3NCPA

Glnk2 from archaeoglobus fulgidus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
MKKIEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQQGGMQIQFRGRTMEVTLLPKVKLEIVVKDDAVEEVIGLIVNSAFTGSPGDGKIFIIPVEDVVRIRTGERGDDSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative binding of MgATP and MgADP in the trimeric P(II) protein GlnK2 from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-2)
total genus 23
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ncpA00
5DRKA 1NAQA 4OZLA 4D3HA 4NYOA 4R25A 4OZNA 1V3SA 3M05A 4WK1A 1O51A 2NS1B 1V3RA 1XK8A 3O8WA 1Q1KA 3X3UA 1VHFA 4YB7A 3AHPA 1H3DA 4USJC 2NUHA 4RWXA 1QY7A 1V6HA 2EG2A 3HLUA 1P1LA 2ZFHA 2O66A 4Y6IA 3NCRA 4RWWA 5D4PA 3OPKA 4USIA 1HWUA 1GNKA 2J9DE 4D3GA 4Y65A 2CZ4A 2GX8A 2RD5C 4ZK7M 1UL3A 3L7PA 3CE8A 2J9CA 1V9OA 2NUUG 1UFLA 4RLEA 4AFFA 3O5TB 4C3MA 2DCLA 3NCQA 4CO2A 2XBPA 4CO5A 1OSCA 1UMJA 1NH7A 4C3KA 2E66A 3T9ZA 1PILA 3DFEA 4E98A 4WK3A 3AA9A 4CNZA 5D4LA 5DS7A 3TA1A 1KR4A 5D4OA 3NCPA 2ZOMA 3AA8A 4C3LA 2XZWA 4NYPA 3N5BA 4CO1A 2V5HG 2Z0GA 1NH8A 2VD3A 3TA0A 2J9EA 1VFJA 2GW8A 2GNKA 3LF0A 2XG8A 1J2VA 2JJ4D 3MHYA 4CO4A 1NZAA 4CNYA 2EG1A 2J9DA 2O67A 5D4NA 3GSDA 4OZJA 1UKUA 2PIIA 4USHA 4YB6A 4YB5A 4CO0A 3BZQA 4IYQA 3AH6A 1O5JA 4RX6A 4CO3A 3TA2A 2XULA 5L9NA
chains in the Genus database with same CATH superfamily
3Q8SB 1S0MA 1G1XA 4RW7A 3WZ0A 4C8KA 3MMAB 1N8RT 3R9LA 4NI2B 1SI9A 1K0VA 3GIJA 1F3VA 3KLIB 2UUCJ 2BOAA 1HBNA 3CTRA 4R25A 4LT6A 4ZA1A 5A8RB 1R8PA 3AT1B 2FGCA 1RTIB 3ENQA 4DI6A 2CQ0A 1B0VA 5KFKA 5B0EA 3HDSA 5KFHA 1HL6A 1S1TB 2HZCA 3HHLB 2W8LA 1TP7A 5GAEU 1N4LA 1WDTA 1HPZA 3G71S 5CYMB 2UUBJ 4PZVA 3M1VB 1RT5B 1SXLA 4EFAC 3O8WA 2D1CA 4YDDB 5CCLA 1MWYA 1OYEA 1X0PA 2MLYA 5CZVA 5IC4B 4RU2A 3FBEA 4ETZA 3HHLD 3MXHP 2MMYA 2NUHA 2DNNA 3TEHB 3OL9A 2EFQA 3OUYB 4DQPA 1HNVA 2R2RA 1ZTTA 1FRMA 3MECA 1BGXT 2BE9B 2BM0A 2E5IA 3QT6A 4I68A 1LV5A 4RWXA 2CJAA 4H4OA 1VQLS 4A8MP 3D0HE 3QJJA 5ETLA 4YS2A 1N5TA 2WCXA 1F5CA 1DURA 1UJ5A 2J0WA 4GC7A 4A8QA 2QSFA 1VQNS 5HMXA 1OY9A 1VIXA 3ETMA 3NG8A 2M3DA 1N5VA 1VC6A 2XWYA 3EGNA 4PCQA 1LQ9A 2OO4A 3NGRA 2CVIA 1FD8A 1K9MT 2DGVA 3J80Y 4ED7A 2BJ8A 3LALA 1QUVA 1L3TA 2KRBA 4X4VA 3I0SB 3KG0A 3ZFVA 4UOHA 4DXLA 4F25A 3G86A 4CT9A 1ZYQA 3T1HJ 3FCVA 2NXCA 4TVAB 2R8KA 4F8RA 4Q8FA 5AXNA 3G6XA 3QJLA 1PO6A 1AUDA 1VBKA 1C1CA 2EFVA 2BUNA 2NUUG 4AL6A 1HNZJ 2FQQB 4NPOA 3K58A 4LR7A 1HD0A 3C6TB 5C5JA 3I87A 3V4IB 2KVQE 2KO1A 4HDHA 4KIAA 1MN7A 2UUAF 1RACB 4RUBA 3VGTA 4KV8A 1LKZA 1X4FA 5GAHI 2M8DB 1APSA 4KHPF 2CJQA 3RAXA 3QBCA 2ZE2B 3W2VB 2OJ3A 4QYZK 1NK7A 1B64A 1IKWB 2FVPA 2H51B 4HKQA 3OHBA 1JIHA 2AIRB 2ZKUA 1YIJS 3LW5C 1UW9A 1WEXA 4OX8A 2W9CA 4JI2J 2BOPA 3HJFA 2MLXA 4LQ3A 3GB0A 3GTYX 4ZP9A 5AE3A 4X65F 4NLYA 1R7IA 2ZOFA 4I2QB 2E5LJ 1PJ7A 2F7VA 4OL8A 3C6UB 1X4EA 3W64A 3K8WA 4MK8A 2KH9A 2XSFA 4KKOA 5LSLA 1BQMA 4DR2J 3I0RA 1YJVA 5D6GA 3EE3A 4DSLA 3UCGA 4MT1A 1HI0P 4OHWA 4K59A 2V8GA 4WU3A 4DR6J 2EFOA 2UXCF 4FDFA 2C3YA 4R5PA 1YJUA 1YRUA 4F3QA 4F4WA 1WC1A 3OXLA 4QR1A 3B6BA 4RNMA 1D9AA 1FRKA 3LP2A 4ZVRB 1JB0C 5GVQA 4M5DA 2LECA 3KNAA 3FCHA 3TAQA 4IFVB 2ZZNA 3OVSA 3DU5A 1FI4A 4BBYA 1FRLA 3MM7A 3CC4S 1H7XA 3W65A 3DOLA 1HBUB 4JI7F 4FZVA 1RK8A 1JJHA 3GZ7A 2DRBA 1N54B 2W1BA 3PTWA 2ZH1A 2AJ4A 4F4ZA 2F65A 2V4JA 1S97A 5IT9Y 2KT5A 1NPRA 1UCNA 3SEOA 2AKWB 2GJFA 3PACA 5F0WA 4IRDA 5C24A 3IS9A 2R7WA 2JEJA 2C3UA 3GIRA 4C98A 3VWSA 1H98A 2FLNA 4AYBD 3I4HX 3E8OA 1RT4B 1VMBA 2R8JA 1Y5NB 5D3GA 2C3MA 1RBOB 3W62A 2CJ9A 1MG7A 1REVB 1C0UB 1V3SA 3BH7B 1RHQB 5KFOA 3E51A 3MPYA 3LWMA 1TK0A 1N36J 2Y1LB 2VPWB 3QNWB 3R5BA 3DLEA 3SIPB 1U1RA 1EETB 2B0GA 2WSEC 1QJHA 4N8OA 3KHRA 1Z1ZA 5CQGA 3H90A 2HVZA 3NP5A 1KEKA 3RB6A 1FRIA 3CT9A 2HHHF 4UUWA 3QYYA 4RBVA 4DV7F 1MSWD 1P9QC 3MI7X 2J8SA 4H54A 4O4RA 4OV6A 2WONA 3SQOP 3CCTA 3UDEA 2V67A 2MQQA 2R8HA 4NXMJ 1U1MA 3G96A 5ETNA 5ETQA 3KJQB 2HS4A 1PBAA 1SCJB 2YNGB 1CC8A 3TVYA 1FWKA 4TQSA 1WHYA 4Y34A 2B43A 3BO3A 1X4HA 2DO0A 2QL5B 3CJ0A 5JVGQ 4F26A 4OIXA 4RNFA 2J0XA 1YSJA 1K1SA 2PEBA 3F0NA 3D4JA 4PWWA 1IKYA 1FNXH 2KHCA 1HNWJ 3UCZP 3M1VA 2W8KA 2L9WA 4ALZA 2VH7A 1ZM4A 3BB5A 2PD1A 3GJSB 2VODA 3MAQA 3GIIA 3GIMA 4W92B 2PGCA 2Y1JA 3T1YF 4ZCMA 5A8WB 3NS6A 4URGA 1Q0NA 1N0VC 3ZO7A 3D1OA 3CDUA 5U47A 5JMNA 4BC7A 3GPAA 4B9MA 2MKHA 1SIWB 1V9OA 3R97A 4J7CA 1CPZA 2ROEA 4TY9A 4UZCA 3ITHA 1B0TA 4YN3B 3QRQA 3PW7A 1EJ7L 3R3TA 2B6AA 3A4TA 4MFBA 1YRXA 4Q2LA 3TQEA 2CNLB 4N56A 1TFWA 3Q8VA 1U8WA 1VQKS 2HNZB 1KQGB 1FX2A 4ZP7A 2BKPA 2HNDB 2AT1B 4C8MA 3HHLC 3OHAA 4ECTA 1MROB 1JK9B 2KM8B 5KFIA 2HNYA 3OBIA 4MKVA 4RW6A 3LQVA 1F60B 3KFWX 4CNZA 3A1YG 2XGPA 3OXFA 2VG6B 1CG2A 1TL1B 2ZOMA 1AW0A 2ZH4A 2ASLA 1N6QB 2A3JA 5KFGA 3GFHA 1R8HA 2J76E 4DPOA 5J1EA 1RT7B 4Y2MA 3V2UC 3KK1A 2IYGA 1R89A 4GO7X 3UN3A 3T5LA 2GV1A 4B3SJ 4F02A 3M9MB 2GNKA 1I6JA 3K7RA 2FVSA 2FVRA 2Y0BB 4DSIA 5H9EK 4M63A 1UPPA 2PO4A 5B0AA 1HLWA 4KE5A 4YR2A 3MR6A 1IKWA 2BE7D 1X60A 3GG0A 1TUWA 2YX1A 2XLIA 4J9QA 4DPTA 1OSDA 3QJPA 3GSDA 3SV4A 1RHJB 1O8BA 2J6TA 3CJ3A 3BSNA 2CVEA 3Q2SC 4TKTA 2DGWA 5HANA 4DL2A 3EZUA 1M5KC 1EQ0A 2HHQA 2KI2A 2GIRA 2RDDA 3MPWA 