3Q2SC

Crystal structure of cfim68 rrm/cfim25 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPVNKQFLSQFEMQSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
publication title Crystal Structure of a Human Cleavage Factor CFI(m)25/CFI(m)68/RNA Complex Provides an Insight into Poly(A) Site Recognition and RNA Looping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 17
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3q2sC00
3NNAA 1W2BR 3S6EA 2OSRA 1SJ4P 5LXRA 2MGZB 3VAJA 2FY1A 2RU3A 2KG0A 1X4AA 2L41A 2MQPA 3V4MA 2DB1A 1FO1A 1OO0B 2DNGA 2LQ5A 1SJ3P 1WI6A 3TP2A 1JJHA 1BY9A 3CC4S 2B0GA 5CA5A 2UP1A 2DO4A 3SMZA 1U6FA 2AYMA 2DGSA 2LCWA 2E5GA 3U1MA 1VQNS 1L3KA 2DH7A 4C4WA 4W90B 1WHYA 3Q2TC 3NNCA 2RRBA 2U2FA 1DZ5A 2DH8A 2CQPA 2DIUA 4WFNQ 2XS7A 2KH9A 1HL6A 3G71S 2MXYA 4WIIA 3JB9k 1NJIT 1VQLS 1WHVA 1UFWA 2FPHX 3G8TA 2MZJA 4CH0S 2M0GB 2DISA 2HGLA 1M5VC 4TLQA 5CYJA 1D8ZA 1U1RA 2CPYA 4QPTA 1RK8A 2VOOA 3MD1A 2DNHA 2I2YA 3PIPQ 5IM0B 1UW4A 2DGOA 2DHSA 2EK1A 5D77A 2X1FA 2DNKA 2ERRA 2MZQA 1VQMS 4IOAQ 2RS8A 4PR6A 5GADU 5LXYA 1FXLA 1SJFA 2DNOA 1X5TA 1H2UX 2AYBA 1YJWS 2OJ3A 2OTLS 3R1LA 4V19X 4LIRA 3H2UB 2HYIB 2RQCA 1U2FA 3P3DA 1NU4A 2DITA 2CQIA 2KM8C 2KM8B 3CF5Q 3P5TL 1U6BA 1UP1A 2XNRA 1VQ9S 2EK6A 2N82B 2KXHA 2AYEA 2MQQA 1NO8A 1VQOS 3ZZZA 4M5DB 4RU2A 2LA4A 2M88A 1M5OC 2D9PA 1JMTA 3UD4P 1S79A 4FXWA 2J0QD 4U67Q 3FEYB 3IWNC 3B4DA 5D78A 2CPEA 4F26A 1FJEB 1R8PA 2M52A 3K0JA 2NLWA 3VAKA 5H1SV 1VQ4S 1WTBA 1X4GA 2MY8A 1SJQA 2G1DA 2RVJA 2JVOA 1VBYA 3CC2S 1JJ2R 4C7QA 2CQCA 5IQQA 3NS5A 1KQSR 2MKSA 4ZKAA 2I38A 2M70A 2YWKA 1YITS 3EX7B 2J8AA 2DHAA 5HL7Q 1VQ5S 4Y00A 1WEYA 1VC5A 2CPHA 4CQ1A 3SDEB 2MSTA 4W92B 2DNMA 5LJ3Y 1U1QA 4YUDA 2DNNA 1CVJA 2N3LA 2MY7A 2LA6A 2XB2D 2CPZA 2MB0B 1N88A 2KRRA 1WF1A 3CCRS 3CCSS 1VQKS 2RS2A 2LYVA 1WHXA 4P6QA 2DGWA 3MI7X 2N3OA 1A7GE 2ZJPQ 4UY8T 5MLCV 1HD0A 1P27B 4IOCQ 2MYFA 5IFMA 3G96A 1UAWA 3PIOQ 1QVFR 2DO0A 2N7CA 2OSQA 4QQBA 1YHQS 4J5OA 1N52B 3DLLQ 3CPWR 4LMZA 2OTJS 2XS2A 4WFAQ 3MURP 2M8HA 2MPUA 1URNA 5DDOC 2MSSA 1VQ8S 3U1LA 2G4BA 2CQGA 1D9AA 2CQ4A 2KG1A 1FNXH 2KHCA 3VAMA 3NS6A 2CJKA 2MKKA 3DXBA 1PGZA 3I55S 5CXTA 1VBZA 2DK2A 2XS5A 3MDFA 2HZCA 3P6YC 1R8HA 2PEHA 2Q79A 1FT8A 1O0PA 4F25A 1H2TZ 3MUVP 1P1TA 1WELA 2FHOB 2XSFA 1WWHA 2JVRA 3US5A 4QU6A 4C0OC 1YJ9S 2CPIA 1WG1A 2DHGA 1WF2A 2X1BA 5GAGU 2QA4S 2A3JA 2HGMA 2D3OR 3VALA 4WFBQ 3THPA 4CH1A 5DETA 1WEXA 2RQ4A 2YH0A 3MD3A 2QFJA 1Q7YT 4CIOA 1A9NB 3G8SA 3UD3P 2M4MA 3D2WA 3HI9A 3LPYA 1M5KC 3CCES 4YOEA 2FC8A 2MGZA 5GMKa 2CQ0A 1Q82T 2JRSA 1X4DA 2DNYA 2KFYA 2LMIA 3N9UC 2KXNB 2RRAA 2F9JA 2EVZA 2JWNA 2MMYA 4Z2XA 5GVQA 1FJ7A 1OWXA 3H2VE 3UCUP 3I56S 2DGTA 2RNEA 2MKIA 1N8RT 2CQHA 4ED5A 2VODA 2KT5A 3BO3A 2MHNA 2DIVA 1FHTA 3R27A 2RUGA 2J76E 2X1GA 2BOPA 2E5JA 2CQBA 1WG5A 4FXVA 3CC7S 1G2EA 2CPXA 4WCEQ 2CQ3A 2DNLA 5LSOA 2K3KA 1VBXA 2GO9A 1PO6A 2MKJA 1IQTA 5DDPC 3CCMS 5BJRA 2MQMA 2DGXA 3UCGA 1ZZFA 2YKAA 2K8GA 2KYXA 2LEAA 5IM0A 3VAIA 4F02A 1DRZA 1WI8A 3BO2A 2RT3A 1WF0A 2ZJRQ 5DM7Q 2DGQA 5LSLA 2J0SD 3J7YU 2L08A 2LXIA 2MKCA 1X4FA 1H6KX 1OIAA 1YIJS 2AD9A 2CQ2A 5ITHA 1VQ6S 1YI2S 1VC0A 2DNRA 2YTCA 2ADBA 2X1AA 4IUFA 1X4BA 3LQVA 3NNHA 3FEXB 3L3CA 1U1NA 2G0CA 4YB1P 3VAFA 2CPJA 3VAGA 2MZSA 3CUNA 1KOOA 4IO9Q 2CPFA 3UWTA 3J7ZT 1M90T 1M1KT 3EGZA 1QM9A 1YWXA 2F3JA 5GAEU 3G4SS 1DHMA 2KXFA 3CCUS 4EGLA 5GAHU 2M8DB 1AUDA 1K8AT 5EN1A 3BO4A 2M9KA 1X5OA 2E5IA 2O3DA 1F9FA 1Q86T 2KN4A 5JVHQ 4PRFA 1X4CA 2XNQA 3TYTA 1H2VZ 2PE8A 3G9CA 2M2BA 1YTYA 3CXCR 3EGNA 2LEBA 4Y0FA 3THTA 2MJNA 5DM6Q 2DH9A 4TU7A 1ZZNA 1KC8T 1WHWA 2OIHA 2YH1A 2DNQA 2ADCA 1X5PA 3ZZYA 2CPDA 1KD1T 2LECA 1XN9A 2BZ2A 3VF0B 2NZ4A 2MZRA 3NMRA 1KOHA 1X5SA 3SDEA 1ZH5A 1HD1A 3BS9A 2DNPA 3TO8A 4ERDA 4OZ0A 1HA1A 3IRWP 2KU7A 2LXUA 3RW7A 3CD6S 3S7RA 3S8SA 2DNZA 2KI2A 5JVGQ 2VONA 1YJNS 1WG4A 1QVGR 3HHNB 4A8XA 2AYGA 4LJMA 2V94A 2E5HA 2MQLA 1U1LA 4TU9A 2SXLA 2MQOA 2MJUA 1SJRA 1OPIA 2CQ1A 2VOPA 2MZ1A 1K73T 4PKDB 5HO4A 3ULHA 2KVIA 1M5PC 4WF9Q 3CCJS 3RW6A 5DDQC 3VAHA 1B7FA 1S72S 2JX2A 5LJ5Y 3MOJB 2FC9A 3CCVS 1U1KA 1U1PA 1FJCA 1VQPS 2DHXA 1U1OA 3MUTP 3S01A 1X4EA 1SXLA 2KRBA 5DDRC 3CMAS 2HVZA 2HGNA 1JJ4A 1U1MA 2GHPA 1N54B 3OW2R 2DGUA 2L9WA 3R1HA 1RKJA 1Q81T 2D9OA 1X0FA 3CCQS 4TU8A 2QEXS 3CCLS 2CQDA 4WKRA 1WEZA 2E44A 4QU7A 2MZTA 3SXLA 4BS2A 2M7SA 2LKZA 2WBRA 3B4MA 3CULA 2U1AA 1VC6A 1K9MT 3BEGB 3UCZP 4UQTA 2DGVA 1DBDA 5FJ4A 3Q2SC 3CTRA 3UE2A 2MKHA 1VQ7S 4OZ1A 3G6ES 1X4HA 2ZJQQ 2MQNA 3P49B 3MUMP 3CMES 3MXHP 2F9DA
chains in the Genus database with same CATH superfamily
