3Q2SC

Crystal structure of cfim68 rrm/cfim25 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPVNKQFLSQFEMQSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Human Cleavage Factor CFI(m)25/CFI(m)68/RNA Complex Provides an Insight into Poly(A) Site Recognition and RNA Looping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
total genus 17
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3q2sC00
2MXYA 2B0GA 5LXYA 3HHNB 3UE2A 5D78A 2I38A 3Q2SC 1L3KA 5GMKa 3UCGA 3EGZA 1WI8A 3K0JA 2MZQA 4F02A 1XN9A 2SXLA 2X1AA 2CQBA 2ZJPQ 3L3CA 2KG0A 3SDEA 2HZCA 3CCJS 3VAKA 3MUVP 2LXIA 3EX7B 1DHMA 2M9KA 4QU7A 2AYEA 2E5JA 2CPXA 2MQMA 3BS9A 2DISA 5GAHU 1OWXA 1DBDA 2M52A 1VQKS 2VODA 2MY7A 3P6YC 2RS2A 3G4SS 1FJCA 3LPYA 1A7GE 2KXFA 1WHWA 2A3JA 5LSLA 1OIAA 3CCES 1QVFR 2U1AA 1S72S 2CPZA 2ERRA 1JMTA 3VAHA 2BZ2A 2F9JA 2KU7A 4M5DB 1WG4A 1NJIT 2HGNA 2NLWA 2MQQA 2DNRA 2OSRA 3DLLQ 1H2TZ 2HGMA 2KM8C 1VQ5S 1DZ5A 3B4DA 5DDPC 2M8DB 3BO4A 2CPDA 3VF0B 2Q79A 2MKCA 2RT3A 3NS6A 3CC2S 2WBRA 3CC7S 4IOAQ 2DNYA 2DNPA 1D8ZA 2F3JA 3NMRA 3CTRA 1U1MA 5BJRA 2J76E 1WEZA 5LXRA 2M0GB 2MMYA 3S01A 3IRWP 3THPA 2N7CA 2U2FA 1VQMS 3VAGA 2CQHA 2FC8A 2XS5A 2DNZA 5DDOC 1UFWA 2AYGA 2X1BA 2E5HA 3U1LA 4PRFA 3JB9k 1U2FA 2KHCA 1U1NA 4ZKAA 3CCSS 2DGVA 1U6FA 1X4CA 3CMES 1FHTA 3MD3A 2LEAA 2KI2A 4WCEQ 1A9NB 1Q81T 4YUDA 2LQ5A 2JX2A 1FNXH 1VQOS 2JVOA 5CYJA 2YH0A 3UD3P 2KG1A 2ZJRQ 2RQCA 5LSOA 1UW4A 1X4EA 2JVRA 5GAGU 1U1KA 3MUMP 3MXHP 2X1GA 5LJ5Y 4QQBA 5ITHA 1Q82T 2G0CA 3PIOQ 2JRSA 1VC6A 3CF5Q 1WEYA 1WTBA 2E44A 1JJ4A 1WF2A 2OSQA 3HI9A 2XS2A 2CQ1A 3SDEB 3D2WA 1FXLA 3RW7A 1YIJS 5JVGQ 3RW6A 1VQ7S 2QEXS 2LMIA 1KQSR 3BEGB 2G4BA 2DGWA 4WFNQ 1H2UX 1WHXA 1M1KT 1YWXA 4WFAQ 2CJKA 4TU7A 4UY8T 2BOPA 1NU4A 2MKKA 1YJNS 2DGSA 3S7RA 4OZ1A 2KRBA 4WFBQ 2DHXA 2K8GA 5HO4A 2MKIA 2VOOA 3VAIA 2MZSA 1UAWA 3CULA 1VBYA 4F26A 2DNGA 2EVZA 2YWKA 1BY9A 2CQDA 2XNQA 3UCZP 4A8XA 2J0SD 2PE8A 4C7QA 2FHOB 2MGZA 1CVJA 3NNHA 1HA1A 5D77A 3H2VE 3SXLA 2DHGA 2KT5A 1X0FA 2DHSA 3S6EA 2QFJA 1O0PA 4OZ0A 2K3KA 3J7ZT 1YHQS 2L9WA 4QPTA 1JJ2R 4RU2A 2KN4A 1X4DA 1X4GA 2DNHA 2MZ1A 4CH1A 5IM0A 1U1LA 1D9AA 2DH9A 3TP2A 3FEXB 2DK2A 2MKSA 2J0QD 5DDQC 2FC9A 2F9DA 3TO8A 1N54B 4CH0S 3CXCR 2ZJQQ 1Q86T 5JVHQ 2MQOA 3MI7X 3BO3A 4IOCQ 1QVGR 1WHYA 2OIHA 3NNAA 3VAMA 2MJNA 4TU9A 2MKHA 2DGQA 3THTA 2N82B 2EK1A 1YITS 2DGOA 2CQCA 3VAFA 1PGZA 2LA6A 3MURP 4C0OC 1HD0A 4C4WA 2CPYA 1WHVA 3UD4P 5IM0B 1DRZA 2MSSA 3ZZYA 1S79A 3FEYB 2CQGA 3CCMS 4EGLA 5DDRC 1K9MT 1B7FA 2CPFA 2YTCA 1N88A 3CCVS 2DH8A 3G96A 3CCUS 2LECA 1W2BR 1WG5A 2M7SA 2OTLS 2CQ0A 3CCQS 4YB1P 2GHPA 2I2YA 2M2BA 1HD1A 4PKDB 2LKZA 5GAEU 2MGZB 2DNLA 4UQTA 1QM9A 4IO9Q 2KXNB 3P49B 2O3DA 3SMZA 1VBXA 2EK6A 4P6QA 1M5KC 2AYBA 1ZZFA 2CPIA 3DXBA 3B4MA 2RU3A 2XB2D 5CXTA 3MOJB 1X5OA 2M88A 2M70A 4CQ1A 3CUNA 2HYIB 1H6KX 3US5A 3S8SA 3G9CA 2DNOA 1FT8A 3EGNA 2QA4S 4Y0FA 2ADBA 2DNQA 3PIPQ 1X4BA 3IWNC 1SJRA 2NZ4A 2D9PA 2LYVA 4U67Q 2VOPA 2KM8B 3CD6S 2MZJA 1WEXA 2XS7A 1WF0A 1U1PA 2DNKA 3P5TL 1G2EA 2YH1A 2DGTA 4FXWA 2KVIA 1X5PA 2DO4A 2AYMA 4TU8A 4WKRA 3R1LA 3CMAS 2DO0A 2GO9A 2LXUA 3LQVA 2RQ4A 1P1TA 5HL7Q 4LIRA 4J5OA 1VQ8S 1K8AT 1M5PC 2CPHA 1YJ9S 4IUFA 2VONA 1U1RA 3P3DA 3TYTA 1RK8A 2M4MA 3N9UC 2CQ3A 2CQ4A 2M8HA 5FJ4A 2DIVA 2E5IA 2N3OA 2MY8A 2D9OA 1U1OA 1VQ4S 2UP1A 3MDFA 1VQ6S 2PEHA 2E5GA 3OW2R 4V19X 2FY1A 2DNMA 2DGUA 3I56S 4TLQA 2CPEA 2MPUA 2AD9A 1JJHA 2DB1A 2V94A 1VC5A 4F25A 2X1FA 2LA4A 1VBZA 3CCLS 3NS5A 1WF1A 1R8PA 2MQNA 4WIIA 1YTYA 2FPHX 1N52B 2RRAA 1OPIA 1WELA 3G8TA 3MUTP 1VQLS 4ERDA 4W92B 2DIUA 2MQLA 1SJ3P 4ED5A 2YKAA 2ADCA 3I55S 1F9FA 2CQIA 2D3OR 1KD1T 1M5VC 5DETA 1X5TA 3MD1A 2KXHA 2L08A 2CPJA 4LJMA 1X4HA 5DM6Q 3G6ES 1ZZNA 3CPWR 1WG1A 1H2VZ 2OTJS 1KOHA 1X4AA 5DM7Q 1NO8A 4FXVA 1KOOA 3R27A 2XNRA 2MYFA 4Y00A 2J8AA 1WWHA 1IQTA 2N3LA 3BO2A 5MLCV 3ULHA 2MQPA 1FO1A 2MB0B 3G71S 4W90B 5LJ3Y 2DITA 2RUGA 1M90T 1FJEB 2LEBA 1URNA 3CCRS 2KRRA 2HGLA 2RRBA 1VQNS 1OO0B 1X5SA 4PR6A 1P27B 2HVZA 3Q2TC 1HL6A 1AUDA 1FJ7A 4YOEA 5H1SV 4LMZA 3G8SA 1SJQA 2RVJA 1U1QA 2KYXA 3NNCA 2MHNA 3UWTA 3VALA 2KFYA 1R8HA 2XSFA 3VAJA 3H2UB 1SXLA 2CQPA 2MZRA 2L41A 1PO6A 3J7YU 4CIOA 1VQPS 2G1DA 1U6BA 2DGXA 1YI2S 5GVQA 1RKJA 2KH9A 1KC8T 2DNNA 3ZZZA 1M5OC 1VQ9S 5CA5A 2MKJA 2OJ3A 2MJUA 1SJFA 2LCWA 3R1HA 2MZTA 1UP1A 3CC4S 2MSTA 1SJ4P 5IFMA 2RNEA 1VC0A 1YJWS 3V4MA 2RS8A 1K73T 1ZH5A 5IQQA 3U1MA 4WF9Q 2DH7A 5GADU 4BS2A 2CQ2A 1X4FA 1N8RT 2DHAA 1WI6A 3UCUP 1Q7YT 4QU6A 5EN1A 4Z2XA 2JWNA
chains in the Genus database with same CATH superfamily