4CLPA 1BWVA 2DNQA 3AJ2A 4LIRA 4OZ5A 4CO0A 3Q24A 4FS1A 1P1TA 4I2QA 3HZGA 1KQKA 5F8LA 3EZOA 1IBCB 1Q5VA 4CO3A 3M6WA 2FZGB 3BSAA 2HVEA 2AJ1A 3IBCB 4UQTA 1FKAF 2JC1A 5IV4A 3EYZA 1NK4A 2LVWA 1RWWB 1JLGA 1B7YB 1SQGA 5J2MA 3IC1A 3CJ8A 4OHXA 4WKRA 1W2IA 3HVTA 4OX6A 2QJ3A 3U1NA 3W5ZA 2HWTA 1LWCB 4PYDA 5KG2A 1G7CB 3CJ2A 3NGTA 4X4PA 3NS7B 1OPIA 2AJQA 2GJ2A 1MWZA 1KSPA 1MNEA 2IJRA 2RQ4A 4M5DB 4YY3F 4JI6J 4IUFA 2VBYA 4C11A 3OV7A 3CDEA 4ZIWA 3PZPA 4PWDA 2UXDF 4P72A 3MR2A 2XQCA 2DB1A 4P74A 4KO0B 1M90T 5CYQB 1VI7A 4F2RA 4QWBA 2LDIA 1L3UA 2ZD1B 4KFBA 4OI2A 1QVFR 1Q1KA 4IH7A 2XMKA 5IC6B 1BQNB 2BW2A 2L9DA 1SIZA 3IR5B 4HVZA 4ZN1A 3BDPA 4DV1J 4DV6F 3AFGA 3FC9A 3QGIA 3M8PB 4CLUA 2AYGA 3IBWA 3DKDA 1XERA 3MM6B 4Q2MA 4QYRA 5C42A 2VA2A 4B9UA 3CULA 2CUYA 1TV6A 5T7LB 3ET6B 2FJBB 4ZDNA 5IWAF 3OSPA 3VVUA 4QU6A 4LF8F 4NXNJ 1PIEA 1YZ6A 2FYXA 3CW2C 3JSMA 4V19X 4LVOP 4YR3A 1T03B 5I42A 2CQIA 3VTIA 4FYYB 4NLTA 1XWLA 3KTQA 3OQ2A 2GVDA 3JYTA 1T9TA 2V6AA 1HBMA 1U49A 3I0SA 1X9SA 2EKYA 2FLPA 4U8YA 3A12A 4OV1A 4DV4F 1RISA 3RR7A 3L4BC 4ED0A 1SJ3P 1CJTA 2Q3PA 4I69A 1RZMA 1S48A 4MKAA 1S1VB 5MAOA 1YBUA 2VL1A 2JSXA 1SBRA 1PJ5A 3GFZA 3IO1A 1OIAA 4M5JA 4UT4A 4U7CA 4OI3A 2D3O1 1HNXF 2UXDJ 5FJ4A 3DRRA 1IN0A 3GV8B 1LK7A 4LJMA 1H74A 2WHOA 1TL7A 2IM0A 4LFAJ 4B17A 1LXJA 4F0MA 5KT4A 3F56A 2RHSB 3OXGA 4PEOA 1Q16B 5EHHA 5HQ8A 2FHKA 3IMQJ 1RA6A 4RNNA 3G6YA 1Y3KA 4XPEA 4ILMA 1NK8A 2KN4A 2HHPA 4NLVA 1C4CA 3DM2A 1Q7YT 2ZZTA 2Z8QA 1VHIA 4K0KJ 4O3SA 1NJZA 1UVIA 1RAOA 2AX0A 1FNMA 3P5TL 4E98A 2ZNYA 3LGMA 3SCIE 4USMA 2HQCA 4U67Q 3E01B 1UVMA 1S5ZA 1E6VB 1XJWB 2KFNA 1XEZA 4KY3A 4GKKF 3NCPA 3RB3A 4ZPVR 3C6UA 1FXLA 2E7VA 3A8JA 4CH0S 3MCSA 3NWGA 5DDQC 4KKOB 1JLAA 3CIZA 3R2DJ 2GVZA 4DV4J 3DMJB 3JAMY 2HAFA 4JP8A 4ECUA 3KUGA 1RT3B 1IM6A 2HLUA 2X3DA 5G0RB 1FJCA 4TU9A 1R8BA 3GJTB 3BO4A 4LFCJ 3LWLA 4DV1F 2RILA 1TKTB 4DV6J 2F40A 5D77A 3C66A 5ETVA 1CQNA 5FLXY 4OJ3A 4ECYA 5KFEA 5DETA 1WKKA 3C14A 4QR0A 4ECXA 3A13A 1RHMB 2D41A 4XDCA 3Q23A 2FJXA 1HBUA 3J7Z5 3NGUA 5L1KA 1X4GA 2QLXA 2FUG9 5KFUA 2R42A 2V4JB 1TUVA 2ZDOA 3K57A 5FDLB 4EK2A 3KLHB 1IR2A 4W4MA 2QYCA 4PG8A 1JLEA 4HHJA 4DR6F 2IIHA 3IS9B 2QN6B 1IVZA 2Q66A 2YNIA 4PQAA 2XULA 1DTQA 3TANA 2XC9A 1NAQA 1VLOA 1KP6A 2E1AA 2QIFA 3C15B 2M2BA 2XMTA 2C2ZB 1F1BB 2ZVSA 4OZ1A 4MKBA 4CI0B 2JLGA 3NNHA 2Z56B 3HVRA 3T3FA 1YX2A 2VPZB 3IAM9 2YKPA 2AX1A 4MK9A 2AEMA 1GT8A 2G0IA 4NWBA 4ZVOB 3C8YA 1PYTA 5J2PB 1ZA1B 2M70A 2PT0A 3MEDA 5DQHA 3KG1A 2CWXA 2N3LA 4DR4J 3HKWA 4UOFA 3DXBA 1VRUA 3TX0A 1QM9A 4FYDA 5EUHA 5F3TA 3QIPB 4Y28C 2V94A 4EGLA 5DLGA 5ADZA 2M8HA 2WONB 2VQEF 3KLEB 2G1HA 4WTYA 1QAIA 3GJRB 3R5AA 1VHFA 4O4GB 5B09A 2E9TA 1I5OB 1VCTA 2MQMA 1W25A 2HWIA 2IDLA 3I0RB 4M8LA 2XHCA 3SCLE 4P75A 1NJYA 3P96A 2YNGA 2QFIA 4CT8A 1O0PA 2LQBA 4NE9C 5KFXA 4NA1A 2VFVA 5IQQA 3EPGA 4I2PB 2DNHA 2OFGX 4IQXA 1S77D 4YP3A 3CDAA 5LXRA 1DTTA 1K44A 4J9MA 1V6HA 3FJ2A 1IKYB 3GCWP 4C11B 2A2CA 1WOPA 4USUA 2OPPA 3SCKE 4HYKA 2HHXA 3NCRA 1HPZB 2BE2B 2E29A 4K4TA 4KO0A 5KFTA 4ED2A 2QG9B 4LF9J 1FFSB 3UDCA 1RLDA 1S6UA 4FS2A 1UVLA 3MTJA 3CCVS 1N5QA 3S6EA 1T3OA 5JXSA 3DU6A 2B9XA 5GMKa 2DXEA 2GQ2A 3CJ5A 1WD6A 2MGZA 1HNVB 2RH3A 5I3UA 2IA6A 1TKZB 1WUUA 4H4KC 4J9NA 1G3OA 5ETPA 2K1RA 4A8FA 4WIIA 4IR1A 1MMDA 4O0IA 3CNQP 3G4SS 3W9JA 2WOMA 1N32F 2HHWA 4M1KA 4ZVQB 2OPSA 5ETTA 4YMEA 1BE4A 2RRBA 3RRHA 1Z2LA 1WEYA 2YWGA 3BPDA 3S1TA 1EAYC 3D9BA 1JKHA 4L3KA 3BV8A 1XMOJ 3Q8YA 4WP9A 5CD4A 3DOKB 3FVYA 1I3OB 1PJ6A 2L48A 4E8UA 2IRYA 2E5GA 5HQMA 4WFYA 1D8YA 1U26A 2CG4A 4Z7YA 2CWKA 3SCJE 3BBBA 2QL9B 1V5IB 3M2RB 2EFPA 5HMWA 2RRNA 2YKNA 3FQLA 4DV7J 4FBUA 1MN9A 4HEA9 2G13A 3SV3A 1JLBA 1M5OC 2F9DA 3OFHA 2AYBA 2QLWA 5D8HB 5KFJA 3M2UA 3V4IA 1MU2A 3GV7B 3RG6A 5KT2A 2U1AA 4ID5A 4RNHA 3ELHA 4CLLA 2BANB 4ZHRA 4NLWA 5DGAA 2AZ1A 1VQMS 2AW0A 1RWXB 2EI5A 1HFEL 1KHWA 1IKVB 3PFEA 1S9FA 4HDGA 1NZAA 2RB7A 4Z7CA 2YWKA 3RBDA 3HFZB 1WOSA 4K4WA 1VDHA 2ASYA 5EX3A 2WVCA 5K8NA 4OZ2A 4OZJA 1Y4ZB 1UEUA 1UKUA 2SXLA 2UUBF 2JEGA 1RAGB 2LQJA 3HD1A 2ZHAA 2CADA 4DLEA 3BZQA 4AT1B 4C8OA 4FNIA 2DEIA 5C25A 4DPXA 4DN0A 2CYYA 4XAKA 2O01C 1P8GA 4AUKA 4EMDA 5J2MB 4ECZA 1QTNB 3HHDA 5IV3A 2D9OA 4UQGA 1SJRA 1ZAVA 1ITPA 2KZZA 2NYIA 2QE5A 1V3ZA 1T0TV 4IRKA 5F8HA 2DVIA 3OFFA 1WTBA 3EVWA 1U45A 3RZAA 2Q79A 1LWEB 3Q8PB 2D3OR 2DPJA 3C14B 3VGVA 1DHMA 5HN0A 3GMGA 5IT4A 4IFVA 4R0JA 4QPXA 3TAPA 3DLBA 2BM1A 1N32J 4DUTA 1JXEA 2ABYA 3M6VA 4OMFG 2RDIA 4RW9B 3SFUA 4DV3J 5C2CA 4EBDA 3N5FA 5L46A 1PSDA 1S57A 4MMOA 4ZPDA 3KK3B 1F0XA 2K2PA 1WF0A 3DN9A 2UP1A 5EDWA 4G6VB 5E3RA 4C9DA 1U2CA 3KK1B 4FXDA 1KLMB 4HACA 2A2DA 1DLOA 4IFYA 3ZZZA 2RS8A 2X51A 4YB7A 4B9NA 1KNZA 1LW2B 5HP1A 4P52A 2ZH6A 2EEYA 1Q8LA 3PYGA 3PYDA 1B3TA 2RF2B 2KDOA 2NCKL 4ZCIA 3JSMB 1XR6A 2ROGA 5F8JA 3FRYA 3GLJA 2K3KA 2EG2A 2HEKA 4FYWB 3B4MA 4DZ6A 1ICEB 2HFZA 4LF6J 1FFWB 1NKCA 2WBRA 4DV2F 1KLNA 1CS4A 4YFUA 4DFKA 1Q79A 2ZKTA 2HK3A 3JXOA 1EKSA 3RGIA 4DU7A 1HQUA 3KLEA 2LA6A 4LRBA 1DY3A 2BJEA 2HBQB 2VB6A 4G65A 3LGHA 2H4WB 3T1HF 2DIVA 1MWQA 2FC8A 2UVWA 3U02A 1VIOA 4OYOA 1S9EA 2EK1A 4KB7A 2J7UA 2AP6A 2C2DA 4DR7J 2CPDA 2DNOA 1GMUA 1X5PA 1YBAA 