 3HHLB 3A8EA 1URNA 1RT3B 4DPWA 5HJYA 1PO6A 4XIUA 3HFKA 4OX7A 3J81j 4IOAQ 5MAOA 5F8JA 1IM6A 2XCPA 5C2GA 4X4PA 3EDRB 3QBCA 2CQ1A 5H9FK 3MOJB 3MMAB 4DPUA 1ZAWA 2IRYA 4USUA 4KFBB 2MZ1A 1X4BA 1FD8A 2H5IB 2J9EA 3DHWC 1PCAA 2ZKUA 1H7WA 1JLQB 3G8TA 2ZH3A 1X4CA 3HFVA 1WEYA 4XDDA 2DNYA 4J90A 4UOGA 3EE3A 3IWXA 3AAWB 1KQKA 5T41A 1L3SA 5HMXA 3CSKA 5ETKA 1BMQB 1QVFR 2VHGA 3P4UB 1WC3A 1P8GA 3KNGA 3I56S 3E01B 3J7YU 2RRBA 5KG4A 5H9EJ 5AJ3J 4LF9J 4OZJA 3P45B 1RLDA 3KFWX 1YI2S 1O6XA 4B3RJ 2PI4A 5KFFA 3VGVA 1D9FA 1B7FA 3MM6A 4EZ6A 3QLHA 2WTFA 3C6TB 1B99A 3NAHA 5IT9U 2QMXA 2WVFA 2J0WA 3H42A 3IM9A 3SSSA 2CQPA 1CPZA 4I2QB 1FEHA 4JI3F 1RAAB 2LXIA 1SUQA 3TW0A 2QL9B 3MEGB 2UU9J 3M9NB 3I9ZA 2AZ1A 5EX0A 4WCEQ 5DGAA 3H2UB 1OPZA 2F40A 1TKTA 1FWKA 1VRUB 2GIRA 3NEKA 4KGMA 5D4OA 2LXUA 1U2RA 1K44A 5CQGA 4H4OB 3T19A 4MK7A 2HVZA 2OTJS 1WG4A 4CTAB 2Y1IA 2CVEA 3TA2A 3L9ZA 2ZWOA 2BE7D 2FHJA 2NYIA 5IWAF 4ZPWR 1X0FA 3OTOJ 3M6WA 4NLWA 5K14B 2D3UA 4RNMA 1ZM3A 3DLBA 2CQDA 3HHDA 4J91A 3TARA 3PX6A 4Y3CA 1EQMA 3A8KA 1TL4A 1X7VA 4TU8A 4QW9A 1ICEB 1RWXB 1K73T 5HN0A 1U1KA 1NK6A 3D6MB 4AXIA 3KK3B 4LRFA 4LR7A 2RNEA 2FPHX 2M9KA 1FVQA 3D28A 5CH7B 3HF5A 5IV4A 3B8HA 1WF0A 1RT5A 2P9EA 5L46A 5I3PA 1TTHB 5B0FA 1QAIA 1ZZNA 2QTWA 4J9NA 2PC6A 2DVIA 3L4BC 5ETNA 3ILOA 4EBCA 4F3OA 3NAIA 1DQ8A 3OL9A 4JI7F 2NXNA 5DQHA 3QWPA 7FD1A 3DKDA 2MEWA 4YDDB 1K47A 2R9LA 2YX4A 3GG0A 2M8DB 3I4PA 4ZHRB 1M1KT 1FDNA 1T0TV 3UN5A 4MKVA 1RKJA 3JQJA 2VPXB 3AJ1A 2HGLA 2XYHB 1F3FA 3CJ3A 1UJ6A 3JTOA 3D6FB 2VA3A 2BX6A 4DV6J 1C0TA 1XR5A 4K7QA 5I3UB 3UO0A 2KRBA 1CJKA 1UPMB 1EP4A 4PWDA 3K8VA 3W2VB 4CH0S 5AJ3F 3KLHB 1J27A 1JX4A 4Y34A 1T9UA 1S1XA 4USHA 5D3GB 2KZMA 2BUNA 3K8WA 1KC8T 3FBCA 9RUBA 1URRA 4WE1A 1IQZA 4W98A 2RRAA 1XR7A 4NXMJ 1B4SA 3QIPA 1T11A 1KFDA 3MM8B 3NGUA 1UVKA 3NGSA 5KFKA 2PFDA 2VPWB 3O44A 1HNWF 3HVAA 2JRSA 5HBMB 3DYAA 5A8KB 2QA4S 4B9LA 2UU9F 1BLUA 3MFIA 1ZTTA 1X8DA 2NUHA 2KXHA 4P10A 3DRSB 3ZZYA 3IN5A 1YQHA 4OI0A 4XPCA 2EG2A 2YVSA 3WC2A 3NBPA 3RBEA 2JZ5A 4C8ZA 2DHHA 4W92B 2V9KA 4A8SA 3SXLA 4WZMA 2BRKA 5C5JA 3BDPA 2XMWA 4CRJA 6FD1A 1RWOB 4ZVSB 3BO3A 2NSBA 2B6AB 3OD2A 3GE9A 3QMQA 1KFSA 3OTOF 2ZHAA 2V8PA 2MXYA 4OJHA 3QJPA 1U26A 2AU0A 1M0SA 1JXEA 4JI0F 1ZM4A 1FJEB 3M8RA 3EJMA 3HSDA 2WSCC 1H2TZ 3POTB 1VQLS 4XDCA 1UTAA 4QU7A 3O2IA 1SJQA 1UFWA 1TKZB 2FJVA 2FTRA 2EFQA 2MKCA 2MYFA 5KFCA 3VAMA 3EX7B 2B5JA 3C15A 1SJ4P 2DCLA 3GJSB 3IWNC 2I9SA 2YWGA 4DUYJ 2B56A 4P71A 2N82B 2CNKB 1NSAA 4MJKA 5IV3A 2G13A 3N6LA 1HMVA 1RJJA 2B7CB 3IR7B 2J8SA 3NXZA 3BBBA 1TMJA 3HZEA 1RT6A 5C42A 4IYQA 2DO0A 3QFHA 4PG5A 4CO2A 2CPDA 4NRUA 3VR1A 4L73A 1CJVA 4FVMA 2JOQA 3MMBA 1FT8A 3W8PA 1TL1B 2RF2B 1Y7PA 5SZTA 4OX6A 4HR2A 4WP9A 2CRLA 4O4GB 4IO1A 2DH8A 5HQLA 1HA1A 2R42A 2VASA 1X4AA 2GVZA 2VOOA 2UV8A 2GZOA 4YP3A 4TY8A 3CJQA 4AYBD 4DV6F 2MSSA 2Z2ZA 1JLGA 4L75A 4LQ3A 2C2DA 1V3RA 3ENAA 2IA0A 1KQFB 4USWA 4ECRA 1XWLA 3FBBA 3TA1A 4ELTA 1G2EA 3DGPB 3TO8A 1F1BB 4Y2CA 3TUPA 4O44B 3ZZRA 5CAAA 2W9CB 1UW4A 3H8YA 2BM1A 4YEAA 2RRNA 4RW6A 2RDIA 3HKZD 1VHFA 3K17A 4DWIA 3T1YJ 2OD4A 1AROP 4J9UE 2RU3A 1FI4A 2RDJA 1VQNS 1YK9A 5F0WA 2AQ4A 4DQPA 2W01A 5D4PA 2NPFA 3D68A 3SV4A 2ACYA 2ZVIA 1WG5A 4KGKA 2HHSA 2RT3A 1U47A 3CDAA 2E1RA 1KN6A 2OPRB 2JEJA 1Q0NA 4ENOA 2ZOFA 2CPZA 3MPYA 3KLFA 4JV2A 3KMSA 5HMZA 2KL8A 2LP4A 4B9MA 1RTZA 2HIQA 1VCTA 3KHLA 4P2XA 1GFWB 4E2FB 3LP2A 4ES1A 1HWKA 4PG7A 1NLKL 2J0SD 4DR4F 4NEYA 4O3QA 1N33J 4LBHA 2V8HA 