3Q2SC

Crystal structure of cfim68 rrm/cfim25 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
b'IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPVNKQFLSQFEMQSRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
publication title Crystal Structure of a Human Cleavage Factor CFI(m)25/CFI(m)68/RNA Complex Provides an Insight into Poly(A) Site Recognition and RNA Looping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 17
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3q2sC00
3RW6A 5GAGU 3CTRA 2E44A 1DBDA 2FY1A 3MD1A 1FJEB 2XNQA 3VAIA 3CMAS 2DIUA 2NLWA 1M5VC 2M8DB 5EN1A 1YWXA 2KXHA 1R8HA 2MPUA 4F26A 2QFJA 2F9DA 1H2TZ 3SDEB 1A7GE 1SXLA 2DGVA 3PIOQ 5DDOC 3L3CA 1DZ5A 2DGXA 5CYJA 1WHWA 1YJNS 1DHMA 1W2BR 2L9WA 2O3DA 2E5HA 2MMYA 1UFWA 1WHVA 2KI2A 5D77A 3IWNC 1YI2S 2YH0A 2KFYA 2KXNB 4RU2A 4FXWA 3ZZZA 1X4AA 2LXIA 3THPA 2CPEA 4QPTA 2KN4A 2YH1A 2WBRA 1X5SA 2CPYA 1VQNS 1D9AA 4ERDA 3I55S 3CCES 2MKHA 2RQ4A 2PEHA 3LPYA 2MKJA 2G0CA 5GMKa 4IOAQ 2MQOA 2LKZA 1FJCA 2BOPA 1BY9A 2FHOB 3LQVA 1VQPS 4TU9A 3VALA 3D2WA 2CQIA 2RRBA 4U67Q 2E5IA 3R1LA 1A9NB 2EK1A 2M70A 2J0SD 1HL6A 2DGOA 2CPIA 1WG1A 2M88A 2LEAA 2CQHA 2HGLA 5IQQA 1P1TA 1WI8A 2LA6A 3NS6A 1FJ7A 2JVRA 4UQTA 1VQ4S 1VQ5S 3S8SA 2KH9A 3CC7S 3CCRS 3THTA 1SJFA 4ZKAA 2DNLA 2KM8B 3TP2A 1VQ7S 1U1OA 4BS2A 5JVGQ 1QVGR 2ERRA 2ZJRQ 3P49B 1X5PA 3UCZP 3K0JA 4J5OA 2M9KA 2G1DA 2XB2D 1D8ZA 1KQSR 1G2EA 2M52A 2UP1A 3ZZYA 3UWTA 4Y00A 1WELA 5HL7Q 2MYFA 1Q82T 1IQTA 2DK2A 4OZ0A 1HD0A 3G96A 2KG0A 2YWKA 1N8RT 2DGQA 2V94A 4QU6A 5ITHA 1X4EA 5H1SV 3MURP 2RVJA 2CPJA 2JX2A 1U2FA 2MY7A 1WWHA 5GAEU 2OSQA 2E5JA 2E5GA 4CH0S 2DISA 1FO1A 2EVZA 3CF5Q 1M1KT 1P27B 2MQNA 2KU7A 2VODA 2DNZA 1KOOA 2MJUA 1F9FA 1ZZFA 1OWXA 3NNCA 2KRBA 1QVFR 2AYGA 3G6ES 4LJMA 2CPDA 3G8TA 3N9UC 4ED5A 1DRZA 2J76E 3ULHA 1WTBA 2MJNA 1R8PA 4LMZA 1K73T 2DH8A 1H2UX 2I2YA 4PRFA 5JVHQ 2F3JA 3VAHA 2KT5A 1U1NA 3EGNA 3MDFA 4WFAQ 3FEYB 2XSFA 5LSOA 1X4GA 2MZSA 3VF0B 2HGMA 1VQ6S 3S6EA 2MY8A 3OW2R 1JMTA 1U1QA 3MXHP 1X0FA 5LJ3Y 3EX7B 2CQPA 2LYVA 3J7ZT 2J0QD 4V19X 2X1AA 1M90T 2N3OA 2DNMA 3CD6S 3J7YU 3TO8A 5LSLA 1N52B 2MGZB 3DLLQ 1M5PC 3CCUS 2RS8A 1N88A 2DH9A 2YTCA 3BS9A 2CQ2A 4IUFA 1YIJS 1K8AT 3EGZA 2MKCA 4WF9Q 4EGLA 2KG1A 2DGTA 2MZ1A 3NS5A 1SJRA 1FHTA 3R27A 4WFBQ 2GHPA 1X4DA 1WI6A 1VBZA 2KXFA 1L3KA 3UE2A 4Z2XA 2B0GA 1U1MA 2CQCA 1WEZA 1VC0A 1NO8A 1X4FA 5IFMA 1YHQS 1S79A 1Q7YT 1VQ8S 2N3LA 2AYMA 2DITA 4CQ1A 3MUMP 5IM0B 2J8AA 2FC9A 1Q86T 3BEGB 4YOEA 2FPHX 3H2UB 1U1LA 3NMRA 5DDQC 3PIPQ 2LECA 3VAJA 2RNEA 2MHNA 2L41A 3CMES 2CPZA 3CCLS 2DNOA 1CVJA 2GO9A 5FJ4A 3VAGA 2MKSA 3UD4P 2MZRA 4F25A 3CUNA 1KC8T 2MQMA 2Q79A 2N82B 2VOOA 2DNGA 2M2BA 2AYBA 2ZJPQ 4FXVA 1X4CA 1H6KX 4A8XA 3UD3P 1KD1T 3CC2S 2ADCA 3Q2SC 2DNHA 5CA5A 1WG4A 2G4BA 2HVZA 3I56S 3HI9A 2CPHA 2DO4A 1WHXA 1U1RA 1M5OC 2MKKA 5HO4A 2DGSA 5CXTA 1UAWA 2M4MA 2XNRA 1OIAA 3CXCR 2RUGA 1QM9A 1PGZA 2OTLS 1YTYA 3Q2TC 5GVQA 3B4MA 2DHXA 1UP1A 2L08A 3VAKA 4IOCQ 3BO3A 2U2FA 2DNYA 2RS2A 5DM6Q 2DH7A 5MLCV 2D3OR 2EK6A 2X1BA 2VONA 3H2VE 2CQGA 2DO0A 2X1GA 3G71S 3MUVP 1N54B 4M5DB 1SJ3P 1U6FA 3G4SS 4PR6A 4WFNQ 2DNRA 1UW4A 1SJQA 2K8GA 2D9PA 4IO9Q 1U1PA 5GADU 1ZZNA 4OZ1A 1YITS 1X5OA 2MZJA 3IRWP 3RW7A 2MZTA 3SDEA 3B4DA 4P6QA 1OPIA 2N7CA 2KM8C 2CQ0A 2DNKA 1VBXA 1WF0A 2DNNA 1WEYA 2LA4A 3US5A 1JJ2R 2MSTA 2CJKA 4W92B 1M5KC 4F02A 3NNHA 2CPXA 1VC5A 2XS7A 3CCJS 1U1KA 2D9OA 3DXBA 2MQLA 2M0GB 3R1HA 2XS5A 2RQCA 2CQ4A 1KOHA 2LCWA 3NNAA 2MGZA 2DNPA 2K3KA 1URNA 4TLQA 2DGUA 1WEXA 2CQ1A 3S01A 2QA4S 3BO2A 2X1FA 2CQDA 4WCEQ 3CCMS 2OIHA 1RKJA 3SMZA 4TU8A 2OTJS 2RU3A 2DHSA 5LXRA 2DB1A 2OJ3A 3UCUP 2MB0B 1OO0B 2HGNA 4C4WA 2BZ2A 3P6YC 3MD3A 1H2VZ 1NU4A 3BO4A 3U1MA 1SJ4P 2DGWA 1VQ9S 2LMIA 2KHCA 3HHNB 3UCGA 2OSRA 2CQ3A 2LQ5A 2YKAA 2HYIB 1XN9A 3JB9k 1WG5A 2RT3A 2MQPA 2ADBA 2DIVA 1FXLA 5DDPC 1NJIT 2M7SA 4W90B 5IM0A 1U6BA 2JVOA 3P3DA 2M8HA 2KVIA 2AYEA 2CPFA 2I38A 1VQKS 4UY8T 3MOJB 5GAHU 5D78A 4TU7A 3MUTP 5DM7Q 3MI7X 1Q81T 2F9JA 3S7RA 2NZ4A 2JRSA 3VAFA 2U1AA 2SXLA 5BJRA 2MXYA 2A3JA 3CPWR 3VAMA 1WF1A 1YJWS 2AD9A 2LXUA 2VOPA 2JWNA 1WF2A 3FEXB 1O0PA 3TYTA 2MSSA 1JJHA 4CH1A 3CULA 1X5TA 2DNQA 2FC8A 5LXYA 1RK8A 1X4HA 4C0OC 3G8SA 2MZQA 5DETA 1S72S 2RRAA 1AUDA 1X4BA 3CCSS 1VC6A 3CCQS 1WHYA 1FT8A 4Y0FA 3G9CA 4C7QA 2DHAA 3V4MA 1B7FA 2HZCA 4LIRA 2ZJQQ 5DDRC 1JJ4A 1VQLS 3U1LA 5LJ5Y 1ZH5A 4YUDA 4QU7A 3P5TL 4CIOA 1VQOS 2PE8A 1VQMS 1HA1A 2QEXS 2MKIA 1VBYA 2KRRA 2MQQA 4WKRA 4PKDB 3SXLA 2LEBA 4WIIA 4QQBA 3CC4S 1HD1A 2DHGA 1YJ9S 2CQBA 3CCVS 1K9MT 2KYXA 1PO6A 1FNXH 4YB1P 2XS2A
chains in the Genus database with same CATH superfamily