3HO1A 3OT9A 5FLXU 4PABA 4F0KA 3BQ1A 4B3TF 1QAYA 3V4MA 3O3LA 1BY9A 2B3TB 1QSYA 1NLKL 1RTJB 5AE2A 4AFFA 4DBQA 2F1FA 4DFJA 3T6BA 4ZP6A 4JI4F 3IR7B 3NCQA 2CXEA 5IQ6A 4OLPA 2IVFB 1WSVA 4O3QA 3KLFB 2CZ9A 3AOAA 5E3AA 1NPKA 2R7TA 1VC5A 4KBIA 4WPAA 3R5GA 4DS4A 4DCOB 3ISNC 3TR5A 4DUYF 5GMEA 1TVRA 3OR2B 2CQ4A 2BBEA 4Q43A 4DZDA 1K73T 1BQNA 1FK9A 3OTEA 4CLWA 2XSJB 4J9RA 4F4XA 2ZJPQ 5BYRA 2O5DA 2GMLA 2B8QA 4MIBA 1R0CB 1XNQJ 1GX5A 3LP0A 5C42B 1B4SA 2DISA 2M9KA 3CC2S 3FGVA 3V6DB 3W61A 1QSLA 1K8AT 2QC3A 1NU4A 2PN6A 1RADB 1KC8T 1D9DA 1P9YA 5IT0A 2HS0A 2QGFB 2GW8A 4M5NA 3KYLA 2J0SD 3W5XA 5I3QA 5AJ3F 4NZ6A 2JJ4D 3C16B 4MYUA 4KJIA 2EG1A 1D3WA 1HA1A 1BHNA 1NO8A 2HNYB 2QMUB 2FGOA 2BKOA 4GC6A 2I0XA 3CCJS 2JNJA 3ZZUA 1FJEB 2OEJA 4AXJA 3M32B 3MEEA 3F73A 3W60A 3V81B 1J5OA 2Y8WA 1JLFB 1TTHB 2JRSA 1KVKA 1F9EB 2YY3A 1JLQA 3FMBA 3I32A 4YB5A 4LBPA 5B0GA 4Q45A 2DR8A 4F2SA 4O44B 1SKRA 3OVBA 2UXBJ 4LBHA 3DRXA 2R7OA 5A8RA 2MSTA 2W9AA 3BBFA 1VJQA 1RQ0A 1CEZA 1YZ7A 4DSEA 2HIYA 4EO6A 3MCMA 5KFYA 1IJEB 3M7VA 1WC6A 3HT3A 4L74A 2RT3A 4J9SA 3B54A 4URSA 1JXVA 4CLSA 3QFHA 4RZRA 4CIOA 5CXTA 1LFWA 5C2GA 2QMWA 2MZSA 3GCXP 5IM0A 4JV5F 4EI2A 3D6FB 3MMCB 4ICLA 1RJJA 2Q43A 1VS3A 3LA0A 3RB0A 4TQRA 4EBEA 1Q4RA 3ILLA 5HAOA 3OUYA 1N48A 1RBAA 2K8GA 1F5BA 8ATCB 2HQFA 2I2YA 3NBPB 4WZMA 1FD2A 1NB7A 2CNNB 5IOLA 1RYSA 4K4UA 1QVGR 2R7XA 2IC3A 1U0HB 3M30B 4DOZA 3PFOA 1WF2A 5BR8J 2DGOA 3CJ4A 3W2WA 4C8LA 4LF6F 4KRWA 3CO0P 1DJ0A 4QIFA 1RCOB 2CKWA 2Z4PA 2GIFA 1LOUA 1RAFB 4BHQA 3TJ8A 4DEZA 2MB0B 2DR5A 3ENVA 3PO4A 4ITSA 4ZPWR 3GR1A 2FHOB 3KDNA 4HLBA 2G0CA 2DR9A 5K9FA 3TARA 5I3PA 2HRUA 2MHEA 3N4WA 3TI0A 3IWLA 3VV2B 2MKKA 2MQPA 2R2SA 3GE9A 2PC6A 1ZPVA 2DH8A 2BACA 3PHEA 4G1PA 2KU7A 3GU0A 4WXOA 2NYHA 3HT0A 4RWWA 1KBRA 4OX9F 2R7VA 4Y2KA 1CQMA 4Y0FA 1RT6B 1PC5A 1WI6A 1HHSA 4KV8B 4USIA 4X4TA 2MGZB 4ZOSA 1UWBA 2YNIB 4BLGA 3IWNC 2DT9A 3H4DA 3NXZA 2KG0A 4ED5A 2KJWA 5HLFA 2RD5C 2CQ1A 3BGLA 3PEHA 3L7PA 1GTHA 5ETKA 1NBEB 2VKZG 1HBOA 1S1UB 6FDRA 4OI6A 3PW0A 2CQCA 1S6QB 1IKXB 2BJ9A 2ZBIA 2GVDB 2LQ8A 3PYEA 4ZJLA 2Y8YA 3IAS9 5KOXA 2V0NA 5HVHA 1S49A 5E2QA 1HQEB 1RWKB 1UVKA 2MJNA 2UZAA 1HQUB 3HI9A 3NWRA 4IDKA 4NOHA 4RW7B 4B3RF 4L75A 1R43A 2FJAB 2ADCA 4DV5J 4TN2A 2AU0A 3CEDA 4O4GA 2PDAA 4J37A 4LRAA 3L7OA 4ELTA 4OZ0A 2VDIA 3Q89A 1I51B 3LO3A 1HYSA 3DGPB 4K4XA 2RJZA 1N52B 1RTHB 2KXNB 1RTIA 3F41A 1F2GA 3CSKA 1DQ8A 1UZHA 2FHJD 4KGKA 3KUEA 1JMTA 3M6XA 3PV8A 2K06A 1YJNS 1IKVA 3MMBA 2MZQA 1LWFB 4P2XA 5CYMA 5EN1A 1WHXA 2W2NP 2RUSA 5IZHA 4CTAB 4RUAA 4X62J 2IVYA 2H1YA 3K89A 4NLDA 4H4MA 4DUZJ 3PO5A 1HWIA 2ZC3A 3QATA 2HHTA 2IBOA 1O6XA 2HGLA 2AJ2A 2J9DA 3MAHA 5G4DA 1NNDA 4JI6F 4G1QB 4ANEA 4JI3J 2HPUA 5DGBA 4X66F 3ZNUA 3US5A 1Y00A 2GMJA 4NCGB 2XO6A 3TAMB 4KGXB 5KG7A 1FNOA 3RJMB 4I56A 1C0TA 2XI3A 1R0AB 2G2ZA 2B4VA 2B7BB 3ZC4A 2C2EA 1C1BA 2ILYA 3N6NA 1CLFA 5B0DA 2OD6A 1FVSA 2BXJA 2KM8C 4JBCA 1N5YB 4X4UA 3EUNA 4KC5A 1CJUB 4DQQA 4U7UD 3HKZD 2VPYB 3AXMA 3OL6A 4M5GA 1RGVA 3VAHA 5DM7Q 4KTQA 5A0YB 3QWPA 4X84A 3ZTSA 2EWHA 5EWEA 4QW9A 1BMQB 5KFLA 4UOGA 2WTFA 2DGUA 2BRLA 3DRYA 3N6MA 1R31A 3UW1A 2D7SA 2NPIA 4QPTA 4RUHA 1WWHA 2W7OA 3D54A 5K5MA 2YQ3A 2FJDB 4NYOA 3A8KA 1S1WB 2CPYA 3UVJA 2YKQA 2ZZMA 4O44A 5E3PA 2A18A 2XLJA 2XEXA 4FF1A 1HYSB 2UXBF 3M2UB 5LL6d 2Q6BA 4DFPA 1EARA 4KPCA 2GO8A 3P5BP 4B3MJ 4DR3F 5KG0A 3D6TB 3EZ5A 3CC7S 2FDNA 2POKA 1VYAA 4DV0F 3ZZOA 4V1Ak 5KG1A 2AJ0A 4DV3F 5LMUF 1GEHA 4JUZA 2HMIB 1TQLA 1UFWA 4L6V3 4NYZA 4U6PA 2X1AA 2CQDA 4DV5F 3BN4A 3ZTPA 1D9FA 5DDRC 4HTIA 2YH0A 1NHVA 3MECB 4A8XA 1FX4A 3NBPA 1B0PA 1J5EJ 4ATNA 2EBGA 3PJWA 1AA1B 4WFNQ 5H9FJ 4PAAA 4LSNA 2C22A 1YBTA 4DR1F 3W66A 4ERDA 2VF3A 3EXYA 2HNZA 1EP4A 2IJNA 3JSRA 1S9EB 2GS8A 1GNKA 3ZZ0A 3FKBA 3RW6A 3UWTA 2KVIA 2FZKB 5M2PA 3OLAA 2ZVIA 2BDPA 3D0GE 1YK9A 4WWSA 2PFDA 2MY7A 2BX6A 3CCLS 4JI1F 4DN9A 3KG4A 3FSXA 1SH3A 2AEFA 4A46A 2J0QD 5D0GA 4QU7A 2RKIB 3CCSS 4PPDA 2DPIA 2H5IB 1HNIA 1VGYA 4LSLB 4FNHA 1U1NA 1CVJA 1FRXA 4DQSA 2C2RA 1Y9OA 4OX9J 5CCMA 1YKWA 4C3MA 4ED3A 1XTZA 2OH2A 1C1CB 4C8ZA 3N6LA 3OR1A 4DR2F 3UN2A 3MM8B 2VG7B 1NUEA 3I5BA 1UMJA 1P27B 2RAQA 1NH7A 2LP4A 3KXDA 1GTEA 2Z57B 5CYJA 2WSFC 2XGQA 3CD5A 3NMAA 4LFBJ 4KAIA 5HMZA 1S72S 1URNA 4OQJA 3BN7A 1X5TA 3Q8QB 1QD1A 1RA7A 1T9UA 3IFEA 4NEZA 4AL5A 5EWGA 3ZNJ1 2XCPA 3NNCA 1B70B 1YI2S 2J7KA 5HL7Q 3G8TA 3BJYA 2VICA 4BDPA 3T19A 1S0OA 5LJ5Y 4USVA 2W9CB 3LPYA 4KR0B 3BSCA 1U09A 4KH1B 2AGPA 2AD9A 4WZQA 1RT2B 3AQPA 2NPFA 3DLKB 2Y1RI 1PAEX 3DOKA 3BR8A 3I9V9 2GAGC 2H5JB 2U2FA 3IM8A 3JQJA 3OFEA 2HRYA 4WKYA 3CUNA 1RWOB 5L1IA 1S10A 4EEYA 1IBKF 2I1RA 3MMAA 5F3ZA 4W98A 1IQZA 2JLFA 4CP5A 2YKNB 5D15A 2BA9A 2CA9A 4WYWA 2OPRA 4RUCA 3FRZA 2JEFA 1BXNA 1H6KX 4USHA 4UW2A 4YB6A 1RTZA 4K0KF 2N3OA 2VBXA 2DH7A 3UD5A 4ZJQA 4A48A 3J7ZT 5A2QU 4C8NA 2GJIA 2HGNA 1RE1B 4I64A 1K0TA 1WG5A 3R6GB 5I4MA 1N88A 1ZA2B 4CTAA 5F9LA 3WIUA 4JI3F 3VAFA 4JI0J 3MPDA 4ILLA 3DOLB 2I8EA 4KHRA 2CQ2A 1S99A 1CULB 1NEEA 2M52A 1AT1B 3W7BA 5L9NA 1IBLJ 2LXFA 5DRKA 5HI7A 3TZXA 4DS5A 1YITS 1FDDA 2LXIA 1TVRB 2MJUA 3D68A 5KT5A 4ILRA 3EGWB 5D78A 2WVFA 4NLPA 2MKCA 2KHDA 4AE5A 2HFOA 