3NCPA

Glnk2 from archaeoglobus fulgidus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
MKKIEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQQGGMQIQFRGRTMEVTLLPKVKLEIVVKDDAVEEVIGLIVNSAFTGSPGDGKIFIIPVEDVVRIRTGERGDDSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-2)
publication title Cooperative binding of MgATP and MgADP in the trimeric P(II) protein GlnK2 from Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 23
structure length 112
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ncpA00
1NZAA 4CO0A 2J9DE 1P1LA 4CNYA 2Z0GA 3AHPA 4YB7A 4CO5A 4OZNA 4AFFA 4C3MA 1OSCA 1V3SA 3AA8A 1XK8A 2EG1A 2ZOMA 1UFLA 2J9DA 2ZFHA 4USHA 2GW8A 3O5TB 5D4NA 1VFJA 4Y6IA 3AH6A 2V5HG 3X3UA 4WK1A 5DRKA 4E98A 4R25A 2NUUG 2VD3A 1V3RA 2NUHA 3TA1A 3NCRA 2GNKA 1KR4A 4CO3A 4CO4A 1H3DA 1NH7A 3MHYA 2DCLA 2RD5C 4CO2A 3TA2A 3HLUA 2JJ4D 2PIIA 1V9OA 2E66A 2XULA 3CE8A 3NCQA 3TA0A 1UL3A 4USIA 4OZLA 3M05A 1HWUA 4USJC 5D4OA 4RWXA 4NYOA 1GNKA 1O51A 2XG8A 3BZQA 1J2VA 4ZK7M 1NAQA 1Q1KA 4OZJA 3O8WA 4D3GA 1V6HA 3L7PA 1QY7A 4RLEA 3NCPA 1NH8A 4C3LA 4C3KA 3OPKA 5D4PA 1O5JA 2O67A 1VHFA 3GSDA 5D4LA 5DS7A 3N5BA 3DFEA 5L9NA 4D3HA 4CNZA 2XBPA 2J9CA 2GX8A 2XZWA 4CO1A 2CZ4A 4YB6A 3T9ZA 4Y65A 3AA9A 1UKUA 2NS1B 1PILA 4IYQA 4WK3A 4YB5A 4RWWA 1UMJA 3LF0A 2EG2A 2O66A 4NYPA 2J9EA 4RX6A
chains in the Genus database with same CATH superfamily
3BSOA 1DLOA 1XMOJ 3SCKE 3Q24A 4X4SA 1R8PA 2UVVA 2ZH2A 4FKXA 1OSCA 2RQ4A 4PYAA 4O3OA 5AXKA 3IBCB 1T03A 2KXFA 4NA1A 1FO1A 3F41A 4ZIVA 4DSIA 1ZH5A 4ZVRB 4MFBA 4UOGA 4ER8A 1F9FA 4OJGA 2RUGA 3IR7B 1FJGJ 1RABB 2OEJA 2VBXA 2VKRA 4Z7YA 1R89A 3MEGA 3J81j 4OYXA 4XPCA 1S79A 5U47A 1I3OB 4OZJA 5KFFA 1MU2B 5B0DA 2LQBA 3THTA 1ZOTA 1RAFB 4M8LA 1XERA 1LW0B 3DRSB 2CA9A 4WXOA 3MFHA 3MD1A 4JI7J 1DARA 4F4ZA 2OI2A 3U27A 3I9ZA 5HP1A 1ICEB 4UZBA 2BV3A 2RQCA 2AJ4A 5CABA 1B3TA 4Q2LA 4ZJOA 1Q7LB 1LWEB 4H4OA 1BD6A 2JEGA 5KFPA 3D5MA 4FS1A 1ULRA 3OXGA 2JZ5A 1FEHA 3MAQA 1IVZA 2YKNB 3C15A 4NI2A 1FERA 2IDEA 3NNAA 2Y1LB 4ED0A 4DR1F 5F8JA 5AT1B 2D69A 1XNRJ 3DRYA 2XCAA 2LLZA 3SCLE 2LU2A 3CJQA 3LOUA 4QU7A 4TVAB 5ETNA 1R7IA 5LSOA 2RILA 4DL0C 1U2FA 2HQDA 1HARA 4I2QB 2VOOA 2APOA 2QT7A 1E6VB 1FKPA 2AYGA 2XYGB 3M6VA 2KKHA 2HVHA 3L7PA 3IR6B 5HQ8A 3PVXA 4F25A 5HSPA 1REGX 2Z2ZA 1PBUA 3O2IA 1NHKL 4AL7A 1FRMA 1RQ0A 1ZYQA 3VAMA 3I6PA 2CZ4A 2FDNA 3NS5A 2I5JB 1JLEA 2QX0A 4TY8A 4GKJJ 2AIRB 5L1IA 5E0OA 3D6HB 1N33F 4CLZA 3MTKA 1PAUB 3W63A 4IG0B 4NX9A 5HAOA 4CNYA 2C2ZB 1U1QA 2FTRA 3OR1A 3HM9A 2GA7A 1U26A 2DR7A 3B6BA 1RLCL 1V3SA 5GAHI 1PC5A 1YKWA 4RW7B 1F60B 3GCWP 3OTEA 3KMQA 5CA5A 1FNXH 3ENVA 3HKWA 3QIPB 1R3NA 4LF8J 1LQ9A 1BQMB 2JC1A 3MURP 4C2MA 3I0RA 2MGZB 1SJRA 3J7ZT 1S10A 3BN4A 2NSCA 3V4IB 2VASA 2VPXB 2B9EA 4HYKA 3NWRA 3V5RA 5CD4H 3D0HE 1X4HA 2XNQA 1FTRA 5A2QU 1T95A 4ICLB 3EICA 1K44A 4DFKA 1JLGA 2V2VA 4RW9A 3AOCA 2J7UA 2MZQA 5J2PA 5K5MA 3TO8A 3LF0A 4Y2KA 1NZAA 1A9NB 1SC3B 2G2YA 3GTYX 3H8YA 1BC6A 3H7HB 2B5JB 4ANEA 3DDNA 2LXIA 3D6TB 1FNOA 3U02A 1X0PA 5HN0A 3ENAA 2Q43A 1OO0B 3HHLC 2J9DA 2GW8A 5IXUA 3FQKA 4M5LA 5C2GA 1OY6A 1IUJA 1NPPA 1NUEA 3UW1A 2JEJA 2VB6A 1XNQF 2CADA 4Y2AA 3HVTB 4O4RA 1RWNB 5KFGA 1GTHA 4AUKA 2E66A 3LGMA 4LRDA 4O3SA 2ASJA 2UUAF 4OL8A 1FKAF 2XHCA 1MWZA 1T9TA 4EZ9A 4CM0A 1AUDA 2ZDOA 3DHWC 3DGPB 2Q1LA 2CJXB 2ZH3A 5DZ7A 4PG4A 3QAEA 2EFOA 1HNVB 3T1YJ 1YG0A 1NO8A 5L8RC 1D1UA 3KTQA 1VIOA 1S12A 4NYPA 1TKXA 1JLFB 1FD2A 2ZE2B 4NLQA 3UO0A 2F40A 1NJZA 3T5KA 3CC4S 2C42A 2R7OA 5HVHA 3MM7A 1OMSA 1NJYA 4KH0B 4EBCA 4NXNF 1F2GA 1BQNB 4YY3F 1GH8A 3PKMA 1YRXA 4PXCA 3S6EA 3JSYA 5KFUA 3FVYA 3MMCB 1U48A 1HMVA 1ZZFA 2MKSA 3PM9A 1UWAA 5D0RA 1SIZA 2HWIA 4ZCLA 4UY85 1CS4A 4JYAF 1S0MA 3MR3A 2KG1A 3CCWA 1VQ9S 2E5GA 1N36F 2MSTA 2IM0A 3DXBA 1YHQS 2FC8A 1OS5A 4ED6A 4NMLA 2HHXA 2UXDF 1U1MA 1SJ4P 2NYIA 4HH1A 2WB1D 2OH2A 2ZH8A 5E2QA 1NJIT 4DR4F 4R0JA 1DTQB 2CG8A 2MLYA 1M1GA 1RE1B 3WQPA 4P75A 3J80Y 1MW7A 2BKOA 2W7PA 4DR6F 1UWBA 1Y5LB 3JAMU 2YNFA 3DGVA 5GMDA 4EWTA 4QR0A 5L1KA 4DBQA 2XHWA 1RP5A 2QLXA 3GV5B 2B6AA 2F7VA 4NLXA 1UVKA 4ZVFA 1B64A 3US5A 4JV2A 1RAEB 2YNHB 2BQRA 3M30A 1NDKA 3SSSA 1VQPS 2DNZA 1LV5A 3Q2SC 4YDXA 4YHHF 2U1AA 1DLOB 2EKYA 2Y3YA 4HT5A 1H2UX 4RW4A 3VQSA 4B3RF 2J0WA 4U95A 2DXDA 1T03B 2Z2LA 2KZMA 2ILYA 5BR8J 3MAAA 4WKYA 1BXNA 1VC0A 2NXJA 4ZPTR 2BRLA 4DL2A 4Q45A 1Y5IB 3JQJA 4DQIA 3KYLA 2R7QA 3OXLA 2DITA 4WZQA 4ZVOB 4A48A 5T14A 2HRYA 1GT8A 1LEOA 3EZOA 3K5MA 3M9MB 3G6ES 4PG5A 2QA4G 3WX4A 2O5DA 1NPRA 1CJVB 1SB6A 5K8NA 3PR5B 3D0IE 2UU9J 5HP1B 4JUZA 2FJWA 2VQFF 3MI7X 4PEOA 4QZVB 2BM1A 4YOEA 1VQOS 2MQPA 1N32F 4H4OB 4EUVA 4M5MA 4ZVSB 3BGFA 1B0TA 2HHQA 2V8PA 3Q8YA 3U1NA 3NMAA 3C15B 4NI2B 1JXVA 2LXFA 3B82A 2ATLA 2GIRA 2E44A 4DV3F 5H9FK 1VOMA 1SCJB 5EX0A 3NS7B 2AF6A 1C0TA 4TY9A 1U6FA 1Q81T 4P10A 3SSQA 2B8PA 4EMDA 1FKPB 5FIIA 4WJBA 3DRPA 2MKCA 4LSZB 2IM1A 3RBZA 2AZ3A 3V81A 2EWHA 2C28A 1LWXA 2M4MA 1JX4A 2SXLA 2AW0A 3MPWA 3G6XA 4DXLA 2FHJA 1WHVA 4ZA1A 5KTQA 8AT1B 2BDPA 2G13A 2BOAA 3RB6A 1JLEB 4TY8B 3R97A 4DPUA 1S1XA 4OJ3A 4WU2A 4ZVGA 1AFIA 3HHEA 2QE5A 1F5AA 4DPYA 4QBUA 5ADZA 4YUDA 4W90B 3WIUA 4WBFA 3GU0A 