3NNAA 3DYAB 3UNGC 2ZVIA 4OZJA 3DDKA 4ICLB 4ZHRA 2QX0A 4NXMJ 4K4YA 1JJHA 2CDQA 2VG7A 1RT4B 2W9CB 1LWFB 3NCPA 4U7UD 4A8OA 3MOZA 1S49A 1HNIB 1R8BA 2JNJA 3Q2TC 5J1NA 3MFHA 3M6VA 4ZVHA 2KH9A 2YXLA 4HVZA 5F3TA 1MSWD 2FLNA 4EO6A 3WIVA 4DZ6A 2X1FA 3UO0A 4ZJLA 1NKCA 4EZ9A 2EFQA 3IG1A 1UVNA 4X4QA 4CWBA 1S0MA 5GAHI 3I32A 4OYIA 1SL2A 3RGIA 2O66A 1O6XA 4ED3A 2C22A 2MEWA 3IWXA 4FF1A 3P5TL 4K4TA 2MQQA 3KLEB 4YR2A 2OELA 1QAIA 4PXCA 2HBRB 3FEYB 3OV7A 2LXFA 1FJEB 2KDOA 1ZM9A 4LVOP 2LQ9A 2RF2A 2CJAA 4DFMA 1NRKA 3I0RA 3IAS9 3MM8A 4OYXA 2MLZA 4TYBA 4MK7A 2C3PA 4MTPA 3W61A 4OHYA 2RS2A 2OPQB 1WSRA 2ZJPQ 5HVGA 1Q16B 2Z2LA 4YMEA 3RR8A 2Z4PA 2ZE2A 4RZRA 3PIOQ 1Q1KA 2CIMA 3FRYA 4OHWA 3PV8A 3SQGB 1GXLA 4I2QB 3CJKA 4CLLA 1QLNA 2EKNA 3A3PB 1RTIA 4K0KF 1FFWB 2UVWA 3KJFB 4DLEA 3D6HB 4ZLJA 2CVEA 3NGRA 1TKXA 1S97A 3PJXA 4NOHA 3MUVP 1WELA 2XGPA 1SV5A 2CYYA 2DRDA 4CO0A 2BM1A 2BVZA 5HN0A 3GZ7A 1X7VA 3DI6B 5DLFA 3N5FA 4USUA 4OYWA 3UI3A 3DU6A 2HNYB 3HM9A 3RBXA 1N32F 4CLZA 4AL7A 1O51A 2V9WA 2OPRB 4J9MA 1NK6A 1LW2A 2CJ9A 1G3OA 1IBKF 2DTJA 3SV4A 3KK3B 2R8JA 4LIWA 2DNLA 3M05A 2VQFF 3BYRA 3HHLD 1ZPVA 4KV8B 3TNVA 4ZP7A 1ZZFA 4FN5A 3G8QA 2LEAA 4JI6J 4UW2A 5EHHA 1HWJA 2GA7A 1KVJA 5ITHA 1YI2S 5DQHA 4RBTA 1X4BA 5HMWA 3VAGA 1TKZB 2MZSA 2UXDF 4IO9Q 5HANA 3QZ7A 4LR7A 1NEEA 2XTJP 2X3GA 3UR3C 3FCWA 4DFPA 3GIIA 4DQQA 4K7QA 5JVHQ 2BE2B 4GKKJ 3TQEA 2M2BA 3ICLA 4DR6J 1V9OA 1O5JA 2ZHOA 2XMTA 5L9NA 1UWBA 2WB4A 1FI4A 2G2ZA 1HBMB 4NRUA 2NXUA 4DL2A 4DG1A 2V4JA 3MMBB 4K4WA 3LH2S 2RD5C 5F9LA 4U96A 1WG4A 2I8EA 2PMWA 3WZ0A 3E2EA 1YKWA 4IRKA 2KFNA 2MZ1A 3FQLA 4WF9Q 4MYUA 2JX2A 5LJ5Y 2FC9A 1YZ6A 1FJCA 2V67A 1KVKA 4DX6A 2O01C 4RW8A 1CJTB 2V4QA 2B51A 4FPRA 4M5KA 4U9RA 1FRKA 3CMAS 1S1WB 4QR0A 3KK1B 1TK5A 3RG6A 4OX9F 5DRKA 3OW2R 3R1HA 3GV7B 2ZM6J 3SEOA 3KJVA 4HR2A 4YFUA 4M5JA 2Y1RI 1WJ9A 2E44A 1YJ7A 2Z57B 4EYIB 2U1AA 2HBQB 1ZA2B 5A6WA 2PA3A 2DPIA 4MT1A 4DQRA 1T7PA 2R7SA 2V34A 3W62A 5CD4H 3AOBA 2WBMA 3AY0A 2W4DA 1CSJA 5ADZA 1ZM4A 2GVDB 5F8GA 1X4AA 5G0RA 5ETSA 1KNZA 3MMCA 3W5ZA 1L3SA 1C1BA 3MF5A 1ZPWX 4TXSA 2D1CA 3PFEA 2UVUA 2YX4A 4X64F 4RNOA 5DG8A 1RWPB 2BRLA 1VQLS 4LF5F 3OVBA 1NJZA 3OL9A 2R7RA 3GQCA 1ULRA 3JQJA 3D1HA 2BJ1A 3HHEA 5IM0B 2DNKA 2IRXA 4J9KA 2EC2A 2ZH7A 4G65A 4LRCA 1VJQA 5I42A 2OJ3A 2VQEJ 4V19X 4RNNA 2ASJA 3DLKA 1TL1A 2LDYA 2AT1B 3K8WA 1IM4A 2XNRA 1Q95G 2WVEA 3M2UB 5ETVA 3MMAB 4OHZA 1RHRB 1VQOS 3AOCA 3GFHA 2LA4A 1S79A 4HYKA 1Q8LA 4WK3A 4BCAA 5H1SV 3EXCX 3Q22A 3ENAA 3M8RA 5IQQA 4ZKAA 3GONA 4Y2AA 1S1XB 2E1CA 3QIPA 3MM7A 5A6PA 1VQ5S 2CPHA 5KFXA 3W63A 3FSYA 4E2FB 4JYAF 4C8OA 2CPZA 3ILOA 2DR9A 2FZGB 4OYMA 1N88A 3QLHA 1S6OA 4X62F 2C2DA 3U7JA 1VQSA 5C5JA 2AX1A 4CTAA 4MK8A 2DR6A 1BXNA 3OXFA 2DO0A 2QL9B 2H48B 1YVFA 1YJVA 3DLLQ 4ELTA 3T5JA 1EQ0A 1FK9B 4B3TJ 3U1LA 1SVDA 3E51A 4CDIA 2R8GA 2HWTA 3IM9A 3VQSA 3W8GA 4FBTA 5L38A 3AXKA 1FDBA 2BJ8A 2PIIA 3LTOA 1WWHA 1S7IA 4NLRA 4A8WA 2PA8D 4P10A 3VTIA 3W9HA 2L48A 2A3JA 3K8VA 2V2ZA 1TZ0A 4CP5A 4P72A 5K20B 3MD3A 2HZAA 1N0UA 1BQMB 2FLPA 4BC9A 1WOOA 4PQUB 4LFBJ 3I96A 4MAKA 4RW4B 2GZOA 2CQHA 2E9ZA 2RKIA 2E1AA 2KT5A 4J9VA 2IC3B 1FHTA 1MROA 4XTTA 3QATA 3ETOA 3M8PB 4WIQA 2CNKB 3HSZA 4USVA 1YSJA 4LF8F 4Q5VA 1RADB 2XM3A 3PX6A 1R27B 2DEIA 2EFOA 1S6QA 2JFDA 3KNAA 3DFEA 1RWNB 4EFAC 2DY9A 2Y1LB 2LQ8A 3CDWA 5B0EA 2ABYA 2BEFA 3AA9A 2FD2A 3GV5B 2XI2A 3KHRA 2LVWA 1CQNA 1RT7A 2BX6A 5E3CA 2H5JB 3M2RB 4O3OA 1X4CA 3LGMA 1DTQB 2FQQB 2FYXA 1RT5A 1Q4RA 4A4JA 5E3QA 4WBFA 5L1IA 1RAJA 1WHWA 3NXZA 1HNZF 3MM5A 4I56A 3WC0A 1GMVA 2BDPA 3TX8A 2BE9B 4ERDA 2FIUA 3R5AA 2VC1A 3DGPB 2KI2A 1IBLF 3EDQB 2HVEA 2VG6B 2HHTA 4LBIA 3TUPA 1FRLA 5KFEA 1B99A 1RAIB 1TV6B 4CO5A 1JXVA 2JC1A 4UQGA 5LMUF 4B3MF 3MUTP 4A48A 4WFZA 2KRBA 3K7RA 5CABA 1NUEA 1LWCA 4PXBA 4WPAA 2R3VA 3T6JA 2RHSB 1TKDA 4AD6A 1HMVA 2HWHA 4LFAF 1VOMA 1Y7PA 3B4MA 1VLOA 1WUUA 2DGVA 4WFXA 4UUWA 4DL3A 1FKPA 3A8IA 1XMQF 3M32A 4O23A 1V5IB 4ZPAA 3JXOA 3EVWA 1HQEA 1ACMB 1NK0A 4B9MA 2J5AA 1OYDA 5KOWA 4IG0B 1Y10A 3V4MA 2DB1A 3MGJA 5KFHA 3GTYX 3HFKA 4CO1A 3I5AA 1RTJB 3MM6B 2L9DA 5L1LA 1IKXB 1SQGA 4B3SJ 1XBWA 4NA3A 3GU0A 4MFBA 3TA0A 4J91A 2KO1A 3G8TA 3RRHA 1U1RA 2VOOA 4JI0J 1X31C 1PYOB 2EK1A 4ES3A 1T03A 1FVQA 5AXLA 5FLXU 2POKA 4F2SA 4DV6J 4URSA 3D6MB 1UP1A 4GVBA 1ZM3A 2OEJA 2YKMB 1RT4A 3BR8A 3RZAA 1YX2A 1HNIA 1NJXA 2M52A 3B6BA 3RBEA 1VQ4S 2MY8A 2ZD1A 3EM1A 2WZ1A 4OHXA 2CXEA 3ILIA 1YITS 3HF5A 2HNZA 2XULA 2AJ1A 5HL7Q 3EE3A 2FY8A 5T7LB 2DNMA 1WOPA 2VBXA 4JOUA 1FX4A 1FESA 1M0SA 3WIUA 2Q6BA 4H54A 1N34F 4NMLA 2DGWA 2G0JA 3BQ0A 4WYLA 4NLGA 3G96A 5IQ6A 5KFNA 3CEDA 4QQBA 1NHKL 3SSRA 3BR9A 4P2SA 2IM1A 4CZCA 2XS2A 2HWIA 3M6XA 2BQUA 3NS6A 4ID5A 1VBZA 1HQUB 3HVRA 2UUBJ 1FT8A 4XO0A 2QSFA 4C0OC 4OYZA 4ED0A 5KFQA 3G2XA 4ALZA 4WFBQ 4X4VA 4ITSA 3UVJA 4KY3A 4O4GB 4F36A 1TTHB 3BDPA 2OO4A 3GIJA 4A8SA 5F8JA 1C1CA 1HBNA 2HIQA 3KK2A 4I2QA 2R2TA 4F67A 2EVZA 5GVQA 1VK8A 4PABA 1LK5A 2ZBPA 1SCJB 4KYZA 4C11A 3ZTSA 2R7QA 1GAOA 4ZVRB 1IKYA 1S9GB 1OSDA 3MTJA 4O4RA 2K3KA 1DLOB 2GO9A 2EFNA 2IJRA 3UCGA 3CT9A 2QLBB 4QPXA 1I5OB 5J2NB 5I3UB 3BO2A 2RT3A 2UVRA 2J0SD 2RILA 3H2LA 2R7WA 1X4FA 1XERA 2UUCF 4CLUA 2ZC3A 1VC0A 3OTDA 3BN4A 2D3O1 2XMWA 5A8KB 3DI6A 5KT7A 5ETMA 2FVQA 1FD8A 4HACA 3QIDA 4X4TA 3ITHA 5GAEU 2FGOA 4WXWA 1KLNA 5EN1A 5HP1B 2IA0A 1S1UA 2KN4A 3ZZRA 4K4UA 3BGLA 1RTDA 3EGNA 5E3RA 1SI9A 2E5LJ 2QSWA 4ZMMA 1KD1T 1JKHB 3QFHA 2HFNA 3W65A 4J9UE 4LSZB 2KU7A 3DOKA 1S57A 2BM0A 3C15B 3A8JA 5A2QY 5EDWA 2UXBF 4A8XA 2DY1A 4JI5J 1J5OB 4H4OB 2E66A 2HHXA 1RHKB 2AGQA 1JB0C 3PZPA 3N0VA 2XMVA 2RRNA 3C6UB 3I87A 4PEOA 4HHUA 2F8MA 1UEKA 2P5VA 1PC4A 4C3LA 1G7CB 2AGOA 4FYDA 1RTZA 2J0WA 2L9WA 4HLBA 