4DX6A 2F8MA 1A6LA 2IMOA 4U9RA 2HAIA 3UE2A 3ET6A 1UVJA 3THVA 4OYIA 1VQ7S 4O0NA 3CCMS 3V6DA 3W63A 4C8YA 2XMAA 2DXFA 1XK8A 3DLEB 2L9NA 1R27B 3R6LB 5F8IA 4RJVA 4TY8B 3KJVA 3M9OB 1LWEA 3HULA 1JNRB 1U02A 3G8QA 2DBBA 4FXVA 1Q8IA 4W90B 3SSRA 3RRGA 2EW9A 2CPFA 2VBZA 3GFXA 4GVBB 1WOOA 1TL1A 4DR5J 2HLTA 3AQOA 1S1VA 4LFBF 5GMDA 1KONA 3PRDA 5F41A 2JX2A 2E1PA 3I5CA 4P2SA 2NSBA 3GV5B 1H72C 3H2UB 2O66A 4MJKA 1GX6A 3QIDA 4PR6A 1TL7B 2MXYA 3CWJA 3FK4A 5B08A 4DLGA 2DNMA 4DDFA 1T8EA 4DCPB 4OYZA 1FEHA 3R5CA 5D4PA 3VVTA 4LRCA 4Q0BB 2QFJA 1M5VC 1JNZB 5HATA 4Y65A 1YQHA 1ZS6A 5J1PA 3EDRB 4GRSA 3GYXB 5B0BA 2ZBCA 1SH0A 3EM1A 1CJVB 4M94A 2IM3A 2VUGA 3MMCA 3A8IA 1LWXA 5BXIA 1VQ6S 1NMEB 2YWHA 4ZVPB 3ILIA 2I5JB 2IFXA 2NXUA 4C48A 2QA4S 3D5MA 2VJVA 2N4CA 2YKMA 2KB2A 4ZS6A 3H25A 2XTJP 3ITHB 2DGXA 3U1MA 1JLGB 5CH7B 1TU0B 2KFYA 1BQMB 4DL7A 1OSCA 1PBUA 1U0HA 3M30A 2ZDPA 2ZHOA 4PG4A 6FD1A 2FPHX 3DGPA 5KT7A 1NB2A 2VQFF 2MKIA 2OMOA 3OJSA 4C4WA 1PILA 1NDCA 3GYGA 4R5PB 1FWLA 2VV5A 1HKAA 2N7YA 3AB2B 3BF4A 2B51A 1S6PA 3D1QA 3KLVA 4J5OA 4P73A 5D4LA 1KRPA 3T5HA 3PRBA 4KHMA 2HHSA 3M9NB 3JAMU 2UVVA 3L09A 2VIHA 4DWIA 2I6WA 1WACA 3R5JB 2JVRA 2VG6A 1X5SA 1XNRJ 4DL5A 1FJGF 1AYEA 4KQZA 2UUWA 1IR1A 3PKMA 2VG7A 4U96A 2V4QA 2PFFB 4QWAA 4B9VA 4DV2J 1Q86T 5T41A 4X64J 4KPYA 3PM9A 5D4NA 4YDXA 1FK9B 1S4FA 2DTJA 3FBFA 1RHKB 1VQYA 3RYLA 1XMQJ 2WW4A 3BGRA 2ZJQQ 3HF5A 3TNVA 4NCAA 2HQGA 1TV6B 2DGSA 3DC2A 1T7PA 4ZMMA 1RB0A 1H2TZ 1KS2A 5AXKA 5KFZA 4WFAQ 3JB9k 2HW3A 1SB6A 4ZLPA 3FEZA 1T03A 2DNPA 1L3VA 4O3NA 4YQWA 1O5JA 1NPPA 2I38A 3NEKA 4DQRA 4NZ0A 2AGQA 2MY8A 2HQ3A 1VRUB 2GQQA 3PW4A 2NLWA 3CVKA 3DLKA 3CMES 5DM6Q 1FRJA 3DLGB 4NXMF 2VC1A 2HHUA 1LK5A 2V8HA 2OLWA 3VAMA 3LTOA 3CD6S 3KOAA 2ZITA 3CPWR 1TKXA 1M0SA 3I31A 4X66J 5HROB 1OJ4A 2OPRB 1SL0A 2LMIA 5HQLA 1FDBA 1VR6A 5IT9U 1YJ9S 3CJKA 4I2PA 4IRCA 1X9WA 4AQYJ 1NM2A 4BWMA 3OTBA 1DTTB 5KG5A 4XO0A 2EC0A 2M4MA 3J7A1 2E5JA 2JVOA 5HJXA 1XBWA 1NKEA 3KKFA 8RUCA 3PIOQ 1LW0B 1O51A 5E5NA 5A8KA 5F8MA 4A8KA 2ATLA 4LF5F 3ZTOA 2UVUA 3QZ8A 4H4MB 4UZBA 2D9PA 2HMIA 2V50A 2PMZD 1E6YA 5LMNF 3RW7A 2IM2A 2ZD1A 4KFBB 1NSQA 4G1QA 2ADBA 3HD2A 3BYRA 2BZ2A 3X1LB 5B0CA 2APOA 1UP1A 1KDNA 1U24A 4Z37A 1H2VZ 2BABA 2JHEA 1WF1A 3KHLA 1GH8A 2P9EA 4JI8F 2QRRA 1EKRA 3MD3A 2VKRA 1B7FA 1RUSA 1JJCB 1L3SA 1R0AA 1S59A 3CJTA 2B6AB 2DNLA 2N82B 3V6JA 4E0DA 1IM4A 5KFBA 5CD4H 2LQ9A 3A8EA 2GGPA 3DXSX 4LF2A 4I1TA 1CJKB 3HHEA 4IO1A 4J9VA 2BVZA 1VQ8S 4UY8T 2VU5A 2FY1A 1HWUA 2OKQA 1JLCB 4I4BA 3OTOJ 3KJVB 2E5LF 1MROA 4P6QA 3JYTB 4B9TA 1NDPA 2E44A 2XY5A 1FKOB 2EBEA 4IKAA 3RU0A 4M5IA 2RS2A 1LFPA 1PG5B 3IR6B 3DRSB 2W4PA 3LH2S 1GFWB 2LU1A 2DCUB 1N33J 2ZH3A 2Q1LA 4CLYA 2YWEA 2XZTB 1UFLA 5JVHQ 1RSCA 5FDLA 4ETXA 5LSRA 1RYRA 4FF2A 2YWFA 1QAXA 2X3GA 1RT6A 3RAMA 1HI8A 1RAHB 2D3ZA 2W24A 4ID5B 4V19J 3I9ZA 3SFGA 1SJQA 1UWBB 4ECSA 2ZC4A 4C2MA 3KLGB 3O1LA 3JQKA 1ROFA 2LEBA 1YJRA 3TVKA 4MKYA 2DGQA 1HR0F 4L73A 4JV2A 3MM9A 4RW4B 4F4AA 2QEXS 3MR7A 4GKJF 1FO1A 3FZ2A 5CHCB 4PXDA 2AWZA 4C6AA 4DV0J 4JI1J 1ZAXA 2CDQA 3TA1A 5D4OA 3BS9A 3SBMA 3I55S 2FVQA 1S6QA 1TELA 1FF2A 2B9WA 2VQEJ 2ZBRA 1RT2A 1E6VA 2AGOA 2Z2MA 4K5RA 5F0UA 3TEGA 3OL8A 5L8RC 4OYAA 2MQ8A 5DZ7A 1A0OB 3ETOA 3OJUA 3PXGa 2AQ4A 2GVZB 3MHYA 1EX8A 4RBUA 1J5EF 1SV5B 4RW8B 1Q95G 2V8VA 3TUJC 2EFGA 2IRUA 2YNHA 3Q83A 4PG5A 2LXUA 3QAUA 3NAIA 2DITA 2DXDA 4KT0C 4URQU 5LOQA 1KVIA 1I1GA 2VG5B 3K17A 4DL3A 1CSJA 4EO8A 3CMAS 3VAGA 1G2EA 3QGPA 2BMBA 1RKJA 1SJFA 2VJUA 1WSRA 2QTWA 2YPZA 2DHGA 4QZVB 2AZ3A 4F04B 4DUYJ 3RR8A 3MURP 3UFCX 2C1EB 1Y0HA 4A8WA 4IG3B 3JQMA 3CMQA 2FIUA 3M8YA 4HR2A 2B7CB 4TXSA 2EKNA 3KHGA 1NK0A 3B4DA 3ENAA 1TKDA 4TLRA 5CYQA 1R6YA 5DJBA 4LSZB 1HR0J 3LP1B 2Y9HA 3R2CJ 4RU9A 2RNEA 1NCLA 5LMUJ 1SJ1A 1U0SA 1FE0A 2PMWA 3HFKA 4HL9A 3KLHA 5A6PA 1D1UA 4TYBA 3G87A 1BC6A 5I3UB 1Q53A 2KYXA 3HZEA 2G9OA 2PMHA 1LW2A 3AD9C 4D3HA 5CA5A 5BYSA 1NHUA 3CO9A 3HM9A 1C1BB 1SC4B 2GHPA 3TYTA 2YBVA 2DHXA 1U1OA 2RF2A 2XNQA 2R7SA 3S7RA 5FD1A 4X4OA 3P45B 3RTVA 3KDOA 2CNOB 2LYVA 3MM5B 1SKSA 2WAQD 4ZLNA 2J8AA 5JUMA 1IBLF 4PXBA 5DG8A 4ZKAA 4WK1A 3J81Y 2DYAA 2QO3A 2VFUA 3DOMB 4ZCKA 1ULRA 2OFHX 3PEJA 4MH8A 2GIQA 3QT8A 4GVBA 1RWMB 3NOCA 2NREA 4B3OB 2C2KB 2MZJA 2XYHB 3WC2A 2OSRA 4R0EA 4GKJJ 2CNKB 3LANA 1MW7A 2YKOA 4MIAA 3TUZC 3EWGA 4O3OA 2MDAA 1FJ7A 1M1GA 3UVJB 5GADI 1HI1A 4FF4A 3DRRB 3TQ1A 1MU2B 1VQSA 2HFUA 4ZVEA 4JV5J 1P1LA 1WG4A 1F6TA 1ZM2A 2ZFHA 3ZZRA 2VASA 3Q0AA 1AROP 1WHVA 4Y6IA 3SYZA 1H73A 4NEYA 5HVGA 4Q0BA 3POTB 3QWUA 3HHLA 2BYCA 8AT1B 5E3CA 2OSQA 4KGVB 3QRRA 4RNOA 3MD1A 3M8WA 2L3MA 4DPUA 1U25A 4WYLA 1QUPA 2ZH5A 3THPA 2D69A 4DR7F 3GILA 1UAWA 4LBIA 2F8EX 4TU7A 2PA3A 1YJTA 5DZ6A 2A10A 1U7LA 1VRTB 2JZ5A 3NMRA 2C2OB 4KHPJ 3C19A 4IG0B 2I5JA 3QSYB 1YTYA 3BYPA 3D0IE 4PYAA 2J9CA 4DUZF 5KFMA 4YY3J 5F9NA 4AXIA 5K8PA 4WFBQ 1RWNB 3CCZA 1RAAB 3LP0B 2G2YA 4QIGA 1F3FA 3G6VA 3D2WA 3QFWA 3SXLA 3I82A 1Q81T 3IGVA 3MFHA 5M2RA 2AF6A 3H2VE 2CRLA 4J91A 1VBZA 4U8VA 3CCRS 1S4EA 1S6PB 2QSWA 1TKTA 4PWUA 1PYSB 3ISZA 1BUXA 1GK8A 2XCAA 2WVEA 2YNFA 1NSAA 3V6KA 2ZH9A 2KRRA 5LXYA 2R2UA 2LQ5A 2B9YA 2OPQB 1SUQB 4O3PA 4RO0A 