1ZAXA 1NU4A 2FIUA 3W66A 1K0TA 3DOLA 3M05A 2AT1B 1UZDA 1NKBA 1PYTA 3FBCA 2JFKA 5LMUF 2B56A 2OD4A 4HACA 1FVSA 2HQCA 4UOCA 2IMOA 3I0RB 1OY9A 1F9HA 4RBUA 2VUGA 4ANDA 5A2QY 4PWUA 4ED8A 1VRTA 3PRBA 5GMEA 2CZ9A 3P8BB 2F63A 4WK3A 5J2QA 4HHUA 3K17A 4MKVA 4FYVB 4OI6A 3ZTPA 1K47A 3ZO7A 4CYUA 2BOPA 1WSVA 4X66J 5CYQA 1K73T 3DMJA 1E6YA 1KVIA 4RW9B 1T02A 3RYLA 3IC1A 5J2PB 4FYWB 4N7TA 2R8GA 4C0BA 5KOXA 4ECRA 2BKNA 3ZTOA 1D09B 5CQGA 4USWA 1S59A 4WP8A 5AXNA 2PSZA 1SH0A 5IQQA 3AOAA 2YWHA 3IRXA 2OO4A 3FEZA 1O0PA 4O3NA 5LL6d 1PJ6A 3W9JA 5IFMA 1F3FA 5ETQA 3ZXWA 1XIQA 3PYDA 3OPKA 3WC0A 1O5JA 4DV2F 1I94F 1S9EA 4V1Ak 2AP6A 1SKRA 4CNZA 3IR5B 1JK9B 1U8WA 1N0UA 4UY8T 1TMMA 2HWTA 1IBLF 3IFEA 1Z2ZA 1YWXA 1QUVA 2VU5A 3NGUA 3KLHB 4AQYF 2CQ1A 2MQMA 4BBYA 2FVCA 3MCNA 1FKOA 4USVA 2HS0A 3UN3A 4YB7A 4DCPB 4ZJQA 3HSGA 2FJVA 2PGCA 3W8GA 4YMEA 4H4MA 4KGVB 3E3XA 2ZZTA 4ES2A 2N82B 4BLGA 3HZGA 1TKXB 4HL9A 3MPUB 3VAKA 2ASLA 1VDHA 2QRRA 2JNJA 4OYAA 1SJFA 5GADI 4DL6A 1KONA 1X4GA 3TAQA 1YJWS 2HW3A 3ISND 4QYZK 4EK2A 5F9NA 3MM7B 3HT3A 4OI3A 2JOQA 1D8ZA 4LRAA 3QGIA 2B43A 1HMVB 2RHQB 2ZDPA 5C25A 1R0AA 1KTQA 2C1EB 4DR1J 2FVSA 4I6YA 1CS4B 1CSJA 1KWMA 5IC6B 3I9V9 4D3HA 4KV8A 2ZH7A 5KFKA 4NYZA 4NXMF 3FDSA 3LGHA 2AGPA 3G96A 4C48A 1K0VA 4L3NA 1CPZA 1VQ8S 3VAFA 3D2WA 4HHHA 1WI8A 2FC9A 2BVZA 3TI0A 3QO9A 4AE5A 3G71S 4J9RA 3QGPA 2E9RX 1IKVB 3CJ5A 1OYDA 1EKSA 4YR0A 1UWBB 1UEVA 3BGLA 3CJ3A 3BQ1A 2YNFB 4FXVA 3W9HA 2DRBA 3BDEA 3BPDA 2X1AA 3SQGA 2IVYA 4OQJA 1FRIA 3CD6S 5DRKA 1R27B 2V2QA 4GO7X 4DHVA 2B6AB 5B09A 1WC1A 1Y0HA 7AT1B 3NCQA 1N33J 2RIJA 3I96A 2BABA 3GIMA 1SVDA 3EVMA 2BJ3A 1CQNA 4TYBA 2HS4A 3RG6A 5DGAA 1U1NA 4RW4B 3UN5A 3OL8A 4HKQA 3FQLA 3KHHA 3PW7A 2DH8A 3R6GB 4DCJB 1OPIA 3CDUA 1IN0A 5CYJA 3Q8UA 5DZ6A 1KNZA 2M8DB 3CJ4A 2W2PP 3MAAB 2N4DA 1UFKA 1NK9A 4X4NA 5IT0A 2OFHX 1JNZB 2OPPA 3MM5A 3BGOP 4ZVQB 1KHVA 5FLXY 5HMYA 4DV1F 2RS8A 2V67A 4LR9A 4O3RA 2CPZA 3OV7A 4CP5A 3CD7A 4X62F 3DYAA 4DPTA 4M1KA 4WPAA 4KE5A 4CCHA 1TL4A 4USIA 2P9GA 2GVDA 1VQMS 1RTDA 1VGYA 4CLYA 2AEFA 3OSNA 2P8IA 2ZH1A 3P3DA 4J5OA 1VJWA 2FJDB 3TEHB 4DS5A 4AD6A 2R3VA 4C3LA 1X31C 1RWMB 3K59A 3P45B 4NEYA 2RB7A 7FDRA 2VPWB 2D3O1 1T9UA 5K8MA 1PYOB 3QLHA 4QIEA 1G6BA 2FZKB 3MWBA 4USMA 1XNQJ 3TUIC 3T1HF 1TV6A 4FVMA 3D9BA 1RAAB 2I9SA 1N5SA 1BE4A 3PYFA 2UUAJ 2JDJA 2R8KA 1C0TB 3K0JA 3QSYB 2PDAA 1W25A 2HFUA 2RT3A 1H38A 3VAJA 1RAOA 3GSIA 5G4DA 4DJBA 4X4VA 3SMZA 4NLSA 2Y8WA 4ETXA 1ZM4A 3DRPB 3C19A 2OPQA 2VBZA 2B7BB 2C3PA 2JHEA 3JSMB 3V81B 3QT6A 1HNIA 1S97A 2HFZA 4WFAQ 2MKHA 3V6JA 4J90A 2A2CA 3HD2A 4URSA 2EFGA 3M8YA 4BC9A 1EETA 1OY8A 1S4FA 4JI6J 1QJHA 2E1MC 3CMES 4WKRA 3NGSA 2WK4A 1S1XB 2ZD1A 2RRAA 2F4VF 1FF2A 5I4MA 3Q86A 2UVWA 2AD9A 3MMBA 2V63A 2E5IA 5F8IA 5AXMA 3QJLA 3KNAA 3HFVA 2FGCA 1QD1A 4PKDB 3I55S 3DOLB 2J7WA 2LDIA 4CO1A 4Z37A 3OUYA 4F4XA 4JYAJ 3K57A 4HACB 4P2MA 4OI0A 2EG2A 4EYIB 3M8QB 5GAEU 5A6WA 5AE3A 3RJMB 3O44A 2PT0A 4DQSA 4DR7F 1SI9A 1WI6A 1S76D 1TUWA 3ZC4A 4DR4J 1VISA 1QSLA 1VRTB 3NNCA 2QIFA 5J2QB 3W62A 4DR6J 4DX8H 1CULB 1IXKA 3HJVA 4CYUB 2FLPA 5CYQB 4LBIA 5A6PA 3DMJB 4JV5J 1E6YB 4ECTA 3HPOA 3F0NA 1CJKA 5J2NA 4PAAA 3OSPA 3M32A 3C14A 4KC5A 1U09A 4USJC 2FZGB 3JTNA 5HK4A 3NP5A 3FBBA 3JSRA 4GMKA 3DC2A 3U1LA 3RBEA 2GMHA 2IBOA 2AYEA 3UD5A 2DR6A 5D4LA 2ZHOA 4YHHJ 1RSCA 2HBQB 3VAIA 1RYRA 1KC8T 3D68A 1YTYA 3IRXB 1EQMA 4B3RJ 4IYQA 1Q86T 1RT6A 2YWFA 1DFDA 4KSEB 2O66A 2VG5A 4RNOA 1S9EB 1NXIA 5GMKa 3CB4A 2PFDA 2V0NA 3V4MA 1F9EB 4ZCKA 2ZJRQ 2I1RA 4IH7A 3GV8B 3CJ2A 5IWAF 2KRRA 4LVNP 1XR7A 2WW4A 3T19A 2CQDA 1P8GA 3KLVA 2QMWA 5B0EA 1X4FA 1FKOB 2IJRA 4DQPA 2B8QA 1U1PA 1KKHA 4DV6F 4A47A 3T5LA 4H4KC 4H4MB 4C8YA 4KH1B 1SV5A 2DEIA 5DQGA 1DAXA 4G65A 5DDOC 2LEAA 1QSYA 1M1KT 4OZ1A 1RT7A 3HHDA 4CLLA 3SI8A 3AJDA 2GAGC 3KK2A 4XO0A 4F4WA 3TVZA 1U1RA 1N32J 2HK3A 3OTOF 2KVQE 5HQLA 2FJXA 2FJAB 4OLOA 5C25B 1R0AB 2DK2A 3M8SA 2XMVA 2CQPA 4DV3J 4TKTA 2GS8A 1FHTA 3N6LA 4KV8B 3A8IA 1DZ5A 5EHHA 2DGUA 4QW9A 4IFYA 5C24A 1T11A 3CCMS 3DI6A 2ZOMA 5D4NA 1WF0A 5ETPA 1GK8A 1DQ8A 2QLBB 3QO9B 4OYOA 1S6QA 3MR6A 2DRDA 4RNHA 3O3LA 2DCLA 2DNNA 2D1CA 3TYTA 1QVFR 1UAWA 1ZA2B 2M5YA 3MEEA 3SQGB 1FRHA 3I5CA 2MQLA 4R5PA 4X4RA 4I64A 3OHBA 4XK8C 2YWEA 1RT4A 4DMZA 4ED3A 4GRSA 3ZFVA 1ZM3A 1HW9A 3ETMA 4ZPDA 2ZITA 4ERDA 2MLXA 3TANA 2AJ1A 3H20A 3H42A 2ZEJA 4ES3A 1H74A 1G7CB 2KN4A 2JEFA 2AJFE 3K5LA 4MT1A 1UMJA 3QGHA 2NZ4A 4QCLA 1GX5A 5T41A 4QIVA 5LMUJ 4K4XA 1RU1A 3K8VA 2FGOA 2VFTA 3QIDA 3PEHA 2HKEA 1MMLA 1RT1A 3FSXA 1HBMA 2WSFC 4ZLJA 1V3RA 3DLKA 4DF8A 2R7TA 2A0FB 2OPPB 3MM5B 3FBEA 2C2OB 4LF9J 3BO4A 1LOUA 4I2PA 2QSWA 5KAKA 5KFQA 3KLIA 2NQPA 1VQKS 1R43A 2KM8B 4UUXA 2DHAA 3CDEA 3MUTP 2LQ8A 4W4MA 4HT7A 3DYAB 2YWWA 1ZPWX 3H90A 5LXRA 3SIPB 2YX4A 1X8DA 2AGOA 2HZAA 2GVDB 4ECXA 1R6YA 1N5YA 1RTDB 1L5UA 2F8EX 3LP1A 3PX0A 3ADAC 4I7FA 5KG0A 2AJQA 3ETOA 1S1TA 1I51B 3FSIA 3MPYA 1Q95G 2BQUA 4U7UD 4YFUA 3QLHB 3W60A 4B9LA 1D9FA 2QL9B 5B0CA 1RUSA 3KJFB 3SSRA 1Y10A 1TV6B 1S1UA 3H40A 4LQ3A 1APSA 1B70B 3GP9A 3TUJC 3EDQB 2W25A 3HHLD 3C3LA 1IBLJ 3AD7C 4QWCA 3CIZA 4CO2A 4DPOA 2JVRA 3N6MA 5DG8A 4AQYJ 2OPQB 1RCXB 2VPZB 