1LKZA 3OT9A 1P6TA 3DN9A 4RPFA 2QEXS 4IR1A 1SQEA 4M5NA 2FVRA 3IR5B 3PKMA 1CS4B 3GSDA 1OQ6A 3C66A 4X66J 4YY3J 3GJQB 5A0YB 1HPZA 3D7SB 4DUZJ 4Y28C 2DT9A 2MKHA 1WC0A 2CJBA 2VDIA 1U0HA 4A8KA 3EVMA 1EX8A 1MN9A 3BM7A 3A12A 5F0UA 3QYYA 1HNWJ 3C6TA 5K14A 5DQGA 1LV5A 4OZNA 5B0DA 5RUBA 3EZOA 1RT6A 3P5BP 4CO2A 1JLCA 2UP1A 2B8PA 5K9FA 3V6KA 2PC6A 1VQNS 2FVPA 2DH7A 4C4WA 1ZTWA 2RRBA 4DV5J 5KFZA 1NJIT 4LBPA 1C0TA 2XO6A 4DSKA 3RYLA 1D8ZA 4Y65A 4ZLPA 3BKFA 4PG7A 2NXJA 2DRAA 3QRRA 3WX8A 4QIEA 5GADU 1FXLA 1SJFA 8RUCA 1PC5A 3R1LA 2HLTA 1TL7B 1C4AA 2DXDA 3H2UB 4HI2A 1VHFA 4XK8C 1FDAA 3UDVA 1Y0HA 4YHHF 2GX8A 3R7BB 3PACA 2ZUGA 2L3MA 4N8OA 4NA2A 3EZUA 1CC7A 2GQQA 2XY5A 3ZZZA 2FVCA 2G1HA 2ZITA 3FQKA 3J81U 1U6ZA 5CD4A 3OXGA 4TVAB 2GVZB 3VAKA 5C2GA 1C0UB 5E2QA 3G82A 4WK1A 1R8AA 4DR1J 1JJ2R 2ZBQA 4BWJA 4YEAA 1KN6A 4OLOA 4P2FA 4QIGA 1QSSA 2YWGA 2HS0A 1WF1A 3D66A 2P8IA 1NK7A 4NLPA 3NCQA 3CE8A 4RBUA 5E41A 3HHKA 4KRWA 5KFJA 4F04B 3FFIB 4H4KA 2OSQA 1FTCA 2JDJA 2OTJS 4DV0F 2IBOA 3M2UA 4X4RA 5DDOC 2KG1A 2CJKA 3JS9A 2VJUA 1TQLA 1FA0A 1FJGF 3I6PA 1ZOTA 1JLBA 3M9MB 4JI4J 1P1TA 4RLEA 5B0FA 2XZTB 3M2VB 4EBCA 2XSJA 2IIHA 2CNLB 3V81B 4PWUA 1R0AA 4LSLA 2HHHJ 3N4WA 1GTHA 4CH7A 2QFJA 4RWXA 3D2WA 1M5KC 2FC8A 5AJ3F 3PRDA 3P4UB 1LW0B 1GXTA 2OPPB 3D4JA 1L5UA 1IVZA 1N5VA 3Q23A 4UOCA 4NZ0A 1IR1A 1H7WA 5JMNA 4JI8J 1FRIA 5B0BA 1FK9A 3HD2A 1KBRA 4TYAA 1E6VA 4GC6A 4IDKB 1U8WA 3F56A 3V2UC 2EPIA 2MQMA 5BJRA 1YJRA 4F4WA 5A8RA 3CWJA 4F02A 1QE1B 2OI2A 1DRZA 4DU8A 4LF7J 3RAXA 3J7Z5 3QWPA 1N5YB 3UN5A 1MU2B 3ENVA 1XMOJ 4ZN1A 1C4CA 2BJ3A 3H42A 4DPOA 2FB0A 1M90T 1TP7A 5C7PA 1CJKA 2UZAA 2YNGB 1WTFA 1EB0A 4UOGA 1I94J 2XLJA 3C16B 2XNQA 2ASLA 1H98A 3G9CA 5CYQA 1YTYA 1RTHB 4HI1A 4F7VA 3GLJA 1PJ6A 3EICA 4C0BA 1EHWA 3PEJA 3K5NA 4RW9A 1FERA 5IT9U 1NPRA 3PHTA 3AAWB 3ZTQA 1KTVA 2NPIA 1ZH5A 5KFFA 2AJFE 1JLAA 4OZ0A 2HRYA 2GHVC 4NLVA 2LXUA 3MAHA 4DPTA 4CM0A 3S7RA 4X65F 1FRMA 3PXGa 5F8MA 3GIKA 2DPJA 3FJ2A 4U8VA 2E5HA 3T1HF 2GAGC 1SJRA 3NMAA 1K73T 2IAJA 5CAAA 1RE1B 1HI0P 1W2IA 2BBEA 1HBOB 1HNVB 4I7FB 1RU2A 3CCVS 1VRQC 3LA0A 4QIFA 1GH8A 3POTB 5MAOA 3M8SA 4HDHA 1MW7A 1X4EA 1JLEA 4DL7A 4EBEA 4DR7F 2PFFB 4Q0BB 2HVZA 2HGNA 3BV8A 2W2OP 1RWUA 1T05A 2F4VF 2DGUA 4ZA1A 4L75A 4ETXA 5CH7B 2V8DA 5LMNJ 2MZTA 2D74B 1BLUA 1ZTTA 1N33F 2AWZA 2Q6CA 4OJ1A 2D3UA 1DBDA 1N36J 2G0IA 2OMOA 1I6JA 4HH1A 3SQOP 4RJVA 1UVIA 2ZJQQ 3CJRA 2BW7A 1FKAF 2AF6A 5D8HB 1UTAA 3T5HA 2MGZB 3VAJA 2YQ0A 2XYHB 2IMWP 3X1LB 1OY6A 1TV6A 2XO7A 2UUAF 3TP2A 3KNGA 1RQ0A 2LP4A 4O3SA 4ILLA 4HH0A 3QSYB 2HVIA 1AROP 4ZIWA 1SKUB 4IG3A 1FF2A 1S4EA 4Z37A 2DIUA 4WFNQ 5FDLB 4RNHA 3DHXA 4CH0S 1NSKL 1T9YA 5L8RC 4ED7A 5IC4B 1H0HB 4GRSA 3ZTOA 3A3NB 3PIPQ 4NLXA 2YKNA 1S6PB 4PYAA 4NXNJ 3HFVA 3P45B 2AJ4A 2RS8A 4PR6A 1S4FA 3N28A 1Q8IA 1U7LA 1LXNA 5IWAF 2QL5B 5THWA 5KT4A 2DR7A 4EU0A 2VUGA 2VPYB 3SI8A 1N6QA 5J2QA 4DR3J 1VQ9S 3HSGA 2LDIA 4LSNB 1VRUA 1RTJA 3N6MA 5D78A 3MEKA 4P2MA 4XAKA 1JLQA 4JI7J 1AA1B 2G2YA 1UEUA 1S6UA 4USHA 4O0IA 4C7QA 2MKSA 1TL3A 5HROA 4RUAA 4EK2A 2YPYA 5F3ZA 3QT6A 1XJWB 1S48A 3EPGA 3WX4A 3IR6B 3FEZA 3M6WA 2BJ9A 2QIFA 3MPDA 4DN0A 1HD0A 2IY5B 4I4BA 1JJCB 2MLXA 3W2WB 2WHOA 4AQYF 2BRKA 1DFDA 3IBWA 3K5OA 3GYGA 4M8LA 4WE1A 3H98A 4PPDA 1KRPA 1N5QA 4ZVQB 5JXSA 2G4BA 3DLBA 1E6YA 4FNHA 4DUYF 1S0NA 4RO0A 3HKZD 2PEHA 3MPYA 3T9NA 1DQ9A 4PXDA 2ILYA 3JYTB 3I0SA 3DRRA 1RHUB 2YNHA 2C42A 1WF2A 2D3OR 3VALA 3FZ2A 4FPIA 2XMMA 2HHWA 2B7BB 1BQNA 3DC2A 4FYYB 4G3IA 2YNFA 3SCKE 2QT7A 5KFUA 3AD9C 2DNYA 2C2OB 2HIYA 3QJLA 4ZHRB 1D9DA 2MKIA 2VODA 2VG7B 2XQCA 4QW9A 4WYWA 3HJFA 1YBUA 3TI0A 4IRDA 2OGUA 1WNEA 3PEHA 3QWUA 3CD5A 5GAGI 5LSLA 1LEOA 3VZIA 1UA1A 2DNRA 2ADBA 2O67A 4YB1P 5F8NA 3I4HX 3IG1B 2HQIA 2RUSA 2FUG9 4BWMA 3F44A 2FHJD 3O2IA 2GGPA 2KXFA 2XMUA 4NCGA 5DQIA 4I6YA 2ASDA 3PHEA 3M6UA 4M5DA 3MR2A 1TKTA 4NLOA 2VFTA 1L3UA 3TYTA 4ZDNA 4ILMA 1S1TB 3TWZA 1S9GA 1KC8T 2YH1A 1N5SA 2LECA 1T95A 3MHYA 1KQGB 4ZJQA 3ZFVA 2IBKA 2J9EA 3U02A 2RF2B 3BS9A 5I3UA 3N01A 1HLWA 1UPPA 4YR0A 1AXQA 2DVIA 1DURA 3RW7A 4ZPCA 4NASA 4Q2LA 3M8WA 2C2KB 3D5MA 3MM8B 5HVFA 2BV3A 2QC3A 4X2BA 3HT0A 1XWLA 1P8GA 2MQOA 4DV3F 3HX9A 3K89A 4WKYA 3NCRA 2PI5A 4CO3A 4C0HA 3TARA 4F3MA 1D0EA 2ZE2B 3CJKB 3KOAA 3PFOA 4K0KJ 1QTMA 1F5AA 4ZPWR 1RHJB 1RTIB 5HATA 1ICEB 3GG0A 1IKVA 3GJTB 3MR3A 2P6SA 1MLAA 1TKXB 3MEDA 2WONA 2N4CA 4NRTA 4F4ZA 2AQ4A 3FMWA 5IS2A 1SV5B 5BYSA 2FJDB 5FJ4A 1Q53A 4IFVA 3Q2SC 1Q79A 1FRXA 3GJRB 3UE2A 3Q0AA 3NGSA 5F8LA 3KXDA 1V3RA 4L76A 3CMES 1J5OA 2VPWB 2H4YB 5D0HA 3HPOA 2FY1A 3OR1A 2HQCA 3UFCX 1R6YA 1SJ3P 1WI6A 1EETA 4MJKA 2J8SA 1N32J 3OR2B 2ZWOA 5E5NA 5HQLA 1NJWA 2OPSA 4G1PA 1IBKJ 1LW2B 1PIEA 3D1QA 2A6OA 4AL5A 2NYHA 3DCAA 3FUYA 3PX4A 2J0XA 2QYGA 5CYMA 1AB8A 2ROGA 5CYJA 3L9ZA 1U09A 2CPYA 4KSEB 4CI0B 2CZVC 3EWGA 1B0VA 4MKBA 4NMXA 3NAHA 5LXYA 2K3IA 1XTZA 4X4NA 2HHPA 1XC9A 2UXDJ 1VDHA 2LU1A 4DSIA 3P3DA 5H9EK 3PW5A 4CNZA 4A8FA 4XIUA 3DRXA 1RSCA 3W1YC 1A0OB 4F3OA 4PYDA 3CDAA 3SCIE 2WW8A 4OYBA 3TUJC 2J0QD 1NZAA 3IWNC 3W7BA 4AFFA 4R5PA 2GMHA 4ID8A 1WTBA 4OZ2A 2JVOA 4V19J 3IMQJ 4ED6A 2QTWA 2F8HA 6FD1A 1RWKB 2I38A 