4USIA 5KG2A 2FY1A 2AKWB 1TU0B 2DIUA 3GLJA 1CPZA 2N4DA 1S99A 1S1WA 3P96A 1R8BA 5EX0A 2C2EA 3A8KA 3VVTA 3K5PA 4OI1A 3VZIA 2MLXA 3TW0A 2RAQA 2YWFA 2HFSA 1WHVA 2VG6B 2GHVC 2QFIA 2N7YA 5H9FK 4OI0A 2MDAA 2YH1A 4NMXA 2H4WB 2C1EB 3IR5B 2MKHA 2ZH4A 4DPTA 5HVHA 1NNDA 5HK4A 2MQOA 3HHEA 2V6AA 1HQUA 3UDVA 5IT4A 2UUAF 2RJZA 3M30B 2J0SD 4YY3F 2C42A 3DCAA 3EZ5A 1FJ7A 3RYLA 2QGFB 4C6AA 3PYFA 4ZCIA 1XWLA 4OX9F 1FXRA 5GAHI 4KV8B 5A2QY 5J2PB 1PYOB 1CJKA 1OQ6A 1FD2A 2XZTB 4U7CA 2XWXA 4YR3A 1F1BB 4RWWA 5D6GA 3VGTA 1TKZB 1E6YA 5A8WA 1UJ6A 1ZM9A 4TVAB 5LMNJ 4CWBA 1R3NA 2FVSA 2K1RA 3T1YF 2IM0A 1NDCA 2C28A 3DGPB 4O3PA 2GQQA 1KOOA 1IM6A 5CCLA 1XC9A 2IDEA 5H9EK 3KLEB 3GV8B 1R8PA 3D1QA 2H5JB 2XY5A 2B56A 5DS7A 3MDFA 2F65A 2YPZA 2AGPA 3DKDA 1VQ6S 3HDSA 2R2TA 2OGUA 2J0QD 2Q1LA 2N3OA 4C8NA 1HYSB 3DLLQ 1I6JA 1MROA 1CS4B 3L09A 4NLGA 1UVNA 3D6TB 5HBMB 4NLXA 4F0MA 4XTTA 3R27A 4B9NA 1HQEA 4NLYA 1WEZA 1RWMB 4ZCKA 5CQGA 5KFNA 2UXCJ 4L76A 2DVIA 2AJQA 3AHPA 4UF4A 2GQCA 3KJQB 4JI7F 3A8JA 5KFWA 1M5SA 2R7QA 5T41A 3OSNA 3PRVA 2O01C 2AJ4A 3W2VB 5DDQC 2LECA 2AHOB 3LP2B 1QAIA 3IAS9 1IKYA 2MQMA 1ACMB 1C0UB 1AROP 5E3AA 2QC3A 3RBEA 1N6QB 1XMQF 5DRKA 3GSDA 1C4AA 3TEGA 1HBOB 2AX1A 4WE1B 4EUVA 4BWJA 4IOBA 3PW4A 2OEKA 1V6HA 1WC5A 4NLRA 2WK4A 3DDKA 5KG5A 2FJBB 2F5GA 4OYIA 1U1PA 2YPYA 1VFJA 1YITS 1TAQA 3FKBA 4CLTA 1BD6A 2AT1B 2KDOA 2B8QA 5HMWA 1RB0A 2W1BA 3KK3B 2DNKA 2H3EB 1HHSA 4UUXA 1EIYB 3H25A 2WONA 1T3NA 3M32A 2WB4A 4W4MA 1ZETA 4IQXA 3DM2A 4ZLNA 2UVWA 4LRBA 3RB0A 2OMOA 4CDIA 2DGUA 2XMJA 4CP5A 3H4BA 5LXRA 3DOMA 1WNEA 1NPRA 4KGKA 1HBMB 2P6TA 3BO4A 1VDHA 2HMIB 2HW3A 1CQNA 5A6PA 3PVXA 1VQ9S 1SKSA 3D6MB 1XN9A 2C2MB 2F1FA 4LFAJ 3IC1A 2IVMA 2BEFA 1HARA 4UZBA 3EVWA 5LM7E 3BKTA 3FJ2A 2KVIA 1HNIA 1TKDA 2WHOA 3VWSA 1B7YB 3CDBA 2Z56B 2QIFA 3CE8A 1T9UA 3AA9A 2CVEA 2GVDA 3PEHA 1VK3A 4J9LA 4MK8A 3TYTA 2BRKA 5D4LA 1YKWA 2VIHA 2MZQA 2E9ZA 2XHWA 1HW8A 1H74A 4Y0FA 1DY3A 3MPDA 2HNYA 2HZCA 1VQLS 2R8GA 4TY8A 1X9WA 1IVZA 4LQ9A 1N32J 1VBYA 2V8PA 2WW8A 3HHLA 2DHHA 2F8MA 4ID8A 2DHGA 4NLPA 3QGIA 1PO6A 1IN0A 2BJ1A 1T0TV 3CTRA 4LBPA 4WU2A 4EK2A 3VCDA 1NKBA 4RKUC 4H4KA 4KBIA 3DLHA 3BH7B 1M5VC 1UEUA 4JI0J 2ZNYA 4MJKA 5KG6A 4X4QA 2C2OB 3OTCA 4UOFA 1NB2A 2AZ3A 3QSYB 2EC2A 3EDRB 1R8AA 1YRTA 2RHQB 1LXJA 4Y34A 1EKRA 4FXWA 4JI1J 1H38A 4OJ3A 3THPA 3GSIA 3HF5A 3OR1A 1SV5B 4ZVPB 4A8YA 5HSPA 4IOAQ 4IRDA 5A8RA 4ANDA 2BE9B 1VJWA 4DZ6A 2BX6A 2PMWA 2CQHA 3QNWB 4L74A 1Y9OA 2IDLA 2QMUB 2QA2A 1S6QB 1QVGR 4I2QA 1RAAB 2G1DA 2HZAA 2LU2A 1U02A 3ZTRA 2QSWA 4JI3J 4I1TA 3NLCA 1I94F 1HD0A 2IRUA 2JC0A 2Z4PA 4E98A 2V5HG 3BF4A 1AT1B 3TAQA 3MHYA 2B4UA 2RRNA 3RRHA 1NHVA 1IM4A 3SSRA 2MY7A 2E5GA 2CFXA 2NPFA 2E9TA 3IGNA 5HI7A 4KKOB 3HD1A 4DCPB 3JQJA 2VODA 1IBLF 4BC9A 1RWWB 5L1IA 3NGUA 4LF6J 4ZVHA 5GADI 2CG4A 1WC3A 3GG0A 4PXBA 1IKXA 1HI8A 2EW9A 3DLEA 1MWYA 1SC4B 3MCNA 1X4GA 1C1CA 3CJ5A 1JLFA 4CO4A 5A2QU 4WK1A 3BN4A 4DCOB 1YVFA 4OX6A 3QRRA 2DRBA 1WKJA 2YTCA 5HP1A 1TL5A 3CW2C 3BDEA 3M4XA 4K4YA 4R25A 3M8QA 4AQYJ 1X4DA 4C98A 1WI6A 3D4JA 1TELA 2DR6A 4XDDA 4CO0A 4PAAA 5JMNA 4WP8A 2P8IA 1WSVA 4CO2A 5IFMA 3DXSX 4ZP8A 4OJHA 3BQ0A 2VJVA 2YNGA 4RUCA 4LFBJ 5IV3A 4ZPTR 3UDLA 3RZAA 5CD4H 4DG1A 1SC1B 4Y2IA 3MR3A 4F25A 3CUNA 4ED4A 4LR7A 2X3DA 2DR9A 3R6LB 5D0RA 2EBEA 2CZVC 4IG3A 3W1YC 3QRQA 8AT1B 3HZEA 3BGOP 2AQ4A 4PUOA 1Q78A 3OJUA 3AA8A 2B43A 1U1RA 2XLKA 1R27B 2DGSA 1JLGA 4IG0B 1PG5B 2DY9A 3OJSA 2XNRA 2OP5A 1KNZA 4JYAJ 3DLGB 1FEEA 3IRXB 5D0HA 5C42A 1YTYA 4HH0A 2Y0SD 2DHXA 3R2CJ 4QIWD 1CSJA 2I5JB 5DM6Q 4KJIA 1KHWA 5MLCV 1SH2A 1FFWB 1T9XA 3HKZD 1DTQA 5DZ7A 1S12A 4CT8A 2R7SA 5IXUA 1FX4A 2Y1LB 4DI6A 4NL5A 3N4WA 1NEEA 2UUCJ 5F8IA 1TVRA 4FF4A 2MZTA 2R7XA 3OD2A 3HSJA 3PJWA 3H98A 4CLUA 2HBQB 4W92B 1HNZJ 2L9DA 3IBFB 3ILOA 2M0GB 3ZZTA 5E0OA 1XMBA 2DJWA 3NNAA 5JJBA 2J5AA 2DEIA 4IFVB 4OX7A 2K3KA 2E9RX 1C0TB 4HDHA 1S48A 3TAMA 4ILLA 4RLEA 3VR1A 4TLRA 4DFPA 1JXVA 2OJ3A 2HNZB 2JOQA 3UPFA 2ALYB 2Y8WA 4ES1A 2FTRA 4M63A 4ILMA 3NGTA 2OMLA 1UL3A 1UVIA 2QMWA 3G2XA 5DDPC 1B64A 2ZDOA 1RT2A 4EO8A 3MM6B 3BSAA 1Z1ZA 4TU7A 2QV6A 4ETZA 4I2PB 2OD6A 1OMSA 3LOUA 2U1AA 3O3LA 3CPWR 2HBRB 3PR5B 1S1VB 2VC0A 4B9TA 3C19A 3LPEA 1FTRA 2HHPA 4HT7A 2EFVA 1XNQJ 2YNFB 5LMNF 1IXKA 3R7SB 1AZSA 5C25B 1AUDA 1VC6A 4ZVEA 1QLNA 3U1LA 1TV6B 1JXLA 1ZH5A 5KFOA 4R5PB 2RDIA 1YJ9S 2OEJA 4RW9B 5AT1B 4HL9A 5GMDA 2HHUA 1EETB 4OYAA 4MAKA 4DCJB 4C3KA 4ILRA 3OL9A 1MN7A 2UXDF 3CNQP 3BGFA 1SUQA 1N5QA 3SDEB 1SB6A 5JUMA 3AH6A 1LW0B 3LO3A 2MMYA 4QWEA 5KFMA 4Q5VA 1JKHA 2HNDA 2WVFA 4DJBA 1X5SA 4DUZJ 1X31C 1NZAA 3SI8A 5F8MA 4DQRA 3LQVA 1VCTA 5LT5A 5A0YA 2L9NA 2ZKTA 2DGOA 1XJWB 2B9WA 4DN0A 2GA7A 2C3UA 2Y9HA 3CC7S 2DNLA 4BS2A 3BZQA 4F2SA 4NCGB 2RKIB 4LF8J 3CMQA 1XNRF 2ATCB 1SJ1A 3GILA 2PIIA 4OYOA 2DK2A 3LUYA 4RNFA 2IC3B 1U09A 3FSYA 3OL7A 3TZYA 2LQBA 1WWHA 2D3O1 4NEZA 2A18A 2E5JA 3H2LA 2BANB 1N4LA 1F6TA 5K14B 4F3QA 4IRCA 3MAQA 2YKNB 2FJAB 4MT1A 1RT3A 2ZH7A 4ZVRB 2GJIA 2J76E 1Q1KA 2VQEJ 3MOZA 5AE1A 1T3OA 1V3SA 1FNOA 1P9YA 3F44A 3JXOA 4BHQA 3A1YG 2MY8A 1X0FA 3N5FA 3EX7B 5KFHA 1DFDA 5I42B 1D8YA 2XWYA 3K17A 4KT0C 1LWXA 4GKJF 2MTLA 3CCUS 3BS9A 3V5RA 2IY5B 2XY7A 3LAMA 1S59A 4TKTA 4DS4A 1VBZA 3R5AA 4CLSA 3WDOA 3Q23A 1ELOA 3QJLA 1VQ8S 3OTEA 4ZVQB 1S77D 1RT1B 5KFKA 3KLVA 2B51A 3D3CJ 4IDKB 3LALA 3GFZA 1CJKB 1UFKA 5F0UA 2PDAA 1VRTA 3DOKA 3PR4A 1Q8KA 2F63A 3EJMA 5AE3A 1E6YB 5A8WB 3CC2S 2ADCA 1F5AA 1OSDA 1RAHB 2XGQA 4Q0BB 5L9XA 2DO4A 2EPIA 2WRMA 4MIWA 3GG1A 2OPRA 4J9UE 2K1RB 4ED0A 1R8CA 2L08A 3SEOA 4DQIA 1F5CA 1N32F 3ZO7A 2VKRA 4FKXA 3PV8A 2KO1A 4LF4F 2ZITA 5J2QB 2D9PA 4IO9Q 4JI0F 2VDIA 3PW7A 