3QT5A 2RMLA 3M6UA 2ACMA 4HI1A 3QPIA 4OYBA 2ZWOA 1J5OB 3RAQA 3IWXA 4GO5X 3UPFA 4DL0C 2IYIA 3BGFA 2B56A 4FVMA 4FYXB 4X4QA 2ZWPA 3PX4A 1S79A 1N36F 2DHSA 4LMZA 4I67A 4NL5A 3A3NB 2KL8A 1OPZA 2DO4A 3PRVA 1N34J 1M1HA 4Q8EA 2HYIB 2ILZA 2DNKA 2ZH7A 1TK5A 4Y3CA 1JXLA 2YX4A 2DJWA 4ANCA 3OVAA 2XS7A 3DLJA 4DJBA 5LJ3Y 5IM0B 1BWEA 2AMCB 2C2NA 2CQHA 1IWGA 5L9XA 4B02A 4X4SA 3MUMP 2MKYA 4NLQA 2XI2A 2RRAA 3HK2A 3SDEB 3CCES 4ZVSB 4J9UE 5J2PA 1S7IA 1CS4B 5KT3A 4WF9Q 4Q7AA 5KFPA 1V5VA 2ZJRQ 2XLKA 1IWAA 9ATCB 3T5KA 4LRFA 4BS2A 2V68A 3DLGA 4FPRA 2HS3A 4NRUA 4C0BA 3FDSA 4NA2A 3OFGA 5HSPA 4J9KA 4FBTA 2IM1A 5E33A 1HWKA 4ZVHA 1AZSA 2XMWA 3G6ES 2FLLA 2W25A 1B99A 3G9CA 1EB0A 3K8VA 1TL3A 3NGKA 4C97A 5DO2A 2B8PA 3BM7A 4J9OA 5H9FK 3FMWA 3JSBA 4QR2A 3KMSA 2R3VA 4NMLA 3KK2A 2UXCJ 1NK5A 2HHVA 4PUOB 4OZNA 4J9PA 2MYFA 3MF5A 3B82A 4GKKJ 3NL0A 4FXWA 3MPVA 1FA0A 1M5SA 2OPPB 2BQUA 1FJGJ 3VCDA 5KFFA 4DSJA 1BQXA 4DL6A 3AXKA 2XYGB 1HW8A 1KFSA 1YDLA 2HIQA 3CGIA 1W2BR 3RRKA 2NS1B 3HXMA 3UCUP 1SL1A 4X64F 3FQKA 4BWJA 4XPCA 4BCAA 3OR2A 2V63A 5KTQA 2R8IA 2IAJB 4CLFA 2OHDA 4CRJA 1H3DA 5KFCA 2YWWA 2IHR1 4LF1A 3MZIA 4RR5A 3K5OA 2RQMA 5HLFB 2W7PA 3GR0A 4QOTA 3G82B 3AJDA 4QYZJ 4LR8A 1QY7A 3KMQA 4HI2A 4ZVGA 1EHWA 1L3KA 1RAEB 1F2HA 3FSYA 4LQ9A 3K0JA 1IKXA 2ROPA 1R8AA 1RT1B 4L76A 3BREA 2MZTA 4WJBA 2B4OA 2B4UA 1H0HB 2UV8A 4UTGA 3R5DA 2XM3A 4OYXA 4QQBA 3N79A 3DRSA 1W7WA 3MEGB 3H40A 4EYIB 2QA1A 1F9HA 4Y2IA 3DRPB 2VDHA 1XMOF 1QE1B 1HWLA 3IGNA 3QAEA 2HSEB 2OI2A 3M2RA 4P10A 2BJ7A 3UDLA 4HTJA 3VGUA 3O2IA 7AT1B 1T9WA 3CE8A 3MMJA 5HROA 4AQYF 3IRXB 3EVMA 2CFXA 2JEIA 5LM7E 1S7HA 1S9GB 1PAUB 3GFYA 4K4ZA 4ES1A 2ZOGA 3R7BB 4J9LA 5L38A 2ZBPA 1HARA 2P6TA 1AXQA 1VJWA 2IVMA 2R7UA 3J80U 2RQCA 4Q5VA 2GC8A 3GWCA 4YUDA 3D3CJ 5A8KB 5DDOC 1RU2A 3FBBA 3IA0A 2OELA 4NLSA 4WFXA 5KG3A 3W9HA 4ZLJA 2RVJA 1X5OA 3AA9A 3PR4A 2ZEJA 1EQMA 1KR4A 3NGSA 3E2EA 4OI4A 5EGYA 1YVFA 2W4DA 3GQCA 2XSJA 1TL5A 3H42A 3CCQS 4CO1A 1VRQC 4KH0B 4GVLA 4WE1B 4NLGA 5HO4A 2OTJS 3ZZPA 5DG7A 1KQSR 3BPSP 3FFIB 3PKYA 1VFJA 1OQ6A 1UPMB 4IQMA 4RL1A 5SZTA 2F4FA 2WSCC 2HNDA 2PEHA 4CNYA 3DI6A 7FD1A 3W3SA 1CJKA 2VZ9A 3PCOB 3HJVA 2UU9F 4N76A 2UUCF 2QZ8A 2GA7A 1QAJA 3CD0A 2WRMA 3CDBA 5E7OB 2HVHA 2V9KA 2M88A 2H5EA 2JFDA 2OPQA 2CQ3A 1HHTP 2E7XA 1FKOA 3N01A 2VFTA 3RBZA 1IJFB 2CJBA 3KNGA 4JI2F 1NSPA 3M2VA 1H38A 4ZITA 2V69A 3PX6A 1CC7A 2VOOA 3SSSA 3I96A 1UZDA 4R8UB 2FJWA 3C2PA 4LF4J 4DR5F 2G4BA 3F44A 4OHVA 1WI8A 5J1NA 5D0RA 1OY6A 2JLEA 4I7FB 4Y00A 4X62F 3IN5A 4B9SA 2WW8A 4LUBA 3EGZA 4OI0A 3HVAA 1HBOB 1S1UA 3MOJB 2CPIA 3W1YC 4KYZA 4DX8H 1GXUA 2UV8G 1HWJA 4NMXA 4CYUB 1YWXA 1U8SA 1GMWD 1U1KA 4GMKA 1HIYA 2MZRA 1KTVA 2WVDA 4EUVA 2ZH2A 4JYAF 3LAKA 3NS5A 2Y0SD 1NK6A 2F5GA 1EIYB 4XDDA 3NAHA 2Z2LA 5THWA 1CBKA 2R7QA 4IOBA 3ISND 5AT1B 1FWPA 1ZBTA 1VC0A 3AAWB 1ZAWA 1HMVA 2GAHC 2MKSA 4PPZA 3X3UA 5IWAJ 4N47A 2IC3B 2BQRA 4USJC 1FESA 1NHKL 4A4JA 1UFKA 3U7JA 4AL7A 2A6OA 4NZ7A 2DNGA 2GFFA 4UF4A 7FDRA 1HBNB 3Q22A 4DX7A 5LMNJ 2CQBA 2CPXA 1ZTWA 3FUYA 4DU8A 1UEVA 3R1HA 4KGZB 4N7TA 2JH3A 2AYMA 3UNYA 3TOQA 2VHGA 1LWFA 4PKDB 1T05A 1RTJA 4P2FA 4PWDB 3OD2A 1RDRA 1XIQA 2H9ZA 3MPUB 4IG3A 1RWUA 2XMJA 2MKJA 4IR9A 2J5AA 1T9XA 4ZP8A 5F8GA 2IAJA 2H4YB 2K7KA 3WHIA 3QGGA 1RHRB 1ZOTA 2YXLA 4ZVTB 1D8ZA 2FJEB 2B5JA 5J2NB 1PGZA 3HHNB 2CZ4A 2GX8A 5C24B 4EWTA 1C0TB 2W01A 3VQTA 1SVDA 2DY1A 3G82A 1TAQA 3GJQB 5DQGA 1U6BA 4P7TA 4TNOA 3P4UB 1Z2ZA 2EFNA 2CQPA 2ZH8A 2GHVC 3IXQA 4RLEA 5ETRA 1ZZNA 1N5YA 3N0VA 1WG1A 2QMXA 4DPWA 1N33F 5ITHA 2DNYA 3DHXA 1ZPWX 2EVZA 4LF8J 1EETA 3Q8UA 3BEGB 4F36A 3GG1A 1HBMB 1TMJA 1UWAA 3GP9A 4O3RA 1U4BA 1R0BG 1R6VA 2A1BA 4LREA 2OAUA 4LF5J 1X4AA 3Q86A 3DRPA 2VQFJ 4FPIA 3V81A 4Y2AA 2CIMA 2CQGA 1NDKA 3PW5A 4M5KA 1JLQB 1WORA 1TZ0A 4JYAJ 2UU9J 1XNRF 2XYPB 3AA8A 3MR5A 5L1LA 4USTA 2EPIA 2P8IA 3W8PA 1RTHA 4CM2A 4ES3A 4B3MF 4OYWA 2NXEA 4OHYA 2LLZA 3R27A 1EZZB 1J27A 2Y1IA 4QW8A 1DARA 3H59A 2XNRA 4JV1A 2ZE2A 3POTA 3UNGC 3W2VA 4X65J 4F4YA 3UN5A 2MZ1A 3QZ7A 1N56A 3O6QA 2J6SA 3AODA 4DFMA 4KGMA 1XNQF 3K5LA 2CZVC 3MM9B 1FFGB 4FKYA 1UA0A 2DK2A 3BO2A 5SUHA 1JWWA 2PI5A 3JTPA 3NY0A 3K5PA 4NCBA 4B3TJ 1QTMA 2I9SA 2FY8A 4ICLB 3W5YA 4I0WA 2HQDA 2QT7A 2IY5B 3KJNB 3C46A 1YGYA 3ZZYA 2DH9A 4IYQA 1KVJA 2X1BA 1XC9A 5KFDA 1F5AA 3CXCR 2LEAA 3D67A 2XB2D 1FKPA 5ETSA 2X1GA 3OTDA 1DRZA 3TA2A 1EP4B 1H7WA 4ZLLA 4ER8A 1KD1T 1X4BA 2DR6A 1TMMA 3D3BJ 4E2FB 2EXUA 2C3OA 3KK2B 1VQOS 1OQ3A 5E3QA 4DR4F 1R3NA 1X31C 4F50A 2Z2YB 4Y2CA 3IG1B 2QV6A 5KFSA 4X4RA 2BV3A 2BQ3A 1I94F 3PYFA 5A0YA 5LT5A 2HZVA 4ELVA 2W2OP 3ICLA 4HHHA 2W2MP 1ACMB 3MDFA 1KKHA 3D28A 4M5LA 4YR0A 3JTNA 2ZUAA 4WU2A 3M2VB 3THTA 5GAHU 3MUTP 5EWFA 3LP1A 2V2KA 3ONQA 2W9BA 3IRWP 4R8UA 3B8HA 1ZETA 5IXUA 3HSZA 2V4RA 1V3RA 3NLCA 1TFYA 2YVSA 3J7AN 1AFIA 3HMJG 4TYAA 4OX7A 4DR1J 1TK8A 5KT6A 5KFNA 4HT7A 3BQ0A 1FTRA 2DRAA 4I6WA 5AXLA 3R7SB 1RTDA 2JFKA 2ASDA 1C0UA 1UEKA 2V8PA 5GAGU 4QJVA 1IR0A 3NRBA 3M8ZA 3MEDB 3FNNA 1XR5A 4PQUA 4CLKA 2C28A 2E1CA 3I6PA 3PY8A 3TZYA 3FEXB 4P7VA 3N28A 2YKMB 2NXNA 5IFMA 4JV0A 1HQEA 4IDKB 4K8RA 3J81j 2FHMA 4LSNB 3H0PA 5GAGI 4IO9Q 4D3GA 2R2TA 1A9NB 