3IWLA 1UWBB 5CCLA 1HWLA 5J1EA 2GIFA 2IDEA 3ZZ0A 2YKPA 2ACMA 2WSCC 4DG1B 2V4JB 3CCSS 2D69A 3D0GE 2KJVA 2DR5A 1A7GE 4NEYA 4TY8A 4R0JA 4IOCQ 1K1QA 2GJ2A 2C2ZB 3OL8A 1Y11A 1JQGA 4J5OA 1N52B 3D6TB 4IKAA 1T3OA 4E8UA 4Q45A 2GS8A 1URNA 2HVDA 3E8OA 4RW8B 4FXDA 1FNXH 2RB7A 3FCVA 3D54A 4F4AA 2BQRA 4OX9J 2FJVA 1IKWA 3MAAA 2AHOB 3RTVA 3FBFA 3DRYA 3KJVB 3VQTA 1F3FA 2HVHA 1YJ9S 4RUHA 2BKOA 4OJ3A 4F4XA 3PYFA 2ZFHA 2I9SA 3IBFB 2YH0A 3MAQA 2YWFA 2LQBA 4CIOA 1A9NB 1GMWA 3MCSA 3LAMA 4YOEA 2W8LA 3HVTA 4M5IA 2NSCA 3KG1A 4C8YA 2LMIA 4K4ZA 5ETTA 4ZCLA 3FSIA 4Z2XA 5G0RB 1WACA 2QE5A 1R8CA 4J37A 4OI3A 3MMCB 2BANA 1C1BB 1WG5A 4FXVA 4WP9A 3GP9A 2CPXA 2BYCA 2C3UA 1F9HA 4X64J 4DR4F 4G6VB 1RISA 4WU2A 4ER8A 1KLMA 1GXUA 4RBVA 4K50A 4LF5J 3B78A 1F9EB 4NLYA 2X7IA 3OFHA 2MKCA 5KG1A 5LT5A 3R9LA 1DY3A 2Y1IA 4DX7A 1F6TA 5DZ7A 3LQVA 2CUYA 3VAFA 1RAEB 2B43A 4ECWA 4WP3A 3J80Y 2WK4A 2HS4A 4ZS6A 5ETOA 1AUSL 5I42B 4NZ6A 5HLFA 3AD7C 2M8DB 2MTLA 3DLKB 1TL1B 2J9DA 4I64A 4ZVUB 1FWKA 4K8RA 3H20A 2LFVA 1PJ7A 4Y2MA 2QMWA 3THTA 2D41A 4TU7A 1ZZNA 4ZVSB 4A8MP 1R31A 1T8EA 4ECVA 2B56A 4KPYA 3MR6A 5ETNA 1HD1A 3QIPB 3MM7B 4JYAJ 2HG4A 2DNZA 3C2PA 3MEEA 4CNYA 4X62J 2F5GA 4KJIA 3PYGA 2MQLA 3QLHB 1QUVA 5JUMA 2CZ4A 5EWGA 4PWDB 2W9AA 4CTAB 4A47A 3IM8A 2C2EA 3NS7B 1PAEX 3VAHA 3MOJB 3EMTA 3CJ0A 3OTEA 2ZH2A 5D4NA 4DCOB 4B02A 5AE3A 5EX0A 1RJJA 3MEGA 2GC8A 2Y3YA 1UL3A 3H5SA 1K1SA 1RKJA 4TU8A 3BGOP 3DRPA 3GYXB 5D4PA 1REVB 2JSXA 4ZPTR 2HSEB 2HLUA 3M8YA 3HVAA 3UN2A 4TQRA 3ENQA 3QNWB 2J6UA 3TOQA 4QWCA 1HBOA 4NYZA 3BZQA 3VGSA 1G4CA 2OHDA 3M8ZA 2PD1A 4B3OA 5CA5A 3CW2C 3MR5A 1HHTP 2RKIB 1MROB 2D7SA 3CCTA 4NCAA 4LF8J 3GG1A 1HL6A 2C3YA 5GMDA 5DGBA 1IR0A 1B3TA 4Z7YA 4B08A 3IRXA 1QJHA 5LM7E 4TLQA 1B0PA 4QPTA 1RK8A 1HW8A 1WC3A 1S6QB 4JI2F 1SBRA 2XZWA 1KTQA 1YK9A 1H3DA 2RQCA 2VFRA 1Z1ZA 5D4LA 3NBPA 4IH6A 4RWWA 4RU2A 3Q8YA 5H9FK 4N7TA 3LUYA 4NI2A 3B4DA 1RT5B 3PW7A 3K2YA 1RCXB 2IVMA 3I82A 1HNZJ 2JEIA 3K5PA 3CC2S 1SH3A 2CQCA 3I5BA 3KLHA 4DR2F 1TUGB 2XLIA 1NDPA 3EX7B 4KC5A 5A8WA 3KG0A 4F4KA 1S6PA 4QWDA 3QFWA 1FNOA 1VQKS 2A6MA 1IBLJ 2W9BA 2ATCB 5F41A 5LOQA 3UPFA 4LFBF 1D8YA 3P96A 2XWXA 1R0BG 5HMXA 4L72B 1HNXF 2YQ1A 1GMUA 1M1GA 5LMUJ 4B3MJ 2M8HA 3NL0A 2PFDA 1NBEB 2AMCB 2CQ4A 2E1MC 1RLDA 2XS5A 1LWCB 4M5HA 2QMUB 1NB2A 4Y2IA 4LFAJ 4J9SA 1HMVB 2HURA 2V63A 2HNDA 4JBCA 4YDXA 4NYPA 2JC0A 1YRXA 1VJWA 1XMQJ 3NRBA 1FKPB 4U6PA 4URGA 3M32B 3T5LA 3HD1A 1BWEA 4TKTA 3JSRA 4KGMA 3ETMA 1HQEB 2K7KA 3NWGA 5HAOA 1RA6A 1RWWB 2CA9A 1TMJA 2LU2A 3I56S 2B4OA 1FWLA 1RWMB 4P9SA 4DU7A 2WTFA 2DIVA 4DL4A 4C8ZA 1DJ0A 1V3ZA 1SKRA 4HT5A 4OI0A 1EP4A 3K58A 1Y3KA 2EEYA 4J9RA 2OLWA 2K8GA 3OJUA 2NYIA 3DLEB 3LWMA 2JEJA 1UMJA 3J7YU 4DF4A 2QZ8A 1LNQA 1T03B 2NS1B 4Q2MA 1XEZA 4ANDA 1M1KT 4EGLA 2CDRB 3AODA 1K8AT 3BO4A 4GVBB 2G9OA 2H5IB 2F7VA 4DPUA 2MQ8A 2BJEA 4ECZA 3ZZYA 2XY7A 1NK8A 1NPPA 1WKJA 2ZD1B 3MZIA 1SC3B 2UU9F 2IPOB 4N56A 5M2UA 2HNZB 2HHQA 3SCJE 2ZNYA 2LEPA 2H4WB 5FD1A 2B4VA 4MKAA 4QCLA 2RIJA 1N34J 3UR0A 1U1LA 3VWSA 3FDSA 2MJUA 3BSCA 2N4DA 1KSPA 5BYQA 2BMBA 2VBZA 1VIXA 1SXLA 5C42A 1S1TA 1LK7A 4B9UA 2A0FB 1JJ4A 3DXSX 5HBMA 1PAUB 2CAJA 1N54B 2C2RA 4ID5B 2E7XA 2A10A 2YPZA 2GIRA 3PW0A 4KR0B 4CLFA 4LT6A 2COLA 3JSYA 5ETQA 4P2XA 3LPEA 1NK9A 2JOQA 1IUJA 1PYTA 1QSLA 1EKSA 3QGHA 2PMHA 3BSOA 2IFXA 4M5LA 5KFYA 2NREA 3UVJB 2F9DA 1S99A 4DFJA 1W2BR 3T5KA 4UT4A 2H1YA 2RU3A 4AUKA 4KH0B 1IJEB 1C1CB 3PCOB 4DEZA 1HBNB 4RX6A 3KK2B 2BOAA 2C28A 5KT5A 5C25A 3D3CJ 1L3KA 4C11B 3PY8A 4W90B 4B9VA 4OHVA 2YWEA 4ZN3A 1DZ5A 3CJ4A 4QYZK 3A13A 1IKYB 4NLSA 2V4RA 3HVWA 3H5YA 3IXQA 3HCXA 3GCWP 2PT0A 3RAMA 2QJ3A 3V4IA 2HAIA 2FZKB 1JLFA 2DNHA 1EAYC 5D77A 3UNYA 7FD1A 1Z4UA 2MZQA 2UUCJ 4ZOSA 1XIQA 1S1VA 3KWMA 2YX7A 2Z2ZA 4LIRA 4BLGA 5E3PA 4HACB 2KM8C 4LRAA 1FRJA 3ITHB 4PG4A 4ZP6A 1MNEA 2EK6A 3OR2A 4XDCA 4R8UA 1S1UB 2V68A 3OVAA 3TA2A 4UZCA 4LF9F 2B6AA 1RTDB 3CDEA 4B3RF 3WQPA 5KFTA 1RGVA 2B9YA 3OBIA 1IBMF 2IM3A 2IM2A 2YWKA 1H73A 3OFGA 1PYSB 5I4MA 2MSTA 3QQCD 1CVJA 2WVCA 2LA6A 2MB0B 2I5JA 3DLGA 3OL6A 3CCRS 3DOKB 3NGUA 2UXBJ 2JEFA 2P9GA 5M2RA 4UY8T 4EBDA 4OI2A 3HZEA 5IFMA 4X84A 2PN6A 3LP0A 4O0NA 2XC9A 3I9V9 3QT8A 4GKJF 3RB0A 1ZAVA 1D9AA 2MKKA 4ZPVR 1RBAA 3MDFA 3P6YC 4Y2KA 3GILA 1U26A 2ASYA 2DBBA 3T9ZA 2K1RA 3IP0A 3W2VA 2IRUA 4N77A 2VZ9A 3Q8PB 2ALZA 1HWUA 2RQ4A 1HPZB 1R0CB 4KHRA 1RHMB 3UD3P 4ECUA 3HHLB 1U0HB 4EEYA 1QD1A 2Y9HA 3DDNA 4ZVOB 4USWA 1EARA 3L7UA 5LL6d 1VR6A 3C6TB 5K14B 1NPKA 2JWNA 3BGUA 3V5RA 3SSQA 3TUIC 2X3DA 1Y5NB 1RT6B 4O44A 4RKUC 4G1IA 1JLCB 5HK4A 4DV4F 3HJVA 2P9EA 3R5DA 5LSOA 4EWTA 3DRSA 1IQTA 1SPBP 2H51B 3NGKA 2NXNA 4DR5F 2YKAA 2X51A 1C0TB 3TAMA 1WF0A 3OL7A 2ZJRQ 4C8MA 1KQKA 5A2QU 3MWBA 3CDUA 4E0DA 3NNHA 3N6LA 4NLTA 5KFBA 5HQ8A 1KOOA 2DR8A 2NQPA 4FF4A 3DLJA 4YHHJ 4ENOA 4JI3F 2QA2A 3O3LA 2M9KA 4FNIA 2E5IA 4QWAA 3BKUA 1RT1A 2RQKA 4Y0FA 2KT3A 3KJNB 3HT3A 1HHQA 3L7OA 4RW6A 4OIXA 2KTQA 2ADCA 3FCHA 3HFZB 1APSA 2NZ4A 4I6WA 3SDEA 3G82B 4IYQA 2AU0A 4LRDA 2B9WA 5CZXA 2IA6A 2IVFB 3KTQA 4N41A 1HBUA 2EFVA 3OLAA 1TL5A 3JSMA 4LF6F 4PKDB 3A8EA 1NAQA 3JTNA 4IO1A 4DV0J 1SC4B 3ISNC 5D3GA 2CJXB 