1RE1B 4RW7B 2LU2A 2C3MA 3IBCB 3OTEA 2V2VA 4OZNA 4P7TA 2B0GA 1I51B 5A0YA 4DSEA 2LU1A 3TQEA 4LFBF 4Q7AA 3DRYA 5D78A 1WDTA 1YJUA 4ZHRA 3HFKA 2KZZA 2AJFE 5K5MA 3KK3A 2GHVC 3C66A 4OYXA 3VGTA 2DRBA 3ITHB 3E3XA 4KV8B 3WBZA 4F02A 2NSBA 2GS8A 4OYZA 4DUYF 1FTRA 3D3BJ 3OXLA 4RWWA 5CYMB 3FBFA 4HKQA 5BR8F 2KG0A 3SDEA 4YY3F 4FYXB 3ZZ0A 4NXNJ 1LEOA 4R5PA 4CNZA 4U9RA 4C8NA 1UWBA 2QLFB 3RAMA 3H4DA 3EX7B 3VVUA 5I4MA 2M9KA 4PZVA 2AYEA 4LF7F 3R5DA 5ETNA 4HACA 3M6XA 2CPXA 2GMLA 2KDOA 4KHMA 3BS9A 4UOCA 4A8FA 1MU2A 2QMXA 2ZM6J 4WXWA 1FI4A 4RNMA 2DPJA 4OV1A 1IN0A 2R2RA 1RACB 2VODA 2QN6B 2MY7A 2IC3A 3J80Y 2WVBA 1DARA 3JAMU 3JSMA 1FJCA 1NPRA 3KK1B 2GVZB 4XDDA 2VFVA 4J91A 1LW0A 2C1EB 2PD1A 2A3JA 2BUNA 3FSIA 2ZH1A 1S72S 1RXOB 2IAJB 2XMJA 3X1LB 3MAAA 2FJVA 4USHA 2V9WA 4DR1F 2AGPA 1R0AB 2ZZMA 3FVYA 2YKNB 1BD6A 4DX7A 2UUAJ 2QJ3A 1Z1ZA 3OPKA 1NJIT 1AROP 2NLWA 1HQ2A 1MNEA 2DNRA 4ZPDA 3KUGA 5KFUA 4F2SA 2OSRA 1FFSB 3M6UA 3DLLQ 1H2TZ 2X51A 3J81U 1VQ5S 1FE0A 2XI2A 2GJIA 3B4DA 3M8RA 3PR5B 3HP6A 3T1HJ 1DTQB 3K5MA 2HNZA 2VDIA 2ZFHA 4TY9A 4DS4A 4QYRA 4FBUA 2CPDA 4I6AA 3CT9A 1CJVB 3D0GE 3KDOA 1XMQJ 3OFFA 3BH6B 5CD4H 2Q79A 1K0VA 2GQCA 4GO7X 5HBMA 1G7CB 3SQGB 3M6WA 1CS4A 3JQMA 3NS6A 5HBMB 4Y3CA 1TMMA 2COLA 4NRUA 4OX7A 1GXUA 5DG8A 1S12A 3CC7S 2YXLA 2DNYA 2HS0A 4XDCA 1LXJA 4KQZA 3A3NB 1QY7A 2X3GA 4MH8A 1FD2A 2UVVA 4V19J 3OHBA 1EARA 2A10A 5G0RA 2NUHA 4UOHA 1ZBTA 3SFGA 4HT7A 5K8OA 1C0TB 4CH7A 3Q24A 4F4XA 4JV1A 1VGYA 4L3KA 2ZZTA 4NLDA 1WORA 1WEZA 4NLPA 3AB4B 4JI2F 5LXRA 4FXDA 3S01A 3UDVA 3IRWP 1RWXB 1YZ7A 3ZZUA 1GTEA 4OZ5A 2N7CA 2U2FA 4O44A 3AJ1A 4F3QA 3VAGA 2C28A 4PG4A 2RDJA 3HHKA 1JLCA 3B6BA 3BPSP 4CO2A 3WHIA 1KVJA 4V1Ak 1HNIB 1UFWA 3FCWA 3NY0A 2JSXA 4F0MA 2E7WA 2ZHAA 2VPWB 3GJQB 2W7OA 2E5HA 2FHKA 4JI1J 1C0UB 3U1LA 1YJ7A 4J9MA 1S6OA 1RDRA 3O8WA 1HLWA 2VBWA 4L3NA 5FIIA 4ZCLA 5C25A 3KLEA 2OH2A 2GMJA 5L1JA 2B9EA 3AQPA 4KO0A 2FYXA 5GAGI 3KLGA 1HWUA 4WJBA 5HLFB 4JI5J 4ECTA 4LF8J 2DGVA 3NGUA 4NOHA 4LF9J 2E5LF 1APSA 1YRTA 1SVDA 3M8ZA 4KSEB 3E8OA 4K59A 4AQYJ 1C1CA 1U09A 5ETSA 4X65F 2UXDF 5FDLA 1VISA 1HHTP 4M5LA 2W4DA 1FEEA 5IOLA 1RWNB 2DD8S 3K7RA 1QSYA 3N4WA 5I3UB 1SV5A 1Y5LB 4YUDA 1A9NB 3N5BA 2BJ7A 3QT7A 4QIGA 2LQ5A 4RUAA 1F2GA 1RWMB 3C14B 1VQOS 2L48A 3Q8SB 3D54A 5KFRA 4L6V3 2FVSA 3FBBA 5KFCA 1JLGB 1UCNA 3UD3P 3BM7A 4EBCA 5LSOA 2CJXB 2UVRA 3ADAC 1X4EA 3HZGA 4RX6A 5T14A 2XZWA 3MF5A 5KFMA 2W9CB 2VFSA 2GX8A 2PMHA 5C7PA 1S59A 1U47A 2P2CB 3ETOA 4ZPAA 4XAKA 2EG1A 1RT6A 4C97A 5KFPA 1B0VA 3NWGA 1C0TA 4OYOA 3VCDA 1WTBA 2AF6A 1WTFA 4JBCA 1S0NA 2XC9A 3B8HA 1T05A 1N6QB 4NXMJ 2KHDA 4U96A 5CZVA 1DTTB 2EFQA 4MTPA 5JUMA 1XMOJ 3HI9A 1GMWD 5DLFA 4M5HA 4WZQA 3MM7B 2P9EA 2P5VA 4MJKA 4ZP6A 4ED4A 2CQ1A 2MDAA 2YX4A 2B5JB 3T9ZA 1K0TA 2LFVA 2OPRB 3D2WA 4DI6A 1U0HB 4CLLA 2WTFA 2ZH8A 4DR3F 2QO3A 4MKVA 3MM5A 3DLJA 2R8HA 5F9NA 1KTVA 3OL6A 5JVGQ 4A8YA 3C8YA 4LRBA 4C8YA 1C0UA 1VQ7S 4FN5A 2LMIA 5K14B 5IWAJ 1KQSR 2QEXS 4ER8A 1ACMB 3M8PB 3QGGA 5IV4A 3IG1B 3MR3A 4XTTA 2ZBIA 4WFAQ 4DR5F 4DF8A 1HNXF 2Q66A 2GV1A 3SFUA 2ZOFA 4ILRA 4OZLA 1FCAA 3KJFB 2BOPA 1RT1B 1CEZA 2MLZA 3GILA 3K8WA 2YX1A 1PBUA 1Y9OA 3PYFA 1YJNS 4AT1B 4D3GA 5ETKA 1GH8A 4KPYA 4WYWA 4WFBQ 2WVEA 3JYTA 1S7HA 1RT2A 3PYGA 2EFGA 2NYHA 3QWPA 3SV3A 1JK9B 1VBYA 3FMBA 2CIMA 4K5SA 4F26A 5KFDA 3OSNA 2DNGA 2ZBCA 4C8MA 4YR2A 3WIVA 1BY9A 2H5EA 1UZHA 3C16A 3V6HA 1XBWA 3UCZP 1IBKJ 2IJFA 3FBEA 1RWVB 2FHOB 3AOCA 4I6YA 2Y0SD 1HA1A 2YNFA 3VR1A 3G6VA 4DL2A 3EWGA 5D77A 1NJXA 3QAUA 5LT5A 2KT5A 4X4OA 3GIIA 3EVMA 2GAGC 4AUKA 1NKCA 3TX8A 1P9YA 4KGVB 4IUFA 3S6EA 1FRLA 4OZ0A 1TKXB 2FGOA 5KG5A 2QFJA 3HK2A 2R8GA 3J7ZT 4ES1A 2ZZNA 5HMYA 2B9XA 2L9WA 1CQMA 2VPZB 3MGJA 4RU2A 2MQ8A 2KN4A 1U02A 4DR2J 1X4GA 5BYSA 3GMGA 1S6PA 2LQ8A 3C3LA 3A8IA 1D9AA 2DH9A 3LP2B 3BH7B 3VZIA 4I64A 1AT1B 3FEXB 4P9SA 2W01A 3MM7A 4NMLA 3FKBA 3HMJG 1MW7A 1ZA2B 2QSWA 4OI1A 1N6QA 1PILA 4N7TA 3ONQA 5KG3A 3KYLA 4DSFA 3OVBA 3M8QB 1N54B 1WD6A 5HJXA 4CH0S 3CXCR 4JI6J 4OJGA 1FRXA 2A2DA 1UMJA 1RTJA 2MQOA 3C14A 5JVHQ 1TAQA 2ZM6F 3W1YC 1QVGR 3D67A 1XNQF 3TUIC 4C48A 4NLUA 2MJNA 1R0AA 2HEKA 1SL0A 3BGLA 1YJRA 1NH8A 3UPFA 4B3OB 3N01A 3CSKA 2CQCA 1WNEA 5DJBA 1R89A 2CJYB 2JDJA 4Y2KA 1TKDA 4ETZA 1UJ5A 2LA6A 2X7IA 3FFIB 3M8PA 2C22A 1R6VA 4C4WA 3ILLA 4Y2CA 4U7CA 1ZM3A 1S9GA 2YPYA 1FVQA 3UD4P 3Q8UA 1DRZA 2GNKA 3TVZA 3FEYB 3QGIA 4KGMA 2PSZA 1PYTA 2KL8A 4EGLA 3SEOA 2V5HG 1TP7A 3LH2S 3NP5A 2QSFA 4O3OA 2YVSA 3LAMA 4OHZA 5ADZA 2XY5A 2QMUB 4YB1P 3HXMA 1ZYQA 4ZVSB 3CB4A 4DX6A 3K5OA 1HWLA 2I8EA 4F4WA 5D6GA 1KSPA 3IR5B 1N32J 2RD5C 3OL9A 2DNLA 3MEKA 4KGXB 3W9HA 2FVPA 1UJ6A 5DG9A 3SMZA 1VBXA 2EK6A 2YKMA 1LFWA 3CJQA 1NDPA 5K20B 4QIWD 2XHWA 2CPIA 2HKEA 1AB8A 2UZAA 3DXBA 5J2MA 3BV8A 1AYEA 2JLFA 1S4FA 2XSJB 2YNGA 4F4YA 3I0SA 1UVKA 5GMDA 5C24B 5CXTA 4KAIA 3HLUA 3R5AA 2LEPA 4ZITA 3QIPA 1VHIA 3UDCA 4ENOA 2EKYA 1J2VA 1RTHB 1NCLA 2M88A 3NGSA 2B4UA 3ZTQA 2ZH3A 4EZ6A 2ZE2B 3GYXB 1KONA 1H6KX 1ZA1B 1S48A 2RQMA 1S6PB 5D15A 4NXMF 4PUOB 2YKQA 1FT8A 2P6TA 2HRYA 5KOXA 2G0IA 5I3QA 1SL2A 3QT5A 1T9WA 2IJNA 4ZVTB 5HATA 4F0HA 3DRPB 4X66F 2HRUA 1R8BA 3KUEA 4F4AA 2VDHA 2CNKB 2WRMA 3C6UA 2DNQA 3PIPQ 2YQ3A 1TK0A 2YPZA 1X4BA 2K06A 5HQMA 4L76A 4QWBA 4NX9A 5KFAA 5D4OA 2GCFA 3NGKA 4U7UK 1S0MA 5DG7A 2MZJA 3POTA 1XNRJ 6AT1B 2D3ZA 2GGPB 2XS7A 4AD6A 1TV6B 3P5TL 2UXBJ 5F8HA 2YH1A 2ROGA 4LF2A 2DGTA 3HD1A 2ZOGA 4OX8A 1YK9A 3NAIA 4FXWA 5K9FA 3QRQA 2KVIA 4EO8A 4HHUA 4OX6A 1EKSA 1X5PA 3JS9A 1KS2A 2DEJA 3L7OA 2XWXA 4NLXA 3BDPA 3LP0B 1TUVA 4RW8B 3UN2A 4RW9A 1CJUB 4C9DA 2DO0A 2GO9A 3NS7B 5ETMA 3IN5A 1PBAA 2LLZA 4EEYA 3G6YA 1FWLA 4J9QA 4LIRA 4NCGA 5KFFA 1L5UA 4HACB 4J5OA 4WXOA 1EETB 5KFGA 4N5SA 1KKHA 