2HFVA 3EJMA 4XK8C 4ENOA 1SC6A 2Z2ZA 2ZUGA 4CH7A 2N7CA 3PHTA 3SQGB 3ZTRA 4K2XA 3PX0A 4EZ9A 3CCUS 3H5XA 4JI0F 4ELUA 4K4VA 2RKIA 5GAEI 2BE2A 1HQ2A 2OEKA 1HNIB 1A7GE 1WC3A 4LSLA 4NXNF 4DG1B 3BDEA 4ECRA 3EVOA 4L3NA 4P2MA 2MHNA 2RIJA 4PXCA 3W8GA 2XS2A 1NKBA 3OR1B 1T9YA 2E66A 2Q6CA 3TWZA 3OL7A 5KFQA 5J2QB 2B5JB 1S1XB 4G1IA 3E3XA 3JTOA 4NCGA 1L5UA 4K50A 2V2VA 3TJ9A 1IBKJ 1X4CA 3M8PA 2K1RB 4WE1A 3MM6A 4I6YA 3R7NB 1OMSA 2F3JA 2AJFE 3FFIA 3H5UA 4C3LA 2LCWA 4NYPA 1RT3A 1X0FA 2F4VF 3N5BA 2WK4A 3M8SA 5G0RA 2ZM6J 2G1DA 3DI6B 3L3CA 1FDNA 5KFAA 2CAJA 2VD3A 4P71A 2GHWA 1CJUA 2QLFB 2WBMA 3LF0A 1Y7PA 1J2VA 2CPEA 3H5SA 4TY8A 3PW2A 1RT1A 4ZPTR 1VQPS 4DSKA 1Q8KA 3QLHB 5KG4A 2RSQA 1SJ4P 1IUJA 2OTLS 4JI8J 3MEGA 2VBWA 2XWXA 4NI2A 3VALA 1RHUB 2PIIA 3HSJA 3PVXA 3DGVA 4WCEQ 4RKUC 2V34A 2QLJB 3IRXA 5J1EB 2CJXB 3AH6A 1NJIT 3GONA 2H3EB 1C2PA 1S9GA 2P5VA 2XMUA 3SSQA 1FEEA 9RUBA 1M1KT 4X2BA 4MIWA 4DL4A 4EZ6A 1C4AA 2CPJA 4RBTA 3C15A 4ZN3A 1PCAA 3L9ZA 3S8SA 1NSKL 3D7SB 4NA3A 3TUPA 1SQEA 2HWHA 1FVQA 2ATCB 3QT7A 1QSSA 1Q5YA 3SI8A 2KZMA 3ENWA 3DYAA 3QO9B 4NX9A 3LGNA 1CULA 1OO0B 1T95A 2DEJA 1FDAA 2WB4A 4FP9A 4ID8A 4OJHA 2ZM6F 4MK7A 2BKNA 2QYGA 2LDYA 3BKFA 2L08A 4FKXA 3UD4P 3CJRA 1MMNA 3E01A 4ES2A 5C7PA 4H4KA 3QIPA 4NLUA 2LU2A 3OW2R 4WBFA 2FHJA 2FZCB 2JDJA 3JSYA 4H4OB 5DG9A 3D1HA 2VPXB 2KFZA 2PE8A 3M8QA 3Q8RB 1FE4A 1JLAB 1LXNA 2E5HA 3CB4A 3V5RA 1DZ5A 3DMJA 2HHHJ 2VA3A 4MTPA 4OLOA 3BGUA 4QIWD 2MSSA 3KJFB 3H4BA 5HBMB 2DRDA 4ED8A 2Y3YA 2G0JA 3AHPA 3EMTA 3G8SA 2VC0A 4F67A 4JI5F 4DMZA 5B7WA 1KOHA 2QA4G 1OYDA 5KOWA 1U2RA 4WIQA 1WKJA 4OJ1A 2HZAA 1BD6A 4G3IA 3I5AA 1KOOA 3LPEA 1VBYA 1Q82T 2DY9A 2XY6A 4DQIA 1SL2A 3RB4A 1TAUA 2FD2A 3KK3A 4C0OC 3MR3A 2BJDA 1SKUB 3MM8A 1WJ9A 5KFVA 3M8RA 5J2NA 2M7SA 2HVIA 3ZZTA 3D6MB 3U27A 4CZCA 1TKZA 2E9ZA 3KLGA 3P49B 2C42A 1LNQA 2QA2A 3AD7C 1DTQB 4WXWA 2UUTA 2ZNZA 4ZPCA 4M5HA 2NSCA 1RTDB 2WOMB 2DD8S 5KFRA 4CLZA 4F3OA 5T7LA 5F8NA 2OPSB 1X7VA 2X1FA 3VR1A 3HP6A 2WB1D 3PIPQ 4IOCQ 2MEWA 3L7UA 3QSIA 1NJWA 4LF7F 3MCOA 4NLXA 1IBMF 3WX8A 3DDIA 1CJVA 5I42B 4PQUB 3O5TB 3LOUA 2A0FB 2XMVA 2R8GA 4JI7J 3MAAB 3CD7A 2XS5A 3ADAC 3BQ2A 2XBPA 1NRKA 1WHWA 3UQSA 4CO5A 1SC3B 4QCLA 2DNRA 1CJTB 1MMLA 2YTCA 4ECWA 4C3KA 4FF3A 3WDOA 2RQKA 4LVNP 1SV5A 4RW8A 1VISA 2JL9A 2WZ1A 4U95A 2YX7A 2YNHB 4AD6A 3VAJA 1S0VA 2HGMA 3KLIA 4USWA 4WK3A 5RUBA 2PA8D 3I4PA 2A6MA 4ZPBA 1YJWS 3UO0A 3FCWA 5DS7A 2OEMA 2DGTA 4A8OA 3Q2TC 3LP2B 3FZBA 1N0UA 2B4PA 1DAXA 2BANA 1UJ4A 3EGVA 2H65B 1RKIA 5HVFA 1P6TA 1S1TA 5CAAA 1T05B 1T02A 2AV5A 2ACYA 2BJ1A 3N9UC 2V5HG 3BBCA 3WBZA 1LW0A 3J7YU 4EYHB 3V6HA 1RT5A 3TA0A 3EPIA 3KLFA 4OYPA 3GYNA 3DM2B 3VHQA 4CO4A 1U48A 2BJ3A 1Y5IB 1E6YB 1VK8A 3RBEA 1SH2A 1U1QA 3C3LA 5K14B 4F7VA 2XMMA 1JQGA 4CCHA 1RBLA 2MPUA 3HCXA 5J2QA 1DQAA 1ZZFA 1URRA 2DHHA 2W4CA 4LF7J 2GZOA 4N8NA 1GAOA 2JC0A 2FLOA 1OWXA 2CPZA 2RE1A 4JOUA 3KUHA 3TRGA 3NKYA 4K4YA 4F3MA 3SMZA 5C25B 3TO8A 2KJVA 3WC0A 1RT4A 1FKPB 3IP0A 2BR0A 2NR0A 4K2JA 1I94J 4JB8B 1WELA 2C2MB 1PKUA 1REVA 3CF5Q 1VLYA 3FEYB 3T9NA 2GMHA 5L1JA 2NXJA 4DF8A 3ZTQA 3TZZA 4CDIA 1TUGB 1JLCA 2L41A 1G6BA 1XQIA 5KAKA 3D66A 3QLHA 5AJ3J 1T9VA 3DDKA 3T5JA 1RU1A 3IBFB 1PYOB 4WFZA 1SC1B 2FJVA 3M32A 3MEEB 4HT5A 3UI3A 3BKUA 4FYVB 5BR8F 3MCNA 1FERA 2EK6A 2D3UA 2HK2A 1N34F 5KG6A 1M5PC 1AFJA 1U2FA 1T11A 1ZM3A 2E1MC 1U1LA 4YEAA 1S76D 3VZHA 1DQ9A 1JLBB 1WEZA 1YLXA 2V9WA 3JS9A 1JLEB 1KQFB 1BLUA 1XR7A 2GQCA 2QLBB 5AXMA 4ZVUB 1OS5A 1RWVB 4ZHRB 2JOQA 1Q8BA 2XHWA 3P3DA 2J6UA 4HH0A 5H1SV 1QDUB 4O23A 2B9EA 1RAJA 1WC4A 2J7WA 3D6HB 4K5SA 4QIEA 4YHHJ 4IOAQ 1UW4A 3BKTA 1REGX 3DYAB 3QO9A 1KWMA 4HHUA 4DF4A 5T14A 1WC5A 2DR7A 4CYUA 4ZCLA 5A8WA 3HSGA 3TX8A 4M5MA 1HW9A 2HURA 3P8BB 1D0EA 5B0FA 3QQCD 4DPYA 4PRFA 1YHQS 1NXIA 2O3DA 3AJ1A 4WP3A 2Z58B 5ETMA 4CLTA 2UUAJ 1FRHA 1UETA 1U6ZA 1Z4UA 2CPHA 5IS2A 2ASJA 4N5SA 4MFBB 3WQPA 4PXEA 1WTFA 3H7HB 5L39A 4A47A 1HMVB 3ULHA 3TUIC 3WIVA 1FCAA 3T1YJ 3W2WB 3UD3P 4JI5J 3OPKA 2V2ZA 4DX5A 1VQ5S 4NLOA 2BW7A 2J9DE 4ZIVA 4UY85 5A6WA 1Y5LB 2VG5A 1RP5A 4BC9A 3KWMA 3H5YA 4S0MA 4F0HA 3UR0A 2E9RX 3H2LA 4ZJOA 5D0HA 4ED4A 2CJKA 4ZK7M 1VQ9S 4XIUA 1UL3A 1UTAA 3AB4B 1S6OA 3IM9A 3LUYA 1WC0A 3OLBA 3GIKA 3QRPA 3H98A 4RPFA 3CDWA 2IPOB 3TJAA 3MM7B 4QWEA 1VBXA 1JX4A 4DG1A 1NJXA 2LEPA 5AE1A 4YOEA 4RW9A 2MQLA 2RUGA 2P9CA 4YB1P 4LFAF 1LEOA 4NLRA 3A3PB 4K4SA 3ILJA 1KTQA 1T94A 4CO2A 1RT7A 4CQ1A 5A76A 5CABA 3W9IA 2G2OA 4YHHF 5DLFA 1S1XA 3H20A 5E0OA 3PR5B 1ZH5A 1KLMA 4HACB 3OSNA 2VONA 3VAIA 1SPBP 1WDDA 2KXFA 4OZ3A 3K59A 4WP8A 2W2PP 5M2UA 2F63A 1WKLA 2E1RA 2HBRB 3VQSA 5DQIA 3BGRB 5HP1B 5D3GB 1RWPB 2MLZA 5MLCV 2P9GA 2PSZA 4I6AA 3T1AA 1JJ2R 4OFZA 2KT2A 2N4DA 2KTQA 2MQOA 1HHQA 4ANDA 5K20B 2OP5A 4RW4A 1UJ6A 1FTCA 2DKOB 4JI4J 2XZWA 4CH1A 3NNAA 2OUGA 2AYEA 3A3OB 3VZIA 5BJRA 1GMWA 3SDEA 2HRTA 3FBCA 2Z0GA 4C7QA 4A8YA 4B9LA 2J9EA 4Q44A 1FXRA 1JKHB 1X8DA 2D74B 3CJQA 4TLQA 2R7RA 1RLCL 2XG8A 1WNEA 4ZVFA 3PNIA 3DLHA 3K5MA 1Y11A 1Y3JA 2EC2A 3GSIA 2YKAA 5E41A 1QLNA 3HVTB 1TKXB 5EX0A 3MOZA 2GCFA 1T3NA 2FTRA 4USKA 3CJKB 1HNWF 1NK9A 2R4FA 1VOMA 2GO9A 4KSEB 2BEFA 2QX0A 4IH6A 4NRTA 3SQGA 