1IN0A 6FDRA 3LGHA 1X9MA 1FJGJ 1DTTA 3AHPA 3KHLA 2VJVA 1JLBB 2RE1A 1X9WA 4DL5A 3Q8VA 2LLZA 2XSJB 1SL1A 5IXUA 1Y9OA 2FJBB 1NHVA 3IS9A 3GIMA 1R0AB 4LSLB 3Q8QB 1CJVA 5AJ3J 4PWDA 4X4PA 3GB0A 1F5BA 2HQFA 1OQ3A 1FO1A 2LQ5A 4DV7F 4TLRA 1PBAA 2B4PA 2QMXA 2AYMA 3MPVA 2DGSA 3KUHA 4DBQA 1MWZA 2E5GA 1N0VC 2YNIA 1TVRA 3OSPA 3NY0A 1X8DA 2QLXA 1E6VB 4WIIA 5J1PA 2MZJA 4DLGA 2ZH5A 1WKKA 4PG8A 1REVA 3BYPA 5A8RB 2BABA 2DHSA 3D6FB 1U49A 1TU0B 4LF1A 3FBCA 4I6AA 2AEMA 4CT8A 3HMJG 4JUZA 1RKIA 2OTLS 1WC1A 1FKOA 2FJXA 2MHEA 2HFZA 4K5RA 4DPWA 3H8YA 1CJKB 3AJ1A 2AJ0A 1D9FA 2M88A 2HAFA 3DOLA 4LFCF 3C14A 5CYQB 2J9CA 1BD6A 2NLWA 3FMBA 4EMDA 4N76A 4RW9B 2RH3A 4DPYA 2P9CA 3A3OB 3AB4B 1S9EA 5EWEA 4FVCA 4A8YA 5LJ3Y 1JLAB 3AT1B 3HKWA 4X65J 5DGAA 1P1LA 3EUNA 4KAIA 3CJ8A 3T1HJ 5D15A 3BBCA 2UV8A 4USKA 2IAJB 2PI4A 3H7HB 2EXUA 1GK8A 3G6XA 3SV3A 4DR7J 1JLEB 2DK2A 1HI1A 2F4VJ 1PKUA 4CYUA 1T05B 3ZZTA 2KHDA 2GAHC 2PDAA 3CIMA 1H2TZ 3MCOA 4L73A 2FHOB 2V9KA 4MKYA 2QN6B 4J9OA 4G1QA 1N33J 4QU6A 3CCWA 3R5CA 1JXLA 2QYCA 3CDBA 2VF3A 5HJYA 2R9LA 4LUBA 3G8SA 2ALYB 2CQ0A 2VICA 1EIYB 1RAFB 2L9NA 1FEEA 3PVXA 4LR9A 4ETZA 3JQMA 2UUAJ 5B08A 4NCBA 2AJ2A 4FKYA 3ADAC 2ILZA 5KFCA 1J5EF 2BOPA 5J2MA 3R6GB 3CSKA 2IVYA 3OTOF 3CJ2A 1T94A 2J9DE 4O3RA 4IG3B 3PRBA 2HS3A 3RUBL 2IHR1 3VAIA 2P6TA 2VPZB 2F65A 4RNMA 3KUEA 2EFPA 5A76A 2L08A 1W25A 2YKNB 1S5ZA 2H54B 2XCPA 1U1NA 5IWAJ 1HHSA 2RHQB 2F3JA 1IWAA 5L1JA 4IFYA 3U27A 4AXJA 1N6QB 5J2QB 4OI4A 1BQXA 1XR6A 3O5TB 3O8WA 3AB2B 3H25A 5DJBA 4J9PA 1SH0A 2E7WA 4LVNP 4W98A 1VRUB 3JQKA 4EYHB 3I4PA 1SKWA 3IAM9 1JLQB 2YVSA 2ZWPA 2C1EB 2VBWA 2JLEA 1TL3B 3DLEA 3OVSA 5HROB 5EGYA 2VPXB 3LP2B 5AE1A 2WOMB 2ZBRA 3W3SA 1DARA 3B54A 4KE5A 2FLLA 2VOPA 1F0XA 2HRUA 2QRRA 1M5PC 3CCJS 3H59A 1SB6A 5AT1B 2FZCB 5DDQC 4CCHA 4AQYJ 2DHXA 1UJ5A 1XNQF 4ANCA 3QGIA 4WE1B 4Q44A 3IC1A 5DDRC 1ZYQA 2H9ZA 4OI1A 3QZ8A 4DUYJ 4Q8FA 1ZAWA 1E6YB 3DNCA 4X4SA 3R6LB 2CQDA 4NPOA 4BS2A 2B5JA 2WBRA 1CJUB 3K57A 1VYAA 1Y5IB 3I0SB 3DRRB 4Y34A 2YNHB 4F0HA 4KKOA 3GE9A 4I2PA 4Y2CA 4UOFA 4YB6A 1X4HA 4KPCA 5IC6B 4WFYA 2ZC4A 1BGXT 4RU9A 1BQNB 2VV5A 2YNFB 4ZLLA 3OUYA 3EYZA 3M9OB 5D6GA 3NP5A 3QAEA 1RDRA 4MIAA 1D1UA 1NMEB 2HK3A 5C24A 1H7XA 3PR4A 3NNCA 1VRTA 2DH8A 5H9EJ 2XS7A 3G71S 1WHVA 2MLYA 3AQOA 2FPHX 3TVKA 2GO8A 4QR1A 3UW1A 3MD1A 5BR8F 1U0SA 3ZTPA 2GFFA 3MPUB 4OYAA 1X5TA 4FBUA 4ECRA 3CGIA 3FNNA 2QA4G 4CLSA 2KM8B 2AZ1A 2V8PA 4Z7CA 2GGPB 4NCGB 3OTBA 3CJ5A 4M5DB 1TKTB 4OI6A 4ATNA 3D3BJ 2R2RA 4B9NA 2XYGB 5T41A 2NUHA 1YJUA 1WSVA 4LQ9A 1WEYA 4W92B 1RU1A 2OEMA 3DMJB 4DV2F 4QIVA 2FHMA 1NDKA 1JX4A 2ROEA 2BJ7A 2E1RA 5KG4A 4DV3J 4PG6A 4DL0C 2QG9B 3ISZA 3AJ2A 2Q43A 1YZ7A 1U45A 2E7VA 1F1BB 4H4MA 4WP8A 3E01A 3GV8B 2KHCA 4ZVFA 5CXTA 4JV1A 4ZCKA 2FHKA 1ELOA 1KEKA 1IKVB 3Q8RB 4DV1F 1NK5A 1CEZA 1O0PA 3TAQA 1WDTA 1VISA 4B17A 4ZCMA 3OPKA 3MEDB 4WZMA 2K7JA 3US5A 1WG1A 2WONB 4LQ3A 2VA3A 5JJBA 4IFVB 1T9UA 4ZITA 7AT1B 3ZXWA 4F2RA 1UVJA 3M1VA 2MDAA 1DQAA 2B7CB 2ZOMA 4QZVB 2F9JA 3OR1B 3QMQA 1F60B 1OWXA 3H2VE 4OX8A 2DGTA 2RNEA 1EETB 2ROPA 2E5JA 3HO1A 2OPSB 1G2EA 1JLGB 4JI1F 3HXMA 4JB8B 2DXFA 1CULA 2HKEA 4NL5A 1LOUA 5CYMB 1LXJA 1WI8A 1XR7A 4AT1B 3RR7A 2Z2YB 3V6HA 2LXIA 1YIJS 2PMZD 2EBGA 1HKAA 1UW9A 3BGRA 1H74A 2R7UA 3HHLA 1S59A 4ZVTB 1Y4ZB 2CPFA 3EGZA 1ROFA 3KLIA 5L9XA 1DHMA 2GCFA 1O8BA 4MYTA 5AE2A 2NPFA 2I6WA 1MMLA 1NJYA 1HR0F 5D4OA 3MM9A 1Q5VA 4OX6A 5KFLA 5KG6A 3GWCA 3ZTRA 4C6AA 1NK4A 2RQMA 1X5PA 4R5PB 3VF0B 2VFVA 4ECYA 4N8NA 3ONQA 2DNPA 2HQGA 2JLGA 4U8YA 3J81j 5J1EB 3LF0A 4M95A 4HDGA 1KS2A 3AA8A 5HO4A 4KO0A 2WRMA 3IA0A 4TY8B 3IGVA 1B7FA 2CJQA 3JTPA 1U1PA 2GV1A 4DX8H 2DJWA 4UTGA 3L7PA 1U1MA 1RP5A 2HFSA 3VVUA 2WB1D 3NOCA 2D9OA 3QO9A 4WKRA 2M5YA 3LP1A 1IKWB 3MAAB 5KTQA 1J2VA 1URRA 2OFGX 3NGDA 1RACB 2Q66A 2HFUA 2VIHA 2ZZNA 3DOMA 2KJWA 3N5BA 3P49B 5KFKA 1TUVA 4DX5A 3S6EA 2OSRA 3T1AA 3HVTB 3IFEA 3TZYA 1ZETA 2IRYA 3T41A 4QJVA 4OX7A 2DD8S 3RB3A 3NWRA 4GVLA 1BUXA 3SMZA 2J6TA 1U48A 2LCWA 1QAYA 2OP5A 3RB4A 3O44A 2BANB 2BKNA 3AD8C 4UF4A 4DR4J 2XMAA 3ZC4A 1SUQA 4IH7A 2YWHA 4JV2A 2MXYA 3GFXA 2ZHBA 1KLMB 3N6NA 1M5VC 3PNIA 4QW8A 1FFSB 2I2YA 2Z56B 4CLPA 5H9FJ 2C2NA 4TNOA 2JJ4D 1H2UX 4UZBA 4NA1A 4WTOB 1NXIA 3C46A 3BH7B 5HLFB 2H5EA 5F0WA 3OFEA 3PO5A 1QTNB 1NO8A 1VHIA 4FDFA 2A2DA 3GIRA 5IV4A 1M5OC 2D9PA 2WVFA 2YKQA 4FXWA 4U67Q 1CLFA 2J7WA 3T1YF 3OTCA 3MECA 4ILRA 3D68A 1T9WA 3MR7A 4C98A 1FTRA 1X4GA 1SJQA 4DHVA 3FZBA 3HSJA 1KQSR 3NS5A 2HMIA 1IR2A 3TJ9A 3HP6A 3V6DA 1VGYA 3OHAA 5G4DA 1KQFB 2IMOA 4YB7A 2DNNA 2XB2D 2W24A 1B64A 1T02A 3R2CJ 3QAUA 2KRRA 2YKOA 2PEBA 4CLKA 2LYVA 3T6BA 1SKSA 3MEEB 3L4BC 2BUNA 3BF4A 3QGPA 1YBTA 2N7CA 3WC2A 3CPWR 4ECSA 4LMZA 4I67A 2QO3A 3MCMA 1BWVA 4RW7A 4F0KA 5EUHA 3MEGB 3BPDA 2XLKA 3TR5A 2HZCA 4USMA 3HULA 3TEGA 3M30A 3IBCB 3BSAA 1HYSA 1NM2A 3DRPB 3QT7A 3L95X 3WBZA 2VG5A 1HWIA 1Q7YT 1GFWB 3HI9A 5GMKa 3VGTA 3J80U 3KUGA 1VI7A 1S0OA 2Z58B 5GMEA 3LAKA 1NDCA 1R7IA 1KKHA 3RBDA 1T3NA 3UDEA 1AW0A 4LBHA 3F73A 1N8RT 2WAQD 4OV6A 1NDLA 3A1YG 1NH7A 4B3OB 3H40A 3NAIA 3SSSA 1B0TA 2VDHA 3P8BB 4NYOA 3PYEA 3EDRB 2MKJA 2KZZA 1CG2A 4WXOA 2ZKTA 4KIAA 