3J7YI 2ZH6A 2EI5A 1KVJA 2DH9A 1HNIB 1UA1A 2UUCF 3G4SS 4B3SF 3D28A 2MZTA 2YQ3A 3MEDA 4M5KA 1WKJA 3OLBA 3R7SB 4QW8A 5LOQA 4NLUA 4NOHA 4DX7A 3CC7S 2B9WA 5KFEA 2H51B 3PZPA 3A13A 3R27A 4A8MP 3AJ2A 3R9LA 2R7RA 4Y28C 2ZD1B 1VJQA 3MM9A 2CPIA 1HLWA 4KY3A 4OYZA 3RRHA 1YJ9S 2HBYB 3MMBB 1RI7A 1RU2A 4AL5A 2WCXA 2IRUA 2IJFA 1F5CA 4FPRA 3CD5A 2NXCA 2YVSA 3BF4A 3AA8A 3FGVA 1TK5A 4ETZA 3UE2A 4LMZA 3UCGA 3D67A 4NLTA 4ZN1A 4NXMJ 3R2DJ 3D0GE 2XY7A 2PMZD 3MM6A 3NCRA 3KNGA 3GJQB 1UVIA 3FNNA 3HX9A 1LW2A 1M0SA 2KFYA 4DL3A 1ELOA 2KYXA 4NRTA 3PW4A 2B7CB 3DRRA 1N4LA 2L9DA 3HZEA 3EPGA 1C0UA 1MG7A 2DTJA 2BQ3A 4PQUB 4PYDA 2KG0A 3TJ9A 4JI2J 3FFIA 2VONA 4LSNA 1FDBA 3CCLS 3HD1A 1CJKB 5J2NB 3M32B 3C14B 2WTFA 2DNKA 2W4PA 1SUQA 3TUPA 4UW2A 1U1KA 1G4CA 4ZVEA 4PG7A 3DU6A 3MEKA 3D1HA 3PX4A 3HSDA 2LCWA 4Y3CA 4J9VA 5A0YA 1VK3A 2F9JA 1AXQA 4R0EA 3LO3A 4LF5F 1VK8A 3EM1A 4C0OC 4J37A 4F02A 4C11A 4L74A 2JLEA 1NPKA 5KFDA 2HAIA 1NBEB 3LTOA 1FFSB 2W24A 2ZJQQ 1TKTB 1YBUA 1RT6B 4ZVPB 2C3OA 2VG5B 5HJYA 4MTPA 1O8BA 1T3NA 4NZ0A 1NRKA 2XEXA 3UCZP 4C8KA 1RWXB 3AJ1A 1LFWA 3AT1B 5G0RA 4K4WA 1YJ7A 1TFYA 4DV1J 1QY7A 1S1WA 1X0FA 3AB2B 2QV6A 3BSCA 4RW6A 4X62J 4F2SA 1KSPA 3KKFA 3WDOA 1SV5B 1Q5VA 1PILA 1HNZF 1WEYA 4O44A 5BYRA 3T6BA 5L1JA 2DNHA 3OQ2A 4XIUA 2Y8YA 1R6VA 1RT7B 3KG4A 2X3GA 1RGVA 4EEYA 3M2VA 2UVUA 3KK2B 2N3LA 3TWZA 4DR5F 3CO9A 4ENOA 3RTVA 2D74B 1R8HA 3T1HJ 2P9EA 5ETVA 1WTFA 4ZVUB 4LR7A 4FBUA 3UDEA 2V4QA 5C24B 5D8HB 3DI6B 4DU7A 2MZSA 4USTA 1HWKA 1S9FA 2IPOB 1XR6A 3UDCA 1VLOA 1S6QB 5D4PA 3MOJB 1TUGB 3GJSB 4DL7A 3M1VA 3GJRB 3N79A 2IM2A 3I5BA 1YBAA 3MEEB 3DLBA 4DLEA 1FX2A 3PXGa 3ZZZA 5KT3A 1IWAA 4DUTA 4LIRA 1VLYA 3PTWA 4QWAA 1VHIA 1HD0A 1FK9A 4R5PB 2F4VJ 3TAPA 3OT9A 1M5PC 1HQUA 1RJJA 1RT4B 3PNIA 5F9LA 1FRXA 4RNFA 4J9OA 1Q8KA 2R9LA 3I31A 2KXNB 2VJUA 1WEZA 4ATNA 4PR6A 4USHA 3K2YA 2K1RB 2Q6BA 1TP7A 1BQXA 3PO5A 3VV2B 4DQRA 2IA6A 1FXRA 4J91A 2V68A 1NB7A 4TU7A 5CXTA 3M7VA 4NCBA 2ADCA 3UWTA 1WG1A 1HBMB 2D9PA 1VBXA 3N0VA 1Q5YA 3S1TA 1GMUA 3EGWB 3DLKB 2HFOA 2VJVA 1W7WA 5HMZA 2XC9A 3H2UB 2F65A 2CQGA 4I2PB 2KHCA 4QIFA 3V6HA 3P6YC 4USKA 2CYYA 2KHDA 3B78A 2QG9B 2XBPA 1LWCA 2CIMA 2E7WA 2BEFA 3BB5A 5A8KA 5L38A 4J9KA 2YTCA 3KLIB 3K7RA 5HMWA 3VZHA 2GO9A 1CJTB 1Q53A 4DV0F 2Y1RI 1N5YB 3VZIA 3RAQA 1QE1B 1OJ4A 5KT6A 2J6TA 3LP1B 2JLFA 2WBRA 4I7FB 1S1TB 3ENQA 2VF3A 3M8PA 4ZPWR 1IM6A 2GNKA 1GX6A 5LXYA 3KLEA 4NCAA 3QT5A 1Q82T 1FFGB 4A8WA 1A6LA 3R5DA 3VTIA 4RW8A 4MH8A 3MF5A 4F0MA 4J9SA 1TTHB 4P73A 3O8WA 2HHWA 3E51A 4ZPCA 1XN9A 3ILLA 4L76A 3C6UA 2R2UA 5IWAJ 4MKBA 3CF5Q 4OLPA 2ZC3A 2D41A 2XSFA 3MEDB 2YKQA 3SV3A 2LQ5A 4DR2F 2XY6A 3IP0A 3F44A 3IG1A 3GFZA 5D78A 2WSCC 3D7SB 3FCWA 2V8VA 1HI0P 4DUZF 2IFXA 2R8JA 3MAHA 5K14A 2W7AA 1WC4A 2H9ZA 3NGRA 2DY9A 4OHZA 1AT1B 1BGXT 4IQMA 3J81U 3MM9B 4LRBA 3MMAA 3OTOJ 2MDAA 1URNA 3RW7A 3CCQS 3H5UA 4DSEA 4UUWA 4K4ZA 1FNMA 4DCOB 3T5HA 5EGYA 3W2WA 1CJUB 2CKWA 2QFJA 3FC9A 4GKKF 3EGVA 4L72B 1SC4B 2XY5A 4DUYF 4ZP9A 1R31A 1J2VA 1K9MT 2CAJA 3HHLA 1KEKA 3MM6B 4IR1A 3SXLA 4C3KA 3MECA 1LW2B 2IIHA 4F0KA 3QFHA 1P1TA 1V5VA 2DNYA 3DRRB 4F67A 4WFXA 4WFYA 1C0UB 5E5NA 2ZWOA 4O23A 2WVCA 3FFIB 1NK5A 1A0OB 1RISA 3UNYA 4LSNB 1FWKA 2BJEA 2P5VA 3FMBA 1SUQB 3GZ7A 2HMIA 3NEKA 2UUTA 3AD8C 3ELHA 4X4PA 3V6DA 4JI1F 5GAGI 3KJQB 3VR1A 5A0YB 2NUUG 2EC2A 4C11B 2LVWA 1W2BR 2V94A 1R0BG 3TA2A 3HVWA 2M0GB 1KFSA 2FZCB 2D3ZA 2HAFA 2VDHA 4WIQA 1O51A 1XJWB 1ZTTA 2BW2A 3A1YG 1NHUA 2CJ9A 2ZBRA 1YJUA 2VQEF 4GC6A 2R7XA 3KWMA 3GYXB 2L3MA 3MTJA 2CQIA 1S99A 5LJ5Y 3RAXA 1SL0A 2UUWA 3LGNA 4YB6A 3NY0A 5G0RB 2GHVC 4ANCA 3MXHP 5JVHQ 4UTGA 1S1WB 1H6KX 1HHSA 3POTA 2E7VA 1C4CA 1MN7A 1FJ7A 4RW6B 3FCHA 4F8RA 3UQSA 1OSDA 2JVOA 2VC0A 1J27A 3JTPA 3AY0A 2HVEA 1LXNA 1SC6A 1TR0A 4O44B 3O5TB 4YR2A 1TAUA 3G6YA 1Y4ZB 3M2VB 2ASYA 1RAHB 4P6QA 2DIVA 4MK9A 4NLPA 2UVRA 2CVEA 4XPEA 3RR8A 4HDGA 3N4WA 4ID8A 4CTAA 4LRFA 1GNKA 5KFSA 1BY9A 1KTVA 3NCPA 4F26A 1X60A 5E3QA 2HHUA 2K2PA 2DGTA 4UQTA 5E3PA 4KAIA 5L39A 4CH0S 1NSQA 1U7LA 2VG7A 1TELA 3BV8A 2YPZA 3TEGA 3QFWA 4KPCA 2YBVA 3H5SA 3IWNC 1WC0A 3Q89A 3RZAA 1RHJB 3BH7B 2NXUA 2UUCJ 5D0EA 3M9OB 1NEEA 3T9NA 3M1VB 4LBHA 4TU9A 2DO4A 2YQ1A 1F6TA 4IO9Q 2H3EB 1LFPA 4B9UA 4CRJA 4N8OA 2F5GA 4U96A 4K5RA 5F8HA 2G0CA 2GHPA 2CZVC 5B0AA 1NLKL 1JXLA 1FK9B 4F4KA 4MIBA 1NSAA 4CIOA 1HQUB 4U7CA 1Q78A 4EO6A 1TL1A 2J0SD 2LYVA 1M5KC 5F8MA 2J0QD 4FNHA 5BJRA 1S6PA 5HANA 4RPFA 2H65B 1CEZA 1PYSB 3R1HA 2PN6A 4KGXB 2E5LF 3W64A 1QLNA 2FYXA 4BWJA 3J7A1 4ECQA 2YX7A 1W2IA 5J1PA 1CBKA 4KKOA 1NCLA 1Y11A 4C4WA 4OZ0A 3DRXA 1P6TA 5EWGA 3EXCX 4F50A 2VDIA 3OFEA 3R5AA 2YNGB 3HVAA 1LWCB 4A8YA 4I4BA 2HEKA 3Q8QB 1SXLA 5THWA 5A8KB 2IC3A 2EW9A 1AROP 3MPDA 4HLBA 4PRFA 5DG9A 4UOHA 4RO0A 4OI1A 2FJBB 2EFNA 2VD3A 2ZM6J 2VOPA 4XAKA 3EYZA 2EK6A 4BCAA 3RR7A 2FHJD 5KT4A 4LF5J 1S7IA 1HWUA 2W4DA 4OZ3A 1F5BA 4PXDA 1FDAA 3M8PB 1HBOA 2MQNA 5KFOA 3KLEB 4M5HA 4G3IA 4FZVA 1URRA 1TL7A 4C8ZA 1X5OA 3GWCA 3KJVA 2YKOA 4RW8B 3D6FB 1PSDA 2ZH5A 9ATCB 4WFBQ 1UKUA 5AJ3J 1LWFA 1WKKA 4EU0A 3CDBA 1XR5A 1U45A 2YKMA 2V34A 4LF7J 2RF2A 4F3OA 2XM3A 1NM2A 3DM2A 1Q8IA 4PUOA 4C8NA 1HL6A 2Z0GA 2KM8C 