2FQQB 2RQKA 4QWEA 5B0CA 3CO9A 3ET6B 2J5AA 1HW9A 5T7LB 4OZ5A 2HHTA 1IKVB 4A8XA 5LM7E 2MGZA 1ZH5A 4F2SA 5K8MA 2VU5A 2Q79A 3QQCD 1SIWB 4ZPCA 3NGTA 4OYWA 2GJIA 3NOGA 2AD9A 2EEYA 1FFGB 3MXHP 2DR9A 4K4UA 2EK6A 3H59A 1XC9A 4NYZA 1RWKB 2PA8D 3FFIA 3KK1B 4HVZA 2HVEA 1S9GA 2HGMA 1HFEL 5U47A 2OPQA 4URGA 4ECTA 4JP8A 4WU3A 2OGUA 1WI8A 3NOCA 2RHSB 1Q95G 4H4MB 5J2MA 4L74A 4DN9A 3KWMA 4ED8A 3I0RB 4N41A 1V9OA 3TZYA 2IVMA 1GQEA 5D78A 3DMJA 3A1YG 5BYQA 3NWGA 1ACMB 3TQEA 5B0DA 3V6DB 3DRYA 4Q45A 5GAEU 4RNNA 4PUOA 3UN3A 1PYOB 3CD0A 5CYQA 4X64J 3QAEA 4LR9A 1CEZA 2NQPA 2CQ4A 3H5SA 5I42A 2MPUA 3TVZA 3THTA 4MTPA 3MDFA 2FJXA 2LQ9A 3I5CA 1ZBTA 5CABA 1UZHA 1M90T 2LKZA 1P1TA 1HBUA 1TVRA 3UDLA 2HMIA 3KJFB 1MN7A 2E5GA 4C8YA 2BACA 5KFEA 1FWLA 4K4WA 1VS3A 4KB7A 3JSRA 1MNEA 1BQMB 2ZZMA 3EGWB 3DRPA 1RT5B 2KG0A 1TZ0A 1HNIA 4F3QA 4ETXA 3M6UA 3DOMA 1QUVA 1LW2A 3MZIA 1QDUB 3PIPQ 3CJ0A 4U95A 3ZZZA 3GIRA 2MKKA 4U8YA 3PHEA 2C2MB 3I87A 2VG5B 1F60B 3BM7A 3E2EA 4NA2A 4RW9A 1FA0A 2FJBB 2DNKA 3CDUA 2EC2A 2W1BA 1EKRA 3K89A 4NYPA 3SQGB 1QSLA 3GWCA 1N33F 4FNHA 5K20B 3EVOA 4ECQA 4CLZA 2UVVA 4EUVA 3BSNA 1Q8IA 2W4PA 1Z2LA 3HK2A 2DTJA 1PYSB 1EP4B 4LBIA 2P2CB 4DZ6A 3C16B 4IDKB 1ZA1B 4XAKA 2QRRA 4WE1B 2GMLA 2Z30B 2DKOB 2UXBF 3BGFA 4IR9A 2BV3A 4JI5J 1X4DA 2DGUA 5F8LA 3TI0A 2EFNA 2DR6A 1WHXA 2BRLA 1RCOB 1OY8A 3L3CA 2HHVA 1YITS 4RBVA 3Q24A 4ETZA 3M7VA 4AUKA 4EFAC 7FDRA 2H5EA 3HPOA 2R8IA 1HHSA 2YKPA 3MCMA 1HNXF 2XULA 1BY9A 1C1BB 1RI7A 2CPIA 4C0HA 3CIMA 2QZ8A 3NBPB 4MIAA 3ISNC 4NLGA 4OZLA 4OYZA 4EEYA 1LWEA 2KKHA 4FPIA 2K1RA 1C1CB 2HBQB 1UVIA 2YQ1A 2LLZA 5A0YB 1Q81T 3D9BA 1AXQA 4C3MA 4IG3A 4DR6J 3KHGA 1VQMS 4JV1A 4I7FB 4ZPVR 1NJWA 3Q89A 2MZSA 1RWMB 1JLEB 4NYOA 5DM6Q 3MEDA 4DV2J 1Q5VA 1OSDA 1HI8A 2XS2A 3IRXA 2CDRB 3ITHA 4J7CA 4ZLJA 1NPPA 1NRKA 1R7IA 3AJDA 3IGVA 2FHKA 3ZO7A 5L1LA 4DR3J 4H4KC 1UZDA 4X4UA 3MM5A 2BOPA 4URQU 2AV5A 3IS9A 3FUYA 2BE2A 3RW7A 1AYEA 1XMQJ 2B5JB 3C15B 4UOCA 5L39A 4G1QA 2E1MC 3HMJG 4EK2A 4Q5VA 4KKOA 4ANCA 3H0PA 3O3LA 5KG6A 4ZP6A 3PJWA 1GXUA 4X4TA 1FTCA 3JAMY 3T5LA 3NKYA 3UNYA 2EXUA 1RT6B 2DGOA 2WVEA 3DLEA 5HO4A 5KFDA 1L3UA 4YMEA 5GAGI 5D0HA 3J80Y 2AMCB 5ETQA 2YNIB 1HBNB 4HL9A 1CJVB 2VG7B 3SEOA 1VJWA 2QMWA 1TP7A 4DOZA 4DF8A 1CS4A 5D0RA 3WIUA 2XMVA 4LVNP 1FKOA 1H3DA 3CCJS 4ANDA 2L9NA 4N8NA 3KLIA 4DV3J 4ZJOA 3EVMA 2GVZB 5BR8J 2C22A 1BGXT 1NJYA 2HHQA 4LVOP 1VRQC 4EO6A 1TUGB 5E33A 3UD3P 5LJ3Y 1IBLF 3TAPA 4GKJJ 3QJLA 3JSMA 4Z2XA 2C3OA 3BH7B 1SH3A 1TUVA 1O51A 4ILRA 3PKYA 3MD1A 4BWJA 2ILZA 4A8MP 1ELOA 3O8WA 1UA0A 5F9LA 5L8RC 4J9QA 4F4XA 1AFIA 3OSNA 4FDFA 2UP1A 1S6OA 1FXDA 1R0CB 2GX8A 1TAQA 3V5RA 2HVHA 3EXCX 1IN0A 4QWDA 2LDIA 3F0NA 3QRQA 5J2QA 1EETB 3LUYA 1NSPA 2HZAA 4KT0C 3HXMA 2RDDA 1UVNA 4DX8H 2W7OA 3IBFB 2CQHA 1VC0A 3AXKA 2Y0BB 4WFNQ 1PBAA 4HDGA 3KLFB 5F0UA 2ZJRQ 2VG6B 5DZ6A 5A2QU 4YN3B 3FZBA 2FY1A 4EMDA 3FK4A 2O01C 4P2SA 1O5JA 3KOAA 5KFSA 3D0HE 1NPKA 1M5KC 3LP2B 1X9MA 2B9EA 1DZ5A 1WC1A 4ZITA 2CJQA 3VVUA 1LNQA 2COLA 2ACMA 4ZVGA 1TKDA 2LVWA 1WEXA 3AOBA 1YJNS 3UVJB 3NP5A 1XMQF 5KFHA 3KLVA 2JHEA 4CLFA 1WHVA 3CMQA 5F9NA 1UA1A 1M5SA 2V9WA 3GLJA 3ILJA 3V4MA 2DY1A 1Y5LB 2DNRA 4K59A 5IQQA 1Q7YT 1YG0A 1F5BA 3G6XA 2OPQB 1QM9A 4JV0A 1E6YB 2CAJA 3TA0A 3MAAA 1YKWA 1U4BA 1M5VC 4J9RA 1HI0P 5J2NA 1RT1A 4TLRA 4ZPBA 1RLCL 5KFMA 2AGQA 2RJZA 2CPFA 4KY3A 4NCAA 3TX8A 4OYXA 2PI5A 4YQWA 1D3WA 3PKMA 2F63A 3UI3A 2WONB 3FMBA 2R8KA 3PYDA 4PUOB 4F26A 2NXJA 1WJ9A 