2ZWPA 2DXEA 1NHKL 5CYQA 3D1OA 2UXBF 2KFNA 3ZTSA 2VONA 1N33J 1WSRA 2M4MA 3BN4A 1NK6A 1J5EF 3TAMA 1NPPA 4KJIA 1YVFA 5HSPA 4DV3F 4KH1B 1LQ9A 2XO6A 4A47A 1KDNA 2D3O1 2N3OA 2HHHF 2QL5B 3I32A 2MY8A 2D9OA 3A3PB 1VQ4S 2UP1A 4Q8FA 1HBUB 2HVIA 3QT8A 1REVB 4YB5A 2PEHA 2BW7A 2I0XA 4K5RA 4TKTA 2KKHA 3CD5A 2HNZB 4HI1A 3ZZPA 3PZPA 4V19X 3SCJE 1XC9A 3MECB 1H74A 2HQCA 4O4GA 2BBEA 3W9IA 3I56S 2C2RA 1ZS6A 1JJHA 1TVRB 3BYRA 4NI2B 3GV8B 1U49A 4Q8EA 3TARA 4KO0B 5IT9U 1VC5A 2ABYA 3ENVA 2AV5A 2HWIA 3RJMB 1VQSA 2QLWA 1S4EA 1FX4A 2B9YA 4Y28C 2LA4A 1VK3A 3CCLS 3PEJA 1VBZA 4K4ZA 3HSGA 4YMEA 1N5YB 3C2PA 2FVCA 1UETA 1XIQA 2VG6A 3DM2A 1N52B 2UUBJ 3OSPA 1WELA 3A1YG 4DL5A 1RWOB 5J2PA 5J2PB 4OI3A 3TI0A 5KFOA 1LWFA 2MQLA 3KKFA 5KG6A 3RGIA 4DUZF 3DI6A 1UEUA 1L3VA 3TOQA 1KD1T 4BBYA 1YLXA 5CH7B 5DETA 3EPGA 4JI4F 4L74A 3JQJA 1WC0A 2ZVSA 4LJMA 3D6MB 2XYPB 4OZJA 5KTQA 3MHYA 4ILMA 2ZOMA 4USJC 2DYAA 2H3EB 4HL9A 4BDPA 5DM7Q 3QJJA 2OTJS 3H42A 1YRXA 1NO8A 4CNYA 4FXVA 3TR5A 3FRZA 1VQYA 1KOOA 3CJTA 2YWWA 3ET6B 3LGNA 2RRNA 4FPRA 2MYFA 3FBCA 3CDUA 4TYBA 1RT3A 1IM6A 1BUXA 4J7CA 3R5GA 3OVSA 1XMOF 2VBXA 3DOMB 3PW7A 4JI7F 3T6BA 3C6UB 1FO1A 5RUBA 4O3NA 2HHVA 3GFHA 3UR0A 1B3TA 3V81B 2CZ9A 1KLMB 5I42B 2LEBA 1WC6A 2XWYA 1URNA 1X7VA 2KRRA 2RF2B 3W65A 1KNZA 1RA6A 4PAAA 3EUNA 4MMOA 4DL3A 4M5DA 1VQNS 3EGWB 2DY1A 4WYLA 4GC7A 2FVRA 2GMHA 3DYAB 1Q16B 4X4UA 4YOEA 4W98A 1D9DA 4YB6A 2IRYA 1NM2A 5E7OB 3T6JA 2XTJP 2KYXA 3L7PA 2CNOB 3NNCA 2MHNA 3UWTA 3OXFA 1Y4ZB 2KFYA 2VASA 1FF2A 3EYZA 3IWLA 1M5HA 1T11A 2BABA 4LIWA 5L1LA 4ZP9A 3IAM9 2CQPA 4PABA 3K5LA 2WK4A 1CS4B 3NWRA 1NB7A 3CJ8A 5F8GA 3DLGB 4X62F 5F9LA 1RAJA 2EFNA 4B3TJ 2QG9B 3SQGA 5KFVA 1AZSA 2E29A 3CIZA 1I3OB 3QBCA 1U6BA 2HS4A 3I82A 3N5FA 2JC0A 3M2RA 3FQLA 3M2RB 3OLAA 2B8QA 3FUYA 1B4SA 2AX1A 1RLCL 1RHQB 1TAUA 3PW0A 4O3QA 3TJ9A 2LCWA 1C4CA 3CC4S 1HYSB 2MSTA 3QQCD 4OIXA 3M4XA 1RUSA 1OSCA 5IFMA 2RNEA 3H7HB 2ILZA 1DTTA 2D1CA 3I0SB 3DOKA 1SKSA 1H7XA 4ECRA 1FKPB 4ZLNA 1I94J 1HQUB 1LK5A 3U1MA 3BGOP 3MR2A 2D69A 4OI0A 4K0KJ 5AE3A 5LMNF 4JYAJ 2WVCA 1RAHB 1WUUA 4RO0A 4RUCA 1ZETA 5GADU 3QGPA 3M8YA 4Q0BB 2XLIA 5F8MA 2P6SA 1K47A 2JH3A 1WI6A 3BBCA 4OYAA 3MMJA 3UCUP 1Q7YT 2VA3A 1EB0A 4NL5A 2XMVA 3MPVA 4A8WA 1EJ7L 2QZ8A 2YY3A 4FYWB 4JOUA 4NCAA 3LA0A 3TX0A 3V6JA 4UOFA 5KT2A 3DM2B 4RBVA 4BWMA 3ICLA 1YJTA 4CLWA 3V81A 3QLHB 3O6QA 1LK7A 2I38A 3UCGA 4KT0C 2KO1A 3E01B 3E2EA 1WI8A 2W2MP 1NK0A 1RU1A 3K0JA 1SV5B 3OVAA 1SL1A 2SXLA 2X1AA 9RUBA 1FRKA 1TL7B 4ZIWA 1RLDA 3SV4A 5IS2A 2OUGA 4RBUA 4FVCA 1SQEA 1S9EB 2Y1IA 3CDAA 6FD1A 2VL1A 4ANEA 3QLHA 2HIQA 1VFJA 3MUVP 1N36F 3MR7A 3GR1A 3W2VA 1NB2A 4DV6J 3O2IA 1DHMA 4UZCA 3CW2C 2EFVA 3UN5A 4C3LA 1NDCA 4X62J 2UUCJ 1R7IA 1HMVB 4R5PB 2OMLA 1GMUA 2MQMA 3H4BA 4CLSA 3HJFA 2DISA 1KHWA 2E1PA 2PT0A 2Z58B 3AXKA 3QATA 5H9EJ 3DLHA 5C42A 2M52A 3OD2A 4R0EA 1VQKS 2C3OA 2JFKA 2QE5A 3Q8VA 1D1UA 3P6YC 4I6WA 2G2OA 2BX6A 1T03A 4FYDA 3LP1B 2HG4A 2AEMA 4TYAA 5LSLA 1QVFR 4IRDA 2U1AA 3SIPB 2CPZA 2DR6A 3P8BB 4DXLA 2AMCB 2B56A 4NCGB 1JMTA 2FQQB 5KG7A 1RHJB 1KBRA 3WDOA 3VAHA 2CJAA 2F9JA 4ZVEA 3NMAA 4U7UD 5DS7A 1T95A 1WG4A 4EBEA 2MQQA 2Z2LA 4ZPTR 4C98A 5HQLA 1EQ0A 3ZTPA 3DFEA 4H4OB 4N47A 4B3RJ 4ZOSA 2K2PA 3GV5B 1N32F 3PR4A 2KM8C 2G2YA 2FUG9 4J9PA 2XYGB 2NR0A 2KTQA 5B0BA 1S1WA 2CKWA 1PJ6A 3DDIA 1IKWA 3G6XA 3OUYA 4IYQA 4JI2J 3BO4A 1FTCA 2RQKA 1NAQA 3O5TB 2BJ8A 2MKCA 1G6BA 2RT3A 1RAFB 3PW5A 1T3NA 4LVNP 4GKKJ 3U1NA 2RE1A 3KHGA 4OQJA 1TU0B 1S1WB 4DQSA 4DPWA 5IQ6A 3GSIA 4KR0B 3OUYB 3BBBA 3PVXA 2D41A 3QRRA 1D0EA 4DR6F 4IDKB 1FDBA 5A6WA 3SYZA 4LF6F 1U1MA 4KBIA 1H72C 4LRDA 1HI1A 2MMYA 3BZQA 4F25A 3ISNC 5CCLA 4RPFA 3THPA 1J27A 3FRYA 4QIEA 1K44A 2EEYA 5AT1B 2A0FB 3KDNA 3GIJA 1EAYC 2VF3A 2CQHA 2YWHA 5GMEA 2IDEA 2DNZA 4GO5X 5EX0A 2BANB 2Y1LB 3UD5A 1Z4UA 5FLXU 1NK4A 4LF4J 1YBAA 3C46A 2HHHJ 5B0DA 1NSPA 4ECYA 1X0PA 1Q8KA 3KK1A 1N48A 5HVFA 2QTWA 1UVIA 2GVZA 5L39A 3THVA 1BMQB 1H98A 2BE2A 1RWUA 1SC4B 2H5IB 2HRTA 2QLXA 5F41A 3Q8PB 5H9EK 1N0VC 2IC3B 3KG1A 3OT9A 4JI3J 3DOMA 1FERA 1VCTA 5KG1A 2V8GA 2CG8A 4ZVFA 3HVTA 3CCSS 2B51A 3CO0P 4DCPB 4ED2A 5E3QA 4IRCA 4NLRA 4YB7A 2UXCF 1T9XA 1FHTA 1YGYA 1CG2A 3GJSB 1T8EA 1OJ4A 4GKJJ 2MTLA 3DU5A 4IFVB 2R7RA 2KI2A 4U6PA 4B3OA 1RBLA 5KFTA 1ZTTA 4DV3J 4LQ9A 1IKYA 4M5KA 1R27B 1DLOB 3AD7C 3DRSB 2M5YA 3M1VA 5GAEI 1R3NA 5U47A 1MMLA 2FHMA 2JX2A 3KTQA 3ZO7A 3DLBA 4A4JA 3PY8A 1NJZA 1JXEA 3MEGB 1CBKA 4TN2A 4DL0C 4J9KA 1CJKA 1RYSA 2R3VA 3CE8A 2H5JB 2ZJRQ 4B3SF 2RDDA 5I3PA 1UW4A 3I87A 2VG6B 1TMJA 3PTWA 3W66A 1LWXA 1K1QA 3MOZA 1HPZB 3MUMP 3DLKA 5LJ5Y 4EZ9A 2C2EA 4X4PA 4RW9B 1BGXT 2JRSA 5KFSA 3SQOP 2IBOA 2XZDB 3EICA 1MG7A 5IC6B 4K4XA 4P52A 5G0RB 1VRTB 1JJ4A 2AKWB 3PO4A 1KR4A 2Y8YA 1WF2A 1IM4A 2FY8A 3PYDA 1C4AA 4P72A 4DUYJ 4RJVA 1AZSB 2Q3PA 4WTOB 3TQ1A 4PWUA 4UY85 1XTZA 4O0IA 2FJBB 4LUBA 2XMMA 5CAAA 3M9OB 1HYSA 2OFHX 2IA0A 3RW7A 3Q8YA 1YIJS 4R25A 3KLEB 4IQMA 1VS3A 1Q53A 5C25B 4ED6A 4H4MB 1FE4A 1FNOA 4DV0F 3I31A 4X66J 2NZCA 3TAMB 2DRAA 3R8YA 2G4BA 2DGWA 1H2UX 1F9EB 2FJWA 1VJWA 2OKQA 1V3SA 3EJMA 2CJKA 4RU9A 2C2DA 4TU7A 3ILOA 5DZ6A 1AUSL 5HVGA 3KLGB 5KFWA 