4N56A 5ETRA 3BQ0A 3M8RA 1FT8A 2CXEA 2DNPA 2MTLA 1RWWB 4X84A 3IG1B 3VGVA 5HQMA 3J81Y 4WE1A 1HNZJ 1BWVA 3P5BP 4A8OA 3MUVP 5K14B 1RBOB 2XYPB 3ZTRA 3CT9A 2X1GA 1UL3A 3Q2TC 3G9CA 2O1PA 4IRCA 2GJIA 1OWXA 5EWEA 3IAM9 4UZCA 3CTRA 3X1LB 3MMAB 4DR5J 4FN5A 1NKEA 2CG4A 4FNIA 3NBPA 4KGMA 1WOPA 3W2WB 1Y3KA 2Q6CA 3EGZA 3LP0A 1H7WA 3A8KA 2UUBF 1R0CB 2VHGA 4L75A 4PWDA 4I1TA 3OFFA 4NA3A 2HG4A 2P9CA 4W92B 1GXUA 3HHLB 3NL0A 4RWWA 3MECB 4URGA 1X4AA 4OYBA 1HQEA 4RX6A 4ZIWA 5I3PA 3I32A 2GQQA 1TMJA 2R42A 4TYAA 3RBXA 2EC0A 2CJYB 2Z8QA 4ELUA 3D1QA 3AH6A 2V5HG 1VQLS 4ED2A 3ILIA 1F3VA 2IA0A 2NUHA 4DSFA 3CCSS 4WXWA 2HMIB 5F0WA 3ZZYA 1DJ0A 2DYAA 2LDYA 5HMXA 3QWUA 2CWXA 5B0FA 3TP2A 2XMTA 2V2KA 1L3TA 2FPHX 5C7PA 4UQGA 2E1RA 5DS7A 1YLXA 3CW2C 3PRDA 3G6VA 1RWVB 1C1CA 3K58A 2CPHA 3M9NB 4Y2IA 2BW7A 2IDLA 4OX8A 2DGOA 1NJXA 2RDJA 2F9DA 4DN9A 2RSQA 2PO4A 4CI0B 3SDEA 4ECWA 4ZLLA 1QAJA 4K4VA 1UVLA 3ZZOA 2JX2A 3A12A 2X1FA 3C66A 3PFEA 2IJNA 2V4RA 1NKCA 4Y2CA 3OR2A 2ZBIA 2BMBA 2ZKUA 3POTB 3RRKA 4GO5X 5EDWA 2DJWA 5CAAA 1D9DA 3CJTA 4QWBA 2I8EA 4OZLA 3QRQA 4DV0J 5DDQC 4DR3J 3QAUA 5F3ZA 1UJ4A 3G87A 3VAGA 3THPA 4NLRA 2Y9HA 1WG5A 2I6WA 3LW5C 2EBGA 3MR5A 4KO0A 3A3PB 4FDFA 1RTZA 3DNCA 1M5VC 3K5OA 1U1LA 2BE2A 2H4WB 3LALA 3GCXP 5GVQA 1MNEA 4CTAB 1UW9A 3QGGA 1J5OA 3S7RA 3AXKA 1QAYA 3CJRA 4YEAA 1WC5A 3Q8PB 3EZ5A 2PE8A 2CPJA 4ZP8A 3H25A 1HNWF 5CCLA 2VG7B 4YN3B 3IA0A 1IJEB 3IBFB 4P52A 2DBBA 4LF4F 3BPSP 4B3TJ 3RGIA 1WDDA 3GG0A 5CH7B 2JRSA 3LAMA 2BE7D 4DR2J 3UR3C 2LXUA 3PRVA 1CVJA 1VQSA 2DCUB 4KRWA 3BGUA 1S7HA 4LBPA 3R3TA 4WFNQ 2DRAA 1N54B 1XMQF 2FY1A 4DUZJ 1OYEA 1WEXA 2CPDA 3DDIA 2QN6B 4J9UE 3QBCA 1PJ7A 1FRLA 3AQOA 3TR5A 2HFSA 1A7GE 1TL1B 2IYGA 4OJ1A 1HWLA 1BLUA 1DTTA 1S6PB 1RLDA 4GKKJ 1SBRA 3A3NB 3CXCR 2HSEB 1RBLA 3N28A 1EQ0A 4DUYJ 4N77A 1AA1B 4B08A 2OMOA 4PZVA 2FLNA 2L41A 2E9TA 1KLNA 3TZXA 4KKOB 3QPIA 3HFKA 2KT2A 2Y0BB 4QIGA 2GJFA 4ZPBA 4O3QA 4PXEA 3SEOA 1DRZA 3QWPA 2O01C 3PJ9A 5D0HA 2UZAA 2C2KB 2V8DA 4MFBB 2OLWA 5ETOA 3OL6A 4ELTA 4CLSA 1FXLA 3CD0A 4N5SA 3GE9A 4G1PA 2MMYA 4F7VA 2IC3B 1IQTA 1M5SA 1RT5A 3MEGB 4Y2MA 3UNGC 2QTWA 3RU0A 3BZQA 1MLAA 4F04B 2MZJA 2QJ3A 4JI1J 3P49B 1C1BA 2E5JA 3QJPA 5IV3A 1HHTP 2Y1JA 4F36A 3OJUA 5L9NA 3QZ7A 3CIMA 4F3MA 5AE2A 5DJBA 1RKIA 2CNLB 5B0GA 3A8EA 2XMWA 2KXHA 1IWGA 3CWJA 2CPEA 2HHSA 3UDVA 3GIIA 1KQGB 4H54A 1HBOB 1SQFA 4KHPJ 5E3CA 1D9AA 1T94A 1N34J 1IBMF 2VBYA 3CCUS 4GVBA 2VQEJ 3ONQA 3T5JA 4JB8B 1NHVA 1S0OA 3TQEA 4LF2A 5CHCB 2R7VA 2HBZB 3KJVB 3QRPA 1LWFB 2RQKA 2W2QP 5D77A 2YKMB 2KZZA 1K1QA 2RF2B 3HHKA 3IWXA 3DM2B 2BJ8A 5B0BA 4PUOB 4TLQA 3FBFA 2XTJP 4CDIA 2CJAA 3KUGA 5H9EJ 3I5AA 3ET6A 3C16A 1Z4UA 4F3QA 2XLKA 2CNNB 4WE1B 1AUSL 3QATA 2BR0A 3VF0B 3FSYA 3BR8A 4CLPA 3GSDA 5ETKA 1X9WA 4NL5A 2DHXA 3OFGA 3NKYA 5BYSA 1H98A 1GQEA 3BM7A 2J6UA 4BDPA 1JB0C 4WU3A 3NBPB 3CNQP 2DGWA 2VFSA 2V4JA 5J1NA 4KIAA 1JMTA 2Z30B 3LP0B 2HYIB 2L08A 2VFRA 3Q83A 4A4JA 4PWDB 3N6NA 5KG4A 3OR1B 2MHNA 2KRBA 2P6TA 5KFRA 3MOZA 4WK1A 3W3SA 4RU9A 1HQEB 1PC4A 1PAEX 2BANA 5IZHA 3BKUA 1BQMA 2GVZA 4OI2A 2OPRA 2HQGA 3CDAA 3EMTA 2MKIA 2MJUA 2RD5C 4KJIA 1WHWA 1HBNA 5BR8F 3W8PA 2DD8S 4N8NA 2VIHA 1M5OC 1HA1A 2EK1A 3ISZA 2UP1A 2OGUA 3ZTSA 1S57A 3HMJG 4U9RA 2AEJA 2CQBA 2V2ZA 2G4BA 4IOAQ 2HNZA 2WVFA 3GPAA 2HURA 1LKZA 2P2CB 1TZ0A 4P2FA 3CJ8A 3EXYA 1RAGB 4K2JA 1NSKL 3AA9A 5T7LA 1JLGB 4ALZA 4H4KA 4Z2XA 2EXUA 2UU9F 1IKYA 2K3IA 1TKDA 2W01A 4ZLPA 1N0VC 1RK8A 3BEGB 2QMXA 2YKPA 2CQCA 3HK2A 1RT3A 4EBEA 1FTCA 3DOKA 3HJFA 2EEYA 5ETMA 4ZHRA 1FCAA 3QJJA 3OFHA 3SDEB 2YQ0A 4B9TA 3KHGA 5DM7Q 1H3DA 2YWKA 1Q79A 2ABYA 4MK8A 2R2SA 2XMUA 3OR2B 2E29A 4KHRA 4OIXA 2FHMA 3DGPA 2MYFA 2UXBF 3CDWA 1IR2A 2HQFA 4LF6F 2RDIA 2JFDA 5KFLA 3RUBL 2OFGX 3EX7B 4L3KA 2J9CA 3GIRA 2XZWA 3SYZA 1UETA 1SC1B 2FHKA 1HFEL 1U0HA 4K2XA 4X65F 1YJNS 2ZE2A 3ITHA 1TVRA 3H5YA 3G8TA 2QGFB 1UEKA 5DG7A 2OTJS 5RUBA 3QRRA 3L3CA 2BE2B 1HQ2A 2HHPA 3M8ZA 4O0IA 3MDFA 3BBBA 1X5TA 1J5OB 1Y9OA 4AT1B 2XSJA 3FJ2A 5A76A 3MMCA 1UVJA 3NRBA 5I42A 3D4JA 4M95A 5B7WA 1SPBP 3CJSA 5A8WA 1VR6A 2DNLA 3CULA 2KJWA 2RQMA 2W2OP 3T3FA 2R7WA 1WHYA 4DFMA 1S5ZA 1UCNA 5HVGA 1GMWA 3GYGA 4ILRA 2JL9A 3JAMY 2L9NA 4O4GA 2C3YA 3OL7A 1X4CA 2KT5A 2GJ2A 3AAWB 3UR0A 3J80U 1AW0A 1TUVA 1KD1T 1MN9A 3WHIA 1N5VA 5LT5A 4CH1A 3FUYA 2YNHA 4MYUA 1DTTB 2FD2A 4DX6A 1EARA 3M30B 3U1MA 4KBIA 1ROFA 2DGSA 3QZ8A 1Q0NA 1XK8A 1GTEA 3PG9A 2ZJPQ 1FWLA 2UUBJ 3ZZUA 1EJ7L 4G1QA 1ZM9A 3PHEA 2FLOA 3KFWX 4DS4A 9RUBA 2AEMA 2HQIA 3CO0P 4OMFG 4CLKA 3UDLA 4S0MA 5IQ6A 1JQGA 4LSLA 2XQCA 1B0VA 3W5YA 4WIIA 4OHXA 3MGJA 3CEDA 2A1BA 4Y34A 1FEEA 3HCXA 1ZA1B 2G2ZA 2CQ4A 2AQ4A 1RT5B 4RR5A 2A10A 2W7OA 4IH5A 1ZPVA 3MFIA 1C1BB 4UF4A 1T05A 2DR8A 4OV6A 2F4FA 4I0WA 1RDRA 2DY1A 2LKZA 3F56A 2H4YB 1CJVA 3ZTQA 2FVPA 2BACA 1OPZA 3FRZA 7FD1A 2IAJA 2YH0A 4OZNA 4ECUA 4RUAA 4F2RA 4K0KF 5DETA 2VKZG 4DFPA 1QUPA 3TJAA 4WCEQ 1C2PA 1KR4A 3BBCA 1X4DA 4GVBB 4M5JA 2XS2A 3E01A 1QTMA 4ZP7A 2BXJA 3SBMA 4QJVA 2NYHA 2IMWP 3BQ2A 4OYWA 2M8HA 1YJRA 4DV5F 1MWYA 1T8EA 2DO0A 1V5IB 3JQKA 2IM3A 2J5AA 1WUUA 1IR1A 1KRPA 2LQJA 4KR0B 2Q66A 1MMDA 3MZIA 2LEPA 4HTJA 3ET6B 3C16B 2ZHBA 