3IC1A 2XCAA 5RUBA 4QPXA 3TNVA 3ZTQA 3GFHA 5CYQB 3HSGA 1FD2A 2LA6A 3QFWA 4TNOA 2F9JA 3PRVA 2ZM6J 3TJAA 1AFJA 4GKJF 1D9DA 5K9FA 1M1GA 2J0QD 4MK8A 2OSQA 1TK0A 2HQIA 3ZZOA 3QRPA 4TVAB 3GJRB 3W60A 3E51A 2HMIB 4RU9A 3E8OA 2H5JB 2O5DA 3DXBA 1IJEB 1KWMA 3N9UC 5EHHA 2JVOA 1QAJA 5CD4A 2H1YA 1EJ7L 5DG9A 3PCOB 2D3O1 3S1TA 4E0DA 3IBCB 1ZAXA 2R7UA 1S0VA 3LALA 4X65J 4USTA 2KYZA 1JXLA 2CNOB 2UXCJ 4B3MJ 4WF9Q 4ZVEA 1HQ2A 3HVTA 3BH6B 4L3KA 1HNIB 4ITSA 2HRYA 3SMZA 4I6YA 2B9WA 5KFNA 4MIBA 4DV4J 1X5TA 3IRWP 3HT0A 2AKWB 1Y00A 2VBXA 2QV6A 3L7UA 4LF6J 4Q0BB 4ECYA 4C3KA 4DG1A 3GR0A 4LR8A 2HZVA 4MMOA 1ZYQA 2ASLA 4OZ3A 1XN9A 2MQQA 1FE0A 1F5AA 2XHCA 4QQBA 2QN6B 1S99A 3R5BA 1U24A 2XEXA 1NM2A 3HI9A 2L3MA 3QT7A 3CC2S 2XY6A 2F1FA 1B3TA 3J81Y 3F56A 1P9YA 4RUAA 1R89A 2APOA 1JLBB 2XMTA 3B4MA 2FY8A 4Q44A 3WDOA 2M8HA 2NCKL 4DX5A 3OL6A 5GMEA 3GIMA 3BO2A 1VQ9S 2DH7A 2G2OA 1LWFA 2GQ2A 2R8JA 2FVQA 4X4NA 2R7OA 3LQVA 5F41A 2VDHA 5GAHI 1KS2A 2IMOA 2L08A 4DFPA 4EBDA 2FZGB 2HNZB 2IPOB 2XMMA 4RW4B 5F3ZA 4DR1J 2VF3A 1YZ7A 4LF5J 1D0EA 1HD0A 3IXQA 3TUJC 2BQ3A 1WSVA 4OZ2A 2AEFA 3CCMS 3OPKA 4OYPA 1AW0A 3DM2A 2CDQA 1FJCA 3JXOA 1MW7A 2B3TB 2CUYA 4BS2A 2FZKB 4LIRA 1JNZB 4DQRA 3D2WA 2ZHBA 1VC5A 3V6HA 2B4VA 4LRDA 2OIHA 1FKPA 4RJVA 2IVYA 3N0VA 1J5OB 1KVJA 3H98A 2MTLA 1VK3A 2CIMA 3CF5Q 2MKJA 2Q43A 1T9VA 4IG3B 3FEYB 4RR5A 4JB8B 4F2RA 3GYXB 4JI2J 3EXYA 3DFEA 3D66A 3J7YI 3UD4P 1SC1B 2OMOA 1UJ4A 1SKRA 3MEDB 4ZVPB 4CI0B 1APSA 2R3VA 2F8HA 1U48A 3HDSA 2OPPA 3ITHB 2E5LF 4GKKF 1RU1A 5E41A 1U1RA 2XY5A 4ZP7A 5FLXY 4KV8B 4P72A 4R8UA 4C97A 4NZ7A 1TR0A 4YS2A 3MM5B 1S76D 2VKZG 1RTIA 4ZLNA 3TOQA 4CO3A 3IS9B 2PT0A 2BE2B 3PR5B 3OLAA 2YNHA 3BQ1A 4FPRA 2CJKA 3M2VA 3Q23A 2ZVSA 2EFGA 2ZH7A 2FDNA 2MQOA 2B7BB 4KKOB 5FD1A 4QIEA 1T3NA 3I9V9 2QE5A 3V6KA 2ZBRA 4IQXA 4X65F 2JX2A 3OR1B 2UXCF 4B3MF 3HHLC 3UW1A 5L1IA 3ENWA 2IC3A 3R7SB 4OI4A 4O3NA 4DBQA 3N5BA 4H54A 1LW0A 2V0NA 3PO4A 3JQKA 4K5SA 3F73A 2XM3A 2JNJA 4NWBA 4DR7F 2C3PA 2ZH1A 3CVKA 3OL8A 1N48A 1KD1T 3A8IA 2FVPA 4OZ0A 1S9EB 2JFKA 4MYUA 1MU2A 1FKOB 3MAHA 3TZWA 4KHPJ 5LOQA 1PAUB 1REVB 4LSLB 2ZDOA 1FRLA 2LEAA 1YLXA 3FZ2A 3N5FA 2LU1A 2E7XA 1LV5A 1IM4A 1DTTB 1DARA 2VL1A 2XI3A 2Z57B 2PEBA 3U1MA 4K8RA 3M2RA 2OH2A 3JSMB 4ZVHA 4WKRA 1U0HB 3TX0A 4K2JA 4RX6A 4TN2A 3GTYX 3MCSA 3MM7A 1NU4A 4WZQA 4ALZA 3JSBA 4LF5F 3IG1B 5I3QA 1FX2A 1NK5A 2KM8B 1HBOB 1QE1A 4LFAJ 3MOZA 4KH1B 4DQQA 1IVZA 2IHR1 1IKXA 2DJWA 2RVJA 4NXNJ 4OHXA 3TUIC 5A8RB 1H73A 4ZK7M 3LGMA 3Q8PB 4OIXA 5KT2A 3BN4A 2QX0A 1SL1A 2XLKA 5KT7A 3D5MA 4ICLA 3P49B 3PG9A 2QA4G 3DGVA 2XSFA 1OYDA 5LSLA 2XSJB 3OUYA 1CJTA 1J2VA 3G6YA 4UTGA 4TQSA 3CJ8A 2MQMA 4JI2F 1QJHA 1S59A 2OD6A 5D0GA 2M3DA 2Y0SD 2HNYB 1TFYA 2IRXA 3P96A 1UMJA 4PCQA 3C6UA 2Q3PA 4PRFA 2I6WA 3TYTA 1SL0A 2XMJA 3K5MA 1WD6A 2Z56B 2E5HA 4CYUA 4GVLA 5M2UA 5HK4A 4DL5A 2WZ1A 3MM9A 3PRBA 4X2BA 4OV1A 1NK4A 1S0OA 3BF4A 3PEHA 2VPYB 1QAXA 3W9HA 1T94A 1SC3B 3UDEA 5F8IA 4J9KA 2ZE2A 4ID8A 4V1Ak 1X60A 5HQMA 1HPZA 2XS7A 2DCUB 1NMEB 3DLGB 2Q6CA 3BGRB 3JYTA 5LXRA 1YVFA 2W2PP 2YKMB 4FF4A 3AY0A 2LECA 3FQLA 4L72B 1HWUA 2BKOA 1KSPA 3NCQA 3MAAB 4B9NA 7AT1B 4O0NA 2JFDA 1RT1B 1TKXA 2H4WB 3T9ZA 4KGXB 1RT2A 1X9SA 3T1AA 4OI1A 3CE8A 1JLAA 4ILLA 3FQKA 2Z2YB 3QIDA 3G82B 4ZCMA 4I2PB 4DR5J 2ALYB 4ES3A 2C2NA 2OELA 1Q79A 4QU6A 3OV7A 1NJIT 4KHPF 3BPSP 1HHQA 1NHUA 2PDAA 1VQKS 3RZAA 1KVKA 2VJUA 4DV1J 2M4MA 3AFGA 1V5IB 4UY85 1ZM9A 3OTDA 2E5IA 4NRTA 3HD2A 