4LRDA 2NZ4A 2IRXA 4DCJB 4X4NA 2F8HA 3U1LA 1DFDA 4RX6A 3RBXA 3S01A 3HVWA 5HJYA 3NGDA 1GQEA 3BGOP 3FSIA 1IXKA 4DSFA 1TL4A 2QL7B 3J7YI 4N41A 3BR9A 2FVCA 3L95X 1M5HA 1SKWA 3HPOA 3SZ2A 2IMWP 2OGUA 4N77A 4A8SA 1KN6A 1RI7A 4OJGA 5D0EA 4EU0A 1OY8A 2HFNA 1VRTA 4OZLA 4B3SF 2W7AA 4IG0A 4ZPAA 2YQ1A 3TP2A 5K8OA 2RU9A 3VGSA 3H8YA 3MGJA 3ILOA 3LAMA 3T6JA 3BH6B 2YQ0A 4DR3J 4QIVA 4LFCF 2BRKA 1NZ8A 2HKEA 1UA1A 1HD1A 4U7UK 2XY7A 4IH5A 3M05A 2K7JA 1XMBA 1FXDA 2LA4A 2COLA 3DLLQ 2IBKA 2UVRA 3NOGA 3WX4A 1RABB 3R1LA 2GGPB 2LKZA 1KFDA 1TR0A 2M0GB 2MTLA 3PG9A 2R9LA 4F4KA 4LF4F 4LIWA 1XMQF 1GXTA 2HQIA 2YNFB 4MYTA 4B08A 3C16A 5A2QY 4TU8A 3KHHA 3IG1A 1ELOA 3PJXA 3I56S 3DOMA 1U1PA 4NASA 1SUQA 2V8DA 1S0NA 4B3OA 4EBCA 4C0HA 2ALZA 1QE1A 3HX9A 2KT3A 3MTKA 1S1WA 3DNCA 3TZWA 6AT1B 1JLFA 4WTOB 2H54B 3EXCX 3QGHA 3HLUA 3AY0A 3DHWC 5HMYA 2JWNA 2M5YA 3EICA 5JJBA 2W9BB 3VAKA 2K3IA 1K1QA 4ECVA 3C6TA 4UUXA 1YRTA 2XO7A 4L72B 2IDEA 3DCAA 2YPYA 3R8YA 5BYQA 2NQPA 1DLOB 4IFYB 2OIHA 3BSOA 1X4DA 2MQNA 1GXLA 4LF9F 1Y10A 5GADU 1HNXJ 3PDNA 3UR3C 4MAKA 1UVNA 2F4VJ 1YJ7A 1XN9A 2AEJA 5K8MA 1VQ4S 2Z30B 1Q78A 2V2QA 4QWDA 3HFVA 3CCWA 3OTOF 2E7WA 1D09B 4P9SA 4OYMA 1F9FA 2KKHA 4LR9A 2P2CB 3K5NA 4HH1A 3CJSA 1R8CA 1KHVA 2HG4A 2X7IA 2HVDA 3TVZA 2H48B 2FC9A 3EDQB 3G2XA 2DCLA 3MFIA 1Q7LB 4CM0A 5DDPC 1IQTA 1AZSB 3M8QB 4J90A 3O44A 3AD8C 3UDVA 1TL3B 2C3PA 3HSDA 2HBYB 4PG7A 4DHVA 3T41A 3OTCA 4ED6A 5H9EJ 1X9MA 3T9ZA 1LWCA 1HNZF 2DNZA 2W2QP 1YG0A 5HBMA 4ECQA 2YH1A 3DFEA 2KYZA 2ERRA 2O1PA 4PUOA 1W26A 2F9JA 2P6SA 1U6FA 3P6YC 2AHOB 1GMVA 2NZCA 4FVCA 2DIUA 4Z2XA 2ZHBA 3MMBB 4RW6B 2VFRA 3TW0A 1NDLA 2KG1A 1DBDA 2WVBA 3ZXWA 1AUSL 5FIIA 1NH8A 1JJ4A 2OMLA 5K14A 1U47A 1N6QA 2CJYB 3K2YA 1ZM9A 3CIMA 4M95A 3DDNA 1AB8A 5ETOA 2VFSA 1VK3A 4K7QA 2RU3A 2XZDB 2ZBQA 5HK4A 2IA0A 1S12A 1SQFA 3MEKA 3TAMA 1FHTA 2KXHA 2CG8A 2O67A 4FN5A 3M4XA 1G4CA 4QWCA 1MLAA 4I7FA 2VOPA 1RXOB 1H2UX 2HBZB 1RCXB 1RAIB 5KFWA 3AOBA 2DHAA 4PG6A 3MUVP 3EX7B 2ALYB 2HFSA 3MWBA 3QMQA 3HHKA 3RUBL 1PC4A 3VF0B 1FT8A 2IJFA 4QBUA 4UOCA 2FB0A 5CZXA 2CDRB 3MM5A 4OI1A 4XTTA 4ED1A 4OHZA 2LFVA 3AOCA 2PI4A 2OD4A 3J81U 2RHQB 2RDJA 1K47A 1N5SA 3MAAA 4CWBA 1IBMJ 5LSOA 4B3RJ 3B78A 3PJ9A
chains in the Genus database with same CATH topology
3Q8SB 1S0MA 1G1XA 4RW7A 3WZ0A 4C8KA 3MMAB 1N8RT 1SI9A 1K0VA 3KLIB 3CTRA 1HBNA 4R25A 4ZA1A 4LT6A 5A8RB 1R8PA 2FGCA 1RTIB 3ENQA 2CQ0A 1B0VA 5KFKA 5B0EA 3HDSA 5KFHA 1HL6A 1S1TB 2HZCA 3HHLB 2W8LA 1TP7A 5GAEU 1N4LA 3G71S 1HPZA 5CYMB 3M1VB 1RT5B 1SXLA 4EFAC 3O8WA 2D1CA 4YDDB 5CCLA 1MWYA 1X0PA 5CZVA 4RU2A 4ETZA 3HHLD 3MXHP 2MMYA 2NUHA 2DNNA 3OL9A 2EFQA 3OUYB 4DQPA 1HNVA 2R2RA 1ZTTA 1FRMA 3MECA 1BGXT 2BM0A 1LV5A 2E5IA 4I68A 4RWXA 2CJAA 4H4OA 1VQLS 4A8MP 3D0HE 3QJJA 1N5TA 2WCXA 1F5CA 1DURA 1UJ5A 2J0WA 4GC7A 4A8QA 2QSFA 1VQNS 5HMXA 1VIXA 3NG8A 2M3DA 1N5VA 1VC6A 2XWYA 3EGNA 4PCQA 1LQ9A 2OO4A 2CVIA 1FD8A 1K9MT 2DGVA 3J80Y 4ED7A 3LALA 1L3TA 1QUVA 2KRBA 4X4VA 3I0SB 3KG0A 3ZFVA 4F25A 3G86A 4CT9A 1ZYQA 4F8RA 2R8KA 4Q8FA 5AXNA 3G6XA 3QJLA 1PO6A 1AUDA 1C1CA 2EFVA 2BUNA 2NUUG 4AL6A 4NPOA 3K58A 1HD0A 3C6TB 5C5JA 3I87A 3V4IB 4HDHA 2KO1A 4KIAA 4OHYA 2UUAF 1APSA 4KV8A 1LKZA 1X4FA 5GAHI 2M8DB 4KHPF 2CJQA 3RAXA 2ZE2B 3W2VB 2OJ3A 1NK7A 1B64A 1IKWB 2FVPA 4HKQA 3OHBA 1JIHA 2ZKUA 1YIJS 3LW5C 1WEXA 4OX8A 2W9CA 2BOPA 3HJFA 4LQ3A 3GB0A 4ZP9A 5AE3A 4X65F 4NLYA 1R7IA 2ZOFA 4I2QB 4OL8A 2F7VA 3C6UB 1X4EA 3K8WA 4MK8A 2KH9A 2XSFA 4KKOA 5LSLA 1BQMA 3I0RA 1YJVA 5D6GA 4DSLA 3UCGA 1HI0P 4OHWA 4K59A 2V8GA 4WU3A 2EFOA 2UXCF 2C3YA 4R5PA 1YJUA 1YRUA 4F3QA 4F4WA 3OXLA 4QR1A 4RNMA 1D9AA 1FRKA 3LP2A 1JB0C 5GVQA 4M5DA 2LECA 3KNAA 3FCHA 3TAQA 4IFVB 2ZZNA 3OVSA 3DU5A 4BBYA 1FRLA 3MM7A 3CC4S 1H7XA 3DOLA 1HBUB 4JI7F 4FZVA 1RK8A 1JJHA 3GZ7A 2DRBA 1N54B 2ZH1A 2AJ4A 4F4ZA 2V4JA 1S97A 5IT9Y 2KT5A 3SEOA 4IRDA 3PACA 5F0WA 5C24A 3IS9A 2R7WA 2JEJA 2C3UA 4C98A 3VWSA 1H98A 2FLNA 4AYBD 3I4HX 3E8OA 1RT4B 1VMBA 2R8JA 1Y5NB 5D3GA 2C3MA 4FBTA 2CJ9A 1REVB 1C0UB 1V3SA 5KFOA 3E51A 3MPYA 3LWMA 1TK0A 2VPWB 3R5BA 1U1RA 3DLEA 1QAIA 1EETB 2B0GA 2WSEC 1QJHA 4N8OA 3KHRA 1Z1ZA 5CQGA 2HVZA 3NP5A 1KEKA 3RB6A 1FRIA 3CT9A 2HHHF 4UUWA 3QYYA 4RBVA 4DV7F 1MSWD 1P9QC 3MI7X 4H54A 4O4RA 2MQQA 2WONA 3CCTA 2R8HA 1U1MA 3G96A 2HS4A 2YNGB 1CC8A 3TVYA 4TQSA 1WHYA 4Y34A 2B43A 3BO3A 1X4HA 2DO0A 3CJ0A 5JVGQ 4F26A 4OIXA 4RNFA 2J0XA 1YSJA 1K1SA 1FNXH 1IKYA 2KHCA 3UCZP 3M1VA 2W8KA 2L9WA 4ALZA 2VH7A 1ZM4A 3BB5A 2PD1A 2VODA 3MAQA 3GIIA 3GIMA 4W92B 2PGCA 2Y1JA 3T1YF 4ZCMA 5A8WB 3NS6A 4URGA 1N0VC 3D1OA 3CDUA 5U47A 4BC7A 4B9MA 2MKHA 1SIWB 1V9OA 1CPZA 2ROEA 4TY9A 3ITHA 1B0TA 3PW7A 3R3TA 2B6AA 4MFBA 4Q2LA 1YRXA 1TFWA 4N56A 1VQKS 2HNZB 1KQGB 4ZP7A 2HNDB 4C8MA 3HHLC 3OHAA 4ECTA 1MROB 1JK9B 2KM8B 5KFIA 2HNYA 3OBIA 4RW6A 3LQVA 1F60B 3KFWX 4CNZA 3A1YG 2XGPA 3OXFA 2VG6B 1CG2A 1TL1B 2ZOMA 1AW0A 2ZH4A 2ASLA 1N6QB 2A3JA 5KFGA 3GFHA 1R8HA 2J76E 4DPOA 5J1EA 1RT7B 4Y2MA 3V2UC 3KK1A 2IYGA 1R89A 4GO7X 3T5LA 2GV1A 4F02A 3M9MB 2GNKA 1I6JA 3K7RA 2FVSA 2FVRA 4DSIA 4M63A 3MR6A 2PO4A 5B0AA 4KE5A 4YR2A 1IKWA 3GG0A 4J9QA 4WZQA 2YX1A 3QJPA 2XLIA 1OSDA 3GSDA 