3NCPA

Glnk2 from archaeoglobus fulgidus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
MKKIEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQQGGMQIQFRGRTMEVTLLPKVKLEIVVKDDAVEEVIGLIVNSAFTGSPGDGKIFIIPVEDVVRIRTGERGDDSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative binding of MgATP and MgADP in the trimeric P(II) protein GlnK2 from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-2)
total genus 23
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ncpA00
2XULA 4RWXA 4C3LA 3NCPA 2JJ4D 1V6HA 4CO3A 1H3DA 4Y6IA 2J9EA 2EG1A 2NS1B 1V9OA 2Z0GA 4NYPA 1V3RA 2ZFHA 3M05A 3LF0A 1P1LA 4AFFA 1KR4A 1UMJA 4IYQA 2XZWA 4E98A 3L7PA 4C3KA 1GNKA 1UL3A 1NAQA 4CO0A 3N5BA 1Q1KA 1OSCA 2J9CA 4OZNA 3O5TB 2O67A 5D4PA 4ZK7M 2VD3A 3AA9A 4RWWA 1O5JA 3TA2A 4YB6A 2DCLA 4OZLA 3T9ZA 3NCQA 1VHFA 5D4OA 3X3UA 2NUUG 4USJC 3OPKA 4Y65A 4CNZA 5D4LA 2GX8A 1XK8A 3AHPA 3MHYA 5L9NA 4CO4A 2NUHA 1QY7A 3GSDA 4D3GA 4USIA 4YB7A 2RD5C 4RLEA 4C3MA 1O51A 4D3HA 2V5HG 3TA1A 1NZAA 3BZQA 3HLUA 4OZJA 3AH6A 1PILA 2O66A 1NH8A 4CO5A 3TA0A 1UFLA 4YB5A 4RX6A 4CO2A 4WK1A 4CO1A 1NH7A 5DS7A 1UKUA 5D4NA 2ZOMA 1V3SA 2J9DA 3DFEA 1VFJA 2PIIA 2GNKA 2XG8A 3AA8A 2CZ4A 1HWUA 2XBPA 5DRKA 4USHA 4R25A 4WK3A 3NCRA 2EG2A 4NYOA 2J9DE 3O8WA 2GW8A 4CNYA 1J2VA 3CE8A 2E66A
chains in the Genus database with same CATH superfamily
3AQPA 1X5PA 3M6VA 1D9AA 1LWCA 2Z8QA 1U7LA 5T7LB 4ZKAA 3WC2A 3JSBA 4PG7A 5L8RC 3B6BA 4LRCA 4ZHRB 3ET6A 3W5ZA 2ZHOA 4O3PA 5JMNA 3K59A 2HGLA 1FI4A 5BYSA 4DR6F 4DBQA 2YKOA 5KG6A 3KK3A 2HIYA 2AF6A 2Y9HA 4A8OA 1DLOA 2CVIA 4AFFA 1SKWA 3D66A 5CQGA 1QAYA 2VFVA 3CCWA 4RW8A 3TQEA 4ZN1A 1WUUA 1WACA 1VS3A 4X4VA 1AZSB 1U2FA 4H4MB 4NMXA 1OPIA 4KC5A 1NJIT 3VGTA 1LW2B 2M8DB 2LVWA 3MMBA 2FLOA 4GVBA 1NJWA 2FVPA 3M6XA 1DTTB 4OI3A 3PW4A 2IM0A 4WU3A 3G8TA 4J5OA 4ES2A 1SJ4P 3ZZYA 5HMYA 4PYDA 2KXNB 5HI7A 3GG1A 1LXNA 4OZNA 3DRSB 1UJ5A 4KPYA 1UA1A 4G3IA 1HQUB 4KV8A 1KS2A 1S99A 1N33F 1CBKA 3U02A 3CW2C 4EYHB 2B5JB 2Z2LA 1R8BA 2HG4A 3H7HB 3HD2A 3NP5A 5IM0B 1VQ9S 1U1RA 1NSKL 2IVFB 4EBDA 2E1AA 1HI8A 2IRXA 4RNMA 2C2EA 2NYIA 3FZ2A 1TR0A 1U1OA 3DOLA 5L1LA 2D3ZA 1M5SA 2V4JB 2Q3PA 4DR7F 3R97A 2V0NA 2C3OA 4XK8C 1YG0A 5KFHA 2I2YA 2KFZA 1GH8A 2GMHA 1Y5NB 1RXOB 2NCKL 3TAQA 4KY3A 3FEYB 2RU3A 3SBMA 1IKYA 2FJDB 3LH2S 1HBOB 2CQHA 3ENVA 1SBRA 2MKSA 1IKWB 4NLTA 1TL5A 3T1HF 1Y10A 1AFJA 1RACB 2B43A 2HBYB 2YWFA 4ICLA 5T7LA 3JB9k 1AUDA 4LF9F 2RHQB 2DISA 2VBWA 3D6MB 4ZHRA 3ET6B 1MU2A 2OELA 3QYYA 4G1QA 2DNRA 3DLEA 4N7TA 5AXMA 4RNOA 3KJVB 3R2CJ 3HFKA 1PAUB 4C3MA 5D77A 1O51A 5HQMA 4WZMA 3BYRA 3IAM9 2B56A 4RNNA 2E5GA 2K3KA 1NHVA 2W9BA 3KDOA 1DLOB 1N0UA 3BBCA 2MQ8A 2KH9A 2K7KA 3BPDA 1QE1A 1FX4A 1UEVA 2R4FA 3AH6A 3K17A 4RW8B 5IQ6A 1TZ0A 1X4CA 4RUBA 1U1MA 2EFPA 4OHXA 1S48A 4QU6A 3NOCA 1X7VA 3LALA 4ID5A 1B3TA 1RCXB 1LW2A 5E3AA 1CJKA 3CCSS 4ER8A 4DR7J 4CLWA 4M5DA 5FIIA 5ADZA 2QL9B 1Q5YA 1FE4A 4MK7A 1CS4A 5H9FJ 2B7BB 5K8NA 4DV2F 2AGQA 2MY7A 1UETA 3HKWA 3L3CA 1HQUA 3I4PA 1TKDA 2CZ4A 3KDNA 1SKUB 4HYKA 4CI0B 2R2TA 5ETMA 1NZ8A 1KDNA 4BDPA 4B3RJ 4P73A 4I68A 4O3OA 4C8KA 2F8MA 1EQ0A 4TLRA 3EPGA 3U1MA 4AL6A 2XY6A 2KT5A 3IMQJ 1I6JA 1HQ2A 3R5JB 1T02A 4X62F 3WHIA 3QGPA 3N28A 3MM8A 1ICEB 3MTJA 4HH0A 2AYMA 4DR4J 1EP4A 3F41A 3IRWP 2M52A 3M8QA 5B08A 2A6OA 4CLKA 2ATLA 1Q86T 4ZPWR 1RA7A 2EC2A 4HH1A 2KM8B 2UU9J 3QBCA 2K3IA 4YY3J 1L3KA 5HMWA 1VHIA 4DV7F 4W98A 1VQNS 3MEEA 2XTJP 4I6WA 2VPXB 2XNRA 4GC7A 2OPSB 4ECRA 1QAJA 3T1YJ 2VFTA 3DLEB 3KWMA 4OZ5A 3CJ2A 3UN3A 2JZ5A 4LF1A 2NREA 5DJBA 3QPIA 4DX7A 4C8NA 4QPXA 4P7VA 3FCVA 1TQLA 3PJ9A 1ACMB 2ZHAA 3CJSA 2O1PA 3H90A 2W9BB 3L7OA 3TZYA 2AP6A 3D4JA 3GFXA 5HQ8A 4U6PA 1ZETA 5HN0A 4JI2J 3MI7X 5T14A 2IY5B 1RHRB 1V5VA 3C14B 2E7XA 2V94A 1RT7A 1S9FA 1FHTA 4GVLA 1IJEB 1S1UA 3SIPB 3SFGA 4J9LA 4DLGA 3IBWA 4X62J 1FXDA 5F8LA 2LMIA 4M5DB 2B9WA 3J80U 2ZH7A 1EKSA 3SZ2A 3V81B 1CS4B 1OQ6A 1QVGR 1P1TA 3OTDA 1RHJB 2AYEA 3Q2TC 3KUEA 2KYXA 1T8EA 2Q6CA 2RHSB 2RF2B 4ETZA 4LREA 2OAUA 1TU0B 2BANB 1VC6A 4DQPA 3C46A 3DYAA 3D6TB 1RAAB 2H5IB 1JXLA 1BY9A 2NPIA 2XEXA 4CLLA 2ZJPQ 3GZ7A 2M9KA 4O3QA 4Z7CA 1VHFA 1N4LA 3D6FB 1OWXA 4WKYA 2Y1JA 3VV2B 4UF4A 4X4TA 2XMJA 4LF8J 1EZZB 2EK6A 3FUYA 1HWLA 3I5AA 4Z7YA 2DCUB 5F3TA 2HNDB 4ZLNA 2CA9A 3MM8B 5GAHU 1PIEA 3PACA 2ZJQQ 3UW1A 5BJRA 3M8QB 3CJ8A 5DM7Q 1QY7A 2N7YA 3V5RA 4DQSA 4QWEA 2Q66A 1JXVA 2B4PA 2X1BA 2AYBA 1SCJB 3ZZTA 4BC9A 3HT3A 1SC1B 4QIWD 2MLYA 4MYTA 2E1CA 1YRUA 1X9WA 4Q2LA 3AOBA 1A7GE 2NR0A 2ZWPA 3K5NA 2KDOA 2KB2A 3AD9C 1MMLA 3TEHB 1NK8A 3L09A 1Q7LB 5A2QY 3FEXB 2C2DA 1YBAA 2AEMA 2ATCB 3HLUA 2BJ8A 3KKFA 4HTJA 4NRTA 4YQWA 3BSCA 3TA0A 2RU9A 1XTZA 4RKUC 3A3PB 2EPIA 3FK4A 3DU5A 5KFYA 1J5OA 4F2SA 2BE9B 4V19J 1KOOA 5LJ3Y 1RADB 1F1BB 4RW7A 2HPUA 1Z2LA 3UNGC 4XPCA 4A8WA 4B3MJ 4AYBD 4EO6A 4YP3A 5HO4A 2QYCA 1IR1A 3M2UA 2R2RA 3RW7A 4X66J 1S1UB 3M30A 1UCNA 2CQ2A 2EFNA 3BF4A 4YR0A 2FVRA 4DOZA 2PN6A 4CH7A 3QJPA 3TANA 2UVVA 1FDBA 1UAWA 4WXWA 3G6ES 4ZVEA 4KGKA 1RT3A 2P9EA 4Y0FA 3MR3A 3V81A 2GFFA 3OSPA 2XBPA 1TMMA 4OZ0A 4W4MA 1CJTA 5HMZA 2WK4A 2RF2A 2WVBA 3W2WA 2HMIB 4K4ZA 1YJUA 3GV7B 3G8QA 4QR2A 1SC6A 