1X5PA 2QA1A 4JV0A 1LNQA 2XZDB 5HROA 1VYAA 1UA0A 4FF1A 1C4AA 1I6JA 2W8KA 2ASDA 3M2RA 2ZVIA 2ZUAA 2C2EA 2YNIA 3K8WA 4FPIA 2L9WA 1RWPB 1RT2A 4C3MA 3BYRA 1SH3A 3KJNB 2WVDA 3ILJA 4CLWA 3UPFA 4X64F 3PJXA 4Q44A 2V4JB 3PYGA 5GAHU 2DGXA 2PFFB 4W98A 4NXNJ 4YY3J 3JSBA 3PKYA 1N48A 3ZZ0A 1BUXA 1HNWJ 2KL8A 2ZKTA 3KG0A 2BANB 4LF4J 4RLEA 4DQQA 1FE4A 2GVZB 4NE9C 1N36J 2OPRB 1G1XA 1IKWA 2UXDJ 4MJKA 1HBNB 3PO4A 3DXSX 1IKXA 2IVMA 2ZBPA 2GX8A 2R2RA 2Z58B 4K7QA 2FUG9 2PA8D 5GAEI 2F3JA 3VWSA 1CC8A 3C6TA 4A8XA 3KMSA 2HNYA 4E2FB 2OP5A 4ECZA 1S72S 1KOHA 2HNZB 1XMQJ 4WWSA 1YZ6A 4HH0A 2NPFA 1MWQA 3SV4A 4KT0C 2QEXS 2DPIA 2IHR1 5T7LB 5E41A 2FB0A 1DQ9A 3V6KA 1IKYB 4IDKA 2AV5A 3KLFA 2KU7A 4IFVA 3EPIA 2E9ZA 1ZTWA 1RT3B 3C46A 1XQIA 2F8MA 3GFYA 4LUBA 3DOKB 3MM8A 1U2CA 4P74A 2CPXA 1B7FA 4RBVA 4ZHRB 2W9CA 3KK3A 5E3RA 4KB7A 2KVIA 2HNDA 3IRWP 3RB3A 2GGPA 3W9IA 2Z56B 4YB1P 5IV4A 4HEA9 4B9VA 2I0XA 2H48B 2RUSA 2POKA 2ADBA 3K89A 1JLBA 1X7VA 2W9AA 2RE1A 2OD6A 1IQZA 5JVGQ 3Q8SB 3MCMA 3KLHA 2MSSA 2RU3A 2LEBA 2KT3A 1GAOA 4DSLA 2FHOB 1U0HB 2EBEA 4MMOA 1FRJA 4JI6F 3GFXA 2AZ1A 4ZCMA 5AXLA 2QYCA 3ITHB 1TVRB 2E7XA 4PXBA 4TN2A 2WOMA 3KOAA 2VQFJ 2WAQD 1IBMJ 1WOSA 1YSJA 2XSJB 4J9NA 3HSJA 4M94A 1T9XA 3QT8A 4RBTA 1UTAA 2B4PA 1B4SA 1BWEA 3DN9A 1Q1KA 2XWXA 2CRLA 5I42B 3A8JA 2XMMA 1P27B 1WACA 3CVKA 5HJXA 2VC1A 1VHFA 5A8WB 2EFPA 4RL1A 2R2TA 2CQHA 3PX6A 4ZLNA 4I67A 2OELA 3BGRA 4E0DA 2HRTA 2HQ3A 5JXSA 2OTLS 3M2UA 1OQ3A 2MQQA 2OEMA 3OVSA 2GQ2A 4YP3A 1SJ1A 1TKZA 3JYTA 1IKVA 3O6QA 1G2EA 5EUHA 2DHGA 2Y0SD 2GAHC 2MY8A 1TK0A 2BYCA 3OLAA 3DDKA 5JJBA 4O4GB 3M6XA 3JXOA 3DHXA 3CCJS 2I2YA 2HWHA 4A46A 4JV5F 2HIYA 1Q7YT 1YRUA 4ID5A 1SKUB 1WG4A 2KTQA 1JLQA 4WTYA 1N5TA 2FLLA 3MCSA 2ZH9A 2X51A 3NLCA 4KYZA 5H1SV 3H59A 3BS9A 2QA4S 4ZITA 3B4DA 4ITSA 2VL1A 2HFVA 3U7JA 4IR9A 2HBRB 4G1QB 2CJQA 2DXEA 3FKBA 2EPIA 2M88A 3QNWB 3NAHA 3KLGA 3PW0A 4N41A 1XWLA 4U6PA 2WONA 3DLGA 5K8PA 3H98A 4OX9F 3GIKA 3Q0AA 2BJ1A 2HHHF 2KFZA 4PWWA 3HT0A 2XMAA 4LSLB 2D9OA 3T41A 3EUNA 1PKUA 4PABA 2DR9A 2DNGA 4DZ6A 3AXMA 2MZ1A 4PQAA 3Q8RB 2XWYA 3GMGA 4MYTA 4MIWA 4OZ5A 3R7BB 2XYHB 5KOWA 2H1YA 2ERRA 4QWEA 4Q8FA 5DQIA 1RADB 4OYMA 2BKPA 5LSLA 2O3DA 8RUCA 5LJ3Y 5D15A 5SUHA 1T05B 2Z57B 5FLXU 2GO8A 4ILLA 1N52B 1Q8LA 3TA1A 2H54B 1XTZA 1KLMA 4U67Q 3MHYA 4C98A 1PGZA 2PIIA 4LFBF 1Q4RA 2IAJB 3G8SA 1TU0B 1NK8A 1VQYA 1LK7A 2J0XA 5ETSA 5HBMA 1MSWD 4I68A 2RAQA 1DBDA 1H7XA 3CC2S 1NK6A 4CLUA 2PC6A 2Z2YB 3IO1A 4A8QA 2X7IA 2IRYA 2QC3A 3E01B 3GLJA 5AE1A 3TVYA 3FMWA 3PIOQ 4Y00A 4OHYA 4X4QA 4B9MA 2E1CA 4DV2J 3SCJE 4J9PA 2HK2A 1I94J 1CC7A 4ZN3A 4YB5A 3NWGA 4PCQA 4OV1A 1SQEA 1YIJS 2D7SA 3JS9A 5B08A 3NOCA 4DX5A 2EVZA 2G1HA 2KJVA 3EWGA 2UXBJ 1FI4A 1WSRA 3W61A 2EFVA 2A6MA 4LF6J 1JLAA 2Z4PA 3JSMA 2W1BA 4TQRA 3UD3P 4R8UA 1RCOB 2MHEA 3CMAS 5HROB 2NLWA 1M90T 4ECSA 3UCUP 3M2RB 3ENWA 4A8FA 3PW2A 4X65J 1EETB 2YNIB 2XULA 4DG1A 3TZWA 1RT2B 1O6XA 1PJ5A 4HI2A 5KFYA 4NA2A 5KG5A 3MCOA 1B0PA 2E1AA 1V6HA 1UJ5A 4C8LA 1S9GA 4AXIA 4OHWA 2CJBA 2B4VA 1S49A 2JEIA 2VZ9A 4LT6A 2KYZA 1FJCA 3OVBA 1YK9A 5M2RA 2VBWA 3NGDA 2XCPA 3OUYB 2R7UA 5F8NA 3RW6A 4C0HA 3IGVA 3M8QA 2HFNA 1NJWA 4KGKA 2J9EA 4XDDA 1RZMA 1IKWB 3IXQA 3GQCA 2RNEA 2RKIA 1IKXB 1RHRB 2XB2D 3GIJA 2LMIA 3W7BA 2PD1A 4Q2MA 1SH2A 1UP1A 3C6TB 3GJTB 3LPEA 3ZZTA 4AFFA 2XGPA 3KHRA 2HNYB 4NZ6A 3DU5A 4LF9F 4FP9A 4OX7A 1CULA 5IT9U 1RBAA 3H4DA 4LREA 4TNOA 4K4YA 4ZS6A 4DDFA 3C8YA 3MUMP 2MQOA 4JI4F 3PEJA 2ZNZA 1KQFB 1U47A 4ES1A 4DV7F 2H5JB 4DEZA 1QDUB 5BXIA 5KFXA 4P7VA 2LU1A 4IDKB 1RHUB 1Q8BA 3KLFB 2NPIA 1ZS6A 4IFVB 3DFEA 5LMNF 3CSKA 3MM8B 1H2TZ 2W9CB 1PBAA 3KK3B 2K8GA 4TLRA 2XMKA 1X4EA 2M2BA 2HNDB 1U4BA 3HULA 2XMJA 2GGPB 4F4YA 4WF9Q 3ZNJ1 2OMLA 1FDNA 5KFCA 3L09A 1MROA 3AHPA 4X4TA 5KFHA 1PCAA 1SJ3P 4LFCF 1JLBB 5KFIA 4Y6IA 4ED7A 2HGLA 1R8BA 3Q23A 1NK7A 3PY8A 3LH2S 3MR2A 3B54A 2UXCF 1QAIA 2NCKL 1HBUA 2R4FA 4FF2A 3HLUA 3R1LA 3GFHA 2AX1A 2KFNA 6FD1A 5GADU 4CM2A 3BKFA 3TUZC 2BJ9A 3A3OB 3TRGA 1VQ5S 1TL3A 2DHSA 3WC2A 2A6OA 4K0KJ 1KN6A 2WOMB 1GXTA 4EO8A 1YRTA 4I56A 2V50A 4B9SA 4DPXA 1VS3A 2R7SA 5C42A 3G2XA 3E2EA 3EJMA 2BE9B 1IBCB 2U2FA 2WZ1A 4FKYA 4YDDB 3DLEA 5J2MA 2QA2A 2D3OR 1X5SA 2CPFA 3W5XA 4DV5J 2Q79A 2MB0B 3KK1A 5KFZA 5HVFA 2MZRA 3MMJA 3BGRB 1M5HA 1FWPA 1XC9A 3DCAA 5EWFA 4IRKA 6FDRA 3M2UB 4IFYB 1RHKB 5IT4A 2B0GA 2QL7B 3EGNA 1N6QA 5I3UA 4L6V3 2I38A 4K50A 3GV7B 1TKZB 1TQLA 3JYTB 2VFVA 5EN1A 2QFIA 1QTNB 1CQMA 3WZ0A 5DDRC 5KFMA 1JJ4A 5IS2A 5KG6A 1GMVA 4DN0A 3LP2A 4JI2F 2MXYA 4OYPA 3HI9A 3KDOA 4ID5B 1JLQB 2XZTB 2QL5B 3L95X 3CCZA 2AYMA 2XO6A 3VGUA 4ECYA 4IOBA 4X64J 4BWMA 4OJHA 3PDNA 4RUBA 1T9WA 2CDRB 2B9YA 4G6VB 3TW0A 5K8OA 2DXFA 2W2NP 1YI2S 5KFTA 1U8SA 5HATA 3G8QA 3KLGB 3HFZB 1RAIB 2WONB 3DLGB 3S01A 4RU2A 3AB4B 4M5DA 2WRMA 1R8CA 4B9NA 3I4PA 4CWBA 1HNXF 2G2OA 4JI0F 1IBKF 2RU9A 4IRDA 5ETLA 3Q22A 3PFOA 4DR7J 1RXOB 3BO2A 2QYGA 1YJTA 1RT1B 2R8IA 5D6GA 4FF3A 4R25A 3EDRB 2V6AA 4DFJA 2BBEA 2ZC4A 1TAQA 4NLYA 2X1BA 1NH7A 1VC6A 2B4UA 2B4OA 2YWGA 1PO6A 5H9FJ 2CWKA 4TU8A 2ALZA 3ZZPA 4LIWA 2HGNA 3ZNUA 5CYMA 2V8GA 2F8HA 1D0EA 4WTOB 1WC3A 1KLMB 5D3GA 3CCTA 3L7OA 3RRGA 