3IRXB 5DM7Q 1LWEA 2HK2A 3PW2A 3KHHA 4JI2J 4USIA 3PW4A 3TAPA 1QUPA 2CG8A 2G0CA 2HPUA 4XPCA 2VBYA 1YDLA 5ETKA 1DAXA 3NBPB 1FNMA 3NEKA 4A8QA 3EGVA 2YQ3A 2R2SA 2KKHA 4J9LA 2ACYA 3RAQA 3RU0A 3T19A 2ZVSA 3TANA 1F3VA 3UQSA 4DUTA 2LEBA 1Y3JA 1NKEA 2P2CB 4NI2B 3PJ9A 4PXEA 2V8VA 3PJWA 1FXRA 4DR2J 4Q8EA 4L74A 4JP8A 2JFKA 3KLHB 2R42A 5KG2A 5HSPA 5A8WB 1UVMA 1S76D 2XCAA 1YJNS 2PGCA 2V94A 1KONA 2W9BB 1Q7LB 1VK3A 5GAEI 4ZVGA 1XNRF 1HNXJ 3D28A 1TFYA 1VFJA 3JAMY 4Q43A 3S01A 4CRJA 4FP9A 2H65B 4PCQA 1YRTA 5E7OB 2GQ2A 3F0NA 1KFSA 2DHHA 2ZH3A 3TX0A 2GW8A 4YQWA 5IT4A 1PSDA 2RDIA 3M8QA 3BEGB 5KFOA 2M3DA 2UV8G 1RT3B 2R8KA 3GCXP 2ZOGA 2HNDB 1V5VA 3LP2A 4KQZA 3KG4A 2CKWA 2NSBA 2A1BA 2WOMA 2IYIA 4QYZJ 4XDDA 3ZO7A 3MXHP 5D0GA 5J2PA 4KGKA 3DKDA 4KHPF 2W2MP 2OMLA 3C3LA 3CC4S 2HFOA 3J7A1 3LGNA 1ZA1B 1WHYA 3KMSA 5KG7A 2FJAB 2CQPA 1EP4B 3X3UA 4DDFA 1QSYA 1UFWA 3HHDA 1G1XA 1CJUA 3R97A 3ENWA 2AIRB 1VQMS 1M5SA 5K8NA 1YJWS 4M5GA 1U2FA 4Q7AA 2CWKA 4IQMA 5HQMA 3OJSA 2ZH1A 2QFIA 1U6BA 4ED8A 2V2QA 1GX5A 3BBBA 2WSFC 2HW3A 3KJQB 3C19A 3FBEA 4EO8A 4DI6A 2NXCA 3ELHA 5L39A 4KFBA 3ZZOA 2QL7B 2DHAA 2UU9J 5EWFA 2Y1JA 2DKOB 4JV5F 3R8YA 5K5MA 5GADI 4IOBA 1A6LA 4DSFA 1RUSA 4OV1A 1UWAA 4LF4F 2RSQA 1FE0A 4ED2A 1R89A 1AZSB 4QWBA 5KFMA 5BXIA 2ZUAA 4A46A 1UAWA 5ETRA 4U95A 4RR5A 2HHUA 4D3GA 4LRBA 3W8PA 3BH6B 3SFGA 5C42B 1W26A 2CADA 1MG7A 5HBMB 1R8HA 2Q79A 4PUOA 1V6HA 1YJTA 1V3SA 2JVRA 4HKQA 2QGFB 2CPIA 2DHGA 2UXCF 5HVHA 4ZK7M 4O3NA 1UFLA 2Z30B 4HL9A 3DMJA 4CH1A 4USTA 3OLBA 1K44A 3DYAA 4ICLA 3M4XA 3G6YA 4ELVA 3LANA 2KXNB 1Z2LA 4NXMF 1NLKL 1Q8KA 2W9CA 1LWFA 2R8HA 4FS2A 1UEVA 1S0VA 5DS7A 1GT8A 2DYAA 2RUGA 2J76E 2X1GA 2ZKUA 5C25B 3SFUA 4EUVA 1ZS6A 1RWVB 1F5CA 1FWPA 1PO6A 1UPMB 4R25A 2ZH6A 2E9TA 2F8EX 2IYGA 3V4IB 1S12A 3ILJA 1MWYA 3RRKA 3PKYA 1H6KX 1JLFB 2CQ2A 4O3QA 4OLPA 2UUWA 1Q78A 3L3CA 3BQ1A 2DCUB 2XEXA 1S1VB 3J7ZT 3BQ2A 3GMGA 3QRPA 2AEJA 2BXJA 6AT1B 2GIQA 5HJXA 2AJQA 3KLEA 1X60A 3NKYA 1MMNA 5E33A 1HQ2A 2PE8A 1FE4A 1BC6A 4BC7A 4LF9J 1FD2A 2MJNA 4R8UB 1JNRB 1U4BA 1JLGA 2DH9A 2HEKA 4PG5A 3C8YA 4B3RJ 2ZHAA 2B6AB 2MZRA 3NMRA 2JZ5A 4NLUA 1IBMJ 2VQFJ 4ZPDA 4QYRA 3D67A 2CZ9A 3CD0A 3KDOA 3ET6B 4FKXA 1Y00A 2OPQA 3PYDA 2I5JB 3DLGB 3IGNA 3EVOA 4P71A 1RAAB 3SQGA 2A2CA 4E98A 2KVIA 1WDDA 2EFGA 1BMQB 4RUBA 2UVVA 1S72S 3HLUA 2B9XA 1AT1B 4OYOA 3LP0B 1TK0A 3W60A 2Z0GA 4DF8A 1WC6A 3KMQA 4GKJJ 5U47A 3CO9A 2FDNA 2W7PA 1WOSA 2EWHA 3J7AN 1X0FA 2KYZA 3CCQS 1WEZA 4QU7A 3CULA 2W4CA 1SIWB 3KDNA 1RYRA 1WORA 2K1RB 5DG9A 3FKBA 3KLGB 3W2VB 4DN9A 3G6ES 5B0CA 4L3KA 2IJNA 5EX3A 2HNYA 2JLFA 2KG0A 3F41A 2GNKA 2MQPA 2OPRA 2D3ZA 5KFDA 2DNGA 3AOAA 4HT7A 2K06A 3QPIA 1LFWA 2DO4A 1NSQA 3KK3A 2VASA 4EI2A 4O44B 2ZH4A 4YB5A 4DV4J 4KV8A 3TA1A 4OJGA 2APOA 2XI3A 4PZVA 3T3FA 3DU5A 2DISA 3DRSB 4DR5J 4C3KA 4JI6F 4J7CA 2EW9A 1KP6A 3K5MA 2DGOA 3TAMB 1OYEA 2ERRA 1U2CA 3FK4A 1TKZA 3N79A 2QV6A 3HHLC 3I9ZA 1NU4A 2CQIA 4IH5A 4JI3J 4BBYA 2GQCA 2BE2A 2KXHA 9RUBA 5KFGA 4MH8A 3PDNA 4GKKF 1OPZA 2ZDPA 1JMTA 4DR6F 1RT1B 1KHVA 3KKFA 5AXKA 5ETLA 4EZ6A 3DGVA 4OMFG 2V8HA 1JXEA 1HBMA 2B9EA 1LWXA 1PBUA 4RW6B 2NXEA 2XGQA 4C3MA 2KVQE 1BE4A 2ATLA 3AQPA 4QIWD 2QLWA 2ZBCA 2W7AA 3MMBA 1VC5A 3SDEB 4HHJA 3ISND 2N3LA 1AYEA 3TJ8A 2GMLA 2IDLA 5KG0A 2CWXA 1X9SA 5DO2A 3S1TA 4LF6J 2BR0A 1FRHA 4TN2A 1HBUB 2J7KA 3JSMB 1U47A 2V69A 1YHQS 3BKTA 1CJTA 4CLWA 2FJEB 2V2KA 2MPUA 1S1WA 3KK1A 5D3GB 4OL8A 3VAMA 4K59A 3I55S 1JNZB 4MMOA 2GMJA 2ZM6F 4HHHA 1GMWD 1YQHA 5SUHA 3HZGA 1DTTB 3H5UA 2B8QA 4YN3B 2VB6A 3TUZC 5GAGU 2HGMA 1GEHA 3BSNA 5DETA 1WEXA 4KT0C 2AW0A 4OZ3A 4I69A 3PM9A 2GVDA 3CCES 5DZ6A 1UZDA 3IS9B 3ZNJ1 2BKPA 5F9NA 1X4DA 1CJVB 4DXLA 3N9UC 2RRAA 1HW9A 4DV7J 3UCUP 1L3TA 4H4KC 4NZ7A 1RT2B 3H0PA 3BO3A 2MHNA 4C8LA 4HTIA 3R27A 2WSEC 4NLWA 4I0WA 2R7TA 3ZZUA 2YNIB 2DEJA 1TVRB 4OQJA 3CCMS 2O5DA 2R8IA 4J9NA 2KYXA 2EG1A 2XMJA 4P73A 5IM0A 2FLOA 4Y3CA 3UN3A 4URQU 3PTWA 1OIAA 1VQYA 4WJBA 5D0RA 3CO0P 2K2PA 4Y6IA 4N5SA 3FEXB 2VQEF 2CPJA 3VCDA 3GR1A 3TRGA 2VHGA 3JSBA 2HRTA 2XBPA 4LF2A 2J7UA 1QM9A 1FKOB 2OH2A 2ZH9A 2CRLA 3NG8A 5M2PA 3GJSB 3MMAA 2AP6A 2PO4A 2O3DA 1F9FA 3TZXA 4MIWA 5IZHA 1U02A 4LFCJ 5DM6Q 1UA0A 3DOLB 3C14B 2Q1LA 1XN9A 1QY7A 1S1XA 1MN7A 2BZ2A 4P52A 2HZVA 2HFVA 1KOHA 3Q24A 4DSLA 4D3HA 1ZBTA 1S9EB 1Q5YA 4OFZA 3CD6S 1CPZA 2VONA 3QJPA 1NHUA 2C3OA 2C3MA 5K8PA 2AYGA 4C9DA 2ZBIA 4F3QA 2E9RX 4PQAA 2CQ1A 1OPIA 1I3OB 4KGZB 5KFAA 9ATCB 4QOTA 1U1KA 1OMSA 1VQPS 3UDCA 4AL6A 3R5BA 2Q3PA 3ILLA 4B3TF 3CJ3A 3CD7A 3FC9A 3MPWA 3K5LA 4YDDB 4CYUB 2KFZA 3H5XA 3SXLA 1FFGB 4DQSA 2OEKA 2VH7A 2LKZA 2Y0SD 3K17A 3H4BA 4UQTA 4G1QB 1TAQA 3DM2B 1BQMA 4QR2A 5CHCB 3PG9A 5KFIA 3CB4A 3TVYA 3LOUA 5KG3A 5LXRA 4PQUA 2JHEA 2L41A 3Q83A 3Q86A 3U1NA 1RAOA 4RW4A 1OO0B 4CLYA 3MFIA 2IC3A 2OAUA 1HWKA 2B0GA 3M8PA 1P9QC 2RMLA 3Q8UA 2CFXA 4I68A 1K47A 3GSIA 1J5EJ 2HHSA 4J9QA 3AH6A 4ZIVA 4FF2A 4OZ5A 3OTOJ 3OQ2A 5J2MB 2U2FA 1M5HA 4ED1A 3JB9k 4GMKA 3I31A 1B70B 1HARA 3UD5A 3SZ2A 5KAKA 5ETPA 4KBIA 5T14A 1UW4A 1RT3A 3OD2A 4FYVB 3R3TA 5F8HA 2HQ3A 3SIPB 1K0TA 2ZDOA 3QT5A 2BA9A 5IOLA 3M2RA 3CF5Q 5B09A 3OFFA 1DTQA 2N82B 2AYEA 2BE7D 