3CD0A 1FNOA 4B17A 2PI5A 3KK2A 4V1Ak 4L75A 2MXYA 1HPZB 2HHSA 4LSNA 3SSSA 2VONA 2B0GA 4GO7X 2UU9F 3ITHB 2L9WA 2FZKB 2OP5A 2QLFB 1MW7A 1SH3A 2UUTA 1TVRB 3OTOF 3OTCA 3R8YA 3PTWA 1HI1A 4C7QA 2BQUA 2AGPA 4QIFA 4YOEA 2CPEA 4P2MA 5LL6d 3B8HA 2DNNA 2QSWA 2KU7A 4JP8A 1YTYA 1YSJA 5ITHA 3NGUA 3OTBA 7FD1A 4LBPA 4J9NA 5J2MA 5G4DA 2V8DA 2ZD1A 3M8PB 3LF0A 3THPA 4A4JA 5DG8A 3RAQA 5CYQB 1R89A 1VJWA 1WNEA 3BKUA 1BWEA 4JI2F 2FJBB 3CCRS 2D7SA 2QA4S 5KG5A 3PW5A 4E98A 2HHHF 3CDAA 5M2UA 1VLOA 1JB0C 2Z2MA 2A2DA 3MD1A 2R3VA 5AE1A 3IWNC 1H38A 1DTQA 4TN2A 1FFWB 5E5NA 1HHQA 1U26A 3UD4P 5HVHA 2ZH4A 1YJNS 2BE2B 3K57A 2KM8C 1RKJA 1MROB 5F3ZA 4WFYA 5KFKA 4B9UA 1SXLA 4DX5A 2XCPA 3M2UB 5B0FA 2XLJA 3EMTA 2PGCA 3NWGA 4I2PB 2GQQA 1VC0A 1OY9A 1UVMA 2HEKA 3FBBA 4WU2A 3JQMA 2EWHA 3VVUA 5DDPC 1CVJA 1RT1A 4CLFA 3DC2A 1IJFB 1DARA 3V6DA 2OFHX 1S72S 3OLBA 2MQLA 3FFIB 3NCQA 2ASDA 4DS4A 2YH0A 2KRBA 1J5EJ 2KT3A 3MGJA 1BQNB 4Y2IA 2DK2A 5D4OA 2CNOB 3VQTA 5E41A 3CJKA 4K0KF 2WCXA 1HPZA 2WVFA 2V2KA 3OUYA 4QW8A 1SH2A 3JS9A 4WIIA 2V8HA 4C0HA 4HT5A 3ITHA 3MAHA 2DGOA 3PVXA 3NEKA 1RABB 1YJVA 1RWPB 1WKLA 4GMKA 5L9NA 1TVRA 2CZ9A 3CJ3A 4M5HA 3AT1B 3IR5B 5B0DA 5JJBA 2AJQA 3R5CA 4OFZA 4RPFA 4CLYA 2UUWA 3LA0A 3VVTA 2VQEF 1MMDA 3MMAB 2HS4A 2MYFA 3IN5A 4ZITA 4WP3A 2AWZA 4WFNQ 1SIWB 3NGKA 1KQFB 3FSYA 5B0EA 4CLUA 3VAGA 2Y8YA 2MZRA 3CD7A 3UO0A 4LF4J 1NDCA 2LCWA 3TUIC 4IDKA 2KVIA 3ZZUA 2XMTA 2Y1LB 1CSJA 1A0OB 2CWKA 1V3ZA 1U24A 3PYDA 2JVRA 1WG5A 1GXLA 1EHWA 1K9MT 3MPVA 3MPWA 2RQCA 4DR5F 3NS5A 4RW9B 2DIVA 3G8SA 2CPZA 1O6XA 3LWLA 5D3GB 1LWFA 4EWTA 3KLGA 2W4CA 1HKAA 1SC3B 5LXYA 3N6NA 1IBKF 3W5YA 2ZZMA 3NGRA 2M5YA 4QWDA 3ILLA 1RGVA 2XMVA 3IAS9 1H72C 3MMCB 4DPTA 3PKYA 4ZVGA 1Y3JA 2NXEA 2EBEA 2ZBPA 3CB4A 2HGNA 1VIXA 3GJRB 4I64A 4I2PA 3W9HA 2C3PA 4AL7A 2BM1A 3EDQB 4RZRA 1U48A 2UV8G 4FS2A 4ES1A 1FJGF 5DLFA 1YHQS 4A8KA 3K58A 2UVRA 1RT1B 2VPYB 5I3QA 2GVZA 2WAQD 4J9VA 3V6DB 5KFXA 3A3NB 3G6XA 4CLSA 4KHPJ 1P27B 2BV3A 4R0JA 2VOPA 1DQ8A 2MKHA 3ISNC 3GU0A 2XYGB 3MUMP 3TI0A 3IXQA 3NS7B 3CJKB 3TAMA 3I87A 3K5MA 3JQKA 2JJ4D 2EI5A 4RJVA 2ASYA 3PO4A 4DFKA 1C4AA 3QT8A 1XIQA 1S0MA 3ZTPA 2EC0A 2LYVA 3CC4S 2EKYA 3VGSA 1NK5A 1JLAA 3U27A 3GV8B 2YNFA 4OYIA 4P74A 5KG3A 3BGUA 1LWEB 4LR9A 4DU8A 1RAFB 4DL7A 4O3NA 4JI6F 3LO3A 3BH6B 5KG1A 2MQPA 4BBYA 5B0GA 3RRGA 1CPZA 5LMNJ 2LQBA 5HVFA 1VRUA 2VC1A 3BS9A 5KFFA 1PO6A 1S76D 3FZBA 4USKA 1N8RT 1AT1B 3PCOB 4ZPCA 5J1EA 4C8ZA 2FGCA 4Y28C 5IT0A 3OTOJ 4RU2A 2Q6BA 4USWA 3R6GB 3V4IA 1REGX 2N7CA 1OSCA 1VIOA 2ACYA 3GB0A 2J9CA 2DXDA 4DL2A 1QTMA 2I9SA 2I8EA 2W2PP 4LFCF 1UJ6A 3GIMA 3IA0A 1M1GA 4YR3A 2PA3A 3VQSA 3FCHA 2UUCJ 3P4UB 5FDLA 1NK9A 4DEZA 2ZH3A 4DQRA 3PFOA 4PXDA 3PKMA 1S6OA 2Z58B 2CDQA 4OQJA 3MM7A 4X4RA 3HHEA 1S6PB 3QT6A 5IT9U 3OV7A 2E29A 4FF4A 3GV5B 1WSRA 1KN6A 2WTFA 2VKZG 3BV8A 4CH1A 2GVZB 4PPZA 5KFMA 3CCVS 1F3FA 1GMVA 1N48A 3SCJE 3HSDA 4JI6J 4ED5A 4WCEQ 1N5YB 1RWNB 2HHVA 3KG4A 3DDNA 2Q1LA 2JL9A 3OR1B 3QGGA 5HJXA 1YRXA 4ZIVA 2X3DA 2Z4PA 4JOUA 3TAMB 1N0VC 3I82A 5A8KA 5HMXA 3K7RA 2X1AA 5C2GA 1WC6A 2XGPA 4OYMA 5M2RA 4OYPA 4TQRA 1XNRJ 2A3JA 3FQKA 1FDAA 1QM9A 3Q0AA 1C4CA 4Z2XA 3TOQA 4ZLLA 1FRKA 2DH8A 2IJRA 5DM6Q 5J2NA 4W90B 2ZEJA 4NPOA 3OFEA 1R43A 2QGFB 3VAFA 1DBDA 1ZAXA 5CD4A 1KOHA 2YQ3A 2BJEA 1WTFA 2M88A 8RUCA 5BR8F 3QGIA 1UVKA 3HVWA 2YWKA 3I32A 4JBCA 4JB8B 5DZ6A 2V4QA 2JC1A 2K1RA 2DR6A 5J1EB 2CQCA 3J7YU 3KLEA 3HSGA 3GJQB 3TVYA 5F8IA 1B7FA 3CCES 4JI5F 4ZPAA 4IG0B 2BABA 2YKMA 3D3CJ 4N8OA 3CD5A 5B0AA 1GX5A 4LSZB 5I3PA 1PAEX 3VHQA 3EJMA 3SYZA 2YWGA 3FBFA 4OJ3A 1OYDA 4G1IA 5F41A 1S97A 2OH2A 1C2PA 4B9NA 1FRMA 4H4OB 2EXUA 2CQ3A 2YX4A 4R25A 1T11A 2DH7A 4ZA1A 3R7BB 2GGPA 3A8KA 2B7CB 4G6VB 5F8HA 4Y2AA 5KT3A 3QO9B 1XR5A 2D74B 1ZTTA 2GW8A 1AW0A 2N4CA 1RT4B 1J2VA 3VGUA 1S1VA 1WELA 5IZHA 3OL6A 5HP1B 1HBMA 3HVTB 4TVAB 2LEBA 4UUXA 2VJVA 2UUAJ 4ERDA 1N33J 4KHRA 3N9UC 4IR9A 3VAMA 4M94A 4MIAA 2VJUA 2CQ4A 2YNHA 4Q43A 2VQFJ 2MKCA 2UXCF 4P52A 4JI3J 4Y6IA 1DQ9A 3JTPA 2FIUA 5J2PB 5BR8J 2XMAA 4TY8A 5A8KB 2HZVA 4F25A 1KLNA 3THTA 2XMWA 1IBLF 2B4VA 4OLOA 4OX6A 4P2FA 3WC0A 4YHHJ 4OI1A 5J2QB 3RB0A 2PT0A 2BACA 3UN2A 2G2YA 3WBZA 3JAMU 4DPOA 1X8DA 2QA1A 1DY3A 2XZTB 5GVQA 4IYQA 4LFAJ 4B3SF 2F8HA 3QMQA 4DV3F 4DR1F 4DLEA 4AQYF 1KNZA 1LK5A 5DETA 3BBBA 4H54A 3R5BA 2NPFA 4Q44A 4LF9J 2RVJA 3QATA 1TL3A 4LRDA 5IFMA 4IOAQ 4OX9J 3FNNA 1ZM9A 1FO1A 4UOGA 4USTA 5L9XA 2IBOA 4DUYJ 4O4GA 5GAGU 1D9DA 3EE3A 1MN7A 3KHLA 3PRBA 1UEKA 1OY6A 3QFWA 3H59A 3ZZOA 2YKMB 2CKWA 5HANA 2RMLA 2VQFF 4LRAA 1BQMB 2E44A 2DHSA 1B99A 2HGMA 4HL9A 5DDOC 2BRLA 3W64A 1X5TA 3BPSP 4H4OA 1O8BA 4U7UK 2UP1A 2FLLA 2HZCA 2J6UA 1NK6A 1P6TA 2H48B 3RRKA 3PEHA 1MMNA 1N54B 4DV2J 1C1BA 3PIOQ 2JLGA 1HQEA 2JHEA 5C42A 1IQTA 5KFWA 1JKHB 1KQKA 1VR6A 2BBEA 2BJ3A 1F2HA 1HBMB 1NUEA 2POKA 3B54A 1T3NA 3UQSA 2WVDA 3U7JA 3JSMB 1YJ9S 3I9ZA 2VG6A 5I4MA 4LFCJ 1FRXA 3AD7C 1QDUB 3NWRA 2YQ1A 4U8YA 4ANDA 1D8YA 3MD3A 1ZOTA 5J2PA 3NGDA 3O2IA 2QT7A 3EPIA 2V9WA 4I56A 1HD0A 4OJGA 1S59A 4DMZA 3THVA 1RWOB 2P8IA 2YWHA 4QIEA 2AEJA 2DHAA 4HI1A 2CWXA 3BZQA 1NB2A 3CJ4A 5ETKA 4ZCKA 4R8UA 1RTIB 2C22A 1HA1A 2DHGA 