1FK9A 3BYRA 4RO0A 2WOMA 4B3RJ 3GJQB 3J7YI 1WF0A 1KDNA 3JSMA 1WEYA 4ID5A 2FVQA 4K4SA 4QYRA 3PW5A 1TAUA 1FFSB 1T8EA 2MQLA 3WHIA 2Z2MA 1KOHA 3KTQA 4M5HA 3HMJG 2QA4S 3W2WA 1NDLA 3M2VB 4DV0F 1RLDA 2VQFF 3T9ZA 4URSA 2DB1A 1KKHA 4RNNA 3F41A 2JEIA 2JC1A 3U1MA 2MKYA 3I0RA 1HWLA 3CDWA 1S0VA 1H98A 3NP5A 2ADBA 2VG7A 4Y65A 1WC4A 3CIZA 2AGQA 3CJRA 1S1UA 1RWKB 1UVKA 2VASA 3ZNJ1 3J81j 2ZHAA 4JI3F 3KUGA 3Q8RB 3VAMA 3C14B 2Z0GA 3BSOA 2B6AA 4OYPA 2GQ2A 4QCLA 3TUJC 5DETA 2RRAA 2R42A 2XQCA 1OQ3A 5KFRA 4QU7A 2PE8A 2UUBJ 2YX4A 4M1KA 2KT2A 5IOLA 2C2KB 5L38A 2FLNA 4HTIA 4GKKJ 2ZNZA 3GIRA 5J1NA 2YBVA 1LXNA 1NPPA 5EHHA 4DL7A 3Q8QB 2LDYA 2XHCA 1NH8A 3FQLA 5DQIA 1PYSB 3NGDA 4F3OA 3BN7A 2NCKL 4OYZA 2W25A 2P2CB 2WONB 1SQGA 3M32B 1F5BA 4RU2A 2HFVA 3FSXA 3DM2B 5E5NA 1SPBP 1SQEA 2CPYA 1D9AA 3NCQA 2VPZB 1U8WA 2G2OA 4ZPWR 4AQYF 4AXIA 4PG7A 4PABA 2LKZA 3DOMB 3LGNA 3T5KA 2MQ8A 5THWA 3NWRA 4U67Q 2NYHA 1T9VA 3MF5A 1WG1A 3PDNA 1YJVA 1SH3A 5IC4B 1BQNB 1VQ5S 4HH1A 1T11A 4X4SA 1U47A 3PYEA 4KFBB 2BR0A 4DV6F 1TTHB 4RL1A 2BACA 2UZAA 5HQMA 1OS5A 3LF0A 4ZN1A 2GVDB 3HSDA 3KDOA 2RILA 2V94A 1DLOA 2VC1A 5CZVA 3EMTA 3KK1B 3THVA 5GAEU 2OSQA 1J27A 3UN3A 5CYQB 1MWQA 2J0XA 4JYAF 3QO9A 4TY8B 1VGYA 2V34A 3JAMY 1S49A 3MWBA 2R2UA 2ZBRA 4DV2J 1FTCA 3PG9A 5KFUA 4C3LA 1RDRA 4DSFA 4TY9A 3J81U 1GMWA 3O2IA 2VG5A 2RF2A 3E51A 4FYXB 1VI7A 3FEYB 1Y7PA 5DQHA 3MXHP 2CQPA 1F9EB 4DN9A 3CD6S 4ALZA 2MGZB 2V8HA 5E3PA 1RTIB 2DH9A 3OR1B 2Y1RI 4WF9Q 1TK5A 4DX6A 1X7VA 1HFEL 2V67A 2R8IA 4G1IA 4RUAA 1T94A 3ZTPA 4OYMA 3CCWA 1ZM3A 1TKXB 4O4GA 3QLHA 1NRKA 1QTNB 5K8OA 3BEGB 4IKAA 3FCVA 3DRYA 4HT5A 4I2QB 3MAHA 1LW2A 7FDRA 3G6VA 3UD4P 3OFEA 4R0JA 2F8EX 4M5KA 2RQMA 2HBYB 4B08A 4DL2A 4JP8A 1U4BA 2LQJA 1UPMB 1XNQF 5M2RA 1BMQB 1Q8IA 4AD6A 2IAJA 2JJ4D 1LOUA 4N76A 3DI6B 2FZKB 2EK6A 2XM3A 3CJKB 1VYAA 3PY8A 1ZA2B 5F8JA 1ZAVA 4PR6A 4WFNQ 2BM0A 1VIXA 1X5OA 3LW5C 3JQMA 2GNKA 3EXCX 3K58A 4AT1B 2ZDPA 2MEWA 3MCMA 4F02A 1RACB 2CPXA 4B02A 3C2PA 1UJ4A 5HP1B 4P7TA 3AJ2A 3DDIA 5H9EJ 2J9DA 2RQCA 3M9MB 1PYTA 1TL3B 4DUZF 3M8QB 4KGVB 2X1FA 3CCMS 3A13A 2AW0A 3KJVA 4EZ6A 1OO0B 3PW2A 2W01A 2LMIA 3QIDA 2OSRA 2G2YA 1IR2A 4ZVOB 3QATA 4DG1B 4K4XA 2A2DA 5AXMA 3SFUA 2APOA 4LF8F 4IG3B 1HNXJ 3OHBA 2MXYA 1HWUA 1WF1A 2VB6A 3KNAA 1P8GA 1JLEA 3M8PA 2UUTA 1JLGB 1X4HA 4C0OC 3NG8A 1MU2A 5FD1A 2NR0A 4LBHA 3M2RB 4E2FB 4P2XA 4CH7A 5LJ5Y 4NXMJ 1FRKA 2GX8A 1TR0A 1DTQB 3ITHB 3SXLA 2KT3A 3OFHA 3Q8PB 5F8HA 7FD1A 5GAGU 2C2NA 4LVNP 4YS2A 2A6MA 1CJUA 2VBXA 4F26A 4OZLA 1HNWJ 2IM1A 5IZHA 2DGXA 5CYJA 4QWBA 2ASLA 1U0SA 3CCZA 4KYZA 1DHMA 2YWGA 2H5EA 1TQLA 3BGRA 3T9NA 4CO3A 3UN2A 2HVIA 2KN4A 2LXFA 1RISA 4EMDA 2D41A 3IG1A 4JI2J 2HPUA 3ENQA 4R8UA 2XCPA 2ZZTA 3H90A 4O3RA 3VGSA 2HQGA 2Y8YA 1FX2A 1HL6A 3ICLA 2OELA 3D6HB 4LIWA 3GCXP 1AFJA 2W8LA 3MMAA 1A6LA 4MKVA 2WSFC 1C2PA 3P5BP 3MM9A 2ZWOA 1RJJA 2XB2D 4PXCA 5AXKA 3KK2A 1HBNA 4F4XA 1IQTA 3GR0A 4FNHA 4WJBA 3JTPA 1BE4A 4DV3F 3CSKA 3KYLA 1LFPA 1HMVB 2MHEA 2QL9B 4ED8A 5F8GA 2EVZA 4KH0B 2W8KA 2MQNA 4DQSA 2F7VA 4N7TA 2V2KA 1F9FA 1UWBB 1ZZFA 4FNIA 2CVIA 2ASDA 1IUJA 2VFVA 1RWVB 2MJNA 1YLXA 1WUUA 4K8RA 2GJFA 3RRKA 3UN5A 4B3SF 2MZSA 2MLYA 3UO0A 3RRGA 1EARA 4B3RF 4GO5X 2RE1A 5CAAA 3DLBA 2LYVA 3AOAA 2FVCA 3D9BA 4ZPCA 4MIAA 1JKHB 3MMJA 3TO8A 2HNDB 1RYRA 2ZC3A 1Q8BA 3DRXA 3BYPA 3UNGC 2VG6A 3HHDA 3HHLD 2MZ1A 3MM7B 3NS5A 3QQCD 1SJRA 1CEZA 3OFFA 3OXLA 4FVCA 1YBAA 3BKUA 1L3KA 3W9HA 5A0YB 1VJQA 4G1QB 1QUVA 2B0GA 2VUGA 2W2OP 2YVSA 2VL1A 1E6VB 4DR2J 5KG7A 3LGMA 3NMRA 1LK7A 4QZVB 2WSCC 5J1EB 2BE7D 2XY6A 2MZRA 1FD8A 4DR1J 4NLVA 4N8OA 4OZ3A 4GMKA 4D3GA 5J2PA 1H6KX 3IWLA 4WZQA 3GE9A 1U48A 4F3MA 3K59A 3W61A 3Q2SC 2PEBA 2G4BA 1B0TA 1NPKA 1M5HA 4ZJQA 3PX4A 3FDSA 4J9SA 1TKZA 4KRWA 3GONA 2GC8A 3UDEA 1HIYA 4PWUA 5B0EA 1RADB 1YJTA 2DNYA 1X9SA 2B7BB 3DGPA 1ZPVA 2DXFA 2FJDB 2E1MC 2V9WA 4GKKF 4KPCA 1ZPWX 1UW4A 1W2IA 3ILLA 2IA0A 3KLEA 3RB4A 5F3TA 1GK8A 1IJEB 4B3TJ 2BJ8A 4FDFA 2N7CA 3MCSA 4O23A 1EP4B 1DQ9A 4WU3A 1FKAF 3KLIA 4OYXA 4NLQA 3I96A 3R1HA 3EZOA 2DR8A 1NK0A 5KFZA 2POKA 5CHCB 1GX6A 2DY1A 1NDPA 1RKJA 3VTIA 3RB3A 2I8EA 3HSGA 3UCUP 4DSEA 4U95A 4QYZJ 1H2VZ 3H20A 3SIPB 1N0UA 3NOCA 2YKAA 1V3RA 2OPPB 3JB9k 1J5EF 4PEOA 3W9IA 4RU9A 3HHLC 4DPOA 2OI2A 4W90B 4KIAA 2JVOA 1B99A 1FKPA 1FE0A 5GAHU 1VRTB 4H4KC 4DR3F 3DC2A 3KLGB 3W2VA 3W8PA 3LP2A 1RKIA 3ZTQA 3ISZA 4DDFA 1QUPA 2VOPA 4WIQA 2HIQA 2IM3A 1O0PA 3PYDA 4FF1A 1RE1B 2FC8A 5LXYA 2AU0A 2H4YB 3OTOJ 4J9OA 1OPZA 2OPRB 1N6QA 4FZVA 3ZTOA 2JLGA 3R2DJ 5HMXA 1NXIA 3NEKA 4NLWA 2YNHA 1NJZA 2GW8A 2HZVA 3ADAC 4DV2F 1HHQA 1HBOA 4DPYA 4PKDB 4ZLLA 4HVZA 1NAQA 3TEHB 2OAUA 4JV5F 4DX5A 3VAIA 3E01A 3CMAS 4LT6A 3HJFA 2QYCA 3TAPA 1FK9B 3IBCB 1A7GE 3H42A 2EXUA 4CLPA 3JSMB 2O3DA 1Q4RA 4C8KA 1FWLA 2B4PA 3W5YA 2R7UA 3CCES 4Y2KA 3LP0A 1HWJA 3W2WB 1KTQA 3DYAA 3DU6A 3TJ9A 3IAM9 1GX5A 5KOXA 1UCNA 1FVQA 3M8ZA 2BQ3A 4FF2A 1S9GB 2XZWA 1WTFA 2R7OA 2BJ7A 4CLKA 4YY3J 2LA6A 2W2QP 9RUBA 3QGPA 1VIOA 2VG7B 1SIWB 1HBMA 2NUUG 2HMIA 5HAOA 3DHWC 3IMQJ 5KFFA 1RWOB 3G86A 2C3YA 3FRZA 4GC6A 3MAAA 5CZXA 1HI1A 3IO1A 1S6PB 1UVMA 3Q0AA 2DR7A 2KG0A 1IBKJ 2ZZNA 1Q0NA 1KEKA 