1KVIA 1NU4A 2J9CA 4LRAA 2DGSA 1XERA 3OV7A 2MLYA 2NCKL 3GG0A 2B7BB 4OZ1A 1TL1B 2DHXA 4IR9A 4ZP8A 2HNYA 3VAFA 1U8SA 3RBZA 4PXDA 5I42A 2MZSA 1F5BA 1LW0B 1Z2LA 3O1LA 3W7BA 4FS1A 4Y2AA 2HK2A 1E6VA 2IVYA 2UV8A 3PG9A 1SQFA 4XIUA 2XZTB 2UUAF 2HQIA 4ES2A 3D5MA 3ZTOA 2RDIA 1UVNA 4WKYA 1V3ZA 2CJQA 2L9DA 2UV8G 3M9NB 4C7QA 2J0SD 2ZD1B 2G1HA 3HO1A 2EWHA 3C19A 3IA0A 3SSRA 2W9BA 1C1BB 1RU2A 2DHGA 1MROA 1LWCB 2BE9B 2FJAB 3D3CJ 3KLHB 4LSNB 1GQEA 1BWVA 3KFWX 1CQNA 4PWWA 2K3KA 1YBUA 3VZHA 3H40A 1DTQA 2UU9F 4QZVB 1YHQS 1QUPA 5L46A 4X65J 4HEA9 1JJ2R 1ELOA 2HQGA 4JB8B 4GC6A 3KNAA 2J7KA 3L09A 3J7A1 3MCMA 2BM1A 5EWEA 4QJVA 2BQRA 4CH1A 1S49A 4JI7J 5T7LA 1HBMA 1SIWB 3ZTRA 5BXIA 2I5JA 3EZOA 4OFZA 3I96A 3EPIA 2J0QD 2ZKTA 2XGPA 2AGQA 4IFYB 2OPPB 3DDNA 3F44A 1BHNA 1IJFB 2WOMB 4YR3A 3MM6A 1UFLA 4L72B 2ZJQQ 3PW2A 3P96A 4FVMA 1KLNA 4IOCQ 1WHYA 2MHEA 2OELA 3PRBA 4B3MF 1IKYB 2CYYA 4HT5A 1UA1A 1ZTWA 3NCRA 2G13A 3GSDA 4J37A 4K50A 2GZOA 1TVRA 3K8VA 2JLEA 4OI4A 2ASJA 3NXZA 2BJ3A 1ZAVA 3TNVA 4FNIA 3MM8B 4NCBA 1CJKB 1REGX 3IG1A 3A12A 2VZ9A 4KHRA 4PXCA 3MURP 1N5YA 5LMUJ 1TUWA 1LFPA 2HIYA 1X9MA 3G82A 1VBKA 3M32A 5LOQA 1Q8LA 5IM0B 2QA4G 4DV2F 2MSSA 3N6NA 1XMBA 2CWXA 3OQ2A 4A8OA 1EKRA 2CQGA 3PX6A 2HHWA 4WP3A 1K9MT 2XYHB 1B7FA 4JI8J 2OEMA 1N88A 4TY8B 4LFCF 4DR7F 2AW0A 2DH8A 3BR8A 3SSQA 3CCUS 2LECA 1RWWB 5GAHI 2K7JA 5CABA 1W2BR 4C8OA 4OHYA 3BKUA 1WG5A 3ILJA 2O01C 3I0RA 3JSYA 3SCKE 1UKUA 3OTBA 2EC0A 2GAHC 3CCQS 5H9FJ 3V6KA 2GHPA 4KY3A 2F4VJ 2I2YA 4NZ6A 2LKZA 4CM0A 4PYAA 4MAKA 3TEHB 4QWDA 1MWZA 4ZS6A 2OJ3A 2G0JA 3DGPB 2APOA 2BJDA 5M2PA 1U45A 2HBRB 4IH7A 3CJKA 2J6TA 4OX9J 1MLAA 3RU0A 2QL7B 2UUTA 1ZZFA 3H20A 1MN7A 4O0NA 2RU3A 2XB2D 1RWKB 1EX8A 4ZVQB 3J7YI 3AOBA 3RG6A 1ZPVA 3SCLE 2EFPA 3HJVA 1R6YA 1X5OA 1LWEB 3E51A 3CMQA 4QIFA 2M70A 2FGCA 3D1HA 3ISND 3LP2A 3QAEA 1HWJA 1HW8A 4CQ1A 2AJ0A 4N76A 5ETLA 4OL8A 3QPIA 4ZVRB 2C2OB 2DPIA 2QA4S 5J1EA 1JLBB 2XM3A 2ZKUA 1MMNA 2QLBB 4M5MA 2ROPA 4YEAA 4DV5J 5D3GB 5D3GA 2NQPA 1C1CB 4DR3J 1FWKA 3W62A 2HAIA 3IXQA 1IKXB 1QJHA 1QE1A 4B9TA 1RHKB 2VD3A 4KIAA 3N6MA 5JJBA 3KLFB 3KLFA 3A8KA 2DVIA 3FSYA 3QZ7A 2JEJA 2GC8A 5KT4A 5BR8J 4DSIA 2ZD1A 3H2LA 3QT6A 4ECUA 4QYZK 1U26A 1CJVA 2DNKA 3GCXP 4ZVGA 1CULA 1TZ0A 4U95A 5B0CA 3DXSX 1N5QA 3CNQP 1X9SA 4OYIA 4ZVOB 2W7AA 2DR9A 3QYYA 4LSLA 4ZIVA 4O3SA 4WKRA 3F56A 4B9VA 1KTQA 3OR2B 2PA8D 3WZ0A 3CMAS 4IKAA 2VICA 4NLYA 1T0TV 2VB6A 1S5ZA 2HHQA 4DQQA 1WC4A 4J9OA 5HMZA 1XNRF 3HPOA 2PFFB 3R3TA 4ECWA 3OXGA 3JAMY 2M3DA 3BSAA 3D4JA 1OS5A 4ALZA 2IDLA 4LRFA 4E98A 3HSJA 1JLFA 2YKMB 1YJ9S 2EW9A 1RK8A 3LUYA 5HN0A 2ZH9A 1UEKA 2ZC4A 3HVWA 2W8KA 2CQ4A 4PEOA 5E41A 1QAIA 3LWLA 2NREA 2QL9B 1GK8A 5CYMA 1NSAA 2AZ3A 3B82A 2E5IA 1LV5A 3TUJC 1XEZA 3LWMA 3MEDB 1U2RA 4ZA1A 4ZK7M 2OPRA 2AGOA 3MDFA 2V0NA 2VJVA 4ELTA 1N5TA 3HSDA 3IGNA 1T9TA 4USIA 1R0BG 4CWBA 1V3RA 2HZAA 2NUUG 3DRRA 4FDFA 4CLUA 2FY1A 2FLPA 2DGUA 2IPOB 4WZMA 2F4FA 3PFOA 5E3AA 2MPUA 4LREA 2DB1A 2XG8A 1CC7A 3W5YA 3TZYA 4USTA 4EUVA 4P2FA 4PUOA 2IM0A 2ALZA 3NBPB 2R2TA 2WONB 3NS5A 2JHEA 4DFJA 1F3FA 1WF1A 1NKEA 4WIIA 1JQGA 3M2VB 2FPHX 4MK7A 2O5DA 4B02A 4I1TA 3GV7B 1YTYA 1OPIA 2AJ2A 2BKPA 3HFVA 3N0VA 3EVOA 1Q95G 2D7SA 3HT0A 1VQLS 4M63A 1OY8A 4W92B 4ITSA 4DPTA 1OMSA 1F9FA 1JLAB 2W2QP 1HQEA 2WONA 3KJVB 2D3OR 2QA2A 1KFDA 1M5VC 2IM2A 1JIHA 4ECVA 3M2UB 2KXHA 3IO1A 4MYUA 5KT5A 3BGFA 1UTAA 2L08A 3HHLA 3GCWP 3EGVA 2VQEF 5B08A 1NK7A 3SCIE 5KFHA 3K57A 1TL3A 1UA0A 2F1FA 3QRPA 5E2QA 5F0WA 2DR8A 4URQU 1S1UA 1KOHA 4ZDNA 3QSYB 1RAEB 1W7WA 1TKTA 4PWDB 4K4SA 3QJPA 4QW8A 3OTOJ 1HBMB 4Y00A 4MKAA 2J8AA 1ZAXA 2AZ1A 1IQTA 2N3LA 2GIRA 1NSQA 3JXOA 1N34F 3H25A 4NXNF 1IWAA 2KZMA 4NLSA 3LO3A 2OPQB 1RGVA 2HFZA 2KYZA 3ULHA 5C2GA 2ZNYA 2MQPA 4CTAB 3TEGA 3G71S 1K1SA 3DHWC 2IRUA 4HVZA 1U48A 1Y7PA 1AFJA 1TELA 2PGCA 1SQGA 1B0TA 1FXRA 1FDAA 3MTJA 4OJ3A 1DQAA 4JI6F 3J81j 2VIHA 4LFBJ 2HGLA 3ZC4A 1P9QC 1M1GA 1OO0B 5F3ZA 2OEKA 1RQ0A 3MMAB 1NRKA 3MMAA 4WK1A 3DCAA 2HVZA 5KT3A 1WJ9A 1HL6A 4DG1A 4K4UA 1HARA 3BSCA 3J80U 1FJ7A 4PPZA 3K58A 3R6LB 1SJQA 2EPIA 3MFHA 5J2MB 1X9WA 2RKIA 4ATNA 5K14A 2VC1A 1XR5A 1EIYB 1R8HA 1HHSA 3D6HB 3GU0A 4ED0A 3JYTB 2XSFA 2NXJA 3H2UB 1KVKA 4YHHJ 3NL0A 3BYPA 4I56A 2L41A 1RT1A 3GIKA 2ASDA 1VQPS 2G1DA 4NWBA 1GXTA 2HBQB 2HQ3A 5KFBA 1AFIA 1TKZB 3BGRA 1Y0HA 1KC8T 3R2DJ 2DNNA 4DMZA 2R7WA 2XULA 3ZZZA 2HPUA 4UT4A 3EXCX 4TY8A 2F5GA 1RAAB 3RB0A 1TR0A 2MJUA 3V4IA 2A6OA 2CZVC 1SJFA 1VI7A 1MROB 3PFEA 3IBWA 5SUHA 2W24A 3ET6A 1SJ4P 2ZDPA 3HCXA 1H0HB 3D6TB 3TZZA 4Q2LA 4PWDA 1IBMJ 2YWEA 2WCXA 1NXIA 2PA3A 1FRMA 3PEHA 5B0FA 3P4UB 2V8VA 2ZDOA 3EVWA 3HKWA 4YN3B 1HBOA 5IQQA 2KT3A 4MIAA 1RKIA 5M2RA 2Z0GA 3NCPA 3CJKB 4WU2A 2DH7A 3DN9A 2IIHA 2JEGA 2C2KB 2HLTA 1X4FA 2LVWA 4WFXA 4DOZA 3JSRA 5M2UA 2V8DA 4CZCA 1SUQA 2ZH4A 2IBKA 4HR2A 5E3CA 1HI0P 2XCAA 4QU6A 2BMBA 2F8EX 4IO1A 3KHRA 2ATLA 1VLYA 5EN1A 2MXYA 4FZVA 3OR1A 2ZUAA 2B4OA 4UF4A 3UW1A 4QW9A 4QWAA 2YNIA 3HHNB 1QAYA 4OZ2A 3Q2SC 5GMKa 4DZDA 4I0WA 2GJFA 3JSMB 3MEGA 5D0GA 4CLKA 2H1YA 3EGZA 1T7PA 5LMNJ 4JYAF 1IXKA 2WVFA 2J7UA 3DRSA 3M1VB 3KMQA 3D9BA 2CQBA 4N8NA 1PC5A 1I1GA 