2DD8S 2ZH2A 2Z4PA 2HRTA 4KGZB 1R0AA 5AXLA 2XG8A 5KFAA 2YPZA 2M5YA 4YHHJ 2DRDA 5IC6B 3IAS9 5JJBA 4YDXA 1A7GE 1D09B 3ZZ0A 4M5IA 2CPEA 2G2ZA 4UT4A 5CCMA 3VALA 3ISND 4XPEA 2F4FA 3MF5A 5SUHA 2HFUA 5HROB 3L7OA 2KFYA 4G1IA 1VIOA 1HWJA 1UW9A 4FKYA 3OQ2A 2BVZA 4FXWA 4LFAF 3NL0A 4UY8T 5ETSA 4P9SA 3VZIA 1R6YA 1SQFA 2AJFE 2XTJP 2HHWA 4DUZJ 4DV7J 1S9FA 1JB0C 2X3DA 5KG2A 1S4EA 3HP6A 1YBTA 1BHNA 1G7CB 1VYAA 5DLGA 4CH7A 3QYYA 1N4LA 2ZKTA 3SIPB 2BANA 3S8SA 3MMJA 5ETPA 4RW8B 1SJ3P 3TQ1A 2KHCA 1Y4ZB 1N52B 4FS2A 4UF4A 3G6VA 4G6VB 3H2VE 4B17A 3DRRA 4A8FA 1N34J 5JVHQ 1S1UB 1N5QA 1CJUB 1TL5A 3IFEA 4KBIA 1FESA 3DU5A 2DR7A 2QT7A 1NPRA 1W25A 4QYZK 2YKNB 4P52A 2HFNA 4CLWA 1Q8LA 4ED6A 4EO8A 2M2BA 4DEZA 1RHQB 2Y8YA 3IBWA 1JKHA 3T6BA 3HHEA 4BC9A 3GV5B 1YJ9S 2E9TA 1R8CA 3VVTA 4K4SA 3P5BP 4U9RA 1KDNA 1PG5B 4ED4A 3MMCA 3KJNB 5LXYA 3RAMA 5KFYA 4DL7A 2OPSA 3OFHA 2PD1A 3OVSA 1UFKA 1BQNA 3MCOA 4OI3A 1WF2A 2A6MA 1WTBA 3CDEA 3LGHA 4ZCIA 5KFZA 5IFMA 1GEHA 4B9TA 4IG0A 3CCVS 1IKYA 4JI4F 4DU7A 3U1NA 1SC6A 1KP6A 4YOEA 1NDLA 3QSIA 5GMKa 1PBUA 4OL8A 1TL3A 3V4IB 2UUCF 3WX8A 3V81A 4WKYA 2J0XA 2YWEA 4MAKA 2ZBPA 5KOXA 1AUDA 3K5LA 4OI6A 1U49A 1O0PA 2YH0A 2AEJA 1CQMA 4Y65A 4C0BA 1IBKF 1UEVA 2GVDA 3MECB 2YH1A 1H0HB 3RB4A 1VBXA 2ZBQA 3FEXB 4C8KA 1NK8A 3GJQB 4OX8A 5BXIA 1TK5A 1XMOJ 1UPPA 2MLYA 1N54B 1RABB 2F3JA 2F8MA 4FVCA 4YHHF 4FYYB 3LP0B 4WYWA 2ZFHA 1DY3A 2YKAA 3MEEB 2W9BA 4NLYA 4AD6A 5LMNJ 2N3OA 3IO1A 4QR1A 1ZTWA 2Y9HA 1RTIB 2GNKA 2YNHB 1ULRA 3M2VB 2CNNB 1CSJA 3DN9A 2I38A 3BB5A 2DY9A 3AB4B 3CJ2A 3D4JA 3EZUA 1HYSB 2BJ1A 3C19A 4IFVA 5KT6A 4M5NA 1RBOB 2HAFA 2XLIA 1WDDA 3L09A 1G4CA 1XMBA 3ZTOA 1PSDA 1GXLA 1WF1A 2B9XA 4O3OA 4RBUA 3UE2A 4DUZF 1LW0B 2ZD1A 1FEEA 1UETA 1SPBP 3PX0A 1WHYA 4DV7F 1UEUA 1SV5A 4JV5J 4H4KA 1F9FA 1G3OA 3AOCA 3NGKA 1N36F 3QJJA 5GAEI 4OYOA 2ZHOA 1S1VA 1RAEB 2AHOB 1RKIA 4F4WA 2E1PA 2EBGA 2CZ4A 1N34F 1RTJB 3FSYA 2UVRA 4DU8A 4NL5A 1FXRA 2RKIA 3CC4S 3ADAC 3KLGB 4ED5A 1F9HA 1U02A 3DLHA 5ETMA 3VHQA 4KPYA 4C0OC 4IRDA 1XNRJ 4DLGA 3TAMB 3A8JA 3R3TA 5JXSA 2LCWA 4WTOB 2OTLS 4QBUA 5KAKA 3GV8B 2XB2D 3OXLA 3MPWA 3R8YA 5K5MA 4PAAA 1U6BA 2J8AA 3V6JA 1S6QB 3DU6A 1FK9A 2ZJPQ 3K2YA 1LWCB 2A2CA 2BE9B 2PA3A 1CBKA 1QE1B 2A6OA 2ADBA 3U02A 4KSEB 1IKXB 3D54A 2KFNA 2BW7A 3ZC4A 5ETLA 2EBEA 2B8QA 4NZ0A 1WC4A 2MQ8A 1RP5A 4IRCA 4HACA 4CCHA 1QY7A 4KHRA 4WU2A 1HWIA 2YNFA 3BGOP 3GIKA 3AQPA 4N56A 3KUGA 2G2YA 3N79A 4ICLB 5LSOA 3GONA 2KTQA 4F36A 2KJWA 2VQFJ 1S49A 4A48A 2MB0B 2QMUB 2V4RA 2ZOMA 1MMLA 1FRKA 4C11A 2ABYA 2VODA 4M5KA 3CD5A 3EVWA 4Y28C 2MDAA 2DRAA 2BABA 3HD1A 2V8DA 5LMNF 1YBUA 2MJUA 3MTKA 4ED3A 1S10A 5LJ5Y 1DLOA 5K8OA 3OTBA 4M5DB 3EWGA 1M1HA 1YDLA 2ZH5A 3LWMA 4QIFA 4X4OA 1FWPA 3CCLS 4MKBA 2C28A 3M6VA 4CLYA 3JYTB 4LRCA 4F50A 3R5JB 2HS0A 3H5XA 1X5PA 4KO0A 3TJ8A 2W24A 2FLLA 2HEKA 4CNZA 2QSWA 2VJVA 4O3SA 3DI6B 3IM8A 4JV5F 3N4WA 3P3DA 2D69A 3LA0A 4AXJA 3Q8VA 1JLAB 3OVBA 2HRUA 1TV6A 2AJ2A 5F8GA 2DHSA 4M5LA 3RAQA 5G4DA 5H9EK 1HL6A 4OYMA 2O3DA 2GGPA 4UZBA 4N76A 3UDVA 2DGSA 3TRGA 1QSSA 1XTZA 2CG8A 3H2LA 5CCLA 5KFLA 2WVCA 4RUBA 2QSFA 1S5ZA 2KHDA 1R0AB 3K5PA 3VGTA 2YKQA 2XLJA 1RA7A 2ZUGA 5FDLA 2B51A 3DOLB 1R3NA 2CG4A 1VQ7S 1UKUA 5EDWA 3AXMA 3T1HJ 1U45A 2RU9A 5CHCB 3UWTA 3R5DA 3TJ9A 3T5HA 2ZC4A 3MPDA 1CULA 4U8VA 1FVSA 3MUMP 3QGIA 2PSZA 3UCZP 1GX5A 5M2PA 3KXDA 1M5PC 3VAHA 3M32B 5KFUA 4K0KJ 1FO1A 2OLWA 2WHOA 3GMGA 1YRTA 5DLFA 4ZJQA 1VQPS 1LEOA 1I3OB 2CJBA 2X7IA 