4QWAA 2ZFHA 4X4OA 2CNNB 4HKQA 1EJ7L 2B6AB 3MURP 1REGX 2XULA 3T1YJ 3M8SA 4KC5A 2KRBA 3G6ES 5D4OA 3SCIE 5HLFA 4ED5A 1DRZA 3KJNB 1GNKA 1WTBA 2PO4A 4I67A 4DR7J 4LMZA 2I2YA 4ZITA 4WFAQ 4MKBA 1NBEB 4FF3A 2A10A 1RI7A 2WVCA 1YDLA 3W62A 2X1AA 3TI0A 1GFWB 4J9VA 2V8VA 4DOZA 4CLZA 3EGZA 2OLWA 2C3PA 2MKCA 5L1KA 2GHPA 4DMZA 1L3UA 1HHTP 3HK2A 4IRKA 2IBKA 1SBRA 1QAJA 3PJXA 2XYHB 3H5YA 5K20B 2J6TA 4FBUA 1X8DA 2H1YA 1GXUA 1GEHA 5DQGA 2GIQA 2H54B 3TZZA 2EEYA 3VAJA 1ZS6A 2QA4G 4F8RA 3VAGA 1FXDA 5K8NA 3X1LB 1S6QA 1HNXF 1T9YA 3TUZC 3DMJB 3C66A 1WG4A 5KFCA 4CRJA 1FNMA 4FYVB 3J7AN 3VAKA 2K06A 1S7IA 4GRSA 4OFZA 2JFDA 2NSCA 2HQDA 3H2VE 4DSKA 2DD8S 1KRPA 2C3OA 3TUPA 2C3MA 4MIBA 1BQMA 1WD6A 2VG5B 2DNRA 1SJQA 1RAIB 1FCAA 3HJVA 4RBVA 1AYEA 3L7UA 1FFGB 1TUGB 3PEJA 3RW7A 1HNWF 3D1HA 2PFDA 2R8HA 1HPZA 3LA0A 2KYZA 3KUHA 3Q83A 3IBWA 5KFDA 4QIGA 2XS5A 3ZXWA 3K5MA 2DNPA 4N8NA 1T7PA 2OHDA 3DGVA 5AXNA 4KGZB 5GMEA 1IBMF 5KFYA 2PI5A 1D3WA 3M2UB 4M5JA 1R6YA 3PXGa 2PMHA 1O5JA 2G13A 4O4GB 3FGVA 2DGWA 4BBYA 3UCGA 2AZ1A 4HACA 2HYIB 4H4OB 1WG5A 4LSNA 3GTYX 5J1PA 3FBBA 4H54A 4KHMA 3U7JA 4UOGA 4NMLA 2BQUA 2R7WA 5A6WA 4EBEA 2BRLA 5DM7Q 1RABB 3G87A 2YQ3A 3VAFA 4LR8A 4CI0B 2LEPA 3TVZA 1RT4B 3T6JA 2GO8A 3KWMA 3ZZOA 4CH1A 4WWSA 1T02A 3G8SA 4CNYA 1AB8A 2R9LA 3CCSS 1S0OA 3CD0A 1RTHA 1UFLA 4C7QA 3GMGA 1IWAA 1IQZA 1REVB 4IG0A 2AJ1A 5LMUF 4CIOA 3DLGA 3IRXA 4ZHRB 1YGYA 4WIIA 2GCFA 4PZVA 5I3QA 3KOAA 2I5JA 2HLTA 4S0MA 2EI5A 2VA3A 1T9TA 2VFUA 2HHVA 2GMLA 2BW2A 5KFAA 4FXDA 2DGVA 3PIOQ 2W9BB 4HHJA 3W8GA 2DBBA 2V4QA 3GIKA 4QBUA 2YKMB 2OKQA 1X4AA 1Q95G 4ERDA 2RQ4A 3KJFB 4EFAC 2ZH3A 2Y0BB 1YBUA 1IKWB 4N56A 1D09B 3KJVB 1P6TA 4O0IA 1LWEA 2G2ZA 4J90A 3LAKA 2HNZA 1RWXB 3UQSA 5ETLA 4DR2F 2ALZA 4ZKAA 1U1OA 5JVGQ 2ZJRQ 1FKOA 3UCZP 3NGKA 2M9KA 3OSPA 1G2EA 2EWHA 4DR6J 1F9HA 3ZZYA 5BYRA 3MM6A 3AFGA 1Q82T 4LRCA 3QGHA 4I2PA 2IBOA 4P71A 3M8PB 4NI2A 2W7AA 1X4EA 4ZVSB 1MU2B 3T5JA 1TZ0A 2YNFA 1W7WA 3BBFA 1P27B 5C25A 2DNZA 2MJUA 2HFUA 3H40A 4A4JA 1L5UA 2NZCA 1QVFR 3VHQA 2AYGA 4C3MA 2BJ3A 3I5AA 4R5PA 1G1XA 1CJUB 2VU5A 2B9EA 2DCLA 2CNOB 3D0HE 1OJ4A 3EVMA 4DV5J 1S6UA 4U96A 3FUYA 4HI1A 2FHJD 1EETA 2OFHX 1DJ0A 4B3TF 3DNCA 2IJRA 2IHR1 4ZA1A 1X0PA 3JYTA 4V1Ak 4OHXA 3ISNC 1LW0A 1N0VC 4CT9A 4MMOA 1ZM4A 3ZNUA 3CT9A 1P9QC 2RS8A 5M2PA 4IUFA 2IYGA 1PILA 4ZCMA 3IG1B 4ED3A 3NCPA 3VQTA 1DTTB 1IKVA 3T41A 2O1PA 1N36J 2D3ZA 2J6SA 2IVFB 3ZTSA 1Q7YT 1Q79A 4TQSA 2NXCA 4WK3A 1WACA 5MAOA 2AYMA 1RAJA 3KG4A 3MMAB 2FC9A 1RTZA 4N47A 4L75A 3MM9B 5HANA 4YOEA 1U1LA 3PIPQ 2RNEA 2L41A 2BJDA 2DNOA 1CVJA 1QTMA 3OXFA 2MKSA 4A8QA 3I5BA 3V6KA 2VOOA 2Q79A 1HBNB 2QYGA 5E3RA 2NREA 3MPUB 4JV1A 1XK8A 1G7CB 5CA5A 4N41A 2QLJB 5EWFA 1CJTB 1U2RA 3OTOF 5HO4A 2QRRA 2IC3A 1BXNA 2EFPA 3Q2TC 4LF2A 3BO3A 4YB5A 1RCXB 5K14A 4M5IA 4DPXA 3HLUA 2GVZB 1S57A 2YKNA 1MMLA 3OHAA 5DGAA 3NGSA 1QDUB 4CLLA 1B0PA 2WAQD 3MR5A 3AB4B 1RGVA 2MZJA 5I3UA 1P1LA 3A3OB 4K2XA 2CXEA 1EZZB 5I42A 1L3VA 3OBIA 4F0HA 2VF3A 4WXOA 3CCTA 3KHRA 5ETTA 1MN9A 4DSIA 4DEZA 3R97A 2FLLA 3FMBA 1AXQA 2HS0A 1UW9A 1NU4A 1RT5B 2KL8A 4USHA 4LFCF 2KHCA 5F41A 3BQ2A 2LQ5A 5LL6d 4G3IA 2ZBQA 3LANA 1RAFB 4B3OB 1RT1A 3NS7B 4U9RA 2GIFA 4IDKA 2GMHA 1VQYA 1U6ZA 1Q7LB 2ZH5A 1IBKF 4EU0A 5KFVA 1X5TA 2HEKA 1SI9A 3HX9A 4ITSA 4Z7YA 1X4BA 4G1PA 1N34F 4Q0BA 1AUSL 2NXJA 2VPYB 2ZE2B 5A8KB 1JLQB 2ZVSA 3U1NA 1FF2A 2V50A 3HVWA 3GV5B 2LEBA 3T1AA 4ECZA 2DYAA 1FNXH 3GYNA 1SL1A 2XS2A 3R9LA 4J9PA 4DR7F 2GHWA 1SH0A 2YXLA 3CVKA 2RD5C 5D15A 2ZM6J 4DPUA 2UXDJ 5J2QA 3L3CA 4ECXA 2BMBA 1MMNA 3MMCB 1OSCA 3GYGA 3KLIB 3KG1A 2Z30B 4Q2LA 3G82A 2JFKA 2CPEA 1GAOA 1WKKA 2J7WA 4KSEB 1M0SA 3FSIA 3LPYA 2HK3A 4Q7AA 1U24A 1O6XA 1PBAA 1VQPS 1CQMA 2CQIA 2RRBA 2PC6A 3PKYA 5SUHA 1KSPA 2EK1A 2D7SA 3M2VA 4NA3A 2M88A 2BUNA 2VKZG 1B3TA 1FERA 1I1GA 1GT8A 3LP1A 4YMEA 1FKPB 4RWXA 3K0JA 2VZ9A 2H9ZA 1NHUA 4J5OA 4LQ3A 4WPAA 2RMLA 4NA1A 3GV7B 2BBEA 1XNRJ 3GPAA 1F2HA 3R5BA 1OYEA 5KAKA 3PRDA 2KHDA 5ITHA 3A4TA 5H1SV 4P2FA 3IR6B 3OV7A 3C14A 3IR7B 2YNHB 1F0XA 1Y5IB 3N6LA 3BGLA 3LWMA 3PFOA 4RUBA 4OZ2A 1LFWA 4QJVA 4O44B 2CJXB 1XR6A 1FRXA 2XBPA 3E01B 1EAYC 3UNYA 1LNQA 2KJVA 2CYYA 4OHVA 5HQLA 3QJJA 2GZOA 3J7ZT 4MK9A 3AT1B 3BBCA 1UKUA 1C1BB 2RB7A 3ZZUA 1M90T 4DV1F 4PQUB 2FIUA 3J7YU 5IWAF 3DRPB 2ZH9A 3ZZPA 4GKJJ 3LP0B 1YIJS 4M5MA 1JJCB 4CZCA 2DGTA 3DYAB 3EM1A 4YQWA 2BXJA 1QAYA 4Z2XA 1GQEA 4C8YA 2CQCA 1ZYQA 3ZC4A 2DITA 4F50A 3QAEA 1BQNA 3U02A 2E1PA 1N5VA 3MAAB 3FBEA 4OHWA 2DNGA 4KFBA 4JBCA 3RR8A 2BDPA 4L6V3 1S76D 4Q8EA 4MK7A 1S0MA 2AF6A 3HVRA 1TP7A 3MZIA 4V19J 2FLOA 4DF4A 3C6TB 1OIAA 3KK1A 3D5MA 3B78A 2H48B 5CYQA 1NK8A 3BM7A 4B3MJ 2PFFB 3RGIA 2HG4A 3H7HB 5HLFB 3I82A 2CQGA 2RDJA 3G71S 4B9SA 1MG7A 1SJ3P 3G6XA 2UVRA 1U6FA 2LU1A 2AWZA 1N33F 2QSFA 1XMOF 4GVBB 3CJSA 4AUKA 4LF4J 3EDQB 1BHNA 3Q22A 3VZHA 3IRWP 2VFTA 2CQ0A 3MFIA 3NRBA 2ZEJA 5CCMA 2R7RA 3EPGA 1M5KC 4WYWA 4AL7A 2D69A 4HI2A 1H72C 1PC4A 1I5OB 4PQAA 3SV3A 3KMQA 5ETVA 2MGZA 3EVOA 1RTIA 1YRXA 4RZRA 1URNA 4TLQA 4DR5J 4FPIA 4NE9C 4TU8A 4EBDA 4DV0J 2MB0B 2VQFJ 4C4WA 1RBLA 3QT5A 4G65A 3PYGA 3JS9A 1NDKA 4QIFA 1JLCA 3FZ2A 2MQPA 3OL6A 1TKXA 