2O66A 3CNQP 3GR1A 1GFWB 2UXBJ 1N5QA 5D0EA 4ENOA 5B09A 2A0FB 2MKIA 2ZH2A 3E2EA 2K7JA 4ZVUB 3KXDA 2CJKA 3R1LA 2C2KB 1NH7A 3FC9A 1IXKA 4QBUA 1K1QA 4OJ1A 1NSQA 2DNGA 5ETRA 4OMFG 2R7QA 1RT2A 2MHEA 2DYAA 1JLGB 1X5SA 1PBAA 1U49A 3IR7B 4PG8A 3PW7A 1U25A 3W8GA 1U6BA 4ILMA 2XG8A 3VALA 5ETOA 2MKKA 1FRJA 4FYXB 1F5BA 3KTQA 3DDIA 4F4XA 1KTQA 3MDFA 2EG2A 4FYVB 2DNQA 2DR7A 1EAYC 2CQ1A 2XSJA 2Y8WA 3LOUA 3CO9A 2W4DA 1VRTA 2J0XA 1VQSA 2QTWA 1MNEA 1P9QC 3EM1A 1R8PA 3W66A 3B4DA 3I96A 4DZDA 3GIRA 3NGSA 4M8LA 3D9BA 3US5A 3BBFA 1RWKB 4HVZA 3NAHA 5KT7A 2QFJA 1G7CB 1L3TA 5E33A 1UEUA 5HL7Q 2FVSA 5KG2A 4JI3F 3MEGB 3KMQA 2CJYB 1FJCA 1HQEB 4BWMA 4YUDA 4NLVA 2VDHA 1FWPA 5C42B 4DR5J 4ECSA 5I3UB 1Q8BA 4IFYB 1N36J 3MEKA 4X4OA 1AROP 4IRDA 1U0SA 3P3DA 4MKBA 2UXBF 2EG1A 2GJ2A 5K8MA 1V9OA 2CQGA 4MKVA 2IYGA 1CJVB 4ZVTB 2DRAA 2HQGA 3GIIA 2FJXA 4YDXA 4NASA 2RQ4A 3MFHA 4DR1J 4NZ6A 4DV5F 2ZVIA 4AQYJ 1SL1A 1AA1B 2FGOA 2SXLA 2DY9A 2ZE2A 4RBVA 6AT1B 3A13A 3TZZA 3BGFA 2UVWA 4C98A 2RT3A 2WVCA 1PGZA 4EU0A 2DNPA 2YY3A 5D0GA 2F1FA 1ZPVA 5KFAA 2DVIA 1HNWF 2DNMA 3I4HX 3GYXB 5L1JA 4K4YA 4AE5A 3D54A 1RTIA 4ZCMA 1P9YA 5G0RB 3CXCR 1RHQB 1S77D 1NAQA 2ADCA 4I2QB 2D3O1 5FLXY 5CXTA 3QJLA 1YBUA 2CNNB 2W7OA 2PE8A 4LF5J 2R7TA 3RAXA 4GC6A 1S1XB 3SQOP 2ZM6F 4UY8T 2NLWA 1YK9A 3VR1A 3AAWB 3HF5A 1UVJA 4WIQA 2OEJA 4O4RA 2Z2ZA 3W1YC 2JC0A 5AT1B 2XO7A 4LFBJ 1U8SA 4KQZA 4Q2MA 2E5JA 4HACA 4JV0A 1JX4A 2C2ZB 4IFVA 3ISZA 4YHHF 2G13A 3AODA 3ENAA 1FNMA 4ELUA 1K0VA 1QJHA 4DWIA 3EZ5A 3Q2SC 1Q0NA 2NXUA 2XHWA 3KNAA 1WJ9A 3DLGB 1NDPA 2BVZA 4DV3J 5LJ5Y 3D5MA 3JYTB 2RKIA 4USJC 4CP5A 1AYEA 1JLEA 4EFAC 3BH7B 3QZ7A 2HVHA 8ATCB 1NKBA 1VC5A 2DT9A 3CCZA 4RW6B 2GX8A 5DG9A 2W9CA 3BDEA 3MEGA 2RSQA 1NK7A 1D0EA 4QU7A 1YDLA 4CDIA 3I0RA 1D1UA 4CO4A 2GAHC 2V68A 3QFHA 1PYSB 2W01A 1LQ9A 3OL9A 2V34A 4D3GA 3BSNA 2HRYA 2B8PA 4Q8FA 1SJ1A 3MCMA 1XJWB 2JX2A 2A2CA 2QL5B 3LP1A 5DQIA 2L3MA 1LFPA 2O01C 2QZ8A 1CJVA 4DDFA 3UDEA 2WSFC 2L41A 1KSPA 2OSRA 1D09B 2MKJA 4IH7A 2IMWP 2B3TB 3K5OA 2OMLA 5KFDA 3M8RA 1BQXA 4ECYA 4CRJA 1TAUA 3D1HA 2COLA 4B9VA 1C1CB 5K8PA 4C4WA 3PW0A 2MQQA 1QD1A 3MXHP 3I5CA 3NG8A 4IR1A 3HHDA 1GMUA 1PILA 3N0VA 2FJEB 3EDRB 3PY8A 3FSXA 2FHKA 2F4VJ 2OKQA 5CCMA 4ZVRB 4DPUA 2D9OA 2KJVA 3HM9A 3DM2B 3RTVA 1SJFA 5G0RA 3W8PA 4DL6A 3L95X 2DHHA 4I2QA 4L74A 4UOCA 2J9DA 3DFEA 4DV1F 4C8LA 1QAIA 3QRQA 3J81U 2N82B 2NZ4A 1RT6B 4F0KA 2G0IA 1RDRA 1RQ0A 2WRMA 2ZC4A 4Q45A 3D67A 2IFXA 4LVOP 4A8SA 2YNGA 3MM5A 2F9DA 1HWUA 1S4EA 2CJAA 2YBVA 3CSKA 1LEOA 1KFDA 3IG1B 3M8YA 2E9RX 1G2EA 1HIYA 4KSEB 1R6VA 4NYOA 1PCAA 2DIUA 2X1GA 2CRLA 3NAIA 3BSAA 2HQIA 2IYIA 1DAXA 2OI2A 3ETOA 1QSLA 2UXDJ 2YQ0A 3GLJA 1GT8A 1O0PA 2CQPA 2WOMB 2XULA 3OL8A 3C6UB 3FEZA 1IBMJ 4PWDB 2CIMA 4WBFA 2CG8A 2Q79A 4PEOA 1R0BG 1FX2A 2BW7A 4ECZA 3LAMA 2LLZA 3DU6A 1NKCA 2HZAA 4F67A 2KKHA 4DPXA 2GVDA 3I0RB 1R8CA 3FDSA 3RB6A 1HMVA 1H74A 4PABA 4DXLA 3BEGB 3PM9A 4P75A 1L5UA 1YJTA 1V3RA 3HJVA 2MZTA 3QAUA 3GFYA 2VOOA 4B3RF 1SUQA 2A6MA 2ZH6A 1RTDA 3TVKA 2RNEA 1Q8IA 4ILLA 1FDNA 4F3MA 2B4OA 1C0UB 1RB0A 1F0XA 4ZP6A 4FZVA 4NXNF 2HLUA 3L7PA 2ZC3A 4TYAA 4LJMA 1F9FA 2BE7D 2B51A 2BRKA 4AD6A 4URGA 1GXTA 4DR4F 3BQ1A 1X31C 5KFSA 3L4BC 4DSLA 3VAJA 1S9GA 2HFVA 2UZAA 3C6TB 3N5FA 4PCQA 3EXCX 1S57A 4C8MA 4J9KA 5EWEA 4PQUB 3M8SA 1EETB 3GCXP 5D78A 3FMWA 2CPXA 3MMJA 2FLNA 5IT4A 2V2ZA 2JEGA 1Y00A 1VYAA 4A8XA 1UWBA 3CMES 1PJ7A 5D8HB 2CPDA 3W2VA 1SJ3P 1FF2A 2BA9A 3CDUA 4B3TF 3EWGA 1RT6A 1IM6A 2HNYA 2K2PA 3EGWB 3UD5A 1TV6B 5CA5A 1N5VA 2YNIB 4CIOA 1TKXB 2KG1A 3HPOA 2DGXA 3MM5B 1UJ4A 3IG1A 5F9NA 5GMKa 4QQBA 2ZH5A 2N3LA 2B4UA 2RUSA 3PYGA 4OV6A 1HI0P 3DRRB 3E01B 3GONA 2VASA 4ANEA 1MN9A 2AJ2A 2G1HA 1NCLA 2NUUG 4O0IA 3OSNA 4OI0A 1T3OA 2RDIA 1JJCB 2UUBF 4JI4J 4F0HA 4G1PA 2VPWB 4CNZA 4PUOA 4OYBA 4AT1B 4NCGA 1FRHA 3AHPA 4CH0S 1EKRA 2MTLA 3M4XA 4ZP9A 3C6UA 3ONQA 3DHXA 4OHVA 5SZTA 1RUSA 2VG7A 3GSDA 1PYTA 4NA1A 3UDCA 3M9MB 1H7WA 3TQ1A 1IQZA 3HO1A 4AUKA 5KFEA 4N77A 4RNFA 5AXKA 3M32A 1UPPA 3KLHB 2GIFA 3AB4B 1I5OB 1RBOB 2VICA 2CVEA 2WZ1A 4ZPDA 5ETLA 4D3HA 4FYDA 3I6PA 1WOSA 1ZAWA 1NKEA 5KFPA 1LW0B 3NOGA 4Z37A 5B0BA 1NZAA 4F4YA 2NXNA 1Y9OA 1U1NA 3TUZC 1B64A 3CT9A 2N3OA 4LF7F 1LWCB 4DF8A 3M6UA 1UPMB 3MM6B 4WK1A 2CJQA 4IRKA 2RDDA 5D4NA 3JSYA 2ZOMA 2GC8A 3EUNA 3QWPA 1ZH5A 3C6TA 5L39A 3U1NA 4DFMA 2HFZA 2MMYA 1RA6A 5AXNA 1VFJA 3TEGA 3UN5A 5AJ3F 2HQFA 2ACMA 2KXFA 1X5OA 2E7WA 2GA7A 2LXUA 1JLFB 1WKKA 3AA8A 4FKYA 4G65A 4F4AA 1U02A 3MZIA 3W2VB 3HFZB 4Q0BA 1H6KX 1KRPA 2HNYB 4R0EA 3D1OA 1GK8A 3SDEB 1AZSA 4YY3F 1FJ7A 3DRYA 3GP9A 3RGIA 1WKJA 2PDAA 1CG2A 1NDLA 4FP9A 4GVBB 2V8PA 4JV2A 3AD8C 3OFGA 3E01A 3EGNA 4LRFA 3TW0A 4RUAA 3WQPA 4F4KA 2HIQA 1NH8A 5AE2A 3ILOA 2V50A 1VQKS 4KV8B 5BYQA 5J1PA 4L6V3 5C25B 3Q23A 3DRPA 3CD6S 1S9EB 1DZ5A 4HI2A 3WX8A 3OR2A 2Q43A 3FBEA 1VQOS 3MM9B 2VG7B 3EGVA 4WTYA 2OHDA 4KR0B 2OFGX 4YB1P 5GADI 1U1LA 1JLCA 4Y3CA 3SEOA 2J6TA 3CUNA 1P1LA 3GSIA 2CPIA 3G86A 2YTCA 4OZ1A 2DEIA 2LQ8A 1FXLA 1FEHA 3Q8VA 2E5LF 1RLDA 1BD6A 1XR7A 1SI9A 4KO0B 3TRGA 5KT2A 1HBOA 3AB2B 2OIHA 1K1SA 2Z57B 4ILRA 2VODA 3C16A 5EX3A 3TX8A 1TL1A 3CPWR 1WEYA 