3LF0A 4IH5A 4P73A 5J2NA 4F4ZA 3LOUA 1LXNA 4TVAB 4X64J 4QYZJ 2B5JA 2Q6BA 3E01A 3EM1A 2HZCA 2H51B 3CCJS 3IC1A 4KH0B 4NZ0A 1NJYA 2LXIA 1S77D 3R97A 1N5VA 2G2ZA 3FMWA 5D0RA 3W2WA 4QU7A 4EFAC 1ZPWX 2E5JA 1REVA 4ZLPA 4PXEA 2PIIA 2C2NA 1C1BA 2XEXA 2JL9A 5FD1A 2RB7A 1OWXA 1DBDA 3PRVA 1RT6B 2Q43A 3BSOA 4MFBA 4EU0A 2AIRB 2RJZA 2RS2A 3G4SS 3LPYA 4LFCJ 1JLFB 4DR7J 5KFKA 2OPSA 2VV5A 3A8JA 4DV7J 2KXFA 3BBFA 4MT1A 1OIAA 4EI2A 3CCES 4OHXA 4USVA 2ERRA 1WC1A 3A3OB 2BZ2A 4OYBA 3JTOA 3LALA 5AJ3F 2HHXA 2HGNA 2OLWA 3ZNUA 4Q0BA 3KHHA 1RABB 2ZBQA 1G3OA 4DF4A 2UXDJ 2XI3A 4HHHA 1YX2A 2N7YA 3UI3A 2HSEB 3RYLA 1EZZB 5HQ8A 4U8VA 4F67A 1FKPA 2R7SA 2VU5A 4IOBA 4C8LA 2BW2A 1IBLF 5D0EA 2HFNA 4A8MP 2P8IA 2B7CB 4N41A 2R7VA 3VF0B 1ZM9A 3MMCB 2OP5A 4RNFA 3PKYA 5L1IA 4CP5A 3MEEA 2ZH6A 3CC2S 1FKAF 1RTHA 2NXNA 1UJ4A 1IKXA 3KJQB 4LQ3A 4X4VA 3W8GA 1D8ZA 2JEIA 2ATCB 4ID5A 4I67A 3G2XA 1SPBP 2WB1D 3CTRA 4PG7A 1NDLA 1X31C 4S0MA 4X4SA 3T1HF 1HNVA 4NASA 1GNKA 5BJRA 3GG1A 2J76E 3V6DB 2M0GB 4U8YA 2AT1B 4DV5F 2Y1JA 1QLNA 1PCAA 3LANA 3TJAA 3WQPA 3KJVA 4RW6B 4CDIA 3FDSA 1RT5B 4LF7J 2FC8A 3OR2A 4O23A 2RF2A 2OFGX 3P5BP 1SH2A 4WFZA 3M8SA 1FXDA 4DZ6A 4JI0J 4LFAF 1FFGB 4OYWA 1Q78A 3PX0A 2C42A 4O3RA 1T03B 3MPYA 4URGA 1JLEB 2WB4A 4RNHA 5K8NA 3TA0A 4KC5A 1KRPA 2I6WA 3JB9k 1ZM4A 4WPAA 5C42B 1KHVA 2R7UA 2ASYA 1DAXA 2VH7A 4ZKAA 2HLUA 5IT4A 4QR1A 4J9VA 2UUBF 3TUPA 5KFXA 3CMES 3KXDA 3OJUA 3C15A 1O5JA 2C2MB 4DX5A 3GLJA 5A0YB 3K89A 3MD3A 5E5NA 2LEAA 4CRJA 4CTAA 3MCOA 3OTCA 4M5NA 5JXSA 3KK2B 3DHXA 5D4LA 2PMWA 4Z7YA 2ZITA 4ECSA 1IQZA 1JNRB 3ITHA 4KYZA 4KV8A 3GP9A 1V5VA 1U25A 4PXBA 2DY9A 1FNXH 2ZHBA 2BVZA 2JVOA 4P2SA 3QSIA 1HIYA 3W63A 4OI2A 1URRA 3MM8A 4NEZA 4OHVA 2KG1A 2HFVA 2WZ1A 2RQCA 4B9UA 2WBMA 2GW8A 3G87A 5GAGU 4C11B 1BQMA 5HP1A 1S10A 1U1KA 2AEFA 3MXHP 3O3LA 3IS9B 2X1GA 2QGFB 4DQRA 4QQBA 3MTKA 3NBPA 3OFHA 2Y0BB 1Q82T 1B99A 1VR6A 2G0CA 3DKDA 2VKZG 2JFDA 2KVQE 4LT6A 1O8BA 1QTNB 2B8PA 1JXLA 1VC6A 1QTMA 1JLAA 3HHLD 3CF5Q 3CGIA 3DLKB 4NRTA 4YY3J 1Q79A 1D3WA 4K4WA 2QYCA 3PV8A 1XK8A 2K7KA 4P75A 1FD8A 3F0NA 3CDWA 4P2XA 5CHCB 4TQRA 3VGVA 4CT8A 1D9FA 1TKZA 2OSQA 4HHJA 3R7NB 4DV2J 1WC5A 2UUCF 1D8YA 2VOPA 2GHWA 1PSDA 3SZ2A 1LWCA 2QRRA 3KLHA 2Y9HA 3SDEB 4ZLLA 1S1XB 1NEEA 3MEDA 1RCOB 2XLKA 3Q0AA 2K1RA 2R2SA 3MR6A 3V4IB 4ECQA 3H98A 2PC6A 2XHCA 1N0UA 3OTOF 1TFYA 4DR4F 3AD8C 1WHXA 4LSZB 3VGSA 4WFNQ 3T5LA 1M1KT 3IBFB 3MCSA 4ANCA 4LSNA 4FP9A 3MZIA 2EBGA 5KFQA 3F41A 4UY8T 3T5KA 1V5IB 3DNCA 4D3HA 5HMWA 3Q8RB 2B43A 3DU6A 1UVJA 5IZHA 3DGVA 2DXDA 1HKAA 3EE3A 2ZVIA 4Z37A 5JMNA 1Y5NB 2KRBA 3LP0A 1CJTA 4RW8A 2AQ4A 5J2QB 2MKIA 3NRBA 1HNWJ 2V4JB 2V8PA 1PYSB 4ILLA 1UAWA 4F3MA 1MWQA 1VIXA 3Q83A 4ID5B 2IRXA 4I69A 4BWJA 3T41A 2VQFF 4IFYA 2HNYB 3X3UA 1MMDA 2XNQA 1CULB 2CQDA 1VRQC 4DG1B 1CVJA 4FS2A 3EZUA 3W9JA 2J0XA 4CO4A 4ED3A 1QE1B 3H2VE 5EUHA 2DXFA 3M9MB 3T1YJ 3NEKA 2DHSA 4K8RA 4LSLB 4FF4A 2ZHOA 2CJBA 3QO9A 4X2BA 4G1IA 2ACYA 2DEIA 1O0PA 4P2MA 4K4VA 4JI4J 1DY3A 1IR0A 1RWPB 5KAKA 2DTJA 2JOQA 2Y1RI 1VRTA 4M8LA 3DLEA 3BGRB 4YS2A 1FDNA 4P71A 1H3DA 2ALYB 4C0HA 4Q43A 4QR0A 4CLZA 1X4DA 3HM9A 2HFOA 5L1KA 2DNHA 3BKTA 1I94F 3GFXA 2MZ1A 1RTIB 1YSJA 1S99A 3JSBA 4DDFA 5IM0A 2ZC3A 2ASLA 1U1LA 1Q1KA 3TP2A 4OHWA 2AP6A 2DK2A 2YBVA 3TVKA 5F8IA 4DBQA 2HURA 2V68A 3H8YA 2VG7B 5B0GA 5KT6A 5LMUF 2F9DA 3TO8A 4BHQA 2BYCA 4C8KA 2FTRA 4RZRA 3IWXA 4DCOB 2C3YA 1UZDA 3B54A 3I5CA 3VQTA 3PHEA 4DX8H 3OL8A 5KG2A 1Q86T 4XK8C 3L9ZA 1ZAWA 3NNAA 4NMXA 3ZZRA 3PKMA 1FA0A 2DHHA 4M94A 2DCLA 1HNXJ 1YRUA 2CVEA 2DGQA 2MKHA 2QIFA 3THTA 4ZJQA 2BJ1A 5MAOA 2EK1A 3I5AA 4ZPWR 2OD6A 2DGOA 4C11A 4LBPA 4ZCMA 5CD4A 5HP1B 3CWJA 3HHLC 1PJ7A 1JJCB 1JLGA 5B0EA 2BQUA 1JXVA 1PGZA 2W2OP 3CO9A 2HVEA 5K8PA 3O44A 1HD0A 4K4YA 2V9KA 1WHVA 1RAIB 4WU3A 4PQUB 2A2CA 3U27A 1LW2B 1YG0A 5HLFA 3PX4A 3MPWA 3ZZYA 1IJEB 2H54B 4DV1J 1YZ6A 5GADI 3CCMS 4DL4A 2CPFA 2BKOA 2YTCA 3G82B 2MLXA 3LTOA 3M32B 3AXMA 3SBMA 2B3TB 2IJRA 2IMOA 4NYPA 3G96A 1N56A 4KPCA 1QUVA 2QMWA 5ETVA 4Y6IA 2M7SA 2H4WB 3R5CA 2OTLS 4NA3A 1FESA 2C3UA 2CQ0A 2NYIA 2VBZA 3DC2A 3GFZA 3GPAA 1FDDA 1S9EA 2LDIA 2OD4A 1AXQA 3AY0A 1VYAA 2W9BB 2Y3YA 5J2NB 1S6QA 4EO6A 3KWMA 4IG3A 4ZCKA 5GAEU 3J7Z5 3K5NA 1B64A 3RUBL 4LR8A 1FK9B 1M0SA 2LXFA 2NXEA 2H9ZA 2V34A 1S9GB 3M7VA 1HFEL 4P6QA 1QAXA 2Z2ZA 1BQXA 5A8RB 7FDRA 5KFYA 5CCMA 3T5JA 1RTDA 2AYBA 1IBCB 2IYIA 3B4MA 3RR8A 1SJ1A 4M5JA 1ZM2A 5KFLA 2OPPA 2R7XA 1TV6A 1NK9A 5AE2A 3RBDA 5T7LB 3KHLA 1NHUA 3RB6A 2AD9A 2I5JB 3KJNB 2GIFA 1SUQB 1LOUA 2CVIA 4FKYA 3CUNA 3RB3A 3S8SA 4JV0A 3TVYA 1S0OA 1F2HA 1JKHA 2RHQB 3DDKA 1E6YB 2W25A 3HX9A 1FRJA 2Q1LA 1KN6A 4ETXA 3MM6B 4DV4J 4Y0FA 4B9SA 2OI2A 3KK2A 5IV3A 1X8DA 1IKVB 4I2PA 3TW0A 1RT4A 3C15B 4CYUA 4H4OA 4DSJA 3IWNC 1SJRA 4YHHF 3I4PA 2C2ZB 2E1MC 4ZJLA 5ETTA 5A8KB 4U67Q 4UZBA 1HNZF 4DR6J 2F65A 1NMEB 2CAJA 3CD6S 3MMCA 4OJHA 2R7OA 3JTPA 3RBXA 3U02A 3PJXA 4M5GA 1DQ9A 3HFZB 5KFIA 1G2EA 4ZMMA 3G8QA 3OFEA 4GKKF 1TKXA 1VRUA 2KJVA 2XBPA 4R0JA 8ATCB 2DO4A 4KFBA 4TU8A 1JLCB 2FD2A 4P7VA 3R1LA 1YJVA 2A1BA 1UPMB 5DLGA 3CCWA 2P9CA 2ZE2A 4IH6A 2LXUA 3LQVA 4ELVA 2Y8WA 4K0KF 2VUGA 