2GMHA 3ENVA 1CVJA 2V50A 3Q83A 2ZH6A 2QGFB 2MKIA 5C25A 1L3VA 4AFFA 4LF4J 4ES2A 4CNYA 2X3GA 1Q8KA 3LTOA 3CNQP 3G96A 1S6PA 2WVDA 3CT9A 4L3NA 4P7VA 1K8AT 1KVIA 5HQ8A 1U1NA 3I0SA 2HHHJ 1HR0J 4TU9A 3HCXA 1S1TA 2VQFF 1L5UA 3H4DA 2BANB 2AJ4A 3ISZA 3DDIA 2J7KA 3TEGA 3KHHA 1RT7B 2OKQA 4NI2B 4Y6IA 4QJVA 4PXCA 2D3ZA 3V2UC 3RB3A 2C3YA 4DSJA 4NX9A 1WC5A 2YXLA 3BSAA 3HHLD 5KFQA 4LQ9A 3BBFA 4NZ6A 1N5YA 2K8GA 4DUTA 1EZZB 2VD3A 2QL5B 1MROA 4UUXA 1AZSB 3M30B 5DO2A 2XQCA 4K4XA 3Q8YA 1JKHB 2JEFA 1PILA 3VCDA 3M8PB 2QLWA 2YNGB 3G8QA 2KZZA 1U1MA 2CPHA 3J7A1 3DOKB 1RTHA 2X1BA 4YB7A 5IT9Y 4S0MA 2LYVA 1GNKA 2HFOA 3EM1A 2D9PA 2YWWA 4N47A 1BQNB 2LEBA 4RZRA 2EW9A 2VDIA 1VR6A 4F8RA 4NLRA 4IG0B 1RSCA 1SL2A 1IKYB 2GHVC 3UFCX 4WFBQ 3BZQA 2VA2A 5HATA 1GH8A 2RUSA 2GS8A 3R5AA 2RQCA 2DXFA 4WP3A 3K58A 1WDTA 3M8QA 4NLQA 3V81B 1A0OB 3G2XA 3NGDA 2V68A 2NREA 5F3TA 3M2UA 3JS9A 3BQ0A 3SSRA 2UUTA 2GVDB 4Z7CA 2IM1A 3IR5B 4KYZA 2R2RA 4IUFA 2BOAA 1TFWA 2R2TA 4YB1P 4OJ3A 1R8HA 2HLTA 4DPYA 4A8OA 2AYMA 4DSIA 4UZCA 3CCSS 4F4AA 3X1LB 2NSCA 2QLBB 2E29A 3T1HF 2W9BB 1U1LA 2XWYA 2WVBA 1EAYC 3R7NB 2WBRA 1DAXA 1SJRA 1WELA 3C14A 4LF1A 5DDQC 3GR1A 1S57A 3R5GA 4K0KF 4F04B 3UR0A 4LF9F 1NZ8A 2HSEB 1JLFA 2QLXA 4B3RF 4B3OA 5GMDA 4KIAA 2OEKA 2DIVA 4X4QA 3W2WB 1T03A 2XO6A 5KFIA 5CZVA 4LF4F 3R1HA 2HIYA 2ZD1B 4PR6A 4DPTA 2MQNA 2F7VA 2R7RA 2RMLA 2HBYB 2IRUA 1SV5B 2O66A 4HHJA 4DXLA 2W8LA 2J6TA 4QW8A 2HHHF 4KRWA 1H2VZ 2FZCB 5KG5A 1PJ7A 2UV8G 1PIEA 2ZBIA 2KG1A 5CA5A 2F4VJ 3I4HX 3WZ0A 1FDAA 1S1VB 1NEEA 2DR8A 4QYRA 3KK2A 1GK8A 3KYLA 2ALZA 2H3EB 1S1WA 1HWLA 3HHLA 3VWSA 5EX3A 2W2OP 2RS2A 1O8BA 2IAJB 4WXOA 1RQ0A 4U96A 1RT3A 1PC4A 1CC7A 5BYRA 3MI7X 2RKIB 3EZOA 5M2RA 3BQ2A 4FXVA 2DNPA 4Q7AA 4MYTA 5L1KA 2W9AA 1FF2A 3J7AN 3PFOA 3X3UA 1HLWA 3MMAA 1BC6A 4KFBA 2JH3A 3ZZUA 3GJTB 4EBEA 1TUWA 2RH3A 1YJWS 2F5GA 4AQYJ 2H9ZA 1RBLA 4RNFA 4XO0A 4J9MA 1SXLA 5A8WA 3PR4A 3LP1B 1YJ7A 1UWBB 5DDRC 2FLNA 3A3PB 1FHTA 4YB5A 1C0UB 1X9WA 2UUBJ 1BWVA 3NLCA 4P2MA 5IZHA 2AGPA 5KFOA 1WOSA 1NDKA 2M52A 4M8LA 3R6LB 2X1GA 1UJ5A 2VH7A 2VOPA 3IR6B 1DTQB 3C6TA 4DDFA 4PXDA 5L9XA 2LU2A 3U27A 1NH7A 3GFZA 3VQSA 1FNMA 2RUGA 1OMSA 3OJSA 2ZDPA 4XTTA 1QVGR 2HWIA 3OT9A 4CIOA 3H5YA 3I82A 3MEGA 3SDEB 3ZTSA 4JYAJ 2MJNA 1RAFB 3OR2A 3AA8A 1VBKA 3N28A 1RB0A 1VRUA 4QR2A 2WOMB 5D77A 1RT4B 2QA1A 2HVDA 2V4JB 3KDNA 1RTDA 2BEFA 1RAOA 3PW7A 2AWZA 1ZAVA 4QR0A 3Q8UA 3EGZA 1DFDA 4H4OA 2XC9A 1DLOB 3GU0A 5J1EB 2E9ZA 4CTAA 1BWEA 4DCJB 3W5ZA 3DRXA 4FF3A 1R43A 4I56A 2RE1A 4RW7B 2HYIB 5ADZA 5B09A 3G86A 3CCQS 2JLFA 2W2NP 3D7SB 4FYWB 4NXMF 1GMWD 5HLFB 1VJQA 3HM9A 4P75A 2BW2A 3RBZA 1NB7A 3LH2S 1XIQA 2UUWA 1AB8A 4GC7A 2A10A 1V3ZA 4ELVA 1ZPVA 5KFPA 1QSYA 3R5CA 2HGNA 1NZAA 3KK3A 3QGHA 1SH0A 4JI6J 1X5SA 2VKRA 2R7QA 3LGNA 3LF0A 4URSA 2I8EA 2ASYA 3TAQA 2UVUA 1OO0B 3NNCA 3T5JA 4G3IA 4K4ZA 2BQUA 3AD8C 5HL7Q 4NASA 5ETTA 2IIHA 2E7VA 3NS6A 4CH1A 1FXLA 3ZTRA 3JTPA 5KG3A 1J5EJ 3PIOQ 1CULB 3DDNA 1NKCA 4AQYF 2DH9A 4PQAA 4ZHRA 4ZDNA 4K2XA 1A6LA 4Y2AA 3OJUA 4A47A 3MM6B 3GIJA 3QLHB 2HS3A 4DFJA 2VFSA 3GYNA 1WTFA 3QAUA 1MG7A 2FJDB 4F0KA 4DUYF 4A4JA 2GV1A 3F44A 5C25B 1TAUA 5I3UA 5JUMA 4I4BA 4IOBA 2AP6A 4I69A 1LQ9A 2JEGA 1ZS6A 5KTQA 1SUQB 3CMES 3KLHA 5ETVA 5AXMA 1TKTB 4K4YA 1U25A 1U6ZA 4ANEA 1Q4RA 1S7HA 1UWAA 5EWFA 2Z8QA 5E2QA 3VGSA 4U6PA 5HBMA 5A8KA 3SSQA 4JYAF 3WQPA 3W5XA 4U7UK 1V5VA 4TXSA 1VQ8S 3CB4A 1CLFA 2CJAA 2G1HA 1CC8A 1BE4A 1UAWA 4G1PA 4F0MA 2EK1A 