3SV4A 1O8BA 2J6TA 3CJ3A 3BSNA 2CVEA 3Q2SC 4TKTA 2DGWA 4DL2A 3EZUA 1M5KC 2HHQA 2KI2A 2GIRA 3MPWA 3Q24A 2DNQA 3AJ2A 4CO0A 4LIRA 4OZ5A 4FS1A 1P1TA 4I2QA 3HZGA 1KQKA 5F8LA 4CO3A 2R8IA 3M6WA 3BSAA 2AJ1A 4UQTA 1FKAF 2JC1A 3EYZA 1NK4A 2LVWA 1JLGA 5J2MA 3IC1A 4OHXA 4WKRA 1W2IA 3HVTA 4OX6A 3U1NA 2HWTA 1LWCB 5KG2A 4X4PA 1G7CB 3CJ2A 2AJQA 1OPIA 2GJ2A 1MWZA 1KSPA 1MNEA 2RQ4A 4M5DB 4IUFA 4YY3F 2VBYA 4C11A 3OV7A 3CDEA 3PZPA 4PWDA 2UXDF 3MR2A 2DB1A 1M90T 4KO0B 5CYQB 1VI7A 4F2RA 4QWBA 2LDIA 1L3UA 2ZD1B 4KFBA 4OI2A 1QVFR 1Q1KA 4IH7A 2XMKA 1BQNB 2BW2A 2L9DA 1SIZA 3IR5B 4HVZA 3BDPA 4DV6F 3QGIA 3M8PB 2AYGA 3IBWA 3MM6B 1XERA 4Q2MA 4QYRA 2VA2A 5C42A 4B9UA 3CULA 1TV6A 5T7LB 3OSPA 2FJBB 4ZDNA 5IWAF 4LF8F 3JSMA 4V19X 4LVOP 4YR3A 1T03B 5I42A 2CQIA 3VTIA 4NLTA 1XWLA 3KTQA 3OQ2A 3JYTA 1X9SA 2FLPA 1HBMA 1U49A 3I0SA 2EKYA 4DV4F 4OV1A 1RISA 3RR7A 1SJ3P 4ED0A 2Q3PA 4I69A 1S48A 4MKAA 1S1VB 5MAOA 2VL1A 2JSXA 1SBRA 3GFZA 3IO1A 4U7CA 1OIAA 1HNXF 4OI3A 5FJ4A 3DRRA 1IN0A 3GV8B 1LK7A 4LJMA 3IN5A 2WHOA 5KT4A 2IM0A 4B17A 1LXJA 3F56A 3OXGA 1Q16B 5EHHA 5HQ8A 2FHKA 1RA6A 4RNNA 3G6YA 1Y3KA 4XPEA 4ILMA 1NK8A 2KN4A 2HHPA 4NLVA 1C4CA 3DM2A 1Q7YT 2Z8QA 4O3SA 1NJZA 1UVIA 2AX0A 4E98A 1FNMA 3P5TL 2ZNYA 3LGMA 3SCIE 4U67Q 1UVMA 3E01B 2KFNA 1E6VB 1XEZA 4GKKF 3NCPA 3RB3A 4ZPVR 3C6UA 1FXLA 4CH0S 3MCSA 3NWGA 5DDQC 4KKOB 1JLAA 3CIZA 3DMJB 3JAMY 4ECUA 1RT3B 2HLUA 5G0RB 1FJCA 4TU9A 1R8BA 3BO4A 3LWLA 4DV1F 2RILA 1TKTB 2F40A 5D77A 3C66A 1CQNA 5FLXY 4OJ3A 4ECYA 5KFEA 5DETA 4QR0A 4ECXA 3Q23A 2D41A 4XDCA 2FJXA 1HBUA 3J7Z5 5L1KA 1X4GA 2QLXA 2FUG9 5KFUA 2V4JB 3K57A 1TUVA 2ZDOA 5FDLB 3KLHB 2QYCA 4PG8A 1JLEA 4HHJA 4DR6F 3IS9B 2Q66A 2YNIA 4PQAA 2XULA 1DTQA 3TANA 2XC9A 1NAQA 2E1AA 2QIFA 2M2BA 2XMTA 4OZ1A 2ZVSA 4CI0B 3NNHA 4MKBA 2JLGA 3HVRA 3T3FA 2VPZB 3IAM9 2YKPA 2AX1A 4MK9A 1GT8A 4NWBA 5DDPC 2DPJA 3C8YA 4YR0A 5J2PB 2PT0A 2M70A 3MEDA 5DQHA 3KG1A 2N3LA 3HKWA 3DXBA 1VRUA 1QM9A 4FYDA 5EUHA 5F3TA 3QIPB 4Y28C 2V94A 4EGLA 5DLGA 5ADZA 2M8HA 2WONB 2VQEF 3KLEB 4WTYA 3R5AA 5B09A 1VHFA 4O4GB 2E9TA 2MQMA 1W25A 2HWIA 3I0RB 4M8LA 1NJYA 3SCLE 3P96A 2YNGA 4CT8A 1O0PA 2LQBA 5KFXA 4NA1A 2VFVA 5IQQA 3EPGA 4I2PB 2DNHA 2OFGX 4IQXA 1S77D 4YP3A 3CDAA 5LXRA 1DTTA 4J9MA 1V6HA 3FJ2A 1IKYB 4C11B 2A2CA 2HHXA 2OPPA 3SCKE 4HYKA 3NCRA 1HPZB 2BE2B 2E29A 4K4TA 4KO0A 5KFTA 3UDCA 1S6UA 4FS2A 1UVLA 3MTJA 3CCVS 1N5QA 3S6EA 1T3OA 5JXSA 3DU6A 2B9XA 5GMKa 2GQ2A 3CJ5A 1WD6A 2MGZA 1HNVB 2RH3A 5I3UA 2IA6A 1TKZB 4H4KC 4J9NA 1G3OA 2K1RA 4A8FA 4WIIA 4IR1A 1MMDA 4O0IA 1N32F 3G4SS 2WOMA 2HHWA 4M1KA 2OPSA 3RRHA 4YMEA 2RRBA 1Z2LA 1WEYA 2YWGA 3S1TA 1JKHA 3DOKB 3FVYA 4LF4F 2L48A 4E8UA 2IRYA 2E5GA 4WFYA 1D8YA 1U26A 2CG4A 3SCJE 3M2RB 2EFPA 5HMWA 2RRNA 2YKNA 3FQLA 4FBUA 4HEA9 2G13A 3SV3A 1JLBA 1M5OC 2F9DA 3OFHA 2AYBA 2QLWA 5D8HB 5KFJA 3M2UA 3V4IA 1MU2A 3GV7B 5KT2A 2U1AA 4ID5A 4RNHA 5DGAA 4ZHRA 2BANB 1VQMS 4NLWA 2AW0A 2EI5A 1HFEL 1KHWA 1IKVB 3PFEA 1S9FA 4HDGA 1NZAA 2RB7A 2YWKA 3RBDA 4K4WA 2ASYA 5EX3A 5K8NA 4OZJA 1Y4ZB 1UEUA 1UKUA 2SXLA 2UUBF 2JEGA 2LQJA 2ZHAA 4DLEA 3BZQA 4C8OA 4FNIA 5C25A 4DN0A 2CYYA 4XAKA 2O01C 1P8GA 4AUKA 5J2MB 4ECZA 4UQGA 3HHDA 2D9OA 1SJRA 1ZAVA 2KZZA 2NYIA 2QE5A 1V3ZA 4IRKA 5F8HA 2DVIA 3OFFA 1WTBA 1U45A 3RZAA 2Q79A 1LWEB 3Q8PB 2D3OR 1DHMA 5HN0A 3GMGA 5IT4A 4IFVA 4R0JA 4QPXA 3TAPA 3DLBA 2BM1A 1JXEA 2ABYA 3M6VA 4OMFG 2RDIA 4RW9B 3SFUA 4EBDA 3N5FA 1PSDA 4MMOA 3KK3B 2UP1A 1F0XA 2K2PA 1WF0A 3DN9A 5EDWA 4G6VB 5E3RA 4C9DA 3KK1B 4FXDA 1KLMB 2A2DA 1DLOA 4IFYA 3ZZZA 2RS8A 2X51A 4YB7A 1KNZA 1LW2B 5HP1A 2ZH6A 1Q8LA 2RF2B 2KDOA 4ZCIA 3JSMB 1XR6A 2ROGA 5F8JA 3FRYA 1VBZA 2K3KA 2EG2A 3B4MA 2HFZA 1NKCA 2WBRA 4DV2F 1KLNA 4YFUA 4DFKA 1Q79A 2ZKTA 3KLEA 1HQUA 2LA6A 2BJEA 2VB6A 3T1HF 2DIVA 2FC8A 2UVWA 3U02A 1VIOA 1S9EA 2EK1A 4KB7A 2J7UA 2AP6A 2C2DA 2CPDA 2DNOA 1YBAA 1X5PA 3HO1A 3BQ1A 4B3TF 1QAYA 3V4MA 3O3LA 1BY9A 2B3TB 1QSYA 1RTJB 5AE2A 4AFFA 4DBQA 2F1FA 4DFJA 3T6BA 4ZP6A 4JI4F 3IR7B 3NCQA 5IQ6A 4OLPA 2IVFB 4O3QA 3KLFB 5E3AA 2R7TA 1VC5A 4KBIA 4DS4A 3ISNC 3TR5A 4DUYF 1TVRA 3OR2B 2CQ4A 2BBEA 4Q43A 1K73T 1BQNA 1FK9A 3OTEA 4J9RA 2XSJB 4F4XA 2ZJPQ 5BYRA 2O5DA 2GMLA 4MIBA 1GX5A 3LP0A 5C42B 2DISA 2M9KA 3CC2S 3FGVA 3V6DB 1QSLA 1K8AT 1NU4A 2PN6A 1KC8T 1D9DA 5IT0A 2HS0A 2J0SD 2GW8A 3KYLA 5I3QA 5AJ3F 4NZ6A 2JJ4D 4MYUA 4KJIA 2EG1A 1D3WA 1HA1A 1NO8A 2HNYB 4GC6A 2FGOA 2I0XA 3CCJS 3ZZUA 1FJEB 3V81B 4AXJA 3M32B 3MEEA 3F73A 1J5OA 1JLFB 2JRSA 3FMBA 4YB5A 2YY3A 1JLQA 3I32A 4Q45A 5B0GA 2DR8A 4F2SA 3OVBA 4O44B 1SKRA 3DRXA 2R7OA 5A8RA 2MSTA 2W9AA 1RQ0A 1CEZA 4DSEA 4EO6A 5KFYA 1IJEB 3HT3A 2RT3A 4J9SA 4URSA 4RZRA 4CIOA 5CXTA 1LFWA 2QMWA 2MZSA 5IM0A 4JV5F 3MMCB 4ICLA 1RJJA 2Q43A 1VS3A 3RB0A 4TQRA 4EBEA 1Q4RA 3OUYA 1N48A 2K8GA 1F5BA 2I2YA 3NBPB 4WZMA 1FD2A 1NB7A 1RYSA 4K4UA 1QVGR 2R7XA 2IC3A 3M30B 4DOZA 3PFOA 1WF2A 2DGOA 3CJ4A 3W2WA 4C8LA 4LF6F 4KRWA 1DJ0A 4QIFA 2CKWA 2Z4PA 4BHQA 1LOUA 2MB0B 4DEZA 2DR5A 3ENVA 3PO4A 4ITSA 4ZPWR 3GR1A 2FHOB 4HLBA 2G0CA 2DR9A 5K9FA 3TARA 5I3PA 2HRUA 2MHEA 3N4WA 3TI0A 3IWLA 2MKKA 2MQPA 2R2SA 3GE9A 2PC6A 1ZPVA 2DH8A 2BACA 3PHEA 4G1PA 2KU7A 4WXOA 4RWWA