3GIRA 2RILA 5HL7Q 4B3MJ 4HDGA 1RCXB 3UDEA 4A8SA 2V2ZA 1VQ8S 1IR2A 1SC1B 4ES3A 1K8AT 1M5PC 2CPHA 4USWA 1MN9A 2CNNB 3P3DA 2R8IA 1VIOA 4EWTA 3N9UC 1WOSA 1TL1A 2CQ3A 4MFBB 2KT2A 2PMZD 2Z8QA 4ELUA 2BJ9A 1Y11A 2K1RB 3DGPA 3MCNA 4LBIA 4YDDB 2M8HA 2WW4A 1S6QB 2RIJA 3FQKA 4J9RA 2E9TA 5AXMA 4C3MA 1IWGA 3AFGA 1U1OA 2W2NP 2J9DA 4B3RF 1S1XA 1OYDA 1VQ6S 3D0IE 3UFCX 4GVBB 3W61A 4DSLA 2E5GA 4LF1A 4JUZA 2JEFA 3D66A 3DOLA 3DOLB 3FEZA 1X60A 4YQWA 3T1YF 4USUA 3CCZA 2B9WA 3H5SA 2D3UA 1S1UB 4TLQA 3VQSA 3LW5C 1RSCA 5DO2A 3KG0A 3MWBA 4F50A 3IGVA 3NKYA 3EXYA 1JLQA 3TA1A 4B3SJ 4I68A 5DGAA 4ZVPB 4HTIA 1OY9A 4K2JA 4X64F 3PYEA 5IT0A 2OMOA 1R8PA 4C3KA 3CJRA 2AHOB 3WX4A 4XPEA 2BEFA 3VTIA 2ZH5A 2CWKA 2RRAA 5CYQB 3MUTP 4DS5A 1S9FA 3N28A 3IRXA 3IRXB 4J9NA 2KB2A 4B9NA 4ERDA 1T9YA 3K5PA 3LP1A 1SJ3P 3H5XA 1RT7B 2YKAA 2PN6A 3OFGA 1KQFB 4GKJF 4WWSA 1X5TA 3BPDA 4F04B 3Q22A 1RTJB 2FDNA 2FIUA 2QV6A 4Z7CA 3BJYA 2CPJA 4AL7A 1DLOA 1X4HA 1PAEX 2XMUA 1HPZA 2LQ9A 1IVZA 1XJWB 3CPWR 4WK3A 1UEVA 4AQYF 4Q5VA 1H2VZ 1WG1A 3KLIA 3CDEA 1RHUB 1HBNB 3R7BB 2RAQA 4HDHA 4KKOB 3SI8A 5F3TA 1KFSA 1LNQA 3LGHA 4CT9A 3M30A 3MAQA 2YNHB 2HZVA 2HBYB 3MR5A 2JJ4D 2XNRA 5THWA 6FDRA 2GIQA 4MK8A 2QC3A 2E7XA 3RZAA 1WWHA 3BO2A 1BC6A 1MWYA 4X4NA 3DLEB 2HQDA 5HK4A 3EZ5A 2ZH2A 4W90B 3IFEA 5D8HB 5LJ3Y 2DITA 1SKUB 2R42A 2RUGA 3UN3A 2DT9A 1NK8A 1D09B 2AWZA 2ZEJA 4QWEA 4CCHA 1O6XA 3CCRS 2VBYA 2IFXA 2IA6A 5DRKA 1RBOB 4PPDA 4KGKA 2V6AA 4CLPA 4C2MA 3GQCA 4PCQA 2DCUB 2YNGB 5H1SV 2F40A 4YDXA 3G8SA 5A76A 4LMZA 1M5SA 2J6UA 1WKLA 2RVJA 3EDRB 3HHDA 2PFDA 5HJYA 1HQUA 1NLKL 4BCAA 5KFEA 3J81Y 3W8PA 3D68A 2D74B 3VALA 5J2QA 2V4JA 3NLCA 5ETRA 1VK8A 1Y3JA 2BM0A 3K2YA 4B17A 5EGYA 2HNDB 3VAJA 1J5EJ 1PAUB 4M95A 3NGTA 2FB0A 3MPUB 4OJ1A 2LDYA 3CJ5A 1F0XA 1SC3B 1PO6A 3MEEB 1MU2B 4HTJA 2J7WA 3NOGA 4OV6A 3J7YU 7FD1A 1YQHA 4NYZA 4MKYA 4JV5J 1S57A 3UQSA 1SKRA 1CLFA 2HFSA 4UW2A 4DR2F 1VLOA 2Z4PA 1JLBA 1HI8A 3FCVA 2UVWA 4C6AA 3BQ1A 1M5OC 5CA5A 3HULA 3NG8A 3PHTA 1VQ9S 3GJTB 4AL5A 2FZGB 1U0HA 1NZAA 3POTB 4H4KA 4PQAA 1GAOA 3FK4A 2QLJB 4LRCA 2H4YB 3CJ3A 3FZ2A 3M2UA 4KE5A 3GONA 4RW4A 1MSWD 3WIUA 5KT7A 5D4NA 5J1PA 1R31A 2L9NA 2YKNA 3M30B 4URSA 4NPOA 4DHVA 1VC0A 1YJWS 4KRWA 4LFAJ 1RZMA 2IAJA 2RS8A 1K73T 1WC3A 2DBBA 1B70B 1DJ0A 1NPKA 2PEBA 1TKTB 1R8CA 3MAAB 3AA9A 3AOAA 2CXEA 4IG0A 1XNQJ 3KUHA 2DR5A 3OL7A 4EYHB 4LBHA 4WF9Q 2RSQA 3PRDA 5A8RA 3ZZTA 4F4KA 4BS2A 1B0PA 2V69A 1JKHB 2CQ2A 3AHPA 5A8WB 2V8HA 1N8RT 2HW3A 3ELHA 3CCTA 1JLQB 4BC9A 2NPIA 4Q2MA 4ZP7A 5L8RC 4N56A 3WC2A 3F73A 4LF9F 2JWNA 1Z2ZA 1KP6A 2EFOA 3GE9A 2VG7A 3AD9C 4MIBA 4MK9A 4I2QB 1Y10A 3CEDA 4OI6A 1SC6A 4ZCIA 3AT1B 5LXYA 4FF1A 4JI8F 4FYYB 3UE2A 5HI7A 1L3KA 1YDLA 2I1RA 4K7QA 4WE1B 3TZXA 1IBKF 4DSKA 3CDBA 4OZ3A 4F3OA 1VOMA 1HBUA 2Q6CA 2MZQA 1XN9A 1TK5A 3BF4A 5KFJA 2BJEA 2ZJPQ 1Y00A 1A6LA 3L3CA 5EX3A 4RBTA 2IY5B 1GX6A 3C6TA 2O67A 3VAKA 5KFZA 2CZ4A 5LSRA 2GVDA 5LM7E 3NMRA 3QJLA 3DRRB 3GYGA 5D4PA 2N4CA 1S76D 1HBNA 3TANA 5EHHA 5F8NA 3BREA 5A2QY 4DUZJ 1U24A 5AJ3J 4E2FB 5GAHU 4G1PA 3RB4A 3GYNA 5SZTA 3PNIA 1NNDA 4HYKA 3TAQA 4ED1A 3PW4A 3K59A 1FJGJ 1PKUA 4KFBB 2NS1B 4ZPVR 1HNVB 5L9NA 1FRIA 1A7GE 1E6VB 2YQ0A 2V4QA 3M8QA 1LWFB 2W7PA 1KQKA 1WHWA 4IDKA 4OLPA 2PO4A 4MIWA 2R7TA 2W2PP 2AJ4A 3PJWA 1RT5A 1NH7A 2FJEB 2RUSA 4BC7A 2W4CA 2HHTA 2DR7A 4CI0B 2J5AA 3H90A 1P8GA 2KU7A 3I4HX 4M5DB 4RWXA 4RW4B 2VQFJ 2E1CA 5HROB 1XWLA 3FZBA 4NLOA 4RNNA 3HHEA 5HANA 5EDWA 4QWCA 5I3UA 4DPYA 2H65B 2HGMA 4ID8A 2OAUA 4J9LA 4B3TF 2Z30B 3I9ZA 1DZ5A 1S6UA 1HBOB 3Q86A 1Q4RA 3VV2B 4H54A 2EKNA 4RUBA 5DDPC 1I6JA 1KQGB 3FNNA 2GGPA 1RAGB 4ZLJA 5L38A 3PM9A 1JNZB 1ULRA 2M8DB 4GVBA 5HROA 1QSLA 1GX5A 2HS3A 4R8UA 3VWSA 4ICLA 2J0WA 1G1XA 2WBRA 1LWEA 5IT9Y 1V9OA 1NBEB 4G3IA 4IOAQ 2Z56B 2X3DA 4EK2A 1IKVA 2DNPA 1JB0C 4I2PB 4DN9A 3Q89A 4EMDA 2F3JA 4PG5A 2VG5A 1TFWA 3QMQA 1HWIA 1EQMA 1UW9A 2FZCB 3B78A 2WAQD 3D28A 3MM9A 1WOOA 3DMJB 1L3UA 4RL1A 1GFWB 1Y3KA 3TA2A 2KFZA 1PC4A 3R5BA 5DQIA 2J9EA 2XQCA 3BQ2A 5D0HA 4OLOA 1HQEB 4IQXA 1VQMS 1F1BB 5DQGA 2HWHA 5F8LA 2AX0A 2UXCJ 4NA2A 2XS5A 1BQMB 1WDDA 2XMAA 2MKYA 1S1TA 3JTNA 4RKUC 4F7VA 2A18A 2XO7A 3TJ8A 3DMJA 4O3PA 4QPXA 1VRUB 2CFXA 4TNOA 3W2WB 2YX7A 2P9GA 3ZNJ1 1GMVA 5DDOC 3G86A 2AYGA 2HHSA 2OPSB 2X1BA 3BGUA 3QNWB 1OY6A 1XQIA 2E66A 2ZBPA 4GMKA 2WSFC 4RNOA 3BSNA 4PRFA 2BRKA 2E1RA 2F8MA 3GB0A 3PJ9A 2UUWA 3TRGA 1U2FA 3MMBB 4AXIA 1RB0A 2KHCA 2HFUA 1U1NA 4DWIA 2HBZB 1UL3A 4ZVHA 1U6FA 1WACA 2RH3A 3R5JB 2NPFA 2UVUA 2R8JA 3I0RB 1RADB 1SIZA 1X4CA 2F4VF 5F8JA 2HVDA 4ZPCA 3D1QA 1RT4B 1U0SA 1OSDA 4HH0A 4G65A 4I2QA 1O51A 2JNJA 4GRSA 5IXUA 4EYIB 2GA7A 4WCEQ 4C0BA 4AL6A 3W5XA 1XR6A 1E6YA 2BKNA 2ZNZA 3CVKA 5B09A 3KMSA 1Q81T 4JI1F 3Q23A 3IM8A 4I7FA 4NLVA 2VKRA 4ED8A 4NYOA 3FSXA 4OYMA 1EP4B 4CO1A 4ZHRB 4KTQA 3KK3B 4PQUA 2W9CA 3QIPB 3AQOA 5CYJA 2R9LA 1FJGF 2YH0A 2EI5A 2XCPA 2WW8A 1HNZJ 2XSJA 3V5RA 4YR0A 4CLFA 2AJQA 2JVRA 2NZ4A 3CJ4A 2RHSB 4FF2A 5KG4A 4B9LA 3M2VA 2B4VA 4F8RA 4WIQA 2WSCC 5ITHA 2QT7A 1EP4A 3IM9A 5F0UA 3PIOQ 2HWTA 3IMQJ 2E9RX 2AEJA 4UTGA 3QWUA 2GQQA 4DLEA 2B6AB 1WEYA 3ZFVA 3IS9A 2HHPA 2L3MA 2GO8A 