4IFYB 1VMBA 3OXLA 3W5YA 2RDDA 1IM6A 3H4DA 2VD3A 1TMMA 2G1DA 3M7VA 3PR5B 2N7YA 1LQ9A 4L3NA 1F2HA 4DCJB 2M70A 3LWLA 2W25A 3B82A 4Y00A 2HBZB 3DHWC 3RJMB 2W1BA 1U1QA 1RWOB 4K4SA 3DGPA 4YUDA 2BQ3A 1NSAA 3R2DJ 1U8SA 2MY7A 1DQ8A 5FIIA 3LALA 2VG6A 4ANEA 4B9SA 5FLXY 4CT9A 4P6QA 2N3OA 5MLCV 1VCTA 8AT1B 4X4OA 4F50A 1OY9A 5E0OA 4WFAQ 3QSIA 1UJ6A 1XNQJ 8ATCB 1VQ8S 1XMBA 1MMDA 4NE9C 3DXBA 5KG5A 4KTQA 3KLVA 4CO4A 3G86A 3PO4A 5KFVA 3TEHB 1D3WA 1WC5A 1L3VA 2B5JB 1KR4A 2VFUA 1SL0A 2AGPA 2NR0A 5AXNA 2H3EB 4KKOB 2M4MA 3KHGA 4DMZA 3THVA 3LPYA 3KYLA 4I2PB 4NWBA 3KLFB 1AZSA 1RWXB 4IG0A 3W9JA 4C8NA 3HDSA 2DRBA 1EKRA 1YBAA 3BBFA 2KFYA 4OYPA 1F2GA 4N47A 3LW5C 3FVYA 2YWWA 3OUYB 1RYSA 4C97A 1S10A 3PRVA 3V6JA 1S7HA 3MM6A 1TUWA 1HFEL 4V1Ak 1IKXA 4B3SF 3FSXA 3TZWA 5C24B 1VRTB 1YG0A 3W64A 5DDPC 5IV3A 4JI0F 3D1OA 5BR8J 2EG2A 2R7XA 3MMJA 2YTCA 1PJ5A 3FRZA 2YY3A 2B3TB 4AXIA 3GFYA 4DV6F 2HHVA 4NLDA 2KZMA 2AZ3A 2YKMA 4PWWA 1Q86T 4PRFA 2OD6A 2J6SA 1PG5B 1AFIA 2CVIA 4BHQA 4PPZA 1UKUA 4BDPA 5L1KA 2FHJA 2CPDA 4AE5A 1GQEA 2G13A 1X5SA 5T7LA 2RDJA 3TO8A 2DCLA 4M63A 2YBVA 2VL1A 1G6BA 2VC0A 2XMKA 2Y0BB 4DV2J 5JVGQ 2NUUG 3R5JB 2BJDA 1RXOB 1QVGR 3HHNB 4USJC 2Y8YA 4TU9A 5LSRA 4JV0A 1RI7A 2R7VA 3L09A 4WZQA 3QBCA 4ZP8A 2EBEA 2ZEJA 3NLCA 1W7WA 2ZZTA 2B4UA 1KWMA 5KFSA 3RB6A 1KHWA 2OUGA 1HQUA 2KL8A 4H4MB 1I1GA 3E01B 4DS5A 2BACA 1JWWA 2GJFA 3D0HE 2UUBF 1Q81T 4DV1J 1BHNA 3OSNA 5KFWA 4MKVA 2F63A 4LREA 3UCZP 3CJQA 2CG4A 1JK9B 1CQMA 4O4GA 5HMZA 3CTRA 3TQ1A 3ET6A 1IJFB 4ZP9A 1J27A 2JH3A 1SQFA 2R4FA 3VGUA 1CBKA 4HTJA 3IO1A 4ED4A 1SJ4P 1RA7A 1ZM2A 2W2NP 3M1VB 2IM0A 3BREA 2LQJA 4ZCIA 2HQDA 3FGVA 1U6FA 4DQPA 1KDNA 4AYBD 1DLOA 4K5SA 1UVKA 3ZZPA 2VU5A 4C48A 2VKZG 4JI1J 5B7WA 1YGYA 2DXEA 1T0TV 5J2NA 2VA2A 3I0RB 1CULB 1UVLA 4GC7A 1B4SA 5A8KA 3KLGA 2WVBA 4IOAQ 3DLHA 4KH1B 4J90A 1LFPA 3E3XA 4ZVPB 4O3PA 2AYBA 5C2CA 3BGRB 4OJHA 1SH2A 4R0EA 3WHIA 2DITA 4IRCA 5HP1A 1TELA 1Y5LB 4M5MA 3KLIB 3K59A 3UDLA 1HR0J 1ZAXA 3JTOA 4DZDA 2E29A 3Q8SB 3MM9B 1OY8A 1VLYA 1IWGA 3W9IA 2XG8A 2IJFA 1R8PA 2E5LF 1JKHA 1SIZA 2Y8WA 2MKYA 1S9FA 2CNNB 2RVJA 3RBZA 1R43A 2J8AA 3M9NB 3C15A 1WD6A 4CQ1A 1RHQB 1IQZA 2V2VA 4H4OA 4JI5F 1WHXA 5K8OA 1REGX 4K2JA 1UFKA 3MI7X 4FS1A 5CCMA 4F4YA 1U2RA 3W5XA 3IN5A 1P27B 4K4XA 2MYFA 4DCPB 3C6UA 4M1KA 3VVTA 1CC8A 4KO0B 3PX0A 3EJMA 1I51B 3BDEA 4ES2A 1X0PA 2RAQA 2JL9A 2R2UA 2MSSA 3J81Y 4CLTA 1PGZA 4P7TA 3CVKA 5I3QA 2O1PA 1CS4A 4B9LA 3SBMA 3QO9B 3VGVA 5A0YA 4X66F 3LP1B 4YY3F 1FXDA 4RUCA 2X1BA 1FDDA 3O6QA 4DS4A 4DUZF 2R7OA 3HK2A 2WW4A 3VR1A 3HSDA 1XQIA 5HMYA 3NGTA 2GJIA 3DOMB 1HNWF 4L6V3 1QAJA 1IXKA 1YLXA 2FTRA 2JRSA 3D0IE 3KFWX 4QBUA 2VKRA 2XWYA 1SC6A 2MMYA 4FYWB 2ZZMA 2Z8QA 3GYNA 2FVSA 4YR3A 4B9TA 1NNDA 2CQ3A 4DV5F 1N48A 3BB5A 3CJSA 1VBXA 3H90A 5DLGA 3A4TA 3D9BA 1SUQB 1HI8A 4FZVA 3QRQA 2FJWA 4X4UA 3G6VA 5HI7A 2DGQA 1VS3A 1KFDA 2XHCA 4ECTA 2W2QP 2AD9A 1VQ6S 1WKLA 2X1AA 1TL7A 2V8GA 4MK9A 4GO7X 3BJYA 3O1LA 4RL1A 3G4SS 3BPSP 5GAHU 4ZLNA 2I0XA 1AUDA 4HEA9 2RJZA 1NH8A 1FDNA 2F4FA 4DOZA 4C8KA 1RT2A 3R7SB 1T9VA 2GVZA 5CQGA 1C0UA 3T1YJ 3R5GA 2FGCA 2NCKL 2OIHA 3Q89A 2PSZA 4XPEA 1FVSA 4DR1F 3MECB 3MCNA 5KFRA 3ZNUA 2AV5A 3IRWP 4W4MA 2HMIB 3J7YI 2F1FA 4MIBA 3V6DB 3GFZA 3S8SA 4I1TA 2UUTA 2OD4A 2A18A 3EPIA 4LJMA 4DSJA 4OZLA 3FFIA 5F8IA 3ULHA 2WVDA 1UETA 2JEGA 3B8HA 1C2PA 4K4VA 1SJ1A 4YS2A 4WTYA 5DG7A 4RW7B 3QJJA 3CCLS 4PAAA 4JI4F 1K0VA 5IT9Y 3M2VA 2Z2MA 5KT6A 3V81A 1VC6A 1K9MT 4KB7A 3M30B 4NX9A 1T9XA 5B0GA 1HYSB 2HHHF 1VQ7S 4OZ1A 2VG5B 3CMQA 1LW0A 1WC4A 3BN7A 2OPPA 2I1RA 1T11A 2EKYA 4U7UK 2QA1A 1Z2ZA 2W01A 3OHBA 4JI8F 4QWEA 1NZ8A 1BY9A 4DJBA 3VV2B 3IR7B 4TQSA 3AXMA 2XYPB 3U1MA 1B7YB 4IDKA 1FX2A 1XR5A 4ZJOA 3SCLE 5IT0A 3CNQP 4U7CA 7FDRA 4S0MA 1QE1A 5I3PA 2M0GB 2HGLA 3VZHA 4LF7F 3EXYA 3W66A 1N5YA 1UZHA 3DM2A 2OKQA 2V0NA 1MU2A 1LWEB 2F40A 1NCLA 3RRGA 2DNOA 1XMOF 1NSPA 2XHWA 2AKWB 2HYIB 3CIZA 2YNGA 1NB7A 1RABB 1TAUA 1H38A 3MTKA 4P74A 3C16A 4KGXB 1I94F 2VFSA 1TR0A 1RTHA 2W2PP 3UD4P 4DWIA 2CPEA 4F26A 3K0JA 3SYZA 4FVMA 2E1PA 1Q0NA 4DQIA 2EI5A 1VBYA 3DDIA 1RAHB 2XZDB 4FF3A 1XK8A 4UY85 4DL6A 1SC1B 3TZZA 1D09B 2V5HG 2ZOFA 4ES1A 3NOGA 5L46A 1VIOA 2V6AA 2CJYB 4F0MA 1HNVA 1EJ7L 2ZNZA 4I7FA 2V50A 1U25A 1QVFR 1TFWA 1RBLA 3QGGA 1XNRJ 3FBBA 3POTA 1R3NA 1GX6A 1RAGB 3MURP 4Q0BA 1TL4A 2QLJB 5SZTA 4TY9A 2CQGA 4KHMA 2ZH8A 2KB2A 2BW2A 3WDOA 1RBOB 1S77D 4ECXA 5KOXA 5KT3A 1IBCB 1EQMA 4F25A 5LMNF 2W8KA 2XSFA 1MWQA 1N5TA 3M8QB 1N36F 2QA4S 1RLCL 3THPA 2CNOB 2AEFA 2MGZA 1ITPA 3GR0A 4IR9A 1Q82T 4YP3A 2GHWA 5E3AA 4CM2A 1T9TA 1RCOB 1RT7B 1R6VA 2EC0A 3I5CA 1FJ7A 4KHPJ 2W7OA 5J2PB 4ED5A 5K8MA 1OSCA 1FEHA 1OS5A 3A8KA 4WU3A 1H72C 2CQBA 3CC7S 4WCEQ 1KVIA 3CCZA 5FDLA 3MM5B 2HBYB 2DGXA 2AX0A 3TJAA 1EZZB 5CZVA 4ELUA 5BYRA 4DSEA 4C2MA 4NXNF 1N4LA 4LR8A 2NZCA 1P9YA 4IUFA 3R7NB 2XY6A 4KGVB 4ZPBA 3CUNA 1GNKA 2W4PA 3KLFA 3UWTA 1GTEA 4M94A 3GPAA 4RNFA 1YWXA 3TW0A 4LRFA 3CCUS 4DFKA 4DR3F 3TVZA 2WCXA 1RB0A 1X5OA 3JAMU 4P75A 4LSNA 1FCAA 1H2VZ 2KT2A 1PILA 4P7VA 3VHQA 1AFJA 3CXCR 4ZVEA 2C2MB 1U24A 4JI7F 2DNQA 3G87A 3EZ5A 1JIHA 4ECQA 4KFBB 1HA1A 3CJTA 4GO5X 2G2OA 2OFHX 4JV5J 1YRUA 2YX1A 4WWSA 1N56A 3EGWB 4DPXA 1Q8BA 3BGFA 4LF4J 2SXLA 5AXMA 2RU9A 3W2WA 1UCNA 2QLFB 3RW6A 1M1HA 4IQXA 3AJDA 4K2XA 1RZMA 1U1OA 1PCAA 4UUXA 5KT2A 1UJ4A 1VBKA 3AFGA 4UOHA 1QAXA 2GHPA 1NKBA 1HIYA 1OJ4A 4F8RA 4MFBB 3JYTA 1TK8A 5D0EA 5B0AA 2M7SA 4PUOB 4FYXB 2UXCJ 3LO3A 4NEZA 4NLQA 1QDUB 5KFPA 2MQNA 3MUMP