1WF1A 2AHOB 2LU1A 4M5IA 2IM1A 4FDFA 1D8ZA 4ZCLA 1MU2B 4G1QB 3TVZA 1KQSR 3BR9A 3MF5A 4EI2A 3KJVA 3MAQA 4NLDA 2WVEA 3CJ5A 1PKUA 1SC4B 1Y5LB 3C3LA 2HS0A 2VD3A 3DHWC 4DX6A 4BCAA 4DU7A 4TKTA 2R7XA 3SQGA 3W63A 3M1VA 3VAHA 2K8GA 3BGRB 4IUFA 4WFAQ 4TYBA 1W2BR 1RWXB 2WSCC 1RAEB 2MSTA 2J7UA 2EK1A 1KLMA 1QE1B 3DMJB 2JRSA 3RBDA 3OBIA 1GMWD 2NXCA 3SDEA 2BJ1A 3OVBA 2VBZA 3JQJA 3DXBA 4F8RA 1TP7A 4OHWA 1TTHB 4U96A 4JI5J 4B9MA 1I51B 1LNQA 2DTJA 4ID5B 3NXZA 2HHQA 1Q16B 3OPKA 2OGUA 5D4LA 6FDRA 5LSOA 1YWXA 1HARA 5SUHA 1UW4A 4IG3B 1B0PA 4MH8A 4E0DA 4OI6A 2M2BA 1WF0A 4QCLA 1WD6A 3P5TL 3GJTB 4I0WA 1T03B 2MLZA 2FYXA 2ZZNA 3QRPA 4DF4A 1UP1A 4WE1A 3DRPB 1S9EA 1VRQC 1NDKA 1FNXH 1ZZFA 2RS2A 3HJFA 1UVNA 1QAXA 4LT6A 3HFVA 3MM9A 3LGMA 2FZCB 1FFGB 1SH0A 1Y0HA 2HFUA 3Q8YA 2WONB 4ZVOB 2RUGA 2V5HG 3HZGA 4L73A 1W2IA 1U6ZA 2PMHA 1F6TA 1GEHA 1JLCB 2HK2A 1ZBTA 4YMEA 5DLGA 3K8VA 1X0FA 4KHMA 2R8HA 2YKQA 2DNKA 2JSXA 1EJ7L 2B9YA 5IXUA 1XN9A 1EP4B 2ROEA 3PIPQ 1JJHA 1ZA1B 1VQ4S 2MQNA 2LKZA 2RS8A 3OXGA 2OPRA 3R5AA 1N34F 3C16B 1T05A 1BHNA 1TL1B 3C15A 5EWGA 3MOJB 3OL7A 3MEEB 1VBKA 2DGUA 3EICA 3PEJA 4PYAA 2OPSA 5KFJA 1RHUB 2R2SA 1RSCA 2PIIA 3IGVA 2GNKA 3W65A 3SXLA 1GQEA 3SSQA 5LSRA 4LFAF 5IC6B 3J7ZT 4MK9A 5GAEU 5DRKA 2IM2A 2XMKA 5KT4A 3QLHB 2GIRA 3Q8SB 3MOZA 4WK3A 2OTLS 3IS9B 3TUPA 4K2JA 1VQYA 4LF4F 3NNHA 2KO1A 1RTJB 3OJSA 1M5KC 2QV6A 2GHWA 2ZDOA 4NLRA 4CT8A 2L9DA 3DMJA 1TUWA 4NRUA 4X66F 4RUCA 3GIKA 1Y3KA 2W7PA 3HI9A 3C14A 4ID8A 2MGZA 2XM3A 1RT7B 3HKZD 1SJRA 2YX1A 3QSYB 1HNVA 1TFYA 1WOPA 1K0TA 1T9TA 2ZBRA 3UFCX 3I56S 3TARA 1MWYA 2E7VA 5CHCB 3IWXA 3W9IA 5GAEI 2VIHA 2A18A 3N79A 2XO6A 2W25A 1RBLA 1HBUB 4I4BA 4IG3A 2HHHJ 1KBRA 2NS1B 5JUMA 1FK9B 3KJFB 4URQU 5HVGA 2R7VA 2Z0GA 1CQMA 4F4WA 4JI0J 2BANA 2XWYA 3NLCA 2X51A 4KH1B 3DYAB 1T94A 2YWWA 4PG5A 5DQHA 5E3QA 3DGPB 4ECWA 2XY5A 1XMQJ 3RW6A 2XYPB 4L72B 1P8GA 1Q8LA 4YEAA 1RWWB 2QJ3A 3B78A 5KFUA 3ULHA 2P5VA 2ZKUA 2P2CB 3DLJA 1K44A 3KUHA 1IKXB 1J27A 1GTHA 1WDDA 2IRYA 4ED8A 3RBEA 4TU8A 1GNKA 3RBXA 2GS8A 2HNDA 2KT2A 4RUHA 1FKPB 3D68A 3SSRA 4J9RA 2DITA 1NNDA 2C3UA 2HRUA 1BGXT 2GHPA 3G87A 4H4KA 4P2XA 5KFZA 3UR0A 3CC2S 1R0AB 3M6WA 5LMUF 3ILJA 4QR1A 5CCLA 5A8RB 3C15B 4R5PB 2C2OB 2F3JA 3H20A 4YFUA 3DOKA 1W26A 1EQMA 3ISND 3KG0A 4ZK7M 3D2WA 1DFDA 2XSFA 2QMWA 4I6YA 2C2NA 4M95A 3T1AA 2AD9A 1E6VA 1WSVA 2QLWA 3BSOA 1S10A 1LK7A 1Y4ZB 4CM0A 3UPFA 3TNVA 2M7SA 5GAHI 2F5GA 5LMNF 4J9QA 2OEKA 3I31A 4Y34A 3IS9A 3T9ZA 5KFCA 2IIHA 3SFUA 3FBCA 4J9OA 2R7SA 2F63A 3CWJA 4XO0A 2R7UA 2RRNA 1NB7A 2JDJA 2BEFA 2OO4A 2C42A 1K47A 3EVMA 2I5JA 1LV5A 2MGZB 1BC6A 3CF5Q 1FEEA 1HNIB 2C3YA 3SI8A 1HNVB 1D9FA 1OPZA 3M30B 4I69A 4NX9A 1KVJA 3H5XA 4DUZJ 3PHTA 2ZZTA 4MTPA 2DGWA 2IDLA 2W9AA 1K73T 2XI3A 4NLSA 2XB2D 1HBUA 3HULA 2F8EX 1RLCL 4MIWA 5LSLA 1SB6A 3LW5C 3W2WB 4LF6J 2J8SA 3FGVA 4KB7A 2VKRA 4CQ1A 3PDNA 3HHLC 1REVA 3KLVA 4DS5A 3DGPA 1QLNA 3CTRA 3KK2B 3R7SB 3P96A 4JI7F 4QR0A 3AXKA 5A0YB 4DV0J 4L3NA 1R7IA 1R6YA 1TKZB 1SQGA 2DNHA 5HAOA 2ASJA 1U45A 3KLFA 3PHEA 4CO2A 4EGLA 3MECB 2HKEA 2CFXA 3W9JA 2O3DA 4DR2J 2VFRA 1FKPA 2FC8A 2FTRA 2WB1D 3AY0A 5KT5A 3L7UA 5ETSA 1S6QB 1H7XA 1IVZA 1V3SA 2G0JA 1JLQA 1RI7A 1HBNB 4IKAA 1FKOB 2QSFA 1TAQA 4LIRA 4DN0A 3HMJG 5I42B 2MPUA 4RU9A 2D3OR 1JNRB 1XBWA 1N88A 2ZNZA 3IM8A 4PPDA 4WP9A 2UV8A 3NNCA 5A8RA 2NXJA 2ZUAA 1N32F 1H0HB 2ZD1B 3NS6A 3M8PA 3QIDA 1BMQB 4R5PA 4MFBB 4ZDNA 1NK0A 2Y1RI 3NMAA 3PXGa 5CZXA 2HBZB 1WHYA 2E1RA 1XWLA 1VCTA 2JFKA 1WORA 1Z2ZA 5L1KA 2VQEJ 1YITS 4B9SA 2HQCA 1Y5IB 3MR2A 4URSA 2ERRA 4TU7A 2PC6A 3I9V9 3J7A1 2ABYA 5CYMA 4DCPB 1I94J 3BGOP 4X65J 1DTQB 1BUXA 1LFWA 5C7PA 3G71S 4O44B 2ZVSA 2FY8A 2DO0A 4P72A 5IOLA 2ZM6J 3PO5A 4GKJJ 2CNKB 3MPUB 3RAMA 1M90T 4NLGA 1CC8A 3MEDB 4IQMA 3TZWA 3DLKB 2I5JB 2Y0SD 3OHBA 2DR5A 1EARA 4NXNJ 2OEMA 2XI2A 3D3BJ 4BC7A 1TUGB 5L46A 3PYEA 4EBCA 3FRYA 3HHNB 3QT7A 3KLIB 2BXJA 4WTOB 4ED2A 3CGIA 1UTAA 2GO8A 3R6LB 4NLXA 3M05A 2KZMA 2V8VA 3GJSB 4XDCA 4OX8A 4KJIA 4LSLA 1HWKA 5IWAJ 3BN4A 1BQNA 3FQLA 3F73A 3TJ8A 4X4UA 4I7FA 2Z56B 4K59A 4KT0C 4EBEA 4UUWA 2H3EB 2M0GB 3OUYB 3JSRA 1KQGB 4N56A 4DUYF 4U9RA 4IRCA 1RHKB 5HBMB 3PR5B 2QA4G 5K14A 1S6UA 3N5BA 2APOA 4MMOA 2AGOA 3KLFB 4QJVA 4PXCA 3G6VA 1I94F 2HVEA 4O23A 3GWCA 2DJWA 4ZOSA 4OHYA 1Q8KA 1S6QA 5CZVA 4XAKA 1F5AA 2FHMA 1JLQB 1WEXA 2C2MB 2J7KA 1FKOA 2B6AA 2GMJA 2MJUA 4M5LA 4X4SA 5I42A 2DBBA 1H2UX 3NY0A 2OJ3A 2CPJA 2W8LA 1N5SA 1RAIB 1RU1A 2EVZA 2NSCA 3TA2A 4YB6A 2IPOB 1UFKA 1VK3A 2FHOB 3H25A 4NA3A 4IDKB 3NL0A 5IS2A 4UQGA 2HFOA 1LWXA 2EFQA 1HNZJ 1FTRA 4NLQA 4X84A 3VTIA 2IRUA 3ENWA 4UTGA 2W2QP 3MR5A 1NHUA 2PMWA 4DCOB 1JQGA 3X3UA 2CDRB 4RW9A 1MLAA 3LTOA 4OX9F 2ZBCA 4ATNA 4KGMA 3P45B 1B4SA 4O44A 4JYAF 4K4VA 1R0CB 4HLBA 3ELHA 2FJWA 4OJHA 2LECA 4J7CA 4ES3A 4NLWA 3H42A 4J91A 1UVIA 2MZQA 3TWZA 2OMOA 4USUA 3ZC4A 3MEDA 3DLKA 5IC4B 4F36A 1WC5A 4YB7A 1YKWA 3M7VA 3DRSA 7AT1B 1XR6A 5KTQA 1T9XA 3GFHA 4RLEA 3OVAA 1FWLA 2QMXA 2GIQA 3M8ZA 4CLPA 1NBEB 3GQCA 4WYLA 3G4SS 1UZDA 3AJ1A 3KLIA 3ZXWA 4CWBA 2B5JA 3VAKA 1CULA 2BKPA 2U1AA 1RTHA 3A1YG 5EGYA 3M9NB 3TA1A 1SL2A 4ZPVR 1TFWA 1MSWD 4LSLB 1EB0A 4CLTA 