1FEHA 2E44A 3HD2A 1PG5B 2BACA 1F5CA 4DEZA 4J90A 1N5SA 4XPCA 1N34J 5EWFA 2HAFA 1FVSA 1RISA 2XS2A 5E0OA 4DU7A 2CADA 2IM1A 3SSSA 2XMKA 1CSJA 1UFKA 3I6PA 3ILIA 2QYGA 5E3RA 4FF3A 1FXLA 1T94A 1NSKL 3D0HE 2VPXB 4OX9F 1BQNA 1IBMF 3ZZOA 3BN7A 4WFYA 3PXGa 3TUZC 3GWCA 2E7VA 5KG0A 5HVHA 4DV4F 3RW6A 1JLEA 3BEGB 4HH1A 2F63A 3M05A 3HZEA 4DU8A 5KFNA 2MEWA 3FFIA 1YWXA 3QO9B 3EMTA 3NAHA 1TL4A 3WX8A 4E0DA 4CO3A 3DLGA 4PYDA 4USKA 5A6PA 4DV6F 2MKKA 1TK8A 2J6SA 2W8LA 4NLGA 3S7RA 3HKZD 1QAJA 2FLLA 2K8GA 5HO4A 3CIMA 2VOOA 3VAIA 1U4BA 4DV1F 3CULA 8AT1B 2WOMA 4Y34A 3V2UC 4PG6A 4BLGA 3R7SB 1CJTB 2VG5B 2R2UA 4FBTA 2EVZA 2W1BA 5HMXA 4H4MA 2CNLB 2YWKA 4NZ7A 4JV5F 4A8XA 5DGBA 4O44B 3HDSA 1WKKA 2PE8A 3ENQA 2MGZA 4DL7A 3BQ0A 3SXLA 3OHAA 1S1VB 1DQ8A 1UWAA 5A8KA 1X0FA 4B9MA 4JV2A 1DFDA 1RHMB 4HLBA 3PO5A 1IKWB 3L7UA 4B08A 4NLWA 2F7VA 2E5LJ 3OBIA 1QD1A 1UWBB 3S1TA 1OQ3A 2YKOA 4N77A 1Q8IA 3C6TB 1J5OA 2O1PA 2OEJA 4QPTA 1SKWA 4DFKA 1AA1B 3P45B 1Q8BA 4UOGA 2HHUA 1T3OA 2I9SA 2QA1A 8RUCA 1XR7A 3OLBA 2BOAA 4FYVB 5KOWA 4NA1A 4WP9A 5FLXY 3IR6B 2XY6A 4F0KA 3AJ2A 3T3FA 2MKSA 3HVAA 3LGMA 1FFWB 2YNHA 5C24A 1WKJA 4LF5F 2DRDA 3RRHA 5DDQC 1WSVA 2AU0A 2EXUA 2FC9A 4P10A 4C8ZA 2V63A 3LAKA 2W4PA 3CJSA 3UNGC 3OJSA 1RT2B 2E1AA 2GQ2A 4A8QA 3MI7X 3BO3A 4DLGA 3HHLB 4I4BA 3TAPA 3DYAA 1Q0NA 1T9VA 4P74A 2OIHA 3VAMA 1FX2A 5E33A 1T02A 4TU9A 2R4FA 3QFWA 3ENWA 3IR7B 3VVTA 2N82B 2VC0A 1YITS 4IG0B 1G4CA 3KLVA 2FHJA 3KNGA 1UPPA 1HMVA 1H73A 4JP8A 4N8OA 4TXSA 1GEHA 3H5YA 2VQEJ 4ZJOA 2FZKB 4C0OC 2CPYA 2Z2MA 4ZN1A 3K17A 1ZZNA 1VDHA 4IR1A 1S79A 1S97A 2XMWA 2AJ1A 1RT3B 2OGUA 5DDRC 1TQLA 1S7IA 3CCVS 1LW2A 1NHVA 1UVMA 1Y5IB 2NXUA 4IFVA 3KG4A 1BLUA 3DRXA 4ECXA 4LVOP 4X4TA 1EETA 3L4BC 3N6LA 3WC0A 3OR1B 1RP5A 2BQ3A 4DPUA 1M1HA 1F5AA 1YKWA 4DPOA 2M2BA 3GTYX 1HD1A 1JWWA 4PKDB 3MPDA 2MGZB 4XO0A 1BXNA 1QM9A 4UQTA 1DURA 4IO9Q 4G6VB 2KXNB 1L3TA 2BDPA 2XGQA 2O3DA 4DQPA 3HSZA 3P49B 5EWGA 2H48B 1FKOB 1WOPA 1NJWA 4RUHA 1M5KC 1P6TA 1HNIA 4KB7A 4NE9C 1FWPA 3AH6A 1Q5VA 2VJUA 3MOJB 4KGZB 2VFRA 5AXNA 4ZVUB 1S1TB 1LKZA 5HAOA 1RHRB 3HT3A 2K3IA 4X4QA 2HYIB 3CJ2A 1RTIA 3US5A 3PACA 3G9CA 5H9FK 2DNOA 3GR0A 3M6VA 4LF8F 2V2KA 3EGNA 2V2QA 4DFPA 2ADBA 5T41A 4TQSA 3FJ2A 4LF6J 4J9UE 1TTHB 4A8KA 4DR5J 2EBEA 2CA9A 4L73A 1RBAA 4PG8A 1S1VA 3AODA 4UUXA 3CD0A 5B0AA 5K8MA 2IMWP 2D9PA 2LYVA 2YNFB 4FPIA 1R0CB 3UDLA 2XLJA 1B7YB 2KM8B 1R8AA 1ICEB 2FVQA 4CYUB 1VJQA 1WEXA 3H59A 1WF0A 4TLRA 1U1PA 1N4LA 3C16B 2HNDA 1NZ8A 2FLOA 3PDNA 2RKIB 2BRLA 3CD7A 1HWKA 1RAOA 4QCLA 2IYGA 3L95X 2Z57B 3UVJA 2KJWA 1F60B 5IC4B 3RRGA 1ROFA 2AYMA 2IM3A 1W2IA 1C2PA 4L75A 1CC8A 4WBFA 2ZBRA 5ETOA 5BYRA 4JI0F 2ZH7A 1L3SA 2G9OA 3W5ZA 2RQ4A 1OQ6A 1P1TA 3MFIA 3NNHA 4WTYA 1HW9A 4NEYA 1RA7A 1YBTA 1IUJA 2YWFA 1RI7A 3NCQA 4K2XA 4IRKA 1CPZA 4QIVA 3I9V9 1U1RA 3TYTA 1H7WA 2J8SA 1RTDB 2E9ZA 2PI5A 2N4DA 4Q45A 4DR1J 4E8UA 3RBEA 1XMQF 1H38A 4LR9A 4F2RA 1FK9A 4Y2IA 4IG3B 1F9HA 1SH3A 5FJ4A 1TL7A 2DIVA 2FJXA 2EG2A 4A48A 3A8EA 4DN0A 3FCHA 3NGDA 4ZN3A 4DFMA 2HMIA 2WHOA 4UUWA 5FDLB 1U7LA 4F36A 3FC9A 2BA9A 3W2VB 4DJBA 5DZ7A 2OHDA 2IVMA 2YWGA 3OW2R 1S0VA 2DNMA 2JC1A 3BB5A 2HK3A 4QR2A 3GJRB 4ANDA 3QZ8A 1IBLJ 4CLYA 4M5IA 2CPEA 3KLIB 1TL3B 1EHWA 1BQNB 2C3PA 2LQJA 2F8HA 2PDAA 1F3VA 4HI2A 3QGHA 4AYBD 2FHJD 2V94A 3AAWB 4ECZA 2IHR1 1N36J 1BWEA 5CZXA 1QDUB 2LQBA 2X1FA 1T9UA 2YQ1A 3IP0A 5A8WA 3NOCA 4WE1A 4AXJA 2QX0A 1PIEA 5C2CA 2MQNA 3T19A 1V6HA 3DI6B 2RMLA 3G8TA 2CRLA 2OO4A 2YNIB 3JQKA 2LP4A 1NDKA 1Q7LB 9ATCB 1GMWA 3GIMA 4EBDA 1ZOTA 1T05B 1NKBA 2DIUA 2NXCA 3AJDA 1HR0F 4ED5A 5E3PA 2ADCA 4AFFA 1HHQA 2CQIA 2R7QA 4LR7A 5ETQA 4ZPBA 2XMTA 2ILYA 4I7FB 3I55S 1VHFA 1NUEA 3MD1A 2JLGA 3RAQA 3KOAA 1SH0A 4DPXA 1UVLA 3N79A 2DKOB 2HVHA 2QFIA 1I5OB 1RT7A 3D7SB 3QFHA 3AA8A 4CO5A 1SBRA 3MM9B 5DM6Q 3G6ES 2VHGA 3MECA 4O4GB 3R2CJ 1PYOB 4YP3A 1X4AA 3W64A 1U6ZA 4H4KC 2POKA 2GFFA 2WVDA 2B4PA 2V50A 3DOKB 2GVDB 1SB6A 5AE1A 2UU9J 2IVFB 4CO0A 3R27A 1QSSA 3J7AN 2JZ5A 4O4RA 1HR0J 2V4RA 2XY7A 5J1NA 4AE5A 1Q5YA 5IWAF 3RR7A 1GTHA 2O66A 2NSCA 2YKPA 3HVTB 2ACMA 3MMBA 5ETPA 7AT1B 5MLCV 1J5OB 1F6TA 2VA2A 1N33F 2MB0B 2PI4A 2RU9A 1OPZA 2BV3A 3DRPA 3MAHA 1M90T 1FJEB 1RJJA 2CDQA 4ED7A 4X84A 1FRHA 4QBUA 4RW7A 2HMIB 2BANA 2BE7D 2ZWOA 3QIDA 2RRBA 4MYTA 4RW6A 2J9DE 3ETMA 3U7JA 2VPYB 5B7WA 1X5SA 4PR6A 1P27B 4W4MA 3Q2TC 3H0PA 3V6DA 2CJ9A 2FJDB 4NLTA 1RTZA 1AUDA 4KHPF 2BE2B 4RLEA 4X4RA 4DV7F 3R6GB 1RYRA 5G4DA 5A2QU 4Y2MA 2ZUGA 3UVJB 5BYQA 1W25A 1U1QA 1SCJB 3PCOB 4OYPA 5AXLA 1ITPA 1A0OB 1FNMA 3ENAA 3AB2B 4YFUA 3TZWA 2OPQA 2A6MA 1U2CA 1VMBA 3W60A 1HNWF 2V67A 4MKBA 1SXLA 1KWMA 2MZRA 4LF5J 3OTDA 1CJUA 1SI9A 4ICLB 3R9LA 2W9AA 1JX4A 3ISZA 3EDQB 3BDEA 3UR3C 4CIOA 2VFTA 3VHQA 4G1QA 3M8WA 3UO0A 4DCJB 4DUTA 4R8UB 4RR5A 1KLMA 2DGXA 1YI2S 2EC2A 3NGRA 2WSEC 5GVQA 3Q8QB 4KHPJ 4Y65A 1RKJA 1GT8A 2KH9A 1R43A 3I5BA 4DL6A 3H5UA 3UNYA 3IAS9 5AXKA 2VFUA 3T9NA 3HVRA 5J1EB 1OYEA 2BXJA 2DJWA 2MKJA 3MM5B 4USMA 3BR9A 3CJ0A 5DQHA 2ROEA 3RRKA 2B6AA 4J9SA 4CLTA 3A4TA 4JI3F 4G1QB 4Q44A 3TWZA 1NK5A 5C5JA 2MZTA 3T1AA 3R1HA 1UP1A 1GXLA 4CM2A 4JI5F 2FLNA 2CDRB 4DQIA 4FNHA 1AW0A 3LPEA 1U8WA 4DV0J 4UQGA 1TL5A 4QOTA 5LL6d 3V4MA 3T5HA 2BR0A 4LF4F 3W3SA 1ZH5A 1PJ5A 3VGUA 5L9XA 4M1KA 3ZXWA 4KKOA 4GVLA 3RAXA 4OMFG 1TUGB 2HQFA 4K4TA 2GJ2A 2CUYA 4A46A 1IR1A 3A13A 2CG4A 5CQGA 3RTVA 2Z2YB 1FKOA 2R8KA 3D6FB 3FGVA 2DHAA 4DR4J 1BE4A 3BKFA 1KEKA 1P1LA 4NLQA 4FKXA 3GZ7A 3HF5A 3GFYA 4WP8A 4NI2A 4Z2XA 1W26A