4WKYA 3SSSA 4XDCA 4WZMA 4NXNJ 1B70B 1JLAA 4X4TA 2CZ9A 2AYEA 4KQZA 2QN6B 1LWFB 3V4IB 3PHTA 4USUA 3C15B 1TL7B 4DR6F 3P4UB 4ECWA 3EXYA 3RAQA 5BJRA 1IJFB 3T6BA 5G4DA 1NSAA 2RUSA 1JIHA 4I4BA 2W2NP 4LUBA 1HWKA 1JJHA 2Q43A 1FT8A 2VH7A 1R0AB 1S10A 1TUVA 3V81B 1JJ4A 4M8LA 4YUDA 4USWA 4K2JA 1KFSA 2UVVA 3QIPA 4A8SA 4QOTA 3N5BA 2PN6A 1ZTTA 1BQMB 3ILJA 3DI6A 3BV8A 4ZVFA 4FYDA 1RWNB 4ZPVR 1N5SA 1ZAXA 3M6WA 1FJGJ 2ZVIA 2B5JA 4O3NA 3CJKA 4DV5F 1PAEX 1R8HA 2MPUA 2QFJA 4XPEA 2IJNA 8RUCA 1DZ5A 1H7WA 1WKLA 3D0IE 4X65J 2NXNA 3N01A 1HPZB 3O6QA 1JB0C 4OZ5A 5D77A 1BGXT 4QYZK 2ROPA 1O8BA 1KP6A 2VV5A 2JSXA 2ZOGA 1FESA 4OX8A 2K3IA 2DTJA 3HXMA 4CTAA 1TL3A 4RW7A 4UT4A 3WC2A 1BY9A 2FHOB 4TU9A 1N36F 2QJ3A 1FRMA 1Y3KA 2R2RA 4HACB 4KO0A 2EKNA 1VQ4S 4LSNB 1BLUA 5C24B 4NA2A 5F3ZA 1KQFB 1NMEB 1WDTA 5HMZA 2H51B 5EUHA 1LEOA 1HWIA 4DV6J 2GS8A 4X64J 1NKEA 1GXTA 3GQCA 5EX3A 4LSLB 2AJ2A 3K5NA 3AB2B 1HKAA 2JX2A 5KFSA 1Y5LB 2C22A 1RTHB 3ZZRA 1KTVA 4F67A 3R5DA 5D3GB 2KU7A 1SIZA 4X4VA 2IA6A 4F4AA 2QX0A 3M2RA 1RP5A 2XZDB 4LJMA 2VBWA 4IO1A 4YP3A 4TQRA 4CCHA 4ELVA 2CJYB 3ULHA 3R3TA 3BDPA 3ITHA 2RQKA 2KKHA 5JVHQ 1U1NA 3EGNA 3OUYA 1Z4UA 4O4RA 5C2GA 2J9DE 1Y10A 4I6AA 2DRAA 2HHTA 2R8KA 1UEKA 5HVFA 2KJWA 1LKZA 3I32A 3W66A 1K8AT 2KB2A 3GU0A 2ROGA 3BR9A 2OUGA 3D6FB 1V5VA 1WOOA 1EQMA 3DRRA 1LWEB 1U1MA 1VQSA 1V3ZA 5T14A 3O1LA 2BE2A 2WVBA 4OV1A 4WBFA 2Z2YB 5A76A 1URRA 3H4DA 2X7IA 2UV8A 1FKOB 2J9EA 2MHNA 5FJ4A 4ANEA 2V8DA 3K7RA 3W5XA 4DX7A 3AODA 2LLZA 2V9KA 4NEYA 5ETRA 4NI2B 2HVZA 2CPHA 2XMUA 1WHXA 4MYTA 4K4ZA 2JL9A 2MKKA 3W9JA 4MH8A 1HMVA 5HJXA 2KFZA 5GVQA 2CDQA 1UP1A 1B4SA 1RQ0A 2U2FA 4P10A 2RS2A 4KTQA 1S1XB 2D3OR 4PPDA 2KFNA 2J6UA 1IR0A 1UWBA 2RIJA 5RUBA 2F40A 4JI6J 5E41A 4OYWA 3J7A1 3W3SA 3SV4A 2ZM6F 4ED1A 1CLFA 2ZD1B 4RR5A 3JYTB 1D1UA 5KFEA 3MM8B 2HRYA 3TRGA 2MSTA 3SYZA 3QFHA 1BQXA 2CJKA 2V4RA 4IR9A 3GJTB 4K50A 2R4FA 2LCWA 2ACYA 2ZBPA 5F9NA 1NSPA 2X3GA 1D9FA 4A46A 1IKVB 5B0FA 4Q2MA 2COLA 1KVKA 4WCEQ 3PCOB 4CO5A 3IA0A 3MM7A 3OTBA 3CJ8A 3MD3A 1MLAA 4G1QA 3AXKA 1UVJA 4ED6A 1YJRA 2O5DA 4FVMA 1MNEA 2RT3A 3RJMB 4ES3A 1ICEB 1LK5A 1E6VA 4DQPA 1U6BA 2CPFA 2J7UA 3BB5A 1Q81T 3S7RA 1S1TA 4C11A 5J1EA 3HVAA 3BH6B 4L3NA 5BXIA 2AD9A 3GFYA 3Q89A 3J80Y 4CLWA 4KY3A 4JV2A 1RCOB 2IFXA 3E3XA 1J5OB 3G9CA 4LIRA 4RPFA 3OVAA 1RT7B 2XLJA 1JWWA 3FFIA 2WBMA 2AJFE 2HHHJ 1VQMS 4NWBA 3FK4A 4OQJA 3SBMA 3BSCA 2IM2A 4A8MP 1HD1A 2AGOA 2OEMA 1FRHA 2E44A 4DR4J 1UZDA 2WW4A 3JSYA 1R0BG 1FJEB 1UEVA 1Q16B 1YWXA 2BABA 4XPCA 2KXHA 2W24A 3MR6A 4HYKA 5KFXA 5I3UB 1WHWA 2L9WA 2E5HA 4DUYF 4L73A 3IWNC 1YX2A 5L1LA 2CA9A 1RUSA 1EP4A 4MKAA 2CJAA 5L39A 4UTGA 2CAJA 2HRUA 1XERA 2AJ0A 1YJUA 3CJ3A 5DG7A 1JNZB 2M70A 1KVJA 2XMAA 3NS6A 2KH9A 2E29A 4M5GA 4A8WA 2CJQA 4DV4F 2JH3A 2OPPA 4OZJA 3ONQA 4WXWA 5F8LA 3FRYA 3CB4A 3KLGA 3H5XA 3EICA 2DGQA 2CRLA 1U2FA 4DV3J 3ENAA 5AJ3F 1RAEB 2WSEC 4ETXA 4BLGA 4PG4A 2M3DA 1TKTA 3IM8A 4B3MF 1AW0A 3NNCA 2B9XA 3PFEA 2FGCA 1LWCB 4URQU 1H2UX 1CBKA 3KLFA 2RU9A 3VAHA 2FJXA 4ZN3A 5FDLB 1KHVA 5LSOA 3DU5A 1U1QA 4B3SJ 1PIEA 4JI8J 1NK4A 1RZMA 2DNMA 3QSIA 3G82B 1N88A 1Y3JA 3WQPA 2FJVA 1KN6A 1O51A 4EGLA 4DR5F 2KXFA 1QD1A 1H73A 1PSDA 4HTJA 2XG8A 3MTKA 4F7VA 2XLIA 2A1BA 4RUHA 3FZBA 5IM0B 5CABA 3LP1B 4EWTA 1S9GA 1XR5A 1YK9A 2DR5A 2QZ8A 4LF7J 3NOGA 4NXNF 3CCLS 4R0EA 3V2UC 3SCJE 3PZPA 1KC8T 1HBUA 4Y2AA 2ZJPQ 2C2RA 1KQKA 1X4CA 1S9EA 3UD3P 2K7JA 4OIXA 3UD5A 1S6PA 4UOCA 3VVUA 3HI9A 5ETMA 1N5YB 1UPPA 1CJVA 8ATCB 2I1RA 1PJ7A 2PD1A 3GIJA 3KLHA 3PTWA 1SKUB 1S9FA 4QR1A 4QIEA 5F8NA 3TOQA 1QSSA 3BBBA 4NRUA 2FZGB 2X51A 2P9EA 1CG2A 3G4SS 4J9KA 1YZ6A 3BQ1A 1FJGF 4KPYA 1QY7A 4B17A 2Q6BA 1WC0A 1Y0HA 5IT0A 2HLUA 4F4YA 2I0XA 1FDAA 2CJBA 1XTZA 2V4JB 4X65F 2VDHA 2DNNA 3D54A 2GJ2A 2LA4A 5CH7B 1VC5A 1R43A 3QMQA 4AFFA 1Q5YA 2QLBB 4EEYA 4I7FB 3DXBA 3C16B 3S01A 4F04B 2OIHA 5L9NA 3E2EA 1GTHA 1M1HA 1ULRA 2HGNA 4ZS6A 4KGXB 1WOPA 1LV5A 2OFGX 3QZ7A 3QRPA 1RTJA 4PCQA 3MTJA 1NK7A 3DLJA 2FYXA 2FJEB 1J5EJ 4ED2A 3V6DB 2JLFA 4UY8T 4EBCA 4X64F 2YX7A 3IS9B 2GMJA 4DR3J 4UUWA 2A3JA 3WIUA 2E5LJ 3JSBA 3CD5A 1K47A 4OI3A 4OV6A 1J2VA 1OY8A 2XMWA 3FEXB 1XR7A 3EZUA 2ZHBA 3DMJA 2DNQA 2YKPA 4P74A 2HHSA 1WC1A 1FDDA 3LWLA 4CNZA 3W64A 1B7FA 5DDRC 3H5UA 1EHWA 1VRUB 3G8QA 1VQOS 3GYXB 3MGJA 4WKRA 1YQHA 3EGVA 4K59A 4QPXA 1TUWA 2CJ9A 4USKA 2Q66A 4JV5J 2DXDA 2YWWA 2DT9A 1G6BA 2IYIA 4P2SA 4B9UA 2FHMA 2XYGB 2GGPA 2E7XA 4OJGA 1H2TZ 3BSNA 5L46A 4IH7A 4WP3A 1UFWA 2KI2A 1RHKB 3BJYA 1BUXA 1U49A 4LF5F 3MEGB 1VQNS 2NS1B 2VPWB 3TA1A 2BKOA 1FEHA 3J80U 5AE2A 3CGIA 5KT7A 5B0GA 2HVEA 2BOPA 5I3PA 5CYMA 5EGYA 4LRAA 1VK8A 3RG6A 2EBGA 4I6YA 3M2UA 1JLCB 1PAUB 1R0CB 2G0JA 2JVRA 4USVA 4QWDA 1B0VA 4NYZA 3THTA 3SQGA 4W98A 1NKCA 1JLAB 4X4PA 2PMZD 1X5PA 4H4OA 2ZOMA 1SC6A 1HNVB 4OLOA 2XC9A 4I56A 4ZP9A 3CJQA 4X4UA 1GMVA 1NLKL 1WELA 5HL7Q 2MYFA 3NAHA 3TA2A 4ZDNA 3G96A 3D3BJ 1ZTWA 2E1CA 1L3TA 4J9MA 2CPJA 1N48A 2L48A 2XO7A 1RT4A 4PWDB 4KGMA 3MCOA 4RNOA 1MSWD 4O3SA 3MECB 2RH3A 3CF5Q 2HBZB 2PI4A 4ZLJA 2W7PA 4TYAA 1OWXA 3QIPB 2E1AA 2ACMA 1REVA 3N6NA 3N9UC 1ZAWA 4AL6A 4X66J 4ZHRA 3MFHA 4NYOA 2B5JB 2RHSB 4JI6F 2LQ9A 