1WWHA 5KT6A 1URRA 1UA0A 2HBQB 4DSKA 2VU5A 4Y00A 4NXMJ 2CPYA 3MCOA 1X4EA 4USVA 4H4KC 1YJRA 2LXFA 2BOPA 4IOBA 1S5ZA 1IKYB 1N5TA 1UKUA 4OI4A 5HBMA 2J5AA 5J1NA 4IQXA 1BWVA 2NQPA 2BQRA 1ZM2A 4K8RA 4BLGA 2E1PA 1JLAB 3MUTP 2LA4A 3JXOA 3IO1A 4ICLB 2IBKA 2HHWA 2HWIA 3TX0A 3G96A 4IOCQ 4F0MA 1TUVA 2LQ5A 2V67A 4WJBA 3JTNA 2B6AB 2HHPA 3NMRA 5M2PA 1ZPWX 4GO5X 1ULRA 3HHLB 4DX8H 4X65F 2MZSA 4TY9A 1FCAA 3DNCA 4YR2A 3KMSA 4JI7J 3F56A 3O8WA 2B8QA 2VHGA 4KPCA 1NO8A 5HLFB 1KHWA 3EVOA 2OLWA 4OZ3A 5EUHA 2HYIB 2KZZA 1L3SA 3V4IB 1A9NB 5JXSA 3NCPA 5F9LA 1X4FA 1IBCB 3DN9A 1K8AT 1T0TV 2W24A 1CJKB 1H3DA 1WOOA 1Q5VA 3IBCB 3IR6B 5EX0A 2LEPA 2VG5A 1NJXA 1RKIA 3UNYA 2H4WB 2F7VA 1UW9A 4DV5J 3RRHA 2ALYB 4K4UA 3KYLA 4NEYA 4C2MA 2XCAA 1YRTA 4E2FB 1R8HA 1S6PA 4ZVPB 4NLOA 1S4FA 3J7YI 5T41A 1UFWA 3EZOA 5B0CA 1NJZA 4ECQA 2WB4A 3RR8A 3UCGA 4O0NA 1CULB 2WW8A 3GR0A 1RTHB 2KYZA 4LIWA 3CCTA 3UVJA 1OJ4A 1RAHB 2W4PA 3T5LA 3CCLS 2VL1A 3R27A 2G0CA 2KHCA 1FD8A 3O3LA 4JV1A 4OI2A 3OFFA 4ZVFA 1WDTA 2DXEA 4DR6J 1NM2A 2N4DA 5K9FA 3K2YA 3R5DA 2XS2A 3QJJA 3Q22A 4KFBB 4LFBF 2I0XA 1RWMB 2XMMA 3HVRA 4ZLJA 5C24B 4NCAA 1U2CA 5GADU 4B3OB 1F5CA 3IFEA 4DSEA 4JI8J 5L1IA 2QC3A 2HQ3A 2DXFA 4ZCIA 3J81Y 5J2NB 2YXLA 4NLPA 3C8YA 2LDIA 3BQ2A 4PRFA 4DUTA 4M1KA 4DZ6A 2FB0A 3CIMA 2XC9A 2VBXA 3PZPA 1NJYA 1HLWA 1JWWA 2MDAA 1FERA 1I1GA 2Z2YB 3HHLA 3KK1B 4FVCA 4Y2KA 3TJAA 1M1KT 3FCWA 4N41A 1S12A 3OXFA 5ETNA 4Y2MA 1KVKA 2DY1A 2ALZA 4ZS6A 2B9XA 4ED4A 1FTCA 4YDDB 3V6HA 2H51B 5HLFA 2K1RB 2BZ2A 3KLEB 3CVKA 3S01A 1WC1A 1S1WB 2VFSA 5AXLA 3B4MA 2FDNA 4KGVB 4WPAA 1WEZA 1XK8A 2XYHB 3N6MA 3W61A 3BR8A 4A8MP 1N6QA 1G6BA 2QG9B 1HHTP 1UVLA 3H4DA 1U1KA 2O5DA 3SV4A 4OYXA 1S0OA 3CMQA 5GMEA 1JIHA 3CIZA 2VG5B 3MURP 2F9JA 3AXMA 1TL7B 2PEHA 2ZOGA 3DGVA 2EFOA 2HBRB 1IWAA 3AJDA 1F60B 1NSPA 5F8GA 3G6YA 1YJWS 3QO9A 2ZH8A 2MKYA 3HDSA 1HNZF 3DLLQ 1RT4A 1YBTA 3HHLD 5KG7A 1S1VB 4AXIA 4ZJQA 1ZM3A 1WHVA 5E3RA 3UVJB 3AQOA 3GYGA 3HVTA 4CO5A 1XNQJ 1GAOA 2V63A 4A48A 1XMOF 2HK3A 4JI1J 1WC4A 2IM3A 4ZJOA 1T7PA 5EHHA 3E51A 3EZUA 4HR2A 1X0PA 2P6TA 3PX0A 1M5PC 2YWEA 1HL6A 2OTJS 2VF3A 3HHKA 4KYZA 4PXEA 4KFBA 3UWTA 1U47A 2JNJA 2P9CA 4GKKJ 3GG0A 1SV5A 5C24A 4B3OA 1FVSA 5BYRA 1N56A 3OFHA 4WWSA 3VAIA 1VJQA 1KVIA 3ZZ0A 1SKSA 1N36F 4M63A 2DNOA 1RE1B 2CADA 1HNXF 3CC7S 4AL5A 5KAKA 1F9EB 3T6JA 1GX6A 1RHMB 2FC9A 5MLCV 3KHHA 2DPJA 4V19X 3Q89A 3UE2A 1FE0A 4DFJA 3OT9A 4C11B 2D9PA 3KK1A 1DURA 1M5OC 2MQOA 3Q24A 8AT1B 1KHVA 1S7HA 4C3LA 2H9ZA 2GMLA 2XNQA 1J5OB 1TMJA 3KNGA 1S1WA 4NZ7A 4RW7B 5KFRA 3FSIA 3M2RA 2ROPA 3IC1A 2E1MC 1NPKA 4L3KA 1U1QA 1FD2A 2BYCA 4NLUA 2KFYA 3T5JA 3D0IE 1N6QB 4F2RA 4IO1A 2CQ0A 3MAAA 3PYFA 2CUYA 1IN0A 4P2SA 4J9MA 2B9EA 2XMUA 5E0OA 2QX0A 2ZBQA 4M5MA 2VB6A 1RT3B 3J80Y 1TL7A 1VISA 1RWUA 1CJTB 4I6AA 2H65B 2HVIA 4C9DA 1C1BB 3TUJC 3H4BA 3P5BP 2HMIA 1AB8A 3LP0A 4MAKA 2PD1A 3T41A 2DRBA 3ILIA 3MR7A 1U8WA 3IM9A 3L9ZA 2OSQA 4LSNB 5KG0A 2KRRA 4QPTA 4CO0A 4HHJA 4ZMMA 5E3PA 1WC3A 4RNHA 4A8QA 2XWXA 2DRDA 2RQKA 5ETPA 4BWJA 1Q4RA 3O5TB 4Q8EA 3TR5A 2AZ1A 2YH1A 3CDBA 2D41A 2RRBA 2EFGA 2HLTA 5D4PA 1WC0A 1HNWJ 3R7NB 3GYNA 1O5JA 2VPZB 4FNIA 1SV5B 1S7IA 2CQBA 2DGVA 2YVSA 1V5IB 2KI2A 5J2MB 2G2ZA 3R1HA 1CC7A 3DI6B 4DL5A 4R8UB 1RISA 3LUYA 3S6EA 2UUBJ 2QRRA 4JI4F 1RYRA 3K0JA 5CYQA 3TZXA 1H98A 4NI2A 5A6WA 2MZJA 5EDWA 4K4TA 1KFSA 3C19A 4NMLA 4NCBA 2UVUA 4ZLPA 4EZ9A 1B7YB 3BREA 4DG1B 4RBTA 3E8OA 4KE5A 4C11A 4ZPTR 4B9TA 2HWTA 1JK9B 2PI4A 3E3XA 2HHXA 2BKNA 1NMEB 4DL3A 3MTKA 3MHYA 4QWCA 1HYSB 1QSYA 4WF9Q 2JLEA 1JLGA 2NUHA 2BE2A 3BB5A 5E2QA 3EYZA 1MROA 1YX2A 2FY1A 2LQ9A 4TLQA 3V6JA 3T1HJ 1IUJA 1H2VZ 1ZS6A 2VFUA 5DGAA 3M2RB 5HSPA 1T95A 2RJZA 3POTA 4KH0B 4EK2A 4F26A 4B3TJ 2F4VF 1S0NA 1VQLS 2E9ZA 2DHXA 5K8OA 1VI7A 4OL8A 3MAAB 2VC0A 3KFWX 2DPIA 2RRAA 1B0TA 5F0WA 4OV1A 3CO0P 2ADBA 1VRTB 5KOWA 2GHVC 3GTYX 4J37A 1XMOJ 2W7AA 2XLKA 4QYRA 2GJIA 3TO8A 1FJEB 4DPWA 4X2BA 3FFIA 1XMBA 4WFZA 3NRBA 1SQFA 5DDRC 2BQ3A 1BXNA 4LMZA 3LP0B 3OD2A 5I3UA 3D28A 1FFSB 1VQ8S 1PG5B 2R9LA 3GMGA 4PG6A 3RU0A 3SCIE 4CO1A 3VZHA 3ZZZA 3P6YC 1A6LA 1VGYA 2F65A 2H54B 1XMQF 4KHPF 5GAGI 1RU2A 4E8UA 3PX4A 2BM0A 3QIPB 3KHRA 2OD4A 3IWLA 4LVNP 1OYEA 4U67Q 4CT9A 3RB3A 3A8EA 3H0PA 1RCOB 1HNXJ 4EUVA 2HVZA 1HWIA 4M5NA 4I1TA 1C0TB 3I5BA 3T1YF 1IBMF 1Q53A 1WHWA 4KBIA 3A8IA 3MMAA 1N52B 3V2UC 4J9UE 2ZH1A 3NCRA 2ZH9A 5DGBA 1XC9A 4NE9C 4ZVQB 4F4ZA 4C0BA 1PC4A 4F7VA 3DI6A 4B3MF 3M8WA 2J9DE 4ZPBA 2QE5A 2V6AA 4DV1J 4ANCA 2R2UA 4NI2B 3A3OB 2KG0A 2IDEA 1CJUA 1VK8A 1NSAA 1HW8A 4RWXA 4DG1A 1M1HA 2E5IA 2BKOA 4XTTA 1S1XA 5ETVA 2KVQE 1XEZA 4OX7A 4IO9Q 3X1LB 1RK8A 1TL4A 2WSEC 4KTQA 2FJAB 4KRWA 5D3GA 2FHJA 1LWFB 2KFNA 2DEJA 3KUGA 1OSDA 4FXWA 4OZ2A 3HD1A 3ENQA 3QT5A 4OYOA 3KLGB 3PW2A 5B7WA 4DN9A 4NYPA 1R27B 2HRTA 4OYZA 2GZOA 3FRZA 4EMDA 4LRBA 9RUBA 1ZYQA 2OPPA 3MMCA 2ZKTA 3POTB 3VZIA 2UXDF 1F2GA 2LFVA 2E5LJ 3Q8UA 4USMA 2FZGB 4O3RA 2VH7A 4YS2A 5F0UA 4QWAA 3ZNJ1 4L76A 2CJ9A 3HXMA 2CXEA 4C3KA 4DSFA 3NNAA 1AXQA 1DQAA 2HSEB 4DR3J 1VQ7S 4LQ3A 2LQJA 1PYOB 5KG4A 4LF8F 2W9CB 1OY8A 4DQQA 4YN3B 4HEA9 1MWZA 3CCQS 3TP2A 4LF6F 1VBZA 3LPEA 2CNLB 4PKDB 4P71A 