2DNQA 1ZOTA 3GPAA 5GADU 2Y1JA 2OMLA 1RTHB 3W66A 2WK4A 2DHGA 3CIZA 4PYDA 2YBVA 3KG0A 2KYXA 3D67A 1N56A 2J76E 1R8AA 4LFCJ 1GMWA 4JUZA 1T95A 3M1VA 3I96A 4M5HA 5ETOA 2PN6A 4IFYA 3T1YF 2IYIA 1RAJA 3VZHA 4TQRA 1H6KX 3MUTP 1YJRA 2ZOGA 4NLPA 3M8QB 2CWKA 4NEZA 4USJC 1NKBA 2KVQE 3CJSA 4V19X 3PJ9A 2CQBA 4K5RA 4P74A 5KT4A 3BDEA 1P9QC 2ZNZA 1SJFA 3TZZA 5MLCV 4YUDA 1Q86T 4OHVA 3EYZA 2UUAJ 5LSRA 4X4VA 5H1SV 2GAGC 3MR6A 2DO4A 1HKAA 3KJQB 4JI3J 2B43A 1Y5IB 2P6TA 4D3GA 4TLQA 8RUCA 3JSYA 3A3OB 3MFHA 3VV2B 4GC6A 4PWUA 4MIWA 4KC5A 2OO4A 4WK3A 3A13A 1FJ7A 2A1BA 2BXJA 4WJBA 3OVAA 4LBPA 3QGPA 1RUSA 3T5KA 4PEOA 2WSEC 3D0GE 2QA2A 1C0TB 2DGXA 2G4BA 3EMTA 2V8GA 1RWUA 1R6VA 3QO9A 3UDCA 4NLVA 1I5OB 1CJKB 4WWSA 4PWDB 2C2OB 3RU0A 2CQ0A 4YFUA 1TL7A 1S1XB 3D3BJ 3GG1A 4B3OB 4IRKA 5IWAJ 3SI8A 1U2FA 1Z4UA 3MWBA 3QIPB 2KU7A 3C8YA 4ED1A 1DQAA 1T03B 3HJFA 3GFYA 4ED7A 3UPFA 3BKUA 3FRYA 2MHNA 3DYAB 2B4PA 1RAGB 2LFVA 3DGPA 3AB2B 4O44A 4DV0J 3Q8RB 4F02A 1HW8A 1OY6A 2P8IA 4ZOSA 1NJXA 4ECWA 1WSRA 3OHAA 1IXKA 3KK2B 3B82A 1LFPA 1S77D 3GILA 1IBCB 4K4VA 3SV3A 2A3JA 1F5CA 1XJWB 2VFUA 2EI5A 1TELA 4RWXA 3JQMA 4JI7J 2OPRA 4X64F 1U09A 5KG7A 1KKHA 5AXNA 2W8KA 1N0UA 1B0VA 4DPXA 3HX9A 4IR1A 5LT5A 2G0CA 1VHIA 3FBEA 2DISA 4DQSA 1IWGA 3PW5A 2D7SA 2NUUG 4OHZA 2KRRA 4LFCF 5HVFA 1SH2A 5A8WB 1SKWA 1WUUA 1NSKL 1NHKL 2WRMA 4Q8EA 2MY8A 2HWHA 4QIWD 1KNZA 4UW2A 3ET6A 1EX8A 5T7LA 4YR2A 2RQ4A 2AYBA 3T9NA 2JC1A 1IKVA 2KT5A 2N3LA 1S48A 1NUEA 1T9YA 2HZCA 3Q0AA 3R1LA 4B9UA 3WC0A 3FDSA 1Q82T 4N77A 4USIA 3KUEA 1HMVB 2N4DA 3SBMA 4P7TA 5H9FJ 3NMRA 2IBOA 2X1FA 5C42B 1D8YA 2P5VA 3VQTA 3J7Z5 8AT1B 3BGUA 4F25A 2UUAF 3MAQA 3ZNJ1 1UVLA 3MMBB 5ETRA 2G1DA 3KK1A 2ROGA 2RSQA 4U67Q 3M9OB 1HNWJ 1U1OA 3HSJA 5T14A 3ILIA 1S72S 1HQUA 3WIVA 2HHUA 3OR2B 1ZPWX 4BDPA 4J9VA 1WNEA 2Q66A 4H4MA 2AGOA 1WC0A 2HPUA 4TY8B 3ELHA 3I0RA 3H20A 2ZBCA 3LW5C 3MHYA 1RTDB 4HDHA 1FDDA 3IWLA 1JLGB 4KAIA 4U7UD 2DRBA 3CJRA 4F67A 3J7ZT 3AHPA 4NCBA 2MZJA 1B64A 1IBMJ 3V6DA 3N6NA 3G6ES 3ETMA 4ZPDA 2LEPA 5D15A 2POKA 4DFMA 1SIZA 3NNHA 2QG9B 3FSXA 2AZ3A 2YY3A 3NMAA 4UOFA 3BKTA 4JI0J 4OHYA 1H38A 4JI5F 4RW6B 1RYSA 1YWXA 1C4CA 1WKKA 2V5HG 2GO8A 4RU2A 1Q16B 1NHVA 3BR9A 1XQIA 2GIFA 4WIIA 4ECSA 1RHKB 1Q8BA 4C3LA 4DV0F 2KDOA 1N8RT 3MEKA 5IQ6A 1PJ5A 2XGPA 5DETA 3AA9A 1M5HA 1BQMA 1SVDA 2HLUA 3B4DA 2MQLA 2Y3YA 3LANA 1Z1ZA 3VAIA 4FF2A 4GO7X 3H7HB 4J9PA 4NA1A 4DR6F 3BYRA 3BSOA 4P6QA 4CM2A 2HG4A 2DNZA 4M95A 3GCXP 2JL9A 4DV2F 2AJ1A 1RADB 4OYIA 3OTCA 2VG5A 2BQRA 2VC0A 2R2UA 4ECZA 2I0XA 2HQGA 5D8HB 3TEHB 2MGZB 4DR3F 2AYGA 2HQCA 2AEMA 3IP0A 2P9GA 1LOUA 3UD5A 3SQGA 2PMHA 3DCAA 2XHWA 4OZNA 3GB0A 4MKAA 2EKNA 5K8NA 1VMBA 4RUHA 3FFIB 4ECUA 1NDCA 1MWQA 2IVFB 1S9GB 2GCFA 4IH5A 5LMUJ 1D1UA 2FGCA 5IOLA 3C16A 4IDKA 5A2QY 2DBBA 4N5SA 2HURA 2LQBA 2OAUA 3JB9k 2C2RA 5J2MB 1JWWA 5KFVA 4CO5A 4KE5A 1IR1A 3TANA 2HFSA 1NO8A 4I6AA 2VBWA 1ITPA 2ASJA 3DMJB 2VFVA 3RRKA 2EVZA 3WBZA 3UCGA 3WX4A 3AD7C 4IH7A 4O3PA 4DV3F 2LA4A 4FP9A 4QCLA 1C1BA 5BR8F 4B02A 1D8ZA 5AE2A 3OXGA 2R4FA 1IKWA 5AE1A 2Q6BA 2CKWA 2K06A 3P8BB 2IM2A 1W2IA 2FJAB 1WI6A 2LQ5A 3OW2R 3D1OA 4J9OA 2R7TA 5I42B 1C1CA 4CM0A 5A0YA 1H98A 1IBMF 3VGUA 4WK1A 3FVYA 5E3AA
chains in the Genus database with same CATH topology