1S0VA 1Y3JA 4ED4A 1UPPA 1DQAA 5LSRA 2C2MB 1HYSA 1CG2A 2JLGA 4JBCA 2ZVSA 2DGQA 5HBMB 2XS5A 2B51A 1AYEA 1HWJA 3DOMA 4N76A 3I87A 2WB4A 2GZOA 6AT1B 1WF2A 3OVAA 2IBKA 4XTTA 1HI8A 2G9OA 5L46A 4TXSA 2DPJA 1YQHA 1WC6A 1NSPA 3TJ8A 1QM9A 1S1UB 2EKNA 5KG3A 2IRXA 4LF1A 3HKZD 2ZWPA 4ZVTB 4HTIA 1JLAB 1RWOB 5ETTA 4RWXA 4R8UB 2G1DA 4QR1A 4DF4A 3PW5A 1FJEB 1RB0A 5KFNA 1H73A 4J9LA 4NLDA 4KTQA 3FEXB 3AD9C 4DV6J 3OXFA 3CMQA 4C7QA 2YXLA 3BSNA 2V8HA 1R8AA 5E7OB 1T9VA 4DG1B 4K4UA 1J5EF 3ULHA 4JI5F 4A8SA 4ZP6A 1JJCB 1RTJA 3BR9A 2CNKB 2CQ0A 4I6AA 1S9GB 3VALA 2GCFA 2ROGA 2FVQA 3L7UA 2MJNA 2AWZA 3R6LB 1VRQC 2LFVA 4EFAC 2NREA 1BMQB 2NSBA 2EG1A 1ZAWA 2MEWA 1H0HB 3X3UA 2YPYA 1SIWB 4M63A 1NDPA 1QAXA 2RKIB 4OZ2A 1VC5A 3PIPQ 5IT9Y 3MD3A 1HR0F 1BHNA 4KFBA 4K8RA 1RWKB 4PQUA 4JI3F 2XS7A 5IC4B 4B3MF 1QSSA 1UVNA 1NH8A 4Q5VA 1T0TV 2DR5A 3KUHA 3M6WA 4K4TA 2OSRA 2ZHAA 4YQWA 2ZOFA 2PMHA 2JC0A 5FJ4A 1YGYA 4NLVA 4Q0BA 2ZZNA 4C6AA 4RZRA 4GC7A 4DI6A 4LFAF 3OTDA 3ILOA 2AU0A 1I5OB 3QQCD 4OX9J 4ILMA 1TKTA 3VGTA 2HHHJ 1QVGR 5IM0A 3IS9A 5KT2A 2ZZMA 2OHDA 2RRBA 5HLFA 1GXLA 1YDLA 4KHMA 1FESA 4QYZJ 3NNHA 4O0NA 4B3OA 1SKSA 2C22A 4X4OA 2RMLA 1JJHA 1MROB 1VMBA 3HXMA 1VI7A 1WD6A 2H5EA 1UZHA 3M6UA 5M2UA 2OKQA 1AFJA 4CLFA 3TVKA 5MAOA 3L9ZA 1NDLA 4JOUA 3G82A 1FXDA 3CGIA 1HBUB 3UN2A 5A8RA 4JI8F 2N7CA 3BYPA 4ECVA 3RBDA 4KQZA 2DHHA 2J7KA 3R5CA 4LFBJ 4IO1A 4JV1A 2PI4A 4CT9A 1VQNS 1TL3B 2C2RA 2AJ0A 3JTOA 2A3JA 1FA0A 4CQ1A 2AX0A 3CJ0A 5C42B 4WZMA 5KFAA 1HW8A 3PR4A 1SJQA 2J76E 3BSAA 4NLWA 4Q8EA 1B7YB 3D54A 4MK7A 1JKHA 4ELVA 1SKWA 4LRCA 5MLCV 3DLEB 5J2MB 1RACB 3KK1B 1RWUA 2W2MP 1HKAA 5DM6Q 2LA4A 2DNQA 2JJ4D 3CCRS 3M8WA 1DHMA 2MKKA 4FYYB 2ALYB 1N6QB 5I3UB 4PG6A 4MAKA 3HO1A 4D3GA 1XBWA 1EZZB 4QIWD 3VVUA 3H2LA 2XO7A 1YBTA 2IYIA 4B3SJ 2XI2A 1Y5NB 2GV1A 1U0SA 2KI2A 4WYLA 3LP2B 2PA3A 4FS2A 2E1PA 1N5QA 2QZ8A 4OYIA 1GEHA 2K7KA 4X4UA 4CT8A 2CVIA 2L48A 2UV8G 3IWLA 2HZCA 4CO0A 2OPSA 3KXDA 3NOGA 3CUNA 2ACMA 4CO5A 2QLFB 5J1EA 2K1RA 3PV8A 1Q16B 3HDSA 3NG8A 4AXJA 2ROPA 3C2PA 3UVJA 3IM8A 4M5DB 2QO3A 3FZ2A 2DB1A 1P9QC 1Z2LA 2AYBA 2AHOB 1VQ4S 3JB9k 2J8SA 3LWLA 3GILA 2AGQA 2ROEA 3PJWA 1W26A 4EYHB 1WELA 4DOZA 5DLFA 1WKLA 4NEZA 2KDOA 1I1GA 3W1YC 4M5GA 1JJ2R 4NASA 2DT9A 3H5XA 5E33A 4TQSA 5KFWA 3D3BJ 4V19J 3TZYA 4J7CA 4E8UA 4IOCQ 5FDLA 3W5ZA 4CZCA 2AKWB 3PACA 4JI4J 2CJKA 5CYMB 3P4UB 4DV7J 4U8VA 1IR0A 5CD4A 2J6SA 5D3GB 1CJTA 4P2SA 5SZTA 2G0IA 1VBYA 3FEYB 2RDDA 2D3UA 2V69A 4IKAA 1HYSB 1EX8A 1QE1A 3TAMA 3OJSA 1S48A 2ZFHA 5LMNJ 3DOMB 1T7PA 3NGKA 1N56A 4ED5A 2VG6A 1LK5A 3FRYA 2A18A 2B3TB 4CO4A 1RTHA 3VVTA 1WORA 4DL5A 1ZETA 4DU8A 3FK4A 2OSQA 4U7UK 2GFFA 2H5IB 1HI1A 2QMUB 3OL9A 2ZH4A 3LAKA 4ZK7M 3J7YU 1U6ZA 4LFCJ 4HVZA 4NPOA 4RJVA 2MKJA 3C6UB 3UI3A 4QU6A 3OTCA 2UXCJ 1VQ7S 3VAHA 3THVA 4KGZB 3KDNA 2M7SA 2HLTA 5HO4A 3BJYA 4DV4F 3SZ2A 2NZCA 4PPDA 3EZUA 2DISA 2P6SA 5K9FA 2BA9A 4WYWA 3LUYA 4EZ6A 4ZOSA 3PYEA 1U24A 2WVBA 2HVZA 1RTJB 1EIYB 1SQGA 1REVA 3KG1A 4BHQA 4N47A 1KBRA 2MPUA 1UVMA 1ZZNA 1KOOA 1KDNA 4IQXA 1X9SA 4DSJA 4CO3A 3ZZRA 4BC7A 1CJUA 4P2XA 2BUNA 1AB8A 4P72A 2KH9A 1NK0A 5F0UA 5H9EK 2GQCA 2XG8A 1VBZA 2HLUA 1XMOF 3GR0A 3J7AN 1PG5B 5KFVA 4XDCA 3WIVA 3IGNA 3G86A 2NXEA 1ACMB 1DURA 1G3OA 1D8YA 2K06A 3N5FA 1DY3A 3MR7A 4USUA 1L3UA 5L1LA 4KFBB 1UW4A 1NNDA 2NS1B 1UFWA 3VGSA 4BS2A 2PI5A 3LWMA 3A4TA 2GIQA 1FJGF 4B02A 4ZPVR 5F8GA 5DGBA 3PCOB 1XMBA 2COLA 4RUHA 4WP3A 2WHOA 4RNNA 4WP9A 4IG3A 8ATCB 3IMQJ 2ZM6F 1K1SA 3KHLA 1S77D 1NZ8A 3E8OA 4URQU 4RNMA 3V6DB 4Q0BB 3FCVA 1ZBTA 1H2VZ 1IM4A 1RTIA 4K59A 2HZVA 1AZSA 4DWIA 1P9YA 2WBMA 4NRUA 2DVIA 1JLCA 4JI7F 2ZBQA 1FFWB 1S1VA 2VICA 2VA2A 3SQOP 1WTBA 2OEKA 2C3MA 3LQVA 4FF4A 5IM0B 4PG8A 3IS9B 1HNXJ 3H0PA 4JI0J 1IBKJ 2ATCB 2ACYA 5HLFB 1H72C 2PMWA 2XNRA 4ZCIA 4B3OB 5AJ3F 4NZ7A 4ZKAA 2W4CA 2VPYB 2AJ2A 3EE3A 4WFZA 2CUYA 4LF7F 3BBFA 1XNRF 2WSEC 1L3KA 5CCMA 4RUCA 3QSIA 3T6JA 1JXEA 1NDCA 3G82B 4OFZA 3QMQA 3OD2A 3BKTA 2KO1A 5A8RB 4M5IA 4FVCA 3VHQA 3TX0A 2HS3A 3IBWA 1GMWD 1U2RA 1RA7A 4YS2A 3CJKA 1FVQA 2PEHA 1UFLA 1K8AT 1VRUA 3W65A 1VFJA 1HD1A 2CPYA 2W9BA 4Q43A 3GONA 2MLZA 4NMXA 2BX6A 4YR3A 4DSKA 1ZM2A 1FDDA 4I6WA 2BM0A 2HRUA 2B9XA 1EP4A 4HI1A 2YH1A 4GKJF 1Y00A 1VCTA 1JKHB 4NYOA 3S8SA 1UEUA 4F0HA 2J8AA 4LR8A 1FD8A 4KPYA 4NCGA 4MIAA 1X9MA 2X3DA 5LM7E 1RHQB 5F8LA 1F1BB 2FQQB 3I0SA 1RYSA 1U49A 1HHQA 2HHVA 4EBDA 2N3OA 2DEJA 3WX8A 2RS2A 4Y65A 4JP8A 2CNOB 4LF8F 3GB0A 1YITS 4A8KA 1JWWA 2ZBCA 1WWHA 5CZVA 3TQ1A 1HPZA 1EKRA 1KFDA 3W2VA 1P1LA 3OW2R 4K4SA 2RHSB 3JQMA 4U8YA 1WDTA 1S4EA 2GHWA 1L3VA 3BO3A 4UOFA 4EGLA 3TX8A 2RRNA 2V9WA 2G0JA 1J5EJ 4JI5J 1KQKA 1WHXA 5KT5A 1RA6A 3TZZA 4LVOP 3R7NB 4QWDA 2OPSB 3RB0A 2C3UA 5DO2A 1LXJA 2CFXA 2HVDA 2VH7A 1ITPA 3DLLQ 1FX4A 4HDHA 3N9UC 3TA0A 4AYBD 4B17A 3ICLA 3EVOA 5J1EB 2F1FA 5L9XA 1M1HA 2VODA 5JMNA 4C8OA 1PIEA 1WF1A 4OI4A 1NAQA 1HIYA 2VA3A 3LPYA 4CH7A 2OIHA 3UVJB 4MKYA 2DIUA 1RHMB 2W8LA 2RJZA 2O67A 5KT7A 3R5BA 3NMRA 3N5BA 2BJDA 4C8MA 2DNOA 2A2DA 2HHTA 5KFBA 1WOOA 3L4BC 3O1LA 5C5JA 4DPWA 3WBZA 3D66A 2VV5A 1TL5A 4V19X 1U25A 2LECA 1HR0J 3H4BA 1YX2A 3LANA 4JI3J 3P5TL 1CLFA 3BN7A 3R5JB 4L73A 