4ZVSB 3LP1B 1F3VA 1HWJA 2R7OA 4B02A 1T9YA 2V4RA 3BYPA 3QIPA 3AA9A 3PG9A 2V2QA 4ZN3A 4WKRA 4RWWA 2DB1A 2YNFB 2QLJB 4MK8A 4LF5F 1LWEA 3DCAA 3K89A 1C0TA 2MLXA 1YZ7A 2PA8D 3HZEA 3UDVA 4Y2CA 3T3FA 4UW2A 4FF1A 1NU4A 4ZJLA 5CH7B 1YZ6A 4ZP7A 1VRUB 2C2RA 1PJ5A 3DM2A 3W7BA 3HCXA 4Y65A 1JNZB 1HR0F 2G2OA 1QTNB 2R8GA 1JMTA 1CJUB 2KJWA 2H1YA 4FYYB 3AOAA 2IMOA 2Y1IA 1VLYA 1FT8A 4LR8A 3VCDA 4NA2A 2EFVA 4USIA 2HWHA 2WHOA 1KONA 2YNGB 5DO2A 2HVDA 2C3MA 2RD5C 1JXEA 1B0VA 5IQQA 4U7CA 4X4QA 1M5HA 3KHGA 2RILA 3QZ8A 3DLBA 3OXLA 3BQ0A 4PG4A 5FDLB 2HURA 5KFVA 1OO0B 4ED0A 1VQ6S 3QGHA 4K5RA 3U1LA 3CCJS 3J7Z5 4F50A 2OPPB 3IP0A 3HP6A 2HNZA 3MM7B 3S8SA 5JVGQ 1RYSA 4WZQA 4ZVHA 2R8IA 2QLBB 4OZJA 3T5HA 2VV5A 2QN6B 5DDQC 2ZJRQ 4X64J 3R2DJ 2FLPA 2QYGA 4MKAA 4NLYA 2FQQB 2RQMA 3H5SA 3ZNUA 5DS7A 3GIJA 2VA2A 2ZWOA 4HDGA 1N5YA 3IBFB 1FESA 5JVHQ 1SVDA 3OR1A 2AW0A 1HMVB 4KGXB 4C97A 2PFFB 3HK2A 2H4YB 3UCZP 2JOQA 4QZVB 2XS5A 3ZZPA 2K06A 2EKNA 5A8WA 2X3GA 5KFGA 3TJ9A 1NK4A 2MJNA 1HR0J 4O3SA 1SUQB 1RTDB 3KOAA 1NPPA 1Z4UA 3VWSA 2IJFA 4LF7J 2V8GA 4DV6F 5L38A 1F9HA 1X4AA 1C0UA 1G4CA 2CG4A 1X9SA 2YX7A 1NRKA 1TKTA 2ILZA 4NYZA 4A47A 3PV8A 2J76E 3K5PA 1Q95G 4FPRA 2WBRA 4WXOA 2C28A 4DL0C 3ZFVA 5K20B 1S9GB 1T9WA 4UZBA 1RAOA 3CDEA 5HATA 4PQUA 2J7WA 1EETA 2XLIA 1N34J 2WW4A 4ECXA 4DR3F 2RDJA 1FRLA 5KFIA 1XQIA 1V6HA 2QIFA 3N01A 3FJ2A 2AIRB 1UWBB 4X64F 4EEYA 1NPRA 1FJGJ 3K8WA 4J90A 2XQCA 3GE9A 3SCKE 4IG0A 3D0GE 2CJXB 4HTIA 1Q7YT 3OVSA 1TV6A 2ILYA 4ZIWA 2Y3YA 2YNIA 1RJJA 1TKXA 4IH6A 1ELOA 4A46A 2LP4A 2PFDA 5EWFA 3Q83A 3G2XA 4U7UD 1IR0A 5E3CA 3WIVA 1WG1A 1KR4A 3FMBA 2DNZA 4M5JA 4NEZA 2J0SD 1L3UA 3CULA 4GRSA 3PR4A 2OUGA 2GGPB 1Q81T 2UUCF 2HNZB 3PFEA 1Q79A 1OS5A 4WYWA 3Q8QB 1UZHA 2DH9A 2IVMA 1RAJA 2WBMA 4PUOB 1SIZA 1KD1T 3H2LA 4NCGB 1H73A 1HHSA 1PC5A 2ROGA 1UL3A 4LQ9A 4QWBA 2VZ9A 5LMUJ 1M0SA 3RJMB 3I55S 5A6PA 5HP1A 1RAGB 4X4NA 4K5SA 2A1BA 4WFXA 1Q1KA 2VBYA 4UY85 2YKNB 5KFLA 4MKYA 1R8AA 2DO4A 2O67A 4TXSA 2YNHB 5AJ3J 1DHMA 1YJ7A 3J81j 1S79A 2J0WA 2Z30B 5H9EK 4EZ6A 4HHHA 2JEJA 2FVQA 1U0HB 4RBUA 4TY8B 4RW4A 5FLXU 2OPQA 5A8WB 4BS2A 1Z1ZA 5HROA 5AE3A 5RUBA 3MFIA 1LW0A 2XGQA 2I1RA 4U95A 3V6KA 5GMDA 1VBXA 4DV7J 5J2QA 1NHKL 3M2VB 4OZLA 4CYUB 1U4BA 4K4SA 1VBYA 4U8VA 4JUZA 1XNRF 4F3QA 4DSJA 5H1SV 1MWQA 1S49A 1TKTB 2BJ7A 2BUNA 2YKPA 2ZITA 3MM6A 5KFQA 3QQCD 4TQSA 1RT5B 1J5EF 1M5VC 1SPBP 3LGNA 4UQTA 5F8MA 5FJ4A 1TL3B 2ZOFA 1T9UA 2R7RA 2EW9A 2R7WA 2ZBIA 4MT1A 1FKAF 1RTZA 4N5SA 2HHUA 2HFSA 3BM7A 4O4GB 1WI8A 1SQEA 1JLFA 1OIAA 3VGVA 1GXUA 1IBKJ 2AYGA 2L48A 3AFGA 3J7AN 4FKXA 3MCSA 4Q0BB 4NL5A 2AX1A 5THWA 2H5JB 3ZTSA 3MR6A 2FUG9 3H2UB 3CCUS 1BQMA 2IA0A 3C66A 4ED6A 3LGHA 3C2PA 4PXBA 3A4TA 4DR2F 3O1LA 2HQDA 1RWVB 1FRIA 1NXIA 5H9EJ 1UFLA 4YB5A 1Q78A 3EX7B 2QEXS 1X4BA 2AJFE 1HD1A 1PJ6A 2AEFA 5C25A 1JKHA 5KOXA 3BDPA 3V4MA 2CZVC 3T19A 4DUZF 1ZM4A 4EO8A 3OR2B 3MPDA 2DR9A 1X4GA 2LU2A 3OJUA 2I38A 3F0NA 2G1DA 2YKNA 3JSMA 2JEIA 2VG6B 1FDDA 5LM7E 4W92B 1S1TA 3DOMA 3R3TA 2UUAF 4KKOA 3NGTA 2XZDB 3IRXB 1URNA 2YPZA 1ZA2B 4K7QA 3JTOA 1U0HA 2V2VA 2R8KA 2FVCA 4RW4B 1G3OA 2OPQB 3FKBA 2ZDPA 2IJNA 4WP8A 5HROB 4PWUA 2GQCA 1IR2A 4KO0A 2HAIA 2JH3A 4CZCA 2X1FA 1WI6A 2BW2A 3GFZA 3ZTQA 4FF3A 3M2VA 4CYUA 4F04B 3ZO7A 4K4WA 2W2MP 2A10A 2FPHX 2GJFA 2V69A 2AJ0A 2RE1A 3CE8A 3CJQA 3RBZA 3LWMA 1IBLJ 1B70B 3QSIA 3GILA 4FS1A 2NSBA 2E66A 3T6BA 3SMZA 1RT5A 3S7RA 1CQNA 2IVYA 4ELTA 3M9OB 5KFTA 4CO3A 4MYUA 2DGTA 2BJ9A 1VQMS 4DFPA 1R31A 2J9EA 3CJ0A 2EEYA 3UR3C 1SL0A 5ETQA 4UOHA 1CEZA 1D3WA 3SQGB 3BO4A 2CQDA 4DQIA 1RT2B 4F02A 5C2CA 3M1VB 3BGRA 3KG1A 4FXDA 2ZUGA 1IM4A 1BLUA 2C1EB 1OQ3A 2ZFHA 3NBPA 4QIVA 4DV6J 4PAAA 1KLMB 1LXJA 2D1CA 3KJQB 3O44A 3ICLA 5ETTA 2BMBA 3A8JA 4RR5A 4OHZA 4CCHA 5F8NA 2VA3A 4PR6A 2CPHA 2FD2A 2MY8A 2AQ4A 4DHVA 2BOAA 2XSJB 5A76A 4A8YA 4EYIB 5H9FK 2R42A 5D0HA 3SV3A 4FXVA 2JVOA 5IV3A 4JI0F 5LXRA 2BJDA 3MCNA 3R9LA 1BE4A 4QOTA 1AFIA 3OHAA 2BR0A 3LQVA 5IV4A 2PSZA 4DL4A 1T03A 3D1QA 4P9SA 3BKFA 4IFYA 4WE1B 1APSA 1T9VA 2MQMA 3UDLA 4JV5J 3ZZRA 1Y11A 2PMZD 4M5KA 5BXIA 2NYHA 1YGYA 1VDHA 2RH3A 2WONA 2IAJA 1U1PA 1S1TB 3DOMB 9ATCB 2BDPA 2DCLA 4KKOB 5DQGA 4OLPA 3IRXA 3UD3P 2AX0A 4JI1F 4XIUA 5MAOA 1NEEA 2M4MA 3W62A 3BO2A 1WHXA 5F8JA 2ASLA 1E6YA 3CEDA 3DKDA 3GPAA 2RAQA 2IA6A 2ZE2B 2MHNA 2D69A 4AXJA 1KWMA 3JAMY 1IWGA 2F4FA 2OPRB 1T05B 5A2QU 3TAPA 2AJ1A 3PJWA 3WX4A 4HHUA 3LANA 4BHQA 4RO0A 2PEBA 3HT0A 3D0HE 1YI2S 3HVAA 4DV0F 3F44A 3H2VE 3UI3A 2XY7A 2R8JA 4DCJB 1EX8A 3AOCA 5LOQA 2CAJA 3W3SA 1KKHA 1PBUA 2QO3A 4FPIA 1XERA 1YQHA 3QLHA 2DNLA 3Q86A 2M3DA 2W1BA 3D6HB 3H8YA 1ITPA 3OTEA 4HACB 2ZHBA 4DSIA 1X9MA 4IFVB 3NBPB 5CD4H 1RTJA 1TK8A 2M8HA 3ETMA 2AT1B 1W7WA 5D6GA 2NZCA 5HK4A 4FBUA 4DPYA 1VQ5S 2YKAA 3PNIA 3W60A 3H98A 3RUBL 3PJXA 1MG7A 2LA6A 3DLGA 1TK5A 1SKRA 2ZNYA 1U6FA 2AKWB 4RX6A 1NLKL 3JYTA 3DLHA 2RKIB 2X7IA 1JLBA 1JLEB 2U2FA 4ETXA 4DV4F 1G1XA 2M70A 3EGZA 3OQ2A 1TK0A 4TU9A 3N4WA 1FK9A 3HSZA 4RW6A 4A8FA 2KL8A 2UXCJ 4C48A 3BKTA 4ED7A 4K0KJ 1DJ0A 2CJBA 2XS7A 5HQLA 2AMCB 5D15A 3W5XA 2CYYA 2QA2A 4GKJF 3CJTA 4S0MA 3ZTRA 4USHA 5DZ7A 4CLZA 2GO9A 4FYWB 2IAJB 3O6QA 