4FNHA 4Z37A 4OQJA 1QY7A 4KHRA 3US5A 4WU2A 1HWIA 2YNFA 4ZLPA 4I7FA 4Y2IA 3GIKA 3AQPA 3CCRS 3RR8A 1HBUB 4N56A 1TVRB 1MSWD 4ECQA 3H40A 3N79A 4ICLB 5LSOA 5IM0A 3N01A 2UVVA 5HMYA 4EUVA 3BSNA 2KTQA 4PPDA 1JLEA 2J6UA 1Q8IA 4ERDA 2KJWA 2W4PA 1S49A 4YR0A 3DI6A 4A48A 1Z2LA 2MB0B 2JWNA 3HK2A 5FIIA 1LK5A 1FCAA 2DTJA 3M1VB 1EP4B 4ZKAA 2HHXA 2V4RA 4C7QA 2V4QA 2ZOMA 1MMLA 2JC0A 2N7YA 2ZC3A 1FRKA 4EZ9A 1I1GA 4IDKB 2GIQA 4C11A 1M5OC 2ABYA 2KH9A 3DRPB 1KEKA 4MK9A 4IFYB 4DS4A 4XAKA 2QRRA 4FYDA 4WFAQ 4WE1B 2GMLA 1X4FA 2VODA 5HP1A 3OXFA 2MKHA 2UXBF 4EGLA 3CD5A 3BGFA 2FB0A 4IR9A 4J37A 3IAM9 1IJFB 2YWKA 4XK8C 3T3FA 2N4CA 4LJMA 2BV3A 4Y28C 3H4BA 1X4DA 2MDAA 1YHQS 1FE4A 2DGUA 5F8LA 3TI0A 2EFNA 1LW2B 1JLQA 2XO7A 1WHXA 2GMJA 2BRLA 4QIGA 4A46A 2DRAA 3CD6S 2BABA 3L3CA 2HHVA 1YITS 4RBVA 3Q24A 2V8DA 4ETZA 5LMNF 4AUKA 4EFAC 2W4CA 1FK9B 7FDRA 5D4LA 2H5EA 2K3KA 3HPOA 1Y3KA 4LFBF 2R8IA 2K3IA 2MJUA 1VQ6S 1LKZA 1HHSA 2D1CA 3MTKA 4I1TA 3K59A 2XNRA 2YKPA 1HNXF 1FNOA 2XULA 4ED3A 1BY9A 3VAJA 3DOLA 1S10A 1KONA 1C1BB 1RI7A 2CPIA 5LJ5Y 1DLOA 5K8OA 1K1QA 3OTBA 4C9DA 4M5DB 4C0HA 1Q53A 1NK9A 3CIMA 2QZ8A 4HLBA 3BGLA 2ZH5A 1UVMA 3LWMA 3NBPB 4QIFA 3ZZPA 3O6QA 4MIAA 4RW9B 4X4OA 3ISNC 4NLGA 4OZLA 3RBDA 2BZ2A 4EEYA 1LWEA 4HT5A 2KKHA 2QYCA 3E01A 5E0OA 1I6JA 3CCLS 1N0VC 4MKBA 2C28A 2K1RA 3M6VA 1C1CB 3HVWA 1UVIA 1H2UX 3M32A 2LLZA 2YNIA 5E5NA 4C8MA 5A0YB 3JYTB 1HBNA 1Q81T 4Q43A 1AXQA 1DQ9A 4F50A 4C3MA 2VG7A 4IG3A 1E6VB 4EWTA 3KHGA 2ZH4A 2FUG9 1VQMS 2HS0A 4JV1A 3H5XA 2YNFB 2L41A 3L7PA 4I7FB 3HT3A 1X5PA 4KO0A 4ZPVR 2W24A 3KJVA 2CJ9A 3M9MB 4A8YA 2FLLA 1NJWA 4CNZA 2QSWA 3CMAS 2MZSA 3QO9B 1JLEB 4I64A 4NYOA 5B08A 4O3SA 3RYLA 3ICLA 3DI6B 2VZ9A 5DM6Q 3RRHA 3MEDA 3O5TB 3OFFA 4C2MA 4JV5F 2XGQA 3BN7A 1OSDA 1HI8A 3N4WA 5DDPC 1XK8A 2XS2A 4JOUA 1VI7A 3P3DA 2GW8A 3IRXA 3Q22A 3ITHA 1OQ3A 3M05A 4AXJA 1FRJA 4A8WA 1NRKA 1R7IA 4IKAA 3IGVA 1VGYA 4C11B 1JLAB 2VONA 2FHKA 1IUJA 1XEZA 2W4DA 3OVBA 5DG8A 4I2QA 2HRUA 1H7XA 3OL7A 5L1LA 2LMIA 1TV6A 2XMKA 1BD6A 1VFJA 3RB6A 5F8GA 2DHSA 4DR2F 3RAQA 5BYSA 3ONQA 1IR0A 4H4KC 5G4DA 1HL6A 4X4UA 2O3DA 2ROEA 2GGPA 3MM5A 2QFJA 3PY8A 4UQTA 3BJYA 4WFYA 2G9OA 2DB1A 2BOPA 4URQU 2SXLA 2AV5A 3IS9A 2BE2A 3I31A 3D1HA 5IT4A 3RW7A 2R8GA 3I32A 4N76A 2B5JB 2BJEA 4UOCA 3SFGA 3VTIA 2DGSA 3TRGA 5L39A 4G1QA 1QSSA 1XTZA 3G71S 2E1MC 3EZ5A 1GXTA 3H2LA 5CCLA 5KFLA 1SQEA 3HMJG 4Q5VA 2QSFA 3FGVA 1P27B 4KKOA 4DFKA 5HI7A 3N6MA 2KHDA 4ZPTR 3K5PA 5LMUF 1R0AB 3FJ2A 3O3LA 2A2DA 1RT7A 1KHVA 2YKQA 5KG6A 2XLJA 4ZP6A 3C3LA 1RA7A 2ZUGA 3PJWA 1GXUA 2B51A 5FDLA 5L9NA 3DOLB 1R3NA 2CG4A 3NS5A 3PNIA 1VQ7S 4X4TA 1FTCA 2BM0A 1UKUA 5GAGU 3JAMY 5J1PA 5EDWA 2W7PA 4NLDA 3D1QA 3T5LA 1U45A 1B0TA 1T3OA 2RU9A 5CHCB 3NKYA 3HO1A 3U1LA 2Z0GA 3R5DA 3UWTA 2RB7A 2YX7A 2FLPA 3T5HA 1RT6B 2DGOA 1LWEB 4RUCA 2ZC4A 5E3AA 3DLEA 5HO4A 5B0GA 1FVSA 3MUMP 1KQSR 5KFDA 3KHRA 3QGIA 2PSZA 1X4GA 1L3UA 3UCZP 4NLXA 1GX5A 2K1RB 4YMEA 5M2PA 5GAGI 3M30A 2A18A 4IOCQ 1M5PC 2P9CA 3J80Y 1KOHA 3VAHA 3M32B 5KFUA 2YNIB 2KFZA 1HBNB 4HL9A 5K14A 2VFTA 3NCRA 1I94F 2VG7B 4DL0C 3SEOA 1VJWA 2QMWA 2FVCA 1TP7A 3M8PA 5F8HA 2DPJA 4DOZA 1FO1A 2OLWA 2WHOA 4DF8A 1VC6A 2YNGA 3GMGA 1YRTA 4FZVA 4KO0B 4MFBA 5DLFA 1S4FA 2HS4A 4ZS6A 4IH6A 1VQPS 1JMTA 2CJBA 5DG7A 2GQCA 3HLUA 3DOKA 2WCXA 2GMHA 2XMVA 5DGBA 1WEZA 1G1XA 3ENVA 1CVJA 1EETA 2GQQA 4LVNP 1QLNA 1FKOA 1H3DA 3CCJS 2ZH6A 2MKIA 1S79A 4DN0A 5EWEA 2IMWP 2L9NA 5C25A 4N8NA 3IRXB 3KLIA 1L3VA 1MMDA 4AFFA 3FRZA 5KFBA 4PPZA 1YSJA 4ES2A 2ZM6F 4LT6A 4CNYA 2AW0A 2X3GA 4ZP9A 2F4VF 2C22A 4EYHB 1BGXT 1TV6B 2VG6A 1NJYA 2HHQA 1UP1A 1OWXA 2Y1RI 3G96A 4HH0A 1S6PA 4LVOP 3K5NA 