2YNGA 3NS6A 4B3MJ 3B4MA 2DNMA 5FDLB 5HI7A 4NLGA 4QPXA 1SL1A 1RAJA 3NAIA 3KUEA 4DL4A 4ZJLA 2DGVA 1U1OA 1UPMB 2CQ2A 4PPZA 1MU2A 3T1YF 4DR3F 2MKYA 4I69A 3ISNC 3RB4A 3D1OA 3AQPA 1LW0A 3TAMB 3DRSA 1RKJA 4LFAJ 2N7YA 3TOQA 5DDPC 5D4OA 4ED1A 1JNRB 1YVFA 3AOBA 3RAMA 3BDPA 2GMLA 2VG6B 1U6BA 1EHWA 4HHJA 1TFWA 1RTHB 3BREA 1F2HA 1SL2A 3CPWR 4FYDA 2JWNA 2YX1A 1LWEA 2E5HA 1WJ9A 4OX6A 1YZ7A 3D6MB 3GG1A 1TL7B 4K5SA 3FZBA 2DNRA 2YKNA 3T1AA 2K3KA 2C2DA 5KG2A 5I3QA 5ITHA 2PEBA 5F3TA 5DLGA 3Q8VA 5DQHA 4M5NA 3IAS9 4B3TF 4HR2A 4Z7CA 3OTBA 2XLIA 4DZDA 4JI8J 3HF5A 3BH6B 4I2QA 2Y1IA 3UFCX 5E3AA 1E6VA 4AL6A 4GVLA 1B99A 3GYNA 1YJVA 2LQ9A 5EX3A 1N88A 2FJEB 4O3PA 1D3WA 2ILZA 2C2NA 1S0NA 4C97A 4ZPAA 1V9OA 4CLTA 3R5GA 1REVB 3LA0A 2DKOB 2FVRA 4QQBA 2I5JA 1TK8A 2M9KA 5M2PA 4QOTA 1L3SA 3H2VE 1VQ6S 2YY3A 4IG0A 2OJ3A 1WNEA 2RH3A 3V2UC 3T9ZA 3M4XA 2K7JA 5FD1A 4RW7A 1EB0A 4LJMA 2QLJB 5IOLA 2XGQA 3QIPA 1KP6A 4FXWA 5KG1A 4RKUC 2J9DE 1VIXA 2GMJA 3I4HX 3MPVA 4ZDNA 2MGZA 1ZAVA 3V4IA 3AODA 3I82A 2CQ3A 4ZVHA 4X2BA 2NR0A 4Q7AA 5GAGU 3DLHA 2R8HA 1S6OA 4P9SA 2GC8A 2UV8A 2MY7A 3DLJA 4IG3B 4ICLA 4FBTA 3CE8A 3NXZA 2M70A 2ZOGA 2WW8A 2BRKA 3K5NA 4C9DA 2HGMA 2JSXA 2M3DA 2LA6A 1RTIB 5HL7Q 1AZSB 4MKAA 3OBIA 5K20B 1KVKA 5BYQA 1JLCB 1S1VB 2YKAA 2QLWA 4KHPF 2B5JA 1Y7PA 3CCES 1N34F 2E5LJ 1C1CB 3QYYA 4FYXB 4NWBA 5CZXA 3IN5A 1FRKA 3SCIE 3R8YA 1JIHA 1GFWB 3J7Z5 4QR2A 3HVTA 3VCDA 2Z2MA 2OAUA 1NB2A 2HVIA 1EAYC 1NMEB 4P71A 4LQ9A 3F73A 1N8RT 2ZUGA 2EFQA 2QSFA 1UJ6A 3R2CJ 2CDQA 3EVWA 1KHWA 4ZMMA 3CJKB 2HPUA 5D0GA 1HNVA 1VBKA 3PHTA 2IVFB 4QYRA 3IM9A 1VRUB 3N01A 3TNVA 4F4AA 2WVEA 2W9BB 5KFJA 2VFUA 3GR1A 1JLFA 1EP4B 1F0XA 3VQTA 3B8HA 3D3CJ 2GIFA 1HWIA 4KO0B 3SFUA 1V3ZA 2XI3A 2KB2A 1KS2A 4QPTA 1S6UA 1BQNA 3P96A 4J9MA 4NCGB 4P7TA 1NK4A 3HP6A 3I0SB 3AFGA 1MMNA 3OHAA 2MQ8A 1IJFB 4EI2A 3HSZA 3NGTA 4E98A 5JUMA 1HPZB 1KQSR 3W2VB 4FXDA 2NXNA 2V9KA 4DV4J 1DTQA 3QT7A 1OQ6A 3HVRA 2M52A 2DH7A 1OIAA 3K5PA 2RVJA 2JH3A 1T3OA 2LP4A 2OUGA 2IY5B 2N4CA 1XEZA 2BJ7A 2HIQA 4X66F 3DKDA 3CCVS 1FE0A 3TARA 4J9QA 3HHNB 5C2CA 4G1IA 3SFGA 2AMCB 4UT4A 4DLGA 5KG7A 2ZNYA 4Y0FA 2XLJA 4NLOA 1X4BA 2FY8A 2Q3PA 3UD4P 2BZ2A 3I56S 4IUFA 1U02A 1Z1ZA 4OHVA 1T9YA 4IH6A 5F41A
chains in the Genus database with same CATH topology
4B08A 2OMOA 1DLOA 2WONB 3DLGB 3BSOA 3S01A 4RU2A 3AB4B 2FLNA 4M5DA 4QCLA 1GX5A 5T41A 3SCKE 4QIVA 2WRMA 1R8CA 4B9NA 2L41A 2E9TA 3Q24A 4K4XA 3I4PA 3K8VA 4X4SA 1R8PA 1KLNA 2FGOA 2VFTA 4KKOB 3QIDA 1HNXF 4JI0F 2UVVA 1IBKF 3PEHA 2RU9A 3QPIA 4IRDA 2ZH2A 3HFKA 2KT2A 1OSCA 2RQ4A 4QIGA 3Q22A 3PFOA 4ZPBA 4O3OA 5AXKA 4O3QA 1MMLA 1RT1A 2KXFA 3FSXA 4NA1A 4PXEA 3SEOA 1T03A 1FO1A 1HBMA 1DRZA 3F41A 3QWPA 3BO2A 2WSFC 1YJTA 1RT1B 2O01C 4DSIA 2R8IA 1ZH5A 5D6GA 4FF3A 4MFBA 2UZAA 4R25A 2V8DA 4MFBB 4DFJA 1F9FA 2OLWA 1V3RA 2BBEA 2ZC4A 3DLKA 4OJGA 4DF8A 2R7TA 3OL6A 1TAQA 2OPPB 2X1BA 3MM5B 4NLYA 4ELTA 1NH7A 2RUGA 3IR7B 1VC6A 1FXLA 2B4UA 3BO4A 3CD0A 4N5SA 3GE9A 4G1PA 2VBXA 2MMYA 1LOUA 2VKRA 4I2PA 2IC3B 2B4OA 1IQTA 1R89A 3MEGA 2YWGA 2QSWA 4XPCA 1M5SA 1PO6A 1S79A 1RT5A 5H9FJ 3MEGB 4Y2MA 3UNGC 4TU8A 2ALZA 3ZZPA 5U47A 5KAKA 5KFQA 4LIWA 3RU0A 3BZQA 2HGNA 5CYMA 2MZJA 3KLIA 2NQPA 1VQKS 4OZJA 1R43A 2V8GA 5KFFA 2F8HA 1MU2B 2KM8B 4UUXA 2DHAA 1D0EA 3CDEA 3MUTP 4HT7A 3P49B 5B0DA 1C1BA 3DYAB 1KLMB 2E5JA 3QJPA 5D3GA 2LQBA 1HHTP 3CCTA 3THTA 2Y1JA 1ZOTA 3L7OA 3RRGA 4M8LA 1ZPWX 1XERA 1LW0B 5LXRA 3DRSB 3OJUA 2YX4A 1S0VA 1X8DA 4WXOA 2AGOA 1Y3JA 5L9NA 1DQAA 3MFHA 3QZ7A 3CIMA 4F3MA 5AE2A 5DJBA 1RKIA 5LSRA 4ECXA 5B0GA 3A8EA 1HYSA 3MD1A 1CG2A 1R6YA 2JLGA 1N5YA 1DARA 2XMWA 4F4ZA 2KXHA 1RTDB 4JBCA 2ZVSA 3CWJA 3U27A 2DGQA 1L5UA 5HBMB 2XS5A 2CPEA 2F8EX 3I9ZA 2B51A 3LP1A 2HHSA 5HP1A 3GIIA 1HWJA 1KQGB 3PX0A 3DOMA 4N76A 4I7FA 4H54A 5KG0A 2AJQA 3ETOA 1HBOB 2BV3A 3I87A 2RQCA 1S1TA 2WB4A 2AJ4A 5E3CA 3FSIA 1D9AA 4Q2LA 1WF2A 3MPYA 1T94A 3OVAA 2BQUA 2IBKA 1IBMF 4YFUA 3QLHB 1Q7LB 2VBYA 3CCUS 1LWEB 4B9LA 4H4OA 1HI8A 2G9OA 3ONQA 3T5JA 1D9FA 1NHVA 5B0CA 1S0OA 5CHCB 1BD6A 2R7VA 3SSRA 4TXSA 2JEGA 5KFPA 3D5MA 3KJVB 2DPJA 4FS1A 1ULRA 1TV6B 1YQHA 3OXGA 2JZ5A 1FEHA 3MAQA 2YKNB 1FERA 1S1UA 3NNAA 4ED0A 3H40A 1LWFB 2RQKA 4LQ3A 1QM9A 1S1UB 4DR1F 1APSA 5F8JA 3TUJC 5D77A 2YKMB 2W25A 2IRXA 3HHLD 5KG3A 2KZZA 3HKZD 3DRYA 1K1QA 2XCAA 2LLZA 2RF2B 3C3LA 3HHKA 3SCLE 3IWXA 4QWCA 3DM2B 3CIZA 2LU2A 5B0BA 4PUOB 4HTIA 3LOUA 4TLQA 4CO2A 4QU7A 4DPOA 2JVRA 3N6MA 1R7IA 5LSOA 2CJAA 2RILA 1JLAB 5DG8A 4DL0C 5H9EJ 2OPQB 1U2FA 1HARA 2VPZB 3J7YI 4I2QB 3I5AA 2EI5A 2APOA 2ZH6A 2VOOA 1KVJA 2QT7A 1E6VB 2DH9A 1FKPA 2G1DA 4QR1A 4RWXA 1HNIB 4R8UB 4DF4A 3G4SS 3PW5A 1UA1A 2UUCF 4B3SF 3D28A 2AYGA 2MZTA 1FJEB 2YQ3A 3MEDA 5KFNA 1Z4UA 3M6VA 4F3QA 2KKHA 2XLKA 2HVHA 4J9LA 4NLDA 4KTQA 4WE1B 3L7PA 3FEXB 3IR6B 3OLBA 2BR0A 3OXFA 3VF0B 4C7QA 5HQ8A 3BSNA 3FSYA 2V8HA 4QW8A 3PVXA 1R8AA 4NLUA 4NOHA 3BR8A 5E7OB 3GSDA 4F25A 1X9WA 3CC7S 2B9WA 4DG1B 4K4UA 3O2IA 1J5EF 4AL7A 1FRMA 1RQ0A 5KFEA 3ULHA 4JI5F 4NL5A 4A8SA 1ZYQA 2DHXA 3OFGA 3VAMA 3I6PA 2CZ4A 4ZP6A 1RTJA 3PZPA 3NKYA 2FDNA 3BR9A 3NS5A 3R27A 5BYSA 4A8MP 2CQ0A 3AJ2A 1H98A 2R7RA 4Y28C 4I6AA 