1VMBA 2AZ3A 1IKXA 1FWKA 3N6LA 4X4PA 1X4HA 1YIJS 1YLXA 1L3VA 3SCLE 1R3NA 4K50A 4B3SJ 4NXMF 3A12A 4LUBA 1C1CA 2F40A 1E6YB 1ZZNA 2W8KA 2P6SA 1AUSL 3HX9A 2HAFA 3D7SB 1N32J 1LKZA 1IKVA 1PSDA 2GV1A 2D3UA 2JWNA 3OW2R 3CJRA 4ZP8A 4I67A 6FD1A 2CQIA 1Q82T 1X60A 3PRVA 3DXSX 1U09A 4KGZB 4LBIA 4IH5A 2I6WA 3DOKB 3NKYA 5FD1A 2H5EA 1RZMA 2KN4A 2KXHA 1WG4A 1RBAA 5LT5A 2JEFA 2AU0A 4NOHA 3HSJA 1JJ4A 4P7TA 4MJKA 3R5GA 4J9PA 2E9TA 1E6VB 2G4BA 4PWWA 3RG6A 3RZAA 5C5JA 4K4XA 4ECTA 1WTBA 4QW9A 4XPEA 2GAGC 3RB4A 2YPYA 3QRRA 5EN1A 2HS3A 1KP6A 1UMJA 4OYWA 1ZAVA 2XZWA 3TYTA 2GCFA 4FF2A 2IHR1 3BN7A 2PO4A 2DNYA 4WFBQ 3G82A 3ZTOA 4ELVA 1HNIA 4CM2A 3G9CA 4XDDA 3AJ2A 3CCMS 5CABA 4JV5F 4ALZA 2WOMA 4HT7A 1JLBB 4ITSA 2MEWA 1RP5A 3CDWA 4PWDA 4QYZJ 4C6AA 2RIJA 5IWAF 5DG7A 3OLAA 1ZTWA 2QL7B 2HFNA 2LXIA 1WF2A 5IT9Y 3Q8RB 1FXRA 4CTAB 4PZVA 2JLFA 1U2RA 3K5LA 2GVDB 3BO3A 4J9SA 4JYAJ 1REVB 2JFDA 3DDKA 2W2NP 4UOFA 3UCUP 3H5UA 3BGLA 2MB0B 3WIUA 3QNWB 3ADAC 2IC3A 5A0YA 4ECVA 2DR8A 1CLFA 3QAEA 3S1TA 3LP2B 2L08A 3I0SA 1TKZA 3MWBA 5HJYA 5K5MA 2EBGA 4B08A 2KTQA 1HW9A 3MECA 2QFIA 4QIGA 2XHCA 4MIBA 3Q8PB 4M5GA 4QYZK 1HYSA 5CAAA 4F3OA 2E5HA 2LDYA 1KEKA 1HBNA 1VOMA 2AV5A 1FVQA 2CPFA 3EXYA 4KIAA 4OIXA 3PX6A 1R0AA 1IKVB 2P9GA 4PQAA 1VQPS 1QUPA 5KFNA 4OYAA 3PRDA 2AJ4A 2RB7A 4LR7A 4DI6A 2GQ2A 4TNOA 4JI8F 4MFBA 3B82A 4HDHA 4ED1A 3KK3B 2BX6A 1QVFR 1LOUA 4LBHA 1S0VA 3MPYA 3RR7A 2J0QD 4ECUA 2LEAA 3WDOA 2J6SA 2DD8S 1UWAA 1H2TZ 3FVYA 3GCWP 4P10A 5CYMB 4N47A 4H4MA 2J8AA 1KC8T 4C8OA 2VDIA 3P49B 3MMBB 4NZ0A 3DRRA 4DV4J 1JJ2R 5KFBA 1DTTA 2DGQA 3H40A 5CYJA 1EIYB 4FBTA 1ROFA 2W2OP 5E7OB 4N76A 4ED3A 3DRXA 3IGNA 2DGSA 3LPYA 1QUVA 2QMUB 4KAIA 3G82B 1GTEA 4N8NA 2DKOB 4Q7AA 3RYLA 4UT4A 5KFOA 1HFEL 4GKKF 3MUVP 2OD6A 4FVMA 5U47A 4RL1A 1QSSA 2MSSA 1Y7PA 1X4DA 2V9KA 1DRZA 4B9LA 2FHJD 3T5KA 1KTVA 2G9OA 3BJYA 1OMSA 1TELA 4K2XA 5IM0A 1FA0A 2VUGA 3QWUA 3T9NA 3EVWA 3P8BB 4LF2A 4C8YA 4CTAA 7FDRA 3CMAS 3M32B 3DOLB 2MZ1A 3KLHA 2V4JA 4NWBA 4FN5A 3VF0B 3H5YA 4I7FB 2HW3A 4FNHA 4P6QA 1SJQA 4HKQA 5D0RA 1GMWA 2IC3B 2KHDA 2HHTA 3WZ0A 4CNYA 1XNQF 3KJNB 2Y0BB 3LP2A 2FJVA 3I0SB 3LAKA 2L9NA 5K14B 4C0OC 1IKWA 4Q5VA 4UZCA 1W25A 1I3OB 1YVFA 2QLXA 4DJBA
chains in the Genus database with same CATH topology
3AQPA 1X5PA 3M6VA 1D9AA 1LWCA 2Z8QA 1U7LA 5T7LB 4ZKAA 3WC2A 3JSBA 4PG7A 5L8RC 4ZHRB 3K59A 2ZHOA 4O3PA 2HGLA 5BYSA 4DR6F 4DBQA 2YKOA 5KG6A 3KK3A 2AF6A 4A8OA 1DLOA 2CVIA 4AFFA 1SKWA 5CQGA 1QAYA 2VFVA 3CCWA 4RW8A 1WACA 1VS3A 4X4VA 1U2FA 4H4MB 1OPIA 4KC5A 1NJIT 1LW2B 2M8DB 2LVWA 3MMBA 2FLOA 1NJWA 2FVPA 3M6XA 1DTTB 4OI3A 3PW4A 2IM0A 4WU3A 3G8TA 4J5OA 4ES2A 1SJ4P 3ZZYA 5HMYA 2KXNB 5HI7A 3GG1A 1LXNA 4OZNA 3DRSB 1UJ5A 4KPYA 1UA1A 4G3IA 1HQUB 4KV8A 1KS2A 1S99A 1N33F 3U02A 4EYHB 2B5JB 2Z2LA 1R8BA 2HG4A 3NP5A 5IM0B 1VQ9S 1U1RA 2IVFB 4EBDA 2E1AA 1HI8A 2IRXA 4RNMA 2C2EA 2NYIA 3FZ2A 1TR0A 1U1OA 3DOLA 5L1LA 2D3ZA 1M5SA 2V4JB 2Q3PA 4DR7F 2V0NA 2C3OA 4XK8C 1YG0A 5KFHA 2I2YA 2KFZA 1GH8A 2GMHA 1Y5NB 3TAQA 3FEYB 2RU3A 1IKYA 2FJDB 3LH2S 1HBOB 2CQHA 3ENVA 1SBRA 2MKSA 1IKWB 4NLTA 1TL5A 3T1HF 1AFJA 2B43A 2YWFA 4ICLA 5T7LA 3JB9k 1AUDA 4LF9F 2VBWA 2DISA 4ZHRA 3QYYA 1MU2A 4G1QA 2DNRA 3DLEA 5AXMA 4RNOA 3KJVB 3HFKA 4C3MA 5D77A 1O51A 4WZMA 3IAM9 2B56A 4RNNA 2E5GA 2K3KA 1NHVA 2W9BA 1DLOB 1N0UA 2KH9A 2K7KA 1QE1A 1UEVA 2R4FA 4RW8B 3AH6A 5IQ6A 1TZ0A 1X4CA 1U1MA 2EFPA 4OHXA 1S48A 4QU6A 1X7VA 3LALA 4ID5A 1LW2A 5E3AA 3CCSS 4M5DA 5FIIA 5ADZA 1FE4A 4MK7A 5H9FJ 5K8NA 2B7BB 4DV2F 2AGQA 2MY7A 1UETA 3HKWA 3L3CA 1HQUA 3I4PA 1TKDA 2CZ4A 4HYKA 4CI0B 2R2TA 4BDPA 4I68A 4O3OA 4C8KA 2F8MA 4TLRA 3EPGA 3U1MA 4AL6A 2XY6A 2KT5A 1I6JA 1T02A 4X62F 3QGPA 3N28A 3MM8A 3MTJA 4HH0A 2AYMA 1EP4A 3F41A 3IRWP 2M52A 3M8QA 5B08A 2ATLA 4ZPWR 1RA7A 4HH1A 2KM8B 2K3IA 1L3KA 5HMWA 4DV7F 1VQNS 3MEEA 4I6WA 2VPXB 2XNRA 4GC7A 2OPSB 4ECRA 1QAJA 2VFTA 3DLEB 3KWMA 4OZ5A 3CJ2A 2JZ5A 2NREA 5DJBA 3QPIA 4C8NA 4QPXA 4P7VA 1TQLA 2ZHAA 2O1PA 2W9BB 3L7OA 2AP6A 4U6PA 3GFXA 5HQ8A 1ZETA 5HN0A 3MI7X 5T14A 2E7XA 2V94A 1RT7A 1S9FA 1FHTA 1IJEB 1S1UA 3SFGA 4J9LA 4DLGA 3IBWA 1FXDA 5F8LA 2LMIA 4M5DB 2B9WA 2ZH7A 3SZ2A 3V81B 1QVGR 1OQ6A 1P1TA 3OTDA 2AYEA 3Q2TC 2KYXA 2Q6CA 2RF2B 4ETZA 2OAUA 2BANB 4DQPA 1VC6A 3C46A 3DYAA 1JXLA 1BY9A 2NPIA 2XEXA 2ZJPQ 3GZ7A 2M9KA 4O3QA 1VHFA 1N4LA 1OWXA 4WKYA 2Y1JA 4X4TA 2XMJA 2EK6A 1HWLA 3I5AA 5F3TA 2DCUB 5GAHU 2HNDB 1Q86T 3MM8B 2ZJQQ 3PACA 3UW1A 5BJRA 3M8QB 5DM7Q 1QY7A 2N7YA 3V5RA 4DQSA 4QWEA 2Q66A 2B4PA 2X1BA 2AYBA 3ZZTA 4BC9A 3HT3A 4QIWD 4MYTA 2E1CA 1YRUA 1X9WA 4Q2LA 2NR0A 1A7GE 3K5NA 2KDOA 2KB2A 1MMLA 1NK8A 3L09A 1Q7LB 5A2QY 3FEXB 2C2DA 1YBAA 4NRTA 3HLUA 4HTJA 3KKFA 4YQWA 3BSCA 3TA0A 2RU9A 1XTZA 4RKUC 1J5OA 2EPIA 5KFYA 3DU5A 4F2SA 4V19J 3P6YC 1KOOA 5LJ3Y 4RW7A 2HPUA 1Z2LA 3UNGC 4XPCA 4A8WA 4AYBD 4EO6A 4YP3A 5HO4A 2QYCA 3M2UA 2R2RA 3RW7A 1S1UB 3M30A 2CQ2A 2EFNA 3BF4A 4YR0A 2FVRA 4DOZA 2PN6A 4CH7A 3QJPA 3TANA 2UVVA 1FDBA 1UAWA 4WXWA 3V81A 4ZVEA 4KGKA 1RT3A 2P9EA 4Y0FA 3MR3A 3OSPA 2GFFA 2XBPA 4OZ0A 5HMZA 2WK4A 2RF2A 3W2WA 2HMIB 4K4ZA 1YJUA 3GV7B 3G8QA 4QR2A 1SC6A 3CD0A 1FNOA 4B17A 2PI5A 3KK2A 