2R7VA 2UU9J 5IT9Y 3VF0B 2HGMA 2OO4A 1G3OA 1NCLA 4ZP7A 3GFXA 1FI4A 2B4OA 2W9BA 2EG2A 4YEAA 1SKRA 2YKMA 3DOLB 4CTAB 2UVUA 4RW7B 2O66A 2M5YA 4NZ0A 3SCKE 1YBTA 1S79A 1IKWA 4WYLA 4BCAA 2XSJA 4PG6A 1RLCL 4KO0B 2J8SA 1TFYA 2BM1A 1RTDB 4IFYB 1U8SA 3AJDA 3H2UB 4RW6A 2GO9A 4X2BA 3UVJA 1S6OA 2M2BA 4K7QA 2ZH1A 5D4NA 3DN9A 3L9ZA 2BJ9A 4ECTA 4U6PA 1IBCB 4CM2A 3QBCA 4F4WA 3TJ8A 4C97A 1V9OA 5KT4A 5J2NA 2IIHA 2HKEA 4H4MB 3T19A 3ET6A 2HHHF 2DH7A 3HO1A 3QT8A 3D66A 3I0SB 3IFEA 1RHMB 4OZNA 7AT1B 4M5DB 1DARA 4DR4F 2CWXA 3OUYB 2HRTA 3S1TA 2G0IA 4OZ1A 4NOHA 2AV5A 4P6QA 1VBXA 3TUIC 1QSLA 2QLXA 3NCRA 2IPOB 2J0WA 5IS2A 2OPQA 5LOQA 2CQ4A 3I31A 4NASA 3HFZB 2VBZA 3DRRB 3SZ2A 5C5JA 2G1HA 4K4UA 3BREA 1IBMJ 2AEMA 2DPJA 1DTTA 2BZ2A 3M9NB 3T1HF 2BE2B 3AD7C 3HKWA 1SJ4P 4KAIA 1D9DA 1ITPA 2R8JA 3QAUA 1JNRB 3GZ7A 1NJXA 1RSCA 1RHUB 4UOHA 2V2QA 1VQKS 4KR0B 3NGRA 3MOJB 4UW2A 3Q86A 5K5MA 3KHLA 2F9JA 3ZFVA 2G9OA 2V8GA 3K57A 2LXUA 2KZZA 2JWNA 5KG0A 2BVZA 2R7TA 5DZ6A 1VHIA 3POTA 1S72S 5DGBA 4RX6A 2YKQA 2ZUAA 1IWGA 4DPWA 1CJTA 3R6GB 4G6VB 3M8RA 3F73A 2QEXS 3MEDB 5LMUJ 4QQBA 2HHWA 2W4DA 3JSRA 4GO7X 3HFKA 4I64A 2ASJA 2FDNA 2GVZA 2VPXB 3D0GE 3MR2A 2J9CA 2F9DA 5IC6B 3AQOA 2I9SA 5IV4A 3FBFA 1G4CA 3PX6A 2LFVA 5KFJA 4CO1A 4JI8F 4IR1A 4ECVA 1YI2S 1NM2A 3TVYA 1RHQB 1S4EA 1CULB 3L7OA 3QJPA 4WFYA 2G0CA 1VBKA 2B4VA 4UQGA 2YQ0A 2UUWA 2F8HA 2ZH8A 2EC0A 1T95A 3D2WA 1RAOA 3Q24A 1A9NB 1VLYA 3F56A 2LEAA 5IQQA 2PA8D 2EKYA 1SC3B 3S8SA 4WFXA 4PWWA 3JAMU 1RT5A 4LF7F 5HQ8A 4J9QA 3KHHA 6AT1B 4ZVUB 5T7LA 3N28A 3TX8A 2DRDA 5E33A 4JUZA 4RW8B 1S1TB 4C11B 4B3OA 3RUBL 4Y00A 4ZOSA 1NSQA 3T3FA 4B9VA 3RAXA 2YWKA 2V68A 5KT2A 3TNVA 1N8RT 3EE3A 3IN5A 3FQKA 4M5NA 3GP9A 3D28A 4K0KJ 1VHFA 4J37A 3FFIB 5CD4A 3C6UB 5KT6A 3VGUA 1PJ5A 4DHVA 3FVYA 5ETKA 2ZE2A 5A8KA 1JLQA 3MPWA 2JEJA 1DURA 2MLZA 3OR2B 3B54A 2EFNA 4CYUB 2DH8A 3RTVA 5DO2A 4BC7A 4HLBA 3MEEB 1KLMA 3I5CA 3MM5B 1JMTA 3HVTB 3OPKA 2ZHOA 2WCXA 3UFCX 2B8PA 4NPOA 4IYQA 1SL2A 2QG9B 3MMCA 4OL8A 2FVPA 2C2DA 2KG1A 3DLKB 1Y00A 3AD9C 1FHTA 4DLGA 4IH5A 1GXLA 2AEFA 2UXCF 3J81Y 1T03B 1FDNA 1NO8A 3L7PA 1YHQS 2F4FA 4Y28C 4M94A 4DU8A 1QSYA 4OYBA 2W4CA 4GC7A 3PO4A 3PX0A 4NLDA 4ZVGA 2AMCB 4E0DA 2OPSA 1AA1B 2QO3A 3H8YA 2GFFA 5IT9U 4NLTA 4FXVA 1N56A 2NSBA 3NAIA 2E5LF 1MMDA 3A3PB 4C9DA 1T05B 1FRIA 3OL8A 3T5LA 1H0HB 1RT6B 3F0NA 3PM9A 1TKTB 2DEJA 1YZ7A 2D3UA 2NYIA 2BQRA 2CNLB 4MFBA 3GR1A 3MUVP 3KLFB 2B9YA 1S1WB 4O44A 4F4ZA 3R8YA 3FEZA 5HROA 3ETOA 1ZBTA 4Z37A 3I9V9 3GWCA 4DL6A 2XTJP 2A0FB 3EGWB 3SCLE 5HJYA 3ETMA 4J9RA 2AEJA 2HFOA 1C1BA 4PQUA 4KHRA 3T5HA 1HQUB 2GV1A 3DRPA 5U47A 4J91A 1AFIA 3FCHA 2HWTA 1KWMA 4K5RA 5KFIA 2A2CA 5ETOA 2IJFA 3LGHA 4LFAF 4BDPA 1ZOTA 3KMSA 4LFCJ 2ABYA 1HW9A 3P3DA 2M8HA 2VFRA 5L1JA 2D74B 5J2MA 1HBUB 5D78A 3I6PA 1S9EB 1Q8LA 4NYPA 3KKFA 3GFHA 1SVDA 5DLGA 2HQCA 4AE5A 5KTQA 1CJVB 3CDUA 4DU7A 2HSEB 3KLHB 1HI0P 4JOUA 1N34J 2UXBJ 2PA3A 3C6TA 1YG0A 2MKIA 4A8OA 3I4PA 3HFVA 4HHHA 3K5LA 4X66F 4QWCA 3CO0P 1YJ7A 5EN1A 4KB7A 2UU9F 2WVEA 1SXLA 5DDOC 1WSRA 4GVBA 4AXJA 3CJ2A 4AYBD 1U2CA 3X3UA 4FKYA 3AD8C 1MROB 3NL0A 3L4BC 5E3CA 2LQ8A 1FE4A 4FP9A 4ELTA 1RA6A 1QJHA 4JI1F 3TARA 2KFYA 4KE5A 3KNGA 5KFPA 1UVLA 2QL5B 2YKOA 3PW0A 1ROFA 1HQEB 4N77A 3DHXA 3I55S 3W60A 1TMMA 3A8IA 1RWPB 4TXSA 5GMKa 3M1VA 2FY8A 1FJCA 1EQ0A 3KHGA 3VALA 1F3VA 1JXEA 2LVWA 1U25A 3FNNA 1RTJB 2HGLA 3JQKA 3NBPA 2KM8B 1IKYB 2ERRA 2JNJA 3RR7A 5BYQA 4YHHJ 4RNMA 1LWFA 2FHJA 3V4IA 3C15A 1TL7A 4DSLA 3A3NB 4HHUA 3AQPA 4QU6A 4DSJA 3ZZ0A 4DL4A 3TANA 5ADZA 3BKFA 1EB0A 3HPOA 3Q8SB 4CH0S 2Y3YA 3WX8A 4Q44A 1R31A 2BV3A 2F4VJ 1M1KT 4LF6F 2JHEA 4OI4A 1R0AA 4LF1A 3V81A 2HAIA 3G8TA 5BR8J 2IRYA 2O67A 1K73T 4LVOP 3HSZA 4C8OA 2ZZMA 4PRFA 2KT5A 3M05A 3MMBA 2GGPB 3H5SA 4M5LA 3OW2R 5LJ3Y 2CZ4A 2P6SA 4IH6A 1JLBA 1KBRA 4USJC 5HN0A 1GH8A 4YN3B 3ILIA 2FB0A 1U0HA 1Q53A 1N52B 2LDIA 4DV1J 2H65B 2CQ2A 5IWAJ 4WFBQ 2NUHA 3M8WA 4QIVA 4WTYA 5CYMB 4AL5A 3UE2A 1TL1A 4KH1B 1K1QA 3UR3C 3EWGA 3TWZA 3P8BB 1KQGB 2J8AA 4LFBF 3SQGB 2HURA 1HNIB 2A6OA 4DL0C 1FA0A 4IQMA 1W25A 2CPZA 3KFWX 5C24A 2N82B 5DLFA 2LP4A 2DNHA 4P75A 3PRBA 1RA7A 2CNKB 4LSLA 2QTWA 1ZA1B 2HNYB 1S0NA 1QM9A 1H3DA 3HHLB 2OTLS 3B4MA 4DL5A 4IOCQ 5BYSA 3AAWB 4DS5A 1KVIA 2X1BA 2HQ3A 2HIYA 2DKOB 5D3GA 3OXGA 1D0EA 1UTAA 3FMWA 4Y2CA 4NCAA 4DXLA 2HWIA 3ISND 4OHYA 1X9MA 2UUCF 5GADU 1VRQC 1N33J 1XMOJ 2KTQA 1SCJB 4OLPA 4DV7J 1HNZF 2JEFA 5E3QA 1RAGB 3US5A 2Y1IA 3Q8YA 2BA9A 1RU2A 4DL3A 2D1CA 1NK6A 1RYSA 2W9CA 4LF9J 4LSZB 2DXEA 5A8RB 4OMFG 4A8KA 2PT0A 4NLSA 2EFGA 2XMMA 3TQEA 3SMZA 1U26A 2DHSA 4FBTA 2XMTA 5I4MA 5B08A 2WB1D 5KT5A 3SQOP 2XSJB 2IVYA 4I6WA 5H9FJ 3OTDA 1Y5NB 4C8MA 2CQ3A 4X84A 1DAXA 1A0OB 4ZP6A 5F0WA 2PGCA 4RW6B 3HCXA 2GIRA 2BKPA 3DRSA 1SKWA 3UVJB 4ZPAA 1Y4ZB 4TNOA 3K2YA 1TK8A 2SXLA 2XYPB 4RNHA 3UW1A 3G6YA 3JTOA 3J7Z5 4ICLA 5J2NB 2FQQB 4K0KF 3JTNA 4Z7CA 4NLUA 3ET6B 3HZGA 2I6WA 2IRXA 1QAXA 1IKXB 3CC4S 2NXUA 3DLEB 3RW6A 4ZCLA 1S1XA 1MWZA 1C1CB 4FN5A 2NLWA 1JLFB 4CLYA 4ZMMA 2VD3A 2CADA 3WIVA 5E7OB 2ZD1A 2Q3PA 2OPQB 3CJTA 3D68A 3MM8A 4L72B 4QPTA 1KONA 1PCAA 1OY9A 4JB8B 5ETPA 3GCWP 1XIQA 3OQ2A 2ZWPA 4NZ6A 