chains in the Genus database with same CATH topology
4RW7B 2LU2A 2C3MA 3OTEA 4OZNA 4P7TA 5A0YA 2B0GA 4LFBF 4DSEA 2LU1A 4Q7AA 3DRYA 5D78A 1YJUA 4ZHRA 3HFKA 2KZZA 2AJFE 5K5MA 3KK3A 2GHVC 3C66A 2DRBA 3ITHB 3E3XA 4KV8B 3WBZA 4F02A 2NSBA 4DUYF 1FTRA 4RWWA 3OXLA 4HKQA 5CYMB 5BR8F 2KG0A 3SDEA 4YY3F 3ZZ0A 4R5PA 4CNZA 4U9RA 4C8NA 1UWBA 3H4DA 3RAMA 3EX7B 5I4MA 2M9KA 2AYEA 3R5DA 3M6XA 2CPXA 2GMLA 2KDOA 4KHMA 3BS9A 4UOCA 4A8FA 1MU2A 2QMXA 4WXWA 4RNMA 2DPJA 4OV1A 1IN0A 2R2RA 2VODA 2MY7A 2IC3A 3J80Y 1DARA 1FJCA 3JSMA 3KK1B 4XDDA 2VFVA 1LW0A 2PD1A 2A3JA 2BUNA 3FSIA 2ZH1A 1S72S 2IAJB 2XMJA 3X1LB 2FJVA 4USHA 2V9WA 4DR1F 2AGPA 1R0AB 2ZZMA 3FVYA 2YKNB 1BD6A 1Z1ZA 3OPKA 1NJIT 1AROP 2NLWA 1MNEA 2DNRA 4ZPDA 5KFUA 4F2SA 2OSRA 3DLLQ 3M6UA 1H2TZ 2X51A 1VQ5S 1FE0A 2XI2A 2GJIA 3B4DA 3M8RA 3PR5B 3HP6A 1DTQB 3K5MA 2HNZA 2ZFHA 4TY9A 4DS4A 4QYRA 4FBUA 2CPDA 4I6AA 3CT9A 3D0GE 3OFFA 5CD4H 2Q79A 1K0VA 2GQCA 4GO7X 5HBMA 1G7CB 3SQGB 3M6WA 5HBMB 3NS6A 4K4SA 4Y3CA 2COLA 4NRUA 4OX7A 5DG8A 1GXUA 3CC7S 2DNYA 2HS0A 4XDCA 1LXJA 4KQZA 1QY7A 2X3GA 4MH8A 1FD2A 2UVVA 4V19J 3OHBA 2A10A 5G0RA 2NUHA 3SFGA 1ZBTA 5K8OA 4HT7A 4F4XA 1C0TB 4CH7A 3Q24A 4JV1A 1VGYA 4NLDA 1WEZA 4NLPA 3AB4B 4JI2F 5LXRA 4FXDA 3S01A 3IRWP 3ZZUA 1GTEA 4OZ5A 2N7CA 2U2FA 4O44A 3AJ1A 4F3QA 3VAGA 2C28A 4PG4A 2RDJA 3HHKA 1JLCA 4CO2A 1KVJA 1HNIB 1UFWA 2JSXA 2ZHAA 2E7WA 2VPWB 2W7OA 2E5HA 2FHKA 1C0UB 3U1LA 4J9MA 2UU9F 1S6OA 1RDRA 3O8WA 4L3NA 2VBWA 5FIIA 4ZCLA 3KLEA 5C25A 2OH2A 2GMJA 5L1JA 3AQPA 4KO0A 5GAGI 3KLGA 1HWUA 4WJBA 5HLFB 4ECTA 2DGVA 4NOHA 2E5LF 1APSA 1YRTA 4KSEB 3E8OA 4K59A 1C1CA 1U09A 4X65F 5FDLA 1HHTP 2W4DA 1FEEA 2DD8S 3K7RA 1QSYA 3N4WA 5I3UB 1SV5A 1Y5LB 4YUDA 1A9NB 3N5BA 4QIGA 2LQ5A 4RUAA 1F2GA 1VQOS 2L48A 3Q8SB 3D54A 5KFRA 4L6V3 2FVSA 5KFCA 1JLGB 3UD3P 3BM7A 4EBCA 5LSOA 2UVRA 5T14A 1X4EA 3HZGA 4RX6A 2XZWA 3MF5A 5KFMA 2W9CB 2VFSA 2GX8A 2PMHA 1U47A 3ETOA 4ZPAA 4XAKA 2EG1A 1RT6A 4C97A 5KFPA 1B0VA 3NWGA 1C0TA 3VCDA 1WTBA 2AF6A 1WTFA 4JBCA 1S0NA 2XC9A 3B8HA 1T05A 1N6QB 2KHDA 5CZVA 1DTTB 2EFQA 4MTPA 5JUMA 4WZQA 3HI9A 5DLFA 3MM7B 2P9EA 2P5VA 4MJKA 4ZP6A 2CQ1A 2MDAA 2YX4A 2B5JB 3T9ZA 1K0TA 3D2WA 2OPRB 2ZH8A 2WTFA 4DR3F 2QO3A 3MM5A 3DLJA 2R8HA 5F9NA 1KTVA 3OL6A 5JVGQ 4A8YA 3C8YA 4C8YA 1C0UA 1VQ7S 4FN5A 2LMIA 5K14B 1KQSR 2QEXS 3MR3A 3M8PB 3QGGA 2Q66A 3IG1B 1HNXF 4WFAQ 2ZBIA 4DR5F 4DF8A 2GV1A 3SFUA 2ZOFA 4ILRA 4OZLA 1FCAA 2BOPA 1RT1B 1CEZA 3GILA 3K8WA 2YX1A 1Y9OA 1YJNS 1GH8A 4D3GA 4KPYA 4WYWA 4WFBQ 3JYTA 1S7HA 1RT2A 2EFGA 3QWPA 3SV3A 1JK9B 1VBYA 3FMBA 2CIMA 4K5SA 4F26A 5KFDA 3OSNA 2DNGA 2ZBCA 4C8MA 4YR2A 1BY9A 2H5EA 3UCZP 3V6HA 1XBWA 2IJFA 2FHOB 3G6VA 4I6YA 2Y0SD 1HA1A 2YNFA 3VR1A 4DL2A 1NJXA 3NNHA 5D77A 3QAUA 5LT5A 2KT5A 4X4OA 3GIIA 4AUKA 1NKCA 3TX8A 3S6EA 1FRLA 4OZ0A 1TKXB 2FGOA 5KG5A 2QFJA 3HK2A 2R8GA 3J7ZT 4ES1A 2ZZNA 5HMYA 2B9XA 2L9WA 1CQMA 2VPZB 3MGJA 4RU2A 2KN4A 1X4GA 5BYSA 3GMGA 1S6PA 3C3LA 1D9AA 2DH9A 3LP2B 3VZIA 4I64A 3FEXB 4NMLA 3MM7A 3HMJG 1MW7A 2QSWA 4OI1A 1N6QA 1PILA 3ONQA 5KG3A 3KYLA 4DSFA 3OVBA 3M8QB 1N54B 1WD6A 4CH0S 3CXCR 4OJGA 1FRXA 2A2DA 1UMJA 1RTJA 2MQOA 5JVHQ 1TAQA 2ZM6F 1QVGR 1XNQF 3TUIC 4NLUA 2MJNA 1R0AA 3BGLA 1YJRA 1NH8A 3UPFA 4B3OB 3N01A 3CSKA 2CQCA 1WNEA 5DJBA 1R89A 1TKDA 2JDJA 4Y2KA 4ETZA 1UJ5A 2LA6A 3FFIB 3M8PA 2C22A 4C4WA 4Y2CA 4U7CA 1ZM3A 1S9GA 1FVQA 3UD4P 1DRZA 2GNKA 3TVZA 3FEYB 3QGIA 4KGMA 2PSZA 4EGLA 3SEOA 2V5HG 1TP7A 3LH2S 3NP5A 2QSFA 4O3OA 2YVSA 3LAMA 4OHZA 5ADZA 2XY5A 4YB1P 3HXMA 1ZYQA 3CB4A 3K5OA 1HWLA 2I8EA 4F4WA 5D6GA 1KSPA 3IR5B 2RD5C 3OL9A 2DNLA 3MEKA 2FVPA 1UJ6A 5DG9A 3SMZA 1VBXA 2EK6A 2YKMA 1LFWA 4QIWD 2XHWA 2CPIA 5J2MA 2UZAA 3DXBA 4F4YA 2JLFA 1S4FA 2XSJB 2YNGA 5CXTA 3I0SA 1UVKA 5C24B 4KAIA 3HLUA 3R5AA 2LEPA 3QIPA 3UDCA 2EKYA 1J2VA 1RTHB 2M88A 2ZH3A 4EZ6A 2B4UA 2ZE2B 3GYXB 1KONA 1H6KX 2RQMA 1S48A 4PUOB 1S6PB 4NXMF 2YKQA 1FT8A 2P6TA 2HRYA 5KOXA 5I3QA 1SL2A 4X66F 2IJNA 3DRPB 2HRUA 1R8BA 2WRMA 3C6UA 2DNQA 3PIPQ 2YQ3A 1TK0A 1X4BA 4QWBA 4NX9A 5KFAA 5D4OA 2GCFA 3NGKA 4U7UK 1S0MA 5DG7A 2MZJA 3POTA 2D3ZA 2GGPB 2XS7A 1TV6B 3P5TL 5F8HA 2YH1A 2ROGA 2DGTA 5K9FA 2ZOGA 4OX8A 3NAIA 4FXWA 2KVIA 4EO8A 4OX6A 1X5PA 1KS2A 3L7OA 2XWXA 4NLXA 3BDPA 3LP0B 1TUVA 4RW8B 4C9DA 4RW9A 2DO0A 2GO9A 3IN5A 4EEYA 2LLZA 3G6YA 4J9QA 4LIRA 4NCGA 5KFFA 1L5UA 4J5OA 4WXOA 5KFGA 1EETB 4N5SA 5CYQA 2UXBF 3D1OA 2KFNA 2VONA 2M4MA 3BN4A 1NK6A 1J5EF 3TAMA 4KJIA 1YVFA 4DV3F 1LQ9A 4A47A 2N3OA 2HHHF 3I32A 2MY8A 2D9OA 2UP1A 1VQ4S 4Q8FA 1HBUB 2HVIA 1REVB 4YB5A 2PEHA 2I0XA 4K5RA 4TKTA 2KKHA 3CD5A 2HNZB 4HI1A 3ZZPA 3PZPA 4V19X 3SCJE 1XC9A 3MECB 4O4GA 3I56S 2BBEA 1U49A 2C2RA 2R7VA 1JJHA 1TVRB 3GV8B 4Q8EA 3TARA 4KO0B 1VC5A 2ABYA 3ENVA 2AV5A 2HWIA 4F25A 1VQSA 2QLWA 4Y28C 2B9YA 2LA4A 1VK3A 3CCLS 3PEJA