chains in the Genus database with same CATH topology
3NNAA 4PWDA 4X4PA 3T5HA 2HNYA 2JLFA 2MGZB 3VAJA 3DYAB 3UNGC 2KG0A 3GB0A 3F41A 1F5BA 2GNKA 2MQPA 2IMWP 4OZJA 3DDKA 4ICLB 1OQ3A 2OPRA 2D3ZA 4ZHRA 1FO1A 2DNGA 5KFDA 2LQ5A 3X1LB 1TV6A 4DV7F 2XO7A 2UUAF 3TP2A 3KNGA 4HT7A 4TLRA 4K4YA 1JJHA 2CDQA 2VG7A 1LFWA 3QPIA 1RQ0A 1RT4B 2B4PA 2W9CB 1LWFB 2DO4A 2QMXA 2AYMA 3MPVA 3KK3A 3NCPA 2DGSA 2VASA 4DBQA 1MWZA 4A8OA 4O3SA 3MOZA 2E5GA 4ILLA 1S49A 4HH0A 1N0VC 1HNIB 4O44B 2HVIA 1AROP 1R8BA 2ZH4A 2YNIA 4YB5A 5J1NA 3Q2TC 1TVRA 4IG3A 1FF2A 3MFHA 3OSPA 1X8DA 4KV8A 3TA1A 4OJGA 2APOA 2QLXA 4Z37A 2DIUA 3M6VA 1E6VB 4ZVHA 2XI3A 4WFNQ 2KH9A 3T3FA 5FDLB 4WIIA 4RNHA 4HVZA 3DHXA 3DU5A 5J1PA 5F3TA 2MZJA 4CH0S 1MSWD 2FLNA 2DISA 3DRSB 5L8RC 4DLGA 4ED7A 4C3KA 4JI6F 2ZH5A 1H0HB 4PG8A 1REVA 2EW9A 4EO6A 3K5MA 3PIPQ 5A8RB 4NLXA 2DGOA 3TAMB 2BABA 2DHSA 1S6PB 2YKNA 2X1FA 1U49A 2ERRA 1NKCA 4EZ9A 2AJ4A 2RS8A 4I6AA 4PR6A 1TKZA 1S4FA 2EFQA 3N28A 1Q8IA 3IG1A 3N79A 1U7LA 1LXNA 1UVNA 4X4QA 4CT8A 3HMJG 1S0MA 4JUZA 1RKIA 5GAHI 3I32A 5IWAF 2OTLS 1FKOA 1SL2A 2FJXA 2O66A 2QV6A 3HHLC 3I9ZA 5THWA 2MHEA 5KT4A 4ED3A 2DR7A 2C22A 1NU4A 4EU0A 2CQIA 2VUGA 2VPYB 3SI8A 1N6QA 3IWXA 4IH5A 5J2QA 2HFZA 4K5RA 4FF1A 3P5TL 4BBYA 2GQCA 4K4TA 2BE2A 1VQ9S 3H8YA 2KXHA 2MQQA 3KLEB 3AJ1A 2LDIA 5KFGA 2AJ0A 4MH8A 4YR2A 3PDNA 1D9FA 4GKKF 4LSNB 1QAIA 1OPZA 4PXCA 2ZDPA 1VRUA 2M88A 1RTJA 1JMTA 4DR6F 1RT1B 3FEYB 3N6MA 3OV7A 3DOLA 4LFCF 2LXFA 5D78A 1KHVA 5CYQB 2J9CA 1FJEB 2KDOA 1ZM9A 3KKFA 3MEKA 4LVOP 5AXKA 1BD6A 2NLWA 4EZ6A 4XAKA 1JLQA 4OMFG 2V8HA 1JXEA 2LQ9A 1HBMA 3FMBA 2RF2A 4RW6B 1UEUA 2XGQA 1S6UA 2CJAA 4USHA 4C3MA 4O0IA 4C7QA 4DFMA 2MKSA 1NRKA 4N76A 4RW9B 2RH3A 3AQPA 1TL3A 2ATLA 3I0RA 5HROA 2P9CA 3AB4B 4QIWD 1S9EA 2QLWA 2ZBCA 5EWEA 2W7AA 3MMBA 4RUAA 1VC5A 5F3ZA 4FVCA 3IAS9 3SDEB 4A8YA 4HHJA 5LJ3Y 3ISND 1JLAB 2N3LA 3HKWA 3MM8A 1S48A 2GMLA 3EPGA 4TYBA 5DGAA 1P1LA 5KG0A 4MK7A 3IR6B 3EUNA 3WX4A 3FEZA 2C3PA 3M6WA 4KAIA 4MTPA 2RS2A 1X9SA 4OHYA 2QIFA 2OPQB 4DN0A 2ZJPQ 5DO2A 3S1TA 2BR0A 1FRHA 1HD0A 1Q16B 2Z2LA 4TN2A 4YMEA 3RR8A 1HBUB 2Z4PA 2J7KA 2UV8A 4I4BA 2ZE2A 4RZRA 3JSMB 3PIOQ 1Q1KA 3W2WB 1U47A 2CIMA 3FRYA 4OHWA 2WHOA 2IAJB 1GXLA 4I2QB 3CJKA 3SQGB 4AQYF 3PV8A 2BRKA 1YHQS 1DFDA 3IBWA 3K5OA 4M8LA 2PI4A 1QLNA 4WE1A 2FJEB 3H98A 4PPDA 1RTIA 4K0KF 2V2KA 1KRPA 2MPUA 3G6XA 1N5QA 2UVWA 1S1WA 3KK1A 4DLEA 5JXSA 5D3GB 2G4BA 3SV3A 2CVEA 4OL8A 1JLEB 3VAMA 3DLBA 4K59A 1E6YA 3I55S 4FNHA 2DK2A 1TKXA 1JNZB 4DUYF 1HI1A 4MMOA 1S97A 2GMJA 1S0NA 2ZM6F 3PJXA 3HKZD 1T05B 2PEHA 3ZZTA 2KHDA 4NOHA 1YQHA 2PDAA 3MPYA 5SUHA 3T9NA 3HZGA 3CIMA 1H2TZ 3MUVP 1DQ9A 1DTTB 1WELA 2XGPA 2FHOB 4PXDA 1SV5A 2ILYA 2V9KA 3JYTB 4MKYA 3H5UA 4J9OA 3I0SA 3DRRA 4G1QA 2VB6A 3TUZC 4QU6A 2YNHA 3CCWA 3R5CA 2CYYA 2C42A 1WF2A 4CO0A 1JXLA 2QYCA 3CDBA 5GAGU 2HGMA 2BM1A 2BVZA 3VALA 2D3OR 2R9LA 4LUBA 3BSNA 3FZ2A 5DETA 1WEXA 2XMMA 4KT0C 2AW0A 5HN0A 2HHWA 2B7BB 3GZ7A 3G8SA 4I69A 3PM9A 1BQNA 3DC2A 1X7VA 3CCES 3DI6B 5DLFA 4G3IA 2CQ0A 2YNFA 3N5FA 3IS9B 3SCKE 2QT7A 5F9NA 5KFUA 1X4DA 2DNYA 3UI3A 2L9NA 1FEEA 3PVXA 3DU6A 3N9UC 2HNYB 2RRAA 4ETZA 3HM9A 1HW9A 3QJLA 1N32F 4AL7A 1O51A 2V9WA 5B08A 3UCUP 2OPRB 4ZHRB 1D9DA 4NCBA 4J9MA 1L3TA 2MKIA 1NK6A 4H4KC 1LW2A 4NZ7A 2VODA 2CJ9A 1RT2B 2VG7B 3BO3A 2MHNA 4C8LA 4HTIA 2ILZA 1G3OA 3R27A 2DTJA 5KFCA 4QW9A 1J5EF 1IBKF 2BOPA 3SV4A 5J2MA 2WSEC 3CSKA 4NLWA 4WYWA 2IVYA 4I0WA 3KK3B 3OTOF 2R8JA 3CJ2A 1T94A 4LIWA 2R7TA 3HJFA 2DNLA 2J9DE 3M05A 3ZZUA 4O3RA 2YNIB 2VQFF 3TI0A 1TVRB 4IG3B 3HHLD 4IRDA 1ZPVA 4KV8B 4OQJA 3CCMS 3TNVA 4ZP7A 3PRBA 2O5DA 1ZZFA 1WNEA 2HS3A 4FN5A 3G8QA 3PEHA 2IHR1 2LEAA 2KYXA 2EG1A 3QWUA 2R8IA 4J9NA 2XMJA 5IM0A 3VAIA 3CD5A 5GAGI 2FLOA 4UW2A 2P6TA 2VPZB 4Y3CA 5EHHA 5LSLA 1HWJA 4RNMA 2GA7A 2EFPA 2L08A 4URQU 3VZIA 1OIAA 1VQYA 4WJBA 1KVJA 5ITHA 1W25A 1YI2S 5DQHA 2K2PA 2YKNB 1UA1A 2DNRA 4RBTA 2ADBA 4Y6IA 4N5SA 1X4BA 5HMWA 3FEXB 2XCPA 2O67A 1U1NA 4YB1P 2VQEF 2CPJA 3VCDA 3VAGA 1TKZB 3GR1A 5F8NA 2MZSA 3I4HX 3TRGA 3IG1B 3JSBA 4IO9Q 2UXDF 1HHSA 2HQIA 2XBPA 2FUG9 2J7UA 1QM9A 2F3JA 4BWMA 1FKOB 3QZ7A 3F44A 2FHJD 3O2IA 2GGPA 2KXFA 2XMUA 4NCGA 5DQIA 4I6YA 1NEEA 2ZH9A 2ASDA 2OH2A 2CRLA 2X3GA 5L1JA 4IFYA 3PHEA 3U27A 3NG8A 3UR3C 4AXJA 5M2PA 3M6UA 4DFPA 3MMAA 2AP6A 2PO4A 3GIIA 4DQQA 1N6QB 4M5DA 2O3DA 3MR2A 5J2QB 1F9FA 1TKTA 4OI4A 1BQXA 1XR6A 2VFTA 3O5TB 3O8WA 4NLOA 5JVHQ 1L3UA 3TYTA 4MIWA 2BE2B 4ZDNA 3AB2B 3H25A 5DJBA 4J9PA 1SH0A 4ILMA 2E7WA 1S1TB 4LVNP 2M2BA 3ICLA 5IZHA 1V9OA 1VRUB 5DM6Q 1O5JA 1UA0A 1S9GA 1KC8T 2YH1A 3DOLB 2ZHOA 4EYHB 1N5SA 2LECA 1T95A 2Q1LA 1XN9A 2XMTA 1QY7A 1S1XA 3I4PA 2BZ2A 3IAM9 3MHYA 5L9NA 1SKWA 1KQGB 1UWBA 2WB4A 1JLQB 3ZFVA 2IBKA 2J9EA 3U02A 2YVSA 1KOHA 1HBMB 2RF2B 4NRUA 3Q24A 2VBWA 3BS9A 5I3UA