4L3NA 3CT9A 4P7VA 3CJ4A 4EO6A 3OLBA 1K8AT 1KVIA 2GGPB 5HQ8A 2RS8A 5GVQA 4M94A 2ZNYA 4DF4A 1U1NA 3I0SA 2FIUA 1Z2ZA 2ILYA 4WTYA 4TU9A 3RTVA 5E33A 4ED0A 1S1TA 2FC9A 3G9CA 3UD3P 5LJ3Y 4QYZJ 1FDBA 1NKEA 5CZXA 1IBLF 3TAPA 4G1QB 2VQFF 2KT3A 1RGVA 1L5UA 3H4DA 1L3KA 2BANB 3QJLA 3JSMA 1SBRA 4Z2XA 4C8NA 2AJ4A 2C3OA 3ISZA 2J7KA 3NG8A 1SH3A 2B4OA 1WWHA 1TUVA 1O51A 4BHQA 3TVYA 3TUZC 3GIIA 1CG2A 4CT9A 3KHHA 5DQGA 1RT7B 4DFJA 4ILRA 3VAFA 3HKWA 5FDLB 2IYGA 2OKQA 4Y6IA 4QJVA 4PXCA 2D3ZA 3V2UC 4B08A 3RB3A 2C3YA 4DSJA 2CQGA 4NX9A 3PKYA 3GQCA 3MD1A 3D0IE 4BWJA 2ILZA 4A8MP 1DRZA 2AJ0A 2M70A 2EC0A 5F8NA 4I6WA 3BSAA 3HHLD 4O23A 5KFQA 1ELOA 2VV5A 4LQ9A 2WAQD 2K8GA 3O8WA 4NZ6A 4BWMA 1N5YA 2ZH8A 4OJ1A 1UA0A 2E9RX 5A6PA 2UVWA 2VD3A 4O0IA 2FLOA 3DLEB 5F9LA 1R8BA 4DV4F 3MR5A 5L8RC 1MROA 3PDNA 4NA3A 4J9QA 3H5UA 4F4XA 1X4HA 4FF1A 1KRPA 1AFIA 3OSNA 4UUXA 2L9WA 4CO1A 3M30B 1KLNA 2UP1A 5DO2A 5KFJA 1S6OA 4NLSA 1FXDA 4K4XA 3W3SA 1N6QA 1JKHB 2NXUA 5LL6d 4LF6F 2JEFA 2GX8A 1PILA 1TAQA 2PE8A 3DLJA 3VCDA 3V5RA 2U2FA 2HVHA 1VRTB 1IN0A 3EXCX 3M8PB 1FRMA 2DGVA 2D41A 2QLWA 4B3TF 2YNGB 2AX0A 3G8QA 1X5OA 3PEJA 2KZZA 4CO4A 4QWDA 2OJ3A 1U1MA 2CPHA 1T02A 5KFXA 3J7A1 2LDIA 1RTHA 2X1BA 3DOKB 2WSFC 4YB7A 2MQPA 5IT9Y 2VFRA 2LYVA 5B0BA 1GNKA 5J2QA 1ZETA 2HFOA 1EETB 2B4UA 1U1PA 3LUYA 3LAMA 2BJDA 2E1CA 1HQUB 1Q7LB 2D9PA 4N47A 1N5VA 5DQIA 4KT0C 2PFFB 1BQNB 3HXMA 3MR3A 1UVNA 4DX8H 2W7OA 2LEBA 1L3TA 4RZRA 2EW9A 1E6YA 2FGOA 3AH6A 2FJWA 4IQMA 3KLIB 1BQXA 2CQHA 2YQ3A 1VC0A 3BREA 1W2BR 4DQIA 3MURP 4DHVA 1MWYA 2UUBF 2DIUA 4F8RA 1SJ1A 4NLRA 2W25A 4HDGA 4WFNQ 3KLFB 5F0UA 3BSCA 1VQ5S 4IG0B 4OX9F 1SL2A 4X66F 2ZJRQ 1IKYB 2VG6B 2GHVC 2D74B 1S6PB 3UFCX 4WFBQ 3FZBA 2FY1A 1OIAA 3BZQA 2V8VA 3R27A 3W2VA 1S0MA 2VA2A 2X1AA 4QPTA 5D3GA 1GH8A 2O01C 3I0SB 4P2SA 1O5JA 2MY7A 1VK8A 3I6PA 3UR3C 3KOAA 5KFSA 2DR5A 3D0HE 1S1TB 1M5KC 3THVA 3LP2B 1X9MA 3R5AA 4L6V3 2RQCA 3K58A 2DGWA 3W2WA 3M8QA 1LXJA 4NLQA 2CQ2A 1DZ5A 3V81B 2WONA 4A8KA 3MM8A 2ZH9A 1FTRA 2JJ4D 3NGDA 2R7WA 4NLOA 2GHPA 2CJQA 2COLA 4NLUA 2NREA 5E7OB 2BA9A 4DR1F 5F3TA 4FN5A 2V2KA 2NZ4A 3M2UA 3BO4A 4ZVGA 1TKDA 3BQ0A 2LVWA 3SSRA 1WEXA 4R5PB 1N5YB 3P6YC 2UUTA 2KO1A 3GSDA 1YJNS 1FERA 3PXGa 3CUNA 1U1QA 3DRSA 3NP5A 2M88A 4DS5A 2IM1A 3IR5B 4LSNA 1XMQF 5KFHA 2MHEA 2R2RA 1MROB 2MMYA 3OFGA 3KLVA 4IUFA 1TFWA 3EGNA 2DNMA 3CDBA 2R2TA 4I67A 2JHEA 4X62F 4YB1P 4OJ3A 1R8HA 2HLTA 2DNNA 3CJ5A 4NMLA 1WHVA 4A8OA 5F9NA 2AYMA 1UA1A 1M5SA 3NCPA 5DDOC 4DSIA 5E3PA 1VQOS 3CCSS 3L95X 1YIJS 2OFHX 4Q2MA 3QPIA 2V9WA 3X1LB 2B0GA 2NSCA 1YJVA 3S7RA 3V4MA 1GTHA 3VAKA 2E29A 3F41A 3OSPA 1U8SA 1Y5LB 4AL7A 4Q2LA 2RD5C 4DLEA 4KR0B 2DNRA 4K59A 2DT9A 3SCIE 5IQQA 3T1HF 2W9BB 5J2QB 2HFZA 2IAJA 1U1LA 1Q7YT 1YG0A 2HWTA 2XWYA 2IA6A 3DLKA 1F5BA 3LO3A 3G6XA 2OPQB 1QM9A 4JV0A 1E6YB 2FHOB 4WFXA 3TA0A 4KQZA 2GA7A 1T05B 2B6AA 2U1AA 2WBRA 1U4BA 4W90B 5CD4H 4ZCLA 1DAXA 1M5VC 3ZZTA 5FJ4A 3EPIA 2ASDA 1SJRA 1WELA 4ECXA 4DL6A 2D3OR 4J9RA 1HI0P 5J2NA 5DDQC 3GR1A 2E5JA 1RT1A 2Q1LA 3MD3A 4X4RA 4TLRA 4ZPBA 2VUGA 3SYZA 5KFMA 2AGQA 2RJZA 4K0KF 2D9OA 2CPFA 3UR0A 4LF9F 3POTA 4NCAA 1JLFA 2QLXA 3TX8A 2F8EX 4HKQA 1JJHA 1OQ6A 4B3RF 2YWFA 4B3OA 2PI5A 4C8OA 1ZM2A 2R8HA 4GO5X 3PZPA 1TKZA 2EWHA 4YQWA 1F0XA 4Q8FA 1D3WA 3QGGA 4KIAA 3PKMA 2DIVA 2NPIA 2AX1A 2CVIA 3O1LA 4X4QA 3W2WB 3UI3A 2ZITA 2R7SA 2XY7A 4OFZA 3TR5A 4Q0BA 2WBMA 5L1JA 1T03A 5EWGA 4V19J 3C2PA 5KFIA 2E66A 2WONB 3FMBA 2NR0A 5CZVA