2MXYA 1HPZB 2HHSA 4LSNA 3SSSA 2VONA 2B0GA 4GO7X 2UU9F 3ITHB 2L9WA 2OP5A 1MW7A 1SH3A 2UUTA 1TVRB 3OTOF 3OTCA 1HI1A 4C7QA 2BQUA 2AGPA 4QIFA 4YOEA 2CPEA 5LL6d 3B8HA 2DNNA 2QSWA 2KU7A 1YTYA 1YSJA 5ITHA 4J9NA 3OTBA 7FD1A 5J2MA 5G4DA 2V8DA 2ZD1A 3M8PB 3LF0A 3THPA 4A4JA 5DG8A 3RAQA 5CYQB 1R89A 1VJWA 1WNEA 1BWEA 4JI2F 2FJBB 3CCRS 2D7SA 2QA4S 5KG5A 3PW5A 4E98A 2HHHF 3CDAA 5M2UA 1JB0C 2Z2MA 2A2DA 3MD1A 5AE1A 3IWNC 1H38A 1DTQA 4TN2A 5E5NA 1U26A 3UD4P 2ZH4A 1YJNS 2BE2B 3K57A 2KM8C 1RKJA 1MROB 5F3ZA 4WFYA 5KFKA 4B9UA 1SXLA 2XCPA 3M2UB 5B0FA 2XLJA 3NWGA 2PGCA 4I2PB 1VC0A 2GQQA 1UVMA 4WU2A 2EWHA 5DDPC 1CVJA 1RT1A 3DC2A 1IJFB 1DARA 3V6DA 2OFHX 1S72S 3OLBA 2MQLA 3FFIB 3NCQA 2ASDA 4DS4A 2YH0A 2KRBA 2KT3A 3MGJA 1BQNB 4Y2IA 2DK2A 5D4OA 3VQTA 5E41A 3CJKA 4K0KF 2WCXA 1HPZA 2V2KA 3OUYA 4QW8A 1SH2A 4WIIA 2V8HA 4C0HA 4HT5A 3ITHA 3MAHA 2DGOA 3PVXA 3HO1A 1YJVA 4GMKA 5L9NA 1TVRA 3CJ3A 5B0DA 5JJBA 2AJQA 3IR5B 3R5CA 4OFZA 2UUWA 1MMDA 3MMAB 2HS4A 2MYFA 3IN5A 4WFNQ 2AWZA 1SIWB 3NGKA 1KQFB 3FSYA 5B0EA 3VAGA 2MZRA 3CD7A 2LCWA 3TUIC 4IDKA 2KVIA 3ZZUA 2XMTA 1CSJA 1V3ZA 1U24A 2JVRA 1WG5A 1GXLA 1K9MT 3MPVA 3MPWA 2RQCA 4DR5F 3NS5A 4RW9B 2DIVA 3G8SA 2CPZA 3LWLA 5D3GB 1LWFA 4EWTA 3KLGA 2W4CA 5LXYA 3N6NA 1IBKF 2ZZMA 2M5YA 4QWDA 3PKYA 1RGVA 2XMVA 3IAS9 3MMCB 4ZVGA 1Y3JA 2EBEA 3CB4A 4I64A 2HGNA 1VIXA 4I2PA 4AL7A 2C3PA 2BM1A 4RZRA 1U48A 2UV8G 4FS2A 4ES1A 1FJGF 5DLFA 1YHQS 4A8KA 3K58A 2UVRA 1RT1B 2VPYB 5I3QA 2WAQD 3V6DB 5KFXA 3G6XA 1P27B 2BV3A 4R0JA 2VOPA 1DQ8A 2MKHA 3ISNC 3MUMP 3TI0A 3IXQA 3CJKB 3TAMA 3I87A 3K5MA 2JJ4D 2EI5A 2ASYA 3PO4A 4DFKA 1C4AA 1S0MA 2EC0A 2LYVA 3CC4S 2EKYA 1NK5A 1JLAA 3U27A 3GV8B 2YNFA 5KG3A 3BGUA 1LWEB 4DL7A 4O3NA 4JI6F 3LO3A 5KG1A 2MQPA 4BBYA 5B0GA 3RRGA 1CPZA 2LQBA 1VRUA 2VC1A 3BS9A 5KFFA 1PO6A 1S76D 3FZBA 1N8RT 4ZPCA 5J1EA 4C8ZA 2FGCA 4Y28C 5IT0A 4RU2A 2Q6BA 3V4IA 2N7CA 1OSCA 1VIOA 2ACYA 3GB0A 2J9CA 4DL2A 1QTMA 2I9SA 2I8EA 4LFCF 1UJ6A 3GIMA 3IA0A 4YR3A 2PA3A 3FCHA 5FDLA 1NK9A 4DEZA 2ZH3A 4DQRA 3PFOA 4PXDA 3PKMA 1S6OA 2CDQA 4OQJA 3MM7A 4X4RA 3HHEA 1S6PB 3OV7A 2E29A 4FF4A 3GV5B 1KN6A 2WTFA 2VKZG 4CH1A 4PPZA 5KFMA 3CCVS 1N48A 3SCJE 4ED5A 4WCEQ 1N5YB 2HHVA 3KG4A 3DDNA 2Q1LA 2JL9A 3OR1B 3QGGA 1YRXA 3TAMB 2Z4PA 4JOUA 5HMXA 1N0VC 3I82A 5A8KA 2X1AA 3K7RA 3BDPA 2XGPA 5M2RA 4TQRA 2A3JA 3FQKA 1FDAA 1QM9A 3Q0AA 1C4CA 4Z2XA 3TOQA 4W90B 1FRKA 2DH8A 5DM6Q 5J2NA 4NPOA 3OFEA 1R43A 3VAFA 1DBDA 1ZAXA 1KOHA 2YQ3A 2BJEA 1WTFA 2M88A 5BR8F 3QGIA 1UVKA 3HVWA 2YWKA 3I32A 4JBCA 2V4QA 2JC1A 2K1RA 5J1EB 3J7YU 2CQCA 3KLEA 3TVYA 5F8IA 1B7FA 3CCES 4JI5F 4ZPAA 4IG0B 2YKMA 2BABA 5B0AA 4N8OA 3CD5A 1GX5A 5I3PA 3SYZA 2YWGA 4OJ3A 5F41A 4G1IA 1S97A 2OH2A 1C2PA 4B9NA 1FRMA 4H4OB 2CQ3A 2YX4A 4R25A 2DH7A 4ZA1A 2GGPA 4G6VB 2B7CB 5F8HA 5KT3A 4Y2AA 3QO9B 1XR5A 2D74B 1ZTTA 2GW8A 1AW0A 2N4CA 1RT4B 1J2VA 1S1VA 1WELA 5IZHA 3OL6A 5HP1B 1HBMA 3HVTB 2LEBA 4UUXA 4ERDA 4KHRA 3N9UC 4IR9A 3VAMA 4M94A 4MIAA 2CQ4A 2YNHA 4Q43A 2MKCA 2UXCF 4Y6IA 1DQ9A 3JTPA 2FIUA 5J2PB 4TY8A 5A8KB 4F25A 1KLNA 3THTA 2XMWA 1IBLF 2B4VA 4OLOA 4OX6A 3RB0A 3WC0A 5J2QB 4OI1A 2PT0A 2BACA 3WBZA 4DPOA 1X8DA 2QA1A 5GVQA 4IYQA 4B3SF 2F8HA 3QMQA 4DV3F 4DR1F 4DLEA 4AQYF 1KNZA 1LK5A 5DETA 4H54A 2NPFA 3R5BA 4Q44A 2RVJA 5IFMA 1TL3A 4IOAQ 3FNNA 1ZM9A 1FO1A 5L9XA 2IBOA 4O4GA 5GAGU 1D9DA 3KHLA 3PRBA 3H59A 3ZZOA 2YKMB 2CKWA 2RMLA 2VQFF 1BQMB 2E44A 2DHSA 5DDOC 2HGMA 4HL9A 2BRLA 1X5TA 4H4OA 4U7UK 1O8BA 2UP1A 2FLLA 2HZCA 2J6UA 1NK6A 1P6TA 3RRKA 3PEHA 1MMNA 1N54B 1C1BA 3PIOQ 2JLGA 1HQEA 2JHEA 5C42A 1IQTA 5KFWA 1JKHB 1KQKA 2BBEA 1HBMB 2POKA 1T3NA 3UQSA 3U7JA 3JSMB 1YJ9S 3I9ZA 2VG6A 5I4MA 1FRXA 1D8YA 3MD3A 1ZOTA 5J2PA 3NGDA 3O2IA 2QT7A 3EPIA 2V9WA 4I56A 1HD0A 4OJGA 4DMZA 3THVA 2YWHA 4QIEA 2DHAA 4HI1A 4ZCKA 3BZQA 3CJ4A 4R8UA 1RTIB 2C22A 1HA1A 2DHGA 2O66A 3GR1A 1N5QA 5B09A 2MKIA 2ZH2A 3E2EA 2K7JA 3R1LA 1NH7A 4QBUA 1IXKA 1K1QA 4OJ1A 2DNGA 4OMFG 2R7QA 1RT2A 2MHEA 1JLGB 1X5SA 1U49A 1U6BA 3IR7B 4PG8A 3PW7A 1U25A 4ILMA 2XG8A 3VALA 2MKKA 1FRJA 1F5BA 3KTQA 4F4XA 1KTQA 3MDFA 2EG2A 2DR7A 2DNQA 2XSJA 2CQ1A 3LOUA 3CO9A 2W4DA 1VRTA 2J0XA 1VQSA 1MNEA 1P9QC 3G6ES 1R8PA 4LF5F 3B4DA 3I96A 5KT7A 4M8LA 3US5A 4HVZA 3NAHA 2QFJA 1G7CB 1L3TA 5E33A 1UEUA 5HL7Q 2FVSA 5KG2A 4JI3F 3MEGB 3KMQA 1FJCA 1HQEB 4BWMA 4YUDA 4NLVA 5C42B 4ECSA 5I3UB 1Q8BA 4IFYB 3MEKA 4X4OA 1AROP 4IRDA 3P3DA 4MKBA 2UXBF 2EG1A 2GJ2A 5K8MA 1V9OA 2CQGA 2IYGA 2DRAA 3GIIA 2FJXA 4YDXA 2RQ4A 3MFHA 4NZ6A 4DV5F 1SL1A 2FGOA 2SXLA 2ZE2A 4RBVA 3BGFA 2UVWA 4C98A 2RT3A 1PGZA 2DVIA 4EU0A 2DNPA 2YY3A 1HNWF 2F1FA 1ZPVA 5KFAA 2DNMA 3I4HX 3GYXB 5L1JA 4K4YA 4AE5A 3D54A 1RTIA 4ZCMA 5G0RB 3CXCR 1NAQA 2ADCA 4I2QB 5CXTA 5FLXY 3QJLA 2W7OA 2PE8A 2R7TA 3RAXA 4GC6A 1S1XB 4UY8T 2ZM6F 2NLWA 3VR1A 3AAWB 3HF5A 1UVJA 4O4RA 2JC0A 2XO7A 1U8SA 4KQZA 4Q2MA 2E5JA 4JV0A 1JX4A 4IFVA 3ISZA 4YHHF 2G13A 1FNMA 4ELUA 1K0VA 1QJHA 4DWIA 3EZ5A 3Q2SC 2NXUA 2XHWA 3KNAA 3DLGB 2BVZA 5LJ5Y 3D5MA 3JYTB 2RKIA 4USJC 4EFAC 1JLEA 3QZ7A 1NKBA 1VC5A 2DT9A 3CCZA 4RW6B 2GX8A 5DG9A 2W9CA 3BDEA 3MEGA 2RSQA 1NK7A 1D0EA 4QU7A 3I0RA 1D1UA 4CO4A 3OL9A 1LQ9A 4D3GA 3BSNA