2ZD1B 2I5JB 1GQEA 3BM7A 1JLEA 4TY8A 3MM9A 2CPIA 5L1IA 2J6UA 5E0OA 3RRHA 1YJ9S 4BDPA 1JB0C 1S9GB 4WU3A 3MMBB 3NBPB 3VALA 2GCFA 2ROGA 2FVQA 2DGWA 2VFSA 2V4JA 5J1NA 4KIAA 1N33F 1JMTA 2MJNA 1RI7A 3MTKA 2AWZA 4IG0B 4NX9A 3LP0B 2HYIB 4AL5A 2WCXA 2IRUA 2IJFA 2L08A 2VFRA 4CNYA 1U1QA 4A4JA 2FTRA 1F5CA 4FPRA 4EFAC 4PWDB 3CD5A 3N6NA 3OR1A 2GA7A 3HM9A 1U26A 2DR7A 5KG4A 2YVSA 3OR1B 2NREA 3BF4A 2NSBA 1V3SA 3AA8A 5GAHI 1PC5A 2MHNA 2KRBA 2EG1A 2P6TA 3FGVA 5KFRA 1ZAWA 1H0HB 4RW7B 1F60B 1TK5A 4ETZA 3UE2A 4LMZA 3X3UA 3MOZA 4WK1A 3UCGA 4NLTA 3W3SA 3OTEA 4RU9A 3KMQA 1HQEB 1PC4A 5CA5A 1FNXH 2BANA 3ENVA 3HKWA 3QIPB 1SIWB 4M63A 3D0GE 2XY7A 1R3NA 3MM6A 2PMZD 3NCRA 5IZHA 1BQMA 1QAXA 2RKIB 3KNGA 4OI2A 1VC5A 1LQ9A 2OPRA 3CDAA 2MKIA 2MJUA 1UVIA 3FNNA 1BQMB 3HX9A 2JC1A 2RD5C 1LW2A 3PIPQ 4KJIA 5IT9Y 3MURP 4C2MA 3I0RA 1WHWA 1M0SA 1HBNA 5BR8F 2MGZB 2KFYA 2DD8S 4DL3A 4N8NA 1ELOA 3MD3A 2KYXA 1SJRA 1M5OC 1HR0F 4NRTA 3PW4A 4KFBA 3J7ZT 2B7CB 1S10A 1HA1A 3DRRA 3BN4A 1N4LA 2EK1A 2NSCA 3V4IB 2L9DA 3ISZA 3HZEA 4PQUA 2VASA 2UP1A 3EPGA 4JI3F 1C0UA 2VPXB 2XS7A 2DTJA 2BQ3A 4HYKA 4PQUB 3HMJG 4U9RA 3V5RA 4B3MF 1QSSA 2KG0A 5CD4H 1UVNA 2CQBA 1NH8A 2G4BA 4Q5VA 4IOAQ 2DR5A 3D0HE 2HNZA 1X4HA 3M6WA 4K4TA 2XNQA 1FTRA 3FFIA 2VONA 2OSRA 4LSNA 1FDBA 1T95A 4ICLB 2ZHAA 1LKZA 4YQWA 1TZ0A 3CCLS 5J2NB 3M32B 2WTFA 2DNKA 3EXYA 2ZOFA 2W4PA 1SUQA 2PMHA 4DFKA 1JLGA 3AA9A 4UW2A 2JC0A 4RW9A 5T7LA 4ZVEA 4PG7A 1U1KA 1JLGB 2J7UA 5FJ4A 2MZQA 1YGYA 4NLVA 3DU6A 5J2PA 3MEKA 3D1HA 4ALZA 3PX4A 4H4KA 5K5MA 4Q0BA 3TO8A 2LCWA 3LF0A 4Y3CA 2ZZNA 4Y2KA 5A0YA 1VK3A 4RZRA 4GC7A 2F9JA 4Z2XA 4LFAF 1AXQA 4R0EA 3LO3A 3OTDA 1NZAA 2UU9F 1A9NB 4LF5F 1IKYA 1VK8A 2AU0A 2K3IA 4C0OC 1TKDA 4ZLPA 4J37A 3H8YA 4F02A 1BC6A 4C11A 1N0VC 2JLEA 1RK8A 3BEGB 2B5JB 3DDNA 2QMXA 2YKPA 2LXIA 1FNOA 3U02A 1X0PA 5HN0A 2CQCA 3HK2A 1RT3A 2Q43A 4ILMA 1TKTA 5KFDA 1OO0B 2HAIA 2J9DA 3HHLC 2ZJQQ 4EBEA 2W24A 2GW8A 5IXUA 1TKTB 1FTCA 1RT6B 3DOKA 3FQKA 1QVGR 5IM0A 2C3OA 3HJFA 3IS9A 5KT2A 2ZZMA 2RRBA 2VG5B 4ZHRA 1IUJA 1FCAA 5HLFA 3QJJA 3UW1A 3OFHA 1GXLA 3SDEB 2JEJA 2VB6A 4B9TA 4KHMA 1FESA 4MTPA 3KHGA 5DM7Q 1H3DA 4QYZJ 1XNQF 3NNHA 1O8BA 4Y2AA 3HVTB 1T3NA 4O4RA 4B3OA 5KFGA 1SKSA 4NZ0A 2YWKA 1GTHA 2C22A 1NRKA 4AUKA 2E66A 3LGMA 4X4OA 2XEXA 3UCZP 4O3SA 2RMLA 1Q79A 4C8KA 1JJHA 1MROB 2ASJA 2UUAF 1VMBA 3HXMA 2ABYA 3AJ1A 1LFWA 1VI7A 4OL8A 1FKAF 4MK8A 1WD6A 2H5EA 5G0RA 2R2SA 2XMUA 1MWZA 2OKQA 3M6UA 3OR2B 5M2UA 1AFJA 4EZ9A 2E29A 4KHRA 1AUDA 4K4WA 1TFYA 4OIXA 3TVKA 2FHMA 3DGPA 2MYFA 1QY7A 2ZDOA 3DHWC 1S1WA 2UXBF 5MAOA 3CDWA 1X0FA 4JOUA 3AB2B 2Q1LA 1FXDA 3CGIA 1HBUB 2QV6A 3BSCA 2ZH3A 4LF6F 2RDIA 4RW6A 5A8RA 4JI8F 2JFDA 5KFLA 2N7CA 4PG4A 3QAEA 2EFOA 4ECVA 2OFGX 1HNVB 3RBDA 1YG0A 1NO8A 3EX7B 4F2SA 5L8RC 1KSPA 4KQZA 2J9CA 1D1UA 3KTQA 2XZWA 3SYZA 3KKFA 3WDOA 1UETA 1VIOA 2J7KA 2FHKA 3R5CA 1HFEL 1SV5B 4IO1A 1PILA 1HNZF 1WEYA 4JV1A 4O44A 2PI4A 5BYRA 3T6BA 4K2XA 5L1JA 4CT9A 1VQNS 4X65F 2DNHA 1TL3B 3OQ2A 4XIUA 1YJNS 2C2RA 4NYPA 1TKXA 2ZE2A 1RT7B 1JLFB 3ITHA 3KG4A 2AJ0A 1FD2A 1TVRA 2X3GA 1RGVA 3JTOA 3G8TA 3H5YA 2A3JA 1FA0A 2ZE2B 4NLQA 4EEYA 5DG7A 3M2VA 2F40A 4CQ1A 1NJZA 2OTJS 3T5KA 3CC4S 2UVUA 3KK2B 2AX0A 3CJ0A 2BE2B 3L3CA 2C42A 2HHPA 5C42B 4WZMA 5KFAA 1HW8A 2R7OA 4O0IA 3MDFA 3PR4A 2N3LA 1SJQA 1X5TA 4DR5F 1Y9OA 2J76E 3BSAA 3MM7A 4NLWA 1J5OB 4Q8EA 3CO9A 1NJYA 4EBCA 2XSJA 4NXNF 1F2GA 3D54A 3FJ2A 1BQNB 4MK7A 4YY3F 1GH8A 1JKHA 3PKMA 4ELVA 1YRXA 4PXCA 3RTVA 3S6EA 2D74B 1SKWA 5MLCV 3MMCA 3DLEB 5J2MB 3JSYA 1R8HA 1UVJA 3NRBA 5KFUA 3FVYA 3MMCB 5I42A 1U48A 2P9EA 1HMVA 1WTFA 1RWUA 3KK1B 1ZZFA 4M95A 2MKSA 3PM9A 1SIZA 2HWIA 5B7WA 5DM6Q 2LA4A 4ZCLA 2DNQA 4FBUA 5A8WA 4UY85 2JJ4D 3CCRS 4JYAF 1S0MA 3MR3A 4JI4F 2KG1A 1DHMA 2V4QA 3CCWA 2DNLA 5C24B 1VQ9S 2E5GA 5D8HB 1N36F 2MSTA 2IM0A 3DI6B 3DXBA 2MKKA 3CULA 1YHQS 2MZSA 2KJWA 2FC8A 5I3UB 1HWKA 1OS5A 2RQMA 4PG6A 4ED6A 1S9FA 1N6QB 4NMLA 4MAKA 1XR6A 2HHXA 3UDCA 1U1MA 2UXDF 3T3FA 1SJ4P 2NYIA 2R7WA 1WHYA 4DFMA 3HO1A 4HH1A 4D3GA 2WB1D 1XBWA 2OH2A 2ZH8A 1S6QB 5E2QA 1NJIT 4QIWD 5D4PA 4DR4F 4R0JA 3MOJB 1DTQB 4DL7A 3H2LA 4ILRA 3M1VA 2JL9A 3N79A 2IYIA 2XO7A 2XI2A 1Y5NB 2IM2A 3JAMY 2GV1A 2KI2A 3I5BA 1YBAA 4WYLA 3LP2B 2PA3A 2L9NA 3J80Y 3MEEB 1MW7A 4O4GA 2C3YA 2W7PA 4FS2A 3DLBA 4DR6F 4DLEA 1UWBA 1Y5LB 3PXGa 3ZZZA 1N5QA 2QZ8A 5KT3A 3OL7A 2YNFA 2K7KA 4X4UA 1X4CA 2KT5A 4LIRA 1VLYA 2GJ2A 3AAWB 3UR0A 4CT8A 4EWTA 1AW0A 4QWAA 4QR0A 5L1KA 1TUVA 1KD1T 1HD0A 1FK9A 4DBQA 4R5PB 2XHWA 2CVIA 2L48A 1N5VA 1RP5A 2QLXA 3TAPA 3GV5B 2UV8G 2B6AA 1M5PC 3IWLA 1HQUA 1RJJA 2F7VA 4NLXA 5LT5A 4CH1A 1UVKA 2HZCA 4ZVFA 1RT4B 4CO0A 2YNHA 1B64A 2OPSA 4MYUA 3US5A 4JV2A 1DTTB 2FD2A 2YNHB 2BQRA 3M30A 3PNIA 3CUNA 5F9LA 1FRXA 4RNFA 4J9OA 3M30B 3U1MA 4CO5A 4KBIA 1ROFA 2DGSA 3I31A 3QZ8A 2R9LA 2KXNB 1XK8A 1WEZA 1GTEA 4ATNA 5J1EA 2K1RA 4PR6A 4USHA 2ZJPQ 1Q16B 3PV8A 3SSSA 3K2YA 2K1RB 2Q6BA 1VQPS 3HDSA 1TP7A 2DNZA 3NG8A 1BQXA 3ZZUA 4AXJA 1LV5A 3PO5A 3Q2SC 4YDXA 2ROPA 4YHHF 3C2PA 4G1QA 1ZM9A 2U1AA 3PHEA 1DLOB 4DQRA 4M5DB 2FLOA 2QO3A 2EKYA 2IA6A 3KFWX 1FXRA 4HT5A 3FZ2A 1H2UX 4DS4A 2DB1A 1P9QC 4RW4A 1Z2LA 2HQIA