1UJ5A 2QMXA 1VLOA 5KG4A 3VGVA 2E5IA 2OD4A 3SFGA 3BR8A 5D0GA 1BC6A 2YNGB 4L3KA 1P1TA 1WI8A 5B7WA 5KT3A 4ZVTB 1PKUA 3TP2A 9ATCB 1RHJB 2CIMA 4RW4A 3CO9A 1D8ZA 3CIMA 3OVBA 1YSJA 1SQFA 1X60A 2UP1A 4C48A 4PUOB 4EZ9A 1I51B 1VR6A 4ZIVA 2BYCA 5FLXY 4ECQA 4Y6IA 2XMKA 3R7NB 4JI5J 3POTB 5C42B 3LH2S 4DWIA 1NUEA 2YX1A 2P9CA 4ZIWA 5HATA 4U7UD 2FLPA 4DFKA 1J5OA 3RBDA 4URGA 4PG5A 2VQEF 3ENWA 1RT7A 3CJ0A 3TX0A 3KDNA 4NZ7A 1K0TA 3R7BB 1TVRB 3ELHA 3DFEA 5G0RA 4OI6A 3KUEA 3S6EA 4FYYB 4FYWB 3GJSB 3HT3A 4NRTA 2VHGA 4JI4J 3PJ9A 1M5PC 1XEZA 1TK0A 3TAMB 2QE5A 3B8HA 1IR1A 2HVHA 4QR2A 3M6XA 1VC0A 3M8YA 1X4FA 4X4NA 1GMWD 4CQ1A 3MUMP 4FS1A 3C3LA 2ZUGA 1RT2B 2HK2A 3EYZA 1APSA 5T7LB 4ECUA 4U7UK 2VA2A 4GVLA 4ZK7M 4NLOA 2PSZA 2HS3A 3CEDA 4Y3CA 5EDWA 2YNIA 1QE1A 4A8XA 3HP6A 2ZOFA 4RBUA 1AZSB 1TL4A 4YB7A 2VICA 2V2ZA 4BWMA 4FPRA 5CXTA 4C0BA 1UAWA 3KXDA 4Q45A 3E8OA 3TJAA 4NCBA 4A47A 4MYUA 2UXBF 2HVDA 3OLBA 5KFGA 1HR0J 2L3MA 5K9FA 2Y1JA 1N54B 4YR2A 1SUQB 1WJ9A 3TQ1A 3A12A 1KLMB 5E2QA 1VMBA 1LWCA 1ZZNA 5ETSA 3WBZA 2KM8C 5FDLA 3RB6A 1JJ2R 2EG1A 3NNHA 3KG0A 2D9OA 1PBUA 1N5TA 1S97A 4YFUA 2HAFA 3CWJA 2AIRB 4A48A 4C0HA 3MPYA 2CQDA 1K44A 4QW9A 6FD1A 3M30A 2V0NA 4ATNA 2K7KA 3HHNB 2XCAA 2CG8A 5IM0A 4YR0A 5KFQA 2I38A 3EPIA 4KV8A 5K8PA 2OPSB 3V6HA 3OT9A 3FC9A 2BW7A 1GMUA 3R5GA 4YB6A 1F60B 3WC0A 4PG8A 4YHHF 3IM9A 5KFLA 3W63A 4DX8H 4N5SA 1YJWS 3R5CA 1C4CA 1WF2A 4ENOA 2FUG9 3VQSA 3BPDA 2K2PA 2XO6A 4K4WA 2AX0A 3RBXA 1N5YA 1T9WA 1RT3B 1NHKL 3HT0A 1UA0A 2ZJQQ 2F4VF 4PYAA 2UUBF 3P5TL 1S4FA 2E1RA 2ASYA 4MFBB 2CWKA 3HULA 1K9MT 2KYXA 4YB1P 5BR8F 4PYDA 4X4RA 2YWHA 1DBDA 4OI2A 4DZDA 4YDXA 1ZM2A 1FWKA 3HHKA 2Z57B 2R3VA 2YY3A 5HROB 3OLAA 1KS2A 2WZ1A 3R5JB 4XK8C 1YJNS 1W2BR 3QPIA 1TMJA 2V4JA 4DUYJ 5KG3A 3ZZZA 1HYSA 2LXIA 4DFMA 4USTA 1CS4A 2FZCB 2W4PA 5HBMA 4I7FA 3AY0A 3D67A 1SL0A 4LREA 1Z2ZA 2EFQA 3R1LA 3C16A 2CPIA 1H7XA 4DUTA 4UQTA 3I87A 1SJFA 3H59A 3DOKB 5M2UA 2ATLA 3P49B 3IXQA 5J2MB 4XIUA 4DV4J 1KQSR 4KHPJ 4TN2A 3FBCA 2M52A 3OFGA 3V6DA 4HR2A 1C0UA 4ZLPA 1DQAA 3QFWA 3U27A 3QWPA 4X62J 3IS9A 3Q8VA 2ZH6A 2RVJA 2JEGA 2HHQA 3C8YA 2HWHA 2DISA 4DF8A 3UR0A 5AJ3J 4O0NA 4LBIA 5B09A 4WE1A 4USMA 4ECYA 4C8ZA 2V2VA 3RBZA 1VRUA 1UMJA 4WTOB 3A8EA 4F2RA 2F3JA 2HS4A 2WOMB 2E7VA 1RWUA 3NY0A 4EO6A 2XI3A 4ID5B 3I4HX 1Y11A 4DV7F 1PJ6A 4LRDA 2C2ZB 4V19X 3KK3A 4I0WA 4ECRA 3DDNA 2W2MP 5FLXU 4LF9F 3M1VB 3BPSP 4YDDB 3MEGA 2UUAJ 3QT6A 2KVQE 1FVSA 3I0RB 2BKNA 3NWGA 2XGPA 5D8HB 1RU1A 3TR5A 3NBPB 2ROEA 3O5TB 1S1UB 4OX9J 2VJUA 2Z58B 4F4KA 2FHKA 3CMES 1EKSA 5L8RC 5B0AA 1LQ9A 2HQIA 2Z2ZA 1HNVA 3GIIA 1TFWA 1UZHA 4F0KA 2W2PP 4ECSA 2RSQA 5GAEI 3I56S 1RBOB 3QGGA 1M5OC 5HVGA 1UWAA 4PXEA 3CXCR 2W9AA 2RUGA 1PGZA 3M9OB 2J7KA 3PKMA 2Z8QA 4PWDA 4QW8A 2IMOA 5KOWA 3MECA 2X1GA 4D3HA 5DJBA 1KLNA 2UV8G 2N4CA 3MMBB 3L95X 3QWUA 4Q8FA 3NXZA 4MTPA 5LSRA 5DG9A 3K8WA 1FRJA 4PPZA 1JLBB 1R89A 1U0HB 5C2CA 3M6VA 2XS7A 1HLWA 2FD2A 2IMWP 4ANCA 5DG8A 1UETA 1SV5A 1WEXA 2CQ1A 1F2GA 3BO2A 4HEA9 1TL1B 1L3SA 2GAGC 4EYIB 3K5OA 3DOLA 1K0VA 3P6YC 2CKWA 2QLFB 4P73A 3LTOA 3PNIA 3PHEA 4K5SA 4A8FA 4JI7J 4HDGA 1FXLA 1NJIT 5K8MA 2M7SA 4DFJA 2NPIA 5SZTA 3O44A 3WX4A 1OYDA 1RTDA 4IFYA 3OVSA 4F36A 3MUTP 3MI7X 2DPIA 1DLOB 2ZKUA 3IP0A 2B3TB 1HQ2A 1XMQJ 1F3FA 2XI2A 4JI5F 2MSSA 3QO9B 1RK8A 2QA1A 2R2SA 4MKYA 2BJEA 3CCQS 4EI2A 4NXMF 4KKOA 3PACA 1KFDA 2EFOA 3O8WA 1UA1A 2ILYA 5AXLA 1JX4A 2CQBA 3CCVS 4H4MA 2RF2B 3W65A 3MD1A 2XNQA 3I0SA 5EWGA 2M8DB 4M5DA 5ETQA 4OHZA 4E8UA 1KR4A 4P7VA 2CDRB 3P45B 2NXEA 1VS3A 2YH0A 2KXNB 4ES2A 4JI4F 4TYBA 2W9CB 2CUYA 1RXOB 1RBAA 3NKYA 4JI2F 2WBRA 4Q43A 2FVRA 4LF5J 2YQ1A 2PEHA 2MKJA 1WOSA 3W5ZA 1NK9A 1CC8A 3QLHB 3HM9A 1OY6A 1S7HA 5ETNA 1VOMA 4C2MA 3CCRS 1LW2B 5FIIA 1VQ7S 1R7IA 2ILZA 1WORA 3DRSB 3TA0A 3N6MA 4ER8A 1W26A 3TZXA 1CC7A 3SSQA 1NK5A 3WZ0A 2HQFA 4RBTA 3UWTA 3B6BA 5HMYA 4CLFA 4OZ0A 2JZ5A 1BWEA 5B0BA 4ICLB 2IAJB 2OH2A 3ENVA 1FO1A 3QZ8A 3VV2B 4P2MA 2ZC4A 2ZH2A 3W7BA 5KFTA 1NZ8A 1HR0F 4K4VA 3EUNA 1Q5VA 4ZPDA 5GAGI 2KZMA 2CPDA 4ZJLA 4UZCA 4LRFA 2HHXA 2H5IB 3MEDA 4U8YA 3C46A 2WTFA 1U7LA 5D4PA 2XSFA 5B0CA 4QR0A 5D0EA 2QL7B 3CDEA 2BOAA 1U45A 1JK9B 3UDCA 2ZBIA 2QT7A 4UY85 5LSLA 2NQPA 2P5VA 4U8VA 4C8LA 1V5IB 1NJWA 4P72A 4IFVA 2JDJA 1CULA 3HD2A 4WP9A 1C0TA 1NB7A 3MR7A 4NX9A 1XQIA 2HFNA 4ELUA 2N3LA 4I68A 4PXDA 4DLEA 4DQQA 3GB0A 1Q86T 2E66A 3AJ1A 2QLWA 3D1OA 2Z2LA 2FPHX 4RW4B 3M6UA 4DR1F 5IQ6A 3M7VA 2B7CB 2ZBCA 4XO0A 2AYBA 2JLEA 2FGOA 1RHRB 3Q8UA 1I94J 2WVDA 3BGUA 1JLEB 4RW8A 1KD1T 2VFSA 1S1VA 2VBYA 5EWEA 2V63A 2V69A 3I9ZA 4CM0A 4XAKA 4Y2MA 2M4MA 3TVKA 4P9SA 4LR9A 3D7SB 3AOCA 4O3OA 4M95A 1IBLJ 5C7PA 1FWPA 5B0DA 1TV6A 4J9NA 1WDDA 3CJ4A 2RDDA 2VONA 3C6UA 2DO0A 1FDBA 5KFBA 3K89A 4RW9A 3B82A 4P52A 3QT7A 5G0RB 2Q6CA 2K8GA 3OR2A 5KG1A 3AOBA 4CYUA 2DCUB 3BGRB 3MEEA 3SDEA 3B4DA 1OPIA 1S5ZA 1Z2LA 3AXMA 1K1SA 5F9LA 3MM5A 1NH7A 3K8VA 2E7WA 3HVTA 1EX8A 4O3QA 3NMAA 3CCJS 1U1KA 1GTEA 4R8UB 2YWEA 3QYYA 1DQ8A 4B9MA 1M1GA 4ZJOA 4ED7A 3CDAA 1VISA 2OTJS 2RU3A 3DLKA 2AP6A 2XEXA 4K4TA 4B9LA 3IWXA 2HFZA 1WC6A 4DBQA 3PO5A 6FDRA 4EYHB 2W7OA 3T1HJ 1T03A 1I3OB 1YRUA 2DIVA 2GAHC 3FCWA 3V6JA 1NSKL 1NJYA 3KK2B 1PC5A 3IGVA 1R6VA 3GJRB 2XMVA 1XBWA 4NCGA 4KHPF 2RKIA 2YNIB 3GIMA 2NZ4A 2JRSA 1QE1B 4J7CA 3N0VA 3N79A 3UI3A 3MEKA 4X62F 4OJ1A 4WFZA 3RU0A 4ZPBA 1JQGA 3CD7A 3RAMA 3CULA 4I69A 3H0PA 1T05A 1WHYA 1MW7A 2BANA 4FS2A 1BWVA 2DHAA 3V4MA 2P9GA 5JXSA 3MPVA 1RT6A 4RJVA 1HA1A 2KRRA 2MQQA 3TZWA 2FJWA 4JV0A 1FRLA
chains in the Genus database with same CATH topology
4USIA 1BQMB 5KG2A 3DI6A 4X66F 5GAGU 3K5LA 4ZVFA 4FYDA 2FY1A 4QWCA 4LVNP 4ZPVR 1N5SA 1ZAXA 3M6WA 2VBXA 2DIUA 2B5JA 4O3NA 5EN1A 1CPZA 3CJKA 4KB7A 2UU9F 2N4DA 4DV5F 1S99A 1R8HA 2MPUA 4F26A 2QFJA 1S1WA 2IJNA 3P96A 1R8BA 4OZLA 5EX0A 4XPEA 2C2EA 2IM1A 1SXLA 1DZ5A 1H7WA 5DDOC 3D0IE 4AXJA 5IZHA 2DGXA 1HPZB 3CJ2A 3K5PA 3N01A 3O6QA 4QWBA 4OI1A 1JB0C 3X3UA 4AYBD 2ASLA 1MROB 3CCZA 3NL0A 1DHMA 3VZIA 5E3CA 2YWGA 2H5EA 1FE4A 1TQLA 2YWFA 3BGRA 4FP9A 4OZ5A 3T9NA 3TW0A 4ELTA 1RA6A 5D77A 1QJHA 1BGXT 1WHVA 4JI1F 2ROPA 2VG6B 1O8BA 3TARA 2KFYA 2GHVC 4KE5A 3KNGA 2N7YA 5KFPA 4CO3A 1UVLA 2VV5A 4OI0A 2JSXA 2YKOA 2MDAA 2HVIA 2ZOGA 2KN4A 3PW0A 1ROFA 2YH1A 2LXFA 1HQEB 1RISA 4N77A 3DHXA 3I55S 1FESA 3IR5B 2MKHA 2D41A 3IG1A 2HPUA 2ZH4A 4OX8A 3ENQA 4R8UA 2K3IA 4TXSA 5GMKa 3M1VA 2XCPA 2DTJA 3HXMA 4CTAA 1NNDA 2MQOA 3HHEA 1TL3A 4RW7A 1FJCA 3KHGA 3WC2A 1HQUA 1BY9A 2FHOB 5IT4A 2RJZA 2UUAF 4O3RA 4TU9A 3VALA 1JXEA 3M30B 1N36F 2LVWA 1U25A 2J0SD 1FRMA 1HL6A 1Y3KA 4YY3F 3ICLA 3FNNA 4LIWA 2C42A 2R2RA 3DCAA 1RTJB 2HGLA 1AFJA 2W8LA 4KO0A 3EZ5A 1FJ7A 3RYLA 3NBPA 1VQ4S 4LSNB 3MMAA 1A6LA 1BLUA 5C24B 4ZCIA 1XWLA 4OX9F 4NA2A 5F3ZA 2KM8B 2WSFC 1C2PA 1IKYB 1KQFB 3MM9A 1FXRA 5GAHI 2ERRA 4KV8B 5A2QY 1RJJA 5HMZA 5J2PB 2XB2D 5EUHA 4PXCA 5AXKA 1HWIA 1OQ6A 1FD2A 3KK2A 4U7CA 3RR7A 2XWXA 5BYQA 4YR3A 1NKEA 1GXTA 3GQCA 4RWWA 1HBNA 4RNMA 1LWFA 5EX3A 2FHJA 4LSLB 4F4XA 3V4IA 5D6GA 1IQTA 3GR0A 4FNHA 4WJBA 1TKZB 4DSLA 1E6YA 3AQPA 3JTPA 5A8WA 3K5NA 4QU6A 1UJ6A 4DSJA 4DV3F 3ZZ0A 4DL4A 3TANA 1ZM9A 3AB2B 3CSKA 3KYLA 1LFPA 2JX2A 5ADZA 1HMVB 2MHEA 5KFSA 3HPOA 3Q8SB 1Y5LB 2C22A 1RTHB 3ZZRA 4CH0S 4ED8A 1R3NA 4Q44A 1R31A 5F8GA 2FVSA 2EVZA 2K1RA 3T1YF 1KTVA 2BV3A 2IM0A 2W8KA 4F67A 2C28A 3R5DA 1M1KT 4O3PA 2GQQA 2KU7A 2MQNA 5D3GB 1SIZA 4DQSA 4X4VA 1KOOA 4LF6F 2F7VA 2V2KA 2JHEA 2IA6A 1F9FA 4OI4A 1UWBB 1ZZFA 4FNIA 5CCLA 2CVIA 1R0AA 1XC9A 2ASDA 3M2RA 3V81A 1RP5A 4LJMA 2VBWA 4IO1A 4YP3A 4TQRA 1IUJA 4CCHA 2HAIA 2VFVA 3G8TA 4ELVA 3KLEB 3ULHA 3GV8B 2IRYA 3R3TA 2MJNA 3BDPA 1R8PA 2O67A 3D1QA 1K73T 3ITHA 4LVOP 4C8OA 2RQKA 2ZZMA 2KKHA 5JVHQ 4PRFA 1U1NA 2KT5A 3M05A 3MMBA 2XY5A 2B56A 3EGNA 5DS7A 3MDFA 3OUYA 2GGPB 1Z4UA 3RRKA 4B3SF 4O4RA 2MZSA 3H5SA 2AGPA 1VQ6S 2J9DE 3OW2R 3RRGA 3HDSA 5LJ3Y 4I6AA 2DRAA 4B3RF 4GO5X 2CZ4A 2P6SA 2RE1A 2R2TA 4IH6A 3DLBA 2LYVA 1JLBA 5HN0A 4USJC 2J0QD 1GH8A 2Q1LA 2HHTA 2FVCA 4ZPCA 2FB0A 2N3OA 4MIAA 1JKHB 4C8NA 2R8KA 3MMJA 3TO8A 1Q53A 2HNDB 1HYSB 1RYRA 1N52B 1I6JA 1MROA 3L09A 2LDIA 3DLLQ 2KJWA 2ZC3A 1Q8BA 3DRXA 3UNGC 1LKZA 2CQ2A 4NLGA 3I32A 2VG6A 1K8AT 2KB2A 3HHDA 2ROGA 1UVNA 3HHLD 5HBMB 3BR9A 2MZ1A 4NLXA 3MM7B 3NS5A 1SJRA 3R27A 2NUHA 4WFBQ 1CEZA 4QIVA 4B9NA 3OFFA 3OXLA 1HQEA 4FVCA 4WTYA 1YBAA 5CYMB 1L3KA 4AL5A 3UE2A 5A0YB 3DRRA 1TL1A 4G1QB 1QUVA 2B0GA 1K1QA 4NLYA 1LWEB 3UR3C 1U1MA 1WEZA 2VUGA 1VQSA 4ZCKA 5CQGA 5KFNA 1V3ZA 1KQGB 2YVSA 2DVIA 2VL1A 2AJQA 5T14A 3AHPA 3O1LA 2BE2A 1E6VB 4OV1A 2J8AA 4LFBF 2GQCA 1URRA 3SQGB 4JI7F 3H4DA 5KFWA 1HNIB 1M5SA 2R7QA 5T41A 3OSNA 5KG7A 3LGMA 2O01C 2UV8A 3NMRA 1FKOB 2AJ4A 4DL0C 3W2VB 2J9EA 1FA0A 1LK7A 5DDQC 4IQMA 2MHNA 4QZVB 2LECA 1W25A 2CPZA 3LP2B 3KFWX 1QAIA 2WSCC 5C24A 5J1EB 2XY6A 5FJ4A 2MZRA 1FD8A 2V8DA 1IKYA 3IAS9 2MQMA 3K7RA 4NLVA 2N82B 4N8OA 1C0UB 4GMKA 4D3GA 5DLFA 5J2PA 1AROP 1H6KX 2LLZA 3IWLA 4WZQA 5E3AA 3GE9A 2V9KA 1U48A 4F3MA 3K59A 3RBEA 3Q2SC 2DNHA 1N6QB 3PRBA 1RA7A 1XMQF 2G4BA 2HVZA 1B0TA 5DRKA 2CPHA 4LSLA 3GSDA 1M5HA 2XMUA 1WHXA 4MYTA 3PX4A 4K4ZA 1C4AA 3FDSA 2JL9A 2MKKA 2HNYB 4J9SA 1TKZA 4KRWA 5F8HA 2GC8A 4MH8A 1S0NA 1HBOB 1QM9A 1HMVA 1H3DA 2AX1A 3HHLB 2OTLS 4PWUA 2KFZA 5B0EA 5GVQA 2CDQA 3B4MA 4WE1B 1UP1A 4DL5A 1YJTA 1RQ0A 5BYSA 4IOCQ 2U2FA 2DNYA 3AAWB 4EUVA 2RS2A 4KTQA 4DS5A 4BWJA 4IOBA 1S1XB 1X9SA 2D3OR 3PW4A 1KVIA 2X1BA 2B7BB 2HQ3A 1V6HA 3DGPA 4PPDA 5D3GA 3OXGA 2KFNA 2J6UA 1ZPVA 4NLRA 2WK4A 1D0EA 2FJDB 3FMWA 2E1MC 1IR0A 1UWBA 4Y2CA 4NCAA 2V9WA 4GKKF 2HWIA 3ISND 2RIJA 3DDKA 5KG5A 4OHYA 2F40A 2FJBB 1X9MA 2UUCF 1ZPWX 1UW4A 1W2IA 2IA0A 3KLEA 5E41A 3RB4A 1U1PA 5F3TA 5GADU 3J7A1 3W3SA 1VFJA 2KTQA 1YITS 3SV4A 1IJEB 1TAQA 4OLPA 1BD6A 2KDOA 2ZM6F 4ED1A 1CLFA 5HMWA 2ZD1B 2N7CA 3JYTB 1HNZF 3KK3B 2DNKA 3MCSA 1D1UA 4O23A 2JEFA 5KFEA 1EP4B 3MM8B 5E3QA 1HHSA 2HRYA 4UUXA 3TRGA 1DQ9A 2MSTA 3US5A 1BQXA 3H25A 3SYZA 2Y1IA 2CJKA 4WU3A 2WONA 1T3NA 3M32A 2BA9A 2WB4A 1FKAF 2V4RA 1ZETA 3KLIA 4DL3A 4IR9A 4K50A 2D1CA 2R4FA 4NLQA 3I96A 1NK6A 3R1HA 1RYSA 2W9CA 4IQXA 2DR8A 3DM2A 2LCWA 1NK0A 2ACYA 5A8RB 2UVWA 4OMFG 5KFZA 5F9NA 2PT0A 4A8KA 2X3GA 4NLSA 2EFGA 2POKA 4A46A 1IKVB 2OMOA 5CHCB 5B0FA 2XMMA 4Q2MA 2COLA 2DGUA 1GX6A 2XMJA 4WCEQ 1RKJA 3SMZA 3VTIA 1U26A 2DHSA 3H4BA 4FBTA 4CO5A 3RB3A 2XMTA 3IA0A